4AQYK

Structure of ribosome-apramycin complexes
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title Dissociation of Antibacterial Activity and Aminoglycoside Ototoxicity in the 4-Monosubstituted 2-Deoxystreptamine Apramycin.
pubmed doi rcsb
total genus 22
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2012-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4aqyK00
2UUCK 4LF8K 1N33K 5IT9O 5A2QO 4JI0K 1IBLK 4JI8K 4JI6K 3OTOK 4LFBK 3T1HK 5LMNK 1J5EK 4LFAK 4YY3K 4NXMK 4JI5K 4JI3K 1HR0K 4B3TK 4DV1K 4JI2K 4JYAK 2UXBK 4DR4K 4DR6K 4X65K 4JI4K 3JAMO 4YHHK 4DV0K 4JV5K 4DV7K 4X64K 1I94K 4JI1K 5LMUK 4NXNK 1N34K 2HHHK 1HNWK 5LL6Z 4LF7K 4DR7K 4CW7B 4DV2K 2UUBK 2VQEK 4V19S 1IBKK 1XMOK 4DR1K 4JI7K 5AJ3K 4OX9K 4DR5K 4DV4K 4DV6K 4LF4K 4B3SK 1HNZK 5FLXO 4LF9K 2ZM6K 3T1YK 1N36K 4CVNE 2UU9K 3J80O 4DR2K 4DV5K 4LF5K 4X62K 4K0KK 2VQFK 4GKJK 4DUYK 4LFCK 4DUZK 1FJGK 4LF6K 2F4VK 2UUAK 4GKKK 2UXDK 5IWAK 1XMQK 4AQYK 3J81O 4X66K 1N32K 2UXCK 1XNQK 3J7YP 4DV3K 4DR3K 2E5LK 4KHPK 4B3MK 5BR8K 1XNRK 3J7AP 1IBMK 1HNXK 4B3RK
chains in the Genus database with same CATH superfamily
1K8KA 5AFUH 3BY5A 2HBKA 3NH1A 3DLHA 3SYZA 2D5RA 4H4OA 1N33K 3LP1A 3LDNA 3KK1A 4H5WA 1QHTA 3OA9A 3KWIA 4LFBK 4BRLA 3E9PA 2YNHA 5LMNK 1B9FA 4QS9A 1UA1A 1VQNN 4CGIA 1SS6A 3D7EO 4N5SA 4DQQA 5HRPA 1RTDA 3AVHA 3HRGA 4BE2A 4CECA 1RTHA 1BCOA 2I7PA 3SMSA 3GG4A 2X6SA 3TARA 2FC0A 1BHLA 1X9SA 3FGUA 1L3UA 3SCXA 5BRDA 3RMCA 4J8FA 3F9KA 4KHUA 3UB5A 2VQEK 1TYQA 3DXKB 1IBKK 1GLAG 1TGOA 3KLEA 4OX9K 3LDSA 2E1YA 2GWJA 5KQDA 4H5VA 4GVEA 2OTLN 1ASUA 2XO7A 3QEWA 2UU9K 1T3VA 3JXUA 3DRSA 4GW6A 4LSNA 3WXLA 1NGJA 4QOZB 4IJAA 4CJUA 4QAGA 1K8KB 3MCAB 2E2QA 4LFCK 3PSFA 4FLZA 3V4IA 2Z1GA 3V9XA 1U49A 4PA1A 3VEZA 4DU3A 3H3OB 2QXLA 4YOTA 4WYBA 1JCGA 2EX3A 4IZ9A 3TSQA 3AY9A 3MAQA 2PY5A 4AQYK 3OYEA 1J54A 3DXMB 4BQLA 4CHZA 1TUYA 2QTDA 3Q7BA 1UWBA 3IMXA 2OZMA 3ZSYA 4B9TA 2PZSA 2GX9A 2W6KA 2Y1IA 4FJXA 4ISEA 1FK9A 4BRGA 1OVYA 1YXQA 4CEAA 3MEEA 5BR9A 3GE1A 3HOSA 4CJFA 4MLHA 4KHPK 3J7AP 3AARA 3O5BA 3QIOA 4F8RA 4LH4A 1TYQB 2UUCK 3AVMA 1X3MA 1QQCA 4E1NA 2E2PA 5GAHP 2P1JA 2W42A 2E6LA 1T05A 2O8FA 3O4WA 4JI5K 1WAJA 4BR9A 3TAPA 4DFKA 4DHYA 3OJUA 1NK6A 1KD1O 1T8EA 1GOCA 4JV5K 3SI6A 4FLWA 3ZCMA 5EY4A 5BREA 3LAKA 1VQON 2XRIA 3HPGA 1TL1A 4G9ZA 4DG1A 2QKBA 3O4NA 3ZT2A 2GTDA 3DLGA 3O8MA 4K43A 3MXIA 1QS4A 3TANA 2F8SA 4H8KA 5M1KA 1J5OA 1C1AA 5E84A 1QVGM 4IOAL 3OYAA 3HP9A 3V9WA 1Q7YO 4J2EA 4HTLA 2HSTA 3WQUA 3D2EB 1JLQA 4CF1A 4KTZA 4ILHA 3VN5A 2YJEA 3AO5A 5DMRA 5E41A 1HPZA 4WQ5A 1NJYA 4PQUA 1HMVA 1YF5L 4GMJB 2P9PA 5DM6L 5ADXA 1XQSC 3CIPA 2V7YA 3P39A 3NBPA 2VWBA 3C7NA 3T1AA 3C95A 1T03A 5C24A 4C1NI 1Z25A 3LL3A 4E0DA 1VSLA 4WFBL 4FLUA 2RF2A 1CZBA 2CH5A 3VQDA 1NK7A 4CIGA 2V51B 2ITMA 2P9IA 3LWLA 4DSEA 3FZMA 3VQ9A 3OYIA 1N8RO 3AO2A 5FRMA 3A8YA 2QKKA 1YUWA 1K8AO 3L3VA 3K0SA 3M5RA 4BREA 4XH5A 4KHWA 4CJRA 4M3YA 4W5QA 1WSJA 5T7BA 4A2BA 3KTQA 4CF2A 2IS3A 4JI0K 5EVZA 3BF3A 5AQVA 1SAZA 3CHWA 3IG1A 4C8NA 4RW7A 3QFUA 2PYJA 1J9AA 3K5MA 4Z0UA 5MLCQ 3QEVA 3R8EA 3O9QA 3C6HA 2WOMA 3U3YA 3I8BA 1LWCA 4FWPA 3NF6A 4LH5A 4JI1K 3ZSRA 3I55N 1BA1A 1J53A 4CJ5A 4A59A 2P9PB 3SMPA 1MU2A 5AQJA 3C7NB 3JYTA 2FBXA 1U2VB 2GEMA 3PO4A 1C6VA 3AA2A 2BANA 1BOTO 3VF6A 3NMUA 1WSGA 3EZWA 2P9IB 1MWMA 2D0AA 1KC8O 2HVHA 2FLOA 4MQ3A 4CK3A 4DF8A 5JMVA 1F21A 4BROA 1VQ9N 3PSIA 1BA0A 3S3MA 3M8SA 2YX6A 2AA4A 3AGKA 5CHIA 1BQMA 2A42A 3TSPA 3K5LA 3CFPA 4MO5A 3CF5L 3CCLN 3QFPA 4BQZA 4CD1A 4K0KK 1VHXA 3SQ4A 1NOZA 3AO4A 3FFKB 1ZBSA 3ATVA 3O9UA 2ASOA 4L8RB 3HSCA 1ASVA 4KV8A 5SZTA 1HJRA 4CEZA 1RT1A 3TABA 3CJ1A 1WBBA 4IOCL 5M1PA 4FSVA 4FYDA 4FK4A 4CEQA 3TAMA 1JJ2M 3VQ7A 4CFBA 1LWEA 4PUOA 4A57A 1CXQA 3L4QA 1JLCA 3AVGA 3KLIA 3QIPA 4O8UA 4JKCA 3KK3A 3LWMA 1GLCG 3A0IX 4H0OA 1XHXA 3KVGA 3WNFA 3KJVA 4M3UA 2ETJA 4LSLA 3BEXA 4M3WA 2YNGA 2O8BB 1QZ5A 1JXEA 3ZSWA 2ZJPL 3RMAA 4ELVA 4HHTA 1HX1A 1BG3A 3ENOA 3NAEA 1WAFA 5IT9O 1ZBUA 4AHRA 2O8CA 3S9HA 2ZD1A 1CXUA 4CJEA 2F9TA 1RDDA 3AO1A 4NO7A 3T1HK 4XEIA 4IOXA 3L4IA 3NVMA 3CJCA 3RTVA 3CCRN 4X65K 3MDQA 3JAMO 4WCEL 3G71N 5GIPA 3VGKA 4CGGA 3WXJA 1ATRA 4FL9A 4I6MA 2DFHA 3K2PA 1HNWK 3O1BA 4LF7K 2GV9A 3L3UA 3AVBA 3V9ZA 3OY9A 4YOVA 4HCCA 5KGXA 2A1RA 1KVCA 3PX6A 4L3QA 1Y97A 1O13A 3H45C 3OW2M 4AM6A 3IDHA 1YTUA 5KRTA 4ISGA 2RKIA 5AZIA 2W40A 4B3SK 1QSSA 4BACA 4NCBA 3T7ZA 4KRFA 4GVMA 2HHTA 3DLLL 4X62K 3EE9A 3QBWA 2VG7A 1R0AA 2I5JA 3V1QA 1WN7A 2IC3A 1U47A 3MMVA 1EQYA 1WSFA 3QEXA 3ULDA 2QWRA 3ZYYX 3G10A 3TAFA 1RBSA 4OO1J 3A5MC 3AV9A 1QTMA 3NH0A 3TI0A 2YHBA 2JWLA 4CFCA 5BN8A 2XY6A 1XNQK 3U6FA 2HHVA 3GOIA 4I9QA 4CJ4A 3DOLA 4I6MB 4CZGA 3BZCA 4DSKA 5CE3A 1NGGA 4E89A 3T69A 2D0CA 1ZC6A 3SLCA 4CJSA 4KFBA 3ENHA 1HNXK 4DTMA 5FROA 1VQ8N 4PWDA 3IS9A 5GAGP 4B9QA 4U67L 3SV4A 4KTQA 2V7ZA 4ICLA 4FJNA 1QVFM 2O8EA 1TK8A 2BGGA 1ZXOA 1DTTA 1NK0A 2UXBK 1W9HA 2PAVA 3L8BA 1EWQA 4FZXC 5JVHL 1FW6A 3IUCA 1B9DA 2KZMA 4FZYA 1DLOA 3ZETA 1VQ7N 