3CF5L

Thiopeptide antibiotic thiostrepton bound to the large ribosomal subunit of deinococcus radiodurans
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
104
structure length
104
Chain Sequence
RRKLRTRRKVRTTTAASGRLRLSVYRSSKHIYAQIIDDSRGQTLAAASSAALKSGNKTDTAAAVGKALAAAAAEKGIKQVVFDRGSYKYHGRVKALADAAREGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 50S RIBOSOMAL PROTEIN L33
publication title Translational Regulation Via L11: Molecular Switches on the Ribosome Turned on and Off by Thiostrepton and Micrococcin.
pubmed doi rcsb
total genus 17
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2008-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00861 Ribosomal_L18p Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.100 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3cf5L01
3G6EN 1YI2N 4WFAL 3CXCM 2ZJQL 5JVHL 1K73O 5DM7L 3J7ZO 5H1SQ 1Q86O 1VQ5N 1M90O 1NJIO 4IO9L 1YJNN 4WCEL 1ILYA 3CF5L 1VQON 2OTJN 1K9MO 2ZJRL 3CCMN 5DM6L 5GAGP 3I55N 3CMAN 3I56N 1W2BM 3OW2M 1Q7YO 2ZJPL 1YIJN 1JJ2M 3G71N 1QVGM 3CCQN 4WF9L 3CCEN 3G4SN 4WFBL 3PIPL 1YJ9N 1Q82O 5HL7L 3DLLL 1K8AO 1YJWN 1Q81O 1KD1O 1S72N 3CC2N 4IOCL 4U67L 2QA4N 5JVGL 4WFNL 3CCVN 3CPWM 5GAEP 1N8RO 1VQ7N 1KC8O 3CMEN 1VQNN 5MLCQ 3CCRN 3CCUN 1VQKN 2QEXN 1M1KO 1VQLN 5GADP 1KQSM 4IOAL 1VQMN 3CD6N 3CCSN 3CC7N 3CC4N 4UY8O 1VQ4N 3CCLN 1VQ6N 3PIOL 1VQPN 3CCJN 1YHQN 1QVFM 2OTLN 1OVYA 5GAHP 1VQ8N 1YITN 1VQ9N
chains in the Genus database with same CATH superfamily
5SZTA 5AQPA 1WOQA 1YI2N 1LWFA 4OKJA 4OPJA 4C1NI 4CI6A 3THVA 4M41A 3LDNA 1LWEA 5H1SQ 3SAFA 5JLHA 1L3UA 2UUAK 4Z4IA 1I94K 3HPGA 4IEIA 1HJOA 1B9DA 2O8EB 1XC3A 1CZ9A 4W5RA 2BTFA 1EETA 3DYAA 4IFEA 3DXMB 3L8BA 4BRLA 3AO5A 2BDPA 3J8AA 2NLXA 5GAGP 4C8MA 1XMOK 1VSMA 4QOZB 3IMXA 1RDWX 3CJ9A 1JJ2M 4IKFA 1QVGM 2UXBK 3CCQN 5AZIA 1WUAA 4BRAA 4X65K 4IWVA 5BN9A 4H4OA 3K57A 1ASWA 1SKSA 4H5VA 4FM1A 3V81A 2E2OA 3ZSYA 4R5PA 1Q81O 2YJEA 5AQWA 3CJ1A 3LAMA 3CQXA 2WONA 5HOOA 2OYQA 2QWQA 4CESA 4YDUA 1S72N 4CF1A 3OYAA 3M8RA 3VERA 5AQUA 1RT2A 2QA4N 4Z4EA 1BI4B 2X6NA 4KTZA 4CEEA 4CF9A 1LAWA 3RRHA 2G8HA 5MLCQ 4DV2K 4KB1A 2WBNA 3O3GA 1QTMA 2QEXN 1VHXA 2KFNA 4HCBA 5JS2A 3E01A 3J81O 3H08A 4BE2A 4F8RA 2J4RA 2YHYA 3EE9A 2UUCK 3B6PA 4CGDA 2IC3A 3M8PA 2B5JA 2O8BB 4HUEA 3HXMA 1BOTO 3EEQA 1NK5A 1KSPA 3NFAA 4ISFA 4YORA 3OY9A 1D9DA 1HR0K 4QS7A 4B1WB 4CZHA 3HOSA 3DLKA 4DQSA 2QTDA 2RF2A 4GY2B 3RVCA 1KXPA 2YNFA 4LF9K 3WXLA 4AM6A 1QSSA 4JD2B 3OA9A 5DMRA 3HSTB 4C23A 2PY5A 5GIPA 4DFMA 3FE1A 4FL9A 2E8AA 2Q31A 2V51B 3ZETB 3M8SA 3F5TA 4KFBA 1RNHA 2G8UA 4XIUA 3CXCM 3QEIA 4DTOA 3J7AP 1LAVA 1K73O 2D0PA 2O8FA 5FPMA 3VQCA 3W0LA 3QEPA 4DTUA 2IOCA 4PKIA 1V4TA 3SJJA 4B1XB 3CJ7A 1DEJA 3WQUA 3LP3A 3SV3A 3OYHA 5LJVA 1JL1A 1JLGA 1JLFA 4FM2A 4LFBK 3V4IA 5AQLA 3KLGA 3DRRA 1UWBA 5KQ8A 3MDQA 4LF8K 5AQIA 4O8UA 3GOIA 4DV4K 3AVHA 3MN9A 4OJRA 3TTFA 2R7YA 1Y97A 1BGXT 1ATRA 4A2AA 4IXCA 2GTDA 4OPHA 3T7ZA 2E5LK 2A41A 4KHUA 4JYAK 2HSTA 3A5NC 4JRQA 4BC5A 5C10A 5JVGL 5J2NA 2Z1HA 2D4WA 3VQ6A 4JKEA 5AZIB 4FZXC 1ATNA 5AQTA 3R8EA 1M1KO 4PQUA 4CEDA 1VQLN 2Y1IA 1KQSM 4FJKA 3P39A 5AFUH 3L6QA 2Z1JA 4CGJA 3E9OA 1SL1A 4XH5A 5E26A 1J53A 3CCSN 4FK2A 1TGOA 4AHVA 4CF8A 3VQ7A 3CCLN 5K14A 4ELUA 2KQ2A 1XNQK 5FLXO 4GKJK 2EHGA 1P90A 3RMBA 3BEXA 4JNEA 4Z4HA 5HRRA 2D0OA 1W97L 4CJSA 4HCCA 3LM9A 4DFJA 2VYPA 3BZCA 2QXFA 3AO4A 2FBTA 2NRZA 3D2FA 3VQ8A 3V1OA 2FC0A 2V7ZA 2FF6A 3PV8A 2BANA 1YT3A 3PO4A 2Q36A 1H1VA 4DB3A 3AARA 4JKFA 4MLHA 1EQYA 2ZGZA 4CECA 3DXKA 3BGRA 2IVOA 1NGDA 4DUYK 4JI5K 1REVA 5JICA 3K59A 4RTFD 3CCMN 2PYLA 3MX2A 4CD1A 4ZHRA 2PAVA 3I55N 4HVJA 3T1YK 4B08A 2KTQA 4K42A 2UU9K 2NRHA 2DFHA 3O80A 1HJRA 1EXQA 2HBMA 4B1VA 3CFOA 2O8FB 4CBUA 2QM1A 1NGFA 3ZEUA 1SL0A 3SBTA 4HHTA 4NCAA 4WFBL 3S9HA 5BPMA 4FO0A 1IKWA 1U47A 1BG3A 1KD1O 1A5WA 3SNNA 3HO1A 4AF1A 3FLCO 1RBRA 5AQYA 4NYNA 1NGBA 2F7TA 1NMNA 5FROA 4CZKA 4JS4A 1QZ6A 4O0IA 5AFUA 4KHPK 3VGKA 1BDGA 1OKJA 3O6WA 4B9QA 4DV0K 4DQQA 4FWKA 4JI3K 1KFDA 4BR2A 3UKUB 1V4SA 3CCRN 1S22A 1MA9B 5HBMA 2VG5A 3ZSZA 2FBXA 1XNRK 3QLHA 3QETA 3PSIA 4JI0K 3MECA 5KRSA 3VEZA 4FPAA 4PL8A 5B8HA 1VK0A 3H46O 1HRHA 2GELA 4DU4A 1ZBSA 3PIOL 4L8RB 3AY9A 2EX3A 3THWB 1GOAA 1BA0A 4B3SK 2D0BA 2PFUA 3WNGA 3OYBA 3LAKA 3R1XA 2XY5A 1NKEA 2G8WA 2HBLA 4JHDB 5D3GA 1U2VA 1HYSA 4CJUA 4ISEA 4EAHD 4M3ZA 4CZEA 4C1NK 5GAHP 4OGEA 3JYTA 5AZJA 4WFAL 1LW2A 1WBDA 2RE2A 4F9OA 1B92A 3MEGA 5IT9O 1ZYQA 1YXQA 4DQPA 2XHBA 2VQEK 1HKCA 4FWMA 4JKDA 4FWNA 2Q2RA 3NBPA 3U8XA 5DM6L 3SUPA 5LMUK 3AO2A 5FPDA 4JI4K 5DK5A 3OW2M 4A2BA 3E9PA 2KZMA 4YOXA 3G71N 3RRGA 4FWOA 1TK0A 3VF6A 1X9WA 1GLJO 1N34K 3FZFA 3NVMA 4C8NA 5CZ2A 1Q18A 4H0OA 1KVAA 2YX6A 4GNIA 1Z05A 1RTIA 5HL7L 5J2QA 4B3OA 2P9UA 3WXKA 3DXKB 1GLAG 4BVOA 4PKHA 4LSLA 1S1UA 5EOYA 1I3AA 5LY3A 4CERA 1NK0A 4CJFA 4G1QA 1N36K 1VQNN 3PLAA 3LDOA 1VQKN 3ZEUB 1XMQK 1WN7A 1XC9A 1ZBLA 3TARA 3OYMA 4BRFA 3DRPA 4JKHA 1NLVA 2YHBA 4ZTJA 1VQMN 4EZ6A 4LF4K 5IWAK 1HX1A 2LSNA 4DS5A 1GLBG 2BUPA 3HPOA 3O5BA 1KTQA 3DLRA 2O4IA 3VEYA 4CJVA 4J2AA 3O1WA 3V6DA 3QO9A 2YNGA 3EZ5A 2HF4A 3SK3A 2P1JA 3F9MA 4FWSA 4E7KA 2FXUA 3AVLA 2O8CB 3TR8A 1YTUA 3QEWA 1JLQA 4CEQA 1NM1A 4NO7A 4B1ZA 5C25A 5KGXA 1U48A 3SBGA 3ID6A 5J2PA 1SV5A 3R3LA 1S5JA 3DRSA 2A1SA 2OPQA 2DPNA 1NJIO 2I7PA 2W41A 4JS5A 2OANA 4KHQA 3GBTA 3OTOK 3U4LA 3D2EB 2G8VA 2HHWA 4UQGA 3I56N 3VQ5A 3PUFA 1Q7YO 1FJGK 2HOEA 3LPTA 1TYQB 3T69A 4HUGA 3AVAA 5KGWA 3MAQA 1C0UA 3RSEA 1NGCA 1Q82O 4YOYA 3MN7A 1TKTA 1CZAN 3DLLL 1G99A 3VN5A 2E88A 3B6OA 3OYLA 4H0YB 4KHSA 3HP6A 4B3TK 1QSLA 4H0VB 1OH8A 3A8YA 4BGAA 4DCHA 4A62A 1SKWA 3O08A 3CMEN 1WAFA 4B1UB 4QAGA 1J5EK 4I6MB 2OZSA 1RDDA 1RGIA 3ID8A 1T8EA 3ZYYX 5C42A 4JKBA 1KCFA 3FGUA 4NB4A 5CHIA 4E7IA 4CEBA 2P5GA 3TAMA 2QWPA 4E1MA 4AH9A 3F73A 4FWRA 3MN5A 3IS9A 1SQKA 2ETJA 3VEOA 4CVNE 4FJLA 3DMJA 2Q97A 4CEFA 4DR1K 1HUXA 3PSFA 4KV8A 4OKEA 1DLOA 1HNVA 3NMUA 4EZ9A 3VQPA 2P9NA 2XY8A 4ILHA 1NGEA 1TL3A 2YHAA 3L2RA 4IJNA 3T3FA 3V9SA 4BRMA 4BRIA 3OJSA 3QNOA 4ELVA 2A3ZA 2DFFA 4JLHA 2NRXA 3WQTA 4E1NA 5FRNA 3EN9A 3KWGA 3L2VA 3VEVA 1TAUA 3KJVA 4CK2A 2Q0RA 3SZ2A 4CEAA 1A5VA 4KRFA 2NNWA 4DR2K 4H0PA 2Z1GA 5KPTA 3VQBA 1JCGA 4RW6A 2HVIA 2VWBA 3ATUA 3UE5A 4DR6K 2V52B 1Z26A 4H5RA 3VQEA 3CG7A 1DTTA 4CZIA 3LP1A 3NF8A 5AQJA 3ZT2A 1NG9A 3P31A 3E66A 4JI1K 1K8AO 5KPZA 2HVHA 4MDAA 1TVRA 3OYGA 1DGKN 3SJHA 4CJRA 1KLNA 1N5YA 3AO1A 4V19S 4N76A 1WSGA 2FSNA 5FPEA 4ZTFA 3CPWM 3K2PA 4W5TA 1T44A 3RSEB 1YVUA 1T05A 4C8OA 3PX4A 4JK7A 1K8KA 3L3VA 2GUPA 3ULEB 1FKPA 4MQ3A 4CJTA 4JI2K 2NUBA 3HM8A 3QDKA 1FW6A 1LCUA 2HHUA 2O8DA 5SWMA 4Z4GA 3VEXA 1LW0A 3MXIA 1VQ4N 3CI5A 4J2DA 2X74A 1EKEA 1P8ZA 1KAZA 4OPAA 1ITGA 2F96A 3OS2A 3BY5A 1T3VA 