3LALA

Crystal structure of hiv-1 reverse transcriptase in complex with n1-ethyl pyrimidinedione non-nucleoside inhibitor
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
553
structure length
553
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title N1-Alkyl pyrimidinediones as non-nucleoside inhibitors of HIV-1 reverse transcriptase.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase
molecule keywords HIV Reverse transcriptase
total genus 157
structure length 553
sequence length 553
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3lalA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3lalA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3lalA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3lalA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3lalA05
3EZUA 4JV1A 2ZE2B 1S1UA 4QW8A 5I3UB 3FRZA 4KKOB 4CF1A 4CGDA 3AV9A 2JEGA 3OYFA 3DRRA 3M8QB 2O4IA 1ZBIA 2XCAA 3WNEA 3TAFA 3GIJA 3AA4A 3LP2A 4KHWA 1XHZA 3NDKA 3UIQA 3KD1E 4CHOA 1T05A 3RWUA 3PX6A 3T1AA 3DM2A 1A5XA 4IG3A 4TY8B 4IBNA 5C24B 4ZMMA 2VG6A 3EPIA 3VA3A 3ZSXA 3H59A 2ASJA 4DG1A 3NE6A 4OGEA 3CFRA 4M41A 1QAIA 1JXEA 5C25A 4I2QB 1FK9B 2VWKA 4RW9B 2RKIB 4M95A 2XC9A 4FLYA 2QKKA 4CJ4A 4BE2A 1VSHA 3AVCA 4CJSA 1JLBA 3T5LA 1UA0A 4OGCA 2JEJA 2ATQA 4O3OA 5KT3A 5C24A 1TK5A 2YHAA 1RDRA 2KFNA 3DLHA 4B9VA 3OL9A 3QZ8A 5KRSA 2XGPA 2G8WA 3NH2A 4K4XA 4F3TA 1Z26A 3JSMA 3TAPA 3RRHA 1RT2B 3CM6A 1KFSA 4QCLA 3AVAA 2R7YA 2HHUA 4Z4EA 4F4WA 2AGOA 3O4NA 4CGHA 4J9QA 1WN7A 2FVPA 4DTUA 4IH6A 3RR8A 3I0SB 3NGYA 3AVJA 3G6VA 3RB0A 3PY8A 3OS2A 3BSCA 4E7JA 4FS2A 2W9CB 4TY9A 3CO9A 3WNFA 4JUZA 4O3RA 3E01A 2EC0A 3KK3A 2AJQA 4YR0A 4E19A 3C6TA 5KFGA 3VQSA 5EDWA 2HHXA 3GIKA 4CEBA 1EETA 1ASUA 1RT3A 3KK3B 3IRXB 4CGFA 3O3FA 4DTPA 4ICLA 3SQ0A 3DLBA 4F2SA 1B9FA 3K57A 4KHUA 4CEDA 2XY6A 3VQ8A 1HYVA 4OVLA 2P51A 4ID5A 1JLFB 1C0TA 4LY7A 4DLGA 5J2MB 4I7FA 3HO1A 1TL1B 1BQMA 4ECWA 1ZETA 5CYMB 2HNYA 4U7CA 4NYNA 3DLGB 3CFPA 3PW0A 4IH5A 2FVRA 3F9KA 4B9UA 2FLNA 2R8HA 3D5MA 3CIZA 3NF8A 4YMEA 4FM0A 4R0EA 1W9HA 1RT6B 4C8LA 3RMAA 1K6YA 4DTJA 3HP9A 1QE1A 4ED0A 4OKKA 1SKSA 3GQCA 2V9WA 4LSLB 2RN2A 4EZ6A 2F8TA 3OVNA 4LH4A 1C1CB 1SL0A 1WSHA 3OYAA 3NGIA 4FM1A 3VQQA 1JLQA 4FJIA 2W8LA 1S0NA 2VG5B 4DQIA 3VQCA 4IRKA 5JS2A 3CWJA 5KFQA 4B9LA 4CK2A 5T7BA 4LSNB 3OYIA 5D3GB 4Y2AA 4LSNA 3QESA 3TAEA 5KT6A 1TV6A 2EX3A 3SPZA 3QGHA 3ZSZA 1N5YA 1RA6A 3L2QA 3KKRA 4N5SA 4DL4A 2BQ3A 4DU3A 4YNQA 3P1GA 3V81B 4HVJA 4C8MA 4NCAA 2WRMA 1IG9A 2D0CA 1J5OA 3IAYA 4B3OB 3E51A 4FJLA 2D0BA 4FJMA 1YVUA 1L3VA 3UQSA 1U48A 4MK8A 2WB4A 1UOCA 3SUNA 1SKRA 3IG1B 1DTTA 1QAJA 1SV5B 4Z4GA 4FM2A 1W25A 4NLWA 4TQRA 5KFYA 2BRLA 5FDLB 2OPPA 4CGJA 3LP2B 3LP3A 1JLGA 1HNVA 4FBUA 4TLRA 2DPJA 4KTZA 2BDPA 2UUWA 4DTOA 4EO8A 4CIFA 3RBEA 3BQ2A 1NOYA 1KHWA 4ZVHA 2IAJA 4OKJA 2IS3A 1GX6A 1WNEA 3CJ5A 2XO7A 1U09A 1U04A 1CXQA 3O3HA 3TWHA 1HQUA 2DY4A 4BE0A 3QEXA 1S97A 1XR5A 5J2MA 2ILZA 3RAQA 4FBTA 1HYZA 4NLSA 2F8SA 2OPQA 3P5JA 3SCXA 3MECA 4OL8A 4RW6A 4IRCA 1TKXB 5EWEA 4B9TA 1S6QB 5HROA 1RDBA 4M3ZA 1D0EA 3C6UA 3DLEB 1B92A 3PJXA 3OYGA 2GIQA 4KE5A 1RT4A 1QSSA 4O0IA 2HAIA 5CY4A 3QEWA 2X6NA 3OL8A 1HQEB 3DYAA 2OPRB 2AX0A 2G8FA 2P1JA 2D7SA 4JLHA 3SV4A 5HLFA 2C22A 4WFXA 4N76A 4KI6A 3VQEA 4OLBA 4RNNA 2W8KA 3JSMB 2XGQA 2QXFA 1X9WA 5L1JA 3M9OB 4K50A 1HJRA 3AO4A 4FLWA 2R2SA 4FW1A 1N48A 3V81A 3T5KA 4LD0A 3S3MA 3HXMA 4H8KA 4HTUA 3KHRA 4CERA 1TAQA 1VK0A 3VQDA 5FRMA 2X74A 2WK4A 1RT7B 2G8IA 4CJQA 4RZRA 3KMQA 4KSEB 4CK3A 1VRTB 3MEEA 4M42A 4R5PA 4F3OA 1TV6B 1S0MA 2UVVA 3N6NA 2B6AB 1WSEA 4NYZA 4ECSA 5KFAA 1NJZA 3ZT0A 3DOKB 4IR1A 5J2QA 3SFGA 3U3YA 1VSEA 3DOLB 5I42B 3QO9A 4ZP7A 2KZMA 1BL3A 3OYBA 1L3UA 4ZHRA 2ASLA 4CHNA 1RTJB 3A2FA 1FKOA 1VSKA 4EP5A 3NH1A 3F73A 1SH0A 1JLGB 1HNVB 3OLAA 4B9MA 3WNGA 2D41A 5HBMB 4BDYA 4KHNA 1CZ9A 2XI3A 4ZPDA 3NMAA 1NK0A 4DSLA 3HP6A 1BQNB 4Q5VA 4Q45A 3B6OA 4N41A 3QYYA 3QO9B 2HNYB 3MFIA 4J9SA 3QNNA 5I3UA 4NLUA 4ED6A 4LSLA 4W5OA 2J6TA 4ZP8A 4DEZA 4XIUA 1DLOA 3VQ6A 1S9FA 1TAUA 1S9GB 5HROB 4Q0BB 3NGDA 3NBPA 4DL6A 3AA3A 5KFBA 2FVCA 4KHSA 2FLPA 1ASVA 3DYAB 2BANA 5J1EA 1BHLA 2QKBA 1HPZA 3DMJA 1NHVA 1XC9A 3HVAA 2FLLA 4CJUA 3CJ0A 4E0DA 1IKWB 5DG8A 1ZTWA 4IFYA 1RBSA 1B9DA 3LAKA 2IJNA 3L2WA 1R0AB 2G8UA 1DLOB 5KFDA 2OYQA 4QWAA 3AVKA 4DQQA 3V9XA 4ED8A 1I39A 3BGRA 3V9SA 4E7HA 2R8GA 4MK7A 1RILA 1QS4A 2HNDA 1NKBA 1XWLA 4KFBB 4RW8A 3NF9A 1RT5A 1LV5A 5FRNA 5DLFA 4M3RA 4HCCA 2JC0A 2XI2A 4IDKB 4DU4A 3OYMA 4O0JA 4KI4A 4E7LA 3C95A 5L1KA 3OYJA 5JXSA 4R8UB 4EBEA 2ITGA 2UVRA 1RTJA 4EYIB 2GBZA 3QLHA 3LZIA 3CDUA 5I42A 1REVA 4MKBA 2IDOA 4DS4A 4IKAA 4F4ZA 4Y1DA 3TAQA 3LP0B 1TKZB 3KLGB 2V4RA 1K1SA 4ZP9A 4CJTA 3MECB 1T8EA 1YVFA 5FDLA 5DGAA 4K4YA 4TSXA 4XPCA 4CGIA 4HHTA 1J5OB 3PJWA 2IGIA 4CESA 1RBRA 1RT7A 5KG2A 1L5UA 4QWEA 3KTQA 3SNNA 2O5DA 1JLEB 2UUTA 3AA5X 5HBMA 4ECTA 3C94A 4CEAA 2PYLA 3AVIA 2OPPB 2RPIA 1LWCA 3HPHA 3VQ5A 2HWIA 4ZP6A 1WLJA 3PUFA 4NLYA 1VSIA 1LW0A 4DSIA 2BR0A 2R8KA 3M8QA 1RAJA 3ZSOA 3QGIA 2GC8A 5KFJA 1A5WA 3K5MA 4CHPA 4FZYA 3TVKA 1C1CA 4DL5A 4DSEA 4RW4A 1NK6A 3QINA 4QWDA 2E6MA 4I9QA 4CEFA 3EPGA 