1Y97A

The human trex2 3' exonuclease structure suggests a mechanism for efficient non-processive dna catalysis
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
230
structure length
214
Chain Sequence
AGMSEAPRAETFVFLDLEATGLPSVEPEIAELSLFAVHRSSLENPEHGALVLPRVLDKLTLCMCPERPFTAKASEITGLSSEGLARCRKAGFDGAVVRTLQAFLSRQAGPICLVAHNGFDYDFPLLCAELRRLGARLPRDTVCLDTLPALRGLDRAHGYSLGSLFHRYFRAEPSSAEGDVHTLLLIFLHRAAELLAWADEQARGWAHIEPMYLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Three prime repair exonuclease 2
publication title The Human TREX2 3' -> 5'-Exonuclease Structure Suggests a Mechanism for Efficient Nonprocessive DNA Catalysis.
pubmed doi rcsb
source organism Homo sapiens
total genus 66
structure length 214
sequence length 230
chains with identical sequence B
ec nomenclature ec 3.1.11.2: Exodeoxyribonuclease III.
pdb deposition date 2004-12-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1y97A01
3DLRA 3KK3A 2PY5A 4Z4IA 1MU2A 1WSHA 2ZD1A 3ALYA 4M42A 1TV6A 3HJFA 1QSSA 3LP3A 4FJKA 3SQ2A 4Y1CA 2D0BA 3EY1A 1YT3A 3PX6A 2O4GA 4OPJA 1BGXT 3NGIA 4KI6A 3QNOA 3QIPA 3VQPA 3OYGA 2JLEA 2PYJA 3ZSYA 1RBTA 4BWMA 3QEVA 4IG3A 4B9NA 1RBRA 1QHTA 3AVIA 2OPRA 4C8NA 4CK1A 3OYLA 3S3NA 4CEOA 3HPHA 4DFPA 4FK4A 1RT4A 2KZMA 1D5AA 3AVFA 3OYHA 2G8VA 3C6TA 5FDLA 4CEAA 1D8YA 4DQPA 3TI0A 3KLEA 2XY8A 5DK5A 4QOZB 2ETJA 3PX4A 4KREA 5HP1A 3TARA 1NKCA 4RW4A 3PX0A 3PO5A 4C8KA 3U3GA 1RT2A 3C95A 3TAGA 2FBVA 3TAFA 4CEBA 4C8OA 4DFJA 3OY9A 1X9WA 2EX3A 3QEXA 4CHQA 3NF9A 1CZ9A 4KB0A 1RBSA 1A5XA 2IC3A 1VSJA 1DTTA 1LWEA 3VQEA 4Q0BA 4M3TA 4K8ZA 5KGWA 4CF2A 3EZ5A 1QTMA 1Q9XA 4ID1A 3AVBA 2GUIA 2QKKA 2D0AA 2XY6A 4KTWA 4RW8A 3TR8A 4DSJA 1CXQA 3KKRA 4OGEA 1HQEA 1S5JA 1KLMA 4Q5VA 3KD5E 4FM0A 3OYIA 3SZ2A 4KHSA 4FJXA 3MEDA 3QETA 2F8SA 2BANA 1LAWA 3ZT2A 1JLBA 3L2UA 3TWHA 4DSFA 1GOCA 3OYKA 2Y1JA 4DSLA 2O4IA 2G8UA 2FC0A 4J2BA 1WAJA 3ASMA 3DLEA 2XHBA 4KTZA 2E6MA 3P83D 3U3YA 2KTQA 3K57A 1GOAA 2GBZA 4H8KA 3ZSZA 2W42A 3TABA 1NKEA 3IAYA 4FK2A 1K6YA 1VSDA 3DLBA 2XY5A 1HNIA 3IRXA 4N41A 2HHSA 4QCLA 2HHXA 3VA0A 4FLTA 4CESA 5HLFA 1VSHA 4ZTJA 1TGOA 4PA1A 2G8KA 2BGGA 1SL2A 1L3VA 3CM5A 4KV8A 3V9XA 5JS2A 4CJ3A 4O44A 3DRRA 2F8TA 2IGIA 1RBVA 4CGGA 1J5OA 4J2DA 4DQRA 1Q9YA 3ZSVA 3WNEA 4Z4EA 1F21A 4FZXC 4AHRA 3QIOA 3AVAA 3ZT3A 2IS3A 1JLGA 2X78A 1ASUA 5HBMA 1TKTA 1XC9A 4EZ9A 4HUGA 1TVRA 2Z1GA 3LPUA 1KVCA 1N6QA 1O1WA 3NH2A 4DTSA 3DLHA 1A5VA 4M3WA 4CK3A 2KQ2A 4KFBA 3VQCA 4JRPA 4C8LA 2KFZA 3G10A 1UA1A 2R7YA 3HVTA 3AVKA 3M8QA 4J2AA 4GVMA 4CGFA 4N76A 4ICLA 2HMIA 1TKXA 1J54A 1RDDA 4B8AB 4CEQA 2A1RA 2D0CA 1NJXA 3OS0A 4BE1A 1L3SA 3HK2A 1VSKA 3ITHA 3AVMA 3HVRA 1IKXA 1U48A 1RDBA 4FJIA 3LWMA 1FKOA 4ZHRA 2ZQBA 1QQCA 4DTPA 4CHNA 2P51A 4N56A 2I5JA 4M41A 4CF9A 3V9ZA 1U04A 4CJ4A 3LALA 1C0MA 4M3RA 3SCXA 1JLAA 1BQMA 3AO3A 4YFUA 2Y1IA 1U47A 4I9QA 4PUOA 3SUQA 1RILA 4KB1A 3AA3A 4NYFA 1NOYA 4HVJA 1BI4B 3L3UA 1C6VA 1LW0A 4OKEA 4DU3A 2G8IA 2HHTA 1C0TA 3LP2A 2DFHA 4FJJA 1DTQA 1LWFA 3AA5X 4W5OA 4HHTA 3SYZA 4BE0A 1TK5A 3ZSQA 5KI6A 1JXBA 2VWKA 4KKOA 1EETA 4E7HA 2Z1HA 1X1PA 2WOMA 4CGHA 2YNFA 4DTOA 1EX4A 4KPYA 4FLXA 1W0HA 3TAMA 3T1AA 3V4IA 3K2PA 3LAMA 1S6QA 3AO5A 4FLUA 3NE6A 3MXMA 1KLNA 3THVA 4XIUA 1Z26A 4HCBA 4RW6A 4CGIA 2FBTA 1C1BA 2YNIA 4CF8A 4CF1A 4C8MA 4CHZA 4DQIA 1VSFA 1WSGA 1S1VA 1RT5A 4O55A 3QEWA 3H08A 4AH9A 3T3FA 2KZZA 2HHVA 5CY4A 1RNHA 3KIOA 4FJ7A 4O0IA 4Y1DA 4DMNA 3O3FA 4CCHA 4J2EA 1HYSA 2YNHA 2FBYA 3HSTB 3MEEA 4I2PA 4KI4A 1WNSA 1BCMA 3CFRA 3HPOA 3KLIA 5FROA 1BISA 4B3OA 5C25A 4M3ZA 2RPIA 3AVHA 3DM2A 3O4NA 3SV3A 4F8RA 1BCOA 3PO4A 4E1NA 1D9DA 2YNGA 2Z1JA 3MXIA 4OGCA 1N5YA 4M45A 4FJHA 5C42A 1SKWA 1REVA 4AHCA 2IOCA 2XY7A 2KFNA 4KRFA 1WAFA 4CEEA 2X6NA 1FXXA 3SUNA 4FJMA 1YTUA 4BDYA 1W9HA 4CJWA 3RMDA 4I9LA 3LPTA 3CYMA 4DF4A 3DLKA 2E4LA 1WN7A 3VQ7A 4BWJA 4CJ5A 1YVUA 4AHSA 4DG1A 4FVMA 1HRHA 4AHTA 1KFSA 3AO4A 4OLBA 4IFYA 3B6OA 1ZBLA 1VSMA 3CFPA 3ZSXA 3SI6A 5HRRA 4DU1A 2HHUA 1EKEA 1IH7A 1KSPA 2PYLA 5CZ1A 4EP4A 3G0ZA 3QEIA 4IFVA 4Z4HA 1HQUA 2HB5A 4KHNA 1T03A 1WSJA 1DLOA 2RF2A 3LP0A 1KFDA 4NCGA 1C1CA 4HUFA 1B92A 4RW9A 5HRNA 1BIUA 3VA3A 1TKZA 5SWMA 2DFFA 1S9GA 4FLVA 3JSMA 3V9WA 4DQSA 5I42A 4PWDA 1IG9A 4CJEA 1XWLA 3L3VA 4CERA 4HUEA 4K8XA 3U6FA 4RW7A 4MQ3A 1UAXA 1B9FA 4BDPA 3P1GA 4CJFA 2D5RA 4OLAA 2HW3A 1QSYA 1BI4A 1JLCA 2LSNA 3E01A 3KTQA 3K59A 1WSEA 3AVCA 4B9TA 4H4OA 1VRTA 3DOKA 3KLFA 4CJUA 4CGJA 4BE2A 3AA2A 3CFOA 2ITGA 3SQ0A 1CXUA 2P1JA 4E7KA 1T8EA 4DSKA 3AVJA 4DS5A 2HVHA 5DMRA 4R5PA 4CFCA 5E41A 2VWJA 1HMVA 1HJRA 4CIGA 4DWIA 4Z4GA 1S1XA 4E7JA 4KTQA 1ITGA 3NGYA 3NCIA 4OJRA 3M8SA 4CK2A 4BDZA 1RT3A 5KGXA 1S6PA 3NBPA 4FJ5A 3SPYA 3A2FA 3VQ8A 4FLYA 3DI6A 1SKRA 1L3TA 5HRSA 3OYJA 5I3UA 1SL1A 1T7PA 2HVIA 3VQAA 1CLQA 4CF0A 5J2PA 1WSIA 3HXMA 4DSIA 1QSLA 3F9KA 4E19A 3ZSRA 5CYMA 3RMCA 1RT7A 3I0SA 1TK0A 3AVLA 3PUFA 3KK1A 4CJSA 3SPZA 2G8HA 4M3UA 1ZBUA 5CYQA 3L2WA 1EXQA 3LWLA 4EP5A 2OZSA 4FW1A 1RDAA 3ZT0A 1HPZA 1NK5A 3WNHA 3AO1A 4CJLA 1X9SA 2BE2A 4DTRA 4E7LA 4W5TA 3T19A 5CZ2A 2Z1IA 1QS4A 3KLHA 1JLFA 2HHWA 3LANA 3L2VA 1TK8A 3SUPA 1JLEA 3NGZA 2VG6A 3TAQA 2B5JA 1CZBA 4CJKA 1C1AA 1YTAA 4F2RA 3ULDA 3HL8A 4JS4A 4CFDA 3QESA 1TAUA 3C6UA 4DU4A 4Z4CA 1QE1A 4CJTA 1SKSA 3OYBA 2VG7A 1ASVA 1TL3A 4CGDA 4DTUA 3OVNA 1LW2A 3QO9A 3OYMA 4PY5A 1X9MA 4Z4FA 3AVGA 5K14A 3SQ4A 1JKHA 4CJVA 3VQ4A 3KKSA 3NF6A 4CIFA 1RT1A 4B8CA 3QINA 1LAVA 4N5SA 1UWBA 1A5WA 4E0DA 4FJGA 1RTHA 2YV0X 5KRSA 3L2QA 1BHLA 3RRHA 3DOLA 3QNNA 4FZYA 3OS1A 4AHUA 3BDPA 1B9DA 2EHGA 3VQBA 1BL3A 2IDOA 3OYFA 4AILC 3QERA 2X6SA 3QEPA 1TAQA 1ZYQA 1JL2A 1JL1A 1JXEA 4F4KA 1IO2A 3AVNA 3MEGA 3K5LA 3V6DA 4B9SA 5JS1A 3RRGA 1SV5A 4ELTA 4CEZA 3OS2A 4LSNA 1XI1A 3K5OA 5KTQA 4ELUA 3VQ9A 4OVLA 4CECA 1XHXA 4CEFA 3RWUA 4IDKA 1U4BA 1RCHA 1VSIA 1RT6A 2B4JA 3O4QA 3K5NA 3RR8A 5FRMA 1SUQA 1NK7A 3NDKA 1LWCA 1S9EA 3HT3A 3D0PA 3SNNA 1SL0A 1HYZA 4IG0A 4F3TA 4H4MA 2GV9A 4IKFA 1NJZA 1NJYA 2G8WA 3AA4A 1ZBFA 1S1TA 3L2RA 3MXJA 2FBXA 1NK9A 4FLWA 3DYAA 2YKNA 2YHAA 4CEDA 3KJVA 3KLGA 4LD0A 5J2MA 1L5UA 2RKIA 1Z25A 2OPPA 1J53A 3TAEA 4E3SA 4FJ9A 1XHZA 1BQNA 2XRIA 5HRPA 2X74A 3HM9A 3V9UA 2DFEA 2QKBA 4ELVA 1U45A 1KRPA 4DS4A 2KW4A 1ZBHA 1NK8A 3HP6A 4QAGA 2DY4A 1RDCA 1IKYA 2WONA 3LZJA 3SV4A 3DMJA 5EU7A 1NK4A 4FW2A 3K5MA 4KHQA 1ZBIA 3M8RA 4FXDA 3SQ1A 4W5QA 1IKWA 1RBUA 4HCCA 3OYEA 1BIZA 3M8PA 3KD1E 3NAEA 4EZ6A 4B08A 1KVBA 4E7IA 2QXFA 4E89A 3EYZA 3SJJA 1TKDA 4LSLA 3LDSA 4M3YA 2P5GA 3JYTA 4UQGA 4F2SA 4IBNA 1GOBA 3OYAA 4L8RB 4GW6A 4O0JA 3VN5A 4I7FA 3O3HA 4KHWA 3L8BA 4KAZA 3AV9A 3ISNC 1NJWA 2IAJA 5T7BA 4B9LA 4FK0A 4DLEA 3O3GA 4BACA 1ASWA 1UA0A 5C24A 4CJQA 4CHPA 5KRTA 3NH0A 4N47A 3C94A 2OPQA 1VRUA 3OYNA 4DTNA 4M3XA 3QLHA 2OA8A 1FKPA 3LAKA 3F73A 3BGRA 4CFAA 3PY8A 5SZTA 3LZIA 3CQ8A 2HHQA 1RTDA 4B9UA 4W5NA 2VG5A 1S1UA 4FLZA 4FM1A 3DLGA 3ZSWA 4LH5A 5J2NA 4PQUA 2ZE2A 3UIQA 5HROA 1VK0A 3HYFA 4JLHA 3TANA 3I8DA 4KHYA 3D45A 4MFBA 4LH4A 2OYQA 1TL1A 3DRPA 2QK9A 2P5OA 4RG8A 5FRNA 5D3GA 4DTJA 1Q8IA 2ATQA 1U49A 1KTQA 3V9SA 3NH1A 3OJSA 3KK2A 1NOZA 4F3OA 1C0UA 1UOCA 3OYDA 3RMAA 3S9HA 3V1OA 4YNQA 3K58A 4DF8A 4B9VA 1I39A 3VQ5A 4CFBA 1NK6A 3V81A 1VSLA 4AHVA 1G15A 1JLQA 4FYDA 4KHUA 3V1QA 2HNZA 3DRSA 5J2QA 1HNVA 2F96A 3WNGA 4DQQA 1LV5A 3VQDA 3CM6A 4GMJB 3RR7A 4NCAA 1IKVA 3FFIA 2A1SA 3VQ6A 2E6LA 4NYNA 4OKKA 4DSEA 3NF7A 1NKBA 2JGUA 4G1QA 1NK0A 1KCFA 3SUOA 2BDPA 4FM2A 5J1EA 3AO2A 3P5JA 4ID5A 3LP1A 2DTUA 4FZZA 2B6AA 4DLGA 4CE9A 3WNFA 2XO7A 1Y97A 4O5BA 3ZT4A 1I3AA 1KVAA 3ZCMA 3NFAA 4JRQA 1WSFA 3MECA 1VSEA 4DTMA 4DFMA 2HNYA 4FCYA 3HP9A 3I0RA 1D9FA 4FJ8A 3V1RA 4I2QA 3ZSOA 4W5RA 3CG7A 4CJPA 4CJRA 2OPSA 1L3UA 3VQQA 2G8FA 3OJUA 4OKJA 2OZMA 4Z0UA 2AJQA 4B9MA 2RN2A 3B6PA 2NUBA 1RTJA 2YHBA 1FK9A 2HNDA 4KO0A 4TSXA 4CHYA 1S1WA 4WE1A 4OPKA 3RTVA 3TAPA 3S3OA 2Q3SA 3ZT1A 2YKMA 3PV8A 3RMBA 3HO1A 4LY7A 3MAQA 4E1MA 1WLJA 3S3MA 2PZSA 3IS9A 1HYVA 4FJNA 3OYCA 4HTUA 4O4GA 3IG1A 3HPGA 3NF8A 4ZTFA 4FJLA 1J9AA 1R0AA 1RTIA 4CIEA 3NHGA 4NCBA 4JS5A 1T05A 4DTXA 1EP4A 4DFKA 4CHOA
chains in the Genus database with same CATH superfamily
