2BH1A

X-ray structure of the general secretion pathway complex of the n- terminal domain of epse and the cytosolic domain of epsl of vibrio cholerae
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
238
structure length
238
Chain Sequence
SEFLTVRLSSQKEADIPWLVWSAEQQEVIASGQVAGWEALHEIESYADQRSVVVLLAASDLILTSVEIPPGASRQLENMLPYLLEDEIAQDVEDVHFCVLSKGRETADVVGVDRLWLRACLDHLKACGFDVKRVLPDVLAIPRPEHGLAALQLGDEWLVRKSTTQGMAVDAQWLSLLAASDWVQNEGEYLPLQALTPLPELSLAETQEWRYEPSGLVMQLLTQEALTSKFNLLTGSFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The X-Ray Structure of the Type II Secretion System Complex Formed by the N-Terminal Domain of Epse and the Cytoplasmic Domain of Epsl of Vibrio Cholerae
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Transport protein
molecule keywords GENERAL SECRETION PATHWAY PROTEIN L
total genus 69
structure length 238
sequence length 238
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05134 T2SSL Type II secretion system (T2SS), protein L
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.370 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2bh1A02
3.30.420.380 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2bh1A01
4PHTX 1YF5L 1W97L 5TKWA 2BH1A
chains in the Genus database with same CATH superfamily
4ID1A 3HSCA 1GLFO 3ID8A 4CFDA 1IBKK 4PY5A 1CZAN 3VA0A 4CI6A 2NZTA 4FOIA 2X6NA 3S3MA 1JXBA 4UY8O 3IFRA 2UXCK 3LPTA 5AQSA 2A6AA 5GAEP 3SAFA 3ZEUB 3LWMA 3ZCMA 3TAPA 3O08A 1TK0A 4OLBA 4IZ9A 1Q8IA 2P5OA 5IT9O 3BF1A 2QKBA 2FSNA 3O9SA 2ZM6K 3O6WA 4BVPA 3VQBA 5GADP 3C7NA 2IOCA 2P9KB 2W42A 4WQ4A 1S72N 4RG8A 4BDPA 3VQ7A 5KQDA 4DR5K 3T7ZA 1S6PA 1BIZA 4CD1A 3HM9A 3THYA 2DPNA 3S3OA 3ULEB 2UUCK 3NFAA 3VPZA 4CIFA 1VRUA 3N4QA 3HP6A 2QWMA 3NBPA 3M8QA 3WXJA 1VHXA 2Q1NA 3OYMA 4CHYA 5AFUA 4H5RA 2DY4A 3J7YP 4H5NA 4YOWA 1NK8A 4CJ3A 3C6TA 3SUPA 3O9UA 1RDCA 3UKUB 2HOEA 4NO7A 3NF7A 1Q81O 4LFCK 2FBXA 4GVEA 1ZBFA 2VCPA 4LY7A 4FJLA 2E1ZA 4DUYK 4QS7A 4DS4A 1RTDA 1TL3A 3O4QA 4FWLA 4O4GA 5DM7L 4K8ZA 2P9PB 5JVGL 3LP1A 4CESA 4BRFA 5BRHA 1TUYA 2E2PA 5JS2A 4CJSA 4CECA 4Q5VA 1MU2A 1WBDA 3P5JA 5GAGP 2UUBK 5C15A 4OPJA 5D3GA 1UA0A 1U6ZA 3KLFA 1S9GA 1V4SA 2F8SA 2QWLA 3ZSZA 3EY1A 2Q3SA 2E8AA 3KD1E 2OPRA 3E66A 2JLEA 1NGBA 1B9FA 3LAKA 3D0PA 1VSHA 3QO9A 4O5FA 3DWLA 2F9TA 3VESA 2QEXN 4BR2A 4KAZA 4NB4A 1BU6O 1S5JA 4LF7K 3SQ4A 5AQTA 3AVFA 4NLCA 1T05A 4H0VB 4BC3A 4N41A 4W5RA 3A5LC 2H3GX 4HUFA 4BC5A 3QEVA 4DV7K 1REVA 3AAPA 5AFUH 1HNXK 1BCMA 5AQWA 4M3WA 4HUGA 5J2QA 3WNEA 4BC2A 3R8EA 4DFMA 2GV9A 3QNOA 3TSQA 4CJQA 4G9ZA 5T7BA 2DTUA 2VGMA 2E20A 3OYGA 3K9KA 4C1NI 4NXNK 3EKSA 4OGEA 1NK4A 3ULEA 5M1KA 3SPZA 1GLEG 3LM2A 4MQ3A 4N47A 3J80O 1NK7A 3FZFA 4DQ8A 1RBSA 4H8KA 3DOKA 5AQRA 4KHWA 1SL0A 5GIOA 3VGMA 1I39A 2YNFA 2P9UB 5EVZA 1HJRA 3EKUA 3ZX2A 2P9IA 2Q2RA 1NGAA 4PA1A 1KAXA 4E7JA 4CZMA 3LP2A 3CJBA 1C0TA 1NGHA 2O8BB 3MXJA 2GTDA 1UWBA 2WONA 4M7YA 3TI0A 3L2WA 4H0TB 1TGOA 5EU7A 1HR0K 3ZLJA 4IOXA 3VETA 3BUZB 5AZIA 4H4OA 2DFFA 4JLHA 4KFBA 2YHWA 1R0AA 2YKNA 3I33A 1WSHA 4DR6K 2XY5A 4B1ZA 1A5WA 2WTUA 4OO1J 3K57A 4CW7B 3KK7A 4BGBA 4CF2A 3JS6A 1S1WA 4B1VA 2I7PA 3SJHA 3K5OA 3AO5A 1TK5A 3ENOA 4BE1A 1JLFA 4JKDA 1K73O 4DV4K 1C0GA 4E1NA 1GLBG 4C1NK 3KTQA 4IBNA 4IFVA 4FLTA 3CIPA 3EO3A 2BGGA 4FLUA 2RKIA 3VQEA 2E6MA 1WBBA 1K8KA 3W3DA 1YF5L 3SMSA 3NCIA 3PO4A 3HJFA 3TU5A 4DHYA 4ZHRA 3ULDA 3WUHA 4KRFA 2FBYA 5FRNA 2O4IA 3PUFA 3V1QA 4MO5A 3QEIA 3I8DA 1BIUA 4KI6A 1L3TA 4KKOA 2E1YA 3V9SA 1W9HA 1GLCG 3DXKB 1TKZA 3CCUN 3BZCA 3UE5A 1W2BM 3JXUA 3DJCA 3AAQA 1XC9A 4FSVA 5EXWA 4FJ9A 1KLNA 3MK6A 4E7KA 1NJIO 2O8FA 1TAUA 3OYEA 3C65A 3FZLA 3AO3A 4LF9K 1RBTA 4B1YB 3SUQA 1EETA 4B9TA 3FGUA 4JKFA 5B8HA 4DSEA 2VQFK 1KAYA 3V9XA 2D0BA 3L4IA 3ZSYA 3OS2A 3TANA 4FLXA 3O5BA 1WAJA 1BOTO 1IJJA 1RT2A 2ZD1A 3CYMA 4ICLA 1RGIA 4B9MA 5BPNA 1BA1A 3TSPA 1B9DA 1V4TA 3PIPL 3L8BA 3AVBA 3LL3A 3OW2M 3OA9A 3BF3A 1ASWA 5FRMA 3HTVA 1XWLA 4JS4A 1ASUA 1NOYA 3U4LA 4CHZA 4CEZA 1J54A 2BE2A 4YORA 4HTLA 1IBLK 4IDKA 4C8NA 4F4KA 4CGIA 3NGIA 3DLEA 3THYB 5HP1A 4FJ5A 1KVCA 1ASVA 5AQOA 1U49A 3MAQA 3O4NA 3WNHA 4JKHA 4KTQA 4A59A 5DMRA 3UIQA 3QFPA 3WNGA 2CGJA 1E3MA 4BE2A 4LSLA 3NF8A 1VQ6N 1S3XA 3P4IA 1N6QA 3J81O 5JLFA 3T1HK 4CF8A 4JRQA 4CZLA 1TV6A 3S41A 1YI2N 4J2EA 3CFOA 2YJFA 1JLBA 4FO0A 5BRFA 3FZHA 4DFPA 1BDGA 4Z4IA 2ASPA 2D5RA 1EWQA 1Q9YA 3PSFA 4CGJA 2QI2A 4FLYA 4H0YB 1OVQA 5M1OA 4O55A 1Z25A 5TKWA 2YNIA 5CE3A 2RE2A 4DQSA 2G8IA 3J8AA 2BUPA 4FYDA 2CH6A 2YHBA 1BWFO 1HPMA 1KVAA 2IVOA 3HYFA 4CGFA 2HHQA 4DR4K 2X6SA 3ZT0A 3SV4A 3QERA 1VSEA 3D7EO 2PFUA 1XNRK 4E7LA 2O8DA 3KHYA 3B8AX 4C23A 3D45A 1RDAA 3L3VA 3ZETA 1KD1O 1BQMA 5C10A 3HVRA 4JD2A 5E84A 3FR0A 4K41A 4FW1A 3QBXA 3VEZA 1QQNA 3G6EN 5FPDA 3TAMA 1OH8A 3FE1A 2WOMA 5LJWA 1KQSM 3O3FA 2OANA 2RN2A 3OYKA 4DFKA 4V19S 4DCHA 1VQLN 2W6LA 2HHUA 2W40A 2KZZA 2HMIA 3ITHA 4BC4A 1NGDA 1RFQA 2QK9A 4IOAL 2QWRA 3FFIA 4NCBA 4W5QA 1JCFA 1VSMA 4B9VA 2IAJA 4FVUA 3EN9A 2F4VK 3CC4N 1EWRA 3L2QA 2IGIA 3UKUA 2P1JA 4IEIA 2HVIA 3ZT3A 2G8WA 4EP5A 3OTOK 3DOLA 4JD2B 1M1KO 1QZ5A 3CHWA 3IRXA 2Z1GA 3ZT1A 4R79A 3MX5A 4W5OA 3E1YA 4QOZB 4OPKA 3E9PA 3HPHA 3LDSA 1HYVA 2UXDK 3NGZA 5BN9A 1CLQA 2HHSA 1YAGA 1I3AA 5BPMA 5CY4A 2XRIA 3DYAA 2HNYA 4BG8A 4BREA 1Z6RA 3ENBA 5C42A 1Q7YO 4ISFA 4J2DA 4FJHA 1S22A 3AVGA 4IJAA 3QDKA 3V1RA 4AILC 2HW3A 1N36K 1OH7A 3UKRB 1SL1A 4FZYA 4IJNA 4K0KK 4DF4A 5HOOA 4KI4A 4AHRA 1NGFA 1T8EA 1NWKA 5C2FA 2QKKA 2NRWA 4FZXC 4HVJA 3WXIA 4JHDA 3NDKA 1QS4A 3IMXA 2HBMA 4C8KA 2ATQA 1GLDG 1RT5A 4CJ7A 5KPRA 5LMNK 3AA4A 2HF4A 4AHTA 4JK8A 4JKCA 4N76A 1S1XA 4Z94A 3OYLA 4CJPA 3KLEA 1KRPA 4FJXA 4E7IA 3QBWA 1BI4B 3KLGA 5J2NA 1DGKN 1NMNA 2I5JA 5KGWA 4BRPA 2O8CA 3PSIA 1HYZA 3GDQA 3O9TA 5LY3A 3LDQA 3KKRA 1NK6A 4CJEA 3RVCA 3O80A 5BREA 1U4BA 3K2PA 4FWRA 4YOYA 3UKRA 4FLZA 3P38A 4B1WB 3HL8A 4GV9A 3HOSA 1TKXA 3BZKA 4DSJA 2ZJQL 3ZYYX 2FC0A 3A2FA 3TAGA 5AZJB 4ZTFA 1K6YA 2GUIA 3U3YA 4GV6A 4EZ6A 4DLEA 3PX4A 4K8XA 2E5LK 3CC7N 1YTUA 5M1FA 3M8RA 1JKHA 4MDAA 1MDUB 1JLEA 4JI2K 3MECA 5BPLA 3P1GA 4JK9A 4U7BA 4M7XA 4RW7A 2GELA 2NRVA 4FCYA 1WN7A 3OBYA 3E9LA 3VGKA 3NF6A 1OH5A 4DR3K 4FW2A 3LALA 4WQ5A 3VEOA 4B9NA 2Q0RA 4JEPA 4LF4K 2YHXA 2GUPA 3VA3A 4FK2A 2Z1IA 4BRNA 3QEWA 3I0RA 4A61A 2X74A 4O8UA 3V9UA 5BN8A 2GBZA 5HRNA 1FKOA 3AO1A 4RW9A 3KK3A 3O3GA 3SJJA 3K5NA 4IO9L 3LDLA 1QVFM 4WE1A 1TL1A 4OVLA 1VQ5N 4RW4A 4HCCA 1WUAA 1W0HA 4LH5A 3BP8A 3OHRA 2PYJA 4B08A 4CGDA 1KC8O 2G8UA 1O13A 3H45C 3LAMA 3LDNA 3VQPA 4WYBA 2AJQA 1IV0A 3U3GA 3LWLA 4Y0WA 2KKZA 4MO4A 4X62K 2QWNA 4NLBA 1UAXA 1VQNN 