3LALA

Crystal structure of hiv-1 reverse transcriptase in complex with n1-ethyl pyrimidinedione non-nucleoside inhibitor
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
553
structure length
553
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV Reverse transcriptase
publication title N1-Alkyl pyrimidinediones as non-nucleoside inhibitors of HIV-1 reverse transcriptase.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase
total genus 157
structure length 553
sequence length 553
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3lalA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3lalA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3lalA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3lalA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3lalA05
4QCLA 4B8AB 1LV5A 4KFBB 4M41A 4B9NA 3HVTB 1D1UA 1UAXA 4GMJB 3KLFA 3NFAA 5DLGA 1REVB 4LSLB 4CIGA 2OZSA 3H40A 3UIQA 3QEPA 3SUNA 2DFHA 4Z4IA 1IKVB 3BQ1A 3L3UA 5KI6A 3TAFA 1KFSA 1BISA 4B9LA 3QYYA 2JEJA 2W42A 2HMIA 4J9SA 5HLFB 4JUZA 2Z1IA 1WSGA 3AA3A 4F3OA 4ZP8A 3U3GA 2KZMA 4CFCA 3LANA 4NLUA 3ZSVA 3AVMA 4CHQA 3OS2A 5F8LA 1A5WA 1TAUA 2G8HA 1BCOA 1U09A 2WOMB 1ZBIA 4Y34A 2IJFA 3EY1A 3QIOA 1BCMA 5DQHA 4FS2A 1RTDA 5HRSA 4FLTA 1Y97A 3VQ5A 1HQUB 1NK5A 2WHOA 1Z25A 3M9MB 1L5UA 4IG0B 1BGXT 3RMAA 1IKWB 3HVTA 3VQEA 1T03B 2Z1HA 4JRQA 2P1JA 3K5MA 4DSKA 1REVA 4LSLA 2I1RA 2IJNA 4FJHA 3MXJA 4BACA 4CJPA 3PR4A 4DTNA 3ZSOA 4CEBA 4O3SA 3OYMA 1ZTTA 1IKVA 1VSJA 4W5OA 1HNVB 4IFVB 5I42A 1VSDA 2YNFB 1QUVA 3V81B 2DTUA 3PJXA 3KLEA 4O3NA 4F2RA 3SCXA 2EC0A 3ZT0A 1HMVB 1RA7A 3VQ8A 1X9SA 4CEEA 2ALZA 2DY4A 3NMAA 1LAWA 1RTHB 2WOMA 1S4FA 3CJ3A 1FXXA 3AVNA 1HQUA 3CWJA 3KNAA 3NF6A 1UOCA 1FKPB 4Y2AA 1KCFA 3KHHA 4AHCA 3C6UB 4WE1A 4IG0A 4E7KA 3SUOA 3MEEB 1IKWA 4Z0UA 1D5AA 1TV6B 4DTMA 4N47A 5SWMA 4O0JA 4CF8A 4OJRA 3H08A 4E7LA 4K50A 4DG1B 3PVXA 2R8JA 5DQIA 4J2EA 5KFUA 1T05B 4IDKA 2KQ2A 3OYBA 3CO9A 2FVQA 2WB4A 4I2QB 1HNVA 4OKEA 2YNFA 1RT6B 3HP6A 3AV9A 4U7CA 3VQBA 3V81A 4HVJA 3CDEA 4O44B 2HHQA 5F8NA 4PWDB 1VSMA 3AVLA 4FJ7A 1WSEA 4FJMA 2HVHA 4J9LA 3AA5X 1HMVA 4N56A 4NYZA 3DDKA 1RTHA 3OYDA 4CCHA 1GX6A 1N5YB 3U3YA 1VK0A 1RBSA 1JLCB 3D0PA 3PX6A 2HNDB 3CFOA 3V6JA 4DLEA 1WN7A 1WAFA 3RB4A 1IKXB 4N76A 1JLQB 3HPOA 1S1UA 5J2QA 1QSLA 2QV6A 3T5KA 4F8RA 2VA2A 1FKPA 3MEDB 2O4IA 4FLVA 4TSXA 4K8ZA 3C6UA 3MEEA 5KFEA 2RN2A 1XC9A 4DTJA 4IR1A 4E7HA 1TV6A 4W5NA 1ASWA 4PY5A 2BE2B 5KFYA 4ECYA 4EO6A 4MFBB 1KHVA 4J2DA 3QEVA 4DG1A 3HJFA 1O1WA 2PYJA 1HYSA 4BE2A 3PW2A 3KK2B 1W25A 3TAQA 4I2QA 1K6YA 3PUFA 4O0IA 5EUHA 4G3IA 1RT6A 4URGA 2HWIA 2X6NA 4K4XA 1X9MA 5KG7A 4J9OA 4O44A 3MAQA 3IRXB 4PWDA 5F9LA 3TQ1A 4FK0A 2AGQA 3UPFA 1ZYQA 3BREA 4NLQA 3RB6A 3AO2A 4G1QB 3P83D 3NGYA 4KHMA 3K59A 5F8IA 4E0DA 1N5YA 5EWFA 4NLOA 4CHOA 1QQCA 2HHUA 2HNDA 4TLRA 3EYZA 1Q9YA 1U45A 2R2UA 3FSIA 4ZVEA 1JLQA 4HCCA 2B43A 3GILA 2P5GA 5F8GA 4YP3A 4RW8A 5KFLA 4K4VA 1CXUA 4K4TA 2G8IA 3OVNA 2D0CA 4CHNA 4F4WA 3H98A 4MFBA 4ECZA 1WSJA 4DSFA 4C8LA 4XPCA 2YKMB 3OL9A 2FJXA 2V0NA 2W8KA 4RW6A 4WZQA 4OVLA 4KAIA 5KFQA 3Q8QB 1CXQA 4LSNB 2G8WA 4O5BA 4CJRA 2JLEA 4YFUA 4G1QA 1MU2B 3OYIA 3IAYA 2ILZA 3ZSYA 3NL0A 3RMCA 1RBRA 3D5MA 4NCGB 3BSNA 3IS9B 4RNFA 3G0ZA 5KFKA 1NOYA 3SQ1A 1OS5A 3D45A 4FJ9A 1RDRA 3ZSWA 2J6TA 1ZBUA 2F8TA 1S10A 1JXBA 4B9SA 4OLBA 4LY7A 1RA6A 1HYZA 4ECSA 4B8CA 4ZTFA 4OGEA 3CM5A 1BQMB 3T5HA 1NJXA 1WSIA 4GW6A 1FKOB 4JV1A 3CYMA 4KO0B 1B92A 3FFIB 2BRLA 4EO8A 5T7BA 4B9VA 3QIPB 1HQEB 4QWAA 4WFYA 5KT5A 3SUQA 4W5QA 1Z26A 2V4QA 4CJKA 1Z4UA 4ZP6A 3KHGA 4IKAA 3OYAA 1RDAA 4R0EA 1TVRA 3CJ4A 1VSIA 3N6LA 3KLIB 2W8LA 3K2PA 4EZ6A 1JL1A 3SV4A 3SZ2A 1MU2A 3MTKA 3SQ2A 3SNNA 3KHRA 4NLDA 3TARA 1KVAA 2D7SA 4DTXA 5CYQB 3HXMA 1ASUA 4ECVA 4FLUA 4NCGA 1QAJA 3KMQA 4RNHA 4DFPA 2BQUA 2Q3SA 4OL8A 4MK8A 2VG6B 4I9LA 3DLHA 3QINA 1HRHA 2OA8A 3PR5B 4URSA 4J9KA 1BQNB 2ZQBA 2AWZA 4ELTA 4B9UA 3OY9A 1WLJA 4YNQA 5HP1B 2IM3A 1KSPA 1A5VA 1NHUA 4KB7A 3L2RA 3AO3A 4Z4HA 1SL1A 1BQMA 4CJVA 2V4RA 4M3RA 3G6YA 4H8KA 2XHBA 2ZD1A 3QEXA 3DOKB 4ED1A 5FDLB 4KO0A 3FFIA 1S6QB 4J9RA 1RTJB 4ID1A 4E19A 2RDIA 1KLNA 2P5OA 2ATLA 3SFUA 1HQEA 4ZTJA 4KHSA 5C25A 4DL5A 3CDWA 2O5DA 4CERA 4H4MB 3VA3A 1TKXA 1TL3B 2V9WA 5DK5A 2BRKA 3S3NA 3KLIA 3VQDA 5DMRA 3MF5A 4CGDA 4DQPA 4QW9A 2HNYB 4KHUA 3LDSA 3DRRB 4K4UA 3PHEA 2PY5A 1RT2B 5KT3A 4ED8A 5KFBA 5CYQA 3TAGA 5KFMA 4O3OA 1S48A 5KFWA 2DPJA 2VG6A 3TR8A 2Z1JA 3KK1B 5L9XA 3VQAA 5KT2A 1VSEA 3NH0A 2UVUA 3V4IA 4IH7A 4IKFA 5JUMA 1ZBHA 3M8PB 2YHBA 1ZTWA 4WFZA 5HP1A 1J9AA 4NCAA 4FYDA 4IFYB 3BDPA 4CESA 3KK3B 3V1OA 3ITHB 3QERA 2WTFA 5J2PB 4DF4A 2IM0A 5T14A 4Y1DA 5FDLA 4TY8A 4CJ4A 3PX4A 4YQWA 1S6QA 1SH0A 2DFEA 5KT6A 3K58A 1BI4B 1UA0A 4KV8A 4GC7A 4NLGA 1N4LA 5EWEA 4NLPA 4CEQA 1KLMA 1TL3A 4DSIA 3H4DA 3ZSQA 4KREA 5KGXA 4KKOB 3SFGA 1RBUA 3CFPA 2HNYA 2AX1A 5J2MB 4AHVA 3RAQA 1C1AA 1NK0A 1RT2A 3DI6B 4Q45A 4EP4A 2UVWA 4DU4A 2YHAA 3SI6A 3V6DB 3MR3A 2IM2A 4FW2A 3KLVA 3H4BA 3KK1A 4URQU 4JV2A 3V9UA 3ZSXA 3RBEA 4IBNA 3M8PA 4FLWA 1RT7B 1N48A 2FLLA 3ALYA 3GYNA 2YNHA 3QGIA 3S9HA 2ETJA 4WYWA 2AJQA 3LP0A 4F2SA 2C22A 3KK3A 3SV3A 