4AQYK

Structure of ribosome-apramycin complexes
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Dissociation of Antibacterial Activity and Aminoglycoside Ototoxicity in the 4-Monosubstituted 2-Deoxystreptamine Apramycin.
pubmed doi rcsb
molecule tags Ribosome
total genus 22
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2012-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4aqyK00
4DR1K 1HNWK 4X66K 4GKJK 5IWAK 4LFBK 4LF5K 1HR0K 2UU9K 4LFAK 4YHHK 2ZM6K 4DR4K 3T1YK 1HNZK 2HHHK 2UXBK 4CW7B 4NXMK 1I94K 4X65K 4DV4K 4DV6K 4DUZK 1J5EK 4DV5K 4YY3K 4JI7K 4LF4K 1IBLK 1N36K 2UUBK 5FLXO 4B3TK 2E5LK 4DR7K 4DV3K 4V19S 4GKKK 4LF8K 3JAMO 4DV7K 4JI0K 4X62K 4JI4K 1FJGK 5LMNK 5A2QO 4DR6K 2VQEK 3J80O 1XMQK 3J7AP 3T1HK 2UUCK 1HNXK 5BR8K 4DR2K 3J81O 4KHPK 4X64K 1XMOK 4JI3K 2UXCK 4B3SK 5LMUK 4LFCK 2VQFK 2F4VK 5AJ3K 4K0KK 4JI6K 4B3RK 4NXNK 1IBKK 4DV0K 1N34K 4AQYK 4DR5K 5IT9O 4DV1K 4JYAK 1N32K 3OTOK 2UXDK 1IBMK 4DUYK 4JI2K 2UUAK 4B3MK 4JI8K 4LF6K 1XNRK 3J7YP 4CVNE 4OX9K 1N33K 4LF7K 1XNQK 4JI5K 4JI1K 4JV5K 5LL6Z 4DR3K 4LF9K 4DV2K
chains in the Genus database with same CATH superfamily
1A5VA 3D2FB 2Q1NA 4CZLA 2O8FB 2P9SB 3NF6A 3QICA 2P9NA 4X66K 4OO1J 1B9FA 3TPQA 3CJ9A 1NK7A 5ADXH 1C0TA 3O9TA 3DLBA 3VENA 2UU9K 4YHHK 3AVCA 2QM1A 4BG9A 2I7NA 4CGFA 3RTVA 1Q82O 2P9LA 2V7ZA 3PX0A 3KLIA 4CHOA 3MEEA 3ZYYX 3SV3A 1TK0A 4WYBA 4PL7A 1NMDA 4KI6A 3O9UA 4FWSA 1YT3A 5TKYA 3BDPA 1O1WA 5AQRA 3LALA 4CJQA 3V81A 5M1QA 4JNEA 3LZJA 3ATUA 4CHNA 1ASUA 1NGGA 4PUOA 1QTMA 3WXLA 5LJWA 4AHVA 3UKRB 3UIQA 2OTLN 2D0AA 4PL8A 5C2DA 3T1HK 4DFPA 4DHYA 2PFUA 4WE1A 2XO7A 1M90O 3CQXA 3VQEA 4X64K 4BRAA 1QQCA 4B3OA 3RWUA 1SS6A 3LPUA 1Z05A 3GL1A 5CZ2A 1JCGA 4CZGA 3LZIA 1VSJA 4DU1A 2OA8A 1NG9A 4CEAA 3SUOA 1K6YA 4QS9A 2P9NB 4ISEA 1N32K 3RRHA 4K43A 2UXDK 1JXEA 3SLCA 1ATSA 4JI8K 4FLTA 3OJSA 3TAPA 3J7YP 4C8OA 3JYTA 3AA4A 1G15A 3BZKA 1VSFA 3KK2A 1TL1A 2RF2A 4QS8A 5AZJB 2GELA 3RMAA 3GBTA 4IXCA 2FC0A 4IFVA 2NNWA 3NCIA 2Y1JA 1WUAA 1X9SA 3A5LC 3WNFA 1K73O 3AVIA 3EE9A 3A2FA 1BL3A 5AQTA 1TYQA 3SZ2A 1WSEA 1E4FT 3J8AA 4O0JA 4AM7A 3DXKA 4A61A 3CCJN 4BE2A 3HSTB 4BQZA 3UB5A 1HNVA 2WTUA 2NRVA 1NGDA 5JVHL 2VGMA 1JL1A 4CJSA 4CZHA 4IG3A 4NYNA 3QETA 2OYQA 1RT4A 3OJUA 3CI5A 1N36K 1QE1A 3DJCA 3VQDA 2CGLA 4F2SA 4WQ4A 4OJRA 4J2BA 5DK5A 4IJAA 2ZQBA 4E0DA 2GUPA 3JAMO 4F8RA 2CGJA 1GLLO 1S22A 3ZEUA 1XC3A 4CHQA 4KHQA 1YJ9N 3VOVA 4DR6K 1NGJA 3TAGA 4AHSA 4C23A 3OYDA 1HYSA 1HUXA 2E1YA 1KVBA 1BI4A 5LJVA 4CJFA 3A0IX 4MQ3A 3ULDA 3WUHA 3FZKA 3TTFA 1NKBA 3TSPA 1JCFA 3KKRA 4IDHA 4FZZA 4FJXA 3VQQA 1KC8O 4HHTA 2O8CA 4BWMA 2E2NA 3NH2A 3KK7A 3ENHA 4ELUA 1BA1A 1X3NA 4WQ5A 1UWBA 1YVNA 1RDDA 4FW2A 4G9ZA 3NH1A 3VEXA 3CCUN 3MWTA 3K5LA 2XY8A 4YNQA 5TKWA 1YI2N 3E9OA 4PKGA 3QEXA 3WNGA 3BUZB 5KI6A 1ZBIA 1WAJA 2HF4A 1CXUA 3FZHA 4XH5A 1NLVA 3SQ2A 2A6AA 4KHYA 3FE1A 4FYDA 2GEMA 4B1VA 5SZTA 3TAMA 4B9QA 4H0TB 4LF9K 2F9TA 4JRQA 1WSJA 4B9NA 3EYZA 3HYFA 4KH6A 3CC4N 3V9SA 4MLEA 5GADP 3MECA 1Q8IA 4I2QA 5JMVA 2QXFA 4CJLA 5AFUH 1G99A 4XH1A 2X78A 1ESVA 3NGZA 1R59O 4LFAK 2FF3B 2Q3SA 1RTHA 2GX9A 2BE2A 5GINA 1RBTA 2HHHK 1DGKN 4JD2A 5KQDA 4CK1A 1H1VA 1BOTO 1ATNA 1IH7A 2WFBA 3ASMA 3TARA 1Q9XA 5HRPA 3CM5A 4H8KA 5EXWA 5FLXO 2QKBA 3OHRA 3HVTA 3CCMN 3HM9A 2IS3A 1EX4A 4BRFA 4IDKA 1VQON 4BRQA 2OPRA 4LSLA 4HCBA 3KWIA 2OPSA 4DTRA 4GMJB 4DSEA 3OYIA 1I39A 1U6ZA 4ELVA 4LH4A 4JKFA 5JICA 3CC2N 4ICLA 1HNXK 3HI0A 3SPZA 5JLHA 3ITHA 1RFQA 1T03A 2F8SA 3R1XA 2F96A 4KHSA 1NGEA 3NVMA 3R8EA 4CF0A 3ULEA 3U9DA 4A5AA 4DQPA 4M45A 3PSFA 4EAHD 4DLGA 2NZTA 3BF3A 4KHWA 3FFIA 5BRFA 3BEXA 3THVA 1IBMK 3HPHA 3MX5A 3AA3A 1YVUA 1XNRK 3G0ZA 1OVYA 1RBRA 3LPTA 4KV8A 2E2OA 1NM1A 4CHPA 3E9LA 4U67L 1HMVA 3K5MA 4J2DA 3OS2A 3KLGA 1JLCA 2VWKA 4R79A 1EWRA 4E1JA 4DR3K 3DLHA 3AVJA 5F1XA 2VG5A 1X9MA 3E66A 4CJPA 3OYLA 3DLRA 2P9KB 4NO7A 5HRSA 1DEJA 3C94A 4GKJK 3EN9A 4FOIA 4BE0A 4N41A 5HLFA 5GIOA 3S3OA 3PIOL 3T69A 2JWKA 3HM8A 5C42A 3KK1A 2ZM6K 3V9XA 3T1YK 4OGEA 4OKKA 3L2VA 2P9PA 3DLGA 3C95A 1HNZK 3LDOA 3LP3A 2HMPA 3S41A 4FJKA 1IJJA 4OVLA 3VQ4A 4JI7K 1D5AA 1J5OA 4NCGA 3RSEA 2Q0UA 1M1KO 3WNEA 1RT2A 5GAHP 3ZT1A 1O13A 1A5WA 3G71N 1FJGK 1WSGA 4BRHA 2NRTA 2Z1HA 5KRSA 2GBZA 2F8TA 4MLHA 1KFSA 4CJKA 4FLXA 2XY6A 3F9MA 4JKBA 1T7PA 4GV3A 2ITGA 2BDPA 1JLEA 2W41A 3MEDA 2VWBA 4FL9A 3AVBA 3NMUA 3MXMA 1NK0A 3DLLL 1GOBA 1ZBFA 4DQQA 4CGIA 3OBYA 2O8BA 3KLHA 4DUYK 3UE5A 4JKEA 3OYCA 1VQPN 2HHWA 3QB0A 3OYNA 4JS4A 2GV9A 3Q7CA 3AVKA 4O5FA 4JV5K 5T7BA 2FF6A 3P38A 2HBMA 2BGGA 4ID1A 4JK8A 3T7ZA 5AQOA 4Z4FA 1DTQA 3ISNC 3HO1A 3P4IA 3VPZA 2CH6A 3THYA 5AQWA 1ZBUA 2QWQA 2Q2RA 3PX4A 2E4LA 4OKJA 5GIPA 2HNDA 4LF5K 4LFBK 1F21A 3HXMA 1XUPO 4EP4A 1L3TA 4DR4K 1RT6A 4BR7A 3IAYA 3EKUA 3S3MA 4YOWA 3TAQA 2DY4A 2DTUA 3LM2A 3CQYA 4JKAA 4CZKA 3C6TA 4FK2A 2P9IA 1YF5L 2A40A 4EZ9A 3HSCA 3NF9A 2A1RA 3SBGA 1SAZA 2ZF5O 2XRIA 4DV3K 5KTQA 3D2EB 4OLBA 2OPPA 5EOYA 4JI4K 4CFAA 2YHXA 5AQHA 1C1BA 2I7PA 