4AQYK

Structure of ribosome-apramycin complexes
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Dissociation of Antibacterial Activity and Aminoglycoside Ototoxicity in the 4-Monosubstituted 2-Deoxystreptamine Apramycin.
pubmed doi rcsb
molecule tags Ribosome
total genus 22
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2012-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4aqyK00
4DV4K 4DV2K 2UUBK 4JI0K 4JI5K 1IBKK 1HNXK 4NXNK 2UU9K 4LF5K 5IWAK 5LMUK 3T1YK 4B3SK 4DV0K 4DR2K 1IBMK 4JI7K 5FLXO 4DR1K 4DV6K 4LFBK 1XNRK 5LL6Z 4JYAK 4YHHK 4JV5K 4DR6K 4DR4K 5BR8K 4AQYK 4X66K 4LF6K 4JI3K 4CW7B 5A2QO 4DUYK 3T1HK 1J5EK 2VQFK 2UXDK 4GKKK 2HHHK 4DR7K 4JI4K 1N36K 4DV3K 4B3MK 4NXMK 4JI6K 1FJGK 1XNQK 4GKJK 2UXBK 1IBLK 4LF7K 2UXCK 4OX9K 4JI2K 4V19S 2E5LK 3J7YP 4DR5K 3OTOK 2UUAK 4JI1K 5LMNK 1HR0K 1XMOK 3JAMO 4LFCK 5IT9O 3J80O 4DUZK 1I94K 3J7AP 1N32K 4X62K 4JI8K 1N34K 4LF4K 4LFAK 1HNZK 4B3TK 5AJ3K 2UUCK 2ZM6K 1N33K 2VQEK 4DV7K 4CVNE 4YY3K 4LF8K 4DV1K 1HNWK 4B3RK 1XMQK 4KHPK 3J81O 4X64K 4X65K 4DR3K 2F4VK 4K0KK 4DV5K 4LF9K
chains in the Genus database with same CATH superfamily
3OYAA 1JJ2M 3O80A 1IBKK 4KI4A 1L3SA 1RT2A 1QQOA 4B9QA 3RRGA 1IBMK 4PWDA 1XC9A 4AH9A 2HVIA 5AZJA 1S6QA 1MA9B 2YI1A 4IFVA 4BR9A 1S9GA 3CJAA 1HPMA 2AJQA 4YHHK 4DTUA 3L0QA 4C8KA 3A5OC 1BWFO 3QNNA 4H0PA 4WFAL 3U3YA 3JS6A 3FLCO 2FBVA 4CW7B 4GVEA 4JK9A 2E2NA 3H45C 5AQZA 3AO5A 3CJ9A 3UKRB 1YT3A 3OBWA 4QS7A 3CC2N 3DWLA 4CEQA 4LD0A 4JKGA 2P9PA 1Y64A 2E6MA 2YHYA 5I3UA 3O1BA 5F0XA 3D2FA 2P9IB 3VA0A 4LH5A 3HJFA 4FZZA 3BZKA 5HRSA 4CZLA 4CEFA 4KHSA 3WEEA 3K9KA 3PO5A 1BQNA 2VG6A 1TL1A 1EQYA 1EXQA 3ZSVA 1HJOA 4BRMA 3TI0A 3O9SA 4MLEA 5HRNA 4CEZA 3SMSA 4LF4K 4YOXA 2ZJQL 1RT5A 4DTNA 3BEXA 2OPRA 4KTWA 3HOTA 1GLLO 2ZJPL 4L8RB 4FM2A 3H3NO 1BOTO 3VERA 5AJ3K 4B3TK 3G71N 2VQEK 3QNOA 3HPHA 4PQUA 4JN4A 1G15A 4YOVA 1MWMA 2DY4A 4E89A 4EP4A 3LDQA 4W5RA 1VSJA 3U9DA 2OTLN 3NGYA 5BN9A 4CJUA 3L3VA 3QBXA 1WSFA 4FSVA 3HP6A 4LF9K 3AVFA 1BI4A 1RBUA 3A5MC 5GINA 4F3OA 5SWMA 2PYLA 3CMAN 1A5XA 3WQUA 5LMUK 4CEBA 3ASMA 1VQMN 1S1UA 4DS4A 3FFKB 4MQ3A 4B8AB 2DTUA 4ILHA 4XH1A 1XNRK 2IGIA 5GIOA 4FWOA 4HUGA 4FPBA 4CGJA 3SNNA 3SPYA 2I7PA 4HHTA 5KTQA 2F9TA 3OYEA 2A3ZA 2IS3A 4DQIA 5FPDA 3WUHA 1K73O 4B3MK 1Z25A 3HVTA 1HRHA 2F96A 2UYTA 2GUIA 2QWRA 1WSHA 1TKDA 4LF7K 5CZ1A 3O8MA 2QWLA 5DM6L 2D0CA 4NB4A 3C6HA 3KHYA 5CE3A 3CIPA 3ISNC 4U67L 2P9KB 1B9FA 2CGLA 2QWPA 3L8BA 1L5UA 2NRVA 2A1RA 3HPGA 1XI1A 3NH1A 1TUYA 4O4GA 4QS8A 2B6AA 2E88A 3ZSOA 3HO1A 3DJCA 2DPNA 5JS2A 3K5NA 4X62K 5GADP 2X78A 4I9QA 4WFNL 3DRSA 3W0LA 3UKRA 3MX5A 5J2PA 5HP1A 1RDAA 4XEIA 3TWHA 3KLFA 2ZM6K 4J2EA 3EY1A 1U2VB 2P9IA 4BRKA 4KREA 1YJWN 4F2RA 3OS1A 3AO1A 4JKFA 4ZHRA 3OYKA 2F4VK 5HBMA 3V81A 4FLWA 3L2UA 3VENA 3FGUA 3VEOA 1RT1A 4BRDA 3BGRA 5B8HA 1KAZA 3VQ4A 1VK0A 3NMUA 5GIPA 1J5OA 3V6DA 4CEAA 5KGXA 4B1YB 3C94A 1SUQA 1S22A 3AO3A 3PX0A 3NGIA 1YJNN 2Q0UA 1EWRA 2DFFA 1R59O 4A59A 4JK8A 4DSIA 2YHXA 4CJWA 5C0YA 3U4LA 2BDPA 3VN5A 4IWVA 3T1HK 1J5EK 3G0ZA 1QVFM 1NJWA 3PIOL 4FLXA 1O1WA 2HHHK 3I0RA 4NXMK 2AP1A 4CECA 4CGHA 4DU1A 2NZTA 4H5NA 4TSXA 3ENOA 3HT3A 4B1ZA 4CZIA 2O8CB 4O5FA 3R3LA 2P9LB 1BUPA 2UUAK 3AAPA 3CCRN 2WFBA 4IEIA 4NLCA 2Q2RA 2OPQA 3MXJA 1ZC6A 3AA4A 1C1CA 3NDKA 4FZYA 5C10A 1NM1A 4KFBA 4B08A 3SV3A 3VQ6A 2HVHA 2NNWA 5BPLA 2HHWA 5KQ8A 3DAWA 1L3VA 4FOEA 3V4IA 4A61A 2HNYA 3NBPA 3MK6A 5BR9A 4HTLA 1WN7A 3TARA 1VSMA 3U8XA 2OYQA 1K8KB 4FJNA 3AARA 4LF8K 3DOKA 1NGFA 1SQKA 2G8FA 1FKOA 1XC3A 2CH6A 4OKEA 3TAPA 4B1WB 3L4IA 3VEXA 4HCBA 3LM9A 3HPOA 3CPEA 1KAYA 4JI5K 2UUBK 2QI2A 1TYQB 3Q7CA 1VQ4N 3I56N 3I8BA 4DQQA 3V9XA 4CJSA 2HHUA 1LWEA 4MFBA 4JI7K 4N76A 3O9UA 2NRXA 3C95A 4HWIA 1O13A 3KD1E 3AO4A 3VQCA 3K5MA 3VQAA 4PHTX 5CHIA 4YFUA 1W7AA 1U2VA 2X6SA 5AQGA 3CJBA 1V4TA 3QEVA 4AQYK 4LF6K 2HSTA 5J2MA 5A2QO 2YV0X 4FLVA 1WB9A 3S41A 2IAJA 3DM2A 3ZX2A 3L3UA 4DU4A 1S1WA 2ASPA 3MEGA 1LWCA 3SQ0A 2Z1GA 2JWKA 3AV9A 3LAKA 5AQIA 1L3UA 3W3DA 3CERA 2ZJRL 4ELUA 3AVMA 4FJIA 3JYTA 1I3AA 4FCYA 3NVMA 4F2SA 3GOIA 2UXBK 4FW1A 1D8YA 1YIJN 1VQKN 5GAGP 5C2DA 3A5NC 1QQCA 4BWJA 3SAHA 3V9UA 2WC9A 4FK0A 3FZHA 2KQ2A 1NNEA 3LDNA 4CIEA 2NUBA 3TTFA 4Z4GA 3O4NA 4UY8O 3KWIA 1C0GA 1ZBUA 4CZJA 5AR0A 3GDQA 3VETA 1ITGA 1T44A 2BH1A 4DWIA 4FJLA 4JKHA 1U6ZA 2PY5A 3K9JA 3DLBA 2A42A 4E1NA 4BREA 3IUCA 2HMPA 3CCMN 1TVRA 4JK7A 5E26A 3UIQA 1NGAA 2QEXN 4M41A 1WBDA 2XY5A 2ATQA 3VGLA 3PSFA 3THWB 4Z4IA 2O8CA 5KPTA 2A41A 4F9OA 1YF5L 4BC4A 2P9LA 1NGJA 2V51B 3DYAA 2VCPA 4PKHA 4OPJA 3SZ2A 2FBTA 4FJMA 1X9MA 3M3ZA 1X9SA 1X9JA 3V1QA 3P83D 4CJQA 2Z1JA 1SV5A 3BF3A 4BRGA 3CETA 5CZ2A 2R7YA 2EX3A 4DV4K 3O3FA 4DTPA 3AGKA 4CZGA 3RMDA 4A5AA 2DFHA 4KB1A 2VGMA 4MO5A 4CZEA 1RNHA 3AO2A 1KRPA 4GV3A 2HHSA 2W41A 5AQTA 1NJYA 2JWLA 3ZETB 1K8KA 1NK9A 3KK7A 3OYNA 3CI5A 5HRPA 1JLFA 3NCIA 5T7BA 1BG3A 4PL8A 1W2BM 4I6MB 1LWFA 1YAGA 3QIPA 3BZCA 5EX5A 3OJSA 2VQFK 4BACA 1BDGA 4CF0A 1TUUA 4H5RA 