3LALA

Crystal structure of hiv-1 reverse transcriptase in complex with n1-ethyl pyrimidinedione non-nucleoside inhibitor
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
553
structure length
553
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title N1-Alkyl pyrimidinediones as non-nucleoside inhibitors of HIV-1 reverse transcriptase.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase
molecule keywords HIV Reverse transcriptase
total genus 157
structure length 553
sequence length 553
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3lalA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3lalA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3lalA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3lalA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3lalA05
1XC9A 2HHUA 1ZBFA 1CXUA 1HNIA 1JXBA 5I42B 4FJ8A 1Q9YA 1CZ9A 1J54A 1NK4A 5K14A 4I9LA 2F96A 4CHQA 1JKHB 4EZ9A 3M8PA 3G6YA 3DLBA 4OPJA 5DGAA 2B43A 5KRTA 3SUNA 3QO9B 4E0DA 2BRLA 4QWAA 4EZ6A 2RDIA 5DQHA 2W9CB 4W5TA 4ZHRA 3SFGA 1W25A 2P5OA 3OL9A 3HPGA 1S4FA 2WHOA 4IRCA 4KFBB 5KFLA 3RMAA 3OYAA 4TY8B 3NKYA 4NRTA 3NGZA 2JGUA 3V6KA 1LAWA 1VSKA 2Z1HA 4J9OA 4Z0UA 4RW6A 3Q8PB 4LQ3A 2ZQBA 4DS5A 2RF2A 3NGYA 5KG2A 2VWKA 4ED7A 5CY4A 3QINA 1C0MA 2FVCA 4DLGA 1REVA 1NNDA 2YKNB 4Q44A 3DMJB 4JS4A 3SI6A 4IBNA 4DTOA 4F4YA 4O5BA 2VWJA 1IM4A 4OKEA 1QQCA 4NLVA 5F8IA 3V9XA 2ATQA 5FROA 3D28A 4GMJB 1FKPB 3KLFA 3DRPB 4FLWA 4ELTA 4FLTA 2OA8A 4RG8A 4IFYA 1RDRA 3OHAA 4F4ZA 4NLSA 3KTQA 3HKWA 3LP2A 3KJVB 4ECYA 5HRSA 1KRPA 1RTJA 4CJFA 2NUBA 5I3UB 1RBUA 4AHVA 3MXMA 3DLHA 3LP3A 3SUOA 3O3GA 3TAGA 3V81A 3MEEB 4RW8A 4YR0A 2QV6A 3E01A 4CGFA 3KHHA 4DLEA 1BQNB 1Y97A 3BDPA 2X6SA 3ZCMA 1RT1B 2KW4A 4BE2A 4GW6A 2BQ3A 1N6QB 3AVIA 5KFJA 2A1RA 4R8UA 4DSLA 2E9ZA 4IH5A 1RDCA 3RB4A 4BDYA 2R2RA 4R5PB 2QXFA 3MFIA 2XY5A 4MK9A 1IO2A 3QNNA 3CFOA 4IG0B 5DGBA 1Q9XA 5KG6A 1DLOA 4JLHA 4DQPA 1S1UB 4KI4A 4MIBA 3DLKB 3ULDA 1LWEB 1KLMB 3QIOA 2D41A 3QIDA 3HVWA 5KFPA 4O3RA 1KLMA 4LH5A 4FJXA 3OJUA 2BDPA 3HVTA 3HHKA 1B9DA 4KO0A 3M8SA 5DQIA 4O44B 1RT3B 2VA2A 4Z4HA 4ZTFA 3HO1A 2FC0A 4FJHA 1KFSA 1ZTTA 3K5OA 1HMVB 3AVAA 4M3UA 1S1VA 3MTKA 4CEEA 1YVFA 4MKBA 5DG7A 3EPIA 4WXOA 4NLXA 2HAIA 5F9LA 2ZE2A 4M3YA 1UA1A 4C8KA 3JSMA 2YNHB 2HNZA 4KB1A 2R8JA 2QE5A 4OPKA 4ZHRB 3AA5X 4IFVA 4H4OB 1FK9B 3EZUA 3NGIA 2WONB 4YP3A 4J2AA 4CESA 1XR7A 4L8RB 3KLGB 4K50A 4QWCA 5K14B 3DLGA 4TY9A 4RNHA 1REVB 1TV6A 1T7PA 3SJJA 3GIJA 3MECA 4F4XA 1KTQA 5KFMA 1IKWB 1IKXB 4CIFA 1S6QB 1BCOA 4HKQA 4KE5A 4FJJA 3NMAA 4CEFA 2OPPB 4LSNA 4DL2A 1ASUA 4IKFA 4KFBA 2R8HA 4DTSA 2HVHA 4IDKA 4FLYA 4X2BA 4E7HA 2XY8A 3Q8RB 4N56A 1JKHA 2RPIA 4FBTA 3RB0A 2G8IA 3QIPA 3UR0A 1U47A 2X78A 5L1LA 3P5JA 4CJEA 1D8YA 3VQ9A 3KKSA 3OHBA 1WAFA 4HCBA 2EX3A 4M3RA 3HP9A 1U48A 3V81B 2Q3SA 5FRNA 2FJVA 4DSJA 2W7OA 4DF8A 2IC3A 3NAIA 2O4IA 1QE1B 3CVKA 2F8TA 1JL2A 1ZBIA 2AX0A 4TYBA 4OLBA 2ASDA 2FVSA 4KHYA 4ZPAA 1YTAA 3MR2A 4CHOA 2YKNA 1HQUA 3T3FA 3DDKA 3RR8A 2XGPA 4H4OA 4CJ5A 3VQAA 2ZD1B 4AHCA 5L1JA 3OYIA 4I9QA 4IKAA 4CEQA 4CEZA 1RT2B 1R0AB 2XGQA 5F8LA 2QK9A 1S0MA 2XY6A 2G8UA 4M3TA 1TKZB 1S1TA 4DQQA 3KMSA 1NJYA 2FLLA 3QLHA 4CJQA 4IH6A 1C1BB 5KFHA 4ZP6A 3ITHA 5J2PB 2W7PA 3H98A 4FM1A 4C8OA 3KJVA 3MR5A 1J9AA 3PR4A 1S6QA 1WSJA 4WFYA 4DQRA 2B5JB 3H5XA 4ED3A 3SCXA 1D9DA 2C22A 1J53A 3CFRA 2IMWP 3C6UB 2Z1GA 4FS1A 4N5SA 4FJ9A 3RTVA 1KLNA 1J5OA 3V6JA 3KLHA 4OLAA 1RTIA 3UDLA 3KLGA 1J5OB 3DRSB 4Y1CA 2XI2A 3NDKA 3T5LA 3I0SA 3S3NA 1TVRB 1VSJA 2R8GA 1S9GA 1NOZA 1RT1A 3NFAA 5KFNA 4HUFA 4HVJA 2UUTA 4H8KA 4DSIA 4H54A 4LSLB 2AX1A 1GOCA 4DU3A 1JLCA 2Z1IA 4FJ7A 3M9NB 2F8EX 4NYZA 3EZ5A 4NLWA 5T7BA 3H2LA 3RAQA 5KFTA 2JLEA 3V6DA 4ICLA 3OL6A 3PR5B 1T05A 3ZT4A 2RDJA 3SQ1A 2G8WA 1MU2A 4J9MA 4DL4A 3OYGA 4NLQA 5KT4A 4CF8A 2W42A 1VSFA 4FJ5A 1KVAA 5EWEA 2FJXA 4CF2A 1JLAB 3SNNA 2DFEA 2HHTA 2D0BA 2V4RA 4DFKA 4CJ3A 3N6LA 1HMVA 2OPPA 3FSIA 4WYWA 3AVHA 1EP4B 2R7YA 5J2QB 1D0EA 1WSIA 1HYSB 1RTHA 1WSGA 2PYLA 4K4VA 2XY7A 4NRUA 1SL0A 3MXJA 1RTIB 3CJ4A 4HCCA 4OGEA 2E6MA 1TK8A 2R8IA 1GOAA 4TLRA 2AGQA 4XO0A 3K2PA 2DPJA 3LANA 5DG9A 1TL3A 2KFNA 4XPCA 5KI6A 1ZETA 4CK2A 2WK4A 3M8QA 4CFCA 1CXQA 2HB5A 3TAMB 1JXEA 1S48A 1QE1A 3ISND 2YV0X 3VQ7A 1S6PA 1K1QA 4CK1A 5CYMB 5D3GB 1NHUA 4MK8A 5KFSA 5L1KA 3NAEA 3AA4A 2XC9A 4CGGA 3QLHB 4TSXA 3CJ2A 5HBMA 4DTXA 4B9SA 1TKTB 1QS4A 3QERA 4QWEA 2OPRB 1WSEA 1RDDA 4WYLA 1N48A 4XIUA 3OYMA 2OPRA 1HNVA 2FBVA 4O3PA 1NK0A 4Z4FA 2EC0A 2O4GA 3PVXA 4KHMA 4J9PA 4OJRA 3KK2A 1IKVB 4FJIA 5KG1A 4Z4IA 2QKKA 1TL1B 4I2PB 1U04A 3O4NA 3V9ZA 4CJSA 1U49A 1KFDA 3KLIA 2WTFA 3G10A 3ZSVA 2XHBA 2FLNA 1RT7A 1NK7A 3C94A 4OKKA 3OYDA 3ZT1A 4DF4A 1S97A 4IRKA 1L5UA 2JC0A 3NF9A 4CFBA 4E7LA 4NLPA 3QESA 4FM0A 5KFUA 3K57A 4R5PA 3PHEA 2D0CA 2HMIA 5KG5A 2OPSB 3QEVA 4FK2A 1S1UA 3G0ZA 1EXQA 3IG1A 3KLHB 3K5NA 3AO1A 3PO4A 3IAYA 1KHWA 1I6JA 5HROB 4ZVFA 4YMEA 1X9MA 1SUQB 3OS0A 3MEGA 2R2SA 3PW4A 1DTTB 4MIAA 4CEDA 4CGJA 2HNYA 2YNGB 2X74A 1ZYQA 2OPQA 3KK1B 4CJ4A 5KFDA 1TKXA 3NE6A 4CECA 4WZMA 3KKRA 3V4IB 3P1GA 5C25A 2D3ZA 3L3VA 4CJWA 2IOCA 2FBTA 3DOKA 3I0RA 1QHTA 4Y2CA 