4FSVA 1D9DA 3SMSA 5EVZA 3W3DA 2QWLA 1XHZA 5HL7L 4O8KA 1N6QA 4FJLA 3I0RA 4EIAA 5BR8K 4BRMA 3VA3A 5GAGP 3MCAB 5FROA 4HUEA 1XMOK 4FZXC 4UY8O 1J53A 1Z6RA 4EHUA 4FJ8A 3PX6A 4F4KA 1I3AA 2E6LA 3BP8A 4XH4A 1IKYA 1NU0A 1T6CA 3G4SN 3DXMB 1HQEA 1VRUA 3KWGA 4ZHRA 2B4JA 3MK6A 4R5PA 4E7IA 4H0OA 2UUAK 4U7BA 1OH6A 1SL1A 3V9ZA 3CJBA 3I8DA 4CZMA 1TV6A 2HBJA 4LF7K 2E88A 1KD1O 2YJFA 5B8HA 4C1NK 1VQ7N 4QS7A 2E8AA 3NDKA 2AJQA 4JI1K 4I9LA 2OPQA 4Y1CA 4M3XA 3TABA 1XWLA 3CM6A 4GNIA 4IWVA 4E89A 2OCEA 3M1FA 5M1OA 4CD3A 4DG1A 4CJRA 1JLBA 5HROA 4BRDA 4IOXA 1LWFA 1D8YA 1BDGA 4M3UA 3THWA 2W42A 2PZSA 4FWMA 3P5JA 1EQYA 3CQ8A 4M3RA 3DOKA 2DPNA 3N4QA 1C0FA 3W0LA 2O8DB 4H03B 3JSMA 4CFDA 2ETJA 3NGYA 2Z1IA 3OBWA 4CW7B 1HLUA 4FVMA 4M3ZA 3ZT3A 3O1BA 3FGUA 1HKGA 1FXXA 4KH4A 1NKEA 1U49A 3VEYA 1GLAG 4WFBL 1QHTA 2NRXA 4DU3A 5BRDA 4AF1A 2E5LK 5AQXA 4W5TA 3CPWM 4DQSA 1HJOA 1HYZA 3AGKA 3A5OC 4IO9L 1HX1A 5I9EB 4Y0WA 5EX5A 4AHUA 1VSKA 1IKWA 1S6PA 3O9QA 5HRRA 4AH9A 3VGMA 2GWKA 3IUCA 4NLBA 3T1AA 4O55A 4DR2K 3TWHA 3J81O 2R7YA 3VMFB 1R0AA 2DFFA 1RDUA 2KZZA 5AQKA 2ZGZA 5H1SQ 1MWMA 4YDUC 1LWCA 4CJ4A 3SUPA 3VEWA 3CCVN 3OYHA 3VGKA 3H1QA 4BR5A 3DRPA 1IBKK 3WXMB 1BIZA 3FZLA 4FWOA 3GDQA 3VQ5A 4GV9A 4CJ7A 1QHAA 1T05A 2V51B 3I0SA 4WFNL 3B8AX 3MWPA 4CGDA 4OX9K 1WB9A 1FKOA 2D5RA 1CZBA 3K2PA 3EZWA 4O0IA 4DF8A 3T19A 5FDLA 4CZJA 5LL6Z 3AAQA 3DWLA 5J2QA 4OPHA 5AQNA 2HBLA 4HCCA 3M8PA 1KTQA 4KBOA 1RDCA 2HHXA 4LH5A 3QFPA 4QAGA 3ZCMA 4CIGA 3KIOA 1ZXOA 1W7AA 5CYMA 3K9JA 4IOAL 3V1QA 4JKGA 2KTQA 2LSNA 3ID6A 5CYQA 4FPBA 5JS2A 5J2MA 4HTLA 2P9LB 1QQOA 4JKDA 2UXBK 4L3QA 2X6NA 3WXKA 4BREA 1KXPA 4CJEA 3G6EN 4B8CA 3R9PA 1QZ5A 3OYEA 1C0MA 4FZYA 4H5VA 2G8VA 4LF4K 1SL2A 1CZAN 3M6GA 2UUBK 2YHBA 2YV0X 3VQ7A 4BRKA 3OYGA 3AARA 1QSLA 2RKIA 3CHWA 3ZETA 1HJRA 2ZJPL 4DV7K 4JI0K 1OVQA 3LWLA 4BRPA 1ZYQA 4DTXA 4O8UA 3HP9A 3CCSN 1KAZA 5C2FA 3ATVA 3L0QA 1E3MA 2IVNA 3KJVA 4M3YA 1KFDA 5KGWA 1Z26A 1C0GA 2DFHA 4DS4A 3AO2A 3ENOA 2VG6A 1WN7A 2AA4A 3MEGA 5AJ3K 3H3NO 4K0KK 4KTQA 4KB0A 4KRFA 4B8AB 3WQTA 3HP6A 3U9ZA 4DSLA 2NRRA 3H46O 4HVJA 2G8FA 4FPAA 4I2PA 4FK0A 1MU2A 3LM9A 2P9UA 3DRSA 3EE8A 3KD5E 1IKVA 1NK8A 4GY2B 2YHYA 3HT3A 4JS5A 4CVNE 3SV4A 1S3XA 2HF3A 4N76A 3K9KA 3SPYA 3VGLA 3LAKA 3AVHA 2ZD1A 4XIUA 4M7YA 3MMVA 4A59A 1BHLA 5AQFA 2I5JA 2IGIA 4A2BA 4DTOA 1QSSA 4CE9A 4IKFA 2EX3A 2HNYA 5E41A 4RWTA 1KSPA 4BDYA 4BGBA 4B9SA 4GVMA 3SNNA 2RN2A 4UQGA 2D4WA 5FPNA 3TTDA 1IO2A 1TYQB 4Z4GA 3CCQN 4RW4A 1L3UA 4DLEA 3V9WA 3EO3A 1KAYA 3DXKB 3ZETB 2J4RA 3ZSWA 1NK6A 1BWFO 4A2AA 4DFJA 4IBNA 4I6MA 3VF4A 5DM6L 3UKUA 3PIPL 2XY5A 1VAZA 3PLAA 1WOQA 2FBXA 3VTIA 3B6PA 4MO4A 4RW6A 4FWLA 1DTTA 4JKHA 4GV6A 3VQ9A 3P1GA 3GG4A 2UYTA 3IDHA 1TGOA 3BGRA 3H1VX 1NJXA 4V19S 3QINA 5AZIA 4CFCA 5BR9A 4CIFA 2PBDA 1T44A 4HWIA 3ZT2A 3ZEUB 4YOVA 3KD1E 3CYMA 3A5MC 3OVNA 4AM6A 3CIPA 4B08A 5KGXA 2FSJA 1BI4B 2ASOA 4EZ6A 1W97L 3C7NA 3CERA 1L3SA 5ELZA 4F3TA 4IG0A 2YKNA 1LAVA 2QTDA 1RILA 5KPTA 2F4VK 2O8CB 1V4SA 4CERA 3IKMA 4BG8A 2O8EA 3L2WA 2A1SA 4DR5K 3C6UA 4Q0BA 4BVOA 4E3SA 3WXIA 3L6QA 3CG7A 3H6EA 1XHXA 3VF2A 1BG3A 3MDQA 1HPZA 3PUFA 2YNGA 1VQ9N 3HVRA 1S1WA 3AAPA 3RVCA 1EKEA 1U45A 1XNQK 4FXDA 3AY9A 1J54A 4DF4A 1SL0A 3O4WA 4JHDA 1NGIA 1TKDA 3QEVA 3KHYA 1REVA 3BZCA 3TSUA 4RW8A 4O5BA 2KKZA 4CF8A 5JVGL 5CY4A 3IFRA 3L2RA 1NOYA 5BRHA 4ELTA 4K8ZA 3AVLA 4E7JA 4HTUA 4C8KA 1W9HA 4K25A 1JLGA 2QKKA 4CEEA 4JD2B 3OYKA 3HPGA 2Y1IA 4XEIA 5CZ1A 1OH8A 1SKWA 4NCAA 4GVEA 1HQUA 1RT5A 4WCEL 5HRNA 1CZ9A 3C7NB 1DLOA 1QQNA 3F5TA 3N4PA 1NK9A 2IIRA 3VN5A 2A41A 2WBNA 4YOXA 2HHQA 3CD6N 4IEIA 4FLWA 2QK9A 1YIJN 3LANA 2BTFA 3NBPA 4IFYA 2B6AA 1UOCA 2O8EB 1VQ6N 3KZBA 3LDLA 3A8YA 3KVGA 3NVKA 1XMQK 5J2NA 4MO5A 1K9MO 1S1TA 3O9SA 2HHTA 1EWQA 1OH5A 1J9AA 3L3UA 4BQLA 4CJTA 5J2PA 4IEEA 1UAXA 4A5BA 3OY9A 5BN8A 4JI3K 4OPJA 1S9GA 1OH7A 3O5BA 1JLQA 4PQUA 1RCHA 3CXCM 2Q36A 1Q81O 3QBWA 1QVGM 1RDAA 5AQYA 3ULEB 2FBYA 4JI6K 2WC9A 4BC2A 1HKCA 4DV0K 3J7ZO 1N34K 3I55N 2IVOA 4FVUA 4FLYA 1WBBA 3E01A 4ISFA 1B92A 3OYFA 4CJVA 1NBWA 2HB5A 3VQ6A 5JS1A 4KKOA 4KO0A 1VQ5N 4JYAK 3AA5X 4BR0A 1Y64A 4B3MK 2F7TA 4DQIA 3HRGA 3AVNA 3DI6A 1VSLA 4FCYA 5BPNA 3DRRA 3CFRA 3KTQA 2IVPA 2W40A 3P39A 3TU5A 2QA4N 2RE2A 1ATRA 2HOEA 3VQCA 3MN9A 4BROA 3VQBA 3EY1A 4CI6A 1D4XA 5DMRA 4KHUA 3NH0A 1WLJA 5ADXA 1RT1A 1RBSA 5AR0A 4FLVA 1ZC6A 4BDZA 4FJIA 1BU6O 5F2RA 3O9RA 3ENBA 3VA0A 4CZEA 3AVGA 1YXQA 3P31A 3SUQA 4DQRA 3D45A 3GOIA 3A5NC 5AQLA 4FWPA 4Z0UA 4KB1A 1YITN 3O3GA 4DWIA 1RNHA 1TKXA 1FK9A 2P9PB 4CGJA 2CH5A 3KLFA 3QEIA 4DSFA 2P5GA 4NYFA 4NXMK 1K8KA 3VETA 3CJ7A 2A5XA 1LV5A 1KVAA 3KKSA 3K0SA 4LY7A 1IG9A 4EFHA 3ZSQA 1P8ZA 1NJYA 3BY5A 2FSKA 5FRNA 3U3GA 2V52B 3RSEB 3ZSXA 2D0BA 1S5JA 2QWNA 4RG8A 4K41A 2G8IA 1HPMA 4KH5A 4DCHA 1VSDA 5A2QO 3G25A 1LW0A 2H3GX 4ILHA 3HK2A 1ZBHA 4H5TA 2EWSA 4M3WA 3FR0A 1NGCA 2VGNA 2Q97A 4H0VB 4E7HA 4KHPK 3LP1A 4F3OA 1VHXA 1DT9A 3G10A 1KQSM 5AQGA 3V1RA 1QS4A 4B3RK 3OS1A 4B1YB 1SQKA 1U2VA 3CJCA 