5BR8K

Ambient-temperature crystal structure of 30s ribosomal subunit from thermus thermophilus in complex with paromomycin
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
117
structure length
117
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
publication title Ambient-temperature crystal structure of 30S ribosomal subunit from Thermus thermophilus in complex with paromomycin
rcsb
total genus 26
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2015-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 5br8K00
1J5EK 4DV6K 2ZM6K 4DR4K 5FLXO 4DV5K 1IBKK 4B3TK 4YY3K 4DV4K 1HR0K 2UUAK 4X66K 4LF4K 4B3MK 3J7AP 3J7YP 4DR3K 2UXDK 4JI5K 4K0KK 4DR5K 5IWAK 4DV7K 2E5LK 4LFBK 5LMUK 5A2QO 3T1YK 4JI1K 2VQFK 3T1HK 3JAMO 1N34K 4DUYK 1HNWK 4DV0K 3J81O 4X64K 4JI3K 2VQEK 4DV2K 4GKKK 4KHPK 4JYAK 2F4VK 5LL6Z 4DR2K 4JI6K 4YHHK 1HNXK 4CW7B 4CVNE 4LFCK 5IT9O 1XNQK 4X62K 4GKJK 4JI8K 4LF6K 4JI7K 4DV1K 5LMNK 1XMQK 4B3SK 2UXCK 5AJ3K 5BR8K 4DV3K 4LF8K 1HNZK 4V19S 3J80O 1IBLK 4JV5K 4LF5K 4DR1K 1XMOK 4NXNK 1XNRK 4JI4K 4JI0K 4LFAK 2UUCK 4DR6K 4LF7K 4NXMK 4JI2K 1FJGK 3OTOK 4LF9K 1N36K 1I94K 4AQYK 2UUBK 4DR7K 4B3RK 2UU9K 1IBMK 1N32K 2UXBK 4OX9K 4X65K 2HHHK 1N33K 4DUZK
chains in the Genus database with same CATH superfamily
3HSTB 3CF5L 3LL3A 1S1XA 1VSIA 1JLGA 1IBKK 1MWMA 3MEDA 3G10A 4M3XA 4CJUA 4DTRA 5AZJB 2A40A 2CH5A 3CETA 2I5JA 2QWLA 4B3MK 3M8PA 3AGRA 4H5TA 4O8KA 4CEAA 4C8KA 3NF7A 4FJNA 3C95A 4CJLA 3OJUA 3WXLA 4FLWA 5BRHA 3SCXA 4HUGA 4FM0A 3VQEA 3B8AX 1UWBA 2D0AA 5E41A 1K6YA 1NK7A 1VQ9N 3DLGA 2Y1IA 2VG5A 1NBWA 1G99A 2W6KA 1VQ7N 3M8SA 1QZ6A 4CEDA 3DXKA 1YVNA 2CGLA 4MO4A 3UIQA 4E1JA 4B9SA 1VQ4N 3QB0A 4MQ3A 5KRSA 4FWMA 5HRSA 3CG7A 3SV3A 2XY7A 2NRTA 3H3OB 1QSSA 2PYLA 4JLHA 4OPKA 1JLQA 2KFNA 3FLCO 4FXDA 2NRVA 3PO4A 2XY5A 2AJQA 2GWKA 2KLAA 5B8HA 2BDPA 1NGJA 2NLXA 1RT2A 1C1AA 4B3OA 4DF8A 2FSJA 4M63C 4KH6A 4V19S 2O8BA 3KIOA 3THYB 5CYMA 3LDQA 4HWIA 4RW8A 4BWMA 4FLZA 4LF5K 4H5VA 3ZT0A 1EETA 1YXQA 1ZBLA 4BQZA 1NOZA 3P5JA 2Q2RA 4FWNA 4Z4HA 5CHIA 1BA1A 4F8RA 1C0TA 3HBTA 2VGNA 2E88A 3HOTA 4N76A 2X6SA 4BG9A 2P9UB 4B3RK 1RT6A 5HOOA 3EKSA 4GMJB 1T7PA 1S9GA 2UXBK 2PYJA 2XO7A 3MCPA 3IS9A 5MLCQ 3KZBA 5I3UA 4FJGA 4OGCA 5AQWA 3JYTA 2JGUA 2EHGA 4YOYA 3G0ZA 2ITMA 2CH6A 4IOCL 1QSYA 1U45A 3FZMA 3ZSQA 1XQSC 2IIRA 4CHZA 4DS5A 3CI5A 1EKEA 4KHSA 3GDQA 4AHSA 3CFRA 5GIOA 3ENOA 4FWLA 4KHQA 5EOYA 4NCAA 4CBWA 5LMUK 4NO7A 3AO4A 3OYAA 3G4SN 4AHCA 2D4WA 2V7ZA 1ZBHA 4CJFA 1HMVA 3TSQA 3QIPA 3MWTA 3LZJA 4DV0K 3DRPA 4KI4A 2F9WA 4FK4A 1M90O 1HYVA 1ZBFA 3CFPA 2HW3A 2O4GA 1U2VB 3TAMA 3KD5E 2Q31A 2WBNA 1VQNN 4CGGA 5LL6Z 4DSEA 3OYMA 1A5WA 4WFAL 4JI6K 4KBOA 2D0OA 3THWB 4CW7B 3QEPA 3FZLA 4C8LA 4ELTA 2VG7A 3OYJA 2HHUA 4ILJA 4J2BA 3HOSA 2ITGA 3CJ9A 4QAGA 1WSHA 1RDBA 3BY5A 5LMNK 4W5NA 2RKIA 1HX1A 4Q5VA 4IOXA 3VEZA 4A5AA 3TWHA 1U6ZA 4UQGA 4LC9B 3HP9A 4FZZA 3VQ6A 1NWKA 1Z6RA 1Q9XA 4JK7A 2CGKA 4PKIA 2FSNA 4O55A 2W40A 4JV5K 4B9UA 1QVFM 2DFEA 3CMEN 3CCMN 3HVRA 4BRMA 4JI0K 1UOCA 3KK3A 3MDQA 3PX4A 2HHTA 1NNEA 3O9RA 3H1QA 4CD1A 1WSIA 4KHWA 3ZETB 4DR7K 2NZTA 4CHOA 3MMVA 3OJSA 4NCBA 3OYDA 5DK5A 2P9PA 1RTHA 1OH6A 3L4IA 3WNHA 2O8FA 1BHLA 1FXXA 4BC3A 3HPHA 3AVAA 3OVNA 3NH0A 5BN9A 1WBDA 4H0OA 1NGEA 2YNGA 3QFUA 3AARA 5AQXA 3VTIA 3CXCM 4DTNA 2KQ2A 1GLAG 1VQMN 3LZIA 3VQPA 4JKGA 2GELA 3DYAA 4BRPA 2P9KB 2NRWA 3ENHA 4J2EA 3CJAA 1WBBA 3TPQA 1I3AA 5F2RA 3T1HK 4IDKA 1JLCA 4CERA 4I9QA 1GLEG 3W0LA 2HF4A 4YDUC 4DB3A 3A8YA 3RRGA 1S1TA 4GKKK 2G8VA 4CZKA 2E4LA 5AQPA 1WSGA 4AHRA 2HNZA 3A2FA 1TL1A 1DLOA 2G8IA 5AZIA 1KQSM 2HNDA 5LJVA 2X74A 5TKWA 3KLGA 2Q1NA 1HRHA 1LCUA 1T6DA 2GBZA 3L3VA 3PIPL 2G8UA 3OYKA 3SYZA 2NRXA 2WFBA 1L3SA 2OZSA 2O8DA 3IRXA 2KTQA 5J2NA 2OZMA 4EZ9A 4CJ5A 3QERA 4B1XB 3DAWA 2D0PA 1A5XA 2E6MA 3CC2N 4K41A 1MDUB 4DSFA 1S3XA 2IVPA 3AVMA 4DQQA 2QWMA 1P90A 2ZQBA 4DQPA 1XNRK 2HHWA 3I0RA 4JKFA 2P5OA 1N5YA 4E7JA 3WXKA 5HRRA 4FWSA 2HBLA 3ZT1A 3ZT2A 4AQYK 4B1YB 3UB5A 3LDLA 1BG3A 2D0BA 4DU1A 1N32K 5C25A 3KK1A 3C0BA 2O8CB 4DTJA 2Z1GA 5EU7A 4A61A 4DQIA 3A0IX 1J5EK 2YCHA 1RBVA 4H8KA 4PL8A 3ZT3A 2JWKA 1K8KB 4B8CA 3OS0A 3PLAA 4LY7A 1QQMA 3SPZA 3OBWA 3C65A 2A1SA 2D0CA 4H4OA 2YKNA 4JHDB 4FJ5A 1YI2N 4YOVA 3VQCA 4CEFA 5C10A 2E5LK 3DOLA 2HSTA 4U7BA 1LAVA 1C0GA 4GV3A 4WE1A 3BP8A 1S1UA 4Z4IA 4PUOA 2P9LB 1ZYQA 3EY1A 3HI0A 4CBXA 4YOUA 4FW2A 3H45C 4DV2K 2J4RA 2E2NA 2QWQA 3D2FA 3DOKA 1GLFO 2W41A 4PKGA 4QCLA 4JS4A 1RFQA 3O4NA 2V52B 3WQTA 3LP0A 4BVOA 3ULEA 3NH1A 3HK2A 2GUIA 4OVLA 4KRFA 2IVOA 3WEEA 4I2PA 3SBGA 5GAGP 4IFYA 1TAUA 1D8YA 1VK0A 4RW6A 4F2RA 4AHTA 1TKZA 4BDZA 3R3LA 4BRDA 3F2KA 4A2BA 1Z25A 3AA3A 3VF6A 3NVMA 1D9FA 3IMXA 3HZ6A 4FWOA 4KHYA 3H46O 3OYNA 1RT1A 2VYPA 5CZ2A 1IV0A 3KK7A 1IKVA 4B9LA 1SQKA 5BRFA 4CGDA 1S22A 2XY6A 1J9AA 1DTQA 3TAPA 3RTVA 3ZEUB 1EWRA 5HRNA 1BI4A 4FLTA 2E2QA 4HCCA 4KB0A 2ETJA 3RWUA 2QI2A 3SMPA 5M1PA 3I33A 2BTFA 4IZ9A 3CQXA 4JK9A 3L3UA 4IO9L 3I8BA 3TAFA 1S1WA 5AQNA 5AQOA 