4KO0B 4QW8A 2JEFA 3V9UA 4F50A 3FDSA 3Q8QB 1HJRA 3VA3A 3M8PB 1C1BA 1SH2A 1I39A 1JLBB 4OKJA 1JLAA 1S1TB 4KSEB 1ZBLA 5EDWA 1VSIA 4U6PA 4ZP7A 4KHUA 5J2NB 4IG3A 5JUMA 2I5JB 3I5BA 2BR0A 1GX5A 5KFKA 2EHGA 3RBDA 4LSNB 2HWIA 5KT3A 3BQ1A 3CG7A 4LD0A 3GQCA 4PA1A 3RB3A 1SV5B 1TL1A 5C42B 3OJSA 2UVUA 2HHWA 1RA7A 3KLIB 5KFEA 3ASMA 1GOBA 3CWJA 3JSMB 2IM3A 3EPGA 1NKBA 1JLGA 4O3QA 3PY8A 4TQRA 4Y3CA 3SYZA 2X6NA 4MFBB 2W8KA 1Q8IA 2ALZA 1VRTA 1YT3A 1JXLA 1S1WA 4FBUA 4CJRA 3RR7A 1BL3A 1C1CA 2WOMA 2KTQA 5JS2A 1JX4A 2ZD1A 3CJ5A 4CJVA 3QNOA 4NLUA 3O3FA 1QSLA 2YNFA 4RNNA 4FZYA 3TAFA 1K1SA 3AVLA 4W5QA 4EBCA 5FDLB 3GIIA 1RBRA 4PWDA 3PW7A 3KK1A 2HWHA 2VA3A 3OYBA 1HNVB 3L2UA 3NAHA 1D5AA 1NK9A 4FLUA 2KZZA 3SV3A 4JV0A 2V4QA 4ID5B 3CO9A 2OPSA 1FKPA 3KLFB 2PY5A 4J9RA 2IS3A 3PJWA 5HROA 1B9FA 5I42A 4EYIB 4NLYA 3QEPA 2AU0A 2HHXA 4BDZA 4LQ9A 1BQNA 3Q8SB 3BQ0A 2HHSA 3DRSA 3GIKA 4O4RA 2RF2B 2ASLA 4NZ0A 4E7JA 4ECVA 1TAQA 1JIHA 3AVKA 4K4UA 4F4KA 3LZJA 3B6OA 3QEXA 4CHPA 5C24B 3G6VA 3HVRA 3IN5A 3ALYA 4RU9A 4O0JA 3ICLA 3AV9A 3WNFA 1C0TB 3MEGB 5FRMA 2C2EA 4FJMA 4RUAA 3MFHA 1S0NA 2J6SA 4BWJA 3SV4A 1U45A 3KHLA 1VSHA 3FRZA 4CERA 4KTQA 1LWFB 1IKWA 4ZPCA 4DWIA 4JUZA 1UWBB 3GIMA 4M94A 4FM2A 3BJYA 3LP1B 3I0RB 5KFZA 1TKXB 3BR9A 1T94A 3SPYA 5F8GA 1VSEA 3OYHA 3I5CA 1XHZA 5KT2A 4CCHA 2C28A 3MEDB 3VQEA 2BQRA 2GV9A 3DRRA 1TK5A 4QPXA 4FS2A 3T1AA 4NLDA 2VG7A 2IC3B 4CEBA 4DG1A 3EYZA 4O3SA 4DTNA 2ITGA 4JV1A 3SQ4A 1BGXT 4F3OA 1RT7B 4O3OA 4FLXA 2AGOA 2AWZA 4Y2AA 5E41A 1U4BA 1KVBA 1QAJA 1N5YB 4FCYA 3TI0A 3LALA 4CF1A 3C6UA 3VQDA 3PJXA 1SH3A 4CIEA 2VG6A 3NBPB 1TL3B 3CDEA 3QGHA 3PX0A 3E01B 4TY8A 4GVMA 3NCIA 3K59A 5KT5A 2P51A 4B3OA 5DG8A 5FDLA 4EYHB 5HP1B 3OYEA 3HT3A 4B08A 2Z1JA 4TYAA 4ECWA 3BGRB 4ZTJA 3QGIA 1OS5A 4ZPDA 3H08A 3PV8A 4ZMMA 4Q43A 4NLOA 4QW9A 4BWMA 4E1NA 3KLVA 1G15A 3WNHA 4DTPA 4E3SA 1LWFA 4U7CA 3D45A 4HUGA 3FQKA 4ZVHA 4TN2A 5SZTA 3V6DB 2A1SA 1BI4A 2HVIA 5C25B 4DU1A 2BQUA 4K4YA 1JLQA 4AHUA 2DPIA 1RT5A 4M3XA 3PW2A 1RTJB 3H40A 3DLRA 4FZXC 3JYTB 2DFFA 3OYKA 1RTHB 3HPHA 2ETJA 1LWCA 3LP2B 4W5OA 4M3WA 3BQ2A 2D5RA 3AVGA 4QOZB 1TAUA 4ZVEA 3AVJA 1LWCB 3QGGA 1DTQB 5EWFA 4YR3A 3M8QB 4ED8A 4CK3A 2KQ2A 1L3TA 1NJWA 4O55A 2UVWA 2JEIA 5DK5A 1L3SA 2UVVA 1W0HA 4ECQA 5DLFA 3VQ6A 3V9WA 4B3OB 1WN7A 3OS1A 3KLEA 5J1EB 4Q0BA 4FLVA 1NK8A 1C2PA 3K5MA 2FBYA 3L8BA 2GIQA 4HHTA 3SFUA 1CLQA 3ZT0A 3AO2A 5KT6A 3BSNA 4E7IA 3BGRA 2B6AA 4JRQA 3OSNA 5F8HA 1C0TA 3KMQA 1S9EA 4CGIA 1HYZA 5KFQA 4O44A 3DOKB 3DM2A 3T5HA 1JL1A 2RKIA 1HARA 3V4IA 1S1VB 2FBXA 5HRRA 4AHSA 2YKMB 3T5KA 2HHVA 1MU2B 1SUQA 3CDUA 4K4WA 3V6HA 3C6TB 4ELUA 4EP4A 3L2VA 4KV8A 2YNIB 4CE9A 3PO5A 4Z4GA 1SKRA 1S5JA 3BSCA 4DL3A 1FK9A 4IFVB 1T03A 2IBKA 4RZRA 1NKEA 1FKOA 1CZBA 5J2NA 4M41A 1S1XA 5C5JA 4YFUA 4MK7A 4KB7A 4DFPA 2HHQA 4Q5VA 4PQUA 5JXSA 3U3YA 1XWLA 3LWMA 3QETA 3RB6A 4ED6A 1MMLA 4Y34A 3WNGA 4Z4CA 3BSOA 4ED0A 1WNEA 3DI6B 4QAGA 4JS5A 3NH1A 3VQBA 4WFZA 3LPUA 3VQQA 4DSKA 4BE0A 4CFAA 4ECUA 5DMRA 4M42A 1B92A 3MECB 3KLEB 1WLJA 1HQEA 3AVCA 3DLGB 3ZSYA 4KHNA 2ILZA 3WNEA 4B9VA 1EKEA 1S1WB 4PUOB 5KTQA 5KG4A 4KAIA 1TKTA 2P5GA 1RT5B 5CZ1A 4K4XA 3DLEB 4B9MA 1S9FA 4I7FB 4G3IA 4WE1A 1BI4B 4E1MA 2WCXA 4M95A 1S0OA 3AO5A 3VA0A 3RWUA 3AO3A 1C6VA 3T5JA 3THVA 2YHBA 4K4SA 1A5VA 3H4BA 4EEYA 1F21A 3F73A 4DL7A 3KHRA 4YR2A 1SL2A 4Q0BB 4M3ZA 1QTMA 4CJLA 1RBVA 2PZSA 3C95A 3HK2A 1ITGA 2QKBA 4O4GA 2XCPA 2WRMA 3IGVA 3DMJA 1T8EA 3KD1E 3U6FA 4W5NA 4FJKA 4F2RA 3QEWA 2D0AA 2DY4A 4CIGA 4DQSA 1XHXA 3IGNA 3IS9B 4NCBA 1VRUA 2FLPA 4RNMA 1RDAA 4B9UA 1TGOA 4FXDA 1S49A 2IGIA 4R0EA 4RW4A 4N47A 3NH2A 5J1EA 2IM0A 4ECZA 4CF0A 3KK3A 3L3UA 4PUOA 3GV5B 5KFOA 3G6XA 3DI6A 2RN2A 1RT2A 5I3UA 4IR1A 3MXIA 2G8KA 1VRTB 4TXSA 5KFIA 1S9GB 1LWEA 1JLCB 4IH7A 3KHGA 4B8CA 1TKZA 1T03B 1K6YA 1YVUA 3PX4A 3TWHA 1Z25A 1JLFB 1S1XB 2KFZA 3VQ5A 4FLZA 1N56A 1O1WA 3DLKA 3RRHA 4HYKA 3U3GA 4F8RA 2P1JA 3N6MA 2ATLA 4RUCA 3L2QA 5KFCA 4ELVA 4DS4A 4XPEA 1HYVA 4ID1A 1A5XA 4Q8FA 3GV7B 3RMBA 3V1OA 2AQ4A 3M9OB 1BCMA 4O0IA 1ZBUA 4RW7B 4DL6A 2YNHA 1KSPA 4ECSA 1HQEB 4NYNA 3H5SA 3CJ0A 4F2SA 2CKWA 2BANB 2BGGA 2DTUA 4E89A 3BREA 3ZT3A 1DLOB 4QWBA 4ZPBA 5CYQB 4Q45A 2R8KA 4C8NA 1U09A 4IR9A 2YHAA 3O4QA 3VQPA 3ZT2A 3NF7A 4AHRA 3AVNA 4KBIA 4TQSA 2IDOA 5SWMA 4K4ZA 2HNDA 5KG3A 4MQ3A 1RNHA 3HJFA 3OL7A 4Q8EA 4EO8A 4ED2A 3DRPA 3OSPA 5CYMA 5D3GA 4FW1A 4CEAA 1NJXA 3G86A 5F9NA 4CHYA 1C0UA 4KHRA 4RW9B 3HVAA 4KHSA 4DU4A 4I7FA 2B5JA 4RW9A 4C8MA 2Y1IA 3TANA 1N6QA 1L3VA 2R2UA 4KV8B 2XRIA 5KGWA 3NGDA 3VQ8A 1IH7A 3TQ1A 2W9CA 1KVCA 1HYSA 2E4LA 3M8RA 4CJPA 4NLGA 4RW8B 4CJUA 2D7SA 4BACA 4URQU 1QUVA 3OYFA 1QSYA 5KG0A 1RYRA 5J2MB 2IM1A 4ZVGA 1W9HA 2XWYA 5KFBA 4DSFA 1N5YA 3ZSRA 3OYCA 1KCFA 3CQ8A 4NCGB 4J9LA 1RT6A 2XCAA 2GUIA 3HPOA 3IRXA 3IS9A 3ZSXA 1JLEB 3PW0A 3HM9A 4WFXA 4YNQA 3ZSZA 4FK0A 3V1QA 3L2WA 1S6PB 3NBPA 2VG6B 3A2FA 4RNOA 3SZ2A 4IOBA 1HNIB 3GILA 1HPZB 5HLFB 3HSTB 1VSDA 1NJZA 1LV5A 3I5AA 4ZP9A 1TV6B 4KTWA 1TQLA 2OYQA 3RRGA 4H4MB 2V9WA 5KG7A 3D5MA 2E9TA 2I5JA 1TK0A 2HNDB 1IG9A 1RTDB 5L9XA 4K8ZA 2WONA 4LH4A 2UUWA 4ECTA 4F3TA 1LW0B 3DM2B 1XI1A 2G8FA 3UQSA 3HL8A 1SKWA 4C8LA 2YKMA 