3MECA

Hiv-1 reverse transcriptase in complex with tmc125
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
552
structure length
550
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords p66 Reverse transcriptase
publication title Crystal Structures of HIV-1 Reverse Transcriptase with Etravirine (TMC125) and Rilpivirine (TMC278): Implications for Drug Design.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
total genus 149
structure length 550
sequence length 552
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3mecA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3mecA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3mecA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3mecA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3mecA05
4BE0A 1YTUA 2FVCA 3M9OB 3L2WA 1RTIB 1VSHA 4H8KA 3V9WA 1KCFA 1QQCA 2HHXA 3GYNA 3AVHA 4OJRA 3VQ9A 4ZVHA 4NLGA 2C2RA 3DLHA 2J6UA 3CQ8A 1S9GA 1DTQA 4IQXA 3AVGA 3ZCMA 5SWMA 2D0AA 1NK9A 1IKWA 1JLBB 4RZRA 5HRPA 2FVPA 3NAIA 3TAEA 4NYFA 3VQ4A 5EWEA 3RRGA 1VSFA 4CHZA 4KI6A 3AVFA 4CCHA 1CLQA 4FBTA 4Y2AA 2G8VA 3CYMA 4E89A 4DSKA 1S1WB 4RW7A 4MK9A 3ZT3A 2OPPB 3BGRB 3RRHA 5K14B 4QWBA 3B6OA 4KO0B 2CJQA 1I6JA 4F2SA 1TP7A 2HNYA 3O4NA 3MXIA 4KAZA 3TAQA 4ZPDA 3KLFA 4C8LA 2IJFA 5CYQB 3C94A 4M3TA 3MEDA 2RKIA 4URQU 3DOLB 4QPXA 4Y3CA 2WTFA 1Q8IA 3SCXA 4EO6A 3EPGA 4RW4B 4CFCA 5FDLA 1YT3A 1GX5A 4E7LA 4J2BA 1RT4A 2IMWP 4W5TA 4CF2A 4CEEA 2QKBA 1Q9YA 1BQMA 3BSNA 4J9SA 2YNIB 1N6QA 2ZE2B 3KHRA 4KHYA 1BQNA 1S1VA 3KKRA 5KI6A 4IRDA 1N5YA 3KLHA 3QO9A 4NLOA 2BANA 4TLRA 1T94A 4IFVA 2HWIA 3SV3A 2QE5A 1WSJA 3CFOA 3NFAA 1IM4A 4PUOA 2FVQA 3LWLA 3HHKA 1TVRB 4B9VA 3NGZA 4ZPCA 4CGDA 2EHGA 4LSLA 4LQ9A 4ED6A 1JLEA 3AVJA 4WE1A 1TK5A 1S48A 3G6VA 3GV5B 3NH1A 5HROB 3M8RA 3DYAA 1RA7A 3LDSA 3NBPA 3TAMB 4CIFA 3FFIA 1L3UA 2R2SA 4KKOB 4B9NA 4ZP7A 4TN2A 1J54A 1C6VA 4CEQA 4H54A 4B8CA 3MFHA 3MECB 4ICLA 2IAJB 4ZPAA 3PR5B 1C1BB 4FJHA 3UDLA 3QETA 2YKNA 2ZKUA 5CZ1A 3I0SA 5HBMA 3AO3A 1D0EA 1LW0B 5J2PB 5L1IA 1W0HA 3OYGA 4R8UB 1NK0A 2O4IA 4DTMA 1NNDA 5CYMA 4NYZA 2XCPA 1FK9A 2VG5A 2HMIA 4M3YA 2IM3A 2XI2A 4ZP8A 5KT2A 1RT3A 3SUNA 1IH7A 1GOAA 1NK4A 5KFEA 5KT7A 1TL3B 5KFMA 1JLFB 5KFOA 2B5JA 1T3NA 1KLNA 3MR6A 4K4VA 3A2FA 3U3GA 5KFDA 1QAJA 1BIUA 4M3RA 1XR5A 2FJWA 2OA8A 4DU1A 2IDOA 1NJWA 4FJGA 3LP2B 4O3SA 3V9SA 2UVVA 1WSHA 4O4RA 4CK1A 3DLEA 2I1RA 2X78A 4EP4A 2HHWA 3RBEA 4F4XA 1DTQB 5J1EB 2R2RA 2G8KA 1EX4A 2HHSA 1ZYQA 4O55A 4CJWA 5F8HA 2OPQB 3GV8B 3GIMA 4WYLA 3LP3A 4QWEA 3SUQA 5L1LA 4W5NA 3HJFA 3FDSA 4QAGA 2HB5A 3ULDA 3V6DA 5EU7A 4DTRA 4HUGA 4DSEA 5DLFA 3V9ZA 1VSEA 4CEDA 3THVA 1XHXA 2RKIB 1W25A 2AU0A 1TV6B 5FDLB 4FLWA 4JS4A 4IOBA 1BQMB 4CEFA 3WNFA 4I9QA 4NLUA 5C24B 4CGHA 4DTUA 4WFZA 3KJVA 3NF9A 2OZSA 3SI8A 1KHWA 1U4BA 4EEYA 3NH2A 3NF6A 4MKBA 1BI4A 3KOAA 1HPZA 3QO9B 2BANB 3DOKB 1ITGA 3T5JA 1D9FA 1WSFA 4GC6A 3L3VA 1ZBIA 5F8JA 4Q8FA 3FRZA 3QNNA 3RR8A 5FRMA 1UOCA 5KFXA 3N6LA 2J6TA 3JYTB 2KZMA 2PYLA 1LWCA 3KK1B 1Z4UA 1NJXA 3GIKA 2C22A 1L3VA 2OPSA 4KSEB 5FRNA 3LP1B 4RW6A 4EBDA 1GOBA 2QV6A 3KK2B 1NOYA 2FBYA 5I42A 3DYAB 1T7PA 5J2MA 3FFIB 3KMQA 3CJ3A 1D1UA 3OS1A 4DLEA 2W7OA 1WNEA 1FKPB 1XHZA 1UA1A 4KHQA 4ICLB 3FQLA 4OGCA 4DS5A 4FK2A 3VN5A 3V9UA 3ZT2A 2C2DA 1X9MA 1RCHA 3KIOA 4CEOA 4K4XA 3QEVA 4QCLA 5HLFA 4KHUA 3H5UA 2ILYA 2PYJA 4IG0B 4JRQA 1C0MA 5J2NA 2QXFA 4KREA 4E7IA 4OLAA 1FK9B 2V9WA 2VG5B 4KB1A 4QW9A 2HMIB 3QESA 1J9AA 2Z1GA 3L2VA 1SUQA 3PZPA 1DLOA 5KFSA 3NDKA 2DTUA 1K1QA 4QWCA 2EX3A 5KTQA 3KHLA 4CJEA 3HO1A 3LP0A 4IG3A 4FM1A 4E1NA 4IR9A 1L3SA 2P51A 4Q8EA 4IRKA 4DQQA 3DRSB 4IBNA 3KLVA 4CHYA 1KFDA 4FJ9A 3OYHA 3NGDA 2ITGA 4KB7A 3VA0A 3QGIA 5DK5A 3PO5A 2IC3B 1ASWA 3LPTA 3IRXB 3RWUA 4MK7A 3QLHB 1JLBA 2P5GA 4N47A 3DLEB 3T5HA 1EKEA 4H4OB 1SKWA 3O3HA 4KFBA 4YR0A 4E0DA 1JLGB 3QGHA 4ZVGA 4XPEA 4K8ZA 4AHCA 2OPPA 1HQUA 1TKXA 3O3GA 3HL8A 4KO0A 3OSPA 3G0ZA 4K50A 4FZYA 3PR4A 4Z4CA 4TXSA 1GX6A 2Y1JA 5CYQA 2R8JA 4AHVA 4M42A 5KT3A 2LSNA 3HPGA 3V1OA 2HNDB 2YHAA 3DOLA 4FK4A 3VQQA 2CKWA 3S3NA 3ZT0A 2OPRB 1JL2A 3L3UA 3HVTB 4CK2A 4E19A 1ZTTA 3SZ2A 3QGGA 3RMAA 2KFZA 2YNIA 2ZE2A 3N6MA 3H5SA 4DSJA 3HK2A 4LH4A 1VK0A 3T19A 1HYSA 4CEZA 4DFJA 2FBXA 4FVMA 4J9OA 4Y1DA 1NK8A 4DF8A 4F8RA 4PA1A 2WCXA 3IS9A 3ISNC 1RBSA 1S10A 1BI4B 4Q45A 4NRUA 4K4UA 3DI6B 3PVXA 3VQCA 4KV8B 1TVRA 5KFVA 4J9KA 3CJ2A 3BQ1A 2Z1IA 4KAIA 5C42B 2G8HA 2PY5A 3AVCA 4MKAA 3ZSQA 2DFEA 5DMRA 4Q0BB 1NKCA 1LWCB 4ZHRA 5C5JA 3ZSVA 3TAMA 3PW4A 3CDUA 4PQUA 4N5SA 4JV1A 2OPSB 3CM5A 3KLGB 4KKOA 3PUFA 4RG8A 1KHVA 1S6QA 1RTHA 3D45A 5I42B 4RNOA 3DRPA 3MECA 2IAJA 4OGEA 4B8AB 5KFPA 3GV7B 4I2QB 4ID5A 2VA2A 4CJSA 2WB4A 2HVIA 4TY8B 1VSMA 1JLAA 4W5OA 3SQ4A 1BIZA 5J2PA 4ZP9A 2OYQA 3CJ5A 4R8UA 4GVMA 2HHUA 3AV9A 3OYMA 3QIPB 1RTJA 2D3UA 4HCCA 3RMBA 3TANA 3FSIA 4QWAA 1TL3A 1JLFA 2B6AB 4ZTJA 2XCAA 4OPJA 3CWJA 4DLGA 1C2PA 4AH9A 3VQ5A 3ITHA 3V4IB 3OHAA 3JSMB 1A5WA 3MXJA 4CJTA 3RB6A 4IG3B 4Z4EA 1UWBA 1KVBA 4CJKA 1KRPA 2F96A 4K4TA 1XC9A 3H40A 3KKSA 2JEIA 3LP2A 1ASUA 1REVA 2A1SA 1U48A 5KG5A 2OH2A 1L5UA 3TR8A 2XWYA 3V6HA 4DSIA 3L2UA 3M9NB 2PZSA 2F8TA 1S4FA 