3LALA

Crystal structure of hiv-1 reverse transcriptase in complex with n1-ethyl pyrimidinedione non-nucleoside inhibitor
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
553
structure length
553
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords HIV Reverse transcriptase
publication title N1-Alkyl pyrimidinediones as non-nucleoside inhibitors of HIV-1 reverse transcriptase.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
total genus 157
structure length 553
sequence length 553
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3lalA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3lalA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3lalA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3lalA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3lalA05
2RKIB 1QQCA 3DRSA 2JC1A 3RRGA 2ETJA 3AA5X 3O4QA 2WB4A 3MEGB 4FW1A 3B6OA 4Y1CA 2HNYB 2RN2A 2RF2B 1S1UA 4W5OA 3KKRA 3I0SB 4CIEA 4I9QA 2G8FA 1VSKA 4M3ZA 3LP3A 4IR1A 2YNHA 1S0NA 4EYIB 3V9WA 3KHGA 4Y2AA 1WLJA 3CDUA 3PUFA 4FBTA 3BSAA 2F8SA 3DMJA 1XR6A 4PQUA 3TAGA 4Z4HA 1S97A 4NLSA 5KT5A 4KAIA 4CESA 2UVVA 1GOCA 3E01B 1RT3A 5DG8A 1S5JA 2X6SA 4H8KA 2OPRA 2UUTA 4DL5A 1ZBLA 1BGXT 1S1TB 3WNEA 4ELVA 3MEDB 5FROA 1WAJA 4E1NA 1G15A 3BSNA 1KHVA 1EXQA 4CEAA 2QXFA 1BIZA 4DS5A 1IO2A 4NYZA 4RW8B 3VQQA 3RWUA 4N41A 3L8BA 4MIBA 4N5SA 4CEZA 4IFVA 2HVHA 2G8UA 2JEJA 3RBDA 3V6KA 4CJPA 1NK0A 4R0EA 3KLFB 2D0AA 4XPCA 4IBNA 4BACA 2NUBA 2DFFA 3M8PB 1U4BA 1RT1A 3Q8PB 3U3YA 3T5HA 4FLWA 3QERA 2YNIA 3ZT4A 2KTQA 1UWBA 2YKNB 3SV3A 5KG7A 3TANA 3CFRA 4NLTA 2ASJA 4DTPA 4MFBA 4AILC 1FK9A 3GYNA 2XHBA 4ZP8A 1J54A 3FSIA 1RTDA 1WAFA 4ED6A 3SFGA 4IRCA 2C2DA 2JLEA 3HKWA 4HUEA 1JLFB 2FBXA 3EZ5A 3QGHA 1MMLA 2I1RA 2BRLA 4U6PA 4Q45A 1S1XB 5KGXA 2DY4A 3SJJA 1U47A 4J2DA 1TVRA 4MIAA 3H4DA 3K5LA 4EBCA 1RNHA 4CEDA 3PY8A 1YTUA 3ZSOA 3M9OB 4CJTA 4C8KA 3RB0A 4Y3CA 4NRUA 2AX1A 5L1JA 3KLGA 3Q8QB 4I7FB 4DTXA 2UUWA 1VSLA 1X9MA 3OJSA 1S6QB 2D5RA 2YNFB 1RT7A 3PZPA 2ASLA 2HHSA 3CIZA 4J2BA 4DTSA 4NLWA 2D0BA 4M95A 4EYHB 3NMAA 3C6UA 4DU3A 4CHQA 2R2SA 4KHSA 4PWDA 5DGAA 1TKTA 1BCOA 5CZ2A 1WSFA 4E19A 3IAYA 3NE6A 2IAJB 4EBEA 1UA1A 4K50A 4O44B 4FJ5A 3MR5A 4F8RA 2X74A 5KFUA 3NF7A 1NKBA 4DSEA 4DSJA 4IFVB 4I2PA 2WONA 3CWJA 3ZT0A 1S1WB 1MU2B 3SUOA 1C1AA 5JUMA 3PHEA 2ILZA 1IG9A 4ICLA 1O1WA 3SPYA 2GV9A 3F9KA 4ZPCA 2ILYA 1KRPA 4Q8EA 3ITHA 2IGIA 3GV7B 1NJXA 2OPQB 1HQEA 2P5GA 2RDIA 1NKCA 4OL8A 2JC0A 3WNGA 1RTDB 2EHGA 3KLHA 1HRHA 3KLEB 4KB7A 1KLMA 4K4SA 4YNQA 1C1CB 4BDPA 3O3FA 4O4GA 4OKJA 4CEEA 3LP2A 1Z4UA 4IR9A 5KG3A 1GOAA 4YR3A 1TL1B 3PVXA 3OYEA 4DSIA 3QNOA 5KFRA 3DLEA 3KOAA 4KSEB 2W9CB 3Q8SB 1C6VA 4W5QA 3AVNA 4IKAA 1RDCA 2IS3A 3CO9A 3KLVA 2O5DA 1HNIB 5HROB 4ZPDA 3BQ2A 5KFEA 4GC7A 2KQ2A 3V9XA 1RT7B 3EPIA 3IS9B 3T5JA 3QIDA 1KFDA 4RNOA 3UR0A 4DQIA 1BQNA 2ALZA 2Z1JA 2XCPA 3V1QA 2Z1HA 3G0ZA 4RW4B 4WFZA 4G3IA 5HRRA 4YMEA 3QGGA 1NHUA 3BREA 1JLQA 3CQ8A 4IQXA 4JV2A 1SL0A 1VRTB 1JLCB 3L2QA 5I3UA 1X9WA 4YFUA 3NGIA 1QE1A 5FDLA 4KKOB 3PJWA 3TQ1A 3V9SA 1NK4A 3VQ4A 1LWCB 2IJFA 4QPXA 3LP0A 5DGBA 4DG1A 4I2PB 1SL2A 3P5JA 4ICLB 1ZBFA 1UAXA 4RUCA 3I5AA 3JYTA 3HT3A 3OLAA 3BJYA 3C6TB 4WZMA 4Q44A 2O4GA 3ZSZA 2B5JB 2GBZA 5JXSA 1U45A 1L3SA 3DOLB 4OPKA 3VN5A 3OYLA 5K14B 2C2RA 3K57A 3OL8A 4FCYA 1REVA 2FJWA 4DL6A 4DQQA 4E7IA 3FQKA 4ECWA 4WZQA 3V81B 4B8AB 4FS1A 1WNSA 4M3UA 3HJFA 4DL3A 4EBDA 1TV6A 4FJ8A 2XWYA 3LP1B 1DTQA 4CGHA 2YV0X 3H4BA 5D3GA 3NFAA 5CYMA 3K5MA 4LD0A 2VG7A 1EKEA 1UOCA 5EDWA 4CF1A 4ZVFA 1L5UA 2DFHA 1K6YA 3I5BA 3V4IA 3I0RA 3RR7A 1RYSA 1RCHA 3MFIA 1C0TB 4ZPBA 2RPIA 2KZZA 4ELUA 1S1VA 4BDZA 2R7YA 3T19A 4NLRA 5HRSA 2QV6A 3CM6A 5KT3A 3CFPA 2YHBA 1BCMA 1RDAA 4Y1DA 4E1MA 2XY7A 5KFLA 5F8JA 1YVFA 1R0AA 2OPPB 5I3UB 1RBSA 3H5SA 2QKBA 3RAQA 3M9NB 4F4WA 3O3HA 4F50A 3HVRA 4EZ9A 5KFBA 5FDLB 2QKKA 3KJVB 3QO9A 3KK2B 3V6HA 3T3FA 1YT3A 3OHAA 4FJ7A 3MFHA 3K5NA 1K1SA 3THVA 2D0CA 3BGRA 1D9DA 3TVKA 1T3NA 1FXXA 4NCAA 2FVPA 4CHZA 2B4JA 4DU4A 2GUIA 2OZSA 3GIIA 2ZQBA 1A5WA 2WRMA 1VSDA 2ZD1A 4MK7A 1B9FA 4J9MA 3AVHA 1ZBHA 4BE2A 3GIJA 3KLIA 3SQ2A 2HHQA 4O3QA 4F2SA 4B8CA 4W5TA 2RKIA 1HARA 4NLXA 3M8QB 3G10A 3MEGA 2HNYA 1RILA 1VSHA 3VA0A 2RF2A 2HHUA 1JLAA 3I0SA 3IGVA 2ITGA 4WFYA 3QNNA 3SI6A 5J2QB 5KTQA 1S6PA 3SUQA 4DSLA 3AVKA 3K5OA 1ZTWA 4DTRA 1B92A 4E0DA 1KVAA 4Q43A 2QE5A 4WYWA 3E01A 3EYZA 4QOZB 1XR5A 2W8KA 4NLDA 4AHSA 5C5JA 3SNNA 1FKPB 3I0RB 5KFAA 2EX3A 2WTFA 3VQ7A 1TL3B 3MEDA 4RUAA 1BIUA 4BE0A 3MXJA 1ZBIA 3MTKA 2VWKA 4DFJA 4B9NA 4ED8A 4K4UA 1CLQA 2XO7A 4CK2A 4J2EA 1R0AB 2R8KA 2R2TA 4RW8A 3OYGA 4FK4A 2G8IA 3OYIA 3KK3A 4E7KA 1Z25A 4ED2A 4AHCA 5T14A 4CJUA 4KV8A 4GC6A 3GV8B 2IOCA 3RTVA 4OLBA 4TQSA 3GIKA 4TXSA 4BE1A 3RB6A 4H4OB 4K4WA 3FDSA 1Z26A 4LSLB 3QEXA 4HHTA 4IKFA 1XWLA 4LSNB 3AO3A 4OVLA 4N76A 1SUQB 4RW6B 4NRTA 4KHWA 4NLPA 4J9KA 2IC3B 1RTIB 3HP9A 5KFMA 1JLFA 5F9LA 4FJXA 4H54A 3OYKA 1C2PA 4OLAA 2G8VA 1JLAB 1TKZB 1S1XA 3OL7A 4ZP7A 3IG1A 4FVMA 1BISA 1SKWA 2HAIA 1U49A 3OLBA 2WOMB 1S6PB 3ASMA 4DWIA 4N47A 5KFKA 2A1RA 4HVJA 4I7FA 1L3TA 2YKMB 4PY5A 1ZTTA 2IM0A 1BQMA 4ZVHA 1WSGA 4ZHRB 2XI2A 2R8IA 