3MECA

Hiv-1 reverse transcriptase in complex with tmc125
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
552
structure length
550
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of HIV-1 Reverse Transcriptase with Etravirine (TMC125) and Rilpivirine (TMC278): Implications for Drug Design.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
molecule keywords p66 Reverse transcriptase
total genus 149
structure length 550
sequence length 552
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3mecA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3mecA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3mecA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3mecA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3mecA05
3IS9A 3ZSOA 4TY8A 1JKHA 2OA8A 3C6UB 4AHVA 3QEVA 3HXMA 1G15A 1VRUA 1TL1A 3CM6A 4Z4EA 4Z4GA 3IG1B 3GILA 3VQ7A 2R2SA 1D9FA 4LY7A 2AX1A 1K6YA 3AVLA 4N41A 4U6PA 1RBRA 1TK0A 4Z4FA 3PJWA 4MQ3A 1KHVA 1IKVA 3NAIA 3MEEA 3SQ0A 4DL4A 3VQCA 4EP4A 4CJRA 4HUFA 4M42A 1F21A 2OH2A 4ECRA 3S3OA 2FBXA 3BGRA 4QWCA 2XGQA 3G0ZA 2W9BB 1HPZB 2AX0A 4PWDA 4CGIA 4IQXA 3V4IA 1C0UB 3HVRA 4FJ5A 3BDPA 3T5JA 1QSLA 1LWCB 3GIJA 2YNHA 4CGDA 4QWAA 3I5AA 1ZETA 3MXJA 5KGXA 4RNHA 2YNIA 2DPJA 4CERA 3MTKA 1BIUA 3DYAA 3G6YA 2R8HA 3ZCMA 4RUAA 4DEZA 4DTSA 2HB5A 3PW7A 3KD1E 2Y1JA 2BE2B 1TV6B 4FZXC 1S48A 4ZMMA 1GOAA 2BGGA 1CXQA 4TLRA 3PO5A 1XR6A 4TXSA 4O55A 4R8UA 3RWUA 3QIPA 2HVIA 3KLHB 3LZJA 1TKTB 4LSNA 4W5QA 2G8HA 4EZ9A 3G86A 4FM2A 1TQLA 3IAYA 1C0MA 2IOCA 3NHGA 4IG3A 2IAJA 5EWFA 2XRIA 2D3ZA 5I3UB 5F8JA 4DTPA 3OS0A 5J2PA 3BR9A 1I6JA 4MFBA 3OSNA 4XO0A 4IKAA 2XY5A 2RF2B 4K4YA 1JLQB 3AVKA 1JKHB 1KCFA 1U47A 4M94A 2J6UA 2V4RA 1S10A 2JEIA 2DFHA 3AVIA 2C28A 4EYHB 1S6QA 3DOLB 3SPZA 1TKDA 2QV6A 4IDKA 2FJXA 2JEFA 1OS5A 1QE1B 1S9EB 3HL8A 1U04A 4I9QA 4K8XA 4ZPCA 3V6DB 2B6AA 4NRUA 1IKXB 1QQCA 4NLPA 4E7JA 4N56A 1FKPB 1DTQB 3HVTB 1VRTA 4C8LA 2R8IA 3QEPA 1C1AA 2OPPB 3HYFA 5HLFA 3KLVA 2HHQA 4O3SA 3CO9A 5EWGA 4J9QA 4GMJB 1QSYA 4KB7A 3NGDA 4K4UA 4FLVA 4F2SA 3DLKA 2Z1GA 1KTQA 2FBTA 3CFPA 1JLEB 2ASLA 4KFBA 4TQRA 1NNDA 1WSHA 4Y1DA 3DM2B 2HAIA 1RT4A 2FJWA 2HVHA 3TI0A 3U3GA 3GIIA 1TV6A 4C8NA 4FK4A 3DMJA 3DLHA 3DRRB 4Z4IA 4KE5A 3HVWA 5L1IA 4ECVA 4ID5B 1GX5A 4O4RA 1IG9A 4ECSA 5KFQA 4FJKA 2VG7B 4FK0A 3H4BA 3MXIA 4B3OA 3WNFA 4NLUA 4YMEA 3AVMA 4J9SA 4NLVA 1T8EA 3M8RA 3KMSA 2BANB 4ZHRA 3CDUA 3SPYA 1FK9B 3RR7A 4J9NA 3OYHA 4CE9A 1NJZA 5I3UA 4Q8EA 1NKEA 5E41A 3PHEA 1HNVB 5C5JA 5EWEA 3LANA 2YKMB 2R8KA 4MK7A 3CJ2A 1KHWA 1J5OA 1CLQA 1S0OA 3NCIA 2OPSB 3V1RA 1SKWA 4DMNA 2ITGA 5I42A 5CYMA 1JXLA 3I8DA 4K4SA 4CEEA 1ZBLA 5KFUA 1QAIA 4XPCA 1N5YA 1C2PA 4KSEB 3D0PA 1C1BA 3G6XA 4BWJA 4O0IA 3AO1A 4RW9B 3PZPA 5KG1A 1S9GA 5HROA 1S6PB 4H4MB 3MAQA 3UQSA 5L9XA 4FJMA 1KLMA 3DDKA 4I2PB 4IH7A 3PR5B 3ZT3A 5KFKA 3CFRA 4GW6A 3AA5X 4MIBA 3NH2A 3QETA 1TVRB 3ULDA 4NYFA 1XHXA 4AHRA 4OKJA 2DFFA 4JV1A 5J2PB 3UPFA 2PZSA 3AVFA 4DFJA 2HNZA 3BQ2A 1W0HA 3O3FA 2XGPA 3O4NA 5DGAA 3NMAA 2HWHA 1RT6A 3FFIA 3CWJA 4FZZA 1RCHA 1HQEB 5HP1A 5KFZA 5KFJA 1JLCA 1KRPA 1VSFA 4QCLA 2ZQBA 5HRRA 3RRHA 4WZQA 4CJVA 2YV0X 2VG5A 1NK5A 3DLGA 2RN2A 2ETJA 3C6UA 4ED2A 4CFDA 1U4BA 1BHLA 3LPUA 4ZTJA 2JEJA 3OJSA 2O5DA 3OYIA 1SUQA 4DTMA 4BE1A 5F8GA 4F8RA 3C6TB 4B9SA 1RILA 3H98A 3RRGA 4KPYA 1TL3B 2HHXA 3RR8A 3KK1B 2J6SA 3FSIA 1T03B 1HMVA 4ICLB 5FROA 4HHTA 4N5SA 4JV2A 2FBYA 4Q0BA 3QYYA 4OLBA 3JSMA 2IA6A 3TABA 5SWMA 3K5LA 4CHZA 4I2QB 3FQKA 3NE6A 3OSPA 1XWLA 2Y1IA 4W5TA 4NLTA 1RDDA 4CEZA 3Q8SB 1EKEA 1JLFA 4KV8B 3DRRA 4J2BA 1RT7B 3E51A 1NK8A 5KFPA 3K5MA 1SL0A 5EDWA 2QE5A 1C0UA 1VSDA 4FJNA 1C1CB 3K57A 4EZ6A 3RBEA 2PYJA 4EEYA 3LWMA 3M8QA 4DU3A 3O4QA 3VQBA 3PJXA 4K8ZA 3MECA 2KQ2A 4K50A 1K1SA 4DG1A 3NF9A 5DMRA 3QGHA 2W42A 1RA7A 1RBUA 2HHWA 4KHRA 4J9LA 4QWDA 4CECA 3OL6A 5KTQA 4M3UA 3ASMA 4FLYA 4KO0B 5FDLB 4ED7A 5HRNA 3U6FA 5KFOA 4FBUA 4KI6A 4AHTA 3HJFA 1J5OB 1S1TA 4LQ3A 4LSNB 5L1LA 4NLSA 1VSLA 2OPSA 2DFEA 3ISNC 4IBNA 3I0RB 4IFYB 5DGBA 4KREA 3Q8QB 3QO9B 1TP7A 4CJ3A 2DY4A 5KG4A 1RTHB 4DSLA 1X1PA 3L2UA 1HYZA 1T3NA 4Q43A 1FXXA 2ZD1B 4M41A 1RNHA 4DLGA 5F9LA 5J1EB 4DS4A 2OPQA 2RF2A 4M3ZA 3KJVB 1NOYA 5KFRA 1BQNB 3IRXB 1Z25A 4MKBA 3VQ8A 3D45A 3MEDB 4M45A 1RT3B 4RW7B 1JLBB 3EZ5A 4FLZA 1WSIA 4M95A 2F8EX 1ASWA 2E9TA 4L8RB 3V6DA 3KHRA 3WNHA 4CJWA 4NLYA 2C22A 3LP1B 4Y3CA 1IKXA 4ED0A 1NHUA 4E19A 5DQGA 2IM0A 2HNZB 3OYFA 3OLBA 3K59A 3JYTA 4CJUA 3UDLA 3VQ4A 2B43A 2FVCA 1VK0A 2W9AA 1TK8A 1RT2A 3KLIA 1FKPA 3HT3A 3DLKB 4FS1A 4QWBA 4KAIA 4O3RA 2X74A 2GC8A 5KG3A 3BSNA 3I0SA 3SI8A 4FJJA 4DS5A 3K2PA 3KLFB 5KG2A 3SUOA 3ZSYA 4CK2A 4OPKA 3OYEA 3IGVA 2D5RA 4OLAA 4DSKA 4WE1B 1S49A 1LWCA 3FRZA 4ECZA 3AA2A 1TL3A 4Y2AA 4BACA 4FLTA 2YNIB 4ID5A 3DYAB 5K14B 3QINA 3L2VA 3SZ2A 3Q8PB 3AVJA 3QZ7A 3T19A 2IC3B 4KB0A 3V81B 1HNVA 3DLEB 5HRPA 4K4XA 1NKBA 4B08A 4EYIB 3QLHB 2HWIA 2FLLA 4HUEA 2ZD1A 1C0TB 3KLHA 2RDIA 3L3VA 3AV9A 3SQ2A 4LD0A 4AHCA 3ZT1A 3HP6A 3QGIA 2IM2A 5JUMA 4KAZA 2AU0A 4CK1A 5KFMA 4ECXA 3SV4A 1RTIA 1IO2A 2HHSA 1TAUA 2O4GA 3TAGA 3KKSA 3KKRA 2V4QA 2BQ3A 1WSJA 2R2TA 1TKXB 5CYMB 3OYGA 4O44B 