3LALA

Crystal structure of hiv-1 reverse transcriptase in complex with n1-ethyl pyrimidinedione non-nucleoside inhibitor
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
553
structure length
553
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV Reverse transcriptase
publication title N1-Alkyl pyrimidinediones as non-nucleoside inhibitors of HIV-1 reverse transcriptase.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase
total genus 157
structure length 553
sequence length 553
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3lalA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3lalA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3lalA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3lalA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3lalA05
3M8PA 1BI4A 1RA6A 4DMNA 3SPYA 1QS4A 2OPQB 4F8RA 5CYMB 5J2NB 2DPIA 1JLEA 4DL7A 3QEXA 5J2QB 1U48A 3B6OA 2F8TA 4HYKA 3LP2B 4FS2A 3CJ2A 4OKEA 3UIQA 2FLPA 1VSKA 1JL1A 1TKZA 1SL1A 1L5UA 1N56A 2XRIA 1TK5A 4J9LA 4K8XA 3AVFA 2HNYB 4CHQA 3M8QA 3D28A 3OVNA 2OPRB 1N6QB 4JV2A 2XGPA 3L3UA 2ATLA 1C0UB 1RDRA 1TKTA 4BE2A 1FKOA 4M3ZA 4IDKA 3NFAA 3GILA 5I3UB 4JLHA 1REVA 3VQAA 3PJXA 4ECSA 1BI4B 2KW4A 1N4LA 4FJ7A 3HVRA 3N6MA 4NLUA 3KD5E 3RB6A 1JLEB 3FQLA 4H4MA 3RBEA 2IJFA 1TP7A 1SV5A 2B43A 3CM5A 4O0JA 3OYCA 4TYBA 4CHNA 1IKVA 4O3NA 1TKZB 3LP0A 4TLRA 4NYFA 2YNFA 4RNNA 1C6VA 3KLGA 4KHUA 5DGBA 4Q43A 1NOZA 4M3TA 1SKRA 2C2EA 3FSIA 2KQ2A 2JC0A 4CGDA 3LP1B 4J9KA 3N6LA 4BE0A 1S0MA 1ZBUA 3VQEA 1FKOB 3CVKA 4IDKB 1KFDA 1SH3A 1REVB 4PA1A 4IRDA 4MIBA 1BQNA 2O5DA 1BQMA 3T5JA 3EY1A 4R8UA 5JS2A 4FBTA 4O55A 5EDWA 4LSNA 4GMJB 3OSPA 3V9XA 4ZPDA 5KGWA 4M94A 1SV5B 4WYLA 4F4ZA 1HYVA 1IKYA 5KFFA 1JLFA 1IKVB 3Q8SB 3VQQA 4G1QA 1J5OA 4DL6A 4QW8A 1IG9A 5KFUA 3LP0B 3CFOA 1C0TA 3AVBA 4FM2A 3VQPA 3SUOA 3RRHA 4Z4GA 3KLGB 5C25B 2ZKUA 4CERA 2ZQBA 3NF8A 3ISNC 4CF2A 1S49A 4RW6A 4EP4A 1KHVA 2LSNA 1TAUA 1KRPA 4WFYA 4DTPA 5HROB 4PQUA 4EEYA 3G0ZA 3TVKA 4EO6A 4CIEA 1BQNB 1J53A 1BQMB 4Z4CA 4DFJA 4R8UB 4HUFA 3CIZA 2HHTA 4LSLA 2F8SA 3CDUA 4M41A 2C2RA 4LSNB 1WNSA 4FJMA 3SNNA 3SCXA 1S6QA 4E1NA 5EWFA 4NLTA 2E9RX 3HP9A 1IO2A 3QEWA 1IKYB 3KK2A 4AHCA 3V1RA 1JLFB 1J5OB 1SKWA 3MECA 4XO0A 1C0TB 1HYZA 3BREA 4RUCA 1VSEA 3EYZA 3CO9A 2G8HA 2FBYA 2IAJA 4MIAA 4RW6B 3TI0A 2W42A 3NAIA 1ZBIA 2G8UA 3ICLA 2AGPA 2WK4A 2ZD1B 5JS1A 2HHQA 4IRCA 1TL3A 3AO3A 2IJNA 3PJWA 1RILA 2ATQA 4LSLB 2FVPA 4URQU 3L2WA 4E3SA 5KFOA 4H8KA 1C1CA 3PO4A 1TAQA 1RTIB 3OYGA 3MR6A 1S6QB 5KFRA 1UA0A 4DSIA 3CWJA 2QKBA 4KTWA 1FK9B 2WB4A 2JEFA 4DEZA 3CDWA 1O1WA 2KTQA 3PX0A 2BGGA 3H59A 3V6DA 4FJHA 4J9SA 4OGEA 3OL8A 3OLAA 4NLYA 1RT5A 2UUTA 1XR5A 2D3UA 3QERA 2IAJB 5FRMA 3IAYA 2GUIA 4Z4HA 4YNQA 3AVHA 3T1AA 5KT4A 4DFPA 2YNIB 2DPJA 3L3VA 2AU0A 2XHBA 3AVCA 5KFBA 4F4KA 3H5SA 4DQSA 1RT6A 5KFVA 4WXOA 1TL3B 4DTRA 5HRRA 4ECVA 3T5LA 2V4QA 5KT2A 1WSJA 3M8RA 4FLUA 3H2LA 4ZVEA 2WRMA 3KTQA 2X6NA 2DFHA 1C1CB 1S48A 3JSMA 4ZVHA 2FBXA 2HMIA 4QW9A 1JLQA 2QK9A 3ZT1A 3PW4A 1RT4B 4GC6A 4BWJA 5FROA 4M45A 4Y2CA 3DMJA 1T7PA 1RNHA 3ZSXA 2EX3A 1RTDA 3QESA 2HVHA 5DG8A 3PW7A 4BDZA 4CEAA 4KB7A 3IGNA 3NAHA 3QZ7A 3OL7A 4AHSA 3AV9A 2W7OA 1RCHA 1VSIA 3SFUA 3AO2A 2UVUA 1HRHA 2G8FA 4F3TA 4GW6A 5F8NA 3TWHA 3JSMB 3AA3A 4IOBA 2P5OA 2HMIB 4N41A 5KG0A 2J6TA 2ZE2A 2A1SA 2VG7B 1JKHA 5KG3A 3PR5B 1JLQB 4KBIA 4JRPA 1ZBHA 3U6FA 2Y1IA 3OYKA 4Q8EA 1UA1A 4QWEA 4J2BA 3DMJB 4CJEA 3TAPA 3DRSA 2FVSA 3V9SA 4DLEA 1RTDB 4OVLA 4EZ9A 3DDKA 1LAWA 1WNEA 4DFMA 3T3FA 4DS4A 4IFYA 2R8GA 3VQBA 3AO4A 1ZBFA 3PW0A 1KVCA 2XY6A 1A5WA 4FJXA 3I8DA 4RW4A 1WSIA 2JGUA 3NGZA 1XC9A 2ZE2B 1U09A 5KT7A 1UOCA 1JKHB 4O3RA 3OYDA 3EZUA 1YVUA 4CEDA 2HHWA 3NF9A 1CXUA 3VQ9A 2VG6B 2ETJA 4O3OA 4OPJA 3BQ2A 5CY4A 4WZQA 3G6VA 1LWEA 4CF8A 4O5BA 2W8KA 4DQIA 2WTFA 3DRSB 1ASUA 2OPSB 3HO1A 1S5JA 3A2FA 4O0IA 4E19A 4ED7A 4M3XA 1I39A 4IFYB 4JV0A 1LW0A 5L1KA 4CIFA 2FLLA 3M9MB 4CJUA 3NDKA 4LH4A 2GIRA 2R2RA 4HKQA 4RW4B 4RW9A 3AO5A 1S1VB 3KK1A 3V9UA 4B8CA 2YNGA 3MFIA 1S1WA 3LWLA 4ECUA 1KFSA 4J2EA 1X9WA 3V9WA 4IR1A 3PX4A 3CG7A 4URGA 4FW1A 3VQ7A 4BWMA 1RBRA 1WLJA 1TKXB 5HRSA 2IM0A 4G3IA 2AX1A 4N5SA 3QGHA 4K4UA 5KFKA 1ASWA 1DTTA 3LDSA 3SQ0A 4EBCA 5CZ1A 1S1XA 3AVJA 4YR0A 3IS9A 1JIHA 4DWIA 4B8AB 3EPGA 3KMQA 5J2NA 3FQKA 3K5MA 3K58A 4TY8B 1ZBLA 3AA4A 2A1RA 4HTUA 1LW0B 4EBDA 5J2QA 4URSA 4TN2A 3AVMA 3C6TA 2DTUA 2ALZA 2E9TA 4ELUA 4DTUA 1CXQA 3OYNA 4MKAA 3KK1B 3ULDA 4M3YA 3C6UB 3VN5A 2YNGB 1F21A 1S1WB 4FZXC 3T5KA 2P1JA 3HHKA 2ASJA 2W9BA 3K59A 5KT3A 2XCAA 1ZTTA 4NLSA 4FLYA 4XPEA 5I3UA 4Q8FA 4LD0A 3U3YA 2RPIA 3TAEA 3QIDA 1DTTB 2IM1A 4KHWA 3OYMA 4IRKA 3Q8RB 4WXWA 1S1XB 3DOLA 3IS9B 1X1PA 5DGAA 3I5AA 1WAFA 4HHTA 4FLTA 3PW5A 3VQ6A 4NCBA 4O3PA 3HVAA 1TL1A 2HNZA 1Q9YA 5L1LA 4NCGB 3G86A 2CJQA 2YNHB 3C6TB 5KFHA 3F73A 2IC3A 3RR7A 2OA8A 4QAGA 2R7YA 4DTNA 1IKXA 2E6LA 2Z1IA 4FLZA 3JYTA 3HVTA 4FJJA 2W9BB 3LP1A 2BANA 4NZ0A 4K4VA 4WZMA 3OJSA 2P5GA 2E4LA 3KHLA 4IKFA 1RBUA 4RW8A 3UR0A 3H40A 4NLWA 5DQHA 1GOBA 1TGOA 1JLBA 1ASVA 1T8EA 1Y97A 3DM2A 2OH2A 1D8YA 2O4IA 4PWDB 1EX4A 4K4SA 4E89A 3DOLB 3B6PA 3BSNA 5KFEA 5EU7A 