4R5PA

Crystal structure of hiv-1 reverse transcriptase (rt) with dna and a nucleoside triphosphate mimic alpha-carboxy nucleoside phosphonate inhibitor
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
555
structure length
555
Chain Sequence
VPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTNSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase, hydrolase/dna/inhibitor
molecule keywords HIV-1 reverse transcriptase, p66 subunit
publication title Alpha-carboxy nucleoside phosphonates as universal nucleoside triphosphate mimics.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
total genus 150
structure length 555
sequence length 555
chains with identical sequence C
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2014-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4r5pA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4r5pA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4r5pA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4r5pA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4r5pA05
4W5OA 3OVNA 4HTUA 2ASDA 4ECXA 3QZ8A 4CCHA 1BQNB 5JS2A 4F4YA 1RBVA 4CJTA 2G8FA 3OYLA 2W9CB 5E41A 3GIIA 3E01B 2IM1A 3PX0A 3IG1A 2ATLA 1UA0A 4O55A 3LDSA 4CGIA 3V81B 1RYSA 4DL6A 4ZPAA 5KT2A 1NHUA 3TR8A 5J2QB 3V9UA 3LPUA 5D3GA 3KLHA 3QNOA 4J2BA 1S9GB 2XI3A 3OSNA 2VWKA 3HP6A 4CHOA 3NH1A 3OS1A 4CJ3A 3OSPA 4QCLA 1SH3A 3MR5A 1S1TB 4N47A 2XY7A 2G8UA 4B8AB 2FJVA 1U04A 1HYSA 4CFBA 3KHLA 2D0CA 2OPRB 1S6PA 3C6UA 3OYGA 1IKWA 1JL1A 4IKFA 3PO5A 2KTQA 4O3NA 1WNSA 4F4KA 3O3FA 2DY4A 4E89A 1TQLA 4YR0A 2JC1A 2BR0A 3H98A 4CK1A 5KG6A 4Q5VA 3QESA 3BR9A 1UWBA 3BGRB 1KFSA 1T05B 5FDLB 1NHVA 3OYIA 3PZPA 3RMBA 4KKOB 3VQ4A 4ID5A 3KMSA 3EZUA 3CQ8A 1SL0A 2FVQA 1NK7A 3DRPA 4RNFA 4TXSA 3RRGA 4GC7A 2O4IA 3G6YA 2XRIA 1T94A 3ASMA 3V9WA 2LSNA 4RU9A 3C95A 1JLCA 4I9QA 3DRSA 2BANB 3SUOA 3ZSRA 1QSSA 3MEEA 3BSAA 3HVWA 4AHUA 3RMDA 4NLUA 3K5OA 1QTMA 4KAIA 2IM3A 5L1JA 3HP9A 5DQGA 3OYJA 2HAIA 3SCXA 1T3NA 2DPIA 4NYFA 3ZCMA 3OL6A 1VSLA 4YR2A 4HUFA 3M8QB 1C1CA 1QE1B 4M3XA 2D3UA 3HVRA 2F8EX 5DMRA 4U6PA 4ZTFA 4FJMA 4FJ9A 4I2QA 3ZT0A 1K1QA 1K1SA 2D3ZA 4DSEA 1ASUA 4QOZB 1U47A 1S48A 3KHRA 4CJRA 4KHSA 1S49A 3CFPA 5DQIA 3OY9A 4L8RB 3MXJA 3NH2A 5KFWA 2HNDB 3VQCA 1LWEB 2B5JA 1HPZA 1EETA 4JV0A 1D1UA 3CJ0A 3AVAA 4CJEA 2HNYA 3QO9A 4TLRA 5KFVA 5T14A 4CHZA 2HW3A 1IKVA 3OS0A 2B6AB 1JX4A 2W9AA 3GV7B 2W8LA 2FBTA 3IN5A 1L5UA 2YKMB 1QS4A 3CJ4A 2RN2A 1LW0A 4H4MB 4CHYA 3ZT1A 1RTIB 4PWDA 4XPEA 1W25A 2FC0A 3UDLA 1L3TA 2IM2A 5KFKA 3NGZA 3V1QA 1NK8A 4FLVA 3H4DA 1TKXB 2W42A 2R8JA 4ZP9A 1BI4B 3KNAA 1VRTB 3I5CA 2GBZA 4RW8A 3V6HA 4ID1A 4YFUA 1JKHA 4WZQA 3A2FA 3PR4A 3QEVA 1JLAB 5KRSA 1TGOA 4E7HA 1QSLA 2Y1IA 4DFPA 4KRFA 2W8KA 3SPZA 2JC0A 3H40A 2KZZA 4WXWA 3VQBA 4J9RA 3C6TB 4ECQA 3VA0A 3AO4A 4DLEA 4H4OA 2FLNA 2JEGA 3GQCA 3OLBA 3KKRA 4NLPA 1Z26A 5CYQA 5FROA 3AVIA 4RW4A 4LSLA 4ZP8A 5C42B 1UAXA 2C2DA 1MU2A 4E1MA 1ZTTA 1ZBFA 2YNHB 5KFAA 2DTUA 4K4WA 2CJQA 4QWEA 1K6YA 4FJKA 5C25A 3I8DA 3RWUA 1J9AA 1ITGA 1RBUA 1LW2A 4GVMA 2RF2A 2IAJA 4FBTA 1HMVA 4PQUA 4IG3A 3NBPA 1D5AA 4KTWA 4F4WA 1N4LA 1RDCA 3QLHA 3MXIA 2G8IA 4ZTJA 5KFGA 5KFDA 1JL2A 1YVUA 2X6SA 4DL4A 3M8RA 3V4IA 3CYMA 1EXQA 1CSJA 1IH7A 2PY5A 1Z4UA 2J6TA 3IRXB 1X9WA 5DG8A 3HT3A 1HRHA 1TV6B 1FKPB 3NF8A 1TKTA 3K5MA 3FDSA 5I3UA 4HUEA 1TL1B 2ZD1B 5K14B 3QYYA 4WE1B 2HHSA 1NK4A 3HVAA 4Q43A 1HNIA 4JV1A 4FCYA 4Z4HA 4AILC 1DTTA 1XHZA 2XY6A 1Y97A 3CO9A 4DTMA 4ELVA 4FS2A 4ICLA 5EWGA 1LAVA 3HO1A 3DLKB 4OGCA 4LD0A 3ZT3A 4CF9A 5L9XA 2FBXA 1HQUA 2HHWA 1WSEA 4G1QA 1F21A 4B9TA 4CF2A 4RW9B 3HXMA 1S10A 1RTHB 3QGIA 3SYZA 5HBMA 4WFXA 1RT5B 3PW2A 3IS9B 3WNGA 1XWLA 2FLPA 4K4YA 4FJLA 3DLHA 3NAIA 4Y3CA 4NRUA 1JXBA 1RT1B 3BJYA 4RW7A 4FW2A 3KLFA 1IKXB 4DTSA 4DSJA 2AU0A 2OPPA 1S1XB 3PJXA 4R5PB 2R8HA 4CK3A 4BDYA 3SV3A 1A5VA 3TWHA 3PUFA 3DI6A 5JUMA 5L1KA 4BWMA 1KLMB 2PYJA 3TAGA 4ED6A 5HROA 2D5RA 4MFBA 2IBKA 3QEXA 3KLIB 4N41A 1C0TA 2R2TA 4DL2A 3FRZA 4AH9A 1JLEA 3KK2A 1RT3A 3ZSVA 3H4BA 4CGGA 2OYQA 4JS4A 1RDBA 4IFVA 2YNGB 5KG2A 2BE2B 1DLOB 1WN7A 4URGA 2DFEA 5J1EA 3QGGA 3VQAA 2D41A 3UPFA 4J9PA 2I5JB 4Z4FA 1SL1A 1T03A 3EPIA 3I0RB 4C8OA 5SWMA 3NFAA 1S0MA 4E7KA 2WK4A 3PJWA 4ECVA 3U6FA 4DTUA 1S1WA 1T8EA 1S6QB 5T7BA 2A1RA 2GIRA 1QQCA 5SZTA 3G6XA 1ZBLA 1TVRA 4J9NA 2IA6A 4WYWA 2VG7B 5C5JA 3M8PB 1FKOB 2ZE2B 3I5AA 1HQEA 3BSCA 3TVKA 3OHBA 3DYAB 4KHWA 1C0UA 4J2EA 4CF0A 2ASLA 1ASWA 4IBNA 1RTJB 3TAPA 4IR1A 4ZVEA 1SUQA 4CHQA 2XWYA 2DFFA 4RW6B 1R0AA 1DTQB 5F8HA 2BQUA 4X2BA 3MEGB 4EP5A 4DQPA 1S9EB 3JSMB 3LP2B 3PVXA 3EY1A 1NKBA 3B6OA 3MF5A 3PW7A 4F2SA 4B8CA 4B3OB 3KK1A 3DRRA 4FZXC 3ITHB 4NYZA 2BRKA 3BQ2A 2RKIA 4OL8A 1LWCA 4CJ5A 3MFHA 2GV9A 3RAQA 3KLEA 3CM6A 4QAGA 4Q45A 3V9SA 2E9TA 3CFOA 5F9NA 5KFTA 3HVTA 4KB0A 3CVKA 2RDJA 2J6SA 1RT7A 4CJFA 3NF9A 4FS1A 4C8NA 4ECWA 4DEZA 1QSYA 1JLGA 3KLGA 3G10A 3MXMA 4NCBA 1FK9A 3KLVA 3SUQA 3TAEA 2DPJA 4BE2A 4DTXA 4E19A 3HPOA 4C8KA 4DG1A 1SH0A 2AQ4A 4CFDA 1VSMA 1IKWB 2KW4A 4KE5A 4NZ0A 3D28A 1NKCA 5CYMB 1N48A 3LP0B 4FJHA 1HNVB 1Q8IA 2E9ZA 1WSHA 2QE5A 2VG6A 1HYZA 3H59A 4F50A 3DOLA 2GUIA 1N6QA 4URQU 5KFJA 4IDKB 