5BR8K

Ambient-temperature crystal structure of 30s ribosomal subunit from thermus thermophilus in complex with paromomycin
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
117
structure length
117
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ambient-temperature crystal structure of 30S ribosomal subunit from Thermus thermophilus in complex with paromomycin
rcsb
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 26
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2015-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 5br8K00
5LMUK 1J5EK 2UUCK 1N36K 5A2QO 4CW7B 2UXDK 4JI5K 1XNQK 2UUBK 4JV5K 2E5LK 2ZM6K 4DUZK 4LF5K 4DV0K 3J80O 3T1YK 4B3SK 5LL6Z 1XMQK 4DR5K 1XNRK 4JYAK 4YHHK 4DV6K 2VQEK 4YY3K 2UXCK 4DV3K 1IBKK 2F4VK 4DV4K 2HHHK 4LF4K 3JAMO 1HNWK 4LF7K 4NXMK 4K0KK 3OTOK 4NXNK 5LMNK 4LFBK 3J7YP 4B3MK 4DR1K 4B3TK 4LF6K 1IBLK 4LF9K 4DR4K 4JI3K 4JI2K 4DR3K 5AJ3K 5IT9O 4OX9K 1XMOK 2UUAK 4KHPK 4DR7K 4JI7K 4DR6K 4DR2K 1N34K 4GKKK 2UXBK 4JI0K 4X66K 4X62K 4JI6K 4X64K 3J7AP 1HNXK 4LF8K 4DUYK 1N32K 5FLXO 3J81O 1I94K 4JI1K 2VQFK 2UU9K 4DV1K 4DV5K 1N33K 4DV2K 1IBMK 4LFAK 4JI8K 4DV7K 4GKJK 1FJGK 4B3RK 4LFCK 4X65K 1HR0K 5BR8K 3T1HK 4V19S 4JI4K 4CVNE 5IWAK 1HNZK 4AQYK
chains in the Genus database with same CATH superfamily
4CEEA 5JS2A 4GW6A 1ITGA 5BREA 4B1XB 3V1OA 4W5OA 4BE1A 1VQNN 1QSLA 4BREA 3ZSWA 1C0TA 2EHGA 2YX6A 3THVA 4O0JA 2F9WA 3KLIA 1TK0A 4CK2A 4JAXA 2ZM6K 2WFBA 3D2EB 3NCIA 1LWEA 3L4IA 1KRPA 3U9ZA 3AARA 4NLCA 5ADXH 3ZSOA 4GV6A 4YHHK 2P1JA 2QWMA 1BDGA 2V51B 2FBYA 2F7TA 2A40A 2BH1A 3IRXA 4DTNA 3OVNA 1KTQA 3H08A 4TSXA 1QQNA 3CIPA 4B1ZA 1WBBA 4FJKA 2X74A 4DHYA 3I33A 1Z6RA 4KO0A 3BZCA 4LF6K 5AQJA 4YOTA 4JI3K 5HBMA 1SL1A 1MWKA 3LDPA 2O8EA 2BE2A 1W97L 1JLAA 5AQVA 1CXUA 3G71N 3PO5A 4XEIA 4OPKA 3N4QA 2WOMA 1GOAA 4C8MA 3BP8A 4E7JA 1S5JA 1IV0A 3RR8A 1NJXA 2OA8A 3QICA 5CHIA 1VQLN 3HPGA 1RTDA 3SBGA 1J6ZA 3HM8A 3S3OA 4KHWA 4LD0A 4YOXA 3HK2A 4WFNL 4JK8A 1LWFA 3BF3A 3H45C 4ELUA 1BA0A 3MXIA 3SJJA 5AQMA 2PYLA 4DTSA 1NLVA 4PL7A 4A2BA 3LWLA 3CPWM 3OY9A 1ESVA 2V7ZA 3KLEA 2QKBA 5IWAK 4HCCA 2BGGA 3O5BA 4B9NA 4MLHA 4FWOA 4ISEA 3F2KA 4FPAA 2FBTA 1J5EK 2UUCK 1NOZA 2VGMA 3SJHA 4ILJA 3OS2A 3LDQA 2OTJN 1IKVA 4RW9A 4FWRA 4ISGA 2H3GX 2D0PA 2VG6A 2WBNA 4CJFA 1F21A 4BQZA 3DRSA 5J2NA 4DSIA 2OPRA 1A5XA 3FZLA 1SL2A 3ZT3A 1XMQK 3HT3A 1YI2N 5AQFA 2VG5A 1XNRK 4DQPA 4B9TA 1A5VA 1RBSA 4FWNA 3I56N 5DM7L 2OYQA 3TANA 3CERA 5GADP 3DXKA 2I7PA 1NGDA 1HNWK 1D8YA 4YOUA 4FJXA 4FK0A 4YNQA 3V9XA 3KTQA 2W6LA 3WNHA 2CGKA 1JLGA 4ZTJA 4FWMA 1BCOA 4DR4K 1BQNA 4JI2K 1CXQA 3C6UA 4Q5VA 2D1KA 3VGKA 1VQKN 3LL3A 1C0UA 2D0OA 2OCEA 3BY5A 4BDYA 2KQ2A 3OJSA 2YHAA 3MDQA 1TK8A 1JCGA 4Y0WA 3U9DA 3LANA 1LAVA 3OJUA 3UKUB 1RCHA 1VSDA 4I6MB 1BI4A 5HRRA 2QWPA 4M3UA 3VPZA 3VERA 5BR8K 4A61A 4CJEA 3A2FA 3MXJA 1S9GA 3FZHA 4DU4A 2Q97A 3AVNA 1RBUA 5J2MA 1SV5A 4AQYK 4FLZA 1NK5A 1KCFA 3FE1A 4CZKA 2E2QA 1SAZA 3EEQA 4IJAA 1KFSA 3TARA 2Q2RA 5AZIA 5EY4A 2XY6A 3MK6A 4OKEA 1JXBA 1JCEA 5DK5A 1NGJA 1XI1A 3E01A 3F9KA 3VQ8A 5GAGP 3D2FA 3H6EA 4GY2B 1BOTO 4H4MA 3S41A 4CK1A 1L3SA 3QNNA 4CFDA 4M45A 2A3ZA 2PAVA 5KPRA 3C0BA 1K8KA 3AO1A 4KFBA 2E6MA 4W5TA 4FM1A 2QKKA 4O8UA 2Q3SA 2PYJA 2Y1IA 4BACA 1SKWA 3LDOA 3DOLA 1B9DA 4FW1A 3SMPA 1R59O 3JSMA 5BRFA 3CM6A 3NF8A 3I8BA 5LMNK 4DTRA 3RMAA 3E9OA 1NGCA 1FW6A 3E9LA 3VF6A 2EX3A 4KTWA 3WNGA 5ELZA 4CZIA 1RT2A 1QTMA 2O8BB 4JRPA 3K9KA 3K5NA 1WSIA 1UA1A 1ATRA 4K8ZA 3SLCA 2YNHA 3RRGA 2OTLN 2BTFA 3H1QA 5KPZA 1E4FT 1C1BA 4M3TA 1ZBFA 2OPQA 4B1YB 4X66K 2VWBA 4JI6K 3PIOL 3CMEN 5M1PA 3CJ9A 2W42A 1M90O 4FM0A 5FLXO 4IEEA 3K59A 3VENA 1S1UA 1K73O 3VEVA 4KHUA 2FF3B 1N33K 4JD2A 4HUEA 4PA1A 4BR0A 2HBJA 4IO9L 2V52B 4BRHA 1QQOA 3WEEA 3WQTA 4CZGA 3SAFA 3T1HK 4BRLA 3FFIA 1U47A 2ZF5O 3DLLL 3AVLA 5JVGL 3VA0A 3ULDA 3ITHA 1S1XA 1Z25A 1EX4A 3A5NC 2NUBA 3B6OA 3ZEUA 1SKRA 4F3OA 5LJVA 4AHTA 5M1OA 1NGGA 3QIPA 3HOSA 4BRPA 2UXDK 2P9NA 3DM2A 2PBDA 5JVHL 1KVCA 3SV3A 3ZCMA 5F2RA 3VN5A 2O8BA 3DLHA 1ATNA 3R6MA 3BUZB 1NKCA 3TR8A 3ZSZA 4CEZA 3GL1A 4H5NA 5AQHA 2A42A 1NK7A 3VQAA 3ZT0A 4OPJA 4BR9A 1U48A 2XY5A 3OYGA 4EZ9A 3F9MA 2VG7A 1CZAN 4PUOA 1RT4A 1DT9A 4LF4K 4KB0A 2NZTA 3V1QA 3RWUA 2HVHA 3U8XA 5KTQA 3K5OA 4FW2A 1VRTA 1LW2A 4IZ9A 1KD1O 1YTUA 4JHDA 3K58A 3OBWA 4DF8A 4B08A 4BWJA 3C65A 1NMNA 4KI6A 3FZFA 3ZSXA 1ASWA 1YHQN 5AJ3K 5IT9O 5K14A 4E19A 2ITGA 3VF4A 3OYFA 1CZBA 3OYLA 3ENHA 4PHTX 1GLDG 3RMBA 2HHXA 2A41A 4DR6K 1ILYA 4DG1A 3VESA 4WQ4C 5GINA 2UXBK 3O3HA 5C25A 4FJIA 1YVUA 3LWMA 1Q18A 2GV9A 3J7AP 3DLKA 2HF3A 3AO3A 1NK0A 4FWPA 4LF8K 4BE0A 3RSEB 3F5TA 3JXUA 4JI1K 4U7BA 4FLYA 3ZSRA 3EE8A 1IO2A 3SYZA 1GLEG 3O9RA 4BDPA 2IIRA 3HRGA 1GOBA 4H8KA 2HHSA 2HSTA 3H46O 4GKJK 4DU3A 4IFEA 2E2OA 4FJ9A 5AZJB 3KD1E 1LOTB 1T6DA 4X65K 3ENBA 3KIOA 5HROA 1I3AA 1HR0K 4I2QA 4JD2B 5AQKA 5KGXA 4FL9A 4CVNE 3FLCO 2ASPA 1Y97A 3LAKA 2O4IA 1NJIO 5LMUK 3O08A 1YTAA 2NRWA 2P9KA 3SAHA 4CW7B 1HQEA 3EL2A 3SMSA 4A62A 