3KLIA 2F96A 1HNZK 2NRZA 4OLAA 4I2QA 1X3MA 2E88A 5ADXH 3CJ9A 4CERA 3AVNA 2D0AA 4B3RK 4DMNA 5LJVA 1NKBA 5CYQA 4B3TK 3A5OC 3AVKA 3G25A 4AQYK 1J6ZA 4XEIA 4JV5K 1CZ9A 3MCAB 3RR7A 3OYBA 1NBWA 4FM0A 2HBJA 2OTJN 5FPEA 2UYTA 1CXQA 1EP4A 4F3TA 3B6PA 3P39A 3I0SA 1RT1A 4LF6K 4E3SA 4BRQA 4BE0A 1LOTB 3MX2A 3NE6A 3T69A 1L3SA 1Q86O 3DXMB 4DTOA 4JI7K 1G99A 3HP9A 5AQYA 1DT9A 1IH7A 4J2AA 3QINA 3AVJA 3FLCO 3SYZA 4KHSA 2YHYA 4BWMA 3EL2A 3O9RA 4C8LA 1EKEA 2OA8A 3T19A 4YOVA 3HM8A 2HNDA 4JI0K 1RDDA 4CJLA 2HHVA 1BGXT 2E6LA 4DWIA 3WXKA 2P9KA 4FK4A 3L2VA 5LL6Z 3OYFA 3CM6A 4GVMA 5J1EA 4B9LA 5C2DA 4BRKA 1FJGK 1T7PA 3QIPA 1GLAG 1HKGA 4M3RA 5HROA 1J5OA 4F8RA 1N33K 1WNSA 1GOAA 4FXDA 1BCOA 2D0CA 3QNNA 2NRRA 3THVA 3DMJA 4MDBA 2P9LB 2G8FA 4KPYA 4CCHA 3HBTA 1N34K 1NKEA 1NJYA 4CJFA 3PIOL 3DLBA 2QXFA 4CZHA 3V81A 1D9DA 2LSNA 4BR7A 2YV0X 3KLHA 1E4FT 3KKSA 4BRGA 3HVTA 3H6EA 4KHQA 5KGXA 2KQ2A 4HTUA 2GWKA 3CQXA 2P51A 2Y1JA 2ZE2A 3SUOA 3IAYA 4CZIA 4BRLA 4DQPA 1LWEA 3TPQA 2HBLA 4PKGA 2O8EB 2PBDA 3NH1A 2ZJPL 4IOCL 1NM1A 4KREA 2X78A 4CZFA 3I56N 4YOTA 1W97L 1VQ7N 3K5MA 1T6DA 1WB9A 3AGRA 3E9OA 5CZ2A 3NHGA 3CCMN 1Q9XA 4I9QA 5FPNA 3S9HA 2Q0UA 4FLWA 5AQQA 3SLCA 3VMFB 4CZJA 4BRIA 3VQ4A 4I2PA 1U47A 1CXUA 3VQ8A 1U45A 1VSLA 2HMPA 1X3NA 5KPZA 3GL1A 2ITGA 2HHXA 4CVNE 1NMDA 3OYDA 2HF3A 2R7YA 4H0OA 5JICA 4N56A 2YKMA 3R1XA 3SQ2A 4AH9A 3B6OA 1A5XA 3P31A 1NJXA 3CF5L 3QEPA 3DLKA 4DV0K 1JL1A 1T44A 1LW2A 4DU4A 4DTXA 3IDHA 2HSTA 2UUAK 3OBWA 5KI6A 4I9LA 3SQ0A 5FPMA 4KH4A 3BDPA 1E4GT 1I94K 1BL3A 2P9SB 1S1TA 3ZSQA 3M8PA 2E2OA 4CEEA 1VQPN 4J2BA 1SQKA 2WBNA 5E26A 2A3ZA 4H03B 4DTJA 4FJNA 4FLVA 2CGLA 1K9MO 4I6MB 4OKKA 4EHUA 4DU3A 1C0FA 2A1SA 3D2FB 4DU1A 4IFEA 4JKGA 3CCLN 1CZBA 1J9AA 4OGCA 3WXLA 5A2QO 2RF2A 3RSEA 2QTDA 4BR4A 4FPBA 4IO8A 5C12A 3RMDA 4BWJA 3ATUA 3A0IX 4CJUA 1YVNA 2ZQBA 5CR4A 3LPUA 3TWHA 3QICA 1NU0A 4BVOA 3PX6A 3AO2A 1WSFA 1N8RO 4A5BA 3N4PA 2P9SA 4B3SK 2VG5A 5DM6L 1TKDA 1NJWA 5E41A 3QB0A 3O1WA 1ILYA 1RT3A 2FBVA 3DRRA 5CHIA 4WQ4C 3ZSRA 2ASMA 3C6UA 3GE1A 4PL8A 3TARA 4I6MA 1TUUA 4Y1DA 4DKWA 2IIRA 2DFHA 3QFUA 4PHTX 4KH6A 1ZBUA 3M5RA 1RDBA 1FK9A 1QSYA 1M90O 1GLLO 3S3NA 4DV1K 5AQZA 5I9EB 1WSIA 3KJVA 3PY8A 3TTDA 4FPAA 4YOXA 3CCVN 4IG0A 2F7TA 2EX3A 2VWKA 3KK1A 4JKAA 1Y64A 3SMPA 4CHOA 1SV5A 4Z4GA 2W41A 3D6RA 4AHSA 4TSXA 4CFAA 1YXQA 3CPWM 2QW9A 4QAGA 2CGKA 4DSLA 2BH1A 4LH4A 3LANA 2OTLN 4CF9A 2WFBA 4M45A 3NAEA 3VF4A 5KPTA 1ZBSA 2W6KA 4IEEA 3VENA 1QQOA 3L4QA 3VN5A 3AVMA 1RDUA 3K0SA 1SL2A 2NRTA 4YOUA 3MXIA 1HMVA 3O3HA 4NCAA 2FSJA 4NYFA 3MWPA 4LF5K 4CFBA 1SKRA 3F2KA 5KRSA 3DLHA 5SZTA 4E1MA 3NMUA 3M3ZA 3IG1A 4YNQA 3ZSOA 3L2UA 3CCSN 2UXBK 5H1SQ 1RT7A 4YY3K 3QIOA 4CJTA 1C1AA 3K9JA 3ZSVA 1NLVA 1ZBIA 2XHBA 4DG1A 3RWUA 4L3QA 3LP3A 1L3UA 1KFDA 1LCUA 1L5UA 3DRSA 3AVAA 3SNNA 2D0OA 5TKYA 3I8BA 4BACA 5AR0A 3AA3A 4E7HA 3GBTA 1HKBA 1P90A 2Q31A 4DTRA 2VQEK 3BY5A 3THWB 3HOTA 4FZZA 4BROA 3CJAA 3M6GA 2XO7A 2KTQA 2IS3A 1IG9A 4CIGA 1NK0A 1RNHA 3F5TA 3THXA 2PY5A 3VQQA 3RR8A 1HJOA 1KTQA 2NRHA 3L3UA 4Z4CA 4CBXA 5KRTA 3D2EA 2D0PA 3GOIA 4CGGA 3C94A 4O8KA 3AV9A 3MEEA 5J2PA 5HBMA 2NNWA 5JVHL 4CZKA 4CF0A 1HKCA 3RMCA 3KVGA 3MN9A 2NUBA 4NCGA 1NKCA 4FJ7A 1X9WA 2HB5A 2OYQA 4WFNL 1TYQB 1RTJA 1ZBLA 2FF3B 4U67L 3DM2A 4Z0UA 4B9QA 3PX0A 2IC3A 1ESVA 3SV3A 4EP4A 4FK0A 1SKWA 1MWMA 4JKBA 3K59A 4N5SA 2G8VA 3CMAN 1S1UA 4DLGA 4FWPA 4OJRA 3SBTA 4E89A 1GLJO 3QMLA 1W7AA 5K14A 3JAMO 4EHTA 4E19A 5BR9A 1KLMA 4ELVA 2RPIA 3OYAA 1C0UA 1D5AA 3DAWA 4JNEA 3QESA 1TYQA 3NH0A 1EQYA 1ATNA 1D4XA 1RBVA 5I3UA 2AA4A 4KB0A 1X9JA 3MDQA 3SBGA 1C1BA 2P5GA 1J53A 4DV5K 1WSGA 4JI3K 2A40A 1RDWX 2QXLA 1C0MA 5I42A 2FF6A 3CERA 5HRRA 4RW8A 1LW0A 1WSEA 3NVMA 2ASOA 1NOZA 3NF9A 3LP0A 4CGHA 5CYMA 5KQ8A 4F9OA 3L6QA 4PUOA 4FWNA 2QWOA 3CC2N 3ZX3A 1MWKA 4CF1A 1UA1A 4JS5A 1XC3A 2HHHK 4FVMA 1TKTA 4X65K 4HHTA 2P9NB 3VQDA 1FXXA 3KWGA 4CEDA 3RSEB 1DKGD 4W5TA 4EAHD 2O8FB 4IWVA 5FROA 3EE9A 3CCRN 4B9SA 3KWIA 3TAEA 2PZSA 5EX5A 3ENHA 4CBUA 1Z05A 4KBOA 4O44A 2V7YA 1DTQA 1ATSA 4BGAA 3MCPA 4O5BA 4FJJA 5C25A 1ZC6A 4QS9A 3VQAA 1B92A 3AARA 3TABA 3H3NO 2VGNA 4BY9C 2WC9A 1X9SA 4NXMK 3C95A 1VAZA 3C6HA 1EXQA 5J2MA 1VQ4N 3CJ1A 1DLOA 1XI1A 4XH1A 1JLCA 3ZETB 3V9ZA 3Q7CA 2OPQA 4JN4A 3ASMA 1NK9A 3VGLA 3R9PA 1DTTA 4DUZK 3IUCA 1KCFA 1JLQA 5C24A 1S6QA 1HQUA 3CMEN 5AQLA 3CFRA 3LZJA 4JYAK 2D4WA 1HX1A 4CEAA 4O0JA 4DS5A 4FJIA 2JGUA 2YNGA 4DQQA 1JLGA 1FW6A 4OPHA 3ISNC 4JI6K 4CZEA 3CQYA 4H0XB 3CJCA 5LMUK 4AM7A 1TVRA 4BQLA 3LM9A 4WCEL 2P9UA 4IDHA 4FM1A 1XMQK 1VQON 4QCLA 1U04A 4GKKK 4ID5A 1QSLA 5FLXO 5JMVA 1R59O 4CFCA 4EIAA 4KHPK 4PQUA 1HRHA 1YITN 2VWJA 4GW6A 1RILA 3CJ7A 3KIOA 1C1CA 4FL9A 1YHQN 4CEQA 1RTHA 5HRSA 4YDUA 1ATRA 4B1UB 4CEOA 4B8CA 2WUSA 3SI6A 1LV5A 3THWA 2OZSA 2HVHA 4M63C 1VSJA 2ZGYA 4OPAA 1RT4A 1U2VB 4DFJA 4CEFA 2V52B 4C8MA 3BEXA 4Y1CA 2GEMA 3CG7A 5AQHA 1XQSC 4JI1K 4YDUC 3VEXA 4LC9B 4CHQA 1NGJA 2HHTA 4R5PA 3J7AP 3Q7BA 3G0ZA 1SUQA 1VQ9N 1YJNN 5AQNA 3MN5A 4DR2K 1D9FA 3TAFA 2Q36A 5AQUA 3ID6A 2FLOA 4JI8K 1QQCA 3H1QA 5CZ1A 3RRHA 3EE8A 5M1NA 1QVGM 1IKVA 3ZT2A 4FJ8A 1TAQA 5GAHP 1VQMN 3EYZA 3T3FA 3G71N 4MLHA 4QS8A 1RBUA 1WOQA 2XY6A 3CM5A 5AZJA 2KLAA 4BDYA 4PKIA 2FSKA 3WQTA 3HZ6A 4CZGA 3OY9A 5AQXA 1JCEA 4CD3A 1T3VA 5AQFA 1NGIA 4PWDA 4CBWA 2ZJRL 1YTAA 3OVNA 1BISA 3OYCA 4JI4K 3SQ1A 3THXB 3I55N 1YIJN 5ADXA 1ZBHA 3QEXA 2KZMA 3HT3A 2GWJA 2BANA 1NGEA 4DF8A 1NGCA 1FKPA 1HNVA 5BR8K 3MWTA 3VQ6A 1ZXOA 5IWAK 3ATVA 1QSSA 4JI5K 4XIUA 1JCGA 2KW4A 1YUWA 3CCJN 4ISGA 3F9KA 2NLXA 3HPOA 1ZYQA 4MLEA 4DR7K 2YI1A 1X9MA 4KHYA 1VK0A 3DXKA 3F73A 3JSMA 4Z4HA 4OX9K 3OYJA 3VOVA 1MA9B 3P83D 5FDLA 3HK2A 1HNIA 3WEEB 1NK5A 1LAVA 2OZMA 1YJWN 3AVCA 2YNHA 4YHHK 4E1JA 3DLGA 3TSUA 3O8MA 4A62A 3IKMA 4LFAK 1SAZA 2P9NA 2EHGA 2FBTA 2OCEA 3OYHA 4A2BA 3SCXA 3C0BA 3DRPA 4CK2A 3G4SN 4DSKA 2B4JA 2VWBA 4CJ5A 1K8AO 5JS1A 1KAZA 2E2QA 2ETJA 4K43A 3TTFA 2G8HA 2QA4N 2E4LA 1N5YA 3SPYA 1WSJA 4FJKA 4KB1A 4DTUA 2HNZA 2ZWHA 5M1PA 3U6FA 4RWTA 4FWQA 3ZT4A 3G10A 1BQNA 1K8KB 4H5VA 4DV6K 3V6DA 1WAFA 3OJUA 1OVYA 1XHZA 3MMVA 2KFZA 3AGKA 3NH2A 1HYSA 5AQJA 2FXUA 4M3XA 3OJSA 3PLAA 1KXPA 4ILJA 2J4RA 2QM1A 3FZMA 3VQ9A 2ZGZA 4BR9A 1YT3A 1XNQK 4JK7A 1S9EA 4XH5A 1QTMA 3HI0A 1XMOK 3U9DA 2I7NA 2HBKA 3NVKA 3CCQN 1QZ6A 4I7FA 1S1VA 3T1AA 4RTFD 4M41A 3IS9A 3J7ZO 3RTVA 3CETA 2YCHA 3AO4A 4BRDA 3WT0A 3CPEA 1YVUA 5KTQA 4HWIA 3KZBA 4AM6A 3MN7A 3O1BA 4H5TA 1HNWK 4RW6A 4X64K 1RBRA 3AVIA 2JWKA 3MN6A 3OS1A 2NRXA 4BQZA 3RRGA 4CK1A 3VF6A 2Z1JA 4CJWA 5DK5A 1UOCA 4FOEA 3BGRA 3H1VX 4LFBK 3EEQA 1RT6A 1BG3A 1Q18A 3CFPA 4CEBA 4DQIA 4F2RA 4UQGA 