3THXB 3P1GA 1TYQA 1RBSA 4CI6A 1SZ2A 4CJTA 3M8PA 4JI6K 3E66A 4E7IA 3F9MA 4DU3A 3B8AX 2UXCK 3D6RA 3B6OA 2W40A 5I9EB 4V19S 4QCLA 4A2AA 1YXQA 5AQRA 3AA2A 1LAWA 4O8UA 3OYJA 4FJXA 1J6ZA 1Y97A 5KPRA 1TK8A 2KFNA 3E9LA 4O55A 4DUZK 1I94K 3OS0A 3A8YA 4RCHA 4UQGA 3CCQN 4FLYA 3MX2A 3Q7BA 4KV8A 4M63C 3TTDA 1SAZA 3LZJA 1RTJA 2HHTA 3HRGA 1VSLA 3DRRA 4JHDB 3A5LC 4KHUA 4IJNA 4FJJA 3AVIA 3ZSQA 3KK1A 4KKOA 2JGUA 4CJ7A 4C23A 2QWMA 3MMVA 2QXLA 3VPZA 3EO3A 1NU0A 1JLAA 1JLBA 3LL3A 1TKTA 5C42A 4B3OA 4B3SK 4B1XB 3MCAB 3HXMA 3O4QA 3H08A 3SK3A 1NKCA 2ETJA 4CF1A 3TSUA 3AY9A 4JKDA 5M1OA 2VG7A 1RBRA 4QOZB 1KD1O 1S3XA 5AQNA 4R5PA 3VQQA 3AAQA 3O5BA 3THWA 3IMXA 3LP3A 3VEVA 2YNIA 4M7YA 4OJRA 4DR6K 3ATUA 4DR4K 5BR8K 5BN8A 5EOYA 2FBXA 4JI3K 5K14A 1RFQA 2F7TA 1HPZA 1NK4A 2NLXA 1EETA 4DR7K 1BIZA 1TL3A 4JI4K 5AQLA 1QHAA 1TKXA 4EIAA 2D5RA 4HCCA 2JLEA 5TKYA 4E7KA 2KZZA 1XNQK 1QQNA 2EHGA 1XHZA 3OY9A 1OKJA 1U04A 2E8AA 2RE2A 1BL3A 3ZETA 1ATNA 3BDPA 4LSLA 1ZBIA 3LP2A 3EYZA 4CK2A 3M8RA 4I6MA 1XMOK 3PX4A 5C15A 2VG5A 3VQEA 3THXA 4DFMA 1W97L 2RF2A 2ZWHA 3CCJN 1XWLA 3QESA 3G10A 4LC9B 4BQZA 4EAHD 1IKVA 4RTFD 3EKSA 2UUCK 3D0PA 4CK1A 2IIRA 1BIUA 4YY3K 1D4XA 4LH4A 5ELZA 5JICA 4OPAA 4X64K 3RRHA 4AHUA 2HBMA 4AHVA 3NE6A 4K0KK 4ZTFA 4IJAA 1NK6A 1TK0A 4CBWA 2Q3SA 4BDYA 1NK0A 2YJEA 4FWQA 4LF5K 1KFSA 1RDCA 4F8RA 1FW6A 2A5XA 3AVNA 3E9OA 4KI6A 5DMRA 3RSEB 2O4IA 3O3GA 2FSNA 3OYLA 1IKWA 4JHDA 1JL2A 3OW2M 4C8LA 3KLEA 1JCFA 3QFPA 2X6NA 4DFJA 4GV9A 5GAEP 3IRXA 1NGIA 5AZIB 1VQON 4MDAA 1U45A 3MN5A 3HM9A 4CJRA 3HK2A 1NLVA 1IG9A 2HF4A 5DM7L 4CF2A 1BGXT 1NGHA 3ZT0A 3JXUA 5KPZA 1KFDA 3LAMA 4Y1CA 1BCMA 5FPMA 3CQXA 4BVPA 1KLNA 4EZ9A 3EN9A 1VQ6N 1T6CA 5E84A 4BRIA 1E4GT 1S1VA 2V7ZA 4NCGA 4YOUA 4AHTA 3D45A 3S3NA 4B9NA 1WSEA 4EFHA 2PZSA 2F9WA 5GAHP 1MDUB 4FO0A 5FDLA 1JLQA 3ZSYA 1C1BA 5AQVA 2IDOA 1ASWA 4OVLA 4KRFA 3THYB 3D7EO 3ZSWA 4DR5K 3OTOK 3AVHA 4KH5A 3QEIA 3MCPA 1NGBA 4B1VA 3QIOA 3L2WA 1IV0A 1MU2A 2YHAA 3PSIA 3RTVA 3ZT1A 1FK9A 4FM0A 1VQPN 3LDLA 5M1KA 2GBZA 3HZ6A 3LM2A 5HOOA 5H1SQ 1YUWA 5JMVA 1KSPA 1C6VA 4DSEA 1NOZA 3ZSZA 4DG1A 1QSLA 1NOYA 1C0FA 1Q9XA 3D2EB 4H0YB 4H0VB 3T3FA 1VQ5N 3ITHA 2LSNA 1XMQK 1RT3A 3OYBA 1GLAG 5AQJA 3J81O 5C2FA 1KC8O 3P4IA 3IAYA 4M3YA 3MDQA 4RWTA 4J2DA 2G8VA 3K57A 4DV2K 2QM1A 4IBNA 2QTDA 3AVLA 5BPMA 3IS9A 4NYFA 3HOSA 3V1RA 4DV6K 4CD1A 2P5OA 3DLKA 2KKZA 2P9SB 5EXWA 3VEWA 4WQ5A 4OO1J 4KHWA 3TAFA 2OA8A 3WXLA 1WUAA 5BPNA 5M1FA 3PIPL 1M90O 4KH6A 2XRIA 3LWLA 2G8IA 3ZSXA 2BGGA 4FVMA 4DF4A 2IVPA 1HYVA 3S3OA 3TAEA 4G1QA 3KK2A 1VQ9N 4GKKK 1NBWA 1IKYA 3CHWA 1N36K 3CJ1A 4C1NK 5DK5A 1QSYA 3DLHA 4U7BA 4BRPA 1SL0A 2A40A 5F1XA 3RSEA 3WT0A 1WSIA 2HHVA 4BE1A 2AA4A 1RCHA 4CFCA 1NGEA 2P1JA 4W5TA 3L2QA 4FWRA 4N5SA 3VF4A 3WNHA 4LY7A 4AHCA 4H0XB 1OH8A 5AZIA 1KVCA 3ZT3A 3I55N 2KHOA 4FJGA 4AHSA 3NFAA 3ZYYX 2Q1NA 4KHNA 4DKWA 4N56A 1N34K 4CFAA 3VQ7A 3MXIA 1WNSA 3OJUA 3SAGA 1BA1A 4RW6A 3AVGA 4BR4A 3C7NB 5M1NA 4B9MA 3WXKA 4DFKA 1JL1A 4JNEA 3EL2A 4C8MA 3T69A 1GLCG 1RT7A 4N47A 1VSEA 2P51A 4I7FA 1NKBA 3O08A 2ASOA 3VEZA 4CIGA 2O8DB 3HSCA 4M3XA 1D5AA 3OYGA 3THYA 4CJKA 4IXCA 4CIFA 4IDHA 2CH5A 4DR3K 4DLGA 4CGFA 1QHTA 3P38A 3G6EN 5AFUA 1KCFA 5I42A 3E1YA 3ZT4A 4RW8A 3WNFA 4C8OA 3G25A 3KLHA 3MAQA 1NJIO 1ZBHA 1E4FT 1S1TA 4JS5A 4HVJA 4O5BA 4DR2K 4DTSA 1HUXA 5FLXO 4Q5VA 4OKKA 2VWJA 3PUFA 4N41A 3VQ9A 1RT4A 2B4JA 3T19A 1NKEA 5HLFA 3OYIA 1G99A 3D2EA 4B9SA 3VQBA 3ZX3A 3TPQA 1HNIA 3GBTA 2HBKA 3ENHA 1I39A 4BDZA 2D0AA 4WFBL 5FROA 4FWNA 1RBTA 5EVZA 3B6PA 4DCHA 1S6PA 2BTFA 4OGEA 4E3SA 1YHQN 3O9TA 5SZTA 2GEMA 1C0MA 4W5QA 4YOTA 1W0HA 3ZLJA 5J1EA 3KKRA 4NO7A 3NH2A 3OYHA 3KTQA 1IBLK 1K8AO 1RT6A 3H6EA 2GTDA 4CK3A 2P9SA 1ZBSA 3A0IX 2ZD1A 4HUEA 2Q36A 1IKXA 3PY8A 2IVOA 4J8FA 4CHPA 4RW9A 4DB3A 4DSFA 3TR8A 1OH7A 4A2BA 1HYSA 1VHXA 2D0BA 4H4MA 2PBDA 2RHKA 4DTRA 4JI8K 5CY4A 3AVJA 3NH0A 3AGRA 5BRDA 4H4OA 4NYNA 1ATRA 2D4WA 3K59A 1GOAA 3AVAA 1SL2A 2YCHA 2KFZA 3QMLA 1LCUA 1Z26A 3LALA 4WYBA 4FJ5A 4CVNE 3M8SA 5AQUA 5AQWA 4BRHA 4KTZA 2HW3A 2X74A 4JKBA 3VTHA 3E01A 4DLEA 2QWOA 1RGIA 2HB5A 4CJ3A 1EO1A 1EX4A 3NF9A 4YOYA 2XY7A 1TKZA 4IFYA 1HNXK 3VEYA 2UU9K 1VQLN 1OVYA 1KXPA 5IWAK 4QAGA 2G8HA 1HMVA 3DLGA 3HI0A 5CYMA 4DR1K 4Z4HA 3F2KA 4CHNA 1VSDA 2FBYA 3C7NA 4DTMA 3DLRA 1WSJA 1HLUA 2W6KA 4CF8A 2O8DA 2O8BB 3V9SA 2E6LA 4CESA 4ZTJA 4CHOA 4CEDA 3PLAA 4FXDA 3RR7A 2G8WA 4EZ6A 3U3GA 4DV3K 1WOQA 4Z4CA 5FPEA 3F9KA 1FJGK 4YNQA 4JD2B 1JKHA 3SUNA 1HKGA 4KO0A 1DKGD 4BG8A 1GOBA 2NRHA 1QTMA 4A62A 2BUPA 3J7ZO 4JI2K 5M1PA 3T7ZA 3NF8A 3PX6A 4CHQA 3O4WA 3MWPA 4MDBA 2VWBA 4FK2A 1ASVA 4CJ4A 3QETA 3C65A 1KAXA 2QKBA 3QLHA 4KBOA 3V9ZA 5EU7A 2GELA 1YVNA 1NK5A 3HTVA 2FXUA 1BISA 1DT9A 1LW2A 3BF1A 2IOCA 3L2RA 3SV4A 3KWGA 4BG9A 2XO7A 1ESVA 2ZE2A 2QK9A 1HKCA 1VRTA 1P90A 2RKIA 4EP5A 1GLBG 3WNEA 3ATVA 3LP1A 3IDHA 3OHRA 4GMJB 1LW0A 3CF5L 3C6UA 4E7JA 4H5TA 4YOWA 3IKMA 5FPNA 3MN7A 3ENBA 3ZCMA 3VGMA 1SS6A 3NVKA 3RMCA 3IFRA 1CZAN 3I8DA 4HTUA 