3LWLA 3QNOA 3QERA 1VRUA 2W7PA 4HUGA 4IOBA 1O1WA 3C6UB 3LPTA 4J2DA 1NKCA 2G8KA 4ECZA 4H4OB 2YNIB 1LWFB 2Z1IA 3L2VA 3ZSVA 1NKEA 2DFHA 5KG5A 1JIHA 4TXSA 4KB7A 4J9PA 3MEEB 4G1QB 3KIOA 4DF4A 1SL1A 3JYTB 4HCBA 4Z4IA 5KFMA 2HNZA 1RTIA 4E1MA 3QZ7A 2DTUA 5DGBA 4LH5A 2W9BA 5KTQA 4QOZB 4WFZA 5KFVA 4CJVA 1KRPA 4CEOA 3NAIA 3QIPA 2FJWA 2IC3A 4J9OA 1CSJA 1HMVB 3ISNC 4CF8A 2GUIA 4K8XA 4Z4CA 4KHRA 1U45A 1NK8A 3ZSQA 1UAXA 4YR3A 2AX1A 2HVHA 3HVTB 3H4DA 2HHTA 4RNMA 1JLAA 4EP4A 2Y1JA 3KK2A 1S1VA 5KFUA 4C8OA 3NH0A 2WOMB 5L1LA 2E9TA 4B3OA 2I5JA 3ZT4A 4O44A 3AVBA 3ZSRA 1J9AA 3TAMA 3QGGA 4G3IA 4URSA 1CLQA 3KLFA 4W5TA 2C2DA 4JV0A 5CYQA 3MF5A 5KFLA 4KB1A 1NOZA 4MIAA 3TAMB 4FLVA 3D45A 3L3VA 3MFHA 5C25B 5E41A 1LW2B 3PX4A 3KHLA 3LWMA 1SV5A 4JRQA 1S1VB 1TVRB 1JLQB 1I6JA 4IFVB 4NCGB 4F4YA 3VQ9A 2IMWP 4E1NA 2XHBA 1NJXA 2WTFA 3I5BA 4F4XA 2FC0A 1NHUA 4NLPA 1L3SA 3SUPA 3DDKA 1FK9A 3S9HA 5KFSA 4EEYA 1HYSB 2W9BB 4IH7A 2VA2A 2VA3A 5CYMA 1RTDA 1NJYA 1S1TB 4DTXA 3DI6B 5J2QB 3LZJA 4DTNA 4CJ5A 1U49A 1HNIB 2ASDA 1IKYB 4RW7B 4RNHA 1KSPA 5D3GA 3CDWA 4DQRA 3M8PA 3U3GA 4CF9A 1N6QA 2C2RA 1BGXT 1N4LA 3GIIA 4DQPA 4EZ9A 1EX4A 3DRRB 4OLAA 4DTSA 3HHKA 4ZPAA 1TKTB 4J9KA 4ECYA 3VQ4A 1EETB 3T3FA 4GC6A 1RTHA 4J9LA 4H4MA 3VA0A 4HUFA 5K14B 1BIUA 4K8ZA 5KFCA 4FLUA 4XPEA 3TABA 3CJ4A 4N56A 1D9FA 3HVTA 1Q9YA 2UVWA 3L2RA 1KTQA 2FBVA 4NLQA 5C5JA 2PZSA 1TKDA 2BGGA 4KKOA 4I7FB 3H5XA 2IM0A 4E7KA 1S10A 2LSNA 5HRRA 1ITGA 3AVFA 4DSKA 3Q8PB 1NK4A 5C42B 4YFUA 2YNHB 4B8CA 3VQBA 3PZPA 2WCXA 4M45A 4FLZA 5HRPA 1C6VA 1ZBHA 3LDSA 2YHBA 3KLVA 5KT7A 3SUOA 3ZT1A 3U6FA 2YKNA 2AQ4A 2WOMA 3KHHA 4J9NA 4M3YA 3NBPB 3DLKA 3KJVB 4KB0A 4ECUA 4DL7A 3DLEA 2VG7A 2FJVA 2A1SA 1VRUB 3JYTA 3Q8SB 2ILYA 3BJYA 4YP3A 3KJVA 4CJPA 2HWHA 3WNHA 3OS0A 1KHVA 5F8IA 3DMJB 2R8IA 3LP1A 1LWFA 1JLCA 4JS4A 1JKHB 2VWJA 3QETA 4Z4FA 1U47A 2G8HA 5JUMA 1JL1A 3CG7A 2RF2B 1S9GA 4JS5A 1UWBB 2E9ZA 1GOBA 4EYHB 4ZVFA 4G1QA 4HUEA 4QWCA 2R8JA 5F8JA 1C0UB 4FYDA 2HB5A 4EO6A 4NYFA 4M3WA 5J2NA 3K5NA 2HVIA 3SUQA 1WAFA 3KLIB 3KNAA 4DS5A 3OY9A 4ECQA 4KO0B 5KFKA 4Q8FA 4U6PA 3PR4A 4LQ9A 2Z1JA 4RUAA 4ID1A 1VSDA 5KFFA 2KTQA 1D9DA 2I1RA 4JRPA 2B6AA 3LP0A 1TL3A 3K5OA 5CZ1A 2HMIB 3NAEA 3VQPA 3OL7A 1JLEA 5KFRA 1HARA 3I0RB 4PWDB 2BRKA 1F21A 3KLFB 3I0RA 4PWDA 4B9SA 3GV5B 1LW0B 3ULDA 3SQ2A 4ED2A 4MKAA 4CE9A 2AGPA 3UDLA 4JV2A 3UPFA 4FCYA 3SQ4A 3IGNA 5KFPA 5KG1A 3CVKA 4O3QA 3NFAA 4J9MA 3RMDA 5KI6A 2AWZA 4KREA 4FK0A 5CYQB 2BQRA 3V9WA 1QSLA 4CEQA 4H54A 2YNHA 3RAXA 2VG6B 1WSGA 4AHVA 5DK5A 2OPRA 3LPUA 1T05B 4ELTA 1CZBA 1G15A 1C0TB 4ZVGA 4ID5B 3UR0A 4DTMA 4O44B 1RDAA 4ED3A 2Z1GA 2BE2A 4KV8B 4K4VA 3SZ2A 3TARA 3KLGA 3AO5A 4NLGA 1X1PA 1S1XA 4FVMA 3THVA 1S9EA 3PHEA 3I5AA 2RF2A 4PUOA 1GOCA 2D3UA 2YV0X 1RBTA 1RYSA 2RDIA 1TKXA 4ZVEA 2ETJA 4C8NA 3M9NB 1JLCB 1WNSA 3G10A 3HL8A 4KHMA 1JLFA 1RTHB 3MR6A 1S6PB 3TAGA 4CHYA 3QEIA 4H4OA 3EY1A 1TKTA 3G6XA 3RTVA 2QE5A 3MXMA 1RNHA 4Z0UA 4IFYB 4OPKA 4WXWA 4FZZA 2FJXA 1ZBLA 5EWFA 4QAGA 2OH2A 4CFBA 2IA6A 1ZBUA 3H5SA 2P5OA 1OS5A 1KLMB 3M8SA 2V0NA 2G8VA 4C8KA 4DFPA 3IG1A 1IKXB 5KGWA 2WONB 2Z1HA 3QEVA 3MXJA 5KFZA 3OYLA 3GILA 2YNFA 4BDZA 4EBCA 4M94A 1IKVB 5J2PA 2E9RX 1VSMA 5KFEA 2HNDB 4ED7A 2RDJA 3PW4A 2IC3B 4KAZA 5KG7A 1J53A 3V6HA 1IH7A 3PV8A 2YNGA 3IS9B 1MU2B 1SUQB 3RB3A 2C28A 2D0AA 1RTIB 2F8EX 4NLXA 4DFJA 3KK1B 4CECA 1NK9A 5F8NA 4GMJB 3GV8B 3ITHB 3KD5E 2B4JA 3OJSA 5K14A 4I2QA 3S3OA 3SV3A 1ZYQA 4R5PB 3K59A 4NRTA 3HPGA 3BSNA 1W0HA 2D5RA 4ELUA 4CFAA 2OZMA 1C2PA 2YKMA 2ZD1A 2J6UA 3RBDA 4QPXA 4ECXA 3SQ1A 1HYSA 3OYKA 3PW5A 3HSTB 1A5VA 3EZ5A 4IG0B 1I3AA 3T19A 1S5JA 4NLDA 1LWEA 1RT6A 3V4IB 4CIGA 3KK2B 5JS1A 3BQ1A 4CEEA 1T03B 3DI6A 2Y1IA 1C1BA 3NAHA 2B5JB 4FXDA 1C1BB 3OYHA 3RB6A 3G0ZA 5KGXA 4TY8A 3M8RA 4O3PA 4CK1A 4FJJA 4OPJA 3MEDA 2HW3A 4CIEA 4CEZA 3MR2A 3QIPB 4CJLA 2V4QA 3AVGA 4E89A 1TK8A 3AVNA 1XR6A 5KT2A 1C0UA 5J2PB 4TYAA 4NLVA 2EHGA 1UWBA 4DL3A 2JEFA 4ZHRB 3HVWA 3Q8QB 1IKWA 4IFVA 1C0MA 3QLHB 4NLTA 4OJRA 4W5RA 1TGOA 1NK5A 3DOLA 1IO2A 2XRIA 4MH8A 4QW9A 1N5YB 3FDSA 5L1IA 5DLGA 1S1UB 2OPSA 2XY7A 4DF8A 4O55A 4NRUA 5KFNA 4RNFA 1KVBA 1SH3A 1NNDA 3RB4A 4FJGA 4O4GB 4DTRA 3KK1A 4ECVA 3VQAA 3SJJA 1JLAB 1Z25A 3PR5B 4GW6A 3ZCMA 4AHTA 1RT5B 4M3UA 5DG7A 2IJFA 4FLXA 4PY5A 4NLOA 3DRPB 3HM9A 3AO2A 3K58A 5KG3A 2OPSB 4F50A 3NL0A 4KTWA 3OJUA 3I0SA 4CGGA 2PYJA 3FQKA 1RBVA 3N6MA 3E01B 3M9MB 4ZPBA 4PQUB 4BDPA 3OSPA 3PO4A 1TQLA 2X78A 5F9NA 2WONA 2FVQA 1QQCA 3CM5A 3GYNA 1LWCB 1D1UA 4E3SA 2W7OA 1HMVA 1Z4UA 3H08A 1IM4A 4URQU 5KG4A 4FW2A 2HHSA 4UQGA 5KFXA 1EP4A 5SWMA 1RBUA 3BSAA 4YR2A 1TL3B 4B8AB 4E7IA 1KVAA 3NKYA 4QWBA 3OYCA 3CYMA 1SL2A 2JC1A 3ICLA 4KAIA 3OHBA 1NK7A 5EWGA 2RKIA 4RW9A 5KRTA 3AVLA 2XWYA 4TYBA 4WE1A 4DQSA 2R2RA 2UVUA 1T3NA 1WAJA 3OL6A 3NF7A 3KMSA 1S9EB 4O4RA 5DQGA 2ZD1B 1Q8IA 1EKEA 1XHXA 1BI4A 3V4IA 3SFUA 1YTAA 3D28A 4R8UA 3M8PB 4ZPCA 5SZTA 1WSIA 1IKYA 4RW7A 4KBIA 4WZMA 5FROA 4W5QA 1BCOA 3EYZA 1DTTB 3SPYA 1JX4A 1CXUA 1TVRA 4DFKA 3VN5A 1FXXA 4AHSA 3DOKA 4Q8EA 4YQWA 3OSNA 3LP1B 3ZSWA 1KLMA 1KLNA 4O3SA 2ATLA 3KLEB 4DMNA 2IBKA 1FKPA 4K4WA 3I8DA 4FJXA 2VG5A 1WSFA 2FBXA 3PVXA 3V1QA 4J2BA 