3ITHA 3RMBA 3WNGA 4IOBA 2UVVA 4QWEA 2XY5A 1VSLA 4ICLB 4O4RA 1U4BA 4M3YA 1HPZB 1T8EA 3SI8A 1SL2A 1UA1A 3AVCA 3SJJA 3SPZA 5KFXA 2W7PA 4O4GB 3AVGA 4TYBA 4FM2A 1Q8IA 4NLWA 1TL1A 2FBXA 5C42B 1TK8A 1C6VA 2GIQA 4JLHA 4CGFA 1JXEA 4DMNA 1NJZA 4KFBA 4CHZA 3DI6A 3AA4A 3PZPA 3T19A 2A1SA 3IGNA 4HYKA 1ZBFA 2XI2A 3KD1E 2CJQA 2QKBA 3M9NB 4BWMA 3OYLA 4TN2A 1RT7A 2OYQA 1SH2A 5KRTA 4JS4A 3NKYA 4Y2CA 3UQSA 2E9TA 1JX4A 4HCBA 1LAVA 5HLFA 3HVRA 3NF9A 4CK1A 1J53A 4CJQA 2C2DA 5FROA 2O4GA 3UDLA 4C8NA 1WSHA 4YMEA 1TAQA 5F8HA 4FW1A 4E1MA 5HRPA 1Q9XA 3GIJA 1LWEB 3RBDA 3L2WA 5F8MA 4DTRA 4ZPDA 2D41A 1L3VA 2UUWA 4WXWA 4O4GA 1S1XB 4IRCA 1RILA 4AILC 2Y1IA 1IKYB 4BE1A 5FRMA 2D0BA 1B9DA 4Z4GA 3RWUA 4WFXA 4NLXA 2FVPA 1HNIB 2XCPA 2P51A 3OHBA 1T03A 4RUAA 3NH2A 5L1KA 2AQ4A 3C94A 3LP1B 5CZ2A 3TAPA 5C5JA 1UWBB 3NCIA 4FJXA 4HUFA 5EDWA 4WYLA 4MH8A 4HKQA 3NGDA 4IFVA 5F8JA 4CEOA 3ZCMA 3EZUA 1HARA 4TXSA 1XR5A 2VG5B 4QPXA 3HVAA 4CJLA 4CEAA 1B9FA 2HW3A 4RZRA 3QNNA 2OH2A 3RRGA 3PW5A 3GQCA 4FJLA 4TQRA 2HHWA 3LZIA 3LPUA 1RDDA 2XY7A 2FVSA 1C0UB 1S1XA 4DL4A 5KFNA 2W9AA 3AVHA 1I6JA 1RT1B 1S6PB 3GIKA 1X9WA 5HBMB 4DSJA 4DU1A 1S1TB 3ULDA 4ECWA 5J2NB 2BGGA 3HPGA 1GOAA 3JYTB 1ITGA 3HYFA 1L3TA 3TAMB 4I7FB 2A1RA 1T7PA 4O3PA 1JLFB 3CJ5A 1HNIA 1GOBA 3ISNC 2FJVA 4AHSA 3QGHA 4Y1CA 1RNHA 5D3GB 2XRIA 3LP1A 1EKEA 3HSTB 3FDSA 3G10A 1UWBA 4O3RA 3DLKB 3OLAA 1T05A 4LH5A 4H54A 3CJ2A 3VN5A 3MEGB 4ZMMA 1LWFB 3NAIA 1HJRA 3I5AA 1WAJA 3HT3A 3M8RA 2XY6A 4DL3A 3DYAB 2PZSA 1D9FA 1J5OB 3DLGB 1XI1A 5HRRA 1XR6A 3RR7A 2IMWP 4CF1A 1NK8A 4PQUB 1JLBB 4ZP9A 4ZHRB 3V9WA 3OL6A 3O3GA 2OPPB 1D9DA 2D3UA 4FK4A 3AVAA 4LD0A 1J54A 3KMSA 4NZ0A 3U6FA 3MXMA 1TKZB 1JLCA 1C0MA 2AGOA 4F4YA 1C0UA 2IOCA 4ZVGA 2R8HA 1IKXA 2QXFA 4ED2A 1SKRA 1RT1A 1S6PA 5HBMA 3MR2A 4CJFA 2AU0A 1S1TA 3VQCA 3DLBA 4FZXC 4MIAA 5J2NA 3MEDA 3HKWA 3JYTA 3GV5B 2F8EX 3MXIA 3TAMA 3OYCA 4FLZA 4DL7A 4CIFA 3D28A 3ZSZA 3I0SB 2BE2A 5D3GA 3SUPA 2E9RX 4F3TA 4QWCA 3V6HA 1RTIB 4QW8A 1JLEB 4ZVFA 3KK2A 1KHWA 3GV7B 4WXOA 1FK9B 3MEGA 1IM4A 2HHXA 1LWFA 4DU3A 2KZZA 1C0TB 3AVFA 5F9NA 2I5JB 1U48A 3L2VA 1RBTA 2IM1A 2UUTA 3DYAA 3UR0A 3BR9A 3H5XA 1JLGB 4Q44A 3IRXA 1J5OA 1KFDA 4DQSA 2QKKA 2DPIA 3QEWA 1TKTB 5KFZA 4FLYA 2R7YA 4PQUA 1JLBA 3HPHA 4ZHRA 3FQLA 3KLGB 1L3SA 4NYFA 1SKWA 3I0RB 2DFFA 2OPPA 4RW4B 3DRPB 4O3QA 4ID5B 3LP2B 1VRTB 2YV0X 4OPJA 3O3HA 3PJWA 1NJWA 5L1JA 5K14B 3DLRA 1CZBA 3H5UA 1XHXA 4B9MA 3OSPA 4J9PA 4J2BA 3OSNA 2JEIA 3NF8A 3NHGA 3FQKA 3NBPB 1BIZA 4RNMA 1NKEA 3V1RA 4M3UA 1F21A 3SQ4A 2B5JB 3I0SA 5HRNA 1G15A 1IH7A 3AO5A 1IO2A 1JLEA 1VRUB 2IAJB 2FVCA 4DTPA 2YKMA 5KFOA 3HL8A 2E6MA 4CJEA 2XY8A 3KIOA 4JRPA 1FK9A 3BQ0A 1C0TA 4IRKA 2RDJA 2IC3B 2HNZB 4ECUA 1EX4A 4XO0A 4CJUA 1C1CB 4CJ3A 2ASLA 2E4LA 1QE1B 4LSNA 3KD5E 1CLQA 3T5JA 3EZ5A 2FBVA 1TKTA 3LPTA 3KLHB 2IDOA 3P1GA 3A2FA 3QLHB 4PUOB 3KLGA 2IGIA 3I0RA 3PW4A 4RW4A 3DRPA 4ID5A 3LP2A 1VRTA 1S97A 2E9ZA 2NUBA 3ASMA 1SUQB 3PW0A 2IS3A 1QTMA 4CF0A 5K14A 5JS2A 2VG7B 3IS9A 4MKAA 1DLOB 3BJYA 3V9XA 5C24B 4RW7B 4R8UB 2HVIA 4BDPA 2ATQA 3CVKA 1SKSA 4MIBA 4KTZA 3BSCA 1C2PA 4FJ5A 1NNDA 4DFMA 5KFHA 1JLAB 2B5JA 5L1IA 4WZMA 1NKCA 2FBTA 4BWJA 3K5LA 3ZT4A 2JEGA 4CJWA 2HHTA 2IAJA 4CF9A 1FKOA 1N6QB 4J9NA 4N41A 4NRTA 2D5RA 4N5SA 5KFCA 4Z4CA 3DRSB 2HNZA 5FRNA 4DFJA 4UQGA 1BL3A 3QIPA 3OYEA 4DS4A 1C1CA 2ZE2B 4CGHA 3RB0A 2HHVA 1KTQA 3PO5A 3KLHA 1NHVA 5CZ1A 1EP4B 3HHKA 4DEZA 4FJ8A 3O4NA 3LP3A 1YVFA 3HVWA 4M94A 3QZ8A 4KI4A 3I5BA 2WCXA 2BDPA 1SUQA 3OS1A 2B4JA 3S3OA 4FJGA 4IH5A 2OZMA 1DLOA 3AVKA 4C8KA 5C24A 2EX3A 4NRUA 4RW7A 4R8UA 4EBDA 1T3NA 1S0NA 3BSOA 5DGAA 1BQNA 4NLTA 2Y1JA 4BDZA 2PYLA 4DWIA 1RBVA 3RTVA 4FJKA 4FXDA 2C28A 3CIZA 3C6TB 3KLFB 5KFFA 3EPGA 4KRFA 4DQRA 4EBEA 5DLFA 3G6VA 3DOKA 3RRHA 3HM9A 1W9HA 4EBCA 2IBKA 1RTJA 1EXQA 2OPRB 1NJYA 3QO9B 5KT7A 5E41A 4YR0A 2ZE2A 1I3AA 1JL2A 4H4MA 5KFGA 3HK2A 5KFIA 3NH1A 4HHTA 3PX0A 4B9TA 3ICLA 3OYHA 2QK9A 3DOLB 4CFDA 5KG5A 1EP4A 1X1PA 3DRRA 3MFHA 3THVA 3BGRB 4DTSA 4K4SA 4J9QA 3AVJA 3DLEB 3Q8PB 2BQ3A 1KRPA 4E89A 1HYVA 3O4QA 2R2TA 4F4ZA 3F73A 2XWYA 5DG7A 2C2RA 3WNHA 4QWDA 3VA0A 1QHTA 4KTWA 3KOAA 4BDYA 1YTUA 1VSFA 2FLNA 3AO1A 1JXLA 4IFYA 3I8DA 3S3MA 1QSSA 4AHUA 3C6TA 1BIUA 1CSJA 3TANA 5J2PA 3BSAA 1TKDA 2VWKA 3OS0A 3G86A 4CJ5A 3VQ7A 2G8FA 4ED6A 1S0MA 5KGWA 4IH6A 5I42B 2OPRA 1BI4A 1ZETA 1A5XA 3QO9A 4MQ3A 4AHTA 3K57A 4NCBA 4R5PB 3KLEB 1S0OA 5J1EB 3L8BA 3GV8B 4ECXA 4FJNA 4ZPBA 5DG9A 3LAMA 3WNFA 3GIMA 3DOLA 4ELVA 5KFPA 4KKOA 2KW4A 5J2MA 4FZZA 4Q43A 4E1NA 4EYIB 3IN5A 3BGRA 1LW0B 4RU9A 3DLEA 3QEIA 2RPIA 1VSHA 2VWJA 4FJJA 1KVCA 3V6DA 3L2UA 2BANB 2R8KA 4HUEA 4CGGA 3NE6A 1YT3A 2WK4A 5KG1A 4BE0A 3WNEA 2G8VA 1BHLA 5DQGA 1R0AB 3AA2A 4WE1B 4ZVHA 3AVBA 4ELUA 4QAGA 2RF2B 5CYMB 2BQRA 1TQLA 2LSNA 4C8OA 2OPQB 3MECB 4HUGA 4B08A 4M3WA 3I5CA 1TK5A 1I39A 4IDKB 4YR3A 4AHRA 5KFDA 3T5LA 4ICLA 1D0EA 2IA6A 2W7OA 2JGUA 4EP5A 1HPZA 2R8IA 4OKKA 4E7IA 2ASJA 3L2QA 1RT3B 5KTQA 4R5PA 2EHGA 1S9GB 5J1EA 2HWHA 1DTTB 5DGBA 5C42A 3V9ZA 4KB1A 4ECQA 4O55A 4Q8FA 4B3OB 3FRZA 1XR7A 2JEFA 2F8SA 1LW0A 5KG2A 4IQXA 2XO7A 3VQPA 4CGJA 3B6PA 3ISND 1QAIA 4OGCA 2F96A 2BANA 1MMLA 4ZPAA 