3MECA

Hiv-1 reverse transcriptase in complex with tmc125
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
552
structure length
550
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of HIV-1 Reverse Transcriptase with Etravirine (TMC125) and Rilpivirine (TMC278): Implications for Drug Design.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
molecule keywords p66 Reverse transcriptase
total genus 149
structure length 550
sequence length 552
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3mecA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3mecA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3mecA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3mecA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3mecA05
3ALYA 3TVKA 1KFSA 2AU0A 4FBUA 3VQ8A 3K59A 4ELUA 1KVCA 3QGGA 2VG5A 4K4VA 3NL0A 1U4BA 3BJYA 1MU2B 2W9BB 3AVNA 2JEIA 2GUIA 4O44B 2UVRA 4URQU 3SJJA 3DI6A 3TARA 2R8GA 4BWMA 4F4WA 3DRPA 3QYYA 5KFSA 1Q8IA 4DWIA 4K4TA 1N5YA 2F96A 4TY8B 4RW4B 1EXQA 3ZSWA 1RTDA 5F8NA 3M8RA 3TAMA 3TAMB 3KTQA 3L3VA 1SH2A 2PZSA 2AJQA 2JEGA 1SV5B 3RMDA 1R0AB 3AO1A 4DG1B 4ECSA 3PZPA 4PY5A 4E19A 1VRTB 4DL4A 3QLHB 4KTWA 4HTUA 1S9EA 4E89A 2KZMA 4M3YA 2HWHA 3L2VA 4EO6A 4GC7A 2BANB 4YR2A 5HP1A 3TAEA 2VG5B 3C6UB 4NCGA 3H4BA 4URSA 4RW6A 2ASLA 1T05B 4BE1A 1TL3B 1Q9YA 5KT5A 3VQQA 1I39A 3RMCA 3OSPA 1L3SA 3FRZA 2W7OA 3CJ0A 4F3TA 1S1XA 3I8DA 3SI6A 4PUOB 5KFKA 4JS5A 4TQSA 5F8JA 4CERA 3OS0A 4FLYA 2C2RA 3VA0A 2WB4A 4GC6A 4QWCA 1WSEA 1HNIB 4TY8A 4FZYA 3CWJA 3HK2A 3HVRA 3THVA 2GC8A 1S9GA 3GILA 4HYKA 4DTSA 3VA3A 1NK6A 4LSLA 4B3OB 3P83D 1RT6A 4FJMA 2FBXA 4KKOB 4Z4FA 5C25B 3CJ2A 3WNFA 1TKDA 5JS2A 4NLTA 4YMEA 4HHTA 3DLEA 3D0PA 3KD1E 5KG2A 3KLHA 4WFZA 3BREA 1J5OB 4WXOA 3VQ6A 2G8IA 5KG0A 4DTPA 4CJLA 4B9UA 3M9OB 4NCGB 2AX1A 4I7FB 4I9QA 4XO0A 2WOMB 4K4XA 5KG5A 2JLEA 3V81B 1Z4UA 1RTJA 1RDRA 1JIHA 2ZE2B 3KMSA 1REVA 4ZTJA 4PUOA 2XI3A 4NLYA 1NOYA 4N76A 4DLGA 1TKZB 3IS9B 3VQAA 2YNFB 1TKXA 4TXSA 1SKSA 4EYIB 4IH7A 4FJKA 5J2NA 2CKWA 5J1EA 3LP0A 2ATLA 1NK0A 4F50A 4YR0A 1JXBA 1S6PA 5KFWA 4Q5VA 1LAWA 3E01B 4E7KA 3ZCMA 5C5JA 1BCMA 1KSPA 1KVAA 4LSLB 4HUFA 4M42A 4CHQA 4WFXA 3QO9A 3LP2A 5I42A 5I42B 3G86A 1WNSA 4C8NA 4MFBA 1NKBA 4TQRA 3RB0A 1VSLA 4YFUA 1T94A 1VSMA 4N5SA 3RMAA 4ZPDA 5DLGA 5J2MB 3LP1A 4DQIA 3OY9A 5J2MA 4CEZA 4OJRA 1HQEA 4DFPA 3DOKA 3LANA 4I7FA 2GIRA 5KT3A 2IGIA 1LWCA 1Z25A 2FVCA 2WOMA 2XCPA 1YT3A 1HQUB 3UPFA 2XO7A 1RT4B 2YKMA 2AQ4A 2FBYA 5KG6A 1RTJB 1BGXT 1A5XA 1SV5A 3D45A 1JLEA 4B9TA 3QNNA 5KFLA 3KLEB 3H59A 3AA2A 4NLXA 4FJJA 4IG0A 4F4YA 4QW9A 4BACA 4CK2A 1BIZA 3NH1A 1ZBFA 4TSXA 3I0SB 2RF2B 4RW8B 3SPYA 5I3UB 5C24B 4QPXA 3MFHA 3AVFA 4CGJA 4RNMA 1J5OA 4DLEA 3KK1B 2BGGA 2HHSA 1ZBLA 1JLAB 3MXJA 3KLIB 3Q8RB 1K1SA 1S1VB 2XY6A 4GW6A 5KFOA 4CHNA 2D0CA 1KVBA 1HRHA 2HVHA 1KLMA 3HVAA 4URGA 1C1AA 3KK2B 1S1XB 3T5LA 3K57A 4CGDA 3OYHA 3TAQA 1TAUA 2ASDA 1QAIA 4FJLA 2KZZA 2ZQBA 4CEAA 1TAQA 1NK8A 1S0NA 3ASMA 1MMLA 3KK3A 1HYZA 3NBPB 3IS9A 5F8GA 5KT7A 2C2DA 2I5JA 4ED6A 3PW5A 2WK4A 4ID1A 4IOBA 3HO1A 1LWCB 2IM3A 5F8LA 4WXWA 4CJRA 4KRFA 3MEDB 4CJTA 2HHQA 3OVNA 3H4DA 1A5WA 1BQNA 1QTMA 3N6LA 3V1OA 4KB0A 3KOAA 3SZ2A 4FM2A 4FBTA 1NK5A 5HRRA 1NKEA 4R8UB 4MFBB 4CEQA 4YNQA 1HYSB 1S1TA 1T03B 3TAFA 1O1WA 3IRXB 2D41A 3P5JA 1NKCA 2EX3A 5HROA 4Q8FA 3BSOA 5F8MA 3GIJA 4CK1A 3AVLA 4KTZA 5C42B 4DQQA 2DTUA 3KLGA 4CFCA 3KLGB 4FJHA 3QGIA 4B9SA 4RNNA 3H5YA 5CZ2A 3PX6A 4LSNA 4K4SA 4KAIA 3RBEA 3N6NA 1VK0A 1JKHA 2RDJA 5FRMA 3LZIA 2W8KA 4E0DA 2VWJA 5KFRA 1NK9A 2G8KA 1C0UB 3JSMA 2WRMA 3MEEB 2R2TA 4IRCA 4EBEA 2WONA 2W9CA 2XWYA 3T1AA 4IFYA 1HNVB 1HNVA 1TP7A 2FLLA 2I1RA 4MKAA 1RNHA 2VWKA 3DDKA 1HPZB 4CJ3A 3P1GA 2DY4A 3H5XA 3QEIA 4NLUA 3SQ4A 4G3IA 1EP4A 1EP4B 1YTUA 4Z4HA 4DTOA 4DSKA 3E01A 4IBNA 4DQRA 4NYNA 4Z4CA 4MH8A 1CZ9A 2YNGA 1WSJA 1B9DA 1KHWA 4M41A 3CVKA 3AVKA 2JGUA 1YVFA 3LAMA 1S1VA 3IN5A 5L1LA 2R2UA 3AA5X 4NLQA 4Q0BB 2HNYB 1NJYA 3AO4A 1GOCA 3H2LA 1G15A 5KFAA 3LZJA 4R0EA 2OA8A 4FZZA 1XC9A 1XR5A 3ZT3A 1BQMB 3NBPA 3BSNA 1LW0A 1ZETA 2XY8A 4F4XA 2X6SA 4DL7A 1FK9B 2WCXA 4F3OA 1LWEA 1RT5B 4E7JA 1WAFA 2JC0A 5JXSA 3SV4A 5KFNA 4GMJB 1RYRA 4M45A 4C8MA 1UA0A 1N56A 3MEEA 3B6PA 2AGOA 2V9WA 4O3PA 3KLEA 5EWFA 3MR6A 3PO5A 5L9XA 5EUHA 5FROA 2HNZA 5EWGA 1BI4B 4ECYA 1TK0A 5JUMA 2ITGA 4WE1B 2AGPA 2DFEA 4Y3CA 4RG8A 3OYCA 4QWEA 5KFYA 2Y1JA 4RW9B 5L1IA 1C6VA 5C42A 4OGCA 2ALZA 4KHMA 3EZ5A 4HUGA 4AH9A 1IKVA 4LH5A 2QK9A 1LW2B 4ECQA 3HVTA 2IBKA 4ZVHA 1JKHB 1RCHA 3GV5B 4FS2A 3SFGA 1XR6A 2RN2A 3VQPA 1C0MA 4DTMA 1ASUA 5KG1A 1VSEA 3ZSVA 1JLQA 3DRRA 1JLQB 3C94A 4PA1A 3L8BA 5DQHA 3OLBA 3CM5A 2FJWA 1IKXB 3U3GA 5DK5A 4MIAA 5J2QB 4FK2A 1VSDA 2HAIA 4K50A 3MEGA 4CF2A 3OYDA 4ZP9A 4DL6A 5J2PB 4KE5A 3QERA 3ITHB 4AHTA 3LP3A 3MR2A 1ITGA 2GIQA 4O3OA 4JV2A 4FW1A 1FKPA 3BGRB 3OYJA 1VSHA 2BE2B 1SH0A 4KV8B 3MF5A 2ILZA 3RB4A 3KIOA 3UDLA 1HMVB 5HBMB 3AVHA 3IAYA 5K14A 3DOLB 1JLGB 2Z1JA 1TK8A 5HROB 4CEEA 1UA1A 3DRSA 4Y2AA 3NF7A 3DRSB 3I5BA 4ID5B 3GIMA 3OJUA 4I2QA 3KLFA 3T5HA 5KRSA 3OYNA 3RWUA 5EU7A 1RDAA 4EBCA 4IH6A 4DFJA 4J2DA 4CHYA 2XY5A 1BHLA 2E6MA 2YV0X 