5HLFB 4KB1A 3BREA 4EO6A 1NJWA 1I3AA 4ZPDA 2VA2A 5KFZA 1CXUA 3AVJA 3DRPB 1C1BA 3MR2A 3RTVA 1WAFA 1QHTA 4DFJA 4NLRA 4I7FB 1ZYQA 1ZTWA 5HP1A 3AA3A 2KFZA 4DFKA 3KHGA 3HJFA 4FJXA 2VA3A 3SQ4A 4TY8A 1HJRA 4ECZA 3ISND 3K57A 4K4VA 1BQMB 4O0IA 4F3TA 4LQ9A 4JRPA 4RNNA 4DWIA 2HHUA 2WCXA 2E6MA 3LP1B 2IOCA 2JLEA 1RT6A 4WZMA 4YNQA 4DS5A 4NLWA 1KVAA 5KFUA 1D8YA 3V6DB 5EU7A 2QKKA 1TKZB 1C1CB 1LV5A 1NK6A 4DQRA 2R8KA 2W7PA 2OPSA 4DTPA 4TY9A 4FLYA 5KT4A 5F8IA 3T5KA 2B4JA 4IG0A 1SKWA 4ECTA 3SV4A 3L2QA 4M41A 4F8RA 3HYFA 1N56A 4J9OA 1BQNA 3BQ0A 4ZHRA 4BWJA 4DQQA 2HNYB 3QO9B 4FZYA 1SV5A 2WTFA 4O4GA 4CEDA 4O44B 3LAMA 3BSNA 3AVKA 2G8HA 3V81A 4FK2A 2OZMA 4CECA 2QXFA 4CF1A 5KFRA 1T7PA 4QPXA 4ZVFA 4QWAA 4FK0A 3QNNA 5J2MB 4FJ7A 3P83D 5KFBA 2AJQA 4K8ZA 1U48A 2R8GA 3LZIA 4M95A 3RMAA 1CZBA 4HVJA 4DTRA 5EWEA 4O4RA 5J2NB 1UOCA 1NJZA 4Z4CA 1VSEA 1X1PA 2ZQBA 3OJUA 4LSNB 1WSFA 4FLZA 3DLGB 4NLSA 1Z25A 2AGQA 4NLTA 4JRQA 1S1UB 4CESA 3RRHA 4CJ4A 1WLJA 2Z1JA 1BCOA 3LANA 3OYBA 4HUGA 3BGRA 3FFIB 1HYVA 4QW9A 5FDLA 4ED8A 4EBEA 2W7OA 4AHTA 1VSIA 1RT2B 4K8XA 2P5OA 2G8WA 3JYTB 2ALZA 4MIBA 4DQSA 3MEDB 5JS1A 4ECRA 4H4OB 2X74A 4RUAA 3DOKA 1KFDA 4LSLB 2V9WA 5KT3A 4IFYA 5KT7A 4RZRA 3OL8A 3VQQA 5KFMA 3L8BA 2Z1HA 3IAYA 2BANA 4TYAA 4DQIA 2HHVA 1REVA 5C25B 3WNHA 3QEPA 1LW2B 4W5RA 2RF2B 4FM2A 1BGXT 4PQUB 4IG3B 4LH4A 2JEFA 1B92A 3PO4A 1S1VB 1TP7A 3VN5A 4CEFA 3KKSA 2XI2A 3TABA 3SQ0A 4KO0B 3QERA 1RNHA 4B9MA 2IC3B 3VA3A 3KIOA 1GX5A 3H5XA 4CEOA 2Z1IA 2VG5B 4NLOA 4PA1A 1KVBA 1S0NA 4JV2A 3QEIA 4CJWA 4NLQA 4PY5A 3NGYA 4O3QA 3H08A 1VSKA 1KHVA 4CJQA 4KTZA 3MR3A 3PHEA 1ASVA 3HHKA 4K4UA 5I42A 2OZSA 3Q8PB 3TARA 4CEBA 2AGOA 4MQ3A 4ICLB 3GV5B 2WONB 4FLUA 1S0OA 1VRUA 3DMJB 3MFIA 3S3MA 4YR3A 2RDIA 4TN2A 2B43A 2YKMA 4H4MA 1IO2A 3KK3A 1N5YA 3T5HA 5KFNA 3MECA 4AHRA 2X78A 2IDOA 1TK0A 3QGHA 4R8UA 2JEJA 4OPKA 2YKNA 1YVFA 2R2SA 2OPQA 4IKAA 5KTQA 2HHXA 4FLWA 1CXQA 4E7LA 1Q9XA 1KHWA 4FJ5A 2HMIA 1L3SA 4M3TA 2OPPB 2W9BB 1KTQA 2AX1A 4F4XA 1W0HA 2HHTA 3QIDA 3ULDA 3M8SA 5HROB 1S5JA 4MFBB 1YTUA 4CJLA 4CHPA 2P51A 1C0TB 3OS2A 3CDEA 4Q8EA 4Q8FA 1JLEB 3NF6A 5CZ1A 3AVGA 4DMNA 4MKAA 4CGFA 3DLEB 3BSOA 4FZZA 5HRRA 4ED2A 1T03B 1NJXA 1VSFA 2UVWA 3CM5A 4GC6A 3ZT2A 4FM0A 4LQ3A 4CJUA 3U3GA 4KBIA 4O3OA 3GYNA 5KFPA 3PR5B 5KGWA 4J9QA 4TSXA 4FVMA 2D7SA 1TAQA 1Q9YA 3I0SB 3K5NA 4ZMMA 4CIGA 2HWHA 5KG5A 1EX4A 1TVRB 3OL7A 1WSJA 3L2RA 2Y1JA 3VQ9A 3SFGA 3OYFA 3C94A 4DL5A 1KLNA 3AO2A 1VSJA 3ZSWA 4CIFA 2ILYA 3V1OA 3D45A 2KFNA 2XY8A 2BDPA 2BQ3A 5L1LA 2YNIA 1JLBB 3OYAA 1JLQB 4M3RA 1A5XA 2EC0A 4IQXA 1TV6A 1SUQB 4CFCA 1FKPA 3SFUA 1SKSA 1U45A 1L3UA 1TL1A 2WOMA 2ZD1A 4O3SA 1IKYA 1ZBUA 2O5DA 1RDRA 4Y2AA 4FM1A 4ED3A 3CDUA 1SH2A 2V4QA 3EPGA 3HSTB 4Z4IA 5KT5A 1TKDA 3BQ1A 4Q0BA 4CF8A 3KD5E 3DRRB 1B9FA 3AO3A 4BDPA 4XIUA 2RKIB 4N76A 4I2PB 2HNZA 3PW4A 1CZ9A 4CGHA 3L2UA 3QINA 4N5SA 5KFHA 2YHBA 3VQ6A 3OYMA 4YQWA 4GMJB 1U49A 2YV0X 3IS9A 2GIQA 3WNFA 4M3ZA 4RUCA 3H5UA 3AA2A 3E51A 3THVA 4IRDA 4UQGA 1YTAA 3ZT4A 4Z0UA 1RT1A 4NCGB 4KAZA 1S4FA 2D0BA 1EP4B 1RTDB 1J53A 1FK9B 4IH5A 3M9NB 4M3YA 1J5OA 2FJXA 2D0AA 4DF8A 1TAUA 5DG7A 2FVPA 2AWZA 1QAJA 4HYKA 4JLHA 1KLMA 3AV9A 4B9VA 4MK8A 3H5SA 3K59A 3Q8SB 4ZP7A 5KG1A 3KJVA 2HVIA 1XR7A 1JLFA 4AHVA 4CK2A 3AO5A 1HARA 2VG6B 3UR0A 3QZ7A 3FSIA 3QIPA 4MK9A 3DOLB 1N6QB 3D0PA 4QW8A 4O3RA 2IJNA 3IG1B 1TL3A 3I0RA 2J6UA 4ZVGA 5DK5A 3RMCA 1L3VA 1XC9A 3D5MA 4Z4EA 4E3SA 5D3GB 3KLHB 3UQSA 4Y34A 1BISA 5HP1B 4W5NA 3K58A 3AVCA 3LAKA 4CE9A 4TY8B 4CEQA 3TAQA 3OL9A 5KFLA 3RB0A 4Y2CA 4RG8A 1HYSB 2R2RA 3TAMA 2FBVA 4B9SA 2VG7A 4WFZA 3DM2A 1FKOA 1LWFA 1S6PB 3C6UB 1RT6B 3VQPA 5KG0A 4CIEA 4B9UA 1SKRA 4B9NA 3H5YA 5EWFA 3MAQA 3CFRA 1RTJA 2VWJA 1UWBB 2OPSB 2HWIA 4KB7A 2AGPA 3PW0A 4HCCA 2F96A 1RT4A 4ECSA 3NAEA 4RW6A 2A1SA 2FVSA 3MEGA 2Z1GA 5DLGA 4M3WA 1WSGA 4ID5B 5KFOA 1JIHA 3MR6A 3O4QA 4DSLA 3RB4A 2C22A 5J2PA 3L2VA 3ZSZA 4M94A 1NK0A 3ITHA 3ZSXA 4ZHRB 3CJ5A 2C2EA 2YNFA 4CERA 5L1IA 1XHXA 1JLCB 1RAJA 3NAHA 1GOBA 2ZKUA 3DRSB 1SV5B 2R2UA 5EUHA 3VQDA 3OYDA 1XI1A 2ITGA 4O4GB 1NKEA 3RAXA 4DSFA 3MEEB 3CJ2A 2GC8A 3AVFA 5C24A 2RPIA 4CEAA 4LY7A 4EYIB 3T5JA 3SJJA 1B9DA 4QWCA 3CWJA 2E6LA 3RR7A 4KHRA 4H8KA 4DL3A 4MIAA 3KMQA 5F9LA 4KFBA 2G8VA 3LWMA 1A5WA 2JEIA 4DL7A 3QEWA 2EX3A 1NJYA 2OA8A 4KV8A 4EZ9A 1JXEA 3LWLA 4O0JA 3T3FA 4FJGA 4KTQA 3T1AA 4I2QB 4PUOA 3HK2A 3QIOA 4EYHB 3NE6A 4NLVA 5KFQA 4FLTA 3GIKA 5CYMA 2P1JA 3LP0A 1HNVA 3WNEA 2XGQA 2B5JB 1HPZB 3MTKA 4FXDA 1EETB 3AO1A 1D9FA 1GX6A 3CDWA 5F8LA 1I39A 3SQ2A 2W9CA 3O3GA 1TK8A 1RBSA 1RYRA 4FJNA 4IDKA 3E01A 5HLFA 4CJVA 1IKVB 2FJWA 5DLFA 5FRNA 4DU1A 4DLGA 4OKKA 1LW0B 3DOKB 5J2QA 4NLXA 3SI8A 4KPYA 4IFYB 4I7FA 4PWDB 4LH5A 3V6JA 1XR5A 1S9GA 2R8IA 3O3HA 2UVRA 1VK0A 4NCAA 4JUZA 1REVB 3NHGA 1QAIA 1S1TA 1BQMA 2CKWA 4B08A 2F8TA 4ELUA 5HRNA 3Q8RB 3LP1A 2OPRA 1OS5A 4K4XA 2ETJA 3K5LA 4RW8B 2QK9A 4F2RA 1BIUA 3KHHA 3F9KA 1JKHB 3ZSYA 4CGJA 4NLGA 4M42A 2IS3A 1BCMA 1ZBIA 3V6DA 3VQ5A 4C8MA 1TKZA 1KRPA 3OYCA 3CG7A 3F73A 1NOZA 3SPYA 4AHCA 4ZPBA 4DU3A 4WYLA 2BQRA 1T05A 1NK9A 1TK5A 4BDZA 4CFAA 4KKOA 3DLBA 4IRCA 3SQ1A 3NMAA 4O3PA 3HPHA 3GV8B 2C2RA 5JXSA 5KFXA 5CYQB 4RW4B 2E9RX 5I42B 2UUWA 