3CF5L

Thiopeptide antibiotic thiostrepton bound to the large ribosomal subunit of deinococcus radiodurans
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
104
structure length
104
Chain Sequence
b'RRKLRTRRKVRTTTAASGRLRLSVYRSSKHIYAQIIDDSRGQTLAAASSAALKSGNKTDTAAAVGKALAAAAAEKGIKQVVFDRGSYKYHGRVKALADAAREGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S RIBOSOMAL PROTEIN L33
publication title Translational Regulation Via L11: Molecular Switches on the Ribosome Turned on and Off by Thiostrepton and Micrococcin.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 17
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2008-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00861 Ribosomal_L18p Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.100 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3cf5L01
1Q86O 1KQSM 3CF5L 3CCRN 5H1SQ 1VQMN 1VQ5N 5GADP 4WFNL 4U67L 5JVGL 4WF9L 3CC2N 1KD1O 1VQON 3CCQN 1QVGM 1YJWN 4WFBL 3CD6N 5GAGP 3CC7N 2ZJPL 1VQ6N 1K73O 1N8RO 1JJ2M 3I56N 1YJNN 3PIOL 1M90O 3PIPL 2ZJRL 3CCEN 1YITN 3CCLN 2ZJQL 4WFAL 2QEXN 5MLCQ 3CXCM 5GAHP 1NJIO 5DM7L 1Q82O 3I55N 1ILYA 3CCUN 3CMAN 3J7ZO 1YHQN 1YJ9N 1M1KO 3CCJN 1VQKN 3CCMN 1Q81O 5GAEP 1K9MO 1VQLN 1YIJN 3CPWM 2OTLN 4IO9L 1KC8O 3DLLL 3CCSN 5JVHL 1OVYA 5DM6L 3G4SN 4IOAL 3CC4N 2OTJN 1YI2N 1S72N 4WCEL 3G6EN 1VQ8N 4UY8O 1VQNN 1VQ7N 2QA4N 5HL7L 1VQPN 1VQ9N 3CCVN 1W2BM 1Q7YO 3OW2M 1QVFM 1VQ4N 4IOCL 3CMEN 3G71N 1K8AO
chains in the Genus database with same CATH superfamily
3M6GA 3IDHA 1RILA 1F21A 1WSFA 3DLHA 1KLMA 4OKEA 3RR7A 1VQ5N 1HKCA 5GADP 4I6MA 1SV5A 4FVUA 2D0BA 2PYJA 4ILGB 4WFBL 1YVUA 4KHYA 1B9DA 3L2UA 3I8DA 2VQEK 4KHQA 5AQXA 3N4QA 2RHKA 3F5TA 3WXIA 3AGKA 4CK3A 3GOIA 3PIOL 1M90O 1ZBIA 4PQUA 4LFAK 4I7FA 4EFHA 2GELA 2O8BA 2FSNA 4CZJA 3G10A 2KZMA 3D2FB 4DF8A 2YX6A 1NGDA 4YY3K 4CJ3A 4CJTA 4E7KA 3GL1A 4CI6A 3O9UA 1A5XA 4FOIA 2QWPA 5KQDA 1WUAA 1TKZA 3KK7A 2EWSA 1NKCA 4J2AA 3AVFA 4YOXA 1KCFA 5C10A 3ID8A 2G8VA 3PX6A 2FF3B 4I9QA 3L2RA 1QQCA 3KIOA 4CHZA 3P31A 2AJQA 3SAHA 3UKUA 4YOTA 4CK2A 5DM6L 3C7NB 3WNEA 5J2QA 4EIAA 4E7IA 5C24A 1HJRA 3J8AA 3IUCA 