5KG6A 1BGXT 5C42A 3SYZA 4QWAA 3O4NA 3C94A 4XPCA 1HMVB 4DU4A 4O44A 2IM3A 1TL1B 3KNAA 1NK5A 4KI4A 2HNZB 4ICLA 4CHYA 2V9WA 4DTMA 1NK7A 4C8OA 3CQ8A 3RB4A 3BQ1A 1C1AA 2IGIA 1NKCA 3P83D 3NF7A 2IC3B 4DG1A 3VQ4A 4CJTA 4KHQA 1IKXB 3H98A 4CK2A 3NGDA 5C25A 3BJYA 3JYTB 3HVTB 3MR2A 4B3OA 3S3OA 2HAIA 3OS2A 3DYAB 4I9LA 5KGXA 3VQ8A 2BANB 1YT3A 4CFAA 3LZJA 5KFTA 1N48A 2DFFA 5KI6A 4CFCA 1HNIA 4B9VA 5F8LA 4CIGA 4I2PB 4RW8B 1NK8A 3CDEA 3AVGA 4J9QA 5HROA 3SFGA 4NYNA 3NAEA 3CJ5A 1X9MA 4J2DA 1JLBB 4DL2A 4CGGA 4GVMA 3DM2B 1IM4A 5KG5A 4I2QA 3TQ1A 2W8LA 1NJYA 2X78A 1QTMA 5C42B 4YMEA 3D45A 4O44B 4BACA 2XY8A 3HK2A 3L2UA 3PR4A 4ICLB 3OYBA 3TANA 3DLGA 3OYLA 5KFMA 3MFHA 4CJ3A 4NLRA 2WONA 4NLQA 2CKWA 1GX5A 4ZP7A 1KVAA 1VK0A 4DG1B 4CJVA 1BCMA 5F9NA 2GBZA 5KT6A 3GV7B 4B3OB 4I7FA 4PUOA 3RWUA 1VSMA 1QE1B 1I6JA 1HNIB 3VQCA 4AHVA 5KG2A 3OYEA 4MK9A 2ZD1A 4M3WA 2AQ4A 4FJ9A 3AVLA 3OL6A 5KFPA 1NK6A 4QWBA 1TV6B 1JL2A 1A5XA 1KLNA 1QSYA 3ITHA 4I2QB 1ZYQA 4DL3A 4CGHA 3HPOA 1S9EA 2G8WA 1HJRA 1RTHA 1RTIA 3MR5A 3MXJA 4CJFA 2HHSA 3NMAA 3HXMA 4FJLA 1NKBA 3HPGA 1FK9A 4FJGA 3DLGB 4H54A 4FK0A 1YVFA 1FXXA 3V1QA 2WONB 4Y2AA 3MTKA 1JXBA 3LWMA 4R0EA 3CFPA 5KFWA 4IQXA 1RBVA 4KHNA 4DSEA 4EZ6A 4KKOA 3SJJA 4I7FB 4PUOB 1T94A 1EP4A 2YNIA 1WSEA 3RTVA 1S10A 3PW2A 5C5JA 3SV4A 1S0OA 2YHAA 4K4ZA 2R8KA 4BDPA 4DQRA 4XIUA 2W9CA 2WOMA 3ITHB 4ECTA 3KKRA 4W5RA 3L2QA 1S9EB 1C1BA 1S1TA 5CYQA 1RTHB 4ED2A 4DSJA 1BCOA 5KRTA 3QIPB 1VRTA 2D5RA 3MEGB 1RDDA 2QKKA 5KFZA 5L1IA 3D5MA 4F4WA 2VWKA 2AX0A 1HQUA 5I42B 1RT4A 2D0CA 4IH7A 1WSFA 3EZ5A 4CEFA 3QINA 4KKOB 1C0MA 1CZ9A 4CJLA 1QAIA 2BR0A 1L3SA 4OGCA 2C2DA 1R0AB 4MQ3A 2G8VA 1VSDA 1SL2A 2R2UA 5CZ2A 1EP4B 4O3QA 2AWZA 1MU2A 4N56A 1UWBB 4FZZA 2BQ3A 4TQSA 1Z26A 4CFDA 2PYLA 4E7LA 3LAMA 5E41A 4KTZA 3RR8A 1LWFA 3LAKA 3E51A 4YQWA 3SUPA 2YV0X 2W9CB 2WOMB 4F4XA 1NJZA 3KJVA 4CK1A 2D0BA 1C1BB 1S1TB 5CYQB 3OY9A 3N6NA 4K4XA 3GYNA 2FJVA 3TABA 3VQDA 1VRTB 3ALYA 3DLBA 4LQ9A 1C2PA 2VG7A 3GV8B 1JLCA 2FVRA 4KI6A 3GIMA 4ELVA 4QWDA 1HQUB 1S9GA 4ZMMA 4RNMA 3OL9A 3BR9A 1RT2A 2FVCA 4KAZA 1ZETA 1S9FA 4DF8A 3DLRA 4DTJA 2BE2A 2R2SA 3QNOA 2EC0A 4DFKA 1MU2B 5DG9A 2HB5A 1WSHA 5HBMA 4CJ4A 4DSKA 3LANA 1LWFB 4KRFA 4CJWA 3PX6A 5EWGA 3HPHA 1T3NA 4FBUA 5F9LA 3C95A 4NLDA 3OHBA 4FK4A 4W5NA 2OYQA 3KLVA 1W25A 3PUFA 4YP3A 1JLAA 2D3ZA 3KJVB 5JUMA 4FJIA 4FJ8A 5HLFA 1QUVA 3LP3A 2WCXA 4CCHA 4QCLA 1CSJA 1QHTA 4FYDA 3QIOA 4KV8A 4OPKA 4KTQA 3MXMA 5DQIA 1JLCB 4EBEA 2XI2A 1S9GB 2VG6A 5KFYA 2JC1A 1NKEA 1U45A 4KHRA 4J9PA 2B4JA 3CJ0A 1RT2B 4CHZA 4FXDA 4CJRA 1NHUA 2I5JB 4ZPAA 2PZSA 4ID1A 3MXIA 2R8HA 2BE2B 2X74A 5EWEA 3TAFA 2OPSA 3K5OA 3HT3A 2V0NA 3M9NB 2Q3SA 5HBMB 3CYMA 1SL0A 4MKBA 4LH5A 4TSXA 2AGOA 2HHVA 4BE1A 5HRNA 3ZT2A 4NLOA 1SH0A 4DU3A 4C8KA 1JLAB 4Y1DA 4ECYA 4CFBA 1GX6A 3QZ8A 5HLFB 1RA7A 4X2BA 4C8LA 3CJ3A 5DLFA 1UAXA 1S1VA 4CHPA 4CJKA 4CF9A 2WHOA 3KOAA 4KV8B 4KHMA 1SH2A 2OPPB 1BHLA 4KE5A 3ZT0A 4L8RB 4DSFA 3KK3A 4U6PA 2RDIA 2HWHA 4FLXA 4Z4EA 4AHTA 1A5VA 1KCFA 4ED1A 5F8IA 1TKXA 2DFEA 4CGJA 2IDOA 5KG4A 2UVVA 1NHVA 3G6YA 4ED0A 4Y34A 2XY7A 3AVKA 3HJFA 4NLXA 1DTQA 4ZPCA 2UVRA 2UVWA 4QOZB 3TR8A 4IG3A 2R8IA 4TY8A 1SKSA 5KT5A 1XR7A 4LQ3A 3L8BA 4Q5VA 1T03B 1Q9XA 3OS1A 5KFJA 1JX4A 4F50A 2R2TA 3WNGA 4DF4A 1IKWA 1Q8IA 2NUBA 1D9DA 4O4GB 2RKIB 1K6YA 3C6UA 3LPTA 1GOCA 5T14A 2G8KA 2W9AA 4J9NA 4K50A 3O4QA 3ZSRA 4W5QA 3KK3B 4ZPBA 3P1GA 5DK5A 1TK8A 3T19A 2E9ZA 2AGQA 2P51A 4N47A 1B9DA 5EUHA 2UUWA 1HYSA 4E7KA 3DLKB 3OYFA 4B08A 3AVAA 4FW2A 3SQ2A 1S97A 3IG1A 3UQSA 3NE6A 4DQPA 4K4TA 3V4IA 3I0SA 5SZTA 3TAMB 1DTQB 4DL5A 4KAIA 4E0DA 1RT1A 3OS0A 3G10A 4IG3B 4F2SA 5J1EA 1NNDA 2HHUA 2XGQA 4NCGA 5HRPA 1NJXA 2YNHA 1HQEA 5KFSA 4KFBB 1QAJA 4NLPA 1XR6A 4FVMA 4ID5A 5DLGA 1IKWB 3GIKA 3ZSWA 3HL8A 1MMLA 4MK7A 4KHSA 3RAQA 4DSLA 1HPZB 1XWLA 1HNVB 3IN5A 1RT3A 3KKSA 1BL3A 4CJSA 1TK0A 1HYSB 1GOAA 1U49A 3THVA 3PV8A 3OYJA 3IG1B 4PWDA 3I0RB 5KFXA 3V4IB 3I0SB 1RT1B 4CJ5A 4DLGA 3SZ2A 5KFNA 4J9MA 4YR3A 1HMVA 2BRKA 5J1EB 4M3UA 2HW3A 3LZIA 4FJKA 2Z1JA 1HQEB 3K2PA 3NGYA 4KREA 3QO9B 4Q0BA 3MEDB 2FC0A 4ID5B 3DOKA 4ECRA 3L2RA 4OJRA 4AHUA 2IS3A 4B9NA 3NHGA 3QETA 3KHRA 1DLOA 3DYAA 3PO5A 4RZRA 1L3VA 4CESA 4TY9A 3MR3A 1RT3B 4NRUA 3DLEA 4I2PA 3Q8PB 1WAJA 1TVRA 1NOYA 3O3GA 4HUEA 4NLVA 4IH6A 1W0HA 2G8IA 4ZTFA 2HNDB 1S0NA 5DMRA 4MK8A 4HCCA 1N5YA 3IGVA 3NGIA 2IA6A 2O4GA 2FJXA 2XWYA 4N76A 2B6AA 2X6SA 3M8PB 4OLBA 3PZPA 3RMDA 4Q0BB 4Y3CA 4IH5A 3P5JA 3DOKB 2ILZA 2F8EX 5L9XA 4J9OA 2JEGA 2KZZA 3K57A 1BISA 4Q45A 5DG7A 1SUQA 2BQUA 1YTUA 1TKDA 3GIIA 1DLOB 1QE1A 4FM1A 3M8SA 5KFDA 5D3GA 3SPZA 2GC8A 3RMBA 2D41A 3DLEB 3QGGA 3NF6A 4B9UA 3BSAA 1TVRB 3BSOA 2JLEA 4CEZA 4FCYA 3M8QB 1TV6A 2KZMA 3G6XA 5F8HA 4FJ5A 1J9AA 4OKKA 1RT7A 3NH0A 1TKTB 1N5YB 4ECZA 1VSHA 1JXEA 5F8MA 4ECQA 3LPUA 2D7SA 2OZMA 3ISND 2YHBA 3D0PA 3DRPA 1QSSA 2B6AB 2VG5A 1Z25A 4H4OA 5C24A 3OYAA 5KTQA 3H08A 2VWJA 4CE9A 3SUQA 2XC9A 4OKJA 3WNEA 1SUQB 3HSTB 2QV6A 4UQGA 4H4MB 1S6PA 5K14A 3KIOA 3KHGA 5D3GB 3I5BA 3OSNA 1BIZA 2HWIA 4FK2A 1U04A 2YNFB 3HP6A 4M42A 1XHXA 4QWCA 3SV3A 4K4YA 5KFCA 2YKNA 2AJQA 1LAVA 4HUGA 3BGRA 4B9TA 4J2AA 4KB1A 4FZYA 1RT7B 