2W42A 1LV5A 3DM2A 4IG3A 5KFGA 2WHOA 3G6VA 1RT7B 4J9OA 4XIUA 2YNIB 4CJ5A 3S3MA 2HNDB 5KG3A 1SKRA 2HNDA 3K58A 1HPZA 2YHAA 2YNHA 4CGFA 1SH3A 4MIBA 4DTJA 4N56A 4C8KA 3H98A 4KHRA 4DL5A 4DU1A 3FFIA 3I5AA 2F8TA 3QZ7A 4ED8A 4OKEA 1SUQB 3AVCA 1B9FA 3KHRA 1IKYA 1ZTWA 4M3TA 4RW9A 5FRNA 4ED0A 5J2PA 2HMIA 2IA6A 4IR1A 3PUFA 1RTIB 3ICLA 3CDEA 4JRQA 3JYTB 4CF1A 2BE2A 4G1QA 2HWIA 2IJNA 3S3NA 2B5JA 2X78A 3Q8SB 3CM6A 3SCXA 4HVJA 5DQGA 5K14B 2HNYA 4ECTA 2V4RA 4NRUA 3OS2A 4NYZA 4ZP7A 2OPPB 3A2FA 4AHSA 1ZBIA 3F73A 3BR9A 4FM1A 2BQUA 3QEWA 4QOZB 4E7LA 1NOZA 1N5YB 2RPIA 4DSEA 4FS1A 3S9HA 1OS5A 3PW4A 2WTFA 1NJZA 2FVQA 3LALA 4DFKA 3EY1A 4ECVA 4OVLA 4FLTA 3B6OA 3O3FA 3HHKA 4KTQA 2XC9A 5KFHA 1R0AA 4KV8A 4I2PA 3KJVA 3DMJA 4I2PB 3KJVB 3S3OA 4M3XA 3PJWA 5DQIA 1XI1A 3RBDA 2VG7B 1KLNA 4DSLA 3V6DA 4X2BA 3T3FA 3TAPA 4DSFA 3RR8A 1RT2B 1X9MA 4AHUA 2BR0A 2C22A 4LD0A 1D1UA 5DLFA 4Z4IA 1RT1B 3NGIA 3HVTB 3JYTA 4G1QB 2B6AA 2GV9A 4RW7B 3OYFA 1T8EA 4TY9A 3QIDA 5CYQA 4E3SA 1RTHB 3ZSOA 2XY7A 1JL1A 2OPQA 2IM2A 4J2EA 3NAHA 1K6YA 3CIZA 4RUAA 1TL1B 1QUVA 4DU4A 3FQLA 3CDUA 3HSTB 2G8WA 1IKXA 4Z4EA 3ISND 3CFOA 2VG6A 1I6JA 5L1KA 3SUNA 4IDKB 3WNEA 3M8QA 2UVWA 3AVBA 1XWLA 1IKYB 3C6TB 3MR3A 4K4ZA 2UVVA 3L2WA 4KI4A 3D28A 4NLVA 1S9GB 2D3ZA 1L3VA 4IKFA 3ITHA 3CJ3A 5SWMA 1EKEA 3HJFA 4TYBA 3ZT1A 3FQKA 4DG1A 3HM9A 2ETJA 4ZP8A 3CJ4A 4ED7A 4JUZA 3OYBA 4ZHRA 4ZHRB 4DS4A 4MK8A 4ED1A 4CJKA 3DOLA 4ZVGA 3V6DB 4QAGA 1QSYA 2HHXA 3QGHA 3PX4A 1KCFA 3DRPB 3PO4A 4H8KA 2Q3SA 4Y1DA 1RT1A 2OYQA 2RKIA 1DTTB 1RBTA 1S0OA 3DLRA 1X1PA 4CJUA 1S97A 4F8RA 1ZTTA 1RTHA 1JL2A 1CXUA 4R5PB 4KO0A 1ZBUA 3OYLA 3OL9A 4ZVFA 4KFBB 1DTQB 5EDWA 3H40A 3SNNA 3DMJB 4DTUA 3O4NA 1RBSA 3IGVA 3M8PB 3PW7A 4OKKA 3GIKA 2FVPA 4EP5A 4OPJA 3HP9A 4ZVEA 1QE1B 4CFDA 2NUBA 4FM0A 4EZ6A 1RDCA 4DU3A 1RTIA 5KFXA 4H4MA 4W5RA 4IQXA 4ZPCA 3ZSQA 4GVMA 1RILA 4RW6B 3LP2B 4RW7A 4TLRA 2R8KA 4RNFA 3KHHA 3K5MA 1C0TB 3V4IA 4K8XA 2BRKA 4IRDA 3RMBA 3BQ0A 3DLGB 4DS5A 1J53A 1D0EA 2PY5A 4QWAA 3OHAA 1QS4A 1J9AA 5DMRA 4W5NA 2KW4A 3NF6A 1HNIA 4M3RA 4O3SA 1S6QA 2V4QA 3V9XA 3QETA 3V9SA 1KRPA 3CDWA 3I0RA 4XPEA 4MK7A 3ZSYA 3I0RB 1RTDB 3KKRA 4NCAA 2J6SA 1RT4A 1C1CB 2C2EA 1U47A 3RAQA 3UQSA 2Z1IA 4ELVA 4TN2A 2Y1IA 1TKZA 5KFDA 2IS3A 3O3GA 1W0HA 5KFBA 4C8LA 5KRTA 5KG7A 5J1EB 2FLPA 4DEZA 2P1JA 4BDZA 2IM1A 3OS1A 1S6PB 4Q43A 4L8RB 4CIFA 2IAJA 4IKAA 4IFVA 3QZ8A 2IAJB 4IR9A 1U09A 1ZYQA 3KNAA 4YR3A 4FYDA 1T05A 4F4ZA 3V6KA 3EPIA 1C0TA 3V4IB 2JEJA 4CK3A 3OYMA 1F21A 3RRHA 1N48A 5E41A 4E7IA 3DI6B 2HHUA 2ZE2A 3DLGA 2DFHA 3NGDA 3L2UA 3GV8B 1QQCA 4J9RA 5KI6A 3NGYA 3PJXA 1ASWA 2V0NA 1HQEB 4KAZA 2YNFA 2BQRA 4FJIA 1HYVA 4RW4A 4DF4A 3DLBA 5J2NB 1GX6A 3RRGA 4IDKA 3LWLA 4CE9A 4NLSA 3HYFA 4Y1CA 3ZT2A 2QKKA 2YKMB 3MECB 4B9LA 2QE5A 3VQDA 4M95A 4CGHA 1BQNB 1RT6B 4Q45A 2FC0A 1K1QA 3M9NB 4MQ3A 4CHOA 3K2PA 5C25A 2G8VA 4OGEA 4JRPA 4DF8A 3LAKA 3G6YA 3QIOA 2G8FA 1RA7A 1S9EB 1T03A 3CG7A 3SQ0A 4HCBA 3DLEB 4J9NA 4EP4A 5C24A 3KLHB 3Q8QB 5KFCA 3MAQA 3H5SA 3OHBA 4CIGA 4CGGA 3KHLA 3TWHA 3V9ZA 1U04A 3NCIA 1KFDA 3PHEA 3FDSA 4B08A 1U48A 4OPKA 3G10A 4E1NA 2HVIA 2E9TA 4OKJA 3OJSA 2HB5A 4NLWA 1TQLA 3EPGA 4KO0B 5T7BA 2JC1A 3AVGA 5KT2A 4FW2A 5FDLA 4CFBA 3VQ9A 1A5VA 2CJQA 3TANA 1IKWA 4O55A 1U49A 3NAIA 3PR5B 4BE2A 2Z1HA 1TKXB 2IOCA 2O4IA 3T5KA 3V9UA 1S1UB 4Q44A 4CECA 1TV6B 4EEYA 4PQUB 3QESA 3ULDA 2QV6A 3MEDA 4K4YA 4KB1A 1RDDA 4J2BA 5CZ1A 2RDIA 1WLJA 4LQ3A 3CO9A 3T5JA 3F9KA 1JLAA 5L1JA 4NCBA 4RZRA 3KLIA 4FJ8A 3GYNA 1TL3A 2EC0A 4WYWA 1QSLA 3VQBA 4NZ0A 4FVMA 3PV8A 3OL8A 3LP1B 2KFZA 5KFVA 4FLUA 2F8EX 1BQMA 3VQSA 3VQ7A 1SKWA 4ED3A 3MXIA 3M9MB 4LH4A 4WYLA 4B9MA 3V9WA 1HQUA 1RT3A 4QWDA 1FXXA 5F9NA 3AO5A 4B9VA 4CJWA 4UQGA 1L5UA 4O3RA 1D9FA 4NLDA 4JV0A 5DG7A 5CY4A 3NF9A 3M8SA 3AA3A 4KPYA 4KKOA 4K4UA 4DL2A 3PVXA 4ZP6A 5JS1A 2C28A 4O3QA 3K5OA 1HARA 1TKTA 3QLHA 1L3TA 3G6XA 3EZUA 4J9SA 1S1TB 1S1UA 4J2AA 4PQUA 3NFAA 3LP0B 4CJQA 3O3HA 3HVWA 1DLOA 5DGBA 3SYZA 3PR4A 1S48A 3LDSA 1ASVA 4IFVB 3OYEA 1CXQA 1NHUA 3C6UA 3CQ8A 2A1RA 1GOBA 3OYIA 3MXMA 4F4KA 2FVRA 1VSKA 4LSNB 4KHSA 4EO8A 3QO9B 3HPHA 5DG8A 3LWMA 1TK5A 4FXDA 4DL3A 1WSHA 1KLMB 4QWBA 3AO3A 4XPCA 3ZT4A 4BWJA 3HPOA 4CIEA 4DMNA 1JLFA 1X9SA 1S4FA 4C8OA 2XI2A 3NF8A 4I9LA 1IKWB 2IMWP 4CEOA 3VQCA 4E7HA 4HCCA 3DOKB 5DG9A 1BIUA 4IH5A 1RBVA 3SV3A 2YKNB 4CEFA 3PW2A 3OYGA 4FJ7A 4ED2A 3FSIA 2DFFA 4KHNA 2PYLA 1S10A 3OSNA 3VN5A 1CLQA 4EZ9A 1T3NA 4DQSA 3SPZA 2G8HA 4Z0UA 4CJSA 2G8UA 3SI8A 4CESA 3QINA 2KTQA 2HNZB 1BI4A 2KFNA 4R8UA 1U45A 1WN7A 3NMAA 4CHZA 3HT3A 3I0SA 2XHBA 4AHRA 4Q0BA 2D5RA 1JLGA 3RB6A 4J9MA 1TVRA 3BDPA 4TYAA 2VA3A 4ZMMA 2P5OA 1UAXA 3N6MA 2IDOA 1KHVA 3KK1A 4OLBA 4I2QB 2Z1GA 1JXEA 4EBDA 2D7SA 2DPIA 3ZSZA 1RT3B 3VQ4A 3V81A 2E9RX 4MK9A 2EHGA 3KK2A 2FJXA 2F8SA 1REVB 4DQPA 3DM2B 2HHVA 5FDLB 4AHCA 5KFZA 4DTRA 2W9CB 1VSFA 4IFYB 2ZD1A 4IG0B 3KK3B 2ZD1B 5KT6A 3WNGA 3DYAA 3MR5A 2YKNA 4J9QA 5KFFA 1TV6A 4WE1A 2IM0A 4ECZA 4RW8A 5HRPA 5KG4A 1C2PA 3HXMA 3H08A 1DLOB 1BL3A 3OL7A 3L2QA 2UUWA 4ECRA 4CEBA 3NKYA 4RU9A 5F9LA 3SQ2A 4M3UA 3PX0A 1CSJA 4RNHA 5KGXA 3AVAA 1WAJA 5F8IA 4KHUA 3GIIA 4DSIA 2JEFA 2XRIA 1JLFB 