4B1WB 1SUQA 3LP0A 4H5NA 4M7XA 2X6SA 3TI0A 1WAFA 3OW2M 3V6DA 3OTOK 3OS0A 3SJHA 4JI2K 2O8BB 1W0HA 1T6DA 1WSFA 5AQIA 4J2AA 3CJ1A 2B5JA 1KLMA 5JLFA 3LDPA 1LCUA 1FKPA 4ZTFA 3FFKB 1RDWX 3LDSA 5AQZA 3D2FA 2ZJQL 4DV2K 3M8SA 2O8FA 2YJEA 4EP5A 3NAEA 3L4IA 3THYB 3RRGA 2ZJRL 1RTIA 3OYAA 3V4IA 4BRIA 3ID8A 1T3VA 2NRZA 1LWEA 1S1XA 3CCRN 4C8NA 4FJ5A 1VQ4N 5AQJA 3CF5L 5HP1A 2PYJA 3LWMA 3THXA 4CGGA 1RT7A 1IV0A 1IBLK 2P9IB 4B9TA 2HHVA 4B1UB 3DLEA 2HHSA 5M1KA 3JXUA 4RTFD 3AO3A 5KRTA 3CETA 4CGHA 4BRGA 1WSIA 1BCMA 3AGRA 3UKRA 3IS9A 3J80O 3ZSRA 4BDPA 2UUCK 5J1EA 1BQNA 2NLXA 3MN5A 1UA1A 1YTAA 2P51A 2CGKA 3ZX3A 1X1PA 4DMNA 3CMAN 1LW2A 4BRLA 4E1NA 4M3TA 2VQFK 3U3YA 4DTSA 1NNEA 4BRNA 5E26A 1TVRA 3CCEN 1E4GT 3SCXA 3ZLJA 3ZSVA 3SQ0A 4KTZA 1T8EA 1TAUA 4DV1K 3PV8A 4CBXA 3H08A 1EETA 3OA9A 2G8KA 1OKJA 3DAWA 4QOZB 2A42A 1XI1A 3O4QA 1HRHA 3MN6A 4J2EA 3JS6A 3AO5A 1N33K 5AZJA 1S1UA 1VSMA 1ASWA 4WQ5C 4BR2A 4DTNA 1NMNA 5FPDA 5M1NA 3VQ8A 1NJZA 3I56N 4DQ8A 1LAWA 1B9DA 3C0BA 4CBUA 3MCPA 4FJ9A 3THXB 4YORA 4Z94A 4BR4A 2Z1JA 3SK3A 4CCHA 1C0UA 5AFUA 4GW6A 2WOMA 3H45C 4E7LA 3RMDA 1YTUA 3THWB 5CHIA 2JWLA 3IG1A 3PSIA 1S6QA 4KFBA 1Q9YA 1SV5A 3SMPA 4CK2A 4M42A 1BO5O 3IRXA 5AQMA 4DV6K 3L3VA 1BGXT 3FLCO 4AILC 3KK3A 1NGBA 3M8QA 1MWKA 2E20A 4B3TK 3TANA 2KFNA 4W5QA 5KQ8A 4GKKK 4Z4EA 3HOSA 1JKHA 4X62K 5C25A 4O4GA 5AQUA 5DM7L 5EU7A 1NKCA 2FBTA 4E7KA 1NGAA 1K8AO 1VSHA 1N5YA 1JCEA 4CBWA 3VESA 1VSEA 3S3NA 2W6KA 1NJWA 3MAQA 1EP4A 3GE1A 4CF2A 4CK3A 2QXLA 1KCFA 4CIEA 4BR9A 4I7FA 1IKXA 2KHOA 3EZ5A 3LDQA 2HVHA 5CE3A 4IZ9A 4ILJA 4FJGA 4IO8A 1SKSA 2JLEA 4AQYK 3RMBA 4DTPA 1C1CA 3L8BA 1LOTB 4FJ7A 3WT0A 4OPKA 2XY7A 5IT9O 1GOCA 3ZX2A 2NUBA 3CJAA 4KAZA 5M1PA 4KREA 2HNZA 4DTMA 5LY3A 5HOOA 3V9UA 3TTCA 4DU4A 1VK0A 3CFPA 2KFZA 3ZSZA 4CF1A 3C6HA 3NF7A 2YNFA 3O1WA 3R3LA 2E6MA 4Z4IA 4YFUA 3VQAA 1MDUB 3C6AA 2ITMA 3QEWA 3AVMA 3F2KA 5BPLA 2YNHA 2YCHA 2P1JA 1U4BA 2WUSA 5IWAK 4CEQA 4FWKA 4DS5A 4JKGB 1TAQA 5BN9A 1HR0K 3B6OA 1HNIA 3RR8A 2KQ2A 3TAFA 3SUNA 1L3VA 4JAXA 2PYLA 4FJHA 3TR8A 1Z25A 1N8RO 4CEBA 1YHQN 2WONA 4Z4CA 1WNSA 2DFEA 1VQLN 1I94K 4BACA 1C1AA 1UA0A 2OTJN 4DSIA 2RHKA 4CJWA 4C8LA 3QNOA 2OZMA 4AHRA 4YY3K 3PY8A 1GLDG 4CEFA 4CJ5A 3SYZA 1Q18A 3MX2A 3QBXA 4ID5A 3O08A 1TUYA 4CJ3A 3L4QA 3CCLN 4CECA 1QZ6A 2IAJA 2O4GA 1W2BM 4OLAA 4YDUA 3HBTA 2VQEK 3QMLA 4CFBA 1VQKN 5GAEP 3H3OB 3C65A 1QSYA 3VF6A 4C1NI 3DLKA 3NF8A 2D0OA 4FO0A 4PWDA 1GLEG 1QQMA 2Q0RA 5FPEA 1XC9A 4JKCA 5LMUK 4WFAL 1ZBLA 1DKGD 3SQ1A 4DB3A 5C15A 3E1YA 1RTJA 4BRCA 2G8HA 4TSXA 1RGIA 3S9HA 2YX6A 4H5WA 4A62A 1X3MA 3SQ4A 2G8WA 5AQSA 4AHCA 4K42A 3VERA 3AA2A 2P9UB 1Q7YO 1ILYA 4G1QA 4Y1DA 3IMXA 4LD0A 1TK5A 4DTUA 1WBDA 4FLZA 4B9MA 4N47A 3CMEN 1TKZA 1IG8A 4JI5K 3PO4A 5FRMA 4KI4A 5AQQA 4DKWA 4H4OA 1CXQA 1RTDA 2A3ZA 3D0PA 3DM2A 4MDAA 4W5NA 3CFOA 2P9KA 1CLQA 3O3HA 4BVPA 4H4MA 5E84A 1NK4A 3NGIA 1VSIA 4FWRA 1FW6A 3OYJA 4LC9B 5BREA 1YAGA 3R6MA 3PO5A 3CC7N 4M41A 4B1ZA 3K57A 4AHTA 4CHZA 1NK5A 4KHNA 2YI1A 3AV9A 4NB4A 4IFEA 3QNNA 3M8RA 4I6MB 4BC3A 3MN7A 2BUPA 3UKUB 1QVFM 5F0XA 4FJNA 3F9KA 1S72N 4FWQA 3ZSOA 3LP2A 3LDNA 4B1XB 2ZGYA 3WXJA 3ZX0A 3AVAA 2QWPA 3U8XA 3U4LA 3WEEA 5C24A 3DYAA 4HUFA 3LL3A 3VEOA 2FXUA 1U48A 4JRPA 1MA9B 4RW9A 4OPAA 4FM0A 5AZIB 4DSKA 3VQPA 1RT3A 1ZBSA 4CD1A 1U04A 2D1KA 4BC5A 2ATQA 4EHTA 3CPEA 2F9WA 2D0PA 2KW4A 3MXJA 1BUPA 1BISA 3J7AP 2VWJA 3SAGA 1JL2A 4H0XB 5AQPA 1YUWA 4BWJA 2VYPA 5D3GA 4YOTA 3HJFA 4PA1A 4F2RA 2UXCK 3DMJA 4OGCA 4W5RA 3ZSYA 4KPYA 1NGHA 4O44A 3F73A 3NE6A 3O6WA 3RMCA 3SBTA 1RBVA 4QCLA 1BA0A 3WQUA 1D9FA 2D0CA 2RPIA 3MXIA 2IC3A 1BQMA 4PY5A 1BCOA 3KLEA 1GOAA 4JLHA 3I8BA 3QO9A 4FK4A 4F9OA 4JN4A 1NWKA 4N5SA 1P90A 3K5NA 3QERA 3QIOA 4C8MA 4JHDB 1RDBA 2KZMA 3EEQA 1WSHA 4PHTX 3L2QA 3WEEB 1JLAA 3FZFA 1YJWN 2ASPA 2OZSA 2G8UA 2ASMA 1KRPA 3QEPA 2P5OA 4ILGB 2QWRA 3QDKA 4PKIA 4RCHA 3AVFA 4X65K 4DV4K 5BPMA 4DV5K 3HL8A 2FSNA 2YNIA 2HSTA 3BF1A 1KAXA 4RW7A 3D2EA 4E19A 1NOZA 2W6LA 2GTDA 3HPOA 1SZ2A 2GWJA 3D6RA 2HBKA 4LF8K 1JLFA 1HYVA 4CESA 1JJ2M 3Q7BA 3SAHA 4BC4A 2IDOA 2OANA 4J8FA 3O80A 4M63C 4CEOA 2KLAA 5LMNK 5KPZA 4A57A 2HW3A 1EO1A 2O4IA 2YHAA 2QI2A 4Z4HA 3V1OA 3FZMA 4CZFA 1SKRA 1TKTA 1X9WA 2QWOA 5C10A 1VQ8N 2NRHA 1GLCG 4B3SK 2PAVA 2VG7A 2XHBA 4IOCL 1YJNN 1VRTA 4NXNK 2EHGA 4DFMA 2YKMA 1JXBA 3DXMA 4H0PA 2QEXN 2E2QA 1C6VA 2E2PA 3VEZA 3P83D 2X74A 3EL2A 5I42A 3U6FA 4FJJA 2HMIA 3DOLA 1TL3A 2Z1GA 5CR4A 4LF6K 4WF9L 4B9UA 3I33A 4CEDA 2Q31A 3K58A 3HOTA 3VTHA 3AO1A 5C0YA 3AO4A 2ZE2A 2BANA 2YHWA 4JK9A 4FM1A 1GLBG 4CF9A 4DR1K 4ZTJA 5MLCQ 1HNWK 2HVIA 3HZ6A 4FLUA 1RBUA 3VEVA 1Q86O 4BY9C 3E9PA 2AP1A 3QFUA 3OYBA 2VCPA 5AQVA 4FW1A 5C12A 3QIPA 1S9EA 4MFBA 4FJMA 4B9LA 2O8DA 1NJIO 1X9JA 4YOYA 3L2UA 3NHGA 1ASVA 1GLJO 4YOUA 4Q5VA 2PY5A 1K8KB 2P9SA 1J5EK 4DUZK 4CZIA 1BIUA 2QWMA 4DTJA 2FBVA 4N56A 1ITGA 3EKSA 4JEPA 3TSQA 2HHUA 4DR7K 3O4NA 3SJJA 1TUUA 2V7YA 4L8RB 3OYMA 5HBMA 3O8MA 3K5OA 1S1VA 4NCBA 5M1FA 4BE1A 1V4TA 4K8XA 2E1ZA 3M3ZA 4KTWA 4OKEA 3NFAA 2FLOA 4I9QA 4BGAA 2ZWHA 3T3FA 5SWMA 3LAMA 1KVCA 3O3FA 4HUGA 3ZT4A 2QW9A 4FWNA 3RR7A 3M5RA 4W5OA 1U47A 4ISGA 4DFKA 1EXQA 5EY4A 4H0YB 2GUIA 4LFCK 1A5XA 4CEZA 1VQMN 4CHYA 1XQSC 3SAFA 4NLCA 4DSJA 1J6ZA 1U2VB 3QLHA 1L5UA 2NRWA 4PKHA 4MDBA 4FM2A 1Y97A 4B9VA 5FPMA 4WQ4C 3TAEA 4FOEA 2BH1A 3SI6A 3ALYA 2JGUA 5KPRA 4IJNA 3K59A 1KLNA 1HKBA 4LSNA 5K14A 1NGFA 4JK7A 2IOCA 4H5RA 3HTVA 4E1MA 3ZT0A 1VQNN 3QESA 3D7EO 5I3UA 1GLFO 3WNHA 1TK8A 4CJUA