3VA3A 2FJVA 2ILYA 1JLGA 4NCGB 2OZMA 3LP1A 4F4ZA 5KG6A 3GIMA 3QEIA 4FJHA 4IH5A 1A5WA 4I2PA 5DG9A 4O5BA 4QW8A 1RTDB 5HRSA 4BDPA 4B9UA 3OYNA 3RB4A 3P5JA 4DL3A 1L5UA 4NCAA 2CJQA 4B8CA 1RDRA 4IFYA 5DQHA 3DLBA 3EPGA 3PW5A 2GBZA 4E7IA 3AO5A 3UR0A 4E89A 4G1QB 4NCBA 4LQ9A 1JIHA 3V9SA 4JLHA 2OPPA 1XR5A 4KHYA 4DQSA 5DLFA 4HYKA 4CEDA 3PY8A 5J2NB 2WRMA 2VG5B 3WNGA 4DL2A 3RB6A 3CJ5A 4OVLA 4QOZB 2XI2A 1JLEA 2AGOA 4ZPBA 3K58A 5F8MA 4ZTFA 4PQUB 2VA3A 4CF9A 3ZSQA 1W25A 5KT4A 4WYWA 2WONA 2YKNB 3OLAA 4PA1A 4JRPA 4ELTA 2HHTA 3TAMB 3KK2B 4PWDB 1SUQB 1S0NA 4Y34A 4RW8A 2HHUA 3DOKA 4XIUA 3SQ4A 2XHBA 3G6VA 1S5JA 2V0NA 1O1WA 2YNHB 4WZMA 4E0DA 1QAJA 1NK6A 1RT2B 3HM9A 4Q0BB 1UA1A 4FJ9A 1CZBA 3T1AA 1SH3A 4NZ0A 3TARA 1VSMA 4FVMA 1WAFA 4RG8A 4J2AA 1IM4A 3HO1A 3L2QA 3KK3A 2ALZA 3BSAA 4QWEA 3KLFA 4DQRA 5KFVA 2UUTA 4ZP7A 3LP0B 3M9MB 4JV0A 3VQ9A 2R7YA 3MR6A 2HW3A 1HARA 1LWEA 4G3IA 4B9NA 4CIFA 3MR3A 2ATQA 2YHBA 1IKWB 2AQ4A 3OS1A 3MECB 2FC0A 1N4LA 4DLEA 2A1RA 4Y2CA 1Z26A 4U7CA 5I42B 3SYZA 2V9WA 4TY9A 5J2QA 3M8QB 4Q5VA 1NK4A 1UWBB 1T94A 4R5PA 3GYNA 2P1JA 4DQPA 1C6VA 1ZYQA 4CEOA 1L3VA 4ED3A 3ISND 5CZ2A 1JLQA 3KMQA 4E1MA 4H4MA 5J2MB 4DL7A 2GIRA 4W5RA 4RNOA 4FJ8A 4GC7A 3QO9A 3BJYA 3BSOA 4ED1A 4TYBA 3AVHA 3O3HA 2EHGA 2ASJA 2D0BA 3TAQA 1HJRA 3MFHA 2IBKA 1TVRA 5DLGA 4F3OA 4IFVA 4OGCA 2CKWA 2WOMA 2JGUA 5JXSA 3AA3A 4ELUA 4CJTA 2EC0A 3H08A 1RDCA 2ZE2A 4URQU 1R0AB 2F8SA 4NCGA 1VSHA 3IRXA 2VA2A 3F73A 2WONB 5KG5A 3V1OA 5KFYA 1CXUA 3MEDA 4KHNA 2OPQB 3HVAA 1ASUA 3KLGA 4H4OA 1DLOB 3L3UA 2ILZA 4DFMA 1NJYA 4XPEA 4CEQA 4WFYA 2ATLA 5CZ1A 1N56A 3PO4A 4ED6A 1L3SA 4BDYA 3NGZA 1BQMA 3QIDA 5KG7A 5KFIA 4C8OA 4YNQA 4E7KA 3C95A 1ZTWA 3DMJB 4TN2A 1S1VB 1B9FA 3M8SA 4FYDA 4AHSA 2UUWA 1T03A 2BQUA 4CGFA 3Q8RB 3KLIB 4DL5A 3RMBA 4IG0A 4C8MA 1FKOB 4IRDA 1BI4A 5F8LA 3LZIA 3I0SB 3LP2B 2AGQA 4LH5A 2F96A 2RKIB 4MH8A 4WE1A 2IMWP 2Z1HA 5C42B 1NKCA 2FVRA 2UVRA 2XY8A 2VWJA 4Z4HA 1CZ9A 4J9OA 4FZYA 3EYZA 3NFAA 1MU2B 4KKOA 3VQSA 3DI6A 3CG7A 4NLWA 1J54A 2UVVA 4DTUA 2IC3A 4QPXA 5KFHA 4I7FA 3TWHA 3MXMA 3HK2A 4RU9A 3SNNA 2HMIB 4AH9A 4FJIA 3QESA 3LP3A 3V81A 3EY1A 4HUGA 5C25B 3QLHA 1KVCA 2QK9A 3CJ4A 1YVUA 3B6OA 1RTIB 3SFGA 4RNMA 3VQAA 3I0RA 2W8LA 1VSIA 3TQ1A 4R0EA 1U45A 3T5KA 4CJEA 3M8PA 2YNFA 4ECQA 1UWBA 5DQIA 5C24B 1HYSA 1L3TA 2BQRA 1X9MA 1VRUB 5F8IA 1S1XB 3S9HA 4WXWA 2A1SA 3KJVA 4Z4CA 4OKKA 4CHQA 1WSGA 3FFIB 2X78A 3CQ8A 1QTMA 1RT3A 5KFTA 3SI6A 4IG3B 3SUNA 3AVAA 3DLGB 3P1GA 3RBDA 3NBPA 5DG7A 3NDKA 2P5OA 5HBMB 3MFIA 4MFBB 1WNSA 1HPZA 4CFBA 2KZZA 4FW2A 4DTXA 1HNIB 3JYTB 1SH2A 3G10A 3MEGA 2D7SA 1S9FA 4IH6A 2XY6A 2IS3A 1VSKA 4KI4A 4CJFA 4DWIA 2J6TA 3I5BA 4CGJA 4DF8A 1S6QB 3DOLA 1BISA 4NLXA 4K4VA 3C94A 2AWZA 4O3NA 2HNDA 1ZBHA 4ZP6A 1IKYA 1CSJA 3LPTA 2YKNA 3AO3A 1SV5B 2BANA 3VQ6A 3CJ3A 4Q44A 4Z0UA 4O4GA 4PQUA 1S1WB 3OY9A 4FW1A 2GUIA 1RT7A 3HVTA 4EO8A 4HCBA 5HLFB 5K14A 3VN5A 3RAQA 4O3PA 1L3UA 2IAJB 4DSJA 4RW6B 3KTQA 4JUZA 3H40A 4F4XA 1KLNA 4FJ7A 2WB4A 1EETA 3QNNA 3QIOA 2W9CA 2YNGA 2BRLA 3DLEA 3OYDA 4M3WA 3ZT4A 1RDAA 3KK3B 5KFAA 2KTQA 1EP4A 5C42A 1Q8IA 5C24A 1HYSB 4NLQA 5KRTA 3GIKA 3NAEA 3HPOA 4RUCA 4AILC 4CFAA 1RBVA 4URSA 1WSEA 3T5HA 4IRCA 5T14A 3A2FA 5J2QB 3H5UA 4HVJA 4CCHA 4FLUA 3OYJA 1IKWA 2GIQA 5SZTA 3OS2A 3DRPB 1QE1A 1S9EA 3KNAA 2E6MA 2HMIA 5KFSA 1XR7A 1BL3A 4F2RA 5J2MA 3AVCA 3QERA 1BCOA 5KGWA 3ZSXA 4DSFA 1JXBA 3OYMA 1KFSA 1VRTB 3RAXA 4F4WA 4OJRA 1BQNA 1RBTA 3LDSA 4BE0A 3NL0A 5FRNA 1A5XA 3TR8A 2WOMB 1SKRA 4H8KA 1RAJA 4H54A 3UIQA 5F9NA 2BDPA 4J9MA 3SJJA 4CGGA 2XI3A 4YR2A 5D3GA 3ZSRA 4B9VA 1S1UB 4IFVB 1N48A 3DRSA 3BQ0A 3ZSVA 2KFZA 3ITHB 3V6JA 1SV5A 1RT5B 1QSSA 3KHGA 2IGIA 2AJQA 3AO2A 2ZE2B 2BRKA 5JS2A 5HROB 2VG7A 3QGGA 3L8BA 4EBCA 4CK3A 4CJSA 2VG6A 3LAKA 4DTJA 1WN7A 4MK8A 3PX4A 5CY4A 1XHZA 4RW4B 2E9ZA 1YT3A 3SV3A 3V6HA 1NK9A 2OZSA 1REVB 4TQSA 2QKBA 4H4OB 4NLOA 3GV8B 4YFUA 1LV5A 2KW4A 3KLEA 1N6QA 4FJLA 1BQMB 4RW8B 3LALA 3CDWA 4FK2A 4OL8A 4OPJA 3AA4A 3WNEA 4HKQA 5KFWA 4CF1A 2WK4A 4CEAA 2XC9A 3OJUA 3M9NB 4PY5A 4IOBA 2PY5A 2UVWA 2ZKUA 3HPHA 5EU7A 3DM2A 2HNDB 4GC6A 1IKYB 2RKIA 1BCMA 1SL2A 4J9PA 1FKOA 1HYVA 4CF8A 1WLJA 3AO4A 3IGNA 1YTAA 3I5CA 4M3XA 4CHOA 4O3OA 5F8NA 1S6PA 2FVQA 3DI6B 5DK5A 1GX6A 2AGPA 2IJFA 4W5OA 1D9DA 1FK9A 4DTOA 1LW0B 1A5VA 4YQWA 1HMVB 4ICLA 3PW0A 2BR0A 4FJXA 2IM1A 3GQCA 1X9SA 4FM0A 2BE2A 3LWLA 1KVAA 4NLRA 2D0CA 3RTVA 1ASVA 3QNOA 2HNYB 2WCXA 2F8TA 4R8UB 1EP4B 2W8KA 3SQ1A 1JLFB 4KV8A 5CYQA 4WFXA 2XCAA 3EPIA 3ITHA 1UOCA 2FBVA 4DTRA 3CJ0A 4ZVGA 4CJLA 4FCYA 5L1KA 2B5JA 1RTJB 3CYMA 4ECUA 1RA6A 1GOBA 1RT1B 2GV9A 4CJ5A 2VG6B 4F4YA 1TAQA 4LSLB 3SUQA 3HP9A 1C1BB 4JRQA 1ZBIA 5KT6A 5JS1A 3VQDA 4KB1A 4QAGA 4TSXA 1JXEA 4J9KA 3C6TA 1IH7A 1NOZA 2B4JA 4K4WA 4O3QA 2G8KA 1I3AA 3RMDA 3KIOA 4E3SA 4KO0A 1GOCA 4JS5A 3O3GA 4URGA 1S1XA 3PR4A 4DF4A 1U48A 1S1TB 3KLGB 4DFPA 3NBPB 3CDEA 4F4KA 1D1UA 2G8IA 1YTUA 3IS9B 4KRFA 3AVGA 4TY8B 2G8VA 1T05A 4DU1A 3MEGB 5KFXA 4NYZA 2JEGA 4DSEA 1LW2A 5HP1B 1WAJA 3NGYA 1JLCB 3SFUA 1HNIA 5KFBA 1YVFA 4MKAA 4YP3A 4ED8A 2KZMA 3OYBA 3NF6A 4PUOB 2E9RX 1TKZB 4B9TA 1JLAA 4O0JA 4CJ4A 4E7HA 4IG0B 1IKVB 2LSNA 1BI4B 