4B9TA 4ED1A 4ELTA 2VWKA 5HRNA 4BDYA 5J1EA 4FLUA 1KTQA 1GOCA 5KRSA 1Z25A 4YQWA 2WONB 4FJ5A 4GC7A 1VSKA 4OPKA 2F8SA 2OPQA 4KFBB 2XI3A 2W42A 4U6PA 3LANA 3PX6A 5KFCA 1WNSA 2XGPA 1BCOA 4O44A 1HQUB 2WOMB 1BCMA 3CO9A 2VA3A 1TKXB 4M3ZA 1QAIA 3Q8PB 1C0UB 3EZ5A 3CDEA 3LZIA 2DFFA 2UVWA 3SYZA 4RW8A 3H5YA 3T3FA 3VQAA 4MH8A 4KB0A 4EP5A 3LAKA 4IH6A 1S9EA 1KLMB 1EP4A 4FJNA 1TV6A 4FJMA 1TQLA 2BQRA 2ILZA 2R8IA 4DL2A 1XWLA 1SL1A 1TKZB 3NHGA 4NCBA 2AJQA 5F8NA 5DQIA 2C2EA 4N56A 5C24A 3H2LA 4WFXA 1S6PB 4WZQA 4ZVFA 1VRUA 2AWZA 1HYSB 3NF8A 4TSXA 4J2DA 4Z4IA 3NKYA 3DOKA 2IBKA 1RYSA 2QKKA 3OYLA 5KFRA 4F2RA 3IS9B 1NKEA 3KK3B 1S0OA 4IH5A 1HNIB 4LSNA 4Q43A 4CJQA 3JYTA 1TL1A 2YNFA 3KK1A 3PJWA 5T7BA 3OSNA 5EWGA 2W8KA 4IRCA 3LP1A 5EDWA 2GIQA 1JKHA 4CK3A 4TQRA 3GIIA 4IKFA 3KK2A 3EZUA 5CY4A 3HVWA 2X6NA 4ZHRB 4NYNA 4GW6A 5DG8A 3KD5E 2I5JA 4PQUB 1VSJA 3LAMA 4KHRA 4URGA 4FJJA 2GV9A 1S6QB 3QEXA 4KTWA 5KFYA 3SJJA 4J9QA 1RTHB 1RT6A 3PJXA 3LWMA 4OKKA 4CFBA 1FKPA 3PW5A 1RDRA 3DRPB 3DRRB 2UVUA 4RW9A 3Q8SB 1FKOA 2R8KA 2XY6A 5DG7A 4ID5B 3D5MA 4F50A 3M8SA 3V6KA 1ZBLA 1JLAB 2AGQA 1RBTA 3TABA 1XR7A 4IG0A 3G6XA 3DLGA 4Y34A 4BACA 5DLGA 3QERA 5F8GA 1RTJB 3I0RB 4MIBA 3MTKA 4X2BA 4YR2A 3UPFA 1VSLA 3H08A 4M3UA 1I39A 2Q3SA 5FROA 4HKQA 4CJFA 3ITHB 3DRSA 5DG9A 2UUTA 4ELVA 1UWBB 1WLJA 3VQ6A 4DTPA 2XRIA 2IC3A 1REVB 3SFGA 3IRXA 4B9SA 1LWFB 3P5JA 4FK0A 1S1TA 3QLHA 1A5XA 4DTOA 3NF7A 3HKWA 4M95A 3HVRA 3SFUA 4H4OA 5KG7A 4Z4HA 3L2QA 5DQHA 4LH5A 3DM2B 2KFNA 4RNFA 4FZZA 3ZSXA 1JLGA 1IKXB 5KFJA 1RAJA 2E9TA 1LAWA 3CVKA 3MR5A 4HUFA 4JRPA 2OZMA 4CF0A 3BR9A 3DLRA 4QW8A 3UR0A 4H4MA 4RUAA 4O44B 3I8DA 4KBIA 2HNDA 1Q9XA 1CZ9A 3ZT1A 2OPRA 4MK8A 4LQ3A 4CIGA 3HVTA 3M8PA 4CECA 4BDZA 1K1SA 3KLEB 4DL7A 3SUPA 4RW8B 1JX4A 3AO1A 3OS2A 3FQKA 1QUVA 1S9EB 1WSGA 1EP4B 3UQSA 1S9FA 4FJIA 2KQ2A 1T05B 4HHTA 2AX1A 1RTDA 1D8YA 3DMJB 1JXLA 3QIDA 2HNZB 4GMJB 3WNEA 2E9RX 1QS4A 3TI0A 3AO5A 1VRUB 1B92A 4FXDA 5D3GA 3DI6A 4KE5A 4Q5VA 3KTQA 1IKYA 4KV8A 4CFAA 4DS4A 2ETJA 2G8IA 1CXUA 3DLKB 3CFRA 1YTAA 4E7KA 3K58A 3ASMA 4LSNB 5C42A 4YMEA 4BWJA 4DG1B 1TL1B 2YNFB 4Q0BA 3KNAA 1JXEA 4F3OA 3DLBA 1JLCB 4TY9A 4R0EA 2B4JA 4CGJA 2G8UA 3NMAA 2W9BA 4RNHA 5SZTA 4WXWA 2X74A 3KLGA 4Q44A 1JKHB 3HSTB 1U45A 3NGIA 3HXMA 4RNMA 1S49A 3V9XA 1IO2A 3RTVA 3IGNA 2I5JB 1T8EA 4EYIB 4I2QA 1RT6B 5EWFA 4K4SA 4TY8A 4RW9B 2W9AA 1FKOB 1RBRA 2R2TA 4DQPA 3BSOA 3IG1A 4XO0A 1SKRA 3QIPA 4WFYA 4DU4A 1BHLA 3MEGA 4RUCA 4ZVEA 2HHQA 3DLGB 4E7HA 3IN5A 5HRRA 3MEEB 2YV0X 2B6AA 4E3SA 1WSEA 2IJNA 3U3YA 4K8XA 4RNNA 3CIZA 3V4IA 3JSMA 4KI4A 4B9LA 5KT6A 2ATLA 4WXOA 5KGWA 4CEBA 1QSLA 5KG0A 4DFPA 3OHBA 4EBEA 1XR6A 2VG6B 2XO7A 2BDPA 5JS1A 1RT5B 4ZTFA 4J2EA 3TAFA 3NAEA 3TVKA 2VWJA 1L3TA 4KRFA 4ECYA 5HRSA 1S1TB 1CZBA 3QEPA 4R5PB 1K6YA 4IFYA 4FJ8A 2WONA 3AVLA 3KLIB 4KTZA 3HPOA 1LW2A 4O3RA 4NLXA 1R0AA 2FVRA 4N76A 4KHWA 3UIQA 2WOMA 5KFWA 2AGPA 3L2RA 3RR7A 4FJLA 5KFTA 4M45A 1C0UA 3L8BA 5J2QA 3AA4A 4DL5A 4H4MB 3PW7A 1JLQB 4DU3A 4FJ7A 4DTXA 3D28A 3OYKA 1KLMA 1SH3A 1QHTA 3M8PB 3PX0A 2JC1A 3AA2A 1TKZA 3ISND 2E6LA 3PX4A 2AQ4A 1UAXA 2V4QA 2V4RA 1X9WA 3ZSRA 1IG9A 3ZSZA 2IM0A 1S6PA 4ECUA 1RTDB 2BRLA 5F9NA 1QTMA 2BE2B 1VSDA 1IKVB 4YNQA 1D9DA 1J5OA 3WNGA 1BGXT 3ZSYA 4NCGB 3KK3A 4MFBA 1RDAA 4CJUA 1KSPA 1NHUA 1HNIA 2Z1HA 5D3GB 3E01A 1ASVA 5JXSA 3ICLA 3ZSOA 2R7YA 1NJYA 1IKYB 1RT2A 4DQRA 3BREA 3NH0A 3OL7A 3SPZA 2WRMA 4FLVA 3Q8QB 3RB0A 2IM1A 4F3TA 3I5AA 4DFKA 4J2AA 3BSAA 1DTTB 1MMLA 5KT4A 5F8LA 3IAYA 1QSSA 2W9BB 3TAGA 1CSJA 4Y2CA 4B3OA 4I7FB 1C1AA 4NRTA 2WK4A 2GC8A 5L9XA 3PO4A 5KFQA 3DRRA 5JS2A 4O3QA 2D3ZA 2P1JA 5E41A 4FLZA 4BWMA 4DQIA 4CJ5A 1SV5B 3C6UB 3LALA 4CJRA 1W9HA 1T03B 1HMVB 1Y97A 4BDPA 3IG1B 2XGQA 4FW2A 3N6NA 3MEGB 3I0RA 5KG4A 1S0MA 5HP1A 3Q8RB 1G15A 3BQ2A 3AO2A 5KG3A 3SQ0A 2DFHA 4AHTA 2FJXA 4G1QA 3EYZA 4FM2A 4DQSA 3DDKA 4CHOA 4KHMA 3S3MA 2YNGA 3WNHA 4C8OA 3EPIA 4HTUA 2E9ZA 3HPHA 3G86A 5L1KA 2FLNA 1CXQA 1SKSA 1HNVB 2FVSA 3V81B 4NZ0A 3KMSA 3AVAA 1HYZA 1LWFA 4O4GB 2FC0A 4FLYA 2YHBA 4UQGA 2IA6A 3C6TA 2KW4A 1N56A 2FBTA 1TGOA 3DM2A 4CHNA 1IKXA 4FS1A 4DFMA 1NK7A 3RMDA 2YNHB 1ZBUA 2B43A 4IFYB 3V6JA 4BE2A 4ZMMA 1FXXA 1LW2B 2IGIA 5KG1A 1R0AB 2BQ3A 3HVAA 2RDIA 2R8GA 3CJ0A 4CERA 4NLRA 3K57A 2ALZA 2FLLA 3AVIA 3MR2A 4EBCA 5J2QB 4YP3A 1WAJA 3H98A 3KLEA 1RT1A 1N4LA 2UUWA 3OYIA 1S97A 3NGYA 4CGFA 4XIUA 1A5VA 3M8QB 3QEIA 4C8KA 4OLBA 3F73A 3AA3A 3IGVA 1T05A 1U49A 4MIAA 2D0CA 3OY9A 3DMJA 3QYYA 3K5NA 4O0JA 2HNZA 5F8IA 3VQSA 2HW3A 4PWDA 3SUOA 2D7SA 4FM0A 4G3IA 1QE1A 1RT7A 2Z1JA 4JUZA 4KPYA 1J5OB 4TYAA 1O1WA 4QOZB 3NCIA 4MFBB 4CF8A 3DLKA 2ASLA 2A1RA 4J9LA 4DMNA 3RB4A 1ZETA 4HVJA 2Y1IA 3MFIA 4J9PA 3E01B 2JEFA 4M94A 3H4BA 3OYCA 4DG1A 1I3AA 1S1XB 1RT2B 1JLCA 3ZSWA 3SI6A 4J9RA 3G6YA 4HYKA 2E6MA 4NLWA 5KFLA 1VRTA 4DL6A 2IS3A 4M41A 4ECRA 4HCBA 3PV8A 1QSYA 2P5OA 2D41A 4O3OA 5DGAA 5CZ2A 2RN2A 3S3OA 4O0IA 4B3OB 4CESA 1S1UB 4FZXC 4DSFA 4DTJA 2HHTA 5F8MA 3MAQA 3KHGA 3OYFA 1MU2A 4L8RB 1BISA 2ZD1B 4NLVA 1KVAA 1RILA 3MEEA 5I3UA 4LY7A 2XY5A 3HM9A 4J9NA 3H5XA 5HP1B 4ZP6A 1RBUA 5KGXA 1WSIA 3MR3A 1RBVA 4G1QB 4OKEA 2XY7A 1RDCA 3T5LA 1EETA 2DPIA 4CGIA 