4R5PA

Crystal structure of hiv-1 reverse transcriptase (rt) with dna and a nucleoside triphosphate mimic alpha-carboxy nucleoside phosphonate inhibitor
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
555
structure length
555
Chain Sequence
VPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTNSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 reverse transcriptase, p66 subunit
publication title Alpha-carboxy nucleoside phosphonates as universal nucleoside triphosphate mimics.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase, hydrolase/dna/inhibitor
total genus 150
structure length 555
sequence length 555
chains with identical sequence C
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2014-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4r5pA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4r5pA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4r5pA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4r5pA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4r5pA05
3V9WA 4GC6A 1NK9A 4OJRA 1N5YA 3OYFA 3G6XA 4IFVA 1VRUB 1RNHA 4EO6A 1T03B 1S1TB 1T3NA 3K5MA 2G8IA 4KHMA 4KO0A 4NLYA 5L1JA 1SH2A 2HNZB 1EKEA 3MR5A 1IKYA 3RAQA 4CIGA 2D7SA 1VSIA 1YVFA 3IN5A 2QKBA 4K4ZA 2VA2A 3HVWA 4ED8A 5HRNA 2X74A 1UAXA 5FRNA 3TAMB 5KRSA 1GX5A 1HPZB 3K5OA 4NLRA 3VQ6A 3CFRA 3Q8SB 3CDEA 2HNZA 3SI8A 1HYSB 5FROA 4KHQA 3NH1A 5KT4A 1IKXB 3S9HA 2W9AA 4ECRA 4DL6A 3HVRA 2F8TA 3GIIA 2BRKA 4CIEA 1HPZA 1NOYA 5KG2A 4CF9A 4W5RA 5JXSA 4J9KA 2AU0A 1HYSA 5KFPA 4KREA 2EX3A 1HNIB 2GIRA 1ZTTA 3DDKA 5I42A 1L3UA 4F2SA 3IS9B 4IDKB 1IKXA 3OYBA 1RTHB 1S1WA 4IFYA 1FXXA 4IR1A 4RW8B 4KE5A 4CEZA 1T8EA 1RT4B 1KHVA 2E9TA 4NLPA 4BE1A 4KPYA 3EZ5A 2QE5A 1TK5A 2IBKA 1U4BA 3OHBA 4CK2A 3LWMA 2GV9A 4EZ6A 4K4TA 4DQIA 1NKBA 1S5JA 3BQ0A 3IS9A 2VA3A 4IDKA 4IH5A 1RTHA 4F4YA 3EPGA 2E4LA 3DMJB 4RW8A 1VSJA 4W5QA 5T7BA 2HHTA 2OZSA 1KHWA 3SQ0A 1RT4A 4CHOA 2WCXA 3D0PA 3KMSA 3N6LA 1BCMA 3HKWA 3QESA 3ALYA 2WHOA 4CEEA 4FZYA 3DMJA 2KFZA 4MFBB 5KT7A 3NGDA 4IQXA 1I39A 3LANA 3ZSRA 1IH7A 3JYTA 5KFBA 2IC3A 5KGXA 1F21A 4TYAA 2Z1HA 4G1QB 4MFBA 3DI6B 5EWGA 3SUQA 4KHWA 3MF5A 4PY5A 4ZP9A 2R2SA 2FVCA 1DTQB 3HP6A 5KFMA 4B3OB 3MR6A 4J9NA 2UVVA 4JRPA 1BCOA 1BIUA 5EWEA 3CO9A 5FRMA 3NCIA 4G1QA 4HCBA 3DI6A 3S3NA 1QAIA 3T1AA 4R8UB 1QTMA 3D5MA 4BDPA 3EYZA 4ED6A 3F73A 4FZZA 3HM9A 1S0MA 1DTQA 2R8KA 1S1XB 4B3OA 4LSNB 2ILZA 1RBTA 1KFDA 2ZQBA 1I3AA 1TKZB 4EYIB 5L1LA 1NK4A 2Y1JA 4F50A 1KRPA 3PW2A 2XCPA 3OYIA 1BIZA 3VQSA 3KOAA 1WAJA 4LSNA 3AVBA 1OS5A 4M3WA 4ID1A 1TKZA 4CHQA 4F3TA 3CWJA 2P5OA 4CJKA 3C95A 3B6PA 4I7FB 2YNHB 3M8SA 4QPXA 3VQCA 2V0NA 3NF7A 4MQ3A 2B43A 4FK4A 4B9LA 1S9FA 1IKWB 3G6VA 4EYHB 2O5DA 2G8VA 3NH0A 3TAPA 4FW2A 1LWEB 1EXQA 4FBUA 1SL0A 1LW2A 4E7HA 4I7FA 2YNHA 4AHUA 2QKKA 4B8CA 4ZP7A 2JEJA 4B9VA 4KKOB 3SQ1A 3V6JA 3GQCA 4LQ3A 4QAGA 1IKWA 4DTNA 1ZBUA 1ZBFA 3ZSVA 4CECA 2KZZA 2D41A 1LWEA 3M9MB 4WZMA 4JV2A 4CF0A 3OYLA 4FJGA 2HHUA 4KKOA 3BSAA 4ZHRB 1C0TA 4WXWA 1KVBA 2KW4A 2FJVA 1SH0A 4KAZA 4NLTA 1S0OA 4CHYA 1JXLA 2I5JB 2OZMA 2QK9A 4KHRA 1ZBLA 3TQ1A 2PYLA 5J1EB 3OYNA 2OA8A 1S6QA 2BR0A 4URSA 3H08A 2J6UA 4HUFA 2DPJA 3P1GA 4DSKA 2EC0A 2AGPA 3M9OB 2FLPA 1BL3A 2AX1A 4YFUA 3L3UA 2I5JA 4HTUA 4NLSA 4O4RA 2DFEA 4CEDA 4MK7A 3HPHA 5L1KA 3C6UB 4WZQA 5J1EA 4CHNA 3M9NB 3OS0A 1VRTA 4FJJA 5F8IA 4N56A 5KFZA 4CCHA 4MIAA 3MEDB 2XY8A 4B9SA 3DYAB 3ASMA 4O4GA 1TAQA 3VQEA 1S0NA 1SKSA 3AO1A 3L3VA 3VQBA 4AHCA 2R2TA 5C25B 5F8LA 2ALZA 1JLAB 4DL7A 1MU2B 3FQLA 2VG6A 3NBPA 3MXMA 2FLNA 3MEDA 1G15A 1RBSA 1D5AA 2RN2A 2KFNA 3BJYA 4DL3A 4I2QB 1XR6A 3QIPA 5C25A 4NLDA 5T14A 4URQU 1FK9B 1MU2A 3G6YA 4E7IA 4ECSA 1WSEA 3NE6A 4KSEB 1RDAA 3I0RB 1IM4A 3KLVA 1RTDA 4IG3B 1QAJA 3QZ7A 5KFCA 1WSFA 4M95A 1C1CB 2X6NA 5KFQA 1UA1A 4WFYA 2YNFB 4TLRA 3CJ2A 2W9BB 5KT2A 1FK9A 5KG3A 3CM5A 3PR4A 4OPJA 5D3GB 3I0RA 4WFXA 5C42B 2YKNB 4ZTJA 2JEIA 2AJQA 1ITGA 1C1CA 1Z25A 2YNFA 2W9BA 3N6MA 4RW7B 3E51A 3KLHB 3AO5A 2AGQA 1NJZA 4Q8EA 4KHNA 5JUMA 4XIUA 5D3GA 4DSEA 2YNGB 2CKWA 5L1IA 3T19A 1NHVA 4OLAA 3AA2A 1LV5A 5F8HA 1BGXT 4FJHA 4DSFA 4RW7A 3OS2A 2IAJB 3KLHA 2HHQA 1RILA 4LSLB 3QEPA 2YNGA 4ID5B 4NLWA 4FJXA 1ZBHA 4J9SA 4CK3A 4CGJA 2HVIA 4ZMMA 3GILA 4K8ZA 1J5OB 1N56A 3GV5B 4FK2A 5KFKA 4FXDA 2IAJA 1YTUA 4LSLA 3CDUA 3V9SA 3KD1E 3PVXA 4B9NA 4ID5A 4DFPA 3PJWA 3SPZA 1HJRA 1SH3A 4PWDA 2OYQA 4DFJA 3KNAA 4FK0A 4U7CA 4CFDA 3OLAA 1S1UB 2QXFA 3RR8A 1VSMA 3NF6A 4E89A 3N6NA 1BISA 4FM2A 4FLYA 3AO4A 1LAVA 1SL1A 4WE1B 3G86A 3MAQA 2E6LA 5J2QB 2HHSA 3DRSB 3NKYA 5KRTA 1S1UA 4I2PB 1XI1A 3LPTA 4DG1B 1KCFA 4CERA 4IKFA 2P51A 3RRHA 4TY8B 3MTKA 3SJJA 4E1NA 3QGGA 4YMEA 2F96A 4WE1A 4DWIA 3CYMA 5SZTA 1KTQA 2IDOA 1U45A 5J2QA 2FLLA 5DMRA 1U09A 3DRSA 3AO2A 3KK2A 4CJPA 4DG1A 4B9MA 2UVRA 4ZP6A 1A5WA 1JXEA 2OPSB 2O4IA 1NK6A 1EETB 2AGOA 3K58A 2ATLA 3NAHA 3HHKA 4RUAA 4TQSA 4YR0A 1B9DA 4FJMA 3RMCA 2UUTA 4DTUA 2FVSA 4EP5A 4R5PA 1C0UB 4FW1A 3OYAA 1A5VA 3SI6A 4FJ7A 4KFBA 2W42A 5DG8A 2OPSA 1EETA 3KJVB 3FSIA 4DQQA 4DQSA 4K4SA 3SFGA 3AVHA 3IRXB 5F8JA 3NGYA 4CFCA 4IBNA 1TKXB 1JLEB 3D28A 1C0UA 4KI6A 4J2BA 4DLEA 4CESA 4K50A 3NF8A 4FLXA 4DL2A 