chains in the Genus database with same CATH topology
4DR1K 1HNWK 4X66K 4GKJK 5IWAK 4LFBK 4LF5K 1HR0K 2UU9K 4LFAK 4YHHK 2ZM6K 4DR4K 3T1YK 1HNZK 2HHHK 2UXBK 4CW7B 4NXMK 1I94K 4X65K 4DV4K 4DV6K 4DUZK 1J5EK 4DV5K 4YY3K 4JI7K 4LF4K 1IBLK 1N36K 2UUBK 5FLXO 4B3TK 2E5LK 4DR7K 4DV3K 4V19S 4GKKK 4LF8K 3JAMO 4DV7K 4JI0K 4X62K 4JI4K 1FJGK 5LMNK 5A2QO 4DR6K 2VQEK 3J80O 1XMQK 3J7AP 3T1HK 2UUCK 1HNXK 5BR8K 4DR2K 3J81O 4KHPK 4X64K 1XMOK 4JI3K 2UXCK 4B3SK 5LMUK 4LFCK 2VQFK 2F4VK 5AJ3K 4K0KK 4JI6K 4B3RK 4NXNK 1IBKK 4DV0K 1N34K 4AQYK 4DR5K 5IT9O 4DV1K 4JYAK 1N32K 3OTOK 2UXDK 1IBMK 4DUYK 4JI2K 2UUAK 4B3MK 4JI8K 4LF6K 1XNRK 3J7YP 4CVNE 4OX9K 1N33K 4LF7K 1XNQK 4JI5K 4JI1K 4JV5K 5LL6Z 4DR3K 4LF9K 4DV2K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR1 K;  1HNW K;  4X66 K;  4GKJ K;  5IWA K;  4LFB K;  4LF5 K;  1HR0 K;  2UU9 K;  4LFA K;  4YHH K;  2ZM6 K;  4DR4 K;  3T1Y K;  1HNZ K;  2HHH K;  2UXB K;  4CW7 B;  4NXM K;  1I94 K;  4X65 K;  4DV4 K;  4DV6 K;  4DUZ K;  1J5E K;  4DV5 K;  4YY3 K;  4JI7 K;  4LF4 K;  1IBL K;  1N36 K;  2UUB K;  5FLX O;  4B3T K;  2E5L K;  4DR7 K;  4DV3 K;  4V19 S;  4GKK K;  4LF8 K;  3JAM O;  4DV7 K;  4JI0 K;  4X62 K;  4JI4 K;  1FJG K;  5LMN K;  5A2Q O;  4DR6 K;  2VQE K;  3J80 O;  1XMQ K;  3J7A P;  3T1H K;  2UUC K;  1HNX K;  5BR8 K;  4DR2 K;  3J81 O;  4KHP K;  4X64 K;  1XMO K;  4JI3 K;  2UXC K;  4B3S K;  5LMU K;  4LFC K;  2VQF K;  2F4V K;  5AJ3 K;  4K0K K;  4JI6 K;  4B3R K;  4NXN K;  1IBK K;  4DV0 K;  1N34 K;  4AQY K;  4DR5 K;  5IT9 O;  4DV1 K;  4JYA K;  1N32 K;  3OTO K;  2UXD K;  1IBM K;  4DUY K;  4JI2 K;  2UUA K;  4B3M K;  4JI8 K;  4LF6 K;  1XNR K;  3J7Y P;  4CVN E;  4OX9 K;  1N33 K;  4LF7 K;  1XNQ K;  4JI5 K;  4JI1 K;  4JV5 K;  5LL6 Z;  4DR3 K;  4LF9 K;  4DV2 K; 
#chains in the Genus database with same CATH topology
 1A5V A;  3D2F B;  2Q1N A;  4CZL A;  2O8F B;  2P9S B;  3NF6 A;  3QIC A;  2P9N A;  4X66 K;  4OO1 J;  1B9F A;  3TPQ A;  3CJ9 A;  1NK7 A;  5ADX H;  1C0T A;  3O9T A;  3DLB A;  3VEN A;  2UU9 K;  4YHH K;  3AVC A;  2QM1 A;  4BG9 A;  2I7N A;  4CGF A;  3RTV A;  1Q82 O;  2P9L A;  2V7Z A;  3PX0 A;  3KLI A;  4CHO A;  3MEE A;  3ZYY X;  3SV3 A;  1TK0 A;  4WYB A;  4PL7 A;  1NMD A;  4KI6 A;  3O9U A;  4FWS A;  1YT3 A;  5TKY A;  3BDP A;  1O1W A;  5AQR A;  3LAL A;  4CJQ A;  3V81 A;  5M1Q A;  4JNE A;  3LZJ A;  3ATU A;  4CHN A;  1ASU A;  1NGG A;  4PUO A;  1QTM A;  3WXL A;  5LJW A;  4AHV A;  3UKR B;  3UIQ A;  2OTL N;  2D0A A;  4PL8 A;  5C2D A;  3T1H K;  4DFP A;  4DHY A;  2PFU A;  4WE1 A;  2XO7 A;  1M90 O;  3CQX A;  3VQE A;  4X64 K;  4BRA A;  1QQC A;  4B3O A;  3RWU A;  1SS6 A;  3LPU A;  1Z05 A;  3GL1 A;  5CZ2 A;  1JCG A;  4CZG A;  3LZI A;  1VSJ A;  4DU1 A;  2OA8 A;  1NG9 A;  4CEA A;  3SUO A;  1K6Y A;  4QS9 A;  2P9N B;  4ISE A;  1N32 K;  3RRH A;  4K43 A;  2UXD K;  1JXE A;  3SLC A;  1ATS A;  4JI8 K;  4FLT A;  3OJS A;  3TAP A;  3J7Y P;  4C8O A;  3JYT A;  3AA4 A;  1G15 A;  3BZK A;  1VSF A;  3KK2 A;  1TL1 A;  2RF2 A;  4QS8 A;  5AZJ B;  2GEL A;  3RMA A;  3GBT A;  4IXC A;  2FC0 A;  4IFV A;  2NNW A;  3NCI A;  2Y1J A;  1WUA A;  1X9S A;  3A5L C;  3WNF A;  1K73 O;  3AVI A;  3EE9 A;  3A2F A;  1BL3 A;  5AQT A;  1TYQ A;  3SZ2 A;  1WSE A;  1E4F T;  3J8A A;  4O0J A;  4AM7 A;  3DXK A;  4A61 A;  3CCJ N;  4BE2 A;  3HST B;  4BQZ A;  3UB5 A;  1HNV A;  2WTU A;  2NRV A;  1NGD A;  5JVH L;  2VGM A;  1JL1 A;  4CJS A;  4CZH A;  4IG3 A;  4NYN A;  3QET A;  2OYQ A;  1RT4 A;  3OJU A;  3CI5 A;  1N36 K;  1QE1 A;  3DJC A;  3VQD A;  2CGL A;  4F2S A;  4WQ4 A;  4OJR A;  4J2B A;  5DK5 A;  4IJA A;  2ZQB A;  4E0D A;  2GUP A;  3JAM O;  4F8R A;  2CGJ A;  1GLL O;  1S22 A;  3ZEU A;  1XC3 A;  4CHQ A;  4KHQ A;  1YJ9 N;  3VOV A;  4DR6 K;  1NGJ A;  3TAG A;  4AHS A;  4C23 A;  3OYD A;  1HYS A;  1HUX A;  2E1Y A;  1KVB A;  1BI4 A;  5LJV A;  4CJF A;  3A0I X;  4MQ3 A;  3ULD A;  3WUH A;  3FZK A;  3TTF A;  1NKB A;  3TSP A;  1JCF A;  3KKR A;  4IDH A;  4FZZ A;  4FJX A;  3VQQ A;  1KC8 O;  4HHT A;  2O8C A;  4BWM A;  2E2N A;  3NH2 A;  3KK7 A;  3ENH A;  4ELU A;  1BA1 A;  1X3N A;  4WQ5 A;  1UWB A;  1YVN A;  1RDD A;  4FW2 A;  4G9Z A;  3NH1 A;  3VEX A;  3CCU N;  3MWT A;  3K5L A;  2XY8 A;  4YNQ A;  5TKW A;  1YI2 N;  3E9O A;  4PKG A;  3QEX A;  3WNG A;  3BUZ B;  5KI6 A;  1ZBI A;  1WAJ A;  2HF4 A;  1CXU A;  3FZH A;  4XH5 A;  1NLV A;  3SQ2 A;  2A6A A;  4KHY A;  3FE1 A;  4FYD A;  2GEM A;  4B1V A;  