3DLRA 3KK3A 3R1XA 5M1KA 4M42A 2WFBA 3SMPA 1YIJN 2D0BA 4O8UA 3QNOA 3OYGA 1NG9A 3ZSYA 4IG3A 1QHTA 5EVZA 3OYLA 4B3SK 3HBTA 3FR0A 3OYHA 5AQFA 3TI0A 2ETJA 2P9UB 2YI1A 3DAWA 2FBVA 3BP8A 3TAFA 1W7AA 2D1KA 4JKFA 2VGMA 5JICA 2EX3A 3LM2A 4Q0BA 1VSJA 1DTTA 3VQEA 5KGWA 1Q9XA 4JKBA 3TR8A 4OGEA 1KLMA 5AQMA 3AAQA 2QEXN 3K0SA 3QETA 2BANA 2ZGYA 4A2AA 1JLBA 4DSFA 2A5XA 1WAJA 3DLEA 3K57A 1GOAA 2GBZA 5BR8K 4FK2A 2I7PA 1NKEA 2GEMA 2P9NB 1VSDA 1EWRA 4H0TB 3CHWA 5HLFA 2G8KA 2HF4A 1TGOA 3VEWA 1SL2A 3LL3A 3MX2A 1ZBSA 4CGGA 3ZETA 3ZSVA 3VEOA 3QIOA 2QW9A 3A8YA 4RWTA 1ASUA 1TKTA 4EZ9A 4H5WA 1O1WA 3DLHA 1A5VA 3L4IA 4KFBA 3VEXA 4U7BA 1T6DA 1UA1A 2R7YA 1TUUA 3M8QA 4GVMA 4IZ9A 1TKXA 3T1YK 1HKCA 4PL7A 2A1RA 3UKRB 4ISGA 3F9MA 3AVMA 1RDBA 3OTOK 1N36K 1FKOA 4LF4K 2QI2A 1QQCA 4DTPA 1WOQA 2I5JA 4MDBA 4M41A 3EZWA 3LALA 1C0MA 4M3RA 3HTVA 1BQMA 2P9UA 4I9QA 3W3DA 3SUQA 4H0XB 1V4TA 1BI4B 4DU3A 1LW0A 4LF8K 4DB3A 1C0TA 1HX1A 2DFHA 5KPZA 1DTQA 1LWFA 3AA5X 1T44A 4W5OA 3SYZA 1TK5A 3VF4A 1X1PA 2WOMA 4CGHA 3C65A 4DTOA 4KBOA 3NE6A 1KLNA 3J7AP 4RW6A 2F4VK 1IBMK 3J8AA 5E84A 3VGMA 2YNIA 5GIPA 4CHZA 1E4FT 1VSFA 5AQPA 3QBWA 1FJGK 3H08A 4DV6K 2YHXA 1NBWA 3C6AA 5CY4A 5A2QO 3O3FA 2P9NA 2E1YA 4BR9A 2ASMA 3CFRA 3O1BA 1NLVA 2RPIA 1VQKN 4YDUA 2D0PA 2VQFK 4CVNE 3PO4A 3SJHA 3VMFB 4B1UB 1FXXA 3P4IA 4MLEA 4K0KK 4BDYA 4CJWA 3MCAB 3LPTA 2E4LA 3CI5A 1RGIA 2CGKA 3LDNA 4FVMA 3AO4A 4LF9K 3ZSXA 3SI6A 3IKMA 3ZEUB 3CJBA 1IH7A 3WXMB 3VF2A 3G0ZA 4IFVA 3UKRA 1OH5A 2HB5A 2QWPA 2YX6A 1XNQK 1WSJA 1HNWK 2Q2RA 1KFDA 1C1CA 5FLXO 5LJWA 1B92A 5IT9O 4EAHD 3GOIA 4H0OA 4H03B 3RVCA 1HNZK 5SWMA 4BVOA 4IEIA 5I42A 1EWQA 1XWLA 4CERA 4RW7A 1NGCA 1B9FA 4CJFA 4BDPA 2HHHK 4OLAA 1QSYA 1BI4A 2LSNA 3KTQA 1WSEA 1N8RO 4BE2A 1NKCA 1ATRA 2IVPA 4CJUA 3AA2A 3CFOA 1CXUA 1XUPO 2VWJA 4E7JA 4KHPK 4OJRA 1BOTO 5AQRA 3A2FA 4K25A 1VQ9N 5I3UA 1SL1A 3ZSRA 1RT7A 4BRQA 1Q86O 3PUFA 3L2WA 4K43A 3G71N 3O4WA 3WXJA 2HBLA 4E7LA 4ISFA 1QS4A 1JLFA 5AQJA 5TKWA 3LANA 3BY5A 3SLCA 1TK8A 3NGZA 2B5JA 4F2RA 1YTAA 4WQ4A 4DU4A 2UU9K 1MDUB 3OVNA 1LW2A 3AVGA 4CJVA 3TPQA 3VQ4A 1CLQA 5GAGP 2YV0X 3FZLA 1VQNN 3QNNA 4JV5K 1BA0A 4B1YB 1HKBA 3OS1A 1B9DA 3ZEUA 4AILC 2X6SA 3QEPA 1JL1A 1YITN 3AVNA 3RRGA 4YOTA 3PIOL 4WQ4C 1XI1A 1SS6A 4ELUA 4FWSA 3CQYA 1U4BA 3RR8A 1RT6A 5FRMA 1BO5O 1QHAA 1SUQA 1NK7A 3I55N 3O08A 3HT3A 3W0LA 1SL0A 1OH6A 4H4MA 1NJYA 2G8WA 3L2RA 3DYAA 4CD3A 3KJVA 2YHAA 2W6LA 3KLGA 2OPPA 5I9EB 4A61A 5C2FA 3CPEA 4PL8A 2QKBA 1KRPA 4DS4A 2KW4A 1IV0A 2GUPA 3HP6A 3TSPA 1MA9B 1RDCA 3SV4A 1NK4A 3K5MA 3M8RA 3SAHA 4HCCA 5KPRA 3H1QA 2A41A 1DKGD 4MO4A 4LSLA 1MWMA 5B8HA 1Q18A 5ADXH 4O0JA 5DM6L 3O3HA 4FK0A 3O3GA 5C24A 4CHPA 5CHIA 3SMSA 3NH0A 2E2OA 3LAKA 4DUZK 4CFAA 4EIAA 4PKGA 2F9TA 3L6QA 4W5NA 4FM1A 4PQUA 5AQHA 2ZE2A 4JLHA 5LMUK 4DR7K 2QXLA 3E1YA 4MFBA 1JJ2M 3BZCA 3A5MC 4RG8A 5FRNA 1Q8IA 2QWRA 3NH1A 3OJSA 1NOZA 3FFKB 3RMAA 3V1OA 4GKKK 4CFBA 4IO8A 1NK6A 3V81A 4CZMA 4AHVA 2A42A 3DRSA 2V52B 1IBLK 1LV5A 3VQDA 3I56N 3PY8A 4CZKA 3NF7A 4G1QA 4U67L 3FZHA 3EE9A 3AO2A 4FZZA 1KAYA 4IJNA 2XO7A 1Y97A 1JCEA 4FJ8A 3WQTA 3V1RA 2P9PA 3ZSOA 4JKGB 1GLEG 4ISEA 1T3VA 4CJRA 3EN9A 3CMEN 2AJQA 4V19S 3B6PA 4B3RK 4CHYA 2UUBK 1S1WA 2KHOA 1V4SA 2A40A 3S3MA 3IS9A 3OYCA 4O4GA 1NGAA 3IG1A 4ZTFA 1J9AA 3ENOA 4BQLA 4CZLA 4O5FA 4DFKA 4F8RA 3CCSN 2PY5A 3AARA 4Z4IA 1WSHA 3ALYA 1TV6A 2GTDA 3LP3A 3M3ZA 3PX6A 3IDHA 2RE2A 5GAHP 4KI6A 2PYJA 3QIPA 4ILJA 5HL7L 2OCEA 4BWMA 4CK1A 3S3NA 4C8NA 4FWQA 4CEOA 3HPHA 4BRNA 2ZGZA 3O1WA 1D5AA 2G8VA 5FDLA 4A5BA 3KLEA 2XY8A 4WYBA 4PKIA 4QOZB 5HP1A 4RW4A 3PO5A 3CCJN 4CEBA 2OTLN 1X9WA 4KB0A 3KK7A 4CF2A 3CJ9A 3EZ5A 3WXLA 5CR4A 2NRXA 3THWB 3AVBA 2GUIA 2ZJQL 2D0AA 2XY6A 4KTWA 4X66K 3P31A 4WFNL 4DSJA 4JKEA 4FM0A 3OYIA 1GLJO 4FJXA 3MEDA 2F8SA 3ZT2A 3TWHA 2HBJA 3JAMO 3OYKA 2G8UA 4BR7A 2KTQA 3O8MA 3WQUA 3FZKA 4H8KA 3ZSZA 1WBDA 3DLBA 1QQMA 4N41A 2ASOA 4OX9K 2QTDA 1VSHA 4ZTJA 4NXNK 2WBNA 4JKGA 4KV8A 3A5LC 4CJ3A 4WCEL 3DRRA 1JCFA 4J2DA 1RBVA 1J5OA 1VQ5N 1Q9YA 3WNEA 4C23A 4IDHA 4AHRA 1H1VA 1HLUA 3O9SA 4YOUA 5ADXA 4HUGA 1TVRA 2Q36A 4M3WA 4DTSA 4J8FA 3VQCA 4C8LA 2KFZA 3ID6A 1N32K 4J2AA 4CGFA 2HMIA 4A57A 1J54A 3OS0A 4BE1A 3HVRA 3LWMA 4A62A 4ZHRA 3BF3A 1VQLN 2ZQBA 4DV3K 3MWPA 4CJ7A 2P51A 4N56A 1U04A 3EEQA 3AGKA 3M5RA 2Y1IA 3AO3A 4PUOA 4H0VB 4KB1A 3AA3A 4OKEA 1C6VA 1W97L 3ZLJA 3Q7CA 2NNWA 2YNFA 3THWA 4KPYA 1W0HA 3TAMA 2Q0RA 3T1AA 4C1NK 3LAMA 2ZJPL 4FLUA 4CGIA 2NZTA 5EXWA 2Q1NA 1W2BM 3D2FB 1HNXK 2W41A 1WSGA 4O55A 2PFUA 4CZJA 3T3FA 1NNEA 2HHVA 1RNHA 4O0IA 3G6EN 4J2EA 1HYSA 4BQZA 2FBYA 3HSTB 3TTCA 4I2PA 5ELZA 1NGIA 3FGUA 5BR9A 1VQ8N 3O4NA 3ATVA 2F7TA 4B9QA 4AM7A 5AQXA 1VQ7N 5AQYA 3O5BA 1BCOA 2YNGA 3MXIA 4GV6A 4FJHA 1SKWA 4AHCA 4DR2K 2KFNA 3CMAN 1YJWN 4FJMA 1W9HA 5M1QA 4I9LA 1VQ4N 3CYMA 3THXB 3D2EB 4AHSA 3N4PA 3B6OA 4YOXA 2HHUA 1KQSM 4DUYK 2PYLA 3P38A 1HKGA 3VTIA 4Z4HA 1DLOA 3LP0A 5HRNA 5JVHL 3DXKA 1X3NA 1BIUA 1S9GA 4FLVA 3V9WA 3ZX2A 4PWDA 2AP1A 4FJKA 4UY8O 1UAXA 3P1GA 3GG4A 1KAZA 3E01A 4CGJA 3SQ0A 2ITGA 4JHDB 4E7KA 5JVGL 4IEEA 3CCUN 5E41A 5KPTA 4DCHA 4Z4GA 1HJRA 5BPNA 1S1XA 5TKYA 2P9IB 3M8SA 3C6HA 3OBWA 5KGXA 3H3NO 1S6PA 3SPYA 1NJIO 3D2FA 2J4RA 3ZX0A 1EO1A 4DV2K 4CF0A 1WSIA 1KC8O 3GBTA 4NLCA 5BRDA 5CYMA 3I0SA 1VHXA 1S22A 3HZ6A 2Q31A 1ZBUA 5CYQA 4DHYA 3UE5A 4BC4A 3LWLA 5IWAK 4FW1A 1RDAA 3ZT0A 1NK5A 2IVNA 3T19A 5CZ2A 3KLHA 2HHWA 3I8BA 1YVNA 5AQTA 3QESA 3IFRA 4CFDA 1TAUA 3C6UA 1QE1A 1U6ZA 3R8EA 2VG7A 1ASVA 4BR0A 1OH8A 4PY5A 5K14A 1Q82O 1JKHA 3OBYA 1RT1A 4B3TK 1UWBA 4BREA 4FJGA 3THXA 3D2EA 3ID8A 3OA9A 1I94K 1VQPN 3EO3A 2IDOA 1XMQK 2OANA 1TAQA 3LDQA 1JXEA 3MEGA 3K5LA 3V6DA 5JS1A 1SV5A 1J5EK 5KTQA 3AGRA 3TSUA 3VQ9A 4CEFA 3K5NA 1GLBG 5LY3A 3NDKA 4JI2K 4IG0A 2O8CB 3MXJA 3M1FA 4FLWA 1R59O 4CEDA 4JHDA 4AF1A 1YJNN 2E20A 4FL9A 2W6KA 5EOYA 3TAEA 5KQ8A 4FJ9A 5HRPA 2P9IA 2X74A 2D4WA 4ELVA 4WFAL 1U2VB 1XQSC 4QAGA 2E2NA 2E2QA 1IKYA 2WONA 4YDUC 3LZJA 3MN9A 4FXDA 4EFHA 1RBUA 1HJOA 4B08A 4B1XB 2QXFA 5AQWA 1NU0A 3EKSA 4FSVA 2P5GA 3JYTA 4UQGA 1SAZA 3J80O 4GW6A 3O9RA 3DWLA 3L8BA 4KAZA 3ISNC 2IAJA 5AQVA 2UXBK 4O8KA 4DLEA 4BACA 4X64K 3CCMN 1WB9A 1VRUA 1YXQA 4LFAK 3OYNA 3QLHA 4JKAA 1FKPA 3LDLA 4BRGA 3CPWM 4CZFA 5SZTA 4JEPA 3CQ8A 2HHQA 1RTDA 2JWKA 1S1UA 5HROA 3E9PA 4FOIA 4KHYA 2OYQA 3DRPA 4PKHA 3SK3A 4DTJA 2ATQA 1KTQA 3V9SA 2NRHA 3KK2A 1C0UA 4YNQA 1S3XA 4JKDA 3O9UA 3VGKA 1G15A 1NGHA 2E2PA 3V1QA 5J2QA 3T69A 2AA4A 3QFPA 4H5TA 4NCAA 5KQDA 2PAVA 3FFIA 2E6LA 4NYNA 4OO1J 4B1ZA 1KCFA 2O8CA 2KLAA 5J1EA 2A6AA 4FOEA 3I33A 4CE9A 3G4SN 3MN6A 3CIPA 2GELA 1WSFA 2HHSA 1GLLO 4BC3A 2BTFA 3I0RA 3CG7A 1QZ6A 4BRKA 1L3UA 4OKJA 2YHBA 1U2VA 2BGGA 4TSXA 3S3OA 5FPDA 3HO1A 4LY7A 3MAQA 4E1MA 2PZSA 4CIEA 2YJFA 3VOVA 4JS5A 3VTHA 4CBXA 2VQEK 1MU2A 1QSSA 1LCUA 3WUHA 5DM7L 3VENA 5M1FA 1BGXT 3R9PA 2JLEA 1NGBA 3J7YP 1RBTA 3QEVA 3QB0A 5FPMA 1RBRA 1ESVA 4BROA 4DFPA 1RT4A 4FWLA 3T7ZA 2KZMA 3WEEB 2P9PB 4BGBA 1DT9A 2ZM6K 3U8XA 3PX4A 4LFBK 4M7XA 3TARA 3PX0A 4IOCL 3U3GA 2FF6A 3TAGA 5AZJB 4CZIA 5AQSA 1IJJA 4DFJA 3BF1A 3OY9A 2UUAK 1XNRK 2E88A 3QEXA 1RBSA 1A5XA 1LWEA 3D7EO 4FVUA 4ID1A 5GAEP 1CXQA 3CC2N 1HQEA 4CBUA 4Q5VA 3CJ7A 1LAWA 2P9SA 3L2UA 1GOCA 4DSLA 1OVQA 2XHBA 4KTZA 2E6MA 3P83D 3U3YA 4JAXA 4OPAA 1VAZA 1OKJA 2HBMA 1K6YA 2XY5A 1HPMA 4DV4K 2HHXA 4QS7A 3NVMA 3QICA 2NRWA 4FLTA 4PA1A 5BPLA 3IMXA 4CZGA 3H6EA 4KH6A 3V9XA 5JS2A 4DR1K 4O44A 5C0YA 2F8TA 4LF5K 1IG8A 4MLHA 5F0XA 4JKCA 1F21A 2IS3A 1JLGA 2X78A 3IUCA 5HBMA 1XC9A 2Z1GA 3LPUA 1KVCA 1N6QA 4CK3A 3CJAA 4ILGB 4JI3K 2E1ZA 3HVTA 3AVKA 1YAGA 4M63C 3ENHA 4ICLA 4B8AB 4EHUA 3WT0A 2D0CA 4FWRA 1VQON 1VSKA 1E3MA 1IKXA 1BU6O 4FJIA 1JCGA 3MDQA 3WEEA 4CHNA 2ITMA 5GINA 4CF9A 3V9ZA 3SAGA 1U47A 1RILA 2CGLA 4BGAA 5AJ3K 3TTDA 5AZJA 3H1VX 3K9KA 1NOYA 4HVJA 2HHTA 2YJEA 4NXMK 4FJJA 4HHTA 4BE0A 3ZSQA 2Z1HA 1EX4A 4FLXA 2QWLA 3SAFA 1C0FA 2NRVA 3AO5A 3MXMA 3THVA 4XIUA 1Z26A 1RDWX 4XH5A 5C10A 4CF8A 4C8MA 4DQIA 1S1VA 1RT5A 3QEWA 4FWOA 2KZZA 3OHRA 3KIOA 4FJ7A 4Y1DA 3S41A 1XC3A 2IIRA 3O9TA 4CCHA 2FSNA 2YNHA 4KI4A 1WNSA 3T1HK 1BCMA 1ZXOA 3KLIA 5FROA 4B3OA 4CZHA 1QVFM 3AVHA 1E4GT 4X62K 4JI1K 4JN4A 3QFUA 4E1NA 1D9DA 3QBXA 4OGCA 5AQNA 1P90A 5C42A 1QVGM 1REVA 3SBGA 1DEJA 2IOCA 1NGDA 2XY7A 4KRFA 1WAFA 2X6NA 3SUNA 5JLFA 2QWQA 2YHWA 3DLKA 1ILYA 1WN7A 3LM9A 3VQ7A 3CF5L 4BWJA 4CJ5A 1YVUA 4AHTA 1HRHA 1KFSA 5MLCQ 4IFYA 1ZBLA 5M1NA 1HR0K 3CCRN 1KSPA 3QEIA 4JI7K 1HQUA 4YOYA 4KHNA 1T03A 4JNEA 1Z05A 4HUFA 5LMNK 4G9ZA 2UXCK 3MN5A 4DQSA 4CJEA 4JI4K 5F2RA 2D5RA 1JLCA 4AQYK 4BRIA 3K59A 3AVCA 4B9TA 4QS8A 1VRTA 3KLFA 1X9JA 4CD1A 4DR4K 2P1JA 2HF3A 4DS5A 5DMRA 4R5PA 4CFCA 3H45C 3L4QA 4IFEA 1K9MO 4DWIA 2O8BB 4KTQA 1ITGA 1OVYA 4CK2A 1RT3A 3NBPA 3E9LA 3MWTA 4FJ5A 3VQ8A 1ATSA 1N34K 3DI6A 4FWMA 1SKRA 5HRSA 1T7PA 5J2PA 4DSIA 3F9KA 4DKWA 4E19A 1NMDA 1TK0A 2VYPA 3AVLA 3KK1A 4M3UA 4JK8A 2G8HA 2WTUA 2UYTA 1Y64A 4EP5A 2OZSA 3DXKB 1HPZA 2GWJA 3WNHA 3AO1A 4CJLA 2IVOA 3C7NB 1X9SA 1TYQB 2CGJA 1OH7A 5M1OA 2Z1IA 1SZ2A 3SUPA 2PBDA 2VG6A 3EL2A 1CZBA 1C1AA 5AQGA 4H0PA 3ULDA 3HL8A 4JS4A 5M1PA 3EE8A 3OYBA 3OYMA 3CCVN 3WXKA 1X9MA 4Z4FA 3KKSA 3NF6A 4YHHK 4N5SA 1EQYA 3PLAA 1RTHA 1GLFO 4XEIA 1BHLA 3RRHA 3DOLA 4BVPA 3EKUA 3VQBA 2A3ZA 4GKJK 3QERA 1ZYQA 3P39A 2V7ZA 4IOAL 1IO2A 5JMVA 1ZC6A 2VWBA 4ELTA 4IJAA 4CEZA 4OVLA 1N33K 1XHXA 2YHYA 3AAPA 4BC2A 2B4JA 1VSIA 4GV9A 4DR6K 4JYAK 1K8AO 4JD2B 3D0PA 1GLAG 2W40A 3SNNA 1HYZA 4IKFA 2GV9A 3AA4A 3E66A 1ZBFA 1S1TA 4BG8A 1X3MA 1YUWA 1NK9A 1S72N 2YKNA 3G25A 4LD0A 1L5UA 1Z25A 3PIPL 4E3SA 2O8BA 3CC4N 3SBTA 1BQNA 2XRIA 4L3QA 1HUXA 3HM9A 3N4QA 5BREA 2DFEA 1XMOK 3FZFA 5AQUA 1U45A 4QS9A 1ZBHA 2OTJN 1NK8A 4RTFD 3DMJA 4KHQA 3LDPA 4FW2A 1ZBIA 3CQXA 2V7YA 3SQ1A 4W5QA 1IKWA 3OYEA 1BIZA 1KVBA 4E89A 3HI0A 4BRHA 3LDSA 4OPHA 4IBNA 3C7NA 1GOBA 1TYQA 5EY4A 3WXIA 3VN5A 4KHWA 3UKUB 3AV9A 1NJWA 4B9LA 5LL6Z 1P8ZA 3A5NC 5KRTA 4N47A 3TU5A 4JI6K 4DTNA 4CZEA 2GWKA 3F73A 3LZIA 2UUCK 4B9UA 2VG5A 3ZSWA 4LH5A 5J2NA 4LF7K 