4UY8O 1UAXA 4IWVA 4KHQA 1SS6A 2E5LK 4GVMA 4E7HA 4KHNA 3UE5A 4CFBA 3RR7A 1HKGA 1XHXA 2P51A 2QWRA 2NRTA 5AQUA 5HRNA 1TVRA 4BRDA 5KPTA 3HSCA 4L8RB 3SQ1A 1JLCA 3GOIA 3LP1A 4H5WA 3THXB 3U3YA 3CD6N 2P9KB 1ZC6A 2HHHK 4BG8A 4CIEA 1N6QA 2O8CB 1HJRA 3QINA 1U6ZA 4CF9A 1D9DA 4JKEA 3LAMA 3LP2A 1EQYA 1JXEA 3VQ9A 4FSVA 1YUWA 1VQPN 3LM9A 4G1QA 4FLWA 4CFAA 4NCBA 3M6GA 4E3SA 4QS8A 4DFPA 1OH6A 3O4QA 4IJNA 1IG8A 3P31A 1WB9A 3RRHA 2IDOA 4LSLA 4HUGA 1KQSM 3B8AX 4JI0K 4JRQA 4KV8A 4H5RA 3QESA 4AHCA 1J54A 2E8AA 3TTDA 1WUAA 1NK6A 1NGEA 3G10A 1RILA 2IAJA 3J81O 1BO5O 3UKRA 3AVFA 3TU5A 4A2AA 3SCXA 2JLEA 3KK2A 5D3GA 3B6PA 2YHXA 3WXJA 4DQRA 3V9SA 2DTUA 2D5RA 4EP4A 4DCHA 4DTMA 4FWSA 1M1KO 2QWLA 4FJ5A 4DU1A 2HHVA 3I0RA 4DLEA 2G8KA 3WNFA 2CGLA 4AHUA 3O9UA 3CMAN 2ITMA 1XHZA 2P9SB 4AM7A 5I9EB 4BR7A 4Z0UA 4CEFA 1KAZA 4DWIA 2HVIA 1HMVA 1RDAA 4H4OA 4CD1A 1K9MO 3C7NB 2B5JA 1WSGA 3RVCA 4FK2A 1SZ2A 4CE9A 2O8EB 3DRRA 5H1SQ 1T3VA 2F8SA 2IOCA 4FM2A 4U67L 3M8PA 3U4LA 3CCJN 4IOAL 1BQMA 1T7PA 1V4SA 4OLAA 5C0YA 3PSIA 1NU0A 4RCHA 1E3MA 3CFRA 3QIOA 3QMLA 1RBVA 3L3VA 4FJ8A 3LDNA 4DQSA 3LM2A 4CJKA 1S1WA 4EHTA 4JKDA 5I42A 3OBYA 3TSUA 2XHBA 3GE1A 5ADXA 1W9HA 2B6AA 3ZX3A 1QZ5A 4DTJA 3M8RA 5BN9A 4EIAA 1BUPA 4CGDA 4OPAA 3C7NA 3ZYYX 4CZEA 5I3UA 4XH1A 3EN9A 4YOYA 1IKYA 3MN5A 3OYKA 3CCUN 3D0PA 5SWMA 5FPMA 4DR7K 3NF6A 2OPSA 2YHWA 4A57A 5AZIB 3PX4A 2FSKA 1RDWX 3BGRA 4X62K 5FPDA 1HNXK 1DLOA 5MLCQ 3HJFA 3I0SA 2G8FA 1P90A 1I94K 5F1XA 3G6EN 1J53A 3R3LA 1T03A 3W3DA 5FRMA 3VQ7A 4AHSA 4W5QA 2OZSA 5T7BA 1YVNA 2XO7A 5E26A 3SBTA 2UYTA 2YHBA 3O3FA 3O1WA 3AA4A 3QDKA 1NM1A 4V19S 4CJWA 4JN4A 4MDAA 2A5XA 3D6RA 3SV4A 4FYDA 1Q7YO 2VWJA 3G0ZA 1WAJA 4R79A 3CJCA 3VQPA 4FWLA 2HOEA 1U2VB 2YJFA 1RBRA 4E7LA 1BISA 1NGHA 3THYB 3AVIA 1N36K 4CEAA 2FXUA 3ULEA 1D4XA 2VGNA 4DS4A 3L2WA 2UUBK 1EO1A 2DY4A 4I2PA 3Q7CA 4CJ3A 1C1AA 4RTFD 3VETA 3KKRA 4DV0K 4B3SK 4CF1A 2NRRA 1Q81O 5FROA 2YNIA 3NH2A 4Z4HA 3ID6A 4A5BA 4IOXA 2WC9A 3L3UA 3HYFA 4WFAL 3ULEB 4BC3A 2RN2A 5AQOA 3R9PA 3IUCA 4NXNK 4FK4A 2JWKA 2YCHA 1U4BA 1MDUB 3DLBA 1HUXA 4GV3A 3CCEN 5JLFA 1RNHA 2YI1A 4YDUC 4Z4FA 1N5YA 3THYA 1DEJA 2UUAK 4JI7K 5CY4A 4F2SA 5BPNA 4NO7A 1VQ5N 4DUYK 4DLGA 4WQ5C 3HVRA 1HLUA 3IKMA 4FCYA 3CF5L 5E84A 4GNIA 1VSLA 3CM5A 3WEEB 2HMIA 1REVA 3C94A 3CC7N 1V4TA 1DTQA 4IOCL 5HLFA 4FJNA 4PY5A 3HPHA 5EX5A 4KREA 2ZJPL 1JKHA 4JI4K 3HZ6A 3SNNA 4AHVA 4KH5A 3CCQN 1T05A 1BCMA 4BY9C 3AVHA 4O0IA 3PLAA 1W7AA 3O9TA 2YKNA 3EZ5A 3IMXA 2I7NA 2P9LA 4BC5A 4JKCA 3M8SA 3TI0A 2GTDA 3CETA 4CJTA 1NKEA 2NLXA 4M3YA 2VYPA 3NVMA 1YJNN 1L3TA 4OVLA 3EKUA 3QEIA 4JHDB 4J8FA 3FGUA 3LPUA 5AQIA 3LP0A 4B9UA 4O55A 2UXCK 2KZZA 3LP3A 1TYQB 3MEDA 4DV4K 4DSLA 3JAMO 3MN6A 1CZ9A 1FK9A 4BGAA 3SQ0A 1TUUA 3AA2A 4IG3A 4B9LA 3OYAA 4E0DA 2R7YA 2P9PA 2Q1NA 4LF9K 1QQCA 3KKSA 3K57A 3QNOA 1ATSA 3OYCA 2HF4A 4PKIA 2G8WA 1JL1A 4CZLA 3OYJA 4C1NK 5AQTA 3K5LA 4OX9K 3V6DA 3GG4A 4KHPK 2CH5A 3THWA 4CGGA 4WFBL 4DFKA 4JKFA 4FVMA 2ZJRL 4DTOA 5FPNA 4KRFA 1NWKA 3ZETA 4CI6A 1NBWA 1FXXA 3LPTA 3GBTA 1RDUA 4C8NA 3P38A 1NJYA 3Q7BA 3CYMA 4N5SA 4FVUA 4CHOA 4L3QA 4DV1K 3BF1A 4FO0A 3BDPA 1IBMK 4CECA 3AY9A 3O80A 4DS5A 4BRKA 4QOZB 1WLJA 5AQXA 3VEXA 3SAGA 2HNZA 2OPPA 4H0XB 4CCHA 3QEVA 4OKJA 3TTFA 3NGYA 4KTZA 2KHOA 3UKRB 3O6WA 5BPMA 2ATQA 2YJEA 5KI6A 3TAQA 2QW9A 4CJPA 3V4IA 4JEPA 3AO2A 5LJWA 4CGFA 3KJVA 2P9PB 4XH5A 4JKGB 2X6NA 3FZKA 3RMDA 4KI4A 5CR4A 4MO5A 2GEMA 1HJOA 2V7YA 3CJ7A 3DAWA 2AA4A 2HB5A 3NHGA 4BG9A 4CIFA 3NGZA 3SZ2A 1VQMN 5C24A 3SK3A 4Z94A 4JI5K 1TV6A 1XNQK 3CI5A 3VF2A 3QFUA 2DFEA 3IAYA 3MEGA 1EXQA 4DUZK 2P9UA 4CJVA 1X9WA 4O4GA 2PY5A 4DR5K 3DWLA 3K0SA 3HI0A 4JYAK 1XC9A 4KH6A 1RDDA 4CESA 3QEPA 2HW3A 3VTIA 3F73A 3V9ZA 2O8CA 5BRHA 4Z4IA 1VQ7N 1WNSA 1IBKK 2QM1A 3VQDA 1D5AA 2HBMA 4OLBA 1EETA 1HYVA 4CZMA 2YKMA 4I9LA 3J7YP 4CHPA 1NJWA 5C2DA 1GLCG 5AFUH 2D4WA 2P5GA 4BR4A 3AA3A 3KLHA 4FJHA 3GDQA 2P9NB 4ICLA 3WXMB 4DSJA 4DR3K 4YOVA 4DF4A 1NK9A 4JS4A 3FZMA 1VSMA 4B8AB 3MX2A 3O8MA 2NRHA 3AVMA 1BGXT 4DR2K 1N34K 5KQ8A 5J2QA 4ELVA 3WXIA 2WONA 3CQXA 1OKJA 1KAXA 4JKAA 4C23A 1VQ8N 1YF5L 4K8XA 1IH7A 4BRMA 2Q36A 2ASOA 3C6TA 5AZJA 4LFAK 3HM9A 2GUPA 1XQSC 3OHRA 3DYAA 3EZWA 2B4JA 5AQSA 3MMVA 3V1RA 1YJWN 3LZJA 2KTQA 2HBKA 2E20A 4FLTA 4BRFA 4R5PA 4E7IA 1J5OA 4F9OA 3KVGA 4DTXA 3MCPA 3DXMA 3CC4N 3R8EA 2GELA 5EOYA 3T19A 1QHAA 4DSEA 5CZ1A 4H5VA 4O5BA 1MU2A 3FFKB 4CJUA 2HMPA 3U3GA 5A2QO 1ZYQA 4QS7A 4N47A 1DKGD 3WXLA 3VQCA 3CCMN 4DTUA 4N76A 4E1NA 4IDKA 3SPZA 1IJJA 1T6CA 3LDLA 5AQQA 4BVOA 1HQUA 5KRTA 4HTLA 3KK3A 1YXQA 3K9JA 3SQ4A 1TGOA 1C0FA 3CCVN 4DV6K 3VEOA 2E1YA 4CZFA 3MXMA 3G4SN 3L0QA 3A8YA 4FWKA 1WBDA 4RW7A 2QWQA 4BRAA 2ZGYA 4NXMK 2P9IA 5LY3A 3DMJA 4O44A 3OTOK 4CEBA 4G9ZA 4JK7A 5AQRA 4WF9L 1EKEA 1QSYA 4CGJA 1U2VA 1TKXA 1KFDA 1C6VA 3VQ6A 3TAMA 4HTUA 4OKKA 2EWSA 4B1VA 3DOKA 5EXWA 1ZBLA 3DRPA 3KK1A 2HNDA 3TAPA 3PY8A 2VCPA 5BPLA 4M63C 3J7ZO 1NGBA 1TYQA 1P8ZA 3MN7A 5HP1A 3VQ4A 5AQYA 2HBLA 1JLEA 2DFHA 3AGRA 2F96A 