5BR8K

Ambient-temperature crystal structure of 30s ribosomal subunit from thermus thermophilus in complex with paromomycin
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
117
structure length
117
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Ambient-temperature crystal structure of 30S ribosomal subunit from Thermus thermophilus in complex with paromomycin
rcsb
molecule tags Ribosome
total genus 26
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2015-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 5br8K00
4CVNE 4DV0K 5LL6Z 4JV5K 4DV3K 4DR7K 3J81O 5BR8K 2UU9K 1N33K 4X65K 4NXMK 2UXDK 5IT9O 1I94K 4LF4K 4X62K 1XNRK 1IBLK 3OTOK 5AJ3K 1N36K 3T1YK 4YY3K 4JI0K 4DR1K 4X64K 2VQFK 2VQEK 4LF9K 4LFAK 4DUYK 4GKJK 2F4VK 4JI5K 4JI2K 5FLXO 1HNXK 4DR4K 4DV5K 4JI8K 4YHHK 3JAMO 3J80O 4K0KK 1HR0K 2UUAK 4LFBK 4JI4K 4LFCK 4DV1K 3J7YP 4LF5K 4LF6K 4B3TK 4CW7B 2UXBK 1J5EK 1XNQK 4LF8K 5LMUK 4AQYK 4DR3K 1XMQK 4JI1K 4LF7K 4DR5K 4DR2K 4JI7K 4DV6K 4DV4K 1XMOK 4NXNK 2UUCK 4B3SK 3T1HK 4JI3K 3J7AP 2UUBK 4B3MK 1N34K 4DV7K 2UXCK 2HHHK 2ZM6K 1IBMK 4JI6K 5LMNK 5A2QO 1N32K 5IWAK 1FJGK 4JYAK 1HNWK 1IBKK 4V19S 4DR6K 4B3RK 4GKKK 4X66K 4DUZK 4KHPK 1HNZK 2E5LK 4OX9K 4DV2K
chains in the Genus database with same CATH superfamily
2YNGA 1VQLN 3SV4A 4FJMA 3ZT3A 4Z4FA 2BGGA 4BRCA 4B1ZA 3MEDA 4CJVA 4CEAA 2HHUA 3H3OB 3OA9A 3F9MA 1NWKA 3ID8A 3OTOK 1QVGM 4E1JA 2D0CA 2VG5A 3DXKA 3HI0A 4FWSA 4G9ZA 4FWLA 4CHQA 1SKRA 2HHQA 3KTQA 2BE2A 4CE9A 3AVJA 3C7NA 4CESA 3IFRA 4B1YB 2YCHA 4CIEA 1VSMA 3MXMA 1C1AA 2HMPA 1U2VA 4FPAA 4Z4GA 2UYTA 1GLEG 1WB9A 3J80O 2O8DA 4DTXA 5KTQA 4BDZA 4B9NA 3J7YP 1BA1A 1TUYA 3MCPA 2QTDA 2P9LB 4KHSA 5JVGL 3RMCA 1WSEA 1SAZA 5M1PA 5CR4A 4YOVA 4H0TB 3KWIA 5T7BA 3CI5A 2QXFA 2Z1JA 4NXNK 2Q2RA 4M3ZA 5J2MA 4KAZA 1WSFA 3VF4A 4DSIA 4KRFA 3E1YA 5ELZA 3V1OA 4KPYA 2O8CA 4JI3K 3DXMB 1IG9A 4R5PA 3TTDA 3H3NO 1X9MA 4OLBA 2UXCK 2DPNA 4PA1A 5LMNK 4IJNA 3BZCA 2ETJA 3VESA 1QQMA 2NLXA 4CEOA 4EFHA 1LAWA 3MMVA 3UKRB 5KGWA 1EKEA 4CFDA 3MXJA 3SUOA 3CJCA 4H03B 3NBPA 4ISEA 4FM1A 4C8NA 3HTVA 1T44A 5EXWA 1G15A 5CZ1A 2FF3B 5HRPA 2AP1A 2QWNA 4HUFA 4DHYA 1GOAA 2FC0A 2Z1GA 3S3MA 3FZMA 4EIAA 3VA3A 1A5VA 1YIJN 4WQ5C 4KV8A 4A59A 2ITGA 5SWMA 3NVMA 3S3OA 4K42A 1ZBIA 3EY1A 4I6MB 4CF9A 5AQIA 3F73A 3G0ZA 2HF4A 4RTFD 2NRTA 5FLXO 2IDOA 2P9IA 3P83D 4IJAA 3ZX0A 4NLBA 4CECA 1KCFA 4FOEA 3RR8A 1U47A 1KAXA 3NCIA 1VK0A 4JI8K 4YHHK 2D0BA 3WNHA 4BC2A 4FM2A 1TL3A 2HOEA 5JMVA 1QHAA 4H4MA 5FPDA 4UQGA 4LF5K 1OKJA 3THYA 3VQDA 3AO3A 1YAGA 2O8EB 4EP5A 3OYCA 4LF8K 3NH0A 2Q0RA 4DR3K 4ZTJA 2X74A 4AF1A 3HSTB 1RDDA 2QKBA 1XC9A 4JKGA 4IFVA 1NGAA 1SQKA 1VSLA 2ASPA 4DTJA 1RDCA 3U9DA 3CMEN 5AFUH 4BRGA 3SAHA 3CM6A 3MEEA 4ID1A 2IIRA 3O4QA 5AZIA 3DRSA 3OYEA 2D5RA 2HHWA 4LD0A 2QEXN 2GUIA 3HRGA 2HBKA 5JVHL 4A57A 2CGLA 3QNOA 1RT4A 4DWIA 4H0XB 4JKFA 3HL8A 4FJ5A 1NG9A 1IBKK 4YOWA 3QEXA 1YI2N 4DFMA 5KPZA 4KHPK 5AQWA 1DLOA 2FBXA 2RHKA 3WNGA 1RTDA 4O0IA 4GVMA 2XO7A 2YHWA 4O8KA 4DR7K 4DMNA 1S9EA 2OANA 2EX3A 2WTUA 2P9SB 3V1RA 4I9QA 1SZ2A 2CGJA 4RCHA 4KH6A 3GE1A 2F8TA 4XIUA 3PSFA 2WC9A 4H5RA 5DM6L 2YNFA 4PKHA 3C0BA 1RDAA 4FJ7A 1ZBHA 3OY9A 2W6KA 4N47A 3GG4A 4CHZA 3AVAA 2E2PA 3TAQA 3ENOA 3DYAA 4BWMA 4JI0K 5BRHA 3OYBA 3MX2A 3OJSA 3OS2A 3TAPA 3VQPA 2XY8A 5CZ2A 1J5OA 3CC2N 4W5QA 4HWIA 5JLHA 1S5JA 1X1PA 4DQRA 5CY4A 4CFCA 3ZT2A 3OBWA 2P9UB 4GV3A 1HNVA 4B9VA 4ILJA 2E1ZA 3B8AX 2QKKA 1KTQA 4F4KA 3LDOA 1NGDA 1J54A 4CGDA 1K9MO 2DTUA 4CJUA 4NYFA 3TTCA 5J1EA 2QXLA 4JS5A 1K8KA 2KW4A 3CJ7A 5K14A 5HRNA 5B8HA 1BGXT 4C8LA 4DR2K 2OA8A 4C23A 1Q82O 3LP1A 2P9PB 2FXUA 4BDYA 2Q31A 4IDKA 5TKWA 4WQ5A 3L2VA 2G8IA 2IC3A 2HNYA 1Q9XA 4KTWA 4RW8A 4FJIA 3SBTA 1J6ZA 4M3TA 3CC7N 2HHHK 3O9QA 4BQLA 4DKWA 4CD3A 5FPMA 2ZD1A 5GAEP 2ZJRL 4FVUA 3THXB 1T7PA 4K41A 1HNZK 4I2PA 5BN8A 1UAXA 4CZFA 3SCXA 3VF6A 4M7YA 3QBWA 3VQAA 3LDLA 4JKHA 4PL7A 2D4WA 4B1WB 2VWJA 3CCRN 1V4SA 4CZGA 3T7ZA 1HRHA 2YV0X 3EE9A 3N4PA 2UXDK 4OLAA 4FLZA 2QM1A 3EL2A 4LC9B 4LF4K 2RE2A 2ATQA 1LAVA 4H0VB 3HK2A 1RDWX 1VAZA 2PZSA 4OKKA 3LAKA 5AQSA 3C6HA 3VTHA 1VRTA 4E7KA 3ZLJA 5KPTA 1TVRA 1S6PA 1YHQN 5JLFA 2NUBA 4MQ3A 1JLGA 1GLBG 4CJTA 1BUPA 3F5TA 3ZT4A 4BVOA 3WXKA 3HT3A 1Q7YO 1E3MA 1T6DA 4C1NK 4JLHA 4FPBA 3EZWA 1JCFA 4Z4EA 1JCGA 2QA4N 3RRGA 1XMQK 3M8QA 1NGGA 2QWRA 2P9NA 3B6OA 3L6QA 3FR0A 2BH1A 3D45A 5EOYA 4DV4K 4C8MA 3ATUA 1N5YA 2E6LA 1QSLA 3SYZA 4CJLA 4FWOA 1W2BM 3J7AP 2UUBK 3RTVA 3MECA 4R79A 3L2QA 3D0PA 5SZTA 1RT5A 2ZM6K 2OYQA 1KD1O 4ID5A 4CF2A 1HNWK 3QO9A 2HVIA 4O5BA 4C8OA 5KRTA 4E7LA 4V19S 3DAWA 2FSJA 4Z4IA 2F7TA 4HVJA 4WCEL 3AV9A 3ISNC 4DV0K 3C6TA 4YFUA 4HTUA 1S1XA 5C24A 4FWKA 3HVTA 3KHYA 5KQDA 1BL3A 4A62A 3ZYYX 2G8HA 4CK1A 1TAUA 2VGMA 1N33K 4CJKA 3DMJA 4CEEA 3LM9A 2KLAA 2ZGZA 2QWLA 1RILA 3SUPA 4MDAA 4DQPA 1HPZA 2J4RA 3ZX2A 1QTMA 3CQ8A 4J2AA 3O3FA 3UKUB 4N56A 2AA4A 2QWPA 4A61A 4NCBA 1NM1A 2D0PA 2P1JA 3KIOA 4JKCA 3BDPA 4GKJK 1D9DA 4CZEA 1YJWN 2W40A 2HHTA 