3MECA

Hiv-1 reverse transcriptase in complex with tmc125
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
552
structure length
550
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords p66 Reverse transcriptase
publication title Crystal Structures of HIV-1 Reverse Transcriptase with Etravirine (TMC125) and Rilpivirine (TMC278): Implications for Drug Design.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
total genus 149
structure length 550
sequence length 552
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3mecA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3mecA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3mecA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3mecA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3mecA05
3H98A 2OPQA 1J9AA 4RG8A 3ITHA 1R0AB 2KTQA 3MAQA 2VG5B 4KFBB 4IG3B 5KFBA 3AA5X 4CJ5A 4YQWA 4Q44A 4F4KA 4TXSA 4B8CA 1Z26A 3HK2A 3NHGA 1ZBLA 3DLGB 1XHXA 3MTKA 4CJTA 4DMNA 4B9MA 3TVKA 5CZ1A 1L3UA 1IH7A 1JIHA 5DMRA 1KVAA 4DTSA 2KW4A 4ECVA 4ID5A 4CGDA 3DM2A 4HCCA 2JEJA 3RRGA 4ED8A 4KKOB 1S9GB 3T5HA 1KLMB 4XO0A 1WSHA 4X2BA 3KMQA 4Z4CA 2AJQA 1Z25A 2G8UA 1TL3A 1F21A 3RAQA 1BISA 5DG9A 5DLGA 2PY5A 4IH5A 3F73A 2QKBA 2QV6A 4CF8A 4F4XA 4WYWA 4CK3A 1A5VA 2A1SA 1GOAA 3QEXA 4WXWA 3CDWA 1SV5B 4PQUB 5HP1A 1D8YA 3O4NA 3VQCA 3KLGA 3AVFA 2G8IA 3KMSA 5KFGA 4CK1A 4NLWA 3TANA 3MXIA 1A5XA 4Z0UA 3H5SA 3AVMA 2VG6A 1QE1B 5T14A 4K4WA 4DL5A 3KK1A 4CJFA 4NLXA 3NFAA 1UWBA 3QIOA 5J2QA 4ZP9A 4FJ5A 5F8HA 4RUAA 3ULDA 3LALA 2AGQA 2HNZB 1T05B 2VG7A 4M3RA 4DF8A 3C6TB 4YR2A 1Q9YA 2W8KA 1DTQB 3EPIA 4CFCA 3TABA 4FS2A 4B9NA 4J9SA 3WNEA 4FCYA 3C95A 4IRKA 4DQRA 3D45A 4FJGA 1T03B 1D9DA 4CGIA 4O4GA 2WTFA 3RMAA 1YTAA 1RT3A 5KG2A 4NLRA 4RNFA 4CEOA 2P5GA 1XR7A 4RW9B 4E7HA 3QIPB 1S6PB 2HHWA 4CJLA 2C22A 4J9OA 4F2RA 5KI6A 4R8UB 2D7SA 2JEGA 2BANA 1S9FA 4DQPA 3GIKA 5L1LA 1IKWA 4OGCA 3ZT4A 3OYMA 4K4YA 1X9MA 4MK8A 1RT6A 4CIGA 4JS4A 2Y1IA 1WSGA 5J2NB 3CG7A 4HUEA 3AA4A 1LAVA 1X9SA 4NLUA 1N56A 4O3RA 4DQIA 1QUVA 1JL1A 3MEDB 1C1BA 1ZBIA 3SQ2A 3B6OA 4NLYA 4LSNA 5KG7A 2RN2A 2W9CB 2B4JA 5J2MB 2D3UA 2YNFB 1N6QA 3NF9A 4DSKA 3KD1E 3RMBA 1KFDA 3OYBA 5L1JA 1L3TA 3OS0A 2WRMA 4FZZA 1HMVB 4EP5A 4G1QA 3DYAA 2D41A 3CYMA 3KLHB 5KFLA 1BI4A 1Q8IA 2WB4A 1RT2B 3VQ7A 2YNGA 4OVLA 2XI3A 5DLFA 3ALYA 3QEWA 4DF4A 3LPTA 3K5OA 3S3NA 2RPIA 1CSJA 3I5AA 3L2VA 4PY5A 2FVSA 4Y1CA 3CIZA 4YR0A 4I9QA 3HPHA 4WFXA 1LV5A 2IC3A 5EWGA 5CZ2A 4H4MB 3MFHA 4J9PA 3MFIA 3PY8A 2I5JB 4IFVB 3IN5A 1VRTB 4C8NA 3M9MB 4CGGA 3V6JA 1TAUA 4O5BA 4CEAA 4F8RA 4WFZA 1D0EA 3JYTB 5KG5A 1BQMA 1LAWA 3MECA 1J5OB 2ILZA 1RTJB 1TVRA 2YNHB 1FKOA 2FLLA 4NLGA 3LP3A 3VQ8A 3ZCMA 4HTUA 4CFDA 1U09A 4M42A 4IG0B 4J9KA 4F4WA 2G8WA 1JL2A 5CYQB 2B5JA 3PW2A 1RA7A 2HMIB 2FVCA 1JLBB 2C28A 2CJQA 3TWHA 3NF7A 4H8KA 2HNDA 3M8QA 2XGQA 4HKQA 4M95A 1EKEA 5HRNA 2J6TA 4CHPA 1RT7A 1HARA 3CDEA 2V4QA 4DS5A 4AH9A 5KT2A 5KFCA 3MR3A 4Q0BA 5KFKA 1C1CB 3BQ2A 4M45A 4DU3A 2J6SA 3H4DA 1ASUA 4KAZA 3SZ2A 4CEZA 3NBPB 4ID1A 4DSLA 3VQPA 4O4RA 2J6UA 4KSEB 2IM0A 4KTZA 2D0CA 4FJLA 1ASWA 4K50A 4E3SA 1ZBFA 4B08A 1T8EA 3L2UA 5EU7A 4LSLA 5HBMA 2DFHA 3PW5A 3GIIA 3CFOA 3KHLA 3DOLB 1TV6B 4FM0A 1U47A 4FJKA 4FJ9A 4C8MA 1RYRA 1HJRA 3DRRA 4IDKB 3QYYA 3KJVA 1JLFB 3H08A 1BIZA 4RW4B 4FJMA 2DFFA 3SCXA 4OKKA 4NLQA 1L5UA 5D3GB 2GC8A 2V9WA 2VA3A 3AVNA 4I2PB 1C0UB 4E1MA 3RBDA 1VSIA 3V9SA 3SQ4A 4C8OA 5EUHA 4NZ0A 4OL8A 2E9RX 4CEQA 4KREA 1N4LA 1JLCB 1HPZA 1NJZA 3VQSA 4DTOA 4FW1A 4RW8A 1TKXB 1TKTB 1GX6A 2WK4A 5SWMA 1NK7A 1C1AA 1TK5A 1RTHA 4WE1A 4K4XA 1W0HA 5KFEA 4FLUA 2OPPB 4CGJA 2IAJB 3SI8A 3SUQA 4IFYA 4EYIB 4OLBA 4DFKA 4NLSA 2HNYB 3ZSOA 2FBYA 4AILC 1NK8A 3ZSXA 1CLQA 4GMJB 3QLHA 2PYJA 1S9EB 1QSLA 1QQCA 1S1TA 4MK7A 3BQ0A 5KRSA 1ZBUA 3KK3A 4DU1A 4TN2A 2WHOA 3CJ4A 4KHRA 2R2SA 1RBSA 3NF6A 1KRPA 4U7CA 1IO2A 1BL3A 4HCBA 4IH6A 4B3OA 1S1UA 1SL2A 1VRUA 3PZPA 4QW9A 3L2WA 5C42A 1DLOA 1QSSA 3MXJA 1ASVA 4KB0A 5KRTA 3HO1A 3SNNA 3E01B 2ZQBA 3TAGA 3CFRA 3O3HA 2FLNA 4AHRA 4EO8A 2IS3A 4TLRA 3GIMA 5KFXA 2HWIA 4ED3A 4ZPDA 4KI6A 2KFZA 3KIOA 4DEZA 3IG1B 4F50A 3DMJA 2O4IA 1B92A 3BGRA 1WSEA 1XI1A 4WFYA 3OYAA 4H4OB 1RA6A 3QEPA 1CZ9A 1U48A 2EHGA 4FJ7A 1K6YA 3CM6A 3AO1A 3KOAA 2OPSA 3FQKA 5I42A 2ZE2B 1R0AA 4Z4FA 4NYZA 3KD5E 4CHNA 4QPXA 4K4UA 3UPFA 4KHQA 5KFSA 1IM4A 1IKXA 1S0OA 3DLGA 4I2QB 2RKIA 1Z4UA 4ED0A 2ASJA 2Z1IA 3SQ0A 2IM2A 3AVGA 4OPKA 1HQUB 3TI0A 2NUBA 5C24A 1HNVA 3NAHA 4IR9A 1J53A 2DFEA 4ELTA 2KZMA 3HP6A 4BACA 3BR9A 4TYAA 1C2PA 3ZSZA 4KKOA 1S9GA 1LWCB 4E7LA 2KFNA 2X6NA 4C8LA 1KLMA 2R7YA 5L1KA 1JLQB 3TARA 3TAPA 2BDPA 2KQ2A 4K4ZA 3ZSYA 3U3YA 3MEGB 4ED1A 2JGUA 4N47A 4CJ4A 3QERA 4FLXA 4EO6A 1WSIA 2XI2A 2GIRA 3L8BA 3P1GA 3CQ8A 3OJUA 2YKMB 2RDJA 3OYNA 3OL8A 3ZT1A 4PQUA 1VSLA 4MFBB 3BSCA 1S1WB 4TY9A 3IRXB 1LWFB 3OYGA 3WNFA 4Q43A 5KFIA 3M9OB 3V6KA 4NCGA 1RCHA 3HVWA 2YNIB 2R2UA 3DOKA 3OLAA 2HVHA 1NHUA 4FLWA 4CHYA 1U4BA 5JS1A 3GIJA 2F96A 4CHZA 1TGOA 3OSNA 3AO2A 1RAJA 2AX1A 2HHTA 5EWFA 1VK0A 1RT4B 3I0SB 4M94A 4ZVHA 1KHWA 4XPCA 4NYNA 5DK5A 3JSMB 4B9VA 1BQNB 2ZD1B 3KK2B 2RF2B 2HHSA 3C94A 3G6VA 4Z4GA 5JS2A 