2BH1A

X-ray structure of the general secretion pathway complex of the n- terminal domain of epse and the cytosolic domain of epsl of vibrio cholerae
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
238
structure length
238
Chain Sequence
SEFLTVRLSSQKEADIPWLVWSAEQQEVIASGQVAGWEALHEIESYADQRSVVVLLAASDLILTSVEIPPGASRQLENMLPYLLEDEIAQDVEDVHFCVLSKGRETADVVGVDRLWLRACLDHLKACGFDVKRVLPDVLAIPRPEHGLAALQLGDEWLVRKSTTQGMAVDAQWLSLLAASDWVQNEGEYLPLQALTPLPELSLAETQEWRYEPSGLVMQLLTQEALTSKFNLLTGSFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GENERAL SECRETION PATHWAY PROTEIN L
publication title The X-Ray Structure of the Type II Secretion System Complex Formed by the N-Terminal Domain of Epse and the Cytoplasmic Domain of Epsl of Vibrio Cholerae
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Transport protein
total genus 69
structure length 238
sequence length 238
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05134 T2SSL Type II secretion system (T2SS), protein L
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.370 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2bh1A02
3.30.420.380 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2bh1A01
1YF5L 2BH1A 1W97L 5TKWA 4PHTX
chains in the Genus database with same CATH superfamily
2F8SA 2E2OA 3NGIA 2E5LK 1NM1A 1MWMA 3WEEB 3HPHA 4H0PA 3C95A 4B1XB 3L3UA 4WQ4A 4QCLA 3F73A 5C24A 3ATVA 3FZKA 4RW7A 1Q81O 4FLUA 4EZ9A 1NMNA 1WSIA 1BHLA 4R5PA 3RMCA 4DR3K 4B1WB 4LF5K 3OJSA 1NG9A 4FWRA 3PIPL 2HHUA 1C0UA 2ITGA 5HL7L 4YOVA 3AVHA 4CJPA 4Q5VA 5M1OA 3KVGA 4CHQA 2E1YA 2QM1A 4FM2A 4AM7A 1NNEA 3EO3A 4C1NK 3TAMA 3K9JA 3E1YA 4H0OA 1YITN 4NCBA 3QEVA 5I3UA 5AFUH 3EE8A 4HUEA 1Z26A 4DMNA 3O9UA 1BUPA 3DRSA 2OA8A 4Z94A 4PY5A 3LP2A 3DXMA 3QIOA 4BRGA 3SQ1A 4ZTFA 4DCHA 4CZJA 1NKBA 3A8YA 3DRRA 3MX2A 3VQBA 1A5VA 3ZEUA 4M3UA 1UOCA 4IO8A 3T7ZA 4CFAA 3K57A 4CBWA 3HSTB 3MWPA 1N6QA 3FZLA 1IO2A 4FJIA 2KFZA 4FK2A 3MXIA 2V7YA 1DTQA 4F8RA 4IJNA 4FO0A 2HBJA 3WXIA 2BE2A 3KLFA 3WQUA 2FSJA 4IEEA 4BC5A 1K9MO 4EP4A 5DM6L 4BDYA 1QZ6A 3B6OA 4DTXA 4JKHA 1GOAA 3ZSYA 3M8QA 4YY3K 4GKKK 4JI1K 1KD1O 3MEGA 3P39A 3QERA 2DY4A 4OPAA 4JI4K 3PO4A 3VQPA 1VHXA 3UKRB 2OTLN 4CEFA 2FSNA 5HBMA 2E20A 3CI5A 4DQIA 1GLBG 1VSEA 2X6SA 5AQZA 1TKZA 2UXCK 4DR7K 4DTOA 3C65A 5KGWA 3AVGA 2ETJA 1WSFA 2KTQA 5KPRA 1E3MA 4HHTA 3NF8A 4BDZA 2ASOA 3GBTA 3O3HA 4UQGA 3L2UA 5FRMA 3KWGA 4F2RA 3ISNC 1XHXA 3THXB 3IDHA 4B9SA 3NGZA 1BA1A 4CEBA 4WF9L 4JI7K 1IBKK 3U3GA 3MWTA 1C1CA 4BY9C 2PAVA 2QXLA 1DKGD 4JKDA 1IJJA 4AM6A 1R0AA 3SAFA 3HPOA 4J2AA 4K8ZA 4KFBA 2XO7A 4IWVA 5SWMA 2HHTA 4FM0A 3H08A 2W40A 4IO9L 3NVMA 4DR4K 4LSNA 4N56A 3EL2A 4FZYA 4NCGA 4I7FA 5FDLA 1SQKA 2NLXA 2CGKA 1NLVA 2KHOA 4C8NA 4WFBL 3E66A 3K5MA 4A57A 3O5BA 3MCPA 1X9SA 1BISA 4B3SK 3VQ6A 4K0KK 4KTQA 2YX6A 4CERA 3BZCA 4JKCA 3KK7A 3VA0A 3SMPA 4BVPA 2YCHA 2DFFA 4JS4A 3VEVA 1G99A 1XC9A 3AVLA 1HUXA 5AQGA 4O4GA 2YV0X 3PY8A 1BL3A 2GELA 4M41A 3G6EN 2WBNA 2XY5A 4KPYA 3DXMB 1I39A 1VQ6N 1KVAA 1BQMA 4ISFA 4CHZA 3J7ZO 3I8BA 1N34K 5ELZA 3FFKB 3WXJA 4AHCA 3SK3A 4KREA 5SZTA 4BRIA 1EQYA 3KIOA 1C0MA 4ID5A 4BRPA 3ZEUB 1WSJA 5JS1A 1TUYA 1HQUA 2HSTA 4F2SA 3G25A 1U4BA 3R9PA 4J8FA 4DQSA 5J2NA 3ZCMA 3IRXA 5J2QA 3O4WA 3VEYA 2IS3A 1W0HA 1QSLA 3O8MA 4Y1DA 1VQLN 3DLEA 2HVHA 5KTQA 3QBWA 3VF4A 3NBPA 2P9PA 1RTHA 5EU7A 1Z6RA 3LWMA 2QTDA 3ZT4A 5IT9O 4CJLA 5AQWA 1ATNA 3ZETA 3HYFA 3VEWA 1NGIA 4CHYA 3QLHA 4CBXA 3KK3A 3PV8A 1KAXA 5D3GA 4ICLA 3CCUN 1EO1A 2HMPA 3LDNA 3OS2A 5DK5A 2OZMA 2VCPA 4Y0WA 5AJ3K 2E2PA 4CIGA 5FPEA 5GIOA 4B1ZA 4BC2A 1O13A 2OPRA 1GLLO 4XH5A 4RW8A 4DB3A 4O8UA 4YORA 2HBMA 4CJFA 4DV1K 2HB5A 4R79A 1ZBHA 4GKJK 3OW2M 4YHHK 3HK2A 1TK0A 4CHPA 4WQ4C 5HRRA 4JI3K 4W5QA 3LP3A 5M1NA 4AF1A 4IJAA 3SUQA 4E89A 2Q36A 3DLRA 4JLHA 4NYFA 3ZT2A 1X9WA 1NBWA 3O3GA 3ZLJA 3QIPA 2OZSA 3SPZA 1RDDA 4ILJA 4A2BA 2PYJA 2JGUA 4BRQA 1RT6A 3CJ9A 1LW2A 1WSHA 4BACA 1Q7YO 3PLAA 4CEAA 1YHQN 2E6LA 2P9NA 2DPNA 5I42A 1ZBLA 1FKOA 2D0PA 1HMVA 4E1JA 3VQDA 4DS5A 5BPMA 1RBTA 3FZHA 2UUAK 4X65K 4JI6K 1JCGA 2WTUA 3CCEN 4KKOA 3LDLA 1L3UA 5LJVA 3CHWA 4JKGA 2HW3A 5AQQA 2O8FA 5FPNA 2RN2A 4DF4A 3G4SN 1Q8IA 3CM6A 3EYZA 4A5AA 4AILC 4CF0A 1WNSA 1YT3A 2F96A 2QK9A 4FCYA 1WAFA 1QSYA 4FK0A 3QMLA 4UY8O 5E41A 2V52B 1JJ2M 5MLCQ 5LL6Z 3DRPA 2BTFA 5C25A 5TKWA 4DUYK 2VG5A 1QQCA 3CFOA 1VSIA 1M1KO 5LMNK 4Z0UA 1VQ5N 2Z1GA 1Y97A 2VWKA 4NYNA 5AZIB 4CJKA 1YVNA 4B9TA 3TR8A 2QKBA 4B8CA 2HOEA 3ZX3A 3H46O 1TVRA 4FYDA 3OYJA 3CPWM 1IH7A 2YNGA 1QQOA 1HR0K 4CFCA 4KBOA 4BQLA 3HL8A 1ZBIA 3ATUA 1ASUA 3WXMB 3HM9A 2Q2RA 3O08A 2D0OA 4O5FA 4OJRA 1EP4A 1Q9XA 3HTVA 5AZJA 1DEJA 4H0XB 4KHWA 1HYZA 3JSMA 5KQDA 1EXQA 2UUCK 3NDKA 3DJCA 4FWOA 1D5AA 4EHTA 4C23A 4W5OA 3CC7N 2DFHA 4DTSA 4O44A 4PWDA 3SUOA 3KLEA 1QQNA 1W9HA 3OYLA 4G9ZA 4IXCA 4RW9A 4H0TB 5C42A 3NH0A 5EX5A 2CH6A 4DTMA 2WOMA 3VQ9A 4EHUA 4CJ7A 2XY7A 2J4RA 4B1VA 1VSMA 3UE5A 2AP1A 1YJ9N 4NXMK 1BI4A 3AO5A 3CCSN 1KCFA 2Z1HA 3VTIA 4FVMA 4IBNA 4FLWA 2A1SA 3CYMA 3OYEA 1NGBA 2IIRA 1HKCA 2ZJQL 1IBMK 1SUQA 4DV5K 1OVQA 2OANA 2P9NB 1KC8O 2BANA 1VQ4N 3WUHA 1U45A 4BG9A 3OYDA 4HCCA 1NGHA 3C6UA 1DLOA 4DR2K 2G8IA 4IEIA 4DV3K 1ZC6A 5KRTA 3RRHA 4JKGB 2YNIA 2FLOA 3LPUA 3MXJA 2O8FB 5JS2A 2ASPA 2Q0RA 2A3ZA 1HJOA 2KQ2A 3L6QA 3AA5X 1QTMA 3OYIA 4E7HA 4KH5A 2IVOA 3HM8A 4DTPA 2Q97A 1RBSA 3VGLA 4FOIA 3VF2A 4CEQA 1N32K 1JL2A 2CGLA 3SAGA 4BRNA 3VQ7A 3VEXA 4Z4IA 5AQFA 1C0FA 1TKTA 4H5WA 4NLBA 4OGEA 4H4OA 2P5OA 1VAZA 1CXQA 1JCEA 1RBUA 1QZ5A 1OH8A 3K5NA 2BGGA 4CZGA 2CGJA 2GWJA 3AAQA 1NK8A 1T05A 5AQUA 5K14A 4CZFA 1SL1A 4QS8A 4BDPA 4OX9K 1JLEA 1SS6A 1NK5A 1A5WA 4FLYA 4KV8A 4U67L 3TWHA 1KQSM 3LZJA 4FWQA 4BRLA 1H1VA 4KHUA 4JK8A 3NAEA 5AZJB 3GE1A 3QDKA 4YFUA 3HP9A 5HRNA 2ZJRL 4FJXA 4OLBA 5GINA 5AQIA 1L3TA 5BR8K 2O4IA 2HF4A 2KZMA 4BGBA 3V9SA 2QWMA 3CD6N 1RDAA 2FBTA 4IKFA 2YKMA 1S22A 2PYLA 1KVCA 4H0VB 5J2MA 1GLDG 3K5OA 2A6AA 4EP5A 2NRHA 4IZ9A 3WT0A 1VQKN 1QVFM 4GMJB 3NHGA 4PL7A 3SQ2A 3ID8A 1FXXA 4A2AA 1RCHA 2W41A 3CQXA 3VN5A 4DLEA 4BC3A 3SPYA 1BI4B 3D6RA 4DSIA 2YI1A 3ZSQA 1S1UA 4Q0BA 3M3ZA 2FF3B 3THWB 3PSFA 1S1TA 3AGRA 4Z4FA 4FJ5A 1RDUA 3KD5E 2P9LA 1NGDA 4EFHA 1RFQA 4JRQA 1UAXA 3ZX0A 4J2BA 3EKSA 3CJCA 5GAGP 4FLVA 3I8DA 3L2QA 3BZKA 3V9UA 2Q3SA 1HJRA 3LAKA 3L2VA 3QESA 5C2FA 3TI0A 1E4FT 5EY4A 2QI2A 1XNQK 4JN4A 2VQEK 1LWEA 1BA0A 2A41A 4NO7A 2GTDA 5AQOA 2GUPA 2HBLA 3PX4A 1UA0A 2YHYA 3SAHA 5BPLA 2BDPA 3U8XA 2IOCA 2EWSA 2V51B 3MN6A 3EKUA 3LDQA 3MEEA 2YHXA 4NXNK 3VQ4A 4NCAA 3TTCA 2QEXN 1BQNA 1RT5A 1NGAA 4BVOA 2UU9K 1U48A 5AQXA 4X66K 4ELTA 