1Y97A

The human trex2 3' exonuclease structure suggests a mechanism for efficient non-processive dna catalysis
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
230
structure length
214
Chain Sequence
AGMSEAPRAETFVFLDLEATGLPSVEPEIAELSLFAVHRSSLENPEHGALVLPRVLDKLTLCMCPERPFTAKASEITGLSSEGLARCRKAGFDGAVVRTLQAFLSRQAGPICLVAHNGFDYDFPLLCAELRRLGARLPRDTVCLDTLPALRGLDRAHGYSLGSLFHRYFRAEPSSAEGDVHTLLLIFLHRAAELLAWADEQARGWAHIEPMYLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Three prime repair exonuclease 2
publication title The Human TREX2 3' -> 5'-Exonuclease Structure Suggests a Mechanism for Efficient Nonprocessive DNA Catalysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 66
structure length 214
sequence length 230
chains with identical sequence B
ec nomenclature ec 3.1.11.2: Exodeoxyribonuclease III.
pdb deposition date 2004-12-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1y97A01
4FLWA 4H4OA 3K59A 1VK0A 3SQ1A 3LZIA 1RT6A 1QHTA 4O5BA 3L2WA 1D9DA 4LD0A 3V1QA 3MECA 4KB1A 3SCXA 1EXQA 3B6OA 3DLHA 3ZT3A 1TK0A 4M3RA 4BE1A 2G8UA 1VSLA 4FZXC 2KFZA 1TL3A 3RR8A 1U47A 4B9SA 2OPPA 3K5MA 3RRGA 3KK3A 4DTPA 2OYQA 4MFBA 3OY9A 3H08A 2NUBA 4FLUA 2HW3A 1CLQA 3IG1A 1D8YA 2RF2A 4NYFA 2OPRA 5C42A 4FM2A 1ZYQA 3ZT4A 4KKOA 1O1WA 4E7HA 1Q9YA 5I3UA 3KLFA 3VQQA 4KREA 3TABA 1T8EA 3MXIA 3D0PA 1D5AA 3NF9A 1U45A 1NOYA 1KFSA 3HPGA 2B6AA 3O4QA 3AVBA 2X6SA 3E01A 3SUNA 4Y1CA 4HUFA 3DLKA 4B3OA 1JXBA 3DM2A 1RTDA 3O3HA 4KRFA 3QEXA 5JS2A 2E4LA 3ZSZA 4CEDA 4CF8A 1SKSA 3PX0A 1C0TA 3PY8A 3KTQA 2FBXA 1NOZA 4HCCA 1RBTA 4DSIA 3S9HA 1VSDA 2PYLA 4CFCA 4DTMA 1IKXA 1C1BA 3MEDA 4LH4A 4IKFA 1C0UA 1ZBLA 4B9NA 4FJ8A 4N56A 2KFNA 3DLBA 4N41A 1J5OA 4CHOA 4CEOA 5HP1A 1U49A 3OYMA 1GOCA 1QSYA 4PWDA 4DMNA 4E7JA 1XC9A 4DFJA 2RN2A 1TK5A 4KHNA 3JYTA 4RW4A 4EP5A 4G1QA 3HSTB 3M8RA 4CIEA 5CYMA 3KKSA 3NGZA 1Q9XA 2ZE2A 4IBNA 4Z4IA 1QSLA 1LAWA 3DLRA 4NCAA 3QESA 3ZCMA 3HJFA 3LPUA 3V4IA 4CEAA 1RTHA 2KZZA 4BE0A 4DS4A 4B08A 4PUOA 1BL3A 3HO1A 1WSFA 4BWJA 1X1PA 3LDSA 2KW4A 2X6NA 2HNDA 1JLBA 3MEGA 3K5NA 1JLFA 4DFKA 2Y1IA 4ID5A 3SUQA 1VSMA 2G8IA 2HHUA 2HHXA 3AVFA 4QCLA 3QNOA 2BGGA 5HRSA 4N76A 1I39A 3DRRA 3NH0A 3QEVA 3B6PA 3ZT2A 3CQ8A 3AVKA 2X74A 3HT3A 5J2QA 3KLHA 1KSPA 3A2FA 5FRNA 1L3UA 3V9UA 5DMRA 4C8LA 4KAZA 3TANA 3DOKA 4B9LA 1T03A 1K6YA 4FLZA 4CHPA 3HM9A 3M8QA 3NDKA 1DLOA 3V9SA 4CERA 4O55A 4CFAA 3SUPA 3SNNA 4ELUA 4DTNA 3VQEA 1N5YA 3OS1A 3V9XA 3C6UA 1ASWA 2G8WA 4YFUA 2PY5A 3SV4A 4BDZA 3SV3A 2Z1GA 3O4NA 1KLNA 5HRRA 1IO2A 3RRHA 4FJGA 3L2VA 4ELVA 4Z4CA 2OA8A 3HK2A 1JXEA 1RBVA 2P51A 4B9UA 4EZ9A 1ZBHA 1GOBA 1QS4A 3UIQA 3AVGA 4Z0UA 1YTAA 1RBUA 1KRPA 1IKVA 3NAEA 1LW0A 4CE9A 4CIGA 1KCFA 3L3VA 1BI4B 3G10A 1WN7A 3LP2A 1VSHA 2X78A 2IAJA 3KLIA 3VQBA 4IFVA 1NJYA 2HHSA 4GW6A 3HVTA 4PY5A 2FC0A 3K5OA 2KQ2A 1BIZA 2Z1IA 3OYDA 2HVHA 4M3XA 1NKEA 1VSKA 4C8NA 2KTQA 3OJUA 4IG3A 3TR8A 1L3VA 1TKXA 4RW6A 3DI6A 4CJ5A 5SWMA 3L2UA 2QXFA 3LZJA 1QQCA 2RPIA 4DFMA 4F4KA 3VN5A 4ELTA 4TSXA 2JGUA 3ITHA 4CF1A 3TAFA 4B8CA 1B92A 4OJRA 4K8ZA 3ZSWA 2OPSA 3PO4A 4EZ6A 4Z4GA 1KVCA 4OVLA 1LWCA 4CGFA 3SQ2A 1NK8A 1KVAA 1NK9A 1WSJA 4I9QA 5JS1A 1BISA 2GV9A 3SI6A 2LSNA 1BIUA 5FRMA 1WSEA 1S9EA 4Z4FA 2Z1JA 3AVNA 2HNZA 4I7FA 5CYQA 1HPZA 1WLJA 4CK2A 1RCHA 4DTUA 3QERA 3QINA 4ZHRA 1FKPA 1L5UA 2QK9A 1N6QA 1HQUA 5SZTA 1X9WA 4CF9A 3ZSVA 1U04A 1C6VA 4N5SA 3MXJA 2XRIA 4Q5VA 2OZMA 3OYKA 4E0DA 1DTTA 2E6MA 4DQQA 2I5JA 4JRPA 4FVMA 3M8PA 4CEBA 3C95A 1SL1A 4L8RB 2HNYA 2XY5A 4FK2A 1RT1A 2D0BA 1RDDA 1IKYA 1S1XA 3SYZA 1HQEA 4M3ZA 1BGXT 4DQPA 3OYBA 1CZ9A 4KV8A 1BCMA 3D45A 4DG1A 3IRXA 2WONA 1RBRA 2PZSA 1CXQA 1UAXA 1HMVA 1YVUA 4CGIA 1QE1A 4E7LA 4OGCA 3I8DA 4KTWA 4N47A 1WAFA 2VG5A 3SUOA 2G8FA 4CJFA 1Z26A 4FJKA 4JS5A 4F2RA 4E7IA 4I2PA 4E3SA 4FZZA 2XY8A 2DFHA 3TAGA 3CM6A 2IGIA 4AH9A 4W5TA 3AO3A 4ZTFA 4M3YA 4M3TA 3NH1A 4J2BA 4F2SA 1IKWA 1FK9A 1YT3A 2DFEA 3BDPA 1Q8IA 3NBPA 1KLMA 4BDPA 3AA5X 3QO9A 1S5JA 4CF2A 4LH5A 1EP4A 3RMCA 4ID1A 2P1JA 4CJ3A 4FLYA 2VG6A 4CJ4A 3AVAA 4FJLA 4AHTA 2VWKA 3TAMA 2HHQA 3OVNA 4E7KA 4CHQA 3L2RA 4C8MA 3EZ5A 3CFPA 4FK0A 4KHSA 4KTZA 1LW2A 3WNHA 3PX4A 4HCBA 3LAMA 1C0MA 3HL8A 3LALA 4AHUA 3P83D 4BE2A 4DTSA 2YHAA 2ETJA 1LV5A 1S6QA 3VQ7A 1FXXA 1JLCA 3VQPA 4AHCA 5KGXA 2XY7A 4KI6A 4DTXA 4GVMA 3ZSXA 2IS3A 3K5LA 4KPYA 4DFPA 1QSSA 1L3SA 3CG7A 1VSIA 4JRQA 1BQNA 3CFRA 4NYNA 4CFDA 4FLXA 3KK1A 4FLVA 3KIOA 1IG9A 4EP4A 3AV9A 4J2DA 4XIUA 2HB5A 3VA3A 4OLAA 3RMBA 3CFOA 5I42A 1RT3A 2FBVA 1NJWA 2IDOA 4FJ9A 3K58A 3NF7A 1C1CA 3SPYA 1Z25A 4CHNA 3K57A 1NKCA 1D9FA 4E89A 3LPTA 1HJRA 3NE6A 1SL2A 1RNHA 2F8SA 1RILA 4ZTJA 3PX6A 3MXMA 4OPKA 4B9VA 2HHVA 4DU1A 2YNIA 1SL0A 3T19A 4CEZA 4DS5A 3L8BA 4KO0A 1S1WA 2ZQBA 4I2QA 4IFYA 4QOZB 3OYCA 1JL1A 1T05A 1F21A 2O4GA 2YNFA 3VQ9A 3QIOA 4CGHA 4AHRA 4UQGA 2JLEA 3G0ZA 2O4IA 2Y1JA 2EHGA 2W42A 3ZT1A 1HYSA 3OYLA 3CYMA 4CK3A 4O0JA 5J1EA 2R7YA 1W0HA 4B9MA 4DSJA 4K8XA 4IG0A 4NCBA 3L3UA 4HUGA 4PA1A 1TKZA 4CJUA 3T1AA 1UOCA 3OS2A 4KHUA 4HTUA 4HHTA 1TAQA 3S3NA 4MQ3A 3HP9A 3ZSQA 3VQ8A 4DQRA 3NGYA 1JL2A 4OKEA 4M41A 3V9ZA 1NJXA 4FJ7A 5KGWA 3AVMA 3PV8A 2G8HA 4DSEA 2YKNA 4RW8A 4FM1A 1ASVA 3QLHA 4OGEA 1SKWA 3QNNA 4KFBA 1RT7A 3SPZA 4FJMA 3JSMA 2XY6A 1ZBIA 1VRTA 1WSHA 3HVRA 3KD1E 1EETA 4CJQA 4QAGA 4CGJA 3OYFA 3OYIA 3VQ6A 4C8OA 4DSLA 3NFAA 3P5JA 3U3YA 1SUQA 4OKKA 4BDYA 3TWHA 2ATQA 1GOAA 2YKMA 4RW7A 4FJ5A 3QEWA 1JLEA 4O44A 3LWLA 4DF8A 1JLGA 3AVIA 2DFFA 4F8RA 4KHWA 4KHYA 4CGDA 1RTIA 1RBSA 3EY1A 4F3TA 2KZMA 4CJEA 3WNGA 3NHGA 2GBZA 4CJTA 1C1AA 3OYEA 3VA0A 4FJJA 3LAKA 2B4JA 2F96A 3V6DA 4AILC 3KKRA 5CZ1A 4CESA 4Z4EA 1XWLA 3TI0A 1I3AA 3QIPA 3KK2A 1KTQA 1WSIA 4CJPA 1TL1A 4FZYA 1ASUA 3OYGA 3OJSA 4KHQA 4W5OA 4E19A 3WNFA 4E1NA 3V81A 2GUIA 4DSFA 1XHZA 5D3GA 3OS0A 3AO2A 3OYNA 3NGIA 1RDBA 1HNVA 4CIFA 1VSEA 3PO5A 3VQ5A 4FJXA 3V9WA 2HHWA 4CEEA 4FW2A 1VSFA 4CJSA 1RDAA 1UWBA 2RKIA 2IC3A 5J2MA 3LP1A 3LWMA 3C94A 4LY7A 1HRHA 3O3FA 2OZSA 1TVRA 4FJNA 1HYZA 2AJQA 3LP0A 4BWMA 3SJJA 1TGOA 3AO4A 3MEEA 2IOCA 1J9AA 1S6PA 3V1OA 4I9LA 4C8KA 1S1UA 1ZBUA 3ULDA 3AVCA 4BACA 1NK5A 3ZSRA 3O3GA 4FK4A 3QETA 4JLHA 3BGRA 1NK4A 1WAJA 3LP3A 4RW9A 4B8AB 4CECA 5HRNA 1XHXA 5KRTA 4HUEA 3EYZA 3TAEA 2G8VA 1RT5A 4CEFA 1SV5A 4H4MA 2P5GA 4PQUA 1T7PA 3AO5A 5DK5A 1VSJA 4LSLA 1HYVA 1REVA 4Y1DA 3SQ4A 1A5XA 3F9KA 1UA0A 1BI4A 1B9DA 1IH7A 1ZBFA 3THVA 4HVJA 5J2PA 2Q3SA 3ZSYA 3U6FA 4F3OA 1RDCA 5FDLA 4AHVA 4CGGA 4DQIA 5CZ2A 4Z4HA 1B9FA 4W5NA 2ITGA 2YV0X 3DRSA 1QTMA 5J2NA 3NF6A 3OYJA 1Y97A 3ZSOA 4KI4A 2Z1HA 1CZBA 3CM5A 1L3TA 4CJWA 2F8TA 3DOLA 1TAUA 2D5RA 3TAPA 1YTUA 5HROA 4DQSA 3DRPA 1A5WA 3SZ2A 1R0AA 4CK1A 1WSGA 3IS9A 3KJVA 3NCIA 2BANA 4CHYA 2BDPA 1JKHA 1RTJA 3VQ4A 4CEQA 4CJKA 4AHSA 4CCHA 2G8KA 3NF8A 1A5VA 1VRUA 2OPQA 4DLEA 1SKRA 3U3GA 4W5RA 4DSKA 3QEIA 2HVIA 2HHTA 2HMIA 3FFIA 3RWUA 3VQCA 1J53A 3ISNC 4LSNA 5HLFA 2QKBA 1DTQA 4E1MA 4OLBA 3AVJA 3VQAA 1S9GA 5KTQA 3T3FA 1TV6A 2YNHA 1NKBA 1XI1A 4CFBA 1X9MA 5HRPA 3NH2A 2ZD1A 1TKDA 1RT2A 2FBTA 4J2AA 3PUFA 3MAQA 3TAQA 1U4BA 3V1RA 3DLEA 2P5OA 4CJVA 4M45A 4OPJA 1BCOA 4J2EA 3ASMA 3RMAA 1LWFA 4DU4A 4FM0A 4KB0A 4M42A 3AA2A 3DLGA 2YHBA 1S1VA 1W9HA 3AVHA 3AVLA 2A1SA 5E41A 3RTVA 3QEPA 3OYAA 1NK7A 1ITGA 4KTQA 3KLGA 3M8SA 1G15A 2VG7A 3OYHA 5HBMA 1KVBA 2D0CA 3AA3A 5KI6A 1CXUA 1JLQA 3DYAA 3WNEA 3KD5E 3K2PA 1UA1A 4ICLA 3AO1A 4O0IA 3I0RA 1TKTA 4DF4A 3ZT0A 4DU3A 1EKEA 3DMJA 1WNSA 3P1GA 4CJLA 5C24A 2E6LA 3AA4A 3TARA 4NCGA 2D0AA 2VWJA 4RG8A 4YNQA 4JS4A 1RT4A 1S1TA 2EX3A 3S3OA 4FXDA 4FJHA 4W5QA 5EU7A 4CJRA 3HP6A 4B9TA 3ALYA 5KRSA 2DY4A 2B5JA 1LWEA 1BHLA 1FKOA 3KLEA 5T7BA 4FJIA 2DTUA 2BE2A 3HPHA 5C25A 1U48A 2FBYA 1BQMA 4H8KA 4DLGA 4CHZA 1NK6A 3LANA 2WOMA 1X9SA 2PYJA 4FLTA 4FCYA 3HXMA 2XO7A 1TK8A 3SQ0A 3F73A 1EX4A 1HNIA 5CY4A 4M3WA 4OKJA 4WE1A 5K14A 2A1RA 2YNGA 3RR7A 3L2QA 4FYDA 4IDKA 1NJZA 1MU2A 4O4GA 4DTOA 4M3UA 4DTRA 3C6TA 4Q0BA 3S3MA 4GMJB 3HYFA 1KFDA 1JLAA 3I0SA 3RMDA 3IAYA 4DTJA 3HPOA 1J54A 2XHBA 3VQDA 4R5PA 4CF0A 1LAVA 2QKKA 1NK0A 5FROA 4FW1A 4DWIA
chains in the Genus database with same CATH superfamily
