4R5PA

Crystal structure of hiv-1 reverse transcriptase (rt) with dna and a nucleoside triphosphate mimic alpha-carboxy nucleoside phosphonate inhibitor
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
555
structure length
555
Chain Sequence
VPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTNSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Alpha-carboxy nucleoside phosphonates as universal nucleoside triphosphate mimics.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase, hydrolase/dna/inhibitor
molecule keywords HIV-1 reverse transcriptase, p66 subunit
total genus 150
structure length 555
sequence length 555
chains with identical sequence C
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2014-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4r5pA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4r5pA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4r5pA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4r5pA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4r5pA05
2JLEA 1YTUA 4MKAA 1WAJA 1ASWA 1ZBLA 5KFBA 4DLEA 1VSEA 3MTKA 4DFJA 2R2TA 4AILC 2AU0A 1JLGA 4Z4HA 4FJGA 1HRHA 4JLHA 3H59A 4CHZA 4CJ3A 3KLIB 1ZETA 1JLEB 2YHBA 3F73A 2IA6A 3L2UA 4HHTA 3KMSA 4MFBA 2BRLA 3HVTA 4ICLB 4ED8A 4KHMA 1S1XA 3SI8A 2HW3A 4NLXA 5KFSA 3CFPA 1HYSA 3P83D 4RW8B 2DPJA 3LP3A 2FC0A 3OYNA 3V9SA 2VG6A 5JUMA 5KI6A 4H4OA 4ED2A 2ILYA 1S9GA 4ECUA 2GBZA 3AVFA 4W5RA 1S97A 1KHWA 3BREA 3PW5A 1QAIA 3KLHB 3I0SB 1T94A 3K5OA 3ISND 4KV8B 5KFNA 2UVRA 3H5XA 2FVSA 2D7SA 2XCPA 1HMVB 1XHXA 2XO7A 1Y97A 1UA1A 4O3RA 3RMBA 1RTJB 5KTQA 3QO9B 1S1VB 4NLGA 4LSLA 3GV8B 4M45A 3K2PA 1WSEA 3PO4A 3KD5E 3NDKA 1LV5A 4FM1A 5DG7A 2JGUA 1IG9A 3OS1A 3KMQA 3RB0A 1Z25A 1RT3A 1NK5A 2AGPA 4J9RA 3I0SA 1RTHA 1HYZA 4YQWA 1WSIA 1WNSA 4HUGA 3SV3A 3V4IA 1FKPA 4GC7A 1S1XB 2PZSA 3SZ2A 1KHVA 5KFXA 4FW2A 3P5JA 2B4JA 4FLZA 2W42A 4DSIA 5F8MA 4CE9A 2W9CA 4I9QA 1C1AA 2YKMB 4KREA 4ZPDA 3LWLA 2JEIA 5I42B 3HL8A 4W5TA 1QHTA 4O3QA 2IDOA 4FBUA 4J9OA 4K4VA 5D3GA 3M8RA 1EP4A 5J1EA 1BISA 3HVRA 1Z4UA 3PZPA 1RNHA 1LAWA 5KFRA 3DRPB 1NJYA 5KGXA 5CZ1A 4L8RB 1UAXA 4ZVFA 3F9KA 2HHXA 1UWBB 1VSKA 1A5XA 4FJMA 1ZTTA 4MK7A 3DRRB 5C24B 3NBPA 2XC9A 4NYZA 4DL4A 4CGDA 3HPGA 3QERA 3UDLA 2GIRA 3IRXA 3PX0A 4H4MB 3T5LA 4ECYA 4RZRA 4KI4A 3GV5B 5KT2A 3MEDB 1K6YA 3G86A 3LZIA 5F9NA 4FZXC 4DQPA 1LWCB 4NYNA 1KFDA 2AJQA 3M9OB 3RAXA 3IG1A 1L3UA 4DU3A 1VSMA 4M3RA 4OL8A 2IJNA 4F3OA 4RUAA 5JS2A 1VSDA 2FLNA 2UUWA 4E0DA 4TY8A 3CM6A 4BDPA 1S6PA 3CJ0A 1J9AA 3S3NA 2QK9A 1NK4A 3OYAA 3SV4A 5J2MB 1TV6B 1B9DA 5F9LA 3KK3A 3V1RA 2Z1JA 1U45A 3MEGA 1BI4A 4CJVA 3NGYA 3G6VA 4CHYA 4FLVA 3MECB 1J53A 1C1CB 2R8HA 2VA2A 1ASUA 5EU7A 3SPZA 3TAPA 4J9SA 1FK9A 1S1WA 4F4WA 1HNVB 4K4XA 3RBDA 1TKXA 3FRZA 3SI6A 4CJ5A 2HNDB 2W9BA 2BGGA 3BGRB 2KQ2A 3OYCA 1U47A 4CJFA 3DMJB 2D3UA 2D0BA 3U3GA 2G8IA 2AGQA 2ATQA 4ECQA 2YV0X 4QWEA 4AH9A 4CHNA 4OLAA 4BE1A 3VQDA 2C22A 4FM0A 4N5SA 4WYWA 1WSGA 1SH2A 3KLGA 3V6DB 2OH2A 4KFBA 1IKYB 1T7PA 1ZBIA 2B5JA 1RTIA 3GV7B 2E9RX 4QOZB 3E01B 5CY4A 1RDRA 4NRUA 2R8JA 2V4RA 2FJWA 1T05A 1J5OA 3N6MA 3QGHA 4DTPA 2RN2A 1S6QB 1C0UB 4E7JA 2XHBA 1S0MA 3L3UA 3T5HA 3G10A 3VQ9A 2JC0A 4RU9A 1CXQA 3D0PA 1RBSA 4I2QA 1WNEA 1C0UA 1VSHA 5C24A 4K4YA 1J54A 3V9ZA 1C1CA 3IGVA 4Q8EA 2BQ3A 2BE2B 3BQ1A 1DTTB 3PUFA 3V6DA 5KG7A 2C2RA 4RW9B 2IAJB 5CYQA 3DDKA 1RDBA 1NHUA 3KLFA 4EZ9A 2GIQA 2DPIA 2OPRB 3HHKA 2Y1IA 2DY4A 3CVKA 3DMJA 4HKQA 4FS2A 2G8KA 3JYTA 2PYJA 4FK0A 4N41A 3H4DA 5HBMB 4IG0A 5JS1A 1IO2A 4KAZA 2ZQBA 3ZSVA 3NH2A 4TN2A 2W9BB 4FJNA 3EZUA 3VN5A 4DFPA 3BDPA 4CEOA 4J2DA 2X6SA 2XI3A 2Z1GA 3DLKA 4J2BA 4QWAA 1U4BA 4CGFA 3LWMA 2OPPB 4Z4CA 4HYKA 3GIJA 3ZSXA 1C1BA 1S1TA 4YR0A 3H98A 3UPFA 2QE5A 5KFIA 3OLBA 3DM2B 3AVBA 3NH1A 5FRMA 1DTQB 4DFKA 4RW6B 3DRSB 4W5QA 4UQGA 3ZT4A 3OYFA 4DTNA 1S1UB 3MECA 4LSLB 2XY8A 2BQRA 2YHAA 3VA3A 1QQCA 1JLQB 3TR8A 1KVCA 1KVAA 3OYGA 1KLNA 4ECSA 1R0AA 4I7FA 4H4MA 4HUFA 4WYLA 3NHGA 5J2MA 3DLBA 4RNMA 3LP2A 2E9TA 2QKBA 1MU2A 4IDKA 1JX4A 3OL9A 1S1VA 3LAKA 3AO1A 4CF0A 3T3FA 2OPSA 3MXMA 4B9MA 3KLFB 4PQUB 3BR9A 2F8EX 4WE1A 4DU1A 4F3TA 1HYSB 4J2AA 1JKHB 4NLQA 1D8YA 2I5JB 1JLBB 1S4FA 3TWHA 3MEEA 1QSLA 4B9TA 2KFNA 3CDUA 1RT2A 2ZD1B 5FDLB 2XRIA 1JLEA 5J2NB 4IFVB 1XR5A 1S9EA 3MR6A 2UVVA 1X1PA 2D41A 4K4SA 1KRPA 4DQQA 1T03A 4IG3A 2C28A 1GOCA 3KLEA 4CF8A 3AO4A 5KFDA 5FROA 5EWFA 3MR2A 3NF7A 1VSLA 3V6KA 4QWCA 3KLEB 4DG1B 3U3YA 3EZ5A 1LWEA 4NYFA 1HYVA 3LP1A 1FKPB 3VQ8A 1VRUB 1T3NA 2ZD1A 4ID5A 1BCOA 4NCBA 1TL3A 4DWIA 3GYNA 3NF6A 3TAFA 5KFMA 2O4IA 2WB4A 1JL1A 1S9EB 3C6TB 2W9CB 3WNGA 4ED7A 3V9WA 4EBEA 1ZBHA 3SQ1A 2FBYA 1RTJA 3QIOA 4DSJA 4NCGB 4CK1A 4K4ZA 1XHZA 4FXDA 4IG3B 2VWKA 4R5PA 4MK9A 1REVA 2VG7B 3SYZA 2KZZA 3QZ8A 4OJRA 1RT3B 2IS3A 1KLMA 3K59A 4DU4A 1JLGB 4KI6A 4Z4GA 4IG0B 3ZSQA 5T7BA 3SQ0A 4E7LA 3HJFA 2B6AA 2RKIB 1ZBFA 3D45A 1TKZA 3AV9A 3LP0B 4BWMA 3MR3A 4AHUA 1JKHA 1ZYQA 3AVMA 4EYHB 4FLWA 4NLSA 1SV5A 1N5YB 2OZMA 1HNVA 3TAGA 3AO5A 4KHQA 4DTRA 2PYLA 3BQ0A 3S3OA 3KHGA 4JUZA 4FM2A 4CFDA 4BDYA 1BCMA 1RT7A 3OJUA 4NCAA 5DQIA 3DI6B 4B3OB 4EYIB 3OYLA 1SL1A 4HUEA 1C0TB 1JLFB 1RTDA 2D0CA 