3D0PA 2FC0A 3QEXA 4B3OA 4M45A 5A2QO 3OBYA 3OYFA 3SQ4A 4IFVA 2GEMA 4F9OA 4DTNA 4M63C 3MAQA 5J1EA 1MU2A 1TGOA 4GV9A 4KTWA 5GAHP 3IKMA 2F8TA 4FJMA 3OTOK 5KPZA 4I6MA 1XI1A 3RVCA 3MMVA 1JKHA 4ELVA 3AO1A 3HVRA 3LWLA 1NJIO 1SKSA 4F3OA 4DS4A 1TKDA 2O8DA 2XRIA 1QVGM 3TSUA 4K42A 1NK9A 1WB9A 4IG3A 3DAWA 3IAYA 5T7BA 3KZBA 4GNIA 3P83D 4DWIA 3N4QA 3OYNA 3B8AX 3BGRA 5JICA 1ASWA 3DLBA 3ITHA 1BOTO 3L2WA 3HP6A 1KVBA 2QWNA 1XMQK 1QE1A 4IDKA 5HLFA 1ATSA 3DLLL 4W5RA 1VRUA 4JV5K 4MQ3A 3HOTA 3LP1A 1S1XA 4BR5A 3MXMA 1YTAA 1F21A 4ISEA 1YXQA 3U9ZA 2G8UA 3VGMA 1JLAA 3NCIA 4KHPK 5HRPA 3DM2A 4KH6A 5C10A 4GY2B 1TYQA 3R6MA 3KWIA 4FSVA 4JS5A 3NGYA 2VG7A 1DTTA 4JI5K 3H3OB 3V1OA 4BQZA 5CYMA 4CK2A 3S41A 3K0SA 2P9LB 2I7PA 4CGHA 3ENHA 4BGAA 3GL1A 3VGKA 3LP0A 4NLCA 2P9KA 2HHHK 1T03A 4K25A 1NJWA 3C6TA 1L3VA 1YTUA 3HJFA 4DFJA 1CZAN 1R59O 1VRTA 4CEZA 1RDWX 3OJUA 1NGJA 4H5TA 2GV9A 3A5NC 4BWJA 3VF6A 1BGXT 4CD1A 3LALA 2KW4A 1L5UA 3ZT1A 2YJEA 2B6AA 2YNHA 1YUWA 2IVPA 4PL8A 3FLCO 3TARA 2YKNA 3Q7BA 4FWLA 3JAMO 2PBDA 3SMSA 4B8AB 1SL0A 1V4SA 3TANA 2RHKA 4B9VA 3OYMA 3V9WA 3ULDA 1IKYA 3FZMA 4CZMA 4B3TK 4CF8A 4E7LA 3IUCA 2FSKA 1IKWA 1HNVA 1JLCA 4JEPA 4H0YB 3BUZB 3O9TA 4M3WA 4CF9A 2NRWA 3QFPA 4BRHA 1VQPN 3WXKA 5ADXA 4CJ3A 4DSFA 5E26A 3JS6A 5CY4A 5JVGL 4ELUA 3QBXA 1B9FA 4LH5A 4I6MB 2QWOA 4CGDA 3NF7A 5BR9A 4E7JA 3TU5A 3NH2A 4ID1A 3O3FA 4WCEL 2O8DB 4H5VA 4KHSA 4DTJA 2D4WA 1A5XA 1ITGA 1RT1A 3P4IA 2FBYA 3C7NA 4A62A 4AHSA 4CD3A 2ZD1A 1Q86O 2UUBK 3ENOA 4IG0A 1VSFA 4CECA 3NMUA 3U9DA 4C8OA 3K5LA 1C0TA 1D4XA 3NF6A 4K43A 2WC9A 3KD1E 4IFYA 3NVKA 5AQRA 4BR0A 5JVHL 4LF8K 1RILA 4AHRA 4LF6K 3ZSVA 3L8BA 1MWKA 2P9SA 3ULEA 1EKEA 1G15A 1UA1A 3BEXA 1KTQA 2G8KA 4M3TA 4DV6K 5AQJA 4L3QA 1C1BA 1TYQB 3KTQA 1X9MA 3S3MA 3TSQA 3DXKA 4F3TA 4FW2A 3G71N 4CGJA 3VTHA 4DFKA 2A1RA 1VQ9N 1FK9A 3ZT3A 5C15A 1GLCG 5BRDA 4C8MA 1CZ9A 1TAQA 3V1RA 5FPMA 3O4QA 2NRVA 3M8RA 1LAVA 4ISGA 2NZTA 3P1GA 2RPIA 5KI6A 1U6ZA 4WQ5A 5BPNA 3O9SA 4XH1A 4BWMA 1NKCA 4PKHA 3HI0A 3OYAA 2HNZA 4FJJA 4RW4A 3LPTA 3P38A 3ZSRA 3ZT0A 1VQ8N 3S9HA 4MLHA 4LD0A 3OYGA 4OKEA 4HVJA 2G8VA 2HBKA 3MCAB 1YJWN 5CR4A 3KLHA 1JL1A 3E9PA 3SV3A 3ZSWA 4B1YB 1WSEA 1B9DA 4JK9A 4O0JA 1GOCA 3CM5A 3L2RA 1NOZA 2A5XA 3FZFA 3CETA 4B9MA 3SQ0A 3A5MC 2CH5A 3U3YA 4O8KA 4XH4A 4CEEA 2KFNA 4B3MK 4LY7A 4BG8A 3K9KA 1KFDA 1OH5A 1BDGA 3J81O 3QEWA 3ALYA 3AO4A 3H1QA 3ID6A 3T1AA 3KKSA 2ASMA 3V9ZA 4OGCA 3J80O 2LSNA 3LDOA 1OH7A 2W6KA 4LFBK 2BUPA 4DKWA 2R7YA 4GW6A 2D5RA 3QNOA 3WQTA 5ADXH 2V7ZA 4CBUA 4WYBA 1GLFO 2VGMA 1T8EA 2HHWA 3SCXA 4L8RB 3OYCA 3M1FA 1S1VA 3G10A 4CIFA 1KLMA 3TABA 4FJGA 3VETA 4DUZK 5KQ8A 2P9PB 4FXDA 3SYZA 3C7NB 3PX0A 3V1QA 3QEIA 2RKIA 3ZETB 5BN8A 2NRXA 3MEDA 4CJEA 5FROA 1RDCA 2VG6A 4FJNA 3IFRA 3VESA 2X6NA 4KO0A 3O80A 5AQSA 3VOVA 4IOAL 4FLTA 3S3NA 3DMJA 3H6EA 4MO5A 2P9SB 4MFBA 3CMAN 3CPEA 4MO4A 3D7EO 4CJRA 1RT7A 4XIUA 3AA4A 3DLKA 4BRFA 3QETA 3DXKB 1U2VA 4KHYA 3ZSXA 5AQVA 3NH1A 1MA9B 1U04A 4B9LA 4HTLA 1LCUA 3RMDA 2W42A 4PKIA 1U47A 4FM1A 2GWKA 2PY5A 4FZXC 3VA3A 2G8HA 4DG1A 4YDUA 2F9WA 3I33A 4Z4EA 1OVYA 3V4IA 1FJGK 1J9AA 1TL3A 3V6DA 5C0YA 4FJ7A 4I9LA 4DU1A 1HKBA 2AJQA 1GOBA 4CJTA 3VMFB 4CK1A 3OHRA 1NK6A 3NF9A 4GVMA 3T19A 3CCJN 3LZIA 5BREA 4YOXA 1EWRA 1XMOK 4WFNL 3HOSA 3OY9A 4CESA 4JD2A 3RRGA 1VSKA 5CYQA 3UKUA 5M1FA 5AQLA 4CK3A 4LFAK 4FPBA 1KFSA 1J54A 1BCOA 3QICA 4JAXA 1XHZA 3AVFA 4Z4GA 2Y1IA 2H3GX 3E01A 3LANA 3VPZA 4OKKA 1N33K 2OTJN 4N5SA 1E4GT 4MDAA 4HWIA 5KGXA 3OS1A 4GVEA 3CQ8A 3P31A 1DGKN 3HXMA 4BREA 4ZTJA 5F2RA 1C0GA 3THVA 2IGIA 1GLEG 1ZYQA 2NUBA 1VSHA 2W6LA 4WE1A 4N76A 3CCMN 2OPPA 3D45A 1Q82O 5AFUA 1ZBFA 3D2FA 3VEZA 3HVTA 4HUFA 3J8AA 3CJ1A 3K2PA 2E8AA 3IG1A 4ZHRA 5KPTA 1JLGA 3RR7A 2NRZA 4QS9A 3CCLN 2YHWA 4DV2K 1JCFA 2ZWHA 1GLAG 1ZBSA 3VQQA 3BDPA 4E0DA 2EHGA 3KJVA 3KKRA 4AH9A 4CW7B 1WAJA 3H45C 3VQEA 3AY9A 2B4JA 4CVNE 2P1JA 5DM7L 3DWLA 3GG4A 4B9QA 4CF1A 4B08A 4CEDA 3PO5A 2ZGYA 3CMEN 4BR7A 4DSJA 4E3SA 3P5JA 4DV4K 1NJXA 2Q0UA 1U2VB 5C2DA 4WQ5C 1W7AA 2X78A 2ZM6K 3LDPA 4DF8A 3ZSOA 1V4TA 4RW6A 4LSLA 1XQSC 4IDHA 2O4GA 4DFPA 3SJHA 4DSKA 2E2NA 2EX3A 1XWLA 3AARA 3I0RA 3QNNA 4CJ4A 5AQYA 2NRTA 1T44A 4H8KA 3UB5A 2IDOA 3ZSZA 1RT4A 3TTFA 4CJUA 5CZ2A 2UXBK 2IAJA 1U49A 1IBLK 5LY3A 3V81A 2RE2A 3EN9A 3UIQA 4B9NA 4DV7K 1SL2A 3L3VA 1T6CA 1BIUA 1HNZK 1C1AA 5BN9A 3CCVN 1ZBUA 3CC2N 1WLJA 2QWLA 2ZQBA 1WUAA 3D2EA 3JXUA 1WOQA 2HNYA 4H03B 2F7TA 3RSEA 3WNFA 1P8ZA 1Y64A 5AQMA 4PA1A 3CJ7A 3HBTA 5HP1A 1HPZA 4JD2B 4HCBA 4M3XA 4RWTA 4E1NA 2RF2A 3UKUB 4BRAA 1QHTA 1SKRA 3L4QA 3RMAA 2Q31A 1K73O 2HHQA 4M3YA 2UYTA 4LH4A 2QWRA 5EVZA 1YAGA 1IV0A 4DLGA 3RMBA 2PZSA 1KSPA 3CXCM 3CF5L 1VQNN 4M7XA 4KB1A 3JYTA 3AAPA 1BWFO 3AVNA 4CF2A 1FKPA 3FFIA 3CFRA 4CGGA 4CHOA 4CE9A 4K8XA 4IFEA 3D2FB 1IG9A 3H3NO 3AV9A 4E19A 4O0IA 1NGGA 1TV6A 1OKJA 3T69A 3TSPA 1VQON 4QOZB 3MDQA 4KRFA 2KZZA 4JNEA 5JMVA 3B6PA 1RT2A 2Z1IA 5BRHA 4FWKA 3GDQA 1MDUB 2FBXA 3CIPA 4ILGB 4F4KA 4V19S 3OBWA 2QA4N 4BRKA 3AVBA 5AQTA 3MN7A 4FL9A 2ITMA 1ESVA 4G1QA 1CXUA 5AQPA 4JI2K 4CJVA 4YDUC 3QINA 4MDBA 4JKAA 4YOYA 1GLJO 3FR0A 3W3DA 4BR4A 3T3FA 2P9IA 1BO5O 2XY6A 2YNFA 3SBTA 4QS7A 1LV5A 3M8SA 3M6GA 3MX5A 2G8WA 1NMDA 3PIOL 1JXEA 2E88A 4A61A 3DOKA 4N41A 1BU6O 3HSCA 3I0SA 5M1QA 3DI6A 4OPHA 5JLHA 2JWLA 1XNRK 3AVJA 1J5OA 3KLGA 2E1ZA 4PUOA 4DQ8A 1EX4A 4DU4A 1NU0A 2D1KA 1Q9YA 4E1MA 4I9QA 2DTUA 3AVKA 3VQ5A 2O8EA 2GBZA 3OYHA 2YHBA 2UXDK 4DQRA 3DYAA 4B3RK 2E6MA 4LFCK 3D2EB 3RSEB 2ZF5O 3RR8A 1X3MA 1RT3A 2XY8A 2ZGZA 1XC3A 3VQAA 4FWMA 4BE2A 4JK7A 3AGKA 4I2PA 1QQMA 4N47A 3BF1A 1RGIA 4CCHA 3O9RA 1ATRA 4DSEA 3BP8A 4RTFD 4FJ8A 4DFMA 3M8PA 3HT3A 3RTVA 4DR1K 2BH1A 3SBGA 1SAZA 2HHSA 3PSIA 4FWSA 1IKXA 3EEQA 1KXPA 1KRPA 1C6VA 4C1NI 2HHVA 3AVCA 3THYA 4GV6A 1NOYA 2YHAA 4CI6A 4XEIA 4DTRA 3FE1A 3LM9A 4PHTX 2P9UA 1X1PA 3L0QA 4NB4A 2Q1NA 1VSLA 3TAEA 1HX1A 4CEOA 3AA3A 4IOCL 2ZJPL 1RNHA 4MLEA 5AZIA 3S3OA 1NGFA 5GADP 4M3ZA 3BY5A 1YF5L 3VERA 1N8RO 1RTDA 1I3AA 5KRSA 3MECA 4JYAK 1KLNA 4OPKA 1HLUA 3AO2A 3ZX2A 3SZ2A 4DSLA 1K6YA 4M42A 1VK0A 3T1YK 4A59A 1NJYA 3K58A 1SV5A 3HRGA 3MN9A 1YJNN 1T6DA 4JKFA 3CCQN 3EY1A 4FPAA 4KI6A 1K8KA 3HZ6A 2P9IB 1S72N 2XHBA 1IG8A 4LF4K 1YIJN 4JI0K 1HNWK 4YOWA 1HNXK 3TTDA 1LOTB 3SJJA 4K41A 5CZ1A 4CZIA 1TL1A 3CJBA 3QB0A 1M90O 4TSXA 5FRNA 1HKGA 3FGUA 5AQHA 1S3XA 3E9LA 4JI8K 5LMUK 1D9FA 2D0BA 3SUNA 4FJHA 4CZHA 3U6FA 3C6HA 3A2FA 3QO9A 2AA4A 4X62K 3R8EA 4M3RA 1DT9A 1X3NA 3CFPA 3VENA 1JLBA 5EOYA 2O8EB 5FPDA 3LDSA 2P9KB 3AO3A 4CZLA 3OA9A 4FW1A 4J2EA 3AVAA 3F9MA 2ZE2A 1QSSA 2NRRA 3VQ8A 5TKYA 2GUIA 4H5RA 4FLXA 3PUFA 4CFBA 