1OH6A 4YORA 3CYMA 4CJEA 3ULEB 3I0SA 4K41A 1DGKN 2V52B 1JXEA 4CGGA 1QQMA 4BRFA 1N6QA 1N8RO 3DLEA 3CCVN 3THVA 3HBTA 1X1PA 1RDBA 4CD3A 5AQKA 3VTIA 2DFEA 1RBVA 4BE2A 4O44A 4WQ4C 3TAMA 4J2BA 4E7HA 1P8ZA 3WNGA 1NMNA 4X66K 3RVCA 4HUFA 3QBWA 4BR5A 3AVBA 3ZX0A 5JS1A 4ID5A 4PKGA 1WSGA 1LAVA 5KRTA 1SKRA 1CZBA 3J8AA 4FM1A 3FR0A 2P9NB 1ASUA 4W5NA 2ITGA 2D0PA 3QDKA 4GKJK 4ISEA 4OLAA 1IG8A 1VQNN 3TABA 2QKKA 1NGGA 2A1SA 3K2PA 5F2RA 4FOIA 5FRMA 2W6LA 3KVGA 4XH4A 1BU6O 3TSQA 2E5LK 1KVBA 5JVHL 1IO2A 5HRRA 2GWKA 4JS4A 4BRQA 3CM6A 3L4QA 2O8BA 3PO4A 5HL7L 2HMIA 3F73A 3AA3A 3ULDA 4BC5A 3O9RA 3J7AP 1X9WA 3VOVA 4BC2A 1C1AA 4BE0A 3O6WA 5HROA 1GLJO 1CXQA 4JD2A 4GY2B 3WQTA 4CHYA 1T8EA 5JLFA 1SL1A 4KPYA 1QZ6A 3EKUA 2HBLA 4JAXA 2E4LA 4DV7K 4FYDA 4O8KA 3OVNA 3CCEN 4K25A 1VRUA 1A5WA 1TAQA 3HVRA 1JCGA 2XHBA 3EZWA 2CGJA 3CJ7A 3L6QA 4R79A 4OKJA 4BVOA 4RW7A 1UAXA 4WCEL 5LY3A 1X3MA 2NRTA 4BRAA 1S5JA 2FF6A 2VYPA 4JRQA 3QO9A 3SQ2A 4DTXA 2KLAA 4RG8A 4YDUC 4B9UA 3UE5A 3T1YK 2G8UA 2GWJA 2IVNA 4FL9A 1BA0A 3M1FA 1LV5A 2HNZA 3MN9A 3CC4N 4FJ7A 4E1JA 4NLBA 4F4KA 4E7LA 1B92A 3KLGA 4ID1A 2ITMA 4M42A 2NRRA 4FJHA 5EY4A 2QA4N 5AQMA 1GOCA 3LDSA 4CHZA 1R0AA 1NJZA 4Z0UA 4GV6A 3ALYA 5JVGL 3SLCA 2D1KA 3H3OB 4ILGB 1NGCA 4M3RA 2HF3A 5TKWA 1RDWX 1GLDG 1QVGM 1T3VA 3OA9A 1OVQA 4IG3A 5AQOA 1NK7A 3ULEA 3K5OA 5AQHA 5JLHA 1WBBA 4FJKA 1TGOA 4IZ9A 3TSPA 3MN6A 4B1UB 1ILYA 5AQQA 2V7YA 2VGNA 3MWTA 1JLEA 4FPAA 4BROA 3R6MA 1QZ5A 1U4BA 4KTQA 3ID6A 3K58A 1KQSM 1NJXA 4H03B 3OYMA 3RR8A 4IFEA 3AVCA 4Y0WA 5LMNK 3KJVA 2NRWA 4FVUA 2G8KA 1Q8IA 2OCEA 2PYJA 4CJLA 2HHQA 1Q9YA 1YTAA 4QS9A 4NCAA 3DMJA 1TAUA 2P9NA 5KGWA 3QFUA 3C6TA 3ID8A 3TTCA 3SPZA 1K6YA 2E2PA 1YITN 2P9UB 4IOXA 2I7NA 3V9WA 4B3RK 3DLLL 4ELVA 4KHPK 2E20A 1HQUA 1ZYQA 1T6DA 4BWMA 4DQPA 3AVKA 4BY9C 3M8QA 4JLHA 3LANA 1S72N 2FC0A 1V4SA 5AQYA 1EKEA 4H5VA 5J2QA 5MLCQ 4CE9A 1YVUA 3VA3A 3VF6A 3M5RA 3M6GA 4AM6A 4LFBK 1UOCA 2Q97A 1MWKA 2WBNA 1HX1A 2J4RA 5J2NA 2GX9A 1VAZA 3SQ4A 2ZGZA 3BUZB 1HKBA 2O4GA 3CQYA 4AF1A 4RW4A 4Q0BA 3H46O 2WTUA 3BP8A 3H1VX 3DOLA 4Z4EA 2QWQA 1YTUA 2YKNA 4JKCA 2ZGYA 4LSNA 4DUYK 3CMEN 3CCLN 4PUOA 4PKIA 3OYCA 5LJVA 3FZKA 1CLQA 3VQ5A 1ZBFA 5C24A 1X3NA 3E9PA 3QB0A 3EE8A 1VQ7N 3LDPA 3EZ5A 1FKPA 4WE1A 3C0BA 1A5VA 3DXMB 3LPTA 4DTJA 3KD5E 4IKFA 3HL8A 4OX9K 4H5WA 4I2PA 4CCHA 1RTDA 2RN2A 4M3UA 1S9EA 2Q0RA 2WOMA 4DQRA 3CC7N 3AA5X 4DQSA 4IO9L 3RMBA 4DHYA 3KKSA 3DXKB 3J80O 3G4SN 4FW2A 3FE1A 1XUPO 2FSJA 3GE1A 1J54A 3SJJA 3CJCA 3NF6A 4DQ8A 2F8SA 1Z6RA 4FJ9A 1SKWA 4CZFA 1UWBA 3U6FA 4CEEA 4FLZA 2KW4A 3N4QA 4M3WA 3FFIA 2I5JA 3SCXA 1S1XA 3P5JA 4A57A 4CJVA 3ZSRA 2E2QA 2KTQA 4DV5K 2FF3B 3O3HA 3CFPA 4CF9A 1DTTA 3VGKA 5KRSA 1U49A 3K5LA 4EHUA 4KAZA 4O0IA 2BANA 2OZMA 4GNIA 3SMPA 1J53A 4CJ5A 1U47A 4ILJA 1EWQA 3P31A 3QERA 1JLCA 2Q31A 5LL6Z 4B9LA 4M7XA 3R8EA 2P9UA 2NRZA 2FLOA 2YX6A 4K43A 3TAGA 4PA1A 3FZFA 4E0DA 4CFBA 4JV5K 2YNFA 3U9ZA 3WXMB 4OGCA 4GVMA 3NF7A 1T03A 3KZBA 3LPUA 4IG0A 1Q82O 3RMAA 2FSKA 4BGBA 1WLJA 1DEJA 3LDOA 4WQ4A 4Z94A 1VSIA 1E3MA 4L3QA 3DI6A 1RILA 4OPKA 5C25A 2A6AA 3CXCM 3LZIA 4XH5A 1NG9A 3QEXA 2OPPA 4DSKA 2Y1JA 3CQ8A 5ADXA 3QICA 2WUSA 4DFPA 4FLTA 1C0UA 1YJ9N 1HNVA 4B8CA 4CEOA 3S9HA 2P9KA 1HR0K 1DTQA 4LFCK 4CERA 3OS2A 4AM7A 2EWSA 4MO4A 3O9QA 3V1OA 3S3MA 4KH4A 1HYZA 4LFAK 2Y1IA 2QXFA 4WF9L 3DXMA 3I33A 1D9DA 1NMDA 4CZHA 4IOCL 4K8XA 1XQSC 2WONA 4M45A 4FWKA 1CZ9A 1Q86O 2KZMA 3SUPA 2B5JA 4DV1K 1U48A 4I9LA 1C0TA 1XHXA 4NCBA 4CGDA 4KHYA 5BRFA 1NWKA 4CJPA 2E1YA 4X65K 1RTIA 2PAVA 4BRCA 3GG4A 3CCSN 2F8TA 1ZXOA 3DXKA 3SUQA 4DMNA 2HBJA 1EP4A 4NXNK 4DS5A 3EEQA 3NGZA 4B9TA 3SI6A 1Z05A 3HYFA 3C6AA 4ELTA 4Z4FA 3NHGA 3WXIA 3VESA 3UKUB 4BRNA 5AQPA 4G9ZA 3ZEUB 2O8EB 3QINA 4YDUA 2YKMA 4M3ZA 4CGIA 4JRPA 2O8FB 4CZMA 4EHTA 4FWLA 3VQDA 4BGAA 1ZBLA 5E41A 4KHQA 2IC3A 1RDUA 3VMFB 1KLMA 3BY5A 3CM5A 3O1WA 1K9MO 4ISFA 4BR7A 2OZSA 3SYZA 3MEDA 1HJRA 4IOAL 1Q7YO 2W42A 4H0TB 4BR2A 1UA0A 3TU5A 2ASMA 2Z1HA 3HSTB 3JSMA 4DTOA 2P5GA 1CXUA 1TK5A 3UB5A 1VSFA 1GLFO 3GL1A 3R1XA 1VQ8N 3MEEA 3ZT2A 4XIUA 4A5BA 4BC3A 4J2AA 2YHWA 3MECA 4DSJA 4JI1K 3N4PA 1REVA 2BE2A 4B9VA 5KI6A 3DRPA 3WXJA 3OBYA 1L3TA 1BHLA 1NK8A 3JAMO 3L2VA 3OYFA 1N32K 2YHBA 1UA1A 5CYQA 3NAEA 4GW6A 3MXMA 3K0SA 4I2QA 5AFUH 1VSHA 2XY6A 3H1QA 1D9FA 2OTJN 1N5YA 4WQ5C 2E2OA 5AZJB 1HNZK 4JKEA 2YNHA 1N33K 5AQFA 3QEPA 4K42A 3OYDA 5M1QA 4FWPA 1Q81O 4E1MA 5BREA 4CJFA 4FWSA 1BQMA 1T7PA 1J9AA 5AQXA 2VWKA 3P39A 3SUOA 3RWUA 1FXXA 5KQDA 4AILC 5AQSA 1NGDA 3CCUN 4E19A 5D3GA 4IO8A 4CZKA 1BO5O 1LOTB 4FZXC 3SBGA 4FWMA 1OH5A 3T1AA 1HQEA 4JI0K 2QW9A 5ADXH 2HOEA 4BR0A 3CD6N 4DV0K 3HM8A 3SQ1A 1IH7A 1SKSA 2PFUA 4JKGB 3VF2A 2P9PB 2YNGA 5LJWA 1RDDA 1JXBA 2GUPA 4JYAK 3D2FB 4CBUA 4W5OA 2GV9A 3KIOA 4CBXA 3KK3A 3SJHA 3WEEB 2HNDA 5C12A 4PY5A 1Q18A 4BRLA 1W9HA 3KLIA 4IEEA 4OPHA 4DSLA 1ATSA 2YJFA 1IJJA 1B9DA 3FZMA 3VQPA 1JLGA 4JEPA 2UXDK 3LP0A 5BRHA 4IDKA 3R9PA 1QE1A 2RPIA 4ICLA 3CFOA 2E1ZA 3CFRA 4M3TA 2ZQBA 4ISGA 1WAFA 1TV6A 3CG7A 5FRNA 2XY8A 2D0OA 4FK4A 4BDPA 3UKUA 3ZEUA 2QWNA 2O8EA 1KVAA 4Y1DA 4C1NI 2O8FA 2CGKA 1KTQA 1YI2N 3J7YP 2ZF5O 4FLUA 1DLOA 4F3TA 3IG1A 4JKAA 2OPSA 4KB0A 4PL7A 1BI4B 3PV8A 5IT9O 5CR4A 1WAJA 3EE9A 3SAFA 4H0OA 4FJ8A 4DF8A 4MLHA 1QS4A 1F21A 1BCOA 3TANA 3F5TA 3HP9A 3VQ8A 3LWMA 2HHXA 3SBTA 1VSKA 4OLBA 1T05A 4BQLA 2Z1IA 3FZLA 1GLEG 4K8ZA 1M1KO 1HNWK 2H3GX 4H8KA 1QSSA 4C8NA 2OANA 4O0JA 1JCEA 4CFDA 3CPWM 3QEWA 1RTHA 1H1VA 3TAQA 3A2FA 4AHRA