4OLBA 2D0CA 5GIOA 1ZBHA 4FLUA 1TL1A 4JKGB 5AQNA 3VMFB 4GVEA 3KKSA 1NK6A 1JL2A 5AQQA 2HB5A 1RTHA 2F9TA 2A1RA 1YITN 4FJGA 2IAJA 4EFHA 2P9SA 3MK6A 3HI0A 4YDUC 4BRHA 5C2FA 3NH0A 4BR7A 4KTQA 3CJAA 1GOBA 4N41A 1KLMA 4X66K 4FLYA 1WBBA 3SUQA 1HYZA 2IVPA 4CFAA 1WAJA 2P51A 2P9LB 3FZKA 3C7NB 2P9KB 3HBTA 1UA0A 4DU1A 2P9NB 3SMSA 3SUNA 3I8BA 3S3MA 3ATVA 3QEXA 4KI6A 4I2QA 2F4VK 2W6KA 4CEOA 4BRQA 2YNHA 2VGMA 4BG8A 3TTDA 4PA1A 5AQMA 2HHQA 2ZQBA 3Q7BA 2QWRA 3EYZA 1C0MA 1OH6A 1IKXA 3U6FA 4EP4A 1X9SA 4H4MA 5KRTA 3ZSWA 2X78A 3O9QA 4KH6A 4EP5A 1BQMA 1LWCA 3OYJA 3IKMA 1C0TA 4JAXA 3S3OA 3OBYA 3DLBA 4CGIA 1EX4A 2YNIA 2D5RA 4BDYA 4O55A 4IOCL 4M63C 4LC9B 2NRTA 3IUCA 3R6MA 4DQRA 1VQ7N 4BROA 5HRSA 4J8FA 3T1AA 1YF5L 4CIFA 4LD0A 4ILJA 5AQZA 4Z0UA 1XUPO 3CC4N 3VETA 5F1XA 4CGGA 4DMNA 4DS4A 4DSEA 3J80O 1KVCA 2ZE2A 4FJJA 3MMVA 1RDBA 2WFBA 2HHXA 4CBXA 1FXXA 3AVMA 3L4IA 4WQ4A 4CZFA 4DQ8A 1K8KB 2YJFA 3L4QA 1NKCA 3O4QA 2P5OA 3HK2A 2O8DB 4H0XB 3H45C 5AQSA 1SKRA 1OH7A 4B9UA 1VQ8N 4OLAA 1VSKA 4XEIA 1J6ZA 1C0FA 3G6EN 2VQFK 1U04A 1DT9A 2XRIA 3H3OB 3HJFA 1KVBA 2A5XA 3GL1A 4DTSA 4BR9A 1VSIA 3CQYA 3CERA 3HL8A 1JLCA 3J7ZO 1S9GA 3S3NA 4OO1J 3LANA 1M90O 4DFPA 1QQNA 2QWLA 2F8TA 3VGLA 1RBSA 5LMNK 1U49A 3CF5L 2E2NA 3ENHA 2OTJN 3WXJA 2ASMA 2IS3A 2RKIA 3ZSVA 3THXA 1L5UA 4DR5K 1IBKK 3A5OC 4EHTA 1JCFA 3NGZA 3CPEA 1NJYA 2IIRA 2I7NA 4WF9L 1BISA 2YI1A 3GG4A 2AP1A 2KW4A 4CJLA 1S3XA 3SPZA 2UXDK 3SQ0A 3AA4A 2FBYA 4FLWA 3ZX3A 1RBTA 4IBNA 1RFQA 4FWPA 4MFBA 1WSIA 3LZJA 1GLCG 3ZSXA 4I9LA 3ASMA 4BDPA 4H8KA 5GAEP 4Z94A 5HP1A 4PWDA 3SLCA 4DV5K 4LY7A 4J2EA 1E3MA 4LH5A 4LF5K 4IOAL 3CYMA 4BE0A 5CR4A 1MDUB 3JS6A 4IO8A 5LL6Z 3ZT3A 2D1KA 4O8KA 4CHPA 3DLGA 4LSNA 3VPZA 3LPUA 3P1GA 2E4LA 3HVTA 4FCYA 4FJ5A 1O1WA 2YHWA 4FW1A 3SMPA 4B9SA 4BRCA 1YHQN 3ZLJA 3KK7A 5A2QO 3QIOA 4DSLA 3OYNA 4YFUA 4ILGB 2ATQA 4DSFA 3LWLA 3TTCA 4O5BA 1QQMA 4AM7A 1BA1A 1Z6RA 3ZT0A 3O9SA 3HOTA 1R0AA 4YOWA 3HTVA 3KLFA 4JK8A 1NK9A 3WEEA 2VCPA 1BIUA 4FLXA 2GWKA 4DWIA 4H03B 4BE1A 4DV6K 3LP0A 3AA3A 4FVMA 3C65A 2E6MA 4DTMA 3ISNC 4J2BA 4CJQA 2QKBA 3DOLA 1NOYA 4OVLA 3CMAN 1BHLA 1TKXA 4OPKA 3SPYA 4EIAA 3THYA 3VQAA 4FPBA 4IG3A 4K0KK 1WSJA 4CJ4A 3AA2A 3TWHA 1S1XA 1HPZA 4AHTA 1YJWN 1MU2A 3VTIA 1RBVA 2ZF5O 4CFDA 4HWIA 4I7FA 2JGUA 1Q9YA 1JXBA 1D4XA 2YKNA 3PO5A 1TV6A 2A6AA 3OS1A 2P9PA 3LDQA 1UAXA 4K25A 3OBWA 3A2FA 3D2FB 1WSFA 4YNQA 4M3RA 3V9ZA 5HROA 5I9EB 1HQEA 3L0QA 4QS8A 2Q0UA 4Z4CA 4HTUA 3FZMA 1NWKA 2FSJA 1BQNA 4GV3A 1ZBIA 2DFEA 2E1YA 1A5XA 5AR0A 1QHAA 4RG8A 4DR7K 3LL3A 1VRTA 4DKWA 1RT1A 3DM2A 1HNWK 1F21A 1N33K 3NF6A 4BGBA 3C94A 2F8SA 3KIOA 3M3ZA 1RILA 3NGIA 3V9XA 1JCEA 4CD3A 4GMJB 3KLEA 3VEWA 1TUUA 1U45A 3V1RA 4FJ8A 2UXCK 1HPMA 1ZBUA 2JWLA 3AV9A 4JKCA 1BIZA 3BF3A 1RT7A 1E4GT 3NGYA 2HHTA 3OHRA 4JRPA 4WYBA 1SAZA 4BY9C 4BR5A 4NLBA 4CHQA 3L2WA 3SV4A 1IKYA 1S1TA 2E20A 1ASVA 2VWKA 1RT6A 1UA1A 2RPIA 5GINA 3AVCA 4AHUA 4WCEL 4E7HA 5HLFA 1Z25A 3VENA 4HTLA 4FJ7A 5C12A 3QINA 3A0IX 2BH1A 4JK9A 3BUZB 3TAEA 4JV5K 3KD5E 1JLBA 4N5SA 1X9MA 5C15A 3MWTA 3HM9A 3LDSA 3SCXA 1NU0A 4RW4A 4E0DA 3CCEN 1J54A 4BQZA 4OX9K 3WEEB 4RWTA 1ATSA 1YJ9N 1U2VB 4M3WA 4C8KA 1OH5A 3PX6A 3NE6A 4DV1K 1S6PA 3QIPA 3CJBA 2HF3A 1VAZA 3D0PA 3OS0A 4WFNL 4LFAK 4KREA 3O9UA 5AQHA 3VQQA 1RCHA 4CK1A 5I42A 3E9LA 3S41A 5AZJB 3DLHA 1MWKA 3TU5A 1KAYA 1HNXK 4WQ5A 4FYDA 3FZHA 3VQ9A 1TKZA 4B3RK 2O8EA 3OVNA 3DXMA 2CGLA 3C6UA 1Q9XA 1DTQA 1G15A 4KTWA 3DOKA 3KK2A 2AA4A 3BF1A 5BREA 2PYJA 4DG1A 3AVJA 4FK0A 4K41A 5AQXA 4B1YB 2HNYA 3D45A 4F3OA 3HSCA 3BDPA 3EKUA 4M3UA 5BRFA 3AVIA 1TAQA 3CJCA 5HRNA 2DTUA 4AILC 1NJXA 3RTVA 5KTQA 4H0TB 4F4KA 2QWOA 2GUIA 4DR4K 4CJ7A 2FLOA 2ASPA 1TKDA 2NRVA 2P9UB 4DTPA 3BZKA 1BUPA 4Y1CA 2CGKA 5F2RA 1BI4A 4RW9A 3P83D 3M5RA 3QMLA 1RDCA 4W5OA 3EKSA 4BWJA 2HHHK 4LH4A 3JSMA 4K8ZA 1X3NA 3MCPA 4KH5A 2DY4A 4CJ5A 3SUOA 3V9UA 2UYTA 2E6LA 3QEVA 4DV7K 1R59O 4XH4A 2YCHA 4OKKA 4IO9L 1FK9A 1ILYA 4FM0A 2JWKA 3MXMA 4K8XA 2Q3SA 2E2PA 2O8BA 3IRXA 3AVKA 1SUQA 4KBOA 2GBZA 2P9IA 3QB0A 3I0RA 3SQ2A 1YIJN 4W5QA 1NOZA 4DTXA 1VSJA 4BC3A 1NK8A 4LF6K 5M1OA 4O0JA 1VSDA 3NF9A 2ITMA 4DTNA 4FJXA 3NDKA 2BE2A 3B8AX 1N6QA 4M42A 4CHZA 3ZETA 4PHTX 1SZ2A 5C0YA 3EY1A 1X9JA 4BVPA 2EWSA 2FSKA 1WB9A 4CGFA 2YV0X 2OPSA 4B9TA 2CH6A 1OVQA 2G8IA 4YOTA 2IDOA 3ZT4A 5TKWA 4FJHA 4BG9A 4KH4A 1SS6A 4CZLA 5EU7A 4DF8A 3KVGA 2VG7A 4JI8K 1S1WA 3L3UA 1WNSA 4HUFA 3RMAA 4W5NA 3TABA 3PY8A 4L3QA 4OGCA 3LDLA 4FLVA 1NBWA 5M1QA 2XY7A 4C8LA 1VQPN 1S1VA 5AJ3K 3RWUA 1XI1A 2YHXA 4DTRA 1L3SA 4N56A 4E19A 2OA8A 3VESA 4YY3K 4CE9A 1IH7A 3MWPA 2QKKA 2W6LA 1QZ5A 3LZIA 1QE1A 3R9PA 5JS1A 3HP9A 1KAXA 4R79A 2VG6A 3H3NO 4PL7A 5HRPA 2XY6A 3ENBA 1WLJA 4BC4A 4JEPA 5AQOA 4CZGA 3TSPA 4IG0A 1QSYA 1I39A 5KQDA 3NVKA 1YTAA 4X64K 1IO2A 3U3YA 1YAGA 4DUZK 1HYVA 4MO5A 5LJWA 3OYIA 1Q86O 3QBWA 4H5NA 3H6EA 4MO4A 4BRPA 3IFRA 2RN2A 3MX5A 3KHYA 1VQON 3CM5A 1GOCA 2ZJRL 5AQKA 4FVUA 3TSQA 2ZJPL 3CQ8A 1D9FA 3A5LC 4GW6A 4DTJA 4FSVA 4IDKA 3N4QA 3P4IA 1RBUA 3AGRA 3CM6A 4IEEA 2GX9A 3PIPL 3WNHA 3GE1A 4DHYA 5BPLA 3C0BA 5F0XA 1QQCA 5CYMA 3G0ZA 3JXUA 4M3TA 4DR3K 4CEZA 4MDBA 4A5BA 2HMPA 3CCVN 5KPRA 4LF7K 3SQ4A 2P9IB 2QI2A 3E1YA 3N4PA 3C6HA 3KTQA 4FJMA 4CW7B 3KLHA 1KC8O 4CHOA 3CCUN 5M1KA 4CHNA 4ICLA 4B3MK 3ZSOA 5EVZA 1XQSC 1LV5A 5GADP 1NGGA 2V7YA 5BRDA 4KPYA 3O8MA 5FPNA 3DJCA 4CIGA 4FWLA 3CD6N 4CFBA 4KI4A 4KB0A 4JI7K 1JLAA 3ZSRA 2Z1IA 4FOIA 1TUYA 4CF0A 4CF2A 2W42A 3IAYA 3O3HA 2KKZA 4GVMA 1J9AA 2OPPA 3O9RA 2KHOA 3U3GA 3V9WA 4CJEA 3DLEA 3QFPA 3KK3A 4KKOA 5AQFA 4BREA 4FK4A 4EHUA 2B6AA 2HBJA 1VSLA 1RDAA 3KK1A 3RMDA 1VSHA 2G8KA 2RHKA 3WUHA 3UKUA 2CGJA 2HW3A 3MN6A 4I2PA 1ZXOA 4FWQA 2HHSA 3EO3A 4BR0A 3VF2A 2AJQA 3CFPA 1CLQA 3M1FA 2I5JA 5I3UA 3HVRA 3FFIA 3I0SA 3VTHA 1C1AA 1HKBA 1ZBFA 4DSKA 4ISGA 3SQ1A 4BRNA 3F9KA 5BR9A 3KKRA 1BU6O 1BCOA 3UKRA 4XH1A 1NNEA 1GLEG 3THWA 4E1JA 4Z4FA 1WSHA 3AVFA 4E7JA 3NF7A 4RW8A 4JHDA 3VGMA 1RT4A 4WE1A 3TI0A 3PX0A 4O5FA 5E41A 1IV0A 3DAWA 3K5LA 4WQ4C 4H5TA 1HKGA 4NCBA 3TAFA 3NCIA 3Q7CA 1RT3A 1CXQA 3QFUA 2BGGA 4A57A 3LP2A 4PKGA 1KRPA 1NJZA 3EL2A 2P9SB 1YVNA 2F9WA 3T19A 2XO7A 3M8QA 3LWMA 3DI6A 1N8RO 3VQDA 3TAPA 1NKBA 1XHXA 3EZWA 4BQLA 4PY5A 3TANA 3QESA 1QS4A 3IG1A 5ELZA 4FZYA 3K0SA 1VRUA 3RR8A 5AQGA 1TK8A 1VSEA 4IZ9A 3VOVA 4O44A 4F2SA 5M1NA 4ID1A 2O4GA 4UY8O 3OYEA 1VQ6N 3AVNA 3A5MC 3VA3A 2HHVA 4DSIA 3AO3A 3AAQA 3O1BA 1L3TA 2KFZA 4KHYA 4GV9A 4Q0BA 2WC9A 1W9HA 3SAGA 1X3MA 3AVGA 3AAPA 2WOMA 4DLGA 3FZLA 1U6ZA 4A5AA 4B9LA 1X1PA 4O4GA 2WUSA 3NHGA 1RTDA 1QQOA 1WSEA 1J5OA 4B8AB 1HMVA 2HNDA 1IKVA 4CZMA 1RTJA 2PBDA 3VF4A 5JVHL 4GKKK 3OJUA 2NRRA 4CHYA 1IG9A 3C6TA 4FJNA 3D6RA 3UB5A 3VQ4A 4PUOA 1NGJA 1GLFO 2W40A 1EWRA 4KHNA 1D8YA 1K9MO 2E2QA 3GDQA 1EO1A 