3V6HA 1B92A 4E7IA 1LV5A 4I9QA 4WYWA 3SQ1A 2RF2A 3RAXA 4EP5A 1NJWA 4F3OA 4KB0A 3QIPA 3EPIA 3MEGA 3DRPB 4RU9A 2VG5B 4J9RA 3NL0A 3SQ4A 4H4OB 3GIJA 5C24B 3I5CA 4E1MA 3ZSQA 5I42A 3O3HA 3LALA 3QEVA 1Z4UA 1S4FA 4RNFA 3TAQA 3MAQA 3GQCA 4FM0A 1R0AA 3VQSA 1S6PB 4TQRA 4DTSA 3NBPA 5HP1A 2BQRA 5K14B 4ZP9A 1UWBA 4G1QB 5KFIA 4CECA 3IRXA 3V9ZA 3MEEA 5KG7A 1KVBA 3OJUA 4EO8A 3PVXA 2KFNA 3K5NA 2VA3A 1B9FA 1I3AA 2PY5A 1X9SA 2YKNB 2JEIA 3V1OA 3BGRB 2GV9A 4DU1A 4KPYA 1D0EA 2RF2B 3QNNA 3ZSVA 4DL4A 2D0AA 2ASDA 3QLHA 4PQUB 4DQQA 1NK4A 4W5OA 4F4YA 2XCPA 3KLFA 2Z1HA 3BQ0A 4JRQA 5J2PA 4CEEA 3NH2A 3KLHA 4C8NA 3S3NA 4F2RA 4AILC 3T5HA 4NLGA 3H5UA 3RMAA 3NBPB 5HP1B 4B9MA 3WNFA 5J2MA 4WE1A 3KK2B 4U7CA 4B9LA 3AA2A 2V4RA 1W9HA 4RW7A 3IRXB 3KHHA 3MEEB 4CJPA 3MECB 1QQCA 4FLWA 3ZSYA 3H4DA 3RB0A 2HVIA 2W7PA 1EKEA 3RRGA 5T7BA 1D5AA 3CM6A 3ZT4A 2RN2A 3K5LA 3QLHB 2QXFA 3OLBA 2GIQA 4ELTA 5KFLA 2HHXA 3KLFB 2IM2A 3AA5X 3SI6A 3KMSA 2FBVA 1QSLA 4JUZA 4EYIB 1VSLA 5FDLA 4JV1A 5FRNA 2ASLA 5J2PB 4ED6A 4ZTJA 3KLHB 3OHAA 3DI6A 2I5JA 1RYSA 1WSGA 2BDPA 5J2MB 4B9SA 4WE1B 3OYIA 5KFAA 3V6DB 4IBNA 4RW7B 2FJWA 4EYHB 4NCAA 4Z0UA 3RMCA 4PY5A 5SWMA 4ZVFA 3E01A 1RT5B 4FS1A 2F96A 2ITGA 3UPFA 3TAGA 2C22A 2OZSA 4AH9A 3FRZA 3KLIA 3AO1A 2YKMA 1JLGA 1RT6B 2C28A 3OYHA 1FKPA 4BDYA 3VQ5A 2PYJA 2OPPA 4MFBA 4CEBA 3GV5B 3V6JA 2VA2A 5FDLB 1KHWA 5KFQA 3AVIA 3ZCMA 4NYZA 3DI6B 4MH8A 2IMWP 3HYFA 3F9KA 4OL8A 5KFGA 1CZBA 2FVQA 3Q8QB 4O4RA 1NK9A 4M3RA 1TQLA 1RDCA 4ZHRA 1XI1A 4DTXA 2J6SA 1RYRA 3E01B 4ECXA 3AVNA 3MF5A 4W5TA 4WFXA 1EETA 1T03A 3HVWA 4IG0A 1HARA 1LW2A 1VSJA 4E7HA 3TARA 3L2VA 1VSFA 3KLIB 2YKMB 1JLGB 5KG1A 4OLAA 4C8MA 4Z4FA 4O4GA 2RKIA 4IR9A 1FKPB 1KLMA 5L1JA 1LWCA 3QEPA 4MFBB 3VA3A 2FLNA 1KTQA 3V6KA 2IBKA 4KSEB 3S3MA 2JEJA 3NH1A 4R5PA 1OS5A 3PHEA 3ZT3A 3FDSA 3DLKA 3ZSZA 1KSPA 3DRRA 3RBDA 2ILYA 2EHGA 4HCBA 1T05A 4CEOA 2R8JA 3O3FA 4ZVGA 5KRSA 4CF0A 3WNHA 4WFZA 5F8JA 4ED3A 3TAMA 4GC7A 3H5XA 4CGIA 4ZHRB 4CK3A 4KO0A 1RDBA 3NKYA 3VA0A 3M9OB 4NRTA 2RDJA 4FLVA 1D1UA 1EETB 2Y1JA 4KFBA 4IG0B 3KLEA 1LW2B 5F8GA 1S1UA 2DY4A 4RG8A 3S9HA 3QGIA 4CHOA 1RAJA 3FFIA 4YR2A 1KLMB 1K1QA 1VRUA 3ZSOA 4CEQA 1LWCB 3PY8A 1RBTA 1HPZA 3U3GA 1YTAA 4IFVA 5DQGA 2Z1GA 1JXLA 1HNVA 4R5PB 4RNHA 4ED8A 1EXQA 4DS5A 2FBTA 2B5JA 1WN7A 4AHRA 1U47A 3DRRB 3DLHA 4Q44A 1T05B 4M95A 1NK0A 2XI3A 2BRLA 4ZP6A 3I0RA 4QPXA 2I1RA 3H5YA 4TXSA 1RBSA 4CGFA 4KO0B 4Z4IA 1ZTWA 3V81A 1IH7A 3H4BA 3NCIA 1LWEB 1RTJA 1L3TA 3RB3A 4CJQA 4K8ZA 3KLEB 3KD1E 5JXSA 2KFZA 3QO9A 1S1UB 4RUAA 3MEDA 1J54A 3HM9A 4IKAA 2OPQA 1CLQA 4O3SA 3BDPA 2XY5A 3FFIB 1VRUB 5CYMA 3CJ4A 4HVJA 4RNOA 4ZP8A 4IFVB 1L3UA 4E7JA 3BSCA 3ASMA 3LP2A 3SI8A 4K4WA 2J6UA 3QEIA 4CF1A 4FJNA 2QE5A 2B5JB 4TYAA 4RW9B 3UDLA 2HNYA 1ITGA 1D9FA 3QYYA 1RDAA 4YFUA 2E6MA 2OPRA 2IOCA 1N6QA 4Y1CA 1K1SA 2XO7A 2HNDA 1C0UA 1G15A 4JS5A 1XHZA 3V81B 1BIUA 1U4BA 4ECWA 4DTOA 3CFRA 4JS4A 3SUNA 4KHYA 4LY7A 1RTJB 3HKWA
chains in the Genus database with same CATH superfamily
4CLPA 3TWZA 1IR2A 2LLZA 2V34A 1JXVA 2OPQB 4DV1F 3UKUB 3IXQA 2O67A 1CS4A 5B09A 2HBMA 1UFLA 1MWKA 1GTHA 1RSCA 4HYKA 5F3ZA 2GW8A 4FS2A 3QAEA 4OKEA 2XRIA 4K8XA 1BWEA 3AVFA 4CHQA 1SC6A 2FJAB 2DNYA 4LRBA 2A1BA 4NMXA 2XGPA 4IO9L 1TKTA 4BE2A 2B4VA 4IDKA 1E4FT 3GILA 4FWOA 1DQ8A 5C2GA 1QAYA 2ZWOA 3PJXA 1BI4B 4FJ7A 2MHNA 3L7OA 2KW4A 2OTJS 2N3LA 3I6PA 1YJVA 5D4NA 3K0JA 2MHEA 4A8OA 2DT9A 1U1OA 2X1BA 3GE1A 4H4MA 4KH1B 4U7UK 1SXLA 4WQ5C 4CH7A 4CHNA 4LBIA 1AB8A 2F4VK 3TVZA 4O3NA 4WK3A 5T7LB 2YNFA 4RNNA 3CPWM 3UNGC 5H1SV 2YJEA 5DGBA 2XHWA 1NOZA 2C2EA 2NXEA 1Y7PA 3FSIA 2GS8A 2JC0A 3LP1B 3H3OB 4BE0A 2DHAA 3MMAB 1S0MA 1UMJA 5BPMA 3BPSP 1HNZK 3LM9A 2ZH3A 4P75A 2CQBA 2X3GA 2O5DA 1BQMA 3CC2S 3KUHA 4R8UA 2WW4A 4LFAK 4BQLA 3W7BA 3MM9B 4FBTA 3G82A 4O55A 5HANA 3OSPA 2DCLA 4HR2A 3VGLA 5KGWA 8RUCA 2YHYA 1SQKA 1HBNB 3MDQA 4YOYA 3D6HB 5KFFA 4G1QA 1J5OA 4L6V3 4DBQA 3LP0B 5EX0A 2XS7A 4Z4GA 4DR7J 4NOHA 3ISNC 4CF2A 4RW6A 1P9QC 2LSNA 1X4GA 3WEEB 3KYLA 3CCTA 4C9DA 3W9HA 5EX5A 1M1GA 2MEWA 1N32J 4J37A 2E2QA 1TMJA 3T1HF 3IO1A 4EEYA 1V3ZA 1BQNB 1J53A 4Z4CA 3S7RA 3CSKA 2DKOB 1OY9A 4LSLA 2VC1A 5DM7Q 2IRYA 4FJMA 2FGCA 2MKHA 2VONA 5AQQA 3FCVA 5ETVA 2CPIA 4C11A 1NSKL 4NLTA 3BZQA 2E9RX 3RJMB 1DQ9A 3P39A 3BS9A 3THXA 1JLFB 6AT1B 4TU8A 2D1KA 3MECA 5F3TA 5K5MA 1WOPA 3Q0AA 3CO9A 2IAJA 2VQFK 1R27B 2I8EA 4LF9F 4M8LA 3U9ZA 2G8UA 3ICLA 2AF6A 2HHQA 4CBUA 4BRPA 5CZVA 3WXKA 4DUTA 4P71A 4H8KA 1C1CA 2H48B 3PO4A 3R2DJ 1IV0A 3CWJA 5CH7B 1Q7LB 1M5VC 2BMBA 4KTWA 2BGGA 1NDLA 1X5TA 2APOA 3UCZP 4BVOA 2DRDA 3CO0P 3B54A 5I3PA 2W2QP 3QPIA 4Y0WA 1XIQA 3IAYA 2MY8A 4GKKK 4Z4HA 3T1AA 4DFPA 4DR5F 4F36A 4IOCL 5GADU 2ZOGA 4DQSA 2F7TA 1VQKS 5KFVA 3ZX0A 1YVNA 1NBEB 2VF3A 2O8FB 2V4QA 1HBUA 3OHRA 4H5VA 4FLUA 4ZVEA 3HSJA 3GR1A 5GADI 2X6NA 2DFHA 3CCES 3JXOA 4ILLA 5L38A 3KNGA 4RUBA 5LXRA 2FJBB 5FLXY 1B7YB 1XQSC 4DV7K 4K7QA 2DD8S 1T44A 3U02A 3FSXA 1T7PA 1HBMA 4NA1A 5CAAA 3ZSXA 1NJIT 2DVIA 1Q78A 1AA1B 2W25A 3UB5A 3PW7A 3BP8A 2W7AA 4CEAA 4KB7A 4RBVA 1WKKA 3QZ7A 3EM1A 3ZTQA 4AHSA 4FWRA 1VBXA 3O80A 3F44A 3H8YA 1HRHA 3LUYA 3D2FB 4HH0A 3BYRA 3JSMB 5KG0A 2J6TA 2ZE2A 