4W5NA 2AWZA 4CGDA 3KJVA 4MIBA 5HLFB 2XY7A 3IRXA 4RW6B 4NRTA 2FJWA 3V1RA 4N47A 3V9UA 3TI0A 1JL1A 1TKXA 5DGAA 1JLEA 4DQRA 2VG5B 3I5CA 4JUZA 2R7YA 2RDIA 2R8HA 1I6JA 2XWYA 2G8HA 3LP1B 4DSIA 1VRUA 4DFKA 1RDBA 2DFFA 5HLFA 2HB5A 1T03A 1S1TA 3K57A 1DLOB 4H4MB 3ZT0A 4RW6A 1EP4B 1QUVA 2IMWP 2YHBA 1NJXA 3LDSA 2Z1IA 3KMQA 1BHLA 5F9LA 3FRZA 3GV8B 2HMIB 4AHSA 1RBRA 1TP7A 3OY9A 1C6VA 1S9EB 1JXBA 4FM1A 2JC1A 1TKTB 1DLOA 4H4MA 3TAMA 3H4BA 2WOMB 1VK0A 1D1UA 3I5AA 4N76A 1NJWA 4IRKA 2UVWA 1NHUA 4NCAA 1TQLA 1NKCA 4DS4A 2V4QA 2HMIA 2XGQA 1HQUB 2CJQA 3T5JA 5KG4A 2VG7B 1X9MA 1S9EA 4DLGA 4KRFA 1TKTA 4M3ZA 2XHBA 3QEXA 4XPCA 1JX4A 2WOMA 2XY6A 3IGNA 3UR0A 4I9QA 3V6DB 4Z0UA 3JSMB 3KLIB 2HHXA 1HNIA 1XR7A 3OL7A 3V9XA 1HNVB 4FLWA 3V6HA 1HQUA 4OGCA 2VG7A 4RNMA 2ASLA 1RBVA 2OH2A 1VSKA 5DG9A 2IA6A 1S9GB 3PHEA 3OSPA 3JSMA 3KLIA 5KFXA 2BQRA 2F8SA 2BANB 4CJSA 4YNQA 1EX4A 4NLQA 3OL9A 1R0AB 3BR9A 2J6TA 3KK1B 5KG5A 4ZTFA 4C8NA 3K59A 3P5JA 2BANA 3AO3A 3TABA 3AV9A 2A1SA 3F9KA 3VA3A 2VWJA 4BDZA 1R0AA 2Q3SA 4KHUA 1TGOA 3L2WA 3GIKA 2KQ2A 1D0EA 3KK1A 1XR5A 2JEGA 3G0ZA 4KAIA 3TANA 1CXQA 3L2RA 4O3SA 5HRRA 4FS2A 1B9FA 4IH6A 2KZMA 4F2RA 1HYZA 3QYYA 4ZVGA 1ZYQA 3KTQA 1TAUA 5KFHA 4CJQA 4CJVA 3I0SB 3UDLA 4Q45A 5F9NA 1XHXA 1B92A 3QNNA 3U3YA 4FJNA 4O3OA 3AVAA 4DTSA 1CZ9A 4J9QA 4CF1A 1KFSA 3BQ2A 1NKEA 4OL8A 2I1RA 4Y34A 1N48A 3ITHB 2HWIA 3SV4A 4CGHA 3I0SA 1NK5A 1REVB 5J2MB 1Q8IA 3RB0A 1NK0A 2IJNA 4YR3A 3AVCA 4R8UA 4FLVA 2ZD1B 4I9LA 4EBEA 4K8XA 1S1XA 1BQNB 3RB6A 5HRSA 4K4VA 1XC9A 4BWMA 4KHSA 3OL8A 3OJUA 4R0EA 5K14B 4NZ0A 4IRCA 3RTVA 1Q9XA 2ZD1A 1S49A 2W9CB 4O55A 1BQNA 4CFAA 2FVQA 2ASJA 4LH4A 3OJSA 4CJWA 3MEEB 3SUPA 5KFJA 5K14A 3DLKB 3P83D 4HKQA 2IS3A 1UOCA 3AA5X 4KHYA 2W9CA 3GIMA 4EBDA 4OKKA 1GOAA 1Y97A 3MR2A 3K2PA 2ATQA 3ISND 3QEWA 3CQ8A 2BGGA 2R2UA 3HPOA 2BDPA 3PO5A 4GW6A 4QWDA 2FVRA 4J2DA 3VQQA 1JLFB 4Y2AA 4BWJA 3S3MA 4Z4EA 4CF8A 2W7OA 3QO9B 4CIFA 4NCGB 4LD0A 4E0DA 3DLHA 3PZPA 4CHPA 5J2PB 4RU9A 4OLBA 5KFTA 3NGZA 1RT7B 1RT5B 4H4OB 3KK3B 2AQ4A 1KVAA 3AVFA 1JLFA 3OYKA 1YT3A 4OKJA 4C8OA 3NAEA 4ZHRA 4TQRA 3BSNA 1ASWA 3QO9A 4NCGA 1Z26A 1C0MA 1JKHB 3LP2B 4O3QA 4O3RA 3BDPA 1LWFB 4FLZA 3H5SA 5J2PA 4AHVA 1RT5A 4DTOA 1WAFA 4H4OA 3O4NA 3KK3A 3ZT4A 3NL0A 4ED3A 2WTFA 4UQGA 2X6SA 5L9XA 3CDWA 1RTJB 2JEFA 1FKOB 3SZ2A 2D5RA 1RYSA 2E9ZA 1JKHA 3LP2A 1HYVA 3VQ9A 1GX6A 1LWFA 4F4WA 3QINA 2E6MA 3C6UA 4PA1A 4NLUA 5EU7A 4H54A 1ZETA 4MK8A 1VSFA 2E9RX 2ITGA 4XO0A 1CLQA 3ISNC 3RMDA 3DYAA 3LAKA 4QWCA 2W7PA 2XY5A 3SPYA 4EO8A 3MXJA 4QWEA 1JLAA 3NAIA 2C22A 3GIJA 3U3GA 3ZSXA 3B6OA 4M41A 4NYFA 4AHRA 3MFHA 1N6QB 2GUIA 3IGVA 2C2DA 5EUHA 4W5OA 4ED7A 3AVLA 1T05B 4FZXC 4I2QA 1ZTWA 4DF8A 3AVJA 3VQAA 4EBCA 4JS5A 4MKBA 3LWLA 5FDLB 2D3UA 2FBTA 2FJXA 2FC0A 2YV0X 2D3ZA 2A1RA 3TAQA 1ASUA 3TVKA 5EWFA 2D0AA 2IM3A 3H40A 4GMJB 1N6QA 4CK1A 2B5JB 2B4JA 4E7KA 1T05A 3DRPB 4N5SA 3Q8QB 4IG3A 5FDLA 2YNIB 4ED0A 4M3XA 4FVMA 4ED1A 5KFRA 2JGUA 2D0BA 4RNFA 3HP9A 3S3OA 2HHWA 2B5JA 5C42A 2YKNA 4JS4A 2C28A 3PW4A 3HL8A 4W5TA 2YNIA 1RA6A 4ZPCA 3ZSOA 4NLVA 1HARA 2O4GA 4ZPBA 4KBIA 1NK7A 4CGGA 3THVA 2WB4A 2BE2B 1KLMB 2C2RA 3HYFA 3OYDA 3H98A 4KI4A 4DU1A 2RF2B 3CJ3A 1RAJA 3ZSWA 1D8YA 3E01B 3RRGA 3LP0B 1T94A 3TR8A 4DF4A 1RT6B 3OYEA 4M94A 2HNDB 2BE2A 5KFWA 1A5XA 1TK8A 1KLMA 3L8BA 4KTZA 2C2EA 3RWUA 1BQMB 2ASDA 1QQCA 4CHZA 3RR7A 3E01A 2G8WA 3HXMA 1WN7A 1J5OA 1ZBIA 1RT6A 5E41A 2IJFA 4HCCA 4IG0B 3SNNA 1SV5B 2HNDA 5KT6A 3VN5A 4J9MA 4CE9A 2XGPA 1VSDA 1JLQB 3VA0A 1TV6B 3HVTB 1TL3B 3PX4A 4QW9A 3AVMA 4BACA 1RTIB 5F8MA 1LWCB 1C1AA 5CY4A 4IG0A 1N4LA 1SV5A 2XI2A 4IRDA 4E3SA 3CFOA 3HSTB 3M8QB 3DOLB 3QLHB 1TKDA 3NDKA 4DEZA 1TV6A 3HVTA 1TL3A 3LZJA 1RCHA 3HJFA 4E1MA 4CJLA 4RW4B 2PZSA 1QS4A 4C8KA 1RTIA 1LWCA 4MH8A 3I8DA 4OVLA 4I2PA 1CSJA 1NNDA 3H4DA 4BDYA 4FJ8A 3VQ4A 4ECZA 3CJ5A 3L2VA 4TY8A 4QWAA 3DOLA 3VQ8A 3OYJA 3QLHA 3ULDA 3LP3A 4RG8A 3TARA 1VSLA 1U47A 1HQEB 5EDWA 3MR3A 4XPEA 4EP4A 4ZVFA 4RW4A 3KKRA 1U49A 4NLOA 5KI6A 3IAYA 4KB0A 3DLBA 4FLTA 1NOZA 4RNHA 3C94A 4JLHA 3CVKA 4B9UA 5F8NA 3QNOA 5HP1B 3HPGA 1HQEA 4QOZB 3NGIA 1RT2B 1JL2A 4NYNA 4FJIA 5DQGA 2PYJA 5HROB 3NMAA 1N5YB 4IH7A 1L3SA 4HUGA 4DSJA 4M45A 3PX6A 1IO2A 3BSCA 2FBYA 4BE0A 4DQPA 3TAEA 1RT2A 3PV8A 4E7LA 4Z4CA 4YQWA 4CJ5A 5HROA 4M3RA 1KLNA 1S6PB 3QGIA 2EHGA 4ECQA 2R8IA 4Q0BB 3T5KA 2JLEA 3CIZA 2VG5A 1JLGB 3LP1A 1S6PA 4B9TA 5HRPA 3T5HA 4OKEA 1EP4A 4M3YA 4ECWA 1KSPA 4Q0BA 2RKIB 5KFLA 3ZT1A 2G8UA 5KFNA 4K4UA 2W8LA 5KFIA 3BSOA 3I5BA 3KLFB 4NCBA 5I42B 3CM6A 5KG1A 3OL6A 1JLGA 1U48A 1S1WB 4IFYB 3AVKA 3DOKB 3VQDA 3O3HA 3PW7A 1RDCA 1U04A 4CFBA 2HHVA 5CYQB 2RKIA 1TL1B 5KG7A 2DY4A 1YVUA 4E7JA 1JIHA 3KLFA 4CEFA 3AA3A 2B6AB 5SWMA 3DOKA 5CZ2A 4FJKA 2OPRB 4O0IA 3UIQA 1FKPB 1QSYA 4CGIA 3KD5E 4FS1A 5CYQA 3V6DA 3CFPA 1TL1A 3PY8A 4J2AA 1X1PA 4FM0A 3QETA 2W8KA 3O3FA 4C8MA 4J9OA 1D9DA 1HNVA 4JRQA 1S10A 5KFSA 2G8FA 2B6AA 5I3UB 1ASVA 2OPRA 3RMBA 4KTWA 1FKPA 4CJ4A 3SQ2A 3QGHA 2RDJA 3WNHA 1S9GA 4ECYA 3FQKA 2GBZA 4DL5A 4IR9A 3JYTB 3H2LA 2IC3B 4IKAA 4BE2A 3H5UA 4FCYA 2DTUA 4AILC 4X2BA 5CYMB 5KG6A 3QERA 4ECVA 5I3UA 5KFAA 1VSHA 4Z4GA 4PUOB 1S97A 4DU3A 3PJXA 5DG7A 5KFFA 3MFIA 2JC0A 3EPIA 