4E0DA 3AGKA 4MLHA 1HR0K 4M3UA 3V6DA 4OPHA 3S41A 3MN6A 3KWGA 3NBPA 3QEIA 3I0SA 2G8HA 5DM6L 3KK2A 4XIUA 5EXWA 4O0JA 3K0SA 5AQHA 4KV8A 4JI1K 3ZLJA 4KHNA 2VQFK 1KAXA 1K8AO 1HPZA 4ZHRA 4JEPA 5C15A 1NJXA 3HT3A 2I7PA 4YOWA 1SKSA 1D4XA 4KH4A 1S6PA 3K2PA 3OS2A 5KTQA 2IAJA 4W5QA 3OYCA 4GW6A 1YTUA 4BR5A 3OYEA 4CZIA 2QWRA 4BE2A 3LPUA 4EFHA 2P9IA 3CJ7A 1WNSA 1DT9A 3O9SA 3FZFA 4X62K 1Q18A 5HLFA 4JKDA 4NYFA 1TAQA 1BDGA 2XHBA 1VSKA 3CM6A 4CHNA 4E7LA 3CCVN 1S9EA 3VGKA 4B9QA 1BA0A 4B1WB 2YNHA 4AH9A 3L2RA 2F8SA 3C94A 2G8WA 2QWOA 4Y1CA 4PHTX 4JI4K 2IVNA 1RDAA 4DQ8A 4IJAA 3SAFA 4CESA 3THXA 1FJGK 3V81A 2A5XA 3UKUA 1YIJN 3MXIA 4DFKA 3R6MA 1X9SA 5J2QA 2HVHA 4M45A 1IBMK 1ZXOA 2VWJA 3M5RA 3SLCA 2E2OA 3ZSVA 3P39A 4FLYA 4H0YB 1KFDA 3UE5A 3S3NA 3THVA 1YHQN 4FJLA 5BREA 3VA0A 2YHAA 5BN8A 3J7ZO 1R59O 3EEQA 4MDAA 5K14A 2IC3A 3J7AP 4C8MA 2Q0RA 3R1XA 4PWDA 1HJOA 2I7NA 1Z05A 4I7FA 3WT0A 1YVUA 4C8NA 3OS1A 1DKGD 5JS1A 4OPJA 1YUWA 4BRGA 2A41A 1TYQB 2RF2A 4ISEA 1NJZA 1VSMA 1EO1A 1Q81O 1RBTA 3CCJN 1WLJA 2BE2A 3LP3A 4DFPA 3ALYA 1WSJA 1ZBUA 4BGBA 3FZHA 3O3FA 4LSLA 3DXMA 5AQJA 4F9OA 3PSFA 1NK0A 4M3YA 4H4MA 4YHHK 2YHYA 2WTUA 3PV8A 3IUCA 1KRPA 1W97L 1NGHA 4CGJA 1RNHA 3DJCA 4FZXC 2QKKA 5KPRA 4DV1K 2O4IA 4AHVA 1OVYA 1XMQK 4CF0A 2UXCK 1LAWA 1W2BM 1WSEA 1CXUA 3V9SA 3PO5A 1C0MA 3HYFA 2RPIA 3UKRB 3LM2A 5CR4A 4JNEA 1LOTB 4G9ZA 5F0XA 2QWPA 2D1KA 2E1YA 3I8DA 2XY8A 3O9UA 2P1JA 4HUFA 2DPNA 2GUPA 4DWIA 3V9WA 1J5OA 3GOIA 2HNYA 2P9SA 4LF7K 3D2EB 1X3MA 3A5LC 3OTOK 4O44A 1X3NA 3OYHA 3AAPA 3MX2A 1VQ6N 3ZX2A 1L3TA 2ZWHA 2VGMA 3HSCA 4Y0WA 3VEYA 3VF2A 4CF9A 3OYGA 3SUOA 3CCSN 4BC4A 2D5RA 3CQYA 3SUQA 4FWQA 3SQ1A 3K5NA 5FLXO 2F8TA 5DMRA 1HLUA 4M3RA 1RBRA 2UUAK 3S3OA 5AZJA 1BCOA 3DLLL 3SAHA 4FW1A 3R9PA 3ZSYA 2UXDK 1GLJO 4M7XA 1NMNA 3U6FA 4BY9C 2GV9A 3HRGA 1XUPO 1KCFA 4B9NA 3NE6A 4WQ5A 3IAYA 1TK8A 2X6NA 1L3UA 1IG9A 3AVJA 1SL0A 2P9NA 1BIZA 1DTTA 2EX3A 4GVMA 4ILGB 1VQPN 2IS3A 5I9EB 2VWKA 5JVHL 1NK8A 3AAQA 4M3WA 3VQAA 3V9XA 1B92A 3DI6A 1GOBA 3HL8A 5M1NA 3D0PA 1S6QA 1KVBA 4CJEA 4DHYA 2WC9A 1C1CA 4CJTA 3K5MA 5AQVA 3G6EN 4J2AA 3LWMA 5AFUA 1TV6A 3V9ZA 4WQ5C 1NJIO 4BRCA 1KTQA 4LSNA 1LWEA 1OH8A 3NGZA 4OLBA 5AFUH 3U9DA 4PY5A 4TSXA 4Z4FA 4DQSA 3TSUA 3O08A 4O4GA 1XC3A 3BZKA 4RG8A 4FZYA 3VPZA 2DFFA 1NGIA 4E19A 3O6WA 3THYA 1XMOK 1DGKN 1GOAA 4BR9A 4YORA 5AQQA 1IG8A 1RTDA 1VQ8N 3U8XA 5HL7L 1RDDA 3SUNA 1OVQA 1FKOA 5D3GA 3JSMA 4DKWA 4CJWA 1I94K 3OYFA 3L8BA 2G8KA 4M42A 4BACA 4KTQA 3KTQA 1ITGA 2IOCA 2P9UA 4CJPA 4WFBL 2HHHK 3NVKA 3F9KA 3G71N 1VQ5N 4WCEL 4JRQA 3G25A 4IG3A 3L0QA 3ATVA 1NJYA 3ISNC 3AO1A 4YY3K 4DU3A 5GINA 5AQKA 2QTDA 3VEVA 4E1MA 4YOTA 5AQYA 1LWCA 3AO3A 3AVBA 4FJIA 1OKJA 4BRFA 3MN9A 3OW2M 1S5JA 1JLAA 3HPOA 5FDLA 3LDOA 4M41A 5HRPA 4ILHA 3L2QA 3VQ4A 4YDUA 4CJ7A 4DLGA 1BGXT 2E6LA 5GAHP 5ELZA 2PBDA 5C24A 5HBMA 4IDHA 3O1BA 1UA0A 1QSLA 1IKXA 4HTUA 1HJRA 4BROA 3TARA 5CZ1A 4CZEA 5KRTA 4L8RB 5FPNA 3WXMB 1VHXA 5KGXA 4BDPA 3DLRA 4FWKA 1YJ9N 3FFIA 1XC9A 3SUPA 3VF4A 4GKJK 3RMBA 4DFMA 2FF6A 4JI7K 1RGIA 4B9MA 4DSLA 5AQZA 3RVCA 5AQSA 4CHYA 2NNWA 4JKCA 5AJ3K 1JLBA 3MECA 1NOYA 4YNQA 1NGGA 4ZTJA 2HBJA 4CJKA 3F73A 4LF8K 2HBMA 5FRNA 4A2AA 3TSPA 3J80O 4K42A 4OGEA 4CJSA 4CZLA 2ASPA 4FJKA 1Q7YO 2Z1HA 5EX5A 1TKXA 2P51A 3RSEB 2UUBK 2PZSA 5H1SQ 1E4GT 4BGAA 4W5RA 4F3TA 3O80A 2W6LA 3P31A 4ZTFA 3I56N 2OA8A 4N41A 5KI6A 3L2VA 2F9TA 3CD6N 4GY2B 2HHQA 4FPAA 4FLUA 1SAZA 1QZ5A 4Y1DA 5KQDA 1JL1A 3MX5A 4B3TK 1IKYA 1FKPA 3D2FB 3K9KA 4CBUA 4FO0A 3SMSA 4H0TB 3SV4A 3VN5A 4FJMA 4ID5A 3LDPA 4K0KK 5IWAK 2EWSA 5BPMA 4BWJA 4DV7K 3HVTA 4AHUA 3QNNA 3C6TA 4C1NK 3MK6A 1HKGA 2P9KA 3LP2A 5C42A 3HJFA 4LD0A 4KH5A 3M1FA 3WEEB 3SZ2A 3RMCA 4CHQA 3O5BA 4BRNA 2HMIA 3J8AA 3O4WA 4XEIA 1SV5A 5AR0A 1C6VA 1NM1A 4ELVA 1TUYA 4DR2K 1IO2A 2GTDA 1GOCA 4B9VA 5AQFA 1Q9YA 3CCLN 5IT9O 1RTJA 3A5MC 1ATSA 3P1GA 3K59A 4GNIA 3ZSWA 3EYZA 4BRQA 1VRTA 4JK8A 3U4LA 5I42A 4RW7A 3SQ0A 3A5NC 1N8RO 2B6AA 1BI4B 2ATQA 5GADP 5CYQA 3VQQA 1ILYA 1U48A 1EXQA 4CZMA 3K9JA 4KHUA 2O8EB 4QS8A 2FC0A 5BPLA 2WOMA 4C23A 3TAQA 5C2DA 1EX4A 1SL2A 4NYNA 1NKCA 3NDKA 2Q36A 2OANA 3AY9A 2DFHA 1UA1A 1NG9A 1B9DA 4CGFA 2QXLA 1RBSA 4IXCA 4XH5A 1J54A 4DSKA 4CJQA 2YNFA 2BANA 1WUAA 4CF2A 3IG1A 4CJ4A 3NCIA 4I6MA 4DUZK 2ZJQL 4XH1A 4JD2A 4BRHA 1SZ2A 4FLXA 4CZFA 3WQUA 1T03A 3DMJA 3L2UA 2IGIA 1K8KA 3KKRA 4PQUA 1TKTA 1TK5A 5J1EA 2FF3B 5F1XA 4CJVA 2P9IB 3EE9A 4CE9A 1JXEA 1S1VA 2YJFA 4JHDA 1JCFA 2VG6A 4BRLA 4DTMA 2QXFA 4CJRA 1D9DA 4FLVA 2FXUA 4GV6A 2YJEA 4DFJA 2RE2A 2Q97A 2HBKA 1BL3A 2P9LA 1TGOA 1NLVA 4IWVA 4O5BA 1ASVA 4X64K 1X9JA 4JI3K 1ZBIA 1KVCA 2P5GA 4W5TA 3T69A 3QBXA 4O5FA 1TL3A 4LH5A 3C7NB 5GIPA 4CVNE 1Q86O 3FE1A 4AF1A 2HVIA 2FLOA 1H1VA 3WUHA 3AA2A 3NGIA 3QNOA 1X1PA 4LF6K 1X9MA 5E84A 1QQCA 3QFPA 3M3ZA 4Q0BA 5AQUA 3PX6A 4B3SK 1CZBA 4JS5A 4DMNA 1WOQA 5BR8K 3QEVA 3Q7BA 1BOTO 4CJ3A 4KFBA 3LWLA 4WYBA 3CIPA 3CCEN 1ZBSA 4K43A 3DM2A 3TTFA 3VQ9A 3CJBA 5FPDA 1NKEA 2UUCK 1VSJA 3F5TA 4IJNA 3SPYA 