4Y3CA 2ASDA 1S1UB 5J2QB 3P5JA 3RB3A 3ZSRA 3K5NA 3N6NA 1R0AA 1SH3A 4DL6A 1EETB 3H2LA 2RF2A 5CYMA 3RAXA 3TI0A 5KFTA 4CK3A 2OPQA 3MECA 1S5JA 4CK2A 2GIRA 4NYNA 1HYSB 3VQQA 2GBZA 3H59A 4RG8A 3Q8RB 3F9KA 4JS5A 1RDCA 1LWEA 1D8YA 3V9SA 4L8RB 4FCYA 4E3SA 4QOZB 1RT3A 3LWLA 1RT4B 1S9GA 4DS5A 4XPEA 5KG6A 1DTTA 1L3UA 3Q8SB 1IKYA 2J6SA 5KG4A 3VQ6A 4Q0BB 4TQSA 2KTQA 5HROB 4MK9A 5KG0A 3AVIA 4B3OA 2ITGA 4F4KA 3OYGA 4W5TA 3E01B 3TABA 2QE5A 4ZPCA 4DFKA 4KE5A 1N56A 1K1QA 3OL7A 2YNGB 1S9EB 2UVRA 4H4OB 4RW8B 1DTQB 1EETA 2JC1A 3RMDA 3LWMA 2OPSB 5I3UB 3OYNA 1TGOA 4RUCA 5KG3A 5JXSA 4K4WA 2VG5A 2R2RA 3PV8A 4RNNA 4J2AA 4KI6A 2W9CB 1S1VB 5SZTA 4C8MA 3OHAA 3T3FA 4CJTA 4FS1A 3ZT1A 4NLSA 4RW6B 3NGZA 4NLRA 4M3XA 1ASVA 1RT4A 4FBTA 4HTUA 1JKHB 2AGPA 4EEYA 3N6MA 3CDUA 2XC9A 1QSYA 4FK2A 3M8QB 4FVMA 3NGIA 1TP7A 4Q0BA 4CECA 3OYKA 3MR6A 5HROA 3LZJA 5EWGA 4F4XA 3KHLA 4I7FA 2R2SA 1JLFA 3TWHA 3OYFA 4LH4A 2RKIB 3E01A 2X6SA 1RAJA 4DSLA 4CIEA 3VQSA 1SL0A 3PO4A 2KFZA 3DLKA 3KKSA 2YNGA 1S9EA 4H4OA 1DTQA 4NLYA 2FBYA 2OPSA 5I3UA 1YTAA 3JSMB 4NLVA 1NK6A 4IRDA 3DLGA 4KHRA 2W9CA 4CFBA 1S1VA 2BR0A 1QS4A 3GIIA 4KHWA 3HP9A 2YKNB 4ED7A 4Q5VA 2X78A 1RYRA 3K5OA 1RDBA 2XCAA 3ZT3A 3TVKA 4DSEA 2B6AB 5KRSA 1TKZA 1JKHA 2FJWA 5L1LA 4XIUA 2C2EA 4ZP7A 1TVRB 4M3TA 3V1QA 4DF8A 1NK7A 3M8QA 3B6OA 4TYAA 3AO4A 2FLPA 4FM1A 3NAHA 1GX5A 3DMJB 2E6LA 4KB0A 4IG3B 2JC0A 5KFVA 1NOZA 4ECTA 3IG1B 4FJIA 4LQ9A 1RT5B 2Z1GA 4FBUA 4CHPA 4CHYA 1WNEA 1WNSA 3M8SA 3KKRA 2RKIA 4CEZA 2X74A 1U47A 1RTIA 2HHSA 3T1AA 3OLBA 4CGIA 2GV9A 3BQ2A 4TY9A 3E51A 4K8XA 1W0HA 3G6XA 4J9MA 3IGVA 4ED0A 2I5JA 2VA3A 5CY4A 3HO1A 3PY8A 3LAKA 3JSMA 2WONB 2XGPA 1JLGA 4PA1A 4FZYA 3CJ0A 4KHQA 2XGQA 2FC0A 4RW9B 2GUIA 2ZD1B 1TK0A 3V6KA 2YKNA 2FVRA 1S9FA 1RCHA 4X2BA 3OJUA 4M42A 4CE9A 1T94A 3H5SA 2B6AA 1LW2B 5C25B 1YVUA 4CF2A 1CZ9A 1TKXB 3SQ0A 4AH9A 4QWBA 4IR9A 1RYSA 3OL8A 4M45A 3DMJA 4JV0A 2HB5A 3SPYA 4IG3A 4DLGA 2ZKUA 3IG1A 1SV5B 3CFRA 3NBPA 1RT5A 1XWLA 4K4YA 4Q8EA 3MFIA 1LWCB 3O3FA 3QGGA 2W9BB 2GC8A 1S1WB 4M3ZA 1NK4A 5KFSA 4GC6A 1WSFA 1VRUA 1KVBA 3PW7A 3LALA 3V4IB 3NDKA 3C95A 3QNOA 4CJSA 2IC3A 4I9QA 4OLAA 2WONA 4KHNA 2G8KA 5DG8A 1QE1A 1IG9A 4RW9A 2G8UA 1S49A 4KSEB 2AX0A 5EU7A 1U49A 3QLHA 4PUOA 4TY8B 4CEFA 1K1SA 3DM2B 4OKJA 3SYZA 3TAEA 1XHZA 4YR2A 1NKBA 3KTQA 3CG7A 4KV8B 4I2PB 4U6PA 4KHYA 3M9OB 1LW2A 3NAEA 2YNIB 2D0AA 3H5YA 1KLMB 4KAZA 4K4ZA 2VG7A 3KJVB 4DQIA 1C1BB 5JS1A 3VQ9A 3RR8A 1GOCA 1SV5A 4EYHB 2D3ZA 3CM6A 1LWCA 1JLAA 3OYJA 1NK9A 2W9BA 4ECRA 3L3VA 1S1WA 2KFNA 4F50A 3ZT2A 4EZ9A 5KFJA 1VSKA 1N6QA 3EPIA 3VQ4A 4Z4EA 3DRSA 2R8GA 4DQQA 2YNHB 1ZBLA 3LP0B 4KPYA 2HMIB 4W5RA 4DTOA 2J6UA 4RNOA 1U04A 4Z4FA 5KT4A 4LQ3A 4M95A 2HAIA 4CFAA 5KFRA 3DM2A 2ILYA 4DL2A 3QIDA 4CEDA 5KFAA 4MK7A 4FLXA 4I2PA 2CKWA 3CQ8A 3QESA 2XI3A 2YNIA 3MR5A 1RTDB 4FM0A 3KJVA 4MKBA 4OPKA 1C1BA 2WRMA 4ED3A 3OJSA 3NF7A 4KBIA 4GVMA 1TL1B 4E7JA 1JIHA 4KTQA 3QZ7A 3QETA 4DTUA
chains in the Genus database with same CATH superfamily
4X84A 4PRFA 3HVTB 2FHOB 2QMXA 3KLFA 3NP5A 3P45B 5CD4H 1VQLS 4NXMF 2P9UB 4CZFA 4XDDA 3QEPA 1XNQJ 3SUNA 3GCWP 1IKVB 1E6YB 3Q8VA 7FDRA 4N7TA 3BZQA 1KFSA 3MDFA 3HRGA 4OZ1A 4GKKK 1HBUB 4GKJK 2JEJA 5HLFB 2Z1IA 5I9EB 3R3LA 3LANA 4DR7K 4CHQA 2F5GA 3CCMS 4PR6A 1ZH5A 2X7IA 2G8HA 4KBOA 4GO5X 2FPHX 3CHWA 5DQHA 3TZZA 1U1LA 1Y97A 5FLXO 3CUNA 2WHOA 1HNZK 4A5AA 5LMUK 2ZUGA 4AUKA 4LF5K 4IG0B 2RSQA 1WUUA 1Y3KA 4QIVA 4FNHA 2XQCA 4ZPVR 4LF6F 3HVTA 3VQEA 1T03B 3KJFB 4RR5A 4JRQA 1VCTA 3JXUA 1X7VA 4YHHF 4FJHA 2HRTA 4H0VB 3QJLA 3FCHA 3TPQA 4U67L 2VKRA 4OYWA 2OUGA 4YB1P 2P9UA 1KQKA 1IKVA 1E6YA 3OUYB 2KVQE 1PJ7A 5I42A 1QUVA 2B4UA 1R8HA 4DV3J 1NGJA 2DTUA 1HBUA 3R1HA 3KLEA 4X4NA 3AA9A 3KWGA 4O3NA 1IR0A 3JQJA 2CJXB 5JMNA 2PD1A 1UCNA 1RA7A 3FZFA 2DY4A 3NMAA 3J7Z5 1LAWA 4LF8J 1S4FA 3SJHA 4KQZA 4ILGB 1FXXA 2ZOFA 4DR5K 1LFWA 2ZVSA 5K8PA 1FA0A 1DBDA 3NF6A 1HKAA 3RW7A 4DX7A 3C6UB 1SPBP 4IG0A 2CQCA 4LT6A 4PWUA 4HT5A 1N32J 4MO5A 4DR3K 1TV6B 4N47A 3BO2A 3F2KA 1H6KX 4FWLA 4L72B 4Z7CA 4PXBA 4P10A 1N54B 2KQ2A 3OTOK 2CJBA 5GAHP 2HKEA 4I2QB 3OUYA 3N4PA 4PCQA 1EZZB 3OR2B 4U7UD 4DDFA 4PWDB 1VSMA 4JI7J 1FRIA 1SCJB 1WSEA 4X62F 3O80A 3D0IE 3NCPA 4ISFA 3PKMA 2LFVA 4NYZA 2GIFA 3PRVA 2JZ5A 1N5YB 1AYEA 1RBSA 4DX5A 4Y6IA 1PKUA 3PX6A 3D0PA 1BUXA 3V6JA 1U8SA 2DB1A 2LEPA 2R7OA 5J2QA 4AM7A 2FTRA 2XMUA 2O4IA 4TSXA 4K8ZA 3C6UA 2DNHA 2CWKA 4DX6A 3U9DA 4OFZA 4IR1A 2HS0A 4DTJA 1VQ6N 1TV6A 2BE2B 4C23A 3QEVA 3HJFA 4M8LA 4XH1A 1HYSA 4BE2A 3D68A 3PW2A 4I2QA 2I38A 3PUFA 1VDHA 3SBMA 3LPYA 4F67A 1MLAA 1SIWB 2X6NA 4K4XA 3PFEA 1S4EA 5KG7A 4J9OA 4NXNK 4PWDA 2KI2A 3TQ1A 1HNZF 4QR0A 4LF5F 1KR4A 2F8MA 2RB7A 1A7GE 2A41A 2JVOA 2RAQA 2E88A 5AQGA 3KUHA 4WTYA 2ASOA 3HCXA 2KLAA 4KHMA 3K59A 1N5YA 1IM6A 4I0WA 3WXJA 4CHOA 5LM7E 3AODA 2HHUA 3CULA 4TLRA 3S8SA 4PXCA 1YJVA 2V2VA 1BA0A 3FSIA 3W2WA 1XMOJ 2NYIA 1ITPA 5F8GA 1GMWA 4K4VA 3QMLA 1CXUA 5F0UA 2CADA 2HFOA 4F4WA 3OXGA 2KRRA 2CNLB 2XBPA 4ECZA 4C8LA 2YKMB 2ZOGA 3T41A 3R7BB 3W62A 2V0NA 3GR0A 1S57A 2B8QA 1GLFO 2KYXA 4RO0A 4KAIA 3W60A 3Q8QB 4LFBK 5AQSA 2G8WA 2E7XA 4JI5K 3QFPA 2X51A 1M5PC 3FBBA 4DR6F 2CGKA 2MKIA 