4R0EA 4W5RA 2HNZA 4E0DA 5JXSA 3K2PA 1JLAB 4Q8FA 3SV4A 3VQBA 4M3WA 1DTQA 3VQDA 4EYHB 3HM9A 4FBUA 4O3PA 1NHVA 1RT5A 3QNOA 2HB5A 2AU0A 1NJWA 3V81A 4DL4A 1IG9A 1LWEA 1T03A 1FK9B 3KLFA 3V9XA 1XR6A 3GV7B 3CJ3A 3HPOA 3V4IB 3K58A 4KV8A 1S49A 2D0BA 4M3UA 2G8KA 4RW9A 1S6PA 3AVHA 3DRSA 2FJXA 4W5NA 4ZVFA 1D5AA 2E6MA 4DFJA 3KLEA 3T5KA 4R8UA 5KG0A 1OS5A 4M41A 4C8KA 1K1SA 4LH5A 4AHTA 3LP1A 4I7FB 1SUQB 3HVAA 3GV5B 4DG1A 3OYDA 3PR5B 1KFSA 1X9WA 1JLGA 5KFZA 3LDSA 4EEYA 3NAEA 3C6UB 4B8AB 1REVB 3MEDA 3AO4A 3NAIA 2IM3A 4DQSA 4RZRA 2W9CA 4MKAA 5J2MA 5DGBA 4JRPA 4CFAA 4HUGA 3N6MA 4Y2AA 3ZSVA 1S0MA 1ZTWA 1JLEB 1HMVA 4ZPAA 4ECSA 3I5CA 1JKHB 1KHVA 5KFMA 4FZYA 3KLHA 1NK0A 2R2RA 3OYJA 1RT2A 4AHSA 3A2FA 3CWJA 4J9RA 1C0MA 3LP2B 3ZSWA 1CXUA 4CHOA 5L1IA 3EPGA 2JEIA 2QE5A 3RMDA 4YP3A 2GBZA 2I5JA 3MXMA 4ID5B 1VRTA 1HNIA 2UVWA 2WONB 2E9TA 3M8SA 2ILYA 4J2DA 1TQLA 4CF2A 2FVQA 4XIUA 3JYTA 2W9AA 1ZBHA 1RTIB 2HVIA 5DQHA 3O3FA 2YNHA 4NLTA 4CJVA 1TL3B 3NL0A 3OYLA 3CJ0A 2A1RA 4IG0A 4M3TA 3LAMA 2ITGA 5CYQA 4DS4A 1LW0B 3SUPA 4JLHA 3PW4A 5F9NA 4AHCA 1JLBA 2WOMA 3EY1A 5HP1B 1U45A 4O0IA 3BSOA 1WNEA 3PUFA 1S6QA 4ZP6A 2W9BA 3H5YA 3V9ZA 1WAJA 3QGGA 3MF5A 1UOCA 4ECWA 3NH1A 1UA1A 4ZHRA 2JLEA 5KFOA 3UIQA 1WLJA 4KBIA 2R8GA 2GIQA 2XY8A 2JEFA 3HJFA 1RBUA 4F3TA 2B6AB 2FC0A 2YKNA 3LP0A 1S97A 4ED7A 1Y97A 1N5YB 2OZSA 3PO4A 3K57A 2FVPA 4PWDA 3RR8A 1ZETA 3NGZA 2UVRA 2CKWA 4KHNA 2JC1A 5KFTA 3EZUA 4FW2A 1TAQA 3HVTA 3SYZA 1JLFA 3G10A 1LW2B 4OLAA 4HUFA 4KHYA 2OYQA 3KKRA 4I2PA 3PHEA 2UVVA 4KI4A 3ZT0A 4KTQA 4J2EA 3V9UA 1XWLA 2HHQA 3RMCA 3E51A 1VSEA 3VQ4A 3AVBA 2AGOA 4FVMA 1TKXA 5J1EA 1S4FA 4ZPBA 1GOBA 3NH2A 1KVCA 4CF0A 3QO9A 4CJKA 4FJ8A 5KFHA 1EXQA 4CEBA 4GVMA 4KE5A 1RT6B 2OPPA 2IAJA 5DG7A 4DSIA 2W7PA 2UVUA 1IKVB 3HYFA 4CE9A 1C1BB 4CK2A 4K4VA 4QWEA 1RDAA 3V1QA 3KHRA 3SPYA 4ZP7A 4TY8B 4FS1A 4CJRA 5HRPA 3KHGA 1U49A 4PUOA 3QZ7A 3IAYA 4JV2A 4URSA 4ICLB 4J9QA 4G1QB 4Q45A 5J2PA 4B9SA 2AWZA 4BWMA 3D28A 3CM5A 4DQQA 5KFYA 4NLPA 2VWKA 4RNHA 3E01A 3M8RA 1G15A 1RBVA 5I3UA 5EWEA 4ZVEA 3ICLA 4F4YA 4EBDA 1NNDA 2Z1GA 4EZ6A 3H5XA 1KCFA 1NOZA 2IC3B 3OYIA 4BE1A 4DTRA 2G8FA 4O3QA 4DU4A 2O4GA 4GC7A 3IG1A 4LQ9A 1HYSA 4TQRA 3ZT3A 5KG6A 4CJQA 1O1WA 3GQCA 1BCOA 5HLFB 3HKWA 1TVRB 1FKOB 3S3MA 4EZ9A 4BE0A 1TKZA 1FKPB 3OYCA 4H4OA 3HP9A 5F8LA 2WCXA 4O44B 2ZE2A 2B5JB 4DTXA 3KLVA 1IKYB 5KFAA 3OSPA 1RYSA 1XR5A 3M8QB 1S1XB 3OVNA 1I3AA 4IQXA 4RW6B 4KO0B 1HYVA 4I2QA 2FBTA 3Q8RB 1HQUA 3NH0A 2O5DA 2R8HA 3QEIA 2IOCA 4ELVA 2X6SA 5HRSA 1S1VA 3DLKB 4CERA 3AA2A 3RB4A 3BDPA 1TL1B 3PX0A 2DPJA 4EBCA 3SV3A 4QCLA 4FLZA 1JLQA 2Z1JA 4RW7B 3AA3A 1NK6A 3V6DB 5L9XA 3MEGA 4YNQA 3FFIB 5DG8A 3DI6A 4FXDA 3FQLA 3PV8A 4F2SA 5F8JA 2GUIA 4IKFA 2X78A 4MFBA 3VQQA 2QKKA 2BGGA 2UUTA 2XGPA 2F8SA 3IRXA 2HWHA 1LWFA 3N6LA 3KJVB 1MU2B 4OJRA 1S10A 3DLEB 1QTMA 3EYZA 3KNAA 3FRZA 1WNSA 2BRLA 3IS9A 2X74A 2YNIA 1VSHA 4ZTFA 1B9FA 2XRIA 3OY9A 4E7JA 4G3IA 4Z4EA 4NCBA 1BGXT 3T5JA 1VSKA 4AHUA 2R8KA 3QIDA 1HPZB 2VG5A 3MEEB 4IR1A 4KFBA 4IG3A 4RW8B 5KG1A 2FVRA 3VA0A 1BQNA 2ZD1A 1JXLA 1RTHB 5CYMB 1VSDA 3TR8A 2W7OA 1JLAA 3KLIB 4CIFA 2ASDA 1HQEB 4RUCA 1RT1B 2IMWP 4YMEA 1KLNA 2FJWA 1C0TB 3VQAA 2HHUA 4OKJA 3PX4A 4FJHA 3S3OA 1QAJA 4JS5A 4ECQA 4IBNA 4O3OA 3OS1A 1GOCA 5F9LA 5KGWA 3QLHB 3M8PB 3V4IA 4M3ZA 5JUMA 4E89A 5C25B 3N6NA 3PW0A 3WNHA 4W5QA 3OHAA 4DTUA 4QWCA 4CIEA 2R8JA 3B6PA 3T19A 5KT6A 3RB6A 3I0RB 2DPIA 1TK0A 1EP4B 1T3NA 4Y2CA 4MQ3A 1SV5A 5C42B 4DTMA 3NE6A 3QGHA 3NMAA 4N76A 4IRCA 3V9WA 4I7FA 2JC0A 3Q8PB 1QSYA 5K14B 3OL7A 2IGIA 4FM1A 4FJJA 2ALZA 1REVA 3RB0A 4NLDA 3BGRB 1QE1A 4CGFA 3OLBA 2C2RA 1W9HA 2HW3A 3CJ2A 4J9NA 3OHBA 1KSPA 2W8LA 1NKCA 5HROB 4MIAA 4TSXA 3SJJA 3SI6A 4H54A 2C2EA 4NRUA 3LWLA 2I1RA 3BJYA 2OPRB 1T05A 1UA0A 1JKHA 3NGYA 1ZTTA 3H59A 2OPSB 3C6TA 5I42B 2BE2B 3O3GA 4Z4IA 3F9KA 4LD0A 4CECA 2P5OA 4DWIA 3LP2A 3OYHA 4KAIA 1N48A 1IKXB 4JV0A 3G86A 1CXQA 3HHKA 2RKIB 4B9UA 1EETB 2HAIA 3DRPB 2G8HA 5KFVA 3KKSA 3RWUA 5C24B 1HNVB 2ATQA 4E1NA 5DGAA 5FDLB 4R5PB 2WONA 4NYFA 3UR0A 4NCAA 3QIPA 3PJXA 3TQ1A 4F4ZA 3L3VA 3L2RA 1DTTB 3THVA 4LY7A 1RTIA 4CGHA 4LH4A 3AVKA 1B9DA 4TYBA 4ZVGA 3VN5A 5KFNA 4Q5VA 4O55A 4ED2A 1RTDB 3K5NA 3TAMB 5KGXA 3ASMA 3K59A 4QAGA 2BRKA 1LW0A 4Q8EA 1RDCA 5J2NA 3LZIA 4DTPA 3VQ9A 3K5LA 3QETA 4DSFA 3RB3A 5EDWA 1SKWA 3ISNC 3AV9A 1RDDA 3NDKA 1NK5A 4QWAA 1SKRA 4QOZB 2YNFA 1NKBA 1JX4A 4CEDA 4NCGB 4URGA 3DOKB 1RDBA 4Y1DA 3PX6A 4ECUA 3HVRA 1SL1A 3ZSRA 1TKDA 4MH8A 3TAQA 4FJNA 2OPQB 3BREA 3Q8SB 3ITHB 3RR7A 3EZ5A 3CO9A 2B6AA 1TP7A 3LZJA 1WAFA 4K8ZA 3HPGA 4KRFA 1N5YA 2OA8A 3TAFA 2IM1A 1NK9A 5C5JA 1VSFA 3HT3A 1RBTA 4ZPCA 1RNHA 1U04A 4FK2A 4H4MA 1I6JA 2YHAA 4ELUA 4IFVA 3DM2B 1RT5B 2HHVA 2B43A 4KHUA 3AVIA 3V81B 3BSNA 4CF9A 1LWEB 2ZKUA 4U6PA 4DL3A 4EBEA 1J5OA 1LW2A 3L2QA 1RTJA 3KLFB 3UDLA 4RU9A 3D0PA 1SH2A 1KTQA 4KPYA 4L8RB 4E7IA 3G6XA 4KV8B 1ZYQA 3T1AA 5E41A 1RILA 4DFMA 3DRSB 2HMIA 2XO7A 4RNOA 3KLEB 3FSIA 3V1RA 4CJSA 3I8DA 1L3VA 3GV8B 3KLGB 3OYEA 4DL6A 1NJYA 4NLVA 4FJIA 2DY4A 3PO5A 4MIBA 2YV0X 4F3OA 3LP1B 4CF1A 4DG1B 4DSEA 3NGDA 1JLGB 3U3GA 3MR6A 2IA6A 5KG3A 4FLTA 1NK4A 4BDPA 2EC0A 4DLGA 5KFWA 