3MECA

Hiv-1 reverse transcriptase in complex with tmc125
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
552
structure length
550
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords p66 Reverse transcriptase
publication title Crystal Structures of HIV-1 Reverse Transcriptase with Etravirine (TMC125) and Rilpivirine (TMC278): Implications for Drug Design.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
total genus 149
structure length 550
sequence length 552
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3mecA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3mecA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3mecA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3mecA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3mecA05
4Z4GA 4RG8A 4IFYA 3I0RB 4AILC 5KFTA 4O3SA 1FK9B 2VG6B 3HVTA 3LP0B 4E3SA 1NK9A 5J2QB 4IDKA 3N6MA 5HP1B 5KFNA 3DLEB 2WTFA 3OY9A 4YR3A 2Z1IA 2HHSA 5D3GB 2D5RA 1MMLA 4RW4B 1QSYA 4URSA 4NRTA 3AVBA 4J9OA 4Z4HA 5F8LA 4FLXA 4G1QB 1WSHA 4B9MA 1QE1B 4RUCA 2OYQA 1NK8A 4DFMA 1S10A 4O0JA 4KAZA 4K4VA 2XWYA 2O4IA 4M3WA 1S9EA 2VG7A 2WK4A 4HYKA 3HM9A 3QEWA 4NCGA 4ECTA 2E4LA 2XI3A 3B6OA 1EETA 3HP9A 2FVSA 2HNYB 1ASVA 1HQUB 2BQUA 3ZSYA 4WFXA 4B9LA 4KKOA 3SPZA 3PX0A 3A2FA 2FJVA 5C25A 3LP2A 1RNHA 3ZCMA 2HHVA 4DF8A 3EZUA 1Z4UA 4ED1A 4DL5A 1ZTWA 1D9DA 5KFAA 2BANA 3C95A 5DQIA 3PW5A 3OS1A 2E9RX 2C2DA 3HPHA 1K1QA 5C5JA 4EZ9A 1D8YA 2QKBA 3I5CA 3QETA 5KFPA 3RB0A 4IG0A 4B9UA 3AO2A 1SKWA 4IH6A 4ICLB 4MKBA 2R8GA 1T8EA 2HW3A 3E01B 4DSKA 1DTTA 1FKPB 3QYYA 5L1JA 3DRSB 2R7YA 2GV9A 3HXMA 2G8IA 4KV8B 3TAPA 5T14A 2V4RA 3MEEB 4BWMA 3I0RA 2AX1A 1FK9A 2VG6A 1KHWA 4IRDA 3LP0A 5J2QA 4K4TA 4H54A 3DLEA 4MFBB 4WXOA 3M8RA 1NK5A 3ASMA 4DTNA 3KK2B 5D3GA 4H4OB 4PUOB 2UVVA 4O3OA 4CGJA 1L3TA 3S3MA 1TKTA 4RW4A 4G1QA 5F8MA 3UQSA 1QE1A 4NCBA 4YR0A 3KHGA 3CYMA 3SNNA 1T7PA 3SUQA 2RKIB 1VSIA 4PWDB 2XCPA 4F4WA 3V1RA 1DLOA 4KPYA 4YP3A 3KNAA 3IG1B 2HNYA 5KFVA 3CJ4A 4TQRA 4DFPA 3M9OB 1HQUA 1U04A 4Y34A 2BQ3A 1S97A 4NYFA 2FJXA 4ED2A 3K59A 4FJLA 1TVRB 3SYZA 2ZE2B 3SFGA 5KFKA 1WSJA 2QV6A 4DS5A 3RBDA 4DL7A 3TAFA 4ECYA 3MTKA 1D1UA 4WZMA 3LPUA 1REVA 5KFEA 4FLUA 4B9NA 3OS0A 1U45A 1CZ9A 1I39A 4K8XA 2KFZA 3TI0A 5FDLA 3DRRB 2CKWA 4JV2A 3NL0A 3RB3A 4ICLA 3RRHA 4ZPCA 1KLNA 1QSLA 4BACA 3E01A 1FKPA 3DRSA 4RW7B 3VQAA 3KJVA 1R0AB 3S9HA 2P5GA 3DRPB 5JXSA 1BI4B 2OZSA 3NGIA 1LWEB 3EZ5A 2JEIA 1QS4A 3MEEA 5F8HA 2NUBA 4OGEA 3ZSVA 2R2UA 3Q8PB 3BSAA 1JLGB 5KG0A 4Y2CA 4W5RA 4FJKA 4M41A 2HWIA 1L3VA 4ELVA 5KFBA 4MFBA 2XGQA 3MR5A 3KK2A 4H4OA 4PUOA 4MK9A 3NH2A 3MFIA 2DTUA 4ECUA 4NLXA 4HHTA 3MXIA 2Q3SA 4K4YA 4KO0B 3CFRA 3PJWA 1Z26A 2RKIA 4OKJA 4PWDA 2O5DA 1ITGA 2BRLA 4BDZA 4FK0A 3V6HA 5KFOA 2W9BB 2R8HA 3V9ZA 1KCFA 1JLEB 2W42A 4F2RA 4WZQA 2C22A 3CIZA 1VSEA 3NHGA 1TVRA 2BE2B 2ZE2A 3RWUA 1KFSA 1SH3A 3KLIA 4CJUA 1LW2B 5EWGA 3DMJB 4HUEA 1JXLA 2E6LA 2IS3A 2DFEA 4KHUA 3TARA 3PW0A 2X6NA 1XC9A 1NJWA 1HYVA 3QEXA 4E7JA 2FVRA 5KFMA 2Z1JA 4QAGA 4DSEA 4JRPA 4KBIA 3DRRA 1HYSB 2W7OA 4KI6A 4NLSA 2OPQA 2YNGB 4CJ4A 3G86A 1BQNB 1GOAA 1RILA 4CGGA 1NNDA 4RW7A 1RTDB 1ZBUA 1IKYB 1R0AA 3MEGB 4KHWA 3M9NB 3FQKA 1BI4A 1LWEA 4DQQA 1KVBA 4YR2A 3T19A 4LQ3A 1JLGA 3QZ8A 4WFYA 5KT5A 3DOLA 4ZVGA 4DL4A 4CEOA 2G8FA 3RMAA 3AVCA 5KI6A 1RT2B 3SCXA 2AU0A 4LH5A 2FBTA 3LP1B 2E6MA 3QO9B 1XR5A 1NK4A 2HMIB 2RPIA 4KO0A 1I3AA 2BGGA 4MKAA 3ZSRA 1VRUB 2ZD1B 1LWFB 1F21A 4EBCA 4DTSA 4DQIA 5F8NA 3WNFA 4CJRA 1C0TB 3P5JA 4BDPA 2W9BA 1J9AA 4OLAA 4JRQA 1S6PB 4CEDA 1JLEA 2A1RA 4AHVA 1X9MA 1S1TB 3SI8A 2R8IA 2YNIB 1GX5A 2AJQA 1VRTB 1VSHA 1BISA 3DI6B 1S6QB 2BE2A 2I1RA 3MAQA 2IOCA 4MK8A 1JL2A 3LWLA 4OGCA 3OS2A 5FRNA 1CZBA 1LW2A 1K6YA 1U47A 4DTPA 3DMJA 4NLDA 1RT1B 2JEJA 4ZP8A 1U49A 3Q8QB 1B92A 3D45A 4CEZA 4MQ3A 4M3UA 4IOBA 2Z1HA 4DTOA 5HRSA 1HYSA 1OS5A 3AO1A 2YNGA 4EP4A 4J9SA 3PV8A 4N5SA 3NDKA 2IJFA 1BQNA 4TY9A 3VQQA 4KHNA 1RTDA 4DU3A 1IKYA 3MEGA 1HRHA 2D3UA 4OJRA 3H2LA 1N56A 4MK7A 3HVTB 4W5TA 1KHVA 1VSDA 2C28A 1LWCB 1RT7B 1U09A 5KFGA 4CIGA 4CJVA 4DQRA 2ALZA 4DTMA 3VQCA 3S3NA 3OYJA 4NYNA 3P1GA 2O4GA 3NKYA 3LP1A 2KZMA 4FW1A 3QO9A 4ZPAA 3E51A 1B9FA 1UA1A 4E7IA 2VG7B 2HMIA 2X6SA 4FJXA 3M8QB 2IGIA 4E7HA 5CYQB 2IAJB 1VRUA 2ZD1A 1LWFA 1QUVA 1T05B 4CIEA 2UVWA 1C0TA 2XHBA 1RBTA 3OYIA 3THVA 4KFBB 4M42A 5E41A 1LW0B 5KT7A 3U3GA 4C8MA 4M94A 1VRTA 5KFCA 3DI6A 1S6QA 3D0PA 3K5NA 4C8LA 3QIDA 1LAWA 4CEBA 2OA8A 1S9GB 2UVRA 1IG9A 4PY5A 1HQEB 3ZT4A 3MR6A 2R8JA 1JXBA 4FLVA 1KTQA 3AVFA 3M8PB 3LDSA 1RT1A 3S3OA 1XR7A 3SPYA 4DFJA 4WYLA 1C1BB 2JEGA 2OPPB 2GBZA 1TK0A 2IMWP 4RU9A 2DY4A 3IN5A 1KVAA 3GV7B 1RT4B 1VSLA 1WN7A 1RT3B 3AVIA 1NKEA 1KFDA 3RB4A 5CZ1A 1XHXA 3NF6A 3B6PA 4GC6A 1A5WA 1LWCA 1RT7A 5SZTA 4DTUA 4I7FB 4CHYA 1TKDA 1RT5B 1TKTB 1N6QB 1RDRA 5J2PA 1J54A 5KFHA 3PW4A 3SQ1A 4KTWA 5J2NB 1G15A 1DLOB 3M8QA 2FVQA 2PY5A 3K5OA 1CSJA 3UPFA 2P51A 5CYQA 2IAJA 4CF8A 4ECQA 5KTQA 4DF4A 3O4QA 1T05A 2F96A 4KREA 4EP5A 4CGHA 4RUAA 1NOZA 4CFAA 2D7SA 1C0UB 3M9MB 4KFBA 2R8KA 4OKKA 4Q43A 1LW0A 4XO0A 2QKKA 1B9DA 2R2SA 3F9KA 3CDWA 3QNOA 4DSJA 3NGYA 1WSFA 4CEEA 4FLZA 4EYHB 1S9GA 