chains in the Genus database with same CATH topology
4DV4K 4DV2K 2UUBK 4JI0K 4JI5K 1IBKK 1HNXK 4NXNK 2UU9K 4LF5K 5IWAK 5LMUK 3T1YK 4B3SK 4DV0K 4DR2K 1IBMK 4JI7K 5FLXO 4DR1K 4DV6K 4LFBK 1XNRK 5LL6Z 4JYAK 4YHHK 4JV5K 4DR6K 4DR4K 5BR8K 4AQYK 4X66K 4LF6K 4JI3K 4CW7B 5A2QO 4DUYK 3T1HK 1J5EK 2VQFK 2UXDK 4GKKK 2HHHK 4DR7K 4JI4K 1N36K 4DV3K 4B3MK 4NXMK 4JI6K 1FJGK 1XNQK 4GKJK 2UXBK 1IBLK 4LF7K 2UXCK 4OX9K 4JI2K 4V19S 2E5LK 3J7YP 4DR5K 3OTOK 2UUAK 4JI1K 5LMNK 1HR0K 1XMOK 3JAMO 4LFCK 5IT9O 3J80O 4DUZK 1I94K 3J7AP 1N32K 4X62K 4JI8K 1N34K 4LF4K 4LFAK 1HNZK 4B3TK 5AJ3K 2UUCK 2ZM6K 1N33K 2VQEK 4DV7K 4CVNE 4YY3K 4LF8K 4DV1K 1HNWK 4B3RK 1XMQK 4KHPK 3J81O 4X64K 4X65K 4DR3K 2F4VK 4K0KK 4DV5K 4LF9K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV4 K;  4DV2 K;  2UUB K;  4JI0 K;  4JI5 K;  1IBK K;  1HNX K;  4NXN K;  2UU9 K;  4LF5 K;  5IWA K;  5LMU K;  3T1Y K;  4B3S K;  4DV0 K;  4DR2 K;  1IBM K;  4JI7 K;  5FLX O;  4DR1 K;  4DV6 K;  4LFB K;  1XNR K;  5LL6 Z;  4JYA K;  4YHH K;  4JV5 K;  4DR6 K;  4DR4 K;  5BR8 K;  4AQY K;  4X66 K;  4LF6 K;  4JI3 K;  4CW7 B;  5A2Q O;  4DUY K;  3T1H K;  1J5E K;  2VQF K;  2UXD K;  4GKK K;  2HHH K;  4DR7 K;  4JI4 K;  1N36 K;  4DV3 K;  4B3M K;  4NXM K;  4JI6 K;  1FJG K;  1XNQ K;  4GKJ K;  2UXB K;  1IBL K;  4LF7 K;  2UXC K;  4OX9 K;  4JI2 K;  4V19 S;  2E5L K;  3J7Y P;  4DR5 K;  3OTO K;  2UUA K;  4JI1 K;  5LMN K;  1HR0 K;  1XMO K;  3JAM O;  4LFC K;  5IT9 O;  3J80 O;  4DUZ K;  1I94 K;  3J7A P;  1N32 K;  4X62 K;  4JI8 K;  1N34 K;  4LF4 K;  4LFA K;  1HNZ K;  4B3T K;  5AJ3 K;  2UUC K;  2ZM6 K;  1N33 K;  2VQE K;  4DV7 K;  4CVN E;  4YY3 K;  4LF8 K;  4DV1 K;  1HNW K;  4B3R K;  1XMQ K;  4KHP K;  3J81 O;  4X64 K;  4X65 K;  4DR3 K;  2F4V K;  4K0K K;  4DV5 K;  4LF9 K; 
#chains in the Genus database with same CATH topology
 3OYA A;  1JJ2 M;  3O80 A;  1IBK K;  4KI4 A;  1L3S A;  1RT2 A;  1QQO A;  4B9Q A;  3RRG A;  1IBM K;  4PWD A;  1XC9 A;  4AH9 A;  2HVI A;  5AZJ A;  1S6Q A;  1MA9 B;  2YI1 A;  4IFV A;  4BR9 A;  1S9G A;  3CJA A;  1HPM A;  2AJQ A;  4YHH K;  4DTU A;  3L0Q A;  4C8K A;  3A5O C;  1BWF O;  3QNN A;  4H0P A;  4WFA L;  3U3Y A;  3JS6 A;  3FLC O;  2FBV A;  4CW7 B;  4GVE A;  4JK9 A;  2E2N A;  3H45 C;  5AQZ A;  3AO5 A;  3CJ9 A;  3UKR B;  1YT3 A;  3OBW A;  4QS7 A;  3CC2 N;  3DWL A;  4CEQ A;  4LD0 A;  4JKG A;  2P9P A;  1Y64 A;  2E6M A;  2YHY A;  5I3U A;  3O1B A;  5F0X A;  3D2F A;  2P9I B;  3VA0 A;  4LH5 A;  3HJF A;  4FZZ A;  3BZK A;  5HRS A;  4CZL A;  4CEF A;  4KHS A;  3WEE A;  3K9K A;  3PO5 A;  1BQN A;  2VG6 A;  1TL1 A;  1EQY A;  1EXQ A;  3ZSV A;  1HJO A;  4BRM A;  3TI0 A;  3O9S A;  4MLE A;  5HRN A;  4CEZ A;  3SMS A;  4LF4 K;  4YOX A;  2ZJQ L;  1RT5 A;  4DTN A;  3BEX A;  2OPR A;  4KTW A;  3HOT A;  1GLL O;  2ZJP L;  4L8R B;  4FM2 A;  3H3N O;  1BOT O;  3VER A;  5AJ3 K;  4B3T K;  3G71 N;  2VQE K;  3QNO A;  3HPH A;  4PQU A;  4JN4 A;  1G15 A;  4YOV A;  1MWM A;  2DY4 A;  4E89 A;  4EP4 A;  3LDQ A;  4W5R A;  1VSJ A;  3U9D A;  2OTL N;  3NGY A;  5BN9 A;  4CJU A;  3L3V A;  3QBX A;  1WSF A;  4FSV A;  3HP6 A;  4LF9 K;  3AVF A;  1BI4 A;  1RBU A;  3A5M C;  5GIN A;  4F3O A;  5SWM A;  2PYL A;  3CMA N;  1A5X A;  3WQU A;  5LMU K;  4CEB A;  3ASM A;  1VQM N;  1S1U A;  4DS4 A;  3FFK B;  4MQ3 A;  4B8A B;  2DTU A;  4ILH A;  4XH1 A;  1XNR K;  2IGI A;  5GIO A;  4FWO A;  4HUG A;  4FPB A;  4CGJ A;  3SNN A;  3SPY A;  2I7P A;  4HHT A;  5KTQ A;  2F9T A;  3OYE A;  2A3Z A;  2IS3 A;  4DQI A;  5FPD A;  3WUH A;  1K73 O;  4B3M K;  1Z25 A;  3HVT A;  1HRH A;  2F96 A;  2UYT A;  2GUI A;  2QWR A;  1WSH A;  1TKD A;  4LF7 K;  5CZ1 A;  3O8M A;  2QWL A;  5DM6 L;  2D0C A;  4NB4 A;  3C6H A;  3KHY A;  5CE3 A;  3CIP A;  3ISN C;  4U67 L;  2P9K B;  1B9F A;  2CGL A;  2QWP A;  3L8B A;  1L5U A;  2NRV A;  2A1R A;  3HPG A;  1XI1 A;  3NH1 A;  1TUY A;  4O4G A;  4QS8 A;  2B6A A;  2E88 A;  3ZSO A;  3HO1 A;  3DJC A;  2DPN A;  5JS2 A;  3K5N A;  4X62 K;  5GAD P;  2X78 A;  4I9Q A;  4WFN L;  3DRS A;  3W0L A;  3UKR A;  3MX5 A;  5J2P A;  5HP1 A;  1RDA A;  4XEI A;  3TWH A;  3KLF A;  2ZM6 K;  4J2E A;  3EY1 A;  1U2V B;  2P9I A;  4BRK A;  4KRE A;  1YJW N;  4F2R A;  3OS1 A;  3AO1 A;  4JKF A;  4ZHR A;  3OYK A;  2F4V K;  5HBM A;  3V81 A;  4FLW A;  3L2U A;  3VEN A;  3FGU A;  3VEO A;  1RT1 A;  4BRD A;  3BGR A;  5B8H A;  1KAZ A;  3VQ4 A;  1VK0 A;  3NMU A;  5GIP A;  1J5O A;  3V6D A;  4CEA A;  5KGX A;  