3LZJA 3BQ0A 4CJ4A 4AILC 2YNGB 3VA3A 2VG6A 3AO4A 1XI1A 3OYAA 1RT5A 5C25A 3QIOA 1RDBA 1TKTA 4CF1A 3HT3A 1LWEB 3PW0A 1JXBA 3QINA 3H4DA 4R5PA 4B08A 4ECQA 3KLIA 3S9HA 3C6TB 4I2PB 4ED2A 4XPCA 2FLPA 2UVRA 1C1CB 2JC0A 3AA5X 4DTNA 4YFUA 3M9MB 3AVNA 2JLEA 4JV2A 2O5DA 4MQ3A 4W5QA 4LD0A 2RPIA 1JLQA 4PY5A 2VG7A 4URSA 4NLPA 1S9GB 4C8MA 3V1QA 4M3XA 3BDPA 1IKWB 4JLHA 3K2PA 2YKMA 2GIRA 3D0PA 4IKAA 4CE9A 5KFAA 1RT1B 3OJSA 4EO8A 2GUIA 1ZBFA 4N41A 4CJVA 3I5BA 2NUBA 4ELUA 1TKDA 2HHVA 4RW7B 4NLDA 5KFGA 1TK8A 3OYJA 4IDKA 1NKBA 2BE2A 1RNHA 2ATQA 2HNYB 1IKVA 2XC9A 1JL1A 1S5JA 3KLFB 1HQEA 5DGBA 2HVHA 3KHHA 4ECWA 2F8EX 5KFZA 4ECVA 1TK0A 2RF2A 3MEDB 4PWDB 3VQDA 4NCGA 3OS0A 2FBVA 3RB3A 1QE1B 1RT7B 2BRKA 4FLXA 2JEJA 1BL3A 3U6FA 2W8LA 4I9LA 1RT4B 4OL8A 2QK9A 3QZ7A 1C0TA 3OL8A 1SL2A 1N6QB 4NLQA 1KVCA 3OYEA 1BQNB 4EYHB 3K5LA 1S1VB 5KFBA 1DTTA 4WYWA 1N5YB 3KLHB 4TQSA 2IM2A 3O3FA 2DY4A 3NAHA 4IFVB 4I7FA 1VRTB 4EZ9A 4NLSA 2W9CA 4O5BA 1SH0A 4PUOB 2KTQA 3OJUA 3CG7A 4NLYA 4OKJA 4LSLB 3CM6A 1SV5A 3C6UA 2XHBA 2O4GA 4M3WA 1JLEB 2J6SA 4WE1B 3SV4A 5KG2A 4J9MA 4CF9A 3SPYA 1T03A 3RBDA 1HMVA 4FBUA 3NBPB 2G8WA 1MU2B 4Z4GA 4NLTA 3SQ2A 3E51A 3VQPA 3SNNA 3P1GA 3OL9A 5KG6A 1HYVA 4AHRA 4K4ZA 3T1AA 1LAVA 5I3UB 1WAFA 4ED8A 3TAPA 4CIEA 2YKNB 3LPUA 2EC0A 4AHUA 3I0SB 5HBMB 2AX0A 3AVBA 3P83D 4QWDA 2FJVA 4K4WA 4B9UA 1HNVA 2R8HA 3MXMA 1EETB 3V81A 5L1JA 2C28A 1RYRA 5CYMB 4FYDA 1SH2A 4FW1A 1YVUA 3GILA 3OYNA 3F9KA 2HWHA 4DL4A 3K5MA 4O4GA 1NK5A 4FS2A 2V0NA 3AVMA 5C25B 1RT3B 4ED7A 4CJ3A 4ED3A 3KD1E 1X1PA 1TKTB 3K59A 2RDJA 4E7JA 2R2UA 5T14A 2B5JB 2YNHA 4CGGA 4CHPA 1RTIA 1ZBHA 3OLBA 2KZZA 4ECZA 4CJLA 3RAXA 4KHNA 1VSIA 2G8FA 1OS5A 2GBZA 5KFNA 2W7PA 3ZT4A 4WZMA 3OLAA 1N48A 3NE6A 1RDDA 3EY1A 4ECTA 3AVKA 2VG7B 3CJ4A 3BJYA 4ECXA 1SL0A 2HAIA 2ASJA 4CHQA 4F4ZA 3G10A 4KHSA 3M8QA 1S1WA 3O4QA 2YKMB 4F4KA 3OYDA 3BGRA 1U47A 5K14A 3VQ7A 1NOZA 3TWHA 4DWIA 1RA6A 2BQUA 1ZTWA 1TAQA 4RU9A 3SQ1A 5JUMA 4B9MA 1HARA 3HYFA 3V6DB 3VQ8A 4Y1CA 4IDKB 5EUHA 5F9LA 4ECSA 2BR0A 1NK6A 4RW4A 3QEWA 1HQEB 3C95A 4DSLA 2RF2B 2JEGA 1J53A 4JV0A 3PY8A 4OVLA 4Z0UA 4E1MA 3CDWA 1S1XA 4DEZA 4EZ6A 3ALYA 4NCAA 1C0TB 4FCYA 2D0BA 4DL3A 1S0NA 4CJPA 3KJVB 3OL6A 4ID1A 4C8NA 1UA0A 3QNOA 5KFKA 4HUEA 3MF5A 3OYBA 4CEAA 1HPZB 2D5RA 4FJXA 1D5AA 1NJZA 2IOCA 1U04A 3CFPA 1B9DA 4W5RA 3HP6A 5KFUA 1S1UA 4O3NA 4JS5A 3I5CA 4U7CA 2W9CB 1YVFA 2DPJA 3VQBA 1WN7A 4CFDA 5HROA 4K4YA 3VQEA 3GIJA 1X9SA 4ZPBA 3K5OA 4ED0A 1EXQA 3PW2A 4RW6B 2AGOA 1TAUA 4BE1A 3T5KA 2ZD1A 3BSCA 2XY8A 4IH7A 1NHVA 4AHSA 3GQCA 3OVNA 5J2MB 5KFFA 5KRTA 5KT5A 1C1BA 3RAQA 2X6SA 3TARA 1LV5A 1B9FA 2ASDA 4F4YA 3NL0A 4FJKA 4DF4A 1LW0A 2ZQBA 4Z4FA 2WHOA 3HP9A 3RMCA 2JGUA 3H59A 1HRHA 5KFHA 2BGGA 5DQGA 3PHEA 1Z26A 3B6PA 5HLFB 5KFIA 4FLTA 1U09A 4O3PA 4DTSA 3V1RA 1JIHA 1KFSA 5J2NB 4TYBA 1LWEA 4F4WA 1HJRA 4KTQA 1SUQB 3TQ1A 1DLOB 4YR3A 1F21A 3QZ8A 3LP0B 4I2PA 4IR1A 1C1CA 2E4LA
chains in the Genus database with same CATH superfamily
2KT3A 3M3ZA 3PIOQ 2FVCA 1VSHA 2VWBA 4H8KA 1KCFA 2HHXA 1GLBG 4FXVA 4LRBA 4NLGA 5AQFA 2J6UA 1S9GA 1X5SA 2GEMA 4ZN1A 1IKWA 1JLBB 5HRPA 4WKRA 3FCVA 3NAIA 3TAEA 2R3VA 1AZSA 1LK7A 3RRGA 1VSFA 3AVFA 4CCHA 4RJVA 3CCSS 2G8VA 4LF5J 4OYAA 1VHXA 3RRKA 3B6OA 4KO0B 2XYGB 1TP7A 2DR6A 1V4SA 3T1HF 4M3TA 2RUSA 4NL5A 2LFVA 4LR9A 4A8WA 3MN7A 3WIUA 1VQLS 1VHFA 3SCXA 4IOAL 1GX5A 4E7LA 4USJC 2IMWP 4DN9A 5IFMA 3BF3A 2W40A 5E5NA 3BSNA 3T6BA 2ZE2B 2HAFA 3QRRA 4A5BA 4OLPA 4KHYA 2QX0A 2R7QA 3AQOA 1S1VA 3R2DJ 3HHLC 5AQQA 1RABB 1UJ4A 2V2KA 4NLOA 1F9HA 2BANA 1NJIO 1QQOA 4IFVA 2HWIA 1Q7YO 3SV3A 2ZOGA 3DXKB 2KG1A 1X31C 1WSJA 1IM4A 3IFRA 3LWLA 2XNRA 3GCWP 1Y3JA 3KHYA 3SMPA 4YDDB 1JLEA 1XNQK 3CSKA 2VQFJ 4G1IA 3H0PA 2J76E 3J80Y 1WKKA 3FFIA 1Q0NA 4DR7J 2R2SA 2ZUAA 4B9NA 2HYIB 1F2GA 4CEQA 3MFHA 3M6UA 1R6VA 4ZPAA 3F41A 2WVFA 5CZ1A 3EVMA 2I8EA 1B64A 5DZ6A 1PJ5A 4DV3K 3GR0A 5J2PB 4YN3B 1NK0A 1NNDA 1OY8A 4H0YB 4NYZA 1FK9A 1E4GT 2BKPA 1UMJA 2NXUA 2IM3A 3CC2N 4QIGA 3LM2A 5KT7A 5CHCB 2OIHA 1FTRA 1KLNA 4CH7A 1FJGK 5KFDA 1QAJA 4M3RA 2FJWA 2OA8A 4A5AA 3G4SN 4PPZA 2IDOA 1CEZA 3LP2B 2R7TA 1XNQJ 3FGVA 1YI2S 3FEZA 2IPOB 4Y2KA 2ZNYA 2HHWA 4EP4A 5HAOA 4RL1A 3Q86A 4YOVA 3RBEA 1DTQB 5J1EB 4KH6A 4Z94A 1GMWA 4CBUA 3K17A 4O55A 3GV8B 3HJVA 2OPQB 3JAMU 3NCPA 4WYLA 3GIMA 4IO8A 3LP3A 4HT5A 2E29A 4LF5F 4PAAA 4QWEA 3SUQA 2JVRA 5AQRA 3JAMO 3FDSA 3W66A 4DV3J 3ULDA 5ETQA 4WF9Q 2IDLA 2CPZA 1RHMB 1F1BB 3LL3A 1XHXA 1LWXA 3TZZA 2RKIB 2B4OA 2JNJA 4BRDA 5D77A 4OZ1A 4M5DB 4IO9L 3TZWA 4FLWA 2PT0A 4JS4A 1BQMB 3O8MA 2NLWA 1SVDA 4NLUA 5C24B 4CGHA 4DTUA 7FD1A 3CJ1A 3SI8A 1KHWA 3NH2A 1P90A 3KOAA 3QO9B 1BHNA 3OTBA 4QOTA 5AZIA 4JEPA 1T9YA 4I4BA 5F8JA 5A8RA 3FRZA 3GP9A 3QJLA 3QNNA 2IVMA 2HIQA 2CJAA 2AEMA 3N6LA 3JYTB 2KZMA 1R0CB 1Z4UA 1DQAA 1B0VA 2H48B 1DJ0A 3GIKA 3M4XA 1EJ7L 1PAUB 1Q78A 4KSEB 1FRXA 2VQFF 1VBXA 3GFXA 2E2NA 2RUGA 2E88A 2XZTB 3GJSB 2XS2A 1YF5L 3UNGC 4DR7F 1RCOB 3DCAA 1X4BA 3CJ3A 1MROB 1BE4A 1UCNA 1FKPB 2LLZA 2OO4A 4JI5K 2G0CA 3FQLA 1VQ4N 1WOPA 2C2DA 4CEOA 1GMUA 4DUZJ 2A41A 3CXCR 3VEOA 5GAGI 2ILYA 4KREA 3TJAA 1TYQB 2V9WA 4KB1A 4QW9A 2HMIB 5A76A 2NZTA 2DNRA 1HBOA 