4O0IA 1REVB 4FJ7A 3TANA 1HQEA 1VK0A 1WNSA 2XRIA 3KKSA 2D3ZA 4DSLA 3M8PA 1RTHB 1S1XB 3DLGB 4I2QB 3NAHA 2V4QA 3AA5X 3ZT2A 3OYLA 4MIAA 3F73A 4DL3A 3U6FA 3I5BA 4KB7A 2ASJA 4E89A 3LWMA 5FDLB 2X78A 2YKMB 1RBUA 4K4XA 5KG7A 1C1BA 4WE1B 4JS5A 3V1QA 2OPPA 4OPJA 3GILA 4ED8A 3KJVB 2XC9A 5DQGA 3OYBA 1RT4A 2EC0A 3GV8B 3KHRA 3ZT1A 3SV4A 2ILZA 2Z1GA 5DG9A 1JXEA 1RT3A 3CFOA 1VSFA 2OH2A 2IC3B 4L8RB 4DEZA 3VA0A 3OSPA 1JLQB 2J6SA 4J9PA 2W9AA 3L3UA 3QGHA 3ALYA 4KHRA 3KIOA 4I7FA 3AO3A 2FC0A 1TGOA 4CERA 4E0DA 1RT5A 3V81B 4M3ZA 4O4RA 1N6QA 3NE6A 1Z25A 4CJLA 4U6PA 1D5AA 3QEPA 3OL6A 1S1VB 1ZETA 5J2NA 3KMSA 4KB1A 4NLPA 1NHVA 3OYFA 3V9WA 4O3NA 1YVFA 1WAJA 4FS1A 3SJJA 3TAMB 3NF9A 2AX0A 4FYDA 1S0MA 1QHTA 5I42B 4ZPBA 1QAIA 3N6LA 4RW9B 2ASLA 3KKRA 3FSIA 3LANA 3DM2B 3NH1A 4DTRA 1C0UA 3HVRA 2FBYA 1KVCA 3IRXB 2IJNA 4IFVB 2WB4A 1NKBA 4CK1A 3KLIB 3C6TB 4CJFA 4MIBA 1HNVB 3ITHB 2YHAA 3ZSXA 2C2EA 5KRTA 4FJHA 4B8AB 1TK8A 3OYHA 3G0ZA 4Y3CA 2RDIA 1RTHA 1S1XA 1SV5B 3DLGA 4I2QA 1QAJA 3CJ5A 2AGOA 4CHZA 3H5YA 4B9TA 4RW6B 4ID1A 4J9NA 4X2BA 3OLBA 4J9LA 4IR1A 4FCYA 2YKMA 2I5JB 1FKOB 2YNHB 4JUZA 2OPQB 4NCAA 1HNIB 4WE1A 3PR4A 4RW8B 3MR2A 4E1MA 4IQXA 1HJRA 5F8JA 2BR0A 3KOAA 4RNFA 1TAUA 2IC3A 3AV9A 1TQLA 3NF8A 3MFHA 1VSMA 4GMJB 2UUTA 1BCOA 4QWDA 1JLQA 4BWJA 3DOLB 4ID5B 4I9QA 4F3OA 4Q8FA 4ELTA 3VQ7A 4N47A 2ATLA 4ECWA 5L1KA 2ILYA 3V81A 4NLQA 2F8TA 5KFXA 1EP4B 5EUHA 1W25A 5L1IA 4G3IA 1T03A 5KG3A 3C94A 3EPIA 1S1VA 3AVGA 4O55A 3QZ7A 4CCHA 3LAKA 3G6XA 1S4FA 4CGFA 3ISNC 3T5KA 3TAMA 3RR7A 1QTMA 5I42A 3FFIB 5KG1A 4OLBA 1UA0A 1I6JA 5DQHA 1NK7A 3V4IB 4RW9A 3Q8SB 3RR8A 4AH9A 2ETJA 3DM2A 4ZTFA 4K4SA 4CHOA 2YV0X 1SKSA 3DLRA 1TL1A 3MR3A 3IRXA 4CJPA 4IFVA 1BHLA 3NCIA 1NK0A 3AVKA 4O4GA 1NHUA 3C6TA 3V6DB 1HNVA 3ITHA 5KFDA 2G8VA 1IKWA 1IM4A 4CJSA 4CECA 3ZSOA 3WNHA 1T94A 1C1CB 3MEDB 4ZMMA 1SV5A 2WCXA 3G10A 1VSJA 4RW6A 2RN2A 2F8SA 1IKXB 1N4LA 5EWEA 2I5JA 1FKOA 2YNHA 3C6UB 1HNIA 2G8UA 1ZBLA 1JLAB 5HBMB 4KTZA 4RW8A 1BIUA 3H4BA 3SQ0A 1KRPA 3HKWA 4B3OB 4CFBA 4J2DA 1LV5A 1WNEA 1L5UA 3AVMA 3RB6A 1MU2B 4ECZA 1HMVB 2HHTA 2DPIA 3BSOA 4TSXA 4E19A 1S1WB 2R2RA 4URGA 5DGAA 3RMBA 4ID5A 3ULDA 1X9WA 3FRZA 5JS1A 3D28A 3CDUA 1ZBFA 3BSCA 1S49A 4H8KA 1JLFA 4KHSA 3V9UA 1EP4A 4M3XA 1RYSA 4TYBA 2KTQA 3M8SA 1TKZA 4ELUA 1W0HA 3QEIA 4EO6A 3CJ3A 3KLFB 1EKEA 4EBEA 3DOKB 3TAQA 4ZP9A 3H40A 4FW2A 1HPZA 2VG5B 3QNNA 3T3FA 2YKNA 4FJJA 4CGIA 4BE1A 4W5OA 3BR9A 3FFIA 4HTUA 5F8GA 4RNOA 4I2PB 1C0MA 4ED0A 4CIFA 3SV3A 3BQ2A 4DWIA 1YTUA 3V4IA 3TAGA 3HPGA 2W8LA 3VQ6A 4QW8A 2VWKA 1JKHB 4CJEA 2JC0A 4U7CA 4ZVEA 4FLYA 3LZJA 4OL8A 3CDEA 2D0BA 5KFJA 2IA6A 3T5LA 4HUGA 4LSNB 3V6DA 3NGZA 4LH4A 4TLRA 4CK3A 4ECXA 3OYMA 2HHWA 4KE5A 4DFKA 5KFUA 3PR5B 4Q5VA 2WRMA 4CFCA 1C1CA 3MEDA 2X74A 2ASDA 4CF1A 4Q45A 1IKXA 1JLCB 1TK5A 3SUOA 1X1PA 2HHXA 2UVUA 3C6UA 4JV0A 2OPRB 3SQ2A 1JLAA 5HBMA 4DU1A 4DL6A 3V6JA 4QWEA 4IRKA 4E7KA 4B3OA 3CFPA 2C2RA 1N5YB 3HT3A 1RBVA 4JLHA 4B08A 4WFZA 3BQ0A 1MU2A 2FLNA 1HMVA 4GVMA 1RYRA 1S1WA 1RDAA 3BJYA 3L2UA 5KFLA 1WLJA 2PZSA 4KSEB 5J2PB 2FBXA 1GOBA 2PYJA 3DLBA 3HJFA 3SQ4A 1RDCA 4FK2A 4AHCA 4CEFA 3IS9B 3RAQA 4FJIA 5K14B 5JUMA 5EWFA 1CLQA 3EY1A 3QEVA 4PQUB 3KLFA 1SH2A 3KLHB 4B9SA 1S0NA 3DOKA 3IGVA 2HAIA 4QPXA 1GOCA 5KFQA 1ASWA 4Y2AA 2IDOA 2VG5A 3SUNA 4DSFA 2W9CB 1S0OA 3K5LA 3MECB 4Y1CA 3KTQA 4Q44A 4RZRA 3KK3B 2WHOA 4I2PA 2WOMB 3KLVA 3VQ9A 4E7LA 4FM2A 2HNDB 5I3UA 4O5BA 1TP7A 2OPSB 1JKHA 1RDBA 4KAIA 3FDSA 2XY8A 5KT6A 1SL1A 5L9XA 4ZTJA 4FM1A 4CJWA 2GIRA 4LD0A 5KT4A 4NLRA 4LSNA 4AHRA 2PYLA 3D5MA 4JS4A 2G8HA 5CYMB 4M3TA 3WNEA 3QLHB 3O3HA 4E1NA 2XI2A 4FZZA 3QIOA 4XIUA 4CF0A 2B4JA 4O3QA 4FJMA 3H98A 1XR6A 3AVAA 3RMCA 1K1SA 3H59A 4IKFA 2BRKA 1JLCA 5C24B 1TV6B 2OPRA 3GV5B 4K4UA 5KT2A 4RNMA 3GIJA 4BE0A 1TAQA 4N76A 2ITGA 3HP6A 4F3TA 2D0CA 4KHMA 2FJWA 5EU7A 4XPEA 3AO4A 1N5YA 5KT3A 2FLPA 4CE9A 3PVXA 1RDDA 3KHHA 2LSNA 4HKQA 4ECRA 3QERA 4FJ5A 4CJTA 3T1AA 2G8KA 4R5PB 1SUQB 4DQPA 4AHSA 3EYZA 2UUWA 3CM6A 3BGRB 3VA3A 3OLAA 2VA2A 3AVHA 3IS9A 4J9KA 5K14A 5KGWA 3PHEA 5KG2A 3CJ0A 1TL3B 4IH5A 4PQUA 3V9SA 3KLHA 1D0EA 1NJZA 3K2PA 2E9ZA 2RDJA 3LAMA 4ECVA 2W9CA 1RCHA 3MECA 2ATQA 2IM1A 4IRCA 3KK3A 4CEAA 2HB5A 3AVLA 4CF2A 2WOMA 4C8NA 4Y1DA 1TKXA 3ZT0A 2HNDA 3AA2A 2OPSA 3OL8A 2W8KA 4F4KA 3NAIA 2G8WA 3TWHA 4J9RA 1JL1A 1EXQA 4NRUA 1ZBIA 4ZP7A 3TR8A 4ZHRB 4TXSA 5CYMA 4DS4A 1C2PA 2VWJA 3QLHA 1BCMA 5KFZA 3HHKA 4LQ9A 2DPJA 2J6UA 4CHQA 5L1LA 1IO2A 1RTIB 4N56A 3O3GA 3CQ8A 4C8OA 2HWHA 4IH7A 5C24A 3TVKA 3PZPA 1TV6A 4LY7A 1YT3A 2B5JB 5HRRA 1T3NA 1RTJB 2A1SA 3OYNA 1S1UB 4BDYA 2P1JA 1Q8IA 1C1AA 4K8ZA 1CXQA 3HSTB 3O3FA 3HK2A 5KG4A 2HVIA 1IKVA 1WSGA 3OJUA 3HO1A 4R5PA 4CFDA 1SUQA 3OL9A 3SUPA 3JYTB 3N6NA 4RNHA 3BGRA 3RAXA 5T7BA 4KB0A 1T03B 4FK4A 4MH8A 2HHUA 3IAYA 1HARA 4HCBA 2FVPA 5HP1A 2Y1JA 2QK9A 3NF7A 4ZVFA 1TL3A 4URQU 2IM0A 3VQ5A 5FRMA 4R8UB 5KFRA 1D9FA 3H5XA 3PX4A 4EYIB 4WYWA 4LSLB 5F9LA 4CJ3A 3H4DA 3I8DA 2HHQA 5DGBA 2V9WA 3NMAA 2E9TA 4FBUA 4J2EA 3WNGA 1RBRA 1TL1B 3I5AA 4H4MB 3DLKB 4ED7A 3RBEA 2IBKA 3L2WA 4O4GB 2Y1IA 1SKRA 4DSIA 4BE2A 1GX6A 2AWZA 4C8KA 4EZ6A 2XCAA 4FJGA 1L3UA 1IH7A 1L3SA 1IKWB 