3M8PB 4CJ3A 1QHTA 5CYMA 1XHZA 1RT3B 3OLBA 4ZVHA 3AVGA 4CEAA 4J9RA 1JLBB 2X78A 2ZKUA 4PUOA 3WNEA 4QWBA 1QE1B 4TN2A 5KFUA 4F4XA 4H8KA 4AH9A 4DTPA 4ECUA 3SUOA 1K6YA 3OS1A 2XI3A 1HRHA 4N41A 4DTMA 3ZSZA 3RBEA 2V9WA 2YKMB 3DLEB 2D0CA 3OVNA 1LW0B 3M8PA 4JV0A 4ZVEA 4NYZA 4E19A 3ZCMA 1RT3A 2AX0A 4DSLA 2BQUA 1JLBA 3DLGB 1RA7A 4QCLA 3RMAA 1QE1A 4QW8A 4KV8B 1QSLA 2LSNA 2QV6A 2YKMA 3DLEA 1LW0A 2FBXA 5KTQA 2GC8A 1C2PA 3KLEB 3GV7B 2R8JA 4U6PA 3ITHA 1WSHA 2IM1A 4B08A 3PW5A 3DLGA 5KFDA 1GOCA 1REVA 5J2MA 4KV8A 3C6TB 4CEOA 2BRLA 4K4YA 4Y2CA 4DTXA 1VSEA 2HWHA 2F8EX 4OPKA 1SKWA 3KLEA 4O44B 3MEGB 3RB4A 4EEYA 4C8LA 2P1JA 4WXOA 4CGFA 1BI4B 3PO4A 3NHGA 3OHAA 2NUBA 1NJYA 3C6TA 5KT3A 3SCXA 1LW2B 3LPUA 1HMVB 3UPFA 4O44A 3MEGA 3V81B 4WFZA 4Q5VA 4ZP8A 4FYDA 4O5BA 2IGIA 3A2FA 3QIDA 3MEEA 1BI4A 3ICLA 4O3PA 3OYHA 3V1QA 3DLKA 1WSGA 1SKRA 3O4QA 3KKSA 5DGBA 3H5YA 1D9FA 4Y3CA 3KHHA 1HMVA 3QIOA 3OYMA 2FVPA 3V81A 1C0TB 4ELUA 4HHTA 4TYBA 2WRMA 4M3TA 1MMLA 4HUEA 3BREA 1LAWA 3RB3A 2UUWA 3PW0A 4O3NA 2FBVA 1S6QB 3Q8RB 3FFIB 2GIQA 1Q9YA 3MECB 4RW9B 4L8RB 3HO1A 2PY5A 1WLJA 4HVJA 4IOBA 3O3GA 5CZ1A 4Q44A 1RT7A 5KT5A 5DLFA 3FFIA 2Y1IA 3BGRB 1VRTB 3MECA 4K4XA 4RW9A 4DS5A 5JS2A 3V6KA 1JLCB 4ECTA 4DFMA 4NRUA 4O4GB 5HBMB 3MXIA 4DTJA 4GVMA 3U6FA 1K1SA 3VQ7A 3BGRA 4ED2A 2ILYA 3HT3A 1RTJA 1RT1B 2G8KA 1FKOA 2VG6B 3NBPB 3AA4A 4CJUA 3WNFA 4AHTA 4DL4A 1JLCA 4CJRA 4DU4A 4M42A 4F3OA 5HBMA 3NF9A 3QIPB 1S48A 3KIOA 2IM0A 3RBDA 1RDDA 2IOCA 3L2QA 1L3VA 2XRIA 1W25A 1RT1A 4CJTA 3PX0A 5C24B 3SQ4A 4URGA 1RTDB 4CEBA 4F4KA 2BQ3A 3V4IB 4NLGA 4CF2A 2DFHA 2OPQB 2RPIA 4FJ9A 4LQ9A 5C24A 3SUNA 4WYWA 4WYLA 1WNSA 2KTQA 3IG1B 3UQSA 3V4IA 2ETJA 4KB1A 1QSSA 3KHGA 1W0HA 4TXSA 1C1BB 2OPQA 3HVAA 3DLRA 1S4FA 5KFVA 1TVRB 3SV3A 2Z1GA 1NK8A 2Z1JA 3DRRB 4M3UA 3DRPA 3FDSA 4JV1A 4RUCA 4Y1CA 3K5LA 4DMNA 3TAFA 4CJEA 3IG1A 3OYCA 1WNEA 1WSJA 4FJ5A 3SFUA 3SYZA 5KFGA 3V1OA 1L3TA 3AVIA 1X9WA 1C1BA 1TVRA 3OSNA 1SL2A 1J9AA 3AVNA 3LZIA 3DRRA 5DLGA 2HAIA 3ZSYA 3QEVA 4KB7A 3QEIA 4GC7A 3KHRA 3H5XA 4PQUB 1UA0A 4J9PA 1W9HA 1TK0A 1RYRA 1X9SA 4J2EA 1S1VB 4TSXA 1RDRA 1XWLA 4Y1DA 2RF2A 4DTRA 1K1QA 3LP0A 4PWDB 4TY9A 3ZT2A 3HK2A 3EY1A 3D45A 4PQUA 4B8AB 5KGWA 5C5JA 3T5LA 1IG9A 3GYNA 4Q43A 1S1VA 2DPIA 3L2UA 4CEQA 1BQMA 1O1WA 4KTQA 3ZSQA 2ZE2B 4LH5A 1GOBA 5KG0A 2YHAA 4ICLB 4LY7A 4EZ9A 2J6SA 3ZT3A 1Z4UA 2VWKA 3M8RA 2R2RA 3EZUA 5KFYA 4RNNA 1RBUA 5J2NB 3T3FA 1UWBB 2UVUA 3RAXA 2IM2A 3CG7A 4F8RA 1YTAA 1JLQA 2ZE2A 4ZPAA 1KVCA 2HNYB 4Z4HA 4J9LA 1CXUA 3NFAA 1DTTB 2P5GA 4ICLA 4RNOA 3VQ5A 4FJLA 2HVHA 1CZBA 3KK2B 5J2NA 3TAGA 1UWBA 4FBTA 3K5NA 5DQHA 2V4RA 4O0JA 3TWHA 3M8QA 3LALA 2HNYA 5F8GA 4R5PB 3KLGB 4MK9A 4ZPDA 4HYKA 3Q8PB 1DTTA 4NLXA 2R8GA 5DQIA 1WSIA 4FLUA 4YP3A 3G10A 2WONB 1SUQB 4KFBB 3H59A 4F4ZA 2WK4A 4Z4FA 3VQPA 4ECXA 4OGEA 2OPPB 3DM2B 1IKVB 3OYGA 3NH2A 1J53A 3V9ZA 1J54A 3KLGA 5KFEA 4ELTA 4YR2A 4MKAA 4K4WA 5KFOA 2XC9A 2XO7A 1T7PA 4Z4IA 3BQ1A 2HW3A 2WONA 1SUQA 3CJ0A 4CJFA 4IFVB 3KHLA 2XCAA 1L5UA 3WNGA 3CJ4A 3PR5B 4G3IA 2OPPA 3DM2A 1IKVA 5JS1A 5DK5A 4KO0B 4RZRA 5HP1A 3QZ8A 3PUFA 3LAMA 4Q8FA 1IKYB 4ELVA
chains in the Genus database with same CATH superfamily
3V9WA 5D0RA 3G6XA 1NGFA 4OX9J 1S1TB 3T9ZA 4KHMA 4KO0A 3B8AX 3CI5A 2AJFE 1YJNS 3RAQA 1VSIA 2QKBA 4K4ZA 4L72B 2M70A 3HVWA 3PXGa 4USKA 1OIAA 1UAXA 2E7XA 3TAMB 1HPZB 3MM9B 4QZVB 3FK4A 3Q8SB 1KP6A 2R7OA 1HWJA 4BRIA 2HNZA 4C8YA 1HYSB 2K1RB 2HGLA 1FXDA 3I32A 4OZ0A 5FPNA 2C1EB 2Z56B 1R59O 3OR2B 4Q2LA 4LRBA 3A3OB 3OBWA 2BE7D 2XHWA 3L7PA 4CJ7A 4NYPA 3DDKA 5I42A 1L3UA 3IS9B 4U7UK 1IKXA 1CLFA 1FTCA 1RTHB 2VGMA 3OYBA 4IFYA 4GO7X 2ZOGA 4IR1A 4QIWD 3KFWX 1X5PA 1BO5O 1KHVA 4KPYA 3EZ5A 4L3NA 3LWMA 1NKBA 4RCHA 1F3FA 3BQ0A 3EPGA 2E4LA 1RWXB 1PYOB 2NREA 3DXBA 1J2VA 4OZ2A 4DPUA 4CHOA 1GEHA 3KMSA 4CM0A 3OTBA 2N82B 3ZTSA 3QESA 3ZLJA 1BQXA 2Y9HA 4U67Q 2WHOA 4CEEA 2KFZA 3ZETB 2M0GB 5DDRC 3G87A 1KONA 4UTGA 3CJ8A 3BV8A 3QNWB 4TYAA 2Z1HA 4EWTA 2VJUA 2FZCB 5AJ3F 1P27B 4KHWA 1SJFA 4LR9A 3JAMY 2FHMA 2CRLA 3W65A 2DO0A 3ET6B 3CO9A 1AB8A 1HD1A 1XMQJ 2I6WA 3T1AA 5GAHU 4ES3A 4DPXA 3EYZA 1GLBG 4FZZA 5CHCB 3HM9A 2R8KA 1PKUA 1S1XB 4OYIA 4BC3A 3GCWP 5M1QA 3UDVA 5KOXA 1I3AA 2P9IB 4EYIB 4H5WA 5L1LA 1TUYA 2HBZB 1VBZA 3HKZD 1HW9A 1KRPA 2WVDA 5C10A 2PIIA 2MQLA 2V4JB 3BF3A 4H0YB 3N9UC 4K0KJ 2APOA 4AQYJ 4FWSA 4PHTX 2P5OA 5DRKA 3VQCA 3NF7A 4MQ3A 2B43A 3L4QA 4FK4A 3LM2A 1NMDA 2WVCA 4HTIA 4CT9A 1IKWB 1S9FA 4DOZA 1HX1A 3CCVN 1U6BA 3DGVA 1LWEB 3K0JA 2YNHA 3L9ZA 2QKKA 4B8CA 2VJVA 4KKOB 3SQ1A 3P96A 3G4SN 5FPEA 3PEJA 3VTHA 3M7VA 4LQ3A 1DFDA 4M1KA 1W2IA 3ZSVA 2CPYA 1YKWA 4DR6J 2L3MA 1JB0C 4MYTA 4CF0A 4CO1A 1K8KA 1FDAA 2V69A 2DNZA 3O6QA 4XH1A 2VD3A 4GY2B 2RQMA 3UDEA 5AQZA 4DV4J 3M6VA 3FBCA 5E2QA 2FHOB 4UZBA 2PYLA 3OYNA 1NBEB 4CTAB 2FLOA 4BQLA 2HYIB 1IM6A 2J6UA 4DPTA 1U1KA 3P1GA 2QYGA 5K5MA 1Q5VA 2N7CA 5KPTA 4ISGA 1VC5A 2FLPA 3MI7X 1S7IA 2DNQA 4CEDA 3HPHA 3C6UB 2FC9A 2Z0GA 3VVUA 1TL7B 1VRTA 1IVZA 3OW2R 1XMQK 1MMNA 4RBVA 4MIAA 4QU7A 4B9SA 4M63C 4O4GA 2AT1B 3HDSA 1TAQA 3DHXA 3NEKA 1G3OA 2JZ5A 4WIQA 3AO1A 3WXJA 1BG3A 5IFMA 4E8UA 1JLAB 1WB9A 1UAWA 2HSEB 2HBMA 1PAUB 2R7VA 2KHCA 1WOQA 5HJYA 1AXQA 3WX4A 