5HN0A 4PWWA 3WX4A 4CLSA 3OTOF 3BSNA 4C3MA 3LDOA 4RWWA 2Q31A 1YITS 1KONA 2BKNA 3G0ZA 1AROP 1IBLJ 1K0VA 4FJ9A 2IYIA 4WKRA 4BRMA 2YI1A 4FDFA 5AXLA 1KQSR 1RA6A 4ECSA 3CD7A 2IIRA 1BQMB 3EE8A 3T5HA 1TR0A 2KHOA 2V8PA 4GW6A 4CZLA 4JV1A 1VK8A 2VICA 4KO0B 3JTNA 1B92A 4J9VA 4HTJA 3WXMB 2Y1RI 5LJ3Y 4B9VA 4GVLA 1HQEB 1B99A 4YDDB 4WFYA 5KT5A 3E9OA 4XH4A 5CHCB 4ZP6A 1R8PA 3OYAA 4PG8A 1KEKA 4BRIA 3CJ4A 1XNQK 1AW0A 3KLIB 2XZTB 2ZJQQ 1JL1A 5I3QA 2P9PA 4E2FB 3SQ2A 1S7IA 4RBUA 2K3IA 4BRHA 3SNNA 4BR9A 2V2QA 3D1OA 2C42A 2P9IB 3HX9A 2EFNA 2J9DA 3W65A 1ASUA 2LEAA 4FLUA 1QAJA 3H6EA 2Y0SD 4EU0A 2BQUA 4YY3J 4FF1A 4KT0C 4P75A 1UJ5A 2ZQBA 3ZZUA 3OR1A 4BR0A 1C4CA 4NXNF 3OY9A 1WLJA 5HP1B 2IM3A 1KSPA 2C1EB 1NHUA 4BR5A 2ADBA 3AO3A 4Z4HA 1ZM2A 1CBKA 1SL1A 1BQMA 4CJVA 2W6LA 4M3RA 5BXIA 2C2MB 1WC1A 4M5DB 2NXCA 3UN2A 3QEXA 4ED1A 5FDLB 3HD1A 4KO0A 1S6QB 4E19A 3G82A 2YJEA 4QS7A 5AQHA 2RMLA 3SFUA 1HQEA 1HJOA 5B0CA 4H4MB 2JFDA 1TL3B 4P52A 1WD6A 3FZLA 5B0DA 2PMWA 2V9WA 3IFEA 3KLIA 3VQDA 3MF5A 1VBKA 3O9UA 1ZAWA 1UEUA 4K4UA 2L41A 2DGQA 4ED8A 2P9IA 5CZVA 3TYTA 5IS2A 4CH1A 3AJ1A 2FJBB 2Z1JA 1XUPO 1VSEA 2GO8A 3ONQA 2G13A 5JUMA 4LF8K 5HP1A 3A13A 1J9AA 2GJ2A 1FFSB 3BDPA 3G8SA 1DURA 4JI5F 4KC5A 1MN7A 3C6HA 4U67Q 1NG9A 3QERA 3CETA 1EARA 4M5DA 2IM0A 2WSCC 4DV5K 3KDNA 5FDLA 4TY8A 5CCMA 4CJ4A 1S6QA 2QWPA 7FD1A 1IG8A 4U7BA 2E20A 2DR5A 1N4LA 4XH5A 1HR0J 4CEQA 1TUGB 1TL3A 2HFVA 1P6TA 3H20A 3ILLA 1JK9B 3I4HX 2OMOA 2G0IA 5J2MB 2YQ1A 2GQCA 3CJ8A 2VU5A 4A8KA 4BRCA 4DUZK 3DI6B 4EP4A 1OY6A 4DU4A 2YHAA 1Q78A 2ZH9A 1PO6A 2W41A 3KLVA 3H4BA 3HMJG 3K0SA 1NGDA 2RRAA 1W2BM 3KG4A 2OFGX 3RBEA 4IBNA 2FLLA 3PYEA 2ETJA 1QM9A 3SQOP 3K0JA 3NMRA 4FYVB 3R5JB 2HEKA 2UVVA 4QWEA 1MSWD 2J5AA 1VSLA 3H25A 4O4RA 1U4BA 3VAMA 1SJ4P 1HNXK 1PC5A 1WDDA 3AVCA 1JCGA 4O4GB 3DXSX 1KAYA 2LDIA 4FM2A 1Q8IA 4NLWA 3JAMU 5E3PA 2KO1A 2W2OP 2FBXA 1TK8A 1OYDA 2QG9B 3NGTA 4JLHA 3RU0A 1XMQF 3DI6A 3AA4A 2V6AA 3PZPA 4JN4A 2HZCA 3MCAB 4L3KA 2VOPA 3D1HA 3KD1E 2EKNA 3CD0A 3M9NB 1RGIA 1S7HA 3A5MC 4JNEA 3I82A 3QWUA 4TN2A 3MPVA 1YJ9S 4B3SK 3NKYA 2AEMA 2E9TA 3LUYA 3X1LB 2MZTA 2X3DA 4L76A 1LAVA 1BLUA 4M5HA 4MTPA 1ZBSA 3AXMA 1XMOK 2HURA 2FSKA 4CJQA 3Q2TC 4JI4K 3UDLA 3K9JA 4C8NA 3CQYA 1WSHA 2CDQA 1TAQA 4CQ1A 4LF7J 5HRPA 3PHTA 1Q9XA 1LWEB 4FL9A 4B3MJ 2AA4A 5F8MA 2DNOA 1MMDA 1HI1A 4O4GA 2K8GA 2NUHA 1VQ5S 4IRCA 2OTJS 1B9DA 1ZA1B 2LU1A 3RWUA 4WFXA 4NLXA 4ZVQB 2FVPA 4BR7A 2WSFC 2XCPA 3X3UA 4CLLA 4DV5F 4ES2A 3EEQA 1XMBA 2QA4G 1FXRA 5F0XA 4FJXA 2VPYB 2YQ3A 4MH8A 3CCQN 3FBCA 3TTFA 4DV1K 4UZCA 3BB5A 3EZUA 3MAHA 3W5YA 1EWQA 4ZN1A 2WSEC 1RAAB 2CJAA 5ETSA 4P2FA 1HBMA 1XR5A 4ANCA 2VG5B 3FKBA 2Z30B 3HVAA 5CYJA 4CJLA 4CEAA 1B9FA 4RZRA 1IBKJ 3RRGA 3PW5A 3ZZTA 4GV6A 4DUZF 4TQRA 1GXUA 2CQPA 3LZIA 2C2NA 3OVBA 2XY7A 3T1YK 4IUFA 3RJMB 4L75A 4IOCL 3AVHA 1I6JA 3EKUA 4NZ7A 3CCVN 3ULDA 5J2NB 4UUWA 3HPGA 2WVCA 2YX1A 2IVPA 5F2RA 3KWIA 3TAMB 2BVZA 5KPRA 2A1RA 4BRFA 2XHWA 4TVAB 3GU0A 3ISNC 2FJVA 2N82B 4AHSA 3QGHA 5C2FA 1RNHA 5D3GB 2UP1A 1M5KC 2XRIA 3KHYA 1KNZA 3G10A 2W40A 1HNXF 3D0HE 3EXCX 5DM6L 3MEGB 1LWFB 2V2ZA 1WAJA 3M8RA 2QYCA 3MCSA 3MM8B 4WBFA 1HWLA 2PEHA 3DLGB 1XI1A 3I56N 1XR6A 2MKKA 2XMKA 4ZP9A 3V9WA 3O3GA 2OPPB 1D9DA 1QY7A 3GE1A 5HQLA 4LD0A 2ASYA 4X4SA 2A2DA 2O8FB 3MMBA 3M2RB 5H9FJ 4CJFA 3VQCA 4B3SF 5AQYA 5J2NA 2NRWA 3GV5B 2F8EX 3MXIA 3TAMA 2K7KA 4FLZA 3D28A 3M32A 5D3GA 5D78A 1M1KT 2P2CB 4QWCA 4JI4F 1TUWA 4WKYA 1WG1A 3UD5A 4IFEA 3MEGA 1IM4A 1WOOA 3O9TA 1LWFA 3L4BC 1C0TB 2YX6A 3EMTA 3K9KA 3VETA 1NXIA 1K0TA 5IT9U 3UR0A 3MM8A 3IRXA 1EX8A 2H5EA 2QKKA 4BRLA 5KFZA 4FLYA 2R7YA 2DHHA 2IDEA 1TMMA 4LRBA 3D7EO 2KT3A 1HBNB 3I0RB 1SKWA 2DFFA 2OHDA 2OPPA 3DRPB 4O3QA 1SXLA 3LP2B 3S1TA 3O3HA 2BTFA 2VPXB 5L1JA 3R6GB 2DRBA 2POKA 4DV1F 3M2RA 2P9EA 3H5UA 4AD6A 4JYAK 5C2CA 5L39A 4J9PA 5ETQA 4DUYJ 3CMAN 4X66J 1HR0K 3TX8A 3SQ4A 2D3OR 4AQYJ 3NS7B 2MJNA 3MN5A 5HRNA 1G15A 2FY8A 1IH7A 4CZJA 5A0YB 1IO2A 2UXDK 3KIOA 4JRPA 2BYCA 1C0TA 5KPTA 1ATSA 4IRKA 2RDJA 3T1YF 2IC3B 1VS3A 1DFDA 1EX4A 3QBWA 2BM0A 2UUCK 3G71N 3KD5E 4A8YA 3F56A 3KLHB 3P1GA 4PUOB 3FZBA 3THTA 2DR9A 3I0RA 2BABA 1WEZA 3DRPA 3LP2A 2E9ZA 1HI8A 5C7PA 1VJWA 1RACB 2CGLA 5JS2A 2VG7B 3PYDA 4MKAA 3BJYA 5C24B 3U9ZA 2Q0UA 4C2MA 3IDHA 1X5OA 3IO1A 4F4AA 1HLUA 1S59A 4OLPA 3ZX3A 2G1HA 4B1XB 2G4BA 2JRSA 2ZWPA 4LC9B 3K5LA 3GLJA 1M5VC 2KKHA 5A0YA 1V3RA 1FKOA 1N6QB 4J9NA 2HHPA 3IM9A 4N5SA 4Z4CA 1UWAA 5CR4A 5FRNA 2GEMA 1M1KO 4DS4A 2HBYB 1NPKA 3RB0A 2FF6A 4M1KA 3KLHA 3TSQA 5CZ1A 2MZQA 5IZHA 4LR7A 3J81U 4C9DA 1Q8LA 4KI4A 1VQ4S 2WCXA 3OS1A 4BGBA 3P5TL 3O3LA 5C24A 2EX3A 5DM7Q 2C2KB 1JJ2M 3ISZA 1M90T 3D3CJ 3KG1A 5F3TA 4KHPJ 1VR6A 2L9DA 4BDZA 2ZH1A 4FJKA 3HOSA 3OT9A 4IO1A 1ZM3A 2EFQA 3ZZRA 4TU7A 5KFFA 3LM9A 3AAQA 1QDUB 4PKGA 3RRHA 3ZTQA 3LGHA 2MSSA 1EXQA 3QDKA 2CQ4A 3MZIA 3T69A 4CD3A 4JYAF 4HHTA 4K41A 3SCKE 3DOLB 1T9WA 1HHTP 3CCRN 5BREA 2QA4S 3DRRA 5A6WA 2WB1D 3BGRB 4DTSA 4J9QA 1S72S 5ETOA 1HHSA 2UXDF 1KRPA 1HYVA 1WG5A 2R2TA 4F4ZA 3PIOQ 5DG7A 3WNHA 1RZMA 4WIQA 3VA0A 1NRKA 2DBBA 3KOAA 5ADXH 4J7CA 2FLNA 5AZIB 2UUCF 2IPOB 4U96A 1BDGA 3TNVA 4CO0A 1Z6RA 1QSSA 4OLOA 3CC7S 