4IRKA 1MU2B 3RB6A 4MH8A 4ZVHA 4OPJA 4IR9A 3HM9A 1MMLA 4O44A 1VRUB 1NK5A 3HKWA 5KRTA 3M9OB 3GIJA 4EZ6A 2IAJB 4EO8A 4C8LA 1HMVB 2IGIA 3PY8A 5KFYA 3KK3B 4EBDA 3OYEA 1N5YB 3TQ1A 3NBPB 4NLYA 2FVRA 3MECB 3OLAA 3V6KA 3OYNA 2F8SA 3QLHB 1UA1A 1RILA 3AVMA 3OJSA 5J2MA 2NUBA 4R8UB 4CJKA 2YKNB 4FBUA 4FJ8A 3V4IB 3QETA 1CLQA 2OPQB 3S9HA 3M8QA 2XCPA 1QE1A 4JS5A 3OYKA 4K50A 1GOAA 4CEZA 4RNHA 3ISNC 2HMIB 3NKYA 1SL2A 1C1AA 5KI6A 4E7JA 5J2NA 3IGNA 3AVHA 2UVVA 3KD1E 4K4SA 1IM4A 1TKTB 4LSNA 5I3UB 4TQSA 1RDDA 3DLGA 3AVLA 1S1UA 1I6JA 2IM0A 3VQEA 4FK4A 4EP4A 1S9FA 2HNDA 1LWEA 1HNIB 5DQHA 2XGPA 4I9LA 4H54A 3FFIA 1DTTB 4Y1DA 2PZSA 1W9HA 2ATQA 1G15A 5F8MA 1RT2A 4KREA 2JGUA 2B6AA 4WXOA 3JYTA 5KFCA 4J9LA 3MEDA 1XR6A 1S97A 1HQUB 2QV6A 3RB3A 4G1QB 2BRLA 4FW1A 3PX4A 4J2DA 1RBRA 1BL3A 4ED1A 2UVUA 4RNOA 1RTIA 3LZJA 5HBMB 3L2WA 5F8GA 3H2LA 5KFIA 1D9DA 1U09A 4ZP6A 3NGDA 2XCAA 2O4GA 1C2PA 3BDPA 4BE0A 4F3OA 4ELTA 1TKXA 4RW7B 3KLFB 4DF4A 1BI4A 2WB4A 1X9SA 3V1RA 4XO0A 1VRTA 1X9MA 4Y1CA 1S1VA 4QWDA 1C6VA 3DI6B 3KOAA 1LAWA 4KO0A 2EHGA 4ED7A 2XO7A 1JLAA 1WAJA 5F8NA 2QKBA 2IC3A 4M3UA 2VG5A 3NL0A 3KK2B 1RA6A 1RT3B 2YNIB 2BGGA 4KHNA 3HPGA 3C6TA 4IFVB 5J1EB 4J2AA 5KT6A 2WOMB 4EBCA 2YHAA 1IKYB 5DGBA 3NGIA 1J54A 3TI0A 4U7CA 3G6VA 4TQRA 3CJ3A 5C42A 4BACA 3O4NA 1O1WA 5KG7A 3EYZA 1RDAA 2YNHA 3L3UA 3I5BA 3OHAA 5KFFA 4E0DA 4Q0BB 4M45A 2UUTA 4OVLA 2WONA 3DMJA 3NCIA 1S1WB 3LPTA 2HNZB 3L3VA 2IMWP 3OYHA 4TYBA 2FVCA 4AHSA 2FLLA 1WSIA 1U4BA 4E1NA 1VSHA 1EKEA 3FQKA 1JXLA 4DSKA 1ZBHA 1BIZA 3T19A 1KCFA 2XC9A 1HQEB 3V9ZA 1GOCA 3PV8A 3RBEA 1C0UB 4K4ZA 4NYNA 3VQSA 1D0EA 3IRXA 4IOBA 5KG3A 2X6NA 2W9BA 1J5OB 4CHNA 4BE1A 3KTQA 5HRPA 3NH0A 4CEEA 3N6MA 3B6PA 4YP3A 2HB5A 4NRTA 5K14A 1R0AB 4WE1A 2V0NA 2WRMA 4CGDA 3KJVB 4OLBA 1JLFB 3ZSQA 4HHTA 5DGAA 3KK1B 2PYLA 3AVNA 4DTJA 3QIPB 4DSIA 3DLKA 1KSPA 3FQLA 1VSDA 4FLXA 3DLEA 1QUVA 1LWCB 1TL3B 1RCHA 4OGEA 2FBYA 3IGVA 4W5QA 2I1RA 3KLEB 4RW9A 3RBDA 3T5LA 2AX0A 4MK7A 1FXXA 1RTHA 5DG9A 4OKJA 5KGXA 1RT5A 4ECUA 3HVTB 3ICLA 4N56A 4KHYA 1RT7B 3SUNA 4KSEB 3M9MB 2HHQA 3VQ8A 4ZPCA 4EEYA 3RR8A 1JLGB 3KLGB 3I0SA 4KHQA 1ZETA 2KQ2A 1IKXA 4R0EA 3TANA 3LP3A 5HRSA 2KZMA 3N6LA 3SNNA 1S1XA 4R5PA 3HL8A 4KHMA 3P1GA 4DG1B 4J9KA 3DLRA 3TAMB 4MKBA 5KFEA 3NF7A 3DM2B 5EDWA 1LWFB 4G3IA 4FJIA 2C28A 4KI4A 3PX6A 4CJPA 3KLIA 2ILZA 3EZ5A 5FRMA 1JLBA 3DDKA 1JLQA 4XPCA 3G0ZA 1RA7A 4RNMA 3S3OA 3K2PA 4Q44A 2V4RA 2G8KA 4IH7A 2YNGA 2BE2A 1DLOA 3SZ2A 1RT4B 1KVCA 3VQ7A 2E4LA 2I5JA 4Z4GA 1C0MA 3ALYA 5CY4A 4DTNA 4WFYA 3TAFA 1C1BB 2OH2A 2ASJA 5J2PB 1NOYA 4KI6A 3LALA 2YNFB 4NLDA 4J9SA 1IG9A 4FYDA 4I2PA 4IH6A 1YT3A 3ZSOA 2HVHA 3CIZA 1S6QA 3AVBA 4DU4A 3GILA 2WHOA 4QWBA 2XY5A 5C24B 2R7YA 4W5TA 4GW6A 4J9MA 2P5GA 3M8PA 4HKQA 4DFMA 2ZE2A 4OLAA 4KFBB 1WNEA 3DYAA 1NNDA 4DTOA 3U3YA 3AA4A 4NCGA 3AA5X 5CZ2A 1EP4A 1RTDA 3V9XA 4E7IA 3N6NA 1BHLA 4CJSA 3SUPA 4OKEA 4KV8B 4DS4A 4OJRA 4URSA 5KFSA 3GIMA 4K4TA 3SI6A 4KHUA 4PUOB 3S3NA 3NDKA 1DTQA 4ECYA 3P5JA 4HCBA 3PW5A 5F8JA 4O5BA 1S9EA 3JSMA 3LP2A 4FJJA 4F4ZA 2Q3SA 1RBTA 4IG0B 4YMEA 3UIQA 4ED0A 2DFHA 5KG4A 3Q8QB 2IJFA 4B9LA 2XHBA 4B3OA 3G86A
chains in the Genus database with same CATH superfamily
4W5OA 4HTUA 5LOQA 1FXDA 4ECXA 5JS2A 4F4YA 2HQ3A 1RBVA 3HOSA 1SCJB 2G8FA 2W9CB 3GWCA 4GY2B 4CH0S 4OLOA 2DHSA 3SQGA 4NEZA 1ZM9A 3WQUA 1RYSA 2GNKA 4BR9A 4ZPAA 1B0PA 3TR8A 1NHUA 2OELA 5A0YB 3LPUA 1DFDA 2XI3A 4A4JA 3W65A 3HP6A 4CHOA 3M2VB 3OS1A 1KAYA 2RDDA 2XY7A 2XQCA 3G71S 2G8UA 3PEHA 4DCPB 3HFZB 1U1PA 1XERA 3U1MA 4LF8J 3ZETA 3BN7A 4H0TB 2OPRB 2C2OB 3OYGA 2Z30B 5FPMA 3PO5A 1RWPB 4TNOA 2CZVC 1GQEA 3CJKA 1BMQB 4YR0A 2CDRB 3H98A 4CK1A 1G2EA 3QESA 4LF5J 4ISGA 4P71A 4ANEA 5ETPA 7AT1B 4WK3A 3BGRB 2PI4A 1WG1A 2KI2A 4YHHF 1R6VA 1RKIA 3WXMB 4JI2F 1T05B 3OYIA 3PZPA 3RMBA 1PIEA 4USWA 3VTHA 2CH5A 2LA4A 2VC0A 5B09A 3RRGA 3IR6B 3BZKA 2O4IA 5RUBA 4N7TA 1DQ9A 3C95A 4H4KA 3UE5A 1U2VA 2OSRA 4C48A 5J1PA 1FNMA 3CO0P 2PDAA 1QSSA 2BW7A 2F4VF 4NXNJ 4PG7A 2NCKL 1IWAA 3GJQB 4LF4F 1YJNS 3RBZA 4KAIA 2VDHA 1U8SA 1RAIB 2HAIA 3I6PA 2D9PA 2WC9A 3ZCMA 3QPIA 4NA2A 4FF4A 2A3ZA 3M8QB 1C1CA 4L76A 2J0QD 3J8AA 1MG7A 4UOHA 5DMRA 3W60A 4ZTFA 2OTLN 1IBLF 3ZT0A 5SUHA 2L48A 2Y8WA 4CP5A 1ASUA 1QQNA 1S48A 3NVMA 4LR8A 4KHSA 5DQIA 3BUZB 1RJJA 4ZIVA 3VQCA 4GKJF 3J81Y 1LWEB 1WC3A 5L46A 4JV0A 4PKHA 1RHRB 2OHDA 2HNYA 3QO9A 2HW3A 5KFVA 3OS0A 1QVFR 2BXJA 5BRDA 1XMBA 3K9KA 4F36A 5MLCV 1L5UA 2NNWA 4AUKA 4JKBA 4ILRA 3R2CJ 2CQ3A 3TZYA 4OV6A 3HX9A 4B3SF 1W25A 3UDLA 2X7IA 3NGZA 3V1QA 4ILGB 2W4PA 4FLVA 2R7UA 1ZM3A 4NA1A 3H4DA 2Z2ZA 4FXWA 3IFEA 4QIFA 3Q83A 1Y5LB 3V6HA 2EXUA 2BX6A 4OYXA 4DV0J 4ID1A 1ZXOA 3I9ZA 1NAQA 2PIIA 1KP6A 3SQOP 4QOTA 5KRSA 2Y1IA 1N32K 4KRFA 3LF0A 1T3VA 2W8KA 4YY3F 3H40A 2KZZA 3N4QA 5AQTA 4J9RA 1YHQS 3VA0A 4OV1A 4DLEA 2IA0A 2JEGA 3GQCA 3CETA 3OLBA 4NLPA 2P6TA 5FROA 1VQ6S 4ZP8A 4DV2K 1LXNA 4JI4F 2YNHB 5KFAA 2DNHA 2M8HA 1ATRA 4ZVRB 4OZ2A 5C25A 3L4BC 3RWUA 1X0PA 3AOAA 3R6MA 1HBOB 2MQ8A 1VQKN 4GVMA 1EIYB 4P2XA 1P9YA 4PQUA 1KNZA 2WVEA 4KTWA 1XNRK 2UUBJ 4F4WA 2EG1A 1RDCA 4JV5K 4W90B 1JL2A 2A5XA 2X6SA 3A0IX 8RUCA 3CYMA 2RD5C 3QB0A 1UTAA 1CSJA 3W9JA 3QJPA 1IH7A 2PY5A 3Q86A 