1RT6A 1RT1A 4CEDA 4X64K 1VQ6N 3WUHA 3HO1A 1T44A 3ZSVA 3S3MA 3THWB 4CHQA 3MWPA 4PWDA 1RTIA 4B1WB 1NKBA 2HHUA 4M3XA 3WXKA 4MQ3A 4B8CA 1U45A 3IG1A 2ZE2A 4FOIA 1B92A 1ZBIA 3ISNC 1WSJA 5AQPA 4IG0A 4ZHRA 3QBWA 4LFCK 4BRQA 3ZEUB 4O5FA 2IC3A 3L2QA 2YV0X 3OYEA 1LAWA 5AQWA 5M1QA 3SQ2A 4BE2A 3VQQA 3M8QA 1QHTA 3CHWA 3QEWA 1W2BM 4BC4A 4JNEA 3FR0A 1S9EA 3OYBA 2OANA 4Y1DA 3HTVA 4CK3A 3HP6A 5M1NA 1NGAA 5FDLA 5LL6Z 3L6QA 3EO3A 3NF7A 1YITN 1HYZA 4B9SA 4NCAA 4CHZA 1GOCA 4M41A 4LH4A 3VEZA 1EP4A 3DLEA 3E1YA 2NRVA 4PKGA 1JJ2M 1EWQA 4OGCA 2YNFA 3MEEA 1WSEA 2XY7A 4Z4EA 3VTHA 2ZQBA 2VWKA 4I7FA 1HX1A 3P83D 2E4LA 3N4PA 4B3MK 1JL2A 4ISFA 1EWRA 3CJBA 2P9LB 4B9MA 2QEXN 2Q31A 1HRHA 5C10A 3QO9A 2FBVA 4E89A 2LSNA 2PZSA 3AVKA 2HNYA 5SZTA 2WTUA 5M1KA 3ENOA 4K41A 4CERA 3HPOA 4UQGA 1NOYA 1X3NA 3J8AA 3VEYA 5AQGA 1BHLA 1Q86O 3OYNA 3L4QA 2VQFK 1NNEA 2X6SA 2HHTA 3WQUA 3L8BA 4DV2K 3JS6A 4H0VB 4ILHA 2KZMA 2E88A 3KZBA 3NE6A 2O4GA 1RBTA 2E2PA 1N8RO 3MN9A 5C2FA 4YORA 3AVJA 1VSJA 3KHYA 1KC8O 1E4GT 4BRNA 3A5OC 1S72N 4BGBA 1WN7A 5CYMA 3KLGA 3M5RA 2FSNA 4DKWA 5GIPA 3LDSA 2D0AA 4BROA 3IS9A 1XC3A 1WOQA 2PFUA 3DXKB 1NK4A 3S3NA 2GUIA 3I55N 2CGJA 3KWIA 4Z4GA 4OJRA 4CIGA 4C8LA 4CJ7A 4H0TB 1Q82O 3VQBA 3V81A 1WAFA 1OVYA 4XIUA 1UWBA 3OYHA 4WE1A 2A6AA 2AJQA 2E6LA 1VQON 4CF8A 1S1VA 4JKHA 4EHUA 3SUPA 4A59A 2Y1JA 1A5WA 1C0GA 3K5MA 4CJ5A 3AVGA 5E41A 3NAEA 5FPEA 4NCGA 3VQ5A 1MWMA 4IBNA 2I5JA 3AVBA 3U6FA 4CZHA 1ZBHA 1KXPA 4LC9B 4DSFA 3EE9A 4EFHA 4MFBA 2P5OA 3AA5X 3ZSYA 5CYQA 4BRIA 2D0CA 4FLUA 4K25A 4FJGA 1YAGA 4WQ4A 2KKZA 3VOVA 3R1XA 4CJSA 3E66A 2NRXA 4GKKK 2A1RA 4IEIA 3KLFA 4OGEA 1BIZA 5HRSA 1XUPO 3NH1A 2IS3A 3CPEA 3DLRA 4IFVA 4KKOA 4IXCA 4CEOA 1T8EA 5AR0A 3PV8A 1Z26A 3ZETB 2UU9K 2G8VA 1CLQA 1HKCA 4I6MA 3LZIA 3CG7A 4FLXA 4FLVA 2RHKA 3QB0A 3CQYA 3HOTA 3NBPA 1YT3A 3CC2N 3NH0A 4IDHA 4MDBA 3NMUA 2FSJA 4GMJB 4AH9A 2ZWHA 3AVAA 1TL1A 1OH5A 3V9UA 4B9QA 5AQLA 1JLBA 1ZBUA 2GWJA 3LALA 2J4RA 3CJ1A 5TKYA 3A5MC 3KD5E 4KAZA 4B3OA 4FJ7A 4AILC 2BDPA 2JWLA 3H3OB 3SI6A 2QWOA 3W0LA 1U04A 3ZT1A 5JS1A 5TKWA 3TAGA 1BL3A 5DM6L 1MA9B 2P9UB 1S6QA 1VSFA 4BRCA 3OA9A 5AQNA 1SQKA 3WT0A 2RE2A 3C6AA 4K43A 3EKSA 1Q9YA 3K2PA 3HVTA 5C12A 1K8KB 2G8UA 1Q8IA 4A5AA 4DQQA 4LF7K 3PIPL 2Q0UA 2QK9A 4K0KK 2Z1GA 5BRDA 1BWFO 4NB4A 2KFZA 3D2EA 4B3TK 3QETA 4YDUA 1OH7A 3QLHA 2A1SA 4B9VA 2IVOA 5JICA 3DLGA 1FKPA 4QS9A 3JYTA 1TK5A 1VRUA 3UIQA 2WUSA 3AAQA 3L2UA 4NYFA 1VQ4N 2FBXA 4CBXA 2Z1JA 1LW0A 3O9QA 2E1ZA 2Z1HA 1SKSA 2W40A 5GAEP 3WNEA 3P5JA 3THXA 4W5NA 4C1NI 2HHWA 5AQZA 4KPYA 4RW8A 1S6PA 4DFJA 4DV5K 3ID8A 4LY7A 3MCAB 3AVCA 4BRGA 2P9SA 4E1JA 3TSQA 1SUQA 2RF2A 4DTPA 4IFYA 5CE3A 1ZBSA 3H3NO 4N41A 3DXMB 1X3MA 1L3UA 1KLMA 1HNVA 1Z05A 3DJCA 4C8OA 1XWLA 2F8TA 1QS4A 1R0AA 3EY1A 3QERA 1O1WA 4ID1A 4FJMA 3VGLA 1J9AA 3E9PA 4DMNA 2RKIA 3IFRA 5EVZA 3BZKA 4DQIA 3RMCA 4CHNA 5HOOA 4O8KA 4LSNA 3T3FA 4CJLA 1VSEA 3ZT2A 3TAFA 3QFPA 4M3RA 4JS5A 5GIOA 3NFAA 4CHYA 1TAUA 1ASVA 3EYZA 1NJZA 1QVGM 1UOCA 4CF0A 3AGKA 2G8IA 4YY3K 1G99A 2P9IB 1BIUA 4DV3K 3PUFA 1RDBA 2NRZA 3T7ZA 4KB1A 4JKGA 4WYBA 4BR2A 1TKDA 1C1CA 4LFBK 2DFFA 3VQEA 4AHRA 2ETJA 1HPMA 2DPNA 1TUYA 2BANA 3NF9A 4BVPA 3A0IX 4FOEA 3SUNA 3ASMA 1FKOA 2QA4N 4J2EA 1ZXOA 2E2NA 3M3ZA 3UB5A 3ZLJA 1OVQA 4PL8A 2FLOA 4M42A 2FC0A 2NNWA 4HHTA 1KSPA 1LCUA 4E1MA 1K8AO 3RTVA 3OS0A 3T1AA 4F8RA 2JGUA 4WCEL 2QXLA 1VSKA 1VAZA 1S3XA 2QWNA 3QEXA 4ILGB 1OH8A 1JLFA 3M1FA 3O9SA 3ZT4A 4KBOA 1RTHA 4JLHA 4NLBA 4Q0BA 2O8DA 5EU7A 3I8DA 1IG9A 1VK0A 3O4WA 4H5TA 3CJAA 2YHYA 4J2DA 3PO4A 3O1BA 1BI4B 4F2RA 1Y64A 1BA1A 1HYSA 4BR5A 5KGWA 3OS1A 1X9MA 4B3RK 4CF2A 2QTDA 1JLQA 3D7EO 1W0HA 3C6HA 2QXFA 1ASUA 4NYNA 4RG8A 3SPYA 2ZGZA 1VSIA 1QSSA 1NMDA 3O3GA 1HNIA 3AAPA 3NVKA 4Y1CA 3VA3A 1UA0A 1HPZA 4MLEA 3AO4A 5C42A 4BQLA 2BUPA 4FPBA 4OPHA 4WQ5A 4RW6A 1Q9XA 4LH5A 2KLAA 2Q0RA 4J2BA 4FZZA 3PSFA 4FXDA 4GVEA 4PQUA 1G15A 1BG3A 2XRIA 4H03B 4I9QA 4Z4CA 3TAEA 3J80O 2RPIA 3C95A 4HVJA 5C15A 4YFUA 4FJLA 4M7YA 5M1FA 4F3TA 3O4NA 1B9FA 1TKZA 3MWTA 3TPQA 1YJ9N 1NG9A 4CD3A 2O8FA 1TAQA 3P39A 4H0YB 2XY8A 1S22A 1DTTA 2G8HA 3P4IA 2O8FB 1C0MA 4GV9A 4MO4A 5BR9A 5J2PA 5JLHA 4BDZA 1U49A 4FJJA 4DR1K 1WSHA 4BC2A 1H1VA 4EAHD 1D9FA 2D0BA 3A5LC 4CGIA 3SUOA 1SL0A 3VGMA 3G25A 4N56A 5KRSA 2KFNA 1KVAA 1TL3A 3L2RA 1NK8A 1XMOK 3BEXA 4M3ZA 4IKFA 4CBUA 4KHSA 4CJRA 4DFMA 4H0PA 3OYIA 2OZMA 1VHXA 4RW4A 3OW2M 2GBZA 1N32K 2ASMA 3ZX0A 2AP1A 5HRPA 3D2FB 4DSKA 3QBXA 3ZSQA 1TKTA 5GAHP 2ZD1A 4EZ6A 1HKBA 1QQMA 4JI8K 3PX6A 3HP9A 4XH4A 4OO1J 3DI6A 1FJGK 3TABA 3S9HA 4CGHA 3CFPA 3SUQA 2O8DB 2QI2A 3CCLN 1RDCA 1RT7A 3AO5A 3VMFB 3ATVA 1QZ6A 1LV5A 4AF1A 4M7XA 1GLFO 3VEWA 3P1GA 4CZJA 1HNZK 3KK7A 1IKWA 1X1PA 2YNGA 3IDHA 2X78A 1L5UA 3V9WA 4CFCA 5J1EA 3ATUA 2GX9A 4AM6A 3NDKA 1NGFA 4J2AA 1L3VA 3CXCM 4JV5K 1NGIA 3PX0A 5FRNA 5B8HA 3ZX2A 3OYMA 4LF5K 4QCLA 2IVNA 3T1YK 2F9TA 4K42A 3HXMA 1KLNA 3L2VA 4HWIA 4CEQA 4CJ4A 4JK9A 2VQEK 3OYDA 4QAGA 1LWCA 4F4KA 5JMVA 3KWGA 4B1UB 1KVBA 4PKHA 4C8KA 1BU6O 2F4VK 4JKBA 3HBTA 4FZYA 1QE1A 1JCFA 1GLJO 5DMRA 1IKXA 4E7KA 3MX5A 1RT3A 2Z1IA 3TWHA 1VSHA 3CFOA 3HSTB 1RFQA 2W41A 1IBLK 3TSPA 4FZXC 5HL7L 1RT5A 1GLBG 1RGIA 3AV9A 5CZ2A 4KHYA 2CH6A 4CBWA 4EP5A 2ZJQL 4KH4A 3UKUA 4YOWA 4H0OA 5AFUA 4ZTFA 4DQ8A 2KW4A 4W5RA 3T69A 3HL8A 4FWQA 4HCBA 4DB3A 2IVPA 4IO8A 5KQDA 1VQ9N 4ELTA 4M3WA 1QVFM 1GLLO 3MECA 1GLAG 4RWTA 2GWKA 1YIJN 4BWMA 3CCRN 1K6YA 2IGIA 4HUFA 1O13A 1WSFA 1X9JA 4DV7K 5BN8A 3MAQA 1RTJA 2HHQA 3ALYA 1I39A 1X9SA 3TTCA 1S1TA 4CJQA 1DGKN 3H1VX 2FF6A 3D45A 4KTQA 5F0XA 3CCSN 3CQ8A 2W6KA 4ID5A 3RSEA 3NGIA 1KAYA
