1Y97A

The human trex2 3' exonuclease structure suggests a mechanism for efficient non-processive dna catalysis
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
230
structure length
214
Chain Sequence
AGMSEAPRAETFVFLDLEATGLPSVEPEIAELSLFAVHRSSLENPEHGALVLPRVLDKLTLCMCPERPFTAKASEITGLSSEGLARCRKAGFDGAVVRTLQAFLSRQAGPICLVAHNGFDYDFPLLCAELRRLGARLPRDTVCLDTLPALRGLDRAHGYSLGSLFHRYFRAEPSSAEGDVHTLLLIFLHRAAELLAWADEQARGWAHIEPMYLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Three prime repair exonuclease 2
publication title The Human TREX2 3' -> 5'-Exonuclease Structure Suggests a Mechanism for Efficient Nonprocessive DNA Catalysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 66
structure length 214
sequence length 230
chains with identical sequence B
ec nomenclature ec 3.1.11.2: Exodeoxyribonuclease III.
pdb deposition date 2004-12-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1y97A01
1WN7A 4O44A 3M8SA 2YHAA 4ICLA 5SWMA 5FRNA 4JS5A 3IS9A 4KRFA 1W0HA 4OVLA 4FLWA 4F8RA 4FJGA 3HJFA 4CEAA 1L3VA 4CEDA 4DSKA 1O1WA 2F8SA 3ZSXA 1ASVA 1RT6A 4FLYA 5J2MA 1NOZA 3ISNC 3K2PA 1XHXA 3SQ0A 1TAQA 3QLHA 4CFBA 3PX4A 4ELUA 4M3UA 3OYBA 2PZSA 1C0UA 3SJJA 2DY4A 4LSLA 4LH5A 3HXMA 4CJFA 2XHBA 3ULDA 1U45A 1S6PA 4DWIA 1RILA 3U3GA 4CIGA 3AA5X 3AA4A 5SZTA 4DFMA 4DF4A 1NK4A 1HQEA 1C0TA 3ZSOA 3PY8A 3VQPA 3AVGA 3V9XA 4B08A 2PYJA 1RBSA 1BI4B 3OYMA 1IKVA 4QCLA 1I39A 1TV6A 4M3TA 3T1AA 4AHVA 4DTNA 1NK0A 3O4NA 2Q3SA 1RBUA 1WNSA 2XRIA 5DK5A 1VSHA 4F4KA 1FXXA 3ZT0A 4C8KA 2G8FA 4EZ9A 4H4OA 4DTUA 3CG7A 3O3GA 3C6UA 3AVCA 4CEZA 1SKRA 1C1BA 4N5SA 4CFAA 3S3MA 2YHBA 4OGEA 2HW3A 2B4JA 5J2NA 3V81A 4AHTA 4E7IA 4IG3A 3JSMA 3IG1A 3KK1A 4DQQA 3SUOA 3NE6A 1NK5A 4JRPA 1LAWA 4DF8A 3PV8A 1ZBLA 2YKMA 4BE2A 4GVMA 1D9DA 1KTQA 4B3OA 3AVFA 1ZBFA 4YNQA 4PA1A 4FCYA 2Y1IA 3CFOA 3CYMA 3IRXA 4IDKA 3TABA 4FJIA 3OJUA 1EKEA 1RT3A 1JLEA 4M45A 3D45A 3TWHA 3LALA 3TAGA 1X9WA 1Q9YA 1RDDA 1MU2A 1NJXA 3WNGA 4ID1A 2NUBA 4BDZA 3HPGA 2FC0A 3MEEA 3L2RA 1BCOA 4IBNA 4CF0A 1U47A 1S5JA 4I2PA 4NYFA 4FK2A 1BL3A 4FW1A 3VN5A 1NKEA 4LH4A 2HHTA 5CZ1A 1XWLA 4DTXA 4C8LA 4RW6A 3ZT4A 3TAEA 4C8MA 1QQCA 2Z1JA 3P5JA 1XHZA 4DQIA 1WSIA 1L5UA 3HT3A 3DYAA 1VK0A 2E4LA 4XIUA 2W42A 4WE1A 3ZCMA 5C42A 4DLGA 4IKFA 4W5NA 1ZYQA 2GBZA 1UAXA 3BDPA 2B6AA 3V1RA 3L3UA 4W5TA 4CF1A 1EETA 4HCBA 2HVHA 1CXUA 2KFZA 4E7KA 4FW2A 1QHTA 1JLFA 3O3FA 3OS2A 4E7JA 3AVAA 1VSFA 3DLKA 4KV8A 4DSIA 3THVA 2JLEA 2VG7A 1VSMA 4F2SA 3L8BA 3LZIA 4CEBA 3ZSVA 3NCIA 4KI6A 1CZ9A 2BANA 3NF7A 3QNOA 4DU1A 2YNGA 1IO2A 5KGWA 3PUFA 4H8KA 4FK4A 3DLHA 3K5OA 1HYVA 1G15A 1TL1A 4W5OA 3LPUA 3L2VA 2G8VA 4Y1CA 3DRSA 1TL3A 1WSEA 3TAMA 4CK3A 1SKWA 1KFSA 4CJTA 1U04A 2VG5A 1TAUA 1BIZA 4B8AB 3G10A 3SQ4A 2D0BA 4DSLA 1NK7A 1B9FA 3HVTA 4O4GA 4UQGA 3DLEA 4HVJA 3NAEA 3BGRA 3VQ5A 4E1MA 3OYCA 3D0PA 3VA0A 4KHUA 5HRRA 2XO7A 1RTIA 1YTAA 4CK1A 3HSTB 3C94A 1BCMA 2HMIA 1D5AA 1TK8A 4M3RA 3DOKA 3K5MA 4JS4A 1RT7A 3DMJA 3OS0A 3U3YA 2HNZA 2XY8A 1RTDA 1CLQA 4FJKA 4RW4A 4PWDA 1HRHA 3OYIA 1WAFA 3VQBA 4CJLA 1X9MA 4J2BA 1FKOA 4KTZA 3NGZA 4CJSA 1GOCA 4IFYA 1CZBA 1VSIA 1JLQA 1T05A 1Q9XA 4DFJA 4K8XA 2FBXA 2HNYA 4CGDA 4M42A 1S1XA 5KTQA 3LP1A 4B9SA 4IG0A 2WONA 1BGXT 1Z26A 3OYFA 1L3UA 3RR8A 3B6PA 1RTHA 1Q8IA 3LP2A 2D5RA 1TKXA 3VQ9A 4N76A 3LANA 1K6YA 2F8TA 1HNVA 2G8WA 4CJWA 3HP6A 4DTJA 4CE9A 3KTQA 1LWFA 1RTJA 1VSKA 4CHZA 2XY6A 4C8OA 2G8HA 1QS4A 3LP3A 3LWMA 1S1UA 3AO3A 4F3TA 5J2QA 4DTPA 3AVLA 3PO5A 4CFDA 1KVCA 2OPSA 4OPKA 3LZJA 4E7LA 3RRHA 1C6VA 2OZMA 1A5VA 4DTOA 1WSJA 4I2QA 3OYDA 3QESA 4KB0A 4CEOA 4CGFA 2WOMA 4IFVA 4W5RA 3RRGA 5JS2A 4CK2A 3ZT2A 4ZHRA 4CJKA 2A1SA 2EX3A 2Z1IA 3NF8A 3VQEA 4KI4A 4CF8A 1NJZA 1REVA 1JLGA 3AVBA 5HRPA 3V1OA 3HVRA 4M3ZA 1IKYA 1BIUA 3VQAA 1RT5A 1YVUA 3I8DA 4CHOA 5E41A 4OLBA 3NDKA 4CFCA 3OYHA 3SPZA 1X9SA 2PYLA 2KZMA 4FZYA 1S1TA 4O5BA 4M41A 3QEIA 3M8RA 3C6TA 3ALYA 3SQ1A 4FK0A 2D0CA 2Z1HA 1QE1A 1VRTA 4B9TA 1C1CA 1S9EA 1I3AA 5J1EA 4G1QA 2AJQA 1TKTA 4CHQA 2A1RA 1ZBHA 3V1QA 2X74A 1RDCA 1BQMA 3RMBA 3ZSYA 2YNFA 1N5YA 1KLNA 3QEVA 4CJEA 4GMJB 5KRTA 1IKWA 1FK9A 3AO2A 4MQ3A 4B9NA 1CXQA 3PO4A 2HNDA 3EY1A 1RBVA 4BE1A 4FJLA 3VQ6A 3S3OA 3QNNA 4FLTA 3QINA 4ZTJA 3TARA 4B9LA 4KKOA 2IC3A 4KFBA 1U49A 2P51A 4M3YA 3DRRA 4E3SA 2P5OA 1DTQA 3DM2A 3NH0A 3KK2A 4DSJA 3V6DA 1NK6A 2KZZA 3EYZA 4DFKA 1HQUA 3I0RA 3P1GA 4LY7A 4M3XA 4E89A 3IAYA 2Y1JA 1GOBA 2VWKA 1NKCA 1TGOA 3NBPA 3OYAA 4ELVA 4FXDA 3ZSZA 3MAQA 3TAPA 3KD5E 4FJNA 3OYNA 2E6MA 3AVNA 4E19A 4Z4CA 3QO9A 4FM0A 3KKRA 1T8EA 3OYKA 2OYQA 4I9QA 4KHWA 4B9VA 3WNEA 2FBVA 2BE2A 2X78A 4LD0A 3S9HA 4E0DA 1J5OA 3SI6A 3HK2A 1UA1A 4CF2A 1C1AA 3OYJA 4BDPA 4Z4EA 3QEWA 4KHYA 3RWUA 2RPIA 2HHUA 3QIOA 4B9UA 3OY9A 3HO1A 1B9DA 4RW8A 3VQCA 1KSPA 4DU3A 5KI6A 2DTUA 4JLHA 3AA2A 4NCBA 4DSFA 3NF6A 4B8CA 2FBYA 1XC9A 1TK0A 3NGIA 2O4GA 5HROA 4PY5A 3PX0A 1NKBA 1LW0A 1LAVA 2IDOA 4KB1A 3T3FA 2Z1GA 2HHSA 3VQ7A 1BHLA 3AV9A 1LW2A 4CHPA 4O0IA 1EXQA 3KJVA 3F9KA 3LDSA 1KCFA 4BDYA 2E6LA 1EP4A 1TKDA 1U48A 4KTQA 3K5NA 1HYSA 3SYZA 3KK3A 4KTWA 1KLMA 3KLIA 3F73A 5JS1A 5CYMA 3DRPA 4I9LA 4NCGA 1KVBA 3LP0A 1KRPA 2KTQA 4AHUA 4C8NA 5FDLA 4O55A 4LSNA 3HPOA 4FZZA 1UA0A 4JRQA 1HYZA 2ZE2A 4Z4GA 4Z0UA 1RDAA 3A2FA 1BISA 2RF2A 1C0MA 3VQDA 2VWJA 4FLVA 3QEXA 4QOZB 1HNIA 3WNFA 4F2RA 1UWBA 1RCHA 2P1JA 3G0ZA 3JYTA 4FJXA 4ID5A 2ATQA 3AVKA 4KO0A 4Y1DA 1X1PA 4CERA 3AVHA 4CESA 3RR7A 5HBMA 4KHNA 3SUNA 4DSEA 1SUQA 3KKSA 4CGIA 3CQ8A 1NJYA 4DQSA 3DLGA 4DTMA 2OPPA 4OJRA 2G8UA 4KAZA 4DS4A 1S6QA 3ZT1A 4CJQA 3HM9A 4PUOA 4EZ6A 1JL1A 3I0SA 5T7BA 2GV9A 4FJJA 1JXBA 1DTTA 2QKKA 5HRNA 2OPQA 2JGUA 3HP9A 3ZSRA 2YKNA 2HHXA 2B5JA 1SKSA 1VSDA 1A5XA 1IH7A 4FLXA 3SZ2A 4RW9A 4L8RB 4DTRA 2LSNA 3V9WA 4FJ9A 3U6FA 3MXJA 4Q5VA 1XI1A 1J9AA 4J2EA 4J2DA 3QIPA 1JXEA 5FRMA 1U4BA 3K58A 4EP4A 4FJHA 1QSLA 2ZQBA 4FVMA 4DLEA 1RT4A 5HP1A 4DG1A 5J2PA 2HHQA 3LAMA 4CGJA 4HUFA 2HVIA 1LWEA 4CGHA 1GOAA 1EX4A 4BWJA 1IG9A 4YFUA 4OGCA 1L3SA 1RBRA 2G8KA 3DI6A 4E7HA 3SCXA 2EHGA 4E1NA 3V9ZA 3SUPA 5D3GA 2HB5A 4H4MA 5CY4A 1UOCA 3KD1E 3QETA 3RMCA 1A5WA 4CCHA 4HUGA 1RDBA 2ZD1A 3DLRA 1ITGA 3VA3A 3L2UA 1JLCA 2OPRA 2DFEA 2DFHA 2IAJA 3T19A 4N56A 3KLHA 3K57A 1SL2A 3E01A 5EU7A 1T03A 5KGXA 4QAGA 1Z25A 5C24A 3OS1A 3MEDA 3KLGA 4BWMA 1RBTA 5K14A 2HHWA 1QTMA 1HMVA 3H08A 2QKBA 4N41A 3KLFA 4N47A 2RKIA 1S1VA 1NJWA 4FLZA 2KW4A 4CF9A 1TK5A 1TVRA 5I3UA 4DMNA 1TKZA 4EP5A 1LWCA 3K59A 3QERA 1SV5A 5CYQA 4AHCA 4HTUA 3FFIA 2QK9A 2ETJA 4CGGA 4J2AA 3EZ5A 1JLAA 1IKXA 3KLEA 4DS5A 4FJMA 3MXMA 3NH2A 4CEQA 3NFAA 2KFNA 3VQ8A 2D0AA 4CJUA 3AA3A 3AO4A 3MECA 1RT1A 3VQ4A 3SV4A 4FM2A 4OKJA 3TAQA 3LAKA 3TAFA 1D8YA 4NCAA 1HJRA 3SV3A 2PY5A 2FBTA 3DOLA 2OA8A 3LPTA 4Q0BA 3OJSA 4FYDA 3M8QA 3NH1A 4BE0A 4CJPA 4CIEA 3CM5A 3NF9A 1ZBUA 1QSSA 3KIOA 4RW7A 3NGYA 4FM1A 3AO1A 3OYLA 4CEEA 4B9MA 4Z4IA 3ZT3A 2P5GA 3K5LA 1J53A 3DLBA 3TR8A 1WSGA 2DFFA 4NYNA 3CFPA 4KPYA 4I7FA 1YTUA 4DQRA 3ASMA 4FJ7A 3RMAA 2G8IA 5CZ2A 4F3OA 3V9SA 5HLFA 4KHSA 4HUEA 1S1WA 3SUQA 3TANA 3ZSWA 3NHGA 1VSEA 1VSLA 3C95A 3HYFA 2RN2A 3L2WA 1HPZA 5DMRA 4AILC 3P83D 3OVNA 1SL1A 1WSFA 4OKEA 1BQNA 1VSJA 4O0JA 4ELTA 2OZSA 4OPJA 4CJ4A 3B6OA 3HPHA 5KRSA 2BDPA 3LWLA 3AO5A 2HHVA 3SQ2A 3AVIA 5C25A 2R7YA 2XY7A 3TI0A 3MXIA 1FKPA 1LV5A 3AVJA 2ITGA 1R0AA 1VRUA 2VG6A 3O3HA 4CECA 1ZBIA 3RMDA 1JL2A 4FJ8A 1KFDA 4HHTA 2QXFA 3O4QA 4ZTFA 1SL0A 1QSYA 2BGGA 4HCCA 3CFRA 1RT2A 4AHRA 3L3VA 4FJ5A 4Z4FA 1WLJA 3VQQA 1J54A 1ASWA 1RNHA 4CJVA 3OYGA 2IOCA 3V9UA 3WNHA 1F21A 4GW6A 3SNNA 1JKHA 2KQ2A 3HL8A 3MEGA 4PQUA 4K8ZA 4CJ5A 1YT3A 2X6SA 1BI4A 4CJRA 4CHYA 4KHQA 1ASUA 1DLOA 4DFPA 5HRSA 3S3NA 1WSHA 4M3WA 4DU4A 1NK8A 1S9GA 4TSXA 4OLAA 1Y97A 2IS3A 4CIFA 3SPYA 1D9FA 4W5QA 3V4IA 1W9HA 2XY5A 4FLUA 2I5JA 4RG8A 4AH9A 5I42A 3QEPA 1JLBA 4CHNA 2IGIA 4OKKA 1T7PA 2GUIA 2F96A 5FROA 4DQPA 1NK9A 2X6NA 4CJ3A 3CM6A 4R5PA 1N6QA 4BACA 3UIQA 1WAJA 1NOYA 3M8PA 4KREA 3AVMA 2O4IA 1B92A 4AHSA 3L2QA 4DTSA 4FZXC 2YNHA 3ITHA 1L3TA 4Z4HA 3PX6A 4CEFA 4MFBA 3OYEA 3RTVA 2YNIA 3ZSQA 1KVAA 2YV0X
chains in the Genus database with same CATH superfamily