3NOCA 2J6TA 3IRXB 4Z2XA 2EFVA 2I6WA 3BF3A 4CZJA 3GLJA 2QMXA 2B4UA 3H42A 3ONQA 3EWGA 5AZIA 3BEGB 2UU9K 5F3TA 1KAZA 4LF6F 4HUEA 2G0CA 1TL1B 3QYYA 5K14B 4WE1B 3A8JA 5AQHA 3HVAA 4Q43A 3D7EO 3LDOA 1SQKA 1RTZA 4ELVA 1AUSL 3NGKA 1X3MA 4OGCA 3HULA 4DR6K 3Q89A 2OANA 1C4AA 4JI0F 2Z56B 4DDFA 1FO1A 4JYAJ 2PMZD 3HSDA 1S10A 3TRGA 2BE9B 3EGZA 5LSRA 2SXLA 5IT9O 3QFUA 2DCUB 1XWLA 3OV7A 3DLHA 4Y3CA 3O1WA 1T3OA 4FW2A 2E1CA 2V68A 2OPPA 2E2OA 3CPWR 2D69A 2LKZA 2R8HA 4CK3A 4BDYA 3V2UC 1H98A 2XMKA 3L7PA 1A5VA 1CS4B 1HBNA 5JUMA 5L1KA 2ZJRL 2PYJA 5K8NA 4ED6A 4ISFA 3QFHA 4MFBA 4USIA 2IBKA 2ZC3A 4N41A 1C0TA 1ZS6A 4H5NA 5DRKA 1JLEA 3KK2A 5CCMA 3GOIA 5LT5A 3H4BA 2NRHA 4CGGA 2RIJA 4NB4A 1RDBA 5B8HA 5KG2A 5CCLA 2FJAB 2PMHA 3UPFA 4J9PA 2I5JB 4Z4FA 2F7VA 1SL1A 5FLXO 3JTOA 3RSEB 4C8OA 1S76D 2ZZMA 3I0RB 1CC7A 2D4WA 5SWMA 2PE8A 3NFAA 3D4JA 1VQ9S 4B1UB 2WK4A 2AJFE 3J80Y 2ZHAA 4DTUA 2PA3A 4U67Q 4JD2A 1T8EA 1S6QB 3ET6A 2Y1LB 1U02A 2CQ0A 3HD1A 2HQDA 3FC9A 3MD1A 3V4MA 3G6XA 3CPEA 1ZBLA 5IT0A 1IBKJ 3A12A 1K0VA 2O8BA 3M8PB 3I5AA 3BSCA 2V9KA 1HNZF 4ETXA 4KHWA 3DHXA 3CMAS 1V3ZA 3KWGA 3WBZA 1GLEG 1NPPA 1G6BA 4KHPF 1YAGA 2CGKA 3SSRA 4CW7B 1TUUA 1Q78A 1GLCG 2M7SA 5F8HA 2RQCA 3AARA 3DXKA 3TA2A 4WFAL 2CQHA 4BR5A 4NOHA 3PVXA 1NKBA 4CT9A 4DV7F 2DT9A 2V2KA 1TYQA 2CQ2A 3LO3A 4OJ3A 2HGNA 1CJKB 1BUPA 2LVWA 2B4OA 1NZ8A 1F5BA 4P2SA 1R8CA 1EARA 2O01C 1LWCA 1QVFM 3GZ7A 2AIRB 2NLWA 3RAQA 3CM6A 2MDAA 1G4CA 4Q45A 1SBRA 3THTA 1VQ5N 1YSJA 2U1AA 2J0WA 4FS1A 1N88A 4ECWA 3M6GA 3NMUA 4FWSA 5AQGA 2AYGA 4DEZA 2DXDA 2IYIA 5A2QO 5GIOA 3POTA 3Q8UA 4JKEA 4L73A 4E19A 4C8KA 3P38A 3AA8A 1IKWB 2KW4A 1NPKA 5JVGL 4NZ0A 5B08A 2E5LF 3SIPB 3BV8A 4PHTX 1WC1A 5CYMB 5AQIA 4YDUC 3BBCA 2V7ZA 4PR6A 5L38A 1YITS 1WSHA 2VG6A 5KQ8A 5JMNA 1MWYA 4NASA 2GUIA 5KFJA 5HLFB 4M5JA 1IR0A 4ZPDA 4IZ9A 4JHDA 2IRYA 3AVJA 4BC7A 5B0CA 2P9EA 5IQ6A 1QHTA 3MK6A 2DR7A 4DFJA 1GFWB 4I7FB 3AJ2A 2KKZA 1F9HA 3DRYA 1PJ7A 1RLCL 3MEKA 2VA3A 4A8KA 2CNKB 2R7WA 3K57A 2B0GA 3FZFA 4L3QA 1HKAA 4K4VA 1BQMB 4RNNA 4OHYA 1X4CA 3LP1B 1I94K 4OYWA 5HVHA 2ZJPQ 4KIAA 3FBCA 3P5TL 1BA1A 1KVAA 2W2NP 2XTJP 4DR1J 1D8YA 2MKSA 2MTLA 4LT6A 2I38A 1LV5A 3IMXA 2RU9A 1X60A 1ZOTA 4A8QA 5C10A 3WC0A 2Y9HA 2W7PA 2JVOA 2EFPA 4H5RA 5B0DA 4M5LA 4HH0A 3FEYB 1VJQA 4FLYA 2HFVA 2CQIA 4JI1K 3I4PA 4L3NA 4IG0A 2NLXA 4ECTA 3A5OC 3E9LA 4F8RA 4J9OA 3BQ0A 2ZUAA 4ZHRA 1VBZA 3WXJA 1KQKA 5D8HB 4O4GA 4M7XA 4CEDA 2CZ4A 2IIHA 4CDIA 1F3VA 3AVKA 2ZVIA 3VGUA 5A0YA 3C65A 2VQFJ 4WP8A 1T7PA 4QIVA 1IG8A 5E7OB 2R9LA 2OD4A 4ZVFA 3M2VA 4CO2A 3K5PA 3D2FA 2YQ1A 1IBMJ 1RB0A 2POKA 1N32F 3NRBA 3VEZA 3F0NA 3M6XA 4M5GA 3VAKA 3LZIA 4M95A 3RMAA 4X4SA 4DTRA 3CPWM 1FFGB 5EWEA 3PIPL 4O4RA 5J2NB 4GVBB 2CXEA 3J7AP 1MLAA 4Z4CA 2WVCA 3UVJA 3U8XA 1X1PA 4JAXA 3THWB 4AT1B 5A76A 4LSNB 1S79A 3OR2B 3IKMA 4FLZA 4IO9Q 5AQMA 1S1UB 2XNRA 1WLJA 5E2QA 1NDKA 3BGRA 2QFJA 3FFIB 2BJ8A 3IBFB 3JAMU 1HYVA 4JI5J 4MLEA 1SI9A 1O6XA 2NXCA 4ED8A 2WBRA 4EBEA 2RHKA 1UFKA 1RT2B 2P5OA 2G8WA 3JYTB 1RLDA 3AQPA 2XMMA 2CPYA 3IM8A 1DEJA 1U2FA 1LEOA 5IXUA 3DCAA 4H4OB 4WYBA 2VH7A 3M3ZA 1VC6A 1APSA 2V9WA 4IFYA 3OL8A 1AZSA 3EXCX 1V4TA 2ASYA 1IBCB 3MX5A 4IEIA 1REVA 4Y6IA 4BR2A 1HIYA 3NGRA 4OX8A 1MWMA 2VUGA 1NJIT 4OI4A 3VF6A 2VC1A 1G1XA 1QTNB 3KJNB 2H9ZA 1PJ5A 4MJKA 1S1VB 4CEFA 2MYFA 2RS2A 3IM9A 4CZLA 1LNQA 1RNHA 3CE8A 2IC3B 2DNOA 3KVGA 1M5KC 2Z1IA 3Q2TC 3QRPA 3PEJA 1XMOJ 4DR6F 3ADAC 4JV2A 4NLQA 1G3OA 2PBDA 1KHVA 2HK2A 2WZ1A 3MX2A 4NWBA 3TPQA 5M1FA 1P9QC 5I42A 3R27A 3Q8PB 2CNLB 1KVIA 5F41A 4W98A 3B8AX 1KD1T 3H3OB 4MQ3A 2ROGA 1ZBSA 2CADA 4PG5A 2WONB 1ZPWX 2QA1A 3LA0A 2RQMA 3S3MA 4YR3A 2C2KB 3O1LA 3T5HA 5KFNA 3SAFA 3W1YC 4EHUA 2CH6A 2C3OA 4BROA 2NS1B 3RYLA 3U9DA 2DNQA 2MEWA 4H0VB 4FLWA 4E7LA 3CJBA 4FJ5A 1L3SA 2DGWA 1HWJA 2O1PA 2AX1A 1BE4A 4NEYA 3J7ZT 5H9EJ 5CD4H 2QMWA 1GTEA 2VKRA 3M8SA 2GEMA 4FYYB 1S5JA 2NUUG 1FRLA 3DFEA 4YDXA 4Q8FA 3PRBA 4KBOA 3HT0A 2CGLA 2DRDA 5DM6L 1YZ6A 1GLLO 3M32A 2VIHA 2LLZA 2KXHA 1R8AA 4CGFA 2DO4A 3G2XA 5GAHP 4OI3A 4PCQA 5T41A 4C3LA 1T03B 4AQYJ 1NJXA 4G65A 1U0HA 3C14A 4J91A 1JXVA 1H6KX 1IJJA 3E9OA 4CJUA 3PM9A 3CCSN 3PR5B 4M5HA 1HBOA 5JVHQ 2GO8A 4FVMA 3N79A 3I0SB 4DI6A 3CCMN 2F9TA 2QI2A 2HWHA 2FSKA 3VQ9A 2WVBA 3R9PA 2XMJA 3OYFA 2DHXA 2AF6A 4DL5A 1E6YA 3AO2A 2CWXA 5GVQA 4CIFA 2ILYA 3CQYA 3W8PA 2LU2A 2Q6BA 3LH2S 3V1OA 1NWKA 4I69A 2BQ3A 1QM9A 1JLBB 2R7SA 4M3RA 2BTFA 1RDUA 2E29A 3ILJA 2WW8A 2FHJD 1F0XA 1L3UA 2G2YA 2UXDF 3LGNA 1TL1A 1WKLA 3WEEB 2XMAA 4DZ6A 2O5DA 1Y9OA 3DWLA 4Y2AA 4FM1A 1RWKB 1QAYA 1X7VA 5KT5A 1RWMB 3BQ1A 1TKDA 5F0WA 3KFWX 5AXLA 3D1OA 3TUIC 4XIUA 4C6AA 3JTNA 3L2UA 4CZKA 3Q2SC 1RHJB 5EY4A 3VQ6A 3VGMA 4GMJB 1J5EK 2GIQA 3LDPA 4PZVA 4RUCA 3H5UA 5BRFA 3E51A 3THVA 4IRDA 4UQGA 4Z0UA 4NCGB 4YDUA 1EP4B 1FK9B 3TUZC 1NG9A 3M9NB 3PTWA 5KQDA 1J5OA 4OX6A 5D4PA 4QU6A 2E1YA 4B9VA 2GIFA 4J5OA 3JTPA 3AXMA 4A8YA 2HVIA 2CPHA 4JI8K 1JLFA 4DR3J 3HFKA 3TQEA 4DV5K 2GAHC 2QN6B 3O9QA 3UR0A 3FSIA 1B70B 4MK9A 2DYAA 2XMWA 1VJWA 2LQ5A 1N6QB 2UYTA 3LGHA 3I0RA 1WDTA 3RMCA 2J8SA 3MCNA 1I94F 2YJFA 5D3GB 2HBQB 3UQSA 4F3QA 4BC3A 1DARA 1Z2LA 1MNEA 1PJ6A 2WVDA 4W5NA 1FX2A 2OEJA 4Q2LA 3K58A 4Y2IA 1ZA2B 2G9OA 