2CH5A 2H3GX 3ZX0A 3ZSQA 5KI6A 4NXMK 1UOCA 4K43A 4CGHA 2VGNA 3W3DA 3SAHA 1TK5A 4ELTA 2A40A 4FOEA 4B8CA 3G4SN 4BR4A 5FRMA 2IVNA 3HYFA 4E89A 3WNFA 4B9MA 3C6AA 3KLIA 1XHZA 5BR8K 2O8CA 3I33A 4Y0WA 3TSUA 2Q1NA 4M3XA 1GLDG 2QW9A 3NH2A 4CCHA 4CBWA 1JLEA 3CC2N 4U67L 3UKRB 2Y1JA 2B4JA 3G10A 3P38A 5CE3A 1NGAA 3LALA 3TPQA 4CJKA 4B9VA 2HBKA 3F2KA 1C0GA 1NMDA 5JLFA 1T03A 4NYFA 5CZ1A 3D2EA 1C6VA 3CC7N 4RW7A 2HNZA 1S6QA 2ZWHA 4BC2A 4FZZA 2QWMA 4JKAA 3THXB 1W7AA 1BCMA 1TYQA 1T6CA 2ITGA 3H1QA 5AQVA 1HLUA 3JAMO 1Y64A 3HZ6A 1L3VA 4KAZA 3K58A 3WNEA 1JKHA 3L2QA 2QXLA 1QVFM 2KZZA 3T1HK 3K5MA 2KLAA 1HQUA 4CJWA 1IG8A 3O4WA 4DU3A 2FBVA 1N32K 4M7YA 4DSJA 3WT0A 4X62K 3HPHA 3J7YP 4AHRA 4IFYA 2YKMA 5J1EA 4I6MA 2QWNA 1IBLK 1NK4A 4FJ9A 3SI6A 1CZBA 4G9ZA 3WXMB 1HNZK 5EX5A 3MEEA 3OYKA 4MLEA 3OYFA 3HT3A 1EP4A 1W0HA 3NH1A 4TSXA 1CXUA 2FF3B 4LFCK 3KD1E 4CZJA 3QICA 1EWQA 2ZM6K 2HMIA 4IFVA 2OPRA 4FXDA 4CK3A 4CFCA 1T6DA 3CETA 3K5OA 3M6GA 3VA0A 4KO0A 3ULDA 1ZC6A 1RT5A 3KZBA 3NAEA 3H1VX 4F3TA 1B9FA 3ALYA 5BN8A 4M45A 1NJWA 2UUBK 4FJIA 2G8FA 2QK9A 4BRKA 4IOXA 4AHCA 5BPNA 3DWLA 3AVBA 5TKYA 4DLEA 3I8DA 3O3FA 5M1FA 1C1CA 3FFKB 4E7LA 3K9JA 3K5NA 4F2RA 3MXJA 1JXEA 4M7XA 4JN4A 3IDHA 2A42A 2ZD1A 5JMVA 4IDHA 4Y1DA 5CYQA 3ENOA 4RCHA 3THYB 3MCAB 4Q5VA 1C1BA 3RMCA 2NZTA 3P5JA 3V1QA 4H5WA 1ASUA 3D7EO 2OTLN 1NGIA 4YOVA 4DF4A 3MEDA 1Q8IA 1NK7A 3QNNA 4NXNK 4BWMA 5EXWA 3RR7A 2GWJA 1BO5O 3ZX2A 4QS9A 5M1PA 4GV6A 2GEMA 4BRGA 1NGHA 2P9PB 3KWIA 1HNIA 4CJ3A 2ZJQL 2NRWA 5ADXH 4DV3K 3O4NA 3U9ZA 5DM7L 5J2MA 1K6YA 1E4FT 1KFSA 1VQ5N 4AQYK 3UIQA 1ESVA 3ULEA 2GV9A 4A61A 4NLCA 4CJPA 1YJNN 4WQ5C 4BACA 1T7PA 1GLLO 4FW2A 3OYDA 2E1ZA 3FR0A 3BP8A 3O9TA 1VSFA 4FLTA 3AA5X 1FKOA 1DKGD 3CHWA 4I9QA 1W2BM 2JLEA 4NCGA 1SL2A 4N47A 2X6SA 3K9KA 3QERA 4KHWA 3ZCMA 3C95A 4JKGA 3L2UA 3QBXA 3CFRA 3TAQA 4IJAA 3LM2A 2WTUA 5C24A 1LOTB 3OYCA 5CY4A 5EY4A 4A59A 4DFKA 3TAGA 1IJJA 4FLZA 4E3SA 3AGKA 2IGIA 5E84A 3EE8A 2PZSA 4M3YA 3WXIA 3SYZA 1YUWA 4DQIA 4CIEA 1RDUA 2P9LA 3C7NA 3U9DA 1XWLA 1BL3A 2P9KA 4JD2A 3HRGA 2OCEA 5C2DA 1O13A 3ITHA 5AQRA 4ID5A 4QCLA 4AHSA 2D0AA 5BRHA 5T7BA 3ZT1A 3CCJN 3LDPA 4U7BA 4B9NA 2OZMA 1MWMA 1U4BA 3G25A 5FDLA 4BRDA 4YOUA 5ADXA 1S9EA 1D5AA 1IBMK 3CIPA 2ZGYA 1OVYA 4YHHK 4JI6K 2VWJA 2ASOA 1BWFO 1VQ9N 1QHTA 4BDZA
chains in the Genus database with same CATH topology
5AQPA 1WOQA 3SBGA 1YI2N 3ID6A 3O9SA 2RHKA 4C1NI 3WUHA 3HOTA 3UKUA 2CGJA 4CI6A 3LDNA 3MN6A 1ZXOA 4YOWA 4FWQA 3HTVA 3R3LA 5H1SQ 3SAFA 3EO3A 4JK8A 3VF2A 4BR0A 5JLHA 2DPNA 1NJIO 3WEEA 2I7PA 2VCPA 3M1FA 2GWKA 2W41A 4IEIA 1HJOA 4H03B 3VTHA 1HKBA 1XC3A 2OANA 2BTFA 4IFEA 3DXMB 3GBTA 4ISGA 4BRLA 3C65A 3U4LA 3D2EB 4BRNA 3J8AA 5BR9A 2NLXA 5GAGP 1BU6O 3CMAN 3I56N 3IMXA 3UKRA 4XH1A 1RDWX 1Q7YO 3CJ9A 1JJ2M 2HOEA 1GLEG 1TYQB 3T69A 4EIAA 1QVGM 3CCQN 4FPBA 5AZIA 1WUAA 4BRAA 4E1JA 4IWVA 5BN9A 4JHDA 3RSEA 3VGMA 1NGCA 4H5VA 1Q82O 4YOYA 3MN7A 2E2OA 4O5FA 1CZAN 3DLLL 3DAWA 1YJWN 2YJEA 1Q81O 3VTIA 1G99A 3CJ1A 5AQWA 2ZF5O 4WQ4C 4H5TA 1HKGA 2E88A 3CQXA 5HOOA 4HWIA 2QWQA 3Q7CA 4H0YB 4YDUA 3QFUA 1S72N 1D4XA 4A57A 3VERA 4H0VB 2A6AA 4PKGA 5AQUA 2P9PA 3A8YA 2QA4N 3LDQA 3EL2A 2P9SB 1YVNA 2F9WA 4K25A 4BGAA 4DCHA 3OBWA 4A62A 4B1ZA 1N8RO 3D2FB 3O08A 3EZWA 4BQLA 3CMEN 4B1UB 5MLCQ 5I9EB 2WBNA 2QEXN 5ELZA 4QS8A 3L0QA 4I6MB 2Q0UA 1RGIA 3ID8A 3FZMA 3ZYYX 1NWKA 5AQGA 2FSJA 2J4RA 4GV3A 4JKBA 5CHIA 3FGUA 4NB4A 4IZ9A 2YHYA 3VOVA 3EE9A 2E1YA 5M1NA 5AR0A 1QHAA 4UY8O 2QWPA 3LL3A 4DKWA 1VQ6N 3A5MC 4FWRA 1BOTO 3MN5A 4BGBA 1SQKA 3VEOA 3M3ZA 4ISFA 3AAQA 3O1BA 4YORA 4QS7A 4GV9A 1JCEA 4B1WB 4CD3A 4CZHA 3HOSA 2WC9A 2Q97A 3SAGA 3VEWA 1TUUA 1X3MA 2QTDA 3AAPA 3FZLA 1HUXA 4GY2B 3RVCA 1KXPA 1U6ZA 4A5AA 3WXLA 4AM6A 2WUSA 4JD2B 1HPMA 1QQOA 2JWLA 3OA9A 3NMUA 4JKCA 4C23A 5GIPA 3BF3A 2P9NA 3FE1A 1E4GT 2Q31A 2V51B 2E8AA 3OHRA 4FL9A 4ILHA 3ZETB 4WYBA 1NGEA 3F5TA 4IJNA 1SAZA 4CZMA 4BRMA 2PBDA 3CXCM 4BRIA 4BY9C 3VF4A 4NLBA 4BR5A 5JVHL 1K73O 2D0PA 2NRRA 2A3ZA 5FPMA 3W0LA 2E20A 2NRXA 3WQTA 3D6RA 4PKIA 3EN9A 1V4TA 3KWGA 3UB5A 5GINA 4B1XB 3VEVA 3CJ7A 1NGJA 4WCEL 1DEJA 1GLFO 2W40A 3WQUA 2Q0RA 5LJVA 3VENA 1K9MO 2E2QA 3GDQA 1EO1A 2NNWA 2CH5A 4HTLA 5AQLA 2H3GX 4H0PA 3ZX0A 5C12A 5KPTA 3A0IX 2BH1A 4K43A 4JK9A 3BUZB 5KQ8A 1JCGA 3MDQA 5AQIA 2VGNA 3GOIA 4O8UA 3W3DA 3SAHA 2VWBA 5C15A 2A40A 3ATUA 3MN9A 3TTFA 3MWTA 3UE5A 2V52B 4H5RA 4FOEA 1ATRA 4A2AA 3CCEN 4CZIA 4BQZA 4IXCA 3G4SN 2GTDA 5AQJA 4BR4A 3P31A 2IVNA 3E66A 3WEEB 1ATSA 4OPHA 4RWTA 1U2VB 3C6AA 1YJ9N 3T7ZA 1K8AO 5KPZA 4MDAA 2A41A 3I33A 4Y0WA 3TSUA 2Q1NA 2HSTA 1DGKN 3A5NC 3SJHA 1GLDG 2QW9A 4BC5A 4CBWA 5C10A 3CJBA 3CC2N 2HF3A 1VAZA 4U67L 2FSNA 5FPEA 5JVGL 4WFNL 2D4WA 3UKRB 3O9UA 5AQHA 3CPWM 3E9LA 3S41A 5AZJB 1MWKA 4JKEA 5AZIB 3P38A 3TU5A 5CE3A 1ATNA 1KAYA 1NGAA 1T44A 5AQTA 3TPQA 3R8EA 3RSEB 2HBKA 4WQ5A 1M1KO 4JK7A 3F2KA 3FZHA 1K8KA 2GUPA 1VQLN 1C0GA 1NMDA 3ULEB 1KQSM 5JLFA 3P39A 3HM8A 3DXMA 2CGLA 3L6QA 1LCUA 3QDKA 5AFUH 3E9OA 3D2EA 4XH5A 3VEXA 2AA4A 5E26A 3CCSN 3BF1A 5BREA 3CC7N 1VQ4N 3CCLN 2ZWHA 3CI5A 4BC2A 2QWMA 4JKAA 4K41A 5AQXA 4B1YB 1TYQA 1T6CA 3H1QA 3HSCA 3EKUA 5AQVA 1HLUA 5BRFA 1P8ZA 1KAZA 1Y64A 1P90A 3HZ6A 4OPAA 3CJCA 3BEXA 1T3VA 4JNEA 5GIOA 2D0OA 4H0TB 1W97L 2QWOA 4JKGB 5AQNA 3VMFB 2QXLA 4GVEA 4CJ7A 1QVFM 2FLOA 2ASPA 3LM9A 2NRVA 2P9UB 5AQQA 2KLAA 2VYPA 1BUPA 1IG8A 2F9TA 3O4WA 1YITN 2CGKA 5F2RA 4EFHA 2P9SA 3M5RA 3MK6A 2NRZA 3HI0A 3QMLA 4YDUC 4BRHA 4M7YA 3WT0A 3D2FA 5C2FA 4BR7A 3EKSA 3CJAA 2V7ZA 1X3NA 3MCPA 4KH5A 2FF6A 2UYTA 2Q36A 1H1VA 2QWNA 4I6MA 4DB3A 4G9ZA 3AARA 1R59O 2IVPA 4XH4A 2YCHA 3WXMB 4JKFA 2P9LB 4IO9L 4MLHA 3FZKA 5EX5A 3C7NB 1EQYA 2ZGZA 1ILYA 3DXKA 2IVOA 2JWKA 1NGDA 2P9KB 3HBTA 2E2PA 5JICA 4RTFD 3CCMN 4MLEA 2P9NB 3MX2A 3SMSA 2PAVA 3I8BA 4CD1A 3ATVA 3I55N 4K42A 4KBOA 4BRQA 2NRHA 2P9IA 3QB0A 1YIJN 2FF3B 2VGMA 3O80A 3TTDA 4BG8A 5AQMA 2HBMA 4BC3A 4CZJA 4B1VA 3Q7BA 3QICA 5M1OA 2QWRA 4CBUA 2QM1A 1NGFA 3ZEUA 3SBTA 4WFBL 5BPMA 2ITMA 4FO0A 1BG3A 1KD1O 1T6DA 3CETA 3M6GA 4AF1A 3O9QA 4KH6A 3FLCO 1ZC6A 3IKMA 4JAXA 3B8AX 3KZBA 3H1VX 3OBYA 5AQYA 1NGBA 2F7TA 3ZETA 4CZKA 4PHTX 4IOCL 1SZ2A 4M63C 5C0YA 1QZ6A 5BN8A 5AFUA 3VGKA 1BDGA 1X9JA 1OKJA 2EWSA 2FSKA 3O6WA 4LC9B 4BVPA 2NRTA 4B9QA 3IUCA 3R6MA 4FWKA 1VQ7N 4BROA 4BR2A 4J8FA 3UKUB 1V4SA 3CCRN 1S22A 1MA9B 2CH6A 1YF5L 4BRKA 4YOTA 4IOXA 5BPNA 3DWLA 5TKWA 4BG9A 4KH4A 5TKYA 1SS6A 4CZLA 3KVGA 4ILJA 5AQZA 1XUPO 3FFKB 5M1FA 3K9JA 3VEZA 3CC4N 3VETA 5F1XA 4M7XA 4FPAA 3IDHA 4JN4A 4PL8A 4L3QA 5B8HA 3LDLA 1NBWA 2A42A 3H46O 5JMVA 2GELA 5M1QA 1ZBSA 3PIOL 4IDHA 3AY9A 3MMVA 3ENOA 4RCHA 1VQPN 3MCAB 1BA0A 2WFBA 2YHXA 2PFUA 3R1XA 2NZTA 2HBLA 3VESA 4CBXA 4JHDB 3L4IA 1U2VA 4WQ4A 4CZFA 1K8KB 4DQ8A 2YJFA 