2BH1A

X-ray structure of the general secretion pathway complex of the n- terminal domain of epse and the cytosolic domain of epsl of vibrio cholerae
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
238
structure length
238
Chain Sequence
SEFLTVRLSSQKEADIPWLVWSAEQQEVIASGQVAGWEALHEIESYADQRSVVVLLAASDLILTSVEIPPGASRQLENMLPYLLEDEIAQDVEDVHFCVLSKGRETADVVGVDRLWLRACLDHLKACGFDVKRVLPDVLAIPRPEHGLAALQLGDEWLVRKSTTQGMAVDAQWLSLLAASDWVQNEGEYLPLQALTPLPELSLAETQEWRYEPSGLVMQLLTQEALTSKFNLLTGSFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The X-Ray Structure of the Type II Secretion System Complex Formed by the N-Terminal Domain of Epse and the Cytoplasmic Domain of Epsl of Vibrio Cholerae
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Transport protein
molecule keywords GENERAL SECRETION PATHWAY PROTEIN L
total genus 69
structure length 238
sequence length 238
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05134 T2SSL Type II secretion system (T2SS), protein L
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.370 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2bh1A02
3.30.420.380 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2bh1A01
2BH1A 1W97L 1YF5L 4PHTX 5TKWA
chains in the Genus database with same CATH superfamily
3FZMA 2YX6A 1QZ6A 3FFKB 4CF9A 2I7PA 2QK9A 1RGIA 1VSIA 2VCPA 3A5NC 4Y0WA 3CJ7A 3P31A 3RMCA 3R6MA 2D0AA 1OH6A 5BPMA 3OJSA 1D9DA 1WBDA 4JI5K 4R5PA 3HL8A 4BG8A 3WXKA 4N56A 4FVUA 3VTHA 2D5RA 1ZBLA 1NM1A 1HKCA 3K5NA 2UUBK 4DV7K 3TR8A 4IEEA 3CQ8A 3CCUN 2YKMA 3PSIA 1D4XA 1S1WA 2OANA 4CHPA 3SQ0A 4LF8K 4J2AA 2DFFA 3LDQA 3D2EA 4CJUA 4FM1A 4CIFA 1TK8A 1RT7A 1SZ2A 3DRSA 4G1QA 1H1VA 3QERA 4Z4IA 2YJFA 4JEPA 1UA1A 4BREA 3C6TA 4E19A 4CEEA 1IKWA 4EZ6A 1RBVA 4GV9A 3J7YP 2XY5A 3NH1A 3H3OB 3RMAA 4CFBA 2QWNA 1F21A 5AQFA 3I33A 4CERA 1DKGD 3WEEB 1QVFM 1IKXA 4I7FA 2OA8A 3MK6A 4B1XB 1K8KB 1NKCA 4F3TA 3THXA 3J7AP 3LAMA 3IS9A 3SUQA 5AQQA 3AV9A 4GMJB 3CFOA 4BRPA 5KGXA 4YOUA 1Q9XA 1KVCA 4BGAA 3AVBA 2G8VA 3BZKA 5LMNK 3J81O 2QWQA 2OZMA 1NGFA 1RT3A 5HL7L 4M3ZA 1CXQA 1J53A 3OYAA 3ATUA 4K42A 4U7BA 3VGKA 4IG3A 3F73A 1NLVA 5GINA 5C25A 4CHQA 4DSLA 2Q36A 2HW3A 1GLFO 1I94K 2FBVA 3UKRB 3TAGA 1WNSA 1T6DA 4DUZK 3OYLA 3AO1A 3VESA 2HHHK 5JVGL 4JRPA 2DPNA 4FO0A 4WQ5A 2HBJA 5CYMA 5AQZA 3CPWM 1HYVA 2VWBA 4DTOA 5DM7L 3D7EO 1J54A 4C8MA 4CZEA 4BVPA 4IJNA 2KW4A 2P9SA 1S1TA 4CZFA 4E89A 3PY8A 3SBTA 5GIOA 3ZSOA 3T1YK 4JLHA 1D9FA 4FPAA 2E88A 2BE2A 4JI1K 5JLHA 1WSEA 4WYBA 4AHUA 3V81A 3THYB 1J5OA 4UY8O 4DR6K 3ULEB 3NBPA 2I7NA 4O55A 3IFRA 1N6QA 3KK7A 1RBSA 5J2MA 2ZGZA 2P9UB 2F9TA 2UUCK 1U6ZA 3CCQN 1RNHA 1NOYA 2NLXA 4PL7A 2E2PA 4DQSA 4FOEA 3QETA 1RTDA 2UU9K 3U6FA 3KKRA 3NGIA 1RTIA 2WTUA 4OPKA 3K5MA 5FPNA 1TK5A 2GWKA 3SPZA 1ZBUA 2FBTA 2HBMA 1N5YA 5EU7A 4YOXA 1VSEA 3R9PA 4O5BA 5M1PA 3MEEA 2OZSA 1IH7A 3O9RA 4WE1A 2GUPA 4BDPA 3KVGA 4BVOA 4E7LA 2AJQA 1YUWA 3AVLA 3L6QA 1Y64A 3G0ZA 4YOWA 1BG3A 4F8RA 2O4GA 4Z4CA 3ZT3A 3HO1A 4LFBK 1UAXA 3KKSA 3ZX2A 3N4PA 3MX2A 4IWVA 2GEMA 4KHUA 3EE9A 1KC8O 1UOCA 1L5UA 2KFNA 4FJLA 3S41A 2ZJRL 3WXJA 3OY9A 4DKWA 1U45A 1OVQA 3PX6A 1YIJN 3CM6A 4B9LA 3MMVA 1Q9YA 3N4QA 5AQRA 4BE0A 3WT0A 2O8CA 4HCCA 3OVNA 1EP4A 5CY4A 4FCYA 1MU2A 1WSHA 3LP0A 4JKFA 4BRNA 3DLHA 1NGJA 3ENHA 3D6RA 4CHYA 1U4BA 3VF6A 4CFCA 1KXPA 4DTUA 3H08A 1X3MA 4IDKA 3CFPA 4XH5A 4K8XA 1N36K 3G6EN 3AVMA 1LV5A 4OLAA 1QQMA 3HT3A 1YTUA 4CGIA 3SQ4A 3AO3A 5BRHA 1IBKK 4CJWA 1W9HA 4JI3K 3K9KA 3CQYA 1NK6A 1TYQA 4LSLA 1M90O 3QO9A 4GKJK 2KFZA 1X3NA 1CZAN 3HOSA 4FLZA 1NNEA 2W6LA 1KAXA 1X9MA 4U67L 3ITHA 4WFNL 4CEOA 3M8RA 1U49A 5A2QO 4ID5A 3TI0A 4IKFA 3AO4A 4Y1DA 4B1VA 3L2QA 3QBWA 2P9IA 2Q97A 3L2VA 1L3TA 4YNQA 1C0GA 3I0RA 1JXBA 4BQZA 4CD1A 3P38A 3F9KA 3UB5A 4EP5A 3EZWA 3I0SA 3BZCA 5KPZA 4M41A 3H6EA 4EP4A 2OYQA 1R59O 5T7BA 2YNGA 2HNDA 1D8YA 3P5JA 4I2PA 3OYHA 1KFSA 4H5WA 3WQTA 4CJTA 3O4WA 3VQ9A 4DB3A 4K41A 1IKVA 4O44A 3CCSN 4BR4A 1NGDA 4XIUA 4ELVA 4E1JA 1G15A 4R79A 3KLEA 4BDZA 2ZF5O 3MXIA 5AQLA 5KI6A 3DLEA 1VQ7N 4EHTA 1GLJO 3AVKA 3CC4N 4BRCA 4NO7A 3O9UA 2W40A 4AM7A 3VQCA 4CHOA 3MECA 2GX9A 1HNXK 4FPBA 1U04A 1A5XA 3U3GA 2FXUA 4CBUA 4KO0A 2ZD1A 1C1CA 3CQXA 4JRQA 1N32K 1HMVA 2CH6A 5M1OA 2A41A 3EKSA 4CZGA 1RDWX 4W5QA 4CJEA 2XHBA 2VG5A 5IWAK 3CCMN 4KREA 1TL1A 4O4GA 4FYDA 2HHUA 1VRUA 4LFAK 1MWKA 5KRSA 4KBOA 5C10A 3KJVA 4EIAA 4DSFA 4O8UA 2HB5A 3B6OA 3OYNA 2ITGA 2JWLA 3MN9A 3SAHA 3CFRA 2QA4N 3Q7CA 3VENA 3ULEA 4BY9C 4MFBA 4FWLA 3IKMA 4WCEL 1MA9B 3ZSZA 3E9PA 2WC9A 3AVFA 3C6AA 4E1NA 2HMPA 1VQLN 2E2OA 3LP2A 1S6QA 3V9WA 4GVMA 1Q18A 2I5JA 2A5XA 1TKTA 1E3MA 4ID1A 3NCIA 1YJNN 4JKGB 1ATSA 3O9QA 3L2WA 4KHQA 3DOLA 1VSMA 3DOKA 3KK1A 4CECA 3LWLA 2WONA 3ZETA 2VQEK 3ZYYX 4DSIA 1JLQA 4DFJA 5CYQA 1NGGA 3DLBA 4FJ5A 2HHTA 4YDUA 4LF9K 4CJFA 5I42A 3AARA 3VEOA 3NF8A 4CD3A 4DTRA 4FLWA 4KFBA 4DQ8A 1SL1A 1BU6O 4NLBA 4M3TA 3MN5A 4A59A 1QSLA 2EHGA 3PSFA 4CIEA 1X9JA 4F2SA 2ETJA 3VQPA 3K9JA 2GUIA 3QFPA 1TKZA 3IMXA 2IS3A 4B9QA 4E7IA 2ASOA 2NUBA 2Q1NA 3OJUA 3SUPA 3SI6A 1VSJA 1LCUA 3TARA 1NK0A 3PX4A 3V1OA 1A5WA 4IOAL 4B9UA 1LWCA 1BO5O 1P90A 2O8CB 4Z4HA 3DJCA 2X78A 4BDYA 4X66K 1W97L 4KHSA 4DV1K 2LSNA 5BPLA 2Z1IA 4CJRA 4H4OA 2E1YA 5LY3A 4LF7K 3AVJA 4JI4K 4DG1A 4OLBA 3ZEUA 3TTDA 3MXJA 4DTSA 3DRPA 4Y1CA 3SBGA 3DXMA 2IVNA 4DV3K 1SQKA 3AA2A 4ZTJA 1Q8IA 5BR8K 2NRZA 3CCVN 4FJJA 4BRGA 3TTFA 1Q86O 4KH5A 3OYGA 1VQKN 2Y1JA 1RT2A 4RW4A 4WQ5C 2KKZA 4DV4K 4JKGA 2E2NA 2XRIA 3LAKA 4AHRA 2IIRA 3OYEA 3MX5A 1QHTA 3KLGA 4DR4K 4BRDA 5AZIA 1XMQK 4BRIA 4ISGA 4DHYA 3I8DA 1RBTA 3QICA 2B6AA 4PQUA 4W5RA 2PYJA 2DY4A 3FZFA 2O8EA 4FJMA 3DM2A 5GAHP 2P9IB 4IJAA 4JI7K 2A6AA 3C94A 3R3LA 4DR1K 4JI2K 2XO7A 5KPRA 4FLVA 4X64K 4QOZB 1NGCA 4HUEA 2F9WA 4KB1A 1EWQA 5FLXO 1JLFA 4ELTA 2G8KA 3ENBA 2P9LB 3QEVA 3KWGA 4OPHA 3U8XA 1RT1A 3C95A 3UKUB 3QFUA 3ZT2A 3QIOA 1HJOA 3R8EA 4KHYA 2E8AA 1L3VA 4H03B 4FLTA 4HTLA 4JV5K 4Z0UA 3GBTA 3K58A 5JLFA 2BUPA 2P1JA 3RSEB 3CERA 4PKHA 2E1ZA 2E2QA 4CESA 3V9UA 4DSKA 3T69A 3V9ZA 4DR7K 2VWKA 1WB9A 1BL3A 3SJJA 3QNNA 3OYFA 3L3UA 4CE9A 1JLGA 1P8ZA 1BHLA 3OYCA 1T6CA 1HUXA 5FRNA 4JK8A 4FJXA 2P9SB 3KLIA 2PY5A 4A5BA 4OGCA 4BRLA 2OTJN 1BA1A 4JI0K 4CJ5A 4MLHA 2UXDK 4DU1A 2HBLA 1NU0A 1VSLA 5D3GA 1Z25A 3IUCA 1W0HA 3M8PA 5AQHA 4KI6A 2Q3SA 5KTQA 1KQSM 5F2RA 1N34K 1DGKN 1XWLA 5JICA 3TU5A 3WXMB 5BRFA 3LM9A 3TPQA 3H46O 1XHZA 3U9ZA 2HHXA 4JN4A 3NDKA 2Q31A 1DLOA 4RW9A 4CGDA 3HXMA 3LDSA 4GY2B 4K25A 3HVRA 4DQPA 1BCOA 1XHXA 3SCXA 3MWPA 4IG0A 2G8UA 4M3RA 4ILHA 1RFQA 3CETA 3I8BA 5FPDA 4GKKK 4G9ZA 2D4WA 