2D41A 3KLGB 1WAFA 3H5SA 4ZHRA 4W5QA 3OYEA 2VA3A 4EBDA 5J2MB 4HUFA 2ZKUA 2KQ2A 3AVNA 2ZQBA 5KRSA 1Q9YA 4DTJA 1RTIA 4J2BA 3DYAB 3T5JA 1S5JA 3TQ1A 2F8EX 2JEFA 3KK1B 3OYAA 1YTAA 4IKAA 4YNQA 5DMRA 1XI1A 2B5JA 2BDPA 3I0SB 4CHPA 3CO9A 1RTJA 4F4XA 2AGPA 3BQ1A 2KFNA 1S1UA 4DU4A 1UOCA 1C6VA 4OPKA 3QGIA 3VQ4A 4QCLA 3AA3A 4DG1B 2DFFA 4J9QA 4Z4CA 4ZVHA 2JGUA 1SL2A 3L2RA 1RA7A 5KFFA 4QWAA 4KI4A 4KV8A 3V9XA 4Z4IA 3OJSA 3HVAA 3SFUA 3AVJA 4F50A 1JLFB 3ZSQA 3NBPB 2V0NA 4JV1A 4FZXC 3JYTA 3AO5A 1TKZB 1UWBB 2DFHA 5DLFA 4PA1A 3HPOA 5HLFB 3O4NA 1KLMB 1QQCA 3HVWA 3QINA 5FROA 2FVCA 4FVMA 1YVUA 1BIZA 1HPZB 1N48A 2XY7A 3BDPA 2GIQA 5KFWA 4CGDA 2YKNB 4R8UA 3AA4A 1ZYQA 3UIQA 5KG5A 3OYGA 1RA6A 3GIKA 4IBNA 4LSLA 3OYCA 1DTQB 4Z4EA 5DLGA 4CESA 3PO5A 4NLGA 1NJXA 3MF5A 4H4MA 3DLKA 3BREA 4TY8B 3IG1A 4NZ0A 2BQRA 1X9SA 3CJ2A 3KD1E 4O44B 3NAEA 4QWCA 3VQBA 4F2SA 3KLGA 3OYKA 2YHBA 4AHUA 4CJQA 3MXMA 3P83D 5CZ2A 3NGDA 2JC1A 2XGPA 5J2MA 3QESA 4QW9A 1UAXA 3JSMB 3H5UA 3OYDA 5HRPA 2IM2A 3RTVA 3QGGA 3OHBA 4FS2A 4ZP6A 3DYAA 1LAVA 2EX3A 3NFAA 4R0EA 2KZZA 3EPGA 3KK1A 1SL0A 5HROB 3KHLA 1ZTTA 3L3VA 4M3RA 4HVJA 3I0SA 4W5NA 3L2QA 4NLOA 4HCCA 2HNZB 3CVKA 3ZSZA 1U4BA 3SZ2A 4K4WA 3HYFA 1BGXT 3DDKA 4DG1A 3K58A 4B9VA 1A5XA 2OZMA 3MXJA 4FLWA 4N41A 4UQGA 5EDWA 1BQMB 3DRPA 1J53A 1JIHA 4F4YA 3NH0A 4KHYA 4GW6A 3FQLA 3ZT3A 3NBPA 3VQ8A 4NLVA 4B8CA 1UWBA 2QE5A 2B6AB 5HLFA 1KLMA 4EEYA 3G6VA 4Z4FA 1RAJA 3HL8A 5F8IA 4XPCA 4M3YA 4CF9A 1CXUA 2P5OA 4TYAA 1FXXA 3GIIA 2YNFB 4CHNA 4IG3B 2W7PA 2WONB 1DTQA 4YMEA 4FZYA 5I3UB 4FJNA 4NYZA 4F8RA 3T5HA 3TAEA 4M95A 4CJ5A 2HVHA 3DLHA 5KFYA 1JLBB 4TY8A 1A5VA 3OHAA 3H08A 4KTQA 4AHTA 3V6KA 1NKCA 4QOZB 4DMNA 2EHGA 4O44A 1VSKA 4CJKA 3LZIA 1Y97A 3SI6A 2XO7A 3UR0A 4QWBA 2GC8A 4ED6A 3KLEB 1J5OB 3U3YA 5KGXA 4KRFA 2RF2B 1WSEA 2QXFA 4Z0UA 1XHZA 3LP3A 5C42B 3JSMA 1HYZA 4FBTA 4ECSA 4K4ZA 3G6YA 3CG7A 1QSSA 1KSPA 4K50A 4CEQA 4Q0BB 3GQCA 3GIMA 3QIPB 5HROA 5DG8A 5J1EB 4GC7A 3IGNA 2HNZA 4FJ8A 1RT6B 3UDLA 1WSIA 2R2TA 4O3RA 4I9LA 5KFSA 4IR9A 3K57A 4IFYB 4TQSA 4DTXA 4OVLA 2D0AA 1BQMA 3GYNA 3K5MA 5CY4A 1S9FA 1BL3A 3VQDA 4DLEA 4CK2A 2XY6A 4ED3A 4IDKB 3PY8A 4FJ9A 3L8BA 2JLEA 1U48A 2B6AA 5SWMA 1ASUA 1JX4A 5DK5A 5DG7A 1S48A 4FXDA 3VQPA 1RBSA 3L2VA 1RT2A 5JS2A 3RRGA 3OVNA 4NLTA 4YFUA 4WXWA 2B43A 1Q9XA 4O3PA 2YNFA 1S9EB 3OL7A 3PUFA 5KG6A 4FM0A 1TKXB 4IG3A 3PJXA 2FBVA 2WONA 4NCGB 4FLTA 4TN2A 1EETB 4OKEA 4J2AA 4RNNA 3VN5A 3PX6A 3ICLA 1O1WA 1JLBA 4KKOB 4NLWA 4NLYA 4YQWA 4J9MA 3TABA 4ZPDA 4F4ZA 5C25B 3LP2B 1S6PA 1NJYA 3RMDA 3CWJA 2J6TA 3V1OA 2FLLA 1S1TA 5KFIA 3VQSA 2YNIA 3KLEA 1J5OA 4M45A 3ZSWA 4KHQA 3LALA 2RF2A 4DQSA 2BANB 3PW2A 1W9HA 2IM3A 5C42A 1XWLA 2AGQA 3CM5A 1SH0A 3KMQA 5F9NA 3VQEA 3ISND 1EX4A 2KW4A 2CJQA 4DL2A 2GUIA 4Q0BA 3OSNA 1NOYA 3QIPA 4IG0B 2AQ4A 4NLUA 3BSNA 4DLGA 5J1EA 5HRNA 3LPTA 3KD5E 4EO8A 1NK6A 3Q8RB 2XY5A 3PW7A 3PO4A 1DTTB 1RT6A 1ZBHA 1IKVB 4Q8EA
chains in the Genus database with same CATH superfamily
4Z4GA 2HBKA 4AILC 3MM6A 3TYTA 1FK9B 2BKOA 3HVTA 1ULRA 3LA0A 4QU7A 5E3QA 4IDKA 4KY3A 2QA1A 2WTFA 3P38A 4RW4B 1QSYA 1ZBTA 2RU3A 4B3TJ 4NA2A 1WSHA 3MUTP 1QE1B 2HG4A 4EHTA 1S10A 1FVQA 2GCFA 2VG7A 2BE7D 2DR5A 1FFWB 3VEXA 4CZFA 1CG2A 2FVSA 2MZJA 1XTZA 3ZX3A 1P9QC 2FJVA 4A2BA 3RAMA 2QSFA 4RL1A 1GK8A 4ED1A 2GQQA 3MM7B 3CCSN 2XMWA 1AROP 2O8FB 2R7SA 1K1QA 5EGYA 1W2BR 4IG0A 4KHPJ 3N5BA 3H2UB 4CLTA 4DR3F 3VGMA 1CZAN 4MKBA 3E01B 4DSKA 2R7YA 5L1JA 3QYYA 1HI8A 3SQGB 2GV9A 3HXMA 1VC6A 5T14A 4HR2A 3EX7B 3MEEB 1FJGF 1BO5O 3TWZA 3TJ8A 4BC4A 1SQEA 4CDIA 2VG6A 1SXLA 4AL5A 3LP0A 5B0GA 5J2QA 1UMJA 3CC2S 3AOAA 4XTTA 4WXOA 1U6FA 2A6OA 3JAMO 3RUBL 5D3GA 5CZVA 4H4OB 2UVVA 4O3OA 1L3TA 4I69A 3MMCB 3GCXP 5E3AA 3IM8A 2KB2A 3KWGA 3H1VX 3V1RA 1DLOA 4Y00A 4Y0FA 2I2YA 3TJ9A 3W3DA 1WEZA 4BVPA 4TQRA 2EWHA 4QR2A 1WI8A 1W7AA 1HQUA 1JK9B 4P52A 5CZXA 5MLCV 4NYFA 4C0BA 1H3DA 3MMJA 4MKVA 2R7UA 3D2FB 3ZO7A 3SFGA 4C3LA 3GL1A 2QM1A 4DV2K 4DL7A 1NGAA 3TAFA 1TU0B 4ECYA 4KJIA 2MHEA 3J81j 2VJVA 3H7HB 4WZMA 3O9SA 1REVA 4OHYA 2FHJA 1FDBA 4JOUA 5KFEA 4B9NA 2KFZA 1I39A 4K8XA 5BRDA 5JVHQ 4M8LA 3SQOP 2BV3A 1WB9A 3VQAA 1WC0A 4MLEA 1UTAA 1FKAF 2AD9A 1BI4B 1FX4A 3DXBA 3D6FB 5H1SQ 3NGIA 1LWEB 4NEYA 2VBZA 3FK4A 1HI0P 1OYDA 3BSAA 3CW2C 1JLGB 3OT9A 1MG7A 4Y2CA 5GAGP 1U24A 1ZA2B 2J7KA 2ERRA 4M41A 2HWIA 2OAUA 1KVJA 2W6LA 5KFBA 3MR5A 3MX2A 1VYAA 3LM9A 3VPZA 3MFIA 2K3IA 2DTUA 4ECUA 1LFWA 4BC3A 2D4WA 4KO0B 2W25A 3CFRA 4JEPA 3PJWA 4ZS6A 1R8HA 1FW6A 5AJ3J 1WC6A 4OKJA 4PWDA 3CB4A 1ITGA 2XQCA 4K2XA 1OWXA 3UCGA 4WP8A 1KP6A 4QR0A 5EX5A 3CD7A 4WZQA 3CQYA 2ZE2A 2QWRA 1CJKB 3BF1A 3KLIA 4ZVUB 3TSQA 1LW2B 4LF1A 2R7VA 1HNWK 4K8RA 3GE9A 1K9MO 2DFEA 3R2CJ 2K1RA 2DKOB 3PW0A 1XC9A 1RHQB 3KG0A 4E7JA 2FVRA 5KFMA 4BQLA 4DSEA 4C98A 4JRPA 3MWTA 1IBMJ 3B82A 2DGUA 2W7OA 3TVYA 4BR5A 4NLSA 5H9EJ 4CJ4A 4UOHA 2GMHA 3G86A 1GOAA 1NNDA 1Q16B 1VQ8S 4RW7A 1ZBUA 3MAAA 5KPZA 3FQKA 3T9NA 4RX6A 2JWKA 3V2UC 1T9XA 3H42A 3T19A 1YIJN 1S7HA 2P9NA 4KT0C 4A8FA 5L8RC 4J8FA 4IJNA 4CEOA 1S57A 1GXTA 2QLJB 4PL7A 3RMAA 1KD1T 1X5SA 3EGZA 4AD6A 4DV1J 4FZVA 3CCVS 4LH5A 5LMNJ 4BRKA 3KJQB 3DOMA 5DO2A 1XR5A 2KG1A 