1S6QA 4C8LA 2YNFA 2JEFA 1S9GB 3ZSVA 3PX4A 3HPGA 3ALYA 3AVBA 3CJ3A 3UPFA 4IOBA 4NLQA 2V4QA 1VRUB 3RB3A 1J53A 4OPJA 3ICLA 4DU1A 5F9NA 3FFIB 1RBUA 3N6LA 3OHBA 4CFDA 3E51A 5L9XA 1EETB 2IAJA 3PV8A 5C25B 1NHVA 4O44A 4TLRA 5KI6A 4R5PA 2YNGA 3HO1A 4TQRA 3AA3A 3DLHA 4NLYA 3KK3B 2W8LA 4KV8B 4KBIA 3LWMA 1T05A 3H5UA 1S0MA 1BI4B 2F8EX 1S1WA 1MU2A 1TKXB 5KFCA 2FBYA 3OYJA 2B6AB 3LWLA 3PW0A 4KPYA 3L2WA 4DSFA 4LH5A 2OPQA 1WN7A 3BQ0A 4C8OA 1ASUA 2HHXA 3DLGB 3C95A 4ECRA 3RAXA 2IA6A 5L1KA 3HK2A 3AV9A 3DI6A 1IKVA 3KLEA 1EX4A 4O3NA 1C1CA 5J2MB 1D5AA 1ITGA 4X2BA 1GX6A 2XI3A 2XY5A 3OS2A 2HNDB 3NGZA 4ID1A 4K4YA 1TL1A 3AVGA 1WNEA 3IG1B 4F4YA 4CFCA 3NF6A 3CYMA 4HTUA 3NAEA 2W9CA 3CJ4A 4B9MA 1KCFA 4FM1A 2F8TA 2E9RX 3OYFA 1HNIA 5HROA 5KFSA 4QW9A 1BQMB 2JGUA 4AH9A 3IS9A 3SYZA 5KFQA 1U04A 4J9OA 1NJZA 4CJWA 3KMQA 4KHYA 3DM2B 4RW4A 4TYBA 1HYZA 4G1QB 4KHNA 1TKDA 1VRTA 1JLCA 1HNVB 3VQEA 2DPJA 4KO0B 3HVAA 5C42A 2OH2A 2XY6A 5I42B 3MR3A 4R5PB 2XGPA 3MR6A 2YNGB 3HPHA 1CXUA 4KKOA 5J2PB 1LWCA 3BR9A 4CGFA 1T05B 3RMCA 3OL6A 4OJRA 3N6NA 2OZMA 2CJQA 3NL0A 3M9MB 2F96A 4YR0A 4QAGA 3ISND 2X6NA 5DG7A 3ZSRA 3V6DB 2VA2A 3C6TA 4CEOA 1SKRA 2P1JA 3SV4A 3V1RA 1RTJB 3NF8A 3NF9A 2B5JA 3KHLA 4HYKA 4CJRA 5EUHA 3DOLA 2XCAA 5K14A 3KIOA 4Z4IA 4HCCA 3KTQA 3ZSQA 3DI6B 1IKVB 2G8KA 1QUVA 4FW2A 5DG9A 5L1IA 3PO4A 3HP6A 3V81A 4FJNA 4OGCA 3V9UA 4URSA 3PW7A 4EP5A 2FJVA 3HVWA 5SZTA 4TYAA 3LP1A 1W0HA 1U09A 5DMRA 4NYNA 1CZ9A 5KG5A 1KTQA 2JEIA 4CECA 4ZVGA 3CG7A 4NCBA 1N5YB 3KNAA 2I5JA 5J1EB 3U3GA 3PR5B 1RBTA 1EP4A 3KHRA 3NDKA 4IRKA 2R2UA 3AO4A 3D45A 2PYJA 3VQBA 4JV0A 3HHKA 1C0TA 1D0EA 3KMSA 4RW7B 3TI0A 3CJ0A 3TARA 1JLBA 4O3OA 2FBTA 3G6VA 4NLGA 4J9PA 2AJQA 1A5VA 2P5OA 2Z1IA 3AA2A 4CEFA 4I2QA 2OPPA 3OS0A 4CCHA 5F8MA 3B6PA 1XHZA 4I9LA 1JKHB 5C42B 1CSJA 3UQSA 4DFKA 4ZPAA 4TSXA 4ED7A 3T5LA 2R8JA 4CK3A 4KFBB 2BQ3A 1D1UA 3KJVA 1S4FA 1N48A 4M41A 2W9BA 4J9NA 1QHTA 2R2RA 2E9ZA 3KK2A 1RT5B 2OYQA 2KFZA 2J6UA 4XO0A 3L3UA 3MEEB 3KK1B 3ZSXA 3NH0A 4W5NA 1HJRA 4FJ9A 4FJMA 4GW6A 5KFVA 2HWHA 3VQ5A 3AVJA 3HSTB 3OYAA 2ZE2B 1NK6A 4HCBA 1RT6B 2AWZA 4M3YA 4WE1B 3M8QA 1N6QB 4RZRA 1X1PA 3NBPB 3QZ7A 4URQU 3KKSA 4K4ZA 3S9HA 1TGOA 1C0UB 3TAMB 4ZVEA 4KREA 4FJLA 5J2QA 3V6JA 1LV5A 3TR8A 2C28A 5F8HA 3QIPB 3H5XA 1S9FA 3OJUA 4JV1A 1TQLA 3G86A 3OYHA 4AHTA 4KRFA 2C22A 2OA8A 2LSNA 5CYQB 4ZP9A 2I5JB 4Q8FA 4CIFA 2BDPA 4YP3A 3ZSWA 4F3TA 3ULDA 1EP4B 5KFXA 2DFEA 3D5MA 1FKPA 4LQ3A 5DQGA 2Y1JA 1JLBB 1TL3A 4FLXA 4ID5B 1SH2A 3BSCA 3V9ZA 3S3NA 2Z1GA 4XPEA 4M3WA 2FVQA 4DQRA 4I2QB 3PJXA 2V9WA 2HHVA 5DLFA 4F3OA 4ZTJA 3LPUA 2VA3A 1IH7A 1SV5B 4DF8A 4ED3A 1LAWA 5FRNA 3TAPA 4ECUA 2FLLA 3CDWA 2VG5A 2W9BB 3RB4A 3RR8A 4H4OA 3KD5E 4ZP6A 4NLVA 2FLNA 3CM5A 4LSLA 3MXMA 1T7PA 4NCGA 5KT4A 3AO5A 3CJ2A 4Z4CA 3DYAB 4LSNA 2D3ZA 4GVMA 3NH2A 4DFMA 4KHMA 3LAMA 1RYRA 1SUQA 4RW6A 1KFSA 3SQ1A 2IC3A 1RTIA 4FJKA 1UA0A 4CJ3A 1NK8A 4K4TA 3L3VA 4K4XA 3P83D 4FS2A 1Q9YA 4O3PA 3PX0A 1XI1A 1TKZA 3AVMA 1ZBUA 3TABA 2BANB 4CJFA 3SPZA 3M8SA 3T5KA 1LW2B 2XC9A 4PA1A 2WOMA 3T1AA 4J9QA 2BE2B 1DLOB 4Q0BB 5KFGA 3SZ2A 2YKMA 4B3OB 3IRXB 2AGOA 1VSEA 4ZHRA 5T7BA 5HBMB 1S9GA 3S3OA 4RNHA 4Z0UA 2QK9A 4QWEA 1RBVA 3AVLA 4IG3B 3LAKA 4NLOA 2FVCA 4E7LA 4MQ3A 3L2RA 3HVTA 1GOBA 1NKEA 1RDDA 1VRUA 1T8EA 4OKEA 1QAJA 4CGIA 4YR2A 4K8XA 2XRIA 3FFIA 4FLVA 4EZ6A 4DMNA 3NCIA 2HMIB 3SUNA 3IGNA 4DSKA 3EY1A 3QEWA 5C24A 1EETA 1KHWA 1HQUB 5C25A 3OVNA 1T03B 1JLEB 2CKWA 4ED0A 4KB0A 3QEIA 1L3UA 4FJJA 4B08A 4FYDA 3BDPA 1BI4A 4IH6A 2HNZB 1L3VA 2FBVA 2VG5B 1TKXA 1CXQA 1F21A 2B6AA 1BHLA 4DLGA 3MR2A 2E6LA 2KW4A 4NCGB 4MKAA 4B9TA 1JXBA 4CGGA 1RA6A 3M8RA 3H08A 4IRDA 1YVUA 3DLGA 1SH0A 3PW2A 4KI4A 2AU0A 3G6YA 3D0PA 5JS2A 1KLNA 2FVSA 4ZTFA 5HLFA 4O3SA 3PW5A 1S9EB 1RAJA 4DEZA 3SCXA 3DLRA 5J2MA 4E7HA 4ECYA 2IM1A 2HNDA 4CJLA 5F8IA 3H59A 4UQGA 4Z4EA 4BWJA 4DTJA 5KFFA 3VQCA 3DRPB 3MECB 1HYSB 4IH7A 4QWAA 4CIGA 2WCXA 4FLUA 3L2VA 3S3MA 2E4LA 5HP1B 2D41A 4F2RA 5DLGA 3RMDA 3VQ6A 4M3TA 3PO5A 3AVAA 4FLZA 4B9SA 4FJHA 3NH1A 5FRMA 4O4RA 3LZIA 3SQ4A 1SL1A 4RW9B 4ZMMA 4DL4A 1QTMA 1TK0A 3HVTB 3DM2A 2VG6A 1SH3A 4G1QA 2ASDA 1DTTA 4C8MA 1BL3A 2IJNA 4FBUA 1HNVA 3QINA 1LWEB 5C24B 4KO0A 5KG6A 4KHUA 5I42A 2GIQA 2V0NA 1ZETA 4CFBA 5J2PA 4CHPA 4O0IA 4QCLA 1IKXB 2EC0A 4EO6A 4DTNA 3QLHA 4N56A 2D7SA 1W25A 4B9VA 3V1OA 2FJXA 2IM2A 4CJEA 1D8YA 1RTHB 2UVWA 4CF8A 3QIOA 3RMBA 3N6MA 2IDOA 4FJGA 4DTMA 1HMVB 4EEYA 3V6DA 2DTUA 3K2PA 2WHOA 4W5RA 1RTJA 1QAIA 1K1QA 5KFYA 3LPTA 5DQHA 4J9SA 1KSPA 3IN5A 4XIUA 4RNMA 4F4ZA 5HLFB 1D9FA 4QW8A 1Y97A 5KGWA 5DK5A 4M94A 4Y2CA 4KE5A 4OKKA 2XGQA 5KFWA 4IG0B 1IKYB 4IDKB 3CFOA 4CF2A 1J9AA 4IFYB 1J5OB 4O3RA 3OYCA 4AHRA 3DLKB 4MK9A 3NGDA 4KTQA 3L2UA 3DOKB 1RT4A 4DTUA 1TK8A 3DRSB 1N5YA 5J1EA 4FXDA 4K8ZA 3U6FA 4PUOA 3VA3A 2R8GA 5L1LA 3FQLA 4DQSA 2ZKUA 1S1UB 3SI8A 2WK4A 2AGPA 2YNHB 4RW7A 3AA4A 3ZT1A 5KG1A 4DLEA 1JL2A 2Y1IA 2VG6B 1LW0A 1S10A 5KFNA 3DMJB 4PQUB 1DTTB 1RT3B 1JIHA 1C0MA 4O5BA 2ATQA 1JKHA 3I5CA 2OPRB 3GQCA 3O3GA 2IBKA 4KHQA 4KFBA 2OPSA 5KT6A 3EPGA 3LZJA 4B9LA 2BGGA 4M45A 5KG0A 4ECSA 4CJ4A 3KD1E 3QLHB 3OL9A 1Q9XA 1RT5A 2G8WA 4DQPA 1ASVA 1B9DA 5KG4A 