4R5PA

Crystal structure of hiv-1 reverse transcriptase (rt) with dna and a nucleoside triphosphate mimic alpha-carboxy nucleoside phosphonate inhibitor
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
555
structure length
555
Chain Sequence
VPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTNSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Alpha-carboxy nucleoside phosphonates as universal nucleoside triphosphate mimics.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase, hydrolase/dna/inhibitor
molecule keywords HIV-1 reverse transcriptase, p66 subunit
total genus 150
structure length 555
sequence length 555
chains with identical sequence C
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2014-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4r5pA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4r5pA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4r5pA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4r5pA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4r5pA05
1S97A 4QCLA 1XR6A 4ED1A 3C94A 3MEDA 4J2AA 3O4QA 3PV8A 3QERA 3SI8A 4HTUA 4OJRA 5KGWA 3HVWA 3QGGA 4WYLA 3O4NA 3KHHA 3S9HA 1N56A 5KG7A 3E01A 4IFVA 4Q5VA 3MR6A 1LWFB 4DU1A 2QKBA 3SPYA 1S6PA 2OPSA 2HAIA 3KLGA 4KHMA 4URGA 4CJ4A 2I5JB 1JX4A 2Z1HA 1NKBA 5SWMA 1BQNB 4KRFA 2D41A 4CEDA 1X9WA 2IM1A 1TGOA 3OYAA 4BDZA 3HK2A 3AVHA 3GV5B 3MECA 3MXIA 2IMWP 2X6NA 2V4RA 4YNQA 4IRKA 1GOBA 2Z1IA 1GOAA 3M8QB 1DTTA 1C1BA 2FVRA 4ZHRB 4EYIB 1LAVA 3V9ZA 2R2RA 2WTFA 2XY6A 3I0SA 5KRSA 2OPQA 2B5JB 2W9CA 4CF1A 4MFBB 3HHKA 1ZBHA 2UVRA 4MH8A 2ALZA 3AA5X 3MEEB 4M95A 4FJNA 2IC3A 3BGRA 3BJYA 4J2EA 4ZP8A 4TQRA 3DLKA 3F9KA 3CM6A 1C1CB 4RZRA 1JLAA 4Q43A 2IM2A 3QYYA 3LP3A 3DM2A 1NK8A 4KO0A 1RTIB 3QNNA 4FYDA 4DQQA 4ELTA 1RBVA 4Q8FA 3QEPA 2JEIA 2HWHA 1N6QB 2W9BB 3IN5A 3KTQA 5FROA 3H5XA 1WNSA 4B08A 3ASMA 1W9HA 4WFZA 3LDSA 1C6VA 2FLPA 4KV8A 4PWDA 3QLHA 4CHPA 1WSJA 3HPHA 4FJLA 3NAHA 3JSMB 4FCYA 2WOMA 4M94A 4CJSA 1HQEB 4I9LA 3FQLA 1BI4A 1YTUA 4W5TA 4DSKA 2IDOA 3CFRA 2R8JA 3CWJA 1JLGB 3DLEB 3DMJA 1KSPA 4H4MA 2FVPA 5KG5A 4BACA 4XPCA 3MXMA 2R2UA 3TI0A 4MIBA 1KFDA 4AHVA 4FK4A 1EXQA 5EUHA 1UA0A 4CEQA 4DSFA 2RDIA 3L2RA 2J6SA 3N6LA 3OJUA 1ITGA 2PZSA 1FXXA 3LP2A 1A5WA 2RKIA 3Q8QB 2IA6A 3SV4A 1N4LA 2GC8A 4DQSA 1J5OA 4DTPA 4BWMA 1TKTB 4XPEA 1RT2B 4F4ZA 4CEOA 4CF0A 2G8UA 5J2PA 3KLHA 3V4IB 3AVJA 3SZ2A 4X2BA 2A1RA 5KG2A 3B6OA 4B3OB 3GIJA 4Z4IA 3MR3A 2QKKA 1HQUB 5KFVA 4BDYA 1D9FA 4FZXC 1XWLA 3I0RA 1U47A 1S1UB 3RBDA 2VG6B 4R8UB 1VSKA 2FC0A 3AO1A 4CGIA 5HROA 4WXWA 1BIZA 1QSSA 3ZSWA 1KLMB 4OL8A 1S10A 1A5XA 5EDWA 4Q8EA 1YVUA 1Z26A 3VQQA 1S1VB 2EHGA 3ICLA 1ZBLA 1Q8IA 1SL1A 2WONA 4CHOA 1VRUB 2ASJA 4N41A 3V81B 4K4UA 1RT7B 3RB4A 4M45A 1KHWA 1VSLA 2E6LA 1S1XB 1RA7A 1O1WA 2A1SA 3NGDA 3NF8A 2XCAA 1TK0A 4ED3A 1QE1A 3DOLB 5KFMA 5KFJA 4E7HA 3DOKB 3CG7A 4WXOA 3QEIA 1ZTWA 4CF8A 4O3SA 4XO0A 2DPIA 4WE1A 1FKPA 4RNMA 2FJVA 2R2TA 2FBXA 2G8KA 4OVLA 5T7BA 4ID1A 1WN7A 4IH7A 4NYZA 2IM0A 1T3NA 3RWUA 3GIMA 3HL8A 1JLBA 1IKYA 2D7SA 4FS2A 4AHRA 3M9MB 3LANA 2IM3A 3ALYA 3CJ3A 4F4WA 5CYQB 3LP0B 1QAIA 4G1QA 3TAQA 2PY5A 5C42B 3SUNA 5FRNA 4RG8A 3OYLA 5DQIA 3SQ2A 1RA6A 3L3UA 4JS4A 4KHNA 2YNIB 1NOYA 1LWEA 3VQBA 3PR5B 3Q8SB 2AWZA 1UOCA 3K58A 1X1PA 1L3VA 2AU0A 1EP4A 1NKEA 4E19A 2OPPA 2YV0X 4FLTA 1TAQA 2XO7A 3WNHA 3TWHA 1VRTB 2HMIA 5HP1A 2FJWA 3TAPA 3MR5A 3DRSB 5EWEA 5C25A 3H4DA 2WB4A 1ZBUA 2QV6A 3CJ5A 1U48A 2YNHB 3TAMB 5KFSA 2PYJA 5F9LA 1KVCA 4RU9A 2KQ2A 2XI3A 3LPTA 1X9SA 4K8XA 2CKWA 2VG5B 5JS2A 1LWCB 2HHTA 4CIGA 5L9XA 4H54A 4GMJB 3PO5A 3SFGA 4DG1A 4ZVHA 1NNDA 4XIUA 3OYDA 4O0IA 2YKMA 4CEFA 4O3QA 4RNHA 3K2PA 3AA2A 1WSIA 2J6UA 4K4VA 4M3RA 1RAJA 4DEZA 3ZSZA 4DTJA 1SH3A 2UVVA 2YKNB 1HYZA 3L2QA 3NAEA 3DLHA 2V4QA 1RT6B 3VQCA 3LZJA 3QNOA 3KLEA 3SV3A 4CHYA 4JRQA 4AHTA 2YHAA 3V1OA 4E7KA 3JYTB 3L2VA 5JUMA 2OPRA 3OYNA 2GV9A 2KFNA 2RF2B 1RBSA 2FBTA 2XGQA 4CERA 3QEVA 4IR9A 4EP4A 3QEWA 3T19A 3L3VA 2HHXA 3VQ7A 4J9LA 4K4YA 3HVTB 3M8PA 2GUIA 4HCCA 1HNIB 4IKAA 4R5PA 3L2WA 4NYNA 3OL6A 4ECZA 3K5NA 5F8IA 4RNNA 4TSXA 4M3UA 1C0UA 1KCFA 2E4LA 5F9NA 2F8SA 4K50A 4NYFA 2IBKA 4ID5A 4IRDA 2WHOA 4ZVFA 2WRMA 3WNGA 4IQXA 3OLBA 5KT4A 2AGPA 4CGFA 3T5HA 2HB5A 4DLGA 4TLRA 4YQWA 5JXSA 1BI4B 1TV6A 4QWAA 4CJWA 2V0NA 4M3WA 2VA2A 4EBDA 1QS4A 3DRPB 2ZE2B 3OS1A 1KHVA 4JLHA 1ZBIA 5C24B 1EX4A 2VG7B 1I3AA 3SJJA 4DL7A 1NJYA 3IS9A 3TARA 3OJSA 3PX6A 2O4GA 1UA1A 3C6TA 4IH6A 4ELVA 1IKVA 3CFPA 3LZIA 4IDKA 4DFPA 4ED2A 2G8IA 4O4GB 3NH0A 1TKXB 2UVUA 4KB1A 3MF5A 5E41A 3OVNA 4FS1A 2KFZA 5KG1A 1TKTA 4WZMA 1TP7A 3PW7A 4FZYA 3S3MA 5K14B 4CECA 2IJNA 4RW4A 1S1TB 3SQ0A 4KTZA 1U4BA 4N5SA 5EWGA 2DFFA 4DFMA 1SL0A 4GC6A 1JXBA 5DGAA 5L1LA 3QGIA 3DYAB 1GX6A 4RW9A 3VQ6A 5KG6A 3G0ZA 1C0TB 2ZD1B 4Y3CA 4LSNA 1QTMA 1FK9A 3TAEA 1TKZA 5CZ1A 1MMLA 3HP9A 5DMRA 4ZPBA 5HROB 4B9UA 2IGIA 3HYFA 3CJ2A 3DLBA 2Z1JA 1RT4A 5J2QA 2VWJA 4DWIA 4U7CA 3RRGA 1VRUA 4KFBB 1JL2A 3V81A 3K59A 5KRTA 1HNVA 1S0NA 2HW3A 3RMDA 1RYRA 3AV9A 4RW6A 4DL4A 3OYMA 2W8KA 2B4JA 4Z0UA 1ZYQA 3V9UA 1DLOA 4M3XA 4KAZA 1G15A 2X78A 4DTSA 4MQ3A 3UDLA 2HNZB 5I42A 4ZPDA 2IC3B 3BGRB 3FDSA 