1DLOA 5KFSA 2VPZB 1K1QA 2GZOA 1HFEL 4IEIA 3HO1A 3LP0A 4MDAA 3I55N 2QA4N 2BTFA 3J7Z5 4E1NA 4YB5A 1L3SA 2P51A 1ZZNA 1MW7A 3OA9A 4FJ9A 2AJ0A 1NMNA 2P6TA 1OO0B 2GGPB 3QGIA 4JBCA 4CLKA 3PO5A 3EO3A 2BJDA 1T3VA 2KHCA 1XNQF 1N5VA 3K0JA 5A0YB 1IJEB 4ZVOB 2LEAA 4H5VA 3MXHP 2P5GA 3H2UB 3O4WA 3DLEB 2VPXB 4H4OB 5D0HA 1RHRB 4KFBA 1HW9A 3OFFA 4E0DA 3QGHA 3AQPA 4ZVGA 5FPDA 4AHCA 4ZVSB 3L95X 4JI5J 2YI1A 3VGKA 3P5BP 2KXHA 1TL5A 4X62K 4PG4A 5HMWA 4NA1A 3HL8A 4BRKA 4CW7B 2QTDA 4K50A 1Q16B 4FZYA 4DV3F 3PR4A 1GX6A 2Y1JA 2R8JA 1W2BR 4M42A 1TR0A 2LSNA 5AQWA 2LXFA 4CYUB 2YHAA 3CCZA 3A3NB 1L3KA 4FK4A 2ZJRL 1G7CB 3NGUA 3Q7CA 3SZ2A 3RMAA 2FUG9 1JK9B 1Z2ZA 2CZVC 1NXIA 3H90A 2KFZA 2G0JA 3H5SA 1JQGA 2D0OA 1U2VA 3EICA 3A8YA 4CEZA 4TVAB 3NGKA 4DFJA 2FBXA 2KVQE 4J9OA 1S72N 4DF8A 3M1FA 3I82A 3NMRA 4PA1A 1RBSA 1OPIA 4K2JA 3N4PA 1S10A 1V3ZA 1BI4B 4NEYA 3ZETA 2K1RB 3THWA 1HHQA 1RAOA 1N33J 3OXLA 5JLHA 2ZITA 3Q23A 4KIAA 2CGKA 1ZS6A 5C42B 1NGEA 5AT1B 1LWCB 3PW4A 3CDUA 4OHYA 5BYQA 1KAZA 3KLGB 3PUFA 5M1FA 4RG8A 1TMJA 2H5IB 3NOGA 3MECA 2BJ8A 2IAJA 5KFPA 1B7YB 4I2QB 1WG5A 4WFBL 3FZHA 3OXGA 1GNKA 1TUUA 3MD3A 4FNIA 5KOXA 1BIZA 2GMJA 3FZMA 1YWXA 4R8UA 3BBCA 2ZJPL 2OJ3A 1HNWJ 1ULRA 3QIPB 3LH2S 1GLAG 3A12A 3H20A 4OZ2A 1ELOA 4QWAA 1TL3A 4ZTJA 1C2PA 3VQ5A 2ZVIA 4JK7A 2V9KA 1JB0C 3V4IB 3MXJA 2I0XA 4Z4EA 1UWBA 1KVBA 5IT9Y 4JV5K 5DDRC 5GADP 4GY2B 3MPDA 1XC9A 4PG7A 5KG5A 1MLAA 2W7AA 1HNZJ 4BG9A 1L5UA 4JHDB 4YHHK 2F8TA 2XSFA 3NS6A 4CLWA 5KRSA 3EGNA 3KWGA 1S0VA 3AH6A 2XI3A 4JI5F 2YWHA 3RZAA 2XGPA 1BCOA 3AGKA 1FWKA 1HQUB 1ZAXA 1JJHA 3CO9A 5H9FK 3H1VX 4OYXA 2KT2A 4X4SA 4PEOA 5E3QA 4ZK7M 4M3ZA 1C0UB 3CDEA 3BH6B 3CJRA 2DFFA 2NYIA 3VQAA 2CPHA 3P4UB 4MH8A 4KB0A 3HHLD 2HVDA 3S41A 2G2ZA 2DHHA 5AXMA 1X60A 1PILA 3OUYB 4MO4A 1YBAA 1XWLA 1SL1A 1AYEA 4F0HA 1YJ9N 5HSPA 2B51A 3NHGA 3VV2B 4NCBA 2NRTA 4N56A 3QT7A 1RJJA 3H2LA 4WFXA 4O5FA 1YBTA 4WZQA 4NA2A 3DC2A 2BOAA 1RGVA 5SUHA 2AWZA 2LVWA 3FR0A 1HBNA 1RYSA 1VFJA 3AB4B 2PDAA 4CO4A 2E1ZA 3IFEA 1UZDA 4DR4K 4IH5A 1HNIB 4MDBA 2ATCB 1N33F 2YNFA 3PJWA 3J7AN 4IRCA 2PA8D 2WUSA 3LP1A 2J7WA 4TQRA 4IKFA 2BM0A 3KK2A 2W25A 4ZHRB 1IWAA 4K41A 4NYNA 5DG8A 4BRGA 3LAMA 3RGIA 2XLKA 3QMLA 1S6QB 4J9QA 3O3LA 3PJXA 4OKKA 3CCUN 3R5DA 1N5TA 3L4QA 1NH7A 3Q8SB 2L9NA 5DG7A 2YWKA 3PRBA 4C1NK 4L76A 1NGHA 3T6JA 5HO4A 2F4FA 3AA9A 1NSKL 3DXMA 3G6XA 5CD4A 5DLGA 4GV3A 3R27A 1UJ6A 3Q22A 4LT6A 3MTKA 5J1NA 5JVGQ 4X2BA 3RU0A 3UPFA 1NM2A 4X4UA 1VSLA 1Q81O 1KD1O 3C7NA 4M3UA 3UDCA 2IIRA 1CQMA 5FROA 1ZA2B 4HKQA 3ITHB 1WUAA 4HWIA 1K47A 5DG9A 4YOUA 4YUDA 2GO8A 4IUFA 5E84A 3VMFB 4C23A 2GHWA 1K8AT 1HNZF 1U8WA 1S1TA 3QLHA 4Q7AA 1Q86O 3QBWA 2XS5A 3NF7A 3HVRA 3GL1A 1CS4B 3FBFA 3LO3A 2KFNA 5AQYA 3ZSXA 1JLGA 5KFJA 4A8FA 3EWGA 2PAVA 3B82A 3MWTA 2K8GA 4HUFA 4Y0WA 4PXBA 4ER8A 3BM7A 4DDFA 1SQEA 2QLWA 2BW7A 1S77D 4CF0A 3BR9A 2KRRA 4ZVRB 3NWRA 3UR0A 4HLBA 2ZHOA 4RUAA 1ZM3A 2BH1A 5ADXH 3I8DA 2DIUA 2HNDA 2FPHX 1CZ9A 2AYEA 3HVTA 3M8PA 4CLFA 2GX9A 5B0AA 3G96A 3AO1A 1LFWA 5T41A 2YQ1A 1BY9A 1UFWA 5AQOA 1EP4B 3CCRS 2E5GA 4F4AA 2DNKA 4HHTA 1NRKA 1RTDA 1D8YA 1NDCA 1FRLA 1XMQJ 1JXLA 2HBRB 2E9RX 1QS4A 4GO5X 2WW8A 5BN8A 1LFPA 1RCXB 2P9EA 4FXDA 3J7YP 3WQUA 3WC2A 3KTQA 1IKYA 4KV8A 4YHHF 2V8PA 4X64J 1SQKA 3MMJA 4ID8A 1HR0K 3W5YA 4BWJA 2J0QD 3I4HX 1BXNA 1X7VA 5KQDA 1EO1A 2B4JA 1M1HA 1NZ8A 3HSTB 1VQ9N 3D2FB 1WJ9A 4QPTA 2NUUG 3UD3P 4DR5K 2A0FB 1S99A 2I5JB 1T8EA 4EYIB 2PSZA 1P6TA 4AE5A 3HZ6A 4PKGA 4F3MA 4LSZB 3M32B 1KEKA 2C3YA 5BYRA 4JI8J 4XO0A 4XDCA 4F3QA 1BHLA 3MEGA 4RUCA 4Q2MA 2HHQA 4ZJOA 5AQNA 4E7HA 2J7KA 1I1GA 2MKHA 5HRRA 1BO5O 1RWWB 2Q0UA 3GBTA 1FXLA 3U3YA 5H1SV 2V8VA 1GAOA 2RE2A 5KT6A 2ATLA 4WXOA 4PG6A 1QSLA 2RJZA 4DMZA 1HR0J 4CLSA 3THYB 2CPEA 1OVQA 1XR6A 2VG6B 4B3SK 1IR2A 1QVGM 4H0OA 4ZTFA 2RILA 1HKAA 2QLJB 2UV8G 1DT9A 1H7WA 2JHEA 4ALZA 3C8YA 1XC3A 4DR5J 2MKCA 4KTZA 4GVBB 3BN4A 1DZ5A 1MG7A 2FVRA 2P9IA 4NYPA 1KQSR 2MHNA 4I64A 1WHVA 3DOMA 3L2RA 4HTJA 4C7QA 5KFTA 4FJLA 3BKTA 1BG3A 1SQGA 4H4MB 1JLQB 1OH6A 3I33A 1NB7A 2V8HA 4FJ7A 1VOMA 3TZXA 1WDDA 2XZDB 1HHSA 4ZIVA 3PM9A 1TKZA 5AQSA 1FT8A 3VGSA 4V19S 2LECA 5FD1A 3MTJA 4OI6A 1S6PA 5GINA 4OZ5A 1XMQF 2MKIA 4FKXA 3G8QA 4B3SJ 1IKVB 1J5OA 4ILLA 1R31A 3VAKA 2VBWA 4GO7X 1RDAA 4CJUA 1NHUA 4IJNA 2F9WA 2Z1HA 1P27B 4A8MP 3ZSOA 2R7YA 1NJYA 1RT2A 4EIAA 4X64F 4FWNA 1ATSA 3BREA 4LIRA 3Q24A 4FLVA 3Q8QB 2IM1A 1XTZA 3I5AA 2YX4A 2KH9A 1FVSA 1M90O 2IMOA 1N52B 4ETZA 2Z4PA 1QSSA 2W9BB 4OZ3A 2H3GX 4Y2CA 4KGKA 4B3OA 4I7FB 1Z2LA 3F56A 4NRTA 5L9XA 2DHGA 3PO4A 4O3QA 2D3ZA 1UL3A 1HIYA 3CCQN 1SV5B 2LP4A 3C6UB 4I1TA 3BUZB 2KYZA 2OD6A 4CZFA 1YJWS 3P49B 2RVJA 5AXKA 4DX7A 2XGQA 3CJ7A 3O80A 5A8KA 1U1MA 3KDOA 3N6NA 2H4WB 5KG4A 2JDJA 1S0MA 3M8YA 5KG3A 3IWXA 3AD7C 2C1EB 2DH9A 3EYZA 3ZZZA 3CIMA 4E98A 3HCXA 5CZVA 1R27B 4FM2A 1RU1A 4ZVQB 2VC0A 2YNGA 4ILGB 3EPIA 3G86A 4ES3A 5L1KA 1NWKA 5AQUA 1IVZA 1SKSA 1GK8A 4Z37A 1HR0F 1S4EA 4PKHA 3IM8A 1SJFA 3AVAA 1CVJA 4YOEA 4JI7J 4O4GB 4CDIA 2QYGA 4FLYA 4UQGA 2IA6A 2KW4A 1FDNA 4LR8A 2VL1A 1IKXA 3RMDA 4DR5F 1GLEG 4BRAA 2B43A 3KJNB 2YWWA 4BGBA 3V6JA 4ZMMA 1VDHA 1OVYA 1GFWB 2VPYB 2DGQA 5KG1A 