2GX9A 1LWFA 5J2PA 4EAHD 3QEPA 1CLQA 1TKXA 2P5GA 2OPQA 2JWKA 4O55A 3K59A 3LL3A 1N5YA 3EE9A 2OCEA 4JKBA 1RTJA 1Z05A 2YJFA 1BIZA 4IOXA 3CC4N 1WN7A 5HROA 4EIAA 1VSDA 2E4LA 3ZYYX 4BR9A 2HHXA 2G8FA 3N4PA 3GOIA 1NJZA 4FJKA 1WSGA 4JHDA 4DR5K 4W5TA 3SI6A 3I55N 3TAGA 3OVNA 2E2QA 3KLIA 4JKEA 3R3LA 3THYB 1HQEA 5LJWA 4OO1J 4E7KA 3CQYA 1Q18A 3MK6A 5BRFA 5H1SQ 3VEOA 2P9UB 2VGNA 3H1VX 4BRMA 4CHNA 1UWBA 4HUGA 2FF6A 3CG7A 4CGFA 5F0XA 2A40A 3OYKA 3A5LC 2F9TA 1RBRA 4AHUA 4LF9K 4X64K 3I56N 1S6QA 4RG8A 4A5BA 2X74A 1EETA 5HOOA 1SKWA 4FWPA 1HYSA 1ILYA 4BE1A 1D9DA 3HPGA 4QAGA 3IMXA 2Z1JA 3NFAA 5AQKA 5EXWA 2F4VK 1IKVA 4H4MA 1K8AO 1L3SA 1XUPO 3F2KA 1EWQA 1W2BM 3TPQA 1B92A 4U7BA 1Z25A 1K8KB 3O4NA 1J5EK 4PQUA 2HF3A 1T7PA 3L4IA 3ULEB 4BROA 1SZ2A 4KTZA 3SV4A 2HNDA 4RCHA 3RWUA 4CJ5A 2I5JA 1JLQA 4CGIA 5CE3A 5GIPA 2JLEA 4FLZA 2O8CA 5AQNA 3O6WA 1KAZA 4EZ6A 2VWBA 2A42A 2VQFK 3SNNA 2O8BA 2Y1JA 1VQMN 4OLAA 4KI4A 4CZKA 2FBVA 3O9QA 3V9XA 1QHAA 4YOTA 1BCMA 1QS4A 3C94A 2VWJA 5GAEP 4AHTA 4PKGA 1P90A 3CCRN 2NNWA 1J53A 1TAUA 4FOEA 3O1WA 3AA2A 1VSJA 4BR2A 1LWCA 1RBVA 4LF7K 2D0CA 3ASMA 3DLHA 3SLCA 4I2QA 3J7YP 3THWA 1BG3A 1S5JA 3QFUA 2PFUA 2KLAA 4FWNA 3EZ5A 3MN5A 1CZBA 4CFDA 3BF3A 2QXFA 1S9EA 2WONA 1NWKA 4FK4A 1HRHA 5IWAK 4CIEA 3WEEA 2D0AA 3WNHA 1NK0A 1NK7A 4AQYK 3CERA 4B1UB 4FJ9A 1JLFA 3OS0A 3KHYA 3KK1A 2QWPA 4KAZA 5HRSA 4JHDB 4AHVA 4DQPA 1NGCA 3HO1A 3F9KA 3T1HK 4CJSA 5I9EB 2QKKA 3J7AP 1S6PA 1RTIA 4DV0K 4FVUA 4KHNA 4H5NA 3Q7CA 2I7NA 3TAQA 3VQCA 3KK2A 2IVNA 4Z4CA 3U4LA 4E7IA 4FJLA 2QW9A 1HNIA 3PX6A 3TAFA 1OH6A 4HTUA 4FZZA 4OKJA 4W5NA 2P51A 1NKEA 2B5JA 4YOUA 4B9UA 3AVMA 4WFAL 3IS9A 4ILHA 1S1WA 1YI2N 5M1PA 3DOLA 4DHYA 4J2DA 3LAMA 4BRDA 4KHQA 3WNGA 3OYBA 1FW6A 1RDBA 4Z4HA 4CJWA 2VYPA 1KAYA 1HPMA 5FLXO 1LAWA 2OPSA 4BRCA 3WXLA 3WNEA 2KKZA 1VQ7N 2ATQA 1X9JA 4YNQA 2HMIA 4CJQA 5C12A 4C8KA 5JLFA 1O1WA 2FXUA 4DTUA 1ZXOA 3NE6A 1NGEA 1W97L 3G0ZA 4KH4A 4DR6K 3A0IX 1S9GA 3M5RA 1LW0A 3C0BA 4OPJA 4KB0A 3TAPA 1NK4A 3SUPA 2O8CB 1WBDA 1TUUA 1ASVA 3O1BA 2OYQA 5AR0A 2O8BB 3R1XA 5M1KA 3AVIA 2HVIA 2WUSA 1JXBA 1T3VA 3F5TA 3UKRA 4BE0A 2IC3A 3A5OC 4GV3A 3CJAA 1I94K 4OVLA 2WFBA 5DMRA 4CZEA 1WBBA 1N36K 1HYVA 3E9OA 1YVUA 1TK8A 2QWQA 4DQQA 2DFEA 3EZWA 4BC4A 5E84A 5CHIA 3LM2A 4LC9B 5B8HA 4O5BA 1D8YA 1J6ZA 4JRPA 3W0LA 1REVA 4Y1CA 3C6AA 3ENBA 4DU3A 4M7YA 3DLGA 3THXA 1TK5A 4C8LA 5F1XA
chains in the Genus database with same CATH topology
1X3MA 2E2OA 4MLHA 2OANA 1NM1A 2P9NB 1MWMA 2HBKA 2ZGZA 3MCAB 3WUHA 1YJWN 1KC8O 1XC3A 5CR4A 3WEEB 4FWMA 1VQ4N 4JK7A 4BG9A 1NGHA 4H0PA 3AGKA 1QQMA 3E9PA 5ADXH 3BF1A 4B1XB 4B1YB 4JK9A 4IEIA 1RGIA 4WQ4A 1ZC6A 1ATRA 3O9RA 4JKGB 2FLOA 3BP8A 4RTFD 2ASPA 2Q0RA 2A3ZA 1HJOA 3ATVA 3FZKA 3L6QA 1Q81O 2A5XA 3FZFA 4KH5A 2IVOA 3CETA 3A5MC 2CH5A 3HM8A 4O8KA 2Q97A 4XH4A 3VGLA 4FOIA 4BG8A 2BH1A 3SBGA 4B1WB 1SAZA 3VF2A 3K9KA 2CGLA 3SAGA 1BDGA 4FWSA 4BRNA 3VEXA 4FWRA 3PIPL 1KXPA 3H1QA 5HL7L 3ID6A 4YOVA 5M1OA 5AQFA 2ASMA 4C1NI 3KVGA 1C0FA 2E1YA 2QM1A 4H5WA 4NLBA 3LDOA 4AM7A 3EO3A 4C1NK 1YITN 3K9JA 3E1YA 4H0OA 4GV6A 1VAZA 4CI6A 4XEIA 5AFUH 2BUPA 3EE8A 4DKWA 1JCEA 1QZ5A 3FE1A 1BUPA 3LM9A 3O9UA 4PHTX 2P9UA 4Z94A 3WQTA 3L0QA 4CZGA 2CGJA 2V7ZA 3DXMA 4NB4A 2GWJA 1GLFO 2Q1NA 2VGMA 3AAQA 4WYBA 4BRGA 4CBUA 5AQUA 4CZFA 1HX1A 3M1FA 4IOCL 2ZJPL 4DCHA 4CZJA 3VETA 4QS8A 4MLEA 5AZIA 3A8YA 5KQ8A 2P9PB 1NGFA 1SS6A 3MX2A 5GADP 1YF5L 3VERA 3ZEUA 1N8RO 3C7NB 4U67L 4IO8A 3T7ZA 1KQSM 1HLUA 4CBWA 4FWQA 4BRLA 3MWPA 3ZX2A 1H1VA 3FZLA 3ZETB 5BN8A 4JK8A 2NRXA 5AZJB 2V7YA 3GE1A 4IJNA 4FO0A 2HBJA 3QDKA 4A59A 3WXIA 3HRGA 3WQUA 3MN9A 2ZJRL 2FSJA 1T6DA 1YJNN 4IEEA 4JKFA 3CCQN 4BC5A 1K9MO 5GINA 3IFRA 3VESA 4FPAA 5AQIA 5DM6L 3O80A 1QZ6A 2HF4A 4BGBA 3RSEB 1K8KA 5AQSA 3VOVA 3HZ6A 4JKHA 4IOAL 2P9IB 1S72N 1IG8A 2QWMA 3CD6N 1YIJN 3H6EA 4MO5A 2P9SB 4YOWA 3TTDA 1LOTB 1S22A 3CMAN 4K41A 1KD1O 3CPEA 4MO4A 3D7EO 3P39A 4CZIA 3QB0A 3CJBA 1GLDG 4H0VB 4OPAA 1M90O 1HKGA 3FGUA 3UKRB 2A6AA 5AQHA 2NRHA 4BRFA 1S3XA 3DXKB 1U2VA 3E9LA 4IZ9A 3WT0A 2OTLN 5AQVA 1VQKN 1QVFM 4PL7A 2FSNA 1MA9B 3ID8A 2E20A 4CZHA 3CI5A 1LCUA 4HTLA 4A2AA 3C6HA 4PKIA 2W41A 1GLBG 3CQXA 2AA4A 5AQZA 3R8EA 4BC3A 2GWKA 1DT9A 3D6RA 2YI1A 1X3NA 3M3ZA 3C65A 4YDUA 2F9WA 3I33A 3VENA 5EOYA 5KPRA 1OVYA 2FF3B 5C0YA 5FPDA 3AGRA 2P9KB 2ASOA 3GBTA 4CZLA 3OA9A 3KWGA 1RDUA 3F9MA 2P9LA 2NRRA 1NGDA 1HKBA 4EFHA 5TKYA 1RFQA 4H5RA 3IDHA 3ZX0A 1BA1A 2GX9A 3EKSA 4EAHD 4WF9L 3VMFB 3CJCA 3OHRA 3MWTA 2JWKA 4BY9C 3LL3A 5GAGP 2PAVA 2QXLA 1DKGD 4JKDA 1IJJA 3EE9A 4AM6A 3CCJN 3SAFA 4JKBA 5C2FA 5BREA 1Z05A 2YJFA 4IOXA 3CC4N 4YOXA 1E4FT 5EY4A 4IWVA 2QI2A 4EIAA 4JN4A 2W40A 4IO9L 1BA0A 4WFNL 2A41A 3NVMA 3ZYYX 4BR9A 5F1XA 3HOSA 4NO7A 2GTDA 3EL2A 4JD2A 5AQOA 3UKUA 2GUPA 5M1FA 3N4PA 1SQKA 3GOIA 2HBLA 2NLXA 2CGKA 5AQLA 1NLVA 2KHOA 2YHYA 4FPBA 3SAHA 4BVOA 4WFBL 4JHDA 3QICA 4JAXA 3U8XA 3E66A 5BPLA 4A57A 3O5BA 3MCPA 3I55N 2E2QA 2EWSA 2YX6A 2V51B 2H3GX 3MN6A 3EKUA 4JKCA 3LDQA 3R3LA 4JKEA 2YHXA 3KK7A 3SMPA 3VPZA 4BVPA 2YCHA 3TTCA 5LJWA 4OO1J 2OTJN 2QEXN 3VEVA 1E4GT 4HWIA 4MDAA 1G99A 1HUXA 1NGAA 1Q18A 3CQYA 3MK6A 4GVEA 5AQGA 3P31A 1DGKN 2GELA 5AQXA 5BRFA 5H1SQ 3VEOA 2P9UB 3G6EN 1VQ8N 4BREA 2VGNA 5F2RA 1C0GA 3H1VX 4BRMA 2WBNA 1GLEG 2FF6A 3DXMB 3OBYA 2A40A 5F0XA 1VQ6N 3A5LC 3CCMN 2F9TA 4ISFA 3J7ZO 3I8BA 3I56N 2GEMA 1Q82O 4F9OA 5ELZA 3FFKB 3WXJA 4M63C 3SK3A 5AFUA 4A5BA 3D2FA 3VEZA 5HOOA 4BRIA 1EQYA 3J8AA 3CJ1A 4GV9A 2E8AA 4BRPA 4FWPA 5GAHP 3ZEUB 5KPTA 1TUYA 3IKMA 1ILYA 2HSTA 2NRZA 3G25A 3R9PA 4QS9A 5KPZA 4J8FA 3IMXA 4I6MA 3RVCA 3MMVA 5AQKA 5EXWA 3CCLN 2YHWA 1JCFA 2ZWHA 1GLAG 3O4WA 3VEYA 1NJIO 1ZBSA 3O8MA 1VQLN 1K8AO 1QVGM 3QBWA 3VF4A 2P9PA 3TSUA 1XUPO 3F2KA 3H45C 4K42A 1W2BM 1Z6RA 3TPQA 3DAWA 3AY9A 3KZBA 4GNIA 4U7BA 2QTDA 1K8KB 3N4QA 5DM7L 3DWLA 2HF3A 3GG4A 3B8AX 5AQWA 5JICA 1ATNA 3L4IA 4B9QA 3ZETA 3ULEB 4BROA 1SZ2A 3VEWA 2ZGYA 1BOTO 4RCHA 3CMEN 2QWNA 4BR7A 1ATSA 1NGIA 3DLLL 4CBXA 1KAXA 5CE3A 5GIPA 3CCUN 2Q0UA 1U2VB 5AQNA 3HOTA 5C2DA 1EO1A 2HMPA 3LDNA 3O6WA 4WQ5C 1KAZA 4BR5A 2VWBA 2A42A 3LDPA 2VCPA 4ISEA 1V4TA 1YXQA 4Y0WA 3U9ZA 1VQMN 2E2PA 1XQSC 5FPEA 4IDHA 5GIOA 4B1ZA 3VGMA 3SJHA 1O13A 4BC2A 1GLLO 4XH5A 2E2NA 4KH6A 5C10A 4DB3A 4GY2B 4CZKA 1TYQA 3AARA 3R6MA 4O8UA 4YORA 2HBMA 3KWIA 3O9QA 4FSVA 5AQYA 4R79A 2NRTA 1T44A 3OW2M 3UB5A 1QHAA 4YOTA 3H3OB 5GAEP 4BQZA 4PKGA 4WQ4C 3S41A 1P90A 3TTFA 3CCRN 2NNWA 2P9LB 5M1NA 4AF1A 5LY3A 4FOEA 3O1WA 4IJAA 2RE2A 2I7PA 3EN9A 4BR2A 3ENHA 4BGAA 3GL1A 1T6CA 2Q36A 3VGKA 1NBWA 3SLCA 1BG3A 4NLCA 2P9KA 4ILJA 5BN9A 3CCVN 4A2BA 4K25A 3QFUA 