1BI4B 4ISFA 4GMJB 1BG3A 3QFPA 3KJVA 3AO4A 3GOIA 2X6NA 1ASUA 5M1FA 1GLFO 1BWFO 3KK3A 2FBTA 1F21A 3WUHA 3I56N 4Z4CA 4BRFA 3AVFA 3VQBA 1Q9YA 4JD2B 3V6DA 1X3NA 1R0AA 3HO1A 1S72N 3OYJA 4BR2A 5AQXA 3CJBA 1FKPA 2ZQBA 2YHAA 4JKBA 3T69A 1W7AA 2VG7A 3R3LA 3P39A 3SQ1A 4CCHA 3H6EA 1WSIA 2OCEA 1NKCA 4AM7A 1RDUA 4YDUC 5AQHA 4Z0UA 3HM8A 4QCLA 4B3SK 1DTTA 2VWBA 1NGFA 3CHWA 4YOTA 1M1KO 1JXEA 3ZSZA 3ZT1A 5M1KA 4H4OA 2O8BA 4JKAA 4M7XA 3AA4A 4FOIA 1RBSA 4CZHA 4CHNA 4B1XB 5M1QA 4CJ5A 1C0GA 3AA2A 3NF7A 4AH9A 4CBUA 1NGEA 2A1RA 4C1NI 4OPJA 3K9KA 1H1VA 4FJ8A 3IS9A 1OH5A 1QZ5A 4CZJA 3SZ2A 2GBZA 1NNEA 3UE5A 2OTLN 5F1XA 1HQUA 5BR8K 1UA0A 1WUAA 5C10A 3K5MA 3UIQA 3I8DA 3DRRA 2E88A 1L5UA 4RW9A 1XWLA 2IVOA 3SQ0A 3TU5A 3M8PA 1HMVA 3BY5A 1QSYA 3V9WA 4LY7A 1ITGA 2P9KA 3V9XA 2ZF5O 4CK2A 1HQEA 3C6AA 2BUPA 4CHOA 2O8FB 2W41A 3J7ZO 4JRQA 4K8ZA 4ZHRA 1JLEA 3QESA 3LANA 3MN9A 2QWOA 4DLGA 5GAGP 1DT9A 3HJFA 1X9SA 4H0PA 4E7JA 4JK8A 4CJFA 2A40A 2VWKA 3ALYA 3DM2A 3NF6A 3NAEA 3KD1E 4DV1K 1BCOA 4LF6K 1KFDA 2E2QA 2Q0UA 4A2AA 3M5RA 1S1UA 3RSEA 5AZJB 3HOTA 1JJ2M 3ATVA 3VA0A 5AQKA 3U4LA 4O5FA 3CCEN 4CBWA 3P4IA 2YNHA 3UKRA 3TTFA 1TAQA 3O9UA 1SUQA 2YKMA 4CJ3A 2UUCK 3SLCA 1ZBSA 1REVA 3SJJA 3L8BA 3DI6A 1VSKA 3O9SA 5I9EB 4PUOA 1IJJA 4IO8A 1TYQA 1L3VA 5DK5A 4FLYA 4QS9A 4DTOA 3TAEA 3UB5A 3QB0A 1QSSA 4GW6A 3AVKA 4M3RA 3ZETA 4PY5A 4GKKK 3CCVN 3AVIA 1M90O 1NGHA 1QZ6A 2D1KA 2NRVA 4OGEA 3MK6A 3HOSA 4GNIA 3DLBA 4JV5K 2WUSA 4B9SA 4FWNA 2G8UA 3J81O 1WN7A 3NDKA 3PV8A 1NGJA 4DSKA 3CJ1A 3DLHA 4DTNA 3CM5A 3MCAB 1QE1A 1O13A 3KK7A 5IT9O 4OJRA 3VF2A 4Q5VA 4HUEA 4B8AB 4X62K 1KVCA 3DRPA 3DXKB 3IUCA 3SK3A 3AY9A 4KTZA 4YDUA 5DMRA 3VQEA 1OH8A 4X64K 1DEJA 3LP0A 3THVA 1QS4A 3EYZA 3L3VA 4CIFA 1VQON 1CZBA 5FROA 5ADXA 3CCQN 3LL3A 1U2VB 2P5OA 3VEVA 5C2DA 3QETA 3CIPA 2KQ2A 3SQ2A 4ELVA 2W42A 4FM0A 2B6AA 3OYLA 5AQZA 3CCSN 2DY4A 5BPNA 1S1WA 3SMPA 1NJZA 2ASMA 4TSXA 4BR7A 4LFCK 2RF2A 3W3DA 4DF8A 4B3TK 4U67L 2F96A 1WSGA 3V1QA 1J5EK 1Q18A 4FJHA 1DGKN 4H5TA 4CF1A 4E89A 3AAQA 3SAGA 4GV6A 3FFIA 1NU0A 1N6QA 4J2EA 3SBGA 4LH4A 2KHOA 1ZYQA 3ENBA 2A3ZA 3OJUA 3E9OA 3ITHA 4B1UB 2O8CB 2GTDA 3LWLA 4PKIA 3OYHA 4QS8A 3CCMN 2D0AA 4O44A 1IKWA 1NBWA 3OYGA 1IKYA 1BQNA 5A2QO 1HYSA 1ZBLA 1VQ5N 3B6PA 4F9OA 1HJRA 3OHRA 3HP6A 1XHXA 3T3FA 2Q36A 2GEMA 1SV5A 3CQXA 5TKYA 1NKEA 3D7EO 4DUZK 4CEBA 4CF8A 4DTSA 1YT3A 1ZC6A 3BP8A 1GLJO 3CCJN 4KH4A 4CVNE 4IOCL 2XY5A 1OVQA 4EZ9A 1HJOA 2F9TA 3H46O 5C15A 1SS6A 1A5XA 3DLLL 3OYIA 2O4GA 2QWQA 5FDLA 3EE8A 1JCEA 1HKGA 2HVHA 4CZMA 4BR9A 1Q86O 1YJ9N 1I3AA 3IMXA 1RFQA 2NZTA 3CPWM 2XY6A 3NF9A 4ZTFA 4ELUA 2KFZA 3HBTA 2VQEK 5AQMA 3SPYA 4J2BA 2IS3A 2WBNA 4N5SA 2GUPA 2FBVA 3QBXA 5HL7L 4CGFA 1SKSA 1JLFA 2CH6A 3G4SN 3VENA 4CJSA 3M8SA 4B3OA 1BO5O 3QDKA 1JLQA 2D0OA 1NK4A 4DSEA 2E8AA 1HR0K 1W0HA 5GADP 1VRUA 4LFBK 4JI4K 4CEFA 3DLRA 3THYB 2WONA 3LAMA 4NCAA 2ZWHA 3FZHA 3VETA 4WYBA 4M3XA 3O9RA 2H3GX 3BF3A 4JI1K 4CJ7A 4ISGA 4F8RA 1IV0A 1ZBUA 3LPTA 3THXA 2G8WA 3K5LA 1EXQA 3O08A 1YF5L 2PBDA 4B9MA 5AZIB 3T1HK 3FZFA 4CZLA 3NVKA 4BR4A 1RT6A 3M3ZA 2OTJN 4DTUA 2KZZA 3THWA 2GV9A 3KLHA 1OH6A 3VEZA 3VEYA 4I7FA 3ZX3A 3U9ZA 3AVGA 4CJPA 1LWCA 4DTPA 4XH4A 5AQVA 3MXIA 2ZJPL 3R9PA 3O4WA 4OX9K 4KI4A 1WNSA 1L3TA 2NRXA 2I5JA 1BU6O 3JYTA 3I0RA 4FSVA 1ESVA 3DLEA 3KKSA 3LDQA 3PO4A 3PLAA 3LZIA 2NRZA 1N8RO 1ASVA 3TANA 2PFUA 2HBMA 4X65K 4YOXA 3BF1A 1RTJA 3VERA 4H5WA 4A5BA 4DQSA 3AO2A 3NE6A 3CG7A 5J2QA 3WEEA 1VQNN 3AAPA 5AQFA 3AA5X 1HUXA 4PQUA 3T1YK 2VYPA 3I33A 4FCYA 3K5OA 1RTIA 3HPGA 3WQTA 3DJCA 3G25A 1NK0A 2FSKA 1VSHA 2JWLA 2HSTA 3MN6A 1Z6RA 5AQRA 3M1FA 3IG1A 3AVLA 3SNNA 2V7ZA 1IKVA 1YVNA 4XH1A 1VSEA 5AQUA 3OYKA 3A0IX 5HROA 1CXQA 1HPMA 3C6UA 3BZKA 2HF3A 4BE2A 3PO5A 3FZKA 2E4LA 4OO1J 4JHDA 1GOCA 3KKRA 1U4BA 2F9WA 3ZSXA 4KHWA 3VQ9A 1VQMN 3BGRA 3VQ7A 3WXIA 4DSLA 4CW7B 4LSLA 5HBMA 3SUNA 1J53A 1WBBA 2W6LA 2HMIA 5E26A 3WQUA 4DR5K 1RBRA 4BRMA 3VPZA 2PAVA 3RR7A 4KREA 3WNEA 1JLAA 4JRPA 2NRHA 1HLUA 1TK8A 4BDPA 3G6EN 2A41A 4B9LA 4U7BA 4FJXA 1E4FT 4BWJA 3QEIA 1XQSC 2E6MA 4JK9A 1RBVA 5GIOA 2VGNA 3KK2A 4JKEA 5CE3A 3LDPA 1Y64A 1NK8A 1VQ9N 1KLMA 3ENHA 3K58A 1TK0A 3KD5E 4JI6K 4DS5A 3ZEUA 2E20A 3AO5A 4FJ9A 2XY7A 1B92A 1NOZA 3CCLN 3QEWA 4JS4A 4DR6K 2OZSA 3HVRA 4AHTA 3WXJA 1C0UA 2FBYA 1Y97A 2HB5A 3L2WA 4CHPA 2Y1JA 3ULEA 4CGIA 3D2FA 1VHXA 1SL0A 4FLVA 4CGGA 1KVAA 3CQYA 3CMAN 4AILC 2DFHA 3LPUA 5ADXH 4FJLA 5BN9A 3HPHA 4O55A 2YHBA 1I94K 4KB1A 4KO0A 1IKXA 3QFUA 3CC4N 3V4IA 4WFAL 1BDGA 3OVNA 4IDHA 4W5RA 2HHXA 4BRQA 3V9UA 1W97L 4B9QA 3EN9A 3QEPA 4LFAK 4IWVA 4DUYK 1Q8IA 1Z26A 4WQ4C 5CYQA 5GAHP 4N41A 3K59A 3T19A 3MEGA 4EAHD 5AQJA 2CH5A 3H45C 3RVCA 1O1WA 4CF0A 2GWKA 3A5MC 1NGCA 1VQ7N 5AQNA 4YORA 5M1NA 5C42A 3NGZA 1T05A 3SMSA 1XUPO 2Q97A 1SKWA 4RG8A 4YNQA 2UXBK 3R8EA 1S1TA 1KC8O 3IKMA 4FO0A 3LALA 3ULDA 2P9NB 3SQ4A 4JKDA 4DG1A 2RN2A 4E1MA 2JLEA 1IH7A 1TKXA 1QQOA 2Z1IA 3E9PA 5C25A 3M8RA 3C65A 4I9LA 4ILHA 3FE1A 4FLUA 4ILGB 2NRRA 4OPAA 4DSFA 1C0FA 5BPMA 