chains in the Genus database with same CATH topology
5LMUK 1J5EK 2UUCK 1N36K 5A2QO 4CW7B 2UXDK 4JI5K 1XNQK 2UUBK 4JV5K 2E5LK 2ZM6K 4DUZK 4LF5K 4DV0K 3J80O 3T1YK 4B3SK 5LL6Z 1XMQK 4DR5K 1XNRK 4JYAK 4YHHK 4DV6K 2VQEK 4YY3K 2UXCK 4DV3K 1IBKK 2F4VK 4DV4K 2HHHK 4LF4K 3JAMO 1HNWK 4LF7K 4NXMK 4K0KK 3OTOK 4NXNK 5LMNK 4LFBK 3J7YP 4B3MK 4DR1K 4B3TK 4LF6K 1IBLK 4LF9K 4DR4K 4JI3K 4JI2K 4DR3K 5AJ3K 5IT9O 4OX9K 1XMOK 2UUAK 4KHPK 4DR7K 4JI7K 4DR6K 4DR2K 1N34K 4GKKK 2UXBK 4JI0K 4X66K 4X62K 4JI6K 4X64K 3J7AP 1HNXK 4LF8K 4DUYK 1N32K 5FLXO 3J81O 1I94K 4JI1K 2VQFK 2UU9K 4DV1K 4DV5K 1N33K 4DV2K 1IBMK 4LFAK 4JI8K 4DV7K 4GKJK 1FJGK 4B3RK 4LFCK 4X65K 1HR0K 5BR8K 3T1HK 4V19S 4JI4K 4CVNE 5IWAK 1HNZK 4AQYK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LMU K;  1J5E K;  2UUC K;  1N36 K;  5A2Q O;  4CW7 B;  2UXD K;  4JI5 K;  1XNQ K;  2UUB K;  4JV5 K;  2E5L K;  2ZM6 K;  4DUZ K;  4LF5 K;  4DV0 K;  3J80 O;  3T1Y K;  4B3S K;  5LL6 Z;  1XMQ K;  4DR5 K;  1XNR K;  4JYA K;  4YHH K;  4DV6 K;  2VQE K;  4YY3 K;  2UXC K;  4DV3 K;  1IBK K;  2F4V K;  4DV4 K;  2HHH K;  4LF4 K;  3JAM O;  1HNW K;  4LF7 K;  4NXM K;  4K0K K;  3OTO K;  4NXN K;  5LMN K;  4LFB K;  3J7Y P;  4B3M K;  4DR1 K;  4B3T K;  4LF6 K;  1IBL K;  4LF9 K;  4DR4 K;  4JI3 K;  4JI2 K;  4DR3 K;  5AJ3 K;  5IT9 O;  4OX9 K;  1XMO K;  2UUA K;  4KHP K;  4DR7 K;  4JI7 K;  4DR6 K;  4DR2 K;  1N34 K;  4GKK K;  2UXB K;  4JI0 K;  4X66 K;  4X62 K;  4JI6 K;  4X64 K;  3J7A P;  1HNX K;  4LF8 K;  4DUY K;  1N32 K;  5FLX O;  3J81 O;  1I94 K;  4JI1 K;  2VQF K;  2UU9 K;  4DV1 K;  4DV5 K;  1N33 K;  4DV2 K;  1IBM K;  4LFA K;  4JI8 K;  4DV7 K;  4GKJ K;  1FJG K;  4B3R K;  4LFC K;  4X65 K;  1HR0 K;  5BR8 K;  3T1H K;  4V19 S;  4JI4 K;  4CVN E;  5IWA K;  1HNZ K;  4AQY K; 
#chains in the Genus database with same CATH topology
 4CEE A;  5JS2 A;  4GW6 A;  1ITG A;  5BRE A;  4B1X B;  3V1O A;  4W5O A;  4BE1 A;  1VQN N;  1QSL A;  4BRE A;  3ZSW A;  1C0T A;  2EHG A;  2YX6 A;  3THV A;  4O0J A;  2F9W A;  3KLI A;  1TK0 A;  4CK2 A;  4JAX A;  2ZM6 K;  2WFB A;  3D2E B;  3NCI A;  1LWE A;  3L4I A;  1KRP A;  3U9Z A;  3AAR A;  4NLC A;  5ADX H;  3ZSO A;  4GV6 A;  4YHH K;  2P1J A;  2QWM A;  1BDG A;  2V51 B;  2FBY A;  2F7T A;  2A40 A;  2BH1 A;  3IRX A;  4DTN A;  3OVN A;  1KTQ A;  3H08 A;  4TSX A;  1QQN A;  3CIP A;  4B1Z A;  1WBB A;  4FJK A;  2X74 A;  4DHY A;  3I33 A;  1Z6R A;  4KO0 A;  3BZC A;  4LF6 K;  5AQJ A;  4YOT A;  4JI3 K;  5HBM A;  1SL1 A;  1MWK A;  3LDP A;  2O8E A;  2BE2 A;  1W97 L;  1JLA A;  5AQV A;  1CXU A;  3G71 N;  3PO5 A;  4XEI A;  4OPK A;  3N4Q A;  2WOM A;  1GOA A;  4C8M A;  3BP8 A;  4E7J A;  1S5J A;  1IV0 A;  3RR8 A;  1NJX A;  2OA8 A;  3QIC A;  5CHI A;  1VQL N;  3HPG A;  1RTD A;  3SBG A;  1J6Z A;  3HM8 A;  3S3O A;  4KHW A;  4LD0 A;  4YOX A;  3HK2 A;  4WFN L;  4JK8 A;  1LWF A;  3BF3 A;  3H45 C;  4ELU A;  1BA0 A;  3MXI A;  3SJJ A;  5AQM A;  2PYL A;  4DTS A;  1NLV A;  4PL7 A;  4A2B A;  3LWL A;  3CPW M;  3OY9 A;  1ESV A;  2V7Z A;  3KLE A;  2QKB A;  5IWA K;  4HCC A;  2BGG A;  3O5B A;  4B9N A;  4MLH A;  4FWO A;  4ISE A;  3F2K A;  4FPA A;  2FBT A;  1J5E K;  2UUC K;  1NOZ A;  2VGM A;  3SJH A;  4ILJ A;  3OS2 A;  3LDQ A;  2OTJ N;  1IKV A;  4RW9 A;  4FWR A;  4ISG A;  2H3G X;  2D0P A;  2VG6 A;  2WBN A;  4CJF A;  1F21 A;  4BQZ A;  3DRS A;  5J2N A;  4DSI A;  2OPR A;  1A5X A;  3FZL A;  1SL2 A;  3ZT3 A;  1XMQ K;  3HT3 A;  1YI2 N;  5AQF A;  2VG5 A;  1XNR K;  4DQP A;  4B9T A;  1A5V A;  1RBS A;  4FWN A;  3I56 N;  5DM7 L;  2OYQ A;  3TAN A;  3CER A;  5GAD P;  3DXK A;  2I7P A;  1NGD A;  1HNW K;  1D8Y A;  4YOU A;  4FJX A;  4FK0 A;  4YNQ A;  3V9X A;  3KTQ A;  2W6L A;  3WNH A;  2CGK A;  1JLG A;  4ZTJ A;  4FWM A;  1BCO A;  4DR4 K;  1BQN A;  4JI2 K;  1CXQ A;  3C6U A;  4Q5V A;  2D1K A;  3VGK A;  1VQK N;  3LL3 A;  1C0U A;  2D0O A;  2OCE A;  3BY5 A;  4BDY A;  2KQ2 A;  3OJS A;  2YHA A;  3MDQ A;  1TK8 A;  1JCG A;  4Y0W A;  3U9D A;  3LAN A;  1LAV A;  3OJU A;  3UKU B;  1RCH A;  1VSD A;  4I6M B;  1BI4 A;  5HRR A;  2QWP A;  4M3U A;  3VPZ A;  3VER A;  5BR8 K;  4A61 A;  4CJE A;  3A2F A;  3MXJ A;  1S9G A;  3FZH A;  4DU4 A;  2Q97 A;  3AVN A;  1RBU A;  5J2M A;  1SV5 A;  4AQY K;  4FLZ A;  1NK5 A;  1KCF A;  3FE1 A;  4CZK A;  2E2Q A;  1SAZ A;  3EEQ A;  4IJA A;  1KFS A;  3TAR A;  2Q2R A;  5AZI A;  