3CC2N 4BRQA 2PFUA 2QWLA 2KLAA 3CJ9A 1WUAA 4FWNA 1Q7YO 3D2EA 3JXUA 1WOQA 3MN5A 4H03B 2F7TA 3RSEA 3PLAA 1P8ZA 1CZAN 1R59O 1Y64A 3BF3A 1RDWX 5AQMA 1NGJA 4H5TA 1YHQN 3A5NC 1NWKA 3CJ7A 2P9NA 2DPNA 3HBTA 3VF6A 4CD1A 2D0PA 4E1JA 4JD2B 3WEEA 4RWTA 5BPMA 3UKUB 3FZHA 2YJEA 4BRAA 3CERA 4B1UB 3CCEN 1YUWA 1JCGA 3KHYA 3L4QA 2QWPA 2Q31A 3LDLA 4JHDB 5LJVA 2IVPA 3CHWA 4JKGA 4PL8A 5AQQA 1K73O 5FPNA 2UYTA 1NGCA 2QWRA 3FLCO 5EVZA 1YAGA 5I9EB 3G4SN 3Q7BA 4FWLA 4A5AA 4FVUA 4H5NA 2PBDA 3SMSA 3CXCM 3Q7CA 3CF5L 1V4SA 2I7NA 1VQNN 4M7XA 3AAPA 2IVNA 2RHKA 3QMLA 3U4LA 4UY8O 2V52B 1BWFO 5MLCQ 1JJ2M 2BTFA 2QW9A 5TKWA 3FZMA 4CZMA 1M1KO 3IUCA 1VQ5N 4YOUA 2FSKA 4IFEA 4JEPA 4WFAL 4H0YB 4ILHA 1YI2N 3BUZB 3O9TA 5AZIB 5M1PA 4DHYA 3D2FB 2NRWA 3QFPA 4BRHA 3H3NO 1VQPN 3WXKA 1NGGA 5ADXA 1OKJA 1YVNA 3T69A 4BRDA 3TSPA 5E26A 3JS6A 5JVGL 1VQON 3MDQA 2HOEA 3QBXA 3ZX3A 3H46O 4I6MB 2QWOA 2VYPA 4JNEA 5JMVA 5BRHA 5BR9A 4FWKA 1KAYA 3TU5A 3CPWM 3GDQA 1HPMA 4WCEL 1QQOA 4H5VA 4BRCA 3WXLA 4KBOA 4BQLA 2D4WA 1MDUB 3P4IA 4A62A 3ATUA 3C7NA 3CIPA 4ILGB 3WXMB 4CD3A 2KKZA 2Q2RA 1VQ7N 1X9JA 2D0OA 3O08A 4O5FA 5C12A 1Q86O 5JLFA 3OBWA 2QA4N 2FXUA 4BRKA 5AQTA 1ZXOA 3HTVA 3MN7A 1NGEA 3ENOA 5AZJA 1DEJA 1W97L 4H0XB 4FL9A 4KH4A 2ITMA 3U9DA 5KQDA 3NMUA 1D4XA 3A0IX 3M5RA 3C0BA 2WC9A 1ESVA 4K43A 5AQPA 3DJCA 4FWOA 4EHTA 3CC7N 4C23A 3NVKA 4YDUC 5AQRA 4BR0A 4MDBA 5JVHL 4JKAA 4YOYA 1GLJO 1TUUA 3FR0A 3W3DA 4BR4A 2P9IA 1BO5O 1QQNA 1MWKA 3O1BA 4G9ZA 4IXCA 5AR0A 2P9SA 3SBTA 3ULEA 4QS7A 3BEXA 3R1XA 5M1KA 4H0TB 3M6GA 3MX5A 2WUSA 5AQJA 4L3QA 1T3VA 3F5TA 1TYQB 3UKRA 5EX5A 3A5OC 2CH6A 3DXKA 3TSQA 1NMDA 3CJAA 4GV3A 3PIOL 4EHUA 3G71N 4CJ7A 3VTHA 2E88A 2WFBA 2J4RA 4A61A 4CZEA 1VQ9N 4B1VA 5C15A 1BU6O 3HSCA 3UE5A 5M1QA 1GLCG 5BRDA 4OPHA 3E9OA 2AP1A 5JLHA 2JWLA 1YJ9N 2QWQA 5FPMA 3EZWA 4BC4A 2E1ZA 5E84A 5CHIA 2NRVA 4DQ8A 4ISGA 2NZTA 2D1KA 3CCSN 3LM2A 4LC9B 5B8HA 1U6ZA 1J6ZA 3VTIA 4WQ5A 5BPNA 3O9SA 4XH1A 3W0LA 4PKHA 3HI0A 3C6AA 3ENBA 4M7YA 1NGBA 2IIRA 1HKCA 2ZJQL 3D2EB 3P38A 2ZF5O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YF5 L;  2BH1 A;  1W97 L;  5TKW A;  4PHT X; 
#chains in the Genus database with same CATH topology
 2F8S A;  2E2O A;  3NGI A;  2E5L K;  1NM1 A;  1MWM A;  3WEE B;  3HPH A;  4H0P A;  3C95 A;  4B1X B;  3L3U A;  4WQ4 A;  4QCL A;  3F73 A;  5C24 A;  3ATV A;  3FZK A;  4RW7 A;  1Q81 O;  4FLU A;  4EZ9 A;  1NMN A;  1WSI A;  1BHL A;  4R5P A;  3RMC A;  4DR3 K;  4B1W B;  4LF5 K;  3OJS A;  1NG9 A;  4FWR A;  3PIP L;  2HHU A;  1C0U A;  2ITG A;  5HL7 L;  4YOV A;  3AVH A;  4CJP A;  4Q5V A;  5M1O A;  3KVG A;  4CHQ A;  2E1Y A;  2QM1 A;  4FM2 A;  4AM7 A;  1NNE A;  3EO3 A;  4C1N K;  3TAM A;  3K9J A;  3E1Y A;  4H0O A;  1YIT N;  4NCB A;  3QEV A;  5I3U A;  5AFU H;  3EE8 A;  4HUE A;  1Z26 A;  4DMN A;  3O9U A;  1BUP A;  3DRS A;  2OA8 A;  4Z94 A;  4PY5 A;  3LP2 A;  3DXM A;  3QIO A;  4BRG A;  3SQ1 A;  4ZTF A;  4DCH A;  4CZJ A;  1NKB A;  3A8Y A;  3DRR A;  3MX2 A;  3VQB A;  1A5V A;  3ZEU A;  4M3U A;  1UOC A;  4IO8 A;  3T7Z A;  4CFA A;  3K57 A;  4CBW A;  3HST B;  3MWP A;  1N6Q A;  3FZL A;  1IO2 A;  4FJI A;  2KFZ A;  4FK2 A;  3MXI A;  2V7Y A;  1DTQ A;  4F8R A;  4IJN A;  4FO0 A;  2HBJ A;  3WXI A;  2BE2 A;  3KLF A;  3WQU A;  2FSJ A;  4IEE A;  4BC5 A;  1K9M O;  4EP4 A;  5DM6 L;  4BDY A;  1QZ6 A;  3B6O A;  4DTX A;  4JKH A;  1GOA A;  3ZSY A;  3M8Q A;  4YY3 K;  4GKK K;  4JI1 K;  1KD1 O;  3MEG A;  3P39 A;  3QER A;  2DY4 A;  4OPA A;  4JI4 K;  3PO4 A;  3VQP A;  1VHX A;  3UKR B;  2OTL N;  4CEF A;  2FSN A;  5HBM A;  2E20 A;  3CI5 A;  4DQI A;  1GLB G;  1VSE A;  2X6S A;  5AQZ A;  1TKZ A;  2UXC K;  4DR7 K;  4DTO A;  3C65 A;  5KGW A;  3AVG A;  2ETJ A;  1WSF A;  2KTQ A;  5KPR A;  1E3M A;  4HHT A;  3NF8 A;  4BDZ A;  2ASO A;  3GBT A;  3O3H A;  4UQG A;  3L2U A;  5FRM A;  3KWG A;  4F2R A;  3ISN C;  1XHX A;  3THX B;  3IDH A;  4B9S A;  3NGZ A;  1BA1 A;  4CEB A;  4WF9 L;  4JI7 K;  1IBK K;  3U3G A;  3MWT A;  1C1C A;  4BY9 C;  2PAV A;  2QXL A;  1DKG D;  4JKD A;  1IJJ A;  4AM6 A;  1R0A A;  3SAF A;  3HPO A;  4J2A A;  4K8Z A;  4KFB A;  2XO7 A;  4IWV A;  5SWM A;  2HHT A;  4FM0 A;  3H08 A;  2W40 A;  4IO9 L;  3NVM A;  4DR4 K;  4LSN A;  4N56 A;  3EL2 A;  4FZY A;  4NCG A;  4I7F A;  5FDL A;  1SQK A;  2NLX A;  2CGK A;  1NLV A;  2KHO A;  4C8N A;  4WFB L;  3E66 A;  3K5M A;  4A57 A;  3O5B A;  3MCP A;  1X9S A;  1BIS A;  4B3S K;  3VQ6 A;  4K0K K;  4KTQ A;  2YX6 A;  4CER A;  3BZC A;  4JKC A;  3KK7 A;  3VA0 A;  3SMP A;  4BVP A;  2YCH A;  2DFF A;  4JS4 A;  3VEV A;  1G99 A;  1XC9 A;  3AVL A;  1HUX A;  5AQG A;  4O4G A;  2YV0 X;  3PY8 A;  1BL3 A;  2GEL A;  4M41 A;  3G6E N;  2WBN A;  2XY5 A;  4KPY A;  3DXM B;  1I39 A;  1VQ6 N;  1KVA A;  1BQM A;  4ISF A;  4CHZ A;  3J7Z O;  3I8B A;  1N34 K;  5ELZ A;  3FFK B;  3WXJ A;  4AHC A;  3SK3 A;  4KRE A;  5SZT A;  4BRI A;  1EQY A;  3KIO A;  1C0M A;  4ID5 A;  4BRP A;  3ZEU B;  1WSJ A;  5JS1 A;  1TUY A;  1HQU A;  2HST A;  4F2S A;  3G25 A;  1U4B A;  3R9P A;  4J8F A;  4DQS A;  5J2N A;  3ZCM A;  3IRX A;  5J2Q A;  3O4W A;  3VEY A;  2IS3 A;  1W0H A;  1QSL A;  3O8M A;  4Y1D A;  1VQL N;  3DLE A;  2HVH A;  5KTQ A;  3QBW A;  3VF4 A;  3NBP A;  2P9P A;  1RTH A;  5EU7 A;  1Z6R A;  3LWM A;  2QTD A;  3ZT4 A;  5IT9 O;  4CJL A;  5AQW A;  1ATN A;  3ZET A;  3HYF A;  3VEW A;  1NGI A;  4CHY A;  3QLH A;  4CBX A;  3KK3 A;  3PV8 A;  1KAX A;  5D3G A;  4ICL A;  3CCU N;  1EO1 A;  2HMP A;  3LDN A;  3OS2 A;  5DK5 A;  2OZM A;  2VCP A;  4Y0W A;  5AJ3 K;  2E2P A;  4CIG A;  5FPE A;  5GIO A;  4B1Z A;  4BC2 A;  1O13 A;  2OPR A;  1GLL O;  4XH5 A;  4RW8 A;  4DB3 A;  4O8U A;  4YOR A;  2HBM A;  4CJF A;  4DV1 K;  2HB5 A;  4R79 A;  1ZBH A;  4GKJ K;  3OW2 M;  4YHH K;  3HK2 A;  1TK0 A;  4CHP A;  4WQ4 C;  5HRR A;  4JI3 K;  4W5Q A;  3LP3 A;  5M1N A;  4AF1 A;  4IJA A;  3SUQ A;  4E89 A;  2Q36 A;  3DLR A;  4JLH A;  4NYF A;  3ZT2 A;  1X9W A;  1NBW A;  3O3G A;  3ZLJ A;  3QIP A;  2OZS A;  3SPZ A;  1RDD A;  4ILJ A;  4A2B A;  2PYJ A;  2JGU A;  4BRQ A;  1RT6 A;  3CJ9 A;  1LW2 A;  1WSH A;  4BAC A;  1Q7Y O;  3PLA A;  4CEA A;  1YHQ N;  2E6L A;  2P9N A;  2DPN A;  5I42 A;  1ZBL A;  1FKO A;  2D0P A;  1HMV A;  4E1J A;  3VQD A;  4DS5 A;  5BPM A;  1RBT A;  3FZH A;  2UUA K;  4X65 K;  4JI6 K;  1JCG A;  2WTU A;  3CCE N;  4KKO A;  3LDL A;  1L3U A;  5LJV A;  3CHW A;  4JKG A;  2HW3 A;  5AQQ A;  2O8F A;  5FPN A;  2RN2 A;  4DF4 A;  3G4S N;  1Q8I A;  3CM6 A;  3EYZ A;  4A5A A;  4AIL C;  4CF0 A;  1WNS A;  1YT3 A;  2F96 A;  2QK9 A;  4FCY A;  1WAF