3MEEB 1Z4UA 3OL8A 3VQPA 1T7PA 1QUVA 3V9ZA 4F3TA 4O4GB 2PYLA 1S1WA 2C2DA 4IR1A 3LP0A 4E1NA 1HQUA 1N6QB 3KK1A 1NJWA 1C0TA 1LWEB 4RW6A 4KHQA 3KHLA 4CHPA 4CJPA 1EETB 5KT7A 3KD5E 4J2EA 1EXQA 4CHNA 2D3UA 2IJNA 1TGOA 2Z1JA 1NHVA 4IRKA 4CESA 4I7FB 3S3MA 4KHSA 2XCPA 1I39A 2D0AA 3L2RA 2IM3A 1K1QA 4R5PB 2Q3SA 4FLXA 4DTNA 3ZT2A 2D41A 4ZP8A 4J2DA 4BDZA 1Q9XA 3H5YA 3MF5A 5KFLA 3NH1A 3CIZA 4ECYA 2RPIA 5L1JA 1RTDA 1LAWA 1XC9A 4DG1B 2ASDA 1JLBA 3NKYA 2DPIA 4M3RA 3H59A 3NF8A 3PV8A 4JS4A 1UAXA 2OPRA 4NYNA 1RDBA 3HHKA 1MMLA 4DQQA 4FS2A 5FDLA 1W9HA 4CFCA 3ZSZA 4FBTA 3N6LA 3RMAA 5KRSA 2EX3A 3OYCA 3PW2A 4ZVFA 1LWFA 1J53A 2R2UA 4IKFA 1X9WA 1RTHA 4DL6A 3KOAA 3TVKA 5D3GB 5KFGA 1VSJA 1D5AA 3N6MA 4K4TA 1NK7A 1TKXA 5J1EA 2WTFA 2C2RA 1ZBFA 3V9WA 3T3FA 1S1UA 4CEFA 3K5OA 1JL2A 1RYRA 1RT6B 1HQUB 4RNFA 3GV7B 3DOKB 4CF2A 4RW7A 4KBIA 2IDOA 4C8KA 5KI6A 1UA0A 3EZUA 3AVNA 2JC1A 3V9XA 2JC0A 4N47A 3SCXA 3OL9A 3DLRA 3OYLA 2X6SA 2W9BA 2VWKA 4KFBB 1XI1A 1B92A 2W7PA 1BGXT 1S0MA 3NF7A 4KHMA 3ICLA 4BWMA 4J9RA 4B9MA 2XWYA 1S4FA 5KFDA 3IN5A 4B3OB 4CJQA 4EP5A 5J2NA 4EBDA 3PW4A 1JL1A 1U49A 1JLAB 4B8AB 4ZVHA 3M9OB 1VSEA 2YNGB 4ZHRB 3P83D 4N76A 2FLNA 4DSIA 4DQIA 4O44A 2OPRB 3D28A 2P5GA 5FRMA 4CF0A 3TAPA 4X2BA 1KVBA 3TAMA 3KK2A 1HRHA 1WSFA 3NH0A 2YKMA 1ZBUA 4CJKA 1SH0A 3H5SA 4FLWA 5F8HA 4ZVEA 4HTUA 3OHAA 1TKTA 2R2RA 3KHHA 4FXDA 4KTZA 1LWFB 4DFKA 3BREA 4W5NA 4MK9A 3PUFA 5KG0A 1J9AA 3DRPA 1LW0A 2FLPA 4ZP9A 2YNFB 4G1QA 1NJXA 2HNYA 4Q45A 3NGIA 4UQGA 5CYQB 4BE2A 1SL1A 2QXFA 3OVNA 4RW9A 4Q8FA 4FJGA 3H2LA 3RB0A 1Q9YA 3QEXA 4MIAA 3L2WA 1RYSA 2I1RA 1SKSA 4KTWA 1D8YA 2W7OA 2OYQA 4OGEA 3HKWA 3PVXA 1RTJA 1D0EA 5KT3A 1RT1A 3THVA 1DLOA 2NUBA 1LAVA 2E4LA 3OYKA 1QS4A 1Y97A 4GVMA 5HBMA 1RT5A 1DTQA 3OYAA 3D5MA 1TL1B 1QHTA 4TYAA 4I9LA 4HCCA 4F50A 3S3NA 3IG1A 1DTTB 2QKKA 3FQLA 3PX0A 3QEWA 4KHWA 1REVA 5KFEA 3ALYA 3ZT0A 3OL7A 3U3YA 3H4DA 2XY7A 4AHUA 4KTQA 4CHYA 1LW2B 3KLEB 3CM5A 3LP2A 1R0AA 2HHVA 3E01B 1RT4B 1T05B 4YR3A 5EUHA 2JLEA 1TK5A 4ELVA 4PUOA 2C2EA 1TKZA 4WFZA 2I5JB 4NLDA 4ECWA 3HPGA 5KFNA 4CIGA 4B9LA 4KKOB 3VQQA 1ITGA 3GV5B 3OHBA 2X6NA 2W9CB 3K5NA 3JSMB 4CEBA 2R8JA 3NAHA 4I2QA 3N6NA 2YHAA 2O4IA 5DG8A 3QIPB 4Y1CA 3B6PA 4RZRA 1KFDA 1S1VA 3QZ8A 3H5XA 3MR5A 1C1CA 3CFOA 3VQ5A 2WHOA 3VQEA 3ZSWA 2RDJA 3BGRB 3CVKA 5KFCA 4ID1A 4YR0A 2KFNA 3MR2A 4DU4A 2E6LA 4WYLA 3M8PB 2G8WA 3V4IB 4M3TA 4EO6A 1S9GB 5KFFA 2R8GA 5KT2A 3AVBA 2DTUA 1U09A 1N5YB 2G8UA 3V9UA 2B5JB 4K4ZA 1MU2A 2P51A 1DTTA 3BQ1A 5T7BA 3F9KA 2FVPA 4IR9A 3TAFA 4IDKB 4NLGA 3RB3A 3SUPA 2G8FA 2FVSA 1KLMB 3V1QA 4QW9A 4LSLA 4LH4A 4CGHA 3TAEA 1JX4A 5KT5A 4RNNA 4ZPDA 4ZPAA 4WXOA 1EX4A 4ECTA 2UVUA 1JLGB 3DRSB 2XO7A 4E7LA 2B6AB 4NRTA 3V6KA 1KSPA 4OKEA 1ZTTA 3T5LA 4M3YA 3FDSA 1HQEA 3PX6A 1BIZA 4FM1A 5C25A 3TANA 1RBSA 3RMCA 4EBEA 3E01A 1B9DA 3VA0A 3LAMA 1NK0A 4KHUA 2Z1IA 3BSCA 1S97A 1WNEA 4RW4A 4CIEA 3HSTB 2I5JA
chains in the Genus database with same CATH superfamily
1LXNA 1JCFA 4UY85 5G4DA 1OYEA 2GO8A 4TY8A 3W60A 1JKHA 1JJ2R 2DXFA 2XWXA 1N0VC 3Q2TC 4TU8A 3QFWA 1TL1A 3VQ7A 2R2SA 1PG5B 4P71A 2AX1A 2FSKA 2DGTA 3PJWA 4W98A 4RUBA 4DN0A 3AHPA 4HVZA 4DL4A 2GWKA 3VQCA 2ZOMA 3E9LA 3VF2A 2OH2A 4CLKA 2QTWA 1MWKA 3S3OA 2FHKA 3BGRA 5CHCB 5EOYA 2NYIA 1Q7YT 2MQMA 3AT1B 2IVNA 4DX8H 4ANCA 2HS3A 5FLXO 1YJVA 1H2UX 1KQGB 3GIJA 3IDHA 4EK2A 3OW2M 3MCPA 1QAYA 2DPJA 5BR8K 3CETA 5E3QA 5JJBA 2JOQA 3HFKA 4AUKA 2WFBA 2C2NA 2NRTA 5LXRA 3B8AX 4K2JA 4BRFA 1SC4B 3KD1E 4FZXC 4BLGA 4M63C 3OFFA 2XB2D 5K9FA 4TXSA 1LNQA 2PMWA 3A8YA 3QIPA 1OIAA 1Q7LB 2QRRA 3O3LA 2FF3B 1WELA 2QJ3A 1YWXA 2IAJA 2E5LJ 2HFNA 1FWLA 2D1KA 2LLZA 3MMVA 3IMXA 2P9SB 1YHQN 2XRIA 3MN7A 3D6FB 3IUCA 3UKRB 1U7LA 2XYGB 4FWLA 3BR9A 2BEFA 1I6JA 5A2QO 4XO0A 4IKAA 3CQXA 5B0AA 3AVKA 4FPAA 1XMBA 4HH1A 3QFPA 1E6VA 1S10A 3TUJC 1KVJA 4MDBA 3AVIA 2C28A 4EYHB 5A8WA 3DOLB 3SPZA 1TKDA 3X3UA 2RHSB 1R43A 5M2PA 2DNHA 3L4QA 4PPDA 4BRNA 1XMQJ 3LDQA 1VC6A 3HL8A 3HFVA 2IMOA 4PAAA 3MPWA 3MUMP 3ZETB 4ZPCA 2NZ4A 4NLPA 4LR9A 1FXRA 1FKPB 1DTQB 2FZCB 1VRTA 1WI8A 2LQ5A 3Q0AA 5LY3A 2H5IB 1R8AA 2HHQA 3AGRA 4O3SA 4ZCMA 4M5NA 4IOXA 4BY9C 4DR5J 1X0FA 4K0KF 4ZCLA 2OTLN 2OEJA 2YX6A 2HAIA 4K0KJ 5ETPA 4AQYJ 3U3GA 3GIIA 1TV6A 3DMJA 3NWGA 3HVWA 1Q18A 4ECSA 1H74A 5KFQA 2Q1NA 4B9QA 1W97L 5T41A 4YMEA 2Q43A 3W5YA 4J9SA 2Z8QA 3KMSA 2RS8A 4ZHRA 1LK7A 5AQLA 3RR7A 4LF8F 4PL8A 5HANA 2HZCA 1N5QA 4JKGA 1NJZA 5I3UA 5IOLA 3HM8A 2PT0A 3PHEA 4CTAA 2YKMB 4DV5K 1B0VA 3A8KA 4Y0WA 3NCIA 5AQPA 1I51B 4DMNA 4HTJA 1N88A 2HWTA 4HWIA 4K4SA 4CZLA 4XPCA 1C2PA 1C1BA 3G6XA 4P2XA 3GFYA 2RU9A 4HI2A 4FJMA 3BBBA 3CO0P 3AARA 3GFXA 3ZT3A 4DV4J 2HYIB 1G6BA 4R25A 2GW8A 2WW8A 3NH2A 1PAEX 3ULDA 3R7BB 5BRDA 1XHXA 2VPZB 4BQLA 4OKJA 4JV1A 3I33A 5J2PB 2KT5A 4DFJA 2WBRA 4JI6F 3ZTSA 1LOTB 4WF9L 3O4NA 3PXGa 5DGAA 1U0HB 3CWJA 4A8QA 3IAS9 4A61A 2DNKA 3SSSA 1KQSR 5KFZA 3OFGA 4JK8A 1VSFA 3ENWA 3J80U 4JI3F 3F41A 3O8MA 3DLGA 1N34J 2RN2A 1HQ2A 2FC8A 4CFDA 1CZAN 5RUBA 4ZTJA 3T1YK 4OI1A 5F1XA 1SUQA 1HNXK 4B3MK 3C6TB 2LP4A 1K8AO 1HNZK 3MX5A 3J80Y 4F4AA 2LECA 1RILA 2JWLA 4JKDA 3G71N 3TSQA 3KK1B 3E2EA 4FOIA 4AL7A 3U1NA 3QBCA 4HHTA 