3PIPL 4AF1A 3B6PA 1IBLK 1BUPA 2HBKA 3MN7A 3HK2A 1I39A 3MEDA 4LSNA 3ID8A 2VG6A 2B5JA 4IDHA 3IAYA 3ZSQA 4X62K 1WSGA 3EO3A 4JS4A 2KZMA 2QM1A 4GW6A 1C0TA 3THYA 1NK9A 2V52B 1X9SA 2FF6A 3MEGA 4C8LA 4BACA 4E3SA 4NYNA 1GLCG 2W6KA 4KV8A 3RRHA 3ZLJA 1JL1A 1NGAA 2O8DB 4Q0BA 2O8FA 3ZT1A 4ISFA 3OS1A 5EVZA 1N33K 2WUSA 2DFHA 5E26A 4NXNK 1EX4A 5J1EA 4IOCL 3O9TA 2VGMA 3WXIA 5BN9A 1B9DA 3V1QA 4ICLA 3VOVA 3O1WA 4B3TK 3EE8A 2RKIA 4BC5A 1XNQK 1HLUA 1U2VB 2P9PA 4H0TB 3GG4A 4J8FA 4W5TA 1VSDA 4QS7A 2G8FA 1OH7A 4BRFA 3AA4A 1J6ZA 2GBZA 4CZJA 5CHIA 4DS5A 1NJWA 3D2FB 5LJWA 3S3OA 3ZETB 4BR2A 3VEZA 3HBTA 4F9OA 3LWMA 4BE1A 3QBXA 4CJPA 3DXKB 1SAZA 1NGBA 4LD0A 3RMDA 1JLAA 1TV6A 3HJFA 5AQYA 3C7NB 3OYKA 4C8OA 2RHKA 4M3WA 4HUGA 4I6MA 3EKUA 2F8TA 3VTIA 1K73O 4BQLA 3ISNC 1NJZA 5SWMA 3V9SA 2VG7A 3THXB 1R0AA 4FJ8A 5JS2A 3EEQA 5JVHL 2QW9A 2P9KB 2D1KA 2Q0RA 3FLCO 3AVCA 4KH6A 4FJHA 5I9EB 4DF8A 3AY9A 3GOIA 3CCEN 2ASMA 4H0VB 5AQVA 4BRKA 4Z4EA 4B9NA 3A0IX 3U4LA 4CEBA 4KHNA 2IVOA 2QTDA 2AP1A 3AO2A 4CZMA 4FLYA 4IEIA 1KCFA 3OYJA 1QQOA 2WFBA 4AH9A 1JLBA 4WFAL 3D0PA 4M3YA 1XNRK 3DXKA 4H5NA 4BWMA 3KWIA 1S1VA 3UKUA 1HYSA 1QQCA 4LF6K 1IBMK 4B8CA 3QEIA 1HRHA 1HNZK 1YJ9N 4JKHA 3LP3A 3SYZA 3VQ8A 4DR2K 2BTFA 3FZLA 1S3XA 4DSEA 1SV5A 1M1KO 5C15A 3D45A 3JSMA 1A5VA 3GE1A 3ULDA 4GVEA 1TUUA 1WSJA 1ZYQA 3OS2A 1LW0A 4CHZA 3ZCMA 3BY5A 2HF4A 5E41A 2NRXA 2P5GA 1BIZA 3GDQA 3O6WA 5IT9O 4CBWA 1JLCA 3SAFA 1WBBA 2E4LA 5M1QA 2RN2A 1C0UA 3HVTA 4DF4A 5AQOA 4DV5K 4NYFA 3LDLA 3V6DA 2HMIA 1HR0K 4IO8A 5AQGA 4FXDA 3S3MA 1S5JA 4RCHA 1T3VA 1JKHA 2A1SA 1VQ6N 4BR9A 3OYDA 3VN5A 4PWDA 2OPQA 3OHRA 1K8KA 3CCLN 3O80A 5EOYA 4BR7A 1TAUA 4FWOA 3AGRA 4DLEA 5EX5A 3T1HK 1S72N 4F3OA 5J2QA 4JHDA 2QKKA 4A2BA 3AVGA 1NJIO 4BC3A 2KHOA 3ZSRA 3BUZB 3TWHA 3HRGA 4FWMA 4RW6A 3HYFA 3NGZA 1CZ9A 3EYZA 3NHGA 4MLEA 4H0OA 1IO2A 3BF1A 2V51B 1YHQN 4A5AA 4BGBA 3MXMA 1C0FA 4I9QA 2O8EB 3P39A 5B8HA 2G8HA 4BR0A 3TSUA 3K59A 3DLKA 3U9DA 3PLAA 1GOAA 2F7TA 4A62A 4MO5A 4DTNA 3CJCA 4CF8A 3SUOA 3VGMA 1UA0A 3QLHA 3PUFA 4JKDA 4JK7A 3OTOK 4NCAA 1JJ2M 4RW7A 3G71N 1KRPA 3RVCA 1NJXA 4E0DA 5C24A 4CZHA 1DEJA 1TGOA 4XEIA 3ZSYA 4DWIA 2WOMA 1QHAA 3DXMB 2QEXN 1UWBA 3LANA 3SPYA 3M8SA 1GLLO 4PY5A 4GV3A 4CJ4A 5KQ8A 3SUNA 1BQMA 2BH1A 3PV8A 3P83D 3FFIA 1KSPA 1YAGA 4CK2A 1GLBG 3HSCA 5MLCQ 2XY8A 3VF4A 1Z26A 1RTHA 2WBNA 1RTJA 1Y97A 3AVAA 1ASWA 1SKSA 3AGKA 2JLEA 3RWUA 4LH4A 3VMFB 2DTUA 1WOQA 4B3SK 5I3UA 4I9LA 4FK2A 4HVJA 5F1XA 3MAQA 2HVIA 2O8BA 2H3GX 2IC3A 3CG7A 5AFUH 2NZTA 2JWKA 4FK4A 1RDAA 4PHTX 2P9LA 3LL3A 3VQ5A 1KLMA 3UE5A 1VAZA 2FBYA 4JHDB 1BQNA 3WNGA 3M8QA 3SMSA 5AQNA 4MDBA 5FROA 5M1KA 1ZBIA 1TKXA 3EY1A 5AQIA 1NK8A 3L2RA 3TANA 1REVA 1GLEG 4FJNA 1ZBFA 4B3OA 3O3GA 4N5SA 3J80O 1LAWA 4BE2A 4B9SA 1Q81O 2QWPA 3VQAA 4ZHRA 1WUAA 2B4JA 4NLCA 5JMVA 3VQ6A 3LDPA 4Z94A 3LDNA 3ALYA 4KI4A 4OO1J 3RTVA 2OPPA 3T7ZA 1S9EA 3A5MC 3A5OC 3W3DA 1EXQA 5KGWA 4YORA 1S6PA 2YJEA 3CCRN 4WF9L 4A2AA 1U48A 2GV9A 3CCJN 4EFHA 3L8BA 1FW6A 2V7ZA 4AHVA 4CIGA 3SQ1A 4EHUA 1DTTA 1TL3A 4CGGA 1SKWA 2HHSA 2NRHA 3KHYA 1RT4A 1ASVA 5M1NA 1OVYA 4DU3A 1BIUA 1WLJA 2CH5A 1YJWN 3NVKA 1ILYA 3SNNA 3CPEA 3WNHA 4NCGA 3K0SA 3C0BA 3NFAA 4RW8A 4DS4A 4CEAA 4FW1A 4PUOA 2Y1IA 2OPSA 2QI2A 2FLOA 1SKRA 1LOTB 2YHBA 2P51A 1NWKA 4DTJA 4H4MA 1ATRA 4JS5A 5HROA 4LY7A 3K2PA 4BROA 1T05A 5ADXH 5HBMA 4AHCA 1BCMA 3T3FA 4CJVA 4JKAA 4LFCK 4M63C 4CJKA 5BR9A 4IZ9A 3MWTA 4HWIA 4CEFA 4DV0K 1NG9A 3VQQA 4H8KA 3KLHA 2FC0A 2FBXA 1HNVA 3EN9A 1SS6A 4FWKA 5C42A 4NCBA 3ZSWA 4H5VA 1L3UA 4O0JA 1NJYA 4WQ4A 1RBUA 3HPHA 1YITN 3AVIA 4CCHA 2A3ZA 1TUYA 3RSEA 4IO9L 1RBRA 1X1PA 5FRMA 3KD1E 4CZLA 4CGJA 3CXCM 1JLEA 1KVAA 1HPZA 2HF3A 3DYAA 1HYZA 4CW7B 3SK3A 2ATQA 4Z4GA 3FE1A 2J4RA 3TAPA 1VSHA 4ZTFA 5AJ3K 3A8YA 1EKEA 3CJ1A 4L8RB 4FZXC 4QS8A 4AHSA 1QE1A 5CE3A 3GL1A 4IXCA 3NH2A 1E4GT 4KB0A 3A5LC 4JKBA 3JYTA 3VQ4A 4ISEA 4YOVA 4DQRA 2ZQBA 1C1AA 3SQ2A 4CZKA 3VQBA 1NKEA 4BRHA 4YDUC 3VQDA 4J2BA 5KQDA 1GOCA 1VRTA 3FGUA 3DRRA 3QEWA 5AZIB 3H1QA 3HTVA 1WAFA 3C65A 1NGEA 3NVMA 1XC3A 4C1NK 1JXEA 5M1FA 4MQ3A 3KZBA 2QXLA 4DR3K 1QQNA 5AQWA 4FJGA 2CGKA 4DLGA 3O1BA 3JS6A 1QS4A 1BDGA 3SZ2A 3LALA 2E5LK 2PZSA 1NK7A 5EXWA 3AVHA 3HM8A 3NF6A 4OX9K 3C6HA 1BWFO 4O5FA 5ADXA 2F4VK 4O8KA 5AQXA 3H3NO 1IJJA 4QAGA 4B08A 1OKJA 4KTQA 1BI4A 1NMDA 2ASPA 5HP1A 3JXUA 3F5TA 3NAEA 1U47A 3BGRA 3ID6A 4CGFA 1Z6RA 3CHWA 1YVNA 2Q2RA 2D0OA 2YNHA 3O8MA 1KAYA 4MO4A 3V9XA 2QWMA 1TVRA 5AZJA 3O5BA 4E7HA 1XC9A 4CF1A 1V4SA 3D2FA 2YCHA 4YFUA 5CZ1A 4OKEA 3OA9A 2E20A 3D2EB 3KLFA 3KK2A 4KRFA 2HHQA 1EO1A 3ASMA 1N8RO 1ZBSA 1FKPA 3DWLA 1HQUA 4GNIA 1QTMA 1HPMA 1HNWK 4JYAK 2Z1HA 3RR7A 1B9FA 2EWSA 3B8AX 1S1XA 4CZIA 1IV0A 5HRNA 4FWSA 3G25A 3AAQA 2ZGYA 3NGYA 1FKOA 5C2FA 3CMEN 2P9PB 4Q5VA 1ATNA 2OPRA 4IBNA 5H1SQ 3BEXA 4FZYA 4W5OA 2BANA 3DI6A 4M42A 3QIPA 3T19A 3TAEA 4BG9A 4PKGA 2NNWA 3TSQA 1YVUA 2X6NA 3PIOL 4HCBA 4CK3A 1KTQA 4BRAA 3NF9A 4KHWA 1JCGA 4HTUA 2KTQA 1YF5L 1NOZA 4BC2A 1TYQB 2PYLA 4JNEA 4DFMA 2QXFA 3CM5A 4F2RA 4LC9B 4CFAA 4JAXA 1MDUB 4K43A 4CEDA 2GWJA 4JI6K 2PFUA 1YI2N 3ZT4A 4AM6A 3K5OA 3HPGA 3S9HA 3QMLA 3CJ9A 2G8WA 3QINA 1WSFA 3C6UA 4LF5K 3AA5X 1LW2A 3L4IA 3OBWA 5HRPA 2XY6A 3QEPA 5GIPA 3LZJA 5LMUK 5CZ2A 4KH4A 1JCEA 3F9MA 4ILJA 4CEZA 4YHHK 3HZ6A 1GLDG 1IG8A 4CJLA 5GAEP 3VEWA 2W42A 3WEEA 1KLNA 4DQIA 1D5AA 3IDHA 1RDUA 1LAVA 3W0LA 2FSJA 5AQKA 2O4IA 4XH4A 2OCEA 3K5LA 4OGEA 3O3FA 3ZEUB 2JGUA 3SV4A 4V19S 4C8NA 4RWTA 3SMPA 3THWA 3PO4A 3C7NA 3HPOA 4CK1A 2KLAA 3LP1A 4QS9A 4CJQA 2ZJPL 2IAJA 4CGHA 1E4FT 5J2PA 1K9MO 1VQ4N 3E9LA 1SL2A 1RT5A 4NB4A 4CF0A 2VWJA 3ZT0A 4N41A 4ELUA 2Z1JA 3SLCA 3E9OA 1S22A 1O13A 2R7YA 4RTFD 2O8FB 4KKOA 1VQMN 2RE2A 3HM9A 1XMOK 4CI6A 3OYMA 2ZJQL 3RR8A 1NGHA 3TSPA 3MDQA 4EZ9A 5AQJA 1EETA 2P5OA 2YI1A 3CC2N 1RDDA 3NMUA 4BR5A 3WQUA 4J2EA 2VQFK 4KTZA 1LWEA 2CGJA 3TTCA 1Z05A 1XUPO 1SUQA 4M3UA 1C6VA 2ZM6K 4IOXA 2PBDA 4YOYA 4FOIA 1VQPN 3JAMO 2YKNA 2HNZA 5BN8A 2P9NB 5AQUA 3U3YA 2DFEA 3LDOA 4JI8K 4FM0A 5KRTA 3CJAA 3S3NA 4WFBL 2HHWA 4B9VA 2RPIA 1OH5A 4FLXA 3P4IA 3ENOA 1IG9A 3CJBA 3WNFA 2YHXA 4FJ9A 4B1UB 1HJRA 1TAQA 1C0MA 2QWRA 4N76A 1YTAA 1CXUA 3ZX3A 2AA4A 3TAQA 1HNIA 1IKYA 3HP9A 3M5RA 4FVMA 2IVPA 3HP6A 3K57A 3MCPA 3A2FA 4YOTA 1T44A 4C8KA 4I2QA 3CD6N 5SZTA 4WQ4C 3L3VA 1VQ8N 2HOEA 2D0BA 4CVNE 4ILGB 4C1NI 5E84A 3O08A 5EY4A 2UXCK 3V1RA 1VK0A 1B92A 5AR0A 5AQSA 1L3SA 3IG1A 1XI1A 1HQEA 1YT3A 3KK3A 4DTXA 2RF2A 3F2KA 1J9AA 1BGXT 2VGNA 3ZSVA 3LPTA 1YXQA 1ZC6A 3I55N 4XH1A 4FWNA 3CMAN 4M45A 3FZHA 3CF5L 4HHTA 3E66A 3EL2A 2IOCA 4FLUA 5BRDA 1VHXA 3DMJA 2GELA 5ELZA 1S1UA 3P1GA 