1WBBA 2YHAA 3UKRB 1E3MA 3IS9A 1NGEA 5FPNA 4CEDA 2DPNA 4FLYA 4EAHD 3K9KA 4IDHA 1P8ZA 1C0UA 2PZSA 2DY4A 2NLXA 2IVNA 1IG8A 5AQZA 4DWIA 2PBDA 1U6ZA 3LM9A 3U3GA 5SZTA 4DF4A 1NWKA 3AVGA 1BI4B 4FPAA 4H0XB 4QCLA 3ID6A 3I8BA 4M63C 2PFUA 3FZLA 3BZCA 4BGAA 2HBMA 5DK5A 4F4KA 3ZT0A 5AZJB 5JLFA 4LF8K 3AVCA 3FR0A 3PIPL 4AHTA 2VCPA 3NE6A 5M1PA 2HBKA 2CH5A 1D9DA 4B3OA 1KTQA 4H5TA 2O8CA 5LMNK 4YNQA 4H5NA 3ENOA 5EOYA 3CFOA 3T69A 4CZKA 3CYMA 3IRXA 3VF2A 1EKEA 3GG4A 4IOXA 3LALA 1RDUA 4ID1A 2FC0A 3CQYA 4CZIA 4BRPA 4FWLA 5ADXA 1S5JA 4JI8K 4FK2A 1BL3A 3H6EA 1X3NA 5AQXA 1XWLA 4DTXA 2Z1JA 4DQIA 1XHZA 1WSIA 1GLLO 1N36K 2E4LA 4XIUA 2FF6A 1C0GA 3V1RA 4CF1A 1CXUA 4YOUA 3OS2A 3CCVN 1YXQA 3UKRA 3VGMA 4JAXA 2VG7A 5AQJA 5M1QA 5AQGA 1CZ9A 3VPZA 5M1KA 4H8KA 3K5OA 3L2VA 3LPUA 3THXA 1K8AO 2QWPA 1MWMA 1XQSC 1NG9A 1BIZA 1YJWN 3SQ4A 1NK7A 1B9FA 1R59O 3NAEA 4NXMK 3CMAN 3RVCA 1RTIA 1YTAA 4CK1A 1BCMA 1BU6O 1D5AA 3DOKA 1N32K 4FWOA 2QTDA 3DMJA 1CLQA 3U3YA 2HNZA 3NMUA 3WXMB 1FW6A 3G71N 4A2AA 4BGBA 1WAFA 3VQBA 2BUPA 4CJLA 1X9MA 3NGZA 4IFYA 1CZBA 2HNYA 1S1XA 5KTQA 3LP1A 3SAGA 3R8EA 4JV5K 4A62A 2Q97A 1Q8IA 1TKXA 4N76A 1SZ2A 1K6YA 3VEVA 2F8TA 2G8WA 4CJWA 3HP6A 3M6GA 1RTJA 4V19S 2P9KA 2QI2A 1U2VA 4HTLA 3SAFA 5J2QA 4DV4K 2AA4A 4E7LA 1SS6A 2OZMA 1C6VA 3H45C 4DTOA 1WSJA 3OYDA 1HX1A 4CGFA 3ZYYX 4IOAL 2WOMA 3RRGA 2EX3A 3E66A 4FOEA 3C7NB 4NB4A 1NJZA 3O08A 1IKYA 4B1YB 4FZYA 1S1TA 3QFUA 3B8AX 3EO3A 1VQLN 4FK0A 2Z1HA 1BG3A 1C1CA 3I55N 2P9IA 1TKTA 5BPNA 3QEVA 1VQON 2P9LB 5JVGL 1IKWA 3AO2A 4MQ3A 5IT9O 3PO4A 4QS9A 5CE3A 4BE1A 4JI4K 3R9PA 4FJLA 3VQ6A 1IBMK 4FLTA 4ZTJA 4B9LA 2D0OA 4KKOA 2IC3A 3UKUA 4E3SA 3DM2A 4JI1K 3V6DA 2KZZA 2GELA 4M3XA 3DXKA 4E89A 3IAYA 1QZ6A 3C65A 2VWKA 3VEOA 4ELVA 3TAPA 3OYNA 3AVNA 2OYQA 4B9VA 3WNEA 2FBVA 2BE2A 3M1FA 3OYJA 4BDPA 3RWUA 1Q86O 4B9UA 3MCPA 2E20A 5DM7L 3OY9A 5C12A 4DU3A 4EHUA 5MLCQ 1QQMA 4JLHA 3SMPA 4NCBA 3DJCA 4EFHA 4JNEA 4B8CA 2FBYA 4A59A 3NGIA 4PY5A 2IDOA 1BA1A 5GINA 4K41A 1LW2A 5E26A 3KJVA 1KCFA 3MWPA 1M90O 4KTQA 2WUSA 5AQLA 3G4SN 3KLIA 5JS1A 3DRPA 4I9LA 4AHUA 4LSNA 4LF5K 3HPOA 4FZZA 4JRQA 4IO9L 5M1FA 3O4WA 1RDAA 2VWJA 1C0MA 2P9LA 4QS7A 3WNFA 1UWBA 2P1JA 3G0ZA 4ID5A 2ATQA 1VQKN 5AQTA 4DR1K 4KO0A 4JI7K 2UUBK 3ZETB 4CGIA 4OJRA 5BREA 3A5OC 4DS4A 2VGMA 3A5LC 1ZC6A 5T7BA 2QKKA 4ILJA 3HP9A 2HHXA 1IH7A 2LSNA 3V9WA 1J9AA 3QIPA 5LJVA 1QQNA 1GLCG 4FJHA 5EY4A 1GLEG 4QS8A 2YI1A 4JK9A 4DG1A 4JKBA 4OPAA 3LAMA 1KD1O 3ID8A 2CGJA 1LWEA 1HLUA 1GOAA 4CGHA 4BWJA 1IG9A 4JK7A 5AFUH 3EE8A 2G8KA 4E7HA 3JXUA 3SUPA 3RMCA 5C2FA 1RDBA 2UXCK 3SJHA 3O1BA 2OPRA 2DFEA 3KZBA 5LMUK 2OTJN 1VAZA 1SL2A 1T03A 3O1WA 3MEDA 4R79A 3AGRA 4CZJA 2JWLA 2RKIA 1CZAN 1V4SA 4DV0K 4DR2K 1TKZA 4EP5A 3K59A 4AHCA 4JKCA 4DS5A 1JLAA 3KLEA 5C2DA 4CJUA 3O9RA 3AA3A 2Q0UA 3C0BA 4B1UB 1D8YA 3LPTA 2E2PA 3CPWM 3NH1A 2W41A 4XH4A 1ZBUA 3D2EB 3OYLA 3K5LA 1J53A 3TR8A 1EWQA 4KPYA 1T6CA 3RMAA 4F3OA 4H03B 3SUQA 3TANA 3NHGA 3C95A 1DKGD 3K0SA 3IMXA 1OVYA 3P83D 3GBTA 3QFPA 4OKEA 1SL1A 1BQNA 1K9MO 4IOCL 3ULEB 2OZSA 4OPJA 3B6OA 4BRIA 4CD1A 2BDPA 3AGKA 1VQMN 4A57A 4CW7B 1R0AA 4LFBK 4MLHA 5TKWA 3FLCO 4BQZA 3ZEUB 2Q36A 3RMDA 3DWLA 1BO5O 2QXFA 4ZTFA 3BY5A 2NRRA 3U9DA 4AHRA 3VQQA 1DEJA 1J54A 2OCEA 3EE9A 5LY3A 3WT0A 4H0YB 2FSNA 1JKHA 2KQ2A 2VQEK 2ASOA 1WSHA 4U7BA 1BA0A 1S9GA 3H1VX 4TSXA 4BRHA 4LFCK 2IS3A 3V4IA 5C15A 2I5JA 4RG8A 3LL3A 4YOTA 4BC4A 1YIJN 3O8MA 2X6NA 2BH1A 3THWB 1NOYA 3J7ZO 1B92A 4AHSA 3L2QA 3CCUN 1HPMA 4MFBA 2ASMA 1XNRK 3F5TA 2YNIA 3ZSQA 1KVAA 1WN7A 4O44A 4CVNE 3D2EA 3M8SA 2RE2A 4AM7A 4FWRA 5SWMA 4JS5A 5FRNA 3GOIA 4FLWA 4FJGA 3THYB 4CEAA 5F1XA 1ASVA 3A5NC 1XHXA 3SQ0A 4CFBA 4M3UA 3CCSN 1MA9B 3HXMA 4CJFA 2XHBA 3I33A 1U45A 1RILA 5BN8A 4L3QA 1NK4A 2O8BB 1C0TA 2IVOA 5AQFA 3V9XA 4B08A 2PYJA 1RBSA 3ULEA 1IKVA 2Q1NA 5A2QO 1S72N 4JI0K 1RDWX 4AHVA 4DTNA 4OO1J 1WNSA 3CJ1A 1FXXA 4C1NK 3ZX0A 1SKRA 3CI5A 1DGKN 4N5SA 2HW3A 3V81A 4E7IA 4IG3A 3JSMA 4G9ZA 3IG1A 2YHXA 4KHPK 1NK5A 4JRPA 3O9UA 2YKMA 3EEQA 1EQYA 1T44A 3AVFA 5DM6L 1HKBA 4FCYA 2Y1IA 1NM1A 4IDKA 1T3VA 2A40A 3D2FA 4K42A 1JLEA 4M45A 3EKUA 2P9NA 1NJXA 3SLCA 4IBNA 1U47A 4I2PA 4NYFA 4GV9A 4NXNK 3VN5A 4LH4A 4C8LA 3ZT4A 1KAYA 3BEXA 4Y0WA 3HT3A 1VK0A 2W42A 4DLGA 4W5NA 1ZYQA 2GBZA 3J81O 3L3UA 4B1WB 4W5TA 2HVHA 5IWAK 3A5MC 1QHTA 4FW2A 3O3FA 3W0LA 4E7JA 4JI3K 3AVAA 1VSFA 5AQQA 1JCFA 4DCHA 2D0PA 3NCIA 4B1ZA 4KI6A 5I9EB 4DU1A 1FJGK 1IO2A 4BC2A 3PUFA 4K43A 3MN5A 2D4WA 4BQLA 3DLHA 2HMPA 1G15A 2G8VA 4OPHA 1TL3A 3HBTA 1WSEA 4CJTA 1U04A 2O8CB 1TAUA 4B8AB 3G10A 3F9MA 1V4TA 3HVTA 4O4GA 2YX6A 3DLEA 4HVJA 3VA0A 3BGRA 3OYCA 1WB9A 3K9JA 4KHUA 3HSTB 4CBXA 4WFBL 2NZTA 3LM2A 2UYTA 3T1YK 2ZF5O 4BRGA 4JS4A 2WC9A 4BY9C 3BF1A 2XY8A 1RTDA 2O8FB 1IBLK 1HRHA 4PKIA 2P9SA 1NGJA 4AQYK 4CJSA 1VSIA 1JLQA 4GKJK 4MDBA 4K8XA 3CQXA 4B9SA 3P38A 4IG0A 4UY8O 2WONA 1BGXT 3B6PA 3VQ9A 1OH8A 1HNVA 4A5AA 3KTQA 1QVFM 1VSKA 2ZWHA 4B1XB 3O9TA 3HRGA 4F3TA 3CETA 1KVCA 3RRHA 2QWLA 4I2QA 3QESA 2QWRA 4KB0A 3THXB 4IFVA 4CK2A 4CJKA 2A1SA 3NF8A 4CF8A 1JLGA 4OLBA 3VQAA 1YVUA 3MN9A 3I8DA 3EN9A 4CHOA 4IEEA 2FXUA 2PYLA 4FWQA 5FPEA 4JKFA 2NRWA 4J8FA 2KZMA 4O5BA 3TTFA 3BZKA 2YJFA 3ALYA 4O8UA 3SQ1A 3C6AA 3A8YA 1YJNN 1VRTA 2AP1A 5J1EA 1S9EA 1ILYA 1YUWA 2X74A 3ZSYA 1N5YA 4CJEA 1FK9A 5GIPA 3QB0A 2HNDA 3J7YP 1J5EK 3E9PA 1E4FT 3S3OA 1KAZA 1NGAA 3TARA 1U49A 4BROA 1Z6RA 2P51A 3QBWA 4BVOA 1NK6A 3EYZA 3I0RA 2P9KB 1U2VB 3MX5A 4CI6A 1GOBA 2O8FA 1TGOA 3MX2A 4H0PA 4A5BA 2E6MA 3QO9A 4FM0A 3OYKA 2CGLA 2J4RA 2X78A 3S9HA 3CJ9A 5C10A 2YHWA 3HK2A 2GUPA 1QQOA 1OH5A 3TSQA 3OW2M 1ATSA 5HL7L 1W97L 2DTUA 1S22A 3NF6A 5AQPA 5JICA 5GIOA 2P9IB 4IFEA 4C23A 2WFBA 4B3SK 4KB1A 4K0KK 4LC9B 1GLAG 3VQ7A 1BHLA 4JYAK 4CZFA 5CHIA 4O0IA 1EP4A 4M7YA 3HOTA 3BP8A 4H5VA 3FZMA 1HUXA 1HYSA 3P39A 3UKUB 3SYZA 3CIPA 2YCHA 3DXKB 3E9OA 4C8NA 2ZGZA 3N4QA 1OVQA 4BC3A 4Z0UA 5EX5A 4FLVA 3QEXA 4QOZB 3SMSA 4F2RA 1HNWK 4LF6K 3VESA 1I94K 3JYTA 1VQ9N 2CGKA 4AF1A 4CERA 3AVHA 4CESA 5HBMA 4KHNA 3SUNA 1SUQA 1XUPO 3CQ8A 3LDOA 4KAZA 4JD2B 1HNZK 2G8UA 1S6QA 5KPTA 3ZT1A 5EXWA 4PUOA 1JL1A 2GV9A 4O8KA 4KH4A 5HRNA 5KQ8A 1VSDA 1A5XA 4L8RB 5JMVA 4X64K 4FJ9A 4Q5VA 3ZLJA 3SK3A 4J2EA 1JXEA 2O8EB 1QSLA 2EWSA 3J8AA 3VEWA 5FPDA 4I6MA 2F4VK 3CD6N 5HP1A 2Q31A 5J2PA 5AQOA 5HOOA 4DR4K 3SCXA 4E1NA 4H4MA 3CCMN 1J6ZA 1UOCA 3KD1E 1A5WA 2E8AA 3L4IA 4HUGA 4PHTX 3DLRA 4LF4K 5AQKA 3T19A 3VEZA 2KLAA 2I7NA 4WQ5A 5C24A 3OS1A 4GY2B 4NLCA 1X3MA 1QTMA 2HHWA 2QKBA 4N41A 3E1YA 4FSVA 4CF9A 4K25A 1TK5A 2O8DB 3EL2A 4WCEL 5CYQA 4HTUA 3FFIA 4MO4A 1QVGM 3O6WA 4DV1K 3NFAA 1GLJO 4BR7A 3VQ8A 4GVEA 1ATNA 4OKJA 3TAQA 2PY5A 2FBTA 3DOLA 3FZFA 4CJPA 4CIEA 4LFAK 3KIOA 4RW7A 2E5LK 3NGYA 4DV7K 3AO1A 4CEEA 2P5GA 3DLBA 3IDHA 1WSGA 4XH5A 3CFPA 4JD2A 4DQRA 4FJ7A 1D4XA 2G8IA 3V9SA 4HUEA 3L2WA 1HPZA 3H3OB 2V52B 3OVNA 1BOTO 3N4PA 1TUYA 4O0JA 2O8EA 4CJ4A 3AO5A 2E88A 2VGNA 3VERA 4JKEA 3AVIA 2XY7A 3TI0A 1LV5A 3CC7N 2ITGA 3R3LA 1XMQK 1VRUA 5LL6Z 1JL2A 4FJ8A 1KFDA 4FWMA 3O4QA 2BGGA 4X62K 1RT2A 4CBWA 4FJ5A 1WLJA 3A0IX 1T6DA 4CJVA 3OYGA 2IOCA 2QW9A 3V9UA 1F21A 4GW6A 5ELZA 1VQ8N 4CJRA 3CC4N 4M3WA 1NK8A 4GV3A 4MLEA 2NRZA 2VQFK 4OLAA 3SBTA 3SPYA 3AY9A 4W5QA 1D9FA 2XY5A 1OH7A 4DR6K 1RFQA 2O8DA 4FLUA 5I42A 4LF9K 4LF7K 3QEPA 1JLBA 2IGIA 3R1XA 2F96A 4DQPA 3C6HA 1NK9A 2E1YA 1N6QA 5BPMA 4FZXC 5AQNA 1L3TA 4CEFA 3OYEA 3CC2N 3FE1A 1L3UA 4DKWA 3Q7CA 4BRQA 4YDUC 4KRFA 4OVLA 2A42A 4F8RA 2H3GX 1G99A 1L3VA 4DV2K 2F8SA 3ZSXA 4YHHK 1H1VA 5M1NA 3K2PA 3PX4A 4ELUA 3SJJA 4CZEA 4OX9K 4LSLA 4LH5A 3ULDA 4CIGA 3AA4A 1Q82O 1HQEA 3PY8A 3VQPA 1TV6A 4M3TA 5JVHL 1GLFO 4DR7K 1IBKK 1RBUA 2NNWA 4DR3K 1VSHA 4C8KA 2G8FA 4EZ9A 4KBOA 3CG7A 3O3GA 4CEZA 1C1BA 4CFAA 2YHBA 3IFRA 3OBYA 5J2NA 2FSJA 4B3RK 1NMDA 3KK1A 5C0YA 4JKGA 4DF8A 1ZBLA 3M3ZA 4BE2A 4GVMA 2JWKA 1NBWA 4WQ4A 1RT3A 3TAGA 5F2RA 3D45A 3TWHA 3LDQA 3U9ZA 1Q9YA 4IEIA 1MU2A 4BDZA 3MEEA 3L2RA 1BCOA 4CF0A 1OKJA 4FW1A 1NKEA 4CZHA 2P9UA 4RW6A 1QQCA 3EZWA 4IKFA 4WE1A 3ZCMA 1UAXA 1YHQN 1KQSM 3WQTA 4JN4A 3DLKA 3CJ7A 3WEEB 3AAPA 1YVNA 5BR9A 5AQUA 2QM1A 2JLEA 3P4IA 1VSMA 3L8BA 4CEBA 5AZIA 3NF7A 2YNGA 4BRCA 3GL1A 5GAHP 4W5OA 4WFNL 3DRSA 3TAMA 1WBDA 3CF5L 3S41A 2VG5A 1NLVA 2D0BA 4RTFD 4B3MK 4DSLA 4JI6K 2A5XA 3VQ5A 4E1MA 3CJAA 1E4GT 3D0PA 5HRRA 2XO7A 3D2FB 4KH6A 2HMIA 1TK8A 2P9NB 3PSIA 5BRDA 2I7PA 4DV5K 4YORA 4PWDA 3OYIA 2HOEA 4J2BA 1FKOA 4KTZA 4CZLA 4PKHA 1ZBSA 1GOCA 5FPMA 4YOWA 4X66K 1T05A 2OANA 3G6EN 4CGDA 4M42A 2VYPA 3SAHA 1Z26A 3RR8A 3QBXA 1RTHA 2D5RA 3LANA 2GEMA 4DTJA 4CE9A 3DXMA 2WTUA 4M7XA 4CHZA 3VTHA 2XY6A 3LP3A 1S1UA 3AO3A 4DTPA 2QA4N 3AVLA 3PO5A 4CFDA 2OPSA 4OPKA 2KHOA 3WXIA 3MMVA 4CEOA 4A61A 5JS2A 4ZHRA 3ZT2A 4ISGA 3VQEA 4KI4A 2QWMA 1REVA 3AVBA 3HVRA 3V1OA 4M3ZA 1TYQB 1BIUA 1RT5A 3OYHA 4U67L 3SPZA 1X9SA 3D6RA 2GWKA 4M41A 3WEEA 4EIAA 3QEIA 3M8RA 3RSEB 2UU9K 4MDAA 1QE1A 5ADXH 4G1QA 2P9SB 1RDCA 1BQMA 3RMBA 1KLNA 2YNFA 2HHHK 1VQ4N 5AR0A 4GMJB 2P9PB 1CXQA 1N33K 5BN9A 3QMLA 1GLBG 3QINA 3U8XA 4KFBA 4M3YA 1JCEA 1DTQA 2P5OA 3KK2A 3PSFA 5AFUA 3L0QA 2F9TA 3P1GA 4LY7A 3J7AP 1NKCA 3OYAA 3ZSZA 3F2KA 3FZHA 3VGLA 1T8EA 4KHWA 4I9QA 1NU0A 2E2QA 4E0DA 3T1HK 4DR5K 1J5OA 1Q7YO 3H46O 4CF2A 4Z4EA 3GE1A 4BRDA 3QEWA 2HHUA 3QIOA 4GKKK 4O5FA 1B9DA 4RW8A 4BRMA 2UUCK 2IIRA 3WXKA 3AA2A 4DV6K 1XC9A 1TK0A 2O4GA 5HROA 3G25A 3PX0A 4X65K 1LW0A 3T3FA 1M1KO 2PAVA 2ZGYA 4BC5A 1YAGA 4CJ7A 4CHPA 3CXCM 3CHWA 1TYQA 4BDYA 2E6LA 1TKDA 1U48A 2D1KA 4KTWA 4PKGA 5AQSA 1C0FA 1LOTB 3RSEA 4YOYA 4HWIA 1KRPA 4Z94A 2KTQA 4H0VB 4WQ5C 3MK6A 1UA0A 5AQYA 1HYZA 3KK7A 1BISA 3AAQA 2F7TA 3LDPA 2P9PA 1NGGA 1RCHA 1HJOA 4FVUA 4Y1DA 4CD3A 3HM8A 3RR7A 1VQNN 4DSEA 4DQSA 5EVZA 2OPPA 3CPEA 4BRAA 4CJQA 3TSPA 4EZ6A 3HZ6A 3I0SA 3MDQA 1JXBA 2FLOA 2OPQA 3ZSRA 1SKSA 4RW9A 1HKCA 3M5RA 3MXJA 1NGDA 5FRMA 3J80O 1YF5L 1U4BA 4YY3K 2ZQBA 4F9OA 1RT4A 3KWGA 2HHQA 1L3SA 1RBRA 2QWQA 3DI6A 5D3GA 1EO1A 3V9ZA 1QZ5A 2HB5A 3ZX3A 1ITGA 1VQ7N 3VA3A 3L2UA 1JLCA 5TKYA 4FO0A 2DFHA 2IAJA 