3L4QA 4H5WA 3MWPA 4ISEA 4EAHD 1QZ5A 3D7EO 2OTLN 1NGIA 4YOVA 3R9PA 4CZEA 4C1NK 4H0XB 1KAXA 3H45C 5AQSA 4R79A 5GAHP 1VQ8N 5EXWA 3H3NO 2GWJA 1BO5O 3ZX2A 4PL7A 4QS9A 1J6ZA 4XEIA 5M1PA 4GV6A 3ENBA 1C0FA 4BC4A 2GEMA 3G6EN 4BRGA 1NGHA 2P9PB 4JEPA 3KWIA 1DT9A 3H3OB 5AZJA 5AQOA 4CZGA 4WFAL 3TSPA 2RE2A 2A5XA 3GL1A 2NRWA 4BR9A 4F9OA 5KQDA 2ZJQL 3CQYA 5ADXH 3CERA 3U9ZA 5DM7L 3NVKA 1YAGA 3J7ZO 1E4FT 4MO5A 5LJWA 1Q86O 1VQ5N 4OO1J 3QBWA 1M90O 4H5NA 1ESVA 3H6EA 4MO4A 3ULEA 1QQNA 2QWLA 3IFRA 4NLCA 4A61A 4BRPA 1YJNN 3VGLA 1YXQA 4WQ5C 1GLLO 3MX5A 1HKCA 3KHYA 3CF5L 4FWMA 2E2NA 4JKDA 3ENHA 1VQON 4FWNA 2Q2RA 2E1ZA 2OTJN 3FR0A 3WXJA 3BP8A 2ASMA 3O9TA 3U8XA 5DM6L 2ZJRL 1DKGD 3CHWA 5FPDA 5AQKA 1W2BM 3OW2M 4FVUA 3A5OC 3TSQA 4A2BA 2ZJPL 3E9PA 4EHTA 1JCFA 4YOXA 3G71N 3CPEA 4FWOA 3A5LC 3VF6A 2IIRA 3K9KA 1GLJO 2I7NA 3FZFA 3NVMA 4FSVA 4WF9L 3N4QA 1Q18A 2YI1A 3P4IA 3GG4A 4H0OA 2AP1A 4JKGA 3AGRA 1S3XA 2YX6A 4GNIA 4IEEA 1Z05A 2GX9A 3PIPL 3GE1A 4DHYA 3QBXA 5BPLA 5HL7L 2P9UA 3WXKA 3ZX3A 3C0BA 3LM2A 4IJAA 5F0XA 3DXKB 1RFQA 1LOTB 4FWPA 3JXUA 1GLAG 4BVOA 1GLCG 4PKHA 5EY4A 4A59A 4MDBA 4A5BA 5EOYA 2HMPA 3CCVN 5KPRA 2P9IB 5LY3A 1IJJA 2QI2A 3E1YA 3N4PA 5GAEP 4Z94A 3AGKA 3C6HA 3SLCA 1KC8O 5E84A 3EE8A 1VQNN 3WXIA 3CCUN 3LDOA 1VQKN 3PLAA 1YUWA 5M1KA 3ZEUB 1RDUA 2P9LA 5EVZA 1XQSC 5GADP 1NGGA 2V7YA 3C7NA 3U9DA 4BRFA 5BRDA 4IOAL 3O8MA 5FPNA 3DJCA 4JKHA 2P9KA 1NLVA 5CR4A 1MDUB 3JS6A 4FWLA 1VQMN 4JD2A 3HRGA 4IO8A 3CD6N 1HX1A 1GLBG 2BUPA 5C2DA 1O13A 2D1KA 3O5BA 4O8KA 4FOIA 1TUYA 3VPZA 5AQRA 5BRHA 2KKZA 3VEYA 3CCJN 3O9RA 2KHOA 2YHWA 3LDPA 3O1WA 4U7BA 3SMPA 4BRCA 1YHQN 2HF4A 1MWMA 3QFPA 3KK7A 3SK3A 5AQFA 3G25A 4BRDA 4ILGB 3F9MA 4BREA 4YOUA 5ADXA 4FWSA 4EHUA 3TTCA 2FXUA 2HBJA 3CIPA 1QQMA 2ZGYA 1OVYA 4AM7A 1BA1A 1NM1A 1BWFO 2ASOA 4NO7A 1VQ9N 1Z6RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G6E N;  1YI2 N;  4WFA L;  3CXC M;  2ZJQ L;  5JVH L;  1K73 O;  5DM7 L;  3J7Z O;  5H1S Q;  1Q86 O;  1VQ5 N;  1M90 O;  1NJI O;  4IO9 L;  1YJN N;  4WCE L;  1ILY A;  3CF5 L;  1VQO N;  2OTJ N;  1K9M O;  2ZJR L;  3CCM N;  5DM6 L;  5GAG P;  3I55 N;  3CMA N;  3I56 N;  1W2B M;  3OW2 M;  1Q7Y O;  2ZJP L;  1YIJ N;  1JJ2 M;  3G71 N;  1QVG M;  3CCQ N;  4WF9 L;  3CCE N;  3G4S N;  4WFB L;  3PIP L;  1YJ9 N;  1Q82 O;  5HL7 L;  3DLL L;  1K8A O;  1YJW N;  1Q81 O;  1KD1 O;  1S72 N;  3CC2 N;  4IOC L;  4U67 L;  2QA4 N;  5JVG L;  4WFN L;  3CCV N;  3CPW M;  5GAE P;  1N8R O;  1VQ7 N;  1KC8 O;  3CME N;  1VQN N;  5MLC Q;  3CCR N;  3CCU N;  1VQK N;  2QEX N;  1M1K O;  1VQL N;  5GAD P;  1KQS M;  4IOA L;  1VQM N;  3CD6 N;  3CCS N;  3CC7 N;  3CC4 N;  4UY8 O;  1VQ4 N;  3CCL N;  1VQ6 N;  3PIO L;  1VQP N;  3CCJ N;  1YHQ N;  1QVF M;  2OTL N;  1OVY A;  5GAH P;  1VQ8 N;  1YIT N;  1VQ9 N; 
#chains in the Genus database with same CATH topology
 5SZT A;  5AQP A;  1WOQ A;  1YI2 N;  1LWF A;  4OKJ A;  4OPJ A;  4C1N I;  4CI6 A;  3THV A;  4M41 A;  3LDN A;  1LWE A;  5H1S Q;  3SAF A;  5JLH A;  1L3U A;  2UUA K;  4Z4I A;  1I94 K;  3HPG A;  4IEI A;  1HJO A;  1B9D A;  2O8E B;  1XC3 A;  1CZ9 A;  4W5R A;  2BTF A;  1EET A;  3DYA A;  4IFE A;  3DXM B;  3L8B A;  4BRL A;  3AO5 A;  2BDP A;  3J8A A;  2NLX A;  5GAG P;  4C8M A;  1XMO K;  1VSM A;  4QOZ B;  3IMX A;  1RDW X;  3CJ9 A;  1JJ2 M;  4IKF A;  1QVG M;  2UXB K;  3CCQ N;  5AZI A;  1WUA A;  4BRA A;  4X65 K;  4IWV A;  5BN9 A;  4H4O A;  3K57 A;  1ASW A;  1SKS A;  4H5V A;  4FM1 A;  3V81 A;  2E2O A;  3ZSY A;  4R5P A;  1Q81 O;  2YJE A;  5AQW A;  3CJ1 A;  3LAM A;  3CQX A;  2WON A;  5HOO A;  2OYQ A;  2QWQ A;  4CES A;  4YDU A;  1S72 N;  4CF1 A;  3OYA A;  3M8R A;  3VER A;  5AQU A;  1RT2 A;  2QA4 N;  4Z4E A;  1BI4 B;  2X6N A;  4KTZ A;  4CEE A;  4CF9 A;  1LAW A;  3RRH A;  2G8H A;  5MLC Q;  4DV2 K;  4KB1 A;  2WBN A;  3O3G A;  1QTM A;  2QEX N;  1VHX A;  2KFN A;  4HCB A;  5JS2 A;  3E01 A;  3J81 O;  3H08 A;  4BE2 A;  4F8R A;  2J4R A;  2YHY A;  3EE9 A;  2UUC K;  3B6P A;  4CGD A;  2IC3 A;  3M8P A;  2B5J A;  2O8B B;  4HUE A;  3HXM A;  1BOT O;  3EEQ A;  1NK5 A;  1KSP A;  3NFA A;  4ISF A;  4YOR A;  3OY9 A;  1D9D A;  1HR0 K;  4QS7 A;  4B1W B;  4CZH A;  3HOS A;  3DLK A;  4DQS A;  2QTD A;  2RF2 A;  4GY2 B;  3RVC A;  1KXP A;  2YNF A;  4LF9 K;  3WXL A;  4AM6 A;  1QSS A;  4JD2 B;  3OA9 A;  5DMR A;  3HST B;  4C23 A;  2PY5 A;  5GIP A;  4DFM A;  3FE1 A;  4FL9 A;  2E8A A;  2Q31 A;  2V51 B;  3ZET B;  3M8S A;  3F5T A;  4KFB A;  1RNH A;  2G8U A;  4XIU A;  3CXC M;  3QEI A;  4DTO A;  3J7A P;  1LAV A;  1K73 O;  2D0P A;  2O8F A;  5FPM A;  3VQC A;  3W0L A;  3QEP A;  4DTU A;  2IOC A;  4PKI A;  1V4T A;  3SJJ A;  4B1X B;  3CJ7 A;  1DEJ A;  3WQU A;  3LP3 A;  3SV3 A;  3OYH A;  5LJV A;  1JL1 A;  1JLG A;  1JLF A;  4FM2 A;  4LFB K;  3V4I A;  5AQL A;  3KLG A;  3DRR A;  1UWB A;  5KQ8 A;  3MDQ A;  4LF8 K;  5AQI A;  4O8U A;  3GOI A;  4DV4 K;  3AVH A;  3MN9 A;  4OJR A;  3TTF A;  2R7Y A;  1Y97 A;  1BGX T;  1ATR A;  4A2A A;  4IXC A;  2GTD A;  4OPH A;  3T7Z A;  2E5L K;  2A41 A;  4KHU A;  4JYA K;  2HST A;  3A5N C;  4JRQ A;  4BC5 A;  5C10 A;  5JVG L;  5J2N A;  2Z1H A;  2D4W A;  3VQ6 A;  4JKE A;  5AZI B;  4FZX C;  1ATN A;  5AQT A;  3R8E A;  1M1K O;  4PQU A;  4CED A;  1VQL N;  2Y1I A;  1KQS M;  4FJK A;  3P39 A;  5AFU H;  3L6Q A;  2Z1J A;  4CGJ A;  3E9O A;  1SL1 A;  4XH5 A;  5E26 A;  1J53 A;  3CCS N;  4FK2 A;  1TGO A;  4AHV A;  4CF8 A;  3VQ7 A;  3CCL N;  5K14 A;  4ELU A;  2KQ2 A;  1XNQ K;  5FLX O;  4GKJ K;  2EHG A;  1P90 A;  3RMB A;  3BEX A;  4JNE A;  4Z4H A;  5HRR A;  2D0O A;  1W97 L;  4CJS A;  4HCC A;  3LM9 A;  4DFJ A;  2VYP A;  3BZC A;  2QXF A;  3AO4 A;  2FBT A;  2NRZ A;  3D2F A;  3VQ8 A;  3V1O A;  2FC0 A;  2V7Z A;  2FF6 A;  3PV8 A;  2BAN A;  1YT3 A;  3PO4 A;  2Q36 A;  1H1V A;  4DB3 A;  3AAR A;  4JKF A;  4MLH A;  1EQY A;  2ZGZ A;  4CEC A;  3DXK A;  3BGR A;  2IVO A;  1NGD A;  4DUY K;  4JI5 K;  1REV A;  5JIC A;  3K59 A;  4RTF D;  3CCM N;  2PYL A;  3MX2 A;  4CD1 A;  4ZHR A;  2PAV A;  3I55 N;  4HVJ A;  3T1Y K;  4B08 A;  2KTQ A;  4K42 A;  2UU9 K;  2NRH A;  2DFH A;  3O80 A;  1HJR A;  1EXQ A;  2HBM A;  4B1V A;  3CFO A;  2O8F B;  4CBU A;  2QM1 A;  1NGF A;  3ZEU A;  1SL0 A;  3SBT A;  4HHT A;  4NCA A;  4WFB L;  3S9H A;  5BPM A;  4FO0 A;  1IKW A;  1U47 A;  1BG3 A;  1KD1 O;  1A5W A;  3SNN A;  3HO1 A;  4AF1 A;  3FLC O;  1RBR A;  5AQY A;  4NYN A;  1NGB A;  2F7T A;  1NMN A;  5FRO A;  4CZK A;  4JS4 A;  1QZ6 A;  4O0I A;  5AFU A;  4KHP K;  3VGK A;  1BDG A;  1OKJ A;  3O6W A;  4B9Q A;  4DV0 K;  4DQQ A;  4FWK A;  4JI3 K;  1KFD A;  4BR2 A;  3UKU B;  1V4S A;  3CCR N;  1S22 A;  1MA9 B;  5HBM A;  2VG5 A;  3ZSZ A;  2FBX A;  1XNR K;  