3AVJA 1ITGA 4DLEA 1IKVA 4B9LA 1C1CA 2VG6B 4RNMA 3KK1B 3VQ5A 1C6VA 4E19A 1UWBB 4JUZA 5J2QB 3NBPA 4TY8A 3GYNA 2C2DA 2V4RA 4YR3A 1SH3A 1L3SA 3H2LA 3AVCA 4BDZA 2VG7B 4ICLA 4O3SA 1SH0A 2W42A 4KB1A 1Q9XA 4QWBA 4URQU 4CESA 3DOLA 2HHXA 1T94A 1TV6A 5F8IA 2IJFA 2QXFA 4I9LA 4CJUA 4IDKA 5FROA 1UAXA 4ECZA 3PJWA 1JXEA 4ECYA 3GILA 4RW4A 1RDRA 4MK9A 4O4GB 4DL2A 4W5OA 3HXMA 3DLHA 5D3GA 5DQGA 1RT3B 1C0UA 2Y1JA 4ZP8A 1HNIB 4ECRA 2EX3A 1YVUA 3VQ6A 3ZT2A 1JLCA 4Y3CA 4NRTA 3O4QA 5HLFA 4IRDA 1TKTA 3SQ1A 3NCIA 2FLPA 3NF8A 3LAKA 3NGIA 1FKPA 2FBVA 2BANB 4PA1A 1IKWB 5KFRA 3NKYA 4O44A 2VWJA 4DL7A 2E4LA 4CEFA 1SKSA 3DLRA 1IKYA 1GX5A 4JRQA 2WOMB 1S1XA 2IJNA 4ZMMA 2HNYA 3BQ1A 4J2BA 3FDSA 1NKEA 3SUNA 4QW8A 4HYKA 2DTUA 4LSNB 4RW6A 4KO0A 1BHLA 1S6QB 4DTNA 5KT5A 4CJEA 5T7BA 1N6QB 2W9BB 1S9EA 4ECXA 4DSJA 2Q3SA 3BSAA 1S0NA 3CVKA 2IBKA 2LSNA 4FZXC 3DLKA 2BQUA 5DQIA 4O3NA 4UQGA 4ZHRB 3QESA 3KTQA 4M3YA 3DYAB 4FLYA 2AX0A 3T5LA 3SFGA 1TL1A 1BI4B 3P5JA 3CJ5A 1VSJA 4XPEA 2YNGB 4J9MA 3SPZA 3AVLA 4N41A 4RW7A 2XY7A 3SUOA 2YKNB 3V6DA 3LP0B 3LANA 3FFIA 4OKEA 3V1OA 3H4BA 3DDKA 4CCHA 4ZTJA 5F8GA 1YT3A 1I39A 4PWDB 3AVAA 5KFQA 3OS2A 3CDUA 3QGIA 1HYZA 3OYFA 3RBEA 2BR0A 3RTVA 3HVTB 3H5UA 1MU2A 3HL8A 2OH2A 3DLEA 1BQMB 1SL0A 4J9LA 3MECB 2RDIA 4YFUA 4GC6A 4K4SA 3AO5A 3QZ8A 4IOBA 4CJPA 1QS4A 1S48A 4JV1A 3VA3A 4CFBA 2P1JA 2KZZA 4B9TA 3MEEA 4CEEA 5KTQA 4ECTA 3PR4A 5J1EB 2XCPA 2HNDB 4BE2A 2IDOA 3QO9B 2F8EX 4O0JA 3LPUA 2Z1HA 5CYMA 2FJVA 3DLBA 4WXOA 1RBRA 1NOYA 3G6YA 4CHQA 3KLIA 4J2AA 1HQEA 1X1PA 1RT7B 1QHTA 1RT1A 3TAEA 3HSTB 4N5SA 1C0TA 2BQRA 2VA2A 5CY4A 2R2TA 4KB7A 2XWYA 3WNGA 2ETJA 1XC9A 4Q0BB 1CZBA 4GW6A 1LWCA 5KFUA 5FRMA 3MR5A 1S5JA 4K8XA 4TQSA 3QEVA 2GV9A 2BQ3A 3IGNA 3LWMA 3M8PA 4AHVA 4PUOB 4W5TA 5C25A 5KT3A 5HRRA 2XY5A 4LQ3A 3RAXA 4LSLB 5J2PB 3I0RA 2AGPA 5HBMB 1FXXA 1EP4A 3MR2A 5FRNA 2YKMA 4QWDA 4DTJA 4WYLA 1S1WA 3DRRB 4ED6A 2P51A 5I3UB 4Z4HA 2OZMA 1BIUA 1WSJA 4FK4A 2XC9A 3AO3A 3U6FA 4CJWA 1WSFA 2ASLA 3I5BA 5K14A 3VQEA 4FLVA 2ATLA 1JXBA 1HYSB 2D5RA 2V0NA 4WZMA 5KFDA 3M9NB 1RT4A 1A5WA 3I0SA 5KT4A 2PYLA 1D1UA 4EP4A 4K4TA 5KFFA 5HROA 3IGVA 4HVJA 3JSMA 4HHTA 4KHSA 3KK2A 2RF2A 3OYKA 3SFUA 1TKZB 4Y34A 4FYDA 2OPRA 2PZSA 4WE1B 4IKAA 4FM2A 5KFPA 2YHBA 1XHZA 2E9ZA 4N56A 4DFPA 4KHMA 2G8VA 2D0AA 2BE2A 4IH7A 4M3XA 1BCMA 4IFYB 4OPJA 5SZTA 4E7KA 2QK9A 3CFPA 2XCAA 1TK8A 5KT7A 3OL9A 3PW7A 3K5MA 1EETA 1YTUA 3DRPA 5KFJA 1FK9A 4CJ3A 1S1TB 2XHBA 3KK3B 1NJXA 1S1VB 3QINA 5FDLA 4R5PA 5F8MA 3G0ZA 4RNNA 3RRHA 1W25A 4WZQA 3D5MA 1J54A 4KHWA 4B3OB 4BWJA 2F8TA 4FJXA 1S1UB 1DTTA 1VRUB 3OL6A 1DLOB 4MKBA 4OGEA 3V6HA 2XY6A 3L3UA 1VSMA 3Q8QB 2AQ4A 3DI6B 1T7PA 3PVXA 1MMLA 1RTDA 3TAMA 1EX4A 1SUQA 3KHHA 1D9FA 3ISND 3T3FA 4FK0A 3P83D 2D3ZA 2FBXA 3C6UA 3DMJB 1WN7A 2E6LA 4KTWA 5F8NA 3OJSA 4BDYA 3QNNA 3UQSA 4FBTA 3H40A 1K1QA 3S9HA 3ZSQA 3IS9B 2R8IA 2UUWA 1JLEA 1HRHA 1YVFA 1QAIA 1KVBA 5KG4A 4NLOA
chains in the Genus database with same CATH superfamily
3ITHA 1R0AB 3W2WB 4KFBB 4AD6A 4CJ5A 3AHPA 4YQWA 2WVFA 2HURA 2PFFB 4D3GA 1ZBLA 3DLGB 5E84A 4DMNA 3VHQA 1BA0A 2XLIA 2EK6A 1JIHA 5DMRA 1KVAA 3ISZA 3ET6B 2KW4A 4ECVA 4ID5A 3DM2A 4HCCA 2GMJA 4ED8A 1V6HA 4JI1K 4PRFA 4PZVA 1G4CA 1SJ4P 4X2BA 1VFJA 2E1ZA 1TL3A 3RG6A 1NPPA 2PY5A 4EHUA 3HD1A 1YTYA 3BO2A 4LF2A 2RAQA 4F4XA 1A5VA 1M1GA 4KH4A 1D8YA 3O4NA 2HPUA 4BR7A 1YHQN 1GK8A 5EHHA 3CDBA 5K8PA 1JJ4A 2MJNA 1NU4A 1SC6A 3OTOJ 3TANA 4WQ5C 1RHRB 4OI3A 2B7BB 3H5SA 2VG6A 3BH7B 2E2NA 3U7JA 1RHMB 2FZCB 3RBZA 3KK1A 4CJFA 3GJSB 3NFAA 1CPZA 2QEXS 3QIOA 4ZP9A 3WXLA 1WI6A 3THWB 1Q8BA 3LALA 1CJKA 1HL6A 3UCGA 3TR5A 2KYZA 4M3RA 3W8PA 2J7KA 1FTCA 2MPUA 3KK7A 2ZGZA 1Q9YA 3R97A 5A0YA 3ENBA 3TABA 1PILA 4B9NA 1PC4A 4P72A 1FNOA 1Q5VA 3JS6A 2P9UB 3HHNB 1T03B 2V5HG 4BHQA 4DV3K 3R27A 2WTFA 1FRHA 1RT3A 4HHJA 3W1YC 4JK7A 5TKYA 3M30A 3HBTA 4RW9B 5AQOA 3QIPB 2AHOB 2CQ0A 1TU0B 3WX4A 2HK3A 4WFAQ 2MZTA 2ZH3A 2J76E 3DWLA 1HI0P 1SQFA 4DQPA 4HTIA 2QFIA 1IKWA 4FDFA 3ZT4A 2H51B 3Q0AA 2Y1IA 1RBLA 2V51B 3AA4A 1LAVA 5MLCQ 4LRCA 4DV5F 2GEMA 2Z8QA 4MLHA 4NLYA 3J80O 4X64K 5GINA 2D3UA 2ZOMA 3NF9A 3KD1E 1KOHA 1BY9A 2W2OP 3PKYA 3CYMA 3KLHB 5KFLA 1BI4A 1NGDA 1CULA 4UZCA 2E1YA 2ZWOA 1RT2B 5FPNA 3EE3A 1HLWA 1OYDA 2M9KA 2K8GA 4OVLA 2DRBA 5DLFA 3QEWA 3E1YA 4DF4A 2Q0RA 2QMWA 3IO1A 1YQHA 2EW9A 3MM9A 1FKAF 4WFXA 1X7VA 3CCSN 2VBWA 4LJMA 2GMHA 3MFIA 1SJQA 4C8NA 3O6QA 3M9MB 2O8CA 4QOTA 2VQFJ 3V6JA 4WQ5A 3BYPA 4FNHA 3QBCA 5AQXA 1S4EA 3NS6A 4HTUA 3W64A 4KHPF 1U09A 1UVNA 4IG0B 3LDLA 2XBPA 1JL2A 3MOZA 3TZXA 4QYZK 4FVUA 1F9HA 3T1HJ 1Y5LB 1RA7A 2FVCA 3PRBA 2CJQA 3M2VA 3TWHA 5KPRA 3KHYA 2XGQA 5AQSA 1EKEA 4LF5F 4N7TA 2J6TA 1P1LA 3W2VB 2F9WA 1RT7A 4NOHA 4I56A 4M5MA 2LEBA 4BG9A 2HBJA 4JK9A 5D15A 2YPZA 2IY5B 5KAKA 1VIXA 5JICA 3CCMN 4CEZA 3NBPB 4ID1A 4EUVA 2AZ3A 1PYTA 2VICA 3HSGA 4KTZA 2IM0A 2D0CA 3SCJE 1ASWA 2CVIA 3Q22A 2BMBA 1ZBFA 5HANA 1T8EA 3ILIA 2F9DA 3L9ZA 5EU7A 1RGVA 4DV6K 1FW6A 4M7XA 5HBMA 5CAAA 1P27B 2V2KA 4CLWA 4ED4A 2YPYA 1NM2A 1U47A 1KDNA 1HJRA 4IDKB 3MMAA 2DHGA 2P9IB 1RWKB 1ZM2A 2BVZA 3VF4A 2GC8A 5GADI 2VA3A 1C0UB 3RBDA 2DISA 3V9SA 3H2VE 3R7BB 4C8OA 5EUHA 3TX0A 