5EY4 A;  2XY6 A;  3MK6 A;  4OKE A;  1JXB A;  1JCE A;  5DK5 A;  1NGJ A;  1XI1 A;  3E01 A;  3F9K A;  3VQ8 A;  5GAG P;  3D2F A;  3H6E A;  4GY2 B;  1BOT O;  4H4M A;  3S41 A;  4CK1 A;  1L3S A;  3QNN A;  4CFD A;  4M45 A;  2A3Z A;  2PAV A;  5KPR A;  3C0B A;  1K8K A;  3AO1 A;  4KFB A;  2E6M A;  4W5T A;  4FM1 A;  2QKK A;  4O8U A;  2Q3S A;  2PYJ A;  2Y1I A;  4BAC A;  1SKW A;  3LDO A;  3DOL A;  1B9D A;  4FW1 A;  3SMP A;  1R59 O;  3JSM A;  5BRF A;  3CM6 A;  3NF8 A;  3I8B A;  5LMN K;  4DTR A;  3RMA A;  3E9O A;  1NGC A;  1FW6 A;  3E9L A;  3VF6 A;  2EX3 A;  4KTW A;  3WNG A;  5ELZ A;  4CZI A;  1RT2 A;  1QTM A;  2O8B B;  4JRP A;  3K9K A;  3K5N A;  1WSI A;  1UA1 A;  1ATR A;  4K8Z A;  3SLC A;  2YNH A;  3RRG A;  2OTL N;  2BTF A;  3H1Q A;  5KPZ A;  1E4F T;  1C1B A;  4M3T A;  1ZBF A;  2OPQ A;  4B1Y B;  4X66 K;  2VWB A;  4JI6 K;  3PIO L;  3CME N;  5M1P A;  3CJ9 A;  2W42 A;  1M90 O;  4FM0 A;  5FLX O;  4IEE A;  3K59 A;  3VEN A;  1S1U A;  1K73 O;  3VEV A;  4KHU A;  2FF3 B;  1N33 K;  4JD2 A;  4HUE A;  4PA1 A;  4BR0 A;  2HBJ A;  4IO9 L;  2V52 B;  4BRH A;  1QQO A;  3WEE A;  3WQT A;  4CZG A;  3SAF A;  3T1H K;  4BRL A;  3FFI A;  1U47 A;  2ZF5 O;  3DLL L;  3AVL A;  5JVG L;  3VA0 A;  3ULD A;  3ITH A;  1S1X A;  1Z25 A;  1EX4 A;  3A5N C;  2NUB A;  3B6O A;  3ZEU A;  1SKR A;  4F3O A;  5LJV A;  4AHT A;  5M1O A;  1NGG A;  3QIP A;  3HOS A;  4BRP A;  2UXD K;  2P9N A;  3DM2 A;  2PBD A;  5JVH L;  1KVC A;  3SV3 A;  3ZCM A;  5F2R A;  3VN5 A;  2O8B A;  3DLH A;  1ATN A;  3R6M A;  3BUZ B;  1NKC A;  3TR8 A;  3ZSZ A;  4CEZ A;  3GL1 A;  4H5N A;  5AQH A;  2A42 A;  1NK7 A;  3VQA A;  3ZT0 A;  4OPJ A;  4BR9 A;  1U48 A;  2XY5 A;  3OYG A;  4EZ9 A;  3F9M A;  2VG7 A;  1CZA N;  4PUO A;  1RT4 A;  1DT9 A;  4LF4 K;  4KB0 A;  2NZT A;  3V1Q A;  3RWU A;  2HVH A;  3U8X A;  5KTQ A;  3K5O A;  4FW2 A;  1VRT A;  1LW2 A;  4IZ9 A;  1KD1 O;  1YTU A;  4JHD A;  3K58 A;  3OBW A;  4DF8 A;  4B08 A;  4BWJ A;  3C65 A;  1NMN A;  4KI6 A;  3FZF A;  3ZSX A;  1ASW A;  1YHQ N;  5AJ3 K;  5IT9 O;  5K14 A;  4E19 A;  2ITG A;  3VF4 A;  3OYF A;  1CZB A;  3OYL A;  3ENH A;  4PHT X;  1GLD G;  3RMB A;  2HHX A;  2A41 A;  4DR6 K;  1ILY A;  4DG1 A;  3VES A;  4WQ4 C;  5GIN A;  2UXB K;  3O3H A;  5C25 A;  4FJI A;  1YVU A;  3LWM A;  1Q18 A;  2GV9 A;  3J7A P;  3DLK A;  2HF3 A;  3AO3 A;  1NK0 A;  4FWP A;  4LF8 K;  4BE0 A;  3RSE B;  3F5T A;  3JXU A;  4JI1 K;  4U7B A;  4FLY A;  3ZSR A;  3EE8 A;  1IO2 A;  3SYZ A;  1GLE G;  3O9R A;  4BDP A;  2IIR A;  3HRG A;  1GOB A;  4H8K A;  2HHS A;  2HST A;  3H46 O;  4GKJ K;  4DU3 A;  4IFE A;  2E2O A;  4FJ9 A;  5AZJ B;  3KD1 E;  1LOT B;  1T6D A;  4X65 K;  3ENB A;  3KIO A;  5HRO A;  1I3A A;  1HR0 K;  4I2Q A;  4JD2 B;  5AQK A;  5KGX A;  4FL9 A;  4CVN E;  3FLC O;  2ASP A;  1Y97 A;  3LAK A;  2O4I A;  1NJI O;  5LMU K;  3O08 A;  1YTA A;  2NRW A;  2P9K A;  3SAH A;  4CW7 B;  1HQE A;  3EL2 A;  3SMS A;  4A62 A;  4UY8 O;  1UAX A;  4IWV A;  4KHQ A;  1SS6 A;  2E5L K;  4GVM A;  4E7H A;  4KHN A;  3UE5 A;  4CFB A;  3RR7 A;  1HKG A;  1XHX A;  2P51 A;  2QWR A;  2NRT A;  5AQU A;  5HRN A;  1TVR A;  4BRD A;  5KPT A;  3HSC A;  4L8R B;  3SQ1 A;  1JLC A;  3GOI A;  3LP1 A;  4H5W A;  3THX B;  3U3Y A;  3CD6 N;  2P9K B;  1ZC6 A;  2HHH K;  4BG8 A;  4CIE A;  1N6Q A;  2O8C B;  1HJR A;  3QIN A;  1U6Z A;  4CF9 A;  1D9D A;  4JKE A;  3LAM A;  3LP2 A;  1EQY A;  1JXE A;  3VQ9 A;  4FSV A;  1YUW A;  1VQP N;  3LM9 A;  4G1Q A;  4FLW A;  4CFA A;  4NCB A;  3M6G A;  4E3S A;  4QS8 A;  4DFP A;  1OH6 A;  3O4Q A;  4IJN A;  1IG8 A;  3P31 A;  1WB9 A;  3RRH A;  2IDO A;  4LSL A;  4HUG A;  1KQS M;  3B8A X;  4JI0 K;  4JRQ A;  4KV8 A;  4H5R A;  3QES A;  4AHC A;  1J54 A;  2E8A A;  3TTD A;  1WUA A;  1NK6 A;  1NGE A;  3G10 A;  1RIL A;  2IAJ A;  3J81 O;  1BO5 O;  3UKR A;  3AVF A;  3TU5 A;  4A2A A;  3SCX A;  2JLE A;  3KK2 A;  5D3G A;  3B6P A;  2YHX A;  3WXJ A;  4DQR A;  3V9S A;  2DTU A;  2D5R A;  4EP4 A;  4DCH A;  4DTM A;  4FWS A;  1M1K O;  2QWL A;  4FJ5 A;  4DU1 A;  2HHV A;  3I0R A;  4DLE A;  2G8K A;  3WNF A;  2CGL A;  4AHU A;  3O9U A;  3CMA N;  2ITM A;  1XHZ A;  2P9S B;  4AM7 A;  5I9E B;  4BR7 A;  4Z0U A;  4CEF A;  1KAZ A;  4DWI A;  2HVI A;  1HMV A;  1RDA A;  4H4O A;  4CD1 A;  1K9M O;  3C7N B;  2B5J A;  1WSG A;  3RVC A;  4FK2 A;  1SZ2 A;  4CE9 A;  2O8E B;  3DRR A;  5H1S Q;  1T3V A;  2F8S A;  2IOC A;  4FM2 A;  4U67 L;  3M8P A;  3U4L A;  3CCJ N;  4IOA L;  1BQM A;  1T7P A;  1V4S A;  4OLA A;  5C0Y A;  3PSI A;  1NU0 A;  4RCH A;  1E3M A;  3CFR A;  3QIO A;  3QML A;  1RBV A;  3L3V A;  4FJ8 A;  3LDN A;  4DQS A;  3LM2 A;  4CJK A;  1S1W A;  4EHT A;  4JKD A;  5I42 A;  3OBY A;  3TSU A;  2XHB A;  3GE1 A;  5ADX A;  1W9H A;  2B6A A;  3ZX3 A;  1QZ5 A;  4DTJ A;  3M8R A;  5BN9 A;  4EIA A;  1BUP A;  4CGD A;  4OPA A;  3C7N A;  3ZYY X;  4CZE A;  5I3U A;  4XH1 A;  3EN9 A;  4YOY A;  1IKY A;  3MN5 A;  3OYK A;  3CCU N;  3D0P A;  5SWM A;  5FPM A;  