4N5SA 4AM7A 3W1YC 2VBXA 3MXHP 1CJTA 2V50A 4WK1A 1E4FT 3OXFA 3JSMA 2IA6A 4IWVA 2V2QA 1R0BG 2QT7A 3T6BA 4CHZA 1C4AA 4CEZA 3Q8SB 1EKEA 5IM0B 3DRRA 2ZVSA 3H6EA 3J7ZO 2ZGYA 1SL0A 2ZM6J 5EDWA 1YBTA 1FRLA 1NHKL 1ZZNA 3R1LA 3F9MA 3A3PB 4V19J 3O4QA 1EHWA 3D3BJ 3PJXA 3K8VA 4DCHA 2ZJRL 2KQ2A 1IV0A 2C3UA 1GXUA 3FE1A 2UU9F 2XSFA 4KHRA 2R7SA 1XNQK 4J9LA 4QWDA 3ASMA 3AY9A 4JV5K 1YKWA 5FDLB 3U6FA 5KFOA 5B0BA 3MAAB 3JQMA 1J5OB 1IBKK 4DR3K 3RG6A 4YN3B 4NLSA 3NXZA 2OPSA 4IFYB 4KREA 3FZMA 4LF4K 4CJ3A 5TKWA 3BH7B 3M32B 4BRHA 4EFHA 5KG4A 1RTHB 1X1PA 3L2UA 2IRXA 3BH6B 2P9NA 2LEPA 4M41A 2FYXA 3OFHA 1RNHA 3GJRB 4DLGA 5F9LA 2HZVA 2UUCF 3NCPA 2DGXA 2O1PA 4DU8A 2VFSA 4LFAJ 1D9AA 4M3ZA 4IOCL 4IO9L 5A8KA 1EKSA 2GFFA 3IRXB 4LBHA 4OYPA 4MKBA 4AXJA 3ZZZA 1VQ5N 3MEDB 4M45A 5C10A 1WEYA 4WIQA 5L8RC 3GYGA 2JLGA 3HI9A 2E9TA 2UZAA 1U6FA 3WNHA 4FVCA 3C15B 4NA1A 3UN2A 3K59A 4ZLNA 3JYTA 4ZIVA 2RQCA 4E98A 4JBCA 2OI2A 1TK8A 1TR0A 5G0RA 3I9ZA 2X74A 1S6OA 4P7VA 2QSWA 1KAZA 4WQ5C 4YHHJ 3ZSYA 3GDQA 2EKNA 4NYOA 4AQYF 4I6AA 4OPKA 3VAGA 2G2ZA 1VBYA 3W9HA 3I82A 4DV5F 4BGBA 3FRZA 1UEUA 3CIPA 1Q79A 3U1MA 3D7EO 4A2AA 3AA2A 2ZJRQ 3M2VA 2YNIB 2UUBK 4FN5A 3MCAB 3SZ2A 4Z37A 1IN0A 4GV6A 4LF8K 3QZ7A 4MLHA 2W4DA 3HT0A 4IOAQ 3AOBA 2L9DA 3DLEB 2X1GA 3QLHB 1YJWS 4H0VB 5ELZA 2V68A 3TZWA 1N8RO 3QQCD 1WWHA 1OY8A 1Y5LB 3O08A 2XHCA 3QGIA 2ZZMA 4WKRA 3TUIC 5JUMA 1DZ5A 4CK1A 5KFMA 5AQWA 3F0NA 5IT4A 2O4GA 3OQ2A 4C0BA 1GLAG 2V4QA 2BQ3A 4QU6A 1Y7PA 4DR1F 4RKUC 3ZZYA 1JLGA 1YJ9N 4NCGB 2OZMA 2R7UA 5KG6A 4DR3F 3CCRN 3QEIA 3VAJA 1V5IB 1NGIA 1RTDB 4BDPA 3THWB 2EWHA 3P5JA 2W2PP 5JVHQ 4DL3A 4NCAA 1UVJA 1AT1B 4B8CA 4NWBA 3DLBA 2UU9K 4UOHA 2GBZA 3DFEA 4PXDA 3ZZOA 4E89A 4QYZJ 1YJWN 1GMWA 2AYEA 4ILRA 3TX8A 3V9SA 1CS4A 2B9XA 4PG7A 3CF5Q 3CCLS 1VQ8S 5IWAK 3G8TA 1Q81O 2VG5B 4Q2MA 1N33K 1S6UA 2ERRA 1VQ4S 3CJ5A 3VAMA 4OVLA 4BRPA 1S7IA 4C8YA 5CYJA 1A9NB 5GAGP 3C0BA 4ZTFA 1FEHA 4UZCA 1BMQB 5HAOA 4DV7F 2MB0B 4ELTA 3NOGA 3TAMB 3TJ8A 2NLXA 4RW8A 2WSEC 1ZS6A 5F3ZA 2XLKA 3U27A 1O1WA 2J8AA 1NK6A 1GLBG 1K0TA 3R5BA 2O8DB 4NZ0A 2YI1A 2O8EB 2A41A 2PGCA 3GJQB 1IM4A 3L2QA 3BSAA 3KLFA 5KFVA 3M9MB 1WHXA 4FNIA 2IYIA 1E4GT 3UKUB 3V4MA 4PG6A 1LWEA 2HG4A 3MN9A 4CIFA 3MR3A 1BUXA 2VJUA 2GIFA 2ATQA 2AQ4A 3OS1A 1IVZA 4DLEA 5ITHA 2V9WA 2WTUA 1PJ6A 5ETVA 4CZMA 4YHHF 1I3OB 1WKLA 1UWBB 2DPNA 3GYNA 4DQPA 3ISND 1UFLA 1VFJA 3EVMA 2HIYA 1SCJB 4FJ8A 4KT0C 3QJLA 4UTGA 1H73A 4LF6F 5C2GA 3AVHA 3GG4A 4FPIA 1HJRA 3HCXA 4M5DA 3MFHA 2VFTA 3ENHA 5GAGI 1O6XA 4ELUA 2CRLA 2EC0A 1TUUA 3O9QA 2ZE2A 2HAFA 3IKMA 2WVDA 3H1VX 2Z58B 2F8SA 4DU7A 1RADB 3CD6N 4NOHA 1HWKA 3RBZA 2BVZA 3V5RA 2IA0A 5AQZA 4WBFA 1FERA 2OPQB 3HVAA 1ASUA 4H4OA 4DPYA 2ILZA 2NS1B 1KC8T 4WFYA 4PKGA 4M5MA 4JI8K 2YWGA 4YS2A 3DRXA 1RP5A 4OI2A 1N56A 1FDAA 1L3SA 3D6TB 4BDYA 4RBUA 5CXTA 2EEYA 3NGUA 2NXJA 3ULEB 2BE7D 1AFIA 3T41A 2ASYA 4Z7YA 3M8SA 2DY9A 4BC9A 4JD2A 2ZJPQ 1CQNA 3UB5A 1T03A 3FZFA 5L46A 1S77D 2VJVA 3KLIB 4IG0A 2ZF5O 1NLKL 4A8OA 2GX8A 4JI1K 4C3MA 3LP2B 3HX9A 3FGUA 3WT0A 1PSDA 3CC7S 2Z1HA 1NKCA 3ILIA 2OO4A 3QWUA 2V5HG 5I3PA 4Z4HA 3ZLJA 4JI7K 1CZ9A 3VAFA 2IRYA 5L9NA 4GKJJ 4Y2IA 4QJVA 3HSJA 3CG7A 1J54A 4P74A 3LGHA 3EKUA 5M1FA 4PEOA 5KFHA 3HK2A 5IC6B 4FYWB 3SNNA 1PJ7A 4AH9A 4LFCJ 1BWEA 2XHWA 2C3MA 4U9RA 3BF3A 4HUGA 5LT5A 3CDBA 5BYRA 2QK9A 1NSPA 3PYDA 4I6WA 1NDKA 3H25A 3I0RA 3TQ1A 5HVGA 3VESA 5B7WA 2KH9A 5AZIB 4EU0A 3M8PA 1XNRK 4ECQA 1KQKA 2AEFA 5AQTA 1NLVA 5DQIA 1EIYB 5C24B 3LDOA 1VGYA 3M30B 4CH7A 1U24A 3M6GA 4U95A 4WXWA 5KQ8A 2A1SA 5D78A 1GLJO 3J80O 1KXPA 1WSGA 1Y0HA 4QIWD 2X78A 2BXJA 2AMCB 2QI2A 4LRCA 4DR4F 4TVAB 5KFTA 1I94K 3SI6A 2BJEA 4DV3K 4HTIA 2VQEF 4J8FA 3NDKA 3GJTB 2NXNA 2R4FA 4MFBB 2HPUA 1NRKA 5DM6L 3MEGA 1S9FA 2CGJA 2V63A 1HKAA 2VPXB 5AQXA 1O51A 3TEGA 3GPAA 2J6TA 6FDRA 4DF8A 1S6QB 3I55N 2DNYA 4NEYA 2DISA 4ZP6A 1IKYA 3CCES 3KG4A 1TL4A 1CULB 2YKNA 3M2RA 1SV5B 2LCWA 1D8ZA 2BANA 3VQ6A 3CJ3A 3IO1A 3LPEA 4B3TK 4A8SA 4Q44A 4O4GA 1CBKA 2MY7A 1WEXA 1S1WB 4LF9K 3OY9A 2FF6A 1S59A 5IV3A 4HCBA 4AL5A 4O23A 2ADCA 5K14A 3MM7A 4LBIA 4QS9A 3RAQA 3VN5A 1O8BA 2MEWA 2IAJB 4DSJA 5DRKA 4JUZA 1IM6A 3H40A 4PKDB 2WB4A 3BP8A 3SDEB 3OPKA 2N7YA 4K41A 1MN7A 3ZT4A 1FRJA 3PSIA 3FSYA 3NS7B 4PG4A 2WSFC 5KFAA 5C42A 3R3LA 4NLQA 4CO0A 5KRTA 5H9EJ 4CFAA 1WSEA 1OQ3A 2APOA 2QLJB 5T14A 3A2FA 4BC4A 5J2QB 4HVJA 2EFQA 1CQMA 4PHTX 4NE9C 2GIQA 5SZTA 3OS2A 2YJFA 3P5BP 2YH1A 4BC2A 2HF4A 4ZITA 2E6MA 4CO1A 5FPEA 2H54B 3CJCA 3PM9A 3OBWA 2UXCK 3P6YC 4DR5F 4G1IA 4F2RA 2FD2A 2B4PA 2V8PA 4USVA 3CB4A 4DCJB 2Y9HA 3ZSXA 3IFEA 2N4CA 1VRTB 3RAXA 4F4WA 1NGFA 1BQNA 5HMWA 3TR8A 1KEKA 4H8KA 1GXLA 3UIQA 5F9NA 1DRZA 4CGGA 4XK8C 4AE5A 4A5BA 3FBCA 1QVFM 1VQ9S 3ZSVA 2ZBQA 2UXDF 2KFZA 4DB3A 3WEEA 3W7BA 3KHGA 2XMAA 2AJQA 3AO2A 3ZX3A 2ZVIA 5AXNA 1MA9B 5JS2A 4TU7A 5M1OA 3VEVA 3QGGA 5IQ6A 5D4NA 2DIVA 1WOQA 5CY4A 3CCMS 5C15A 3W2VA 1KOOA 2ZH2A 1HR0J 5GIOA 4H0YB 1RZMA 2DNMA 2BTFA 4IEIA 2VV5A 3R8YA 4BRGA 4OYOA 2K3KA 1REGX 1VI7A 1N6QA 3DNCA 4FK2A 2DRBA 2RQ4A 4IO8A 5AJ3F 4GNIA 4LF5F 2WK4A 2XC9A 4DV1J 2ASPA 1HI1A 2EBGA 4BC3A 3DM2A 2CJXB 5BPLA 2I9SA 2WVCA 4GC6A 4MTPA 4CVNE 4CRJA 