2JEJA 2JC1A 4BDPA 1EETA 3AVBA 5CYQA 3OYNA 4DQIA 1RBTA 4PWDB 4KHQA 1JLBA 1X9SA 1D9FA 1LW2A 1RT6B 4K4TA 3GV8B 2IJNA 1NKCA 5JS1A 2HMIB 5DQGA 3CM6A 1UA0A 3NL0A 5EUHA 3TAEA 1VSMA 1RBSA 1SH0A 5HP1A 5C24A 3AVFA 3KNAA 4ECRA 3LP0B 4DTMA 3AA3A 4EBDA 3PX6A 4RW4B 5KFYA 4KRFA 1WNSA 4PQUB 4ZP8A 2OPQB 4FJGA 2W9AA 1UWBA 3NF6A 5KGXA 4HUEA 5CZ2A 3CM5A 4UQGA 3S3MA 4J9KA 4QCLA 4DSEA 2O5DA 4LSLA 1KHVA 4GC7A 1JLFA 3HXMA 2AGPA 4NYFA 1LW0A 4DG1B 1BISA 2B4JA 1RAJA 1YTUA 3ITHB 4WE1B 5J2PA 1WSFA 4J2EA 2FJWA 4FK4A 3DRRB 1JLQB 3SI8A 4F4WA 3FFIA 4QWDA 1RT3A 3V1RA 1IKVA 1DTQA 4NCGA 3N6NA 2YNFB 4NLRA 2XI3A 4WXWA 4E7KA 2FVRA 1QSSA 4O3NA 3QIPB 2FVPA 4KKOB 4B8AB 3LAKA 1ZBHA 3DYAA 1IKYB 1BHLA 2ZE2B 2B6AB 5HRPA 3O3HA 4MFBA 3L2RA 3OLBA 1S9EB 1SV5A 3LP0A 4ICLB 3QZ7A 3RMDA 4J9QA 1ASWA 2IAJA 4J9SA 3QYYA 1GX6A 2G8VA 1RDBA 3IRXB 3TAMA 4IFYB 4O4GB 3SPZA 2Y1JA 3LAMA 3VQCA 5KFGA 3AA2A 5KFWA 2OH2A 3LPTA 1ZTWA 4Z4EA 4NCAA 3RMCA 1WSHA 1C1CB 2WOMB 3RAXA 1VSLA 3ZSOA 2GBZA 1HPZA 5HLFA 2HW3A 4B9LA 3FQLA 3OVNA 2OZMA 4KAZA 4AH9A 2AJQA 3OLAA 3AVMA 1FXXA 3KK3B 5J2QA 3SQ0A 5EU7A 3D0PA 3MF5A 3JYTA 4H4MA 4ECXA 4I2QA 1XR6A 2VG5A 1ASVA 3RBEA 3QO9A 2I1RA 4CHZA 3CJ3A 3B6PA 3UPFA 2F8SA 5F8JA 2CJQA 1X1PA 3QEIA 4KKOA 4K8XA 3TAPA 4J9NA 2IAJB 1RT4A 4FJNA 3ZSQA 4J2DA 4DTJA 2IA6A 5EWGA 1HRHA 3TARA 1JLGB 1RT4B 1C1AA 4YQWA 2JEGA 4E19A 4PY5A 3TVKA 3DYAB 3PUFA 1A5WA 2PYJA 3QZ8A 3DOLA 2D3UA 1S10A 2KZMA 5HRNA 2W9BB 3NH0A 3DOLB 4MKAA 4EO6A 3H4DA 2ASJA 4IQXA 3KK2B 1SKSA 2BE2B 3K5LA 3S3OA 2GC8A 1T05B 1TKDA 3VN5A 2E6LA 4FVMA 4G1QA 1D1UA 4MH8A 3TR8A 3C6TA 3MR3A 3CDWA 5F8NA 4I2PA 1NHVA 4J2BA 3OYJA 4CJKA 3UIQA 3PW5A 4LY7A 1CSJA 1RA6A 4IRDA 3CFPA 3HVTB 1N4LA 1RCHA 2XO7A 2ILYA 2C2RA 2HNZB 3AO4A 1UAXA 2R2TA 3PZPA 4NLTA 2VG5B 5F8MA 4DL5A 4CGDA 4CJTA 3LDSA 1WAJA 1QAIA 5KFFA 2RKIB 4RW7A 2W8LA 4ID5A 4DFJA 2BANA 4DMNA 4KREA 3F9KA 4JRPA 3P83D 3BSAA 3FFIB 4WZQA 2HNYB 2YNGA 3LZIA 4KB0A 4I2QB 3K58A 4OGCA 4N76A 3H5YA 1VRUB 2C2DA 1LAVA 3HYFA 1IKXA 4CFDA 5KFXA 4CGHA 2LSNA 1HQUB 3S9HA 2IM2A 1X9WA 3OS2A 3E51A 3TABA 3IG1B 3OY9A 3HP6A 1FKOB 2BRKA 2WB4A 2ZKUA 4IG0A 1NOYA 5L1IA 1RYSA 3OYLA 4KHWA 4FJLA 3OL8A 5HBMB 3H59A 3CYMA 4HTUA 5KFVA 4OVLA 4B9NA 1RILA 3MR6A 4N41A 4FW2A 1T3NA 1JLEA 4RNFA 4IDKB 2J6TA 4CEOA 3MEDA 2IJFA 2V0NA 4JV2A 2UVRA 3V9SA 3VQ4A 4URGA 5T14A 3KIOA 2YNIA 1C0UB 1BIUA 3NF8A 3MEEA 1TP7A 4OL8A 1EP4A 3M9MB 4KPYA 5KFAA 3CIZA 4AHTA 1I3AA 2FVQA 1BIZA 3EY1A 2VG7B 1NK6A 2J6UA 5KT7A 3SQ2A 4DTUA 1VK0A 4IG3B 4DEZA 4B9TA 5DLGA 3SUPA 1TVRA 3NHGA 1Z26A 4DTRA 1DTTA 1XR5A 1LW2B 1IKYA 4KI6A 3KOAA 3KD5E 2G8HA 4EBEA 3ISNC 3ZSWA 3VQSA 4FYDA 1R0AA 3LWLA 3T19A 4KTZA 4CHNA 4G1QB 2E9RX 5C42A 3GYNA 4FZZA 2OZSA 3TAQA 4RW6B 5J2MA 1UOCA 3I0SB 1EETB 4GC6A 4BE1A 1L3UA 2GIRA 1NK5A 3H5UA 1BQMA 4URSA 3MAQA 1EX4A 1SL1A 2W9BA 5KRSA 1BQMB 4Y1DA 4EP5A 2BE2A 4M45A 5KFRA 4R8UB 1RTDA 2DFHA 4ED1A 4DFMA 3DLEA 3I8DA 4W5RA 4AILC 3SUQA 3LP1A 4CF9A 1Z4UA
chains in the Genus database with same CATH superfamily
1XC9A 2ZHOA 3OR2B 1CXUA 1HNIA 4DPUA 1YJNS 4FJ8A 2AV5A 1MLAA 5DDPC 2NRTA 2AZ3A 3QJLA 4LFBJ 4A48A 3W61A 2KI2A 1JKHB 3M8PA 3G6YA 3DLBA 3N01A 3SUNA 2LU1A 4F3QA 3D6MB 4E0DA 3KWIA 1FRXA 4EZ6A 2W9CB 4ZHRA 3TRGA 4JYAK 2P5OA 3OL9A 1BHNA 2DGSA 1F60B 3L95X 1RBLA 4DV3K 3KXDA 3RMAA 2RD5C 1V9OA 3V6KA 2CQ3A 3Q8PB 1NSAA 3NGYA 4ZVPB 2XSFA 1LXNA 5CY4A 2RE2A 2UXCJ 3QINA 2MKCA 1C0MA 2FDNA 4PZVA 1N8RO 4XEIA 1CBKA 2YKNB 4Q44A 2MPUA 2DPNA 3SI6A 1XC3A 1FF2A 1I1GA 4O5BA 1HL6A 4A5AA 4BG8A 1R8AA 2E5HA 4FWSA 4OYMA 1QQCA 3MR7A 3G71N 5IWAJ 1HNWJ 5FROA 2JWNA 3D28A 1FKPB 1OIAA 1FE0A 2A10A 4IEEA 3THWA 4NLSA 4B3SK 4LVNP 1M5KC 1RTJA 3DLLQ 5AE3A 5I3UB 4CLZA 2K3KA 4LF4K 2HFVA 3WX8A 2MQNA 3LM9A 4HTJA 3MD3A 2BW2A 2O3DA 1HBMA 3AODA 1JNZB 4KH0B 4E2FB 3A5NC 3R97A 5CHIA 4BE2A 2KW4A 2VYPA 5EGYA 1N6QB 1G4CA 3ILLA 3K17A 5KFJA 4LBHA 2A1RA 1BU6O 4AFFA 2LEPA 4IDHA 3SMZA 4R5PB 1P6TA 3MFIA 3E66A 2XY5A 4C8ZA 1JWWA 1VQ5S 1IO2A 3NGTA 3EE3A 3J80U 2CDRB 5DGBA 3ETOA 3OTOK 2V8PA 1DLOA 5E26A 3W62A 2YXLA 3OV7A 2HHHK 1QDUB 3CJQA 2M8DB 3ULDA 4W4MA 1SAZA 1SC4B 3QICA 4B17A 3QIDA 1BA0A 4EFHA 3M6VA 2P9SA 4KGMA 4FJXA 3H20A 3OJUA 3CJBA 3NWGA 3U02A 5GAGI 2X1AA 3HO1A 1M1GA 3K5OA 3FBBA 1HMVB 4M3UA 3H1VX 1S1VA 3MTKA 4OI4A 1KQSR 2EXUA 3EPIA 4WXOA 1I51B 2HBJA 2LXUA 2MY7A 2EFGA 1M90O 1UA1A 1NGAA 2YNHB 4Y6IA 4U7BA 2HNZA 1X4HA 4OX6A 1Y5LB 2QE5A 3JQKA 1KAZA 4OPKA 4A2AA 4KB1A 3AA5X 3WEEB 3DXSX 1DJ0A 2VU5A 5M1OA 4BRCA 4LF6F 3CCZA 3W5YA 3MEKA 5A8WB 4QWCA 2P5VA 2RRBA 1MSWD 4RNHA 2A40A 1T7PA 5LMNJ 3FZBA 2COLA 5KFMA 2BVZA 4BRMA 2LP4A 1IKXB 4OJ3A 2OD6A 4HKQA 4KE5A 1S72S 3TW0A 3NMAA 4CEFA 4DB3A 2OPPB 3M30B 1KXPA 4DL2A 1UMJA 4BS2A 4IKFA 2R8HA 2O8CB 1RWNB 4FLYA 4JKDA 4MAKA 4E7HA 2XY8A 3Q8RB 4B3RK 4TU7A 2RPIA 4YHHK 3QIPA 1N34K 4UOFA 1ILYA 2P9UB 1R6YA 3LOUA 5HVHA 4BHQA 1UJ4A 4X62K 4U95A 3ID6A 2W7OA 2FY1A 4DF8A 2O8EB 3NAIA 3R7SB 2O4IA 5D77A 1RCOB 3HDSA 4K25A 2F8TA 4MDAA 1RFQA 4J90A 3W2VA 2O8FA 4KYZA 2LQ8A 4ZS6A 3A8EA 3MMCA 2ZHBA 4OYXA 2FVSA 4WQ5A 5AXKA 4CHOA 3MR2A 2E1RA 2DCUB 2CJAA 3K9JA 3SLCA 4DR3F 3IBCB 1HQUA 2ZC3A 4XH5A 4ERDA 5ETNA 1DARA 4CJ5A 1T3VA 4AHCA 