4JKHA 1VK0A 3HYFA 3TANA 3A5OC 3D45A 3C0BA 1TL1A 1NGGA 1BUPA 4YOVA 3O80A 4F3OA 1UOCA 3OYDA 3CETA 3VQ5A 4FPAA 1IBKK 4FYDA 2F96A 2VCPA 3U9DA 3VESA 4WF9L 4GMJB 3RR7A 1MWKA 1IKVA 4DV1K 2A1SA 4JD2A 1NK0A 1NKBA 3SUOA 4FM2A 1KD1O 4ID5A 2DTUA 3Q7BA 2B6AA 2H3GX 1BG3A 2FSJA 3KWIA 3GDQA 1I3AA 1KVAA 3ZCMA 4DTMA 3MMVA 3MECA 4DFMA 1VSEA 1D9FA 2HNYA 3HP9A 4I2QA 3TSQA 4CJPA 4JI8K 2KKZA 2FF3B 3MX5A 3VETA 4A59A 3CJ1A 2OZMA 4B9MA 2NUBA 1RTJA 3RWUA 1FK9A 2HNDA 3TAPA 3RTVA 4OPKA 2Q3SA 3RMBA 2YKMA 1M1KO 4GY2B 1HYVA 3HPGA 4FJLA 3JS6A 3HOTA 4BRPA 4NCBA 4DTXA 1EP4A 4FWPA 1KXPA 4BR2A 1NM1A 2ZD1A 2ZJRL 3HJFA 2YCHA 3SQ2A 4Y1CA 3DJCA 3EY1A 1YT3A 2O4GA 3UKUA 4OPJA 4K41A 3CCQN 3NGIA 3VQPA 5FPEA 4B9NA 3AVIA 5AFUH 2OPRA 3MK6A 4FK4A 1KAXA 3F2KA 3AVFA 2GX9A 3C6TA 4CEAA 1D8YA 4DQPA 5GIOA 5DK5A 3HM8A 4KREA 5C2DA 4PHTX 4C8KA 4BRLA 1RT2A 3C95A 4C8OA 5BRFA 2HVHA 4H5VA 3NF9A 1CZ9A 2IC3A 3K9JA 4M3TA 4K8ZA 1QTMA 2O8FB 2QKKA 2V51B 4RW8A 3FE1A 3NMUA 4DV0K 3KKRA 1S5JA 3KD5E 4K42A 3SZ2A 4KHSA 1K8KB 2Y1JA 3VPZA 4R79A 2O4IA 2FC0A 4J2BA 3ASMA 1T6CA 5AZIB 3BUZB 3TABA 2W42A 3IAYA 4A2BA 4B1WB 1HNIA 3IRXA 4QCLA 3VA0A 4CESA 5AQZA 3HOSA 1L3VA 3CM5A 1NGEA 4M7YA 3VEZA 1YI2N 2FSKA 4WQ5A 5AQIA 4LFCK 2IGIA 4FWKA 4DQRA 4Z4EA 4FZXC 3ZYYX 4DV5K 3AVAA 3RSEB 3ZT3A 3R6MA 3VERA 1BDGA 3TTFA 3NH2A 2KQ2A 5E26A 4JRPA 5F1XA 3G10A 3THYB 4CW7B 3U4LA 1WBBA 2P9SB 3QMLA 4N76A 2QM1A 4DR5K 2I7NA 1RFQA 1RDDA 4AM6A 4CEQA 1NJXA 4FWNA 4WQ5C 1L3SA 3DLLL 3HK2A 3ITHA 1U48A 3BZKA 1BWFO 4RCHA 2E8AA 1NGFA 4CJ4A 3L0QA 3SCXA 1JLAA 3ENBA 4YFUA 2F9WA 4EHTA 4NYFA 4YOWA 3L3UA 2G8IA 4I6MB 3LP2A 1TUYA 2NRRA 4E7HA 5KI6A 1JXBA 2VWKA 4KKOA 1EETA 5BRHA 3PSIA 2O8FA 5BPMA 4MO5A 3V4IA 3K2PA 1S6QA 4HCBA 2CH6A 1QQNA 2EWSA 2FBTA 1K8KA 1C1BA 4CF1A 2D0OA 1O13A 4AH9A 1NMNA 5AZIA 2P9LB 4YORA 4DMNA 4H0YB 3MN7A 5FPNA 4XH1A 3MEEA 3O9QA 3HPOA 1BISA 3KVGA 5C25A 4IO9L 1Z6RA 4M3ZA 2DPNA 2QA4N 3CCEN 3DM2A 3SV3A 2NRZA 3JXUA 3LDOA 4Z94A 2Z1JA 1N5YA 1Q7YO 4M45A 4BRFA 3RSEA 4C1NI 4CEEA 1YTUA 3RMDA 1GLDG 4DF4A 4HWIA 2HMPA 4DG1A 2FLOA 3THYA 5AFUA 4CI6A 4OLBA 4H5RA 1VSMA 3CFPA 1NGJA 4E1JA 5HRRA 2CH5A 3ULEB 4DU1A 1EKEA 1YF5L 5CZ1A 5JLHA 4EP4A 3U9ZA 2RF2A 5BN8A 4NCGA 3R3LA 4RW9A 3VA3A 1TKZA 2DFFA 3PSFA 2ZWHA 3JSMA 1IG9A 4K8XA 4HUEA 3L3VA 3U6FA 4MQ3A 5LJVA 4YY3K 2O8EB 2O8DB 4BRCA 2HW3A 3CD6N 3A0IX 3NVKA 4I6MA 4H4OA 3DOKA 1VQMN 2WC9A 5C12A 1WUAA 2P9KB 1T8EA 3AVJA 2Q97A 4DSKA 3MCPA 1HMVA 4CIGA 1VQ6N 3NGYA 4GNIA 3NCIA 4BDZA 4DV7K 4FLYA 1L3TA 3OYJA 2HVIA 4NB4A 5AR0A 3DXMB 3VQAA 3CXCM 3HXMA 3KHYA 1QSLA 3RMCA 3H46O 2JWLA 4CJSA 3E9OA 3SPZA 2P9LA 4BR4A 2Q0UA 1EXQA 3QDKA 5AQOA 3VF6A 1BA1A 2BE2A 4W5TA 2NLXA 5GADP 3L2VA 3CJCA 1JLEA 3TAQA 4CJKA 3J7ZO 4B3MK 4BC5A 4Z4CA 4BRAA 3B8AX 4CJTA 1SKSA 4CGDA 1TL3A 4DTUA 1DGKN 3QO9A 3FLCO 3SQ4A 5EX5A 4CIFA 4B8CA 3QINA 1LAVA 4E0DA 1A5WA 1C0GA 4LC9B 5KRSA 3L2QA 4FZYA 4JI0K 4MDAA 3GE1A 4JI5K 4AHUA 3BDPA 2EHGA 3ULEA 1LOTB 1K73O 1BL3A 3OYFA 4A5AA 4BRDA 1JL2A 1G99A 4BY9C 4F4KA 4H5NA 4B9SA 4GVEA 3OS2A 4LSNA 1CZAN 3K5OA 4FO0A 4BRMA 4CECA 2HOEA 4IDKA 4WFBL 1RCHA 3O4QA 3J81O 1YHQN 4FPBA 1GLCG 2UXDK 1LWCA 1S9EA 3ATUA 4KH5A 4F3TA 2BUPA 4Y0WA 1NJZA 4DR3K 2QWMA 2O8EA 2O8DA 1D4XA 1FW6A 2ASPA 3VEYA 4F9OA 2FBXA 3BEXA 5J2MA 2P9KA 2RKIA 4ILHA 1J53A 5C15A 1XHZA 3HRGA 3V9UA 4B1VA 3OW2M 1M90O 5AQQA 2VGNA 3H3OB 3DXMA 4IXCA 2DY4A 5EU7A 3KWGA 3CC7N 2NRTA 2WUSA 1J6ZA 3M8PA 3KD1E 3NAEA 4EZ6A 4E7IA 3EYZA 3SJJA 4HTLA 1TKDA 4M3YA 2E5LK 4F2SA 4NO7A 3OYAA 4L8RB 5HOOA 4I7FA 2ZF5O 5T7BA 1QZ5A 5BN9A 3CERA 4CBWA 1ASWA 1UA0A 4CJQA 5AQKA 3C94A 2OPQA 2QWOA 4M3XA 4JK7A 2RHKA 4X65K 2OA8A 3BGRA 4IWVA 3ZX3A 2QWNA 1NWKA 3UB5A 4FLZA 3DLGA 2HBKA 3UIQA 3I8DA 4LH4A 2BH1A 2QK9A 3CCLN 2P5OA 1QQOA 4BG9A 5D3GA 1U49A 1YJ9N 4GV3A 3S9HA 4LF6K 4KH4A 2HSTA 3K58A 4DF8A 4B9VA 1I39A 3O6WA 1SQKA 1VSLA 1JLQA 4BR5A 3D6RA 4KHUA 1ATNA 2HNZA 3VGLA 5CE3A 1HNVA 3WNGA 4DQQA 3CM6A 3VQ6A 4DSEA 3F5TA 4OKKA 2JGUA 1RDUA 2BDPA 3FZMA 4NLBA 3M6GA 4IOXA 3P5JA 3LP1A 3GL1A 4JK9A 4DLGA 3AY9A 3KZBA 3WNFA 4O5BA 3ZT4A 3NFAA 4JRQA 4FCYA 3HSCA 4W5RA 4DQ8A 2FXUA 2OPSA 2G8FA 3VQQA 3OJUA 4Z0UA 2RN2A 1Q81O 3ZETB 4CHQA 4DTRA 4KO0A 4WE1A 4XH4A 3ZT1A 3PV8A 3VEVA 1WLJA 4FJNA 4HTUA 5AQLA 3NF8A 1R0AA 1RTIA 3NHGA 5H1SQ 1T05A 4CHOA
chains in the Genus database with same CATH topology
3DLRA 3KK3A 2PY5A 4Z4IA 1MU2A 1WSHA 2ZD1A 3ALYA 4M42A 1TV6A 3HJFA 1QSSA 3LP3A 4FJKA 3SQ2A 4Y1CA 2D0BA 3EY1A 1YT3A 3PX6A 2O4GA 4OPJA 1BGXT 3NGIA 4KI6A 3QNOA 3QIPA 3VQPA 3OYGA 2JLEA 2PYJA 3ZSYA 1RBTA 4BWMA 3QEVA 4IG3A 4B9NA 1RBRA 1QHTA 3AVIA 2OPRA 4C8NA 4CK1A 3OYLA 3S3NA 4CEOA 3HPHA 4DFPA 4FK4A 1RT4A 2KZMA 1D5AA 3AVFA 3OYHA 2G8VA 3C6TA 5FDLA 4CEAA 1D8YA 4DQPA 3TI0A 3KLEA 2XY8A 5DK5A 4QOZB 2ETJA 3PX4A 4KREA 5HP1A 3TARA 1NKCA 4RW4A 3PX0A 3PO5A 4C8KA 3U3GA 1RT2A 3C95A 3TAGA 2FBVA 3TAFA 4CEBA 4C8OA 4DFJA 3OY9A 1X9WA 2EX3A 3QEXA 4CHQA 3NF9A 1CZ9A 4KB0A 1RBSA 1A5XA 2IC3A 1VSJA 1DTTA 1LWEA 3VQEA 4Q0BA 4M3TA 4K8ZA 5KGWA 4CF2A 3EZ5A 1QTMA 1Q9XA 4ID1A 3AVBA 2GUIA 2QKKA 2D0AA 2XY6A 4KTWA 4RW8A 3TR8A 4DSJA 1CXQA 3KKRA 4OGEA 1HQEA 1S5JA 1KLMA 4Q5VA 3KD5E 4FM0A 3OYIA 3SZ2A 4KHSA 4FJXA 3MEDA 3QETA 2F8SA 2BANA 1LAWA 3ZT2A 1JLBA 3L2UA 3TWHA 4DSFA 1GOCA 3OYKA 2Y1JA 4DSLA 2O4IA 2G8UA 2FC0A 4J2BA 1WAJA 3ASMA 3DLEA 2XHBA 4KTZA 2E6MA 3P83D 3U3YA 2KTQA 3K57A 1GOAA 2GBZA 4H8KA 3ZSZA 2W42A 3TABA 1NKEA 3IAYA 4FK2A 1K6YA 1VSDA 3DLBA 2XY5A 1HNIA 3IRXA 4N41A 2HHSA 4QCLA 2HHXA 3VA0A 4FLTA 4CESA 5HLFA 1VSHA 4ZTJA 1TGOA 4PA1A 2G8KA 2BGGA 1SL2A 1L3VA 3CM5A 4KV8A 3V9XA 5JS2A 4CJ3A 4O44A 3DRRA 2F8TA 2IGIA 1RBVA 4CGGA 1J5OA 4J2DA 4DQRA 1Q9YA 3ZSVA 3WNEA 4Z4EA 1F21A 4FZXC 4AHRA 3QIOA 3AVAA 3ZT3A 2IS3A 1JLGA 2X78A 1ASUA 5HBMA 1TKTA 1XC9A 4EZ9A 4HUGA 1TVRA 2Z1GA 3LPUA 1KVCA 1N6QA 1O1WA 3NH2A 4DTSA 3DLHA 1A5VA 4M3WA 4CK3A 2KQ2A 4KFBA 3VQCA 4JRPA 4C8LA 2KFZA 3G10A 1UA1A 2R7YA 3HVTA 3AVKA 3M8QA 4J2AA 4GVMA 4CGFA 4N76A 4ICLA 2HMIA 1TKXA 1J54A 1RDDA 4B8AB 4CEQA 2A1RA 2D0CA 1NJXA 3OS0A 4BE1A 1L3SA 3HK2A 1VSKA 3ITHA 3AVMA 3HVRA 1IKXA 1U48A 1RDBA 4FJIA 3LWMA 1FKOA 4ZHRA 2ZQBA 1QQCA 4DTPA 4CHNA 2P51A 4N56A 2I5JA 4M41A 4CF9A 3V9ZA 1U04A 4CJ4A 3LALA 1C0MA 4M3RA 3SCXA 1JLAA 1BQMA 3AO3A 4YFUA 2Y1IA 1U47A 4I9QA 4PUOA 3SUQA 1RILA 4KB1A 3AA3A 4NYFA 1NOYA 4HVJA 1BI4B 3L3UA 1C6VA 1LW0A 4OKEA 4DU3A 2G8IA 2HHTA 1C0TA 3LP2A 2DFHA 4FJJA 1DTQA 1LWFA 3AA5X 4W5OA 4HHTA 3SYZA 4BE0A 1TK5A 3ZSQA 5KI6A 1JXBA 2VWKA 4KKOA 1EETA 4E7HA 2Z1HA 1X1PA 2WOMA 4CGHA 2YNFA 4DTOA 1EX4A 4KPYA 4FLXA 1W0HA 3TAMA 3T1AA 3V4IA 3K2PA 3LAMA 1S6QA 3AO5A 4FLUA 3NE6A 3MXMA 1KLNA 3THVA 4XIUA 1Z26A 4HCBA 4RW6A 4CGIA 2FBTA 1C1BA 2YNIA 4CF8A 4CF1A 4C8MA 4CHZA 4DQIA 1VSFA 1WSGA 1S1VA 1RT5A 4O55A 3QEWA 3H08A 4AH9A 3T3FA 2KZZA 2HHVA 5CY4A 1RNHA 3KIOA 4FJ7A 4O0IA 4Y1DA 4DMNA 3O3FA 4CCHA 4J2EA 1HYSA 2YNHA 2FBYA 3HSTB 3MEEA 4I2PA 4KI4A 1WNSA 1BCMA 3CFRA 3HPOA 3KLIA 5FROA 1BISA 4B3OA 5C25A 4M3ZA 2RPIA 3AVHA 3DM2A 3O4NA 3SV3A 4F8RA 1BCOA 3PO4A 4E1NA 1D9DA 2YNGA 2Z1JA 3MXIA 4OGCA 1N5YA 4M45A 4FJHA 5C42A 1SKWA 1REVA 4AHCA 2IOCA 2XY7A 2KFNA 4KRFA 1WAFA 4CEEA 2X6NA 1FXXA 3SUNA 4FJMA 1YTUA 4BDYA 1W9HA 4CJWA 3RMDA 4I9LA 3LPTA 3CYMA 4DF4A 3DLKA 2E4LA 1WN7A 3VQ7A 4BWJA 4CJ5A 1YVUA 4AHSA 4DG1A 4FVMA 1HRHA 4AHTA 1KFSA 3AO4A 4OLBA 4IFYA 3B6OA 1ZBLA 1VSMA 3CFPA 3ZSXA 3SI6A 5HRRA 4DU1A 2HHUA 1EKEA 1IH7A 1KSPA 2PYLA 5CZ1A 4EP4A 3G0ZA 3QEIA 4IFVA 4Z4HA 1HQUA 2HB5A 4KHNA 1T03A 1WSJA 1DLOA 2RF2A 3LP0A 1KFDA 4NCGA 1C1CA 4HUFA 1B92A 4RW9A 5HRNA 1BIUA 3VA3A 1TKZA 5SWMA 2DFFA 1S9GA 4FLVA 3JSMA 3V9WA 4DQSA 5I42A 4PWDA 1IG9A 4CJEA 1XWLA 3L3VA 4CERA 4HUEA 4K8XA 3U6FA 4RW7A 4MQ3A 1UAXA 1B9FA 4BDPA 3P1GA 4CJFA 2D5RA 4OLAA 2HW3A 1QSYA 1BI4A 1JLCA 2LSNA 3E01A 3KTQA 3K59A 1WSEA 3AVCA 4B9TA 4H4OA 1VRTA 3DOKA 3KLFA 4CJUA 4CGJA 4BE2A 3AA2A 3CFOA 2ITGA 3SQ0A 1CXUA 2P1JA 4E7KA 1T8EA 4DSKA 3AVJA 4DS5A 2HVHA 5DMRA 4R5PA 4CFCA 5E41A 2VWJA 1HMVA 1HJRA 4CIGA 4DWIA 4Z4GA 1S1XA 4E7JA 4KTQA 1ITGA 3NGYA 3NCIA 4OJRA 3M8SA 4CK2A 4BDZA 1RT3A 5KGXA 1S6PA 3NBPA 4FJ5A 3SPYA 3A2FA 3VQ8A 4FLYA 3DI6A 1SKRA 1L3TA 5HRSA 3OYJA 5I3UA 1SL1A 1T7PA 2HVIA 3VQAA 1CLQA 4CF0A 5J2PA 1WSIA 3HXMA 4DSIA 1QSLA 3F9KA 4E19A 3ZSRA 5CYMA 3RMCA 1RT7A 3I0SA 1TK0A 3AVLA 3PUFA 3KK1A 4CJSA 3SPZA 2G8HA 4M3UA 1ZBUA 5CYQA 3L2WA 1EXQA 3LWLA 4EP5A 2OZSA 4FW1A 1RDAA 3ZT0A 1HPZA 1NK5A 3WNHA 3AO1A 4CJLA 1X9SA 2BE2A 4DTRA 4E7LA 4W5TA 3T19A 5CZ2A 2Z1IA 1QS4A 3KLHA 1JLFA 2HHWA 3LANA 3L2VA 1TK8A 3SUPA 1JLEA 3NGZA 2VG6A 3TAQA 2B5JA 1CZBA 4CJKA 1C1AA 1YTAA 4F2RA 3ULDA 3HL8A 4JS4A 4CFDA 3QESA 1TAUA 3C6UA 4DU4A 4Z4CA 1QE1A 4CJTA 1SKSA 3OYBA 2VG7A 1ASVA 1TL3A 4CGDA 4DTUA 3OVNA 1LW2A 3QO9A 3OYMA 4PY5A 1X9MA 4Z4FA 3AVGA 5K14A 3SQ4A 1JKHA 4CJVA 3VQ4A 3KKSA 3NF6A 4CIFA 1RT1A 4B8CA 3QINA 1LAVA 4N5SA 1UWBA 1A5WA 4E0DA 4FJGA 1RTHA 2YV0X 5KRSA 3L2QA 1BHLA 3RRHA 3DOLA 3QNNA 4FZYA 3OS1A 4AHUA 3BDPA 1B9DA 2EHGA 3VQBA 1BL3A 2IDOA 3OYFA 4AILC 3QERA 2X6SA 3QEPA 1TAQA 1ZYQA 1JL2A 1JL1A 1JXEA 4F4KA 1IO2A 3AVNA 3MEGA 3K5LA 3V6DA 4B9SA 