5AQQA 2ZD1B 3EM1A 3AFGA 3BGLA 4DTSA 2W7AA 4O0NA 3WNFA 1RBAA 4IO9Q 2AF6A 3M32B 1R7IA 4Y28C 3PKMA 3NCQA 1JLEA 2FY1A 1S1TB 3SI8A 3A3OB 5G0RB 2QLWA 4JI0K 1S6QB 3MAQA 4MK8A 5AZIB 3THYA 1EO1A 5LL6Z 4RBVA 5FRNA 2LP4A 3J8AA 3FR0A 1TL7A 3RRKA 4DV2F 2JFDA 5E3CA 3KUGA 3Q8VA 2QN6B 1B92A 4CEZA 3FZHA 1VISA 2VOOA 1IV0A 3G87A 1OS5A 3AO1A 4J9SA 3PEJA 3R6MA 4N5SA 3NDKA 1BQNA 4WCEL 2QFIA 3KNGA 3MEGA 4OJRA 1Y5IB 3H2LA 4HL9A 1M1HA 4OZ5A 5IC6B 2C28A 5AQUA 1FF2A 1U09A 2QJ3A 3DDIA 3M30B 1WHVA 4FNHA 1KS2A 2ALZA 2JZ5A 3VQCA 4BRCA 3S3NA 2CPYA 1FEEA 4ZKAA 3O5BA 3EMTA 2A3ZA 2Q1LA 1EX8A 1H98A 3HTVA 3VGUA 2R42A 4CQ1A 4YHHK 1YBUA 3F41A 2J8SA 1UA1A 3FSYA 4EWTA 2HMIA 1WDDA 2IGIA 3GBTA 5CYQB 1VRUA 3FNNA 3WC0A 4WYBA 3W63A 4A8XA 2RAQA 3IR7B 1VHXA 2IYGA 3D6RA 1UZHA 3R5JB 3ILLA 3EL2A 4CIEA 3J7A1 1IBKK 2UVWA 2G9OA 4DL0C 2VODA 2YH1A 1U1QA 1YJ9N 3CMAS 3U3GA 2WVEA 2KVQE 1Y7PA 3RSEA 1VRTA 3OXGA 5KFCA 3DI6A 1ZAVA 3D0PA 5AQKA 1JB0C 5AE3A 1HBNB 3FLCO 1RU1A 4PY5A 3H1QA 3ZT4A 2NXCA 3QGPA 4BGBA 1KTQA 1RLCL 4I67A 1C0FA 3DC2A 4WK3A 3SPYA 1GT8A 4KGVB 3OFFA 1GXLA 3R6GB 4ES1A 4WYLA 2OPPB 1HNWF 4EFHA 1TK0A 2IMWP 2DHSA 1UPPA 3L7UA 5ETSA 2E1RA 2X51A 3AVIA 1KFDA 4OI6A 2ROGA 3M1FA 4MYUA 5C2DA 3JXOA 4L3NA 2A18A 2O8CA 4ED4A 1LWCA 5SZTA 4HWIA 4DTUA 1FERA 5BPLA 3LH2S 4FF1A 1TKTB 1N6QB 2W1BA 3PEHA 5KFHA 3MEKA 3PW4A 1FJ7A 3SQ1A 1DZ5A 3IBWA 1FHTA 2ZEJA 4YORA 2VDIA 3C3LA 2FGOA 2QMXA 3D6MB 5EXWA 1K8AO 3UPFA 2WBNA 1N8RT 3C14A 2UP1A 1WWHA 1NUEA 4ECQA 4DF4A 1T05A 2K06A 4KREA 4MTPA 4A48A 4ZN3A 2ZNZA 2R8KA 4ZLNA 4Q43A 4TU7A 3UDEA 4XO0A 5E2QA 4X84A 2BM1A 4U67Q 2RHKA 1B9DA 1ROFA 3F9KA 4DMZA 2PMWA 3AJDA 4JI5K 1UEVA 3CDWA 2BJ8A 3CJCA 5LL6d 4BRQA 4F4AA 1SJ1A 3VAJA 4QZVB 4FLZA 1S9GA 4RUHA 1YGYA 3TANA 2XRIA 1PBAA 1KAYA 3KKSA 4JI0F 1T9YA 3M8PA 1S1XB 2V4QA 3ZT2A 4MIAA 3VV2B 3IUCA 3LWMA 3W61A 5FDLB 3VR1A 4K4XA 2CPEA 5HL7Q 1C1BA 4PWWA 1A9NB 4A4JA 3V1QA 3IMXA 3KJVB 2J5AA 2EC0A 3GV8B 2FHOB 3KHRA 5AQWA 3ZT1A 1JCEA 1JXEA 2COLA 5DG9A 1VSFA 3D4JA 4KQZA 2EFQA 2NREA 2HMPA 3VA0A 4H5TA 1SZ2A 4V19S 5AQXA 3NGSA 3IR6B 3ALYA 2PMHA 4KHRA 2OTLN 2ZZMA 2FC9A 4BHQA 2FC0A 1TGOA 4LF8K 3HI0A 4O4RA 2PE8A 1BUPA 3VTHA 3QEPA 2BM0A 4Y2IA 1BUXA 1S1VB 1ZETA 5HI7A 3C15A 5J2NA 3ENQA 4KB1A 4NLPA 4GKKJ 2H3EB 5F3ZA 2OEMA 2VIHA 1WAJA 3NF9A 2ZHOA 1ZA1B 2QEXS 2FHJD 1A7GE 4YHHF 4JHDA 3FCVA 2NRXA 4RW9B 2EWSA 4A8MP 3TVZA 2G1DA 4DTRA 2GVZA 2IHR1 3C7NA 4WFAL 1JXVA 1KVCA 3IRXB 2IJNA 4RR5A 3VVTA 4DPUA 1IBKF 3C6TB 4AYBD 4CJFA 1HNVB 3ITHB 5KRTA 4FJHA 2R7RA 4A62A 1Q7LB 2VFVA 3OYHA 2VQFK 1PKUA 4ZLJA 1RZMA 4WFNQ 4OZ2A 1VQKS 4NYPA 1RTHA 1KTVA 3DLGA 2M9KA 4CHZA 1X3MA 4B9TA 1VQYA 4BRGA 4X2BA 3OLBA 2QMWA 2I5JB 4LF7K 1HNIB 3FUYA 3MPDA 3MR2A 2NZCA 3UKRA 4E1MA 2OLWA 1RHKB 2ZC4A 1NLVA 3CDAA 2E5IA 1TQLA 5GMEA 1HHSA 4WWSA 3DOLB 2LXIA 1VJQA 4CTAB 4BR4A 4F3OA 3R7SB 4DR5J 4ECWA 2ZHAA 3TTCA 2YQ1A 2BUNA 1R6YA 3MURP 2Q3PA 3O08A 1W25A 5L1IA 1HWUA 4JKAA 1RGVA 3EPIA 3C94A 4CD3A 3ZXWA 3QZ7A 1S4FA 2OTJS 1DQ8A 1JCFA 1PILA 3M2UA 1C4AA 1QTMA 1FRMA 4F7VA 4DV4K 3O1LA 3RR8A 2RQMA 2ETJA 1T9VA 4ZTFA 4K4SA 2QXLA 3OUYB 1OPZA 3MR3A 4IFVA 3GYGA 4L3KA 1NK0A 4O4GA 5B0FA 2I9SA 4QIGA 3THWB 2FPHX 3LDLA 1IKWA 2I6WA 4CECA 1RXOB 4DDFA 2YVSA 3WNHA 2R7TA 4JI5F 2XG8A 1F5AA 3CETA 4DKWA 2MSSA 3G10A 2RN2A 1IKXB 1T3OA 1FKOA 5FIIA 4X4UA 4H5RA 3CCEN 5ETLA 1BIUA 4LVNP 4NXMK 2A2CA 3GP9A 4ZVPB 3HKWA 4GVBB 2VL1A 4J2DA 1X9JA 1K9MT 1MU2B 2D9OA 1HMVB 4G1IA 2DPNA 3BSOA 2NQPA 2R2RA 4URGA 2O8BA 3ULDA 1S7IA 3L95X 1K0VA 5JS1A 1ZBFA 4EHUA 1YJVA 1JLFA 4KHSA 2ASOA 1UVLA 1RYSA 4F3MA 3LPEA 2G1HA 1NBEB 4WKRA 1W0HA 4DB3A 2KHDA 2DB1A 4LF8F 3MCNA 4FW2A 3OD2A 4JYAJ 3T3FA 3A1YG 4X4SA 2H5JB 4FJJA 2N7YA 4E2FB 3BR9A 4HTUA 3V4IA 1I5OB 3JTPA 4CJEA 2JC0A 4NB4A 4Z7CA 2XSJA 2HQGA 1WC3A 2H3GX 4CZMA 2GX9A 4HUGA 5GAHI 3ZTPA 1KNZA 1NJIT 4CK3A 1L3KA 3VAHA 2WRMA 4JK9A 1K8KB 3SJHA 1JLCB 2VQFF 2UVUA 2K3KA 1JLAA 1RWKB 3MMAB 5HBMA 1VAZA 3QPIA 4Z94A 3LTOA 4B3OA 2MQNA 3HT3A 1D4XA 5GINA 2R9LA 4LF7F 1YAGA 2FLNA 3QB0A 4GVMA 8RUCA 1RP5A 1NGJA 4K0KJ 3BJYA 1WLJA 4GKJK 4KSEB 5J2PB 1GOBA 3Q8YA 3G8QA 3GTYX 3RBZA 4FK2A 3IS9B 4DV6K 4FJIA 4YB1P 4LRAA 3CCJS 4AXIA 2EFNA 3CUNA 1QQMA 1SH2A 4B9SA 2UXDK 2HAIA 1F3FA 2YWHA 5KFQA 4OJHA 1G6BA 5A2QU 2VG5A 1S0OA 3K5LA 2EK1A 2C3UA 1VJWA 4IQMA 2WHOA 3DGVA 2V94A 1YJNN 1HBMB 2V2QA 2HNDB 1UVMA 4O5BA 4JI3K 4KAIA 5KT6A 4KBOA 1SI9A 4ZTJA 2GIRA 2WVBA 3THXA 1BHNA 3LO3A 4WIIA 4DV4F 4LSNA 2LMIA 4OJ1A 4YB7A 2PYLA 3D5MA 5CYMB 4OHWA 2CJXB 3W64A 4DX8H 3QLHB 1Y9OA 4E1NA 2XI2A 1CJUA 3QIOA 1RWWB 3O3LA 5AFUA 2ZZNA 2B4JA 2BBEA 4FJMA 1J27A 4JI1J 2CQDA 3OPKA 3AVAA 2CQIA 1K1SA 2FSKA 5A0YB 1VRQC 1SKUB 2GVDA 2LVWA 3GV5B 4M7YA 5AQOA 4RNMA 5FLXU 4GV9A 3EGWB 4M5DA 4K5SA 5E5NA 1X3NA 4CO2A 1N34J 4XPEA 3AO4A 4V1Ak 2I38A 1TUGB 4W4MA 3R1LA 2FC8A 2C3PA 1V4TA 1RDDA 3KHHA 4NXMF 2A3JA 2KO1A 5JMVA 1DQ9A 2G8KA 2IRUA 1ICEB 3VA3A 2IPOB 2MEWA 3AVHA 1HNZK 5K14A 3DHXA 2XMAA 1Q18A 4CM0A 1U1MA 4K59A 3IBFB 3VF2A 3V9SA 4U7BA 1NJZA 2CPZA 1B70B 3D6HB 2Q2RA 3LAMA 3ZLJA 4HHUA 2J7UA 2W9CA 3MECA 3HOTA 4IRCA 2DXEA 3AVLA 5FPNA 4C8NA 3QRRA 5ETOA 3PYDA 2MQLA 2CZ4A 4NO7A 3A5OC 3G8TA 3TWHA 5B0DA 