1SL0A 3V6JA 3AA4A 2O4GA 3SUPA 3TI0A 4BE0A 1LW0B 3NH0A 2FBTA 1J54A 2ZKUA 2FBVA 3BSCA 2B43A 3Q8PB 1NNDA 3AVJA 3BQ2A 4PWDB 2R8IA 4FJNA 2R2RA 3DLHA 4O0JA 3VQ5A 5HRNA 4U7CA 1JLEB 3NDKA 1C0UA 1VSIA 4MKBA 4NLOA 3ZT0A 4M94A 1I3AA 4DTNA 1EX4A 1BCOA 3U6FA 1TKTB 5SZTA 4BDPA 3DYAB 4KHQA 2RF2A 3CFRA 1N6QB 1SL2A 5I3UA 1QHTA 1JX4A 2R8JA 1TVRB 2W9AA 4OLAA 4CF0A 3CYMA 3LPUA 4RUCA 4FJ5A 4ECWA 3U3YA 1IH7A 4NLGA 2B5JB 2J6TA 1WSGA 3O4QA 4ZTFA 3L2RA 2OPPA 3D5MA 4F2SA 3DRRB 3AVIA 3RB3A 5KFTA 3HP6A 4EYHB 2I5JB 3ZSXA 1NJWA 1IM4A 1RA6A 3V6HA 2VG6B 3RR7A 1S1WB 4KREA 1LWEB 3FFIB 3MEGB 1W25A 4H4OB 1FKOB 4H4OA 3CJ5A 4DSJA 1WSFA 1IO2A 2E4LA 3MTKA 5HRSA 2D3UA 3K5LA 1RAJA 1FKPB 3BGRA 1LAVA 3TR8A 4ICLB 2R7YA 4WFYA 4JLHA 1S0MA 5D3GB 5KT4A 1HYSA 3K5NA 5KGWA 4M3WA 5KTQA 3SQ1A 2HW3A 3IRXA 1N6QA 4QCLA 3QIPB 3IGNA 1NK7A 1RT2A 2A1SA 3E51A 4JV1A 2XGQA 4B8AB 4J9LA 4ID5A 1IKVB 4YP3A 1LW2A 4CF9A 4QW8A 1BISA 2RKIB 3SUQA 1GX5A 3UIQA 2B6AB 2HHTA 3OLAA 3KD5E 1RT5A 2OPSB 5CYQB 4PWDA 2OPSA 1Y97A 2X74A 1W9HA 3NAEA 1NHVA 4R5PA 4ECUA 3JSMB 1GOAA 2WONB 1RDBA 4W5QA 3ISNC 4CJ4A 5KFIA 2IC3A 4FLVA 1IG9A 4KFBA 1DTQA 1S9FA 3H5UA 4ECXA 3KHGA 2ATQA 4M3ZA 1EETB 2GBZA 2VG7A 1LWFA 1RBRA 2OPRB 3QEXA 4FK4A 3CFPA 4NYFA 4WZQA 1TGOA 1SUQA 4KHWA 4CJVA 2XCAA 2OH2A 2ASJA 1UWBA 5CYMB 2HMIB 1UWBB 5CYMA 2P5GA 2B4JA 4U6PA 4H4MB 3TQ1A 2D0AA 3RTVA 2YNGB 4KSEB 2QKBA 3QEPA 3OYKA 4FLXA 5EWEA 4JS4A 5HLFB 4Q8EA 5KFMA 1XHZA 5KFPA 1HMVA 3SUOA 1S5JA 3KKSA 2OPQB 2IJFA 4Z4GA 3RAXA 3UR0A 4ZPAA 1T7PA 1QAJA 3KLVA 3LPTA 2E6LA 3OYAA 4CJPA 3VQEA 3TAGA 2O5DA 4O3NA 4FK0A 2BDPA 2J6UA 1FK9A 1Z26A 5J2QA 4Y2CA 1S1WA 5KFUA 4FCYA 4F2RA 3ZSRA 3V1QA 1FKOA 4KBIA 4O4GB 1D5AA 3AV9A 3IG1B 3C95A 4AHVA 4NLPA 5F8HA 1S49A 2FLNA 3T19A 3PY8A 4IG3B 4W5OA 2FVSA 5KFJA 5KFEA 1VRUB 4ICLA 4H54A 5T14A 1SL1A 4FJXA 4KHYA 4ZPBA 5D3GA 4FZXC 1VSJA 5HBMA 4LY7A 1EETA 4O5BA 3GV7B 1NK4A 1LWFB 4FJ9A 3DLKB 2OPRA 1JXLA 4HKQA 1JLCB 3SFUA 1Q9XA 1JLCA 1N4LA 3TABA 4O4RA 3G0ZA 1QE1A 2R2SA 3BQ1A 4Y34A 2BANA 5HP1B 4E1MA 3AVMA 3HL8A 1DTTA 2BQ3A 4CFAA 1JLBB 5HLFA 1JLBA 4K4WA 2P51A 4FJGA 1RYSA 2VA2A 1MU2A 2W9BA 4IRKA 2LSNA 1CZBA 4CCHA 3QEVA 3NH2A 1QSSA 4ELTA 1C1BB 2XGPA 4CJEA 4YQWA 1WNEA 1RT7A 2UVUA 2OZSA 4N47A 1TL1A 4NRTA 2W7PA 2AX0A 2QXFA 4RNOA 4CEDA 3EYZA 3M8PA 3NHGA 2UUTA 4B9NA 4CGIA 4BDYA 4DFMA 3OL6A 3M8QB 1B92A 3C6TA 3L3UA 1C1CA 1WSIA 3MECA 2FJVA 2X6NA 2D0BA 3GQCA 2AGQA 3AO2A 4B8CA 4KB7A 4B3OA 1YTAA 4CF8A 1VRUA 4DTXA 5KFQA 3KMQA 2KQ2A 1D9DA 4CHPA 1YVUA 4AILC 1VRTA 4HUEA 4J9KA 4O44A 3MFIA 3DLKA 2AWZA 4FLWA 4W5TA 3QIPA 4N41A 1RBUA 2ILYA 4O0IA 2DPJA 1HJRA 4KI6A 2YHBA 3QNOA 3KLFB 3HPGA 1NJXA 4WZMA 3BSAA 1S6QB 1X9WA 1KTQA 2E9ZA 4K8ZA 2HHWA 4O4GA 4OL8A 3IG1A 3WNHA 4J9PA 2PYJA 3V1RA 1UOCA 1C1BA 3NGZA 1XHXA 3NE6A 2IC3B 1ZBHA 2YNIA 4NLRA 4FLZA 1XR7A 2W8LA 1L3UA 2BRLA 2OZMA 3I5CA 3HKWA 2YNHB 1D8YA 5DGAA 4LQ9A 3PW0A 2R8HA 4CJFA
chains in the Genus database with same CATH superfamily
4AQYJ 3D6RA 4ILHA 1KFSA 1NSQA 3A8YA 3VQ8A 1LWXA 4ELUA 4O8KA 1XMQK 1WTFA 3UE5A 1YJNN 2DHAA 3T9NA 1RUSA 2XULA 2N7YA 1MU2B 4BRKA 4OI4A 2JEIA 4O44B 3N9UC 2UVRA 4URQU 3LDOA 1KR4A 3FBEA 3DRPA 1RLDA 2VIHA 4DWIA 1K9MT 3QMLA 2GX8A 2DNGA 1VBKA 1E6VB 1N32F 4GV9A 2VD3A 1N5YA 2QMWA 1QQOA 4RW4B 3IC1A 1ZA1B 4TU7A 3DCAA 2LYVA 4J91A 2LQ5A 4B1XB 3KTQA 3D6TB 1Q8BA 2AJQA 2JEGA 1SV5B 1LNQA 1X4AA 3KWGA 1EQ0A 2M0GB 4LFBK 5F2RA 3BO2A 4PPZA 4ILLA 1RTZA 3E9PA 3WDOA 2NLXA 5BR8K 4PY5A 1VRTB 4DL4A 1AA1B 3CCES 1S9EA 4KTWA 4OLPA 1RXOB 1H7XA 3L2VA 3NGSA 1JJCB 4MJKA 1F5AA 1Q8LA 4YR2A 4Y0FA 1VQSA 2FTRA 2VG5B 1TFWA 3P45B 1KVIA 1RCOB 3H4BA 4HACB 4URSA 4TU8A 2DKOB 3WBZA 2R7WA 1T05B 3HJVA 3C6HA 3VQQA 3L7UA 1PAUB 3RMCA 3D6MB 1L3SA 1WC5A 3FRZA 1HR0F 5A8KA 1S1XA 4X65F 4WFNL 1GLJO 3SI6A 1IG8A 2EW9A 4DV5J 1NGIA 3AXKA 4WFBQ 4GC6A 4LRCA 3J7YU 1HNIB 2FSKA 2CPZA 2IYIA 4FZYA 3HVRA 4K43A 1T0TV 2IIRA 4DV7F 5DZ6A 3GILA 2KL8A 4CYUB 3U4LA 5H9EK 1N34J 4OI6A 1FHTA 3C15A 1PYOB 1PO6A 4EFHA 3NY0A 3WNFA 1IXKA 1XEZA 2CJKA 2DR9A 3IDHA 5A0YA 1U8WA 3T7ZA 1UMJA 4YMEA 3O6WA 2CFXA 3DLEA 4J7CA 3KLHA 4WFZA 4WQ4C 4OZJA 3D4JA 2G8IA 3OFGA 5M2UA 5EX5A 3GDQA 3M9OB 2AX1A 1RADB 4XO0A 1MWQA 1OQ3A 3H20A 5G0RA 5DZ7A 2RE2A 3MEKA 1Z4UA 1JIHA 2HRUA 2JWKA 4ZTJA 1GK8A 3FUYA 5FLXY 1NOYA 4BS2A 3BKFA 2BUNA 4PKHA 1EJ7L 2BMBA 4USKA 4TXSA 1IN0A 4DR4K 5J2NA 3UKRA 5EVZA 3DGPB 4YR0A 1JXBA 1S6PA 4B17A 3W3DA 2FZKB 4E7KA 1S7IA 2JSXA 2LU2A 5C5JA 3GG0A 2L9WA 4WKRA 3HTVA 5I3PA 3TU5A 4CHQA 2IPOB 4WFXA 4PXDA 3G82A 5A8WA 1WNSA 1FJGK 4MFBA 4X4QA 1E6YB 3I56N 5A0YB 4M5HA 5ADXA 2MGZB 4W98A 4DPOA 3IR7B 4N5SA 4X64F 3GP9A 2BVZA 3NS5A 5J2MB 3J7AP 4K41A 3CF5L 1HQEA 3BY5A 1F6TA 3OFEA 1QVFM 2IGIA 4JI5J 1LWCA 2FVCA 4DPYA 1YT3A 3UPFA 5CR4A 1RT4B 3IWXA 2AQ4A 1RTJB 1LK7A 4B9TA 2V5HG 1AZSB 1WEZA 2W2PP 4C3LA 4QW9A 4CK2A 1BIZA 2CVEA 3MWTA 3CCUS 3GMGA 3D2EB 2JH3A 2ZJQL 4RW8B 1S6UA 3MFHA 2NZCA 3PXGa 5ADZA 3H7HB 1J5OA 3QWPA 1FVQA 1CULA 5KOWA 2BGGA 5GAEP 2HHSA 3KHYA 2DISA 3MXJA 2QLWA 1X0PA 1DZ5A 3HKZD 3Q8RB 1VQYA 3SBMA 4V19J 5KFOA 3HF5A 2D0CA 2DB1A 3NGKA 3T5LA 3W60A 5M2PA 2KZZA 1Q82T 4YB5A 3OTOK 2R7RA 2KG0A 3NGUA 4BRPA 3ASMA 