4DR7 K;  3NF6 A;  2OPS A;  2YHW A;  4A57 A;  5AZI B;  3PX4 A;  2FSK A;  1RDW X;  3BGR A;  4X62 K;  5FPD A;  1HNX K;  1DLO A;  5MLC Q;  3HJF A;  3I0S A;  2G8F A;  1P90 A;  1I94 K;  5F1X A;  3G6E N;  1J53 A;  3R3L A;  1T03 A;  3W3D A;  5FRM A;  3VQ7 A;  4AHS A;  4W5Q A;  2OZS A;  5T7B A;  1YVN A;  2XO7 A;  5E26 A;  3SBT A;  2UYT A;  2YHB A;  3O3F A;  3O1W A;  3AA4 A;  3QDK A;  1NM1 A;  4V19 S;  4CJW A;  4JN4 A;  4MDA A;  2A5X A;  3D6R A;  3SV4 A;  4FYD A;  1Q7Y O;  2VWJ A;  3G0Z A;  1WAJ A;  4R79 A;  3CJC A;  3VQP A;  4FWL A;  2HOE A;  1U2V B;  2YJF A;  1RBR A;  4E7L A;  1BIS A;  1NGH A;  3THY B;  3AVI A;  1N36 K;  4CEA A;  2FXU A;  3ULE A;  1D4X A;  2VGN A;  4DS4 A;  3L2W A;  2UUB K;  1EO1 A;  2DY4 A;  4I2P A;  3Q7C A;  4CJ3 A;  1C1A A;  4RTF D;  3VET A;  3KKR A;  4DV0 K;  4B3S K;  4CF1 A;  2NRR A;  1Q81 O;  5FRO A;  2YNI A;  3NH2 A;  4Z4H A;  3ID6 A;  4A5B A;  4IOX A;  2WC9 A;  3L3U A;  3HYF A;  4WFA L;  3ULE B;  4BC3 A;  2RN2 A;  5AQO A;  3R9P A;  3IUC A;  4NXN K;  4FK4 A;  2JWK A;  2YCH A;  1U4B A;  1MDU B;  3DLB A;  1HUX A;  4GV3 A;  3CCE N;  5JLF A;  1RNH A;  2YI1 A;  4YDU C;  4Z4F A;  1N5Y A;  3THY A;  1DEJ A;  2UUA K;  4JI7 K;  5CY4 A;  4F2S A;  5BPN A;  4NO7 A;  1VQ5 N;  4DUY K;  4DLG A;  4WQ5 C;  3HVR A;  1HLU A;  3IKM A;  4FCY A;  3CF5 L;  5E84 A;  4GNI A;  1VSL A;  3CM5 A;  3WEE B;  2HMI A;  1REV A;  3C94 A;  3CC7 N;  1V4T A;  1DTQ A;  4IOC L;  5HLF A;  4FJN A;  4PY5 A;  3HPH A;  5EX5 A;  4KRE A;  2ZJP L;  1JKH A;  4JI4 K;  3HZ6 A;  3SNN A;  4AHV A;  4KH5 A;  3CCQ N;  1T05 A;  1BCM A;  4BY9 C;  3AVH A;  4O0I A;  3PLA A;  1W7A A;  3O9T A;  2YKN A;  3EZ5 A;  3IMX A;  2I7N A;  2P9L A;  4BC5 A;  4JKC A;  3M8S A;  3TI0 A;  2GTD A;  3CET A;  4CJT A;  1NKE A;  2NLX A;  4M3Y A;  2VYP A;  3NVM A;  1YJN N;  1L3T A;  4OVL A;  3EKU A;  3QEI A;  4JHD B;  4J8F A;  3FGU A;  3LPU A;  5AQI A;  3LP0 A;  4B9U A;  4O55 A;  2UXC K;  2KZZ A;  3LP3 A;  1TYQ B;  3MED A;  4DV4 K;  4DSL A;  3JAM O;  3MN6 A;  1CZ9 A;  1FK9 A;  4BGA A;  3SQ0 A;  1TUU A;  3AA2 A;  4IG3 A;  4B9L A;  3OYA A;  4E0D A;  2R7Y A;  2P9P A;  2Q1N A;  4LF9 K;  1QQC A;  3KKS A;  3K57 A;  3QNO A;  1ATS A;  3OYC A;  2HF4 A;  4PKI A;  2G8W A;  1JL1 A;  4CZL A;  3OYJ A;  4C1N K;  5AQT A;  3K5L A;  4OX9 K;  3V6D A;  3GG4 A;  4KHP K;  2CH5 A;  3THW A;  4CGG A;  4WFB L;  4DFK A;  4JKF A;  4FVM A;  2ZJR L;  4DTO A;  5FPN A;  4KRF A;  1NWK A;  3ZET A;  4CI6 A;  1NBW A;  1FXX A;  3LPT A;  3GBT A;  1RDU A;  4C8N A;  3P38 A;  1NJY A;  3Q7B A;  3CYM A;  4N5S A;  4FVU A;  4CHO A;  4L3Q A;  4DV1 K;  3BF1 A;  4FO0 A;  3BDP A;  1IBM K;  4CEC A;  3AY9 A;  3O80 A;  4DS5 A;  4BRK A;  4QOZ B;  1WLJ A;  5AQX A;  3VEX A;  3SAG A;  2HNZ A;  2OPP A;  4H0X B;  4CCH A;  3QEV A;  4OKJ A;  3TTF A;  3NGY A;  4KTZ A;  2KHO A;  3UKR B;  3O6W A;  5BPM A;  2ATQ A;  2YJE A;  5KI6 A;  3TAQ A;  2QW9 A;  4CJP A;  3V4I A;  4JEP A;  3AO2 A;  5LJW A;  4CGF A;  3KJV A;  2P9P B;  4XH5 A;  4JKG B;  2X6N A;  3FZK A;  3RMD A;  4KI4 A;  5CR4 A;  4MO5 A;  2GEM A;  1HJO A;  2V7Y A;  3CJ7 A;  3DAW A;  2AA4 A;  2HB5 A;  3NHG A;  4BG9 A;  4CIF A;  3NGZ A;  3SZ2 A;  1VQM N;  5C24 A;  3SK3 A;  4Z94 A;  4JI5 K;  1TV6 A;  1XNQ K;  3CI5 A;  3VF2 A;  3QFU A;  2DFE A;  3IAY A;  3MEG A;  1EXQ A;  4DUZ K;  2P9U A;  4CJV A;  1X9W A;  4O4G A;  2PY5 A;  4DR5 K;  3DWL A;  3K0S A;  3HI0 A;  4JYA K;  1XC9 A;  4KH6 A;  1RDD A;  4CES A;  3QEP A;  2HW3 A;  3VTI A;  3F73 A;  3V9Z A;  2O8C A;  5BRH A;  4Z4I A;  1VQ7 N;  1WNS A;  1IBK K;  2QM1 A;  3VQD A;  1D5A A;  2HBM A;  4OLB A;  1EET A;  1HYV A;  4CZM A;  2YKM A;  4I9L A;  3J7Y P;  4CHP A;  1NJW A;  5C2D A;  1GLC G;  5AFU H;  2D4W A;  2P5G A;  4BR4 A;  3AA3 A;  3KLH A;  4FJH A;  3GDQ A;  2P9N B;  4ICL A;  3WXM B;  4DSJ A;  4DR3 K;  4YOV A;  4DF4 A;  1NK9 A;  4JS4 A;  3FZM A;  1VSM A;  4B8A B;  3MX2 A;  3O8M A;  2NRH A;  3AVM A;  1BGX T;  4DR2 K;  1N34 K;  5KQ8 A;  5J2Q A;  4ELV A;  3WXI A;  2WON A;  3CQX A;  1OKJ A;  1KAX A;  4JKA A;  4C23 A;  1VQ8 N;  1YF5 L;  4K8X A;  1IH7 A;  4BRM A;  2Q36 A;  2ASO A;  3C6T A;  5AZJ A;  4LFA K;  3HM9 A;  2GUP A;  1XQS C;  3OHR A;  3DYA A;  3EZW A;  2B4J A;  5AQS A;  3MMV A;  3V1R A;  1YJW N;  3LZJ A;  2KTQ A;  2HBK A;  2E20 A;  4FLT A;  4BRF A;  4R5P A;  4E7I A;  1J5O A;  4F9O A;  3KVG A;  4DTX A;  3MCP A;  3DXM A;  3CC4 N;  3R8E A;  2GEL A;  5EOY A;  3T19 A;  1QHA A;  4DSE A;  5CZ1 A;  4H5V A;  4O5B A;  1MU2 A;  3FFK B;  4CJU A;  2HMP A;  3U3G A;  5A2Q O;  1ZYQ A;  4QS7 A;  4N47 A;  1DKG D;  3WXL A;  3VQC A;  3CCM N;  4DTU A;  4N76 A;  4E1N A;  4IDK A;  3SPZ A;  1IJJ A;  1T6C A;  3LDL A;  5AQQ A;  4BVO A;  1HQU A;  5KRT A;  4HTL A;  3KK3 A;  1YXQ A;  3K9J A;  3SQ4 A;  1TGO A;  1C0F A;  3CCV N;  4DV6 K;  3VEO A;  2E1Y A;  4CZF A;  3MXM A;  3G4S N;  3L0Q A;  3A8Y A;  4FWK A;  1WBD A;  4RW7 A;  2QWQ A;  4BRA A;  2ZGY