4BR0A 3R3LA 5SWMA 1QHTA 3VEWA 4A5AA 1SKSA 1QHAA 1X1PA 4FM2A 1IKXA 3DI6A 2PAVA 2JWLA 3DLLL 4ISEA 3W0LA 4CE9A 1HQEA 4IXCA 4H4MA 1A5VA 4C8OA 4B3MK 2E2NA 4Q0BA 3AVHA 3KK2A 4KO0A 4EFHA 2EWSA 4B8AB 4CHNA 3GG4A 4FWOA 1Z26A 3VQ5A 1IKWA 4CK3A 3F9MA 4LF8K 1SZ2A 3HSTB 3HXMA 5HLFA 1T6CA 3AVLA 4M3ZA 4JAXA 2XY8A 1LWCA 4YFUA 1XHXA 3V1OA 4ILHA 2AP1A 2IVPA 3OYIA 1BO5O 1NJZA 4W5NA 4CJKA 4JRPA 4KH5A 3ZX0A 1BUPA 4KTZA 1XUPO 1C6VA 1JJ2M 2A41A 5C0YA 2KHOA 3V9WA 3DLRA 5M1QA 4IG3A 4K25A 1H1VA 4WQ5C 2GX9A 2F9WA 1G15A 2A42A 4DV2K 4DTMA 1JLAA 4DTNA 4GNIA 3K5LA 4BG9A 4GV3A 2ITMA 3LZIA 2BTFA 4M3YA 2IVNA 1ITGA 5F1XA 4Z4FA 2P9PA 4E0DA 1F21A 5EOYA 2B6AA 4B3OA 3VERA 4WF9L 1NNEA 1D8YA 3O9QA 3PO5A 4WFBL 1JL2A 4FWSA 4KHNA 3UB5A 1JXEA 3VQCA 3OYNA 2A1RA 3QLHA 1TK8A 3MEDA 3VTIA 4B1XB 3QETA 3O4WA 2DFEA 4LD0A 3TAQA 4A2AA 2OPSA 4AHCA 4EZ9A 4DTSA 2P9IB 3A5MC 4O0IA 3LDPA 4FJGA 4FWKA 1SS6A 2VYPA 3AY9A 3T1YK 3FFKB 4GKJK 2O8CB 4BR5A 2O8BA 1U48A 2Y1IA 1VSDA 4HUEA 4ZTJA 5GIPA 3C7NB 1Q82O 2PYLA 5BRDA 1O1WA 2YJEA 3ALYA 4DR1K 3SK3A 2VG6A 4IFYA 3PV8A 4RCHA 3SZ2A 4FWMA 1EX4A 4L8RB 5AZIB 4BRAA 3CXCM 4XH4A 4KHUA 2P9LA 2YX6A 3M8SA 4A57A 5ELZA 4BDZA 3L2RA 3VTHA 2RHKA 3R6MA 1NG9A 2G8KA 3ZEUA 5AQIA 1BI4A 1KFSA 3SAHA 4F3OA 4DSFA 5AJ3K 3VF2A 4M42A 3VEYA 4BRCA 2Z1HA 1HUXA 1DEJA 3FZKA 1BHLA 1IKYA 2O4GA 1N32K 4KTWA 2CH5A 2UU9K 1LWFA 3D2FA 4Z4EA 4PKHA 3DXMA 5AQMA 2QWQA 4JHDB 1WLJA 2VG7A 4CJRA 1L3VA 2IDOA 4JKEA 5GINA 3NGYA 1U2VA 4H5WA 1RCHA 4HCBA 3ZSWA 1BA0A 1RTIA 4BRHA 3KD5E 3RMAA 1YJ9N 3LDOA 4ELUA 4OKJA 4BRMA 5AQKA 4DSIA 4FJMA 1NGGA 3TR8A 4NYNA 2BDPA 5HRPA 4WFAL 1KSPA 3WEEA 1IG8A 2V51B 3D2EB 1IO2A 1J5EK 4CIEA 2HHWA 4M3TA 3CI5A 1GOCA 4X66K 4KV8A 3RMBA 3OS0A 3SAGA 1QE1A 4ILGB 3CD6N 2Q97A 3EZ5A 1VSKA 3CCEN 3E01A 1HPZA 4G1QA 3U8XA 1Y97A 1KVBA 3H3OB 3K58A 2XY7A 4B9UA 4DTPA 3WQUA 1VSFA 2ZF5O 4AHVA 1T03A 3H46O 1OH6A 4F2SA 1VRTA 5F2RA 2O8DB 3C6AA 4OKEA 4DQRA 2OPPA 3MEGA 4CJ4A 2QWPA 3A8YA 3AA5X 4AHUA 2B5JA 5AQGA 3SUNA 4PL7A 4J8FA 4MFBA 3AA2A 1GOBA 3WXMB 3ZSXA 3MXMA 1HLUA 2V7ZA 5MLCQ 3A5NC 2O8EA 1LAWA 4H0PA 1P8ZA 5HL7L 3U9ZA 4GMJB 5AQPA 4DV3K 3V4IA 3M1FA 5EY4A 3HPGA 4DB3A 4GY2B 2D1KA 1VQ8N 4CJVA 5JLHA 2KFNA 4K42A 4LSNA 4IKFA 1OKJA 3VEVA 2A5XA 3HRGA 3CQ8A 1IBMK 3HO1A 3H08A 3TTCA 4ELTA 1EO1A 5F0XA 4CHPA 3WNFA 1VQKN 3JYTA 4JKGB 1VSIA 2F8TA 5AQVA 4AF1A 2YHAA 3EZWA 4M3UA 1QQMA 3L0QA
chains in the Genus database with same CATH topology
3ATVA 3HSCA 1GLFO 5LJWA 1KQSM 3ID8A 3RSEA 2OANA 2QTDA 4BR4A 4FPBA 4IO8A 1CZAN 1JCGA 5C12A 1YUWA 3CCJN 4ISGA 4CI6A 2NZTA 3ATUA 4FOIA 2NLXA 3A0IX 4UY8O 4DCHA 1VQLN 1YVNA 4MLEA 3IFRA 2YI1A 5CR4A 2W40A 3QICA 5AQSA 4BVOA 2A6AA 5GAEP 4BC4A 3SAFA 1NGDA 1RFQA 1N8RO 4A5BA 4IOAL 2QWRA 3DXKA 3ZEUB 3N4PA 2P9SA 1JCFA 3O08A 4IZ9A 3BF1A 3VOVA 1MA9B 4FVUA 3EN9A 5DM6L 3CC4N 2FSNA 3O9SA 3WEEB 3O6WA 4BVPA 3QB0A 3O1WA 1YJWN 5GADP 1ILYA 3C7NA 3UKUA 4IEIA 5CHIA 4E1JA 3TSUA 3O8MA 4WQ4C 4A62A 2P9KB 2ASMA 4WQ4A 3IKMA 1S72N 3GE1A 4JD2B 4PL8A 1M1KO 5KQDA 4I6MA 1SAZA 1TUUA 3T7ZA 4DKWA 1QZ5A 2P9NA 3CHWA 2IIRA 3QFUA 4CD1A 4PHTX 4R79A 2DPNA 4KH6A 3M5RA 3MX5A 3E1YA 3ULEB 1M90O 1GLLO 4A2BA 3C0BA 3E9PA 3VPZA 3N4QA 5AQZA 3G4SN 2QWMA 2VWBA 1K8AO 5I9EB 1KAZA 2E2QA 3TTDA 5BN9A 4FPAA 4K43A 3WXJA 2Q1NA 3TTFA 2QA4N 1YAGA 5BPMA 4YOXA 3CCVN 5AFUA 4H5RA 2F7TA 4BG8A 4H5NA 4BREA 4YOWA 1Z6RA 3ENBA 4JKAA 1Q7YO 1Y64A 3SMPA 2ZWHA 4ISFA 2W41A 3D6RA 3O9UA 5M1PA 1S22A 3UKUB 4RWTA 4FWQA 2HOEA 4NO7A 4IJAA 1Q81O 1K8KB 3QDKA 4H5VA 4GVEA 2VCPA 1YXQA 2E1ZA 3CPWM 2QW9A 1OVYA 2CGKA 2BH1A 4QS7A 3UKRB 2OTLN 3MMVA 4IJNA 3AGKA 2WFBA 5HOOA 4FWLA 5DM7L 3VF4A 2P9PB 2FXUA 5AQJA 5KPTA 1NGFA 1ZBSA 5JVGL 4IEEA 3PLAA 3VENA 1KXPA 1NWKA 1QQOA 3L4QA 4ILJA 2J4RA 2QM1A 1TUYA 2E2PA 2NRWA 2ZGZA 3FZMA 4BRFA 5BRHA 4BR9A 4JK7A 3WXIA 1RDUA 4XH5A 4JHDA 5GAGP 3IMXA 2HBMA 2NRTA 3HI0A 4YOUA 5C15A 1GLDG 4CJ7A 5KPRA 3U9DA 2I7NA 2HBKA 3NVKA 3CCQN 1QZ6A 2HF4A 2FSJA 1U6ZA 4JK8A 4JKCA 1V4SA 2QWLA 3MWPA 4RTFD 3F2KA 3J7ZO 3CETA 4Z94A 2E8AA 2YCHA 4BRDA 3WT0A 3NMUA 3CPEA 3E66A 1NGBA 3KZBA 3M3ZA 3MN7A 3O1BA 4HWIA 3QBWA 4H5TA 4AM6A 3CCSN 5H1SQ 4O5FA 3DWLA 2F9TA 3VESA 3K9JA 1DGKN 2QEXN 4BR2A 4BRPA 1NLVA 4NB4A 3GDQA 1BU6O 3O9TA 5LY3A 2JWKA 3LDQA 3MN6A 2NRXA 5BREA 3RVCA 3O80A 4BQZA 3VF6A 4FWRA 4YOYA 5AQTA 3UKRA 4NLCA 3P38A 4FOEA 4B1WB 4L3QA 4GV9A 4H0VB 3HOSA 3H1VX 1LCUA 4BC3A 2ZJQL 1BG3A 1Q18A 2D0OA 5TKYA 3I8BA 3ZYYX 3A5LC 2H3GX 5AR0A 4BC5A 3GBTA 1HKBA 1P90A 5AZJB 3AAPA 3R3LA 4BR0A 2Q31A 4GV6A 3HOTA 3VEWA 4BROA 3CJAA 4A5AA 3M6GA 1QHAA 3CC7N 5AFUH 5M1FA 3F5TA 4MDAA 2PAVA 1MDUB 2JWLA 3DLLL 4ISEA 3W0LA 5BPLA 5AQWA 4JK9A 4U7BA 4M7XA 4IXCA 2GELA 1HJOA 2NRHA 2NRVA 4BC2A 3R8EA 2E2NA 3OBYA 3E9LA 3VGKA 4CBXA 3TSQA 4EFHA 2EWSA 3D2EA 4G9ZA 2D0PA 3GG4A 4FWOA 3GOIA 4WQ5A 2VGMA 3VEOA 2Q0RA 4JEPA 4O8KA 2YHXA 3F9MA 2GUPA 1SZ2A 2NNWA 5JVHL 4CZKA 4BRNA 1HKCA 2E20A 3K9KA 3KVGA 1T6CA 4C1NI 4A61A 3MN9A 4JAXA 3EKSA 4O8UA 3ULEA 5M1KA 1GLEG 4ILHA 4WFNL 1TYQB 2AP1A 2IVPA 2FF3B 3LM2A 1BO5O 5BN8A 3FZFA 4DQ8A 4U67L 4KH5A 3ZX0A 3LDLA 4B9QA 4IO9L 1QVFM 1BUPA 1ESVA 1XUPO 1VQ5N 1JJ2M 5AQRA 1MWMA 2A41A 5C0YA 2KHOA 1WUAA 4JKBA 3BP8A 3OHRA 5GIOA 5M1QA 3VGMA 4K25A 3CMAN 1H1VA 4WQ5C 2GX9A 2P9UB 4FWPA 5EVZA 2F9WA 3EKUA 2A42A 3ZX2A 1KC8O 2P9IA 3SBTA 1O13A 2Q2RA 3H45C 1NGAA 1GLJO 3LDNA 4GNIA 1KAXA 4BG9A 4WYBA 3QMLA 4CZMA 2ITMA 4GV3A 2BTFA 3CJBA 4EHTA 4Y0WA 5BR9A 1NGHA 2IVNA 2KKZA 5C2FA 5F1XA 2GTDA 4M7YA 2QWNA 4MO4A 2P9PA 4NLBA 5EOYA 1VQNN 3VERA 4H0TB 4WF9L 3DAWA 4JNEA 3O9QA 1TYQA 4IOXA 4WFBL 4FWSA 3VETA 3BUZB 1EQYA 5AZIA 3UB5A 2NRZA 1ATNA 1D4XA 2AA4A 2YHWA 1X3MA 2E88A 5ADXH 1X9JA 3I33A 3CJ9A 3MDQA 3SBGA 3VTIA 4B1XB 4B1ZA 2A40A 1RDWX 2QXLA 5LJVA 4OO1J 3O4WA 3KK7A 4BGBA 4A2AA 2FF6A 3A5OC 3JS6A 3CERA 2P9IB 3G25A 3A5MC 2I7PA 1J6ZA 3NVMA 3SJHA 4B1VA 2ASOA 3LDPA 4XEIA 3ENOA 4FWKA 5KQ8A 3MCAB 4JKDA 1SS6A 2VYPA 4F9OA 1K73O 1NBWA 3AY9A 3FFKB 3L6QA 2HBJA 1C0GA 4BR5A 2OTJN 1GLBG 4FWNA 4C1NK 5FPEA 2QWOA 3CC2N 2UYTA 3CIPA 3EO3A 3ZX3A 1MWKA 1XC3A 1K8KA 3P39A 3C7NB 3W3DA 5GIPA 1Q82O 2P9NB 1YF5L 3SMSA 5BRDA 3KWGA 3RSEB 1DKGD 2YJEA 4BRQA 4EAHD 1LOTB 3SK3A 4IWVA 3TU5A 3EE9A 3MX2A 4DHYA 3CCRN 3T69A 3KWIA 4RCHA 1Q86O 4FWMA 5EX5A 3DXMB 3WUHA 5AZIB 3ENHA 4CBUA 1Z05A 4KBOA 4BRAA 2V7YA 4XH4A 3CXCM 1ATSA 2P9LA 2YX6A 4BGAA 4A57A 3MCPA 4MO5A 1G99A 5ELZA 3VTHA 1ZC6A 2RHKA 2E1YA 4QS9A 1DT9A 3R6MA 3AARA 5AQYA 1GLCG 3H3NO 3DXKB 3ZEUA 2VGNA 5AQIA 4BY9C 3CCUN 2WC9A 3UE5A 3FLCO 1W2BM 3JXUA 1VAZA 3C6HA 3AAQA 3DJCA 3SAHA 2YHYA 3EL2A 3VF2A 3VEYA 4BRCA 1VQ4N 3O9RA 3CJ1A 4FSVA 1HUXA 4YOVA 