3KG0A 2B9XA 3UI3A 3IS9A 2ZUAA 2C2DA 3K0SA 3N01A 4ED6A 3VHQA 3PW5A 3U9DA 4DR4F 2HHPA 3ZTSA 4JI6K 2FB0A 3SBTA 2H3EB 4CJTA 3DN9A 3H4DA 1U25A 1BUPA 1VJWA 4KB0A 1OYDA 5LMNK 2ZNYA 2LECA 2J0SD 4FM2A 4BLGA 4R8UB 3ZEUB 4YNQA 1T03B 4B3MF 3L4BC 1O1WA 1NKCA 3BSOA 4LF1A 4A47A 5C42B 4DQQA 5F0WA 3KLGA 1K0VA 3CMES 3J7A1 2ZEJA 1AROP 1CULB 4B9SA 4Z7YA 1ELOA 4K4SA 4KAIA 3N6NA 1F3VA 5HN0A 4L3QA 3LZIA 4FOIA 5GAEU 5IT0A 1S12A 4X66F 2CPYA 4LF4J 1URNA 1M5OC 2AYGA 4A48A 4M5DB 1DFDA 2XWYA 4OYMA 4IFYA 2VBXA 1FFGB 3MK6A 2VWKA 1HPZB 4KPCA 4YDDB 3IWNC 1IQZA 4J5OA 4CM0A 4NOHA 2VICA 1XNRK 1EP4B 1YTUA 4DTOA 1NNEA 4NYNA 1GEHA 4PR6A 2VCPA 2OI2A 1R59O 2XWXA 3PYDA 4DV4J 2YNGA 1UZDA 2QL9B 4CNZA 2JGUA 2K7JA 4CO0A 1S1VA 4WQ5A 3ZEUA 1ZAVA 3AA5X 1MW7A 4NLQA 2GGPB 2ZJRQ 1GMUA 5EY4A 5GADP 3DFEA 3MMBB 5KFAA 5EOYA 2WFBA 4DPUA 3CC7S 2C3OA 1XC9A 2V50A 1BQMB 3NBPA 4ZN1A 3A8IA 2BABA 2WCXA 3MD3A 1IBLF 1RT5B 1WAFA 2JC0A 5JXSA 5KFNA 1I94J 5LJWA 4ZVRB 4H5NA 3R9LA 1RYRA 4JV5K 1U1PA 1WD6A 4FYVB 5E5NA 4OHWA 3B6PA 2V9WA 4DUZF 2E7VA 3H2UB 4DV0F 5L9XA 5EUHA 5EWGA 4C48A 4U67L 5KQ8A 2HBKA 4C11B 3HSDA 2J4RA 3VAIA 3QMQA 1TK0A 1R27B 5JUMA 3OYCA 4X4PA 4QWEA 2HBRB 5KFYA 3CCRS 1V5IB 1C6VA 1N32J 4KHMA 2XYPB 2RRNA 4LRFA 3B4MA 3KXDA 1IKVA 5B7WA 4LH5A 3SMPA 1LW2B 3HVTA 2CVIA 1Q86O 4RWXA 5AQQA 2KM8B 4QJVA 3GV5B 4FS2A 2PT0A 2LMIA 2FJBB 1Z2ZA 3VQPA 1ASUA 2VQEJ 4P52A 3ILOA 3ZSVA 5H9FJ 1JLQB 3C16B 3OLBA 1B7YB 4BR9A 1K44A 1WBDA 3U3GA 5DK5A 5J2QB 2QC3A 4FK2A 1M1HA 1SS6A 3FLCO 2HAIA 2V63A 3FC9A 3CE8A 1YJVA 1MMNA 2BJ7A 4JKFA 2YY3A 2M88A 1RFQA 3GU0A 4FWMA 2DY1A 2AEJA 4JV2A 2FHMA 4EGLA 4FW1A 1WSRA 1VSHA 3FSYA 3DC2A 3MF5A 3RB4A 3W0LA 3WC2A 2FF6A 3IAYA 5K14A 3MM5A 2PC6A 4J9UE 1UA1A 4DZ6A 1ZXOA 5AT1B 3DRSB 1RABB 3B6BA 3I5BA 2RH3A 3BS9A 3Q8YA 3TTCA 2CZ4A 3GIMA 3D66A 3CNQP 1CBKA 3K5PA 3MAHA 1W7AA 1RDAA 4IH6A 4DFJA 2OTJS 4X62J 1S5ZA 4JV5F 2V67A 1RAEB 2WHOA 4X4TA 5TKWA 1VHFA 5DETA 5THWA 2V8HA 3ZX0A 4CJ5A 3SJHA 2HNDB 1YJUA 5KG3A 3K58A 4QPTA 2VPZB 2HBJA 4C8KA 1SH3A 4KHRA 2GAGC 1R8BA 4OX7A 4DU1A 2F8TA 3KHRA 1ZTWA 2NZ4A 4IR1A 2BUPA 4I4BA 3ICLA 3CDEA 4DCHA 5BR9A 4JRQA 3CCJS 1TELA 2W6KA 4YB6A 2O8DA 1VIOA 1WHXA 2HWIA 2IJNA 3KG1A 4OI0A 3S41A 4PL8A 3S3NA 2B5JA 1N0UA 4NZ6A 1TUYA 2X78A 2NXEA 5K14B 2XG8A 2HNYA 4ECTA 2EKNA 4NRUA 2R3VA 3SQGB 1YJNS 2QWOA 4L72B 2F40A 3F73A 1YZ6A 1SVDA 4FM1A 3QEWA 4P2XA 1T11A 3NG8A 3OTEA 3PW4A 2WTFA 1NJZA 2O01C 2BJ1A 4DFKA 7FDRA 2UUCF 3QNWB 2XSJB 4JOUA 2W01A 3HHKA 1EO1A 1VBYA 1ATNA 5KFHA 4Y2KA 4UY8T 4I2PB 3S3OA 4M3XA 1PJ6A 2VFUA 4L3KA 1HBOA 2Z2LA 3IR6B 4X2BA 4GY2B 2LXIA 1MROA 4CW7B 4DSFA 5IT4A 3J7YP 1RT2B 4DV3K 2C22A 1EQYA 1OH7A 2PMWA 1T9WA 1RT1B 3NGIA 4DI6A 2V51B 3AQPA 1T8EA 4DV6K 3ZSOA 1YIJS 1MWKA 2OPQA 4J2EA 5BRDA 1CQMA 2G0IA 1CJTA 1FF2A 5IC6B 3VZIA 4C1NK 1QUVA 3O5BA 1IKXA 3ISND 4C0BA 3JQKA 3WNEA 3QGPA 1Q1KA 3AXMA 1XWLA 3C6TB 3L2WA 3MR3A 3D28A 2D3ZA 5ADXH 3SCLE 1EKEA 1B0PA 2ZZNA 2WUSA 5H9FK 4DR5J 2MSTA 1APSA 5LJVA 4DG1A 1H2UX 2I9SA 2ETJA 4ZP8A 5E7OB 3GG1A 3M5RA 3QT6A 5AZIB 1HWKA 4MK8A 4ED1A 2F8HA 4CJKA 4WP8A 3V6DB 3QRQA 1SAZA 3R5DA 1V4TA 2VC0A 1RT1A 1QUPA 2OYQA 2XYGB 1B7FA 3AAPA 1RBTA 2H51B 3DLRA 2CQ3A 1S97A 4GO7X 4OQJA 1NLKL 1VOMA 2V8VA 2X1GA 4R5PB 2YXLA 2UUBK 1K8KA 2MB0B 2CNNB 1DTQB 5EDWA 3VMFB 2NSCA 4C1NI 4NA1A 1NZAA 3DMJB 3O4NA 3SBGA 4KJIA 1FXDA 4OKKA 1Y5LB 4JI8J 2FVPA 3LGNA 2DY9A 1BD6A 3THWA 1Q82O 1QE1B 1RDCA 4JI4F 4DU3A 2V7YA 3Q23A 1M90O 4TVAB 3HBTA 5E3RA 1LCUA 2K1RB 1KQSR 1BMQB 3MCOA 3V4IA 4ED4A 5CXTA 1GLLO 2W2MP 3DLGB 3CCVS 3DLLQ 1X5SA 4DS5A 2YQ0A 1LK5A 3OHAA 3GCWP 2AIRB 4O3SA 1S6QA 1GXLA 2ZBCA 3QETA 3ENQA 3CDWA 3I0RA 2RHQB 4MK7A 1JMTA 4OJHA 4WTYA 3KKRA 2ZZTA 2J6SA 1C1CB 1VQ7S 2H4WB 4KH6A 5JVGL 2Z1IA 1VAZA 4OZ1A 5E3PA 2YJEA 2BJ9A 2Y1IA 2CQGA 3NNAA 3MZIA 3O3GA 1T95A 1W0HA 4C8LA 1R7IA 1YHQS 4DEZA 4BDZA 1S6PB 4L8RB 4CIFA 2IAJA 4IFVA 2BTFA 1FJGJ 2E1ZA 1YJTA 3H3OB 2RNEA 3KNAA 1YHQN 1T05A 3JXOA 4F4ZA 4DR3J 2RE1A 4LF6K 2JEJA 4HT5A 4P71A 1F21A 5E41A 4E7IA 4X65K 1AB8A 2I8EA 2JFKA 3VALA 1QQCA 1VCTA 2PO4A 3ILLA 5FPNA 3NGTA 5T41A 3PJXA 3EGNA 1ASWA 1FDAA 4IFEA 2V0NA 1YJ7A 4UY85 2IVFB 1S72S 2QA4N 2W1BA 2EFNA 3ZZPA 3CTRA 5AXKA 1GX6A 3LWLA 2AJ1A 3A8JA 4FWKA 4QS7A 1FVSA 4CE9A 3ZTQA 3M2RA 4C98A 2YKMB 5D4LA 4M95A 1V5VA 2QXLA 4DR5F 3FZFA 3JSRA 3E66A 5T7LA 2FC0A 4AM6A 5D4NA 4F3MA 2NXCA 5LM7E 3HI9A 4DF8A 2V9KA 1KQFB 4NPOA 3QFUA 2RU3A 4RBTA 4RX6A 4M5MA 4MYUA 3CG7A 4HCBA 4EP4A 4XH1A 3Q8QB 3IWLA 1XNQF 2V94A 5AQIA 4CLKA 3TWHA 1EKSA 2HVZA 3UDEA 1NDLA 1U04A 3FZBA 2A5XA 4HACA 4XK8C 3UCZP 2EEYA 4XTTA 4DR7F 2HVIA 2Y1LB 4IQMA 4NLWA 1Y64A 2BJEA 2V7ZA 2NREA 5G4DA 3AVGA 5KT2A 1F2GA 3VQ9A 2CJQA 3TANA 1IKWA 4KH4A 3NAIA 1TKXB 2NRWA 5KPZA 4ZLNA 2ABYA 4LRBA 3UWTA 2MJUA 1RU2A 2E44A 2QL5B 2BKPA 3HOTA 3RUBL 3VF2A 1HW9A 1WOPA 4RZRA 1DAXA 2YH0A 3Q2SC 2VODA 1KXPA 3H45C 3V4MA 2U1AA 5KPRA 4JI3J 2EC0A 3IBFB 1VHIA 4ZLPA 2OTLN 4WYWA 3VQBA 3R2DJ 4NZ0A 3CCWA 2HIQA 3PV8A 3LP1B 3MMCB 2KFZA 5KFVA 4FLUA 2DHSA 3CD7A 1SKWA 4H0VB 3MXIA 2YKQA 4IOAL 2GMLA 5ETNA 4WYLA 3M9MB 3WXKA 3CD6S 1FXXA 3AO5A 3ZX3A 1F5BA 4BRMA 2I7PA 3QBXA 2OGUA 4NLDA 4NXNJ 4KKOA 4K4UA 1NB7A 