4AQYK

Structure of ribosome-apramycin complexes
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dissociation of Antibacterial Activity and Aminoglycoside Ototoxicity in the 4-Monosubstituted 2-Deoxystreptamine Apramycin.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 22
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2012-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4aqyK00
3T1YK 4CW7B 4CVNE 4DV2K 5BR8K 4LFAK 4YY3K 3J7YP 4JV5K 4LF9K 1J5EK 4JI5K 4DR1K 4V19S 4NXNK 1N32K 4DR5K 4JI0K 4JI6K 5FLXO 4DUYK 1XMOK 1FJGK 4GKKK 4JI7K 1XNQK 2UXCK 4NXMK 3J81O 1HNZK 2UUBK 4B3SK 1N33K 3T1HK 4X64K 4DR6K 4LF8K 1IBLK 1HNWK 2E5LK 4OX9K 4YHHK 4X65K 4JYAK 5AJ3K 2UUAK 2UUCK 4K0KK 4DV3K 3JAMO 4DR2K 4DV7K 4LF6K 4GKJK 4LF7K 4B3TK 4JI3K 4X66K 4DR4K 4LF4K 1IBKK 4LFBK 3OTOK 2ZM6K 1I94K 4JI4K 4KHPK 5LL6Z 4B3RK 4DR3K 4DR7K 1HR0K 2HHHK 3J80O 5LMUK 4DV1K 1N36K 4DV0K 4AQYK 5IT9O 4DUZK 4DV6K 2UU9K 1N34K 4B3MK 1IBMK 5A2QO 4JI1K 2VQEK 4JI8K 4JI2K 5IWAK 1XNRK 4DV4K 3J7AP 5LMNK 4LFCK 1XMQK 2UXDK 2VQFK 1HNXK 2F4VK 4X62K 2UXBK 4DV5K 4LF5K
chains in the Genus database with same CATH superfamily
3WXJA 1ZBFA 2ZJQL 4DV2K 4YY3K 3CIPA 1NU0A 3FZMA 3UKRB 1S9EA 3CMAN 2IDOA 3SPYA 3ULEA 4IEEA 3J8AA 5AQVA 5BREA 4BE1A 3O4WA 4V19S 4OPKA 3KLHA 1S1TA 2EX3A 3L0QA 1C0TA 1YTAA 5HLFA 1FJGK 4CF1A 4CHOA 3K5MA 2UXCK 4NXMK 3QICA 2PAVA 3CC4N 2QWQA 2Z1GA 1U47A 1X9SA 2QWPA 3SMSA 3CCRN 4O5BA 1EWRA 1OH7A 4O4GA 3T19A 1NMNA 2NRTA 1C0FA 3TTCA 2OTJN 2FF3B 4FWOA 4H5WA 4M7XA 4RW6A 2AJQA 5J2MA 3DM2A 5AQMA 4HVJA 4CJVA 5E41A 2A3ZA 3ZYYX 2KHOA 4ILHA 3CJBA 4CFCA 1ATSA 1RT3A 3MN6A 3T7ZA 3NGZA 4F2RA 4I9LA 2YJEA 3THYA 1CXUA 2IGIA 1DT9A 2DPNA 4BWJA 4PL7A 3KK2A 3HPGA 1RTJA 5T7BA 4M3XA 3RMDA 2OPQA 3ZCMA 2V7ZA 4HUGA 3BZKA 2VCPA 4BRPA 1N5YA 3L2WA 1SUQA 2HHHK 4IO8A 5HBMA 1T6DA 3ZSVA 2HVIA 2VGMA 3AVKA 3I55N 4O8KA 4CJSA 3G6EN 3KKSA 3MN9A 2ZQBA 2OZMA 2VG5A 1TYQA 2E1YA 4DV6K 3TSPA 3HYFA 3ID6A 5SZTA 1U2VA 3M8RA 5GAHP 2QI2A 1KRPA 3LP2A 4HTLA 1IO2A 2NRWA 3T69A 3NE6A 2UXDK 1GOCA 2Q1NA 3AARA 1UA0A 3RRGA 4JKGB 3RVCA 5C12A 2O8DB 1WAJA 2A1SA 3E01A 4LFAK 3DJCA 3FE1A 3UKUB 1BOTO 4WFNL 2QW9A 4OVLA 4NLBA 4L3QA 2ASPA 5HRSA 2FBYA 4L8RB 5CHIA 1D8YA 5MLCQ 1GLEG 1QTMA 1IKYA 2YKNA 3EE8A 5BN9A 4DR1K 4DTJA 5HRRA 3WXLA 3C94A 4KHQA 4EP5A 4WFAL 1IKVA 3SAGA 3SLCA 5ADXA 1VQKN 3TAQA 1ZC6A 4CERA 3KKRA 5CZ2A 4CK2A 1RBTA 1J54A 4K8ZA 2O8EB 3EO3A 4A2AA 4CF0A 3UB5A 1HNWK 4CZHA 1WBDA 4JK7A 4RG8A 4CK1A 3O4QA 1HLUA 4E1JA 1NBWA 4CJFA 4PKIA 2O8EA 5AQTA 2YNGA 4BRDA 4B3TK 4DFPA 1TK0A 1EO1A 3P5JA 1EXQA 1KFDA 3VA3A 1IBKK 4FJGA 2ZM6K 3QBWA 3HOSA 4IG3A 3LDQA 4CBWA 1LOTB 5CZ1A 4CHYA 2DFHA 3CG7A 1TYQB 2B6AA 3FZHA 4JN4A 2YHYA 3M5RA 3T3FA 1NGBA 3VQ8A 1RGIA 4I6MB 1YJWN 3MEEA 4B1UB 2Q0UA 4GY2B 5LJVA 1N34K 3C7NA 5BRFA 2WOMA 3SV3A 1KFSA 1MA9B 1QZ6A 3QIPA 2NUBA 2YNHA 1XNRK 3CQ8A 3I33A 1NNEA 2ETJA 1L3UA 4B1ZA 3OYCA 4KI6A 1W97L 3THYB 1NGHA 3THXB 3VETA 1ATRA 2OPSA 3RSEB 4CEDA 1SL2A 3J7ZO 3NH1A 4FOIA 1HNIA 3C6AA 1WB9A 5BN8A 3TTFA 5SWMA 2OZSA 5AQUA 4QS7A 4MO4A 4E7LA 2G8IA 3U8XA 4LF9K 1VQLN 1NK6A 5CY4A 5GINA 3AVMA 2E2NA 4LH5A 2Q97A 2B4JA 3ZT0A 4BC3A 2RN2A 3DRPA 3SNNA 3HXMA 4B3OA 3BY5A 4DUYK 1KXPA 1D5AA 1SKRA 4AHRA 3QESA 5GAGP 1WSGA 1M1KO 1QE1A 2UUBK 4BREA 1KAYA 4E19A 4OJRA 4WE1A 3OYKA 5JS2A 1YIJN 4FJMA 3VGLA 1IBLK 5FRNA 3S41A 4CHNA 2QWRA 4CJQA 3EL2A 1NMDA 4JKHA 2W6LA 3W0LA 1ZBSA 1UOCA 3LANA 4Z4HA 3KJVA 3QIOA 2ITMA 1NOYA 4OPJA 5J1EA 3SQ1A 4JYAK 5AJ3K 5KGWA 1S1VA 3AO2A 3MMVA 2RHKA 1SKSA 4PUOA 1NGFA 3LZJA 1BI4A 3K5LA 3O9SA 3CYMA 2ZJPL 3V9UA 5C24A 4I2PA 4MQ3A 1FKPA 4CJLA 4Q5VA 4FJJA 3QINA 3UE5A 4DR7K 2ASOA 3KLIA 2HBLA 4JLHA 1HNVA 4M3YA 2F8SA 4FLXA 1BIZA 1L3SA 4FJKA 4CIGA 1VSDA 3AVBA 4IEIA 2DFFA 4B3MK 3G4SN 4CI6A 4Z4IA 3CJAA 4BRHA 4FM0A 3V6DA 4B9LA 1GLDG 1B9DA 3HP6A 3PO5A 3MXJA 4CD3A 3MCAB 4BGAA 5DM6L 3O3GA 3I0SA 1K9MO 1YXQA 4CJTA 1DTQA 1NM1A 2F4VK 2P5OA 4DQPA 1MWKA 3OJSA 4MO5A 1LV5A 3CPEA 2J4RA 1YUWA 1SL1A 2HHQA 4B9UA 3T1YK 3CCQN 3OYGA 1B92A 3CETA 1NLVA 4Z0UA 2E1ZA 5AQWA 3GL1A 2RPIA 5F2RA 5EXWA 2W6KA 3QDKA 1RDBA 4YOUA 4KI4A 3CC2N 4J2BA 1NOZA 2I5JA 2G8FA 3NFAA 4CEQA 1G15A 2CH6A 4BDZA 2NNWA 3AO5A 4Z4GA 1QQMA 2XHBA 3SAHA 1XNQK 3J81O 4B1WB 5AFUA 4FPBA 4CBUA 3M8PA 5CYMA 5JLFA 4CEAA 4NCGA 1RBVA 3NCIA 4J8FA 1DTTA 3ULEB 3BDPA 3R3LA 3CHWA 4A57A 3OYHA 2O8DA 4HCBA 4X65K 3IRXA 5EX5A 4DQ8A 1EWQA 1VK0A 1V4TA 3OYNA 4DV7K 3CCLN 2V52B 3HTVA 1O13A 3QFUA 4FPAA 3ZSZA 4CD1A 3OBWA 3R9PA 1NK4A 3NBPA 3KLEA 4WF9L 3CJCA 3D6RA 5TKWA 2Q3SA 2OYQA 4KHYA 3IDHA 4DWIA 3J80O 3A5OC 2VWBA 1IG8A 5F1XA 4HWIA 4AHUA 3VQ4A 3HOTA 3VQ9A 3ULDA 1N36K 4AQYK 1Q8IA 1JXEA 3MWPA 4ILGB 3AVNA 1XHXA 2X6SA 5KQ8A 4JNEA 3HPOA 3GDQA 2BE2A 2O8BA 4FZYA 4JI2K 5B8HA 3HZ6A 3WEEA 3G71N 3PX0A 4WQ4C 5IWAK 4IFEA 2X78A 3THXA 1TUUA 5M1QA 2VWJA 3LDOA 4WFBL 3OYBA 2Q31A 4C1NI 2E4LA 4H0PA 5FPNA 1VQ9N 3K0SA 1Z05A 4CVNE 2HOEA 1D9DA 3QB0A 4BDYA 4MLEA 3ID8A 4FK2A 1X1PA 2KLAA 