1P9YA 1NU4A 5LL6d 4KBIA 1ZBHA 4JRPA 3FVYA 2K06A 1GQEA 1Q8LA 3SMPA 4NEZA 3R9PA 1PYOB 1YIJN 2FVSA 1KEKA 4DLEA 2OP5A 1RTDB 3V9SA 3D0HE 4K2JA 2BH1A 4DFMA 3VVTA 2OELA 4IFYA 1GNKA 2E7XA 2VICA 1F0XA 5GADP 3HZEA 1YAGA 1ULRA 2XY6A 1QVGR 4ZVOB 2XBPA 4FJXA 1WSIA 2P2CB 3NGUA 4A2BA 3VR1A 5KT7A 2HQIA 2HIQA 3CCRN 1KQSM 3EZUA 4HACB 2HHWA 1YK9A 2WB1D 1WF1A 4JI7F 4F0MA 2UUCJ 2CXEA 4DX8H 4CF8A 1CLFA 4DQIA 3ZXWA 4JOUA 4M63C 4JHDB 4UY8O 2J7KA 1KP6A 1CZAN 1F9EB 3OBIA 5B0BA 2JJ4D 1S5JA 1DZ5A 1UPMB 3GFHA 1DKGD 1LOTB 2C2NA 3U1MA 2V2VA 1LW0A 3R5DA 3T6JA 3M9MB 1CJTA 3TU5A 2B4UA 3NDKA 4DV2J 3BGUA 4RW9A 3KK1A 4PG8A 2NRRA 4B8CA 4USMA 1S1WA 3BF3A 3LWLA 4FPAA 1VC6A 3TW0A 3V9WA 3DWLA 3PX4A 3OTCA 4A4JA 3CG7A 1WI6A 2VZ9A 4X64F 4RUHA 3VQ7A 1SJ4P 4NXMJ 3VEWA 1TKXB 1HKCA 2IM0A 2AX1A 3QGHA 2A6OA 1G7CB 5KFKA 1ASWA 3QT6A 3LOUA 3TX0A 3VEOA 5CZ1A 2IY5B 1AYEA 1XMOJ 3K58A 1ZBLA 4DV6K 4HTUA 4Y2MA 4URSA 3AVMA 3ENOA 2J76E 4YDDB 2ALZA 3L09A 4AXJA 3GG4A 1IBKK 3G87A 4C0HA 2DY1A 3CW2C 2G2OA 2H9ZA 1HPMA 3ULDA 1DRZA 3G8SA 3EUNA 3HHKA 2IVFB 3DHXA 1Z2LA 2QSWA 3CMES 2VKZG 4QIGA 5D6GA 1VQ6S 3SDEB 2HMPA 1JMTA 3W9IA 1U02A 4M7YA 3ILJA 5I3UA 2Q66A 3O9SA 4LD0A 1R6VA 4H0XB 2IM1A 2GX9A 2RQMA 3P5BP 3OYMA 3Q8RB 4NLCA 5M2UA 4DPOA 1X1PA 1A6LA 4P9SA 5DGAA 3FEXB 4NCBA 3H6EA 2HNZA 2GHVC 2GVZA 5KFHA 1X5OA 1BWFO 3DLLL 1IKXA 1FEHA 1EQYA 1NPPA 5IM0B 3DRXA 1F3FA 3OJSA 4K4VA 1PSDA 3I32A 2RS2A 4FYYB 1RBUA 2CQ3A 5BXIA 4KPCA 4NLWA 1Q8BA 5DQHA 1MWZA 1TUWA 1ZBTA 4J7CA 4N7TA 2LDIA 1S79A 4E89A 3BSNA 5KFEA 2J7WA 2JL9A 3R6LB 5HQLA 3FZ2A 2W40A 3M7VA 1HWKA 4DU4A 3KNAA 2MQQA 2V9WA 3IM8A 1NK7A 5FPEA 4C8OA 3RB4A 4CVNE 2VU5A 2IC3B 5K9FA 4AQYK 2BJ1A 3A3OB 3JYTB 3HVTB 3S3OA 3MMBB 2EK1A 3DYAB 2IBOA 3EXYA 1YT3A 3ZTSA 5KFTA 4Y28C 1CC8A 1LFWA 4C0BA 3PCOB 3D6TB 2UUBJ 1HNIA 5ETQA 2YPYA 5F8LA 2X1FA 4I2PB 4CIGA 5L39A 1ZZNA 1MG7A 3SFGA 3F0NA 1N33K 2QEXN 3CJ5A 4LF2A 1JLBB 2E1MC 1WC4A 5LM7E 4LR8A 4GVMA 3DM2B 4CGGA 4N77A 4CZKA 4J5OA 5KG5A 3HHLC 4I2QA 4JB8B 2W8LA 4I0WA 1MWMA 4QR2A 2X78A 1HNWF 2LU1A 4QQBA 3HDSA 4O44B 4BACA 2IRXA 2YWHA 3OYLA 2OEJA 4CJ3A 1N8RO 5C2FA 4NLQA 1WEZA 4B3RF 2CKWA 1GX5A 4ZP7A 2O8DA 4DN9A 1RK8A 2C3YA 4LBHA 3W61A 2YH1A 5C10A 3RWUA 1X3MA 4GKJK 2CH6A 2XS2A 1DJ0A 4P2FA 5AXLA 2PC6A 4ZLJA 2B56A 3T1YK 1UAWA 3JB9k 1RAAB 5KG2A 5IWAK 3OYEA 1HR0K 6FDRA 4XH1A 4A47A 4QWBA 2UP1A 3JAMU 1TV6B 1A5XA 4L76A 3I56N 2DEJA 4BC4A 3D0IE 3ITHA 1JNZB 2NPIA 4OIXA 1YHQS 4DL3A 4PG4A 1FNOA 3HPOA 2CQ1A 4OV6A 3CJTA 3MXJA 1VBZA 4DV4J 4FF4A 4FJGA 1VLYA 1YJUA 5IFMA 4NXNJ 5FPMA 2FY8A 3MTKA 1H73A 3LWMA 1JXBA 2F4VJ 4CO2A 3P45B 1KDNA 1BA1A 1M1KT 3J8AA 1E6VA 4ZCMA 3VAGA 3RTVA 1JCGA 3FBFA 2AT1B 1B99A 2CGJA 1HNZJ 2RNEA 3EJMA 4BDPA 1IJJA 2MZTA 4OHWA 2YHWA 2PFDA 5ETNA 3C2PA 2P9UA 4LFCK 4W5RA 3L2QA 5CYQA 1KOOA 1RTHB 4LFAJ 2KVQE 4DSJA 1BCOA 4UW2A 1CJVA 1ACMB 2D5RA 1JCFA 1XNRK 3MEGB 3MMVA 4JI3F 3K17A 4F4WA 1HQUA 4IH7A 2CAJA 3QINA 2XQCA 2UV8A 4CM2A 1C0MA 1CZ9A 1L3SA 4OGCA 4OYOA 4S0MA 4MQ3A 4FYWB 1VSDA 1SL2A 4LF1A 1IJFB 1F9HA 2VGNA 4TU9A 5ETRA 2GCFA 4OI3A 3IUCA 4FZZA 4E7LA 4KTZA 2WW8A 4CLKA 3E51A 1S72N 2LQ8A 4LF7F 1V9OA 3KJVA 3JQMA 2NQPA 3M3ZA 4NMLA 3AY0A 4PXBA 1N36K 1VHXA 2VG7A 4KI6A 3EVMA 3SSSA 1VHIA 4QWDA 3M2UB 4P6QA 4AFFA 1VQPS 3G8QA 3AD8C 4KAZA 4I4BA 1NDCA 1ZETA 1S9FA 2BXJA 3DLRA 2YWGA 2BE2A 3CJ8A 5GMEA 3ZLJA 1YBAA 3P4IA 4FSVA 1MU2B 5DG9A 1PG5B 2HB5A 1URRA 4PPZA 2EBEA 1XERA 4NLDA 2IVMA 3AODA 4OPAA 2NZTA 1F1BB 3D7EO 5HLFA 4JKHA 2EFNA 3THYA 2R7QA 2LU2A 1CSJA 1QHTA 4LF5F 1O51A 1F5BA 1YJTA 1GXLA 3UR3C 5DQIA 4FXWA 1JLCB 4EBEA 2ZBPA 2VG6A 2OFHX 3GL1A 1NKEA 1RT2B 3K2YA 4FL9A 4CHZA 2ZUAA 1QQMA 5AQFA 1NHUA 2I5JB 3E2EA 2BJDA 2X74A 5F0UA 2OPSA 1VQ5S 3K5OA 4GKKJ 4L73A 3R7NB 3CYMA 4FF3A 1SJ1A 2W6LA 2RHSB 4QU7A 4WYBA 2L41A 1CEZA 5HRNA 4FYVB 4C8KA 2P9LA 2CUYA 4ECYA 3KG1A 4GV9A 4UOCA 1GX6A 2DR7A 1RA7A 1NGDA 4ZVTB 4TNOA 2WAQD 1UAXA 4CHPA 2OI2A 3GONA 3MCNA 4KV8B 4K0KJ 3JQJA 3MCAB 1BHLA 4KE5A 4ZVUB 3US5A 4RKUC 4QYRA 2LMIA 7FDRA 4U6PA 3J81Y 1RHQB 4FLXA 5CR4A 4Z4EA 4AT1B 4AHTA 2K3IA 4ETXA 1WKLA 1S7IA 2QI2A 4JK9A 4ED1A 1RISA 3GU0A 5F8IA 2HHHK 2DFEA 1MW7A 1R0CB 2O8BA 4U67Q 5ADXA 4KHPF 1PCAA 1YJNN 3H90A 3GSDA 5M1FA 4WIIA 3I8BA 1WG5A 3SQGA 2UVRA 2UVWA 3CF5L 3FMBA 3CC7S 3TR8A 1Y00A 2R8IA 1VQ9S 5C7PA 4M5JA 1XR7A 1YF5L 2V7YA 2PSZA 2V2QA 1T03B 3J7A1 2QGFB 1Q9XA 4LJMA 3OS1A 1JX4A 2MZJA 3SK3A 4FWSA 2MZQA 2RKIB 1YJWN 2NUHA 2D4WA 3LPTA 5D0EA 1GTEA 1Y9OA 3POTA 3CCSN 2CNLB 4QS9A 1AROP 4J9NA 4NWBA 2HSTA 3ZSRA 4ZPBA 1TK8A 5KPTA 1YUWA 2E9ZA 4N47A 1B9DA 3U1NA 5AQXA 1B70B 1DURA 4B08A 2BACA 4HHUA 1FRIA 1GLFO 5SZTA 3TAMB 2F65A 3D7SB 2RE2A 2OTLS 1DTQB 4E0DA 1B7FA 5ETLA 1GLEG 3CJCA 5J1EA 2XGQA 3C14A 4X65F 1NU0A 5KFSA 4KFBB 3HD2A 4PKDB 4DR6K 4FVMA 4B02A 3R1HA 2O8EB 3M2RA 1IKWB 3TZZA 1UJ4A 4DV1K 2KDOA 3VEYA 2XMMA 1MMLA 1IR1A 4MK7A 3RAQA 4DR2F 3UVJA 1NGEA 1DAXA 4USKA 2J0XA 2ADCA 3EGWB 2PI5A 2UXBJ 1BD6A 3KKSA 1BL3A 2HQ3A 1HYSB 3P96A 4B17A 2L9DA 2LECA 3THVA 3D2EA 3PV8A 4GRSA 1U1MA 1X4CA 3FZHA 3OYJA 3IG1B 5IS2A 1Q1KA 5KFXA 3V4IB 3I0SB 4PG6A 3EDRB 4JN4A 1NZAA 2QWMA 4AL5A 1RT1B 3SZ2A 2NLWA 2CQCA 5C0YA 3W2WB 2Y8YA 3K2PA 