4DB3A 4N56A 3KLHA 2HBLA 3K57A 5AQIA 3E01A 3DAWA 1Z25A 1RBTA 5K14A 1HMVA 3H08A 3KWIA 3GDQA 4N47A 1Q81O 3QICA 1Z05A 4FLZA 1EWRA 1LWCA 4JHDA 3O80A 2ETJA 4CGGA 4J2AA 3EZ5A 1IKXA 1HKGA 3HSCA 2ZJRL 4CEQA 3VF4A 2KFNA 2D0AA 3AO4A 3VQ4A 3SV4A 3MN7A 3LAKA 3TAFA 4NCAA 1HJRA 3SV3A 2UXBK 2OA8A 4Q0BA 3M8QA 4I6MB 2ZJPL 1QSSA 2Q0RA 3E9LA 3WXJA 1NGBA 4B9MA 3ZT3A 3CCLN 4NYNA 2YJEA 5AQVA 2NRHA 3NVMA 4BRKA 5CZ2A 1K73O 1VSEA 1VSLA 2ASPA 3HYFA 3L4QA 3CMEN 5DMRA 4DUYK 1WSFA 4RWTA 5LJWA 2HF4A 1VSJA 3OHRA 4ELTA 3HPHA 3LWLA 4H5WA 2HHVA 3ENBA 3SQ2A 5C25A 2R7YA 4IO8A 1FKPA 1NNEA 3W3DA 2VG6A 2GTDA 3D7EO 1HR0K 4HHTA 1SL0A 1NGHA 1QSYA 3TSUA 4HCCA 3CFRA 2E1ZA 3L3VA 4JI5K 4Z4FA 3ATVA 3SNNA 3HL8A 1YT3A 2X6SA 1BI4A 1ASUA 4DFPA 5HRSA 3S3NA 4CIFA 2E2NA 1KXPA 1T7PA 3QDKA 1NGIA 2GUIA 5AZJA 1VQ6N 5FROA 3CM6A 4BACA 5BRHA 4DTSA 4WQ4C 4CZGA 5BPLA 4E1JA 2UXDK 3VTIA 2YV0X 4CJ3A 3S3MA 4ICLA 1W0HA 3HJFA 4PL8A 4DSKA 1O1WA 1RT6A 5J2MA 1NOZA 3VGKA 2BTFA 3ISNC 5GAGP 1TAQA 3QLHA 3OYBA 3MN6A 1S6PA 4WYBA 5AQRA 3AA5X 4DFMA 1BDGA 3ZSOA 1O13A 5AJ3K 3OYMA 1WOQA 4FWNA 2IVPA 1I39A 1X9JA 3T1AA 1NK0A 3O4NA 2Q3SA 2QEXN 2XRIA 4JK8A 4H4OA 4DTUA 5KPRA 3C6UA 4OGEA 2B4JA 2V51B 4DQQA 3SUOA 1LAWA 3PV8A 4JKHA 1BUPA 2A6AA 1ZBFA 4IZ9A 5AQWA 4PA1A 4KH5A 3TABA 4FJIA 2ZM6K 3OJUA 1X9WA 5KPZA 1RDDA 1GLDG 1ZXOA 3WNGA 2NUBA 3HPGA 1DT9A 1S3XA 3AARA 2HHTA 5CZ1A 4YOXA 4C8MA 3TAEA 3P5JA 1L5UA 3DYAA 3LDNA 5C42A 4BG9A 3BDPA 2B6AA 1EETA 1VQ5N 2KFZA 4E7KA 4ILHA 1JLFA 5KQDA 3LDLA 2ZJQL 4KV8A 4DSIA 3THVA 3VETA 3VENA 4F2SA 1Q18A 3LZIA 1P90A 3ZSVA 4FWPA 4BR0A 2BANA 3QNOA 1YJ9N 5KGWA 4FK4A 1HYVA 1TL1A 1N34K 4Y1CA 2V7YA 4JKGB 4CK3A 1SKWA 4WF9L 1KFSA 3C7NA 4UQGA 4BRLA 3C94A 3WXLA 4M3RA 2F9WA 3K5MA 4YOVA 4BVPA 1RT7A 3OS0A 5BR8K 1SQKA 4FJKA 4RW4A 5GAEP 2P9UB 3UE5A 4WFAL 1XNQK 2Q2RA 1Q9XA 4DFJA 3O9SA 5E84A 2FBXA 1Y64A 3OYFA 3LP2A 3BF3A 4ILGB 1W2BM 1LWFA 4C8OA 2NRVA 1QS4A 3LWMA 5AZIB 2E2OA 5H1SQ 3VEYA 3IUCA 4HCBA 3LZJA 1A5VA 4XH1A 4W5RA 5CR4A 2Z1IA 3VEXA 3NVKA 3IKMA 5HRPA 4JKAA 3OBWA 5E41A 3NDKA 4CFCA 4H0TB 4IWVA 2UUAK 3TTCA 3C6TA 3Q7BA 2D0CA 4BR2A 4B9TA 1I3AA 2AJQA 4CHQA 3TU5A 2A1RA 1ZBHA 3V1QA 3CCQN 4CBUA 5AQMA 5KRTA 1VQPN 4B9NA 3TTDA 3CCRN 3EY1A 1NGCA 1RBVA 3QNNA 3O9QA 2FF3B 3DRRA 3NH0A 4DSJA 3DXMB 4BR5A 4H5RA 3FGUA 4JKDA 4DFKA 1HQUA 2Y1JA 4EHTA 5M1OA 3NBPA 4FXDA 3VOVA 4BRNA 3MAQA 3KD5E 4FJNA 2G8HA 4E19A 4Z4CA 4FL9A 3KKRA 3WQUA 1XMOK 4LD0A 4FWKA 3SI6A 1UA1A 1C1AA 3HTVA 4KHYA 2RPIA 4IJAA 3HO1A 4AM6A 3ZETA 4ISFA 3VQCA 1W7AA 1KSPA 5KI6A 4BR4A 3FZKA 3JS6A 4DSFA 3SBGA 2QWNA 4JEPA 3BUZB 1NKBA 1LAVA 3R6MA 2Z1GA 1ATRA 2HHSA 3AV9A 1EXQA 3F9KA 3LDSA 2W6KA 1MWKA 3K5NA 4GV6A 3KK3A 3PLAA 2A41A 1KLMA 3F73A 5CYMA 2ITMA 4NCGA 1KVBA 3LP0A 2A3ZA 1NMNA 1K8KB 5FDLA 1YI2N 4O55A 3HOSA 3ENHA 3CJCA 2ZE2A 4Z4GA 2RF2A 3A2FA 3VQDA 4JI2K 4IXCA 1HNIA 2QXLA 1TUUA 1SAZA 4FJXA 3AVKA 1X1PA 3KKSA 1NJYA 3H3NO 3DLGA 4DTMA 2NRXA 3HM9A 4FJJA 1DTTA 1VHXA 2JGUA 2YKNA 3HI0A 2B5JA 4FLXA 3SZ2A 2NRTA 4DTRA 3U6FA 3FFKB 3T7ZA 1XI1A 4J2DA 4A2BA 3K58A 4EP4A 3ATUA 3KVGA 3U4LA 4FVMA 4DLEA 3O5BA 3OTOK 4HUFA 4CGJA 2HVIA 1EX4A 2WBNA 4YFUA 4OGCA 1JCGA 2EHGA 3CERA 5CY4A 2RHKA 3QETA 2FSKA 4CCHA 3EKSA 2ZD1A 5EU7A 3CCEN 3JAMO 5KGXA 4QAGA 3KLGA 4BWMA 1QHAA 2HSTA 5BRFA 3KLFA 4XEIA 1S1VA 1NJWA 2KW4A 1OH6A 3H1QA 1TVRA 5JLHA 4DMNA 3I56N 5I3UA 3QERA 1SV5A 4NO7A 3CJBA 2QK9A 3ZEUA 4FJMA 3MXMA 4DUZK 3ZX2A 4B1VA 3NH2A 1K8KA 3UB5A 4DV3K 3MECA 1RT1A 4FM2A 4C1NI 2W40A 3L6QA 3DLLL 4FYDA 3OJSA 4BE0A 3CM5A 3NF9A 1WUAA 1LCUA 2W6LA 4FM1A 4Z4IA 4BR9A 1JJ2M 4PL7A 2DFFA 4I7FA 1YTUA 3ASMA 4BRFA 4FOIA 2OTLN 4YDUA 4IJNA 5HLFA 4KHSA 1IJJA 1S1WA 2KKZA 3ZSWA 2HBJA 4GNIA 2V7ZA 4FPBA 3THWA 2RN2A 3P31A 3OA9A 2GWJA 4AILC 4NLBA 1BWFO 1KC8O 5KRSA 1IV0A 2CH6A 5GADP 3MXIA 2HF3A 3AVJA 5AQHA 5FLXO 4FWSA 3THYA 1NJIO 2GX9A 4JHDB 3O3HA 4CECA 1ZBIA 4ISEA 4BG8A 4BREA 1HNXK 4B3TK 1ASWA 1RNHA 4RCHA 3KHYA 4H0OA 3WNHA 2O8BA 3MEGA 4PQUA 1RGIA 4K8ZA 4CJ5A 3CCJN 4KHQA 4CHYA 1DLOA 4DU4A 2YHYA 3VMFB 4DQ8A 3VF6A 3PIOL 1KAXA 1Y97A 3TPQA 1W9HA 5F0XA 4AH9A 4B9QA 4CHNA 4OKKA 5B8HA 1N8RO 4MO5A 4R5PA 4CZMA 3UIQA 1WAJA 2VWBA 1XC3A 3M8PA 1MDUB 4KREA 3AVMA 2O4IA 2YNHA 3MCAB 3ITHA 3WUHA 4Z4HA 3PX6A 4DHYA 1NGFA 2QWOA 3MWTA 3RTVA 1YITN 1ESVA
chains in the Genus database with same CATH topology
1WN7A 4O44A 3M8SA 2YHAA 4ICLA 5SWMA 5FRNA 4JS5A 3IS9A 4KRFA 1W0HA 4OVLA 4FLWA 4F8RA 4FJGA 3HJFA 4CEAA 1L3VA 4CEDA 4DSKA 1O1WA 2F8SA 3ZSXA 1ASVA 1RT6A 4FLYA 5J2MA 1NOZA 3ISNC 3K2PA 1XHXA 3SQ0A 1TAQA 3QLHA 4CFBA 3PX4A 4ELUA 4M3UA 3OYBA 2PZSA 1C0UA 3SJJA 2DY4A 4LSLA 4LH5A 3HXMA 4CJFA 2XHBA 3ULDA 1U45A 1S6PA 4DWIA 1RILA 3U3GA 4CIGA 3AA5X 3AA4A 5SZTA 4DFMA 4DF4A 1NK4A 1HQEA 1C0TA 3ZSOA 3PY8A 3VQPA 3AVGA 3V9XA 4B08A 2PYJA 1RBSA 1BI4B 3OYMA 1IKVA 4QCLA 1I39A 1TV6A 4M3TA 3T1AA 4AHVA 4DTNA 1NK0A 3O4NA 2Q3SA 1RBUA 1WNSA 2XRIA 5DK5A 1VSHA 4F4KA 1FXXA 3ZT0A 4C8KA 2G8FA 4EZ9A 4H4OA 4DTUA 3CG7A 3O3GA 3C6UA 3AVCA 4CEZA 1SKRA 1C1BA 4N5SA 4CFAA 3S3MA 2YHBA 4OGEA 2HW3A 2B4JA 5J2NA 3V81A 4AHTA 4E7IA 4IG3A 3JSMA 3IG1A 3KK1A 4DQQA 3SUOA 3NE6A 1NK5A 4JRPA 1LAWA 4DF8A 3PV8A 1ZBLA 2YKMA 4BE2A 4GVMA 1D9DA 1KTQA 4B3OA 3AVFA 1ZBFA 4YNQA 4PA1A 4FCYA 2Y1IA 3CFOA 3CYMA 3IRXA 4IDKA 3TABA 4FJIA 3OJUA 1EKEA 1RT3A 1JLEA 4M45A 3D45A 3TWHA 3LALA 3TAGA 1X9WA 1Q9YA 1RDDA 1MU2A 1NJXA 3WNGA 4ID1A 2NUBA 4BDZA 3HPGA 2FC0A 3MEEA 3L2RA 1BCOA 4IBNA 4CF0A 1U47A 1S5JA 4I2PA 4NYFA 4FK2A 1BL3A 4FW1A 3VN5A 1NKEA 4LH4A 2HHTA 5CZ1A 1XWLA 4DTXA 4C8LA 4RW6A 3ZT4A 3TAEA 4C8MA 1QQCA 2Z1JA 3P5JA 1XHZA 4DQIA 1WSIA 1L5UA 3HT3A 3DYAA 1VK0A 2E4LA 4XIUA 2W42A 4WE1A 3ZCMA 5C42A 4DLGA 4IKFA 4W5NA 1ZYQA 2GBZA 1UAXA 3BDPA 2B6AA 3V1RA 3L3UA 4W5TA 4CF1A 1EETA 4HCBA 2HVHA 1CXUA 2KFZA 4E7KA 4FW2A 1QHTA 1JLFA 3O3FA 3OS2A 4E7JA 3AVAA 1VSFA 3DLKA 4KV8A 4DSIA 3THVA 2JLEA 2VG7A 1VSMA 4F2SA 3L8BA 3LZIA 4CEBA 3ZSVA 3NCIA 4KI6A 1CZ9A 2BANA 3NF7A 3QNOA 4DU1A 2YNGA 1IO2A 5KGWA 3PUFA 4H8KA 4FK4A 3DLHA 3K5OA 1HYVA 1G15A 1TL1A 4W5OA 3LPUA 3L2VA 2G8VA 4Y1CA 3DRSA 1TL3A 1WSEA 3TAMA 4CK3A 1SKWA 1KFSA 4CJTA 1U04A 2VG5A 1TAUA 1BIZA 4B8AB 3G10A 3SQ4A 2D0BA 4DSLA 1NK7A 1B9FA 3HVTA 4O4GA 4UQGA 3DLEA 4HVJA 3NAEA 3BGRA 3VQ5A 4E1MA 3OYCA 3D0PA 3VA0A 4KHUA 5HRRA 2XO7A 1RTIA 1YTAA 4CK1A 3HSTB 3C94A 1BCMA 2HMIA 1D5AA 1TK8A 4M3RA 3DOKA 3K5MA 4JS4A 1RT7A 3DMJA 3OS0A 3U3YA 2HNZA 2XY8A 1RTDA 1CLQA 4FJKA 4RW4A 4PWDA 1HRHA 3OYIA 1WAFA 3VQBA 4CJLA 1X9MA 4J2BA 1FKOA 4KTZA 3NGZA 4CJSA 1GOCA 4IFYA 1CZBA 1VSIA 1JLQA 1T05A 1Q9XA 4DFJA 4K8XA 2FBXA 2HNYA 4CGDA 4M42A 1S1XA 5KTQA 3LP1A 4B9SA 4IG0A 2WONA 1BGXT 1Z26A 3OYFA 1L3UA 3RR8A 3B6PA 1RTHA 1Q8IA 3LP2A 2D5RA 1TKXA 3VQ9A 4N76A 3LANA 1K6YA 2F8TA 1HNVA 2G8WA 4CJWA 3HP6A 4DTJA 4CE9A 3KTQA 1LWFA 1RTJA 1VSKA 4CHZA 2XY6A 4C8OA 2G8HA 1QS4A 3LP3A 3LWMA 1S1UA 3AO3A 4F3TA 5J2QA 4DTPA 3AVLA 3PO5A 4CFDA 1KVCA 2OPSA 4OPKA 3LZJA 4E7LA 3RRHA 1C6VA 2OZMA 1A5VA 4DTOA 1WSJA 4I2QA 3OYDA 3QESA 4KB0A 4CEOA 4CGFA 2WOMA 4IFVA 4W5RA 3RRGA 5JS2A 4CK2A 3ZT2A 4ZHRA 4CJKA 2A1SA 2EX3A 2Z1IA 3NF8A 3VQEA 4KI4A 4CF8A 1NJZA 1REVA 1JLGA 3AVBA 5HRPA 3V1OA 3HVRA 4M3ZA 1IKYA 1BIUA 3VQAA 1RT5A 1YVUA 3I8DA 4CHOA 5E41A 4OLBA 3NDKA 4CFCA 3OYHA 3SPZA 1X9SA 2PYLA 2KZMA 4FZYA 1S1TA 4O5BA 4M41A 3QEIA 3M8RA 3C6TA 3ALYA 3SQ1A 4FK0A 2D0CA 2Z1HA 1QE1A 1VRTA 4B9TA 1C1CA 1S9EA 1I3AA 5J1EA 4G1QA 2AJQA 1TKTA 4CHQA 2A1RA 1ZBHA 3V1QA 2X74A 1RDCA 1BQMA 3RMBA 3ZSYA 2YNFA 1N5YA 1KLNA 3QEVA 4CJEA 4GMJB 5KRTA 1IKWA 1FK9A 3AO2A 4MQ3A 4B9NA 1CXQA 3PO4A 2HNDA 3EY1A 1RBVA 4BE1A 4FJLA 3VQ6A 3S3OA 3QNNA 4FLTA 3QINA 4ZTJA 3TARA 4B9LA 4KKOA 2IC3A 4KFBA 1U49A 2P51A 4M3YA 3DRRA 4E3SA 2P5OA 1DTQA 3DM2A 3NH0A 3KK2A 4DSJA 3V6DA 1NK6A 2KZZA 3EYZA 4DFKA 1HQUA 3I0RA 3P1GA 4LY7A 4M3XA 4E89A 3IAYA 2Y1JA 1GOBA 2VWKA 1NKCA 1TGOA 3NBPA 3OYAA 4ELVA 4FXDA 3ZSZA 3MAQA 3TAPA 3KD5E 4FJNA 3OYNA 2E6MA 3AVNA 4E19A 4Z4CA 3QO9A 4FM0A 3KKRA 1T8EA 3OYKA 2OYQA 4I9QA 4KHWA 4B9VA 3WNEA 2FBVA 2BE2A 2X78A 4LD0A 3S9HA 4E0DA 1J5OA 3SI6A 3HK2A 1UA1A 4CF2A 1C1AA 3OYJA 4BDPA 4Z4EA 3QEWA 4KHYA 3RWUA 2RPIA 2HHUA 3QIOA 4B9UA 3OY9A 3HO1A 1B9DA 4RW8A 3VQCA 1KSPA 4DU3A 5KI6A 2DTUA 4JLHA 3AA2A 4NCBA 4DSFA 3NF6A 4B8CA 2FBYA 1XC9A 1TK0A 3NGIA 2O4GA 5HROA 4PY5A 3PX0A 1NKBA 1LW0A 1LAVA 2IDOA 4KB1A 3T3FA 2Z1GA 2HHSA 3VQ7A 1BHLA 3AV9A 1LW2A 4CHPA 4O0IA 1EXQA 3KJVA 3F9KA 3LDSA 1KCFA 4BDYA 2E6LA 1EP4A 1TKDA 1U48A 4KTQA 3K5NA 1HYSA 3SYZA 3KK3A 4KTWA 1KLMA 3KLIA 3F73A 5JS1A 5CYMA 3DRPA 4I9LA 4NCGA 1KVBA 3LP0A 1KRPA 2KTQA 4AHUA 4C8NA 5FDLA 4O55A 4LSNA 3HPOA 4FZZA 1UA0A 4JRQA 1HYZA 2ZE2A 4Z4GA 4Z0UA 1RDAA 3A2FA 1BISA 2RF2A 1C0MA 3VQDA 2VWJA 4FLVA 3QEXA 4QOZB 1HNIA 3WNFA 4F2RA 1UWBA 1RCHA 2P1JA 3G0ZA 3JYTA 4FJXA 4ID5A 2ATQA 3AVKA 4KO0A 4Y1DA 1X1PA 4CERA 3AVHA 4CESA 3RR7A 5HBMA 4KHNA 3SUNA 4DSEA 1SUQA 3KKSA 4CGIA 3CQ8A 1NJYA 4DQSA 3DLGA 4DTMA 2OPPA 4OJRA 2G8UA 4KAZA 4DS4A 1S6QA 3ZT1A 4CJQA 3HM9A 4PUOA 4EZ6A 1JL1A 3I0SA 5T7BA 2GV9A 4FJJA 1JXBA 1DTTA 2QKKA 5HRNA 2OPQA 2JGUA 3HP9A 3ZSRA 2YKNA 2HHXA 2B5JA 1SKSA 