1Q4RA 2UUAK 2VU5A 3US5A 2RNEA 4FN5A 4J7CA 1FEHA 2FUG9 4ZP7A 4ZHRB 1SCJB 5A6WA 2O8DB 5AE1A 4FNIA 3U1LA 3L7OA 1BCMA 5KFZA 3WC2A 4DU7A 3HHKA 4LQ9A 4OV1A 1NO8A 2DPJA 4CHQA 3W0LA 3U27A 1I3OB 3N4WA 4LF5J 1Q8KA 1HD0A 5C24A 4OIXA 4N8NA 1YT3A 1PSDA 3AARA 3OYNA 3FZ2A 4LIRA 5CHIA 4F67A 2VJUA 3U1MA 1IJEB 3O3FA 1IKVA 3C2PA 3CMQA 3JS6A 1RWPB 4BRPA 4R5PA 3SUPA 2DEJA 4LF6J 1B3TA 2MZQA 2YHXA 1T03B 1B7FA 2RUSA 4A8OA 4MH8A 1RHJB 3IAYA 4I1TA 3D3CJ 4K41A 4WTYA 2QK9A 4GKJF 5FRMA 4OYMA 4USJC 1UAWA 2QW9A 2HZAA 5HN0A 4DV6F 1UW4A 3W2WB 1YI2S 2FIUA 5F9LA 4CJ3A 4YY3K 2UXDF 1XNQK 3EVOA 2C1EB 3SMSA 1HKGA 2IBKA 3L2WA 1Q86O 2Y1IA 4DSIA 5HMWA 1GX6A 5AZJB 4M7XA 2ZH1A 4FJGA 2P2CB 2D41A 3I56N 3KLGB 1WAFA 3TR5A 3MTJA 3NP5A 4JI3F 5J2MB 3SCKE 4YDUA 3U7JA 3VAFA 3MM7A 4FWRA 2ZQBA 3CIPA 1O8BA 3FSXA 1RTIA 1F5CA 5EX0A 3H3OB 2BXJA 2CPDA 2J76E 4FWLA 3TQ1A 3KK1B 5B8HA 3MMVA 3OYAA 3K9KA 4IKAA 4EUVA 3GJQB 1S99A 5IQ6A 2B5JA 7FDRA 2GAGC 2AGPA 3BQ1A 9RUBA 2E1PA 2B9EA 4OPKA 1X0FA 5LJ3Y 4KC5A 2BTFA 1VQ6S 1MW7A 2DGWA 2DFFA 5E3PA 4J9QA 2GMJA 3OTBA 3NNHA 1RA7A 4DV0K 4OYXA 1FNMA 1HJOA 3G25A 3D2EB 4BC2A 3ELHA 2L08A 1O6XA 3BV8A 1YZ6A 1TKZB 5DLFA 3TZZA 3F0NA 1YVUA 1BXNA 4RLEA 3S8SA 2Z57B 1D3WA 1MA9B 2MKSA 4CGDA 4R8UA 3UVJA 2OFGX 3AA4A 2ZITA 2BW2A 1HNZF 1U2VA 1BDGA 3GIKA 2ZKTA 4QR1A 1DTQB 5A8RB 3ILOA 5DLGA 2QX0A 3M6XA 4NLGA 3OBWA 4H4MA 4OO1J 1FX2A 4NZ0A 2E1MC 4USUA 5E0OA 4KYZA 5SUHA 4H0OA 4Z7YA 1CJTA 3VAGA 1ATSA 3F5TA 4JKHA 3CGIA 2X1FA 4AHUA 2YKOA 3L3CA 2FB0A 1KEKA 4CJQA 3P83D 3NGDA 2JC1A 4FWNA 5B0CA 5AQFA 4QW9A 1D9AA 4P75A 2UUAF 4LFCJ 3ISZA 4JKGB 3MAHA 3SCIE 1CC7A 1LXJA 1RDUA 3DYAA 2KZZA 2LXFA 1IBLK 2B3TB 1FO1A 1HWIA 4LR9A 2HBJA 3KHLA 4M3RA 1A0OB 3HD2A 3DXMB 4F02A 4DUZK 3SCJE 2O1PA 1RKJA 4HCCA 3BR8A 2DNZA 1N36J 3ZZ0A 3FMWA 3S01A 5AQNA 1LFPA 4C7QA 3D0GE 4UQGA 1HI1A 4PXBA 2YPZA 4F4YA 4KHYA 5C2CA 1EWRA 1WDTA 3IAS9 4JI8J 3BKUA 1UWBA 4DV5K 2B6AB 1KLMA 1QAYA 3HHDA 2HIQA 2U2FA 1RAJA 4B3RK 1HX1A 4C6AA 4WCEQ 2ZNYA 5F8IA 2W4CA 2P5OA 5BRFA 2AA4A 1YVNA 3OW2M 2W7PA 4YMEA 4C1NI 4FJNA 1CS4A 5ETVA 2LECA 4X4TA 4F8RA 3FCWA 1MWYA 2OHDA 2HVHA 1VK3A 5IWAJ 1O51A 2MB0B 4TY8A 4JKBA 2V4JA 3OHAA 3FJ2A 5IT9U 3BF4A 2HQDA 3V6KA 4QOZB 1JWWA 1NGIA 2YX7A 2Z8QA 4YUDA 4YY3F 5LMUJ 3J81O 1GLFO 4CLSA 1YK9A 1S6UA 2YWFA 1XNQF 3UR0A 3ZETB 2GC8A 1J5OB 4X4QA 1FFGB 2QXFA 3HZEA 5E26A 4Z0UA 2P5VA 2ZFHA 4V19J 1YQHA 1CJKA 3AAQA 5ADXH 4P9SA 3TX8A 5IQQA 3AAWB 3JTNA 1GNKA 3PHTA 2P9KB 4Q0BB 3VCDA 5HROA 3SSSA 2G0CA 5J1EB 4OYIA 3VZHA 1VQSA 3IGNA 1RT6B 2GTDA 2X1GA 3BB5A 2VBWA 3WEEB 1EKRA 3K5PA 4X66K 5C15A 4DTXA 5BN8A 2OO4A 1VGYA 3MM6B 1PJ7A 3K5MA 3CMES 3B6BA 1FJEB 3NRBA 2XY6A 1IR0A 4KRWA 4IDKB 5T41A 3L8BA 3MDFA 4DV0F 3L7PA 5SWMA 1ASUA 3T1YK 5DK5A 2AIRB 1OIAA 1WF2A 3VQPA 3MWPA 3L2VA 4C0OC 4FF2A 3RRGA 3MPUB 3Q22A 5D4PA 2B43A 1NDLA 2YNFA 3EICA 2FBVA 3PJXA 3AD7C 2KHCA 3HHNB 4J2AA 1PIEA 3W7BA 4IXCA 2DISA 1BA1A 3VN5A 3P45B 2CAJA 4RWTA 2GA7A 1JLBA 4DI6A 4ZPTR 3VF0B 1GMVA 4E98A 3DHWC 2BOAA 4DCHA 4ZPDA 2XS7A 3DXKA 1Y00A 1S1TA 5KFIA 2PA3A 1AFJA 3OBYA 4JI6K 3KLEA 2E2NA 1F1BB 1PJ6A 1W9HA 2ZVIA 1T9TA 3IP0A 1XWLA 3O1BA 2NLXA 2KXHA 4F3QA 3KMQA 3G4SN 2W2MP 1EQMA 2GX8A 2HBZB 4HHHA 1NOYA 2AQ4A 4IG0B 2DNPA 4U7UD 5U47A 1GLAG 4OYBA 4DLGA 1WF1A 3PRVA 3RW6A 4U9RA 3KD5E 2M5YA 4F25A 2W2OP 4H5WA 1IBLF 4PXEA 3TPQA 4ITSA 2CPFA 4USVA 2KYZA 4C11A 4DUZF 4O3SA 2CZVC 2VG6B 2JHEA 1TL5A 3LP0B 3HSJA 1NK9A 5J2QB 4E3SA 3WUHA 3N6MA 4DCPB 5HP1B 2FTRA 1OMSA 2FSNA 3OY9A 2MDAA 2Z1IA 5D3GB 3I32A 4YOWA 4DR1K 5CABA 3AVBA 1U2CA 4Z4HA 3FGUA 4B9MA 1HW8A 1QLNA 4OPHA 2HS0A 4H03B 2OYQA 1HNWJ 2VONA 3SAHA 4PEOA 4O0JA 4KAZA 2BOPA 4B3RF 4ECTA 2E4LA 2XI3A 3B6OA 2XNQA 1ASVA 3B8AX 1OVQA 3Q0AA 1RHUB 5B09A 1HQUB 3ZSYA 4JKEA 1C4CA 5D8HB 2QI2A 4KKOA 3CF5L 3PX0A 4FKXA 5IV4A 1PG5B 4YOTA 3UN5A 3ZCMA 2DXDA 1Z4UA 4Y2MA 3C65A 1FCAA 1U6ZA 2RH3A 3AY9A 4DL5A 1X0PA 3AHPA 1MDUB 1D9DA 3OXLA 1Y3KA 3HULA 3PW5A 1YITS 4UY8O 3NXZA 3CIMA 4JI4K 1OH7A 1D8YA 1UEKA 4WP9A 2AKWB 3FKBA 4WFAQ 2RMLA 3EXYA 5FD1A 4B9UA 4ZPWR 5BYSA 3AO2A 1NSPA 1SKWA 3UNGC 2R8GA 1P27B 4GV6A 1XQSC 4H5NA 1T8EA 4XH1A 4XH4A 2WW4A 2XHWA 1UVJA 2HW3A 1O0PA 3TAPA 1Y5NB 2V4RA 2NXUA 4EU0A 2BZ2A 4JK7A 5M1QA 3KDOA 4A59A 1M90T 2GEMA 1APSA 4X66F 4JI0J 4H54A 4PR6A 3M8RA 4DTNA 2AP6A 1TKTA 4YOXA 4G1QA 5F8MA 3KHGA 4LF4K 1EAYC 1LOTB 3MN5A 2E8AA 1KBRA 3T1YF 1Q8BA 4PWDB 4F4WA 2F9TA 4FPAA 2FJAB 3KNAA 2VFUA 1Q79A 1GEHA 3SAGA 3M9OB 5AQPA 5HK4A 3DWLA 1VMBA 2H9ZA 2YWEA 3J7YI 4B3SJ 4FJLA 2ZWOA 3SYZA 1WSRA 2ZE2B 5C12A 4C2MA 5KFKA 3RBDA 1GLLO 2IJRA 3O6WA 2VHGA 3F9MA 3AA8A 3ZX0A 3QWUA 3BGFA 3HHEA 2K1RB 1WOSA 4JI6F 5G4DA 3WXKA 3OS0A 1U45A 4YHHJ 3TI0A 2K7KA 3OFGA 4H4KC 5FDLA 4DQ8A 3CXCM 3ENHA 4ICLA 1RLDA 3SXLA 1FKPA 4RW7B 3KJVA 3MAAB 2P5GA 5JXSA 2OZSA 3EZ5A 2JEIA 1QS4A 1PYOB 4L72B 5F8HA 4OGEA 2R2UA 2HBLA 5KG0A 2CA9A 4W5RA 2BJ7A 1T3VA 4FJKA 2VF3A 3H90A 4DUTA 4MFBA 2XGQA 2ZZTA 4NMXA 2X3GA 2HFSA 2MJUA 3KK2A 3KYLA 2CJBA 2C3YA 2OSQA 4OX9K 4QIVA 3UE2A 3DOMB 4HHTA 3MXIA 3ET6A 1R31A 4IO1A 2VGMA 3K17A 5GAEI 1GQEA 2DGTA 3ZZZA 4DR1F 3PLAA 1U1NA 3O80A 4WQ5C 2NYHA 5KFOA 4J9VA 2QTWA 2R8HA 5IT0A 1JLEB 1RKIA 