3U9ZA 4KH5A 4F8RA 1VK0A 1ATNA 4Y0WA 4JI4K 4GKKK 1EXQA 3B6OA 1GLJO 3DLHA 2IVOA 1DEJA 4FZXC 1VSLA 2O8FA 3RR8A 4B9SA 2NRTA 1IBLK 2E1YA 3TSQA 4FLUA 3IG1A 2RF2A 5KPTA 5C42A 1X3MA 4U7BA 2FF6A 3N4PA 4BGBA 3A0IX 2ZJQL 4OPHA 1T8EA 2ZJPL 3MXIA 5BRDA 5DM7L 3NF9A 1NOYA 1KFSA 1YUWA 2A40A 3EZWA 4HUFA 4JKGB 2F7TA 4X66K 3DM2A 3O9TA 5JS2A 3QEXA 4JK8A 2QWPA 4CEDA 4CF8A 4BRNA 3VF4A 3PX0A 2P9LA 1SKSA 1NOZA 1WOQA 3WUHA 4IOAL 4CFCA 4DTMA 1C1BA 4B9NA 4KBOA 2KFNA 1C0FA 1J5OA 4B1UB 4PWDA 4DCHA 4E7JA 4HWIA 4ILGB 2VWBA 3SAHA 4BRFA 3HSTB 2F9WA 1GLAG 4MLEA 4BRMA 1LAWA 3DLRA 1QSLA 2CH5A 1P8ZA 5AQQA 1BL3A 1WSFA 3LDSA 3O9RA 2HNDA 1JLFA 3SUQA 4ID5A 3HI0A 3AVFA 3QMLA 3DRRA 3QEVA 1T6DA 1Q18A 3PSFA 1Q82O 3AVKA 2X74A 1KSPA 4H0TB 3A2FA 4DUYK 4H0XB 3VTHA 5DMRA 4B9LA 1T03A 4ILJA 4BGAA 3NDKA 2Q2RA 3BY5A 1BWFO 2EWSA 4BDZA 1NU0A 1KLNA 4ISGA 4BR7A 4CZKA 4JI7K 4MDAA 1JXEA 2UYTA 4B9UA 4EZ9A 1GOBA 1U2VB 3A5MC 3UIQA 4Z0UA 1IKVA 4CE9A 2F9TA 1KC8O 3VEWA 1KCFA 1BI4B 3G10A 1WN7A 4R79A 2IAJA 3KLIA 4MO4A 1NJYA 5KPRA 3HVTA 3BUZB 4NXNK 1VSKA 2UXCK 1N32K 3OJUA 3DWLA 3TR8A 1L3VA 1SZ2A 2RPIA 3VGKA 4G9ZA 4JEPA 2JGUA 4CF1A 1T6CA 4OJRA 4K8ZA 2NRHA 1LWCA 1WSJA 1BISA 2GV9A 1WSEA 3UKRB 3T1YK 5CYQA 1JCEA 1HPZA 2QWOA 1RCHA 2QK9A 1U04A 4AM7A 3PIOL 1JJ2M 4Q5VA 3OYKA 1NGBA 1YTUA 2I5JA 1NMNA 4FVMA 3WXIA 4RTFD 1RT1A 5AQMA 1HQEA 5EOYA 3FE1A 4KV8A 3IRXA 1IBMK 2E88A 5C12A 4CGIA 4OGCA 2Q0UA 5AQYA 1Z26A 4FJKA 4F2RA 1ZXOA 4E3SA 5AQUA 3FZKA 2DFHA 3TAGA 3CM6A 3UKUA 4M3YA 1QZ6A 3LM2A 3D2FA 4M3TA 4GY2B 1IKWA 3NBPA 3AA5X 1VQLN 3QO9A 1DGKN 1D4XA 4B1WB 3RMCA 2VG6A 4CJ4A 3AVAA 4DV0K 3LDPA 5CR4A 2O8CB 3EZ5A 5KPZA 4KTZA 3O08A 3GDQA 1C0MA 3HL8A 2HBKA 2HMPA 4CZFA 4CZMA 3O6WA 3AGRA 3K5LA 4KPYA 3MX2A 2UUAK 1L3SA 1QZ5A 1IG8A 5EY4A 4C1NK 4FLVA 4CBXA 5AQVA 4H5VA 3TU5A 3EKSA 5I42A 1RT3A 1N33K 3E1YA 3K58A 3NF7A 3UE5A 2WFBA 4FPAA 3TTFA 3SPYA 1SAZA 3K57A 4E89A 3OBYA 1SL2A 1RNHA 3QFUA 4A5AA 4ZTJA 3MN9A 4WFBL 1QVGM 4OPKA 2P9IA 3HSCA 2HHVA 3EEQA 2YNIA 5TKYA 1SS6A 2O8EA 1S1WA 3T7ZA 1TYQA 4BG9A 1F21A 3NVKA 4BRGA 4DR3K 4DKWA 4A57A 2EHGA 2W42A 3CYMA 1W2BM 5J1EA 3CIPA 1RGIA 4K8XA 4IO8A 5BR9A 4CJUA 3T1AA 3QBWA 3OS2A 4YHHK 4XH5A 4MQ3A 2ITMA 1VQ5N 3V9ZA 1NJXA 5AR0A 1VQ8N 3CJ9A 2YKNA 4FM1A 3HRGA 5M1FA 4OGEA 1HR0K 1YF5L 3O80A 5AQTA 3SPZA 3D2EA 2XY6A 4FJMA 1VRTA 3HVRA 2P9PB 4QAGA 4DSLA 3NFAA 5LMNK 4BDYA 1GOAA 4RW7A 4FJ5A 1HKBA 3A5LC 1QQNA 2DFFA 4KHWA 4KHYA 1RTIA 1RBSA 4F3TA 1X9JA 4CJTA 3CC4N 5M1NA 4FJJA 3LAKA 4CESA 4Z4EA 3U9DA 3TI0A 3QIPA 4H03B 4IZ9A 2WC9A 3ATUA 3OYGA 2IVPA 3RVCA 3THWA 4E19A 1DKGD 3FZMA 4BVPA 4KHPK 3OS0A 3U8XA 5C2FA 3G4SN 1VSEA 4CD1A 3V9WA 5MLCQ 3MDQA 2RKIA 3HZ6A 4JHDA 3KK7A 3LWMA 3C94A 3IMXA 1TVRA 4DR7K 3F9MA 1XUPO 1TGOA 3AO4A 3WT0A 4CZHA 1S6PA 3V1OA 1VQMN 1S1UA 3ULDA 1OH6A 1NK4A 4IEIA 5KRTA 3FLCO 3EYZA 2V7ZA 3GL1A 3VERA 4LSLA 2NLXA 3F9KA 5J2PA 3JAMO 5FDLA 5CZ2A 4W5NA 3NF6A 3OYJA 2HF3A 3CM5A 1K8AO 4CJWA 1Y64A 5HROA 5F2RA 4XH1A 1NJIO 4CK1A 1KAYA 1EWQA 2RE2A 2BANA 1JKHA 1RTJA 4CJKA 3D7EO 3P4IA 2HVIA 4DLEA 2HHTA 3QEIA 4JYAK 3QDKA 1V4TA 3R1XA 1J53A 4BC3A 3Q7CA 4LSNA 4OLBA 2JWLA 1YAGA 4H5RA 4J2AA 3PUFA 2P5OA 3CCUN 4M45A 4OPJA 1BCOA 4J2EA 3BF1A 1S1VA 5BN9A 3QEPA 4K41A 5M1KA 3RTVA 3BF3A 2PAVA 1ITGA 1NK7A 5A2QO 3KLGA 3SJHA 3UKUB 3AARA 3D2FB 4MDBA 2D0CA 4B1ZA 3FR0A 3AA3A 2GX9A 1JLQA 1UA1A 5AQXA 3E66A 3VEZA 1EKEA 2KTQA 3G25A 3AA4A 3FZLA 4NCGA 1N36K 4RG8A 4BRKA 4JS4A 5EU7A 4CJRA 5KRSA 2A41A 2B5JA 4MLHA 5CE3A 1BQMA 1KAXA 4H8KA 2PYJA 4FCYA 3SQ0A 3F73A 1EX4A 1HNIA 2Q1NA 2A1RA 4WE1A 1YXQA 3L2QA 4IDKA 1NJZA 1MU2A 4O4GA 4DTOA 4DTRA 3GG4A 3NVMA 4GMJB 5E26A 4DTJA 2XHBA 2BUPA 3VQDA 2ZJRL 4H4OA 3LDLA 3LZIA 1RT6A 3CHWA 4O5BA 3L2WA 3SCXA 4BE1A 1TL3A 2P9IB 3K5MA 3KK3A 4DB3A 5LJWA 4MFBA 2O8EB 4FM2A 2QXLA 1TYQB 4KKOA 4GKJK 4E7HA 5I3UA 4B3SK 3VF2A 3ENHA 3TABA 1ZBSA 3D0PA 4A62A 5FPDA 2GELA 2HBMA 2X6SA 3P38A 3SUNA 3ZX0A 4I6MA 3O3HA 1C0TA 4JI0K 4EHTA 4IKFA 4CBWA 2HBLA 1ZBLA 4JN4A 3T69A 1DT9A 5HP1A 1HUXA 3D2EB 5BR8K 2RN2A 4YOWA 1WBBA 1JCGA 3JYTA 4EP5A 4QS8A 3KKSA 4IBNA 2ZWHA 3ZCMA 2NRWA 3L6QA 3KWIA 4CZJA 2I7NA 3KZBA 4BWJA 2KW4A 1JLBA 2Y1IA 3IDHA 2G8IA 3S41A 2YHWA 3THWB 2FLOA 5HRSA 5JVHL 4FWMA 3B6PA 3HT3A 3KLHA 5FRNA 2NRVA 3ZX2A 3TANA 1H1VA 4CJ7A 3H1VX 4FLZA 3J7YP 4ELUA 4DTNA 3VQEA 3J7ZO 1N5YA 3V9XA 3C6UA 1ASWA 2HF4A 2Z1GA 3O4NA 1IO2A 3RRHA 4ELVA 4Z4CA 2OA8A 3BEXA 5M1OA 1RBVA 3QICA 2P51A 2OTLN 1ZBHA 3HTVA 1YTAA 1RBUA 4FOEA 1MA9B 3NAEA 1LW0A 5AQGA 4QS9A 4GW6A 4DV4K 5AZJA 3A5OC 3H6EA 4PY5A 1BIZA 2Z1IA 1ZC6A 4M3XA 2ZGYA 1NKEA 2W6KA 1IJJA 4WQ4C 4PKGA 4CJ5A 4DFMA 1QQCA 3IKMA 1BUPA 4OX9K 2BTFA 3CQXA 4TSXA 4B8CA 2OPSA 1KVCA 3M3ZA 1NK8A 1KVAA 2P9KA 5JS1A 3QBXA 4BR5A 3PLAA 5FRMA 1S9EA 3MN5A 3FGUA 2OANA 4I7FA 4FWQA 1HNXK 4DTUA 3H45C 1FKPA 4H0OA 4YOUA 1N6QA 1HQUA 3OTOK 3ZSVA 4LF5K 4E0DA 2E6MA 4JV5K 1SL1A 4JRPA 4CEBA 4FK2A 4FWPA 2HNYA 1IKYA 1S1XA 3SYZA 3DAWA 4M3ZA 2E20A 2QWNA 3OYBA 3CJ1A 4B3TK 4UY8O 1BCMA 3WQTA 2Q0RA 3K9JA 2WONA 2V52B 3SMSA 2I7PA 5GAHP 1GLEG 1HMVA 1WAFA 2V7YA 4E7IA 3VTIA 4DV2K 4JNEA 4A2AA 2VGNA 2FXUA 2IGIA 3WXKA 3AO3A 4LC9B 1YT3A 1FK9A 3SBTA 3JXUA 1Q8IA 2CGKA 4H0YB 4RCHA 4LH5A 4ID1A 4FJLA 5B8HA 4B1XB 4AHTA 2VWKA 3TAMA 2HHQA 3OVNA 4C23A 4YY3K 1MDUB 4E7KA 4CHQA 4C8MA 3ZEUB 3CFPA 4ILHA 4FK0A 3P83D 1LV5A 3VQ7A 4AHCA 3ENBA 2XY7A 4DTXA 3ZSXA 1VQKN 4DFPA 3HBTA 4FLXA 4EP4A 2E2QA 2JWKA 3EKUA 3T1HK 3LDOA 4O8KA 3E9PA 1C1CA 2QA4N 4H5TA 3LPTA 1HJRA 2QWMA 1BG3A 2NZTA 2PFUA 3CXCM 1BA1A 3H3NO 5FPEA 4CEZA 4KO0A 3WXMB 3VF6A 3VQ9A 4BR4A 1K9MO 3ZETA 4UQGA 2GEMA 3OYLA 4I6MB 4CZEA 4O0JA 1W0HA 4NLCA 4B9MA 4JKDA 5AQOA 4HUGA 1UOCA 4KHUA 4HTUA 1HX1A 2HBJA 3HP9A 3ZSQA 1XC3A 3NGYA 1JL2A 4OKEA 1NNEA 1NGDA 4DSEA 3DLLL 4RW8A 4IFEA 5LL6Z 1SKWA 4JI3K 1RT7A 2WTUA 1BOTO 1EETA 3MCPA 1E3MA 4CGJA 3VQ6A 1SUQA 1VHXA 4OKKA 3KWGA 2YKMA 4DF8A 3AVIA 2E2OA 3F5TA 2KZMA 1XMQK 4L3QA 3OYEA 3VA0A 5LJVA 4E1JA 2F96A 3V6DA 1EQYA 1I3AA 3KK2A 2AP1A 1KTQA 1Q81O 1WSIA 4FZYA 5GINA 1ASUA 3OJSA 1K73O 2GUIA 4DSFA 1XHZA 4BQLA 2UXDK 3NGIA 1RDBA 2A6AA 3CERA 3VQ5A 5JMVA 4CEEA 4EFHA 3O1BA 4JD2A 1TUUA 2ASPA 5J2MA 2ZGZA 4LY7A 2OZSA 1HYZA 3JS6A 3LP0A 4BWMA 3SJJA 5AQZA 1NK5A 1OVQA 3ZSRA 3CCRN 3CCJN 3QETA 4JLHA 3BGRA 4WF9L 1WAJA 3LP3A 4CECA 4EAHD 4HUEA 3TAEA 4H4MA 4BC2A 5AZJB 5AQWA 1B9DA 2QEXN 3THVA 3R6MA 3PIPL 4AM6A 4JKCA 3CCLN 2WUSA 4DQIA 1B9FA 1MWKA 2ITGA 2P9UA 5J2NA 1Y97A 3ZSOA 4B3MK 1M1KO 1IBKK 4NXMK 4BQZA 3A5NC 1L3TA 1NLVA 2HOEA 4JKAA 2P9KB 4WQ4A 3SZ2A 3KVGA 4DHYA 1WSGA 3KJVA 2O8FB 2FSKA 3EL2A 1NGFA 3NF8A 2OPQA 2P9NA 1QQMA 2HMIA 3FFIA 1NBWA 2WBNA 3AAPA 4BR0A 1VQNN 1NGAA 4E1MA 3AVJA 1TV6A 3CF5L 3NH2A 2ZD1A 1NGCA 3MAQA 1U4BA 1S3XA 3DLEA 3O9QA 2Q36A 2P9LB 2J4RA 1NMDA 4DU4A 4M42A 2O8BA 3AA2A 3AVHA 5BN8A 3AVLA 4KTQA 4JKBA 3OYAA 1G15A 5HBMA 1KVBA 4K0KK 3ZYYX 1CXUA 3KD5E 5ELZA 3CJ7A 3AO1A 4DF4A 1TKTA 3ZT0A 3P1GA 3TARA 1YJNN 4JI2K 1I94K 4CI6A 4B9TA 3HP6A 2DY4A 1LWEA 1BHLA 1FKOA 2UUCK 4FJIA 2BE2A 3HPHA 2FBYA 2A5XA 1NK6A 3LANA 3UB5A 1X9SA 1TK8A 3P31A 4M3WA 4KH4A 3W3DA 3S3MA 3IAYA 1KFDA 3I0SA 3HPOA 5F0XA 4R5PA 2QKKA 4CF0A 1LAVA 4IWVA 4FW1A 3SQ1A 1D9DA 4LD0A 3V1QA 3MECA 3IUCA 1TK0A 4M3RA 2KFZA 1Q7YO 1U47A 2OPPA 3RRGA 4DTPA 4DR6K 2FF3B 2NUBA 2HW3A 1CLQA 1D8YA 4NYFA 1ZYQA 3B8AX 1S22A 5JICA 3U4LA 1Q9YA 3TTCA 4A61A 3KLFA 1OH7A 3ZETB 3VOVA 3HPGA 2B6AA 4Y1CA 3DLKA 4B3OA 4PKIA 4YOTA 3GBTA 1RTDA 4KRFA 3PY8A 2E4LA 3ZSZA 3SLCA 1GLDG 3KTQA 1RBTA 4DSIA 5BPLA 2PYLA 1IKXA 4LH4A 4FJ8A 4H5WA 4CHOA 4CEOA 1U49A 3WQUA 2ZF5O 3TSPA 1QSYA 4DMNA 4JK9A 4DFJA 4CBUA 3EE8A 1TK5A 4KHNA 1YI2N 1HNWK 1HNZK 4HTLA 1ILYA 5CYMA 1VQ9N 1Q9XA 4FOIA 4BROA 5AQFA 4NCAA 1K8KA 3Q7BA 4GNIA 4LF4K 1BO5O 3V4IA 1RTHA 3HO1A 1X1PA 5AQLA 1FW6A 2X6NA 3MEGA 4DFKA 3K5NA 4B1YB 3CCSN 3THXA 2HHUA 1VSMA 1XMOK 4BRHA 1I39A 3NH0A 3ZT2A 4DR2K 3CQ8A 3L0QA 4YOXA 1MWMA 1L3UA 3C0BA 3LDNA 4JD2B 3HM9A 3M8QA 3V9SA 4CERA 4CFAA 3SNNA 3CJCA 2KLAA 2G8WA 4YFUA 2PY5A 5IT9O 3SV4A 5EX5A 4CZIA 3EO3A 5HRRA 1J6ZA 4FJGA 3L2VA 4BG8A 3HK2A 5C0YA 5BRFA 3MWTA 1X3NA 4F9OA 3AAQA 3AVGA 4A2BA 5AZIA 4CIGA 4DQ8A 3LP2A 4FL9A 1VSHA 3VQBA 4DV6K 2W6LA 4IFVA 4A5BA 2KHOA 2FC0A 5EXWA 2HVHA 2ASMA 2YX6A 5JLFA 2P9UB 4V19S 4C8NA 5ADXH 1LOTB 1TKXA 3CCEN 3VN5A 3VGLA 4ELTA 3E9LA 3O1WA 1OH5A 4EZ6A 4OVLA 1NK9A 4M63C 1NGHA 1SQKA 4FO0A 3SI6A 2LSNA 2P9NB 3THYA 1WLJA 4LFAK 1L5UA 5GAGP 1X9WA 4IXCA 3AGKA 2GWKA 3MXJA 4B3RK 2OZMA 1DTTA 3VENA 3I8BA 3C95A 3NMUA 3QFPA 2QW9A 2NNWA 2QM1A 1BGXT 4DQPA 3H1QA 3D45A 2O8BB 1QHAA 1RBRA 2PZSA 1YVUA 2VG5A 3SUOA 4LF9K 4CJFA 4JS5A 4FZZA 2XY8A 4BRDA 3CETA 4W5TA 4X64K 3RSEA 4J2BA 4F2SA 3BDPA 2DFEA 4BDPA 1YIJN 5JVGL 3AY9A 4PL8A 1S5JA 3CI5A 1EP4A 1Z05A 2P1JA 1VQ7N 3C6HA 4OPAA 3I56N 3L2RA 3MWPA 1VAZA 3WNHA 4KHSA 4HCBA 3LAMA 4AHUA 3LALA 4DTSA 4FWNA 4DV7K 1S6QA 5IWAK 3G6EN 1JLCA 2NRRA 3VQPA 4BRCA 4PL7A 1OH8A 2IS3A 3N4QA 4ISEA 1GLFO 3CG7A 3TPQA 2V51B 1VSIA 4JRQA 3CFRA 3KIOA 1IG9A 2F4VK 4J2DA 4XIUA 4OLAA 3C65A 4CD3A 4QS7A 4FPBA 1NJWA 2IDOA 5DM6L 1GLLO 1NGJA 2YI1A 4RWTA 4H0VB 1NKCA 1D9FA 5LMUK 2F8SA 4JHDB 1RILA 3PX6A 4B9VA 1NGGA 3M5RA 3L8BA 2NRZA 1RDWX 4NB4A 1IV0A 4I2QA 2ZM6K 2KKZA 3A8YA 3OA9A 4IFYA 1T05A 3QIOA 4LF7K 4CGHA 4AHRA 3H46O 3G0ZA 2Y1JA 3ZT1A 1HYSA 2Q31A 4CK3A 2R7YA 4IG0A 3L3UA 2VCPA 4HHTA 1TAQA 4EIAA 3CCVN 3VQ8A 4FJ7A 3AVMA 3PV8A 2E2PA 1N8RO 2QI2A 1KQSM 1E4FT 3QNNA 4X65K 1HLUA 1WSHA 2VGMA 3OYFA 2QWLA 2ATQA 4JI8K 4AF1A 4FVUA 4JI5K 1K8KB 4O44A 1JLGA 2A42A 1LCUA 3EY1A 3M1FA 1T44A 3NHGA 3WXJA 4O8UA 3GE1A 3THXB 5CZ1A 1XWLA 2QWRA 4CJPA 4U67L 4AQYK 2H3GX 2AA4A 3WNFA 4E1NA 5FPNA 5D3GA 1C0GA 3OYNA 2YHYA 1HNVA 4FJXA 2HHWA 4FW2A 1VSFA 4CJSA 3OW2M 1UWBA 2VQFK 3LP1A 1HRHA 4O5FA 3O3FA 1GLCG 4FJNA 2AJQA 2YJFA 3MEEA 2IOCA 3BP8A 4I9LA 4C8KA 4IEEA 3AVCA 4BACA 1OVYA 2D4WA 3BZKA 4FK4A 1ZBIA 4RW9A 4B8AB 1XHXA 5AZIB 3FZFA 5M1QA 4CEFA 5H1SQ 1SV5A 1T7PA 4PKHA 3AO5A 3VEVA 1VSJA 4WFAL 4Y1DA 3SQ4A 1A5XA 5AQSA 2P9SA 4DR5K 1NGEA 1ZBFA 4HVJA 2Q3SA 3ZSYA 5M1PA 1NGIA 