4KREA 2NNWA 1GX6A 2WK4A 5SWMA 3GFYA 1FJ7A 1RTHA 1MSWD 3MPUB 2P9KA 4OHVA 2DNZA 1VAZA 1PKUA 2FJBB 5KOXA 4DV7K 3GJQB 5KFEA 3BZCA 2CDRB 1WB9A 3CDAA 4CGJA 2VOPA 3SI8A 4HT5A 3SUQA 1BUPA 4IFYA 4OLBA 4DR2F 1HKBA 3M2UB 2HNYB 3PSFA 2YKOA 1PYSB 3UW1A 1EARA 3FZFA 2KXNB 1CLQA 2UXCK 3FNNA 4K2XA 2KB2A 2P9CA 1S1TA 4KT0C 1KS2A 3KK3A 4DU1A 4KHRA 1XQIA 1SPBP 2N4CA 1RBSA 1IO2A 4B3OA 1VS3A 5CD4A 2HGMA 5C42A 3KDNA 4CBWA 1R43A 1HQ2A 3E01B 3CCVS 2NRTA 1TYQB 5TKWA 3QDKA 4ZPVR 2FLNA 4AHRA 1UJ6A 1HJOA 1RHJB 4U7UK 2PFDA 4ZS6A 3I31A 2B8PA 4ANDA 4DEZA 3IG1B 1OSDA 3DMJA 2O4IA 1RWPB 1B92A 3BGRA 3R3TA 4HTJA 1XI1A 5EX0A 4A8YA 2KJVA 4WFYA 3E9PA 3K7RA 2AIRB 3OYAA 4B3RF 3BEGB 3BF3A 1RA6A 3HSDA 4BRFA 2ZEJA 4GVEA 3CM6A 3AO1A 2N4DA 3FQKA 3MMVA 4BC4A 4B1UB 5I42A 2IVNA 4LBHA 2RQ4A 4FN5A 1UP1A 3FFKB 3SMPA 1X9JA 4K4UA 3UPFA 2OJ3A 5IM0B 1IM4A 1IKXA 3NNHA 1S0OA 3DHXA 3UDVA 4I2QB 1Z4UA 4NA3A 3CD0A 4JI7F 1BWVA 4OPKA 4CM2A 1U2VB 2NUBA 4IR9A 2YCHA 2PT0A 3M6GA 1Q81T 2DNQA 1CJUA 3HP6A 4BACA 1FT8A 2ZZTA 1C2PA 4KKOA 4OYZA 3ZTOA 1S9GA 3VF0B 4E7LA 2U1AA 2AEJA 5L1KA 2BJ8A 2J9EA 3T7ZA 3HFZB 3TAPA 4RU2A 3Q8UA 3HM8A 1RP5A 2NXJA 2JGUA 2XI2A 3L8BA 3SQOP 3CQ8A 3SXLA 3NY0A 4G65A 1OJ4A 3FCHA 4HACA 3OL8A 4RTFD 3CC4N 1NNEA 5C12A 5GAHU 1HWUA 4YOYA 3F41A 4TY9A 3G9CA 5KPTA 1YBAA 1RKIA 3THTA 4NCGA 2O3DA 5AE1A 3C7NB 1CC7A 1GMUA 2QA2A 2HVHA 1U4BA 4F02A 2V67A 3WDOA 1SQKA 3MCAB 4CHZA 4PG5A 2DNPA 1SIZA 2VHGA 3AGRA 3POTA 2HHTA 5EWFA 1LOTB 2CIMA 3LL3A 4RX6A 2XMVA 5DZ7A 1AZSB 3W0LA 2P6SA 1KHWA 3PSIA 2ZD1B 2RF2B 3C94A 1Y00A 3G6VA 4A8QA 4W5RA 1JLAB 4Q8FA 2JHEA 2QZ8A 2Z4PA 1X3MA 4MIWA 1RGIA 1KD1T 2GJ2A 3EGZA 1XMOJ 5MAOA 4CLKA 4DL4A 1HNXK 2FSNA 4NX9A 2X7IA 4DX8H 3V9XA 1XR6A 3N9UC 3HPOA 4KV8A 2HBZB 5AZJA 2D0BA 1T95A 4M3UA 3WHIA 4M63C 4WCEL 2GZOA 3LH2S 1S6PA 3VEXA 2CG8A 2V2VA 1JNZB 2CJKA 3FEXB 2JX2A 2QWLA 1FXDA 3HZ6A 5KG0A 1WOQA 3K9KA 1ILYA 3W61A 4C8KA 3R8YA 3GG0A 3GV5B 4DG1A 2BACA 1VHXA 1JWWA 2UP1A 3C6UB 1REVB 4KH6A 1YX2A 3NAIA 3CGIA 2FY8A 5AT1B 4KPCA 2UUCK 1YHQS 4JRPA 1S59A 3ID8A 1S72N 4HUGA 4WU3A 1S0MA 3OTCA 1ZTWA 4ZPAA 2W6KA 1KHVA 4FZYA 1NK0A 3F9MA 4HT7A 3OYJA 1KBRA 1FJGF 3NS7B 1KWMA 3H1VX 2HVDA 1YLXA 5IXUA 4J9RA 1B64A 1C0MA 1V3RA 1UVIA 3R3LA 2ZBRA 3ZSWA 3G4SN 2CJBA 2ZZMA 2MJUA 5L1IA 3CULA 3EPGA 5B7WA 3PNIA 5G0RB 2BE7D 1Q0NA 3RMDA 3A3OB 4OI1A 3D7SB 1W7AA 1BMQB 2GBZA 2I5JA 4ID5B 2QX0A 5A2QY 2UVWA 2WONB 3M8SA 1SQGA 4WKRA 1JNRB 2ILYA 5CD4H 1Y3JA 5JMNA 4DUZJ 1G3OA 2HVIA 4EWTA 3I82A 5DQHA 4C1NK 4K8RA 1TL3B 3NL0A 2IMOA 4BG8A 5FLXY 3LAMA 4YB1P 4O8KA 1RWWB 4OX9F 2MHEA 2O8EA 4JLHA 2FLOA 3PW4A 1JLBA 2EVZA 2WOMA 2J0SD 4H0YB 4A8OA 1U45A 2XULA 3GTYX 2LQ5A 3V9ZA 1WAJA 3RZAA 1EAYC 4U67Q 3AODA 1Q53A 3OTOF 2Q36A 4P2SA 2XLKA 2GIQA 1URRA 4M63A 2UXDJ 1FRLA 4F3TA 2B6AB 1V5IB 4YOVA 5A8WA 1Y97A 1U1NA 1CJKB 2UXBJ 2OZSA 3C66A 3MUVP 3CCJN 3VAKA 3C6AA 2HBLA 3RR8A 3HTVA 5A0YB 4LRFA 3CTRA 2CKWA 4KHNA 3EZUA 4FW2A 1HD1A 1VQ9N 2W4DA 1IBMJ 1VC0A 4QYRA 3LA0A 3P8BB 3E66A 4HUFA 3TVYA 2MXYA 5HMWA 2OYQA 1GLCG 3S41A 2MDAA 3N4WA 2F3JA 2DIVA 2CPYA 2IRUA 1XWLA 4FWLA 1ULRA 3RMCA 2JWNA 2YH0A 3E51A 4FVCA 5LMUJ 3VQ4A 5DO2A 4LMZA 5J1EA 1BE4A 1S4FA 4ZPBA 3NH2A 1NGAA 1Q81O 4EFAC 3QO9A 2EK1A 4V19J 3GE1A 4CJKA 2IA0A 4ID8A 4KE5A 1JXVA 1J5EK 2FHMA 1R89A 3UFCX 2IAJA 2Z30B 4QU7A 1T02A 3D6FB 2W7PA 2UVUA 4WFNQ 4CK2A 3R7SB 3OR2A 4K4VA 2XO6A 1RDAA 5LJVA 4ZP7A 3VGKA 3TO8A 3KHGA 1U49A 5BR9A 5HRPA 3QZ7A 5AQRA 3NCRA 3IAYA 2P9SB 2I9SA 3CMAN 4GKKF 1RBOB 4Q45A 2CYYA 4B9SA 4DPYA 3D28A 3S7RA 5BN9A 3CCMS 2VWKA 3L6QA 2ZH2A 3M8RA 1G15A 1UKUA 3SSRA 5GAGI 4JKEA 1VISA 4LF5K 3ZNUA 1NNDA 3MM9B 4EZ6A 4DTRA 2G8FA 2WC9A 4AE5A 1H2UX 2DY9A 2FZGB 2P9LA 3L7OA 2O8CB 2MLYA 1FFSB 1GLAG 3AOAA 2VQFF 2NQPA 2RU3A 3S3MA 3WBZA 4WTOB 1FKPB 2KKZA 4H4OA 1EQ0A 2CGJA 3QFPA 2GMLA 2VYPA 4DUYF 4MLEA 3TOQA 3T1YJ 4USIA 2HQCA 3HRGA 3KLVA 4BRHA 1IKYB 3OSPA 2LQBA 3FMWA 4HI1A 1RYSA 3T1HF 3OVNA 5EN1A 4IQXA 3N5FA 4JN4A 3PTWA 1RLDA 1HQUA 2AW0A 2O5DA 4P2XA 4ELVA 1MWYA 4CZEA 3AA2A 1DQAA 3JTPA 1WSVA 4CLSA 2E7XA 4DV2K 1GEHA 4JKHA 3AA3A 1QTNB 3A3PB 1NK6A 4UOHA 4YNQA 2CNOB 5DG8A 3GYXB 2HOEA 3JTNA 2ZH7A 4FXDA 3MM5B 5F8JA 3AJDA 4J9VA 4IKFA 3CJ1A 4DR2K 4MFBA 1SJFA 2F8SA 5AQLA 3MD1A 3IRXA 5L39A 4JI3J 4YHHJ 3KNAA 1KC8T 4PAAA 2BRLA 2X74A 2IFXA 2DCLA 3WXJA 1HIYA 1B0TA 1DQ8A 4E7JA 2XRIA 4NCBA 1BGXT 1Q86T 2I7NA 3RRKA 2EG1A 3MEEB 4IR1A 1YJ9N 5KG1A 3P38A 3JQMA 5BPNA 2HSEB 2W2PP 1JXLA 1RTHB 2XEXA 3TR8A 3R5JB 3KLIB 2UUAJ 1RT1B 5CZXA 1C0TB 1Y64A 3PX4A 4FJHA 3S3OA 4JS5A 4C8YA 2B56A 3V4IA 1NGEA 5JUMA 2GAGC 1FRIA 3WNHA 3OHAA 3A1YG 4ZK7M 5DM6Q 4BRLA 3T19A 1OVYA 3TUPA 3RB6A 2HFUA 3ZTSA 4UW2A 1SV5A 2FZKB 5C42B 3DOMA 5B09A 3ZFVA 2YX6A 2EI5A 3CJ8A 5CCLA 4XK8C 2W2QP 4FWQA 3NMAA 2J9DA 4IRCA 1T3VA 4JI7K 1Y7PA 3IP0A 1QSYA 2ZJPL 1JCGA 2IGIA 4FWNA 1K9MO 5GAEP 3CC4S 1FRMA 3BGRB 2A1BA 2YBVA 3OLBA 3QQCD 4DPUA 2HW3A 1W9HA 1RAAB 3W7BA 1XTZA 1IV0A 1NKCA 5HROB 1GTHA 3J7ZO 3UKRB 2I1RA 2W6LA 3BB5A 4AT1B 3Q83A 1AT1B 3NGYA 3H59A 2LVWA 5I42B 1PSDA 2WSFC 4H5RA 4B3MK 3A4TA 1KQSR 4JI6K 3TU5A 2BE9B 2KO1A 3CERA 1AYEA 3U1LA 1IKXB 1D8ZA 1YF5L 2WW4A 3HHKA 2LKZA 2HAIA 3OFEA 3U27A 