1RBTA 1MA9B 2FSNA 3B6PA 3CETA 3WEEA 2GUPA 4CFAA 3EKSA 4Q0BA 3DLRA 4CHNA 1HRHA 5AQGA 3FZKA 1HLUA 4KB1A 2RPIA 3VETA 1NGHA 2YNIA 1IO2A 3VQQA 2EHGA 3LP2A 4JKDA 1NMNA 2A1SA 3FR0A 1ZYQA 3SQ0A 1WOQA 4RW6A 1VSEA 3K9KA 3AVKA 4JKEA 2IOCA 4W5RA 1TV6A 1M1KO 1NK9A 3HTVA 1ITGA 4FWLA 3ZLJA 1JXBA 3CJ9A 5C42A 3S3NA 3CPWM 2NRTA 3AA5X 3V1OA 1Z05A 4FJMA 2A40A 4DUZK 4RWTA 2GUIA 4H0YB 3WNHA 4AH9A 4CJTA 3ZSZA 1SKSA 2VGMA 3SV3A 1I3AA 4BRFA 4QS7A 4OKKA 4GV9A 1D9FA 1W0HA 3GDQA 3J7YP 4FJ8A 3LM2A 3MCPA 3ZX3A 2HNYA 5AQKA 4N47A 2YKNA 4KO0A 2E5LK 3ZETB 4FO0A 4KKOA 1HKGA 4O4GA 3WEEB 1WBDA 1IBMK 4CF8A 3NF9A 4WE1A 4KHYA 4DMNA 1HKCA 3THYA 3V1RA 1DKGD 4I7FA 1NGFA 4Z4HA 5J2NA 5JLFA 3VEVA 4AHCA 1KSPA 1LAVA 3OYNA 3OVNA 4JI6K 1ASWA 1ZBFA 3MN9A 5JS1A 1X9MA 4FXDA 2E88A 4BGBA 3KLHA 3VENA 4DSLA 3OYHA 1Q18A 4DR4K 4DR6K 4DSIA 4BGAA 3HM9A 4GY2B 3MX5A 4IG0A 4EP4A 2EWSA 3HXMA 2DY4A 4DV0K 4IBNA 4FW1A 3O08A 2G8UA 3LM9A 4M3RA 3CC7N 3E9LA 5CZ2A 1BGXT 2NRWA 1TKXA 5AQPA 1WB9A 4K41A 4E3SA 3UE5A 3DYAA 2QI2A 1N6QA 3ZSQA 4UQGA 1T44A 2P9KB 1NJIO 5C10A 1LWFA 4WQ4C 5K14A 2NZTA 3HSTB 2IVOA 4YNQA 2NRRA 3VF4A 4Y1CA 3OYCA 3O3HA 2Z1IA 4DV4K 4GV6A 2A41A 4PKHA 4OLAA 1B92A 1RT3A 2WC9A 1TL3A 3HP6A 2FBTA 3WUHA 4LC9B 1KFSA 5KPRA 1QSYA 1RDBA 4NB4A 2KZZA 1W2BM 4DR2K 4NCGA 4DV5K 3DOKA 4DTXA 1KLMA 4ILJA 4QCLA 3O9SA 3MEDA 3SPZA 4O55A 4DU4A 3CFOA 1BU6O 4AHTA 1BIZA 5M1NA 1HNIA 1UA0A 4BR7A 3L0QA 4Z4FA 2ZF5O 2YCHA 1SKWA 1IJJA 2QW9A 2ITGA 1QHAA 3FZHA 1KQSM 3MWTA 2G8FA 3HYFA 1ZBIA 2OPRA 3WQTA 3CQYA 2YHWA 2P51A 3VMFB 4FLTA 2GWKA 3VEXA 4JS4A 4DQPA 2BUPA 4RW4A 4B1UB 3O9TA 3TPQA 5JS2A 4FCYA 2FSJA 2IGIA 4Z4CA 2Q31A 1A5XA 3DJCA 4IG3A 2P9NA 5KGWA 1ESVA 3ZT3A 1YVUA 1LV5A 2OYQA 4B3RK 4CJKA 3A2FA 1IH7A 3AA3A 4CF0A 1U6ZA 4CJ7A 3OTOK 4B8CA 2NRHA 4FLVA 3VTHA 3SK3A 3ASMA 1NGDA 1LW2A 1YT3A 2D4WA 2ATQA 4DTSA 4JI2K 4KI6A 4B1XB 3MECA 3L2RA 1IKWA 4F3OA 3CMAN 1S1WA 4X64K 5EXWA 3D45A 4BDYA 3KHYA 1N34K 4EAHD 3CYMA 4O8KA 3CD6N 1WNSA 4JD2A 1Q82O 1RDUA 5GINA 2VGNA 5HROA 4FWKA 1IG9A 3QERA 2I7NA 1ZBLA 3VQ5A 3G4SN 3JS6A 2HBMA 1TVRA 1C0TA 1TKZA 4PL8A 4N76A 1BISA 2UYTA 1U45A 3T1YK 4AILC 2P9SA 1BUPA 4QS8A 2BE2A 3QINA 3RSEA 3CG7A 5HRNA 5EU7A 1BO5O 3D2FA 4BRAA 4DUYK 1K73O 3LP3A 4XH1A 4LY7A 1RTIA 3MK6A 1RBUA 1HYSA 4CHPA 4CHQA 4B8AB 2F4VK 4CE9A 3KD5E 2G8VA 2Q1NA 3J81O 3UIQA 4UY8O 4NLBA 5C12A 4W5OA 4FJ7A 3VEWA 4JN4A 3VOVA 1JLBA 3TAEA 1GLEG 4E7JA 2ASPA 4FPBA 4FJJA 3H46O 5J1EA 5JICA 3HM8A 4U7BA 1QQMA 1RBRA 2RN2A 4H0PA 1D9DA 5BR8K 4JD2B 2ZE2A 2V52B 4H0XB 5I3UA 1BI4A 3BF1A 1NKCA 2FF6A 3JSMA 2YHXA 2IIRA 3HZ6A 2O8FB 3QBXA 2B6AA 4CZJA 4Z94A 1TKDA 3I0SA 2OCEA 3V9SA 1HQUA 3ID8A 3NGIA 3MXJA 4DSJA 1VQMN 2HVIA 3ISNC 3O6WA 2ZJQL 4NXMK 1E4GT 1Z6RA 2P9SB 3CCJN 4I2PA 5KI6A 1LAWA 4BE1A 4FJHA 3RSEB 3CC4N 5C25A 1T6DA 1YHQN 2CGJA 3AVNA 1KAYA 3LDQA 3WXKA 5BRFA 1S1TA 2D1KA 3C6TA 4FJ5A 3OYKA 4FW2A 4B9SA 2WFBA 4ZHRA 5LMUK 4FVUA 2H3GX 1XWLA 1L5UA 3KIOA 2HOEA 1OH7A 5AQRA 1XHZA 4BRNA 4K8XA 1TUUA 4W5NA 3MN5A 1HYZA 3KD1E 1XMOK 3M6GA 4FZZA 1S1XA 2ZGZA 4JS5A 1VAZA 4CEBA 1LOTB 2QA4N 1HNZK 4B9VA 2KFNA 4MFBA 3VF2A 5FPDA 4BG9A 4NCAA 1N36K 4OVLA 5DK5A 3VESA 5HRSA 1T6CA 4DTPA 3HK2A 2KW4A 1BWFO 4JLHA 4BVOA 4MLEA 1BI4B 1VQ5N 3SUPA 2DFEA 4CZMA 4EHTA 3U3GA 4F2RA 1GOAA 5AQOA 4H5RA 4E19A 3NF7A 3K9JA 3PO5A 4BRCA 3WNGA 4B9MA 1RTJA 2HBLA 1D4XA 3HT3A 1OVQA 2UUAK 3CCVN 4PKGA 3ZEUA 3NHGA 4CHYA 3WXMB 5J2MA 4IO9L 4JAXA 1VQPN 3LZJA 2NNWA 4CJLA 3KLFA 1GLDG 3VERA 1IKYA 3W0LA 3ZX2A 4OGEA 4DTOA 2HNZA 4F9OA 3PIPL 3K57A 3EO3A 3ZT0A 3NDKA 2HNDA 4B9LA 2XY5A 2FBYA 3KKRA 2D0OA 4KI4A 2F9WA 3FZFA 5CZ1A 2G8HA 5I42A 2O8DA 3RVCA 2Q36A 5HP1A 2E6MA 4OPKA 1SL2A 1TAQA 1RNHA 4CK2A 4KBOA 3NE6A 3E1YA 2HHQA 1NKBA 3OYDA 3K58A 3C94A 1VRUA 4CZHA 1NNEA 4JK9A 3O1WA 2PFUA 5HLFA 3LP0A 4JYAK 3TTDA 3VTIA 1ILYA 4TSXA 2HB5A 1I94K 1RGIA 5HL7L 4B08A 3CI5A 4FM2A 5GADP 3CC2N 1KAXA 4DR7K 1JLEA 2P5GA 4IEEA 4B1YB 3EZ5A 5HRRA 4CJPA 1GLJO 4BRHA 4FWRA 3ZT4A 1KVBA 1OKJA 3C65A 2X74A 2A5XA 5M1QA 1ATNA 1RT5A 5C2FA 3P5JA 3M3ZA 4I2QA 3D6RA 3ZSVA 3C0BA 1YJNN 4YFUA 2P9LA 5AQYA 1U48A 4GV3A 2KTQA 4E7LA 3SJJA 1VSFA 3PX0A 4FWSA 1RT6A 4JKHA 3THWA 1NMDA 2HHUA 1NK5A 3E66A 3HPHA 4LF6K 2Q97A 3N4PA 3FLCO 1XMQK 1P8ZA 3RR7A 2FXUA 4DB3A 4B9UA 2W41A 4A62A 1WSIA 2OA8A 4CZKA 4DS5A 1S72N 5M1FA 2NLXA 2KFZA 1YITN 3ULEA 4RG8A 2O8CB 3L2UA 1OH5A 4KREA 3OS0A 3IKMA 2XY8A 2G8WA 3T19A 2BTFA 2JGUA 3HJFA 4FWMA 1TAUA 3NH2A 4C8KA 3DRRA 3AAPA 3VQCA 3SQ2A 4JI8K 1DTQA 5C0YA 2OANA 4FM1A 1RDAA 4LFAK 2YV0X 1L3TA 2WONA 1CZ9A 4M45A 2P9LB 4IO8A 3AVLA 3HVTA 3U9DA 5I9EB 3QETA 1BCMA 3H6EA 4DKWA 5AQIA 3OJSA 3RWUA 1RT7A 2KLAA 4DSFA 1NJXA 4CGHA 3DLBA 5DM7L 4CF9A 1HJOA 5LJWA 4C8LA 1M90O 3THWB 1NJWA 2DPNA 1NG9A 4CBWA 1VSKA 2J4RA 2VG6A 5AZIB 1JL2A 3O4QA 3CFRA 2HHXA 4AHUA 2NRZA 3S41A 3OYFA 4JI7K 2F96A 1LCUA 5AJ3K 3F5TA 3VQBA 4DV6K 4JK7A 4DS4A 1XUPO 2RE2A 1GOBA 2E8AA 2E2NA 1YI2N 1EX4A 1S9GA 1S1UA 3ULEB 3OYGA 4C8OA 3J80O 5CYQA 5TKYA 1X3NA 