1RILA 3NF9A 3AVLA 3Q8QB 3V9UA 1I6JA 3HXMA 4JV0A 2G8HA 3NMAA 3QLHB 4Q45A 4IH6A 2XY6A 1T03B 3SUPA 3EPIA 4JS5A 1VSJA 2CKWA 4CF9A 4CJ4A 5L1LA 3A2FA 3UIQA 2O5DA 2UVWA 4R0EA 3H08A 5KG3A 3ITHB 4O3NA 3OJSA 4QCLA 1TV6A 4M3TA 4MKBA 4F4KA 4NLWA 2FBXA 4CHOA 5KFPA 3T1AA 4HCBA 3QEPA 1WSHA 2F96A 3NH0A 2C2DA 4YFUA 2DTUA 1W9HA 1RDAA 2FBVA 1HQEB 3HP6A 2GV9A 3VQ6A 3RB3A 3MXIA 5KFQA 2FLLA 3MAQA 3D28A 2B6AB 2HWIA 3I5CA 3CFRA 3QEWA 1U04A 4CEZA 4PY5A 4ELTA 1NNDA 3KJVB 5KRTA 4ZHRB 3ZSZA 3E01A 3AVJA 4R8UA 3PHEA 3AO2A 1L5UA 3IS9B 2Q3SA 4M3WA 1IKYA 4FVMA 1CXUA 1TKXB 4TSXA 3TQ1A 4RW4A 4MFBB 2R2SA 3D5MA 5KG0A 1TVRA 5HRRA 1HMVA 4CEDA 2AQ4A 5F8HA 5L1KA 1NKCA 3OLAA 3PW0A 4CGJA 1IKWA 4KHSA 2HB5A 3KLHA 3H5YA 4YR2A 2YNFB 4RW7A 3ICLA 3RMCA 3ZSYA 2IMWP 1UA0A 2EC0A 4IFYB 2UUTA 4WFZA 3O4NA 3M9MB 2IM0A 3L8BA 5DQGA 4DSLA 1LW2A 1RTIB 4FJKA 1TK0A 2FVRA 3GIKA 3O3FA 4F8RA 2ATLA 2IJFA 1DTTA 1RT4A 4WFYA 2JEGA 2FLPA 3O3HA 1RT5B 4LSNB 2FJXA 2HNZB 5KGWA 2ETJA 1C0TA 1JLFA 3QLHA 4DL6A 1A5VA 4ECRA 1NK7A 1SH3A 3ZT2A 4FJHA 4LD0A 4B9NA 4WZQA 4ZTFA 2HHQA 2OPPA 2W9AA 4EEYA 4JS4A 2B43A 2YNFA 4RW7B 2GC8A 1K1SA 3B6OA 3DLKB 3RR8A 4YNQA 1NK6A 3CM5A 2YNIA 1REVB 3KNAA 3VQBA 4KB1A 1T05B 4K8XA 2AX0A 1B9FA 4CJEA 4B8CA 3MR5A 1RCHA 4J9LA 4G1QA 3DLHA 1ZBUA 4BE0A 3QEIA 3PO5A 4QW8A 1X9SA 3DM2A 4TYAA 3FDSA 4IDKB 4CK2A 2W7PA 1TP7A 4J2EA 2WONA 5KFFA 3KLVA 4OPJA 3FFIB 5D3GB 4W5NA 4GC6A 1N48A 4FZYA 1TK8A 3Q8PB 2HHTA 3PR4A 3NKYA 1RDDA 4U7CA 4RW4B 3AA2A 4CHQA 1MMLA 4BWJA 3PW7A 1JXBA 4QAGA 4LSNA 4Y2CA 3TAMB 4ZVGA 4IKFA 4FJIA 1IKVB 5KFOA 2YKNA 1RBUA 2E4LA 4NLDA 3KOAA 4ELUA 1LWCA 4AHSA 3TARA 3AA5X 4OPKA 2OYQA 1W25A 2JC1A 4ZPBA 3LP2B 3DLEB 4ECVA 3T5JA 3NBPB 3OS0A 1RT1A 2HHUA 2ZKUA 2FVQA 4IH5A 3HVAA 4EBCA 4ZVEA 1JLCB 2IOCA 1W0HA 1TGOA 5EUHA 3SCXA 1VK0A 1KFSA 1D9FA 4ECXA 5KG1A 3SUQA 4I2PB 2VG6B 3QNOA 1DLOA 5KFEA 2G8VA 4NLTA 1BQMA 3M8PA 3QIDA 3OVNA 2RF2B 4E1MA 4E19A 3C94A 3IG1B 3QETA 4CEAA 3IGNA 4KKOB 1FKOA 5KFTA 1TL1A 3KJVA 4B9VA 1RT7B 3PV8A 1Q8IA 3KIOA 4KB0A 3ZT1A 1RT6B 1TKTA 3EPGA 4O44B 3IN5A 4DS4A 3PW4A 4WE1B 3LP1B 4KTWA 4LQ9A 1EX4A 2IAJA 5CYQB 3HPHA 3NE6A 1X9MA 3HT3A 3CQ8A 4IR1A 3ZSRA 4RNFA 1DLOB 4TQRA 3KD1E 3C6TA 5K14A 2V9WA 3DOKB 4M94A 1NOZA 1KSPA 1L3SA 3HKWA 4ZP9A 3KKSA 5HBMA 5J2PB 3S3MA 4J9NA 2ZE2B 5HROA 3CDWA 4W5OA 3V9XA 5EWEA 4KAIA 4KE5A 2I5JA 4IQXA 4AHRA 2BQUA 4Z0UA 1CSJA 4HCCA 4FYDA 4FK2A 3SUNA 3M8PB 5CZ2A 1HARA 3NGDA 2IM3A 1UOCA 1ASVA 4OKJA 4Y2AA 4KHUA 1NJZA 4Q5VA 3DLGA 4Q0BA 5HLFB 1NK8A 1S9GB 4J9PA 2FBTA 5KFJA 4OGCA 4TY8B 3H2LA 1Q9YA 4QWDA 2HHVA 4F4YA 5FDLA 4CEBA 1X9WA 1RBTA 4DSEA 1LWEB 3AA3A 4ZPCA 4DTOA 4FJ8A 3T19A 2R8GA 1S49A 4CEEA 3RTVA 3T5KA 4FCYA 2KTQA 5T14A 4O0JA 4E7HA 1C1BB 3RRHA 1SKWA 4KTZA 2XWYA 4NLPA 2HAIA 3WNEA 3VA0A 2P1JA 5DLGA 4B3OA 2F8SA 4URGA 3AA4A 2PY5A 4DG1A 3CYMA 3I5AA 3L3VA 4CEQA 2RF2A 4NLYA 4YR3A 4DL5A 4KHYA 2HVIA 4KKOA 2V0NA 2OZSA 4IRCA 4I2PA 1NK9A 2R8IA 1TAQA 1S5JA 5F8NA 5KG5A 5C5JA 4F4ZA 4ED3A 3PY8A 4AHCA 3QNNA 4HTUA 2HNYA 1I39A 2BANA 2ALZA 3PVXA 2YNHA 5J2QA 1RAJA 4ID5B 1S1TB 4O3PA 3WNFA 1LAVA 2HNYB 1XR7A 4CFBA 3GQCA 4IKAA 4RUCA 4Y3CA 1RT4B 4RNHA 4M41A 4EP4A 3PJWA 1BQNA 3BSCA 3MFHA 3PJXA 3SPYA 4PQUA 4I9LA 3FSIA 1EKEA 4ECZA 2IC3A 1L3TA 5KFLA 5KFCA 5HRSA 2O4GA 4Y34A 2C2EA 3KLIA 5HP1A 2WRMA 4J9MA 1RT6A 3ZSOA 5F8IA 3MXJA 4B9LA 4QWBA 4Z4IA 1TK5A 4K4TA 5DK5A 4F2SA 3HPOA 4FLUA 1GOAA 1BGXT 3CJ5A 4XPEA 3NFAA 1S10A 3M8QB 4ZMMA 1I3AA 1KTQA 5KFVA 4NLRA 1S9FA 1RBRA 4FJ9A 1R0AB 2BDPA 3C6UA 3VQCA 1CLQA 1C0MA 3OL8A 1N56A 4ECWA 1IKXA 3KTQA 2ASLA 3M9NB 4N56A 3O3GA 4LQ3A 3DLRA 2W8KA 1F21A 4F50A 4CJWA 4J9KA 3FFIA 2EHGA 3MEDA 1N6QA 3DRSA 4ZP8A 4IFVA 3QESA 4ID1A 4B9SA 5KT3A 3RBEA 3QINA 2BRKA 1QTMA 4GMJB 5E41A 3RMDA 3OL7A 3H4BA 1U09A 3MF5A 3M8SA 1JLBA 1KVBA 4CJSA 4O4GA 1YT3A 1HNIA 2IC3B 4RNOA 4FLXA 2YNGB 3FQKA 3GILA 1QE1A 4FK4A 5KRSA 2Y1JA 2ITGA 1QSSA 4KFBB 3DYAA 2XCAA 1EETA 2IGIA 4IRKA 1OS5A 4PA1A 5CYMB 4DF8A 2A1RA 5C42B 1EETB 4TXSA 4DS5A 4EO8A 2KFZA 4TLRA 2HNDA 3O4QA 2VA3A 1NKBA 3NGZA 4OLBA 3NGIA 3NCIA 3I0RB 3G6YA 2V4QA 2JEFA 3G6XA 2FVPA 4CECA 3HM9A 3KK2B 4CERA 2BANB 3OYBA 1U49A 1JL2A 4ZTJA 1YVFA 5DQHA 4Q44A 5KT4A 4K8ZA 3RMAA 3AO3A 3FQLA 4CFAA 1BHLA 1WAFA 4G3IA 1B92A 4E89A 4CESA 1HQEA 5HP1B 3LPTA 1LW0A 5SWMA 1QUVA 1HNIB 3LANA 4R5PB 1JXLA 4KB7A 4Q43A 2VG5A 2KZMA 4FJ5A 4N47A 3OHAA 1VRTA 3OYMA 3AVHA 3BSNA 3MEGB 3BQ2A 4M3YA 3JSMA 1SH0A 4M95A 1D5AA 3HVWA 3VQAA 1GX6A 3RAQA 2J6SA 1TKZB 4H8KA 1SUQA 2DFHA 3SNNA 1K1QA 3S9HA 1NOYA 5CYMA 1CZBA 1U48A 1WSFA 2NUBA 3DI6A 3QO9A 4B08A 4H4OB 4K4WA 3VQ5A 1NKEA 5SZTA 3ZSWA 4URQU 1YTAA 3N6NA 1L3VA 1SKSA 4GVMA 1LWFB 4FJJA 2XY5A 3KLGB 3RB6A 3ASMA 2RDJA 3VQQA 4RW6A 1NJWA 5KG2A 3CFOA 3GIIA 4NCGA 4KHNA 4KO0B 4DLGA 1QSYA 3CG7A 5HLFA 4XPCA 2DFFA 4WZMA 3OS2A 5DLFA 3THVA 4MK8A 4NLUA 3DRRA 4AHTA 4BE2A 3QZ7A 1KLMB 3H5SA 2J6UA 3I5BA 3ALYA 2W7OA 3C6UB 4E7KA 2QXFA 1RA6A 1VSFA 4NZ0A 3RR7A 4DTJA 2IBKA 1HJRA 2QV6A 2X74A 1EP4B 1N5YA 3LDSA 1YVUA 4MQ3A 2E9ZA 3V6JA 2XY7A 3PR5B 2YNHB 5J2QB 3P1GA 4WXOA 4GW6A 4KHWA 2ZE2A 5J1EB 5HROB 3TI0A 5L1JA 4FZZA 5KFZA 4TYBA 5F8JA 2E6LA 4FLYA 2OPQB 3QIPB 4CJLA 4RW8A 4DFMA 3L2VA 1N4LA 2HWHA 3OHBA 