A;  1QSY A;  4FK0 A;  3QML A;  4UY8 O;  5E41 A;  2V52 B;  1JJ2 M;  5MLC Q;  5LL6 Z;  3DRP A;  2BTF A;  5C25 A;  5TKW A;  4DUY K;  2VG5 A;  1QQC A;  3CFO A;  1VSI A;  1M1K O;  5LMN K;  4Z0U A;  1VQ5 N;  2Z1G A;  1Y97 A;  2VWK A;  4NYN A;  5AZI B;  4CJK A;  1YVN A;  4B9T A;  3TR8 A;  2QKB A;  4B8C A;  2HOE A;  3ZX3 A;  3H46 O;  1TVR A;  4FYD A;  3OYJ A;  3CPW M;  1IH7 A;  2YNG A;  1QQO A;  1HR0 K;  4CFC A;  4KBO A;  4BQL A;  3HL8 A;  1ZBI A;  3ATU A;  1ASU A;  3WXM B;  3HM9 A;  2Q2R A;  3O08 A;  2D0O A;  4O5F A;  4OJR A;  1EP4 A;  1Q9X A;  3HTV A;  5AZJ A;  1DEJ A;  4H0X B;  4KHW A;  1HYZ A;  3JSM A;  5KQD A;  1EXQ A;  2UUC K;  3NDK A;  3DJC A;  4FWO A;  1D5A A;  4EHT A;  4C23 A;  4W5O A;  3CC7 N;  2DFH A;  4DTS A;  4O44 A;  4PWD A;  3SUO A;  3KLE A;  1QQN A;  1W9H A;  3OYL A;  4G9Z A;  4IXC A;  4RW9 A;  4H0T B;  5C42 A;  3NH0 A;  5EX5 A;  2CH6 A;  4DTM A;  2WOM A;  3VQ9 A;  4EHU A;  4CJ7 A;  2XY7 A;  2J4R A;  4B1V A;  1VSM A;  3UE5 A;  2AP1 A;  1YJ9 N;  4NXM K;  1BI4 A;  3AO5 A;  3CCS N;  1KCF A;  2Z1H A;  3VTI A;  4FVM A;  4IBN A;  4FLW A;  2A1S A;  3CYM A;  3OYE A;  1NGB A;  2IIR A;  1HKC A;  2ZJQ L;  1IBM K;  1SUQ A;  4DV5 K;  1OVQ A;  2OAN A;  2P9N B;  1KC8 O;  2BAN A;  1VQ4 N;  3WUH A;  1U45 A;  4BG9 A;  3OYD A;  4HCC A;  1NGH A;  3C6U A;  1DLO A;  4DR2 K;  2G8I A;  4IEI A;  4DV3 K;  1ZC6 A;  5KRT A;  3RRH A;  4JKG B;  2YNI A;  2FLO A;  3LPU A;  3MXJ A;  2O8F B;  5JS2 A;  2ASP A;  2Q0R A;  2A3Z A;  1HJO A;  2KQ2 A;  3L6Q A;  3AA5 X;  1QTM A;  3OYI A;  4E7H A;  4KH5 A;  2IVO A;  3HM8 A;  4DTP A;  2Q97 A;  1RBS A;  3VGL A;  4FOI A;  3VF2 A;  4CEQ A;  1N32 K;  1JL2 A;  2CGL A;  3SAG A;  4BRN A;  3VQ7 A;  3VEX A;  4Z4I A;  5AQF A;  1C0F A;  1TKT A;  4H5W A;  4NLB A;  4OGE A;  4H4O A;  2P5O A;  1VAZ A;  1CXQ A;  1JCE A;  1RBU A;  1QZ5 A;  1OH8 A;  3K5N A;  2BGG A;  4CZG A;  2CGJ A;  2GWJ A;  3AAQ A;  1NK8 A;  1T05 A;  5AQU A;  5K14 A;  4CZF A;  1SL1 A;  4QS8 A;  4BDP A;  4OX9 K;  1JLE A;  1SS6 A;  1NK5 A;  1A5W A;  4FLY A;  4KV8 A;  4U67 L;  3TWH A;  1KQS M;  3LZJ A;  4FWQ A;  4BRL A;  1H1V A;  4KHU A;  4JK8 A;  3NAE A;  5AZJ B;  3GE1 A;  3QDK A;  4YFU A;  3HP9 A;  5HRN A;  2ZJR L;  4FJX A;  4OLB A;  5GIN A;  5AQI A;  1L3T A;  5BR8 K;  2O4I A;  2HF4 A;  2KZM A;  4BGB A;  3V9S A;  2QWM A;  3CD6 N;  1RDA A;  2FBT A;  4IKF A;  2YKM A;  1S22 A;  2PYL A;  1KVC A;  4H0V B;  5J2M A;  1GLD G;  3K5O A;  2A6A A;  4EP5 A;  2NRH A;  4IZ9 A;  3WT0 A;  1VQK N;  1QVF M;  4GMJ B;  3NHG A;  4PL7 A;  3SQ2 A;  3ID8 A;  1FXX A;  4A2A A;  1RCH A;  2W41 A;  3CQX A;  3VN5 A;  4DLE A;  4BC3 A;  3SPY A;  1BI4 B;  3D6R A;  4DSI A;  2YI1 A;  3ZSQ A;  1S1U A;  4Q0B A;  3M3Z A;  2FF3 B;  3THW B;  3PSF A;  1S1T A;  3AGR A;  4Z4F A;  4FJ5 A;  1RDU A;  3KD5 E;  2P9L A;  1NGD A;  4EFH A;  1RFQ A;  4JRQ A;  1UAX A;  3ZX0 A;  4J2B A;  3EKS A;  3CJC A;  5GAG P;  4FLV A;  3I8D A;  3L2Q A;  3BZK A;  3V9U A;  2Q3S A;  1HJR A;  3LAK A;  3L2V A;  3QES A;  5C2F A;  3TI0 A;  1E4F T;  5EY4 A;  2QI2 A;  1XNQ K;  4JN4 A;  2VQE K;  1LWE A;  1BA0 A;  2A41 A;  4NO7 A;  2GTD A;  5AQO A;  2GUP A;  2HBL A;  3PX4 A;  1UA0 A;  2YHY A;  3SAH A;  5BPL A;  2BDP A;  3U8X A;  2IOC A;  2EWS A;  2V51 B;  3MN6 A;  3EKU A;  3LDQ A;  3MEE A;  2YHX A;  4NXN K;  3VQ4 A;  4NCA A;  3TTC A;  2QEX N;  1BQN A;  1RT5 A;  1NGA A;  4BVO A;  2UU9 K;  1U48 A;  5AQX A;  4X66 K;  4ELT A;  3D0P A;  2FC0 A;  3QEX A;  4B3O A;  4M45 A;  5A2Q O;  3OBY A;  3OYF A;  3SQ4 A;  4IFV A;  2GEM A;  4F9O A;  4DTN A;  4M63 C;  3MAQ A;  5J1E A;  1MU2 A;  1TGO A;  4GV9 A;  4KTW A;  5GAH P;  3IKM A;  2F8T A;  4FJM A;  3OTO K;  5KPZ A;  4I6M A;  1XI1 A;  3RVC A;  3MMV A;  1JKH A;  4ELV A;  3AO1 A;  3HVR A;  3LWL A;  1NJI O;  1SKS A;  4F3O A;  4DS4 A;  1TKD A;  2O8D A;  2XRI A;  1QVG M;  3TSU A;  4K42 A;  1NK9 A;  1WB9 A;  4IG3 A;  3DAW A;  3IAY A;  5T7B A;  3KZB A;  4GNI A;  3P83 D;  4DWI A;  3N4Q A;  3OYN A;  3B8A X;  3BGR A;  5JIC A;  1ASW A;  3DLB A;  3ITH A;  1BOT O;  3L2W A;  3HP6 A;  1KVB A;  2QWN A;  1XMQ K;  1QE1 A;  4IDK A;  5HLF A;  1ATS A;  3DLL L;  4W5R A;  1VRU A;  4JV5 K;  4MQ3 A;  3HOT A;  3LP1 A;  1S1X A;  4BR5 A;  3MXM A;  1YTA A;  1F21 A;  4ISE A;  1YXQ A;  3U9Z A;  2G8U A;  3VGM A;  1JLA A;  3NCI A;  4KHP K;  5HRP A;  3DM2 A;  4KH6 A;  5C10 A;  4GY2 B;  1TYQ A;  3R6M A;  3KWI A;  4FSV A;  4JS5 A;  3NGY A;  2VG7 A;  1DTT A;  4JI5 K;  3H3O B;  3V1O A;  4BQZ A;  5CYM A;  4CK2 A;  3S41 A;  3K0S A;  2P9L B;  2I7P A;  4CGH A;  3ENH A;  4BGA A;  3GL1 A;  3VGK A;  3LP0 A;  4NLC A;  2P9K A;  2HHH K;  1T03 A;  4K25 A;  1NJW A;  3C6T A;  1L3V A;  1YTU A;  3HJF A;  4DFJ A;  1CZA N;  1R59 O;  1VRT A;  4CEZ A;  1RDW X;  3OJU A;  1NGJ A;  4H5T A;  2GV9 A;  3A5N C;  4BWJ A;  3VF6 A;  1BGX T;  4CD1 A;  3LAL A;  2KW4 A;  1L5U A;  3ZT1 A;  2YJE A;  2B6A A;  2YNH A;  1YUW A;  2IVP A;  4PL8 A;  3FLC O;  3TAR A;  2YKN A;  3Q7B A;  4FWL A;  3JAM O;  2PBD A;  3SMS A;  4B8A B;  1SL0 A;  1V4S A;  3TAN A;  2RHK A;  4B9V A;  3OYM A;  3V9W A;  3ULD A;  1IKY A;  3FZM A;  4CZM A;  4B3T K;  4CF8 A;  4E7L A;  3IUC A;  2FSK A;  1IKW A;  1HNV A;  1JLC A;  4JEP A;  4H0Y B;  3BUZ B;  3O9T A;  4M3W A;  4CF9 A;  2NRW A;  3QFP A;  4BRH A;  1VQP N;  3WXK A;  5ADX A;  4CJ3 A;  4DSF A;  5E26 A;  3JS6 A;  5CY4 A;  5JVG L;  4ELU A;  3QBX A;  1B9F A;  4LH5 A;  4I6M B;  2QWO A;  4CGD A;  3NF7 A;  5BR9 A;  4E7J A;  3TU5 A;  3NH2 A;  4ID1 A;  3O3F A;  4WCE L;  2O8D B;  4H5V A;  4KHS A;  4DTJ A;  2D4W A;  1A5X A;  1ITG A;  1RT1 A;  3P4I A;  2FBY A;  3C7N A;  4A62 A;  4AHS A;  4CD3 A;  2ZD1 A;  1Q86 O;  2UUB K;  3ENO A;  4IG0 A;  1VSF A;  4CEC A;  3NMU A;  3U9D A;  4C8O A;  3K5L A;  1C0T A;  1D4X A;  3NF6 A;  4K43 A;  2WC9 A;  3KD1 E;  4IFY A;  3NVK A;  5AQR A;  4BR0 A;  5JVH L;  4LF8 K;  1RIL A;  4AHR A;  4LF6 K;  3ZSV A;  3L8B A;  1MWK A;  2P9S A;  3ULE A;  1EKE A;  1G15 A;  1UA1 A;  3BEX A;  1KTQ A;  2G8K A;  4M3T A;  4DV6 K;  5AQJ A;  4L3Q A;  1C1B A;  1TYQ B;  3KTQ A;  1X9M A;  3S3M A;  3TSQ A;  3DXK A;  4F3T A;  4FW2 A;  3G71 N;  4CGJ A;  3VTH A;  4DFK A;  2A1R A;  1VQ9 N;  1FK9 A;  3ZT3 A;  5C15 A;  1GLC G;  5BRD A;  4C8M A;  1CZ9 A;  1TAQ A;  3V1R A;  5FPM A;  3O4Q A;  2NRV A;  3M8R A;  1LAV A;  4ISG A;  2NZT A;  3P1G A;  2RPI A;  5KI6 A;  1U6Z A;  4WQ5 A;  5BPN A;  3O9S A;  4XH1 A;  4BWM A;  1NKC A;  4PKH A;  3HI0 A;  3OYA A;  2HNZ A;  4FJJ A;  4RW4 A;  3LPT A;  3P38 A;  3ZSR A;  