4WKRA 4Q0BA 1VBKA 4CZLA 1E6YB 1OH8A 3DOKA 3VAIA 1HKGA 4OJRA 3H45C 5FD1A 1DLOA 5FPNA 1L3VA 2Y3YA 3BBBA 1RT3B 4NRUA 1N54B 3DLEA 2B51A 2M8DB 4PG7A 3BO3A 5ETSA 1P8GA 3VAFA 1YRTA 2C3MA 4OZLA 1RKIA 2MSSA 1TFYA 4NLVA 3Q7CA 1W0HA 2UYTA 2I7NA 2CWKA 4UUXA 4ZTFA 2KXHA 2OFGX 1T6DA 2X3DA 3IGVA 5D0GA 1MMDA 3NGIA 2U1AA 2JWKA 3EGVA 1MDUB 2IA6A 2XWYA 4DXLA 1Q81T 2B6AA 4DV6J 2X6SA 3M8PB 4OLBA 4GO7X 3TSUA 1YG0A 5L9XA 4Q2LA 3GWCA 1IBKJ 3K57A 1BISA 2IIRA 3JAMY 1ZAWA 4MKYA 2VFUA 3T7ZA 1UVNA 1OQ6A 3WX4A 2E2PA 4DUYK 3SPZA 1OIAA 3SCLE 1VJWA 3QGGA 1FRMA 4B9UA 4M5IA 3BSAA 3MCOA 4FCYA 3DOMA 3J80Y 2ROPA 1KAXA 4FJ5A 4Y0FA 3Q2TC 1T02A 4A62A 4ECZA 1VSHA 4TU7A 3PIOQ 3G4SS 1MWYA 3D0PA 3WX8A 4KH6A 3O8WA 2CRLA 2MLYA 3UCGA 3U4LA 5DM7L 3H08A 4CE9A 3SUQA 2KYXA 1VQMS 2XC9A 1SUQB 1PC5A 3HSTB 1BMQB 4EMDA 1S6PA 1D8ZA 3TTCA 3PTWA 5K14A 4A8QA 2P9PA 3KHGA 2XLKA 3WHIA 4ZA1A 5A8RB 3VGKA 3T41A 3LF0A 1U04A 4LBPA 4QWCA 1ILYA 3SMZA 2B8PA 2QLJB 2GA7A 1SQEA 1Q16B 3TTDA 5IQ6A 1LAVA 4BRKA 4MDBA 2VOPA 1RT7B 2H1YA 1RLDA 1LV5A 4I9QA 1S72S 2RF2A 1QM9A 4EP5A 3PIPQ 4C3KA 3GDQA 3QIPA 3CJBA 2VG5B 4J9RA 2KHDA 5C24B 4USHA 5A2QY 3CIPA 5EVZA 1FI4A 3I5CA 3ZSQA 5I42A 1FF2A 3LALA 1UVIA 4NLBA 3MAQA 4LT6A 4FM0A 4AQYJ 3B4DA 4DTSA 1NJIO 2BQRA 3EXCX 2QFJA 3DDIA 3RRKA 2RRNA 3AY9A 3IRXA 4PABA 1KVBA 5ELZA 3OJUA 3MWTA 3K5NA 1X9SA 1N33J 3KWGA 1GMVA 3BGRB 1C0GA 2GQ2A 3UE2A 1SQFA 3V4MA 5DETA 2EBGA 3M30B 1W2IA 3QNNA 1GFWB 3ELHA 3N79A 3AARA 3QLHA 4DQQA 1NK4A 4MO5A 3OVAA 4UOFA 1HI1A 2BKOA 3KLFA 3HF5A 1FXLA 1U24A 4DR4J 2YPZA 3KLHA 3OA9A 3S3NA 2KG0A 2W4PA 1QLNA 3KZBA 4P2XA 3WNFA 3K89A 2EG2A 2IDEA 5E7OB 3WUHA 3TEHB 2V4RA 4GKJJ 3H1VX 4RW7A 4MYUA 3KHHA 3BEXA 4CJPA 4OYWA 3ET6A 3T1YJ 3NG8A 4H4KA 1EARA 4FLWA 3DGVA 2YJFA 3RB0A 3FEYB 1K9MO 1HR0J 5CQGA 5BRFA 2NR0A 3TJ8A 3A5NC 2ZZMA 3VGUA 3DNCA 4XAKA 3ZT4A 2DNPA 3ID8A 3M8ZA 4QBUA 3I55S 3B6BA 2GIQA 3VF2A 4ELTA 2G2YA 4X4PA 2HHXA 3AOBA 4KIAA 4R0JA 1PAUB 2FBVA 4JUZA 1K8KA 1XNQK 1Q8KA 1UVJA 4JV1A 3W1YC 1PGZA 4ED6A 4JI4K 3U9DA 3OHAA 2BDPA 4B9SA 4WE1B 3W2VB 1YDLA 5AQOA 4PY5A 5SWMA 4OFZA 2O01C 2NYHA 3E01A 2HOEA 1RT5B 4LR7A 3OR1B 3UPFA 1YJNS 1WDDA 3TAGA 5CHCB 2C22A 1HFEL 3HM8A 1HWIA 3PKYA 2PYJA 2B4OA 2OPPA 1ZM9A 3MAHA 1XNRJ 2HRYA 3CCLS 2XSJB 2CA9A 5D0HA 1RZMA 2RUSA 1U6ZA 3AVIA 4LRAA 4I1TA 4BRIA 4PWUA 4MH8A 2IMWP 2EKNA 3F9KA 2ZH5A 3TPQA 1YRXA 3QDKA 1VQNN 1NK9A 4UUWA 2CADA 4LF4J 4M3RA 1XI1A 3VGVA 2J6SA 5LMNF 3MF5A 1WC5A 3LO3A 4Z37A 2GVDA 1WKJA 3HVWA 2DXEA 1HARA 1RI7A 3EWGA 3TARA 2ZFHA 3KHYA 2V8VA 3UW1A 2HHPA 4Z4FA 1U2RA 1FKPB 1KLMA 1LWCA 1N36J 4QJVA 3QEPA 1VQ7N 4OJ1A 2FLNA 3V6KA 2IBKA 2O8CA 3NH1A 4R5PA 2RD5C 1BQXA 3ZSZA 5F1XA 4WP3A 2OSRA 2RHKA 1T05A 2MKSA 2R8JA 4DUZK 1RBAA 2PMZD 1IBLF 4WFZA 1Q0NA 3H5XA 4IJNA 4ZHRB 4TVAB 4CK3A 1OVYA 1CULB 4FLVA 1D1UA 3L7UA 1EETB 4GVBA 1EWQA 3SXLA 1RLCL 5C12A 4RG8A 1Y4ZB 3KVGA 4QPTA 5E3CA 1O5JA 4V1Ak 1FDDA 2YQ0A 3FFIA 2B0GA 3IR6B 3E1YA 2BBEA 3ZZ0A 3TJ9A 1YTAA 3U3GA 1EB0A 4CLTA 1JXLA 3H1QA 3KJFB 1HNVA 1YITN 1WN7A 4CLFA 3DRRB 4Q44A 1OH6A 5K20B 3TUPA 4CBXA 1NSQA 3C66A 3I0RA 4C7QA 1SJ3P 1IBMF 2VBZA 2I1RA 2E44A 1B0PA 4KO0B 1IH7A 1LWEB 3FGUA 1FWKA 2ZVIA 3OFEA 3ZEUB 3P8BB 1M5PC 3KLEB 5B8HA 3QO9A 1S1UB 4O5FA 3MEDA 3SBTA 1WF2A 1NHKL 4FNIA 3F9MA 3TRGA 4IKAA 5BPNA 4O3SA 5AZIB 1ZAVA 3AJDA 2VC0A 3M4XA 2NPFA 3O9TA 4CF1A 5CABA 1J5EF 3GCXP 2HNYA 3MMJA 1D9FA 4KGXB 1RDAA 2HHHJ 3K0SA 2LXUA 2QL7B 3OFFA 4JI2F 2PFFB 2IVOA 4Z94A 3DCAA 1C0UA 2LP4A 4RR5A 1G15A 4JS5A 5AQGA 4OJ3A 1N88A 3V81B 1WUAA 3SUNA 3O5BA 3OTOK 3HOTA 2FIUA 2V9KA 2LKZA 2H54B 3R5GA 3AGKA 2WFBA 4CT8A 1MROB 1RA6A 4DMNA 3ZNJ1 5E26A 3MM6B 3SPYA 2KJWA 4YEAA 4UTGA 2P9GA 1M5OC 4BRFA 3TX8A 4JKBA 4CW7B 3QRPA 4F8RA 5J2NB 1JLEA 2I7PA 2IJRA 2NXNA 5J2QB 1H72C 1YZ7A 5IT0A 2UU9J 1VSKA 4DR1K 1TK5A 4J9LA 2EKYA 3D28A 5D4OA 3PNIA 1N6QB 2BW2A 4JV2A 5GMKa 3BEGB 1FA0A 1RDRA 1N5TA 3A13A 1TL7A 1YBUA 2HK2A 2VPWB 1I3OB 1REVA 4OLOA 3FMWA 1VYAA 1GT8A 4ECSA 1NO8A 4DPUA 3N6MA 4J8FA 3VETA 4DV1J 3UN2A 1CS4B 2DGXA 4J9VA 3O1BA 2B43A 3CM5A 3EZWA 2M9KA 3RZAA 2AMCB 4A8WA 4NYFA 1VQ8S 4KHUA 5BJRA 4RPFA 3O6QA 4M3TA 3ULHA 2MKIA 2KQ2A 1F5CA 1M1HA 1ZM2A 1RWNB 4FKXA 3VQEA 2HIYA 4IDKB 5AQWA 2RHQB 2QW9A 1KFDA 3OW2M 3Q89A 1SH3A 4MIBA 1S4EA 4CDIA 2MQ8A 5GIOA 1S6UA 4OV1A 3T5JA 3GJQB 4X62F 4C2MA 1C4AA 2QMUB 2F8MA 1CBKA 3IMXA 4GMJB 4CZCA 3A0IX 2Y0SD 1HYVA 1ZPWX 1GLBG 1IG9A 1RAGB 4QW8A 1VQYA 2MQMA 3UDVA 3G9CA 3AVBA 4XEIA 3VMFB 3VQPA 3SUOA 3RRHA 3S01A 2ZKUA 4WCEQ 2KKZA 4H0PA 1HL6A 4B3TF 4YB1P 3I82A 1Y3JA 1FVSA 3M6WA 1KQGB 2VB6A 4LF6F 1XMQK 1EIYB 2Q0UA 4PQUA 2ZBIA 4ZS6A 4UZCA 4CIEA 1R31A 3R2CJ 2E5IA 3D2WA 1BQMB 4DFJA 4CI0B 1U1LA 4R8UB 1H2TZ 3CIZA 4ILGB 3R1XA 2F8SA 3G82B 3VTIA 4IOAQ 1ATNA 3SCXA 3SSQA 2JWNA 5FLXO 3HP9A 1IO2A 4H5RA 3QEWA 3V1RA 2QLWA 1J5OB 2BYCA 4E2FB 3M05A 1HYZA 1FW6A 5EGYA 2L48A 4RUCA 3TUIC 3NEKA 2G8HA 4RW6B 2LEPA 3TI0A 2GV1A 2QWNA 1EJ7L 5LSLA 4DZDA 3N5FA 5DDQC 5A0YA 2WK4A 2ZD1B 1YBTA 1H38A 1TL3A 1IUJA 3AO3A 1IR0A 2LXIA 3TNVA 3NGKA 1RILA 3TZWA 5AZJA 2ATQA 4ZJQA 4LSLB 2FVPA 3ENBA 4P7TA 5KFOA 3I31A 3OYGA 2CPFA 1V3SA 3EZOA 4DV0K 3O9UA 2WB4A 3SBMA 4DEZA 1O1WA 3THXB 