3QLH A;  3QET A;  3PSI A;  4JI0 K;  3MEC A;  5KRS A;  3VEZ A;  4FPA A;  4PL8 A;  5B8H A;  1VK0 A;  3H46 O;  1HRH A;  2GEL A;  4DU4 A;  1ZBS A;  3PIO L;  4L8R B;  3AY9 A;  2EX3 A;  3THW B;  1GOA A;  1BA0 A;  4B3S K;  2D0B A;  2PFU A;  3WNG A;  3OYB A;  3LAK A;  3R1X A;  2XY5 A;  1NKE A;  2G8W A;  2HBL A;  4JHD B;  5D3G A;  1U2V A;  1HYS A;  4CJU A;  4ISE A;  4EAH D;  4M3Z A;  4CZE A;  4C1N K;  5GAH P;  4OGE A;  3JYT A;  5AZJ A;  4WFA L;  1LW2 A;  1WBD A;  2RE2 A;  4F9O A;  1B92 A;  3MEG A;  5IT9 O;  1ZYQ A;  1YXQ A;  4DQP A;  2XHB A;  2VQE K;  1HKC A;  4FWM A;  4JKD A;  4FWN A;  2Q2R A;  3NBP A;  3U8X A;  5DM6 L;  3SUP A;  5LMU K;  3AO2 A;  5FPD A;  4JI4 K;  5DK5 A;  3OW2 M;  4A2B A;  3E9P A;  2KZM A;  4YOX A;  3G71 N;  3RRG A;  4FWO A;  1TK0 A;  3VF6 A;  1X9W A;  1GLJ O;  1N34 K;  3FZF A;  3NVM A;  4C8N A;  5CZ2 A;  1Q18 A;  4H0O A;  1KVA A;  2YX6 A;  4GNI A;  1Z05 A;  1RTI A;  5HL7 L;  5J2Q A;  4B3O A;  2P9U A;  3WXK A;  3DXK B;  1GLA G;  4BVO A;  4PKH A;  4LSL A;  1S1U A;  5EOY A;  1I3A A;  5LY3 A;  4CER A;  1NK0 A;  4CJF A;  4G1Q A;  1N36 K;  1VQN N;  3PLA A;  3LDO A;  1VQK N;  3ZEU B;  1XMQ K;  1WN7 A;  1XC9 A;  1ZBL A;  3TAR A;  3OYM A;  4BRF A;  3DRP A;  4JKH A;  1NLV A;  2YHB A;  4ZTJ A;  1VQM N;  4EZ6 A;  4LF4 K;  5IWA K;  1HX1 A;  2LSN A;  4DS5 A;  1GLB G;  2BUP A;  3HPO A;  3O5B A;  1KTQ A;  3DLR A;  2O4I A;  3VEY A;  4CJV A;  4J2A A;  3O1W A;  3V6D A;  3QO9 A;  2YNG A;  3EZ5 A;  2HF4 A;  3SK3 A;  2P1J A;  3F9M A;  4FWS A;  4E7K A;  2FXU A;  3AVL A;  2O8C B;  3TR8 A;  1YTU A;  3QEW A;  1JLQ A;  4CEQ A;  1NM1 A;  4NO7 A;  4B1Z A;  5C25 A;  5KGX A;  1U48 A;  3SBG A;  3ID6 A;  5J2P A;  1SV5 A;  3R3L A;  1S5J A;  3DRS A;  2A1S A;  2OPQ A;  2DPN A;  1NJI O;  2I7P A;  2W41 A;  4JS5 A;  2OAN A;  4KHQ A;  3GBT A;  3OTO K;  3U4L A;  3D2E B;  2G8V A;  2HHW A;  4UQG A;  3I56 N;  3VQ5 A;  3PUF A;  1Q7Y O;  1FJG K;  2HOE A;  3LPT A;  1TYQ B;  3T69 A;  4HUG A;  3AVA A;  5KGW A;  3MAQ A;  1C0U A;  3RSE A;  1NGC A;  1Q82 O;  4YOY A;  3MN7 A;  1TKT A;  1CZA N;  3DLL L;  1G99 A;  3VN5 A;  2E88 A;  3B6O A;  3OYL A;  4H0Y B;  4KHS A;  3HP6 A;  4B3T K;  1QSL A;  4H0V B;  1OH8 A;  3A8Y A;  4BGA A;  4DCH A;  4A62 A;  1SKW A;  3O08 A;  3CME N;  1WAF A;  4B1U B;  4QAG A;  1J5E K;  4I6M B;  2OZS A;  1RDD A;  1RGI A;  3ID8 A;  1T8E A;  3ZYY X;  5C42 A;  4JKB A;  1KCF A;  3FGU A;  4NB4 A;  5CHI A;  4E7I A;  4CEB A;  2P5G A;  3TAM A;  2QWP A;  4E1M A;  4AH9 A;  3F73 A;  4FWR A;  3MN5 A;  3IS9 A;  1SQK A;  2ETJ A;  3VEO A;  4CVN E;  4FJL A;  3DMJ A;  2Q97 A;  4CEF A;  4DR1 K;  1HUX A;  3PSF A;  4KV8 A;  4OKE A;  1DLO A;  1HNV A;  3NMU A;  4EZ9 A;  3VQP A;  2P9N A;  2XY8 A;  4ILH A;  1NGE A;  1TL3 A;  2YHA A;  3L2R A;  4IJN A;  3T3F A;  3V9S A;  4BRM A;  4BRI A;  3OJS A;  3QNO A;  4ELV A;  2A3Z A;  2DFF A;  4JLH A;  2NRX A;  3WQT A;  4E1N A;  5FRN A;  3EN9 A;  3KWG A;  3L2V A;  3VEV A;  1TAU A;  3KJV A;  4CK2 A;  2Q0R A;  3SZ2 A;  4CEA A;  1A5V A;  4KRF A;  2NNW A;  4DR2 K;  4H0P A;  2Z1G A;  5KPT A;  3VQB A;  1JCG A;  4RW6 A;  2HVI A;  2VWB A;  3ATU A;  3UE5 A;  4DR6 K;  2V52 B;  1Z26 A;  4H5R A;  3VQE A;  3CG7 A;  1DTT A;  4CZI A;  3LP1 A;  3NF8 A;  5AQJ A;  3ZT2 A;  1NG9 A;  3P31 A;  3E66 A;  4JI1 K;  1K8A O;  5KPZ A;  2HVH A;  4MDA A;  1TVR A;  3OYG A;  1DGK N;  3SJH A;  4CJR A;  1KLN A;  1N5Y A;  3AO1 A;  4V19 S;  4N76 A;  1WSG A;  2FSN A;  5FPE A;  4ZTF A;  3CPW M;  3K2P A;  4W5T A;  1T44 A;  3RSE B;  1YVU A;  1T05 A;  4C8O A;  3PX4 A;  4JK7 A;  1K8K A;  3L3V A;  2GUP A;  3ULE B;  1FKP A;  4MQ3 A;  4CJT A;  4JI2 K;  2NUB A;  3HM8 A;  3QDK A;  1FW6 A;  1LCU A;  2HHU A;  2O8D A;  5SWM A;  4Z4G A;  3VEX A;  1LW0 A;  3MXI A;  1VQ4 N;  3CI5 A;  4J2D A;  2X74 A;  1EKE A;  1P8Z A;  1KAZ A;  4OPA A;  1ITG A;  2F96 A;  3OS2 A;  3BY5 A;  1T3V A;  4OLB A;  2D0C A;  5GIO A;  1ZBH A;  4FLU A;  1TL1 A;  4JKG B;  5AQN A;  3VMF B;  4GVE A;  3KKS A;  1NK6 A;  1JL2 A;  5AQQ A;  2HB5 A;  1RTH A;  2F9T A;  2A1R A;  1YIT N;  4FJG A;  2IAJ A;  4EFH A;  2P9S A;  3MK6 A;  3HI0 A;  4YDU C;  4BRH A;  5C2F A;  3NH0 A;  4BR7 A;  4KTQ A;  3CJA A;  1GOB A;  4N41 A;  1KLM A;  4X66 K;  4FLY A;  1WBB A;  3SUQ A;  1HYZ A;  2IVP A;  4CFA A;  1WAJ A;  2P51 A;  2P9L B;  3FZK A;  3C7N B;  2P9K B;  3HBT A;  1UA0 A;  4DU1 A;  2P9N B;  3SMS A;  3SUN A;  3I8B A;  3S3M A;  3ATV A;  3QEX A;  4KI6 A;  4I2Q A;  2F4V K;  2W6K A;  4CEO A;  4BRQ A;  2YNH A;  2VGM A;  4BG8 A;  3TTD A;  4PA1 A;  5AQM A;  2HHQ A;  2ZQB A;  3Q7B A;  2QWR A;  3EYZ A;  1C0M A;  1OH6 A;  1IKX A;  3U6F A;  4EP4 A;  1X9S A;  4H4M A;  5KRT A;  3ZSW A;  2X78 A;  3O9Q A;  4KH6 A;  4EP5 A;  1BQM A;  1LWC A;  3OYJ A;  3IKM A;  1C0T A;  4JAX A;  3S3O A;  3OBY A;  3DLB A;  4CGI A;  1EX4 A;  2YNI A;  2D5R A;  4BDY A;  4O55 A;  4IOC L;  4M63 C;  4LC9 B;  2NRT A;  3IUC A;  3R6M A;  4DQR A;  1VQ7 N;  4BRO A;  5HRS A;  4J8F A;  3T1A A;  1YF5 L;  4CIF A;  4LD0 A;  4ILJ A;  5AQZ A;  4Z0U A;  1XUP O;  3CC4 N;  3VET A;  5F1X A;  4CGG A;  4DMN A;  4DS4 A;  4DSE A;  3J80 O;  1KVC A;  2ZE2 A;  4FJJ A;  3MMV A;  1RDB A;  2WFB A;  2HHX A;  4CBX A;  1FXX A;  3AVM A;  3L4I A;  4WQ4 A;  4CZF A;  4DQ8 A;  1K8K B;  2YJF A;  3L4Q A;  1NKC A;  3O4Q A;  2P5O A;  3HK2 A;  2O8D B;  4H0X B;  3H45 C;  5AQS A;  1SKR A;  1OH7 A;  4B9U A;  1VQ8 N;  4OLA A;  1VSK A;  4XEI A;  1J6Z A;  1C0F A;  3G6E N;  2VQF K;  1U04 A;  1DT9 A;  2XRI A;  3H3O B;  3HJF A;  1KVB A;  2A5X A;  3GL1 A;  4DTS A;  4BR9 A;  1VSI A;  3CQY A;  3CER A;  3HL8 A;  1JLC A;  3J7Z O;  1S9G A;  3S3N A;  4OO1 J;  3LAN A;  1M90 O;  4DFP A;  1QQN A;  2QWL A;  2F8T A;  3VGL A;  1RBS A;  5LMN K;  1U49 A;  3CF5 L;  2E2N A;  3ENH A;  2OTJ N;  3WXJ A;  2ASM A;  2IS3 A;  2RKI A;  3ZSV A;  3THX A;  1L5U A;  4DR5 K;  1IBK K;  3A5O C;  4EHT A;  1JCF A;  3NGZ A;  3CPE A;  1NJY A;  2IIR A;  2I7N A;  4WF9 L;  1BIS A;  2YI1 A;  3GG4 A;  2AP1 A;  2KW4 A;  4CJL A;  1S3X A;  3SPZ A;  2UXD K;  3SQ0 A;  3AA4 A;  2FBY A;  4FLW A;  3ZX3 A;  1RBT A;  4IBN A;  1RFQ A;  4FWP A;  4MFB A;  1WSI A;  3LZJ A;  1GLC G;  3ZSX A;  4I9L A;  3ASM A;  4BDP A;  4H8K A;  5GAE P;  4Z94 A;  5HP1 A;  4PWD A;  3SLC A;  4DV5 K;  4LY7 A;  4J2E A;  1E3M A;  4LH5 A;  4LF5 K;  4IOA L;  3CYM A;  4BE0 A;  5CR4 A;  1MDU B;  3JS6 A;  4IO8 A;  5LL6 Z;  3ZT3 A;  2D1K A;  4O8K A;  4CHP A;  3DLG A;  4LSN A;  3VPZ A;  3LPU A;  3P1G A;  2E4L A;  3HVT A;  4FCY A;  4FJ5 A;  1O1W A;  2YHW A;  4FW1 A;  3SMP A;  4B9S A;  4BRC A;  1YHQ N;  3ZLJ A;  3KK7 A;  5A2Q O;  3QIO A;  4DSL A;  3OYN A;  4YFU A;  4ILG