3CF5L

Thiopeptide antibiotic thiostrepton bound to the large ribosomal subunit of deinococcus radiodurans
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
104
structure length
104
Chain Sequence
RRKLRTRRKVRTTTAASGRLRLSVYRSSKHIYAQIIDDSRGQTLAAASSAALKSGNKTDTAAAVGKALAAAAAEKGIKQVVFDRGSYKYHGRVKALADAAREGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S RIBOSOMAL PROTEIN L33
publication title Translational Regulation Via L11: Molecular Switches on the Ribosome Turned on and Off by Thiostrepton and Micrococcin.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 17
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2008-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00861 Ribosomal_L18p Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.100 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3cf5L01
4IO9L 4WFNL 1YJNN 1VQ6N 3CCRN 1VQ7N 4WF9L 3CC2N 1OVYA 1ILYA 1YHQN 1YJ9N 3DLLL 3CCUN 5H1SQ 3CCVN 2ZJRL 1VQ5N 2QEXN 1VQPN 3J7ZO 5HL7L 1QVFM 1YJWN 3PIPL 3CCSN 1VQ9N 5DM6L 1M1KO 3CCLN 4IOCL 3CCJN 4WFBL 5JVGL 3PIOL 2ZJPL 1Q7YO 4WFAL 1YIJN 1VQ8N 4WCEL 5GAEP 1K8AO 2OTJN 3OW2M 3CCMN 1JJ2M 2ZJQL 2OTLN 1K9MO 1YITN 5DM7L 3I55N 3CXCM 5GAHP 1VQKN 5JVHL 4IOAL 1Q82O 1Q81O 5GADP 3CMEN 1QVGM 1VQNN 3I56N 2QA4N 3CMAN 1YI2N 1S72N 4U67L 1Q86O 3CD6N 1VQON 1NJIO 3CC4N 1KQSM 3CCEN 1VQMN 3CPWM 1KD1O 3G6EN 3CF5L 1K73O 3CC7N 1W2BM 3CCQN 1VQLN 1VQ4N 1M90O 3G4SN 3G71N 4UY8O 5MLCQ 1KC8O 5GAGP 1N8RO
chains in the Genus database with same CATH superfamily
3C65A 5J1EA 5ADXH 1RFQA 1E4GT 3NF9A 4BR4A 1RBVA 2PFUA 4PHTX 1HLUA 4BACA 3QLHA 4NYFA 4O8KA 4XH4A 3CC2N 2QKBA 3EE9A 4X64K 4OLAA 3L0QA 4B9SA 3T1AA 4B9MA 3L3UA 4NO7A 5GIPA 3VEOA 3QDKA 4G1QA 4Z4IA 2HF4A 2QW9A 1GLFO 1NJWA 4CJ5A 4CBWA 1HPZA 3UKUB 3KD5E 1HJRA 5CHIA 4E1MA 3L3VA 3PIOL 1Z05A 4BGAA 3VQ5A 2E1ZA 4WCEL 2IGIA 4CHNA 4OPAA 3WEEB 1WBBA 3WT0A 2E8AA 2HHQA 3LDNA 4B3TK 5BREA 3EY1A 5KPRA 3RR7A 4OGEA 3AVHA 4YDUC 2J4RA 4CEEA 1NJYA 1HQUA 2NRZA 2ZJQL 3M8SA 4K0KK 4JI5K 3AVMA 4DFPA 5DM7L 4LF5K 1IV0A 5GAHP 4FJXA 3DRRA 2Z1IA 2I7NA 4N47A 3OJUA 3PY8A 1XC3A 4CFAA 3IMXA 4CEFA 5GADP 4M3WA 3CMEN 1KVAA 5AQVA 4AILC 3TAMA 4KH6A 5KRSA 4GKJK 4DKWA 2IS3A 2HB5A 3I56N 1RTDA 4DLEA 3UKUA 4DV4K 3D2FB 4DR7K 1R0AA 3EO3A 5LJWA 1VSJA 4HTLA 4BRFA 1QSLA 2X6SA 3VQCA 4B9TA 3KK2A 3WEEA 5AQFA 3B6PA 2VGNA 1NMDA 4LF7K 1K73O 3CC7N 1QQMA 1KRPA 4FLVA 3NF8A 2H3GX 5TKYA 2KZZA 3JXUA 4JI3K 3T19A 1SKRA 5M1QA 3CG7A 4DSJA 4FWNA 3MK6A 3ULEA 3ZT4A 4A5BA 5T7BA 2KW4A 4ICLA 3R3LA 3HSCA 1WSGA 4FW1A 2ETJA 4BQZA 3VPZA 4OKJA 4IG0A 1OH6A 1QTMA 3OYMA 5HRSA 3AA3A 1NK7A 1KFDA 3D2FA 1VSEA 4ID5A 1TK0A 4LF9K 5GINA 2A3ZA 2A41A 2LSNA 2F4VK 4Y1DA 3VQAA 4M3UA 4X66K 1J9AA 2RN2A 5AQJA 3ENBA 1RDWX 4BR2A 4QCLA 4OLBA 2VCPA 4DF4A 3V9UA 2Z1HA 4BRAA 2CGKA 5FROA 4HHTA 1BGXT 1UAXA 2BH1A 3HP9A 3SPZA 5BRDA 3NVMA 2FBXA 1RT4A 1HX1A 4CZEA 3SUPA 1HJOA 2Q31A 3JAMO 5KQ8A 4IOAL 4CJKA 4DTPA 3RWUA 2NRTA 4NLCA 2NRWA 5A2QO 2I5JA 2E5LK 4K41A 5FPNA 3TSUA 4CFDA 5K14A 3O6WA 4C8LA 3O9SA 2FC0A 3MX5A 4BR7A 3MN9A 1HKGA 1IO2A 1BIUA 2OA8A 1XMOK 1IKYA 2G8KA 3KK7A 3U9DA 2YHYA 1YF5L 4NXMK 3A5LC 3CPWM 4M42A 4PWDA 1C0UA 1BI4A 4LF4K 3AVJA 3IUCA 4XIUA 2XY5A 4CECA 3J80O 4DR5K 3TAQA 5J2NA 2OYQA 1VSKA 4Q5VA 3OYNA 3O5BA 1LW0A 3HOSA 5GAGP 5HBMA 3HPOA 1WAJA 1VSHA 1OH7A 2HNZA 1MDUB 3K58A 2IVPA 4JK8A 5SZTA 4FVUA 4CHOA 2XY8A 4CHQA 1ILYA 4JKGB 1P8ZA 3VERA 1YVUA 3OYLA 4CIFA 3V9SA 4J2EA 3CCVN 2QEXN 3DLBA 3TWHA 2AJQA 1BA1A 2GTDA 2F9TA 5HL7L 2OPRA 4AQYK 2O4IA 4GMJB 3ITHA 3I0RA 3WNFA 5F0XA 4CW7B 1VQ8N 4DG1A 4CI6A 3OVNA 3AO2A 3P4IA 3V9ZA 4KPYA 3DYAA 4OO1J 1N34K 3C0BA 2B4JA 4M3RA 3VTHA 5AZIA 2EHGA 4R5PA 1P90A 3CFRA 1YAGA 2OTLN 3A2FA 5BN9A 4E7IA 1XNRK 4CEZA 4RTFD 1ATRA 4CJRA 3K59A 1BIZA 3WXMB 2QXLA 3PV8A 5KI6A 3NF7A 3VETA 1I3AA 1NK6A 3Q7CA 1IH7A 4ISGA 3NMUA 5AQUA 3OBYA 1RCHA 1Z25A 1QZ5A 3SBTA 3AVGA 4CJSA 4O5BA 4HVJA 1YI2N 5CYMA 4CZKA 4FLYA 4ELUA 2P9NA 3LDQA 1Z6RA 3D7EO 4FWLA 2W40A 4EHTA 2IDOA 1XUPO 4DF8A 1VQMN 3MWTA 3FZLA 3NBPA 3ZSVA 3VGLA 1J5EK 5LMUK 3GOIA 2FBTA 5M1FA 5LL6Z 4FJKA 3MAQA 4CFCA 1WSHA 2P5OA 3K5MA 5TKWA 3FZKA 2O8BB 4BC4A 3QESA 3DWLA 3L4IA 3JYTA 3MWPA 5LJVA 4GV9A 3AGKA 1S1WA 1EWRA 3JSMA 1NJZA 3AO3A 1W7AA 1WLJA 4BG9A 1NGAA 1FJGK 3CCUN 3IFRA 4PA1A 1HPMA 1OKJA 2XY7A 5CE3A 3D6RA 3T69A 3SBGA 4BR0A 4RCHA 3SI6A 1D5AA 4HUEA 3E66A 1K8AO 3QBWA 3FGUA 4PL8A 2RPIA 4A2BA 1FK9A 4H4OA 2O8FA 4YNQA 1VSIA 2E2OA 5JICA 3LDPA 4M3ZA 3CPEA 3ZX0A 2O8BA 3QB0A 4B1XB 1QZ6A 3CJBA 1QSSA 3K57A 4FZYA 1SAZA 4PKIA 3LP1A 2O8DB 3V9WA 1X9WA 1ZBLA 1Q82O 3SUNA 3L2UA 5BR8K 4XH1A 4LD0A 4DU3A 1ZBIA 2D0AA 3ENOA 3WUHA 1DT9A 4M41A 1ASVA 1B9DA 3ZT0A 5AQSA 4U67L 3K5LA 3RMAA 1GLAG 4CK1A 2F8SA 1V4SA 4QOZB 3PX6A 3OS1A 1TUYA 4BREA 4IO8A 4DTUA 4M63C 3G25A 4CJWA 4LFCK 3CCQN 3MCPA 4H0PA 1I39A 4FJJA 3GBTA 4CF2A 1OH8A 1Q9YA 1KC8O 4OX9K 3OHRA 1U2VB 3O8MA 4KTZA 4F3TA 4GVMA 4EZ6A 3E1YA 4OKEA 2DFFA 3NH0A 4PQUA 1SKSA 1RT1A 4GKKK 4C1NI 1YHQN 1CLQA 5AR0A 4JHDB 4DSEA 1ZBSA 2YX6A 5I9EB 4WQ4A 2QI2A 1ASWA 1KLMA 4YOWA 4OPJA 2A6AA 3VQ6A 3VQQA 4F4KA 3CCJN 3F2KA 2GELA 3ZSXA 3LP0A 1O13A 3I0SA 2NNWA 5CY4A 4DQSA 4YOYA 2D1KA 4MDBA 2OTJN 4CEBA 2Q3SA 1HKBA 4BR9A 1VSDA 3AAQA 1TYQA 1RT6A 1BWFO 4DTRA 1S1XA 3LALA 4CJFA 2F8TA 4FLXA 4FM1A 1RGIA 4BC5A 3OBWA 1BQNA 4BC2A 5ELZA 5CZ2A 3ZT2A 2P9LB 4OKKA 3THXB 4QAGA 3TTCA 4RW8A 3N4QA 3LP3A 2R7YA 3QIPA 3OYAA 3RVCA 4JHDA 1V4TA 4W5TA 1SV5A 3JS6A 4AHVA 1X9JA 4BDYA 1VHXA 5E26A 3VMFB 1TKTA 1DTTA 4LF8K 4BRQA 3U4LA 4K8XA 3UE5A 3ALYA 3LP2A 1EQYA 1VK0A 3BZKA 1BDGA 2YNIA 3UKRB 4TSXA 1Y97A 3F9KA 2X6NA 5I3UA 5J2MA 1JCEA 1IKXA 1C1AA 4DV5K 4Y0WA 2QWRA 4BG8A 1JKHA 3HOTA 2XY6A 4FYDA 4EZ9A 4L3QA 4IO9L 1TV6A 4FXDA 3THXA 2NRVA 4KHUA 4N76A 1GOAA 2GWKA 2HHTA 3VQ4A 1YT3A 2HHWA 3EE8A 4JKBA 4C8OA 3HVTA 4H5TA 1U04A 4UQGA 1IBKK 4E1NA 5LMNK 3PSIA 1C6VA 3E9PA 2CH5A 2YJFA 3OYIA 1YJWN 3FZHA 5JS2A 1DKGD 1NGIA 4B9UA 2HW3A 4CK3A 2BANA 3CFPA 4CBUA 1Q7YO 1YIJN 3DLKA 4EP5A 4BVPA 5E84A 3UKRA 5C10A 3MXMA 3PLAA 3O08A 3NGZA 1XHXA 1XMQK 2IC3A 4FLTA 5EOYA 1TKDA 2HBKA 1GOBA 4CGDA 3DOLA 4BY9C 1TVRA 2V52B 4BQLA 3MEEA 4ELTA 3D45A 2RE2A 3QMLA 3TANA 3ZX2A 4NXNK 1QS4A 4J2DA 4F8RA 4B8AB 2OPSA 3VF2A 3LWMA 1ATNA 4Y1CA 4IWVA 3KLFA 3SK3A 4O0IA 1LW2A 2ZWHA 1MU2A 2EWSA 2PYLA 4FLUA 2UUAK 3ATVA 3ULEB 3H08A 4AHSA 3EKUA 4RG8A 1HNVA 2YV0X 4AM6A 1UA0A 2D5RA 5AQIA 3TTFA 4YORA 2HVIA 1NK5A 1TAQA 3O9QA 3AY9A 3WNGA 4KB1A 1LCUA 1BCOA 3KWGA 3E9LA 3BUZB 2ZM6K 3HM8A 4CJVA 4CD1A 4BE0A 4BE1A 4HUFA 3P83D 3AGRA 4HCBA 2YHXA 1CZ9A 2FLOA 3K5OA 1NGBA 4WQ5C 1T8EA 4LFAK 4CJQA 4DQPA 4DWIA 3NGIA 3MN5A 4O4GA 3VQ7A 2GUPA 2NRHA 3QEPA 4DU4A 1VQ7N 1CZBA 4EFHA 1W97L 3O4QA 3HZ6A 4FM2A 4DV7K 2HSTA 2GEMA 