1EQ0A 1BIUA 4BC3A 3MM7B 1CSJA 5H9EJ 2N3LA 4X4QA 5J2PA 3OS0A 3CJAA 3H2UB 4ED6A 4JKAA 3WXKA 3M6WA 5GADP 3FR0A 1ZETA 2IVFB 4MQ3A 1RI7A 4Z7YA 4AHTA 4LREA 1RAEB 5J1EB 4FJNA 4RBVA 3PRBA 4ZPBA 3LAMA 3DOLA 3CJSA 4KKOA 2PN6A 2K06A 4CLPA 3HSZA 2KW4A 2J7WA 2VF3A 2A3JA 4Q43A 2FF3B 3IN5A 3BGRA 4GMKA 3CMES 1F3FA 4QZVB 3QJPA 3KDOA 5TKYA 4YOXA 3V6DA 2R8KA 4HUEA 3LW5C 2WK4A 2VQFJ 4AT1B 2H4WB 4BE0A 5AZIA 1W97L 1VQON 4ZVHA 2CQ0A 3DRYA 2GGPB 1YJ7A 4CYUB 3MMAB 4BY9C 4C8OA 3MCOA 1M90O 5DM6Q 4M3WA 4X64J 4IDKB 2LU2A 4ICLA 2X3GA 1EAYC 2IA6A 2JGUA 1W2IA 3KKFA 4OKKA 2ASJA 4CZMA 1PYOB 3OFFA 3JQMA 3O9RA 2EHGA 3B4MA 3KJQB 5J1EA 5LJ5Y 1FFGB 4NA2A 3UN3A 5DGBA 3H90A 2KXHA 4DPYA 2DXFA 4IO8A 3A3PB 5ETVA 3M6XA 4OZNA 5KG2A 4B3RJ 2XO7A 2EK6A 3NOGA 1RSCA 1NB2A 2OEJA 2RQCA 2F96A 1MMLA 1NGHA 1AZSA 1FX2A 4ZOSA 2ASDA 4LRDA 3P5JA 3N6NA 4YOTA 4OZ0A 2GGPA 5CAAA 3MMAA 1D8ZA 2J7KA 4MT1A 5KFTA 1YITN 1PGZA 3D2WA 2MZ1A 2G0JA 2ALYB 2GIRA 4MKVA 2F4VJ 4RG8A 4X66K 2N7CA 3I32A 5GADU 2ZJPL 1N52B 4L8RB 4Q7AA 4OV1A 1KOHA 3K8WA 5K8OA 4DS5A 1YI2N 3BKFA 4I67A 5D4OA 5KG4A 1P1LA 2R9LA 2MQNA 1RBAA 2KTQA 3CC2S 4C6AA 1V6HA 4FPAA 5M1QA 3AAWB 4ZIVA 2E1ZA 2G2YA 4ETXA 2QE5A 3F44A 2ZH2A 1K1QA 2YNGB 4RW8B 1DTQB 3RMDA 2GHVC 1AFJA 4YOWA 4PG4A 4K4WA 4A8FA 2DNGA 1T44A 2A6OA 2QYGA 1JWWA 1DY3A 4RNNA 3DXBA 3OHAA 1FRKA 2XMVA 4CJTA 1MROA 2L3MA 3SCIE 4FWKA 3SAGA 4NLSA 5HQMA 4USJC 4M3XA 1MNEA 1HNWK 4QU6A 1JKHB 2AGPA 2C2ZB 3TJ8A 1QSYA 4FVMA 1OO0B 2MZRA 2V7ZA 2W6KA 1H1VA 4ZVSB 4UF4A 1QVFR 5EWGA 2PMHA 3KHLA 2UXCF 4F04B 1PJ6A 3TWHA 2O8BB 1CS4B 2RKIB 2AF6A 1RAJA 1AFIA 3W5ZA 2QL9B 1SL0A 5GIPA 3TQEA 3NXZA 2FDNA 2YNGA 1DTQA 2KU7A 1KC8T 4IRDA 5L9NA 5CXTA 2G2ZA 2H3EB 2XCAA 1Y0HA 3ZT3A 3TVKA 3OV7A 4HI2A 3R7SB 1TKZA 1JKHA 1T9UA 2FZGB 3FE1A 3MOZA 3KJNB 3W64A 1HW8A 2CPYA 1X4GA 3DMJB 5AQNA 3NY0A 2JC0A 3WIVA 1TTHB 2OSRA 1IN0A 2R4FA 4G65A 5FIIA 4OJHA 4ECTA 4OHVA 2M8DB 3CD6S 2K3KA 3T9NA 1RT5B 2Z1GA 4WF9L 1CS4A 2RKIA 2YXLA 2N4CA 1RTIA 2HHSA 3GZ7A 4KPCA 1B7FA 2JLGA 3QBCA 3CXCM 3S01A 3M2VB 3BQ2A 4K8XA 3E51A 4J5OA 4C11B 2BE7D 2FSJA 1UW9A 5EX0A 4A8QA 2I5JA 2VA3A 3EVOA 3HHLB 1KOOA 2HFSA 2WONB 1IBMK 3CJ0A 3FMWA 3NNHA 2ZD1B 1M1HA 1TK0A 2MGZB 1FX4A 2FVRA 1RCHA 3OJUA 3ZC4A 1BU6O 4OYPA 3JAMY 2CQIA 2KN4A 1N33J 1U26A 2DNYA 5FLXU 1JJ4A 1TYQB 2HQIA 3D6MB 4C98A 1NU0A 4ZCKA 1XQSC 1RYSA 2P9SA 4A8MP 3DMJA 4ZCMA 3SPYA 5A8RB 3US5A 4XDCA 3GR1A 3CFRA 1FE4A 1RT5A 1HQ2A 2GC8A 2C3PA 1RAGB 4M3ZA 2FC9A 5KFSA 3DU6A 1LNQA 2AP1A 1RHKB 4JI1K 4C11A 4ES1A 3QNOA 4I4BA 2QRRA 4XTTA 3HHLA 4JBCA 2DHSA 2F3JA 2WONA 5DG8A 1QE1A 4FPIA 2O1PA 2NCKL 3OTDA 2EI5A 1S49A 2DRDA 2MGZA 1KC8O 3DM2B 1BXNA 1NKBA 3HDSA 2OIHA 3CJ9A 3FBFA 1NZ8A 5B7WA 1IJFB 1F5CA 4DQIA 3GBTA 2MKCA 3R5GA 2BJ3A 2PFUA 4H03B 2C3UA 1ZAXA 5A8RA 1HBOB 2GWKA 2EPIA 4LF9F 1PG5B 4I64A 2L48A 2X1AA 1VQ5N 1JLAA 1NK9A 3OYJA 4C1NK 1CJTA 2CXEA 2OTJN 1HLWA 5KFJA 1VQPN 1KAXA 1VQMN 3THXB 4Z4EA 2XHCA 2R8GA 1R8BA 5HANA 2NRXA 1ZBLA 1B4SA 1ROFA 4KPYA 4OJ3A 2D4WA 3AGRA 3QAUA 4M95A 4CFAA 5BRDA 3DM2A 3A8JA 2DD8S 4BC9A 3QIDA 4CEDA 4PAAA 2R7VA 2ZF5O 2CKWA 1HKCA 2XMMA 4P2XA 2O66A 5EX3A 4F3MA 1B70B 1FEHA 2RQKA 2HFNA 3OJSA 4AFFA 3UNYA 1NAQA 4GVMA 2Y8YA 3DCAA 4CVNE 4ZS6A 4KTQA 3QZ7A 1X4DA 2CG4A 4QCLA 1IBMF 2VQEJ 1JJCB 4M41A 4HACA 2PDAA 1D1UA 2QFIA 2LMIA 3RVCA 4GMJB 4JKFA 4LSLB 3O6WA 3DGPB 2E1RA 1IV0A 2OZSA 5CQGA 4RTFD 3M1VB 3THXA 4Z4IA 1C4AA 3BQ1A 2K2PA 2BUPA 5AQPA 3IAM9 3H1VX 2XSJB 1WEXA 4WPAA 4J9SA 4JUZA 4M5LA 5GADI 4F3OA 4MKYA 4KYZA 4ZP8A 4NMLA 3U3GA 2KZMA 4CFCA 4P6QA 4NLUA 3AVMA 3OS2A 4EK2A 3IMQJ 1TAUA 4EMDA 1NGCA 4RUBA 2WOMB 4Y34A 2VJUA 4J8FA 4FKYA 4FS2A 4JI1F 2ZVIA 3VQ5A 2OFHX 2YPZA 2ITMA 1M5HA 1NK5A 3A8YA 2DH7A 1TUUA 3IWLA 5LMNJ 5AQQA 2DO0A 1BGXT 1FDAA 5ETMA 5DDPC 4BBYA 2ABYA 4ZPTR 1DT9A 2P1JA 3K5MA 4LSLA 2JHEA 4QQBA 3J7YU 1MDUB 3PR4A 1IJEB 2GWJA 3G6ES 5IT9Y 1ZTTA 3M1VA 2MJUA 1HNVB 4IFVB 3P49B 2F1FA 1YRTA 1CC8A 2LDYA 5JICA 2XSJA 3PJXA 3A3OB 4LIWA 2FC8A 1NGEA 1Q0NA 1M1GA 1HKGA 1LFPA 1BG3A 1RTHB 2WOMA 3CJ3A 3L7PA 3DXMB 2NZTA 1FWPA 3EX7B 5B0EA 4DV2K 2BX6A 4ZCIA 3Q8YA 1H2TZ 2GO9A 2NSCA 4Y2AA 3KHHA 3NCRA 4CO3A 2HQCA 4ZVPB 3FCWA 4JV5J 4B1ZA 4WFAL 1FXDA 2DGXA 5DQIA 5KFUA 3VERA 3OYBA 5FPNA 2AYMA 2FVQA 1HNVA 4JI7F 4OKEA 3HP6A 4V19J 4CZHA 2AV5A 4HVJA 4O44B 5F8NA 5AQRA 3AVLA 4FJ7A 1OY9A 1RB0A 4A57A 4J9LA 3DDNA 1RWPB 4W98A 2YWEA 4A2BA 4OJGA 1NSQA 1KBRA 1RTHA 4CCHA 3OYDA 2Z2LA 4C0HA 1VK0A 2H4YB 2GS8A 1WORA 4P7TA 4EWTA 2GJFA 4Z37A 3O1WA 3RB4A 1RWUA 1IKXB 1RABB 3O8MA 1S1UA 3GG0A 1X4EA 3ADAC 4F8RA 5L38A 3L7UA 4FLVA 2YKPA 2VONA 1LXNA 1GLCG 3T6JA 2MQOA 4EO6A 4F0MA 3J7ZT 2AEJA 2NUUG 2PYJA 3CCJS 4PG5A 3KK2B 1W25A 1RHRB 4DN0A 3TAQA 4G9ZA 4WJBA 3BR8A 3UE2A 1K6YA 1U2FA 4W92B 3PJ9A 4G3IA 2P6TA 2HWIA 1S0VA 4DV4J 1BOTO 2WFBA 4O44A 4ILJA 3I87A 2YX4A 1IWAA 2AGQA 4NLQA 3J81Y 2DGUA 3AO2A 4E98A 2BH1A 1O0PA 2J0SD 4UT4A 4E0DA 1QZ5A 1QQCA 2FB0A 3E3XA 2N7YA 3Q0AA 1U45A 4JI6J 2DIVA 3TW0A 4IJAA 1F1BB 3R6LB 4HCCA 1R89A 1UJ6A 3JAMO 3CCUS 4YP3A 4BHQA 5KFLA 1VQ4N 2ZH3A 2G8IA 2AYEA 4A46A 4CHNA 3H98A 3MK6A 3LTOA 1NMDA 1FNXH 4XPCA 1N0UA 2EG2A 1J27A 2V67A 2KG1A 4KH0B 3M1FA 3OBIA 2UU9K 