3VENA 4KTWA 3L2RA 1J5EK 3RMCA 1WNSA 3WQUA 3HM9A 4GVMA 2FF6A 1FXXA 5EY4A 5AQQA 3AO4A 3PX6A 3HK2A 2D0AA 3JSMA 3BGRA 4B3SK 4FJXA 3FFKB 2P9PB 2YX6A 1YJNN 2NRVA 4FJ7A 1HJRA 3PSIA 2E8AA 5KRSA 1HYZA 3OYAA 1C0GA 3TAPA 1CXQA 2CGKA 1FW6A 2OCEA 1TUYA 2P9LB 3SUOA 4DTNA 3TAGA 1KAXA 2KZZA 3NVMA 3EZWA 3IFRA 3O3HA 2UUAK 2A6AA 4O55A 4FWLA 3NF9A 3VQBA 1P90A 3AAQA 3PIOL 4FOEA 3HRGA 3DI6A 2WFBA 1BQMA 3OS1A 5I3UA 3VF4A 3K5NA 3CFOA 4JKEA 3TAFA 3CI5A 1NGIA 4RW8A 4KHPK 3O1BA 4NO7A 4B1VA 4CJ3A 3OS0A 4BVPA 1S1XA 4IDKA 3RMAA 4B1XB 4PY5A 4I6MA 4FCYA 3CCUN 3V9ZA 2QKBA 2DTUA 5D3GA 3I8BA 1S72N 2LSNA 1QZ5A 3O1WA 3FZKA 1TKZA 1K8KA 3LDSA 2P51A 3WXIA 2WONA 3ENHA 3LWMA 1QQNA 4DTXA 1NJZA 5CE3A 1M90O 1VSFA 1F21A 4LFCK 4DMNA 5BPNA 4I9QA 4E0DA 2NRRA 1ITGA 4B8CA 4DSIA 1LWFA 4CW7B 3LWLA 3C7NB 3DYAA 1TL1A 3P39A 3ZX0A 4FZXC 3O3FA 1DKGD 1HYVA 1LAWA 4DB3A 4JV5K 4KFBA 4F9OA 1QSSA 2D0BA 3MAQA 4I7FA 4XEIA 3HBTA 5HL7L 1VQ5N 1N32K 5AQIA 4F2SA 4CGJA 4LY7A 1WN7A 3NGYA 5AQSA 1ZBLA 3KLFA 3LP3A 3KK1A 5M1KA 4H0YB 1FKOA 4C23A 2O8FB 2AA4A 2HF4A 3NF6A 3VGMA 4ICLA 2Z1IA 2P9KB 3DLLL 1RT6A 4HHTA 4H4OA 4OX9K 4Y0WA 1RDDA 3IMXA 3LDNA 3CM5A 1KCFA 4H5RA 3KLGA 3A0IX 2KKZA 3IAYA 4LD0A 4JRQA 4DV3K 1EETA 4YDUA 4BR5A 1NKEA 4JKCA 3NH2A 4EAHD 4JI3K 1HJOA 2P9LA 3H3OB 3VESA 1GOBA 4RTFD 3JXUA 2ZE2A 1U48A 3GBTA 3G25A 4XH1A 3DXKB 3LPUA 2GWJA 3ZSXA 1K8KB 2GWKA 4DTUA 1TKTA 4O8UA 2YNFA 5K14A 4Y1DA 4DU1A 2GX9A 2ZWHA 3OYEA 4J2AA 1TVRA 1BI4B 2F9TA 4CJ5A 3MK6A 4JHDB 4M3TA 2VQEK 5C25A 1A5XA 2HBKA 3TARA 1A5WA 3ZEUA 2XY5A 3K9JA 3ZSRA 1JLFA 3O4NA 3AV9A 3C6HA 3GE1A 3CFRA 4CGGA 3CMEN 2VYPA 1I3AA 3SI6A 4AHVA 4W5RA 1CZ9A 3CJ7A 4E7KA 1HMVA 3FGUA 2Q0RA 3HI0A 4WQ5C 2UYTA 3S3OA 4EZ6A 2Z1JA 1NGDA 1BUPA 4YORA 3CCVN 1RT2A 1NKCA 4DQIA 3A8YA 2P9PA 2KW4A 1XMOK 1WBBA 4JKBA 2E2QA 2DY4A 2PYLA 3F9KA 5KPZA 2XRIA 4CZIA 1CZBA 4X64K 2QWNA 3VERA 4CF8A 4GV3A 1HKBA 1LAVA 2EWSA 2D0CA 1Z26A 2QKKA 1B9FA 4IXCA 4NLCA 3NGIA 4DHYA 4BG9A 5JICA 3LALA 1NK7A 1X3MA 1I39A 4BC2A 4K0KK 3JS6A 3WNGA 4KREA 3QMLA 4C8MA 1NK9A 5AZIA 1WSIA 3NDKA 3P38A 1LW2A 3AGRA 4O0IA 1S3XA 4N56A 3KK7A 4KHNA 4CEOA 3E1YA 1S9GA 5J2QA 1J9AA 3MXIA 1VQ7N 1Z25A 3OW2M 4Z4EA 4LSLA 3ITHA 4YDUC 2H3GX 2QA4N 1DLOA 4W5QA 2XY8A 5LMUK 5I9EB 4DV0K 3C95A 4LSNA 3LPTA 2IVPA 5AQNA 4KH4A 3TU5A 2JWKA 4B8AB 3DLGA 4O44A 3HO1A 1J5OA 1WSEA 2O8CB 3DLRA 3Q7BA 3QFPA 1C1BA 4H5VA 3CJ9A 5JMVA 2RKIA 3J7AP 4H03B 3ZT2A 3FR0A 4GMJB 4O0JA 4RCHA 1QHTA 5J2PA 3JYTA 4BRFA 3K9KA 3F9MA 4ISEA 1N8RO 4B9SA 1Q86O 3LM9A 2I7NA 4JRPA 4OPHA 4NB4A 4DTSA 2O4IA 5M1PA 4H8KA 4M3UA 4JS5A 3ZSWA 3DWLA 3E9PA 4YOXA 2CH5A 1GLAG 4FJHA 2ZGYA 2WC9A 4AM6A 1RT5A 3K5OA 4C8OA 2QM1A 4NXNK 1QQOA 4MDBA 4HUEA 4DS4A 4AH9A 2BANA 1EQYA 2KQ2A 4CESA 1XWLA 3AA2A 4BE0A 1Q81O 1RT1A 4XH4A 1SL0A 4GKKK 3D7EO 4JI7K 4JKAA 1U04A 5DK5A 3IUCA 1BDGA 4DR6K 4ELVA 3DXKA 2Z1HA 4NCBA 4FWNA 5DMRA 3S3NA 1YVUA 2IC3A 1ESVA 1ZBHA 1QSLA 2QK9A 1JXBA 3IS9A 4CEBA 4IFVA 4YHHK 3UKRA 5BR9A 3HVTA 2YHXA 3K59A 3DLEA 2YV0X 3ISNC 1RNHA 4MLHA 1L3VA 3JAMO 4KHWA 3TWHA 4FLZA 3H1VX 5AQKA 4GKJK 4DFJA 4FVUA 3GOIA 1IV0A 3BZCA 1QVFM 2BTFA 1MDUB 3VPZA 3OBYA 4CF9A 1X9WA 3TSUA 1K6YA 5AQGA 3A5MC 4BR2A 4JEPA 2ZJRL 1W2BM 3UIQA 5AQLA 4B9VA 4BRMA 4CZEA 4WQ5A 3R6MA 4C8LA 4I2QA 4B3RK 4CFDA 1LWCA 1J6ZA 3HP9A 2HHUA 3DRSA 1IG9A 2FSKA 1NGCA 2CGJA 3WNFA 3E9OA 2IAJA 4DG1A 5KGXA 5ADXH 1T6CA 3H45C 4BQLA 3WNHA 4CJ7A 3TAEA 3ZT4A 1TKXA 1X9JA 2QEXN 3O9QA 2WBNA 3VEXA 4DF8A 5FPEA 3U6FA 4FLVA 2G8UA 4BDPA 4K41A 1VSKA 4YOTA 1IH7A 1IJJA 4DTOA 3MWTA 2WUSA 3H6EA 4M41A 2A40A 3ZEUB 3OYMA 4IWVA 3SUPA 4K43A 1L3TA 1KVBA 4KRFA 4FO0A 2R7YA 2RE2A 2YHBA 3W3DA 1U45A 4FXDA 4JD2A 4LC9B 3M6GA 5JLHA 2I7PA 3D45A 5KQDA 3PY8A 5C0YA 2OANA 3E9LA 3FLCO 4UQGA 2XO7A 3V9XA 4W5TA 1ASVA 4KKOA 4DR5K 1R59O 4M63C 3QERA 4MFBA 4CFBA 3VQ7A 1P8ZA 4A5BA 3I8DA 4JD2B 3VQ6A 3EYZA 3LAMA 1HUXA 4O5FA 5HRPA 3OYLA 2HHWA 4LF8K 2B5JA 4FLWA 1JCEA 3VQQA 2HNYA 3B6PA 3EY1A 3VEVA 1VQ8N 1RDAA 3O9UA 2WTUA 3QEWA 3L3UA 3U4LA 3AVHA 1Q18A 3M3ZA 1C0MA 3KD1E 4DSLA 1KC8O 4RW9A 3SMPA 3D2FA 1NJWA 1WOQA 2V7YA 3AVAA 2D4WA 1CZAN 1TAQA 3P83D 3HPHA 4X66K 4UY8O 3SZ2A 3CCSN 2P9KA 4W5NA 2HBMA 3H1QA 4DQRA 3CCJN 3CJ1A 5EOYA 3ZX2A 3HT3A 2NRZA 2VGNA 1VQ6N 1VQPN 1ZXOA 1BU6O 1S6PA 3HSCA 4ZTFA 2KZMA 1FK9A 4CHQA 1XQSC 4EZ9A 3DLHA 3DRRA 1VQON 1RT7A 3V1QA 3ENOA 3QLHA 1Q9YA 5IT9O 1YVNA 1GLCG 1WAFA 3AA5X 1YT3A 1VRUA 3SYZA 3U9ZA 1WUAA 2DFEA 3VOVA 1Y97A 4OO1J 3CCMN 3SK3A 4Y1CA 4CJ4A 3AA4A 4DV4K 3B6OA 1KSPA 1TL3A 2OA8A 5AZIB 3R8EA 1JCFA 1C1CA 1Q7YO 4JHDA 5E84A 3L8BA 2F8TA 4BRGA 4CZJA 4BR7A 4OGCA 1KQSM 4IFYA 1D4XA 4A59A 3NAEA 1RFQA 1NK0A 3F5TA 3U9DA 4G9ZA 1BIUA 3RR7A 4CEZA 4N41A 4CJKA 5GIOA 3EZ5A 4BGBA 1BHLA 3MDQA 5AR0A 3ZX3A 2P9UA 1KLNA 3AVFA 2E5LK 3O08A 4FLTA 2E2PA 5KRTA 2PYJA 3WUHA 4W5OA 4DS5A 4AHTA 4OKJA 4E1NA 3TI0A 4LF7K 2E2OA 2OPPA 3ATUA 1G99A 1RTHA 5AZJA 4LFBK 3OTOK 1VSHA 2YI1A 5AQZA 4DFMA 1XI1A 1YTUA 2XY6A 1L5UA 5FPMA 4B1YB 3MN7A 3LAKA 2NRXA 