5C25B 3ISNC 3JSMB 4MH8A 4G1QB 2VG7A 1IKVA 1RA7A 1BL3A 5KT6A 1JIHA 2IM1A 4KV8A 3KHRA 4KHRA 3UR0A 1XC9A 4ZP6A 1RT1B 1HQUA 4Y1CA 3H40A 5L1IA 3AVCA 5KFKA 5FRNA 2GUIA 1QS4A 2P5OA 2R2RA 2RPIA 4Y1DA 4CJUA 4CK3A 4PWDB 3C95A 1RYRA 4CIGA 4M42A 4KSEB 1UWBA 3KK1A 3EY1A 4CJPA 4IBNA 1JLAA 2WK4A 3TABA 3SUOA 1RDCA 4PWDA 3KK3B 5KFAA 2EX3A 4IH7A 2D0AA 1TL3B 2RDIA 4IFYA 4TQSA 2WHOA 1D1UA 4Z4EA 5L9XA 4DTMA 4I7FB 4ECTA 4O44A 5EWGA 3TAEA 2WONB 3ULDA 2G8FA 3KKRA 4CJQA 2W8LA 2WCXA 2WTFA 4DTUA 3I8DA 4NRTA 3HVTB 4ICLA 2X78A 4K4UA 4LY7A 1BQNB 2B5JB 1LWFA 2ILZA 1O1WA 1D9DA 3HK2A 3VQEA 3L2QA 4JV1A 4C8MA 4DQIA 3IS9A 2BE2A 3BSOA 4O5BA 4PUOB 3OL6A 1T8EA 3QGIA 5J2PA 4CIFA 3RWUA 2HMIA 1S0NA 5DG8A 3E51A 5I3UA 3DLEA 4RNNA 4DSKA 3V81A 4ZVHA 3V1OA 3K57A 5J2NA 5HRPA 4LH5A 3TAMA 4OVLA 4E7IA 2D5RA 3DOKA 1TAUA 2YKNB 1SV5B 1D0EA 2G8WA 1JLAB 1BIZA 1Z26A 4J9QA 4B8AB 3K5LA 4ED1A 4WFXA 3OSNA 4IRDA 4JV2A 3PW2A 4CCHA 3LAMA 2QKKA 4AHVA 3PX6A 5DGBA 2IM2A 2A1SA 5DMRA 1ITGA 4X2BA 4JRQA 4KTQA 4EP5A 3HYFA 1TL1B 2HHWA 4C8NA 2WOMA 3JYTB 1TKTB 3AVGA 3GIMA 5K14B 1FXXA 4B9UA 2R7YA 3DOLA 1RT2B 4DSFA 2FVCA 3U6FA 3OYIA 4IOBA 4O3SA 3AVIA 5KFHA 1QAJA 1A5WA 3K5NA 4OGEA 1S1UA 3CWJA 2ASJA 4O4RA 1BIUA 1XWLA 1RYSA 4CGIA 3CIZA 5C42A 3BGRA 1WSJA 3KHHA 4N76A 2P5GA 2XI2A 5DGAA 1S0OA 3OYHA 2OPRA 3BJYA 4CFCA 1S1WB 4XIUA 4CEFA 1IH7A 1BQMB 1JLQA 1TQLA 5HRNA 3ZT3A 4FW1A 3SFGA 3ZT0A 2OA8A 4E3SA 4CHPA 4R8UB 3G0ZA 1G15A 4CGGA 4E1NA 3OSPA 1RBVA 1JLCA 2HVHA 3K5MA 1XI1A 3QYYA 1LW2B 4KRFA 4JRPA 1HQUB 3SQ4A 3UQSA 1NK0A 2WOMB 3KHLA 4QW9A 4C8LA 4Q0BB 3V1QA 3MFIA 3NAIA 3OYEA 1TKDA 1ZTWA 3PX4A 2YKMA 1C6VA 1WN7A 5KG4A 3EYZA 4DMNA 4TY9A 4ED0A 2KW4A 4CJTA 3CDEA 4FS1A 4M3ZA 4KPYA 3AVAA 1TVRB 2BR0A 1LW0B 3TVKA 5KG6A 2D3ZA 3LALA 4RW9A 4O0IA 5KFWA 1VRTB 3OYDA 4MIAA 1S48A 4LH4A 2Z1IA 1MU2B 3L2RA 3LZJA 3WNHA 3L2WA 4M3UA 4HVJA 5KFUA 2J6TA 3Q8SB 4Q8FA 4O55A 3OY9A 3OYJA 3SJJA 3DLGB 3ZCMA 3ITHA 4C8OA 4O3OA 1N6QB 3MEEB 3QEXA 1RT5A 2AGOA 5F8GA 4RG8A 2VG5B 4CF2A 2ASDA 4OKKA 3H5UA 4H54A 1FK9B 3AVKA 4ED6A 4K50A 4I2QB 3DOLB 2HNZA 1VSIA 4M3XA 4CGHA 3N6LA 2XGPA 4YP3A 4U6PA 1BI4B 4WXWA 4DTXA 1XR6A 1SUQB 1JXEA 5I3UB 5KT7A 1GOBA 3HO1A 1J5OB 3VQ4A 4DQRA 1GX5A 3V6HA 3QGGA 2HHSA 4KO0A 1IM4A 4BACA 3I0RA 2R8KA 1WLJA 1IKWB 4NLOA 4DF4A 1NJXA 4FJ7A 3NAHA 4O4GB 1HPZB 3NL0A 2DFEA 4FBTA 3AVNA 1SKRA 4DQSA 1QE1B 3CJ4A 2FJVA 1RTDB 2LSNA 2R2UA 4ELVA 2HMIB 3CO9A 3V4IB 4EO6A 2OPQA 3QIPA 4QPXA 1CZ9A 2VWJA 4CJKA 4F2RA 4MIBA 3BSAA 5KT5A 2RKIA 1S6QA 1S6PB 3KK2A 4KBIA 3RB4A 4CIEA 1KCFA 3NF8A 2YNGA 3B6PA 2Z1HA 4DL3A 4FJLA 4ZPAA 4FLTA 4XO0A 1HPZA 5JXSA 2CJQA 4F4XA 2XGQA 3SFUA 4DEZA 4DL7A 1DTQA 3OYKA 2E6MA 5C25A 4ZHRA 3NAEA 4PUOA 4IR9A 4EZ6A 5KFYA 5KFGA 1EXQA 5I42A 2AX1A 4EBDA 3VQPA 4CF1A 1FKOB 4CJRA 2P51A 3VQSA 4OKEA 2G8UA 3QEVA 4DTSA 3Q8RB 4NLVA 4BDZA 2AWZA 5DG9A 5F8LA 3HP9A 4FJXA 1IKXB 3LP0A 2YNIB 1RTHB 3TANA 2X6NA 3IAYA 2I1RA 4URSA 2OPSB 3K58A 4C8KA 4ZP7A 4Z4FA 3VQ7A 1VRUA 3RRGA 1SL0A 3M8QA 3TAQA 3V81B 1NHVA 2JEJA 2F8TA 3CJ2A 3HSTB 3DYAB 3IRXB 4DL2A 1SL2A 3CJ3A 3SQ2A 5EDWA 1C2PA 1Q9XA 3LPUA 3DRPA 4YMEA 2UVUA 3KK1B
chains in the Genus database with same CATH superfamily
4OYAA 1WBDA 3UB5A 4YOVA 4RU2A 1YBAA 1VAZA 4LVNP 3AHPA 2O8EB 2Q1NA 1ZBLA 3M3ZA 3GFYA 2HS4A 2V2KA 3MTKA 1RHQB 5D0HA 1UFWA 1JLGA 3MEKA 4FJGA 1U02A 3EMTA 3O9RA 3W1YC 3KJFB 4CHZA 3KLIB 5CHIA 3ZTOA 1ZETA 4OJGA 3LDOA 2BM0A 3KMSA 2JHEA 4KBOA 1OY6A 1S1XA 3SI8A 1JWWA 4RW8B 2DRBA 2FXUA 3OYNA 2VG6A 1ATNA 2V68A 3VPZA 1S7IA 4ED2A 5G0RA 2JNJA 5ITHA 4DV7J 3PW5A 1QAIA 3I0SB 1Y10A 5KFNA 2OTJS 3H5XA 2B4UA 3VZIA 3N5BA 4JI5F 1XHXA 1UA1A 2HHHF 1QQOA 1WJ9A 3GSIA 4LF6F 2PGCA 1S4EA 2NRWA 1Y5IB 2DCUB 3PO4A 5JLFA 1LV5A 2RQCA 1YJNS 2J9DE 2VFUA 2V8GA 2LXIA 1NK5A 1HNXJ 1VQSA 3ULEB 3M1VA 1HW8A 4YQWA 4NLCA 3SV3A 1IBLK 1HWLA 3C7NB 1CZAN 3HX9A 1F60B 5GMDA 5A8RB 2A0FB 2P6TA 2WAQD 4FLZA 1GK8A 2MZQA 3MXHP 1IJEB 1Q86T 1U1PA 2MZJA 1A6LA 2VL1A 1GXTA 2UUAF 4LMZA 5I9EB 1C1AA 4KREA 1HBUA 4B1WB 3G82A 3ZX2A 2P9UA 3IO1A 3HL8A 4W5TA 1QHTA 2H5EA 4ISGA 3HVRA 1YKWA 2V2ZA 2CQ3A 4GRSA 3H1VX 2P9GA 3IWNC 3A12A 5KGXA 3K0SA 1WUUA 4K42A 2O8DB 4WTOB 2W2NP 4FJMA 3CMAN 1Q81O 3UDLA 2GIRA 3IRXA 2C3OA 3PX0A 3M2UA 3T5LA 2V5HG 1FDDA 5A0YA 4X4VA 4RL1A 3QWUA 2F65A 3LZIA 3R7NB 1YWXA 2AA4A 4JI0J 3IG1A 1L3UA 3AGRA 3MMAA 2UXDF 4OJHA 3DN9A 4F3OA 4RUAA 5LSLA 1JNRB 2XHWA 1EWQA 5JS2A 1VSDA 3VEWA 4IWVA 1RWMB 2UUWA 2F4VK 4YY3K 3ZC4A 3W8GA 4MDBA 3OYAA 1VDHA 1N32F 1VBYA 3EJMA 1YJ9N 1U45A 1CS4A 7AT1B 3NGYA 4BRCA 4CHYA 4FLVA 3MECB 3O2IA 4DL0C 2R8HA 2VA2A 1ASUA 3TAPA 3GE1A 4F4WA 4BHQA 3RBDA 2MSTA 2DXEA 2HNDB 2W9BA 2BGGA 1ZAWA 1RBLA 1HKCA 2V7ZA 4CZIA 4BRGA 3U3GA 4LFAJ 1AB8A 2G8IA 3I6PA 2ATQA 3G82B 4CHNA 1X0PA 5B0BA 3AGKA 3ENHA 3QNWB 1WSGA 1SH2A 3R5BA 2OH2A 1IKYB 1T7PA 4HL9A 2POKA 2G2ZA 1NMDA 3GV7B 2E9RX 4QOZB 4X4NA 1NGFA 3E01B 1WORA 1ZC6A 4PYDA 5AT1B 2V4RA 4LJMA 1GNKA 1T05A 5EN1A 3QGHA 1C0UB 2Q3PA 2XHBA 3THYA 5ETQA 1S0MA 3G10A 3BP8A 4HI2A 3DOMB 1FX2A 4FXVA 4RU9A 1CXQA 3D0PA 4I2QA 3S6EA 1WNEA 1VSHA 4K4YA 5IT0A 1J54A 1N33J 3V2UC 4YN3B 4P72A 3PUFA 1SC4B 3CD7A 4P2SA 5KG7A 2C2RA 3UI3A 2IAJB 5C2CA 3DDKA 3KLFA 2M5YA 5M1KA 1PBAA 