1IO2A 4B3MK 5EU7A 2YJEA 4OKEA 1RTHA 4BC3A 2E2OA 3QLHA 4L3QA 1SL1A 5IWAK 1WSJA 1SL2A 2HW3A 4IEIA 1BOTO 4RW4A 2JWKA 3MWPA 5EY4A 3NGYA 4PWDA 1FW6A 3D2EA 3KLGA 1RGIA 3MN7A 3FLCO 3CFOA 3VEXA 2VCPA 5LY3A 3LZJA 2RPIA 4XEIA 3O6WA 1HYVA 4FZXC 3MX5A 1NK9A 3SAFA 4RWTA 2BTFA 4W5OA 1CLQA 4FYDA 2YNIA 2Q3SA 2YX6A 3TSQA 1VQPN 1QQNA 3VQ4A 1HNIA 4C8KA 4CI6A 3LP3A 1BA0A 3OS0A 3QERA 3EKUA 4CEZA 5GINA 1EQYA 4DB3A 2VQFK 4AHCA 4LH5A 2V7YA 2PYJA 3P5JA 4DLEA 4BGAA 5DM7L 1L3UA 4KBOA 2V51B 4CJEA 4BC4A 3SI6A 1TGOA 3EEQA 3EZ5A 5FPNA 4N76A 2BANA 3IRXA 1FK9A 3PY8A 3F9KA 5HLFA 1RNHA 2OPQA 3RMAA 3AGRA 5F0XA 4DSJA 4DU4A 4MDBA 3SJHA 2P9LA 4A2BA 4J2DA 4IO9L 3H08A 3LWMA 4FZZA 4CJWA 4E19A 3K57A 2ZJQL 3WNFA 1S3XA 2B5JA 2I7PA 1TKDA 3O9TA 3VGMA 4EHTA 1WOQA 4IKFA 2E2NA 1D8YA 3G71N 4E7IA 1UA1A 3GL1A 4PL8A 1A5WA 1KXPA 4A5AA 3DXMA 1LWEA 2O8BB 1TK5A 1ILYA 3TSPA 3MDQA 4W5TA 5KQ8A 1RCHA 2FF6A 2KZMA 4WQ4A 3L4QA 3R1XA 4IZ9A 5AQYA 5BRFA 5LJWA 3FFKB 4BRAA 4CJRA 2ZGYA 4HUGA 3A8YA 2Y1IA 4FK2A 3QIPA 1T03A 4BVPA 5I3UA 3VOVA 4H5NA 1GOBA 1X9JA 5MLCQ 4JEPA 3DWLA 4Y1DA 3V9SA 4RW6A 4DFJA 1HKBA 4GVEA 4NXMK 1OVYA 1JL2A 3IDHA 1ASWA 5AQQA 3LDSA 3HM9A 3RWUA 4H0YB 2A5XA 4BGBA 4F2RA 3Q7BA 1NK6A 1S1VA 2V52B 3O1BA 2P9KB 3KLEA 4MFBA 4M41A 4BR0A 2AJQA 3L2RA 4LF9K 3WXLA 4QS7A 2X6SA 1TV6A 3AVCA 5E41A 4I6MA 4CJ4A 4KI6A 4DF4A 3I0SA 3LDNA 2HHSA 4DV5K 3KZBA 3CFRA 4OGCA 4AHUA 4CJQA 1KVBA 1Z05A 1EETA 3JAMO 2XRIA 3K5NA 4Z94A 4BY9C 4KHNA 4IBNA 4KB0A 1EWRA 3PSIA 3RSEB 1RDBA 1BQMA 4MO4A 1T6CA 3AO1A 2O8EA 3P31A 4M63C 4AQYK 5I42A 3C7NB 2GWJA 1FKOA 3VN5A 1C0TA 4OKJA 2NNWA 2P5GA 5BPLA 2HBLA 1XMOK 1X3MA 2O8DB 3CJ9A 3FZLA 3Q7CA 4FK0A 1TYQB 1J9AA 1QVFM 1VQ8N 1N32K 2NRWA 3O1WA 4FWQA 3HYFA 1ATNA 3ZSYA 3ZETB 3VEWA 1U49A 3OYMA 4B3RK 4CZKA 3KVGA 4E0DA 3HZ6A 3VQ8A 4FWRA 4FW2A 5M1OA 3F2KA 4G1QA 3N4QA 1FXXA 5LL6Z 5C2FA 1BIZA 1EX4A 4BRPA 1JLCA 3O80A 4FW1A 1NJYA 1GLDG 4IXCA 2UU9K 1P8ZA 2P9SA 4NCGA 4BE1A 3D6RA 4CK3A 4CFBA 1C1BA 3DOKA 1EWQA 3WT0A 3SV3A 1C0MA 3L2UA 1U04A 4WFBL 3BUZB 3PX6A 2WFBA 4FLWA 4YY3K 3OYNA 2OPRA 4DR1K 4FJKA 4DCHA 5HOOA 4FLTA 4E1NA 4DQIA 5JS2A 2G8VA 5LJVA 5F2RA 2KFNA 4JN4A 4DU1A 3CFPA 2EWSA 1CXUA 4CFAA 3S9HA 1YTAA 5KI6A 3MN5A 1RBUA 2QWMA 4B8CA 2QW9A 3K9JA 1ATSA 2P9UA 4IFEA 1G99A 4IOXA 3E01A 3VMFB 3CD6N 1WSHA 3TPQA 2B4JA 4KHUA 3PIPL 5AQPA 4M45A 3VQ6A 3V9ZA 3FGUA 2R7YA 3AGKA 5GIPA 5C12A 2KTQA 3PUFA 4K25A 3SUQA 3RRHA 4FJJA 5AR0A 2P9IB 1HKCA 2GELA 4DV6K 4O0JA 4WF9L 2P9PA 5BRDA 5KPRA 1OH7A 1W9HA 4BRKA 4BG9A 3AVNA 3ZT0A 3DLGA 1YXQA 3TR8A 2YKNA 1HX1A 4KHYA 3MWTA 4BACA 1LV5A 1B9FA 5JS1A 1GLAG 1FJGK 4JYAK 1GLCG 3QEVA 4JKGB 3TAGA 4IG3A 3O3HA 4W5NA 4J8FA 4MLHA 5HRRA 3ZSRA 3E9LA 1TL1A 1MU2A 3PIOL 4M3YA 1K6YA 3AVMA 3QIOA 4EP4A 3CPEA 1CZ9A 2ITMA 1D4XA 4O4GA 4B9UA 2I7NA 3HP9A 1YJNN 3G10A 2P51A 2QI2A 4CERA 1VQ6N 5JICA 3A5LC 4QOZB 1NKBA 3L4IA 2XHBA 3NH2A 2A6AA 1C6VA 4YOUA 2CGKA 1CZAN 1IBLK 3HSCA 5AJ3K 4CBXA 1MWKA 4CD1A 3PX4A 4HHTA 3CF5L 3KWGA 3ZSVA 3TAFA 1DTQA 3OYAA 2ASOA 3A2FA 3OW2M 2RKIA 3VQQA 1NGBA 1ZBFA 1LWFA 1U45A 2VG6A 4CZIA 1Z25A 1HNXK 3U3GA 2FLOA 3VQCA 4CIGA 3HPOA 3GDQA 4KFBA 3TABA 1IG8A 1UWBA 1YUWA 2HBJA 1MA9B 4FVMA 2IOCA 3O4NA 4FL9A 3MAQA 2OPPA 3TARA 5H1SQ 4Y0WA 5BREA 3S3NA 3S41A 5HP1A 1NMNA 1XNQK 4XH5A 1KSPA 2DFEA 4Y1CA 2EHGA 3NFAA 1MDUB 4CHYA 3V81A 3BEXA 4LF7K 3T1AA 4DFKA 1NLVA 3H1QA 3QNNA 4NO7A 2FSNA 2IGIA 4ICLA 5CHIA 4DS4A 4DQQA 4DTRA 1VSJA 3A5NC 4BRLA 2YI1A 5EVZA 4JAXA 2IAJA 4LSNA 4UY8O 4FJGA 4Q0BA 1YITN 4BE0A 4DV7K 1ZXOA 4Z4HA 2A42A 5C0YA 1HYZA 5D3GA 5HRSA 1K8KB 4WE1A 3THWB 3LM2A 3QICA 1KQSM 1JLBA 4F3TA 1C1CA 1RT1A 2F8SA 4BROA 4DTMA 1YTUA 1TKZA 2WOMA 3IAYA 3VTIA 3ZSOA 3NMUA 4DU3A 4K43A 4DV2K 3VGKA 1VSIA 1YVUA 3LP2A 3KLFA 3GBTA 3NGIA 4BR5A 2G8KA 3TWHA 4FXDA 4NB4A 1LCUA 3C94A 4DFPA 1T3VA 3M6GA 1VSFA 4FJNA 3U3YA 4FWPA 1WLJA 1WAFA 2GX9A 3WEEB 4HCBA 2A1SA 4BRDA 4OPHA 3TI0A 2BDPA 5AQLA 4WFNL 1KAZA 3ZSWA 4K8XA 1EO1A 1N36K 3AVHA 3W0LA 3EKSA 3UKUA 3O5BA 3P1GA 2PY5A 4ELTA 1NOYA 3QINA 3HXMA 1WBDA 4EHUA 3VEOA 1NJXA 1MWMA 1Q81O 4B9TA 3JXUA 4CGHA 2F4VK 4JI5K 2IVNA 4BRIA 3RMDA 4EZ6A 4JI2K 1BI4A 1NGIA 4IG0A 3KLIA 1UOCA 4GV9A 1DKGD 3CCUN 2IVPA 3A5OC 1T8EA 2YJFA 3JSMA 4JHDB 3ZCMA 1NJWA 1GLLO 4M42A 4H0OA 4KH5A 4L8RB 1L3SA 1EP4A 4JD2A 3O8MA 4AM6A 1S22A 3SPZA 1B9DA 1QQCA 1NJIO 4BREA 3DOLA 4M3WA 4E7HA 3NH1A 2HNZA 3L3UA 4CEDA 3ID6A 3EO3A 4JI7K 1U6ZA 3NF8A 3ASMA 4IFYA 3NHGA 1KLNA 5J2NA 3TSUA 4FLXA 1KAYA 1LW2A 1P90A 1KRPA 5EX5A 1D5AA 3TAMA 1NMDA 2OPSA 4JNEA 2YHXA 4JK7A 3ZEUB 3ZSQA 3U6FA 2QK9A 2E1YA 2PYLA 1R59O 3CYMA 1K8AO 1NK7A 1LOTB 3VQ5A 3QMLA 5FRMA 1E4GT 1D9FA 3OS1A 3AA3A 1I39A 4X66K 3CETA 1S6QA 4B08A 5AFUA 2E5LK 2HHVA 4BRHA 3OBYA 2LSNA 4NYNA 4KHQA 3ULEB 3D2FB 2HNDA 4DV3K 5CYMA 1RT7A 2O4IA 3KK1A 2G8FA 3JS6A 1V4TA 4MLEA 3WXMB 4RW7A 4KTQA 3CJAA 4MO5A 5BR9A 1XNRK 4IEEA 4H8KA 3DLKA 3RMBA 4PHTX 2OZMA 4BC5A 1X9WA 2DFFA 4BG8A 1XC3A 1TUUA 4QAGA 3L0QA 1JL1A 4O8UA 4FWMA 2O8FA 1ATRA 4FK4A 2JGUA 4DR4K 4CGJA 1BIUA 1XI1A 5J2PA 4I2QA 4BQZA 1XHZA 4K0KK 5E84A 5FRNA 5AQTA 3VGLA 2UUAK 2KKZA 3U8XA 4F2SA 3OYDA 3AARA 4FZYA 4CEQA 5AQGA 1VQKN 4F3OA 4B1VA 4HCCA 3PX0A 3I8BA 1TKTA 1NK5A 5AZJA 5LMUK 3K0SA 4E3SA 5KRSA 3R6MA 3O3GA 3K2PA 5KGXA 3P38A 1BCMA 4PKGA 4AHVA 3I55N 5AQOA 1QHTA 1JKHA 1JXBA 1WAJA 4AHRA 3J8AA 4KKOA 1U48A 2X78A 1KFSA 3E66A 4OVLA 4OPKA 2Q1NA 1RT3A 4H5VA 4M3UA 1N34K 1S9GA 2Z1HA 1IBMK 1RBTA 1BHLA 3CERA 4GY2B 4BRNA 4HTLA 3AVBA 3OYFA 1RT2A 4YOYA 3H1VX 3CXCM 1BISA 4NLCA 4IOAL 4AHSA 4DQ8A 2YHYA 5FPEA 3D2EB 1VQ4N 1VSDA 2ZE2A 3C95A 1K73O 1LW0A