4XH1A 5EXWA 1DEJA 3FZKA 3HM8A 3ZETB 3Q7CA 3MK6A 1NJIO 2CH5A 4JN4A 3C65A 3FZLA 2P9KA 3VGLA 3D2FA 3R9PA 3WXKA 4PKHA 3DXMA 5AQMA 2QWQA 4JHDB 3IUCA 4B1YB 5C2DA 4BRKA 4JKEA 3CMEN 5AQLA 1GLAG 1HKGA 3FGUA 4JKFA 5B8HA 5GINA 2D4WA 1HX1A 1U2VA 1KAYA 4H5WA 3L4IA 1BA0A 2NRRA 4BRHA 1YJ9N 4MDBA 2P9LB 3LDOA 3O5BA 1BOTO 1IJJA 3HBTA 4BRMA 5AQKA 4OPHA 1RGIA 3PIOL 5BPNA 4CZEA 4CZHA 1BA1A 3CQYA 4H0XB 1NGGA 3CJCA 3TSPA 1V4TA 3PIPL 4AM7A 3LL3A 4BQLA 4BR7A 3OA9A 3OW2M 3LM9A 4WCEL 2P9UA 4IDHA 3BF3A 4WFAL 1VQON 1E4FT 3WEEA 3HTVA 4BRGA 1IG8A 3H6EA 2V51B 3D2EB 5JMVA 1R59O 2GWKA 3CQXA 3U4LA 3CI5A 4EIAA 4CZIA 4BRLA 4YORA 4HTLA 1YITN 3SAGA 3CJ7A 2HBLA 4PKGA 3TPQA 4FL9A 1YHQN 2PBDA 5AQOA 4ILGB 4YDUA 1ATRA 4B1UB 2WUSA 2ZJPL 2Q97A 4IOCL 3CD6N 4M63C 4JKHA 1NM1A 2ZGYA 4OPAA 3WXLA 4A59A 1U2VB 3CCEN 4CZFA 3I56N 2V52B 4YOTA 3BEXA 1W97L 3QFPA 2GEMA 3U8XA 2CGJA 1VQ7N 1T6DA 5AQHA 1XQSC 3AGRA 3E9OA 3H3OB 3CCMN 4YDUC 3WQUA 3VEXA 4LC9B 2ZF5O 1NGJA 1VQ6N 3H46O 1S3XA 5FPNA 3P4IA 2Q0UA 5F2RA 3Q7BA 5AQQA 5JLFA 3SLCA 3C6AA 1VQ9N 1YJNN 4CZLA 3VMFB 4CZJA 3S41A 4BRIA 1YI2N 2QWPA 2YJFA 3A8YA 5AQNA 3MN5A 2HMPA 4FO0A 3FZHA 1X3NA 5AQGA 5BRFA 1BDGA 3GL1A 5KPZA 2Q36A 2ASPA 3ID6A 5AQUA 2FLOA 4J8FA 4PL7A 3H1QA 1NMDA 3EE8A 5M1NA 2HF3A 1QVGM 4H0OA 5JICA 2QI2A 3WXMB 5GAHP 3R1XA 1VQMN 4H0YB 5M1OA 1HLUA 2V7ZA 5MLCQ 3G71N 3A5NC 4H0PA 5HL7L 1P8ZA 3P31A 4MLHA 4QS8A 3U9ZA 5AQPA 5TKWA 1WOQA 5CE3A 3M1FA 3CF5L 5AZJA 2RE2A 2KLAA 5EY4A 4PKIA 3J8AA 2BUPA 4DB3A 2FSKA 4GY2B 2D1KA 3WQTA 1T44A 3HZ6A 2CH6A 1VQ8N 3IDHA 2HSTA 4CZGA 1BWFO 3OBWA 5AQXA 1JCEA 1HPMA 2IVOA 4CD3A 5JLHA 1T3VA 5AQFA 1NGIA 4CBWA 4K42A 3D7EO 5FPMA 2ZJRL 2PFUA 4KH4A 1OKJA 3VEVA 2A5XA 1E4GT 3HRGA 3I55N 1YIJN 5ADXA 3KHYA 2P9SB 2E2OA 3B8AX 4C23A 1VQPN 1SQKA 2GWJA 2WBNA 3TTCA 1EO1A 5F0XA 5E26A 2A3ZA 3ZETA 1KD1O 1NGEA 4H03B 5C10A 1VQKN 4JD2A 2CGLA 3FR0A 1NGCA 4JKGB 4I6MB 4K41A 5E84A 4EHUA 1K9MO 1C0FA 3QBXA 3D2FB 1QQNA 3VEZA 3G6EN 5FPDA 4IFEA 4JKGA 3MWTA 5AQVA 3CCLN 4AF1A 3EZWA 3FE1A 1ZXOA 1QQMA 3L0QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PHT X;  1YF5 L;  1W97 L;  5TKW A;  2BH1 A; 
#chains in the Genus database with same CATH topology
 4ID1 A;  3HSC A;  1GLF O;  3ID8 A;  4CFD A;  1IBK K;  4PY5 A;  1CZA N;  3VA0 A;  4CI6 A;  2NZT A;  4FOI A;  2X6N A;  3S3M A;  1JXB A;  4UY8 O;  3IFR A;  2UXC K;  3LPT A;  5AQS A;  2A6A A;  5GAE P;  3SAF A;  3ZEU B;  3LWM A;  3ZCM A;  3TAP A;  3O08 A;  1TK0 A;  4OLB A;  4IZ9 A;  1Q8I A;  2P5O A;  5IT9 O;  3BF1 A;  2QKB A;  2FSN A;  3O9S A;  2ZM6 K;  3O6W A;  4BVP A;  3VQB A;  5GAD P;  3C7N A;  2IOC A;  2P9K B;  2W42 A;  4WQ4 A;  1S72 N;  4RG8 A;  4BDP A;  3VQ7 A;  5KQD A;  4DR5 K;  3T7Z A;  1S6P A;  1BIZ A;  4CD1 A;  3HM9 A;  3THY A;  2DPN A;  3S3O A;  3ULE B;  2UUC K;  3NFA A;  3VPZ A;  4CIF A;  1VRU A;  3N4Q A;  3HP6 A;  2QWM A;  3NBP A;  3M8Q A;  3WXJ A;  1VHX A;  2Q1N A;  3OYM A;  4CHY A;  5AFU A;  4H5R A;  2DY4 A;  3J7Y P;  4H5N A;  4YOW A;  1NK8 A;  4CJ3 A;  3C6T A;  3SUP A;  3O9U A;  1RDC A;  3UKU B;  2HOE A;  4NO7 A;  3NF7 A;  1Q81 O;  4LFC K;  2FBX A;  4GVE A;  1ZBF A;  2VCP A;  4LY7 A;  4FJL A;  2E1Z A;  4DUY K;  4QS7 A;  4DS4 A;  1RTD A;  1TL3 A;  3O4Q A;  4FWL A;  4O4G A;  5DM7 L;  4K8Z A;  2P9P B;  5JVG L;  3LP1 A;  4CES A;  4BRF A;  5BRH A;  1TUY A;  2E2P A;  5JS2 A;  4CJS A;  4CEC A;  4Q5V A;  1MU2 A;  1WBD A;  3P5J A;  5GAG P;  2UUB K;  5C15 A;  4OPJ A;  5D3G A;  1UA0 A;  1U6Z A;  3KLF A;  1S9G A;  1V4S A;  2F8S A;  2QWL A;  3ZSZ A;  3EY1 A;  2Q3S A;  2E8A A;  3KD1 E;  2OPR A;  3E66 A;  2JLE A;  1NGB A;  1B9F A;  3LAK A;  3D0P A;  1VSH A;  3QO9 A;  4O5F A;  3DWL A;  2F9T A;  3VES A;  2QEX N;  4BR2 A;  4KAZ A;  4NB4 A;  1BU6 O;  1S5J A;  4LF7 K;  3SQ4 A;  5AQT A;  3AVF A;  4NLC A;  1T05 A;  4H0V B;  4BC3 A;  4N41 A;  4W5R A;  3A5L C;  2H3G X;  4HUF A;  4BC5 A;  3QEV A;  4DV7 K;  1REV A;  3AAP A;  5AFU H;  1HNX K;  1BCM A;  5AQW A;  4M3W A;  4HUG A;  5J2Q A;  3WNE A;  4BC2 A;  3R8E A;  4DFM A;  2GV9 A;  3QNO A;  3TSQ A;  4CJQ A;  4G9Z A;  5T7B A;  2DTU A;  2VGM A;  2E20 A;  3OYG A;  3K9K A;  4C1N I;  4NXN K;  3EKS A;  4OGE A;  1NK4 A;  3ULE A;  5M1K A;  3SPZ A;  1GLE G;  3LM2 A;  4MQ3 A;  4N47 A;  3J80 O;  1NK7 A;  3FZF A;  4DQ8 A;  1RBS A;  4H8K A;  3DOK A;  5AQR A;  4KHW A;  1SL0 A;  5GIO A;  3VGM A;  1I39 A;  2YNF A;  2P9U B;  5EVZ A;  1HJR A;  3EKU A;  3ZX2 A;  2P9I A;  2Q2R A;  1NGA A;  4PA1 A;  1KAX A;  4E7J A;  4CZM A;  3LP2 A;  3CJB A;  1C0T A;  1NGH A;  2O8B B;  3MXJ A;  2GTD A;  1UWB A;  2WON A;  4M7Y A;  3TI0 A;  3L2W A;  4H0T B;  1TGO A;  5EU7 A;  1HR0 K;  3ZLJ A;  4IOX A;  3VET A;  3BUZ B;  5AZI A;  4H4O A;  2DFF A;  4JLH A;  4KFB A;  2YHW A;  1R0A A;  2YKN A;  3I33 A;  1WSH A;  4DR6 K;  2XY5 A;  4B1Z A;  1A5W A;  2WTU A;  4OO1 J;  3K57 A;  4CW7 B;  3KK7 A;  4BGB A;  4CF2 A;  3JS6 A;  1S1W A;  4B1V A;  2I7P A;  3SJH A;  3K5O A;  3AO5 A;  1TK5 A;  3ENO A;  4BE1 A;  1JLF A;  4JKD A;  1K73 O;  4DV4 K;  1C0G A;  4E1N A;  1GLB G;  4C1N K;  3KTQ A;  4IBN A;  4IFV A;  4FLT A;  3CIP A;  3EO3 A;  2BGG A;  4FLU A;  2RKI A;  3VQE A;  2E6M A;  1WBB A;  1K8K A;  3W3D A;  1YF5 L;  3SMS A;  3NCI A;  3PO4 A;  3HJF A;  3TU5 A;  4DHY A;  4ZHR A;  3ULD A;  3WUH A;  4KRF A;  2FBY A;  5FRN A;  2O4I A;  3PUF A;  3V1Q A;  4MO5 A;  3QEI A;  3I8D A;  1BIU A;  4KI6 A;  1L3T A;  4KKO A;  2E1Y A;  3V9S A;  1W9H A;  1GLC G;  3DXK B;  1TKZ A;  3CCU N;  3BZC A;  3UE5 A;  1W2B M;  3JXU A;  3DJC A;  3AAQ A;  1XC9 A;  4FSV A;  5EXW A;  4FJ9 A;  1KLN A;  3MK6 A;  4E7K A;  1NJI O;  2O8F A;  1TAU A;  3OYE A;  3C65 A;  3FZL A;  3AO3 A;  4LF9 K;  1RBT A;  4B1Y B;  3SUQ A;  1EET A;  4B9T A;  3FGU A;  4JKF A;  5B8H A;  4DSE A;  2VQF K;  1KAY A;  3V9X A;  2D0B A;  3L4I A;  3ZSY A;  3OS2 A;  3TAN A;  4FLX A;  3O5B A;  1WAJ A;  1BOT O;  1IJJ A;  1RT2 A;  2ZD1 A;  3CYM A;  4ICL A;  1RGI A;  4B9M A;  5BPN A;  1BA1 A;  3TSP A;  1B9D A;  1V4T A;  3PIP L;  3L8B A;  3AVB A;  3LL3 A;  3OW2 M;  3OA9 A;  3BF3 A;  1ASW A;  5FRM A;  3HTV A;  1XWL A;  4JS4 A;  1ASU A;  1NOY A;  3U4L A;  4CHZ A;  4CEZ A;  1J54 A;  2BE2 A;  4YOR A;  4HTL A;  1IBL K;  4IDK A;  4C8N A;  4F4K A;  4CGI A;  3NGI A;  3DLE A;  3THY B;  5HP1 A;  4FJ5 A;  1KVC A;  1ASV A;  5AQO A;  1U49 A;  3MAQ A;  3O4N A;  3WNH A;  4JKH A;  4KTQ A;  4A59 A;  5DMR A;  3UIQ A;  3QFP A;  3WNG A;  2CGJ A;  1E3M A;  4BE2 A;  4LSL A;  3NF8 A;  1VQ6 N;  1S3X A;  3P4I A;  1N6Q A;  3J81 O;  5JLF A;  3T1H K;  4CF8 