2VFRA 4HKQA 2G8KA 1SAZA 2RD5C 2MY8A 3U27A 2DY1A 1WHYA 3CE8A 2CPXA 1IO2A 2ZZTA 1M5VC 1NB2A 3ZSVA 3RSEA 1DQ9A 1OJ4A 2HSTA 4TN2A 3CGIA 4CEOA 3UCZP 3HFVA 4ILMA 2WC9A 3PEHA 1FI4A 3DLKA 3NY0A 1ROFA 4LF5J 2W41A 1IBMJ 5DM7L 3GJTB 3CCRS 2BABA 3BGUA 2VFTA 4NXNJ 1R8CA 4XK8C 4B3SJ 1SQGA 3HSDA 5A8WB 3OLBA 5FRMA 4HI1A 4RW6B 4W5QA 4XEIA 1S1UB 2ERRA 3VA3A 3ISZA 1JLQB 2IIHA 3MTJA 3MCSA 4M5JA 1KVAA 3OYGA 5AJ3F 1SC3B 4G1PA 1YGYA 4CO4A 2CXEA 3GL1A 3Q8UA 3UN2A 1VOMA 3D3CJ 3LP2A 3KJQB 1DARA 1EX8A 2E5LK 1MU2A 2BW7A 2CZVC 1YLXA 3MXMA 4B9MA 2OPSA 4M5DA 4PQUB 3M2RB 3BR9A 2F8EX 4WE1A 2UV8G 4J2AA 1JKHB 1JLBB 3UVJA 3MEEA 2F7VA 4B9TA 3CDUA 3HSZA 1QZ6A 3LGNA 3R1LA 2MQ8A 1JLEA 1BY9A 3AJ2A 4IFVB 1S9EA 2V8DA 3UDVA 1X1PA 3F9MA 3IBFB 2EPIA 4CT8A 4AFFA 1OYDA 3BF3A 4W4MA 1Q8BA 4K4SA 4DQQA 3MMVA 3BGOP 1GOCA 1OIAA 4CF8A 1KD1O 2CPDA 5FROA 4WQ4A 3EO3A 2JFDA 4QOTA 3V6KA 2EC2A 1FEEA 3CC4N 1CJKA 1OO0B 3LP1A 3VQ8A 1H73A 2N4CA 2UU9F 3JXOA 2ZD1A 4NCBA 3POTA 1WEXA 3HI9A 4UOFA 3NF6A 2K3KA 1JL1A 2FUG9 4Y2IA 2DXDA 5DS7A 2QL9B 4C8ZA 2F1FA 4L3KA 3T1YJ 1ZBHA 3SQ1A 3PKYA 2FBYA 1SQKA 4KHPF 4DSJA 4M5MA 3QIOA 1VR6A 4CO2A 1E6VA 4FXDA 2QFJA 5F0XA 4H0VB 3OA9A 3JSYA 1REVA 4I67A 4OI2A 2KZZA 4JYAK 3IKMA 5GAEP 4DHVA 2HF3A 1RT3B 3ET6A 4Z4GA 3UDEA 4DCPB 3SQ0A 2IIRA 4UUXA 4YB7A 3A5LC 4H5WA 3OFFA 4QIFA 2V94A 4ZVUB 4BC7A 4USMA 2B6AA 1XMQJ 1ZBFA 1OKJA 3BKTA 2HFOA 1ZZFA 3G8QA 2X1BA 4DXLA 4KH6A 4OIXA 3AVMA 4NLSA 1SV5A 2AEFA 3DCAA 2OZMA 2D74B 2GVDA 3AO5A 2W6KA 3BO2A 3NGSA 1X0FA 2PYLA 4OYZA 5A2QO 1LK7A 1JK9B 3BBBA 1T3VA 1RT7A 4NCAA 1GLDG 3QJLA 1RBOB 3D7SB 2JLFA 3MMBB 4EYIB 2RRAA 1SL1A 5M1FA 1LEOA 4RR5A 3THXB 3NF9A 3KG4A 3THPA 3LF0A 3QMQA 3A3PB 3A5MC 3H7HB 4IH6A 2XY6A 2JDJA 4JS5A 1WTFA 2AEJA 1U1RA 1Z05A 4CI6A 2LQ8A 3UKUA 1GLLO 2O5DA 2I8EA 2UVWA 3H08A 4JI6J 4EI2A 2LECA 1HWJA 2N3OA 2F9DA 3TP2A 4OZ0A 2W25A 4GV9A 4M3TA 2UXBJ 2O1PA 3D4JA 4F26A 2FBXA 1PJ7A 1KQFB 2DTUA 1BLUA 3W2WA 1RDAA 2E1ZA 3TTCA 2XMKA 3MXIA 2V50A 5KFQA 3G8TA 2RSQA 2H5IB 4DR6F 2FLLA 4OZ2A 3K8VA 3R6GB 3MAQA 4HDGA 1WC5A 3NG8A 4LFCK 2I38A 1UW4A 1U25A 2DNMA 5AQXA 1TUWA 1VJWA 2QRRA 3MK6A 2GA7A 4ZKAA 1TR0A 4PY5A 4ELTA 3HFZB 1ZBSA 3E01A 3Q23A 3AVJA 4GY2B 2RE1A 4R8UA 1U1OA 4ILRA 3HHEA 2J7KA 4C2MA 1NUEA 3BKFA 3MX2A 1Q5VA 1TKXB 3HTVA 4TSXA 2B51A 4DBQA 3I9ZA 4MFBB 3J7ZO 1HMVA 2GV1A 5L1KA 2PI5A 4OLPA 2AD9A 5M1NA 3D2EB 1F2GA 3H5YA 4YR2A 4ETZA 4RW7A 1S76D 4D3GA 3GFZA 2EC0A 3R3LA 3UKRA 4JI6K 2IM0A 2RHKA 4DSLA 1EZZB 1RTIB 4JI1J 2IJFA 3SAFA 2AEMA 3O3HA 4LSNB 2ALYB 3VGTA 4MO4A 4CLYA 2OKQA 4L74A 3FFKB 4ISEA 1NU0A 5LL6d 2DEIA 1PIEA 2A6OA 2OPPA 3NOCA 4JS4A 2YNFA 2GC8A 3IM8A 3B6OA 3M2VB 2DNNA 3L95X 3M6UA 5ETTA 1U1QA 3O4WA 4F02A 2WW4A 2YNIA 3KNAA 4YUDA 1W26A 1YIJN 4NA1A 1Q5YA 2RS2A 4RBUA 3R5CA 5AQQA 3QEIA 4FNHA 3B4DA 3EE3A 2XMTA 4TYAA 3CC7N 3FDSA 2JX2A 4IDKB 3ENAA 1KVIA 2WONA 5LJ5Y 2YWWA 3EEQA 1N48A 4FZYA 2O8CA 1U6FA 4DV0F 1TK8A 3Q8PB 1EWRA 3VF0B 3TW0A 3PR4A 3NKYA 1V6HA 4U7CA 4PPZA 4OYMA 4FF1A 2Q43A 1AUDA 4QAGA 2V4JA 1YJUA 2IMOA 3TAMB 3C8YA 3ZTSA 2IVPA 3NS7B 2P2CB 1FRJA 2CPYA 1LWCA 4C1NK 2KN4A 4WU2A 1HNWF 2CJBA 2MSSA 1JJ2M 4OPKA 1YZ6A 2BJDA 1N54B 3FK4A 4ECVA 1RT1A 5BR8J 2HHUA 3W2VB 2ZKUA 2RRNA 4IH5A 2M52A 1JLCB 3O80A 4B1VA 1FNXH 2UP1A 4GVBA 3R5AA 4RBVA 4ECXA 2BJ3A 2HVDA 1PSDA 2VG6B 4F0MA 2LU1A 1VQPS 1NGBA 4DMZA 2WBMA 4TU8A 4JKAA 3ZZRA 5CCMA 3SEOA 3L4QA 1H72C 2OMLA 3OVNA 4JI8F 4DJBA 3OPKA 2Y3YA 4JI7F 3ATVA 4KKOB 3AXMA 2VQFK 5KFTA 1N36K 1RT7B 2FD2A 3KIOA 1HR0J 1V5VA 3G87A 4OFZA 1XERA 2ZBCA 2A42A 3LP1B 4ZIWA 3CXCR 2Z8QA 3CIMA 3HPHA 5F2RA 3NE6A 1NBEB 3WXKA 1HX1A 4H5VA 3ZSRA 3VAFA 4RNFA 1DLOB 2C1EB 3DOKB 4ES3A 1QAXA 4DV3K 3HKWA 4ZP9A 2ATCB 4B3RF 3CF5L 4J9NA 2ZE2B 3CDWA 4DR6K 2NSCA 2I5JA 1YTYA 1I5OB 1VMBA 4WJBA 2R7VA 3T7ZA 2DR6A 4HCCA 5LJVA 4FK2A 2IVNA 2AYGA 3CD6N 2NZCA 1UOCA 1JQGA 1ASVA 1R27B 3UKRB 4KHUA 3PFEA 3DLGA 3ENWA 3TNVA 1GLJO 5HLFB 2NRVA 1N33K 1S9GB 2FBTA 3R27A 1Q9YA 4QWDA 1UEKA 3U7JA 3RW6A 4B3TF 1MSWD 1X9WA 3H46O 1RBTA 2W4PA 1LWEB 1XMBA 3MPVA 4DTOA 2LA4A 2R8GA 4CEEA 2P5VA 2VPWB 4AL5A 3T5KA 4DU8A 1C1BB 1RLDA 3W8PA 3K5PA 1YG0A 2WFBA 2XWYA 3MPYA 2P1JA 4B3OA 3GG1A 4ETXA 1YJVA 4YOTA 2PY5A 4DG1A 3CYMA 4CEQA 3Q2SC 4YR3A 1VQ8S 2DEJA 3FEZA 2HVIA 3C65A 2OZSA 1CQNA 5CR4A 2DTJA 4AM6A 1MDUB 3U4LA 1RCXB 4PKDB 3AD8C 1S5JA 5KG5A 4YDXA 1PBUA 4F4ZA 3CMES 4LF9K 3QNNA 4HTUA 1I39A 3U8XA 4UOGA 4ZJQA 3PVXA 5J2QA 1KNZA 2IRXA 4ID5B 4ZA1A 4JYAF 5IT9O 2YPYA 2QLJB 4JN4A 3JXUA 3OXFA 4DPOA 4Y3CA 1RT4B 2ZVSA 4M41A 3NGUA 3BSCA 3D66A 4DKWA 4ECZA 2IC3A 2R7QA 5HRSA 2CIMA 2YHWA 5KPRA 1K8KB 2QA1A 1ITPA 3VAJA 2CVEA 1F3VA 1T9UA 5HP1A 5B0EA 4J9MA 2UU9K 1RAHB 2DGVA 2J8SA 4B9LA 2ZWHA 3FBFA 2V69A 4K4TA 4F2SA 2HBKA 4ZCIA 4KYZA 2OEJA 2HQIA 2J0SD 4XPEA 3C16B 4F04B 1MMNA 1HQ2A 3SMSA 4NLRA 3FR0A 1S9FA 4FJ9A 2A10A 4AXJA 4PXDA 2KXFA 3CHWA 1VBXA 4ZDNA 1C0MA 1FHTA 4FYYB 3OL8A 4ECWA 1KKHA 5IWAF 3FZHA 3O3GA 2VC1A 2EWSA 4MMOA 3C0BA 4J9KA 2EHGA 3MEDA 1IXKA 3QDKA 4ID1A 3S7RA 1RK8A 3O8WA 1WG1A 1R43A 3QINA 5AQUA 5E41A 7FD1A 5M1PA 1EKRA 4P7TA 1U1MA 2MLZA 3M8SA 3KUHA 3IR6B 1QVGM 3HRGA 4UUWA 4FLXA 1BDGA 2Y1JA 5D77A 3DYAA 5U47A 3FBBA 1CC8A 5DRKA 2MQQA 5CAAA 4UT4A 4DV2J 3QT7A 5AQMA 2IGIA 2OFHX 1B0TA 4JNEA 3Q8YA 5CYMB 4DF8A 1RTZA 1EETB 1RP5A 4M7YA 2DHGA 4TXSA 4U9RA 2KFZA 1LXNA 2L48A 2VA3A 1BQXA 3I87A 1NKBA 2CNKB 4ZPWR 2LCWA 2JEFA 3G6XA 2FVPA 3AD9C 2NRXA 4YDDB 4LSZB 3OTOJ 1M1KT 2GQCA 3OYBA 4HH1A 4ZTJA 5DQHA 1JCEA 4A48A 3E3XA 3WQUA 1VQ4N 3RMAA 3AO3A 4H0PA 1NSQA 2QXLA 1C0GA 2B4PA 4G3IA 4UZCA 1IVZA 3LPTA 1LW0A 5SWMA 4X66K 1QUVA 4BGBA 1K73T 3THWA 1J5EJ 3AOCA 4FJ5A 3Q8VA 1VRTA 1CEZA 3BSNA 3MEGB 3AY9A 1IQZA 2N3LA 3PEJA 4DUYJ 4OX9J 4M95A 3QSIA 4DV6K 1KC8T 2E44A 4JB8B 3BUZB 3VQAA 1GX6A 4ERDA 3KDNA 2E8AA 3WDOA 3S9HA 4R25A 4A62A 4BR0A 2NUBA 3QO9A 4B08A 2E5GA 4H4OB 1NKEA 1ZA2B 1XNQJ 5SZTA 1WG4A 4URQU 1YTAA 2ZWPA 5LJWA 4LREA 1L3VA 1SKSA 4GVMA 2VONA 2WVEA 2XY5A 3RB6A 3ASMA 4FP9A 3DXKA 3VQQA 5BR8K 3D6TB 2FYXA 4RW6A 2PFFB 3RU0A 1QSYA 1X7VA 5HLFA 4XPCA 3WIUA 2DFFA 1DRZA 3VEXA 3THVA 1JJ4A 2Q0UA 4JI4J 3I5BA 3J7Z5 2Q2RA 1NZAA 3W2WB 3UKUB 1RA6A 5I3QA 1RLCL 2EK6A 1X9JA 4DTJA 4H4KC 2X74A 2NZTA 3LDSA 4MQ3A 2LKZA 4A8WA 1NBWA 3TI0A 3ILOA 4USJC 5BR9A 1VLOA 4FZZA 4TYBA 5F8JA 4CDIA 2A18A 2K1RA 5ETKA 3CCMN 4RW8A 3L2VA 1N4LA 2FHJA 4C4WA 2XS7A 1B64A 3GCWP 5C25B 5HVFA 5RUBA 1CJKB 4MH8A 3R5DA 2Y1LB 4JI5J 2VG7A 1RA7A 1Q53A 1XQSC 5KT6A 2J9EA 1BL3A 3HDSA 3U1MA 1U8SA 5AZJA 3CF5Q 2E5LJ 4XH1A 3N0VA 4YY3F 1HQUA 1OMSA 3O1WA 3CJRA 3P38A 2ZGZA 5L1IA 1T9YA 3AVCA 5KFKA 5FRNA 2ZHOA 2VDIA 1QS4A 4DV6F 2RPIA 4CJUA 3ENQA 3VF6A 1G7CB 1QJHA 1MWZA 5HMZA 2XB2D 2ZC3A 3KK1A 4CJPA 1JLAA 3SUOA 3TZZA 1RDCA 2LFVA 4FPBA 2GMLA 4YOEA 1URRA 1TL3B 1D1UA 3MAAA 2DNYA 5L9XA 4ILJA 2P8IA 3DRYA 4ECTA 4O44A 2GVZB 4AD6A 3ULDA 1S72S 4YOWA 4CP5A 2HZAA 4LF5K 3EXCX 3TJ9A 1DKGD 2ROEA 4DTUA 1XJWB 4EU0A 2BJ8A 2CDQA 5G4DA 1E4FT 2KLAA 4K4UA 2HOEA 3BSOA 2BE2A 3OXLA 4CO0A 3DRXA 4CJ7A 4O5BA 4PUOB 1T8EA 4CIFA 3DOMA 2G1HA 1KVKA 3RWUA 2HMIA 3UFCX 3DLEA 4B3MJ 1C4CA 2YX7A 4ZVHA 2JH3A 4RWXA 4K2XA 3VVUA 1FCAA 2R4FA 1XBWA 3KJNB 4OVLA 4E7IA 4LIWA 2NXUA 5BPMA 1K73O 1NAQA 3H0PA 1IBLF 1SV5B 1BIZA 4ED1A 4WFXA 2B3TB 3LAMA 1GT8A 4V19S 2G4BA 2ZGYA 2IM2A 4K2JA 4GO5X 3I55S 5DMRA 3BB5A 3HYFA 2EFQA 1Q95G 3OR1A 1R0BG 3PFOA 3JYTB 1NPPA 3CJ8A 5GAEU 3D2FA 1KS2A 1U1KA 1SC1B 2EBGA 4WKYA 2ZJQL 4NLBA 2BTFA 2R7YA 2HHHK 1RT2B 4DSFA 2FVCA 4HH0A 5IWAK 4IOBA 3AVIA 5KFHA 1QAJA 2CQPA 3FLCO 4O4RA 4HT5A 1S12A 3U9DA 2O3DA 1MWYA 4ZVRB 2XI2A 4PHTX 3MM7A 3MM6A 5MAOA 1EKSA 1S1WB 4OV1A 2BXJA 4XIUA 4MKYA 4NX9A 5KPZA 5EOYA 1JLQA 2A3ZA 1M90O 2HAFA 3ZT3A 1HD0A 4R8UB 3G0ZA 2EW9A 3HZ6A 1JLCA 2HWTA 4J9VA 2I7NA 2Q36A 4A8XA 1GMUA 1SXLA 4KRFA 5AQRA 3D6RA 3SQ4A 2I9SA 1Q18A 4QW9A 4C8LA 1N0UA 2RUSA 3PYEA 1NGHA 3FNNA 4TY9A 1T9VA 4CJTA 3CDEA 4M3ZA 2F8MA 4KPYA 3AVAA 2BR0A 4XH5A 3WQTA 5KG6A 3LALA 4O0IA 3TA0A 1FW6A 4OQJA 4PRFA 1S48A 4LH4A 3V4MA 1MU2B 3NNAA 3WNHA 3EGWB 1YI2S 3T6BA 5H9EK 4DR1J 4MDAA 3P39A 2OEKA 1PYSB 3MDFA 2UXCF 3GU0A 2ABYA 1RT5A 4I68A 1YRXA 4Y65A 2DRDA 1FK9B 4F25A 4I2QB 2HNZA 1PC4A 2DIVA 3N6LA 2XGPA 4DTXA 2Z56B 1IN0A 3NGRA 2QL5B 2QI2A 2Z0GA 5LMNJ 4CM0A 3NMUA 4B3SF 2HHSA 1IM4A 1VQMN 3THYB 1J27A 1HKBA 1IKWB 1WLJA 4FJ7A 4O4GB 4C98A 3NL0A 3VAHA 4FBTA 1ZH5A 2XMJA 4OZLA 1IR2A 3LDQA 4FWNA 2N7CA 1RTDB 4JI2J 4EO6A 1KAXA 2QL7B 1GLFO 5LMUF 4QPXA 2Q31A 2YX4A 5CA5A 4CJKA 2RJZA 3BSAA 1PGZA 1S6QA 4JI2K 5LMUK 1S6PB 5M1QA 3RUBL 2E66A 1HBMA 1YK9A 2L41A 3ENOA 4N77A 3SAHA 4B3RK 1WKKA 2LQBA 5BRFA 3NF8A 3R97A 2ZJQQ 2Z1HA 1UVJA 3CJ9A 4FJLA 2F3JA 2RU9A 4QIEA 3AODA 2XGQA 4DUZJ 3KWIA 4NYPA 4DL7A 1YI2N 3NNHA 1VIOA 5GADI 4DPWA 1HL6A 3A5OC 4PUOA 1IJJA 3JTOA 4EZ6A 2ASMA 2MZSA 3PYFA 5KFYA 1Q8LA 4OZNA 5I42A 4AL7A 3VQSA 2G8UA 1N36F 3CPWM 4QR2A 4JI7K 3Q8RB 2FSKA 1VJQA 1AT1B 5B0AA 4JI8K 1U1LA 1IKXB 3SQOP 3OFHA 3DDIA 3S01A 4BROA 5HJYA 3OT9A 2GGPB 4YEAA 3H3NO 1VRUA 3B82A 3RRGA 3A0IX 2CH6A 3V81B 1NHVA 4YORA 3UVJB 3LPYA 2AJ1A 4FPRA 2MKCA 5EDWA 1C2PA 3TR5A 5L8RC 3JQMA 1Q9XA 2R7OA 4BR4A 2VOPA 3DRPA 4YHHF 1C0FA 1U24A 4ATNA 1Z2LA 3CJ7A 3VV2B 1ZBTA 1FJGJ 4MKAA 3FZ2A 1X4AA 3IM9A 5CH7B 1ASWA 5THWA 5KFBA 4DLEA 2R7TA 4PZVA 2YCHA 3O9SA 2R2TA 4AILC 1H7XA 2AU0A 1HRHA 1FX4A 2B56A 4JLHA 3TOQA 3H59A 1WC0A 1BMQB 3O8MA 2IA6A 3L2UA 2BA9A 2VV5A 4MFBA 2BRLA 2Y0BB 1VQ9S 2HW3A 4NLXA 1X4FA 3EZWA 3V9SA 1KTVA 5KI6A 2ZBQA 3N9UC 3SBMA 1TELA 4DV7F 3UD3P 5A2QY 2JSXA 2N82B 5IV3A 1S97A 1KHWA 4K25A 2IRUA 3WC0A 3HOSA 3IBCB 4PPDA 4PQAA 1LNQA 2D7SA 4HT7A 4PKIA 2XO7A 3HZEA 3ZNUA 1R3NA 4LF6J 2Z2YB 2QN6B 4C3LA 5KTQA 1S1VB 4NLGA 4GVLA 2M3DA 2DO4A 4HTJA 2JGUA 2NYIA 3D67A 3FMBA 3KMQA 4JI6F 3SMPA 5G0RB 4OV6A 1RT3A 2AGPA 2HBLA 3B78A 2XLJA 2ASPA 5DDRC 3I0SA 5D0RA 3DWLA 1WNSA 4JEPA 1FKPA 1S1XB 2PZSA 3R6MA 5KFXA 4FW2A 3F56A 4OHWA 1FDBA 2W42A 3CCQN 4LC9B 3TSQA 1JJCB 4DR6J 2ZH9A 1MG7A 4ZPDA 3SBGA 2YJEA 3LWLA 5I42B 3D54A 4O3QA 1O0PA 2IDOA 1U0HA 4FBUA 3M8RA 1BISA 1MWKA 3TPQA 3I55N 4PWWA 4WCEQ 3FSYA 1FDNA 1AFIA 1LAWA 1RNHA 5E5NA 3DRPB 2GVDB 3TX8A 4CZCA 3MHYA 1FNOA 4AYBD 4CM2A 1A5XA 1GEHA 1ZTTA 3DRRB 2F9JA 1UEUA 5C24B 2XC9A 3HPGA 3TUPA 4A59A 3N28A 2BBEA 4RZRA 5KT2A 3MEDB 3UW1A 3J7ZT 2R7WA 2ZJRL 2E7VA 4DQPA 2HVZA 4L3NA 1LWCB 3R1HA 4NYNA 3RAXA 2AJ4A 3WX4A 4M3RA 5FLXY 4BC3A 3IUCA 4GV3A 2NRRA 3C15A 1UPMB 1J9AA 1SZ2A 3SV4A 3KK1B 5J2MB 1K0VA 1WOQA 1RBAA 