chains in the Genus database with same CATH topology
4CVNE 4DV0K 5LL6Z 4JV5K 4DV3K 4DR7K 3J81O 5BR8K 2UU9K 1N33K 4X65K 4NXMK 2UXDK 5IT9O 1I94K 4LF4K 4X62K 1XNRK 1IBLK 3OTOK 5AJ3K 1N36K 3T1YK 4YY3K 4JI0K 4DR1K 4X64K 2VQFK 2VQEK 4LF9K 4LFAK 4DUYK 4GKJK 2F4VK 4JI5K 4JI2K 5FLXO 1HNXK 4DR4K 4DV5K 4JI8K 4YHHK 3JAMO 3J80O 4K0KK 1HR0K 2UUAK 4LFBK 4JI4K 4LFCK 4DV1K 3J7YP 4LF5K 4LF6K 4B3TK 4CW7B 2UXBK 1J5EK 1XNQK 4LF8K 5LMUK 4AQYK 4DR3K 1XMQK 4JI1K 4LF7K 4DR5K 4DR2K 4JI7K 4DV6K 4DV4K 1XMOK 4NXNK 2UUCK 4B3SK 3T1HK 4JI3K 3J7AP 2UUBK 4B3MK 1N34K 4DV7K 2UXCK 2HHHK 2ZM6K 1IBMK 4JI6K 5LMNK 5A2QO 1N32K 5IWAK 1FJGK 4JYAK 1HNWK 1IBKK 4V19S 4DR6K 4B3RK 4GKKK 4X66K 4DUZK 4KHPK 1HNZK 2E5LK 4OX9K 4DV2K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CVN E;  4DV0 K;  5LL6 Z;  4JV5 K;  4DV3 K;  4DR7 K;  3J81 O;  5BR8 K;  2UU9 K;  1N33 K;  4X65 K;  4NXM K;  2UXD K;  5IT9 O;  1I94 K;  4LF4 K;  4X62 K;  1XNR K;  1IBL K;  3OTO K;  5AJ3 K;  1N36 K;  3T1Y K;  4YY3 K;  4JI0 K;  4DR1 K;  4X64 K;  2VQF K;  2VQE K;  4LF9 K;  4LFA K;  4DUY K;  4GKJ K;  2F4V K;  4JI5 K;  4JI2 K;  5FLX O;  1HNX K;  4DR4 K;  4DV5 K;  4JI8 K;  4YHH K;  3JAM O;  3J80 O;  4K0K K;  1HR0 K;  2UUA K;  4LFB K;  4JI4 K;  4LFC K;  4DV1 K;  3J7Y P;  4LF5 K;  4LF6 K;  4B3T K;  4CW7 B;  2UXB K;  1J5E K;  1XNQ K;  4LF8 K;  5LMU K;  4AQY K;  4DR3 K;  1XMQ K;  4JI1 K;  4LF7 K;  4DR5 K;  4DR2 K;  4JI7 K;  4DV6 K;  4DV4 K;  1XMO K;  4NXN K;  2UUC K;  4B3S K;  3T1H K;  4JI3 K;  3J7A P;  2UUB K;  4B3M K;  1N34 K;  4DV7 K;  2UXC K;  2HHH K;  2ZM6 K;  1IBM K;  4JI6 K;  5LMN K;  5A2Q O;  1N32 K;  5IWA K;  1FJG K;  4JYA K;  1HNW K;  1IBK K;  4V19 S;  4DR6 K;  4B3R K;  4GKK K;  4X66 K;  4DUZ K;  4KHP K;  1HNZ K;  2E5L K;  4OX9 K;  4DV2 K; 
#chains in the Genus database with same CATH topology
 2YNG A;  1VQL N;  3SV4 A;  4FJM A;  3ZT3 A;  4Z4F A;  2BGG A;  4BRC A;  4B1Z A;  3MED A;  4CJV A;  4CEA A;  2HHU A;  3H3O B;  3OA9 A;  3F9M A;  1NWK A;  3ID8 A;  3OTO K;  1QVG M;  4E1J A;  2D0C A;  2VG5 A;  3DXK A;  3HI0 A;  4FWS A;  4G9Z A;  4FWL A;  4CHQ A;  1SKR A;  2HHQ A;  3KTQ A;  2BE2 A;  4CE9 A;  3AVJ A;  3C7N A;  4CES A;  3IFR A;  4B1Y B;  2YCH A;  4CIE A;  1VSM A;  3MXM A;  1C1A A;  2HMP A;  1U2V A;  4FPA A;  4Z4G A;  2UYT A;  1GLE G;  1WB9 A;  3J80 O;  2O8D A;  4DTX A;  5KTQ A;  4BDZ A;  4B9N A;  3J7Y P;  1BA1 A;  1TUY A;  3MCP A;  2QTD A;  2P9L B;  4KHS A;  5JVG L;  3RMC A;  1WSE A;  1SAZ A;  5M1P A;  5CR4 A;  4YOV A;  4H0T B;  3KWI A;  5T7B A;  3CI5 A;  2QXF A;  2Z1J A;  4NXN K;  2Q2R A;  4M3Z A;  5J2M A;  4KAZ A;  1WSF A;  3VF4 A;  4DSI A;  4KRF A;  3E1Y A;  5ELZ A;  3V1O A;  4KPY A;  2O8C A;  4JI3 K;  3DXM B;  1IG9 A;  4R5P A;  3TTD A;  3H3N O;  1X9M A;  4OLB A;  2UXC K;  2DPN A;  4PA1 A;  5LMN K;  4IJN A;  3BZC A;  2ETJ A;  3VES A;  1QQM A;  2NLX A;  4CEO A;  4EFH A;  1LAW A;  3MMV A;  3UKR B;  5KGW A;  1EKE A;  4CFD A;  3MXJ A;  3SUO A;  3CJC A;  4H03 B;  3NBP A;  4ISE A;  4FM1 A;  4C8N A;  3HTV A;  1T44 A;  5EXW A;  1G15 A;  5CZ1 A;  2FF3 B;  5HRP A;  2AP1 A;  2QWN A;  4HUF A;  4DHY A;  1GOA A;  2FC0 A;  2Z1G A;  3S3M A;  3FZM A;  4EIA A;  3VA3 A;  1A5V A;  1YIJ N;  4WQ5 C;  4KV8 A;  4A59 A;  2ITG A;  5SWM A;  3NVM A;  3S3O A;  4K42 A;  1ZBI A;  3EY1 A;  4I6M B;  4CF9 A;  5AQI A;  3F73 A;  3G0Z A;  2HF4 A;  4RTF D;  2NRT A;  5FLX O;  2IDO A;  2P9I A;  3P83 D;  4IJA A;  3ZX0 A;  4NLB A;  4CEC A;  1KCF A;  4FOE A;  3RR8 A;  1U47 A;  1KAX A;  3NCI A;  1VK0 A;  4JI8 K;  4YHH K;  2D0B A;  3WNH A;  4BC2 A;  4FM2 A;  1TL3 A;  2HOE A;  5JMV A;  1QHA A;  4H4M A;  5FPD A;  4UQG A;  4LF5 K;  1OKJ A;  3THY A;  3VQD A;  3AO3 A;  1YAG A;  2O8E B;  4EP5 A;  3OYC A;  4LF8 K;  3NH0 A;  2Q0R A;  4DR3 K;  4ZTJ A;  2X74 A;  4AF1 A;  3HST B;  1RDD A;  2QKB A;  1XC9 A;  4JKG A;  4IFV A;  1NGA A;  1SQK A;  1VSL A;  2ASP A;  4DTJ A;  1RDC A;  3U9D A;  3CME N;  5AFU H;  4BRG A;  3SAH A;  3CM6 A;  3MEE A;  4ID1 A;  2IIR A;  3O4Q A;  5AZI A;  3DRS A;  3OYE A;  2D5R A;  2HHW A;  4LD0 A;  2QEX N;  2GUI A;  3HRG A;  2HBK A;  5JVH L;  4A57 A;  2CGL A;  3QNO A;  1RT4 A;  4DWI A;  4H0X B;  4JKF A;  3HL8 A;  4FJ5 A;  1NG9 A;  1IBK K;  4YOW A;  3QEX A;  1YI2 N;  4DFM A;  5KPZ A;  4KHP K;  5AQW A;  1DLO A;  2FBX A;  2RHK A;  3WNG A;  1RTD A;  4O0I A;  