1VSDA 1A5XA 1IH7A 4FLXA 3SZ2A 4RW9A 4L8RB 4DTRA 2LSNA 3V9WA 4FJ9A 3U6FA 3MXJA 4Q5VA 1XI1A 1J9AA 4J2EA 4J2DA 3QIPA 1JXEA 5FRMA 1U4BA 3K58A 4EP4A 4FJHA 1QSLA 2ZQBA 4FVMA 4DLEA 1RT4A 5HP1A 4DG1A 5J2PA 2HHQA 3LAMA 4CGJA 4HUFA 2HVIA 1LWEA 4CGHA 1GOAA 1EX4A 4BWJA 1IG9A 4YFUA 4OGCA 1L3SA 1RBRA 2G8KA 3DI6A 4E7HA 3SCXA 2EHGA 4E1NA 3V9ZA 3SUPA 5D3GA 2HB5A 4H4MA 5CY4A 1UOCA 3KD1E 3QETA 3RMCA 1A5WA 4CCHA 4HUGA 1RDBA 2ZD1A 3DLRA 1ITGA 3VA3A 3L2UA 1JLCA 2OPRA 2DFEA 2DFHA 2IAJA 3T19A 4N56A 3KLHA 3K57A 1SL2A 3E01A 5EU7A 1T03A 5KGXA 4QAGA 1Z25A 5C24A 3OS1A 3MEDA 3KLGA 4BWMA 1RBTA 5K14A 2HHWA 1QTMA 1HMVA 3H08A 2QKBA 4N41A 3KLFA 4N47A 2RKIA 1S1VA 1NJWA 4FLZA 2KW4A 4CF9A 1TK5A 1TVRA 5I3UA 4DMNA 1TKZA 4EP5A 1LWCA 3K59A 3QERA 1SV5A 5CYQA 4AHCA 4HTUA 3FFIA 2QK9A 2ETJA 4CGGA 4J2AA 3EZ5A 1JLAA 1IKXA 3KLEA 4DS5A 4FJMA 3MXMA 3NH2A 4CEQA 3NFAA 2KFNA 3VQ8A 2D0AA 4CJUA 3AA3A 3AO4A 3MECA 1RT1A 3VQ4A 3SV4A 4FM2A 4OKJA 3TAQA 3LAKA 3TAFA 1D8YA 4NCAA 1HJRA 3SV3A 2PY5A 2FBTA 3DOLA 2OA8A 3LPTA 4Q0BA 3OJSA 4FYDA 3M8QA 3NH1A 4BE0A 4CJPA 4CIEA 3CM5A 3NF9A 1ZBUA 1QSSA 3KIOA 4RW7A 3NGYA 4FM1A 3AO1A 3OYLA 4CEEA 4B9MA 4Z4IA 3ZT3A 2P5GA 3K5LA 1J53A 3DLBA 3TR8A 1WSGA 2DFFA 4NYNA 3CFPA 4KPYA 4I7FA 1YTUA 4DQRA 3ASMA 4FJ7A 3RMAA 2G8IA 5CZ2A 4F3OA 3V9SA 5HLFA 4KHSA 4HUEA 1S1WA 3SUQA 3TANA 3ZSWA 3NHGA 1VSEA 1VSLA 3C95A 3HYFA 2RN2A 3L2WA 1HPZA 5DMRA 4AILC 3P83D 3OVNA 1SL1A 1WSFA 4OKEA 1BQNA 1VSJA 4O0JA 4ELTA 2OZSA 4OPJA 4CJ4A 3B6OA 3HPHA 5KRSA 2BDPA 3LWLA 3AO5A 2HHVA 3SQ2A 3AVIA 5C25A 2R7YA 2XY7A 3TI0A 3MXIA 1FKPA 1LV5A 3AVJA 2ITGA 1R0AA 1VRUA 2VG6A 3O3HA 4CECA 1ZBIA 3RMDA 1JL2A 4FJ8A 1KFDA 4HHTA 2QXFA 3O4QA 4ZTFA 1SL0A 1QSYA 2BGGA 4HCCA 3CFRA 1RT2A 4AHRA 3L3VA 4FJ5A 4Z4FA 1WLJA 3VQQA 1J54A 1ASWA 1RNHA 4CJVA 3OYGA 2IOCA 3V9UA 3WNHA 1F21A 4GW6A 3SNNA 1JKHA 2KQ2A 3HL8A 3MEGA 4PQUA 4K8ZA 4CJ5A 1YT3A 2X6SA 1BI4A 4CJRA 4CHYA 4KHQA 1ASUA 1DLOA 4DFPA 5HRSA 3S3NA 1WSHA 4M3WA 4DU4A 1NK8A 1S9GA 4TSXA 4OLAA 1Y97A 2IS3A 4CIFA 3SPYA 1D9FA 4W5QA 3V4IA 1W9HA 2XY5A 4FLUA 2I5JA 4RG8A 4AH9A 5I42A 3QEPA 1JLBA 4CHNA 2IGIA 4OKKA 1T7PA 2GUIA 2F96A 5FROA 4DQPA 1NK9A 2X6NA 4CJ3A 3CM6A 4R5PA 1N6QA 4BACA 3UIQA 1WAJA 1NOYA 3M8PA 4KREA 3AVMA 2O4IA 1B92A 4AHSA 3L2QA 4DTSA 4FZXC 2YNHA 3ITHA 1L3TA 4Z4HA 3PX6A 4CEFA 4MFBA 3OYEA 3RTVA 2YNIA 3ZSQA 1KVAA 2YV0X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WN7 A;  4O44 A;  3M8S A;  2YHA A;  4ICL A;  5SWM A;  5FRN A;  4JS5 A;  3IS9 A;  4KRF A;  1W0H A;  4OVL A;  4FLW A;  4F8R A;  4FJG A;  3HJF A;  4CEA A;  1L3V A;  4CED A;  4DSK A;  1O1W A;  2F8S A;  3ZSX A;  1ASV A;  1RT6 A;  4FLY A;  5J2M A;  1NOZ A;  3ISN C;  3K2P A;  1XHX A;  3SQ0 A;  1TAQ A;  3QLH A;  4CFB A;  3PX4 A;  4ELU A;  4M3U A;  3OYB A;  2PZS A;  1C0U A;  3SJJ A;  2DY4 A;  4LSL A;  4LH5 A;  3HXM A;  4CJF A;  2XHB A;  3ULD A;  1U45 A;  1S6P A;  4DWI A;  1RIL A;  3U3G A;  4CIG A;  3AA5 X;  3AA4 A;  5SZT A;  4DFM A;  4DF4 A;  1NK4 A;  1HQE A;  1C0T A;  3ZSO A;  3PY8 A;  3VQP A;  3AVG A;  3V9X A;  4B08 A;  2PYJ A;  1RBS A;  1BI4 B;  3OYM A;  1IKV A;  4QCL A;  1I39 A;  1TV6 A;  4M3T A;  3T1A A;  4AHV A;  4DTN A;  1NK0 A;  3O4N A;  2Q3S A;  1RBU A;  1WNS A;  2XRI A;  5DK5 A;  1VSH A;  4F4K A;  1FXX A;  3ZT0 A;  4C8K A;  2G8F A;  4EZ9 A;  4H4O A;  4DTU A;  3CG7 A;  3O3G A;  3C6U A;  3AVC A;  4CEZ A;  1SKR A;  1C1B A;  4N5S A;  4CFA A;  3S3M A;  2YHB A;  4OGE A;  2HW3 A;  2B4J A;  5J2N A;  3V81 A;  4AHT A;  4E7I A;  4IG3 A;  3JSM A;  3IG1 A;  3KK1 A;  4DQQ A;  3SUO A;  3NE6 A;  1NK5 A;  4JRP A;  1LAW A;  4DF8 A;  3PV8 A;  1ZBL A;  2YKM A;  4BE2 A;  4GVM A;  1D9D A;  1KTQ A;  4B3O A;  3AVF A;  1ZBF A;  4YNQ A;  4PA1 A;  4FCY A;  2Y1I A;  3CFO A;  3CYM A;  3IRX A;  4IDK A;  3TAB A;  4FJI A;  3OJU A;  1EKE A;  1RT3 A;  1JLE A;  4M45 A;  3D45 A;  3TWH A;  3LAL A;  3TAG A;  1X9W A;  1Q9Y A;  1RDD A;  1MU2 A;  1NJX A;  3WNG A;  4ID1 A;  2NUB A;  4BDZ A;  3HPG A;  2FC0 A;  3MEE A;  3L2R A;  1BCO A;  4IBN A;  4CF0 A;  1U47 A;  1S5J A;  4I2P A;  4NYF A;  4FK2 A;  1BL3 A;  4FW1 A;  3VN5 A;  1NKE A;  4LH4 A;  2HHT A;  5CZ1 A;  1XWL A;  4DTX A;  4C8L A;  4RW6 A;  3ZT4 A;  3TAE A;  4C8M A;  1QQC A;  2Z1J A;  3P5J A;  1XHZ A;  4DQI A;  1WSI A;  1L5U A;  3HT3 A;  3DYA A;  1VK0 A;  2E4L A;  4XIU A;  2W42 A;  4WE1 A;  3ZCM A;  5C42 A;  4DLG A;  4IKF A;  4W5N A;  1ZYQ A;  2GBZ A;  1UAX A;  3BDP A;  2B6A A;  3V1R A;  3L3U A;  4W5T A;  4CF1 A;  1EET A;  4HCB A;  2HVH A;  1CXU A;  2KFZ A;  4E7K A;  4FW2 A;  1QHT A;  1JLF A;  3O3F A;  3OS2 A;  4E7J A;  3AVA A;  1VSF A;  3DLK A;  4KV8 A;  4DSI A;  3THV A;  2JLE A;  2VG7 A;  1VSM A;  4F2S A;  3L8B A;  3LZI A;  4CEB A;  3ZSV A;  3NCI A;  4KI6 A;  1CZ9 A;  2BAN A;  3NF7 A;  3QNO A;  4DU1 A;  2YNG A;  1IO2 A;  5KGW A;  3PUF A;  4H8K A;  4FK4 A;  3DLH A;  3K5O A;  1HYV A;  1G15 A;  1TL1 A;  4W5O A;  3LPU A;  3L2V A;  2G8V A;  4Y1C A;  3DRS A;  1TL3 A;  1WSE A;  3TAM A;  4CK3 A;  1SKW A;  1KFS A;  4CJT A;  1U04 A;  2VG5 A;  1TAU A;  1BIZ A;  4B8A B;  3G10 A;  3SQ4 A;  2D0B A;  4DSL A;  1NK7 A;  1B9F A;  3HVT A;  4O4G A;  4UQG A;  3DLE A;  4HVJ A;  3NAE A;  3BGR A;  3VQ5 A;  4E1M A;  3OYC A;  3D0P A;  3VA0 A;  4KHU A;  5HRR A;  2XO7 A;  1RTI A;  1YTA A;  4CK1 A;  3HST B;  3C94 A;  1BCM A;  2HMI A;  1D5A A;  1TK8 A;  4M3R A;  3DOK A;  3K5M A;  4JS4 A;  1RT7 A;  3DMJ A;  3OS0 A;  3U3Y A;  2HNZ A;  2XY8 A;  1RTD A;  1CLQ A;  4FJK A;  4RW4 A;  4PWD A;  1HRH A;  3OYI A;  1WAF A;  3VQB A;  4CJL A;  1X9M A;  4J2B A;  1FKO A;  4KTZ A;  3NGZ A;  4CJS A;  1GOC A;  4IFY A;  1CZB A;  1VSI A;  1JLQ A;  1T05 A;  1Q9X A;  4DFJ A;  4K8X A;  2FBX A;  2HNY A;  4CGD A;  4M42 A;  1S1X A;  5KTQ A;  3LP1 A;  4B9S A;  4IG0 A;  2WON A;  1BGX T;  1Z26 A;  3OYF A;  1L3U A;  3RR8 A;  3B6P A;  1RTH A;  1Q8I A;  3LP2 A;  2D5R A;  1TKX A;  3VQ9 A;  4N76 A;  3LAN A;  1K6Y A;  2F8T A;  1HNV A;  2G8W A;  4CJW A;  3HP6 A;  4DTJ A;  4CE9 A;  3KTQ A;  1LWF A;  1RTJ A;  1VSK A;  4CHZ A;  2XY6 A;  4C8O A;  2G8H A;  1QS4 A;  3LP3 A;  3LWM A;  1S1U A;  3AO3 A;  4F3T A;  5J2Q A;  4DTP A;  3AVL A;  3PO5 A;  4CFD A;  1KVC A;  2OPS A;  4OPK A;  3LZJ A;  4E7L A;  3RRH A;  1C6V A;  2OZM A;  1A5V A;  4DTO A;  1WSJ A;  4I2Q A;  3OYD A;  3QES A;  4KB0 A;  4CEO A;  4CGF A;  2WOM A;  4IFV A;  4W5R A;  3RRG A;  5JS2 A;  4CK2 A;  3ZT2 A;  4ZHR A;  4CJK A;  2A1S A;  2EX3 A;  2Z1I A;  3NF8 A;  3VQE A;  4KI4 A;  4CF8 A;  1NJZ A;  1REV A;  1JLG A;  3AVB A;  5HRP A;  3V1O A;  3HVR A;  4M3Z A;  1IKY A;  1BIU A;  3VQA A;  1RT5 A;  1YVU A;  3I8D A;  4CHO A;  5E41 A;  4OLB A;  3NDK A;  4CFC A;  3OYH A;  3SPZ A;  1X9S A;  2PYL A;  2KZM A;  4FZY A;  1S1T A;  4O5B A;  4M41 A;  3QEI A;  3M8R A;  3C6T A;  3ALY A;  3SQ1 A;  4FK0 A;  2D0C A;  2Z1H A;  1QE1 A;  1VRT A;  4B9T A;  1C1C A;  1S9E A;  1I3A A;  5J1E A;  4G1Q A;  2AJQ A;  1TKT A;  4CHQ A;  2A1R A;  1ZBH A;  3V1Q A;  2X74 A;  1RDC A;  1BQM A;  3RMB A;  3ZSY A;  2YNF A;  1N5Y A;  1KLN A;  3QEV A;  4CJE A;  4GMJ B;  5KRT A;  1IKW A;  1FK9 A;  3AO2 A;  4MQ3 A;  4B9N A;  1CXQ A;  3PO4 A;  2HND A;  3EY1 A;  1RBV A;  4BE1 A;  4FJL A;  3VQ6 A;  3S3O A;  3QNN A;  4FLT A;  3QIN A;  4ZTJ A;  3TAR A;  4B9L A;  4KKO A;  2IC3 A;  4KFB A;  1U49 A;  2P51 A;  4M3Y A;  3DRR A;  4E3S A;  2P5O A;  1DTQ A;  3DM2 A;  3NH0 A;  3KK2 A;  4DSJ A;  3V6D A;  1NK6 A;  2KZZ A;  3EYZ A;  4DFK A;  1HQU A;  3I0R A;  3P1G A;  4LY7 A;  4M3X A;  4E89 A;  3IAY A;  2Y1J A;  1GOB A;  2VWK A;  1NKC A;  1TGO A;  3NBP A;  3OYA A;  4ELV A;  4FXD A;  3ZSZ A;  3MAQ A;  3TAP A;  3KD5 E;  4FJN A;  3OYN A;  2E6M A;  3AVN A;  4E19 A;  4Z4C A;  3QO9 A;  4FM0 A;  3KKR A;  1T8E A;  3OYK A;  2OYQ A;  4I9Q A;  4KHW A;  4B9V A;  3WNE A;  2FBV A;  2BE2 A;  2X78 A;  4LD0 A;  3S9H A;  4E0D A;  1J5O A;  3SI6 A;  3HK2 A;  1UA1 A;  4CF2 A;  1C1A A;  3OYJ A;  4BDP A;  4Z4E A;  3QEW A;  4KHY A;  3RWU A;  2RPI A;  2HHU A;  3QIO A;  4B9U A;  3OY9 A;  3HO1 A;  1B9D A;  4RW8 A;  3VQC A;  1KSP A;  4DU3 A;  5KI6 A;  2DTU A;  4JLH A;  3AA2 A;  4NCB A;  4DSF A;  3NF6 A;  4B8C A;  2FBY A;  1XC9 A;  1TK0 A;  3NGI A;  2O4G A;  5HRO A;  4PY5 A;  3PX0 A;  1NKB A;  1LW0 A;  1LAV A;  2IDO A;  4KB1 A;  3T3F A;  2Z1G A;  2HHS A;  3VQ7 A;  1BHL A;  3AV9 A;  1LW2 A;  4CHP A;  4O0I A;  1EXQ A;  3KJV A;  3F9K A;  3LDS A;  1KCF A;  4BDY A;  2E6L A;  1EP4 A;  1TKD A;  1U48 A;  4KTQ A;  3K5N A;  1HYS A;  3SYZ A;  3KK3 A;  4KTW A;  1KLM A;  3KLI A;  3F73 A;  5JS1 A;  5CYM A;  3DRP A;  4I9L A;  4NCG A;  1KVB A;  3LP0 A;  1KRP A;  2KTQ A;  4AHU A;  4C8N A;  5FDL A;  4O55 A;  4LSN A;  3HPO A;  4FZZ A;  1UA0 A;  4JRQ A;  1HYZ A;  2ZE2 A;  4Z4G A;  4Z0U A;  1RDA A;  3A2F A;  1BIS A;  2RF2 A;  1C0M A;  3VQD A;  2VWJ A;  4FLV A;  3QEX A;  4QOZ B;  1HNI A;  3WNF A;  4F2R A;  1UWB A;  1RCH A;  2P1J A;  3G0Z A;  3JYT A;  4FJX A;  4ID5 A;  2ATQ A;  3AVK A;  4KO0 