3FJ2A 1T9WA 1WDTA 3BPDA 2HK3A 2BQ3A 1R8CA 2FYXA 4JAXA 3SMSA 3JSBA 3CJ0A 1H2TZ 4H4KC 3U1NA 4A62A 2ALZA 3AVIA 4BRCA 3MR2A 4QIWD 5J2QB 2HBZB 4YP3A 1FDDA 3F2KA 4EFAC 1RT1A 1N4LA 2UUWA 3ID6A 1S97A 2DBBA 3NGYA 1JJ2M 3SCLE 1T05A 1M1GA 2D0CA 2NRVA 3CJSA 1U0HB 2BA9A 1HA1A 4O0JA 2HNZA 1EQYA 2VBXA 1RP5A 1VQOS 3CD0A 4G3IA 1QE1A 4B3SF 2Z1JA 1A7GE 2NXJA 4BRPA 3SDEA 4LF8K 3MX2A 4OI3A 4TYAA 1Q4RA 1XNRK 2XMUA 1E6YA 3PSFA 3RB4A 4HVJA 2Y1IA 4A8YA 4YS2A 3VCDA 1SPBP 3E01B 2V67A 1JLCA 5IV4A 3X1LB 3A5MC 3FMWA 4WWSA 1WOOA 5BRDA 1WC1A 2KKZA 3N4WA 3FLCO 3VF6A 4B3TK 1VRTA 3QNWB 2ZNZA 4M41A 1PYTA 3D6RA 2MQPA 3OT9A 4GNIA 2D41A 3G6EN 2RN2A 4CESA 1S1UB 3CQXA 2RMLA 4DSFA 4DTJA 2HHTA 1YJUA 3VF4A 4WF9L 1KQKA 4JK8A 5L46A 4ANEA 1FEHA 2P9LB 2V4JB 3WQPA 2DKOB 3UCZP 3H1QA 1BISA 5IT4A 2HQFA 2M8HA 1KC8O 2CGJA 5I3UA 4ZVUB 1VBYA 3DAWA 4ILJA 2MZ1A 3U7JA 4IO1A 3HSGA 1WSIA 4H4KA 2XY7A 1RDCA 2DGSA 1XNRJ 2GUPA 3LZJA 2MZJA 4MT1A 4A61A 2QG9B 2MEWA 3AO4A 1XI1A 5HVFA 4BREA 4X4PA 1D09B 3FCWA 1FW6A 3W2VB 3POTB 1LWEB 4JI7F 5D4PA 1MWMA 4DV0J 4OHXA 3ENAA 4R5PA 2P9KB 3KLIA 1LEOA 3C6TB 2VOOA 2FLPA 3ULEB 2Z2ZA 4NI2B 1IBMK 2J0XA 3AA5X 1H6KX 3TX0A 4EK2A 2ZH7A 4HACA 2Z8QA 2JLEA 2AJ4A 3O1LA 4JV2A 4I6AA 2FF3B 3BYRA 4W5QA 5DDQC 2RPIA 2FHJA 4ZDNA 4CVNE 2VG7A 1UEUA 2I6WA 4NLPA 5ELZA 3I56N 3SSSA 2F9DA 4G6VB 4MIWA 3V1QA 4M3XA 3BDPA 4BS2A 4JLHA 1TTHB 3OBWA 3LOUA 3D0PA 1GQEA 3NNAA 4HHHA 4CE9A 5BR8K 4C8YA 4N41A 3CE8A 3EVWA 2PIIA 1NGCA 4PWWA 2ZFHA 3D0HE 3VTHA 2BE2A 4ZN3A 2ATQA 2HNYB 3PXGa 2Z2YB 1S5JA 3GG4A 4FOEA 3TVZA 3MEDB 1HBUA 3VQDA 4NCGA 3CF5Q 3D6MB 3RB3A 5BREA 4FSVA 1FD2A 4D3GA 5M2PA 1BL3A 1ZAWA 3QDKA 4EMDA 1UFLA 2QK9A 4U7UK 3LDQA 1N6QB 1R7IA 3L9ZA 4NLQA 2C3MA 3BY5A 3HSZA 2I2YA 2DHSA 2HHPA 5GMEA 1FRJA 3E9OA 1I94K 3DLJA 3GFYA 4A57A 4TQSA 2O3DA 2NPFA 1LXJA 1X4GA 3M6XA 1LQ9A 4LJMA 2ZUGA 3CCJS 5G0RA 3WXMB 3AGRA 4PUOB 3ENHA 1RHQB 4M7XA 2KTQA 3CPWM 1RAGB 4RUBA 4X4VA 4NLYA 3ET6B 3ZZTA 2QYCA 1FWPA 2PA3A 3VEVA 5D0GA 2B4VA 1HMVA 4FBUA 1B70B 2Z2LA 1IBLK 4NLTA 1UVIA 3SQ2A 1N0VC 3P1GA 3OL9A 5LM7E 1HYVA 9RUBA 2EKNA 3MN6A 3ADAC 4WFNQ 4XH1A 1LAVA 5DZ7A 4K42A 5DDOC 1WAFA 4EWTA 4AHUA 3I0SB 2VKZG 3IR5B 4BRMA 1X0PA 5KQ8A 3EZWA 4WP3A 1XNRF 4K4WA 4B9UA 3LGHA 2R8HA 1KAYA 3MXMA 2RQ4A 3UO0A 3BPSP 4BG8A 3OYNA 2DT9A 4KGZB 4CH1A 2V0NA 3AVMA 1VQ5S 4BR7A 4W92B 4CZHA 1TKTB 3GB0A 4M5JA 5BRHA 4DV0F 3UI3A 2NQPA 3I87A 5T14A 2K3KA 4MLHA 1GLDG 2NPIA 4OMFG 3QRPA 1YXQA 2OTJS 4USVA 3UN3A 4FF3A 2AJ1A 1AT1B 2V94A 3HSDA 1AA1B 3DNCA 2W7PA 3MM8B 3NE6A 2MXYA 3EY1A 4ECTA 3AVKA 3C3LA 2N3OA 4NXMJ 2HAIA 4F4ZA 4HTLA 4DHYA 3H8YA 1RWNB 3OW2M 2KXNB 4LF4J 4MTPA 3D6HB 3GWCA 1M1KT 1RQ0A 1TAQA 3E9PA 4B9MA 1HARA 3HYFA 3VQ8A 1ZM9A 4IDKB 5EUHA 1NK6A 1UEVA 2QL9B 2EI5A 3AODA 4G1PA 3CCEN 2WVBA 3K8WA 3UKRA 5AFUA 2UXCJ 2LU2A 4JV0A 1J53A 1RHKB 3D4JA 4Z0UA 4WYBA 4E1MA 4DEZA 3TA2A 1C0FA 1CC8A 3ALYA 2G1DA 5IZHA 4DL3A 1IBMF 3OL6A 2ASOA 1UA0A 4J5OA 4B3MK 5FPMA 2ALYB 2B0GA 4CEAA 1HPZB 1QY7A 5LMUK 4P72A 2IOCA 1U1LA 3P38A 4H5WA 3CFPA 2YKOA 4JN4A 2CQIA 2W9CB 2GQQA 4CFDA 2AV5A 1X4AA 3TTCA 4DOZA 4RW6B 2HKEA 4IH7A 4M5NA 2NLXA 5J2MB 1R0BG 3JSYA 3TARA 1NGGA 1WI8A 4F4YA 2ASYA 2PFUA 4EU0A 4DF4A 4LFAK 2ZDOA 2JGUA 5HVGA 4OLOA 3UN5A 1PGZA 2M7SA 1CPZA 1K8KB 5CCLA 2O8CA 4KH5A 5KFIA 5IM0B 3SK3A 3K7RA 4FLTA 5DJBA 5I4MA 4F4WA 2PI5A 1I94F 3CDAA 4JYAK 2R42A 1QUPA 2NRHA 3QZ8A 3MMVA 1BLUA 2JJ4D 3GIRA 1OY9A 1C1CA 2WC9A 1XMBA 1YTUA 2EFQA 2EW9A 5D4OA 1QQCA 2MHEA 3GYNA 5M1KA 4DCJB 1ROFA 4ZVHA 5H9EJ 3OQ2A 2C2RA 3KWMA 2GWKA 3AVGA 2B9WA 1NK9A 2GS8A 2D0AA 4RZRA 2NRRA 2NXEA 5EWEA 1X4EA 4NXMF 3C46A 1CLQA 2HK2A 3CJBA 3DU6A 1UAWA 3AY0A 2UU9K 2WW4A 3EE3A 4RW7A 2OPPB 4LF4F 2EBGA 4XAKA 5K14B 1H0HB 4QWBA 3I96A 3QFHA 5JVGL 3BF1A 4KAZA 4ZPDA 5L9NA 4C8LA 3U9ZA 2DIVA 3UW1A 3H3OB 2BM1A 1ILYA 1Q8IA 2EWHA 4RW4B 1YT3A 1YIJN 2HFUA 4JYAJ 2FZGB 4UOFA 4TKTA 4MYUA 5AQZA 3MDQA 2UXCF 2QKBA 1OSCA 1FWLA 3EXCX 2CVEA 1SXLA 1BQNA 2QEXS 4K2XA 5KI6A 2DRDA 2CZ4A 3ZTRA 4OO1J 1N5YA 3KLHA 4ZIWA 5HANA 1P9QC 2ZH5A 2YX1A 5AJ3J 2BVZA 4IFEA 2QE5A 3MWPA 2VODA 3CFOA 2RNEA 4GMKA 2PE8A 1TVRB 4B9VA 2QL7B 4KH1B 3KZBA 1C4CA 4CGDA 2EHGA 4LSLA 1X5TA 2YQ3A 1SJ3P 1VIOA 2AZ1A 2E20A 4WE1A 1ZM2A 3D2EB 3G6VA 2ADCA 5HROB 3DYAA 3TAMB 1DY3A 2DR5A 4A2BA 1L3UA 1RAHB 4ZLJA 3D9BA 4TN2A 4TU9A 2ZH6A 3CC2S 1A6LA 3PYDA 4ICLA 3PR5B 3MCPA 4DPXA 1D4XA 3UDLA 2R9LA 4CD3A 2YKNA 2WBNA 5HBMA 3OTOJ 1D0EA 2LEBA 5L1IA 3G4SS 5CYMA 4G9ZA 1NHKL 4ERDA 2D3O1 2XI2A 1RT3A 1NU0A 2CPIA 4P2MA 1GOAA 1NK4A 5KFEA 4UY85 2M4MA 1IG8A 1YLXA 5KFOA 2NNWA 1T3NA 3MR6A 3U3GA 1BIUA 3CERA 1ZBTA 4C0BA 3UB5A 4NXNK 1UFKA 2MZSA 2ZM6J 4DU1A 4QYZK 2YBVA 3IR6B 4FJGA 1VI7A 3V9SA 3O1BA 2Z58B 2ZOFA 3MD1A 2MKJA 3T69A 3NS5A 1G4CA 2CNKB 2HHHK 3IBCB 3TOQA 2E1CA 1VQKN 5I3PA 2G8KA 1VISA 2M2BA 2V2ZA 1FX4A 3TTDA 2XZWA 1AZSB 1CJUB 2J4RA 3MM5B 5F8HA 2JWNA 1DARA 4P74A 1UVJA 4DV1K 3IC1A 3HJFA 4D3HA 4QAGA 4BR0A 2HB5A 1VQPN 3V6DA 2B9EA 5EU7A 1Q7LB 1WG1A 4DSEA 5DLFA 1X0FA 1V3SA 4CEDA 5I9EB 2P9UA 2NZ4A 1W25A 4CRJA 2CG8A 3J81U 2PMHA 2QIFA 1TV6B 4JYAF 1RU2A 2DISA 5A6PA 3SSRA 2D1CA 4Y28C 4WFZA 2OZSA 3ENOA 3B54A 4EEYA 3NF6A 1FE0A 3QT8A 