1Q8IA 3I8DA 3OYNA 3MEEA 3KK1A 4ELTA 3AVFA 4FLYA 1HPZA 3PR4A 1QS4A 2ZE2A 3TWHA 1RT6A 3RMAA 3OY9A 1A5XA 5KRTA 3DRRA 4WE1A 1N6QA 2BQUA 3SQ0A 2HVIA 4KHRA 1I3AA 3NBPA 3NHGA 4ECXA 1RT1B 2A1SA 3QZ8A 2E6MA 1NOZA 4O55A 1C0UA 2YNIB 3ISNC 1UWBB 3TAMA 2FLPA 4B9UA 1LWFA 3NAHA 4MFBB 4MKBA 4BWMA 1FK9B 2P51A 4KTZA 3QIPA 1T94A 3QESA 5F8NA 4FM2A 2IMWP 1RT4B 5CYQA 4PUOB 5CZ1A 4AHUA 3O4NA 4KB1A 1U48A 3P1GA 1TVRB 3D28A 3TAQA 1KVBA 4H4MA 4E7JA 2KFNA 1IKWA 4ID5A 4WXOA 4Z4FA 4GMJB 1ZYQA 1LW0B 3KLGB 2UVUA 5KG2A 4OGEA 4FZYA 4CHOA 3ZT2A 4J9LA 3SUPA 2JEGA 1TAUA 1SV5A 3OYMA 2HW3A 2BR0A 3QETA 2W9AA 4AHVA 4KTWA 2G8HA 3HYFA 5KFIA 4Z4GA 3C6UB 2OPSB 2C2EA 2KZMA 5SWMA 3VQ9A 4PWDB 1TKTB 3AO2A 3TAFA 3H40A 3GIMA 4NYFA 5HRPA 1JLGA 2XY8A 2HB5A 3DYAA 1XHXA 4WFXA 4CE9A 1TAQA 5EU7A 5KFHA 4DFPA 3OSNA 3AVIA 3H2LA 1CZBA 4EP4A 1HPZB 4ED1A 3NGYA 3NKYA 1VSMA 2PY5A 3VQSA 3K58A 4R8UA 1JXEA 2FC0A 2WONB 4CF0A 1S0OA 3DRRB 4ECVA 2YHAA 2J6TA 5KFJA 5KFTA 3Q8RB 3BSOA 3PW4A 4CGJA 4FZXC 3LDSA 4JLHA 1C1BA 2J6SA 4DTOA 3JSMA 2Q3SA 3C94A 3UIQA 1RT2A 2BANA 3ITHB 4FJIA 4LH4A 4FK2A 1QSSA 3FRZA 1HQEB 3KHHA 1LWFB 1LW2A 2V4RA 5EWEA 4QWBA 3NAIA 1RDBA 2BE2A 2X78A 1DLOA 4Q0BA 4MK8A 4YQWA 4DF4A 4NZ0A 3ZSYA 3VQ8A 3KLHB 4B3OA 3IRXA 1KLMB 1VSFA 4DL2A 5HBMA 3RRHA 5CY4A 4HUFA 4ECQA 5KT7A 4O4GB 3WNFA 4WXWA 3LP2B 3GV5B 4IG3A 3QEVA 1XR7A 4L8RB 4LQ9A 3DLEB 5KRSA 5KFPA 4H4MB 3QEPA 1XC9A 5J2NA 4RU9A 1IKWB 4CEQA 4CK1A 2UVRA 5KFOA 4J2AA 3AO1A 1GX5A 2HMIA 4F4KA 1LAVA 4CEBA 2IM3A 2O4IA 4URGA 1HQUA 2B43A 3MXIA 3VQAA 1T03A 1JLEA 4CHNA 3ZCMA 4M42A 2W7OA 3LANA 1NK9A 1BQNB 3DLBA 5JS1A 5E41A 4NLUA 1HYVA 4CERA 4M3XA 1WSHA 1NJYA 2HNZA 1JLQB 3MF5A 2VWJA 1QSYA 1JLGB 1WSIA 3A2FA 4TY8A 3HM9A 3F73A 3G6XA 1QE1B 4RG8A 1WSEA 1NNDA 4CJQA 5HRNA 5F8LA 2ATLA 3HPOA 3LP0B 1S9EA 5KFZA 4O0JA 4R8UB 4DG1B 3CVKA 1NJWA 4CF9A 1C1BB 3JSMB 4J9RA 3JYTB 3RBEA 3ZT3A 3DRPA 1RT2B 3MECA 1HYSA 2BQRA 3EZUA 1FKOA 1NK5A 3H5YA 4IH5A 4CJKA 3QGIA 1I39A 3OS1A 4JRPA 4JS5A 1VK0A 4M3RA 4FM0A 3VQPA 2GIRA 5HP1A 3LALA 1KVCA 1NK7A 1REVB 4JUZA 4DL7A 3DDKA 1RBRA 1JL1A 4F4XA 1QSLA 1TP7A 5DQIA 4FZZA 4RW9A 2RDJA 4KI6A 1TK5A 1TV6B 3VQDA 3HXMA 1RA7A 1DTQB 4E89A 1NOYA 3CDEA 5D3GB 2DPIA 5CYMB 5J2NB 2VG7B 3UDLA 2HHWA 4HUGA 4KAZA 1N56A 1LWEA 4CFAA 1WSJA 1SKSA 2D3UA 4FLTA 4U7CA 4EO8A 4E3SA 3V4IB 1S49A 1X9SA 4ECTA 4MH8A 4C8NA 1S1TA 1IKXA 4QWCA 1S1VB 5KT2A 1VSJA 4RNFA 4Q5VA 4JRQA 2E9TA 1W9HA 2W7PA 1RDRA 1RTHA 2AX0A 4CJVA 1I6JA 4CJ5A 2HWIA 3HL8A 1ASWA 3BQ1A 2W42A 4WYLA 4ECZA 4TY8B 1HMVA 4HKQA 1IM4A 3SFUA 1OS5A 3CJ5A 3GILA 2R8HA 5F8GA 1N4LA 4FK0A 3OYBA 3K59A 3PX6A 5EWFA 3OYDA 3KLFA 4QWDA 3TAEA 3QYYA 4RNNA 4DS4A 3QO9B 1S48A 2FVRA 1JX4A 3WNHA 4CGDA 3M8PA 3MAQA 3H98A 5EWGA 4Y34A 1JXLA 3BGRB 4IG0A 1IKYA 4IDKA 4TN2A 2YKNA 2GC8A 4K4VA 5KFDA 2BRKA 1VSIA 4BDYA 4CHYA 4IFYA 2AQ4A 1J5OA 2AGQA 4TY9A 1YTAA 4LY7A 2ZD1B 2PZSA 3AVCA 4JS4A 3DLKA 3OSPA 3KLIB 1FKOB 4CJSA 2PYLA 2HHTA 3DOKA
chains in the Genus database with same CATH superfamily
2RKIB 3DRSA 2F9WA 3U9DA 3AB2B 3OT9A 3W66A 3AA5X 3O4QA 2LXIA 3VEXA 4Y1CA 4WKYA 4DZ6A 2ASMA 3KKRA 1S77D 3QMQA 4OI6A 4I9QA 4PXCA 2G8FA 2F5GA 2QMXA 3LP3A 2YNHA 2CADA 1RUSA 5K8MA 1WLJA 3CDUA 4MDBA 3BSAA 2DK2A 2W4CA 5L9NA 1S97A 2AHOB 4KAIA 3GPAA 3EUNA 1M5OC 2ZUGA 5E3AA 1N8RO 5DG8A 1ZXOA 5AQIA 2ZNZA 2UXDJ 5HANA 3ADAC 2AW0A 2UUTA 2B8PA 1BGXT 2LKZA 4TU7A 1VQLS 2OEMA 3BSNA 2ZZTA 1KHVA 1EXQA 4ZK7M 5HO4A 4I6WA 1KC8T 4NYZA 1KQSM 1NZAA 2VU5A 4BR4A 4B3TF 1OSDA 5CYJA 4DUZK 1JCFA 3NGRA 5AQLA 3VR1A 3RBDA 1SC3B 3KLFB 2D0AA 1UZDA 4BACA 1NDCA 2HBMA 1RT1A 2C3UA 1RXOB 3T5HA 3QQCD 3QERA 2YNIA 3ZT4A 3TANA 4DR7K 2ASJA 2H5IB 4CO2A 4DR4F 2DKOB 1KAXA 1J54A 3FSIA 1RTDA 1HHQA 5HSPA 2C2DA 3DXBA 5BR8F 1JLFB 4BS2A 2A40A 2FBXA 1N33F 4KY3A 2HBYB 2I1RA 3PXGa 3T1YF 3VF2A 1VRQC 2BRLA 4F25A 5KGXA 2B4PA 3ZZ0A 1VQ4S 1PJ6A 3H4DA 5M1PA 3PY8A 4PXEA 3KDOA 2IHR1 3JS9A 5L1JA 3IO1A 4DTXA 1VSLA 2RS8A 3WC0A 4JP8A 4JI7F 1S6QB 5DZ6A 1PAEX 4OZ0A 4J2BA 4F67A 4NLWA 2IFXA 2G2YA 4M95A 3NMAA 3C6UA 2VIHA 2PA8D 4DU3A 2NRRA 4PWDA 1TKTA 2VHGA 2CWXA 4M7YA 2YHYA 3IAYA 3RZAA 4EBEA 1XNQK 3MPDA 4O44B 4FJ5A 3MM7B 3NF7A 5LJ3Y 1KBRA 4ILHA 4U8YA 3D6RA 1NKBA 3K5PA 1KD1O 1RDUA 2BW2A 3MN7A 4Q2MA 1HNXK 4GNIA 3J7A1 2WONA 3ZT0A 3PHEA 4ZIWA 1O1WA 2E44A 4LFBF 1NLVA 2GV9A 2ILYA 5A0YB 2CQBA 3UVJB 1WC3A 1U7LA 3DC2A 4A8XA 1R0CB 3CDBA 2YWHA 1RTDB 3KLHA 1HRHA 2E29A 1KLMA 2P5VA 4CD1A 3HSDA 4OPAA 4G1IA 4UZBA 4O4GA 1PILA 5E0OA 4L76A 3PVXA 3L4QA 3KOAA 2LEAA 4PR6A 2FTRA 2W9CB 3Q8SB 4W5QA 4ZPDA 3BQ2A 3UD4P 4YDUC 4OHZA 2VQFF 2V8GA 3FMWA 4JBCA 4DQIA 3EXYA 1BQNA 4C3KA 2BUPA 1RWNB 4F0KA 2UXCK 4ED5A 1XQIA 4FF4A 4EIAA 3IC1A 4USJC 2JJ4D 4IQXA 5GAHI 2ZH5A 2HZVA 3L2QA 3J7ZO 3R7BB 4USKA 3PLAA 2YPZA 3SSSA 1FNXH 1U1LA 1SC4B 3MK6A 3N5FA 1P9QC 1A6LA 3R7NB 4JYAK 5FDLA 4CW7B 3V9SA 3VQ4A 3IFRA 1Q82O 2IJFA 2ZOGA 4AXJA 2AYMA 4ZLPA 4IOAL 1RAFB 2CJYB 1P1TA 3CMQA 4O8KA 3BJYA 5GAGI 1NRKA 2ZEJA 4A4JA 5JXSA 5DO2A 2JWNA 1L3SA 4X4QA 3IMXA 3DOLB 3VN5A 4AL6A 1WDDA 4FCYA 1REVA 2QL7B 2FJWA 4DQQA 4DUYK 2QEXS 2YTCA 4WZQA 4FS1A 3UDCA 3FEYB 1P9YA 4RUHA 1K0TA 1IXKA 3JAMU 4EBDA 4FJ8A 3MOJB 2YV0X 5D3GA 