A;  4NXM K;  2P9I A;  5LY3 A;  3DMJ A;  4O44 A;  3OTO K;  4CEB A;  4G9Z A;  4JK7 A;  5AQR A;  4WF9 L;  1EKE A;  1QSY A;  4CGJ A;  1U2V A;  1TKX A;  1KFD A;  1C6V A;  3VQ6 A;  3TAM A;  4HTU A;  4OKK A;  2EWS A;  4B1V A;  3DOK A;  5EXW A;  1ZBL A;  3DRP A;  3KK1 A;  2HND A;  3TAP A;  3PY8 A;  2VCP A;  5BPL A;  4M63 C;  3J7Z O;  1NGB A;  1TYQ A;  1P8Z A;  3MN7 A;  5HP1 A;  3VQ4 A;  5AQY A;  2HBL A;  1JLE A;  2DFH A;  3AGR A;  2F96 A;  1RT6 A;  1RT1 A;  4CED A;  4X64 K;  1VQ6 N;  3WUH A;  3HO1 A;  1T44 A;  3ZSV A;  3S3M A;  3THW B;  4CHQ A;  3MWP A;  4PWD A;  1RTI A;  4B1W B;  1NKB A;  2HHU A;  4M3X A;  3WXK A;  4MQ3 A;  4B8C A;  1U45 A;  3IG1 A;  2ZE2 A;  4FOI A;  1B92 A;  1ZBI A;  3ISN C;  1WSJ A;  5AQP A;  4IG0 A;  4ZHR A;  3QBW A;  4LFC K;  4BRQ A;  3ZEU B;  4O5F A;  2IC3 A;  3L2Q A;  2YV0 X;  3OYE A;  1LAW A;  5AQW A;  5M1Q A;  3SQ2 A;  4BE2 A;  3VQQ A;  3M8Q A;  1QHT A;  3CHW A;  3QEW A;  1W2B M;  4BC4 A;  4JNE A;  3FR0 A;  1S9E A;  3OYB A;  2OAN A;  4Y1D A;  3HTV A;  4CK3 A;  3HP6 A;  5M1N A;  1NGA A;  5FDL A;  5LL6 Z;  3L6Q A;  3EO3 A;  3NF7 A;  1YIT N;  1HYZ A;  4B9S A;  4NCA A;  4CHZ A;  1GOC A;  4M41 A;  4LH4 A;  3VEZ A;  1EP4 A;  3DLE A;  3E1Y A;  2NRV A;  4PKG A;  1JJ2 M;  1EWQ A;  4OGC A;  2YNF A;  3MEE A;  1WSE A;  2XY7 A;  4Z4E A;  3VTH A;  2ZQB A;  2VWK A;  4I7F A;  1HX1 A;  3P83 D;  2E4L A;  3N4P A;  4B3M K;  1JL2 A;  4ISF A;  1EWR A;  3CJB A;  2P9L B;  4B9M A;  2QEX N;  2Q31 A;  1HRH A;  5C10 A;  3QO9 A;  2FBV A;  4E89 A;  2LSN A;  2PZS A;  3AVK A;  2HNY A;  5SZT A;  2WTU A;  5M1K A;  3ENO A;  4K41 A;  4CER A;  3HPO A;  4UQG A;  1NOY A;  1X3N A;  3J8A A;  3VEY A;  5AQG A;  1BHL A;  1Q86 O;  3OYN A;  3L4Q A;  2VQF K;  1NNE A;  2X6S A;  2HHT A;  3WQU A;  3L8B A;  4DV2 K;  3JS6 A;  4H0V B;  4ILH A;  2KZM A;  2E88 A;  3KZB A;  3NE6 A;  2O4G A;  1RBT A;  2E2P A;  1N8R O;  3MN9 A;  5C2F A;  4YOR A;  3AVJ A;  1VSJ A;  3KHY A;  1KC8 O;  1E4G T;  4BRN A;  3A5O C;  1S72 N;  4BGB A;  1WN7 A;  5CYM A;  3KLG A;  3M5R A;  2FSN A;  4DKW A;  5GIP A;  3LDS A;  2D0A A;  4BRO A;  3IS9 A;  1XC3 A;  1WOQ A;  2PFU A;  3DXK B;  1NK4 A;  3S3N A;  2GUI A;  3I55 N;  2CGJ A;  3KWI A;  4Z4G A;  4OJR A;  4CIG A;  4C8L A;  4CJ7 A;  4H0T B;  1Q82 O;  3VQB A;  3V81 A;  1WAF A;  1OVY A;  4XIU A;  1UWB A;  3OYH A;  4WE1 A;  2A6A A;  2AJQ A;  2E6L A;  1VQO N;  4CF8 A;  1S1V A;  4JKH A;  4EHU A;  3SUP A;  4A59 A;  2Y1J A;  1A5W A;  1C0G A;  3K5M A;  4CJ5 A;  3AVG A;  5E41 A;  3NAE A;  5FPE A;  4NCG A;  3VQ5 A;  1MWM A;  4IBN A;  2I5J A;  3AVB A;  3U6F A;  4CZH A;  1ZBH A;  1KXP A;  4LC9 B;  4DSF A;  3EE9 A;  4EFH A;  4MFB A;  2P5O A;  3AA5 X;  3ZSY A;  5CYQ A;  4BRI A;  2D0C A;  4FLU A;  4K25 A;  4FJG A;  1YAG A;  4WQ4 A;  2KKZ A;  3VOV A;  3R1X A;  4CJS A;  3E66 A;  2NRX A;  4GKK K;  2A1R A;  4IEI A;  3KLF A;  4OGE A;  1BIZ A;  5HRS A;  1XUP O;  3NH1 A;  2IS3 A;  3CPE A;  3DLR A;  4IFV A;  4KKO A;  4IXC A;  4CEO A;  1T8E A;  5AR0 A;  3PV8 A;  1Z26 A;  3ZET B;  2UU9 K;  2G8V A;  1CLQ A;  1HKC A;  4I6M A;  3LZI A;  3CG7 A;  4FLX A;  4FLV A;  2RHK A;  3QB0 A;  3CQY A;  3HOT A;  3NBP A;  1YT3 A;  3CC2 N;  3NH0 A;  4IDH A;  4MDB A;  3NMU A;  2FSJ A;  4GMJ B;  4AH9 A;  2ZWH A;  3AVA A;  1TL1 A;  1OH5 A;  3V9U A;  4B9Q A;  5AQL A;  1JLB A;  1ZBU A;  2GWJ A;  3LAL A;  2J4R A;  3CJ1 A;  5TKY A;  3A5M C;  3KD5 E;  4KAZ A;  4B3O A;  4FJ7 A;  4AIL C;  2BDP A;  2JWL A;  3H3O B;  3SI6 A;  2QWO A;  3W0L A;  1U04 A;  3ZT1 A;  5JS1 A;  5TKW A;  3TAG A;  1BL3 A;  5DM6 L;  1MA9 B;  2P9U B;  1S6Q A;  1VSF A;  4BRC A;  3OA9 A;  5AQN A;  1SQK A;  3WT0 A;  2RE2 A;  3C6A A;  4K43 A;  3EKS A;  1Q9Y A;  3K2P A;  3HVT A;  5C12 A;  1K8K B;  2G8U A;  1Q8I A;  4A5A A;  4DQQ A;  4LF7 K;  3PIP L;  2Q0U A;  2QK9 A;  4K0K K;  2Z1G A;  5BRD A;  1BWF O;  4NB4 A;  2KFZ A;  3D2E A;  4B3T K;  3QET A;  4YDU A;  1OH7 A;  3QLH A;  2A1S A;  4B9V A;  2IVO A;  5JIC A;  3DLG A;  1FKP A;  4QS9 A;  3JYT A;  1TK5 A;  1VRU A;  3UIQ A;  2WUS A;  3AAQ A;  3L2U A;  4NYF A;  1VQ4 N;  2FBX A;  4CBX A;  2Z1J A;  1LW0 A;  3O9Q A;  2E1Z A;  2Z1H A;  1SKS A;  2W40 A;  5GAE P;  3WNE A;  3P5J A;  3THX A;  4W5N A;  4C1N I;  2HHW A;  5AQZ A;  4KPY A;  4RW8 A;  1S6P A;  4DFJ A;  4DV5 K;  3ID8 A;  4LY7 A;  3MCA B;  3AVC A;  4BRG A;  2P9S A;  4E1J A;  3TSQ A;  1SUQ A;  2RF2 A;  4DTP A;  4IFY A;  5CE3 A;  1ZBS A;  3H3N O;  4N41 A;  3DXM B;  1X3M A;  1L3U A;  1KLM A;  1HNV A;  1Z05 A;  3DJC A;  4C8O A;  1XWL A;  2F8T A;  1QS4 A;  1R0A A;  3EY1 A;  3QER A;  1O1W A;  4ID1 A;  4FJM A;  3VGL A;  1J9A A;  3E9P A;  4DMN A;  2RKI A;  3IFR A;  5EVZ A;  3BZK A;  4DQI A;  3RMC A;  4CHN A;  5HOO A;  4O8K A;  4LSN A;  3T3F A;  4CJL A;  1VSE A;  3ZT2 A;  3TAF A;  3QFP A;  4M3R A;  4JS5 A;  5GIO A;  3NFA A;  4CHY A;  1TAU A;  1ASV A;  3EYZ A;  1NJZ A;  1QVG M;  1UOC A;  4CF0 A;  3AGK A;  2G8I