4AH9A 4DSJA 1VSFA 4K4ZA 2E6LA 1MU2A 2YKMB 2AU0A 2ZKUA 4CFCA 5HP1A 3K2PA 4IKFA 4BACA 2ZQBA 3C6TB 4CF2A 4Z4HA 3MXIA 4F4KA 3H5YA 3ALYA 3CJ3A 1RT4B 1XI1A 2B43A 3AVMA 1BISA 3LANA 3BR9A 1TK0A 2W9CA 4FJ8A 4PQUA 2IAJB 3BREA 4IG3B 1VSJA 1HQEA 4I2PA 4DSFA 4AHUA 1YTUA 5F8HA 2OPQB 4W5NA 2YKNB 2IM2A 3BSOA 4URGA 4MIBA 4WXOA 3G86A 5DQHA 4BWJA 3SI8A 4ELVA 3HPOA 1N56A 2HHWA 1HQUB 4HKQA 3T5HA 4LQ3A 1BQNA 3V1RA 4MK9A 1JKHA 3ISND 4ECRA 3V6DA 2BANB 5J1EB 3BGRB 2FBYA 4O5BA 2W9AA 2YNIA 1HRHA 1SKWA 3L3UA 4Q0BA 4FK2A 1ZBFA 4Y3CA 3HJFA 4HYKA 3VQ7A 4PUOB 1UA1A 4J2EA 4KPYA 2QV6A 1T03A 4WZQA 1QTMA 3Q8RB 3N6LA 1Y97A 3TI0A 1MMLA 4ED1A 1RT1A 2A1RA 5DG9A 1QSYA 1LWEB 4DFMA 2AGQA 4IQXA 3CQ8A 1S1WA 3S3NA 2HHVA 1RTDB 4CHZA 4TN2A 4CJFA 4DLEA 4PA1A 1XR7A 3CJ2A 4J9RA 3IS9A 2JGUA 1JL2A 5F9LA 3KLIA 4ZTFA 3H4BA 1FKPB 3HK2A 3PW2A 2DFFA 4CFDA 3MR5A 3KLEA 2XCPA 3QEPA 5HRSA 3NGZA 4B08A 3MEDB 3ITHA 4RG8A 1S49A 4NLRA 3ZT3A 4AILC 2NUBA 2YNFB 3D0PA 1S1TA 2KFZA 3O3GA 3T5JA 5F8LA 1J54A 3OYEA 2KQ2A 2KZZA 2W42A 1BQMB 4WFYA 3GIMA 4NCBA 4FJ9A 4FS1A 1DTQA 5KG0A 3HYFA 1D5AA 4XO0A 1ASWA 2O4GA 2IM1A 1JXBA 3DLRA 1TKZA 3H40A 4RUCA 3DRSB 5KT5A 1KCFA 4DU1A 1EP4B 4KO0A 1S6QA 1BCMA 3GV7B 3IRXA 3PX0A 4WYWA 2DFEA 3CDEA 4WYLA 4CJWA 3ASMA 2I5JB 2CJQA 1IKVA 4AHRA 1K1QA 2CKWA 3RMCA 2PY5A 3L2UA 5HLFB 4F2RA 1S48A 3PO5A 1SH2A 4CJRA 1TL1A 2YNGB 4CJEA 1RT3B 2ZE2A 3FFIB 3RR7A 3LALA 1QE1B 5HRNA 1RCHA 3V6DB 4ZTJA 4FK4A 2WHOA 4FLTA 5KFHA 2JLEA 4CJKA 3BQ0A 4IDKA 2B5JA 3V6JA 4BWMA 4K4TA 3V9ZA 2ALZA 2HNZB 3CFOA 3SI6A 4KFBA 1S6PA 4RW8B 1GX5A 5F8MA 1ZTTA 3ZT2A 4X2BA 3FQLA 2R2UA 4TQSA 1R0AA 3QIDA 4FJHA 1U4BA 4DWIA 2BQUA 1S1XB 2C2EA 1JLBB 2IOCA 2FBTA 3H98A 4K4SA 3AVHA 4GVMA 4O4GA 3OHAA 2E4LA 1JXLA 2FVSA 3BDPA 3KLHB 1DTQB 1WSJA 3AA2A 5DMRA 5HP1B 5KFOA 1X9SA 1KFDA 4I9LA 4Y1CA 4CHQA 1SUQA 3AO1A 5C42A 4KHQA 2HMIA 4B9NA 1T94A 4Q44A 1N6QB 3O4QA 4FJ5A 2JEIA 3LAMA 5L9XA 3HVRA 1S4FA 3NHGA 1LAWA 3H5UA 4IRDA 3QIOA 3IN5A 5EUHA 4DG1B 1RDDA 1Q9XA 3DLGA 4AHCA 1S0OA 2OZSA 3MAQA 5KFTA 4FJ7A 4MFBB 4J2AA 3OYDA 1RA7A 4CCHA 3V6KA 3IGVA 4NZ0A 4FJNA 4O3NA 2KW4A 1QUVA 3ZSYA 3NCIA 4IG0A 3HKWA 1GOAA 1BI4B 4K4UA 4KRFA 1FKOB 3SYZA 3RMBA 1T7PA 2VG7B 1REVB 4BE1A 1C1AA 4Y2CA 5F8GA 3MTKA 4M3XA 2R2TA 1KVCA 3DM2B 1BIZA 2F96A 3DLKB 1YT3A 4WE1B 1LAVA 2HHQA 1S1WB 2D3ZA 5J2NB 4L8RB 2J6SA 4DL2A 2X6SA 1L3TA 4N47A 4RW4B 5KFIA 5KG6A 3KHGA 4IR9A 3TQ1A 1RT1B 1HNIA 4EBDA 1VRTA 4MFBA 3AO3A 3HT3A 1VSLA 3NF6A 4NCGA 2XY5A 4F8RA 3OLBA 4GC7A 4MQ3A 1QHTA 2Q3SA 1D8YA 3OS1A 1LW2A 1RDCA 3FSIA 2BE2B 1EXQA 4KV8A 3KOAA 2XY8A 1TP7A 3DRPA 4FJKA 3TANA 1NJWA 2QK9A 1X9MA 3FFIA 2DPIA 4RNOA 4CF0A 3V1OA 5KT4A 1RYRA 5EU7A 2IM3A 1RT2A 1IKXA 4Y34A 3RRGA 3OYNA 4RU9A 3H2LA 3B6PA 3PW7A 5T14A 3KKSA 3MR3A 1HPZB 2P5GA 4H4MB 3L8BA 4KTQA 4CJ3A 3KLHA 3V9UA 4I2PB 3I5CA 3MEGB 2GV9A 4OKEA 5CZ2A 2OA8A 3G6YA 4Q43A 4M3TA 4KHYA 3K5LA 4ICLB 3DRSA 3P83D 5KFWA 3MEGA 4FZXC 5DQIA 2GIRA 4RW6B 3TR8A
chains in the Genus database with same CATH superfamily
5HATA 4QR2A 2IPOB 2ZZMA 2AYMA 1S1UA 4DQ8A 5A2QU 3FRZA 3OBWA 4RO0A 4M63A 3M2RB 3M8QB 4W4MA 5EX5A 3TAFA 3AA4A 4JI1K 4JKDA 4W90B 3LP2A 4L73A 4PKHA 3OFHA 5L39A 3KD1E 2CPFA 1RHRB 3I8BA 4IG3A 4ZMMA 2VG6A 2O8FB 3ZSXA 3H59A 2ASJA 2IBOA 4PL8A 3ZEUA 3NE6A 4L76A 5C25A 3BGOP 1AUSL 4X4OA 5E5NA 3TUIC 4UZCA 2XC9A 2E1CA 2VOOA 3MUVP 1RLCL 1JLBA 3T5LA 2CQ2A 2VGMA 4OGCA 3MPVA 1YJVA 2HFZA 2RDDA 4GV3A 3OVAA 4O3OA 5KT3A 4DKWA 1TK5A 1RDRA 2GMLA 2L9WA 3FCHA 3DXMA 1FDDA 5KRSA 2PA8D 3LA0A 2DNNA 2ZWOA 4RCHA 2XGPA 2G8WA 3NH2A 2YXLA 2RU9A 2XYHB 1PBUA 1Z26A 4FYVB 2DNRA 1DURA 3CM6A 4QCLA 2SXLA 4LFAJ 1HNWK 2HHUA 2AGOA 3O4NA 4I56A 4MIWA 1HKCA 4DTUA 2MKYA 3JSRA 3JAMO 3ENVA 1FD2A 5LJWA 2HPUA 2H5IB 2FF3B 1MWQA 1XMOK 1SQGA 4J91A 4NPOA 4XAKA 5DDPC 1HQ2A 3BSCA 4FS2A 3O08A 4TY9A 3PDNA 3HHLB 3JSBA 4JUZA 4O3RA 4CZKA 3TEHB 3C6TA 5KFGA 4PG8A 1FEEA 2GIFA 3UNYA 2UXCK 4CEBA 2QTDA 4WCEQ 3U02A 2G2ZA 3SXLA 4DTPA 4CM0A 4ICLA 3DLBA 2UU9K 3EL2A 1IWGA 4CEDA 1XNQJ 4EHUA 2UP1A 4X66F 4BY9C 1EARA 4CZIA 5K5MA 2JX2A 1JLFB 1MW7A 3EXYA 2E5GA 4W92B 2IVMA 3DLGB 1QQMA 1HBNA 2FVRA 3CETA 2FLNA 3MOZA 2R7QA 4R0JA 2X1FA 4OKKA 3P5TL 3W7BA 1SKSA 1MROA 2DXDA 1NGCA 3GQCA 2GWJA 5CHCB 1WSHA 3FRYA 3OYAA 3VQQA 4KGKA 2W8LA 2R7SA 4A8OA 1PO6A 3CMQA 4JI6J 4B9LA 4C3MA 3WZ0A 3VGTA 2ZH8A 3A5NC 2W2NP 2LYVA 2EX3A 3D1HA 3SPZA 3D1QA 5BPLA 4CLZA 1ATSA 3ZEUB 1XNRJ 1ITPA 2DEIA 1NWKA 4Z7YA 4YNQA 3V81B 4X65F 5JICA 3E51A 3LM2A 1MMNA 2CAJA 3SQGA 4IO9L 4FJMA 2VFUA 1IBCB 4TKTA 4DR7K 3GYGA 3T1HK 2WW8A 1SKRA 4FKYA 3MPUB 1VQ4N 3TUZC 1RACB 5T7LB 1HNVA 2BDPA 3BQ2A 5B0BA 1I3OB 2AP6A 2NUUG 1EQ0A 2K3KA 1GX6A 2P2CB 2FF6A 3HOSA 3MMCA 1XR5A 1U1KA 4BRQA 3P96A 2JFDA 2ZITA 2KO1A 3VGMA 3MECA 5ELZA 4IRCA 1TKXB 2FHOB 5GVQA 5IT0A 2KRRA 1YBTA 1HI0P 3P38A 4QIFA 4KE5A 5CY4A 3D3BJ 3U4LA 2DNOA 3B8AX 3I56S 3DYAA 2AX0A 2P1JA 4JLHA 1FRIA 5HLFA 1VIOA 3G8SA 5JLFA 4LF6K 4WJBA 4OLBA 3O9SA 3HHLC 2XGQA 4X84A 1Y5NB 5L1JA 3M9OB 2EK6A 4K8RA 2JLGA 1NGHA 4YOUA 2VQFK 4FLWA 1YJRA 3MI7X 3V81A 3HXMA 1WBDA 3KHRA 4CERA 2VBZA 4A47A 2X74A 4B1ZA 2G8IA 4XK8C 1IN0A 3KMQA 1H2UX 2XMWA 2Q79A 4M42A 4F3OA 1TV6B 3AD9C 