4F2RA 5BN9A 1FXDA 7AT1B 5DDPC 2IA0A 3JAMU 2YY3A 1VQMN 2PIIA 1TVRA 1ZAWA 2NXJA 3AOBA 1NPRA 1FTRA 3HSDA 1QQOA 5CR4A 5MLCQ 1XMOK 3OVBA 3D6TB 1VQ9N 5HVGA 5IFMA 3IWXA 1HQ2A 1JXLA 5D0HA 4NMLA 1TL7B 4CZGA 3Q8UA 4WIQA 2VUGA 4ZDNA 2X6NA 3I9V9 2CPXA 1NJWA 3E9PA 4RU2A 1I94J 2Z1JA 1Q82T 2HWTA 4KBIA 3DRRA 4JI4F 3CC7S 4KI6A 5M1PA 2LDIA 2V68A 2NYIA 4GRSA 2VBXA 1H0HB 1FT8A 3N79A 4QJVA 4FVUA 1FI4A 1BQNB 1RILA 1HWJA 1R0AA 3MEGB 3KJNB 2E5LJ 4YDXA 4OJ3A 5A2QO 4DQQA 2ZH5A 1KVBA 2AYEA 2QSWA 3W5YA 2LEAA 2GHVC 5CCMA 5KT5A 3DOLA 1HW9A 3GZ7A 2MXYA 2RU9A 5LJVA 1RT2B 3ZEUA 2FXUA 5AQZA 4CZIA 2DHAA 4EI2A 3NMRA 4BG9A 2Z56B 2HMIB 1PJ5A 2RPIA 1I3AA 3M8ZA 1VRUB 1QZ6A 1F21A 2JRSA 4U95A 3J80U 1W97L 2JVRA 4LF9K 2E1CA 1W7WA 4LF4F 3P5JA 1R59O 2E2QA 4JRQA 2V6AA 1S6PB 4CEDA 4DX6A 3BP8A 4MLHA 5AQSA 1WC4A 2DGSA 3RSEB 1VRTB 1VSHA 2PC6A 1BISA 1CPZA 3DI6B 2BE2A 3OUYA 5FLXO 4WFBL 2GHPA 3UB5A 2IOCA 1RWXB 1XNRK 3LWLA 1ILYA 5ETMA 2NZ4A 1CZBA 3HFVA 4CIOA 1R8CA 1K6YA 3THWA 3A8YA 3DMJA 1AYEA 1RGIA 2OP5A 1ZPWX 4OI0A 4L6V3 4ZP8A 1OYEA 1KVIA 4DV7J 1SJ3P 2CPHA 1U6BA 3HHLC 1BMQB 4M3UA 4IOBA 1SIZA 3O6QA 1HYSA 4CT8A 5DDRC 4K25A 3AA9A 3PV8A 4UY85 2YHWA 2IJFA 3SK3A 3BYRA 3WQTA 3VQQA 1RTDA 4DU3A 4FSVA 1IKYA 3KZBA 2D3UA 1N56A 4USWA 2HLTA 5JLHA 2Z30B 1VSDA 3CCSS 1LWCB 5JJBA 3GLJA 1TUUA 4DQRA 2Q43A 4DTMA 1FRJA 3OYJA 2KT5A 3P1GA 4M5MA 4UF4A 2RE2A 5EY4A 2YXLA 3LP1A 5GAEP 2KZMA 2DHGA 3IKMA 3QO9A 4OYZA 1B9FA 2VQFJ 3PG9A 1SAZA 4FWPA 4LRDA 3C14B 3D0HE 1SVDA 4DPOA 1T05B 4OX9F 2PI4A 1RAGB 4GVEA 3SAFA 3UKUB 3NOGA 3W1YC 2VC0A 3H45C 2XHBA 1LCUA 2DY1A 3VWSA 3OYIA 3THVA 4HEA9 2KN4A 1YF5L 3I9ZA 4M42A 2EBGA 1WORA 2MLXA 2OEKA 5CQGA 3FBEA 3I31A 2QL7B 3K5NA 1LAWA 4CEBA 3W60A 1S9GB 3SLCA 1B64A 1RFQA 3LQVA 1JXBA 3AVFA 3M8PB 4JD2A 1RT1A 1NGCA 2IYIA 3VALA 1XMOF 4P2FA 3DKDA 2HZVA 1KVKA 1C1BB 4J9UE 3MOJB 1K8KA 2C2MB 2DY4A 1KVAA 3GV7B 1VSLA 3CCQN 5MAOA 1K47A 2D1CA 3RB4A 1WTBA 4JV5J 2EFGA 4DV4J 1Z2ZA 4GC6A 1A5WA 3UD4P 1RT7A 2QWNA 2W4PA 3A12A 2IBOA 1TKDA 4CLPA 1VBZA 1RDRA 5J2PA 1NGEA 3FMBA 1F3VA 5FPDA 3NGRA 4KTWA 3C15B 5J2NB 3G8SA 3ZC4A 4A8KA 1G15A 4OQJA 3M8QA 2FVQA 4BLGA 4BCAA 2NZTA 1H72C 1M5PC 1OH8A 3O4QA 2ASYA 1S6OA 2F96A 4JHDB 4EP5A 4HH1A 4CGHA 5B0EA 4KH0B 1Y4ZB 4RUAA 2KKHA 4BGAA 2ABYA 1FE4A 4PABA 2C2OB 4NXMJ 1NSKL 2GJ2A 2GVZB 4OX8A 1O13A 3C7NB 1HBMA 1LW0A 3LGMA 5DDQC 2XHCA 4LF9F 5F0XA 3EGNA 1QQNA 3QNOA 4DSJA 1WSFA 4L75A 5AFUH 1W2IA 1HBUB 4DCJB 3TA1A 2JL9A 1VC5A 1HQEA 5KQDA 1RTHB 3DLGB 3NAHA 3AA5X 5BREA 2KT3A 3U6FA 3I5BA 1XNRF 4KB7A 4E89A 1V5IB 2NXEA 1ATNA 3E9LA 5KG7A 3MMBA 1ZM3A 3TSPA 1IR1A 3UKRB 4IOAL 3GILA 4B1ZA 1RT4A 3R1HA 2DYAA 3SV4A 2Z1GA 1RT3A 3CFOA 2OH2A 4KH1B 3R3LA 2CJ9A 4DEZA 4OZLA 5A76A 3OSPA 2J6SA 4ZVOB 2W9AA 4I7FA 3AO3A 4CLYA 4BROA 4E0DA 1RT5A 4M3ZA 3B4DA 1Z25A 4LFBK 5A2QY 2PGCA 5IM0A 3C16A 3OL6A 3ETMA 1Q7YO 1NHVA 3HJVA 3W65A 4NA1A 4ES3A 3P3DA 2MPUA 3EWGA 1QHTA 3KKFA 2NCKL 4ZPBA 3LGNA 4PHTX 1VIOA 2ASLA 1LEOA 3LANA 3C46A 3T69A 2LQ8A 2GHWA 1YIJS 1HR0J 4IFVB 1GTEA 5TKYA 2WB4A 6AT1B 2FJEB 2UV8A 1ZM4A 1FRHA 1T6CA 1TZ0A 1YLXA 3R9LA 3TO8A 3ZSXA 2C2EA 1Z6RA 1U0HA 4ZPVR 1TK8A 2ZVSA 3JQKA 1VOMA 2RDIA 2P9SA 1F9HA 2ZHBA 3H20A 2AGOA 3MZIA 1UP1A 3FBFA 1IQTA 1KAXA 1FKOB 3LM2A 3SSRA 3X3UA 1HJRA 2BR0A 2HFZA 1JJHA 1VLYA 2FQQB 4RNFA 3F2KA 3VETA 3L0QA 2IC3A 3A5LC 1VSMA 1WOPA 1BG3A 4BWJA 2H4WB 4HT7A 2O8BB 2XMKA 1XMQK 2CJKA 1Y10A 5AXKA 2WZ1A 4A5BA 2ILYA 1YJTA 2XMMA 3K2YA 2NRTA 4KGKA 2ZH6A 4IFEA 2E20A 2L3MA 1Y64A 3SEOA 1U2FA 4G3IA 1T03A 2JH3A 4CP5A 5KG3A 1RHRB 1IWGA 3MM5A 4X64K 2IVYA 3OTDA 4S0MA 3PKYA 1UVNA 4CGFA 2W24A 3ISNC 3T5KA 2QFJA 3RR7A 5KG1A 2QWOA 4OLBA 1UA0A 1I6JA 3V4IB 4AH9A 2B4OA 3DM2A 4CHOA 1SKSA 2CVIA 5EHHA 3MPYA 2M2BA 2XSJB 3WZ0A 1DARA 1NU0A 4B3TK 2Y8YA 1X4CA 3HMJG 2H5EA 2C2NA 4AXJA 2G8VA 1IM4A 1S72S 5LSOA 1EARA 4YOUA 3SDEA 1T94A 1R3NA 1SV5A 2OGUA 1Q95G 2XMUA 4RW6A 1J6ZA 2A10A 5EWEA 1B99A 4OFZA 2F4VK 2YNHA 3PRBA 1ZBLA 1JLAB 3ENWA 5HBMB 2DJWA 2QL9B 4LFAK 2P9IA 2RQKA 3OTOF 1EJ7L 3SQ0A 1YJ9S 4B3OB 3BY5A 1L5UA 3AVMA 3RB6A 4ECZA 2BH1A 2GW8A 4E19A 3P96A 5DGAA 4ID5A 5GAHU 3H3NO 3R7BB 5C7PA 3W62A 4H8KA 4KHPK 4ZJLA 1EP4A 4M3XA 1U1RA 1H1VA 2KTQA 1TKZA 2GQCA 2V8HA 3CJ3A 1MROA 4EBEA 4EAHD 2MQ8A 2R4FA 3TAQA 2C42A 3GFXA 5CE3A 2VG5B 4LFBF 2EK6A 4Y65A 4ILHA 3C19A 2MYFA 2CGJA 4W5OA 4QS8A 3FFIA 5IC4B 5F8GA 4RNOA 2M7SA 2B4UA 4DWIA 1YTUA 2W8LA 2M3DA 1YBAA 3BEXA 4ZVTB 5HVFA 4U7CA 4M5IA 3THXB 3W2VB 4DR6F 4FLYA 3LZJA 4MDAA 3AQOA 4LSNB 3V6DA 2KVIA 3VVUA 2ZDPA 4TLRA 5HQLA 4DHYA 1VBKA 4ECXA 3OYMA 2QRRA 2CQPA 1X31C 3WQPA 5C2FA 4W98A 4CLLA 3PR5B 2VB6A 3BBCA 1CJUB 2QA4N 3MEDA 3DFEA 1TK5A 3C6UA 4JV0A 3SQ2A 2RRNA 2ZM6J 4RJVA 5DS7A 4DR4J 2NXNA 5DM6L 4BR2A 4YY3J 5KQ8A 5RUBA 2N4DA 1OH6A 2QA2A 2FJDB 2UUCK 2ZJQL 2DEIA 1S1WA 5K8MA 3L2UA 1RCOB 4H5VA 2FBXA 2PYJA 1RDCA 4GO7X 4AHCA 5K14B 2IDEA 2NRHA 2W41A 1FDDA 4Y0WA 4OYAA 4A2AA 1PCAA 1XMQF 1KQSM 3A8IA 2ZH7A 5C0YA 4OI1A 3MM8A 3DOKA 4QPXA 3CPWM 2VBYA 1ASWA 2IDOA 1WHXA 4DSFA 3VENA 4L73A 2W9CB 4AM7A 3MECB 3KTQA 1O5JA 2E1AA 3ATVA 4RZRA 2DO0A 2NRRA 4X64F 5CYJA 3VQ9A 1F60B 4FM2A 4AT1B 1JKHA 1RDBA 3DLJA 4JI7J 3FDSA 1Q0NA 