4UF4A 2Q1LA 2QG9B 3K5MA 4LD0A 4N7TA 1LK5A 1HW9A 2QZ8A 1EKEA 2DR6A 4R25A 5H9EJ 3OQ2A 3AOBA 2DFHA 1I1GA 1Q86O 2E1MC 5T7LA 2YQ3A 4ES1A 3OTOJ 4ZPBA 1RU1A 1WEZA 2R7YA 5AQVA 2LEBA 4CO0A 2QV6A 2M52A 3T41A 1UJ4A 4AM7A 1VQON 1FE0A 1YVFA 1R0AA 2OPPB 1OY6A 2E5JA 1KOHA 3JSRA 2QKBA 1NZ8A 2IYIA 1FFGB 3O3HA 5M1KA 1T9WA 2LU2A 2E5LF 5FDLB 3KUHA 3KK2B 1K9MT 4F0MA 2DIVA 3D68A 4P74A 3OHAA 3MFHA 2Z4PA 5M1QA 3EDRB 1T9TA 1D9DA 2HF4A 2B4JA 2HFZA 3GIIA 2ZQBA 2WRMA 1R8BA 3OFGA 1B9FA 5DRKA 4J9MA 4BE2A 3GIJA 2J5AA 4B8CA 3HSZA 1B7FA 4UY8O 1YGYA 3MEGA 3AA9A 1RILA 1VSHA 5HL7Q 2RF2A 2ROEA 3ZTRA 3I0SA 4LF5J 2GQQA 4WFYA 2G2ZA 1ZZNA 3E9PA 2ZH3A 5J2QB 1QAYA 1RWKB 1SC6A 1WG4A 1YJ7A 4DV7J 1KXPA 2W2NP 1ZTWA 1WTBA 3MWPA 4LBPA 4WYWA 4RWXA 1F5BA 3GE1A 4NLDA 5BYQA 1LXJA 4B3MJ 5C5JA 3ZYYX 1FKPB 4WK1A 1H98A 4DX5A 1TL3B 3MEDA 1VJWA 1BIUA 3MXJA 3MWBA 2AKWB 3VEWA 2KI2A 4BRKA 4ED8A 1R0AB 4FPRA 3TUJC 4RW8A 5IS2A 1S76D 2DRBA 3ZLJA 1SIZA 4DQ8A 5T14A 3L7PA 3RTVA 2IOCA 1QY7A 3ZO7A 4J91A 5JVHQ 2XEXA 4IKFA 2QA4N 3W60A 2OELA 4LSNB 3BKFA 2B4UA 3UKUB 3MAHA 4RW6B 4NRTA 3W5XA 3Q22A 4H0TB 2GIFA 3P4UB 5KFMA 1WHXA 4JHDB 4B1XB 2QLFB 3A8JA 3HDSA 3OYKA 1UVIA 1VK3A 1C2PA 2ERRA 4LF9J 2RIJA 3O8WA 4RBVA 3IWXA 1TKZB 1S1XA 4I6YA 4FVMA 1Y5LB 5AQFA 2Q43A 1YX2A 2AA4A 2ZBRA 1NH7A 2FLOA 3ASMA 4DWIA 3RYLA 1VHXA 4ZPWR 2L41A 5B0GA 1YI2S 3A8IA 1PIEA 4ZVHA 1WSGA 2AEJA 3TU5A 2JEFA 2QFJA 1FD8A 2UP1A 3DAWA 3IBFB 1CJVA 3FFIB 1RWPB 1N32J 3N6LA 1MMDA 3VAMA 2HBQB 5M1NA 4CFDA 2V68A 1EETB 1SJFA 2IAJA 2BACA 3PV8A 2R7VA 2PFFB 4JKEA 2Z0GA 4TLRA 3R9PA 1PYSB 2YXLA 2RHSB 2FF3B 4BVOA 1VBZA 4R5PA 3TP2A 4TQRA 2I8EA 4NLYA 4OYWA 3ZTQA 1N8RT 2DBBA 3FBEA 3H5UA 4TU8A 2LA6A 1HI8A 2F8EX 1S1WA 1UP1A 1FXRA 1M5SA 2FBYA 5T41A 3PW0A 4KPYA 1GLBG 3TRGA 4A8MP 1OH8A 2CQGA 4C8OA 3C95A 2MQMA 3RAXA 3R3LA 4FNHA 4EUVA 4LF6F 2QYCA 1HBUB 4O3NA 1C1CA 1RAOA 1ITGA 4ID1A 3W1YC 3R1XA 2B56A 4F4YA 3NF6A 3J81O 4HTUA 1M1HA 2KRRA 2Q79A 3NS7B 2QWRA 3IR7B 5D0RA 3VOVA 4FM1A 3HI9A 1RKJA 4K2XA 2F8TA 3B78A 3MAAA 4XTTA 2C3MA 4JKHA 5ETOA 1WUUA 2JGUA 4AH9A 3O3LA 3M6XA 2HG4A 4WP3A 5BPMA 2RRAA 3M2UA 3CCJS 4JV5J 5BR8K 3THYA 2QWQA 3CCUN 2ZH8A 4RW4A 3F56A 4TYBA 1HYZA 1YJRA 2Z2ZA 2H48B 4MT1A 3T1YK 4WPAA 4H5WA 4HHJA 3CD0A 2QLXA 1JLCA 1NSPA 5FPEA 4KO0B 2OH2A 4H0XB 4BGBA 2DNZA 1LWXA 5I42B 4R5PB 2XGPA 2HSTA 3CJ8A 4NZ7A 1CXUA 5J2PB 3W9IA 1LWCA 2HRUA 3RBXA 4JI7K 5C2DA 3O9QA 1Y9OA 2UXBF 4KGXB 1VC0A 4BRQA 2BMBA 2Q6CA 4OJRA 2CJQA 3VERA 4NO7A 3ZX0A 4QAGA 4CIOA 4WBFA 1JMTA 3ISND 2X6NA 3SQGA 1AZSB 3ENVA 1MROA 2BKPA 1FTCA 5AE3A 1SKRA 1EWRA 3FRYA 2HVDA 2KG0A 3AA8A 3PRVA 3NF8A 4CJRA 1A9NB 2CFXA 2GVDA 5A6WA 4UQTA 3JQKA 3OFHA 2XCAA 1KD1T 3KIOA 4HCCA 3M2RA 4X4SA 3ZSQA 1APSA 1S5ZA 5IWAJ 3PO4A 1NMEB 2HBLA 2K06A 3PW7A 2XS5A 4EP5A 4EHUA 3HVWA 1VQNN 4FWOA 4EFHA 1CBKA 1NGBA 5CA5A 4B3RF 4LFBK 4CM2A 1W0HA 4NYNA 1CZ9A 1KTQA 4CECA 2XM3A 4ZVGA 3CG7A 5CD4A 1LQ9A 4WFNL 5GADP 3NOGA 5AQPA 3UCUP 3MAAB 3Q86A 3I4PA 1BQXA 1DFDA 1HD0A 3IAM9 3G25A 3NDKA 1BWVA 1VCTA 3D45A 2PYJA 4UTGA 3ILLA 4CZEA 1C0TA 1D0EA 1BUXA 3KMSA 1RABB 4AXIA 1HNZK 4DU7A 4NLGA 3D0GE 1T44A 3CF5Q 1NPRA 1WD6A 4CEFA 3CCLS 3M5RA 2K7JA 2VPYB 4NXMF 2GHPA 1QZ5A 3W3DA 2E1YA 3B6PA 1RQ0A 1H72C 2R7UA 4NEZA 1YZ7A 4DFKA 4ZPAA 1W2BM 2KFYA 1I3OB 4ED7A 5DDRC 3T5LA 2RHKA 2Z56B 4HR2A 3N9UC 3KJVA 1S4FA 2R2RA 4FWQA 2BYCA 4DR5J 4YHHJ 2KFZA 3W9HA 1H3DA 2V8DA 4XO0A 2GVZA 1H73A 2CQCA 1PGZA 4LF2A 3P4IA 3J7ZT 1MROB 5JVGQ 3AVJA 2IMOA 4DHYA 2F1FA 5H9FK 4HCBA 2AYEA 2BOPA 1N6QB 2GVDB 2FQQB 4W98A 2QLWA 3OXFA 2YWKA 3KKSA 5AQZA 5CH7B 3UR3C 2RU3A 1NM2A 1JJ4A 1L3KA 3PYFA 4FVCA 5AQXA 1U2RA 1RLDA 2C2MB 1ILYA 2HHPA 5H1SQ 4JV1A 3GBTA 3G86A 4KRFA 2C22A 2LSNA 5HQLA 4ZVTB 4ZP9A 4G65A 2Z57B 4IJNA 4LQ3A 4M5GA 3CD5A 3PM9A 3ENOA 5DQGA 2Y1JA 4PG5A 1WWHA 1V6HA 3W5YA 3CQYA 5LJ5Y 3RSEB 1SH2A 1J2VA 3S3NA 2Z1GA 1QVGM 2Q0RA 2ZJRQ 3DDNA 2ZM6J 3Q83A 4F3OA 4ES3A 4ZTJA 1FJGF 2GGPA 2O01C 3G71N 2MZQA 3A0IX 3TSUA 3DNCA 3KJQB 3AOCA 4WTOB 5M2PA 4ECUA 3CDWA 1S12A 2VG5A 3RR8A 4WCEQ 3D3CJ 3KD5E 3EGNA 1HJOA 2LFVA 4Y6IA 2DNQA 4P9SA 3CM5A 3MXMA 2U1AA 2Y1RI 2BBEA 1KONA 2GVZB 1G2EA 5AR0A 4KHMA 1RYRA 2UUAF 2MDAA 3KWGA 2E2QA 4M5NA 2IC3A 2RE1A 3ZZRA 3C19A 4U8VA 4BRCA 3CC2N 3NMRA 2NPIA 4HT5A 1Q95G 4K4XA 3P83D 1YIJN 1V5VA 3CCMN 2ATCB 5GIOA 1XMOF 2DCUB 1ZBUA 1BC6A 2EWSA 5CR4A 1VI7A 3M8SA 2NXCA 4Y2MA 5KPZA 1FRXA 2AEFA 2J0WA 3CXCM 4K41A 1YTYA 4E98A 1DLOB 5KFGA 3SZ2A 3VALA 1F9EB 3MM9A 4DV4J 3FCWA 3TSQA 4B3OB 1WG5A 3MMJA 5M1OA 5HBMB 1S9GA 3S3OA 4A8WA 1FRKA 1U24A 4UY8T 4NLBA 1RBVA 3AVLA 4IG3B 4M5MA 4NLOA 4E7LA 4MQ3A 3L2RA 3ID8A 1NKEA 2H51B 2CGKA 3LDQA 2HFVA 3HMJG 3W0LA 3GR1A 4J90A 5HJXA 2LQBA 5C24A 1UFKA 4Y65A 1KHWA 2OJ3A 2ZHOA 2XYPB 4ED0A 3VGMA 3R2CJ 3QEIA 2GGPB 3NNCA 4FJJA 5CE3A 4PL8A 5E3PA 3D7EO 2E2OA 1BI4A 3EDQB 5TKYA 4MKYA 4X64K 2BX6A 2FBVA 2VG5B 1TKXA 2P9IB 1F21A 2V5HG 4BC4A 2RDDA 3QWUA 3MR2A 3PFOA 5LJVA 4YOYA 4MKAA 1JXBA 2QL5B 2ZJQQ 5A8WA 1SH0A 2JFKA 4GO5X 3D0PA 5JS2A 1J5EJ 3MZIA 2FVSA 4ZTFA 5HLFA 5I9EB 4LFCF 4DEZA 2FDNA 3BZKA 1R89A 2JH3A 4DTJA 3AH6A 3MECB 2LYVA 2APOA 1S6OA 3UWTA 4QWAA 3ULHA 4WKRA 3M4XA 3L2VA 3R5AA 4DR3J 1V9OA 