3Q7BA 3ETMA 4V19J 1TELA 1UMJA 4G9ZA 4ED5A 3TAQA 4IWVA 4Y2CA 5C7PA 4B9SA 2QX0A 3DM2A 1LWFA 1S6PB 3C6UB 1RT6B 4DL0C 3ZXWA 2WBMA 4OPAA 2J9DA 5LMUJ 5MLCQ 5EWFA 5CD4A 3CFRA 1FRJA 5HMXA 2XSJB 1T0TV 1UWBB 2OPSB 3U27A 2AGPA 3PW0A 2EPIA 3TP2A 2UXCF 4DCHA 2Z1GA 4OLPA 1WSGA 4ID5B 4NXMJ 1NZAA 1FRHA 3TYTA 4OZ3A 4DSLA 4B3MJ 2OIHA 3QWPA 3T1HK 3ZSZA 4M94A 1CJKA 1NK0A 3WX4A 4ZLNA 3UD4P 2QZ8A 4CYUA 1XI1A 2I8EA 2ITGA 3RAXA 4OZJA 2L08A 2DGSA 4QWCA 4AF1A 4QR0A 4DV4J 2A18A 4F0KA 4KHRA 4KGKA 3KMQA 3K0JA 2B4PA 3LWMA 3R5JB 1FDAA 2HBYB 3FMWA 1A5WA 1Q1KA 2JEIA 2QLXA 4RJVA 3MM7A 3T3FA 3MMBB 4DUZJ 4ATNA 4KTQA 3EZWA 2BABA 4IFEA 2IRUA 2H65B 3Q24A 3HK2A 4LBHA 1BY9A 5AXMA 4L6V3 1JCFA 2AA4A 3TNVA 5CYMA 2XGQA 3THXA 2NYIA 2X3GA 2QG9B 2KO1A 1FT8A 5C15A 3CJSA 3WIVA 3AO1A 3CDWA 5ETRA 2RVJA 3O3GA 1TK8A 1RYRA 4CJVA 5HLFA 1IKVB 2OTJN 1FRIA 3O3LA 3D2EB 2X1BA 3OUYB 2MQPA 2C2ZB 4OIXA 4DU1A 3P31A 1N5TA 3D2WA 2DH8A 1JJ4A 4I7FA 4O5FA 4PWDB 1XR5A 1S9GA 3K2YA 5HVFA 2A0FB 3FLCO 4JUZA 5AJ3J 1BQMA 4UY8O 3J7Z5 3GCWP 2AP1A 4B08A 4ELUA 5I9EB 3Q8RB 3LP1A 2CG8A 4K4XA 2ETJA 1ZAXA 4RW8B 8AT1B 4LMZA 4LF8F 4EFHA 3F9KA 1Y00A 3ZSYA 4CGJA 2IS3A 4Z94A 1WHVA 3OXFA 4DV6J 2HFOA 3OYCA 1W2BR 3F73A 2KB2A 3SPYA 4X66J 4AHCA 4DU3A 5B0BA 3MD3A 4LF5F 1S72N 3S8SA 2XB2D 4GV9A 3FFKB 5EOYA 3BGLA 4OI0A 3KZBA 4IRCA 3GV8B 2LFVA 3A5LC 3QRQA 5CYQB 4QIWD 2UUWA 1MU2B 1H74A 2N4CA 5F0UA 3GTYX 1H2UX 4P2MA 4ZVHA 2DJWA 3A8YA 3AD9C 1MMLA 1N33F 4BR0A 5IWAK 1KS2A 1VRUB 3K8VA 3HKWA 5C2GA 2GO9A 2IAJB 4EO8A 1HMVB 2IGIA 2OTLS 4NXNF 4A2AA 3KK3B 4BC5A 2WSFC 3MECB 3OLAA 3OYNA 2F8SA 2PFDA 4GKKF 3IA0A 2KVQE 3AVMA 2E8AA 3EUNA 3V4IB 4LRAA 5BR8F 2EVZA 1CJVA 1VI7A 2AEFA 4RNHA 4JKHA 3NKYA 2V2QA 1X4HA 5KI6A 5J2NA 2B9WA 3IGNA 3UR3C 3AVHA 1NBEB 1FKAF 3MGJA 2LXIA 1UPMB 4ZPVR 1NO8A 2J0SD 4BCAA 2ASPA 4LSNA 3OR2A 5I3UB 1VC0A 4LF7F 1XUPO 5DDRC 3AVLA 1S1UA 2IM0A 4FK4A 1NGFA 4X62J 1HNIB 3SDEB 4I9LA 3GJTB 1UVNA 3FFIA 1PILA 2PZSA 1W9HA 1G15A 2VL1A 1Q8BA 2APOA 2RAQA 5F8MA 1RT2A 2QT7A 2JGUA 2B6AA 2MQMA 5M1NA 3JYTA 5KFCA 2UUCF 4O8KA 4I6WA 4J9LA 1YUWA 1XMQK 2DXFA 3UO0A 1NDPA 1BL3A 1AT1B 3LZJA 3CJ8A 3NG8A 5KFIA 3UDCA 4ZP6A 3NGDA 2O4GA 2ZNYA 2HZAA 1W7WA 2HBLA 3IXQA 5CXTA 4WCEL 3AAQA 4RW7B 4DF4A 1BI4A 2WB4A 2EG2A 2B9YA 3SAGA 1S1VA 2VB6A 1C6VA 2CJBA 1LAWA 4RLEA 1Q5YA 4DV0F 4BC9A 5B0GA 1WAJA 2IC3A 4WK1A 3CJQA 4I64A 4DR4K 2L9WA 2NREA 5JICA 4PXEA 4IFVB 1FTRA 1HD0A 4J2AA 3H46O 4I67A 5CE3A 1VQKS 2VOPA 1M90O 4QU7A 2G0IA 2VBWA 4YOYA 4BACA 1NMEB 3EYZA 3L3UA 3I5BA 5IT9Y 1WOQA 3UN5A 4B3RJ 4USUA 2UUTA 2WONA 4LF2A 3J7AN 3LPTA 2HNZB 3L3VA 2IMWP 1FJCA 4TYBA 2FLLA 1S57A 1NGGA 4JKFA 2CQPA 3RW6A 2YBVA 3OT9A 3BH6B 2BVZA 1JXLA 1LKZA 4DBQA 3T19A 1B0VA 1WG5A 1HQEB 5ETMA 3PV8A 1GOCA 3QMLA 2QYGA 3FR0A 4DV5F 4NYNA 1D0EA 1FJ7A 2Q1NA 2HS3A 3NH0A 4CEEA 3VAHA 2YWKA 1TU0B 2C2MB 2FZCB 2HB5A 2UXBK 4AL7A 2P9KB 5FLXY 1XIQA 4KH4A 2V0NA 2WRMA 3P45B 3M2UB 4DR2K 2WW4A 1NMDA 2KJWA 1UVJA 2VFSA 2MJNA 2PC6A 1VSDA 1Y0HA 3QRRA 1QUVA 2VONA 4J37A 2FBYA 3IGVA 4W5QA 1FWPA 4RW9A 1FXXA 1KOOA 1T9VA 4QYRA 3HVTB 4N56A 3OBYA 4RR5A 1FE4A 3CDAA 2G13A 4JI7K 4ZPCA 4EEYA 3RR8A 1JLGB 3R2DJ 3I0SA 4KHQA 2KQ2A 4TU8A 5I3QA 2KZMA 1Y3KA 3N6LA 5AE2A 2AZ1A 2DNGA 4FYVB 3HL8A 3P1GA 3M4XA 2HHHJ 3TAMB 5EDWA 4WQ5C 2W2PP 4ZVUB 4KI4A 1WBDA 2ZC4A 1N8RO 1IV0A 1YX2A 2JOQA 5FRMA 1U1QA 1Z2ZA 1YBAA 1JLBA 3AH6A 1W2BM 3DDKA 3NWRA 1L3KA 1E3MA 4XPCA 2IVPA 4FOEA 1WF1A 3BPDA 5IT4A 1RHQB 2V4RA 4WKRA 1UP1A 2YNGA 2BE2A 3GE1A 2HBMA 3PLAA 2UZAA 2F65A 3WEEA 3L7OA 2E4LA 2QRRA 3HSJA 5KPRA 1TL7B 3M6WA 2BUPA 3ZTRA 1Q4RA 2AW0A 4C1NI 3UI3A 2XG8A 2OH2A 2ASJA 2CAJA 2JL9A 4GRSA 4FYDA 2YNFB 4NLDA 4J9SA 2P9PA 1HNXK 1RABB 4XK8C 3G8TA 5A2QY 2VQEK 1YRTA 2HVHA 3CIZA 1HNWJ 1D9AA 1WELA 4DU4A 2WHOA 5A8KB 2XY5A 3PJ9A 5C24B 3VESA 2Q1LA 2FSNA 3SMSA 2H5EA 4W5TA 3HDSA 1M1KO 4FWOA 5AQLA 2ZE2A 4OLAA 3GJSB 1IBKF 4QBUA 4ILHA 3BR8A 3DYAA 3KYLA 4DTOA 4NCGA 2AYBA 1EP4A 5CZ2A 2EWHA 3OTCA 3TZZA 1BHLA 3TTFA 4CJSA 5HQ8A 2VJVA 4OKEA 4XH5A 3W5ZA 5KFSA 3U4LA 3N4PA 4BC4A 3SI6A 4PUOB 3M2RA 1I3OB 1NCLA 4JP8A 1DTQA 4O5BA 1S9EA 5LJVA 2OGUA 4FJJA 1RBTA 3UIQA 2BJDA 3IR7B 3ZLJA 5KG4A 1VQ5S 4B9LA 2EW9A 1WOOA 4TKTA 4YHHJ 4B3OA 1WBBA 2GUPA 3VVUA 2ASDA 3QZ8A 3UWTA 4X64K 1YK9A 5E41A 2MZRA 3CB4A 3E01B 2ATLA 4LBPA 1Q18A 1ATSA 2CRLA 2BJ7A 3PHTA 4CLPA 2R7TA 4UTGA 2YX6A 5D3GA 3H0PA 3QNOA 1VOMA 4A8MP 3ETOA 5JMVA 5LSLA 3SEOA 2FGCA 1S1TB 1XQIA 4LF4J 4U9RA 1RADB 2FJVA 5AXKA 2RQ4A 5C2FA 2PSZA 3W5YA 4H0XB 4TU9A 3GG0A 4UUXA 1S6PA 3C6UA 4JI6K 1M0SA 3QGPA 1JL1A 4IKFA 3T7ZA 3M6VA 4C8ZA 4F4KA 1WNSA 2AKWB 1OKJA 4FKXA 3O2IA 4OZNA 3T9NA 1UWBA 3V5RA 3LPEA 1WI8A 1HHSA 3GB0A 3IUCA 2F40A 1VGYA 2W41A 4KKOB 4ID5A 3EZUA 3OA9A 4UZCA 1NK7A 1I51B 1K73O 1T94A 3I55N 1ZAWA 2DEIA 1U8WA 4I9QA 5E3RA 3MMVA 2BANB 3NS7B 3VAMA 3GE9A 1HL6A 2MHEA 3NS5A 2FJEB 1Q82T 3J81U 3M30B 3RMDA 3WXIA 1QTMA 3B8HA 4OX9K 2E88A 3JSBA 5L1JA 4B3SJ 5DQGA 4DQ8A 3OYJA 3DDNA 4WKYA 2HLTA 1T3NA 1T9UA 4YR2A 2KHDA 4HUFA 3O6QA 2W6KA 3MMBA 3ILIA 2GMLA 4LJMA 3EMTA 4FJ9A 2ZJRQ 3EN9A 4QOZB 3UD3P 1U47A 1SQGA 3KHRA 2AP6A 1S49A 3CFPA 4DV1K 3NH2A 2HNDB 1DAXA 1RWVB 4FXVA 4OHVA 1D1UA 3CJ0A 3AVAA 1FRKA 4CHZA 1IKVA 4WPAA 