5SZT A;  3TAM A;  4B9Q A;  4H0T B;  4LF9 K;  2F9T A;  4JRQ A;  1WSJ A;  4B9N A;  3EYZ A;  3HYF A;  4KH6 A;  3CC4 N;  3V9S A;  4MLE A;  5GAD P;  3MEC A;  1Q8I A;  4I2Q A;  5JMV A;  2QXF A;  4CJL A;  5AFU H;  1G99 A;  4XH1 A;  2X78 A;  1ESV A;  3NGZ A;  1R59 O;  4LFA K;  2FF3 B;  2Q3S A;  1RTH A;  2GX9 A;  2BE2 A;  5GIN A;  1RBT A;  2HHH K;  1DGK N;  4JD2 A;  5KQD A;  4CK1 A;  1H1V A;  1BOT O;  1ATN A;  1IH7 A;  2WFB A;  3ASM A;  3TAR A;  1Q9X A;  5HRP A;  3CM5 A;  4H8K A;  5EXW A;  5FLX O;  2QKB A;  3OHR A;  3HVT A;  3CCM N;  3HM9 A;  2IS3 A;  1EX4 A;  4BRF A;  4IDK A;  1VQO N;  4BRQ A;  2OPR A;  4LSL A;  4HCB A;  3KWI A;  2OPS A;  4DTR A;  4GMJ B;  4DSE A;  3OYI A;  1I39 A;  1U6Z A;  4ELV A;  4LH4 A;  4JKF A;  5JIC A;  3CC2 N;  4ICL A;  1HNX K;  3HI0 A;  3SPZ A;  5JLH A;  3ITH A;  1RFQ A;  1T03 A;  2F8S A;  3R1X A;  2F96 A;  4KHS A;  1NGE A;  3NVM A;  3R8E A;  4CF0 A;  3ULE A;  3U9D A;  4A5A A;  4DQP A;  4M45 A;  3PSF A;  4EAH D;  4DLG A;  2NZT A;  3BF3 A;  4KHW A;  3FFI A;  5BRF A;  3BEX A;  3THV A;  1IBM K;  3HPH A;  3MX5 A;  3AA3 A;  1YVU A;  1XNR K;  3G0Z A;  1OVY A;  1RBR A;  3LPT A;  4KV8 A;  2E2O A;  1NM1 A;  4CHP A;  3E9L A;  4U67 L;  1HMV A;  3K5M A;  4J2D A;  3OS2 A;  3KLG A;  1JLC A;  2VWK A;  4R79 A;  1EWR A;  4E1J A;  4DR3 K;  3DLH A;  3AVJ A;  5F1X A;  2VG5 A;  1X9M A;  3E66 A;  4CJP A;  3OYL A;  3DLR A;  2P9K B;  4NO7 A;  5HRS A;  1DEJ A;  3C94 A;  4GKJ K;  3EN9 A;  4FOI A;  4BE0 A;  4N41 A;  5HLF A;  5GIO A;  3S3O A;  3PIO L;  3T69 A;  2JWK A;  3HM8 A;  5C42 A;  3KK1 A;  2ZM6 K;  3V9X A;  3T1Y K;  4OGE A;  4OKK A;  3L2V A;  2P9P A;  3DLG A;  3C95 A;  1HNZ K;  3LDO A;  3LP3 A;  2HMP A;  3S41 A;  4FJK A;  1IJJ A;  4OVL A;  3VQ4 A;  4JI7 K;  1D5A A;  1J5O A;  4NCG A;  3RSE A;  2Q0U A;  1M1K O;  3WNE A;  1RT2 A;  5GAH P;  3ZT1 A;  1O13 A;  1A5W A;  3G71 N;  1FJG K;  1WSG A;  4BRH A;  2NRT A;  2Z1H A;  5KRS A;  2GBZ A;  2F8T A;  4MLH A;  1KFS A;  4CJK A;  4FLX A;  2XY6 A;  3F9M A;  4JKB A;  1T7P A;  4GV3 A;  2ITG A;  2BDP A;  1JLE A;  2W41 A;  3MED A;  2VWB A;  4FL9 A;  3AVB A;  3NMU A;  3MXM A;  1NK0 A;  3DLL L;  1GOB A;  1ZBF A;  4DQQ A;  4CGI A;  3OBY A;  2O8B A;  3KLH A;  4DUY K;  3UE5 A;  4JKE A;  3OYC A;  1VQP N;  2HHW A;  3QB0 A;  3OYN A;  4JS4 A;  2GV9 A;  3Q7C A;  3AVK A;  4O5F A;  4JV5 K;  5T7B A;  2FF6 A;  3P38 A;  2HBM A;  2BGG A;  4ID1 A;  4JK8 A;  3T7Z A;  5AQO A;  4Z4F A;  1DTQ A;  3ISN C;  3HO1 A;  3P4I A;  3VPZ A;  2CH6 A;  3THY A;  5AQW A;  1ZBU A;  2QWQ A;  2Q2R A;  3PX4 A;  2E4L A;  4OKJ A;  5GIP A;  2HND A;  4LF5 K;  4LFB K;  1F21 A;  3HXM A;  1XUP O;  4EP4 A;  1L3T A;  4DR4 K;  1RT6 A;  4BR7 A;  3IAY A;  3EKU A;  3S3M A;  4YOW A;  3TAQ A;  2DY4 A;  2DTU A;  3LM2 A;  3CQY A;  4JKA A;  4CZK A;  3C6T A;  4FK2 A;  2P9I A;  1YF5 L;  2A40 A;  4EZ9 A;  3HSC A;  3NF9 A;  2A1R A;  3SBG A;  1SAZ A;  2ZF5 O;  2XRI A;  4DV3 K;  5KTQ A;  3D2E B;  4OLB A;  2OPP A;  5EOY A;  4JI4 K;  4CFA A;  2YHX A;  5AQH A;  1C1B A;  2I7P A;  4FSV A;  1D9D A;  3SMS A;  5EVZ A;  3W3D A;  2QWL A;  1XHZ A;  5HL7 L;  4O8K A;  1N6Q A;  4FJL A;  3I0R A;  4EIA A;  5BR8 K;  4BRM A;  3VA3 A;  5GAG P;  3MCA B;  5FRO A;  4HUE A;  1XMO K;  4FZX C;  4UY8 O;  1J53 A;  1Z6R A;  4EHU A;  4FJ8 A;  3PX6 A;  4F4K A;  1I3A A;  2E6L A;  3BP8 A;  4XH4 A;  1IKY A;  1NU0 A;  1T6C A;  3G4S N;  3DXM B;  1HQE A;  1VRU A;  3KWG A;  4ZHR A;  2B4J A;  3MK6 A;  4R5P A;  4E7I A;  4H0O A;  2UUA K;  4U7B A;  1OH6 A;  1SL1 A;  3V9Z A;  3CJB A;  3I8D A;  4CZM A;  1TV6 A;  2HBJ A;  4LF7 K;  2E88 A;  1KD1 O;  2YJF A;  5B8H A;  4C1N K;  1VQ7 N;  4QS7 A;  2E8A A;  3NDK A;  2AJQ A;  4JI1 K;  4I9L A;  2OPQ A;  4Y1C A;  4M3X A;  3TAB A;  1XWL A;  3CM6 A;  4GNI A;  4IWV A;  4E89 A;  2OCE A;  3M1F A;  5M1O A;  4CD3 A;  4DG1 A;  4CJR A;  1JLB A;  5HRO A;  4BRD A;  4IOX A;  1LWF A;  1D8Y A;  1BDG A;  4M3U A;  3THW A;  2W42 A;  2PZS A;  4FWM A;  3P5J A;  1EQY A;  3CQ8 A;  4M3R A;  3DOK A;  2DPN A;  3N4Q A;  1C0F A;  3W0L A;  2O8D B;  4H03 B;  3JSM A;  4CFD A;  2ETJ A;  3NGY A;  2Z1I A;  3OBW A;  4CW7 B;  1HLU A;  4FVM A;  4M3Z A;  3ZT3 A;  3O1B A;  3FGU A;  1HKG A;  1FXX A;  4KH4 A;  1NKE A;  1U49 A;  3VEY A;  1GLA G;  4WFB L;  1QHT A;  2NRX A;  4DU3 A;  5BRD A;  4AF1 A;  2E5L K;  5AQX A;  4W5T A;  3CPW M;  4DQS A;  1HJO A;  1HYZ A;  3AGK A;  3A5O C;  4IO9 L;  1HX1 A;  5I9E B;  4Y0W A;  5EX5 A;  4AHU A;  1VSK A;  1IKW A;  1S6P A;  3O9Q A;  5HRR A;  4AH9 A;  3VGM A;  2GWK A;  3IUC A;  4NLB A;  3T1A A;  4O55 A;  4DR2 K;  3TWH A;  3J81 O;  2R7Y A;  3VMF B;  1R0A A;  2DFF A;  1RDU A;  2KZZ A;  5AQK A;  2ZGZ A;  5H1S Q;  1MWM A;  4YDU C;  1LWC A;  4CJ4 A;  3SUP A;  3VEW A;  3CCV N;  3OYH A;  3VGK A;  3H1Q A;  4BR5 A;  3DRP A;  1IBK K;  3WXM B;  1BIZ A;  3FZL A;  4FWO A;  3GDQ A;  3VQ5 A;  4GV9 A;  4CJ7 A;  1QHA A;  1T05 