1RDCA 4CGGA 4F3OA 4IJNA 3DRSA 2IVNA 4ISFA 4KI4A 2Z1HA 4CVNE 2F8TA 4X62K 1TAUA 2W41A 2CGJA 2P9PA 3QB0A 3TAPA 4GV3A 2D0PA 1A5WA 1R0AA 5KQ8A 3IS9A 3THYB 4CEQA 3VQ4A 4AHSA 1A5VA 2HHHK 3U3GA 4W5RA 3R9PA 3RWUA 5HLFA 3ZLJA 1DTQA 1VQON 3I55N 1WBDA 3VQAA 1XI1A 5EVZA 2CH6A 5HRPA 1RT2A 1T3VA 2FBTA 1W7AA 2RHKA 3V1RA 5TKWA 4YDUC 2OTJN 4JI6K 3RMAA 4PHTX 4FM0A 3MK6A 3P39A 3DLGA 1W9HA 2VG7A 3RSEB 5KI6A 4CZGA 3K2PA 5BRHA 4K43A 3VEOA 4L8RB 4CJLA 3DMJA 2E6LA 4M7YA 2VWJA 2EX3A 3S3OA 5F1XA 4FXDA 1G99A 3L4IA 1XQSC 5T7BA 2FSNA 2DTUA 1U48A 4DLGA 3HOTA 3WXLA 5C2DA 4CHZA 2WOMA 4FLTA 1EWRA 4OKJA 5K14A 1BU6O 4Q0BA 3C6TA 3HYFA 2O8DA 3F2KA 2D0OA 5FROA 4DWIA 3SBGA 3TSUA 4FLWA 3K59A 1QHTA 4KB1A 4Z94A 3ZT3A 4EHUA 2G8UA 3CC7N 3I33A 2OYQA 3OY9A 3H08A 2OPRA 1RFQA 3ZT4A 1HJOA 1O1WA 5AFUH 3VQQA 4KREA 4DUZK 2BH1A 1D5AA 1U45A 3O4QA 5ADXA 3AVBA 3O9SA 3E01A 1VQ4N 1JXBA 4BR9A 3EE9A 4KH6A 2FBXA 4HCCA 3S9HA 1VSDA 3DXMA 5BREA 3MEDA 1C0UA 4N56A 3ULEA 3DLBA 4N41A 4JKEA 3OYMA 3ID8A 4GV6A 1GOCA 1XC9A 1YJ9N 3CJAA 4RW4A 4G1QA 3M8RA 3DJCA 4CIEA 3WEEA 3NGZA 2ZE2A 4Z4IA 3QESA 2UXBK 3HJFA 3LPUA 4CEAA 1U6ZA 3ID6A 2KZZA 4BE0A 4DS4A 4B08A 4PUOA 4OO1J 2YJEA 2NRXA 2HHXA 2UU9K 4QCLA 3QNOA 2BGGA 4N76A 4DV5K 3DXKA 3GOIA 3J8AA 5J2QA 3O9UA 3VPZA 3V9UA 4C8LA 4KAZA 3DOKA 1K6YA 3HOSA 4CHPA 1ATRA 3VESA 3CJBA 1DLOA 4CZLA 4O55A 3SUPA 4JI1K 1N34K 3OS1A 4YOYA 5KQDA 3CMEN 2IIRA 3SV3A 2W40A 2E8AA 3J81O 3R8EA 1QS4A 1KRPA 3L3VA 2P9SB 2X78A 2HHSA 3SMPA 5E84A 3L4QA 3K5OA 2KQ2A 1YJWN 3OYDA 3HM8A 4YORA 2E5LK 2VQEK 4IG3A 4RW6A 5GAEP 3DI6A 5SWMA 1KXPA 3C6AA 3L2UA 2QXFA 3LZJA 4F4KA 2YHXA 3ITHA 3TAFA 3LM9A 5AQJA 4BREA 5C15A 1B92A 4WQ5C 3ZSWA 3PO4A 4Z4GA 5AQKA 4CGFA 3SQ2A 4I9QA 4LF6K 5AJ3K 1BIUA 4Z4FA 4LFCK 2Z1JA 3AVNA 2HNZA 3QERA 4CK2A 1J5EK 2GWJA 3QINA 4ZHRA 5SZTA 4CF9A 4N5SA 1C6VA 4BRAA 5AQNA 2XRIA 4DQQA 3M8PA 2XY5A 4FSVA 2D0BA 1RDDA 1NWKA 4IJAA 1CZ9A 1S72N 3O5BA 1M90O 1FJGK 4DG1A 3MCAB 1CXQA 4FWOA 5AQPA 1UAXA 2HSTA 1QE1A 4E7LA 3I8DA 2UUBK 4KTWA 4N47A 5GIOA 1Z6RA 2G8FA 4DV1K 3ATVA 1YVNA 4I2PA 4YDUA 4BRQA 5AQHA 4AH9A 4ZTFA 3VGMA 3NH1A 3IFRA 1EO1A 4WCEL 3FZHA 4B9QA 3OBWA 3G71N 1KLMA 4BRIA 1VQPN 4CF2A 2FSJA 4B1VA 4CJ3A 3C7NA 4FLYA 4BY9C 4IOCL 4GVEA 4LFBK 1LW2A 3PX4A 4BE2A 2YHAA 2ETJA 1FXXA 4KI6A 5KGXA 4DR4K 1KD1O 4GVMA 3E9OA 4LF8K 3R3LA 1QSSA 1QQOA 4FWLA 2O8DB 3O8MA 1BQNA 1HKCA 4NYNA 4CFDA 3KK1A 5AQRA 3CCMN 3AV9A 2HB5A 3VA3A 3RMBA 3CFOA 2FBVA 3VMFB 1ATSA 4FJ9A 5CHIA 3SAFA 1Z25A 3VEXA 4CHNA 5FLXO 3NE6A 2D1KA 3MMVA 4DV3K 1GLBG 2DPNA 3MXMA 4DU1A 1SL0A 3T19A 1WB9A 4DS5A 3J7AP 2ZQBA 4WYBA 4QOZB 3OYCA 1JL1A 2O4GA 2YNFA 4FWRA 2JLEA 2O4IA 4NLBA 1OKJA 2E2NA 4H0PA 4DSJA 3CPWM 4NCBA 4JKGA 4MO5A 4PA1A 1TKZA 5AQIA 4YOVA 2YCHA 1HKGA 3DXMB 3H3OB 5GIPA 3S3NA 2QWQA 4BC5A 1TUYA 3ULEB 4DQRA 4M41A 5KGWA 2G8HA 1Q86O 5C10A 4DR1K 1ASVA 3QLHA 1W97L 3OHRA 4KFBA 4M7XA 3JSMA 3KD1E 4CJQA 3OYIA 4C8OA 1WUAA 3P5JA 3U3YA 3WEEB 3LL3A 3TWHA 3MX5A 5BPMA 4XEIA 1BDGA 4BR2A 3QEWA 1JLEA 1JCFA 3ZEUA 3LWLA 3M6GA 1CZAN 4CGDA 3D6RA 4CJEA 3EN9A 3WNGA 2GBZA 1C1AA 4IOXA 2B4JA 4WFNL 4AILC 3CD6N 3KKRA 3FFKB 1QVFM 1TL1A 3DXKB 4NO7A 4C1NI 4KHQA 4W5OA 1XNQK 3V81A 1YHQN 4FWKA 4J8FA 3KHYA 3AO2A 4XH4A 3ENOA 4CIFA 3PO5A 1RDAA 2ASOA 3W0LA 2IC3A 2E1ZA 3K0SA 1ESVA 3CCQN 3VETA 1V4SA 1J9AA 1ZBUA 4BRLA 2A3ZA 3O3GA 5HRNA 2G8VA 1VQ6N 1RT5A 2OCEA 5BPNA 5JLHA 2P5GA 4PQUA 1U2VA 5DK5A 4GV9A 1HYVA 1YITN 1REVA 1UA0A 1BI4A 3J80O 1IH7A 3U6FA 4AHVA 3TTDA 4Z4HA 2YV0X 1QTMA 4H5NA 4BVOA 5AFUA 3K9KA 5FPMA 1CZBA 1O13A 3DOLA 2D5RA 1RDUA 4DQSA 1NG9A 3DRPA 1NM1A 1KAZA 3MN7A 3NCIA 3ZX3A 4CHYA 2BDPA 4K42A 4CW7B 1HPMA 3CQYA 4CCHA 1XNRK 2G8KA 1VRUA 4DSKA 1SKRA 3UKRA 4IO9L 5GADP 4BC4A 4WQ5A 3VQCA 3ISNC 2QKBA 3CPEA 4A59A 3MN6A 1S9GA 5KTQA 3T3FA 2YNHA 1NKBA 4CFBA 1R59O 1X9MA 1TKDA 5HOOA 3TAQA 1P90A 4CJVA 3PSIA 3ASMA 4JK7A 1LWFA 4KB0A 2GTDA 2YHBA 5I9EB 5E41A 2A1SA 3SK3A 3M8SA 3SAGA 3OYHA 3O4WA 1E4GT 2CGLA 3WNEA 3DYAA 5HL7L 4ICLA 4O0IA 3I0RA 4JKHA 4DU3A 2QTDA 1WNSA 5C24A 3C7NB 2D0AA 3BZCA 4YNQA 4K25A 1RT4A 1S1TA 4FJHA 4W5QA 4JKFA 3ALYA 3KLEA 5C25A 2O8CA 2GUPA 3VEYA 2Q97A 3CC2N 4FWSA 3HXMA 2XO7A 3LDQA 5CY4A 1BA0A 3RR7A 2YNGA 4FYDA 2VYPA 4M3UA 3RMDA 1JLAA 4JAXA 4BRPA 5LY3A 1J54A 3CMAN 1NK0A 2PBDA 4IDHA
chains in the Genus database with same CATH topology
4FLWA 4H4OA 3K59A 1VK0A 3SQ1A 3LZIA 1RT6A 1QHTA 4O5BA 3L2WA 1D9DA 4LD0A 3V1QA 3MECA 4KB1A 3SCXA 1EXQA 3B6OA 3DLHA 3ZT3A 1TK0A 4M3RA 4BE1A 2G8UA 1VSLA 4FZXC 2KFZA 1TL3A 3RR8A 1U47A 4B9SA 2OPPA 3K5MA 3RRGA 3KK3A 4DTPA 2OYQA 4MFBA 3OY9A 3H08A 2NUBA 4FLUA 2HW3A 1CLQA 3IG1A 1D8YA 2RF2A 4NYFA 2OPRA 5C42A 4FM2A 1ZYQA 3ZT4A 4KKOA 1O1WA 4E7HA 1Q9YA 5I3UA 3KLFA 3VQQA 4KREA 3TABA 1T8EA 3MXIA 3D0PA 1D5AA 3NF9A 1U45A 1NOYA 1KFSA 3HPGA 2B6AA 3O4QA 3AVBA 2X6SA 3E01A 3SUNA 4Y1CA 4HUFA 3DLKA 4B3OA 1JXBA 3DM2A 1RTDA 3O3HA 4KRFA 3QEXA 5JS2A 2E4LA 3ZSZA 4CEDA 4CF8A 1SKSA 3PX0A 1C0TA 3PY8A 3KTQA 2FBXA 1NOZA 4HCCA 1RBTA 4DSIA 3S9HA 1VSDA 2PYLA 4CFCA 4DTMA 1IKXA 1C1BA 3MEDA 4LH4A 4IKFA 1C0UA 1ZBLA 4B9NA 4FJ8A 4N56A 2KFNA 3DLBA 4N41A 1J5OA 4CHOA 4CEOA 5HP1A 1U49A 3OYMA 1GOCA 1QSYA 4PWDA 4DMNA 4E7JA 1XC9A 4DFJA 2RN2A 1TK5A 4KHNA 3JYTA 4RW4A 4EP5A 4G1QA 3HSTB 3M8RA 4CIEA 5CYMA 3KKSA 3NGZA 1Q9XA 2ZE2A 4IBNA 4Z4IA 1QSLA 1LAWA 3DLRA 4NCAA 3QESA 3ZCMA 3HJFA 3LPUA 3V4IA 4CEAA 1RTHA 2KZZA 4BE0A 4DS4A 4B08A 4PUOA 1BL3A 3HO1A 1WSFA 4BWJA 1X1PA 3LDSA 2KW4A 2X6NA 2HNDA 1JLBA 3MEGA 3K5NA 1JLFA 4DFKA 2Y1IA 4ID5A 3SUQA 1VSMA 2G8IA 2HHUA 2HHXA 3AVFA 4QCLA 3QNOA 2BGGA 5HRSA 4N76A 1I39A 3DRRA 3NH0A 3QEVA 3B6PA 3ZT2A 3CQ8A 3AVKA 2X74A 3HT3A 5J2QA 3KLHA 1KSPA 3A2FA 5FRNA 1L3UA 3V9UA 5DMRA 4C8LA 4KAZA 3TANA 3DOKA 4B9LA 1T03A 1K6YA 4FLZA 4CHPA 3HM9A 3M8QA 3NDKA 1DLOA 3V9SA 4CERA 4O55A 4CFAA 3SUPA 3SNNA 4ELUA 4DTNA 3VQEA 1N5YA 3OS1A 3V9XA 3C6UA 1ASWA 2G8WA 4YFUA 2PY5A 3SV4A 4BDZA 3SV3A 2Z1GA 3O4NA 1KLNA 5HRRA 1IO2A 3RRHA 4FJGA 3L2VA 4ELVA 4Z4CA 2OA8A 3HK2A 1JXEA 1RBVA 2P51A 4B9UA 4EZ9A 1ZBHA 1GOBA 1QS4A 3UIQA 3AVGA 4Z0UA 1YTAA 1RBUA 1KRPA 1IKVA 3NAEA 1LW0A 4CE9A 4CIGA 1KCFA 3L3VA 1BI4B 3G10A 1WN7A 3LP2A 1VSHA 2X78A 2IAJA 3KLIA 3VQBA 4IFVA 1NJYA 2HHSA 4GW6A 3HVTA 4PY5A 2FC0A 3K5OA 2KQ2A 1BIZA 2Z1IA 3OYDA 2HVHA 4M3XA 1NKEA 1VSKA 4C8NA 2KTQA 3OJUA 4IG3A 3TR8A 1L3VA 1TKXA 4RW6A 3DI6A 4CJ5A 5SWMA 3L2UA 2QXFA 3LZJA 1QQCA 2RPIA 4DFMA 4F4KA 3VN5A 4ELTA 4TSXA 2JGUA 3ITHA 4CF1A 3TAFA 4B8CA 1B92A 4OJRA 4K8ZA 3ZSWA 2OPSA 3PO4A 4EZ6A 4Z4GA 1KVCA 4OVLA 1LWCA 4CGFA 3SQ2A 1NK8A 1KVAA 1NK9A 1WSJA 4I9QA 5JS1A 1BISA 2GV9A 3SI6A 2LSNA 1BIUA 5FRMA 1WSEA 1S9EA 4Z4FA 2Z1JA 3AVNA 2HNZA 4I7FA 5CYQA 1HPZA 1WLJA 4CK2A 1RCHA 4DTUA 3QERA 3QINA 4ZHRA 1FKPA 1L5UA 2QK9A 1N6QA 1HQUA 5SZTA 1X9WA 4CF9A 3ZSVA 1U04A 1C6VA 4N5SA 3MXJA 2XRIA 4Q5VA 2OZMA 3OYKA 4E0DA 1DTTA 2E6MA 4DQQA 2I5JA 4JRPA 4FVMA 3M8PA 4CEBA 3C95A 1SL1A 4L8RB 2HNYA 2XY5A 4FK2A 1RT1A 2D0BA 1RDDA 1IKYA 1S1XA 3SYZA 1HQEA 4M3ZA 1BGXT 4DQPA 3OYBA 1CZ9A 4KV8A 1BCMA 3D45A 4DG1A 3IRXA 2WONA 1RBRA 2PZSA 1CXQA 1UAXA 1HMVA 1YVUA 4CGIA 1QE1A 4E7LA 4OGCA 3I8DA 4KTWA 4N47A 1WAFA 2VG5A 3SUOA 2G8FA 4CJFA 1Z26A 4FJKA 4JS5A 4F2RA 4E7IA 4I2PA 4E3SA 4FZZA 2XY8A 2DFHA 3TAGA 3CM6A 2IGIA 4AH9A 4W5TA 3AO3A 4ZTFA 4M3YA 4M3TA 3NH1A 4J2BA 4F2SA 1IKWA 1FK9A 1YT3A 2DFEA 3BDPA 1Q8IA 3NBPA 1KLMA 4BDPA 3AA5X 3QO9A 1S5JA 4CF2A 4LH5A 1EP4A 3RMCA 4ID1A 2P1JA 4CJ3A 4FLYA 2VG6A 4CJ4A 3AVAA 4FJLA 4AHTA 2VWKA 3TAMA 2HHQA 3OVNA 4E7KA 4CHQA 3L2RA 4C8MA 3EZ5A 3CFPA 4FK0A 4KHSA 4KTZA 1LW2A 3WNHA 3PX4A 4HCBA 3LAMA 1C0MA 3HL8A 3LALA 4AHUA 3P83D 4BE2A 4DTSA 2YHAA 2ETJA 1LV5A 1S6QA 3VQ7A 1FXXA 1JLCA 3VQPA 4AHCA 5KGXA 2XY7A 4KI6A 4DTXA 4GVMA 3ZSXA 2IS3A 3K5LA 4KPYA 4DFPA 1QSSA 1L3SA 3CG7A 1VSIA 4JRQA 1BQNA 3CFRA 4NYNA 4CFDA 4FLXA 3KK1A 4FLVA 3KIOA 1IG9A 4EP4A 3AV9A 4J2DA 4XIUA 2HB5A 3VA3A 4OLAA 3RMBA 3CFOA 5I42A 1RT3A 2FBVA 1NJWA 2IDOA 4FJ9A 3K58A 3NF7A 1C1CA 3SPYA 1Z25A 4CHNA 3K57A 1NKCA 1D9FA 4E89A 3LPTA 1HJRA 3NE6A 1SL2A 1RNHA 2F8SA 1RILA 4ZTJA 3PX6A 3MXMA 4OPKA 4B9VA 2HHVA 4DU1A 2YNIA 1SL0A 3T19A 4CEZA 4DS5A 3L8BA 4KO0A 1S1WA 2ZQBA 4I2QA 4IFYA 4QOZB 3OYCA 1JL1A 1T05A 1F21A 2O4GA 2YNFA 3VQ9A 3QIOA 4CGHA 4AHRA 4UQGA 2JLEA 3G0ZA 2O4IA 2Y1JA 2EHGA 2W42A 3ZT1A 1HYSA 3OYLA 3CYMA 4CK3A 4O0JA 5J1EA 2R7YA 1W0HA 4B9MA 4DSJA 4K8XA 4IG0A 4NCBA 3L3UA 4HUGA 4PA1A 1TKZA 4CJUA 3T1AA 1UOCA 3OS2A 4KHUA 4HTUA 4HHTA 1TAQA 3S3NA 4MQ3A 3HP9A 3ZSQA 3VQ8A 4DQRA 3NGYA 1JL2A 4OKEA 4M41A 3V9ZA 1NJXA 4FJ7A 5KGWA 3AVMA 3PV8A 2G8HA 4DSEA 2YKNA 4RW8A 4FM1A 1ASVA 3QLHA 4OGEA 1SKWA 3QNNA 4KFBA 1RT7A 3SPZA 4FJMA 3JSMA 2XY6A 1ZBIA 1VRTA 1WSHA 3HVRA 3KD1E 1EETA 4CJQA 4QAGA 4CGJA 3OYFA 3OYIA 3VQ6A 4C8OA 4DSLA 3NFAA 3P5JA 3U3YA 1SUQA 4OKKA 4BDYA 3TWHA 2ATQA 1GOAA 2YKMA 4RW7A 4FJ5A 3QEWA 1JLEA 4O44A 3LWLA 4DF8A 1JLGA 3AVIA 2DFFA 4F8RA 4KHWA 4KHYA 4CGDA 1RTIA 1RBSA 3EY1A 4F3TA 2KZMA 4CJEA 3WNGA 3NHGA 2GBZA 4CJTA 1C1AA 3OYEA 3VA0A 4FJJA 3LAKA 2B4JA 2F96A 3V6DA 4AILC 3KKRA 5CZ1A 4CESA 4Z4EA 1XWLA 3TI0A 1I3AA 3QIPA 3KK2A 1KTQA 