1JX4A 3D2EA 2W9AA 1YVNA 4YB7A 2IVMA 4JI4J 4HT5A 3EGNA 2RRNA 3ZT1A 1KTVA 1RTIB 1FDNA 1O51A 4PWDA 2VQFF 1UVMA 1NHKL 3NNHA 1FRXA 4RBTA 3UD5A 4DR7J 4DR4F 2DR5A 2LDIA 2XNQA 3DAWA 4USVA 3KNAA 3SCKE 1VRTB 2GBZA 4RW8A 2A6MA 1VQ8N 3A2FA 2UV8A 1XNQK 2XLKA 1QSLA 4E7HA 2FF6A 3DXMA 3WT0A 3UCGA 2JC0A 5T7LB 4WXWA 3VQBA 4LF6J 2BW2A 3NNCA 3I33A 4WFAQ 1GXUA 3SMPA 1AFJA 1FEHA 4LR9A 2FLNA 5CYQA 1WD6A 4LSLA 3FBBA 1MU2A 5E5NA 1ZTTA 3MUVP 2HURA 4KH1B 3QDKA 3K0SA 3LDLA 2CJQA 3QT5A 2OP5A 3JSRA 1K6YA 3OTOK 1JNRB 4H0YB 2XMUA 3CMEN 1ITGA 3GR1A 2IAJA 4FBTA 1HMVA 4DU8A 4IG3A 5FPNA 1N4LA 4FVCA 4U7BA 1S0VA 2UXBF 1KBRA 4DL4A 3M8RA 3V4IA 2YPZA 1EXQA 3B82A 1LFWA 2R7RA 3GR0A 3HT3A 2K3KA 5JVGQ 1HRHA 1TV6B 3VEVA 1XMOF 3K5MA 3NF8A 3A8IA 5I3UA 2FHKA 3OVBA 5DM7L 4ILJA 2CJAA 1SJFA 2RT3A 2Q97A 1HNIA 1OH7A 1SS6A 1ZA1B 2CPIA 2Z2MA 4Z4HA 3MMCB 1XHZA 3MMAB 4P74A 3KDOA 3P5BP 4HACB 5EWGA 5GAGU 4LD0A 3ZT3A 1B99A 4LRBA 4E1JA 1F21A 3US5A 4CF2A 2CG4A 2G1DA 2P9GA 5DDQC 3PW2A 4WQ5A 2NZ4A 1FVSA 3CTRA 3UFCX 2FLPA 4CRJA 4K4YA 2X1GA 4NRUA 5E84A 5EVZA 4RW7A 3GSIA 4FNIA 2VBXA 1NB2A 3EVWA 4DTSA 2AU0A 1CVJA 3PJXA 4B3TK 4IJNA 4HHUA 2AYEA 1TMJA 3FEZA 1VQNN 2JVRA 1HNZJ 3PUFA 4LF9K 1U0SA 4BWMA 1KLMB 4PABA 3TAGA 2RQKA 4K2JA 1NGAA 4Z7CA 5M1PA 3UNGC 2HGMA 4WP9A 2DTJA 4DL2A 4KHPJ 2JRSA 3Q23A 1K8KA 4ILLA 3D67A 3MCOA 4LR7A 1HNXF 2OYQA 2MSSA 4DHYA 4IFVA 2E1PA 2DFEA 1DLOB 2DIUA 5K9FA 4U96A 3CCSS 3VQAA 4C97A 1HUXA 3O1BA 5CYJA 3CCMS 3EPIA 4AQYF 3PJWA 1P90A 5IC6B 1YGYA 2QTWA 2B8QA 1HW8A 6FDRA 4OZ5A 3CJAA 3FZHA 5FPEA 3CJRA 2GIRA 1QQCA 5SZTA 2ZH3A 2HSEB 5GAEP 1TVRA 2IA6A 1RWUA 5C5JA 4W92B 3VOVA 2RHQB 1FKOB 4NMXA 4QJVA 2AJ0A 1HQEA 3TVKA 4LRDA 3CXCR 3BF1A 2UUBK 1UJ5A 5A6PA 1ASWA 2C3MA 3R5DA 3T1YF 3TAPA 3PIPQ 3QT7A 1HLUA 2FHJA 2W6LA 3H6EA 4IOAL 3CCEN 1JJHA 4EP5A 3JSMB 5F2RA 1TZ0A 3M2UA 3LP2B 2MQLA 4C11B 3HHNB 4X84A 3MF5A 4KGZB 1FERA 3DRRA 2BRKA 2RKIA 1S7HA 1SJ4P 3MFHA 1F6TA 2GV9A 4XTTA 3SQGB 1SQFA 5FJ4A 2MGZA 5LY3A 1WEXA 4WWSA 3HVTA 3IWLA 2RDJA 2E5GA 3I4HX 2MY7A 4QS7A 3F44A 4JYAK 4ZDNA 2KT3A 1A7GE 1JLGA 1LXJA 3MXMA 4NCBA 1TL5A 1T9YA 4IXCA 1UW9A 1FDDA 4C3MA 2GA7A 2UUAF 3KLVA 4BRAA 9RUBA 5HMWA 4AXIA 1SH0A 3PCOB 1VSMA 4U7UK 4RU2A 3LW5C 2RU3A 3UKUB 1NKCA 5GAGP 2ZOGA 3CJKB 3LP0B 3ENQA 2QLWA 4MO5A 5KPZA 2DXEA 2YWFA 5D78A 1HYZA 4F50A 1HW9A 2B8PA 3DU5A 2LP4A 4BQLA 4CQ1A 3DOLA 1YJ9N 2GGPB 4C23A 1N34K 1NJWA 4L75A 1I3AA 2VA2A 5KFZA 3MR2A 4FN5A 4PKIA 2CQBA 4C3KA 3DN9A 2CJYB 4D3GA 1ZTWA 5HP1A 3G9CA 1U2VB 2HMPA 2KFZA 2DK2A 4UF4A 4HTLA 1Y10A 4FJXA 3G82B 2CJXB 2VD3A 3J7YI 4TY8A 1HJRA 5A8KA 5AE3A 4CLTA 4PG4A 4A57A 4EWTA 3TSUA 4JRPA 3L9ZA 5D0HA 2WAQD 1OQ6A 2JLEA 4WZMA 3VGKA 5KOXA 1N32J 1HWUA 4DS5A 2PA8D 3TVZA 1B7YB 4NLWA 1TFWA 2FLOA 4HH1A 5KFUA 3V6DB 1T9WA 3BKFA 4FPRA 1TKZB 3CULA 1C1CB 1UFLA 1NK6A 3AFGA 2OSQA 4DQRA 2AHOB 2MKHA 2LEPA 2GJIA 1J2VA 1JJCB 5AQJA 3UCUP 3T5KA 3OVAA 2QTDA 3VR1A 3SV4A 5DM6Q 2HS0A 3A3PB 4UY8T 3W3SA 4PYAA 4P75A 3HYFA 1N56A 1VHFA 4B3MF 1GMVA 1BG3A 3TA1A 3E2EA 2HNYB 3QO9B 1CPZA 3CCLN 4B9QA 3O5TB 4O44B 1XNRJ 5EHHA 4MT1A 4JV5J 1RAOA 4NLBA 2N7CA 2OZMA 4QYZJ 3GPAA 4ILMA 4CVNE 3AJ1A 3D1HA 4FK0A 1XNQF 4FJ7A 4A8FA 4DR5K 4A8XA 5EXWA 1U48A 2R8GA 2P6SA 1Z6RA 2UU9J 1DBDA 4DUZF 1NJZA 4OYPA 2OTJS 2ZQBA 2QMUB 3ATUA 2V8VA 2DHGA 2HS4A 3H1VX 1RCOB 1BCOA 3LL3A 3OYBA 4DR6J 3ZZZA 3BKUA 3FCVA 2CPFA 2I0XA 4LFBK 3OTDA 4AHTA 3QJJA 3KJQB 4K8XA 4LF1A 3ZO7A 2ALZA 4ECRA 3R7SB 2X74A 1VRQC 1U1RA 5HATA 3MTJA 4BVOA 4B17A 3MAHA 4WBFA 1H2VZ 2BANA 4CLFA 3CC2N 4A59A 2HHVA 5C25B 2L9DA 3WNHA 4F7VA 3SBMA 3M30A 3BO2A 4PQUB 2MQNA 1UETA 3PO4A 1B92A 5IFMA 5A6WA 3TABA 3R5GA 1TFYA 2HQFA 3QERA 4B9MA 3WZ0A 2ZHBA 1T02A 3HSGA 1OVYA 3BY5A 5FD1A 1H2TZ 1GH8A 4OMFG 2ZGYA 4NLOA 2BJ9A 4DR1K 3KUGA 1KVBA 4X66F 2W2MP 1RKJA 1KN6A 3QEIA 3SSSA 1NMNA 3H3NO 1R43A 4PY5A 4FYWB 1P8GA 2H3GX 4AL5A 5BYQA 3H08A 1T6CA 2ZKTA 2MHNA 6FD1A 2KH9A 1ZBTA 2QL7B 1FWKA 4HTIA 3PKMA 2GVZA 4L72B 3DMJB 3R5AA 4KT0C 3GG4A 3SCJE 4M5DA 1IO2A 1ESVA 2CQDA 3DKDA 4NYPA 4BGBA 2RJZA 5H9FK 4AHRA 2DD8S 3OBWA 1BWFO 3QGHA 4RBUA 2JEJA 2YKNA 2R2SA 1TUVA 2GZOA 5JJBA 4CBXA 1CXQA 3AD7C 1M90T 1Q9XA 2OPPB 2FQQB 1KTQA 1F9FA 1W0HA 4CIOA 3D0IE 4K0KK 4PEOA 2IDLA 1H73A 3MPVA 1OSCA 4MFBB 1YTUA 2VODA 4CHPA 1C0TB 2HEKA 2ZDPA 2G1HA 1JLEB 2DRAA 1HQ2A 3D3BJ 1LQ9A 5T7LA 1X0FA 3NF6A 4A5BA 2ZH2A 4AM7A 4FPAA 4DMNA 4MKAA 4DXLA 2DHAA 3CQXA 4JI5K 1VSFA 3J7ZO 3CM5A 1NDLA 3MURP 1PBUA 4FM0A 1GK8A 5U47A 3DDIA 3U1LA 5DJBA 3U3GA 4O3OA 1HI0P 2EI5A 2RB7A 2HK3A 1AB8A 1S4EA 2DR6A 2V8GA 3FUYA 2D7SA 3ET6B 4HL9A 1Q9YA 3IMQJ 4JK9A 1OMSA 3K5NA 3OTEA 2YJEA 4JEPA 2GTDA 5E3PA 1EX4A 2Y1JA 3KDNA 1U6FA 5GMDA 5B0EA 1VSJA 3UE2A 2LA6A 1YJ7A 2P9NA 3D45A 2KFNA 2BDPA 3ZNUA 3OYAA 1R31A 4LFCF 1A5XA 1RAEB 3W66A 4I4BA 3ZZYA 3R1HA 4PXBA 1TV6A 3MCMA 3NWGA 1SZ2A 1U45A 2IMOA 1IKYA 2ZBPA 4A48A 1RDRA 3C16B 3DXKB 3UDVA 3OD2A 3CDUA 5AT1B 1SH2A 5H1SQ 2V4QA 3MMCA 1WUAA 1TYQB 4ZPTR 5HL7L 1MWZA 5KAKA 4Q0BA 4CF8A 3O80A 4HACA 2YQ0A 3PYDA 4O8UA 2GVDB 1CZ9A 1N52B 1I94J 3DRXA 1N8RT 4JKDA 4RTFD 4N5SA 2WSEC 3L0QA 2F9WA 5LMNK 2H5IB 3WNFA 4I1TA 1YTAA 3ZT4A 3A5MC 2Q0RA 1RTDB 1J53A 3TUJC 2YKPA 3UDEA 3M8WA 1TAUA 5E0OA 1G99A 