4Y1CA 4QOZB 4ECSA 1VSIA 4NLVA 4ICLB 3NGZA 1UWBB 3VQDA 3FSIA 1TL3A 1JLAB 3OY9A 3IG1A 2NUBA 2BANA 5I3UA 1RDDA 1REVA 4J2DA 3V6DA 4TY8B 2FVSA 4M3YA 4BE2A 1U49A 4NLDA 4KB0A 2ASDA 2Q3SA 3KHLA 4B8AB 5HBMA 3ZSYA 3TQ1A 4KPYA 2P1JA 4LQ9A 4DL5A 1FKOA 4I2PA 3NGIA 3CVKA 4N47A 1HYVA 1HJRA 4B9NA 2OYQA 2G8VA 5DG8A 1QSYA 1TK8A 1RDBA 2FBVA 2HVHA 1NK6A 3VQEA 4MKAA 4NLQA 4FJKA 4KI6A 4NCGB 4FJJA 2D0CA 4IG0A 3NF7A 4HHTA 2XGPA 2OPSB 3GILA 3V6HA 3RBEA 3HVAA 1J54A 1BISA 3M9NB 2D3UA 3KK1A 1TVRB 1MU2A 1JLFA 4DS4A 4FK0A 4DMNA 3KJVA 1XR7A 3AVFA 1HYSA 1JIHA 5HP1B 1SH0A 4FJ8A 4BE1A 1SKSA 4DTUA 3QO9B 2E9ZA 1WSFA 2R8GA 2XCPA 4CGDA 4DF8A 4J9NA 1LW2B 1JLQA 1RTDB 3KHGA 4CGJA 3O3GA 1C2PA 1RTHB 2B5JA 5KFEA 2WK4A 2EC0A 4Y1DA 3K5MA 3QZ7A 4KKOA 4YMEA 4NLRA 3HP6A 1TL1B 3UR0A 1JKHB 1LWFA 4ED8A 3LP1A 4HVJA 4IKFA 4PA1A 1C1CA 5KT3A 2C28A 1KFSA 2XRIA 1NK0A 3PUFA 1RDAA 2IJFA 2YKNA 2WCXA 2G8WA 3SYZA 1JLCA 4DS5A 2JLEA 3THVA 4ZTJA 4Y2AA 4QAGA 1GX5A 2R7YA 1BIUA 4NLGA 3AA4A 3V9WA 5KFOA 4CFAA 3RB3A 4HCBA 3D0PA 4RW8B 1J53A 3PX4A 1VSDA 3KK3A 4DFJA 3OSNA 4FM0A 4DSIA 1S9EA 2GBZA 3LWMA 1XHXA 5C5JA 1WSHA 2W8LA 2AX1A 3OSPA 4PQUB 4NLPA 1HQEA 4F2SA 1RDCA 3DI6A 1S6QB 2HNYB 4I2QB 1HPZB 5F8MA 2C2RA 4IG3B 4UQGA 4FM2A 4ZVGA 4HUFA 3TR8A 1RT5A 5KFTA 4FW1A 5KGXA 2QK9A 3KNAA 5J2NA 3FFIB 2R8IA 4OPKA 1BHLA 1T05A 4AHUA 4WFYA 3V6JA 1CXUA 3CDWA 4QW9A 3KKRA 4RUAA 2OZMA 2O5DA 2XWYA 3F73A 1DTQA 2B6AB 1IG9A 4CHNA 1I6JA 1NJZA 3M8QA 3AVMA 4CIFA 2HHSA 3ITHB 4IFVB 3H5UA 4CFCA 1TK5A 1IKVB 4ZVEA 1NK9A 3S3NA 2GIQA 4O3OA 2C22A 3VQ5A 2Y1IA 1RT3A 1WSEA 1ASUA 2HHQA 4KSEB 4FBUA 1TKDA 1SH2A 4ZPAA 4HUEA 4FJXA 2I1RA 3FRZA 4URSA 4ZPCA 3QETA 4J9PA 1R0AB 3O3HA 2DTUA 3VQAA 5HRNA 2D0BA 1DTTB 3SQ1A 4LQ3A 5KT5A 3KLIB 5KFNA 1BQMB 1LWCA 4E7IA 4J9SA 2W7PA 4E89A 3DRRB 4KI4A 4MFBA 3GIIA 4FJGA 2KTQA 3DOLA 1BCMA 1Z4UA 1XHZA 5KG4A 2UUTA 4CEBA 3MEGB 4Z4FA 5EWFA 3KK2A 4JS5A 4IRCA 4I7FB 4RNOA 3LALA 1S9GB 3HKWA 2HWIA 2IS3A 4KV8B 1K1QA 3BSOA 4LSLA 1T03B 2OZSA 1BQNA 3OYBA 2LSNA 3KD5E 4FLUA 4NLYA 4W5NA 1YT3A 4Z4EA 3DLGA 4FJIA 5FDLA 1CSJA 3KMSA 1A5VA 1KLMA 3V1RA 2V9WA 4HUGA 3K57A 2P51A 4DL6A 1RILA 4K4XA 4G1QB 4Q45A 4FLVA 5L1JA 2BDPA 5KG0A 4PWDB 1S48A 1VSFA 1CXQA 1LW0A 4F4YA 3LP2B 2D3ZA 3HVTA 3C95A 3M8PB 3SCXA 3ZSXA 3OLAA 1WAJA 3JSMA 3NBPB 4QWEA 2JEGA 1ASWA 3VA0A 2OA8A 3Q8PB 4EYHB 3M8RA 3DLKB 3SUPA 5DGBA 4ED6A 4MIAA 3RB0A 3GYNA 4FJ9A 4O44B 4J2BA 1ASVA 4NRTA 5DQGA 3OHBA 3NF6A 3KK1B 1TVRA 3G86A 3LWLA 4EZ6A 4IH5A 3HVRA 5CYQA 3Q8RB 1RT2A 3OHAA 1Q9XA 2XY7A 1HYSB 4O5BA 3D28A 3ZSRA 2BQRA 1NKCA 3OS0A 5D3GA 3RRHA 4TQSA 3QLHB 4L8RB 1NJXA 4CGHA 4CE9A 1VSJA 5SZTA 4PUOA 5KFPA 4CJLA 1JLEA 2I5JA 2IAJB 1IKWA 3CYMA 1IKXA 1SUQB 4FBTA 1SKWA 4ED7A 1ZETA 5KG3A 4RUCA 5J1EB 3GV8B 3NH2A 4CCHA 1W25A 1FKPB 4ECVA 1S0OA 4FLWA 1RYSA 4NCAA 3I5BA 3I5AA 4DU3A 1C1BB 3AO3A 3NDKA 5J2MB 5HLFB 3MFHA 2XHBA 3KLFB 4H4OA 3TAFA 4KREA 3EZ5A 4DL3A 4F3OA 4WFXA 5KFFA 4CFDA 3KLHB 1WLJA 3T3FA 1S1WB 3TVKA 4CIEA 3OL9A 5C42A 3ZT4A 3IGVA 4DTMA 2AQ4A 1N48A 4JV1A 4EBEA 3LPUA 4I9QA 2DPJA 3DM2B 3QESA 3K5LA 4KO0B 4E0DA 2YNFA 4RW7A 3MXJA 5CYMB 5L1IA 4NCBA 4IFYA 3RR8A 2KZZA 5CZ2A 4AH9A 4CJ5A 3VN5A 2GIRA 4GW6A 4Z4GA 2D0AA 1L3UA 2VA3A 3HPOA 1VSEA 2AX0A 3PZPA 1Y97A 2FBYA 3DRPA 2R8HA 2XY8A 4IG3A 4CHQA 5KFGA 2WONB 4ECXA 4DTXA 4FXDA 5KFUA 3QIPB 4EEYA 3IS9B 3OL7A 2R2SA 1EETB 3A2FA 3L8BA 2BE2B 2FVCA 1SKRA 3E51A 1WSGA 1N5YB 3AVAA 3IRXA 3RTVA 4DTNA 3H59A 3OYJA 3CO9A 4LY7A 2FLLA 4J9MA 4ED0A 3HXMA 3G10A 4FW2A 3V4IA 4JV2A 2HNDB 4HKQA 3UIQA 4I2PB 4J9KA 2UVWA 3EPGA 5KFWA 4CJKA 4OPJA 3SUOA 3N6NA 4B9MA 4E1MA 2YKMB 4CK3A 3C6UA 3D45A 1BGXT 1D0EA 3T5LA 3BQ0A 1RCHA 3AO4A 3VQ4A 4IG0B 1QQCA 4CJUA 3BSCA 1C0TA 1RNHA 3AVLA 4AHSA 1T8EA 1LV5A 4C8OA 4NLOA 4AILC 4NLXA 5KFYA 4ECUA 1HARA 2X74A 1L3SA 4CK2A 3OYEA 2QE5A 3BQ1A 2ILZA 4W5RA 3V9SA 3ZT1A 2CJQA 3PO4A 4K4ZA 1QUVA 5KI6A 2DY4A 3I0RB 1RBUA 2OPQB 3NF9A 4CF2A 2W9AA 4FJMA 1QE1B 5DQHA 2FJXA 4KHRA 3MEEA 1DLOB 3KOAA 4C8MA 4ECTA 3SI6A 4I7FA 4TY9A 4QPXA 2HHVA 4KAIA 4CJPA 4WE1B 4ZMMA 4YR3A 1F21A 3DYAA 2G8FA 4ZTFA 3LP1B 4O3PA 4TN2A 2RF2A 2YNGB 2Y1JA 4QWCA 3KIOA 1YVFA 3V9XA 4OGEA 4DSEA 1TQLA 5I3UB 3PR4A 2OH2A 3DLGB 1S1XA 1IKYB 3MEDB 2W7OA 2W9CB 2RKIB 2BRKA 2HHUA 4IOBA 2QXFA 1HMVA 5HBMB 3VA3A 4W5OA 4DTRA 1UAXA 4AHCA 3V6KA 1Z25A 2AJQA 4OLBA 3EPIA 4CJFA 1WAFA 4YR2A 1RTIA 4CHZA 3RMAA 1LWEB 3NMAA 4IDKB 3QZ8A 4GVMA 1N6QA 4TYBA 1KVAA 4F50A 3PVXA 2ASLA 4Q0BA 4M41A 4QWDA 3DMJB 4KHSA 1VRTA 3IGNA 4RW4B 2HMIB 2ATLA 4G3IA 3B6PA 3ZCMA 3K5OA 4DQPA 4O44A 4ELUA 4F3TA 4E7LA 1SV5B 4ZHRA 3S3OA 2ZD1A 3GV7B 3AO5A 5KFBA 3SUQA 3AVCA 4CEEA 5F8LA 1K1SA 2AGQA 4CEAA 2KW4A 4FVMA 5KFAA 3DLEA 1C0UB 3PX0A 1RT4B 4O4RA 1S1TA 3CQ8A 2B6AA 4KBIA 1HQUA 1D9DA 1KVBA 4K4TA 2ETJA 1CLQA 4MKBA 4DSJA 1S6PB 3KHRA 1JKHA 1JL1A 3KKSA 5F8JA 1IM4A 4DF4A 3TANA 1RT3B 3M8SA 5KT6A 2IAJA 4CK1A 2VG5A 1J5OB 3O3FA 1NK4A 3MECB 3RMBA 5J2PB 4J9RA 3JYTA 3NE6A 1Q9YA 4NLWA 5KFLA 2IOCA 5KFIA 5KT7A 1T7PA 3EZUA 3G6XA 3H2LA 5KTQA 1QSLA 4ECYA 2JC0A 1RBRA 3U3YA 1S9EB 4CF9A 4JUZA 3CJ4A 3PY8A 4FLYA 4TYAA 2WOMB 3ZT2A 4OKJA 4E1NA 4WYWA 1JLGA 1S0MA 4BE0A 3ISND 1TAUA 5L1KA 4CESA 3L2UA 4W5QA 1RT1A 2DFHA 2ILYA 