4B9TA 3CCUN 1YJNN 1ASUA 1NGDA 1E3MA 1BO5O 2UU9K 3EE8A 2YV0X 3KKSA 3K5LA 4R79A 2OCEA 3SNNA 2HHSA 1QHTA 3MWPA 4DR4K 3C6UA 3CM5A 1B9FA 3ZSRA 2RHKA 3QETA 4FM2A 3MN5A 4BE1A 4DQRA 3ZX0A 3V1QA 5DM7L 5CY4A 1G15A 2QWNA 4K8XA 4KPYA 4BRIA 3NF6A 3HXMA 2ZF5O 2YX6A 3H1VX 1MA9B 4KKOA 4LFBK 4OJRA 4CD3A 1WAFA 3JAMO 4DTSA 4BRAA 1V4TA 4J8FA 5M1OA 5JLHA 2B5JA 1GLCG 4H5RA 3DXKB 1ZC6A 1YF5L 2KW4A 2WUSA 4DTOA 1EP4A 3HTVA 4BDYA 3J81O 3LANA 3K5OA 3ZSOA 3CYMA 3BUZB 4KHPK 3SJHA 3RMAA 4FSVA 4JKHA 2F7TA 2PY5A 1BQMA 4G1QA 4CEZA 4W5OA 1IJJA 2YHWA 3T19A 4CIGA 2W42A 3AA4A 1ATRA 1F21A 3D7EO 3QMLA 3HM8A 4CEEA 3VERA 1QTMA 4UY8O 3I55N 4M3TA 5AQTA 4ID1A 1ESVA 4YFUA 1NK5A 3L2WA 2O8BB 2RN2A 4A5BA 4FJ8A 2KHOA 5JMVA 1NU0A 4FJ7A 1VAZA 3ATUA 3O9TA 1YTAA 4BRKA 4ELUA 1YAGA 3TTDA 4KTWA 4IOAL 3CJCA 3NFAA 1TKDA 1FW6A 3OBYA 3AVHA 3CFOA 3DLBA 3DLHA 3V1RA 3OYIA 3BF3A 1J6ZA 4LF9K 3VETA 2HMPA 4DSIA 3V9UA 3E1YA 1CZ9A 2ZJPL 4CHPA 3S9HA 1ASWA 2WONA 1JCEA 3OYBA 2P9NB 4Z4GA 2AP1A 4FK2A 2NRZA 5HROA 1Q8IA 2V51B 3AVNA 3NHGA 4CGHA 1T3VA 2QW9A 3ID8A 5M1QA 1N6QA 1MWKA 1U49A 1RT3A 3NF9A 3BF1A 2QKBA 1KAYA 4DCHA 3AVFA 4DS4A 4N56A 2ZE2A 2H3GX 4CFCA 5JVGL 3WXJA 2NUBA 4CIFA 4DR5K 2Q0UA 3VQDA 3KJVA 4Z4EA 3PY8A 5SZTA 1GLDG 3GBTA 1WSFA 1P8ZA 1TYQA 1LW0A 5FRMA 1SL1A 1SKWA 3H3NO 2AA4A 1QHAA 2LSNA 2R7YA 3AO2A 2VQEK 1QQNA 3ULDA 4EP5A 1Y64A 4FJ9A 4EIAA 2E1ZA 4CZJA 4RTFD 3TANA 1JKHA 4H5WA 4CFBA 4HHTA 1HQEA 3VQBA 3K57A 3AVCA 3OHRA 3ZYYX 3S3MA 4IG0A 3DRRA 4CZHA 3P83D 4H03B 3H6EA 3CERA 3M6GA 3SK3A 1C0UA 3PIOL 1KD1O 3SQ4A 3JS6A 3HM9A 2ZD1A 1C0FA 3CCRN 1KXPA 2OPRA 3VQ5A 1HYZA 4H0XB 1YITN 3CCQN 3UKRA 4CK3A 3EKUA 5KPTA 3WNEA 5AQIA 4NXNK 5J2MA 1RBUA 1U04A 3ENBA 4IFVA 4RW4A 4DR6K 5BR9A 1IH7A 3E01A 3EZ5A 4FPBA 1QVGM 5FROA 3VENA 3EO3A 3P38A 3D2EA 4WFNL 3GE1A 4HCBA 4OLAA 3BEXA 3PUFA 2P9PB 4DG1A 1Q82O 2FBYA 2O8FB 4X65K 4PKHA 3C6HA 1K9MO 4QOZB 3AVKA 1HYSA 3H08A 2VCPA 2YKMA 3CJ1A 4CEOA 2HHXA 4CK2A 3FGUA 2ZM6K 1Z26A 2HF3A 4BREA 1REVA 3O9QA 5KGWA 1NGBA 2KZZA 4DV4K 1RDUA 1NMDA 2ZGYA 4OKKA 4X66K 3AV9A 1CLQA 3VGMA 4JKGB 1W7AA 4FWRA 1VQON 4WF9L 3J7YP 1K73O 3AA5X 3RR8A 1SKRA 3T7ZA 2QM1A 1HPMA 3EL2A 4FOEA 4HTLA 1HQUA 4BQLA 4FVUA 3TAGA 1N34K 1IKWA 4IO8A 4K25A 4FOIA 4JRPA 1NK6A 4CF8A 1XI1A 4H0PA 5FPMA 3PX0A 1LWFA 4N47A 1NK9A 1U4BA 5AZIB 1XWLA 1BCMA 3U3GA 3GG4A 4EHUA 4F2SA 1A5VA 1VSLA 4NCGA 4F4KA 4KB1A 1YT3A 4NB4A 5C2FA 2O8DB 1M1KO 2Z1JA 1BQNA 1HNVA 3NMUA 1W0HA 4IBNA 3KLHA 1BISA 2FBXA 2HOEA 3OY9A 3VMFB 5BRDA 2E2PA 3AO5A 3F9MA 3ID6A 3JXUA 3M8RA 1U2VA 3CHWA 3DWLA 4HVJA 2FBTA 3SI6A 1KSPA 3T3FA 1BUPA 3THWA 3RR7A 3NGYA 1VSHA 3IDHA 5AQRA 1T6CA 4NXMK 4CI6A 3P4IA 2A1RA 3MCAB 3ZT4A 1SUQA 4FYDA 5HP1A 4FVMA 3N4QA 2GEMA 4AM6A 3KLFA 1LW2A 2HB5A 4U67L 3K58A 4E7HA 3QIOA 2F96A 3IKMA 4OKJA 4EZ6A 1N33K 1RDCA 4NLCA 2DTUA 1KC8O 3N4PA 4I2QA 4KTZA 1RT7A 3VESA 3RRHA 3OA9A 1U47A 4EHTA 1W9HA 1XHXA 4EP4A 3LM9A 1CXQA 4LF4K 1E4FT 1KFSA 5J2PA 4JI5K 3LDNA 2KKZA 4O8UA 3ZETA 1WN7A 3LAMA 2OTLN 3B6PA 4CGIA 2QEXN 3CPEA 5A2QO 4CK1A 4RWTA 3R8EA 4B1ZA 1T05A 4B1UB 2E8AA 3MAQA 5GAEP 4J2DA 2JLEA 5M1FA 1V4SA 4WQ4A 2OTJN 1T44A 4Z0UA 3VOVA 2UYTA 4F3OA 3ASMA 2YI1A 4CEQA 1OH7A 4FL9A 3QICA 4FM1A 3QLHA 4Z94A 3LALA 1VRUA 4KAZA 4BG8A 2F4VK 4FK0A 1WAJA 4L3QA 4QS7A 1R0AA 3KLIA 3ULEB 1HNXK 3MEEA 1OH5A 5BPNA 4DTUA 4KI6A 1XNQK 2YHBA 4ISGA 2OPQA 4JKBA 4JI8K 1DEJA 3VEOA 1L5UA 4IEEA 1RCHA 4IEIA 3D6RA 5C12A 1BU6O 4OPAA 4WQ4C 3CMAN 4NLBA 4MFBA 1QS4A 3CC4N 2BGGA 2OYQA 1EQYA 4BE0A 3CC7N 4B8AB 3C6AA 3FZKA 4I6MB 4BC5A 4FJJA 1IBLK 2FBVA 3DLEA 3KWIA 4JD2B 3Q7CA 4BR7A 3W3DA 1HUXA 5JICA 4DTPA 5KPZA 3MXMA 4AILC 1EWQA 1HKBA 1JLFA 3TTCA 1RT5A 1L3VA 3SJJA 3LPTA 3TU5A 2ZGZA 3ZX3A 1JJ2M 3MXJA 3RSEA 4M3ZA 3AVLA 3A5OC 3L4QA 5LJWA 5JS2A 4B08A 4CCHA 4C1NI 4AM7A 3QDKA 4JKAA 3TR8A 3B6OA 1Y97A 3LDSA 4XH4A 3SBTA 4EAHD 4DV5K 4QS9A 5TKYA 3VEWA 4BVPA 4DLEA 2QK9A 3WNGA 4FCYA 2GWJA 3PSIA 3VQ7A 3DRSA 4R5PA 4FWPA 2XRIA 2V7YA 4B1VA 3O3GA 3AVGA 3HPGA 3BGRA 3AVIA 3E9OA 3T1YK 1D5AA 1KLMA 5AQLA 2OPSA 4LH4A 5E26A 4GVEA 2O8CA 3KD1E 3WXIA 4N5SA 3QEXA 1RILA 3ZSZA 4A62A 4DUYK 2OPPA 1I39A 4A59A 1HNWK 1BIUA 2YHXA 3RMDA 4H0VB 3VGLA 1VSDA 3VA3A 4JYAK 4ISFA 1CZAN 3D45A 3HO1A 1BWFO 3V1OA 4RCHA 3KHYA 3EZWA 3VQ8A 4CF1A 3SQ2A 5T7BA 4DF4A 1JCGA 5AQMA 5SWMA 3BZCA 4FJXA 3DLKA 3IFRA 4JAXA 1TUUA 1J53A 3BDPA 4RW9A 1SS6A 3NF8A 1RDWX 2NRRA 2Q3SA 5AQGA 4MDBA 2BH1A 1QE1A 4CFAA 4BR0A 2VWBA 4BR4A 4HUEA 4MLEA 3QINA 1O1WA 3L6QA 1HNZK 5C0YA 4E7KA 1VSEA 2KZMA 2O8EA 1TVRA 4KREA 3U9ZA 2Y1JA 4PA1A 5LY3A 3THXB 4LFAK 4Z4CA 3VTHA 3QESA 2G8FA 3QBWA 3UKUB 3OYLA 4DU4A 1NGCA 4O0IA 1KLNA 1N36K 3T1AA 5FPEA 3E9PA 3CPWM 4H5NA 5CE3A 1VQLN 1RT4A 2CGJA 4OX9K 3LP1A 3O3HA 2FSKA 1YJWN 4DV6K 1NGFA 4E7IA 3E9LA 3O8MA 1NK4A 3MN7A 3O4QA 4FJHA 3HP6A 4IFEA 1QQOA 1NGAA 2BUPA 5M1KA 2YNIA 4DR3K 1NKBA 2X78A 1UAXA 1XHZA 3MEGA 4DTXA 3ZEUA 4I9LA 3FFKB 2A3ZA 4CIEA 4M7YA 1MU2A 3NH2A 3TI0A 1JL2A 3SAGA 2ZJRL 3DXMB 4MO5A 2E20A 3O1WA 2PFUA 4IKFA 4E1NA 2KFZA 1JXBA 1HKCA 2B4JA 4BC2A 1LV5A 2QA4N 3QO9A 4OO1J 1WB9A 1VSFA 2ASMA 3TABA 1HNIA 1KVAA 4DSJA 1O13A 3WNFA 4LFCK 3C7NA 1ATNA 3ITHA 3ZSXA 4CECA 1TK0A 5ADXA 4YOXA 2ASOA 2GX9A 3U3YA 4K8ZA 4JKEA 4GV9A 2Z1IA 3KVGA 3M8QA 5ADXH 1FK9A 1NJWA 5EY4A 4DV3K 2A6AA 5KQ8A 1GLBG 3V4IA 3FR0A 2PAVA 4CFDA 3CQ8A 4CEBA 4DR1K 4E3SA 3NAEA 1T8EA 2P9SB 4OKEA 4PL7A 4C8OA 1S72N 2NRHA 4CZGA 4JI2K 1RTIA 2IDOA 3QEWA 4ICLA 1X9WA 3TAEA 2A42A 1JLEA 2DY4A 4BR2A 4JN4A 3LAKA 4E89A 3GL1A 1C1BA 2HHVA 1GLLO 4A57A 3VEXA 2JWLA 4KO0A 1KAZA 5EVZA 3KLEA 3EN9A 3ZCMA 5JLFA 3E66A 1VQKN