1N33J 4IKAA 1U0HB 1XBWA 2HQIA 4DV3J 1S0MA 2XY6A 1TKZB 4JN4A 4JI0K 4FWNA 4KH6A 3KMSA 2QT7A 5CYJA 4CJQA 1RI7A 3WQUA 4ZP6A 2W7PA 4FM1A 3KJVA 1YJUA 3MR5A 4JV5K 3R9LA 1WSJA 3P5TL 3I56N 3I9ZA 4WFBL 2B5JB 1OPIA 1M5PC 1D9DA 1RBAA 4NWBA 4C11B 2CDQA 1V5IB 2RUSA 3FSYA 3T1HJ 2C3OA 4HHHA 4BC2A 3D2WA 3IO1A 4FS1A 3R2CJ 1OPZA 4N5SA 4FJ9A 4NXMK 1KLNA 2VBZA 2JWKA 1RTIA 2O67A 3DRSB 3NOCA 2WVBA 3I0SA 1S9GA 4TU8A 2YJFA 1RT1A 2FGOA 4YDUA 2P9IB 2XLJA 2VGNA 1WHXA 4H54A 4LSLB 1HNXK 1J5EF 2PFUA 2Z1IA 2F8EX 1R59O 2PN6A 2HK2A 3V6DA 4OHVA 1WTBA 2EFQA 5LXRA 5BPLA 3ZT4A 2HBYB 4OYZA 4GVEA 3I9V9 2G8WA 2H5IB 2EWHA 5ETVA 4AE5A 1VSFA 3VEXA 3SAGA 3VVTA 2XLKA 9ATCB 3ZTSA 2D0BA 2V4RA 4DFKA 4CJ3A 2OPPA 4QYRA 3FSIA 5E0OA 4WYWA 1QVFR 3OR1A 1EP4B 1E6VA 5IFMA 3WXIA 3VERA 3M8WA 2ALYB 1WSIA 2B8PA 1HYSB 1RTHA 5A8WA 2PYLA 1FWKA 2W2QP 2HQFA 3MXJA 2YTCA 4JD2A 2ZWPA 3CJ4A 4L3NA 2CH6A 3JTNA 4JD2B 4TLRA 2AGQA 3D54A 2OGUA 1XMOK 1MDUB 1NZAA 2GO9A 1QTNB 2G9OA 3DXKB 4IO9L 1WG4A 5LJWA 4U8YA 3CCMN 3L4IA 1S48A 3H2VE 2HHHJ 3HSZA 4ANDA 1NWKA 4DV5K 4XAKA 1YG0A 5CYMB 5KFSA 1NHUA 1RU2A 4F04B 3QBXA 4FSVA 1DHMA 3TP2A 4PG4A 3CJ2A 5HBMA 1TKTB 5A8RA 1ACMB 3QERA 2OELA 4QWEA 2H3GX 4DV7J 2OPRB 1X4DA 3KNGA 1P1LA 2ZZMA 4JV5J 4PAAA 2OPRA 1HNVA 2M2BA 2FBVA 4O3PA 4CH0S 1QUPA 3FZKA 2L9WA 4J9PA 3G4SN 3V4MA 2FHJA 3KK2A 1HKAA 2GHVC 1PO6A 5KG1A 1SQKA 3R8YA 4Z4IA 4WFNQ 4XDCA 4Y00A 2C1EB 4CJSA 1U49A 3UN2A 4MMOA 4YB5A 3G10A 4NXNK 4DV0F 4OHXA 2XHBA 1RT7A 3RW7A 2JOQA 2J0WA 4ZCMA 4ZPTR 4DF4A 3ZT1A 1QQOA 3J81U 4IRKA 3DU6A 2JC0A 3W63A 4NASA 2GQ2A 2K7JA 4IEIA 2UUCF 5AXLA 2VHGA 4JKGA 4OX8A 4QPTA 4B3TJ 1W2BM 3IAYA 3AO1A 4KC5A 1KHWA 1I6JA 3B4MA 4BR0A 2W2OP 4LFAJ 2HNYA 1SQEA 3ZYYX 2E5LF 4ILJA 3KK1B 3UKUA 4AQYK 1FJGF 3FJ2A 1SZ2A 4FP9A 1GTEA 3R3LA 3L3VA 4NPOA 2J9EA 4LF5F 3OA9A 3I0RA 4P75A 1NBWA 4Y2CA 4FWMA 2JEFA 4X4UA 1HJRA 4F50A 3VGTA 3KDNA 3VA3A 2FTRA 5GINA 2NRZA 4HDHA 5D4PA 1YJWS 4LF6J 1JLBB 1JLAA 4DQ8A 4KSEB 1HQ2A 1CVJA 2GQQA 4BRPA 3OQ2A 3AOAA 1X4CA 4ZP7A 4IOXA 3RBDA 3DWLA 2NCKL 3PYGA 5GMKa 1WC0A 5LMNK 1U24A 1FVQA 4PA1A 3W2WB 3L9ZA 3OJSA 2Q6BA 2MY8A 5DJBA 2CQ2A 1OJ4A 3CWJA 4J8FA 4C48A 3T6BA 2R7VA 1BOTO 3R5JB 3IR5B 3DLJA 3MUVP 3PHTA 1NLKL 4MFBB 1Q8IA 1VRTA 1AA1B 1YT3A 4FBUA 4CZGA 2KTQA 3VWSA 3QNOA 4NXMF 4YOVA 1GLFO 1K8AO 5F0XA 1Y4ZB 3MCNA 3GIIA 4FZVA 3A8YA 3PRBA 3PW7A 3KK1A 3UKUB 2KN4A 1GLDG 1D5AA 3M30A 1TUVA 5BYSA 1NGHA 5AQRA 2HFOA 5EXWA 2EKNA 3CO9A 2CPEA 2QSWA 2DNPA 2IS3A 4JI2F 4K42A 2QIFA 5I42A 4NLYA 4X64K 4BDZA 4GKJK 1BQNA 4YHHF 1ZS6A 2KJWA 1RWWB 3SBTA 2DGVA 3S6EA 2ASLA 4E7JA 1NGDA 3TVYA 4K4UA 4F4KA 1Q18A 4F9OA 1UFWA 3LZJA 3QEXA 4CHPA 3G6VA 3AD9C 5KOWA 3MCAB 3IN5A 2BEFA 3WNFA 3NS6A 2KKHA 4FJMA 2J6SA 3M2RA 3MFHA 1VSHA 2I6WA 4CERA 4KTQA 1LWFB 1IKWA 2KXFA 3DN9A 2QYCA 1KOOA 4OZ0A 3LP1B 4Y0WA 4BLGA 5KFZA 1TKXB 3BR9A 1T94A 2MZTA 3OYHA 4L6V3 2FHMA 5F1XA 3I5CA 1BG3A 3VV2B 1XHZA 3MEDB 3VQEA 2ZJPL 2KHDA 2BQRA 3GTYX 4QPXA 3T1AA 3K8WA 2ZH6A 1J5EJ 5C2FA 4JV1A 2QSFA 4P52A 1BGXT 4PQAA 1KC8O 4F3OA 4OPHA 1GMUA 4WF9L 2LKZA 1FE4A 2AWZA 1W7WA 4FCYA 1W2IA 3C6UA 2AW0A 3T6JA 4AM6A 3IP0A 1GEHA 4B3SF 3CJ8A 5KT5A 3C19A 3TJ8A 4B3OA 2YX6A 1KQKA 1FJCA 4EYHB 1YXQA 3OYEA 3HT3A 2Z1JA 4TYAA 1VQ6N 3VESA 3SCIE 3QGIA 2MZ1A 1NGIA 4AF1A 4NLOA 1S72N 2E44A 3WXKA 2DD8S 5AZJA 5E2QA 3V6DB 2HIQA 2HVIA 5C25B 1DFDA 4B1UB 4K4YA 5KPRA 2H48B 3CHWA 3R2DJ 4M3XA 1RT5A 1YBTA 3H40A 4GVLA 2ZH9A 2HG4A 3HPHA 4W5OA 4M3WA 2B3TB 5B0EA 2WSCC 3ILOA 4ZVEA 1IBMF 2Y8YA 3ET6B 4OI0A 4C8YA 3PRVA 3M8QB 4CK3A 5AQMA 2KQ2A 2QW9A 2GMLA 3P8BB 3BS9A 2UVWA 1GLLO 2VQEK 4ECQA 5D6GA 4KGKA 3KLEA 2KM8B 3DDNA 2DNHA 3O1WA 4M7XA 1NGFA 4MYTA 1ZM2A 2CPHA 3SFUA 3ZT0A 3VGKA 2QWNA 1GK8A 3AO2A 3VTIA 5KT6A 3GU0A 5BRHA 2QWLA 1SQFA 3JAMO 4JRQA 3O6QA 4F02A 2F7VA 5F8HA 1C0TA 5AJ3K 2M9KA 1RSCA 1S9EA 3M2VA 2UU9J 1FXRA 2RNEA 4O44A 3DM2A 3CPWR 3T5HA 4JI1K 3EDRB 2PFDA 5M1QA 1S77D 1FI4A 1RDWX 2FBXA 3D3BJ 2HLTA 4AHSA 2YKMB 1HBOB 1E4FT 3NVMA 3L7OA 3C6TB 2GVZB 2A5XA 3MPYA 4KV8A 1FERA 4FKXA 4Q7AA 2VV5A 4OMFG 4DL3A 1FK9A 4IFVB 1T03A 1NKEA 1CZBA 1BXNA 3AQPA 3U1NA 4M41A 1S1XA 2RQKA 3KK7A 2XZWA 4YFUA 4KB7A 4DFPA 1Y10A 2F9JA 5GAHI 3U3YA 3H25A 3SK3A 2ZBQA 1FNXH 3G4SS 2DNNA 4KY3A 3PKYA 1WNEA 5BREA 2QEXS 1WHVA 3TU5A 2YH0A 4H4KA 1JJ2M 1XEZA 1HWUA 4JS5A 1V3ZA 1VIOA 1KAYA 3VQQA 4DSKA 1YLXA 5B08A 1LFPA 1ZZNA 5DMRA 2HK3A 3KLEB 4DCJB 2BKNA 2WW8A 3KG4A 1NDPA 2ILZA 5KG4A 3VGMA 1XNQF 1UEKA 2IHR1 4USJC 1R6VA 1NRKA 5CZXA 4A59A 3E1YA 2DRAA 4G3IA 2ROEA 4WE1A 3OUYA 5B0BA 1BI4B 1N8RT 1S0OA 5C15A 3AO3A 2R9LA 1C6VA 3THVA 1RAOA 3VEOA 3KHRA 1JCEA 1SL2A 3LGNA 2YX7A 3VZIA 1RBVA 3V2UC 3OFFA 4LSZB 1ITGA 4HACB 3C14B 3UW1A 2QTDA 2CQ1A 3VOVA 5HMXA 4H0OA 2E1CA 4A2BA 1ITPA 1YJWN 1TL7A 3AAQA 4MIWA 1X3NA 3IGNA 1QY7A 4DPXA 1N5TA 4RCHA 1ZM9A 1S49A 5DZ6A 2IGIA 1NUEA 4R0EA 4RW4A 4W90B 1QM9A 3DRYA 3PKMA 1A0OB 3GV5B 4AT1B 3D2EB 3DI6A 2ZC4A 4DV6J 2RN2A 1RT2A 2Q79A 4IR1A 2LEAA 1IWGA 5A8RB 1DT9A 4QR1A 4F25A 4LJMA 4JI8F 3KHGA 4B8CA 4QU7A 4NOHA 5K8MA 1RU1A 1Q86O 2ZH4A 3SMSA 4R25A 1N56A 1O1WA 3RRHA 1RHKB 2YHYA 2B9XA 4F8RA 2ATLA 3O9TA 2B9YA 4NL5A 2IYIA 3ID8A 3M9OB 1X5PA 2GMHA 2UXBF 