3IG1B 3BREA 4OKEA 2YNFB 4RW7B 4ZP9A 3PW2A 1TKZB 1CZBA 3ZT3A 1U09A 2W9BA 3V6DB 1JLBB 1ZBFA 4CJVA 3NFAA 3WNFA 2DFEA 1HNIA 1RTJB 3KMQA 4ECQA 4B8CA 1K6YA 4F2RA 4O55A 5CY4A 4RW8A 4DG1B 4B3OA 5JS1A 3LAKA 3NGYA 1HNVB 3KLVA 3PJXA 2XY5A 2RN2A 3NAIA 3ITHA 2BE2A 1QHTA 5DK5A 4Z4CA 1S1UA 4O4GA 3H08A 3ZT0A 3CDEA 4PQUA 2KZMA 4O3NA 2E9RX 1CZ9A 5KFQA 2OPPB 4NZ0A 4C8KA 2HHWA 4OLAA 4H4MB 2HNDA 1MU2B 2JEJA 1BL3A 2JC1A 1D8YA 4EO6A 4TXSA 2E6MA 1R0AA 4LH4A 3BSNA 3C6TB 2ATQA 3NKYA 3GQCA 3ISNC 1IO2A 1U04A 3N6MA 5J2NB 1T94A 5DG9A 1SL2A 2BR0A 2HVIA 1L3TA 4FJ7A 3I0SB 4JRPA 4K4WA 3D5MA 3MTKA 5K14A 4R5PB 4DL2A 2BQUA 3QINA 3CIZA 4E3SA 4ECRA 3AVNA 5KFHA 4FM1A 4CJEA 4E7JA 5F8NA 1VSMA 4U6PA 4KKOB 4B9SA 4DSLA 2YNHA 3TAMA 2XC9A 4ID5B 2VG6A 4R8UA 1LAWA 3RR7A 3VQSA 1S4FA 4KHQA 4QW8A 3QGHA 5EU7A 1JLCB 1RT6A 4EZ9A 3KJVB 1TV6B 4NLUA 3OYFA 3EYZA 3UQSA 1KLNA 3LP0A 3LAMA 3QO9A 5J2QB 3OYCA 5C24A 2VG7A 1RT7A 4Y34A 4BDPA 3M9OB 2YNGA 5J2MA 3FQKA 1I39A 3KLFA 1BQMA 4H4OB 4DQRA 1BCOA 1NK7A 2YNIA 2AGOA 3AO2A 4O0JA 1X9MA 3HT3A 3ZSVA 3OYIA 1NK5A 3HM9A 1EP4B 3BR9A 3OYGA 3DI6B 3KD1E 1QAJA 3P1GA 3VQ9A 4F4KA 4O3RA 4ZP7A 2E9TA 4NRUA 4RNFA 5CYMA 1NHVA 3AVKA 5DG7A 5T14A 1IH7A 4TY8A 4LSNB 2UUWA 5FDLB 3AA3A 3FFIA 1S9FA 3ZSOA 1L5UA 4DFKA 4M42A 4N76A 4YP3A 4FLZA 1WNEA 4NLSA 1DTQB 3BQ2A 4F4XA 4EP5A 2BGGA 4URQU 1D1UA 3E01B 2P5GA 4KHUA 2ZQBA 1W0HA 4KHYA 4B9TA 1S5JA 3KLGB 1N5YA 4JV0A 1TKXA 4LH5A 5DLGA 4CJRA 4MK9A 5KT2A 3CDUA 1KTQA 1HPZA 4I2QA 4Y2CA 3NCIA 3QIDA 4GC7A 3PW0A 4OKKA 3PJWA 2JEFA 1S1VA 4B9LA 3H98A 1TL1A 2ZKUA 5HRRA 3G6YA 4ICLA 3C6UB 4FK2A 3AVBA 1XR5A 3UPFA 1YTAA 4CFBA 2BANB 4CEZA 5HRSA 5HLFA 4MK7A 4K8ZA 1REVB 3H4BA 1JXLA 3DLRA 4J9QA 2R8KA 3CM5A 3SPZA 4KE5A 3DOKA 1C1AA 3VQ8A 3NHGA 3CJ0A 3QEXA 3OYKA 4M3TA 3AVIA 1S1WA 2P5OA 1U45A 2XI2A 3I5CA 3GIKA 2X6SA 3RAXA 4KTWA 4EO8A 4WZQA 4C8NA 4RW9B 3OL8A 3QIOA 1T03A 2YHBA 4NCGA 3TAGA 3RB6A 4DTOA 2C2DA 3CFOA 4NLTA 4ECWA 2BQ3A 3I8DA 4K4SA 1JLFB 3OYHA 1KRPA 2W42A 1S49A 1B9FA 3NH1A 2BRLA 3QIPA 3OS2A 4LD0A 2O4IA 1LW2A 4CGGA 5KFXA 1RBTA 4FJHA 4DU4A 1XI1A 3NBPA 2G8HA 1HMVB 4DLEA 1RTJA 1NHUA 1S6QA 2HNYA 1NJWA 4Q44A 5KFDA 3DRSA 1RDRA 2J6TA 1S9GA 5C25B 2C2EA 5D3GB 4LSLB 3BSAA 4EBCA 3G6VA 3MAQA 3V1QA 1ZTTA 1D5AA 3ZSQA 4IR1A 2F8TA 3NL0A 4CJTA 2RPIA 5KFKA 3PW5A 3VQPA 4F8RA 1FK9B 2F8EX 4HYKA 3RAQA 1IKXB 1IKWB 1SUQA 4Q0BB 2ZE2A 2ITGA 3P5JA 1XC9A 1FKOB 2RDJA 4FLXA 2PYLA 4C8LA 4KB7A 4DQIA 2Z1GA 1EETA 5KFZA 3WNEA 3SQ4A 1OS5A 1J9AA 4FJ5A 1JLQB 1RTDA 1JXEA 3HJFA 4PUOB 4YR0A 3DDKA 1VSHA 1RTHA 3RMCA 4CJ3A 3PHEA 1B92A 4B9VA 5FRMA 3KLEB 1C0MA 3HO1A 3MEGA 4YFUA 3ULDA 2HNZA 5I42B 3HSTB 5J1EA 2OPRB 4ZP6A 3P83D 1UWBA 3U6FA 3EY1A 4M3ZA 3H40A 4IBNA 3PW4A 5F8GA 1B9DA 2VWKA 3KLIA 4IFYB 5HRPA 4MK8A 3SFUA 4FZZA 3H5SA 2D5RA 3T5JA 4OGCA 1VK0A 3DRRA 1T05B 1EKEA 4CJQA 1GOCA 3TABA 4KTQA 3T1AA 5F8HA 3MR2A 3MFIA 3KK2B 3HPGA 4KFBA 3SNNA 3H5YA 4BWJA 4RW6B 2F96A 2EX3A 1JLEB 1LW0B 5KFCA 3IRXB 4J9OA 4H8KA 4QWBA 4KHWA 4PY5A 3U3GA 3IAYA 4Z4HA 2FVQA 5KFRA 4R0EA 3BDPA 2B43A 1HRHA 5DLFA 1TL3B 1RT5B 1RT1B 3T5KA 2FLNA 2JGUA 3AVGA 4N56A 3KK3B 1NOZA 1SV5A
chains in the Genus database with same CATH superfamily
1F5CA 1XR6A 2HPUA 4ED1A 1ZAVA 2QTDA 2HOEA 2FZKB 3ZTQA 3BN4A 3QERA 3SI8A 3PACA 3TRGA 5LJ5Y 4OJRA 2QC3A 5IWAF 4IO1A 4KPCA 4ED4A 4IXCA 5KGWA 3J81O 3QGGA 3KHHA 3S9HA 2YH0A 5ADXA 2QKBA 4U95A 5EX3A 4KHMA 2I5JB 2DHXA 2FC9A 2Z1HA 5T7LB 2IM1A 5AQRA 3AVHA 3ZZTA 2IMWP 5IT9O 5IM0A 4FPRA 2EK6A 3GE1A 4ANEA 1JQGA 5E33A 4ZHRB 1F5BA 3QSIA 2A1BA 2WTFA 2K06A 2XY6A 2E88A 2OPQA 2KLAA 2W9CA 1WSRA 1QQMA 3HHKA 1IBCB 3WX8A 2ALZA 2AD9A 2C2KB 3MEEB 3K2YA 4X4TA 5GAGP 3MCOA 4M95A 5LJ3Y 3J7ZT 2IM2A 4FVCA 3LP3A 4M5MA 4LF6F 3QNNA 3GR0A 2OJ3A 4UQTA 4GV9A 3QEPA 1OKJA 2DR5A 3R9PA 5AQXA 5LT5A 3E8OA 3H5XA 2R9LA 3ILJA 5AQHA 3T69A 2A41A 1GLEG 3L7OA 1WSJA 3HPHA 4FJLA 3I55N 2KVQE 4QPTA 3ZEUB 3S1TA 4UOFA 1WDTA 3PEJA 2O3DA 4W5TA 3CFRA 1CJUA 3JAMY 2Y0SD 1WC5A 2HBZB 3EDRB 3G4SS 1QAXA 4YORA 4G9ZA 1KSPA 4H4MA 3T1YJ 5LJWA 3MXMA 3TI0A 4AHVA 1YJRA 5EUHA 1UA0A 2J7KA 3DFEA 4LBIA 3GFXA 2DK2A 4OHZA 1ZAXA 2N82B 4LT6A 3L2RA 1UFKA 3MOJB 4FPIA 2AP1A 1FXXA 1A5WA 1VQ9N 4DQSA 2MYFA 4DTPA 4BWMA 3BEGB 4QYZJ 4HT5A 4OX6A 4USIA 1WB9A 2PC6A 3FUYA 1QHAA 2W6KA 2A1RA 3IWLA 2NPFA 3B6OA 3GIJA 1D9FA 4AD6A 1FJCA 3I0RA 1YJVA 3GCXP 3P39A 2IJRA 2W01A 3FBCA 1DARA 1TU0B 4CGIA 3DLLQ 1WUAA 1J5EF 2KXFA 1PBAA 3ZSWA 5BXIA 4CRJA 1S10A 1YVUA 4Q8EA 1S1VB 3AB2B 4ZN1A 1MWKA 2RD5C 4JN4A 2MKKA 4K4UA 5E84A 5FPDA 4CNYA 2VQFJ 2BJEA 5AQOA 2ZH6A 4RO0A 1M90O 2E6LA 3LPYA 4RJVA 5AQSA 1RA7A 1YDLA 2XZTB 1WG4A 2WW4A 1NSQA 4E7HA 4ZN3A 1X4BA 3QEIA 2BW7A 3SSQA 2FB0A 4XO0A 1VC0A 1S7IA 4WE1A 1DGKN 4NXMK 3SQGB 4UT4A 3WQPA 3ZETB 4DV0K 4I69A 3PXGa 1ZA1B 3GIMA 3HL8A 2D7SA 1CLFA 5GMEA 3LANA 3OPKA 2IM3A 3CJ3A 3O3LA 5TKYA 5JVGQ 2P9UB 2HBQB 4G1QA 5JVHL 3SUNA 5FRNA 4RG8A 4C11A 3OYLA 2K8GA 3LOUA 3L3UA 4W92B 4PKGA 3VQBA 3Q8SB 2GMJA 5A8KB 1T3VA 5CQGA 1L3VA 1X1PA 1EP4A 1NKEA 3GJRB 2OPPA 2RQMA 2CGLA 2XO7A 1VRTB 3MM8B 4M5GA 2HMIA 3TAPA 2ATCB 3J7YU 3ILIA 2Q66A 3MX5A 1EB0A 1AW0A 2DISA 4DPXA 2PYJA 2QWPA 5F9LA 4DR3F 1WBBA 2W41A 3CC2S 2YWFA 2VG5B 4OI0A 5AJ3F 3HHEA 