A;  4Y1D A;  1X1P A;  4CER A;  3AVH A;  4CES A;  3RR7 A;  5HBM A;  4KHN A;  3SUN A;  4DSE A;  1SUQ A;  3KKS A;  4CGI A;  3CQ8 A;  1NJY A;  4DQS A;  3DLG A;  4DTM A;  2OPP A;  4OJR A;  2G8U A;  4KAZ A;  4DS4 A;  1S6Q A;  3ZT1 A;  4CJQ A;  3HM9 A;  4PUO A;  4EZ6 A;  1JL1 A;  3I0S A;  5T7B A;  2GV9 A;  4FJJ A;  1JXB A;  1DTT A;  2QKK A;  5HRN A;  2OPQ A;  2JGU A;  3HP9 A;  3ZSR A;  2YKN A;  2HHX A;  2B5J A;  1SKS A;  1VSD A;  1A5X A;  1IH7 A;  4FLX A;  3SZ2 A;  4RW9 A;  4L8R B;  4DTR A;  2LSN A;  3V9W A;  4FJ9 A;  3U6F A;  3MXJ A;  4Q5V A;  1XI1 A;  1J9A A;  4J2E A;  4J2D A;  3QIP A;  1JXE A;  5FRM A;  1U4B A;  3K58 A;  4EP4 A;  4FJH A;  1QSL A;  2ZQB A;  4FVM A;  4DLE A;  1RT4 A;  5HP1 A;  4DG1 A;  5J2P A;  2HHQ A;  3LAM A;  4CGJ A;  4HUF A;  2HVI A;  1LWE A;  4CGH A;  1GOA A;  1EX4 A;  4BWJ A;  1IG9 A;  4YFU A;  4OGC A;  1L3S A;  1RBR A;  2G8K A;  3DI6 A;  4E7H A;  3SCX A;  2EHG A;  4E1N A;  3V9Z A;  3SUP A;  5D3G A;  2HB5 A;  4H4M A;  5CY4 A;  1UOC A;  3KD1 E;  3QET A;  3RMC A;  1A5W A;  4CCH A;  4HUG A;  1RDB A;  2ZD1 A;  3DLR A;  1ITG A;  3VA3 A;  3L2U A;  1JLC A;  2OPR A;  2DFE A;  2DFH A;  2IAJ A;  3T19 A;  4N56 A;  3KLH A;  3K57 A;  1SL2 A;  3E01 A;  5EU7 A;  1T03 A;  5KGX A;  4QAG A;  1Z25 A;  5C24 A;  3OS1 A;  3MED A;  3KLG A;  4BWM A;  1RBT A;  5K14 A;  2HHW A;  1QTM A;  1HMV A;  3H08 A;  2QKB A;  4N41 A;  3KLF A;  4N47 A;  2RKI A;  1S1V A;  1NJW A;  4FLZ A;  2KW4 A;  4CF9 A;  1TK5 A;  1TVR A;  5I3U A;  4DMN A;  1TKZ A;  4EP5 A;  1LWC A;  3K59 A;  3QER A;  1SV5 A;  5CYQ A;  4AHC A;  4HTU A;  3FFI A;  2QK9 A;  2ETJ A;  4CGG A;  4J2A A;  3EZ5 A;  1JLA A;  1IKX A;  3KLE A;  4DS5 A;  4FJM A;  3MXM A;  3NH2 A;  4CEQ A;  3NFA A;  2KFN A;  3VQ8 A;  2D0A A;  4CJU A;  3AA3 A;  3AO4 A;  3MEC A;  1RT1 A;  3VQ4 A;  3SV4 A;  4FM2 A;  4OKJ A;  3TAQ A;  3LAK A;  3TAF A;  1D8Y A;  4NCA A;  1HJR A;  3SV3 A;  2PY5 A;  2FBT A;  3DOL A;  2OA8 A;  3LPT A;  4Q0B A;  3OJS A;  4FYD A;  3M8Q A;  3NH1 A;  4BE0 A;  4CJP A;  4CIE A;  3CM5 A;  3NF9 A;  1ZBU A;  1QSS A;  3KIO A;  4RW7 A;  3NGY A;  4FM1 A;  3AO1 A;  3OYL A;  4CEE A;  4B9M A;  4Z4I A;  3ZT3 A;  2P5G A;  3K5L A;  1J53 A;  3DLB A;  3TR8 A;  1WSG A;  2DFF A;  4NYN A;  3CFP A;  4KPY A;  4I7F A;  1YTU A;  4DQR A;  3ASM A;  4FJ7 A;  3RMA A;  2G8I A;  5CZ2 A;  4F3O A;  3V9S A;  5HLF A;  4KHS A;  4HUE A;  1S1W A;  3SUQ A;  3TAN A;  3ZSW A;  3NHG A;  1VSE A;  1VSL A;  3C95 A;  3HYF A;  2RN2 A;  3L2W A;  1HPZ A;  5DMR A;  4AIL C;  3P83 D;  3OVN A;  1SL1 A;  1WSF A;  4OKE A;  1BQN A;  1VSJ A;  4O0J A;  4ELT A;  2OZS A;  4OPJ A;  4CJ4 A;  3B6O A;  3HPH A;  5KRS A;  2BDP A;  3LWL A;  3AO5 A;  2HHV A;  3SQ2 A;  3AVI A;  5C25 A;  2R7Y A;  2XY7 A;  3TI0 A;  3MXI A;  1FKP A;  1LV5 A;  3AVJ A;  2ITG A;  1R0A A;  1VRU A;  2VG6 A;  3O3H A;  4CEC A;  1ZBI A;  3RMD A;  1JL2 A;  4FJ8 A;  1KFD A;  4HHT A;  2QXF A;  3O4Q A;  4ZTF A;  1SL0 A;  1QSY A;  2BGG A;  4HCC A;  3CFR A;  1RT2 A;  4AHR A;  3L3V A;  4FJ5 A;  4Z4F A;  1WLJ A;  3VQQ A;  1J54 A;  1ASW A;  1RNH A;  4CJV A;  3OYG A;  2IOC A;  3V9U A;  3WNH A;  1F21 A;  4GW6 A;  3SNN A;  1JKH A;  2KQ2 A;  3HL8 A;  3MEG A;  4PQU A;  4K8Z A;  4CJ5 A;  1YT3 A;  2X6S A;  1BI4 A;  4CJR A;  4CHY A;  4KHQ A;  1ASU A;  1DLO A;  4DFP A;  5HRS A;  3S3N A;  1WSH A;  4M3W A;  4DU4 A;  1NK8 A;  1S9G A;  4TSX A;  4OLA A;  1Y97 A;  2IS3 A;  4CIF A;  3SPY A;  1D9F A;  4W5Q A;  3V4I A;  1W9H A;  2XY5 A;  4FLU A;  2I5J A;  4RG8 A;  4AH9 A;  5I42 A;  3QEP A;  1JLB A;  4CHN A;  2IGI A;  4OKK A;  1T7P A;  2GUI A;  2F96 A;  5FRO A;  4DQP A;  1NK9 A;  2X6N A;  4CJ3 A;  3CM6 A;  4R5P A;  1N6Q A;  4BAC A;  3UIQ A;  1WAJ A;  1NOY A;  3M8P A;  4KRE A;  3AVM A;  2O4I A;  1B92 A;  4AHS A;  3L2Q A;  4DTS A;  4FZX C;  2YNH A;  3ITH A;  1L3T A;  4Z4H A;  3PX6 A;  4CEF A;  4MFB A;  3OYE A;  3RTV A;  2YNI A;  3ZSQ A;  1KVA A;  2YV0 X; 
#chains in the Genus database with same CATH topology
 1WBB A;  2YHA A;  3UKR B;  1E3M A;  3IS9 A;  1NGE A;  5FPN A;  4CED A;  2DPN A;  4FLY A;  4EAH D;  3K9K A;  4IDH A;  1P8Z A;  1C0U A;  2PZS A;  2DY4 A;  2NLX A;  2IVN A;  1IG8 A;  5AQZ A;  4DWI A;  2PBD A;  1U6Z A;  3LM9 A;  3U3G A;  5SZT A;  4DF4 A;  1NWK A;  3AVG A;  1BI4 B;  4FPA A;  4H0X B;  4QCL A;  3ID6 A;  3I8B A;  4M63 C;  2PFU A;  3FZL A;  3BZC A;  4BGA A;  2HBM A;  5DK5 A;  4F4K A;  3ZT0 A;  5AZJ B;  5JLF A;  4LF8 K;  3AVC A;  3FR0 A;  3PIP L;  4AHT A;  2VCP A;  3NE6 A;  5M1P A;  2HBK A;  2CH5 A;  1D9D A;  4B3O A;  1KTQ A;  4H5T A;  2O8C A;  5LMN K;  4YNQ A;  4H5N A;  3ENO A;  5EOY A;  3CFO A;  3T69 A;  4CZK A;  3CYM A;  3IRX A;  3VF2 A;  1EKE A;  3GG4 A;  4IOX A;  3LAL A;  1RDU A;  4ID1 A;  2FC0 A;  3CQY A;  4CZI A;  4BRP A;  4FWL A;  5ADX A;  1S5J A;  4JI8 K;  4FK2 A;  1BL3 A;  3H6E A;  1X3N A;  5AQX A;  1XWL A;  4DTX A;  2Z1J A;  4DQI A;  1XHZ A;  1WSI A;  1GLL O;  1N36 K;  2E4L A;  4XIU A;  2FF6 A;  1C0G A;  3V1R A;  4CF1 A;  1CXU A;  4YOU A;  3OS2 A;  3CCV N;  1YXQ A;  3UKR A;  3VGM A;  4JAX A;  2VG7 A;  5AQJ A;  5M1Q A;  5AQG A;  1CZ9 A;  3VPZ A;  5M1K A;  4H8K A;  3K5O A;  3L2V A;  3LPU A;  3THX A;  1K8A O;  2QWP A;  1MWM A;  1XQS C;  1NG9 A;  1BIZ A;  1YJW N;  3SQ4 A;  1NK7 A;  1B9F A;  1R59 O;  3NAE A;  4NXM K;  3CMA N;  3RVC A;  1RTI A;  1YTA A;  4CK1 A;  1BCM A;  1BU6 O;  1D5A A;  3DOK A;  1N32 K;  4FWO A;  2QTD A;  3DMJ A;  1CLQ A;  3U3Y A;  2HNZ A;  3NMU A;  3WXM B;  1FW6 A;  3G71 N;  4A2A A;  4BGB A;  1WAF A;  3VQB A;  2BUP A;  4CJL A;  1X9M A;  3NGZ A;  4IFY A;  1CZB A;  2HNY A;  1S1X A;  5KTQ A;  3LP1 A;  3SAG A;  3R8E A;  4JV5 K;  4A62 A;  2Q97 A;  1Q8I A;  1TKX A;  4N76 A;  1SZ2 A;  1K6Y A;  3VEV A;  2F8T A;  2G8W A;  4CJW A;  3HP6 A;  3M6G A;  1RTJ A;  4V19 S;  2P9K A;  2QI2 A;  1U2V A;  4HTL A;  3SAF A;  5J2Q A;  4DV4 K;  2AA4 A;  4E7L A;  1SS6 A;  2OZM A;  1C6V A;  3H45 C;  4DTO A;  1WSJ A;  3OYD A;  1HX1 A;  4CGF A;  3ZYY X;  4IOA L;  2WOM A;  3RRG A;  2EX3 A;  3E66 A;  4FOE A;  3C7N B;  4NB4 A;  1NJZ A;  3O08 A;  1IKY A;  4B1Y B;  4FZY A;  1S1T A;  3QFU A;  3B8A X;  3EO3 A;  1VQL N;  4FK0 A;  2Z1H A;  1BG3 A;  1C1C A;  3I55 N;  2P9I A;  1TKT A;  5BPN A;  3QEV A;  1VQO N;  2P9L B;  5JVG L;  1IKW A;  3AO2 A;  4MQ3 A;  5IT9 O;  3PO4 A;  4QS9 A;  5CE3 A;  4BE1 A;  4JI4 K;  3R9P A;  4FJL A;  3VQ6 A;  1IBM K;  4FLT A;  4ZTJ A;  4B9L A;  2D0O A;  4KKO A;  2IC3 A;  3UKU A;  4E3S A;  3DM2 A;  4JI1 K;  3V6D A;  2KZZ A;  2GEL A;  4M3X A;  3DXK A;  4E89 A;  3IAY A;  1QZ6 A;  3C65 A;  2VWK A;  3VEO A;  4ELV A;  3TAP A;  3OYN A;  3AVN A;  2OYQ A;  4B9V A;  3WNE A;  2FBV A;  2BE2 A;  3M1F A;  3OYJ A;  4BDP A;  3RWU A;  1Q86 O;  4B9U A;  3MCP A;  2E20 A;  5DM7 L;  3OY9 A;  5C12 A;  4DU3 A;  4EHU A;  5MLC Q;  1QQM A;  4JLH A;  3SMP A;  4NCB A;  3DJC A;  4EFH A;  4JNE A;  4B8C A;  2FBY A;  4A59 A;  3NGI A;  4PY5 A;  2IDO A;  1BA1 A;  5GIN A;  4K41 A;  1LW2 A;  5E26 A;  3KJV A;  1KCF A;  3MWP A;  1M90 O;  4KTQ A;  2WUS A;  5AQL A;  3G4S N;  3KLI A;  5JS1 A;  3DRP A;  4I9L A;  4AHU A;  4LSN A;  4LF5 K;  3HPO A;  4FZZ A;  4JRQ A;  4IO9 L;  5M1F A;  3O4W A;  1RDA A;  2VWJ A;  1C0M A;  2P9L A;  4QS7 A;  3WNF A;  1UWB A;  2P1J A;  3G0Z A;  4ID5 A;  2ATQ A;  1VQK N;  5AQT A;  4DR1 K;  4KO0 A;  4JI7 K;  2UUB K;  3ZET B;  4CGI A;  4OJR A;  5BRE A;  3A5O C;  4DS4 A;  2VGM A;  3A5L C;  1ZC6 A;  5T7B A;  2QKK A;  4ILJ A;  3HP9 A;  2HHX A;  1IH7 A;  2LSN A;  3V9W A;  1J9A A;  3QIP A;  5LJV A;  1QQN A;  1GLC G;  4FJH A;  5EY4 A;  1GLE G;  4QS8 A;  2YI1 A;  4JK9 A;  4DG1 A;  4JKB A;  4OPA A;  3LAM A;  1KD1 O;  3ID8 A;  2CGJ A;  1LWE A;  1HLU A;  1GOA A;  4CGH A;  4BWJ A;  1IG9 A;  4JK7 A;  5AFU H;  3EE8 A;  2G8K A;  4E7H A;  3JXU A;  3SUP A;  3RMC A;  5C2F A;  1RDB A;  2UXC K;  3SJH A;  3O1B A;  2OPR A;  2DFE A;  3KZB A;  5LMU K;  2OTJ N;  1VAZ A;  1SL2 A;  1T03 A;  3O1W A;  3MED A;  4R79 A;  3AGR A;  4CZJ A;  2JWL A;  2RKI A;  1CZA N;  1V4S A;  4DV0 K;  4DR2 K;  1TKZ A;  4EP5 A;  3K59 A;  4AHC A;  4JKC A;  4DS5 A;  1JLA A;  3KLE A;  5C2D A;  4CJU A;  3O9R A;  3AA3 A;  2Q0U A;  3C0B A;  4B1U B;  1D8Y A;  3LPT A;  2E2P A;  3CPW M;  3NH1 A;  2W41 A;  4XH4 A;  1ZBU A;  3D2E B;  3OYL A;  3K5L A;  1J53 A;  3TR8 A;  1EWQ A;  4KPY A;  1T6C A;  3RMA A;  4F3O A;  4H03 B;  3SUQ A;  3TAN A;  3NHG A;  3C95 A;  1DKG D;  3K0S A;  3IMX A;  1OVY A;  3P83 D;  3GBT A;  3QFP A;  4OKE A;  1SL1 A;  1BQN A;  1K9M O;  4IOC L;  3ULE B;  2OZS A;  4OPJ A;  3B6O A;  4BRI A;  4CD1 A;  2BDP A;  3AGK A;  1VQM N;  4A57 A;  4CW7 B;  1R0A A;  4LFB K;  4MLH A;  5TKW A;  3FLC O;  4BQZ A;  3ZEU B;  2Q36 A;  3RMD A;  3DWL A;  1BO5 O;  2QXF A;  4ZTF A;  3BY5 A;  2NRR A;  3U9D A;  4AHR A;  3VQQ A;  1DEJ A;  1J54 A;  2OCE A;  3EE9 A;  5LY3 A;  3WT0 A;  4H0Y B;  2FSN A;  1JKH A;  2KQ2 A;  2VQE K;  2ASO A;  1WSH A;  4U7B