1WSIA 4CJPA 1TL1A 4FZYA 1ASUA 3OYGA 3OJSA 4KHQA 4W5OA 4E19A 3WNFA 4E1NA 3V81A 2GUIA 4DSFA 1XHZA 5D3GA 3OS0A 3AO2A 3OYNA 3NGIA 1RDBA 1HNVA 4CIFA 1VSEA 3PO5A 3VQ5A 4FJXA 3V9WA 2HHWA 4CEEA 4FW2A 1VSFA 4CJSA 1RDAA 1UWBA 2RKIA 2IC3A 5J2MA 3LP1A 3LWMA 3C94A 4LY7A 1HRHA 3O3FA 2OZSA 1TVRA 4FJNA 1HYZA 2AJQA 3LP0A 4BWMA 3SJJA 1TGOA 3AO4A 3MEEA 2IOCA 1J9AA 1S6PA 3V1OA 4I9LA 4C8KA 1S1UA 1ZBUA 3ULDA 3AVCA 4BACA 1NK5A 3ZSRA 3O3GA 4FK4A 3QETA 4JLHA 3BGRA 1NK4A 1WAJA 3LP3A 4RW9A 4B8AB 4CECA 5HRNA 1XHXA 5KRTA 4HUEA 3EYZA 3TAEA 2G8VA 1RT5A 4CEFA 1SV5A 4H4MA 2P5GA 4PQUA 1T7PA 3AO5A 5DK5A 1VSJA 4LSLA 1HYVA 1REVA 4Y1DA 3SQ4A 1A5XA 3F9KA 1UA0A 1BI4A 1B9DA 1IH7A 1ZBFA 3THVA 4HVJA 5J2PA 2Q3SA 3ZSYA 3U6FA 4F3OA 1RDCA 5FDLA 4AHVA 4CGGA 4DQIA 5CZ2A 4Z4HA 1B9FA 4W5NA 2ITGA 2YV0X 3DRSA 1QTMA 5J2NA 3NF6A 3OYJA 1Y97A 3ZSOA 4KI4A 2Z1HA 1CZBA 3CM5A 1L3TA 4CJWA 2F8TA 3DOLA 1TAUA 2D5RA 3TAPA 1YTUA 5HROA 4DQSA 3DRPA 1A5WA 3SZ2A 1R0AA 4CK1A 1WSGA 3IS9A 3KJVA 3NCIA 2BANA 4CHYA 2BDPA 1JKHA 1RTJA 3VQ4A 4CEQA 4CJKA 4AHSA 4CCHA 2G8KA 3NF8A 1A5VA 1VRUA 2OPQA 4DLEA 1SKRA 3U3GA 4W5RA 4DSKA 3QEIA 2HVIA 2HHTA 2HMIA 3FFIA 3RWUA 3VQCA 1J53A 3ISNC 4LSNA 5HLFA 2QKBA 1DTQA 4E1MA 4OLBA 3AVJA 3VQAA 1S9GA 5KTQA 3T3FA 1TV6A 2YNHA 1NKBA 1XI1A 4CFBA 1X9MA 5HRPA 3NH2A 2ZD1A 1TKDA 1RT2A 2FBTA 4J2AA 3PUFA 3MAQA 3TAQA 1U4BA 3V1RA 3DLEA 2P5OA 4CJVA 4M45A 4OPJA 1BCOA 4J2EA 3ASMA 3RMAA 1LWFA 4DU4A 4FM0A 4KB0A 4M42A 3AA2A 3DLGA 2YHBA 1S1VA 1W9HA 3AVHA 3AVLA 2A1SA 5E41A 3RTVA 3QEPA 3OYAA 1NK7A 1ITGA 4KTQA 3KLGA 3M8SA 1G15A 2VG7A 3OYHA 5HBMA 1KVBA 2D0CA 3AA3A 5KI6A 1CXUA 1JLQA 3DYAA 3WNEA 3KD5E 3K2PA 1UA1A 4ICLA 3AO1A 4O0IA 3I0RA 1TKTA 4DF4A 3ZT0A 4DU3A 1EKEA 3DMJA 1WNSA 3P1GA 4CJLA 5C24A 2E6LA 3AA4A 3TARA 4NCGA 2D0AA 2VWJA 4RG8A 4YNQA 4JS4A 1RT4A 1S1TA 2EX3A 3S3OA 4FXDA 4FJHA 4W5QA 5EU7A 4CJRA 3HP6A 4B9TA 3ALYA 5KRSA 2DY4A 2B5JA 1LWEA 1BHLA 1FKOA 3KLEA 5T7BA 4FJIA 2DTUA 2BE2A 3HPHA 5C25A 1U48A 2FBYA 1BQMA 4H8KA 4DLGA 4CHZA 1NK6A 3LANA 2WOMA 1X9SA 2PYJA 4FLTA 4FCYA 3HXMA 2XO7A 1TK8A 3SQ0A 3F73A 1EX4A 1HNIA 5CY4A 4M3WA 4OKJA 4WE1A 5K14A 2A1RA 2YNGA 3RR7A 3L2QA 4FYDA 4IDKA 1NJZA 1MU2A 4O4GA 4DTOA 4M3UA 4DTRA 3C6TA 4Q0BA 3S3MA 4GMJB 3HYFA 1KFDA 1JLAA 3I0SA 3RMDA 3IAYA 4DTJA 3HPOA 1J54A 2XHBA 3VQDA 4R5PA 4CF0A 1LAVA 2QKKA 1NK0A 5FROA 4FW1A 4DWIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FLW A;  4H4O A;  3K59 A;  1VK0 A;  3SQ1 A;  3LZI A;  1RT6 A;  1QHT A;  4O5B A;  3L2W A;  1D9D A;  4LD0 A;  3V1Q A;  3MEC A;  4KB1 A;  3SCX A;  1EXQ A;  3B6O A;  3DLH A;  3ZT3 A;  1TK0 A;  4M3R A;  4BE1 A;  2G8U A;  1VSL A;  4FZX C;  2KFZ A;  1TL3 A;  3RR8 A;  1U47 A;  4B9S A;  2OPP A;  3K5M A;  3RRG A;  3KK3 A;  4DTP A;  2OYQ A;  4MFB A;  3OY9 A;  3H08 A;  2NUB A;  4FLU A;  2HW3 A;  1CLQ A;  3IG1 A;  1D8Y A;  2RF2 A;  4NYF A;  2OPR A;  5C42 A;  4FM2 A;  1ZYQ A;  3ZT4 A;  4KKO A;  1O1W A;  4E7H A;  1Q9Y A;  5I3U A;  3KLF A;  3VQQ A;  4KRE A;  3TAB A;  1T8E A;  3MXI A;  3D0P A;  1D5A A;  3NF9 A;  1U45 A;  1NOY A;  1KFS A;  3HPG A;  2B6A A;  3O4Q A;  3AVB A;  2X6S A;  3E01 A;  3SUN A;  4Y1C A;  4HUF A;  3DLK A;  4B3O A;  1JXB A;  3DM2 A;  1RTD A;  3O3H A;  4KRF A;  3QEX A;  5JS2 A;  2E4L A;  3ZSZ A;  4CED A;  4CF8 A;  1SKS A;  3PX0 A;  1C0T A;  3PY8 A;  3KTQ A;  2FBX A;  1NOZ A;  4HCC A;  1RBT A;  4DSI A;  3S9H A;  1VSD A;  2PYL A;  4CFC A;  4DTM A;  1IKX A;  1C1B A;  3MED A;  4LH4 A;  4IKF A;  1C0U A;  1ZBL A;  4B9N A;  4FJ8 A;  4N56 A;  2KFN A;  3DLB A;  4N41 A;  1J5O A;  4CHO A;  4CEO A;  5HP1 A;  1U49 A;  3OYM A;  1GOC A;  1QSY A;  4PWD A;  4DMN A;  4E7J A;  1XC9 A;  4DFJ A;  2RN2 A;  1TK5 A;  4KHN A;  3JYT A;  4RW4 A;  4EP5 A;  4G1Q A;  3HST B;  3M8R A;  4CIE A;  5CYM A;  3KKS A;  3NGZ A;  1Q9X A;  2ZE2 A;  4IBN A;  4Z4I A;  1QSL A;  1LAW A;  3DLR A;  4NCA A;  3QES A;  3ZCM A;  3HJF A;  3LPU A;  3V4I A;  4CEA A;  1RTH A;  2KZZ A;  4BE0 A;  4DS4 A;  4B08 A;  4PUO A;  1BL3 A;  3HO1 A;  1WSF A;  4BWJ A;  1X1P A;  3LDS A;  2KW4 A;  2X6N A;  2HND A;  1JLB A;  3MEG A;  3K5N A;  1JLF A;  4DFK A;  2Y1I A;  4ID5 A;  3SUQ A;  1VSM A;  2G8I A;  2HHU A;  2HHX A;  3AVF A;  4QCL A;  3QNO A;  2BGG A;  5HRS A;  4N76 A;  1I39 A;  3DRR A;  3NH0 A;  3QEV A;  3B6P A;  3ZT2 A;  3CQ8 A;  3AVK A;  2X74 A;  3HT3 A;  5J2Q A;  3KLH A;  1KSP A;  3A2F A;  5FRN A;  1L3U A;  3V9U A;  5DMR A;  4C8L A;  4KAZ A;  3TAN A;  3DOK A;  4B9L A;  1T03 A;  1K6Y A;  4FLZ A;  4CHP A;  3HM9 A;  3M8Q A;  3NDK A;  1DLO A;  3V9S A;  4CER A;  4O55 A;  4CFA A;  3SUP A;  3SNN A;  4ELU A;  4DTN A;  3VQE A;  1N5Y A;  3OS1 A;  3V9X A;  3C6U A;  1ASW A;  2G8W A;  4YFU A;  2PY5 A;  3SV4 A;  4BDZ A;  3SV3 A;  2Z1G A;  3O4N A;  1KLN A;  5HRR A;  1IO2 A;  3RRH A;  4FJG A;  3L2V A;  4ELV A;  4Z4C A;  2OA8 A;  3HK2 A;  1JXE A;  1RBV A;  2P51 A;  4B9U A;  4EZ9 A;  1ZBH A;  1GOB A;  1QS4 A;  3UIQ A;  3AVG A;  4Z0U A;  1YTA A;  1RBU A;  1KRP A;  1IKV A;  3NAE A;  1LW0 A;  4CE9 A;  4CIG A;  1KCF A;  3L3V A;  1BI4 B;  3G10 A;  1WN7 A;  3LP2 A;  1VSH A;  2X78 A;  2IAJ A;  3KLI A;  3VQB A;  4IFV A;  1NJY A;  2HHS A;  4GW6 A;  3HVT A;  4PY5 A;  2FC0 A;  3K5O A;  2KQ2 A;  1BIZ A;  2Z1I A;  3OYD A;  2HVH A;  4M3X A;  1NKE A;  1VSK A;  4C8N A;  2KTQ A;  3OJU A;  4IG3 A;  3TR8 A;  1L3V A;  1TKX A;  4RW6 A;  3DI6 A;  4CJ5 A;  5SWM A;  3L2U A;  2QXF A;  3LZJ A;  1QQC A;  2RPI A;  4DFM A;  4F4K A;  3VN5 A;  4ELT A;  4TSX A;  2JGU A;  3ITH A;  4CF1 A;  3TAF A;  4B8C A;  1B92 A;  4OJR A;  4K8Z A;  3ZSW A;  2OPS A;  3PO4 A;  4EZ6 A;  4Z4G A;  1KVC A;  4OVL A;  1LWC A;  4CGF A;  3SQ2 A;  1NK8 A;  1KVA A;  1NK9 A;  1WSJ A;  4I9Q A;  5JS1 A;  1BIS A;  2GV9 A;  3SI6 A;  2LSN A;  1BIU A;  5FRM A;  1WSE A;  1S9E A;  4Z4F A;  2Z1J A;  3AVN A;  2HNZ A;  4I7F A;  5CYQ A;  1HPZ A;  1WLJ A;  4CK2 A;  1RCH A;  4DTU A;  3QER A;  3QIN A;  4ZHR A;  1FKP A;  1L5U A;  2QK9 A;  1N6Q A;  1HQU A;  5SZT A;  1X9W A;  4CF9 A;  3ZSV A;  1U04 A;  1C6V A;  4N5S A;  3MXJ A;  2XRI A;  4Q5V A;  2OZM A;  3OYK A;  4E0D A;  1DTT A;  2E6M A;  4DQQ A;  2I5J A;  4JRP A;  4FVM A;  3M8P A;  4CEB A;  3C95 A;  1SL1 A;  4L8R B;  2HNY A;  2XY5 A;  4FK2 A;  1RT1 A;  2D0B A;  1RDD A;  1IKY A;  1S1X A;  3SYZ A;  1HQE A;  4M3Z A;  1BGX T;  4DQP A;  3OYB A;  1CZ9 A;  4KV8 A;  1BCM A;  3D45 A;  4DG1 A;  3IRX A;  2WON A;  1RBR A;  2PZS A;  1CXQ A;  1UAX A;  1HMV A;  1YVU A;  4CGI A;  1QE1 A;  4E7L A;  4OGC A;  3I8D A;  4KTW A;  4N47 A;  1WAF A;  2VG5 A;  3SUO A;  2G8F A;  4CJF A;  1Z26 A;  4FJK A;  4JS5 A;  4F2R A;  4E7I A;  4I2P A;  4E3S A;  4FZZ A;  2XY8 A;  2DFH A;  3TAG A;  3CM6 A;  2IGI A;  4AH9 A;  4W5T A;  3AO3 A;  4ZTF A;  4M3Y A;  4M3T A;  3NH1 A;  4J2B A;  4F2S A;  1IKW A;  1FK9 A;  1YT3 A;  2DFE A;  3BDP A;  1Q8I A;  3NBP A;  1KLM A;  4BDP A;  3AA5 X;  3QO9 A;  1S5J A;  4CF2 A;  4LH5 A;  1EP4 A;  3RMC A;  4ID1 A;  2P1J A;  4CJ3 A;  4FLY A;  2VG6 A;  4CJ4 A;  3AVA A;  4FJL A;  4AHT A;  2VWK A;  3TAM A;  2HHQ A;  3OVN A;  4E7K A;  4CHQ A;  3L2R A;  4C8M A;  3EZ5 A;  3CFP A;  4FK0 A;  4KHS A;  4KTZ A;  1LW2 A;  3WNH A;  3PX4 A;  4HCB A;  3LAM A;  1C0M A;  3HL8 A;  3LAL A;  4AHU A;  3P83 D;  4BE2 A;  4DTS A;  2YHA A;  2ETJ A;  1LV5 A;  1S6Q A;  3VQ7 A;  1FXX A;  1JLC A;  3VQP A;  4AHC A;  5KGX A;  2XY7 A;  4KI6 A;  4DTX A;  4GVM A;  3ZSX A;  2IS3 A;  3K5L A;  4KPY A;  4DFP A;  1QSS A;  1L3S A;  3CG7 A;  1VSI A;  4JRQ A;  1BQN A;  3CFR A;  4NYN A;  4CFD A;  4FLX A;  3KK1 A;  4FLV A;  3KIO A;  1IG9 A;  4EP4 A;  3AV9 A;  4J2D A;  4XIU A;  2HB5 A;  3VA3 A;  4OLA A;  3RMB A;  3CFO A;  5I42 A;  1RT3 A;  2FBV A;  1NJW A;  2IDO A;  4FJ9 A;  3K58 A;  3NF7 A;  1C1C A;  3SPY A;  1Z25 A;  4CHN A;  3K57 A;  1NKC A;  1D9F A;  4E89 A;  3LPT A;  1HJR A;  3NE6 A;  1SL2 A;  1RNH A;  2F8S A;  1RIL A;  4ZTJ A;  3PX6 A;  3MXM A;  4OPK A;  4B9V A;  2HHV A;  4DU1 A;  2YNI A;  1SL0 A;  3T19 A;  4CEZ A;  4DS5 A;  3L8B A;  4KO0 A;  1S1W A;  2ZQB A;  4I2Q A;  4IFY A;  4QOZ B;  3OYC A;  1JL1 A;  1T05 A;  1F21 A;  2O4G A;  2YNF A;  3VQ9 A;  3QIO A;  4CGH A;  4AHR A;  4UQG A;  2JLE A;  3G0Z A;  2O4I A;  2Y1J A;  2EHG A;  2W42 A;  3ZT1 A;  1HYS A;  3OYL A;  3CYM A;  4CK3 A;  4O0J A;  5J1E A;  2R7Y A;  1W0H A;  4B9M A;  4DSJ A;  4K8X A;  4IG0 A;  4NCB A;  3L3U A;  4HUG A;  4PA1 A;  1TKZ A;  4CJU A;  3T1A A;  1UOC A;  3OS2 A;  4KHU A;  4HTU A;  4HHT A;  1TAQ A;  3S3N A;  4MQ3 A;  3HP9 A;  3ZSQ A;  3VQ8 A;  4DQR A;  3NGY A;  1JL2 A;  4OKE A;  4M41 A;  3V9Z A;  1NJX A;  4FJ7 A;  5KGW A;  3AVM A;  3PV8 A;  2G8H A;  4DSE A;  2YKN A;  4RW8 A;  4FM1 A;  1ASV A;  3QLH A;  4OGE A;  1SKW A;  3QNN A;  4KFB A;  1RT7 A;  3SPZ A;  4FJM A;  3JSM A;  2XY6 A;  1ZBI A;  1VRT A;  1WSH A;  3HVR A;  3KD1 E;  1EET A;  4CJQ A;  4QAG A;  4CGJ A;  3OYF A;  3OYI A;  3VQ6 A;  4C8O A;  4DSL A;  3NFA A;  3P5J A;  3U3Y A;  1SUQ A;  4OKK A;  4BDY A;  3TWH