1RKIA 2HSEB 3OFEA 3R5AA 1X4GA 2DNOA 2AT1B 2PFDA 4XIUA 4FYVB 3J7ZO 1S6UA 1VQNS 5DDOC 2PMZD 5IT4A 4ERDA 4RNHA 3K2PA 1Y64A 1WSIA 3AA2A 3O9QA 4K4VA 4M3RA 4X62F 4DTJA 1NGJA 3HZGA 1SH3A 3AD7C 3W1YC 3QJLA 3SAHA 4KGVB 1B0PA 1C4CA 2E1RA 1U26A 3DLHA 3GPAA 3I55S 3LZJA 4BC7A 3SV3A 1CVJA 4CHYA 4JRQA 4ZS6A 3TEGA 3V1OA 1T9UA 2IVMA 1XJWB 3VAIA 4NO7A 1LKZA 2RF2B 4CP5A 1RBSA 4CH1A 1JB0C 2FBTA 2NXNA 2XGQA 3HKZD 1F2GA 2YH1A 1TYQB 3VQ7A 1S7HA 3M32A 4F7VA 1NGGA 3MM6A 3M8PA 5F3TA 4WBFA 2P9IA 3C66A 4TSXA 2NXUA 3VAKA 4KH6A 5AQVA 4I6AA 2Z57B 3R7BB 4I67A 2QA2A 4ID5A 4IRDA 1WHYA 2A6AA 4ZVFA 4KH0B 4PL8A 1Y11A 4FF2A 3H1VX 4DLGA 2V2KA 1TV6A 2FPHX 5A8WA 4CJWA 4YEAA 5GAHP 1ZBIA 3GCWP 2ZDPA 5C24B 5HQLA 2HBLA 4FOEA 1EZZB 1I3AA 3SJJA 3M4XA 1Q79A 3TARA 1B64A 2O4GA 4N8OA 4DR2F 3I9V9 4IH6A 5C2FA 4Z94A 3DGVA 3HSJA 2E5HA 4BQZA 3CCRN 3EXYA 4KB1A 1UJ4A 3UN2A 1GQEA 3FBBA 3S3MA 5K14B 2YWHA 4G1PA 2IJNA 4R0JA 4A4JA 1JJ4A 2MQOA 2H65B 5GMKa 3KG4A 1OH7A 3T41A 4N5SA 4RBVA 4DV1J 1JXBA 4OPHA 5L1LA 5E3RA 2XMKA 3W62A 1UJ6A 1C0TB 3QT7A 1QTMA 4B9QA 3NS7B 2Z1JA 4QS9A 2NRTA 2MLZA 4BG9A 2N4DA 4V19S 4LR8A 1YHQN 2HBJA 3DU6A 2CQ0A 4KFBB 1HBUA 1RAFB 3MCAB 3V81A 4K8RA 4TU8A 2VPYB 2HW3A 5JLFA 2MZSA 2D0PA 3J7A1 4DL4A 3OYMA 3UO0A 1IBLJ 2B4JA 3G8TA 1ZYQA 5M2PA 2HQIA 4ILRA 2NZ4A 1DLOA 5D0RA 4M3XA 4KAZA 1HR0F 1SQGA 2X78A 2WBMA 3UDLA 1X31C 1UEUA 2HNZB 5I42A 4O8UA 3FDSA 4Y1CA 1VSIA 4C1NK 2K3KA 2D3OR 4S0MA 3VQDA 2FZCB 1GLLO 3HCXA 3IG1A 3GJTB 2BANA 3WXMB 4AL7A 3AY9A 5I3UA 1RDDA 4J2DA 4LMZA 4M3YA 1AUSL 4NLDA 4LR9A 2ASDA 3S8SA 3TQ1A 4CIOA 4LQ9A 1T9YA 2KYZA 1HJRA 2GWKA 2E1PA 1MROA 1QSYA 1YITS 4EK2A 1N34K 2FBVA 2MKHA 4NLQA 4A46A 4FJJA 2D0CA 5F3ZA 4YB6A 4IG0A 3UCGA 2Y9HA 5HVFA 1Q81T 3V6HA 3RBEA 1HLWA 2D3UA 4QIWD 5ETSA 1NGEA 4DS4A 4DMNA 3S6EA 1SH0A 4BE1A 1U0HB 1SKSA 2I8EA 1FEEA 4Y0FA 1YK9A 2HQ3A 2R8GA 4K59A 1NGHA 3CD6S 3FCHA 2CVIA 2I38A 4H03B 1N8RT 2VGMA 4H5NA 1I1GA 4JI2J 4KKOA 1IG8A 5AQLA 2O8FA 4RKUC 3CULA 4LF6J 1LWFA 2UUAK 4PA1A 1K0TA 2EG1A 4YOYA 3PSFA 5A8RB 3R1XA 1T9VA 3BN7A 3C3LA 1JLCA 3DXMA 4JAXA 1Q82T 2E2OA 2B7BB 3H2VE 4NLGA 3V9WA 1IBKJ 3RB3A 4HCBA 3D0PA 1VIOA 4RW8B 1HW8A 3M6UA 3TUJC 2ZH8A 4GVEA 3Q8UA 3JXUA 2M9KA 1J53A 3VTIA 3PX4A 1VSDA 3WEEA 4FM0A 2HGLA 1T6DA 3FSXA 3GDQA 5C5JA 2QA4S 2W8LA 3CQXA 3O8MA 3OSPA 5ETNA 4PQUB 2LKZA 4B17A 1CULB 4G6VB 1PJ5A 1HQEA 4F2SA 1I51B 2MTLA 2UYTA 1Y3KA 4FM2A 2P9KA 4ZVTB 2L9WA 3D0IE 3MI7X 5HVHA 3FR0A 4H0VB 2QK9A 3P5TL 1Y5IB 6AT1B 3D2EA 2FSJA 1BHLA 1O51A 4BR2A 3CDWA 1BUXA 1Q8KA 3AARA 2GNKA 4ZPTR 5M2UA 3FGUA 2WUSA 4CQ1A 2DEIA 3M30B 3OXGA 3QJJA 2R7XA 4Q2LA 4CFCA 1NJIT 3MM7B 4WKYA 2VQEF 1F9FA 3EGZA 4EUVA 1S22A 2C22A 4O3OA 4FZVA 3UFCX 2Y1IA 1WSEA 1ZPWX 3FBFA 4FBUA 4HUEA 1VQ6N 3EX7B 3FNNA 2CJAA 5ETRA 3VQAA 4IZ9A 2D0BA 3D6MB 1DTTB 2NRHA 3SQ1A 4DR6F 5KT5A 4DV2K 2OHDA 2X1AA 3R5GA 1BQMB 3ENQA 3L4QA 2Z56B 2VQFK 3UKUB 2K3IA 4J9SA 4E89A 3DRRB 3IR5B 2Y8YA 4DDFA 3TZXA 3HULA 3DOLA 2DT9A 5HN0A 3VAFA 3NOCA 4CEBA 2CJKA 3MEGB 3FC9A 4X4QA 2CFXA 3ZTRA 3LALA 1LFWA 4CO0A 2B7CB 2KKHA 4IFEA 1RWPB 4KV8B 2XM3A 1NZ8A 1OIAA 3BUZB 3SQGA 3C19A 2C3YA 3OYBA 2LSNA 3G71N 4Z4EA 2WVFA 1CJUB 5CD4H 4WCEQ 2XEXA 2YWEA 4RWTA 2V9WA 3K57A 2V7ZA 2W2PP 2XG8A 3J7YP 1N36K 1Q82O 1K8KA 4G1QB 4QYZK 3BYPA 4OPAA 1NJIO 4FLVA 2E1ZA 4LFBF 4TU7A 1EQMA 2V2VA 3MWTA 4F4YA 3OW2M 3HVTA 1NH8A 3KKFA 4QWEA 5A8KA 1R27B 3Q8PB 4PQAA 5HK4A 3EXCX 3M8RA 3QRQA 2RRNA 4LF4J 1I3OB 4RU2A 3SUPA 1H74A 1KQFB 3U4LA 4O44B 4ES1A 1CQMA 2IYIA 2ZWPA 4HHUA 2XYHB 1O6XA 4I68A 1ASVA 3NF6A 3KK1B 1VQ4N 1S4EA 4EGLA 5BR9A 1FD8A 3OHAA 3D28A 4M5DB 3IBWA 3JTNA 4P71A 2DHSA 1E6YA 2BXJA 2RHQB 3R7SB 3BBBA 4JEPA 3BS9A 1W7AA 4PUOA 1PSDA 1TUWA 1HW9A 2I5JA 1FCAA 2ASOA 2ROGA 3RBXA 3NGKA 3B8AX 2QWLA 4YDUC 2VFRA 4RL1A 3UD3P 1FXLA 5KG3A 1G3OA 2U1AA 2AJ2A 3NH2A 1E4GT 3ZZOA 4P2XA 2UXCK 3TEHB 3I5AA 4DU3A 1NG9A 3CMAN 2LDYA 1NMEB 5HLFB 4LRCA 4H4OA 3CPEA 4KREA 3AAPA 2UUCJ 1YZ6A 4WFXA 3J7Z5 3CSKA 4JI6F 5HO4A 2PA8D 4NOHA 1WLJA 3CJBA 4PABA 2OIHA 3Q83A 4A47A 5M1PA 1RAGB 3GOIA 4B1WB 4XAKA 2HG4A 3CDAA 4I9QA 2Y3YA 4ZKAA 3QESA 4QR2A 1SQFA 2LEPA 3BM7A 4NCBA 2EFPA 4DUYF 3RR8A 2UXBK 1ZA2B 3FZLA 3C6AA 3NEKA 3AOBA 3WC0A 3CO0P 1CJTA 3HPOA 1VSEA 1FJEB 4L6V3 2C3UA 4A2BA 5EY4A 1IBKF 3A2FA 4X66J 1K8AO 4JI7J 3QFPA 1M5KC 1NDPA 4DTNA 3H25A 4DV7K 5D6GA 2OMLA 4A8XA 3V4IA 3CJKA 4JV2A 4HKQA 4I2PB 3G6ES 2LXUA 1RSCA 4AF1A 2W4CA 3T5LA 1RCHA 2RRAA 3VQ4A 2CZ4A 4IG0B 2E44A 3J7YI 1UFLA 1C0TA 2HRUA 2OO4A 2ZC4A 3AVLA 4C8OA 1N54B 2FJDB 4CT8A 1LV5A 3M05A 4NLOA 5GIOA 4ECUA 1HARA 1HX1A 5EN1A 4U67Q 4L74A 3JAMU 3OYEA 2QE5A 1U1LA 2ILZA 4ZVRB 3QFUA 3VGKA 1JWWA 3BYRA 4B3RF 1QUVA 5KI6A 2QSWA 3I0RB 1RBUA 2OPQB 2VV5A 4O5FA 4CF2A 4JKGA 5KPZA 4TNOA 5DQHA 1DLOB 2VH7A 2ACYA 4GY2B 3SI6A 4I7FA 4TY9A 4KAIA 4YR3A 2RU9A 3O5BA 4JI3F 3I56N 4E8UA 3QB0A 2Y1JA 3CD5A 3KIOA 2DGVA 4FWPA 4A8WA 4OMFG 3D2FA 1TQLA 4NPOA 3PR4A 3DLGB 2HK3A 1FRHA 2BRKA 2RKIB 1NHKL 4FVUA 3GMGA 4OLPA 1OMSA 4YOVA 2A3JA 3TW0A 4GNIA 2AJQA 2I6WA 4OLBA 4M5NA 2R7QA 1BC6A 1NSKL 2VBYA 4ZVUB 4YR2A 1RTIA 2COLA 3KXDA 3D4JA 4WIIA 1HKCA 2ZM6F 3M3ZA 1N6QA 3CCVS 1KVAA 3PVXA 2ERRA 1TUYA 1MNEA 1PO6A 2FQQB 4G3IA 2CGKA 1H98A 2XTJP 