1YRXA 4QR0A 2FB0A 3HFKA 3W2WA 5HSPA 3MPYA 3ZT0A 5FPEA 4H0PA 4DUZK 4IXCA 4DV4J 3MDQA 1BQXA 1XK8A 1W7WA 4BRFA 1RTJB 4MAKA 3CPWM 1FO1A 3NH1A 3CJ7A 1IBLK 1FERA 3WNGA 3M6VA 5HBMB 4X4PA 4KHNA 2XI3A 3WQUA 4KH6A 2O01C 5FPDA 2BX6A 3HP6A 2R7WA 4Q5VA 2KVQE 3ZX2A 4BRAA 1R7IA 2FJBB 5M2UA 5I3UA 2E20A 2P9UB 3C8YA 4LSLA 2J6TA 3MAHA 3A5LC 1H7XA 5L38A 1DLOA 4PXEA 4F25A 1H2VZ 3VQ6A 1TAUA 1EB0A 1NU0A 2M52A 1KKHA 3ET6A 4Q0BB 3MM9B 1VQ5S 3DYAB 3HOTA 1BHLA 1HL6A 4CLYA 1HPZA 2E5LK 1V4TA 4DR5K 1HW8A 4LIWA 3CJ0A 1N8RT 4FNIA 1IKWB 3QT5A 4K41A 4QWAA 2B51A 1X4CA 3G8TA 1KC8O 2LVWA 4MK7A 2DT9A 5IC4B 1VLYA 1NKBA 2DIUA 1RT5A 3HSJA 2KG0A 5AJ3F 1ELOA 2BMBA 3H25A 4HCCA 2C3YA 4H0TB 2A40A 1TMJA 2DD8S 4IDKB 4JKBA 1O8BA 4LF9J 3FSXA 3C95A 2DHAA 3JS9A 3ZTRA 1UL3A 5BYSA 2CUYA 1Q86T 4WQ4C 3OR2A 1RTJA 4EYIB 1UEVA 3TZZA 2FUG9 1J27A 4P2XA 2D1KA 2C3UA 2J7KA 3CDUA 5I42A 2E5JA 2RQKA 3TAQA 4Y1DA 2DEJA 1SQFA 4DN0A 4PWUA 3LP0B 5CCLA 2W4CA 3MECB 5DGAA 2OSRA 3POTB 4XPCA 4K2XA 4QIVA 3PJWA 1RBRA 1L5UA 3CC7N 4QWEA 1NBWA 5ADXA 1JLEB 2CFXA 4OI1A 2AT1B 1Q95G 2OMLA 1ZOTA 8ATCB 2PA3A 2OPPB 3SEOA 4CLPA 2RPIA 2YWFA 3M8QA 1RAJA 3ZSOA 1FJGJ 1NZAA 4DCJB 3M2RA 3S8SA 3K5MA 2ZHBA 1JWWA 5AJ3J 3TVKA 4QIEA 3DXBA 3BF1A 2HF3A 2XHCA 2YH0A 1NK6A 3OHRA 1UKUA 3QINA 5AQGA 3G25A 3W2VA 1YQHA 4LF4K 4I9QA 2CQIA 4CEFA 3LM9A 1HLWA 5M2PA 1YJ9S 2AYBA 5A8WB 4FXVA 4HUGA 1BWVA 4IOBA 1O1WA 3FE1A 4FWRA 3LPTA 1CJUB 2YKPA 1NKCA 4DR3F 2G8KA 1YJNN 4ECZA 4JI8F 2XSJA 3OD2A 3WQTA 2Z1IA 5HMXA 4OYOA 4P6QA 4BBYA 1JIHA 4J9PA 1U1OA 1UVNA 2MKJA 3KIOA 3VGLA 3SIPB 3JYTB 4Z4IA 4E1MA 3QZ7A 4D3HA 2DTUA 2XMUA 5DGBA 4V19J 4OJHA 5KTQA 4WTOB 3THWA 3O80A 5KFVA 4CJVA 2U2FA 2VWBA 1CJVB 3T1YK 3LW5C 1FJEB 5M1QA 3ISNC 4CF8A 1NH7A 1NK8A 2CNLB 4A8QA 2MY7A 4X62F 4LIRA 2FY8A 4LUBA 1LKZA 5B0DA 5ETSA 4TNOA 5AQFA 5HI7A 1S1VA 3TJ8A 2ATCB 3U7JA 1NSAA 1WDDA 3PKMA 3BGUA 2I5JA 2X1GA 5BPMA 4OFZA 1GMWA 2MLXA 1CJKA 2KU7A 2I7NA 2FJDB 3EVWA 2XZWA 3TRGA 5KFLA 4LBHA 2YX4A 4OO1J 4FLVA 2HQDA 2QTWA 1NM2A 2EI5A 4A5AA 2LXIA 3MHYA 4CO3A 2GNKA 2AA4A 5E41A 1VJWA 3KHLA 5G0RA 2R4FA 3QATA 1RSCA 4IFVB 4PKIA 1IUJA 4E8UA 3EDRB 2MHNA 3H1QA 4DR6K 2WTFA 1PC4A 4G1IA 1ZBSA 4NLPA 1L3SA 3RVCA 5C0YA 3DDKA 2DGOA 2UXBK 2H4YB 3OVSA 2W9BB 3A5MC 1VQ9S 2WBMA 4WF9Q 3X3UA 1NJYA 3DU5A 3LZJA 2VIHA 4P74A 3P3DA 1VOMA 1IKYB 1KSPA 3UNGC 4OYZA 3DXSX 1N6QA 2C2RA 1NPRA 3D6FB 4JD2B 3IAS9 2ZM6K 4YB7A 2MQNA 2UUAF 2R7TA 4J9KA 3NOCA 1EETB 3T3FA 3SJHA 4GC6A 1EKRA 1HR0K 1DFDA 2E1ZA 3VA0A 1HI1A 1IBKF 2DNMA 5KFCA 3MX5A 1OH6A 2VC1A 4N56A 5LMUJ 2HYIB 2HKEA 1D9FA 1AZSB 2AEFA 2UVWA 3J7YU 1QUPA 3MM5B 3N4PA 2A3ZA 2BGGA 1HPMA 4I7FB 2NXJA 5LSRA 1DT9A 3T1YF 1U2CA 1RKJA 2LSNA 4FL9A 5A2QO 4CD3A 3Q8PB 3TQEA 1N34F 4LF5F 4M45A 2P9GA 4C1NK 5HRPA 2YI1A 1C6VA 1ZBHA 4LF8J 3CHWA 2NRWA 2ZGYA 3RJMB 2W40A 4LFBK 3U6FA 1MWYA 2AQ4A 2WOMA 3NGSA 4J9NA 1N52B 2WC9A 2VFRA 4KB0A 1HW9A 3AOAA 2G9OA 4JHDB 1R6YA 2ILYA 3BJYA 3OS0A 3CMAS 5F8IA 1N33F 2VDIA 3NVMA 2R8IA 4JS4A 1ZM3A 2VWJA 3QETA 4JI6F 1UMJA 2CDRB 2PEBA 2J9EA 4Z4FA 3CCLS 3CJSA 4UOCA 2PSZA 4NOHA 3CG7A 3Q22A 1K8AO 3CC2S 2VZ9A 1GLEG 2BH1A 3LDQA 2OTJS 1VC6A 2HB5A 1G99A 2YCHA 3FZHA 2HVIA 4N7TA 4M5DB 1NPPA 4GVBB 3AAQA 5GAEU 1KD1O 2O67A 5KFKA 3PR4A 2Z1JA 1NSKL 2OSQA 2ASYA 3KG0A 2E1MC 1VQLN 2KTQA 5IV3A 4DPYA 1MWMA 1Z05A 1TL3A 3K5OA 2HMIB 3IA0A 3LDNA 3P4UB 3D0GE 1JLEA 3MM7B 4IO8A 5KFRA 1HARA 3I0RB 3KLFB 4PWDA 4B9SA 4ZCKA 1RCOB 3SQ2A 3W9IA 4ED2A 2HVZA 2AGPA 3DGPA 2BKOA 4JV2A 4LMZA 1N36K 4KH1B 1RWPB 3R9PA 2HZAA 1WC6A 1Z6RA 4FK0A 5CYQB 4C2MA 3V9WA 3CDAA 4CEQA 3CMEN 1GFWB 2JZ5A 2WSFC 5DK5A 3GE9A 3OR2B 2OPRA 3LPUA 2I8EA 2R3VA 4OMFG 5ETPA 2GX8A 1NB2A 4CZEA 3KXDA 3SZ2A 3WBZA 4ATNA 1WB9A 5CA5A 4FVMA 4GKJF 3THVA 1S9EA 1J5EJ 3TA2A 5E2QA 3DCAA 3O5TB 4YOWA 1RBTA 2Z56B 3EGWB 4ZVEA 2ETJA 3BH7B 1JLCB 5GAGI 5E3RA 3QDKA 2E7WA 3HL8A 4JI3F 3FMWA 4KHMA 3SQOP 3M1FA 3JSYA 3S01A 4WFBL 1S6PB 2WVEA 3R6GB 4CHYA 3Q0AA 2QE5A 3SBTA 2QXLA 2J0SD 2XTJP 2J76E 2BJ9A 3OT9A 5CR4A 4PABA 4K25A 5EWFA 4QAGA 4YOTA 4RUBA 4P7TA 1ZBUA 3GOIA 1KLMB 2MHEA 2V0NA 1VBYA 2P9KA 3KWGA 4NI2B 1VQMN 4H0XB 4GMKA 1P90A 2Q66A 5FD1A 5KFZA 3W1YC 4AL6A 3P45B 4DV1J 2J0QD 3SBMA 1RI7A 1KQSR 2HNDB 4ED7A 2QMWA 2RDJA 2DBBA 4K0KK 3PW4A 3M30A 1GLLO 3J7AP 1J53A 4ANEA 1QD1A 5I9EB 3UFCX 1UTAA 2D0AA 4LREA 4X65K 3UVJA 4KGMA 5F2RA 4CECA 3EX7B 2V63A 1RDWX 1P8GA 2E88A 4P9SA 4ANDA 4X4VA 4R5PB 3HPGA 4CFAA 2MZ1A 5H9EJ 1C2PA 5D6GA 4XH1A 4WQ4A 3VAKA 1CJUA 1M5OC 3F41A 1PJ5A 3OYKA 3PW5A 1RWOB 3MCSA 4ZVOB 3EZ5A 2A6MA 2ZUAA 1S5JA 2O3DA 3V4IB 4DV2F 3RGIA 5IT9U 2PC6A 3QFWA 3BQ1A 5TKYA 4I4BA 2BJ1A 3DI6A 3MCNA 3TX8A 5AQXA 2B5JB 4FXDA 1I51B 1UZHA 2HSEB 3G0ZA 4DV5F 3VF2A 4CK1A 3MWPA 4OPJA 4LF5K 4CIEA 3G71N 2DITA 1HHTP 3CJBA 3X1LB 4P73A 3J7YP 5M2RA 1IVZA 5AFUA 3K8VA 3MN7A 3ZZYA 1S3XA 1UWBA 4ZHRB 2JEFA 4Y65A 2GCFA 1X5SA 2Y3YA 4NLTA 3DOLA 4C3KA 4QW9A 1VMBA 3J7ZT 2OPSA 2ZJQL 5LSOA 4M1KA 4PPZA 2XY7A 2OTLS 4NRUA 3J7AN 2N4CA 2G2YA 3LQVA 3BYPA 4LR8A 3KK1A 2UUCF 2R7UA 3SJJA 5KAKA 3MX2A 2NXNA 1Z25A 2VPWB 2E2QA 2HG4A 2OO4A 3D2WA 3DRPB 3HM9A 3C7NA 5ETOA 4KTWA 3FQKA 4F3QA 3E01B 3CTRA 1GXUA 4WK1A 4OX9J 3OSPA 1TQLA 