5DM6L 5AQMA 4DQQA 2P9KA 3G10A 1ZBHA 4M7YA 3OBYA 2Z1GA 2P9NA 4PL8A 2Q0UA 4IFYA 3QNOA 4B1YB 2KQ2A 3NE6A 3V4IA 3L2UA 4UQGA 3HSTB 3L4QA 4NXMK 4X65K 3OS0A 1CLQA 2FSKA 4CF2A 1FJGK 4CBXA 5BPNA 2QWOA 1K8AO 3KIOA 4DV6K 3ZSXA 3TABA 4B3RK 4M7XA 5HLFA 2UUAK 3AA3A 5AQPA 5GADP 3CIPA 4DV2K 3QESA 1U2VA 3PX0A 3T1AA 5CR4A 5AFUA 4TSXA 3VEYA 2W41A 4CFDA 4N47A 4KTWA 4YY3K 3OYBA 1VQON 4DSJA 4J2DA 1NK4A 1X9WA 5FPEA 4E7JA 2X74A 2HSTA 4CJ7A 4FWQA 5LL6Z 3RMBA 3MN6A 3WUHA 3VQEA 2QKBA 3VEVA 5HOOA 3AO5A 4FWPA 1J5EK 4FSVA 3NH0A 1FXXA 2OTLN 2D0PA 1WSIA 1WAJA 1JL2A 4FL9A 4H0YB 3KD5E 3EZ5A 3VF2A 5K14A 2KZZA 1WN7A 3QB0A 4OJRA 4IFEA 3UKRA 4LF4K 3BP8A 4FJIA 4Z4FA 1ITGA 4PKIA 1GLAG 4H5TA 1QZ5A 5J2NA 1OH8A 3DLRA 4B9MA 3VPZA 2UYTA 4FWRA 3AAPA 3L0QA 4OVLA 3MCAB 1T03A 1SL0A 4OPAA 1RDBA 3HOTA 4DR5K 3VEXA 2CGLA 1G99A 1MWMA 4CEQA 3VGLA 2O8BB 4B9TA 1BOTO 5FPMA 3E01A 4FK0A 4BRQA 4OPJA 4LH5A 3E1YA 2VYPA 1S9GA 1ZXOA 5HRRA 4MDAA 4DCHA 1HKBA 4DTPA 4BRMA 1KAZA 2F96A 3O4NA 4HUFA 4W5NA 4B1ZA 1HKGA 4DFPA 3AVNA 1KVBA 1O1WA 1NKBA 5C12A 1RDCA 2XY7A 1HX1A 2O8DA 3TAFA 1VQ9N 4DFKA 1NGIA 2V7YA 4B1WB 4DUYK 1Q82O 1K6YA 4K0KK 4EAHD 5BREA 2QWLA 2ZWHA 5C2DA 3CC7N 1QSYA 4F4KA 4O0IA 4BWJA 4DTMA 4B8AB 4BC4A 1QSSA 3OW2M 3VA0A 2E6LA 3H1VX 1DT9A 1Q7YO 1KFDA 4H0PA 3ATVA 4B3MK 4FJKA 2IDOA 4GV6A 3J7ZO 2HVHA 4KHPK 4CHNA 5GAGP 4AQYK 3HI0A 1TK0A 5AZJB 1NK5A 3BF3A 2GTDA 4KAZA 2BGGA 2YNIA 4CJ3A 1JCFA 1LWFA 2ZE2A 3SJHA 1NMNA 3SV3A 3M1FA 2ITMA 1W2BM 1BI4B 1T7PA 4JK9A 2FSNA 3WXLA 3THWB 2A1RA 1QVGM 4DU4A 5LJVA 3Q7BA 1EWRA 1VSKA 2X6SA 4E1MA 2YV0X 5DMRA 3VETA 1GOBA 3KTQA 3RRGA 3O3HA 4FJ7A 3CI5A 4OKKA 4JD2B 3O4QA 4AHTA 1EQYA 2P9UA 1NBWA 1V4TA 3QDKA 4FW2A 3LM2A 3J8AA 2YHAA 5KPTA 4AILC 4RG8A 1VQ5N 1ESVA 4DMNA 3BDPA 4L3QA 4H5RA 1C1BA 3I56N 5DK5A 3THVA 3VQ7A 2FF3B 4FZZA 3FZKA 1VSFA 1ASUA 1DTQA 3LZIA 5HRSA 2D0CA 3LPUA 4I6MB 1RILA 3M6GA 2IGIA 1VQNN 5AQTA 4A61A 2UXBK 3OYIA 3IRXA 2NRWA 2HNYA 4H0XB 4E7KA 3WNEA 4CJSA 4K8ZA 2YHWA 4PA1A 5TKWA 1XQSC 3VA3A 5C0YA 3DLLL 2G8IA 1TKDA 3SAGA 1BISA 3R1XA 4JD2A 3DAWA 4M3XA 2BDPA 1FK9A 4JKCA 2F8SA 1RT6A 3M3ZA 3UIQA 3ZX0A 1W7AA 3DLGA 2NRRA 4IFVA 4QCLA 5JS1A 4KPYA 5FDLA 3PO5A 4C23A 5TKYA 2EX3A 1T8EA 2YHYA 3VERA 1BA0A 2E6MA 1KD1O 2NRVA 3FR0A 5F0XA 1I3AA 2YNFA 3CYMA 3TAMA 4OKJA 2A42A 1CZBA 4FM2A 2PAVA 3H45C 2NRTA 3G4SN 3QEXA 2HHVA 1RCHA 4A57A 4JKEA 3NF7A 2A40A 3O9SA
chains in the Genus database with same CATH topology
3DJCA 3VF4A 4CI6A 2ZJQL 1W97L 1NGHA 3FZMA 3TSPA 3MDQA 2YX6A 2WBNA 1QZ6A 5AQJA 3FFKB 2I7PA 1RGIA 5BPLA 2YI1A 3CC2N 3AGKA 5LY3A 2E1YA 2VCPA 3A5NC 4Y0WA 3VMFB 3CJ7A 3P31A 3NMUA 3ZEUA 4BR5A 3R6MA 3TTDA 1WOQA 3WQUA 5BPMA 2CGJA 3SBGA 3TTCA 1Z05A 1XUPO 3DXMA 2IVNA 3WXKA 4BG8A 1SQKA 3VTHA 5F1XA 4IOXA 2PBDA 4YOYA 2H3GX 4FVUA 4FOIA 2NRZA 5AFUH 5BN8A 3CCVN 2NZTA 4BRGA 1NM1A 2JWKA 1VQPN 1HKCA 2P9NB 3TTFA 4PHTX 2P9LA 3LL3A 5AQUA 1Q86O 4KH5A 3UE5A 1VAZA 3LDOA 1VQKN 4WQ5C 2KKZA 4IEEA 4JHDB 3CJAA 4JKGA 3SMSA 3CCUN 5AQNA 4MDBA 2E2NA 5M1KA 4WFBL 1D4XA 2OANA 2IIRA 5AQIA 3P4IA 3ENOA 3MX5A 4BRDA 3LDQA 5AZIA 3D2EA 4BRIA 4ISGA 1GLEG 4DHYA 1SZ2A 3CJBA 2YHXA 1H1VA 4B1UB 1Q81O 3QICA 2QWPA 2QWRA 1WUAA 2YJFA 4JEPA 3FZFA 2AA4A 4NLCA 3ZX3A 4BREA 3M5RA 2IVPA 5JMVA 3LDPA 5GAHP 3MCPA 4Z94A 2P9IB 3LDNA 4IJAA 4GV9A 4OO1J 3H3OB 4YOTA 2A6AA 1T44A 3R3LA 3T7ZA 2QWNA 3CD6N 5KPRA 3A5MC 3I33A 3A5OC 4WQ4C 5AQFA 1DKGD 3W3DA 3WEEB 1QVFM 1NGCA 2HOEA 1VQ8N 4YORA 3MK6A 2F9WA 2YJEA 4ILGB 1K8KB 4A2AA 4B1XB 4WF9L 4C1NI 5E84A 3CCRN 3CCJN 3O08A 4EFHA 5EY4A 5AQQA 3ENBA 2P9LB 4BRPA 2V7ZA 5AR0A 3KWGA 4OPHA 3U8XA 5AQSA 4YOUA 3UKUB 3QFUA 4EHUA 4BGAA 2NRHA 1HJOA 3KHYA 3R8EA 5M1NA 1OVYA 2E8AA 4H03B 2QWQA 1NGFA 5HL7L 2CH5A 3F2KA 4HTLA 2VGNA 1YJWN 3GBTA 1YXQA 3NVKA 1ZC6A 3I55N 5JLFA 3ATUA 4XH1A 1ILYA 2BUPA 4K42A 4FWNA 3VGKA 4U7BA 3RSEB 3CPEA 3CMAN 3FZHA 3CERA 3C0BA 4PKHA 2E1ZA 2E2QA 3CF5L 1NLVA 3T69A 5GINA 3E66A 3EL2A 5BRDA 2Q36A 2GELA 2QI2A 1GLFO 2FLOA 1P8ZA 5ELZA 1T6CA 1HUXA 1LOTB 3UKRB 4JK8A 5DM6L 1NWKA 2P9SB 5AQMA 2P9KA 1ATRA 4M7YA 1T6DA 3OBYA 4A5BA 4BROA 4BRLA 2OTJN 5ADXH 1BA1A 2P9NA 4PL8A 2Q0UA 3VESA 4MLHA 4B1YB 5JVGL 2DPNA 4FO0A 4JKAA 2HBJA 4WQ5A 4M63C 2HBLA 5AQZA 3CPWM 2VWBA 5DM7L 3D7EO 5BR9A 3IUCA 4IZ9A 3MWTA 5AQHA 3L4QA 4HWIA 4CZEA 4BVPA 4IJNA 2FSKA 5F2RA 1KQSM 2P9SA 4CBXA 4CZFA 5BPNA 2QWOA 1DGKN 1K8AO 3SBTA 5GIOA 3EN9A 1SS6A 4FWKA 4M7XA 5JICA 4FPAA 5AQPA 3TU5A 3WXMB 5BRFA 2E88A 4H5VA 5GADP 3CIPA 3LM9A 4WQ4A 3TPQA 3H46O 5JLHA 1U2VA 1YITN 4WYBA 5CR4A 3U9ZA 5AFUA 2W41A 2A3ZA 4JN4A 3VEYA 1TUYA 2Q31A 3RSEA 4IO9L 4UY8O 3ULEB 4GY2B 4K25A 2I7NA 3IFRA 1VQON 3MWPA 3KK7A 4CZLA 3CXCM 2ZGZA 2P9UB 2F9TA 1U6ZA 2HF3A 3CCQN 5FPEA 4ILHA 2HSTA 4CJ7A 4FWQA 1RFQA 2NLXA 3CETA 3SK3A 4PL7A 3FE1A 3I8BA 3MN6A 3WUHA 2J4RA 5FPDA 2E2PA 4FOEA 3VEVA 5HOOA 4G9ZA 3A8YA 3CJ1A 4FWPA 4QS8A 4FSVA 5FPNA 2OTLN 2D4WA 2D0PA 5CE3A 2GWKA 3PIPL 4AF1A 3GL1A 2HBMA 4FL9A 4IXCA 1BUPA 1E4GT 2HBKA 3MN7A 3A5LC 4JKBA 4YOXA 4H0YB 3R9PA 5M1PA 4ISEA 4YOVA 3ID8A 4IDHA 3O9RA 4CZKA 2GUPA 3VF2A 3EO3A 3KVGA 4BVOA 4BRHA 3QB0A 4YDUC 1YUWA 4IFEA 2QM1A 3UKRA 3BP8A 3L6QA 1Y64A 4YOWA 1BG3A 2V52B 5KQDA 2FF6A 4PKIA 1GLAG 3FGUA 1QZ5A 4H5TA 5AZIB 3N4PA 3ZX2A 3MX2A 3H1QA 3HTVA 1GLCG 4IWVA 2GEMA 3EE9A 3VPZA 2UYTA 4FWRA 3C65A 3AAPA 1KC8O 3L0QA 1NGEA 1NGAA 3MCAB 3NVMA 1XC3A 3S41A 3WXJA 4C1NK 2ZJRL 4OPAA 4DKWA 3HOTA 5M1FA 3KZBA 3VEXA 2CGLA 1G99A 2QXLA 4ISFA 5EVZA 1YIJN 1QQNA 5AQWA 1MWMA 2WUSA 5E26A 2CGKA 4IOCL 3O1BA 3MMVA 3O9TA 3VGLA 2VGMA 3N4QA 3WXIA 5AQRA 5BN9A 3JS6A 3VOVA 3WT0A 1BDGA 1BOTO 3O1WA 3EE8A 5FPMA 4BC5A 1HLUA 4BRQA 1U2VB 2P9PA 4H0TB 3GG4A 4J8FA 4JKFA 4BRNA 5EXWA 1NGJA 3E1YA 3ENHA 3HM8A 4QS7A 2VYPA 3D6RA 3C6HA 1BWFO 4O5FA 5ADXA 4BRFA 1ZXOA 4O8KA 3VF6A 4MDAA 1KXPA 4DCHA 5AQXA 3H3NO 1HKBA 1IJJA 1J6ZA 1OKJA 4CZJA 5CHIA 1X3MA 3D2FB 5LJWA 4BRMA 1NMDA 2ASPA 3ZETB 1KAZA 4BR2A 3JXUA 3F5TA 3VEZA 4XH5A 3HBTA 4F9OA 3ID6A 1Z6RA 3QBXA 3DXKB 1SAZA 1NGBA 3CHWA 3G6EN 1YVNA 1HKGA 2D0OA 2Q2RA 4B1ZA 3O8MA 1KAYA 1QQMA 4MO4A 5AQYA 5C12A 2QWMA 3C7NB 5BRHA 1HX1A 2RHKA 3K9KA 5AZJA 1VQ9N 3CQYA 3O5BA 1TYQA 4I6MA 1NGIA 3EKUA 1M90O 2V7YA 3VTIA 4B1WB 1V4SA 1K73O 1X3NA 3D2FA 2YCHA 1CZAN 3HOSA 1Q82O 4BQLA 1KAXA 3OA9A 4EAHD 2E20A 3D2EB 4U67L 5BREA 2QWLA 5JVHL 2ZWHA 2QW9A 5C2DA 2P9KB 4WFNL 3CC7N 2D1KA 2Q0RA 3FLCO 4KH6A 1EO1A 5I9EB 3AY9A 3GOIA 3CCEN 2ASMA 4H0VB 1N8RO 4BC4A 5AQVA 4BRKA 4B1VA 1ZBSA 3DWLA 3QBWA 3OW2M 2P9IA 2Q97A 3A0IX 3H1VX 3U4LA 1DT9A 1C0GA 1Q7YO 4H0PA 4BQZA 4CD1A 3P38A 2IVOA 2QTDA 2AP1A 3ATVA 4GNIA 3UB5A 1HPMA 3EZWA 5KPZA 4CZMA 3H6EA 4IEIA 