1EP4A 3TSUA 2XY7A 1W7AA 5M1OA 1U4BA 2P9UA 3O80A 3DI6A 1VSHA 1QSLA 1NGAA 1S5JA 4XH4A 4E7KA 4FJIA 1QQOA 5C2DA 4H4MA 5AQHA 5KQ8A 3ATUA 5LJVA 1IKXA 4JKGA 1D5AA 3DWLA 3A5OC 1C0FA 1C1BA 1RT2A 3UKUA 1X1PA 3VQ4A 4OJRA 3QICA 5HBMA 3MWPA 1Z26A 2QM1A 3G25A 2XHBA 4YDUC 5BPMA 4K8ZA 3M8PA 4DQIA 4EIAA 3M8RA 4LD0A 2VYPA 2WBNA 3KLGA 2Q3SA 5KTQA 2O8EB 4PY5A 4KB0A 4Q5VA 2RHKA 5BRHA 2HHWA 4FJLA 1D8YA 1WLJA 4CJQA 1W97L 2KHOA 4M3XA 4B3OA 2QWOA 3TAQA 1HYVA 2X78A 4BRDA 3R9PA 3D0PA 4JI4K 4AF1A 1HKBA 2PYLA 4YHHK 1S3XA 2O4GA 2P9UB 3A5LC 3LPTA 3OYMA 3KK7A 5AQFA 1NGBA 1RCHA 4CEEA 4B1WB 3CQ8A 4PHTX 3KWGA 2YHAA 1EKEA 4WF9L 1CLQA 3U8XA 3AAQA 4JNEA 3A5NC 4CJVA 3THXA 4ELTA 4V19S 3FZLA 4IXCA 2Z1HA 2HMIA 5AQZA 3R3LA 1HUXA 4BDPA 4LF4K 4F3TA 3UKUB 4CEFA 2CGKA 5BPNA 3CPEA 2E4LA 3ID6A 4J2DA 3PIOL 4ID5A 4CERA 1KFDA 3K5OA 1DGKN 4B1VA 2DTUA 4GKJK 1C1CA 4I9LA 2HF4A 1XI1A 1NM1A 1VQKN 1QE1A 1H1VA 1Y64A 4YORA 5AQMA 3QLHA 4CJ3A 1NWKA 3BGRA 1Q8IA 2UXCK 3V6DA 4N41A 2YHYA 3L2QA 3THYB 2OZSA 2R7YA 4FOEA 3ZX0A 3DXMA 4DTNA 5D3GA 1NU0A 3O3GA 3I8DA 3CJ7A 1A5WA 1I39A 4KHSA 1Q9XA 1Q81O 3THXB 4JK8A 3CJBA 5AQTA 3UKRA 3EYZA 3EN9A 4PKIA 1IBLK 3CXCM 4OPJA 1KLNA 4OPAA 1YTAA 4JI3K 3B8AX 1HR0K 3OS2A 2BDPA 3HO1A 1UAXA 1P90A 4Y0WA 2Q2RA 3CMEN 4AHVA 4A2AA 3CCEN 1VSMA 3NGZA 1KCFA 3VGMA 1S6QA 2FBVA 4A61A 4K25A 4NXNK 4YOUA 2QWQA 1FKOA 4N56A 3NF8A 3NVKA 2HMPA 3H1VX 3C6AA 1XC9A 3L6QA 5F2RA 3LDPA 1MWKA 4KAZA 2HF3A 4FWOA 1V4SA 2AJQA 3QEPA 3CQXA 1HNVA 3CJAA 4DCHA 2ZJRL 3I0RA 4FLYA 4B1ZA 5FLXO 5AQXA 2ZWHA 1REVA 1JKHA 2ZM6K 2LSNA 4XIUA 2B4JA 3VQAA 1BIUA 1VQLN 4BWJA 4LF5K 2VWJA 4DTJA 4YDUA 5FDLA 2VQFK 2HW3A 3D2EA 3UKRB 4DFJA 1YAGA 4BC2A 1YJ9N 3G0ZA 4CBUA 1O1WA 3CM6A 4NLCA 4HTUA 4GKKK 2UXDK 1OH8A 3OBYA 5IWAK 4FJ9A 3LDLA 1C0MA 3DAWA 3LPUA 4X66K 3AGRA 3HVRA 2NRVA 4FPAA 4CIFA 3BDPA 3J7ZO 4JKAA 2P9NB 4CEDA 2WTUA 4JRQA 1GLLO 4DV3K 3WT0A 4E1JA 1WUAA 1VK0A 2VWKA 1RBVA 1IG8A 1K9MO 3ZT1A 4KPYA 4WFNL 4E1MA 5AQSA 1QQNA 3SJHA 4Z4IA 1U04A 3P83D 2VG5A 1SV5A 4A5AA 4LF8K 4BRPA 5AQNA 5EX5A 4CHOA 4IKFA 2NRXA 3Q7CA 5FPEA 2KQ2A 4YY3K 2FF3B 4BY9C 4OKEA 1VQ6N 4B3TK 3FE1A 4ELUA 1NGEA 1NJZA 3QB0A 3CCMN 1DT9A 5FPNA 4MDAA 3ITHA 5J2PA 4BR4A 2ZGYA 4BG8A 4IJNA 4BRIA 4WQ4A 3GBTA 1J6ZA 4DTUA 4H03B 1NLVA 2A3ZA 1DEJA 3QNOA 3H1QA 4Y1DA 3OYLA 3QDKA 2QXFA 3N4QA 1X9WA 4BC4A 3O9RA 3THVA 3VA3A 1NKEA 4YOXA 4DR5K 1A5VA 3B6OA 3EY1A 3OS1A 4RCHA 2Q0UA 3VGLA 4BRKA 3OYBA 3D2FB 1U2VA 3AA4A 4CCHA 4O5BA 4E7HA 2B5JA 4M3ZA 3SBGA 3QEIA 1CZAN 3AVFA 4IFYA 4EZ9A 1V4TA 1RILA 3FFIA 4BR5A 4OPHA 3U9ZA 5CYMA 5AZJA 4Z4GA 3SAFA 1IV0A 4YOWA 1T7PA 4J2BA 5AQQA 4A5BA 4BC3A 4OGCA 4RW9A 1JCFA 1NBWA 1IKVA 4EHUA 1SUQA 4NYFA 3ZSXA 2G8KA 4M42A 4CGJA 4F2SA 1LW0A 3EL2A 5ELZA 3LZIA 4HWIA 4FWNA 3MN6A 4BVPA 3TR8A 3WXIA 3PX4A 4M7YA 4ZTFA 4DQSA 4EZ6A 3P1GA 4HCBA 2JWKA 4H0TB 3HI0A 2W6LA 4B3MK 2X6NA 4FK2A 4OLBA 4AHSA 4R5PA 3CERA 2BH1A 4KHQA 4FWQA 1RDWX 4ID1A 2O8BA 5A2QO 3TU5A 3E9OA 4DFMA 1RT4A 5HOOA 3EKUA 3P31A 4IWVA 3TAGA 1WSHA 3P4IA 4O0JA 4BWMA 4GNIA 2YJFA 2NUBA 2Y1JA 1E4FT 4KTWA 3PY8A 5TKWA 4DV7K 5AZJB 3SZ2A 1JLAA 2IDOA 4E7IA 2HHHK 2QEXN 1SKRA 1KXPA 3NGYA 3AO3A 3QESA 4CW7B 3AVAA 4DU1A 4C23A 1L3SA 2JLEA 1UOCA 3SQ1A 2E1ZA 1ATSA 3VQEA 1SL0A 3NFAA 2OPQA 1VSIA 3QNNA 3EE8A 3DLEA 4H0VB 3DM2A 3PLAA 4M3TA 1S22A 2E2OA 3R1XA 3L2WA 1S9EA 3VQPA 5KPTA 3CCSN 2Z1JA 1FXXA 4ILGB 1TK0A 3R6MA 5AQUA 2CGLA 3ZEUB 1ZBHA 1JL1A 1N5YA 1VRTA 4KH5A 1Q9YA 1EO1A 4DLGA 1R59O 1SZ2A 2WUSA 3SUNA 2CH6A 3PV8A 3S3OA 1YVNA 3LANA 3OYJA 4CBXA 2QWPA 5CR4A 2OPSA 4WFAL 2OTJN 5H1SQ 5JLHA 4B9NA 4CEOA 4IDHA 4DR3K 1KAZA 5KRSA 2A6AA 2VCPA 3HL8A 1JCEA 3MX2A 2O8DB 1VSDA 4G1QA 4JHDA 3SAGA 4FLXA 3WNEA 3K59A 4ISFA 3V81A 4ZTJA 2D0BA 4HUFA 3RR8A 5AFUA 2GBZA 4PL7A 1SL1A 4IEIA 3VEOA 3F73A 3MN7A 1NOYA 3KK2A 5B8HA 5GAEP 4DV1K 4BE0A 3HOTA 3U4LA 4CD3A 5FRNA 3RMDA 4H5TA 4IFVA 1SQKA 1NK8A 4H5NA 4JRPA 4FJGA 4R79A 1EWRA 2ZQBA 4M63C 1G15A 3BZKA 3I56N 2YKMA 1QZ6A 5LL6Z 1Q86O 1S1VA 5AQWA 4FJKA 4FVMA 2QWLA 4KH4A 1K6YA 2KKZA 2O4IA 3CCUN 3MXMA 5ADXH 1G99A 3AVCA 4YOYA 4HUEA 4BRQA 4RW8A 1NGIA 3OBWA 4DR1K 4F4KA 2PBDA 1GLFO 3H3NO 3NCIA 3VA0A 5F1XA 1C0GA 4OKJA 4JEPA 3M8QA 1TKTA 4DQ8A 4LF9K 4CVNE 3SBTA 5SWMA 4BC5A 1MDUB 3F2KA 4IFEA 2F7TA 3OHRA 4CESA 1BQNA 4JHDB 1KVAA 4HVJA 2YNFA 5KPZA 4FOIA 4MDBA 2E20A 3TWHA 3SUQA 4FK0A 3LDOA 4CZLA 4KH6A 2G8IA 4BR2A 4IDKA 5JVGL 3IAYA 1FJGK 1C0UA 3AVJA 4CZEA 3PUFA 5GIOA 1BDGA 1TK5A 5F0XA 3QO9A 4CFDA 4DTRA 1OH6A 2GELA 5C15A 4HUGA 3T3FA 1KTQA 5BPLA 3KZBA 3J8AA 4CK1A 3TTFA 4KHNA 1XC3A 3SUOA 1XNRK 1WSEA 3KKSA 1VSJA 1RFQA 3O3FA 3DLKA 4C1NK 3RMBA 3HBTA 3VQ6A 2D0PA 3BP8A 2QWMA 5FPMA 4BR0A 3CM5A 1YIJN 3E01A 3I33A 3SAHA 1NK4A 4BRMA 3QMLA 2HHSA 1J5EK 1JLGA 3ZSOA 2QWNA 3H08A 2P5OA 3VEYA 4J2AA 4BDZA 4DQRA 1HQEA 4EP5A 5EOYA 1L3VA 1GLBG 3GL1A 3LALA 3TTCA 1NGCA 3SPYA 4CZFA 2IAJA 4CGDA 3BUZB 4K42A 4O5FA 4EFHA 4W5TA 3SNNA 3DMJA 4DV2K 2UUBK 4C8MA 1EXQA 2OPPA 2IVPA 4NYNA 3VQ8A 3MEGA 5AR0A 4M7XA 3IRXA 2P9KA 4AM7A 3P38A 3IFRA 5E26A 4M41A 4CJWA 4JKFA 3CCQN 3W3DA 3ALYA 5AQLA 1BL3A 2Q0RA 2AP1A 3F9MA 2F8TA 4O0IA 3L2VA 4DF4A 3RRHA 3DRPA 4CI6A 1HPMA 4JKGB 4DWIA 1X9JA 3M1FA 5BN9A 3LAMA 1S6PA 2HBJA 5J2QA 3V9UA 3G6EN 3K5NA 4CZIA 5LY3A 3DXKA 3EEQA 4FM0A 4Z4EA 3C6UA 4JKBA 1JLFA 4DLEA 1YJWN 4RTFD 4DFPA 1EETA 1N32K 3ENBA 1FKPA 2ASMA 1KRPA 3AVIA 2FSKA 1E3MA 4MO4A 3RRGA 4O44A 3VPZA 4CGFA 3HPOA 1VQ4N 2DFFA 1RDCA 2IVNA 2YI1A 4WQ5C 4CIEA 5CY4A 2QK9A