4B1Y B;  3C94 A;  1SUQ A;  1S22 A;  3AO3 A;  3PX0 A;  3NGI A;  1YJN N;  2Q0U A;  1EWR A;  2DFF A;  1R59 O;  4A59 A;  4JK8 A;  4DSI A;  2YHX A;  4CJW A;  5C0Y A;  3U4L A;  2BDP A;  3VN5 A;  4IWV A;  3T1H K;  1J5E K;  3G0Z A;  1QVF M;  1NJW A;  3PIO L;  4FLX A;  1O1W A;  2HHH K;  3I0R A;  4NXM K;  2AP1 A;  4CEC A;  4CGH A;  4DU1 A;  2NZT A;  4H5N A;  4TSX A;  3ENO A;  3HT3 A;  4B1Z A;  4CZI A;  2O8C B;  4O5F A;  3R3L A;  2P9L B;  1BUP A;  2UUA K;  3AAP A;  3CCR N;  2WFB A;  4IEI A;  4NLC A;  2Q2R A;  2OPQ A;  3MXJ A;  1ZC6 A;  3AA4 A;  1C1C A;  3NDK A;  4FZY A;  5C10 A;  1NM1 A;  4KFB A;  4B08 A;  3SV3 A;  3VQ6 A;  2HVH A;  2NNW A;  5BPL A;  2HHW A;  5KQ8 A;  3DAW A;  1L3V A;  4FOE A;  3V4I A;  4A61 A;  2HNY A;  3NBP A;  3MK6 A;  5BR9 A;  4HTL A;  1WN7 A;  3TAR A;  1VSM A;  3U8X A;  2OYQ A;  1K8K B;  4FJN A;  3AAR A;  4LF8 K;  3DOK A;  1NGF A;  1SQK A;  2G8F A;  1FKO A;  1XC3 A;  2CH6 A;  4OKE A;  3TAP A;  4B1W B;  3L4I A;  3VEX A;  4HCB A;  3LM9 A;  3HPO A;  3CPE A;  1KAY A;  4JI5 K;  2UUB K;  2QI2 A;  1TYQ B;  3Q7C A;  1VQ4 N;  3I56 N;  3I8B A;  4DQQ A;  3V9X A;  4CJS A;  2HHU A;  1LWE A;  4MFB A;  4JI7 K;  4N76 A;  3O9U A;  2NRX A;  3C95 A;  4HWI A;  1O13 A;  3KD1 E;  3AO4 A;  3VQC A;  3K5M A;  3VQA A;  4PHT X;  5CHI A;  4YFU A;  1W7A A;  1U2V A;  2X6S A;  5AQG A;  3CJB A;  1V4T A;  3QEV A;  4AQY K;  4LF6 K;  2HST A;  5J2M A;  5A2Q O;  2YV0 X;  4FLV A;  1WB9 A;  3S41 A;  2IAJ A;  3DM2 A;  3ZX2 A;  3L3U A;  4DU4 A;  1S1W A;  2ASP A;  3MEG A;  1LWC A;  3SQ0 A;  2Z1G A;  2JWK A;  3AV9 A;  3LAK A;  5AQI A;  1L3U A;  3W3D A;  3CER A;  2ZJR L;  4ELU A;  3AVM A;  4FJI A;  3JYT A;  1I3A A;  4FCY A;  3NVM A;  4F2S A;  3GOI A;  2UXB K;  4FW1 A;  1D8Y A;  1YIJ N;  1VQK N;  5GAG P;  5C2D A;  3A5N C;  1QQC A;  4BWJ A;  3SAH A;  3V9U A;  2WC9 A;  4FK0 A;  3FZH A;  2KQ2 A;  1NNE A;  3LDN A;  4CIE A;  2NUB A;  3TTF A;  4Z4G A;  3O4N A;  4UY8 O;  3KWI A;  1C0G A;  1ZBU A;  4CZJ A;  5AR0 A;  3GDQ A;  3VET A;  1ITG A;  1T44 A;  2BH1 A;  4DWI A;  4FJL A;  4JKH A;  1U6Z A;  2PY5 A;  3K9J A;  3DLB A;  2A42 A;  4E1N A;  4BRE A;  3IUC A;  2HMP A;  3CCM N;  1TVR A;  4JK7 A;  5E26 A;  3UIQ A;  1NGA A;  2QEX N;  4M41 A;  1WBD A;  2XY5 A;  2ATQ A;  3VGL A;  3PSF A;  3THW B;  4Z4I A;  2O8C A;  5KPT A;  2A41 A;  4F9O A;  1YF5 L;  4BC4 A;  2P9L A;  1NGJ A;  2V51 B;  3DYA A;  2VCP A;  4PKH A;  4OPJ A;  3SZ2 A;  2FBT A;  4FJM A;  1X9M A;  3M3Z A;  1X9S A;  1X9J A;  3V1Q A;  3P83 D;  4CJQ A;  2Z1J A;  1SV5 A;  3BF3 A;  4BRG A;  3CET A;  5CZ2 A;  2R7Y A;  2EX3 A;  4DV4 K;  3O3F A;  4DTP A;  3AGK A;  4CZG A;  3RMD A;  4A5A A;  2DFH A;  4KB1 A;  2VGM A;  4MO5 A;  4CZE A;  1RNH A;  3AO2 A;  1KRP A;  4GV3 A;  2HHS A;  2W41 A;  5AQT A;  1NJY A;  2JWL A;  3ZET B;  1K8K A;  1NK9 A;  3KK7 A;  3OYN A;  3CI5 A;  5HRP A;  1JLF A;  3NCI A;  5T7B A;  1BG3 A;  4PL8 A;  1W2B M;  4I6M B;  1LWF A;  1YAG A;  3QIP A;  3BZC A;  5EX5 A;  3OJS A;  2VQF K;  4BAC A;  1BDG A;  4CF0 A;  1TUU A;  4H5R A;  3THX B;  3P1G A;  1TYQ A;  1RBS A;  4CI6 A;  1SZ2 A;  4CJT A;  3M8P A;  4JI6 K;  3E66 A;  4E7I A;  3F9M A;  4DU3 A;  3B8A X;  2UXC K;  3D6R A;  3B6O A;  2W40 A;  5I9E B;  4V19 S;  4QCL A;  4A2A A;  1YXQ A;  5AQR A;  3AA2 A;  1LAW A;  4O8U A;  3OYJ A;  4FJX A;  1J6Z A;  1Y97 A;  5KPR A;  1TK8 A;  2KFN A;  3E9L A;  4O55 A;  4DUZ K;  1I94 K;  3OS0 A;  3A8Y A;  4RCH A;  4UQG A;  3CCQ N;  4FLY A;  3MX2 A;  3Q7B A;  4KV8 A;  4M63 C;  3TTD A;  1SAZ A;  3LZJ A;  1RTJ A;  2HHT A;  3HRG A;  1VSL A;  3DRR A;  4JHD B;  3A5L C;  4KHU A;  4IJN A;  4FJJ A;  3AVI A;  3ZSQ A;  3KK1 A;  4KKO A;  2JGU A;  4CJ7 A;  4C23 A;  2QWM A;  3MMV A;  2QXL A;  3VPZ A;  3EO3 A;  1NU0 A;  1JLA A;  1JLB A;  3LL3 A;  1TKT A;  5C42 A;  4B3O A;  4B3S K;  4B1X B;  3MCA B;  3HXM A;  3O4Q A;  3H08 A;  3SK3 A;  1NKC A;  2ETJ A;  4CF1 A;  3TSU A;  3AY9 A;  4JKD A;  5M1O A;  2VG7 A;  1RBR A;  4QOZ B;  1KD1 O;  1S3X A;  5AQN A;  4R5P A;  3VQQ A;  3AAQ A;  3O5B A;  3THW A;  3IMX A;  3LP3 A;  3VEV A;  2YNI A;  4M7Y A;  4OJR A;  4DR6 K;  3ATU A;  4DR4 K;  5BR8 K;  5BN8 A;  5EOY A;  2FBX A;  4JI3 K;  5K14 A;  1RFQ A;  2F7T A;  1HPZ A;  1NK4 A;  2NLX A;  1EET A;  4DR7 K;  1BIZ A;  1TL3 A;  4JI4 K;  5AQL A;  1QHA A;  1TKX A;  4EIA A;  2D5R A;  4HCC A;  2JLE A;  5TKY A;  4E7K A;  2KZZ A;  1XNQ K;  1QQN A;  2EHG A;  1XHZ A;  3OY9 A;  1OKJ A;  1U04 A;  2E8A A;  2RE2 A;  1BL3 A;  3ZET A;  1ATN A;  3BDP A;  4LSL A;  1ZBI A;  3LP2 A;  3EYZ A;  4CK2 A;  3M8R A;  4I6M A;  1XMO K;  3PX4 A;  5C15 A;  2VG5 A;  3VQE A;  3THX A;  4DFM A;  1W97 L;  2RF2 A;  2ZWH A;  3CCJ N;  1XWL A;  3QES A;  3G10 A;  4LC9 B;  4BQZ A;  4EAH D;  1IKV A;  4RTF D;  3EKS A;  2UUC K;  3D0P A;  4CK1 A;  2IIR A;  1BIU A;  4YY3 K;  1D4X A;  4LH4 A;  5ELZ A;  5JIC A;  4OPA A;  4X64 K;  3RRH A;  4AHU A;  2HBM A;  4AHV