4DPTA 2QYCA 2GEMA 2DR5A 2Z1JA 4BQLA 4NL5A 3OUYA 4CJVA 3TJAA 4AT1B 4I6MA 4PXEA 3G71S 1HHSA 5EU7A 3R6LB 1HNVB 2KDOA 3FRZA 3S8SA 3SI6A 1MW7A 3BGRB 3IAM9 5EX5A 3L3CA 2O8FA 1U8WA 3FJ2A 2HGMA 1SI9A 4CJFA 2AGQA 3SCKE 3EZOA 2DHXA 4OLAA 2C22A 2B7BB 2FQQB 2QSWA 1KEKA 4KH0B 4V1Ak 2IYGA 2B5JA 3C46A 1HW9A 4NXMJ 1RTIA 2CGKA 3UDCA 3NCPA 5CY4A 2ZBPA 4NRUA 3JAMO 2FJWA 4FWQA 4DTPA 3QT6A 2XZWA 3JSBA 4WF9L 2CADA 3W5ZA 3VQ9A 1X4HA 2JC0A 5BR8F 1C0UA 3MMAB 1XQIA 3H3OB 1C1CA 2BE2B 1FD2A 2J7WA 2BQ3A 3BQ1A 1DTTB 2IRYA 5B09A 1VQ6S 2A6MA 5AQLA 4USWA 2OPRB 1I94J 1RI7A 1WACA 3CVKA 3SDEA 5DZ7A 3HD1A 2N4DA 2ZKTA 5FPEA 4FK0A 4N41A 1X4CA 4FVUA 5HBMB 4ANEA 2FF3B 2COLA 4HWIA 2ZQBA 3SK3A 3NH2A 2PEHA 2FLOA 2W9BB 2GW8A 3EZUA 3MCNA 5HSPA 4J2DA 1K44A 4NEYA 1H2TZ 2Z1GA 3E9OA 3C6HA 4QWAA 1VQNN 2HBYB 3SXLA 3CCUS 3LWMA 1FRXA 4C1NI 4BRPA 2ZUAA 4CGFA 1JMTA 4WFNL 4HYKA 5IT4A 2EG1A 2G13A 2MTLA 2C2MB 1GXUA 1C1BA 3QFWA 4HACA 3MN5A 1S1TA 3H98A 3UPFA 1CVJA 2QE5A 3NH1A 3DM2B 2VB6A 1DTQB 3DRSB 3OYFA 2KHOA 1V4SA 4X4OA 3IFEA 2YHAA 3EICA 3J80U 1QY7A 3MAHA 2P9IB 2BZ2A 3KG0A 1VQ6N 2AYMA 3VAGA 1EHWA 2PN6A 5BJRA 2MHNA 3MM7B 2APOA 3UR3C 5C7PA 5J2MA 4CLLA 3FGUA 3DLBA 2Q79A 4RNMA 2DGUA 2ACYA 3TTDA 2E9TA 5D0EA 4ISFA 1SKUB 3LAKA 3AO1A 3E8OA 2GS8A 1HYSB 4NLQA 2I5JB 5A8KA 1S4FA 1OH7A 5DZ6A 3M2RA 3PIOQ 1RT2A 2OUGA 4C9DA 2KM8C 1FWPA 4LIRA 3D1QA 4PAAA 3L7PA 1KRPA 2OIHA 2OJ3A 3CJQA 5H9EJ 3O5TB 2C28A 4ED5A 1S6UA 3TTFA 5KFDA 5EWFA 3MR2A 2NQPA 3NF7A 5LM7E 2CQBA 3KLEB 2LXUA 4DG1B 3U3YA 1LWEA 1U6ZA 1T3NA 1BCOA 4WKRA 1JXVA 2O4IA 3P96A 4MLEA 3U02A 2V34A 3C6TB 3V9WA 1NDKA 2KVIA 1T9WA 5E3CA 1QQMA 4NCGB 4K4ZA 2GUPA 1XHZA 2BH1A 4DV5J 4FWLA 1Q7YT 1IR0A 3NS5A 4MK9A 3CCJN 3NRBA 3SYZA 4FYVB 3QZ8A 4JKEA 4DZDA 2BW2A 2DISA 2NRHA 4LF9F 3QAUA 4B02A 4E7LA 2U2FA 5ETMA 3HJFA 3AV9A 3MR3A 3CCLN 2VC0A 3ENBA 1OPIA 1JKHA 1ZYQA 4FOIA 3G96A 2HLUA 3ZTPA 1FXLA 4EYHB 1CJTA 3CPEA 1Q0NA 3W9IA 5AQGA 2QO3A 4RUBA 4DTRA 3D6MB 4H5RA 1CJVB 5BRDA 2C42A 3S3OA 2ZEJA 2O67A 1BE4A 2QWPA 4BG8A 3CJCA 2B8PA 3DI6B 4B3OB 1UCNA 4ENOA 1S99A 1C0TB 1JLFB 4RX6A 1RTDA 4UTGA 4DV5K 1RILA 3JTNA 3AVLA 3E66A 3R2CJ 3CETA 4WFBL 3HXMA 3EGZA 2F4VF 3BGLA 4Q45A 2LVWA 3SUPA 4OI6A 1V9OA 1YIJS 1JCGA 4K43A 3CI5A 2EFVA 4HACB 3A2FA 3UIQA 5MLCV 4R0EA 4KJIA 1H7WA 2A40A 4O3NA 3AAWB 2Z58B 1TV6A 1ZS6A 3UO0A 2JLGA 3K9KA 3MPDA 1G4CA 4O0NA 2QWQA 4BLGA 2ZJPQ 2E29A 5KFPA 4DCOB 3QEPA 3BF1A 1W9HA 1KXPA 3T41A 1H74A 2OMOA 3HP6A 2DVIA 1HNZJ 4R79A 4RWTA 2PMWA 3KDOA 3MWPA 2ZH8A 2B6AB 4USHA 2KL8A 2FGOA 1NNDA 3KJVB 1HA1A 4DV3F 1RGIA 1X3MA 4CLZA 4ZHRB 2ZDPA 2XZDB 2GJFA 1VBKA 3EE9A 3N79A 1BWVA 2UUAK 4FVMA 4QYZJ 1RFQA 2QW9A 2D9PA 3TQ1A 3CMAS 1SIWB 2MEWA 1TVRA 5HRRA 2G0CA 5C2GA 1WB9A 4C97A 3PW0A 3PG9A 3NXZA 3VGLA 1IKWA 4MIWA 2MDAA 4A47A 2HB5A 3KLHA 3LL3A 1Q81T 4NB4A 2YNFB 3ICLA 3RMCA 3ZSYA 5LXRA 3DXMA 2P9LB 2UUTA 4WFZA 3M9MB 1LW2A 4W92B 2HFUA 1T0TV 1TK0A 4F8RA 2ATLA 4GNIA 2J4RA 1RT5B 2FJXA 5KGWA 4C23A 2X1FA 1M5KC 4DL6A 5D4NA 1NK7A 4C0HA 3NNCA 4CI0B 1HNWK 4B9NA 4LF4J 1GXLA 4CIOA 2GHPA 4BGAA 1NJIO 4AXIA 2B43A 4RW7B 2CNOB 1Q86O 3RR8A 4YNQA 4WBFA 1FVSA 4DV7K 4L3QA 3IP0A 1JB0C 3VQBA 4KB1A 2RB7A 3B8HA 4HHHA 4CJEA 4OHYA 1S22A 4G1QA 3DLHA 4DV0K 1X9SA 1G1XA 1NGIA 2HURA 4P71A 1TP7A 1I94K 4LFAK 2CZ4A 5EX0A 2P9KA 4JK8A 4J2EA 3KLVA 4OPJA 2YWEA 4GC6A 2QLXA 2VOOA 4JAXA 2HHTA 4NO7A 3FKBA 1TTHB 1MMLA 4BWJA 3PW7A 4CD3A 2D9OA 3K89A 4DI6A 4Y2CA 4ZVGA 3W62A 4Y2KA 4RLEA 3VEYA 2ADCA 2YKNA 5DDOC 2D69A 4YHHK 3PACA 4ELUA 5GINA 3W9HA 5ELZA 4AHSA 3BH6B 1RKJA 2JC1A 4DR7J 1UVKA 4YY3J 1H98A 1HLWA 3PIPL 2MQLA 1W0HA 4QIGA 3MMCB 1VK0A 3HD2A 5KQ8A 1SCJB 1D9FA 4I2PB 1CJTB 3QNOA 3VEOA 1NDCA 1DLOA 4KT0C 4RTFD 3EDQB 4IXCA 2G8VA 1F5BA 3HSCA 1BQMA 5KOXA 5B0DA 3A8YA 4E19A 3MN6A 1D4XA 3IGNA 5AQWA 2P9NA 4BR5A 3D9BA 2A3JA 2PA3A 2DNPA 4CWBA 5DM7Q 2W4DA 2VCPA 3H90A 5AFUA 5IQQA 4QYZK 3GDQA 4DS4A 1PYOB 3EVWA 2D0OA 4LF4K 4KTWA 4LQ9A 2IVOA 2IAJA 3I56N 4IYQA 1HUXA 2G2YA 4TQRA 3M6XA 2ITMA 3C6TA 1BA1A 4M94A 1KSPA 1FXDA 3HHLA 1GLEG 2RQMA 4LFCF 1X60A 4DV4J 4KAIA 4KE5A 1Y5LB 2Q1LA 3ZX3A 1X5PA 2BQUA 1XTZA 1VISA 3TA1A 3DNCA 5C2FA 1NO8A 3KXDA 3HT0A 1CSJA 3IWXA 4FYDA 3NVMA 3FCHA 3BBFA 4FWOA 3MCMA 3BN7A 2GAGC 3JS9A 2YBVA 4Y2AA 4DV1F 5LMNK 4Q5VA 4FN5A 4Q0BA 3A13A 1CQMA 2E2QA 4TY8B 3H2LA 3NS6A 5FDLA 4CEBA 2HFSA 2GJIA 3AA3A 4ZPCA 1P1TA 1KOHA 2E1PA 4AE5A 3CC7S 5AXMA 2AJ2A 2KTQA 1F3FA 4KTZA 2DPNA 2P9KB 1CULA 4NLPA 3J80Y 3WNEA 3MMBA 2MKIA 1YITS 3GG4A 4URGA 5LSOA 4CH1A 2KT5A 2YPZA 2R42A 3I5AA 1SJ4P 3L3VA 4NLYA 4F4AA 4KHYA 2AHOB 4P2XA 4KKOA 3H8YA 2CPHA 2YTCA 1TU0B 1WHVA 1KQKA 2R8IA 2PBDA 4WU3A 2FJDB 2JZ5A 2EK1A 5F8NA 4LVOP 4L72B 3PY8A 4FWSA 4CBUA 1NJIT 4AHCA 2UUCJ 4JYAJ 2CG8A 3FRYA 2PE8A 2YNHA 4USTA 1XNRF 4GMKA 4WFNQ 1S1TB 4O3PA 4Q2LA 1RHMB 2DXFA 1RWXB 2B9YA 2DGTA 4O8UA 1UFLA 4CFBA 4IKAA 1E6YB 4U7UD 3LGHA 3PJXA 3H2UB 4QR0A 1EKEA 1ZAXA 3MUTP 3CULA 4ZIVA 4C0BA 2ACMA 4IOXA 3KLIA 2WRMA 4FF3A 3NWGA 5F8IA 3SJHA 4CVNE 1TK5A 5DK5A 3HHLB 3KUGA 4NEZA 1GMVA 4CRJA 1BGXT 4OHZA 4GKJJ 3J7AP 1ZPVA 1U2FA 2E2OA 1I3AA 5GAHU 2DGXA 2CZ9A 4KIAA 5IWAJ 1UW9A 2HS3A 1R7IA 4N56A 2ASLA 2KVQE 2AP1A 2W8KA 4CJWA 4P7VA 3TX0A 2DH9A 2EEYA 