chains in the Genus database with same CATH topology
2UUCK 4LF8K 1N33K 5IT9O 5A2QO 4JI0K 1IBLK 4JI8K 4JI6K 3OTOK 4LFBK 3T1HK 5LMNK 1J5EK 4LFAK 4YY3K 4NXMK 4JI5K 4JI3K 1HR0K 4B3TK 4DV1K 4JI2K 4JYAK 2UXBK 4DR4K 4DR6K 4X65K 4JI4K 3JAMO 4YHHK 4DV0K 4JV5K 4DV7K 4X64K 1I94K 4JI1K 5LMUK 4NXNK 1N34K 2HHHK 1HNWK 5LL6Z 4LF7K 4DR7K 4CW7B 4DV2K 2UUBK 2VQEK 4V19S 1IBKK 1XMOK 4DR1K 4JI7K 5AJ3K 4OX9K 4DR5K 4DV4K 4DV6K 4LF4K 4B3SK 1HNZK 5FLXO 4LF9K 2ZM6K 3T1YK 1N36K 4CVNE 2UU9K 3J80O 4DR2K 4DV5K 4LF5K 4X62K 4K0KK 2VQFK 4GKJK 4DUYK 4LFCK 4DUZK 1FJGK 4LF6K 2F4VK 2UUAK 4GKKK 2UXDK 5IWAK 1XMQK 4AQYK 3J81O 4X66K 1N32K 2UXCK 1XNQK 3J7YP 4DV3K 4DR3K 2E5LK 4KHPK 4B3MK 5BR8K 1XNRK 3J7AP 1IBMK 1HNXK 4B3RK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UUC K;  4LF8 K;  1N33 K;  5IT9 O;  5A2Q O;  4JI0 K;  1IBL K;  4JI8 K;  4JI6 K;  3OTO K;  4LFB K;  3T1H K;  5LMN K;  1J5E K;  4LFA K;  4YY3 K;  4NXM K;  4JI5 K;  4JI3 K;  1HR0 K;  4B3T K;  4DV1 K;  4JI2 K;  4JYA K;  2UXB K;  4DR4 K;  4DR6 K;  4X65 K;  4JI4 K;  3JAM O;  4YHH K;  4DV0 K;  4JV5 K;  4DV7 K;  4X64 K;  1I94 K;  4JI1 K;  5LMU K;  4NXN K;  1N34 K;  2HHH K;  1HNW K;  5LL6 Z;  4LF7 K;  4DR7 K;  4CW7 B;  4DV2 K;  2UUB K;  2VQE K;  4V19 S;  1IBK K;  1XMO K;  4DR1 K;  4JI7 K;  5AJ3 K;  4OX9 K;  4DR5 K;  4DV4 K;  4DV6 K;  4LF4 K;  4B3S K;  1HNZ K;  5FLX O;  4LF9 K;  2ZM6 K;  3T1Y K;  1N36 K;  4CVN E;  2UU9 K;  3J80 O;  4DR2 K;  4DV5 K;  4LF5 K;  4X62 K;  4K0K K;  2VQF K;  4GKJ K;  4DUY K;  4LFC K;  4DUZ K;  1FJG K;  4LF6 K;  2F4V K;  2UUA K;  4GKK K;  2UXD K;  5IWA K;  1XMQ K;  4AQY K;  3J81 O;  4X66 K;  1N32 K;  2UXC K;  1XNQ K;  3J7Y P;  4DV3 K;  4DR3 K;  2E5L K;  4KHP K;  4B3M K;  5BR8 K;  1XNR K;  3J7A P;  1IBM K;  1HNX K;  4B3R K; 
#chains in the Genus database with same CATH topology
 1K8K A;  5AFU H;  3BY5 A;  2HBK A;  3NH1 A;  3DLH A;  3SYZ A;  2D5R A;  4H4O A;  1N33 K;  3LP1 A;  3LDN A;  3KK1 A;  4H5W A;  1QHT A;  3OA9 A;  3KWI A;  4LFB K;  4BRL A;  3E9P A;  2YNH A;  5LMN K;  1B9F A;  4QS9 A;  1UA1 A;  1VQN N;  4CGI A;  1SS6 A;  3D7E O;  4N5S A;  4DQQ A;  5HRP A;  1RTD A;  3AVH A;  3HRG A;  4BE2 A;  4CEC A;  1RTH A;  1BCO A;  2I7P A;  3SMS A;  3GG4 A;  2X6S A;  3TAR A;  2FC0 A;  1BHL A;  1X9S A;  3FGU A;  1L3U A;  3SCX A;  5BRD A;  3RMC A;  4J8F A;  3F9K A;  4KHU A;  3UB5 A;  2VQE K;  1TYQ A;  3DXK B;  1IBK K;  1GLA G;  1TGO A;  3KLE A;  4OX9 K;  3LDS A;  2E1Y A;  2GWJ A;  5KQD A;  4H5V A;  4GVE A;  2OTL N;  1ASU A;  2XO7 A;  3QEW A;  2UU9 K;  1T3V A;  3JXU A;  3DRS A;  4GW6 A;  4LSN A;  3WXL A;  1NGJ A;  4QOZ B;  4IJA A;  4CJU A;  4QAG A;  1K8K B;  3MCA B;  2E2Q A;  4LFC K;  3PSF A;  4FLZ A;  3V4I A;  2Z1G A;  3V9X A;  1U49 A;  4PA1 A;  3VEZ A;  4DU3 A;  3H3O B;  2QXL A;  4YOT A;  4WYB A;  1JCG A;  2EX3 A;  4IZ9 A;  3TSQ A;  3AY9 A;  3MAQ A;  2PY5 A;  4AQY K;  3OYE A;  1J54 A;  3DXM B;  4BQL A;  4CHZ A;  1TUY A;  2QTD A;  3Q7B A;  1UWB A;  3IMX A;  2OZM A;  3ZSY A;  4B9T A;  2PZS A;  2GX9 A;  2W6K A;  2Y1I A;  4FJX A;  4ISE A;  1FK9 A;  4BRG A;  1OVY A;  1YXQ A;  4CEA A;  3MEE A;  5BR9 A;  3GE1 A;  3HOS A;  4CJF A;  4MLH A;  4KHP K;  3J7A P;  3AAR A;  3O5B A;  3QIO A;  4F8R A;  4LH4 A;  1TYQ B;  2UUC K;  3AVM A;  1X3M A;  1QQC A;  4E1N A;  2E2P A;  5GAH P;  2P1J A;  2W42 A;  2E6L A;  1T05 A;  2O8F A;  3O4W A;  4JI5 K;  1WAJ A;  4BR9 A;  3TAP A;  4DFK A;  4DHY A;  3OJU A;  1NK6 A;  1KD1 O;  1T8E A;  1GOC A;  4JV5 K;  3SI6 A;  4FLW A;  3ZCM A;  5EY4 A;  5BRE A;  3LAK A;  1VQO N;  2XRI A;  3HPG A;  1TL1 A;  4G9Z A;  4DG1 A;  2QKB A;  3O4N A;  3ZT2 A;  2GTD A;  3DLG A;  3O8M A;  4K43 A;  3MXI A;  1QS4 A;  3TAN A;  2F8S A;  4H8K A;  5M1K A;  1J5O A;  1C1A A;  5E84 A;  1QVG M;  4IOA L;  3OYA A;  3HP9 A;  3V9W A;  1Q7Y O;  4J2E A;  4HTL A;  2HST A;  3WQU A;  3D2E B;  1JLQ A;  4CF1 A;  4KTZ A;  4ILH A;  3VN5 A;  2YJE A;  3AO5 A;  5DMR A;  5E41 A;  1HPZ A;  4WQ5 A;  1NJY A;  4PQU A;  1HMV A;  1YF5 L;  4GMJ B;  2P9P A;  5DM6 L;  5ADX A;  1XQS C;  3CIP A;  2V7Y A;  3P39 A;  3NBP A;  2VWB A;  3C7N A;  3T1A A;  3C95 A;  1T03 A;  5C24 A;  4C1N I;  1Z25 A;  3LL3 A;  4E0D A;  1VSL A;  4WFB L;  4FLU A;  2RF2 A;  1CZB A;  2CH5 A;  3VQD A;  1NK7 A;  4CIG A;  2V51 B;  2ITM A;  2P9I A;  3LWL A;  4DSE A;  3FZM A;  3VQ9 A;  3OYI A;  1N8R O;  3AO2 A;  5FRM A;  3A8Y A;  2QKK A;  1YUW A;  1K8A O;  3L3V A;  3K0S