A;  3NE6 A;  4K0K K;  4ZTF A;  4IJA A;  1NK6 A;  1TK0 A;  4CBW A;  2Q3S A;  4BDY A;  1NK0 A;  2YJE A;  4FWQ A;  4LF5 K;  1KFS A;  1RDC A;  4F8R A;  1FW6 A;  2A5X A;  3AVN A;  3E9O A;  4KI6 A;  5DMR A;  3RSE B;  2O4I A;  3O3G A;  2FSN A;  3OYL A;  1IKW A;  4JHD A;  1JL2 A;  3OW2 M;  4C8L A;  3KLE A;  1JCF A;  3QFP A;  2X6N A;  4DFJ A;  4GV9 A;  5GAE P;  3IRX A;  1NGI A;  5AZI B;  1VQO N;  4MDA A;  1U45 A;  3MN5 A;  3HM9 A;  4CJR A;  3HK2 A;  1NLV A;  1IG9 A;  2HF4 A;  5DM7 L;  4CF2 A;  1BGX T;  1NGH A;  3ZT0 A;  3JXU A;  5KPZ A;  1KFD A;  3LAM A;  4Y1C A;  1BCM A;  5FPM A;  3CQX A;  4BVP A;  1KLN A;  4EZ9 A;  3EN9 A;  1VQ6 N;  1T6C A;  5E84 A;  4BRI A;  1E4G T;  1S1V A;  2V7Z A;  4NCG A;  4YOU A;  4AHT A;  3D45 A;  3S3N A;  4B9N A;  1WSE A;  4EFH A;  2PZS A;  2F9W A;  5GAH P;  1MDU B;  4FO0 A;  5FDL A;  1JLQ A;  3ZSY A;  1C1B A;  5AQV A;  2IDO A;  1ASW A;  4OVL A;  4KRF A;  3THY B;  3D7E O;  3ZSW A;  4DR5 K;  3OTO K;  3AVH A;  4KH5 A;  3QEI A;  3MCP A;  1NGB A;  4B1V A;  3QIO A;  3L2W A;  1IV0 A;  1MU2 A;  2YHA A;  3PSI A;  3RTV A;  3ZT1 A;  1FK9 A;  4FM0 A;  1VQP N;  3LDL A;  5M1K A;  2GBZ A;  3HZ6 A;  3LM2 A;  5HOO A;  5H1S Q;  1YUW A;  5JMV A;  1KSP A;  1C6V A;  4DSE A;  1NOZ A;  3ZSZ A;  4DG1 A;  1QSL A;  1NOY A;  1C0F A;  1Q9X A;  3D2E B;  4H0Y B;  4H0V B;  3T3F A;  1VQ5 N;  3ITH A;  2LSN A;  1XMQ K;  1RT3 A;  3OYB A;  1GLA G;  5AQJ A;  3J81 O;  5C2F A;  1KC8 O;  3P4I A;  3IAY A;  4M3Y A;  3MDQ A;  4RWT A;  4J2D A;  2G8V A;  3K57 A;  4DV2 K;  2QM1 A;  4IBN A;  2QTD A;  3AVL A;  5BPM A;  3IS9 A;  4NYF A;  3HOS A;  3V1R A;  4DV6 K;  4CD1 A;  2P5O A;  3DLK A;  2KKZ A;  2P9S B;  5EXW A;  3VEW A;  4WQ5 A;  4OO1 J;  4KHW A;  3TAF A;  2OA8 A;  3WXL A;  1WUA A;  5BPN A;  5M1F A;  3PIP L;  1M90 O;  4KH6 A;  2XRI A;  3LWL A;  2G8I A;  3ZSX A;  2BGG A;  4FVM A;  4DF4 A;  2IVP A;  1HYV A;  3S3O A;  3TAE A;  4G1Q A;  3KK2 A;  1VQ9 N;  4GKK K;  1NBW A;  1IKY A;  3CHW A;  1N36 K;  3CJ1 A;  4C1N K;  5DK5 A;  1QSY A;  3DLH A;  4U7B A;  4BRP A;  1SL0 A;  2A40 A;  5F1X A;  3RSE A;  3WT0 A;  1WSI A;  2HHV A;  4BE1 A;  2AA4 A;  1RCH A;  4CFC A;  1NGE A;  2P1J A;  4W5T A;  3L2Q A;  4FWR A;  4N5S A;  3VF4 A;  3WNH A;  4LY7 A;  4AHC A;  4H0X B;  1OH8 A;  5AZI A;  1KVC A;  3ZT3 A;  3I55 N;  2KHO A;  4FJG A;  4AHS A;  3NFA A;  3ZYY X;  2Q1N A;  4KHN A;  4DKW A;  4N56 A;  1N34 K;  4CFA A;  3VQ7 A;  3MXI A;  1WNS A;  3OJU A;  3SAG A;  1BA1 A;  4RW6 A;  3AVG A;  4BR4 A;  3C7N B;  5M1N A;  4B9M A;  3WXK A;  4DFK A;  1JL1 A;  4JNE A;  3EL2 A;  4C8M A;  3T69 A;  1GLC G;  1RT7 A;  4N47 A;  1VSE A;  2P51 A;  4I7F A;  1NKB A;  3O08 A;  2ASO A;  3VEZ A;  4CIG A;  2O8D B;  3HSC A;  4M3X A;  1D5A A;  3OYG A;  3THY A;  4CJK A;  4IXC A;  4CIF A;  4IDH A;  2CH5 A;  4DR3 K;  4DLG A;  4CGF A;  1QHT A;  3P38 A;  3G6E N;  5AFU A;  1KCF A;  5I42 A;  3E1Y A;  3ZT4 A;  4RW8 A;  3WNF A;  4C8O A;  3G25 A;  3KLH A;  3MAQ A;  1NJI O;  1ZBH A;  1E4F T;  1S1T A;  4JS5 A;  4HVJ A;  4O5B A;  4DR2 K;  4DTS A;  1HUX A;  5FLX O;  4Q5V A;  4OKK A;  2VWJ A;  3PUF A;  4N41 A;  3VQ9 A;  1RT4 A;  2B4J A;  3T19 A;  1NKE A;  5HLF A;  3OYI A;  1G99 A;  3D2E A;  4B9S A;  3VQB A;  3ZX3 A;  3TPQ A;  1HNI A;  3GBT A;  2HBK A;  3ENH A;  1I39 A;  4BDZ A;  2D0A A;  4WFB L;  5FRO A;  4FWN A;  1RBT A;  5EVZ A;  3B6P A;  4DCH A;  1S6P A;  2BTF A;  4OGE A;  4E3S A;  1YHQ N;  3O9T A;  5SZT A;  2GEM A;  1C0M A;  4W5Q A;  4YOT A;  1W0H A;  3ZLJ A;  5J1E A;  3KKR A;  4NO7 A;  3NH2 A;  3OYH A;  3KTQ A;  1IBL K;  1K8A O;  1RT6 A;  3H6E A;  2GTD A;  4CK3 A;  2P9S A;  1ZBS A;  3A0I X;  2ZD1 A;  4HUE A;  2Q36 A;  1IKX A;  3PY8 A;  2IVO A;  4J8F A;  4CHP A;  4RW9 A;  4DB3 A;  4DSF A;  3TR8 A;  1OH7 A;  4A2B A;  1HYS A;  1VHX A;  2D0B A;  4H4M A;  2PBD A;  2RHK A;  4DTR A;  4JI8 K;  5CY4 A;  3AVJ A;  3NH0 A;  3AGR A;  5BRD A;  4H4O A;  4NYN A;  1ATR A;  2D4W A;  3K59 A;  1GOA A;  3AVA A;  1SL2 A;  2YCH A;  2KFZ A;  3QML A;  1LCU A;  1Z26 A;  3LAL A;  4WYB A;  4FJ5 A;  4CVN E;  3M8S A;  5AQU A;  5AQW A;  4BRH A;  4KTZ A;  2HW3 A;  2X74 A;  4JKB A;  3VTH A;  3E01 A;  4DLE A;  2QWO A;  1RGI A;  2HB5 A;  4CJ3 A;  1EO1 A;  1EX4 A;  3NF9 A;  4YOY A;  2XY7 A;  1TKZ A;  4IFY A;  1HNX K;  3VEY A;  2UU9 K;  1VQL N;  1OVY A;  1KXP A;  5IWA K;  4QAG A;  2G8H A;  1HMV A;  3DLG A;  3HI0 A;  5CYM A;  4DR1 K;  4Z4H A;  3F2K A;  4CHN A;  1VSD A;  2FBY A;  3C7N A;  4DTM A;  3DLR A;  1WSJ A;  1HLU A;  2W6K A;  4CF8 A;  2O8D A;  2O8B B;  3V9S A;  2E6L A;  4CES A;  4ZTJ A;  4CHO A;  4CED A;  3PLA A;  4FXD A;  3RR7 A;  2G8W A;  4EZ6 A;  3U3G A;  4DV3 K;  1WOQ A;  4Z4C A;  5FPE A;  3F9K A;  1FJG K;  4YNQ A;  4JD2 B;  1JKH A;  3SUN A;  1HKG A;  4KO0 A;  1DKG D;  4BG8 A;  1GOB A;  2NRH A;  1QTM A;  4A62 A;  2BUP A;  3J7Z O;  4JI2 K;  5M1P A;  3T7Z A;  3NF8 A;  3PX6 A;  4CHQ A;  