1J54A 3IS9A 3J8AA 3C6AA 3SAFA 3K9JA 4FWRA 1VQPN 4CK2A 3CCSN 4JK7A 4H03B 3CIPA 1QQOA 4DCHA 2ITGA 3HSTB 1S5JA 4U7BA 3VQ8A 3VF6A 4FM0A 3H3OB 4E7KA 3V1RA 2ZD1A 1A5VA 2E2PA 3CCMN 4JI0K 2A1SA 3E9OA 2Z1JA 3CM5A 1GLDG 1WSJA 3IDHA 3O80A 3THYB 1TKZA 5C0YA 1GLCG 3QINA 4FJ8A 4CHYA 4MO4A 5C25A 1HNWK 3AA4A 3M8QA 4BRHA 3PO4A 5AQQA 4C8NA 3E01A 4M3YA 3ZX3A 1D4XA 3K5NA 3QEWA 1KTQA 3O1BA 3LDOA 4B9QA 1NGGA 3HRGA 3THWB 4Z4HA 3NHGA 4BC3A 4CESA 4QS9A 1BI4B 1VSFA 3OYBA 5EY4A 3RMDA 3VQEA 3AVBA 5KGWA 4JI6K 3KKRA 1NK8A 3SZ2A 2QA4N 1TGOA 1T7PA 4DSKA 4KAZA 4DQQA 4CJUA 4W5QA 1WSIA 1JLQA 4CJ3A 2VG5A 4C23A 3L2WA 2ZGYA 4DTSA 3MMVA 4IKFA 4B1UB 4M7YA 3HI0A 1BQMA 3O9RA 4F2SA 3TARA 2Q1NA 4BRDA 1W2BM 3ZSOA 4ISEA 4FJMA 4JD2A 4W5RA 5C2FA 3AO1A 4CZJA 3ZSYA 4YOTA 2W6LA 3THYA 3MECA 4UY8O 5HP1A 3U6FA 5MLCQ 3TSQA 3SQ2A 1T05A 4G9ZA 1HNZK 1U47A 4AM7A 3FR0A 3QNOA 4FZXC 1DEJA 1JCGA 1OVQA 3EEQA 5JLHA 1RTJA 3THWA 3R9PA 3KJVA 3A5NC 3J7AP 1ITGA 2OPQA 2WBNA 2CH6A 4NYNA 3L6QA 3TAFA 1JL1A 4M45A 3DLLL 4JS4A 1XC9A 1EETA 1SQKA 1NGJA 4PKHA 1T3VA 5AZIB 3ZEUA 2UUBK 3S3NA 1M1KO 1T44A 3C95A 4DQIA 2O4GA 5SWMA 3M6GA 5JVGL 3GL1A 3EZWA 5BR9A 4HWIA 4I2QA 3H46O 1FW6A 3ID8A 2G8FA 2DY4A 3OW2M 2OANA 3RTVA 3ZSZA 2KHOA 5AFUA 2PY5A 4KI4A 3LDSA 1C1BA 1TAUA 1IG8A 3LZJA 3DM2A 1HYSA 2HHHK 2P9NB 3CXCM 1IBLK 2KFNA 4DS5A 4CJ7A 4ID1A 3H1QA 2GV9A 3TSPA 5C15A 3OJSA 4GY2B 1D9FA 5ADXA 2E1YA 1D8YA 1WSEA 5AQOA 4CF1A 4JN4A 2VG7A 2NUBA 2KLAA 4K43A 3CHWA 2QTDA 3UIQA 4RW4A 3QICA 4W5NA 4BGBA 4L8RB 2QWNA 1YVNA 4KHPK 3U3GA 4YHHK 2HHUA 1VQON 2QWMA 1RBTA 2HHSA 2B5JA 5M1KA 3O3HA 3CYMA 3S3OA 1NK0A 3SLCA 3V81A 2HBLA 3KLEA 1EO1A 5CZ1A 3VTIA 1CXUA 2YKNA 4FO0A 3CM6A 1SL0A 2V7YA 3AVKA 3R6MA 1BO5O 4JNEA 4M7XA 4DV6K 1YTUA 3I8DA 4YDUA 4LF6K 2EX3A 3GDQA 4DQRA 1REVA 4Z4FA 4WFNL 5AQXA 2Z1GA 3CCRN 1MWMA 4ZTFA 2RKIA 1NGCA 3U8XA 3NAEA 1NKCA 2YCHA 3WXLA 3D2EB 2YNFA 4ILGB 1BA0A 1QHAA 3KTQA 2O8FB 4JKFA 2E2NA 3C6UA 5IWAK 2QKKA 4CIEA 1Z26A 4KRFA 2P5GA 3RRGA 3CQXA 4JAXA 2VWJA 2G8VA 4W5OA 4ILHA 3WNHA 1EX4A 2WTUA 4B3MK 3FZFA 2WFBA 4FLZA 1S9EA 3BEXA 4DV0K 2W42A 5B8HA 1X3NA 3FE1A 5J2PA 1NJXA 2G8IA 1KCFA 3THVA 3UB5A 3VA0A 2G8WA 4LC9B 3A5OC 4O5FA 1WAFA 2JWLA 4AH9A 4DTJA 1EXQA 4RW6A 5BRFA 3KD1E 2ATQA 3HPHA 1NK9A 4RWTA 1NKBA 2KKZA 3P39A 4YOUA 2HF3A 1Q81O 4GV3A 3D2EA 4KI6A 1WB9A 1L3VA 2ZF5O 2O8CA 3FFKB 4DR3K 2G8HA 3R8EA 4A62A 1YXQA 4KHQA 4JI2K 4BRIA 3MXIA 4F9OA 3CMAN 1L3SA 1RDCA 2DFHA 3TU5A 3OTOK 3AA2A 3VEVA 4I6MA 3LPUA 1KSPA 3SYZA 3F5TA 2FF6A 3O4NA 4A5AA 3VEZA 2QM1A 4NB4A 3OYHA 1B9FA 3KLIA 1A5WA 3NFAA 4K25A 4CFBA 2JLEA 4FOIA 2X78A 1GLLO 4LSLA 3T3FA 2WOMA 3AO5A 4E89A 3DRPA 2KQ2A 2BE2A 4E7HA 3SV3A 3B8AX 4CGGA 4DQ8A 1KFSA 4CZHA 3WXIA 1DLOA 4M3XA 4KH4A 1N5YA 2ZJRL 1RT3A 4AHUA 1TYQB 4EAHD 1RNHA 1VSMA 4BWJA 4JI7K 3DLHA 1ZBFA 2AA4A 2HVHA 1VQ9N 2GBZA 4FJ7A 4BR5A 5DMRA 3HM9A 2D0CA 3CI5A 1BG3A 3C6HA 3G10A 3U3YA 4DLGA 1HKCA 4IZ9A 1K6YA 4BRNA 4MO5A 4CZFA 2YNGA 4IFVA 3CJ1A 1TL3A 3M8PA 3VGMA 4CEAA 2E2QA 3QFUA 4GV6A 4FJLA 5HRNA 4CEDA 3VQ9A 1JJ2M 4RW9A 3OA9A 2P9IB 3K9KA 4KH5A 4OJRA 4IFEA 5AQLA 1YITN 2CGLA 1BISA 1RT7A 2ZGZA 3I55N 3NE6A 4ZHRA 2A5XA 1C0TA 4B9NA 4K8ZA 5JLFA 4GW6A 4KHSA 1ZYQA 3SQ4A 3MN6A 5M1PA 1FKPA 3DLRA 3ZLJA 2BGGA 1KVCA 3ASMA 4ILJA 4OVLA 3MEDA 3OYJA 3RR8A 2WONA 1VAZA 4BVOA 4NCBA 3LZIA 2DFEA 1QE1A 4CIGA 4X65K 4KKOA 4QS7A 1Q86O 2W6KA 4B08A 1S1TA 2P9UB 3AV9A 3BGRA 3CCEN 4Z4GA 4H5NA 3MX2A 3G6EN 1Y64A 1ZC6A 3I8BA 1LWCA 5JMVA 1NBWA 3H1VX 3LANA 3EZ5A 3RRHA 1T03A 1M90O 4PY5A 1RT2A 3KK1A 3ISNC 3CETA 4BDPA 5GIOA 5FLXO 2P9IA 1ATSA 3QEXA 4CJEA 4NCAA 5C2DA 3ZSQA 1HUXA 1WOQA 4MLHA 3SQ1A 1YJNN 2OCEA 3DRSA 3ZSRA 4LSNA 5KGXA 3A0IX 4WF9L 3O9TA 1OVYA 3S41A 4B9VA 1U48A 5F1XA 1L3UA 2XHBA 3CERA 2VQEK 3DLGA 3AAPA 3SMSA 1BOTO 1C0GA 2P9UA 3AVLA 5AQKA 2UU9K 1NGHA 3OYEA 2OPPA 3CJAA 4H5RA 4FJNA 1WN7A 3VN5A 1NNEA 2GWJA 4CJLA 3U9ZA 1LOTB 4BRPA 4FZZA 4JKHA 4E7LA 3LWLA 4DV3K 2D0PA 4IFYA 2OZMA 1U4BA 1BU6O 4B3OA 3NH2A 1SZ2A 3OYKA 4CGFA 2NRRA 1NKEA 1N36K 2ITMA 2ASPA 4MDAA 3AVAA 2E88A 1NWKA 1QHTA 1ESVA 2P51A 1W9HA 3BY5A 3VEXA 4DV1K 5JVHL 5BPMA 2Q0RA 4JI1K 3HBTA 4KTQA 4CHPA 1HNXK 4JKDA 1JXBA 5EU7A 4FK2A 1K8KB 2FSKA 4OGCA 2Y1JA 4Z94A 3O3GA 4DSLA 1JCFA 1HR0K 2FXUA 4Z4EA 1D9DA 3H6EA 3L2RA 4WYBA 3M8RA 4BE2A 3V9XA 4E19A 3SPYA 1TK5A 1C0FA 2IOCA 3LAKA 5FRMA 4B1YB 2YI1A 1RBUA 4JS5A 2YHAA 3KK3A 1KD1O 5EX5A 1EP4A 2D4WA 4DTOA 1RDBA 3WXJA 3DI6A 4IOXA 3HO1A 3T1YK 1JL2A 1LWFA 1RDAA 4MQ3A 3G4SN 3V1QA 3HVRA 3OYGA 2O8EB 1QQNA 2D0BA 4ELVA 4FCYA 4IDKA 2FF3B 4IJNA 4A59A 3HP6A 2GUIA 1GLEG 4JKEA 1EWQA 3A5MC 3KIOA 3ZETB 1HMVA 1KAYA 2Q0UA 3CQ8A 2G8UA 4GNIA 1BL3A 1ZXOA 1ZBHA 2DTUA 1BCMA 2VWKA 3L2QA 1K8KA 1NK4A 3TAPA 1KLNA 2NLXA 3IRXA 3SMPA 5HLFA 1H1VA 2F9WA 3WXKA 4BRGA 3S9HA 2NZTA 4B1VA 4FJ5A 3VF4A 2V51B 1W0HA 1SS6A 2AP1A 1C0MA 4B1ZA 1S1VA 3PIPL 3BP8A 1RDUA 5DM6L 4IOCL 4FPAA 3KKSA 1NM1A 3P1GA 4CEQA 5KTQA 4KHYA 2B6AA 2HNDA 4J8FA 4DR2K 4CVNE 3SNNA 1UOCA 4JK9A 4XH5A 1UWBA 5FPMA 4CZMA 1TKXA 1J53A 2O8EA 3RMCA 4DB3A 3NCIA 3SV4A 3TPQA 3SQ0A 3ZETA 1RILA 4H0YB 4DUYK 5AQYA 4PKGA 3MXJA 4H4MA 2Q97A 3ZYYX 1G99A 4F2RA 1GOCA 2UXDK 5BPNA 2KZMA 3NVKA 2UXCK 4CEOA 5KPTA 3P31A 4CERA 4JYAK 3DLEA 3A8YA 3C6TA 3R1XA 4JD2B 5AQRA 2ZE2A 3KLGA 3OYFA 4IBNA 5DK5A 1FXXA 4H0OA 1C1CA 4AHCA 3AVNA 4B3RK 4DFMA 5BN8A 1NOZA 4BRLA 3CD6N 5BPLA 3RSEB 3BF3A 5FRNA 4HTUA 2YJEA 4HUGA 4OPKA 3K2PA 4O0JA 4OPHA 1NOYA 2HBJA 5AZJB 4B1WB 4DFKA 1IKWA 4E7JA 4H0XB 3V6DA 1LAVA 3HTVA 2VQFK 3Q7BA 2JWKA 3KHYA 4H8KA 3DJCA 3LM2A 3DOKA 1RTIA 5JS1A 4EP4A 3ZEUB 3HXMA 5AJ3K 3DXMB 5C42A 1WSFA 3D0PA 4RW7A 3BF1A 1NG9A 1OH5A 4C8KA 5J2QA 1TL1A 3VEYA 5AQMA 1NU0A 3ZT3A 1S3XA 3AA5X 2ZQBA 1QQCA 2DPNA 1VSLA 1YJ9N 3NF6A 1DGKN 2XRIA 2IVNA 4IDHA 2V7ZA 1QVFM 1DTQA 4H5WA 1CXQA 3CCLN 1A5XA 2ASMA 2IVOA 4FW2A 3RSEA 4WFBL 2A42A 3C7NB 4DMNA 4BRKA 4CHZA 5LY3A 3O3FA 2VGMA 3FFIA 5AZJA 4KHWA 4JLHA 3GE1A 3TAGA 1TK8A 1IG9A 1KVBA 4CBXA 1SUQA 5AQZA 1HNIA 5EXWA 1K9MO 3SUQA 3DXKB 3I33A 2JGUA 3DXMA 4KB0A 3HL8A 4ISFA 4LY7A 5AQGA 2OZSA 2P9SB 3AO4A 5AQPA 4IJAA 2GX9A 1FKOA 1U6ZA 1VQKN 4FJIA 3DMJA 5E41A 4FWOA 1QVGM 4WQ4C 2HMPA 4GVEA 4CZIA 2W41A 4IEEA 3J7YP 1KXPA 4DSFA 4JV5K 5HRRA 1LV5A 1S6PA 1XI1A 1KAXA 1S72N 4XEIA 3AVCA 4CF8A 1WNSA 5AQNA 3MEGA 3BZCA 3C7NA 1NJIO 4CGIA 3CC4N 3V4IA 3VQBA 4DHYA 4Z0UA 4X62K 3VGKA 1BHLA 3C94A 2FBYA 4CCHA 3PUFA 4R79A 4CJ4A 1WBDA 3VOVA 4HCCA 4JRPA 3SAHA 4FOEA 4DTMA 3G71N 3SJJA 4I7FA 4KO0A 4DR1K 1E4FT 2Q36A 2A40A 1Q9XA 3MDQA 2FBVA 4LH5A 4N56A 3DXKA 3RMBA 4FWPA 2XO7A 2P9SA 5FDLA 3CJ9A 2RF2A 3K0SA 1HYVA 3S3MA 3QFPA 4V19S 2HOEA 3T7ZA 4DR4K 2E20A 3ZSWA 2PZSA 3P38A 3AVFA 4CJPA 5H1SQ 5C12A 3IG1A 1JXEA 3QIOA 1LAWA 3J7ZO 3M5RA 5KRTA 2HBMA 4J2BA 4H0TB 4O44A 