4JI4J 3P49B 1HBMB 2F4VK 2YNHA 4WP8A 2XTJP 2K1RA 3G82A 3H5SA 4FO0A 2ZJRQ 2CKWA 5E5NA 2DGXA 2DTUA 2GTDA 7FDRA 1NMNA 2NPFA 4M5KA 1JJ2R 1HNXF 3ZT3A 2FHJD 4QWBA 2V6AA 3C15B 4C8NA 2F8MA 1TUUA 3VQPA 1UKUA 4I1TA 1KEKA 4QJVA 1CS4B 2KXHA 1JJ4A 4TQSA 2PI5A 2VGMA 2ACMA 2IDOA 3D67A 2HNDA 5KG3A 1GMWA 5C2CA 4M5DB 2CPYA 1VQNN 3HJFA 4R0JA 4DR5K 4DV7K 5CYMA 3QFUA 2KHOA 4FW1A 4CEAA 2MKYA 2HKEA 2H54B 2DK2A 3PSFA 3HVAA 4BROA 3ZETB 5T7LB 1XUPO 3AAWB 4RW9A 3WXLA 3TANA 3MPWA 4P2SA 1Q1KA 1SI9A 1HI8A 4KQZA 2HVDA 3TQ1A 2W9CA 5HQ8A 2NRWA 3DU5A 1S3XA 2IVPA 3M8RA 4CJPA 4NLGA 4WK3A 3Q2TC 4CJUA 3J80Y 3CCLS 1QUVA 1QSYA 3E8OA 2KDOA 2V4JA 1BWEA 2M7SA 2RRAA 4DSFA 1Q7LB 4DR7J 3CCJS 3MOZA 4FWRA 1KCFA 3CQ8A 4NCGB 5HANA 2GUIA 5LOQA 3ZSXA 2UV8G 3TX0A 2P6SA 3ZZUA 3U8XA 4PHTX 2VQFK 2W1BA 4TU9A 1S6PB 2VG6B 4P6QA 3A2FA 4YOYA 3A0IX 3CJ9A 4B02A 2HFSA 2PIIA 3HSTB 5BR9A 2XWXA 4DR6F 1NDLA 2OD4A 3SCKE 1NJZA 1LV5A 2DVIA 2CZ9A 3CCWA 4KTWA 1VQSA 2HF4A 7AT1B 2MKJA 2BOPA 2OYQA 3RRGA 4H4MB 3TSPA 2A18A 2A6MA 4DDFA 4Y2IA 2I5JA 2VD3A 2HNDB 2B7CB 2UXDF 1VQ6S 4B1ZA 1V4SA 3CMAN 1RTDB 1S5ZA 4K8ZA 1U2VA 4A47A 4UZCA 4F3TA 3DM2B 2JVRA 3CCQS 1XI1A 3KUHA 2HRYA 1HX1A 2HQGA 2YKMA 1UWAA 4F67A 3AVBA 5CYQA 3W2WA 3ILJA 5JVGL 4KHQA 2ZOFA 1D9FA 4AXJA 2FHKA 1NKCA 5JS1A 2HMIB 2ZUGA 4EMDA 1YJ9S 5DQGA 2XHCA 1UA0A 1OH5A 4X65F 4HHJA 2XO6A 3UWTA 1RBSA 5HP1A 4H03B 1Y7PA 3LP0B 4DTMA 5DM6L 3BY5A 4EBDA 4ZP8A 2OPQB 2OP5A 2W9AA 3NF6A 4GV9A 4CM2A 4A8FA 1QJHA 4UQGA 4DR2F 3HM8A 4DSEA 4FYYB 2J7WA 1H1VA 3QATA 3U7JA 2W2MP 2NREA 4M5GA 4LF2A 1WOPA 3GPAA 2Q1NA 2ZBRA 1KHVA 1JLFA 3D0HE 3MMAB 3HXMA 3ULEB 2B4JA 1RAJA 1YTUA 3ITHB 2Q31A 4HT5A 3IR7B 4J2EA 4DV7F 1EX8A 4HVZA 1JLQB 4F4WA 2OKQA 4QWDA 1RT3A 4X64F 3NWRA 1DTQA 1KQSM 3FBEA 1HI1A 4NLRA 1I94J 4ZIWA 4WXWA 3TTFA 4E7KA 1FESA 4DXLA 4CZEA 3LAKA 3F0NA 3IBFB 2ZE2B 3CERA 1I5OB 3ZEUA 3BZKA 2KHCA 4DZ6A 3RMDA 1ASWA 3QYYA 3ZEUB 3CD6N 4EAHD 1RDBA 2ZDPA 3IRXB 4YHHJ 2DH9A 4CRJA 2GVDA 3PACA 3P6YC 3HSDA 1ZTWA 2B4OA 1WSHA 2VOOA 2WOMB 1MWZA 4PKDB 3CO0P 2VQFF 2HW3A 3DOMA 4PYAA 1F5AA 3EGVA 1SCJB 2OZMA 2YKQA 4M63C 3LDQA 4X4TA 4XTTA 4NZ7A 5HMWA 1S4EA 4BRGA 2JL9A 1FXXA 4AQYF 1VQ9N 4U8VA 6AT1B 2UV8A 3WIUA 1MNEA 4BQZA 3FCVA 3JYTA 3CUNA 4ECXA 4BGBA 2AT1B 3U9ZA 3MPVA 1SQGA 1SBRA 2DH8A 4CHZA 2Q3PA 2F8SA 3UN5A 5JLHA 4ZKAA 5AT1B 4K8XA 2R7OA 3P96A 4J91A 4J2DA 3TARA 1HRHA 1JLGB 1RT4B 1UZDA 1C1AA 2E5JA 4DR7K 4K0KJ 4YQWA 2Q1LA 2JEGA 1S0VA 4E19A 4PY5A 3MWTA 5ETLA 4JAXA 2PDAA 1KQFB 4ED5A 1K44A 3NS7B 4KGZB 3DOLB 4MKAA 4IQXA 3D7EO 1IBKJ 3BYPA 3K5LA 2DHHA 1WHYA 3QFWA 3VN5A 4X66F 2E1YA 2FZCB 1N36K 3DXMB 3DFEA 3D0GE 4J9VA 4J2BA 3OYJA 2DY1A 2C3PA 3KJFB 3PW5A 3Q8YA 1RA6A 1RWOB 2MQLA 2XO7A 2ROGA 4X4VA 2JLGA 5ETMA 3OR1B 2CGKA 1O0PA 1K9MO 1RLCL 4DL5A 1HNWK 4I68A 5KFFA 2RKIB 4RW7A 2BANA 2FGCA 1NZ8A 4WZQA 4AXIA 5LMUF 5HVGA 2MB0B 3EE9A 2X7IA 2C2DA 1Q5YA 3LUYA 2FD2A 3HYFA 4CFDA 2O8EA 3ZXWA 1HQUB 2E1AA 3CTRA 3OS2A 3E51A 3OY9A 5EX3A 3HP6A 1FKOB 2PFFB 5AQQA 1LEOA 4IG0A 4XH4A 3L0QA 2VPZB 2DJWA 1L3KA 3OL8A 1YVNA 1BQXA 2VQEF 4B9NA 3CB4A 1ZBSA 5H9FJ 4B1WB 1VGYA 3GCWP 4RNFA 1V4TA 2J6TA 4CEOA 2DRDA 2R3VA 4JI7F 3FCWA 1Q0NA 1T0TV 1JJCB 4URGA 4UZBA 1HNWF 1BIUA 3WC0A 3PDNA 2V9KA 5HAOA 3JXUA 4CDIA 3CIZA 3G82B 1I3AA 2FVQA 2XHWA 2VG7B 6FD1A 5MAOA 3G8QA 4V19S 1VQ5N 4DTRA 1X4BA 3EGZA 5E33A 1LW2B 2BJEA 2CJBA 1B0TA 3D6TB 4JI3J 2DHXA 2ZM6K 5IC4B 2HPUA 4X62F 3DOMB 3PRDA 3GL1A 3BKFA 5HATA 3JS9A 4FNHA 2E9RX 1VJQA 4LRAA 4HLBA 2HVZA 1UOCA 2M52A 2P9GA 2GIRA 3JSYA 2WBMA 1BQMA 1S79A 4DV4J 3FEXB 5C12A 1SL1A 1KN6A 1BQMB 4EP5A 1XIQA 1VIXA 2DITA 5KFRA 4R8UB 1N32J 1DQ8A 3CT9A 4FWKA 3CCJN 2WVCA 1EKRA 4H0XB 1D4XA 3I4PA 3GCXP 3LP1A 4IOAQ 1HKCA 3T69A 4CF9A 1Z4UA 1KR4A 2BKOA 4OYWA 3J81O 1JXBA 1NK4A 1OH8A 5SUHA 5HL7Q 2CPDA 4I9LA 2E1PA 1KVJA 1GLJO 4QIGA 4FL9A 1E3MA 4BRQA 2BM0A 1ZA2B 2B43A 3DGVA 5KRTA 1PYOB 2VPYB 3NOGA 3T1HF 5DQHA 3BF3A 4B1YB 4DV0J 1W25A 4DR6K 2HIYA 4AL7A 3MMAA 3M1VB 2WHOA 4OHWA 1HD0A 3B78A 1HLUA 4IOAL 1Q8LA 5KFLA 4JI0F 1P9YA 3CCES 3NKYA 1U8SA 3NLCA 4RW6A 2RF2A 5KG2A 2DNMA 2ZOGA 3TTDA 1RAFB 2FVCA 4DLGA 4QYZJ 1NNDA 4YEAA 1QLNA 1N5VA 2IDEA 4JS4A 1T9XA 4IBNA 2ZEJA 2VWJA 4I69A 3F41A 3ONQA 2RHQB 2UUAK 1RHJB 4NLVA 5F8IA 3MUMP 1IQZA 3OBWA 3KLFA 3DRPB 1RKIA 2DYAA 1XMQF 2DO0A 4RL1A 4PEOA 4FLTA 2J0SD 1NPRA 2LXIA 1GXTA 4F4ZA 4Y2KA 2GVDB 3HKWA 3ATUA 4ECYA 5HRSA 3CPWM 4KGVB 4FXWA 2NUBA 2XSJB 1RBUA 2F4VJ 3EX7B 3A4TA 3BUZB 2NUHA 4F36A 3LP3A 3LDOA 3ENHA 3T1HK 5AR0A 3E01A 4EI2A 2IBOA 4O8KA 3KHHA 4DLEA 1BQNB 1YSJA 4G1IA 1O51A 3O44A 4GW6A 2DEJA 1OH7A 3N5BA 2E9ZA 3RB4A 3O9SA 4QR2A 2JWLA 2UYTA 2Z58B 4FNIA 2QXFA 3O6WA 3THXA 4H0YB 3S41A 5AQKA 2V8HA 4GV6A 1WHWA 3EN9A 4JI2K 2P9EA 1Q9XA 1N33K 3SCLE 4EGLA 4FOIA 1NSQA 5KG6A 3NNCA 1NGJA 1WELA 3P31A 4DQPA 2CNOB 4KI4A 3DLKB 1LWEB 3HVWA 4NI2B 5KFPA 1H2UX 3CMAS 3NNAA 4FWOA 2B8QA 2Q97A 1AZSB 3HVTA 4NYOA 2HSTA 4KO0A 2VA2A 5HJYA 1DZ5A 2F65A 2K3IA 1ZTTA 1M5VC 3AVAA 2IYGA 2VIHA 3BBBA 4ZVRB 5KQ8A 1LFWA 2BJ7A 1Q8KA 2XEXA 1D09B 3E9PA 1Q86T 3JAMY 4L3QA 2ZBCA 3EZUA 2WONB 4OX9J 2CG4A 3VGSA 3L3CA 2EK6A 5AQFA 2CH5A 1RGVA 2OMLA 2PE8A 5H9EJ 3DLGA 2E5IA 5HL7L 