4JI5F 3CMAS 2W24A 2WTUA 1ZAXA 4OGEA 3OL8A 2UXCK 2ZITA 2UUTA 2IAJB 3E9OA 4OYPA 2GQCA 5KT4A 4LIRA 2YNIB 3L3VA 4ZN1A 4F4KA 5AFUA 4FO0A 1RT6A 4LF9J 5ETMA 4BG8A 4WXOA 3T5LA 3NMRA 4UZBA 3DU6A 1WSJA 5C15A 5M1QA 1WORA 2HFUA 3J81j 4OZNA 1C1CB 4CT9A 4LF5K 3M2VB 2D3O1 4HTLA 3R97A 1QUPA 1OO0B 3UN5A 4JI1F 1JLQA 2QK9A 3ZT1A 3E8OA 1W2BM 5JLFA 1C0FA 5GVQA 2NRWA 4HH1A 4I67A 3DMJA 4KBOA 2DISA 2OD4A 1A9NB 5JVHQ 2FHKA 1HA1A 4ILMA 2YHXA 4V19X 4G65A 4DR5J 1RQ0A 3CCVS 1HBUB 2W7OA 1RCHA 1VSIA 2UVUA 3VEVA 4I6WA 2YX7A 2D1CA 4PCQA 4P74A 3W60A 2AJ2A 3O08A 2HS4A 2A1SA 3HULA 4JKDA 4BR0A 1JKHA 4YHHK 3C6HA 1YITS 4WF9Q 2XLIA 2D3OR 4O8UA 2PGCA 1H7XA 2P9SA 1GEHA 4RWXA 3DXMB 2YBVA 2Y1IA 1K73O 3OYKA 2HURA 1FXDA 4Q8EA 4QWEA 1GH8A 1Q5VA 1HBMB 2W1BA 4CM0A 4OVLA 4U67L 4EZ9A 3DDKA 4M5MA 3T3FA 1S76D 1G1XA 5BRDA 1FTCA 3I4PA 3JTPA 2P9KA 3MAAA 3PW0A 1T9XA 2W41A 2PFUA 1LOUA 2QT7A 3I8DA 2JGUA 4ATNA 4PKGA 3NGZA 2C2KB 1XC9A 3UN3A 3RVCA 4JI4J 4JYAF 2ZE2B 1HUXA 2HQGA 5ADZA 2R4FA 4UT4A 2M88A 2ETJA 4O3OA 3BQ2A 2HVEA 5CY4A 5AJ3F 3R5BA 4WZQA 3MCSA 4ZJOA 2SXLA 5DDRC 3SAFA 1RAFB 4DCPB 3CD7A 5LT5A 1Y3KA 2W2OP 3GFXA 5AQTA 4O0IA 1SC3B 4E19A 1VS3A 4WIQA 3FE1A 4ED7A 4M3XA 3LPEA 4IFYB 4F4AA 3DGPA 4C97A 4G1PA 3JSRA 4CIFA 2F1FA 4KH4A 2ZJRQ 1L3KA 1AUDA 5BR8F 2R2RA 4HKQA 1S1VB 1RACB 3CCWA 3ATUA 2YNGA 4DR2K 1N34K 1LXJA 1VQON 3IMQJ 3KJNB 4IR1A 2H3GX 1SVDA 2BKPA 1VMBA 2IPOB 4JI7J 1DBDA 1FE4A 2BJ7A 4N5SA 2Q36A 1GLDG 4J91A 2XLJA 4PXDA 3AVJA 3H3NO 3UKUA 4Z7YA 3KMQA 4F0HA 3K5MA 1X5PA 4TY8B 2A1RA 1LW0B 4EBDA 1U6BA 2NRZA 2P9NA 2GFFA 4TN2A 4OI1A 5BYQA 2E9TA 4ELUA 4DTUA 3E9LA 3N4WA 4MKAA 3KK1B 4RJVA 1DFDA 4M3YA 3C6UB 3PRBA 3VN5A 1F21A 1S1WB 4FZXC 3T5KA 3WQTA 4BC3A 4M5KA 1ZS6A 2DYAA 3BGLA 4U9RA 4FLYA 4XPEA 2DHHA 2Y9HA 4X64J 4OX8A 1TUUA 3TAEA 4CH1A 1TFWA 3M8YA 4KHWA 2H4YB 4IRKA 1O6XA 4OMFG 2C2MB 3CDAA 3D1OA 3UDCA 3PW5A 1APSA 4W90B 3VQ6A 3AB2B 1TL1A 4USTA 1Q9YA 3G86A 2YNHB 1IQTA 2LQBA 2FY1A 1PYTA 4UY8T 2ZDPA 2N82B 4YDUC 4CZJA 4IO8A 1Z1ZA 4QAGA 2R7YA 1EQMA 4HTIA 1U1NA 3W5YA 4FJJA 3LP1A 4NZ0A 4B1XB 1VQLS 1R3NA 2P5GA 2E4LA 4BRQA 2XMTA 2Z30B 4RW8A 5A76A 3H40A 2C1EB 4ZK7M 3NWGA 4C48A 1TGOA 5H9FJ 2XB2D 1T8EA 7AT1B 4ANCA 2HRTA 5KOWA 4PWDB 1JJ4A 3DLJA 3CJSA 5EU7A 3QJPA 2DY9A 1H74A 3SYZA 1KKHA 1HMVB 3PIOL 8AT1B 2IM3A 4EFHA 5HOOA 4KI4A 2HNZB 2F8HA 1HBNA 4A57A 2GVZB 2N4DA 3WXIA 3NCRA 3CUNA 2M2BA 3P83D 3NF7A 3VQ4A 5LL6Z 5SUHA 1IKXB 3H98A 3QWUA 1RADB 2WVCA 4HHJA 5DO2A 3MR2A 4B3OA 3L7PA 3OS2A 2VUGA 3WEEA 2DFFA 3NGRA 1QHAA 3BB5A 4B3SF 3PDNA 4J2DA 4DL2A 2HFOA 1X0FA 1ZXOA 3OTOJ 1IM4A 1UFKA 3UD4P 1QQNA 5E3AA 3MM7A 3PIPL 2CZ9A 1FJ7A 1NGIA 3IP0A 2XY8A 3L2UA 2IYGA 3DLGA 3NS5A 4IZ9A 4A5BA 4EHUA 3PYDA 1VK0A 3A5OC 4CJVA 1HKBA 4DR1J 1NGBA 5F9NA 5KT6A 2KT5A 1DHMA 4I7FA 4PUOA 5MLCV 2NREA 3CJKA 1VSMA 2V2KA 3Q7BA 3S8SA 5THWA 1I6JA 5E33A 1HNIB 3DJCA 3VQCA 5F0XA 3OVSA 4EUVA 4FJ9A 3BZCA 1MN9A 3AVLA 4OQJA 2VQEF 5KFPA 1NK6A 4JD2A 1IM6A 3VAJA 3G8TA 4I2QB 1ZYQA 2Q97A 4USWA 4CGHA 1Y11A 1HJRA 2XS5A 3DXKA 3MR5A 4CJFA 1HNWJ 3HXMA 4FJLA 4RWTA 3MN6A 5D0RA 1P1LA 1FXXA 4R0EA 1OQ3A 1WSRA 3G71S 2O8DB 4B3RJ 4EZ6A 4KKOA 2ZNYA 4C8YA 1J2VA 2E7VA 4X4RA 4IJAA 3QBCA 2CPYA 2PT0A 5HAOA 3J7YI 1S0OA 2YHAA 3WIUA 2XM3A 4JI0F 2O8FA 4RWWA 2IRUA 2KT2A 4DQRA 2CVIA 3ITHB 4LRDA 4ECTA 3KKRA 4OYIA 3R7BB 3QAUA 1C1BA 1S1TA 1X4EA 4CLYA 4I6MA 3CULA 1VRTA 4OI4A 3TEGA 5J1NA 3V2UC 2R7UA 5KFZA 2V2ZA 2KRRA 1P27B 2ZGZA 4YB6A 2D0CA 3GYGA 1F2HA 3EZ5A 4ITSA 1U8WA 1QAIA 2BR0A 2B7BB 2LCWA 1R0AB 3Q8UA 2JX2A 3IWXA 1NXIA 2R2UA 1CJUB 5CZ2A 2AJ0A 4DOZA 4O3QA 3R5AA 1UWBB 1N8RT 2HF3A 5LJVA 2YWWA 1YI2N 4TQSA 1Z26A 2PYLA 1S59A 2HLTA 1LWFA 1N5SA 3NNHA 3Q22A 5DM6Q 3MX2A 3SAGA 1WACA 2YWEA 4XDCA 2EFOA 4F4XA 3ID6A 4ZDNA 2P9UB 3ZZRA 1OVQA 5CYQB 3N6NA 4K4XA 3GYNA 5DS7A 3W63A 1ATRA 2NRVA 4K8RA 1CJVB 3MCPA 3VQDA 1UFWA 3Q86A 3QMLA 4MDAA 3Q8VA 4LQ9A 3BO2A 1ELOA 3VCDA 3GV8B 4W98A 5AQPA 4OYMA 3SBGA 2MGZA 1HQUB 1LNQA 1S9GA 3BKTA 2CQHA 1FE0A 3OL9A 4M5LA 3BDEA 1RBOB 2H5EA 3MPYA 3OXGA 2R2SA 2EC0A 4HDHA 3UKRA 2PIIA 2ASMA 4KRFA 4CJWA 2AHOB 1T3NA 5F9LA 2DIUA 1RTZA 3PUFA 3JTOA 4YP3A 1UZDA 3KJVB 4LIWA 2QSFA 4FJIA 4LF7J 1RABB 1UVLA 3R6MA 4NPOA 4KTQA 4DV0J 3MXMA 1E3MA 4O8KA 1XBWA 2BM1A 2XMJA 3HMJG 1UTAA 2ZH2A 3HOSA 1S12A 2UUCF 1HI8A 1U0HB 5AE1A 4DPTA 1AZSA 2QLBB 4KHRA 3DHWC 3M8WA 3PHTA 5H1SQ 4BC9A 2J0WA 4CJRA 1RFQA 2RU9A 2UXCJ 2BE2B 3MEKA 1IQZA 2ZUGA 1CVJA 2PD1A 4MKBA 3P5TL 4NXMK 3V5RA 4LH5A 4TSXA 3VWSA 1BDGA 4WFNQ 3ADAC 4N8NA 4DU3A 2H3EB 5F2RA 2AJFE 2Z58B 3EO3A 5HLFB 3THYB 1XMOK 4C8LA 3CCMN 5DLFA 2ZH6A 3ZZUA 4NA3A 3RAMA 4LF5J 5BN9A 1FDAA 3GLJA 1QDUB 1TTHB 2FSJA 2LA6A 3ZT0A 1TUVA 4DSFA 3BKFA 5ETTA 1NMNA 1P8ZA 1NWKA 4JI8F 4ER8A 1TKXA 1RAHB 4ZVSB 2BJ9A 3R5JB 1RAEB 2XNRA 3E3XA 1U25A 4ZPCA 4UY85 1FJEB 3E9PA 3L8BA 4Q5VA 3ZETA 2P9LB 5F41A 2HRUA 4DF4A 4F50A 2R2TA 3WNGA 2NUBA 1D9DA 1K0TA 1K6YA 2B3TB 1GOCA 1G4CA 3KFWX 2W9AA 3LW5C 1RWMB 3P1GA 4YS2A 3ILIA 1F5AA 2P51A 3OYFA 2B9XA 3M6VA 2G0JA 2DHSA 3CD6S 4FW2A 4DL0C 3J7AN 2O8BB 3UQSA 3NE6A 4K4TA 3O1LA 4YN3B 2CGKA 2HBZB 4KHPJ 4AL6A 4DL5A 4KAIA 4PR6A 3SQGB 3NOCA 2FLOA 1IWGA 3G10A 3VEZA 4RTFD 3KUEA 