B;  2ATQ A;  4DSF A;  3LWL A;  3TTC A;  4O5B A;  1QQM A;  4AM7 A;  1BA1 A;  1Z6R A;  3ZT0 A;  3O9S A;  3HOT A;  1R0A A;  4YOW A;  3HTV A;  3KLF A;  4JK8 A;  1NK9 A;  3WEE A;  2VCP A;  1BIU A;  4FLX A;  2GWK A;  4DWI A;  4H03 B;  4BE1 A;  4DV6 K;  3LP0 A;  3AA3 A;  4FVM A;  3C65 A;  2E6M A;  4DTM A;  3ISN C;  4J2B A;  4CJQ A;  2QKB A;  3DOL A;  1NOY A;  4OVL A;  3CMA N;  1BHL A;  1TKX A;  4OPK A;  3SPY A;  4EIA A;  3THY A;  3VQA A;  4FPB A;  4IG3 A;  4K0K K;  1WSJ A;  4CJ4 A;  3AA2 A;  3TWH A;  1S1X A;  1HPZ A;  4AHT A;  1YJW N;  1MU2 A;  3VTI A;  1RBV A;  2ZF5 O;  4CFD A;  4HWI A;  4I7F A;  2JGU A;  1Q9Y A;  1JXB A;  1D4X A;  2YKN A;  3PO5 A;  1TV6 A;  2A6A A;  3OS1 A;  2P9P A;  3LDQ A;  1UAX A;  4K25 A;  3OBW A;  3A2F A;  3D2F B;  1WSF A;  4YNQ A;  4M3R A;  3V9Z A;  5HRO A;  5I9E B;  1HQE A;  3L0Q A;  4QS8 A;  2Q0U A;  4Z4C A;  4HTU A;  3FZM A;  1NWK A;  2FSJ A;  1BQN A;  4GV3 A;  1ZBI A;  2DFE A;  2E1Y A;  1A5X A;  5AR0 A;  1QHA A;  4RG8 A;  4DR7 K;  3LL3 A;  1VRT A;  4DKW A;  1RT1 A;  3DM2 A;  1HNW K;  1F21 A;  1N33 K;  3NF6 A;  4BGB A;  3C94 A;  2F8S A;  3KIO A;  3M3Z A;  1RIL A;  3NGI A;  3V9X A;  1JCE A;  4CD3 A;  4GMJ B;  3KLE A;  3VEW A;  1TUU A;  1U45 A;  3V1R A;  4FJ8 A;  2UXC K;  1HPM A;  1ZBU A;  2JWL A;  3AV9 A;  4JKC A;  1BIZ A;  3BF3 A;  1RT7 A;  1E4G T;  3NGY A;  2HHT A;  3OHR A;  4JRP A;  4WYB A;  1SAZ A;  4BY9 C;  4BR5 A;  4NLB A;  4CHQ A;  3L2W A;  3SV4 A;  1IKY A;  1S1T A;  2E20 A;  1ASV A;  2VWK A;  1RT6 A;  1UA1 A;  2RPI A;  5GIN A;  3AVC A;  4AHU A;  4WCE L;  4E7H A;  5HLF A;  1Z25 A;  3VEN A;  4HTL A;  4FJ7 A;  5C12 A;  3QIN A;  3A0I X;  2BH1 A;  4JK9 A;  3BUZ B;  3TAE A;  4JV5 K;  3KD5 E;  1JLB A;  4N5S A;  1X9M A;  5C15 A;  3MWT A;  3HM9 A;  3LDS A;  3SCX A;  1NU0 A;  4RW4 A;  4E0D A;  3CCE N;  1J54 A;  4BQZ A;  4OX9 K;  3WEE B;  4RWT A;  1ATS A;  1YJ9 N;  1U2V B;  4M3W A;  4C8K A;  1OH5 A;  3PX6 A;  3NE6 A;  4DV1 K;  1S6P A;  3QIP A;  3CJB A;  2HF3 A;  1VAZ A;  3D0P A;  3OS0 A;  4WFN L;  4LFA K;  4KRE A;  3O9U A;  5AQH A;  3VQQ A;  1RCH A;  4CK1 A;  5I42 A;  3E9L A;  3S41 A;  5AZJ B;  3DLH A;  1MWK A;  3TU5 A;  1KAY A;  1HNX K;  4WQ5 A;  4FYD A;  3FZH A;  3VQ9 A;  1TKZ A;  4B3R K;  2O8E A;  3OVN A;  3DXM A;  2CGL A;  3C6U A;  1Q9X A;  1DTQ A;  1G15 A;  4KTW A;  3DOK A;  3KK2 A;  2AA4 A;  3BF1 A;  5BRE A;  2PYJ A;  4DG1 A;  3AVJ A;  4FK0 A;  4K41 A;  5AQX A;  4B1Y B;  2HNY A;  3D45 A;  4F3O A;  3HSC A;  3BDP A;  3EKU A;  4M3U A;  5BRF A;  3AVI A;  1TAQ A;  3CJC A;  5HRN A;  2DTU A;  4AIL C;  1NJX A;  3RTV A;  5KTQ A;  4H0T B;  4F4K A;  2QWO A;  2GUI A;  4DR4 K;  4CJ7 A;  2FLO A;  2ASP A;  1TKD A;  2NRV A;  2P9U B;  4DTP A;  3BZK A;  1BUP A;  4Y1C A;  2CGK A;  5F2R A;  1BI4 A;  4RW9 A;  3P83 D;  3M5R A;  3QML A;  1RDC A;  4W5O A;  3EKS A;  4BWJ A;  2HHH K;  4LH4 A;  3JSM A;  4K8Z A;  1X3N A;  3MCP A;  4KH5 A;  2DY4 A;  4CJ5 A;  3SUO A;  3V9U A;  2UYT A;  2E6L A;  3QEV A;  4DV7 K;  1R59 O;  4XH4 A;  2YCH A;  4OKK A;  4IO9 L;  1FK9 A;  1ILY A;  4FM0 A;  2JWK A;  3MXM A;  4K8X A;  2Q3S A;  2E2P A;  2O8B A;  3IRX A;  3AVK A;  1SUQ A;  4KBO A;  2GBZ A;  2P9I A;  3QB0 A;  3I0R A;  3SQ2 A;  1YIJ N;  4W5Q A;  1NOZ A;  4DTX A;  1VSJ A;  4BC3 A;  1NK8 A;  4LF6 K;  5M1O A;  4O0J A;  1VSD A;  3NF9 A;  2ITM A;  4DTN A;  4FJX A;  3NDK A;  2BE2 A;  3B8A X;  1N6Q A;  4M42 A;  4CHZ A;  3ZET A;  4PHT X;  1SZ2 A;  5C0Y A;  3EY1 A;  1X9J A;  4BVP A;  2EWS A;  2FSK A;  1WB9 A;  4CGF A;  2YV0 X;  2OPS A;  4B9T A;  2CH6 A;  1OVQ A;  2G8I A;  4YOT A;  2IDO A;  3ZT4 A;  5TKW A;  4FJH A;  4BG9 A;  4KH4 A;  1SS6 A;  4CZL A;  5EU7 A;  4DF8 A;  3KVG A;  2VG7 A;  4JI8 K;  1S1W A;  3L3U A;  1WNS A;  4HUF A;  3RMA A;  4W5N A;  3TAB A;  3PY8 A;  4L3Q A;  4OGC A;  3LDL A;  4FLV A;  1NBW A;  5M1Q A;  2XY7 A;  4C8L A;  1VQP N;  1S1V A;  5AJ3 K;  3RWU A;  1XI1 A;  2YHX A;  4DTR A;  1L3S A;  4N56 A;  4E19 A;  2OA8 A;  3VES A;  4YY3 K;  4CE9 A;  1IH7 A;  3MWP A;  2QKK A;  2W6L A;  1QZ5 A;  3LZI A;  1QE1 A;  3R9P A;  5JS1 A;  3HP9 A;  1KAX A;  4R79 A;  2VG6 A;  3H3N O;  4PL7 A;  5HRP A;  2XY6 A;  3ENB A;  1WLJ A;  4BC4 A;  4JEP A;  5AQO A;  4CZG A;  3TSP A;  4IG0 A;  1QSY A;  1I39 A;  5KQD A;  3NVK A;  1YTA A;  4X64 K;  1IO2 A;  3U3Y A;  1YAG A;  4DUZ K;  1HYV A;  4MO5 A;  5LJW A;  3OYI A;  1Q86 O;  3QBW A;  4H5N A;  3H6E A;  4MO4 A;  4BRP A;  3IFR A;  2RN2 A;  3MX5 A;  3KHY A;  1VQO N;  3CM5 A;  1GOC A;  2ZJR L;  5AQK A;  4FVU A;  3TSQ A;  2ZJP L;  3CQ8 A;  1D9F A;  3A5L C;  4GW6 A;  4DTJ A;  4FSV A;  4IDK A;  3N4Q A;  3P4I A;  1RBU A;  3AGR A;  3CM6 A;  4IEE A;  2GX9 A;  3PIP L;  3WNH A;  3GE1 A;  4DHY A;  5BPL A;  3C0B A;  5F0X A;  1QQC A;  5CYM A;  3G0Z A;  3JXU A;  4M3T A;  4DR3 K;  4CEZ A;  4MDB A;  4A5B A;  2HMP A;  3CCV N;  5KPR A;  4LF7 K;  3SQ4 A;  2P9I B;  2QI2 A;  3E1Y A;  3N4P A;  3C6H A;  3KTQ A;  4FJM A;  4CW7 B;  3KLH A;  1KC8 O;  4CHO A;  3CCU N;  5M1K A;  4CHN A;  4ICL A;  4B3M K;  3ZSO A;  5EVZ A;  1XQS C;  1LV5 A;  5GAD P;  1NGG A;  2V7Y A;  5BRD A;  4KPY A;  3O8M A;  5FPN A;  3DJC A;  4CIG A;  4FWL A;  3CD6 N;  4CFB A;  4KI4 A;  4KB0 A;  4JI7 K;  1JLA A;  3ZSR A;  2Z1I A;  4FOI A;  1TUY A;  4CF0 A;  4CF2 A;  2W42 A;  3IAY A;  3O3H A;  2KKZ A;  4GVM A;  1J9A A;  2OPP A;  3O9R A;  2KHO A;  3U3G A;  3V9W A;  4CJE A;  3DLE A;  3QFP A;  3KK3 A;  4KKO A;  5AQF A;  4BRE A;  4FK4 A;  4EHU A;  2B6A A;  2HBJ A;  1VSL A;  1RDA A;  3KK1 A;  3RMD A;  1VSH A;  2G8K A;  2RHK A;  3WUH A;  3UKU A;  2CGJ A;  2HW3 A;  3MN6 A;  4I2P A;  1ZXO A;  4FWQ A;  2HHS A;  3EO3 A;  4BR0 A;  3VF2 A;  2AJQ A;  3CFP A;  1CLQ A;  3M1F A;  2I5J A;  5I3U A;  3HVR A;  3FFI A;  3I0S A;  3VTH A;  1C1A A;  1HKB A;  1ZBF A;  4DSK A;  4ISG A;  3SQ1 A;  4BRN A;  3F9K A;  5BR9 A;  3KKR A;  1BU6 O;  1BCO A;  3UKR A;  4XH1 A;  1NNE A;  1GLE G;  3THW A;  4E1J A;  4Z4F A;  1WSH A;  3AVF A;  4E7J A;  3NF7 A;  4RW8 A;  4JHD A;  3VGM A;  1RT4 A;  4WE1 A;  3TI0 A;  3PX0 A;  4O5F A;  5E41 A;  1IV0 A;  3DAW A;  3K5L A;  4WQ4 C;  4H5T A;  1HKG A;  4NCB A;  3TAF A;  3NCI A;  3Q7C A;  1RT3 A;  1CXQ A;  3QFU A;  2BGG A;  4A57 A;  3LP2 A;  4PKG A;  1KRP A;  1NJZ A;  3EL2 A;  2P9S B;  1YVN A;  2F9W A;  3T19 A;  2XO7 A;  3M8Q A;  3LWM A;  3DI6 A;  1N8R O;  3VQD A;  3TAP A;  1NKB A;  1XHX A;  3EZW A;  4BQL A;  4PY5 A;  3TAN A;  3QES A;  1QS4 A;  3IG1 A;  5ELZ A;  4FZY A;  3K0S A;  1VRU A;  3RR8 A;  5AQG A;  1TK8 A;  1VSE A;  4IZ9 A;  3VOV A;  4O44 A;  4F2S A;  5M1N A;  4ID1 A;  2O4G A;  4UY8 O;  3OYE A;  1VQ6 N;  3AVN A;  3A5M C;  3VA3 A;  