2P9LA 2F9WA 4ZHRA 5LSOA 2I7PA 3S3OA 2ZD1A 4PXDA 2HBMA 3SUQA 2W25A 4A8QA 1FWLA 1F60B 4ATNA 2AGQA 4FVMA 4Y0WA 1VQPN 5GIPA 3UCUP 4OYAA 3CIMA 3IBCB 5DS7A 1D9DA 1KVBA 4K4TA 3THYA 4DSJA 1XNRJ 4DUZK 3J80O 3J7AN 2VG5A 1J5OB 4M63C 3O3FA 5FJ4A 7AT1B 1YI2N 3RMBA 1XIQA 5KFLA 4LF1A 3TU5A 5KT7A 4ZJLA 1FJ7A 2AJ0A 3M2VB 2DXEA 1QSLA 4B3RJ 2DR9A 5B0EA 2B4OA 3AQPA 2LQ5A 2OP5A 4FLYA 3K5PA 5CZVA 4XTTA 4AXJA 4FKXA 4WYWA 3FZFA 3ISND 1Y3JA 2ILYA 1NB7A 2YNFB 4RW7B 4ZP9A 4FF4A 2WBNA 2CZ9A 3GIRA 2PO4A 4P10A 1U09A 1ZBFA 3EUNA 2YY3A 2DFEA 3L4BC 4U7UK 2VZ9A 1HNIA 1RTJB 4QYRA 4PL7A 4HEA9 2BJ7A 4ECQA 4DR2J 2HBYB 1H72C 5CY4A 2WC9A 3MPWA 4B3OA 5CHCB 2RSQA 3U1LA 3PIPQ 2RN2A 4E98A 2FHJA 2E5LJ 1FWPA 3PIOL 4K5RA 3ZT0A 4O3NA 4NXNK 5BYQA 2FHMA 1CZ9A 2OPPB 4NZ0A 1S6OA 1V3SA 2G0CA 1U2VA 2HNDA 1MU2B 3QWPA 2JEJA 2F4VK 2AYGA 5CE3A 1CPZA 3TUIC 4TXSA 1VLYA 2IY5B 2QGFB 3BSNA 2ATQA 1KVIA 2FF3B 3GQCA 4DV5J 3N6MA 3VVUA 5DG9A 1SL2A 4FJ7A 3HSDA 4WU2A 4JRPA 2MJNA 4PG8A 5CABA 3NNHA 1UVJA 4K4WA 4JHDB 2QMXA 5K14A 4R5PB 3FCVA 2NREA 4JI1J 4ECRA 3AVNA 5KFHA 2OD4A 1AZSA 4U6PA 1E6YB 4XH4A 2GQCA 4WF9L 3TAMA 2VG6A 1A6LA 2X51A 2P2CB 3W7BA 3ZZZA 1CJKA 4KHQA 2Q1LA 4E2FB 5LMUK 4OYWA 1NPPA 1N32J 3FZHA 1UVIA 3MWBA 4NLUA 1DY3A 4RUHA 5F2RA 3LP0A 3QO9A 5ITHA 3MPYA 3C16A 1WKJA 4KGMA 4BROA 1DAXA 4BDPA 2NXJA 1RWKB 3DGPA 3NCQA 1TUUA 1I39A 3ATUA 1BCOA 4C3KA 1M1KT 4B1VA 3SMPA 1HBOA 3ZSVA 1WEXA 1NK5A 3OYGA 5BR8F 3FBEA 4WQ4C 2VICA 1B99A 3SAGA 4JI4K 3VZIA 3G25A 2E9TA 1C0GA 4NRUA 3MD3A 4P2FA 5GADI 5KOXA 3DXMB 4CH7A 4TY8A 2L41A 3AA3A 1Z1ZA 3EE8A 4WIQA 4J37A 3BPDA 1L5UA 4YP3A 4BR4A 2E1AA 2VWBA 4BRCA 3MOZA 1HNXJ 1OQ3A 4B3SJ 2EBGA 1SZ2A 4JV0A 1FJGJ 5DLGA 1R8BA 4QU6A 2NLXA 3CDUA 1KTQA 4FWSA 1KR4A 3BH6B 4GC7A 3KFWX 1SXLA 2JEFA 2HQGA 3H98A 1TL1A 1ACMB 5HRRA 2YX6A 4ICLA 2WTUA 3AVBA 3CCUS 2CQPA 3W64A 2GX8A 3LF0A 4MK7A 1YTYA 1REVB 1XMOF 3KUHA 3THXA 2HS0A 3CM5A 3SPZA 4ER8A 1VOMA 2F5GA 4M3TA 2C2MB 2P5OA 3U9DA 1FF2A 3RAXA 3RSEA 2LXFA 2NSBA 5C2CA 4WZQA 4C8NA 2P9CA 2C42A 5K8NA 2K1RA 1RLCL 1VK8A 4DTOA 2AKWB 4QJVA 4DPYA 2CNLB 3BKUA 2CPEA 3CFOA 4YOTA 1VAZA 4ILLA 3I8DA 5MAOA 3THTA 4USVA 3SBMA 2YBVA 3RAMA 2W42A 1UJ5A 5CA5A 2VQEJ 3EVMA 1G99A 3QIPA 1F3VA 3HOSA 4WK1A 3VGLA 4J7CA 3BF3A 1I94F 4YOWA 1FRIA 1VQ6S 4OYOA 3NBPA 5JLHA 4DLEA 1CULA 3MPDA 3CXCM 1RCOB 2F8MA 5KFDA 5MLCQ 2YQ0A 3G6VA 2ADBA 1YJ7A 2C2NA 3V1QA 1H38A 2E8AA 3ZSQA 3UW1A 3NL0A 3ENHA 1SQKA 1GLDG 3PW5A 1GMWA 1T3OA 4DB3A 3CMEN 2ZH2A 2H4YB 1VQ5S 1HLUA 2ZVIA 3E9LA 2EK1A 1OY9A 2PMWA 3WNEA 2XLIA 2CQCA 4OJ1A 4B3SF 3G8SA 2N4CA 3THPA 3R1HA 2H9ZA 3L95X 1JXEA 4UF4A 2XHCA 4YY3F 2KG0A 3RMCA 2Z58B 5FRMA 3PYDA 2M88A 3KLEB 3HO1A 4OV6A 4YFUA 2HNZA 5I42B 3WXJA 3HSTB 3T7ZA 5J1EA 2CNNB 3P96A 1BHNA 3ENBA 2OPRB 3IFEA 4ZP6A 3P83D 4YY3K 3U6FA 3UNGC 2RE2A 4M3ZA 1S76D 1VQKN 1HKAA 2GVZA 4BRGA 2HLUA 3ZZ0A 5HRPA 3VGTA 3AJ2A 3H5SA 3C2PA 1BWVA 3K8VA 1Q5YA 3GJSB 1M1GA 4K5SA 3TABA 1UVNA 3T1AA 5F8HA 1IR1A 2CPIA 2Z4PA 3WEEB 2ZHOA 1MROB 2O67A 2GUPA 4BWJA 3H5YA 4JI0K 1ILYA 1JLEB 4JK9A 4NYPA 4NWBA 3IRXB 4U67L 4QWBA 3P49B 3GG0A 2DGQA 3BGUA 4PY5A 3CCMN 4CLWA 3WQTA 5JMVA 1EAYC 3MCMA 2FVQA 3BDPA 1X0FA 2UP1A 2PIIA 2POKA 1TL3B 4X65F 2G4BA 3AVGA 4GV6A 3KK3B 1UETA 2APOA 1RBAA 5G4DA 5K20B 1MLAA 2RH3A 4C0HA 1QVFM 2ZFHA 4J2AA 4YOUA 3TO8A 5D78A 1TELA 3I82A 2GHVC 4IJAA 3NS6A 4CO1A 4WYLA 4LFAJ 1F9EB 1NGIA 2LXIA 4FYXB 3E01A 1FA0A 4Q5VA 1SIZA 3MR6A 1XNQJ 1IR0A 5FIIA 3HSCA 2HAIA 3UD5A 3KLGA 1FE4A 1RWXB 4URGA 3P31A 1MN7A 5EGYA 2LYVA 5SWMA 4DR1K 2D41A 1X9WA 2P9SA 4CEDA 4K42A 3QGPA 3OYAA 3HK2A 2X6NA 2KHDA 1GOBA 3WQUA 1TMMA 2B0GA 6FD1A 3GR1A 1C1BA 3RBZA 3OFHA 2MQQA 2O8DB 1JNRB 2XMTA 1YQHA 2Q31A 2FD2A 1ICEB 4AM6A 1WF0A 1ZBHA 2UVRA 3CCSS 2CPJA 4X4OA 2IC3A 3D0HE 3BJYA 5AQTA 4ZP8A 3UDCA 3F9KA 1C1CB 3RW6A 2JWKA 2PE8A 3DM2A 3VEZA 2FY8A 2EVZA 4ELTA 1RBVA 2KHCA 4Q8FA 4DHVA 2W6LA 3ENWA 2HWHA 3VMFB 2W9BB 3KTQA 2IPOB 2LEAA 3W9HA 1YKWA 2DRDA 3U1MA 1WNSA 2ZUAA 4B08A 1WF2A 4WKRA 3LDSA 3CJTA 1C6VA 3AGKA 3KJFB 3NNAA 1RKJA 4PWDA 3QLHA 2ZJPQ 4CHPA 3EE9A 3KK7A 3NAHA 4PG5A 3JSMB 3Q8YA 2WOMA 5D4PA 4M94A 4K43A 5H9FK 1BI4A 2VFUA 1YTUA 2RE1A 3SMZA 2UXBF 3DMJA 3I4PA 3HDSA 4BACA 4XPCA 1SPBP 4BY9C 5DM7L 4KGKA 4CH0S 4I4BA 2R2UA 2RVJA 1R31A 3VPZA 2ADCA 1EXQA 2GQ2A 4CEQA 3U1NA 2RDIA 4DPUA 4UY8O 1RHUB 2CJXB 1VQSA 2RKIA 3Q8QB 8RUCA 2IA6A 3SV4A 2GC8A 5B09A 4QR0A 1TKTB 4BR5A 1RT2B 4CZGA 3W9IA 3SEOA 4CF0A 3OR2A 4G1IA 5J2PA 3V4IB 3CJKB 3AVJA 4ILHA 4U9RA 2G0IA 4X2BA 3FLCO 4BRNA 4ZIWA 5KG2A 4YHHJ 1SCJB 3MAAA 2H4WB 4FXVA 4JD2B 2LQ8A 5KFVA 3C14B 4LRAA 4FZXC 1U1NA 1S1UB 1EWRA 3RBDA 2VG6B 4P73A 2G0JA 2FC0A 3AO1A 2L9NA 5HMZA 1H2UX 4I6MA 4GKKK 4JV5K 4OL8A 4H0PA 3UWTA 2EHGA 3MN6A 2P9LB 3BV8A 5H9EJ 3G6EN 1VRUB 2ASJA 3V81B 1RT7B 4F25A 3RB4A 4B1XB 1U24A 4BC9A 2KN4A 4LRFA 1H7XA 1VMBA 1S1XB 3D9BA 4W90B 2HRTA 3NGDA 3EICA 1TK0A 4ED3A 5I9EB 1QE1A 1VHIA 4W4MA 3R2DJ 4WXOA 1YGYA 1NEEA 4DR5J 4PYDA 1GLFO 4C7QA 4O3SA 4LF8K 4DV1F 2DPIA 4KGZB 1DFDA 1WC0A 4P2SA 1BE4A 2NR0A 2G8KA 4OVLA 2O8EA 1WN7A 4IH7A 3ZNUA 4NYZA 5L9NA 2IM0A 3Q8VA 4PXCA 6FDRA 4ETXA 2GJFA 1YJ9S 3L7UA 3BO3A 1IKYA 3GG1A 2ZGZA 4AHRA 4OYXA 3M9MB 4GVBA 3PYGA 4F4WA 4LF5K 