A;  1BA0 A;  1S9G A;  3H1V X;  4TSX A;  4BRH A;  4LFC K;  2IS3 A;  3V4I A;  5C15 A;  2I5J A;  4RG8 A;  3LL3 A;  4YOT A;  4BC4 A;  1YIJ N;  3O8M A;  2X6N A;  2BH1 A;  3THW B;  1NOY A;  3J7Z O;  1B92 A;  4AHS A;  3L2Q A;  3CCU N;  1HPM A;  4MFB A;  2ASM A;  1XNR K;  3F5T A;  2YNI A;  3ZSQ A;  1KVA A;  1WN7 A;  4O44 A;  4CVN E;  3D2E A;  3M8S A;  2RE2 A;  4AM7 A;  4FWR A;  5SWM A;  4JS5 A;  5FRN A;  3GOI A;  4FLW A;  4FJG A;  3THY B;  4CEA A;  5F1X A;  1ASV A;  3A5N C;  1XHX A;  3SQ0 A;  4CFB A;  4M3U A;  3CCS N;  1MA9 B;  3HXM A;  4CJF A;  2XHB A;  3I33 A;  1U45 A;  1RIL A;  5BN8 A;  4L3Q A;  1NK4 A;  2O8B B;  1C0T A;  2IVO A;  5AQF A;  3V9X A;  4B08 A;  2PYJ A;  1RBS A;  3ULE A;  1IKV A;  2Q1N A;  5A2Q O;  1S72 N;  4JI0 K;  1RDW X;  4AHV A;  4DTN A;  4OO1 J;  1WNS A;  3CJ1 A;  1FXX A;  4C1N K;  3ZX0 A;  1SKR A;  3CI5 A;  1DGK N;  4N5S A;  2HW3 A;  3V81 A;  4E7I A;  4IG3 A;  3JSM A;  4G9Z A;  3IG1 A;  2YHX A;  4KHP K;  1NK5 A;  4JRP A;  3O9U A;  2YKM A;  3EEQ A;  1EQY A;  1T44 A;  3AVF A;  5DM6 L;  1HKB A;  4FCY A;  2Y1I A;  1NM1 A;  4IDK A;  1T3V A;  2A40 A;  3D2F A;  4K42 A;  1JLE A;  4M45 A;  3EKU A;  2P9N A;  1NJX A;  3SLC A;  4IBN A;  1U47 A;  4I2P A;  4NYF A;  4GV9 A;  4NXN K;  3VN5 A;  4LH4 A;  4C8L A;  3ZT4 A;  1KAY A;  3BEX A;  4Y0W A;  3HT3 A;  1VK0 A;  2W42 A;  4DLG A;  4W5N A;  1ZYQ A;  2GBZ A;  3J81 O;  3L3U A;  4B1W B;  4W5T A;  2HVH A;  5IWA K;  3A5M C;  1QHT A;  4FW2 A;  3O3F A;  3W0L A;  4E7J A;  4JI3 K;  3AVA A;  1VSF A;  5AQQ A;  1JCF A;  4DCH A;  2D0P A;  3NCI A;  4B1Z A;  4KI6 A;  5I9E B;  4DU1 A;  1FJG K;  1IO2 A;  4BC2 A;  3PUF A;  4K43 A;  3MN5 A;  2D4W A;  4BQL A;  3DLH A;  2HMP A;  1G15 A;  2G8V A;  4OPH A;  1TL3 A;  3HBT A;  1WSE A;  4CJT A;  1U04 A;  2O8C B;  1TAU A;  4B8A B;  3G10 A;  3F9M A;  1V4T A;  3HVT A;  4O4G A;  2YX6 A;  3DLE A;  4HVJ A;  3VA0 A;  3BGR A;  3OYC A;  1WB9 A;  3K9J A;  4KHU A;  3HST B;  4CBX A;  4WFB L;  2NZT A;  3LM2 A;  2UYT A;  3T1Y K;  2ZF5 O;  4BRG A;  4JS4 A;  2WC9 A;  4BY9 C;  3BF1 A;  2XY8 A;  1RTD A;  2O8F B;  1IBL K;  1HRH A;  4PKI A;  2P9S A;  1NGJ A;  4AQY K;  4CJS A;  1VSI A;  1JLQ A;  4GKJ K;  4MDB A;  4K8X A;  3CQX A;  4B9S A;  3P38 A;  4IG0 A;  4UY8 O;  2WON A;  1BGX T;  3B6P A;  3VQ9 A;  1OH8 A;  1HNV A;  4A5A A;  3KTQ A;  1QVF M;  1VSK A;  2ZWH A;  4B1X B;  3O9T A;  3HRG A;  4F3T A;  3CET A;  1KVC A;  3RRH A;  2QWL A;  4I2Q A;  3QES A;  2QWR A;  4KB0 A;  3THX B;  4IFV A;  4CK2 A;  4CJK A;  2A1S A;  3NF8 A;  4CF8 A;  1JLG A;  4OLB A;  3VQA A;  1YVU A;  3MN9 A;  3I8D A;  3EN9 A;  4CHO A;  4IEE A;  2FXU A;  2PYL A;  4FWQ A;  5FPE A;  4JKF A;  2NRW A;  4J8F A;  2KZM A;  4O5B A;  3TTF A;  3BZK A;  2YJF A;  3ALY A;  4O8U A;  3SQ1 A;  3C6A A;  3A8Y A;  1YJN N;  1VRT A;  2AP1 A;  5J1E A;  1S9E A;  1ILY A;  1YUW A;  2X74 A;  3ZSY A;  1N5Y A;  4CJE A;  1FK9 A;  5GIP A;  3QB0 A;  2HND A;  3J7Y P;  1J5E K;  3E9P A;  1E4F T;  3S3O A;  1KAZ A;  1NGA A;  3TAR A;  1U49 A;  4BRO A;  1Z6R A;  2P51 A;  3QBW A;  4BVO A;  1NK6 A;  3EYZ A;  3I0R A;  2P9K B;  1U2V B;  3MX5 A;  4CI6 A;  1GOB A;  2O8F A;  1TGO A;  3MX2 A;  4H0P A;  4A5B A;  2E6M A;  3QO9 A;  4FM0 A;  3OYK A;  2CGL A;  2J4R A;  2X78 A;  3S9H A;  3CJ9 A;  5C10 A;  2YHW A;  3HK2 A;  2GUP A;  1QQO A;  1OH5 A;  3TSQ A;  3OW2 M;  1ATS A;  5HL7 L;  1W97 L;  2DTU A;  1S22 A;  3NF6 A;  5AQP A;  5JIC A;  5GIO A;  2P9I B;  4IFE A;  4C23 A;  2WFB A;  4B3S K;  4KB1 A;  4K0K K;  4LC9 B;  1GLA G;  3VQ7 A;  1BHL A;  4JYA K;  4CZF A;  5CHI A;  4O0I A;  1EP4 A;  4M7Y A;  3HOT A;  3BP8 A;  4H5V A;  3FZM A;  1HUX A;  1HYS A;  3P39 A;  3UKU B;  3SYZ A;  3CIP A;  2YCH A;  3DXK B;  3E9O A;  4C8N A;  2ZGZ A;  3N4Q A;  1OVQ A;  4BC3 A;  4Z0U A;  5EX5 A;  4FLV A;  3QEX A;  4QOZ B;  3SMS A;  4F2R A;  1HNW K;  4LF6 K;  3VES A;  1I94 K;  3JYT A;  1VQ9 N;  2CGK A;  4AF1 A;  4CER A;  3AVH A;  4CES A;  5HBM A;  4KHN A;  3SUN A;  1SUQ A;  1XUP O;  3CQ8 A;  3LDO A;  4KAZ A;  4JD2 B;  1HNZ K;  2G8U A;  1S6Q A;  5KPT A;  3ZT1 A;  5EXW A;  4PUO A;  1JL1 A;  2GV9 A;  4O8K A;  4KH4 A;  5HRN A;  5KQ8 A;  1VSD A;  1A5X A;  4L8R B;  5JMV A;  4X64 K;  4FJ9 A;  4Q5V A;  3ZLJ A;  3SK3 A;  4J2E A;  1JXE A;  2O8E B;  1QSL A;  2EWS A;  3J8A A;  3VEW A;  5FPD A;  4I6M A;  2F4V K;  3CD6 N;  5HP1 A;  2Q31 A;  5J2P A;  5AQO A;  5HOO A;  4DR4 K;  3SCX A;  4E1N A;  4H4M A;  3CCM N;  1J6Z A;  1UOC A;  3KD1 E;  1A5W A;  2E8A A;  3L4I A;  4HUG A;  4PHT X;  3DLR A;  4LF4 K;  5AQK A;  3T19 A;  3VEZ A;  2KLA A;  2I7N A;  4WQ5 A;  5C24 A;  3OS1 A;  4GY2 B;  4NLC A;  1X3M A;  1QTM A;  2HHW A;  2QKB A;  4N41 A;  3E1Y A;  4FSV A;  4CF9 A;  4K25 A;  1TK5 A;  2O8D B;  3EL2 A;  4WCE L;  5CYQ A;  4HTU A;  3FFI A;  4MO4 A;  1QVG M;  3O6W A;  4DV1 K;  3NFA A;  1GLJ O;  4BR7 A;  3VQ8 A;  4GVE A;  1ATN A;  4OKJ A;  3TAQ A;  2PY5 A;  2FBT A;  3DOL A;  3FZF A;  4CJP A;  4CIE A;  4LFA K;  3KIO A;  4RW7 A;  2E5L K;  3NGY A;  4DV7 K;  3AO1 A;  4CEE A;  2P5G A;  3DLB A;  3IDH A;  1WSG A;  4XH5 A;  3CFP A;  4JD2 A;  4DQR A;  4FJ7 A;  1D4X A;  2G8I A;  3V9S A;  4HUE A;  3L2W A;  1HPZ A;  3H3O B;  2V52 B;  3OVN A;  1BOT O;  3N4P A;  1TUY A;  4O0J A;  2O8E A;  4CJ4 A;  3AO5 A;  2E88 A;  2VGN A;  3VER A;  4JKE A;  3AVI A;  2XY7 A;  3TI0 A;  1LV5 A;  3CC7 N;  2ITG A;  3R3L A;  1XMQ K;  1VRU A;  5LL6 Z;  1JL2 A;  4FJ8 A;  1KFD A;  4FWM A;  3O4Q A;  2BGG A;  4X62 K;  1RT2 A;  4CBW A;  4FJ5 A;  1WLJ A;  3A0I X;  1T6D A;  4CJV A;  3OYG A;  2IOC A;  2QW9 A;  3V9U A;  1F21 A;  4GW6 A;  5ELZ A;  1VQ8 N;  4CJR A;  3CC4 N;  4M3W A;  1NK8 A;  4GV3 A;  4MLE A;  2NRZ A;  2VQF K;  4OLA A;  3SBT A;  3SPY A;  3AY9 A;  4W5Q A;  1D9F A;  2XY5 A;  1OH7 A;  4DR6 K;  1RFQ A;  2O8D A;  4FLU A;  5I42 A;  4LF9 K;  4LF7 K;  3QEP A;  1JLB A;  2IGI A;  3R1X A;  2F96 A;  4DQP A;  3C6H A;  1NK9 A;  2E1Y A;  1N6Q A;  5BPM A;  4FZX C;  5AQN A;  1L3T A;  4CEF A;  3OYE A;  3CC2 N;  3FE1 A;  1L3U A;  4DKW A;  3Q7C A;  4BRQ A;  4YDU C;  4KRF A;  4OVL A;  2A42 A;  4F8R A;  2H3G X;  1G99 A;  1L3V A;  4DV2 K;  2F8S A;  3ZSX A;  4YHH K;  1H1V A;  5M1N A;  3K2P A;  3PX4 A;  4ELU A;  3SJJ A;  4CZE A;  4OX9 K;  4LSL A;  4LH5 A;  3ULD A;  4CIG A;  3AA4 A;  1Q82 O;  1HQE A;  3PY8 A;  3VQP A;  1TV6 A;  4M3T A;  5JVH L;  1GLF O;  4DR7 K;  1IBK K;  1RBU A;  2NNW A;  4DR3 K;  1VSH A;  4C8K A;  2G8F A;  4EZ9 A;  4KBO A;  3CG7 A;  3O3G A;  4CEZ A;  1C1B A;  4CFA A;  2YHB A;  3IFR A;  3OBY A;  5J2N A;  2FSJ A;  4B3R K;  1NMD A;  3KK1 A;  5C0Y A;  4JKG A;  4DF8 A;  1ZBL A;  3M3Z A;  4BE2 A;  4GVM A;  2JWK A;  1NBW A;  4WQ4 A;  1RT3 A;  3TAG A;  5F2R A;  3D45 A;  3TWH A;  3LDQ A;  3U9Z A;  1Q9Y A;  4IEI A;  1MU2 A;  4BDZ A;  3MEE A;  3L2R A;  1BCO A;  4CF0 A;  1OKJ A;  4FW1 A;  1NKE A;  4CZH A;  2P9U A;  4RW6 A;  1QQC A;  3EZW A;  4IKF A;  4WE1 A;  3ZCM A;  1UAX A;  1YHQ N;  1KQS M;  3WQT A;  4JN4 A;  3DLK A;  3CJ7 A;  3WEE B;  3AAP A;  1YVN A;  5BR9 A;  5AQU A;  2QM1 A;  2JLE A;  3P4I A;  1VSM A;  3L8B A;  4CEB A;  5AZI A;  3NF7 A;  2YNG A;  4BRC A;  3GL1 A;  5GAH P;  4W5O A;  4WFN L;  3DRS A;  3TAM A;  1WBD A;  3CF5 L;  3S41 A;  2VG5 A;  1NLV A;  2D0B A;  4RTF D;  4B3M K;  4DSL A;  4JI6 K;  2A5X A;  3VQ5 A;  4E1M A;  3CJA A;  1E4G T;  3D0P A;  5HRR A;  2XO7 A;  3D2F B;  4KH6 A;  2HMI A;  1TK8 A;  2P9N B;  3PSI A;  5BRD A;  2I7P A;  4DV5 K;  4YOR A;  4PWD A;  3OYI A;  2HOE A;  4J2B A;  1FKO A;  4KTZ A;  4CZL A;  4PKH A;  1ZBS A;  1GOC A;  5FPM A;  4YOW A;  4X66 K;  1T05 A;  2OAN A;  3G6E N;  4CGD A;  4M42 A;  2VYP A;  3SAH A;  1Z26 A;  3RR8 A;  3QBX A;  1RTH A;  2D5R A;  3LAN A;  2GEM A;  4DTJ A;  4CE9 A;  3DXM A;  2WTU A;  4M7X A;  4CHZ A;  3VTH A;  2XY6 A;  3LP3 A;  1S1U A;  3AO3 A;  4DTP A;  2QA4 N;  3AVL A;  3PO5 A;  4CFD A;  2OPS A;  4OPK A;  2KHO A;  3WXI A;  3MMV A;  4CEO A;  4A61 A;  5JS2 A;  4ZHR A;  3ZT2 A;  4ISG A;  3VQE A;  4KI4 A;  2QWM A;  1REV A;  3AVB A;  3HVR A;  3V1O A;  4M3Z A;  1TYQ B;  1BIU A;  1RT5 A;  3OYH A;  4U67 L;  3SPZ A;  1X9S A;  3D6R A;  2GWK A;  4M41 A;  3WEE A;  4EIA A;  3QEI A;  3M8R A;  3RSE B;  2UU9 K;  4MDA A;  1QE1 A;  5ADX H;  4G1Q A;  2P9S B;  1RDC A;  1BQM A;  3RMB A;  1KLN A;  2YNF A;  2HHH K;  1VQ4 N;  5AR0 A;  4GMJ B;  2P9P B;  1CXQ A;  1N33 K;  5BN9 A;  3QML A;  1GLB G;  3QIN A;  3U8X A;  4KFB A;  4M3Y A;  1JCE A;  1DTQ A;  2P5O A;  3KK2 A;  3PSF A;  5AFU A;  3L0Q A;  2F9T A;  3P1G A;  4LY7 A;  3J7A P;  1NKC A;  3OYA A;  3ZSZ A;  3F2K A;  3FZH A;  3VGL A;  1T8E A;  4KHW A;  4I9Q A;  1NU0 A;  2E2Q A;  4E0D A;  3T1H K;  4DR5 K;  1J5O A;  1Q7Y O;  3H46 O;  4CF2 A;  4Z4E A;  3GE1 A;  4BRD A;  3QEW A;  2HHU A;  3QIO A;  4GKK K;  4O5F A;  1B9D A;  4RW8 A;  4BRM A;  2UUC K;  2IIR A;  3WXK A;  3AA2 A;  4DV6 K;  1XC9 A;  1TK0 A;  2O4G A;  5HRO A;  3G25 A;  3PX0 A;  4X65 K;  1LW0 A;  3T3F A;  