A;  3M5R A;  4BRE A;  4XH5 A;  4KHW A;  4CJR A;  4M3Y A;  4W5Q A;  1WSJ A;  5T7B A;  4A2B A;  3KTQ A;  4CF2 A;  2IS3 A;  4JI0 K;  5EVZ A;  3BF3 A;  5AQV A;  1SAZ A;  3CHW A;  3IG1 A;  4C8N A;  4RW7 A;  3QFU A;  2PYJ A;  1J9A A;  3K5M A;  4Z0U A;  5MLC Q;  3QEV A;  3R8E A;  3O9Q A;  3C6H A;  2WOM A;  3U3Y A;  3I8B A;  1LWC A;  4FWP A;  3NF6 A;  4LH5 A;  4JI1 K;  3ZSR A;  3I55 N;  1BA1 A;  1J53 A;  4CJ5 A;  4A59 A;  2P9P B;  3SMP A;  1MU2 A;  5AQJ A;  3C7N B;  3JYT A;  2FBX A;  1U2V B;  2GEM A;  3PO4 A;  1C6V A;  3AA2 A;  2BAN A;  1BOT O;  3VF6 A;  3NMU A;  1WSG A;  3EZW A;  2P9I B;  1MWM A;  2D0A A;  1KC8 O;  2HVH A;  2FLO A;  4MQ3 A;  4CK3 A;  4DF8 A;  5JMV A;  1F21 A;  4BRO A;  1VQ9 N;  3PSI A;  1BA0 A;  3S3M A;  3M8S A;  2YX6 A;  2AA4 A;  3AGK A;  5CHI A;  1BQM A;  2A42 A;  3TSP A;  3K5L A;  3CFP A;  4MO5 A;  3CF5 L;  3CCL N;  3QFP A;  4BQZ A;  4CD1 A;  4K0K K;  1VHX A;  3SQ4 A;  1NOZ A;  3AO4 A;  3FFK B;  1ZBS A;  3ATV A;  3O9U A;  2ASO A;  4L8R B;  3HSC A;  1ASV A;  4KV8 A;  5SZT A;  1HJR A;  4CEZ A;  1RT1 A;  3TAB A;  3CJ1 A;  1WBB A;  4IOC L;  5M1P A;  4FSV A;  4FYD A;  4FK4 A;  4CEQ A;  3TAM A;  1JJ2 M;  3VQ7 A;  4CFB A;  1LWE A;  4PUO A;  4A57 A;  1CXQ A;  3L4Q A;  1JLC A;  3AVG A;  3KLI A;  3QIP A;  4O8U A;  4JKC A;  3KK3 A;  3LWM A;  1GLC G;  3A0I X;  4H0O A;  1XHX A;  3KVG A;  3WNF A;  3KJV A;  4M3U A;  2ETJ A;  4LSL A;  3BEX A;  4M3W A;  2YNG A;  2O8B B;  1QZ5 A;  1JXE A;  3ZSW A;  2ZJP L;  3RMA A;  4ELV A;  4HHT A;  1HX1 A;  1BG3 A;  3ENO A;  3NAE A;  1WAF A;  5IT9 O;  1ZBU A;  4AHR A;  2O8C A;  3S9H A;  2ZD1 A;  1CXU A;  4CJE A;  2F9T A;  1RDD A;  3AO1 A;  4NO7 A;  3T1H K;  4XEI A;  4IOX A;  3L4I A;  3NVM A;  3CJC A;  3RTV A;  3CCR N;  4X65 K;  3MDQ A;  3JAM O;  4WCE L;  3G71 N;  5GIP A;  3VGK A;  4CGG A;  3WXJ A;  1ATR A;  4FL9 A;  4I6M A;  2DFH A;  3K2P A;  1HNW K;  3O1B A;  4LF7 K;  2GV9 A;  3L3U A;  3AVB A;  3V9Z A;  3OY9 A;  4YOV A;  4HCC A;  5KGX A;  2A1R A;  1KVC A;  3PX6 A;  4L3Q A;  1Y97 A;  1O13 A;  3H45 C;  3OW2 M;  4AM6 A;  3IDH A;  1YTU A;  5KRT A;  4ISG A;  2RKI A;  5AZI A;  2W40 A;  4B3S K;  1QSS A;  4BAC A;  4NCB A;  3T7Z A;  4KRF A;  4GVM A;  2HHT A;  3DLL L;  4X62 K;  3EE9 A;  3QBW A;  2VG7 A;  1R0A A;  2I5J A;  3V1Q A;  1WN7 A;  2IC3 A;  1U47 A;  3MMV A;  1EQY A;  1WSF A;  3QEX A;  3ULD A;  2QWR A;  3ZYY X;  3G10 A;  3TAF A;  1RBS A;  4OO1 J;  3A5M C;  3AV9 A;  1QTM A;  3NH0 A;  3TI0 A;  2YHB A;  2JWL A;  4CFC A;  5BN8 A;  2XY6 A;  1XNQ K;  3U6F A;  2HHV A;  3GOI A;  4I9Q A;  4CJ4 A;  3DOL A;  4I6M B;  4CZG A;  3BZC A;  4DSK A;  5CE3 A;  1NGG A;  4E89 A;  3T69 A;  2D0C A;  1ZC6 A;  3SLC A;  4CJS A;  4KFB A;  3ENH A;  1HNX K;  4DTM A;  5FRO A;  1VQ8 N;  4PWD A;  3IS9 A;  5GAG P;  4B9Q A;  4U67 L;  3SV4 A;  4KTQ A;  2V7Z A;  4ICL A;  4FJN A;  1QVF M;  2O8E A;  1TK8 A;  2BGG A;  1ZXO A;  1DTT A;  1NK0 A;  2UXB K;  1W9H A;  2PAV A;  3L8B A;  1EWQ A;  4FZX C;  5JVH L;  1FW6 A;  3IUC A;  1B9D A;  2KZM A;  4FZY A;  1DLO A;  3ZET A;  1VQ7 N;  1RBT A;  1MA9 B;  2FSN A;  3B6P A;  3CET A;  3WEE A;  2GUP A;  4CFA A;  3EKS A;  4Q0B A;  3DLR A;  4CHN A;  1HRH A;  5AQG A;  3FZK A;  1HLU A;  4KB1 A;  2RPI A;  3VET A;  1NGH A;  2YNI A;  1IO2 A;  3VQQ A;  2EHG A;  3LP2 A;  4JKD A;  1NMN A;  2A1S A;  3FR0 A;  1ZYQ A;  3SQ0 A;  1WOQ A;  4RW6 A;  1VSE A;  3K9K A;  3AVK A;  4JKE A;  2IOC A;  4W5R A;  1TV6 A;  1M1K O;  1NK9 A;  3HTV A;  1ITG A;  4FWL A;  3ZLJ A;  1JXB A;  3CJ9 A;  5C42 A;  3S3N A;  3CPW M;  2NRT A;  3AA5 X;  3V1O A;  1Z05 A;  4FJM A;  2A40 A;  4DUZ K;  4RWT A;  2GUI A;  4H0Y B;  3WNH A;  4AH9 A;  4CJT A;  3ZSZ A;  1SKS A;  2VGM A;  3SV3 A;  1I3A A;  4BRF A;  4QS7 A;  4OKK A;  4GV9 A;  1D9F A;  1W0H A;  3GDQ A;  3J7Y P;  4FJ8 A;  3LM2 A;  3MCP A;  3ZX3 A;  2HNY A;  5AQK A;  4N47 A;  2YKN A;  4KO0 A;  2E5L K;  3ZET B;  4FO0 A;  4KKO A;  1HKG A;  4O4G A;  3WEE B;  1WBD A;  1IBM K;  4CF8 A;  3NF9 A;  4WE1 A;  4KHY A;  4DMN A;  1HKC A;  3THY A;  3V1R A;  1DKG D;  4I7F A;  1NGF A;  4Z4H A;  5J2N A;  5JLF A;  3VEV A;  4AHC A;  1KSP A;  1LAV A;  3OYN A;  3OVN A;  4JI6 K;  1ASW A;  1ZBF A;  3MN9 A;  5JS1 A;  1X9M A;  4FXD A;  2E88 A;  4BGB A;  3KLH A;  3VEN A;  4DSL A;  3OYH A;  1Q18 A;  4DR4 K;  4DR6 K;  4DSI A;  4BGA A;  3HM9 A;  4GY2 B;  3MX5 A;  4IG0 A;  4EP4 A;  2EWS A;  3HXM A;  2DY4 A;  4DV0 K;  4IBN A;  4FW1 A;  3O08 A;  2G8U A;  3LM9 A;  4M3R A;  3CC7 N;  3E9L A;  5CZ2 A;  1BGX T;  2NRW A;  1TKX A;  5AQP A;  1WB9 A;  4K41 A;  4E3S A;  3UE5 A;  3DYA A;  2QI2 A;  1N6Q A;  3ZSQ A;  4UQG A;  1T44 A;  2P9K B;  1NJI O;  5C10 A;  1LWF A;  4WQ4 C;  5K14 A;  2NZT A;  3HST B;  2IVO A;  4YNQ A;  2NRR A;  3VF4 A;  4Y1C A;  3OYC A;  3O3H A;  2Z1I A;  4DV4 K;  4GV6 A;  2A41 A;  4PKH A;  4OLA A;  1B92 A;  1RT3 A;  2WC9 A;  1TL3 A;  3HP6 A;  2FBT A;  3WUH A;  