3W9JA 1QAIA 3TAQA 2MZJA 3NWGA 3IKMA 5DQIA 3SQ2A 3VGSA 2XHWA 2E5GA 5A2QY 1HNZK 4FWLA 4OYPA 2AWZA 1YVNA 2FLOA 4BREA 1UOCA 3QWUA 2C3PA 4K25A 2ZOMA 2AU0A 2HZCA 3TTFA 1TAQA 4M7XA 3WNHA 3QBWA 3X1LB 1CJVB 2CPXA 3PEHA 5EWEA 3SJHA 1HWJA 3NOGA 1WTBA 2QV6A 4P2MA 1U48A 1H2TZ 5D15A 3TAMB 2GELA 4DR4K 5AXKA 4X65J 2QL5B 2XI3A 2V69A 1LXNA 3AT1B 1LOTB 2CKWA 2PFFB 2RAQA 2V51B 3TQEA 4MJKA 1KAZA 1LXJA 5AFUA 1R3NA 3PO5A 1CEZA 3GONA 4YHHF 1OYDA 3OBIA 1U1RA 1RI7A 3MN9A 5IWAJ 2N7CA 4HT7A 2KG1A 1RDWX 5DETA 4M1KA 2DH8A 5B7WA 2J6UA 4DEZA 3ZSZA 3AQOA 2YKNB 2CG8A 4ES3A 3WX4A 2MLXA 4WP9A 1U2VB 2V4QA 1C4AA 2JNJA 1RT6B 3T1HJ 1W2IA 3QQCD 3PIOQ 1RADB 2OPRA 3OYNA 4GVLA 4NZ7A 3CCRS 3QEVA 5HSPA 3BZCA 4IR9A 4EP4A 5F0WA 2B9WA 4CLKA 2HHXA 1GTEA 5AJ3J 1NMNA 4K4YA 2MQ8A 1HNWF 2OSRA 1HHTP 3DNCA 2D9OA 4OZLA 2CQDA 4HCCA 4R5PA 1VYAA 3OV7A 3H3NO 3OL6A 2CNOB 5F8IA 3R5DA 4M3UA 1X5PA 4IWVA 2QG9B 1PJ6A 4P6QA 5F9NA 4DU7A 2LECA 4NYFA 2YWKA 2WHOA 1KAXA 1KQGB 2JHEA 2LA4A 5KT4A 2AGPA 4BRPA 3T5HA 4TLRA 4JKHA 3CD6N 3O08A 4NI2A 3FZBA 2MZ1A 3O80A 4M3WA 5KPTA 3UKRA 1VBYA 4DCJB 3ZLJA 1IJJA 4AYBD 4A59A 3OJSA 3PX6A 3KUEA 2IVPA 4ELVA 2ZBRA 5U47A 3CFPA 1BLUA 2FHJD 1HKBA 3CC4N 1X3NA 4BR0A 4ED2A 2UVUA 3OVNA 2Z2LA 4FS1A 4WZMA 3PW7A 4FZYA 1CC7A 4CECA 3VETA 4ZLLA 1FRLA 2FTRA 4DFMA 2DFFA 1DZ5A 2NS1B 5DGAA 4K0KJ 3DYAB 5DZ7A 2Q43A 2ZH5A 3L4IA 1Q16B 1TKZA 5CZ1A 1MMLA 4ZPBA 5ETMA 4YDXA 4B3MJ 4FYYB 4OI4A 4PG6A 1ZM9A 1HA1A 4AQYJ 1RT4A 4QQBA 3VVTA 3E66A 1JL2A 2MQMA 5IFMA 4BR7A 3HFZB 1PIEA 1HNVA 3RMDA 2CG4A 4RW6A 1R43A 2R7SA 3OTOF 4GRSA 2JSXA 1YJTA 2OAUA 4MQ3A 2IC3B 2ZUGA 4ECSA 5GAGU 4NLVA 4ICLB 2RJZA 1UWBB 1KC8T 1KN6A 4CZHA 1TL3A 1JLAB 2FF6A 1OO0B 2Z2MA 3OY9A 2V63A 4M63A 3KYLA 4JI8F 3KUGA 1N34F 2NUBA 3A5OC 1REVA 3AA9A 3HJVA 4M5HA 5AQNA 5M1FA 1HWUA 1FE0A 4HHJA 5H1SQ 2DNLA 3ZX3A 3CVKA 3TUZC 2YKOA 1X8DA 4OX7A 1DT9A 5DG8A 1TK8A 1WF1A 3R8EA 1BMQB 2A10A 3VQEA 4KI6A 4CZJA 2DNQA 1RFQA 4HHTA 5A0YB 2XGPA 3GILA 2JWNA 1R6VA 1SS6A 1MMDA 3HSZA 4JI6K 2P9GA 2QA4N 3CERA 4CGDA 3J80Y 1FERA 5TKWA 4V19J 4M7YA 1JLQA 1RTDB 3EEQA 2O8DA 4CGJA 4OZJA 4JI0F 3GG4A 4CJ7A 3GJQB 1U1MA 1U2FA 3CCJS 2WK4A 4LUBA 5L39A 4DX5A 3W3SA 3E3XA 4Y1DA 3K5MA 4UY8T 3QZ7A 3HP6A 1YRTA 3UR0A 1JKHB 4ED8A 4HVJA 4B1ZA 4IKFA 3ONQA 3KJQB 2UXDJ 2C1EB 2XRIA 1NK0A 2ZH7A 3I96A 3PUFA 2A6OA 3O6WA 3MN5A 1ZXOA 4ZTJA 2UXDF 3NVKA 4QAGA 1IVZA 2RUSA 2H3GX 2ZC3A 4PKHA 1BIUA 2ZH3A 3AA4A 3FZ2A 1W97L 1RK8A 4FWKA 4CFAA 3SDEA 4EU0A 1XK8A 3KK3A 4DFJA 4DSIA 2GBZA 2QMUB 2RRBA 4UOHA 3IM9A 3BDEA 3Q24A 3IRWP 3IUCA 3A5MC 1B7YB 1YZ7A 1RDCA 4CLUA 4DR7K 3B4MA 1MMNA 2ZJQQ 4PCQA 4LC9B 3WBZA 4UQGA 1N33F 4ZVGA 4C97A 4B3MF 3R2CJ 2BEFA 3TR8A 4NE9C 2AW0A 3QT6A 1A0OB 3VWSA 1FDDA 1B70B 3PYEA 3L7PA 3MMCA 2GFFA 3UD4P 4EMDA 4A48A 2ZKTA 4CW7B 2NUUG 4WFYA 4QW9A 5DZ6A 3KKRA 2G1HA 4N7TA 4HWIA 1SB6A 2O5DA 3AOCA 1TUGB 4DR3K 5GINA 2Z30B 2WSEC 2ZWOA 4CHNA 1I6JA 5CD4A 5I4MA 2HHSA 3ITHB 4IFVB 1TK5A 3OR1B 3QAEA 5JVHQ 2NYIA 4P9SA 2GIQA 5ADZA 2WVCA 3VQ5A 4LBHA 1OH8A 3UVJB 1RT3A 4Z2XA 1ASUA 1M1HA 1SH2A 4ZPAA 2M4MA 2I1RA 4URSA 4ZPCA 2W2NP 5AT1B 5LY3A 4DV4F 1A7GE 2QFJA 4X84A 2GGPB 3KLIB 3SSRA 5KFNA 4J8FA 2W2OP 2A3ZA 4OZ3A 4JI5F 2ZM6J 1G2EA 4KI4A 5BR8K 4F67A 1BCMA 4QZVB 1Z4UA 3L09A 1CQNA 1PYTA 5KG4A 1IBMF 2UUTA 2IRUA 5D77A 5IC4B 3KK2A 4JS5A 4IRCA 4I7FB 1FDBA 2YKPA 3RSEB 1FD2A 5L8RC 4DMZA 1S9GB 3HKWA 2IS3A 4K0KK 4ZLJA 4YS2A 4KGXB 2QLJB 4ZOSA 5LMNK 2NZTA 1DBDA 1P9QC 1XMQJ 4FJIA 3H20A 4CLFA 2NSCA 3V1RA 5IOLA 1OH6A 3VF2A 3I33A 1RILA 3DXSX 3CUNA 4Q45A 2BDPA 3KVGA 3R3LA 1SJRA 4H5WA 1J27A 1VSFA 3VF6A 1VFJA 3NY0A 3EVWA 1KNZA 2BA9A 1WAJA 2JEGA 2BE9B 4EYHB 3EWGA 4NZ6A 3CCLS 1Q7YT 3QRRA 2XMAA 5DGBA 1KOHA 3RB0A 1IWGA 4FJ9A 3RVCA 4P74A 2OTJN 3BBFA 4DV6K 1WI6A 1KAYA 4X62K 3UB5A 1HNWK 5DQGA 2B9EA 1PGZA 3J81Y 2JL9A 1X4FA 4EZ6A 4IH5A 2K7JA 1NDLA 2CVEA 3T1YF 2XY7A 3ZXWA 4JKAA 4O5BA 3MZIA 1FRMA 2BQRA 1QQOA 4C11B 3OS0A 1X5TA 4TQSA 1K73O 3QLHB 1OQ6A 2C2ZB 1NJXA 3IC1A 4CGHA 2VODA 4CE9A 3CCVN 4DCOB 4Q2MA 2GX9A 3Q22A 3MMVA 3SIPB 3AAQA 4ILGB 1IKXA 4FBTA 3QAUA 4ED7A 1TL5A 2NRZA 3MUMP 4WFNL 5J1EB 2HHHJ 2QX0A 3M6XA 2Q6CA 4B3TK 4LFBK 1S0OA 4FLWA 4NCAA 1C1BB 3AO3A 3CCLN 5J2MB 2XHBA 4IOXA 3I8BA 2YTCA 4DL3A 4F3OA 1VGYA 3CB4A 5K8OA 3ZX2A 3KLHB 1EHWA 3LDPA 2NCKL 3K17A 2ZJQL 3TVKA 4DPTA 4OX9J 2QFIA 2DO0A 2VBWA 3W8GA 4FKYA 3OUYB 3OL9A 1YJNN 4DTMA 4EBEA 3LPUA 1Z2ZA 3H42A 3K5LA 1ZOTA 1HR0J 3GFYA 2YNFA 4RW7A 3OQ2A 5CYMB 3ZEUA 5CZ2A 4B02A 2GIRA 2WFBA 2ZEJA 1L3UA 2AX0A 3PZPA 3DC2A 3J81j 1RJJA 3U7JA 2R8HA 2XY8A 1KONA 4HLBA 5KFGA 3T9ZA 2MQLA 1IM6A 5IM0B 2Q97A 2R2SA 1EETB 4FPAA 2XQCA 4C0BA 4WF9Q 1I94K 3G71S 2V2QA 4NEZA 2BE2B 4MLEA 3O6QA 3E51A 1PJ7A 1WBDA 4Z37A 3DXBA 4IEEA 2FLLA 3G10A 4FW2A 2HNDB 3OT9A 3EPGA 5K8PA 3IWNC 4LRDA 1QUPA 3MAHA 2B4UA 2VQFF 4BC5A 4B9MA 4E1MA 4CO5A 3C6UA 1BGXT 2VGNA 3KWGA 2IVOA 5C2GA 1UZDA 4L75A 3BQ0A 4H5VA 2CIMA 5HANA 1NDCA 1QQCA 3KG0A 2W4PA 4L3KA 1T8EA 1Q86T 2VBXA 3R6MA 3CI5A 4AILC 4NLXA 5CCLA 4GMKA 2CPZA 2RS8A 2CRLA 2CUYA 3CCQS 4F0MA 2UU9K 1CBKA 4ZJQA 2VF3A 1FFSB 1U8WA 2GIFA 1R89A 2VDHA 2DY4A 5LJVA 1N0VC 2VJUA 4CM2A 3OTEA 3VEYA 2W9AA 4FJMA 2GO8A 1Q78A 2FJXA 3CC2N 4KHRA 2XLKA 4F9OA 1NRKA 4ECTA 1BWFO 2YKQA 1P27B 4LFCK 4FPBA 2HKEA 4WE1B 4ZMMA 2EC2A 4ZTFA 2OFGX 2RF2A 1NGBA 4H5RA 4IDHA 2ASYA 1P6TA 1OVYA 4OGEA 4DSEA 1YX2A 2N3OA 1TYQA 2OH2A 3A8IA 1HI0P 3MEDB 2W7OA 2W9CB 2HHUA 1NAQA 4U8VA 4PKIA 4TKTA 3VEVA 3N9UC 3QATA 4RUBA 4ZJOA 4W5OA 1HFEL 4DTRA 4CJFA 2WVEA 1NGCA 1IUJA 3JB9k 4CHZA 3NMAA 4IDKB 3QZ8A 2GMLA 2DHHA 5A0YA 4GVMA 5ETOA 3MM5B 3IGNA 4RW4B 3ZC4A 4D3HA 2ATLA 3FKBA 3EKSA 2DNKA 3K5OA 2PEBA 4DQPA 4O44A 3AGRA 3IDHA 4GKJK 3I32A 4KIAA 1NNEA 3A8EA 2F1FA 2QWQA 4L3NA 5KFBA 3IM8A 3MMCB 3AVCA 3L0QA 2B4PA 4RBTA 1X9JA 5AXMA 1K1SA 5ELZA 3FVYA 2KW4A 3DLEA 1WI8A 1RE1B 2XBPA 3PX0A 4O4RA 2B6AA 2KKZA 1HQUA 5KQDA 2DR8A 4MKBA 1S6PB 2VKZG 3KKSA 5F8JA 3A5NC 3M8SA 2RIJA 5KT6A 2FDNA 2FHOB 4CK1A 4WP3A 3UKRB 1NK4A 4A8MP 4JI3K 2QSFA 1NBEB 3NE6A 1N5SA 2CAJA 3IMQJ 4LVOP 4DX8H 4NB4A 3B4DA 2R7RA 3H2LA 1VC6A 3OFGA 2V8HA 1VQ8N 2NPIA 4IOAQ 4JUZA 3CJ4A 2ZH4A 4RWWA 4TYAA 3ZT2A 2GAHC 4ZCLA 3H3OB 4E1NA 5D8HB 4DR1J 2DNMA 3C7NA 1JLGA 2DGXA 3FSYA 1PC4A 4WQ5C 4LF9F 3CJCA 1FX2A 4WCEL 1TAUA 3BKTA 2GW8A 3NMRA 3OD2A 1JCEA 2DCUB 5F0UA 2RQKA 3BZQA 3BREA 4OKEA 3PW2A 1S57A 2H51B 4JYAK 4C1NI 1JLBB 1QLNA 4CJVA 1NO8A 4EIAA 4B8CA 2QLXA 4U96A 4F2RA 1MWYA 4Z7CA 4DG1B 3MAAB 5JS1A 4I56A 1HNVB 1S59A 3CPWM 3PJXA 1HPMA 2YQ3A 3OR1A 1S1UA 3H08A 4PQUA 2KZMA 4NASA 2E9RX 4DI6A 3O8WA 4NI2B 2BABA 2PT0A 4YDUA 4H4MB 4PZVA 5BPMA 2JC1A 1EO1A 2OELA 2A40A 4EO6A 3O9SA 3K8WA 2E6MA 2XS5A 1ZAWA 1IO2A 3OVBA 3CCJN 1U04A 2RB7A 3WIUA 1YWXA 2HVIA 2BR0A 1TR0A 1YAGA 4NMLA 2F9TA 1YIJS 4X64J 3CIZA 1Q5VA 5B0GA 2J9DA 1BWEA 3RGIA 4ISGA 1J5EK 4E7JA 5F8NA 4ZLPA 4KKOB 4B9SA 3MM7A 4ID5B 1LAWA 1S4FA 5LSRA 2XMUA 4QW8A 1DRZA 1ZH5A 5EU7A 1JLCB 2MJUA 1RT6A 4EHTA 4ES2A 4CLTA 2VB6A 5IXUA 5E26A 3QBXA 3OYFA 3H45C 4CLYA 3EYZA 4OX9K 4MO5A 4XH1A 3D6RA 3LAMA 3VOVA 3R9LA 5J2QB 4HACB 2ZHBA 5C24A 3G8QA 1KEKA 3D0GE 4Y34A 3M9OB 1YG0A 1PYOB 1KXPA 2HBRB 2GQQA 4ZVQB 3KLFA 2V4JA 1BQMA 1BQXA 4DQRA 4X4SA 1OVQA 2LMIA 1HBMB 3T6JA 1UVMA 4BVPA 1RHKB 2A6MA 2MKJA 1G1XA 4IOCL 3JQJA 3VQTA 4LFBJ 3N4QA 3HM9A 4U8YA 3BR9A 2CJBA 1KQSM 1SJFA 3EGVA 2KT2A 4O0NA 4A8YA 4I6WA 1ZBTA 4JNEA 1SJQA 1U6FA 1B4SA 3VQ9A 5FLXU 4F4KA 1UP1A 4LBPA 5HATA 3ZETA 3PHTA 1SJ1A 4RNFA 5CYMA 2V67A 2YVSA 4OI6A 3MWPA 3NS5A 3H46O 4PPDA 2R4FA 3H8YA 3SCIE 2CPHA 3POTB 2O8BA 2CQBA 3SCKE 3ZSOA 3U8XA 2MMYA 4DFKA 4M42A 3N79A 1WNEA 2CNKB 4URQU 1UFWA 1R8AA 2VQEK 4H5TA 4KHUA 2ZQBA 1W0HA 5DM6L 2LDIA 3KLGB 2KM8C 4X62J 1N5YA 3ETMA 2AF6A 4DV6J 1VHXA 1M5OC 5A8WB 5EX5A 1HPZA 4I2QA 2YHXA 3BH7B 4Y2CA 3QIDA 3VAMA 4WQ4A 1WC1A 2QI2A 1KOOA 4AQYF 1S1VA 3IMXA 1WELA 2F40A 5THWA 2D74B 1XR5A 4C3LA 4QOTA 4CFBA 3SSSA 5HRSA 4JKFA 2AA4A 1VQ7N 4K8ZA 4UY85 4J9QA 1WSVA 3NXZA 3VQ8A 1C1AA 1MW7A 3QEXA 3OYKA 1ITPA 1S1WA 4CZEA 2YPZA 2XI2A 2HHHF 1N36F 2DKOB 2MEWA 1XMQK 4FNIA 1VI7A 4EO8A 4OHWA 4H0YB 5C12A 1MWZA 4RW9B 3F5TA 2GO9A 4MTPA 4NCGA 1JK9B 5CYJA 2C2DA 2HVZA 5I3QA 4ECWA 4Q7AA 4MMOA 2QZ8A 4MIWA 4CZKA 2NLWA 2JJ4D 2J9DE 3NH1A 3ILOA 4O23A 2AZ3A 2P6SA 4KHPK 2O4IA 1LW2A 3BEXA 1QY7A 5FLXO 1XI1A 3R5JB 1OSDA 3MMBB 1HMVB 4CYUB 1F2HA 2L9DA 2HNYA 4JI1F 1NJWA 3W66A 3TZYA 3EL2A 3RG6A 1G4CA 1S9GA 2IYGA 2PFUA 3LH2S 5D3GB 2MY7A 1MWMA 1ZTTA 4X4RA 2F8TA 5F1XA 5A8RA 4A5BA 4WP8A 1GT8A 5LXYA 3D3BJ 2EW9A 1HL6A 1KQSR 1IKWB 2DNYA 2ZE2A 4DR3J 2WVBA 3HHLB 1GAOA 2RDJA 2VJVA 1RXOB 2HVEA 4KB7A 4DQIA 5KFZA 1XNRF 2KH9A 4M5LA 1J9AA 1JLQB 1RTDA 5E2QA 3CD7A 3ULHA 1ZZFA 5AQFA 4L76A 1VSHA 2HGNA 3GFZA 3UVJA 1N32K 3I6PA 3E1YA 1O0PA 4X4NA 2UUBK 2FSNA 3MEGA 2W24A 1QDUB 2HQDA 2EFVA 1UWBA 2HZVA 3H40A 3HD1A 2VWKA 4K41A 5E7OB 4LRBA 4CM0A 4OGCA 5AZIA 3T5JA 1BU6O 4CJQA 1EKEA 1GOCA 1FEHA 2J8SA 4DV5K 2QWMA 2BKNA 1M1KO 2J0WA 3SNNA 5EHHA 3JSBA 2EX3A 2KHOA 2DEJA 5KFCA 4H8KA 2JVRA 1XC3A 1MWQA 3U3GA 3NWRA 4AM7A 3IAYA 2X3DA 3N4PA 3VGMA 3N28A 1Q7LB 2E5LK 1HRHA 2VL1A 5DLFA 4YB5A 3CQYA 2QWRA 1RT5B 4BC4A 1RT1B 1QD1A 2FLNA 2E66A 2O1PA 2EXUA 3LM9A 5L38A 2FZGB 4MKYA 1S97A 4CO3A 1TL7A 2ZWHA 3PV8A 3O4QA 3LGMA 3VTHA 3HZEA 2DB1A 3HVWA 2AEJA 3O4NA 1WJ9A 2PD1A 4MYUA 1N56A 5KG7A 4C8YA 4IFVA 1WOPA 4L3QA 5B0DA 2G1DA 3SBTA 4BBYA 1S6PA 2OPSA 1NPKA 1NKBA 4DV6F 8ATCB 4KRFA 1WUUA 2ZBQA 4BDZA 3GV5B 5GADP 1XQSC 1NM2A 4CNZA 2V4RA 4IRKA 1SKUB 2Z1IA 1GOAA 2Z0GA 3SAFA 4B3RK 2HFVA 3IR7B 3M8QB 5A2QU 2FVRA 2E2NA 1LAVA 4CBUA 3T6BA 1Q4RA 4FOIA 4CLLA 1XERA 3MDFA 3THXB 4K2JA 5AQZA 1WOSA 2VFVA 3M6GA 2DO4A 4FJNA 3BGRA 3C8YA 3GB0A 1H1VA 4J2EA 4TQRA 3DLKA 4HTIA 2F9JA 5ETVA 4RZRA 4Q43A 1KC8O 5JMNA 4DQQA 1X5OA 3W2WA 1F6TA 2XWXA 2JEIA 3GSDA 1AROP 1FXDA 3HI9A 2HIQA 1G7CB 2NZCA 5FROA 1I5OB 2H5JB 3O1LA 1VQLS 2RHKA 4AQYK 1W9HA 4WFZA 1T9TA 3R6LB 4KV8A 2QO3A 1FNMA 2DRBA 4FCYA 4ZIVA 1KWMA 2A2DA 2HFOA 2I9SA 1HQEB 3B78A 2R8JA 1FESA 1VQLN 3CWJA 3DLEB 3CCQN 1ROFA 3KZBA 1X5SA 1AYEA 3D54A 4DL0C 4FK4A 2OSQA 1FRKA 1Q8BA 2VUGA 3N6LA 1ITGA 4OZ2A 1RWMB 3KWIA 2PAVA 4XPEA 1T6CA 4CEOA 2G8UA 3HFKA 3TJ8A 3MPUB 3SZ2A 4PWWA 2G13A 2YX1A 4B3OB 2XYPB 3PDNA 4MAKA 4Z4IA 3MR3A 2QKKA 1JMTA 1U02A 4BDYA 1XWLA 1U47A 3F9MA 2PI4A 4R8UB 3DDIA 1VSKA 4CLSA 5FLXY 1UVKA 1BIZA 2QL7B 3AXMA 2H48B 2Y0BB 3C7NB 5BYSA 2XMWA 4J9VA 2I0XA 1ZBLA 3M8YA 2WONA 4CHOA 5A76A 4ZPWR 3ULEB 