2O8BB 2MZSA 4I2QB 1EWQA 3LPYA 2ROGA 2Q0UA 5C25A 5T14A 1E6VA 1FK9B 1QUPA 1MU2A 4AQYK 4E7IA 2HVEA 4KSEB 1RDAA 1K8AO 3LO3A 1ZPWX 4W92B 1A0OB 3UDCA 1ZA1B 1RTDA 4K2XA 2BA9A 3QZ7A 4I67A 2HFZA 7AT1B 1YZ7A 5KFQA 3HZEA 4J5OA 3BN4A 4TLRA 5KT2A 1X4CA 3CM5A 3PR4A 1OH6A 1RB0A 4FNIA 5D3GB 1J5EJ 3I0RA 4WFXA 2YKNB 4ZTJA 2JEIA 3ETOA 2GVDB 1WC3A 2LEAA 3R3TA 5LMNF 2AZ3A 2GZOA 1ITGA 4B1XB 1C1CA 2VQEF 3E51A 4OYPA 2LXIA 3P5TL 3F9MA 4OLOA 4HTJA 5JUMA 2CKWA 2FY8A 5L1IA 4JEPA 4USVA 1YDLA 3AA2A 1GMUA 1MN7A 1LV5A 3BEXA 4EI2A 3L7UA 3L09A 3OS2A 4JHDB 2E1ZA 4DV4K 1RILA 3AAPA 4LSLB 1YG0A 3QEPA 2YNGA 2IY5B 3QAEA 2PFFB 4IYQA 4MYUA 2CDRB 4BR7A 4CK3A 1Q0NA 1N8RO 1VQ6S 2PFDA 5LL6Z 4ZMMA 3GILA 3R8YA 1J5OB 4YS2A 4FK2A 4FXDA 2HQIA 2WTUA 2BOAA 1HKAA 4DV2F 4ALZA 1U7LA 1SH3A 4PWDA 1MLAA 3GYGA 1PBAA 4JI3F 4DI6A 3CJSA 2ZH1A 1HBNA 1ZAXA 2VUGA 4FM2A 3SQGB 1VK3A 1IXKA 1HBMA 4PQAA 4XAKA 4WE1B 3O3LA 1DHMA 3D4JA 2HHSA 2MSTA 4WF9Q 1XI1A 1VIOA 5A6WA 4IKFA 1XJWB 4AXJA 3A13A 2NRTA 1IBMK 3W63A 2F96A 5DM6Q 3CYMA 4ZVSB 1UEKA 1KTQA 2BKOA 2IDOA 4LC9B 2JFKA 3AO2A 2O1PA 4I69A 4BR4A 5CYJA 4DG1A 2UVRA 2M3DA 1NK6A 3L0QA 3GE9A 2VC0A 1IN0A 3W5YA 3D2FB 3RMCA 4FJMA 5CE3A 2UUTA 4DTUA 3OYAA 5C2CA 1VI7A 1J5EK 2OP5A 5CA5A 1WC4A 4FJ7A 3IUCA 1QVFR 2OPSA 3W2WA 3KJVB 4DQSA 2KKHA 4K4SA 3SFGA 1M1KO 2OLWA 2EFVA 1S0VA 4OHZA 1GLDG 3NS6A 1TKXB 1JLEB 2XLKA 2CWXA 4DLEA 1FX4A 3S6EA 3MMCA 3MX5A 3NMRA 2DNPA 2AWZA 3CJ7A 1PBUA 4CGDA 4MIBA 3ILLA 1ZZNA 4FYWB 4RW6B 3QICA 4CI0B 4N47A 3TI0A 3V9UA 1OH7A 4DQRA 4B3RF 2MB0B 2R8HA 2JJ4D 4OYOA 3THWA 2ZZNA 1BUPA 1NZ8A 1BA0A 1VRUA 2CZVC 2CZ9A 1BWVA 2DFFA 1B99A 1T03A 3K57A 2BH1A 2ZJQQ 1DLOB 4H4MB 4GNIA 2J5AA 1EP4B 3CJAA 2MYFA 2VBXA 3T7ZA 1NJXA 5A2QY 1YBTA 2NYIA 2F7TA 1SC6A 1JXBA 4FM1A 4YN3B 3H4BA 4A8KA 3JSRA 2GO8A 3OFEA 2DHGA 2PI4A 1NJWA 3HSGA 4EFHA 3PYEA 1TQLA 4DS4A 2HMIA 1CJVB 5GMEA 2EI5A 2CJQA 1K47A 2VG7B 1X9MA 4DLGA 4KRFA 2QJ3A 1TKTA 3RW7A 2WOMA 3AQOA 1PJ5A 4Z0UA 2DITA 2ZH5A 1KAYA 1HNIA 5K8OA 1RK8A 5BPNA 3C65A 3V9XA 4YOEA 4PR6A 2DKOB 4YB1P 1HQUA 1ZAVA 1Q16B 2GGPA 3BGLA 5MLCV 4JYAF 3GE1A 5LMNJ 3OBYA 1S9GB 3PHEA 1J6ZA 3JSMA 3KLIA 1FRHA 3DLLQ 4JI1F 2F8SA 2BANB 4CJSA 4YNQA 1X31C 2KYXA 1GLJO 2NLWA 2GJIA 2DHSA 4H5VA 2NNWA 2KRBA 2P9KA 3LDLA 4U95A 4OZ3A 5D0GA 3VOVA 4V1Ak 2Q3PA 4A5AA 3AO3A 2ZBCA 1RAFB 1SJQA 2CG4A 2IVMA 3R2CJ 2IVNA 2Q3SA 2N7YA 3KUEA 2KQ2A 2JEGA 3KK1A 3G0ZA 3UE2A 1EB0A 3OA9A 5HRRA 3S01A 4FS2A 2YI1A 3CC2N 2ASOA 2QC3A 2VGNA 1HYZA 1SJ4P 3KTQA 4CJVA 3I0SB 3TP2A 3V5RA 1U25A 3A0IX 4B9QA 3U3YA 4BC2A 1S79A 4QS7A 1KFSA 2CJYB 1FDDA 2IVOA 2MKCA 1OPZA 3LTOA 2HOEA 1S4EA 3CC2S 4Y34A 2RE1A 3ITHB 2DRBA 3TSQA 1NK5A 3G82A 1REVB 1WEZA 3JQJA 3RB0A 4DJBA 4PG6A 2UU9K 4FLVA 2ZFHA 4IOCQ 3FZKA 3RB6A 5HRSA 4K4VA 3MGJA 4CM2A 4KHSA 2FHJA 4IUFA 4ZA1A 1I51B 4LBIA 3MPWA 3Q2SC 4IRCA 3RTVA 2XMTA 1WELA 1RWWB 1KC8T 2ASYA 2D0OA 5FPMA 2YPYA 4NZ7A 2F4VF 3NLCA 2ASJA 3MEEB 3SUPA 2YX4A 5AR0A 4LBPA 5H9EJ 4OFZA 3FGUA 3P83D 4HKQA 4KHYA 4OKKA 2KXHA 4S0MA 3EXCX 3J80Y 2HZCA 4FPRA 2CPXA 4USHA 2ATQA 3CQXA 2C2OB 3VF4A 1UEUA 4CQ1A 4H5TA 4OX6A 3UCGA 1WI6A 3J81U 3VQQA 4Y2AA 4CF8A 1F0XA 4NCGB 1WF2A 3PZPA 4CHPA 3NGZA 2OIHA 3NXZA 3KK3B 2AQ4A 3CCES 1KVAA 1JLFA 4B3RJ 1DZ5A 3SJHA 2CQ1A 2UXBK 2PI5A 4TQRA 3BSNA 1FO1A 1RJJA 1Z26A 5AFUH 1C0MA 1JKHB 3BDPA 3A8YA 1MWMA 3H5SA 3NMUA 3NL0A 4ED3A 1U1OA 2P9NA 3HX9A 1M1HA 5JMVA 3J8AA 1FT8A 2ZVIA 1K0TA 4P7VA 2ZEJA 2M52A 3CDWA 5EN1A 3PIOL 3LP2A 1LWFA 2AF6A 2RRNA 5DDOC 3QINA 3CCJS 1U1NA 3FBBA 1UJ6A 2P6TA 4GKJF 3EUNA 4PA1A 1H2VZ 3SXLA 1ZETA 1VSFA 4OYMA 2Z2YB 3Q2TC 5HOOA 1N33F 3CJBA 2UXDK 1TL4A 2HVZA 3DYAA 3LAKA 3MMBA 4ANDA 2AP6A 2PMWA 3KDNA 3TX8A 2LKZA 4AUKA 1X4EA 2R7UA 5B0BA 4FYVB 1UFLA 2C22A 1QJHA 1T9YA 2XSFA 4NYFA 4JYAJ 5EUHA 4A48A 2B4VA 5LT5A 1ZTWA 2FTRA 2BTFA 3VQAA 4MKBA 3CJKB 3BY5A 1PC5A 3TAQA 1ASUA 2PFUA 3WEEA 1SZ2A 2IM3A 4JKGA 4DV1K 4GMJB 5H9EK 2KT5A 3NOCA 4ER8A 1OVYA 4E7KA 1UZDA 3M2UA 1KBRA 4IG3A 3NWGA 3HHLB 3VHQA 1C0FA 2Y8WA 3GG4A 4M3XA 3G25A 2VBWA 2V2VA 1N34F 2ZNZA 4RNFA 3HP9A 2J4RA 2WBRA 5C42A 3I4HX 4JS4A 3D1HA 3PW4A 2XZWA 1U02A 1F2HA 4KC5A 4QR0A 3JB9k 5HI7A 4ZPCA 3ZSOA 3VF0B 3OD2A 4ZPBA 4A8FA 2ZKTA 4KBIA 4B1YB 4CGGA 3J7YI 3P5BP 4NMLA 2WB4A 3ZZPA 2A42A 3THTA 4KI4A 3HYFA 3HFZB 2YH0A 3TQEA 2DHAA 4NE9C 3K17A 3LP0B 3KNGA 4DPOA 4F7VA 4M94A 1FJCA 2RILA 5KFWA 4DV3J 4X4PA 3L8BA 2C2EA 2P9UA 3RWUA 5FLXY 2VPYB 1DURA 1UL3A 5IT9Y 3WZ0A 3J7A1 3EKUA 1RT6A 3T1HF 3A5LC 4HTLA 4IG0B 2WSEC 4J9MA 4CE9A 2GHWA 2Q6BA 2XULA 2V5HG 1TV6B 4HHHA 2YWEA 5C2FA 4BACA 2VHGA 5CD4H 2JRSA 1NEEA 1JJHA 5B0AA 2BVZA 2F4VJ 1LWCB 1UW4A 1N4LA 1O6XA 2DK2A 3N4WA 1T9VA 2DNHA 4E3SA 4TU9A 5BXIA 3CFOA 3DOLB 3Q22A 3NDKA 4H0XB 3EGNA 3K5PA 2Z58B 2YKPA 3OR1A 4R25A 4C8KA 4I2PA 3BPSP 1NNDA 3VQ4A 5HQ8A 4TY8A 1NSAA 3OYJA 2DBBA 2MQOA 1U47A 3TARA 1DRZA 1VSLA 4RG8A 3E9PA 4XPEA 1M90T 3HULA 3W62A 3KKRA 1U49A 1GQEA 4JI6F 2DGWA 4PPDA 2B8PA 1GTEA 2BW2A 1GLLO 3D2EA 1GK8A 5HP1B 3HPGA 2F1FA 1O8BA 4QOZB 1UP1A 1RT2B 4FJIA 4M5DB 3PSFA 3DXKB 3I82A 3WC2A 1QQOA 5HROB 1HQ2A 4PZVA 2HBJA 2P9SB 3O2IA 3BSCA 4BE0A 4DQPA 3TAEA 4DDFA 1DQAA 1BXNA 4Z4CA 2ROEA 2JHEA 1AUSL 3T6JA 5ADXA 4ECQA 1UVKA 4Z94A 