3DRSA 4BQZA 4ZP8A 3QESA 2ZHAA 4B9SA 5KT3A 2HVEA 1FJEB 3RMDA 4I64A 1ULRA 3PNIA 4Z37A 4GVEA 7FDRA 1KVBA 3CCEN 3P49B 4O4GA 1YT3A 4CJSA 1W2IA 4RNOA 3FQKA 3GILA 4FK4A 3P31A 1FDAA 2FZKB 4CLUA 1B0VA 2MHEA 2XCAA 1RE1B 1N88A 2ZH2A 1EETA 2G0JA 1WSRA 1K8AT 4FF2A 1KN6A 3EVOA 2UUBF 5DDQC 1I1GA 1OS5A 2JRSA 5AJ3K 4PA1A 4I1TA 3ETMA 5C42B 4C0OC 1EO1A 4DS5A 4EO8A 3EE8A 1SJRA 3KUEA 4OLBA 3OTOF 3TZWA 3T9NA 2VBYA 1D3WA 3NCIA 1VQKN 2JFKA 3ZZPA 4QS7A 3KK2B 5FPDA 1IBMK 1KONA 3LW5C 1LKZA 2HRYA 2BANB 1U49A 3FVYA 4LF5F 2PSZA 1JL2A 8ATCB 3TYTA 2D3OR 4Q44A 3D1HA 1FNMA 3UE5A 2UZAA 2KH9A 2J8AA 4IUFA 1RJJA 5IC4B 1NDPA 2YKOA 4CESA 2RDDA 4PWUA 3A5NC 4Q43A 2KZMA 1CJVA 3OYMA 3OHRA 1SVDA 1TL5A 1WHXA 2C3YA 2MKYA 2OEMA 4Z2XA 4ZVSB 3SAGA 4H8KA 4EUVA 4BVOA 3SNNA 5AQPA 2CQCA 3I8BA 1XNQF 1U48A 5E3QA 2QMXA 2EFGA 3VQ5A 4BR7A 2KHDA 3Q24A 2WVBA 8RUCA 3N6NA 2XMUA 5HJXA 4EWTA 2RQKA 2OCEA 3M6WA 2KG0A 1LWFB 2CPZA 3KLGB 2XBPA 3MD3A 2RDJA 1VQOS 2CPJA 2KT2A 2F4FA 1ZM9A 4NCGA 4YB1P 4KO0B 4DLGA 1UEVA 3EXYA 4WZMA 3OS2A 5DLFA 2E2NA 4XDCA 5IT9U 3BN4A 3M1VB 3QPIA 3DGVA 3SQGA 1TMMA 2W7OA 3C6UB 4E7KA 4P9SA 2QXFA 4MT1A 3GE9A 3RR7A 4ZJLA 2GMJA 2ASOA 2IDLA 2IBKA 1HJRA 3AH6A 3QSYB 1EP4B 4KPCA 3SCIE 1YVUA 1UAWA 2ZH7A 3V6JA 1NZ8A 5K8PA 2YNHB 3P1GA 1NU4A 1T3OA 2QWLA 4KHWA 2ZE2A 2UU9J 2MGZB 3EKUA 4QS9A 4U8YA 4FLYA 2OPQB 3QIPB 4LR7A 3D2WA 3OHBA 1UZDA 4WFBQ 3QRPA 4LRCA 3CW2C 3JSMB 1UTAA 3VERA 3MOJB 4FWKA 4U95A 1HHQA 1RU1A 4KHPJ 1JIHA 2ROGA 4X4SA 4LUBA 4CW7B 3FCWA 2GWKA 3CERA 1R89A 3GOIA 2OTLS 2HKEA 3KHRA 3GZ7A 3J7YU 2QLBB 3MUVP 1B70B 5JVHQ 2GAHC 3MPUB 2FJAB 1R31A 1UVNA 5TKYA 2UXDK 4HTLA 2QWRA 2QIFA 2R2RA 4Y1DA 4CK3A 4PWDB 4TNOA 3M05A 3UNGC 4M42A 1UWBA 2ZH1A 4QBUA 4IBNA 2Z2LA 1FWKA 3H1QA 1IWAA 1YDLA 4CO1A 2EX3A 2O8BA 4X66F 1YXQA 4IFYA 2WHOA 4Z4EA 1H0HB 1M5OC 5T41A 2JWLA 1T9TA 4JI3F 4I7FB 3JQJA 3K17A 5EWGA 2G8FA 2NLXA 1SBRA 3WXLA 2QWMA 4CLTA 4LFBJ 4HHUA 1U2CA 2W8LA 2OD6A 4X84A 3R9LA 4ICLA 5ETPA 2FGCA 2X78A 1BQNB 2ILZA 2CVIA 3P3DA 3L2QA 4EFAC 1Y0HA 1RU2A 3IS9A 2ZF5O 1Q16B 2FZCB 4NMLA 1LFWA 1S0VA 1HNXF 3MAAB 1S0NA 1VQ5N 3CC4S 3TVZA 5J2NA 1T11A 1D9AA 1KQGB 2HBMA 5HRPA 4DR4K 1R8AA 1NCLA 2OHDA 3J7YI 3UCGA 3IDHA 3DOKA 2YKNB 2G8WA 1Z26A 3QMLA 3K5LA 4UOHA 5A8WA 1RWUA 2B9WA 3KK7A 4QQBA 3CJ1A 2GO8A 2N7YA 2QZ8A 3BZCA 3PX6A 1VQ8N 2A1SA 1M0SA 2BKPA 2WOMA 2R7RA 3GIMA 2H9ZA 5K14B 4ILGB 3CD5A 1FJ7A 3J7AN 3A8KA 3M30B 5ETVA 2KYZA 3CCJS 3U6FA 4JI5K 1EB0A 2CPIA 5HL7Q 2NUUG 3K5NA 4OGEA 3ZETB 2ASJA 4MTPA 3BGRA 3O1BA 4N76A 2QMUB 4KC5A 5GIOA 1RAAB 2BMBA 4CEFA 2MKHA 1TQLA 5HRNA 4FW1A 2OA8A 4E1NA 3OSPA 3UWTA 5FPNA 3M8ZA 1FD8A 3K5MA 1XI1A 1LW2B 1N32J 1QD1A 3SSRA 1NK0A 1ZAVA 3V1QA 3T1YK 4CTAA 3MFIA 3NAIA 1PCAA 2LEAA 2YKMA 5D4LA 3M6GA 1TUUA 4CQ1A 4C11A 2KW4A 5I4MA 4EHTA 3DU5A 2FY8A 1LW0B 1RSCA 4U8VA 2OD4A 2KXHA 2LDIA 1VRTB 3OYDA 4DN0A 2Z1IA 3OV7A 4JKCA 4DR1F 4P73A 4M3UA 1VK3A 3QB0A 3MURP 1WWHA 3CCSN 1IBKJ 4Q8FA 3CXCM 5DDPC 4O55A 1Q8KA 3OY9A 3OYJA 1M5HA 1FXRA 1OH8A 1HWIA 3DGPA 4ZCLA 4X4TA 2ASDA 4RPFA 3CJTA 2CQIA 3AVKA 4MYUA 3D2FB 1VLYA 2BX6A 1HD1A 1D8ZA 4DN9A 4YP3A 2EFNA 2QGFB 1LFPA 4DX8H 1OWXA 3GIRA 1Q7LB 4B3TK 1XR6A 2O8FB 1SUQB 3O6WA 5I3UB 2MKKA 1GOBA 1J5OB 3V6HA 1RDWX 4KO0A 3OBIA 1N33F 2IHR1 1QUPA 1RWKB 4Z7CA 2RU3A 4V19X 2BOAA 4N7TA 1LQ9A 2XHCA 2DFEA 1NSAA 3G8SA 1SKRA 3IRWP 3AY0A 4DQSA 2W2MP 3CJ4A 3WQPA 1FFWB 2LSNA 3M1FA 2R2UA 3CO9A 1MROB 1Y3JA 4K0KJ 4MIBA 5KT5A 2RKIA 3QAEA 5H1SV 4I69A 4NZ7A 3LDPA 3MZIA 4CIEA 3B6PA 2HQFA 4DL3A 2DNRA 4ZPAA 3W65A 5DETA 5IZHA 4A8KA 4NWBA 2DGSA 2A1BA 4ZJOA 2Q6CA 2IBOA 3B4MA 2C3PA 2E6MA 4NXNF 1FT8A 2LQJA 3NAEA 1UKUA 3PDNA 1IR1A 2RVJA 5F3ZA 4EBDA 2AX1A 4CF1A 3BEXA 1FKOB 5M2PA 4OKEA 5ADZA 3VGVA 2J7UA 1GMWA 2PC6A 2VQFF 3HM8A 2XZTB 1VS3A 3T9ZA 1ZZNA 2AWZA 4DR3J 5F8LA 1ZM2A 2JWNA 3LP0A 2YNIB 2K7KA 1RTHB 2W2PP 3E9LA 3TANA 3G4SN 1HWUA 3IAYA 2I1RA 1NPKA 4ZP7A 1S5ZA 4Z4FA 5CE3A 2D3O1 5HQMA 3HSJA 2EI5A 2MMYA 3THXA 3ZZUA 5ETOA 3CJ2A 3D1OA 3DYAB 2C2ZB 1Y7PA 3IRXB 3MN9A 3CJ3A 3R5GA 3QRQA 1MN7A 3L7UA 1DQAA 2VKRA 3IMXA 5CXTA 3FC9A 4X62K 2YWGA 2YH1A 2PFDA 4ES2A 1BUPA 1WAJA 4GVBB 2LQ9A 1U2VA 4BC2A 4A61A 5K5MA 1N5QA 5M2UA 4DFJA 4LRFA 4K59A 4Z4HA 2C2KB 1YBTA 4Q2MA 2L08A 2B0GA 1NH8A 4ITSA 3NP5A 5BRHA 2YHBA 3F73A 1GH8A 5J1NA 2K3IA 2NSBA 2R3VA 4AUKA 3D0HE 3HVTA 4ED8A 3OW2R 1YJWN 2V2QA 3CFPA 2RHQB 1HYSA 5ETLA 4UW2A 1YAGA 4UY85 4H4OA 2WVFA 2CRLA 2ILYA 1S9GA 4ECUA 2GBZA 3AVFA 3GLJA 4W5RA 1U6BA 5IC6B 3BREA 3MX5A 3MN7A 1T94A 2VODA 3ISND 4EK2A 2RMLA 2UVRA 1R8HA 2FVSA 2DD8S 2E2PA 3D68A 2XCPA 5EXWA 2EWHA 1Y97A 1OSCA 4JKHA 2M7SA 2P9SB 4A4JA 3RMBA 1RTJB 1VC6A 3QO9B 3N4QA 2LA6A 4LSLA 3GV8B 1FERA 2NPIA 4X4RA 3K2PA 3L0QA 1G2EA 3NDKA 4FM1A 4DZ6A 1IG9A 3OS1A 4CO5A 3RB0A 1Y64A 1NB7A 4IOAL 3BY5A 1P27B 3RZAA 2B9EA 1Q82T 3I96A 4GC7A 3ONQA 3LO3A 4OI3A 3SZ2A 3VGMA 2B4JA 4H5NA 4BCAA 2EVZA 4P2MA 2H4WB 5BN8A 4B1ZA 3CC2S 4DSIA 4CE9A 3WUHA 2SXLA 4A5BA 2YKMB 1C4AA 1U2RA 4J9OA 4K4VA 4A57A 3GPAA 5J1EA 1Z4UA 4YDUA 1NRKA 3O9UA 5K8MA 4OMFG 2DY9A 5KFRA 1GLBG 3QT5A 1NJYA 5CZ1A 4L8RB 2HHXA 3AOBA 2WZ1A 1VSKA 4OYXA 3ID8A 3NBPA 4NYZA 2GHVC 4J37A 4CGDA 2UXBK 3QERA 2WBNA 2HGNA 4I56A 2OLWA 2QM1A 4H4MB 