4LC9 B;  1KFS A;  5KPR A;  1QSY A;  1RDB A;  4NB4 A;  2KZZ A;  1W2B M;  4DR2 K;  4NCG A;  4DV5 K;  3DOK A;  4DTX A;  1KLM A;  4ILJ A;  4QCL A;  3O9S A;  3MED A;  3SPZ A;  4O55 A;  4DU4 A;  3CFO A;  1BU6 O;  4AHT A;  1BIZ A;  5M1N A;  1HNI A;  1UA0 A;  4BR7 A;  3L0Q A;  4Z4F A;  2ZF5 O;  2YCH A;  1SKW A;  1IJJ A;  2QW9 A;  2ITG A;  1QHA A;  3FZH A;  1KQS M;  3MWT A;  2G8F A;  3HYF A;  1ZBI A;  2OPR A;  3WQT A;  3CQY A;  2YHW A;  2P51 A;  3VMF B;  4FLT A;  2GWK A;  3VEX A;  4JS4 A;  4DQP A;  2BUP A;  4RW4 A;  4B1U B;  3O9T A;  3TPQ A;  5JS2 A;  4FCY A;  2FSJ A;  2IGI A;  4Z4C A;  2Q31 A;  1A5X A;  3DJC A;  4IG3 A;  2P9N A;  5KGW A;  1ESV A;  3ZT3 A;  1YVU A;  1LV5 A;  2OYQ A;  4B3R K;  4CJK A;  3A2F A;  1IH7 A;  3AA3 A;  4CF0 A;  1U6Z A;  4CJ7 A;  3OTO K;  4B8C A;  2NRH A;  4FLV A;  3VTH A;  3SK3 A;  3ASM A;  1NGD A;  1LW2 A;  1YT3 A;  2D4W A;  2ATQ A;  4DTS A;  4JI2 K;  4KI6 A;  4B1X B;  3MEC A;  3L2R A;  1IKW A;  4F3O A;  3CMA N;  1S1W A;  4X64 K;  5EXW A;  3D45 A;  4BDY A;  3KHY A;  1N34 K;  4EAH D;  3CYM A;  4O8K A;  3CD6 N;  1WNS A;  4JD2 A;  1Q82 O;  1RDU A;  5GIN A;  2VGN A;  5HRO A;  4FWK A;  1IG9 A;  3QER A;  2I7N A;  1ZBL A;  3VQ5 A;  3G4S N;  3JS6 A;  2HBM A;  1TVR A;  1C0T A;  1TKZ A;  4PL8 A;  4N76 A;  1BIS A;  2UYT A;  1U45 A;  3T1Y K;  4AIL C;  2P9S A;  1BUP A;  4QS8 A;  2BE2 A;  3QIN A;  3RSE A;  3CG7 A;  5HRN A;  5EU7 A;  1BO5 O;  3D2F A;  4BRA A;  4DUY K;  1K73 O;  3LP3 A;  4XH1 A;  4LY7 A;  1RTI A;  3MK6 A;  1RBU A;  1HYS A;  4CHP A;  4CHQ A;  4B8A B;  2F4V K;  4CE9 A;  3KD5 E;  2G8V A;  2Q1N A;  3J81 O;  3UIQ A;  4UY8 O;  4NLB A;  5C12 A;  4W5O A;  4FJ7 A;  3VEW A;  4JN4 A;  3VOV A;  1JLB A;  3TAE A;  1GLE G;  4E7J A;  2ASP A;  4FPB A;  4FJJ A;  3H46 O;  5J1E A;  5JIC A;  3HM8 A;  4U7B A;  1QQM A;  1RBR A;  2RN2 A;  4H0P A;  1D9D A;  5BR8 K;  4JD2 B;  2ZE2 A;  2V52 B;  4H0X B;  5I3U A;  1BI4 A;  3BF1 A;  1NKC A;  2FF6 A;  3JSM A;  2YHX A;  2IIR A;  3HZ6 A;  2O8F B;  3QBX A;  2B6A A;  4CZJ A;  4Z94 A;  1TKD A;  3I0S A;  2OCE A;  3V9S A;  1HQU A;  3ID8 A;  3NGI A;  3MXJ A;  4DSJ A;  1VQM N;  2HVI A;  3ISN C;  3O6W A;  2ZJQ L;  4NXM K;  1E4G T;  1Z6R A;  2P9S B;  3CCJ N;  4I2P A;  5KI6 A;  1LAW A;  4BE1 A;  4FJH A;  3RSE B;  3CC4 N;  5C25 A;  1T6D A;  1YHQ N;  2CGJ A;  3AVN A;  1KAY A;  3LDQ A;  3WXK A;  5BRF A;  1S1T A;  2D1K A;  3C6T A;  4FJ5 A;  3OYK A;  4FW2 A;  4B9S A;  2WFB A;  4ZHR A;  5LMU K;  4FVU A;  2H3G X;  1XWL A;  1L5U A;  3KIO A;  2HOE A;  1OH7 A;  5AQR A;  1XHZ A;  4BRN A;  4K8X A;  1TUU A;  4W5N A;  3MN5 A;  1HYZ A;  3KD1 E;  1XMO K;  3M6G A;  4FZZ A;  1S1X A;  2ZGZ A;  4JS5 A;  1VAZ A;  4CEB A;  1LOT B;  2QA4 N;  1HNZ K;  4B9V A;  2KFN A;  4MFB A;  3VF2 A;  5FPD A;  4BG9 A;  4NCA A;  1N36 K;  4OVL A;  5DK5 A;  3VES A;  5HRS A;  1T6C A;  4DTP A;  3HK2 A;  2KW4 A;  1BWF O;  4JLH A;  4BVO A;  4MLE A;  1BI4 B;  1VQ5 N;  3SUP A;  2DFE A;  4CZM A;  4EHT A;  3U3G A;  4F2R A;  1GOA A;  5AQO A;  4H5R A;  4E19 A;  3NF7 A;  3K9J A;  3PO5 A;  4BRC A;  3WNG A;  4B9M A;  1RTJ A;  2HBL A;  1D4X A;  3HT3 A;  1OVQ A;  2UUA K;  3CCV N;  4PKG A;  3ZEU A;  3NHG A;  4CHY A;  3WXM B;  5J2M A;  4IO9 L;  4JAX A;  1VQP N;  3LZJ A;  2NNW A;  4CJL A;  3KLF A;  1GLD G;  3VER A;  1IKY A;  3W0L A;  3ZX2 A;  4OGE A;  4DTO A;  2HNZ A;  4F9O A;  3PIP L;  3K57 A;  3EO3 A;  3ZT0 A;  3NDK A;  2HND A;  4B9L A;  2XY5 A;  2FBY A;  3KKR A;  2D0O A;  4KI4 A;  2F9W A;  3FZF A;  5CZ1 A;  2G8H A;  5I42 A;  2O8D A;  3RVC A;  2Q36 A;  5HP1 A;  2E6M A;  4OPK A;  1SL2 A;  1TAQ A;  1RNH A;  4CK2 A;  4KBO A;  3NE6 A;  3E1Y A;  2HHQ A;  1NKB A;  3OYD A;  3K58 A;  3C94 A;  1VRU A;  4CZH A;  1NNE A;  4JK9 A;  3O1W A;  2PFU A;  5HLF A;  3LP0 A;  4JYA K;  3TTD A;  3VTI A;  1ILY A;  4TSX A;  2HB5 A;  1I94 K;  1RGI A;  5HL7 L;  4B08 A;  3CI5 A;  4FM2 A;  5GAD P;  3CC2 N;  1KAX A;  4DR7 K;  1JLE A;  2P5G A;  4IEE A;  4B1Y B;  3EZ5 A;  5HRR A;  4CJP A;  1GLJ O;  4BRH A;  4FWR A;  3ZT4 A;  1KVB A;  1OKJ A;  3C65 A;  2X74 A;  2A5X A;  5M1Q A;  1ATN A;  1RT5 A;  5C2F A;  3P5J A;  3M3Z A;  4I2Q A;  3D6R A;  3ZSV A;  3C0B A;  1YJN N;  4YFU A;  2P9L A;  5AQY A;  1U48 A;  4GV3 A;  2KTQ A;  4E7L A;  3SJJ A;  1VSF A;  3PX0 A;  4FWS A;  1RT6 A;  4JKH A;  3THW A;  1NMD A;  2HHU A;  1NK5 A;  3E66 A;  3HPH A;  4LF6 K;  2Q97 A;  3N4P A;  3FLC O;  1XMQ K;  1P8Z A;  3RR7 A;  2FXU A;  4DB3 A;  4B9U A;  2W41 A;  4A62 A;  1WSI A;  2OA8 A;  4CZK A;  4DS5 A;  1S72 N;  5M1F A;  2NLX A;  2KFZ A;  1YIT N;  3ULE A;  4RG8 A;  2O8C B;  3L2U A;  1OH5 A;  4KRE A;  3OS0 A;  3IKM A;  2XY8 A;  2G8W A;  3T19 A;  2BTF A;  2JGU A;  3HJF A;  4FWM A;  1TAU A;  3NH2 A;  4C8K A;  3DRR A;  3AAP A;  3VQC A;  3SQ2 A;  4JI8 K;  1DTQ A;  5C0Y A;  2OAN A;  4FM1 A;  1RDA A;  4LFA K;  2YV0 X;  1L3T A;  2WON A;  1CZ9 A;  4M45 A;  2P9L B;  4IO8 