2HHV A;  4DSI A;  3AO3 A;  3AAQ A;  3O1B A;  1L3T A;  2KFZ A;  4KHY A;  4GV9 A;  4Q0B A;  2WC9 A;  1W9H A;  3SAG A;  1X3M A;  3AVG A;  3AAP A;  2WOM A;  4DLG A;  3FZL A;  1U6Z A;  4A5A A;  4B9L A;  1X1P A;  4O4G A;  2WUS A;  3NHG A;  1RTD A;  1QQO A;  1WSE A;  1J5O A;  4B8A B;  1HMV A;  2HND A;  1IKV A;  4CZM A;  1RTJ A;  2PBD A;  3VF4 A;  5JVH L;  4GKK K;  3OJU A;  2NRR A;  4CHY A;  1IG9 A;  3C6T A;  4FJN A;  3D6R A;  3UB5 A;  3VQ4 A;  4PUO A;  1NGJ A;  1GLF O;  2W40 A;  1EWR A;  4KHN A;  1D8Y A;  1K9M O;  2E2Q A;  3GDQ A;  1EO1 A;  2CH5 A;  2H3G X;  3ZX0 A;  3ZSQ A;  5KI6 A;  4NXM K;  1UOC A;  4K43 A;  4CGH A;  2VGN A;  3W3D A;  3SAH A;  1TK5 A;  4ELT A;  2A40 A;  4FOE A;  4B8C A;  3G4S N;  4BR4 A;  5FRM A;  2IVN A;  3HYF A;  4E89 A;  3WNF A;  4B9M A;  3C6A A;  3KLI A;  1XHZ A;  5BR8 K;  2O8C A;  3I33 A;  4Y0W A;  3TSU A;  2Q1N A;  4M3X A;  1GLD G;  2QW9 A;  3NH2 A;  4CCH A;  4CBW A;  1JLE A;  3CC2 N;  4U67 L;  3UKR B;  2Y1J A;  2B4J A;  3G10 A;  3P38 A;  5CE3 A;  1NGA A;  3LAL A;  3TPQ A;  4CJK A;  4B9V A;  2HBK A;  3F2K A;  1C0G A;  1NMD A;  5JLF A;  1T03 A;  4NYF A;  5CZ1 A;  3D2E A;  1C6V A;  3CC7 N;  4RW7 A;  2HNZ A;  1S6Q A;  2ZWH A;  4BC2 A;  4FZZ A;  2QWM A;  4JKA A;  3THX B;  1W7A A;  1BCM A;  1TYQ A;  1T6C A;  2ITG A;  3H1Q A;  5AQV A;  1HLU A;  3JAM O;  1Y64 A;  3HZ6 A;  1L3V A;  4KAZ A;  3K58 A;  3WNE A;  1JKH A;  3L2Q A;  2QXL A;  1QVF M;  2KZZ A;  3T1H K;  3K5M A;  2KLA A;  1HQU A;  4CJW A;  1IG8 A;  3O4W A;  4DU3 A;  2FBV A;  1N32 K;  4M7Y A;  4DSJ A;  3WT0 A;  4X62 K;  3HPH A;  3J7Y P;  4AHR A;  4IFY A;  2YKM A;  5J1E A;  4I6M A;  2QWN A;  1IBL K;  1NK4 A;  4FJ9 A;  3SI6 A;  1CZB A;  4G9Z A;  3WXM B;  1HNZ K;  5EX5 A;  3MEE A;  3OYK A;  4MLE A;  3OYF A;  3HT3 A;  1EP4 A;  1W0H A;  3NH1 A;  4TSX A;  1CXU A;  2FF3 B;  4LFC K;  3KD1 E;  4CZJ A;  3QIC A;  1EWQ A;  2ZM6 K;  2HMI A;  4IFV A;  2OPR A;  4FXD A;  4CK3 A;  4CFC A;  1T6D A;  3CET A;  3K5O A;  3M6G A;  3VA0 A;  4KO0 A;  3ULD A;  1ZC6 A;  1RT5 A;  3KZB A;  3NAE A;  3H1V X;  4F3T A;  1B9F A;  3ALY A;  5BN8 A;  4M45 A;  1NJW A;  2UUB K;  4FJI A;  2G8F A;  2QK9 A;  4BRK A;  4IOX A;  4AHC A;  5BPN A;  3DWL A;  3AVB A;  5TKY A;  4DLE A;  3I8D A;  3O3F A;  5M1F A;  1C1C A;  3FFK B;  4E7L A;  3K9J A;  3K5N A;  4F2R A;  3MXJ A;  1JXE A;  4M7X A;  4JN4 A;  3IDH A;  2A42 A;  2ZD1 A;  5JMV A;  4IDH A;  4Y1D A;  5CYQ A;  3ENO A;  4RCH A;  3THY B;  3MCA B;  4Q5V A;  1C1B A;  3RMC A;  2NZT A;  3P5J A;  3V1Q A;  4H5W A;  1ASU A;  3D7E O;  2OTL N;  1NGI A;  4YOV A;  4DF4 A;  3MED A;  1Q8I A;  1NK7 A;  3QNN A;  4NXN K;  4BWM A;  5EXW A;  3RR7 A;  2GWJ A;  1BO5 O;  3ZX2 A;  4QS9 A;  5M1P A;  4GV6 A;  2GEM A;  4BRG A;  1NGH A;  2P9P B;  3KWI A;  1HNI A;  4CJ3 A;  2ZJQ L;  2NRW A;  5ADX H;  4DV3 K;  3O4N A;  3U9Z A;  5DM7 L;  5J2M A;  1K6Y A;  1E4F T;  1KFS A;  1VQ5 N;  4AQY K;  3UIQ A;  1ESV A;  3ULE A;  2GV9 A;  4A61 A;  4NLC A;  4CJP A;  1YJN N;  4WQ5 C;  4BAC A;  1T7P A;  1GLL O;  4FW2 A;  3OYD A;  2E1Z A;  3FR0 A;  3BP8 A;  3O9T A;  1VSF A;  4FLT A;  3AA5 X;  1FKO A;  1DKG D;  3CHW A;  4I9Q A;  1W2B M;  2JLE A;  4NCG A;  1SL2 A;  4N47 A;  2X6S A;  3K9K A;  3QER A;  4KHW A;  3ZCM A;  3C95 A;  4JKG A;  3L2U A;  3QBX A;  3CFR A;  3TAQ A;  4IJA A;  3LM2 A;  2WTU A;  5C24 A;  1LOT B;  3OYC A;  5CY4 A;  5EY4 A;  4A59 A;  4DFK A;  3TAG A;  1IJJ A;  4FLZ A;  4E3S A;  3AGK A;  2IGI A;  5E84 A;  3EE8 A;  2PZS A;  4M3Y A;  3WXI A;  3SYZ A;  1YUW A;  4DQI A;  4CIE A;  1RDU A;  2P9L A;  3C7N A;  3U9D A;  1XWL A;  1BL3 A;  2P9K A;  4JD2 A;  3HRG A;  2OCE A;  5C2D A;  1O13 A;  3ITH A;  5AQR A;  4ID5 A;  4QCL A;  4AHS A;  2D0A A;  5BRH A;  5T7B A;  3ZT1 A;  3CCJ N;  3LDP A;  4U7B A;  4B9N A;  2OZM A;  1MWM A;  1U4B A;  3G25 A;  5FDL A;  4BRD A;  4YOU A;  5ADX A;  1S9E A;  1D5A A;  1IBM K;  3CIP A;  2ZGY A;  1OVY A;  4YHH K;  4JI6 K;  2VWJ A;  2ASO A;  1BWF O;  1VQ9 N;  1QHT A;  4BDZ A; 
#chains in the Genus database with same CATH homology
 5AQP A;  1WOQ A;  3SBG A;  1YI2 N;  3ID6 A;  3O9S A;  2RHK A;  4C1N I;  3WUH A;  3HOT A;  3UKU A;  2CGJ A;  4CI6 A;  3LDN A;  3MN6 A;  1ZXO A;  4YOW A;  4FWQ A;  3HTV A;  3R3L A;  5H1S Q;  3SAF A;  3EO3 A;  4JK8 A;  3VF2 A;  4BR0 A;  5JLH A;  2DPN A;  1NJI O;  3WEE A;  2I7P A;  2VCP A;  3M1F A;  2GWK A;  2W41 A;  4IEI A;  1HJO A;  4H03 B;  3VTH A;  1HKB A;  1XC3 A;  2OAN A;  2BTF A;  4IFE A;  3DXM B;  3GBT A;  4ISG A;  4BRL A;  3C65 A;  3U4L A;  3D2E B;  4BRN A;  3J8A A;  5BR9 A;  2NLX A;  5GAG P;  1BU6 O;  3CMA N;  3I56 N;  3IMX A;  3UKR A;  4XH1 A;  1RDW X;  1Q7Y O;  3CJ9 A;  1JJ2 M;  2HOE A;  1GLE G;  1TYQ B;  3T69 A;  4EIA A;  1QVG M;  3CCQ N;  4FPB A;  5AZI A;  1WUA A;  4BRA A;  4E1J A;  4IWV A;  5BN9 A;  4JHD A;  3RSE A;  3VGM A;  1NGC A;  4H5V A;  1Q82 O;  4YOY A;  3MN7 A;  2E2O A;  4O5F A;  1CZA N;  3DLL L;  3DAW A;  1YJW N;  2YJE A;  1Q81 O;  3VTI A;  1G99 A;  3CJ1 A;  5AQW A;  2ZF5 O;  4WQ4 C;  4H5T A;  1HKG A;  2E88 A;  3CQX A;  5HOO A;  4HWI A;  2QWQ A;  3Q7C A;  4H0Y B;  4YDU A;  3QFU A;  1S72 N;  1D4X A;  4A57 A;  3VER A;  4H0V B;  2A6A A;  4PKG A;  5AQU A;  2P9P A;  3A8Y A;  2QA4 N;  3LDQ A;  3EL2 A;  2P9S B;  1YVN A;  2F9W A;  4K25 A;  4BGA A;  4DCH A;  3OBW A;  4A62 A;  4B1Z A;  1N8R O;  3D2F B;  3O08 A;  3EZW A;  4BQL A;  3CME N;  4B1U B;  5MLC Q;  5I9E B;  2WBN A;  2QEX N;  5ELZ A;  4QS8 A;  3L0Q A;  4I6M B;  2Q0U A;  1RGI A;  3ID8 A;  3FZM A;  3ZYY X;  1NWK A;  5AQG A;  2FSJ A;  2J4R A;  4GV3 A;  4JKB A;  5CHI A;  3FGU A;  4NB4 A;  4IZ9 A;  2YHY A;  3VOV A;  3EE9 A;  2E1Y A;  5M1N A;  5AR0 A;  1QHA A;  4UY8 O;  2QWP A;  3LL3 A;  4DKW A;  1VQ6 N;  3A5M C;  4FWR A;  1BOT O;  3MN5 A;  4BGB A;  1SQK A;  3VEO A;  3M3Z A;  4ISF A;  3AAQ A;  3O1B A;  4YOR A;  4QS7 A;  4GV9 A;  1JCE A;  4B1W B;  4CD3 A;  4CZH A;  3HOS A;  2WC9 A;  2Q97 A;  3SAG A;  3VEW A;  1TUU A;  1X3M A;  2QTD A;  3AAP A;  3FZL A;  1HUX A;  4GY2 B;  3RVC A;  1KXP A;  1U6Z A;  4A5A A;  3WXL A;  4AM6 A;  2WUS A;  4JD2 B;  1HPM A;  1QQO A;  2JWL A;  3OA9 A;  3NMU A;  4JKC A;  4C23 A;  5GIP A;  3BF3 A;  2P9N A;  3FE1 A;  1E4G T;  2Q31 A;  2V51 B;  2E8A A;  3OHR A;  4FL9 A;  4ILH A;  3ZET B;  4WYB A;  1NGE A;  3F5T A;  4IJN A;  1SAZ A;  4CZM A;  4BRM A;  2PBD A;  3CXC M;  4BRI A;  4BY9 C;  3VF4 A;  4NLB A;  4BR5 A;  5JVH L;  1K73 O;  2D0P A;  2NRR A;  2A3Z A;  5FPM A;  3W0L A;  2E20 A;  2NRX A;  3WQT A;  3D6R A;  4PKI A;  3EN9 A;  1V4T A;  3KWG A;  3UB5 A;  5GIN A;  4B1X B;  3VEV A;  3CJ7 A;  1NGJ A;  4WCE L;  1DEJ A;  1GLF O;  