A;  4JRQ A;  4CZL A;  1TV6 A;  3S41 A;  1YI2 N;  4J2E A;  3CFO A;  2YJF A;  1JLB A;  4FO0 A;  5BRF A;  3FZH A;  4DFP A;  1BDG A;  4Z4I A;  2ASP A;  2D5R A;  1EWQ A;  1Q9Y A;  3PSF A;  4CGJ A;  2QI2 A;  4FLY A;  4H0Y B;  1OVQ A;  5M1O A;  4O55 A;  1Z25 A;  5TKW A;  2YNI A;  5CE3 A;  2RE2 A;  4DQS A;  2G8I A;  3J8A A;  2BUP A;  4FYD A;  2CH6 A;  2YHB A;  1BWF O;  1HPM A;  1KVA A;  2IVO A;  3HYF A;  4CGF A;  2HHQ A;  4DR4 K;  2X6S A;  3ZT0 A;  3SV4 A;  3QER A;  1VSE A;  3D7E O;  2PFU A;  1XNR K;  4E7L A;  2O8D A;  3KHY A;  3B8A X;  4C23 A;  3D45 A;  1RDA A;  3L3V A;  3ZET A;  1KD1 O;  1BQM A;  5C10 A;  3HVR A;  4JD2 A;  5E84 A;  3FR0 A;  4K41 A;  4FW1 A;  3QBX A;  3VEZ A;  1QQN A;  3G6E N;  5FPD A;  3TAM A;  1OH8 A;  3FE1 A;  2WOM A;  5LJW A;  1KQS M;  3O3F A;  2OAN A;  2RN2 A;  3OYK A;  4DFK A;  4V19 S;  4DCH A;  1VQL N;  2W6L A;  2HHU A;  2W40 A;  2KZZ A;  2HMI A;  3ITH A;  4BC4 A;  1NGD A;  1RFQ A;  2QK9 A;  4IOA L;  2QWR A;  3FFI A;  4NCB A;  4W5Q A;  1JCF A;  1VSM A;  4B9V A;  2IAJ A;  4FVU A;  3EN9 A;  2F4V K;  3CC4 N;  1EWR A;  3L2Q A;  2IGI A;  3UKU A;  2P1J A;  4IEI A;  2HVI A;  3ZT3 A;  2G8W A;  4EP5 A;  3OTO K;  3DOL A;  4JD2 B;  1M1K O;  1QZ5 A;  3CHW A;  3IRX A;  2Z1G A;  3ZT1 A;  4R79 A;  3MX5 A;  4W5O A;  3E1Y A;  4QOZ B;  4OPK A;  3E9P A;  3HPH A;  3LDS A;  1HYV A;  2UXD K;  3NGZ A;  5BN9 A;  1CLQ A;  2HHS A;  1YAG A;  1I3A A;  5BPM A;  5CY4 A;  2XRI A;  3DYA A;  2HNY A;  4BG8 A;  4BRE A;  1Z6R A;  3ENB A;  5C42 A;  1Q7Y O;  4ISF A;  4J2D A;  4FJH A;  1S22 A;  3AVG A;  4IJA A;  3QDK A;  3V1R A;  4AIL C;  2HW3 A;  1N36 K;  1OH7 A;  3UKR B;  1SL1 A;  4FZY A;  4IJN A;  4K0K K;  4DF4 A;  5HOO A;  4KI4 A;  4AHR A;  1NGF A;  1T8E A;  1NWK A;  5C2F A;  2QKK A;  2NRW A;  4FZX C;  4HVJ A;  3WXI A;  4JHD A;  3NDK A;  1QS4 A;  3IMX A;  2HBM A;  4C8K A;  2ATQ A;  1GLD G;  1RT5 A;  4CJ7 A;  5KPR A;  5LMN K;  3AA4 A;  2HF4 A;  4AHT A;  4JK8 A;  4JKC A;  4N76 A;  1S1X A;  4Z94 A;  3OYL A;  4CJP A;  3KLE A;  1KRP A;  4FJX A;  4E7I A;  3QBW A;  1BI4 B;  3KLG A;  5J2N A;  1DGK N;  1NMN A;  2I5J A;  5KGW A;  4BRP A;  2O8C A;  3PSI A;  1HYZ A;  3GDQ A;  3O9T A;  5LY3 A;  3LDQ A;  3KKR A;  1NK6 A;  4CJE A;  3RVC A;  3O80 A;  5BRE A;  1U4B A;  3K2P A;  4FWR A;  4YOY A;  3UKR A;  4FLZ A;  3P38 A;  4B1W B;  3HL8 A;  4GV9 A;  3HOS A;  1TKX A;  3BZK A;  4DSJ A;  2ZJQ L;  3ZYY X;  2FC0 A;  3A2F A;  3TAG A;  5AZJ B;  4ZTF A;  1K6Y A;  2GUI A;  3U3Y A;  4GV6 A;  4EZ6 A;  4DLE A;  3PX4 A;  4K8X A;  2E5L K;  3CC7 N;  1YTU A;  5M1F A;  3M8R A;  1JKH A;  4MDA A;  1MDU B;  1JLE A;  4JI2 K;  3MEC A;  5BPL A;  3P1G A;  4JK9 A;  4U7B A;  4M7X A;  4RW7 A;  2GEL A;  2NRV A;  4FCY A;  1WN7 A;  3OBY A;  3E9L A;  3VGK A;  3NF6 A;  1OH5 A;  4DR3 K;  4FW2 A;  3LAL A;  4WQ5 A;  3VEO A;  4B9N A;  2Q0R A;  4JEP A;  4LF4 K;  2YHX A;  2GUP A;  3VA3 A;  4FK2 A;  2Z1I A;  4BRN A;  3QEW A;  3I0R A;  4A61 A;  2X74 A;  4O8U A;  3V9U A;  5BN8 A;  2GBZ A;  5HRN A;  1FKO A;  3AO1 A;  4RW9 A;  3KK3 A;  3O3G A;  3SJJ A;  3K5N A;  4IO9 L;  3LDL A;  1QVF M;  4WE1 A;  1TL1 A;  4OVL A;  1VQ5 N;  4RW4 A;  4HCC A;  1WUA A;  1W0H A;  4LH5 A;  3BP8 A;  3OHR A;  2PYJ A;  4B08 A;  4CGD A;  1KC8 O;  2G8U A;  1O13 A;  3H45 C;  3LAM A;  3LDN A;  3VQP A;  4WYB A;  2AJQ A;  1IV0 A;  3U3G A;  3LWL A;  4Y0W A;  2KKZ A;  4MO4 A;  4X62 K;  2QWN A;  4NLB A;  1UAX A;  1VQN N;  3KLI A;  2F96 A;  1HNZ K;  2NRZ A;  4OLA A;  4I2Q A;  1X3M A;  2E88 A;  5ADX H;  3CJ9 A;  4CER A;  3AVN A;  2D0A A;  4B3R K;  4DMN A;  5LJV A;  1NKB A;  5CYQ A;  4B3T K;  3A5O C;  3AVK A;  3G25 A;  4AQY K;  1J6Z A;  4XEI A;  4JV5 K;  1CZ9 A;  3MCA B;  3RR7 A;  3OYB A;  1NBW A;  4FM0 A;  2HBJ A;  2OTJ N;  5FPE A;  2UYT A;  1CXQ A;  1EP4 A;  4F3T A;  3B6P A;  3P39 A;  3I0S A;  1RT1 A;  4LF6 K;  4E3S A;  4BRQ A;  4BE0 A;  1LOT B;  3MX2 A;  3NE6 A;  3T69 A;  1L3S A;  1Q86 O;  3DXM B;  4DTO A;  4JI7 K;  1G99 A;  3HP9 A;  5AQY A;  1DT9 A;  1IH7 A;  4J2A A;  3QIN A;  3AVJ A;  3FLC O;  3SYZ A;  4KHS A;  2YHY A;  4BWM A;  3EL2 A;  3O9R A;  4C8L A;  1EKE A;  2OA8 A;  3T19 A;  4YOV A;  3HM8 A;  2HND A;  4JI0 K;  1RDD A;  4CJL A;  2HHV A;  1BGX T;  2E6L A;  4DWI A;  3WXK A;  2P9K A;  4FK4 A;  3L2V A;  5LL6 Z;  3OYF A;  3CM6 A;  4GVM A;  5J1E A;  4B9L A;  5C2D A;  4BRK A;  1FJG K;  1T7P A;  3QIP A;  1GLA G;  1HKG A;  4M3R A;  5HRO A;  1J5O A;  4F8R A;  1N33 K;  1WNS A;  1GOA A;  4FXD A;  1BCO A;  2D0C A;  3QNN A;  2NRR A;  3THV A;  3DMJ A;  4MDB A;  2P9L B;  2G8F A;  4KPY A;  4CCH A;  3HBT A;  1N34 K;  1NKE A;  1NJY A;  4CJF A;  3PIO L;  3DLB A;  2QXF A;  4CZH A;  3V81 A;  1D9D A;  2LSN A;  4BR7 A;  2YV0 X;  3KLH A;  1E4F T;  3KKS A;  4BRG A;  3HVT A;  3H6E A;  4KHQ A;  5KGX A;  2KQ2 A;  4HTU A;  2GWK A;  3CQX A;  2P51 A;  2Y1J A;  2ZE2 A;  3SUO A;  3IAY A;  4CZI A;  4BRL A;  4DQP A;  1LWE A;  3TPQ A;  2HBL A;  4PKG A;  2O8E B;  2PBD A;  3NH1 A;  2ZJP L;  4IOC L;  1NM1 A;  4KRE A;  2X78 A;  4CZF A;  3I56 N;  4YOT A;  1W97 L;  1VQ7 N;  3K5M A;  1T6D A;  1WB9 A;  3AGR A;  3E9O A;  5CZ2 A;  3NHG A;  3CCM N;  1Q9X A;  4I9Q A;  5FPN A;  3S9H A;  2Q0U A;  4FLW A;  5AQQ A;  3SLC A;  3VMF B;  4CZJ A;  4BRI A;  3VQ4 A;  4I2P A;  1U47 A;  1CXU A;  3VQ8 A;  1U45 A;  1VSL A;  2HMP A;  1X3N A;  5KPZ A;  3GL1 A;  2ITG A;  2HHX A;  4CVN E;  1NMD A;  3OYD A;  2HF3 A;  2R7Y A;  4H0O A;  5JIC A;  4N56 A;  2YKM A;  3R1X A;  3SQ2 A;  4AH9 A;  3B6O A;  1A5X A;  3P31 A;  1NJX A;  3CF5 L;  3QEP A;  3DLK A;  4DV0 K;  1JL1 A;  1T44 A;  1LW2 A;  4DU4 A;  4DTX A;  3IDH A;  2HST A;  2UUA K;  3OBW A;  5KI6 A;  4I9L A;  3SQ0 A;  5FPM A;  4KH4 A;  3BDP A;  1E4G T;  1I94 K;  1BL3 A;  2P9S B;  1S1T A;  3ZSQ A;  3M8P A;  2E2O A;  4CEE A;  1VQP N;  4J2B A;  1SQK A;  2WBN A;  5E26 A;  2A3Z A;  4H03 B;  4DTJ A;  4FJN A;  4FLV A;  2CGL A;  1K9M O;  4I6M B;  4OKK A;  4EHU A;  4DU3 A;  1C0F A;  2A1S A;  3D2F B;  4DU1 A;  4IFE A;  4JKG A;  3CCL N;  1CZB A;  1J9A A;  4OGC A;  3WXL A;  5A2Q O;  2RF2 A;  3RSE A;  2QTD A;  4BR4 A;  4FPB A;  4IO8 A;  5C12 A;  3RMD A;  4BWJ A;  3ATU A;  3A0I X;  4CJU A;  1YVN A;  2ZQB A;  5CR4 A;  3LPU A;  3TWH A;  3QIC A;  1NU0 A;  4BVO A;  3PX6 A;  3AO2 A;  1WSF A;  1N8R O;  4A5B A;  3N4P A;  2P9S A;  4B3S K;  2VG5 A;  5DM6 L;  1TKD A;  1NJW A;  5E41 A;  3QB0 A;  3O1W A;  1ILY A;  1RT3 A;  2FBV A;  3DRR A;  5CHI A;  4WQ4 C;  3ZSR A;  2ASM A;  3C6U A;  3GE1 A;  4PL8 A;  3TAR A;  