2E5LF 5IT9Y 3PVXA 1EIYB 2C28A 3K5OA 3EZUA 1S1TB 1S1UA 1KQKA 3O3HA 2ZVIA 4GNIA 2FHJA 2GHWA 5HK4A 1QLNA 4EUVA 2HFUA 1S48A 3TZYA 1NHUA 2W4CA 2IVNA 2A1RA 1GOBA 1FE0A 3UR3C 1GXUA 2FVRA 4LSNB 3AB2B 1HNWF 5AQPA 3BN7A 3LWMA 2KT3A 1CC8A 3R3LA 4FXDA 4CIOA 1YLXA 2ASYA 4JI5F 2HOEA 2HHHK 4XPCA 1Q0NA 2B9EA 3W66A 3VGSA 4DMNA 3OTOF 4DUYF 1S4FA 3KK7A 3PKYA 2HS4A 4F0MA 4E7HA 5D0HA 4Q2MA 1J5EF 3S7RA 5DDPC 1BIUA 4PEOA 4FNIA 2QRRA 4ZJOA 3PW2A 1D09B 4J90A 1F60B 2E20A 2CYYA 3UD4P 3WXJA 3WEEA 2PYLA 1S10A 3OSNA 3VN5A 5GINA 1GQEA 4EZ9A 4LF4F 4CZIA 4Z0UA 2BYCA 2G8UA 2HNZB 5GMEA 3O1WA 2MZQA 3NMAA 1RQ0A 5AXMA 2NXUA 4Q0BA 2D5RA 4KGZB 2BH1A 2JVRA 3BDPA 2Q0UA 3X3UA 4TYAA 4ZMMA 5GADU 2P9PA 1ACMB 1UAXA 3W5YA 5C2GA 3N6MA 1NH8A 2IDOA 1VMBA 4ZA1A 4I6WA 1DJ0A 3BUZB 3DGVA 4RO0A 2VQEK 4K8RA 4D3GA 3EE8A 1M1GA 1YXQA 1VQON 1VC0A 2WVCA 1J6ZA 3CJ8A 3K8WA 4MK9A 4USIA 8AT1B 3SK3A 2F8SA 1YBUA 5FDLB 5KFZA 4B1WB 1QM9A 2KHDA 1VSFA 1M1KO 2FD2A 1RGVA 4RUBA 4ENOA 5KFFA 1TV6A 5IOLA 2QLJB 4DXLA 2EFGA 3CCZA 3U27A 1EARA 1DLOB 4DMZA 4LF2A 3FRYA 5CD4A 3OL7A 4RU2A 2AW0A 1RDUA 2EBEA 1OJ4A 3L2QA 1NGCA 4NO7A 4ECRA 3SQOP 4CEBA 4PKDB 3OR1B 3BF4A 1T6CA 2J7UA 1R8HA 3AVAA 3CCUN 4CTAA 5F8IA 2RQKA 5LXYA 2XHCA 2PAVA 1N36J 2OD6A 4RL1A 1SL0A 3BGLA 3D67A 2O4GA 3SUPA 1VDHA 2FBTA 2E5HA 3FE1A 3J81O 1J5EK 2G0JA 3BSCA 4QU7A 2B43A 3ISZA 4LRDA 1NNDA 3QFPA 1HNXK 3BQ2A 1RBAA 4K5SA 2R2RA 3MM6B 1ZZFA 1JLEB 2H9ZA 3NDKA 2HRYA 1ZS6A 4NLOA 3ZT0A 4QU6A 4DTNA 3NOCA 4AFFA 1EX4A 2BA9A 1I1GA 4FWQA 2CJAA 1TKTB 2A6OA 4KHQA 2RF2A 1QHTA 2PBDA 2MQMA 3SMZA 3TA2A 3BBFA 5ETTA 3KUHA 1HL6A 3CYMA 4N8NA 4S0MA 3LPUA 4CO1A 4WFNQ 4FJ5A 3T6JA 3H0PA 3U3YA 2Q0RA 2JLGA 2JL9A 2OMLA 1Q86T 4OZ2A 4OX9F 1WHYA 1RAGB 4OHVA 2FHOB 1NSPA 4A8MP 1XNRJ 2J9CA 3VVUA 2OPPA 2G1DA 4Y2IA 3DRRB 3EN9A 5AFUH 4KRWA 3HP6A 3N5BA 2YHWA 3ZSXA 3GL1A 1IM4A 3DOMB 4HI1A 4OZ5A 2E88A 2P9IA 2CGLA 3FFIB 3OHRA 3MEGB 3MN9A 4H4OA 2XLIA 4DSJA 3VOVA 1IO2A 1HKBA 2E4LA 2GA7A 4HHHA 2XYHB 1RAJA 2VUGA 3L0QA 1FKPB 1FERA 3T1HF 2F9WA 3W63A 3WX8A 5C7PA 4JLHA 4M5KA 3HCXA 2ADBA 4M3WA 4EHUA 3IRXA 1S99A 4JI2K 4A61A 1RT2A 3JAMY 4JV1A 1P1TA 2XGQA 4B8AB 4J9LA 1IKVB 1LW2A 4QW8A 2PEBA 1S59A 4HTIA 2B6AB 2HHTA 3FEXB 5AR0A 5AQKA 3U1NA 5CYQB 1VQLS 3BEGB 3CJTA 4B1ZA 5CZVA 1GOAA 2WONB 1RDBA 5C10A 4LF7K 1FJGF 4NEZA 4KFBA 3Q22A 1WUUA 4WF9L 4ECXA 4M3ZA 3DU6A 2GBZA 3FZMA 4OYAA 3TP2A 1SUQA 1TGOA 4KHWA 3P39A 2XCAA 3EX7B 2H1YA 1UWBB 1CPZA 2B4JA 4KSEB 2AYEA 5EWEA 5F3TA 2O8DB 3VF0B 3G96A 4DV1K 1G4CA 3AJ1A 4OX9K 1LOUA 5AQNA 1ATSA 2IJFA 2VPWB 2VGNA 3GBTA 3MMBA 2M3DA 3SSRA 1Q53A 1QDUB 3KLVA 3LPTA 3OYAA 3VGMA 4FSVA 2JVOA 1FNOA 4FK0A 3HOSA 3NWRA 2A3JA 5BRHA 2J6UA 1SQEA 3EVMA 1S1WA 5KFUA 3K8VA 3ZSRA 3V1QA 1FKOA 4KBIA 3AV9A 4AHVA 4NLPA 1S49A 2MLZA 2J9DE 4W5OA 1VQ4N 3OXLA 1U24A 4DR2J 4FJXA 4KHYA 3CJAA 4FZXC 1EETA 5B0AA 1U1OA 4K2JA 3OVSA 1ROFA 4NLCA 3SFUA 5L46A 4LF9F 4X4NA 3D0HE 2FUG9 2VDIA 1QE1A 3HMJG 3CGIA 1FFSB 3EXYA 1QAXA 3AVMA 4B02A 3MPDA 3I31A 2CUYA 2E8AA 1GTHA 1JLBA 3F41A 1AXQA 4TNOA 1MU2A 5CA5A 2LSNA 1CZBA 2VKZG 4CCHA 2CJ9A 2CZVC 4USWA 4USMA 2CH5A 4I67A 2HQIA 2RUGA 5FIIA 1RWVB 1OSDA 2OZSA 4LT6A 4N47A 2PFDA 5IFMA 2F4FA 1R89A 4G1PA 4H4KC 4CEDA 3M8PA 4JI0J 3NHGA 4ITSA 4CLWA 1QVGM 1CQNA 1C1CA 1ATRA 3MMAA 1SKUB 2OJ3A 3ZZOA 3DXMA 4DTXA 4JKGB 4PYAA 4B3RF 2DNLA 4DU8A 4DV1F 4DV5F 3CB4A 4J9KA 2KI2A 4W5TA 4YOXA 4N41A 1RBUA 2ILYA 3IMXA 2YX6A 4KI6A 1VQ7N 4L76A 5HVHA 2YH1A 3HPGA 3BSAA 4L73A 3VGKA 3K9KA 2QWQA 1S76D 1DY3A 2WC9A 2E9ZA 4HT7A 2HVDA 5ETKA 2G2OA 3IG1A 2PYJA 3R7SB 3NGZA 3CIMA 2HIYA 4OYPA 2G0CA 1EQMA 4DN9A 2IC3B 1ZBHA 1TFYA 2XZDB 3JTPA 4NLRA 1IBLJ 1JQGA 3EICA 3M6UA 4I1TA 1WEXA 3ETMA 5DGAA 4L74A 4LQ9A 3PW0A 4HDGA 4DR2F 2MPUA 3O6QA 4LF8F 2IY5B 4OPAA 3M30B 3D6FB 1IBLK 4H0XB 3BJYA 5IQ6A 4RJVA 3AVNA 5AZIA 2Y0BB 1X8DA 3SJJA 3DI6A 2CG8A 1FO1A 2R8GA 5LMUJ 3QYYA 5KFSA 3G6ES 3UNYA 2DT9A 3GSIA 4YY3F 2J0XA 3CCEN 2ATCB 2F96A 4DX8H 3VF4A 2V8DA 1UL3A 4TY8B 1EXQA 2W2QP 1RTDA 4HHUA 2AKWB 2CZ9A 1WC3A 1XTZA 1U1QA 4W4MA 5FLXU 4B3SJ 3R6MA 3RMDA 4YOWA 2VBYA 2XSFA 3Q2TC 1MWYA 4ECSA 1SQKA 1N8RO 1NXIA 1TUWA 2ZOFA 1JK9B 4BC2A 5BR8F 4F0KA 2KZMA 2AHOB 4NA3A 3IXQA 2HWHA 2CNOB 4EO6A 4GC7A 5HP1A 2CPEA 2YQ1A 3M30A 3C6UB 2JWLA 4ISEA 3B82A 4Z94A 3D3CJ 1RI7A 1I39A 3OSPA 2GFFA 5F0XA 2O8BB 4H5VA 1HHSA 2W7OA 2HGMA 4PUOB 2LQJA 3SAHA 4TQSA 5HQ8A 2XTJP 3TR5A 4Y0WA 3VA0A 3WXMB 2WB4A 1WSEA 2RDDA 4TY8A 1WOQA 2ZC3A 1WC4A 3HK2A 1IBKJ 2ZH4A 1S9GA 4KC5A 8ATCB 1OH6A 3PSFA 2XNRA 1Q81T 4YEAA 4FF4A 3VA3A 1NK6A 2V8PA 2X3DA 1QJHA 2XNQA 5AFUA 4K0KF 4AL5A 1UKUA 4FJMA 2P2CB 1C4CA 1N5SA 3CJ2A 3SSSA 2MY8A 5AQVA 2H5EA 4HHTA 3RW7A 3KNGA 4UW2A 2W24A 2KG1A 1J5OB 4BVPA 3W61A 1NGBA 2JZ5A 3VQ6A 3BH7B 4B9UA 4I7FB 3UD3P 4K4XA 1SPBP 3V81B 4EMDA 3GLJA 3KMSA 2IVYA 1REVA 1HI1A 2ZF5O 4PUOA 2HF3A 4DLGA 1NDPA 3M6VA 3D3BJ 3IS9B 1TKXA 4H5WA 1SKSA 1KONA 3O9QA 1X3NA 1T9XA 5J1EA 4YY3J 5J1NA 4F50A 3R5GA 3C14B 2JDJA 1LAWA 3E01B 3KZBA 1A0OB 4FO0A 2KRRA 3AT1B 1FESA 1KVAA 4NB4A 2UV8A 3QO9A 5IZHA 3G82B 4C8NA 1E6YA 4K25A 1T94A 1VSMA 2F9TA 4NXMK 2UP1A 5J2MA 3OY9A 4CEZA 4DFPA 2QWPA 3DOKA 4B3TK 2W7AA 2PEHA 4I7FA 