4ECYA 1AUSL 4KI4A 3GV5B 4GKJK 1K6YA 4FZXC 3U1LA 3EGNA 3GFXA 1E4GT 1KFDA 3M9OB 1VHXA 4DU3A 3FBCA 4H0TB 4OL8A 2IJNA 3CCLS 1CJUA 2FY1A 1Z1ZA 4E0DA 4BDPA 2YH0A 2Y8YA 1JNZB 2VHGA 1NK4A 5AXLA 3POTB 5L39A 2DK2A 5BPNA 3VF4A 2W4CA 1TV6B 2IYIA 5F9LA 2XTJP 2D1KA 1VRQC 3V1RA 2CG4A 3PRBA 3QRRA 2HG4A 2V67A 4A8QA 1F5CA 2YHXA 1C1CB 3QGPA 2R7XA 5CD4A 1FK9A 1S1WA 4K4XA 2IA0A 3CCTA 4CJ5A 3RGIA 2P9PB 4OX9F 4DUYF 2KQ2A 2QMWA 4NA3A 2WVDA 3DMJB 1FE0A 5A76A 4QIWD 4ECQA 2YV0X 3WZ0A 4AH9A 2MY7A 4BE1A 1XUPO 3VQDA 4FM0A 2CFXA 3KLGA 3V6DB 3DKDA 2QLWA 1V3SA 2VU5A 1VHFA 1RDRA 2XG8A 2R8JA 1KQSR 4LBPA 1ZM4A 3CJKA 4KHPK 1S6QB 2NCKL 4E7JA 3L3UA 1HBNA 2DGWA 4ZN1A 3WXJA 2YQ0A 2VDHA 2PO4A 5C24A 3IGVA 1RUSA 4U96A 4JBCA 4RW9B 3AD7C 2VASA 1FFGB 4EZ9A 4E2FB 2DPIA 4DR4J 1WOPA 3WHIA 4BRKA 4F3QA 5HVGA 3RRKA 2E5JA 2FB0A 3FCVA 2ZNYA 5IM0A 2BJ7A 4IG0A 3GJQB 5JS1A 3N5FA 4Z94A 1AZSB 3S41A 4KAZA 2CGLA 9ATCB 2GQQA 2ZZMA 1XMOJ 2R7UA 4EMDA 3VN5A 3BDPA 2ASYA 3JTPA 4CBWA 1P8ZA 1F2HA 2XI3A 3K7RA 1P90A 1TYQA 5HL7L 2MZRA 5IFMA 4DR2F 4J2BA 3ET6B 4YS2A 4Z4CA 3Q86A 2VQEJ 2ZITA 2NR0A 1KWMA 1VQMS 1FA0A 2E5LF 3ZSXA 1T95A 2KRBA 2QYGA 4W90B 2NRZA 3KZBA 3AVBA 4PABA 2HYIB 1XMOK 4DFKA 2RUGA 5AE1A 3DJCA 3MECA 4DR5J 4LSLB 2XY8A 2AV5A 3M4XA 1HIYA 1V5IB 2EBEA 3O9QA 4B9QA 2AP6A 4ECSA 1AROP 4ZPTR 4I7FA 4H4MA 4HUFA 3L7OA 2HQ3A 3NGKA 3NHGA 2CQDA 2VJUA 2CWKA 4IZ9A 1QTNB 2BJ9A 4OYPA 3QJPA 2BE7D 4IDKA 3OL9A 1ACMB 3TZXA 2A5XA 4JK7A 4DR7K 1DFDA 5D0GA 4DU1A 3CIPA 1N34K 2XLKA 1D8YA 5B0GA 5AQSA 4BC5A 2YHYA 1QSLA 4JD2A 2C3MA 3ATUA 1UFKA 4AQYJ 5FDLB 2XRIA 1YJ9S 5J2NB 1UMJA 2J0XA 3PJ9A 1HNZK 1YUWA 3MR6A 4B3MF 3FZLA 3BGFA 2BUPA 4XH4A 2D41A 1T03A 4IG3A 3TWZA 3KLEA 4X4UA 2FTRA 4V19J 3AO4A 1MMDA 4KY3A 3WXIA 4BY9C 1R59O 3TJ8A 4YB5A 2JL9A 3FEYB 4ZVOB 4QWCA 1TFYA 3AAQA 2E20A 3HFKA 1Q82O 3EZ5A 4NYFA 3J80O 3T1HF 1VRUB 4CZMA 2YWKA 1TMJA 3ILLA 4DWIA 3E2EA 1XNRJ 5IQ6A 2PEBA 2WB4A 4E1JA 5HQ8A 4NA2A 4LF1A 3WNGA 4O23A 4EBEA 3UE2A 4UY8T 2V4JB 4CK1A 4J90A 3MM5A 1JCFA 3HJVA 2XULA 1BC6A 1YITN 2HHHJ 1Z2ZA 1YHQS 4R5PA 2VG7B 4OJRA 2ZHBA 2IS3A 1KLMA 4IG0B 3ZSQA 4LRDA 5T7BA 4JKBA 1KC8O 4DUTA 2YKAA 3VEZA 3UN3A 5KAKA 2UUCK 1NSPA 4AHUA 3G6ES 2H65B 4FLWA 5LL6Z 1FFSB 1APSA 3TAGA 1XMQK 4WFAL 1DBDA 4KHQA 4CZHA 4KGMA 5GAGI 2HBQB 3TZYA 5ETSA 4RBTA 3KHGA 4GKKF 4FM2A 4CFDA 5HMXA 5DJBA 3TA2A 2ZOGA 3OJUA 3OR1B 5T7LB 3CCUN 4UQTA 3OYLA 3UD5A 2CPFA 1TUGB 2CQ4A 2V52B 4HUEA 1N32K 4BRNA 4QJVA 2D0CA 2HRTA 2E1CA 5GIPA 1I6JA 2V63A 2V9KA 2DNZA 1N8RO 2G8HA 3QLHB 4L73A 2MQNA 2BOPA 1T03B 4C3MA 4M7XA 1CS4B 3C19A 1ZPWX 1FESA 3K9JA 3ITHB 3HLUA 3MM6B 3OJSA 2ZFHA 1S72N 3ZLJA 4IJAA 4QCLA 4A2BA 4DX6A 4M63A 5JVHL 2O8CB 1MROA 1N52B 4MKBA 4F4KA 4ZPVR 2DITA 4NLWA 1NG9A 1UJ4A 3K8WA 4CYUA 1WSHA 2F96A 2DHHA 2L9NA 3NH0A 4YOUA 4B1YB 2QT7A 2FBVA 1HQEB 4PYAA 3RB3A 3GMGA 2FHJD 4X4PA 1R6YA 1S79A 4DV3J 2HWIA 1FTCA 3I5CA 3MM9B 3CFRA 3W7BA 3QEWA 3GFHA 3ZO7A 1YRTA 1OH5A 5KRTA 3MWTA 3F2KA 3AO2A 4BRMA 1SJQA 1L5UA 3CJKB 4DUZK 2IVFB 1CXUA 4OX8A 4I6YA 3FGVA 4L76A 3HULA 4RW4A 2R2SA 1T6DA 2IY5B 5F8HA 1VQ5S 1FE4A 1NKCA 3OLAA 1WOSA 3PXGa 4DHYA 1B7FA 5LMUJ 4ZVQB 3PM9A 3KVGA 1K8KA 3AOAA 2B7CB 3O4NA 3LM2A 3L8BA 4WQ4C 2DCLA 4Y0WA 4ZK7M 2FVRA 5B7WA 5MLCQ 1DTTA 1RT4A 4ES1A 4K5SA 4WFYA 2FLPA 2HNZB 4LF6K 2FSJA 2ETJA 2HBZB 1C0TA 1JLFA 3QLHA 1U0HB 3I56S 2YY3A 4I0WA 4ECRA 1J2VA 3CCQS 3VESA 5B8HA 4OHVA 4N8OA 3ZT2A 2F5GA 1MWQA 3P6YC 4FJHA 1HBOB 4WZQA 2D1CA 2B4VA 2W9AA 4EEYA 1Q1KA 2P9NB 2BUNA 2AIRB 3DLKB 2GFFA 1NK6A 4DQ8A 3HCXA 5AQTA 1HR0K 1BOTO 3CD6S 1REVB 3A3NB 2PA8D 2CJXB 2U1AA 2Z4PA 1TZ0A 1B9FA 5L9NA 4B8CA 2DNQA 2L9DA 4J9LA 2E1AA 4BE0A 4L75A 3K0JA 3DAWA 5FJ4A 2ZBIA 1S3XA 4CK2A 4IEIA 2CUYA 2P9UB 2W7PA 2HPUA 1HPMA 1NNEA 1U1NA 1ZXOA 4W5NA 1SQEA 4FYXB 2O8BB 2EFOA 1RDDA 2DB1A 3AA2A 2P9EA 1JXBA 4TKTA 2ADBA 1IQTA 4FJIA 5KFOA 1DEJA 5BYSA 1FTRA 4NLDA 2DJWA 3WT0A 3TARA 1HFEL 3AA5X 1P9YA 3K2YA 1W25A 4ZPBA 3DLEB 2PT0A 4MJKA 2FVQA 3JQKA 3HVAA 2QX0A 1TGOA 5EUHA 3SCXA 5FIIA 2EFPA 5AZIB 4JV5F 3SUQA 5CCLA 4CLSA 2NLWA 2RS8A 1V3ZA 5HMYA 5KFEA 2NZ4A 3IR5B 1BHNA 1OYEA 2X1AA 1WDDA 5IS2A 3QIDA 1LOTB 3ZYYX 3C94A 1HI1A 2EKNA 3QETA 4CEAA 5GMEA 3M2UB 1ATSA 2H3GX 3KNGA 3O44A 4DR5K 4B9VA 4DV4K 1S7HA 1RT6B 3J81j 4DPUA 3CCSS 4JI3J 4AQYK 2KRRA 4PEOA 2CDRB 3BYPA 1F6TA 1EX4A 5CYQB 2VQEK 3CQ8A 1FJCA 5E26A 3HKZD 4N8NA 5CQGA 3KD1E 5K14A 4WP8A 1FRKA 1L3SA 4TVAB 2HFNA 5J1PA 3KKSA 5HBMA 5J2PB 4X4QA 3S3MA 1OH6A 1HBOA 1KP6A 5HROA 3EM1A 4W5OA 5L46A 4A5AA 3V9XA 5EWEA 1KVJA 4DV6J 4WK3A 4IQXA 2FHMA 3EWGA 3VHQA 5HVHA 3SUNA 3M8PB 4H4KA 1HARA 2IM3A 2XYHB 3L6QA 3GYGA 2P6SA 2F8HA 3CCRN 4OKJA 1EARA 1Y4ZB 1LCUA 1NJZA 3ZZYA 1YSJA 3TRGA 1Y11A 3I82A 3CPWR 2HHVA 1X5SA 2VBXA 3H45C 1NXIA 2Q6BA 5H9FK 4FVCA 4FJ8A 1NWKA 4FDFA 3RTVA 1RWPB 4FCYA 4B17A 2AYBA 1A7GE 4CNYA 5LSRA 1Z6RA 3GR0A 3UN5A 4NXMK 3VA0A 5DLGA 2M0GB 4M1KA 3MUMP 1MLAA 5IM0B 2F8SA 3AA4A 5LOQA 1OVQA 3E1YA 2W2OP 2RF2A 3ZZTA 3U1NA 4CT9A 3HOTA 4DL5A 1XMQF 2V0NA 5E3PA 4H03B 2ZOFA 3PCOB 4LF7J 1NGAA 1BO5O 3GB0A 2UUCF 1RGVA 3J81U 4ED3A 1AA1B 2HNYA 4P52A 2ALZA 3QQCD 1RAJA 1AZSA 5AFUH 3Q7BA 1XK8A 3WNFA 1LAVA 5HI7A 3FZKA 3BKUA 3GQCA 2BYCA 2RRBA 2K2PA 2L3MA