3CF5L

Thiopeptide antibiotic thiostrepton bound to the large ribosomal subunit of deinococcus radiodurans
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
104
structure length
104
Chain Sequence
RRKLRTRRKVRTTTAASGRLRLSVYRSSKHIYAQIIDDSRGQTLAAASSAALKSGNKTDTAAAVGKALAAAAAEKGIKQVVFDRGSYKYHGRVKALADAAREGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Translational Regulation Via L11: Molecular Switches on the Ribosome Turned on and Off by Thiostrepton and Micrococcin.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 50S RIBOSOMAL PROTEIN L33
total genus 17
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2008-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00861 Ribosomal_L18p Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.100 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3cf5L01
3CPWM 2ZJQL 3CCSN 3CCUN 1VQ7N 1M90O 1S72N 3CCQN 3CF5L 1OVYA 1VQ5N 1Q86O 2QEXN 1K9MO 4UY8O 1M1KO 3CC4N 4U67L 1VQLN 1K8AO 4WCEL 3I55N 4WF9L 4WFAL 3G71N 1YI2N 1Q82O 1KD1O 4IO9L 3CXCM 2OTJN 3I56N 1VQNN 5HL7L 5GAGP 1VQ6N 3G4SN 1NJIO 1YJWN 1VQ8N 1Q7YO 1YHQN 1ILYA 1YJ9N 1VQON 3CMEN 5DM7L 2QA4N 4WFBL 4WFNL 5JVGL 3PIPL 1VQMN 3CC7N 3DLLL 5H1SQ 1VQ4N 3CCLN 3CCMN 1VQ9N 3CCVN 3CC2N 1VQPN 2ZJPL 1JJ2M 5GAEP 3J7ZO 5JVHL 4IOAL 1YJNN 3G6EN 1VQKN 1N8RO 3PIOL 5GADP 3CCJN 3CMAN 1K73O 3OW2M 2ZJRL 1YIJN 4IOCL 1KQSM 3CCEN 5GAHP 5DM6L 1W2BM 1QVFM 5MLCQ 1Q81O 2OTLN 1QVGM 3CCRN 1KC8O 1YITN 3CD6N
chains in the Genus database with same CATH superfamily
1WNSA 2O8CA 4FWNA 2A5XA 1QSSA 4JYAK 5M1PA 2QTDA 4KI6A 4M3XA 5KPRA 3FE1A 2F7TA 4DR3K 3O3HA 1ZBFA 2Q3SA 3DXKB 3Q7CA 3ZSOA 4ID1A 3K2PA 3HXMA 1GOCA 1WN7A 5AQQA 1C0UA 4YDUC 3O9QA 3S3NA 2YHWA 2GV9A 3DWLA 3LAMA 4DWIA 4ZTJA 1J53A 3GOIA 5J2MA 1W0HA 1A5XA 4BVPA 1HRHA 1NMNA 3BDPA 1RDCA 1FK9A 4FLTA 3CYMA 3SUQA 1HUXA 3A5LC 3TANA 4WYBA 1QQMA 2UYTA 3LDNA 1JL1A 1YF5L 4ZTFA 4DFPA 4KV8A 4UQGA 2X6NA 4A5BA 1YVNA 1HLUA 2HHXA 1NBWA 1ILYA 1C1CA 4FOEA 3CJ1A 4KI4A 4N5SA 3SQ4A 4A2BA 3VOVA 1S1XA 4E1JA 3AVHA 5JS2A 1IKVA 3DYAA 1Y97A 1JLCA 3HRGA 1JLGA 4DSKA 3CQ8A 2A6AA 3VEZA 3OJUA 5J1EA 5AQIA 2QK9A 2FSNA 3JXUA 2YHAA 4XIUA 1XWLA 4BR7A 3NH0A 1LAVA 1X9SA 1QQCA 4PA1A 5KQDA 1UA0A 2AA4A 4CHZA 4KB1A 4CGJA 3SQ1A 3BY5A 4YOUA 1ZXOA 4KPYA 3I33A 4O8UA 3DLHA 5SZTA 4CEDA 1TVRA 2GEMA 3O80A 1BA1A 2A40A 4O55A 4LF6K 5FPEA 1JLQA 2D0PA 4JV5K 1C0TA 5AZJB 3PX4A 4FWMA 1JXBA 1IBLK 4JI8K 3G10A 5E26A 2YJEA 2CGKA 4X62K 4FWPA 4CCHA 2KZMA 1EWRA 4DR2K 4AF1A 5IT9O 1RT7A 2PZSA 4JK8A 1VRTA 4I2PA 2BDPA 2ZQBA 3OY9A 3DMJA 4ID5A 4GV3A 4U67L 1XHZA 4CJVA 4QCLA 3NVMA 4CHOA 1WSJA 4RW6A 4JS5A 4CK3A 3FZFA 3TTDA 2KLAA 3AA5X 3SCXA 3A2FA 5AQRA 4BWMA 3SBTA 4DU4A 4W5RA 1NJZA 5DK5A 3DAWA 2DFEA 2NRHA 2P9LB 1NGHA 4H4MA 3PX0A 1TUUA 2QKKA 4TSXA 3IUCA 4CF0A 4BY9C 4ISFA 5C2DA 2D4WA 3A8YA 2YNGA 1NU0A 4OPJA 4CFBA 5FDLA 4FLUA 4EZ9A 1UA1A 4KTQA 1VSJA 1K8KB 3VN5A 2HHSA 3ALYA 2Z1HA 2X74A 3MEGA 3HOTA 2BUPA 3CQYA 1VQ4N 3OYEA 4FJXA 2E5LK 1P90A 1X9MA 1MA9B 1TYQA 3O4NA 1IBKK 1YVUA 4AHVA 4NB4A 1QE1A 3G0ZA 1E3MA 3KZBA 3P4IA 3J7AP 4B1ZA 2V7YA 4BRGA 1KLMA 3HVRA 4ZHRA 2IVNA 1L3TA 2A3ZA 3AVLA 4CEFA 1ATSA 4ILHA 5CYQA 4W5OA 5AFUH 3ULDA 4BRMA 3ZX2A 4FJ9A 1KQSM 4RW7A 1SV5A 1NMDA 2IDOA 3DRSA 5GIPA 3AARA 1BU6O 2OTLN 1NKEA 4N76A 3IFRA 1HMVA 2FSJA 2VG6A 3ZT1A 2HOEA 3CCUN 3U3GA 4NCBA 2Y1JA 3T1HK 3QDKA 4IXCA 4FCYA 2HVIA 4BR2A 4CIGA 1CZBA 1XHXA 1X9WA 4PHTX 3MCPA 4F3TA 1E4GT 5ELZA 2BTFA 3KLFA 4LY7A 4WF9L 3THWB 4H5WA 4J2DA 3QICA 1U48A 3NGYA 3L2QA 1IG8A 3MX2A 3EYZA 1SKWA 4IO9L 3MECA 4Z4HA 4H0YB 5F1XA 2AP1A 3I56N 3NGIA 3ATUA 4JS4A 4CVNE 2P9UB 4NYNA 2YI1A 4JI1K 1K6YA 4JD2B 1VAZA 2DTUA 4EIAA 2A1RA 3OYNA 1I94K 1XQSC 2HNZA 5FRNA 1SUQA 3SUPA 2RF2A 3KK2A 4LD0A 1RCHA 4H8KA 1T05A 4E0DA 2GWJA 3R3LA 3MN5A 3O9TA 4BR0A 2YNFA 3HJFA 3U9ZA 1MU2A 5HROA 3NF7A 3OS0A 4EHUA 1VSLA 4FLYA 2Q0RA 4BWJA 2HBJA 2JWLA 2RHKA 3DI6A 5K14A 2IS3A 4CJSA 4I6MA 3K9KA 1BIUA 1YTAA 4G9ZA 4DR1K 1BISA 5JVHL 2HMPA 4IOAL 4CGGA 4CJUA 1VSIA 1LW0A 4BGAA 4BE1A 4KHQA 4YFUA 3CCJN 4DV3K 2CGJA 4FYDA 4CEEA 5LJVA 1J54A 2YCHA 2O4IA 3V1OA 2Z1IA 1CXQA 3FGUA 3LAKA 2QM1A 2RPIA 2NRTA 5CZ1A 1W97L 4GMJB 2GTDA 3AO4A 3V9XA 5J2PA 4PL7A 3QMLA 4JI0K 1ESVA 4X66K 3VA3A 4JKAA 4X65K 2P9IB 3S3MA 4LF4K 2QI2A 4O44A 2VYPA 4DKWA 1Q86O 3WT0A 2ZWHA 4YOYA 3NDKA 5AQVA 2IIRA 3NFAA 4C8LA 1VSFA 4GVEA 2KKZA 3J80O 1WOQA 2FF3B 2ETJA 4CJFA 3JAMO 3O3GA 2BE2A 3EEQA 3LANA 3CXCM 3ULEB 2KTQA 5HBMA 1KVAA 4MFBA 5AQFA 4FJ8A 5AQXA 1GLDG 1RT2A 3UKRB 3WUHA 2OCEA 4BRDA 3GE1A 4JKDA 4PKGA 3TAQA 1CXUA 2IOCA 3RRGA 2YNHA 2OPQA 5E84A 3M5RA 3D2FB 3MMVA 1I39A 1YJ9N 1KFSA 1TGOA 1L3UA 3LALA 4PUOA 4ILJA 4FZYA 3HO1A 2QA4N 4F2RA 3CFPA 3S41A 3U6FA 1HYSA 1TKZA 1VHXA 4FZZA 3QBWA 2CH5A 1BUPA 1XMQK 3IMXA 5CZ2A 3KK1A 4CF8A 3TPQA 3CC7N 4N47A 3ZSQA 2NRWA 3EE9A 2HB5A 2ATQA 3C6HA 2F9WA 4DTOA 1D9FA 1X3MA 1VQPN 3CC2N 5GAEP 3O9UA 3OYKA 1HNZK 1J6ZA 4CIFA 3K5MA 1P8ZA 3M8RA 1NOYA 2P9PB 1N8RO 3RR7A 1TL3A 2HMIA 1IO2A 3RSEA 3A0IX 3VF2A 5B8HA 4DTJA 4F4KA 3LP2A 4JAXA 5AZIA 4A2AA 2WTUA 3L8BA 3AO1A 1ZBLA 3L4IA 3N4QA 4FJ7A 1NGAA 3VQ9A 4K42A 2HBMA 3OYGA 2R7YA 1QVGM 3TAEA 3AGKA 3K9JA 5HRPA 1T6CA 1NGCA 5KRSA 1T44A 5AQGA 4BVOA 4KHPK 2P9NA 1XI1A 4H0VB 4JKGB 4AQYK 1BI4A 2VWKA 4O5FA 5AQOA 3VF6A 4JI2K 3HYFA 4C23A 2UUCK 3OYDA 5CYMA 4KHNA 1C0MA 4BQLA 1QHTA 5AQSA 3QLHA 3AGRA 3WXIA 4NCAA 1HQEA 4Z4GA 3V1QA 4B9LA 4BACA 3HM8A 3ID8A 4CFDA 4H5TA 1C6VA 2E88A 4BE2A 2LSNA 1KRPA 2FF6A 1HKCA 3G25A 4DCHA 3O6WA 3PY8A 1RDAA 4DV0K 3CI5A 3ZT2A 2PYJA 3LZJA 2Q2RA 1NK0A 2D1KA 2W42A 3FZHA 4E19A 2O8FA 3CJ9A 3RMAA 4AHSA 3LDSA 3AVNA 4F3OA 1KFDA 3GBTA 4DV1K 1UAXA 4NLCA 4BRIA 1VQMN 3CM5A 2WBNA 2W40A 2F9TA 1C1AA 4E7LA 3ZYYX 4U7BA 3ZLJA 1VK0A 2E8AA 1HYZA 2P51A 4HVJA 3EO3A 4E7HA 4BDPA 4AHTA 4FM0A 4JI7K 3NHGA 5FPNA 3OS2A 2VWJA 1ITGA 4FJMA 3U3YA 1NGFA 4DR6K 1S9GA 1Z26A 2YJFA 1S9EA 2ZJRL 4OGEA 4G1QA 2RE2A 3DJCA 3ZT3A 2ASPA 5GAHP 2QW9A 1Q18A 4CHQA 1HR0K 5MLCQ 4JKEA 2ZGYA 4DTUA 1RDDA 1LWEA 5AQMA 3LP0A 3W3DA 3L6QA 4FJNA 4DQIA 1ATRA 1RDUA 3C6UA 3M3ZA 4DTPA 4OKKA 2FXUA 3CC4N 1C1BA 4AHUA 2HHWA 1IG9A 1ASUA 4LFBK 4KB0A 2O8BB 4GVMA 1SKRA 3KKSA 3KLHA 4DV5K 4YOXA 1OVQA 3OTOK 1RT1A 1DTTA 2D0CA 1NK9A 4H03B 4Q0BA 4K25A 2A1SA 2JWKA 4ISEA 1O1WA 3SMPA 4EZ6A 4CEQA 3DLKA 3QIOA 2V7ZA 3S3OA 4NXMK 4JRPA 4BR4A 1WSFA 2E20A 3H1VX 5DMRA 4DSJA 3EY1A 2E1ZA 1RTHA 3CMEN 1ZC6A 1RBUA 4B3TK 3VEYA 1HKGA 2EHGA 3F5TA 3TR8A 4ELTA 2P9SA 3TAGA 3LZIA 2YV0X 1S22A 3C7NB 3DLGA 3KWGA 2IC3A 1NGIA 2P9UA 3AVBA 1HPMA 3R9PA 3AA3A 1NNEA 5FPMA 4F2SA 1DKGD 2QWLA 4M45A 2P9SB 3EKSA 2ZM6K 5JICA 1QQOA 1RNHA 1VQ9N 4AILC 4K41A 3FR0A 4E7JA 4BGBA 4FXDA 4A59A 3WEEB 4DUZK 3UE5A 1IJJA 3NF6A 1CZAN 3E9OA 1VSEA 4IG0A 