A;  2ATQ A;  1GOA A;  2YKM A;  4RW7 A;  4FJ5 A;  3QEW A;  1JLE A;  4O44 A;  3LWL A;  4DF8 A;  1JLG A;  3AVI A;  2DFF A;  4F8R A;  4KHW A;  4KHY A;  4CGD A;  1RTI A;  1RBS A;  3EY1 A;  4F3T A;  2KZM A;  4CJE A;  3WNG A;  3NHG A;  2GBZ A;  4CJT A;  1C1A A;  3OYE A;  3VA0 A;  4FJJ A;  3LAK A;  2B4J A;  2F96 A;  3V6D A;  4AIL C;  3KKR A;  5CZ1 A;  4CES A;  4Z4E A;  1XWL A;  3TI0 A;  1I3A A;  3QIP A;  3KK2 A;  1KTQ A;  1WSI A;  4CJP A;  1TL1 A;  4FZY A;  1ASU A;  3OYG A;  3OJS A;  4KHQ A;  4W5O A;  4E19 A;  3WNF A;  4E1N A;  3V81 A;  2GUI A;  4DSF A;  1XHZ A;  5D3G A;  3OS0 A;  3AO2 A;  3OYN A;  3NGI A;  1RDB A;  1HNV A;  4CIF A;  1VSE A;  3PO5 A;  3VQ5 A;  4FJX A;  3V9W A;  2HHW A;  4CEE A;  4FW2 A;  1VSF A;  4CJS A;  1RDA A;  1UWB A;  2RKI A;  2IC3 A;  5J2M A;  3LP1 A;  3LWM A;  3C94 A;  4LY7 A;  1HRH A;  3O3F A;  2OZS A;  1TVR A;  4FJN A;  1HYZ A;  2AJQ A;  3LP0 A;  4BWM A;  3SJJ A;  1TGO A;  3AO4 A;  3MEE A;  2IOC A;  1J9A A;  1S6P A;  3V1O A;  4I9L A;  4C8K A;  1S1U A;  1ZBU A;  3ULD A;  3AVC A;  4BAC A;  1NK5 A;  3ZSR A;  3O3G A;  4FK4 A;  3QET A;  4JLH A;  3BGR A;  1NK4 A;  1WAJ A;  3LP3 A;  4RW9 A;  4B8A B;  4CEC A;  5HRN A;  1XHX A;  5KRT A;  4HUE A;  3EYZ A;  3TAE A;  2G8V A;  1RT5 A;  4CEF A;  1SV5 A;  4H4M A;  2P5G A;  4PQU A;  1T7P A;  3AO5 A;  5DK5 A;  1VSJ A;  4LSL A;  1HYV A;  1REV A;  4Y1D A;  3SQ4 A;  1A5X A;  3F9K A;  1UA0 A;  1BI4 A;  1B9D A;  1IH7 A;  1ZBF A;  3THV A;  4HVJ A;  5J2P A;  2Q3S A;  3ZSY A;  3U6F A;  4F3O A;  1RDC A;  5FDL A;  4AHV A;  4CGG A;  4DQI A;  5CZ2 A;  4Z4H A;  1B9F A;  4W5N A;  2ITG A;  2YV0 X;  3DRS A;  1QTM A;  5J2N A;  3NF6 A;  3OYJ A;  1Y97 A;  3ZSO A;  4KI4 A;  2Z1H A;  1CZB A;  3CM5 A;  1L3T A;  4CJW A;  2F8T A;  3DOL A;  1TAU A;  2D5R A;  3TAP A;  1YTU A;  5HRO A;  4DQS A;  3DRP A;  1A5W A;  3SZ2 A;  1R0A A;  4CK1 A;  1WSG A;  3IS9 A;  3KJV A;  3NCI A;  2BAN A;  4CHY A;  2BDP A;  1JKH A;  1RTJ A;  3VQ4 A;  4CEQ A;  4CJK A;  4AHS A;  4CCH A;  2G8K A;  3NF8 A;  1A5V A;  1VRU A;  2OPQ A;  4DLE A;  1SKR A;  3U3G A;  4W5R A;  4DSK A;  3QEI A;  2HVI A;  2HHT A;  2HMI A;  3FFI A;  3RWU A;  3VQC A;  1J53 A;  3ISN C;  4LSN A;  5HLF A;  2QKB A;  1DTQ A;  4E1M A;  4OLB A;  3AVJ A;  3VQA A;  1S9G A;  5KTQ A;  3T3F A;  1TV6 A;  2YNH A;  1NKB A;  1XI1 A;  4CFB A;  1X9M A;  5HRP A;  3NH2 A;  2ZD1 A;  1TKD A;  1RT2 A;  2FBT A;  4J2A A;  3PUF A;  3MAQ A;  3TAQ A;  1U4B A;  3V1R A;  3DLE A;  2P5O A;  4CJV A;  4M45 A;  4OPJ A;  1BCO A;  4J2E A;  3ASM A;  3RMA A;  1LWF A;  4DU4 A;  4FM0 A;  4KB0 A;  4M42 A;  3AA2 A;  3DLG A;  2YHB A;  1S1V A;  1W9H A;  3AVH A;  3AVL A;  2A1S A;  5E41 A;  3RTV A;  3QEP A;  3OYA A;  1NK7 A;  1ITG A;  4KTQ A;  3KLG A;  3M8S A;  1G15 A;  2VG7 A;  3OYH A;  5HBM A;  1KVB A;  2D0C A;  3AA3 A;  5KI6 A;  1CXU A;  1JLQ A;  3DYA A;  3WNE A;  3KD5 E;  3K2P A;  1UA1 A;  4ICL A;  3AO1 A;  4O0I A;  3I0R A;  1TKT A;  4DF4 A;  3ZT0 A;  4DU3 A;  1EKE A;  3DMJ A;  1WNS A;  3P1G A;  4CJL A;  5C24 A;  2E6L A;  3AA4 A;  3TAR A;  4NCG A;  2D0A A;  2VWJ A;  4RG8 A;  4YNQ A;  4JS4 A;  1RT4 A;  1S1T A;  2EX3 A;  3S3O A;  4FXD A;  4FJH A;  4W5Q A;  5EU7 A;  4CJR A;  3HP6 A;  4B9T A;  3ALY A;  5KRS A;  2DY4 A;  2B5J A;  1LWE A;  1BHL A;  1FKO A;  3KLE A;  5T7B A;  4FJI A;  2DTU A;  2BE2 A;  3HPH A;  5C25 A;  1U48 A;  2FBY A;  1BQM A;  4H8K A;  4DLG A;  4CHZ A;  1NK6 A;  3LAN A;  2WOM A;  1X9S A;  2PYJ A;  4FLT A;  4FCY A;  3HXM A;  2XO7 A;  1TK8 A;  3SQ0 A;  3F73 A;  1EX4 A;  1HNI A;  5CY4 A;  4M3W A;  4OKJ A;  4WE1 A;  5K14 A;  2A1R A;  2YNG A;  3RR7 A;  3L2Q A;  4FYD A;  4IDK A;  1NJZ A;  1MU2 A;  4O4G A;  4DTO A;  4M3U A;  4DTR A;  3C6T A;  4Q0B A;  3S3M A;  4GMJ B;  3HYF A;  1KFD A;  1JLA A;  3I0S A;  3RMD A;  3IAY A;  4DTJ A;  3HPO A;  1J54 A;  2XHB A;  3VQD A;  4R5P A;  4CF0 A;  1LAV A;  2QKK A;  1NK0 A;  5FRO A;  4FW1 A;  4DWI A; 
#chains in the Genus database with same CATH topology
 3U9Z A;  4KH5 A;  4F8R A;  1VK0 A;  1ATN A;  4Y0W A;  4JI4 K;  4GKK K;  1EXQ A;  3B6O A;  1GLJ O;  3DLH A;  2IVO A;  1DEJ A;  4FZX C;  1VSL A;  2O8F A;  3RR8 A;  4B9S A;  2NRT A;  1IBL K;  2E1Y A;  3TSQ A;  4FLU A;  3IG1 A;  2RF2 A;  5KPT A;  5C42 A;  1X3M A;  4U7B A;  2FF6 A;  3N4P A;  4BGB A;  3A0I X;  2ZJQ L;  4OPH A;  1T8E A;  2ZJP L;  3MXI A;  5BRD A;  5DM7 L;  3NF9 A;  1NOY A;  1KFS A;  1YUW A;  2A40 A;  3EZW A;  4HUF A;  4JKG B;  2F7T A;  4X66 K;  3DM2 A;  3O9T A;  5JS2 A;  3QEX A;  4JK8 A;  2QWP A;  4CED A;  4CF8 A;  4BRN A;  3VF4 A;  3PX0 A;  2P9L A;  1SKS A;  1NOZ A;  1WOQ A;  3WUH A;  4IOA L;  4CFC A;  4DTM A;  1C1B A;  4B9N A;  4KBO A;  2KFN A;  1C0F A;  1J5O A;  4B1U B;  4PWD A;  4DCH A;  4E7J A;  4HWI A;  4ILG B;  2VWB A;  3SAH A;  4BRF A;  3HST B;  2F9W A;  1GLA G;  4MLE A;  4BRM A;  1LAW A;  3DLR A;  1QSL A;  2CH5 A;  1P8Z A;  5AQQ A;  1BL3 A;  1WSF A;  3LDS A;  3O9R A;  2HND A;  1JLF A;  3SUQ A;  4ID5 A;  3HI0 A;  3AVF A;  3QML A;  3DRR A;  3QEV A;  1T6D A;  1Q18 A;  3PSF A;  1Q82 O;  3AVK A;  2X74 A;  1KSP A;  4H0T B;  3A2F A;  4DUY K;  4H0X B;  3VTH A;  5DMR A;  4B9L A;  1T03 A;  4ILJ A;  4BGA A;  3NDK A;  2Q2R A;  3BY5 A;  1BWF O;  2EWS A;  4BDZ A;  1NU0 A;  1KLN A;  4ISG A;  4BR7 A;  4CZK A;  4JI7 K;  4MDA A;  1JXE A;  2UYT A;  4B9U A;  4EZ9 A;  1GOB A;  1U2V B;  3A5M C;  3UIQ A;  4Z0U A;  1IKV A;  4CE9 A;  2F9T A;  1KC8 O;  3VEW A;  1KCF A;  1BI4 B;  3G10 A;  1WN7 A;  4R79 A;  2IAJ A;  3KLI A;  4MO4 A;  1NJY A;  5KPR A;  3HVT A;  3BUZ B;  4NXN K;  1VSK A;  2UXC K;  1N32 K;  3OJU A;  3DWL A;  3TR8 A;  1L3V A;  1SZ2 A;  2RPI A;  3VGK A;  4G9Z A;  4JEP A;  2JGU A;  4CF1 A;  1T6C A;  4OJR A;  4K8Z A;  2NRH A;  1LWC A;  1WSJ A;  1BIS A;  2GV9 A;  1WSE A;  3UKR B;  3T1Y K;  5CYQ A;  1JCE A;  1HPZ A;  2QWO A;  1RCH A;  2QK9 A;  1U04 A;  4AM7 A;  3PIO L;  1JJ2 M;  4Q5V A;  3OYK A;  1NGB A;  1YTU A;  2I5J A;  1NMN A;  4FVM A;  3WXI A;  4RTF D;  1RT1 A;  5AQM A;  1HQE A;  5EOY A;  3FE1 A;  4KV8 A;  3IRX A;  1IBM K;  2E88 A;  5C12 A;  4CGI A;  4OGC A;  2Q0U A;  5AQY A;  1Z26 A;  4FJK A;  4F2R A;  1ZXO A;  4E3S A;  5AQU A;  3FZK A;  2DFH A;  3TAG A;  3CM6 A;  3UKU A;  4M3Y A;  1QZ6 A;  3LM2 A;  3D2F A;  4M3T A;  4GY2 B;  1IKW A;  3NBP A;  3AA5 X;  1VQL N;  3QO9 A;  1DGK N;  1D4X A;  4B1W B;  3RMC A;  2VG6 A;  4CJ4 A;  3AVA A;  4DV0 K;  3LDP A;  5CR4 A;  2O8C B;  3EZ5 A;  5KPZ A;  4KTZ A;  3O08 A;  3GDQ A;  1C0M A;  3HL8 A;  2HBK A;  2HMP A;  4CZF A;  4CZM A;  3O6W A;  3AGR A;  3K5L A;  4KPY A;  3MX2 A;  2UUA K;  1L3S A;  1QZ5 A;  1IG8 A;  5EY4 A;  4C1N K;  4FLV A;  4CBX A;  5AQV A;  4H5V A;  3TU5 A;  3EKS A;  5I42 A;  1RT3 A;  1N33 K;  3E1Y A;  3K58 A;  3NF7 A;  3UE5 A;  2WFB A;  4FPA A;  3TTF A;  3SPY A;  1SAZ A;  3K57 A;  4E89 A;  3OBY A;  1SL2 A;  1RNH A;  3QFU A;  4A5A A;  4ZTJ A;  3MN9 A;  4WFB L;  1QVG M;  4OPK A;  2P9I A;  3HSC A;  2HHV A;  3EEQ A;  2YNI A;  5TKY A;  1SS6 A;  2O8E A;  1S1W A;  3T7Z A;  1TYQ A;  4BG9 A;  1F21 A;  3NVK A;  4BRG A;  4DR3 K;  4DKW A;  4A57 A;  2EHG A;  2W42 A;  3CYM A;  1W2B M;  5J1E A;  3CIP A;  1RGI A;  4K8X A;  4IO8 A;  5BR9 A;  4CJU A;  3T1A A;  3QBW A;  3OS2 A;  4YHH K;  4XH5 A;  4MQ3 A;  2ITM A;  1VQ5 N;  3V9Z A;  1NJX A;  5AR0 A;  1VQ8 N;  3CJ9 A;  2YKN A;  4FM1 A;  3HRG A;  5M1F A;  4OGE A;  1HR0 K;  1YF5 L;  3O80 A;  5AQT A;  3SPZ A;  3D2E A;  2XY6 A;  4FJM A;  1VRT A;  3HVR A;  2P9P B;  4QAG A;  4DSL A;  3NFA A;  5LMN K;  4BDY A;  1GOA A;  4RW7 A;  4FJ5 A;  1HKB A;  3A5L C;  1QQN A;  2DFF A;  4KHW A;  4KHY A;  1RTI A;  1RBS A;  4F3T A;  1X9J A;  4CJT A;  3CC4 N;  5M1N A;  4FJJ A;  3LAK A;  4CES A;  4Z4E A;  3U9D A;  3TI0 A;  3QIP A;  4H03 B;  4IZ9 A;  2WC9 A;  3ATU A;  3OYG A;  2IVP A;  3RVC A;  3THW A;  4E19 A;  1DKG D;  3FZM A;  4BVP A;  4KHP K;  3OS0 A;  3U8X A;  5C2F A;  3G4S N;  1VSE A;  4CD1 A;  3V9W A;  5MLC Q;  3MDQ A;  2RKI A;  3HZ6 A;  4JHD A;  3KK7 A;  3LWM A;  3C94 A;  3IMX A;  1TVR A;  4DR7 K;  3F9M A;  1XUP O;  1TGO A;  3AO4 A;  3WT0 A;  4CZH A;  1S6P A;  3V1O A;  1VQM N;  1S1U A;  3ULD A;  1OH6 A;  1NK4 A;  4IEI A;  5KRT A;  3FLC O;  3EYZ A;  2V7Z A;  3GL1 A;  3VER A;  4LSL A;  2NLX A;  3F9K A;  5J2P A;  3JAM O;  5FDL A;  5CZ2 A;  4W5N A;  3NF6 A;  3OYJ A;  2HF3 A;  3CM5 A;  1K8A O;  4CJW A;  1Y64 A;  5HRO A;  5F2R A;  4XH1 A;  1NJI O;  4CK1 A;  1KAY A;  1EWQ A;  2RE2 A;  2BAN A;  1JKH A;  1RTJ A;  4CJK A;  3D7E O;  3P4I A;  2HVI A;  4DLE A;  2HHT A;  3QEI A;  4JYA K;  3QDK A;  1V4T A;  3R1X A;  1J53 A;  4BC3 A;  3Q7C A;  4LSN A;  4OLB A;  2JWL A;  1YAG A;  4H5R A;  4J2A A;  3PUF A;  2P5O A;  3CCU N;  4M45 A;  4OPJ A;  1BCO A;  4J2E A;  3BF1 A;  1S1V A;  5BN9 A;  3QEP A;  4K41 A;  5M1K A;  3RTV A;  3BF3 A;  2PAV A;  1ITG A;  1NK7 A;  5A2Q O;  3KLG A;  3SJH A;  3UKU B;  3AAR A;  3D2F B;  4MDB A;  2D0C A;  4B1Z