4MKBA 2H9ZA 1KP6A 1FFGB 3SSQA 2BANB 4MKYA 1ITGA 5AJ3F 3T5JA 4L75A 1D9FA 4E1JA 3L3VA 5E7OB 3A3OB 3CCRN 1SJQA 1BC6A 4GV6A 4O0NA 1WBBA 4M5MA 1UVMA 1VQ4S 3KK1B 1NJXA 1V6HA 2NR0A 4U95A 1L3VA 5M1QA 1OH7A 3OPKA 1BDGA 2FBYA 5AE1A 3FFIB 1WWHA 4AM7A 1D1UA 4DLEA 4LF7K 2BKOA 1UA1A 3VGUA 3I55S 2QA4S 3V9UA 3VAGA 2KKHA 4DB3A 2RQCA 1SCJB 1YJNN 4R0JA 1N32K 3OTOF 1BUXA 1FX2A 3MM6B 1BOTO 5HLFA 3R5BA 1MMNA 4KHUA 4IG0B 4JRQA 2OEMA 1C0MA 5J2NA 4OLAA 1FK9B 2ZJQQ 2LDIA 2JSXA 2Z1GA 3FZKA 4H0VB 5GAHU 4QWCA 5KTQA 1NM1A 4JI1J 2AA4A 2JLGA 4IR9A 2Q97A 1P1TA 3AT1B 4DQQA 1FO1A 3DRSB 1ZPVA 3W2WB 1QDUB 3J80U 4IO9Q 3NGDA 2ZM6F 2CQ4A 5BPLA 5M2RA 3A8EA 1KOOA 3J80O 5JMNA 3VA0A 4HDGA 1FVQA 1YUWA 3CQYA 1H38A 4BCAA 4RWXA 1JLBA 4UZBA 2QLBB 4JI4K 4LF2A 2QWOA 4ILRA 1E6VB 2UUAK 1EKEA 1RISA 4OQJA 2KHDA 4K8ZA 2AIRB 3LF0A 3MI7X 4Y00A 4M1KA 4YY3J 2I38A 3O3GA 2HBMA 4KO0A 2QLXA 4Z4CA 5KT3A 1S72S 3TX8A 2CJBA 3HPGA 5A6WA 1CJVA 1WC5A 2CKWA 3S3NA 1FRIA 1JL2A 4MYTA 4CK2A 1O51A 3ZC4A 4E19A 3VTIA 2Y8YA 4WK3A 2ZE2A 3GFHA 1CZAN 4UW2A 2QFJA 4CO3A 3HK2A 3HULA 2CQCA 4DCHA 3T19A 3N0VA 1FCAA 4CJ7A 4F7VA 4NXNF 3KWIA 3Q8UA 1VQ7S 3MCAB 3P31A 2WCXA 1N8RT 5LJWA 3DXKA 2DO0A 4NWBA 1PO6A 1DBDA 3F9MA 2MSSA 4NRUA 3GDQA 4RBUA 4JI4J 3OFHA 2Y3YA 5KFVA 1NGAA 4JNEA 1ZZFA 4J9KA 2XEXA 2D74B 3AOCA 1W26A 4AD6A 2V2QA 6FD1A 1UVNA 2Z1IA 2G8HA 2VZ9A 2BYCA 2XSJA 2GFFA 2E1AA 1EZZB 4Q0BB 1NKCA 2OEKA 5C5JA 2X1AA 4CIOA 4JV1A 3CM5A 4DV1F 1U6ZA 3HHDA 4RNOA 2XHCA 1VIXA 3DRPA 2QWRA 3RBZA 2G2OA 3NCQA 2NCKL 4NYOA 2VA2A 2HVIA 4TY8B 1VSMA 4W5OA 3SQ4A 4NEZA 3MCOA 3BO4A 5J2PA 1FJ7A 3SAHA 3EGZA 2OYQA 2HHUA 3R5GA 5K9FA 2VBZA 2GVZA 2OFHX 1RTJA 2D3UA 2CJXB 2G13A 3NGRA 3NY0A 5K20B 2XCAA 1HBOB 4E2FB 4DLGA 4JI1F 1A5WA 4XK8C 3OHAA 4ZJQA 2A10A 4CJKA 1SC3B 4K4TA 2DHXA 3CJQA 1F5CA 2JEIA 3LP2A 3IO1A 1ASUA 1YTYA 1REVA 4FXWA 4ISEA 2UP1A 4BC7A 2F65A 8RUCA 4OYPA 5BPMA 4UTGA 2BXJA 4B9TA 3GE9A 4ED1A 2VWKA 4BDYA 5J1EA 2HF3A 1KTQA 4FLUA 2ZWHA 3CETA 3A8JA 4BLGA 1GOCA 5FLXO 3HTVA 5AZJB 1VQ8S 4GC7A 5LT5A 4OPKA 2LU1A 3DDNA 2AYGA 1Y10A 2OPQA 1YHQS 2IVOA 4KFBB 2W42A 1YJ9S 3LANA 2FJBB 2RDDA 4YY3F 2VA3A 2RD5C 1UJ5A 1QAIA 3Q8PB 3NMUA 2B8QA 3LZIA 4JK9A 2UVWA 3SYZA 4RW8A 3HFKA 1JJCB 2ZBQA 4AF1A 5KPTA 3EMTA 2BQRA 3GG1A 2ILZA 4DL2A 1YJRA 2DNGA 1S6UA 2WSFC 3G2XA 5F8NA 5DQIA 2C2EA 5GIPA 5C24A 4E8UA 3WIVA 3KUEA 2C3OA 1KOHA 3CCVS 2HBKA 4B1YB 1PYOB 1S57A 1U2VB 2ZJPQ 4TSXA 2CVIA 4FF1A 4Z4IA 1NSAA 3EN9A 3OYLA 4PPDA 2FLOA 5KFRA 4F2RA 3HI0A 4CP5A 4FOIA 4DR6J 1S0OA 3CD6N 3ULHA 5CZXA 1P9YA 2D4WA 3RW7A 2H1YA 3CCUS 4Q43A 4JI4F 3JYTA 1UEKA 1TL1A 4W90B 1RK8A 4JI3K 5EOYA 2XS7A 4WCEQ 5EWGA 1K8AO 1U1QA 4CLPA 2AP6A 3KJFB 4M5HA 3Q89A 1TZ0A 4QS7A 1T11A 4CK3A 1DQ9A 2XB2D 3EZUA 5GAEU 2W4CA 4C11B 5C2FA 3WT0A 2VOPA 3ILJA 4GW6A 2W01A 1V5VA 4DV4K 1MWYA 2UXDK 2NUHA 1MROA 4FJJA 5BXIA 3QEXA 1FTCA 1RT6A 3LWMA 1FKPA 3EKSA 3PW5A 2O1PA 3DRRB 1J5EK 1FKOA 3QBXA 1S6OA 4UUXA 2R7WA 3V6KA 1M5KC 5MLCV 2AGQA 3CF5L 3TABA 3HSCA 4Y34A 1VJQA 1FFSB 2CQ0A 1TYQA 2NSCA 5LXRA 1WELA 5F8GA 4OV1A 3ELHA 4R25A 3I0RB 2VC1A 1YK9A 1H74A 3VQTA 3PACA 1RSCA 5BRFA 2F63A 1X4CA 5ETNA 4JI0K 3J7ZT 2UUTA 1UWBB 1WLJA 4BRFA 4CNYA 4JI3J 1TELA 2GGPA 2XRIA 3C14A 1J27A 5DDPC 3SFGA 4GKJK 2EEYA 4ZVTB 1LWFB 1A5XA 4OHWA 1FRHA 1ATNA 5KG7A 4H4OA 2CPJA 5DQHA 3AJ1A 3TEGA 4RNFA 3VETA 4FZZA 5C10A 1RAJA 2E9TA 3SBMA 2IIHA 3MR5A 1J5EJ 3MMCB 4B1ZA 3BV8A 2DNYA 3KG1A 3MAHA 2EPIA 4RR5A 3THXB 3M2VA 4QW8A 1GLCG 3E9LA 4KBIA 3L7PA 2J9DE 1QVFR 1Q9XA 4MK8A 2IYIA 4CECA 1YSJA 5MAOA 1JX4A 3FQKA 5IT9U 5IT9O 2MQMA 3PYEA 3DMJB 2VUGA 1BU6O 4ZJLA 3WNEA 3A0IX 2FC9A 3AO5A 1VQ9S 4OI0A 3O6WA 4GKJJ 2OGUA 5D3GA 1VCTA 4KE5A 3OVSA 2K1RA 4UOGA 1ZA1B 2G8IA 1CXUA 2A6MA 1IWGA 1ZPWX 4E7KA 3DHXA 5LL6Z 5C42A 3LPYA 4DG1B 2YNFB 1K73T 4HDHA 4F3OA 5AFUH 3QAEA 2EG1A 1CG2A 2G8UA 5CXTA 4LF6J 4RNHA 5SZTA 4WXWA 3KLGA 4OYBA 3AAQA 3V9XA 3CJAA 3KKFA 4IWVA 3CO0P 3M2RB 4CZEA 4I2QA 3D6TB 4RUHA 4K4SA 2YCHA 2FHMA 1VLOA 1Y3KA 2X1BA 3MM7B 4I0WA 3KFWX 2W9AA 1ZBSA 2PEBA 3BSOA 1FNMA 1SKRA 5GAGU 3QIPA 4DU4A 3F0NA 4C0HA 1KWMA 1JMTA 2C3PA 3CCJN 3FSYA 3E3XA 1NAQA 3MEEB 1YZ6A 1NBWA 1WSEA 2PBDA 3KVGA 2M9KA 3VAHA 3V4IA 4YOTA 2IRXA 4B9LA 2XMAA 2XLJA 3PIPQ 3AXKA 3C7NB 4I6WA 5KG0A 3CD5A 2XO7A 1DEJA 1KKHA 4JI3F 5DO2A 1B7FA 1RT5B 4LVOP 4C4WA 4KT0C 2DH7A 4JHDA 3P8BB 4BROA 2EBEA 2M3DA 4RLEA 5GAHI 1H2UX 5AQVA 4J2EA 2QZ8A 3TAFA 1WHXA 4OHVA 1L3TA 5HRSA 1S1TB 1CJKB 4IFYA 4FJ8A 1LOTB 2DR9A 2UXDF 5ADXA 4AUKA 5D8HB 1LW2A 4X66J 1XUPO 4USHA 3JXUA 1R0AA 3FSXA 2AYMA 1J5EF 3ZYYX 4N76A 4KHWA 2M0GB 5KFWA 5ETSA 3PRDA 2GJIA 4M45A 1C0UA 1IQTA 3PW7A 5F0XA 1VQMN 5E3AA 3G8TA 3H7HB 4OPHA 1QHTA 3OFEA 3M8PB 3PX0A 2JC1A 2O8BA 2XHWA 4F67A 2E6LA 2GA7A 3ZSRA 1IG9A 2BKNA 3H45C 3ZSZA 2IM0A 2FGCA 3I32A 4DJBA 5DM7L 4ECUA 1RTDB 4LRDA 2BRLA 3GU0A 1VSDA 1BGXT 3T7ZA 5GADI 1WHWA 4MFBA 4GKJF 1KSPA 1X4HA 1P8GA 1HNIA 1YJTA 3FGUA 1ZM4A 5JXSA 1IKYB 4GKKK 4CD1A 3ILLA 3CCQS 1N88A 2DRAA 2KG0A 2AMCB 4F3TA 3R1HA 1DTTB 4LF6F 3IAYA 5HK4A 1HHTP 4Z7CA 4OHZA 1FDBA 3KUGA 5JLFA 4KBOA 2OMOA 2FJEB 5KFQA 1YRXA 4DR2J 3U1LA 3MMAA 2NRWA 3V2UC 4DQIA 1RAAB 4Z7YA 1YJVA 1WD6A 5C2GA 2QWLA 