1QQOA 2WFBA 4WFAL 4GV6A 3J7ZO 1R59O 3DXKA 4H5NA 3KWIA 3UKUA 2EWSA 3B8AX 4H5WA 3WQTA 4CZIA 5GAGP 3HI0A 3O4WA 4FWSA 5AZJB 3G25A 3AAQA 2ZGYA 4DB3A 3BF3A 5C2FA 1YJ9N 4JKHA 2GTDA 1VQMN 3CMEN 2P9PB 4K41A 3CCSN 1ATNA 1NGDA 2BTFA 4BR4A 5H1SQ 3FZLA 1JCFA 1S3XA 3BEXA 4E1JA 4R79A 3SJHA 2ZF5O 1M1KO 5AQLA 5C15A 1VQ7N 3M1FA 4BG9A 3GE1A 4PKGA 2ITMA 4EHTA 1W2BM 1GLJO 2NNWA 4JK9A 4GVEA 1TUUA 2FSNA 3WXLA 3CC4N 4BRCA 3TSQA 4NO7A 3O9UA 3PIOL 2W40A 4AM7A 1QVGM 5LJVA 3Q7BA 2HF4A 2NRXA 2GX9A 4BRAA 3GDQA 4FPBA 3O6WA 4CBWA 3SAFA 1JCGA 2FXUA 5M1QA 4CBUA 1YF5L 5AQOA 3CQXA 3LDLA 3VETA 4BC2A 2CH6A 1TYQB 2A41A 5M1OA 4IO8A 4JNEA 5AQGA 3EKSA 4CZGA 1RDWX 4RCHA 1T3VA 3CI5A 1VQ6N 4JD2B 1EQYA 2P9UA 1NBWA 4LC9B 1V4TA 3QDKA 3CCMN 4BR9A 3LM2A 3J8AA 3OHRA 4JAXA 1K8KA 5KPTA 1MDUB 3CCLN 3O80A 5EOYA 1VQ5N 4BR7A 1MWKA 1ESVA 4K43A 4KBOA 5C10A 4FWOA 3AGRA 4EIAA 5EX5A 2GWJA 1S72N 2PFUA 4L3QA 4H5RA 1YI2N 4O8UA 4JHDA 3I56N 4AM6A 4A2BA 2FF3B 1NJIO 3FZKA 4BC3A 2KHOA 2JWLA 3MN9A 3QMLA 3SAHA 3CJ9A 2QA4N 3BUZB 3Q7CA 3VENA 3ULEA 3HRGA 4I6MB 4BY9C 4FWMA 4FWLA 3IKMA 4WCEL 1MA9B 3E9PA 3M6GA 2WC9A 4H0OA 3C6AA 4MLEA 5AQTA 3BF1A 3L4IA 1VQNN 4A61A 2HMPA 2V51B 3OBWA 1YHQN 4A5AA 4BGBA 1VQLN 3O9SA 2E2OA 5GIPA 2NRWA 4H0XB 1Q18A 1C0FA 2A5XA 3P39A 5B8HA 2YHWA 4KH4A 1JCEA 5TKWA 1XQSC 3TSUA 4BR0A 4JKGB 3U9DA 1ATSA 3O9QA 1YJNN 5C0YA 3F9MA 4ILJA 3DLLL 3PLAA 2F7TA 4A62A 4MO5A 3HZ6A 1GLDG 1IG8A 5GAEP 3SAGA 3CJCA 3R1XA 3VEWA 4JD2A 3DAWA 3WEEA 4JKCA 3VGMA 3M3ZA 3ZETA 3IDHA 3ZYYX 1RDUA 3W0LA 3ZX0A 2FSJA 5AQKA 4JKDA 4JK7A 1NGGA 4XH4A 2NRRA 4YDUA 1JJ2M 3G71N 3RVCA 3ZEUB 3AARA 3VEOA 4CZHA 4CD3A 1DEJA 4RWTA 4C23A 5TKYA 3SMPA 4DQ8A 3C7NA 4XEIA 1BU6O 2YHYA 4NLBA 3VERA 1QHAA 2KLAA 3DXMB 4QS9A 2ZJPL 1BA0A 2QEXN 1E4FT 3MN5A 1K9MO 4A59A 1KD1O 1X9JA 2NRVA 3FR0A 3K9JA 5F0XA 1GLLO 1VQ4N 3E9LA 3QFPA 4GV3A 3IMXA 4NB4A 5KQ8A 4B9QA 2BH1A 2A42A 2ASOA 2Q1NA 3SLCA 3E9OA 2PAVA 1LCUA 1S22A 1YAGA 2NRTA 3H45C 1O13A 3G4SN 1GLBG 2A40A 4RTFD 3HSCA 4IOAL 4A57A 4JKEA 1BO5O 5MLCQ 2RE2A 1P90A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BH1 A;  1W97 L;  1YF5 L;  4PHT X;  5TKW A; 
#chains in the Genus database with same CATH topology
 3FZM A;  2YX6 A;  1QZ6 A;  3FFK B;  4CF9 A;  2I7P A;  2QK9 A;  1RGI A;  1VSI A;  2VCP A;  3A5N C;  4Y0W A;  3CJ7 A;  3P31 A;  3RMC A;  3R6M A;  2D0A A;  1OH6 A;  5BPM A;  3OJS A;  1D9D A;  1WBD A;  4JI5 K;  4R5P A;  3HL8 A;  4BG8 A;  3WXK A;  4N56 A;  4FVU A;  3VTH A;  2D5R A;  1ZBL A;  1NM1 A;  1HKC A;  3K5N A;  2UUB K;  4DV7 K;  3TR8 A;  4IEE A;  3CQ8 A;  3CCU N;  2YKM A;  3PSI A;  1D4X A;  1S1W A;  2OAN A;  4CHP A;  3SQ0 A;  4LF8 K;  4J2A A;  2DFF A;  3LDQ A;  3D2E A;  4CJU A;  4FM1 A;  4CIF A;  1TK8 A;  1RT7 A;  1SZ2 A;  3DRS A;  4G1Q A;  1H1V A;  3QER A;  4Z4I A;  2YJF A;  4JEP A;  1UA1 A;  4BRE A;  3C6T A;  4E19 A;  4CEE A;  1IKW A;  4EZ6 A;  1RBV A;  4GV9 A;  3J7Y P;  2XY5 A;  3NH1 A;  3H3O B;  3RMA A;  4CFB A;  2QWN A;  1F21 A;  5AQF A;  3I33 A;  4CER A;  1DKG D;  3WEE B;  1QVF M;  1IKX A;  4I7F A;  2OA8 A;  3MK6 A;  4B1X B;  1K8K B;  1NKC A;  4F3T A;  3THX A;  3J7A P;  3LAM A;  3IS9 A;  3SUQ A;  5AQQ A;  3AV9 A;  4GMJ B;  3CFO A;  4BRP A;  5KGX A;  4YOU A;  1Q9X A;  1KVC A;  4BGA A;  3AVB A;  2G8V A;  3BZK A;  5LMN K;  3J81 O;  2QWQ A;  2OZM A;  1NGF A;  1RT3 A;  5HL7 L;  4M3Z A;  1CXQ A;  1J53 A;  3OYA A;  3ATU A;  4K42 A;  4U7B A;  3VGK A;  4IG3 A;  3F73 A;  1NLV A;  5GIN A;  5C25 A;  4CHQ A;  4DSL A;  2Q36 A;  2HW3 A;  1GLF O;  1I94 K;  2FBV A;  3UKR B;  3TAG A;  1WNS A;  1T6D A;  4DUZ K;  3OYL A;  3AO1 A;  3VES A;  2HHH K;  5JVG L;  4JRP A;  2DPN A;  4FO0 A;  4WQ5 A;  2HBJ A;  5CYM A;  5AQZ A;  3CPW M;  1HYV A;  2VWB A;  4DTO A;  5DM7 L;  3D7E O;  1J54 A;  4C8M A;  4CZE A;  4BVP A;  4IJN A;  2KW4 A;  2P9S A;  1S1T A;  4CZF A;  4E89 A;  3PY8 A;  3SBT A;  5GIO A;  3ZSO A;  3T1Y K;  4JLH A;  1D9F A;  4FPA A;  2E88 A;  2BE2 A;  4JI1 K;  5JLH A;  1WSE A;  4WYB A;  4AHU A;  3V81 A;  3THY B;  1J5O A;  4UY8 O;  4DR6 K;  3ULE B;  3NBP A;  2I7N A;  4O55 A;  3IFR A;  1N6Q A;  3KK7 A;  1RBS A;  5J2M A;  2ZGZ A;  2P9U B;  2F9T A;  2UUC K;  1U6Z A;  3CCQ N;  1RNH A;  1NOY A;  2NLX A;  4PL7 A;  2E2P A;  4DQS A;  4FOE A;  3QET A;  1RTD A;  2UU9 K;  3U6F A;  3KKR A;  3NGI A;  1RTI A;  2WTU A;  4OPK A;  3K5M A;  5FPN A;  1TK5 A;  2GWK A;  3SPZ A;  1ZBU A;  2FBT A;  2HBM A;  1N5Y A;  5EU7 A;  4YOX A;  1VSE A;  3R9P A;  4O5B A;  5M1P A;  3MEE A;  2OZS A;  1IH7 A;  3O9R A;  4WE1 A;  2GUP A;  4BDP A;  3KVG A;  4BVO A;  4E7L A;  2AJQ A;  1YUW A;  3AVL A;  3L6Q A;  1Y64 A;  3G0Z A;  4YOW A;  1BG3 A;  4F8R A;  2O4G A;  4Z4C A;  3ZT3 A;  3HO1 A;  4LFB K;  1UAX A;  3KKS A;  3ZX2 A;  3N4P A;  3MX2 A;  4IWV A;  2GEM A;  4KHU A;  3EE9 A;  1KC8 O;  1UOC A;  1L5U A;  2KFN A;  4FJL A;  3S41 A;  2ZJR L;  3WXJ A;  3OY9 A;  4DKW A;  1U45 A;  1OVQ A;  3PX6 A;  1YIJ N;  3CM6 A;  4B9L A;  3MMV A;  1Q9Y A;  3N4Q A;  5AQR A;  4BE0 A;  3WT0 A;  2O8C A;  4HCC A;  3OVN A;  1EP4 A;  5CY4 A;  4FCY A;  1MU2 A;  1WSH A;  3LP0 A;  4JKF A;  4BRN A;  3DLH A;  1NGJ A;  3ENH A;  3D6R A;  4CHY A;  1U4B A;  3VF6 A;  4CFC A;  1KXP A;  4DTU A;  3H08 A;  1X3M A;  4IDK A;  3CFP A;  4XH5 A;  4K8X A;  1N36 K;  3G6E N;  3AVM A;  1LV5 A;  4OLA A;  1QQM A;  3HT3 A;  1YTU A;  4CGI A;  3SQ4 A;  3AO3 A;  5BRH A;  1IBK K;  4CJW A;  1W9H A;  4JI3 K;  3K9K A;  3CQY A;  1NK6 A;  1TYQ A;  4LSL A;  1M90 O;  3QO9 A;  4GKJ K;  2KFZ A;  1X3N A;  1CZA N;  3HOS A;  4FLZ A;  1NNE A;  2W6L A;  1KAX A;  1X9M A;  4U67 L;  3ITH A;  4WFN L;  4CEO A;  3M8R A;  1U49 A;  5A2Q O;  4ID5 A;  3TI0 A;  4IKF A;  3AO4 A;  4Y1D A;  4B1V A;  3L2Q A;  3QBW A;  2P9I A;  2Q97 A;  3L2V A;  1L3T A;  4YNQ A;  1C0G A;  3I0R A;  1JXB A;  4BQZ A;  4CD1 A;  3P38 A;  3F9K A;  3UB5 A;  4EP5 A;  3EZW A;  3I0S A;  3BZC A;  5KPZ A;  4M41 A;  3H6E A;  4EP4 A;  2OYQ A;  1R59 O;  5T7B A;  2YNG A;  2HND A;  1D8Y A;  3P5J A;  4I2P A;  3OYH A;  1KFS A;  4H5W A;  3WQT A;  4CJT A;  3O4W A;  3VQ9 A;  4DB3 A;  4K41 A;  1IKV A;  4O44 A;  3CCS N;  4BR4 A;  1NGD A;  4XIU A;  4ELV A;  4E1J A;  1G15 A;  4R79 A;  3KLE A;  4BDZ A;  2ZF5 O;  3MXI A;  5AQL A;  5KI6 A;  3DLE A;  1VQ7 N;  4EHT A;  1GLJ O;  3AVK A;  3CC4 N;  4BRC A;  4NO7 A;  3O9U A;  2W40 A;  4AM7 A;  3VQC A;  4CHO A;  3MEC A;  2GX9 A;  1HNX K;  4FPB A;  1U04 A;  1A5X A;  3U3G A;  2FXU A;  4CBU A;  4KO0 A;  2ZD1 A;  1C1C A;  3CQX A;  4JRQ A;  1N32 K;  1HMV A;  2CH6 A;  5M1O A;  2A41 