4E1NA 2Q2RA 5FDLB 1CJUB 1VK8A 2BOPA 3CJAA 4K42A 4F4ZA 2ZZNA 3D0GE 1RTIA 4LF8J 5FPMA 3TSUA 4LH4A 2ZJRQ 4M5IA 3AVKA 5M2UA 4H5VA 2MLXA 3VN5A 3SMZA 5E26A 3GE9A 1RTDB 4CVNE 3K59A 3VWSA 2MKCA 2E5HA 4Q8EA 5H1SQ 1RDCA 5J2NA 3LZIA 2Y3YA 3QETA 1JCFA 4A2BA 1NZ8A 5EDWA 1SKWA 2FQQB 3ISNC 1RDDA 3QFUA 1NK5A 1U1QA 1YWXA 2YNFA 4NCGB 4ETXA 4URGA 1U1LA 4O0NA 4ZN1A 3BBBA 1TKDA 3ZZOA 3POTB 2OPQB 3MN5A 3Q8SB 1ZPVA 2ASPA 1WACA 3HSJA 3RR7A 3EZ5A 1WC6A 2D9PA 3CO9A 1PJ5A 3OBYA 1TP7A 5IFMA 2LQJA 1S72S 2OA8A 2IM1A 1NK9A 4DUTA 3HT3A 1RBTA 4ZPCA 1RNHA 2Q1LA 4H4MA 2C2OB 2YHAA 3AQPA 4ELUA 2C3YA 4C3LA 3BYRA 4IFVA 4RWTA 2CQIA 3AVIA 3G4SS 4DCOB 4U6PA 3J81Y 3EKUA 1EKRA 2KT3A 3UDLA 3KNGA 2CRLA 4RU9A 3D0PA 1SH2A 1VQKS 3DXMB 4L8RB 4KV8B 1FDBA 2NZCA 4EK2A 3BDEA 1FHTA 4DZ6A 2E1AA 2XO7A 1ZAWA 4B02A 2XZWA 1L3VA 3KLGB 3OYEA 3S6EA 4FYWB 4F3OA 4H4KC 4CYUA 2ZJQQ 4CF1A 4DG1B 3B8AX 4DLGA 2A18A 1DQ9A 1ITGA 2YVSA 1NSPA 3BR8A 1XK8A 1C1CA 2AF6A 4XH1A 1GMVA 4RNMA 5L8RC 2E5LK 2HAFA 2LA4A 1C6VA 4E19A 4K0KJ 2VFVA 3TEHB 5J2QB 3QJLA 4QS9A 1TUYA 2E5GA 3OTBA 4KH5A 2QC3A 4KB1A 1Q9XA 2N3OA 2DITA 1Q86O 2D3O1 1UAXA 1AB8A 4ECZA 1R7IA 4ECYA 1DFDA 3D3CJ 1WF1A 3QWPA 4O4GB 4DL2A 3NXZA 4BRDA 3CCJS 1H74A 1I1GA 1V3SA 2W4PA 3AXKA 1H73A 5DQGA 3UWTA 2ZNYA 3I56N 4LFAJ 4ILGB 4ZP8A 4ECRA 2IJRA 2O67A 1JLCA 4Y3CA 4PG4A 4NRTA 1S5ZA 4FF1A 1VQ9S 1TKTA 3SQ1A 1VQ4S 3LAKA 2QA1A 1OQ3A 4YB5A 3NKYA 2C3OA 2O8EB 4F0MA 2E4LA 1B3TA 4CEFA 3GZ7A 1A6LA 3VENA 1F3FA 4JRQA 2WOMB 1HKCA 5DS7A 1S1XA 3FZKA 2IDEA 4KO0A 1BHLA 4WFBL 3FEZA 1OH6A 4DTNA 4CJEA 1S9EA 4FZXC 3DLKA 2BQUA 3KTQA 2NREA 2QWQA 2AX0A 3MX2A 3T69A 1TL1A 3VQTA 3CJ5A 2YNGB 4LRBA 4XDDA 4ES2A 4N41A 2XY7A 5AQPA 2K3IA 4OV1A 1ZZFA 2MQ8A 2ZOGA 5A8WB 2UXDF 4DCHA 3CMAS 3R5BA 2OHDA 1YT3A 4P2FA 2E2OA 1HYZA 2M52A 5ETOA 4H4KA 1F60B 2V63A 2B4OA 3DFEA 1MU2A 3DLEA 1BQMB 3IC1A 5AQKA 3AO5A 4IOBA 4PWWA 3QJJA 1IBMF 2QFJA 1WEZA 2P1JA 3GMGA 2VKZG 2CWKA 1IR0A 4ECTA 2A40A 5J1EB 3VETA 4NLBA 5LMUF 2DNRA 5H9FJ 3VAIA 3QO9B 4JI8F 1H38A 3LPUA 1IBLJ 3DLBA 3OV7A 1R3NA 4CLFA 1RBRA 3G6YA 1QHTA 2RQCA 4PXDA 3D54A 3TAEA 4XEIA 3HSTB 2BQRA 3EE8A 3FZ2A 1FF2A 4JI5J 1XC9A 2O8FA 1LWCA 3H1QA 2L9WA 2KXFA 3N79A 2DR5A 1S5JA 3A3NB 1KONA 1VBZA 3JB9k 2VQFK 2F9TA 3DCAA 1N32F 1VMBA 5ETVA 5KT3A 3IRWP 2H5JB 4LF4J 2QW9A 4LSLB 1RCOB 1QQOA 3HF5A 2RRAA 2C2MB 3MR2A 4HWIA 5FRNA 4CTAA 3KKFA 3T1HK 3CF5L 3TJ8A 4NA1A 2JFDA 3HCXA 1RWVB 3MI7X 4FLVA 1W2BM 4BR5A 2HIYA 1CJTB 2P9LB 2CAJA 3C15B 2RNEA 4WZMA 3OFFA 3M9NB 3FCWA 1RT4A 1UCNA 3I0SA 4X4VA 4CI0B 3H90A 5KFFA 3IGVA 3GJTB 3KK2A 4Y34A 3Q24A 1QVGR 3FUYA 2PZSA 2I6WA 4QIVA 5KFPA 1S3XA 4NMLA 2E9ZA 1FEEA 1A0OB 1U24A 5F2RA 4AM6A 4N56A 4DFPA 2VFRA 4AFFA 3GLJA 3PDNA 1KOOA 2RRNA 1RAFB 3T1YF 3HLUA 1NH8A 2PDAA 3G8QA 4E7KA 2ACYA 3OL9A 3PW7A 5JVGL 2WVEA 1UVLA 2KN4A 5FD1A 1LNQA 4IQMA 4CJ3A 3GPAA 4A8FA 2XHBA 2P9PA 3QINA 5F8MA 4R5PA 5C2FA 2M8HA 2XZDB 3G0ZA 2LQ8A 3CNQP 3ENQA 4BWJA 4FJXA 1S1UB 4X65K 1VRUB 2NYHA 3W5YA 1PO6A 3K0JA 3V6HA 3G96A 2XY6A 3L3UA 4M5DB 2AQ4A 1KP6A 1T7PA 3PVXA 1G6BA 3THPA 4F4AA 2JSXA 4NEYA 3F2KA 3UKUA 1HPMA 3P83D 3U4LA 2V52B 4BC5A 2CADA 2D3ZA 2GTDA 5AQHA 2QT7A 1IXKA 2FYXA 3EZOA 1EJ7L 4LFCF 3OJSA 5C2DA 4HDGA 4DPXA 4N77A 1U25A 1R0CB 4LF6J 3ZTPA 2IRXA 4KIAA 2R8IA 1PIEA 4JI3F 4YHHF 1JLEA 5AXMA 4DV4J 1QAIA 3TPQA 2YY3A 2RILA 4NLOA 3H98A 5HL7L 1J9AA 1BA1A 2W40A 5EY4A 2KTQA 3MAQA 3I8BA 3C8YA 5IWAF 1NH7A 3WXMB 4USTA 3G82A 2Q79A 3HK2A 3NHGA 6AT1B 3PYGA 1LCUA 1JQGA 5FPEA 1OWXA 4B9MA 1E4FT 4DTSA 2UUAF 5SUHA 2VJUA 2JEJA 3RRGA 2MKHA 1SC4B 4KH0B 4XO0A 1WSHA 1FDAA 1VCTA 3KMQA 4Z4CA 1RWMB 3RAQA 1H7WA 2CGLA 2CJXB 4IH5A 4CF8A 3CJQA 4LIWA 3PYEA 3W8GA 3CIMA 3QEXA 4WXWA 1SV5B 5HP1A 1XNRF 2BKOA 3AVFA 5E7OB 2MZJA 5D4LA 4EIAA 2CDQA 3KMSA 1FRJA 2HBMA 3ENWA 3O1BA 1RLCL 2EBEA 1DKGD 3Q2TC 2KJWA 2NRXA 1XJWB 2MSTA 1ZM4A 2CFXA 3HULA 4F36A 4BRMA 2N7YA 1A5XA 4Z0UA 3AY0A 2M2BA 1N34J 3KJFB 4DL5A 3VESA 2KT2A 2K7JA 4L74A 4NLXA 1M1KO 5CE3A 5GADU 1DURA 4WK1A 3ULDA 3R2CJ 1RTZA 3VZIA 3AAQA 2VG7A 4B3SF 3C14A 4U9RA 3UNYA 2DGSA 5AQWA 3GFXA 3ENVA 3O5BA 5L38A 1UAWA 4R0JA 1F9FA 1L3KA 4J9SA 2OFGX 2QLJB 3D45A 4CGIA 1EX8A 5JVHQ 3AD9C 4YB7A 3J80Y 1YTAA 5KG2A 4EHTA 4UTGA 1RADB 4CEOA 1DJ0A 4QPTA 5AFUH 4E7HA 2HHWA 2DNMA 3GONA 4FPRA 3BEXA 1P9QC 2BJ7A 3AFGA 5KI6A 4R8UB 2KI2A 1HI8A 4LF8F 2AJ4A 4K7QA 4MK8A 1RT6A 4JS4A 1GXTA 4ZVTB 2OTLN 3CPEA 5J2NB 4QIFA 1RU1A 1GLDG 3CG7A 4HUEA 1G99A 4PR6A 4H0PA 4GV6A 4O3RA 3H25A 3EXYA 4EFHA 1P90A 3MEDB 1C1BA 2MMYA 3SQ2A 3B6OA 2RN2A 2KM8C 2W9CB 2B4JA 4JHDB 3UB5A 2YNFB 1XMOK 3RMBA 3OYBA 5L1JA 1OQ6A 3VALA 3OS0A 2DGTA 4FPIA 7AT1B 2RE1A 3BKFA 5F0WA 1HMVB 3DYAA 2D41A 1WDTA 1Q8IA 5B0AA 3VQ7A 2LYVA 3VAJA 1SJRA 2DNLA 4BLGA 3U9DA 4NASA 3QT5A 1OH7A 4A4JA 4AQYK 2IVYA 2RPIA 3TRGA 1YJNN 2FXUA 1FVQA 2VPZB 1J2VA 4PY5A 2FHJD 4Y1CA 3CIZA 1X0PA 4H4MB 1WC0A 1GXLA 4NXNF 3MFHA 1SCJB 5DM7Q 1AUDA 3PY8A 4IFVB 1VRTB 4F8RA 2ZKTA 2DHHA 4WFZA 1GNKA 2QA4N 6FD1A 3OUYB 2YHXA 5KG5A 2KLAA 2JLGA 2YNHB 4K43A 4F4WA 4J9KA 1FD8A 5A8RB 3I56S 5CYQB 2V8PA 2VGMA 2B5JA 3S01A 2H5IB 1VOMA 2C28A 3P96A 3NF7A 4H8KA 2FSKA 1YVNA 5EVZA 3DJCA 1JJ2R 5AQYA 2A3ZA 1HARA 