5JS1A 3RRGA 1SV5A 4ELTA 4CEZA 3OS2A 4LSNA 1XI1A 3K5OA 5KTQA 4ELUA 3VQ9A 4OVLA 4CECA 1XHXA 4CEFA 3RWUA 4IDKA 1U4BA 1RCHA 1VSIA 1RT6A 2B4JA 3O4QA 3K5NA 3RR8A 5FRMA 1SUQA 1NK7A 3NDKA 1LWCA 1S9EA 3HT3A 3D0PA 3SNNA 1SL0A 1HYZA 4IG0A 4F3TA 4H4MA 2GV9A 4IKFA 1NJZA 1NJYA 2G8WA 3AA4A 1ZBFA 1S1TA 3L2RA 3MXJA 2FBXA 1NK9A 4FLWA 3DYAA 2YKNA 2YHAA 4CEDA 3KJVA 3KLGA 4LD0A 5J2MA 1L5UA 2RKIA 1Z25A 2OPPA 1J53A 3TAEA 4E3SA 4FJ9A 1XHZA 1BQNA 2XRIA 5HRPA 2X74A 3HM9A 3V9UA 2DFEA 2QKBA 4ELVA 1U45A 1KRPA 4DS4A 2KW4A 1ZBHA 1NK8A 3HP6A 4QAGA 2DY4A 1RDCA 1IKYA 2WONA 3LZJA 3SV4A 3DMJA 5EU7A 1NK4A 4FW2A 3K5MA 4KHQA 1ZBIA 3M8RA 4FXDA 3SQ1A 4W5QA 1IKWA 1RBUA 4HCCA 3OYEA 1BIZA 3M8PA 3KD1E 3NAEA 4EZ6A 4B08A 1KVBA 4E7IA 2QXFA 4E89A 3EYZA 3SJJA 1TKDA 4LSLA 3LDSA 4M3YA 2P5GA 3JYTA 4UQGA 4F2SA 4IBNA 1GOBA 3OYAA 4L8RB 4GW6A 4O0JA 3VN5A 4I7FA 3O3HA 4KHWA 3L8BA 4KAZA 3AV9A 3ISNC 1NJWA 2IAJA 5T7BA 4B9LA 4FK0A 4DLEA 3O3GA 4BACA 1ASWA 1UA0A 5C24A 4CJQA 4CHPA 5KRTA 3NH0A 4N47A 3C94A 2OPQA 1VRUA 3OYNA 4DTNA 4M3XA 3QLHA 2OA8A 1FKPA 3LAKA 3F73A 3BGRA 4CFAA 3PY8A 5SZTA 3LZIA 3CQ8A 2HHQA 1RTDA 4B9UA 4W5NA 2VG5A 1S1UA 4FLZA 4FM1A 3DLGA 3ZSWA 4LH5A 5J2NA 4PQUA 2ZE2A 3UIQA 5HROA 1VK0A 3HYFA 4JLHA 3TANA 3I8DA 4KHYA 3D45A 4MFBA 4LH4A 2OYQA 1TL1A 3DRPA 2QK9A 2P5OA 4RG8A 5FRNA 5D3GA 4DTJA 1Q8IA 2ATQA 1U49A 1KTQA 3V9SA 3NH1A 3OJSA 3KK2A 1NOZA 4F3OA 1C0UA 1UOCA 3OYDA 3RMAA 3S9HA 3V1OA 4YNQA 3K58A 4DF8A 4B9VA 1I39A 3VQ5A 4CFBA 1NK6A 3V81A 1VSLA 4AHVA 1G15A 1JLQA 4FYDA 4KHUA 3V1QA 2HNZA 3DRSA 5J2QA 1HNVA 2F96A 3WNGA 4DQQA 1LV5A 3VQDA 3CM6A 4GMJB 3RR7A 4NCAA 1IKVA 3FFIA 2A1SA 3VQ6A 2E6LA 4NYNA 4OKKA 4DSEA 3NF7A 1NKBA 2JGUA 4G1QA 1NK0A 1KCFA 3SUOA 2BDPA 4FM2A 5J1EA 3AO2A 3P5JA 4ID5A 3LP1A 2DTUA 4FZZA 2B6AA 4DLGA 4CE9A 3WNFA 2XO7A 1Y97A 4O5BA 3ZT4A 1I3AA 1KVAA 3ZCMA 3NFAA 4JRQA 1WSFA 3MECA 1VSEA 4DTMA 4DFMA 2HNYA 4FCYA 3HP9A 3I0RA 1D9FA 4FJ8A 3V1RA 4I2QA 3ZSOA 4W5RA 3CG7A 4CJPA 4CJRA 2OPSA 1L3UA 3VQQA 2G8FA 3OJUA 4OKJA 2OZMA 4Z0UA 2AJQA 4B9MA 2RN2A 3B6PA 2NUBA 1RTJA 2YHBA 1FK9A 2HNDA 4KO0A 4TSXA 4CHYA 1S1WA 4WE1A 4OPKA 3RTVA 3TAPA 3S3OA 2Q3SA 3ZT1A 2YKMA 3PV8A 3RMBA 3HO1A 4LY7A 3MAQA 4E1MA 1WLJA 3S3MA 2PZSA 3IS9A 1HYVA 4FJNA 3OYCA 4HTUA 4O4GA 3IG1A 3HPGA 3NF8A 4ZTFA 4FJLA 1J9AA 1R0AA 1RTIA 4CIEA 3NHGA 4NCBA 4JS5A 1T05A 4DTXA 1EP4A 4DFKA 4CHOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DLR A;  3KK3 A;  2PY5 A;  4Z4I A;  1MU2 A;  1WSH A;  2ZD1 A;  3ALY A;  4M42 A;  1TV6 A;  3HJF A;  1QSS A;  3LP3 A;  4FJK A;  3SQ2 A;  4Y1C A;  2D0B A;  3EY1 A;  1YT3 A;  3PX6 A;  2O4G A;  4OPJ A;  1BGX T;  3NGI A;  4KI6 A;  3QNO A;  3QIP A;  3VQP A;  3OYG A;  2JLE A;  2PYJ A;  3ZSY A;  1RBT A;  4BWM A;  3QEV A;  4IG3 A;  4B9N A;  1RBR A;  1QHT A;  3AVI A;  2OPR A;  4C8N A;  4CK1 A;  3OYL A;  3S3N A;  4CEO A;  3HPH A;  4DFP A;  4FK4 A;  1RT4 A;  2KZM A;  1D5A A;  3AVF A;  3OYH A;  2G8V A;  3C6T A;  5FDL A;  4CEA A;  1D8Y A;  4DQP A;  3TI0 A;  3KLE A;  2XY8 A;  5DK5 A;  4QOZ B;  2ETJ A;  3PX4 A;  4KRE A;  5HP1 A;  3TAR A;  1NKC A;  4RW4 A;  3PX0 A;  3PO5 A;  4C8K A;  3U3G A;  1RT2 A;  3C95 A;  3TAG A;  2FBV A;  3TAF A;  4CEB A;  4C8O A;  4DFJ A;  3OY9 A;  1X9W A;  2EX3 A;  3QEX A;  4CHQ A;  3NF9 A;  1CZ9 A;  4KB0 A;  1RBS A;  1A5X A;  2IC3 A;  1VSJ A;  1DTT A;  1LWE A;  3VQE A;  4Q0B A;  4M3T A;  4K8Z A;  5KGW A;  4CF2 A;  3EZ5 A;  1QTM A;  1Q9X A;  4ID1 A;  3AVB A;  2GUI A;  2QKK A;  2D0A A;  2XY6 A;  4KTW A;  4RW8 A;  3TR8 A;  4DSJ A;  1CXQ A;  3KKR A;  4OGE A;  1HQE A;  1S5J A;  1KLM A;  4Q5V A;  3KD5 E;  4FM0 A;  3OYI A;  3SZ2 A;  4KHS A;  4FJX A;  3MED A;  3QET A;  2F8S A;  2BAN A;  1LAW A;  3ZT2 A;  1JLB A;  3L2U A;  3TWH A;  4DSF A;  1GOC A;  3OYK A;  2Y1J A;  4DSL A;  2O4I A;  2G8U A;  2FC0 A;  4J2B A;  1WAJ A;  3ASM A;  3DLE A;  2XHB A;  4KTZ A;  2E6M A;  3P83 D;  3U3Y A;  2KTQ A;  3K57 A;  1GOA A;  2GBZ A;  4H8K A;  3ZSZ A;  2W42 A;  3TAB A;  1NKE A;  3IAY A;  4FK2 A;  1K6Y A;  1VSD A;  3DLB A;  2XY5 A;  1HNI A;  3IRX A;  4N41 A;  2HHS A;  4QCL A;  2HHX A;  3VA0 A;  4FLT A;  4CES A;  5HLF A;  1VSH A;  4ZTJ A;  1TGO A;  4PA1 A;  2G8K A;  2BGG A;  1SL2 A;  1L3V A;  3CM5 A;  4KV8 A;  3V9X A;  5JS2 A;  4CJ3 A;  4O44 A;  3DRR A;  2F8T A;  2IGI A;  1RBV A;  4CGG A;  1J5O A;  4J2D A;  4DQR A;  1Q9Y A;  3ZSV A;  3WNE A;  4Z4E A;  1F21 A;  4FZX C;  4AHR A;  3QIO A;  3AVA A;  3ZT3 A;  2IS3 A;  1JLG A;  2X78 A;  1ASU A;  5HBM A;  1TKT A;  1XC9 A;  4EZ9 A;  4HUG A;  1TVR A;  2Z1G A;  3LPU A;  1KVC A;  1N6Q A;  1O1W A;  3NH2 A;  4DTS A;  3DLH A;  1A5V A;  4M3W A;  4CK3 A;  2KQ2 A;  4KFB A;  3VQC A;  4JRP A;  4C8L A;  2KFZ A;  3G10 A;  1UA1 A;  2R7Y A;  3HVT A;  3AVK A;  3M8Q A;  4J2A A;  4GVM A;  4CGF A;  4N76 A;  4ICL A;  2HMI A;  1TKX A;  1J54 A;  1RDD A;  4B8A B;  4CEQ A;  2A1R A;  2D0C A;  1NJX A;  3OS0 A;  4BE1 A;  1L3S A;  3HK2 A;  1VSK A;  3ITH A;  3AVM A;  3HVR A;  1IKX A;  1U48 A;  1RDB A;  4FJI A;  3LWM A;  1FKO A;  4ZHR A;  2ZQB A;  1QQC A;  4DTP A;  4CHN A;  2P51 A;  4N56 A;  2I5J A;  4M41 A;  4CF9 A;  3V9Z A;  1U04 A;  4CJ4 A;  3LAL A;  1C0M A;  4M3R A;  3SCX A;  1JLA A;  1BQM A;  3AO3 A;  4YFU A;  2Y1I A;  1U47 A;  4I9Q A;  4PUO A;  3SUQ A;  1RIL A;  4KB1 A;  3AA3 A;  4NYF A;  1NOY A;  4HVJ A;  1BI4 B;  3L3U A;  1C6V A;  1LW0 A;  4OKE A;  4DU3 A;  2G8I A;  2HHT A;  1C0T A;  3LP2 A;  2DFH A;  4FJJ A;  1DTQ A;  1LWF A;  3AA5 X;  4W5O A;  4HHT A;  3SYZ A;  4BE0 A;  1TK5 A;  3ZSQ A;  5KI6 A;  1JXB A;  2VWK A;  4KKO A;  1EET A;  4E7H A;  2Z1H A;  1X1P A;  2WOM A;  4CGH A;  2YNF A;  4DTO A;  1EX4 A;  4KPY A;  4FLX A;  1W0H A;  3TAM A;  3T1A A;  3V4I A;  3K2P A;  3LAM A;  1S6Q A;  3AO5 A;  4FLU A;  3NE6 A;  3MXM A;  1KLN A;  3THV A;  4XIU A;  1Z26 A;  4HCB A;  4RW6 A;  4CGI A;  2FBT A;  1C1B A;  2YNI A;  4CF8 A;  4CF1 A;  4C8M A;  4CHZ A;  4DQI A;  1VSF A;  1WSG A;  1S1V A;  1RT5 A;  4O55 A;  3QEW A;  3H08 A;  4AH9 A;  3T3F A;  2KZZ A;  2HHV A;  5CY4 A;  1RNH A;  3KIO A;  4FJ7 A;  4O0I A;  4Y1D A;  4DMN A;  3O3F A;  4CCH A;  4J2E A;  1HYS A;  2YNH A;  2FBY A;  3HST B;  3MEE A;  4I2P A;  4KI4 A;  1WNS A;  1BCM A;  3CFR A;  3HPO A;  3KLI A;  5FRO A;  1BIS A;  4B3O A;  5C25 A;  4M3Z A;  2RPI A;  3AVH A;  3DM2 A;  3O4N A;  3SV3 A;  4F8R A;  1BCO A;  3PO4 A;  4E1N A;  1D9D A;  2YNG A;  2Z1J A;  3MXI A;  4OGC A;  1N5Y A;  4M45 A;  4FJH A;  5C42 A;  1SKW A;  1REV A;  4AHC A;  2IOC A;  2XY7 A;  2KFN A;  4KRF A;  1WAF A;  4CEE A;  2X6N A;  1FXX A;  3SUN A;  4FJM A;  1YTU A;  4BDY A;  1W9H A;  4CJW A;  3RMD A;  4I9L A;  3LPT A;  3CYM A;  4DF4 A;  3DLK A;  2E4L A;  1WN7 A;  3VQ7 A;  4BWJ A;  4CJ5 A;  1YVU A;  4AHS A;  4DG1 A;  4FVM A;  1HRH A;  4AHT A;  1KFS A;  3AO4 A;  4OLB A;  4IFY A;  3B6O A;  1ZBL A;  1VSM A;  3CFP A;  3ZSX A;  3SI6 A;  5HRR A;  4DU1 A;  2HHU A;  1EKE A;  1IH7 A;  1KSP A;  2PYL A;  5CZ1 A;  4EP4 A;  3G0Z A;  3QEI A;  4IFV A;  4Z4H A;  1HQU A;  2HB5 A;  4KHN A;  1T03 A;  1WSJ A;  1DLO A;  2RF2 A;  3LP0 A;  1KFD A;  4NCG A;  1C1C A;  4HUF A;  1B92 A;  4RW9 A;  5HRN A;  1BIU A;  3VA3 A;  1TKZ A;  5SWM A;  2DFF A;  1S9G A;  4FLV A;  3JSM A;  3V9W A;  4DQS A;  5I42 A;  4PWD A;  1IG9 A;  4CJE A;  1XWL A;  3L3V A;  4CER A;  4HUE A;  4K8X A;  3U6F A;  4RW7 A;  4MQ3 A;  1UAX A;  1B9F A;  4BDP A;  3P1G A;  4CJF A;  2D5R A;  4OLA A;  2HW3 A;  1QSY A;  1BI4 A;  1JLC A;  2LSN A;  3E01 A;  3KTQ A;  3K59 A;  1WSE A;  3AVC A;  4B9T A;  4H4O A;  1VRT A;  3DOK A;  3KLF A;  4CJU A;  4CGJ A;  4BE2 A;  3AA2 A;  3CFO A;  2ITG A;  3SQ0 A;  1CXU A;  2P1J A;  4E7K A;  1T8E A;  4DSK A;  3AVJ A;  4DS5 A;  2HVH A;  5DMR A;  4R5P A;  4CFC A;  5E41 A;  2VWJ A;  1HMV A;  1HJR A;  4CIG A;  4DWI A;  4Z4G A;  1S1X A;  4E7J A;  4KTQ A;  1ITG A;  3NGY A;  3NCI A;  4OJR A;  3M8S A;  4CK2 A;  4BDZ A;  1RT3 A;  5KGX A;  1S6P A;  3NBP A;  4FJ5 A;  3SPY A;  3A2F A;  3VQ8 A;  4FLY A;  3DI6 A;  1SKR A;  1L3T A;  5HRS A;  3OYJ A;  5I3U A;  1SL1 A;  1T7P A;  2HVI A;  3VQA A;  1CLQ A;  4CF0 A;  5J2P A;  1WSI A;  3HXM A;  4DSI A;  1QSL A;  3F9K A;  4E19 A;  3ZSR A;  5CYM A;  3RMC A;  1RT7 A;  3I0S A;  1TK0 A;  3AVL A;  3PUF A;  3KK1 A;  4CJS A;  3SPZ A;  2G8H A;  4M3U A;  1ZBU A;  5CYQ A;  3L2W A;  1EXQ A;  3LWL A;  4EP5 A;  2OZS A;  4FW1 A;  1RDA A;  3ZT0 A;  1HPZ A;  1NK5 A;  3WNH A;  3AO1 A;  4CJL A;  1X9S A;  2BE2 A;  4DTR A;  4E7L A;  4W5T A;  3T19 A;  5CZ2 A;  2Z1I A;  1QS4 A;  3KLH A;  1JLF A;  2HHW A;  3LAN A;  3L2V A;  1TK8 A;  3SUP A;  1JLE A;  3NGZ A;  2VG6 A;  3TAQ A;  2B5J A;  1CZB A;  4CJK A;  1C1A A;  1YTA A;  4F2R A;  3ULD A;  3HL8 A;  4JS4 A;  4CFD A;  3QES A;  1TAU A;  3C6U A;  4DU4 A;  4Z4C A;  1QE1 A;  4CJT A;  1SKS A;  3OYB A;  2VG7 A;  1ASV A;  1TL3 A;  4CGD A;  4DTU A;  3OVN A;  1LW2 A;  3QO9 A;  3OYM A;  4PY5 A;  1X9M A;  4Z4F A;  3AVG A;  5K14 A;  3SQ4 A;  1JKH A;  4CJV A;  3VQ4 A;  