3VQ6A 4M3TA 2DNYA 3PO5A 4AFFA 2Y0SD 2IVYA 1WC5A 3LZIA 1SL1A 3HHLC 2Z2LA 1Y3JA 3DM2A 2HSEB 3QFWA 2AT1B 3O9UA 3AAPA 4USMA 2RH3A 1LWEB 1JK9B 1NGJA 2J7KA 5C24B 2X1GA 1NJIT 3FMBA 1U8WA 4CFBA 4QCLA 4CHPA 2C3PA 3V1OA 2FJXA 1W2BR 5C0YA 2IM2A 4CJEA 2JVRA 3TTFA 2A2DA 2UVWA 3N6MA 2IDOA 4JI4J 1IVZA 2LMIA 2D3OR 1HMVB 4HTLA 2P6TA 5D8HB 2UXDF 4H0PA 5G0RA 2IVFB 3FZBA 1RCOB 4D3HA 1K1QA 3OR1A 4CBUA 3LPTA 2JLFA 5HLFB 3QJLA 4QW8A 1Q8KA 4UOFA 1UTAA 2CUYA 1FWLA 5DK5A 3VGUA 2GTDA 4MJKA 4IG0B 1G6BA 5F0UA 2D0PA 4BCAA 3CFOA 1J9AA 3VEZA 4DV2K 5A8KB 1HX1A 4IFYB 3H2VE 4YOUA 2CZ9A 1LK7A 3NGDA 4PKDB 4KTQA 3DOKB 4H0YB 1TK8A 2GAHC 2GJFA 1N5YA 3W61A 1Z2ZA 3ZEUB 1RAEB 1UVMA 2E20A 3EWGA 4LF6K 2AGPA 4RW7A 3AA4A 5ELZA 4ETZA 3MDFA 4L3KA 3ZT1A 1M1GA 1JL2A 2Y1IA 2XSJA 4K8RA 4PQUB 5AT1B 2DNNA 3EMTA 3U8XA 1E3MA 3PSIA 3QSYB 3MMCA 1VBXA 4DB3A 2CYYA 3MCPA 1JKHA 4GO7X 3MM8B 2A0FB 1QVGR 2OPRB 2QA4G 3EKUA 3TZZA 2CAJA 5DZ7A 2B0GA 4KFBA 1URRA 2CJXB 5BPNA 2OANA 3IBCB 3LZJA 1RWMB 4J37A 4CJ4A 2FY1A 1V3RA 3KUGA 1Q8IA 3T1HK 2N7YA 3AVFA 1VQ7N 2AV5A 5G0RB 5A8RA 1J27A 2ZE2A 4GVLA 5AXNA 3OR1B 1Q53A 3DRRA 3WQPA 2BQUA 2HVIA 2H4WB 2FJAB 3FGUA 3NBPA 2BE9B 4PG7A 5DM7L 1VC6A 3TAMA 3CC4N 5AQTA 4B9UA 4DX6A 4MFBB 4MKBA 3KK7A 2P51A 2E7WA 2HFNA 4OYXA 4OYMA 2CNNB 1YHQS 2M3DA 1M0SA 2LXFA 2OD6A 3W3SA 3CXCR 2GAGC 3OPKA 4X4NA 2WB1D 4UUXA 1Q81O 5GIPA 4KH0B 2P6SA 2CG4A 1HFEL 4J5OA 1U6FA 4PYAA 2KFNA 2RVJA 1EO1A 4WXOA 3GSDA 3PYGA 1U2FA 4LFAK 2JFDA 2UVUA 1YVNA 2YKQA 3F9MA 2NRWA 1W7WA 1TAUA 4OX9J 2HW3A 2BR0A 1XNRJ 3VAIA 3CEDA 2C2EA 1BLUA 2KZMA 5FPMA 5K8PA 3AO2A 1NGDA 3CD6N 3FUYA 3FKBA 1UETA 3PCOB 2KH9A 4H0VB 2ZKTA 3H1QA 4K42A 3A12A 5CXTA 2H9ZA 4AE5A 5A8RB 3W8GA 3EE9A 3NGYA 1YKWA 7FD1A 3NP5A 2FC0A 1CULA 1NO8A 3DRRB 4NXNJ 2V2ZA 2YCHA 4K5SA 2OMLA 3G2XA 1HWIA 3PW4A 4FZXC 3LDSA 4JLHA 4LJMA 4E1JA 4DTOA 3UIQA 4S0MA 4LC9B 1RT2A 4C0BA 5LMUF 1QSSA 5IFMA 2HZAA 2CQ0A 3ISZA 1X4DA 1LW2A 4PQAA 2V9KA 3QWPA 4QWBA 3NAIA 5ETRA 2OFHX 4AF1A 2VJVA 2X78A 2DPNA 4LBIA 1HR0J 4MIWA 2E5IA 2P9SA 4QIVA 1NMNA 1VSFA 4BVPA 2FGOA 3FBCA 4BBYA 2YH0A 4HUFA 4OYPA 5KT7A 3A5NC 2VUGA 4ZN3A 3LP2B 3OXLA 4JI0F 1S22A 4JKGA 3HFKA 4KH4A 3PIPQ 3QJPA 4MAKA 5KFPA 5CCLA 5J2NA 1XC9A 3QFUA 2FYXA 2M8DB 3C65A 4OV1A 2YY3A 2B43A 4PG8A 2QYGA 3IM8A 4CHNA 4KGKA 3AXKA 1FJCA 2CH5A 4YY3J 1NNEA 2W7OA 3B4MA 4X4TA 4NPOA 3IUCA 1EAYC 4NLUA 1WSHA 4PRFA 5K9FA 4ILGB 1JLQB 3G4SN 4X66K 1WOOA 3MF5A 2P9UB 1QSYA 3A2FA 2DITA 1VLYA 2VPXB 1NGEA 3VCDA 2Y8YA 2V4JB 1OIAA 3G6XA 3OTOF 4QPTA 4RU2A 2VONA 4Y2IA 3VVTA 4RG8A 1WSEA 1NNDA 3CCQN 8AT1B 2QA2A 1MSWD 3VTHA 1O51A 4O0JA 4CLFA 3F2KA 5BRDA 2F3JA 2FHMA 3CVKA 3UKRA 4MKVA 1NJWA 1GQEA 1RT2B 1FKOA 3H5YA 2F8HA 2HS0A 4CJKA 4BRAA 1VQOS 2ASYA 2VD3A 2C2ZB 2PE8A 1NK7A 4PXBA 2WBNA 5BYRA 4F4XA 3SBTA 1XTZA 4ILJA 1TP7A 3CPWM 5DQIA 4RW9A 3N4PA 2RDJA 3HXMA 1BXNA 5J2NB 2VG7B 2A1BA 3GDQA 3DXMB 2M2BA 3J81Y 2V63A 3LPYA 5D0HA 4LF5F 2PIIA 1B0VA 2F8MA 4DV1J 2HQ3A 1IKXA 1VSJA 4RNFA 4DV7F 1W9HA 4DR2J 1YJNN 4QYRA 4AQYK 5U47A 1RDRA 4PPDA 3AB4B 5B0BA 3E8OA 1I6JA 3HL8A 1W2IA 5LXRA 4ISEA 3IR6B 4HKQA 4B3MF 3WXJA 4QIWD 1OS5A 4FWRA 2R8HA 2HZCA 4FK0A 3OYBA 3K59A 3OYDA 3TAEA 1RSCA 1FRIA 1S48A 2V52B 5MLCQ 4OO1J 3FBFA 4CYUB 1JX4A 3WNHA 1TFWA 2PA3A 5EWGA 4JD2B 1KP6A 4ILMA 2CA9A 3DLLQ 4P71A 1UW4A 2NRVA 2J9DE 5A76A 3CQXA 3BGRB 4IDKA 2YKNA 3SMPA 4I56A 4CHYA 2EWHA 1J5OA 1ZAVA 2AGQA 4JS4A 3DLKA 2CZ4A 3BH6B 3W8PA 3OSPA 1RAIB 1FKOB 1ITPA 2M4MA 4WFAQ 1T9UA 1YBUA 1VGYA 1XERA 1QQCA 3QRRA 1VQLN 4UZCA 4OHVA 2CIMA 2HNYB 2DHHA 1IWGA 1S1UA 4W5OA 4CIEA 2DGWA 3V2UC 4ALZA 4X4OA 4LFCK 4IR1A 1LFPA 4GKJF 3VEVA 4JB8B 2XYHB 1WG1A 3V9WA 3KHGA 2MLZA 4ZITA 3HSGA 3PUFA 4FBTA 4KH1B 2HGNA 2F8SA 3DMJA 3FFKB 4Z4HA 1U02A 2QA4S 5KT5A 4QS8A 2UVVA 3CI5A 4GVBA 4LF9F 3E01B 2RUGA 3DLJA 3J7AN 2X6SA 4DX8H 3D6HB 3BGLA 3FEXB 3FSXA 4ZPVR 2X51A 5FROA 2E1AA 2PDAA 2JOQA 2DHSA 4QQBA 1G15A 2QXFA 3QRQA 4DS5A 1IO2A 2H3GX 1N5VA 4Y0WA 4CI0B 1VQ4N 2GFFA 4IFVA 3W2VA 2VKZG 3V6KA 3AFGA 1N5SA 1GNKA 4XPCA 2F7TA 4IBNA 2NUBA 2ABYA 3ONQA 3Q8PB 3A8YA 5BJRA 4YB1P 2OD4A 1YUWA 5LOQA 2YKNB 3SV3A 5KG7A 1VQ9N 4DV5F 2P9NB 4DPYA 2OMOA 3GYNA 1WAFA 4ED6A 4IRCA 2HLTA 2R7XA 1VAZA 4HUEA 1G4CA 1H6KX 3EZ5A 3JSYA 2K7KA 3FEZA 4U6PA 3SJJA 1F3FA 1TVRA 4MIAA 1VK8A 4EK2A 2PI4A 3QFPA 1ZPVA 3W2WA 2F4VJ 1TTHB 4JEPA 2WVBA 3PKMA 2RUSA 4ILRA 4PAAA 4CLZA 4C8KA 1DARA 2D1CA 4Y3CA 4NRUA 1R27B 1KVJA 3TR5A 3RU0A 4M7XA 3Q8QB 4I7FB 1X4GA 4JI6K 3W9JA 4C97A 1CJTB 1X9MA 3D54A 3OJSA 4XDDA 4KHPJ 1UKUA 4GVBB 2HHSA 2CQ1A 4ETXA 3CIZA 3K9JA 2B4VA 2AJ4A 3R5BA 5F41A 2M8HA 2ZZNA 4CHQA 1BCOA 2K1RA 3SCKE 5CZ2A 1U0HA 3NXZA 2UU9F 1NPKA 1NEEA 1HLWA 3PKYA 5HN0A 2X74A 3E3XA 3T6JA 2DNGA 4HI1A 3C0BA 4DSEA 4IFVB 1P8GA 4I2PA 1WORA 3M6UA 1I51B 3SUOA 2ILZA 3LGNA 3SPYA 3F9KA 2OHDA 1MW7A 1JNRB 1KQFB 2C2OB 3LPEA 5F0XA 3G8QA 4Q8EA 3ITHA 3ZZUA 1NH8A 3GV7B 1YRXA 1B70B 3H20A 2JC0A 2DGXA 1HW8A 1OYEA 3WNGA 5B0CA 3KG1A 3Q23A 3KLEB 4KB7A 4LF7F 1R31A 5GVQA 4YNQA 2BM0A 1TL7A 1YJVA 3O3FA 3A13A 2PFDA 4OKJA 1HWLA 4CEEA 4WU2A 1Z4UA 5HMXA 3DLEA 2YI1A 3I9V9 2AIRB 3W2WB 3MUVP 3OBWA 2YHWA 5EGYA 3AD8C 3HZGA 1H2TZ 4CLWA 3MXHP 1KEKA 