A;  2V51 B;  3I0S A;  4WFN L;  3B8A X;  3MWP A;  4CGD A;  4OX9 K;  1WB9 A;  1FKO A;  2D5R A;  1CZB A;  3K2P A;  3EZW A;  4O0I A;  4DF8 A;  3T19 A;  5FDL A;  4CZJ A;  5LL6 Z;  3AAQ A;  3DWL A;  5J2Q A;  4OPH A;  5AQN A;  2HBL A;  4HCC A;  3M8P A;  1KTQ A;  4KBO A;  1RDC A;  2HHX A;  4LH5 A;  3QFP A;  4QAG A;  3ZCM A;  4CIG A;  3KIO A;  1ZXO A;  1W7A A;  5CYM A;  3K9J A;  4IOA L;  3V1Q A;  4JKG A;  2KTQ A;  2LSN A;  3ID6 A;  5CYQ A;  4FPB A;  5JS2 A;  5J2M A;  4HTL A;  2P9L B;  1QQO A;  4JKD A;  2UXB K;  4L3Q A;  2X6N A;  3WXK A;  4BRE A;  1KXP A;  4CJE A;  3G6E N;  4B8C A;  3R9P A;  1QZ5 A;  3OYE A;  1C0M A;  4FZY A;  4H5V A;  2G8V A;  4LF4 K;  1SL2 A;  1CZA N;  3M6G A;  2UUB K;  2YHB A;  2YV0 X;  3VQ7 A;  4BRK A;  3OYG A;  3AAR A;  1QSL A;  2RKI A;  3CHW A;  3ZET A;  1HJR A;  2ZJP L;  4DV7 K;  4JI0 K;  1OVQ A;  3LWL A;  4BRP A;  1ZYQ A;  4DTX A;  4O8U A;  3HP9 A;  3CCS N;  1KAZ A;  5C2F A;  3ATV A;  3L0Q A;  1E3M A;  2IVN A;  3KJV A;  4M3Y A;  1KFD A;  5KGW A;  1Z26 A;  1C0G A;  2DFH A;  4DS4 A;  3AO2 A;  3ENO A;  2VG6 A;  1WN7 A;  2AA4 A;  3MEG A;  5AJ3 K;  3H3N O;  4K0K K;  4KTQ A;  4KB0 A;  4KRF A;  4B8A B;  3WQT A;  3HP6 A;  3U9Z A;  4DSL A;  2NRR A;  3H46 O;  4HVJ A;  2G8F A;  4FPA A;  4I2P A;  4FK0 A;  1MU2 A;  3LM9 A;  2P9U A;  3DRS A;  3EE8 A;  3KD5 E;  1IKV A;  1NK8 A;  4GY2 B;  2YHY A;  3HT3 A;  4JS5 A;  4CVN E;  3SV4 A;  1S3X A;  2HF3 A;  4N76 A;  3K9K A;  3SPY A;  3VGL A;  3LAK A;  3AVH A;  2ZD1 A;  4XIU A;  4M7Y A;  3MMV A;  4A59 A;  1BHL A;  5AQF A;  2I5J A;  2IGI A;  4A2B A;  4DTO A;  1QSS A;  4CE9 A;  4IKF A;  2EX3 A;  2HNY A;  5E41 A;  4RWT A;  1KSP A;  4BDY A;  4BGB A;  4B9S A;  4GVM A;  3SNN A;  2RN2 A;  4UQG A;  2D4W A;  5FPN A;  3TTD A;  1IO2 A;  1TYQ B;  4Z4G A;  3CCQ N;  4RW4 A;  1L3U A;  4DLE A;  3V9W A;  3EO3 A;  1KAY A;  3DXK B;  3ZET B;  2J4R A;  3ZSW A;  1NK6 A;  1BWF O;  4A2A A;  4DFJ A;  4IBN A;  4I6M A;  3VF4 A;  5DM6 L;  3UKU A;  3PIP L;  2XY5 A;  1VAZ A;  3PLA A;  1WOQ A;  2FBX A;  3VTI A;  3B6P A;  4MO4 A;  4RW6 A;  4FWL A;  1DTT A;  4JKH A;  4GV6 A;  3VQ9 A;  3P1G A;  3GG4 A;  2UYT A;  3IDH A;  1TGO A;  3BGR A;  3H1V X;  1NJX A;  4V19 S;  3QIN A;  5AZI A;  4CFC A;  5BR9 A;  4CIF A;  2PBD A;  1T44 A;  4HWI A;  3ZT2 A;  3ZEU B;  4YOV A;  3KD1 E;  3CYM A;  3A5M C;  3OVN A;  4AM6 A;  3CIP A;  4B08 A;  5KGX A;  2FSJ A;  1BI4 B;  2ASO A;  4EZ6 A;  1W97 L;  3C7N A;  3CER A;  1L3S A;  5ELZ A;  4F3T A;  4IG0 A;  2YKN A;  1LAV A;  2QTD A;  1RIL A;  5KPT A;  2F4V K;  2O8C B;  1V4S A;  4CER A;  3IKM A;  4BG8 A;  2O8E A;  3L2W A;  2A1S A;  4DR5 K;  3C6U A;  4Q0B A;  4BVO A;  4E3S A;  3WXI A;  3L6Q A;  3CG7 A;  3H6E A;  1XHX A;  3VF2 A;  1BG3 A;  3MDQ A;  1HPZ A;  3PUF A;  2YNG A;  1VQ9 N;  3HVR A;  1S1W A;  3AAP A;  3RVC A;  1EKE A;  1U45 A;  1XNQ K;  4FXD A;  3AY9 A;  1J54 A;  4DF4 A;  1SL0 A;  3O4W A;  4JHD A;  1NGI A;  1TKD A;  3QEV A;  3KHY A;  1REV A;  3BZC A;  3TSU A;  4RW8 A;  4O5B A;  2KKZ A;  4CF8 A;  5JVG L;  5CY4 A;  3IFR A;  3L2R A;  1NOY A;  5BRH A;  4ELT A;  4K8Z A;  3AVL A;  4E7J A;  4HTU A;  4C8K A;  1W9H A;  4K25 A;  1JLG A;  2QKK A;  4CEE A;  4JD2 B;  3OYK A;  3HPG A;  2Y1I A;  4XEI A;  5CZ1 A;  1OH8 A;  1SKW A;  4NCA A;  4GVE A;  1HQU A;  1RT5 A;  4WCE L;  5HRN A;  1CZ9 A;  3C7N B;  1DLO A;  1QQN A;  3F5T A;  3N4P A;  1NK9 A;  2IIR A;  3VN5 A;  2A41 A;  2WBN A;  4YOX A;  2HHQ A;  3CD6 N;  4IEI A;  4FLW A;  2QK9 A;  1YIJ N;  3LAN A;  2BTF A;  3NBP A;  4IFY A;  2B6A A;  1UOC A;  2O8E B;  1VQ6 N;  3KZB A;  3LDL A;  3A8Y A;  3KVG A;  3NVK A;  1XMQ K;  5J2N A;  4MO5 A;  1K9M O;  1S1T A;  3O9S A;  2HHT A;  1EWQ A;  1OH5 A;  1J9A A;  3L3U A;  4BQL A;  4CJT A;  5J2P A;  4IEE A;  1UAX A;  4A5B A;  3OY9 A;  5BN8 A;  4JI3 K;  4OPJ A;  1S9G A;  1OH7 A;  3O5B A;  1JLQ A;  4PQU A;  1RCH A;  3CXC M;  2Q36 A;  1Q81 O;  3QBW A;  1QVG M;  1RDA A;  5AQY A;  3ULE B;  2FBY A;  4JI6 K;  2WC9 A;  4BC2 A;  1HKC A;  4DV0 K;  3J7Z O;  1N34 K;  3I55 N;  2IVO A;  4FVU A;  4FLY A;  1WBB A;  3E01 A;  4ISF A;  1B92 A;  3OYF A;  4CJV A;  1NBW A;  2HB5 A;  3VQ6 A;  5JS1 A;  4KKO A;  4KO0 A;  1VQ5 N;  4JYA K;  3AA5 X;  4BR0 A;  1Y64 A;  4B3M K;  2F7T A;  4DQI A;  3HRG A;  3AVN A;  3DI6 A;  1VSL A;  4FCY A;  5BPN A;  3DRR A;  3CFR A;  3KTQ A;  2IVP A;  2W40 A;  3P39 A;  3TU5 A;  2QA4 N;  2RE2 A;  1ATR A;  2HOE A;  3VQC A;  3MN9 A;  4BRO A;  3VQB A;  3EY1 A;  4CI6 A;  1D4X A;  5DMR A;  4KHU A;  3NH0 A;  1WLJ A;  5ADX A;  1RT1 A;  1RBS A;  5AR0 A;  4FLV A;  1ZC6 A;  4BDZ A;  4FJI A;  1BU6 O;  5F2R A;  3O9R A;  3ENB A;  3VA0 A;  4CZE A;  3AVG A;  1YXQ A;  3P31 A;  3SUQ A;  4DQR A;  3D45 A;  3GOI A;  3A5N C;  5AQL A;  4FWP A;  4Z0U A;  4KB1 A;  1YIT N;  3O3G A;  4DWI A;  1RNH A;  1TKX A;  1FK9 A;  2P9P B;  4CGJ A;  2CH5 A;  3KLF A;  3QEI A;  4DSF A;  2P5G A;  4NYF A;  