2F7TA 2ZJPL 1XQSC 4WFAL 2F96A 3SUOA 2UYTA 3ZT1A 5GAEP 4JKGA 1T6CA 5M1NA 4FLWA 2NRXA 1O1WA 1NGEA 3TR8A 3LM9A 3QBXA 1HQEA 1S6QA 3IKMA 3NDKA 2O8CB 4YOXA 3OYCA 2YKMA 1JLEA 4NLBA 1S22A 2YHWA 4CF9A 2IIRA 2BUPA 3VEWA 4WQ5A 1S9GA 2QWOA 4FWQA 4I6MB 4LFBK 4PUOA 2PBDA 4ZTJA 4JKAA 3W3DA 2QK9A 3HPGA 5AQTA 1NGFA 1MWKA 3QEVA 2RHKA 2VYPA 4KHNA 1VQNN 3VQDA 4A61A 2D0OA 3MCAB 3SCXA 1VRUA 4JI4K 4DFJA 1RBRA 5F2RA 4FWKA 5FPEA 2P9KB 5EVZA 4N41A 3VA3A 1KQSM 1JLCA 3NH1A 4KV8A 2QXFA 4JKCA 3M3ZA 2I7PA 3IAYA 3EN9A 4B3SK 1GLJO 4DR6K 3O4WA 4MLEA 5AQHA 4FK0A 4H5VA 1N8RO 3BDPA 1L3TA 5FPDA 4CZGA 2KTQA 2HNYA 1JLFA 3TI0A 1VQ6N 4M3TA 1SL2A 1R59O 3DAWA 3L8BA 1JLGA 4IG3A 2VG6A 2WC9A 1NLVA 4IEIA 4F3OA 2WUSA 4NCGA 4YOVA 4O8UA 4MFBA 1SL1A 3AVIA 4C8MA 3L2VA 4E0DA 4BROA 5I42A 1B92A 1ZBUA 4CE9A 2HMIA 3AARA 1L5UA 2HHVA 2P9KA 3F73A 5HROA 4FJGA 4KBOA 4DU1A 1I94K 4IXCA 4CZLA 4YY3K 2P9PB 4FVMA 4EIAA 3N4PA 1RTHA 1IJJA 1J6ZA 3CJ7A 3T1HK 4KFBA 3WNEA 4O55A 1LWEA 1RBSA 3CJCA 1GLBG 1X9SA 4B8CA 1JLAA 1HYZA 3KZBA 1YUWA 2FSNA 3QO9A 4JRQA 4C1NK 4Z4CA 4DV2K 5HOOA 4B9LA 1CZAN 2QWPA 1IBMK 1U49A 2HHXA 2IAJA 4FSVA 3GG4A 3OYDA 1Q8IA 2P1JA 3O1WA 4FWMA 1EKEA 1MA9B 4QS8A 2A1RA 3M1FA 4LH4A 2CGJA 3OS2A 4FJ9A 5AQWA 1IKVA 2PAVA 4Q0BA 3KVGA 5M1OA 3WQTA 3CFOA 3LPTA 2O8DA 1VRTA 3H45C 3H3NO 4BDZA 4KTWA 2ASOA 4BRCA 3QNNA 1UA1A 2P9PA 3EYZA 2UUCK 4BWMA 3ULDA 1F21A 2E4LA 4N5SA 3LAMA 3KWIA 1WUAA 1VQ4N 1XNQK 2Q2RA 3FZMA 3PSFA 1N32K 2BTFA 4FWSA 4E1JA 1HRHA 3W0LA 4JI8K 4YFUA 2QWQA 1XHZA 1NGDA 3MN7A 5CYQA 2BDPA 2FSJA 1JLBA 4CD3A 1BUPA 5BRHA 4PL7A 1N6QA 4CF0A 3F9MA 2PYJA 2E6LA 1SKWA 1U45A 1J5OA 4JEPA 5HRPA 2YNHA 4FPBA 1VQ5N 3ATUA 1Q18A 3QERA 1U2VA 3B6OA 1T6DA 1ASUA 3L4QA 4AHTA 3ID6A 3EKSA 1XWLA 4DS4A 1KAZA 3P5JA 1QSYA 3FLCO 5KPZA 3HYFA 4A57A 3SAGA 3NGYA 4CJTA 2QWLA 4DSIA 4AHRA 3WQUA 1G15A 3LL3A 4FJHA 4DTXA 4I2PA 4K42A 1RT5A 5KQDA 3ENHA 3EL2A 4I9QA 1X9MA 3VESA 3G0ZA 3LDLA 2Y1IA 5CR4A 2KFZA 1TUUA 2E6MA 3TAEA 5D3GA 4CGJA 4FL9A 3TABA 3QETA 3CQYA 3PX4A 3V1OA 1S1UA 1X1PA 3OS0A 1YTAA 3HT3A 3QEIA 4DUZK 4A2AA 3TTDA 2UXBK 1N33K 1X3MA 3KLHA 2X74A 2P9LA 5C24A 3HK2A 3VENA 4EHUA 3SJHA 4WE1A 4KREA 4DTNA 4H0VB 1NMNA 5AFUH 3HJFA 3VQPA 3CF5L 3O9UA 3PO5A 3ZCMA 4J2AA 2YHBA 3OY9A 4I9LA 3J81O 1VQLN 5IT9O 2VWBA 3PX0A 1RDDA 1E3MA 4AF1A 4BRMA 4FK4A 4CGHA 4E3SA
chains in the Genus database with same CATH topology
3GDQA 3O8MA 3ZEUB 4WFNL 3DXMB 3C65A 5AQXA 5ADXH 3CCRN 3E1YA 1RFQA 1E4GT 4BR4A 2PFUA 1MWMA 1HLUA 3BF1A 4PHTX 4O8KA 4XH4A 3CC2N 1NGCA 3EE9A 3U8XA 3VEYA 2YCHA 3L0QA 5AQMA 3WXLA 1S3XA 4C1NI 1YHQN 5AR0A 3D2EB 4JHDB 4ILGB 2DPNA 1ZBSA 4NO7A 5GIPA 2YX6A 1YJ9N 1BA0A 3QDKA 3VEOA 5I9EB 1QHAA 4WQ4A 2QI2A 1DGKN 4JKFA 2HF4A 2QW9A 2IVNA 1GLFO 4YOWA 2E2NA 4IDHA 2V7ZA 4CBWA 1QVFM 3UKUB 2A6AA 4H5WA 3CCLN 5CHIA 2ASMA 3CQXA 3F2KA 2IVOA 4WFBL 3RSEA 2GELA 4JAXA 3CCJN 3PIOL 1Z05A 4BGAA 2A42A 3C7NB 1O13A 2E1ZA 2NNWA 4BRKA 4WCEL 5LY3A 4YOYA 2VGMA 4ILHA 4OPAA 3WEEB 2D1KA 4MDBA 3WT0A 5AZJA 2OTJN 1HKBA 2E8AA 4BR9A 3FZFA 2WFBA 3GE1A 3LDNA 3AAQA 5BREA 1TYQA 1BWFO 5KPRA 4CBXA 3BEXA 5B8HA 1X3NA 3FE1A 2J4RA 4YDUC 5AQZA 1RGIA 4BC5A 3UB5A 2NRZA 2ZJQL 4LC9B 3A5OC 4O5FA 5EXWA 2JWLA 3OBWA 4BC2A 1K9MO 3DXKB 3I33A 3DXMA 5ELZA 5BRFA 4ISFA 5DM7L 5AQGA 2P9LB 2P9SB 5AQPA 4IJAA 3TTCA 5GAHP 2GX9A 1U6ZA 4RWTA 2KKZA 3N4QA 2I7NA 1VQKN 3P39A 4YOUA 1XC3A 2HF3A 1Q81O 4GV3A 3IMXA 3D2EA 5GADP 3RVCA 3CMEN 4JHDA 1V4TA 2ZF5O 4FWOA 1QVGM 5AQVA 3FFKB 3JS6A 4KH6A 4DKWA 1X9JA 3R8EA 4WQ4C 4A62A 2HMPA 5E26A 3I56N 1YXQA 4GVEA 4CZIA 2W41A 4IEEA 1KXPA 3VMFB 4BRIA 4F9OA 3CMAN 3UKUA 3D2FB 1KAXA 3TU5A 1S72N 4XEIA 3EO3A 4I6MA 3VEVA 4BRQA 5AQNA 5LJWA 3U4LA 4HTLA 3UE5A 4BRFA 3C7NA 1NJIO 3F5TA 1EQYA 3CC4N 4DHYA 1BDGA 2FF6A 3VGKA 3WEEA 5AQFA 4A5AA 2VGNA 1NMDA 3UKRB 3VEZA 1K73O 3CC7N 1QQMA 2QM1A 4NB4A 4R79A 2H3GX 3VOVA 5TKYA 3JXUA 1JCEA 3SAHA 4K25A 4FOEA 5M1QA 4Y0WA 2QWRA 4FOIA 3G71N 1E4FT 2Q36A 2A40A 4FWNA 3MDQA 3MK6A 3ULEA 1GLLO 4BG8A 3HOTA 3DXKA 4L3QA 4A5BA 4IO9L 4FWPA 2P9SA 3R3LA 3HSCA 2NRVA 2GWKA 4BQZA 3B8AX 3CJ9A 3QFPA 3VPZA 4DQ8A 3EE8A 4JKBA 2HOEA 3T7ZA 2E20A 4H5TA 4CZHA 3WXIA 3P38A 4KH4A 5H1SQ 5C12A 2ZJRL 3E9PA 4EAHD 1TYQB 2CH5A 2YJFA 3D2FA 3J7ZO 2AA4A 3M5RA 5GINA 1YJWN 1VQ9N 2A3ZA 2A41A 2HBMA 3FZHA 1DKGD 1NGIA 4BR5A 4H0TB 4CBUA 2F7TA 2ZJPL 3CI5A 1Q7YO 1BG3A 1XQSC 3C6HA 4WFAL 1YIJN 2UYTA 4BVPA 5GAEP 1HKCA 4IZ9A 5E84A 3UKRA 4JKGA 5C10A 4BRNA 1T6CA 5M1NA 4MO5A 3PLAA 5AQJA 4CZFA 3ENBA 3O08A 2NRXA 3CJ1A 1NGEA 1RDWX 3LM9A 3VGMA 4BR2A 2E2QA 3QFUA 3QBXA 4GV6A 2VCPA 3IKMA 5EOYA 1JJ2M 4BRAA 4YOXA 2CGKA 3OA9A 4NLBA 1S22A 2P9IB 2HBKA 2YHWA 3K9KA 2IIRA 2BUPA 4KH5A 3VEWA 4WQ5A 4IFEA 5AQLA 1YITN 2CGLA 4BY9C 2BH1A 2QWOA 2ZGZA 2V52B 4FWQA 3NVMA 4I6MB 5BRDA 4BQLA 3I55N 2A5XA 1HX1A 4CZEA 2PBDA 1HJOA 2Q31A 4JKAA 5JLFA 2RE2A 3W3DA 5KQ8A 3QMLA 4IOAL 3MN6A 5AQTA 1NGFA 1MWKA 3ZX2A 5M1PA 2NRTA 3VF2A 1ATNA 4IWVA 4NLCA 2NRWA 2RHKA 2VYPA 4ILJA 3SK3A 1VQNN 4A61A 2D0OA 4K41A 5FPNA 2ZWHA 1VAZA 4BVOA 3TSUA 2EWSA 3MCAB 3O6WA 3O9SA 3MX5A 4BR7A 3MN9A 1HKGA 4QS7A 1Q86O 3ATVA 3ULEB 3EKUA 5F2RA 4FWKA 5FPEA 2P9UB 4AM6A 3KK7A 2P9KB 5AQIA 5EVZA 3TTFA 3U9DA 2YHYA 4YORA 1KQSM 3CCEN 1YF5L 3O9QA 4H5NA 3A5LC 3AY9A 3CPWM 3MX2A 3G6EN 1Y64A 1LCUA 1ZC6A 3I8BA 3KWGA 3E9LA 3BUZB 4JKCA 3HM8A 3M3ZA 2I7PA 4CD1A 5JMVA 3IUCA 1NBWA 3H1VX 3EN9A 1GLJO 1M90O 3AGRA 2YHXA 3CETA 5GIOA 2P9IA 3O5BA 1ATSA 3O4WA 2FLOA 4MLEA 3HOSA 5C2DA 5AQHA 1NGBA 4WQ5C 4H5VA 5GAGP 1N8RO 5FPDA 4CZGA 1MDUB 1HUXA 2IVPA 1WOQA 3MN5A 4MLHA 1YJNN 1VQ6N 2GUPA 2NRHA 1R59O 3DAWA 4JK8A 1VQ7N 3A0IX 4WF9L 4FVUA 4EFHA 3O9TA 1OVYA 1W97L 2WC9A 3S41A 1ILYA 3HZ6A 4JKGB 1NLVA 4IEIA 1P8ZA 5F1XA 2WUSA 3VERA 4YOVA 2HSTA 3CERA 4O8UA 2GEMA 3CCVN 3AAPA 2QEXN 3SMSA 3J8AA 3C6AA 3SAFA 3K9JA 1BA1A 4FWRA 1VQPN 4BROA 2GTDA 2F9TA 1BOTO 5HL7L 3CCSN 1C0GA 2P9UA 3AARA 2P9KA 4JK7A 4H03B 5AQKA 5F0XA 3CIPA 1NGHA 1QQOA 4DCHA 4KBOA 4U7BA 1VQ8N 4IXCA 4CZLA 3VF6A 3CJAA 4CI6A 2P9PB 4H5RA 3H3OB 4EIAA 3N4PA 2GWJA 3P4IA 3U9ZA 2E2PA 3CCMN 1LOTB 3E9OA 4BRPA 4OO1J 4JKHA 1IJJA 1GLDG 3C0BA 1J6ZA 3CJ7A 2D0PA 3IDHA 3O80A 3CJCA 3VTHA 1BU6O 5AZIA 1SZ2A 1GLBG 1GLCG 5C0YA 1P90A 4MO4A 2NRRA 1YAGA 2OTLN 5BN9A 2ITMA 4BRHA 2ASPA 5AQQA 3KZBA 4MDAA 1YUWA 2FSNA 2E88A 3ZX3A 1NWKA 1D4XA 1ATRA 1ESVA 4RTFD 4C1NK 5HOOA 3WXMB 2QXLA 3O1BA 3LDOA 3VEXA 4B9QA 1CZAN 1NGGA 2QWPA 2Q0RA 3HRGA 3HBTA 3VETA 5BPMA 5JVHL 3Q7CA 4FSVA 4BC3A 3GG4A 4ISGA 4QS9A 4JKDA 3NMUA 5AQUA 3OBYA 1K8KB 5EY4A 3O1WA 2FSKA 4FWMA 1MA9B 1QZ5A 4QS8A 4Z94A 3SBTA 2QA4N 1JCFA 3M1FA 2FXUA 2CGJA 1YI2N 5AQWA 2PAVA 4CZKA 3H6EA 3KVGA 4WYBA 5M1OA 3WQTA 2P9NA 3LDQA 1Z6RA 3D7EO 4FWLA 1C0FA 3H45C 4C23A 2ZGYA 4B1YB 2W40A 3H3NO 2YI1A 3MMVA 1XUPO 4EHTA 4B1UB 