1REVB 5DETA 1GH8A 1TV6A 2V2KA 3SJJA 2DEIA 3GIJA 3MECA 1RCXB 4F4XA 2KM8C 2E88A 3A13A 4ZJQA 5EX5A 4OIXA 3KWGA 2U1AA 2BXJA 4Q2MA 4LF5K 4FJJA 1JJHA 1WI8A 4DTSA 4OZNA 2AIRB 5F3ZA 2QA1A 1LWXA 2ZGYA 3LPYA 3GE9A 4JI8J 1VQ4N 2HZCA 4HL9A 4LIWA 3P5JA 1FD2A 4CJEA 2HF3A 3VQ9A 4DUYJ 1WAFA 3CCMS 3QJJA 2A1BA 4M3RA 5AQLA 4CZIA 3V81B 4M8LA 3J7ZT 2R4FA 1Q78A 1XERA 2FJVA 2HMPA 3CCVS 2JLFA 3PNIA 1FO1A 1S99A 1JL2A 5BN9A 4N8OA 3C46A 2DCLA 5MLCV 3EM1A 4YDDB 4KHYA 5AQIA 2DHSA 1N0VC 3EMTA 1N5QA 4DX5A 5D4OA 4J9UE 3O1BA 4UY8T 4QIWD 4PL7A 3RR8A 4H4OA 2VBYA 5CAAA 1CJTA 2NXJA 5TKWA 4CEZA 5HOOA 2FF3B 1RT2B 1S76D 2BTFA 2HS4A 4X4PA 5F8LA 2QK9A 2GGPA 3Q22A 4M3TA 1S1TA 2F9DA 3MM8A 2WSEC 1E6VB 4AL5A 4OV6A 5G0RA 2MTLA 1XQSC 1H0HB 3ITHA 2MLXA 4P71A 1J9AA 2Y0SD 3CJ7A 2AEFA 3BEGB 5AQVA 4WKRA 2QLBB 4DQRA 1N88A 3NNHA 3SCXA 3O1LA 2C22A 2IMWP 2PGCA 2MGZA 3C6UB 1Y3JA 4DV5F 4WYBA 3O4WA 3WDOA 5B09A 3FZHA 3V6JA 2NSCA 3WUHA 2V67A 3A3OB 3AGRA 1WBDA 4Y1CA 3ZZRA 3S3NA 3OTDA 2P9IA 4GRSA 2R8GA 5ADZA 1NOZA 1LK5A 3D7SB 5D4NA 3U1MA 2MJUA 1X5TA 1YBUA 4DR1F 4IZ9A 1WEYA 4DR7F 2ZJQL 4NLWA 4PKIA 3H2LA 4F3MA 3HFVA 4ICLA 2YHXA 3OL6A 3PR5B 2DHAA 5L39A 4W92B 1DRZA 1IBMK 1MU2A 4J9MA 4DL4A 3BO2A 4NLQA 3IWXA 2A2CA 4FJ5A 1NCLA 1KVAA 6FDRA 5EWEA 4ZVOB 3WHIA 2KRRA 1Y64A 1VC0A 2KB2A 4JNEA 5HJXA 4K41A 2R7YA 1HNZK 2AJ2A 1A7GE 2HGLA 3J80O 2XY7A 4U67L 1RTIB 2E6MA 1TK8A 2MXYA 3ZTOA 3MN5A 4XO0A 3K2PA 2RQMA 1YHQS 2ZKTA 1TL3A 3MWPA 5KI6A 2APOA 2WK4A 1TUYA 3FUYA 1CXQA 1U26A 1B7YB 1QE1A 1RDUA 2W2NP 1O8BA 1S6PA 1K1QA 2VOPA 3AA4A 4O23A 1NJIO 4B9SA 4DUZK 4ZVTB 4USIA 5BYQA 3FVYA 1RDDA 1VBKA 2YWKA 1DAXA 3OYMA 2PO4A 4Z4FA 1RP5A 3A8KA 3JXOA 1IKVB 4FJIA 3LTOA 2QKKA 1PCAA 2ZVSA 1EARA 3O4NA 2DNOA 3ENQA 3MN6A 2FLNA 3I4HX 1F3VA 5B0DA 1NK7A 2JDJA 3C94A 4OKKA 4ILLA 2H1YA 2H5EA 1RISA 1U1QA 5IZHA 4CFBA 3QESA 3UFCX 2NRXA 3UCUP 5GAGU 2EVZA 5JMNA 3QEVA 1S1UA 3G0ZA 3K5NA 1IBCB 3PO4A 2GJ2A 1SUQB 2M88A 3MEGA 3A3PB 3I82A 3PW4A 1DTTB 4MIAA 2HYIB 4CEDA 4LF9K 2YI1A 1U25A 2G2OA 5KFDA 1TKXA 2CZ4A 4DUYK 2ZZTA 4ZLLA 3KKRA 3S1TA 3P1GA 1U7LA 2MHEA 1ELOA 3A8JA 4NA1A 1QHTA 4JI1J 3V9UA 3M8PB 2GMJA 1C1BA 3ENBA 3L6QA 2HVEA 3AH6A 1S1TB 4GVBB 1ZBLA 4LF5J 1LOUA 1F5CA 3Q24A 3D0IE 2CVIA 2UUBK 3R5GA 5J2NB 5JUMA 3I5BA 1NMEB 5A8KA 1GX5A 2ZNZA 1NDKA 5KFKA 2D9PA 2BR0A 4WFNL 1R43A 3CCEN 1WEZA 1U1RA 1FFSB 1X5SA 3RZAA 3GJSB 3GQCA 2VICA 3RB3A 2ITMA 1TL1A 4JI4F 2JSXA 5C42B 3W5ZA 3I31A 3FC9A 3KLIB 5KFEA 1PG5B 4JK7A 4I6MB 2IM3A 3EPGA 1NU0A 1NKBA 4O3QA 7FD1A 3PY8A 4TQRA 4PYDA 1YUWA 1QHAA 1YX2A 2DGWA 4X84A 4U96A 4DV4K 1YK9A 4B3SJ 2WOMA 2ROPA 5JS2A 2H4YB 1IJJA 4DV2J 4CJVA 3O3FA 1M5HA 2YNFA 4RNNA 5IV3A 3AVLA 4W5QA 5IWAK 4DU8A 2YJEA 4PWDA 3OYBA 2BE7D 2G0IA 4MO5A 3L2UA 4JI3K 4OI3A 3IFRA 1U2VB 2Z57B 1UVIA 1HNZJ 1PILA 1FXLA 3OXLA 5D4LA 4ID5B 2GGPB 2J76E 4LRFA 3GDQA 3MMVA 2HBQB 4JHDA 1FKPA 3PJWA 3GMGA 4LRDA 2OTLS 2QLWA 1B9FA 2HHXA 3I33A 3TX8A 2BJ3A 2I8EA 3BQ0A 1X7VA 4AUKA 1IG8A 5HSPA 1QQMA 1M1KO 2RF2B 2AJ0A 2OFGX 1ROFA 1FJ7A 2YQ0A 1TAQA 2KT3A 4XK8C 3THYB 2QJ3A 1CJUA 3HHNB 3HVRA 4OHZA 3X3UA 4RU9A 3AV9A 1C0TB 5FRMA 2C2EA 5LMNF 2HQCA 4BBYA 4RUAA 2D4WA 1U45A 1CPZA 3CCVN 4ZIVA 2MQ8A 4A5BA 4I6WA 1Z1ZA 1SJ3P 4JUZA 1UWBB 2V2ZA 3KHYA 3N5FA 4DX7A 4CLSA 1NBEB 5F8GA 1VSEA 1FRLA 3HT0A 1YAGA 3TZWA 2KRBA 4CCHA 2WUSA 3T41A 3QBCA 3UDCA 2NSBA 4ID8A 3U4LA 1WC3A 4RU2A 2DRBA 3AT1B 3O9UA 1ZZFA 4NLDA 4BRNA 4ENOA 4CEBA 1MN9A 5T7LA 4DG1A 1UJ5A 4O3SA 4DTNA 3G6EN 2GELA 4O3OA 4FLXA 2KYXA 1URRA 2L48A 3FMBA 4WIQA 4Y2AA 5AQPA 3SDEB 1U4BA 1KVBA 3KVGA 2BV3A 1QAJA 1DKGD 4JI5J 2ZF5O 3LALA 3A3NB 4K5SA 3KZBA 3QGHA 3PX0A 2G13A 1KVKA 4BC7A 4BR7A 2RS2A 3IAS9 3NCIA 5FJ4A 3K59A 4HH1A 2A3ZA 4JK9A 1NNEA 4ZTJA 2FPHX 1FDAA 2QFJA 3PV8A 3W65A 4Q43A 4QW9A 3ZX3A 4DI6A 3PYDA 3D2FB 1G15A 4DTPA 4E3SA 3VAHA 4DL0C 4U7CA 3C2PA 5GAGP 3FQKA 1X4FA 2OTJN 4NI2A 4HDGA 2Q6CA 2VPXB 3R6GB 3CETA 2A1SA 3C6AA 1H7WA 3OTBA 3OTEA 2P9KB 1YITN 1VQ4S 4PG8A 2WAQD 2BQUA 1OYDA 3DKDA 5JVHQ 4TVAB 4AHUA 3PW2A 5E3PA 3DLRA 4OZ2A 2EEYA 4FZXC 2PSZA 4QIFA 4JI8K 3JYTB 2DFFA 1N5SA 2BOAA 2PA3A 2D5RA 1NG9A 1I94F 4RWTA 1YGYA 1LWCB 2L3MA 2RIJA 3M32A 4DMZA 3OTOJ 3CJKA 1NJWA 1WKLA 3CXCR 2NLWA 4DV1F 2QGFB 2JEIA 5ITHA 3MMCB 5BR8J 4JHDB 5ETQA 3VQ6A 4B3OB 3OS1A 1C2PA 2A41A 2XYPB 2FBYA 1T11A 2IRXA 1EHWA 4HHTA 3MAHA 4ANCA 4JI0J 5IT9O 4E7IA 3PIPL 3BGRA 3G8TA 2NRVA 3OSNA 3KMQA 3HHLA 3VETA 4IQMA 1PC4A 2PEBA 4CO4A 5KFQA 2W6KA 3DOKB 2ZH5A 2PMZD 1S1VB 2NYIA 4CLTA 1SUQA 2D9OA 2NZTA 1VQYA 4NA2A 4K8RA 5A2QY 4MT1A 4HHUA 4CZHA 2KVQE 3G2XA 4L72B 4JKFA 3KJQB 3V6HA 4ELUA 4QIVA 1RJJA 1TZ0A 2XG8A 1UL3A 2YHWA 1PJ7A 2HBRB 1NPPA 2Z8QA 5M2RA 1SKRA 3R7BB 5IXUA 2HURA 3OVAA 5J2NA 2A2DA 4DR1K 3HZEA 2QLJB 4Q5VA 2LA6A 1RHUB 5JXSA 1XNRF 1MA9B 1XWLA 2EBEA 2O01C 3EVWA 4P73A 3NCQA 4C0OC 3BSOA 1P8ZA 4LF7J 4ED0A 3DI6B 9RUBA 4QAGA 1SC1B 2MKSA 3NH1A 2AJ4A 2BABA 5A6WA 5AZJB 1X0PA 4OLPA 4M42A 3UO0A 3AVCA 3DLGB 3M6UA 4B9VA 1EKEA 2DR9A 3RBXA 2V7YA 4K4XA 4HR2A 3HZ6A 3CCLN 3M32B 1BDGA 4I7FB 1Y00A 2A0FB 3SIPB 3AO5A 3VA0A 2WVEA 1FKAF 2YHBA 3TSQA 4K4SA 1A5VA 4CTAB 4EEYA 2V8GA 1PIEA 3BDEA 1FD8A 2W25A 1HKBA 3SQGA 5CCMA 1IBKK 2KO1A 