3THTA 2MTLA 3BPDA 4FM1A 4CJWA 2OTLS 3OXFA 4BR0A 4X62J 2QTDA 4KIAA 3HSGA 3POTA 4USIA 5AQMA 4DV0J 4H0XB 2ZJPL 3EJMA 2G8HA 5H9FJ 2C2KB 5AJ3K 5HATA 2J0QD 4XIUA 4CF0A 4B3TF 4O3QA 2EG2A 4MIWA 1JJ2M 1XR6A 3IO1A 5CAAA 2IVPA 4CNZA 3B54A 1XC3A 2VGNA 2BRKA 3CF5Q 5C24B 1DAXA 4F0HA 5T7LA 2EFVA 3RZAA 1TAQA 4N76A 5B7WA 4F3TA 2MLYA 1H2VZ 3J7ZT 1N5YA 2F4VF 3A3PB 3AJ1A 4Y2KA 4V19X 4OZJA 1LK5A 4F0MA 2LSNA 2CH6A 4B3MJ 2KL8A 4LFAF 3O9UA 4ECRA 3QERA 3RGIA 4CJTA 4R5PB 4CH7A 4DQPA 3CM6A 4C1NK 3UI3A 1SQKA 3OLAA 2VA2A 2X1BA 3TQEA 5B08A 1YRXA 1IBMK 1F2HA 3VGTA 5H9EK 4DR2K 2XZDB 3NLCA 5LXYA 3CO0P 2GFFA 4NEZA 3KLHA 5GAGI 1WSVA 4WBFA 1R8BA 4KHPF 3K2PA 2D3OR 2E9ZA 3EO3A 5M1KA 2DRAA 3MN7A 3NY0A 5IT9Y 4ED5A 2ATQA 4CEAA 5HO4A 3HFZB 3NWRA 5KAKA 3ULHA 3AA2A 3JSRA 2HVEA 5THWA 4DUZJ 1NZ8A 3NAIA 2CQHA 1RQ0A 2AP1A 4J9RA 4DV1K 1EXQA 2I8EA 1NSAA 2DNNA 4NRUA 1ZBIA 1TUWA 3NWGA 1WACA 4IZ9A 3ETOA 8ATCB 4DS4A 5GADP 4KGXB 2J6UA 1RTIB 3O3GA 3BZQA 2HWHA 2BYCA 4OHZA 4IH7A 4NL5A 2MSTA 3TVKA 4LY7A 2LCWA 4UOFA 2B5JB 5HRRA 2B9WA 1VC0A 1NHKL 2UXBF 3TX0A 1PYTA 2P1JA 4CM2A 4HTJA 1T11A 1X7VA 3HK2A 2MJNA 5KG4A 1OKJA 2HVIA 2HPUA 3A0IX 5ITHA 3OJUA 3MUMP 1WSGA 1S22A 2OFHX 4WP3A 3HO1A 1PO6A 1H6KX 3N6NA 3BGRA 2GGPA 5T7BA 4KB0A 1MWMA 2JNJA 2UUCF 2E7VA 1HARA 1RISA 3VGKA 3HCXA 1PC4A 5HP1A 2Y1JA 5D0RA 1H74A 1T02A 4K2JA 4LC9B 4ZVFA 3VQ5A 2WVDA 4R8UB 3UVJB 4NYOA 4PWUA 1D9FA 5M1OA 3CCES 3CERA 1U2VB 1KONA 1GLJO 3HZ6A 4B9QA 1TL1B 3I5AA 4H4MB 2KRBA 1SKRA 1CJTB 4BE2A 4ENOA 1Q7YT 2J8AA 3WXLA 4F0KA 1L3UA 1L3SA 3H5SA 2VA3A 4LMZA 2W2NP 2CUYA 2WVCA 3AVNA 2VFSA 2A1BA 5KRSA 2AYBA 4J2BA 3DYAB 3VZIA 3M8YA 2F8EX 2OIHA 4GV3A 1CBKA 3IA0A 2WB1D 5AJ3F 2L9WA 1XI1A 4CHPA 3CO9A 1RTJA 1YZ7A 4F4XA 4P71A 5K9FA 1MMNA 3EDQB 3QGIA 1Z1ZA 1FRXA 1H2UX 2XWXA 4Z4CA 2JGUA 3CCMN 1FD2A 1SL2A 3MCMA 3S1TA 1AA1B 2YQ0A 3V9XA 3OJSA 3J80O 3P5TL 3AVJA 2OEJA 3ZSQA 3AODA 2V0NA 2VCPA 4P7TA 4B1YB 1UWBB 4PA1A 3HPOA 2KRRA 3O4NA 1KLMB 1OSCA 1QQCA 2FVCA 4FVMA 2APOA 3RU0A 2LA4A 2Q31A 2XY7A 2GIQA 2YKNB 1RE1B 2VFRA 2F3JA 1N33J 3M3ZA 5ETRA 2PMZD 4FWOA 4LSLA 1IBMF 3OYCA 3H25A 1PAEX 4DR2F 1CS4B 1E6VA 1NB7A 3ZZPA 3PO5A 1BC6A 1QVFM 4W92B 3CQXA 2FZCB 2BKPA 3MF5A 4TY8B 2J9DA 3QFPA 2RD5C 2V4JB 2BQRA 1WOOA 1X9SA 2HSEB 5KPTA 3W3SA 2ZGYA 2QYCA 1U1LA 4ILGB 2SXLA 5CZ2A 1U8WA 2J7WA 2F65A 4DHVA 1HLUA 4DV1F 1Q1KA 3WDOA 3AJ2A 3Q7CA 3H5UA 3EN9A 1VQ5N 3JQMA 2IM2A 4B1WB 3OHBA 3G82A 2EX3A 4C4WA 4R0EA 3EPGA 5HQMA 2W6KA 2VPWB 1SL0A 4PG7A 5HROB 2VKRA 2AW0A 3ATUA 1YJNS 4HVJA 3I0SA 3L2QA 1FA0A 4WFBQ 1KN6A 4NLOA 4Y6IA 2DNGA 2M0GB 3ILIA 3CVKA 4HDGA 1U4BA 2R7WA 3ZSZA 4BC9A 3KG1A 1S5ZA 3CJ9A 4B9VA 4FLWA 3FZBA 4N41A 4WK1A 4B17A 4E1JA 1JIHA 4GW6A 3NBPA 5HJYA 2RRAA 3CCWA 4WTOB 3FVYA 1K73O 3MCAB 5HLFA 2CZ9A 2RS8A 4Z4FA 3PYEA 4IUFA 2IRYA 2RHSB 4MO5A 5HJXA 2E5HA 4M3YA 2W2QP 1B0VA 1X4EA 2QLBB 4P2XA 4O8UA 1KC8O 5LJWA 4TYAA 1FXXA 3GIIA 2P9CA 2YNFB 2V8PA 2HBMA 4CHNA 4PQAA 4UZBA 4CVNE 3T5HA 4M95A 4FPIA 2XNRA 2VD3A 4X4VA 1JLBB 3GG0A 3H08A 4AHTA 1LXNA 2YX4A 2ZJRQ 2OANA 4DMNA 2EHGA 3DXKB 4O44A 3M6GA 4CJKA 4EGLA 3SI6A 1QTNB 1HWKA 3AB4B 3KLEB 3U3YA 2KHOA 4GKKK 3CCLN 1R0CB 1NGDA 1XHZA 2JDJA 3LP3A 1HYZA 4J5OA 4ECSA 3C66A 1N54B 2DIUA 2BKNA 4HTIA 5DG8A 2EKYA 4D3GA 2HNZA 4FJ8A 2R2TA 2LQ9A 3FEYB 4O3RA 4I9LA 5KFSA 4IR9A 5BRHA 4TQSA 3UCUP 4DN9A 3CJRA 1B7YB 4FWMA 3O1WA 3AD9C 4C11B 5DETA 2QYGA 4AFFA 4BVOA 2GJFA 3VERA 3NMUA 2XM3A 1U2RA 1SC4B 1BL3A 3VQDA 4DLEA 1PGZA 4ED3A 4QIEA 3BYPA 5IOLA 1DJ0A 3QJPA 2JLEA 4X65J 5CD4H 4W90B 1YHQN 2DNKA 2WBMA 2HF4A 1VDHA 4LR7A 2HFVA 4DPTA 1RBSA 1RT2A 2L41A 2HBRB 1S72N 4DCOB 3MN9A 3AD8C 2G2YA 4PG8A 3OL7A 1TKXB 4IG3A 1ZZNA 4CLKA 4TN2A 3H6EA 3M6WA 4K43A 1UFKA 3JAMY 2BEFA 2ZGZA 4DR5K 3K7RA 1N0VC 1O1WA 4KKOB 2YX1A 4NLYA 4NLWA 3Q23A 1WKJA 4F4ZA 2JWNA 1S6PA 1NJYA 3MCPA 2J6TA 3V1OA 3VQSA 3ZSWA 3LALA 2RF2A 5AE2A 3PW2A 3QT5A 2IM3A 5C42A 2XMTA 1QM9A 1D8ZA 1FNOA 3N0VA 1SH0A 5F9NA 4C8YA 4B1XB 2CJQA 4DL2A 3VAMA 4ATNA 2MQQA 4A5AA 3OSNA 3QIPA 4MJKA 1JNRB 1NGHA 4NLUA 1RADB 5E3RA 3I96A 2K8GA 3J81U 3PO4A 2JLGA 2MKIA 4ZLPA 4O8KA 3IBCB 4IFYA 2A40A 4C3KA 4CI0B 3I56S 4I6MA 4P6QA 2CXEA 4J90A 4M63C 3S41A 2MQMA 2B7CB 2E44A 3Q2SC 1SS6A 2HGNA 3CC4N 2LYVA 4CZJA 4C97A 3TSUA 1RWVB 1X4BA 3ENAA 3M7VA 4IOAQ 3A5NC 2H4YB 5M1FA 2D5RA 2IDLA 1MMLA 4NRTA 1C0GA 4G1QB 3J80Y 1DURA 4FLXA 5CHCB 1NDCA 1NK8A 4DFMA 2CG8A 2M4MA 5I3PA 2MQOA 2XWYA 2O4IA 4M3WA 3QFWA 1S9EA 1X5PA 2WK4A 2VASA 3UFCX 4NCGA 2LDYA 3HP9A 5C2GA 1I1GA 1URNA 3TU5A 1X60A 3OBIA 4C3MA 1XJWB 2BQUA 1HLWA 3NG8A 4WFXA 1EQ0A 4B9LA 4DR7J 3UKUA 3A2FA 4BQZA 3TTDA 4QYRA 3LP2A 2RRBA 3KUEA 1KDNA 1M1KO 3HKZD 2QGFB 4DF8A 2O8EA 1VQNN 2XYGB 2BANA 3M05A 4JYAK 5DQIA 3CI5A 2QG9B 3ENOA 2E9RX 3OR1A 2C2DA 3HPHA 1N32J 1WOQA 1FESA 1HKBA 2QKBA 3I5CA 2OD4A 3QETA 4GKKF 5KFPA 1G3OA 3T1HJ 3RB0A 4ZITA 2RB7A 2B4PA 4GVLA 1XK8A 3SMZA 1AW0A 3M2RA 3LDPA 4ICLB 1VIXA 1FKPB 1ATRA 4AL7A 2ZBPA 2Z2YB 3D0IE 1HNXK 3DN9A 4BWMA 3TNVA 3I0RA 2KI2A 3TZYA 3J7YU 1REGX 2GUPA 1YJUA 2U1AA 3PM9A 1KHWA 1RUSA 2XULA 4IRDA 3V5RA 3MGJA 1ZH5A 2CQ0A 3DLEA 1IG8A 4MFBB 1NK5A 3ASMA 3KK2B 1YJWS 1XNRJ 1S59A 3FGVA 3ET6B 1R8AA 4NCBA 