4Q0BA 3F73A 2F9WA 4BRCA 1QVGM 4HUFA 2P1JA 1K73O 1HR0K 1NGEA 4IOCL 1YAGA 4E89A 3OYFA 3ZSOA 3CF5L 4KB0A 3CC7N 5GADP 1VQMN 1XUPO 1NWKA 3WXKA 4B9NA 3AA3A 3BP8A 1RT4A 1VSEA 3PSFA 2A41A 2FC0A 1VHXA 3FFIA 1JLEA 1WLJA 3HSTB 3I56N 3SQ4A 4BVOA 2VQFK 2BGGA 4QAGA 4JAXA 2OPRA 4FM2A 1GLFO 4FK0A 2QWMA 5C2DA 5EVZA 4AF1A 3ZSQA 1KAZA 3DOKA 5BR8K 2A42A 2ASMA 3AGKA 3C0BA 4EHTA 4DFKA 3I0RA 3OJUA 3ENBA 3QBXA 4BC4A 3MXMA 3LL3A 3WT0A 1RDWX 1DEJA 4FM1A 4BR4A 1KTQA 4AHSA 3VQCA 3SQ0A 1RDUA 2YCHA 1T3VA 4EHUA 2A1RA 5H1SQ 5M1OA 1Q82O 3KWGA 4A61A 4A62A 1RDCA 4OKKA 5AQPA 4XIUA 3V9SA 3ZT3A 4IKFA 1HNZK 4CJPA 1BL3A 4FJNA 3WNEA 2FSNA 3OHRA 4F8RA 5LJWA 5BPLA 1W0HA 3THWA 1HPMA 1BA1A 4PKHA 4DU3A 4XH5A 4OLAA 3D0PA 3NF8A 3LDPA 4MDAA 4DTPA 3BUZB 4M3WA 1ZBIA 5GIPA 1RILA 5F0XA 3SV4A 4DR2K 4DSEA 5C15A 1S1UA 3TANA 1QQCA 1YF5L 4BRIA 1HPZA 4IOXA 3O80A 1NK5A 3P31A 1WSJA 3ALYA 4M3ZA 4CIFA 4B9MA 1TKDA 1N6QA 2GUIA 4H5NA 2CGLA 4DU4A 3VGKA 5BPMA 2E88A 2VG7A 4AHCA 3VF6A 2KFNA 4JK9A 4JI8K 1T03A 4U7BA 1BCMA 4N5SA 4IO9L 3D2FB 4OGEA 4ISFA 2D5RA 1Y64A 4IZ9A 4K42A 3K2PA 3AVGA 4LF5K 3QO9A 3V1RA 4IJNA 1LW0A 2HW3A 4HCCA 1KVCA 4RW7A 3J7YP 3T1AA 4AM7A 2KFZA 1NGGA 2D0PA 5JVGL 1JCGA 1UA1A 4F3OA 3V81A 2Y1JA 4JS4A 2Q36A 1OKJA 3O9TA 4DCHA 3O5BA 1S22A 1RBUA 5FLXO 2HVHA 1E3MA 3QEIA 4DSJA 4EFHA 4CJWA 3LZIA 4CCHA 4BY9C 4QCLA 1VSJA 3AVCA 1SV5A 2ZGZA 3VQEA 2NLXA 3CQYA 1KD1O 5CYQA 2P9IA 3SBGA 2GELA 4BQZA 1GLLO 4DTRA 2JWLA 4FWSA 3KIOA 3TTDA 3EE9A 2P9SB 4J2DA 2HMIA 2HNDA 4G1QA 3LDLA 1D9FA 1XC3A 3DLKA 4OKEA 4FJLA 3NMUA 4HTUA 4FW1A 5AQYA 1O1WA 3HL8A 1CLQA 3PV8A 4LH4A 3P1GA 3ATVA 3KTQA 2QWLA 4FWPA 3MECA 3TABA 2P9NB 3VQAA 2PY5A 4BWMA 2O8CA 1WSFA 4ZHRA 3S3MA 3CM6A 3MCPA 1IKWA 1GLJO 4JK8A 3TR8A 4DV1K 1RTDA 3L3VA 1QS4A 1LWEA 1XHZA 2YKMA 2A5XA 2Q2RA 4NYFA 3O9RA 2XY7A 1ILYA 3MN5A 2F7TA 4IBNA 3E66A 3VEOA 2YHWA 4CHZA 1LCUA 3U3GA 2GTDA 2VWKA 3THVA 3ASMA 5LMNK 2BUPA 5EU7A 4BACA 1JLQA 1VRTA 4YNQA 4B08A 4FK4A 1RCHA 4DV5K 1YHQN 4KH6A 4KH5A 4EIAA 4FJIA 3MEDA 3BF1A 4FL9A 2HB5A 4IG0A 3ZETA 1ATNA 1U4BA 2G8VA 3VQ5A 2G8HA 5ELZA 4CJEA 1JLAA 3THWB 3S9HA 3A5NC 4QOZB 3DXMA 4JI5K 1ZBUA 1SKWA 5HRNA 4EP4A 4K8XA 3IKMA 3MX2A 3CERA 4IOAL 3G10A 3QEXA 4JI6K 3OYIA 1REVA 4TSXA 1NK8A 3FZLA 4H0VB 3TAMA 1BA0A 3T1HK 1TK5A 4M42A 2HHVA 3DOLA 2BDPA 1C1AA 4GNIA 4PWDA 3KZBA 1YJ9N 4OLBA 5BRHA 1HRHA 2W41A 3VMFB 2V51B 4B9QA 4FLYA 3QEPA 4CGIA 2ATQA 3HVRA 3AVJA 1BQNA 1BCOA 1S5JA 1ASUA 4KPYA 1U49A 2HMPA 2RF2A 4LF6K 4QS8A 3BEXA 3C6TA 3WEEB 3IG1A 4PKGA 4YOWA 4DR4K 2W42A 3H3NO 1V4SA 4AILC 4LF4K 4KHSA 3ZSYA 4H4MA 2ZF5O 4YFUA 3WXMB 1IKXA 4BR9A 4CZKA 2O8FA 2O4GA 1NKBA 2FXUA 4IDHA 4DF4A 4BRNA 4CJUA 4ZTJA 1VSLA 2QXLA 4CF2A 4A5AA 2E6LA 4YOYA 4FVMA 1GOAA 4R79A 4DTMA 2FLOA 4BRLA 3KK3A 1EX4A 3UKUA 2UU9K 2P5GA 3CPWM 3M1FA 2P9NA 5E26A 4FJ9A 5A2QO 4KHUA 2E6MA 2AP1A 4RW4A 3ZETB 1Z6RA 2FBXA 4N76A 1XMQK 5J2NA 2HHXA 1MU2A 3SAFA 4BR0A 1VQ4N 4CGHA 3OS2A 2W40A 4C8NA 1C6VA 3OVNA 3KWIA 5FROA 4NCAA 5TKYA 1EP4A 3L6QA 2KTQA 1UWBA 2QTDA 1OH8A 1NJIO 1JLCA 4ISGA 3HJFA 4H0OA 4CE9A 5M1FA 4ID1A 4DKWA 3L2VA 4DSFA 4Z4CA 3RRHA 1KVAA 3VEYA 1YITN 1JL2A 2YJFA 2QWOA 4M3RA 3LP0A 3CXCM 3EN9A 3SPZA 1T8EA 5C42A 4CGDA 2PZSA 5FPDA 1RBSA 3P4IA 3OYJA 3PO4A 4CIEA 4DQQA 5M1NA 2G8KA 5I42A 4H0TB 4JKFA 2HBJA 3VN5A 2HNZA 3NF7A 2IVNA 3SQ2A 3CQXA 3WQTA 4C8KA 4FLUA 3RSEA 2X74A 3KD5E 2FBTA 2P9SA 5JS1A 3R1XA 2G8WA 4KBOA 4CBXA 3D2EA 5AQFA 2P9IB 4PHTX 4FYDA 2QXFA 4GV9A 1JLBA 5BRDA 5LY3A 4ILJA 5AQOA 1T7PA 1VAZA 3G0ZA 3NHGA 3OA9A 3D2EB 4H5TA 2D0OA 4KTQA 1W7AA 2EHGA 4ELTA 4CJRA 5AZJB 5AQXA 5AQHA 4N47A 3Q7CA 2HHSA 1SAZA 1S1WA 3QNNA 4DLGA 3K58A 1S6QA 4FWMA 4CZFA 2IIRA 1HKGA 4FWQA 1A5VA 1UAXA 5C10A 1H1VA 3QETA 2IVOA 4BC5A 2UXBK 3C65A 3A2FA 1JKHA 2O8BB 4QS9A 2FSJA 1U2VB 4E7JA 4DLEA 3OY9A 4B9TA 2BH1A 1QSYA 5KPRA 2X6NA 1OVYA 1HKCA 2JLEA 3AO3A 4PL8A 4BG8A 2PBDA 4CK3A 3TSQA 4BE2A 2P9UB 3SJHA 1E4FT 3M8QA 4KV8A 3PLAA 3VTHA 1HQEA 1TK8A 3O6WA 4ELUA 4CHPA 4E3SA 3BF3A 3CCEN 1T05A 3L2QA 4PQUA 3MX5A 4C1NK 1Q9XA 5DM7L 2OTLN 1OH6A 4KTZA 2GEMA 3DXMB 2D1KA 3L4IA 3LM2A 4JKDA 3VQDA 4CZLA 2F96A 3B8AX 1QHAA 4FWRA 4M7YA 4BROA 2ZD1A 3RTVA 1W9HA 3QEVA 2GBZA 1HX1A 2UUCK 1EKEA 4JKGA 1GLBG 4F4KA 3V9WA 4DSKA 4CGFA 3RMBA 1YI2N 1OH5A 3AVIA 3RWUA 1C0UA 3AAPA 2ITGA 3VTIA 1BWFO 3O8MA 3CD6N 4E7IA 1WSHA 3PIPL 3SUNA 1VSIA 4JI4K 4E7HA 1TV6A 3DAWA 5AQRA 1U6ZA 2IOCA 4K25A 3U3YA 1MWMA 2Y1IA 1BG3A 1E4GT 1X9MA 3EKUA 1K8AO 2IS3A 3PX4A 3NVKA 5FDLA 2E20A 2JGUA 3H08A 1IBMK 1BISA 4JI1K 4CFAA 3F2KA 4WQ4A 1NJYA 3VQPA 4E1MA 1R0AA 2FBVA 4U67L 4Z4FA 1VSMA 3AO1A 1HNXK 4CEFA 4X62K 3A5LC 2HHTA 1BGXT 4IJAA 1RBRA 1OVQA 3N4QA 3AVLA 3V1OA 4WYBA 3C6UA 4R5PA 3VEWA 1NGJA 5GAEP 3HM8A 3RR8A 3DMJA 1HQUA 4M45A 3DLBA 1X3NA 1TGOA 1NG9A 2GV9A 1JLGA 4FSVA 4JI0K 1SS6A 3NH0A 2HF3A 2NRHA 3VF2A 2HSTA 3QNOA 1BO5O 4FJ5A 1N33K 3PUFA 3MEGA 4GW6A 4Z94A 1J53A 4GV6A 3H46O 1XC9A 4NYNA 3L2UA 4A2BA 3FZFA 4KB1A 4FW2A 3V4IA 3ZLJA 1NGAA 3SBTA 3TPQA 3LP1A 5FRMA 4KAZA 1ASWA 4YOVA 3VEZA 2YHAA 4OPAA 1KLMA 1DGKN 1SQKA 5HP1A 2PFUA 2GUPA 4DQSA 5C2FA 3AY9A 4FZZA 1NJXA 4CZMA 4J2EA 5HROA 1SZ2A 4CZGA 4CECA 3K57A 3L4QA 3EEQA 3SUQA 3SCXA 1RTIA 1I94K 3M8SA 5AQJA 5LL6Z 5HOOA 4CEEA 1TAUA 1T44A 5AFUH 4DR3K 3KVGA 2VG6A 5KTQA 4PA1A 5CR4A 1HYSA 2NZTA 4WCEL 3KHYA 2YNIA 1VQNN 4DUZK 3VA0A 3OYDA 5JVHL 1JJ2M 3SJJA 4FWKA 3ZT1A 5KPTA 3CFPA 4FJ8A 4H0XB 4BRQA 4RWTA 1JL1A 5KI6A 4GVEA 4F3TA 4KO0A 3GG4A 1ZYQA 4ID5A 4BRKA 3EKSA 4BRAA 3N4PA