2PZSA 5HQLA 1FFGB 2XMKA 3GE1A 2XZTB 4O4GA 1C4CA 5AE1A 2XCPA 4DV2F 2HQDA 3IGVA 2UXCF 3VCDA 1MMDA 2FJDB 4W5NA 4FJKA 4F2RA 2D0AA 2DY4A 4OZ3A 3IS9B 1VRUA 2FLPA 2UU9F 1RDAA 3GLJA 5F0UA 4B3TF 4B9UA 3OW2R 5GAEU 5IT0A 3VAFA 3BN4A 2ZH7A 3IAM9 4N47A 4F4AA 3NH2A 2HFZA 5J1EA 2IM0A 4ECZA 2X1FA 1TUGB 4OX9F 2NRRA 4BRLA 2GVZA 3BB5A 5KFOA 4X65K 1H38A 5HO4A 3C8YA 3G87A 2J8AA 1VAZA 5I3UA 1VCTA 3RSEA 2G8KA 3M6XA 1N34F 1S9GB 1T6CA 1LWEA 1T03B 3SSRA 1J27A 1YVUA 4H5RA 3GJRB 2AA4A 3QWPA 2Q36A 1HPMA 1S1XB 3AARA 3VQ5A 3P45B 3PIOQ 3WQPA 3H3NO 3D6HB 1H2TZ 1RWXB 2ZJRL 2HBMA 2ZOMA 3KYLA 4WFAQ 1V5VA 2M8HA 1G2EA 3L2QA 5I3QA 5KFCA 2IIHA 4ELVA 3MDQA 4XPEA 2EFVA 4ID1A 1A5XA 4Q8FA 4LR7A 4GNIA 4CLKA 3OBIA 3RMBA 1HJOA 3V1OA 2XSJA 3TNVA 4O0IA 2NUUG 3RGIA 4RW7B 3AQOA 3AA9A 2OI2A 1IQTA 4E98A 1KSPA 4Z2XA 2UU9K 2HBKA 1RAEB 1LKZA 3MPDA 2BGGA 1B3TA 4E89A 3BREA 2E20A 2F9WA 3FCHA 1WKJA 2QX0A 4ZPBA 1HWLA 1HW8A 1ZA1B 2F63A 2YHAA 4GKJF 3O4QA 2MZQA 2QG9B 3AOCA 3ZT2A 1QZ6A 5CE3A 2E2QA 4AHRA 2C2NA 2EFNA 3CEDA 4RR5A 2EKYA 5SWMA 4ZPWR 4K4ZA 1CEZA 3H6EA 3B8HA 8RUCA 1XQIA 3WX4A 1TFYA 4Q8EA 4ED2A 3DRPA 2ZM6J 5B0AA 5JJBA 1NJXA 4O8UA 2ASMA 3ENVA 4YORA 4RW9B 4YS2A 3BPSP 4N77A 3ZC4A 3I56S 2Y1IA 2M3DA 1L3VA 4KV8B 5KGWA 4MO4A 2O8BB 2QO3A 1KNZA 4YOWA 1IBMJ 2P9UA 3TZZA 4V1Ak 2E4LA 1K0VA 5FLXO 4URQU 1N32F 4ZVQB 1CJKA 2IM1A 2DR8A 5DM7Q 1NJIT 5K20B 2IVNA 3RU0A 3GJTB 1Q95G 5KFBA 3EGWB 3NG8A 3G9CA 5KAKA 2VDHA 3HPOA 1WORA 3IRXA 1QVGM 3WT0A 3MCMA 3A12A 3HSCA 1Y5IB 4FK0A 4BR2A 1T3OA 2Z2YB 1VQ9S 3C65A 5IT9U 1VHXA 3SZ2A 2MEWA 2MLYA 2MHNA 3GILA 2XS7A 2HQ3A 1BC6A 3U27A 4LIRA 1TV6B 4P2MA 3QAUA 3HULA 3D5MA 4DU7A 1EAYC 5H1SQ 3T1YK 2CRLA 4USTA 1S6OA 4KPCA 3ZX2A 1SC6A 2UUWA 4ECTA 3HL8A 3OPKA 4C8LA 3Q8VA 3I87A 1AT1B 1U02A 4WP3A 2C3UA 4IJNA 4A8YA 4YDXA 2OTJS 2R7SA 2B4VA 1EETA 2IRUA 3C15A 3OYNA 2C2MB 1XNRK 1YITS 3RW6A 1X9SA 1LW2A 3TR5A 1RT6B 3GV8B 3MCPA 4PG7A 1PJ6A 4OO1J 3CM6A 1YIJN 1NB2A 3PLAA 1Q7YT 3VMFB 5FD1A 4LFBF 1QD1A 3PX6A 2EK1A 4RW4B 4KRFA 2BBEA 2OCEA 4B3MF 3S3MA 1HBNA 4C3LA 3I96A 5EHHA 2O5DA 4NO7A 1HFEL 4LSLA 1GMVA 1IBLK 4FWQA 2H5JB 3HFKA 2AYBA 4EFAC 2CPIA 4OYPA 2FSJA 2AGPA 1GQEA 1XMBA 4G1PA 3PYFA 5J2PA 4RUHA 3DCAA 2CQGA 4FK4A 4CLWA 4DKWA 4C0HA 1IKVA 2D1CA 5M2PA 4NCGA 1H73A 3N6NA 1FVSA 2UZAA 3ZZZA 1RWKB 3QIPB 4B8AB 4KKOB 2GNKA 4C11A 4X4SA 2KH9A 5FLXU 2HFNA 1OVQA 4MFBA 3L2RA 3OLBA 1S9EB 2ZUAA 3M2VB 1SV5A 3LP0A 2GW8A 2WZ1A 4J9QA 4NXNF 2IAJA 4ZLNA 2YWEA 4IFYB 3SPZA 1J6ZA 2Y1JA 3LAMA 3WZ0A 4JEPA 1PAEX 3N4PA 4NCAA 4X4RA 1C1CB 4FYVB 1YF5L 2JJ4D 1ZAWA 1HPZA 3CJTA 4NX9A 2AJFE 2HS0A 4AH9A 3MURP 3MM9B 3WC2A 3UDEA 1Z2LA 3DHWC 4JI7K 1F9HA 1E4GT 5J2QA 3GG1A 1W2BR 2J0QD 1VQPS 2FHOB 5HMZA 2QWMA 1LCUA 1SIWB 1YDLA 2HSEB 2IMOA 1ASVA 2CGJA 4PRFA 3UNGC 3CJ3A 1ATRA 5L38A 2CJQA 1G99A 1R0CB 3TAPA 4QR0A 1RT4A 2OMOA 4YOUA 3ZSQA 1U2CA 2IA6A 5EWGA 4RJVA 2FC9A 3VEVA 3O8WA 2ZH2A 2P9LB 5EY4A 4DPWA 4YOEA 3TVKA 3MXHP 1K47A 2XMMA 4CLUA 1A5WA 3DOLA 1S10A 4P74A 4H4KC 5HRNA 3NH0A 3M2UB 3H4DA 1BMQB 2ASJA 3KK2B 1CG2A 1TMJA 1SKSA 3QGPA 4JKGB 4CZMA 3PEHA 2GC8A 1M1KT 2GCFA 4G1QA 1IR2A 3C6TA 4G65A 3MMJA 3DNCA 4USHA 3W8GA 4G9ZA 2EPIA 4FF3A 4DR2K 1E6YA 2FC8A 3H3OB 3CF5L 4CLPA 4IRDA 3CFPA 1N4LA 2ILYA 2C2RA 4ALZA 1UAXA 2R2TA 4AM7A 5F8MA 2RT3A 4W98A 4CJTA 3W5XA 2LQBA 3MM6A 1VQ7S 3ZTQA 4ID5A 4DFJA 4DMNA 4KREA 3F9KA 5IT4A 5IM0A 3BSAA 2RMLA 5EOYA 1OH6A 3Q0AA 2YNGA 3LZIA 4YB1P 2QA4N 2FIUA 3K58A 4N76A 2O8BA 2HRUA 2W4DA 5CHCB 2CPXA 4CGHA 1X4GA 5CZVA 2QL9B 1KQGB 4LF8F 3IG1B 4P2XA 1CJTB 2WB4A 4FYWB 4MKVA 5L1IA 1RYSA 1KKHA 2Y1LB 4FJLA 3VGUA 4DV6F 3H59A 4HTUA 4DR6J 1GNKA 4J7CA 3MR6A 3LDLA 1WTFA 1U8WA 1Z05A 3N4QA 1RHRB 2IDLA 1B0VA 3CPEA 3ILIA 2V0NA 1Q81T 1Y9OA 3MI7X 2UVRA 2FJBB 2YX1A 2ZH1A 3NF8A 3CCUN 3KDOA 3JTPA 3TA1A 4OL8A 4QOTA 1EP4A 1R8PA 2HAFA 3MAAA 3MX2A 2KT5A 2DIUA 4ZCKA 4WIIA 1BIZA 3EY1A 1RAGB 1SXLA 3SQ2A 4CLLA 4DTUA 1VK0A 5I4MA 4DEZA 3MM5B 3SUPA 1TVRA 1Z26A 3H8YA 4DUTA 1IKYA 5ETSA 4LF1A 2UUBF 1C0GA 1M5SA 2Q0UA 1U1MA 1RADB 3UVJA 3CJAA 4BC9A 4UF4A 4C98A 1R0AA 2VL1A 1SJ4P 4KTZA 2MMYA 1KOHA 4G1QB 3N4WA 4CYUB 1VFJA 2OZSA 2OO4A 3I0SB 4BE1A 2JNJA 5H9EK 1NK5A 3H5UA 5K8NA 4URSA 4HWIA 2W9BA 1OQ3A 3TO8A 1REGX 4YN3B 4WTOB 2BE2A 2AEMA 1RTDA 1IJFB 4DFMA 3DLEA 1K8KA 3I8DA 4BRFA 2QFIA 3QRPA 2BH1A 3Q23A 4NYPA 1EWQA 5I42B 1VI7A 5GAEP 3AXKA 1Q9YA 1CZ9A 3R1LA 4P9SA 1SJRA 1H6KX 2IY5B 4ZOSA 3IXQA 3ENWA 4CHQA 2Y8WA 4OPJA 2RVJA 4QIEA 5ETOA 3N79A 3QO9B 5GAHU 2BRLA 3AFGA 2RDIA 2F40A 4W5TA 4LF4F 3Q86A 2CJYB 2WFBA 3K9KA 2CNNB 1UZHA 3SQGB 2J9DE 4CLFA 3VEWA 3OYAA 4LF6K 4NRTA 1VMBA 1FDDA 1FW6A 4C97A 2Z1HA 4WQ4A 4DV6K 3U1LA 4OX7A 4YB7A 4Z0UA 2J7UA 4CO5A 2BACA 1DURA 2VWKA 1RE1B 3TEHB 4L73A 2MSSA 1REVA 1BA1A 3DMJB 1VQ8N 1EQMA 1UVNA 3LF0A 1F6TA 4WQ4C 4JI7J 4NLBA 2GIFA 2RS8A 4P10A 5LL6Z 3V9XA 5ELZA 2F1FA 4IOCL 3QRQA 4FLWA 1YIJS 1VQMN 2OA8A 4RG8A 4Z7CA 3OHAA 3ATVA 3KTQA 1HBNB 3LP2A 1NHKL 3OBYA 4NEYA 4WFAL 2XMTA 1N34J 2V51B 1ZH5A 4CJFA 1RAAB 4LUBA 2DNLA 1ZAXA 4AHVA 3DLHA 3D6RA 4K2XA 4N7TA 3W66A 2P9PB 3M3ZA 4RW8A 2QV6A 1F9FA 1CJKB 2VBXA 4LVOP 3CC4N 1EJ7L 2X6SA 3ZCMA 1FX2A 2K2PA 3F9MA 2QEXN 4DUYF 3AVIA 