4MLHA 4EAHD 3DLRA 4QS7A 4B3RK 3OYJA 2GWKA 3SQ2A 4Z94A 2ASOA 3EE8A 2XRIA 4E1MA 4M7YA 4BRHA 1JLBA 3AAPA 3V4IA 3L0QA 2G8VA 4FOIA 1B9FA 3LP3A 3ZX0A 4BQZA 3MWPA 1Q81O 4KAZA 2ASMA 2CGLA 3C95A 1V4SA 1Q8IA 1N36K 1DTQA 3VENA 3HK2A 5BPMA 3LDOA 5LY3A 4JI4K 2E6MA 1S3XA 3DLEA 3IG1A 3ZT0A 2HHVA 1NKCA 4Z0UA 4O5BA 1MWMA 1RTIA 2OPPA 3HVTA 3KWIA 3NVKA 3C6AA 4YORA 1YXQA 5A2QO 1WB9A 5M1QA 1HX1A 5JLHA 3KLIA 3BP8A 1X3NA 1DGKN 4B9VA 1NKBA 4GY2B 3QFPA 1Z05A 3KK7A 5J2QA 3UKUA 3VQ4A 1VQ6N 4E89A 3TTFA 4FM2A 1Q7YO 3RMCA 2KHOA 3FZLA 5KPTA 4E1NA 1O13A 4WFBL 2GELA 4LSNA 2FBXA 1T03A 4B08A 4E7KA 1RT3A 4CJTA 3NF8A 4OKJA 4CERA 2QWRA 1NK6A 2HF3A 2ITGA 3K5NA 3QB0A 4KH4A 5EX5A 1UWBA 4LFAK 3QFUA 3NF9A 3V1RA 5BPLA 3SAFA 5HLFA 5HOOA 4J8FA 4FJJA 4QOZB 5LJWA 4HTLA 3NAEA 3EL2A 1Y64A 3BEXA 4CZJA 1IV0A 3MK6A 3D0PA 3S9HA 3HP9A 1WSHA 2HNYA 4O8KA 1BI4B 4E3SA 3A5NC 1XUPO 1VQKN 4FK4A 3WNEA 4YNQA 2UXCK 5BR9A 1J5EK 3LP1A 4DHYA 2F8SA 3VMFB 3ZSVA 4ISGA 1KAZA 1GLEG 3FZMA 4BE0A 5DM6L 1RBSA 4CZMA 2KFZA 5KGWA 4FJGA 1L5UA 1LOTB 3K5OA 4KREA 3CM6A 1S72N 4W5TA 3R8EA 5HRNA 3BZKA 3N4PA 1VQ5N 1M1KO 4BC5A 2V52B 4EP5A 4CGIA 2YX6A 1KTQA 4FWOA 4HHTA 2IVOA 4CZKA 2F96A 3VQ5A 2E2OA 2PAVA 2F4VK 1S6QA 3QEWA 3IDHA 5BRDA 1BQNA 4CI6A 2GUPA 1TL1A 3RR8A 3TAPA 2KQ2A 4JI3K 3ENBA 4BG9A 1YAGA 4CJPA 4KBOA 5SWMA 4DR7K 1YJWN 2UXDK 4I2QA 3GDQA 4YOVA 1QZ5A 1BG3A 2XY8A 4PY5A 4QS8A 4M7XA 5D3GA 2GX9A 3P39A 4KTZA 3HPHA 4V19S 4MDAA 1EX4A 3DRRA 1NM1A 2D5RA 3MN9A 3UB5A 4CJ5A 2EWSA 3VQQA 2Z1JA 5BRHA 3PSFA 2KW4A 3LPUA 4Z4FA 3O08A 4KH5A 4CEOA 4DSLA 2Q1NA 5H1SQ 4B9MA 3QEIA 3HT3A 1NGDA 3CCMN 2IVPA 1VSHA 3B6PA 3WEEA 1B9DA 2I5JA 4CJKA 3O1WA 3SYZA 1BOTO 3VESA 4Y1CA 3GG4A 1YJNN 3KJVA 3V9SA 5GIOA 1JCFA 5AFUA 5GADP 3AVIA 1U45A 1NOZA 1W9HA 1SKSA 5M1NA 4KHUA 3PO4A 3VPZA 3LM2A 3RTVA 3DXKA 4DLGA 4XH1A 3L2VA 4AHCA 1N34K 4JN4A 2EX3A 3CCEN 5KGXA 3U9DA 4HUEA 4R5PA 4K8XA 1ZBSA 4B9UA 2X78A 4CW7B 3F9MA 1RBTA 1JLAA 1WBBA 3HM9A 3GL1A 3LM9A 4JHDA 4B3MK 2XY5A 4W5NA 3NGZA 5AQYA 1KVBA 5LL6Z 1Z25A 3ZEUB 3A5OC 4DG1A 3SQ0A 2OZSA 1HKBA 2OPRA 4CESA 2UUAK 3NBPA 4DTMA 4IJAA 4DFKA 1WBDA 3H08A 2G8KA 4BREA 2QKBA 4FM1A 1NK4A 3J81O 3UKRA 2XO7A 1HQUA 3KVGA 1BHLA 4CEBA 3JS6A 1OKJA 4N41A 3HI0A 4H0XB 2GUIA 1RDBA 2P5GA 4KTWA 1MDUB 3SV4A 4DR4K 3ZSYA 3VGMA 4YOWA 2UXBK 2PBDA 4Q5VA 3RWUA 1HYVA 2P9LA 3K57A 1KVCA 1X9JA 4DSFA 2FSKA 3VEVA 3TWHA 2Y1IA 3M8PA 1TK0A 3WNGA 1NG9A 3SPZA 5HP1A 4HCBA 4LF5K 4GNIA 1JCEA 4CFAA 1GLJO 3LL3A 1XC3A 4DTXA 5JMVA 3HSTB 1K8KA 3OVNA 3T19A 3R1XA 1JJ2M 3J7ZO 1JLFA 1HJOA 4IO8A 4A62A 4EP4A 5C12A 1FW6A 3TSPA 2JGUA 2YKNA 4DTRA 5AQWA 4FWLA 4LSLA 4ELUA 1RGIA 2YHXA 3CMAN 3M6GA 1WLJA 1TK8A 2G8HA 4CBUA 3EKUA 3WNFA 3OYFA 4RG8A 4GV6A 2P9KB 1QVFM 1A5WA 3ITHA 4WQ4C 2W6LA 4MO5A 3VTIA 1YITN 3CPWM 4DU3A 4LF9K 5AZIB 4BC3A 4E7IA 4M3UA 3J7YP 4NYFA 3SLCA 2YHYA 3VQ8A 5J2NA 1KSPA 3SJHA 5LMNK 1SL0A 4M3WA 4DR5K 4OPHA 2G8UA 1SZ2A 4FJIA 3Q7BA 3QBXA 4CZEA 3E01A 4NXNK 1U2VA 5ADXA 4IDHA 3C94A 2NUBA 1D8YA 1ZBHA 4PKHA 2UUBK 2I7NA 1RTJA 3AVJA 1BO5O 3ATVA 4FPBA 4CHYA 4CJQA 3K0SA 5I9EB 4LH4A 2FBYA 4CF1A 4FWKA 3WXLA 2HHHK 1EXQA 1VQON 4B3OA 5CY4A 2RN2A 4GKJK 2KZZA 4DV2K 1JLEA 3IAYA 1LWCA 4FSVA 4B9SA 4Y1DA 2FLOA 4DQQA 4DB3A 5JVGL 4IEEA 4FJ5A 5IWAK 1TKXA 4PKIA 4FJKA 3DLLL 2YNIA 2JLEA 4FW2A 3CG7A 4PWDA 1RT4A 3DXMB 5FRMA 4PQUA 3NE6A 3NH2A 4C1NI 4KHSA 2Z1GA 3MXIA 3L3UA 3OBYA 2B6AA 3CPEA 3TAFA 1YTUA 3PIOL 4NLBA 3SAGA 1LWFA 3OW2M 1TYQB 3P1GA 4JEPA 4KFBA 3AO2A 1HJRA 4A61A 1VSMA 4FWRA 1RBVA 4CIEA 1DT9A 1D5AA 3PLAA 1GOAA 3CD6N 2A41A 3T1AA 2ZE2A 4IJNA 4JKFA 3D7EO 4XH4A 4CEAA 4ELVA 1OVYA 2XY7A 4Z4CA 1F21A 3EZWA 5F0XA 4FLXA 4DF4A 5I3UA 4LC9B 2DFHA 3D2FA 3HL8A 2OANA 5AZJA 3VQAA 1T7PA 4J2BA 2VGMA 1QQNA 3CJCA 1Z6RA 1BCOA 4OO1J 4DFMA 3CFRA 1D9DA 1S5JA 3BF3A 1IBMK 4IDKA 3OJSA 5HL7L 4M3ZA 2E6LA 2V51B 5AQHA 3ULEA 1OH5A 1NJIO 5EXWA 3VETA 2OA8A 4Y0WA 1T3VA 3SK3A 4BRAA 3LDPA 3ZX3A 4H5NA 3J8AA 3AVAA 1HNWK 4DV7K 4MO4A 3B6OA 1SAZA 2NRZA 3SMSA 1E4FT 5LMUK 3CQXA 3I0RA 3KD1E 1C0GA 4DSEA 3TU5A 1EQYA 4IEIA 3O4WA 4IZ9A 2ITMA 3RMBA 1QHAA 4EHTA 3PIPL 3OYMA 1JCGA 4IBNA 4BR9A 3QEPA 3UIQA 3C6TA 3VQDA 3MAQA 4FVUA 3ZETB 3HTVA 3W0LA 3AY9A 5TKWA 3FZKA 3NMUA 3DOKA 5I42A 3TSQA 1U6ZA 4F9OA 2Q31A 1L3SA 2NZTA 4FL9A 1WAJA 5BREA 5C2FA 1NGGA 3PUFA 1WUAA 1GLLO 4IKFA 3RVCA 3KLEA 2IAJA 3QEVA 2HF4A 3CJAA 4M42A 3FFIA 5EVZA 1W2BM 2NRXA 1NK8A 2VCPA 2WUSA 5KTQA 2Q97A 1G99A 1C0FA 2VG7A 4KO0A 3JYTA 4H0PA 3BZCA 3CCSN 4BDYA 1H1VA 3T1YK 2Q0UA 5KPZA 3SJJA 5M1FA 2F8TA 3OA9A 1RT5A 3TARA 1Q9YA 4WQ4A 4OJRA 2WC9A 1G15A 3CJ7A 2A42A 3LDLA 1NJXA 1OH6A 3MXMA 3CFOA 2OZMA 4KHWA 2O4GA 3CETA 1U4BA 3H45C 2DPNA 3SAHA 2OYQA 3O9RA 4CZGA 4M3YA 4BRQA 2WFBA 1KD1O 1EKEA 3P31A 3HSCA 4JKGA 3DXMA 4RTFD 3P38A 4Z4IA 2WONA 1NGEA 4CD1A 3KIOA 4O0JA 5C25A 5F2RA 3AA2A 4AH9A 4K8ZA 5E41A 4B1WB 2G8FA 4J2AA 5AQNA 4DV6K 4JI5K 4N56A 3F2KA 3OYCA 3QETA 4B9QA 4O0IA 3MXJA 3MEEA 4M41A 3D2EB 5JLFA 4DU1A 5DM7L 3KD5E 3QNOA 2ZGZA 4RW8A 5KRTA 1KAYA 4FK0A 3THYB 4FLZA 2VGNA 4DLEA 1JKHA 4CECA 1W7AA 1ASWA 4K0KK 3OYIA 1NLVA 3TAMA 3SUNA 4BRFA 3D6RA 4KRFA 3P83D 3O3FA 5AQLA 2H3GX 4O4GA 4JRQA 3CCLN 1FJGK 3SBGA 5AQZA 3SNNA 1QSLA 5ADXH 2VG5A 4CHPA 4CHNA 1S1UA 4LH5A 3TSUA 1RT6A 1U49A 2BGGA 2W6KA 4CGDA 3THXB 3VQPA 4IFYA 2G8IA 3G6EN 2VWBA 2J4RA 4AHRA 3AVKA 3VGLA 4B1XB 4DF8A 3CIPA 3K59A 1BA0A 1SL1A 3E66A 3I8DA 3KKRA 3QERA 4NO7A 3SZ2A 1LW2A 3LWLA 4BR5A 1WSGA 3VQBA 3WQTA 1S6PA 4C8OA 3H3OB 3RRHA 4H5VA 4CJWA 3O5BA 2CH6A 1X1PA 3IRXA 3E1YA 1VRUA 3CCRN 3VEXA 2QXFA 2ZJQL 1XNQK 4FPAA 1VSDA 3CCQN 4BRKA 4M63C 2QEXN 4L3QA 4CE9A 2NRRA 3KTQA 2NLXA 1KXPA 4RWTA 4B9NA 4B9TA 4B1VA 3MN6A 1EO1A 4JHDB 5BN8A 3V9WA 1LCUA 3T3FA 3R6MA 3V9ZA 4YOTA 2HHQA 3THXA 4HTUA 1HNVA 1OH8A 3RMDA 3WXJA 1VQNN 2HVHA 2HBKA 4HWIA 2BH1A 3E9LA 5GAGP 1SL2A 3ISNC 4M3RA 4CFCA 4CJ7A 1GOBA 4CZHA 3CHWA 3WNHA 5GINA 2P9NB 4F8RA 3TI0A 3WXMB 4C1NK 1YHQN 4JLHA 3HOSA 2BANA 1BCMA 1RTDA 3QEXA 1OH7A 4CBXA 4JKHA 3KK3A 1S1WA 4XEIA 4MQ3A 4CGHA 4BC2A 1KCFA 1VSKA 3QINA 2E2QA 4W5QA 2FBVA 4OPKA 2P5OA 5TKYA 4CF9A 4M3TA 5BRFA 1S1TA 4IOXA 3V9UA 4DUYK 3AA4A 1TK5A 3H3NO 4KH6A 4B8CA 4CJLA 5AJ3K 1LV5A 4CD3A 5KQ8A 3PX6A 3QO9A 3T69A 1EETA 4H0TB 1GLBG 2KFNA 2ZJPL 2PYLA 4LF7K 2HW3A 3CERA 3ZEUA 1UOCA 3ASMA 4DQRA 5C42A 4JK7A 4DV4K 3O8MA 3C0BA 3AVCA 4B1UB 5AR0A 2FBTA 3FFKB 3KLGA 2O8CB 1TAQA 5C10A 1ZYQA 3ZSWA 4LF8K 1TV6A 4DQSA 4FVMA 4B1YB 1L3VA 4CK1A 1RILA 1EWQA 5AQJA 4Z4EA 3AO3A 3O4QA 2QWPA 4OGCA 3AO5A 1S1VA 1M90O 3M1FA 4JD2A 2NRVA 1WAFA 4OX9K 1N5YA 4FWQA 5BPNA 3E9PA 2AJQA 1QSYA 4DTNA 4QAGA 4OKEA 3PSIA 4C8NA 4YHHK 1K8AO 4RW4A 3I55N 4FW1A 4CJEA 3ZSRA 1A5VA 2QXLA 4CZIA 3G71N 4IWVA 1QTMA 4IFEA 1Q82O 4DQPA 4WQ5A 2OTJN 3HPGA 5FROA 4EFHA 3HBTA 5AQTA 