chains in the Genus database with same CATH topology
1J5EK 4DV6K 2ZM6K 4DR4K 5FLXO 4DV5K 1IBKK 4B3TK 4YY3K 4DV4K 1HR0K 2UUAK 4X66K 4LF4K 4B3MK 3J7AP 3J7YP 4DR3K 2UXDK 4JI5K 4K0KK 4DR5K 5IWAK 4DV7K 2E5LK 4LFBK 5LMUK 5A2QO 3T1YK 4JI1K 2VQFK 3T1HK 3JAMO 1N34K 4DUYK 1HNWK 4DV0K 3J81O 4X64K 4JI3K 2VQEK 4DV2K 4GKKK 4KHPK 4JYAK 2F4VK 5LL6Z 4DR2K 4JI6K 4YHHK 1HNXK 4CW7B 4CVNE 4LFCK 5IT9O 1XNQK 4X62K 4GKJK 4JI8K 4LF6K 4JI7K 4DV1K 5LMNK 1XMQK 4B3SK 2UXCK 5AJ3K 5BR8K 4DV3K 4LF8K 1HNZK 4V19S 3J80O 1IBLK 4JV5K 4LF5K 4DR1K 1XMOK 4NXNK 1XNRK 4JI4K 4JI0K 4LFAK 2UUCK 4DR6K 4LF7K 4NXMK 4JI2K 1FJGK 3OTOK 4LF9K 1N36K 1I94K 4AQYK 2UUBK 4DR7K 4B3RK 2UU9K 1IBMK 1N32K 2UXBK 4OX9K 4X65K 2HHHK 1N33K 4DUZK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J5E K;  4DV6 K;  2ZM6 K;  4DR4 K;  5FLX O;  4DV5 K;  1IBK K;  4B3T K;  4YY3 K;  4DV4 K;  1HR0 K;  2UUA K;  4X66 K;  4LF4 K;  4B3M K;  3J7A P;  3J7Y P;  4DR3 K;  2UXD K;  4JI5 K;  4K0K K;  4DR5 K;  5IWA K;  4DV7 K;  2E5L K;  4LFB K;  5LMU K;  5A2Q O;  3T1Y K;  4JI1 K;  2VQF K;  3T1H K;  3JAM O;  1N34 K;  4DUY K;  1HNW K;  4DV0 K;  3J81 O;  4X64 K;  4JI3 K;  2VQE K;  4DV2 K;  4GKK K;  4KHP K;  4JYA K;  2F4V K;  5LL6 Z;  4DR2 K;  4JI6 K;  4YHH K;  1HNX K;  4CW7 B;  4CVN E;  4LFC K;  5IT9 O;  1XNQ K;  4X62 K;  4GKJ K;  4JI8 K;  4LF6 K;  4JI7 K;  4DV1 K;  5LMN K;  1XMQ K;  4B3S K;  2UXC K;  5AJ3 K;  5BR8 K;  4DV3 K;  4LF8 K;  1HNZ K;  4V19 S;  3J80 O;  1IBL K;  4JV5 K;  4LF5 K;  4DR1 K;  1XMO K;  4NXN K;  1XNR K;  4JI4 K;  4JI0 K;  4LFA K;  2UUC K;  4DR6 K;  4LF7 K;  4NXM K;  4JI2 K;  1FJG K;  3OTO K;  4LF9 K;  1N36 K;  1I94 K;  4AQY K;  2UUB K;  4DR7 K;  4B3R K;  2UU9 K;  1IBM K;  1N32 K;  2UXB K;  4OX9 K;  4X65 K;  2HHH K;  1N33 K;  4DUZ K; 
#chains in the Genus database with same CATH topology
 3HST B;  3CF5 L;  3LL3 A;  1S1X A;  1VSI A;  1JLG A;  1IBK K;  1MWM A;  3MED A;  3G10 A;  4M3X A;  4CJU A;  4DTR A;  5AZJ B;  2A40 A;  2CH5 A;  3CET A;  2I5J A;  2QWL A;  4B3M K;  3M8P A;  3AGR A;  4H5T A;  4O8K A;  4CEA A;  4C8K A;  3NF7 A;  4FJN A;  3C95 A;  4CJL A;  3OJU A;  3WXL A;  4FLW A;  5BRH A;  3SCX A;  4HUG A;  4FM0 A;  3VQE A;  3B8A X;  1UWB A;  2D0A A;  5E41 A;  1K6Y A;  1NK7 A;  1VQ9 N;  3DLG A;  2Y1I A;  2VG5 A;  1NBW A;  1G99 A;  2W6K A;  1VQ7 N;  3M8S A;  1QZ6 A;  4CED A;  3DXK A;  1YVN A;  2CGL A;  4MO4 A;  3UIQ A;  4E1J A;  4B9S A;  1VQ4 N;  3QB0 A;  4MQ3 A;  5KRS A;  4FWM A;  5HRS A;  3CG7 A;  3SV3 A;  2XY7 A;  2NRT A;  3H3O B;  1QSS A;  2PYL A;  4JLH A;  4OPK A;  1JLQ A;  2KFN A;  3FLC O;  4FXD A;  2NRV A;  3PO4 A;  2XY5 A;  2AJQ A;  2GWK A;  2KLA A;  5B8H A;  2BDP A;  1NGJ A;  2NLX A;  1RT2 A;  1C1A A;  4B3O A;  4DF8 A;  2FSJ A;  4M63 C;  4KH6 A;  4V19 S;  2O8B A;  3KIO A;  3THY B;  5CYM A;  3LDQ A;  4HWI A;  4RW8 A;  4BWM A;  4FLZ A;  4LF5 K;  4H5V A;  3ZT0 A;  1EET A;  1YXQ A;  1ZBL A;  4BQZ A;  1NOZ A;  3P5J A;  2Q2R A;  4FWN A;  4Z4H A;  5CHI A;  1BA1 A;  4F8R A;  1C0T A;  3HBT A;  2VGN A;  2E88 A;  3HOT A;  4N76 A;  2X6S A;  4BG9 A;  2P9U B;  4B3R K;  1RT6 A;  5HOO A;  3EKS A;  4GMJ B;  1T7P A;  1S9G A;  2UXB K;  2PYJ A;  2XO7 A;  3MCP A;  3IS9 A;  5MLC Q;  3KZB A;  5I3U A;  4FJG A;  4OGC A;  5AQW A;  3JYT A;  2JGU A;  2EHG A;  4YOY A;  3G0Z A;  2ITM A;  2CH6 A;  4IOC L;  1QSY A;  1U45 A;  3FZM A;  3ZSQ A;  1XQS C;  2IIR A;  4CHZ A;  4DS5 A;  3CI5 A;  1EKE A;  4KHS A;  3GDQ A;  4AHS A;  3CFR A;  5GIO A;  3ENO A;  4FWL A;  4KHQ A;  5EOY A;  4NCA A;  4CBW A;  5LMU K;  4NO7 A;  3AO4 A;  3OYA A;  3G4S N;  4AHC A;  2D4W A;  2V7Z A;  1ZBH A;  4CJF A;  1HMV A;  3TSQ A;  3QIP A;  3MWT A;  3LZJ A;  4DV0 K;  3DRP A;  4KI4 A;  2F9W A;  4FK4 A;  1M90 O;  1HYV A;  1ZBF A;  3CFP A;  2HW3 A;  2O4G A;  1U2V B;  3TAM A;  3KD5 E;  2Q31 A;  2WBN A;  1VQN N;  4CGG A;  5LL6 Z;  4DSE A;  3OYM A;  1A5W A;  4WFA L;  4JI6 K;  4KBO A;  2D0O A;  3THW B;  4CW7 B;  3QEP A;  3FZL A;  4C8L A;  4ELT A;  2VG7 A;  3OYJ A;  2HHU A;  4ILJ A;  4J2B A;  3HOS A;  2ITG A;  3CJ9 A;  4QAG A;  1WSH A;  1RDB A;  3BY5 A;  5LMN K;  4W5N A;  2RKI A;  1HX1 A;  4Q5V A;  4IOX A;  3VEZ A;  4A5A A;  3TWH A;  1U6Z A;  4UQG A;  4LC9 B;  3HP9 A;  4FZZ A;  3VQ6 A;  1NWK A;  1Z6R A;  1Q9X A;  4JK7 A;  2CGK A;  4PKI A;  2FSN A;  4O55 A;  2W40 A;  4JV5 K;  4B9U A;  1QVF