1NZ8A 3GCWP 4JB8B 1AUDA 2FVQA 3OVBA 3DLLQ 4U7UD 2D3O1 2W7OA 4B3SF 4CLSA 4ZA1A 4L3NA 1WORA 4FW2A 4OZJA 3BPSP 4J5OA 1K73O 3HF5A 5KFXA 4BHQA 2CJYB 1AZSA 1URNA 3OFEA 4YR2A 3PIPQ 1AROP 1APSA 1TL3B 3ZZZA 3OFFA 1SL2A 2MJUA 3ICLA 4KAIA 5IFMA 1W2BR 1WI6A 1OY8A 4RW9A 5K8OA 5KRTA 2V68A 3AVLA 4CZLA 4QYRA 4TYBA 4DQSA 4BRLA 3QBCA 3OL6A 1Q8IA 2ZD1B 4FPIA 4QYZK 1VAZA 1XHXA 1RBAA 2QIFA 3GFHA 3DU6A 5SZTA 3CJQA 3UCGA 2VQEK 4KBIA 5FROA 3LDOA 5HQLA 4BR9A 1DTTB 1GTEA 4BGAA 3R5DA 1TVRA 4YOEA 2PEHA 3DOKA 4YQWA 3OSNA 3QSIA 4QZVB 1KLNA 2ATLA 3KLEB 4DMNA 5IOLA 2IBKA 2K1RA 2QW9A 2V7YA 1RAIB 1RAFB 4YORA 2F9JA 3WEEA 2RHQB 1AB8A 1Y5IB 4J2BA 5C2DA 4DSJA 1R31A 2ZKUA 3EM1A 4AE5A 4DHYA 1ZC6A 3W2WB 4BACA 3AXKA 2V2ZA 3PRDA 5A8KA 3C6TB 1XMBA 3AY0A 2FQQB 4WQ5A 1RAHB 4A2AA 4RKUC 3TP2A 1WHVA 5AZIA 4PQUA 2IAJB 1G4CA 1HKBA 3GFYA 4IG3B 1XNQK 4I2PA 4AHUA 1YTUA 5F8HA 1S12A 2YKNB 3ENBA 1Q86O 3JB9k 4URGA 5IM0A 1X3MA 3G86A 5DQHA 1GH8A 6AT1B 3MM5A 1T9XA 1N56A 2HHWA 1HQUB 3T5HA 1WJ9A 5BR8K 2GVZA 2BKPA 3V1RA 4LT6A 1CC8A 1JKHA 4Y2MA 5HANA 1HNXK 1OWXA 3VEZA 4PG4A 2MPUA 3VZIA 4OZ3A 4U8YA 4LRAA 1HRHA 2NXEA 3EXCX 4Q0BA 3HJFA 4HYKA 4KC5A 1QVFM 3HHLD 1UA1A 1V3SA 1T03A 2V8VA 2P9PB 1QTMA 3Q8RB 3N6LA 3TI0A 2FGCA 4PCQA 1K47A 1QDUB 3FMBA 4DFMA 4ETZA 2AGQA 3QQCD 4ILHA 1YLXA 1K0VA 1KP6A 5B0EA 1Y4ZB 1RLDA 4PKDB 1VQ4S 2HHPA 4HH1A 3CO0P 5E26A 4ZTFA 5DZ7A 2BACA 5BRHA 4JK9A 2DFFA 2OMOA 2GVDB 5C7PA 2L9DA 2XCPA 3QEPA 5T7LA 4B08A 1RHUB 3AFGA 4CO4A 2QA4N 4AILC 1T3OA 2Z2ZA 1S1TA 3TNVA 4ITSA 3OYEA 3CDBA 2Z2YB 4H5RA 2ZEJA 1UVLA 6FD1A 1B64A 2MXYA 5KG0A 2CQ0A 4ES3A 2M70A 2WSCC 4C1NI 2M7SA 1K0TA 2X1BA 3PKYA 4ED5A 4ZLPA 1NJIO 1CEZA 2A5XA 1K8KA 4JI0K 3IRXA 4GRSA 3P49B 3CDEA 1V4SA 4CJWA 2F8HA 2DISA 2I5JB 2W2QP 3PSIA 5U47A 1YIJS 1T44A 3B78A 4DPWA 1S0VA 3L2UA 5HLFB 4PR6A 1R0BG 2DHGA 1OPZA 1Q18A 1TL1A 3FFIB 3UN3A 1HWUA 9ATCB 1QJHA 3LALA 1RCHA 3WC2A 3M32A 4FLTA 4DDFA 3VCDA 3BQ0A 2HNZB 3Q2TC 1QAXA 5A0YA 1KC8T 2WFBA 3OQ2A 2EFVA 5F8MA 3HSCA 4F36A 1I94F 1IJEB 1GT8A 2P6SA 2QWLA 1RXOB 4F0MA 3TSUA 3ZETB 1S4EA 3QIDA 2ALYB 2BQUA 2ADBA 1S1XB 1P8ZA 3AVHA 4O4GA 1QHAA 2GQ2A 3PYFA 1AXQA 3MWBA 7FD1A 5DMRA 3C2PA 5HP1B 2WBRA 3BM7A 4GVEA 1X9SA 4I9LA 2I6WA 4AM6A 1SUQA 1VQNS 3AO1A 3JS6A 1X60A 4G9ZA 2VYPA 5C42A 4GVBA 4KHQA 1T94A 1N6QB 3SSSA 9RUBA 4DX5A 3LAMA 5GAEI 5L9XA 3SAFA 1XMQF 2QO3A 1OYEA 1S4FA 2IIHA 2DRDA 3QIOA 1FF2A 5IT9Y 4DG1B 1O5JA 1RDDA 2LQ8A 3PNIA 1Q9XA 3AXMA 2VBWA 3C0BA 1SZ2A 1DY3A 3DLGA 4FJ7A 4J2AA 1RA7A 4BC5A 5ETLA 3EJMA 3V6KA 4FO0A 4NZ0A 5AQOA 3E9PA 1QUVA 2GS8A 3GCXP 3HX9A 4I0WA 4DR4J 2NLWA 1BI4B 2KFYA 2DHHA 3AQPA 2CGJA 3SYZA 2MQMA 3DDIA 1REVB 1F5BA 1C1AA 1VBKA 3FR0A 4M3XA 4C4WA 1E6VB 1SKUB 1C0GA 2F96A 4DCHA 3KG1A 1OVQA 2HHQA 2ZVSA 2VDHA 1OMSA 2B8PA 3I96A 2J6SA 1NDLA 2QA1A 2YWWA 3MN6A 4EBDA 1VRTA 4MFBA 3AO3A 1R8AA 1VSLA 2P9PA 1LW2A 4KBOA 3MMVA 3FSIA 1J6ZA 3G8QA 3TANA 2DGVA 1OY6A 2CQBA 3R5GA 2K3IA 5M1NA 3ENWA 1YGYA 3C6HA 4F04B 1K9MT 4B1XB 3OYNA 3DRXA 3H2LA 4P2MA 3A8IA 3B6PA 3PW7A 3KKSA 5GADI 3ID8A 3J81Y 1HPZB 2P5GA 4JI5K 2ROPA 4NE9C 4JV5F 4CJ3A 3KLHA 4WIIA 5D8HB 1PG5B 5D4OA 4I2PB 1VLOA 3I5CA 3MEGB 4OKEA 3MR7A 3CD6S 4OYXA 3K7RA 1EQMA 2QLWA 3DRSA 1YHQN 5KFWA 3FGVA 3TR5A 5DQIA 3MPDA 1VFJA 1YRTA 4JV1A 2NCKL 5I3UB 3W66A 4DV1K 2GUPA 1F1BB 1HBOB 4ILGB 2EEYA 3IBCB 3AV9A 5K8PA 2W1BA 4GO5X 5H1SQ 3WNEA 2CQCA 4KYZA 3WIUA 1JJ4A 4KHWA 4QU7A 2DY9A 3UIQA 2GZOA 4CHOA 1T05A 5JJBA 5BN9A 5BYQA 4IBNA 2H48B 1NB7A 3VA3A 4B3TK 4QOTA 4TU9A 4A8KA 5A8WA 1NEEA 2R42A 1RU1A 4CH7A 4DV6J 4I2QB 1FHTA 3H45C 1FK9B 2VWKA 4JK7A 2RKIB 1GLBG 4OZ0A 3ETMA 2HGNA 2EFQA 3R3TA 2JSXA 2QKKA 4CJ4A 1VSHA 4CJSA 2JVRA 1JJ2R 3N4QA 4DUYK 2CGLA 4LBIA 3R7NB 3L9ZA 3QT6A 1GNKA 4B9VA 3QZ8A 4JOUA 2N4DA 3ZFVA 5ADZA 1WWHA 3JSMA 2DY1A 2LKZA 4CBXA 2N7YA 3RRHA 4LF8F 3H7HB 4NZ6A 1D8ZA 1KFSA 3VTHA 1AFJA 4Z4EA 4LF5J 4F4WA 4B3RJ 2PI4A 2XMJA 1N34J 2QWQA 4V1Ak 2FVPA 2H5JB 3AJDA 3N28A 3I0SB 3NGYA 5CCMA 4FNHA 4B1VA 1EJ7L 1IBMK 2ZOFA 4CD1A 3T1YJ 3BP8A 3OS2A 3M6GA 5DM7L 3J7Z5 3TPQA 2VU5A 2PD1A 4OQJA 4E7JA 3CXCM 3CO9A 1VQ8S 2C2KB 2A41A 1FJ7A 4MO4A 3WNFA 3DLJA 3G96A 5AQQA 3KK3A 4Q7AA 3CMES 5EDWA 2QMUB 2HHXA 1ASUA 4IYQA 1X4FA 2UUAJ 3I55N 5BREA 4Y00A 3E66A 4F2SA 2ZF5O 1B9FA 4RBUA 4NXMJ 1XQIA 4JBCA 2BJDA 3PIOQ 2CJXB 2B9WA 1T95A 2DNQA 1FXRA 2P51A 4ID5A 4A61A 4DLGA 3VGKA 5J2MB 1F6TA 1TL1B 2HRUA 4ECWA 4CLFA 2BUNA 3ZNUA 1OH7A 2A6OA 4NYNA 5GAEP 2KT3A 3PW0A 4IH5A 3J80Y 3FLCO 3CIZA 4YMEA 5GAHI 3H20A 1VJQA 2V8DA 1N0UA 1F9EB 2CZVC 4DX7A 4DTJA 1PAUB 3HP9A 1QE1A 3RUBL 4C23A 4LSLB 2RN2A 4EZ6A 3OVNA 1C1CB 1SL0A 3ET6B 3ONQA 2N3LA 2ZJRQ 5RUBA 1JLQA 1VQ6S 2UUCJ 4IRKA 3N5FA 5JS2A 2VFVA 3W8GA 2Q1LA 3NNHA 4Y28C 4CK2A 2JJ4D 3DWLA 4LSNB 5LMNK 3MTJA 3GJQB 2CJAA 2WSEC 3L2QA 4N5SA 1WKJA 2POKA 2RILA 2BYCA 5BYRA 4CTAA 3Q8YA 3WIVA 2KLAA 2ZKTA 3ZYYX 2WRMA 2MKIA 1NH8A 3GYXB 4B3OB 5L46A 4UOHA 2ZDPA 5LXRA 2LFVA 2V7ZA 1HHSA 4K2JA 4CZCA 3CJTA 4MK8A 2D1CA 1KNZA 1FRHA 1UOCA 1E4GT 3AY9A 2Y0BB 4WFAQ 4HACB 1YJWN 1SV5B 3ENAA 4NLWA 4TQRA 3WX4A 4G65A 3LP2B 3LP3A 2XMAA 4FBUA 4KTZA 4ES1A 4EO8A 1S22A 1KHWA 3AT1B 2IAJA 4IOAL 3G2XA 1Q7LB 3CJ5A 2ZZTA 3DHXA 