A;  4YY3 K;  1G99 A;  2P9I B;  1BIU A;  4DV3 K;  3PUF A;  1RDB A;  2NRZ A;  3T7Z A;  4KB1 A;  4JKG A;  4WYB A;  4BR2 A;  1TKD A;  1C1C A;  4LFB K;  2DFF A;  3VQE A;  4AHR A;  2ETJ A;  1HPM A;  2DPN A;  1TUY A;  2BAN A;  3NF9 A;  4BVP A;  3A0I X;  4FOE A;  3SUN A;  3ASM A;  1FKO A;  2QA4 N;  4J2E A;  1ZXO A;  2E2N A;  3M3Z A;  3UB5 A;  3ZLJ A;  1OVQ A;  4PL8 A;  2FLO A;  4M42 A;  2FC0 A;  2NNW A;  4HHT A;  1KSP A;  1LCU A;  4E1M A;  1K8A O;  3RTV A;  3OS0 A;  3T1A A;  4F8R A;  2JGU A;  4WCE L;  2QXL A;  1VSK A;  1VAZ A;  1S3X A;  2QWN A;  3QEX A;  4ILG B;  1OH8 A;  1JLF A;  3M1F A;  3O9S A;  3ZT4 A;  4KBO A;  1RTH A;  4JLH A;  4NLB A;  4Q0B A;  2O8D A;  5EU7 A;  3I8D A;  1IG9 A;  1VK0 A;  3O4W A;  4H5T A;  3CJA A;  2YHY A;  4J2D A;  3PO4 A;  3O1B A;  1BI4 B;  4F2R A;  1Y64 A;  1BA1 A;  1HYS A;  4BR5 A;  5KGW A;  3OS1 A;  1X9M A;  4B3R K;  4CF2 A;  2QTD A;  1JLQ A;  3D7E O;  1W0H A;  3C6H A;  2QXF A;  1ASU A;  4NYN A;  4RG8 A;  3SPY A;  2ZGZ A;  1VSI A;  1QSS A;  1NMD A;  3O3G A;  1HNI A;  3AAP A;  3NVK A;  4Y1C A;  3VA3 A;  1UA0 A;  1HPZ A;  4MLE A;  3AO4 A;  5C42 A;  4BQL A;  2BUP A;  4FPB A;  4OPH A;  4WQ5 A;  4RW6 A;  1Q9X A;  4LH5 A;  2KLA A;  2Q0R A;  4J2B A;  4FZZ A;  3PSF A;  4FXD A;  4GVE A;  4PQU A;  1G15 A;  1BG3 A;  2XRI A;  4H03 B;  4I9Q A;  4Z4C A;  3TAE A;  3J80 O;  2RPI A;  3C95 A;  4HVJ A;  5C15 A;  4YFU A;  4FJL A;  4M7Y A;  5M1F A;  4F3T A;  3O4N A;  1B9F A;  1TKZ A;  3MWT A;  3TPQ A;  1YJ9 N;  1NG9 A;  4CD3 A;  2O8F A;  1TAQ A;  3P39 A;  4H0Y B;  2XY8 A;  1S22 A;  1DTT A;  2G8H A;  3P4I A;  2O8F B;  1C0M A;  4GV9 A;  4MO4 A;  5BR9 A;  5J2P A;  5JLH A;  4BDZ A;  1U49 A;  4FJJ A;  4DR1 K;  1WSH A;  4BC2 A;  1H1V A;  4EAH D;  1D9F A;  2D0B A;  3A5L C;  4CGI A;  3SUO A;  1SL0 A;  3VGM A;  3G25 A;  4N56 A;  5KRS A;  2KFN A;  1KVA A;  1TL3 A;  3L2R A;  1NK8 A;  1XMO K;  3BEX A;  4M3Z A;  4IKF A;  4CBU A;  4KHS A;  4CJR A;  4DFM A;  4H0P A;  3OYI A;  2OZM A;  1VHX A;  4RW4 A;  3OW2 M;  2GBZ A;  1N32 K;  2ASM A;  3ZX0 A;  2AP1 A;  5HRP A;  3D2F B;  4DSK A;  3QBX A;  3ZSQ A;  1TKT A;  5GAH P;  2ZD1 A;  4EZ6 A;  1HKB A;  1QQM A;  4JI8 K;  3PX6 A;  3HP9 A;  4XH4 A;  4OO1 J;  3DI6 A;  1FJG K;  3TAB A;  3S9H A;  4CGH A;  3CFP A;  3SUQ A;  2O8D B;  2QI2 A;  3CCL N;  1RDC A;  1RT7 A;  3AO5 A;  3VMF B;  3ATV A;  1QZ6 A;  1LV5 A;  4AF1 A;  4M7X A;  1GLF O;  3VEW A;  3P1G A;  4CZJ A;  1HNZ K;  3KK7 A;  1IKW A;  1X1P A;  2YNG A;  3IDH A;  2X78 A;  1L5U A;  3V9W A;  4CFC A;  5J1E A;  3ATU A;  2GX9 A;  4AM6 A;  3NDK A;  1NGF A;  4J2A A;  1L3V A;  3CXC M;  4JV5 K;  1NGI A;  3PX0 A;  5FRN A;  5B8H A;  3ZX2 A;  3OYM A;  4LF5 K;  4QCL A;  2IVN A;  3T1Y K;  2F9T A;  4K42 A;  3HXM A;  1KLN A;  3L2V A;  4HWI A;  4CEQ A;  4CJ4 A;  4JK9 A;  2VQE K;  3OYD A;  4QAG A;  1LWC A;  4F4K A;  5JMV A;  3KWG A;  4B1U B;  1KVB A;  4PKH A;  4C8K A;  1BU6 O;  2F4V K;  4JKB A;  3HBT A;  4FZY A;  1QE1 A;  1JCF A;  1GLJ O;  5DMR A;  1IKX A;  4E7K A;  3MX5 A;  1RT3 A;  2Z1I A;  3TWH A;  1VSH A;  3CFO A;  3HST B;  1RFQ A;  2W41 A;  1IBL K;  3TSP A;  4FZX C;  5HL7 L;  1RT5 A;  1GLB G;  1RGI A;  3AV9 A;  5CZ2 A;  4KHY A;  2CH6 A;  4CBW A;  4EP5 A;  2ZJQ L;  4KH4 A;  3UKU A;  4YOW A;  4H0O A;  5AFU A;  4ZTF A;  4DQ8 A;  2KW4 A;  4W5R A;  3T69 A;  3HL8 A;  4FWQ A;  4HCB A;  4DB3 A;  2IVP A;  4IO8 A;  5KQD A;  1VQ9 N;  4ELT A;  4M3W A;  1QVF M;  1GLL O;  3MEC A;  1GLA G;  4RWT A;  2GWK A;  1YIJ N;  4BWM A;  3CCR N;  1K6Y A;  2IGI A;  4HUF A;  1O13 A;  1WSF A;  1X9J A;  4DV7 K;  5BN8 A;  3MAQ A;  1RTJ A;  2HHQ A;  3ALY A;  1I39 A;  1X9S A;  3TTC A;  1S1T A;  4CJQ A;  1DGK N;  3H1V X;  2FF6 A;  3D45 A;  4KTQ A;  5F0X A;  3CCS N;  3CQ8 A;  2W6K A;  4ID5 A;  3RSE A;  3NGI A;  1KAY A; 
#chains in the Genus database with same CATH homology
 5LMU K;  1J5E K;  2UUC K;  1N36 K;  5A2Q O;  4CW7 B;  2UXD K;  4JI5 K;  1XNQ K;  2UUB K;  4JV5 K;  2E5L K;  2ZM6 K;  4DUZ K;  4LF5 K;  4DV0 K;  3J80 O;  3T1Y K;  4B3S K;  5LL6 Z;  1XMQ K;  4DR5 K;  1XNR K;  4JYA K;  4YHH K;  4DV6 K;  2VQE K;  4YY3 K;  2UXC K;  4DV3 K;  1IBK K;  2F4V K;  4DV4 K;  2HHH K;  4LF4 K;  3JAM O;  1HNW K;  4LF7 K;  4NXM K;  4K0K K;  3OTO K;  4NXN K;  5LMN K;  4LFB K;  3J7Y P;  4B3M K;  4DR1 K;  4B3T K;  4LF6 K;  1IBL K;  4LF9 K;  4DR4 K;  4JI3 K;  4JI2 K;  4DR3 K;  5AJ3 K;  5IT9 O;  4OX9 K;  1XMO K;  2UUA K;  4KHP K;  4DR7 K;  4JI7 K;  4DR6 K;  4DR2 K;  1N34 K;  4GKK K;  2UXB K;  4JI0 K;  4X66 K;  4X62 K;  4JI6 K;  4X64 K;  3J7A P;  1HNX K;  4LF8 K;  4DUY K;  1N32 K;  5FLX O;  3J81 O;  1I94 K;  4JI1 K;  2VQF K;  2UU9 K;  4DV1 K;  4DV5 K;  1N33 K;  4DV2 K;  1IBM K;  4LFA K;  4JI8 K;  4DV7 K;  4GKJ K;  1FJG K;  4B3R K;  4LFC K;  4X65 K;  1HR0 K;  5BR8 K;  3T1H K;  4V19 S;  4JI4 K;  4CVN E;  5IWA K;  1HNZ K;  4AQY K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...