M;  2DFE A;  3CME N;  3CCM N;  3HVR A;  4BRM A;  4JI0 K;  1UOC A;  3KK3 A;  3MDQ A;  3PX4 A;  2HHT A;  1NNE A;  3O9R A;  3H1Q A;  4CD1 A;  1WSI A;  4KHW A;  3ZET B;  4DR7 K;  2NZT A;  4CHO A;  3MMV A;  3OJS A;  4NCB A;  3OYD A;  5DK5 A;  2P9P A;  1RTH A;  1OH6 A;  3L4I A;  3WNH A;  2O8F A;  1BHL A;  1FXX A;  4BC3 A;  3HPH A;  3AVA A;  3OVN A;  3NH0 A;  5BN9 A;  1WBD A;  4H0O A;  1NGE A;  2YNG A;  3QFU A;  3AAR A;  5AQX A;  3VTI A;  3CXC M;  4DTN A;  2KQ2 A;  1GLA G;  1VQM N;  3LZI A;  3VQP A;  4JKG A;  2GEL A;  3DYA A;  4BRP A;  2P9K B;  2NRW A;  3ENH A;  4J2E A;  3CJA A;  1WBB A;  3TPQ A;  1I3A A;  5F2R A;  3T1H K;  4IDK A;  1JLC A;  4CER A;  4I9Q A;  1GLE G;  3W0L A;  2HF4 A;  4YDU C;  4DB3 A;  3A8Y A;  3RRG A;  1S1T A;  4GKK K;  2G8V A;  4CZK A;  2E4L A;  5AQP A;  1WSG A;  4AHR A;  2HNZ A;  3A2F A;  1TL1 A;  1DLO A;  2G8I A;  5AZI A;  1KQS M;  2HND A;  5LJV A;  2X74 A;  5TKW A;  3KLG A;  2Q1N A;  1HRH A;  1LCU A;  1T6D A;  2GBZ A;  3L3V A;  3PIP L;  2G8U A;  3OYK A;  3SYZ A;  2NRX A;  2WFB A;  1L3S A;  2OZS A;  2O8D A;  3IRX A;  2KTQ A;  5J2N A;  2OZM A;  4EZ9 A;  4CJ5 A;  3QER A;  4B1X B;  3DAW A;  2D0P A;  1A5X A;  2E6M A;  3CC2 N;  4K41 A;  1MDU B;  4DSF A;  1S3X A;  2IVP A;  3AVM A;  4DQQ A;  2QWM A;  1P90 A;  2ZQB A;  4DQP A;  1XNR K;  2HHW A;  3I0R A;  4JKF A;  2P5O A;  1N5Y A;  4E7J A;  3WXK A;  5HRR A;  4FWS A;  2HBL A;  3ZT1 A;  3ZT2 A;  4AQY K;  4B1Y B;  3UB5 A;  3LDL A;  1BG3 A;  2D0B A;  4DU1 A;  1N32 K;  5C25 A;  3KK1 A;  3C0B A;  2O8C B;  4DTJ A;  2Z1G A;  5EU7 A;  4A61 A;  4DQI A;  3A0I X;  1J5E K;  2YCH A;  1RBV A;  4H8K A;  4PL8 A;  3ZT3 A;  2JWK A;  1K8K B;  4B8C A;  3OS0 A;  3PLA A;  4LY7 A;  1QQM A;  3SPZ A;  3OBW A;  3C65 A;  2A1S A;  2D0C A;  4H4O A;  2YKN A;  4JHD B;  4FJ5 A;  1YI2 N;  4YOV A;  3VQC A;  4CEF A;  5C10 A;  2E5L K;  3DOL A;  2HST A;  4U7B A;  1LAV A;  1C0G A;  4GV3 A;  4WE1 A;  3BP8 A;  1S1U A;  4Z4I A;  4PUO A;  2P9L B;  1ZYQ A;  3EY1 A;  3HI0 A;  4CBX A;  4YOU A;  4FW2 A;  3H45 C;  4DV2 K;  2J4R A;  2E2N A;  2QWQ A;  3D2F A;  3DOK A;  1GLF O;  2W41 A;  4PKG A;  4QCL A;  4JS4 A;  1RFQ A;  3O4N A;  2V52 B;  3WQT A;  3LP0 A;  4BVO A;  3ULE A;  3NH1 A;  3HK2 A;  2GUI A;  4OVL A;  4KRF A;  2IVO A;  3WEE A;  4I2P A;  3SBG A;  5GAG P;  4IFY A;  1TAU A;  1D8Y A;  1VK0 A;  4RW6 A;  4F2R A;  4AHT A;  1TKZ A;  4BDZ A;  3R3L A;  4BRD A;  3F2K A;  4A2B A;  1Z25 A;  3AA3 A;  3VF6 A;  3NVM A;  1D9F A;  3IMX A;  3HZ6 A;  4FWO A;  4KHY A;  3H46 O;  3OYN A;  1RT1 A;  2VYP A;  5CZ2 A;  1IV0 A;  3KK7 A;  1IKV A;  4B9L A;  1SQK A;  5BRF A;  4CGD A;  1S22 A;  2XY6 A;  1J9A A;  1DTQ A;  3TAP A;  3RTV A;  3ZEU B;  1EWR A;  5HRN A;  1BI4 A;  4FLT A;  2E2Q A;  4HCC A;  4KB0 A;  2ETJ A;  3RWU A;  2QI2 A;  3SMP A;  5M1P A;  3I33 A;  2BTF A;  4IZ9 A;  3CQX A;  4JK9 A;  3L3U A;  4IO9 L;  3I8B A;  3TAF A;  1S1W A;  5AQN A;  5AQO A;  4E0D A;  3AGK A;  4MLH A;  1HR0 K;  4M3U A;  3V6D A;  4OPH A;  3S41 A;  3MN6 A;  3KWG A;  3NBP A;  3QEI A;  3I0S A;  2G8H A;  5DM6 L;  3KK2 A;  4XIU A;  5EXW A;  4O0J A;  3K0S A;  5AQH A;  4KV8 A;  4JI1 K;  3ZLJ A;  4KHN A;  2VQF K;  1KAX A;  1K8A O;  1HPZ A;  4ZHR A;  4JEP A;  5C15 A;  1NJX A;  3HT3 A;  2I7P A;  4YOW A;  1SKS A;  1D4X A;  4KH4 A;  1S6P A;  3K2P A;  3OS2 A;  5KTQ A;  2IAJ A;  4W5Q A;  3OYC A;  4GW6 A;  1YTU A;  4BR5 A;  3OYE A;  4CZI A;  2QWR A;  4BE2 A;  3LPU A;  4EFH A;  2P9I A;  3CJ7 A;  1WNS A;  1DT9 A;  3O9S A;  3FZF A;  4X62 K;  1Q18 A;  5HLF A;  4JKD A;  4NYF A;  1TAQ A;  1BDG A;  2XHB A;  1VSK A;  3CM6 A;  4CHN A;  4E7L A;  3CCV N;  1S9E A;  3VGK A;  4B9Q A;  1BA0 A;  4B1W B;  2YNH A;  4AH9 A;  3L2R A;  2F8S A;  3C94 A;  2G8W A;  2QWO A;  4Y1C A;  4PHT X;  4JI4 K;  2IVN A;  1RDA A;  4DQ8 A;  4IJA A;  3SAF A;  4CES A;  3THX A;  1FJG K;  3V81 A;  2A5X A;  3UKU A;  1YIJ N;  3MXI A;  4DFK A;  3R6M A;  1X9S A;  5J2Q A;  2HVH A;  4M45 A;  1IBM K;  1ZXO A;  2VWJ A;  3M5R A;  3SLC A;  2E2O A;  3ZSV A;  3P39 A;  4FLY A;  4H0Y B;  1KFD A;  3UE5 A;  3S3N A;  3THV A;  1YHQ N;  4FJL A;  5BRE A;  3VA0 A;  2YHA A;  5BN8 A;  3J7Z O;  1R59 O;  3EEQ A;  4MDA A;  5K14 A;  2IC3 A;  3J7A P;  4C8M A;  2Q0R A;  3R1X A;  4PWD A;  1HJO A;  2I7N A;  1Z05 A;  4I7F A;  3WT0 A;  1YVU A;  4C8N A;  3OS1 A;  1DKG D;  5JS1 A;  4OPJ A;  1YUW A;  4BRG A;  2A41 A;  1TYQ B;  2RF2 A;  4ISE A;  1NJZ A;  1VSM A;  1EO1 A;  1Q81 O;  1RBT A;  3CCJ N;  1WLJ A;  2BE2 A;  3LP3 A;  4DFP A;  3ALY A;  1WSJ A;  1ZBU A;  4BGB A;  3FZH A;  3O3F A;  4LSL A;  3DXM A;  5AQJ A;  4F9O A;  3PSF A;  1NK0 A;  4M3Y A;  4H4M A;  4YHH K;  2YHY A;  2WTU A;  3PV8 A;  3IUC A;  1KRP A;  1W97 L;  1NGH A;  4CGJ A;  1RNH A;  3DJC A;  4FZX C;  2QKK A;  5KPR A;  4DV1 K;  2O4I A;  4AHV A;  1OVY A;  1XMQ K;  4CF0 A;  2UXC K;  1LAW A;  1W2B M;  1WSE A;  1CXU A;  3V9S A;  3PO5 A;  1C0M A;  3HYF A;  