1W2BR 1FVSA 3E9PA 3AA8A 2W8KA 1NMNA 1HKBA 4DV2F 2XG8A 4LSNB 4LF4K 2ZJRL 1O5JA 4KGXB 4O8UA 2QN6B 3OYIA 4P71A 1WC4A 1FJGK 3ZSYA 3NS6A 4CBWA 5C0YA 1SJQA 2EW9A 3IS9B 3MM5B 1CQMA 4ZJQA 1P9YA 4ZCLA 2V94A 1NOYA 3SQ1A 4CO4A 1JXBA 4B9SA 3B82A 4LY7A 1HYZA 4ZTFA 5ETRA 3THPA 3VGUA 3ZO7A 1OYEA 2ZHBA 5IFMA 1NJXA 3BH6B 4EO8A 2BRLA 2O8DA 3DHXA 4RLEA 2OLWA 2JWKA 3CC7N 3J7ZO 1T3VA 2V8DA 5TKWA 2XEXA 1Z26A 4IEIA 4M5MA 4O8KA 4IKAA 1DHMA 4R0EA 1TVRA 1P9QC 5MLCV 3HZGA 3THYB 4EZ6A 3SV4A 4JI2K 1OPZA 3D7SB 1KVAA 4DTXA 5CYQB 4RWXA 3HXMA 3I96A 1YAGA 2BEFA 2I0XA 4RNHA 3MM5A 2EBGA 1OH5A 4CO2A 2MLZA 4C3LA 2VG6B 3SXLA 3DLHA 1HRHA 2N4DA 2GX9A 2XLIA 2ZBRA 4ELTA 3BH7B 3PTWA 4FKXA 3CMEN 3ENHA 1N5VA 4KB7A 3L2RA 1WHVA 2QMUB 3HHLC 2AJFE 2V4RA 2PMZD 2B9EA 4CT8A 2KHDA 3DOKB 3W0LA 4CO1A 3R1LA 5E3QA 1RTJB 1KLNA 3NNCA 5IWAF 2ATLA 2XS5A 5DDRC 4KHSA 5C25A 4FPBA 2O5DA 3VA3A 1TKXA 5E3AA 1H73A 2QA1A 2Z2MA 5DK5A 3TSPA 2BRKA 3QJJA 5LT5A 5DMRA 4CGDA 4DQPA 4KHUA 3LDSA 3PHEA 3L0QA 2PY5A 1RT2B 4D3GA 3BBBA 5CYQA 2RHQB 3TAGA 2ROPA 1S48A 2GAGC 1KVIA 2V4JB 2XMWA 2DPJA 2CIMA 2VG6A 1DAXA 2CUYA 2WVEA 3C16A 3GJRB 3KK1B 5L9XA 2BKOA 2UVUA 3V4IA 1UETA 3J7YI 3M8PB 3A12A 1ZTWA 1SI9A 4HVZA 5DRKA 1XERA 4IFYB 4LF4F 5AQXA 4CD1A 2I7NA 4KH4A 3VALA 5HL7L 5T14A 3VAKA 1FJGF 2X1GA 2XB2D 4JI0J 5KT6A 3TA2A 3MOJB 2W4DA 4GC7A 2AP6A 3PRDA 4JV5K 1E6VB 1ZBTA 5IT9O 4DR1K 4NLPA 3ZSQA 2YHWA 5KGXA 3W8PA 4DR4F 3ZZ0A 4UY85 1RT2A 2A3ZA 4WQ5A 4OZJA 3MD1A 4Z2XA 3KK1A 2AW0A 1ACMB 3C0BA 2ZKTA 2B7BB 3M8PA 3QT7A 4FLWA 1RT7B 3QBXA 3LP0A 3GPAA 4F2SA 2MLYA 3RMBA 2QL5B 1FHTA 4JI2F 4U8VA 2W2PP 1YVNA 2PBDA 5JVHQ 3SJJA 4Q2LA 1VBZA 4OV6A 1E6VA 3NEKA 5KFXA 3EE3A 3AVGA 2FHKA 1XEZA 4TYBA 2OO4A 4XEIA 4DCJB 1T9TA 3NGUA 2ZZMA 1TL1A 5C42B 1XTZA 5IC6B 4Y2KA 4ZVOB 5E84A 1E4FT 4J90A 4JI8K 4DMNA 4KFBA 4CHZA 3CW2C 2XI2A 4CT9A 2CJQA 2QKBA 3CJ7A 3D2FA 2HFUA 4EFAC 3VZHA 1FRXA 3TZXA 4ILLA 4JKBA 4YHHJ 1OH6A 1RT7A 1WI8A 3I33A 1NGIA 2BJ9A 4JS4A 4GVEA 1VFJA 3OFEA 1JX4A 1Y9OA 3NF9A 1VLOA 4DCHA 1U2VB 4B3MF 4USKA 4QR2A 3BS9A 2C2DA 3AB4B 2O4GA 1QQOA 2HHHJ 5B0BA 1YIJS 2D41A 2H65B 5B0AA 2IMOA 2NNWA 4DU7A 3VEVA 2VCPA 2V9KA 2E44A 2Z57B 2QWLA 5CD4A 3EXYA 4DV0K 5D0HA 4CWBA 1VHIA 3J81O 1NMEB 4K25A 3NH2A 4RUAA 5L1KA 2G1DA 1MWYA 4QYZK 2NXEA 4D3HA 3LP1B 3FZ2A 2MXYA 1RDWX 5EDWA 4WYLA 4HKQA 3NGDA 3CPEA 5HVGA 5F8JA 4C97A 1ZS6A 3CDAA 3BEXA 2NR0A 1RE1B 1UEKA 1V5IB 1BQXA 1LKZA 3MD3A 3CPWR 1WOQA 4IOAQ 5FPMA 1OMSA 4WWSA 1U2VA 2ZM6K 2HW3A 1YSJA 2GQ2A 3UVJB 1SQFA 3GQCA 3GG4A 2KB2A 3QMQA 4X62J 4ZITA 1RDDA 2HBQB 2FVSA 2UUBK 5K9FA 4B1WB 2W9AA 1ZPWX 3G2XA 4DSJA 2CNOB 1FRMA 4ECWA 4PHTX 1FDDA 2BGGA 1RKIA 3JYTB 2OI2A 3UKUA 1ITGA 2BXJA 3FJ2A 1L3TA 4I7FB 1T7PA 1JLFB 4H0YB 4GKKJ 3FLCO 1KD1T 4GKJJ 3LP1A 1EKEA 1SVDA 3FDSA 2DITA 3BF4A 3OLAA 4DV6K 1T05A 1NSPA 5A2QY 5E5NA 4DR7J 3VN5A 2NXJA 1JJ2R 2DHXA 1HJRA 2ROGA 4NLBA 3CQXA 2XY6A 4NO7A 2LYVA 3DYAB 2PZSA 1D9FA 4LF1A 1J5OB 4FYWB 1A0OB 4C0OC 3H1QA 5JJBA 4OJ1A 4PQUB 4DCOB 3UVJA 4JI8F 2CQGA 2W2MP 1HNZJ 4FK4A 5AZJA 3AAPA 3AVAA 2P9LA 1YF5L 5LMUJ 1J54A 3BF1A 4LF5J 4NZ0A 3U6FA 1JLCA 1M5OC 4X4TA 3IC1A 4ZVGA 2R8HA 3M8WA 2P9NB 4M5IA 1SKRA 2AU0A 3HBTA 3SK3A 4MIAA 3MEDA 3HKWA 3JYTA 2E2OA 1B0VA 3OYCA 1X5PA 2IRYA 4DL7A 1O13A 3ZSZA 1WSVA 1FJEB 1U1QA 2E9RX 4FWQA 2OTLS 4QW8A 3I4PA 2EFGA 4ZVFA 1KHWA 3GV7B 2H54B 1FK9B 2HHXA 4DU3A 2KZZA 2LVWA 2C2OB 2AEFA 2WVFA 3L2VA 3IR5B 3DYAA 3BR9A 1JLGB 3H3OB 1J5OA 1KFDA 4NYPA 2DRAA 4H5RA 1VIOA 2DPIA 4DR5J 3QEWA 4CZKA 3P4UB 1Q7LB 2A0FB 4PQUA 3D6HB 5ADZA 3HPHA 1PILA 3ZFVA 4NYFA 2GW8A 3VGLA 4ID5B 1NBEB 1GFWB 4A8XA 1NJWA 4DR3J 1AUSL 5M1NA 4DR6J 4DUYF 3GFHA 2XLKA 2P9NA 3GOIA 1RWMB 2ACYA 4C4WA 1U1MA 1X4AA 4B9MA 3OTOJ 3NHGA 3FQKA 2CAJA 1U1KA 2W01A 2ZM6F 5HMWA 2B5JB 2VZ9A 1FTCA 2DNNA 1X4FA 3GWCA 1F9FA 2CZ9A 1LXJA 3HL8A 1G1XA 1FK9A 4HEA9 3BQ0A 1IWGA 5EVZA 4YOVA 1RU1A 2HNZB 2UUBF 1KD1O 2QWOA 3OTEA 4CJ3A 3BN7A 1CLQA 3EZ5A 2FBVA 4HDGA 4I6YA 1UVLA 2D0OA 3MWTA 3LPTA 3L3CA 4BRAA 3FSYA 3A2FA 1FRHA 3WDOA 2CWXA 4ID5A 4JP8A 4NXMK 2RE1A 1QTMA 2E7WA 4ZLPA 1VBYA 4BC7A 2HVIA 4BGAA 2B9YA 3CVKA 5C10A 3LO3A 4MIBA 4KTZA 3BSCA 1C2PA 4FJ5A 4UTGA 5AQOA 2B5JA 3C14B 1N0VC 1NKCA 2NS1B 4QS9A 3GFYA 3CT9A 4NXNJ 3ZT4A 3PYFA 2H51B 3VEOA 1A9NB 1GLAG 2YTCA 3CIMA 2HNZA 1BL3A 3QIPA 4BREA 4LF2A 2RILA 3LQVA 2WZ1A 3M6VA 2HBKA 5AFUH 4LF6K 4H0TB 2HHVA 2LA6A 4MYTA 1KTQA 3G6EN 5GAEI 1NHVA 1YJWS 4DR2K 2E7VA 1EP4B 4FJ8A 1ATNA 4K2JA 3O4NA 3LP3A 1YVFA 1TL7B 3UCZP 3HVWA 5HVFA 3QZ8A 1B0PA 3I5BA 3CNQP 3MR7A 3LDLA 5FD1A 3HKZD 2XZDB 2B4JA 2FD2A 4IH5A 2OZMA 4C8KA 1J6ZA 4NRUA 1QTNB 2LECA 5DGAA 1BQNA 2Y1JA 1GTHA 1RBVA 4FXDA 2B51A 1K8AT 3CIZA 2V50A 3C14A 3TU5A 2XULA 3KLFB 4KRFA 3JS9A 4DQRA 3UDVA 2J0XA 4LFBJ 2KRBA 5DLFA 2L9WA 2MB0B 3G6VA 5CABA 4JI5J 1W26A 1W9HA 3SAHA 4EBCA 3P3DA 1K73O 2OPRB 1T9VA 1NJYA 3QO9B 3UD4P 3WQUA 2BM1A 1I3AA 4X4RA 5KFIA 3NH1A 1RLDA 4B9TA 2HOEA 4CFDA 2O01C 4ILMA 5KG5A 1EP4A 1X1PA 5K8MA 3E2EA 2BBEA 2DGVA 3R9LA 3UCGA 1EQYA 2ZJQL 3MFHA 4JOUA 2B56A 1AT1B 3AVJA 4I68A 3WHIA 3F73A 3AXKA 2HF4A 4QWDA 1RCXB 4WQ5C 3CSKA 1BY9A 4ZK7M 4BDYA 1YTUA 1QHAA 1J5EK 3CB4A 4OHYA 3Q2SC 1YBTA 3AO1A 