3WQTA 2RKIA 2OKQA 4IEEA 1SL2A 4K5RA 1HYVA 1MLAA 2DNNA 3VETA 1LFPA 5BJRA 2KM8B 5F8NA 1OY9A 1NDPA 1HHQA 5DK5A 4OYXA 2AGPA 2L9NA 4C1NK 5DJBA 1NJIT 1D9DA 2LU1A 1LW0B 5FLXU 3GFZA 3PW0A 4DX7A 2NNWA 3GQCA 1X9SA 3G87A 4CZKA 2XTJP 4FM0A 3KNGA 2MZSA 4JEPA 4A57A 3ZZPA 3QNOA 3L6QA 2F8TA 2K2PA 4R8UB 4OPAA 1JLFB 4KV8A 5LJ3Y 1B4SA 1HLWA 3ITHA 4ZVGA 4CJLA 2B5JA 3ZC4A 5L39A 2AJ0A 4DMZA 1RT1B 5TKYA 4G65A 2VG6B 3QRRA 4X4RA 4FYXB 4OZNA 4WKYA 1R89A 1YAGA 2GQ2A 4HDHA 1KONA 3MUVP 1MWQA 1RWPB 1ZBIA 4Z7CA 4TSXA 4J9KA 3IR5B 5J1PA 3C6TA 2MDAA 1IH7A 2B4JA 2GVZA 2E29A 3TVYA 1I3AA 3KIOA 2MQPA 3IRWP 4E3SA 3M1VB 1GMVA 3HHNB 3PR4A 4QU7A 4CNZA 1TUWA 4YB1P 2K3IA 3LF0A 3CMEN 2MJNA 4UOGA 1D1UA 3HSCA 3IS9B 4JI2F 2BJDA 1CC7A 2JEGA 2COLA 3ZXWA 4C1NI 3WX8A 1YJTA 1RWUA 1JLCB 3SFUA 3W66A 4HT7A 4MKAA 3HMJG 1QVGR 1ICEB 2DIUA 2M2BA 4ED8A 3OYBA 2E9RX 1TKZB 1UVMA 4B9TA 4CJ4A 1FDDA 4JI0F 5D4LA 5A76A 4TKTA 3B82A 2UV8A 1Z4UA 3OL8A 4A8MP 3G9CA 1T7PA 1G1XA 2A0FB 1RKIA 3RUBL 4U7BA 4OLPA 4JI8J 1NJWA 1C0TA 3SSQA 2QIFA 5GAGU 2DGWA 1XMQK 4CHPA 4LF5J 4FPBA 1X0PA 3MCOA 1BY9A 4C7QA 3ENOA 4NXMK 2D3UA 2YHWA 3CJ1A 4IRKA 3S3MA 4KHSA 2XCPA 1CJUB 4CLSA 1Y5IB 4WFBL 5GADI 4XH1A 2IM3A 2UV8G 5AFUA 3KJQB 4LFBJ 3EZOA 4FF2A 2GZOA 5CH7B 1Q8LA 3CJBA 2ACYA 4OZJA 5KFLA 4ECYA 1JJCB 3PFOA 1EWRA 4R0JA 2ASDA 4JP8A 2NRXA 1W26A 2LKZA 3UN3A 3TTDA 3R6LB 1YIJN 4DR2K 3WIVA 2V8GA 1G4CA 5IZHA 2N3LA 4FS2A 1W9HA 4CFCA 5K8NA 4X4NA 3GG0A 4FBTA 3G8QA 3RMAA 1NUEA 2V8DA 3PW2A 4ZVFA 2HLUA 1J53A 4IKFA 3BBCA 1X9WA 3TVKA 4JKFA 5D3GB 4DV0K 2ZC3A 2CJBA 5AXMA 3RRKA 4AM6A 2E44A 2J9EA 5F0WA 7FDRA 1IBLK 1FJEB 5GAHP 1ZBFA 3V9WA 3MM6B 1XMQF 2NR0A 1JL2A 5F0UA 3B8HA 1RT6B 3KWMA 4X4VA 2V52B 3I6PA 3GV7B 4RW7A 2OD6A 1B0PA 2XM3A 2Q6CA 3QT5A 1UA0A 3CCJN 1GLFO 3AVNA 4PG8A 5KPTA 2ATCB 3V9XA 3EUNA 2JC0A 5HVFA 4J37A 2DTJA 3OL9A 4F04B 3OYLA 1FHTA 2VWKA 4KFBB 1DFDA 2MSSA 3UVJA 3CCVS 4LF4J 5IWAF 4QIFA 3UCUP 2JHEA 1RAHB 3ICLA 3IN5A 2V34A 1RLCL 2V6AA 1JLAB 2HKEA 4FKXA 1R6YA 5C2FA 3M9OB 3P83D 1NXIA 2FLNA 2ROEA 4DQIA 2OPRB 4FWQA 3VGLA 5JMNA 2P5GA 5FRMA 3TAPA 4X2BA 3MI7X 1KVBA 1SH0A 1N34K 4DR6F 2H3GX 1GLEG 3N28A 3T1YJ 3PIOL 1LWFB 1VQLS 4W5NA 5DETA 2KYZA 1VQPS 1J9AA 5AQYA 1H1VA 3H2UB 2YNFB 1TUGB 2HNYA 1Z2LA 4RW9A 2DCUB 3JXOA 4DUZK 2OEMA 4DCOB 2QMWA 1RYSA 2GJ2A 2I1RA 2POKA 1SKSA 4KTWA 3BKFA 2GMJA 1WTBA 1VOMA 1RWVB 1LXJA 3FRYA 1DLOA 4P9SA 5BRHA 1KOHA 1LAVA 1QS4A 4R79A 1P1LA 2UUBJ 1X5SA 2EVZA 3THXA 1RT5A 2OCEA 1DTQA 1TL1B 4TYAA 1RI7A 5JVGL 2WUSA 1WHWA 3I56N 3JS6A 3Q8VA 2FJAB 4X84A 3CPWR 3EE8A 1NG9A 3DOMA 2GV1A 2JL9A 1REVA 2KDOA 4ZPWR 4ANDA 1GLLO 5KFEA 3J7YI 2M0GB 1YJNS 3ZT0A 1FA0A 3U3YA 3H4DA 4AHUA 4P73A 1HWUA 5CQGA 2X1AA 5GVQA 3CM5A 4CZCA 2V4JA 2HHVA 1H72C 1RT4B 4YR3A 3UKUA 5CZXA 1HNXF 2JLEA 3TSUA 4DUYK 3J7AP 4PUOA 1VC0A 1AA1B 3MAHA 4ECWA 2Q1LA 4B9LA 5IFMA 3CMQA 3P31A 4KKOB 1ITGA 5HJXA 4FSVA 3CHWA 2MKCA 2AZ1A 4BCAA 1YLXA 2QL7B 4X65J 1KS2A 4NASA 2R8JA 3NAHA 1DBDA 3HI0A 4I2QA 1NM2A 3HHLA 5IT9O 4EGLA 3QIPB 5D0GA 5I3QA 1HR0K 1S1VA 1QQMA 1C1CA 3VQ5A 2WHOA 3VQEA 2EFNA 2NZCA 1T9WA 1NWKA 2RDJA 5KFCA 1HWLA 3MWBA 4KR0B 2R9LA 4I56A 3DLLQ 1U2VB 3VTHA 3PKYA 4PRFA 2E6LA 1W2BR 2G8WA 2V2KA 4JI0J 3V4IB 4M3TA 2VKZG 3GONA 5DZ6A 3N4PA 1DAXA 2R8GA 3NWRA 2DTUA 2G8UA 2DR8A 3V9UA 1WJ9A 3PNIA 5ETRA 2FVPA 4BGAA 2E7XA 3SUPA 2G8FA 1T95A 2FVSA 1KLMB 1KAYA 4QW9A 4LSLA 3CC4S 4NB4A 4CGHA 3DDIA 3R9LA 4L73A 1JX4A 5KT5A 4ZPDA 2H9ZA 4ZPAA 1UW4A 3D2FA 4JYAF 3DRSB 3MURP 1OO0B 3H8YA 2ZFHA 4FM1A 3VF6A 2YPYA 4LF8J 5DDOC 1GK8A 4JD2B 1JCEA 5KPRA 3LAMA 1NK0A 1XNRF 2CH6A 2HSEB 5JLHA 4CIEA 1RBAA 3D67A 3R9PA 4DV6K 2E7VA 4QR2A 1KN6A 3C6UB 4ZN3A 4OI3A 1VRUA 3CM6A 4Z4EA 3VR1A 4J9VA 3H0PA 3IG1B 4F02A 2J7WA 1K6YA 1RBRA 2E8AA 1TK0A 1VQNN 4JHDB 1M1KT 3BBFA 2GVDA 3NAIA 2SXLA 3N9UC 5K20B 1VIXA 3MDFA 1BDGA 5K8OA 2VL1A 2CNNB 4FJ5A 1IJEB 1RKJA 2F8HA 4RJVA 3T5JA 3QMQA 1QSLA 3POTA 1XQIA 4EIAA 1ZETA 3MXJA 4ITSA 4JI1F 3PSFA 5KGXA 1QQNA 4CERA 3MTKA 1NH8A 3ZCMA 3VEZA 4RUAA 4QOTA 2VBWA 3BPDA 2HB5A 3RJMB 2BE2B 4OHXA 2ROGA 2X3DA 1S48A 1GOAA 4WP3A 2BGGA 1M5VC 4TLRA 1BE4A 4OYMA 2DK2A 4O55A 3NNAA 3RWUA 3KJFB 4RBVA 5AJ3J 5LMNF 4Q7AA 2IOCA 2QO3A 4XH5A 4P2SA 2C3YA 5J2PA 1R6VA 4J5OA 3C7NB 4MFBA 1VK8A 1JLQB 4ZPTR 2HQGA 3EGVA 2CPJA 4DHYA 4H5WA 3U9ZA 1KCFA 2DEJA 4M94A 2V4RA 2DBBA 3VGTA 3LDPA 3RSEA 2DFHA 5IT9Y 1S6QA 1H6KX 2YHXA 2Z57B 2KU7A 2QV6A 3RGIA 4M7XA 1XJWB 5B0EA 2J76E 1WBDA 2JEFA 1OS5A 1KQSM 2PEBA 1MROB 3ZEUA 1U2RA 4K8XA 5HVHA 3CCRS 1P8GA 2C3PA 2I7PA 4LIRA 1PGZA 3V6DB 2B6AA 4NRUA 5EX3A 2FJDB 3P39A 2C2KB 3QEPA 1C1AA 2MZ1A 4J9UE 3VCDA 4I67A 5EY4A 2F4VK 2FDNA 4JK9A 4A8FA 4BRAA 1GAOA 4HHUA 3CO9A 4J9QA 3E9OA 1EB0A 3OXLA 4K4UA 3NGDA 4DV5J 4WPAA 3J7Z5 4USWA 2FBTA 3P4IA 2VODA 3CFPA 1JLEB 2VCPA 1WSHA 4GMKA 4B3SF 3TI0A 2ZWHA 3DXKB 5IM0A 4FK4A 3DLHA 4Z4IA 3DRRB 2RNEA 2PD1A 3PYGA 5L1IA 1IG9A 2VG7B 4FK0A 3H4BA 3HKZD 4B3OA 2QFIA 4K42A 2RRBA 2B9YA 4LF7J 4NLVA 1T8EA 1ZXOA 1P9YA 4GKKK 5BPMA 3CDUA 1FK9B 2LEAA 3J8AA 4J9NA 2CQ0A 1J5EJ 4CE9A 1NKEA 5E41A 2XZDB 1U2FA 1FD8A 2KO1A 2M70A 1HNVB 4AYBD 4JB8B 1MN9A 3J7A1 4MK7A 2P9CA 1J5OA 2VDIA 4ETZA 1Q5YA 2O8CA 