3KKS A;  3NF6 A;  4CIF A;  1RT1 A;  4B8C A;  3QIN A;  1LAV A;  4N5S A;  1UWB A;  1A5W A;  4E0D A;  4FJG A;  1RTH A;  2YV0 X;  5KRS A;  3L2Q A;  1BHL A;  3RRH A;  3DOL A;  3QNN A;  4FZY A;  3OS1 A;  4AHU A;  3BDP A;  1B9D A;  2EHG A;  3VQB A;  1BL3 A;  2IDO A;  3OYF A;  4AIL C;  3QER A;  2X6S A;  3QEP A;  1TAQ A;  1ZYQ A;  1JL2 A;  1JL1 A;  1JXE A;  4F4K A;  1IO2 A;  3AVN A;  3MEG A;  3K5L A;  3V6D A;  4B9S A;  5JS1 A;  3RRG A;  1SV5 A;  4ELT A;  4CEZ A;  3OS2 A;  4LSN A;  1XI1 A;  3K5O A;  5KTQ A;  4ELU A;  3VQ9 A;  4OVL A;  4CEC A;  1XHX A;  4CEF A;  3RWU A;  4IDK A;  1U4B A;  1RCH A;  1VSI A;  1RT6 A;  2B4J A;  3O4Q A;  3K5N A;  3RR8 A;  5FRM A;  1SUQ A;  1NK7 A;  3NDK A;  1LWC A;  1S9E A;  3HT3 A;  3D0P A;  3SNN A;  1SL0 A;  1HYZ A;  4IG0 A;  4F3T A;  4H4M A;  2GV9 A;  4IKF A;  1NJZ A;  1NJY A;  2G8W A;  3AA4 A;  1ZBF A;  1S1T A;  3L2R A;  3MXJ A;  2FBX A;  1NK9 A;  4FLW A;  3DYA A;  2YKN A;  2YHA A;  4CED A;  3KJV A;  3KLG A;  4LD0 A;  5J2M A;  1L5U A;  2RKI A;  1Z25 A;  2OPP A;  1J53 A;  3TAE A;  4E3S A;  4FJ9 A;  1XHZ A;  1BQN A;  2XRI A;  5HRP A;  2X74 A;  3HM9 A;  3V9U A;  2DFE A;  2QKB A;  4ELV A;  1U45 A;  1KRP A;  4DS4 A;  2KW4 A;  1ZBH A;  1NK8 A;  3HP6 A;  4QAG A;  2DY4 A;  1RDC A;  1IKY A;  2WON A;  3LZJ A;  3SV4 A;  3DMJ A;  5EU7 A;  1NK4 A;  4FW2 A;  3K5M A;  4KHQ A;  1ZBI A;  3M8R A;  4FXD A;  3SQ1 A;  4W5Q A;  1IKW A;  1RBU A;  4HCC A;  3OYE A;  1BIZ A;  3M8P A;  3KD1 E;  3NAE A;  4EZ6 A;  4B08 A;  1KVB A;  4E7I A;  2QXF A;  4E89 A;  3EYZ A;  3SJJ A;  1TKD A;  4LSL A;  3LDS A;  4M3Y A;  2P5G A;  3JYT A;  4UQG A;  4F2S A;  4IBN A;  1GOB A;  3OYA A;  4L8R B;  4GW6 A;  4O0J A;  3VN5 A;  4I7F A;  3O3H A;  4KHW A;  3L8B A;  4KAZ A;  3AV9 A;  3ISN C;  1NJW A;  2IAJ A;  5T7B A;  4B9L A;  4FK0 A;  4DLE A;  3O3G A;  4BAC A;  1ASW A;  1UA0 A;  5C24 A;  4CJQ A;  4CHP A;  5KRT A;  3NH0 A;  4N47 A;  3C94 A;  2OPQ A;  1VRU A;  3OYN A;  4DTN A;  4M3X A;  3QLH A;  2OA8 A;  1FKP A;  3LAK A;  3F73 A;  3BGR A;  4CFA A;  3PY8 A;  5SZT A;  3LZI A;  3CQ8 A;  2HHQ A;  1RTD A;  4B9U A;  4W5N A;  2VG5 A;  1S1U A;  4FLZ A;  4FM1 A;  3DLG A;  3ZSW A;  4LH5 A;  5J2N A;  4PQU A;  2ZE2 A;  3UIQ A;  5HRO A;  1VK0 A;  3HYF A;  4JLH A;  3TAN A;  3I8D A;  4KHY A;  3D45 A;  4MFB A;  4LH4 A;  2OYQ A;  1TL1 A;  3DRP A;  2QK9 A;  2P5O A;  4RG8 A;  5FRN A;  5D3G A;  4DTJ A;  1Q8I A;  2ATQ A;  1U49 A;  1KTQ A;  3V9S A;  3NH1 A;  3OJS A;  3KK2 A;  1NOZ A;  4F3O A;  1C0U A;  1UOC A;  3OYD A;  3RMA A;  3S9H A;  3V1O A;  4YNQ A;  3K58 A;  4DF8 A;  4B9V A;  1I39 A;  3VQ5 A;  4CFB A;  1NK6 A;  3V81 A;  1VSL A;  4AHV A;  1G15 A;  1JLQ A;  4FYD A;  4KHU A;  3V1Q A;  2HNZ A;  3DRS A;  5J2Q A;  1HNV A;  2F96 A;  3WNG A;  4DQQ A;  1LV5 A;  3VQD A;  3CM6 A;  4GMJ B;  3RR7 A;  4NCA A;  1IKV A;  3FFI A;  2A1S A;  3VQ6 A;  2E6L A;  4NYN A;  4OKK A;  4DSE A;  3NF7 A;  1NKB A;  2JGU A;  4G1Q A;  1NK0 A;  1KCF A;  3SUO A;  2BDP A;  4FM2 A;  5J1E A;  3AO2 A;  3P5J A;  4ID5 A;  3LP1 A;  2DTU A;  4FZZ A;  2B6A A;  4DLG A;  4CE9 A;  3WNF A;  2XO7 A;  1Y97 A;  4O5B A;  3ZT4 A;  1I3A A;  1KVA A;  3ZCM A;  3NFA A;  4JRQ A;  1WSF A;  3MEC A;  1VSE A;  4DTM A;  4DFM A;  2HNY A;  4FCY A;  3HP9 A;  3I0R A;  1D9F A;  4FJ8 A;  3V1R A;  4I2Q A;  3ZSO A;  4W5R A;  3CG7 A;  4CJP A;  4CJR A;  2OPS A;  1L3U A;  3VQQ A;  2G8F A;  3OJU A;  4OKJ A;  2OZM A;  4Z0U A;  2AJQ A;  4B9M A;  2RN2 A;  3B6P A;  2NUB A;  1RTJ A;  2YHB A;  1FK9 A;  2HND A;  4KO0 A;  4TSX A;  4CHY A;  1S1W A;  4WE1 A;  4OPK A;  3RTV A;  3TAP A;  3S3O A;  2Q3S A;  3ZT1 A;  2YKM A;  3PV8 A;  3RMB A;  3HO1 A;  4LY7 A;  3MAQ A;  4E1M A;  1WLJ A;  3S3M A;  2PZS A;  3IS9 A;  1HYV A;  4FJN A;  3OYC A;  4HTU A;  4O4G A;  3IG1 A;  3HPG A;  3NF8 A;  4ZTF A;  4FJL A;  1J9A A;  1R0A A;  1RTI A;  4CIE A;  3NHG A;  4NCB A;  4JS5 A;  1T05 A;  4DTX A;  1EP4 A;  4DFK A;  4CHO A; 
#chains in the Genus database with same CATH topology
 3DLR A;  3KK3 A;  3R1X A;  5M1K A;  4M42 A;  2WFB A;  3SMP A;  1YIJ N;  2D0B A;  4O8U A;  3QNO A;  3OYG A;  1NG9 A;  3ZSY A;  4IG3 A;  1QHT A;  5EVZ A;  3OYL A;  4B3S K;  3HBT A;  3FR0 A;  3OYH A;  5AQF A;  3TI0 A;  2ETJ A;  2P9U B;  2YI1 A;  3DAW A;  2FBV A;  3BP8 A;  3TAF A;  1W7A A;  2D1K A;  4JKF A;  2VGM A;  5JIC A;  2EX3 A;  3LM2 A;  4Q0B A;  1VSJ A;  1DTT A;  3VQE A;  5KGW A;  1Q9X A;  4JKB A;  3TR8 A;  4OGE A;  1KLM A;  5AQM A;  3AAQ A;  2QEX N;  3K0S A;  3QET A;  2BAN A;  2ZGY A;  4A2A A;  1JLB A;  4DSF A;  2A5X A;  1WAJ A;  3DLE A;  3K57 A;  1GOA A;  2GBZ A;  5BR8 K;  4FK2 A;  2I7P A;  1NKE A;  2GEM A;  2P9N B;  1VSD A;  1EWR A;  4H0T B;  3CHW A;  5HLF A;  2G8K A;  2HF4 A;  1TGO A;  3VEW A;  1SL2 A;  3LL3 A;  3MX2 A;  1ZBS A;  4CGG A;  3ZET A;  3ZSV A;  3VEO A;  3QIO A;  2QW9 A;  3A8Y A;  4RWT A;  1ASU A;  1TKT A;  4EZ9 A;  4H5W A;  1O1W A;  3DLH A;  1A5V A;  3L4I A;  4KFB A;  3VEX A;  4U7B A;  1T6D A;  1UA1 A;  2R7Y A;  1TUU A;  3M8Q A;  4GVM A;  4IZ9 A;  1TKX A;  3T1Y K;  1HKC A;  4PL7 A;  2A1R A;  3UKR B;  4ISG A;  3F9M A;  3AVM A;  1RDB A;  3OTO K;  1N36 K;  1FKO A;  4LF4 K;  2QI2 A;  1QQC A;  4DTP A;  1WOQ A;  2I5J A;  4MDB A;  4M41 A;  3EZW A;  3LAL A;  1C0M A;  4M3R A;  3HTV A;  1BQM A;  2P9U A;  4I9Q A;  3W3D A;  3SUQ A;  4H0X B;  1V4T A;  1BI4 B;  4DU3 A;  1LW0 A;  4LF8 K;  4DB3 A;  1C0T A;  1HX1 A;  2DFH A;  5KPZ A;  1DTQ A;  1LWF A;  3AA5 X;  1T44 A;  4W5O A;  3SYZ A;  1TK5 A;  3VF4 A;  1X1P A;  2WOM A;  4CGH A;  3C65 A;  4DTO A;  4KBO A;  3NE6 A;  1KLN A;  3J7A P;  4RW6 A;  2F4V K;  1IBM K;  3J8A A;  5E84 A;  3VGM A;  2YNI A;  5GIP A;  4CHZ A;  1E4F T;  1VSF A;  5AQP A;  3QBW A;  1FJG K;  3H08 A;  4DV6 K;  2YHX A;  1NBW A;  3C6A A;  5CY4 A;  5A2Q O;  3O3F A;  2P9N A;  2E1Y A;  4BR9 A;  2ASM A;  3CFR A;  3O1B A;  1NLV A;  2RPI A;  1VQK N;  4YDU A;  2D0P A;  2VQF K;  4CVN E;  3PO4 A;  3SJH A;  3VMF B;  4B1U B;  1FXX A;  3P4I A;  4MLE A;  4K0K K;  4BDY A;  4CJW A;  3MCA B;  3LPT A;  2E4L A;  3CI5 A;  1RGI A;  2CGK A;  3LDN A;  4FVM A;  3AO4 A;  4LF9 K;  3ZSX A;  3SI6 A;  3IKM A;  3ZEU B;  3CJB A;  1IH7 A;  3WXM B;  3VF2 A;  3G0Z A;  4IFV A;  3UKR A;  1OH5 A;  2HB5 A;  2QWP A;  2YX6 A;  1XNQ K;  1WSJ A;  1HNW K;  2Q2R A;  1KFD A;  1C1C A;  5FLX O;  5LJW A;  1B92 A;  5IT9 O;  4EAH D;  3GOI A;  4H0O A;  4H03 B;  3RVC A;  1HNZ K;  5SWM A;  4BVO A;  4IEI A;  5I42 A;  1EWQ A;  1XWL A;  4CER A;  4RW7 A;  1NGC A;  1B9F A;  4CJF A;  4BDP A;  2HHH K;  4OLA A;  1QSY A;  1BI4 A;  2LSN A;  3KTQ A;  1WSE A;  1N8R O;  4BE2 A;  1NKC A;  1ATR A;  2IVP A;  4CJU A;  3AA2 A;  3CFO A;  1CXU A;  1XUP O;  2VWJ A;  4E7J A;  4KHP K;  4OJR A;  1BOT O;  5AQR A;  3A2F A;  4K25 A;  1VQ9 N;  5I3U A;  1SL1 A;  3ZSR A;  1RT7 A;  4BRQ A;  1Q86 O;  3PUF A;  3L2W A;  4K43 A;  3G71 N;  3O4W A;  3WXJ A;  2HBL A;  4E7L A;  4ISF A;  1QS4 A;  1JLF A;  5AQJ A;  5TKW A;  3LAN A;  3BY5 A;  3SLC A;  1TK8 A;  3NGZ A;  2B5J A;  4F2R A;  1YTA A;  4WQ4 A;  4DU4 A;  2UU9 K;  1MDU B;  3OVN A;  1LW2 A;  3AVG A;  4CJV A;  3TPQ A;  3VQ4 A;  1CLQ A;  5GAG P;  2YV0 X;  3FZL A;  1VQN N;  3QNN A;  4JV5 K;  1BA0 A;  4B1Y B;  1HKB A;  3OS1 A;  1B9D A;  3ZEU A;  4AIL C;  2X6S A;  3QEP A;  1JL1 A;  1YIT N;  3AVN A;  3RRG A;  4YOT A;  3PIO L;  4WQ4 C;  1XI1 A;  1SS6 A;  4ELU A;  4FWS A;  3CQY A;  1U4B A;  3RR8 A;  1RT6 A;  5FRM A;  1BO5 O;  1QHA A;  1SUQ A;  1NK7 A;  3I55 N;  3O08 A;  3HT3 A;  3W0L A;  1SL0 A;  1OH6 A;  4H4M A;  1NJY A;  2G8W A;  3L2R A;  3DYA A;  4CD3 A;  3KJV A;  2YHA A;  2W6L A;  3KLG A;  2OPP A;  5I9E B;  4A61 A;  5C2F A;  3CPE A;  4PL8 A;  2QKB A;  1KRP A;  4DS4 A;  2KW4 A;  1IV0 A;  2GUP A;  3HP6 A;  3TSP A;  1MA9 B;  1RDC A;  3SV4 A;  1NK4 A;  3K5M A;  3M8R A;  3SAH A;  4HCC A;  5KPR A;  3H1Q A;  2A41 A;  1DKG D;  4MO4 A;  4LSL A;  1MWM A;  5B8H A;  1Q18 A;  5ADX H;  4O0J A;  5DM6 L;  3O3H A;  4FK0 A;  3O3G A;  5C24 A;  4CHP A;  5CHI A;  3SMS A;  3NH0 A;  2E2O A;  3LAK A;  4DUZ K;  4CFA A;  4EIA A;  4PKG A;  2F9T A;  3L6Q A;  4W5N A;  4FM1 A;  4PQU A;  5AQH A;  2ZE2 A;  4JLH A;  5LMU K;  4DR7 K;  2QXL A;  3E1Y A;  4MFB A;  1JJ2 M;  3BZC A;  3A5M C;  4RG8 A;  5FRN A;  1Q8I A;  2QWR A;  3NH1 A;  3OJS A;  1NOZ A;  3FFK B;  3RMA A;  3V1O A;  4GKK K;  4CFB A;  4IO8 A;  1NK6 A;  3V81 A;  4CZM A;  4AHV A;  2A42 A;  3DRS A;  2V52 B;  1IBL K;  1LV5 A;  3VQD A;  3I56 N;  3PY8 A;  4CZK A;  3NF7 A;  4G1Q A;  4U67 L;  3FZH A;  3EE9 A;  3AO2 A;  4FZZ A;  1KAY A;  4IJN A;  2XO7 A;  1Y97 A;  1JCE A;  4FJ8 A;  3WQT A;  3V1R A;  2P9P A;  3ZSO A;  4JKG B;  1GLE G;  4ISE A;  1T3V A;  4CJR A;  3EN9 A;  3CME N;  2AJQ A;  4V19 S;  3B6P A;  4B3R K;  4CHY A;  2UUB K;  1S1W A;  2KHO A;  1V4S A;  2A40 A;  3S3M A;  3IS9 A;  3OYC A;  4O4G A;  1NGA A;  3IG1 A;  4ZTF A;  1J9A A;  3ENO A;  4BQL A;  4CZL A;  4O5F A;  4DFK A;  4F8R