3ZT0 A;  1VQ8 N;  3S9H A;  4MLH A;  4LD0 A;  3OYG A;  4OKE A;  4HVJ A;  2G8V A;  2HBK A;  3MCA B;  1YJW N;  5CR4 A;  3KLH A;  1JL1 A;  3E9P A;  3SV3 A;  3ZSW A;  4B1Y B;  1WSE A;  1B9D A;  4JK9 A;  4O0J A;  1GOC A;  3CM5 A;  3L2R A;  1NOZ A;  2A5X A;  3FZF A;  3CET A;  4B9M A;  3SQ0 A;  3A5M C;  2CH5 A;  3U3Y A;  4O8K A;  4XH4 A;  4CEE A;  2KFN A;  4B3M K;  4LY7 A;  4BG8 A;  3K9K A;  1KFD A;  1OH5 A;  1BDG A;  3J81 O;  3QEW A;  3ALY A;  3AO4 A;  3H1Q A;  3ID6 A;  3T1A A;  3KKS A;  2ASM A;  3V9Z A;  4OGC A;  3J80 O;  2LSN A;  3LDO A;  1OH7 A;  2W6K A;  4LFB K;  2BUP A;  4DKW A;  2R7Y A;  4GW6 A;  2D5R A;  3QNO A;  3WQT A;  5ADX H;  2V7Z A;  4CBU A;  4WYB A;  1GLF O;  2VGM A;  1T8E A;  2HHW A;  3SCX A;  4L8R B;  3OYC A;  3M1F A;  1S1V A;  3G10 A;  4CIF A;  1KLM A;  3TAB A;  4FJG A;  3VET A;  4DUZ K;  5KQ8 A;  2P9P B;  4FXD A;  3SYZ A;  3C7N B;  3PX0 A;  3V1Q A;  3QEI A;  2RKI A;  3ZET B;  5BN8 A;  2NRX A;  3MED A;  4CJE A;  5FRO A;  1RDC A;  2VG6 A;  4FJN A;  3IFR A;  3VES A;  2X6N A;  4KO0 A;  3O80 A;  5AQS A;  3VOV A;  4IOA L;  4FLT A;  3S3N A;  3DMJ A;  3H6E A;  4MO5 A;  2P9S B;  4MFB A;  3CMA N;  3CPE A;  4MO4 A;  3D7E O;  4CJR A;  1RT7 A;  4XIU A;  3AA4 A;  3DLK A;  4BRF A;  3QET A;  3DXK B;  1U2V A;  4KHY A;  3ZSX A;  5AQV A;  3NH1 A;  1MA9 B;  1U04 A;  4B9L A;  4HTL A;  1LCU A;  3RMD A;  2W42 A;  4PKI A;  1U47 A;  4FM1 A;  2GWK A;  2PY5 A;  4FZX C;  3VA3 A;  2G8H A;  4DG1 A;  4YDU A;  2F9W A;  3I33 A;  4Z4E A;  1OVY A;  3V4I A;  1FJG K;  1J9A A;  1TL3 A;  3V6D A;  5C0Y A;  4FJ7 A;  4I9L A;  4DU1 A;  1HKB A;  2AJQ A;  1GOB A;  4CJT A;  3VMF B;  4CK1 A;  3OHR A;  1NK6 A;  3NF9 A;  4GVM A;  3T19 A;  3CCJ N;  3LZI A;  5BRE A;  4YOX A;  1EWR A;  1XMO K;  4WFN L;  3HOS A;  3OY9 A;  4CES A;  4JD2 A;  3RRG A;  1VSK A;  5CYQ A;  3UKU A;  5M1F A;  5AQL A;  4CK3 A;  4LFA K;  4FPB A;  1KFS A;  1J54 A;  1BCO A;  3QIC A;  4JAX A;  1XHZ A;  3AVF A;  4Z4G A;  2Y1I A;  2H3G X;  3E01 A;  3LAN A;  3VPZ A;  4OKK A;  1N33 K;  2OTJ N;  4N5S A;  1E4G T;  4MDA A;  4HWI A;  5KGX A;  3OS1 A;  4GVE A;  3CQ8 A;  3P31 A;  1DGK N;  3HXM A;  4BRE A;  4ZTJ A;  5F2R A;  1C0G A;  3THV A;  2IGI A;  1GLE G;  1ZYQ A;  2NUB A;  1VSH A;  2W6L A;  4WE1 A;  4N76 A;  3CCM N;  2OPP A;  3D45 A;  1Q82 O;  5AFU A;  1ZBF A;  3D2F A;  3VEZ A;  3HVT A;  4HUF A;  3J8A A;  3CJ1 A;  3K2P A;  2E8A A;  3IG1 A;  4ZHR A;  5KPT A;  1JLG A;  3RR7 A;  2NRZ A;  4QS9 A;  3CCL N;  2YHW A;  4DV2 K;  1JCF A;  2ZWH A;  1GLA G;  1ZBS A;  3VQQ A;  3BDP A;  4E0D A;  2EHG A;  3KJV A;  3KKR A;  4AH9 A;  4CW7 B;  1WAJ A;  3H45 C;  3VQE A;  3AY9 A;  2B4J A;  4CVN E;  2P1J A;  5DM7 L;  3DWL A;  3GG4 A;  4B9Q A;  4CF1 A;  4B08 A;  4CED A;  3PO5 A;  2ZGY A;  3CME N;  4BR7 A;  4DSJ A;  4E3S A;  3P5J A;  4DV4 K;  1NJX A;  2Q0U A;  1U2V B;  5C2D A;  4WQ5 C;  1W7A A;  2X78 A;  2ZM6 K;  3LDP A;  4DF8 A;  3ZSO A;  1V4T A;  4RW6 A;  4LSL A;  1XQS C;  4IDH A;  2O4G A;  4DFP A;  3SJH A;  4DSK A;  2E2N A;  2EX3 A;  1XWL A;  3AAR A;  3I0R A;  3QNN A;  4CJ4 A;  5AQY A;  2NRT A;  1T44 A;  4H8K A;  3UB5 A;  2IDO A;  3ZSZ A;  1RT4 A;  3TTF A;  4CJU A;  5CZ2 A;  2UXB K;  2IAJ A;  1U49 A;  1IBL K;  5LY3 A;  3V81 A;  2RE2 A;  3EN9 A;  3UIQ A;  4B9N A;  4DV7 K;  1SL2 A;  3L3V A;  1T6C A;  1BIU A;  1HNZ K;  1C1A A;  5BN9 A;  3CCV N;  1ZBU A;  3CC2 N;  1WLJ A;  2QWL A;  2ZQB A;  1WUA A;  3D2E A;  3JXU A;  1WOQ A;  2HNY A;  4H03 B;  2F7T A;  3RSE A;  3WNF A;  1P8Z A;  1Y64 A;  5AQM A;  4PA1 A;  3CJ7 A;  3HBT A;  5HP1 A;  1HPZ A;  4JD2 B;  4HCB A;  4M3X A;  4RWT A;  4E1N A;  2RF2 A;  3UKU B;  4BRA A;  1QHT A;  1SKR A;  3L4Q A;  3RMA A;  2Q31 A;  1K73 O;  2HHQ A;  4M3Y A;  2UYT A;  4LH4 A;  2QWR A;  5EVZ A;  1YAG A;  1IV0 A;  4DLG A;  3RMB A;  2PZS A;  1KSP A;  3CXC M;  3CF5 L;  1VQN N;  4M7X A;  4KB1 A;  3JYT A;  3AAP A;  1BWF O;  3AVN A;  4CF2 A;  1FKP A;  3FFI A;  3CFR A;  4CGG A;  4CHO A;  4CE9 A;  4K8X A;  4IFE A;  3D2F B;  1IG9 A;  3H3N O;  3AV9 A;  4E19 A;  4O0I A;  1NGG A;  1TV6 A;  1OKJ A;  3T69 A;  3TSP A;  1VQO N;  4QOZ B;  3MDQ A;  4KRF A;  2KZZ A;  4JNE A;  5JMV A;  3B6P A;  1RT2 A;  2Z1I A;  5BRH A;  4FWK A;  3GDQ A;  1MDU B;  2FBX A;  3CIP A;  4ILG B;  4F4K A;  4V19 S;  3OBW A;  2QA4 N;  4BRK A;  3AVB A;  5AQT A;  3MN7 A;  4FL9 A;  2ITM A;  1ESV A;  4G1Q A;  1CXU A;  5AQP A;  4JI2 K;  4CJV A;  4YDU C;  3QIN A;  4MDB A;  4JKA A;  4YOY A;  1GLJ O;  3FR0 A;  3W3D A;  4BR4 A;  3T3F A;  2P9I A;  1BO5 O;  2XY6 A;  2YNF A;  3SBT A;  4QS7 A;  1LV5 A;  3M8S A;  3M6G A;  3MX5 A;  2G8W A;  1NMD A;  3PIO L;  1JXE A;  2E88 A;  4A61 A;  3DOK A;  4N41 A;  1BU6 O;  3HSC A;  3I0S A;  5M1Q A;  3DI6 A;  4OPH A;  5JLH A;  2JWL A;  1XNR K;  3AVJ A;  1J5O A;  3KLG A;  2E1Z A;  4PUO A;  4DQ8 A;  1EX4 A;  4DU4 A;  1NU0 A;  2D1K A;  1Q9Y A;  4E1M A;  4I9Q A;  2DTU A;  3AVK A;  3VQ5 A;  2O8E A;  2GBZ A;  3OYH A;  2YHB A;  2UXD K;  4DQR A;  3DYA A;  4B3R K;  2E6M A;  4LFC K;  3D2E B;  3RSE B;  2ZF5 O;  3RR8 A;  1X3M A;  1RT3 A;  2XY8 A;  2ZGZ A;  1XC3 A;  3VQA A;  4FWM A;  4BE2 A;  4JK7 A;  3AGK A;  4I2P A;  1QQM A;  4N47 A;  3BF1 A;  1RGI A;  4CCH A;  3O9R A;  1ATR A;  4DSE A;  3BP8 A;  4RTF D;  4FJ8 A;  4DFM A;  3M8P A;  3HT3 A;  3RTV A;  4DR1 K;  2BH1 A;  3SBG A;  1SAZ A;  2HHS A;  3PSI A;  4FWS A;  1IKX A;  3EEQ A;  1KXP A;  1KRP A;  1C6V A;  4C1N I;  2HHV A;  3AVC A;  3THY A;  4GV6 A;  1NOY A;  2YHA A;  4CI6 A;  4XEI A;  4DTR A;  3FE1 A;  3LM9 A;  4PHT X;  2P9U A;  1X1P A;  3L0Q A;  4NB4 A;  2Q1N A;  1VSL A;  3TAE A;  1HX1 A;  4CEO A;  3AA3 A;  4IOC L;  2ZJP L;  1RNH A;  4MLE A;  5AZI A;  3S3O A;  1NGF A;  5GAD P;  4M3Z A;  3BY5 A;  1YF5 L;  3VER A;  1N8R O;  1RTD A;  1I3A A;  5KRS A;  3MEC A;  4JYA K;  1KLN A;  4OPK A;  1HLU A;  3AO2 A;  3ZX2 A;  3SZ2 A;  4DSL A;  1K6Y A;  4M42 A;  1VK0 A;  3T1Y K;  4A59 A;  1NJY A;  3K58 A;  1SV5 A;  3HRG A;  3MN9 A;  1YJN N;  1T6D A;  4JKF A;  3CCQ N;  3EY1 A;  4FPA A;  4KI6 A;  1K8K A;  3HZ6 A;  2P9I B;  1S72 N;  2XHB A;  1IG8 A;  4LF4 K;  1YIJ N;  4JI0 K;  1HNW K;  4YOW A;  1HNX K;  3TTD A;  1LOT B;  3SJJ A;  4K41 A;  5CZ1 A;  4CZI A;  1TL1 A;  3CJB A;  3QB0 A;  1M90 O;  4TSX A;  5FRN A;  1HKG A;  3FGU A;  5AQH A;  1S3X A;  3E9L A;  4JI8 K;  5LMU K;  1D9F A;  2D0B A;  3SUN A;  4FJH A;  4CZH A;  3U6F A;  3C6H A;  3A2F A;  3QO9 A;  2AA4 A;  4X62 K;  3R8E A;  4M3R A;  1DT9 A;  1X3N A;  3CFP A;  3VEN A;  1JLB A;  5EOY A;  2O8E