3HF5A 2VPWB 4JI1J 4HYKA 1URNA 5HANA 1KLMA 1EZZB 3AV9A 4LFAK 1C0GA 3R1XA 4C7QA 3K59A 3Q8SB 3F9MA 4ZP7A 1JNZB 3QATA 1GT8A 1WC0A 4E98A 1EO1A 1DHMA 4CK2A 1FNOA 1HARA 2VG6B 2UXCJ 1AFIA 3AGRA 3VGTA 3QBWA 2A1BA 1VQ7N 2NRTA 4OHZA 4W4MA 1UVLA 4CLSA 2FF3B 3D0PA 2E44A 4QW8A 2IJNA 3IG1B 1TL3A 5IV3A 2NXUA 1O13A 3CC4N 3MAAA 5DK5A 4JHDB 2CQCA 2OFGX 1EWQA 4Z4EA 5AFUH 1X4EA 3KLHB 2K7KA 1VQMN 4IDHA 2WUSA 3AVCA 4OHWA 4FF2A 3LAKA 2W01A 2FHMA 4RG8A 2PAVA 2FBVA 4WFZA 3E3XA 1FKOA 3FRYA 2QWQA 4OJGA 3I87A 3S6EA 2DH9A 2R7XA 3R97A 2VASA 4BGAA 1HI8A 2M2BA 4EAHD 2VWJA 4JOUA 1RWOB 1P27B 3IBWA 4HCCA 4ECSA 3NAEA 2MXYA 2FVSA 4ZCKA 5E3AA 2VFTA 3CCWA 1TTHB 4C11A 5KFOA 3JQJA 3O4QA 4H0OA 5J2PA 4FPIA 4I6AA 3EO3A 2YWWA 4ZHRB 4CERA 3VTIA 1JLCB 1RAJA 3NAHA 3DRSB 3VQDA 5BYRA 4O4GB 1ZM4A 3MEEB 1CJUA 1HNWF 4EYIB 3SJJA 4YORA 3OW2R 1ITPA 4H8KA 5K20B 4MIAA 3BZCA 4KFBA 3K9JA 2G8VA 5BN8A 4DKWA 1EAYC 4WCEQ 1PG5B 3D2FB 3QEWA 3VAFA 2EX3A 2PD1A 4EZ9A 2M5YA 3LWLA 3VALA 2E66A 5AQWA 5C12A 1K73T 4FJGA 2V7YA 4I2QB 1WG4A 1Q16B 4Y2MA 3UVJB 1QHAA 2WB1D 2X51A 3NE6A 5KFQA 3UKUA 4F26A 3H25A 1MW7A 2OCEA 2P1JA 3LP0A 3W63A 3WNEA 2KL8A 3BGUA 1N0UA 3IFRA 2AT1B 1HPZB 2BA9A 2R7OA 1EETB 1GX6A 5ETNA 4DUYK 3NS6A 3SQ2A 2GGPA 1VISA 5E26A 1X5OA 1D4XA 5D0GA 2YTCA 3GIRA 4OKKA 1LW0B 5J2QA 4NLXA 4KPYA 2XZWA 4IFYB 1AZSB 4LH5A 1N33J 3EKUA 4PWWA 1PKUA 3G82A 1REVB 2LEAA 1QAIA 1EKSA 2BOAA 1YG0A 4A47A 4GKKJ 2VGNA 1NU0A 3K5LA 2BUNA 4IEEA 2QK9A 1BIUA 3KHHA 4MMOA 1WHXA 3U7JA 2C3YA 3GYXB 2AJ2A 4KGXB 3V6DA 5BR8J 3VQ5A 1ZBIA 2NUHA 4C8MA 1TKZA 4QR1A 1KRPA 1SC6A 3PYEA 4ALZA 1SJQA 3VGLA 3I55S 4WYLA 4CLZA 1QZ6A 2VDIA 2MKKA 5IM0A 4LF7J 5JLFA 4CFAA 5AXNA 3HD2A 3RU0A 2RUSA 3DLBA 4LVOP 2QGFB 2C2RA 4WU2A 1A6LA 1CJTB 3SCLE 5I42B 4IRKA 3ZZ0A 3J81O 4A8WA 3RB6A 2UUCJ 4OPJA 1MWKA 4O44A 2BH1A 2DISA 3GIJA 5AFUA 3ZEUB 2ZOFA 3PY8A 4EBDA 1RCXB 2AV5A 1IJFB 4Y28C 2W7AA 2Z2LA 2HIYA 4DV4K 2NUBA 4CJKA 4FBUA 3QNWB 1FXLA 2MLZA 2ITMA 4BLGA 2VCPA 1QE1A 4JS5A 4K50A 1GOAA 3FMBA 4OO1J 3DJCA 1C1AA 3HHLD 1QLNA 2NRRA 3KD1E 4K4SA 1RFQA 3KK7A 1IM4A 4BRMA 1TKTB 4MAKA 4TQSA 2B51A 4B1XB 4FP9A 3VQEA 4EP4A 2FDNA 2ASOA 4Y0WA 1DJ0A 1PC4A 4H54A 3D7SB 2Z57B 4Y1DA 3VEYA 2YH0A 3M32B 2ATQA 1CLFA 5HQMA 2GMJA 1FJGK 1WC5A 4KREA 3BN4A 3K17A 2NQPA 1XR6A 2ASMA 5AE1A 1HQUB 2CPZA 2BJEA 5BYSA 2DNKA 3RB3A 4G1QB 2BRLA 4J2DA 2ZEJA 1RBRA 4FWPA 3M1VA 2GQ2A 2FYXA 1U0HB 2V67A 4CM0A 3C14B 2LXFA 3L2WA 4CZCA 1D9DA 1VQ8S 2RH3A 3GMGA 4F3OA 4BY9C 1HR0F 2CVEA 1TKXA 4X65K 2KDOA 4DR7F 5D4LA 3BYPA 4XO0A 4GVEA 4GO7X 4Y1CA 1ZZFA 3N9UC 5AJ3K 3GFZA 2GAGC 3I82A 4JI8J 2CPXA 3P49B 1E6YB 4DV5J 4ED7A 1JLAA 2LCWA 5F8NA 3NL0A 2VHGA 2DR8A 2E2PA 2BGGA 3HPGA 3C6TA 1C0FA 5J1EB 3TA0A 2AJ4A 3CMES 3TSQA 1OQ3A 3NGIA 3ZFVA 3ZYYX 2IDEA 5KOWA 3G6VA 5ETSA 2KG1A 4PL8A 4KYZA 3VGVA 1ICEB 5HAOA 5LMNF 5C42A 3O4NA 3KNGA 5KG7A 1O1WA 4USMA 5CA5A 4CZHA 3O4WA 4E0DA 4DPTA 1EQYA 3TX8A 3GP9A 3DMJA 1S1WB 4C0HA 3MM5B 2I7NA 3IRWP 4DPWA 4K5SA 1FXRA 2ZM6F 1WSIA 3OW2M 3E66A 2OKQA 4DSKA 2B7BB 4CT8A 1EKRA 2XC9A 3UN2A 4P10A 3B4MA 3V9ZA 4FWNA 4Y0FA 2W40A 4X4VA 2F8MA 2HQCA 1R7IA 3VQSA 2HF3A 1U26A 3Q22A 4IOBA 2E5IA 1J5OB 3HSZA 2ZH8A 1FA0A 4CO3A 1SC1B 3P6YC 1HBUA 3SMZA 2P9SA 1R0AB 2LQBA 1YJTA 1VQYA 1JLFB 2B3TB 1AYEA 2OJ3A 4HHTA 3KK1B 2ZHOA 3O6WA 2HBJA 1FDBA 3AVNA 4DTJA 4X62K 3DLKA 1HKGA 4K43A 4LRCA 1KWMA 4QPTA 2Q79A 3SLCA 2X1AA 4OGEA 2MZTA 2I1RA 2M52A 3RBDA 2GWKA 1MMDA 1RTHA 4BRKA 3UKRB 1HJOA 1RWXB 4OKJA 5KGXA 1WSVA 1RT5A 1VQNS 1F2HA 3M9MB 2HHQA 1YDLA 1FJEB 3AAPA 1SC3B 2XO6A 3KLGB 3NGSA 3FKBA 1ZETA 1IKXA 3SNNA 1S1XA 4R5PA 4DG1B 3BGFA 3DM2B 5A2QU 1LWFB 1YKWA 4G3IA 2ZFHA 4DV3K 4FJIA 2MY8A 3KLIA 2ILZA 3TJ9A 1VIXA 2J7UA 4RNMA 2ZBIA 1KVJA 4JK7A 5F1XA 2EEYA 2GW8A 5HN0A 3SZ2A 4BG9A 1KVCA 2JX2A 3C16A 4Z4GA 1NDCA 1C0MA 3GSDA 4LRFA 2LU1A 3TAFA 2FJBB 1AW0A 2YWEA 3IAM9 2A42A 1Y64A 2FHOB 1IG9A 3M1FA 3O5BA 4IH6A 2GVDA 1AA1B 4CYUB 5HJYA 3IAS9 3NY0A 3ZSOA 3ULEA 2KYZA 1PC5A 4A61A 1VQLN 2R7YA 2V63A 3W2VB 1RHMB 2WTUA 2P2CB 1WNEA 2PMWA 2ZDOA 3CCES 3AA4A 4E7IA 1RTDA 2FZKB 1OVQA 3V9XA 3N6NA 2MKJA 4XDCA 1SIWB 3MM7B 1PO6A 3GIMA 1VQ4N 5KPTA 3LTOA 4JI3K 3S3NA 3NDKA 2A2CA 1PBAA 3UNYA 4ECYA 3P5JA 4PRFA 1M1HA 4F4ZA 2L3MA 4ED0A 2DFHA 2DNZA 3Q8QB 2XHBA 3THXB 1FX4A 5IWAJ 4M7YA 4CCHA 3HKZD 4XH1A 2QM1A 1D3WA 4BRIA 2N82B 2VJUA 3VAGA 1WOPA 3PX0A 1W2IA 3IG1A 3A3OB 4BR7A 2ZBRA 4O55A 3CCVN 4CGIA 5IQQA 3PYGA 1EQMA 3AT1B 5KT2A 3BP8A 2CDQA 1WSRA 4C2MA 3CI5A 3V9UA 3KLHA 2UV8G 4I6MA 3TJAA 1S9GB 2J9DE 2VWKA 4R25A 2O8EA 3NH1A 1AUDA 4QCLA 3OSPA 4CJ3A 4ZJQA 3MR5A 2WBNA 1U04A 4CFBA 3O44A 3KHLA 1DY3A 2D0CA 5CH7B 3M8ZA 2ACYA 1YJ9S 4BR4A 4HT7A 3K89A 4C8YA 3CCUN 4QR2A 2BMBA 3O3FA 2DY4A 2KM8C 1YXQA 3ZX0A 5C2DA 3CIPA 3SBTA 4KQZA 2BR0A 2IY5B 4Q5VA 5B7WA 2BOPA 3VGSA 2ALYB 5DM7Q 5FDLB 2AD9A 1F5AA 4QZVB 3VQ4A 3CQ8A 2ZBCA 1RGVA 1SL0A 3DRPA 4RNFA 1N36K 3TTDA 1ZM2A 2XHWA 2OEMA 4GC7A 3G6YA 2XRIA 3L95X 4RU9A 2GHPA 1JLCA 4ZLLA 3DXBA 3DRSA 3SUOA 3MEEA 1XEZA 3WUHA 2MLYA 3J81j 3HVWA 4AHUA 3ZZRA 1MDUB 2QWOA 2IM3A 1K9MO 3HCXA 1YZ7A 3SCXA 1NUEA 1SKUB 4USKA 4DR4J 1VSLA 4B1YB 3VF4A 4IQMA 1RHUB 4M3XA 2D3UA 3HVRA 3D66A 2AZ3A 3MDQA 1CJVB 4U6PA 4AE5A 4DX5A 