A;  3AVL A;  3HVT A;  3U9D A;  5I9E B;  3QET A;  1BCM A;  3H6E A;  4DKW A;  5AQI A;  3OJS A;  3RWU A;  1RT7 A;  2KLA A;  4DSF A;  1NJX A;  4CGH A;  3DLB A;  5DM7 L;  4CF9 A;  1HJO A;  5LJW A;  4C8L A;  1M90 O;  3THW B;  1NJW A;  2DPN A;  1NG9 A;  4CBW A;  1VSK A;  2J4R A;  2VG6 A;  5AZI B;  1JL2 A;  3O4Q A;  3CFR A;  2HHX A;  4AHU A;  2NRZ A;  3S41 A;  3OYF A;  4JI7 K;  2F96 A;  1LCU A;  5AJ3 K;  3F5T A;  3VQB A;  4DV6 K;  4JK7 A;  4DS4 A;  1XUP O;  2RE2 A;  1GOB A;  2E8A A;  2E2N A;  1YI2 N;  1EX4 A;  1S9G A;  1S1U A;  3ULE B;  3OYG A;  4C8O A;  3J80 O;  5CYQ A;  5TKY A;  1X3N A;  1EP4 A;  3TSU A;  2XY7 A;  1W7A A;  5M1O A;  1U4B A;  2P9U A;  3O80 A;  3DI6 A;  1VSH A;  1QSL A;  1NGA A;  1S5J A;  4XH4 A;  4E7K A;  4FJI A;  1QQO A;  5C2D A;  4H4M A;  5AQH A;  5KQ8 A;  3ATU A;  5LJV A;  1IKX A;  4JKG A;  1D5A A;  3DWL A;  3A5O C;  1C0F A;  1C1B A;  1RT2 A;  3UKU A;  1X1P A;  3VQ4 A;  4OJR A;  3QIC A;  5HBM A;  3MWP A;  1Z26 A;  2QM1 A;  3G25 A;  2XHB A;  4YDU C;  5BPM A;  4K8Z A;  3M8P A;  4DQI A;  4EIA A;  3M8R A;  4LD0 A;  2VYP A;  2WBN A;  3KLG A;  2Q3S A;  5KTQ A;  2O8E B;  4PY5 A;  4KB0 A;  4Q5V A;  2RHK A;  5BRH A;  2HHW A;  4FJL A;  1D8Y A;  1WLJ A;  4CJQ A;  1W97 L;  2KHO A;  4M3X A;  4B3O A;  2QWO A;  3TAQ A;  1HYV A;  2X78 A;  4BRD A;  3R9P A;  3D0P A;  4JI4 K;  4AF1 A;  1HKB A;  2PYL A;  4YHH K;  1S3X A;  2O4G A;  2P9U B;  3A5L C;  3LPT A;  3OYM A;  3KK7 A;  5AQF A;  1NGB A;  1RCH A;  4CEE A;  4B1W B;  3CQ8 A;  4PHT X;  3KWG A;  2YHA A;  1EKE A;  4WF9 L;  1CLQ A;  3U8X A;  3AAQ A;  4JNE A;  3A5N C;  4CJV A;  3THX A;  4ELT A;  4V19 S;  3FZL A;  4IXC A;  2Z1H A;  2HMI A;  5AQZ A;  3R3L A;  1HUX A;  4BDP A;  4LF4 K;  4F3T A;  3UKU B;  4CEF A;  2CGK A;  5BPN A;  3CPE A;  2E4L A;  3ID6 A;  4J2D A;  3PIO L;  4ID5 A;  4CER A;  1KFD A;  3K5O A;  1DGK N;  4B1V A;  2DTU A;  4GKJ K;  1C1C A;  4I9L A;  2HF4 A;  1XI1 A;  1NM1 A;  1VQK N;  1QE1 A;  1H1V A;  1Y64 A;  4YOR A;  5AQM A;  3QLH A;  4CJ3 A;  1NWK A;  3BGR A;  1Q8I A;  2UXC K;  3V6D A;  4N41 A;  2YHY A;  3L2Q A;  3THY B;  2OZS A;  2R7Y A;  4FOE A;  3ZX0 A;  3DXM A;  4DTN A;  5D3G A;  1NU0 A;  3O3G A;  3I8D A;  3CJ7 A;  1A5W A;  1I39 A;  4KHS A;  1Q9X A;  1Q81 O;  3THX B;  4JK8 A;  3CJB A;  5AQT A;  3UKR A;  3EYZ A;  3EN9 A;  4PKI A;  1IBL K;  3CXC M;  4OPJ A;  1KLN A;  4OPA A;  1YTA A;  4JI3 K;  3B8A X;  1HR0 K;  3OS2 A;  2BDP A;  3HO1 A;  1UAX A;  1P90 A;  4Y0W A;  2Q2R A;  3CME N;  4AHV A;  4A2A A;  3CCE N;  1VSM A;  3NGZ A;  1KCF A;  3VGM A;  1S6Q A;  2FBV A;  4A61 A;  4K25 A;  4NXN K;  4YOU A;  2QWQ A;  1FKO A;  4N56 A;  3NF8 A;  3NVK A;  2HMP A;  3H1V X;  3C6A A;  1XC9 A;  3L6Q A;  5F2R A;  3LDP A;  1MWK A;  4KAZ A;  2HF3 A;  4FWO A;  1V4S A;  2AJQ A;  3QEP A;  3CQX A;  1HNV A;  3CJA A;  4DCH A;  2ZJR L;  3I0R A;  4FLY A;  4B1Z A;  5FLX O;  5AQX A;  2ZWH A;  1REV A;  1JKH A;  2ZM6 K;  2LSN A;  4XIU A;  2B4J A;  3VQA A;  1BIU A;  1VQL N;  4BWJ A;  4LF5 K;  2VWJ A;  4DTJ A;  4YDU A;  5FDL A;  2VQF K;  2HW3 A;  3D2E A;  3UKR B;  4DFJ A;  1YAG A;  4BC2 A;  1YJ9 N;  3G0Z A;  4CBU A;  1O1W A;  3CM6 A;  4NLC A;  4HTU A;  4GKK K;  2UXD K;  1OH8 A;  3OBY A;  5IWA K;  4FJ9 A;  3LDL A;  1C0M A;  3DAW A;  3LPU A;  4X66 K;  3AGR A;  3HVR A;  2NRV A;  4FPA A;  4CIF A;  3BDP A;  3J7Z O;  4JKA A;  2P9N B;  4CED A;  2WTU A;  4JRQ A;  1GLL O;  4DV3 K;  3WT0 A;  4E1J A;  1WUA A;  1VK0 A;  2VWK A;  1RBV A;  1IG8 A;  1K9M O;  3ZT1 A;  4KPY A;  4WFN L;  4E1M A;  5AQS A;  1QQN A;  3SJH A;  4Z4I A;  1U04 A;  3P83 D;  2VG5 A;  1SV5 A;  4A5A A;  4LF8 K;  4BRP A;  5AQN A;  5EX5 A;  4CHO A;  4IKF A;  2NRX A;  3Q7C A;  5FPE A;  2KQ2 A;  4YY3 K;  2FF3 B;  4BY9 C;  4OKE A;  1VQ6 N;  4B3T K;  3FE1 A;  4ELU A;  1NGE A;  1NJZ A;  3QB0 A;  3CCM N;  1DT9 A;  5FPN A;  4MDA A;  3ITH A;  5J2P A;  4BR4 A;  2ZGY A;  4BG8 A;  4IJN A;  4BRI A;  4WQ4 A;  3GBT A;  1J6Z A;  4DTU A;  4H03 B;  1NLV A;  2A3Z A;  1DEJ A;  3QNO A;  3H1Q A;  4Y1D A;  3OYL A;  3QDK A;  2QXF A;  3N4Q A;  1X9W A;  4BC4 A;  3O9R A;  3THV A;  3VA3 A;  1NKE A;  4YOX A;  4DR5 K;  1A5V A;  3B6O A;  3EY1 A;  3OS1 A;  4RCH A;  2Q0U A;  3VGL A;  4BRK A;  3OYB A;  3D2F B;  1U2V A;  3AA4 A;  4CCH A;  4O5B A;  4E7H A;  2B5J A;  4M3Z A;  3SBG A;  3QEI A;  1CZA N;  3AVF A;  4IFY A;  4EZ9 A;  1V4T A;  1RIL A;  3FFI A;  4BR5 A;  4OPH A;  3U9Z A;  5CYM A;  5AZJ A;  4Z4G A;  3SAF A;  1IV0 A;  4YOW A;  1T7P A;  4J2B A;  5AQQ A;  4A5B A;  4BC3 A;  4OGC A;  4RW9 A;  1JCF A;  1NBW A;  1IKV A;  4EHU A;  1SUQ A;  4NYF A;  3ZSX A;  2G8K A;  4M42 A;  4CGJ A;  4F2S A;  1LW0 A;  3EL2 A;  5ELZ A;  3LZI A;  4HWI A;  4FWN A;  3MN6 A;  4BVP A;  3TR8 A;  3WXI A;  3PX4 A;  4M7Y A;  4ZTF A;  4DQS A;  4EZ6 A;  3P1G A;  4HCB A;  2JWK A;  4H0T B;  3HI0 A;  2W6L A;  4B3M K;  2X6N A;  4FK2 A;  4OLB A;  4AHS A;  4R5P