2ASOA 4M7YA 1VQMN 3MWTA 3HI0A 3FZLA 4BRCA 5EX5A 2P9PA 1KD1O 3O9RA 2D4WA 3VGLA 2Q1NA 4BRDA 1W2BM 3WXJA 3GOIA 5M1FA 4IOXA 4ISEA 4JD2A 5C2FA 3KWIA 1WUAA 4CZJA 1VQ4N 4YOTA 2Q2RA 3FZMA 3G4SN 4UY8O 5MLCQ 3TSQA 1QQNA 4G9ZA 2BTFA 4FWSA 4A59A 2FF3B 4IJNA 4E1JA 3W0LA 1GLEG 4JKEA 4AM7A 5TKWA 3FR0A 2QWQA 3FZKA 3A5MC 4BC4A 3ZETB 1DEJA 1JCGA 1NGDA 3MN7A 1KAYA 3DWLA 2Q0UA 3L4IA 3MWPA 2FSJA 5JLHA 5LJVA 3R9PA 4GV9A 4GNIA 3A5NC 3AGKA 1ZXOA 3OHRA 4CD3A 1BUPA 5BRHA 2WBNA 4PL7A 2CH6A 1K8KA 3F9MA 3L6QA 2NLXA 3SMPA 4BG9A 1NGAA 1H1VA 2F9WA 4JEPA 3DLLL 3CCUN 3WXKA 4FPBA 1VQ5N 3IFRA 4BRGA 2NZTA 1HPMA 1OKJA 3ATUA 1Q18A 3VF4A 1U2VA 4B1VA 2V51B 1SQKA 1T6DA 1SS6A 2AP1A 3D6RA 4B1ZA 5CE3A 1NGJA 4PKHA 1T3VA 5AZIB 3L4QA 3SBGA 3BP8A 3T69A 3ZEUA 4BR0A 1RDUA 3ID6A 5DM6L 3PIPL 1T44A 3EKSA 4IOCL 1M1KO 4RCHA 4FPAA 1KAZA 3M6GA 5JVGL 3GL1A 1NM1A 3EZWA 5BR9A 3FLCO 5KPZA 4HWIA 4A57A 3H46O 3E66A 4J8FA 3ID8A 3SAGA 3QBWA 3FGUA 1K8AO 4PL8A 4JK9A 3OW2M 4XH5A 2OANA 2QWLA 4A2BA 2KHOA 5FPMA 5AFUA 3WQUA 4CZMA 3LL3A 2E2OA 4K42A 5KQDA 4DB3A 3ENHA 3EL2A 1IG8A 5JICA 3LDPA 3VESA 3LDLA 5CR4A 3CPEA 3ZX0A 3TPQA 3QB0A 3ZETA 4B1XB 1QZ6A 3CJBA 2P9NB 4H0YB 1SAZA 1TUUA 3CXCM 4PKIA 5AQYA 4PKGA 2Q97A 3ZYYX 4CJ7A 1G99A 4FL9A 1Q82O 3H1QA 5BPNA 3TSPA 5C15A 3NVKA 3CQYA 5KPTA 4GY2B 3P31A 4XH1A 3A8YA 5ADXA 2E1YA 3ENOA 3R1XA 4JD2B 5AQOA 5AQRA 4JN4A 3WUHA 2KLAA 1DT9A 4K43A 3CHWA 2QTDA 4H0OA 4A2AA 3TTDA 3QICA 1X3MA 5AQSA 4U67L 1GLAG 1V4SA 4BGBA 2P9LA 2QWNA 1YVNA 1TUYA 5BN8A 4BRLA 3CD6N 5BPLA 3VENA 4BREA 4IO8A 3SJHA 3RSEB 4EHUA 2QWMA 3BF3A 1VQON 2YJEA 4H0VB 4M63C 5AFUH 5M1KA 3CF5L 3G25A 3O9UA 4OPHA 3SLCA 2HBLA 2HBJA 5AZJB 4B1WB 3VTIA 1EO1A 3CCQN 3MCPA 4H0XB 4H0PA 4FO0A 1VQLN 2VWBA 3HTVA 2V7YA 3Q7BA 2JWKA 3GBTA 3R6MA 1BO5O 3KHYA 4JNEA 4M7XA 4AF1A 4BRMA 3DJCA 1KC8O 3LM2A 4YDUA 1U2VB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IO9 L;  4WFN L;  1YJN N;  1VQ6 N;  3CCR N;  1VQ7 N;  4WF9 L;  3CC2 N;  1OVY A;  1ILY A;  1YHQ N;  1YJ9 N;  3DLL L;  3CCU N;  5H1S Q;  3CCV N;  2ZJR L;  1VQ5 N;  2QEX N;  1VQP N;  3J7Z O;  5HL7 L;  1QVF M;  1YJW N;  3PIP L;  3CCS N;  1VQ9 N;  5DM6 L;  1M1K O;  3CCL N;  4IOC L;  3CCJ N;  4WFB L;  5JVG L;  3PIO L;  2ZJP L;  1Q7Y O;  4WFA L;  1YIJ N;  1VQ8 N;  4WCE L;  5GAE P;  1K8A O;  2OTJ N;  3OW2 M;  3CCM N;  1JJ2 M;  2ZJQ L;  2OTL N;  1K9M O;  1YIT N;  5DM7 L;  3I55 N;  3CXC M;  5GAH P;  1VQK N;  5JVH L;  4IOA L;  1Q82 O;  1Q81 O;  5GAD P;  3CME N;  1QVG M;  1VQN N;  3I56 N;  2QA4 N;  3CMA N;  1YI2 N;  1S72 N;  4U67 L;  1Q86 O;  3CD6 N;  1VQO N;  1NJI O;  3CC4 N;  1KQS M;  3CCE N;  1VQM N;  3CPW M;  1KD1 O;  3G6E N;  3CF5 L;  1K73 O;  3CC7 N;  1W2B M;  3CCQ N;  1VQL N;  1VQ4 N;  1M90 O;  3G4S N;  3G71 N;  4UY8 O;  5MLC Q;  1KC8 O;  5GAG P;  1N8R O; 
#chains in the Genus database with same CATH topology
 3C65 A;  5J1E A;  5ADX H;  1RFQ A;  1E4G T;  3NF9 A;  4BR4 A;  1RBV A;  2PFU A;  4PHT X;  1HLU A;  4BAC A;  3QLH A;  4NYF A;  4O8K A;  4XH4 A;  3CC2 N;  2QKB A;  3EE9 A;  4X64 K;  4OLA A;  3L0Q A;  4B9S A;  3T1A A;  4B9M A;  3L3U A;  4NO7 A;  5GIP A;  3VEO A;  3QDK A;  4G1Q A;  4Z4I A;  2HF4 A;  2QW9 A;  1GLF O;  1NJW A;  4CJ5 A;  4CBW A;  1HPZ A;  3UKU B;  3KD5 E;  1HJR A;  5CHI A;  4E1M A;  3L3V A;  3PIO L;  1Z05 A;  4BGA A;  3VQ5 A;  2E1Z A;  4WCE L;  2IGI A;  4CHN A;  4OPA A;  3WEE B;  1WBB A;  3WT0 A;  2E8A A;  2HHQ A;  3LDN A;  4B3T K;  5BRE A;  3EY1 A;  5KPR A;  3RR7 A;  4OGE A;  3AVH A;  4YDU C;  2J4R A;  4CEE A;  1NJY A;  1HQU A;  2NRZ A;  2ZJQ L;  3M8S A;  4K0K K;  4JI5 K;  3AVM A;  4DFP A;  5DM7 L;  4LF5 K;  1IV0 A;  5GAH P;  4FJX A;  3DRR A;  2Z1I A;  2I7N A;  4N47 A;  3OJU A;  3PY8 A;  1XC3 A;  4CFA A;  3IMX A;  4CEF A;  5GAD P;  4M3W A;  3CME N;  1KVA A;  5AQV A;  4AIL C;  3TAM A;  4KH6 A;  5KRS A;  4GKJ K;  4DKW A;  2IS3 A;  2HB5 A;  3I56 N;  1RTD A;  4DLE A;  3UKU A;  4DV4 K;  3D2F B;  4DR7 K;  1R0A A;  3EO3 A;  5LJW A;  1VSJ A;  4HTL A;  4BRF A;  1QSL A;  2X6S A;  3VQC A;  4B9T A;  3KK2 A;  3WEE A;  5AQF A;  3B6P A;  2VGN A;  1NMD A;  4LF7 K;  1K73 O;  3CC7 N;  1QQM A;  1KRP A;  4FLV A;  3NF8 A;  2H3G X;  5TKY A;  2KZZ A;  3JXU A;  4JI3 K;  3T19 A;  1SKR A;  5M1Q A;  3CG7 A;  4DSJ A;  4FWN A;  3MK6 A;  3ULE A;  3ZT4 A;  4A5B A;  5T7B A;  2KW4 A;  4ICL A;  3R3L A;  3HSC A;  1WSG A;  4FW1 A;  2ETJ A;  4BQZ A;  3VPZ A;  4OKJ A;  4IG0 A;  1OH6 A;  1QTM A;  3OYM A;  5HRS A;  3AA3 A;  1NK7 A;  1KFD A;  3D2F A;  1VSE A;  4ID5 A;  1TK0 A;  4LF9 K;  5GIN A;  2A3Z A;  2A41 A;  2LSN A;  2F4V K;  4Y1D A;  3VQA A;  4M3U A;  4X66 K;  1J9A A;  2RN2 A;  5AQJ A;  3ENB A;  1RDW X;  4BR2 A;  4QCL A;  4OLB A;  2VCP A;  4DF4 A;  3V9U A;  2Z1H A;  4BRA A;  2CGK A;  5FRO A;  4HHT A;  1BGX T;  1UAX A;  2BH1 A;  3HP9 A;  3SPZ A;  5BRD A;  3NVM A;  2FBX A;  1RT4 A;  1HX1 A;  4CZE A;  3SUP A;  1HJO A;  2Q31 A;  3JAM O;  5KQ8 A;  4IOA L;  4CJK A;  4DTP A;  3RWU A;  2NRT A;  4NLC A;  2NRW A;  5A2Q O;  2I5J A;  2E5L K;  4K41 A;  5FPN A;  3TSU A;  4CFD A;  5K14 A;  3O6W A;  4C8L A;  3O9S A;  2FC0 A;  3MX5 A;  4BR7 A;  3MN9 A;  1HKG A;  1IO2 A;  1BIU A;  2OA8 A;  1XMO K;  1IKY A;  2G8K A;  3KK7 A;  3U9D A;  2YHY A;  1YF5 L;  4NXM K;  3A5L C;  3CPW M;  4M42 A;  4PWD A;  1C0U A;  1BI4 A;  4LF4 K;  3AVJ A;  3IUC A;  4XIU A;  2XY5 A;  4CEC A;  3J80 O;  4DR5 K;  3TAQ A;  5J2N A;  2OYQ A;  1VSK A;  4Q5V A;  3OYN A;  3O5B A;  1LW0 A;  3HOS A;  5GAG P;  5HBM A;  3HPO A;  1WAJ A;  1VSH A;  1OH7 A;  2HNZ A;  1MDU B;  3K58 A;  2IVP A;  4JK8 A;  5SZT A;  4FVU A;  4CHO A;  2XY8 A;  4CHQ A;  1ILY A;  4JKG B;  1P8Z A;  3VER A;  1YVU A;  3OYL A;  4CIF A;  3V9S A;  4J2E A;  3CCV N;  2QEX N;  3DLB A;  3TWH A;  2AJQ A;  1BA1 A;  2GTD A;  2F9T A;  5HL7 L;  2OPR A;  4AQY K;  2O4I A;  4GMJ B;  3ITH A;  3I0R A;  3WNF A;  5F0X A;  4CW7 B;  1VQ8 N;  4DG1 A;  4CI6 A;  3OVN A;  3AO2 A;  3P4I A;  3V9Z A;  4KPY A;  3DYA A;  4OO1 J;  1N34 K;  3C0B A;  2B4J A;  4M3R A;  3VTH A;  5AZI A;  2EHG A;  4R5P A;  1P90 A;  3CFR A;  1YAG A;  2OTL N;  3A2F A;  5BN9 A;  4E7I A;  1XNR K;  4CEZ A;  4RTF D;  1ATR A;  4CJR A;  3K59 A;  1BIZ A;  3WXM B;  2QXL A;  3PV8 A;  5KI6 A;  3NF7 A;  3VET A;  1I3A A;  1NK6 A;  3Q7C A;  1IH7 A;  4ISG A;  3NMU A;  5AQU A;  3OBY A;  1RCH A;  1Z25 A;  1QZ5 A;  3SBT A;  3AVG A;  4CJS A;  4O5B A;  4HVJ A;  1YI2 N;  5CYM A;  4CZK A;  4FLY A;  4ELU A;  2P9N A;  3LDQ A;  1Z6R A;  3D7E O;  4FWL A;  2W40 A;  4EHT A;  2IDO A;  1XUP O;  4DF8 A;  1VQM N;  3MWT A;  3FZL A;  3NBP A;  3ZSV A;  3VGL A;  1J5E K;  5LMU K;  3GOI A;  2FBT A;  5M1F A;  5LL6 Z;  4FJK A;  3MAQ A;  