A;  3FR0 A;  3AA3 A;  2GX9 A;  1JLQ A;  1UA1 A;  5AQX A;  3E66 A;  3VEZ A;  1EKE A;  2KTQ A;  3G25 A;  3AA4 A;  3FZL A;  4NCG A;  1N36 K;  4RG8 A;  4BRK A;  4JS4 A;  5EU7 A;  4CJR A;  5KRS A;  2A41 A;  2B5J A;  4MLH A;  5CE3 A;  1BQM A;  1KAX A;  4H8K A;  2PYJ A;  4FCY A;  3SQ0 A;  3F73 A;  1EX4 A;  1HNI A;  2Q1N A;  2A1R A;  4WE1 A;  1YXQ A;  3L2Q A;  4IDK A;  1NJZ A;  1MU2 A;  4O4G A;  4DTO A;  4DTR A;  3GG4 A;  3NVM A;  4GMJ B;  5E26 A;  4DTJ A;  2XHB A;  2BUP A;  3VQD A;  2ZJR L;  4H4O A;  3LDL A;  3LZI A;  1RT6 A;  3CHW A;  4O5B A;  3L2W A;  3SCX A;  4BE1 A;  1TL3 A;  2P9I B;  3K5M A;  3KK3 A;  4DB3 A;  5LJW A;  4MFB A;  2O8E B;  4FM2 A;  2QXL A;  1TYQ B;  4KKO A;  4GKJ K;  4E7H A;  5I3U A;  4B3S K;  3VF2 A;  3ENH A;  3TAB A;  1ZBS A;  3D0P A;  4A62 A;  5FPD A;  2GEL A;  2HBM A;  2X6S A;  3P38 A;  3SUN A;  3ZX0 A;  4I6M A;  3O3H A;  1C0T A;  4JI0 K;  4EHT A;  4IKF A;  4CBW A;  2HBL A;  1ZBL A;  4JN4 A;  3T69 A;  1DT9 A;  5HP1 A;  1HUX A;  3D2E B;  5BR8 K;  2RN2 A;  4YOW A;  1WBB A;  1JCG A;  3JYT A;  4EP5 A;  4QS8 A;  3KKS A;  4IBN A;  2ZWH A;  3ZCM A;  2NRW A;  3L6Q A;  3KWI A;  4CZJ A;  2I7N A;  3KZB A;  4BWJ A;  2KW4 A;  1JLB A;  2Y1I A;  3IDH A;  2G8I A;  3S41 A;  2YHW A;  3THW B;  2FLO A;  5HRS A;  5JVH L;  4FWM A;  3B6P A;  3HT3 A;  3KLH A;  5FRN A;  2NRV A;  3ZX2 A;  3TAN A;  1H1V A;  4CJ7 A;  3H1V X;  4FLZ A;  3J7Y P;  4ELU A;  4DTN A;  3VQE A;  3J7Z O;  1N5Y A;  3V9X A;  3C6U A;  1ASW A;  2HF4 A;  2Z1G A;  3O4N A;  1IO2 A;  3RRH A;  4ELV A;  4Z4C A;  2OA8 A;  3BEX A;  5M1O A;  1RBV A;  3QIC A;  2P51 A;  2OTL N;  1ZBH A;  3HTV A;  1YTA A;  1RBU A;  4FOE A;  1MA9 B;  3NAE A;  1LW0 A;  5AQG A;  4QS9 A;  4GW6 A;  4DV4 K;  5AZJ A;  3A5O C;  3H6E A;  4PY5 A;  1BIZ A;  2Z1I A;  1ZC6 A;  4M3X A;  2ZGY A;  1NKE A;  2W6K A;  1IJJ A;  4WQ4 C;  4PKG A;  4CJ5 A;  4DFM A;  1QQC A;  3IKM A;  1BUP A;  4OX9 K;  2BTF A;  3CQX A;  4TSX A;  4B8C A;  2OPS A;  1KVC A;  3M3Z A;  1NK8 A;  1KVA A;  2P9K A;  5JS1 A;  3QBX A;  4BR5 A;  3PLA A;  5FRM A;  1S9E A;  3MN5 A;  3FGU A;  2OAN A;  4I7F A;  4FWQ A;  1HNX K;  4DTU A;  3H45 C;  1FKP A;  4H0O A;  4YOU A;  1N6Q A;  1HQU A;  3OTO K;  3ZSV A;  4LF5 K;  4E0D A;  2E6M A;  4JV5 K;  1SL1 A;  4JRP A;  4CEB A;  4FK2 A;  4FWP A;  2HNY A;  1IKY A;  1S1X A;  3SYZ A;  3DAW A;  4M3Z A;  2E20 A;  2QWN A;  3OYB A;  3CJ1 A;  4B3T K;  4UY8 O;  1BCM A;  3WQT A;  2Q0R A;  3K9J A;  2WON A;  2V52 B;  3SMS A;  2I7P A;  5GAH P;  1GLE G;  1HMV A;  1WAF A;  2V7Y A;  4E7I A;  3VTI A;  4DV2 K;  4JNE A;  4A2A A;  2VGN A;  2FXU A;  2IGI A;  3WXK A;  3AO3 A;  4LC9 B;  1YT3 A;  1FK9 A;  3SBT A;  3JXU A;  1Q8I A;  2CGK A;  4H0Y B;  4RCH A;  4LH5 A;  4ID1 A;  4FJL A;  5B8H A;  4B1X B;  4AHT A;  2VWK A;  3TAM A;  2HHQ A;  3OVN A;  4C23 A;  4YY3 K;  1MDU B;  4E7K A;  4CHQ A;  4C8M A;  3ZEU B;  3CFP A;  4ILH A;  4FK0 A;  3P83 D;  1LV5 A;  3VQ7 A;  4AHC A;  3ENB A;  2XY7 A;  4DTX A;  3ZSX A;  1VQK N;  4DFP A;  3HBT A;  4FLX A;  4EP4 A;  2E2Q A;  2JWK A;  3EKU A;  3T1H K;  3LDO A;  4O8K A;  3E9P A;  1C1C A;  2QA4 N;  4H5T A;  3LPT A;  1HJR A;  2QWM A;  1BG3 A;  2NZT A;  2PFU A;  3CXC M;  1BA1 A;  3H3N O;  5FPE A;  4CEZ A;  4KO0 A;  3WXM B;  3VF6 A;  3VQ9 A;  4BR4 A;  1K9M O;  3ZET A;  4UQG A;  2GEM A;  3OYL A;  4I6M B;  4CZE A;  4O0J A;  1W0H A;  4NLC A;  4B9M A;  4JKD A;  5AQO A;  4HUG A;  1UOC A;  4KHU A;  4HTU A;  1HX1 A;  2HBJ A;  3HP9 A;  3ZSQ A;  1XC3 A;  3NGY A;  1JL2 A;  4OKE A;  1NNE A;  1NGD A;  4DSE A;  3DLL L;  4RW8 A;  4IFE A;  5LL6 Z;  1SKW A;  4JI3 K;  1RT7 A;  2WTU A;  1BOT O;  1EET A;  3MCP A;  1E3M A;  4CGJ A;  3VQ6 A;  1SUQ A;  1VHX A;  4OKK A;  3KWG A;  2YKM A;  4DF8 A;  3AVI A;  2E2O A;  3F5T A;  2KZM A;  1XMQ K;  4L3Q A;  3OYE A;  3VA0 A;  5LJV A;  4E1J A;  2F96 A;  3V6D A;  1EQY A;  1I3A A;  3KK2 A;  2AP1 A;  1KTQ A;  1Q81 O;  1WSI A;  4FZY A;  5GIN A;  1ASU A;  3OJS A;  1K73 O;  2GUI A;  4DSF A;  1XHZ A;  4BQL A;  2UXD K;  3NGI A;  1RDB A;  2A6A A;  3CER A;  3VQ5 A;  5JMV A;  4CEE A;  4EFH A;  3O1B A;  4JD2 A;  1TUU A;  2ASP A;  5J2M A;  2ZGZ A;  4LY7 A;  2OZS A;  1HYZ A;  3JS6 A;  3LP0 A;  4BWM A;  3SJJ A;  5AQZ A;  1NK5 A;  1OVQ A;  3ZSR A;  3CCR N;  3CCJ N;  3QET A;  4JLH A;  3BGR A;  4WF9 L;  1WAJ A;  3LP3 A;  4CEC A;  4EAH D;  4HUE A;  3TAE A;  4H4M A;  4BC2 A;  5AZJ B;  5AQW A;  1B9D A;  2QEX N;  3THV A;  3R6M A;  3PIP L;  4AM6 A;  4JKC A;  3CCL N;  2WUS A;  4DQI A;  1B9F A;  1MWK A;  2ITG A;  2P9U A;  5J2N A;  1Y97 A;  3ZSO A;  4B3M K;  1M1K O;  1IBK K;  4NXM K;  4BQZ A;  3A5N C;  1L3T A;  1NLV A;  2HOE A;  4JKA A;  2P9K B;  4WQ4 A;  3SZ2 A;  3KVG A;  4DHY A;  1WSG A;  3KJV A;  2O8F B;  2FSK A;  3EL2 A;  1NGF A;  3NF8 A;  2OPQ A;  2P9N A;  1QQM A;  2HMI A;  3FFI A;  1NBW A;  2WBN A;  3AAP A;  4BR0 A;  1VQN N;  1NGA A;  4E1M A;  3AVJ A;  1TV6 A;  3CF5 L;  3NH2 A;  2ZD1 A;  1NGC A;  3MAQ A;  1U4B A;  1S3X A;  3DLE A;  3O9Q A;  2Q36 A;  2P9L B;  2J4R A;  1NMD A;  4DU4 A;  4M42 A;  2O8B A;  3AA2 A;  3AVH A;  5BN8 A;  3AVL A;  4KTQ A;  4JKB A;  3OYA A;  1G15 A;  5HBM A;  1KVB A;  4K0K K;  3ZYY X;  1CXU A;  3KD5 E;  5ELZ A;  3CJ7 A;  3AO1 A;  4DF4 A;  1TKT A;  3ZT0 A;  3P1G A;  3TAR A;  1YJN N;  4JI2 K;  1I94 K;  4CI6 A;  4B9T A;  3HP6 A;  2DY4 A;  1LWE A;  1BHL A;  1FKO A;  2UUC K;  4FJI A;  2BE2 A;  3HPH A;  2FBY A;  2A5X A;  1NK6 A;  3LAN A;  3UB5 A;  1X9S A;  1TK8 A;  3P31 A;  4M3W A;  4KH4 A;  3W3D A;  3S3M A;  3IAY A;  1KFD A;  3I0S A;  3HPO A;  5F0X A;  4R5P A;  2QKK A;  4CF0 A;  1LAV A;  4IWV A;  4FW1 A;  3SQ1 A;  1D9D A;  4LD0 A;  3V1Q A;  3MEC A;  3IUC A;  1TK0 A;  4M3R A;  2KFZ A;  1Q7Y O;  1U47 A;  2OPP A;  3RRG A;  4DTP A;  4DR6 K;  2FF3 B;  2NUB A;  2HW3 A;  1CLQ A;  1D8Y A;  4NYF A;  1ZYQ A;  3B8A X;  1S22 A;  5JIC A;  3U4L A;  1Q9Y A;  3TTC A;  4A61 A;  3KLF A;  1OH7 A;  3ZET B;  3VOV A;  3HPG A;  2B6A A;  4Y1C A;  3DLK A;  4B3O A;  4PKI A;  4YOT A;  3GBT A;  1RTD A;  4KRF A;  3PY8 A;  2E4L A;  3ZSZ A;  3SLC A;  1GLD G;  3KTQ A;  1RBT A;  4DSI A;  5BPL A;  2PYL A;  1IKX A;  4LH4 A;  4FJ8 A;  4H5W A;  4CHO A;  4CEO A;  1U49 A;  3WQU A;  2ZF5 O;  3TSP A;  1QSY A;  4DMN A;  4JK9 A;  4DFJ A;  4CBU A;  3EE8 A;  1TK5 A;  4KHN A;  1YI2 N;  1HNW K;  1HNZ K;  4HTL A;  1ILY A;  5CYM A;  1VQ9 N;  1Q9X A;  4FOI A;  4BRO A;  5AQF A;  4NCA A;  1K8K A;  3Q7B A;  4GNI A;  4LF4 K;  1BO5 O;  3V4I A;  1RTH A;  3HO1 A;  1X1P A;  5AQL A;  1FW6 A;  2X6N A;  3MEG A;  4DFK A;  3K5N A;  4B1Y B;  3CCS N;  3THX A;  2HHU A;  1VSM A;  1XMO K;  4BRH A;  1I39 A;  3NH0 A;  3ZT2 A;  4DR2 K;  3CQ8 A;  3L0Q A;  4YOX A;  1MWM A;  1L3U A;  3C0B A;  3LDN A;  4JD2 B;  3HM9 A;  3M8Q A;  3V9S A;  4CER A;  4CFA A;  3SNN A;  3CJC A;  2KLA A;  2G8W A;  4YFU A;  2PY5 A;  5IT9 O;  3SV4 A;  5EX5 A;  4CZI A;  3EO3 A;  5HRR A;  1J6Z A;  4FJG A;  3L2V A;  4BG8 A;  3HK2 A;  5C0Y A;  5BRF A;  3MWT A;  1X3N A;  4F9O A;  3AAQ A;  3AVG A;  4A2B A;  5AZI A;  4CIG A;  4DQ8 A;  3LP2 A;  4FL9 A;  1VSH A;  3VQB A;  4DV6 K;  2W6L A;  4IFV A;  4A5B A;  2KHO A;  2FC0 A;  5EXW A;  2HVH A;  2ASM A;  2YX6 A;  5JLF A;  2P9U B;  4V19 S;  4C8N A;  5ADX H;  1LOT B;  1TKX A;  3CCE N;  3VN5 A;  3VGL A;  4ELT A;  3E9L A;  3O1W A;  1OH5 A;  4EZ6 A;  4OVL A;  1NK9 A;  4M63 C;  1NGH A;  1SQK A;  4FO0 A;  3SI6 A;  2LSN A;  2P9N B;  3THY A;  1WLJ A;  4LFA K;  1L5U A;  5GAG P;  1X9W A;  4IXC A;  3AGK A;  2GWK A;  3MXJ A;  4B3R K;  2OZM A;  1DTT A;  3VEN A;  3I8B A;  3C95 A;  3NMU A;  3QFP A;  2QW9 A;  2NNW A;  2QM1 A;  1BGX T;  4DQP A;  3H1Q A;  3D45 A;  2O8B B;  1QHA A;  1RBR A;  2PZS A;  1YVU A;  2VG5 A;  3SUO A;  4LF9 K;  4CJF A;  4JS5 A;  4FZZ A;  2XY8 A;  4BRD A;  3CET A;  4W5T A;  4X64 K;  3RSE A;  4J2B A;  4F2S A;  3BDP A;  2DFE A;  4BDP A;  1YIJ N;  5JVG L;  3AY9 A;  4PL8 A;  1S5J A;  3CI5 A;  1EP4 A;  1Z05 A;  2P1J A;  1VQ7 N;  3C6H A;  4OPA A;  3I56 N;  3L2R A;  3MWP A;  1VAZ A;  3WNH A;  4KHS A;  4HCB A;  3LAM A;  4AHU A;  3LAL A;  4DTS A;  4FWN A;  4DV7 K;  1S6Q A;  5IWA K;  3G6E N;  1JLC A;  2NRR A;  3VQP A;  4BRC A;  4PL7 A;  1OH8 A;  2IS3 A;  3N4Q A;  4ISE A;  1GLF O;  3CG7 A;  3TPQ A;  2V51 B;  1VSI A;  4JRQ A;  3CFR A;  3KIO A;  1IG9 A;  2F4V K;  4J2D A;  4XIU A;  4OLA A;  3C65 A;  4CD3 A;  4QS7 A;  4FPB A;  1NJW A;  2IDO A;  5DM6 L;  1GLL O;  1NGJ A;  2YI1 A;  4RWT A;  4H0V B;  1NKC A;  1D9F A;  5LMU K;  2F8S A;  4JHD B;  1RIL A;  3PX6 A;  4B9V A;  1NGG A;  3M5R A;  3L8B A;  2NRZ A;  1RDW X;  4NB4 A;  1IV0 A;  4I2Q A;  2ZM6 K;  2KKZ A;  3A8Y A;  3OA9 A;  4IFY A;  1T05 A;  3QIO A;  4LF7 K;  4CGH A;  4AHR A;  3H46 O;  3G0Z A;  2Y1J A;  3ZT1 A;  1HYS A;  2Q31 A;  4CK3 A;  2R7Y A;  4IG0 A;  3L3U A;  2VCP A;  4HHT A;  1TAQ A;  4EIA A;  3CCV N;  3VQ8 A;  4FJ7 A;  3AVM A;  3PV8 A;  2E2P A;  1N8R O;  2QI2 A;  1KQS M;  1E4F T;  