4I6M A;  1TUU A;  4Y1D A;  4DKW A;  2IIR A;  2DFH A;  3QFU A;  4PHT X;  4KH6 A;  1ZBU A;  3M5R A;  1RDB A;  1FK9 A;  1QSY A;  1M90 O;  1GLL O;  3S3N A;  4DV1 K;  5AQZ A;  5I9E B;  1WSI A;  3KJV A;  3PY8 A;  3TTD A;  4FPA A;  4YOX A;  3CCV N;  4IG0 A;  2F7T A;  2EX3 A;  2VWK A;  3KK1 A;  4JKA A;  1Y64 A;  3SMP A;  4CHO A;  1SV5 A;  4Z4G A;  2W41 A;  3D6R A;  4AHS A;  4TSX A;  4CFA A;  1YXQ A;  3CPW M;  2QW9 A;  4QAG A;  2CGK A;  4DSL A;  2BH1 A;  4LH4 A;  3LAN A;  2OTL N;  4CF9 A;  2WFB A;  4M45 A;  3NAE A;  3VF4 A;  5KPT A;  1ZBS A;  2W6K A;  4IEE A;  3VEN A;  1QQO A;  3L4Q A;  3VN5 A;  3AVM A;  1RDU A;  3K0S A;  1SL2 A;  2NRT A;  4YOU A;  3MXI A;  1HMV A;  3O3H A;  4NCA A;  2FSJ A;  4NYF A;  3MWP A;  4LF5 K;  4CFB A;  1SKR A;  3F2K A;  5KRS A;  3DLH A;  5SZT A;  4E1M A;  3NMU A;  3M3Z A;  3IG1 A;  4YNQ A;  3ZSO A;  3L2U A;  3CCS N;  2UXB K;  5H1S Q;  1RT7 A;  4YY3 K;  3QIO A;  4CJT A;  1C1A A;  3K9J A;  3ZSV A;  1NLV A;  1ZBI A;  2XHB A;  4DG1 A;  3RWU A;  4L3Q A;  3LP3 A;  1L3U A;  1KFD A;  1LCU A;  1L5U A;  3DRS A;  3AVA A;  3SNN A;  2D0O A;  5TKY A;  3I8B A;  4BAC A;  5AR0 A;  3AA3 A;  4E7H A;  3GBT A;  1HKB A;  1P90 A;  2Q31 A;  4DTR A;  2VQE K;  3BY5 A;  3THW B;  3HOT A;  4FZZ A;  4BRO A;  3CJA A;  3M6G A;  2XO7 A;  2KTQ A;  2IS3 A;  1IG9 A;  4CIG A;  1NK0 A;  1RNH A;  3F5T A;  3THX A;  2PY5 A;  3VQQ A;  3RR8 A;  1HJO A;  1KTQ A;  2NRH A;  3L3U A;  4Z4C A;  4CBX A;  5KRT A;  3D2E A;  2D0P A;  3GOI A;  4CGG A;  3C94 A;  4O8K A;  3AV9 A;  3MEE A;  5J2P A;  5HBM A;  2NNW A;  5JVH L;  4CZK A;  4CF0 A;  1HKC A;  3RMC A;  3KVG A;  3MN9 A;  2NUB A;  4NCG A;  1NKC A;  4FJ7 A;  1X9W A;  2HB5 A;  2OYQ A;  4WFN L;  1TYQ B;  1RTJ A;  1ZBL A;  2FF3 B;  4U67 L;  3DM2 A;  4Z0U A;  4B9Q A;  3PX0 A;  2IC3 A;  1ESV A;  3SV3 A;  4EP4 A;  4FK0 A;  1SKW A;  1MWM A;  4JKB A;  3K59 A;  4N5S A;  2G8V A;  3CMA N;  1S1U A;  4DLG A;  4FWP A;  4OJR A;  3SBT A;  4E89 A;  1GLJ O;  3QML A;  1W7A A;  5K14 A;  3JAM O;  4EHT A;  4E19 A;  5BR9 A;  1KLM A;  4ELV A;  2RPI A;  3OYA A;  1C0U A;  1D5A A;  3DAW A;  4JNE A;  3QES A;  1TYQ A;  3NH0 A;  1EQY A;  1ATN A;  1D4X A;  1RBV A;  5I3U A;  2AA4 A;  4KB0 A;  1X9J A;  3MDQ A;  3SBG A;  1C1B A;  2P5G A;  1J53 A;  4DV5 K;  1WSG A;  4JI3 K;  2A40 A;  1RDW X;  2QXL A;  1C0M A;  5I42 A;  2FF6 A;  3CER A;  5HRR A;  4RW8 A;  1LW0 A;  1WSE A;  3NVM A;  2ASO A;  1NOZ A;  3NF9 A;  3LP0 A;  4CGH A;  5CYM A;  5KQ8 A;  4F9O A;  3L6Q A;  4PUO A;  4FWN A;  2QWO A;  3CC2 N;  3ZX3 A;  1MWK A;  4CF1 A;  1UA1 A;  4JS5 A;  1XC3 A;  2HHH K;  4FVM A;  1TKT A;  4X65 K;  4HHT A;  2P9N B;  3VQD A;  1FXX A;  3KWG A;  4CED A;  3RSE B;  1DKG D;  4W5T A;  4EAH D;  2O8F B;  4IWV A;  5FRO A;  3EE9 A;  3CCR N;  4B9S A;  3KWI A;  3TAE A;  2PZS A;  5EX5 A;  3ENH A;  4CBU A;  1Z05 A;  4KBO A;  4O44 A;  2V7Y A;  1DTQ A;  1ATS A;  4BGA A;  3MCP A;  4O5B A;  4FJJ A;  5C25 A;  1ZC6 A;  4QS9 A;  3VQA A;  1B92 A;  3AAR A;  3TAB A;  3H3N O;  2VGN A;  4BY9 C;  2WC9 A;  1X9S A;  4NXM K;  3C95 A;  1VAZ A;  3C6H A;  1EXQ A;  5J2M A;  1VQ4 N;  3CJ1 A;  1DLO A;  1XI1 A;  4XH1 A;  1JLC A;  3ZET B;  3V9Z A;  3Q7C A;  2OPQ A;  4JN4 A;  3ASM A;  1NK9 A;  3VGL A;  3R9P A;  1DTT A;  4DUZ K;  3IUC A;  1KCF A;  1JLQ A;  5C24 A;  1S6Q A;  1HQU A;  3CME N;  5AQL A;  3CFR A;  3LZJ A;  4JYA K;  2D4W A;  1HX1 A;  4CEA A;  4O0J A;  4DS5 A;  4FJI A;  2JGU A;  2YNG A;  4DQQ A;  1JLG A;  1FW6 A;  4OPH A;  3ISN C;  4JI6 K;  4CZE A;  3CQY A;  4H0X B;  3CJC A;  5LMU K;  4AM7 A;  1TVR A;  4BQL A;  3LM9 A;  4WCE L;  2P9U A;  4IDH A;  4FM1 A;  1XMQ K;  1VQO N;  4QCL A;  1U04 A;  4GKK K;  4ID5 A;  1QSL A;  5FLX O;  5JMV A;  1R59 O;  4CFC A;  4EIA A;  4KHP K;  4PQU A;  1HRH A;  1YIT N;  2VWJ A;  4GW6 A;  1RIL A;  3CJ7 A;  3KIO A;  1C1C A;  4FL9 A;  1YHQ N;  4CEQ A;  1RTH A;  5HRS A;  4YDU A;  1ATR A;  4B1U B;  4CEO A;  4B8C A;  2WUS A;  3SI6 A;  1LV5 A;  3THW A;  2OZS A;  2HVH A;  4M63 C;  1VSJ A;  2ZGY A;  4OPA A;  1RT4 A;  1U2V B;  4DFJ A;  4CEF A;  2V52 B;  4C8M A;  3BEX A;  4Y1C A;  2GEM A;  3CG7 A;  5AQH A;  1XQS C;  4JI1 K;  4YDU C;  3VEX A;  4LC9 B;  4CHQ A;  1NGJ A;  2HHT A;  4R5P A;  3J7A P;  3Q7B A;  3G0Z A;  1SUQ A;  1VQ9 N;  1YJN N;  5AQN A;  3MN5 A;  4DR2 K;  1D9F A;  3TAF A;  2Q36 A;  5AQU A;  3ID6 A;  2FLO A;  4JI8 K;  1QQC A;  3H1Q A;  5CZ1 A;  3RRH A;  3EE8 A;  5M1N A;  1QVG M;  1IKV A;  3ZT2 A;  4FJ8 A;  1TAQ A;  5GAH P;  1VQM N;  3EYZ A;  3T3F A;  3G71 N;  4MLH A;  4QS8 A;  1RBU A;  1WOQ A;  2XY6 A;  3CM5 A;  5AZJ A;  2KLA A;  4BDY A;  4PKI A;  2FSK A;  3WQT A;  3HZ6 A;  4CZG A;  3OY9 A;  5AQX A;  1JCE A;  4CD3 A;  1T3V A;  5AQF A;  1NGI A;  4PWD A;  4CBW A;  2ZJR L;  1YTA A;  3OVN A;  1BIS A;  3OYC A;  4JI4 K;  3SQ1 A;  3THX B;  3I55 N;  1YIJ N;  5ADX A;  1ZBH A;  3QEX A;  2KZM A;  3HT3 A;  2GWJ A;  2BAN A;  1NGE A;  4DF8 A;  1NGC A;  1FKP A;  1HNV A;  5BR8 K;  3MWT A;  3VQ6 A;  1ZXO A;  5IWA K;  3ATV A;  1QSS A;  4JI5 K;  4XIU A;  1JCG A;  2KW4 A;  1YUW A;  3CCJ N;  4ISG A;  3F9K A;  2NLX A;  3HPO A;  1ZYQ A;  4MLE A;  4DR7 K;  2YI1 A;  1X9M A;  4KHY A;  1VK0 A;  3DXK A;  3F73 A;  3JSM A;  4Z4H A;  4OX9 K;  3OYJ A;  3VOV A;  1MA9 B;  3P83 D;  5FDL A;  3HK2 A;  1HNI A;  3WEE B;  1NK5 A;  1LAV A;  2OZM A;  1YJW N;  3AVC A;  2YNH A;  4YHH K;  4E1J A;  3DLG A;  3TSU A;  3O8M A;  4A62 A;  3IKM A;  4LFA K;  1SAZ A;  2P9N A;  2EHG A;  2FBT A;  2OCE A;  3OYH A;  4A2B A;  3SCX A;  3C0B A;  3DRP A;  4CK2 A;  3G4S N;  4DSK A;  2B4J A;  2VWB A;  4CJ5 A;  1K8A O;  5JS1 A;  1KAZ A;  2E2Q A;  2ETJ A;  4K43 A;  3TTF A;  2G8H A;  2QA4 N;  2E4L A;  1N5Y A;  3SPY A;  1WSJ A;  4FJK A;  4KB1 A;  4DTU A;  2HNZ A;  2ZWH A;  5M1P A;  3U6F A;  4RWT A;  4FWQ A;  3ZT4 A;  3G10 A;  1BQN A;  1K8K B;  4H5V A;  4DV6 K;  3V6D A;  1WAF A;  3OJU A;  1OVY A;  1XHZ A;  3MMV A;  2KFZ A;  3AGK A;  3NH2 A;  1HYS A;  5AQJ A;  2FXU A;  4M3X A;  3OJS A;  3PLA A;  1KXP A;  4ILJ A;  2J4R A;  2QM1 A;  3FZM A;  3VQ9 A;  2ZGZ A;  4BR9 A;  1YT3 A;  1XNQ K;  4JK7 A;  1S9E A;  4XH5 A;  1QTM A;  3HI0 A;  1XMO K;  3U9D A;  2I7N A;  2HBK A;  3NVK A;  3CCQ N;  1QZ6 A;  4I7F A;  1S1V A;  3T1A A;  4RTF D;  4M41 A;  3IS9 A;  3J7Z O;  3RTV A;  3CET A;  2YCH A;  3AO4 A;  4BRD A;  3WT0 A;  3CPE A;  1YVU A;  5KTQ A;  4HWI A;  3KZB A;  4AM6 A;  3MN7 A;  3O1B A;  4H5T A;  1HNW K;  4RW6 A;  4X64 K;  1RBR A;  3AVI A;  2JWK A;  3MN6 A;  3OS1 A;  2NRX A;  4BQZ A;  3RRG A;  4CK1 A;  3VF6 A;  2Z1J A;  4CJW A;  5DK5 A;  1UOC A;  4FOE A;  3BGR A;  3H1V X;  4LFB K;  3EEQ A;  1RT6 A;  1BG3 A;  1Q18 A;  3CFP A;  4CEB A;  4DQI A;  4F2R A;  4UQG A;  4BR0 A;  3R3L A;  5SWM A;  1QHT A;  3VEW A;  4A5A A;  1SKS A;  1QHA A;  1X1P A;  4FM2 A;  1IKX A;  3DI6 A;  2PAV A;  2JWL A;  3DLL L;  4ISE A;  3W0L A;  4CE9 A;  1HQE A;  4IXC A;  4H4M A;  1A5V A;  4C8O A;  4B3M K;  2E2N A;  4Q0B A;  3AVH A;  3KK2 A;  4KO0 A;  4EFH A;  2EWS A;  4B8A B;  4CHN A;  3GG4 A;  4FWO A;  1Z26 A;  3VQ5 A;  1IKW A;  4CK3 A;  3F9M A;  4LF8 K;  1SZ2 A;  3HST B;  3HXM A;  5HLF A;  1T6C A;  3AVL A;  4M3Z A;  4JAX A;  2XY8 A;  1LWC A;  4YFU A;  1XHX A;  3V1O A;  4ILH A;  2AP1 A;  2IVP A;  3OYI A;  1BO5 O;  1NJZ A;  4W5N A;  4CJK A;  4JRP A;  4KH5 A;  3ZX0 A;  1BUP A;  4KTZ A;  1XUP O;  1C6V A;  1JJ2 M;  2A41 A;  5C0Y A;  2KHO A;  3V9W A;  3DLR A;  5M1Q A;  4IG3 A;  4K25 A;  1H1V A;  4WQ5 C;  2GX9 A;  2F9W A;  1G15 A;  2A42 A;  4DV2 K;  4DTM A;  1JLA A;  4DTN A;  4GNI A;  3K5L A;  4BG9 A;  4GV3 A;  2ITM A;  3LZI A;  2BTF A;  4M3Y A;  2IVN A;  1ITG A;  5F1X A;  4Z4F A;  2P9P A;  4E0D A;  1F21 A;  5EOY A;  2B6A A;  4B3O A;  3VER A;  4WF9 L;  1NNE A;  1D8Y A;  3O9Q A;  3PO5 A;  4WFB L;  1JL2 A;  4FWS A;  4KHN A;  3UB5 A;  1JXE A;  3VQC A;  3OYN A;  2A1R A;  3QLH A;  1TK8 A;  3MED A;  3VTI A;  4B1X B;  3QET A;  3O4W A;  2DFE A;  4LD0 A;  3TAQ A;  4A2A A;  2OPS A;  4AHC A;  4EZ9 A;  4DTS A;  2P9I B;  3A5M C;  4O0I A;  3LDP A;  4FJG A;  4FWK A;  1SS6 A;  2VYP A;  3AY9 A;  3T1Y K;  3FFK B;  4GKJ K;  2O8C B;  4BR5 A;  2O8B A;  1U48 A;  2Y1I A;  1VSD A;  4HUE A;  4ZTJ A;  5GIP A;  3C7N B;  1Q82 O;  2PYL A;  5BRD A;  1O1W A;  2YJE A;  3ALY A;  4DR1 K;  3SK3 A;  2VG6 A;  4IFY A;  3PV8 A;  4RCH A;  3SZ2 A;  4FWM A;  1EX4 A;  4L8R B;  5AZI B;  4BRA A;  3CXC M;  4XH4 A;  4KHU A;  2P9L A;  2YX6 A;  3M8S A;  4A57 A;  5ELZ A;  4BDZ A;  3L2R A;  3VTH A;  2RHK A;  3R6M A;  1NG9 A;  2G8K A;  3ZEU A;  5AQI A;  1BI4 A;  1KFS A;  3SAH A;  4F3O A;  4DSF A;  5AJ3 K;  3VF2 A;  4M42 A;  3VEY A;  4BRC A;  2Z1H A;  1HUX A;  1DEJ A;  3FZK A;  1BHL A;  1IKY A;  2O4G A;  1N32 K;  4KTW A;  2CH5 A;  2UU9 K;  1LWF A;  3D2F A;  4Z4E A;  4PKH A;  3DXM A;  5AQM A;  2QWQ A;  4JHD B;  1WLJ A;  2VG7 A;  4CJR A;  1L3V A;  2IDO A;  4JKE A;  5GIN A;  3NGY A;  1U2V A;  4H5W A;  1RCH A;  4HCB A;  3ZSW A;  1BA0 A;  1RTI A;  4BRH A;  3KD5 E;  3RMA A;  1YJ9 N;  3LDO A;  4ELU A;  4OKJ A;  4BRM A;  5AQK A;  4DSI A;  4FJM A;  1NGG A;  3TR8 A;  4NYN A;  2BDP A;  5HRP A;  4WFA L;  1KSP A;  3WEE A;  1IG8 A;  2V51 B;  3D2E B;  1IO2 A;  1J5E K;  4CIE A;  2HHW A;  4M3T A;  3CI5 A;  1GOC A;  4X66 K;  4KV8 A;  3RMB A;  3OS0 A;  3SAG A;  1QE1 A;  4ILG B;  3CD6 N;  2Q97 A;  3EZ5 A;  1VSK A;  3CCE N;  3E01 A;  1HPZ A;  4G1Q A;  3U8X A;  1Y97 A;  1KVB A;  3H3O B;  3K58 A;  2XY7 A;  4B9U A;  4DTP A;  3WQU A;  1VSF A;  2ZF5 O;  4AHV A;  1T03 A;  3H46 O;  1OH6 A;  4F2S A;  1VRT A;  5F2R A;  2O8D B;  3C6A A;  4OKE A;  4DQR A;  2OPP A;  3MEG A;  4CJ4 A;  2QWP A;  3A8Y A;  3AA5 X;  4AHU A;  2B5J A;  5AQG A;  3SUN A;  4PL7 A;  4J8F A;  4MFB A;  3AA2 A;  1GOB A;  3WXM B;  3ZSX A;  3MXM A;  1HLU A;  2V7Z A;  5MLC Q;  3A5N C;  2O8E A;  1LAW A;  4H0P A;  1P8Z A;  5HL7 L;  3U9Z A;  4GMJ B;  5AQP A;  4DV3 K;  3V4I A;  3M1F A;  5EY4 A;  3HPG A;  4DB3 A;  4GY2 B;  2D1K A;  1VQ8 N;  4CJV A;  5JLH A;  2KFN A;  4K42 A;  4LSN A;  4IKF A;  1OKJ A;  3VEV A;  2A5X A;  3HRG A;  3CQ8 A;  1IBM K;  3HO1 A;  3H08 A;  3TTC A;  4ELT A;  1EO1 A;  5F0X A;  4CHP A;  3WNF A;  1VQK N;  3JYT A;  4JKG B;  1VSI A;  2F8T A;  5AQV A;  4AF1 A;  2YHA A;  3EZW A;  4M3U A;  1QQM A;  3L0Q A; 
#chains in the Genus database with same CATH homology
 3ATV A;  3HSC A;  1GLF O;  5LJW A;  1KQS M;  3ID8 A;  3RSE A;  2OAN A;  2QTD A;  4BR4 A;  4FPB A;  4IO8 A;  1CZA N;  1JCG A;  5C12 A;  1YUW A;  3CCJ N;  4ISG A;  4CI6 A;  2NZT A;  3ATU A;  4FOI A;  2NLX A;  3A0I X;  4UY8 O;  4DCH A;  1VQL N;  1YVN A;  4MLE A;  3IFR A;  2YI1 A;  5CR4 A;  2W40 A;  3QIC A;  5AQS A;  4BVO A;  2A6A A;  5GAE P;  4BC4 A;  3SAF A;  1NGD A;  1RFQ A;  1N8R O;  4A5B A;  4IOA L;  2QWR A;  3DXK A;  3ZEU B;  3N4P A;  2P9S A;  1JCF A;  3O08 A;  4IZ9 A;  3BF1 A;  3VOV A;  1MA9 B;  4FVU A;  3EN9 A;  5DM6 L;  3CC4 N;  2FSN A;  3O9S A;  3WEE B;  3O6W A;  4BVP A;  3QB0 A;  3O1W A;  1YJW N;  5GAD P;  1ILY A;  3C7N A;  3UKU A;  4IEI A;  5CHI A;  4E1J A;  3TSU A;  3O8M A;  4WQ4 C;  4A62 A;  2P9K B;  2ASM A;  4WQ4 A;  3IKM A;  1S72 N;  3GE1 A;  4JD2 B;  4PL8 A;  1M1K O;  5KQD A;  4I6M A;  1SAZ A;  1TUU A;  3T7Z A;  4DKW A;  1QZ5 A;  2P9N A;  3CHW A;  2IIR A;  3QFU A;  4CD1 A;  4PHT X;  4R79 A;  2DPN A;  4KH6 A;  3M5R A;  3MX5 A;  3E1Y A;  3ULE B;  1M90 O;  1GLL O;  4A2B A;  3C0B A;  3E9P A;  3VPZ A;  3N4Q A;  5AQZ A;  3G4S N;  2QWM A;  2VWB A;  1K8A O;  5I9E B;  1KAZ A;  2E2Q A;  3TTD A;  5BN9 A;  4FPA A;  4K43 A;  3WXJ A;  2Q1N A;  3TTF A;  2QA4 N;  1YAG A;  5BPM A;  4YOX A;  3CCV N;  5AFU A;  4H5R A;  2F7T A;  4BG8 A;  4H5N A;  4BRE A;  4YOW A;  1Z6R A;  3ENB A;  4JKA A;  1Q7Y O;  1Y64 A;  3SMP A;  2ZWH A;  4ISF A;  2W41 A;  3D6R A;  3O9U A;  5M1P A;  1S22 A;  3UKU B;  4RWT A;  4FWQ A;  2HOE A;  4NO7 A;  4IJA A;  1Q81 O;  1K8K B;  3QDK A;  4H5V A;  4GVE A;  2VCP A;  1YXQ A;  2E1Z A;  3CPW M;  2QW9 A;  1OVY A;  2CGK A;  2BH1 A;  4QS7 A;  3UKR B;  2OTL N;  3MMV A;  4IJN A;  3AGK A;  2WFB A;  5HOO A;  4FWL A;  5DM7 L;  3VF4 A;  2P9P B;  2FXU A;  5AQJ A;  5KPT A;  1NGF A;  1ZBS A;  5JVG L;  4IEE A;  3PLA A;  3VEN A;  1KXP A;  1NWK A;  1QQO A;  3L4Q A;  4ILJ A;  2J4R A;  2QM1 A;  1TUY A;  2E2P A;  2NRW A;  2ZGZ A;  3FZM A;  4BRF A;  5BRH A;  4BR9 A;  4JK7 A;  3WXI A;  1RDU A;  4XH5 A;  4JHD A;  5GAG P;  3IMX A;  2HBM A;  2NRT A;  3HI0 A;  4YOU A;  5C15 A;  1GLD G;  4CJ7 A;  5KPR A;  3U9D A;  2I7N A;  2HBK A;  3NVK A;  3CCQ N;  1QZ6 A;  2HF4 A;  2FSJ A;  1U6Z A;  4JK8 A;  4JKC A;  1V4S A;  2QWL A;  3MWP A;  4RTF D;  3F2K A;  3J7Z O;  3CET A;  4Z94 A;  2E8A A;  2YCH A;  4BRD A;  3WT0 A;  3NMU A;  3CPE A;  3E66 A;  1NGB A;  3KZB A;  3M3Z A;  3MN7 A;  3O1B A;  4HWI A;  3QBW A;  4H5T A;  4AM6 A;  3CCS N;  5H1S Q;  4O5F A;  3DWL A;  2F9T A;  3VES A;  3K9J A;  1DGK N;  2QEX N;  4BR2 A;  4BRP A;  1NLV A;  4NB4 A;  3GDQ A;  1BU6 O;  3O9T A;  5LY3 A;  2JWK A;  3LDQ A;  3MN6 A;  2NRX A;  5BRE A;  3RVC A;  3O80 A;  4BQZ A;  3VF6 A;  