4CFC A;  1WSH A;  2P5O A;  3K5M A;  5TKW A;  3FZK A;  2O8B B;  4BC4 A;  3QES A;  3DWL A;  3L4I A;  3JYT A;  3MWP A;  5LJV A;  4GV9 A;  3AGK A;  1S1W A;  1EWR A;  3JSM A;  1NJZ A;  3AO3 A;  1W7A A;  1WLJ A;  4BG9 A;  1NGA A;  1FJG K;  3CCU N;  3IFR A;  4PA1 A;  1HPM A;  1OKJ A;  2XY7 A;  5CE3 A;  3D6R A;  3T69 A;  3SBG A;  4BR0 A;  4RCH A;  3SI6 A;  1D5A A;  4HUE A;  3E66 A;  1K8A O;  3QBW A;  3FGU A;  4PL8 A;  2RPI A;  4A2B A;  1FK9 A;  4H4O A;  2O8F A;  4YNQ A;  1VSI A;  2E2O A;  5JIC A;  3LDP A;  4M3Z A;  3CPE A;  3ZX0 A;  2O8B A;  3QB0 A;  4B1X B;  1QZ6 A;  3CJB A;  1QSS A;  3K57 A;  4FZY A;  1SAZ A;  4PKI A;  3LP1 A;  2O8D B;  3V9W A;  1X9W A;  1ZBL A;  1Q82 O;  3SUN A;  3L2U A;  5BR8 K;  4XH1 A;  4LD0 A;  4DU3 A;  1ZBI A;  2D0A A;  3ENO A;  3WUH A;  1DT9 A;  4M41 A;  1ASV A;  1B9D A;  3ZT0 A;  5AQS A;  4U67 L;  3K5L A;  3RMA A;  1GLA G;  4CK1 A;  2F8S A;  1V4S A;  4QOZ B;  3PX6 A;  3OS1 A;  1TUY A;  4BRE A;  4IO8 A;  4DTU A;  4M63 C;  3G25 A;  4CJW A;  4LFC K;  3CCQ N;  3MCP A;  4H0P A;  1I39 A;  4FJJ A;  3GBT A;  4CF2 A;  1OH8 A;  1Q9Y A;  1KC8 O;  4OX9 K;  3OHR A;  1U2V B;  3O8M A;  4KTZ A;  4F3T A;  4GVM A;  4EZ6 A;  3E1Y A;  4OKE A;  2DFF A;  3NH0 A;  4PQU A;  1SKS A;  1RT1 A;  4GKK K;  4C1N I;  1YHQ N;  1CLQ A;  5AR0 A;  4JHD B;  4DSE A;  1ZBS A;  2YX6 A;  5I9E B;  4WQ4 A;  2QI2 A;  1ASW A;  1KLM A;  4YOW A;  4OPJ A;  2A6A A;  3VQ6 A;  3VQQ A;  4F4K A;  3CCJ N;  3F2K A;  2GEL A;  3ZSX A;  3LP0 A;  1O13 A;  3I0S A;  2NNW A;  5CY4 A;  4DQS A;  4YOY A;  2D1K A;  4MDB A;  2OTJ N;  4CEB A;  2Q3S A;  1HKB A;  4BR9 A;  1VSD A;  3AAQ A;  1TYQ A;  1RT6 A;  1BWF O;  4DTR A;  1S1X A;  3LAL A;  4CJF A;  2F8T A;  4FLX A;  4FM1 A;  1RGI A;  4BC5 A;  3OBW A;  1BQN A;  4BC2 A;  5ELZ A;  5CZ2 A;  3ZT2 A;  2P9L B;  4OKK A;  3THX B;  4QAG A;  3TTC A;  4RW8 A;  3N4Q A;  3LP3 A;  2R7Y A;  3QIP A;  3OYA A;  3RVC A;  4JHD A;  1V4T A;  4W5T A;  1SV5 A;  3JS6 A;  4AHV A;  1X9J A;  4BDY A;  1VHX A;  5E26 A;  3VMF B;  1TKT A;  1DTT A;  4LF8 K;  4BRQ A;  3U4L A;  4K8X A;  3UE5 A;  3ALY A;  3LP2 A;  1EQY A;  1VK0 A;  3BZK A;  1BDG A;  2YNI A;  3UKR B;  4TSX A;  1Y97 A;  3F9K A;  2X6N A;  5I3U A;  5J2M A;  1JCE A;  1IKX A;  1C1A A;  4DV5 K;  4Y0W A;  2QWR A;  4BG8 A;  1JKH A;  3HOT A;  2XY6 A;  4FYD A;  4EZ9 A;  4L3Q A;  4IO9 L;  1TV6 A;  4FXD A;  3THX A;  2NRV A;  4KHU A;  4N76 A;  1GOA A;  2GWK A;  2HHT A;  3VQ4 A;  1YT3 A;  2HHW A;  3EE8 A;  4JKB A;  4C8O A;  3HVT A;  4H5T A;  1U04 A;  4UQG A;  1IBK K;  4E1N A;  5LMN K;  3PSI A;  1C6V A;  3E9P A;  2CH5 A;  2YJF A;  3OYI A;  1YJW N;  3FZH A;  5JS2 A;  1DKG D;  1NGI A;  4B9U A;  2HW3 A;  4CK3 A;  2BAN A;  3CFP A;  4CBU A;  1Q7Y O;  1YIJ N;  3DLK A;  4EP5 A;  4BVP A;  5E84 A;  3UKR A;  5C10 A;  3MXM A;  3PLA A;  3O08 A;  3NGZ A;  1XHX A;  1XMQ K;  2IC3 A;  4FLT A;  5EOY A;  1TKD A;  2HBK A;  1GOB A;  4CGD A;  3DOL A;  4BY9 C;  1TVR A;  2V52 B;  4BQL A;  3MEE A;  4ELT A;  3D45 A;  2RE2 A;  3QML A;  3TAN A;  3ZX2 A;  4NXN K;  1QS4 A;  4J2D A;  4F8R A;  4B8A B;  2OPS A;  3VF2 A;  3LWM A;  1ATN A;  4Y1C A;  4IWV A;  3KLF A;  3SK3 A;  4O0I A;  1LW2 A;  2ZWH A;  1MU2 A;  2EWS A;  2PYL A;  4FLU A;  2UUA K;  3ATV A;  3ULE B;  3H08 A;  4AHS A;  3EKU A;  4RG8 A;  1HNV A;  2YV0 X;  4AM6 A;  1UA0 A;  2D5R A;  5AQI A;  3TTF A;  4YOR A;  2HVI A;  1NK5 A;  1TAQ A;  3O9Q A;  3AY9 A;  3WNG A;  4KB1 A;  1LCU A;  1BCO A;  3KWG A;  3E9L A;  3BUZ B;  2ZM6 K;  3HM8 A;  4CJV A;  4CD1 A;  4BE0 A;  4BE1 A;  4HUF A;  3P83 D;  3AGR A;  4HCB A;  2YHX A;  1CZ9 A;  2FLO A;  3K5O A;  1NGB A;  4WQ5 C;  1T8E A;  4LFA K;  4CJQ A;  4DQP A;  4DWI A;  3NGI A;  3MN5 A;  4O4G A;  3VQ7 A;  2GUP A;  2NRH A;  3QEP A;  4DU4 A;  1VQ7 N;  1CZB A;  4EFH A;  1W97 L;  3O4Q A;  3HZ6 A;  4FM2 A;  4DV7 K;  2HST A;  2GEM A;  1J54 A;  3IS9 A;  3J8A A;  3C6A A;  3SAF A;  3K9J A;  4FWR A;  1VQP N;  4CK2 A;  3CCS N;  4JK7 A;  4H03 B;  3CIP A;  1QQO A;  4DCH A;  2ITG A;  3HST B;  1S5J A;  4U7B A;  3VQ8 A;  3VF6 A;  4FM0 A;  3H3O B;  4E7K A;  3V1R A;  2ZD1 A;  1A5V A;  2E2P A;  3CCM N;  4JI0 K;  2A1S A;  3E9O A;  2Z1J A;  3CM5 A;  1GLD G;  1WSJ A;  3IDH A;  3O80 A;  3THY B;  1TKZ A;  5C0Y A;  1GLC G;  3QIN A;  4FJ8 A;  4CHY A;  4MO4 A;  5C25 A;  1HNW K;  3AA4 A;  3M8Q A;  4BRH A;  3PO4 A;  5AQQ A;  4C8N A;  3E01 A;  4M3Y A;  3ZX3 A;  1D4X A;  3K5N A;  3QEW A;  1KTQ A;  3O1B A;  3LDO A;  4B9Q A;  1NGG A;  3HRG A;  3THW B;  4Z4H A;  3NHG A;  4BC3 A;  4CES A;  4QS9 A;  1BI4 B;  1VSF A;  3OYB A;  5EY4 A;  3RMD A;  3VQE A;  3AVB A;  5KGW A;  4JI6 K;  3KKR A;  1NK8 A;  3SZ2 A;  2QA4 N;  1TGO A;  1T7P A;  4DSK A;  4KAZ A;  4DQQ A;  4CJU A;  4W5Q A;  1WSI A;  1JLQ A;  4CJ3 A;  2VG5 A;  4C23 A;  3L2W A;  2ZGY A;  4DTS A;  3MMV A;  4IKF A;  4B1U B;  4M7Y A;  3HI0 A;  1BQM A;  3O9R A;  4F2S A;  3TAR A;  2Q1N A;  4BRD A;  1W2B M;  3ZSO A;  4ISE A;  4FJM A;  4JD2 A;  4W5R A;  5C2F A;  3AO1 A;  4CZJ A;  3ZSY A;  4YOT A;  2W6L A;  3THY A;  3MEC A;  4UY8 O;  5HP1 A;  3U6F A;  5MLC Q;  3TSQ A;  3SQ2 A;  1T05 A;  4G9Z A;  1HNZ K;  1U47 A;  4AM7 A;  3FR0 A;  3QNO A;  4FZX C;  1DEJ A;  1JCG A;  1OVQ A;  3EEQ A;  5JLH A;  1RTJ A;  3THW A;  3R9P A;  3KJV A;  3A5N C;  3J7A P;  1ITG A;  2OPQ A;  2WBN A;  2CH6 A;  4NYN A;  3L6Q A;  3TAF A;  1JL1 A;  4M45 A;  3DLL L;  4JS4 A;  1XC9 A;  1EET A;  1SQK A;  1NGJ A;  4PKH A;  1T3V A;  5AZI B;  3ZEU A;  2UUB K;  3S3N A;  1M1K O;  1T44 A;  3C95 A;  4DQI A;  2O4G A;  5SWM A;  3M6G A;  5JVG L;  3GL1 A;  3EZW A;  5BR9 A;  4HWI A;  4I2Q A;  3H46 O;  1FW6 A;  3ID8 A;  2G8F A;  2DY4 A;  3OW2 M;  2OAN A;  3RTV A;  3ZSZ A;  2KHO A;  5AFU A;  2PY5 A;  4KI4 A;  3LDS A;  1C1B A;  1TAU A;  1IG8 A;  3LZJ A;  3DM2 A;  1HYS A;  2HHH K;  2P9N B;  3CXC M;  1IBL K;  2KFN A;  4DS5 A;  4CJ7 A;  4ID1 A;  3H1Q A;  2GV9 A;  3TSP A;  5C15 A;  3OJS A;  4GY2 B;  1D9F A;  5ADX A;  2E1Y A;  1D8Y A;  1WSE A;  5AQO A;  4CF1 A;  4JN4 A;  2VG7 A;  2NUB A;  2KLA A;  4K43 A;  3CHW A;  2QTD A;  3UIQ A;  4RW4 A;  3QIC A;  4W5N A;  4BGB A;  4L8R B;  2QWN A;  1YVN A;  4KHP K;  3U3G A;  4YHH K;  2HHU A;  1VQO N;  2QWM A;  1RBT A;  2HHS A;  2B5J A;  5M1K A;  3O3H A;  3CYM A;  3S3O A;  1NK0 A;  3SLC A;  3V81 A;  2HBL A;  3KLE A;  1EO1 A;  5CZ1 A;  3VTI A;  1CXU A;  2YKN A;  4FO0 A;  3CM6 A;  1SL0 A;  2V7Y A;  3AVK A;  3R6M A;  1BO5 O;  4JNE A;  4M7X A;  4DV6 K;  1YTU A;  3I8D A;  4YDU A;  4LF6 K;  2EX3 A;  3GDQ A;  4DQR A;  1REV A;  4Z4F A;  4WFN L;  5AQX A;  2Z1G A;  3CCR N;  1MWM A;  4ZTF A;  2RKI A;  1NGC A;  3U8X A;  3NAE A;  1NKC A;  