4NXM K;  1K8K A;  3VET A;  3CJ7 A;  2A5X A;  1LV5 A;  1KVA A;  3KKS A;  3K0S A;  4LY7 A;  1IG9 A;  4EFH A;  3ZSQ A;  1P8Z A;  1NJY A;  3BY5 A;  2FSK A;  5FRN A;  3U3G A;  2V52 B;  3RSE B;  3ZSX A;  2D0B A;  1S5J A;  2QWN A;  4RG8 A;  4K41 A;  2G8I A;  1HPM A;  4KH5 A;  4DCH A;  1VSD A;  5A2Q O;  3G25 A;  1LW0 A;  2H3G X;  4ILH A;  3HK2 A;  1ZBH A;  4H5T A;  2EWS A;  4M3W A;  3FR0 A;  1NGC A;  2VGN A;  2Q97 A;  4H0V B;  4E7H A;  4KHP K;  3LP1 A;  4F3O A;  1VHX A;  1DT9 A;  3G10 A;  1KQS M;  5AQG A;  3V1R A;  1QS4 A;  4B3R K;  3OS1 A;  4B1Y B;  1SQK A;  1U2V A;  3CJC A;  4B1W B;  1SUQ A;  3LP0 A;  4H5N A;  4M7X A;  2X6S A;  3TI0 A;  1WAF A;  3OW2 M;  3V6D A;  3OTO K;  3OS0 A;  3SJH A;  4JI2 K;  2O8B B;  1W0H A;  1T6D A;  1WSF A;  5AQI A;  4J2A A;  3CJ1 A;  2B5J A;  1KLM A;  5JLF A;  3LDP A;  1LCU A;  1FKP A;  4ZTF A;  3FFK B;  1RDW X;  3LDS A;  5AQZ A;  3D2F A;  2ZJQ L;  4DV2 K;  3M8S A;  2O8F A;  2YJE A;  4EP5 A;  3NAE A;  3L4I A;  3THY B;  3RRG A;  2ZJR L;  1RTI A;  3OYA A;  3V4I A;  4BRI A;  3ID8 A;  1T3V A;  2NRZ A;  1LWE A;  1S1X A;  3CCR N;  4C8N A;  4FJ5 A;  1VQ4 N;  5AQJ A;  3CF5 L;  5HP1 A;  2PYJ A;  3LWM A;  3THX A;  4CGG A;  1RT7 A;  1IV0 A;  1IBL K;  2P9I B;  4B9T A;  2HHV A;  4B1U B;  3DLE A;  2HHS A;  5M1K A;  3JXU A;  4RTF D;  3AO3 A;  5KRT A;  3CET A;  4CGH A;  4BRG A;  1WSI A;  1BCM A;  3AGR A;  3UKR A;  3IS9 A;  3J80 O;  3ZSR A;  4BDP A;  2UUC K;  5J1E A;  1BQN A;  2NLX A;  3MN5 A;  1UA1 A;  1YTA A;  2P51 A;  2CGK A;  3ZX3 A;  1X1P A;  4DMN A;  3CMA N;  1LW2 A;  4BRL A;  4E1N A;  4M3T A;  2VQF K;  3U3Y A;  4DTS A;  1NNE A;  4BRN A;  5E26 A;  1TVR A;  3CCE N;  1E4G T;  3SCX A;  3ZLJ A;  3ZSV A;  3SQ0 A;  4KTZ A;  1T8E A;  1TAU A;  4DV1 K;  3PV8 A;  4CBX A;  3H08 A;  1EET A;  3OA9 A;  2G8K A;  1OKJ A;  3DAW A;  4QOZ B;  2A42 A;  1XI1 A;  3O4Q A;  1HRH A;  3MN6 A;  4J2E A;  3JS6 A;  3AO5 A;  1N33 K;  5AZJ A;  1S1U A;  1VSM A;  1ASW A;  4WQ5 C;  4BR2 A;  4DTN A;  1NMN A;  5FPD A;  5M1N A;  3VQ8 A;  1NJZ A;  3I56 N;  4DQ8 A;  1LAW A;  1B9D A;  3C0B A;  4CBU A;  3MCP A;  4FJ9 A;  3THX B;  4YOR A;  4Z94 A;  4BR4 A;  2Z1J A;  3SK3 A;  4CCH A;  1C0U A;  5AFU A;  4GW6 A;  2WOM A;  3H45 C;  4E7L A;  3RMD A;  1YTU A;  3THW B;  5CHI A;  2JWL A;  3IG1 A;  3PSI A;  1S6Q A;  4KFB A;  1Q9Y A;  1SV5 A;  3SMP A;  4CK2 A;  4M42 A;  1BO5 O;  3IRX A;  5AQM A;  4DV6 K;  3L3V A;  1BGX T;  3FLC O;  4AIL C;  3KK3 A;  1NGB A;  3M8Q A;  1MWK A;  2E20 A;  4B3T K;  3TAN A;  2KFN A;  4W5Q A;  5KQ8 A;  4GKK K;  4Z4E A;  3HOS A;  1JKH A;  4X62 K;  5C25 A;  4O4G A;  5AQU A;  5DM7 L;  5EU7 A;  1NKC A;  2FBT A;  4E7K A;  1NGA A;  1K8A O;  1VSH A;  1N5Y A;  1JCE A;  4CBW A;  3VES A;  1VSE A;  3S3N A;  2W6K A;  1NJW A;  3MAQ A;  1EP4 A;  3GE1 A;  4CF2 A;  4CK3 A;  2QXL A;  1KCF A;  4CIE A;  4BR9 A;  4I7F A;  1IKX A;  2KHO A;  3EZ5 A;  3LDQ A;  2HVH A;  5CE3 A;  4IZ9 A;  4ILJ A;  4FJG A;  4IO8 A;  1SKS A;  2JLE A;  4AQY K;  3RMB A;  4DTP A;  1C1C A;  3L8B A;  1LOT B;  4FJ7 A;  3WT0 A;  4OPK A;  2XY7 A;  5IT9 O;  1GOC A;  3ZX2 A;  2NUB A;  3CJA A;  4KAZ A;  5M1P A;  4KRE A;  2HNZ A;  4DTM A;  5LY3 A;  5HOO A;  3V9U A;  3TTC A;  4DU4 A;  1VK0 A;  3CFP A;  2KFZ A;  3ZSZ A;  4CF1 A;  3C6H A;  3NF7 A;  2YNF A;  3O1W A;  3R3L A;  2E6M A;  4Z4I A;  4YFU A;  3VQA A;  1MDU B;  3C6A A;  2ITM A;  3QEW A;  3AVM A;  3F2K A;  5BPL A;  2YNH A;  2YCH A;  2P1J A;  1U4B A;  2WUS A;  5IWA K;  4CEQ A;  4FWK A;  4DS5 A;  4JKG B;  1TAQ A;  5BN9 A;  1HR0 K;  3B6O A;  1HNI A;  3RR8 A;  2KQ2 A;  3TAF A;  3SUN A;  1L3V A;  4JAX A;  2PYL A;  4FJH A;  3TR8 A;  1Z25 A;  1N8R O;  4CEB A;  1YHQ N;  2WON A;  4Z4C A;  1WNS A;  2DFE A;  1VQL N;  1I94 K;  4BAC A;  1C1A A;  1UA0 A;  2OTJ N;  4DSI A;  2RHK A;  4CJW A;  4C8L A;  3QNO A;  2OZM A;  4AHR A;  4YY3 K;  3PY8 A;  1GLD G;  4CEF A;  4CJ5 A;  3SYZ A;  1Q18 A;  3MX2 A;  3QBX A;  4ID5 A;  3O08 A;  1TUY A;  4CJ3 A;  3L4Q A;  3CCL N;  4CEC A;  1QZ6 A;  2IAJ A;  2O4G A;  1W2B M;  4OLA A;  4YDU A;  3HBT A;  2VQE K;  3QML A;  4CFB A;  1VQK N;  5GAE P;  3H3O B;  3C65 A;  1QSY A;  3VF6 A;  4C1N I;  3DLK A;  3NF8 A;  2D0O A;  4FO0 A;  4PWD A;  1GLE G;  1QQM A;  2Q0R A;  5FPE A;  1XC9 A;  4JKC A;  5LMU K;  4WFA L;  1ZBL A;  1DKG D;  3SQ1 A;  4DB3 A;  5C15 A;  3E1Y A;  1RTJ A;  4BRC A;  2G8H A;  4TSX A;  1RGI A;  3S9H A;  2YX6 A;  4H5W A;  4A62 A;  1X3M A;  3SQ4 A;  2G8W A;  5AQS A;  4AHC A;  4K42 A;  3VER A;  3AA2 A;  2P9U B;  1Q7Y O;  1ILY A;  4G1Q A;  4Y1D A;  3IMX A;  4LD0 A;  1TK5 A;  4DTU A;  1WBD A;  4FLZ A;  4B9M A;  4N47 A;  3CME N;  1TKZ A;  1IG8 A;  4JI5 K;  3PO4 A;  5FRM A;  4KI4 A;  5AQQ A;  4DKW A;  4H4O A;  1CXQ A;  1RTD A;  2A3Z A;  3D0P A;  3DM2 A;  4MDA A;  4W5N A;  3CFO A;  2P9K A;  1CLQ A;  3O3H A;  4BVP A;  4H4M A;  5E84 A;  1NK4 A;  3NGI A;  1VSI A;  4FWR A;  1FW6 