1RLCL 1N34J 1D8ZA 2QTWA 3T1YK 1VRQC 2B4PA 4BDPA 5A2QU 4WBFA 4FW2A 3RJMB 5A2QO 2FZCB 2R7XA 3MEGB 2LQ9A 3AO2A 3SQ0A 4U9RA 2DFHA 2FJXA 4G1QA 3D54A 2CQPA 3R5CA 4RBTA 3DDKA 4CHOA 2ZBIA 2LMIA 4WFAQ 1YX2A 4CZGA 4GKKJ 1CXQA 1KDNA 2CH5A 4H03B 2JOQA 2WBMA 3C0BA 4C8ZA 1HNVB 4A8QA 2WBRA 3V81B 4I6MB 3KMSA 2RQKA 1HI0P 4X4RA 1X9JA 3Q2TC 3CTRA 1Q18A 1ACMB 4CZJA 1N56A 1CS4A 2EFVA 3UFCX 4CHNA 1ZAVA 3I4PA 1OWXA 2YNHB 2OP5A 2NRXA 1AXQA 2KL8A 3AFGA 4QR0A 4X66F 4DV5K 4BE2A 3GTYX 2A2CA 5BN9A 2UUCJ 1HWJA 4DX5A 4P7VA 2ZZTA 4BGAA 2IGIA 4P71A 3CB4A 3HVAA 4B1VA 2RDIA 4NO7A 3AJDA 4CERA 3DOMB 3R9PA 4A8XA 5E33A 1OQ6A 3K57A 2YX7A 3DDIA 2X3DA 2YJFA 1H2VZ 4CI0B 2A1BA 3SBTA 3UE2A 2YQ0A 3C15B 2WVDA 3QEIA 1RHJB 3F73A 3AA3A 1F5BA 1WC4A 2CPDA 4MIAA 2BE7D 3MPWA 2VCPA 2CQGA 5F8IA 2K7KA 4TNOA 2HW3A 4PWDA 4RCHA 3SUOA 4ZCMA 4DR3K 2HF4A 4KPYA 1J5OB 2DR7A 5IWAK 3G6ES 4JB8B 1O1WA 1V4TA 2F3JA 4J9LA 2JEFA 3G87A 5A8WB 3H4BA 4PL8A 1I3AA 1RT2B 5HJYA 5HVHA 2PFDA 3E1YA 3FZFA 3ZSWA 4J9RA 2MB0B 1X4DA 4K25A 5HL7L 4NLWA 5KFLA 2DGTA 3D2FA 2ZC3A 1T95A 4NASA 4ECRA 2YH1A 3ATVA 1QSYA 2P5OA 4HI2A 3C66A 4O3OA 5CHIA 5CZ2A 2WTUA 2DXEA 4B3OB 2R7SA 2ZH9A 4FZXC 1EB0A 3ENVA 4DR2F 2QEXN 1JNZB 5KPRA 2V7ZA 2RU9A 5E0OA 3KHGA 1AW0A 3D7SB 3LDLA 5GAEI 3OYFA 4Z2XA 5C2CA 3PG9A 4F25A 1N34F 5TKYA 3NLCA 5CYJA 3AOAA 5DM6Q 2LEPA 2I7PA 2XMVA 5B8HA 4NLVA 5IV3A 1HD1A 2DRBA 2ZF5O 1U2FA 3H5XA 3M8WA 4ZP6A 3MR3A 2QL5B 1RBVA 3BO3A 4ZVPB 2QFIA 3MPYA 4M63C 3THYA 2YNGB 5K8OA 4GKKF 2VG6A 2DD8S 2XMWA 3CD7A 3Q8YA 2O01C 5C25A 3IA0A 4KHPK 4PYAA 5B7WA 2KRBA 1TUGB 3I56S 3QINA 2F9JA 3JTPA 4B08A 3QMQA 2XYHB 2UUBK 3S9HA 2J0SD 2GO9A 3CULA 1RBOB 3S7RA 2IBOA 5FPNA 2JWLA 1TUWA 4DTNA 3AA8A 2UUCF 2PEHA 3SBGA 2ZGZA 4MQ3A 3HHLA 1JLQA 1WEZA 5EVZA 2A3JA 1V3RA 3WUHA 2DCLA 3K2PA 2RB7A 1RT1B 2FB0A 2GUIA 3EGWB 2AJ2A 1LCUA 1YRTA 4CJVA 2Q79A 3MUMP 2NUBA 1TKDA 2ZJQL 2HHVA 2K7JA 4NLDA 5KFGA 1NKBA 3L09A 3N28A 1Q8BA 3JSRA 4EFHA 2XC9A 1IKVA 3UDVA 3MCMA 3KLFB 1WG4A 5DGBA 3KHHA 4ECVA 2F8EX 2RF2A 4KHPJ 4OX6A 4F9OA 1NMDA 1QE1B 3U6FA 2W8LA 4I9LA 5BJRA 4PWUA 3LA0A 1RT4B 2MGZB 4BY9C 4CLLA 4ED5A 4A59A 4DKWA 2MZQA 4TU7A 1FJGJ 2PC6A 2EG2A 1C0TA 1T9TA 3OL8A 1E6YB 2OI2A 1KVCA 3SCJE 2AHOB 2HQ3A 5KFBA 4JD2B 5AQHA 3HBTA 4KGVB 4AXJA 1KQGB 2C42A 3M30B 3O9RA 3FZLA 3QGPA 3EKUA 4QIEA 2OTLN 4I7FA 1VRTB 2DK2A 1SH0A 4DV2K 1R89A 1OKJA 3CG7A 4OKJA 2FSKA 4CZMA 2YHWA 1SV5A 3GR1A 3C6UA 1X4FA 2PFFB 2J6SA 1RAEB 4J9MA 4CF9A 4HH0A 3B4MA 3NBPB 2G8WA 4Z4GA 5FLXY 2BEFA 4DR3F 4EHUA 4A48A 2HQCA 5I3UB 3HRGA 4CIEA 4EGLA 2FZKB 2EC0A 3B8AX 5RUBA 1ZC6A 3R7SB 4B9QA 1CULA 1YAGA 2C28A 3GILA 4OIXA 3F9KA 2HWHA 4O4GA 4FPAA 1NK5A 1Q82T 2QW9A 1U2RA 1JNRB 2OCEA 4FF4A 4ED7A 4CJ3A 4H5NA 3N01A 2R2UA 3R8EA 3CJKB 2B5JB 2A6AA 4DV6K 4DV2J 3R2CJ 1BWVA 3O9QA 1RTIA 4IOXA 3HZEA 2RHQB 2W2NP 1S7HA 4J90A 4ECZA 3HHEA 4NA3A 4B02A 3FE1A 4RKUC 4CJLA 3EDRB 2L48A 4X84A 3CW2C 4JI2K 2G8FA 3LDNA 3L3CA 4KGXB 1OS5A 3VEXA 2QJ3A 4OX9K 2V7YA 2VG7B 3M8ZA 4DUYK 3CJ4A 3BJYA 1SL0A 3CCES 2LQJA 3G10A 4KHSA 1PBUA 1S1WA 3O4QA 3CJ9A 3BGRA 3TQEA 4GV9A 2CNNB 1U0HA 3KYLA 2BQUA 1Y5NB 4RU9A 5JUMA 2A42A 1UPMB 3W61A 2EFOA 3TW0A 1YZ7A 2ZWPA 1WKJA 1GLLO 1TL4A 2XNQA 2BABA 4DSLA 4KHPF 2XMKA 2JEGA 2JWKA 4UZCA 3PY8A 4OVLA 4WQ5C 1FJGF 3EE9A 2QO3A 1NO8A 4OYMA 3KJVB 4ITSA 2JZ5A 3WDOA 5M1NA 1J6ZA 3QNOA 3OTEA 3BKFA 4HUEA 2Q6CA 3CJCA 3OYBA 2OSQA 4JI2J 1O0PA 3M2UA 3ZFVA 2D5RA 4F02A 1TUYA 2QM1A 5B09A 3VESA 2EFNA 1U04A 3KNGA 1S1UA 3VVUA 4O3NA 5G0RB 4PR6A 4DUYJ 3I5CA 4L74A 3ZZUA 4U7CA 1VR6A 2DPJA 3ZX3A 3CCLN 2CYYA 4K4YA 3VQEA 2W2OP 1X9SA 4X62J 3K5OA 2V4JA 2P9LA 1T6CA 1VQ7N 1EXQA 4LVNP 2AGOA 1VBZA 3K9KA 4FWPA 2XY8A 1NHVA 4AHSA 3Q2SC 3OVNA 1C1BA 4FL9A 1VAZA 1LV5A 1RWOB 1B9FA 3VGLA 5LL6d 4FJKA 1OIAA 1LW0A 2P9NB 2LA4A 3H59A 1HRHA 2BGGA 2N4CA 3ISZA 1IR1A 2B3TB 3V1RA 2FY8A 1JIHA 3O9TA 5CH7B 3POTA 1LWEA 5ETPA 4OYOA 4RO0A 1HKBA 1OPZA 1SUQB 3TQ1A 4YR3A 4WCEL 3I8BA 3ENQA 4EHTA 4IR1A 1NPKA 2E4LA 4S0MA 4DV2F 4ZPWR 1O6XA 3M9OB 4P7TA 3V9WA 4RWTA 1FXRA 2BX6A 4WQ5A 4LF1A 3QICA 1VMBA 4KY3A 3AVHA 4OJRA 3VQ9A 4GVEA 4ED4A 4IQXA 5SWMA 2XM3A 2UXBK 1RWKB 2QA1A 4KYZA 3QT5A 1YIJS 1OY6A 3BZKA 5C7PA 1N54B 4C97A 2Q43A 2KM8B 1R3NA 2DYAA 1SJ4P 1Q5VA 2DGVA 1X3NA 3ZT3A 2K2PA 3RRHA 5LJ5Y 4F2SA 2W41A 4N8OA 3UR3C 4MJKA 2HNYA 5L39A 1EIYB 3TAQA 2IJFA 5CYQB 3C94A 3MEDA 1Y00A 1QAXA 4F36A 2VJVA 4URQU 3DOLB 3AOBA 1VQ8N 2WTFA 4V19J 1R8HA 1WTFA 4I6YA 4CFCA 5FDLA 1YHQN 4J2BA 1KQFB 3TZYA 2KXFA 1SC1B 3UKRB 1HUXA 2YNIB 1N6QA 3AD9C 3KHRA 4JV5J 2FHOB 4LBHA 4IRDA 3BZQA 4TLRA 1FI4A 1T94A 2LYVA 1C4AA 2ZHBA 3BF4A 3GSIA 4YHHJ 4JI2F 4UT4A 3JTOA 4ZA1A 4PUOA 2FVQA 3HHKA 3TJ8A 2YWEA 3ET6A 4DUYF 3UE5A 4ED6A 1IN0A 3CCVN 1TK5A 1NBEB 2OMLA 1S48A 2HRTA 3NH1A 2HQIA 4X62F 3VAJA 5H9FJ 4CIFA 1WUUA 3C16A 1R6YA 3FVYA 4H5TA 2NRZA 3NOCA 4KKOB 4CO5A 4BBYA 1XBWA 1C6VA 2QLFB 4H54A 4B8CA 1U1NA 2DHAA 3O5BA 3NGTA 1CBKA 2W6KA 3QETA 1F3VA 2HS3A 3OTCA 3I0SA 1J2VA 2YHXA 9ATCB 1W0HA 4DTMA 1QVGR 5LJVA 4RU2A 2MZRA 2EC2A 3AAPA 5E26A 3RYLA 2VG5A 4C0OC 2O8CB 2ABYA 1NCLA 1SB6A 5B0CA 5KT2A 4ZP8A 4YB7A 1IH7A 1N36K 2VQEK 1JLFB 1VQKS 4DR4J 2D9PA 1S12A 4DQ8A 3G9CA 