1F2HA 2QGFB 2M4MA 2WOMA 2XCPA 2E1RA 2XO7A 3BKUA 1EHWA 3CMAS 4OYIA 3UKUB 4CZFA 2GX9A 1SV5A 3IBCB 1OIAA 1UJ5A 3MD1A 3QNNA 3W8PA 2ACMA 4BG8A 4K0KK 4NLXA 4CZGA 4BACA 3D7EO 4U7BA 3I0SB 3BBBA 1SJQA 4QS8A 2VOOA 4UQTA 3PSIA 4U96A 2NXJA 4XAKA 2DNKA 3PG9A 3FEYB 2P8IA 1K1SA 1S1VB 2XY6A 5E84A 4GW6A 4JYAF 3TRGA 4Z2XA 2VQFK 2UU9K 2HMPA 2HVHA 1Y9OA 5A2QY 3KK2B 1UVIA 3CMQA 4V19X 3OA9A 3QT7A 2DGXA 2MEWA 4NLBA 1QAIA 4FJLA 1TAQA 2IFXA 4NL5A 1NK8A 4YOYA 1MMLA 2GO9A 2IVOA 2WK4A 1OSCA 1OYEA 2LQ9A 1M5SA 5F8LA 4B3SK 4WXWA 5HJXA 3MCPA 4JI6F 2KM8C 2NUUG 2HHQA 3OVAA 3DXSX 4CLFA 3AGRA 4YDUA 4DV4F 5ETLA 1BQNA 1QTMA 3N6LA 3V1OA 2MQ8A 2VFVA 4G9ZA 1NK5A 4MFBB 4CEQA 2RMLA 1S1TA 3BYRA 3TAFA 2D41A 3WIUA 2XMVA 3CQXA 3GIJA 4KTZA 1KOOA 4CFCA 3IMQJ 1EAYC 3KLGB 3QGIA 2UXBK 3SAGA 2GUPA 3DRXA 1JKHA 2HLUA 2RDJA 5FRMA 2RT3A 2W8KA 4KGMA 1NK9A 2G8KA 1C0UB 3MEEB 2R2TA 1ZBTA 3VAJA 3MR7A 1P8GA 2AA4A 3T1AA 2PSZA 1I51B 1HNVB 3UN5A 3C16A 2C3YA 1F9EB 4FPRA 4KH1B 1RNHA 3DDKA 4CJ3A 3D2EA 1K73O 3QEIA 3BKTA 5IXUA 4OJGA 2N3OA 3PFOA 4IBNA 2ZITA 2O8EA 3NVMA 4Z4CA 1ZM2A 3P38A 1CZ9A 4FKXA 1YVFA 3LAMA 3DHXA 5L1LA 1B3TA 4JYAK 4ATNA 1Q79A 1YRTA 2R2UA 1OVQA 1NJYA 3AO4A 1SC3B 1S22A 3Q24A 2OA8A 1NDCA 3T41A 4GVBA 4A5BA 1ZETA 4A8XA 4DL7A 3D0IE 4F3OA 3P31A 1T02A 4GMJB 4C8MA 1N56A 1GT8A 2AEFA 2BXJA 2AGOA 4LVNP 2KKHA 1VGYA 1BI4B 2R7XA 3P5BP 1SC4B 2VYPA 1CJUA 2AJ4A 2ITGA 4WE1B 3OVBA 3QBCA 4H5RA 2MDAA 4Y3CA 1MROB 4USHA 4YOEA 3PCOB 5C42A 4OGCA 3CJ1A 2ALZA 2MJNA 2E66A 1M5VC 2UXBF 2IBKA 4FN5A 4FWPA 2CJYB 4YUDA 2VV5A 1X0FA 3CJBA 3LGMA 1FD8A 5AQHA 1C0MA 4DTMA 4UOFA 2MQNA 5DM6L 3ATUA 1JLQA 3DRRA 3C94A 2MLYA 5A8RB 5DQHA 3A3NB 4HDHA 3CM5A 4FL9A 1CC7A 1IKXB 2E5IA 4FWLA 2HK2A 1JNZB 3VV2B 4MIAA 4W92B 1N32K 3MEGA 2DGVA 2NNWA 2YX1A 5BN9A 1SB6A 1TL4A 3TYTA 3U8XA 4LFAF 1G1XA 1PSDA 3VGTA 2PE8A 2J8SA 4I6MA 2BE2B 1SH0A 4DPTA 1Q8KA 3L9ZA 2QA2A 3JSYA 2ILZA 4CM2A 3EGWB 2X3GA 2MZ1A 3DRSA 2AJ0A 1PJ7A 2DGUA 4ID5B 2IBOA 4I2QA 2OEKA 1W97L 3CXCM 2B7BB 2Z2YB 4XEIA 4BRQA 2DXFA 3QRRA 3KUGA 3RWUA 5EU7A 2RSQA 3P4UB 2J5AA 1XK8A 2YV0X 1LV5A 3RRKA 2MXYA 5KFGA 2V2VA 4XIUA 2KYXA 3NOGA 2HNDA 4ETXA 1Q7YO 1HPZA 2YNHA 3H98A 4RR5A 4DL5A 5AQRA 3FFIA 3AVCA 1B9FA 2I7NA 4RW9A 4A8WA 1Q95G 3ZFVA 4PABA 1F1BB 4CF1A 3G6EN 2BE2A 2KH9A 4G1QA 3CDAA 1AW0A 1CJKA 1TMMA 5HOOA 3SLCA 4YHHJ 3OS2A 4ZP7A 1H2VZ 3SCJE 1NH7A 4F67A 4AUKA 3BM7A 3TSQA 2CQ2A 1Z1ZA 3MM8B 4DSEA 2B0GA 3S9HA 3PHTA 3W2VB 4X4SA 3MHYA 2YBVA 4FDFA 3W62A 1YVNA 1FA0A 4OVLA 1IM6A 4WCEL 4FLTA 1TUVA 4YB1P 3MPVA 4LFCK 4I2PA 3W5XA 3DMJA 1KC8T 2DO4A 4M7YA 5DQIA 1R8PA 1VQNS 2DH9A 1XI1A 3T3FA 3TAPA 2HFNA 2NPIA 4YOVA 4BROA 2F63A 3I32A 5ETMA 1D1UA 5DLFA 1FKAF 3HVTB 2V4JA 2BEFA 3LGHA 3GJQB 4OYXA 2UXCK 4ILGB 3QIDA 3QSIA 4E3SA 1RTHB 4CZKA 1RWMB 2XY7A 4DCPB 1JL1A 4OZNA 1PAEX 1U6ZA 3NAHA 4X65J 1WF1A 3H25A 2X1BA 5AQGA 3ZTOA 1XN9A 1NO8A 1TL1B 4GRSA 4QIGA 1R8CA 1ULRA 4ZPVR 3EDQB 2K8GA 5K20B 1EWRA 2G8WA 2VG6A 1I6JA 4YDUC 4JKHA 5AQXA 5HVGA 4OHXA 3M8QA 2UVWA 4KI4A 4K4ZA 2DHXA 1L3VA 4QYRA 4IKFA 4MKVA 3ITHA 1AUDA 4I69A 3FVYA 2D0OA 1FJ7A 4ED7A 4JUZA 3H90A 4DS4A 2BJ8A 1JCEA 4H5TA 4ZVGA 3GTYX 4QAGA 1QSYA 2HHXA 3A8KA 3DRPB 4PZVA 3MI7X 1RAAB 5D0RA 2W2NP 1S3XA 4OO1J 3U7JA 4Y1DA 4FWSA 2HVEA 4CI6A 1X1PA 1ZTTA 1Q5VA 2YWGA 1RTHA 1E3MA 1CXUA 5D4PA 4NA2A 3OYLA 3US5A 4MLHA 1HBUB 4KFBB 3SNNA 2VB6A 4CZMA 4DX7A 5IWAK 1TL5A 2NXNA 4DTUA 3IGVA 3IO1A 3M8PB 3PW7A 4CDIA 4GKJF 3VAGA 1LQ9A 1VIXA 5ETRA 2Z4PA 4OPJA 2MKYA 3HP9A 4CFDA 4FM0A 4CH1A 4JI8K 2D1CA 5KFXA 4W5RA 2F4VK 4JI4K 3ZSQA 2LEPA 2M9KA 3CCRN 2R7QA 4RW7A 3KHHA 3K5MA 1C0TB 4IRDA 5ETOA 1V3RA 4G6VB 2GZOA 3A4TA 2JX2A 3MPWA 3C7NB 4YY3K 4P9SA 4QWAA 1NLVA 1AFJA 4OMFG 1QS4A 1HNIA 1SI9A 2EK6A 4M3RA 3V9XA 3R97A 3V9SA 3ZSYA 3I0RB 2OUGA 1RTDB 1DQAA 2ZM6F 1HFEL 4NCAA 1N52B 1RT4A 3HSGA 3W9IA 2FC9A 5M1KA 3RAQA 4AXIA 3UQSA 5CZXA 2KN4A 4ELVA 4TN2A 1O5JA 4USUA 2E5LJ 1H0HB 1TKZA 2QT7A 3GYXB 1PBUA 5KFBA 5KRTA 5KG7A 5J1EB 2FLPA 2EWSA 3OS1A 3M8ZA 3SEOA 3M2UA 1NPKA 2J0WA 2QI2A 4CD3A 1R8AA 3QZ8A 2IAJB 2MZTA 1YGYA 4IR9A 5AQZA 1C0FA 1H73A 2CPFA 2XZWA 2IDLA 4FYDA 3R7BB 2ACYA 3UN3A 1C0TA 4CK3A 2NRZA 1SJ4P 4ER8A 2OSQA 2ZE2A 2DFHA 3NGDA 2QFIA 1BDGA 2E2PA 2ZH6A 1NBEB 2YNFA 2BQRA 2MQPA 1HYVA 1KQGB 4DF4A 3DLBA 3R7NB 5B8HA 5AZJA 3U1LA 3SSQA 5J2NB 3RRGA 1PCAA 1HX1A 3GIRA 4NLSA 3ZTPA 4Y1CA 3ULEB 3MECB 4B9LA 4X4UA 2HPUA 1Q5YA 5HMWA 2YTCA 2ZM6J 3M1FA 4CGHA 3TUZC 4JI8F 1NMEB 1RT6B 4I0WA 4Q45A 1K1QA 4MQ3A 4BVOA 2GWKA 3K2PA 5C25A 2EK1A 4OGEA 2NRHA 2HQCA 2XS5A 2KT2A 1T03A 2DYAA 3SQ0A 3DLEB 2AP1A 5C24A 1TL7B 3HHLB 3M1VA 4DUTA 1RKJA 2WB1D 5IV3A 5KFCA 3M4XA 1YWXA 3H5SA 3OHBA 4CIGA 3VAHA 4CGGA 5LSLA 2PA8D 3V9ZA 2MQLA 4RTFD 2HHHJ 4FP9A 2B4UA 1U48A 1OPZA 4OPKA 4A62A 4H4KA 2E9TA 2HB5A 2OTLS 3GOIA 1O13A 2N3LA 2W25A 4BRFA 5T7BA 3CCSN 2JC1A 4X4OA 3R6LB 2V68A 4J37A 5FDLA 3FR0A 2BKNA 4XDCA 1EKRA 4ETZA 3PR5B 3A3OB 2Z1HA 4BE2A 2O4IA 3T5KA 4CBXA 3ZZ0A 2WVEA 4LR7A 4CECA 3T6BA 4PQUB 3PIOL 2MKJA 3MEDA 4K4YA 2RB7A 4F36A 4BGAA 4I6YA 4LF8J 2OCEA 1WLJA 3CO9A 3G8SA 3T5JA 3EE9A 1ZC6A 3I87A 1G6BA 3AOBA 2ZBRA 1TL3A 2Q6CA 3DDIA 3E8OA 2ZHBA 4FWRA 1QSLA 2DNYA 4FVCA 