A;  3CER A;  2BH1 A;  4KHQ A;  4FWQ A;  1RDW X;  4ID1 A;  2O8B A;  5A2Q O;  3TU5 A;  3E9O A;  4DFM A;  1RT4 A;  5HOO A;  3EKU A;  3P31 A;  4IWV A;  3TAG A;  1WSH A;  3P4I A;  4O0J A;  4BWM A;  4GNI A;  2YJF A;  2NUB A;  2Y1J A;  1E4F T;  4KTW A;  3PY8 A;  5TKW A;  4DV7 K;  5AZJ B;  3SZ2 A;  1JLA A;  2IDO A;  4E7I A;  2HHH K;  2QEX N;  1SKR A;  1KXP A;  3NGY A;  3AO3 A;  3QES A;  4CW7 B;  3AVA A;  4DU1 A;  4C23 A;  1L3S A;  2JLE A;  1UOC A;  3SQ1 A;  2E1Z A;  1ATS A;  3VQE A;  1SL0 A;  3NFA A;  2OPQ A;  1VSI A;  3QNN A;  3EE8 A;  3DLE A;  4H0V B;  3DM2 A;  3PLA A;  4M3T A;  1S22 A;  2E2O A;  3R1X A;  3L2W A;  1S9E A;  3VQP A;  5KPT A;  3CCS N;  2Z1J A;  1FXX A;  4ILG B;  1TK0 A;  3R6M A;  5AQU A;  2CGL A;  3ZEU B;  1ZBH A;  1JL1 A;  1N5Y A;  1VRT A;  4KH5 A;  1Q9Y A;  1EO1 A;  4DLG A;  1R59 O;  1SZ2 A;  2WUS A;  3SUN A;  2CH6 A;  3PV8 A;  3S3O A;  1YVN A;  3LAN A;  3OYJ A;  4CBX A;  2QWP A;  5CR4 A;  2OPS A;  4WFA L;  2OTJ N;  5H1S Q;  5JLH A;  4B9N A;  4CEO A;  4IDH A;  4DR3 K;  1KAZ A;  5KRS A;  2A6A A;  2VCP A;  3HL8 A;  1JCE A;  3MX2 A;  2O8D B;  1VSD A;  4G1Q A;  4JHD A;  3SAG A;  4FLX A;  3WNE A;  3K59 A;  4ISF A;  3V81 A;  4ZTJ A;  2D0B A;  4HUF A;  3RR8 A;  5AFU A;  2GBZ A;  4PL7 A;  1SL1 A;  4IEI A;  3VEO A;  3F73 A;  3MN7 A;  1NOY A;  3KK2 A;  5B8H A;  5GAE P;  4DV1 K;  4BE0 A;  3HOT A;  3U4L A;  4CD3 A;  5FRN A;  3RMD A;  4H5T A;  4IFV A;  1SQK A;  1NK8 A;  4H5N A;  4JRP A;  4FJG A;  4R79 A;  1EWR A;  2ZQB A;  4M63 C;  1G15 A;  3BZK A;  3I56 N;  2YKM A;  1QZ6 A;  5LL6 Z;  1Q86 O;  1S1V A;  5AQW A;  4FJK A;  4FVM A;  2QWL A;  4KH4 A;  1K6Y A;  2KKZ A;  2O4I A;  3CCU N;  3MXM A;  5ADX H;  1G99 A;  3AVC A;  4YOY A;  4HUE A;  4BRQ A;  4RW8 A;  1NGI A;  3OBW A;  4DR1 K;  4F4K A;  2PBD A;  1GLF O;  3H3N O;  3NCI A;  3VA0 A;  5F1X A;  1C0G A;  4OKJ A;  4JEP A;  3M8Q A;  1TKT A;  4DQ8 A;  4LF9 K;  4CVN E;  3SBT A;  5SWM A;  4BC5 A;  1MDU B;  3F2K A;  4IFE A;  2F7T A;  3OHR A;  4CES A;  1BQN A;  4JHD B;  1KVA A;  4HVJ A;  2YNF A;  5KPZ A;  4FOI A;  4MDB A;  2E20 A;  3TWH A;  3SUQ A;  4FK0 A;  3LDO A;  4CZL A;  4KH6 A;  2G8I A;  4BR2 A;  4IDK A;  5JVG L;  3IAY A;  1FJG K;  1C0U A;  3AVJ A;  4CZE A;  3PUF A;  5GIO A;  1BDG A;  1TK5 A;  5F0X A;  3QO9 A;  4CFD A;  4DTR A;  1OH6 A;  2GEL A;  5C15 A;  4HUG A;  3T3F A;  1KTQ A;  5BPL A;  3KZB A;  3J8A A;  4CK1 A;  3TTF A;  4KHN A;  1XC3 A;  3SUO A;  1XNR K;  1WSE A;  3KKS A;  1VSJ A;  1RFQ A;  3O3F A;  3DLK A;  4C1N K;  3RMB A;  3HBT A;  3VQ6 A;  2D0P A;  3BP8 A;  2QWM A;  5FPM A;  4BR0 A;  3CM5 A;  1YIJ N;  3E01 A;  3I33 A;  3SAH A;  1NK4 A;  4BRM A;  3QML A;  2HHS A;  1J5E K;  1JLG A;  3ZSO A;  2QWN A;  3H08 A;  2P5O A;  3VEY A;  4J2A A;  4BDZ A;  4DQR A;  1HQE A;  4EP5 A;  5EOY A;  1L3V A;  1GLB G;  3GL1 A;  3LAL A;  3TTC A;  1NGC A;  3SPY A;  4CZF A;  2IAJ A;  4CGD A;  3BUZ B;  4K42 A;  4O5F A;  4EFH A;  4W5T A;  3SNN A;  3DMJ A;  4DV2 K;  2UUB K;  4C8M A;  1EXQ A;  2OPP A;  2IVP A;  4NYN A;  3VQ8 A;  3MEG A;  5AR0 A;  4M7X A;  3IRX A;  2P9K A;  4AM7 A;  3P38 A;  3IFR A;  5E26 A;  4M41 A;  4CJW A;  4JKF A;  3CCQ N;  3W3D A;  3ALY A;  5AQL A;  1BL3 A;  2Q0R A;  2AP1 A;  3F9M A;  2F8T A;  4O0I A;  3L2V A;  4DF4 A;  3RRH A;  3DRP A;  4CI6 A;  1HPM A;  4JKG B;  4DWI A;  1X9J A;  3M1F A;  5BN9 A;  3LAM A;  1S6P A;  2HBJ A;  5J2Q A;  3V9U A;  3G6E N;  3K5N A;  4CZI A;  5LY3 A;  3DXK A;  3EEQ A;  4FM0 A;  4Z4E A;  3C6U A;  4JKB A;  1JLF A;  4DLE A;  1YJW N;  4RTF D;  4DFP A;  1EET A;  1N32 K;  3ENB A;  1FKP A;  2ASM A;  1KRP A;  3AVI A;  2FSK A;  1E3M A;  4MO4 A;  3RRG A;  4O44 A;  3VPZ A;  4CGF A;  3HPO A;  1VQ4 N;  2DFF A;  1RDC A;  2IVN A;  2YI1 A;  4WQ5 C;  4CIE A;  5CY4 A;  2QK9 A; 
#chains in the Genus database with same CATH homology
 2UUC K;  4LF8 K;  1N33 K;  5IT9 O;  5A2Q O;  4JI0 K;  1IBL K;  4JI8 K;  4JI6 K;  3OTO K;  4LFB K;  3T1H K;  5LMN K;  1J5E K;  4LFA K;  4YY3 K;  4NXM K;  4JI5 K;  4JI3 K;  1HR0 K;  4B3T K;  4DV1 K;  4JI2 K;  4JYA K;  2UXB K;  4DR4 K;  4DR6 K;  4X65 K;  4JI4 K;  3JAM O;  4YHH K;  4DV0 K;  4JV5 K;  4DV7 K;  4X64 K;  1I94 K;  4JI1 K;  5LMU K;  4NXN K;  1N34 K;  2HHH K;  1HNW K;  5LL6 Z;  4LF7 K;  4DR7 K;  4CW7 B;  4DV2 K;  2UUB K;  2VQE K;  4V19 S;  1IBK K;  1XMO K;  4DR1 K;  4JI7 K;  5AJ3 K;  4OX9 K;  4DR5 K;  4DV4 K;  4DV6 K;  4LF4 K;  4B3S K;  1HNZ K;  5FLX O;  4LF9 K;  2ZM6 K;  3T1Y K;  1N36 K;  4CVN E;  2UU9 K;  3J80 O;  4DR2 K;  4DV5 K;  4LF5 K;  4X62 K;  4K0K K;  2VQF K;  4GKJ K;  4DUY K;  4LFC K;  4DUZ K;  1FJG K;  4LF6 K;  2F4V K;  2UUA K;  4GKK K;  2UXD K;  5IWA K;  1XMQ K;  4AQY K;  3J81 O;  4X66 K;  1N32 K;  2UXC K;  1XNQ K;  3J7Y P;  4DV3 K;  4DR3 K;  2E5L K;  4KHP K;  4B3M K;  5BR8 K;  1XNR K;  3J7A P;  1IBM K;  1HNX K;  4B3R K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...