5GAGU 2NQPA 4AHUA 3EUNA 5BN8A 5A8KB 4UW2A 3TANA 2OELA 5F41A 4FXVA 3BSAA 3O08A 4CJ5A 2LXIA 5KGWA 5I42B 3CCEN 1R6VA 2OPRA 4CW7B 1BI4A 4WFNQ 1AXQA 3H46O 1A5XA 3QO9A 3KK7A 2PEBA 4R5PB 3KLEB 2D9OA 3FVYA 2O3DA 3CCJN 4BR4A 5DG9A 4PEOA 3WNFA 5KFPA 3THWA 1X0FA 3AQPA 1UVKA 1KQSM 2VBXA 4USIA 1Q81T 2CPXA 2FQQB 2VQFF 3QEIA 2RPIA 2VWJA 3A5LC 3NE6A 1YT3A 4U8YA 1NSKL 2WVDA 5CA5A 1WC0A 3AA2A 4B02A 1NCLA 5BR8K 3U7JA 2RF2B 5MLCQ 3SSQA 4PABA 2NYHA 3ILJA 5A8KA 1J2VA 4BCAA 4DR2F 4RJVA 4B08A 3I5CA 4YR3A 2B9WA 2Z0GA 2Q36A 4AHRA 3CCUN 2FJEB 2DT9A 1FERA 2KJWA 3BYRA 4EP5A 1HPZA 1K8AO 3LGNA 4LR8A 4KR0B 1E3MA 3CXCR 4DI6A 4E7IA 2HWTA 1RT3B 4R5PA 5A2QO 1VJQA 2HWHA 3MPWA 5JVGQ 1V4TA 2HBZB 3CC4N 3J80Y 2PA8D 4KB1A 1JNZB 1ZZFA 5K8NA 5I3PA 3FRZA 2V52B 2NRZA 4EI2A 3PKYA 1GLJO 4YEAA 3VQPA 4CGJA 3PEJA 5AQMA 3ISND 4OGCA 3JXOA 5J2QB 3K8VA 4I6WA 1BWVA 3RB3A 3R9PA 3K5NA 4DV5J 2ZWHA 5D4LA 5ITHA 1U25A 3QRQA 3H2LA 2RF2A 2PA3A 4ID8A 2HSTA 4DR6K 1T6CA 1S76D 2KG0A 1CEZA 2FGOA 1HYSB 4NYNA 2DH8A 3IBFB 3H59A 3F9KA 2HPUA 4V19X 1N36K 1D8YA 2CNKB 4FCYA 1VQ8S 1RT3A 4CNZA 2CFXA 3CERA 4DUZJ 4AL6A 2VDHA 3P39A 2ZEJA 1LOUA 4XPEA 5KG6A 1IQZA 3CCLS 1IKYA 1J5EF 1H72C 1X3NA 3CF5Q 1ELOA 2YPYA 1L3KA 3AHPA 4TQSA 5HROB 3AVIA 9RUBA 4RUHA 2IVYA 3SBGA 3UW1A 3W2WB 5AQWA 4ZPCA 2BA9A 2A6MA 2CPZA 3O44A 4KE5A 4KIAA 3OL7A 1Y5NB 2UVRA 1RBOB 1Q81O 3N28A 2JC1A 3R7NB 1HNXJ 2YKQA 5I3UB 4RUCA 5JXSA 4FZVA 4WP9A 2OSQA 1F0XA 5A8WB 1FXLA 1VC0A 2W9CB 4C7QA 5SZTA 3VR1A 1FWLA 3T9ZA 2OEKA 2KH9A 3ZT1A 1YUWA 5EXWA 1ASVA 4HTUA 1Q5YA 3AJDA 2MYFA 3A8IA 5AJ3K 4TNOA 4A48A 3N6MA 3CDUA 3MUVP 4FK2A 3F0NA 4ZDNA 2J7UA 3NGIA 5BR8F 4CECA 4ZN3A 5HROA 3MCPA 4KH1B 2R2SA 4KH6A 5JLHA 2RIJA 4B3SJ 2C3OA 1GK8A 4PKIA 3PSIA 4DSLA 4CIOA 1X4CA 3OFGA 3DLKA 1F9EB 5LSRA 3W2VB 4A59A 3AOAA 4JI4J 1PSDA 1MG7A 3BBFA 2NZCA 5I3UA 1YTAA 4Y0WA 3JSMB 3PG9A 2Y3YA 3ZNJ1 3U1LA 5A8WA 5IQQA 3T1HK 1WF0A 2W9CA 1EKRA 1YJUA 3SSRA 5GAHU 1XBWA 1CQNA 3A3NB 5FPDA 4Y2MA 1YHQS 1RDBA 3V2UC 4DSEA 1XNRK 2DNZA 4A47A 5BYQA 4OZ3A 4JKGB 1CJUB 2YX7A 3B6OA 5IM0B 1H2UX 3VF2A 2E6LA 4IG3B 2P9PB 1U1RA 1NOZA 4DV1J 4DQ8A 4BLGA 4R79A 5C12A 1T3OA 4LQ9A 2OP5A 3GMGA 3EE9A 3KKRA 3PYGA 3ZTOA 3T1AA 3HOTA 1N36F 2GV9A 1VLYA 3W2VA 4H0OA 4TY9A 2A6AA 2GJIA 1UVJA 1W0HA 1PYSB 3OR1B 3R5DA 1JB0C 3IGVA 4ED0A 1UVIA 3BZCA 2FUG9 4DUTA 3PY8A 3EZOA 3JSMA 2XGPA 4KHQA 2XGQA 3T1YJ 4EHUA 2GUIA 3G4SS 1CJVA 4AYBD 2EG1A 1S9FA 3L4QA 2KM8C 1UVMA 3G82B 3GYGA 2AZ1A 4BRKA 4A4JA 3H5SA 1V4SA 1O8BA 1EO1A 3KWMA 3DJCA 2NPIA 3WQTA 4AH9A 3N4WA 1I5OB 2Z58B 2BUNA 2RNEA 4JKGA 1CJUA 3NGRA 5IM0A 1O51A 5ETKA 3OL8A 4PYAA 4IG3A 2O67A 2YBVA 4FNIA 4DLGA 2CJKA 1CVJA 2FXUA 4DPXA 1QZ6A 2ZKUA 1MW7A 3NBPA 4CBXA 4GV9A 3GYXB 4JKHA 3MFIA 4Q8EA 1D4XA 3QGGA 2Q66A 5A6PA 1S1WB 1VRUA 4JK9A 4NLCA 5GAGI 3ZYYX 5FPEA 1C0GA 2CYYA 4K59A 3SLCA 2A5XA 4I9QA 1X31C 1NGGA 5AJ3F 5F0WA 3QRRA 5LSOA 1B64A 4PZVA 5M1KA 1NWKA 3SDEB 1XMQK 4DZ6A 2XS2A 5EU7A 3QLHA 4A8WA 4TY8B 3Q24A 4ILHA 4CEFA 3W66A 2XM3A 1IJJA 3TAEA 5AQUA 1TMJA 3MX5A 1R43A 4YDUA 4CLZA 3CG7A 5E7OB 2DK2A 4WCEQ 4I2PB 3DFEA 3M9OB 4DZDA 3S7RA 3SQGB 4KRWA 1LQ9A 2VB6A 3H5YA 3L4IA 3D9BA 3ZX2A 2VGNA 3FSXA 1YWXA 5AE1A 3RR8A 3IUCA 2LXFA 1GOCA 1GXTA 4X65K 5BPLA 4C8YA 4OI6A 3T1HF 1T9XA 3HSCA 1S1WA 1YG0A 2MKJA 4OO1J 1VSKA 3NGKA 3EKSA 5L8RC 3DRSA 1T95A 2Z8QA 3LGMA 4FVUA 3AOBA 1XNRF 1Q8BA 4LFAK 1T6DA 3SDEA 2J6UA 3TVZA 4Z4FA 5ETNA 4LQ3A 5D8HB 2J8AA 3QT6A 2E5LK 2HAIA 4RBTA 2ILYA 2U2FA 4JYAJ 4DL2A 4LBHA 2QXLA 4NEYA 2Z4PA 4FLXA 4I2PA 5DDOC 4WFBL 2DCLA 3SQGA 2W1BA 2XI3A 2RQMA 3MR5A 2P9KB 2WRMA 4ED3A 3NF7A 3GE9A 1UJ4A 3D3BJ 1UP1A 2UXDJ 4EIAA 2DNPA 3AARA 4B8AB 1LV5A 3W61A 2Q6CA 4OYAA 3J80O 3VMFB 1UAXA 4M7XA 1RTZA 1Q53A 2UUCJ 1REVB 2CQ2A 3DOMA 1OQ3A 4GY2B 2HS3A 5EN1A 3UIQA 3VGTA 2DFHA 1TL4A 3L3UA 2IA0A 1DRZA 1BISA 3BM7A 2QZ8A 3SIPB 1WWHA 3FC9A 1WSGA 3AA3A 2KVIA 3UNGC 3JTPA 3MCNA 2OCEA 4CO5A 4KGKA 3ZSVA 3QSIA 5F8LA 2CH5A 5LJVA 1BCOA 4C48A 4CZGA 3TA0A 3HHNB 1ZBIA 2QLXA 2IJFA 3QIOA 1AA1B 1RDUA 2P9KA 3D66A 4WTOB 4DPUA 1U24A 3VTIA 4A8OA 1Z25A 2GHWA 3M9MB 5DM7L 1UPMB 2BJ1A 4NEZA 2G0CA 5F1XA 1VGYA 1IKWB 2QTDA 4CLKA 1ZZNA 2ZWOA 1HL6A 2R7TA 4IZ9A 4DSKA 1REVA 3MXJA 4BACA 4CJPA 3VEWA 4DTNA 2CNNB 3A4TA 3ZSOA 3MX2A 4IO9Q 1RWOB 3Q83A 1FDNA 2J4RA 2PGCA 1VSDA 2YNFB 1GLLO 3V81B 3WEEA 4P2SA 1F60B 4IEEA 2OTLN 1HBMB 3H7HB 3SCXA 2EC0A 5K20B 4X65F 3TTCA 1S6UA 1IR1A 1X9SA 4CEEA 2D9PA 3HFZB 3FEXB 5ADXA 2QSFA 3WQPA 2ZH5A 3AVNA 2DNKA 4BRQA 3CWJA 3KNAA 3PIOL 2GNKA 1KCFA 1FJ7A 2HRYA 4WE1A 1RBLA 4E7KA 3SUOA 3MEEB 4LFAF 1IKWA 4Z0UA 1D5AA 3I31A 4DTMA 5IT0A 3P4IA 5SWMA 1FRLA 4O0JA 4OJRA 2E5LF 3H08A 1OIAA 4E7LA 3TX0A 2R8JA 4ISEA 3CO9A 2WB4A 4YB5A 2W4CA 4HTIA 2HLUA 2YNFA 4PYDA 1OVQA 3VQBA 3V81A 1SBRA 5GAHI 2HGMA 3HFKA 5U47A 3AT1B 3K89A 4BC4A 1XN9A 1Y10A 3ETMA 2RE2A 3AA5X 5D15A 2FJAB 2RT3A 1NGAA 3QFWA 4N56A 1ZXOA 5ETPA 3NNAA 3DDKA 4C0BA 2XS7A 1GX6A 3CFOA 5CH7B 1ZM4A 5C15A 1WN7A 3MMBB 5GIOA 3CEDA 3R2DJ 2DHGA 1VAZA 1QSLA 2QV6A 3OA9A 2JJ4D 3HF5A 2MY7A 1Q5VA 2QWNA 3MEEA 3UDCA 5KFEA 1XC9A 3KYLA 2Y8WA 4W5NA 2EWSA 3M32B 2DCUB 4ECYA 4RWTA 4MFBB 1KHVA 1HWKA 4J2DA 1UEVA 1SB6A 3BP8A 