4B17A 1U09A 1KOHA 1U04A 3O3HA 3RYLA 4BE0A 4FWNA 5J2MA 3RAQA 4NLSA 2F8SA 4LRCA 3QJLA 3P5JA 3SCXA 4RW6A 3VAGA 1S6QB 2Z30B 3VENA 2JRSA 3C6UA 3DLEB 2QN6B 2GIQA 4WU3A 4C48A 1YIJN 4O0IA 3OW2R 1JQGA 4J8FA 3CB4A 2HAIA 3SAGA 4WU2A 3O6QA 1Y3KA 4RPFA 5B0FA 3CPWR 3SV4A 2C22A 2L08A 4RWWA 4KI6A 3VQEA 4LVOP 2VFTA 3BF4A 2DVIA 1FWPA 2QXFA 2F4VJ 3R6LB 1LFPA 1AW0A 1TMMA 3O1LA 3J7ZO 3AO4A 2D9OA 4J90A 3TZYA 4ZN1A 5CH7B 3JTPA 1KAYA 4DV3F 1TAQA 3VALA 1OVYA 5FRMA 2WK4A 1RT7B 4CJQA 4IO9Q 4RZRA 1OSCA 3C15B 4N8NA 1S0MA 2UVVA 4USTA 1WSEA 4NYZA 4ECSA 4YOXA 2HK2A 5M1PA 1NJZA 3R8EA 3DOKB 4M7YA 2BE7D 3AB4B 1R8BA 1V5VA 2KZMA 1BL3A 3OYBA 3CC7S 3BO2A 2RH3A 2ASLA 4EWTA 4NEZA 3A2FA 1VSKA 4EP5A 5FPNA 1HNVB 2ZVIA 4B9MA 4HEA9 2D41A 4BDYA 3NMAA 4LF9F 1NK0A 4KGVB 4DSLA 1BQNB 1KVKA 4Q45A 2IY5B 2O8BA 2G1DA 3QO9B 2O8BB 4J9SA 3WXJA 2DK2A 3MK6A 1RADB 2C2ZB 1B0PA 2YX6A 3PYEA 1XMQJ 2MZRA 2XEXA 4DEZA 2YH1A 2EFNA 3QGPA 2YWEA 2PFDA 2XYGB 3CIMA 3IMXA 4DL6A 2GJ2A 3SMPA 2FLPA 4JEPA 2BANA 5J1EA 2CQGA 1EWRA 1P9QC 4GKKK 4KRWA 1XC9A 3HMJG 5BXIA 2RT3A 5DG8A 1ZTWA 4IFYA 1VK8A 2HBZB 2GEMA 3L2WA 1R0AB 2G8UA 4IEEA 5KFDA 1N54B 2B0GA 2KH9A 3V9XA 4PL7A 4ED8A 4P72A 2E5LJ 3MMBA 4QIWD 1QS4A 3KJQB 2HNDA 5HAOA 3O1BA 3QRQA 1LV5A 2KL8A 3D0HE 5DLFA 3BY5A 3MPWA 2JC0A 1NU4A 3Q83A 4DU4A 3IP0A 3BEGB 4E7LA 2IJRA 1T11A 5BR9A 3S7RA 2QMXA 3KZBA 1F2GA 2WVFA 1KQSM 4EBEA 5H9FK 4JKAA 3KUEA 3EE3A 2GBZA 4DJBA 3LZIA 3MD3A 4CBUA 2LQBA 4BC7A 2DGUA 2HZCA 2O8DB 4CJTA 3OBIA 5FDLA 4K4YA 2VJUA 5DDOC 3PTWA 4HHTA 1UFKA 4LF1A 3TEGA 3A3OB 3D4JA 2IGIA 4CESA 4EFAC 1RT7A 4LVNP 3DC2A 4U7UK 2UXDK 1TL7A 3MMAA 1U1QA 2O8CA 3GR1A 5HBMA 1BE4A 2JOQA 3CUNA 2FY1A 5IWAF 4CO0A 1LWCA 2HWIA 3EVOA 1WLJA 1WEXA 4C0BA 4HHUA 2BR0A 2YJEA 1HWIA 2GC8A 1A5WA 1HBOA 3DHWC 2Q6CA 2F9TA 1C1CA 4OX7A 3CD0A 1G3OA 3MN9A 4NLCA 3FGUA 4BQLA 1YDLA 3QB0A 4AL7A 3LWLA 1RTZA 5DO2A 5T41A 1RHQB 1NMDA 1D4XA 4J2DA 1VQ8N 2CNOB 3QWPA 2HQ3A 2G1HA 3B82A 2DNHA 3NP5A 5LJVA 1SIZA 3ZSVA 2UZAA 1NKEA 2DFHA 4NMLA 4TXSA 1XERA 1SL1A 1EWQA 5DM6Q 1R8HA 3HHLA 1Q78A 1RTIA 2P9NA 3O5BA 3ILLA 4LH5A 3V4MA 4QOZB 3CT9A 4TU8A 1KRPA 5AQMA 2HFNA 4F7VA 4C97A 2DR8A 2NRZA 2G4BA 4DV4K 1CSJA 1SJ4P 2NRHA 2GAHC 2GUIA 2LQ5A 4KHRA 1U45A 2AX1A 2XWXA 2O8EA 3K17A 4JI5J 2QL9B 3QMQA 2NS1B 5KFUA 2XYPB 2E2PA 1CPZA 2E9TA 2XNQA 4B3OA 2OANA 3ZT4A 3T6JA 3H3NO 2HGLA 4O8UA 2YQ0A 2BOPA 3KJFB 3TAMA 4WK3A 1H1VA 1X5PA 3A4TA 4EIAA 3OR1B 1NOZA 3D45A 4B3MF 3W5ZA 5C25B 2FC9A 3RZAA 4DX6A 3NMRA 3QT7A 1LXNA 4JRQA 4C8YA 2MQPA 3HHDA 1N32K 4ZLJA 4NCGB 3VQ9A 2FC0A 1IXKA 2DPNA 1NHUA 4OLOA 4DPTA 3A3NB 1FK9A 2Y1LB 3S9HA 5KFSA 2XS5A 1DQAA 1SVDA 1WHXA 4WP3A 4EEYA 2VA3A 2EG2A 2V50A 3C6AA 4HL9A 3CCUN 5LXYA 4XH4A 1XNRK 4QS9A 3VZHA 1SCJB 1HNIB 1SJQA 4CH1A 3N9UC 5D3GA 3M8PA 4JI8J 3C15A 4X66J 2L41A 1N4LA 4LRBA 3GIIA 4DQPA 3CMAN 2P9IA 1R59O 3L7UA 2KI2A 3LTOA 3VQ4A 1RTHA 4I69A 1HI8A 2D74B 4JI1J 2XZDB 3CD5A 3TVYA 4HUFA 4K8ZA 5AQKA 1KOOA 4DBQA 3THYA 3CJ4A 4FOEA 3M8YA 5ETKA 1KTQA 2FBVA 4NLQA 5M1KA 2GQQA 5C5JA 2PZSA 1TKDA 3RU0A 3M8ZA 3H5XA 4X64K 4E7KA 3W5XA 2HRYA 1S10A 2AMCB 1EQYA 1ITGA 2YX7A 1QZ5A 2VKZG 4DSKA 2O8CB 3D6RA 3ULEB 2YNHB 3CC4S 4FLZA 4A48A 3LDSA 4Z2XA 3IAM9 3BV8A 2DH7A 3SUOA 2LDYA 3H6EA 3G82A 3DLKA 5A6PA 2EFOA 3IKMA 1LOTB 1YK9A 1HNWJ 2VG7A 2FJVA 3FFKB 4B9QA 1BMQB 5IQ6A 4B3SK 2VB6A 2J8SA 3KJVA 1MA9B 2Y0SD 2YQ3A 3O6WA 1NRKA 4JKGB 3O2IA 1TYQB 3LP1A 1U25A 3IM8A 1JLCA 5JUMA 1YVNA 1JL1A 3WX8A 1XIQA 1S9GA 2EPIA 4ZVFA 4QWCA 5F8JA 1C0UB 4ILJA 4UT4A 4UUXA 5J2NA 3SUQA 5LSLA 3PIOL 1Y5LB 3KNAA 3IC1A 3US5A 3DJCA 4KO0B 3O8WA 4LQ9A 1IG8A 2VOPA 2MSTA 5KFFA 2PIIA 2UUBF 1H7WA 1ZM4A 1D9DA 2AZ3A 4OV1A 2B6AA 3EO3A 4ISEA 1UW4A 1FDBA 3NAEA 3VQPA 5A6WA 3OL7A 2W2MP 4CTAB 1HBMB 3I0RA 3W61A 3IR6B 2J9DA 3ULDA 5DM7Q 5BJRA 3UDLA 2RB7A 1BD6A 4PQAA 3IGNA 5KFPA 1C4AA 2H3GX 2E44A 5KG1A 3BO3A 2YTCA 3NFAA 4J9MA 3RMDA 2ZH3A 5KI6A 3SSRA 4R79A 1QSLA 1B70B 3FEXB 4YDXA 4E1JA 2B4PA 2W7AA 6FDRA 4ZVRB 4TU7A 2ZH4A 1N36J 4ID5B 1RDAA 4ED3A 3K0JA 2Z1GA 2BE2A 2H1YA 1O13A 1G6BA 1X1PA 1P1LA 4Q2MA 3PHEA 3THXA 4AUKA 5A0YB 2RF2A 4PUOA 1GOCA 3ZZ0A 2D3UA 2YV0X 3K89A 2HHHK 3F5TA 5HVFA 1FDAA 4C8NA 3J7YI 2V2KA 3HSDA 3MM6B 4A46A 3M5RA 2CPHA 4A8MP 3VQTA 2DB1A 3HHNB 2M2BA 2J4RA 3RTVA 4CZFA 3VETA 4JHDA 2E66A 1T9WA 2Q36A 2P9IB 4IFYB 2IRYA 3CNQP 4AD6A 4CO5A 3D67A 3NRBA 2UV8G 2KJVA 2IA6A 2A18A 3EUNA 1GQEA 1IJFB 2G8VA 4NA2A 2ASOA 4DFPA 5HQ8A 3VEWA 2Z1HA 3QEVA 1N8RO 3GILA 3P31A 4GKJJ 4M94A 4HLBA 2BZ2A 4ZOSA 5KFEA 3M3ZA 4XTTA 2IC3B 1HLUA 4KAZA 3B8HA 3WUHA 3V6HA 3AAWB 2PFUA 2YNGA 1MU2B 3DDNA 1SJFA 3BF3A 1RTIB 3G6EN 3KK1B 4LR9A 1Q5YA 2M8HA 3KD5E 3I9V9 4QR1A 2DH8A 4NRTA 4ELUA 1FWKA 2A1BA 3UCUP 4Z37A 3WDOA 2YKMA 3EN9A 2J6UA 3RBDA 2KB2A 4C3LA 4OPAA 3HSTB 4BVPA 1QM9A 3L6QA 2NSCA 1RT6A 1GLAG 1Q8KA 2WVBA 1VHXA 3D2FA 1YG0A 2DH9A 1ZH5A 3NGKA 1LEOA 2WUSA 2Q43A 2ZDOA 5AQJA 1PSDA 3J81O 3EVMA 3OYHA 4USHA 1HD0A 4TY8A 3M8RA 1ZA2B 2ZNZA 1ZZNA 1OYDA 2CZ9A 3K0SA 4CEZA 3MR2A 2V4QA 2G0JA 1TK8A 1C0UA 5GIOA 5J2PB 2HF4A 3UCZP 1ESVA 3PFEA 1BA0A 2EHGA 3FNNA 3HVWA 1M5HA 2QLJB 3IFRA 4USVA 2XRIA 3RAMA 4M8LA 4K43A 3EZOA 3IDHA 1MLAA 4FSVA 4PG7A 4B3MJ 3AD8C 