4GVM A;  2XO7 A;  2YHW A;  4O8K A;  4DR7 K;  4DMN A;  1S9E A;  2OAN A;  2EX3 A;  2WTU A;  2P9S B;  3V1R A;  4I9Q A;  1SZ2 A;  2CGJ A;  4RCH A;  4KH6 A;  3GE1 A;  2F8T A;  4XIU A;  3PSF A;  2WC9 A;  4H5R A;  5DM6 L;  2YNF A;  4PKH A;  3C0B A;  1RDA A;  4FJ7 A;  1ZBH A;  3OY9 A;  2W6K A;  4N47 A;  3GG4 A;  4CHZ A;  3AVA A;  2E2P A;  3TAQ A;  3ENO A;  3DYA A;  4BWM A;  4JI0 K;  5BRH A;  3OYB A;  3MX2 A;  3OJS A;  3OS2 A;  3TAP A;  3VQP A;  2XY8 A;  5CZ2 A;  1J5O A;  3CC2 N;  4W5Q A;  4HWI A;  5JLH A;  1S5J A;  1X1P A;  4DQR A;  5CY4 A;  4CFC A;  3ZT2 A;  3OBW A;  2P9U B;  4GV3 A;  1HNV A;  4B9V A;  4ILJ A;  2E1Z A;  3B8A X;  2QKK A;  1KTQ A;  4F4K A;  3LDO A;  1NGD A;  1J54 A;  4CGD A;  1K9M O;  2DTU A;  4CJU A;  4NYF A;  3TTC A;  5J1E A;  2QXL A;  4JS5 A;  1K8K A;  2KW4 A;  3CJ7 A;  5K14 A;  5HRN A;  5B8H A;  1BGX T;  4C8L A;  4DR2 K;  2OA8 A;  4C23 A;  1Q82 O;  3LP1 A;  2P9P B;  2FXU A;  4BDY A;  2Q31 A;  4IDK A;  5TKW A;  4WQ5 A;  3L2V A;  2G8I A;  2IC3 A;  2HNY A;  1Q9X A;  4KTW A;  4RW8 A;  4FJI A;  3SBT A;  1J6Z A;  4M3T A;  3CC7 N;  2HHH K;  3O9Q A;  4BQL A;  4DKW A;  4CD3 A;  5FPM A;  2ZD1 A;  5GAE P;  2ZJR L;  4FVU A;  3THX B;  1T7P A;  4K41 A;  1HNZ K;  4I2P A;  5BN8 A;  1UAX A;  4CZF A;  3SCX A;  3VF6 A;  4M7Y A;  3QBW A;  3VQA A;  3LDL A;  4JKH A;  4PL7 A;  2D4W A;  4B1W B;  2VWJ A;  3CCR N;  1V4S A;  4CZG A;  3T7Z A;  1HRH A;  2YV0 X;  3EE9 A;  3N4P A;  2UXD K;  4OLA A;  4FLZ A;  2QM1 A;  3EL2 A;  4LC9 B;  4LF4 K;  2RE2 A;  2ATQ A;  1LAV A;  4H0V B;  3HK2 A;  1RDW X;  1VAZ A;  2PZS A;  4OKK A;  3LAK A;  5AQS A;  3C6H A;  3VTH A;  1VRT A;  4E7K A;  3ZLJ A;  5KPT A;  1TVR A;  1S6P A;  1YHQ N;  5JLF A;  2NUB A;  4MQ3 A;  1JLG A;  1GLB G;  4CJT A;  1BUP A;  3F5T A;  3ZT4 A;  4BVO A;  3WXK A;  3HT3 A;  1Q7Y O;  1E3M A;  1T6D A;  4C1N K;  4JLH A;  4FPB A;  3EZW A;  1JCF A;  4Z4E A;  1JCG A;  2QA4 N;  3RRG A;  1XMQ K;  3M8Q A;  1NGG A;  2QWR A;  2P9N A;  3B6O A;  3L6Q A;  3FR0 A;  2BH1 A;  3D45 A;  5EOY A;  4DV4 K;  4C8M A;  3ATU A;  1N5Y A;  2E6L A;  1QSL A;  3SYZ A;  4CJL A;  4FWO A;  1W2B M;  3J7A P;  2UUB K;  3RTV A;  3MEC A;  4R79 A;  3L2Q A;  3D0P A;  5SZT A;  1RT5 A;  2ZM6 K;  2OYQ A;  1KD1 O;  4ID5 A;  4CF2 A;  1HNW K;  3QO9 A;  2HVI A;  4O5B A;  4C8O A;  5KRT A;  4E7L A;  4V19 S;  3DAW A;  2FSJ A;  4Z4I A;  2F7T A;  4HVJ A;  4WCE L;  3AV9 A;  3ISN C;  4DV0 K;  3C6T A;  4YFU A;  4HTU A;  1S1X A;  5C24 A;  4FWK A;  3HVT A;  3KHY A;  5KQD A;  1BL3 A;  4A62 A;  3ZYY X;  2G8H A;  4CK1 A;  1TAU A;  2VGM A;  1N33 K;  4CJK A;  3DMJ A;  4CEE A;  3LM9 A;  2KLA A;  2ZGZ A;  2QWL A;  1RIL A;  3SUP A;  4MDA A;  4DQP A;  1HPZ A;  2J4R A;  3ZX2 A;  1QTM A;  3CQ8 A;  4J2A A;  3O3F A;  3UKU B;  4N56 A;  2AA4 A;  2QWP A;  4A61 A;  4NCB A;  1NM1 A;  2D0P A;  2P1J A;  3KIO A;  4JKC A;  3BDP A;  4GKJ K;  1D9D A;  4CZE A;  1YJW N;  2W40 A;  2HHT A;  1BI4 B;  4ISF A;  4GMJ B;  1BG3 A;  3QFP A;  3KJV A;  3AO4 A;  3GOI A;  2X6N A;  1ASU A;  5M1F A;  1GLF O;  1BWF O;  3KK3 A;  2FBT A;  1F21 A;  3WUH A;  3I56 N;  4Z4C A;  4BRF A;  3AVF A;  3VQB A;  1Q9Y A;  4JD2 B;  3V6D A;  1X3N A;  1R0A A;  3HO1 A;  1S72 N;  3OYJ A;  4BR2 A;  5AQX A;  3CJB A;  1FKP A;  2ZQB A;  2YHA A;  4JKB A;  3T69 A;  1W7A A;  2VG7 A;  3R3L A;  3P39 A;  3SQ1 A;  4CCH A;  3H6E A;  1WSI A;  2OCE A;  1NKC A;  4AM7 A;  1RDU A;  4YDU C;  5AQH A;  4Z0U A;  3HM8 A;  4QCL A;  4B3S K;  1DTT A;  2VWB A;  1NGF A;  3CHW A;  4YOT A;  1M1K O;  1JXE A;  3ZSZ A;  3ZT1 A;  5M1K A;  4H4O A;  2O8B A;  4JKA A;  4M7X A;  3AA4 A;  4FOI A;  1RBS A;  4CZH A;  4CHN A;  4B1X B;  5M1Q A;  4CJ5 A;  1C0G A;  3AA2 A;  3NF7 A;  4AH9 A;  4CBU A;  1NGE A;  2A1R A;  4C1N I;  4OPJ A;  3K9K A;  1H1V A;  4FJ8 A;  3IS9 A;  1OH5 A;  1QZ5 A;  4CZJ A;  3SZ2 A;  2GBZ A;  1NNE A;  3UE5 A;  2OTL N;  5F1X A;  1HQU A;  5BR8 K;  1UA0 A;  1WUA A;  5C10 A;  3K5M A;  3UIQ A;  3I8D A;  3DRR A;  2E88 A;  1L5U A;  4RW9 A;  1XWL A;  2IVO A;  3SQ0 A;  3TU5 A;  3M8P A;  1HMV A;  3BY5 A;  1QSY A;  3V9W A;  4LY7 A;  1ITG A;  2P9K A;  3V9X A;  2ZF5 O;  4CK2 A;  1HQE A;  3C6A A;  2BUP A;  4CHO A;  2O8F B;  2W41 A;  3J7Z O;  4JRQ A;  4K8Z A;  4ZHR A;  1JLE A;  3QES A;  3LAN A;  3MN9 A;  2QWO A;  4DLG A;  5GAG P;  1DT9 A;  3HJF A;  1X9S A;  4H0P A;  4E7J A;  4JK8 A;  4CJF A;  2A40 A;  2VWK A;  3ALY A;  3DM2 A;  3NF6 A;  3NAE A;  3KD1 E;  4DV1 K;  1BCO A;  4LF6 K;  1KFD A;  2E2Q A;  2Q0U A;  4A2A A;  3M5R A;  1S1U A;  3RSE A;  5AZJ B;  3HOT A;  1JJ2 M;  3ATV A;  3VA0 A;  5AQK A;  3U4L A;  4O5F A;  3CCE N;  4CBW A;  3P4I A;  2YNH A;  3UKR A;  3TTF A;  1TAQ A;  3O9U A;  1SUQ A;  2YKM A;  4CJ3 A;  2UUC K;  3SLC A;  1ZBS A;  1REV A;  3SJJ A;  3L8B A;  3DI6 A;  1VSK A;  3O9S A;  5I9E B;  4PUO A;  1IJJ A;  4IO8 A;  1TYQ A;  1L3V A;  5DK5 A;  4FLY A;  4QS9 A;  4DTO A;  3TAE A;  3UB5 A;  3QB0 A;  1QSS