3QNN A;  4X65 K;  1HLU A;  1WSH A;  2VGM A;  3OYF A;  2QWL A;  2ATQ A;  4JI8 K;  4AF1 A;  4FVU A;  4JI5 K;  1K8K B;  4O44 A;  1JLG A;  2A42 A;  1LCU A;  3EY1 A;  3M1F A;  1T44 A;  3NHG A;  3WXJ A;  4O8U A;  3GE1 A;  3THX B;  5CZ1 A;  1XWL A;  2QWR A;  4CJP A;  4U67 L;  4AQY K;  2H3G X;  2AA4 A;  3WNF A;  4E1N A;  5FPN A;  5D3G A;  1C0G A;  3OYN A;  2YHY A;  1HNV A;  4FJX A;  2HHW A;  4FW2 A;  1VSF A;  4CJS A;  3OW2 M;  1UWB A;  2VQF K;  3LP1 A;  1HRH A;  4O5F A;  3O3F A;  1GLC G;  4FJN A;  2AJQ A;  2YJF A;  3MEE A;  2IOC A;  3BP8 A;  4I9L A;  4C8K A;  4IEE A;  3AVC A;  4BAC A;  1OVY A;  2D4W A;  3BZK A;  4FK4 A;  1ZBI A;  4RW9 A;  4B8A B;  1XHX A;  5AZI B;  3FZF A;  5M1Q A;  4CEF A;  5H1S Q;  1SV5 A;  1T7P A;  4PKH A;  3AO5 A;  3VEV A;  1VSJ A;  4WFA L;  4Y1D A;  3SQ4 A;  1A5X A;  5AQS A;  2P9S A;  4DR5 K;  1NGE A;  1ZBF A;  4HVJ A;  2Q3S A;  3ZSY A;  5M1P A;  1NGI A;  1RDC A;  4CGG A;  4F3O A;  4IJN A;  3DRS A;  2IVN A;  4ISF A;  4KI4 A;  2Z1H A;  4CVN E;  2F8T A;  4X62 K;  1TAU A;  2W41 A;  2CGJ A;  2P9P A;  3QB0 A;  3TAP A;  4GV3 A;  2D0P A;  1A5W A;  1R0A A;  5KQ8 A;  3IS9 A;  3THY B;  4CEQ A;  3VQ4 A;  4AHS A;  1A5V A;  2HHH K;  3U3G A;  4W5R A;  3R9P A;  3RWU A;  5HLF A;  3ZLJ A;  1DTQ A;  1VQO N;  3I55 N;  1WBD A;  3VQA A;  1XI1 A;  5EVZ A;  2CH6 A;  5HRP A;  1RT2 A;  1T3V A;  2FBT A;  1W7A A;  2RHK A;  3V1R A;  5TKW A;  4YDU C;  2OTJ N;  4JI6 K;  3RMA A;  4PHT X;  4FM0 A;  3MK6 A;  3P39 A;  3DLG A;  1W9H A;  2VG7 A;  3RSE B;  5KI6 A;  4CZG A;  3K2P A;  5BRH A;  4K43 A;  3VEO A;  4L8R B;  4CJL A;  3DMJ A;  2E6L A;  4M7Y A;  2VWJ A;  2EX3 A;  3S3O A;  5F1X A;  4FXD A;  1G99 A;  3L4I A;  1XQS C;  5T7B A;  2FSN A;  2DTU A;  1U48 A;  4DLG A;  3HOT A;  3WXL A;  5C2D A;  4CHZ A;  2WOM A;  4FLT A;  1EWR A;  4OKJ A;  5K14 A;  1BU6 O;  4Q0B A;  3C6T A;  3HYF A;  2O8D A;  3F2K A;  2D0O A;  5FRO A;  4DWI A;  3SBG A;  3TSU A;  4FLW A;  3K59 A;  1QHT A;  4KB1 A;  4Z94 A;  3ZT3 A;  4EHU A;  2G8U A;  3CC7 N;  3I33 A;  2OYQ A;  3OY9 A;  3H08 A;  2OPR A;  1RFQ A;  3ZT4 A;  1HJO A;  1O1W A;  5AFU H;  3VQQ A;  4KRE A;  4DUZ K;  2BH1 A;  1D5A A;  1U45 A;  3O4Q A;  5ADX A;  3AVB A;  3O9S A;  3E01 A;  1VQ4 N;  1JXB A;  4BR9 A;  3EE9 A;  4KH6 A;  2FBX A;  4HCC A;  3S9H A;  1VSD A;  3DXM A;  5BRE A;  3MED A;  1C0U A;  4N56 A;  3ULE A;  3DLB A;  4N41 A;  4JKE A;  3OYM A;  3ID8 A;  4GV6 A;  1GOC A;  1XC9 A;  1YJ9 N;  3CJA A;  4RW4 A;  4G1Q A;  3M8R A;  3DJC A;  4CIE A;  3WEE A;  3NGZ A;  2ZE2 A;  4Z4I A;  3QES A;  2UXB K;  3HJF A;  3LPU A;  4CEA A;  1U6Z A;  3ID6 A;  2KZZ A;  4BE0 A;  4DS4 A;  4B08 A;  4PUO A;  4OO1 J;  2YJE A;  2NRX A;  2HHX A;  2UU9 K;  4QCL A;  3QNO A;  2BGG A;  4N76 A;  4DV5 K;  3DXK A;  3GOI A;  3J8A A;  5J2Q A;  3O9U A;  3VPZ A;  3V9U A;  4C8L A;  4KAZ A;  3DOK A;  1K6Y A;  3HOS A;  4CHP A;  1ATR A;  3VES A;  3CJB A;  1DLO A;  4CZL A;  4O55 A;  3SUP A;  4JI1 K;  1N34 K;  3OS1 A;  4YOY A;  5KQD A;  3CME N;  2IIR A;  3SV3 A;  2W40 A;  2E8A A;  3J81 O;  3R8E A;  1QS4 A;  1KRP A;  3L3V A;  2P9S B;  2X78 A;  2HHS A;  3SMP A;  5E84 A;  3L4Q A;  3K5O A;  2KQ2 A;  1YJW N;  3OYD A;  3HM8 A;  4YOR A;  2E5L K;  2VQE K;  4IG3 A;  4RW6 A;  5GAE P;  3DI6 A;  5SWM A;  1KXP A;  3C6A A;  3L2U A;  2QXF A;  3LZJ A;  4F4K A;  2YHX A;  3ITH A;  3TAF A;  3LM9 A;  5AQJ A;  4BRE A;  5C15 A;  1B92 A;  4WQ5 C;  3ZSW A;  3PO4 A;  4Z4G A;  5AQK A;  4CGF A;  3SQ2 A;  4I9Q A;  4LF6 K;  5AJ3 K;  1BIU A;  4Z4F A;  4LFC K;  2Z1J A;  3AVN A;  2HNZ A;  3QER A;  4CK2 A;  1J5E K;  2GWJ A;  3QIN A;  4ZHR A;  5SZT A;  4CF9 A;  4N5S A;  1C6V A;  4BRA A;  5AQN A;  2XRI A;  4DQQ A;  3M8P A;  2XY5 A;  4FSV A;  2D0B A;  1RDD A;  1NWK A;  4IJA A;  1CZ9 A;  1S72 N;  3O5B A;  1M90 O;  1FJG K;  4DG1 A;  3MCA B;  1CXQ A;  4FWO A;  5AQP A;  1UAX A;  2HST A;  1QE1 A;  4E7L A;  3I8D A;  2UUB K;  4KTW A;  4N47 A;  5GIO A;  1Z6R A;  2G8F A;  4DV1 K;  3ATV A;  1YVN A;  4I2P A;  4YDU A;  4BRQ A;  5AQH A;  4AH9 A;  4ZTF A;  3VGM A;  3NH1 A;  3IFR A;  1EO1 A;  4WCE L;  3FZH A;  4B9Q A;  3OBW A;  3G71 N;  1KLM A;  4BRI A;  1VQP N;  4CF2 A;  2FSJ A;  4B1V A;  4CJ3 A;  3C7N A;  4FLY A;  4BY9 C;  4IOC L;  4GVE A;  4LFB K;  1LW2 A;  3PX4 A;  4BE2 A;  2YHA A;  2ETJ A;  1FXX A;  4KI6 A;  5KGX A;  4DR4 K;  1KD1 O;  4GVM A;  3E9O A;  4LF8 K;  3R3L A;  1QSS A;  1QQO A;  4FWL A;  2O8D B;  3O8M A;  1BQN A;  1HKC A;  4NYN A;  4CFD A;  3KK1 A;  5AQR A;  3CCM N;  3AV9 A;  2HB5 A;  3VA3 A;  3RMB A;  3CFO A;  2FBV A;  3VMF B;  1ATS A;  4FJ9 A;  5CHI A;  3SAF A;  1Z25 A;  3VEX A;  4CHN A;  5FLX O;  3NE6 A;  2D1K A;  3MMV A;  4DV3 K;  1GLB G;  2DPN A;  3MXM A;  4DU1 A;  1SL0 A;  3T19 A;  1WB9 A;  4DS5 A;  3J7A P;  2ZQB A;  4WYB A;  4QOZ B;  3OYC A;  1JL1 A;  2O4G A;  2YNF A;  4FWR A;  2JLE A;  2O4I A;  4NLB A;  1OKJ A;  2E2N A;  4H0P A;  4DSJ A;  3CPW M;  4NCB A;  4JKG A;  4MO5 A;  4PA1 A;  1TKZ A;  5AQI A;  4YOV A;  2YCH A;  1HKG A;  3DXM B;  3H3O B;  5GIP A;  3S3N A;  2QWQ A;  4BC5 A;  1TUY A;  3ULE B;  4DQR A;  4M41 A;  5KGW A;  2G8H A;  1Q86 O;  5C10 A;  4DR1 K;  1ASV A;  3QLH A;  1W97 L;  3OHR A;  4KFB A;  4M7X A;  3JSM A;  3KD1 E;  4CJQ A;  3OYI A;  4C8O A;  1WUA A;  3P5J A;  3U3Y A;  3WEE B;  3LL3 A;  3TWH A;  3MX5 A;  5BPM A;  4XEI A;  1BDG A;  4BR2 A;  3QEW A;  1JLE A;  1JCF A;  3ZEU A;  3LWL A;  3M6G A;  1CZA N;  4CGD A;  3D6R A;  4CJE A;  3EN9 A;  3WNG A;  2GBZ A;  1C1A A;  4IOX A;  2B4J A;  4WFN L;  4AIL C;  3CD6 N;  3KKR A;  3FFK B;  1QVF M;  1TL1 A;  3DXK B;  4NO7 A;  4C1N I;  4KHQ A;  4W5O A;  1XNQ K;  3V81 A;  1YHQ N;  4FWK A;  4J8F A;  3KHY A;  3AO2 A;  4XH4 A;  3ENO A;  4CIF A;  3PO5 A;  1RDA A;  2ASO A;  3W0L A;  2IC3 A;  2E1Z A;  3K0S A;  1ESV A;  3CCQ N;  3VET A;  1V4S A;  1J9A A;  1ZBU A;  4BRL A;  2A3Z A;  3O3G A;  5HRN A;  2G8V A;  1VQ6 N;  1RT5 A;  2OCE A;  5BPN A;  5JLH A;  2P5G A;  4PQU A;  1U2V A;  5DK5 A;  4GV9 A;  1HYV A;  1YIT N;  1REV A;  1UA0 A;  1BI4 A;  3J80 O;  1IH7 A;  3U6F A;  4AHV A;  3TTD A;  4Z4H A;  2YV0 X;  1QTM A;  4H5N A;  4BVO A;  5AFU A;  3K9K A;  5FPM A;  1CZB A;  1O13 A;  3DOL A;  2D5R A;  1RDU A;  4DQS A;  1NG9 A;  3DRP A;  1NM1 A;  1KAZ A;  3MN7 A;  3NCI A;  3ZX3 A;  4CHY A;  2BDP A;  4K42 A;  4CW7 B;  1HPM A;  3CQY A;  4CCH A;  1XNR K;  2G8K A;  1VRU A;  4DSK A;  1SKR A;  3UKR A;  4IO9 L;  5GAD P;  4BC4 A;  4WQ5 A;  3VQC A;  3ISN C;  2QKB A;  3CPE A;  4A59 A;  3MN6 A;  1S9G A;  5KTQ A;  3T3F A;  2YNH A;  1NKB A;  4CFB A;  1R59 O;  1X9M A;  1TKD A;  5HOO A;  3TAQ A;  1P90 A;  4CJV A;  3PSI A;  3ASM A;  4JK7 A;  1LWF A;  4KB0 A;  2GTD A;  2YHB A;  5I9E B;  5E41 A;  2A1S A;  3SK3 A;  3M8S A;  3SAG A;  3OYH A;  3O4W A;  1E4G T;  2CGL A;  3WNE A;  3DYA A;  5HL7 L;  4ICL A;  4O0I A;  3I0R A;  4JKH A;  4DU3 A;  2QTD A;  1WNS A;  5C24 A;  3C7N B;  2D0A A;  3BZC A;  4YNQ A;  4K25 A;  1RT4 A;  1S1T A;  4FJH A;  4W5Q A;  4JKF A;  3ALY A;  3KLE A;  5C25 A;  2O8C A;  2GUP A;  3VEY A;  2Q97 A;  3CC2 N;  4FWS A;  3HXM A;  2XO7 A;  3LDQ A;  5CY4 A;  1BA0 A;  3RR7 A;  2YNG A;  4FYD A;  2VYP A;  4M3U A;  3RMD A;  1JLA A;  4JAX A;  4BRP A;  5LY3 A;  1J54 A;  3CMA N;  1NK0 A;  2PBD A;  4IDH A; 
#chains in the Genus database with same CATH homology
 4FLW A;  4H4O A;  3K59 A;  1VK0 A;  3SQ1 A;  3LZI A;  1RT6 A;  1QHT A;  4O5B A;  3L2W A;  1D9D A;  4LD0 A;  3V1Q A;  3MEC A;  4KB1 A;  3SCX A;  1EXQ A;  3B6O A;  3DLH A;  3ZT3 A;  1TK0 A;  4M3R A;  4BE1 A;  2G8U A;  1VSL A;  4FZX C;  2KFZ A;  1TL3 A;  3RR8 A;  1U47 A;  4B9S A;  2OPP A;  3K5M A;  3RRG A;  3KK3 A;  4DTP A;  2OYQ A;  4MFB A;  3OY9 A;  3H08 A;  2NUB A;  4FLU A;  2HW3 A;  1CLQ A;  3IG1 A;  1D8Y A;  2RF2 A;  4NYF A;  2OPR A;  5C42 A;  4FM2 A;  1ZYQ A;  3ZT4 A;  4KKO A;  1O1W A;  4E7H A;  1Q9Y A;  5I3U A;  3KLF A;  3VQQ A;  4KRE A;  3TAB A;  1T8E A;  3MXI A;  3D0P A;  1D5A A;  3NF9 A;  1U45 A;  1NOY A;  1KFS A;  3HPG A;  2B6A A;  3O4Q A;  3AVB A;  2X6S A;  3E01 A;  3SUN A;  4Y1C A;  4HUF A;  3DLK A;  4B3O A;  1JXB A;  3DM2 A;  1RTD A;  3O3H A;  4KRF A;  3QEX A;  5JS2 A;  2E4L A;  3ZSZ A;  4CED A;  4CF8 A;  1SKS A;  3PX0 A;  1C0T A;  3PY8 A;  3KTQ A;  2FBX A;  1NOZ A;  4HCC A;  1RBT A;  4DSI A;  3S9H A;  1VSD A;  2PYL A;  4CFC A;  4DTM A;  1IKX A;  1C1B A;  3MED A;  4LH4 A;  4IKF A;  1C0U A;  1ZBL A;  4B9N A;  4FJ8 A;  4N56 A;  2KFN A;  3DLB A;  4N41 A;  1J5O A;  4CHO A;  4CEO A;  5HP1 A;  1U49 A;  3OYM A;  1GOC A;  1QSY A;  4PWD A;  4DMN A;  4E7J A;  1XC9 A;  4DFJ A;  2RN2 A;  1TK5 A;  4KHN A;  3JYT A;  4RW4 A;  4EP5 A;  4G1Q A;  3HST B;  3M8R A;  4CIE A;  5CYM A;  3KKS A;  3NGZ A;  1Q9X A;  2ZE2 A;  4IBN A;  4Z4I A;  1QSL A;  1LAW A;  3DLR A;  4NCA A;  3QES A;  3ZCM A;  3HJF A;  3LPU A;  3V4I A;  4CEA A;  1RTH A;  2KZZ A;  4BE0 A;  4DS4 A;  4B08 A;  4PUO A;  1BL3 A;  3HO1 A;  1WSF A;  4BWJ A;  1X1P A;  3LDS A;  2KW4 A;  2X6N A;  2HND A;  1JLB A;  3MEG A;  3K5N A;  1JLF A;  4DFK A;  2Y1I A;  4ID5 A;  3SUQ A;  1VSM A;  2G8I A;  2HHU A;  2HHX A;  3AVF A;  4QCL A;  3QNO A;  2BGG A;  5HRS A;  4N76 A;  1I39 A;  3DRR A;  3NH0 A;  3QEV A;  3B6P A;  3ZT2 A;  3CQ8 A;  3AVK A;  2X74 A;  3HT3 A;  5J2Q A;  3KLH A;  1KSP A;  3A2F A;  5FRN A;  1L3U A;  3V9U A;  5DMR A;  4C8L A;  4KAZ A;  3TAN A;  3DOK A;  4B9L A;  1T03 A;  1K6Y A;  4FLZ A;  4CHP A;  3HM9 A;  3M8Q A;  3NDK A;  1DLO A;  3V9S A;  4CER A;  4O55 A;  4CFA A;  3SUP A;  3SNN A;  4ELU A;  4DTN A;  3VQE A;  1N5Y A;  3OS1 A;  3V9X A;  3C6U A;  1ASW A;  2G8W A;  4YFU A;  2PY5 A;  3SV4 A;  4BDZ A;  3SV3 A;  2Z1G A;  3O4N A;  1KLN A;  5HRR A;  1IO2 A;  3RRH A;  4FJG A;  3L2V A;  4ELV A;  4Z4C A;  2OA8 A;  3HK2 A;  1JXE A;  1RBV A;  2P51 A;  4B9U A;  4EZ9 A;  1ZBH A;  1GOB A;  1QS4 A;  3UIQ A;  3AVG A;  4Z0U A;  1YTA A;  1RBU A;  1KRP A;  1IKV A;  3NAE A;  1LW0 A;  4CE9 A;  4CIG A;  1KCF A;  3L3V A;  1BI4 B;  3G10 A;  1WN7 A;  3LP2 A;  1VSH A;  2X78 A;  2IAJ A;  3KLI A;  3VQB A;  4IFV A;  1NJY A;  2HHS A;  4GW6 A;  3HVT A;  4PY5 A;  2FC0 A;  3K5O A;  2KQ2 A;  1BIZ A;  2Z1I A;  3OYD A;  2HVH A;  4M3X A;  1NKE A;  1VSK A;  4C8N A;  2KTQ A;  3OJU A;  4IG3 A;  3TR8 A;  1L3V A;  1TKX A;  4RW6 A;  3DI6 A;  4CJ5 A;  5SWM A;  3L2U A;  2QXF A;  3LZJ A;  1QQC A;  2RPI A;  4DFM A;  4F4K A;  3VN5 A;  4ELT A;  4TSX A;  2JGU A;  3ITH A;  4CF1 A;  3TAF A;  4B8C A;  1B92 A;  4OJR A;  4K8Z A;  3ZSW A;  2OPS A;  3PO4 A;  4EZ6 A;  4Z4G A;  1KVC A;  4OVL A;  1LWC A;  4CGF A;  3SQ2 A;  1NK8 A;  1KVA A;  1NK9 A;  1WSJ A;  4I9Q A;  5JS1 A;  1BIS A;  2GV9 A;  3SI6 A;  2LSN A;  1BIU A;  5FRM A;  1WSE A;  1S9E A;  4Z4F A;  2Z1J A;  3AVN A;  2HNZ A;  4I7F A;  5CYQ A;  1HPZ A;  1WLJ A;  4CK2 A;  1RCH A;  4DTU A;  3QER A;  3QIN A;  4ZHR A;  1FKP A;  1L5U A;  2QK9 A;  1N6Q A;  1HQU A;  5SZT A;  1X9W A;  4CF9 A;  3ZSV A;  1U04 A;  1C6V A;  4N5S A;  3MXJ A;  2XRI A;  4Q5V A;  2OZM A;  3OYK A;  4E0D A;  1DTT A;  2E6M A;  4DQQ A;  2I5J A;  4JRP A;  4FVM A;  3M8P A;  4CEB A;  3C95 A;  1SL1 A;  4L8R B;  2HNY A;  2XY5 A;  4FK2 A;  1RT1 A;  2D0B A;  1RDD A;  1IKY A;  1S1X A;  3SYZ A;  1HQE A;  4M3Z A;  1BGX T;  4DQP A;  3OYB A;  1CZ9 A;  4KV8 A;  1BCM A;  3D45 A;  4DG1 A;  3IRX A;  2WON A;  1RBR A;  2PZS A;  1CXQ A;  1UAX A;  1HMV A;  1YVU A;  4CGI A;  1QE1 A;  4E7L A;  4OGC A;  3I8D A;  4KTW A;  4N47 A;  1WAF A;  2VG5 A;  3SUO A;  2G8F A;  4CJF A;  1Z26 A;  4FJK A;  4JS5 A;  4F2R A;  4E7I A;  4I2P A;  4E3S A;  4FZZ A;  2XY8 A;  2DFH A;  3TAG A;  3CM6 A;  2IGI A;  4AH9 A;  4W5T A;  3AO3 A;  4ZTF A;  4M3Y A;  4M3T A;  3NH1 A;  4J2B A;  4F2S A;  1IKW A;  1FK9 A;  1YT3 A;  2DFE A;  3BDP A;  1Q8I A;  3NBP A;  1KLM A;  4BDP A;  3AA5 X;  3QO9 A;  1S5J A;  4CF2 A;  4LH5 A;  1EP4 A;  3RMC A;  4ID1 A;  2P1J A;  4CJ3 A;  4FLY A;  2VG6 A;  4CJ4 A;  3AVA A;  4FJL A;  4AHT A;  2VWK A;  3TAM A;  2HHQ A;  3OVN A;  4E7K A;  4CHQ A;  3L2R A;  4C8M A;  3EZ5 A;  3CFP A;  4FK0 A;  4KHS A;  4KTZ A;  1LW2 A;  3WNH A;  3PX4 A;  4HCB A;  3LAM A;  1C0M A;  3HL8 A;  3LAL A;  4AHU A;  3P83 D;  4BE2 A;  4DTS A;  2YHA A;  2ETJ A;  1LV5 A;  1S6Q A;  3VQ7 A;  1FXX A;  1JLC A;  3VQP A;  4AHC A;  5KGX A;  2XY7 A;  4KI6 A;  4DTX A;  4GVM A;  3ZSX A;  2IS3 A;  3K5L A;  4KPY A;  4DFP A;  1QSS A;  1L3S A;  3CG7 A;  1VSI A;  4JRQ A;  1BQN A;  3CFR A;  4NYN A;  4CFD A;  4FLX A;  3KK1 A;  4FLV A;  3KIO A;  1IG9 A;  4EP4 A;  3AV9 A;  4J2D A;  4XIU A;  2HB5 A;  3VA3 A;  4OLA A;  3RMB A;  3CFO A;  5I42 A;  1RT3 A;  2FBV A;  1NJW A;  2IDO A;  4FJ9 A;  3K58 A;  3NF7 A;  1C1C A;  3SPY A;  1Z25 A;  4CHN A;  3K57 A;  1NKC A;  1D9F A;  4E89 A;  3LPT A;  1HJR A;  3NE6 A;  1SL2 A;  1RNH A;  2F8S A;  1RIL A;  4ZTJ A;  3PX6 A;  3MXM A;  4OPK A;  4B9V A;  2HHV A;  4DU1 A;  2YNI A;  1SL0 A;  3T19 A;  4CEZ A;  4DS5 A;  3L8B A;  4KO0 A;  1S1W A;  2ZQB A;  4I2Q A;  4IFY A;  4QOZ B;  3OYC A;  1JL1 A;  1T05 A;  1F21 A;  2O4G A;  2YNF A;  3VQ9 A;  3QIO A;  4CGH A;  4AHR A;  4UQG A;  2JLE A;  3G0Z A;  2O4I A;  2Y1J A;  2EHG A;  2W42 A;  3ZT1 A;  1HYS A;  3OYL A;  3CYM A;  4CK3 A;  4O0J A;  5J1E A;  2R7Y A;  1W0H A;  4B9M A;  4DSJ A;  4K8X A;  4IG0 A;  4NCB A;  3L3U A;  4HUG A;  4PA1 A;  1TKZ A;  4CJU A;  3T1A A;  1UOC A;  3OS2 A;  4KHU A;  4HTU A;  4HHT A;  1TAQ A;  3S3N A;  4MQ3 A;  3HP9 A;  3ZSQ A;  3VQ8 A;  4DQR A;  3NGY A;  1JL2 A;  4OKE A;  4M41 A;  3V9Z A;  1NJX A;  4FJ7 A;  5KGW A;  3AVM A;  3PV8 A;  2G8H A;  4DSE A;  2YKN A;  4RW8 A;  4FM1 A;  1ASV A;  3QLH A;  4OGE A;  1SKW A;  3QNN A;  4KFB A;  1RT7 A;  3SPZ A;  4FJM A;  3JSM A;  2XY6 A;  1ZBI A;  1VRT A;  1WSH A;  3HVR A;  3KD1 E;  1EET A;  4CJQ A;  4QAG A;  4CGJ A;  3OYF A;  3OYI A;  3VQ6 A;  4C8O A;  4DSL A;  3NFA A;  3P5J A;  3U3Y A;  1SUQ A;  4OKK A;  4BDY A;  3TWH A;  2ATQ A;  1GOA A;  2YKM A;  4RW7 A;  4FJ5 A;  3QEW A;  1JLE A;  4O44 A;  3LWL A;  4DF8 A;  1JLG A;  3AVI A;  2DFF A;  4F8R A;  4KHW A;  4KHY A;  4CGD A;  1RTI A;  1RBS A;  3EY1 A;  4F3T A;  2KZM A;  4CJE A;  3WNG A;  3NHG A;  2GBZ A;  4CJT A;  1C1A A;  3OYE A;  3VA0 A;  4FJJ A;  3LAK A;  2B4J A;  2F96 A;  3V6D A;  4AIL C;  3KKR A;  5CZ1 A;  4CES A;  4Z4E A;  1XWL A;  3TI0 A;  1I3A A;  3QIP A;  3KK2 A;  1KTQ A;  1WSI A;  4CJP A;  1TL1 A;  4FZY A;  1ASU A;  3OYG A;  3OJS A;  4KHQ A;  4W5O A;  4E19 A;  3WNF A;  4E1N A;  3V81 A;  2GUI A;  4DSF A;  1XHZ A;  5D3G A;  3OS0 A;  3AO2 A;  3OYN A;  3NGI A;  1RDB A;  1HNV A;  4CIF A;  1VSE A;  3PO5 A;  3VQ5 A;  4FJX A;  3V9W A;  2HHW A;  4CEE A;  4FW2 A;  1VSF A;  4CJS A;  1RDA A;  1UWB A;  2RKI A;  2IC3 A;  5J2M A;  3LP1 A;  3LWM A;  3C94 A;  4LY7 A;  1HRH A;  3O3F A;  2OZS A;  1TVR A;  4FJN A;  1HYZ A;  2AJQ A;  3LP0 A;  4BWM A;  3SJJ A;  1TGO A;  3AO4 A;  3MEE A;  2IOC A;  1J9A A;  1S6P A;  3V1O A;  4I9L A;  4C8K A;  1S1U A;  1ZBU A;  3ULD A;  3AVC A;  4BAC A;  1NK5 A;  3ZSR A;  3O3G A;  4FK4 A;  3QET A;  4JLH A;  3BGR A;  1NK4 A;  1WAJ A;  3LP3 A;  4RW9 A;  4B8A B;  4CEC A;  5HRN A;  1XHX A;  5KRT A;  4HUE A;  3EYZ A;  3TAE A;  2G8V A;  1RT5 A;  4CEF A;  1SV5 A;  4H4M A;  2P5G A;  4PQU A;  1T7P A;  3AO5 A;  5DK5 A;  1VSJ A;  4LSL A;  1HYV A;  1REV A;  4Y1D A;  3SQ4 A;  1A5X A;  3F9K A;  1UA0 A;  1BI4 A;  1B9D A;  1IH7 A;  1ZBF A;  3THV A;  4HVJ A;  5J2P A;  2Q3S A;  3ZSY A;  3U6F A;  4F3O A;  1RDC A;  5FDL A;  4AHV A;  4CGG A;  4DQI A;  5CZ2 A;  4Z4H A;  1B9F A;  4W5N A;  2ITG A;  2YV0 X;  3DRS A;  1QTM A;  5J2N A;  3NF6 A;  3OYJ A;  1Y97 A;  3ZSO A;  4KI4 A;  2Z1H A;  1CZB A;  3CM5 A;  1L3T A;  4CJW A;  2F8T A;  3DOL A;  1TAU A;  2D5R A;  3TAP A;  1YTU A;  5HRO A;  4DQS A;  3DRP A;  1A5W A;  3SZ2 A;  1R0A A;  4CK1 A;  1WSG A;  3IS9 A;  3KJV A;  3NCI A;  2BAN A;  4CHY A;  2BDP A;  1JKH A;  1RTJ A;  3VQ4 A;  4CEQ A;  4CJK A;  4AHS A;  4CCH A;  2G8K A;  3NF8 A;  1A5V A;  1VRU A;  2OPQ A;  4DLE A;  1SKR A;  3U3G A;  4W5R A;  4DSK A;  3QEI A;  2HVI A;  2HHT A;  2HMI A;  3FFI A;  3RWU A;  3VQC A;  1J53 A;  3ISN C;  4LSN A;  5HLF A;  2QKB A;  1DTQ A;  4E1M A;  4OLB A;  3AVJ A;  3VQA A;  1S9G A;  5KTQ A;  3T3F A;  1TV6 A;  2YNH A;  1NKB A;  1XI1 A;  4CFB A;  1X9M A;  5HRP A;  3NH2 A;  2ZD1 A;  1TKD A;  1RT2 A;  2FBT A;  4J2A A;  3PUF A;  3MAQ A;  3TAQ A;  1U4B A;  3V1R A;  3DLE A;  2P5O A;  4CJV A;  4M45 A;  4OPJ A;  1BCO A;  4J2E A;  3ASM A;  3RMA A;  1LWF A;  4DU4 A;  4FM0 A;  4KB0 A;  4M42 A;  3AA2 A;  3DLG A;  2YHB A;  1S1V A;  1W9H A;  3AVH A;  3AVL A;  2A1S A;  5E41 A;  3RTV A;  3QEP A;  3OYA A;  1NK7 A;  1ITG A;  4KTQ A;  3KLG A;  3M8S A;  1G15 A;  2VG7 A;  3OYH A;  5HBM A;  1KVB A;  2D0C A;  3AA3 A;  5KI6 A;  1CXU A;  1JLQ A;  3DYA A;  3WNE A;  3KD5 E;  3K2P A;  1UA1 A;  4ICL A;  3AO1 A;  4O0I A;  3I0R A;  1TKT A;  4DF4 A;  3ZT0 A;  4DU3 A;  1EKE A;  3DMJ A;  1WNS A;  3P1G A;  4CJL A;  5C24 A;  2E6L A;  3AA4 A;  3TAR A;  4NCG A;  2D0A A;  2VWJ A;  4RG8 A;  4YNQ A;  4JS4 A;  1RT4 A;  1S1T A;  2EX3 A;  3S3O A;  4FXD A;  4FJH A;  4W5Q A;  5EU7 A;  4CJR A;  3HP6 A;  4B9T A;  3ALY A;  5KRS A;  2DY4 A;  2B5J A;  1LWE A;  1BHL A;  1FKO A;  3KLE A;  5T7B A;  4FJI A;  2DTU A;  2BE2 A;  3HPH A;  5C25 A;  1U48 A;  2FBY A;  1BQM A;  4H8K A;  4DLG A;  4CHZ A;  1NK6 A;  3LAN A;  2WOM A;  1X9S A;  2PYJ A;  4FLT A;  4FCY A;  3HXM A;  2XO7 A;  1TK8 A;  3SQ0 A;  3F73 A;  1EX4 A;  1HNI A;  5CY4 A;  4M3W A;  4OKJ A;  4WE1 A;  5K14 A;  2A1R A;  2YNG A;  3RR7 A;  3L2Q A;  4FYD A;  4IDK A;  1NJZ A;  1MU2 A;  4O4G A;  4DTO A;  4M3U A;  4DTR A;  3C6T A;  4Q0B A;  3S3M A;  4GMJ B;  3HYF A;  1KFD A;  1JLA A;  3I0S A;  3RMD A;  3IAY A;  4DTJ A;  3HPO A;  1J54 A;  2XHB A;  3VQD A;  4R5P A;  4CF0 A;  1LAV A;  2QKK A;  1NK0 A;  5FRO A;  4FW1 A;  4DWI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...