3HKZD 2CYYA 5E2QA 5HRPA 1NJXA 2G2ZA 2H5IB 1QAJA 1XR6A 3FBBA 1SPBP 3ZSWA 4YOUA 3JAMO 2O1PA 3POTB 2MDAA 3G2XA 1HPZB 1XWLA 3HBTA 3IN5A 2XO6A 1GOAA 4IO1A 1U49A 4A5AA 5HMYA 4U95A 3CCQN 3J80O 2ZHOA 3W8GA 3CETA 2K8GA 1WG1A 1JCEA 3OUYA 2NLXA 4NB4A 4CJ5A 2MJUA 2PN6A 5KFNA 1FESA 4JNEA 5J1EB 1FFSB 2OIHA 4M3UA 4FJKA 2Z1JA 4CZEA 3NGYA 4KREA 3M2RB 2M8HA 1NB2A 4HLBA 4ECRA 3EKSA 3IAM9 3CC4N 3MPVA 3NHGA 1R6YA 2OMOA 3UVJB 3QETA 3EICA 5DRKA 4MT1A 3DYAA 3PO5A 4DR2J 1N34J 4RZRA 2UUBF 1NGCA 5ADXH 3IWLA 4I2PA 1KQKA 3J7ZO 2DRBA 2OO4A 1TVRA 3D2EB 2CQ0A 1FJCA 3O3GA 4HUEA 2A42A 2G8IA 2HNDB 2GZOA 3D6FB 4MK8A 3R8YA 4YOVA 3CCUS 1N5YA 3CJRA 3H2VE 1RB0A 2PA8D 1NMDA 1SJQA 3IBWA 3MWBA 1IWAA 2FJXA 4M7XA 2M7SA 5A2QO 3RMDA 4Q0BB 1UEVA 4BG9A 4X62K 3DOKB 2ILZA 2JEGA 2Z56B 4J9UE 2NXUA 4NYPA 4DV4K 2BQUA 2QWOA 1YRUA 3L6QA 3GR0A 4FOIA 3GIIA 4NXNK 1RKJA 1DLOB 1HWUA 1XEZA 3QGPA 1U2VA 1M0SA 3M8SA 5KFDA 1VBYA 2D41A 3DLEB 5AQLA 3UE5A 7FD1A 3JSYA 3NF6A 5RUBA 3BR8A 4CEZA 3M8QB 1TV6A 4WCEL 3G6XA 5F8HA 4JKCA 1J9AA 3NMUA 2GMHA 1QVGM 5IT9U 4ECQA 3ISND 4BC7A 1RHMB 2B6AB 4PYDA 4Q7AA 4MMOA 4ES1A 2AZ1A 4H4OA 3D3BJ 2F4VF 5KTQA 4IOAL 3M1VA 3CJQA 2AW0A 1FRLA 5AQVA 3PSFA 2R7SA 4ILJA 1QY7A 2C3PA 2QV6A 4UQGA 1WHXA 4WQ5A 4BC2A 2YKPA 2RB7A 4FK2A 3W8PA 1G2EA 4M42A 1XHXA 1B4SA 3FCHA 2Y1LB 1ATSA 1TL5A 1RWWB 1FJGK 3DOMB 1EX8A 4HUGA 4Y65A 4ID8A 4KB1A 1X3NA 4FZYA 4LFAF 4JEPA 3V6HA 1NUEA 5BYRA 3RAXA 3FBCA 3GE9A 3EPIA 3MEGA 4RU9A 2EFQA 5IXUA 2F63A 4XDDA 1M90O 4RLEA 3NVKA 2XHCA 2GHWA 1XQIA 3IC1A 1S4FA 1UVKA 1BHNA 4Q2MA 2NSBA 1VISA 3VQSA 1S6PB 4TQRA 2VL1A 3NBPA 5HP1A 5K14B 4LF8F 2P9PB 4ZP9A 3D1QA 1NH7A 3KJQB 4CECA 1HX1A 3A3NB 4USIA 1WDTA 3FLCO 4EO8A 2KFNA 1FKAF 3THTA 5EOYA 2KU7A 1RHKB 4C23A 1KN6A 5LSOA 2KJVA 3HZGA 2GV9A 3H2UB 4DU1A 3TYTA 1QQOA 3G6EN 3C7NA 4KPYA 2LA4A 4IDHA 2RF2B 2N3OA 3ZSVA 3VF4A 1P90A 1YJ9S 2HWTA 2W2NP 4JV5F 2Z1HA 3GJTB 3W5ZA 3M2UA 4JRQA 1EWRA 5J2PA 3ZNUA 3NH2A 4BLGA 2RE1A 4C8NA 1N5QA 4F2RA 2QYGA 3T5HA 2VQFF 2HQDA 4B9MA 2DGOA 3KK2B 3EDQB 3AA2A 1BO5O 1W9HA 3IRXB 5FJ4A 3H4DA 3L4BC 1A7GE 2QLFB 5JVHL 1EHWA 2HBYB 3LL3A 3CM6A 4KGVB 2RN2A 1N5VA 3QLHB 2EXUA 2VBYA 5JMNA 5KFLA 3ENHA 2RS8A 1Q53A 5EXWA 3RSEA 3KLFB 1U2CA 3SI6A 5HQ8A 1QSLA 4EYIB 5FDLA 2RT3A 4NEYA 5FRNA 2ASLA 1NNEA 1FFWB 4CO4A 4ZTJA 3KLHB 4K0KK 2CJYB 3DDNA 3DI6A 2BOAA 4KY3A 2I5JA 1RYSA 1WSGA 2V6AA 2ZZNA 4WF9L 3V6DB 4IBNA 4RW7B 2FB0A 3IA0A 3RMCA 3ET6B 2I6WA 2M5YA 3CHWA 2ASYA 1VC0A 1OJ4A 3EGZA 3D0GE 4U8YA 3E66A 4AH9A 1Y5NB 1S77D 3FRZA 5LY3A 3KLIA 3AO1A 1JLGA 3RBXA 2C28A 3TA0A 3K9JA 2HKEA 3CCJN 2CJAA 3D3CJ 5GAHU 3VQ5A 4H0OA 4FYXB 4DV7F 4RL1A 1K8KB 3HD1A 3CXCR 4X4NA 5KFQA 4B3MK 1K8AT 3ZCMA 1N0VC 4NYZA 2ZH4A 4CLWA 2K1RA 4JK8A 4O4RA 3FGVA 2FD2A 4IXCA 4DTXA 1FDNA 3E01B 4BR7A 3ENQA 4HEA9 4QR0A 1T03A 4IG0A 4ETZA 1LW2A 1VSJA 4E7HA 2D0OA 3L2VA 2CVEA 5KG1A 3WXJA 4OLAA 3VGMA 2RKIA 4O23A 5G0RA 4LVOP 3VZIA 3B82A 3PRDA 3UWTA 4FF1A 2Z2MA 4CNYA 4DV3F 5M1KA 4DCOB 4WFAQ 3FCWA 1K9MT 3OVBA 2ZJRL 3HZ6A 4HTJA 2JEJA 1OS5A 2J8AA 3FDSA 1QTNB 1KSPA 2DR6A 4HCBA 1HHQA 3GZ7A 3O3FA 1NEEA 5IZHA 3WNHA 1VQ4N 2UXBK 2KI2A 3GPAA 5F8JA 4ED3A 3TAMA 3GFYA 4CGIA 1RDBA 3LDLA 3K9KA 2GVDB 1CJKA 2Y1JA 4DDFA 4KFBA 4JBCA 4ZPVR 5F8GA 2QA4S 4F02A 1BXNA 2FZGB 3QGIA 2AP6A 2IYIA 2D0PA 1KLMB 1VRUA 3PY8A 3ZSOA 1LWCB 2KYZA 4IFVA 1HQ2A 3C15A 3B8HA 1UVMA 2O8CB 2RIJA 4R5PB 2RUGA 3SQOP 3LDQA 3GB0A 3KXDA 4AHRA 3DLHA 5GAHP 1D3WA 1T05B 2VOOA 4M95A 2BRLA 2MLZA 2FTRA 4ZP6A 3L95X 1OYDA 4C3MA 1IBLJ 4TXSA 2KL8A 3QJJA 1ZTWA 2KN4A 1T9WA 3H4BA 4QIVA 4OI2A 3W2WA 1GXTA 3NCIA 2IDLA 2Z2LA 1L3TA 4GVBB 4M63A 4K8ZA 3KD1E 4RUAA 2JNJA 3HM9A 2DTJA 5D4PA 4FF2A 4OZ0A 4GNIA 3FFIB 3ZZOA 5CYMA 3CJ4A 2FPHX 2HBRB 1WSVA 4ZP8A 1L3UA 3LP2A 3SI8A 4K4WA 2J6UA 2JRSA 2D74B 5AQYA 2KFYA 5BPLA 4FJNA 2QE5A 1GLLO 2QRRA 3SCKE 1MLAA 3QYYA 2QWQA 4MO4A 2HBLA 4HI2A 4YFUA 5CCMA 2OPRA 2IOCA 4PKIA 1ROFA 2AEFA 1K1SA 2Q6BA 1H2VZ 5T41A 4RCHA 1FT8A 4BC5A 4WFBQ 4F9OA 1U1QA 4PG5A 1IBMJ 3QFPA 1DY3A 4JKFA 2GWKA 3VV2B 1BIUA 3K7RA 1NPRA 3CFRA 1Z05A 5D77A 4LY7A 1H0HB 3O2IA 3FC9A 2V68A 3M8PA 2E7WA 2AD9A 3RGIA 4F0KA 1QS4A 3UD5A 1IBKF 2YX6A 2VODA 1KD1T 1WI8A 2MMYA 3W3SA 4USVA 3QEXA 5IT9Y 4WKYA 3UIQA 2R7WA 3LPYA 2HFVA 1JL1A 1TKZA 1SL1A 1L5UA 1Y64A 4KR0B 2HNYB 1PBUA 1J5EJ 2Z0GA 2CPJA 2DR5A 3L3UA 1C0UB 2BVZA 3C8YA 1FKOA 3R7SB 4B3SK 4JLHA 1PKUA 3PJ9A 4LUBA 2DNKA 3VQAA 4L74A 1VC5A 1N4LA 2CNNB 4DV5K 2JDJA 2BTFA 2BUNA 1NLVA 3KUGA 3O5TB 2MXYA 4NLUA 3MD3A 1JLEB 3FQLA 3RBEA 1TP7A 1SV5A 3MM8A 4OPHA 4O0JA 3OYCA 2JHEA 1IKVA 1UJ5A 4TLRA 1C6VA 1RBLA 2CFXA 1MWQA 3KLGA 4Q43A 2VPYB 2XNQA 1SBRA 2A3ZA 4CGDA 4Z2XA 4J9KA 3N6LA 1X7VA 1NDKA 3CVKA 2OJ3A 1TL7B 1N52B 2Z2YB 1HWJA 4YUDA 1REVB 4PA1A 2Q1NA 5IT4A 1WBBA 2AJ4A 2DIVA 3FFKB 3ZX3A 4FWQA 3EY1A 3LA0A 5JS2A 5CA5A 2Y1RI 4LSNA 2MQNA 3N4QA 3EKUA 2ZF5O 4WYLA 1IKYA 4DR4K 2A18A 5KFUA 2QJ3A 4CD3A 1C0TA 4FM2A 5C25B 4CBWA 2ZQBA 3SJHA 4GVEA 1TAUA 3SSRA 3KDNA 1KRPA 2OTJN 3AQOA 3MN7A 4M1KA 4WFYA 4DTPA 5HROB 2A40A 4MAKA 4EO6A 3ZZZA 5AQMA 5DDPC 4MLEA 2H51B 3HHLA 4M41A 3C6AA 2C2RA 4X62J 1WNSA 4ZVQB 1T3OA 3CDBA 1S6QA 2QWRA 2QA1A 5EWFA 4AM7A 3HFZB 4QIFA 