4FVMA 1VQ5S 4WBFA 1YIJN 1VQNN 2B4VA 4BRAA 1GAOA 1DEJA 4AYBD 2QLXA 4CVNE 3QICA 3PNIA 3DAWA 1N0VC 3VTIA 3V9WA 3W8GA 1PC5A 3M2RB 1RT3A 3MMJA 4QWDA 2QJ3A 5F9NA 3M32A 3UE2A 5F0UA 2QFJA 1VQ6N 5CCLA 2NYIA 1KS2A 4BBYA 4UQGA 5DM7L 1XIQA 1L5UA 5JLFA 1GNKA 4LBPA 2CJXB 4DL2A 2RJZA 3R6GB 3TSUA 4O3QA 3R9PA 1TKTA 1L3TA 3G6XA 5GADI 4J2AA 2DNMA 2IRYA 2WW4A 3NFAA 3LP0B 2KXHA 1K8AT 3CETA 3HVWA 1DLOA 3CXCR 3PR4A 3LDSA 3OYEA 5BYRA 1CXQA 3G25A 3IP0A 3CQ8A 4F4KA 3P4IA 3EGZA 3GJSB 2ZH3A 1VQMN 5IT9U 2I38A 2H65B 5FPDA 4ZVSB 4DL3A 1KLMB 4QWBA 3AD7C 1KP6A 4ZIVA 4PG8A 3ZT4A 2HHHF 3HPOA 1O8BA 4OI1A 1X9SA 4C8OA 3MCMA 2MZRA 2PA3A 2XI2A 3F56A 3NF8A 1IKWB 4IOXA 3EZOA 3W3SA 3DOKB 4LREA 1R0BG 3CCMS 1RBVA 3PM9A 2YKNB 4B3SF 5BXIA 3DXKB 4CEFA 3VZHA 1YX2A 3QB0A 4DR6F 4FJ7A 3DGPA 4ERDA 4KHNA 3TA1A 4NI2B 3G87A 4DQSA 4CH0S 3QINA 3CPWM 1BI4A 3I96A 4R8UA 1K9MO 1U45A 4JI6J 2GJ2A 4CHZA 3I0SA 2VONA 2GGPA 4B1UB 4DBQA 4A46A 1T9VA 2F8MA 1KHVA 3KK1A 1VK3A 2L41A 3AOCA 1YK9A 4LVOP 4E8UA 3CC4N 2YI1A 4A2BA 2OHDA 3VQ4A 1M90T 3CMEN 3KK2A 3S8SA 1REVB 1K0TA 4JAXA 5ELZA 4AHCA 2RHKA 4DTRA 4DV6F 1HKAA 2ZD1B 4J9VA 2VZ9A 4C8ZA 5B0DA 3ADAC 4ECZA 4RW8A 1RACB 2NS1B 5HANA 3TX8A 3HXMA 2HFZA 3H08A 3T1HJ 3HZ6A 1WEYA 3HFKA 2KO1A 1BL3A 3OFHA 3B4DA 3BO3A 1FE4A 5DDOC 1WACA 2UUWA 3BP8A 3LDQA 4DV2K 4Y2MA 2MKCA 2FXUA 4EWTA 4RNHA 2AZ1A 1NRKA 2ZDOA 4KHUA 2QMUB 1HBMA 2JEFA 2XRIA 1Y5IB 4ZVOB 4DN0A 3V6JA 3U1MA 3AA4A 5C15A 3TI0A 2ZBQA 1NDKA 1NWKA 1LW0B 4X84A 1J54A 3NLCA 3R27A 5HATA 2ZH7A 2FBVA 4WJBA 1HNZJ 2DGWA 3L3CA 3Q8PB 4DR5K 4PXEA 3AVJA 2BM1A 1TMJA 1YRXA 4DR6K 4RWTA 2QLFB 2R8IA 2FF3B 4O0JA 3VQ5A 5B0BA 3T1YF 3MM6A 4WPAA 1YKWA 5HRNA 2DPNA 3FMBA 3WQTA 1NZ8A 1P1LA 3ENHA 4NXMJ 4M94A 1I3AA 4ZIWA 2ZGYA 2RS8A 1DURA 2PIIA 1RWWB 1FX4A 1KNZA 2FY1A 3R5AA 3MM5B 3CJQA 4B3MK 5EN1A 1JX4A 1NAQA 4OYOA 4X4VA 2YJFA 3WHIA 2FJAB 4F9OA 2AJFE 4JI2J 5AQOA 3CJKB 5GMKa 4RUCA 4PKIA 4ECWA 2YKPA 2K3KA 3VGLA 1HPMA 2WBMA 3E2EA 1R43A 3ID8A 2J6TA 3QT5A 1WSGA 3O4QA 2HAFA 3L2RA 4F2SA 4GMKA 3TJ8A 1IVZA 3ENOA 3RB3A 2CPDA 4AD6A 1H74A 1NJWA 1RA6A 2OEJA 3V6HA 5H1SV 3ZTRA 1G2EA 1LWEB 1FRMA 4IUFA 3FKBA 4C3MA 4H4OB 2ZKTA 3A5OC 4DHVA 1IR1A 1TYQB 2Y1RI 4DDFA 2HSEB 4ZLJA 4GO5X 1N5VA 3MTKA 5HRSA 2N82B 2R7YA 3TR8A 4KIAA 3OR1A 3CF5Q 5JJBA 5KT4A 3SQ1A 2HW3A 1N6QA 1BLUA 4QCLA 3HM8A 3QIPB 1UEVA 2CXEA 2DR7A 1NBWA 3E51A 8RUCA 4DV7K 4AL6A 4OHYA 1UW4A 3F5TA 4YP3A 4CF9A 4I6AA 5HL7L 4OJ3A 2HKEA 1RT5A 3NWGA 2YWEA 1W9HA 3LL3A 1NHVA 2LQBA 4C7QA 2PN6A 4R5PA 3JSMB 3N5FA 2VPXB 3RG6A 5H9EJ 1N34K 5KFIA 2IC3A 4FLVA 1DTQA 4LFAJ 1U2CA 1S9FA 3H5UA 1LWFA 2QTWA 3J81U 2OPRB 5K8PA 3TSPA 5L38A 3KJFB 2UUAJ 2P9LB 1UJ4A 4FZVA 4CJVA 4HLBA 1UWBA 2MKKA 2P5GA 4JKCA 1W7WA 4U6PA 1V4SA 2D0AA 1FDNA 3OYKA 2R7VA 4JKGA 1WJ9A 3C66A 3CEDA 3PYEA 1HMVA 1HD0A 4DV6J 1S5JA 1B0TA 1VC6A 1VQ5N 1XQIA 1X4BA 1RAOA 2E6LA 4EHTA 2ZUGA 3TAGA 3C8YA 2BDPA 4QIVA 1FK9A 2K3IA 1XNQK 1SQFA 4PG7A 5J2QA 4Y2CA 2Q79A 2HFVA 4H0OA 2XSJA 1D5AA 1CVJA 3HX9A 3T19A 1RCXB 4IG3B 2FVSA 4ZCKA 2ZZMA 4XH4A 2UU9F 5FPEA 1SL1A 4ZPBA 1AT1B 4KGVB 4LY7A 2KVIA 1WI8A 1NK4A 1LWFB 3DLKB 4B1VA 2OPRA 2OEMA 5A2QO 4HKQA 1KEKA 1JLCB 2DH7A 2NRVA 4O4RA 5K8MA 1RAHB 2DNRA 2BANA 4RKUC 1URRA 2HK3A 2MHNA 3VENA 5B0CA 4ZVPB 1BHNA 1DTTA 2MKHA 4M5GA 3CIPA 4CBWA 4K4WA 2VA2A 4WK3A 2WSCC 2IVMA 1QSSA 4DJBA 1IBMK 3RJMB 4CJEA 1HHQA 1K8KB 4YQWA 5IQQA 1WI6A 4UF4A 3GG4A 2Q3PA 1TL1A 3NCRA 1RWUA 2UUTA 4DFMA 3CHWA 2U2FA 3M6GA 1B92A 3L3UA 4LC9B 4JKEA 1WSIA 2B8QA 2X6NA 1QY7A 2D0BA 2FPHX 2DK2A 2V2ZA 3AO2A 5DS7A 2EC2A 2Q66A 2QLBB 5JMVA 4QR0A 3D1QA 4IOCL 5U47A 1DHMA 5JVHL 2FC8A 2KQ2A 4CHPA 3BF1A 4O44A 3MFIA 2CQ4A 1TTHB 3FMWA 3U02A 2MKSA 1HJRA 2CWKA 2FJDB 3D7SB 2B7CB 1WC6A 1IBKF 4PWUA 3TJAA 3WXLA 5J1PA 1S6QB 4OYWA 4FF3A 2XMMA 3CW2C 5CHIA 2GMHA 4K8ZA 4A8FA 4OL8A 1KDNA 3D1OA 2YCHA 3V1RA 1C1BA 2DNPA 3OT9A 4BC7A 1I94K 2PDAA 1XHXA 3NE6A 3DRYA 3O9SA 2EFPA 1XR7A 2W8LA 1JJ2M 1L3UA 2BBEA 2BRLA 1HNWJ 3I5CA 2YNHB 4LUBA 2C2MB 4LF6J 4NX9A 1FEHA 2R8HA 3R5CA 4ZDNA 3ALYA 4DR6J 4FBUA 3AY0A 3K59A 1KVCA 2VG5A 2I2YA 3NL0A 1U4BA 1FWLA 1PYSB 1Y0HA 2E1PA 2W9BB 3SAFA 5L8RC 1UTAA 2CPJA 4PQAA 1FXRA 4GKKJ 4BWMA 3WC0A 3JXUA 1Q8IA 2O3DA 3RAMA 3OXGA 1ZZNA 4ANDA 4JI7F 3GE9A 3GFZA 2PFFB 3CJ9A 2A6MA 3M8RA 2VQEF 3TAMA 1VS3A 1XMOJ 4I56A 5LL6Z 3L3VA 5M1PA 4C23A 1R0AB 4KHPF 3A13A 2P9UA 2D4WA 3AO1A 2XMWA 4JI2F 4DG1B 5GAHU 3PZPA 4E19A 3MM7A 1ZPWX 3J80Y 3AAWB 3O9RA 4M3YA 1H6KX 2E29A 4ID8A 4FWNA 4ISFA 1TR0A 2M7SA 4MT1A 1N36F 1SJ1A 4UZBA 4NCGA 2EXUA 1WOOA 1ZM3A 2M5YA 2ASLA 4JKAA 4BE1A 3T9ZA 1TL3B 1Q9YA 2HBYB 4LF7F 2O8BA 4CO5A 4LR9A 1JWWA 2PI5A 3CJ0A 1VQ8N 5KFKA 1YBAA 1FJEB 2BX6A 4IO8A 2C3UA 2VASA 5F8JA 4CERA 3OS0A 2C2RA 2UUBJ 4QQBA 4DR3F 2QWRA 3LF0A 4YHHK 4QIEA 3CMAN 2LU1A 5D6GA 3CWJA 1CEZA 2HGLA 3UKRB 4Y00A 3EUNA 4BY9C 3THVA 1VFJA 2QZ8A 3I8BA 2M8DB 3ULEA 2CWXA 4HYKA 1NGFA 4DTSA 4GV3A 4LSLA 4QS9A 3P83D 3IAS9 3CI5A 1RT6A 2P9UB 2FBXA 5C25B 2FQQB 3MWPA 2YHYA 5JS2A 4ZJQA 5LOQA 5KG2A 2CQPA 4WXOA 1U1KA 3PRDA 1K47A 5KG0A 1RHQB 4WIIA 4CP5A 4NCGB 3O80A 5KQDA 2R4FA 3E9LA 2XM3A 4BRIA 1PIEA 4BG9A 5KG5A 5EGYA 2JLEA 2BW2A 1W2IA 3HSZA 1RTJA 