4YDDB 1KVBA 3CCVS 3RB4A 4KHPK 1IJJA 5E7OB 3CCSN 3IR7B 3U1LA 1CJTA 4U8VA 1JLAB 1NGAA 2JWLA 2W2OP 4YHHK 1E4FT 2AF6A 5AQVA 1CJKB 2JHEA 5AE3A 1M0SA 4FLXA 4PY5A 4NLOA 2OEMA 2CJBA 3FEYB 3K58A 2F9WA 4A2BA 3CJ9A 3R6MA 4J9VA 4O23A 5M1FA 4CLKA 2PYJA 1Q1KA 1RBVA 4OPHA 4HACA 1LXJA 3B4MA 3VMFB 1F3FA 4BDPA 4HTIA 5LJ5Y 4A4JA 2QG9B 3QAEA 4HT5A 1WOPA 2XMVA 3OA9A 4AM7A 1N5VA 2LXUA 3PHTA 3A8JA 4F0HA 4URQU 5J1PA 3MM9A 2Y9HA 4BC9A 1PJ6A 2HHSA 4UQGA 1REGX 4FF1A 4CYUA 1EP4A 4OZLA 3NXZA 1KVAA 3W60A 1LCUA 3DXKB 2HBQB 3CYMA 5EGYA 2RVJA 1NK7A 4JV5J 1IBKJ 3CQXA 2QYCA 2GHPA 4ZJLA 2FSNA 1J5EK 3NCPA 4DZDA 1OQ3A 2UXDJ 3TZWA 4IUFA 4WE1A 3I31A 3CI5A 1WAJA 1S9EB 4O4RA 4JYAK 3LDPA 3M6XA 1IQZA 4PG5A 1BI4A 4YUDA 3SFUA 4I6MB 3AJ1A 1S57A 3W62A 1WSIA 1S59A 4RW7A 1TU0B 4Z7CA 4WZMA 3KWMA 2CYYA 1NGJA 1HIYA 1CXUA 3CCMN 4AHSA 3RSEA 4Q8EA 4A8WA 3OTDA 3ZSWA 1KLMA 3MMBB 2HS0A 3Q2SC 3TA1A 4ES2A 5IWAJ 1FTCA 2HWTA 5FJ4A 3FZKA 1FKPA 3GWCA 3T9ZA 4LF7J 1Q81O 2E5IA 2VG5A 2FBXA 1NMNA 3PVXA 1RWUA 1AA1B 4BRMA 1SC1B 4LR7A 4P71A 1I5OB 1XTZA 2E6LA 1MU2A 3D7EO 1F3VA 2MKCA 2RAQA 4DR4F 4CFCA 5HP1A 1RABB 4IKFA 3EE8A 2C2OB 3CCSS 4Z4HA 4OIXA 1IM6A 3AVMA 3ULHA 3MCAB 2W9CA 1KN6A 1FXDA 2OUGA 4FJ8A 2QWMA 4MDBA 3BREA 2VONA 4DSFA 2OPQB 2QLFB 2YJFA 4MIBA 1Q7YO 4WXOA 3SI8A 3HPOA 3ILIA 2XMTA 4CNZA 4JI2K 1FKAF 1BQNA 4IFEA 3NS5A 1KS2A 5B0CA 3ISND 1WTBA 3MM6A 4DCPB 4OYWA 1WG5A 4FWQA 5ETVA 4HI1A 5GADP 1PC5A 1SKWA 1NXIA 3EGVA 4RR5A 2MEWA 4Y3CA 1HNZJ 3GR0A 2XLJA 4J2EA 2PO4A 4KPYA 1HFEL 2QV6A 4W98A 4H03B 3R8YA 1M1GA 4ED1A 4OLPA 2YBVA 4A59A 1QSYA 3EKUA 1X31C 4CI6A 4IQXA 4ZDNA 4AYBD 1KQKA 2D9PA 4DR2J 2IA0A 3S3NA 1RHJB 3O3LA 4QIGA 4LFAK 2HHVA 5JVGL 2XSFA 2AV5A 1XR7A 3CGIA 4I6WA 4KQZA 4CLLA 2JGUA 1VQNN 1JL2A 2KYXA 3KLIA 1FKPB 3HK2A 4EFHA 2HMPA 3IFEA 2E2NA 1TUVA 3PIPL 3ZTOA 3MEDB 1RHMB 3CD7A 4RG8A 3EEQA 1S49A 3ZT3A 5KQ8A 2ZH9A 2E2OA 2YNFB 1KXPA 2KFZA 3T5JA 2LU2A 1FJGF 2KZZA 2FDNA 1TL4A 4ER8A 3L0QA 2CH6A 2UXCJ 1Q82T 3JAMU 3HYFA 2CPJA 4XO0A 1ASWA 1FA0A 2O4GA 2E1PA 1RWKB 1LFWA 3OBYA 3DLRA 3OXFA 3H40A 4RUCA 3DRSB 2C2MB 2FZCB 3OTOJ 4V19S 2GWKA 4DU1A 1EP4B 4KO0A 1S6QA 2HLUA 4CYUB 2P9LB 5CD4A 4DR6J 2ABYA 2DFEA 4OI0A 2DGXA 3HFVA 2ZBPA 2UUBK 1NGDA 3PRBA 1RGIA 1S48A 2ZWHA 3U8XA 1SH2A 3NEKA 3SAHA 4CJEA 5HQMA 2FTRA 3RR7A 5AQRA 2KT2A 3OPKA 3W8PA 2FSJA 1QE1B 1UFWA 4FK4A 2WHOA 3O1WA 1R27B 1SJ1A 1LOUA 2DO0A 1VIXA 4QYZJ 4CJKA 4USJC 2B5JA 4BWMA 4K4TA 3V9ZA 2ALZA 3BZKA 2ZM6J 3HHEA 3EGZA 4OHZA 4KHPF 3CFOA 1GMWD 1ZTTA 2KT5A 2BV3A 4X2BA 3TTFA 4LC9B 5DJBA 1GXLA 3FQLA 1R0AA 1FNMA 4FPRA 5F3ZA 1U4BA 1WKLA 3BBFA 2C2EA 2PMWA 3QAUA 4MMOA 1S99A 3WEEB 2E4LA 5B0AA 1JXLA 2K1RB 2PI5A 2DR7A 1FESA 4JI3K 3T1HJ 3MZIA 5KFOA 1KFDA 2LEBA 4CQ1A 4A8YA 4HH0A 4YDUA 5JVHL 4B9NA 3GMGA 2YHXA 2BKNA 4PXBA 4LFBJ 3HVRA 1B3TA 2ROGA 3NHGA 1RDUA 1WOOA 3SCIE 3IN5A 5EUHA 1KVJA 3HI0A 1VQON 2KXFA 5EVZA 2HS4A 1M5VC 4DV2K 3OYDA 3D66A 2XS7A 2P6TA 3CD6N 1HWKA 4JKGA 5JVGQ 3JTNA 4X4UA 4IG0A 5AQYA 1DHMA 1S77D 5ADXH 1FKOB 1FT8A 1ZA1B 5F8GA 1VQKS 1YF5L 2V51B 3DLKB 3VAHA 4WPAA 3GJRB 2RU3A 2PBDA 2D3ZA 5AXLA 4DL2A 2X6SA 2RHKA 4YS2A 3TQ1A 2DRBA 4JI4J 3ZXWA 2F65A 4NCGA 1DEJA 3OLBA 2ZFHA 1NMEB 4MJKA 2Q6BA 2B7CB 3KHYA 1BWEA 3D54A 3GFXA 1RDCA 4DV7K 1EXQA 1N5QA 3KOAA 2V94A 1WEZA 3L4QA 1X9MA 3GIRA 2I0XA 3B54A 3CJKB 5EU7A 3UD4P 2IM3A 4ZN3A 1RT2A 2C2NA 1IKXA 4L72B 4Y34A 5F1XA 2ZC4A 4OV6A 4AQYF 3NOGA 4Y0FA 4H4MB 4USIA 4JAXA 4DUZJ 1DQ8A 2J7WA 2EKNA 3GONA 4NXMF 4Q43A 4M3TA 4UUWA 2K2PA 4YB5A 4KHYA 3K5LA 1BUPA 4ICLB 3MEGA 2HLTA 4RW6B 1N0VC 3MAQA 3TR8A 1UPMB 4P2SA 3J8AA 4CO1A 2H54B 3KUHA 4BR2A 1P6TA 2YVSA 1PJ7A 3L95X 5SUHA 4CGDA 5HMZA 3BH6B 2JEGA 2HQCA 1XUPO 3AOBA 2O4IA 2ZBRA 3GIJA 3D6MB 2ZH6A 1KD1T 3NDKA 2L3MA 2XHWA 4RWTA 3RWUA 3PX6A 1A5XA 1BDGA 3LL3A 5C24B 1BOTO 3EPIA 4B3RF 3DOMB 2VH7A 5IQQA 4M41A 3K9JA 2D4WA 4ZIWA 1AFIA 4O5FA 4M95A 3MCPA 4FLYA 3Q23A 5C12A 4BE2A 3KJNB 2F7VA 1WC4A 2OJ3A 2ATQA 5DDQC 2YHAA 5BN8A 5L9NA 2FLOA 2W24A 2KFNA 1SI9A 2HAFA 2K7JA 3DLHA 3OL9A 2F5GA 4H4KA 2AEMA 2VFSA 1YJWS 3HZ6A 2MQLA 1BLUA 4K0KJ 2B7BB 4K4XA 4F3TA 4DV6F 1CBKA 5G4DA 1VQPN 3NY0A 2V34A 3AVAA 2ZJQQ 4CGHA 4J9QA 2NLXA 3E8OA 4IH6A 2WBNA 3TVZA 1PBAA 3RR8A 3HZGA 3FK4A 1BXNA 3AVJA 3LOUA 1T6DA 4M5IA 1ZAWA 2PMZD 3NGTA 4NYOA 3BZQA 3PY8A 3D2EA 3AODA 2W01A 1VHFA 3O8MA 2CNNB 1TL7B 1CJTB 2CZ4A 3KFWX 5CYJA 2EC0A 4B3MK 2XLIA 2AJQA 4YR0A 4E19A 4KH4A 1MN9A 3CSKA 2GV1A 2OKQA 3VQSA 1EETA 2RQ4A 4CGFA 4YHHJ 4RLEA 5GMDA 2OELA 1KVIA 5E3CA 2VODA 3ULEA 3VWSA 1U2RA 2XY6A 2G13A 2MYFA 1GMVA 4DR4K 4OVLA 1RBLA 4BLGA 4EK2A 3AQOA 3CERA 4LY7A 2DHXA 3KK7A 4PEOA 5FPMA 3MM8B 5CYMB 4DV1F 2HNYA 3I6PA 4U7CA 1WUUA 3M1VB 1L3KA 2NSBA 2R8HA 3D5MA 4NZ7A 1W9HA 1RT6B 1GK8A 1VS3A 4C8LA 1K6YA 3RMAA 4NA1A 2OD6A 4RL1A 4LH4A 2YKQA 3D3CJ 2ACMA 4LFCK 5GMEA 4WIQA 3NGIA 4FM1A 4PAAA 3ZTPA 4FJIA 3ISZA 1XMOJ 2EC2A 4DQIA 1IBKK 2MKHA 5KFQA 1Q8BA 2ZH5A 5T7BA 2DKOB 3OYIA 5D3GB 4Y2AA 1NNEA 4LSNA 4BRDA 5KT6A 2DXFA 3EKSA 1TV6A 3FVYA 4DCOB 3QGHA 4MYUA 4PZVA 2Z58B 3ZSZA 4P2FA 3KKRA 1N5TA 2BQ3A 3MOJB 2JWKA 1WACA 3P1GA 4WP8A 3GG4A 5GINA 4C8MA 2B3TB 4NCAA 2NRXA 1X0FA 1IG9A 3O9TA 1DKGD 2DCLA 3IAYA 