2RPI A;  3UKR B;  3LM2 A;  5CR4 A;  4JNE A;  1LOT B;  4G9Z A;  5F0X A;  2QWP A;  2D1K A;  2E1Y A;  3I8D A;  2XY8 A;  3O9U A;  2P1J A;  4HUF A;  2DPN A;  2GUP A;  4DWI A;  3V9W A;  1J5O A;  3GOI A;  2HNY A;  2P9S A;  4LF7 K;  3D2E B;  1X3M A;  3A5L C;  3OTO K;  4O44 A;  1X3N A;  3OYH A;  3AAP A;  3MX2 A;  1VQ6 N;  3ZX2 A;  1L3T A;  2ZWH A;  2VGM A;  3HSC A;  4Y0W A;  3VEY A;  3VF2 A;  4CF9 A;  3OYG A;  3SUO A;  3CCS N;  4BC4 A;  2D5R A;  3CQY A;  3SUQ A;  4FWQ A;  3SQ1 A;  3K5N A;  5FLX O;  2F8T A;  5DMR A;  1HLU A;  4M3R A;  1RBR A;  2UUA K;  3S3O A;  5AZJ A;  1BCO A;  3DLL L;  3SAH A;  4FW1 A;  3R9P A;  3ZSY A;  2UXD K;  1GLJ O;  4M7X A;  1NMN A;  3U6F A;  4BY9 C;  2GV9 A;  3HRG A;  1XUP O;  1KCF A;  4B9N A;  3NE6 A;  4WQ5 A;  3IAY A;  1TK8 A;  2X6N A;  1L3U A;  1IG9 A;  3AVJ A;  1SL0 A;  2P9N A;  1BIZ A;  1DTT A;  2EX3 A;  4GVM A;  4ILG B;  1VQP N;  2IS3 A;  5I9E B;  2VWK A;  5JVH L;  1NK8 A;  3AAQ A;  4M3W A;  3VQA A;  3V9X A;  1B92 A;  3DI6 A;  1GOB A;  3HL8 A;  5M1N A;  3D0P A;  1S6Q A;  1KVB A;  4CJE A;  4DHY A;  2WC9 A;  1C1C A;  4CJT A;  3K5M A;  5AQV A;  3G6E N;  4J2A A;  3LWM A;  5AFU A;  1TV6 A;  3V9Z A;  4WQ5 C;  1NJI O;  4BRC A;  1KTQ A;  4LSN A;  1LWE A;  1OH8 A;  3NGZ A;  4OLB A;  5AFU H;  3U9D A;  4PY5 A;  4TSX A;  4Z4F A;  4DQS A;  3TSU A;  3O08 A;  4O4G A;  1XC3 A;  3BZK A;  4RG8 A;  4FZY A;  3VPZ A;  2DFF A;  1NGI A;  4E19 A;  3O6W A;  3THY A;  1XMO K;  1DGK N;  1GOA A;  4BR9 A;  4YOR A;  5AQQ A;  1IG8 A;  1RTD A;  1VQ8 N;  3U8X A;  5HL7 L;  1RDD A;  3SUN A;  1OVQ A;  1FKO A;  5D3G A;  3JSM A;  4DKW A;  4CJW A;  1I94 K;  3OYF A;  3L8B A;  2G8K A;  4M42 A;  4BAC A;  4KTQ A;  3KTQ A;  1ITG A;  2IOC A;  2P9U A;  4CJP A;  4WFB L;  2HHH K;  3NVK A;  3F9K A;  3G71 N;  1VQ5 N;  4WCE L;  4JRQ A;  3G25 A;  4IG3 A;  3L0Q A;  3ATV A;  1NJY A;  3ISN C;  3AO1 A;  4YY3 K;  4DU3 A;  5GIN A;  5AQK A;  2QTD A;  3VEV A;  4E1M A;  4YOT A;  5AQY A;  1LWC A;  3AO3 A;  3AVB A;  4FJI A;  1OKJ A;  4BRF A;  3MN9 A;  3OW2 M;  1S5J A;  1JLA A;  3HPO A;  5FDL A;  3LDO A;  4M41 A;  5HRP A;  4ILH A;  3L2Q A;  3VQ4 A;  4YDU A;  4CJ7 A;  4DLG A;  1BGX T;  2E6L A;  5GAH P;  5ELZ A;  2PBD A;  5C24 A;  5HBM A;  4IDH A;  3O1B A;  1UA0 A;  1QSL A;  1IKX A;  4HTU A;  1HJR A;  4BRO A;  3TAR A;  5CZ1 A;  4CZE A;  5KRT A;  4L8R B;  5FPN A;  3WXM B;  1VHX A;  5KGX A;  4BDP A;  3DLR A;  4FWK A;  1YJ9 N;  3FFI A;  1XC9 A;  3SUP A;  3VF4 A;  4GKJ K;  3RMB A;  4DFM A;  2FF6 A;  4JI7 K;  1RGI A;  4B9M A;  4DSL A;  5AQZ A;  3RVC A;  5AQS A;  4CHY A;  2NNW A;  4JKC A;  5AJ3 K;  1JLB A;  3MEC A;  1NOY A;  4YNQ A;  1NGG A;  4ZTJ A;  2HBJ A;  4CJK A;  3F73 A;  4LF8 K;  2HBM A;  5FRN A;  4A2A A;  3TSP A;  3J80 O;  4K42 A;  4OGE A;  4CJS A;  4CZL A;  2ASP A;  4FJK A;  1Q7Y O;  2Z1H A;  5EX5 A;  1TKX A;  2P51 A;  3RSE B;  2UUB K;  2PZS A;  5H1S Q;  1E4G T;  4BGA A;  4W5R A;  4F3T A;  3O80 A;  2W6L A;  3P31 A;  4ZTF A;  3I56 N;  2OA8 A;  4N41 A;  5KI6 A;  3L2V A;  2F9T A;  3CD6 N;  4GY2 B;  2HHQ A;  4FPA A;  4FLU A;  1SAZ A;  1QZ5 A;  4Y1D A;  5KQD A;  1JL1 A;  3MX5 A;  4B3T K;  1IKY A;  1FKP A;  3D2F B;  3K9K A;  4CBU A;  4FO0 A;  3SMS A;  4H0T B;  3SV4 A;  3VN5 A;  4FJM A;  4ID5 A;  3LDP A;  4K0K K;  5IWA K;  2EWS A;  5BPM A;  4BWJ A;  4DV7 K;  3HVT A;  4AHU A;  3QNN A;  3C6T A;  4C1N K;  3MK6 A;  1HKG A;  2P9K A;  3LP2 A;  5C42 A;  3HJF A;  4LD0 A;  4KH5 A;  3M1F A;  3WEE B;  3SZ2 A;  3RMC A;  4CHQ A;  3O5B A;  4BRN A;  2HMI A;  3J8A A;  3O4W A;  4XEI A;  1SV5 A;  5AR0 A;  1C6V A;  1NM1 A;  4ELV A;  1TUY A;  4DR2 K;  1IO2 A;  2GTD A;  1GOC A;  4B9V A;  5AQF A;  1Q9Y A;  3CCL N;  5IT9 O;  1RTJ A;  3A5M C;  1ATS A;  3P1G A;  3K59 A;  4GNI A;  3ZSW A;  3EYZ A;  4BRQ A;  1VRT A;  4JK8 A;  3U4L A;  5I42 A;  4RW7 A;  3SQ0 A;  3A5N C;  1N8R O;  2B6A A;  1BI4 B;  2ATQ A;  5GAD P;  5CYQ A;  3VQQ A;  1ILY A;  1U48 A;  1EXQ A;  4CZM A;  3K9J A;  4KHU A;  2O8E B;  4QS8 A;  2FC0 A;  5BPL A;  2WOM A;  4C23 A;  3TAQ A;  5C2D A;  1EX4 A;  1SL2 A;  4NYN A;  1NKC A;  3NDK A;  2Q36 A;  2OAN A;  3AY9 A;  2DFH A;  1UA1 A;  1NG9 A;  1B9D A;  4CGF A;  2QXL A;  1RBS A;  4IXC A;  4XH5 A;  1J54 A;  4DSK A;  4CJQ A;  2YNF A;  2BAN A;  1WUA A;  4CF2 A;  3IG1 A;  4CJ4 A;  3NCI A;  4I6M A;  4DUZ K;  2ZJQ L;  4XH1 A;  4JD2 A;  4BRH A;  1SZ2 A;  4FLX A;  4CZF A;  3WQU A;  1T03 A;  3DMJ A;  3L2U A;  2IGI A;  1K8K A;  3KKR A;  4PQU A;  1TKT A;  1TK5 A;  5J1E A;  2FF3 B;  5F1X A;  4CJV A;  2P9I B;  3EE9 A;  4CE9 A;  1JXE A;  1S1V A;  2YJF A;  4JHD A;  1JCF A;  2VG6 A;  4BRL A;  4DTM A;  2QXF A;  4CJR A;  1D9D A;  4FLV A;  2FXU A;  4GV6 A;  2YJE A;  4DFJ A;  2RE2 A;  2Q97 A;  2HBK A;  1BL3 A;  2P9L A;  1TGO A;  1NLV A;  4IWV A;  4O5B A;  1ASV A;  4X64 K;  1X9J A;  4JI3 K;  1ZBI A;  1KVC A;  2P5G A;  4W5T A;  3T69 A;  3QBX A;  4O5F A;  1TL3 A;  4LH5 A;  