1XIQA 2YJFA 4EMDA 3CYMA 4AF1A 1T7PA 2Y0SD 2XCPA 2MKJA 4KPYA 1Z05A 3ENBA 4K0KK 2HNYA 3CJ4A 4MAKA 1DRZA 3BKFA 4DFPA 2Z2MA 3W9JA 4Y34A 2BQ3A 3OVAA 1RI7A 4WF9L 2ZH2A 2FJXA 4ED2A 1VQPN 2YTCA 3GYXB 4OYPA 1TVRB 2F7VA 1XMBA 5M2UA 4DR5F 1U25A 3K0SA 5LY3A 3R97A 3PNIA 2QV6A 4DS5A 1R6VA 3GU0A 2GAHC 2EFOA 1HBUA 1AB8A 4CZCA 4PPZA 1JNZB 3UN2A 2MGZA 3EDRB 3IWLA 5GAEU 1CZ9A 2DH9A 4BRFA 3WIVA 1LKZA 4P72A 3DRRB 4OI3A 2CKWA 1AT1B 4ZPCA 1QSLA 2AJ0A 4BACA 4LBIA 4WJBA 1AXQA 3DRSA 3GFHA 3NGTA 1R0AB 2F9JA 3S9HA 5GMKa 3G6EN 2GO9A 5AQLA 2IIHA 1UWAA 3DRYA 1QUPA 2NUHA 1HBOA 2LQ5A 3LW5C 5JMNA 2CRLA 1L3VA 4Q7AA 4ELVA 3SCLE 3ZEUB 5KPRA 4PUOA 4DX5A 1RWOB 2CPJA 2AJ4A 1B4SA 3BM7A 2F40A 4K4YA 2W40A 5D0EA 3I55N 2AZ3A 2ZWPA 4KGMA 2RKIA 3O4WA 1FWPA 4HVZA 2O5DA 2BRLA 2N4CA 4BDZA 2O3DA 4FK0A 2YBVA 5ETQA 1WC5A 1KCFA 2C2ZB 2B7BB 2ZBCA 2C22A 2CG4A 3ZTOA 5F3TA 2BE2B 3FEZA 1MSWD 3DCAA 1KFSA 4FWKA 2JFKA 2ASPA 1CLFA 3OW2R 3DMJB 4HUEA 3R1XA 3QAUA 2E6LA 2IS3A 3UN3A 2ROPA 1P6TA 4KHUA 3TARA 5GIOA 1NLKL 1KD1O 1AUDA 4JYAF 4CJ7A 3BPSP 3GSIA 2HGLA 2E2PA 2F4FA 4KPCA 1HYSB 3DLLL 2RS2A 4CLUA 4LF2A 2PN6A 4CGGA 2A41A 2MKKA 4LSZB 1RTDB 2P9LA 3K0JA 1IKYB 4QIWD 1CC8A 4KHWA 3M9NB 2D9PA 5A6PA 4U96A 2C3OA 3AAPA 4YR2A 4RWXA 4LF5K 2QZ8A 1HD1A 4R0JA 2G8FA 1XERA 1HNXF 3G4SS 4FOIA 5DM6Q 3NS7B 3LP1B 3R5GA 2E6MA 3CJKA 3QO9B 2CQ3A 2J9EA 4NPOA 1UCNA 4MKAA 1CULA 3M4XA 3ZSRA 2RE1A 3OTOJ 2ZJQQ 1SJ4P 5F8NA 4BG8A 5L9NA 4CJRA 3IR5B 4ZJOA 4BDPA 2W9BA 4OLAA 1SPBP 4LF6K 2HSTA 2A1RA 3MD3A 1GX5A 4K0KF 4AQYJ 2R7OA 2I1RA 4XDCA 3BGOP 3LF0A 2EBEA 2YPYA 1JL2A 4XEIA 4C23A 3TTFA 1P1TA 4WU2A 4DTPA 2P6SA 1ZXOA 4DBQA 4JD2B 1MWQA 4NLDA 1RT1B 3VESA 2BJ3A 4LFBJ 3LPYA 1NDPA 3D66A 1LWXA 2OI2A 1NU4A 2ZH4A 4U8YA 2Z1HA 4DTOA 5DZ6A 5HRSA 2YNGA 2ZJPQ 5GIPA 2VQEK 2BVZA 4KHNA 2D0OA 3MXHP 4DR6J 1UL3A 1V5VA 2B9YA 3BN7A 2HHHJ 2FYXA 1RT7B 4I6YA 5KFGA 4CJVA 5CXTA 4RBUA 4QU6A 4OMFG 2EFPA 2Q1NA 4FW1A 1A6LA 3B78A 4ZPAA 3CCRN 3M8QB 5GMDA 3A4TA 1LWFA 1NH7A 1S4EA 3GIRA 5DDOC 2HURA 1C0TA 1DGKN 2V8VA 1RBTA 2OD6A 5E41A 3BO2A 1LW0B 5AXLA 3ZZOA 4M94A 4F9OA 3GFZA 1JQGA 4ANDA 4YEAA 3OHRA 2ZUGA 3QIDA 4GO5X 2HGMA 3W2VA 2OA8A 2UVRA 1IG9A 4H4KA 1F9EB 3W8PA 1HQEB 2DIVA 3EZOA 3GG4A 3GJRB 4QYZJ 3MR6A 4FLVA 2A0FB 3U1NA 2KYXA 4QQBA 1NPPA 2IY5B 3S3OA 3ZTQA 4DU8A 3L09A 1WTFA 2DR6A 4DFJA 1KAZA 3MMBB 5IS2A 2GBZA 1Y0HA 4X64J 3F56A 1ZPVA 4RU9A 1RT4B 1E6YA 2ZBQA 4PG5A 1TFWA 5L38A 1WN7A 3VHQA 1RTZA 1RT3B 2CNNB 1NKEA 4CBUA 1N8RO 3N9UC 2DR9A 1T9WA 3B6PA 4LFCK 2CQ1A 1FRKA 4I7FB 1RAIB 5BPMA 4P74A 4DJBA 4B1UB 4CHYA 2J0WA 3N4PA 1RT5B 1HIYA 1OY6A 1J54A 3NCPA 1YUWA 3VGSA 5IM0B 1YRTA 3A13A 3C16B 2YHYA 4WQ5A 2WTUA 4LF5F 1KR4A 1ZOTA 1N36K 4A61A 5HVHA 2PY5A 1RAAB 2DRDA 1CSJA 2IAJA 3PRDA 1R8PA 3IAM9 5A8WA 2F4VJ 3C6HA 1QHAA 3GJTB 2FJBB 4JI8K 3QT7A 2D7SA 4LFAJ 4QIFA 4KFBA 2QMUB 3EKUA 3M2VA 3A5MC 2QKKA 3MX5A 3PDNA 4MDBA 4ILLA 1S12A 5JLFA 2A6AA 3CJSA 4LF6F 5AQTA 1U0HB 2WW8A 1NBWA 4O0IA 3T6JA 1K8AT 1WNSA 1BOTO 4CH1A 3VGLA 2P9SB 3A8EA 4DSLA 2CFXA 2Z58B 3C6AA 1YXQA 2DH7A 3F73A 4DL3A 2EW9A 1NSQA 2X78A 5IWAK 1RBUA 4CNYA 4MYTA 4JS5A 3RW7A 2A5XA 2CWKA 1M1KT 3HM8A 2ZF5O 4OPJA 5LMUK 4O5FA 4ED8A 3IDHA 3VF6A 2DHXA 3NVKA 1WD6A 1AZSA 2IVNA 1YSJA 2IC3B 4L8RB 2CQCA 4NZ6A 1VQMS 2HF3A 2DY9A 4J9PA 3L3UA 3KIOA 2VQEF 4ALZA 1VQ9S 2CYYA 4OHVA 2P9UA 3QFUA 1BQXA 3R5CA 4PAAA 4CJLA 3GJSB 4U6PA 4KR0B 3CXCR 1RBOB 4WQ4A 3DU6A 2P9EA 4TU9A 2XTJP 1LOUA 3KMSA 3MM5B 3TW0A 3OYFA 3P49B 3CJTA 3V9WA 3R7NB 1YVFA 2AX0A 2UXBJ 4DR3J 3N6LA 2V50A 1IXKA 5ETPA 2BJDA 3AB2B 1WG5A 3FSIA 2QWLA 3H8YA 3L9ZA 3DM2B 3NH1A 4ZVRB 2DNOA 1C0UA 3HVRA 2FBYA 1FJGJ 4XK8C 1GFWB 1NKBA 4PL8A 4MIBA 2YHAA 2N82B 3HHLA 2UUCJ 2G2ZA 1RSCA 4LRBA 4Y3CA 3SDEB 3MUVP 3MHYA 1SV5B 4I2QA 1QAJA 3H5YA 3KFWX 4RW6B 4ID1A 4J9NA 2YKMA 2YNHB 4JUZA 2OPQB 2IVOA 4WE1A 1U26A 3J7AN 2JJ4D 2XLIA 3ZZTA 4P7VA 4BRAA 1SQFA 2P9IB 4M1KA 4IQXA 5F8JA 3KOAA 1BD6A 4OI2A 3AV9A 3NF8A 3KG4A 3MFHA 3KXDA 2UUTA 2NRWA 1BCOA 4QWDA 1JLQA 2XBPA 3X1LB 2Q36A 4ID5B 3EVWA 3M1VA 2XYPB 4TNOA 4Q8FA 4ELTA 3VQ7A 2ATLA 5L1KA 1WG1A 2VPXB 1HHTP 3V81A 2MQPA 2MKYA 5KFXA 4LFCF 1EP4B 2LLZA 1VQLN 3R5AA 3FC9A 4O55A 1MROB 3LAKA 1N52B 4NE9C 4HACA 3TAMA 1FE0A 1X4HA 5AT1B 3UCZP 5I42A 1S77D 3FFIB 1RWMB 5DQHA 2M8DB 1N36F 3SSQA 3IRWP 2HQCA 4CT9A 1TL1A 1SC6A 2ZOFA 2R7QA 3UNYA 1NXIA 3TUZC 1NHUA 1MMDA 3V6DB 4JI8F 4MT1A 3CJAA 2A2DA 3TEGA 4JNEA 2DGOA 3ILJA 2F1FA 1MWKA 3T41A 3MEDB 3UD3P 5ADXA 1SQGA 4JKCA 5I9EB 3CD6N 1VSJA 1YBTA 2F8SA 4P2MA 1NB2A 1U8SA 2ZOGA 3C6UB 1YJWN 4Z37A 1WEXA 4DR2J 3W9IA 2G8UA 1OPIA 2J9CA 3H0PA 4RW8A 3PCOB 2DBBA 3H4BA 3N01A 1KRPA 1UVIA 2DCUB 4CFBA 5IWAF 5A8KA 1WNEA 4YB6A 1IQZA 2V2KA 4A8YA 2VC1A 3W5XA 2AHOB 3CJ8A 5LMUF 2DPIA 1S1WB 2PEBA 4IEEA 2HK2A 4BRHA 3DGPA 4Z2XA 3BZKA 1ITPA 4USMA 4EFAC 4LJMA 1BWEA 4XH5A 3HBTA 5L46A 3V9UA 1P90A 1NMDA 3M8SA 5GADU 4ELUA 3QEIA 4U7UK 3MM8B 3VTIA 1NJIO 1EKEA 3DOKB 1RBLA 4X4OA 3VEVA 5HAOA 4ZJQA 3H40A 3BZCA 3QNNA 2YKNA 2EPIA 4CGIA 4BE1A 3CCQS 1XBWA 2YKAA 1GMWA 4ED0A 3SV3A 4CIFA 2ACMA 4JAXA 1DKGD 1YWXA 3TAGA 3HPGA 3VQ6A 2VWKA 1JKHB 2ZH3A 4YB5A 2BX6A 5AR0A 3POTB 3CDEA 2ALYB 5KFJA 2IA6A 2LU2A