3O4W A;  3MWP A;  4MDB A;  2VWB A;  4FK2 A;  1ASV A;  4CJ4 A;  3QET A;  3C65 A;  1KAX A;  2QKB A;  3QLH A;  4KBO A;  3V9Z A;  5EU7 A;  2GEL A;  1YVN A;  1NK5 A;  3HTV A;  2FXU A;  1BIS A;  1DT9 A;  1LW2 A;  3BF1 A;  2IOC A;  3L2R A;  3SV4 A;  3KWG A;  4BG9 A;  2XO7 A;  1ESV A;  2ZE2 A;  2QK9 A;  1HKC A;  1VRT A;  1P90 A;  2RKI A;  4EP5 A;  1GLB G;  3WNE A;  3ATV A;  3LP1 A;  3IDH A;  3OHR A;  4GMJ B;  1LW0 A;  3CF5 L;  3C6U A;  4E7J A;  4H5T A;  4YOW A;  3IKM A;  5FPN A;  3MN7 A;  3ENB A;  3ZCM A;  3VGM A;  1SS6 A;  3NVK A;  3RMC A;  3IFR A;  1CZA N;  3I8D A;  4HTU A;  1OH6 A;  4YOR A;  3CYM A;  4CJE A;  3ULE B;  3I0S A;  4K41 A;  1DGK N;  2V52 B;  1JXE A;  4CGG A;  1QQM A;  4BRF A;  1N6Q A;  1N8R O;  3DLE A;  3CCV N;  3THV A;  3HBT A;  1X1P A;  1RDB A;  4CD3 A;  5AQK A;  3VTI A;  2DFE A;  1RBV A;  4BE2 A;  4O44 A;  4WQ4 C;  3TAM A;  4J2B A;  4E7H A;  1P8Z A;  3WNG A;  1NMN A;  4X66 K;  3RVC A;  4HUF A;  3QBW A;  4BR5 A;  3AVB A;  3ZX0 A;  5JS1 A;  4ID5 A;  4PKG A;  1WSG A;  1LAV A;  5KRT A;  1SKR A;  1CZB A;  3J8A A;  4FM1 A;  3FR0 A;  2P9N B;  1ASU A;  4W5N A;  2ITG A;  2D0P A;  3QDK A;  4GKJ K;  4ISE A;  4OLA A;  1IG8 A;  1VQN N;  3TAB A;  2QKK A;  1NGG A;  2A1S A;  3K2P A;  5F2R A;  4FOI A;  5FRM A;  2W6L A;  3KVG A;  4XH4 A;  1BU6 O;  3TSQ A;  2E5L K;  1KVB A;  5JVH L;  1IO2 A;  5HRR A;  2GWK A;  4JS4 A;  4BRQ A;  3CM6 A;  3L4Q A;  2O8B A;  3PO4 A;  5HL7 L;  2HMI A;  3F73 A;  3AA3 A;  3ULD A;  4BC5 A;  3O9R A;  3J7A P;  1X9W A;  3VOV A;  4BC2 A;  1C1A A;  4BE0 A;  3O6W A;  5HRO A;  1GLJ O;  1CXQ A;  4JD2 A;  4GY2 B;  3WQT A;  4CHY A;  1T8E A;  5JLF A;  1SL1 A;  4KPY A;  1QZ6 A;  3EKU A;  2HBL A;  4JAX A;  2E4L A;  4DV7 K;  4FYD A;  4O8K A;  3OVN A;  3CCE N;  4K25 A;  1VRU A;  1A5W A;  1TAQ A;  3HVR A;  1JCG A;  2XHB A;  3EZW A;  2CGJ A;  3CJ7 A;  3L6Q A;  4R79 A;  4OKJ A;  4BVO A;  4RW7 A;  1UAX A;  4WCE L;  5LY3 A;  1X3M A;  2NRT A;  4BRA A;  1S5J A;  2FF6 A;  2VYP A;  4JRQ A;  3QO9 A;  3SQ2 A;  4DTX A;  2KLA A;  4RG8 A;  4YDU C;  4B9U A;  3UE5 A;  3T1Y K;  2G8U A;  2GWJ A;  2IVN A;  4FL9 A;  1BA0 A;  3M1F A;  1LV5 A;  2HNZ A;  3MN9 A;  3CC4 N;  4FJ7 A;  4E1J A;  4NLB A;  4F4K A;  4E7L A;  1B92 A;  3KLG A;  4ID1 A;  2ITM A;  4M42 A;  2NRR A;  4FJH A;  5EY4 A;  2QA4 N;  5AQM A;  1GOC A;  3LDS A;  4CHZ A;  1R0A A;  1NJZ A;  4Z0U A;  4GV6 A;  3ALY A;  5JVG L;  3SLC A;  2D1K A;  3H3O B;  4ILG B;  1NGC A;  4M3R A;  2HF3 A;  5TKW A;  1RDW X;  1GLD G;  1QVG M;  1T3V A;  3OA9 A;  1OVQ A;  4IG3 A;  5AQO A;  1NK7 A;  3ULE A;  3K5O A;  5AQH A;  5JLH A;  1WBB A;  4FJK A;  1TGO A;  4IZ9 A;  3TSP A;  3MN6 A;  4B1U B;  1ILY A;  5AQQ A;  2V7Y A;  2VGN A;  3MWT A;  1JLE A;  4FPA A;  4BRO A;  3R6M A;  1QZ5 A;  1U4B A;  4KTQ A;  3ID6 A;  3K58 A;  1KQS M;  1NJX A;  4H03 B;  3OYM A;  3RR8 A;  4IFE A;  3AVC A;  4Y0W A;  5LMN K;  3KJV A;  2NRW A;  4FVU A;  2G8K A;  1Q8I A;  2OCE A;  2PYJ A;  4CJL A;  2HHQ A;  1Q9Y A;  1YTA A;  4QS9 A;  4NCA A;  3DMJ A;  1TAU A;  2P9N A;  5KGW A;  3QFU A;  3C6T A;  3ID8 A;  3TTC A;  3SPZ A;  1K6Y A;  2E2P A;  1YIT N;  2P9U B;  4IOX A;  2I7N A;  3V9W A;  4B3R K;  3DLL L;  4ELV A;  4KHP K;  2E20 A;  1HQU A;  1ZYQ A;  1T6D A;  4BWM A;  4DQP A;  3AVK A;  4BY9 C;  3M8Q A;  4JLH A;  3LAN A;  1S72 N;  2FC0 A;  1V4S A;  5AQY A;  1EKE A;  4H5V A;  5J2Q A;  5MLC Q;  4CE9 A;  1YVU A;  3VA3 A;  3VF6 A;  3M5R A;  3M6G A;  4AM6 A;  4LFB K;  1UOC A;  2Q97 A;  1MWK A;  2WBN A;  1HX1 A;  2J4R A;  5J2N A;  2GX9 A;  1VAZ A;  3SQ4 A;  2ZGZ A;  3BUZ B;  1HKB A;  2O4G A;  3CQY A;  4AF1 A;  4RW4 A;  4Q0B A;  3H46 O;  2WTU A;  3BP8 A;  3H1V X;  3DOL A;  4Z4E A;  2QWQ A;  1YTU A;  2YKN A;  4JKC A;  2ZGY A;  4LSN A;  4DUY K;  3CME N;  3CCL N;  4PUO A;  4PKI A;  3OYC A;  5LJV A;  3FZK A;  1CLQ A;  3VQ5 A;  1ZBF A;  5C24 A;  1X3N A;  3E9P A;  3QB0 A;  3EE8 A;  1VQ7 N;  3LDP A;  3EZ5 A;  1FKP A;  4WE1 A;  3C0B A;  1A5V A;  3DXM B;  3LPT A;  4DTJ A;  3KD5 E;  4IKF A;  3HL8 A;  4OX9 K;  4H5W A;  4I2P A;  4CCH A;  1RTD A;  2RN2 A;  4M3U A;  1S9E A;  2Q0R A;  2WOM A;  4DQR A;  3CC7 N;  3AA5 X;  4DQS A;  4IO9 L;  3RMB A;  4DHY A;  3KKS A;  3DXK B;  3J80 O;  3G4S N;  4FW2 A;  3FE1 A;  1XUP O;  2FSJ A;  3GE1 A;  1J54 A;  3SJJ A;  3CJC A;  3NF6 A;  4DQ8 A;  2F8S A;  1Z6R A;  4FJ9 A;  1SKW A;  4CZF A;  1UWB A;  3U6F A;  4CEE A;  4FLZ A;  2KW4 A;  3N4Q A;  4M3W A;  3FFI A;  2I5J A;  3SCX A;  1S1X A;  3P5J A;  4A57 A;  4CJV A;  3ZSR A;  2E2Q A;  2KTQ A;  4DV5 K;  2FF3 B;  3O3H A;  3CFP A;  4CF9 A;  1DTT A;  3VGK A;  5KRS A;  1U49 A;  3K5L A;  4EHU A;  4KAZ A;  4O0I A;  2BAN A;  2OZM A;  4GNI A;  3SMP A;  1J53 A;  4CJ5 A;  1U47 A;  4ILJ A;  1EWQ A;  3P31 A;  3QER A;  1JLC A;  2Q31 A;  5LL6 Z;  4B9L A;  4M7X A;  3R8E A;  2P9U A;  2NRZ A;  2FLO A;  2YX6 A;  4K43 A;  3TAG A;  4PA1 A;  3FZF A;  4E0D