3FCVA 4USWA 1HNXF 4GKJJ 4NXNF 5L39A 3CIZA 3QBWA 4DV3K 2OFGX 3GFYA 1NCLA 3UN5A 3SMSA 1JLGB 3LP1A 1S6PA 4DBQA 2GWJA 4NA2A 4J9VA 3T5HA 4OKEA 2F5GA 2CGLA 3P39A 4Q0BA 4F04B 5KFNA 2O8FB 4H0VB 3IWNC 5KFIA 3W8GA 4JOUA 4HLBA 3OL6A 5H1SV 1J27A 2ITMA 3VQDA 1A7GE 3O3HA 1JQGA 2R42A 3MOZA 4GVEA 3PW7A 3WDOA 2ACMA 2HHVA 2RKIA 3GCXP 4ANEA 3GWCA 4LFAF 1D3WA 5HQLA 2BEFA 3ADAC 4CEFA 4WFAL 1FERA 2FF3B 3DOKA 4FJKA 2OPRB 1R8CA 3B54A 2CDQA 3KD5E 4C2MA 1GMWD 1Y00A 5CYQA 2KHDA 3V6DA 1WG1A 1X1PA 2QWLA 4FVCA 3FVYA 2D1KA 3QETA 4L73A 2ZVSA 4LF1A 2ERRA 5LMUK 3OUYB 4OHWA 3TRGA 4LT6A 1T9XA 4JI7F 1ASVA 3SBTA 2NXJA 4CJ4A 3J7AN 3QGHA 2RDJA 5M2RA 2LVWA 3JYTB 2BBEA 2IC3B 2YKQA 2E66A 3DXSX 4FCYA 4X2BA 3KYLA 3BBBA 1H38A 3J7ZT 2JVOA 1NGDA 2DR8A 1HFEL 5AQPA 2L9DA 4BGAA 2JC0A 3ZFVA 1VQ7S 1VQLN 2OI2A 1QTNB 1LXNA 5CYMA 3VEZA 4J9RA 3SLCA 3HOSA 4JK9A 4PXDA 2CQIA 4PUOA 4AH9A 1QE1B 4F4XA 4F67A 4H8KA 2XI3A 4MO4A 1E4GT 4DTMA 3T1HJ 3RBEA 2YKMB 1LW0B 4JV0A 2NPFA 4NYZA 4OI0A 3MWPA 3ID6A 3L4BC 2WW8A 2BQUA 4RU2A 4HHUA 1JLBA 1H2TZ 3VGSA 1RA7A 3MCAB 3ILJA 4QW8A 4ZVPB 1QSLA 2LSNA 2VKRA 2QV6A 4JP8A 2B4OA 2GC8A 3IBFB 2R8JA 3CSKA 1FRLA 3C2PA 5JVGQ 1GOCA 5J2MA 2X1FA 3JS9A 1WOOA 4K4YA 2E1PA 5AQLA 4UQTA 1VSEA 2F8EX 3D68A 2YXLA 2QWNA 3O80A 3W3SA 4C8LA 1XNQJ 1NGCA 2L41A 1IR2A 3AXKA 2LQ8A 4WFNL 1BHNA 1T02A 1LW2B 3IMQJ 4HWIA 4JI6J 1XUPO 3GJRB 4H4KA 1WG4A 1YBUA 4Q5VA 2RU3A 1RWOB 2ZHAA 2IGIA 4O5BA 2G9OA 4Y6IA 3QIDA 1BI4A 1F5CA 3K9JA 2VQFF 1IJEB 2Z2MA 3OTOF 4L74A 1T9TA 2VH7A 4DPWA 1P90A 3LGMA 4JI0F 4LVOP 4A2BA 2FF6A 2RUGA 1MMLA 3H1VX 3UVJB 1VBXA 1D09B 1LXJA 2E20A 3DRYA 1CVJA 3DWLA 3QRQA 2FBVA 3W5ZA 1Q9YA 4K42A 1ACMB 1UEVA 1QM9A 3HO1A 5LSOA 4X65K 1HNXJ 3O3GA 3W2VA 4Q44A 4BCAA 3TNVA 5H9FK 2XQCA 2GO9A 2QL7B 2W40A 1URRA 2EBGA 2UUBF 4BRCA 3ULHA 3AOCA 1Q95G 5JS2A 2XG8A 2O3DA 4ECTA 2GHPA 5HBMB 8RUCA 2HS4A 3MXIA 1RCXB 3BYPA 2VWBA 2YX1A 1RT1B 3SSRA 2VG6B 3NBPB 1B0VA 1R8HA 4UY85 1KR4A 4AHTA 4CJRA 4PG5A 3U1LA 2O8EA 3LW5C 3QIPB 3UKRB 1RDDA 1MN9A 1TTHB 1YF5L 3GSIA 1YJVA 1IBLJ 2AEJA 3D2WA 2BJ1A 5AQJA 4URGA 3TTDA 4CD1A 3QATA 1XNQK 4A47A 4H0PA 4PG7A 3FUYA 4P71A 4PEOA 2DFHA 2OPQB 3G8QA 5G4DA 3OV7A 1CQMA 4HDHA 3WIVA 3DGPB 5C24A 1UCNA 3SUNA 4FYXB 3MM7B 1SIWB 2KTQA 2R7WA 3V4IA 4PL8A 1QSSA 1YITN 3KHGA 3SBGA 1W0HA 4U67L 3DLRA 2PMHA 1S4FA 4FPIA 4DUZF 3CC4N 3SCJE 3DRRB 3HF5A 4JV1A 2N4CA 4NA3A 4DMNA 4YOUA 2YPZA 3VWSA 3AJ1A 2VOPA 1Q82O 3A3NB 1K44A 1YITS 1ICEB 3V1OA 1TUGB 4RUBA 1FRMA 2ZUGA 4LIRA 4CZGA 1J9AA 5DLGA 1NZAA 1G4CA 3ZSYA 3QEVA 4GC7A 4NEYA 1UA0A 3SAHA 2OTLS 1TK0A 1IQZA 5B7WA 4OX7A 2VFUA 4TSXA 4UOHA 1KKHA 1RDRA 1XWLA 1VHIA 3MM8A 2NXEA 2BJEA 3G9CA 3ZT2A 2MLZA 5C2DA 3OW2M 2E1AA 4EHUA 1N32F 2RRAA 1N0VC 4MO5A 1VQNN 3THYA 3UN3A 4K2JA 1S1VA 2DPIA 3L2UA 2FZGB 2KHOA 4CEQA 2NZ4A 2B7CB 1Q7YO 3FJ2A 3H45C 3FC9A 4ZCMA 2VPXB 1PC4A 1XNRF 3H3OB 2YHAA 2J6SA 2A18A 2W4CA 1VQNS 1RBUA 3T3FA 1N36F 3WQTA 3RAXA 2IM2A 1WG5A 1P8ZA 1JLQA 2ZE2A 4ZPAA 1L3KA 1H98A 2HNYB 1IBLK 4J9LA 2F65A 1CXUA 3NFAA 1DTTB 2ASMA 4OYXA 4DMZA 4ICLA 4DR5J 1QQNA 4QQBA 1GAOA 2HVHA 3JTPA 3TAGA 1X8DA 4FBTA 2QFJA 3CUNA 1JK9B 3I8BA 2VQFJ 2ADBA 5F8GA 4YHHJ 3QJPA 4OJHA 3VF6A 2YVSA 2XMJA 4R5PB 4ZPDA 4JI0J 2DY1A 4NLXA 2I2YA 1F9FA 1FWKA 3C19A 1BOTO 5D78A 3GTYX 3QT7A 3H59A 4KFBB 1PYSB 2H51B 1T6DA 1QD1A 1X5OA 1N54B 4FWOA 2DGVA 3OYGA 1W2BR 4M5KA 4JV5J 2NSBA 3KLGA 2EWSA 4ELTA 4YR2A 5CAAA 4NASA 2XC9A 4ERDA 1JJ4A 1SUQA 2CPEA 4DR3K 1YK9A 3KHLA 2XCAA 1L5UA 4GV3A 1TFYA 3M2RB 3A8IA 5JS1A 4KO0B 3ELHA 2UUBJ 3PUFA 2AIRB 4Q8FA 1R8PA 4ELVA 4GC6A 3C66A 3P3DA 1IBKF 1T44A 2QWOA 4OJRA 5BPMA 1N5YA 3OYFA 2HS3A 1T3NA 1VMBA 2G8IA 2FGOA 1VJWA 4CO3A 2DGTA 1SH2A 2HNZB 5LXRA 2NXUA 3AQPA 3CPWR 3HMJG 1K73O 4WQ5A 5ETMA 1JJ2R 4H4KC 3CC7S 4NLRA 1SCJB 2DY9A 3VGVA 3H0PA 4XEIA 4JKBA 3CDEA 3SI8A 3B4MA 4KHQA 2C3YA 3W61A 5C0YA 1IKXB 3FMBA 3S9HA 4ECRA 4DL6A 3HVRA 2F8TA 3GIIA 4BR5A 3I96A 4NOHA 4AM7A 2V7ZA 4W5RA 3L4IA 3WC0A 4OQJA 2F4FA 1B0TA 3VEOA 3R1LA 3M1VA 4A8YA 4PPZA 3QSYB 5B8HA 4KE5A 4DR5K 3U9ZA 5JJBA 4NLPA 4IQMA 2QE5A 3TEHB 1TK5A 4DV6F 2IBKA 4CK2A 2J9DE 4DQIA 4QYZK 4IDKA 4WTYA 3CF5Q 1IBCB 3N28A 3TSUA 4LREA 4YHHK 3L7OA 4A8XA 1VSJA 2HHTA 2OZSA 3SQ0A 1RT4A 3VGTA 1SC1B 4CNZA 3RW6A 1WACA 1UPMB 3BBFA 3X3UA 2AW0A 4JV5K 2FSNA 5CQGA 3EE9A 5EY4A 3NGDA 5DM7Q 4IQXA 1NH8A 2OEKA 1I39A 3ZSRA 1IH7A 4LF2A 2XO6A 4CLTA 1F21A 1RDUA 2Q79A 5AQNA 2YWKA 4BRLA 4CVNE 3SUQA 5CHIA 3MF5A 5BREA 2WB1D 3A3PB 2X51A 5KFMA 2UUAJ 1BIUA 2MKYA 2K8GA 2XLJA 2B4UA 5FRMA 3NCIA 4G1QA 4DV7F 2OEMA 3DI6A 2ZJPQ 3VEXA 3D6HB 2RDDA 5AQFA 1DTQA 1N36J 4LF4F 4B3OA 3O9UA 4A59A 2ZM6F 2ILZA 3OQ2A 1HBUA 2Y1JA 4A8SA 9RUBA 1Y64A 5CCLA 2Q31A 4FF2A 4Y0WA 4WF9L 2CQBA 3OYIA 1AYEA 5AFUA 3R5GA 1FX2A 4IFEA 1HKBA 3KOAA 4LSNA 3AVBA 4M3WA 2HHPA 4ID1A 2E44A 2QGFB 5DM6L 3M8YA 4CJKA 4ED5A 3MDFA 3C95A 1CPZA 2YNHB 1Y7PA 2FHKA 4CYUA 1VQPN 2V0NA 1AUDA 3P8BB 2XZTB 4CLPA 2GAGC 2L08A 2QLWA 4EYHB 2LQBA 1AFIA 3TAPA 4FW2A 2M5YA 2CPFA 3PYFA 4FBUA 1SL0A 4E7HA 4I7FA 1CJUB 4Y28C 2CWKA 2EBEA 4AHUA 4AD6A 4BRKA 2JEJA 1FD2A 3RBZA 3J7ZO 1WHWA 1DAXA 4FZVA 1OYDA 3FEZA 3TTCA 2KZZA 2D41A 4J90A 4WZMA 5I3PA 3MCNA 2HQDA 1URNA 4OZNA 1IBKJ 3BSAA 4ZHRB 