2YCH A;  3WXL A;  3D2E B;  2YNF A;  4ILG B;  1BA0 A;  1QHA A;  3KTQ A;  2O8F B;  4JKF A;  2E2N A;  3C6U A;  5IWA K;  2QKK A;  4CIE A;  1Z26 A;  4KRF A;  2P5G A;  3RRG A;  3CQX A;  4JAX A;  2VWJ A;  2G8V A;  4W5O A;  4ILH A;  3WNH A;  1EX4 A;  2WTU A;  4B3M K;  3FZF A;  2WFB A;  4FLZ A;  1S9E A;  3BEX A;  4DV0 K;  2W42 A;  5B8H A;  1X3N A;  3FE1 A;  5J2P A;  1NJX A;  2G8I A;  1KCF A;  3THV A;  3UB5 A;  3VA0 A;  2G8W A;  4LC9 B;  3A5O C;  4O5F A;  1WAF A;  2JWL A;  4AH9 A;  4DTJ A;  1EXQ A;  4RW6 A;  5BRF A;  3KD1 E;  2ATQ A;  3HPH A;  1NK9 A;  4RWT A;  1NKB A;  2KKZ A;  3P39 A;  4YOU A;  2HF3 A;  1Q81 O;  4GV3 A;  3D2E A;  4KI6 A;  1WB9 A;  1L3V A;  2ZF5 O;  2O8C A;  3FFK B;  4DR3 K;  2G8H A;  3R8E A;  4A62 A;  1YXQ A;  4KHQ A;  4JI2 K;  4BRI A;  3MXI A;  4F9O A;  3CMA N;  1L3S A;  1RDC A;  2DFH A;  3TU5 A;  3OTO K;  3AA2 A;  3VEV A;  4I6M A;  3LPU A;  1KSP A;  3SYZ A;  3F5T A;  2FF6 A;  3O4N A;  4A5A A;  3VEZ A;  2QM1 A;  4NB4 A;  3OYH A;  1B9F A;  3KLI A;  1A5W A;  3NFA A;  4K25 A;  4CFB A;  2JLE A;  4FOI A;  2X78 A;  1GLL O;  4LSL A;  3T3F A;  2WOM A;  3AO5 A;  4E89 A;  3DRP A;  2KQ2 A;  2BE2 A;  4E7H A;  3SV3 A;  3B8A X;  4CGG A;  4DQ8 A;  1KFS A;  4CZH A;  3WXI A;  1DLO A;  4M3X A;  4KH4 A;  1N5Y A;  2ZJR L;  1RT3 A;  4AHU A;  1TYQ B;  4EAH D;  1RNH A;  1VSM A;  4BWJ A;  4JI7 K;  3DLH A;  1ZBF A;  2AA4 A;  2HVH A;  1VQ9 N;  2GBZ A;  4FJ7 A;  4BR5 A;  5DMR A;  3HM9 A;  2D0C A;  3CI5 A;  1BG3 A;  3C6H A;  3G10 A;  3U3Y A;  4DLG A;  1HKC A;  4IZ9 A;  1K6Y A;  4BRN A;  4MO5 A;  4CZF A;  2YNG A;  4IFV A;  3CJ1 A;  1TL3 A;  3M8P A;  3VGM A;  4CEA A;  2E2Q A;  3QFU A;  4GV6 A;  4FJL A;  5HRN A;  4CED A;  3VQ9 A;  1JJ2 M;  4RW9 A;  3OA9 A;  2P9I B;  3K9K A;  4KH5 A;  4OJR A;  4IFE A;  5AQL A;  1YIT N;  2CGL A;  1BIS A;  1RT7 A;  2ZGZ A;  3I55 N;  3NE6 A;  4ZHR A;  2A5X A;  1C0T A;  4B9N A;  4K8Z A;  5JLF A;  4GW6 A;  4KHS A;  1ZYQ A;  3SQ4 A;  3MN6 A;  5M1P A;  1FKP A;  3DLR A;  3ZLJ A;  2BGG A;  1KVC A;  3ASM A;  4ILJ A;  4OVL A;  3MED A;  3OYJ A;  3RR8 A;  2WON A;  1VAZ A;  4BVO A;  4NCB A;  3LZI A;  2DFE A;  1QE1 A;  4CIG A;  4X65 K;  4KKO A;  4QS7 A;  1Q86 O;  2W6K A;  4B08 A;  1S1T A;  2P9U B;  3AV9 A;  3BGR A;  3CCE N;  4Z4G A;  4H5N A;  3MX2 A;  3G6E N;  1Y64 A;  1ZC6 A;  3I8B A;  1LWC A;  5JMV A;  1NBW A;  3H1V X;  3LAN A;  3EZ5 A;  3RRH A;  1T03 A;  1M90 O;  4PY5 A;  1RT2 A;  3KK1 A;  3ISN C;  3CET A;  4BDP A;  5GIO A;  5FLX O;  2P9I A;  1ATS A;  3QEX A;  4CJE A;  4NCA A;  5C2D A;  3ZSQ A;  1HUX A;  1WOQ A;  4MLH A;  3SQ1 A;  1YJN N;  2OCE A;  3DRS A;  3ZSR A;  4LSN A;  5KGX A;  3A0I X;  4WF9 L;  3O9T A;  1OVY A;  3S41 A;  4B9V A;  1U48 A;  5F1X A;  1L3U A;  2XHB A;  3CER A;  2VQE K;  3DLG A;  3AAP A;  3SMS A;  1BOT O;  1C0G A;  2P9U A;  3AVL A;  5AQK A;  2UU9 K;  1NGH A;  3OYE A;  2OPP A;  3CJA A;  4H5R A;  4FJN A;  1WN7 A;  3VN5 A;  1NNE A;  2GWJ A;  4CJL A;  3U9Z A;  1LOT B;  4BRP A;  4FZZ A;  4JKH A;  4E7L A;  3LWL A;  4DV3 K;  2D0P A;  4IFY A;  2OZM A;  1U4B A;  1BU6 O;  4B3O A;  3NH2 A;  1SZ2 A;  3OYK A;  4CGF A;  2NRR A;  1NKE A;  1N36 K;  2ITM A;  2ASP A;  4MDA A;  3AVA A;  2E88 A;  1NWK A;  1QHT A;  1ESV A;  2P51 A;  1W9H A;  3BY5 A;  3VEX A;  4DV1 K;  5JVH L;  5BPM A;  2Q0R A;  4JI1 K;  3HBT A;  4KTQ A;  4CHP A;  1HNX K;  4JKD A;  1JXB A;  5EU7 A;  4FK2 A;  1K8K B;  2FSK A;  4OGC A;  2Y1J A;  4Z94 A;  3O3G A;  4DSL A;  1JCF A;  1HR0 K;  2FXU A;  4Z4E A;  1D9D A;  3H6E A;  3L2R A;  4WYB A;  3M8R A;  4BE2 A;  3V9X A;  4E19 A;  3SPY A;  1TK5 A;  1C0F A;  2IOC A;  3LAK A;  5FRM A;  4B1Y B;  2YI1 A;  1RBU A;  4JS5 A;  2YHA A;  3KK3 A;  1KD1 O;  5EX5 A;  1EP4 A;  2D4W A;  4DTO A;  1RDB A;  3WXJ A;  3DI6 A;  4IOX A;  3HO1 A;  3T1Y K;  1JL2 A;  1LWF A;  1RDA A;  4MQ3 A;  3G4S N;  3V1Q A;  3HVR A;  3OYG A;  2O8E B;  1QQN A;  2D0B A;  4ELV A;  4FCY A;  4IDK A;  2FF3 B;  4IJN A;  4A59 A;  3HP6 A;  2GUI A;  1GLE G;  4JKE A;  1EWQ A;  3A5M C;  3KIO A;  3ZET B;  1HMV A;  1KAY A;  2Q0U A;  3CQ8 A;  2G8U A;  4GNI A;  1BL3 A;  1ZXO A;  1ZBH A;  2DTU A;  1BCM A;  2VWK A;  3L2Q A;  1K8K A;  1NK4 A;  3TAP A;  1KLN A;  2NLX A;  3IRX A;  3SMP A;  5HLF A;  1H1V A;  2F9W A;  3WXK A;  4BRG A;  3S9H A;  2NZT A;  4B1V A;  4FJ5 A;  3VF4 A;  2V51 B;  1W0H A;  1SS6 A;  2AP1 A;  1C0M A;  4B1Z A;  1S1V A;  3PIP L;  3BP8 A;  1RDU A;  5DM6 L;  4IOC L;  4FPA A;  3KKS A;  1NM1 A;  3P1G A;  4CEQ A;  5KTQ A;  4KHY A;  2B6A A;  2HND A;  4J8F A;  4DR2 K;  4CVN E;  3SNN A;  1UOC A;  4JK9 A;  4XH5 A;  1UWB A;  5FPM A;  4CZM A;  1TKX A;  1J53 A;  2O8E A;  3RMC A;  4DB3 A;  3NCI A;  3SV4 A;  3TPQ A;  3SQ0 A;  3ZET A;  1RIL A;  4H0Y B;  4DUY K;  5AQY A;  4PKG A;  3MXJ A;  4H4M A;  2Q97 A;  3ZYY X;  1G99 A;  4F2R A;  1GOC A;  2UXD K;  5BPN A;  2KZM A;  3NVK A;  2UXC K;  4CEO A;  5KPT A;  3P31 A;  4CER A;  4JYA K;  3DLE A;  3A8Y A;  3C6T A;  3R1X A;  4JD2 B;  5AQR A;  2ZE2 A;  3KLG A;  3OYF A;  4IBN A;  5DK5 A;  1FXX A;  4H0O A;  1C1C A;  4AHC A;  3AVN A;  4B3R K;  4DFM A;  5BN8 A;  1NOZ A;  4BRL A;  3CD6 N;  5BPL A;  3RSE B;  3BF3 A;  5FRN A;  4HTU A;  2YJE A;  4HUG A;  4OPK A;  3K2P A;  4O0J A;  4OPH A;  1NOY A;  2HBJ A;  5AZJ B;  4B1W B;  4DFK A;  1IKW A;  4E7J A;  4H0X B;  3V6D A;  1LAV A;  3HTV A;  2VQF K;  3Q7B A;  2JWK A;  3KHY A;  4H8K A;  3DJC A;  3LM2 A;  3DOK A;  1RTI A;  5JS1 A;  4EP4 A;  3ZEU B;  3HXM A;  5AJ3 K;  3DXM B;  5C42 A;  1WSF A;  3D0P A;  4RW7 A;  3BF1 A;  1NG9 A;  1OH5 A;  4C8K A;  5J2Q A;  1TL1 A;  3VEY A;  5AQM A;  1NU0 A;  3ZT3 A;  1S3X A;  3AA5 X;  2ZQB A;  1QQC A;  2DPN A;  1VSL A;  1YJ9 N;  3NF6 A;  1DGK N;  2XRI A;  2IVN A;  4IDH A;  2V7Z A;  1QVF M;  1DTQ A;  4H5W A;  1CXQ A;  3CCL N;  1A5X A;  2ASM A;  2IVO A;  4FW2 A;  3RSE A;  4WFB L;  2A42 A;  3C7N B;  4DMN A;  4BRK A;  4CHZ A;  5LY3 A;  3O3F A;  2VGM A;  3FFI A;  5AZJ A;  4KHW A;  4JLH A;  3GE1 A;  3TAG A;  1TK8 A;  1IG9 A;  1KVB A;  4CBX A;  1SUQ A;  5AQZ A;  1HNI A;  5EXW A;  1K9M O;  3SUQ A;  3DXK B;  3I33 A;  2JGU A;  3DXM A;  4KB0 A;  3HL8 A;  4ISF A;  4LY7 A;  5AQG A;  2OZS A;  2P9S B;  3AO4 A;  5AQP A;  4IJA A;  2GX9 A;  1FKO A;  1U6Z A;  1VQK N;  4FJI A;  3DMJ A;  5E41 A;  4FWO A;  1QVG M;  4WQ4 C;  2HMP A;  4GVE A;  4CZI A;  2W41 A;  4IEE A;  3J7Y P;  1KXP A;  4DSF A;  4JV5 K;  5HRR A;  1LV5 A;  1S6P A;  1XI1 A;  1KAX A;  1S72 N;  4XEI A;  3AVC A;  4CF8 A;  1WNS A;  5AQN A;  3MEG A;  3BZC A;  3C7N A;  1NJI O;  4CGI A;  3CC4 N;  3V4I A;  3VQB A;  4DHY A;  4Z0U A;  4X62 K;  3VGK A;  1BHL A;  3C94 A;  2FBY A;  4CCH A;  3PUF