chains in the Genus database with same CATH topology
3T1YK 4CW7B 4CVNE 4DV2K 5BR8K 4LFAK 4YY3K 3J7YP 4JV5K 4LF9K 1J5EK 4JI5K 4DR1K 4V19S 4NXNK 1N32K 4DR5K 4JI0K 4JI6K 5FLXO 4DUYK 1XMOK 1FJGK 4GKKK 4JI7K 1XNQK 2UXCK 4NXMK 3J81O 1HNZK 2UUBK 4B3SK 1N33K 3T1HK 4X64K 4DR6K 4LF8K 1IBLK 1HNWK 2E5LK 4OX9K 4YHHK 4X65K 4JYAK 5AJ3K 2UUAK 2UUCK 4K0KK 4DV3K 3JAMO 4DR2K 4DV7K 4LF6K 4GKJK 4LF7K 4B3TK 4JI3K 4X66K 4DR4K 4LF4K 1IBKK 4LFBK 3OTOK 2ZM6K 1I94K 4JI4K 4KHPK 5LL6Z 4B3RK 4DR3K 4DR7K 1HR0K 2HHHK 3J80O 5LMUK 4DV1K 1N36K 4DV0K 4AQYK 5IT9O 4DUZK 4DV6K 2UU9K 1N34K 4B3MK 1IBMK 5A2QO 4JI1K 2VQEK 4JI8K 4JI2K 5IWAK 1XNRK 4DV4K 3J7AP 5LMNK 4LFCK 1XMQK 2UXDK 2VQFK 1HNXK 2F4VK 4X62K 2UXBK 4DV5K 4LF5K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T1Y K;  4CW7 B;  4CVN E;  4DV2 K;  5BR8 K;  4LFA K;  4YY3 K;  3J7Y P;  4JV5 K;  4LF9 K;  1J5E K;  4JI5 K;  4DR1 K;  4V19 S;  4NXN K;  1N32 K;  4DR5 K;  4JI0 K;  4JI6 K;  5FLX O;  4DUY K;  1XMO K;  1FJG K;  4GKK K;  4JI7 K;  1XNQ K;  2UXC K;  4NXM K;  3J81 O;  1HNZ K;  2UUB K;  4B3S K;  1N33 K;  3T1H K;  4X64 K;  4DR6 K;  4LF8 K;  1IBL K;  1HNW K;  2E5L K;  4OX9 K;  4YHH K;  4X65 K;  4JYA K;  5AJ3 K;  2UUA K;  2UUC K;  4K0K K;  4DV3 K;  3JAM O;  4DR2 K;  4DV7 K;  4LF6 K;  4GKJ K;  4LF7 K;  4B3T K;  4JI3 K;  4X66 K;  4DR4 K;  4LF4 K;  1IBK K;  4LFB K;  3OTO K;  2ZM6 K;  1I94 K;  4JI4 K;  4KHP K;  5LL6 Z;  4B3R K;  4DR3 K;  4DR7 K;  1HR0 K;  2HHH K;  3J80 O;  5LMU K;  4DV1 K;  1N36 K;  4DV0 K;  4AQY K;  5IT9 O;  4DUZ K;  4DV6 K;  2UU9 K;  1N34 K;  4B3M K;  1IBM K;  5A2Q O;  4JI1 K;  2VQE K;  4JI8 K;  4JI2 K;  5IWA K;  1XNR K;  4DV4 K;  3J7A P;  5LMN K;  4LFC K;  1XMQ K;  2UXD K;  2VQF K;  1HNX K;  2F4V K;  4X62 K;  2UXB K;  4DV5 K;  4LF5 K; 
#chains in the Genus database with same CATH topology
 3WXJ A;  1ZBF A;  2ZJQ L;  4DV2 K;  4YY3 K;  3CIP A;  1NU0 A;  3FZM A;  3UKR B;  1S9E A;  3CMA N;  2IDO A;  3SPY A;  3ULE A;  4IEE A;  3J8A A;  5AQV A;  5BRE A;  4BE1 A;  3O4W A;  4V19 S;  4OPK A;  3KLH A;  1S1T A;  2EX3 A;  3L0Q A;  1C0T A;  1YTA A;  5HLF A;  1FJG K;  4CF1 A;  4CHO A;  3K5M A;  2UXC K;  4NXM K;  3QIC A;  2PAV A;  3CC4 N;  2QWQ A;  2Z1G A;  1U47 A;  1X9S A;  2QWP A;  3SMS A;  3CCR N;  4O5B A;  1EWR A;  1OH7 A;  4O4G A;  3T19 A;  1NMN A;  2NRT A;  1C0F A;  3TTC A;  2OTJ N;  2FF3 B;  4FWO A;  4H5W A;  4M7X A;  4RW6 A;  2AJQ A;  5J2M A;  3DM2 A;  5AQM A;  4HVJ A;  4CJV A;  5E41 A;  2A3Z A;  3ZYY X;  2KHO A;  4ILH A;  3CJB A;  4CFC A;  1ATS A;  1RT3 A;  3MN6 A;  3T7Z A;  3NGZ A;  4F2R A;  4I9L A;  2YJE A;  3THY A;  1CXU A;  2IGI A;  1DT9 A;  2DPN A;  4BWJ A;  4PL7 A;  3KK2 A;  3HPG A;  1RTJ A;  5T7B A;  4M3X A;  3RMD A;  2OPQ A;  3ZCM A;  2V7Z A;  4HUG A;  3BZK A;  2VCP A;  4BRP A;  1N5Y A;  3L2W A;  1SUQ A;  2HHH K;  4IO8 A;  5HBM A;  1T6D A;  3ZSV A;  2HVI A;  2VGM A;  3AVK A;  3I55 N;  4O8K A;  4CJS A;  3G6E N;  3KKS A;  3MN9 A;  2ZQB A;  2OZM A;  2VG5 A;  1TYQ A;  2E1Y A;  4DV6 K;  3TSP A;  3HYF A;  3ID6 A;  5SZT A;  1U2V A;  3M8R A;  5GAH P;  2QI2 A;  1KRP A;  3LP2 A;  4HTL A;  1IO2 A;  2NRW A;  3T69 A;  3NE6 A;  2UXD K;  1GOC A;  2Q1N A;  3AAR A;  1UA0 A;  3RRG A;  4JKG B;  3RVC A;  5C12 A;  2O8D B;  1WAJ A;  2A1S A;  3E01 A;  4LFA K;  3DJC A;  3FE1 A;  3UKU B;  1BOT O;  4WFN L;  2QW9 A;  4OVL A;  4NLB A;  4L3Q A;  2ASP A;  5HRS A;  2FBY A;  4L8R B;  5CHI A;  1D8Y A;  5MLC Q;  1GLE G;  1QTM A;  1IKY A;  2YKN A;  3EE8 A;  5BN9 A;  4DR1 K;  4DTJ A;  5HRR A;  3WXL A;  3C94 A;  4KHQ A;  4EP5 A;  4WFA L;  1IKV A;  3SAG A;  3SLC A;  5ADX A;  1VQK N;  3TAQ A;  1ZC6 A;  4CER A;  3KKR A;  5CZ2 A;  4CK2 A;  1RBT A;  1J54 A;  4K8Z A;  2O8E B;  3EO3 A;  4A2A A;  4CF0 A;  3UB5 A;  1HNW K;  4CZH A;  1WBD A;  4JK7 A;  4RG8 A;  4CK1 A;  3O4Q A;  1HLU A;  4E1J A;  1NBW A;  4CJF A;  4PKI A;  2O8E A;  5AQT A;  2YNG A;  4BRD A;  4B3T K;  4DFP A;  1TK0 A;  1EO1 A;  3P5J A;  1EXQ A;  1KFD A;  3VA3 A;  1IBK K;  4FJG A;  2ZM6 K;  3QBW A;  3HOS A;  4IG3 A;  3LDQ A;  4CBW A;  1LOT B;  5CZ1 A;  4CHY A;  2DFH A;  3CG7 A;  1TYQ B;  2B6A A;  3FZH A;  4JN4 A;  2YHY A;  3M5R A;  3T3F A;  1NGB A;  3VQ8 A;  1RGI A;  4I6M B;  1YJW N;  3MEE A;  4B1U B;  2Q0U A;  4GY2 B;  5LJV A;  1N34 K;  3C7N A;  5BRF A;  2WOM A;  3SV3 A;  1KFS A;  1MA9 B;  1QZ6 A;  3QIP A;  2NUB A;  2YNH A;  1XNR K;  3CQ8 A;  3I33 A;  1NNE A;  2ETJ A;  1L3U A;  4B1Z A;  3OYC A;  4KI6 A;  1W97 L;  3THY B;  1NGH A;  3THX B;  3VET A;  1ATR A;  2OPS A;  3RSE B;  4CED A;  1SL2 A;  3J7Z O;  3NH1 A;  4FOI A;  1HNI A;  3C6A A;  1WB9 A;  5BN8 A;  3TTF A;  5SWM A;  2OZS A;  5AQU A;  4QS7 A;  4MO4 A;  4E7L A;  2G8I A;  3U8X A;  4LF9 K;  1VQL N;  1NK6 A;  5CY4 A;  5GIN A;  3AVM A;  2E2N A;  4LH5 A;  2Q97 A;  2B4J A;  3ZT0 A;  4BC3 A;  2RN2 A;  3DRP A;  3SNN A;  3HXM A;  4B3O A;  3BY5 A;  4DUY K;  1KXP A;  1D5A A;  1SKR A;  4AHR A;  3QES A;  5GAG P;  1WSG A;  1M1K O;  1QE1 A;  2UUB K;  4BRE A;  1KAY A;  4E19 A;  4OJR A;  4WE1 A;  3OYK A;  5JS2 A;  1YIJ N;  4FJM A;  3VGL A;  1IBL K;  5FRN A;  3S41 A;  4CHN A;  2QWR A;  4CJQ A;  3EL2 A;  1NMD A;  4JKH A;  2W6L A;  3W0L A;  1ZBS A;  1UOC A;  3LAN A;  4Z4H A;  3KJV A;  3QIO A;  2ITM A;  1NOY A;  4OPJ A;  5J1E A;  3SQ1 A;  4JYA K;  5AJ3 K;  5KGW A;  1S1V A;  3AO2 A;  3MMV A;  2RHK A;  1SKS A;  4PUO A;  1NGF A;  3LZJ A;  1BI4 A;  3K5L A;  3O9S A;  3CYM A;  2ZJP L;  3V9U A;  5C24 A;  4I2P A;  4MQ3 A;  1FKP A;  4CJL A;  4Q5V A;  4FJJ A;  3QIN A;  3UE5 A;  4DR7 K;  2ASO A;  3KLI A;  2HBL A;  4JLH A;  1HNV A;  4M3Y A;  2F8S A;  4FLX A;  1BIZ A;  1L3S A;  4FJK A;  4CIG A;  1VSD A;  3AVB A;  4IEI A;  2DFF A;  4B3M K;  3G4S N;  4CI6 A;  4Z4I A;  3CJA A;  4BRH A;  4FM0 A;  3V6D A;  4B9L A;  1GLD G;  1B9D A;  3HP6 A;  3PO5 A;  3MXJ A;  4CD3 A;  3MCA B;  4BGA A;  5DM6 L;  3O3G A;  3I0S A;  1K9M O;  1YXQ A;  4CJT A;  1DTQ A;  1NM1 A;  2F4V K;  2P5O A;  4DQP A;  1MWK A;  3OJS A;  4MO5 A;  1LV5 A;  3CPE A;  2J4R A;  1YUW A;  1SL1 A;  2HHQ A;  4B9U A;  3T1Y K;  3CCQ N;  3OYG A;  1B92 A;  3CET A;  1NLV A;  4Z0U A;  2E1Z A;  5AQW A;  3GL1 A;  2RPI A;  5F2R A;  5EXW A;  2W6K A;  3QDK A;  1RDB A;  4YOU A;  4KI4 A;  3CC2 N;  4J2B A;  1NOZ A;  2I5J A;  2G8F A;  3NFA A;  4CEQ A;  1G15 A;  2CH6 A;  4BDZ A;  2NNW A;  3AO5 A;  4Z4G A;  1QQM A;  2XHB A;  3SAH A;  1XNQ K;  3J81 O;  4B1W B;  5AFU A;  4FPB A;  4CBU A;  3M8P A;  5CYM A;  5JLF A;  4CEA A;  4NCG A;  1RBV A;  3NCI A;  4J8F A;  1DTT A;  3ULE B;  3BDP A;  3R3L A;  3CHW A;  4A57 A;  3OYH A;  2O8D A;  4HCB A;  4X65 K;  3IRX A;  5EX5 A;  4DQ8 A;  1EWQ A;  1VK0 A;  1V4T A;  3OYN A;  4DV7 K;  3CCL N;  2V52 B;  3HTV A;  1O13 A;  3QFU A;  4FPA A;  3ZSZ A;  4CD1 A;  3OBW A;  3R9P A;  1NK4 A;  3NBP A;  3KLE A;  4WF9 L;  3CJC A;  3D6R A;  5TKW A;  2Q3S A;  2OYQ A;  4KHY A;  3IDH A;  4DWI A;  3J80 O;  3A5O C;  2VWB A;  1IG8 A;  5F1X A;  4HWI A;  4AHU A;  3VQ4 A;  3HOT A;  3VQ9 A;  3ULD A;  1N36 K;  4AQY K;  1Q8I A;  1JXE A;  3MWP A;  4ILG B;  3AVN A;  1XHX A;  2X6S A;  5KQ8 A;  4JNE A;  3HPO A;  3GDQ A;  2BE2 A;  2O8B A;  4FZY A;  4JI2 K;  5B8H A;  3HZ6 A;  3WEE A;  3G71 N;  3PX0 A;  4WQ4 C;  5IWA K;  4IFE A;  2X78 A;  3THX A;  1TUU A;  5M1Q A;  2VWJ A;  3LDO A;  4WFB L;  3OYB A;  2Q31 A;  4C1N I;  2E4L A;  4H0P A;  5FPN A;  1VQ9 N;  3K0S A;  1Z05 A;  4CVN E;  2HOE A;  1D9D A;  3QB0 A;  4BDY A;  4MLE A;  3ID8 A;  4FK2 A;  1X1P A;  2KLA A;  3VEN A;  4KTW A;  3L2R A;  1J5E K;  3RMC A;  1WNS A;  3WQU A;  3HM9 A;  4GVM A;  2FF6 A;  1FXX A;  5EY4 A;  5AQQ A;  3AO4 A;  3PX6 A;  3HK2 A;  2D0A A;  3JSM A;  3BGR A;  4B3S K;  4FJX A;  3FFK B;  2P9P B;  2YX6 A;  1YJN N;  2NRV A;  4FJ7 A;  1HJR A;  3PSI A;  2E8A A;  5KRS A;  1HYZ A;  3OYA A;  1C0G A;  3TAP A;  1CXQ A;  2CGK A;  1FW6 A;  2OCE A;  1TUY A;  2P9L B;  3SUO A;  4DTN A;  3TAG A;  1KAX A;  2KZZ A;  3NVM A;  3EZW A;  3IFR A;  3O3H A;  2UUA K;  2A6A A;  4O55 A;  4FWL A;  3NF9 A;  3VQB A;  1P90 A;  3AAQ A;  3PIO L;  4FOE A;  3HRG A;  3DI6 A;  2WFB A;  1BQM A;  3OS1 A;  5I3U A;  3VF4 A;  3K5N A;  3CFO A;  4JKE A;  3TAF A;  3CI5 A;  1NGI A;  4RW8 A;  4KHP K;  3O1B A;  4NO7 A;  4B1V A;  4CJ3 A;  3OS0 A;  4BVP A;  1S1X A;  4IDK A;  3RMA A;  4B1X B;  4PY5 A;  4I6M A;  4FCY A;  3CCU N;  3V9Z A;  2QKB A;  2DTU A;  5D3G A;  3I8B A;  1S72 N;  2LSN A;  1QZ5 A;  3O1W A;  3FZK A;  1TKZ A;  1K8K A;  3LDS A;  2P51 A;  3WXI A;  2WON A;  3ENH A;  3LWM A;  1QQN A;  4DTX A;  1NJZ A;  5CE3 A;  1M90 O;  1VSF A;  1F21 A;  4LFC K;  4DMN A;  5BPN A;  4I9Q A;  4E0D A;  2NRR A;  1ITG A;  4B8C A;  4DSI A;  1LWF A;  4CW7 B;  3LWL A;  3C7N B;  3DYA A;  1TL1 A;  3P39 A;  3ZX0 A;  4FZX C;  3O3F A;  1DKG D;  1HYV A;  1LAW A;  4DB3 A;  4JV5 K;  4KFB A;  4F9O A;  1QSS A;  2D0B A;  3MAQ A;  4I7F A;  4XEI A;  3HBT A;  5HL7 L;  1VQ5 N;  1N32 K;  5AQI A;  4F2S A;  4CGJ A;  4LY7 A;  1WN7 A;  3NGY A;  5AQS A;  1ZBL A;  3KLF A;  3LP3 A;  3KK1 A;  5M1K A;  4H0Y B;  1FKO A;  4C23 A;  2O8F B;  2AA4 A;  2HF4 A;  3NF6 A;  3VGM A;  4ICL A;  2Z1I A;  2P9K B;  3DLL L;  1RT6 A;  4HHT A;  4H4O A;  4OX9 K;  4Y0W A;  1RDD A;  3IMX A;  3LDN A;  3CM5 A;  1KCF A;  4H5R A;  3KLG A;  3A0I X;  2KKZ A;  3IAY A;  4LD0 A;  4JRQ A;  4DV3 K;  1EET A;  4YDU A;  4BR5 A;  1NKE A;  