5HROB 5IWAF 2CJKA 1NBWA 2FXUA 1OVYA 3EVMA 3HD2A 4KBOA 3LH2S 3G82A 1MN7A 1T11A 4G3IA 3QGGA 4BREA 2ZJPL 2QWMA 4OYOA 3CQ8A 5CQGA 4JV2A 3FCVA 5I3UA 2GQ2A 4OHYA 4FWSA 3TYTA 1U0HB 1X9WA 3DGPA 2QEXN 1IUJA 4YFUA 1ZBTA 3KG4A 4NB4A 2OO4A 3G8SA 1QE1A 4DKWA 3TQEA 1YK9A 3NG8A 4KKOB 2J9CA 3ZETA 3U1LA 3E9LA 4QPXA 3M32A 1S7IA 4I2PB 3P38A 4PKGA 3L0QA 5IQQA 1ZBFA 4RUCA 3JYTA 3HT3A 1WOSA 3C6TB 1VQMN 4JI3J 1HQ2A 2O4GA 2B5JB 2CPEA 3OA9A 3D1OA 1RWXB 5K14B 3K57A 4DR5F 4YHHF 4DL6A 3GIRA 2GW8A 5AJ3F 3PDNA 1QAXA 4E7IA 3FQKA 4YDDB 4ECWA 3QT7A 5IT0A 2NYHA 5AQNA 4DL3A 1PG5B 3WQTA 1TV6A 4CGHA 3MWTA 5SUHA 4FKXA 3MPUB 4UY85 5LMUK 3CNQP 1PYTA 1UOCA 3VESA 1FDAA 3CJSA 4CF1A 3G87A 3V4IA 4X62F 3RR7A 1CC8A 3IBWA 1RCHA 2NLXA 2KZZA 2RPIA 3LL3A 1GK8A 1S6UA 1S1VA 1G1XA 3T19A 2MJUA 5F3ZA 1AFIA 5ETQA 3GJTB 1M1KO 4JI0K 4E1MA 1HNWJ 2OTLS 4FXVA 3CCVN 3ZC4A 1T9VA 1E4FT 5I3UB 2ZGYA 3H5SA 1BA0A 2LQ8A 2BABA 3DGPB 3M9NB 4F4WA 2P9KB 3M2VA 4F50A 4CZGA 4K43A 2RB7A 4EZ9A 2R7RA 1P90A 2AJ0A 1R8AA 3HLUA 1NBEB 2ZUAA 1K1SA 3O9TA 2ZM6F 3TNVA 5DS7A 4WQ5C 1FXXA 2FVPA 4R79A 4CHZA 4X65F 4DV0J 2HYIB 5DDQC 2K3IA 1A5WA 4P73A 1F2HA 4L3NA 3ZTSA 4JI1J 1E6YA 2VB6A 3SQ2A 5HVFA 3QATA 3M8QB 4DL0C 4OPHA 2DNKA 3FK4A 4OI0A 3VENA 3FR0A 4A57A 2F9JA 2NS1B 2C42A 2MGZA 3AVKA 4RBTA 3K5OA 4J9VA 4DTRA 1B92A 4F9OA 5AE2A 4WWSA 1B0PA 2ZC3A 2IRXA 4V19X 2FIUA 2GX9A 4QOZB 4NEYA 2RQMA 3MPVA 4MYTA 2W8KA 3U1NA 2XLJA 1TMMA 5KOXA 4F26A 1FDNA 5KFAA 4ES2A 3S8SA 1R8CA 2WTFA 3VQ7A 1NSAA 4OYBA 1ATNA 3CCMS 1ZBIA 4DV4F 2ZH6A 4DFJA 2VWKA 4CNYA 5FPNA 5B0DA 1Q8LA 4B9NA 1CLQA 2YHXA 4CK2A 4J2EA 3FZFA 4FYYB 4FK4A 4ZA1A 3OYIA 2DYAA 3KK3A 5AFUA 4CJUA 4KV8A 3GV8B 1PJ7A 2DXDA 2D9PA 1YJWS 3G9CA 4TXSA 4W92B 4BE1A 4K4WA 4OZ1A 1UPPA 5G4DA 1OWXA 4LF4F 3QEXA 4HHTA 1YI2N 3HHLB 4PPZA 4NA2A 3NCRA 5FIIA 3TUPA 1SUQB 5ETKA 2XS7A 1R59O 1VC5A 4P7VA 1E6YB 4J9KA 3I33A 1RTIB 3GL1A 1V5IB 4DUZJ 2EKYA 4H54A 1ESVA 4BLGA 1NWKA 1WBDA 3IG1A 2BM1A 5IM0A 2RD5C 3Q8UA 5BRFA 3SAHA 2MMYA 1CEZA 4BC5A 4N47A 1ZAXA 4DR7J 5KFKA 2A1RA 2VFTA 4HVJA 4FZVA 2YKMB 2MLYA 1ZTTA 3H45C 4ZHRB 4DOZA 1RBAA 2YNFA 3PX4A 3HPGA 4A8KA 2DY9A 2BOAA 1IQTA 2XLKA 5L46A 2V51B 2DNRA 1J53A 4OPJA 3ICLA 3GU0A 4DU1A 2HMPA 2ZBQA 1X4HA 4GKJK 3E51A 5L9XA 3MOZA 2LU1A 5C25B 5DM6L 4OI3A 1DEJA 4DCPB 4N77A 3PIOQ 5A2QO 3HO1A 1LCUA 3KK3B 3IFEA 4ZKAA 2EVZA 3ETMA 3UE2A 3POTA 1DY3A 4KV8B 4KBIA 3LWMA 3THWA 4BRIA 2J7UA 4YEAA 1MU2A 3M1VA 3LQVA 3MMAB 4WFBQ 4C1NI 3OYJA 2B6AB 1VS3A 1NU4A 4YDUA 4FF1A 4LH5A 2IVNA 2OPQA 3BQ0A 2NXEA 3DLGB 4ECRA 3CCJN 3MHYA 1XNQJ 3CCSS 3JTPA 2V34A 2Q66A 3K0SA 4JI4F 5J2MB 1D5AA 3N5BA 3DHWC 8ATCB 3MCOA 2MKCA 1HNXJ 1TL1A 4V1Ak 1WNEA 3IG1B 2BH1A 4CFCA 3ATUA 2MTLA 4QR0A 2P9LA 3MMBB 2YWFA 4KRWA 1UL3A 3FC9A 4QR2A 2LQ9A 4DV6K 2PMWA 4DV5K 4CLSA 5E3QA 1HNIA 5KFSA 3R6LB 5D15A 4KR0B 3IS9A 2XTJP 2M0GB 4J9OA 3FCHA 3GJSB 4CJWA 3ZZOA 3T6BA 1IBKF 1S72S 4G1QB 2WVFA 3H8YA 2EFPA 2EI5A 3HTVA 1VRTA 1ATRA 1BMQB 1HNVB 3VQEA 3FNNA 3C14A 3GE9A 3ENHA 5C42A 4NWBA 2BXJA 3VGSA 4YB5A 4ZCIA 5HVGA 3ETOA 4LRBA 3POTB 1IBLF 3QRPA 1CG2A 4CGFA 3CCWA 3OL6A 2ZITA 2POKA 2KT2A 2OZMA 3M9MB 2F96A 1LXNA 1AT1B 4AD6A 2YJFA 4AL5A 2XMMA 4CLUA 3UNYA 1KQKA 2N82B 4CEOA 2UXCJ 1AYEA 3V1RA 1MNEA 4Z2XA 1RTJB 3KHLA 4HYKA 2UU9K 4Z7CA 4HT7A 4LR9A 2RT3A 1X7VA 5A6PA 1FEHA 3EE3A 2A5XA 1NGAA 2HAFA 3NS5A 4JYAJ 3OD2A 1QUVA 2JX2A 4LIRA 2BJ8A 3V81A 1OPIA 2CGLA 2GQCA 1EKSA 3U7JA 1H1VA 2FJVA 4I68A 1RE1B 2WZ1A 4U67L 4KHPK 3LP1A 5KG5A 2JEIA 2KHOA 2W2MP 2ROPA 2E8AA 3U3GA 2J9DA 1N36F 1VQ7S 3WBZA 1RBTA 1EP4A 1SC1B 3TA0A 1EB0A 2J9EA 3VQBA 4JV0A 3QJJA 1VQSA 4KGMA 3TI0A 4LF7K 1JLBA 4O3OA 4DUYJ 2FBTA 2HFUA 4J9PA 4V19J 5HL7L 5GADU 1QHAA 2VF3A 3CC4S 3OS0A 2FF6A 1OO0B 4FO0A 5CD4H 4FPBA 1WOQA 2QWNA 5C42B 4TSXA 2DXFA 2R8JA 4CK3A 5CCMA 3SAFA 1VJQA 2W9BA 3AD9C 2AJ2A 1IJJA 1ULRA 1SI9A 1RT5B 2OYQA 1VQKS 2WVEA 3RUBL 5GAEP 3HRGA 4BR0A 2QSFA 3L3UA 3MEEB 3SLCA 4OX9F 4FJ9A 2FZKB 4GW6A 3DJCA 2HWHA 3SXLA 3VAJA 1U1OA 1XNRF 4CLTA 1D4XA 1I94F 2FHJD 3BYPA 3LUYA 1GH8A 1X1PA 3QZ7A 5KQDA 2QJ3A 3BS9A 2GMLA 1C0UB 4RPFA 2YH1A 3TR8A 2Y1LB 3H5XA 1S9FA 2XULA 3OJUA 3CD6S 3H42A 5JVHL 3ENAA 1GXUA 4NXNF 4WIIA 2B51A 2M9KA 1O6XA 4Q8FA 4EWTA 4CIFA 4B3SK 2Z2MA 2BDPA 2XZDB 1EP4B 3D5MA 5E5NA 3A5OC 1WHWA 2MEWA 4CNZA 3EVOA 3EO3A 3RAMA 5AJ3K 1Q7YO 1JLBB 4M1KA 4ID5B 1HR0F 1X4EA 3V9ZA 3VGLA 2QT7A 3B6BA 2HHVA 4U7BA 4DCHA 3U27A 3CO0P 1OKJA 1WB9A 2VA3A 1SV5B 2YKPA 3I87A 2YX6A 1HBNA 4ED3A 5B0EA 1HIYA 1QQMA 3CJKB 5CHCB 2FSNA 2W9BB 3RB4A 4H4OA 4JI2F 3J81j 4ZP6A 4LSLA 3MPYA 4GV3A 3SMSA 3QNWB 1M1KT 3DYAB 4WFNQ 4USTA 4YY3F 3MI7X 2GWKA 2N3OA 5LL6Z 3NH2A 2D69A 2HEKA 3D4JA 4A48A 3AQPA 1KFSA 3A3PB 3N0VA 1NMDA 4FJKA 4R0JA 4CJ3A 3ET6A 1NK8A 4PCQA 4OJ1A 1T6DA 4K4TA 2O66A 1NCLA 4O3PA 3CE8A 2B4OA 3I9ZA 3AVMA 3OBYA 4CJFA 3TABA 3AOAA 3SPZA 1R6VA 2HBKA 1MLAA 4PA1A 2WOMA 3PEJA 3DKDA 4J9QA 2BE2B 3CETA 1FJEB 4X65K 5IT9U 2L9WA 3KWIA 3IRXB 2DNLA 4FF2A 1VSEA 4ZOSA 3CCQS 3OTEA 3LAKA 3HVTA 1GOBA 1VRUA 2NSBA 1QAJA 3Q0AA 1EJ7L 2IRYA 4EZ6A 3MCAB 2HMIB 2XMWA 2L9NA 3SUNA 2VC1A 3IGNA 4M63C 4CJ7A 1MWZA 4BQZA 2CKWA 4ZJLA 4KB0A 1S59A 4P72A 2QA1A 3FVYA 2MQNA 2O8CB 