1YUWA 3WQUA 2XHBA 3VGKA 2O8BA 2O8EA 4C8MA 4CEZA 1RBRA 2O8DA 4IFVA 1HNXK 3QNNA 4DSIA 1NGJA 3ID6A 4CBWA 4YDUA 4HUGA 3H1QA 4B3SK 1NJYA 4LFCK 4CJ4A 1J9AA 1HNIA 3QESA 4FJLA 4AM6A 1SQKA 3O9SA 5C0YA 3NH1A 3MDQA 1WSEA 3H6EA 4C8KA 1BL3A 5C24A 5JS1A 3IS9A 1N32K 2ZD1A 3THWA 1N33K 3VEOA 2E2PA 3OYHA 4I9QA 3VTHA 3HZ6A 3ZCMA 4H5RA 2O8DB 3F9KA 1RFQA 4K43A 5HRRA 2O8FB 1U04A 3WXKA 4JNEA 2O8EB 4YY3K 1REVA 4FO0A 1QZ6A 1K73O 4DFJA 3OYAA 4R79A 5KI6A 3MN7A 3VQ7A 3OYBA 3CJBA 3UKUB 1MWKA 4JKCA 3MEDA 1NK5A 5M1KA 3JSMA 2YKMA 1KC8O 5T7BA 1BIZA 3SI6A 5HRSA 5EOYA 2VQFK 3VQCA 2P9IA 4FWSA 3CF5L 4JI6K 3U4LA 1J5OA 1K9MO 2P1JA 3D45A 2GBZA 1VQLN 1JL2A 3LDQA 4WCEL 1TKTA 4GV9A 1FKOA 3VEWA 4DMNA 5CE3A 1YT3A 2DFFA 4WFAL 1DLOA 1XC9A 1YI2N 5C15A 1D4XA 2DY4A 4WQ5C 3ZSXA 1IH7A 1BWFO 4L8RB 3M8SA 3I0SA 5AQPA 3TABA 4CZLA 4DQ8A 1KLNA 4CZFA 2QWQA 1LAWA 1BDGA 2B5JA 1U47A 2G8WA 3VA0A 3L4QA 1VQ8N 3U8XA 4ICLA 3LPTA 4DS4A 1BQMA 2HNDA 1WSIA 4I6MB 3OHRA 2D0OA 1ATNA 3TTCA 4OLAA 3VERA 1BGXT 4WFNL 1KAXA 3H46O 3BGRA 3IKMA 2HSTA 4CGFA 4WE1A 3BUZB 3SUOA 2WOMA 1TUYA 1IKYA 2NNWA 3F73A 3VQ6A 2YHBA 2P9PA 3NCIA 3CCVN 1FXXA 4A5AA 4KHYA 4MLEA 4GKKK 1I3AA 1CLQA 2HHUA 5AQKA 3AAQA 2E1YA 2UU9K 3HP6A 1HPZA 3L2RA 3SV3A 2E2NA 4CJRA 2VQEK 1R59O 2E4LA 4I9LA 1CZ9A 3O1BA 3V6DA 2D0AA 3V81A 1N6QA 4ILGB 1U2VB 5EY4A 3A5MC 1NWKA 3MX5A 4DS5A 4JK9A 2QWMA 2IGIA 5CR4A 3QIPA 5FLXO 3FLCO 1GLCG 3B8AX 1T6DA 4H4OA 4I7FA 4FJHA 4J2EA 4RW9A 3THYA 1T8EA 3L3VA 4QS9A 5BR8K 1VQ7N 2XY6A 3D2EA 3I8BA 2P9KA 3EZ5A 3ENHA 2B4JA 3C65A 4UY8O 3ZSZA 4BRCA 4BRNA 4MDBA 1FKPA 3LWMA 1TKDA 3L2WA 4BRLA 4CF2A 3VF4A 1R0AA 3DLBA 3PO5A 4CJ3A 2W41A 3OS1A 5CHIA 2PFUA 4JKBA 1IKWA 3K58A 4FLWA 4RCHA 2I7PA 1XMOK 2PY5A 4BG8A 4PL8A 1SS6A 3L2UA 3K5LA 3KHYA 3G4SN 2HBLA 4BC4A 3HPOA 3AVMA 4AM7A 1B92A 3C7NA 4BDZA 1Q9XA 2QWOA 4OVLA 4HCCA 4GW6A 2D0BA 4X64K 4DTSA 1V4TA 3AV9A 3BF1A 5BN9A 4OLBA 2RKIA 4BROA 3ZT4A 1GLAG 3AVFA 2X6SA 1QS4A 5FPDA 1JXEA 1ASVA 5M1OA 3MCAB 4KKOA 3OYLA 1RDWX 2ZF5O 3ENOA 4XH5A 3AVGA 2HHTA 3MWTA 1EP4A 2Q36A 4FZXC 1TAUA 1NK7A 4H0OA 3DOLA 3RSEB 4FLVA 3OBWA 2QWNA 1XNRK 4BRPA 5AQUA 2OPSA 2FC0A 3ZETA 3P5JA 3M8QA 3VQEA 3DM2A 3EN9A 5EU7A 4A57A 3PV8A 1ZBIA 1YIJN 1ZBUA 1DEJA 4B8AB 4FK2A 3DRPA 1IKXA 4IOCL 3THVA 1NGBA 3T7ZA 1NJWA 1GLFO 4OPAA 4CK2A 4IG3A 4HUFA 3SPYA 4NCGA
chains in the Genus database with same CATH topology
2ZJQL 3F9MA 2A5XA 4FWNA 3AGKA 3K9JA 4FPAA 1T6CA 1NGCA 1T44A 2QTDA 5M1PA 3CCQN 5AQGA 4BRKA 3GL1A 3LM9A 4M63C 4BVOA 2QEXN 4JHDA 5KPRA 3FE1A 4L3QA 2P9NA 5AQYA 2F7TA 4H0VB 4JKGB 3DXKB 3Q7CA 2NRRA 5AQOA 4O5FA 2NLXA 3ZEUB 3A5OC 3VF6A 1KXPA 4RWTA 1HKBA 5AQQA 4C23A 4B1VA 3MN6A 1EO1A 4JHDB 4YDUC 3O9QA 4IJAA 2YHWA 5BN8A 3DWLA 1LCUA 3GOIA 3R6MA 4BREA 4BQLA 5AQSA 4YOTA 3WXIA 3AGRA 3UKRA 4BVPA 3WXJA 1VQNN 2HBKA 1HUXA 3KVGA 3A5LC 2BH1A 4HWIA 3E9LA 3HM8A 3ID8A 4WYBA 5GAGP 1QQMA 2UYTA 4H5TA 3JS6A 3LDNA 4CJ7A 3CHWA 1OKJA 2E88A 1YF5L 2P9NB 4CZHA 5GINA 2FF6A 3HI0A 4H0XB 4A5BA 1HKCA 1YVNA 1HLUA 3G25A 3WXMB 4C1NK 4DCHA 1YHQN 1NBWA 3O6WA 3HOSA 1ILYA 4FOEA 3CJ1A 1MDUB 3VGMA 4YOWA 3CI5A 2PBDA 4A2BA 2P9LA 2Q2RA 4CBXA 4JKHA 2D1KA 3VOVA 4XEIA 1X9JA 3FZHA 4E1JA 3CJ9A 4BC2A 2E2QA 5TKYA 2FSKA 3GBTA 3HRGA 5BRFA 4IOXA 4NLCA 3VEVA 4BRIA 1VQMN 3H3NO 2WBNA 2W40A 2A6AA 2F9TA 3VEZA 4GNIA 4KH6A 5AQIA 1JCEA 2FSNA 3JXUA 3ZYYX 1GLJO 4CD3A 4U7BA 3LL3A 5KQ8A 4BR7A 1XC3A 5JMVA 2E8AA 3T69A 1K8KA 3EO3A 4H0TB 5KQDA 1GLBG 2AA4A 3R1XA 2ZJPL 1JJ2M 3J7ZO 1HJOA 4IO8A 5FPNA 3CERA 4A62A 5C12A 4YOUA 1ZXOA 3ZEUA 3TSPA 1NGFA 3I33A 4JK7A 4O8UA 5AQWA 4FWLA 3O8MA 1RGIA 2YHXA 3CMAN 2YJFA 3C0BA 3M6GA 2ZJRL 2GEMA 3O80A 5AR0A 1BA1A 4B1UB 4CBUA 3EKUA 2RE2A 2A40A 3FFKB 5FPEA 3DJCA 5C10A 2ASPA 2D0PA 4GV6A 5GAHP 5AZJB 2QW9A 1Q18A 2P9KB 4FWMA 1QVFM 5MLCQ 4JKEA 4WQ4C 2YJEA 5E26A 4B1YB 2CGKA 4FWPA 2ZGYA 5AQJA 4MO5A 3VTIA 1YITN 2QWPA 3CPWM 5AQMA 5AZIB 3W3DA 4AF1A 1M90O 3M1FA 3L6QA 4BC3A 4JD2A 2NRVA 4JK8A 1ATRA 4FWQA 5BPNA 1RDUA 3SLCA 3E9PA 3M3ZA 4GV3A 2YHYA 2FXUA 3CC4N 3SJHA 4U67L 1K8AO 3I55N 3NVMA 4OPHA 1SZ2A 3FZFA 3Q7BA 2QXLA 3QBXA 4CZIA 4CZEA 3G71N 4IWVA 3TTDA 4IFEA 1U2VA 2KLAA 5ADXA 4IDHA 1Q82O 4WQ5A 2OTJN 4YOXA 4EFHA 3HBTA 5AQTA 1YUWA 3WQUA 4H03B 4PKHA 3VGKA 4K25A 5AQRA 2I7NA 2JWKA 4ISEA 3SBTA 3SMPA 1BO5O 3ATVA 4FPBA 3DAWA 2V7ZA 2NRHA 2P9LB 1NGHA 4BR4A 5I9EB 2E20A 3H1VX 1NGJA 3ID6A 1TUUA 4FWKA 3WXLA 2E1ZA 4CBWA 4YDUA 3H1QA 1VQON 3CMEN 1ZC6A 3VEYA 1HKGA 3F5TA 3IUCA 4BY9C 4ISFA 2P9SA 4FSVA 2FLOA 5C2DA 2D4WA 1S22A 3A8YA 3C7NB 3KWGA 4DB3A 5JVGL 4AM6A 1NGIA 1SQKA 2P9UA 3O9SA 1HPMA 4IEEA 3R9PA 5C0YA 5FPMA 4PKIA 3MDQA 1K8KB 3H6EA 1DKGD 2QWLA 3DLLL 3HOTA 2BUPA 2P9SB 3EKSA 3CQYA 1VQ4N 5JICA 1QQOA 3DXMB 1VQ9N 4K41A 3FR0A 1P90A 4BGBA 4A59A 3VEOA 3WEEB 2E2PA 3VTHA 3HZ6A 1MA9B 1IJJA 3UE5A 1TYQA 4H5RA 4C1NI 1CZAN 3E9OA 4NB4A 4MLHA 4EAHD 1RFQA 3OBYA 4K43A 4QS7A 3CPEA 3KZBA 3P4IA 4B1ZA 2GWKA 3WXKA 3PIOL 4JNEA 2V7YA 4NLBA 4BRGA 4FO0A 4Z94A 1QZ6A 2IVNA 3SAGA 1K73O 2ASOA 2A3ZA 3EE8A 3OW2M 1TYQB 4JEPA 4R79A 4M7YA 1ATSA 4ILHA 4BRHA 5AFUH 3AAPA 4A61A 4BRMA 3L0QA 3ZX2A 4FWRA 1KQSM 1NMDA 3MN7A 4FOIA 5GIPA 3CJBA 3ZX0A 3UKUB 1MWKA 1DT9A 1BU6O 3AARA 3MWPA 4JKCA 2ASMA 4BQZA 1Q81O 2OTLN 2CGLA 5M1KA 1V4SA 3PLAA 1KC8O 3IFRA 3CD6N 2A41A 2FSJA 3VENA 2HOEA 3CCUN 5EOYA 4IJNA 4JKFA 3D7EO 3LDOA 4XH4A 5BPMA 5LY3A 2P9IA 4FWSA 3QDKA 4IXCA 1OVYA 3U4LA 1S3XA 3CF5L 4BR2A 1K9MO 4PHTX 1VQLN 3LDQA 3EZWA 3MCPA 4WCEL 5F0XA 1E4GT 5ELZA 4LC9B 2BTFA 4WF9L 1MWMA 3VEWA 4GV9A 3D2FA 5CE3A 2OANA 4H5WA 5AZJA 4WFAL 1YI2N 3KWIA 3NVKA 5C15A 2VGMA 3QICA 3C6AA 4YORA 1D4XA 1IG8A 1YXQA 3MX2A 1QQNA 3CJCA 4WQ5C 5M1QA 4IO9L 1Z6RA 4OO1J 1HX1A 4H0YB 5F1XA 5JLHA 2AP1A 3I56N 3ATUA 1BWFO 3BF3A 3BP8A 1X3NA 2P9UB 1DGKN 4GY2B 5AQPA 4CZLA 4DQ8A 2YI1A 3QFPA 4CZFA 5HL7L 4JD2B 1Z05A 2V51B 3KK7A 5AQHA 1VAZA 3UKUA 3ULEA 1VQ6N 2QWQA 1BDGA 4EIAA 1NJIO 5EXWA 3VETA 3L4QA 3TTFA 1VQ8N 1Q7YO 4Y0WA 3U8XA 1T3VA 1XQSC 2KHOA 3FZLA 3SK3A 4BRAA 3LDPA 5KPTA 4I6MB 3ZX3A 3OHRA 3J8AA 4H5NA 2D0OA 1ATNA 3TTCA 1O13A 3VERA 4WFBL 2GELA 4MO4A 2GWJA 4WFNL 1KAXA 1SAZA 2NRZA 3H46O 2HSTA 3IKMA 3MN5A 1E4FT 3O9TA 3R3LA 3SMSA 4BR0A 3U9ZA 3CQXA 2QWRA 1C0GA 2HF3A 3BUZB 4EHUA 3TU5A 1EQYA 4IEIA 1TUYA 3O4WA 3QB0A 4IZ9A 4KH4A 1QHAA 5EX5A 2ITMA 4EHTA 3PIPL 3QFUA 2NNWA 1JCGA 2Q0RA 4BR9A 5BPLA 3SAFA 5HOOA 4J8FA 2HBJA 2JWLA 2RHKA 5LJWA 4FVUA 4HTLA 2P9PA 3ZETB 3CCVN 4I6MA 3K9KA 3HTVA 3W0LA 3EL2A 1Y64A 3BEXA 4CZJA 3AY9A 3MK6A 4A5AA 4G9ZA 4MLEA 5TKWA 5JVHL 3FZKA 2HMPA 4IOAL 5AQKA 3AAQA 3NMUA 2E1YA 3TSQA 1U6ZA 4BGAA 4F9OA 4O8KA 2E2NA 1VQKN 1R59O 1XUPO 3A5NC 3O1BA 2Q31A 4ILGB 1U2VB 5EY4A 3A5MC 3CCJN 2NZTA 1NWKA 2CGJA 3MX5A 4FL9A 4JK9A 5LJVA 2QWMA 2YCHA 5BREA 5BR9A 5CR4A 3FGUA 5C2FA 