A;  4R79 A;  4CJ4 A;  1WBD A;  3VOV A;  4HCC A;  4JRP A;  3SAH A;  4FOE A;  4DTM A;  3G71 N;  3SJJ A;  4I7F A;  4KO0 A;  4DR1 K;  1E4F T;  2Q36 A;  2A40 A;  1Q9X A;  3MDQ A;  2FBV A;  4LH5 A;  4N56 A;  3DXK A;  3RMB A;  4FWP A;  2XO7 A;  2P9S A;  5FDL A;  3CJ9 A;  2RF2 A;  3K0S A;  1HYV A;  3S3M A;  3QFP A;  4V19 S;  2HOE A;  3T7Z A;  4DR4 K;  2E20 A;  3ZSW A;  2PZS A;  3P38 A;  3AVF A;  4CJP A;  5H1S Q;  5C12 A;  3IG1 A;  1JXE A;  3QIO A;  1LAW A;  3J7Z O;  3M5R A;  5KRT A;  2HBM A;  4J2B A;  4H0T B;  4O44 A;  2F7T A;  2ZJP L;  1XQS C;  4WFA L;  2F96 A;  3SUO A;  2UYT A;  3ZT1 A;  5GAE P;  4JKG A;  1T6C A;  5M1N A;  4FLW A;  2NRX A;  1O1W A;  1NGE A;  3TR8 A;  3LM9 A;  3QBX A;  1HQE A;  1S6Q A;  3IKM A;  3NDK A;  2O8C B;  4YOX A;  3OYC A;  2YKM A;  1JLE A;  4NLB A;  1S22 A;  2YHW A;  4CF9 A;  2IIR A;  2BUP A;  3VEW A;  4WQ5 A;  1S9G A;  2QWO A;  4FWQ A;  4I6M B;  4LFB K;  4PUO A;  2PBD A;  4ZTJ A;  4JKA A;  3W3D A;  2QK9 A;  3HPG A;  5AQT A;  1NGF A;  1MWK A;  3QEV A;  2RHK A;  2VYP A;  4KHN A;  1VQN N;  3VQD A;  4A61 A;  2D0O A;  3MCA B;  3SCX A;  1VRU A;  4JI4 K;  4DFJ A;  1RBR A;  5F2R A;  4FWK A;  5FPE A;  2P9K B;  5EVZ A;  4N41 A;  3VA3 A;  1KQS M;  1JLC A;  3NH1 A;  4KV8 A;  2QXF A;  4JKC A;  3M3Z A;  2I7P A;  3IAY A;  3EN9 A;  4B3S K;  1GLJ O;  4DR6 K;  3O4W A;  4MLE A;  5AQH A;  4FK0 A;  4H5V A;  1N8R O;  3BDP A;  1L3T A;  5FPD A;  4CZG A;  2KTQ A;  2HNY A;  1JLF A;  3TI0 A;  1VQ6 N;  4M3T A;  1SL2 A;  1R59 O;  3DAW A;  3L8B A;  1JLG A;  4IG3 A;  2VG6 A;  2WC9 A;  1NLV A;  4IEI A;  4F3O A;  2WUS A;  4NCG A;  4YOV A;  4O8U A;  4MFB A;  1SL1 A;  3AVI A;  4C8M A;  3L2V A;  4E0D A;  4BRO A;  5I42 A;  1B92 A;  1ZBU A;  4CE9 A;  2HMI A;  3AAR A;  1L5U A;  2HHV A;  2P9K A;  3F73 A;  5HRO A;  4FJG A;  4KBO A;  4DU1 A;  1I94 K;  4IXC A;  4CZL A;  4YY3 K;  2P9P B;  4FVM A;  4EIA A;  3N4P A;  1RTH A;  1IJJ A;  1J6Z A;  3CJ7 A;  3T1H K;  4KFB A;  3WNE A;  4O55 A;  1LWE A;  1RBS A;  3CJC A;  1GLB G;  1X9S A;  4B8C A;  1JLA A;  1HYZ A;  3KZB A;  1YUW A;  2FSN A;  3QO9 A;  4JRQ A;  4C1N K;  4Z4C A;  4DV2 K;  5HOO A;  4B9L A;  1CZA N;  2QWP A;  1IBM K;  1U49 A;  2HHX A;  2IAJ A;  4FSV A;  3GG4 A;  3OYD A;  1Q8I A;  2P1J A;  3O1W A;  4FWM A;  1EKE A;  1MA9 B;  4QS8 A;  2A1R A;  3M1F A;  4LH4 A;  2CGJ A;  3OS2 A;  4FJ9 A;  5AQW A;  1IKV A;  2PAV A;  4Q0B A;  3KVG A;  5M1O A;  3WQT A;  3CFO A;  3LPT A;  2O8D A;  1VRT A;  3H45 C;  3H3N O;  4BDZ A;  4KTW A;  2ASO A;  4BRC A;  3QNN A;  1UA1 A;  2P9P A;  3EYZ A;  2UUC K;  4BWM A;  3ULD A;  1F21 A;  2E4L A;  4N5S A;  3LAM A;  3KWI A;  1WUA A;  1VQ4 N;  1XNQ K;  2Q2R A;  3FZM A;  3PSF A;  1N32 K;  2BTF A;  4FWS A;  4E1J A;  1HRH A;  3W0L A;  4JI8 K;  4YFU A;  2QWQ A;  1XHZ A;  1NGD A;  3MN7 A;  5CYQ A;  2BDP A;  2FSJ A;  1JLB A;  4CD3 A;  1BUP A;  5BRH A;  4PL7 A;  1N6Q A;  4CF0 A;  3F9M A;  2PYJ A;  2E6L A;  1SKW A;  1U45 A;  1J5O A;  4JEP A;  5HRP A;  2YNH A;  4FPB A;  1VQ5 N;  3ATU A;  1Q18 A;  3QER A;  1U2V A;  3B6O A;  1T6D A;  1ASU A;  3L4Q A;  4AHT A;  3ID6 A;  3EKS A;  1XWL A;  4DS4 A;  1KAZ A;  3P5J A;  1QSY A;  3FLC O;  5KPZ A;  3HYF A;  4A57 A;  3SAG A;  3NGY A;  4CJT A;  2QWL A;  4DSI A;  4AHR A;  3WQU A;  1G15 A;  3LL3 A;  4FJH A;  4DTX A;  4I2P A;  4K42 A;  1RT5 A;  5KQD A;  3ENH A;  3EL2 A;  4I9Q A;  1X9M A;  3VES A;  3G0Z A;  3LDL A;  2Y1I A;  5CR4 A;  2KFZ A;  1TUU A;  2E6M A;  3TAE A;  5D3G A;  4CGJ A;  4FL9 A;  3TAB A;  3QET A;  3CQY A;  3PX4 A;  3V1O A;  1S1U A;  1X1P A;  3OS0 A;  1YTA A;  3HT3 A;  3QEI A;  4DUZ K;  4A2A A;  3TTD A;  2UXB K;  1N33 K;  1X3M A;  3KLH A;  2X74 A;  2P9L A;  5C24 A;  3HK2 A;  3VEN A;  4EHU A;  3SJH A;  4WE1 A;  4KRE A;  4DTN A;  4H0V B;  1NMN A;  5AFU H;  3HJF A;  3VQP A;  3CF5 L;  3O9U A;  3PO5 A;  3ZCM A;  4J2A A;  2YHB A;  3OY9 A;  4I9L A;  3J81 O;  1VQL N;  5IT9 O;  2VWB A;  3PX0 A;  1RDD A;  1E3M A;  4AF1 A;  4BRM A;  4FK4 A;  4CGH A;  4E3S A; 
#chains in the Genus database with same CATH homology
 3GDQ A;  3O8M A;  3ZEU B;  4WFN L;  3DXM B;  3C65 A;  5AQX A;  5ADX H;  3CCR N;  3E1Y A;  1RFQ A;  1E4G T;  4BR4 A;  2PFU A;  1MWM A;  1HLU A;  3BF1 A;  4PHT X;  4O8K A;  4XH4 A;  3CC2 N;  1NGC A;  3EE9 A;  3U8X A;  3VEY A;  2YCH A;  3L0Q A;  5AQM A;  3WXL A;  1S3X A;  4C1N I;  1YHQ N;  5AR0 A;  3D2E B;  4JHD B;  4ILG B;  2DPN A;  1ZBS A;  4NO7 A;  5GIP A;  2YX6 A;  1YJ9 N;  1BA0 A;  3QDK A;  3VEO A;  5I9E B;  1QHA A;  4WQ4 A;  2QI2 A;  1DGK N;  4JKF A;  2HF4 A;  2QW9 A;  2IVN A;  1GLF O;  4YOW A;  2E2N A;  4IDH A;  2V7Z A;  4CBW A;  1QVF M;  3UKU B;  2A6A A;  4H5W A;  3CCL N;  5CHI A;  2ASM A;  3CQX A;  3F2K A;  2IVO A;  4WFB L;  3RSE A;  2GEL A;  4JAX A;  3CCJ N;  3PIO L;  1Z05 A;  4BGA A;  2A42 A;  3C7N B;  1O13 A;  2E1Z A;  2NNW A;  4BRK A;  4WCE L;  5LY3 A;  4YOY A;  2VGM A;  4ILH A;  4OPA A;  3WEE B;  2D1K A;  4MDB A;  3WT0 A;  5AZJ A;  2OTJ N;  1HKB A;  2E8A A;  4BR9 A;  3FZF A;  2WFB A;  3GE1 A;  3LDN A;  3AAQ A;  5BRE A;  1TYQ A;  1BWF O;  5KPR A;  4CBX A;  3BEX A;  5B8H A;  1X3N A;  3FE1 A;  2J4R A;  4YDU C;  5AQZ A;  1RGI A;  4BC5 A;  3UB5 A;  2NRZ A;  2ZJQ L;  4LC9 B;  3A5O C;  4O5F A;  5EXW A;  2JWL A;  3OBW A;  4BC2 A;  1K9M O;  3DXK B;  3I33 A;  3DXM A;  5ELZ A;  5BRF A;  4ISF A;  5DM7 L;  5AQG A;  2P9L B;  2P9S B;  5AQP A;  4IJA A;  3TTC A;  5GAH P;  2GX9 A;  1U6Z A;  4RWT A;  2KKZ A;  3N4Q A;  2I7N A;  1VQK N;  3P39 A;  4YOU A;  1XC3 A;  2HF3 A;  1Q81 O;  4GV3 A;  3IMX A;  3D2E A;  5GAD P;  3RVC A;  3CME N;  4JHD A;  1V4T A;  2ZF5 O;  4FWO A;  1QVG M;  5AQV A;  3FFK B;  3JS6 A;  4KH6 A;  4DKW A;  1X9J A;  3R8E A;  4WQ4 C;  4A62 A;  2HMP A;  5E26 A;  3I56 N;  1YXQ A;  4GVE A;  4CZI A;  2W41 A;  4IEE A;  1KXP A;  3VMF B;  4BRI A;  4F9O A;  3CMA N;  3UKU A;  3D2F B;  1KAX A;  3TU5 A;  1S72 N;  4XEI A;  3EO3 A;  4I6M A;  3VEV A;  4BRQ A;  5AQN A;  5LJW A;  3U4L A;  4HTL A;  3UE5 A;  4BRF A;  3C7N A;  1NJI O;  3F5T A;  1EQY A;  3CC4 N;  4DHY A;  1BDG A;  2FF6 A;  3VGK A;  3WEE A;  5AQF A;  4A5A A;  2VGN A;  1NMD A;  3UKR B;  3VEZ A;  1K73 O;  3CC7 N;  1QQM A;  2QM1 A;  4NB4 A;  4R79 A;  2H3G X;  3VOV A;  5TKY A;  3JXU A;  1JCE A;  3SAH A;  4K25 A;  4FOE A;  5M1Q A;  4Y0W A;  2QWR A;  4FOI A;  3G71 N;  1E4F T;  2Q36 A;  2A40 A;  4FWN A;  3MDQ A;  3MK6 A;  3ULE A;  1GLL O;  4BG8 A;  3HOT A;  3DXK A;  4L3Q A;  4A5B A;  4IO9 L;  4FWP A;  2P9S A;  3R3L A;  3HSC A;  2NRV A;  2GWK A;  4BQZ A;  3B8A X;  3CJ9 A;  3QFP A;  3VPZ A;  4DQ8 A;  3EE8 A;  4JKB A;  2HOE A;  3T7Z A;  2E20 A;  4H5T A;  4CZH A;  