1JB0C 1HBNB 4B08A 3J7YP 1KR4A 2LEPA 3R9LA 2KO1A 2HBZB 3VHQA 1DJ0A 4WTYA 1OQ6A 4CTAA 1BHLA 1QUPA 2JHEA 2E6LA 3P96A 4CGGA 3JTNA 4CWBA 2EG1A 3IXQA 2VCPA 1H0HB 1AROP 3V4MA 5F1XA 4KI4A 3A4TA 3ZFVA 1KLNA 1FXLA 4O3SA 3U4LA 1YF5L 1RAJA 2XNQA 3D2FA 2FPHX 1KAZA 5BRHA 3BO2A 3GZ7A 3SDEA 7FDRA 4JI8F 2ZVSA 2IM1A 4DR1F 2HNDA 4CJLA 4UQGA 5CABA 5KFFA 3IM9A 3O1BA 1HYSB 5I4MA 4KH6A 1XMBA 3OV7A 2FD2A 4EI2A 4LF4K 2WCXA 4DR6K 2D1KA 3O44A 1R8PA 2W25A 5HP1B 4C11B 4P2XA 1Q0NA 1MMNA 1HLUA 2R3VA 3C15B 4FLZA 2L9DA 2MZ1A 4B9SA 2FUG9 1VBKA 5E7OB 3SQ4A 2HRYA 4A47A 4B3TJ 4DL4A 3FJ2A 3LA0A 2GA7A 4QS9A 1TK0A 3HVTB 1ZA1B 2VG6A 3BF1A 3LF0A 4OX6A 1DTTA 3TZXA 1U0SA 1GTHA 4F4AA 3CJ7A 2O8DA 2GIQA 2HFSA 1KVIA 4JI5K 4O0IA 5JLFA 3HCXA 4J7CA 3QLHA 1RK8A 2D7SA 5RUBA 2CPJA 4B9VA 2XMJA 1SBRA 4GY2B 4CF8A 3QIOA 3NGUA 3RMBA 4IO9Q 5BR8J 1QJHA 2A6AA 1TUYA 3T1YJ 3N4QA 3V6DA 5C2GA 4G1PA 3SCIE 1HD1A 4A8YA 4H03B 3CF5L 3HFZB 5KFYA 2LECA 2VBWA 3IKMA 3JS6A 4F4ZA 1D9FA 5L38A 1Y97A 1YJTA 3UD3P 1YAGA 4M94A 4Y2CA 4OKKA 2XGQA 1JQGA 1IKYB 4JI7J 5FLXO 2IDLA 2HGLA 2EC2A 2BJDA 4ZN1A 2MQPA 4YOVA 3L2UA 3SSRA 4DTUA 3DRSB 5J1EA 4H5TA 3U6FA 2QIFA 3VA3A 4MO4A 5L1LA 2ZKUA 1N88A 4KQZA 2YNHB 2CJ9A 4WYBA 2AYGA 4CQ1A 1JNZB 5KG1A 2VG6B 2XSFA 5BPLA 5KFNA 4KT0C 2H4YB 4O23A 1DTTB 2EEYA 4LIWA 3WX4A 3A3NB 1VQ9S 4LFBJ 4EGLA 4O5BA 2R7WA 4PABA 1AUSL 1EX8A 3HKZD 1TL4A 5KT6A 2QSWA 4CZFA 1U6ZA 3QLHB 1Q9XA 2I7PA 2G8WA 3OR2A 1ASVA 1B9DA 1HNZJ 3I8DA 3OYNA 4ZS6A 1YHQN 1IBKK 3KK1A 3JTOA 4HWIA 3H3NO 3M8ZA 4B17A 2FGCA 2CPYA 2UUBF 1RT6A 3SEOA 3BV8A 2MKYA 3OY9A 2ZJRL 4WE1A 1GAOA 4IOCL 1RT1B 5AQJA 2CPXA 1IWAA 3QZ8A 1IBLK 1NOZA 1OJ4A 2KLAA 2YNIB 2BV3A 3BZCA 4FPIA 2VFSA 2FLPA 3IDHA 1LWFA 3QICA 3MM6A 4BR7A 2FJEB 3QIPA 1NPPA 3BF4A 3BN4A 4FM2A 5JMNA 3CIMA 5CYQA 4F0HA 2CPHA 5H9FJ 5CZ1A 4AHUA 2QM1A 4BRHA 4KB1A 4QU7A 1U48A 4CZHA 3P1GA 3D28A 1KVBA 1ZH5A 4E7JA 2UUCF 1CPZA 2IRUA 3ULEA 2RILA 3I4HX 3WIUA 1NGFA 1U6BA 4FZYA 4CHOA 3SUPA 4LMZA 6FDRA 3OYMA 4LBHA 2HHHK 2O8BA 2MQ8A 5HQ8A 5KFIA 1N36K 2J8AA 3C6UB 1VR6A 4PWUA 2P9PA 3MTJA 3FGVA 2O8EA 3VQ9A 2YPYA 4PWDB 1TKTB 3GIMA 4NYFA 1GEHA 5IOLA 3BY5A 3DN9A 1HHSA 2DH9A 2XY8A 5C12A 1B3TA 5C15A 4RUBA 4WFXA 1TAQA 3VAFA 3AVIA 5M2RA 3FLCO 3NKYA 2IVPA 2PY5A 3VQSA 5L39A 3K58A 4FWPA 4R8UA 4OJ3A 2WONB 1S0OA 1OMSA 3TX0A 2DGOA 2J6TA 3LDPA 1WI8A 4V19S 2J6SA 3BO3A 3JSMA 3C94A 3QT6A 2BANA 5I3PA 3KHHA 1LWFB 1DBDA 4IDHA 5M1FA 5EWEA 1WKJA 4L6V3 3E1YA 5BN8A 4Q0BA 4E2FB 2A41A 1FT8A 3KLHB 5LMNF 4IO8A 1KLMB 4DL2A 3PRBA 2DNMA 2IYGA 3NEKA 4IXCA 1H2VZ 4O4GB 3WNFA 4WXWA 3O08A 1I94K 3GV5B 2OEJA 4JI3F 2CWKA 2HK3A 2GMJA 1Z05A 5KRSA 4CM0A 4G6VB 4USUA 2E5LJ 3QEPA 5AZIA 4J2AA 1VQ8S 4F4KA 2F7VA 2O4IA 1HQUA 3MXIA 3P39A 1VQMS 3TUZC 1C0GA 1T03A 1JLEA 3HJVA 3LW5C 4M42A 1NK9A 1BQNB 5JS1A 2DHGA 4MLEA 1HYVA 2HNZA 2I0XA 1OSCA 2DRAA 5KPTA 1Q7YT 1Y10A 2ASPA 4IUFA 1WSIA 3HM9A 2D3O1 3F73A 1YJUA 3D67A 4W90B 3IMQJ 3D1QA 1Q1KA 2HQCA 4OQJA 1YRUA 4CJQA 2F40A 1C0FA 3GYGA 2ATLA 5A2QY 3TX8A 1KKHA 1S9EA 1FA0A 4R8UB 3CJBA 1HNWF 2W4PA 4QJVA 1X9JA 2FSKA 3DXKA 2ZHAA 3WXMB 3JSMB 4J9RA 4X64J 3DRPA 2HPUA 3IWLA 4JI2K 4C48A 2BQRA 1NK5A 4DUTA 3C16A 1MA9B 4OJHA 4JRPA 3VEYA 4UOHA 4FOIA 2GIRA 3CCVS 3OW2M 3A1YG 4CI6A 1NGCA 1REVB 4DL7A 4CLKA 3DDKA 1RWUA 4DPOA 1RBRA 1GLLO 1QSLA 1E6VA 1IBMK 3KDNA 3UO0A 4FZZA 4LF8F 4JI1F 1TK5A 1NOYA 2VC0A 2V7ZA 5D3GB 4ZJOA 1M5HA 3UDLA 5AZIB 2PN6A 4RCHA 4JAXA 2CPIA 2D3UA 1P1LA 1IG8A 3NNAA 4RJVA 4EO8A 5T7LB 1S49A 1X9SA 3M30A 4MH8A 1IJFB 3PACA 3U1MA 1TUWA 4QWCA 1PC5A 3AAQA 2E9TA 2JL9A 2W7PA 4DV3F 2DD8S 3TO8A 1Q7LB 1RTHA 2AX0A 4CJVA 2HWIA 3TPQA 1ASWA 4OYIA 4WYLA 2N3LA 3PFEA 3ZZYA 3SFUA 4MTPA 2QLJB 5AQGA 4BROA 4DZDA 1TR0A 3PX6A 2N4DA 5EWFA 1UPMB 4TNOA 2E5GA 3MD3A 3M8PA 2KXNB 4Y34A 5GAHP 1KQGB 1JXLA 3FZHA 3UN5A 1VSIA 1X31C 4LRAA 3BYRA 4LY7A 4TY9A 4HHHA 1BA1A 2PZSA 1X0PA 3CERA 2I2YA 5EX3A 3H90A 4CJSA 3CJ1A 2JC1A 3RRGA 2ETJA 4HTIA 2WB4A 2QMWA 2R42A 3MEGB 3CJCA 2BE7D 1OY8A 3GTYX 2RN2A 1X5SA 2RF2B 2XZWA 3I0SB 3J8AA 3ILIA 1VQ5S 5GAGP 4Y2AA 2E1ZA 4JI8K 4GKKF 4DR1K 3L3CA 1XR6A 1NHKL 4LUBA 4DV2J 2HS3A 4NLSA 1NJIO 4DUZF 1F0XA 2L3MA 2YX7A 3THXA 5JLHA 1RT3A 4H8KA 2QGFB 1X4CA 4DL5A 4CO5A 2DR7A 3CGIA 4FN5A 2GJ2A 2J0SD 3MEDB 3QBWA 1WAJA 4LF6J 2AZ3A 3QBXA 2A18A 3KXDA 3MM5A 4CEAA 4PEOA 1BIZA 3RBZA 5HMWA 3JAMO 4RW8B 4NX9A 4JNEA 3VQQA 1T9YA 4ED4A 3RWUA 6AT1B 4N41A 3L8BA 1PJ5A 1DZ5A 1S79A 4MIBA 4N5SA 1U25A 2M7SA 3CW2C 3OTDA 1CS4A 5M2UA 2JEJA 1VHFA 2XZTB 2YWWA 4R0EA 4AYBD 3MD1A 3M8PB 3VV2B 5E84A 4KIAA 5DDOC 1WC4A 1UWBA 2A42A 1VYAA 3CFRA 4NLTA 4DTPA 1FE4A 1FK9A 3T1HJ 4ZP8A 3R6GB 4B3TK 3P5BP 2YQ0A 3QSIA 4FXWA 3KUEA 2MQQA 2CDRB 1MMLA 3R2DJ 3VF4A 4Q45A 4BC7A 1S1XB 1PYOB 2DY4A 2ALYB 1U47A 2PFUA 4J2DA 2E2PA 4CEDA 1RNHA 9RUBA 4HLBA 1YTUA 3RGIA 3ZSOA 4TKTA 1XNQF 3M9OB 1K73T 2BJ3A 4ZLLA 4OJGA 1VIXA 2AX1A 3P49B 4XH4A 3KLGA 4DR4K 1TUUA 2VOOA 2AJ1A 1BO5O 2A6MA 4CT8A 1Y3KA 1HNXF 3PZPA 2ASLA 4ISFA 4DTSA 1AB8A 1N33K 4I69A 4RWTA 3ZNUA 1CJVB 2ZOMA 5DGAA 3MN9A 1WSFA 4BR9A 4E19A 2IAJB 3MM5B 4F04B 3PIPL 4F8RA 4M5LA 1PSDA 1QVFR 3ZTOA 1WEYA 3D9BA 4LFAJ 4OI4A 1DAXA 2K3KA 3J80Y 2R7QA 3EXCX 3CWJA 