4JKC A;  3NH2 A;  4EAH D;  4JI3 K;  1HJO A;  2P9L A;  3H3O B;  3VES A;  1GOB A;  4RTF D;  3JXU A;  2ZE2 A;  1U48 A;  3GBT A;  3G25 A;  4XH1 A;  3DXK B;  3LPU A;  2GWJ A;  3ZSX A;  1K8K B;  2GWK A;  4DTU A;  1TKT A;  4O8U A;  2YNF A;  5K14 A;  4Y1D A;  4DU1 A;  2GX9 A;  2ZWH A;  3OYE A;  4J2A A;  1TVR A;  1BI4 B;  2F9T A;  4CJ5 A;  3MK6 A;  4JHD B;  4M3T A;  2VQE K;  5C25 A;  1A5X A;  2HBK A;  3TAR A;  1A5W A;  3ZEU A;  2XY5 A;  3K9J A;  3ZSR A;  1JLF A;  3O4N A;  3AV9 A;  3C6H A;  3GE1 A;  3CFR A;  4CGG A;  3CME N;  2VYP A;  1I3A A;  3SI6 A;  4AHV A;  4W5R A;  1CZ9 A;  3CJ7 A;  4E7K A;  1HMV A;  3FGU A;  2Q0R A;  3HI0 A;  4WQ5 C;  2UYT A;  3S3O A;  4EZ6 A;  2Z1J A;  1NGD A;  1BUP A;  4YOR A;  3CCV N;  1RT2 A;  1NKC A;  4DQI A;  3A8Y A;  2P9P A;  2KW4 A;  1XMO K;  1WBB A;  4JKB A;  2E2Q A;  2DY4 A;  2PYL A;  3F9K A;  5KPZ A;  2XRI A;  4CZI A;  1CZB A;  4X64 K;  2QWN A;  3VER A;  4CF8 A;  4GV3 A;  1HKB A;  1LAV A;  2EWS A;  2D0C A;  1Z26 A;  2QKK A;  1B9F A;  4IXC A;  4NLC A;  3NGI A;  4DHY A;  4BG9 A;  5JIC A;  3LAL A;  1NK7 A;  1X3M A;  1I39 A;  4BC2 A;  4K0K K;  3JS6 A;  3WNG A;  4KRE A;  3QML A;  4C8M A;  1NK9 A;  5AZI A;  1WSI A;  3NDK A;  3P38 A;  1LW2 A;  3AGR A;  4O0I A;  1S3X A;  4N56 A;  3KK7 A;  4KHN A;  4CEO A;  3E1Y A;  1S9G A;  5J2Q A;  1J9A A;  3MXI A;  1VQ7 N;  1Z25 A;  3OW2 M;  4Z4E A;  4LSL A;  3ITH A;  4YDU C;  2H3G X;  2QA4 N;  1DLO A;  4W5Q A;  2XY8 A;  5LMU K;  5I9E B;  4DV0 K;  3C95 A;  4LSN A;  3LPT A;  2IVP A;  5AQN A;  4KH4 A;  3TU5 A;  2JWK A;  4B8A B;  3DLG A;  4O44 A;  3HO1 A;  1J5O A;  1WSE A;  2O8C B;  3DLR A;  3Q7B A;  3QFP A;  1C1B A;  4H5V A;  3CJ9 A;  5JMV A;  2RKI A;  3J7A P;  4H03 B;  3ZT2 A;  3FR0 A;  4GMJ B;  4O0J A;  4RCH A;  1QHT A;  5J2P A;  3JYT A;  4BRF A;  3K9K A;  3F9M A;  4ISE A;  1N8R O;  4B9S A;  1Q86 O;  3LM9 A;  2I7N A;  4JRP A;  4OPH A;  4NB4 A;  4DTS A;  2O4I A;  5M1P A;  4H8K A;  4M3U A;  4JS5 A;  3ZSW A;  3DWL A;  3E9P A;  4YOX A;  2CH5 A;  1GLA G;  4FJH A;  2ZGY A;  2WC9 A;  4AM6 A;  1RT5 A;  3K5O A;  4C8O A;  2QM1 A;  4NXN K;  1QQO A;  4MDB A;  4HUE A;  4DS4 A;  4AH9 A;  2BAN A;  1EQY A;  2KQ2 A;  4CES A;  1XWL A;  3AA2 A;  4BE0 A;  1Q81 O;  1RT1 A;  4XH4 A;  1SL0 A;  4GKK K;  3D7E O;  4JI7 K;  4JKA A;  1U04 A;  5DK5 A;  3IUC A;  1BDG A;  4DR6 K;  4ELV A;  3DXK A;  2Z1H A;  4NCB A;  4FWN A;  5DMR A;  3S3N A;  1YVU A;  2IC3 A;  1ESV A;  1ZBH A;  1QSL A;  2QK9 A;  1JXB A;  3IS9 A;  4CEB A;  4IFV A;  4YHH K;  3UKR A;  5BR9 A;  3HVT A;  2YHX A;  3K59 A;  3DLE A;  2YV0 X;  3ISN C;  1RNH A;  4MLH A;  1L3V A;  3JAM O;  4KHW A;  3TWH A;  4FLZ A;  3H1V X;  5AQK A;  4GKJ K;  4DFJ A;  4FVU A;  3GOI A;  1IV0 A;  3BZC A;  1QVF M;  2BTF A;  1MDU B;  3VPZ A;  3OBY A;  4CF9 A;  1X9W A;  3TSU A;  1K6Y A;  5AQG A;  3A5M C;  4BR2 A;  4JEP A;  2ZJR L;  1W2B M;  3UIQ A;  5AQL A;  4B9V A;  4BRM A;  4CZE A;  4WQ5 A;  3R6M A;  4C8L A;  4I2Q A;  4B3R K;  4CFD A;  1LWC A;  1J6Z A;  3HP9 A;  2HHU A;  3DRS A;  1IG9 A;  2FSK A;  1NGC A;  2CGJ A;  3WNF A;  3E9O A;  2IAJ A;  4DG1 A;  5KGX A;  5ADX H;  1T6C A;  3H45 C;  4BQL A;  3WNH A;  4CJ7 A;  3TAE A;  3ZT4 A;  1TKX A;  1X9J A;  2QEX N;  3O9Q A;  2WBN A;  3VEX A;  4DF8 A;  5FPE A;  3U6F A;  4FLV A;  2G8U A;  4BDP A;  4K41 A;  1VSK A;  4YOT A;  1IH7 A;  1IJJ A;  4DTO A;  3MWT A;  2WUS A;  3H6E A;  4M41 A;  2A40 A;  3ZEU B;  3OYM A;  4IWV A;  3SUP A;  4K43 A;  1L3T A;  1KVB A;  4KRF A;  4FO0 A;  2R7Y A;  2RE2 A;  2YHB A;  3W3D A;  1U45 A;  4FXD A;  4JD2 A;  4LC9 B;  3M6G A;  5JLH A;  2I7P A;  3D45 A;  5KQD A;  3PY8 A;  5C0Y A;  2OAN A;  3E9L A;  3FLC O;  4UQG A;  2XO7 A;  3V9X A;  4W5T A;  1ASV A;  4KKO A;  4DR5 K;  1R59 O;  4M63 C;  3QER A;  4MFB A;  4CFB A;  3VQ7 A;  1P8Z A;  4A5B A;  3I8D A;  4JD2 B;  3VQ6 A;  3EYZ A;  3LAM A;  1HUX A;  4O5F A;  5HRP A;  3OYL A;  2HHW A;  4LF8 K;  2B5J A;  4FLW A;  1JCE A;  3VQQ A;  2HNY A;  3B6P A;  3EY1 A;  3VEV A;  1VQ8 N;  1RDA A;  3O9U A;  2WTU A;  3QEW A;  3L3U A;  3U4L A;  3AVH A;  1Q18 A;  3M3Z A;  1C0M A;  3KD1 E;  4DSL A;  1KC8 O;  4RW9 A;  3SMP A;  3D2F A;  1NJW A;  1WOQ A;  2V7Y A;  3AVA A;  2D4W A;  1CZA N;  1TAQ A;  3P83 D;  3HPH A;  4X66 K;  4UY8 O;  3SZ2 A;  3CCS N;  2P9K A;  4W5N A;  2HBM A;  3H1Q A;  4DQR A;  3CCJ N;  3CJ1 A;  5EOY A;  3ZX2 A;  3HT3 A;  2NRZ A;  2VGN A;  1VQ6 N;  1VQP N;  1ZXO A;  1BU6 O;  1S6P A;  3HSC A;  4ZTF A;  2KZM A;  1FK9 A;  4CHQ A;  1XQS C;  4EZ9 A;  3DLH A;  3DRR A;  1VQO N;  1RT7 A;  3V1Q A;  3ENO A;  3QLH A;  1Q9Y A;  5IT9 O;  1YVN A;  1GLC G;  1WAF A;  3AA5 X;  1YT3 A;  1VRU A;  3SYZ A;  3U9Z A;  1WUA A;  2DFE A;  3VOV A;  1Y97 A;  4OO1 J;  3CCM N;  3SK3 A;  4Y1C A;  4CJ4 A;  3AA4 A;  4DV4 K;  3B6O A;  1KSP A;  1TL3 A;  2OA8 A;  5AZI B;  3R8E A;  1JCF A;  1C1C A;  1Q7Y O;  4JHD A;  5E84 A;  3L8B A;  2F8T A;  4BRG