3OVSA 1MDUB 5LL6d 3WIUA 3JXOA 1C0TA 4WXWA 1KVBA 2KW4A 2FJVA 2MTLA 2KG1A 2E7WA 4CHYA 2OZMA 1W97L 3MAAA 4CH1A 2GJ2A 1S6QA 1SXLA 2BKNA 2VCPA 4HUFA 4DSKA 4M5MA 2BW7A 1X3NA 1YLXA 3D9BA 3M9OB 2N3OA 2J9CA 1HNWF 2UXCF 1I3OB 3GJQB 4NLSA 3IAM9 2DFEA 4MK7A 1SC4B 4XK8C 3TUIC 1WF1A 2UUAK 2CADA 5J1EA 4DPYA 3DKDA 4P72A 3RU0A 5K20B 3CJ1A 5F8IA 5KFZA 1A9NB 1FJGK 1D9AA 2XY8A 3R5AA 5HL7L 3ASMA 1XMOF 1NJIT 3VQEA 1SKSA 1N36K 4G9ZA 1GMVA 3L3VA 2R2TA 5C25B 4C1NK 5F8LA 2ALZA 1E6VB 4HACA 1BU6O 4DL7A 1MU2B 2AZ1A 3FQLA 1YUWA 2CJ9A 4PKIA 3MEDA 1RBSA 1HWIA 1D5AA 2RN2A 2WSFC 4DL3A 2Q43A 2D3OR 4CT8A 3R1HA 2W2NP 4DV6J 5B0CA 5F0UA 4URQU 1G7CB 3NE6A 3AD7C 3I0RB 1IM4A 1QY7A 3SK3A 2F9JA 3KLVA 1G2EA 4MDBA 5KFCA 1C1CB 1YQHA 4WFYA 2AA4A 5DS7A 2XNRA 5KG3A 5G0RA 1HKCA 1E6YB 3VAIA 4OPJA 2Z2LA 2XSJA 1RAEB 4OI2A 3OFHA 2AJQA 4LUBA 4F0HA 5CD4A 1UWAA 5IZHA 3RSEA 2YNFA 2KJVA 3N6MA 1YIJN 3AO5A 1NB2A 4Q8EA 4KHNA 4XIUA 4R0JA 5M1KA 4DSEA 2YNGB 1VHXA 1ZC6A 3T19A 2WSCC 3R6GB 1NHVA 2V52B 4X4VA 2G0IA 5F8HA 4KGVB 3KLHA 1NPRA 1SS6A 3F41A 4UF4A 3MWTA 4Y65A 2NRXA 4DV7J 5GAGP 4NLWA 2RRBA 4B3TJ 2D3O1 2K7KA 1ROFA 4FJXA 1ZBHA 2P9PB 2HVIA 1YBAA 4NLCA 1NWKA 3NVKA 2ZM6J 1YTUA 3DXMB 3CDUA 5A8WA 3PVXA 2YKAA 4ZLLA 4QBUA 3PJWA 4P74A 3ZNJ1 1HBMB 3IXQA 2OYQA 4C4WA 3ZTQA 4IOCL 2PE8A 2HBRB 4C48A 3QFUA 1NNEA 4JB8B 1NM1A 2W4PA 3D3BJ 3N6NA 2GJFA 4LFCJ 5HMWA 3A5MC 4FLYA 1SL1A 3QMQA 1T0TV 2YH1A 3IM8A 4BRMA 2HZVA 3TSPA 3ZYYX 3CMEN 1S1UA 3LPTA 4DG1B 4CERA 2QI2A 2P51A 4B1WB 2YWFA 4E1NA 4YMEA 1NB7A 2OAUA 2R7SA 4RJVA 1U45A 3CCUN 4F36A 3T1YF 2C3PA 3ILOA 3CMES 5DMRA 3DRSA 4K41A 4A2AA 1N0UA 1A5WA 2OPSB 2AEMA 3CJCA 2A6AA 3W2WB 3K58A 4DCHA 2B0GA 4RUAA 4YR0A 2ZGYA 4FW1A 1A5VA 3THXA 4P6QA 3SI6A 1TYQB 5HK4A 2DD8S 4QR2A 3D0IE 5J1PA 3MMCB 1EWRA 2ZGZA 1RWVB 3B8HA 2W42A 2AJ4A 5DG8A 1EETA 1S77D 1FNMA 3NGYA 4CFCA 3GDQA 4IBNA 1RU2A 2GA7A 3DNCA 5LJ5Y 3ULEA 4RL1A 1JJCB 4KI6A 1CJTA 4J2BA 3K9KA 1KQSR 2KO1A 1YAGA 3THWB 4FLXA 4DL2A 1HNWJ 5DO2A 2UXCJ 4JKCA 2QRRA 4KHPK 2FJWA 5AXNA 3N4QA 4KGKA 3PRBA 4BRQA 4JUZA 3O9SA 2P9LA 3CIPA 2QWMA 4B3TK 1IJJA 3RYLA 1I6JA 2XWYA 3EX7B 1XMOJ 2HQCA 5HLFA 1S1TA 1VC0A 1NRKA 2IMWP 2EVZA 4LFBJ 1ZA2B 4HDGA 1LNQA 1BHLA 5F9LA 2HMIB 1C6VA 3PIOQ 4JI4J 2JC1A 1TKTB 2GMLA 1QAYA 3OVAA 3QB0A 3TAMA 4KPCA 2MXYA 2WOMB 2VKZG 1D1UA 2F9WA 3FBFA 2QA2A 1UTAA 1P1TA 2UVWA 1NHUA 3TJ9A 4OJ1A 1NKCA 2V4QA 2FGCA 4LFCK 2XGQA 1HQUB 1HHTP 2GGPB 4IO1A 2W6LA 4X66F 4YB6A 3GYXB 4JKHA 4NXMK 2XHBA 4ITSA 1RWNB 2AJ0A 3OR2A 4J9UE 4P9SA 4I9QA 3JSMB 1VDHA 3KLIB 2GNKA 2XMVA 1XR7A 2JWLA 1HNVB 3VERA 3FLCO 2M8DB 3ATVA 1OPIA 2ASLA 2PT0A 1RBVA 1VSKA 5DG9A 5K8NA 4B17A 2IA6A 2EG1A 5L38A 5T41A 2DNLA 3GSDA 2RS8A 5D15A 3BKFA 3ZZUA 3POTA 4U96A 1EX4A 4NLQA 2G1DA 5AQIA 3OL9A 3QPIA 1YWXA 1V4SA 2CH5A 2HHHF 3J81Y 3KK1B 1CG2A 4L75A 2DEIA 5KG5A 3NCPA 4B3MF 4ZTFA 4C8NA 3K59A 2F9TA 3U7JA 3F9KA 2VWJA 2KFYA 2XMKA 5EHHA 1R0AA 1TGOA 2ZWOA 4YDUA 3GIKA 3J7YU 1Y5NB 1CXQA 2V2QA 5MLCQ 4IH6A 2PA3A 4F2RA 4EK2A 3QYYA 3UWTA 4ZVGA 1ZYQA 3C16B 1FVSA 4CJQA 3UDLA 4QIVA 2LU2A 3G82B 1XHXA 1B92A 4BQZA 2MDAA 3VZIA 4FJNA 4CZFA 3AVAA 1RWKB 4DTSA 5IT4A 2CQ2A 1SBRA 2NZCA 4XTTA 3Q0AA 5LJ3Y 4BR2A 5F1XA 5BRHA 4LFBK 2C3OA 3MMVA 5BPLA 4GVBB 4ILGB 2ZWPA 5F2RA 3AVCA 2H3EB 2LFVA 2KLAA 4K8XA 4ZITA 1S1XA 4JI4K 3IFRA 4K5SA 3D66A 4BWMA 2QN6B 1QAXA 3OJUA 5IWAJ 2CJBA 3CDAA 4MAKA 2ZITA 4QIGA 4A61A 2XS5A 3T1YJ 4TNOA 2FQQB 1Q81T 1YRXA 2ZD1A 1Q9XA 1WORA 2ZH6A 1S49A 2E88A 4GVLA 4O55A 3OFFA 2V4JA 1BQNA 4QS8A 1HI0P 2KJWA 3QWUA 2M7SA 4Z2XA 4LH4A 2QMUB 5B0EA 5KFJA 4ISEA 4LF9K 4Y0FA 3NY0A 4PG4A 3NGTA 4JI2K 4PG8A 2H5EA 2HFOA 4BS2A 5DDQC 3O5TB 4EBDA 5T7LB 3CCMS 1Y97A 2OTJN 2W7AA 3ISND 1WTBA 3QEWA 2PEBA 2JWKA 4GW6A 4QWDA 4K59A 1JLFB 3CE8A 4IEEA 2MHEA 4CLYA 1SAZA 2W7OA 4DU7A 4CIFA 2OTJS 3DLHA 4WQ4A 4C3MA 2JH3A 3GFZA 4RU9A 1DT9A 2XZDB 2OO4A 2H48B 1B7FA 4A4JA 2P9NB 5ETOA 3DU5A 3JAMU 4OKJA 2QTDA 3FKBA 4C8OA 3NAEA 1ASWA 3QO9A 2MJUA 4AT1B 3LP2B 1LWFB 5J2PA 2G2OA 1BUXA 3HSZA 1NGEA 1RT5A 2A6OA 2IDLA 2A2DA 2M2BA 2J9DA 4OYWA 1FJ7A 1BDGA 4CTAA 2PO4A 5IC4B 1RWPB 2DGOA 2JEFA 4J7CA 1WF0A 4NB4A 4V19S 1LK5A 4MTPA 4P75A 2E9ZA 2OELA 2W41A 1UVLA 3QWPA 2QMXA 3HFVA 3MMBB 2LDYA 3H3NO 5E33A 5BJRA 2HLTA 3PG9A 3C6UA 4LJMA 4N8OA 3HD1A 4NLUA 4OI4A 5B0GA 2QL9B 3WHIA 4I64A 4BRAA 1CLQA 4QU6A 1EAYC 2W2QP 4CZLA 1HI1A 3US5A 4IXCA 1K9MT 1VQ4N 3MXJA 2G0CA 4QWEA 1JLAA 3NAIA 3U3GA 3ZSXA 5IWAK 3WEEB 2C2KB 4M41A 4JKGB 3A8JA 3ZX0A 2CNOB 2C2DA 4DV0K 3T1YK 2PN6A 4I2QA 3M2UB 4DF8A 3AVJA 3SDEB 3M8WA 4JS5A 3AT1B 2D3UA 2BM1A 2FBTA 2FC0A 2KT3A 2A1RA 2D0AA 3R8EA 4FXWA 4WBFA 1N6QA 1H2UX 3O4WA 3I6PA 3TUJC 3LA0A 4BVOA 1RCOB 1FCAA 1T05A 2HHHJ 1CC7A 1NAQA 4N5SA 4BRFA 3Q8QB 4B3MJ 3CCWA 3VF2A 5FDLA 3NG8A 2AMCB 5ITHA 4JAXA 3ZTRA 5KFRA 1PYTA 2JGUA 2D0BA 3PEHA 5F3ZA 2NCKL 4I6YA 5K8MA 3QJLA 3A12A 2HHWA 2A0FB 1Y5IB 2YKNA 3VAFA 2U1AA 1SQKA 1B4SA 4O8UA 2PEHA 4NLBA 5GMKa 3O1LA 2YNIA 5E3AA 1HARA 3C7NA 4DZDA 7FD1A 1RAAB 1NK7A 4GMKA 1WHYA 3EGWB 3CCLN 3THVA 4L3KA 5DZ7A 3PM9A 1IWAA 3TA0A 2C2RA 2FSKA 2V94A 5L8RC 2RF2B 1NMNA 4NI2B 1D8YA 3W7BA 1TUVA 5CABA 4PYAA 1RT6B 3M6GA 4YDDB 3CCLS 5E26A 2BE2A 3D0GE 2AYBA 2WC9A 1Q53A 4F25A 