4USJC 2V4QA 3D1OA 5KFCA 4AH9A 3L4BC 5HJXA 1Q8KA 3MR3A 2H4YB 1K8AT 5KFKA 1C1CB 1UETA 3A12A 2ZBCA 4QBUA 4CNZA 5BYQA 4DXLA 4KAZA 4W90B 1KAYA 5AXKA 4DSLA 4O4RA 2X1AA 4DUZK 2DNKA 3IMQJ 4K0KF 4UY8T 1I5OB 2IVOA 2CZ4A 2YH1A 3L2UA 3Q23A 3DU6A 3HI9A 3NEKA 3PW5A 3GIIA 3CFOA 3KHLA 3CCUN 2V2QA 4FJ9A 2H5EA 2RMLA 3H08A 4FJMA 2DFFA 3SCXA 2X1GA 4OKKA 4KBOA 1WF2A 3B6BA 4LBPA 1L5UA 1S79A 3HOSA 3AVNA 1GLJO 4I2PB 3HFVA 3SQ4A 2BJEA 4OL8A 4NZ0A 2E9RX 1MMDA 2EFOA 1N4LA 1JLCB 4LFAF 3M6WA 2ITMA 4DTOA 4C3KA 1TKTB 3ID6A 5E33A 2DD8S 3DGPA 3M6VA 2YWGA 2UXDK 4LF7F 4WE1A 4K4XA 4DR6J 2WBRA 3QJPA 2PMWA 3KXDA 3D4JA 2OPPB 3PFOA 2WSEC 3GFZA 2UXBK 1Q7YT 4CW7B 3WC0A 3ZEUA 4NLSA 1V3ZA 2JLFA 3O4WA 5K9FA 4AILC 1NK8A 5D77A 3ZSXA 3W9HA 3QLHA 4QQBA 3J7YI 2NSBA 1S9EB 4I0WA 2D0PA 2LECA 5M1NA 5HMXA 4TN2A 2WHOA 3H46O 1IBMK 3PIPQ 2W25A 2R2SA 5E3AA 1X8DA 3CD6N 1TMJA 3NF6A 4QIEA 3HFKA 2VFUA 1KRPA 4X4PA 4U7CA 4HCBA 4IH6A 3R6LB 3H42A 1SL2A 4A8SA 3PZPA 1M1HA 3I55N 4NO7A 4NPOA 1DLOA 2A2DA 1QSSA 1GXUA 1ASVA 2B4VA 4QIWD 4KB0A 3HO1A 5KRTA 3SNNA 5LMUK 4OZJA 2ZQBA 2AA4A 2Z2MA 3O3HA 2IS3A 4FO0A 1SB6A 1HBOA 2HWIA 4IOCQ 3VMFB 4KI6A 3D6RA 3KIOA 1D3WA 3VEVA 2JWKA 5IT4A 1T9UA 4CQ1A 4ZLNA 2GQCA 3MUTP 3HKZD 3LQVA 4FPBA 2MQQA 4DR7J 2D9OA 1QM9A 1GQEA 1VYAA 5A76A 2EHGA 4FJ7A 1K6YA 1U7LA 2D74B 3VERA 1T9TA 2XYHB 1Y10A 3O6WA 1K8KA 2OSRA 1R0AA 5ADXA 4NYZA 3W2WA 5KOWA 3G8SA 3OBIA 3HZEA 2DEJA 2NRWA 3VEOA 1XEZA 3DLGA 2RKIA 2ASJA 1WHXA 5E5NA 4WP8A 2DKOB 1AXQA 5C24A 1HNVA 4JYAJ 3ET6A 2DFEA 4ELTA 4KYZA 4PXEA 4HL9A 1LWCB 4JI5F 4C8LA 2LMIA 4RLEA 2R7YA 3RU0A 1JLQB 2XNQA 1FVSA 3CMEN 5E3QA 4B3TJ 2BDPA 2KQ2A 3QWUA 4RR5A 2EKNA 1VQYA 2CUYA 4DPOA 3U3YA 4ED1A 3TYTA 3I9ZA 4MYUA 4N47A 4CJ4A 3QERA 2WBNA 4FLXA 5M1FA 1WSIA 4BRGA 4DMZA 3P1GA 1UVMA 3CJ9A 5ETPA 4PKGA 2RDJA 2RU9A 3L09A 4LF4F 3T1YK 1LWFB 4CLZA 3OYGA 1WHYA 2DVIA 3M9OB 1WC5A 3K9JA 1N33F 1RCHA 3FEYB 3OLAA 3DOKA 4TU7A 2YI1A 5JS1A 4BGAA 1ROFA 2NXNA 3OSNA 2YX1A 1RWNB 1RT4B 4JKBA 3I0SB 2RB7A 2XNRA 1R6YA 5CQGA 3G6EN 3KK2B 4JI2J 1IWGA 5JS2A 3N5BA 4R0EA 5JXSA 3K2PA 2G0JA 3SAFA 4H5TA 1EWQA 5LXRA 3IR5B 1HR0F 3VQDA 2ALYB 3SAGA 2DHSA 1IUJA 2W1BA 1IG9A 4ZVPB 2P9UA 5HVHA 4WQ4C 1T03A 4NE9C 1QDUB 3DU5A 3CJ3A 1QLNA 5IT9U 5EX5A 3PXGa 2LCWA 1HFEL 3W5XA 5BXIA 2XMUA 4C11B 4RW9A 1W97L 2CVEA 2GQ2A 3VCDA 2ZH8A 4ZVFA 2APOA 4XTTA 1I94J 2AEMA 3NWGA 1BUXA 2YWWA 4DR3J 4M41A 3ONQA 1K1SA 5LSLA 4LH5A 4AHTA 4DV5J 3LP1A 2XHWA 3UKUB 2PA3A 3PR5B 1X9WA 4EEYA 2UUAK 1D4XA 5GAGU 3CO0P 2XHCA 2IM3A 5AJ3J 4DQSA 4RZRA 1GFWB 3M6XA 1JJHA 3M8YA 4CFAA 4F04B 2P9NB 3N6MA 4Y2AA 1BWEA 1M90O 3ZSVA 1FJEB 3NVMA 1JLEB 2B51A 2HVZA 4LF6F 4ECSA 2VV5A 1JKHB 3KLHA 1F1BB 2R2RA 1RT2A 4AHSA 2NZ4A 3U9ZA 4DV4F 3TP2A 1QAXA 3AA9A 2XSJA 1RAHB 4YOTA 3CHWA 3G82B 2GA7A 4WIIA 4A46A 3FKBA 3HT0A 3VF2A 3ILLA 2JEIA 1IQZA 1UZDA 3LGNA 2PO4A 2QE5A 3HZGA 3CCQN 1EO1A 1LEOA 4YP3A 3SJHA 1KKHA 3D9BA 5AE2A 3VEYA 4CF2A 4XIUA 2MKYA 4KHPJ 4J91A 2W2NP 4F0KA 3O3FA 1NSAA 2E88A 4NLTA 1ZA1B 4CJVA 2QLXA 1YDLA 3CJ0A 3A8JA 3MXHP 4IG0A 2KRRA 1NDPA 2ITGA 4JKAA 3SUPA 3FR0A 2ZM6J 2E1PA 5ETTA 3EY1A 1RJJA 5HP1B 1NRKA 2V8VA 2VASA 1WNEA 4L3KA 5DETA 4ZP6A 4NZ7A 2W9BA 3QGGA 3AAPA 4ECWA 3NH1A 1UA1A 2OTLS 4WQ4A 4E1JA 2VPXB 2MKKA 1UZHA 5KFOA 2YHYA 4CZMA 1WLJA 4HDHA 4CJ7A 1RWOB 1T6DA 4DV1J 4QJVA 4PG8A 4C6AA 3EVWA 2JEFA 3BN4A 3HJFA 2L9NA 1RBUA 1T0TV 2OLWA 2LU2A 1S97A 1NB7A 1FXRA 1EKSA 4R79A 3PO4A 3K57A 3C14B 4HHHA 3DAWA 3AA8A 5HO4A 1FEHA 2JC1A 2Y8WA 2E2PA 3JSRA 3O1LA 3SYZA 4P71A 1CS4B 4OZ2A 3P6YC 4WPAA 1LW2B 8RUCA 1WHWA 4BCAA 3SLCA 3H8YA 1RDWX 3KKRA 5C15A 2N7CA 1C4CA 4J2EA 2CJYB 2DT9A 2UU9J 2HHQA 2BW2A 2KG0A 1S12A 3Q8VA 1VSEA 4CBXA 1VQ6S 2QA4S 3J7AN 4O8UA 2Y1RI 2PAVA 4CF0A 2DXDA 5D0HA 4OYPA 5AQQA 4FJ8A 3ZYYX 1EXQA 2PA8D 4MDAA 3BZQA 1RT6B 5AQIA 2A2CA 2WVBA 3U1MA 5AQZA 3M2UA 4CE9A 1FXLA 1C1BB 4CD1A 4CZGA 4WKYA 1WWHA 3M1FA 3L95X 4FS1A 4TY8B 2ZBPA 4PUOA 1DAXA 3A8KA 2JFKA 3EZWA 2XMJA 4J9QA 1UJ5A 1ZC6A 5AQMA 2KHOA 4A2AA 1PJ7A 4DQQA 4OYOA 5KFYA 1JB0C 5D4PA 2HZCA 3E01A 3VAFA 3MM8B 5I3UA 1TYQA 5EWEA 4PYDA 4ZVEA 4HR2A 5D78A 1OY9A 1FESA 4F4YA 3ZZZA 3H5XA 4BE1A 4CT9A 3R6MA 2VBXA 3IG1A 2LEPA 1HYSA 3CCUS 4TQRA 2IIHA 5KG6A 4CJQA 4ILLA 4LUBA 1BCOA 3A8IA 4ZIVA 5HLFB 4G9ZA 3O5TB 4EZ9A 1TKZA 3OYCA 3HP9A 3B82A 2PGCA 4DBQA 4K0KK 1P6TA 3LW5C 1DHMA 1YRUA 1QVFR 1XERA 2B5JB 4PG6A 3Q7CA 5D8HB 4BRQA 3LM2A 4FWOA 1I3AA 2W01A 3KFWX 3MAHA 4I2QA 3ULHA 2FBTA 4CH7A 5F3ZA 1U2VA 5AQGA 3QEIA 2IOCA 2OIHA 1S1VA 4CERA 4KH1B 3B54A 1U8WA 4X66J 2OD6A 5JLFA 8ATCB 4OZNA 2A6AA 2FC9A 4WFAL 2Z1JA 4LFAK 4B1YB 4CLYA 3V6DB 5L9XA 1N5SA 3DI6A 3H45C 4BRAA 3RBXA 4DU7A 4NZ6A 4F2SA 1PC5A 1MWKA 3CD6S 2QWRA 1N54B 2D69A 5BJRA 1ACMB 3VQQA 1FJCA 2BGGA 2UUTA 2XGPA 3I55S 2HVEA 3BV8A 4KGMA 2HWHA 3E9OA 1S10A 2AZ1A 3BF4A 3CT9A 4MAKA 1BDGA 3FRZA 1P8GA 2ZHOA 3DXSX 3C7NA 2KM8B 2EC2A 5KPZA 1B9FA 4G3IA 3T5JA 5FIIA 2R8KA 3QIDA 2K1RA 1AUSL 2CPJA 2VG5A 3RGIA 2VQEJ 1AZSA 2PFUA 3M7VA 1VQNN 4LVNP 3VA0A 2ZD1A 5LMNF 4CT8A 2H3EB 2MKSA 2V34A 1XNQJ 1JLAA 4PPZA 2OMOA 2ASDA 2CQPA 2IMWP 3T6JA 1KLNA 3ZEUB 5ETRA 4JI0K 1QAJA 1AW0A 2NSCA 4O3OA 4M5HA 3IMXA 1GOCA 1K47A 4V19X 