1NGGA 3FLCO 1GLCG 1WUAA 2QM1A 1GLLO 4DHYA 3RVCA 3B8AX 3VMFB 4ISGA 1KAZA 1T6DA 2NRTA 1GLEG 2HF4A 3CJAA 3FZMA 1W97L 5EVZA 5DM6L 2GTDA 1W2BM 2NRXA 2VCPA 4PL7A 2WUSA 4CZMA 2Q97A 3QMLA 1ESVA 1G99A 1C0FA 4QS9A 4JKAA 4H0PA 3CCSN 1VQ7N 1H1VA 2P9IB 1LOTB 3D2EA 3I8BA 2Q0UA 5KPZA 1S72N 2P9KA 5M1FA 2QI2A 3R8EA 3ENHA 3N4PA 2VYPA 4DKWA 1Q86O 1VQ5N 3WT0A 3OA9A 3C65A 2ZWHA 1M1KO 4BC5A 2V52B 4YOYA 4UY8O 4WQ4A 4BRCA 4BRNA 5AQVA 4MDBA 2WC9A 3CJ7A 2YX6A 2IIRA 2A42A 3LDLA 4FWOA 3CETA 2IVOA 2KKZA 4GVEA 4CZKA 1WOQA 2FF3B 3H45C 2DPNA 3SAHA 2E2OA 2PAVA 4BRLA 3VF4A 3O9RA 3IDHA 4CZGA 5BRDA 4CI6A 4BRQA 2W41A 2WFBA 1KD1O 3CXCM 3ULEB 2GUPA 2PFUA 5CHIA 4JKBA 3P31A 5AQFA 3HSCA 4JKGA 3DXMA 3ENBA 4RTFD 4RCHA 5AQXA 4CD1A 1GLDG 3P38A 1YAGA 2I7PA 4BG9A 3UKRB 1NGEA 3GE1A 4JKDA 4PKGA 4PL8A 1SS6A 3WUHA 4BG8A 4BRDA 3KHYA 4KBOA 5F2RA 3G4SN 4B1WB 2HBLA 5E84A 1YJWN 5AQNA 4BC4A 3F2KA 3M5RA 4AM7A 3GDQA 3D2FB 4B9QA 3C7NA 4YOVA 5JLFA 3MMVA 1QZ5A 2QWOA 3D2EB 1BG3A 1YJ9N 5DM7L 4ILJA 2ZGZA 2QA4N 1V4TA 4QS8A 1KAYA 4M7XA 3BF1A 5BN9A 3S41A 2GX9A 3P39A 4BROA 4MDAA 1GLAG 3QBWA 1NM1A 2VGNA 3MN9A 5FPDA 3UB5A 2CH5A 1BUPA 2EWSA 5M1OA 3MCAB 3IMXA 1NLVA 5BRHA 1RDWX 4BRFA 2ZF5O 3O08A 3TPQA 4KH5A 3CC7N 3D6RA 3ENOA 2Q1NA 4XH5A 5H1SQ 5AQLA 2H3GX 3CCLN 1NGDA 2NRWA 3SBGA 3CCMN 5AQZA 2IVPA 3MWTA 2Q36A 3EE9A 3WEEA 5ADXH 3C6HA 3O1WA 2F9WA 4H0OA 3CC2N 1X3MA 3RSEB 3TSUA 1VQPN 5GAEP 3O9UA 1J6ZA 1BOTO 3VESA 3OBWA 2QWNA 3GG4A 1YJNN 4BRPA 1P8ZA 3G6EN 5AQUA 2VWBA 2J4RA 5GIOA 1JCFA 2P9PB 3VGLA 3ZETA 4B1XB 3CIPA 5AFUA 1BA0A 5GADP 1N8RO 3E66A 5M1NA 3EN9A 3RSEA 3A0IX 3VF2A 4A57A 4NO7A 3VPZA 3LM2A 5B8HA 1YIJN 3DXKA 1DEJA 4JAXA 3WQTA 4BR5A 5AZIA 4XH1A 4A2AA 3H3OB 4IOCL 3L4IA 1NGBA 4H5VA 4JN4A 3T7ZA 3CCEN 3N4QA 3O5BA 3U9DA 1NGAA 2CH6A 1GLFO 4OPAA 4K42A 2HBMA 1QVGM 3E1YA 1ZBSA 3CCRN 3VEXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CPW M;  2ZJQ L;  3CCS N;  3CCU N;  1VQ7 N;  1M90 O;  1S72 N;  3CCQ N;  3CF5 L;  1OVY A;  1VQ5 N;  1Q86 O;  2QEX N;  1K9M O;  4UY8 O;  1M1K O;  3CC4 N;  4U67 L;  1VQL N;  1K8A O;  4WCE L;  3I55 N;  4WF9 L;  4WFA L;  3G71 N;  1YI2 N;  1Q82 O;  1KD1 O;  4IO9 L;  3CXC M;  2OTJ N;  3I56 N;  1VQN N;  5HL7 L;  5GAG P;  1VQ6 N;  3G4S N;  1NJI O;  1YJW N;  1VQ8 N;  1Q7Y O;  1YHQ N;  1ILY A;  1YJ9 N;  1VQO N;  3CME N;  5DM7 L;  2QA4 N;  4WFB L;  4WFN L;  5JVG L;  3PIP L;  1VQM N;  3CC7 N;  3DLL L;  5H1S Q;  1VQ4 N;  3CCL N;  3CCM N;  1VQ9 N;  3CCV N;  3CC2 N;  1VQP N;  2ZJP L;  1JJ2 M;  5GAE P;  3J7Z O;  5JVH L;  4IOA L;  1YJN N;  3G6E N;  1VQK N;  1N8R O;  3PIO L;  5GAD P;  3CCJ N;  3CMA N;  1K73 O;  3OW2 M;  2ZJR L;  1YIJ N;  4IOC L;  1KQS M;  3CCE N;  5GAH P;  5DM6 L;  1W2B M;  1QVF M;  5MLC Q;  1Q81 O;  2OTL N;  1QVG M;  3CCR N;  1KC8 O;  1YIT N;  3CD6 N; 
#chains in the Genus database with same CATH topology
 1WNS A;  2O8C A;  4FWN A;  2A5X A;  1QSS A;  4JYA K;  5M1P A;  2QTD A;  4KI6 A;  4M3X A;  5KPR A;  3FE1 A;  2F7T A;  4DR3 K;  3O3H A;  1ZBF A;  2Q3S A;  3DXK B;  3Q7C A;  3ZSO A;  4ID1 A;  3K2P A;  3HXM A;  1GOC A;  1WN7 A;  5AQQ A;  1C0U A;  4YDU C;  3O9Q A;  3S3N A;  2YHW A;  2GV9 A;  3DWL A;  3LAM A;  4DWI A;  4ZTJ A;  1J53 A;  3GOI A;  5J2M A;  1W0H A;  1A5X A;  4BVP A;  1HRH A;  1NMN A;  3BDP A;  1RDC A;  1FK9 A;  4FLT A;  3CYM A;  3SUQ A;  1HUX A;  3A5L C;  3TAN A;  4WYB A;  1QQM A;  2UYT A;  3LDN A;  1JL1 A;  1YF5 L;  4ZTF A;  4DFP A;  4KV8 A;  4UQG A;  2X6N A;  4A5B A;  1YVN A;  1HLU A;  2HHX A;  1NBW A;  1ILY A;  1C1C A;  4FOE A;  3CJ1 A;  4KI4 A;  4N5S A;  3SQ4 A;  4A2B A;  3VOV A;  1S1X A;  4E1J A;  3AVH A;  5JS2 A;  1IKV A;  3DYA A;  1Y97 A;  1JLC A;  3HRG A;  1JLG A;  4DSK A;  3CQ8 A;  2A6A A;  3VEZ A;  3OJU A;  5J1E A;  5AQI A;  2QK9 A;  2FSN A;  3JXU A;  2YHA A;  4XIU A;  1XWL A;  4BR7 A;  3NH0 A;  1LAV A;  1X9S A;  1QQC A;  4PA1 A;  5KQD A;  1UA0 A;  2AA4 A;  4CHZ A;  4KB1 A;  4CGJ A;  3SQ1 A;  3BY5 A;  4YOU A;  1ZXO A;  4KPY A;  3I33 A;  4O8U A;  3DLH A;  5SZT A;  4CED A;  1TVR A;  2GEM A;  3O80 A;  1BA1 A;  2A40 A;  4O55 A;  4LF6 K;  5FPE A;  1JLQ A;  2D0P A;  4JV5 K;  1C0T A;  5AZJ B;  3PX4 A;  4FWM A;  1JXB A;  1IBL K;  4JI8 K;  3G10 A;  5E26 A;  2YJE A;  2CGK A;  4X62 K;  4FWP A;  4CCH A;  2KZM A;  1EWR A;  4DR2 K;  4AF1 A;  5IT9 O;  1RT7 A;  2PZS A;  4JK8 A;  1VRT A;  4I2P A;  2BDP A;  2ZQB A;  3OY9 A;  3DMJ A;  4ID5 A;  4GV3 A;  4U67 L;  1XHZ A;  4CJV A;  4QCL A;  3NVM A;  4CHO A;  1WSJ A;  4RW6 A;  4JS5 A;  4CK3 A;  3FZF A;  3TTD A;  2KLA A;  3AA5 X;  3SCX A;  3A2F A;  5AQR A;  4BWM A;  3SBT A;  4DU4 A;  4W5R A;  1NJZ A;  5DK5 A;  3DAW A;  2DFE A;  2NRH A;  2P9L B;  1NGH A;  4H4M A;  3PX0 A;  1TUU A;  2QKK A;  4TSX A;  3IUC A;  4CF0 A;  4BY9 C;  4ISF A;  5C2D A;  2D4W A;  3A8Y A;  2YNG A;  1NU0 A;  4OPJ A;  4CFB A;  5FDL A;  4FLU A;  4EZ9 A;  1UA1 A;  4KTQ A;  1VSJ A;  1K8K B;  3VN5 A;  2HHS A;  3ALY A;  2Z1H A;  2X74 A;  3MEG A;  3HOT A;  2BUP A;  3CQY A;  1VQ4 N;  3OYE A;  4FJX A;  2E5L K;  1P90 A;  1X9M A;  1MA9 B;  1TYQ A;  3O4N A;  1IBK K;  1YVU A;  4AHV A;  4NB4 A;  1QE1 A;  3G0Z A;  1E3M A;  3KZB A;  3P4I A;  3J7A P;  4B1Z A;  2V7Y A;  4BRG A;  1KLM A;  3HVR A;  4ZHR A;  2IVN A;  1L3T A;  2A3Z A;  3AVL A;  4CEF A;  1ATS A;  4ILH A;  5CYQ A;  4W5O A;  5AFU H;  3ULD A;  4BRM A;  3ZX2 A;  4FJ9 A;  1KQS M;  4RW7 A;  1SV5 A;  1NMD A;  2IDO A;  3DRS A;  5GIP A;  3AAR A;  1BU6 O;  2OTL N;  1NKE A;  4N76 A;  3IFR A;  1HMV A;  2FSJ A;  2VG6 A;  3ZT1 A;  2HOE A;  3CCU N;  3U3G A;  4NCB A;  2Y1J A;  3T1H K;  3QDK A;  4IXC A;  4FCY A;  2HVI A;  4BR2 A;  4CIG A;  1CZB A;  1XHX A;  1X9W A;  4PHT X;  3MCP A;  4F3T A;  1E4G T;  5ELZ A;  2BTF A;  3KLF A;  4LY7 A;  4WF9 L;  3THW B;  4H5W A;  4J2D A;  3QIC A;  1U48 A;  3NGY A;  3L2Q A;  1IG8 A;  3MX2 A;  3EYZ A;  1SKW A;  4IO9 L;  3MEC A;  4Z4H A;  4H0Y B;  5F1X A;  2AP1 A;  3I56 N;  3NGI A;  3ATU A;  4JS4 A;  4CVN E;  2P9U B;  4NYN A;  2YI1 A;  4JI1 K;  1K6Y A;  4JD2 B;  1VAZ A;  2DTU A;  4EIA A;  2A1R A;  3OYN A;  1I94 K;  1XQS C;  2HNZ A;  5FRN A;  1SUQ A;  3SUP A;  2RF2 A;  3KK2 A;  4LD0 A;  1RCH A;  4H8K A;  1T05 A;  4E0D A;  2GWJ A;  3R3L A;  3MN5 A;  3O9T A;  4BR0 A;  2YNF A;  3HJF A;  3U9Z A;  1MU2 A;  5HRO A;  3NF7 A;  3OS0 A;  4EHU A;  1VSL A;  4FLY A;  2Q0R A;  4BWJ A;  2HBJ A;  2JWL A;  2RHK A;  3DI6 A;  5K14 A;  2IS3 A;  4CJS A;  4I6M A;  3K9K A;  1BIU A;  1YTA A;  4G9Z A;  4DR1 K;  1BIS A;  5JVH L;  2HMP A;  4IOA L;  4CGG A;  4CJU A;  1VSI A;  1LW0 A;  4BGA A;  4BE1 A;  4KHQ A;  4YFU A;  3CCJ N;  4DV3 K;  2CGJ A;  4FYD A;  4CEE A;  5LJV A;  1J54 A;  2YCH A;  2O4I A;  3V1O A;  2Z1I A;  1CXQ A;  3FGU A;  3LAK A;  2QM1 A;  2RPI A;  2NRT A;  5CZ1 A;  1W97 L;  4GMJ B;  2GTD A;  3AO4 A;  3V9X A;  5J2P A;  4PL7 A;  3QML A;  4JI0 K;  1ESV A;  4X66 K;  3VA3 A;  4JKA A;  4X65 K;  2P9I B;  3S3M A;  4LF4 K;  2QI2 A;  4O44 A;  2VYP A;  4DKW A;  1Q86 O;  3WT0 A;  2ZWH A;  4YOY A;  3NDK A;  5AQV A;  2IIR A;  3NFA A;  4C8L A;  1VSF A;  4GVE A;  2KKZ A;  3J80 O;  1WOQ A;  2FF3 B;  2ETJ A;  4CJF A;  3JAM O;  3O3G A;  2BE2 A;  3EEQ A;  3LAN A;  3CXC M;  3ULE B;  2KTQ A;  5HBM A;  1KVA A;  4MFB A;  5AQF A;  4FJ8 A;  5AQX A;  1GLD G;  1RT2 A;  3UKR B;  3WUH A;  2OCE A;  4BRD A;  3GE1 A;  4JKD A;  4PKG A;  3TAQ A;  1CXU A;  2IOC A;  3RRG A;  2YNH A;  2OPQ A;  5E84 A;  3M5R A;  3D2F B;  3MMV A;  1I39 A;  1YJ9 N;  1KFS A;  1TGO A;  1L3U A;  3LAL A;  4PUO A;  4ILJ A;  4FZY A;  3HO1 A;  2QA4 N;  4F2R A;  3CFP A;  3S41 A;  3U6F A;  1HYS A;  1TKZ A;  1VHX A;  4FZZ A;  3QBW A;  2CH5 A;  1BUP A;  1XMQ K;  3IMX A;  5CZ2 A;  3KK1 A;  4CF8 A;  3TPQ A;  3CC7 N;  4N47 A;  3ZSQ A;  2NRW A;  3EE9 A;  2HB5 A;  2ATQ A;  3C6H A;  2F9W A;  4DTO A;  1D9F A;  1X3M A;  1VQP N;  3CC2 N;  5GAE P;  3O9U A;  3OYK A;  1HNZ K;  1J6Z A;  4CIF A;  3K5M A;  1P8Z A;  3M8R A;  1NOY A;  2P9P B;  1N8R O;  3RR7 A;  1TL3 A;  2HMI A;  1IO2 A;  3RSE A;  3A0I X;  3VF2 A;  5B8H A;  4DTJ A;  4F4K A;  3LP2 A;  4JAX A;  5AZI A;  4A2A A;  2WTU A;  3L8B A;  3AO1 A;  1ZBL A;  3L4I A;  3N4Q A;  4FJ7 A;  1NGA A;  3VQ9 A;  4K42 A;  2HBM A;  3OYG A;  2R7Y A;  1QVG M;  3TAE A;  3AGK A;  3K9J A;  5HRP A;  1T6C A;  1NGC A;  5KRS A;  1T44 A;  5AQG A;  4BVO A;  4KHP K;  2P9N A;  1XI1 A;  4H0V B;  4JKG B;  4AQY K;  1BI4 A;  2VWK A;  4O5F A;  5AQO A;  3VF6 A;  4JI2 K;  3HYF A;  4C23 A;  2UUC K;  3OYD A;  5CYM A;  4KHN A;  1C0M A;  4BQL A;  1QHT A;  5AQS A;  3QLH A;  3AGR A;  3WXI A;  4NCA A;  1HQE A;  4Z4G A;  3V1Q A;  4B9L A;  4BAC A;  3HM8 A;  3ID8 A;  4CFD A;  4H5T A;  1C6V A;  2E88 A;  4BE2 A;  2LSN A;  1KRP A;  2FF6 A;  1HKC A;  3G25 A;  4DCH A;  3O6W A;  3PY8 A;  1RDA A;  4DV0 K;  3CI5 A;  3ZT2 A;  2PYJ A;  3LZJ A;  2Q2R A;  1NK0 A;  2D1K A;  2W42 A;  3FZH A;  4E19 A;  2O8F A;  3CJ9 A;  3RMA A;  4AHS A;  3LDS A;  3AVN A;  4F3O A;  1KFD A;  3GBT A;  4DV1 K;  1UAX A;  4NLC A;  4BRI A;  1VQM N;  3CM5 A;  2WBN A;  2W40 A;  2F9T A;  1C1A A;  4E7L A;  3ZYY X;  4U7B A;  3ZLJ A;  1VK0 A;  2E8A A;  1HYZ A;  2P51 A;  4HVJ A;  3EO3 A;  4E7H A;  4BDP A;  4AHT A;  4FM0 A;  4JI7 K;  3NHG A;  5FPN A;  3OS2 A;  2VWJ A;  1ITG A;  4FJM A;  3U3Y A;  1NGF A;  4DR6 K;  1S9G A;  1Z26 A;  2YJF A;  1S9E A;  2ZJR L;  4OGE A;  4G1Q A;  2RE2 A;  3DJC A;  3ZT3 A;  2ASP A;  5GAH P;  2QW9 A;  1Q18 A;  4CHQ A;  1HR0 K;  5MLC Q;  4JKE A;  2ZGY A;  4DTU A;  1RDD A;  1LWE A;  5AQM A;  3LP0 A;  3W3D A;  3L6Q A;  4FJN A;  4DQI A;  1ATR A;  1RDU A;  3C6U A;  3M3Z A;  4DTP A;  4OKK A;  2FXU A;  3CC4 N;  1C1B A;  4AHU A;  2HHW A;  1IG9 A;  1ASU A;  4LFB K;  4KB0 A;  2O8B B;  4GVM A;  1SKR A;  3KKS A;  3KLH A;  4DV5 K;  4YOX A;  1OVQ A;  3OTO K;  1RT1 A;  1DTT A;  2D0C A;  1NK9 A;  4H03 B;  4Q0B A;  4K25 A;  2A1S A;  2JWK A;  4ISE A;  1O1W A;  3SMP A;  4EZ6 A;  4CEQ A;  3DLK A;  3QIO A;  2V7Z A;  3S3O A;  4NXM K;  4JRP A;  4BR4 A;  1WSF A;  2E20 A;  3H1V X;  5DMR A;  4DSJ A;  3EY1 A;  2E1Z A;  1RTH A;  3CME N;  1ZC6 A;  1RBU A;  4B3T K;  3VEY A;  1HKG A;  2EHG A;  3F5T A;  3TR8 A;  4ELT A;  2P9S A;  3TAG A;  3LZI A;  2YV0 X;  1S22 A;  3C7N B;  3DLG A;  3KWG A;  2IC3 A;  1NGI A;  2P9U A;  3AVB A;  1HPM A;  3R9P A;  3AA3 A;  1NNE A;  5FPM A;  4F2S A;  1DKG D;  2QWL A;  4M45 A;  2P9S B;  3EKS A;  2ZM6 K;  5JIC A;  1QQO A;  1RNH A;  1VQ9 N;  4AIL C;  4K41 A;  3FR0 A;  4E7J A;  4BGB A;  4FXD A;  4A59 A;  3WEE B;  4DUZ K;  3UE5 A;  1IJJ A;  3NF6 A;  1CZA N;  3E9O A;  1VSE A;  4IG0 A;  4MLH A;  4EAH D;  3DLR A;  4QS7 A;  4B3R K;  3OYJ A;  2GWK A;  3SQ2 A;  4Z94 A;  2ASO A;  3EE8 A;  2XRI A;  4E1M A;  4M7Y A;  4BRH A;  1JLB A;  3AAP A;  3V4I A;  3L0Q A;  2G8V A;  4FOI A;  1B9F A;  3LP3 A;  3ZX0 A;  4BQZ A;  3MWP A;  1Q81 O;  4KAZ A;  2ASM A;  2CGL A;  3C95 A;  1V4S A;  1Q8I A;  1N36 K;  1DTQ A;  3VEN A;  3HK2 A;  5BPM A;  3LDO A;  5LY3 A;  4JI4 K;  2E6M A;  1S3X A;  3DLE A;  3IG1 A;  3ZT0 A;  2HHV A;  1NKC A;  4Z0U A;  4O5B A;  1MWM A;  1RTI A;  2OPP A;  3HVT A;  3KWI A;  3NVK A;  3C6A A;  4YOR A;  1YXQ A;  5A2Q O;  1WB9 A;  5M1Q A;  1HX1 A;  5JLH A;  3KLI A;  3BP8 A;  1X3N A;  1DGK N;  4B9V A;  1NKB A;  4GY2 B;  3QFP A;  1Z05 A;  3KK7 A;  5J2Q A;  3UKU A;  3VQ4 A;  1VQ6 N;  4E89 A;  3TTF A;  4FM2 A;  1Q7Y O;  3RMC A;  2KHO A;  3FZL A;  5KPT A;  4E1N A;  1O13 A;  4WFB L;  2GEL A;  4LSN A;  2FBX A;  1T03 A;  4B08 A;  4E7K A;  1RT3 A;  4CJT A;  3NF8 A;  4OKJ A;  4CER A;  2QWR A;  1NK6 A;  2HF3 A;  2ITG A;  3K5N A;  3QB0 A;  4KH4 A;  5EX5 A;  1UWB A;  4LFA K;  3QFU A;  3NF9 A;  3V1R A;  5BPL A;  3SAF A;  5HLF A;  5HOO A;  4J8F A;  4FJJ A;  4QOZ B;  5LJW A;  4HTL A;  3NAE A;  3EL2 A;  1Y64 A;  3BEX A;  4CZJ A;  1IV0 A;  3MK6 A;  3D0P A;  3S9H A;  3HP9 A;  1WSH A;  2HNY A;  4O8K A;  1BI4 B;  4E3S A;  3A5N C;  1XUP O;  1VQK N;  4FK4 A;  3WNE A;  4YNQ A;  2UXC K;  5BR9 A;  1J5E K;  3LP1 A;  4DHY A;  2F8S A;  3VMF B;  3ZSV A;  4ISG A;  1KAZ A;  1GLE G;  3FZM A;  4BE0 A;  5DM6 L;  1RBS A;  4CZM A;  2KFZ A;  5KGW A;  4FJG A;  1L5U A;  1LOT B;  3K5O A;  4KRE A;  3CM6 A;  1S72 N;  4W5T A;  3R8E A;  5HRN A;  3BZK A;  3N4P A;  1VQ5 N;  1M1K O;  4BC5 A;  2V52 B;  4EP5 A;  4CGI A;  2YX6 A;  1KTQ A;  4FWO A;  4HHT A;  2IVO A;  4CZK A;  2F96 A;  3VQ5 A;  2E2O A;  2PAV A;  2F4V K;  1S6Q A;  3QEW A;  3IDH A;  5BRD A;  1BQN A;  4CI6 A;  2GUP A;  1TL1 A;  3RR8 A;  3TAP A;  2KQ2 A;  4JI3 K;  3ENB A;  4BG9 A;  1YAG A;  4CJP A;  4KBO A;  5SWM A;  4DR7 K;  1YJW N;  2UXD K;  4I2Q A;  3GDQ A;  4YOV A;  1QZ5 A;  1BG3 A;  2XY8 A;  4PY5 A;  4QS8 A;  4M7X A;  5D3G A;  2GX9 A;  3P39 A;  4KTZ A;  3HPH A;  4V19 S;  4MDA A;  1EX4 A;  3DRR A;  1NM1 A;  2D5R A;  3MN9 A;  3UB5 A;  4CJ5 A;  2EWS A;  3VQQ A;  2Z1J A;  5BRH A;  3PSF A;  2KW4 A;  3LPU A;  4Z4F A;  3O08 A;  4KH5 A;  4CEO A;  4DSL A;  2Q1N A;  5H1S Q;  4B9M A;  3QEI A;  3HT3 A;  1NGD A;  3CCM N;  2IVP A;  1VSH A;  3B6P A;  3WEE A;  1B9D A;  2I5J A;  4CJK A;  3O1W A;  3SYZ A;  1BOT O;  3VES A;  4Y1C A;  3GG4 A;  1YJN N;  3KJV A;  3V9S A;  5GIO A;  1JCF A;  5AFU A;  5GAD P;  3AVI A;  1U45 A;  1NOZ A;  1W9H A;  1SKS A;  5M1N A;  4KHU A;  3PO4 A;  3VPZ A;  3LM2 A;  3RTV A;  3DXK A;  4DLG A;  4XH1 A;  3L2V A;  4AHC A;  1N34 K;  4JN4 A;  2EX3 A;  