A;  3EKS A;  4CZG A;  1RDW X;  4W5Q A;  4CJE A;  2XHB A;  2VG5 A;  5IWA K;  3CCM N;  4KRE A;  1TL1 A;  4O4G A;  4FYD A;  2HHU A;  1VRU A;  4LFA K;  1MWK A;  5KRS A;  4KBO A;  5C10 A;  3KJV A;  4EIA A;  4DSF A;  4O8U A;  2HB5 A;  3B6O A;  3OYN A;  2ITG A;  2JWL A;  3MN9 A;  3SAH A;  3CFR A;  2QA4 N;  3Q7C A;  3VEN A;  3ULE A;  4BY9 C;  4MFB A;  4FWL A;  3IKM A;  4WCE L;  1MA9 B;  3ZSZ A;  3E9P A;  2WC9 A;  3AVF A;  3C6A A;  4E1N A;  2HMP A;  1VQL N;  2E2O A;  3LP2 A;  1S6Q A;  3V9W A;  4GVM A;  1Q18 A;  2I5J A;  2A5X A;  1TKT A;  1E3M A;  4ID1 A;  3NCI A;  1YJN N;  4JKG B;  1ATS A;  3O9Q A;  3L2W A;  4KHQ A;  3DOL A;  1VSM A;  3DOK A;  3KK1 A;  4CEC A;  3LWL A;  2WON A;  3ZET A;  2VQE K;  3ZYY X;  4DSI A;  1JLQ A;  4DFJ A;  5CYQ A;  1NGG A;  3DLB A;  4FJ5 A;  2HHT A;  4YDU A;  4LF9 K;  4CJF A;  5I42 A;  3AAR A;  3VEO A;  3NF8 A;  4CD3 A;  4DTR A;  4FLW A;  4KFB A;  4DQ8 A;  1SL1 A;  1BU6 O;  4NLB A;  4M3T A;  3MN5 A;  4A59 A;  1QSL A;  2EHG A;  3PSF A;  4CIE A;  1X9J A;  4F2S A;  2ETJ A;  3VQP A;  3K9J A;  2GUI A;  3QFP A;  1TKZ A;  3IMX A;  2IS3 A;  4B9Q A;  4E7I A;  2ASO A;  2NUB A;  2Q1N A;  3OJU A;  3SUP A;  3SI6 A;  1VSJ A;  1LCU A;  3TAR A;  1NK0 A;  3PX4 A;  3V1O A;  1A5W A;  4IOA L;  4B9U A;  1LWC A;  1BO5 O;  1P90 A;  2O8C B;  4Z4H A;  3DJC A;  2X78 A;  4BDY A;  4X66 K;  1W97 L;  4KHS A;  4DV1 K;  2LSN A;  5BPL A;  2Z1I A;  4CJR A;  4H4O A;  2E1Y A;  5LY3 A;  4LF7 K;  3AVJ A;  4JI4 K;  4DG1 A;  4OLB A;  3ZEU A;  3TTD A;  3MXJ A;  4DTS A;  3DRP A;  4Y1C A;  3SBG A;  3DXM A;  2IVN A;  4DV3 K;  1SQK A;  3AA2 A;  4ZTJ A;  1Q8I A;  5BR8 K;  2NRZ A;  3CCV N;  4FJJ A;  4BRG A;  3TTF A;  1Q86 O;  4KH5 A;  3OYG A;  1VQK N;  2Y1J A;  1RT2 A;  4RW4 A;  4WQ5 C;  2KKZ A;  4DV4 K;  4JKG A;  2E2N A;  2XRI A;  3LAK A;  4AHR A;  2IIR A;  3OYE A;  3MX5 A;  1QHT A;  3KLG A;  4DR4 K;  4BRD A;  5AZI A;  1XMQ K;  4BRI A;  4ISG A;  4DHY A;  3I8D A;  1RBT A;  3QIC A;  2B6A A;  4PQU A;  4W5R A;  2PYJ A;  2DY4 A;  3FZF A;  2O8E A;  4FJM A;  3DM2 A;  5GAH P;  2P9I B;  4IJA A;  4JI7 K;  2A6A A;  3C94 A;  3R3L A;  4DR1 K;  4JI2 K;  2XO7 A;  5KPR A;  4FLV A;  4X64 K;  4QOZ B;  1NGC A;  4HUE A;  2F9W A;  4KB1 A;  1EWQ A;  5FLX O;  1JLF A;  4ELT A;  2G8K A;  3ENB A;  2P9L B;  3QEV A;  3KWG A;  4OPH A;  3U8X A;  1RT1 A;  3C95 A;  3UKU B;  3QFU A;  3ZT2 A;  3QIO A;  1HJO A;  3R8E A;  4KHY A;  2E8A A;  1L3V A;  4H03 B;  4FLT A;  4HTL A;  4JV5 K;  4Z0U A;  3GBT A;  3K58 A;  5JLF A;  2BUP A;  2P1J A;  3RSE B;  3CER A;  4PKH A;  2E1Z A;  2E2Q A;  4CES A;  3V9U A;  4DSK A;  3T69 A;  3V9Z A;  4DR7 K;  2VWK A;  1WB9 A;  1BL3 A;  3SJJ A;  3QNN A;  3OYF A;  3L3U A;  4CE9 A;  1JLG A;  1P8Z A;  1BHL A;  3OYC A;  1T6C A;  1HUX A;  5FRN A;  4JK8 A;  4FJX A;  2P9S B;  3KLI A;  2PY5 A;  4A5B A;  4OGC A;  4BRL A;  2OTJ N;  1BA1 A;  4JI0 K;  4CJ5 A;  4MLH A;  2UXD K;  4DU1 A;  2HBL A;  1NU0 A;  1VSL A;  5D3G A;  1Z25 A;  3IUC A;  1W0H A;  3M8P A;  5AQH A;  4KI6 A;  2Q3S A;  5KTQ A;  1KQS M;  5F2R A;  1N34 K;  1DGK N;  1XWL A;  5JIC A;  3TU5 A;  3WXM B;  5BRF A;  3LM9 A;  3TPQ A;  3H46 O;  1XHZ A;  3U9Z A;  2HHX A;  4JN4 A;  3NDK A;  2Q31 A;  1DLO A;  4RW9 A;  4CGD A;  3HXM A;  3LDS A;  4GY2 B;  4K25 A;  3HVR A;  4DQP A;  1BCO A;  1XHX A;  3SCX A;  3MWP A;  4IG0 A;  2G8U A;  4M3R A;  4ILH A;  1RFQ A;  3CET A;  3I8B A;  5FPD A;  4GKK K;  4G9Z A;  2D4W A;  3PIP L;  4AF1 A;  3B6P A;  1IBL K;  1BUP A;  2HBK A;  3MN7 A;  3HK2 A;  1I39 A;  3MED A;  4LSN A;  3ID8 A;  2VG6 A;  2B5J A;  4IDH A;  3IAY A;  3ZSQ A;  4X62 K;  1WSG A;  3EO3 A;  4JS4 A;  2KZM A;  2QM1 A;  4GW6 A;  1C0T A;  3THY A;  1NK9 A;  2V52 B;  1X9S A;  2FF6 A;  3MEG A;  4C8L A;  4BAC A;  4E3S A;  4NYN A;  1GLC G;  2W6K A;  4KV8 A;  3RRH A;  3ZLJ A;  1JL1 A;  1NGA A;  2O8D B;  4Q0B A;  2O8F A;  3ZT1 A;  4ISF A;  3OS1 A;  5EVZ A;  1N33 K;  2WUS A;  2DFH A;  5E26 A;  4NXN K;  1EX4 A;  5J1E A;  4IOC L;  3O9T A;  2VGM A;  3WXI A;  5BN9 A;  1B9D A;  3V1Q A;  4ICL A;  3VOV A;  3O1W A;  4B3T K;  3EE8 A;  2RKI A;  4BC5 A;  1XNQ K;  1HLU A;  1U2V B;  2P9P A;  4H0T B;  3GG4 A;  4J8F A;  4W5T A;  1VSD A;  4QS7 A;  2G8F A;  1OH7 A;  4BRF A;  3AA4 A;  1J6Z A;  2GBZ A;  4CZJ A;  5CHI A;  4DS5 A;  1NJW A;  3D2F B;  5LJW A;  3S3O A;  3ZET B;  4BR2 A;  3VEZ A;  3HBT A;  4F9O A;  3LWM A;  4BE1 A;  3QBX A;  4CJP A;  3DXK B;  1SAZ A;  1NGB A;  4LD0 A;  3RMD A;  1JLA A;  1TV6 A;  3HJF A;  5AQY A;  3C7N B;  3OYK A;  4C8O A;  2RHK A;  4M3W A;  4HUG A;  4I6M A;  3EKU A;  2F8T A;  3VTI A;  1K73 O;  4BQL A;  3ISN C;  1NJZ A;  5SWM A;  3V9S A;  2VG7 A;  3THX B;  1R0A A;  4FJ8 A;  5JS2 A;  3EEQ A;  5JVH L;  2QW9 A;  2P9K B;  2D1K A;  2Q0R A;  3FLC O;  3AVC A;  4KH6 A;  4FJH A;  5I9E B;  4DF8 A;  3AY9 A;  3GOI A;  3CCE N;  2ASM A;  4H0V B;  5AQV A;  4BRK A;  4Z4E A;  4B9N A;  3A0I X;  3U4L A;  4CEB A;  4KHN A;  2IVO A;  2QTD A;  2AP1 A;  3AO2 A;  4CZM A;  4FLY A;  4IEI A;  1KCF A;  3OYJ A;  1QQO A;  2WFB A;  4AH9 A;  1JLB A;  4WFA L;  3D0P A;  4M3Y A;  1XNR K;  3DXK A;  4H5N A;  4BWM A;  3KWI A;  1S1V A;  3UKU A;  1HYS A;  1QQC A;  4LF6 K;  1IBM K;  4B8C A;  3QEI A;  1HRH A;  1HNZ K;  1YJ9 N;  4JKH A;  3LP3 A;  3SYZ A;  3VQ8 A;  4DR2 K;  2BTF A;  3FZL A;  1S3X A;  4DSE A;  1SV5 A;  1M1K O;  5C15 A;  3D45 A;  3JSM A;  1A5V A;  3GE1 A;  3ULD A;  4GVE A;  1TUU A;  1WSJ A;  1ZYQ A;  3OS2 A;  1LW0 A;  4CHZ A;  3ZCM A;  3BY5 A;  2HF4 A;  5E41 A;  2NRX A;  2P5G A;  1BIZ A;  3GDQ A;  3O6W A;  5IT9 O;  4CBW A;  1JLC A;  3SAF A;  1WBB A;  2E4L A;  5M1Q A;  2RN2 A;  1C0U A;  3HVT A;  4DF4 A;  5AQO A;  4DV5 K;  4NYF A;  3LDL A;  3V6D A;  2HMI A;  1HR0 K;  4IO8 A;  5AQG A;  4FXD A;  3S3M A;  1S5J A;  4RCH A;  1T3V A;  1JKH A;  2A1S A;  1VQ6 N;  4BR9 A;  3OYD A;  3VN5 A;  4PWD A;  2OPQ A;  3OHR A;  1K8K A;  3CCL N;  3O80 A;  5EOY A;  4BR7 A;  1TAU A;  4FWO A;  3AGR A;  4DLE A;  5EX5 A;  3T1H K;  1S72 N;  4F3O A;  5J2Q A;  4JHD A;  2QKK A;  4A2B A;  3AVG A;  1NJI O;  4BC3 A;  2KHO A;  3ZSR A;  3BUZ B;  3TWH A;  3HRG A;  4FWM A;  4RW6 A;  3HYF A;  3NGZ A;  1CZ9 A;  3EYZ A;  3NHG A;  4MLE A;  4H0O A;  1IO2 A;  3BF1 A;  2V51 B;  1YHQ N;  4A5A A;  4BGB A;  3MXM A;  1C0F A;  4I9Q A;  2O8E B;  3P39 A;  5B8H A;  2G8H A;  4BR0 A;  3TSU A;  3K59 A;  3DLK A;  3U9D A;  3PLA A;  1GOA A;  2F7T A;  4A62 A;  4MO5 A;  4DTN A;  3CJC A;  4CF8 A;  3SUO A;  3VGM A;  1UA0 A;  3QLH A;  3PUF A;  4JKD A;  4JK7 A;  3OTO K;  4NCA A;  1JJ2 M;  4RW7 A;  3G71 N;  1KRP A;  3RVC A;  1NJX A;  4E0D A;  5C24 A;  4CZH A;  1DEJ A;  1TGO A;  4XEI A;  3ZSY A;  4DWI A;  2WOM A;  1QHA A;  3DXM B;  2QEX N;  1UWB A;  3LAN A;  3SPY A;  3M8S A;  1GLL O;  4PY5 A;  4GV3 A;  4CJ4 A;  5KQ8 A;  3SUN A;  1BQM A;  2BH1 A;  3PV8 A;  3P83 D;  3FFI A;  1KSP A;  1YAG A;  4CK2 A;  1GLB G;  3HSC A;  5MLC Q;  2XY8 A;  3VF4 A;  1Z26 A;  1RTH A;  2WBN A;  1RTJ A;  1Y97 A;  3AVA A;  1ASW A;  1SKS A;  3AGK A;  2JLE A;  3RWU A;  4LH4 A;  3VMF B;  2DTU A;  1WOQ A;  4B3S K;  5I3U A;  4I9L A;  4FK2 A;  4HVJ A;  5F1X A;  3MAQ A;  2HVI A;  2O8B A;  2H3G X;  2IC3 A;  3CG7 A;  5AFU H;  2NZT A;  2JWK A;  4FK4 A;  1RDA A;  4PHT X;  2P9L A;  3LL3 A;  3VQ5 A;  1KLM A;  3UE5 A;  1VAZ A;  2FBY A;  4JHD B;  1BQN A;  3WNG A;  3M8Q A;  3SMS A;  5AQN A;  4MDB A;  5FRO A;  5M1K A;  1ZBI A;  1TKX A;  3EY1 A;  5AQI A;  1NK8 A;  3L2R A;  3TAN A;  1REV A;  1GLE G;  4FJN A;  1ZBF A;  4B3O A;  3O3G A;  4N5S A;  3J80 O;  1LAW A;  4BE2 A;  4B9S A;  1Q81 O;  2QWP A;  3VQA A;  4ZHR A;  1WUA A;  2B4J A;  4NLC A;  5JMV A;  3VQ6 A;  3LDP A;  4Z94 A;  3LDN A;  3ALY A;  4KI4 A;  4OO1 J;  3RTV A;  2OPP A;  3T7Z A;  1S9E A;  3A5M C;  3A5O C;  3W3D A;  1EXQ A;  5KGW A;  4YOR A;  1S6P A;  2YJE A;  3CCR N;  4WF9 L;  4A2A A;  1U48 A;  2GV9 A;  3CCJ N;  4EFH A;  3L8B A;  1FW6 A;  2V7Z A;  4AHV A;  4CIG A;  3SQ1 A;  4EHU A;  1DTT A;  1TL3 A;  4CGG A;  1SKW A;  2HHS A;  2NRH A;  3KHY A;  1RT4 A;  1ASV A;  5M1N A;  1OVY A;  4DU3 A;  1BIU A;  1WLJ A;  2CH5 A;  1YJW N;  3NVK A;  1ILY A;  3SNN A;  3CPE A;  3WNH A;  4NCG A;  3K0S A;  3C0B A;  3NFA A;  4RW8 A;  4DS4 A;  4CEA A;  4FW1 A;  4PUO A;  2Y1I A;  2OPS A;  2QI2 A;  2FLO A;  1SKR A;  1LOT B;  2YHB A;  2P51 A;  1NWK A;  4DTJ A;  4H4M A;  1ATR A;  4JS5 A;  5HRO A;  4LY7 A;  3K2P A;  4BRO A;  1T05 A;  5ADX H;  5HBM A;  4AHC A;  1BCM A;  3T3F A;  4CJV A;  4JKA A;  4LFC K;  4M63 C;  4CJK A;  5BR9 A;  4IZ9 A;  3MWT A;  4HWI A;  4CEF A;  4DV0 K;  1NG9 A;  3VQQ A;  4H8K A;  3KLH A;  2FC0 A;  2FBX A;  1HNV A;  3EN9 A;  1SS6 A;  4FWK A;  5C42 A;  4NCB A;  3ZSW A;  4H5V A;  1L3U A;  4O0J A;  1NJY A;  4WQ4 A;  1RBU A;  3HPH A;  1YIT N;  3AVI A;  4CCH A;  2A3Z A;  1TUY A;  3RSE A;  4IO9 L;  1RBR A;  1X1P A;  5FRM A;  3KD1 E;  4CZL A;  4CGJ A;  3CXC M;  1JLE A;  1KVA A;  1HPZ A;  2HF3 A;  3DYA A;  1HYZ A;  4CW7 B;  3SK3 A;  2ATQ A;  4Z4G A;  3FE1 A;  2J4R A;  3TAP A;  1VSH A;  4ZTF A;  5AJ3 K;  3A8Y A;  1EKE A;  3CJ1 A;  4L8R B;  4FZX C;  4QS8 A;  4AHS A;  1QE1 A;  5CE3 A;  3GL1 A;  4IXC A;  3NH2 A;  1E4G T;  4KB0 A;  3A5L C;  4JKB A;  3JYT A;  3VQ4 A;  4ISE A;  4YOV A;  4DQR A;  2ZQB A;  1C1A A;  3SQ2 A;  4CZK A;  3VQB A;  1NKE A;  4BRH A;  4YDU C;  3VQD A;  4J2B A;  5KQD A;  1GOC A;  1VRT A;  3FGU A;  3DRR A;  3QEW A;  5AZI B;  3H1Q A;  3HTV A;  1WAF A;  3C65 A;  1NGE A;  3NVM A;  1XC3 A;  4C1N K;  1JXE A;  5M1F A;  4MQ3 A;  3KZB A;  2QXL A;  4DR3 K;  1QQN A;  5AQW A;  4FJG A;  2CGK A;  4DLG A;  3O1B A;  3JS6 A;  1QS4 A;  1BDG A;  3SZ2 A;  3LAL A;  2E5L K;  2PZS A;  1NK7 A;  5EXW A;  3AVH A;  3HM8 A;  3NF6 A;  4OX9 K;  3C6H A;  1BWF O;  4O5F A;  5ADX A;  2F4V K;  4O8K A;  5AQX A;  3H3N O;  1IJJ A;  4QAG A;  4B08 A;  1OKJ A;  4KTQ A;  1BI4 A;  1NMD A;  2ASP A;  5HP1 A;  3JXU A;  3F5T A;  3NAE A;  1U47 A;  3BGR A;  3ID6 A;  4CGF A;  1Z6R A;  3CHW A;  1YVN A;  2Q2R A;  2D0O A;  2YNH A;  3O8M A;  1KAY A;  4MO4 A;  3V9X A;  2QWM A;  1TVR A;  5AZJ A;  3O5B A;  4E7H A;  1XC9 A;  4CF1 A;  1V4S A;  3D2F A;  2YCH A;  4YFU A;  5CZ1 A;  4OKE A;  3OA9 A;  2E20 A;  3D2E B;  3KLF A;  3KK2 A;  4KRF A;  2HHQ A;  1EO1 A;  3ASM A;  1N8R O;  1ZBS A;  1FKP A;  3DWL A;  1HQU A;  4GNI A;  1QTM A;  1HPM A;  1HNW K;  4JYA K;  2Z1H A;  3RR7 A;  1B9F A;  2EWS A;  3B8A X;  1S1X A;  4CZI A;  1IV0 A;  5HRN A;  4FWS A;  3G25 A;  3AAQ A;  2ZGY A;  3NGY A;  1FKO A;  5C2F A;  3CME N;  2P9P B;  4Q5V A;  1ATN A;  2OPR A;  4IBN A;  5H1S Q;  3BEX A;  4FZY A;  4W5O A;  2BAN A;  3DI6 A;  4M42 A;  3QIP A;  3T19 A;  3TAE A;  4BG9 A;  4PKG A;  2NNW A;  3TSQ A;  1YVU A;  2X6N A;  3PIO L;  4HCB A;  4CK3 A;  1KTQ A;  4BRA A;  3NF9 A;  4KHW A;  1JCG A;  4HTU A;  2KTQ A;  1YF5 L;  1NOZ A;  4BC2 A;  1TYQ B;  2PYL A;  4JNE A;  4DFM A;  2QXF A;  3CM5 A;  4F2R A;  4LC9 B;  4CFA A;  4JAX A;  1MDU B;  4K43 A;  4CED A;  2GWJ A;  4JI6 K;  2PFU A;  1YI2 N;  3ZT4 A;  4AM6 A;  3K5O A;  3HPG A;  3S9H A;  3QML A;  3CJ9 A;  2G8W A;  3QIN A;  1WSF A;  3C6U A;  4LF5 K;  3AA5 X;  1LW2 A;  3L4I A;  3OBW A;  5HRP A;  2XY6 A;  3QEP A;  5GIP A;  3LZJ A;  5LMU K;  5CZ2 A;  4KH4 A;  1JCE A;  3F9M A;  4ILJ A;  4CEZ A;  4YHH K;  3HZ6 A;  1GLD G;  1IG8 A;  4CJL A;  5GAE P;  3VEW A;  2W42 A;  3WEE A;  1KLN A;  4DQI A;  1D5A A;  3IDH A;  1RDU A;  1LAV A;  3W0L A;  2FSJ A;  5AQK A;  2O4I A;  4XH4 A;  2OCE A;  3K5L A;  4OGE A;  3O3F A;  3ZEU B;  2JGU A;  3SV4 A;  4V19 S;  4C8N A;  4RWT A;  3SMP A;  3THW A;  3PO4 A;  3C7N A;  3HPO A;  4CK1 A;  2KLA A;  3LP1 A;  4QS9 A;  4CJQ A;  2ZJP L;  2IAJ A;  4CGH A;  1E4F T;  5J2P A;  1K9M O;  1VQ4 N;  3E9L A;  1SL2 A;  1RT5 A;  4NB4 A;  4CF0 A;  2VWJ A;  3ZT0 A;  4N41 A;  4ELU A;  2Z1J A;  3SLC A;  3E9O A;  1S22 A;  1O13 A;  2R7Y A;  4RTF D;  2O8F B;  4KKO A;  1VQM N;  2RE2 A;  3HM9 A;  1XMO K;  4CI6 A;  3OYM A;  2ZJQ L;  3RR8 A;  1NGH A;  3TSP A;  3MDQ A;  4EZ9 A;  5AQJ A;  1EET A;  2P5O A;  2YI1 A;  3CC2 N;  1RDD A;  3NMU A;  4BR5 A;  3WQU A;  4J2E A;  2VQF K;  4KTZ A;  1LWE A;  2CGJ A;  3TTC A;  1Z05 A;  1XUP O;  1SUQ A;  4M3U A;  1C6V A;  2ZM6 K;  4IOX A;  2PBD A;  4YOY A;  4FOI A;  1VQP N;  3JAM O;  2YKN A;  2HNZ A;  5BN8 A;  2P9N B;  5AQU A;  3U3Y A;  2DFE A;  3LDO A;  4JI8 K;  4FM0 A;  5KRT A;  3CJA A;  3S3N A;  4WFB L;  2HHW A;  4B9V A;  2RPI A;  1OH5 A;  4FLX A;  3P4I A;  3ENO A;  1IG9 A;  3CJB A;  3WNF A;  2YHX A;  4FJ9 A;  4B1U B;  1HJR A;  1TAQ A;  1C0M A;  2QWR A;  4N76 A;  1YTA A;  1CXU A;  3ZX3 A;  2AA4 A;  3TAQ A;  1HNI A;  1IKY A;  3HP9 A;  3M5R A;  4FVM A;  2IVP A;  3HP6 A;  3K57 A;  3MCP A;  3A2F A;  4YOT A;  1T44 A;  4C8K A;  4I2Q A;  3CD6 N;  5SZT A;  4WQ4 C;  3L3V A;  1VQ8 N;  2HOE A;  2D0B A;  4CVN E;  4ILG B;  4C1N I;  5E84 A;  3O08 A;  5EY4 A;  2UXC K;  3V1R A;  1VK0 A;  1B92 A;  5AR0 A;  5AQS A;  1L3S A;  3IG1 A;  1XI1 A;  1HQE A;  1YT3 A;  3KK3 A;  4DTX A;  2RF2 A;  3F2K A;  1J9A A;  1BGX T;  2VGN A;  3ZSV A;  3LPT A;  1YXQ A;  1ZC6 A;  3I55 N;  4XH1 A;  4FWN A;  3CMA N;  4M45 A;  3FZH A;  3CF5 L;  4HHT A;  3E66 A;  3EL2 A;  2IOC A;  4FLU A;  5BRD A;  1VHX A;  3DMJ A;  2GEL A;  5ELZ A;  1S1U A;  3P1G A;  5DM6 L;  5AQM A;  4DQQ A;  2P9K A;  3G10 A;  1ZBH A;  4M7Y A;  3OBY A;  2Z1G A;  2P9N A;  4PL8 A;  2Q0U A;  4IFY A;  3QNO A;  4B1Y B;  2KQ2 A;  3NE6 A;  3V4I A;  3L2U A;  4UQG A;  3HST B;  3L4Q A;  4NXM K;  4X65 K;  3OS0 A;  1CLQ A;  2FSK A;  4CF2 A;  1FJG K;  4CBX A;  5BPN A;  2QWO A;  1K8A O;  3KIO A;  4DV6 K;  3ZSX A;  3TAB A;  4B3R K;  4M7X A;  5HLF A;  2UUA K;  3AA3 A;  5AQP A;  5GAD P;  3CIP A;  4DV2 K;  3QES A;  1U2V A;  3PX0 A;  3T1A A;  5CR4 A;  5AFU A;  4TSX A;  3VEY A;  2W41 A;  4CFD A;  4N47 A;  4KTW A;  4YY3 K;  3OYB A;  1VQO N;  4DSJ A;  4J2D A;  1NK4 A;  1X9W A;  5FPE A;  4E7J A;  2X74 A;  2HST A;  4CJ7 A;  4FWQ A;  5LL6 Z;  3RMB A;  3MN6 A;  3WUH A;  3VQE A;  2QKB A;  3VEV A;  5HOO A;  3AO5 A;  4FWP A;  1J5E K;  4FSV A;  3NH0 A;  1FXX A;  2OTL N;  2D0P A;  1WSI A;  1WAJ A;  1JL2 A;  4FL9 A;  4H0Y B;  3KD5 E;  3EZ5 A;  3VF2 A;  5K14 A;  2KZZ A;  1WN7 A;  3QB0 A;  4OJR A;  4IFE A;  3UKR A;  4LF4 K;  3BP8 A;  4FJI A;  4Z4F A;  1ITG A;  4PKI A;  1GLA G;  4H5T A;  1QZ5 A;  5J2N A;  1OH8 A;  3DLR A;  4B9M A;  3VPZ A;  2UYT A;  4FWR A;  3AAP A;  3L0Q A;  4OVL A;  3MCA B;  1T03 A;  1SL0 A;  4OPA A;  1RDB A;  3HOT A;  4DR5 K;  3VEX A;  2CGL A;  1G99 A;  1MWM A;  4CEQ A;  3VGL A;  2O8B B;  4B9T A;  1BOT O;  5FPM A;  3E01 A;  4FK0 A;  4BRQ A;  4OPJ A;  4LH5 A;  3E1Y A;  2VYP A;  1S9G A;  1ZXO A;  5HRR A;  4MDA A;  4DCH A;  1HKB A;  4DTP A;  4BRM A;  1KAZ A;  2F96 A;  3O4N A;  4HUF A;  4W5N A;  4B1Z A;  1HKG A;  4DFP A;  3AVN A;  1KVB A;  1O1W A;  1NKB A;  5C12 A;  1RDC A;  2XY7 A;  1HX1 A;  2O8D A;  3TAF A;  1VQ9 N;  4DFK A;  1NGI A;  2V7Y A;  4B1W B;  4DUY K;  1Q82 O;  1K6Y A;  4K0K K;  4EAH D;  5BRE A;  2QWL A;  2ZWH A;  5C2D A;  3CC7 N;  1QSY A;  4F4K A;  4O0I A;  4BWJ A;  4DTM A;  4B8A B;  4BC4 A;  1QSS A;  3OW2 M;  3VA0 A;  2E6L A;  3H1V X;  1DT9 A;  1Q7Y O;  1KFD A;  4H0P A;  3ATV A;  4B3M K;  4FJK A;  2IDO A;  4GV6 A;  3J7Z O;  2HVH A;  4KHP K;  4CHN A;  5GAG P;  4AQY K;  3HI0 A;  1TK0 A;  5AZJ B;  1NK5 A;  3BF3 A;  2GTD A;  4KAZ A;  2BGG A;  2YNI A;  4CJ3 A;  1JCF A;  1LWF A;  2ZE2 A;  3SJH A;  1NMN A;  3SV3 A;  3M1F A;  2ITM A;  1W2B M;  1BI4 B;  1T7P A;  4JK9 A;  2FSN A;  3WXL A;  3THW B;  2A1R A;  1QVG M;  4DU4 A;  5LJV A;  3Q7B A;  1EWR A;  1VSK A;  2X6S A;  4E1M A;  2YV0 X;  5DMR A;  3VET A;  1GOB A;  3KTQ A;  3RRG A;  3O3H A;  4FJ7 A;  3CI5 A;  4OKK A;  4JD2 B;  3O4Q A;  4AHT A;  1EQY A;  2P9U A;  1NBW A;  1V4T A;  3QDK A;  4FW2 A;  3LM2 A;  3J8A A;  2YHA A;  5KPT A;  4AIL C;  4RG8 A;  1VQ5 N;  1ESV A;  4DMN A;  3BDP A;  4L3Q A;  4H5R A;  1C1B A;  3I56 N;  5DK5 A;  3THV A;  3VQ7 A;  2FF3 B;  4FZZ A;  3FZK A;  1VSF A;  1ASU A;  1DTQ A;  3LZI A;  5HRS A;  2D0C A;  3LPU A;  4I6M B;  1RIL A;  3M6G A;  2IGI A;  1VQN N;  5AQT A;  4A61 A;  2UXB K;  3OYI A;  3IRX A;  2NRW A;  2HNY A;  4H0X B;  4E7K A;  3WNE A;  4CJS A;  4K8Z A;  2YHW A;  4PA1 A;  5TKW A;  1XQS C;  3VA3 A;  5C0Y A;  3DLL L;  2G8I A;  1TKD A;  3SAG A;  1BIS A;  3R1X A;  4JD2 A;  3DAW A;  4M3X A;  2BDP A;  1FK9 A;  4JKC A;  2F8S A;  1RT6 A;  3M3Z A;  3UIQ A;  3ZX0 A;  1W7A A;  3DLG A;  2NRR A;  4IFV A;  4QCL A;  5JS1 A;  4KPY A;  5FDL A;  3PO5 A;  4C23 A;  5TKY A;  2EX3 A;  1T8E A;  2YHY A;  3VER A;  1BA0 A;  2E6M A;  1KD1 O;  2NRV A;  3FR0 A;  5F0X A;  1I3A A;  2YNF A;  3CYM A;  3TAM A;  4OKJ A;  2A42 A;  1CZB A;  4FM2 A;  2PAV A;  3H45 C;  2NRT A;  3G4S N;  3QEX A;  2HHV A;  1RCH A;  4A57 A;  4JKE A;  3NF7 A;  2A40 A;  3O9S A; 
#chains in the Genus database with same CATH homology
 3DJC A;  3VF4 A;  4CI6 A;  2ZJQ L;  1W97 L;  1NGH A;  3FZM A;  3TSP A;  3MDQ A;  2YX6 A;  2WBN A;  1QZ6 A;  5AQJ A;  3FFK B;  2I7P A;  1RGI A;  5BPL A;  2YI1 A;  3CC2 N;  3AGK A;  5LY3 A;  2E1Y A;  2VCP A;  3A5N C;  4Y0W A;  3VMF B;  3CJ7 A;  3P31 A;  3NMU A;  3ZEU A;  4BR5 A;  3R6M A;  3TTD A;  1WOQ A;  3WQU A;  5BPM A;  2CGJ A;  3SBG A;  3TTC A;  1Z05 A;  1XUP O;  3DXM A;  2IVN A;  3WXK A;  4BG8 A;  1SQK A;  3VTH A;  5F1X A;  4IOX A;  2PBD A;  4YOY A;  2H3G X;  4FVU A;  4FOI A;  2NRZ A;  5AFU H;  5BN8 A;  3CCV N;  2NZT A;  4BRG A;  1NM1 A;  2JWK A;  1VQP N;  1HKC A;  2P9N B;  3TTF A;  4PHT X;  2P9L A;  3LL3 A;  5AQU A;  1Q86 O;  4KH5 A;  3UE5 A;  1VAZ A;  3LDO A;  1VQK N;  4WQ5 C;  2KKZ A;  4IEE A;  4JHD B;  3CJA A;  4JKG A;  3SMS A;  3CCU N;  5AQN A;  4MDB A;  2E2N A;  5M1K A;  4WFB L;  1D4X A;  2OAN A;  2IIR A;  5AQI A;  3P4I A;  3ENO A;  3MX5 A;  4BRD A;  3LDQ A;  5AZI A;  3D2E A;  4BRI A;  4ISG A;  1GLE G;  4DHY A;  1SZ2 A;  3CJB A;  2YHX A;  1H1V A;  4B1U B;  1Q81 O;  3QIC A;  2QWP A;  2QWR A;  1WUA A;  2YJF A;  4JEP A;  3FZF A;  2AA4 A;  4NLC A;  3ZX3 A;  4BRE A;  3M5R A;  2IVP A;  5JMV A;  3LDP A;  5GAH P;  3MCP A;  4Z94 A;  2P9I B;  3LDN A;  4IJA A;  4GV9 A;  4OO1 J;  3H3O B;  4YOT A;  2A6A A;  1T44 A;  3R3L A;  3T7Z A;  2QWN A;  3CD6 N;  5KPR A;  3A5M C;  3I33 A;  3A5O C;  4WQ4 C;  5AQF A;  1DKG D;  3W3D A;  3WEE B;  1QVF M;  1NGC A;  2HOE A;  1VQ8 N;  4YOR A;  3MK6 A;  2F9W A;  2YJE A;  4ILG B;  1K8K B;  4A2A A;  4B1X B;  4WF9 L;  4C1N I;  5E84 A;  3CCR N;  3CCJ N;  3O08 A;  4EFH A;  5EY4 A;  5AQQ A;  3ENB A;  2P9L B;  4BRP A;  2V7Z A;  5AR0 A;  3KWG A;  4OPH A;  3U8X A;  5AQS A;  4YOU A;  3UKU B;  3QFU A;  4EHU A;  4BGA A;  2NRH A;  1HJO A;  3KHY A;  3R8E A;  5M1N A;  1OVY A;  2E8A A;  4H03 B;  2QWQ A;  1NGF A;  5HL7 L;  2CH5 A;  3F2K A;  4HTL A;  2VGN A;  1YJW N;  3GBT A;  1YXQ A;  3NVK A;  1ZC6 A;  3I55 N;  5JLF A;  3ATU A;  4XH1 A;  1ILY A;  2BUP A;  4K42 A;  4FWN A;  3VGK A;  4U7B A;  3RSE B;  3CPE A;  3CMA N;  3FZH A;  3CER A;  3C0B A;  4PKH A;  2E1Z A;  2E2Q A;  3CF5 L;  1NLV A;  3T69 A;  5GIN A;  3E66 A;  3EL2 A;  5BRD A;  2Q36 A;  2GEL A;  2QI2 A;  1GLF O;  2FLO A;  1P8Z A;  5ELZ A;  1T6C A;  1HUX A;  1LOT B;  3UKR B;  4JK8 A;  5DM6 L;  1NWK A;  2P9S B;  5AQM A;  2P9K A;  1ATR A;  4M7Y A;  1T6D A;  3OBY A;  4A5B A;  4BRO A;  4BRL A;  2OTJ N;  5ADX H;  1BA1 A;  2P9N A;  4PL8 A;  2Q0U A;  3VES A;  4MLH A;  4B1Y B;  5JVG L;  2DPN A;  4FO0 A;  4JKA A;  2HBJ A;  4WQ5 A;  4M63 C;  2HBL A;  5AQZ A;  3CPW M;  2VWB A;  5DM7 L;  3D7E O;  5BR9 A;  3IUC A;  4IZ9 A;  3MWT A;  5AQH A;  3L4Q A;  4HWI A;  4CZE A;  4BVP A;  4IJN A;  2FSK A;  5F2R A;  1KQS M;  2P9S A;  4CBX A;  4CZF A;  5BPN A;  2QWO A;  1DGK N;  1K8A O;  3SBT A;  5GIO A;  3EN9 A;  1SS6 A;  4FWK A;  4M7X A;  5JIC A;  4FPA A;  5AQP A;  3TU5 A;  3WXM B;  5BRF A;  2E88 A;  4H5V A;  5GAD P;  3CIP A;  3LM9 A;  4WQ4 A;  3TPQ A;  3H46 O;  5JLH A;  1U2V A;  1YIT N;  4WYB A;  5CR4 A;  3U9Z A;  5AFU A;  2W41 A;  2A3Z A;  4JN4 A;  3VEY A;  1TUY A;  2Q31 A;  3RSE A;  4IO9 L;  4UY8 O;  3ULE B;  4GY2 B;  4K25 A;  2I7N A;  3IFR A;  1VQO N;  3MWP A;  3KK7 A;  4CZL A;  3CXC M;  2ZGZ A;  2P9U B;  2F9T A;  1U6Z A;  2HF3 A;  3CCQ N;  5FPE A;  4ILH A;  2HST A;  4CJ7 A;  4FWQ A;  1RFQ A;  2NLX A;  3CET A;  3SK3 A;  4PL7 A;  3FE1 A;  3I8B A;  3MN6 A;  3WUH A;  2J4R A;  5FPD A;  2E2P A;  4FOE A;  3VEV A;  5HOO A;  4G9Z A;  3A8Y A;  3CJ1 A;  4FWP A;  4QS8 A;  4FSV A;  5FPN A;  2OTL N;  2D4W A;  2D0P A;  5CE3 A;  2GWK A;  3PIP L;  4AF1 A;  3GL1 A;  2HBM A;  4FL9 A;  4IXC A;  1BUP A;  1E4G T;  2HBK A;  3MN7 A;  3A5L C;  4JKB A;  4YOX A;  4H0Y B;  3R9P A;  5M1P A;  4ISE A;  4YOV A;  3ID8 A;  4IDH A;  3O9R A;  4CZK A;  2GUP A;  3VF2 A;  3EO3 A;  3KVG A;  4BVO A;  4BRH A;  3QB0 A;  4YDU C;  1YUW A;  4IFE A;  2QM1 A;  3UKR A;  3BP8 A;  3L6Q A;  1Y64 A;  4YOW A;  1BG3 A;  2V52 B;  5KQD A;  2FF6 A;  4PKI A;  1GLA G;  3FGU A;  1QZ5 A;  4H5T A;  5AZI B;  3N4P A;  3ZX2 A;  3MX2 A;  3H1Q A;  3HTV A;  1GLC G;  4IWV A;  2GEM A;  3EE9 A;  3VPZ A;  2UYT A;  4FWR A;  3C65 A;  3AAP A;  1KC8 O;  3L0Q A;  1NGE A;  1NGA A;  3MCA B;  3NVM A;  1XC3 A;  3S41 A;  3WXJ A;  4C1N K;  2ZJR L;  4OPA A;  4DKW A;  3HOT A;  5M1F A;  3KZB A;  3VEX A;  2CGL A;  1G99 A;  2QXL A;  4ISF A;  5EVZ A;  1YIJ N;  1QQN A;  5AQW A;  1MWM A;  2WUS A;  5E26 A;  2CGK A;  4IOC L;  3O1B A;  3MMV A;  3O9T A;  3VGL A;  2VGM A;  3N4Q A;  3WXI A;  5AQR A;  5BN9 A;  3JS6 A;  3VOV A;  3WT0 A;  1BDG A;  1BOT O;  3O1W A;  3EE8 A;  5FPM A;  4BC5 A;  1HLU A;  4BRQ A;  1U2V B;  2P9P A;  4H0T B;  3GG4 A;  4J8F A;  4JKF A;  4BRN A;  5EXW A;  1NGJ A;  3E1Y A;  3ENH A;  3HM8 A;  4QS7 A;  2VYP A;  3D6R A;  3C6H A;  1BWF O;  4O5F A;  5ADX A;  4BRF A;  1ZXO A;  4O8K A;  3VF6 A;  4MDA A;  1KXP A;  4DCH A;  5AQX A;  3H3N O;  1HKB A;  1IJJ A;  1J6Z A;  1OKJ A;  4CZJ A;  5CHI A;  1X3M A;  3D2F B;  5LJW A;  4BRM A;  1NMD A;  2ASP A;  3ZET B;  1KAZ A;  4BR2 A;  3JXU A;  3F5T A;  3VEZ A;  4XH5 A;  3HBT A;  4F9O A;  3ID6 A;  1Z6R A;  3QBX A;  3DXK B;  1SAZ A;  1NGB A;  3CHW A;  3G6E N;  1YVN A;  1HKG A;  2D0O A;  2Q2R A;  4B1Z A;  3O8M A;  1KAY A;  1QQM A;  4MO4 A;  5AQY A;  5C12 A;  2QWM A;  3C7N B;  5BRH A;  1HX1 A;  2RHK A;  3K9K A;  5AZJ A;  1VQ9 N;  3CQY A;  3O5B A;  1TYQ A;  4I6M A;  1NGI A;  3EKU A;  1M90 O;  2V7Y A;  3VTI A;  4B1W B;  1V4S A;  1K73 O;  1X3N A;  3D2F A;  2YCH A;  1CZA N;  3HOS A;  1Q82 O;  4BQL A;  1KAX A;  3OA9 A;  4EAH D;  2E20 A;  3D2E B;  4U67 L;  5BRE A;  2QWL A;  5JVH L;  2ZWH A;  2QW9 A;  5C2D A;  2P9K B;  4WFN L;  3CC7 N;  2D1K A;  2Q0R A;  3FLC O;  4KH6 A;  1EO1 A;  5I9E B;  3AY9 A;  3GOI A;  3CCE N;  2ASM A;  4H0V B;  1N8R O;  4BC4 A;  5AQV A;  4BRK A;  4B1V A;  1ZBS A;  3DWL A;  3QBW A;  3OW2 M;  2P9I A;  2Q97 A;  3A0I X;  3H1V X;  3U4L A;  1DT9 A;  1C0G A;  1Q7Y O;  4H0P A;  4BQZ A;  4CD1 A;  3P38 A;  2IVO A;  2QTD A;  2AP1 A;  3ATV A;  4GNI A;  3UB5 A;  1HPM A;  3EZW A;  5KPZ A;  4CZM A;  3H6E A;  4IEI A;  1QQO A;  2WFB A;  4WFA L;  4GV6 A;  3J7Z O;  1R59 O;  3DXK A;  4H5N A;  3KWI A;  3UKU A;  2EWS A;  3B8A X;  4H5W A;  3WQT A;  4CZI A;  5GAG P;  3HI0 A;  3O4W A;  4FWS A;  5AZJ B;  3G25 A;  3AAQ A;  2ZGY A;  4DB3 A;  3BF3 A;  5C2F A;  1YJ9 N;  4JKH A;  2GTD A;  1VQM N;  3CME N;  2P9P B;  4K41 A;  3CCS N;  1ATN A;  1NGD A;  2BTF A;  4BR4 A;  5H1S Q;  3FZL A;  1JCF A;  1S3X A;  3BEX A;  4E1J A;  4R79 A;  3SJH A;  2ZF5 O;  1M1K O;  5AQL A;  5C15 A;  1VQ7 N;  3M1F A;  4BG9 A;  3GE1 A;  4PKG A;  2ITM A;  4EHT A;  1W2B M;  1GLJ O;  2NNW A;  4JK9 A;  4GVE A;  1TUU A;  2FSN A;  3WXL A;  3CC4 N;  4BRC A;  3TSQ A;  4NO7 A;  3O9U A;  3PIO L;  2W40 A;  4AM7 A;  1QVG M;  5LJV A;  3Q7B A;  2HF4 A;  2NRX A;  2GX9 A;  4BRA A;  3GDQ A;  4FPB A;  3O6W A;  4CBW A;  3SAF A;  1JCG A;  2FXU A;  5M1Q A;  4CBU A;  1YF5 L;  5AQO A;  3CQX A;  3LDL A;  3VET A;  4BC2 A;  2CH6 A;  1TYQ B;  2A41 A;  5M1O A;  4IO8 A;  4JNE A;  5AQG A;  3EKS A;  4CZG A;  1RDW X;  4RCH A;  1T3V A;  3CI5 A;  1VQ6 N;  4JD2 B;  1EQY A;  2P9U A;  1NBW A;  4LC9 B;  1V4T A;  3QDK A;  3CCM N;  4BR9 A;  3LM2 A;  3J8A A;  3OHR A;  4JAX A;  1K8K A;  5KPT A;  1MDU B;  3CCL N;  3O80 A;  5EOY A;  1VQ5 N;  4BR7 A;  1MWK A;  1ESV A;  4K43 A;  4KBO A;  5C10 A;  4FWO A;  3AGR A;  4EIA A;  5EX5 A;  2GWJ A;  1S72 N;  2PFU A;  4L3Q A;  4H5R A;  1YI2 N;  4O8U A;  4JHD A;  3I56 N;  4AM6 A;  4A2B A;  2FF3 B;  1NJI O;  3FZK A;  4BC3 A;  2KHO A;  2JWL A;  3MN9 A;  3QML A;  3SAH A;  3CJ9 A;  2QA4 N;  3BUZ B;  3Q7C A;  3VEN A;  3ULE A;  3HRG A;  4I6M B;  4BY9 C;  4FWM A;  4FWL A;  3IKM A;  4WCE L;  1MA9 B;  3E9P A;  3M6G A;  2WC9 A;  4H0O A;  3C6A A;  4MLE A;  5AQT A;  3BF1 A;  3L4I A;  1VQN N;  4A61 A;  2HMP A;  2V51 B;  3OBW A;  1YHQ N;  4A5A A;  4BGB A;  1VQL N;  3O9S A;  2E2O A;  5GIP A;  2NRW A;  4H0X B;  1Q18 A;  1C0F A;  2A5X A;  3P39 A;  5B8H A;  2YHW A;  4KH4 A;  1JCE A;  5TKW A;  1XQS C;  3TSU A;  4BR0 A;  4JKG B;  3U9D A;  1ATS A;  3O9Q A;  1YJN N;  5C0Y A;  3F9M A;  4ILJ A;  3DLL L;  3PLA A;  2F7T A;  4A62 A;  4MO5 A;  3HZ6 A;  1GLD G;  1IG8 A;  5GAE P;  3SAG A;  3CJC A;  3R1X A;  3VEW A;  4JD2 A;  3DAW A;  3WEE A;  4JKC A;  3VGM A;  3M3Z A;  3ZET A;  3IDH A;  3ZYY X;  1RDU A;  3W0L A;  3ZX0 A;  2FSJ A;  5AQK A;  4JKD A;  4JK7 A;  1NGG A;  4XH4 A;  2NRR A;  4YDU A;  1JJ2 M;  3G71 N;  3RVC A;  3ZEU B;  3AAR A;  3VEO A;  4CZH A;  4CD3 A;  1DEJ A;  4RWT A;  4C23 A;  5TKY A;  3SMP A;  4DQ8 A;  3C7N A;  4XEI A;  1BU6 O;  2YHY A;  4NLB A;  3VER A;  1QHA A;  2KLA A;  3DXM B;  4QS9 A;  2ZJP L;  1BA0 A;  2QEX N;  1E4F T;  3MN5 A;  1K9M O;  4A59 A;  1KD1 O;  1X9J A;  2NRV A;  3FR0 A;  3K9J A;  5F0X A;  1GLL O;  1VQ4 N;  3E9L A;  3QFP A;  4GV3 A;  3IMX A;  4NB4 A;  5KQ8 A;  4B9Q A;  2BH1 A;  2A42 A;  2ASO A;  2Q1N A;  3SLC A;  3E9O A;  2PAV A;  1LCU A;  1S22 A;  1YAG A;  2NRT A;  3H45 C;  1O13 A;  3G4S N;  1GLB G;  2A40 A;  4RTF D;  3HSC A;  4IOA L;  4A57 A;  4JKE A;  1BO5 O;  5MLC Q;  2RE2 A;  1P90 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...