3C7N B;  5GIP A;  4CVN E;  1Q86 O;  3FE1 A;  4AF1 A;  2HVI A;  2FLO A;  1H1V A;  3WUH A;  3AA2 A;  3NGI A;  3QNO A;  1X1P A;  4LF6 K;  1X9M A;  5E84 A;  1QQC A;  3QFP A;  3M3Z A;  4Q0B A;  5AQU A;  3PX6 A;  4B3S K;  1CZB A;  4JS5 A;  4DMN A;  1WOQ A;  5BR8 K;  3QEV A;  3Q7B A;  1BOT O;  4CJ3 A;  4KFB A;  3LWL A;  4WYB A;  3CIP A;  3CCE N;  1ZBS A;  4K43 A;  3DM2 A;  3TTF A;  3VQ9 A;  3CJB A;  5FPD A;  1NKE A;  2UUC K;  1VSJ A;  3F5T A;  4IJN A;  3SPY A;  4B9T A;  3CCU N;  1YJN N;  1ASU A;  1NGD A;  1E3M A;  1BO5 O;  2UU9 K;  3EE8 A;  2YV0 X;  3KKS A;  3K5L A;  4R79 A;  2OCE A;  3SNN A;  2HHS A;  1QHT A;  3MWP A;  4DR4 K;  3C6U A;  3CM5 A;  1B9F A;  3ZSR A;  2RHK A;  3QET A;  4FM2 A;  3MN5 A;  4BE1 A;  4DQR A;  3ZX0 A;  3V1Q A;  5DM7 L;  5CY4 A;  1G15 A;  2QWN A;  4K8X A;  4KPY A;  4BRI A;  3NF6 A;  3HXM A;  2ZF5 O;  2YX6 A;  3H1V X;  1MA9 B;  4KKO A;  4LFB K;  4OJR A;  4CD3 A;  1WAF A;  3JAM O;  4DTS A;  4BRA A;  1V4T A;  4J8F A;  5M1O A;  5JLH A;  2B5J A;  1GLC G;  4H5R A;  3DXK B;  1ZC6 A;  1YF5 L;  2KW4 A;  2WUS A;  4DTO A;  1EP4 A;  3HTV A;  4BDY A;  3J81 O;  3LAN A;  3K5O A;  3ZSO A;  3CYM A;  3BUZ B;  4KHP K;  3SJH A;  3RMA A;  4FSV A;  4JKH A;  2F7T A;  2PY5 A;  1BQM A;  4G1Q A;  4CEZ A;  4W5O A;  1IJJ A;  2YHW A;  3T19 A;  4CIG A;  2W42 A;  3AA4 A;  1ATR A;  1F21 A;  3D7E O;  3QML A;  3HM8 A;  4CEE A;  3VER A;  1QTM A;  4UY8 O;  3I55 N;  4M3T A;  5AQT A;  4ID1 A;  1ESV A;  4YFU A;  1NK5 A;  3L2W A;  2O8B B;  2RN2 A;  4A5B A;  4FJ8 A;  2KHO A;  5JMV A;  1NU0 A;  4FJ7 A;  1VAZ A;  3ATU A;  3O9T A;  1YTA A;  4BRK A;  4ELU A;  1YAG A;  3TTD A;  4KTW A;  4IOA L;  3CJC A;  3NFA A;  1TKD A;  1FW6 A;  3OBY A;  3AVH A;  3CFO A;  3DLB A;  3DLH A;  3V1R A;  3OYI A;  3BF3 A;  1J6Z A;  4LF9 K;  3VET A;  2HMP A;  4DSI A;  3V9U A;  3E1Y A;  1CZ9 A;  2ZJP L;  4CHP A;  3S9H A;  1ASW A;  2WON A;  1JCE A;  3OYB A;  2P9N B;  4Z4G A;  2AP1 A;  4FK2 A;  2NRZ A;  5HRO A;  1Q8I A;  2V51 B;  3AVN A;  3NHG A;  4CGH A;  1T3V A;  2QW9 A;  3ID8 A;  5M1Q A;  1N6Q A;  1MWK A;  1U49 A;  1RT3 A;  3NF9 A;  3BF1 A;  2QKB A;  1KAY A;  4DCH A;  3AVF A;  4DS4 A;  4N56 A;  2ZE2 A;  2H3G X;  4CFC A;  5JVG L;  3WXJ A;  2NUB A;  4CIF A;  4DR5 K;  2Q0U A;  3VQD A;  3KJV A;  4Z4E A;  3PY8 A;  5SZT A;  1GLD G;  3GBT A;  1WSF A;  1P8Z A;  1TYQ A;  1LW0 A;  5FRM A;  1SL1 A;  1SKW A;  3H3N O;  2AA4 A;  1QHA A;  2LSN A;  2R7Y A;  3AO2 A;  2VQE K;  1QQN A;  3ULD A;  4EP5 A;  1Y64 A;  4FJ9 A;  4EIA A;  2E1Z A;  4CZJ A;  4RTF D;  3TAN A;  1JKH A;  4H5W A;  4CFB A;  4HHT A;  1HQE A;  3VQB A;  3K57 A;  3AVC A;  3OHR A;  3ZYY X;  3S3M A;  4IG0 A;  3DRR A;  4CZH A;  3P83 D;  4H03 B;  3H6E A;  3CER A;  3M6G A;  3SK3 A;  1C0U A;  3PIO L;  1KD1 O;  3SQ4 A;  3JS6 A;  3HM9 A;  2ZD1 A;  1C0F A;  3CCR N;  1KXP A;  2OPR A;  3VQ5 A;  1HYZ A;  4H0X B;  1YIT N;  3CCQ N;  3UKR A;  4CK3 A;  3EKU A;  5KPT A;  3WNE A;  5AQI A;  4NXN K;  5J2M A;  1RBU A;  1U04 A;  3ENB A;  4IFV A;  4RW4 A;  4DR6 K;  5BR9 A;  1IH7 A;  3E01 A;  3EZ5 A;  4FPB A;  1QVG M;  5FRO A;  3VEN A;  3EO3 A;  3P38 A;  3D2E A;  4WFN L;  3GE1 A;  4HCB A;  4OLA A;  3BEX A;  3PUF A;  2P9P B;  4DG1 A;  1Q82 O;  2FBY A;  2O8F B;  4X65 K;  4PKH A;  3C6H A;  1K9M O;  4QOZ B;  3AVK A;  1HYS A;  3H08 A;  2VCP A;  2YKM A;  3CJ1 A;  4CEO A;  2HHX A;  4CK2 A;  3FGU A;  2ZM6 K;  1Z26 A;  2HF3 A;  4BRE A;  1REV A;  3O9Q A;  5KGW A;  1NGB A;  2KZZ A;  4DV4 K;  1RDU A;  1NMD A;  2ZGY A;  4OKK A;  4X66 K;  3AV9 A;  1CLQ A;  3VGM A;  4JKG B;  1W7A A;  4FWR A;  1VQO N;  4WF9 L;  3J7Y P;  1K73 O;  3AA5 X;  3RR8 A;  1SKR A;  3T7Z A;  2QM1 A;  1HPM A;  3EL2 A;  4FOE A;  4HTL A;  1HQU A;  4BQL A;  4FVU A;  3TAG A;  1N34 K;  1IKW A;  4IO8 A;  4K25 A;  4FOI A;  4JRP A;  1NK6 A;  4CF8 A;  1XI1 A;  4H0P A;  5FPM A;  3PX0 A;  1LWF A;  4N47 A;  1NK9 A;  1U4B A;  5AZI B;  1XWL A;  1BCM A;  3U3G A;  3GG4 A;  4EHU A;  4F2S A;  1A5V A;  1VSL A;  4NCG A;  4F4K A;  4KB1 A;  1YT3 A;  4NB4 A;  5C2F A;  2O8D B;  1M1K O;  2Z1J A;  1BQN A;  1HNV A;  3NMU A;  1W0H A;  4IBN A;  3KLH A;  1BIS A;  2FBX A;  2HOE A;  3OY9 A;  3VMF B;  5BRD A;  2E2P A;  3AO5 A;  3F9M A;  3ID6 A;  3JXU A;  3M8R A;  1U2V A;  3CHW A;  3DWL A;  4HVJ A;  2FBT A;  3SI6 A;  1KSP A;  3T3F A;  1BUP A;  3THW A;  3RR7 A;  3NGY A;  1VSH A;  3IDH A;  5AQR A;  1T6C A;  4NXM K;  4CI6 A;  3P4I A;  2A1R A;  3MCA B;  3ZT4 A;  1SUQ A;  4FYD A;  5HP1 A;  4FVM A;  3N4Q A;  2GEM A;  4AM6 A;  3KLF A;  1LW2 A;  2HB5 A;  4U67 L;  3K58 A;  4E7H A;  3QIO A;  2F96 A;  3IKM A;  4OKJ A;  4EZ6 A;  1N33 K;  1RDC A;  4NLC A;  2DTU A;  1KC8 O;  3N4P A;  4I2Q A;  4KTZ A;  1RT7 A;  3VES A;  3RRH A;  3OA9 A;  1U47 A;  4EHT A;  1W9H A;  1XHX A;  4EP4 A;  3LM9 A;  1CXQ A;  4LF4 K;  1E4F T;  1KFS A;  5J2P A;  4JI5 K;  3LDN A;  2KKZ A;  4O8U A;  3ZET A;  1WN7 A;  3LAM A;  2OTL N;  3B6P