1PAEX 3FZMA 4I2QA 1K1QA 1K1SA 3X1LB 4G6VB 2FTRA 3CCLS 3OY9A 1Q82O 2DNPA 1HWLA 4FF1A 3MXJA 4YOTA 1N5VA 4DV2F 1X5SA 1QDUB 1YRXA 4BRPA 5KFWA 2QSWA 1NNEA 4OYMA 1HPZA 2P9IB 1EETA 3AD8C 3ZTPA 4X4RA 3AB2B 3EGWB 4TLRA 5T14A 3R6LB 4UOFA 2B6AB 4PWUA 4JI2K 4KJIA 3GV7B 1FW6A 2RN2A 2DGVA 4CLUA 1XNRF 1LW0A 4H4MB 4RO0A 4JV5F 4CHYA 3JB9k 1R27B 4XPEA 4J8FA 4V1Ak 2QEXN 2IM2A 5KFKA 1NK8A 3A5NC 3VEOA 2DRBA 2CJ9A 4ZP9A 2C3PA 2F4VK 1BI4B 4JKGB 4DCJB 4A46A 2UXBJ 3I5CA 2GCFA 3UCZP 2UU9F 3HHLB 2MZSA 1UL3A 4DR2J 1UEVA 5GADI 3PR4A 1VK3A 3D6HB 1TGOA 3VENA 1RI7A 4DFPA 1GXTA 3SPZA 2P8IA 3CW2C 2LQ9A 4OQJA 2EFQA 5ITHA 5D4NA 1IBLK 2EBEA 4E8UA 3CC2S 1X4FA 4IOAQ 3FZLA 4CO0A 3AO4A 3ELHA 4CNZA 5AQUA 2Z2YB 3KKRA 1CJTA 1Z26A 2HPUA 1V3RA 2HRYA 4RUBA 4JI7J 1HHQA 2K8GA 4E1MA 4GKJK 4RWXA 1R6YA 3I8DA 2HF4A 1LW2A 2RF2A 2B9EA 3ZEUA 2FC9A 2JNJA 3E9PA 1D5AA 3FBFA 1TMMA 7FD1A 1NGEA 2G8IA 5KFGA 5KFDA 1YVUA 2ERRA 4B3SK 4GNIA 2FC8A 2HQIA 4ZVQB 1Z4UA 4TU7A 1IXKA 3G6EN 2EC2A 1BUXA 2D74B 3ENOA 3TZXA 4ITSA 3Q8VA 2NRXA 2KVIA 1FKPB 1TKTA 2VYPA 2ZD1B 2HHSA 2VBYA 1NK4A 1MMNA 2N3LA 4JV1A 1HNXJ 4EGLA 4AILC 3GG1A 2VQEJ 2XYPB 4USJC 2RHSB 3T6JA 2V8PA 4DTMA 4IO8A 4YY3K 2ZH7A 4ICLA 4F3MA 3TSPA 4WJBA 1WKJA 3HO1A 3G4SN 3TEGA 4CF9A 5L9XA 2QL9B 2FBXA 1HQUA 3TTCA 2HHWA 4CZGA 1FHTA 1WSEA 4G1QA 4RW9B 5AQZA 1ILYA 3NCRA 4WFXA 2ZZTA 3IS9B 3BZQA 4A62A 5DO2A 3WNGA 3D68A 3QAEA 3NCQA 4DV3F 1GAOA 1CQNA 1Y4ZB 5CAAA 1YTYA 2AEMA 1JXBA 2VU5A 3BJYA 1IUJA 4K25A 4RCHA 1SXLA 3VAIA 4DSJA 3MM9A 4EUVA 4NZ6A 4DZDA 3TWHA 5HROA 1KVKA 2D5RA 3D9BA 2H54B 2FSJA 3MWTA 3QEXA 3T1YJ 2R2TA 3FRZA 1NEEA 4U8VA 4X64J 4Y2KA 1PCAA 5M1OA 3ZSVA 2CPJA 3JS9A 2IPOB 4BRNA 3H20A 2MMYA 4JS4A 2YNGB 2BE2B 3HHLC 5J1EA 3HI9A 3P4IA 4MTPA 4CJ7A 1P1LA 3LQVA 3PFOA 2DB1A 3N4WA 2DNNA 2PO4A 2YH1A 3EICA 3KG0A 3U6FA 2P9PB 3AOBA 1WF2A 1S1WA 3MM5A 5EX5A 3CCQN 2DITA 5T7BA 1DKGD 3CCRN 1DQ8A 3DLLL 4JI6J 2ZWHA 4JI0K 5TKWA 2O8FA 2IVNA 2E5HA 1KEKA 4OZLA 3SSQA 4WYWA 4CD1A 2VG7B 4A8SA 3MPUB 2ZE2B 1IWGA 4FNHA 4BRDA 5GINA 2V2ZA 2UUAJ 3R5CA 1RDWX 3DYAB 2VPZB 5BJRA 1RK8A 2YWGA 2HSTA 3S7RA 4B02A 1U1NA 2V50A 4RBVA 2F5GA 2A6AA 4RWWA 2KYXA 4IR1A 1GLBG 3FZKA 4ZVEA 1SUQA 4WTOB 3P8BB 3EVOA 3M2RB 4CHQA 2XWYA 2DFFA 4RW6B 1R0AA 1DTQB 2ZH6A 4ZLJA 2BQUA 4DQPA 1S9EB 4UQTA 4PXDA 4M8LA 3EY1A 3QFPA 1HWIA 3PW7A 4B8CA 4B3OB 3KK1A 2DEJA 3TVYA 4FZXC 3NLCA 3ITHB 4OL8A 4CJ5A 4NI2B 2VBZA 3H45C 2ZOMA 1CEZA 4QAGA 4ZPWR 3C6AA 4J9VA 1Q81T 3UKRA 2XULA 3CFOA 5F9NA 4IYQA 3CVKA 2J6SA 4CJFA 3NF9A 1Y11A 3P4UB 1T9XA 4KR0B 2QLJB 4DJBA 1RWWB 2V52B 3KLGA 3G10A 4MKYA 3JXOA 3SUQA 3HOTA 4BE2A 4BRFA 2XWXA 4DG1A 4K59A 1WTFA 2J5AA 1VQ7S 4RPFA 2H48B 2MZJA 4DV1J 4CFDA 2NRVA 4JI1F 4KE5A 2G2ZA 3D28A 3I96A 2YKOA 3CC4S 1N36F 3KWIA 4LREA 3RGIA 1SJ1A 1HNZK 1RU2A 4FJHA 5AQRA 1Q8IA 2E9ZA 2F9DA 2V94A 4KHPK 3E1YA 3PRVA 1VQMS 1X4AA 4IDKB 1K47A 1CG2A 1MROA 2PT0A 2Q43A 3FBEA 3DGPA 5MAOA 4DV7K 2UP1A 4NLRA 3MM8A 3AA3A 3QBCA 3KHGA 3HJFA 3ISND 2XZTB 4F3TA 1QQOA 3W2VA 3EDRB 2E6MA 3A8KA 4C1NK 1XNQJ 4PG6A 3THYB 3EL2A 2PEHA 3GYGA 2JWLA 3J7A1 1GEHA 1V5IB 1HKBA 1VBKA 4DPYA 2V34A 4CLLA 2W24A 3RBXA 3D6RA 2QKKA 2YCHA 2R8KA 3C46A 4PQAA 1YLXA 4RKUC 4DTPA 4OI2A 3QWUA 4TY9A 5KT4A 1AXQA 2HBKA 2NSCA 1Y7PA 2OMLA 1N0VC 2N7YA 2E5LK 1X4BA 1ZH5A 1HI1A 2XLIA 2RE2A 3C7NA 1RBAA 3OTOJ 1TUYA 3BGOP 2FY1A 4BWJA 4HR2A 3TW0A 4DQQA 2IRXA 4OYOA 2CPDA 4Z37A 3EZOA 1SV5A 3LM9A 3BSNA 3K7RA 5AQVA 1VK8A 2G8HA 2QFIA 2A6OA 4FK2A 2DGTA 4CLWA 1EWRA 1VHIA 4CECA 2QXFA 4CF1A 5KFRA 4QPXA 2IIRA 4ES1A 5CQGA 3B6BA 1JQGA 2OD6A 4QWAA 3DOMB 5J2MB 3P83D 5KFBA 3EM1A 4K8ZA 1H1VA 3CCJN 2CNNB 2VFUA 4HVJA 2Q66A 1OPZA 2ZJQL 3OJUA 2QWNA 3A4TA 4OHXA 1U2CA 1WSFA 3DLGB 4NLSA 2AGQA 2ZNZA 2QWMA 3RRHA 4LUBA 3DXMB 3LANA 3MXHP 2XEXA 1QUPA 2OO4A 2I7PA 5HOOA 5FDLA 3SXLA 2HGLA 2BE7D 2F1FA 4MIBA 5CABA 3NMRA 3AJDA 4DQSA 1KXPA 5JS1A 4YN3B 5HL7Q 4RUAA 2EFGA 3DOKA 5HMZA 1KFDA 4LSLB 5ETVA 3FCHA 1K8AO 5KT3A 4RZRA 3IP0A 3VQQA 5KFMA 1OY8A 2J8AA 4DHVA 3IAYA 2M9KA 3O8WA 4B3TJ 2O8DA 3QEPA 4W5RA 4LF9J 1BGXT 3MM6B 2MKCA 1NGJA 4IG3B 4LH4A 2HIQA 5EGYA 2JEFA 2Q3PA 4L3KA 3T41A 2QJ3A 1TP7A 3VN5A 3KKSA 2XI2A 4C0BA 1UW4A 1MSWD 3SQ0A 3D0GE 1U1MA 4M63C 2WSCC 3VA3A 3KIOA 1VQPN 1GXLA 2VG5B 3P3DA 2KLAA 4PA1A 4OZ1A 2RUGA 4H5TA 2IVOA 1UEKA 2O67A 2QA2A 3NGYA 4RX6A 3ZTQA 4OFZA 4KTZA 3MR3A 1ASVA 2DGOA 1W7AA 4XEIA 3HHKA 2P9IA 4LIWA 4CEBA 2AGOA 2HVZA 3ENWA 4FLUA 1S0OA 2CJKA 3MFIA 3CF5L 2RDIA 2HVEA 4H4MA 4FVUA 1N5YA 3WIUA 1OY9A 1V5VA 1TK0A 4R8UA 4QYZK 2FPHX 1YVFA 2OPQA 2YQ3A 3N5BA 1KHWA 4M3TA 2HMIA 4XH4A 5BPLA 4JKGA 4G1IA 2B7CB 2W9BB 2XSFA 4F4XA 3HHLA 1VDHA 4NPOA 3H1QA 2CA9A 1KOHA 4A5AA 3QIDA 3ULDA 3D1QA 1V9OA 4PG8A 1X8DA 4CJLA 2P51A 4M5MA 3TJ8A 4LFCJ 4Q8EA 3WDOA 1K8KB 4KGMA 2DO0A 4H03B 2VICA 4J90A 1U24A 3AVGA 2KXFA 3DLEB 3BSOA 3HM8A 4ED2A 1J5EF 1VC5A 2AMCB 2HKEA 2UVWA 1VS3A 3AXKA 1YBTA 4MIWA 3ZT2A 4LQ3A 2HQGA 1KKHA 3T69A 4KBIA 5THWA 3EEQA 5D0RA 1HBMA 3GYNA 4LVNP 4CTAB 4TSXA 1TAQA 3DXSX 2K1RA 1FD8A 4USHA 1LFPA 4JKAA 3IC1A 4CIGA 1TVRB 1R3NA 3L2RA 5DZ7A 3SFGA 5D77A 1KLNA 1UEUA 2OAUA 1CULB 3ZSWA 4JI8F 1YF5L 3Q7CA 2HG4A 3ULHA 5L1LA 4FZVA 2YNIA 1JLQB 1N34J 2LQJA 4N77A 5E33A 4CFCA 1FKPA