2OPSB 1MMDA 1SKWA 1U2CA 3Q86A 1DQAA 3HSDA 1T9TA 4P7TA 2ITGA 1HFEL 3CJTA 1VIOA 4CEEA 1KVKA 1ZBLA 2KJWA 1N5YA 3N5FA 4KSEB 3CW2C 4O0IA 3ULHA 1RTZA 3A8EA 5KG1A 1S9GA 2CVIA 2KHCA 4JOUA 2MKIA 3TUPA 4I2PB 3QGPA 3PR5B 2ZC4A 2CJYB 1GMWD 1TVRB 3QB0A 4F25A 4AHRA 4CZFA 4USKA 5HL7Q 2J8SA 1M90O 2XSJA 3UPFA 2PZSA 3AVFA 1W0HA 2XULA 4ES2A 2R7QA 2W2NP 3HF5A 3H1QA 1FJGK 2HWHA 2MPUA 1AZSA 1UZDA 3FFIA 1ATSA 4DPWA 3FZKA 1RCHA 4OFZA 4BRCA 5KFJA 4QCLA 1S3XA 2F9JA 3IBFB 4CJVA 2AKWB 3AD9C 3OT9A 2RMLA 2ETJA 2PN6A 4ED2A 3KG0A 3NRBA 5K5MA 1U4BA 1BHLA 3I31A 2DGOA 2O5DA 2A3ZA 3FFKB 1WC3A 4BE1A 4F8RA 1WC1A 2BJ3A 5B0DA 3ZNUA 4CLUA 3EVOA 4DL0C 4PG5A 3H98A 3BYRA 1RWXB 3RR8A 5AQNA 4USTA 1MWYA 2O8EA 3FSIA 1FTCA 3M6WA 1FESA 1WHYA 2FBYA 3BF4A 2XYPB 3TABA 1NMDA 1LQ9A 3HZ6A 3J7YU 2BACA 4W5TA 1RDDA 1JLFA 4KV8B 1K9MO 3AAPA 4J2BA 1RT7B 1I94J 3C46A 3CEDA 2QE5A 1C0UA 4G1PA 4KGXB 4AT1B 4EZ6A 2PYJA 3CXCR 2MKYA 4TNOA 3IAM9 3ENAA 3VQBA 3MECA 4K50A 4DG1A 1DT9A 5IS2A 1VQON 3FLCO 4CLYA 2DCLA 1RA7A 2HHWA 1RBUA 4C11B 1XERA 4OX9K 3OL6A 5KTQA 1HBNA 3AH6A 3IM9A 1M5KC 3EMTA 1RWOB 2MHNA 3M1VA 3OVAA 2VC1A 2Q0RA 4QR1A 1VSLA 3CCTA 1YJ9S 2ZH8A 4IBNA 5DGBA 1RHJB 4DSLA 3QICA 1HYZA 1T3NA 4Q43A 4JI7F 1FXXA 4OJGA 4HI1A 3I96A 2AP1A 3DU6A 5J1EB 4BR0A 3NMUA 1Q86O 2OPQA 2RF2A 3D54A 3AGKA 1CJKA 4W92B 5KFRA 2J9CA 3A5NC 3LL3A 2V51B 2HRYA 3D45A 4G6VB 3G4SS 1RT3B 1RU1A 1LWXA 1RAGB 2ITMA 3C2PA 2O8BB 3I56S 4NLYA 2C22A 3LP1B 4Y3CA 4RPFA 5IXUA 4A8WA 5AZJB 4CD3A 1B7YB 4E19A 1HI8A 3ENVA 4PXCA 3MMBB 1T11A 1HKBA 3X1LB 4CBWA 4UOCA 2NUUG 3B4DA 1XNQF 1VK0A 2DGUA 2W9AA 2FHJD 3W2WB 1DEJA 5ETLA 3KLIA 2GHVC 5AQOA 5M1NA 4KAIA 3M2UB 2GQQA 2AF6A 2GC8A 3BSNA 2QA4N 3K2PA 3KLFB 5KG2A 2ZJQL 1DHMA 1UEVA 3OYEA 3IGVA 2D5RA 2CQ3A 2AA4A 3L7OA 4JNEA 4WE1B 1SJRA 3GWCA 1S49A 3LDLA 4ZVQB 1M90T 4ECZA 3ZTPA 4C2MA 3TYTA 1TL3A 4ED4A 4S0MA 1CJVB 3M1FA 3L2VA 3TQEA 4NI2B 4CO4A 1BWFO 1B0TA 2FZKB 2QYGA 2F8MA 2GNKA 3M8ZA 4IXCA 2ZD1A 3SMPA 4RUHA 3ENQA 1AROP 4EMDA 3L3VA 3AV9A 3EICA 5ETNA 3SQ2A 3ZT1A 1EO1A 2E2QA 2HMPA 4ECXA 1AFJA 3SV4A 3D2EB 4BVOA 2HHSA 1TAUA 1IO2A 2MY8A 3IFRA 8AT1B 1WSJA 2EPIA 3M30A 2FJVA 3MM6A 2Y1RI 5KQDA 1QUPA 1F5AA 1QZ5A 3M05A 4DR6K 3I87A 2CG4A 4IH5A 1X4CA 5DG9A 1A5WA 4QW8A 1YBUA 4BG8A 4CZGA 5HRSA 2E5LF 4B9UA 4CYUB 1JJ4A 3SAGA 2MYFA 3O1WA 3N4WA 2CJQA 2VPWB 2HBLA 2ZH9A 4FF3A 4KC5A 2JLFA 3EPGA 4O8KA 5LSRA 2IRUA 2OMOA 4E7IA 2J0QD 1R27B 2QL9B 1JIHA 3BY5A 2E5JA 4TU9A 3R27A 2AP6A 1B7FA 1KD1O 1FEEA 4A59A 3Q2SC 1URRA 3CCMN 3R3TA 4ZJQA 1ZAWA 3PY8A 4CEDA 2BJ1A 3P3DA 1HHTP 4QZVB 1K8AT 1XMOJ 4QOZB 3MM8A 2AGOA 1L3KA 3CJAA 5IC4B 4O8UA 3VHQA 2CYYA 3PIPQ 1HA1A 1W25A 2WONA 1NCLA 5BRFA 2P6SA 1ZH5A 3PYEA 4LRDA 4PWDB 1S0NA 4Y34A 2HHUA 2OSQA 3DOKA 2LDIA 5HL7L 4XIUA 3G6VA 1WOSA 1KAXA 2V0NA 2YNHB 4WZMA 4E0DA 3MPUB 1RT2B 3HM9A 1CJTB 2KKHA 1CZBA 3T1AA 3D0HE 2VBYA 2RIJA 3R5DA 2WC9A 4JI5J 3QBWA 4CBXA 1ZAVA 4CO5A 2HHPA 2F4VJ 3CC4N 4FOEA 3VQ9A 1RSCA 1NPRA 2HW3A 1UJ6A 3MR6A 2R7YA 5B0FA 2W2OP 2HBMA 2NRZA 3GIRA 1U6ZA 4OJ1A 4J90A 2FC0A 2A1RA 3PIPL 1Z26A 1UAWA 2QWRA 4D3GA 4WFNL 2HSTA 3WBZA 1T94A 4R5PA 4OI0A 5LL6d 1ZYQA 3ATUA 2HFOA 1L3VA 1E6YA 5CZ2A 5IV4A 3J81O 4ZLPA 5J2MB 4W5RA 2XNRA 4B1ZA 3BJYA 3ADAC 1S57A 4TYBA 1QLNA 2LXIA 3TAQA 2ASJA 3CJ8A 2B9EA 1TZ0A 3EGZA 1HKGA 2JWKA 2Z2MA 4F3OA 4OGCA 2DEIA 1N8RT 1X4FA 2CKWA 1WC4A 2JGUA 2CPEA 3FCHA 7AT1B 2DO4A 4HLBA 4CJTA 2OD4A 1E3MA 2EWSA 1FRHA 1VSHA 3IRXA 3F73A 3S8SA 2PA3A 3V1OA 5KFYA 1CXUA 3MEDA 2G0CA 4KHNA 2NXEA 5ETKA 5D77A 4NXNK 3L3UA 2M9KA 4LFBK 4XPEA 4CEQA 2ATLA 2R7RA 5FJ4A 3ILLA 4OZLA 3BO4A 3PO4A 5AQIA 4LF6K 4ED6A 1PJ5A 2GJFA 5LJVA 3NGZA 3QIDA 1G3OA 5KG7A 4ED5A 1OSCA 2DXEA 4KH1B 1MDUB 4XH4A 3EDRB 1FNOA 3UD4P 3VALA 1S1VB 1M5OC 2P9LB 3Q89A 4ZVSB 3VF4A 1PAUB 2B51A 1WDTA 3Q8RB 2Z2YB 4C8MA 4DUZJ 1VQOS 1B64A 2B3TB 1U2VA 1RB0A 2J7UA 2ZZNA 4ZVPB 5F8LA 1OKJA 2AGQA 3MN6A 4LH5A 1Z6RA 2F96A 3EX7B 3TWZA 2IMWP 5C42B 2HFSA 4BRDA 3GU0A 2UVRA 2XY8A 2OANA 3CCJS 4ILHA 4QBUA 3MZIA 4J9OA 4FZYA 4DV0J 3EYZA 3NFAA 1NO8A 1RUSA 4CWBA 4WP8A 2ROPA 2UVVA 1QZ6A 1TU0B 3MXMA 4OZ0A 3TWHA 2R7OA 4RU9A 5F3TA 1S7HA 2P5VA 2KHDA 1FKAF 1EQMA 1TL7B 3CJ9A 4H0PA 3QESA 5DDPC 3LP3A 1V4TA 4B3SJ 4OX9F 3G96A 2GAGC 1KVCA 2OEKA 4L72B 5D6GA 2DXDA 3Q7CA 4NLCA 1HNWK 1HW8A 2E66A 3CNQP 1SC1B 5F2RA 2KXNB 3T7ZA 4DZ6A 3C6AA 4GVBB 5CA5A 1HYSA 4JI3J 1X9MA 1VRUB 5F8IA 5LMNK 4EHTA 2M52A 2YKAA 3LH2S 2G0JA 4DUTA 1GLCG 2C2MB 4B3RF 1MSWD 4B3TJ 4UOFA 4IG3B 1Q7YO 3SIPB 5IT0A 3QSYB 3RBDA 5ETSA 3NBPA 5HBMB 3FMWA 2VF3A 3NVKA 1YI2S 4DTXA 3JYTB 3JSRA 1SH2A 3L7PA 2NREA 1XMOF 3AFGA 2HK3A 2KXHA 3D6RA 4IH6A 3T1YF 3UDEA 2XY6A 5M2RA 2K7KA 1OWXA 3TTCA 2PFFB 4NLXA 4K4VA 3SLCA 2AWZA 1SC3B 2A10A 3BUZB 3ZNJ1 1FXDA 4DPXA 3JAMO 2K06A 2B8QA 2KVIA 1NZAA 2LFVA 3RW7A 3KUEA 4DR1J 3U4LA 2MZQA 1RWWB 3O9RA 1HJOA 3E3XA 4PQUA 3GR1A 3O80A 2YWWA 4FW1A 5ETQA 4JKHA 1JNZB 3HVTA 4EO8A 1OPZA 2Q3PA 1IR2A 1PILA 3KTQA 3IWNC 4FJ7A 5C0YA 2XNQA 4LUBA 3QIOA 2W9CA 4CT9A 5D0HA 4BBYA 3DLEA 2HQFA 3D7SB 3OYDA 1EWQA 1JK9B 3PDNA 3EE9A 3AD8C 5KOWA 4FPRA 3GIKA 2P9GA 1RBVA 1EQ0A 5AT1B 1V3SA 2FQQB 3THYB 4DJBA 3H5UA 3GZ7A 3M6VA 3GL1A 2ZGZA 4QIGA 