A;  3CCS N;  2PY5 A;  3AAR A;  4Z4I A;  1WSH A;  3ALY A;  1TV6 A;  2GTD A;  3LP3 A;  3M3Z A;  3PX6 A;  3IDH A;  2RE2 A;  5GAH P;  4KI6 A;  2PYJ A;  3QIP A;  4ILJ A;  5HL7 L;  2OCE A;  4BWM A;  4CK1 A;  3S3N A;  4C8N A;  4FWQ A;  4CEO A;  3HPH A;  4BRN A;  2ZGZ A;  3O1W A;  1D5A A;  2G8V A;  5FDL A;  4A5B A;  3KLE A;  2XY8 A;  4WYB A;  4PKI A;  4QOZ B;  5HP1 A;  4RW4 A;  3PO5 A;  3CCJ N;  4CEB A;  2OTL N;  1X9W A;  4KB0 A;  3KK7 A;  4CF2 A;  3CJ9 A;  3EZ5 A;  3WXL A;  5CR4 A;  2NRX A;  3THW B;  3AVB A;  2GUI A;  2ZJQ L;  2D0A A;  2XY6 A;  4KTW A;  4X66 K;  3P31 A;  4WFN L;  4DSJ A;  4JKE A;  4FM0 A;  3OYI A;  1GLJ O;  4FJX A;  3MED A;  2F8S A;  3ZT2 A;  3TWH A;  2HBJ A;  3JAM O;  3OYK A;  2G8U A;  4BR7 A;  2KTQ A;  3O8M A;  3WQU A;  3FZK A;  4H8K A;  3ZSZ A;  1WBD A;  3DLB A;  1QQM A;  4N41 A;  2ASO A;  4OX9 K;  2QTD A;  1VSH A;  4ZTJ A;  4NXN K;  2WBN A;  4JKG A;  4KV8 A;  3A5L C;  4CJ3 A;  4WCE L;  3DRR A;  1JCF A;  4J2D A;  1RBV A;  1J5O A;  1VQ5 N;  1Q9Y A;  3WNE A;  4C23 A;  4IDH A;  4AHR A;  1H1V A;  1HLU A;  3O9S A;  4YOU A;  5ADX A;  4HUG A;  1TVR A;  2Q36 A;  4M3W A;  4DTS A;  4J8F A;  3VQC A;  4C8L A;  2KFZ A;  3ID6 A;  1N32 K;  4J2A A;  4CGF A;  2HMI A;  4A57 A;  1J54 A;  3OS0 A;  4BE1 A;  3HVR A;  3LWM A;  4A62 A;  4ZHR A;  3BF3 A;  1VQL N;  2ZQB A;  4DV3 K;  3MWP A;  4CJ7 A;  2P51 A;  4N56 A;  1U04 A;  3EEQ A;  3AGK A;  3M5R A;  2Y1I A;  3AO3 A;  4PUO A;  4H0V B;  4KB1 A;  3AA3 A;  4OKE A;  1C6V A;  1W97 L;  3ZLJ A;  3Q7C A;  2NNW A;  2YNF A;  3THW A;  4KPY A;  1W0H A;  3TAM A;  2Q0R A;  3T1A A;  4C1N K;  3LAM A;  2ZJP L;  4FLU A;  4CGI A;  2NZT A;  5EXW A;  2Q1N A;  1W2B M;  3D2F B;  1HNX K;  2W41 A;  1WSG A;  4O55 A;  2PFU A;  4CZJ A;  3T3F A;  1NNE A;  2HHV A;  1RNH A;  4O0I A;  3G6E N;  4J2E A;  1HYS A;  4BQZ A;  2FBY A;  3HST B;  3TTC A;  4I2P A;  5ELZ A;  1NGI A;  3FGU A;  5BR9 A;  1VQ8 N;  3O4N A;  3ATV A;  2F7T A;  4B9Q A;  4AM7 A;  5AQX A;  1VQ7 N;  5AQY A;  3O5B A;  1BCO A;  2YNG A;  3MXI A;  4GV6 A;  4FJH A;  1SKW A;  4AHC A;  4DR2 K;  2KFN A;  3CMA N;  1YJW N;  4FJM A;  1W9H A;  5M1Q A;  4I9L A;  1VQ4 N;  3CYM A;  3THX B;  3D2E B;  4AHS A;  3N4P A;  3B6O A;  4YOX A;  2HHU A;  1KQS M;  4DUY K;  2PYL A;  3P38 A;  1HKG A;  3VTI A;  4Z4H A;  1DLO A;  3LP0 A;  5HRN A;  5JVH L;  3DXK A;  1X3N A;  1BIU A;  1S9G A;  4FLV A;  3V9W A;  3ZX2 A;  4PWD A;  2AP1 A;  4FJK A;  4UY8 O;  1UAX A;  3P1G A;  3GG4 A;  1KAZ A;  3E01 A;  4CGJ A;  3SQ0 A;  2ITG A;  4JHD B;  4E7K A;  5JVG L;  4IEE A;  3CCU N;  5E41 A;  5KPT A;  4DCH A;  4Z4G A;  1HJR A;  5BPN A;  1S1X A;  5TKY A;  2P9I B;  3M8S A;  3C6H A;  3OBW A;  5KGX A;  3H3N O;  1S6P A;  3SPY A;  1NJI O;  3D2F A;  2J4R A;  3ZX0 A;  1EO1 A;  4DV2 K;  4CF0 A;  1WSI A;  1KC8 O;  3GBT A;  4NLC A;  5BRD A;  5CYM A;  3I0S A;  1VHX A;  1S22 A;  3HZ6 A;  2Q31 A;  1ZBU A;  5CYQ A;  4DHY A;  3UE5 A;  4BC4 A;  3LWL A;  5IWA K;  4FW1 A;  1RDA A;  3ZT0 A;  1NK5 A;  2IVN A;  3T19 A;  5CZ2 A;  3KLH A;  2HHW A;  3I8B A;  1YVN A;  5AQT A;  3QES A;  3IFR A;  4CFD A;  1TAU A;  3C6U A;  1QE1 A;  1U6Z A;  3R8E A;  2VG7 A;  1ASV A;  4BR0 A;  1OH8 A;  4PY5 A;  5K14 A;  1Q82 O;  1JKH A;  3OBY A;  1RT1 A;  4B3T K;  1UWB A;  4BRE A;  4FJG A;  3THX A;  3D2E A;  3ID8 A;  3OA9 A;  1I94 K;  1VQP N;  3EO3 A;  2IDO A;  1XMQ K;  2OAN A;  1TAQ A;  3LDQ A;  1JXE A;  3MEG A;  3K5L A;  3V6D A;  5JS1 A;  1SV5 A;  1J5E K;  5KTQ A;  3AGR A;  3TSU A;  3VQ9 A;  4CEF A;  3K5N A;  1GLB G;  5LY3 A;  3NDK A;  4JI2 K;  4IG0 A;  2O8C B;  3MXJ A;  3M1F A;  4FLW A;  1R59 O;  4CED A;  4JHD A;  4AF1 A;  1YJN N;  2E20 A;  4FL9 A;  2W6K A;  5EOY A;  3TAE A;  5KQ8 A;  4FJ9 A;  5HRP A;  2P9I A;  2X74 A;  2D4W A;  4ELV A;  4WFA L;  1U2V B;  1XQS C;  4QAG A;  2E2N A;  2E2Q A;  1IKY A;  2WON A;  4YDU C;  3LZJ A;  3MN9 A;  4FXD A;  4EFH A;  1RBU A;  1HJO A;  4B08 A;  4B1X B;  2QXF A;  5AQW A;  1NU0 A;  3EKS A;  4FSV A;  2P5G A;  3JYT A;  4UQG A;  1SAZ A;  3J80 O;  4GW6 A;  3O9R A;  3DWL A;  3L8B A;  4KAZ A;  3ISN C;  2IAJ A;  5AQV A;  2UXB K;  4O8K A;  4DLE A;  4BAC A;  4X64 K;  3CCM N;  1WB9 A;  1VRU A;  1YXQ A;  4LFA K;  3OYN A;  3QLH A;  4JKA A;  1FKP A;  3LDL A;  4BRG A;  3CPW M;  4CZF A;  5SZT A;  4JEP A;  3CQ8 A;  2HHQ A;  1RTD A;  2JWK A;  1S1U A;  5HRO A;  3E9P A;  4FOI A;  4KHY A;  2OYQ A;  3DRP A;  4PKH A;  3SK3 A;  4DTJ A;  2ATQ A;  1KTQ A;  3V9S A;  2NRH A;  3KK2 A;  1C0U A;  4YNQ A;  1S3X A;  4JKD A;  3O9U A;  3VGK A;  1G15 A;  1NGH A;  2E2P A;  3V1Q A;  5J2Q A;  3T69 A;  2AA4 A;  3QFP A;  4H5T A;  4NCA A;  5KQD A;  2PAV A;  3FFI A;  2E6L A;  4NYN A;  4OO1 J;  4B1Z A;  1KCF A;  2O8C A;  2KLA A;  5J1E A;  2A6A A;  4FOE A;  3I33 A;  4CE9 A;  3G4S N;  3MN6 A;  3CIP A;  2GEL A;  1WSF A;  2HHS A;  1GLL O;  4BC3 A;  2BTF A;  3I0R A;  3CG7 A;  1QZ6 A;  4BRK A;  1L3U A;  4OKJ A;  2YHB A;  1U2V A;  2BGG A;  4TSX A;  3S3O A;  5FPD A;  3HO1 A;  4LY7 A;  3MAQ A;  4E1M A;  2PZS A;  4CIE A;  2YJF A;  3VOV A;  4JS5 A;  3VTH A;  4CBX A;  2VQE K;  1MU2 A;  1QSS A;  1LCU A;  3WUH A;  5DM7 L;  3VEN A;  5M1F A;  1BGX T;  3R9P A;  2JLE A;  1NGB A;  3J7Y P;  1RBT A;  3QEV A;  3QB0 A;  5FPM A;  1RBR A;  1ESV A;  4BRO A;  4DFP A;  1RT4 A;  4FWL A;  3T7Z A;  2KZM A;  3WEE B;  2P9P B;  4BGB A;  1DT9 A;  2ZM6 K;  3U8X A;  3PX4 A;  4LFB K;  4M7X A;  3TAR A;  3PX0 A;  4IOC L;  3U3G A;  2FF6 A;  3TAG A;  5AZJ B;  4CZI A;  5AQS A;  1IJJ A;  4DFJ A;  3BF1 A;  3OY9 A;  2UUA K;  1XNR K;  2E88 A;  3QEX A;  1RBS A;  1A5X A;  1LWE A;  3D7E O;  4FVU A;  4ID1 A;  5GAE P;  1CXQ A;  3CC2 N;  1HQE A;  4CBU A;  4Q5V A;  3CJ7 A;  1LAW A;  2P9S A;  3L2U A;  1GOC A;  4DSL A;  1OVQ A;  2XHB A;  4KTZ A;  2E6M A;  3P83 D;  3U3Y A;  4JAX A;  4OPA A;  1VAZ A;  1OKJ A;  2HBM A;  1K6Y A;  2XY5 A;  1HPM A;  4DV4 K;  2HHX A;  4QS7 A;  3NVM A;  3QIC A;  2NRW A;  4FLT A;  4PA1 A;  5BPL A;  3IMX A;  4CZG A;  3H6E A;  4KH6 A;  3V9X A;  5JS2 A;  4DR1 K;  4O44 A;  5C0Y A;  2F8T A;  4LF5 K;  1IG8 A;  4MLH A;  5F0X A;  4JKC A;  1F21 A;  2IS3 A;  1JLG A;  2X78 A;  3IUC A;  5HBM A;  1XC9 A;  2Z1G A;  3LPU A;  1KVC A;  1N6Q A;  4CK3 A;  3CJA A;  4ILG B;  4JI3 K;  2E1Z A;  3HVT A;  3AVK A;  1YAG A;  4M63 C;  3ENH A;  4ICL A;  4B8A B;  4EHU A;  3WT0 A;  2D0C A;  4FWR A;  1VQO N;  1VSK A;  1E3M A;  1IKX A;  1BU6 O;  4FJI A;  1JCG A;  3MDQ A;  3WEE A;  4CHN A;  2ITM A;  5GIN A;  4CF9 A;  3V9Z A;  3SAG A;  1U47 A;  1RIL A;  2CGL A;  4BGA A;  5AJ3 K;  3TTD A;  5AZJ A;  3H1V X;  3K9K A;  1NOY A;  4HVJ A;  2HHT A;  2YJE A;  4NXM K;  4FJJ A;  4HHT A;  4BE0 A;  3ZSQ A;  2Z1H A;  1EX4 A;  4FLX A;  2QWL A;  3SAF A;  1C0F A;  2NRV A;  3AO5 A;  3MXM A;  3THV A;  4XIU A;  1Z26 A;  1RDW X;  4XH5 A;  5C10 A;  4CF8 A;  4C8M A;  4DQI A;  1S1V A;  1RT5 A;  3QEW A;  4FWO A;  2KZZ A;  3OHR A;  3KIO A;  4FJ7 A;  4Y1D A;  3S41 A;  1XC3 A;  2IIR A;  3O9T A;  4CCH A;  2FSN A;  2YNH A;  4KI4 A;  1WNS A;  3T1H K;  1BCM A;  1ZXO A;  3KLI A;  5FRO A;  4B3O A;  4CZH A;  1QVF M;  3AVH A;  1E4G T;  4X62 K;  4JI1 K;  4JN4 A;  3QFU A;  4E1N A;  1D9D A;  3QBX A;  4OGC A;  5AQN A;  1P90 A;  5C42 A;  1QVG M;  1REV A;  3SBG A;  1DEJ A;  2IOC A;  1NGD A;  2XY7 A;  4KRF A;  1WAF A;  2X6N A;  3SUN A;  5JLF A;  2QWQ A;  2YHW A;  3DLK A;  1ILY A;  1WN7 A;  3LM9 A;  3VQ7 A;  3CF5 L;  4BWJ A;  4CJ5 A;  1YVU A;  4AHT A;  1HRH A;  1KFS A;  5MLC Q;  4IFY A;  1ZBL A;  5M1N A;  1HR0 K;  3CCR N;  1KSP A;  3QEI A;  4JI7 K;  1HQU A;  4YOY A;  4KHN A;  1T03 A;  4JNE A;  1Z05 A;  4HUF A;  5LMN K;  4G9Z A;  2UXC K;  3MN5 A;  4DQS A;  4CJE A;  4JI4 K;  5F2R A;  2D5R A;  1JLC A;  4AQY K;  4BRI A;  3K59 A;  3AVC A;  4B9T A;  4QS8 A;  1VRT A;  3KLF A;  1X9J A;  4CD1 A;  4DR4 K;  2P1J A;  2HF3 A;  4DS5 A;  5DMR A;  4R5P A;  4CFC A;  3H45 C;  3L4Q A;  4IFE A;  1K9M O;  4DWI A;  2O8B B;  4KTQ A;  1ITG A;  1OVY A;  4CK2 A;  1RT3 A;  3NBP A;  3E9L A;  3MWT A;  4FJ5 A;  3VQ8 A;  1ATS A;  1N34 K;  3DI6 A;  4FWM A;  1SKR A;  5HRS A;  1T7P A;  5J2P A;  4DSI A;  3F9K A;  4DKW A;  4E19 A;  1NMD A;  1TK0 A;  2VYP A;  3AVL A;  3KK1 A;  4M3U A;  4JK8 A;  2G8H A;  2WTU A;  2UYT A;  1Y64 A;  4EP5 A;  2OZS A;  3DXK B;  1HPZ A;  2GWJ A;  3WNH A;  3AO1 A;  4CJL A;  2IVO A;  3C7N B;  1X9S A;  1TYQ B;  2CGJ A;  1OH7 A;  5M1O A;  2Z1I A;  1SZ2 A;  3SUP A;  2PBD A;  2VG6 A;  3EL2 A;  1CZB A;  1C1A A;  5AQG A;  4H0P A;  3ULD A;  3HL8 A;  4JS4 A;  5M1P A;  3EE8 A;  3OYB A;  3OYM A;  3CCV N;  3WXK A;  1X9M A;  4Z4F A;  3KKS A;  3NF6 A;  4YHH K;  4N5S A;  1EQY A;  3PLA A;  1RTH A;  1GLF O;  4XEI A;  1BHL A;  3RRH A;  3DOL A;  4BVP A;  3EKU A;  3VQB A;  2A3Z A;  4GKJ K;  3QER A;  1ZYQ A;  3P39 A;  2V7Z A;  4IOA L;  1IO2 A;  5JMV A;  1ZC6 A;  2VWB A;  4ELT A;  4IJA A;  4CEZ A;  4OVL A;  1N33 K;  1XHX A;  2YHY A;  3AAP A;  4BC2 A;  2B4J A;  1VSI A;  