4N41A 1NSAA 3PYFA 1KHWA 3IAM9 4NEYA 4JBCA 3U02A 2DNPA 2LA6A 1O1WA 2YWGA 1BG3A 2WSFC 2BBEA 3DOLB 1YSJA 3DOKB 1FXRA 1VJQA 5HQMA 2GEMA 3ZYYX 1ZTWA 1WTFA 3T1HK 1FKPA 4ZCKA 1KTVA 4WYBA 1F0XA 5T7BA 1PG5B 1RCXB 1RWWB 5K9FA 3VAJA 2IVFB 1VLOA 4R79A 1L3KA 1T3NA 3RWUA 2RILA 3CC4S 1VQMS 4M5KA 4E1JA 5G0RA 3PJ9A 3LP0B 4JI7K 1HNXF 3M2RB 2ITMA 4WTOB 2PY5A 1KDNA 1E6VA 1SQEA 1YRXA 2LLZA 4OJHA 4MT1A 1RA6A 5D4LA 3CTRA 2YNIB 1FDAA 3AOAA 1LWEA 4J5OA 3PR5B 2AYBA 2KL8A 3M1VB 2XMJA 2R7OA 4NLBA 1GFWB 2YPYA 3UDVA 3DLLL 3MR5A 3DRSB 5IT9Y 1M5VC 1K0VA 3H4DA 3H2UB 1RAAB 3BGOP 1R7IA 5KFSA 4USJC 1J5EJ 1ZC6A 1KVCA 2KQ2A 5AQQA 1X9SA 4QIEA 3R97A 4X64K 4K8XA 3IFRA 3P6YC 5GAEP 1LWCB 7FDRA 1U6ZA 1GMUA 4CIGA 5L9XA 2J0XA 4AXIA 4H54A 3W3DA 4GMJB 1U1PA 1LK5A 1MN9A 4DG1A 3PFOA 1NCLA 1NNDA 2DTJA 4LF5J 3VEWA 2BM0A 2YKMA 4CEFA 1WC4A 4DBQA 1H2VZ 1RAJA 4I6YA 2D69A 2IA0A 3WXLA 3L2QA 3NAEA 4BVOA 1HBNA 4DV0F 3QNOA 4LF8J 2MSTA 1T9XA 4AHTA 1HHSA 1UPMB 5ETTA 5BRHA 4I0WA 2AJ4A 2GV9A 2KFNA 4USUA 3KDNA 4BCAA 4CERA 1NLKL 3CC7S 3WXKA 1B0TA 3L6QA 2YX4A 3UI3A 4J9LA 3THWA 3HVTB 2GJIA 1N32F 4JKGB 5H9EK 2GUIA 1HNIB 3FZKA 3CJQA 1HBOB 4NYNA 3MMBA 4LFCF 1LFPA 4ANDA 2DY1A 3K5NA 2YXLA 3K89A 3LGHA 1C0UA 1KCFA 3PFEA 2QMWA 2F8SA 2QRRA 4K50A 2IBKA 2WRMA 5L46A 3CJ8A 1M0SA 1RWVB 2HB5A 2D0OA 2JRSA 3N5BA 4YQWA 5JXSA 4ED5A 2M0GB 2KB2A 2ASMA 5B0AA 1BI4B 1YIJN 4QWAA 3H7HB 3DRPB 2ZE2B 2O66A 4JLHA 2DJWA 5H1SV 2VG7B 2E1MC 4DL7A 3IS9A 2Q3PA 4DUTA 3C6TA 2UV8G 1V3ZA 4B1YB 5C15A 3MM9A 3IAS9 4DFPA 9RUBA 2G8IA 1TKXB 3MF5A 4JI3J 2KFZA 5KG1A 4DJBA 1TKTA 1TP7A 2RNEA 1VK3A 1DURA 4HTLA 4TVAB 3CCUN 1S1TB 1NLVA 1EKRA 1U4BA 5EWGA 2EFNA 2ALYB 3D2WA 3QGIA 1XMOJ 1UMJA 4ILMA 4RW9A 3VQ6A 2IVNA 4BHQA 5KG6A 3G0ZA 3RRKA 2ZD1B 2BE7D 4Y3CA 5AQYA 4B9UA 5HROB 1XQIA 2IGIA 2IHR1 3HYFA 4J9UE 3M7VA 3OBYA 4IYQA 2P5VA 2VWJA 3P4IA 1J2VA 4GKJJ 4DWIA 3C16B 4DV3F 4U7CA 3RRGA 1VRUA 3DGPB 3K59A 3TSUA 2CWXA 1S0NA 2OUGA 3DHWC 1RYRA 3AV9A 5EOYA 2V8VA 4FNHA 5E5NA 1H7WA 1TZ0A 5E3QA 4XDCA 1XMOK 2G2ZA 1GEHA 2HAFA 2L08A 1G15A 4DTSA 2VU5A 3S41A 4ZPDA 3BGRB 4QOZB 1FT8A 3MR7A 3NGZA 2JWLA 4HTJA 2QEXS 2NUHA 3SBGA 4QS8A 2ZJRL 3W2VB 3V6DA 4TY8B 2FVSA 5M1OA 4C0OC 4KB0A 2Q3SA 3KHLA 4B8AB 5HBMA 3ZSYA 2P1JA 3JS6A 1FKOA 2OTLN 4I2PA 3M8WA 3NGIA 1HYVA 1A9NB 2G8VA 2XNQA 2JX2A 1RDBA 1NK6A 1UTAA 4NCGB 3MHYA 3D1OA 4X64F 2DXFA 3FE1A 4LFCJ 2OPSB 3R5BA 3HVAA 3FCWA 1BISA 1S5ZA 2R42A 3M9NB 2NRWA 3ZO7A 3AA8A 3L3CA 4OHVA 1YUWA 3G9CA 4FK0A 2EKNA 2VIHA 3AVFA 1HYSA 5HP1B 4BRHA 2CH5A 1CJVA 3C46A 5DO2A 4ZPVR 3QO9B 4OX9F 1KVKA 3AY0A 2XCPA 4DF8A 1LW2B 2KVIA 1TFYA 2IBOA 3KHGA 4FF3A 1VQOS 2AMCB 5AZIB 3CC7N 1RTHB 3TJ9A 5LL6d 3ID8A 1KBRA 2EC0A 2ZOGA 4UOCA 2Q2RA 4M8LA 4NLRA 1V5VA 2YI1A 1WKLA 5AQJA 4LF6K 2BKPA 3G2XA 3ENOA 5B0CA 3ZTPA 1OYEA 2QN6B 1RDAA 2YKNA 2WCXA 1D8ZA 3DJCA 2G8WA 1EJ7L 1FTCA 4AL5A 3SYZA 4DS5A 2JLEA 3THVA 3VGVA 1Q95G 2R7YA 2DNHA 5A6PA 4O8KA 2ZH9A 1ZM4A 5KFOA 3M2VA 3P4UB 3ULEA 1WHWA 2FUG9 5IC6B 4A61A 1S9EA 3LWMA 1XHXA 3D6HB 2DIUA 1KP6A 1U2RA 2AX1A 2ZZTA 4DR7F 1ULRA 4NLPA 1EX8A 3CNQP 1SC1B 5B8HA 1S6QB 2V2ZA 3M5RA 1EKSA 1LQ9A 2DNGA 4IG3B 1HR0K 1BOTO 1FDNA 2DITA 2HVDA 4HUFA 4LIRA 1N34J 5C2DA 5KFTA 1SIWB 1RHRB 2WVDA 3H0PA 1NM1A 1W2BR 4BLGA 3M6WA 3MCPA 3KNAA 2R7UA 1QVGM 1S79A 1R0BG 1OY6A 5J2NA 3FFIB 2R8IA 1ZBSA 4OPKA 3EM1A 3DKDA 3LGNA 1CXUA 4RUAA 4CZLA 3G82A 4OZ5A 3F73A 3WHIA 1LEOA 1WORA 1BUPA 2I7NA 1NJZA 3M8QA 3AVMA 3R1LA 1AUDA 1FHTA 1SJ4P 4AL6A 3H5UA 4MDAA 4UTGA 4B3TJ 1CG2A 1IKVB 5HI7A 4ZVEA 3K0SA 1NK9A 1QQNA 4DN9A 2HF4A 3FJ2A 1FWKA 1G6BA 1URNA 2CDQA 1ATSA 2E7WA 4DV7F 1TKDA 2UV8A 1YBUA 4MYTA 4FJXA 3FGVA 1E4FT 3QETA 4J9PA 3HHLA 2DNRA 1R0AB 2E29A 5DM6Q 3O3HA 2MXYA 1FTRA 5HRNA 1Q81O 1JNZB 3A5LC 3HHLC 1U7LA 3NMUA 3W2WB 4H0OA 2GAGC 4USWA 1LWCA 2ZZMA 2W7PA 4MFBA 3GIIA 2KTQA 3UE2A 4OZ1A 2V34A 5EWFA 4RNOA 5BPLA 2XSFA 1GLJO 2HWIA 4RX6A 3VCDA 3BSOA 1VQON 1T03B 4EAHD 3GFHA 1YT3A 2E1CA 4A8KA 3VAGA 1CSJA 2O8BB 1A5VA 1KLMA 4DN0A 1TUVA 4L73A 4HUGA 2P51A 4DL6A 3TVZA 4JP8A 4CI0B 1V4TA 4K4XA 2KU7A 5L1JA 4J90A 5KG0A 3NGTA 4PWDB 5T41A 1RABB 1CXQA 1LW0A 2GWJA 3OTCA 3M8PB 3ZSXA 3OLAA 3JSMA 2NNWA 3VA0A 1JXVA 2MKCA 2OGUA 1K8AT 2VFSA 5K8MA 3BGLA 2QLBB 3SMSA 3QMLA 5LMNJ 3DLKB 2QT7A 1O8BA 3Q23A 4ED6A 3A3OB 2EPIA 1R59O 2P9PB 1X4AA 2Z2ZA 4Y28C 2IVYA 1DHMA 1WWHA 2RT3A 4NRTA 2BZ2A 4JI2F 4G65A 3SK3A 1UZHA 5BR8J 1TVRA 2ZM6K 1Q1KA 1UVLA 1H73A 3HVRA 5CYQA 3O5TB 1RT2A 1MDUB 3HOTA 3JSRA 4HH1A 3PKYA 2QXLA 4IEIA 2A42A 3ZSRA 4HDHA 3HD2A 3VR1A 3TNVA 1SVDA 1VDHA 2FIUA 3MUVP 2H54B 2IDEA 3R6GB 4C3MA 4MLHA 1TTHB 3M8ZA 1N0UA 4H0XB 5KFPA 4CJLA 1JLEA 2MSSA 1SUQB 3CYMA 1SKWA 4RCHA 4I6MB 4JI4J 5J1NA 2IIRA 3QSYB 3R7NB 1ZETA 2Q0UA 3GV8B 3D67A 2P9NA 1K47A 2JDJA 4DUZF 1FKPB 1YBAA 1RYSA 4IOAL 3K0JA 1T44A 3NDKA 1XEZA 3ISZA 3TAFA 1HD0A 2BUPA 3CCMS 1Y0HA 4BG8A 2AEMA 5E3AA 5ETKA 3TWZA 5KFFA 3OFFA 5CH7B 4CFDA 2E5JA 3A3NB 4AE5A 3T3FA 2KM8B 1VHFA 3VALA 4CIEA 3ZT4A 3IGVA 2AQ4A 1N48A 4JV1A 3DRXA 1KS2A 3TTDA 3RJMB 1WHVA 4DR7J 3ZTOA 4C2MA 3OTDA 3J7AP 3VN5A 1QAYA 3M1VA 4Z4GA 1FVSA 4W98A 4PXBA 2D0AA 2H3EB 2ZH1A 2DH7A 3DRPA 2UUBF 2WONB 2DNZA 4ECXA 4DTXA 1R6YA 2BOPA 1LWXA 3QIPB 3IS9B 3OL7A