A;  4CZJ A;  4BR7 A;  4OGC A;  1KQS M;  4IFY A;  1D4X A;  4A59 A;  3NAE A;  1RFQ A;  1NK0 A;  3F5T A;  3U9D A;  4G9Z A;  1BIU A;  3RR7 A;  4CEZ A;  4N41 A;  4CJK A;  5GIO A;  3EZ5 A;  4BGB A;  1BHL A;  3MDQ A;  5AR0 A;  3ZX3 A;  2P9U A;  1KLN A;  3AVF A;  2E5L K;  3O08 A;  4FLT A;  2E2P A;  5KRT A;  2PYJ A;  3WUH A;  4W5O A;  4DS5 A;  4AHT A;  4OKJ A;  4E1N A;  3TI0 A;  4LF7 K;  2E2O A;  2OPP A;  3ATU A;  1G99 A;  1RTH A;  5AZJ A;  4LFB K;  3OTO K;  1VSH A;  2YI1 A;  5AQZ A;  4DFM A;  1XI1 A;  1YTU A;  2XY6 A;  1L5U A;  5FPM A;  4B1Y B;  3MN7 A;  3LAK A;  2NRX A;  4Q0B A;  3F73 A;  2F9W A;  4BRC A;  1QVG M;  4HUF A;  2P1J A;  1K73 O;  1HR0 K;  1NGE A;  4IOC L;  1YAG A;  4E89 A;  3OYF A;  3ZSO A;  3CF5 L;  4KB0 A;  3CC7 N;  5GAD P;  1VQM N;  1XUP O;  1NWK A;  3WXK A;  4B9N A;  3AA3 A;  3BP8 A;  1RT4 A;  1VSE A;  3PSF A;  2A41 A;  2FC0 A;  1VHX A;  3FFI A;  1JLE A;  1WLJ A;  3HST B;  3I56 N;  3SQ4 A;  4BVO A;  2VQF K;  2BGG A;  4QAG A;  4JAX A;  2OPR A;  4FM2 A;  1GLF O;  4FK0 A;  2QWM A;  5C2D A;  5EVZ A;  4AF1 A;  3ZSQ A;  1KAZ A;  3DOK A;  5BR8 K;  2A42 A;  2ASM A;  3AGK A;  3C0B A;  4EHT A;  4DFK A;  3I0R A;  3OJU A;  3ENB A;  3QBX A;  4BC4 A;  3MXM A;  3LL3 A;  3WT0 A;  1RDW X;  1DEJ A;  4FM1 A;  4BR4 A;  1KTQ A;  4AHS A;  3VQC A;  3SQ0 A;  1RDU A;  2YCH A;  1T3V A;  4EHU A;  2A1R A;  5H1S Q;  5M1O A;  1Q82 O;  3KWG A;  4A61 A;  4A62 A;  1RDC A;  4OKK A;  5AQP A;  4XIU A;  3V9S A;  3ZT3 A;  4IKF A;  1HNZ K;  4CJP A;  1BL3 A;  4FJN A;  3WNE A;  2FSN A;  3OHR A;  4F8R A;  5LJW A;  5BPL A;  1W0H A;  3THW A;  1HPM A;  1BA1 A;  4PKH A;  4DU3 A;  4XH5 A;  4OLA A;  3D0P A;  3NF8 A;  3LDP A;  4MDA A;  4DTP A;  3BUZ B;  4M3W A;  1ZBI A;  5GIP A;  1RIL A;  5F0X A;  3SV4 A;  4DR2 K;  4DSE A;  5C15 A;  1S1U A;  3TAN A;  1QQC A;  1YF5 L;  4BRI A;  1HPZ A;  4IOX A;  3O80 A;  1NK5 A;  3P31 A;  1WSJ A;  3ALY A;  4M3Z A;  4CIF A;  4B9M A;  1TKD A;  1N6Q A;  2GUI A;  4H5N A;  2CGL A;  4DU4 A;  3VGK A;  5BPM A;  2E88 A;  2VG7 A;  4AHC A;  3VF6 A;  2KFN A;  4JK9 A;  4JI8 K;  1T03 A;  4U7B A;  1BCM A;  4N5S A;  4IO9 L;  3D2F B;  4OGE A;  4ISF A;  2D5R A;  1Y64 A;  4IZ9 A;  4K42 A;  3K2P A;  3AVG A;  4LF5 K;  3QO9 A;  3V1R A;  4IJN A;  1LW0 A;  2HW3 A;  4HCC A;  1KVC A;  4RW7 A;  3J7Y P;  3T1A A;  4AM7 A;  2KFZ A;  1NGG A;  2D0P A;  5JVG L;  1JCG A;  1UA1 A;  4F3O A;  3V81 A;  2Y1J A;  4JS4 A;  2Q36 A;  1OKJ A;  3O9T A;  4DCH A;  3O5B A;  1S22 A;  1RBU A;  5FLX O;  2HVH A;  1E3M A;  3QEI A;  4DSJ A;  4EFH A;  4CJW A;  3LZI A;  4CCH A;  4BY9 C;  4QCL A;  1VSJ A;  3AVC A;  1SV5 A;  2ZGZ A;  3VQE A;  2NLX A;  3CQY A;  1KD1 O;  5CYQ A;  2P9I A;  3SBG A;  2GEL A;  4BQZ A;  1GLL O;  4DTR A;  2JWL A;  4FWS A;  3KIO A;  3TTD A;  3EE9 A;  2P9S B;  4J2D A;  2HMI A;  2HND A;  4G1Q A;  3LDL A;  1D9F A;  1XC3 A;  3DLK A;  4OKE A;  4FJL A;  3NMU A;  4HTU A;  4FW1 A;  5AQY A;  1O1W A;  3HL8 A;  1CLQ A;  3PV8 A;  4LH4 A;  3P1G A;  3ATV A;  3KTQ A;  2QWL A;  4FWP A;  3MEC A;  3TAB A;  2P9N B;  3VQA A;  2PY5 A;  4BWM A;  2O8C A;  1WSF A;  4ZHR A;  3S3M A;  3CM6 A;  3MCP A;  1IKW A;  1GLJ O;  4JK8 A;  3TR8 A;  4DV1 K;  1RTD A;  3L3V A;  1QS4 A;  1LWE A;  1XHZ A;  2YKM A;  2A5X A;  2Q2R A;  4NYF A;  3O9R A;  2XY7 A;  1ILY A;  3MN5 A;  2F7T A;  4IBN A;  3E66 A;  3VEO A;  2YHW A;  4CHZ A;  1LCU A;  3U3G A;  2GTD A;  2VWK A;  3THV A;  3ASM A;  5LMN K;  2BUP A;  5EU7 A;  4BAC A;  1JLQ A;  1VRT A;  4YNQ A;  4B08 A;  4FK4 A;  1RCH A;  4DV5 K;  1YHQ N;  4KH6 A;  4KH5 A;  4EIA A;  4FJI A;  3MED A;  3BF1 A;  4FL9 A;  2HB5 A;  4IG0 A;  3ZET A;  1ATN A;  1U4B A;  2G8V A;  3VQ5 A;  2G8H A;  5ELZ A;  4CJE A;  1JLA A;  3THW B;  3S9H A;  3A5N C;  4QOZ B;  3DXM A;  4JI5 K;  1ZBU A;  1SKW A;  5HRN A;  4EP4 A;  4K8X A;  3IKM A;  3MX2 A;  3CER A;  4IOA L;  3G10 A;  3QEX A;  4JI6 K;  3OYI A;  1REV A;  4TSX A;  1NK8 A;  3FZL A;  4H0V B;  3TAM A;  1BA0 A;  3T1H K;  1TK5 A;  4M42 A;  2HHV A;  3DOL A;  2BDP A;  1C1A A;  4GNI A;  4PWD A;  3KZB A;  1YJ9 N;  4OLB A;  5BRH A;  1HRH A;  2W41 A;  3VMF B;  2V51 B;  4B9Q A;  4FLY A;  3QEP A;  4CGI A;  2ATQ A;  3HVR A;  3AVJ A;  1BQN A;  1BCO A;  1S5J A;  1ASU A;  4KPY A;  1U49 A;  2HMP A;  2RF2 A;  4LF6 K;  4QS8 A;  3BEX A;  3C6T A;  3WEE B;  3IG1 A;  4PKG A;  4YOW A;  4DR4 K;  2W42 A;  3H3N O;  1V4S A;  4AIL C;  4LF4 K;  4KHS A;  3ZSY A;  4H4M A;  2ZF5 O;  4YFU A;  3WXM B;  1IKX A;  4BR9 A;  4CZK A;  2O8F A;  2O4G A;  1NKB A;  2FXU A;  4IDH A;  4DF4 A;  4BRN A;  4CJU A;  4ZTJ A;  1VSL A;  2QXL A;  4CF2 A;  4A5A A;  2E6L A;  4YOY A;  4FVM A;  1GOA A;  4R79 A;  4DTM A;  2FLO A;  4BRL A;  3KK3 A;  1EX4 A;  3UKU A;  2UU9 K;  2P5G A;  3CPW M;  3M1F A;  2P9N A;  5E26 A;  4FJ9 A;  5A2Q O;  4KHU A;  2E6M A;  2AP1 A;  4RW4 A;  3ZET B;  1Z6R A;  2FBX A;  4N76 A;  1XMQ K;  5J2N A;  2HHX A;  1MU2 A;  3SAF