4GV9 A;  4DR6 K;  4JYA K;  1K8A O;  4JD2 B;  3D0P A;  1GLA G;  2W40 A;  3SNN A;  1HYZ A;  4IKF A;  2GV9 A;  3AA4 A;  3E66 A;  1ZBF A;  1S1T A;  4BG8 A;  1X3M A;  1YUW A;  1NK9 A;  1S72 N;  2YKN A;  3G25 A;  4LD0 A;  1L5U A;  1Z25 A;  3PIP L;  4E3S A;  2O8B A;  3CC4 N;  3SBT A;  1BQN A;  2XRI A;  4L3Q A;  1HUX A;  3HM9 A;  3N4Q A;  5BRE A;  2DFE A;  1XMO K;  3FZF A;  5AQU A;  1U45 A;  4QS9 A;  1ZBH A;  2OTJ N;  1NK8 A;  4RTF D;  3DMJ A;  4KHQ A;  3LDP A;  4FW2 A;  1ZBI A;  3CQX A;  2V7Y A;  3SQ1 A;  4W5Q A;  1IKW A;  3OYE A;  1BIZ A;  1KVB A;  4E89 A;  3HI0 A;  4BRH A;  3LDS A;  4OPH A;  4IBN A;  3C7N A;  1GOB A;  1TYQ A;  5EY4 A;  3WXI A;  3VN5 A;  4KHW A;  3UKU B;  3AV9 A;  1NJW A;  4B9L A;  5LL6 Z;  1P8Z A;  3A5N C;  5KRT A;  4N47 A;  3TU5 A;  4JI6 K;  4DTN A;  4CZE A;  2GWK A;  3F73 A;  3LZI A;  2UUC K;  4B9U A;  2VG5 A;  3ZSW A;  4LH5 A;  5J2N A;  4LF7 K;  4JKH A;  1VK0 A;  3HYF A;  3TAN A;  3A5O C;  3D45 A;  3C0B A;  1TL1 A;  1NGG A;  1BUP A;  4YOV A;  3O80 A;  4F3O A;  1UOC A;  3OYD A;  3CET A;  3VQ5 A;  4FPA A;  1IBK K;  4FYD A;  2F96 A;  2VCP A;  3U9D A;  3VES A;  4WF9 L;  4GMJ B;  3RR7 A;  1MWK A;  1IKV A;  4DV1 K;  2A1S A;  4JD2 A;  1NK0 A;  1NKB A;  3SUO A;  4FM2 A;  1KD1 O;  4ID5 A;  2DTU A;  3Q7B A;  2B6A A;  2H3G X;  1BG3 A;  2FSJ A;  3KWI A;  3GDQ A;  1I3A A;  1KVA A;  3ZCM A;  4DTM A;  3MMV A;  3MEC A;  4DFM A;  1VSE A;  1D9F A;  2HNY A;  3HP9 A;  4I2Q A;  3TSQ A;  4CJP A;  4JI8 K;  2KKZ A;  2FF3 B;  3MX5 A;  3VET A;  4A59 A;  3CJ1 A;  2OZM A;  4B9M A;  2NUB A;  1RTJ A;  3RWU A;  1FK9 A;  2HND A;  3TAP A;  3RTV A;  4OPK A;  2Q3S A;  3RMB A;  2YKM A;  1M1K O;  4GY2 B;  1HYV A;  3HPG A;  4FJL A;  3JS6 A;  3HOT A;  4BRP A;  4NCB A;  4DTX A;  1EP4 A;  4FWP A;  1KXP A;  4BR2 A;  1NM1 A;  2ZD1 A;  2ZJR L;  3HJF A;  2YCH A;  3SQ2 A;  4Y1C A;  3DJC A;  3EY1 A;  1YT3 A;  2O4G A;  3UKU A;  4OPJ A;  4K41 A;  3CCQ N;  3NGI A;  3VQP A;  5FPE A;  4B9N A;  3AVI A;  5AFU H;  2OPR A;  3MK6 A;  4FK4 A;  1KAX A;  3F2K A;  3AVF A;  2GX9 A;  3C6T A;  4CEA A;  1D8Y A;  4DQP A;  5GIO A;  5DK5 A;  3HM8 A;  4KRE A;  5C2D A;  4PHT X;  4C8K A;  4BRL A;  1RT2 A;  3C95 A;  4C8O A;  5BRF A;  2HVH A;  4H5V A;  3NF9 A;  1CZ9 A;  2IC3 A;  3K9J A;  4M3T A;  4K8Z A;  1QTM A;  2O8F B;  2QKK A;  2V51 B;  4RW8 A;  3FE1 A;  3NMU A;  4DV0 K;  3KKR A;  1S5J A;  3KD5 E;  4K42 A;  3SZ2 A;  4KHS A;  1K8K B;  2Y1J A;  3VPZ A;  4R79 A;  2O4I A;  2FC0 A;  4J2B A;  3ASM A;  1T6C A;  5AZI B;  3BUZ B;  3TAB A;  2W42 A;  3IAY A;  4A2B A;  4B1W B;  1HNI A;  3IRX A;  4QCL A;  3VA0 A;  4CES A;  5AQZ A;  3HOS A;  1L3V A;  3CM5 A;  1NGE A;  4M7Y A;  3VEZ A;  1YI2 N;  2FSK A;  4WQ5 A;  5AQI A;  4LFC K;  2IGI A;  4FWK A;  4DQR A;  4Z4E A;  4FZX C;  3ZYY X;  4DV5 K;  3AVA A;  3RSE B;  3ZT3 A;  3R6M A;  3VER A;  1BDG A;  3TTF A;  3NH2 A;  2KQ2 A;  5E26 A;  4JRP A;  5F1X A;  3G10 A;  3THY B;  4CW7 B;  3U4L A;  1WBB A;  2P9S B;  3QML A;  4N76 A;  2QM1 A;  4DR5 K;  2I7N A;  1RFQ A;  1RDD A;  4AM6 A;  4CEQ A;  1NJX A;  4FWN A;  4WQ5 C;  1L3S A;  3DLL L;  3HK2 A;  3ITH A;  1U48 A;  3BZK A;  1BWF O;  4RCH A;  2E8A A;  1NGF A;  4CJ4 A;  3L0Q A;  3SCX A;  1JLA A;  3ENB A;  4YFU A;  2F9W A;  4EHT A;  4NYF A;  4YOW A;  3L3U A;  2G8I A;  4I6M B;  3LP2 A;  1TUY A;  2NRR A;  4E7H A;  5KI6 A;  1JXB A;  2VWK A;  4KKO A;  1EET A;  5BRH A;  3PSI A;  2O8F A;  5BPM A;  4MO5 A;  3V4I A;  3K2P A;  1S6Q A;  4HCB A;  2CH6 A;  1QQN A;  2EWS A;  2FBT A;  1K8K A;  1C1B A;  4CF1 A;  2D0O A;  1O13 A;  4AH9 A;  1NMN A;  5AZI A;  2P9L B;  4YOR A;  4DMN A;  4H0Y B;  3MN7 A;  5FPN A;  4XH1 A;  3MEE A;  3O9Q A;  3HPO A;  1BIS A;  3KVG A;  5C25 A;  4IO9 L;  1Z6R A;  4M3Z A;  2DPN A;  2QA4 N;  3CCE N;  3DM2 A;  3SV3 A;  2NRZ A;  3JXU A;  3LDO A;  4Z94 A;  2Z1J A;  1N5Y A;  1Q7Y O;  4M45 A;  4BRF A;  3RSE A;  4C1N I;  4CEE A;  1YTU A;  3RMD A;  1GLD G;  4DF4 A;  4HWI A;  2HMP A;  4DG1 A;  2FLO A;  3THY A;  5AFU A;  4CI6 A;  4OLB A;  4H5R A;  1VSM A;  3CFP A;  1NGJ A;  4E1J A;  5HRR A;  2CH5 A;  3ULE B;  4DU1 A;  1EKE A;  1YF5 L;  5CZ1 A;  5JLH A;  4EP4 A;  3U9Z A;  2RF2 A;  5BN8 A;  4NCG A;  3R3L A;  4RW9 A;  3VA3 A;  1TKZ A;  2DFF A;  3PSF A;  2ZWH A;  3JSM A;  1IG9 A;  4K8X A;  4HUE A;  3L3V A;  3U6F A;  4MQ3 A;  5LJV A;  4YY3 K;  2O8E B;  2O8D B;  4BRC A;  2HW3 A;  3CD6 N;  3A0I X;  3NVK A;  4I6M A;  4H4O A;  3DOK A;  1VQM N;  2WC9 A;  5C12 A;  1WUA A;  2P9K B;  1T8E A;  3AVJ A;  2Q97 A;  4DSK A;  3MCP A;  1HMV A;  4CIG A;  1VQ6 N;  3NGY A;  4GNI A;  3NCI A;  4BDZ A;  4DV7 K;  4FLY A;  1L3T A;  3OYJ A;  2HVI A;  4NB4 A;  5AR0 A;  3DXM B;  3VQA A;  3CXC M;  3HXM A;  3KHY A;  1QSL A;  3RMC A;  3H46 O;  2JWL A;  4CJS A;  3E9O A;  3SPZ A;  2P9L A;  4BR4 A;  2Q0U A;  1EXQ A;  3QDK A;  5AQO A;  3VF6 A;  1BA1 A;  2BE2 A;  4W5T A;  2NLX A;  5GAD P;  3L2V A;  3CJC A;  1JLE A;  3TAQ A;  4CJK A;  3J7Z O;  4B3M K;  4BC5 A;  4Z4C A;  4BRA A;  3B8A X;  4CJT A;  1SKS A;  4CGD A;  1TL3 A;  4DTU A;  1DGK N;  3QO9 A;  3FLC O;  3SQ4 A;  5EX5 A;  4CIF A;  4B8C A;  3QIN A;  1LAV A;  4E0D A;  1A5W A;  1C0G A;  4LC9 B;  5KRS A;  3L2Q A;  4FZY A;  4JI0 K;  4MDA A;  3GE1 A;  4JI5 K;  4AHU A;  3BDP A;  2EHG A;  3ULE A;  1LOT B;  1K73 O;  1BL3 A;  3OYF A;  4A5A A;  4BRD A;  1JL2 A;  1G99 A;  4BY9 C;  4F4K A;  4H5N A;  4B9S A;  4GVE A;  3OS2 A;  4LSN A;  1CZA N;  3K5O A;  4FO0 A;  4BRM A;  4CEC A;  2HOE A;  4IDK A;  4WFB L;  1RCH A;  3O4Q A;  3J81 O;  1YHQ N;  4FPB A;  1GLC G;  2UXD K;  1LWC A;  1S9E A;  3ATU A;  4KH5 A;  4F3T A;  2BUP A;  4Y0W A;  1NJZ A;  4DR3 K;  2QWM A;  2O8E A;  2O8D A;  1D4X A;  1FW6 A;  2ASP A;  3VEY A;  4F9O A;  2FBX A;  3BEX A;  5J2M A;  2P9K A;  2RKI A;  4ILH A;  1J53 A;  5C15 A;  1XHZ A;  3HRG A;  3V9U A;  4B1V A;  3OW2 M;  1M90 O;  5AQQ A;  2VGN A;  3H3O B;  3DXM A;  4IXC A;  2DY4 A;  5EU7 A;  3KWG A;  3CC7 N;  2NRT A;  2WUS A;  1J6Z A;  3M8P A;  3KD1 E;  3NAE A;  4EZ6 A;  4E7I A;  3EYZ A;  3SJJ A;  4HTL A;  1TKD A;  4M3Y A;  2E5L K;  4F2S A;  4NO7 A;  3OYA A;  4L8R B;  5HOO A;  4I7F A;  2ZF5 O;  5T7B A;  1QZ5 A;  5BN9 A;  3CER A;  4CBW A;  1ASW A;  1UA0 A;  4CJQ A;  5AQK A;  3C94 A;  2OPQ A;  2QWO A;  4M3X A;  4JK7 A;  2RHK A;  4X65 K;  2OA8 A;  3BGR A;  4IWV A;  3ZX3 A;  2QWN A;  1NWK A;  3UB5 A;  4FLZ A;  3DLG A;  2HBK A;  3UIQ A;  3I8D A;  4LH4 A;  2BH1 A;  2QK9 A;  3CCL N;  2P5O A;  1QQO A;  4BG9 A;  5D3G A;  1U49 A;  1YJ9 N;  4GV3 A;  3S9H A;  4LF6 K;  4KH4 A;  2HST A;  3K58 A;  4DF8 A;  4B9V A;  1I39 A;  3O6W A;  1SQK A;  1VSL A;  1JLQ A;  4BR5 A;  3D6R A;  4KHU A;  1ATN A;  2HNZ A;  3VGL A;  5CE3 A;  1HNV A;  3WNG A;  4DQQ A;  3CM6 A;  3VQ6 A;  4DSE A;  3F5T A;  4OKK A;  2JGU A;  1RDU A;  2BDP A;  3FZM A;  4NLB A;  3M6G A;  4IOX A;  3P5J A;  3LP1 A;  3GL1 A;  4JK9 A;  4DLG A;  3AY9 A;  3KZB A;  3WNF A;  4O5B A;  3ZT4 A;  3NFA A;  4JRQ A;  4FCY A;  3HSC A;  4W5R A;  4DQ8 A;  2FXU A;  2OPS A;  2G8F A;  3VQQ A;  3OJU A;  4Z0U A;  2RN2 A;  1Q81 O;  3ZET B;  4CHQ A;  4DTR A;  4KO0 A;  4WE1 A;  4XH4 A;  3ZT1 A;  3PV8 A;  3VEV A;  1WLJ A;  4FJN A;  4HTU A;  5AQL A;  3NF8 A;  1R0A A;  1RTI A;  3NHG A;  5H1S Q;  1T05 A;  4CHO A; 
#chains in the Genus database with same CATH homology
 3DLR A;  3KK3 A;  2PY5 A;  4Z4I A;  1MU2 A;  1WSH A;  2ZD1 A;  3ALY A;  4M42 A;  1TV6 A;  3HJF A;  1QSS A;  3LP3 A;  4FJK A;  3SQ2 A;  4Y1C A;  2D0B A;  3EY1 A;  1YT3 A;  3PX6 A;  2O4G A;  4OPJ A;  1BGX T;  3NGI A;  4KI6 A;  3QNO A;  3QIP A;  3VQP A;  3OYG A;  2JLE A;  2PYJ A;  3ZSY A;  1RBT A;  4BWM A;  3QEV A;  4IG3 A;  4B9N A;  1RBR A;  1QHT A;  3AVI A;  2OPR A;  4C8N A;  4CK1 A;  3OYL A;  3S3N A;  4CEO A;  3HPH A;  4DFP A;  4FK4 A;  1RT4 A;  2KZM A;  1D5A A;  3AVF A;  3OYH A;  2G8V A;  3C6T A;  5FDL A;  4CEA A;  1D8Y A;  4DQP A;  3TI0 A;  3KLE A;  2XY8 A;  5DK5 A;  4QOZ B;  2ETJ A;  3PX4 A;  4KRE A;  5HP1 A;  3TAR A;  1NKC A;  4RW4 A;  3PX0 A;  3PO5 A;  4C8K A;  3U3G A;  1RT2 A;  3C95 A;  3TAG A;  2FBV A;  3TAF A;  4CEB A;  4C8O A;  4DFJ A;  3OY9 A;  1X9W A;  2EX3 A;  3QEX A;  4CHQ A;  3NF9 A;  1CZ9 A;  4KB0 A;  1RBS A;  1A5X A;  2IC3 A;  1VSJ A;  1DTT A;  1LWE A;  3VQE A;  4Q0B A;  4M3T A;  4K8Z A;  5KGW A;  4CF2 A;  3EZ5 A;  1QTM A;  1Q9X A;  4ID1 A;  3AVB A;  2GUI A;  2QKK A;  2D0A A;  2XY6 A;  4KTW A;  4RW8 A;  3TR8 A;  4DSJ A;  1CXQ A;  3KKR A;  4OGE A;  1HQE A;  1S5J A;  1KLM A;  4Q5V A;  3KD5 E;  4FM0 A;  3OYI A;  3SZ2 A;  4KHS A;  4FJX A;  3MED A;  3QET A;  2F8S A;  2BAN A;  1LAW A;  3ZT2 A;  1JLB A;  3L2U A;  3TWH A;  4DSF A;  1GOC A;  3OYK A;  2Y1J A;  4DSL A;  2O4I A;  2G8U A;  2FC0 A;  4J2B A;  1WAJ A;  3ASM A;  3DLE A;  2XHB A;  4KTZ A;  2E6M A;  3P83 D;  3U3Y A;  2KTQ A;  3K57 A;  1GOA A;  2GBZ A;  4H8K A;  3ZSZ A;  2W42 A;  3TAB A;  1NKE A;  3IAY A;  4FK2 A;  1K6Y A;  1VSD A;  