1M1K O;  2PAV A;  2ZGY A;  4BC5 A;  1YAG A;  4CJ7 A;  4CHP A;  3CXC M;  3CHW A;  1TYQ A;  4BDY A;  2E6L A;  1TKD A;  1U48 A;  2D1K A;  4KTW A;  4PKG A;  5AQS A;  1C0F A;  1LOT B;  3RSE A;  4YOY A;  4HWI A;  1KRP A;  4Z94 A;  2KTQ A;  4H0V B;  4WQ5 C;  3MK6 A;  1UA0 A;  5AQY A;  1HYZ A;  3KK7 A;  1BIS A;  3AAQ A;  2F7T A;  3LDP A;  2P9P A;  1NGG A;  1RCH A;  1HJO A;  4FVU A;  4Y1D A;  4CD3 A;  3HM8 A;  3RR7 A;  1VQN N;  4DSE A;  4DQS A;  5EVZ A;  2OPP A;  3CPE A;  4BRA A;  4CJQ A;  3TSP A;  4EZ6 A;  3HZ6 A;  3I0S A;  3MDQ A;  1JXB A;  2FLO A;  2OPQ A;  3ZSR A;  1SKS A;  4RW9 A;  1HKC A;  3M5R A;  3MXJ A;  1NGD A;  5FRM A;  3J80 O;  1YF5 L;  1U4B A;  4YY3 K;  2ZQB A;  4F9O A;  1RT4 A;  3KWG A;  2HHQ A;  1L3S A;  1RBR A;  2QWQ A;  3DI6 A;  5D3G A;  1EO1 A;  3V9Z A;  1QZ5 A;  2HB5 A;  3ZX3 A;  1ITG A;  1VQ7 N;  3VA3 A;  3L2U A;  1JLC A;  5TKY A;  4FO0 A;  2DFH A;  2IAJ A;  4DB3 A;  4N56 A;  3KLH A;  2HBL A;  3K57 A;  5AQI A;  3E01 A;  3DAW A;  1Z25 A;  1RBT A;  5K14 A;  1HMV A;  3H08 A;  3KWI A;  3GDQ A;  4N47 A;  1Q81 O;  3QIC A;  1Z05 A;  4FLZ A;  1EWR A;  1LWC A;  4JHD A;  3O80 A;  2ETJ A;  4CGG A;  4J2A A;  3EZ5 A;  1IKX A;  1HKG A;  3HSC A;  2ZJR L;  4CEQ A;  3VF4 A;  2KFN A;  2D0A A;  3AO4 A;  3VQ4 A;  3SV4 A;  3MN7 A;  3LAK A;  3TAF A;  4NCA A;  1HJR A;  3SV3 A;  2UXB K;  2OA8 A;  4Q0B A;  3M8Q A;  4I6M B;  2ZJP L;  1QSS A;  2Q0R A;  3E9L A;  3WXJ A;  1NGB A;  4B9M A;  3ZT3 A;  3CCL N;  4NYN A;  2YJE A;  5AQV A;  2NRH A;  3NVM A;  4BRK A;  5CZ2 A;  1K73 O;  1VSE A;  1VSL A;  2ASP A;  3HYF A;  3L4Q A;  3CME N;  5DMR A;  4DUY K;  1WSF A;  4RWT A;  5LJW A;  2HF4 A;  1VSJ A;  3OHR A;  4ELT A;  3HPH A;  3LWL A;  4H5W A;  2HHV A;  3ENB A;  3SQ2 A;  5C25 A;  2R7Y A;  4IO8 A;  1FKP A;  1NNE A;  3W3D A;  2VG6 A;  2GTD A;  3D7E O;  1HR0 K;  4HHT A;  1SL0 A;  1NGH A;  1QSY A;  3TSU A;  4HCC A;  3CFR A;  2E1Z A;  3L3V A;  4JI5 K;  4Z4F A;  3ATV A;  3SNN A;  3HL8 A;  1YT3 A;  2X6S A;  1BI4 A;  1ASU A;  4DFP A;  5HRS A;  3S3N A;  4CIF A;  2E2N A;  1KXP A;  1T7P A;  3QDK A;  1NGI A;  2GUI A;  5AZJ A;  1VQ6 N;  5FRO A;  3CM6 A;  4BAC A;  5BRH A;  4DTS A;  4WQ4 C;  4CZG A;  5BPL A;  4E1J A;  2UXD K;  3VTI A;  2YV0 X;  4CJ3 A;  3S3M A;  4ICL A;  1W0H A;  3HJF A;  4PL8 A;  4DSK A;  1O1W A;  1RT6 A;  5J2M A;  1NOZ A;  3VGK A;  2BTF A;  3ISN C;  5GAG P;  1TAQ A;  3QLH A;  3OYB A;  3MN6 A;  1S6P A;  4WYB A;  5AQR A;  3AA5 X;  4DFM A;  1BDG A;  3ZSO A;  1O13 A;  5AJ3 K;  3OYM A;  1WOQ A;  4FWN A;  2IVP A;  1I39 A;  1X9J A;  3T1A A;  1NK0 A;  3O4N A;  2Q3S A;  2QEX N;  2XRI A;  4JK8 A;  4H4O A;  4DTU A;  5KPR A;  3C6U A;  4OGE A;  2B4J A;  2V51 B;  4DQQ A;  3SUO A;  1LAW A;  3PV8 A;  4JKH A;  1BUP A;  2A6A A;  1ZBF A;  4IZ9 A;  5AQW A;  4PA1 A;  4KH5 A;  3TAB A;  4FJI A;  2ZM6 K;  3OJU A;  1X9W A;  5KPZ A;  1RDD A;  1GLD G;  1ZXO A;  3WNG A;  2NUB A;  3HPG A;  1DT9 A;  1S3X A;  3AAR A;  2HHT A;  5CZ1 A;  4YOX A;  4C8M A;  3TAE A;  3P5J A;  1L5U A;  3DYA A;  3LDN A;  5C42 A;  4BG9 A;  3BDP A;  2B6A A;  1EET A;  1VQ5 N;  2KFZ A;  4E7K A;  4ILH A;  1JLF A;  5KQD A;  3LDL A;  2ZJQ L;  4KV8 A;  4DSI A;  3THV A;  3VET A;  3VEN A;  4F2S A;  1Q18 A;  3LZI A;  1P90 A;  3ZSV A;  4FWP A;  4BR0 A;  2BAN A;  3QNO A;  1YJ9 N;  5KGW A;  4FK4 A;  1HYV A;  1TL1 A;  1N34 K;  4Y1C A;  2V7Y A;  4JKG B;  4CK3 A;  1SKW A;  4WF9 L;  1KFS A;  3C7N A;  4UQG A;  4BRL A;  3C94 A;  3WXL A;  4M3R A;  2F9W A;  3K5M A;  4YOV A;  4BVP A;  1RT7 A;  3OS0 A;  5BR8 K;  1SQK A;  4FJK A;  4RW4 A;  5GAE P;  2P9U B;  3UE5 A;  4WFA L;  1XNQ K;  2Q2R A;  1Q9X A;  4DFJ A;  3O9S A;  5E84 A;  2FBX A;  1Y64 A;  3OYF A;  3LP2 A;  3BF3 A;  4ILG B;  1W2B M;  1LWF A;  4C8O A;  2NRV A;  1QS4 A;  3LWM A;  5AZI B;  2E2O A;  5H1S Q;  3VEY A;  3IUC A;  4HCB A;  3LZJ A;  1A5V A;  4XH1 A;  4W5R A;  5CR4 A;  2Z1I A;  3VEX A;  3NVK A;  3IKM A;  5HRP A;  4JKA A;  3OBW A;  5E41 A;  3NDK A;  4CFC A;  4H0T B;  4IWV A;  2UUA K;  3TTC A;  3C6T A;  3Q7B A;  2D0C A;  4BR2 A;  4B9T A;  1I3A A;  2AJQ A;  4CHQ A;  3TU5 A;  2A1R A;  1ZBH A;  3V1Q A;  3CCQ N;  4CBU A;  5AQM A;  5KRT A;  1VQP N;  4B9N A;  3TTD A;  3CCR N;  3EY1 A;  1NGC A;  1RBV A;  3QNN A;  3O9Q A;  2FF3 B;  3DRR A;  3NH0 A;  4DSJ A;  3DXM B;  4BR5 A;  4H5R A;  3FGU A;  4JKD A;  4DFK A;  1HQU A;  2Y1J A;  4EHT A;  5M1O A;  3NBP A;  4FXD A;  3VOV A;  4BRN A;  3MAQ A;  3KD5 E;  4FJN A;  2G8H A;  4E19 A;  4Z4C A;  4FL9 A;  3KKR A;  3WQU A;  1XMO K;  4LD0 A;  4FWK A;  3SI6 A;  1UA1 A;  1C1A A;  3HTV A;  4KHY A;  2RPI A;  4IJA A;  3HO1 A;  4AM6 A;  3ZET A;  4ISF A;  3VQC A;  1W7A A;  1KSP A;  5KI6 A;  4BR4 A;  3FZK A;  3JS6 A;  4DSF A;  3SBG A;  2QWN A;  4JEP A;  3BUZ B;  1NKB A;  1LAV A;  3R6M A;  2Z1G A;  1ATR A;  2HHS A;  3AV9 A;  1EXQ A;  3F9K A;  3LDS A;  2W6K A;  1MWK A;  3K5N A;  4GV6 A;  3KK3 A;  3PLA A;  2A41 A;  1KLM A;  3F73 A;  5CYM A;  2ITM A;  4NCG A;  1KVB A;  3LP0 A;  2A3Z A;  1NMN A;  1K8K B;  5FDL A;  1YI2 N;  4O55 A;  3HOS A;  3ENH A;  3CJC A;  2ZE2 A;  4Z4G A;  2RF2 A;  3A2F A;  3VQD A;  4JI2 K;  4IXC A;  1HNI A;  2QXL A;  1TUU A;  1SAZ A;  4FJX A;  3AVK A;  1X1P A;  3KKS A;  1NJY A;  3H3N O;  3DLG A;  4DTM A;  2NRX A;  3HM9 A;  4FJJ A;  1DTT A;  1VHX A;  2JGU A;  2YKN A;  3HI0 A;  2B5J A;  4FLX A;  3SZ2 A;  2NRT A;  4DTR A;  3U6F A;  3FFK B;  3T7Z A;  1XI1 A;  4J2D A;  4A2B A;  3K58 A;  4EP4 A;  3ATU A;  3KVG A;  3U4L A;  4FVM A;  4DLE A;  3O5B A;  3OTO K;  4HUF A;  4CGJ A;  2HVI A;  1EX4 A;  2WBN A;  4YFU A;  4OGC A;  1JCG A;  2EHG A;  3CER A;  5CY4 A;  2RHK A;  3QET A;  2FSK A;  4CCH A;  3EKS A;  2ZD1 A;  5EU7 A;  3CCE N;  3JAM O;  5KGX A;  4QAG A;  3KLG A;  4BWM A;  1QHA A;  2HST A;  5BRF A;  3KLF A;  4XEI A;  1S1V A;  1NJW A;  2KW4 A;  1OH6 A;  3H1Q A;  1TVR A;  5JLH A;  4DMN A;  3I56 N;  5I3U A;  3QER A;  1SV5 A;  4NO7 A;  3CJB A;  2QK9 A;  3ZEU A;  4FJM A;  3MXM A;  4DUZ K;  3ZX2 A;  4B1V A;  3NH2 A;  1K8K A;  3UB5 A;  4DV3 K;  3MEC A;  1RT1 A;  4FM2 A;  4C1N I;  2W40 A;  3L6Q A;  3DLL L;  4FYD A;  3OJS A;  4BE0 A;  3CM5 A;  3NF9 A;  1WUA A;  1LCU A;  2W6L A;  4FM1 A;  4Z4I A;  4BR9 A;  1JJ2 M;  4PL7 A;  2DFF A;  4I7F A;  1YTU A;  3ASM A;  4BRF A;  4FOI A;  2OTL N;  4YDU A;  4IJN A;  5HLF A;  4KHS A;  1IJJ A;  1S1W A;  2KKZ A;  3ZSW A;  2HBJ A;  4GNI A;  2V7Z A;  4FPB A;  3THW A;  2RN2 A;  3P31 A;  3OA9 A;  2GWJ A;  4AIL C;  4NLB A;  1BWF O;  1KC8 O;  5KRS A;  1IV0 A;  2CH6 A;  5GAD P;  3MXI A;  2HF3 A;  3AVJ A;  5AQH A;  5FLX O;  4FWS A;  3THY A;  1NJI O;  2GX9 A;  4JHD B;  3O3H A;  4CEC A;  1ZBI A;  4ISE A;  4BG8 A;  4BRE A;  1HNX K;  4B3T K;  1ASW A;  1RNH A;  4RCH A;  3KHY A;  4H0O A;  3WNH A;  2O8B A;  3MEG A;  4PQU A;  1RGI A;  4K8Z A;  4CJ5 A;  3CCJ N;  4KHQ A;  4CHY A;  1DLO A;  4DU4 A;  2YHY A;  3VMF B;  4DQ8 A;  3VF6 A;  3PIO L;  1KAX A;  1Y97 A;  3TPQ A;  1W9H A;  5F0X A;  4AH9 A;  4B9Q A;  4CHN A;  4OKK A;  5B8H A;  1N8R O;  4MO5 A;  4R5P A;  4CZM A;  3UIQ A;  1WAJ A;  2VWB A;  1XC3 A;  3M8P A;  1MDU B;  4KRE A;  3AVM A;  2O4I A;  2YNH A;  3MCA B;  3ITH A;  3WUH A;  4Z4H A;  3PX6 A;  4DHY A;  1NGF A;  2QWO A;  3MWT A;  3RTV A;  1YIT N;  1ESV A; 
#chains in the Genus database with same CATH homology
 1WN7 A;  4O44 A;  3M8S A;  2YHA A;  4ICL A;  5SWM A;  5FRN A;  4JS5 A;  3IS9 A;  4KRF A;  1W0H A;  4OVL A;  4FLW A;  4F8R A;  4FJG A;  3HJF A;  4CEA A;  1L3V A;  4CED A;  4DSK A;  1O1W A;  2F8S A;  3ZSX A;  1ASV A;  1RT6 A;  4FLY A;  5J2M A;  1NOZ A;  3ISN C;  3K2P A;  1XHX A;  3SQ0 A;  1TAQ A;  3QLH A;  4CFB A;  3PX4 A;  4ELU A;  4M3U A;  3OYB A;  2PZS A;  1C0U A;  3SJJ A;  2DY4 A;  4LSL A;  4LH5 A;  3HXM A;  4CJF A;  2XHB A;  3ULD A;  1U45 A;  1S6P A;  4DWI A;  1RIL A;  3U3G A;  4CIG A;  3AA5 X;  3AA4 A;  5SZT A;  4DFM A;  4DF4 A;  1NK4 A;  1HQE A;  1C0T A;  3ZSO A;  3PY8 A;  3VQP A;  3AVG A;  3V9X A;  4B08 A;  2PYJ A;  1RBS A;  1BI4 B;  3OYM A;  1IKV A;  4QCL A;  1I39 A;  1TV6 A;  4M3T A;  3T1A A;  4AHV A;  4DTN A;  1NK0 A;  3O4N A;  2Q3S A;  1RBU A;  1WNS A;  2XRI A;  5DK5 A;  1VSH A;  4F4K A;  1FXX A;  3ZT0 A;  4C8K A;  2G8F A;  4EZ9 A;  4H4O A;  4DTU A;  3CG7 A;  3O3G A;  3C6U A;  3AVC A;  4CEZ A;  1SKR A;  1C1B A;  4N5S A;  4CFA A;  3S3M A;  2YHB A;  4OGE A;  2HW3 A;  2B4J A;  5J2N A;  3V81 A;  4AHT A;  4E7I A;  4IG3 A;  3JSM A;  3IG1 A;  3KK1 A;  4DQQ A;  3SUO A;  3NE6 A;  1NK5 A;  4JRP A;  1LAW A;  4DF8 A;  3PV8 A;  1ZBL A;  2YKM A;  4BE2 A;  4GVM A;  1D9D A;  1KTQ A;  4B3O A;  3AVF A;  1ZBF A;  4YNQ A;  4PA1 A;  4FCY A;  2Y1I A;  3CFO A;  3CYM A;  3IRX A;  4IDK A;  3TAB A;  4FJI A;  3OJU A;  1EKE A;  1RT3 A;  1JLE A;  4M45 A;  3D45 A;  3TWH A;  3LAL A;  3TAG A;  1X9W A;  1Q9Y A;  1RDD A;  1MU2 A;  1NJX A;  3WNG A;  4ID1 A;  2NUB A;  4BDZ A;  3HPG A;  2FC0 A;  3MEE A;  3L2R A;  1BCO A;  4IBN