2W40 A;  3WQU A;  2Q0R A;  5LJV A;  3VEN A;  1K9M O;  2E2Q A;  3GDQ A;  1EO1 A;  2NNW A;  2CH5 A;  4HTL A;  5AQL A;  2H3G X;  4H0P A;  3ZX0 A;  5C12 A;  5KPT A;  3A0I X;  2BH1 A;  4K43 A;  4JK9 A;  3BUZ B;  5KQ8 A;  1JCG A;  3MDQ A;  5AQI A;  2VGN A;  3GOI A;  4O8U A;  3W3D A;  3SAH A;  2VWB A;  5C15 A;  2A40 A;  3ATU A;  3MN9 A;  3TTF A;  3MWT A;  3UE5 A;  2V52 B;  4H5R A;  4FOE A;  1ATR A;  4A2A A;  3CCE N;  4CZI A;  4BQZ A;  4IXC A;  3G4S N;  2GTD A;  5AQJ A;  4BR4 A;  3P31 A;  2IVN A;  3E66 A;  3WEE B;  1ATS A;  4OPH A;  4RWT A;  1U2V B;  3C6A A;  1YJ9 N;  3T7Z A;  1K8A O;  5KPZ A;  4MDA A;  2A41 A;  3I33 A;  4Y0W A;  3TSU A;  2Q1N A;  2HST A;  1DGK N;  3A5N C;  3SJH A;  1GLD G;  2QW9 A;  4BC5 A;  4CBW A;  5C10 A;  3CJB A;  3CC2 N;  2HF3 A;  1VAZ A;  4U67 L;  2FSN A;  5FPE A;  5JVG L;  4WFN L;  2D4W A;  3UKR B;  3O9U A;  5AQH A;  3CPW M;  3E9L A;  3S41 A;  5AZJ B;  1MWK A;  4JKE A;  5AZI B;  3P38 A;  3TU5 A;  5CE3 A;  1ATN A;  1KAY A;  1NGA A;  1T44 A;  5AQT A;  3TPQ A;  3R8E A;  3RSE B;  2HBK A;  4WQ5 A;  1M1K O;  4JK7 A;  3F2K A;  3FZH A;  1K8K A;  2GUP A;  1VQL N;  1C0G A;  1NMD A;  3ULE B;  1KQS M;  5JLF A;  3P39 A;  3HM8 A;  3DXM A;  2CGL A;  3L6Q A;  1LCU A;  3QDK A;  5AFU H;  3E9O A;  3D2E A;  4XH5 A;  3VEX A;  2AA4 A;  5E26 A;  3CCS N;  3BF1 A;  5BRE A;  3CC7 N;  1VQ4 N;  3CCL N;  2ZWH A;  3CI5 A;  4BC2 A;  2QWM A;  4JKA A;  4K41 A;  5AQX A;  4B1Y B;  1TYQ A;  1T6C A;  3H1Q A;  3HSC A;  3EKU A;  5AQV A;  1HLU A;  5BRF A;  1P8Z A;  1KAZ A;  1Y64 A;  1P90 A;  3HZ6 A;  4OPA A;  3CJC A;  3BEX A;  1T3V A;  4JNE A;  5GIO A;  2D0O A;  4H0T B;  1W97 L;  2QWO A;  4JKG B;  5AQN A;  3VMF B;  2QXL A;  4GVE A;  4CJ7 A;  1QVF M;  2FLO A;  2ASP A;  3LM9 A;  2NRV A;  2P9U B;  5AQQ A;  2KLA A;  2VYP A;  1BUP A;  1IG8 A;  2F9T A;  3O4W A;  1YIT N;  2CGK A;  5F2R A;  4EFH A;  2P9S A;  3M5R A;  3MK6 A;  2NRZ A;  3HI0 A;  3QML A;  4YDU C;  4BRH A;  4M7Y A;  3WT0 A;  3D2F A;  5C2F A;  4BR7 A;  3EKS A;  3CJA A;  2V7Z A;  1X3N A;  3MCP A;  4KH5 A;  2FF6 A;  2UYT A;  2Q36 A;  1H1V A;  2QWN A;  4I6M A;  4DB3 A;  4G9Z A;  3AAR A;  1R59 O;  2IVP A;  4XH4 A;  2YCH A;  3WXM B;  4JKF A;  2P9L B;  4IO9 L;  4MLH A;  3FZK A;  5EX5 A;  3C7N B;  1EQY A;  2ZGZ A;  1ILY A;  3DXK A;  2IVO A;  2JWK A;  1NGD A;  2P9K B;  3HBT A;  2E2P A;  5JIC A;  4RTF D;  3CCM N;  4MLE A;  2P9N B;  3MX2 A;  3SMS A;  2PAV A;  3I8B A;  4CD1 A;  3ATV A;  3I55 N;  4K42 A;  4KBO A;  4BRQ A;  2NRH A;  2P9I A;  3QB0 A;  1YIJ N;  2FF3 B;  2VGM A;  3O80 A;  3TTD A;  4BG8 A;  5AQM A;  2HBM A;  4BC3 A;  4CZJ A;  4B1V A;  3Q7B A;  3QIC A;  5M1O A;  2QWR A;  4CBU A;  2QM1 A;  1NGF A;  3ZEU A;  3SBT A;  4WFB L;  5BPM A;  2ITM A;  4FO0 A;  1BG3 A;  1KD1 O;  1T6D A;  3CET A;  3M6G A;  4AF1 A;  3O9Q A;  4KH6 A;  3FLC O;  1ZC6 A;  3IKM A;  4JAX A;  3B8A X;  3KZB A;  3H1V X;  3OBY A;  5AQY A;  1NGB A;  2F7T A;  3ZET A;  4CZK A;  4PHT X;  4IOC L;  1SZ2 A;  4M63 C;  5C0Y A;  1QZ6 A;  5BN8 A;  5AFU A;  3VGK A;  1BDG A;  1X9J A;  1OKJ A;  2EWS A;  2FSK A;  3O6W A;  4LC9 B;  4BVP A;  2NRT A;  4B9Q A;  3IUC A;  3R6M A;  4FWK A;  1VQ7 N;  4BRO A;  4BR2 A;  4J8F A;  3UKU B;  1V4S A;  3CCR N;  1S22 A;  1MA9 B;  2CH6 A;  1YF5 L;  4BRK A;  4YOT A;  4IOX A;  5BPN A;  3DWL A;  5TKW A;  4BG9 A;  4KH4 A;  5TKY A;  1SS6 A;  4CZL A;  3KVG A;  4ILJ A;  5AQZ A;  1XUP O;  3FFK B;  5M1F A;  3K9J A;  3VEZ A;  3CC4 N;  3VET A;  5F1X A;  4M7X A;  4FPA A;  3IDH A;  4JN4 A;  4PL8 A;  4L3Q A;  5B8H A;  3LDL A;  1NBW A;  2A42 A;  3H46 O;  5JMV A;  2GEL A;  5M1Q A;  1ZBS A;  3PIO L;  4IDH A;  3AY9 A;  3MMV A;  3ENO A;  4RCH A;  1VQP N;  3MCA B;  1BA0 A;  2WFB A;  2YHX A;  2PFU A;  3R1X A;  2NZT A;  2HBL A;  3VES A;  4CBX A;  4JHD B;  3L4I A;  1U2V A;  4WQ4 A;  4CZF A;  1K8K B;  4DQ8 A;  2YJF A;  3L4Q A;  4H5W A;  3MWP A;  4ISE A;  4EAH D;  1QZ5 A;  3D7E O;  2OTL N;  1NGI A;  4YOV A;  3R9P A;  4CZE A;  4C1N K;  4H0X B;  1KAX A;  3H45 C;  5AQS A;  4R79 A;  5GAH P;  1VQ8 N;  5EXW A;  3H3N O;  2GWJ A;  1BO5 O;  3ZX2 A;  4PL7 A;  4QS9 A;  1J6Z A;  4XEI A;  5M1P A;  4GV6 A;  3ENB A;  1C0F A;  4BC4 A;  2GEM A;  3G6E N;  4BRG A;  1NGH A;  2P9P B;  4JEP A;  3KWI A;  1DT9 A;  3H3O B;  5AZJ A;  5AQO A;  4CZG A;  4WFA L;  3TSP A;  2RE2 A;  2A5X A;  3GL1 A;  2NRW A;  4BR9 A;  4F9O A;  5KQD A;  2ZJQ L;  3CQY A;  5ADX H;  3CER A;  3U9Z A;  5DM7 L;  3NVK A;  1YAG A;  3J7Z O;  1E4F T;  4MO5 A;  5LJW A;  1Q86 O;  1VQ5 N;  4OO1 J;  3QBW A;  1M90 O;  4H5N A;  1ESV A;  3H6E A;  4MO4 A;  3ULE A;  1QQN A;  2QWL A;  3IFR A;  4NLC A;  4A61 A;  4BRP A;  1YJN N;  3VGL A;  1YXQ A;  4WQ5 C;  1GLL O;  3MX5 A;  1HKC A;  3KHY A;  3CF5 L;  4FWM A;  2E2N A;  4JKD A;  3ENH A;  1VQO N;  4FWN A;  2Q2R A;  2E1Z A;  2OTJ N;  3FR0 A;  3WXJ A;  3BP8 A;  2ASM A;  3O9T A;  3U8X A;  5DM6 L;  2ZJR L;  1DKG D;  3CHW A;  5FPD A;  5AQK A;  1W2B M;  3OW2 M;  4FVU A;  3A5O C;  3TSQ A;  4A2B A;  2ZJP L;  3E9P A;  4EHT A;  1JCF A;  4YOX A;  3G71 N;  3CPE A;  4FWO A;  3A5L C;  3VF6 A;  2IIR A;  3K9K A;  1GLJ O;  2I7N A;  3FZF A;  3NVM A;  4FSV A;  4WF9 L;  3N4Q A;  1Q18 A;  2YI1 A;  3P4I A;  3GG4 A;  4H0O A;  2AP1 A;  4JKG A;  3AGR A;  1S3X A;  2YX6 A;  4GNI A;  4IEE A;  1Z05 A;  2GX9 A;  3PIP L;  3GE1 A;  4DHY A;  3QBX A;  5BPL A;  5HL7 L;  2P9U A;  3WXK A;  3ZX3 A;  3C0B A;  3LM2 A;  4IJA A;  5F0X A;  3DXK B;  1RFQ A;  1LOT B;  4FWP A;  3JXU A;  1GLA G;  4BVO A;  1GLC G;  4PKH A;  5EY4 A;  4A59 A;  4MDB A;  4A5B A;  5EOY A;  2HMP A;  3CCV N;  5KPR A;  2P9I B;  5LY3 A;  1IJJ A;  2QI2 A;  3E1Y A;  3N4P A;  5GAE P;  4Z94 A;  3AGK A;  3C6H A;  3SLC A;  1KC8 O;  5E84 A;  3EE8 A;  1VQN N;  3WXI A;  3CCU N;  3LDO A;  1VQK N;  3PLA A;  1YUW A;  5M1K A;  3ZEU B;  1RDU A;  2P9L A;  5EVZ A;  1XQS C;  5GAD P;  1NGG A;  2V7Y A;  3C7N A;  3U9D A;  4BRF A;  5BRD A;  4IOA L;  3O8M A;  5FPN A;  3DJC A;  4JKH A;  2P9K A;  1NLV A;  5CR4 A;  1MDU B;  3JS6 A;  4FWL A;  1VQM N;  4JD2 A;  3HRG A;  4IO8 A;  3CD6 N;  1HX1 A;  1GLB G;  2BUP A;  5C2D A;  1O13 A;  2D1K A;  3O5B A;  4O8K A;  4FOI A;  1TUY A;  3VPZ A;  5AQR A;  5BRH A;  2KKZ A;  3VEY A;  3CCJ N;  3O9R A;  2KHO A;  2YHW A;  3LDP A;  3O1W A;  4U7B A;  3SMP A;  4BRC A;  1YHQ N;  2HF4 A;  1MWM A;  3QFP A;  3KK7 A;  3SK3 A;  5AQF A;  3G25 A;  4BRD A;  4ILG B;  3F9M A;  4BRE A;  4YOU A;  5ADX A;  4FWS A;  4EHU A;  3TTC A;  2FXU A;  2HBJ A;  3CIP A;  1QQM A;  2ZGY A;  1OVY A;  4AM7 A;  1BA1 A;  1NM1 A;  1BWF O;  2ASO A;  4NO7 A;  1VQ9 N;  1Z6R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...