3LDQA 1DGKN 2G8WA 3M6UA 1J5OA 1ZBIA 5E41A 2E1RA 3TO8A 3SNNA 2HNDA 1S72S 3G8SA 4JKFA 3D1OA 5M1OA 1XMQF 1WEXA 3H25A 2Q2RA 1KD1T 1XQIA 2DJWA 1ZS6A 2FUG9 5F8MA 4MDAA 4JI8J 4RX6A 3D54A 4ZDNA 2DHXA 4IO9Q 3PLAA 2YQ1A 3GR1A 4DCJB 2XMAA 4DEZA 1TL3A 2QL5B 4E1MA 4AFFA 4K43A 3DCAA 1RTIA 2CJXB 4FWRA 3KWIA 3I8DA 1XIQA 4X4TA 4YDUC 4FJ8A 2BV3A 3ILIA 3CJ5A 2HKEA 4CH0S 2HEKA 3D2EB 4AQYF 2L48A 5EDWA 1HWUA 4USIA 1OKJA 3IAYA 4B3MK 1NOZA 1MSWD 2QZ8A 1FESA 1WC5A 3BO2A 3CVKA 3CCQN 5F8NA 3ZTOA 4F26A 3NGIA 2PAVA 4JN4A 3HFKA 5DQGA 5AQYA 5LJVA 4UY8O 1XMBA 2H3GX 3NMAA 4TLQA 2DNNA 2LXFA 4EFAC 2PC6A 3PX6A 2VC1A 1RBLA 1YJNN 3DFEA 2MQQA 3PV8A 1YJWN 3WXIA 1TU0B 3EXYA 5AQSA 4PAAA 4ETZA 1S6PB 4FWKA 3EGVA 2E2QA 4DV4F 4Q0BB 2JLEA 1DARA 1YJWS 3KKFA 3LDOA 3MN5A 1MMDA 2EFNA 3SSSA 2ZH2A 4B9TA 4FWQA 3IRWP 2X3DA 5HMXA 1EP4A 1ZOTA 2X1GA 5EX0A 2RKIB 2G8UA 4GV9A 3BSOA 4ZK7M 1U48A 1S1WB 1A6LA 2DH8A 2XYGB 3DOKB 1EX8A 3F2KA 1VQ9S 4USTA 1NM2A 1EO1A 2XMMA 3HHEA 4IJNA 4CFBA 5CYQB 4JI8K 4C9DA 4TKTA 3E9OA 5SWMA 4O0IA 1QSYA 1WOPA 4BGBA 4CBUA 3L95X 4FWMA 5IV4A 3CFPA 1IWGA 3MN7A 2GAHC 1IV0A 1RI7A 2YTCA 2PD1A 1JCEA 1IBMF 2W8KA 4ES1A 5D0EA 4J9OA 1D9DA 4JRQA 3I33A 4I6AA 5KFSA 2B6AA 2G8FA 2D0PA 1UVMA 1S9GA 4ECYA 2ZC3A 5CYMB 4I56A 4OMFG 1NGJA 1V4TA 5KFAA 1VSHA 1WSVA 3NNAA 1J5EF 4PUOB 2H4YB 1V9OA 3MFIA 3HJVA 3EJMA 3R7NB 4FF4A 3H2VE 3J7AP 3KUHA 4CJ3A 1RWMB 1WUUA 3GBTA 1XHZA 3TOQA 1M5OC 4CEAA 2V2ZA 1JLBB 2X78A 3S41A 4JI5K 2QW9A 2ZKUA 3GIRA 2O8CA 3WNEA 4QWBA 1HW8A 1TR0A 4ECUA 1IG8A 3PACA 5IM0A 1Q86T 1HRHA 2E2NA 3ZSZA 2PA8D 3CPWM 4CZIA 3OVNA 3KG4A 2LP4A 3ZCMA 5GADP 1RT3A 2JLFA 1JJ2M 4DZ6A 3RMAA 4ZPWR 3KG0A 1OO0B 3BZQA 2IA0A 3PRVA 3CULA 3MN9A 2YJFA 5IS2A 5E5NA 3ITHA 1S57A 2CVIA 1D4XA 5AZIB 4U8YA 1REVA 4KV8A 4ES2A 4UOCA 2BRLA 4CEOA 4OPKA 3PHTA 4CLLA 3M6WA 2KU7A 1PG5B 2P1JA 5GAEP 1BI4B 3NHGA 4ZKAA 2A5XA 5KT3A 2NLXA 3SCXA 4OYAA 2ZHOA 4C0OC 1R31A 3CPEA 2YCHA 4RBUA 4WFZA 1MWQA 3CHWA 4FYDA 3O44A 4BRPA 2QX0A 3DU6A 3MEEA 4G1IA 3ICLA 4O3PA 3OYHA 4A46A 1SKRA 2VFVA 3O4QA 4WIIA 5DGBA 3H5YA 1FI4A 3KJNB 1D9FA 3PSIA 1HLWA 3EE8A 4OPHA 2FC8A 5HSPA 3W2VB 1LAWA 4UW2A 1BD6A 3RB3A 2WVFA 2UUCK 1Q8BA 3HI9A 4FKXA 3Q8RB 2GIQA 2KB2A 2LA4A 5GIOA 1WLJA 4QJVA 2IVPA 3A1YG 1RZMA 4K7QA 4C0HA 2DGXA 5KT5A 3KZBA 2DPNA 2ZBIA 2VICA 2A3ZA 4O0NA 4LF7K 3MECA 4K4XA 4RW9A 1VYAA 1RKIA 1YJRA 4A57A 2RSQA 4DFMA 2NRHA 3KG1A 4DTJA 4CWBA 3U6FA 1K1SA 4DR2K 3PRDA 3BGRA 3LPEA 4ED2A 2ILYA 5M1FA 4YORA 3CD0A 3AA4A 4CJUA 4V19X 3H2UB 5EOYA 3WNFA 2ZH8A 4WYBA 5CCMA 1X0FA 4F3OA 3U1MA 4CRJA 2Z57B 2IM0A 4NPOA 2IOCA 1ZPVA 3C15A 2XB2D 2UU9F 1MROA 1T3VA 1VBYA 4DHYA 5C24B 4RPFA 3SQ4A 1Z2LA 3IWXA 3ZEUB 4BROA 4CEBA 3WX8A 4I4BA 3LOUA 1IBMJ 3V4IB 5AT1B 1EZZB 3CJ9A 4MMOA 4NLGA 3CF5L 1HKGA 4CF2A 3QJJA 3MAHA 3J80U 3CD6S 4OYBA 1N52B 4P2FA 1NMEB 2LQ9A 2Q1NA 1HHSA 3CJKA 4NX9A 2E5GA 3UQSA 3IC1A 2DVIA 2ETJA 4KB1A 5C15A 4DHVA 1U6FA 1M5VC 4KR0B 4PCQA 5BN9A 5DM7L 3FDSA 4RUCA 4UZCA 4CJEA 3IG1A 2NYHA 1RBAA 4FJ5A 3SFUA 4WP8A 1L3TA 4FL9A 1X9WA 4LF6F 1TVRA 2MLYA 3NS5A 3TWZA 3AVNA 3NGKA 1B0PA 4WWSA 3L3CA 2DGSA 4N77A 4KB7A 3QEIA 1VQ6N 1SJ3P 3VEWA 4O5FA 4LMZA 2MQMA 3NGUA 4OJGA 4J9PA 2VL1A 1X9SA 1S1VB 2ZJPL 2XTJP 3MMJA 2UXBF 3I31A 4FWPA 3LP0A 5L46A 3N5FA 3MPDA 3VAMA 2QWRA 3GYNA 4Q43A 2QEXS 1WTFA 5I9EB 2HBKA 3NNHA 1NSKL 1U0SA 1O1WA 3BZCA 2ZE2B 4LH5A 3MPVA 3MD1A 1GOBA 5ETRA 5KG0A 4ICLB 2FHJD 4EZ9A 4LY7A 1R6VA 1Z4UA 3EZUA 4RNNA 3ZZYA 4HEA9 2DIVA 3EMTA 4D3GA 1YTAA 5JLHA 1KVCA 2BACA 4NO7A 3BH7B 2UXDF 1N5VA 3NCRA 3GLJA 1OQ6A 3TU5A 1U1QA 3JS6A 1CZBA 3KK2B 5ETNA 1NG9A 1UWBA 3JTNA 4C7QA 3CTRA 3C3LA 3HSDA 3LALA 3I56N 3IM9A 4LRDA 1ATSA 3KLGB 2OD6A 2RB7A 3Q8PB 3FZBA 1SIZA 1RGIA 4FLUA 3PTWA 4YP3A 1VGYA 3G10A 1Q4RA 4F4ZA 1SUQB 4U8VA 5L9NA 2IRYA 1WC6A 3I56S 4DV1F 1J54A 3FZHA 5KFEA 2X7IA 3R9LA 5GADI 4K4WA 2Z4PA 4H5RA 2XO7A 2QA4S 4Z4IA 1Q18A 3CJ0A 2XS7A 2DRAA 3CD7A 2OPPA 3DM2A 3Q24A 3DOMB 1IKVA 4LF5F 3C46A 5HP1A 1YRTA 3ENVA 3TPQA 2HGMA 2A3JA 4IZ9A 2OUGA 1NK9A 1QHAA 1MWYA 1RNHA 3OTCA 5KPZA 2HURA 5FLXU 1V3ZA 3G71N 1U2RA 5MAOA 3U4LA 2IPOB 3UI3A 2P9SA 3T9NA 2OMLA 2N4DA 4CIGA 4OHYA 4FKYA 3IN5A 1V5IB 4ED8A 5HRNA 4QOTA 2KI2A 4C8ZA 5C2GA 3J7Z5 2X74A 1MWZA 4C97A 4DX6A 3G71S 2GMJA 1GX5A 1KD1O 3K5OA 2ZNYA 3CFRA 1OSCA 3MM5A 3SCIE 3MN6A 3O9TA 5FROA 2UU9J 3NH1A 2YY3A 3ZX3A 3I87A 5KT4A 1Q7LB 3TVZA 2W9AA 4NL5A 1HR0F 4F02A 5LY3A 2YKOA 2BRKA 3R1XA 5HL7Q 3ZZOA 1NOYA 2HZAA 3RJMB 3RGIA 5KFPA 4KREA 3DAWA 2ZDPA 2EX3A 2DR5A 2RQCA 4IDKB 4HHJA 2OSQA 2E1MC 3B6BA 3A5NC 2EXUA 1R6YA 1SJRA 5B0FA 3RVCA 1WUAA 4CEZA 1T8EA 1M5KC 1RT4B 1BWEA 2E9TA 3JSYA 4DR7K 5EX3A 1U4BA 3R97A 1TFWA 2J7UA 4QYRA 2VA3A 1IR1A 4RW8A 1FFGB 4W5QA 5T7BA 1NGHA 2AJ2A 1KHWA 3CJRA 1GLFO 1G6BA 2VDHA 4A8QA 3DC2A 3D0PA 3OVBA 4AM6A 4LF6J 2YX6A 2MKIA 1U26A 3HKWA 3CETA 1NU0A 2GX9A 3ALYA 4DU8A 3G2XA 3DMJA 1HWLA 4JKDA 2X1BA 4F0MA 1AT1B 3JYTA 3QSIA 2W1BA 2IC3A 5KGXA 1KQSM 1XC3A 1MG7A 1DBDA 1UZHA 4M7YA 3Q86A 2R9LA 2HMPA 2UXBJ 4G1QB 4MFBA 1RKJA 3DI6B 5EWGA 1Y10A 3V2UC 5BN8A 4PY5A 2R2SA 2HK2A 1DTQB 3HP6A 4CH7A 5BYSA 3IBCB 4B3OB 4J9NA 2UVVA 3VGMA 1WBDA 5HMYA 2DCUB 4FXVA 5DDPC 1HBUB 1MWKA 4WKRA 3S3NA 1NPPA 4R8UB 1QTMA 