A;  4CF0 A;  1U47 A;  1S5J A;  4I2P A;  4NYF A;  4FK2 A;  1BL3 A;  4FW1 A;  3VN5 A;  1NKE A;  4LH4 A;  2HHT A;  5CZ1 A;  1XWL A;  4DTX A;  4C8L A;  4RW6 A;  3ZT4 A;  3TAE A;  4C8M A;  1QQC A;  2Z1J A;  3P5J A;  1XHZ A;  4DQI A;  1WSI A;  1L5U A;  3HT3 A;  3DYA A;  1VK0 A;  2E4L A;  4XIU A;  2W42 A;  4WE1 A;  3ZCM A;  5C42 A;  4DLG A;  4IKF A;  4W5N A;  1ZYQ A;  2GBZ A;  1UAX A;  3BDP A;  2B6A A;  3V1R A;  3L3U A;  4W5T A;  4CF1 A;  1EET A;  4HCB A;  2HVH A;  1CXU A;  2KFZ A;  4E7K A;  4FW2 A;  1QHT A;  1JLF A;  3O3F A;  3OS2 A;  4E7J A;  3AVA A;  1VSF A;  3DLK A;  4KV8 A;  4DSI A;  3THV A;  2JLE A;  2VG7 A;  1VSM A;  4F2S A;  3L8B A;  3LZI A;  4CEB A;  3ZSV A;  3NCI A;  4KI6 A;  1CZ9 A;  2BAN A;  3NF7 A;  3QNO A;  4DU1 A;  2YNG A;  1IO2 A;  5KGW A;  3PUF A;  4H8K A;  4FK4 A;  3DLH A;  3K5O A;  1HYV A;  1G15 A;  1TL1 A;  4W5O A;  3LPU A;  3L2V A;  2G8V A;  4Y1C A;  3DRS A;  1TL3 A;  1WSE A;  3TAM A;  4CK3 A;  1SKW A;  1KFS A;  4CJT A;  1U04 A;  2VG5 A;  1TAU A;  1BIZ A;  4B8A B;  3G10 A;  3SQ4 A;  2D0B A;  4DSL A;  1NK7 A;  1B9F A;  3HVT A;  4O4G A;  4UQG A;  3DLE A;  4HVJ A;  3NAE A;  3BGR A;  3VQ5 A;  4E1M A;  3OYC A;  3D0P A;  3VA0 A;  4KHU A;  5HRR A;  2XO7 A;  1RTI A;  1YTA A;  4CK1 A;  3HST B;  3C94 A;  1BCM A;  2HMI A;  1D5A A;  1TK8 A;  4M3R A;  3DOK A;  3K5M A;  4JS4 A;  1RT7 A;  3DMJ A;  3OS0 A;  3U3Y A;  2HNZ A;  2XY8 A;  1RTD A;  1CLQ A;  4FJK A;  4RW4 A;  4PWD A;  1HRH A;  3OYI A;  1WAF A;  3VQB A;  4CJL A;  1X9M A;  4J2B A;  1FKO A;  4KTZ A;  3NGZ A;  4CJS A;  1GOC A;  4IFY A;  1CZB A;  1VSI A;  1JLQ A;  1T05 A;  1Q9X A;  4DFJ A;  4K8X A;  2FBX A;  2HNY A;  4CGD A;  4M42 A;  1S1X A;  5KTQ A;  3LP1 A;  4B9S A;  4IG0 A;  2WON A;  1BGX T;  1Z26 A;  3OYF A;  1L3U A;  3RR8 A;  3B6P A;  1RTH A;  1Q8I A;  3LP2 A;  2D5R A;  1TKX A;  3VQ9 A;  4N76 A;  3LAN A;  1K6Y A;  2F8T A;  1HNV A;  2G8W A;  4CJW A;  3HP6 A;  4DTJ A;  4CE9 A;  3KTQ A;  1LWF A;  1RTJ A;  1VSK A;  4CHZ A;  2XY6 A;  4C8O A;  2G8H A;  1QS4 A;  3LP3 A;  3LWM A;  1S1U A;  3AO3 A;  4F3T A;  5J2Q A;  4DTP A;  3AVL A;  3PO5 A;  4CFD A;  1KVC A;  2OPS A;  4OPK A;  3LZJ A;  4E7L A;  3RRH A;  1C6V A;  2OZM A;  1A5V A;  4DTO A;  1WSJ A;  4I2Q A;  3OYD A;  3QES A;  4KB0 A;  4CEO A;  4CGF A;  2WOM A;  4IFV A;  4W5R A;  3RRG A;  5JS2 A;  4CK2 A;  3ZT2 A;  4ZHR A;  4CJK A;  2A1S A;  2EX3 A;  2Z1I A;  3NF8 A;  3VQE A;  4KI4 A;  4CF8 A;  1NJZ A;  1REV A;  1JLG A;  3AVB A;  5HRP A;  3V1O A;  3HVR A;  4M3Z A;  1IKY A;  1BIU A;  3VQA A;  1RT5 A;  1YVU A;  3I8D A;  4CHO A;  5E41 A;  4OLB A;  3NDK A;  4CFC A;  3OYH A;  3SPZ A;  1X9S A;  2PYL A;  2KZM A;  4FZY A;  1S1T A;  4O5B A;  4M41 A;  3QEI A;  3M8R A;  3C6T A;  3ALY A;  3SQ1 A;  4FK0 A;  2D0C A;  2Z1H A;  1QE1 A;  1VRT A;  4B9T A;  1C1C A;  1S9E A;  1I3A A;  5J1E A;  4G1Q A;  2AJQ A;  1TKT A;  4CHQ A;  2A1R A;  1ZBH A;  3V1Q A;  2X74 A;  1RDC A;  1BQM A;  3RMB A;  3ZSY A;  2YNF A;  1N5Y A;  1KLN A;  3QEV A;  4CJE A;  4GMJ B;  5KRT A;  1IKW A;  1FK9 A;  3AO2 A;  4MQ3 A;  4B9N A;  1CXQ A;  3PO4 A;  2HND A;  3EY1 A;  1RBV A;  4BE1 A;  4FJL A;  3VQ6 A;  3S3O A;  3QNN A;  4FLT A;  3QIN A;  4ZTJ A;  3TAR A;  4B9L A;  4KKO A;  2IC3 A;  4KFB A;  1U49 A;  2P51 A;  4M3Y A;  3DRR A;  4E3S A;  2P5O A;  1DTQ A;  3DM2 A;  3NH0 A;  3KK2 A;  4DSJ A;  3V6D A;  1NK6 A;  2KZZ A;  3EYZ A;  4DFK A;  1HQU A;  3I0R A;  3P1G A;  4LY7 A;  4M3X A;  4E89 A;  3IAY A;  2Y1J A;  1GOB A;  2VWK A;  1NKC A;  1TGO A;  3NBP A;  3OYA A;  4ELV A;  4FXD A;  3ZSZ A;  3MAQ A;  3TAP A;  3KD5 E;  4FJN A;  3OYN A;  2E6M A;  3AVN A;  4E19 A;  4Z4C A;  3QO9 A;  4FM0 A;  3KKR A;  1T8E A;  3OYK A;  2OYQ A;  4I9Q A;  4KHW A;  4B9V A;  3WNE A;  2FBV A;  2BE2 A;  2X78 A;  4LD0 A;  3S9H A;  4E0D A;  1J5O A;  3SI6 A;  3HK2 A;  1UA1 A;  4CF2 A;  1C1A A;  3OYJ A;  4BDP A;  4Z4E A;  3QEW A;  4KHY A;  3RWU A;  2RPI A;  2HHU A;  3QIO A;  4B9U A;  3OY9 A;  3HO1 A;  1B9D A;  4RW8 A;  3VQC A;  1KSP A;  4DU3 A;  5KI6 A;  2DTU A;  4JLH A;  3AA2 A;  4NCB A;  4DSF A;  3NF6 A;  4B8C A;  2FBY A;  1XC9 A;  1TK0 A;  3NGI A;  2O4G A;  5HRO A;  4PY5 A;  3PX0 A;  1NKB A;  1LW0 A;  1LAV A;  2IDO A;  4KB1 A;  3T3F A;  2Z1G A;  2HHS A;  3VQ7 A;  1BHL A;  3AV9 A;  1LW2 A;  4CHP A;  4O0I A;  1EXQ A;  3KJV A;  3F9K A;  3LDS A;  1KCF A;  4BDY A;  2E6L A;  1EP4 A;  1TKD A;  1U48 A;  4KTQ A;  3K5N A;  1HYS A;  3SYZ A;  3KK3 A;  4KTW A;  1KLM A;  3KLI A;  3F73 A;  5JS1 A;  5CYM A;  3DRP A;  4I9L A;  4NCG A;  1KVB A;  3LP0 A;  1KRP A;  2KTQ A;  4AHU A;  4C8N A;  5FDL A;  4O55 A;  4LSN A;  3HPO A;  4FZZ A;  1UA0 A;  4JRQ A;  1HYZ A;  2ZE2 A;  4Z4G A;  4Z0U A;  1RDA A;  3A2F A;  1BIS A;  2RF2 A;  1C0M A;  3VQD A;  2VWJ A;  4FLV A;  3QEX A;  4QOZ B;  1HNI A;  3WNF A;  4F2R A;  1UWB A;  1RCH A;  2P1J A;  3G0Z A;  3JYT A;  4FJX A;  4ID5 A;  2ATQ A;  3AVK A;  4KO0 A;  4Y1D A;  1X1P A;  4CER A;  3AVH A;  4CES A;  3RR7 A;  5HBM A;  4KHN A;  3SUN A;  4DSE A;  1SUQ A;  3KKS A;  4CGI A;  3CQ8 A;  1NJY A;  4DQS A;  3DLG A;  4DTM A;  2OPP A;  4OJR A;  2G8U A;  4KAZ A;  4DS4 A;  1S6Q A;  3ZT1 A;  4CJQ A;  3HM9 A;  4PUO A;  4EZ6 A;  1JL1 A;  3I0S A;  5T7B A;  2GV9 A;  4FJJ A;  1JXB A;  1DTT A;  2QKK A;  5HRN A;  2OPQ A;  2JGU A;  3HP9 A;  3ZSR A;  2YKN A;  2HHX A;  2B5J A;  1SKS A;  1VSD A;  1A5X A;  1IH7 A;  4FLX A;  3SZ2 A;  4RW9 A;  4L8R B;  4DTR A;  2LSN A;  3V9W A;  4FJ9 A;  3U6F A;  3MXJ A;  4Q5V A;  1XI1 A;  1J9A A;  4J2E A;  4J2D A;  3QIP A;  1JXE A;  5FRM A;  1U4B A;  3K58 A;  4EP4 A;  4FJH A;  1QSL A;  2ZQB A;  4FVM A;  4DLE A;  1RT4 A;  5HP1 A;  4DG1 A;  5J2P A;  2HHQ A;  3LAM A;  4CGJ A;  4HUF A;  2HVI A;  1LWE A;  4CGH A;  1GOA A;  1EX4 A;  4BWJ A;  1IG9 A;  4YFU A;  4OGC A;  1L3S A;  1RBR A;  2G8K A;  3DI6 A;  4E7H A;  3SCX A;  2EHG A;  4E1N A;  3V9Z A;  3SUP A;  5D3G A;  2HB5 A;  4H4M A;  5CY4 A;  1UOC A;  3KD1 E;  3QET A;  3RMC A;  1A5W A;  4CCH A;  4HUG A;  1RDB A;  2ZD1 A;  3DLR A;  1ITG A;  3VA3 A;  3L2U A;  1JLC A;  2OPR A;  2DFE A;  2DFH A;  2IAJ A;  3T19 A;  4N56 A;  3KLH A;  3K57 A;  1SL2 A;  3E01 A;  5EU7 A;  1T03 A;  5KGX A;  4QAG A;  1Z25 A;  5C24 A;  3OS1 A;  3MED A;  3KLG A;  4BWM A;  1RBT A;  5K14 A;  2HHW A;  1QTM A;  1HMV A;  3H08 A;  2QKB A;  4N41 A;  3KLF A;  4N47 A;  2RKI A;  1S1V A;  1NJW A;  4FLZ A;  2KW4 A;  4CF9 A;  1TK5 A;  1TVR A;  5I3U A;  4DMN A;  1TKZ A;  4EP5 A;  1LWC A;  3K59 A;  3QER A;  1SV5 A;  5CYQ A;  4AHC A;  4HTU A;  3FFI A;  2QK9 A;  2ETJ A;  4CGG A;  4J2A A;  3EZ5 A;  1JLA A;  1IKX A;  3KLE A;  4DS5 A;  4FJM A;  3MXM A;  3NH2 A;  4CEQ A;  3NFA A;  2KFN A;  3VQ8 A;  2D0A A;  4CJU A;  3AA3 A;  3AO4 A;  3MEC A;  1RT1 A;  3VQ4 A;  3SV4 A;  4FM2 A;  4OKJ A;  3TAQ A;  3LAK A;  3TAF A;  1D8Y A;  4NCA A;  1HJR A;  3SV3 A;  2PY5 A;  2FBT A;  3DOL A;  2OA8 A;  3LPT A;  4Q0B A;  3OJS A;  4FYD A;  3M8Q A;  3NH1 A;  4BE0 A;  4CJP A;  4CIE A;  3CM5 A;  3NF9 A;  1ZBU A;  1QSS A;  3KIO A;  4RW7 A;  3NGY A;  4FM1 A;  3AO1 A;  3OYL A;  4CEE A;  4B9M A;  4Z4I A;  3ZT3 A;  2P5G A;  3K5L A;  1J53 A;  3DLB A;  3TR8 A;  1WSG A;  2DFF A;  4NYN A;  3CFP A;  4KPY A;  4I7F A;  1YTU A;  4DQR A;  3ASM A;  4FJ7 A;  3RMA A;  2G8I A;  5CZ2 A;  4F3O A;  3V9S A;  5HLF A;  4KHS A;  4HUE A;  1S1W A;  3SUQ A;  3TAN A;  3ZSW A;  3NHG A;  1VSE A;  1VSL A;  3C95 A;  3HYF A;  2RN2 A;  3L2W A;  1HPZ A;  5DMR A;  4AIL C;  3P83 D;  3OVN A;  1SL1 A;  1WSF A;  4OKE A;  1BQN A;  1VSJ A;  4O0J A;  4ELT A;  2OZS A;  4OPJ A;  4CJ4 A;  3B6O A;  3HPH A;  5KRS A;  2BDP A;  3LWL A;  3AO5 A;  2HHV A;  3SQ2 A;  3AVI A;  5C25 A;  2R7Y A;  2XY7 A;  3TI0 A;  3MXI A;  1FKP A;  1LV5 A;  3AVJ A;  2ITG A;  1R0A A;  1VRU A;  2VG6 A;  3O3H A;  4CEC A;  1ZBI A;  3RMD A;  1JL2 A;  4FJ8 A;  1KFD A;  4HHT A;  2QXF A;  3O4Q A;  4ZTF A;  1SL0 A;  1QSY A;  2BGG A;  4HCC A;  3CFR A;  1RT2 A;  4AHR A;  3L3V A;  4FJ5 A;  4Z4F A;  1WLJ A;  3VQQ A;  1J54 A;  1ASW A;  1RNH A;  4CJV A;  3OYG A;  2IOC A;  3V9U A;  3WNH A;  1F21 A;  4GW6 A;  3SNN A;  1JKH A;  2KQ2 A;  3HL8 A;  3MEG A;  4PQU A;  4K8Z A;  4CJ5 A;  1YT3 A;  2X6S A;  1BI4 A;  4CJR A;  4CHY A;  4KHQ A;  1ASU A;  1DLO A;  4DFP A;  5HRS A;  3S3N A;  1WSH A;  4M3W A;  4DU4 A;  1NK8 A;  1S9G A;  4TSX A;  4OLA A;  1Y97 A;  2IS3 A;  4CIF A;  3SPY A;  1D9F A;  4W5Q A;  3V4I A;  1W9H A;  2XY5 A;  4FLU A;  2I5J A;  4RG8 A;  4AH9 A;  5I42 A;  3QEP A;  1JLB A;  4CHN A;  2IGI A;  4OKK A;  1T7P A;  2GUI A;  2F96 A;  5FRO A;  4DQP A;  1NK9 A;  2X6N A;  4CJ3 A;  3CM6 A;  4R5P A;  1N6Q A;  4BAC A;  3UIQ A;  1WAJ A;  1NOY A;  3M8P A;  4KRE A;  3AVM A;  2O4I A;  1B92 A;  4AHS A;  3L2Q A;  4DTS A;  4FZX C;  2YNH A;  3ITH A;  1L3T A;  4Z4H A;  3PX6 A;  4CEF A;  4MFB A;  3OYE A;  3RTV A;  2YNI A;  3ZSQ A;  1KVA A;  2YV0 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...