A;  4GW6 A;  3AVK A;  4M3R A;  3ZET A;  4PY5 A;  4GKK K;  3CCV N;  3AVI A;  1M90 O;  1NGH A;  1QZ6 A;  2D1K A;  2NRV A;  4OGE A;  3MK6 A;  3HOS A;  4GNI A;  3DLB A;  4JV5 K;  2WUS A;  4B9S A;  4FWN A;  2G8U A;  3J81 O;  1WN7 A;  3NDK A;  3PV8 A;  1NGJ A;  4DSK A;  3CJ1 A;  3DLH A;  4DTN A;  3CM5 A;  3MCA B;  1QE1 A;  1O13 A;  3KK7 A;  5IT9 O;  4OJR A;  3VF2 A;  4Q5V A;  4HUE A;  4B8A B;  4X62 K;  1KVC A;  3DRP A;  3DXK B;  3IUC A;  3SK3 A;  3AY9 A;  4KTZ A;  4YDU A;  5DMR A;  3VQE A;  1OH8 A;  4X64 K;  1DEJ A;  3LP0 A;  3THV A;  1QS4 A;  3EYZ A;  3L3V A;  4CIF A;  1VQO N;  1CZB A;  5FRO A;  5ADX A;  3CCQ N;  3LL3 A;  1U2V B;  2P5O A;  3VEV A;  5C2D A;  3QET A;  3CIP A;  2KQ2 A;  3SQ2 A;  4ELV A;  2W42 A;  4FM0 A;  2B6A A;  3OYL A;  5AQZ A;  3CCS N;  2DY4 A;  5BPN A;  1S1W A;  3SMP A;  1NJZ A;  2ASM A;  4TSX A;  4BR7 A;  4LFC K;  2RF2 A;  3W3D A;  4DF8 A;  4B3T K;  4U67 L;  2F96 A;  1WSG A;  3V1Q A;  1J5E K;  1Q18 A;  4FJH A;  1DGK N;  4H5T A;  4CF1 A;  4E89 A;  3AAQ A;  3SAG A;  4GV6 A;  3FFI A;  1NU0 A;  1N6Q A;  4J2E A;  3SBG A;  4LH4 A;  2KHO A;  1ZYQ A;  3ENB A;  2A3Z A;  3OJU A;  3E9O A;  3ITH A;  4B1U B;  2O8C B;  2GTD A;  3LWL A;  4PKI A;  3OYH A;  4QS8 A;  3CCM N;  2D0A A;  4O44 A;  1IKW A;  1NBW A;  3OYG A;  1IKY A;  1BQN A;  5A2Q O;  1HYS A;  1ZBL A;  1VQ5 N;  3B6P A;  4F9O A;  1HJR A;  3OHR A;  3HP6 A;  1XHX A;  3T3F A;  2Q36 A;  2GEM A;  1SV5 A;  3CQX A;  5TKY A;  1NKE A;  3D7E O;  4DUZ K;  4CEB A;  4CF8 A;  4DTS A;  1YT3 A;  1ZC6 A;  3BP8 A;  1GLJ O;  3CCJ N;  4KH4 A;  4CVN E;  4IOC L;  2XY5 A;  1OVQ A;  4EZ9 A;  1HJO A;  2F9T A;  3H46 O;  5C15 A;  1SS6 A;  1A5X A;  3DLL L;  3OYI A;  2O4G A;  2QWQ A;  5FDL A;  3EE8 A;  1JCE A;  1HKG A;  2HVH A;  4CZM A;  4BR9 A;  1Q86 O;  1YJ9 N;  1I3A A;  3IMX A;  1RFQ A;  2NZT A;  3CPW M;  2XY6 A;  3NF9 A;  4ZTF A;  4ELU A;  2KFZ A;  3HBT A;  2VQE K;  5AQM A;  3SPY A;  4J2B A;  2IS3 A;  2WBN A;  4N5S A;  2GUP A;  2FBV A;  3QBX A;  5HL7 L;  4CGF A;  1SKS A;  1JLF A;  2CH6 A;  3G4S N;  3VEN A;  4CJS A;  3M8S A;  4B3O A;  1BO5 O;  3QDK A;  1JLQ A;  2D0O A;  1NK4 A;  4DSE A;  2E8A A;  1HR0 K;  1W0H A;  5GAD P;  1VRU A;  4LFB K;  4JI4 K;  4CEF A;  3DLR A;  3THY B;  2WON A;  3LAM A;  4NCA A;  2ZWH A;  3FZH A;  3VET A;  4WYB A;  4M3X A;  3O9R A;  2H3G X;  3BF3 A;  4JI1 K;  4CJ7 A;  4ISG A;  4F8R A;  1IV0 A;  1ZBU A;  3LPT A;  3THX A;  2G8W A;  3K5L A;  1EXQ A;  3O08 A;  1YF5 L;  2PBD A;  4B9M A;  5AZI B;  3T1H K;  3FZF A;  4CZL A;  3NVK A;  4BR4 A;  1RT6 A;  3M3Z A;  2OTJ N;  4DTU A;  2KZZ A;  3THW A;  2GV9 A;  3KLH A;  1OH6 A;  3VEZ A;  3VEY A;  4I7F A;  3ZX3 A;  3U9Z A;  3AVG A;  4CJP A;  1LWC A;  4DTP A;  4XH4 A;  5AQV A;  3MXI A;  2ZJP L;  3R9P A;  3O4W A;  4OX9 K;  4KI4 A;  1WNS A;  1L3T A;  2NRX A;  2I5J A;  1BU6 O;  3JYT A;  3I0R A;  4FSV A;  1ESV A;  3DLE A;  3KKS A;  3LDQ A;  3PO4 A;  3PLA A;  3LZI A;  2NRZ A;  1N8R O;  1ASV A;  3TAN A;  2PFU A;  2HBM A;  4X65 K;  4YOX A;  3BF1 A;  1RTJ A;  3VER A;  4H5W A;  4A5B A;  4DQS A;  3AO2 A;  3NE6 A;  3CG7 A;  5J2Q A;  3WEE A;  1VQN N;  3AAP A;  5AQF A;  3AA5 X;  1HUX A;  4PQU A;  3T1Y K;  2VYP A;  3I33 A;  4FCY A;  3K5O A;  1RTI A;  3HPG A;  3WQT A;  3DJC A;  3G25 A;  1NK0 A;  2FSK A;  1VSH A;  2JWL A;  2HST A;  3MN6 A;  1Z6R A;  5AQR A;  3M1F A;  3IG1 A;  3AVL A;  3SNN A;  2V7Z A;  1IKV A;  1YVN A;  4XH1 A;  1VSE A;  5AQU A;  3OYK A;  3A0I X;  5HRO A;  1CXQ A;  1HPM A;  3C6U A;  3BZK A;  2HF3 A;  4BE2 A;  3PO5 A;  3FZK A;  2E4L A;  4OO1 J;  4JHD A;  1GOC A;  3KKR A;  1U4B A;  2F9W A;  3ZSX A;  4KHW A;  3VQ9 A;  1VQM N;  3BGR A;  3VQ7 A;  3WXI A;  4DSL A;  4CW7 B;  4LSL A;  5HBM A;  3SUN A;  1J53 A;  1WBB A;  2W6L A;  2HMI A;  5E26 A;  3WQU A;  4DR5 K;  1RBR A;  4BRM A;  3VPZ A;  2PAV A;  3RR7 A;  4KRE A;  3WNE A;  1JLA A;  4JRP A;  2NRH A;  1HLU A;  1TK8 A;  4BDP A;  3G6E N;  2A41 A;  4B9L A;  4U7B A;  4FJX A;  1E4F T;  4BWJ A;  3QEI A;  1XQS C;  2E6M A;  4JK9 A;  1RBV A;  5GIO A;  2VGN A;  3KK2 A;  4JKE A;  5CE3 A;  3LDP A;  1Y64 A;  1NK8 A;  1VQ9 N;  1KLM A;  3ENH A;  3K58 A;  1TK0 A;  3KD5 E;  4JI6 K;  4DS5 A;  3ZEU A;  2E20 A;  3AO5 A;  4FJ9 A;  2XY7 A;  1B92 A;  1NOZ A;  3CCL N;  3QEW A;  4JS4 A;  4DR6 K;  2OZS A;  3HVR A;  4AHT A;  3WXJ A;  1C0U A;  2FBY A;  1Y97 A;  2HB5 A;  3L2W A;  4CHP A;  2Y1J A;  3ULE A;  4CGI A;  3D2F A;  1VHX A;  1SL0 A;  4FLV A;  4CGG A;  1KVA A;  3CQY A;  3CMA N;  4AIL C;  2DFH A;  3LPU A;  5ADX H;  4FJL A;  5BN9 A;  3HPH A;  4O55 A;  2YHB A;  1I94 K;  4KB1 A;  4KO0 A;  1IKX A;  3QFU A;  3CC4 N;  3V4I A;  4WFA L;  1BDG A;  3OVN A;  4IDH A;  4W5R A;  2HHX A;  4BRQ A;  3V9U A;  1W97 L;  4B9Q A;  3EN9 A;  3QEP A;  4LFA K;  4IWV A;  4DUY K;  1Q8I A;  1Z26 A;  4WQ4 C;  5CYQ A;  5GAH P;  4N41 A;  3K59 A;  3T19 A;  3MEG A;  4EAH D;  5AQJ A;  2CH5 A;  3H45 C;  3RVC A;  