3CCE N;  5KGX A;  3U9D A;  4HUE A;  4R5P A;  4K8X A;  1ZBS A;  4B9U A;  2X78 A;  4CW7 B;  3F9M A;  1RBT A;  1JLA A;  1WBB A;  3HM9 A;  3GL1 A;  3LM9 A;  4JHD A;  4B3M K;  2XY5 A;  4W5N A;  3NGZ A;  5AQY A;  1KVB A;  5LL6 Z;  1Z25 A;  3ZEU B;  3A5O C;  4DG1 A;  3SQ0 A;  2OZS A;  1HKB A;  2OPR A;  4CES A;  2UUA K;  3NBP A;  4DTM A;  4IJA A;  4DFK A;  1WBD A;  3H08 A;  2G8K A;  4BRE A;  2QKB A;  4FM1 A;  1NK4 A;  3J81 O;  3UKR A;  2XO7 A;  1HQU A;  3KVG A;  1BHL A;  4CEB A;  3JS6 A;  1OKJ A;  4N41 A;  3HI0 A;  4H0X B;  2GUI A;  1RDB A;  2P5G A;  4KTW A;  1MDU B;  3SV4 A;  4DR4 K;  3ZSY A;  3VGM A;  4YOW A;  2UXB K;  2PBD A;  4Q5V A;  3RWU A;  1HYV A;  2P9L A;  3K57 A;  1KVC A;  1X9J A;  4DSF A;  2FSK A;  3VEV A;  3TWH A;  2Y1I A;  3M8P A;  1TK0 A;  3WNG A;  1NG9 A;  3SPZ A;  5HP1 A;  4HCB A;  4LF5 K;  4GNI A;  1JCE A;  4CFA A;  1GLJ O;  3LL3 A;  1XC3 A;  4DTX A;  5JMV A;  3HST B;  1K8K A;  3OVN A;  3T19 A;  3R1X A;  1JJ2 M;  3J7Z O;  1JLF A;  1HJO A;  4IO8 A;  4A62 A;  4EP4 A;  5C12 A;  1FW6 A;  3TSP A;  2JGU A;  2YKN A;  4DTR A;  5AQW A;  4FWL A;  4LSL A;  4ELU A;  1RGI A;  2YHX A;  3CMA N;  3M6G A;  1WLJ A;  1TK8 A;  2G8H A;  4CBU A;  3EKU A;  3WNF A;  3OYF A;  4RG8 A;  4GV6 A;  2P9K B;  1QVF M;  1A5W A;  3ITH A;  4WQ4 C;  2W6L A;  4MO5 A;  3VTI A;  1YIT N;  3CPW M;  4DU3 A;  4LF9 K;  5AZI B;  4BC3 A;  4E7I A;  4M3U A;  3J7Y P;  4NYF A;  3SLC A;  2YHY A;  3VQ8 A;  5J2N A;  1KSP A;  3SJH A;  5LMN K;  1SL0 A;  4M3W A;  4DR5 K;  4OPH A;  2G8U A;  1SZ2 A;  4FJI A;  3Q7B A;  3QBX A;  4CZE A;  3E01 A;  4NXN K;  1U2V A;  5ADX A;  4IDH A;  3C94 A;  2NUB A;  1D8Y A;  1ZBH A;  4PKH A;  2UUB K;  2I7N A;  1RTJ A;  3AVJ A;  1BO5 O;  3ATV A;  4FPB A;  4CHY A;  4CJQ A;  3K0S A;  5I9E B;  4LH4 A;  2FBY A;  4CF1 A;  4FWK A;  3WXL A;  2HHH K;  1EXQ A;  1VQO N;  4B3O A;  5CY4 A;  2RN2 A;  4GKJ K;  2KZZ A;  4DV2 K;  1JLE A;  3IAY A;  1LWC A;  4FSV A;  4B9S A;  4Y1D A;  2FLO A;  4DQQ A;  4DB3 A;  5JVG L;  4IEE A;  4FJ5 A;  5IWA K;  1TKX A;  4PKI A;  4FJK A;  3DLL L;  2YNI A;  2JLE A;  4FW2 A;  3CG7 A;  4PWD A;  1RT4 A;  3DXM B;  5FRM A;  4PQU A;  3NE6 A;  3NH2 A;  4C1N I;  4KHS A;  2Z1G A;  3MXI A;  3L3U A;  3OBY A;  2B6A A;  3CPE A;  3TAF A;  1YTU A;  3PIO L;  4NLB A;  3SAG A;  1LWF A;  3OW2 M;  1TYQ B;  3P1G A;  4JEP A;  4KFB A;  3AO2 A;  1HJR A;  4A61 A;  1VSM A;  4FWR A;  1RBV A;  4CIE A;  1DT9 A;  1D5A A;  3PLA A;  1GOA A;  3CD6 N;  2A41 A;  3T1A A;  2ZE2 A;  4IJN A;  4JKF A;  3D7E O;  4XH4 A;  4CEA A;  4ELV A;  1OVY A;  2XY7 A;  4Z4C A;  1F21 A;  3EZW A;  5F0X A;  4FLX A;  4DF4 A;  5I3U A;  4LC9 B;  2DFH A;  3D2F A;  3HL8 A;  2OAN A;  5AZJ A;  3VQA A;  1T7P A;  4J2B A;  2VGM A;  1QQN A;  3CJC A;  1Z6R A;  1BCO A;  4OO1 J;  4DFM A;  3CFR A;  1D9D A;  1S5J A;  3BF3 A;  1IBM K;  4IDK A;  3OJS A;  5HL7 L;  4M3Z A;  2E6L A;  2V51 B;  5AQH A;  3ULE A;  1OH5 A;  1NJI O;  5EXW A;  3VET A;  2OA8 A;  4Y0W A;  1T3V A;  3SK3 A;  4BRA A;  3LDP A;  3ZX3 A;  4H5N A;  3J8A A;  3AVA A;  1HNW K;  4DV7 K;  4MO4 A;  3B6O A;  1SAZ A;  2NRZ A;  3SMS A;  1E4F T;  5LMU K;  3CQX A;  3I0R A;  3KD1 E;  1C0G A;  4DSE A;  3TU5 A;  1EQY A;  4IEI A;  3O4W A;  4IZ9 A;  2ITM A;  3RMB A;  1QHA A;  4EHT A;  3PIP L;  3OYM A;  1JCG A;  4IBN A;  4BR9 A;  3QEP A;  3UIQ A;  3C6T A;  3VQD A;  3MAQ A;  4FVU A;  3ZET B;  3HTV A;  3W0L A;  3AY9 A;  5TKW A;  3FZK A;  3NMU A;  3DOK A;  5I42 A;  3TSQ A;  1U6Z A;  4F9O A;  2Q31 A;  1L3S A;  2NZT A;  4FL9 A;  1WAJ A;  5BRE A;  5C2F A;  1NGG A;  3PUF A;  1WUA A;  1GLL O;  4IKF A;  3RVC A;  3KLE A;  2IAJ A;  3QEV A;  2HF4 A;  3CJA A;  4M42 A;  3FFI A;  5EVZ A;  1W2B M;  2NRX A;  1NK8 A;  2VCP A;  2WUS A;  5KTQ A;  2Q97 A;  1G99 A;  1C0F A;  2VG7 A;  4KO0 A;  3JYT A;  4H0P A;  3BZC A;  3CCS N;  4BDY A;  1H1V A;  3T1Y K;  2Q0U A;  5KPZ A;  3SJJ A;  5M1F A;  2F8T A;  3OA9 A;  1RT5 A;  3TAR A;  1Q9Y A;  4WQ4 A;  4OJR A;  2WC9 A;  1G15 A;  3CJ7 A;  2A42 A;  3LDL A;  1NJX A;  1OH6 A;  3MXM A;  3CFO A;  2OZM A;  4KHW A;  2O4G A;  3CET A;  1U4B A;  3H45 C;  2DPN A;  3SAH A;  2OYQ A;  3O9R A;  4CZG A;  4M3Y A;  4BRQ A;  2WFB A;  1KD1 O;  1EKE A;  3P31 A;  3HSC A;  4JKG A;  3DXM A;  4RTF D;  3P38 A;  4Z4I A;  2WON A;  1NGE A;  4CD1 A;  3KIO A;  4O0J A;  5C25 A;  5F2R A;  3AA2 A;  4AH9 A;  4K8Z A;  5E41 A;  4B1W B;  2G8F A;  4J2A A;  5AQN A;  4DV6 K;  4JI5 K;  4N56 A;  3F2K A;  3OYC A;  3QET A;  4B9Q A;  4O0I A;  3MXJ A;  3MEE A;  4M41 A;  3D2E B;  5JLF A;  4DU1 A;  5DM7 L;  3KD5 E;  3QNO A;  2ZGZ A;  4RW8 A;  5KRT A;  1KAY A;  4FK0 A;  3THY B;  4FLZ A;  2VGN A;  4DLE A;  1JKH A;  4CEC A;  1W7A A;  1ASW A;  4K0K K;  3OYI A;  1NLV A;  3TAM A;  3SUN A;  4BRF A;  3D6R A;  4KRF A;  3P83 D;  3O3F A;  5AQL A;  2H3G X;  4O4G A;  4JRQ A;  3CCL N;  1FJG K;  3SBG A;  5AQZ A;  3SNN A;  1QSL A;  5ADX H;  2VG5 A;  4CHP A;  4CHN A;  1S1U A;  4LH5 A;  3TSU A;  1RT6 A;  1U49 A;  2BGG A;  2W6K A;  4CGD A;  3THX B;  3VQP A;  4IFY A;  2G8I A;  3G6E N;  2VWB A;  2J4R A;  4AHR A;  3AVK A;  3VGL A;  4B1X B;  4DF8 A;  3CIP A;  3K59 A;  1BA0 A;  1SL1 A;  3E66 A;  3I8D A;  3KKR A;  3QER A;  4NO7 A;  3SZ2 A;  1LW2 A;  3LWL A;  4BR5 A;  1WSG A;  3VQB A;  3WQT A;  1S6P A;  4C8O A;  3H3O B;  3RRH A;  4H5V A;  4CJW A;  3O5B A;  2CH6 A;  1X1P A;  3IRX A;  3E1Y A;  1VRU A;  3CCR N;  3VEX A;  2QXF A;  2ZJQ L;  1XNQ K;  4FPA A;  1VSD A;  3CCQ N;  4BRK A;  4M63 C;  2QEX N;  4L3Q A;  4CE9 A;  2NRR A;  3KTQ A;  2NLX A;  1KXP A;  4RWT A;  4B9N A;  4B9T A;  4B1V A;  3MN6 A;  1EO1 A;  4JHD B;  5BN8 A;  3V9W A;  1LCU A;  3T3F A;  3R6M A;  3V9Z A;  4YOT A;  2HHQ A;  3THX A;  4HTU A;  1HNV A;  1OH8 A;  3RMD A;  3WXJ A;  1VQN N;  2HVH A;  2HBK A;  4HWI A;  2BH1 A;  3E9L A;  5GAG P;  1SL2 A;  3ISN C;  4M3R A;  4CFC A;  4CJ7 A;  1GOB A;  4CZH A;  3CHW A;  3WNH A;  5GIN A;  2P9N B;  4F8R A;  3TI0 A;  3WXM B;  4C1N K;  1YHQ N;  4JLH A;  3HOS A;  2BAN A;  1BCM A;  1RTD A;  3QEX A;  1OH7 A;  4CBX A;  4JKH A;  3KK3 A;  1S1W A;  4XEI A;  4MQ3 A;  4CGH A;  4BC2 A;  1KCF A;  1VSK A;  3QIN A;  2E2Q A;  4W5Q A;  2FBV A;  4OPK A;  2P5O A;  5TKY A;  4CF9 A;  4M3T A;  5BRF A;  1S1T A;  4IOX A;  3V9U A;  4DUY K;  3AA4 A;  1TK5 A;  3H3N O;  4KH6 A;  4B8C A;  4CJL A;  5AJ3 K;  1LV5 A;  4CD3 A;  5KQ8 A;  3PX6 A;  3QO9 A;  3T69 A;  1EET A;  4H0T B;  1GLB G;  2KFN A;  2ZJP L;  2PYL A;  4LF7 K;  2HW3 A;  3CER A;  3ZEU A;  1UOC A;  3ASM A;  4DQR A;  5C42 A;  4JK7 A;  4DV4 K;  3O8M A;  3C0B A;  3AVC A;  4B1U B;  5AR0 A;  2FBT A;  3FFK B;  3KLG A;  2O8C B;  1TAQ A;  5C10 A;  1ZYQ A;  3ZSW A;  4LF8 K;  1TV6 A;  4DQS A;  4FVM A;  4B1Y B;  1L3V A;  4CK1 A;  1RIL A;  1EWQ A;  5AQJ A;  4Z4E A;  3AO3 A;  3O4Q A;  2QWP A;  4OGC A;  3AO5 A;  1S1V A;  1M90 O;  3M1F A;  4JD2 A;  2NRV A;  1WAF A;  4OX9 K;  1N5Y A;  4FWQ A;  5BPN A;  3E9P A;  2AJQ A;  1QSY A;  4DTN A;  4QAG A;  4OKE A;  3PSI A;  4C8N A;  4YHH K;  1K8A O;  4RW4 A;  3I55 N;  4FW1 A;  4CJE A;  3ZSR A;  1A5V A;  2QXL A;  4CZI A;  3G71 N;  4IWV A;  1QTM A;  4IFE A;  1Q82 O;  4DQP A;  4WQ5 A;  2OTJ N;  3HPG A;  5FRO A;  4EFH A;  3HBT A;  5AQT A;  1YUW A;  3WQU A;  2XHB A;  3VGK A;  2O8B A;  2O8E A;  4C8M A;  4CEZ A;  1RBR A;  2O8D A;  4IFV A;  1HNX K;  3QNN A;  4DSI A;  1NGJ A;  3ID6 A;  4CBW A;  4YDU A;  4HUG A;  3H1Q A;  4B3S K;  1NJY A;  4LFC K;  4CJ4 A;  1J9A A;  1HNI A;  3QES A;  4FJL A;  4AM6 A;  1SQK A;  3O9S A;  5C0Y A;  3NH1 A;  3MDQ A;  1WSE A;  3H6E A;  4C8K A;  1BL3 A;  5C24 A;  5JS1 A;  3IS9 A;  1N32 K;  2ZD1 A;  3THW A;  1N33 K;  3VEO A;  2E2P A;  3OYH A;  4I9Q A;  3VTH A;  3HZ6 A;  3ZCM A;  4H5R A;  2O8D B;  3F9K A;  1RFQ A;  4K43 A;  5HRR A;  2O8F B;  1U04 A;  3WXK A;  4JNE A;  2O8E B;  4YY3 K;  1REV A;  4FO0 A;  1QZ6 A;  1K73 O;  4DFJ A;  3OYA A;  4R79 A;  5KI6 A;  3MN7 A;  3VQ7 A;  3OYB A;  3CJB A;  3UKU B;  1MWK A;  4JKC A;  3MED A;  1NK5 A;  5M1K A;  3JSM A;  2YKM A;  1KC8 O;  5T7B A;  1BIZ A;  3SI6 A;  5HRS A;  5EOY A;  2VQF K;  3VQC A;  2P9I A;  4FWS A;  3CF5 L;  4JI6 K;  3U4L A;  1J5O A;  1K9M O;  2P1J A;  3D45 A;  2GBZ A;  1VQL N;  1JL2 A;  3LDQ A;  4WCE L;  1TKT A;  4GV9 A;  1FKO A;  3VEW A;  4DMN A;  5CE3 A;  1YT3 A;  2DFF A;  4WFA L;  1DLO A;  1XC9 A;  1YI2 N;  5C15 A;  1D4X A;  2DY4 A;  4WQ5 C;  3ZSX A;  1IH7 A;  1BWF O;  4L8R B;  3M8S A;  3I0S A;  5AQP A;  3TAB A;  4CZL A;  4DQ8 A;  1KLN A;  4CZF A;  2QWQ A;  1LAW A;  1BDG A;  2B5J A;  1U47 A;  2G8W A;  3VA0 A;  3L4Q A;  1VQ8 N;  3U8X A;  4ICL A;  3LPT A;  4DS4 A;  1BQM A;  2HND A;  1WSI A;  4I6M B;  3OHR A;  2D0O A;  1ATN A;  3TTC A;  4OLA A;  3VER A;  1BGX T;  4WFN L;  1KAX A;  3H46 O;  3BGR A;  3IKM A;  2HST A;  4CGF A;  4WE1 A;  3BUZ B;  3SUO A;  2WOM A;  1TUY A;  1IKY A;  2NNW A;  3F73 A;  3VQ6 A;  2YHB A;  2P9P A;  3NCI A;  3CCV N;  1FXX A;  4A5A A;  4KHY A;  4MLE A;  4GKK K;  1I3A A;  1CLQ A;  2HHU A;  5AQK A;  3AAQ A;  2E1Y A;  2UU9 K;  3HP6 A;  1HPZ A;  3L2R A;  3SV3 A;  2E2N A;  4CJR A;  2VQE K;  1R59 O;  2E4L A;  4I9L A;  1CZ9 A;  3O1B A;  3V6D A;  2D0A A;  3V81 A;  1N6Q A;  4ILG B;  1U2V B;  5EY4 A;  3A5M C;  1NWK A;  3MX5 A;  4DS5 A;  4JK9 A;  2QWM A;  2IGI A;  5CR4 A;  3QIP A;  5FLX O;  3FLC O;  1GLC G;  3B8A X;  1T6D A;  4H4O A;  4I7F A;  4FJH A;  4J2E A;  4RW9 A;  3THY A;  1T8E A;  3L3V A;  4QS9 A;  5BR8 K;  1VQ7 N;  2XY6 A;  3D2E A;  3I8B A;  2P9K A;  3EZ5 A;  3ENH A;  2B4J A;  3C65 A;  4UY8 O;  3ZSZ A;  4BRC A;  4BRN A;  4MDB A;  1FKP A;  3LWM A;  1TKD A;  3L2W A;  4BRL A;  4CF2 A;  3VF4 A;  1R0A A;  3DLB A;  3PO5 A;  4CJ3 A;  2W41 A;  3OS1 A;  5CHI A;  2PFU A;  4JKB A;  1IKW A;  3K58 A;  4FLW A;  4RCH A;  2I7P A;  1XMO K;  2PY5 A;  4BG8 A;  4PL8 A;  1SS6 A;  3L2U A;  3K5L A;  3KHY A;  3G4S N;  2HBL A;  4BC4 A;  3HPO A;  3AVM A;  4AM7 A;  1B92 A;  3C7N A;  4BDZ A;  1Q9X A;  2QWO A;  4OVL A;  4HCC A;  4GW6 A;  2D0B A;  4X64 K;  4DTS A;  1V4T A;  3AV9 A;  3BF1 A;  5BN9 A;  4OLB A;  2RKI A;  4BRO A;  3ZT4 A;  1GLA G;  3AVF A;  2X6S A;  1QS4 A;  5FPD A;  1JXE A;  1ASV A;  5M1O A;  3MCA B;  4KKO A;  3OYL A;  1RDW X;  2ZF5 O;  3ENO A;  4XH5 A;  3AVG A;  2HHT A;  3MWT A;  1EP4 A;  2Q36 A;  4FZX C;  1TAU A;  1NK7 A;  4H0O A;  3DOL A;  3RSE B;  4FLV A;  3OBW A;  2QWN A;  1XNR K;  4BRP A;  5AQU A;  2OPS A;  2FC0 A;  3ZET A;  3P5J A;  3M8Q A;  3VQE A;  3DM2 A;  3EN9 A;  5EU7 A;  4A57 A;  3PV8 A;  1ZBI A;  1YIJ N;  1ZBU A;  1DEJ A;  4B8A B;  4FK2 A;  3DRP A;  1IKX A;  4IOC L;  3THV A;  1NGB A;  3T7Z A;  1NJW A;  1GLF O;  4OPA A;  4CK2 A;  4IG3 A;  4HUF A;  3SPY A;  4NCG A; 
#chains in the Genus database with same CATH homology
 2ZJQ L;  3F9M A;  2A5X A;  4FWN A;  3AGK A;  3K9J A;  4FPA A;  1T6C A;  1NGC A;  1T44 A;  2QTD A;  5M1P A;  3CCQ N;  5AQG A;  4BRK A;  3GL1 A;  3LM9 A;  4M63 C;  4BVO A;  2QEX N;  4JHD A;  5KPR A;  3FE1 A;  4L3Q A;  2P9N A;  5AQY A;  2F7T A;  4H0V B;  4JKG B;  3DXK B;  3Q7C A;  2NRR A;  5AQO A;  4O5F A;  2NLX A;  3ZEU B;  3A5O C;  3VF6 A;  1KXP A;  4RWT A;  1HKB A;  5AQQ A;  4C23 A;  4B1V A;  3MN6 A;  1EO1 A;  4JHD B;  4YDU C;  3O9Q A;  4IJA A;  2YHW A;  5BN8 A;  3DWL A;  1LCU A;  3GOI A;  3R6M A;  4BRE A;  4BQL A;  5AQS A;  4YOT A;  3WXI A;  3AGR A;  3UKR A;  4BVP A;  3WXJ A;  1VQN N;  2HBK A;  1HUX A;  3KVG A;  3A5L C;  2BH1 A;  4HWI A;  3E9L A;  3HM8 A;  3ID8 A;  4WYB A;  5GAG P;  1QQM A;  2UYT A;  4H5T A;  3JS6 A;  3LDN A;  4CJ7 A;  3CHW A;  1OKJ A;  2E88 A;  1YF5 L;  2P9N B;  4CZH A;  5GIN A;  2FF6 A;  3HI0 A;  4H0X B;  4A5B A;  1HKC A;  1YVN A;  1HLU A;  3G25 A;  3WXM B;  4C1N K;  4DCH A;  1YHQ N;  1NBW A;  3O6W A;  3HOS A;  1ILY A;  4FOE A;  3CJ1 A;  1MDU B;  3VGM A;  4YOW A;  3CI5 A;  2PBD A;  4A2B A;  2P9L A;  2Q2R A;  4CBX A;  4JKH A;  2D1K A;  3VOV A;  4XEI A;  1X9J A;  3FZH A;  4E1J A;  3CJ9 A;  4BC2 A;  2E2Q A;  5TKY A;  2FSK A;  3GBT A;  3HRG A;  5BRF A;  4IOX A;  4NLC A;  3VEV A;  4BRI A;  1VQM N;  3H3N O;  2WBN A;  2W40 A;  2A6A A;  2F9T A;  3VEZ A;  4GNI A;  4KH6 A;  5AQI A;  1JCE A;  2FSN A;  3JXU A;  3ZYY X;  1GLJ O;  4CD3 A;  4U7B A;  3LL3 A;  5KQ8 A;  4BR7 A;  1XC3 A;  5JMV A;  2E8A A;  3T69 A;  1K8K A;  3EO3 A;  4H0T B;  5KQD A;  1GLB G;  2AA4 A;  3R1X A;  2ZJP L;  1JJ2 M;  3J7Z O;  1HJO A;  4IO8 A;  5FPN A;  3CER A;  4A62 A;  5C12 A;  4YOU A;  1ZXO A;  3ZEU A;  3TSP A;  1NGF A;  3I33 A;  4JK7 A;  4O8U A;  5AQW A;  4FWL A;  3O8M A;  1RGI A;  2YHX A;  3CMA N;  2YJF A;  3C0B A;  3M6G A;  2ZJR L;  2GEM A;  3O80 A;  5AR0 A;  1BA1 A;  4B1U B;  4CBU A;  3EKU A;  2RE2 A;  2A40 A;  3FFK B;  5FPE A;  3DJC A;  5C10 A;  2ASP A;  2D0P A;  4GV6 A;  5GAH P;  5AZJ B;  2QW9 A;  1Q18 A;  2P9K B;  4FWM A;  1QVF M;  5MLC Q;  4JKE A;  4WQ4 C;  2YJE A;  5E26 A;  4B1Y B;  2CGK A;  4FWP A;  2ZGY A;  5AQJ A;  4MO5 A;  3VTI A;  1YIT N;  2QWP A;  3CPW M;  5AQM A;  5AZI B;  3W3D A;  4AF1 A;  1M90 O;  3M1F A;  3L6Q A;  4BC3 A;  4JD2 A;  2NRV A;  4JK8 A;  1ATR A;  4FWQ A;  5BPN A;  1RDU A;  3SLC A;  3E9P A;  3M3Z A;  4GV3 A;  2YHY A;  2FXU A;  3CC4 N;  3SJH A;  4U67 L;  1K8A O;  3I55 N;  3NVM A;  4OPH A;  1SZ2 A;  3FZF A;  3Q7B A;  2QXL A;  3QBX A;  4CZI A;  4CZE A;  3G71 N;  4IWV A;  3TTD A;  4IFE A;  1U2V A;  