1S1WB 1IG9A 1VHIA 1HWKA 1KAYA 2OTJS 2B7CB 1KRPA 1QLNA 2IGIA 1NJXA 1HQEA 4C0HA 2MJNA 3EGWB 2B8QA 4TLQA 5C2FA 3L9ZA 3BBBA 3M6VA 4PL7A 1C1CB 1ATSA 2UUBK 1NB7A 1TYQA 3OW2R 3D1HA 3NVMA 2H1YA 2UXCF 4OZJA 5ITHA 2PMZD 1N5TA 1HHTP 4DSIA 3QNOA 1VFJA 9ATCB 2H5JB 1ZM3A 4KSEB 3KJFB 4IKAA 1RDCA 2O5DA 1QQOA 2HOEA 5KFEA 4GC7A 2KQ2A 3V9XA 3EPIA 3T5JA 4ZVQB 1KFDA 3US5A 4OV6A 4NMXA 3M2UB 3UR0A 2ALZA 3BEXA 3THYB 1WELA 2XCPA 1QQNA 3V1QA 4U7UD 3N79A 2Z1HA 3G0ZA 4RW4B 2IPOB 3BDEA 4TU9A 1RAHB 4YMEA 1XN9A 3BREA 3R8YA 4RR5A 3FZLA 1JLCB 6FD1A 2UUCK 1VIOA 1RB0A 3NGIA 3WIVA 3PJWA 2IA0A 3TQ1A 3I6PA 1LWCB 3CCRN 3LP0A 3M05A 4DG1A 4LR8A 2VQFK 4HTJA 2IBOA 1F2GA 4KGVB 4KGZB 1UAXA 3SQGB 4WZMA 1KWMA 1YBAA 4X66J 4Q44A 5IT4A 1F9HA 1TFYA 3GLJA 2OP5A 5EOYA 3OYLA 4ZJQA 3M2RB 4HEA9 2OTLN 1TL5A 4BR5A 1TYQB 3R5DA 1YJ9N 1U26A 2B9EA 3HJFA 4M3UA 4BRDA 2HFOA 1DTQA 1QM9A 3H4BA 3DLLL 3NFAA 5CYMA 3UDEA 4ZVFA 3MDQA 1L5UA 1K6YA 1EWQA 3I5BA 3I0RA 3MFIA 1C0TB 1CJUA 4NE9C 5LMNK 2UUAJ 4NLRA 3CM6A 3TTDA 2G0IA 4RBUA 4Y1DA 2XY7A 3ENWA 5AZJA 3H3OB 1LOTB 2ADBA 2RHQB 3HSJA 3JQJA 4QU6A 4B9QA 3HVRA 2QKKA 5HOOA 3KJVB 5B09A 3QO9A 3QAEA 1SJQA 4LSZB 3T3FA 4UOGA 2MYFA 4NI2A 3M3ZA 1DGKN 3K5NA 3L95X 3THVA 2D0CA 4JKFA 3TVKA 3VEOA 2VZ9A 4WJBA 3AQOA 4AQYJ 2GUIA 1SJRA 1VSDA 2ZD1A 3SCLE 1RKIA 4MK7A 3N4WA 1U1PA 3AVHA 2VICA 3KLIA 2L08A 2HHQA 3TW0A 3N01A 2RKIA 2QTDA 3BF3A 3G10A 5D77A 3D6FB 1VBYA 4ZLJA 2E5LK 2W24A 2HHUA 1JLAA 4P75A 4ZCMA 2ZJPQ 1F5AA 2OSRA 3IGVA 2G0CA 3TVZA 2ITGA 3QNNA 1BU6O 3SK3A 5KTQA 3SUQA 3HM8A 2OIHA 5FLXY 2P8IA 2KDOA 4E0DA 1KVAA 4OHWA 4Q43A 1YJWN 2QE5A 4ZDNA 2XHWA 1SAZA 4WU3A 4OLOA 4DX7A 4U95A 3EYZA 4FYVB 4AHSA 1V4SA 4XEIA 3SNNA 2WUSA 2VQEF 3I0RB 2E2NA 3OTCA 3DOMA 2EX3A 1K0VA 2QN6B 4LRFA 1DQ9A 3VGTA 4OI2A 2XNRA 4LFCJ 4N8NA 3MTKA 4PZVA 4CZKA 4LF8K 3B4DA 4F3QA 2CXEA 2XO7A 2COLA 2R2TA 4C8YA 1NLKL 2JSXA 2RAQA 3TTCA 4K0KF 2G8IA 2VODA 4E7KA 4AHCA 4GVEA 2Y0BB 4DPWA 2OCEA 1Z1ZA 4OLBA 3UB5A 1FTRA 3GIKA 4QS7A 4NI2B 3FDSA 1CLFA 1XWLA 2R9LA 5B08A 3O5BA 3H0PA 4DV3K 4OVLA 4N76A 2NREA 4KHWA 4ZLNA 3ZX2A 2NSCA 3VGKA 4NLPA 2IC3B 5AFUH 2MXYA 3HP9A 1RWWB 3T69A 1JLFA 4CZJA 5EY4A 3BKTA 2G8VA 1JLAB 4YOWA 3HHLD 1O8BA 1BISA 2HAIA 1WUAA 1U49A 3OLBA 2GX8A 4XAKA 2W4DA 2KKZA 1R3NA 3M6GA 3R8EA 3MM9B 4QZVB 3SBMA 4C98A 1L3TA 2IM0A 1BQMA 4AUKA 2R8IA 4CLLA 1S6QA 1S9GB 1N34F 2R7SA 1ELOA 4A8QA 3ALYA 1XMQF 3CJ3A 1HPMA 3UPFA 2CQPA 4X84A 4IOBA 3NGSA 4NLQA 3RB3A 2A10A 3CCTA 3DOMB 7AT1B 2Z8QA 1O13A 3HZ6A 4C6AA 3DFEA 3CCSN 4CO3A 4BY9C 2HK2A 3OHBA 4H4KC 5C2CA 3HT0A 3NOCA 1NHVA 4O44A 2X3DA 3D0IE 3MM7A 4FWNA 2OUGA 4GKKK 5KI6A 2WW8A 2YNGA 1G7CB 3DLHA 2FZGB 4JI6J 2Y9HA 4Q2LA 3DDIA 1T05A 3SQOP 1S0MA 2K2PA 1BI4B 3GOIA 1B64A 3HSCA 1TKXB 5KFCA 2NZ4A 3LWLA 3CB4A 4RWWA 5A0YA 3UVJA 3TEGA 1PBAA 3CMES 5CAAA 1WN7A 2DXEA 4ILLA 5A8WB 4PYDA 2EK1A 2KVQE 2ADCA 3VZIA 1S72N 5L1KA 3DI6A 1SJ3P 1EX4A 4X2BA 1RACB 1GX6A 2XY5A 3NLCA 3GFHA 1R8HA 4K4YA 3C46A 3AVGA 3MCNA 3AODA 1X8DA 3W63A 4C3LA 4JOUA 2W9CA 4IQMA 3S6EA 3T9NA 3TVYA 4B9MA 1KCFA 1T3OA 3OYFA 3QT5A 1Y0HA 4QW9A 4C0OC 1BQMB 2WW4A 3UN3A 2EK6A 3VVUA 3K89A 1NJZA 4KHYA 4K5RA 3DM2B 4KHNA 4OZLA 3CUNA 2CH6A 1B99A 1UJ5A 2MKIA 2ITMA 2PO4A 2DPJA 2DTJA 1RAGB 2XY6A 2YNGB 2J8SA 3FBBA 2IVMA 3BR9A 2HQIA 2KRBA 1T05B 3RMCA 1R0BG 2CVEA 3N6NA 3F0NA 3VZHA 1FX4A 5DG7A 2CJAA 3ZSRA 3BPDA 2VA2A 5D0EA 2P1JA 1WSVA 3SV4A 2OSQA 1GMWD 3CJ9A 3NF9A 3AHPA 5EUHA 3DOLA 2XWXA 2R7OA 3KHYA 4Z4IA 2HIQA 3DI6B 1HNZF 3OUYA 2VJUA 1VQPS 2G8KA 4FW2A 5DG9A 5L1IA 2I38A 4HDHA 4CLYA 2UXBK 3V9UA 4URSA 5D6GA 1YLXA 4GRSA 2XB2D 5SZTA 5DM6Q 1NDKA 1UCNA 1B7YB 5DMRA 4WF9Q 2IVOA 3AY9A 3P45B 4NCBA 3KJNB 3LO3A 1N5YB 3KNAA 3P8BB 2I5JA 4WQ5A 3OVSA 2ASOA 4ATNA 3LGMA 2NPFA 1VQKN 3A3OB 3AO4A 2CPZA 3HHKA 4RW7B 3TARA 3SIPB 4QOTA 4J8FA 4UW2A 3LDLA 1NB2A 1RJJA 2MKHA 2XSJB 2AJQA 1A5VA 1N5QA 1O0PA 2P5OA 2Z1IA 3AA2A 4I2QA 2ZC4A 2OPPA 4CCHA 4B3RK 3MMCB 1LKZA 5F8MA 2NXUA 3H1VX 4MMOA 4A62A 1JKHB 2W1BA 3I56N 5LMUJ 4KFBB 2BQ3A 4ANCA 1D1UA 4M41A 4J9NA 2E9ZA 3KK2A 1WEXA 5EX0A 1ZA2B 2DGVA 4WP8A 2DY1A 4OZ5A 5HJYA 3DXSX 2ZGZA 2IDEA 3NH0A 3HOTA 1ZM9A 5KFVA 1EQYA 4JI0J 3VQ5A 3K7RA 5B0FA 4NXMK 5D4LA 3OYAA 2ZE2B 1NK6A 1F1BB 1S99A 2DNOA 1VQ6S 1I5OB 1MWQA 1TZ0A 3NBPB 2BKNA 5GAEU 3C3LA 3OUYB 3S9HA 1EHWA 5EHHA 3TAMB 5HQMA 3L09A 5ETMA 2DRDA 4ZVEA 1CQMA 5J2QA 4ANEA 3V6JA 1LV5A 1M90T 2C28A 4J9UE 5F8HA 1SS6A 3CSKA 1YZ6A 5LT5A 4AHTA 3R3TA 2V67A 1NGHA 5J1PA 3SAGA 2I5JB 3ULDA 5KFXA 2DFEA 4WK3A 1FKPA 1NU0A 1SZ2A 3S7RA 1U1QA 4NYPA 3T9ZA 1TL3A 3AJDA 4FLXA 2QXLA 1SJ4P 3BSCA 2ZOFA 3VTIA 4OZ2A 4I2QB 3PJXA 5KAKA 5DLFA 2Z30B 4HL9A 1WDTA 3JXOA 3LPUA 1IH7A 1PKUA 5GMKa 4DF8A 3HHEA 1LAWA 3EJMA 5FRNA 2KXFA 3WHIA 3TAPA 2DVIA 3Q2TC 1UEUA 1KQSR 2GEMA 4U67Q 2KB2A 2ZWHA 2FB0A 3J81U 2VFVA 3LM2A 4EU0A 2MQOA 1T7PA 4NCGA 2I9SA 2KHDA 4FPAA 2A2CA 4LSNA 4GVMA 4B1ZA 1BE4A 5FJ4A 3FZ2A 4DFMA 1XJWB 3UKUA 4RW6A 4UOCA 3JAMY 2G1DA 1WF2A 1GLDG 1FJGK 3OFFA 5MAOA 1GLJO 3PRDA 1UA0A 3GG0A 1CULB 4JHDA 2NLWA 5LY3A 3L3VA 4USHA 3PIOL 1YITN 3LDNA 1GXLA 2P9GA 2BW7A 1U1MA 2CDQA 1TKZA 1DHMA 4QIEA 3GG4A 3WEEA 1Y4ZB 3T5KA 3O2IA 1LW2B 4DDFA 4WFBL 1UEVA<