A;  3OYJ A;  4LC9 B;  5BRE A;  1YAG A;  3R6M A;  3PO5 A;  3CC7 N;  4M41 A;  4B1Z A;  3K57 A;  4AHT A;  4CHZ A;  1NK5 A;  4KHN A;  2YI1 A;  3AV9 A;  4NB4 A;  4IFE A;  3QNN A;  3M8R A;  4I6M B;  4BC3 A;  3MN7 A;  2BUP A;  3UKU B;  1QVF M;  5F0X A;  4FJN A;  3F9K A;  1S72 N;  4FWQ A;  3ZSO A;  3LP2 A;  3LDN A;  4B1X B;  2ZGY A;  3WXJ A;  3ZX0 A;  3AVA A;  2QWP A;  3U8X A;  3U4L A;  3WEE A;  5C24 A;  3DYA A;  4HUF A;  3LL3 A;  3VEO A;  2FXU A;  1U48 A;  4JRP A;  1MA9 B;  4RW9 A;  4OPA A;  4FM0 A;  5AZI B;  4DSK A;  3VQP A;  1RT3 A;  1ZBS A;  4CD1 A;  1U04 A;  2D1K A;  4BC5 A;  2ATQ A;  4EHT A;  3CPE A;  2F9W A;  2D0P A;  2KW4 A;  3MXJ A;  1BUP A;  1BIS A;  3J7A P;  2VWJ A;  3SAG A;  1JL2 A;  4H0X B;  5AQP A;  1YUW A;  4BWJ A;  2VYP A;  5D3G A;  4YOT A;  3HJF A;  4PA1 A;  4F2R A;  2UXC K;  3DMJ A;  4OGC A;  4W5R A;  3ZSY A;  4KPY A;  1NGH A;  4O44 A;  3F73 A;  3NE6 A;  3O6W A;  3RMC A;  3SBT A;  1RBV A;  4QCL A;  1BA0 A;  3WQU A;  1D9F A;  2D0C A;  2RPI A;  3MXI A;  2IC3 A;  1BQM A;  4PY5 A;  1BCO A;  3KLE A;  1GOA A;  4JLH A;  3I8B A;  3QO9 A;  4FK4 A;  4F9O A;  4JN4 A;  1NWK A;  4N5S A;  1P90 A;  3K5N A;  3QER A;  3QIO A;  4C8M A;  4JHD B;  1RDB A;  2KZM A;  3EEQ A;  1WSH A;  4PHT X;  3L2Q A;  3WEE B;  1JLA A;  3FZF A;  1YJW N;  2ASP A;  2OZS A;  2G8U A;  2ASM A;  1KRP A;  3QEP A;  2P5O A;  4ILG B;  2QWR A;  3QDK A;  4PKI A;  4RCH A;  3AVF A;  4X65 K;  4DV4 K;  5BPM A;  4DV5 K;  3HL8 A;  2FSN A;  2YNI A;  2HST A;  3BF1 A;  1KAX A;  4RW7 A;  3D2E A;  4E19 A;  1NOZ A;  2W6L A;  2GTD A;  3HPO A;  1SZ2 A;  2GWJ A;  3D6R A;  2HBK A;  4LF8 K;  1JLF A;  1HYV A;  4CES A;  1JJ2 M;  3Q7B A;  3SAH A;  4BC4 A;  2IDO A;  2OAN A;  4J8F A;  3O80 A;  4M63 C;  4CEO A;  2KLA A;  5LMN K;  5KPZ A;  4A57 A;  2HW3 A;  1EO1 A;  2O4I A;  2YHA A;  2QI2 A;  4Z4H A;  3V1O A;  3FZM A;  4CZF A;  1SKR A;  1TKT A;  1X9W A;  2QWO A;  5C10 A;  1VQ8 N;  2NRH A;  1GLC G;  4B3S K;  2PAV A;  2VG7 A;  2XHB A;  4IOC L;  1YJN N;  1VRT A;  4NXN K;  2EHG A;  4DFM A;  2YKM A;  1JXB A;  3DXM A;  4H0P A;  2QEX N;  2E2Q A;  1C6V A;  2E2P A;  3VEZ A;  3P83 D;  2X74 A;  3EL2 A;  5I42 A;  3U6F A;  4FJJ A;  2HMI A;  3DOL A;  1TL3 A;  2Z1G A;  5CR4 A;  4LF6 K;  4WF9 L;  4B9U A;  3I33 A;  4CED A;  2Q31 A;  3K58 A;  3HOT A;  3VTH A;  3AO1 A;  5C0Y A;  3AO4 A;  2ZE2 A;  2BAN A;  2YHW A;  4JK9 A;  4FM1 A;  1GLB G;  4CF9 A;  4DR1 K;  4ZTJ A;  5MLC Q;  1HNW K;  2HVI A;  3HZ6 A;  4FLU A;  1RBU A;  3VEV A;  1Q86 O;  4BY9 C;  3E9P A;  2AP1 A;  3QFU A;  3OYB A;  2VCP A;  5AQV A;  4FW1 A;  5C12 A;  3QIP A;  1S9E A;  4MFB A;  4FJM A;  4B9L A;  2O8D A;  1NJI O;  1X9J A;  4YOY A;  3L2U A;  3NHG A;  1ASV A;  1GLJ O;  4YOU A;  4Q5V A;  2PY5 A;  1K8K B;  2P9S A;  1J5E K;  4DUZ K;  4CZI A;  1BIU A;  2QWM A;  4DTJ A;  2FBV A;  4N56 A;  1ITG A;  3EKS A;  4JEP A;  3TSQ A;  2HHU A;  4DR7 K;  3O4N A;  3SJJ A;  1TUU A;  2V7Y A;  4L8R B;  3OYM A;  5HBM A;  3O8M A;  3K5O A;  1S1V A;  4NCB A;  5M1F A;  4BE1 A;  1V4T A;  4K8X A;  2E1Z A;  3M3Z A;  4KTW A;  4OKE A;  3NFA A;  2FLO A;  4I9Q A;  4BGA A;  2ZWH A;  3T3F A;  5SWM A;  3LAM A;  1KVC A;  3O3F A;  4HUG A;  3ZT4 A;  2QW9 A;  4FWN A;  3RR7 A;  3M5R A;  4W5O A;  1U47 A;  4ISG A;  4DFK A;  1EXQ A;  5EY4 A;  4H0Y B;  2GUI A;  4LFC K;  1A5X A;  4CEZ A;  1VQM N;  4CHY A;  1XQS C;  3SAF A;  4NLC A;  4DSJ A;  1J6Z A;  1U2V B;  3QLH A;  1L5U A;  2NRW A;  4PKH A;  4MDB A;  4FM2 A;  1Y97 A;  4B9V A;  5FPM A;  4WQ4 C;  3TAE A;  4FOE A;  2BH1 A;  3SI6 A;  3ALY A;  2JGU A;  5KPR A;  4IJN A;  3K59 A;  1KLN A;  1HKB A;  4LSN A;  5K14 A;  1NGF A;  4JK7 A;  2IOC A;  4H5R A;  3HTV A;  4E1M A;  3ZT0 A;  1VQN N;  3QES A;  3D7E O;  5I3U A;  1GLF O;  3WNH A;  1TK8 A;  4CJU A; 
#chains in the Genus database with same CATH homology
 4DR1 K;  1HNW K;  4X66 K;  4GKJ K;  5IWA K;  4LFB K;  4LF5 K;  1HR0 K;  2UU9 K;  4LFA K;  4YHH K;  2ZM6 K;  4DR4 K;  3T1Y K;  1HNZ K;  2HHH K;  2UXB K;  4CW7 B;  4NXM K;  1I94 K;  4X65 K;  4DV4 K;  4DV6 K;  4DUZ K;  1J5E K;  4DV5 K;  4YY3 K;  4JI7 K;  4LF4 K;  1IBL K;  1N36 K;  2UUB K;  5FLX O;  4B3T K;  2E5L K;  4DR7 K;  4DV3 K;  4V19 S;  4GKK K;  4LF8 K;  3JAM O;  4DV7 K;  4JI0 K;  4X62 K;  4JI4 K;  1FJG K;  5LMN K;  5A2Q O;  4DR6 K;  2VQE K;  3J80 O;  1XMQ K;  3J7A P;  3T1H K;  2UUC K;  1HNX K;  5BR8 K;  4DR2 K;  3J81 O;  4KHP K;  4X64 K;  1XMO K;  4JI3 K;  2UXC K;  4B3S K;  5LMU K;  4LFC K;  2VQF K;  2F4V K;  5AJ3 K;  4K0K K;  4JI6 K;  4B3R K;  4NXN K;  1IBK K;  4DV0 K;  1N34 K;  4AQY K;  4DR5 K;  5IT9 O;  4DV1 K;  4JYA K;  1N32 K;  3OTO K;  2UXD K;  1IBM K;  4DUY K;  4JI2 K;  2UUA K;  4B3M K;  4JI8 K;  4LF6 K;  1XNR K;  3J7Y P;  4CVN E;  4OX9 K;  1N33 K;  4LF7 K;  1XNQ K;  4JI5 K;  4JI1 K;  4JV5 K;  5LL6 Z;  4DR3 K;  4LF9 K;  4DV2 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...