2UXBK 3GFZA 5M1FA 4I69A 2QEXN 4O0IA 4Y00A 4URGA 2J9EA 2AJ1A 2BV3A 3BPDA 3IRXB 5HMZA 4FK0A 4F25A 3OVAA 4DKWA 3BREA 4CI0B 3TZYA 1RWNB 4G1QB 1BD6A 3BO3A 1WC5A 5F8IA 4PQAA 5EWFA 3FMBA 4FWSA 3CMQA 1Q9YA 1S99A 2R2UA 4ZVEA 4OI2A 2UXCJ 1X3MA 3GILA 3UFCX 2PO4A 4K5SA 3VGSA 1UAWA 4JB8B 1WSRA 2EC2A 2YHXA 4S0MA 2D0CA 1MWQA 2PSZA 2XMJA 3BDEA 1RCOB 4MFBA 4HHJA 1WOPA 3VVUA 2E2QA 1Z1ZA 4U9RA 3OL9A 3I8BA 2R7WA 2FYXA 4UQTA 2HZVA 1XIQA 1P8ZA 4RW6A 4WZQA 4KH5A 3ZXWA 2M88A 1RP5A 5KFQA 3TJAA 3W9IA 2WUSA 1YZ7A 2NPFA 4O5BA 4CJRA 4U95A 2KT5A 2JLEA 4YFUA 4G1QA 1MU2B 2YWGA 3CCQS 2V51B 1K47A 3IAYA 4ANDA 5IV4A 1B7YB 3NL0A 1H7WA 4NWBA 3D5MA 3L7OA 2FSNA 4RNFA 3E9LA 1HA1A 1CJKB 4M63A 5KFKA 4BRDA 2DJWA 1OS5A 1PIEA 3D45A 1G7CB 3ZSWA 3PLAA 2J6TA 1ZBUA 2F8TA 1S10A 2UUAK 4GRSA 4B8CA 4MLEA 1BWEA 2O8CB 2H5JB 4N77A 4CRJA 2CDRB 1FKOB 1NPPA 1K9MT 5T7BA 2D3O1 1YZ6A 1WC6A 5E0OA 3SUQA 4W5QA 4CJKA 1Z4UA 3PEHA 3IR7B 1VQLN 2E1PA 4CLUA 1VSIA 1GNKA 3D2EB 3SZ2A 4WFBQ 1MU2A 3N4QA 3MTKA 1DQ8A 1F9HA 4FPRA 4B3TK 1UPPA 4JI3K 2AHOB 4ECVA 2UXBF 3KMQA 4DFPA 2MSTA 1Z2ZA 4MK8A 3CCMN 2OA8A 1CJKA 1IXKA 2QJ3A 3G96A 3MI7X 5KQDA 4B17A 2AWZA 4HWIA 4CNYA 3HHDA 3QWPA 2YVSA 4ZVRB 3IWNC 1JMTA 1A5VA 2XYPB 1V9OA 4USVA 1HHQA 1HNWJ 2O8CA 1RJJA 5JMVA 1N8RO 2VD3A 4USHA 4H0XB 2XHBA 1Q1KA 1T02A 4EFHA 2B4OA 2HQ3A 1WI6A 4J9RA 4NOHA 4ID1A 2RDIA 1G6BA 1IUJA 4ZTJA 4YDUC 3MAAA 3R5AA 4CERA 3M2UA 3I55S 3ZTPA 3GFXA 3S3NA 3D2EA 4QW9A 1H2VZ 2HNYB 3DRRB 8RUCA 3CJKA 4I6AA 5KT3A 2YKAA 5KFBA 5HAOA 5AQKA 4LFCF 5IT4A 2IRUA 5KFWA 4F36A 1EB0A 1FF2A 1KTVA 4YDXA 3NH0A 1IBCB 5AQTA 1NU4A 4WFZA 2R7RA 4WU3A 4NCAA 1DEJA 3NCQA 3CCWA 1YKWA 4CESA 2G2OA 2JL9A 2EVZA 1GMVA 4BS2A 5J2PB 1GMUA 4DF4A 1QVFM 2Z56B 3VPZA 4YQWA 3K58A 5B8HA 4OI3A 3QRPA 1UA0A 2GVDB 3CMAS 4KV8A 2IIHA 3SAFA 4NLGA 3VAFA 1KLMA 3H4DA 3EGWB 4CLYA 1K9MO 1AB8A 3KXDA 3W1YC 4KKOB 1RBUA 5EX5A 1OSCA 3CFPA 2HNYA 6FDRA 4AHVA 3RAQA 2UUAF 1VQ8N 2AT1B 1C1AA 4R0JA 3FNNA 1U2RA 4CJ7A 1VOMA 1WHYA 2GMHA 4Q45A 3J7AN 2UVWA 3CCLN 2YHYA 3V6DB 1IBMJ 3MR3A 3UE5A 4BVPA 2IM2A 3QSYB 1NGBA 4KGMA 5BYSA 3G71S 5AQZA 1FW6A 4ALZA 3GB0A 4A5BA 1GXLA 4URQU 2HIQA 3DLLQ 4JV2A 3V9UA 3ZSXA 1JQGA 4QR1A 3AOCA 2VV5A 1N48A 4IQMA 2YNHA 3QGIA 2EFPA 3L09A 2C22A 3VAJA 1QJHA 3MUTP 2ZDOA 2YH0A 3SV3A 3WNGA 1NLVA 3R8YA 2XY5A 4ICLB 4B3TF 2V68A 4M3YA 4PKHA 4JI3F 4OYIA 3NLCA 2JX2A 2QO3A 1VQ7S 1T8EA 2GVDA 3SI8A 5K5MA 3SMSA 3H8YA 1SL2A 4NL5A 3MCMA 4PG7A 3UCUP 3SPZA 2W7PA 1NSAA 3PNIA 3UB5A 3N5BA 1KP6A 4ED4A 3NVKA 4JI1J 4I6MB 1C6VA 1SAZA 2GIQA 1G99A 3BKUA 1QQMA 1NJZA 3R97A 3J8AA 3T19A 1I94K 2A1SA 4HYKA 3FUYA 1AZSB 5CE3A 4BWMA 2B0GA 3WBZA 5H1SV 3Q23A 2EBEA 2OYQA 5KRTA 3MDQA 4EAHD 2FY1A 4HCBA 1Y5IB 5HLFA 2ZC3A 4UY8T 3HVRA 2UXCK 2IDLA 4CK1A 1WOSA 1NEEA 2HHHF 1J53A 5E3RA 1CULB 4NA3A 4YMEA 5F8HA 4E1MA 1HUXA 3GIJA 3EDQB 3RBDA 2P9GA 2XYGB 1F3VA 4DHYA 1L3VA 1HFEL 4HH1A 4JK8A 1KVKA 1S1XB 3AD9C 3DWLA 2Y1IA 2J0WA 2EKYA 1DKGD 5FRMA 4JHDB 4Z4GA 2L08A 4I6MA 1YHQN 4J9UE 3ZZOA 3FCVA 4TKTA 3O1LA 1HNIB 2HMPA 1T03A 1TUVA 2AQ4A 3C94A 4NMXA 5CZ2A 3TAPA 4BQZA 3NCIA 3H3NO 1YJNS 4HUFA 3NG8A 1WG4A 3GSDA 3CCRS 4CEOA 2XNRA 3MHYA 3IKMA 2GQQA 3UD3P 2GVZB 3MXHP 4JK7A 2Q0RA 2RUSA 2OH2A 2HRUA 1CULA 2XLJA 4FJLA 1VQ9S 1MROB 1NDCA 1RHUB 2HHWA 4UUXA 3RG6A 1C0UB 4YOUA 1S1XA 3G4SN 1VYAA 3HZEA 4DL4A 4OX9K 3D6TB 1RT1B 1S6PB 3GIKA 3NWRA 5HBMB 1WKJA 1X9WA 3G25A 4JHDA 2ZITA 4DU1A 1S1TB 4GKKF 1FEEA 2IVOA 1RQ0A 4GKJF 2PI5A 3DHWC 3SCJE 4K0KK 4XAKA 1RKJA 2V2KA 3HYFA 1HNIA 1GOBA 4XK8C 3Q22A 2E66A 2QL7B 2P6SA 3CI5A 1Y00A 4JD2B 5RUBA 4DR7F 3HSTB 1Z2LA 2Q1LA 1U6FA 3VWSA 4O3RA 1Q86T 4LH5A 2YWKA 4H54A 2KJVA 3CJ2A 5HVHA 2VFSA 3NAIA 3I5AA 4V19S 3HT3A 3OR2A 1NJIT 3PDNA 4CM2A 4DL3A 2GVZA 4DV7K 5HRRA 4F0KA 2CQBA 2J9DE 1S5ZA 4FO0A 3RR7A 4CF1A 5LMUF 1JLBB 3VAIA 2UYTA 1KXPA 5ELZA 3EM1A 2D3UA 1WTBA 1I94F 3KMSA 4UY8O 1VQOS 3ATVA 5IOLA 3OW2R 1TKZB 3MXMA 1C0UA 1F5AA 5M2UA 3BY5A 4ED2A 3W9JA 2R7QA 1YJTA 4K43A 1RT1A 1S6PA 2YY3A 5HBMA 3VCDA 1S1TA 3DLBA 4FZXC 3BGUA 4MAKA 2M5YA 3M8ZA 1N34K 4CIFA 4JD2A 2BE2A 3KFWX 1AUDA 5GMKa 4AXJA 4F3TA 2YWWA 1RTIB 1JLEB 2RH3A 2D0PA 4WXOA 1ZAVA 1MWKA 3KVGA 2Q1NA 2P5VA 3QB0A 3ILOA 5F9NA 4DR5F 2I5JB 4CTAB 1U48A 4LRAA 4YOYA 4Q44A 4DQSA 4LF9K 1LK7A 1TKTB 3DRXA 1APSA 3CJTA 2GELA 5HO4A 1JLBA 2WVBA 1T0TV 2OEMA 4DV2J 4RW4B 2HS4A 4DR3F 2PI4A 2ZFHA 2KT2A 2YV0X 3W9HA 1OJ4A 2OANA 3PJWA 5K14B 3ZZPA 4J91A 3D6FB 2KHCA 3B6BA 4CLTA 2GUPA 3DLRA 5LY3A 2HLTA 3IM8A 3V5RA 1XHXA 2H9ZA 2P9SB 1D3WA 1YLXA 3C3LA 4M63C 5BPMA 4J2BA 2PAVA 3OSNA 2JEIA 1BWFO 1JCEA 3ILIA 4RNMA 1NKEA 3ENQA 4CP5A 3V1RA 4B1UB 4M3UA 3EDRB 1RAFB 3HHLD 3AO5A 1JLEA 1YI2S 2FVCA 4DTPA 4LMZA 2YKMA 2E6MA 1HD0A 4CJEA 1ULRA 2DXDA 4QOTA 3J7A1 2JH3A 1QQNA 4CTAA 4ECUA 4XO0A 4CJUA 3QGPA 1OH8A 4OX9F 1RFQA 2ASLA 1Q86O 4ED5A 1QE1B 2VKZG 1TKTA 2IDOA 2WW4A 4ER8A 4K0KF 2VFUA 2IGIA 3PW4A 1NJIO 3TSUA 4RW4A 2A2CA 3M4XA 4CM0A 3PW0A 3DDIA 3KZBA 2IS3A 1WHWA 5I4MA 4P74A 3OHRA 5K14A 2CRLA 1HIYA 4R8UB 1MMNA 5BRFA 5B0FA 3GJQB 4P7VA 5C2DA 3DAWA 4HI1A 4DV7F 4DFMA 2W24A 4CLFA 4JKDA 4AE5A 1JLAB 2BJDA 2IHR1 5LSLA 5L1IA 4WZMA 5IXUA 2FBTA 4BWJA 3RZAA 1CJTB 2JEGA