1O1W A;  4CF0 A;  2GWK A;  3A5M C;  1NGC A;  1VQ7 N;  5AQN A;  4YOR A;  5M1N A;  5C42 A;  3NGZ A;  1T05 A;  3SMS A;  1XUP O;  2Q97 A;  1SKW A;  4RG8 A;  4YNQ A;  2UXB K;  3R8E A;  1S1T A;  1KC8 O;  3IKM A;  4FO0 A;  3LAL A;  3ULD A;  2P9N B;  3SQ4 A;  4JKD A;  4DG1 A;  2RN2 A;  4E1M A;  2JLE A;  1IH7 A;  1TKX A;  1QQO A;  2Z1I A;  3E9P A;  5C25 A;  3M8R A;  3C65 A;  4I9L A;  4ILH A;  3FE1 A;  4FLU A;  4ILG B;  2NRR A;  4OPA A;  4DSF A;  1C0F A;  5BPM A;  1IO2 A;  4B3M K;  5EU7 A;  2YJE A;  4OKE A;  1RTH A;  4BC3 A;  2E2O A;  3QLH A;  4L3Q A;  1SL1 A;  5IWA K;  1WSJ A;  1SL2 A;  2HW3 A;  4IEI A;  1BOT O;  4RW4 A;  2JWK A;  3MWP A;  5EY4 A;  3NGY A;  4PWD A;  1FW6 A;  3D2E A;  3KLG A;  1RGI A;  3MN7 A;  3FLC O;  3CFO A;  3VEX A;  2VCP A;  5LY3 A;  3LZJ A;  2RPI A;  4XEI A;  3O6W A;  1HYV A;  4FZX C;  3MX5 A;  1NK9 A;  3SAF A;  4RWT A;  2BTF A;  4W5O A;  1CLQ A;  4FYD A;  2YNI A;  2Q3S A;  2YX6 A;  3TSQ A;  1VQP N;  1QQN A;  3VQ4 A;  1HNI A;  4C8K A;  4CI6 A;  3LP3 A;  1BA0 A;  3OS0 A;  3QER A;  3EKU A;  4CEZ A;  5GIN A;  1EQY A;  4DB3 A;  2VQF K;  4AHC A;  4LH5 A;  2V7Y A;  2PYJ A;  3P5J A;  4DLE A;  4BGA A;  5DM7 L;  1L3U A;  4KBO A;  2V51 B;  4CJE A;  4BC4 A;  3SI6 A;  1TGO A;  3EEQ A;  3EZ5 A;  5FPN A;  4N76 A;  2BAN A;  3IRX A;  1FK9 A;  3PY8 A;  3F9K A;  5HLF A;  1RNH A;  2OPQ A;  3RMA A;  3AGR A;  5F0X A;  4DSJ A;  4DU4 A;  4MDB A;  3SJH A;  2P9L A;  4A2B A;  4J2D A;  4IO9 L;  3H08 A;  3LWM A;  4FZZ A;  4CJW A;  4E19 A;  3K57 A;  2ZJQ L;  3WNF A;  1S3X A;  2B5J A;  2I7P A;  1TKD A;  3O9T A;  3VGM A;  4EHT A;  1WOQ A;  4IKF A;  2E2N A;  1D8Y A;  3G71 N;  4E7I A;  1UA1 A;  3GL1 A;  4PL8 A;  1A5W A;  1KXP A;  4A5A A;  3DXM A;  1LWE A;  2O8B B;  1TK5 A;  1ILY A;  3TSP A;  3MDQ A;  4W5T A;  5KQ8 A;  1RCH A;  2FF6 A;  2KZM A;  4WQ4 A;  3L4Q A;  3R1X A;  4IZ9 A;  5AQY A;  5BRF A;  5LJW A;  3FFK B;  4BRA A;  4CJR A;  2ZGY A;  4HUG A;  3A8Y A;  2Y1I A;  4FK2 A;  3QIP A;  1T03 A;  4BVP A;  5I3U A;  3VOV A;  4H5N A;  1GOB A;  1X9J A;  5MLC Q;  4JEP A;  3DWL A;  4Y1D A;  3V9S A;  4RW6 A;  4DFJ A;  1HKB A;  4GVE A;  4NXM K;  1OVY A;  1JL2 A;  3IDH A;  1ASW A;  5AQQ A;  3LDS A;  3HM9 A;  3RWU A;  4H0Y B;  2A5X A;  4BGB A;  4F2R A;  3Q7B A;  1NK6 A;  1S1V A;  2V52 B;  3O1B A;  2P9K B;  3KLE A;  4MFB A;  4M41 A;  4BR0 A;  2AJQ A;  3L2R A;  4LF9 K;  3WXL A;  4QS7 A;  2X6S A;  1TV6 A;  3AVC A;  5E41 A;  4I6M A;  4CJ4 A;  4KI6 A;  4DF4 A;  3I0S A;  3LDN A;  2HHS A;  4DV5 K;  3KZB A;  3CFR A;  4OGC A;  4AHU A;  4CJQ A;  1KVB A;  1Z05 A;  1EET A;  3JAM O;  2XRI A;  3K5N A;  4Z94 A;  4BY9 C;  4KHN A;  4IBN A;  4KB0 A;  1EWR A;  3PSI A;  3RSE B;  1RDB A;  1BQM A;  4MO4 A;  1T6C A;  3AO1 A;  2O8E A;  3P31 A;  4M63 C;  4AQY K;  5I42 A;  3C7N B;  2GWJ A;  1FKO A;  3VN5 A;  1C0T A;  4OKJ A;  2NNW A;  2P5G A;  5BPL A;  2HBL A;  1XMO K;  1X3M A;  2O8D B;  3CJ9 A;  3FZL A;  3Q7C A;  4FK0 A;  1TYQ B;  1J9A A;  1QVF M;  1VQ8 N;  1N32 K;  2NRW A;  3O1W A;  4FWQ A;  3HYF A;  1ATN A;  3ZSY A;  3ZET B;  3VEW A;  1U49 A;  3OYM A;  4B3R K;  4CZK A;  3KVG A;  4E0D A;  3HZ6 A;  3VQ8 A;  4FWR A;  4FW2 A;  5M1O A;  3F2K A;  4G1Q A;  3N4Q A;  1FXX A;  5LL6 Z;  5C2F A;  1BIZ A;  1EX4 A;  4BRP A;  1JLC A;  3O80 A;  4FW1 A;  1NJY A;  1GLD G;  4IXC A;  2UU9 K;  1P8Z A;  2P9S A;  4NCG A;  4BE1 A;  3D6R A;  4CK3 A;  4CFB A;  1C1B A;  3DOK A;  1EWQ A;  3WT0 A;  3SV3 A;  1C0M A;  3L2U A;  1U04 A;  4WFB L;  3BUZ B;  3PX6 A;  2WFB A;  4FLW A;  4YY3 K;  3OYN A;  2OPR A;  4DR1 K;  4FJK A;  4DCH A;  5HOO A;  4FLT A;  4E1N A;  4DQI A;  5JS2 A;  2G8V A;  5LJV A;  5F2R A;  2KFN A;  4JN4 A;  4DU1 A;  3CFP A;  2EWS A;  1CXU A;  4CFA A;  3S9H A;  1YTA A;  5KI6 A;  3MN5 A;  1RBU A;  2QWM A;  4B8C A;  2QW9 A;  3K9J A;  1ATS A;  2P9U A;  4IFE A;  1G99 A;  4IOX A;  3E01 A;  3VMF B;  3CD6 N;  1WSH A;  3TPQ A;  2B4J A;  4KHU A;  3PIP L;  5AQP A;  4M45 A;  3VQ6 A;  3V9Z A;  3FGU A;  2R7Y A;  3AGK A;  5GIP A;  5C12 A;  2KTQ A;  3PUF A;  4K25 A;  3SUQ A;  3RRH A;  4FJJ A;  5AR0 A;  2P9I B;  1HKC A;  2GEL A;  4DV6 K;  4O0J A;  4WF9 L;  2P9P A;  5BRD A;  5KPR A;  1OH7 A;  1W9H A;  4BRK A;  4BG9 A;  3AVN A;  3ZT0 A;  3DLG A;  1YXQ A;  3TR8 A;  2YKN A;  1HX1 A;  4KHY A;  3MWT A;  4BAC A;  1LV5 A;  1B9F A;  5JS1 A;  1GLA G;  1FJG K;  4JYA K;  1GLC G;  3QEV A;  4JKG B;  3TAG A;  4IG3 A;  3O3H A;  4W5N A;  4J8F A;  4MLH A;  5HRR A;  3ZSR A;  3E9L A;  1TL1 A;  1MU2 A;  3PIO L;  4M3Y A;  1K6Y A;  3AVM A;  3QIO A;  4EP4 A;  3CPE A;  1CZ9 A;  2ITM A;  1D4X A;  4O4G A;  4B9U A;  2I7N A;  3HP9 A;  1YJN N;  3G10 A;  2P51 A;  2QI2 A;  4CER A;  1VQ6 N;  5JIC A;  3A5L C;  4QOZ B;  1NKB A;  3L4I A;  2XHB A;  3NH2 A;  2A6A A;  1C6V A;  4YOU A;  2CGK A;  1CZA N;  1IBL K;  3HSC A;  5AJ3 K;  4CBX A;  1MWK A;  4CD1 A;  3PX4 A;  4HHT A;  3CF5 L;  3KWG A;  3ZSV A;  3TAF A;  1DTQ A;  3OYA A;  2ASO A;  3A2F A;  3OW2 M;  2RKI A;  3VQQ A;  1NGB A;  1ZBF A;  1LWF A;  1U45 A;  2VG6 A;  4CZI A;  1Z25 A;  1HNX K;  3U3G A;  2FLO A;  3VQC A;  4CIG A;  3HPO A;  3GDQ A;  4KFB A;  3TAB A;  1IG8 A;  1UWB A;  1YUW A;  2HBJ A;  1MA9 B;  4FVM A;  2IOC A;  3O4N A;  4FL9 A;  3MAQ A;  2OPP A;  3TAR A;  5H1S Q;  4Y0W A;  5BRE A;  3S3N A;  3S41 A;  5HP1 A;  1NMN A;  1XNQ K;  4XH5 A;  1KSP A;  2DFE A;  4Y1C A;  2EHG A;  3NFA A;  1MDU B;  4CHY A;  3V81 A;  3BEX A;  4LF7 K;  3T1A A;  4DFK A;  1NLV A;  3H1Q A;  3QNN A;  4NO7 A;  2FSN A;  2IGI A;  4ICL A;  5CHI A;  4DS4 A;  4DQQ A;  4DTR A;  1VSJ A;  3A5N C;  4BRL A;  2YI1 A;  5EVZ A;  4JAX A;  2IAJ A;  4LSN A;  4UY8 O;  4FJG A;  4Q0B A;  1YIT N;  4BE0 A;  4DV7 K;  1ZXO A;  4Z4H A;  2A42 A;  5C0Y A;  1HYZ A;  5D3G A;  5HRS A;  1K8K B;  4WE1 A;  3THW B;  3LM2 A;  3QIC A;  1KQS M;  1JLB A;  4F3T A;  1C1C A;  1RT1 A;  2F8S A;  4BRO A;  4DTM A;  1YTU A;  1TKZ A;  2WOM A;  3IAY A;  3VTI A;  3ZSO A;  3NMU A;  4DU3 A;  4K43 A;  4DV2 K;  3VGK A;  1VSI A;  1YVU A;  3LP2 A;  3KLF A;  3GBT A;  3NGI A;  4BR5 A;  2G8K A;  3TWH A;  4FXD A;  4NB4 A;  1LCU A;  3C94 A;  4DFP A;  1T3V A;  3M6G A;  1VSF A;  4FJN A;  3U3Y A;  4FWP A;  1WLJ A;  1WAF A;  2GX9 A;  3WEE B;  4HCB A;  2A1S A;  4BRD A;  4OPH A;  3TI0 A;  2BDP A;  5AQL A;  4WFN L;  1KAZ A;  3ZSW A;  4K8X A;  1EO1 A;  1N36 K;  3AVH A;  3W0L A;  3EKS A;  3UKU A;  3O5B A;  3P1G A;  2PY5 A;  4ELT A;  1NOY A;  3QIN A;  3HXM A;  1WBD A;  4EHU A;  3VEO A;  1NJX A;  1MWM A;  1Q81 O;  4B9T A;  3JXU A;  4CGH A;  2F4V K;  4JI5 K;  2IVN A;  4BRI A;  3RMD A;  4EZ6 A;  4JI2 K;  1BI4 A;  1NGI A;  4IG0 A;  3KLI A;  1UOC A;  4GV9 A;  1DKG D;  3CCU N;  2IVP A;  3A5O C;  1T8E A;  2YJF A;  3JSM A;  4JHD B;  3ZCM A;  1NJW A;  1GLL O;  4M42 A;  4H0O A;  4KH5 A;  4L8R B;  1L3S A;  1EP4 A;  4JD2 A;  3O8M A;  4AM6 A;  1S22 A;  3SPZ A;  1B9D A;  1QQC A;  1NJI O;  4BRE A;  3DOL A;  4M3W A;  4E7H A;  3NH1 A;  2HNZ A;  3L3U A;  4CED A;  3ID6 A;  3EO3 A;  4JI7 K;  1U6Z A;  3NF8 A;  3ASM A;  4IFY A;  3NHG A;  1KLN A;  5J2N A;  3TSU A;  4FLX A;  1KAY A;  1LW2 A;  1P90 A;  1KRP A;  5EX5 A;  1D5A A;  3TAM A;  1NMD A;  2OPS A;  4JNE A;  2YHX A;  4JK7 A;  3ZEU B;  3ZSQ A;  3U6F A;  2QK9 A;  2E1Y A;  2PYL A;  1R59 O;  3CYM A;  1K8A O;  1NK7 A;  1LOT B;  3VQ5 A;  3QML A;  5FRM A;  1E4G T;  1D9F A;  3OS1 A;  3AA3 A;  1I39 A;  4X66 K;  3CET A;  1S6Q A;  4B08 A;  5AFU A;  2E5L K;  2HHV A;  4BRH A;  3OBY A;  2LSN A;  4NYN A;  4KHQ A;  3ULE B;  3D2F B;  2HND A;  4DV3 K;  5CYM A;  1RT7 A;  2O4I A;  3KK1 A;  2G8F A;  3JS6 A;  1V4T A;  4MLE A;  3WXM B;  4RW7 A;  4KTQ A;  3CJA A;  4MO5 A;  5BR9 A;  1XNR K;  4IEE A;  4H8K A;  3DLK A;  3RMB A;  4PHT X;  2OZM A;  4BC5 A;  1X9W A;  2DFF A;  4BG8 A;  1XC3 A;  1TUU A;  4QAG A;  3L0Q A;  1JL1 A;  4O8U A;  4FWM A;  2O8F A;  1ATR A;  4FK4 A;  2JGU A;  4DR4 K;  4CGJ A;  1BIU A;  1XI1 A;  5J2P A;  4I2Q A;  4BQZ A;  1XHZ A;  4K0K K;  5E84 A;  5FRN A;  5AQT A;  3VGL A;  2UUA K;  2KKZ A;  3U8X A;  4F2S A;  3OYD A;  3AAR A;  4FZY A;  4CEQ A;  5AQG A;  1VQK N;  4F3O A;  4B1V A;  4HCC A;  3PX0 A;  3I8B A;  1TKT A;  1NK5 A;  5AZJ A;  5LMU K;  3K0S A;  4E3S A;  5KRS A;  3R6M A;  3O3G A;  3K2P A;  5KGX A;  3P38 A;  1BCM A;  4PKG A;  4AHV A;  3I55 N;  5AQO A;  1QHT A;  1JKH A;  1JXB A;  1WAJ A;  4AHR A;  3J8A A;  4KKO A;  1U48 A;  2X78 A;  1KFS A;  3E66 A;  4OVL A;  4OPK A;  2Q1N A;  1RT3 A;  4H5V A;  4M3U A;  1N34 K;  1S9G A;  2Z1H A;  1IBM K;  1RBT A;  1BHL A;  3CER A;  4GY2 B;  4BRN A;  4HTL A;  3AVB A;  3OYF A;  1RT2 A;  4YOY A;  3H1V X;  3CXC M;  1BIS A;  4NLC A;  4IOA L;  4AHS A;  4DQ8 A;  2YHY A;  5FPE A;  3D2E B;  1VQ4 N;  1VSD A;  2ZE2 A;  3C95 A;  1K73 O;  1LW0 A; 
#chains in the Genus database with same CATH homology
 4CVN E;  4DV0 K;  5LL6 Z;  4JV5 K;  4DV3 K;  4DR7 K;  3J81 O;  5BR8 K;  2UU9 K;  1N33 K;  4X65 K;  4NXM K;  2UXD K;  5IT9 O;  1I94 K;  4LF4 K;  4X62 K;  1XNR K;  1IBL K;  3OTO K;  5AJ3 K;  1N36 K;  3T1Y K;  4YY3 K;  4JI0 K;  4DR1 K;  4X64 K;  2VQF K;  2VQE K;  4LF9 K;  4LFA K;  4DUY K;  4GKJ K;  2F4V K;  4JI5 K;  4JI2 K;  5FLX O;  1HNX K;  4DR4 K;  4DV5 K;  4JI8 K;  4YHH K;  3JAM O;  3J80 O;  4K0K K;  1HR0 K;  2UUA K;  4LFB K;  4JI4 K;  4LFC K;  4DV1 K;  3J7Y P;  4LF5 K;  4LF6 K;  4B3T K;  4CW7 B;  2UXB K;  1J5E K;  1XNQ K;  4LF8 K;  5LMU K;  4AQY K;  4DR3 K;  1XMQ K;  4JI1 K;  4LF7 K;  4DR5 K;  4DR2 K;  4JI7 K;  4DV6 K;  4DV4 K;  1XMO K;  4NXN K;  2UUC K;  4B3S K;  3T1H K;  4JI3 K;  3J7A P;  2UUB K;  4B3M K;  1N34 K;  4DV7 K;  2UXC K;  2HHH K;  2ZM6 K;  1IBM K;  4JI6 K;  5LMN K;  5A2Q O;  1N32 K;  5IWA K;  1FJG K;  4JYA K;  1HNW K;  1IBK K;  4V19 S;  4DR6 K;  4B3R K;  4GKK K;  4X66 K;  4DUZ K;  4KHP K;  1HNZ K;  2E5L K;  4OX9 K;  4DV2 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...