A;  4BR0 A;  1VQ4 N;  4CGH A;  3OS2 A;  2W40 A;  4C8N A;  1C6V A;  3OVN A;  3KWI A;  5FRO A;  4NCA A;  5TKY A;  1EP4 A;  3L6Q A;  2KTQ A;  1UWB A;  2QTD A;  1OH8 A;  1NJI O;  1JLC A;  4ISG A;  3HJF A;  4H0O A;  4CE9 A;  5M1F A;  4ID1 A;  4DKW A;  3L2V A;  4DSF A;  4Z4C A;  3RRH A;  1KVA A;  3VEY A;  1YIT N;  1JL2 A;  2YJF A;  2QWO A;  4M3R A;  3LP0 A;  3CXC M;  3EN9 A;  3SPZ A;  1T8E A;  5C42 A;  4CGD A;  2PZS A;  5FPD A;  1RBS A;  3P4I A;  3OYJ A;  3PO4 A;  4CIE A;  4DQQ A;  5M1N A;  2G8K A;  5I42 A;  4H0T B;  4JKF A;  2HBJ A;  3VN5 A;  2HNZ A;  3NF7 A;  2IVN A;  3SQ2 A;  3CQX A;  3WQT A;  4C8K A;  4FLU A;  3RSE A;  2X74 A;  3KD5 E;  2FBT A;  2P9S A;  5JS1 A;  3R1X A;  2G8W A;  4KBO A;  4CBX A;  3D2E A;  5AQF A;  2P9I B;  4PHT X;  4FYD A;  2QXF A;  4GV9 A;  1JLB A;  5BRD A;  5LY3 A;  4ILJ A;  5AQO A;  1T7P A;  1VAZ A;  3G0Z A;  3NHG A;  3OA9 A;  3D2E B;  4H5T A;  2D0O A;  4KTQ A;  1W7A A;  2EHG A;  4ELT A;  4CJR A;  5AZJ B;  5AQX A;  5AQH A;  4N47 A;  3Q7C A;  2HHS A;  1SAZ A;  1S1W A;  3QNN A;  4DLG A;  3K58 A;  1S6Q A;  4FWM A;  4CZF A;  2IIR A;  1HKG A;  4FWQ A;  1A5V A;  1UAX A;  5C10 A;  1H1V A;  3QET A;  2IVO A;  4BC5 A;  2UXB K;  3C65 A;  3A2F A;  1JKH A;  2O8B B;  4QS9 A;  2FSJ A;  1U2V B;  4E7J A;  4DLE A;  3OY9 A;  4B9T A;  2BH1 A;  1QSY A;  5KPR A;  2X6N A;  1OVY A;  1HKC A;  2JLE A;  3AO3 A;  4PL8 A;  4BG8 A;  2PBD A;  4CK3 A;  3TSQ A;  4BE2 A;  2P9U B;  3SJH A;  1E4F T;  3M8Q A;  4KV8 A;  3PLA A;  3VTH A;  1HQE A;  1TK8 A;  3O6W A;  4ELU A;  4CHP A;  4E3S A;  3BF3 A;  3CCE N;  1T05 A;  3L2Q A;  4PQU A;  3MX5 A;  4C1N K;  1Q9X A;  5DM7 L;  2OTL N;  1OH6 A;  4KTZ A;  2GEM A;  3DXM B;  2D1K A;  3L4I A;  3LM2 A;  4JKD A;  3VQD A;  4CZL A;  2F96 A;  3B8A X;  1QHA A;  4FWR A;  4M7Y A;  4BRO A;  2ZD1 A;  3RTV A;  1W9H A;  3QEV A;  2GBZ A;  1HX1 A;  2UUC K;  1EKE A;  4JKG A;  1GLB G;  4F4K A;  3V9W A;  4DSK A;  4CGF A;  3RMB A;  1YI2 N;  1OH5 A;  3AVI A;  3RWU A;  1C0U A;  3AAP A;  2ITG A;  3VTI A;  1BWF O;  3O8M A;  3CD6 N;  4E7I A;  1WSH A;  3PIP L;  3SUN A;  1VSI A;  4JI4 K;  4E7H A;  1TV6 A;  3DAW A;  5AQR A;  1U6Z A;  2IOC A;  4K25 A;  3U3Y A;  1MWM A;  2Y1I A;  1BG3 A;  1E4G T;  1X9M A;  3EKU A;  1K8A O;  2IS3 A;  3PX4 A;  3NVK A;  5FDL A;  2E20 A;  2JGU A;  3H08 A;  1IBM K;  1BIS A;  4JI1 K;  4CFA A;  3F2K A;  4WQ4 A;  1NJY A;  3VQP A;  4E1M A;  1R0A A;  2FBV A;  4U67 L;  4Z4F A;  1VSM A;  3AO1 A;  1HNX K;  4CEF A;  4X62 K;  3A5L C;  2HHT A;  1BGX T;  4IJA A;  1RBR A;  1OVQ A;  3N4Q A;  3AVL A;  3V1O A;  4WYB A;  3C6U A;  4R5P A;  3VEW A;  1NGJ A;  5GAE P;  3HM8 A;  3RR8 A;  3DMJ A;  1HQU A;  4M45 A;  3DLB A;  1X3N A;  1TGO A;  1NG9 A;  2GV9 A;  1JLG A;  4FSV A;  4JI0 K;  1SS6 A;  3NH0 A;  2HF3 A;  2NRH A;  3VF2 A;  2HST A;  3QNO A;  1BO5 O;  4FJ5 A;  1N33 K;  3PUF A;  3MEG A;  4GW6 A;  4Z94 A;  1J53 A;  4GV6 A;  3H46 O;  1XC9 A;  4NYN A;  3L2U A;  4A2B A;  3FZF A;  4KB1 A;  4FW2 A;  3V4I A;  3ZLJ A;  1NGA A;  3SBT A;  3TPQ A;  3LP1 A;  5FRM A;  4KAZ A;  1ASW A;  4YOV A;  3VEZ A;  2YHA A;  4OPA A;  1KLM A;  1DGK N;  1SQK A;  5HP1 A;  2PFU A;  2GUP A;  4DQS A;  5C2F A;  3AY9 A;  4FZZ A;  1NJX A;  4CZM A;  4J2E A;  5HRO A;  1SZ2 A;  4CZG A;  4CEC A;  3K57 A;  3L4Q A;  3EEQ A;  3SUQ A;  3SCX A;  1RTI A;  1I94 K;  3M8S A;  5AQJ A;  5LL6 Z;  5HOO A;  4CEE A;  1TAU A;  1T44 A;  5AFU H;  4DR3 K;  3KVG A;  2VG6 A;  5KTQ A;  4PA1 A;  5CR4 A;  1HYS A;  2NZT A;  4WCE L;  3KHY A;  2YNI A;  1VQN N;  4DUZ K;  3VA0 A;  3OYD A;  5JVH L;  1JJ2 M;  3SJJ A;  4FWK A;  3ZT1 A;  5KPT A;  3CFP A;  4FJ8 A;  4H0X B;  4BRQ A;  4RWT A;  1JL1 A;  5KI6 A;  4GVE A;  4F3T A;  4KO0 A;  3GG4 A;  1ZYQ A;  4ID5 A;  4BRK A;  3EKS A;  4BRA A;  3N4P A; 
#chains in the Genus database with same CATH homology
 3T1Y K;  4CW7 B;  4CVN E;  4DV2 K;  5BR8 K;  4LFA K;  4YY3 K;  3J7Y P;  4JV5 K;  4LF9 K;  1J5E K;  4JI5 K;  4DR1 K;  4V19 S;  4NXN K;  1N32 K;  4DR5 K;  4JI0 K;  4JI6 K;  5FLX O;  4DUY K;  1XMO K;  1FJG K;  4GKK K;  4JI7 K;  1XNQ K;  2UXC K;  4NXM K;  3J81 O;  1HNZ K;  2UUB K;  4B3S K;  1N33 K;  3T1H K;  4X64 K;  4DR6 K;  4LF8 K;  1IBL K;  1HNW K;  2E5L K;  4OX9 K;  4YHH K;  4X65 K;  4JYA K;  5AJ3 K;  2UUA K;  2UUC K;  4K0K K;  4DV3 K;  3JAM O;  4DR2 K;  4DV7 K;  4LF6 K;  4GKJ K;  4LF7 K;  4B3T K;  4JI3 K;  4X66 K;  4DR4 K;  4LF4 K;  1IBK K;  4LFB K;  3OTO K;  2ZM6 K;  1I94 K;  4JI4 K;  4KHP K;  5LL6 Z;  4B3R K;  4DR3 K;  4DR7 K;  1HR0 K;  2HHH K;  3J80 O;  5LMU K;  4DV1 K;  1N36 K;  4DV0 K;  4AQY K;  5IT9 O;  4DUZ K;  4DV6 K;  2UU9 K;  1N34 K;  4B3M K;  1IBM K;  5A2Q O;  4JI1 K;  2VQE K;  4JI8 K;  4JI2 K;  5IWA K;  1XNR K;  4DV4 K;  3J7A P;  5LMN K;  4LFC K;  1XMQ K;  2UXD K;  2VQF K;  1HNX K;  2F4V K;  4X62 K;  2UXB K;  4DV5 K;  4LF5 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...