5F9LA 3QLHB 3M8PB 2V9KA 4QS7A 4FF2A 5C25B 5IQ6A 4IOXA 3R5DA 4W5QA 2R8JA 2I2YA 5EX3A 4PL7A 5HSPA 3CIPA 2DPIA 1TK0A 3TA0A 1T3NA 4Y2CA 4MQ3A 4Y28C 4X4OA 3CMES 3W63A 3CXCR 3L4IA 3KUGA 2EFNA 1RKJA 2JC0A 5H9FK 4DPTA 3G25A 3R8EA 2Q6CA 1IBLK 3PJ9A 4TKTA 4FJJA 2GHPA 3J7AP 1REVA 5A8KB 1XC3A 1QE1A 4CGFA 3GCXP 3CJ2A 3OHBA 2W8LA 4NRUA 3TA2A 1MDUB 3T9NA 1T05A 1UA0A 1ZTTA 1Y4ZB 4DR7F 2BE2B 3O3GA 1K8KB 1VHFA 3P4IA 1U1MA 1VR6A 4KAIA 4BR2A 2BXJA 2CPZA 3E9LA 3G6ES 2VODA 1OPZA 2RKIB 3BKTA 2DGQA 1E4GT 1EETB 3GSIA 1KAZA 3DRPB 5G0RA 5KFVA 1HBMB 3KKSA 2PE8A 1SKUB 3R9LA 5C24B 1SVDA 1HNVB 3ZETA 1U6BA 5DGAA 4RWWA 2Q0UA 2WONA 3UR0A 4WYBA 3TQ1A 4JYAF 3NGSA 4ZPWR 1IJEB 2Y0SD 5HI7A 3CCEN 2ABYA 2E7WA 4Y2MA 4WIQA 4GV9A 4TYBA 4OX9J 4HEA9 4F0HA 4NMXA 4ED2A 1N36J 1NZAA 4B3TF 3TAMB 5KGXA 4MDBA 2BRKA 3HHLC 3FCVA 3MPYA 3IBFB 1U1PA 3VQ9A 1HI1A 2HFSA 2QWMA 1ZBSA 4X4TA 3MCPA 4U8YA 1NKBA 2DR9A 1JX4A 4PWUA 2FHOB 4RCHA 4X4RA 3DOKB 1TUUA 1SL1A 2LP4A 2BTFA 3ZSRA 1ZAXA 4MH8A 4FNIA 4IEEA 3BREA 2RHQB 2DNOA 3IWLA 1R27B 2B6AA 3LZJA 4K8ZA 3AARA 1E6YB 4ZCMA 3KZBA 3OFGA 3EE9A 3TAFA 3L3CA 1VSFA 4YOXA 3D1QA 4LT6A 4JI2F 4FK2A 5ETQA 4UOCA 2HQGA 3BPDA 4EAHD 2HHVA 2B43A 3AOCA 4I68A 4PCQA 1J5OA 5E2QA 4EBEA 2R7TA 3QT8A 1K73T 1KTQA 4E7IA 2UUBJ 5L46A 3CCQS 4U95A 3T1AA 5E41A 4JKDA 1RILA 3CC7N 4LF6K 4DFMA 4IO9Q 2ZWPA 4N8OA 4GVLA 2I38A 2HFOA 1TUVA 2A3JA 1LXNA 1LFWA 4NLVA 4BREA 3HOTA 4FJIA 2DY4A 3FE1A 3PO5A 1N8RT 2XMAA 1I94F 3OR1A 3LP1B 2XZTB 4DR3F 3U3GA 3MR6A 1NK4A 5KG3A 2IA6A 5KQDA 4FLTA 2QLFB 4OPHA 5A6WA 2CQDA 1BU6O 4B9LA 1YGYA 1U6FA 1AROP 4AF1A 3AJ1A 3B4DA 3VQ5A 1UWBB 1YUWA 4XAKA 1Q95G 2AV5A 1X60A 5AJ3F 4YR3A 2RS2A 4GKKJ 2P9SA 1L3SA 3IA0A 2COLA 3H2LA 2R7OA 1F2GA 4Z37A 1H6KX 4QWBA 1O13A 4FF4A 1T94A 2XSJB 1TV6A 3OXGA 3FGUA 4EU0A 3HHLA 2QXFA 5BYSA 1F9EB 1N0UA 2DR8A 1R31A 2CG4A 1NCLA 1U1KA 5E3RA 3BY5A 3CETA 4F9OA 4JI4K 3BBFA 5D3GA 2HHHJ 2Y1JA 1U02A 2FY1A 4LF9J 2X3GA 4OPAA 4QR1A 5B0CA 3G87A 3D6HB 3O4QA 1WOSA 3IUCA 2J0QD 3NMUA 2M3DA 3NCIA 4DUYJ 1N34K 5IT9O 1FKPA 2BANB 4PA1A 2KDOA 4GY2B 2BM0A 5KFRA 1SIWB 3R5GA 4DL7A 1NGIA 3DLRA 1IKYA 3NGUA 2PMZD 4ZMMA 3BQ1A 4DR1K 4J2BA 2ZM6F 1NKEA 3SUNA 4O23A 4HYKA 4LSNB 2Z57B 3M8WA 1FFWB 3FBEA 1N6QB 2W9BB 1SC3B 1R8AA 4AXJA 2IVFB 4DSJA 5B8HA 4IUFA 1S0NA 2HRYA 5DJBA 3T5LA 3SFGA 4FYXB 1YI2N 3P5JA 1CG2A 4DR4K 1RZMA 1RACB 3AVLA 2CGKA 2LU1A 4NL5A 4DV1F 1PYOB 2K3KA 3WXKA 3CJKB 3VF6A 2QIFA 3DDKA 3MM5A 4CCHA 2D0OA 1VBYA 4ZTJA 4E8UA 1KQSM 1YSJA 2E5JA 4IWVA 3CDUA 3QGIA 5HMZA 3OYFA 3RBEA 3PCOB 3WIUA 2BR0A 3RTVA 3H5UA 4RPFA 3MECB 5HN0A 4ALZA 4DPWA 1HBNB 4K4SA 2K7KA 1QS4A 1S48A 3OPKA 4JV1A 5E0OA 1ZAVA 4YDDB 1Y0HA 4B9TA 3MEEA 3EMTA 5KTQA 2UU9F 2RVJA 5LM7E 2HNDB 2IDOA 2G2ZA 4FPAA 3O80A 2AJ2A 5AQVA 1NOYA 5C7PA 4CHQA 3KLIA 2L48A 2M5YA 1RT1A 4FF3A 2Y8YA 3CJ7A 4N5SA 1C0TA 3LO3A 3ULEB 4DL0C 4HI2A 4KB7A 3WNGA 4Q0BB 1B0VA 2RE2A 3U1NA 1KTVA 4J7CA 5FRMA 2BM1A 1UPMB 2MY8A 4ER8A 1T9XA 3MR5A 4IFEA 2YWFA 3QEVA 1HNWF 3IGNA 3O08A 4PUOB 1K44A 4W5TA 1WEXA 5HRRA 2XY5A 3AD8C 2GVZB 5U47A 2D3OR 2F9JA 3RAXA 2HFZA 1FXXA 5F0XA 1NGJA 2MZQA 3Q7BA 2JL9A 3PEJA 4X84A 4UY85 4DTJA 2RHSB 4UUXA 3UN5A 1S1WA 3DRRB 4ED6A 5I3UB 3TX8A 2OZMA 1BIUA 1WSJA 4FK4A 3D66A 4A48A 2XC9A 3IKMA 3CB4A 1VJQA 4CJWA 4U67L 2CQ1A 5ETNA 2IDLA 3GFHA 2DNGA 3VQEA 4YEAA 3DXKA 2ATLA 1OY6A 1HYSB 2D5RA 3C2PA 2V0NA 1WD6A 1ZH5A 2PYLA 3ADAC 2DPNA 3CI5A 5HROA 3JSMA 1S22A 4KHSA 3SFUA 5BR8K 1TKZB 3UKRA 3ZZ0A 4ZITA 4FYDA 4A57A 2GELA 5LSRA 5IOLA 2G8VA 3EGNA 2D0AA 4M3XA 3E3XA 4CRJA 5SZTA 1VQNS 3CFPA 3PYDA 2F8MA 4DX5A 3VTIA 3SMSA 2P8IA 1NB2A 5KFJA 2FHJA 2E44A 4OX6A 2BABA 3RSEB 4ZIWA 1S1VB 5LJ3Y 5FDLA 3EJMA 2DNNA 2K06A 3A5LC 3ZXWA 4WZQA 4KHWA 2HF3A 1U1RA 3OL6A 4X66F 2HGLA 2CJ9A 3ETOA 2DIUA 4MKBA 5AZIA 2Y0BB 3GIRA 1VSMA 3Q8QB 2QSFA 3SBTA 3DI6B 1MMLA 1RTDA 2ZOFA 3NNAA 3KHHA 3LGMA 3UE2A 3T3FA 3UO0A 5JMVA 4I6AA 4WFNL 1N0VC 4DR6K 3DLLQ 4KTWA 3QRRA 3HX9A 4JI1F 1VBXA 5F8NA 3QNNA 2BJDA 3ZZUA 4FBTA 1NLVA 2IBOA 5CABA 4O5FA 4DZDA 3VVUA 4F3MA 2MKIA 2E8AA 3TVZA 1QZ6A 1FO1A 1R6VA 1ZOTA 1MNEA 2OPQA 2GGPA 2VCPA 3D67A 2K1RB 4RG8A 3WC2A 2VG5B 3J7YP 2FGOA 4Q44A 3BF1A 4YB6A 3WQUA 1Z26A 2VQEF 4PKHA 5HQLA 2XMWA 1XHXA 3MTKA 3SDEB 2EFPA 1XNQF 4M5JA 1A7GE 4NXMJ 4MYTA 3T5HA 4L75A 4OYXA 1UTAA 1XMQK 3OVAA 1KLMB 3K2YA 4RUBA 3M3ZA 3DXMA 3AB2B 1Z25A 3FRYA 4OI0A 4AUKA 1BISA 2ZF5O 5DG9A 3BKUA 5DLGA 1SJ3P 4WU2A 2QV6A 3M32B 4Z2XA 3FJ2A 2A1SA 1GOAA 4W98A 3ZZRA 4PQUB 3MPVA 3CCES 4BR4A 4DI6A 3KLGA 3NGKA 2NXUA 2G8IA 2C2ZB 3GCWP 2BW7A 3FZMA 3WQPA 1X3NA 4DOZA 3MD3A 2V68A 2BA9A 5AXLA 5D0GA 4NLWA 3MXIA 1R0BG 3QPIA 2R7VA 1FDNA 1QE1B 4JYAK 3QFHA 1HKGA 2EWSA 3AGKA 3M5RA 3K89A 1OMSA 3MMBA 5J2QA 2B8QA 3MTJA 1EB0A 5IS2A 1O8BA 2G0IA 4FJ5A 2F65A 1J5EJ 5F8HA 2AGQA 2HNZB 1T05B 5GMEA 4DF8A 4YR2A 3O3LA 1U2FA 1DTQB 2KKHA 3W3DA 1W2BR 4PPDA 1M5OC 3WNEA 3HI0A 1I3OB 4WWSA 1DY3A 4X64F 4DQRA 4NB4A 4FJGA 1VQKN 4O4GA 1T9YA 3O8MA 4H03B 4OFZA 3ZETB 1Y5NB 4IOAQ 5LOQA 1U8SA 1WG5A 4CP5A 1XR7A 4CLLA 4CJLA 3ZTQA 3EWGA 3FSYA 4F67A 2C22A 4J9OA 4F2RA 4B1ZA 2L9DA 4A8XA 2HQIA 2HBKA 3GIKA 1CVJA 3BZKA 1UW4A 4OGCA 3OYMA 1VHIA 2ZBQA 2OAUA 1WSGA 