1PIEA 1SQGA 1O8BA 3HRGA 2ZGYA 3H25A 3PKMA 5HI7A 1WHVA 3VAKA 1SJFA 3BF1A 4AHCA 2P9EA 3Q2SC 3T1YF 4XO0A 1JJ2R 3GJRB 3WZ0A 2XEXA 3BREA 5IWAF 2VWBA 2BA9A 1RCXB 3MUMP 1CQMA 3M5RA 1WC0A 4MIAA 2B9YA 1TU0B 2PEBA 4M5NA 2DNHA 5LMUF 4FVUA 4FOEA 3NAIA 3GMGA 1ZBIA 3CC2N 5LSRA 4B3TJ 2AGPA 1P6TA 5DM6L 1FDBA 4LF6J 3L4QA 4P73A 4L3NA 1B3TA 3PJWA 4YOTA 5B0CA 4I6AA 4JK7A 2B4PA 2DGVA 2AJ1A 3OFHA 3R27A 4URQU 3ENAA 1Q18A 1TAQA 1RTIB 3MR6A 4DSIA 4ZLLA 2FHJD 2QKBA 1FK9B 2ZBRA 2GX8A 2BE9B 3NGTA 1O0PA 2ZNZA 2KTQA 3W2VA 4BRDA 1REGX 2NXCA 4ZCKA 4ALZA 4HL9A 1V6HA 3A12A 4F26A 4OX9F 2BUPA 4NLYA 2GGPA 2V8GA 1RT5A 2BJ3A 2D3UA 3OR1A 1CG2A 3AVHA 1FJGJ 4LFCF 3PYGA 4LF4K 2AU0A 2V5HG 2XHBA 3AVCA 5KFBA 4K43A 3H46O 1YIJS 5A0YB 3BYPA 4V19S 3MN5A 2Y8WA 1TL3B 1VIOA 4UOGA 3M8RA 2A3JA 2V4JB 3H2LA 2J5AA 2MY7A 3KTQA 2HG4A 4OZ3A 6FD1A 1RWXB 4FNHA 4ZVHA 3U27A 1JJHA 4F3MA 2HMIA 4I56A 4P72A 2Z8QA 4QW9A 2YX4A 3L3CA 4JI5J 1YQHA 3HI0A 1RT4B 2A2CA 1WC3A 5A6PA 4M45A 4CI6A 3CCRS 2XG8A 1RNHA 5EX3A 5IOLA 2GTDA 4YOWA 2HVHA 3FNNA 1ZZFA 3IGNA 2G1DA 4DR3F 5D78A 2CQPA 4WFNL 3AV9A 2FHJA 3AO2A 4NYOA 2C3OA 4F3TA 2HK3A 5F8NA 5IC4B 3TWHA 2BABA 4N41A 2VBXA 4PL7A 2DNRA 1XJWB 3K8VA 5KG3A 1JLQB 3U6FA 4JI1J 2P6TA 3MK6A 2DH9A 3LH2S 3CE8A 4JI8K 1UA1A 1RUSA 3DMJB 1VQKN 4L72B 3TAPA 3DRSA 3VQTA 2GJFA 2QTDA 2GHPA 5FLXU 5FPDA 1NB7A 1H3DA 2FZCB 4DS4A 2YCHA 1XC3A 3CCEN 3VQBA 3AO4A 3HTVA 1ZBFA 1RCOB 1TYQA 2M3DA 3HX9A 1KVCA 1V5IB 4RW4A 4JKEA 3WQPA 1U09A 2FUG9 1JKHB 2DRAA 2B8QA 1IBCB 3OYDA 4CEDA 2P9SB 4NO7A 1FVQA 5AFUH 1YXQA 4OPJA 3MTJA 2E20A 1M5SA 1B64A 1LWEA 4O5BA 2W8KA 4AM6A 4ZIWA 4H03B 2WTFA 1KC8T 4LREA 3A2FA 2DPNA 2KXFA 2YQ3A 3W64A 4WQ4C 4L3KA 1I39A 4JV0A 4CJ7A 3MAAB 1JK9B 2FLLA 4YY3K 1S57A 1T9UA 2CIMA 2KHOA 2P8IA 4LH4A 2GIRA 3AO5A 3V9UA 3NOGA 3PSIA 2HHHF 4B3MJ 2E5LK 1X9WA 4JYAJ 3QFWA 4R25A 2UU9K 4A8MP 2HZAA 2DGWA 4URGA 4FW1A 4CLLA 1RBRA 1WLJA 1AFJA 4G3IA 2E8AA 5AJ3J 4K4UA 4U96A 1ZA2B 1DTTA 3SQ0A 4H0YB 3MM6A 1FRJA 4EBCA 4WPAA 1S1XA 2MKCA 1WJ9A 3IS9A 3DKDA 1KTVA 1JIHA 5ITHA 4B8AB 2VH7A 1K73T 5J2NA 1FWLA 3AA4A 4I68A 3DGPB 5J2QA 3AD7C 2JSXA 3C6TA 3CNQP 5BR8J 2MZSA 3VOVA 3ZZTA 1NSAA 2YNGB 3A8YA 3MZIA 1SJRA 2W9BA 2OEMA 3K59A 2IA0A 4FKYA 3HLUA 5KT3A 1LK7A 4NLSA 2QZ8A 3TVYA 3VESA 2CPEA 2DR9A 3U3YA 4R79A 2RPIA 4OYBA 1KOHA 2ZJPQ 3QSIA 1NGFA 4DR6F 1FCAA 1X8DA 1GAOA 4E1JA 4WXWA 3DOLA 1I94F 4PRFA 3K5PA 2QEXS 2XYPB 1YZ6A 4DZ6A 3I5AA 1WAFA 2QA4G 4HHTA 5KAKA 2GELA 4O3PA 3HVAA 4WBFA 5ETPA 2PA3A 4NCGB 5L1LA 3EN9A 2P9NB 1PJ7A 1VGYA 3F73A 2FC9A 3TA1A 3RR7A 3O9RA 4DTNA 2E6LA 3TZXA 2PMHA 4U7BA 2BANA 1T9YA 2IMOA 1PC4A 4IKFA 5A6WA 2ZC4A 3TQEA 3UR0A 1GOBA 1ASVA 2OH2A 3VF0B 2O4IA 1EX4A 3QATA 3B6PA 5HVHA 1BGXT 5C42A 3O4NA 2HQFA 1OKJA 4JKGA 3I56S 1TL1B 3B4MA 2CG8A 4ICLA 3ISZA 3WXLA 3CERA 3H20A 4DTMA 3BH6B 1T9VA 3BM7A 3O1WA 3W65A 4OYZA 3CMEN 1VQ6N 2G4BA 4EU0A 4DG1A 4KHQA 2KG1A 4CK2A 5JICA 4AXIA 3BJYA 3Q8YA 2F9DA 2ZH8A 3LDPA 2HAIA 3AAWB 4I9LA 3VQ8A 4CFAA 3LZJA 3ZC4A 4FDFA 2HVZA 4KGKA 1N48A 4B1WB 4AE5A 1MSWD 4CFCA 4B9VA 4ZIVA 1NK8A 4RW8B 4J9QA 2CH5A 2BJEA 4NYNA 3C16A 3NAEA 1X9MA 4OHXA 4IEEA 5E3PA 1U1KA 5TKYA 3TSPA 3BN4A 3IFRA 4YMEA 3QFUA 2QWLA 1KR4A 3D45A 3T1HK 4A61A 3TANA 2WSCC 1ZC6A 5KFMA 4NLRA 5JMVA 2WONA 2HVDA 4DUYF 2IVPA 1BY9A 1T11A 1BCMA 1V4SA 2GBZA 3WC2A 3GV7B 4B3OB 3ILOA 3TR5A 3OBYA 1HNXF 1UW4A 2YY3A 4LF8K 1QE1B 1WD6A 1DGKN 3M6GA 1FD8A 2MKKA 1RU1A 2YVSA 3ZZPA 2IVYA 2ZD1A 4M3WA 3QRQA 1SB6A 2YH0A 3OL6A 4OO1J 4B3SJ 1JL2A 4WJBA 1KLNA 5CHIA 1QSYA 4NI2B 4ZLNA 2C2OB 1S9EA 2QL5B 4LF9K 1HLUA 2DGTA 1NZ8A 3MM7B 4BRGA 1QVFR 4DV5J 2ZHAA 1EAYC 2VIHA 1RHRB 3OR2A 4FWKA 3HPGA 3DLGB 4JV5K 4FK0A 1BOTO 1YVFA 3V1QA 1GXUA 5KFWA 4OLPA 1RBVA 4DSEA 3WC0A 1VHFA 1F9FA 4CO0A 3PFEA 4ISGA 4I7FB 4PUOB 1T94A 2EW9A 3CJKB 3L4IA 1EP4A 2YNIA 2LEAA 1S10A 1Q4RA 4NE9C 5C5JA 3QRRA 4K42A 1HHTP 1PYSB 2VYPA 2VFSA 4K4ZA 2DXDA 4JD2B 5IQQA 2VQEJ 2W9CA 2WOMA 2KKHA 1RWUA 2AYGA 4DR5K 2QTWA 3C0BA 3FUYA 3CQXA 3DXKB 1HIYA 4ED2A 1K8AO 3M2VA 5KRTA 3P4UB 1XN9A 3AB4B 2KM8B 2YWKA 4QS7A 2HPUA 4DJBA 2CWXA 3D5MA 1GMWD 1WSFA 1X0PA 4CEFA 3SLCA 4KKOB 4CJLA 2C42A 1VDHA 2G8VA 2EWSA 2EFPA 5F0WA 2E5JA 4DI6A 1IVZA 2BQ3A 4CFDA 1YHQN 3LAMA 4ERDA 3RR8A 3CIMA 1T9TA 3AA9A 5AQKA 3LAKA 2DH7A 2M4MA 3PEHA 5B08A 4JI0J 4QYZJ 4OJHA 1NJZA 2RJZA 3CJAA 4CK1A 1C1BB 1S1TB 5J1PA 1PJ6A 2BM0A 2HBQB 4I6MB 3TABA 1VRTB 3DLBA 3ALYA 1U1PA 3N28A 1C2PA 2FVRA 1VI7A 3GIMA 4ELVA 2BV3A 2Q79A 2K7JA 4WTOB 3DXMA 1OSDA 4CO1A 2FVCA 4DF8A 3UNYA 3F5TA 4OX7A 1BA0A 2AYBA 4DFKA 1JWWA 3SEOA 1DQAA 1WSHA 5HBMA 2XYGB 4CJ4A 1X4BA 1LWFB 5EWGA 3HPHA 3VALA 4FK4A 4W5NA 2OYQA 1JLAA 5JUMA 4HT5A 2RQKA 1XNQF 3JSBA 1MNEA 4LVNP 4GY2B 3CI5A 1GMWA 4QCLA 4JI4F 1BUPA 1JJCB 2OUGA 4CYUB 3KDOA 4DV3K 5A8WA 4WFAL 3RUBL 3CCZA 3D6RA 2YKOA 2MGZB 1S9GB 3FZBA 1YJWS 5KFYA 2JC1A 1U45A 4J9PA 3CCSS 2B4JA 3CJ0A 2PZSA 4ID1A 2G1HA 3MXIA 2R8HA 5EWEA 1O13A 2V8HA 2V0NA 2YKAA 4XH4A 4KT0C 5G4DA 3M9NB 2Q3SA 3UKRB 4JI7K 3CPWR 4CLUA 1OMSA 2E1ZA 4BE1A 1NH8A 3GTYX 1K0VA 3ZT2A 4NLOA 1SH0A 1FO1A 4Y1DA 1WUUA 1U8SA 2QXLA 3P31A 2LEBA 3CJ3A 1S1VA 4CJKA 2DGSA 2PAVA 3QB0A 1G6BA 2WHOA 2Q0RA 1VQPN 2RSQA