3WXI A;  3P38 A;  4KH4 A;  5H1S Q;  5C12 A;  2ZJR L;  3E9P A;  4EAH D;  1TYQ B;  2CH5 A;  2YJF A;  3D2F A;  3J7Z O;  2AA4 A;  3M5R A;  5GIN A;  1YJW N;  1VQ9 N;  2A3Z A;  2A41 A;  2HBM A;  3FZH A;  1DKG D;  1NGI A;  4BR5 A;  4H0T B;  4CBU A;  2F7T A;  2ZJP L;  3CI5 A;  1Q7Y O;  1BG3 A;  1XQS C;  3C6H A;  4WFA L;  1YIJ N;  2UYT A;  4BVP A;  5GAE P;  1HKC A;  4IZ9 A;  5E84 A;  3UKR A;  4JKG A;  5C10 A;  4BRN A;  1T6C A;  5M1N A;  4MO5 A;  3PLA A;  5AQJ A;  4CZF A;  3ENB A;  3O08 A;  2NRX A;  3CJ1 A;  1NGE A;  1RDW X;  3LM9 A;  3VGM A;  4BR2 A;  2E2Q A;  3QFU A;  3QBX A;  4GV6 A;  2VCP A;  3IKM A;  5EOY A;  1JJ2 M;  4BRA A;  4YOX A;  2CGK A;  3OA9 A;  4NLB A;  1S22 A;  2P9I B;  2HBK A;  2YHW A;  3K9K A;  2IIR A;  2BUP A;  4KH5 A;  3VEW A;  4WQ5 A;  4IFE A;  5AQL A;  1YIT N;  2CGL A;  4BY9 C;  2BH1 A;  2QWO A;  2ZGZ A;  2V52 B;  4FWQ A;  3NVM A;  4I6M B;  5BRD A;  4BQL A;  3I55 N;  2A5X A;  1HX1 A;  4CZE A;  2PBD A;  1HJO A;  2Q31 A;  4JKA A;  5JLF A;  2RE2 A;  3W3D A;  5KQ8 A;  3QML A;  4IOA L;  3MN6 A;  5AQT A;  1NGF A;  1MWK A;  3ZX2 A;  5M1P A;  2NRT A;  3VF2 A;  1ATN A;  4IWV A;  4NLC A;  2NRW A;  2RHK A;  2VYP A;  4ILJ A;  3SK3 A;  1VQN N;  4A61 A;  2D0O A;  4K41 A;  5FPN A;  2ZWH A;  1VAZ A;  4BVO A;  3TSU A;  2EWS A;  3MCA B;  3O6W A;  3O9S A;  3MX5 A;  4BR7 A;  3MN9 A;  1HKG A;  4QS7 A;  1Q86 O;  3ATV A;  3ULE B;  3EKU A;  5F2R A;  4FWK A;  5FPE A;  2P9U B;  4AM6 A;  3KK7 A;  2P9K B;  5AQI A;  5EVZ A;  3TTF A;  3U9D A;  2YHY A;  4YOR A;  1KQS M;  3CCE N;  1YF5 L;  3O9Q A;  4H5N A;  3A5L C;  3AY9 A;  3CPW M;  3MX2 A;  3G6E N;  1Y64 A;  1LCU A;  1ZC6 A;  3I8B A;  3KWG A;  3E9L A;  3BUZ B;  4JKC A;  3HM8 A;  3M3Z A;  2I7P A;  4CD1 A;  5JMV A;  3IUC A;  1NBW A;  3H1V X;  3EN9 A;  1GLJ O;  1M90 O;  3AGR A;  2YHX A;  3CET A;  5GIO A;  2P9I A;  3O5B A;  1ATS A;  3O4W A;  2FLO A;  4MLE A;  3HOS A;  5C2D A;  5AQH A;  1NGB A;  4WQ5 C;  4H5V A;  5GAG P;  1N8R O;  5FPD A;  4CZG A;  1MDU B;  1HUX A;  2IVP A;  1WOQ A;  3MN5 A;  4MLH A;  1YJN N;  1VQ6 N;  2GUP A;  2NRH A;  1R59 O;  3DAW A;  4JK8 A;  1VQ7 N;  3A0I X;  4WF9 L;  4FVU A;  4EFH A;  3O9T A;  1OVY A;  1W97 L;  2WC9 A;  3S41 A;  1ILY A;  3HZ6 A;  4JKG B;  1NLV A;  4IEI A;  1P8Z A;  5F1X A;  2WUS A;  3VER A;  4YOV A;  2HST A;  3CER A;  4O8U A;  2GEM A;  3CCV N;  3AAP A;  2QEX N;  3SMS A;  3J8A A;  3C6A A;  3SAF A;  3K9J A;  1BA1 A;  4FWR A;  1VQP N;  4BRO A;  2GTD A;  2F9T A;  1BOT O;  5HL7 L;  3CCS N;  1C0G A;  2P9U A;  3AAR A;  2P9K A;  4JK7 A;  4H03 B;  5AQK A;  5F0X A;  3CIP A;  1NGH A;  1QQO A;  4DCH A;  4KBO A;  4U7B A;  1VQ8 N;  4IXC A;  4CZL A;  3VF6 A;  3CJA A;  4CI6 A;  2P9P B;  4H5R A;  3H3O B;  4EIA A;  3N4P A;  2GWJ A;  3P4I A;  3U9Z A;  2E2P A;  3CCM N;  1LOT B;  3E9O A;  4BRP A;  4OO1 J;  4JKH A;  1IJJ A;  1GLD G;  3C0B A;  1J6Z A;  3CJ7 A;  2D0P A;  3IDH A;  3O80 A;  3CJC A;  3VTH A;  1BU6 O;  5AZI A;  1SZ2 A;  1GLB G;  1GLC G;  5C0Y A;  1P90 A;  4MO4 A;  2NRR A;  1YAG A;  2OTL N;  5BN9 A;  2ITM A;  4BRH A;  2ASP A;  5AQQ A;  3KZB A;  4MDA A;  1YUW A;  2FSN A;  2E88 A;  3ZX3 A;  1NWK A;  1D4X A;  1ATR A;  1ESV A;  4RTF D;  4C1N K;  5HOO A;  3WXM B;  2QXL A;  3O1B A;  3LDO A;  3VEX A;  4B9Q A;  1CZA N;  1NGG A;  2QWP A;  2Q0R A;  3HRG A;  3HBT A;  3VET A;  5BPM A;  5JVH L;  3Q7C A;  4FSV A;  4BC3 A;  3GG4 A;  4ISG A;  4QS9 A;  4JKD A;  3NMU A;  5AQU A;  3OBY A;  1K8K B;  5EY4 A;  3O1W A;  2FSK A;  4FWM A;  1MA9 B;  1QZ5 A;  4QS8 A;  4Z94 A;  3SBT A;  2QA4 N;  1JCF A;  3M1F A;  2FXU A;  2CGJ A;  1YI2 N;  5AQW A;  2PAV A;  4CZK A;  3H6E A;  3KVG A;  4WYB A;  5M1O A;  3WQT A;  2P9N A;  3LDQ A;  1Z6R A;  3D7E O;  4FWL A;  1C0F A;  3H45 C;  4C23 A;  2ZGY A;  4B1Y B;  2W40 A;  3H3N O;  2YI1 A;  3MMV A;  1XUP O;  4EHT A;  4B1U B;  2ASO A;  4M7Y A;  1VQM N;  3MWT A;  3HI0 A;  3FZL A;  4BRC A;  5EX5 A;  2P9P A;  1KD1 O;  3O9R A;  2D4W A;  3VGL A;  2Q1N A;  4BRD A;  1W2B M;  3WXJ A;  3GOI A;  5M1F A;  4IOX A;  4ISE A;  4JD2 A;  5C2F A;  3KWI A;  1WUA A;  4CZJ A;  1VQ4 N;  4YOT A;  2Q2R A;  3FZM A;  3G4S N;  4UY8 O;  5MLC Q;  3TSQ A;  1QQN A;  4G9Z A;  2BTF A;  4FWS A;  4A59 A;  2FF3 B;  4IJN A;  4E1J A;  3W0L A;  1GLE G;  4JKE A;  4AM7 A;  5TKW A;  3FR0 A;  2QWQ A;  3FZK A;  3A5M C;  4BC4 A;  3ZET B;  1DEJ A;  1JCG A;  1NGD A;  3MN7 A;  1KAY A;  3DWL A;  2Q0U A;  3L4I A;  3MWP A;  2FSJ A;  5JLH A;  5LJV A;  3R9P A;  4GV9 A;  4GNI A;  3A5N C;  3AGK A;  1ZXO A;  3OHR A;  4CD3 A;  1BUP A;  5BRH A;  2WBN A;  4PL7 A;  2CH6 A;  1K8K A;  3F9M A;  3L6Q A;  2NLX A;  3SMP A;  4BG9 A;  1NGA A;  1H1V A;  2F9W A;  4JEP A;  3DLL L;  3CCU N;  3WXK A;  4FPB A;  1VQ5 N;  3IFR A;  4BRG A;  2NZT A;  1HPM A;  1OKJ A;  3ATU A;  1Q18 A;  3VF4 A;  1U2V A;  4B1V A;  2V51 B;  1SQK A;  1T6D A;  1SS6 A;  2AP1 A;  3D6R A;  4B1Z A;  5CE3 A;  1NGJ A;  4PKH A;  1T3V A;  5AZI B;  3L4Q A;  3SBG A;  3BP8 A;  3T69 A;  3ZEU A;  4BR0 A;  1RDU A;  3ID6 A;  5DM6 L;  3PIP L;  1T44 A;  3EKS A;  4IOC L;  1M1K O;  4RCH A;  4FPA A;  1KAZ A;  3M6G A;  5JVG L;  3GL1 A;  1NM1 A;  3EZW A;  5BR9 A;  3FLC O;  5KPZ A;  4HWI A;  4A57 A;  3H46 O;  3E66 A;  4J8F A;  3ID8 A;  3SAG A;  3QBW A;  3FGU A;  1K8A O;  4PL8 A;  4JK9 A;  3OW2 M;  4XH5 A;  2OAN A;  2QWL A;  4A2B A;  2KHO A;  5FPM A;  5AFU A;  3WQU A;  4CZM A;  3LL3 A;  2E2O A;  4K42 A;  5KQD A;  4DB3 A;  3ENH A;  3EL2 A;  1IG8 A;  5JIC A;  3LDP A;  3VES A;  3LDL A;  5CR4 A;  3CPE A;  3ZX0 A;  3TPQ A;  3QB0 A;  3ZET A;  4B1X B;  1QZ6 A;  3CJB A;  2P9N B;  4H0Y B;  1SAZ A;  1TUU A;  3CXC M;  4PKI A;  5AQY A;  4PKG A;  2Q97 A;  3ZYY X;  4CJ7 A;  1G99 A;  4FL9 A;  1Q82 O;  3H1Q A;  5BPN A;  3TSP A;  5C15 A;  3NVK A;  3CQY A;  5KPT A;  4GY2 B;  3P31 A;  4XH1 A;  3A8Y A;  5ADX A;  2E1Y A;  3ENO A;  3R1X A;  4JD2 B;  5AQO A;  5AQR A;  4JN4 A;  3WUH A;  2KLA A;  1DT9 A;  4K43 A;  3CHW A;  2QTD A;  4H0O A;  4A2A A;  3TTD A;  3QIC A;  1X3M A;  5AQS A;  4U67 L;  1GLA G;  1V4S A;  4BGB A;  2P9L A;  2QWN A;  1YVN A;  1TUY A;  5BN8 A;  4BRL A;  3CD6 N;  5BPL A;  3VEN A;  4BRE A;  4IO8 A;  3SJH A;  3RSE B;  4EHU A;  2QWM A;  3BF3 A;  1VQO N;  2YJE A;  4H0V B;  4M63 C;  5AFU H;  5M1K A;  3CF5 L;  3G25 A;  3O9U A;  4OPH A;  3SLC A;  2HBL A;  2HBJ A;  5AZJ B;  4B1W B;  3VTI A;  1EO1 A;  3CCQ N;  3MCP A;  4H0X B;  4H0P A;  4FO0 A;  1VQL N;  2VWB A;  3HTV A;  2V7Y A;  3Q7B A;  2JWK A;  3GBT A;  3R6M A;  1BO5 O;  3KHY A;  4JNE A;  4M7X A;  4AF1 A;  4BRM A;  3DJC A;  1KC8 O;  3LM2 A;  4YDU A;  1U2V B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...