2ZH4A 3D5MA 3F73A 1LEOA 1S0MA 2YHXA 4X4SA 4HI1A 4LSNB 1RBTA 3HBTA 4A8MP 4DV3F 1JCFA 3AFGA 2P5VA 4MKYA 2WVBA 3TVYA 4F50A 2D1CA 2UXDJ 2M4MA 1Y4ZB 5D8HB 3PW2A 2Q1LA 2RJZA 3CXCR 2DEJA 7FDRA 5AQMA 2W6KA 1P6TA 1OMSA 2NUHA 3VQSA 1BIZA 3EL2A 3JAMO 1TKZA 4CHQA 5AE2A 3KHYA 3IR6B 4F3TA 3H6EA 2NZTA 3E8OA 4I7FB 3B6PA 4QPXA 4UT4A 1S6OA 5D77A 2A6MA 4DB3A 2R7RA 4QPTA 4B9LA 3WXMB 3QBXA 1GXLA 3G6VA 2O5DA 2R4FA 2CNLB 3W66A 4DV1J 5BR8F 1K8AT 4C6AA 1APSA 3LGNA 5AQGA 4I68A 1LW2A 2BUNA 2E5LK 5SUHA 1REGX 3KWMA 1FXRA 4QAGA 2CQGA 6AT1B 3GU0A 4LF5J 4CECA 4LF6K 3LUYA 3CCEN 3MAAB 5LMUF 3M9MB 4JV2A 3OYLA 1H7WA 4FJGA 1KAZA 2HHUA 2Y1RI 2DR7A 1HBOA 3P6YC 4M5NA 1S0OA 1HUXA 3JXUA 3ZZTA 1X3MA 3PIPL 3PKMA 2YQ0A 4KHRA 1ZBLA 4PXCA 5J1EB 2ZBRA 8AT1B 2BR0A 4URSA 1JCGA 3H08A 2DPJA 1W7WA 1Y5LB 2EC0A 4LF8J 4YFUA 3CCJN 1F9EB 2I5JA 4DR1J 4HTUA 1KQFB 1VC6A 2RHSB 2V63A 4IJAA 3M9NB 2OANA 3CJQA 1N8RT 3OS0A 4HACB 2D9OA 4FJJA 1G99A 2E29A 5KOWA 4CCHA 1HR0J 3P4IA 3MEDB 3M30A 5M2UA 1S0NA 5IXUA 4ZJQA 4AHCA 2VG6A 3NBPA 3ETMA 4I6MA 2CQPA 3MXMA 2FLNA 1G15A 3MPYA 1WKJA 5D4NA 3BJYA 4BRDA 3QIPA 5D6GA 5GINA 1DKGD 1ZBSA 2E1YA 2CPDA 3P45B 4R79A 3QT8A 3EDQB 5GVQA 1O51A 5G0RB 4RBTA 2FDNA 1WSEA 2XSJB 5RUBA 3HT0A 3AARA 3GL1A 2XYPB 1QAJA 5HO4A 1HLUA 4M95A 3HZ6A 1QZ5A 1UA1A 3RSEB 2YNFB 3NS7B 3TA2A 1YJ9N 2LEBA 2GEMA 4FN5A 3Q8VA 4ZOSA 4RUHA 3EM1A 3MM7A 4BR9A 3E3XA 4ED4A 2P8IA 3C14B 1Z25A 2W9BA 1YJ9S 4IO8A 3KLHB 4LF5K 3G6ES 1PJ6A 2Q66A 2QMWA 2V9KA 1F60B 1H72C 4LSZB 2MZ1A 3R9PA 1M1KT 2KDOA 1BGXT 4FJHA 2CG8A 1FD8A 4RW7A 4KGXB 4ILLA 2E5JA 5ETPA 5A8WB 2KVQE 3UN2A 2L9WA 1FE0A 4ZN1A 3H46O 4CGJA 4X65F 1WDTA 2CQ0A 3DRXA 4PYDA 4K8ZA 3GV5B 1N56A 1B70B 2VBZA 5KFKA 4LF8K 2IAJA 1JWWA 2CFXA 4RLEA 4DR1K 2MLXA 5IQQA 1VIXA 4B9NA 4ID5A 2RH3A 2IRUA 4DFPA 1RAHB 3SPZA 1HJRA 2I9SA 1FVQA 3HSCA 2MJNA 3OTDA 2G2YA 4DFJA 3KNAA 4FK0A 1HR0K 1U8SA 4RR5A 1S1UB 4CO0A 4YB5A 3K89A 3NF6A 2J8SA 1FWLA 1BISA 3FZLA 3AO4A 2V68A 3G86A 1SVDA 3QAUA 4Y2IA 3DRSB 3NKYA 4ILMA 5KRTA 2LLZA 3AH6A 2MQ8A 4ZIWA 4KJIA 3SCLE 2JFDA 5BR8J 3RRHA 2UP1A 1KQGB 3M6XA 3MTKA 3SJJA 4LIWA 3QGGA 2YBVA 4DWIA 2V2KA 3D0HE 3BGOP 4M63A 2IVFB 3THXB 5J2QA 2HFSA 1ESVA 3IR7B 2GQQA 2IMOA 1U09A 1UFWA 2AHOB 4DV5J 4B9MA 2F40A 1JXEA 3UFCX 2O4IA 1EETB 1XNQF 2AGOA 3NAHA 3HHKA 5LMUJ 4TQSA 1B9DA 4BRNA 4OZJA 2CPHA 2FVSA 4R5PA 1YI2S 3UKUA 3I55N 4JK8A 2V8GA 5AE3A 3ULEB 4C11A 2QFIA 3CERA 4KFBA 1H1VA 2BABA 3FSIA 4DQQA 4MLHA 2EK6A 5F8JA 4PWUA 1RBOB 3I55S 1C0UA 2VB6A 4BREA 4CESA 4K50A 3CD5A 2IIHA 3R6LB 5HLFB 3NOGA 3IRXA 3THPA 3V1RA 3M2RA 1NDPA 1YHQN 2E5IA 5DGAA 1KS2A 2VG5B 3I5CA 2E2PA 2RDIA 2O8DA 1RHRB 2BUPA 4DSIA 2NXCA 4A5BA 3ZT0A 3M2VA 1QUVA 1YHQS 1BY9A 2YHBA 4A8WA 4YY3F 1WHVA 3KMQA 2MGZA 3GV8B 3W0LA 4AHSA 1RBRA 1TP7A 3OY9A 3PNIA 1OSDA 1KAXA 3I5AA 4N76A 3OPKA 3MCSA 4PXBA 3AXMA 2MY7A 4JNEA 8ATCB 2B8QA 2IDEA 2KT2A 1F5BA 5TKWA 1UKUA 2YHWA 1S9EA 2D74B 3QEXA 4XPCA 2XY6A 3IGNA 3UR0A 1PSDA 1S99A 4X4NA 2P9CA 3BYRA 2QLFB 3OL7A 5BR8K 2POKA 3M05A 3POTB 3SMPA 3V6HA 5KAKA 2NSCA 1I94F 1IBLF 1CBKA 2V34A 5IT0A 4RNMA 2OH2A 4H03B 1R7IA 5ADXH 2N3LA 5A2QO 4J91A 3MMAA 5HN0A 4DV5K 5I4MA 2CQ4A 4Z7CA 4ZCLA 1R0AB 3BR9A 4BLGA 3A8EA 4CZMA 3P5JA 1VQ7N 1N88A 3QFPA 4FSVA 1PJ7A 2LDIA 3IR5B 3VA3A 4BDZA 3M5RA 5M1PA 3L2WA 1NDCA 4X65J 1D0EA 1RAOA 5F0XA 4DR3F 4DQ8A 3L2RA 5H9FJ 4DCPB 1FNXH 1B9FA 3ZZZA 4ZPTR 4OX9K 2C2NA 2QYCA 5KFHA 2G1HA 4Q45A 5F9NA 3HSJA 3QNNA 3GMGA 1CZ9A 1PO6A 2L9NA 2XBPA 4CF1A 3TA1A 3BQ2A 3KVGA 1NKEA 4FVUA 2MQPA 3NRBA 4ZCKA 3O8WA 2HWIA 4QS9A 4CGHA 3P4UB 3S8SA 1BC6A 1VAZA 3W3DA 3E9LA 3VGKA 2IJNA 1GFWB 3GP9A 2F3JA 2ZD1B 2MEWA 4I9LA 4TU8A 2LEPA 3VTIA 1BQNB 4X64F 5F41A 3U8XA 4IO9L 3E1YA 1XC9A 2OSRA 2B4PA 3OL8A 2Q0RA 5A0YB 1HNZJ 4FF3A 4R0EA 3H20A 1CC8A 2A10A 2DR6A 3FE1A 4OLPA 3DHWC 2QWPA 1NSQA 2GVZA 4LBHA 2FVQA 3VQTA 1DQ9A 4FWLA 2HPUA 3EZOA 1F6TA 4RWXA 5K14A 3DLKB 4YOYA 1U2CA 3CCSN 2P6SA 2RUSA 2SXLA 3AA5X 2W9CA 1V6HA 5ELZA 4DR5F 3C6HA 3VETA 3MR2A 2Y1LB 5KQ8A 4TVAB 1JNRB 3CQ8A 1ELOA 5AE1A 2BDPA 2MZJA 4WTOB 3CCVS 2FVRA 1NPKA 4J2DA 3CCSS 1CJUA 4YHHF 3S3MA 3CO0P 4Z4EA 3QO9B 4C3LA 2WZ1A 3G4SS 4KT0C 5J2PB 4OLBA 5KFTA 3BF1A 1RT7B 1RT5B 3TUPA 3OYKA 1YT3A 4X4UA 3KDOA 4JV5F 4ZHRA 4YDXA 1WD6A 3CIMA 2LU1A 1F1BB 3H7HB 4O3RA 4FLZA 1WC1A 2LYVA 3DDIA 3W1YC 4AHVA 3HOTA 2B9WA 4DTOA 4H4OA 3O4NA 3J80O 3ENQA 4Z37A 4DX7A 4YY3J 3HHDA 4I1TA 5AQRA 2X6SA 4O8KA 5L9XA 1RTJB 1FKOB 3SZ2A 4EMDA 4WCEQ 1RYSA 2EPIA 3VQ9A 1HYVA 1ILYA 1AZSB 2FJBB 1NGIA 1RHQB 4NEZA 4MKVA 4MK8A 2ITGA 5HMZA 4ID8A 4CW7B 3ISNC 2W7PA 2XY5A 4EU0A 4W4MA 4AL5A 1X5TA 3SPYA 1KC8O 2ACYA 2P2CB 4EO8A 2BJDA 2CA9A 1Y0HA 4K0KK 3GIJA 1I94J 3B6OA 1HNZK 3MFHA 1N6QB 2QA4G 1CULA 3IGVA 4DUTA 3SMZA 2RVJA 4ED7A 1T05B 4FZXC 4EBCA 1DQ8A 3IP0A 4ZPVR 5FDLB 2E5HA 2QT7A 2EKNA 5HATA 1S3XA 3HCXA 2I38A 3BKUA 1YXQA 3SIPB 2I0XA 4CK1A 3TJ8A 2GFFA 4QR1A 2G2ZA 4XDDA 3DRPB 1TUWA 1Z2ZA 2FJAB 3UO0A 2YNIB 3C7NB 4ED0A 3Q23A 4ED1A 1KOOA 1NDLA 2CQ3A 5A6PA 1E6YA 3BGFA 1BA1A 2B5JA 2RHKA 4DR6K 5AJ3J 1P8GA 1NGGA 3AA8A 2AV5A 3KXDA 2AYMA 4DR3J 1VQSA 1RA6A 4ZVQB 1S5ZA 2CJAA 4YOTA 4F4AA 2OTLN 5FJ4A 5F3TA 4CLKA 4BR0A 3ID8A 2BE2B 2ABYA 1U0HA 3AA9A 4RTFD 1SC3B