1LWXA 3D6HB 3QNWB 4XDDA 2DGWA 5HVHA 1GLDG 4B1YB 2JL9A 1L3VA 1YVUA 3UQSA 1U48A 2KYZA 5DS7A 2VV5A 3SUNA 3TTCA 3HCXA 3FBFA 3D1OA 4ZIVA 5IWAK 1QAJA 4G6VB 1K73T 5IS2A 4FM2A 1W25A 2E7XA 2HQGA 1ZPWX 3OFGA 4Q2LA 5KFYA 3QFPA 2OPPA 4CGJA 3NWRA 5BR8F 1JLGA 2D0PA 4TLRA 2UUWA 2ZC3A 1T9YA 4CIFA 3RBEA 5IT4A 4OX8A 4OKJA 2RQCA 2IS3A 4UOGA 3VF0B 3QPIA 3R5AA 1CS4B 2NR0A 2DY4A 5EXWA 3JQMA 1CZAN 1T6CA 1S97A 3QEXA 1K9MO 2ILZA 2OFGX 4FBTA 1T9TA 4EU0A 1HYZA 2OPQA 4CO2A 3GPAA 4OZ5A 4OL8A 4DV7F 2G0CA 2APOA 2MSSA 5HROA 2H51B 5CXTA 2MKKA 1B92A 1IBLJ 3PJXA 3TZXA 1U1NA 1DARA 1RT4A 1PILA 1YJ7A 1WC3A 3QEWA 2GJIA 2QWRA 2ZJRL 4NMXA 2UXBJ 4OHVA 1HQEB 2ROEA 3GJTB 1RZMA 3MEKA 2D7SA 3M2UB 3AAPA 2VF3A 4CJ7A 4RNNA 4JI7J 2W8KA 3BN4A 3JSMB 1O51A 2HQIA 4USWA 4BRIA 4K0KF 1YI2S 1HNZK 3WXMB 2BJ7A 1WOQA 1JNZB 3T41A 2R2SA 4JYAF 2AHOB 1N48A 4PRFA 5C10A 3SSQA 2YHYA 4H0YB 4H8KA 1LQ9A 4JD2A 1FDNA 3VQDA 2EVZA 1PCAA 2ZH7A 3GSIA 1VRTB 3MEEA 4R5PA 5C2CA 1LNQA 2YKOA 2NREA 2B6AB 1V6HA 3EGNA 1VQOS 5KFAA 4OI3A 3RSEB 4IR1A 5J2QA 1VSEA 5I42B 3CCRN 1ZZFA 1L3UA 3IUCA 3G4SN 2EBGA 2ZGZA 2XQCA 4EI2A 1SH0A 3OLAA 1XJWB 1HA1A 2WVCA 3IRWP 2P9EA 1VQKN 3B6OA 4N41A 2HNYB 1YJ9N 3A8YA 4AT1B 4FVUA 1RAAB 4NLUA 4FYWB 2XBPA 2QLXA 4FF3A 2VC0A 4WFNQ 4ZP8A 4JP8A 2PDAA 1S9FA 4PXCA 3ZTSA 1S9GB 3Q24A 3FUYA 2N3OA 4F9OA 2FXUA 2X7IA 3NGDA 2HHHJ 3NBPA 1MWKA 4NL5A 5KFBA 1QY7A 1QQOA 4L3QA 4NB4A 1ASVA 5FLXY 2DNLA 2DGQA 4OHWA 2MTLA 1U1MA 4WFAL 2KHDA 4CJUA 2UUCK 3AD7C 3U27A 5HVGA 4HR2A 1U1PA 2MJNA 4E0DA 2DO4A 1RBSA 3CCJN 2DIVA 5AXNA 5IV4A 3T7ZA 1DLOB 1G7CB 4DQQA 3AVKA 2LECA 3BGRA 2AJFE 1BHNA 2R8GA 4QPTA 3VGSA 4RW8A 1QQNA 4MO5A 5FRNA 1UCNA 3BBCA 3FBCA 2EKYA 1FD8A 1O6XA 4FYYB 2V8GA 4LF6F 2XI2A 3TUPA 3OYMA 4KI4A 3I56N 2IVOA 2RRBA 3BGFA 2MGZA 5L1KA 3NGUA 2RUSA 5JXSA 1JJHA 1Y7PA 1UAWA 2ITGA 1YTYA 2UVRA 4ILLA 1GLJO 2CXEA 3QLHA 1OSDA 1REVA 4FWLA 3UD3P 3H8YA 1K1SA 1NHKL 1KONA 1HNXF 4CIOA 2Z57B 1T8EA 1YVFA 2KJWA 2FHJD 2HQFA 4PWWA 1YHQS 4CGIA 1KQGB 2WAQD 4ZPTR 1UJ4A 1H73A 1BU6O 3Q7BA 5MLCQ 2U1AA 2PN6A 1FFGB 3SNNA 4ALZA 2UUTA 5K20B 3IBWA 4CDIA 2HBMA 4ECTA 4CEAA 2PYLA 3AVIA 5D4LA 3E9OA 3N5BA 3HPHA 4ZP6A 4WTYA 3FZ2A 1VSIA 1LW0A 2R8KA 2BJ3A 1X4GA 1ZAXA 5KFJA 1U2VA 1Y11A 4M5GA 4DSEA 4UZBA 1VCTA 4QWDA 5CAAA 1H38A 2E6MA 2MKSA 4DXLA 4QS7A 5JVHQ 3EPGA 2CJKA 3AA9A 2G2OA 3QNOA 3QERA 2W7PA 2W4DA 3L09A 4DR3J 4BREA 2CG8A 1NAQA 5A8RA 4H4OB 1ATRA 3J81j 2YNIB 4JI4K 1LWFB 2ZBCA 1HR0F 2QZ8A 4CVNE 3NCQA 5LJ3Y 5KG5A 4G1QB 4KHPJ 1JCEA 4USUA 3HDSA 3CCQS 2HNZA 1T02A 4YEAA 3VF4A 4OI2A 2RS8A 3R27A 5IZHA 2O66A 4MKYA 2W9BA 3MWTA 4CEOA 3QIPA 4H4KC 2FJWA 3SDEB 4J9OA 1X4EA 4LBPA 2C42A 4Z4CA 3ZSQA 4YR3A 2V5HG 3HVTB 2HHTA 2ERRA 4RNMA 1X3NA 2O8EB 3M1VA 3U9ZA 2Q97A 3KK2A 4BVOA 1FJGK 2WOMB 3BS9A 3J80U 4OJGA 1H74A 5BPNA 4NXMK 2NYIA 3AVBA 2B4UA 3E3XA 5C2GA 3NS6A 4DR6F 1GAOA 1VISA 4G3IA 4CWBA 2V52B 4JV0A 1XMQK 3MF5A 4MIAA 4LFCF 1SC3B 5HN0A 2AJ1A 4MLEA 4NO7A 3ZTQA 5AFUH 3MFHA 5AR0A 1T3VA 2QWPA 2UXCF 1U26A 3M6WA 2V2QA 1WF2A 4K5SA 1LW2B 2B4OA 4XH5A 1SV5A 3L4IA 1S1VB 2LXFA 4BC2A 3OXGA 1NSPA 1NJXA 5EY4A 2NNWA 2FPHX 2DCUB 3I5BA 5KOXA 4F4XA 4JYAJ 3SUPA 3CCQN 4UOFA 3PCOB 3OW2M 4LF8K 5B8HA 3I9ZA 4IH7A 3VVTA 2VA2A 5CYMA 1RTDA 4DTXA 5HOOA 4A62A 1S6UA 5J2QB 2A6AA 1U49A 4CJ5A 4JKFA 3TX0A 4BROA 2ZH2A 1N32F 1BG3A 1YBAA 1VQ6N 3H90A 3CDWA 3KWIA 4M5LA 2UXBF 2XSJB 3U3GA 4CF9A 2Y1RI 1BGXT 1RWWB 1JB0C 3C16A 3N4WA 4A8XA 4P10A 1FJCA 4OLAA 2HSTA 3MM7A 4U7BA 2GFFA 1WOSA 4IEIA 4C7QA 1CVJA 1ZM2A 1TR0A 4IDHA 4FLUA 3TABA 4NXNF 3KYLA 3IM9A 3HVTA 2GMJA 2X3GA 1UJ6A 2YPZA 2EFGA 4NWBA 1DRZA 2M3DA 4ENOA 1TUWA 2ZJPQ 3M6UA 3Q89A 4XDCA 2NPFA 2E1YA 5E3PA 1NK4A 5C42B 3LH2S 4KIAA 4B8CA 3VQBA 2CWKA 3PZPA 3CCES 2WCXA 4DUYJ 4DV4F 3QICA 1IR2A 1Y00A 1SC6A 4X4TA 2GX9A 4X64J 2VHGA 4UW2A 1FRXA 3KHHA 4M3YA 1H3DA 3KDOA 3L3CA 3JYTA 4B3RK 3Q8SB 1FW6A 1RU2A 5HJYA 5F0UA 5B08A 2CG4A 4CJPA 3I87A 3UDEA 3E1YA 3DMJB 1QVGR 2DNGA 3A0IX 4N77A 1LWFA 3HZEA 2GGPB 4DR5J 4LRDA 5IXUA 3CJ1A 3EICA 1U47A 2G8HA 2MLYA 1MWZA 4DV3K 2RF2B 4JS5A 1J5EF 5E3AA 1UWBB 2E9ZA 4G1QA 4HUEA 2VASA 2Q0RA 2R8JA 4FYDA 1V3ZA 4UQTA 4EO6A 3W3SA 3K5NA 2BOAA 2ZOGA 3KLIB 3SBGA 5DDRC 4DPXA 5CQGA 3CCRS 4DS5A 2ZH1A 3D7SB 2RNEA 4Q8FA 4U6PA 2R7OA 4RUAA 2FC8A 4ETXA 1KAZA 4ID1A 1VSDA 1X8DA 4DU8A 2UXDF 3SQGB 4LF9K 3HD2A 5K9FA 4JRPA 3IO1A 2EXUA 3LP0A 3LGNA 4GV9A 5CZ1A 3GB0A 2AJ4A 1M1HA 1LW0B 2QSWA 4YHHF 2AP1A 3H46O 3CEDA 1CQNA 4MKAA 4CLTA 4F4AA 4CE9A 4FCYA 3D9BA 1ZM9A 1IBMF 3C65A 3CVKA 4O3QA 4R25A 4JKCA 3LDLA 3PRVA 1NGEA 4WWSA 3CW2C 2CPXA 3UD5A 4H54A 5HMWA 3BBBA 5DZ6A 4LJMA 1WSGA 4U67L 4HDGA 5GAHP 1T05B 4ELTA 4L75A 1CZBA 1G15A 4U9RA 4ZVGA 4DTMA 4O44B 3JXOA 3CIPA 4KV8B 2FZGB 4X65J 3Q8UA 3ZZOA 3VF6A 1A0OB 3BO4A 2XM3A 4OYPA 2JDJA 3S1TA 4USMA 5BRFA 1GLFO 2XMMA 1XNRF 4RU2A 5AJ3K 5ETNA 3M9NB 1WNSA 3QRPA 3G10A 2VKRA 1JLFA 5FLXU 2COLA 1OO0B 4PPDA 2PE8A 3EY1A 3R1XA 3LF0A 2BTFA 3MXMA 3MUMP 4WXWA 1F2HA 2FJXA 4Y6IA 2W4PA 1RKIA 4CFBA 3H5SA 4L74A 1OS5A 1IR1A 1A9NB 4C8KA 1ZBTA 1HWLA 4BGBA 4JN4A 1SXLA 1O0PA 3IG1A 5KGWA 3TTDA 3UE5A 2QFJA 1WC1A 4BDZA 4EBCA 1IKVB 5J2PA 2E9RX 1VSMA 4F02A 1RWNB 2BXJA 1WUAA