B;  5FPD A;  3LDS A;  2P9K B;  3AO3 A;  4CZL A;  3OA9 A;  4FW1 A;  4J2E A;  3AVA A;  3F9M A;  2ZE2 A;  1QSS A;  2NRR A;  3VQ8 A;  5TKY A;  2GUI A;  4H5R A;  4FLX A;  3PUF A;  4CFB A;  2GX9 A;  1LWF A;  5J2P A;  4EAH D;  3QEP A;  1CLQ A;  1TKX A;  2P5G A;  2OPQ A;  2JWK A;  4O55 A;  3K59 A;  3LL3 A;  1N5Y A;  3EE9 A;  2OCE A;  4JKB A;  1RTJ A;  1Z05 A;  2YJF A;  1BIZ A;  4IOX A;  3CC4 N;  1WN7 A;  5HRO A;  4EIA A;  1VSD A;  2E4L A;  3ZYY X;  4BR9 A;  2HHX A;  2G8F A;  3N4P A;  3GOI A;  1NJZ A;  4FJK A;  1WSG A;  4JHD A;  4DR5 K;  4W5T A;  3SI6 A;  3I55 N;  3TAG A;  3OVN A;  2E2Q A;  3KLI A;  4JKE A;  3R3L A;  3THY B;  1HQE A;  5LJW A;  4OO1 J;  4E7K A;  3CQY A;  1Q18 A;  3MK6 A;  5BRF A;  5H1S Q;  3VEO A;  2P9U B;  2VGN A;  3H1V X;  4BRM A;  4CHN A;  1UWB A;  4HUG A;  2FF6 A;  3CG7 A;  4CGF A;  5F0X A;  2A40 A;  3OYK A;  3A5L C;  2F9T A;  1RBR A;  4AHU A;  4LF9 K;  4X64 K;  3I56 N;  1S6Q A;  4RG8 A;  4A5B A;  2X74 A;  1EET A;  5HOO A;  1SKW A;  4FWP A;  1HYS A;  1ILY A;  4BE1 A;  1D9D A;  3HPG A;  4QAG A;  3IMX A;  2Z1J A;  3NFA A;  5AQK A;  5EXW A;  2F4V K;  1IKV A;  4H4M A;  1K8A O;  1L3S A;  1XUP O;  3F2K A;  1EWQ A;  1W2B M;  3TPQ A;  1B92 A;  4U7B A;  1Z25 A;  1K8K B;  3O4N A;  1J5E K;  4PQU A;  2HF3 A;  1T7P A;  3L4I A;  3ULE B;  4BRO A;  1SZ2 A;  4KTZ A;  3SV4 A;  2HND A;  4RCH A;  3RWU A;  4CJ5 A;  2I5J A;  1JLQ A;  4CGI A;  5CE3 A;  5GIP A;  2JLE A;  4FLZ A;  2O8C A;  5AQN A;  3O6W A;  1KAZ A;  4EZ6 A;  2VWB A;  2A42 A;  2VQF K;  3SNN A;  2O8B A;  2Y1J A;  1VQM N;  4OLA A;  4KI4 A;  4CZK A;  2FBV A;  3O9Q A;  3V9X A;  1QHA A;  4YOT A;  1BCM A;  1QS4 A;  3C94 A;  2VWJ A;  5GAE P;  4AHT A;  4PKG A;  1P90 A;  3CCR N;  2NNW A;  1J53 A;  1TAU A;  4FOE A;  3O1W A;  3AA2 A;  1VSJ A;  4BR2 A;  1LWC A;  1RBV A;  4LF7 K;  2D0C A;  3ASM A;  3DLH A;  3SLC A;  4I2Q A;  3J7Y P;  3THW A;  1BG3 A;  1S5J A;  3QFU A;  2PFU A;  2KLA A;  4FWN A;  3EZ5 A;  3MN5 A;  1CZB A;  4CFD A;  3BF3 A;  2QXF A;  1S9E A;  2WON A;  1NWK A;  4FK4 A;  1HRH A;  5IWA K;  4CIE A;  3WEE A;  2D0A A;  3WNH A;  1NK0 A;  1NK7 A;  4AQY K;  3CER A;  4B1U B;  4FJ9 A;  1JLF A;  3OS0 A;  3KHY A;  3KK1 A;  2QWP A;  4KAZ A;  5HRS A;  4JHD B;  4AHV A;  4DQP A;  1NGC A;  3HO1 A;  3F9K A;  3T1H K;  4CJS A;  5I9E B;  2QKK A;  3J7A P;  1S6P A;  1RTI A;  4DV0 K;  4FVU A;  4KHN A;  4H5N A;  3Q7C A;  2I7N A;  3TAQ A;  3VQC A;  3KK2 A;  2IVN A;  4Z4C A;  3U4L A;  4E7I A;  4FJL A;  2QW9 A;  1HNI A;  3PX6 A;  3TAF A;  1OH6 A;  4HTU A;  4FZZ A;  4OKJ A;  4W5N A;  2P51 A;  1NKE A;  2B5J A;  4YOU A;  4B9U A;  3AVM A;  4WFA L;  3IS9 A;  4ILH A;  1S1W A;  1YI2 N;  5M1P A;  3DOL A;  4DHY A;  4J2D A;  3LAM A;  4BRD A;  4KHQ A;  3WNG A;  3OYB A;  1FW6 A;  1RDB A;  4Z4H A;  4CJW A;  2VYP A;  1KAY A;  1HPM A;  5FLX O;  1LAW A;  2OPS A;  4BRC A;  3WXL A;  3WNE A;  2KKZ A;  1VQ7 N;  2ATQ A;  1X9J A;  4YNQ A;  2HMI A;  4CJQ A;  5C12 A;  4C8K A;  5JLF A;  1O1W A;  2FXU A;  4DTU A;  1ZXO A;  3NE6 A;  1NGE A;  1W97 L;  3G0Z A;  4KH4 A;  4DR6 K;  3A0I X;  1S9G A;  3M5R A;  1LW0 A;  3C0B A;  4OPJ A;  4KB0 A;  3TAP A;  1NK4 A;  3SUP A;  2O8C B;  1WBD A;  1TUU A;  1ASV A;  3O1B A;  2OYQ A;  5AR0 A;  2O8B B;  3R1X A;  5M1K A;  3AVI A;  2HVI A;  2WUS A;  1JXB A;  1T3V A;  3F5T A;  3UKR A;  4BE0 A;  2IC3 A;  3A5O C;  4GV3 A;  3CJA A;  1I94 K;  4OVL A;  2WFB A;  5DMR A;  4CZE A;  1WBB A;  1N36 K;  1HYV A;  3E9O A;  1YVU A;  1TK8 A;  2QWQ A;  4DQQ A;  2DFE A;  3EZW A;  4BC4 A;  5E84 A;  5CHI A;  3LM2 A;  4LC9 B;  5B8H A;  4O5B A;  1D8Y A;  1J6Z A;  4JRP A;  3W0L A;  1REV A;  4Y1C A;  3C6A A;  3ENB A;  4DU3 A;  4M7Y A;  3DLG A;  3THX A;  1TK5 A;  4C8L A;  5F1X A; 
#chains in the Genus database with same CATH homology
 1X3M A;  2E2O A;  4MLH A;  2OAN A;  1NM1 A;  2P9N B;  1MWM A;  2HBK A;  2ZGZ A;  3MCA B;  3WUH A;  1YJW N;  1KC8 O;  1XC3 A;  5CR4 A;  3WEE B;  4FWM A;  1VQ4 N;  4JK7 A;  4BG9 A;  1NGH A;  4H0P A;  3AGK A;  1QQM A;  3E9P A;  5ADX H;  3BF1 A;  4B1X B;  4B1Y B;  4JK9 A;  4IEI A;  1RGI A;  4WQ4 A;  1ZC6 A;  1ATR A;  3O9R A;  4JKG B;  2FLO A;  3BP8 A;  4RTF D;  2ASP A;  2Q0R A;  2A3Z A;  1HJO A;  3ATV A;  3FZK A;  3L6Q A;  1Q81 O;  2A5X A;  3FZF A;  4KH5 A;  2IVO A;  3CET A;  3A5M C;  2CH5 A;  3HM8 A;  4O8K A;  2Q97 A;  4XH4 A;  3VGL A;  4FOI A;  4BG8 A;  2BH1 A;  3SBG A;  4B1W B;  1SAZ A;  3VF2 A;  3K9K A;  2CGL A;  3SAG A;  1BDG A;  4FWS A;  4BRN A;  3VEX A;  4FWR A;  3PIP L;  1KXP A;  3H1Q A;  5HL7 L;  3ID6 A;  4YOV A;  5M1O A;  5AQF A;  2ASM A;  4C1N I;  3KVG A;  1C0F A;  2E1Y A;  2QM1 A;  4H5W A;  4NLB A;  3LDO A;  4AM7 A;  3EO3 A;  4C1N K;  1YIT N;  3K9J A;  3E1Y A;  4H0O A;  4GV6 A;  1VAZ A;  4CI6 A;  4XEI A;  5AFU H;  2BUP A;  3EE8 A;  4DKW A;  1JCE A;  1QZ5 A;  3FE1 A;  1BUP A;  3LM9 A;  3O9U A;  4PHT X;  2P9U A;  4Z94 A;  3WQT A;  3L0Q A;  4CZG A;  2CGJ A;  2V7Z A;  3DXM A;  4NB4 A;  2GWJ A;  1GLF O;  2Q1N A;  2VGM A;  3AAQ A;  4WYB A;  4BRG A;  4CBU A;  5AQU A;  4CZF A;  1HX1 A;  3M1F A;  4IOC L;  2ZJP L;  4DCH A;  4CZJ A;  3VET A;  4QS8 A;  4MLE A;  5AZI A;  3A8Y A;  5KQ8 A;  2P9P B;  1NGF A;  1SS6 A;  3MX2 A;  5GAD P;  1YF5 L;  3VER A;  3ZEU A;  1N8R O;  3C7N B;  4U67 L;  4IO8 A;  3T7Z A;  1KQS M;  1HLU A;  4CBW A;  4FWQ A;  4BRL A;  3MWP A;  3ZX2 A;  1H1V A;  3FZL A;  3ZET B;  5BN8 A;  4JK8 A;  2NRX A;  5AZJ B;  2V7Y A;  3GE1 A;  4IJN A;  4FO0 A;  2HBJ A;  3QDK A;  4A59 A;  3WXI A;  3HRG A;  3WQU A;  3MN9 A;  2ZJR L;  2FSJ A;  1T6D A;  1YJN N;  4IEE A;  4JKF A;  3CCQ N;  4BC5 A;  1K9M O;  5GIN A;  3IFR A;  3VES A;  4FPA A;  5AQI A;  5DM6 L;  3O80 A;  1QZ6 A;  2HF4 A;  4BGB A;  3RSE B;  1K8K A;  5AQS A;  3VOV A;  3HZ6 A;  4JKH A;  4IOA L;  2P9I B;  1S72 N;  1IG8 A;  2QWM A;  3CD6 N;  1YIJ N;  3H6E A;  4MO5 A;  2P9S B;  4YOW A;  3TTD A;  1LOT B;  1S22 A;  3CMA N;  4K41 A;  1KD1 O;  3CPE A;  4MO4 A;  3D7E O;  3P39 A;  4CZI A;  3QB0 A;  3CJB A;  1GLD G;  4H0V B;  4OPA A;  1M90 O;  1HKG A;  3FGU A;  3UKR B;  2A6A A;  5AQH A;  2NRH A;  4BRF A;  1S3X A;  3DXK B;  1U2V A;  3E9L A;  4IZ9 A;  3WT0 A;  2OTL N;  5AQV A;  1VQK N;  1QVF M;  4PL7 A;  2FSN A;  1MA9 B;  3ID8 A;  2E20 A;  4CZH A;  3CI5 A;  1LCU A;  4HTL A;  4A2A A;  3C6H A;  4PKI A;  2W41 A;  1GLB G;  3CQX A;  2AA4 A;  5AQZ A;  3R8E A;  4BC3 A;  2GWK A;  1DT9 A;  3D6R A;  2YI1 A;  1X3N A;  3M3Z A;  3C65 A;  4YDU A;  2F9W A;  3I33 A;  3VEN A;  5EOY A;  5KPR A;  1OVY A;  