3W9JA 5A8KB 2ZE2B 3TUJC 4DV2J 2XI3A 4FKYA 4N76A 3AD8C 4DX5A 5D77A 2QWNA 3VQAA 2YNFB 3J81j 4TLQA 4IH7A 4FJKA 3VEXA 3FBFA 3GZ7A 3UNGC 4Q5VA 2R7UA 3ZCMA 4EU0A 3OTOJ 1KSPA 4LSLB 4HUFA 3L4IA 4M42A 1N54B 2E1CA 4YORA 4X66J 1UVMA 4DPXA 1IUJA 3GB0A 4JI1J 3N4QA 5I42A 1QVFR 1VHXA 3G86A 2DH8A 2A3ZA 1T3OA 4TQRA 3M1VB 4YFUA 4JK9A 2GQCA 3TVYA 5C2CA 3RMAA 4ZPDA 4DR4J 2MTLA 2A42A 4OJRA 3I6PA 4IEEA 1FT8A 4JK8A 1FDDA 5CD4H 1B0VA 4BR0A 3LANA 2HQ3A 5AQFA 2WBNA 4M5NA 1Y3JA 1C0GA 1WWHA 3GR0A 2YKMA 5AQTA 4BRGA 5KG6A 3ZXWA 1JLEA 2UXCF 1DBDA 4FJJA 4IG0A 4F4YA 4BREA 3OTCA 3QAUA 2IMOA 4LF5F 2RF2B 4QPXA 2GQ2A 4RNMA 3TVZA 1NGDA 1P90A 2GIFA 1ZBLA 1JLAB 4H0PA 3ENBA 2D9PA 1FFWB 1KVBA 1HRHA 1KLMA 2VQFF 4FF1A 3HVAA 4URGA 4LMZA 3K57A 4CGDA 4M5DA 1TAUA 2SXLA 3BV8A 2ZQBA 4B1YB 4Y65A 1S0NA 3KK3A 3DKDA 4DV3F 5F8GA 2I5JA 2HBMA 1U1NA 2CAJA 4ID1A 3HO1A 1LWCB 3RZAA 2R42A 3ZLJA 1VQ4S 4CJRA 4KRFA 2E1MC 1NCLA 1WORA 3C14A 4R79A 1Y3KA 4ZS6A 3CUNA 4EIAA 4C97A 3CQYA 2EFQA 3PEHA 4YOUA 3EMTA 1NKEA 2DR8A 1IQTA 1CJUB 4ANCA 3IRXB 2HS0A 5IWAF 3RSEA 3AJDA 5F8MA 3AVLA 3VPZA 1VQPS 1KAYA 4GKJK 2AF6A 3V2UC 1XMBA 4RNNA 3H5YA 3PX6A 3RBEA 3UO0A 3A12A 1RBOB 4P75A 3Q8VA 4LF9J 4E0DA 2VWJA 2RU9A 3UKUA 4DCJB 3OR2B 4IRCA 2WONA 2W9CA 3IR5B 4F25A 1FNXH 1HNVA 2Q43A 3D68A 2E5LK 1TP7A 2FLLA 2I1RA 4MKAA 2XB2D 3VAMA 1HKCA 2O66A 1WC0A 2DGSA 2OSRA 3N4WA 1HQ2A 4NLUA 4TKTA 1IJJA 3CDBA 3SQ4A 2ROPA 4DHYA 5K5MA 3RBZA 1IWAA 4F4AA 4DSKA 4Z4HA 3H6EA 3E01A 3J7ZO 1SQGA 2GW8A 4LFBJ 2QSWA 4DQRA 1RJJA 4NI2A 2NRTA 5CE3A 2DBBA 1LEOA 4A4JA 1IJEB 1WSJA 1B9DA 1KHWA 4M41A 3CVKA 3AVKA 2ZBIA 1MA9B 1W26A 1RLCL 2MY7A 1XMQJ 3EE3A 3AARA 1WOSA 1RWOB 2DXDA 1Q7LB 4EFAC 1GOCA 1G15A 1NGHA 4WYBA 3LZJA 2ZH8A 4U67Q 3ZT3A 3BSNA 1LW0A 3GCXP 4JV5J 4WP3A 3EM1A 2X6SA 2HFOA 4XH5A 3DOMA 1VQMS 4HTJA 3WQPA 1U8SA 2VL1A 3P6YC 4E7JA 3Q89A 2DCLA 3QATA 1MWMA 3HULA 3KJQB 4N7TA 2LXFA 1U26A 4UT4A 1KBRA 3TZWA 4O3PA 2E7XA 3KLEA 1RISA 3AQOA 3MR6A 2ZWPA 3PO5A 3JTOA 5FROA 2HNZA 1HR0K 4CRJA 4ECYA 5C12A 2IYGA 3FCHA 3MM9B 3MPYA 2QW9A 4RW9B 4HEA9 3NP5A 4WIQA 2BOAA 3EZ5A 4BRCA 4HUGA 4AH9A 1Q4RA 5CHCB 2QK9A 2V4JB 3LUYA 4DL0C 3MN5A 3HHLC 1JKHB 1H3DA 1RCHA 3SFGA 2ROGA 3VR1A 2RN2A 2VBZA 5KG1A 1VSEA 1FCAA 2BJ3A 1D4XA 3MM8A 2O8CB 2FJWA 2CH6A 4A8SA 2OD4A 1RHRB 3ID6A 1VSDA 2VFRA 1SJFA 2DD8S 4CF2A 1IJFB 1FEEA 3OYDA 2QWLA 4DL6A 3FSXA 4LF6F 3ITHB 3LP3A 1ITGA 2GIQA 1NMNA 1FKPA 1PILA 4I68A 2C42A 4KV8B 2E1YA 2QL7B 3KIOA 2CPIA 5HBMB 3HHNB 5E26A 2ASOA 1JLGB 3O9TA 3MM9A 3ILIA 2HURA 1TK8A 3QDKA 5HROB 4CEEA 1TUUA 2QN6B 1U2FA 2Z30B 4Y2AA 2UV8G 5GAGI 3K17A 4IYQA 4ZPWR 5KRSA 1YJ9S 4P7TA 3I82A 2ZFHA 3RW6A 4CHYA 4QR2A 2E6MA 2W42A 3MDFA 3DM2A 1N34F 1AUSL 3G6VA 4J9OA 2F4VJ 1T44A 2YNIB 4HTLA 1MG7A 3BGFA 2O8CA 3CO0P 4DR1K 4MIBA 3EJMA 4DTJA 4U7UK 1FI4A 2DR6A 3NCQA 3I5AA 2J76E 2QG9B 3QZ7A 1SUQB 1BA1A 3SCIE 4M3TA 1UETA 3VCDA 1VC5A 5FRNA 3M8YA 4ED0A 2HMIA 3PUFA 4DR7K 4KR0B 1RTIB 2O8FB 2A2CA 3IM8A 2V69A 2CNKB 3R8YA 1SXLA 4L75A 4CQ1A 2KB2A 1RHJB 4F26A 2AD9A 1FRXA 2V4RA 3UB5A 1ZPVA 1YUWA 1BE4A 2ZJQQ 4NYZA 2OPPB 4ZVUB 4AHSA 4WFBL 3TX0A 2XMKA 2ZH2A 3BR9A 2DNOA 2Z58B 4GVBB 2AP6A 1MDUB 4WQ5C 4QOZB 4E7LA 4FS1A 1WG1A 2FVQA 3G9CA 3TZZA 3ZC4A 3FGVA 3OUYB 3IFRA 4F04B 2P9NB 2QO3A 4U8YA 4I64A 4RBUA 2B51A 2W4DA 3B6OA 3TZXA 3DXMB 4KTQA 2XC9A 2MKIA 4MKYA 3KJVB 3A8EA 1P9QC 5FLXO 2XEXA 3RBDA 1NSKL 3V6DA 1JJ2R 4CT8A 2CJBA 3R8EA 2E5JA 2BR0A 3N0VA 5BPMA 4Z4IA 3P49B 1HD1A 2K06A 5EXWA 4A57A 1FJCA 2B6AA 1X60A 4RW7B 3OYFA 3G8TA 4DUZJ 5CYQA 1T9YA 3MDQA 4FF2A 2IM2A 2KT5A 4PRFA 1K6YA 4UOHA 5E3QA 3CIZA 4RUAA 3ULHA 5IM0A 2EFVA 1MLAA 2GVDA 4Z4EA 5HMZA 2J7KA 5L1KA 3FFKB 5AZJB 5E2QA 4IDKB 3AHPA 3AVBA 3WQUA 1IKYB 3CCSS 2UVVA 1XJWB 4NLVA 2HWTA 1S9GB 3W64A 3LM9A 3CJ3A 5SWMA 4O0NA 6AT1B 3HJFA 1FRKA 3CD5A 3FQKA 4M1KA 3DJCA 2RAQA 2K1RA 3D9BA 2KFYA 4ZHRB 3MM7B 3D2FB 3DOLA 2F7VA 5JMNA 1LOTB 1GLBG 3QGHA 1KCFA 1P6TA 3D54A 2FSNA 3PO4A 4H8KA 4L3NA 1IBKK 3L7PA 1U2RA 3MURP 4DB3A 1J2VA 2RHSB 1DTTB 5A2QU 3LPYA 1XNRF 2VH7A 1S0OA 4IXCA 4F8RA 2LKZA 2E2OA 2EKYA 1JL2A 3DHWC 2BJDA 2CPXA 2FGOA 4KO0A 1ZA2B 3OL9A 1DQ8A 4ZVFA 5AQLA 3NMRA 1F9FA 3EXCX 2HYIB 2GQQA 1F0XA 3TNVA 4AE5A 3SMSA 2D69A 3GIKA 3EKSA 3T1YJ 1DKGD 3A1YG 5HQMA 2CPHA 4BCAA 4ZVEA 3HRGA 3DU5A 3TA0A 3JTNA 1UCNA 1S6OA 1N8RT 1IBCB 1BXNA 3PDNA 4DV3J 4BR2A 4TU9A 4GVMA 1RILA 4RW6B 2VC1A 4GV6A 4RBVA 3LP2B 9RUBA 3W9HA 4TLRA 3T1YK 2QA4S 3N79A 4RNFA 4BC3A 4K8XA 2BRKA 3NGRA 4BR4A 3IRWP 2UXDK 1UW9A 1J53A 5K9FA 4BQZA 4JI7K 4JYAJ 3C7NA 3DLLL 5AQWA 1J9AA 2N7CA 5DMRA 4W5NA 2KW4A 3NF6A 2A18A 4AF1A 4CLSA 4ED5A 1S7HA 3DXBA 2VKRA 4HH1A 2NPFA 2NRRA 1X4DA 5D15A 3HZGA 4FPAA 4K5RA 1U47A 3AJ2A 5SUHA 2WZ1A 1X4CA 4P7VA 2RILA 3CCMN 1SC6A 5BN8A 5KFDA 3PACA 2L9NA 3GYGA 3NRBA 2UXDJ 4FPIA 1G99A 2C2KB 2IM1A 3AAQA 4Q43A 5CAAA 4IKAA 1P9YA 1F9HA 4CZEA 2K2PA 4YOTA 4K42A 5AQJA 4C3KA 3OTBA 1EX8A 3V4IB 2LLZA 2W40A 4PG5A 4ILMA 1T9TA 2ZNZA 4IOAQ 1N48A 1XQSC 2HHUA 3DLGA 4MDBA 2BOPA 3IUCA 3UDVA 1IR0A 4J9RA 3O5TB 1RWKB 5BJRA 3R5JB 3Q86A 5KI6A 1HQEB 4KAZA 4FJIA 2WTUA 4MDAA 3EL2A 4RW4A 2LEBA 1HWJA 2DO0A 2ZBPA 3K2YA 3HYFA 1MNEA 3CCVN 1SJRA 2QKKA 1CZAN