2KLA A;  5ADX A;  4IDH A;  1Q82 O;  4WQ5 A;  2OTJ N;  4YOX A;  4EFH A;  3HBT A;  5AQT A;  1YUW A;  3WQU A;  4H03 B;  4PKH A;  3VGK A;  4K25 A;  5AQR A;  2I7N A;  2JWK A;  4ISE A;  3SBT A;  3SMP A;  1BO5 O;  3ATV A;  4FPB A;  3DAW A;  2V7Z A;  2NRH A;  2P9L B;  1NGH A;  4BR4 A;  5I9E B;  2E20 A;  3H1V X;  1NGJ A;  3ID6 A;  1TUU A;  4FWK A;  3WXL A;  2E1Z A;  4CBW A;  4YDU A;  3H1Q A;  1VQO N;  3CME N;  1ZC6 A;  3VEY A;  1HKG A;  3F5T A;  3IUC A;  4BY9 C;  4ISF A;  2P9S A;  4FSV A;  2FLO A;  5C2D A;  2D4W A;  1S22 A;  3A8Y A;  3C7N B;  3KWG A;  4DB3 A;  5JVG L;  4AM6 A;  1NGI A;  1SQK A;  2P9U A;  3O9S A;  1HPM A;  4IEE A;  3R9P A;  5C0Y A;  5FPM A;  4PKI A;  3MDQ A;  1K8K B;  3H6E A;  1DKG D;  2QWL A;  3DLL L;  3HOT A;  2BUP A;  2P9S B;  3EKS A;  3CQY A;  1VQ4 N;  5JIC A;  1QQO A;  3DXM B;  1VQ9 N;  4K41 A;  3FR0 A;  1P90 A;  4BGB A;  4A59 A;  3VEO A;  3WEE B;  2E2P A;  3VTH A;  3HZ6 A;  1MA9 B;  1IJJ A;  3UE5 A;  1TYQ A;  4H5R A;  4C1N I;  1CZA N;  3E9O A;  4NB4 A;  4MLH A;  4EAH D;  1RFQ A;  3OBY A;  4K43 A;  4QS7 A;  3CPE A;  3KZB A;  3P4I A;  4B1Z A;  2GWK A;  3WXK A;  3PIO L;  4JNE A;  2V7Y A;  4NLB A;  4BRG A;  4FO0 A;  4Z94 A;  1QZ6 A;  2IVN A;  3SAG A;  1K73 O;  2ASO A;  2A3Z A;  3EE8 A;  3OW2 M;  1TYQ B;  4JEP A;  4R79 A;  4M7Y A;  1ATS A;  4ILH A;  4BRH A;  5AFU H;  3AAP A;  4A61 A;  4BRM A;  3L0Q A;  3ZX2 A;  4FWR A;  1KQS M;  1NMD A;  3MN7 A;  4FOI A;  5GIP A;  3CJB A;  3ZX0 A;  3UKU B;  1MWK A;  1DT9 A;  1BU6 O;  3AAR A;  3MWP A;  4JKC A;  2ASM A;  4BQZ A;  1Q81 O;  2OTL N;  2CGL A;  5M1K A;  1V4S A;  3PLA A;  1KC8 O;  3IFR A;  3CD6 N;  2A41 A;  2FSJ A;  3VEN A;  2HOE A;  3CCU N;  5EOY A;  4IJN A;  4JKF A;  3D7E O;  3LDO A;  4XH4 A;  5BPM A;  5LY3 A;  2P9I A;  4FWS A;  3QDK A;  4IXC A;  1OVY A;  3U4L A;  1S3X A;  3CF5 L;  4BR2 A;  1K9M O;  4PHT X;  1VQL N;  3LDQ A;  3EZW A;  3MCP A;  4WCE L;  5F0X A;  1E4G T;  5ELZ A;  4LC9 B;  2BTF A;  4WF9 L;  1MWM A;  3VEW A;  4GV9 A;  3D2F A;  5CE3 A;  2OAN A;  4H5W A;  5AZJ A;  4WFA L;  1YI2 N;  3KWI A;  3NVK A;  5C15 A;  2VGM A;  3QIC A;  3C6A A;  4YOR A;  1D4X A;  1IG8 A;  1YXQ A;  3MX2 A;  1QQN A;  3CJC A;  4WQ5 C;  5M1Q A;  4IO9 L;  1Z6R A;  4OO1 J;  1HX1 A;  4H0Y B;  5F1X A;  5JLH A;  2AP1 A;  3I56 N;  3ATU A;  1BWF O;  3BF3 A;  3BP8 A;  1X3N A;  2P9U B;  1DGK N;  4GY2 B;  5AQP A;  4CZL A;  4DQ8 A;  2YI1 A;  3QFP A;  4CZF A;  5HL7 L;  4JD2 B;  1Z05 A;  2V51 B;  3KK7 A;  5AQH A;  1VAZ A;  3UKU A;  3ULE A;  1VQ6 N;  2QWQ A;  1BDG A;  4EIA A;  1NJI O;  5EXW A;  3VET A;  3L4Q A;  3TTF A;  1VQ8 N;  1Q7Y O;  4Y0W A;  3U8X A;  1T3V A;  1XQS C;  2KHO A;  3FZL A;  3SK3 A;  4BRA A;  3LDP A;  5KPT A;  4I6M B;  3ZX3 A;  3OHR A;  3J8A A;  4H5N A;  2D0O A;  1ATN A;  3TTC A;  1O13 A;  3VER A;  4WFB L;  2GEL A;  4MO4 A;  2GWJ A;  4WFN L;  1KAX A;  1SAZ A;  2NRZ A;  3H46 O;  2HST A;  3IKM A;  3MN5 A;  1E4F T;  3O9T A;  3R3L A;  3SMS A;  4BR0 A;  3U9Z A;  3CQX A;  2QWR A;  1C0G A;  2HF3 A;  3BUZ B;  4EHU A;  3TU5 A;  1EQY A;  4IEI A;  1TUY A;  3O4W A;  3QB0 A;  4IZ9 A;  4KH4 A;  1QHA A;  5EX5 A;  2ITM A;  4EHT A;  3PIP L;  3QFU A;  2NNW A;  1JCG A;  2Q0R A;  4BR9 A;  5BPL A;  3SAF A;  5HOO A;  4J8F A;  2HBJ A;  2JWL A;  2RHK A;  5LJW A;  4FVU A;  4HTL A;  2P9P A;  3ZET B;  3CCV N;  4I6M A;  3K9K A;  3HTV A;  3W0L A;  3EL2 A;  1Y64 A;  3BEX A;  4CZJ A;  3AY9 A;  3MK6 A;  4A5A A;  4G9Z A;  4MLE A;  5TKW A;  5JVH L;  3FZK A;  2HMP A;  4IOA L;  5AQK A;  3AAQ A;  3NMU A;  2E1Y A;  3TSQ A;  1U6Z A;  4BGA A;  4F9O A;  4O8K A;  2E2N A;  1VQK N;  1R59 O;  1XUP O;  3A5N C;  3O1B A;  2Q31 A;  4ILG B;  1U2V B;  5EY4 A;  3A5M C;  3CCJ N;  2NZT A;  1NWK A;  2CGJ A;  3MX5 A;  4FL9 A;  4JK9 A;  5LJV A;  2QWM A;  2YCH A;  5BRE A;  5BR9 A;  5CR4 A;  3FGU A;  5C2F A;  1NGG A;  3FLC O;  1GLC G;  1WUA A;  2QM1 A;  1GLL O;  4DHY A;  3RVC A;  3B8A X;  3VMF B;  4ISG A;  1KAZ A;  1T6D A;  2NRT A;  1GLE G;  2HF4 A;  3CJA A;  3FZM A;  1W97 L;  5EVZ A;  5DM6 L;  2GTD A;  1W2B M;  2NRX A;  2VCP A;  4PL7 A;  2WUS A;  4CZM A;  2Q97 A;  3QML A;  1ESV A;  1G99 A;  1C0F A;  4QS9 A;  4JKA A;  4H0P A;  3CCS N;  1VQ7 N;  1H1V A;  2P9I B;  1LOT B;  3D2E A;  3I8B A;  2Q0U A;  5KPZ A;  1S72 N;  2P9K A;  5M1F A;  2QI2 A;  3R8E A;  3ENH A;  3N4P A;  2VYP A;  4DKW A;  1Q86 O;  1VQ5 N;  3WT0 A;  3OA9 A;  3C65 A;  2ZWH A;  1M1K O;  4BC5 A;  2V52 B;  4YOY A;  4UY8 O;  4WQ4 A;  4BRC A;  4BRN A;  5AQV A;  4MDB A;  2WC9 A;  3CJ7 A;  2YX6 A;  2IIR A;  2A42 A;  3LDL A;  4FWO A;  3CET A;  2IVO A;  2KKZ A;  4GVE A;  4CZK A;  1WOQ A;  2FF3 B;  3H45 C;  2DPN A;  3SAH A;  2E2O A;  2PAV A;  4BRL A;  3VF4 A;  3O9R A;  3IDH A;  4CZG A;  5BRD A;  4CI6 A;  4BRQ A;  2W41 A;  2WFB A;  1KD1 O;  3CXC M;  3ULE B;  2GUP A;  2PFU A;  5CHI A;  4JKB A;  3P31 A;  5AQF A;  3HSC A;  4JKG A;  3DXM A;  3ENB A;  4RTF D;  4RCH A;  5AQX A;  4CD1 A;  1GLD G;  3P38 A;  1YAG A;  2I7P A;  4BG9 A;  3UKR B;  1NGE A;  3GE1 A;  4JKD A;  4PKG A;  4PL8 A;  1SS6 A;  3WUH A;  4BG8 A;  4BRD A;  3KHY A;  4KBO A;  5F2R A;  3G4S N;  4B1W B;  2HBL A;  5E84 A;  1YJW N;  5AQN A;  4BC4 A;  3F2K A;  3M5R A;  4AM7 A;  3GDQ A;  3D2F B;  4B9Q A;  3C7N A;  4YOV A;  5JLF A;  3MMV A;  1QZ5 A;  2QWO A;  3D2E B;  1BG3 A;  1YJ9 N;  5DM7 L;  4ILJ A;  2ZGZ A;  2QA4 N;  1V4T A;  4QS8 A;  1KAY A;  4M7X A;  3BF1 A;  5BN9 A;  3S41 A;  2GX9 A;  3P39 A;  4BRO A;  4MDA A;  1GLA G;  3QBW A;  1NM1 A;  2VGN A;  3MN9 A;  5FPD A;  3UB5 A;  2CH5 A;  1BUP A;  2EWS A;  5M1O A;  3MCA B;  3IMX A;  1NLV A;  5BRH A;  1RDW X;  4BRF A;  2ZF5 O;  3O08 A;  3TPQ A;  4KH5 A;  3CC7 N;  3D6R A;  3ENO A;  2Q1N A;  4XH5 A;  5H1S Q;  5AQL A;  2H3G X;  3CCL N;  1NGD A;  2NRW A;  3SBG A;  3CCM N;  5AQZ A;  2IVP A;  3MWT A;  2Q36 A;  3EE9 A;  3WEE A;  5ADX H;  3C6H A;  3O1W A;  2F9W A;  4H0O A;  3CC2 N;  1X3M A;  3RSE B;  3TSU A;  1VQP N;  5GAE P;  3O9U A;  1J6Z A;  1BOT O;  3VES A;  3OBW A;  2QWN A;  3GG4 A;  1YJN N;  4BRP A;  1P8Z A;  3G6E N;  5AQU A;  2VWB A;  2J4R A;  5GIO A;  1JCF A;  2P9P B;  3VGL A;  3ZET A;  4B1X B;  3CIP A;  5AFU A;  1BA0 A;  5GAD P;  1N8R O;  3E66 A;  5M1N A;  3EN9 A;  3RSE A;  3A0I X;  3VF2 A;  4A57 A;  4NO7 A;  3VPZ A;  3LM2 A;  5B8H A;  1YIJ N;  3DXK A;  1DEJ A;  4JAX A;  3WQT A;  4BR5 A;  5AZI A;  4XH1 A;  4A2A A;  3H3O B;  4IOC L;  3L4I A;  1NGB A;  4H5V A;  4JN4 A;  3T7Z A;  3CCE N;  3N4Q A;  3O5B A;  3U9D A;  1NGA A;  2CH6 A;  1GLF O;  4OPA A;  4K42 A;  2HBM A;  1QVG M;  3E1Y A;  1ZBS A;  3CCR N;  3VEX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...