2FF3 B;  5C0Y A;  5FPD A;  3AGR A;  2P9K B;  2ASO A;  3GBT A;  4CZL A;  3OA9 A;  3KWG A;  1RDU A;  3F9M A;  2P9L A;  2NRR A;  1NGD A;  1HKB A;  4EFH A;  5TKY A;  1RFQ A;  4H5R A;  3IDH A;  3ZX0 A;  1BA1 A;  2GX9 A;  3EKS A;  4EAH D;  4WF9 L;  3VMF B;  3CJC A;  3OHR A;  3MWT A;  2JWK A;  4BY9 C;  3LL3 A;  5GAG P;  2PAV A;  2QXL A;  1DKG D;  4JKD A;  1IJJ A;  3EE9 A;  4AM6 A;  3CCJ N;  3SAF A;  4JKB A;  5C2F A;  5BRE A;  1Z05 A;  2YJF A;  4IOX A;  3CC4 N;  4YOX A;  1E4F T;  5EY4 A;  4IWV A;  2QI2 A;  4EIA A;  4JN4 A;  2W40 A;  4IO9 L;  1BA0 A;  4WFN L;  2A41 A;  3NVM A;  3ZYY X;  4BR9 A;  5F1X A;  3HOS A;  4NO7 A;  2GTD A;  3EL2 A;  4JD2 A;  5AQO A;  3UKU A;  2GUP A;  5M1F A;  3N4P A;  1SQK A;  3GOI A;  2HBL A;  2NLX A;  2CGK A;  5AQL A;  1NLV A;  2KHO A;  2YHY A;  4FPB A;  3SAH A;  4BVO A;  4WFB L;  4JHD A;  3QIC A;  4JAX A;  3U8X A;  3E66 A;  5BPL A;  4A57 A;  3O5B A;  3MCP A;  3I55 N;  2E2Q A;  2EWS A;  2YX6 A;  2V51 B;  2H3G X;  3MN6 A;  3EKU A;  4JKC A;  3LDQ A;  3R3L A;  4JKE A;  2YHX A;  3KK7 A;  3SMP A;  3VPZ A;  4BVP A;  2YCH A;  3TTC A;  5LJW A;  4OO1 J;  2OTJ N;  2QEX N;  3VEV A;  1E4G T;  4HWI A;  4MDA A;  1G99 A;  1HUX A;  1NGA A;  1Q18 A;  3CQY A;  3MK6 A;  4GVE A;  5AQG A;  3P31 A;  1DGK N;  2GEL A;  5AQX A;  5BRF A;  5H1S Q;  3VEO A;  2P9U B;  3G6E N;  1VQ8 N;  4BRE A;  2VGN A;  5F2R A;  1C0G A;  3H1V X;  4BRM A;  2WBN A;  1GLE G;  2FF6 A;  3DXM B;  3OBY A;  2A40 A;  5F0X A;  1VQ6 N;  3A5L C;  3CCM N;  2F9T A;  4ISF A;  3J7Z O;  3I8B A;  3I56 N;  2GEM A;  1Q82 O;  4F9O A;  5ELZ A;  3FFK B;  3WXJ A;  4M63 C;  3SK3 A;  5AFU A;  4A5B A;  3D2F A;  3VEZ A;  5HOO A;  4BRI A;  1EQY A;  3J8A A;  3CJ1 A;  4GV9 A;  2E8A A;  4BRP A;  4FWP A;  5GAH P;  3ZEU B;  5KPT A;  1TUY A;  3IKM A;  1ILY A;  2HST A;  2NRZ A;  3G25 A;  3R9P A;  4QS9 A;  5KPZ A;  4J8F A;  3IMX A;  4I6M A;  3RVC A;  3MMV A;  5AQK A;  5EXW A;  3CCL N;  2YHW A;  1JCF A;  2ZWH A;  1GLA G;  3O4W A;  3VEY A;  1NJI O;  1ZBS A;  3O8M A;  1VQL N;  1K8A O;  1QVG M;  3QBW A;  3VF4 A;  2P9P A;  3TSU A;  1XUP O;  3F2K A;  3H45 C;  4K42 A;  1W2B M;  1Z6R A;  3TPQ A;  3DAW A;  3AY9 A;  3KZB A;  4GNI A;  4U7B A;  2QTD A;  1K8K B;  3N4Q A;  5DM7 L;  3DWL A;  2HF3 A;  3GG4 A;  3B8A X;  5AQW A;  5JIC A;  1ATN A;  3L4I A;  4B9Q A;  3ZET A;  3ULE B;  4BRO A;  1SZ2 A;  3VEW A;  2ZGY A;  1BOT O;  4RCH A;  3CME N;  2QWN A;  4BR7 A;  1ATS A;  1NGI A;  3DLL L;  4CBX A;  1KAX A;  5CE3 A;  5GIP A;  3CCU N;  2Q0U A;  1U2V B;  5AQN A;  3HOT A;  5C2D A;  1EO1 A;  2HMP A;  3LDN A;  3O6W A;  4WQ5 C;  1KAZ A;  4BR5 A;  2VWB A;  2A42 A;  3LDP A;  2VCP A;  4ISE A;  1V4T A;  1YXQ A;  4Y0W A;  3U9Z A;  1VQM N;  2E2P A;  1XQS C;  5FPE A;  4IDH A;  5GIO A;  4B1Z A;  3VGM A;  3SJH A;  1O13 A;  4BC2 A;  1GLL O;  4XH5 A;  2E2N A;  4KH6 A;  5C10 A;  4DB3 A;  4GY2 B;  4CZK A;  1TYQ A;  3AAR A;  3R6M A;  4O8U A;  4YOR A;  2HBM A;  3KWI A;  3O9Q A;  4FSV A;  5AQY A;  4R79 A;  2NRT A;  1T44 A;  3OW2 M;  3UB5 A;  1QHA A;  4YOT A;  3H3O B;  5GAE P;  4BQZ A;  4PKG A;  4WQ4 C;  3S41 A;  1P90 A;  3TTF A;  3CCR N;  2NNW A;  2P9L B;  5M1N A;  4AF1 A;  5LY3 A;  4FOE A;  3O1W A;  4IJA A;  2RE2 A;  2I7P A;  3EN9 A;  4BR2 A;  3ENH A;  4BGA A;  3GL1 A;  1T6C A;  2Q36 A;  3VGK A;  1NBW A;  3SLC A;  1BG3 A;  4NLC A;  2P9K A;  4ILJ A;  5BN9 A;  3CCV N;  4A2B A;  4K25 A;  3QFU A;  3CC2 N;  4BRQ A;  2PFU A;  2QWL A;  2KLA A;  3CJ9 A;  1WUA A;  4FWN A;  1Q7Y O;  3D2E A;  3JXU A;  1WOQ A;  3MN5 A;  4H03 B;  2F7T A;  3RSE A;  3PLA A;  1P8Z A;  1CZA N;  1R59 O;  1Y64 A;  3BF3 A;  1RDW X;  5AQM A;  1NGJ A;  4H5T A;  1YHQ N;  3A5N C;  1NWK A;  3CJ7 A;  2P9N A;  2DPN A;  3HBT A;  3VF6 A;  4CD1 A;  2D0P A;  4E1J A;  4JD2 B;  3WEE A;  4RWT A;  5BPM A;  3UKU B;  3FZH A;  2YJE A;  4BRA A;  3CER A;  4B1U B;  3CCE N;  1YUW A;  1JCG A;  3KHY A;  3L4Q A;  2QWP A;  2Q31 A;  3LDL A;  4JHD B;  5LJV A;  2IVP A;  3CHW A;  4JKG A;  4PL8 A;  5AQQ A;  1K73 O;  5FPN A;  2UYT A;  1NGC A;  2QWR A;  3FLC O;  5EVZ A;  1YAG A;  5I9E B;  3G4S N;  3Q7B A;  4FWL A;  4A5A A;  4FVU A;  4H5N A;  2PBD A;  3SMS A;  3CXC M;  3Q7C A;  3CF5 L;  1V4S A;  2I7N A;  1VQN N;  4M7X A;  3AAP A;  2IVN A;  2RHK A;  3QML A;  3U4L A;  4UY8 O;  2V52 B;  1BWF O;  5MLC Q;  1JJ2 M;  2BTF A;  2QW9 A;  5TKW A;  3FZM A;  4CZM A;  1M1K O;  3IUC A;  1VQ5 N;  4YOU A;  2FSK A;  4IFE A;  4JEP A;  4WFA L;  4H0Y B;  4ILH A;  1YI2 N;  3BUZ B;  3O9T A;  5AZI B;  5M1P A;  4DHY A;  3D2F B;  2NRW A;  3QFP A;  4BRH A;  3H3N O;  1VQP N;  3WXK A;  1NGG A;  5ADX A;  1OKJ A;  1YVN A;  3T69 A;  4BRD A;  3TSP A;  5E26 A;  3JS6 A;  5JVG L;  1VQO N;  3MDQ A;  2HOE A;  3QBX A;  3ZX3 A;  3H46 O;  4I6M B;  2QWO A;  2VYP A;  4JNE A;  5JMV A;  5BRH A;  5BR9 A;  4FWK A;  1KAY A;  3TU5 A;  3CPW M;  3GDQ A;  1HPM A;  4WCE L;  1QQO A;  4H5V A;  4BRC A;  3WXL A;  4KBO A;  4BQL A;  2D4W A;  1MDU B;  3P4I A;  4A62 A;  3ATU A;  3C7N A;  3CIP A;  4ILG B;  3WXM B;  4CD3 A;  2KKZ A;  2Q2R A;  1VQ7 N;  1X9J A;  2D0O A;  3O08 A;  4O5F A;  5C12 A;  1Q86 O;  5JLF A;  3OBW A;  2QA4 N;  2FXU A;  4BRK A;  5AQT A;  1ZXO A;  3HTV A;  3MN7 A;  1NGE A;  3ENO A;  5AZJ A;  1DEJ A;  1W97 L;  4H0X B;  4FL9 A;  4KH4 A;  2ITM A;  3U9D A;  5KQD A;  3NMU A;  1D4X A;  3A0I X;  3M5R A;  3C0B A;  2WC9 A;  1ESV A;  4K43 A;  5AQP A;  3DJC A;  4FWO A;  4EHT A;  3CC7 N;  4C23 A;  3NVK A;  4YDU C;  5AQR A;  4BR0 A;  4MDB A;  5JVH L;  4JKA A;  4YOY A;  1GLJ O;  1TUU A;  3FR0 A;  3W3D A;  4BR4 A;  2P9I A;  1BO5 O;  1QQN A;  1MWK A;  3O1B A;  4G9Z A;  4IXC A;  5AR0 A;  2P9S A;  3SBT A;  3ULE A;  4QS7 A;  3BEX A;  3R1X A;  5M1K A;  4H0T B;  3M6G A;  3MX5 A;  2WUS A;  5AQJ A;  4L3Q A;  1T3V A;  3F5T A;  1TYQ B;  3UKR A;  5EX5 A;  3A5O C;  2CH6 A;  3DXK A;  3TSQ A;  1NMD A;  3CJA A;  4GV3 A;  3PIO L;  4EHU A;  3G71 N;  4CJ7 A;  3VTH A;  2E88 A;  2WFB A;  2J4R A;  4A61 A;  4CZE A;  1VQ9 N;  4B1V A;  5C15 A;  1BU6 O;  3HSC A;  3UE5 A;  5M1Q A;  1GLC G;  5BRD A;  4OPH A;  3E9O A;  2AP1 A;  5JLH A;  2JWL A;  1YJ9 N;  2QWQ A;  5FPM A;  3EZW A;  4BC4 A;  2E1Z A;  5E84 A;  5CHI A;  2NRV A;  4DQ8 A;  4ISG A;  2NZT A;  2D1K A;  3CCS N;  3LM2 A;  4LC9 B;  5B8H A;  1U6Z A;  1J6Z A;  3VTI A;  4WQ5 A;  5BPN A;  3O9S A;  4XH1 A;  3W0L A;  4PKH A;  3HI0 A;  3C6A A;  3ENB A;  4M7Y A;  1NGB A;  2IIR A;  1HKC A;  2ZJQ L;  3D2E B;  3P38 A;  2ZF5 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...