4FWR A;  4YOY A;  5AQT A;  3UKR A;  4NLC A;  3P38 A;  4FOE A;  4B1W B;  4L3Q A;  4GV9 A;  4H0V B;  3HOS A;  3H1V X;  1LCU A;  4BC3 A;  2ZJQ L;  1BG3 A;  1Q18 A;  2D0O A;  5TKY A;  3I8B A;  3ZYY X;  3A5L C;  2H3G X;  5AR0 A;  4BC5 A;  3GBT A;  1HKB A;  1P90 A;  5AZJ B;  3AAP A;  3R3L A;  4BR0 A;  2Q31 A;  4GV6 A;  3HOT A;  3VEW A;  4BRO A;  3CJA A;  4A5A A;  3M6G A;  1QHA A;  3CC7 N;  5AFU H;  5M1F A;  3F5T A;  4MDA A;  2PAV A;  1MDU B;  2JWL A;  3DLL L;  4ISE A;  3W0L A;  5BPL A;  5AQW A;  4JK9 A;  4U7B A;  4M7X A;  4IXC A;  2GEL A;  1HJO A;  2NRH A;  2NRV A;  4BC2 A;  3R8E A;  2E2N A;  3OBY A;  3E9L A;  3VGK A;  4CBX A;  3TSQ A;  4EFH A;  2EWS A;  3D2E A;  4G9Z A;  2D0P A;  3GG4 A;  4FWO A;  3GOI A;  4WQ5 A;  2VGM A;  3VEO A;  2Q0R A;  4JEP A;  4O8K A;  2YHX A;  3F9M A;  2GUP A;  1SZ2 A;  2NNW A;  5JVH L;  4CZK A;  4BRN A;  1HKC A;  2E20 A;  3K9K A;  3KVG A;  1T6C A;  4C1N I;  4A61 A;  3MN9 A;  4JAX A;  3EKS A;  4O8U A;  3ULE A;  5M1K A;  1GLE G;  4ILH A;  4WFN L;  1TYQ B;  2AP1 A;  2IVP A;  2FF3 B;  3LM2 A;  1BO5 O;  5BN8 A;  3FZF A;  4DQ8 A;  4U67 L;  4KH5 A;  3ZX0 A;  3LDL A;  4B9Q A;  4IO9 L;  1QVF M;  1BUP A;  1ESV A;  1XUP O;  1VQ5 N;  1JJ2 M;  5AQR A;  1MWM A;  2A41 A;  5C0Y A;  2KHO A;  1WUA A;  4JKB A;  3BP8 A;  3OHR A;  5GIO A;  5M1Q A;  3VGM A;  4K25 A;  3CMA N;  1H1V A;  4WQ5 C;  2GX9 A;  2P9U B;  4FWP A;  5EVZ A;  2F9W A;  3EKU A;  2A42 A;  3ZX2 A;  1KC8 O;  2P9I A;  3SBT A;  1O13 A;  2Q2R A;  3H45 C;  1NGA A;  1GLJ O;  3LDN A;  4GNI A;  1KAX A;  4BG9 A;  4WYB A;  3QML A;  4CZM A;  2ITM A;  4GV3 A;  2BTF A;  3CJB A;  4EHT A;  4Y0W A;  5BR9 A;  1NGH A;  2IVN A;  2KKZ A;  5C2F A;  5F1X A;  2GTD A;  4M7Y A;  2QWN A;  4MO4 A;  2P9P A;  4NLB A;  5EOY A;  1VQN N;  3VER A;  4H0T B;  4WF9 L;  3DAW A;  4JNE A;  3O9Q A;  1TYQ A;  4IOX A;  4WFB L;  4FWS A;  3VET A;  3BUZ B;  1EQY A;  5AZI A;  3UB5 A;  2NRZ A;  1ATN A;  1D4X A;  2AA4 A;  2YHW A;  1X3M A;  2E88 A;  5ADX H;  1X9J A;  3I33 A;  3CJ9 A;  3MDQ A;  3SBG A;  3VTI A;  4B1X B;  4B1Z A;  2A40 A;  1RDW X;  2QXL A;  5LJV A;  4OO1 J;  3O4W A;  3KK7 A;  4BGB A;  4A2A A;  2FF6 A;  3A5O C;  3JS6 A;  3CER A;  2P9I B;  3G25 A;  3A5M C;  2I7P A;  1J6Z A;  3NVM A;  3SJH A;  4B1V A;  2ASO A;  3LDP A;  4XEI A;  3ENO A;  4FWK A;  5KQ8 A;  3MCA B;  4JKD A;  1SS6 A;  2VYP A;  4F9O A;  1K73 O;  1NBW A;  3AY9 A;  3FFK B;  3L6Q A;  2HBJ A;  1C0G A;  4BR5 A;  2OTJ N;  1GLB G;  4FWN A;  4C1N K;  5FPE A;  2QWO A;  3CC2 N;  2UYT A;  3CIP A;  3EO3 A;  3ZX3 A;  1MWK A;  1XC3 A;  1K8K A;  3P39 A;  3C7N B;  3W3D A;  5GIP A;  1Q82 O;  2P9N B;  1YF5 L;  3SMS A;  5BRD A;  3KWG A;  3RSE B;  1DKG D;  2YJE A;  4BRQ A;  4EAH D;  1LOT B;  3SK3 A;  4IWV A;  3TU5 A;  3EE9 A;  3MX2 A;  4DHY A;  3CCR N;  3T69 A;  3KWI A;  4RCH A;  1Q86 O;  4FWM A;  5EX5 A;  3DXM B;  3WUH A;  5AZI B;  3ENH A;  4CBU A;  1Z05 A;  4KBO A;  4BRA A;  2V7Y A;  4XH4 A;  3CXC M;  1ATS A;  2P9L A;  2YX6 A;  4BGA A;  4A57 A;  3MCP A;  4MO5 A;  1G99 A;  5ELZ A;  3VTH A;  1ZC6 A;  2RHK A;  2E1Y A;  4QS9 A;  1DT9 A;  3R6M A;  3AAR A;  5AQY A;  1GLC G;  3H3N O;  3DXK B;  3ZEU A;  2VGN A;  5AQI A;  4BY9 C;  3CCU N;  2WC9 A;  3UE5 A;  3FLC O;  1W2B M;  3JXU A;  1VAZ A;  3C6H A;  3AAQ A;  3DJC A;  3SAH A;  2YHY A;  3EL2 A;  3VF2 A;  3VEY A;  4BRC A;  1VQ4 N;  3O9R A;  3CJ1 A;  4FSV A;  1HUX A;  4YOV A;  4XH1 A;  5EXW A;  1DEJ A;  3FZK A;  3HM8 A;  3ZET B;  3Q7C A;  3MK6 A;  1NJI O;  2CH5 A;  4JN4 A;  3C65 A;  3FZL A;  2P9K A;  3VGL A;  3D2F A;  3R9P A;  3WXK A;  4PKH A;  3DXM A;  5AQM A;  2QWQ A;  4JHD B;  3IUC A;  4B1Y B;  5C2D A;  4BRK A;  4JKE A;  3CME N;  5AQL A;  1GLA G;  1HKG A;  3FGU A;  4JKF A;  5B8H A;  5GIN A;  2D4W A;  1HX1 A;  1U2V A;  1KAY A;  4H5W A;  3L4I A;  1BA0 A;  2NRR A;  4BRH A;  1YJ9 N;  4MDB A;  2P9L B;  3LDO A;  3O5B A;  1BOT O;  1IJJ A;  3HBT A;  4BRM A;  5AQK A;  4OPH A;  1RGI A;  3PIO L;  5BPN A;  4CZE A;  4CZH A;  1BA1 A;  3CQY A;  4H0X B;  1NGG A;  3CJC A;  3TSP A;  1V4T A;  3PIP L;  4AM7 A;  3LL3 A;  4BQL A;  4BR7 A;  3OA9 A;  3OW2 M;  3LM9 A;  4WCE L;  2P9U A;  4IDH A;  3BF3 A;  4WFA L;  1VQO N;  1E4F T;  3WEE A;  3HTV A;  4BRG A;  1IG8 A;  3H6E A;  2V51 B;  3D2E B;  5JMV A;  1R59 O;  2GWK A;  3CQX A;  3U4L A;  3CI5 A;  4EIA A;  4CZI A;  4BRL A;  4YOR A;  4HTL A;  1YIT N;  3SAG A;  3CJ7 A;  2HBL A;  4PKG A;  3TPQ A;  4FL9 A;  1YHQ N;  2PBD A;  5AQO A;  4ILG B;  4YDU A;  1ATR A;  4B1U B;  2WUS A;  2ZJP L;  2Q97 A;  4IOC L;  3CD6 N;  4M63 C;  4JKH A;  1NM1 A;  2ZGY A;  4OPA A;  3WXL A;  4A59 A;  1U2V B;  3CCE N;  4CZF A;  3I56 N;  2V52 B;  4YOT A;  3BEX A;  1W97 L;  3QFP A;  2GEM A;  3U8X A;  2CGJ A;  1VQ7 N;  1T6D A;  5AQH A;  1XQS C;  3AGR A;  3E9O A;  3H3O B;  3CCM N;  4YDU C;  3WQU A;  3VEX A;  4LC9 B;  2ZF5 O;  1NGJ A;  1VQ6 N;  3H46 O;  1S3X A;  5FPN A;  3P4I A;  2Q0U A;  5F2R A;  3Q7B A;  5AQQ A;  5JLF A;  3SLC A;  3C6A A;  1VQ9 N;  1YJN N;  4CZL A;  3VMF B;  4CZJ A;  3S41 A;  4BRI A;  1YI2 N;  2QWP A;  2YJF A;  3A8Y A;  5AQN A;  3MN5 A;  2HMP A;  4FO0 A;  3FZH A;  1X3N A;  5AQG A;  5BRF A;  1BDG A;  3GL1 A;  5KPZ A;  2Q36 A;  2ASP A;  3ID6 A;  5AQU A;  2FLO A;  4J8F A;  4PL7 A;  3H1Q A;  1NMD A;  3EE8 A;  5M1N A;  2HF3 A;  1QVG M;  4H0O A;  5JIC A;  2QI2 A;  3WXM B;  5GAH P;  3R1X A;  1VQM N;  4H0Y B;  5M1O A;  1HLU A;  2V7Z A;  5MLC Q;  3G71 N;  3A5N C;  4H0P A;  5HL7 L;  1P8Z A;  3P31 A;  4MLH A;  4QS8 A;  3U9Z A;  5AQP A;  5TKW A;  1WOQ A;  5CE3 A;  3M1F A;  3CF5 L;  5AZJ A;  2RE2 A;  2KLA A;  5EY4 A;  4PKI A;  3J8A A;  2BUP A;  4DB3 A;  2FSK A;  4GY2 B;  2D1K A;  3WQT A;  1T44 A;  3HZ6 A;  2CH6 A;  1VQ8 N;  3IDH A;  2HST A;  4CZG A;  1BWF O;  3OBW A;  5AQX A;  1JCE A;  1HPM A;  2IVO A;  4CD3 A;  5JLH A;  1T3V A;  5AQF A;  1NGI A;  4CBW A;  4K42 A;  3D7E O;  5FPM A;  2ZJR L;  2PFU A;  4KH4 A;  1OKJ A;  3VEV A;  2A5X A;  1E4G T;  3HRG A;  3I55 N;  1YIJ N;  5ADX A;  3KHY A;  2P9S B;  2E2O A;  3B8A X;  4C23 A;  1VQP N;  1SQK A;  2GWJ A;  2WBN A;  3TTC A;  1EO1 A;  5F0X A;  5E26 A;  2A3Z A;  3ZET A;  1KD1 O;  1NGE A;  4H03 B;  5C10 A;  1VQK N;  4JD2 A;  2CGL A;  3FR0 A;  1NGC A;  4JKG B;  4I6M B;  4K41 A;  5E84 A;  4EHU A;  1K9M O;  1C0F A;  3QBX A;  3D2F B;  1QQN A;  3VEZ A;  3G6E N;  5FPD A;  4IFE A;  4JKG A;  3MWT A;  5AQV A;  3CCL N;  4AF1 A;  3EZW A;  3FE1 A;  1ZXO A;  1QQM A;  3L0Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...