4R8UA 4L75A 4K0KF 2CG8A 3TSUA 4IH5A 3O08A 1Y3KA 2XYGB 2E5GA 4MK9A 3H45C 4IYQA 3CDAA 1FTCA 1NO8A 3TUJC 4UY85 1B0PA 4KJIA 4JLHA 1R27B 1WC6A 2FY8A 2VFRA 4WBFA 4FKYA 5AQOA 4M5IA 1VQLN 4ZPVR 4U9RA 2E7XA 1HIYA 1FHTA 1OMSA 4O3RA 4JYAF 4FWPA 1B9DA 1YJ7A 3JB9k 1RT3B 4ZTFA 4NEZA 3EICA 2RRNA 1HBUB 5CD4A 2R7QA 4CEEA 4KGXB 2Q0RA 1YVFA 3GR1A 4MKBA 1WF0A 5DG7A 4NLXA 2HAIA 4OJ1A 5F9LA 5K9FA 2ZE2A 4M3YA 2DR7A 1J2VA 2D3OR 3TQEA 5HN0A 4ILMA 1FWLA 4H4OB 5AJ3J 1VQPN 4BQLA 4IFEA 4JOUA 2QC3A 2FJAB 4YP3A 3HFZB 4CESA 3GFXA 4UY8O 1WC1A 4RKUC 3KLGB 2YWHA 4K50A 4WP9A 5K14B 5AQHA 4OV1A 3OXGA 2LDIA 3I32A 4M5HA 3PIPQ 3R9PA 1KTQA 1IKWB 3UD4P 2VQEJ 2LEBA 3F2KA 3M2UA 2QTWA 3NCPA 2V5HG 2QWPA 5RUBA 1SJ1A 4C0BA 4LSNA 4CLYA 3GG0A 4UOGA 3AD7C 4KFBA 2DNRA 4C2MA 2IA0A 2HVHA 2K06A 2N3LA 3IWNC 3IRWP 4N56A 1JKHA 3CJ1A 3RB0A 3O9RA 3QJPA 1U47A 3UR0A 1UW9A 1IJEB 3TUIC 2X78A 3WIVA 4DV1K 5GMDA 3SCJE 3GG4A 5E3QA 1D8YA 4HEA9 4WU3A 2EX3A 3HP9A 1U48A 5BRFA 4TKTA 2ADCA 4LFAK 2OUGA 2Q3SA 1GXLA 5KOXA 1SS6A 5FRNA 4ZN3A 3O2IA 4BGAA 2LA4A 2HBLA 1T9VA 4DSJA 5H9FK 3DDIA 2IC3A 3N9UC 1QE1B 1ZBIA 4B3MK 2J8SA 3W64A 2AX0A 3J7Z5 4TYBA 4OLBA 3QT6A 2ASDA 1ZM4A 5GAHP 3GIRA 1UTAA 3MZIA 2ZJQQ 3VEYA 2YKNA 4DJBA 5C2GA 3S01A 4C3MA 3T3FA 3DDKA 3N0VA 4B3RJ 3HSJA 3VQAA 2ZD1B 3OYIA 1WACA 4CEQA 2QA4S 2RUGA 4PG6A 5IQQA 2G8UA 4LRBA 1NJYA 3QLHA 2AHOB 2U2FA 2G2ZA 3GB0A 4A62A 4IH6A 5J2PB 3H98A 4C8OA 1WSRA 2IJRA 4RX6A 4PR6A 5BR8K 2I38A 3W60A 1J53A 4JKEA 4EK2A 1FFWB 3LM2A 1R8CA 3IMQJ 2CQIA 1HHSA 2Z1GA 1KD1T 4UUXA 2CNLB 4BCAA 3IFEA 3KLHA 3UDLA 1J5OB 5ETKA 2XS5A 3CCUS 1EO1A 4C3KA 3O3LA 1TVRB 2HFUA 4BVPA 3NFAA 4H8KA 4DSIA 4X4OA 1Q5VA 2C2OB 2AX1A 3CULA 4FJ7A 4OPAA 3EZ5A 5T7BA 2V8DA 3RAQA 2JLEA 2N7YA 5G0RB 1T05A 2GWJA 3RSEB 3SQ1A 4EWTA 1RZMA 2W2PP 3OYGA 5KT4A 1WUAA 3J7ZO 2W42A 1KVIA 2CQDA 2QLFB 1CQNA 1JLAB 3SNNA 3OXFA 2DFEA 2HHTA 2O8CA 1K73O 4DPTA 2W4CA 1HKGA 3N6LA 1HMVA 3FZ2A 5DO2A 5F0WA 1MWKA 4BR5A 1FRIA 1D0EA 4YDUC 4GMKA 4J5OA 4NRUA 1SL0A 3AJ1A 1EQ0A 4HCCA 4OGEA 1HNXJ 2XNRA 1ATNA 1YJ9N 3CJKB 3HD1A 5KPZA 5DG9A 4B1VA 2CJKA 2G2YA 4M5DA 4LF7F 4CK2A 2MZJA 3M8QA 3VGVA 4FYXB 3NMUA 4LFCJ 2ZITA 1JXEA 1LNQA 2DGUA 4K5RA 2CPFA 2YV0X 4O0NA 3LO3A 5HVFA 2LXFA 4CK1A 4MK8A 3BKTA 5D0EA 2XC9A 5CD4H 4CGGA 2F3JA 4DTXA 3J81Y 2FSNA 3EUNA 2RDDA 1WSEA 2O8DB 4WJBA 2D0PA 4XIUA 2MQPA 4MDBA 4IO9Q 2EC0A 2O4GA 4ZA1A 1QAYA 3BV8A 4JKHA 1TL1B 3ZNUA 4EU0A 4DBQA 3V9ZA 2E2PA 1X4EA 1KFDA 1HBUA 2ZZNA 3KLIA 2NZCA 3P4IA 3ZSVA 1G7CB 4MKYA 2QMWA 2MKHA 4USKA 2DKOB 4CI0B 3GFZA 2VKZG 4JI4K 5DDRC 1LOTB 1S97A 3NF9A 4DCOB 4NLPA 4MLEA 4DR1J 4R5PA 3PHEA 2D0CA 2HMIA 5KG5A 1NU4A 2OPSB 3R6LB 4FK2A 1TYQB 1EXQA 3DXKA 3IG1A 3KLHB 3CD0A 5HROB 4ZVFA 4YMEA 3ETMA 3OS0A 2R2SA 2CA9A 4CGJA 1RTZA 4DR5F 1VISA 1ZYQA 2OPQA 3NRBA 3SAFA 4CJ4A 3FGVA 2AYEA 1VLOA 3M1FA 1RUSA 2WB1D 2W01A 4CJWA 3G6ES 2FBTA 3DOKA 2UXCK 3THWB 2F7TA 4PXDA 4FPBA 4QW8A 8AT1B 4ES1A 1UVLA 3FDSA 3Q8QB 1B64A 4E8UA 1OY8A 2Y9HA 3B6BA 4KHPF 4AD6A 4PABA 5EDWA 1F3FA 3ENOA 1VSIA 1KC8T 2XB2D 3M5RA 2I5JB 3BH6B 5D15A 2EHGA 2HRTA 4CZLA 3HCXA 5IC6B 1R31A 1Y0HA 1SV5B 4FF1A 1ZBTA 4WCEL 3HX9A 1LXJA 2HHWA 1RA7A 2UUAF 2E7VA 1FNOA 2GHWA 3JSMB 1IBKF 1JCFA 3GYGA 3RUBL 1VQ8S 1JLGA 4KT0C 3VAGA 1TELA 3QSIA 2PMWA 1C0FA 2OSQA 3JTOA 2CQHA 3H90A 3SYZA 5AQJA 2YQ3A 2ALZA 5THWA 3M6WA 1SC3B 4I67A 1S1WA 3RR7A 1BL3A 1VQMS 1C1CA 2ZD1A 3CI5A 3Q8UA 3BGLA 2E7WA 1QSLA 4FF4A 4FZYA 3TAFA 1VK8A 4EBCA 5FDLB 1RBRA 2HWHA 2VA3A 5LT5A 1T6DA 1X9JA 4FLUA 1VJWA 2DO4A 3SV3A 2W4PA 4GKJJ 5DZ7A 2V4QA 3UE2A 3ZZYA 4C1NK 2OPSA 2LQJA 3ET6A 3KLFB 3P5BP 3W2VB 4J9RA 2O8FB 2DNYA 3D1QA 5HROA 1EKSA 2AU0A 1IBLJ 5A2QU 1YRUA 3CCRS 4LQ9A 2HHSA 3GIKA 3D4JA 3S8SA 5CH7B 5J1PA 4ECVA 1RQ0A 3WEEA 3BF1A 1CC7A 4USWA 1JQGA 3BYRA 4ETXA 3W9HA 1Q82O 5AFUA 5LJ3Y 2G1HA 4O0JA 2BUPA 3DC2A 1S0NA 4RBTA 2WW4A 2B9EA 4ZPCA 4DR4J 4WF9Q 5AQNA 3QMQA 1HWKA 4RTFD 3BJYA 3TJ9A 4IXCA 3I0RB 1PJ5A 5E84A 3SPYA 1CS4A 4K43A 2YX4A 3MDFA 2YBVA 1KS2A 5BJRA 1YJTA 3R6MA 2VDIA 4FS2A 3DXMA 4CBXA 2DNGA 4C1NI 5M1KA 2ITGA 2A6AA 3SQ4A 3IMXA 4DZDA 4Z94A 2WBNA 1RT7B 1IXKA 1IUJA 1OY6A 3BGUA 1P27B 1F5BA 5M1NA 5E41A 2YY3A 3U9DA 3QT7A 3VQDA 3PJXA 1SH3A 3NBPB 3CDEA 4ITSA 1RHMB 2V69A 1H7XA 2LQ5A 1HD1A 3E01B 1Q82T 5IQ6A 3M8ZA 4TY8A 3HKZD 3R1XA 1W97L 4GVMA 1HHQA 2DR5A 2AP1A 5DG8A 5C7PA 5FDLA 3V5RA 2OEJA 4B08A 2FZGB 3BGRB 1QQNA 1V6HA 3EL2A 4B3MJ 2VH7A 3FLCO 4BWMA 4E1NA 3KLVA 2OSRA 1BWVA 3WNHA 5BPNA 3FSXA 1LWFA 2JHEA 5GVQA 4ILGB 4HUGA 3FMWA 3SQOP 4USVA 2V7ZA 3H1QA 3D66A 1BI4A 1KD1O 2O8DA 3DAWA 4DU1A 1N0UA 1JLQA 2DPIA 1BUXA 4CH7A 4H0PA 1RTJB 2D74B 4RBVA 1ZOTA 4DCPB 4DV1J 1RTHB 2ETJA 1LWCA 3LP2B 3W8PA 5D8HB 1MG7A 2I9SA 2N7CA 1TAUA 3CXCM 4GKKJ 3VVUA 4R79A 1DTQB 3QNWB 2DGQA 5EWFA 3HTVA 4QS9A 1W26A 5JMVA 1L3TA 3AAPA 5FIIA 2VCPA 4O55A 2E1MC 2GAHC 1L3SA 1W0HA 1U1KA 1FDNA 5DLFA 3S7RA 3MTJA 4PWUA 3CQYA 1WB9A 5J1EB 4Q0BA 1NK8A 4FLVA 4LT6A 1J5EK 3K5MA 5LSLA 2GIQA 5CR4A 1XMQJ 3G8SA 1YBAA 4HI2A 4PXEA 3H46O 1SJQA 3GOIA 2V52B 1JCGA 2MQOA 1JB0C 2LVWA 4L74A 3G96A 1NMDA 4DR3K 1JL1A 2V34A 1OSCA 2RKIA 1HARA 3G71S 3V4IA 2KG0A 5L8RC 5CQGA 3PJ9A 3LA0A 2HHVA 3GBTA 3UKRB