2M52A 2G9OA 1NJWA 4YDUC 4O3SA 1RB0A 8AT1B 3L6QA 1VQPS 2UVVA 3J8AA 4OYZA 3MM8A 2VFUA 2IVPA 2RE1A 2I1RA 3ZNUA 2X78A 4ZLLA 3PYGA 5EY4A 2DGXA 3SXLA 3IAM9 2Q3PA 1ZYQA 5LY3A 4KRWA 4LF9K 4CJWA 1YVNA 3Q7BA 5L1LA 4OX7A 3VAIA 3RG6A 2DNPA 4DTRA 4HUGA 2G2YA 5CA5A 1VSEA 3DGPA 2E1YA 3RUBL 3FEYB 3THVA 3PIPL 5CQGA 5HI7A 1PG5B 4OI2A 2YTCA 2YPZA 1K0TA 4M8LA 5TKWA 1KS2A 4CEFA 4JV5F 2VU5A 4I9QA 2AT1B 1WF1A 1F0XA 2W1BA 3HKZD 5A2QY 2NREA 3ZZYA 1RXOB 1RHUB 1HPZA 2QT7A 4PYDA 3DOKB 3WQTA 2HQGA 1WSFA 3PFOA 3SCIE 2MQLA 3RR8A 5FRMA 1UOCA 5KFXA 4NMLA 2J6TA 2CADA 2ZVSA 1OYDA 2PYLA 1KVIA 1GXTA 1UPPA 1EKSA 1YJNS 1WHYA 2EVZA 4HL9A 3UKUB 2CQ3A 4LF9J 2OPSA 5B0FA 4RW6A 2CQ2A 2J9CA 2MQQA 2B9XA 2GCFA 1NOYA 1VC6A 3HM8A 5I42A 4AYBD 3DYAB 5AQKA 1MDUB 1T7PA 5J2MA 3IWLA 1GLFO 1SKUB 3KMQA 4FKYA 5JJBA 3UCUP 4XTTA 5AQPA 2W7OA 4DZDA 1WNEA 3EE8A 1XHZA 2QC3A 4ICLB 1VK3A 4DS5A 4FK2A 3VN5A 1X9MA 1RCHA 3KIOA 1RWXB 1K8KA 3FFKB 2CWKA 2MLZA 3H5UA 2PYJA 2ERRA 2ZGYA 2QXFA 4E7IA 3MEKA 1RWMB 1YGYA 3M1VA 2E5JA 3QESA 3T41A 3L2VA 2M5YA 3PZPA 3CCMN 4CJEA 4IG3A 4FM1A 1WORA 3WHIA 4DR4F 4Q8EA 2M8DB 2OSRA 4IBNA 3ILOA 3KLVA 4LFBK 4CHYA 1KFDA 3OYHA 2ASMA 1RWPB 1N8RO 2ITGA 2C3UA 2IC3B 1ASWA 3R3LA 2QMWA 4FNHA 3IRXB 4MK7A 4KJIA 4N47A 2O8EB 1Y5LB 3SQGB 1JJ2R 5C2DA 4YR0A 2Y1RI 1N5SA 2HZCA 4C3LA 2OPPA 2C2NA 4TLQA 1TKXA 4FWLA 2CJ9A 3OSPA 3ZX2A 3FBBA 1HWIA 1SC6A 4TXSA 5D15A 2CFXA 4AHVA 3ONQA 2FDNA 3V1OA 2OPRB 4CZIA 4WFAL 1U1OA 2P9UB 2RHKA 1H3DA 3QGGA 5JICA 3CIPA 2HGMA 4A8SA 4NLBA 4QU6A 1WF2A 3R3TA 3GPAA 4LH4A 5CCMA 2VD3A 1HYSA 4LFBJ 2FSNA 2W4PA 4FVMA 4USMA 1NK8A 3IS9A 1APSA 3MN5A 4Q45A 3DI6B 3PVXA 2EFGA 3W9JA 1TVRA 1AFIA 2HOEA 3CJ2A 4USTA 2RIJA 4WQ4C 2O8DB 2PY5A 2H65B 2F7VA 3GCXP 2DFEA 5DMRA 3D2EA 1IJJA 3HHNB 4LF9F 4IZ9A 3TAMA 3TVYA 4PQUA 1OSDA 4J7CA 1RTHA 3D45A 1TFWA 5HN0A 3ID8A 1UW4A 4OGEA 4B8AB 2F5GA 4ID5A 3FEXB 2WB4A 1FRKA 1SIZA 1JLAA 4LF5K 3MMBA 3JXOA 4LR7A 3CJ5A 4GVMA 4HHJA 1EQ0A 3Q83A 4U67Q 2AEJA 3OYMA 2OUGA 1QZ6A 4HCCA 3A8KA 5IQ6A 3RMBA 2RRNA 3TANA 4P2XA 5IC6B 3LDPA 2B6AB 3CWJA 4ZOSA 2P9SA 4AH9A 3JSMB 4CJTA 3MWBA 3RB6A 3D1HA 4UY8T 1KRPA 2ZHAA 3RAMA 1WOQA 2MKKA 3MUTP 1U48A 2A1SA 1TUVA 3KG4A 5KAKA 3BDEA 3NVMA 1T9XA 2ZKTA 3L2UA 4I56A 2J8SA 1S4FA 2HFVA 3NS7B 4ELTA 3K9JA 1PIEA 2G4BA 2E1PA 1Z25A 4YQWA 2WONB 4CTAB 2VHGA 4FJ5A 2F8SA 2MJUA 1CJUA 3TSQA 3MM5A 5DM6L 1WEYA 1ICEB 4U6PA 1U1KA 2VQFK 5KFCA 1QQMA 1WNSA 4O44A 4CWBA 2WOMB 4WQ4A 1NGFA 1U2CA 4DR7K 3H3NO 1CJTB 2JFKA 3EZ5A 4FVUA 2LKZA 3T3FA 2MKYA 1CJVB 3LAKA 4IH6A 2HLTA 1S9EA 1RBAA 1KLMB 3CD6S 1TV6A 1NSQA 4FJMA 2DNZA 1S5ZA 4BHQA 2HG4A 1RWVB 2R8IA 1RE1B 1K44A 3V4MA 1QTNB 1LXNA 4ZVFA 1VRUA 4LFBF 3QWPA 3R5JB 1F5AA 1T6DA 3NF8A 4J2DA 4WP9A 5HMZA 1GT8A 3NKYA 4AL6A 4DV7K 3CPWR 4L3QA 3MR7A 3KK3B 4L3NA 4P6QA 2DNQA 4LSNA 3J7ZO 4RWWA 3FK4A 4CJQA 3KK1A 4X4QA 5T7BA 3OSNA 1YKWA 4L72B 4B1WB 4GVLA 4QS8A 4P2FA 2W8KA 2GIQA 1JKHA 2XSJB 4X4TA 3LDOA 5F3ZA 3KD5E 1VSJA 4KHRA 2DJWA 2VGMA 4QYRA 1MA9B 2B56A 3SJJA 4JKHA 4CFBA 4MLEA 3FBCA 2F40A 3DRPB 4RW9A 3D66A 3HD1A 4OYWA 2R8KA 2XY6A 2HGLA 4M5LA 3VZHA 3D5MA 5D4NA 3M8SA 3FUYA 3UCGA 3U27A 3MM6A 1RBTA 1N5QA 2RHSB 4OPAA 1SJ1A 4IG0A 2OLWA 4FPBA 3DLGA 3ZZ0A 3QERA 2GVZB 2BJ9A 1S79A 1RTJB 1IBKK 4MIBA 4YR2A 4LF8J 3J81j 2SXLA 5H1SQ 3KDNA 4DV7J 5LMNK 4WIIA 3UDEA 2ASPA 3H08A 3TP2A 5FPEA 4CJFA 3DRSA 4Y2MA 3W2WA 2BOPA 3VQ6A 4DTPA 1UVKA 2ZH3A 1Z1ZA 3OFGA 1REVB 2FJDB 4B3TJ 1M5OC 3P5JA 4FK0A 1GMVA 5K5MA 5EGYA 1E6VA 4M95A 2IA0A 4Z4HA 3OW2R 2YHYA 4LH5A 3DM2B 2WZ1A 2WFBA 3MHYA 1K73O 1VQSA 3I9ZA 2R7RA 3RSEB 5IQQA 3CVKA 3MURP 1WSVA 3DLLL 2OZMA 2O8FB 3DKDA 2AZ3A 3VOVA 4F04B 1BMQB 3A3PB 3QBCA 3JS6A 1IBCB 1MWZA 2ACYA 1XQSC 3ZT1A 2OEJA 4NMXA 2DH8A 4LQ3A 4CIGA 4CT8A 4WIQA 4BDZA 1B4SA 2WVEA 1MSWD 1K1SA 3IAS9 3KLEB 4DL7A 3LTOA 3SUPA 4RW8B 1IBKJ 4BRHA 3OS2A 2E7WA 3PJ9A 5LMNJ 2BW2A 3D6FB 1WSGA 4JKGB 4FJIA 2JVOA 2XG8A 4DUZK 2AX1A 2FSJA 5F0UA 2MPUA 4M7YA 2YKPA 1VLYA 3EJMA 3ATUA 3BYPA 1B92A 5LSLA 3BGUA 1HW8A 3I6PA 1K9MT 3P45B 2R7OA 1PYSB 4JI6K 1QLNA 4CFAA 4DS4A 4BC3A 2DPNA 3DLKB 1FDAA 1A0OB 3K58A 3C6AA 2P9PA 4YMEA 1IBMJ 3JS9A 3KNAA 1TL1B 4Q0BA 1X3MA 1JXEA 1TL7A 4HHUA 3DLBA 4K5RA 2ZH4A 4KGMA 1JCGA 3WXKA 2FIUA 3B78A 3NMAA 1S22A 3W0LA 5AXLA 2GX8A 2Z57B 2X74A 1QAYA 3NGIA 1JJ4A 3HXMA 4RNMA 1S49A 1M5HA 1IO2A 4I69A 3VWSA 3IGNA 3A5LC 1NUEA 3M6VA 1FJCA 4CBWA 1AUDA 1RT6B 2D9OA 4TY8A 5GVQA 5BR8J 4RX6A 2CJKA 4DI6A 4ISGA 5AE3A 3O9UA 3DFEA 5ETRA 1FKOB 5C0YA 1RBRA 2CDQA 4DQPA 3IG1A 4JKEA 1DURA 4WFYA 1UKUA 4U8YA 3ZEUA 4FO0A 5F0WA 3IN5A 1U26A 3TUJC 4U7UD 2KDOA 2ROEA 2YV0X 5AR0A 2IJNA 1WBDA 4K8XA 4RNNA 4LF8F 2YWFA 3B6BA 2JX2A 3CIZA 5GIOA 4DV7F 1UWAA 2J9DA 4JI6J 2HVZA 4KI4A 3WXJA 5EHHA 1HWLA 5KGWA 4CEBA 3NRBA 5U47A 4DFPA 4KC5A 2LQ5A 2FY1A 3OHBA 2MLXA 5ETLA 3G82B 5JS1A 2AW0A 1I94J 3N4QA 3C14B 3GJQB 3SIPB 4B3TF 4J91A 5AQLA 3PKYA 1URNA 4RBVA 1G3OA 1VQMS 3QEPA 1N33K 1K6YA 5CE3A 5AZJA 2JH3A 2OELA 3R7BB 2CPFA 4CZLA 4O3RA 3JQJA 2AP1A 3L4BC 5B0BA 2E5HA 3TYTA 1XMOK 2I9SA 3RR7A 1IQZA 2JLFA 1IBLJ 2B9YA 3M2VB 4DL5A 4JKDA 2IVYA 2MDAA 3TWZA 3D28A 2E5IA 3OYKA 2J5AA 4OI1A 1SH3A 1KXPA 1PSDA 1NPPA 3R8YA 1IBKF