1R8PA 3TJ9A 2ZH6A 1IKWA 3DRPB 1K8KA 4X4UA 4RBTA 5HATA 3UCGA 4DUYJ 5KFSA 4H0XB 1BL3A 4BR9A 1NPPA 2GHWA 1X4EA 4DSFA 2HRTA 3R5CA 1TMMA 3THWA 2JZ5A 1GEHA 2R7WA 5FRNA 1ZC6A 1RHUB 2AHOB 1SKRA 3N79A 2AJ1A 1RAJA 2BDPA 2DH9A 4DV0F 3GE9A 3JAMU 3THPA 2XI3A 2UUAJ 4IFVB 3PRDA 3BQ0A 1EKRA 3V6JA 2MQLA 2F7TA 2BM1A 1WF0A 3WXJA 4HHHA 5A8WB 1SAZA 2VG7A 3L8BA 4N8NA 4MK8A 2KG1A 1XHZA 3BDEA 1WTFA 4DX5A 2QA4G 4RW4B 2E9ZA 3V6HA 3GV8B 1UPMB 3ULEA 4YFUA 1KKHA 4KPCA 3I8BA 2LA6A 3GLJA 1BQMB 3QMLA 4RW8B 1VQ7N 3LALA 3AA4A 3WNEA 4DPUA 4KGVB 5KFWA 1QDUB 4CF1A 2CQDA 2O67A 1X5TA 4IOBA 4JI8F 5I9EB 2UVWA 4MYTA 2ZKUA 1Y11A 2HNDB 3FZLA 3M7VA 4J9PA 1FKOA 2ZKTA 4DV3F 1WLJA 2J5AA 3GSDA 3IGNA 3BGUA 1Y9OA 4O3OA 1S99A 2VGNA 1GX6A 3VF0B 2IJFA 2RS2A 4GRSA 4OJ3A 2EI5A 4W5OA 1F5CA 4UY8T 1HMVB 4ICLA 1YSJA 3UDVA 3OD2A 3QPIA 3ZTRA 1KVAA 2YCHA 1U26A 2J9DA 3O5TB 3G4SN 5K8MA 3A12A 1ASVA 3ZX0A 2IPOB 3SQ1A 2BH1A 4WFXA 2B4OA 2XCAA 3JAMY 3BGOP 1UOCA 5AE3A 2FBVA 4DTRA 3K8WA 3G71S 3CJ0A 2M88A 5L1KA 4FCYA 4AF1A 2IJRA 4ECUA 1RA6A 4X4TA 3UE2A 3CMES 5FPNA 4AD6A 1F9FA 1TAQA 3JSBA 3SUQA 3HP9A 1C1BB 4KGMA 5KT6A 4NLBA 4NYPA 4QAGA 1U8WA 1ZBTA 1NOZA 4YOWA 4DDFA 3OV7A 3OR2B 3RMDA 4RLEA 3GBTA 1GOCA 4JS5A 1T6DA 3SXLA 3EGNA 8ATCB 5FLXY 3KXDA 1S1XA 3MOZA 1U48A 4QIEA 4DFPA 2L3MA 5B09A 1FDNA 4F4KA 3GMGA 2HLTA 4KBOA 2J4RA 4KRFA 1U1MA 3AVGA 2G8VA 2MHEA 2DHXA 3MEGB 3HD1A 3JB9k 1U0HA 2CQGA 5DDQC 4PXBA 1F60B 2KL8A 1LW2A 4DV7K 5E33A 5KFBA 1H7WA 3UFCX 5BREA 2LQ8A 4YP3A 3K0JA 3RAMA 2FGOA 1XC3A 2HOEA 1HW9A 1P8ZA 3CCVN 1HIYA 1ZA1B 1JLAA 1WEZA 2HVZA 4IG0B 1IKVB 1N33F 3THTA 2J0WA 3MEEB 1YRXA 1UCNA 5BYQA 4JI6J 4P52A 4O4GB 1RWMB 4EUVA 2PYLA 4C11A 1S1WA 1MNEA 2C2DA 2WBNA 4IR1A 3LP0A 4OI4A 4E1NA 5DDRC 1HQUA 1RU2A 2GAHC 3KK1A 1Q0NA 1OH8A 2NZTA 4KHQA 4CJPA 1XTZA 5KT7A 4J2EA 2Z1JA 1VRQC 1TGOA 1YITS 3WQPA 2HF3A 1FJCA 1I39A 4DR3J 1V5VA 5HMXA 2D41A 3CCQS 3R7SB 2UP1A 2R7XA 2HBKA 3WQUA 2AZ3A 2RPIA 5L1JA 4BRKA 3H59A 3PV8A 1UVNA 1YXQA 2O8BA 3JSYA 4DPTA 2MQNA 1OH5A 2ZEJA 5FDLA 3ZSZA 5HK4A 1I5OB 4DPOA 3N6LA 3MAAA 2EX3A 4WCEQ 7FD1A 2W6KA 2YJEA 1WC5A 4YOYA 4LVNP 2HK2A 3CCZA 1RTHA 4DL6A 1U1KA 1VSJA 2MLZA 1K73O 2WTFA 2C2RA 4F0MA 2HBYB 4CEFA 4YB7A 3K5OA 4IUFA 2JSXA 1RYRA 4Z94A 1VQPN 3K7RA 4F7VA 4HL9A 4M5LA 4CF2A 2QLBB 5KI6A 2J0SD 4ZVOB 5GAEU 4KGZB 4N47A 2PBDA 3DLLL 3SCXA 5MLCV 2GA7A 1ZA2B 3W64A 2DNGA 2DD8S 1B92A 2W7PA 2CUYA 3MOJB 3QATA 1D4XA 4KY3A 3OW2R 5GAEI 2XWYA 1S4FA 1SC6A 2ABYA 3MM7B 2EW9A 1IBMK 2MZRA 3W8GA 3O5BA 2FJEB 1VSEA 3KWIA 1EARA 2XLIA 3WC2A 2RRAA 4DSIA 1SBRA 2OP5A 4OV1A 3VMFB 2ZBIA 2BM0A 2XLJA 2RJZA 3MCSA 3NH0A 4M5JA 2E5LK 3KVGA 5GMEA 4CYUA 3BS9A 4HTUA 3OHAA 1TKTA 4H03B 4LF4F 1O5JA 4DFKA 3BREA 2C2OB 3PUFA 4LC9B 2JFDA 4CNYA 3U8XA 2I38A 2FTRA 4X62K 2ZDPA 4N8OA 1FRIA 1NPKA 2UU9J 4JKEA 3H2LA 4CQ1A 4YY3J 4MIAA 3K2YA 1APSA 5E3RA 5JVGQ 5A6PA 2E1MC 4DV6F 4OGEA 2J0XA 5E84A 4G9ZA 1XUPO 3OTEA 1IBCB 3M3ZA 2E4LA 3D66A 1KTVA 5A2QY 3WEEB 2OHDA 2NSBA 5K8PA 3UD5A 1Q82O 3AOCA 1W2BM 3IG1A 5C7PA 3MK6A 2R42A 2QKKA 3FQLA 2F7VA 2H51B 5T7LA 5AQKA 4X64K 3CCUN 1TYQB 1VDHA 3PX0A 2HGNA 4KHWA 4OX9J 3H3NO 4V19S 2XY7A 4LFCF 2I6WA 5BYSA 4JYAJ 2Y3YA 5E5NA 5GMDA 1CS4B 3ID8A 1WHVA 1R0AA 2ZDOA 3A13A 5EUHA 2DHAA 3H46O 4MJKA 4FNHA 1UKUA 2X1FA 1TKZA 1ZM9A 2CZ4A 2I5JB 4NLDA 2CH5A 3NG8A 1VBXA 2QA1A 3NS5A 4CIGA 4IZ9A 3VQQA 1HPMA 1DY3A 5E2QA 3OHBA 2NXCA 2HHHF 4B1XB 3K5NA 3D6HB 2IDLA 4ATNA 5M2UA 4PWUA 1E6YB 2DNQA 5BR8J 1RISA 2PMZD 4Y1CA 1K73T 1JJ2M 3KKFA 2QWMA 3H5XA 2E5HA 3FVYA 3CFOA 2HHHK 3F56A 2D69A 2ZZTA 1SJFA 3BGRB 3CVKA 4ID1A 4F9OA 2KFNA 3OTOF 1T9XA 4WFAQ 1GFWB 4B1UB 3R1XA 1S9GB 3VVTA 3OTOJ 5E26A 5KFFA 1XMOK 3AVBA 2AD9A 4HACB 5A0YB 1H2VZ 2B5JB 4K4ZA 4M5HA 2VFUA 2P51A 2WBMA 1DTTA 2U1AA 3TX0A 3HBTA 3TAFA 4NLGA 3RB3A 3NNHA 4FVUA 5LL6Z 4NXMF 3TAEA 4TLQA 2CPZA 3UDCA 1GLDG 2V2VA 4YOUA 1EX4A 1JLGB 2B6AB 4NRTA 4I0WA 3T5LA 3FDSA 5E3PA 2UUAF 1Y00A 1BIZA 5C25A 3TANA 4DV2J 3RMCA 3E01A 5A8RA 2H5JB 3KYLA 1B9DA 2JNJA 2Z1IA 1WNEA 1S79A 1C0FA 3KWGA 3FSXA 3MWPA 3UNGC 5CABA 3IS9A 3ZSOA 1HBOB 1VHFA 3MM9B 2OA8A 1T44A 2V7ZA 4YORA 4PQAA 4JI5F 1E6VB 2VOOA 2K7JA 4NL5A 5EN1A 4HT5A 4Z4GA 3GILA 1D9FA 2FSNA 3AVLA 3PEHA 1PC4A 1MWMA 1JMTA 4K0KK 1NMEB 2FHMA 4Z4FA 4MQ3A 1KHVA 4DR2F 5CR4A 1ELOA 5LSLA 2EK1A 4YY3F 1HL6A 1N32F 3T69A 5H1SV 1RK8A 4LRBA 4DX6A 4EP4A 5THWA 3ZETA 4CJRA 4HUFA 2JDJA 4ECRA 1VISA 2BKOA 3GJSB 2ZM6K 4QWCA 4CGIA 3C66A 4IQXA 1C0UB 3HVRA 5ADXA 2CFXA 1LWCB 3J81Y 3DJCA 3IC1A 2MMYA 1BOTO 4QWAA 2KJVA 3H7HB 4V19X 4XEIA 4JI4J 3DYAA 1BLUA 2R8HA 3AAQA 2VC0A 3WIUA 3TPQA 4O0NA 4DEZA 4DTSA 1TMJA 3PW7A 4JV5J 2Y1JA 2R7VA 1TV6B 4ZMMA 2YQ3A 1U25A 1CXQA 1R8BA 3MMCB 1AW0A 1U0SA 2HVIA 4GY2B 3KLHB 2HVDA 1Q5VA 1WG5A 2VBZA 4EZ9A 2G8HA 3BGFA 3NVMA 2WVFA 3HZEA 2L08A 3IAYA 3OTBA 3LO3A 3NHGA 4IG3A 3KJNB 4CIOA 3HFZB 3ZO7A 2D3ZA 5I3UB 3ZZTA 3CJ7A 2XSJB 2CQPA 3T6JA 2O3DA 2RF2B 4K4YA 3DDNA 1JKHB 1CJKB 3E1YA 1T02A 2J6UA 4BROA 4NMLA 3L7UA 2JEIA 2EK6A 3AJ1A 1NJIO 4LFAK 4B3RJ 2QFJA 1QE1B 1U04A 4I9QA 3FK4A 3W5XA 2D9OA 4GKKF 4RL1A 4LF7K 2E5IA 2HZAA 3CCWA 1IKXB 4RWWA 2OGUA 4N56A 1FVSA 3HVTB 2HS4A 2R8IA 2OPPB 3HYFA 3KLVA 