3DLB A;  2XY5 A;  1HNI A;  3IRX A;  4N41 A;  2HHS A;  4QCL A;  2HHX A;  3VA0 A;  4FLT A;  4CES A;  5HLF A;  1VSH A;  4ZTJ A;  1TGO A;  4PA1 A;  2G8K A;  2BGG A;  1SL2 A;  1L3V A;  3CM5 A;  4KV8 A;  3V9X A;  5JS2 A;  4CJ3 A;  4O44 A;  3DRR A;  2F8T A;  2IGI A;  1RBV A;  4CGG A;  1J5O A;  4J2D A;  4DQR A;  1Q9Y A;  3ZSV A;  3WNE A;  4Z4E A;  1F21 A;  4FZX C;  4AHR A;  3QIO A;  3AVA A;  3ZT3 A;  2IS3 A;  1JLG A;  2X78 A;  1ASU A;  5HBM A;  1TKT A;  1XC9 A;  4EZ9 A;  4HUG A;  1TVR A;  2Z1G A;  3LPU A;  1KVC A;  1N6Q A;  1O1W A;  3NH2 A;  4DTS A;  3DLH A;  1A5V A;  4M3W A;  4CK3 A;  2KQ2 A;  4KFB A;  3VQC A;  4JRP A;  4C8L A;  2KFZ A;  3G10 A;  1UA1 A;  2R7Y A;  3HVT A;  3AVK A;  3M8Q A;  4J2A A;  4GVM A;  4CGF A;  4N76 A;  4ICL A;  2HMI A;  1TKX A;  1J54 A;  1RDD A;  4B8A B;  4CEQ A;  2A1R A;  2D0C A;  1NJX A;  3OS0 A;  4BE1 A;  1L3S A;  3HK2 A;  1VSK A;  3ITH A;  3AVM A;  3HVR A;  1IKX A;  1U48 A;  1RDB A;  4FJI A;  3LWM A;  1FKO A;  4ZHR A;  2ZQB A;  1QQC A;  4DTP A;  4CHN A;  2P51 A;  4N56 A;  2I5J A;  4M41 A;  4CF9 A;  3V9Z A;  1U04 A;  4CJ4 A;  3LAL A;  1C0M A;  4M3R A;  3SCX A;  1JLA A;  1BQM A;  3AO3 A;  4YFU A;  2Y1I A;  1U47 A;  4I9Q A;  4PUO A;  3SUQ A;  1RIL A;  4KB1 A;  3AA3 A;  4NYF A;  1NOY A;  4HVJ A;  1BI4 B;  3L3U A;  1C6V A;  1LW0 A;  4OKE A;  4DU3 A;  2G8I A;  2HHT A;  1C0T A;  3LP2 A;  2DFH A;  4FJJ A;  1DTQ A;  1LWF A;  3AA5 X;  4W5O A;  4HHT A;  3SYZ A;  4BE0 A;  1TK5 A;  3ZSQ A;  5KI6 A;  1JXB A;  2VWK A;  4KKO A;  1EET A;  4E7H A;  2Z1H A;  1X1P A;  2WOM A;  4CGH A;  2YNF A;  4DTO A;  1EX4 A;  4KPY A;  4FLX A;  1W0H A;  3TAM A;  3T1A A;  3V4I A;  3K2P A;  3LAM A;  1S6Q A;  3AO5 A;  4FLU A;  3NE6 A;  3MXM A;  1KLN A;  3THV A;  4XIU A;  1Z26 A;  4HCB A;  4RW6 A;  4CGI A;  2FBT A;  1C1B A;  2YNI A;  4CF8 A;  4CF1 A;  4C8M A;  4CHZ A;  4DQI A;  1VSF A;  1WSG A;  1S1V A;  1RT5 A;  4O55 A;  3QEW A;  3H08 A;  4AH9 A;  3T3F A;  2KZZ A;  2HHV A;  5CY4 A;  1RNH A;  3KIO A;  4FJ7 A;  4O0I A;  4Y1D A;  4DMN A;  3O3F A;  4CCH A;  4J2E A;  1HYS A;  2YNH A;  2FBY A;  3HST B;  3MEE A;  4I2P A;  4KI4 A;  1WNS A;  1BCM A;  3CFR A;  3HPO A;  3KLI A;  5FRO A;  1BIS A;  4B3O A;  5C25 A;  4M3Z A;  2RPI A;  3AVH A;  3DM2 A;  3O4N A;  3SV3 A;  4F8R A;  1BCO A;  3PO4 A;  4E1N A;  1D9D A;  2YNG A;  2Z1J A;  3MXI A;  4OGC A;  1N5Y A;  4M45 A;  4FJH A;  5C42 A;  1SKW A;  1REV A;  4AHC A;  2IOC A;  2XY7 A;  2KFN A;  4KRF A;  1WAF A;  4CEE A;  2X6N A;  1FXX A;  3SUN A;  4FJM A;  1YTU A;  4BDY A;  1W9H A;  4CJW A;  3RMD A;  4I9L A;  3LPT A;  3CYM A;  4DF4 A;  3DLK A;  2E4L A;  1WN7 A;  3VQ7 A;  4BWJ A;  4CJ5 A;  1YVU A;  4AHS A;  4DG1 A;  4FVM A;  1HRH A;  4AHT A;  1KFS A;  3AO4 A;  4OLB A;  4IFY A;  3B6O A;  1ZBL A;  1VSM A;  3CFP A;  3ZSX A;  3SI6 A;  5HRR A;  4DU1 A;  2HHU A;  1EKE A;  1IH7 A;  1KSP A;  2PYL A;  5CZ1 A;  4EP4 A;  3G0Z A;  3QEI A;  4IFV A;  4Z4H A;  1HQU A;  2HB5 A;  4KHN A;  1T03 A;  1WSJ A;  1DLO A;  2RF2 A;  3LP0 A;  1KFD A;  4NCG A;  1C1C A;  4HUF A;  1B92 A;  4RW9 A;  5HRN A;  1BIU A;  3VA3 A;  1TKZ A;  5SWM A;  2DFF A;  1S9G A;  4FLV A;  3JSM A;  3V9W A;  4DQS A;  5I42 A;  4PWD A;  1IG9 A;  4CJE A;  1XWL A;  3L3V A;  4CER A;  4HUE A;  4K8X A;  3U6F A;  4RW7 A;  4MQ3 A;  1UAX A;  1B9F A;  4BDP A;  3P1G A;  4CJF A;  2D5R A;  4OLA A;  2HW3 A;  1QSY A;  1BI4 A;  1JLC A;  2LSN A;  3E01 A;  3KTQ A;  3K59 A;  1WSE A;  3AVC A;  4B9T A;  4H4O A;  1VRT A;  3DOK A;  3KLF A;  4CJU A;  4CGJ A;  4BE2 A;  3AA2 A;  3CFO A;  2ITG A;  3SQ0 A;  1CXU A;  2P1J A;  4E7K A;  1T8E A;  4DSK A;  3AVJ A;  4DS5 A;  2HVH A;  5DMR A;  4R5P A;  4CFC A;  5E41 A;  2VWJ A;  1HMV A;  1HJR A;  4CIG A;  4DWI A;  4Z4G A;  1S1X A;  4E7J A;  4KTQ A;  1ITG A;  3NGY A;  3NCI A;  4OJR A;  3M8S A;  4CK2 A;  4BDZ A;  1RT3 A;  5KGX A;  1S6P A;  3NBP A;  4FJ5 A;  3SPY A;  3A2F A;  3VQ8 A;  4FLY A;  3DI6 A;  1SKR A;  1L3T A;  5HRS A;  3OYJ A;  5I3U A;  1SL1 A;  1T7P A;  2HVI A;  3VQA A;  1CLQ A;  4CF0 A;  5J2P A;  1WSI A;  3HXM A;  4DSI A;  1QSL A;  3F9K A;  4E19 A;  3ZSR A;  5CYM A;  3RMC A;  1RT7 A;  3I0S A;  1TK0 A;  3AVL A;  3PUF A;  3KK1 A;  4CJS A;  3SPZ A;  2G8H A;  4M3U A;  1ZBU A;  5CYQ A;  3L2W A;  1EXQ A;  3LWL A;  4EP5 A;  2OZS A;  4FW1 A;  1RDA A;  3ZT0 A;  1HPZ A;  1NK5 A;  3WNH A;  3AO1 A;  4CJL A;  1X9S A;  2BE2 A;  4DTR A;  4E7L A;  4W5T A;  3T19 A;  5CZ2 A;  2Z1I A;  1QS4 A;  3KLH A;  1JLF A;  2HHW A;  3LAN A;  3L2V A;  1TK8 A;  3SUP A;  1JLE A;  3NGZ A;  2VG6 A;  3TAQ A;  2B5J A;  1CZB A;  4CJK A;  1C1A A;  1YTA A;  4F2R A;  3ULD A;  3HL8 A;  4JS4 A;  4CFD A;  3QES A;  1TAU A;  3C6U A;  4DU4 A;  4Z4C A;  1QE1 A;  4CJT A;  1SKS A;  3OYB A;  2VG7 A;  1ASV A;  1TL3 A;  4CGD A;  4DTU A;  3OVN A;  1LW2 A;  3QO9 A;  3OYM A;  4PY5 A;  1X9M A;  4Z4F A;  3AVG A;  5K14 A;  3SQ4 A;  1JKH A;  4CJV A;  3VQ4 A;  3KKS A;  3NF6 A;  4CIF A;  1RT1 A;  4B8C A;  3QIN A;  1LAV A;  4N5S A;  1UWB A;  1A5W A;  4E0D A;  4FJG A;  1RTH A;  2YV0 X;  5KRS A;  3L2Q A;  1BHL A;  3RRH A;  3DOL A;  3QNN A;  4FZY A;  3OS1 A;  4AHU A;  3BDP A;  1B9D A;  2EHG A;  3VQB A;  1BL3 A;  2IDO A;  3OYF A;  4AIL C;  3QER A;  2X6S A;  3QEP A;  1TAQ A;  1ZYQ A;  1JL2 A;  1JL1 A;  1JXE A;  4F4K A;  1IO2 A;  3AVN A;  3MEG A;  3K5L A;  3V6D A;  4B9S A;  5JS1 A;  3RRG A;  1SV5 A;  4ELT A;  4CEZ A;  3OS2 A;  4LSN A;  1XI1 A;  3K5O A;  5KTQ A;  4ELU A;  3VQ9 A;  4OVL A;  4CEC A;  1XHX A;  4CEF A;  3RWU A;  4IDK A;  1U4B A;  1RCH A;  1VSI A;  1RT6 A;  2B4J A;  3O4Q A;  3K5N A;  3RR8 A;  5FRM A;  1SUQ A;  1NK7 A;  3NDK A;  1LWC A;  1S9E A;  3HT3 A;  3D0P A;  3SNN A;  1SL0 A;  1HYZ A;  4IG0 A;  4F3T A;  4H4M A;  2GV9 A;  4IKF A;  1NJZ A;  1NJY A;  2G8W A;  3AA4 A;  1ZBF A;  1S1T A;  3L2R A;  3MXJ A;  2FBX A;  1NK9 A;  4FLW A;  3DYA A;  2YKN A;  2YHA A;  4CED A;  3KJV A;  3KLG A;  4LD0 A;  5J2M A;  1L5U A;  2RKI A;  1Z25 A;  2OPP A;  1J53 A;  3TAE A;  4E3S A;  4FJ9 A;  1XHZ A;  1BQN A;  2XRI A;  5HRP A;  2X74 A;  3HM9 A;  3V9U A;  2DFE A;  2QKB A;  4ELV A;  1U45 A;  1KRP A;  4DS4 A;  2KW4 A;  1ZBH A;  1NK8 A;  3HP6 A;  4QAG A;  2DY4 A;  1RDC A;  1IKY A;  2WON A;  3LZJ A;  3SV4 A;  3DMJ A;  5EU7 A;  1NK4 A;  4FW2 A;  3K5M A;  4KHQ A;  1ZBI A;  3M8R A;  4FXD A;  3SQ1 A;  4W5Q A;  1IKW A;  1RBU A;  4HCC A;  3OYE A;  1BIZ A;  3M8P A;  3KD1 E;  3NAE A;  4EZ6 A;  4B08 A;  1KVB A;  4E7I A;  2QXF A;  4E89 A;  3EYZ A;  3SJJ A;  1TKD A;  4LSL A;  3LDS A;  4M3Y A;  2P5G A;  3JYT A;  4UQG A;  4F2S A;  4IBN A;  1GOB A;  3OYA A;  4L8R B;  4GW6 A;  4O0J A;  3VN5 A;  4I7F A;  3O3H A;  4KHW A;  3L8B A;  4KAZ A;  3AV9 A;  3ISN C;  1NJW A;  2IAJ A;  5T7B A;  4B9L A;  4FK0 A;  4DLE A;  3O3G A;  4BAC A;  1ASW A;  1UA0 A;  5C24 A;  4CJQ A;  4CHP A;  5KRT A;  3NH0 A;  4N47 A;  3C94 A;  2OPQ A;  1VRU A;  3OYN A;  4DTN A;  4M3X A;  3QLH A;  2OA8 A;  1FKP A;  3LAK A;  3F73 A;  3BGR A;  4CFA A;  3PY8 A;  5SZT A;  3LZI A;  3CQ8 A;  2HHQ A;  1RTD A;  4B9U A;  4W5N A;  2VG5 A;  1S1U A;  4FLZ A;  4FM1 A;  3DLG A;  3ZSW A;  4LH5 A;  5J2N A;  4PQU A;  2ZE2 A;  3UIQ A;  5HRO A;  1VK0 A;  3HYF A;  4JLH A;  3TAN A;  3I8D A;  4KHY A;  3D45 A;  4MFB A;  4LH4 A;  2OYQ A;  1TL1 A;  3DRP A;  2QK9 A;  2P5O A;  4RG8 A;  5FRN A;  5D3G A;  4DTJ A;  1Q8I A;  2ATQ A;  1U49 A;  1KTQ A;  3V9S A;  3NH1 A;  3OJS A;  3KK2 A;  1NOZ A;  4F3O A;  1C0U A;  1UOC A;  3OYD A;  3RMA A;  3S9H A;  3V1O A;  4YNQ A;  3K58 A;  4DF8 A;  4B9V A;  1I39 A;  3VQ5 A;  4CFB A;  1NK6 A;  3V81 A;  1VSL A;  4AHV A;  1G15 A;  1JLQ A;  4FYD A;  4KHU A;  3V1Q A;  2HNZ A;  3DRS A;  5J2Q A;  1HNV A;  2F96 A;  3WNG A;  4DQQ A;  1LV5 A;  3VQD A;  3CM6 A;  4GMJ B;  3RR7 A;  4NCA A;  1IKV A;  3FFI A;  2A1S A;  3VQ6 A;  2E6L A;  4NYN A;  4OKK A;  4DSE A;  3NF7 A;  1NKB A;  2JGU A;  4G1Q A;  1NK0 A;  1KCF A;  3SUO A;  2BDP A;  4FM2 A;  5J1E A;  3AO2 A;  3P5J A;  4ID5 A;  3LP1 A;  2DTU A;  4FZZ A;  2B6A A;  4DLG A;  4CE9 A;  3WNF A;  2XO7 A;  1Y97 A;  4O5B A;  3ZT4 A;  1I3A A;  1KVA A;  3ZCM A;  3NFA A;  4JRQ A;  1WSF A;  3MEC A;  1VSE A;  4DTM A;  4DFM A;  2HNY A;  4FCY A;  3HP9 A;  3I0R A;  1D9F A;  4FJ8 A;  3V1R A;  4I2Q A;  3ZSO A;  4W5R A;  3CG7 A;  4CJP A;  4CJR A;  2OPS A;  1L3U A;  3VQQ A;  2G8F A;  3OJU A;  4OKJ A;  2OZM A;  4Z0U A;  2AJQ A;  4B9M A;  2RN2 A;  3B6P A;  2NUB A;  1RTJ A;  2YHB A;  1FK9 A;  2HND A;  4KO0 A;  4TSX A;  4CHY A;  1S1W A;  4WE1 A;  4OPK A;  3RTV A;  3TAP A;  3S3O A;  2Q3S A;  3ZT1 A;  2YKM A;  3PV8 A;  3RMB A;  3HO1 A;  4LY7 A;  3MAQ A;  4E1M A;  1WLJ A;  3S3M A;  2PZS A;  3IS9 A;  1HYV A;  4FJN A;  3OYC A;  4HTU A;  4O4G A;  3IG1 A;  3HPG A;  3NF8 A;  4ZTF A;  4FJL A;  1J9A A;  1R0A A;  1RTI A;  4CIE A;  3NHG A;  4NCB A;  4JS5 A;  1T05 A;  4DTX A;  1EP4 A;  4DFK A;  4CHO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...