A;  4CGI A;  2QEX N;  3CPE A;  5A2Q O;  4CK1 A;  4RWT A;  3R8E A;  4B1Z A;  1T05 A;  4B1U B;  2E8A A;  3MAQ A;  5GAE P;  4J2D A;  2JLE A;  5M1F A;  1V4S A;  4WQ4 A;  2OTJ N;  1T44 A;  4Z0U A;  3VOV A;  2UYT A;  4F3O A;  3ASM A;  2YI1 A;  4CEQ A;  1OH7 A;  4FL9 A;  3QIC A;  4FM1 A;  3QLH A;  4Z94 A;  3LAL A;  1VRU A;  4KAZ A;  4BG8 A;  2F4V K;  4FK0 A;  1WAJ A;  4L3Q A;  4QS7 A;  1R0A A;  3KLI A;  3ULE B;  1HNX K;  3MEE A;  1OH5 A;  5BPN A;  4DTU A;  4KI6 A;  1XNQ K;  2YHB A;  4ISG A;  2OPQ A;  4JKB A;  4JI8 K;  1DEJ A;  3VEO A;  1L5U A;  4IEE A;  1RCH A;  4IEI A;  3D6R A;  5C12 A;  1BU6 O;  4OPA A;  4WQ4 C;  3CMA N;  4NLB A;  4MFB A;  1QS4 A;  3CC4 N;  2BGG A;  2OYQ A;  1EQY A;  4BE0 A;  3CC7 N;  4B8A B;  3C6A A;  3FZK A;  4I6M B;  4BC5 A;  4FJJ A;  1IBL K;  2FBV A;  3DLE A;  3KWI A;  4JD2 B;  3Q7C A;  4BR7 A;  3W3D A;  1HUX A;  5JIC A;  4DTP A;  5KPZ A;  3MXM A;  4AIL C;  1EWQ A;  1HKB A;  1JLF A;  3TTC A;  1RT5 A;  1L3V A;  3SJJ A;  3LPT A;  3TU5 A;  2ZGZ A;  3ZX3 A;  1JJ2 M;  3MXJ A;  3RSE A;  4M3Z A;  3AVL A;  3A5O C;  3L4Q A;  5LJW A;  5JS2 A;  4B08 A;  4CCH A;  4C1N I;  4AM7 A;  3QDK A;  4JKA A;  3TR8 A;  3B6O A;  1Y97 A;  3LDS A;  4XH4 A;  3SBT A;  4EAH D;  4DV5 K;  4QS9 A;  5TKY A;  3VEW A;  4BVP A;  4DLE A;  2QK9 A;  3WNG A;  4FCY A;  2GWJ A;  3PSI A;  3VQ7 A;  3DRS A;  4R5P A;  4FWP A;  2XRI A;  2V7Y A;  4B1V A;  3O3G A;  3AVG A;  3HPG A;  3BGR A;  3AVI A;  3E9O A;  3T1Y K;  1D5A A;  1KLM A;  5AQL A;  2OPS A;  4LH4 A;  5E26 A;  4GVE A;  2O8C A;  3KD1 E;  3WXI A;  4N5S A;  3QEX A;  1RIL A;  3ZSZ A;  4A62 A;  4DUY K;  2OPP A;  1I39 A;  4A59 A;  1HNW K;  1BIU A;  2YHX A;  3RMD A;  4H0V B;  3VGL A;  1VSD A;  3VA3 A;  4JYA K;  4ISF A;  1CZA N;  3D45 A;  3HO1 A;  1BWF O;  3V1O A;  4RCH A;  3KHY A;  3EZW A;  3VQ8 A;  4CF1 A;  3SQ2 A;  5T7B A;  4DF4 A;  1JCG A;  5AQM A;  5SWM A;  3BZC A;  4FJX A;  3DLK A;  3IFR A;  4JAX A;  1TUU A;  1J53 A;  3BDP A;  4RW9 A;  1SS6 A;  3NF8 A;  1RDW X;  2NRR A;  2Q3S A;  5AQG A;  4MDB A;  2BH1 A;  1QE1 A;  4CFA A;  4BR0 A;  2VWB A;  4BR4 A;  4HUE A;  4MLE A;  3QIN A;  1O1W A;  3L6Q A;  1HNZ K;  5C0Y A;  4E7K A;  1VSE A;  2KZM A;  2O8E A;  1TVR A;  4KRE A;  3U9Z A;  2Y1J A;  4PA1 A;  5LY3 A;  3THX B;  4LFA K;  4Z4C A;  3VTH A;  3QES A;  2G8F A;  3QBW A;  3UKU B;  3OYL A;  4DU4 A;  1NGC A;  4O0I A;  1KLN A;  1N36 K;  3T1A A;  5FPE A;  3E9P A;  3CPW M;  4H5N A;  5CE3 A;  1VQL N;  1RT4 A;  2CGJ A;  4OX9 K;  3LP1 A;  3O3H A;  2FSK A;  1YJW N;  4DV6 K;  1NGF A;  4E7I A;  3E9L A;  3O8M A;  1NK4 A;  3MN7 A;  3O4Q A;  4FJH A;  3HP6 A;  4IFE A;  1QQO A;  1NGA A;  2BUP A;  5M1K A;  2YNI A;  4DR3 K;  1NKB A;  2X78 A;  1UAX A;  1XHZ A;  3MEG A;  4DTX A;  3ZEU A;  4I9L A;  3FFK B;  2A3Z A;  4CIE A;  4M7Y A;  1MU2 A;  3NH2 A;  3TI0 A;  1JL2 A;  3SAG A;  2ZJR L;  3DXM B;  4MO5 A;  2E20 A;  3O1W A;  2PFU A;  4IKF A;  4E1N A;  2KFZ A;  1JXB A;  1HKC A;  2B4J A;  4BC2 A;  1LV5 A;  2QA4 N;  3QO9 A;  4OO1 J;  1WB9 A;  1VSF A;  2ASM A;  3TAB A;  1HNI A;  1KVA A;  4DSJ A;  1O13 A;  3WNF A;  4LFC K;  3C7N A;  1ATN A;  3ITH A;  3ZSX A;  4CEC A;  1TK0 A;  5ADX A;  4YOX A;  2ASO A;  2GX9 A;  3U3Y A;  4K8Z A;  4JKE A;  4GV9 A;  2Z1I A;  3KVG A;  3M8Q A;  5ADX H;  1FK9 A;  1NJW A;  5EY4 A;  4DV3 K;  2A6A A;  5KQ8 A;  1GLB G;  3V4I A;  3FR0 A;  2PAV A;  4CFD A;  3CQ8 A;  4CEB A;  4DR1 K;  4E3S A;  3NAE A;  1T8E A;  2P9S B;  4OKE A;  4PL7 A;  4C8O A;  1S72 N;  2NRH A;  4CZG A;  4JI2 K;  1RTI A;  2IDO A;  3QEW A;  4ICL A;  1X9W A;  3TAE A;  2A42 A;  1JLE A;  2DY4 A;  4BR2 A;  4JN4 A;  3LAK A;  4E89 A;  3GL1 A;  1C1B A;  2HHV A;  1GLL O;  4A57 A;  3VEX A;  2JWL A;  4KO0 A;  1KAZ A;  5EVZ A;  3KLE A;  3EN9 A;  3ZCM A;  5JLF A;  3E66 A;  1VQK N; 
#chains in the Genus database with same CATH homology
 1J5E K;  4DV6 K;  2ZM6 K;  4DR4 K;  5FLX O;  4DV5 K;  1IBK K;  4B3T K;  4YY3 K;  4DV4 K;  1HR0 K;  2UUA K;  4X66 K;  4LF4 K;  4B3M K;  3J7A P;  3J7Y P;  4DR3 K;  2UXD K;  4JI5 K;  4K0K K;  4DR5 K;  5IWA K;  4DV7 K;  2E5L K;  4LFB K;  5LMU K;  5A2Q O;  3T1Y K;  4JI1 K;  2VQF K;  3T1H K;  3JAM O;  1N34 K;  4DUY K;  1HNW K;  4DV0 K;  3J81 O;  4X64 K;  4JI3 K;  2VQE K;  4DV2 K;  4GKK K;  4KHP K;  4JYA K;  2F4V K;  5LL6 Z;  4DR2 K;  4JI6 K;  4YHH K;  1HNX K;  4CW7 B;  4CVN E;  4LFC K;  5IT9 O;  1XNQ K;  4X62 K;  4GKJ K;  4JI8 K;  4LF6 K;  4JI7 K;  4DV1 K;  5LMN K;  1XMQ K;  4B3S K;  2UXC K;  5AJ3 K;  5BR8 K;  4DV3 K;  4LF8 K;  1HNZ K;  4V19 S;  3J80 O;  1IBL K;  4JV5 K;  4LF5 K;  4DR1 K;  1XMO K;  4NXN K;  1XNR K;  4JI4 K;  4JI0 K;  4LFA K;  2UUC K;  4DR6 K;  4LF7 K;  4NXM K;  4JI2 K;  1FJG K;  3OTO K;  4LF9 K;  1N36 K;  1I94 K;  4AQY K;  2UUB K;  4DR7 K;  4B3R K;  2UU9 K;  1IBM K;  1N32 K;  2UXB K;  4OX9 K;  4X65 K;  2HHH K;  1N33 K;  4DUZ K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...