1IXKA 3QBXA 4UF4A 1H2TZ 1N32K 1VQYA 2MLYA 4B3MJ 1RLDA 5EWGA 1QSYA 2QEXS 4F2SA 4FLVA 3DLKA 2Z1GA 1KTQA 4LF9J 1KP6A 2DNPA 2ASLA 4KFBA 2I7NA 1RT4A 5C2DA 1AXQA 1J6ZA 4AFFA 1U1QA 5DZ7A 3A5MC 2RRNA 3MHYA 4KE5A 5L38A 4ECVA 1CJVA 1YITN 3MXIA 3FBEA 1F3FA 2AEMA 4LJMA 1SQEA 4NLUA 3TRGA 2BANB 4KHPK 2P2CB 1X5OA 5H9EK 2RB7A 3OYHA 1SB6A 3SCIE 2P9SA 2QMUB 2CIMA 4Q8EA 2LYVA 3HTVA 1WBBA 5C5JA 5EWEA 2PMHA 2R8KA 4P10A 2E7WA 2P9UA 1TELA 3BEXA 1CLQA 2DGQA 3E8OA 2A18A 2UXCJ 4X4OA 4A46A 2A42A 2HQDA 5I42A 5J1NA 1JXLA 3VEOA 2XQCA 2V67A 3QJPA 3LTOA 2KB2A 2GWJA 1QAIA 3I55S 1J2VA 4BWJA 3W65A 3AY0A 4RW9B 1IBMJ 1U8SA 4H4MB 1BA0A 4IQMA 3MAQA 2CPHA 2HRUA 5AE2A 1XEZA 3UQSA 1KLMA 2IYGA 4ILGB 5KFKA 1U1RA 3CFRA 1VQ5S 1W2IA 1GTHA 3QETA 2DR6A 1SQFA 2YHYA 4NYFA 1RCXB 2XMJA 2DFFA 3PKMA 5H9FK 3BQ2A 1UWAA 4JI2J 1TUVA 4B3TF 1N33J 1XBWA 2XGPA 4NMXA 2E1RA 4N7TA 5M1QA 1W7AA 4A8YA 5HP1A 2F40A 3CMAS 1PKUA 2ZQBA 5HRRA 3RRHA 2YQ0A 5JICA 5BR9A 4LT6A 4X62J 1NK5A 3C8YA 2QWQA 1HBUA 3C6UA 1B70B 3OJSA 4YY3K 2CJKA 3OYIA 2IDEA 3HSGA 2KG0A 2YKOA 4HH0A 2NUHA 5F8GA 1IBKF 2V4JB 3EKSA 5FPMA 3PACA 3EM1A 3CCEN 2WVBA 4JHDA 4KPYA 3MMAB 1TL3B 2HEKA 4Y00A 2J6SA 4M5GA 1HMVA 4ICLB 4DR4K 4NI2A 4IO9Q 2MJUA 5SUHA 4Q0BA 1CULA 3QYYA 1RAOA 5SWMA 4I2QB 3FQKA 2Y1IA 1XWLA 1MWZA 1ZPWX 4NLTA 4F3MA 2BW2A 4UT4A 4BRQA 3E51A 1NK8A 3UE5A 1UETA 4OO1J 5AQUA 2FSJA 2UUAK 1VSDA 3PRBA 4FO0A 4FJNA 1C1CB 1NGGA 3MR7A 3K57A 3AODA 3RBEA 1HBMA 3LWMA 3SCKE 4JYAK 3GSIA 3R5AA 4BREA 1T9YA 3SDEA 3W61A 4K8ZA 3Q7BA 3MM5B 3NF9A 3I4PA 4F26A 2W42A 3MEKA 1WD6A 4DR7F 4USHA 3UWTA 3FEZA 3CUNA 2KFYA 1UJ5A 4FBUA 1VCTA 1FRMA 4AHTA 2VUGA 4LQ3A 4OHYA 4LSNB 2DFEA 3ISNC 4LR8A 1F3VA 3Q8QB 3QO9B 4DR1K 2DY4A 4OLOA 2KT3A 3CSKA 1QHAA 3HHDA 1V4SA 1RCOB 4DS4A 3EL2A 1HR0F 3KJVB 1BQNB 2E2PA 1Z25A 3VQ8A 4C23A 3ENBA 2B4VA 1KQFB 9RUBA 2DRDA 1JLBB 3DGPB 3EZ5A 2ZHAA 4FLZA 4YOXA 2VQEK 1ASWA 3V6DA 3KHRA 2VASA 4CJWA 4ED0A 3W9JA 2AJ4A 5DQGA 3OYFA 2HNZB 1IQTA 3VAHA 3UDLA 2H5EA 3ILJA 3PRVA 3VQ4A 2DR9A 2CDQA 3Q83A 1RT2A 1HNXJ 3HT3A 1FW6A 4FS1A 1PO6A 4O3RA 3SAFA 2XO6A 2GVDB 5KG3A 1HNZJ 4AQYK 3T9NA 4WF9Q 4CK2A 3F5TA 3A3NB 4K7QA 3PIOQ 2DRAA 4OLAA 2F63A 2H65B 4U8VA 4K59A 3E9PA 4Y2AA 4BACA 3N01A 4ID5A 3QINA 4WFBQ 2UXBF 3Q8PB 3AVJA 3EVWA 3VPZA 3ZTQA 2PI5A 4RWXA 2IC3B 1HNVA 3M32A 5HRPA 4B08A 2FLLA 1OJ4A 3IBCB 4HUEA 2P9NB 1C0TB 3A5OC 5HQ8A 5BXIA 3UO0A 2RDIA 3EN9A 2KRBA 4LBPA 2CQHA 4ISFA 2K1RB 4LD0A 1ZAXA 1WORA 3ETOA 4KGKA 3TA1A 4KAZA 5HO4A 3EO3A 1RTIA 1Y10A 4L3KA 2QYCA 4FWMA 1YUWA 3KKRA 3ZYYX 1Q1KA 3RZAA 1EAYC 2KT2A 5CYMB 3VA3A 4O44B 1BQXA 2ILYA 3DCAA 1FX4A 2VD3A 4F4ZA 1YK9A 3PG9A 4I2PA 4O5BA 3W8PA 5HSPA 1EX8A 1WOOA 3OYNA 3RB4A 3TEHB 1R7IA 2A1BA 4RCHA 1FNXH 1NGHA 1RDRA 3P4UB 4ZVTB 4PKIA 5DQHA 2AEJA 3PW5A 1RHRB 4WQ4A 2KI2A 3ZEUB 3AO5A 4G1QB 1V3RA 1XK8A 3TR5A 4LREA 4USMA 3HLUA 3MCNA 2I8EA 2NPFA 2F9TA 3NGKA 3VTIA 1C4CA 2RAQA 1XR5A 4QYRA 4KHYA 4M5DB 1VQ7S 4C9DA 2WRMA 2EC2A 3RB6A 2CZVC 2XI2A 1JLEA 1YRUA 2IFXA 4H5VA 4MDAA 2VQFF 5F8MA 1HHSA 1TL5A 3GTYX 4PQUB 1RWKB 5KT4A 2AJFE 2ZH4A 3N4QA 4JRPA 4ZVUB 4MKVA 2OLWA 1S5JA 1YIJS 3BM7A 2M7SA 1QAJA 5M1KA 3TARA 2QM1A 2OJ3A 1VSMA 1KD1T 4J2AA 3HO1A 4QWEA 1NU4A 1PIEA 3OVSA 4DQRA 1BXNA 1TL7A 2UUTA 1PYSB 4ZP7A 5CHIA 3MWTA 4JV0A 3G82A 2PI4A 4G3IA 2DO0A 5AQRA 2VPYB 1X31C 3N5BA 3FZ2A 3K5PA 1IKWB 3MECB 4ZLLA 4Y2CA 3SYZA 3CXCM 4U67Q 3M8QB 4GVLA 4Q5VA 1NDLA 3CJSA 2P1JA 1C6VA 2F1FA 2DJWA 1Q8KA 1AB8A 4E1MA 1JXVA 1N0UA 4DL7A 2GIRA 2B9WA 1TFYA 3NCRA 4QIVA 1XNQJ 4KH6A 3BSOA 4ED1A 3AJ2A 2UXBK 2UYTA 3KUGA 1TVRA 4LFBF 4IFVA 3KUHA 2DR7A 2WOMA 5JXSA 2W7AA 1VHIA 3H2VE 3Q8YA 3H08A 2OELA 5AQSA 4PXEA 1RAIB 4PR6A 4URQU 2YVSA 4ZJLA 1R0AB 1UTAA 3R6MA 5KG5A 1RGIA 5FD1A 4QYZK 3KLGA 2NRVA 5ADXH 1DLOB 2FY1A 3O9UA 1VQ9N 4LRFA 5CZ1A 1VBKA 4ZJOA 4I4BA 3QRQA 3C16A 1BQMA 1D09B 2N82B 3M4XA 5KFIA 4CD1A 1O0PA 4C8OA 4CDIA 1ZTWA 1AUDA 3MX2A 2GGPB 3DMJB 1H3DA 1B9FA 1JQGA 1QJHA 2RUSA 2A2DA 3OBIA 2UUWA 3AOAA 4J91A 3OR1A 4F67A 3CF5L 2BQUA 4X66K 4CGFA 3RMBA 4DL5A 4A47A 1FKOB 5BR8F 2E20A 1BI4A 2M3DA 2EBEA 3I0SB 3D2WA 2G1DA 4MH8A 4WE1A 4Q2LA 2L41A 4OZ1A 3S01A 3M6UA 3O2IA 2VWJA 3JTNA 1X4DA 4WIIA 2U2FA 5JVHL 4KKOA 3VQSA 3DI6A 1FRKA 1CG2A 4ES3A 2BABA 3OHRA 4DTUA 4L76A 3M2RB 4I7FA 2PA8D 1XN9A 1RHQB 1ESVA 3LA0A 3FZBA 1VJQA 3LDNA 4WQ5A 2XMUA 3R2DJ 3V81A 4DUYF 5C25B 1U1PA 2CJ9A 3CJ4A 4DBQA 3CTRA 3NLCA 4JAXA 1V3ZA 3B6OA 4RNMA 3VQAA 3K9KA 1VSIA 1U45A 3T5KA 4C3LA 2Q66A 4IDHA 4O5FA 2YNFA 3EWGA 1G99A 3SQGA 3AXMA 4WTOB 3SJHA 2AW0A 1S1XB 3S9HA 4J7CA 4IOAL 3RW6A 4MAKA 2XMWA 3WZ0A 4Z4CA 2BW7A 4OKKA 4PPZA 3CQ8A 4P2MA 1QTMA 5AQGA 1RT3A 2C42A 2ZWPA 4MT1A 2A6MA 2ZH1A 1SZ2A 3AVAA 2OSRA 3DLGB 2CQBA 3CGIA 4YB5A 5DG7A 3MFIA 2CPFA 3MMBA 2VQFJ 4DV4F 4CFBA 2KZZA 4FW2A 3ETMA 4DCPB 1M1KO 4RO0A 2D7SA 3ATVA 2GQCA 2MKJA 3ZFVA 2MLXA 2BOAA 3UD3P 1N5SA 4DWIA 4KRWA 3I5BA 4CGJA 2NXUA 2ZNYA 1P1TA 2HNDA 1HKCA 4YB6A 4LF2A 3TA2A 3LPTA 5GADP 1HD1A 3AO3A 1WC6A 4CLZA 3J7AN 4IJNA 3D3CJ 4Z0UA 2VZ9A 3RU0A 4OV6A 2FB0A 4YEAA 2V94A 4KQZA 4DR7K 2VQEJ 5HLFB 2ZJQQ 4RTFD 4O3PA 2OTJN 1L3UA 4RW6B 1KLNA 1EETA 4BR5A 4CP5A 3QNNA 3ZZUA 2YNGA 4CBUA 2GUPA 2BRLA