A;  4CFB A;  4JV5 K;  2YNF A;  3U9Z A;  3WXM B;  4OGC A;  4GVM A;  3NF7 A;  1T03 A;  3KZB A;  3LPU A;  4IG0 A;  1Q82 O;  3RMA A;  2FSK A;  4BGB A;  1WLJ A;  1DEJ A;  3LDO A;  4WQ4 A;  4Z94 A;  1VSI A;  1E3M A;  4L3Q A;  3DI6 A;  1RIL A;  4OPK A;  5C25 A;  2A6A A;  3CXC M;  3LZI A;  4XH5 A;  1NG9 A;  3QEX A;  2OPP A;  4DSK A;  2Y1J A;  3CQ8 A;  5ADX A;  3QIC A;  2WUS A;  4DFP A;  4FLT A;  1C0U A;  1YJ9 N;  1HNV A;  4B8C A;  4CEO A;  3S9H A;  2P9K A;  1HR0 K;  1DTQ A;  4LFC K;  4CER A;  3OS2 A;  4AM7 A;  2EWS A;  4MO4 A;  3O9Q A;  3V1O A;  3S3M A;  4KH4 A;  1HYZ A;  4LFA K;  2Y1I A;  2QXF A;  4WF9 L;  3DXM A;  3I33 A;  1D9D A;  1NMD A;  4CZH A;  4IOC L;  4K8X A;  1XQS C;  2WON A;  4M45 A;  4FWK A;  1CZ9 A;  1Q86 O;  2KZM A;  3SUP A;  2B5J A;  4DV1 K;  1U48 A;  4I9L A;  1C0T A;  1XHX A;  4NCB A;  4CGD A;  4KHY A;  5BRF A;  1NWK A;  4CJP A;  2E1Y A;  4X65 K;  1RTI A;  2PAV A;  4BRC A;  3GG4 A;  3CCS N;  2F8T A;  1ZXO A;  3DXK A;  3SUQ A;  4DMN A;  2HBJ A;  1EP4 A;  4NXN K;  4DS5 A;  3EEQ A;  3NGZ A;  4B9T A;  3SI6 A;  1Z05 A;  3HYF A;  3C6A A;  4ELT A;  4Z4F A;  3NHG A;  3WXI A;  3VES A;  3UKU B;  4BRN A;  5AQP A;  4G9Z A;  3ZEU B;  2O8E B;  3QIN A;  4YDU A;  2YKM A;  4M3Z A;  4CGI A;  4JRP A;  2O8F B;  4CZM A;  4EHT A;  4FWL A;  3VQD A;  4BGA A;  1ZBL A;  5E41 A;  4KHQ A;  2IC3 A;  1RDU A;  3VMF B;  1KLM A;  3BY5 A;  3CM5 A;  3O1W A;  1K9M O;  4ISF A;  4BR7 A;  2OZS A;  3SYZ A;  3MED A;  1HJR A;  4IOA L;  1Q7Y O;  2W42 A;  4H0T B;  4BR2 A;  1UA0 A;  3TU5 A;  2ASM A;  2Z1H A;  3HST B;  3JSM A;  4DTO A;  2P5G A;  1CXU A;  1TK5 A;  3UB5 A;  1VSF A;  1GLF O;  3GL1 A;  3R1X A;  1VQ8 N;  3MEE A;  3ZT2 A;  4XIU A;  4A5B A;  4BC3 A;  4J2A A;  2YHW A;  3MEC A;  4DSJ A;  4JI1 K;  3N4P A;  1REV A;  2BE2 A;  4B9V A;  5KI6 A;  3DRP A;  3WXJ A;  3OBY A;  1L3T A;  1BHL A;  1NK8 A;  3JAM O;  3L2V A;  3OYF A;  1N32 K;  2YHB A;  1UA1 A;  5CYQ A;  3NAE A;  4GW6 A;  3MXM A;  3K0S A;  4I2Q A;  5AFU H;  1VSH A;  2XY6 A;  3H1Q A;  1D9F A;  2OTJ N;  1N5Y A;  4WQ5 C;  2E2O A;  5AZJ B;  1HNZ K;  4JKE A;  2YNH A;  1N33 K;  5AQF A;  3QEP A;  4K42 A;  3OYD A;  5M1Q A;  4FWP A;  1Q81 O;  4E1M A;  5BRE A;  4CJF A;  4FWS A;  1BQM A;  1T7P A;  1J9A A;  5AQX A;  2VWK A;  3P39 A;  3SUO A;  3RWU A;  1FXX A;  5KQD A;  4AIL C;  5AQS A;  1NGD A;  3CCU N;  4E19 A;  5D3G A;  4IO8 A;  4CZK A;  1BO5 O;  1LOT B;  4FZX C;  3SBG A;  4FWM A;  1OH5 A;  3T1A A;  1HQE A;  4JI0 K;  2QW9 A;  5ADX H;  2HOE A;  4BR0 A;  3CD6 N;  4DV0 K;  3HM8 A;  3SQ1 A;  1IH7 A;  1SKS A;  2PFU A;  4JKG B;  3VF2 A;  2P9P B;  2YNG A;  5LJW A;  1RDD A;  1JXB A;  2GUP A;  4JYA K;  3D2F B;  4CBU A;  4W5O A;  2GV9 A;  3KIO A;  4CBX A;  3KK3 A;  3SJH A;  3WEE B;  2HND A;  5C12 A;  4PY5 A;  1Q18 A;  4BRL A;  1W9H A;  3KLI A;  4IEE A;  4OPH A;  4DSL A;  1ATS A;  2YJF A;  1IJJ A;  1B9D A;  3FZM A;  3VQP A;  1JLG A;  4JEP A;  2UXD K;  3LP0 A;  5BRH A;  4IDK A;  3R9P A;  1QE1 A;  2RPI A;  4ICL A;  3CFO A;  2E1Z A;  3CFR A;  4M3T A;  2ZQB A;  4ISG A;  1WAF A;  1TV6 A;  3CG7 A;  5FRN A;  2XY8 A;  2D0O A;  4FK4 A;  4BDP A;  3UKU A;  3ZEU A;  2QWN A;  2O8E A;  1KVA A;  4Y1D A;  4C1N I;  2O8F A;  2CGK A;  1KTQ A;  1YI2 N;  3J7Y P;  2ZF5 O;  4FLU A;  1DLO A;  4F3T A;  3IG1 A;  4JKA A;  2OPS A;  4KB0 A;  4PL7 A;  1BI4 B;  3PV8 A;  5IT9 O;  5CR4 A;  1WAJ A;  3EE9 A;  3SAF A;  4H0O A;  4FJ8 A;  4DF8 A;  4MLH A;  1QS4 A;  1F21 A;  1BCO A;  3TAN A;  3F5T A;  3HP9 A;  3VQ8 A;  3LWM A;  2HHX A;  3SBT A;  1VSK A;  4OLB A;  1T05 A;  4BQL A;  2Z1I A;  3FZL A;  1GLE G;  4K8Z A;  1M1K O;  1HNW K;  2H3G X;  4H8K A;  1QSS A;  4C8N A;  2OAN A;  4O0J A;  1JCE A;  4CFD A;  3CPW M;  3QEW A;  1RTH A;  1H1V A;  3TAQ A;  3A2F A;  4AHR A; 
#chains in the Genus database with same CATH homology
 4DV4 K;  4DV2 K;  2UUB K;  4JI0 K;  4JI5 K;  1IBK K;  1HNX K;  4NXN K;  2UU9 K;  4LF5 K;  5IWA K;  5LMU K;  3T1Y K;  4B3S K;  4DV0 K;  4DR2 K;  1IBM K;  4JI7 K;  5FLX O;  4DR1 K;  4DV6 K;  4LFB K;  1XNR K;  5LL6 Z;  4JYA K;  4YHH K;  4JV5 K;  4DR6 K;  4DR4 K;  5BR8 K;  4AQY K;  4X66 K;  4LF6 K;  4JI3 K;  4CW7 B;  5A2Q O;  4DUY K;  3T1H K;  1J5E K;  2VQF K;  2UXD K;  4GKK K;  2HHH K;  4DR7 K;  4JI4 K;  1N36 K;  4DV3 K;  4B3M K;  4NXM K;  4JI6 K;  1FJG K;  1XNQ K;  4GKJ K;  2UXB K;  1IBL K;  4LF7 K;  2UXC K;  4OX9 K;  4JI2 K;  4V19 S;  2E5L K;  3J7Y P;  4DR5 K;  3OTO K;  2UUA K;  4JI1 K;  5LMN K;  1HR0 K;  1XMO K;  3JAM O;  4LFC K;  5IT9 O;  3J80 O;  4DUZ K;  1I94 K;  3J7A P;  1N32 K;  4X62 K;  4JI8 K;  1N34 K;  4LF4 K;  4LFA K;  1HNZ K;  4B3T K;  5AJ3 K;  2UUC K;  2ZM6 K;  1N33 K;  2VQE K;  4DV7 K;  4CVN E;  4YY3 K;  4LF8 K;  4DV1 K;  1HNW K;  4B3R K;  1XMQ K;  4KHP K;  3J81 O;  4X64 K;  4X65 K;  4DR3 K;  2F4V K;  4K0K K;  4DV5 K;  4LF9 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...