3CC7S 2GW8A 2CJAA 1SBRA 1WEYA 1N36F 1X9SA 4NLUA 5G4DA 4DQIA 1QUVA 2DY1A 1JL1A 2G2OA 5KG7A 3HJVA 1ZM3A 2DGUA 5J2MB 1HW8A 1RAIB 4C9DA 2ZH5A 2VFSA 2GQQA 1L3TA 2YXLA 2NLXA 3W62A 2KVIA 4CO1A 3CJCA 2WRMA 5DM6L 1VQ5S 5I9EB 4EMDA 3ZZYA 3UD3P 2QRRA 1VC6A 1WUAA 2YNGA 1RHUB 3JXOA 3I5AA 3L2VA 2OD4A 3TW0A 1SS6A 1I94K 1UFKA 1FD2A 5FPDA 1LV5A 2IC3A 3R5CA 5CZ2A 4DV2J 3D3BJ 1HKAA 4DV5K 3UN3A 1TAUA 4CEAA 4BRKA 1D0EA 2L08A 3R7NB 3JYTB 1BQMA 3B4MA 3DHWC 1VQ4N 1BOTO 1J5OB 2OMLA 2ILZA 1TVRA 3Q8YA 1FKOA 3VQ8A 4NLGA 4ERDA 4OI2A 2CNNB 5AJ3K 2C3MA 4TU8A 4CFDA 4M42A 2NZTA 1X5TA 4YDUC 2AP6A 2UUBF 2VF3A 4JI8J 2XMMA 3M8QA 3OW2M 5D0EA 5GIOA 4M95A 1PJ6A 5HRNA 3OXFA 2IIRA 3GG4A 3WUHA 3OR1B 4L3NA 4CO3A 2F7TA 1B99A 5KT2A 1T3OA 2VWBA 3KJNB 4MO5A 4WF9Q 1UEVA 3RVCA 2A6OA 1TELA 4M45A 1HWLA 1N52B 4DU3A 3BUZB 1ASUA 3P5TL 1XUPO 1N32J 4KGZB 2ZJRL 4MKVA 3SZ2A 2D1CA 2FJAB 4FJLA 4KHPK 2RDDA 4K50A 4E3SA 4B08A 3C16B 2EKYA 4LSLA 3CCRS 1EIYB 1YI2S 1Q16B 1TL7B 1NSQA 1TV6B 1IG8A 2M70A 4FJKA 4C8MA 1RYRA 3HHLB 3QYYA 1JLFB 2A41A 2QWOA 1BIZA 2UXCF 1NO8A 3S8SA 3PG9A 4NLQA 2OP5A 3UCZP 5D3GB 2V9WA 1S7HA 4E1MA 1CJTA 1MG7A 1VSIA 3IFRA 4FWRA 2FJDB 4CEQA 2HHHF 3C15A 1HPZA 3VQSA 2WZ1A 4LF9F 5ADZA 4FW1A 2GO9A 4RW8A 1TKXB 1ZBTA 4UUWA 2V8GA 3M4XA 1KD1O 2CPXA 1NK7A 2OEJA 4ZCIA 1NBWA 4OJ1A 5B0FA 3D0IE 2J7UA 3MPWA 2YX7A 4P52A 4FLUA 5HMYA 3F44A 3NP5A 5DDRC 4EYIB 3CW2C 3CE8A 4DFKA 3QFWA 4P9SA 3UI3A 2UV8A 2FBYA 3NWRA 2KH9A 3PHTA 3QSYB 2VPWB 3EN9A 1BXNA 2AP1A 5KRSA 3BQ0A 4DX7A 3CJ4A 1RAEB 4A59A 2CQ2A 2NR0A 3J7A1 4F3QA 1BL3A 1S1UA 4CO0A 1VRUA 3VGVA 1O5JA 3L2WA 4YDUA 4JP8A 5HAOA 4M5DA 2HRTA 1WKKA 2DGOA 2GNKA 2ZJQL 2VIHA 2M88A 3GIMA 3MCMA 2RD5C 5IC6B 4LFCJ 4ED3A 2QL9B 2R7UA 2P5VA 2O66A 2KFZA 2QG9B 5DDOC 4F50A 2EG2A 1WSEA 2G9OA 3M2RB 3UCUP 3RUBL 5H1SV 3MMJA 4FP9A 1CZ9A 1U48A 2DBBA 3HD2A 5ELZA 4OHXA 5IWAJ 3KOAA 2R7QA 2ZE2B 4Z4FA 1YXQA 2OEKA 1SI9A 1FERA 3KD5E 2C2NA 4PG7A 4QPXA 3A8YA 4KHQA 4QIGA 5KFSA 3EKSA 1EQMA 4ED0A 2Z1IA 3PIOQ 4C0OC 1RDUA 2B9XA 1IM6A 2ZDPA 3T6BA 4U8VA 1J53A 5EOYA 2XG8A 4LR9A 4B1WB 5J1NA 3MCNA 2JJ4D 2KZMA 2V7YA 1N5VA 3BR9A 4TYAA 2YTCA 3HDSA 5HJYA 2ZC3A 3EDRB 2V4JA 2KFNA 2X51A 2X6NA 2BUPA 3OVBA 3TARA 2PD1A 3ZSYA 4ILRA 3MEGB 4B3RK 2B9WA 3NLCA 3FGVA 2GIRA 3N4QA 5D0RA 1XNRJ 3OYNA 3ZT1A 2GWJA 1S1WB 3UDEA 3WNFA 3MWPA 1NDCA 4Q43A 3V6KA 2YNIB 2QL5B 3DXKB 3VAGA 3GIJA 3GYGA 4OJGA 3QRQA 3A5MC 2UV8G 2KFYA 1RAJA 1VK0A 2JDJA 4ZVHA 1FWPA 2HZVA 4X66K 4HHUA 4NYNA 5DK5A 4B3SJ 3JSMB 3OQ2A 1BQNB 2MTLA 4U7UD 7FD1A 4B17A 1E6VA 2W4CA 4CBUA 4C23A 3SV4A 3VQBA 2E5LJ 1Z2ZA 2GIFA 1NWKA 4O3PA 1NHVA 4USUA 1KR4A 3QNOA 2HB5A 1JJ2M 4BY9C 4ES3A 2UUCF 1RU2A 1LWEA 1VQOS 3M1VB 1TFYA 3MM7B 4BC2A 3GV7B 4A8MP 1BO5O 1S49A 3EL2A 2IHR1 3AVHA 3DRSA 3THXB 4RJVA 1TL4A 1D5AA 5AZIB 2L3MA 1U0HA 4R8UA 1X31C 2VC0A 3VPZA 2Z0GA 2AJ0A 2PEHA 1OS5A 2VQEK 2ADCA 3GR1A 1WKLA 3D2FB 2O8BA 4I7FB 3HVAA 4RBTA 4HTLA 1JLGA 5KFZA 3SCLE 1XNQK 4M1KA 3MEDA 2NS1B 3AO4A 1YJ7A 4CO5A 4OMFG 2AMCB 4P74A 2W9CA 4MKAA 4JHDA 5DGBA 4CO4A 2I7PA 1V5VA 2DB1A 2C3UA 2LQ9A 3MWTA 1T6CA 1HMVA 1X4EA 5K8NA 1C0GA 3SBGA 3QBWA 2GGPB 3CPWR 3AH6A 4OZ3A 5HK4A 1NMDA 2CZ9A 2BOAA 1LQ9A 3LP2B 4ANEA 4NI2B 1G1XA 1K0TA 4CHOA 4BRIA 4ZLPA 4C3MA 4NXNJ 4C2MA 2DNYA 5M1OA 2O8DA 5GAEU 1VRTA 2VBYA 4BQZA 1Y9OA 2OO4A 4J2DA 3UNGC 3OUYA 4LRDA 2W9AA 4M5LA 2BZ2A 3MDQA 1SAZA 4NXMF 4P7VA 2YNHA 3CMQA 2N82B 4FWMA 3OYLA 1HHSA 2RJZA 2A1RA 3P39A 4M3TA 5A8RA 4LVOP 3EUNA 5CYQA 5DDPC 1LW0B 3MWBA 1FJGK 2DYAA 4AHCA 2C2KB 5HQ8A 2CQCA 3EVOA 4JB8B 4ZVQB 2CPHA 1UVJA 1ZZNA 4MMOA 3H6EA 1S6QA 2VDHA 3FZLA 5LJ5Y 3MF5A 2CQ4A 3WEEA 2J4RA 4ZHRA 1PGZA 3UIQA 3UR3C 3H2UB 2HKEA 1PBUA 1JJCB 2JZ5A 3KWGA 4CZIA 3MMBB 5AQJA 5E3PA 1HWKA 4OX7A 3DN9A 4PXCA 3DRYA 1N5YB 4Y2KA 4ZLLA 3ATUA 3VEZA 3JAMU 1KNZA 2FVPA 2JH3A 4NWBA 1J5EF 1KC8O 4OX9K 1NPRA 3RJMB 4PWDA 2OANA 1ZETA 1N36K 1VQ7N 2UVRA 1Q79A 2H9ZA 5LT5A 7FDRA 3HVTA 2KG1A 3VTHA 2VOOA 5FJ4A 2MKJA 4OLAA 3ENAA 3CC2N 2E7VA 4QU6A 3LF0A 4A8WA 4I2PA 3PHEA 1HA1A 4KTQA 2HBYB 3PKMA 2B7CB 1GLFO 3GOIA 3OTOK 1TUWA 3GR0A 3IBCB 4C7QA 2HBRB 1QQMA 3AVBA 3M8ZA 1Q4RA 1XBWA 2AGOA 4LF7J 1GOBA 3WQTA 1YIJN 4BVPA 2P9EA 2MGZB 3KG4A 4V1Ak 4GVMA 1N5QA 1TZ0A 4Q2MA 3JQKA 1FDDA 2OPPA 4M5KA 1HNZJ 4LFBJ 2H54B 4CH1A 4OV6A 5DG7A 3R2DJ 1IKVB 3HYFA 1S6OA 1VIOA 2ZH9A 1B0PA 3KG1A 2A6MA 2ZBIA 4CJRA 1FA0A 2XMKA 2MQLA 2M8DB 4X4NA 4FKYA 3BO3A 4URSA 4ICLB 3JS9A 3ZO7A 1ZS6A 4CLUA 2UUBK 1MROB 1RI7A 3DDIA 2AWZA 4HLBA 4BWMA 4RKUC 3CCLN 4NLPA 4BRCA 4RNHA 1RBVA 1VQSA 4ED5A 2DRDA 1X4GA 1ELOA 3KUEA 1KCFA 1NOZA 2IC3B 2GHVC 1I51B 4O3QA 3K5PA 2O4GA 4X65J 3AAWB 2ZH6A 9ATCB 2PI5A 3ZT3A 2KT5A 3G2XA 4DV2F 1YRTA 1NXIA 3HKWA 1TVRB 1FKOB 4MTPA 1Z1ZA 1CEZA 4GVBB 5F8LA 2DHAA 3C3LA 4O44B 1RFQA 4LRAA 4GKKK 4DTXA 4RBUA 5KFAA 1S7IA 4G1IA 3M8QB 3W9IA 5GAHP 3J8AA 4L3QA 3MCSA 4RW6B 1QY7A 1U2RA 5JVHL 4ITSA 1QHAA 3FVYA 3MMCA 2ROPA 3PACA 4X4QA 3OTDA 2R8HA 4PYAA 2R42A 3TQEA 3RB4A 3MPDA 3BDPA 4KGVB 2DPJA 2PMHA 3SSQA 2AYBA 2HHHK 3SV3A 3BM7A 2DH8A 4FLZA 1JLQA 4LF9K 4RW7B 3P4UB 1BG3A 3N4PA 1OYEA 4B9QA 4CIOA 4ILMA 3FFIB 2QXLA 2BV3A 3PV8A 4DUYK 2DO4A 3MM6A 3OFHA 4ETZA 4BR0A 3RYLA <