4DR3K 3ZSQA 1FKOA 2ZD1A 3IRXA 5TKWA 3QNNA 4H5TA 3J7YP 5AQZA 2XY7A 4DF4A 4JI6K 3K57A 4PWDA 5JS2A 4RWTA 3CJCA 4EZ6A 2NRVA 3AAPA 3HVTA 1CZBA 4JKHA 3FFKB 1K8KA 2QTDA 3EE9A 1X9JA 2P51A 3VTIA 3OW2M 2BTFA 2P5GA 2XO7A 4CEQA 2XHBA 1MWMA 1RTDA 1REVA 3S41A 4E7LA 3M8QA 4Z4EA 3QEIA 5AQQA 1TYQA 5ELZA 1TVRA 2I5JA 1NGAA 1SZ2A 3O1WA 2HVHA 3ENHA 3OBWA 5BRHA 5E41A 5E84A 4Y0WA 1BU6O 4FJHA 4H5VA 4CJQA 4CJLA 4QS7A 2ZJPL 2YHBA 3FZKA 3CI5A 2DY4A 3L3UA 3LL3A 3WUHA 4CGIA 4IKFA 4RTFD 3VERA 4BR7A 1XNQK 3H3NO 3I56N 3NVKA 3UB5A 2HNDA 3U8XA 1IJJA 1BQNA 1Z25A 4AM6A 4B1XB 1S22A 4CZIA 5B8HA 4CGDA 3AA4A 5HP1A 1YT3A 1TL3A 2G8WA 4IWVA 1C0GA 3MN7A 4FJ9A 4DQSA 3CXCM 3WXMB 1P90A 3RSEA 3HP6A 3EN9A 4OPJA 3DMJA 3HOTA 1NLVA 3DWLA 2P9NA 4AHSA 1LWEA 3SLCA 1L5UA 1B9FA 5BREA 1IBLK 3ZLJA 5LMUK 3RMBA 4BREA 4FJ7A 5KGWA 3DXKA 4FZZA 1DTQA 4M7XA 4B08A 1D9FA 3O08A 4N41A 3OA9A 4H0TB 4BRPA 4KHNA 3FZMA 5EX5A 1XMQK 1BCOA 4PHTX 3M5RA 1GLBG 3VF2A 4JS4A 4DFMA 4BWMA 2E2OA 1EX4A 2WONA 4OO1J 1ATSA 2HF4A 2GWKA 1W97L 2ZF5O 4JI5K 4JKFA 1U45A 3HI0A 1RT7A 5GINA 1QSSA 3BGRA 4BRIA 1TK0A 3ZETB 4BR0A 3M8SA 1CLQA 1S3XA 1TAQA 4JI8K 1Q7YO 4MDBA 3HJFA 3UIQA 3VGKA 3QMLA 3SBTA 2IIRA 1ASWA 4H5WA 4BRFA 3KK2A 3U9ZA 4MO4A 1XC9A 3Q7CA 4DHYA 2G8HA 4IDKA 1Y97A 3P38A 5JVGL 5KPRA 4DTNA 3TAFA 2WC9A 3M1FA 1S6QA 1HX1A 3T3FA 4NCAA 3BZCA 2YNHA 4AQYK 4DR7K 3A5OC 1BDGA 3CC7N 5M1QA 1NG9A 2YHYA 1K73O 3MXJA 3AAQA 4K43A 4OKJA 4BC3A 5HRSA 4YOUA 5BR8K 3E01A 3FZHA 4HTLA 3ULEA 3FGUA 2Z1HA 3G25A 3A5NC 5C2FA 3ZT4A 3WXLA 3IAYA 4CGGA 2ZJQL 5HRNA 4WYBA 4FXDA 2D0AA 1EQYA 3C7NA 5MLCQ 3I0RA 5AQFA 5M1FA 1S9EA 1Q9XA 5DM7L 4E89A 2W41A 2XY6A 1X3NA 4JNEA 1HNZK 3KKRA 1LWCA 1K6YA 1VQKN 2BE2A 4BC5A 4YDUC 2NZTA 1CZAN 1YIJN 3CPWM 2YHWA 2UYTA 1HMVA 5CZ2A 1BL3A 3ENOA 1Z26A 3HVRA 2O8EB 3QIOA 4C1NI 3CC4N 4JKGB 3OS1A 1VSJA 4CHOA 2Y1IA 3OJSA 3IMXA 4WCEL 4HUEA 1LOTB 3TSPA 1KRPA 2Q1NA 1VK0A 2DFFA 1VQ7N 1HKBA 4F9OA 1BO5O 2NRZA 1S1WA 3O9SA 2QA4N 5AQYA 4BRGA 4BVPA 1KFSA 3DLGA 4CEAA 4LFCK 3QESA 1P8ZA 4LC9B 3D0PA 1GOCA 4C8KA 3A0IX 2AA4A 4WQ5C 1UA0A 1CXUA 1V4TA 1UOCA 4KV8A 3CMEN 2HBMA 2F9TA 4YOWA 5C42A 3OHRA 4GV6A 3NBPA 4DUYK 1RDCA 1X9MA 1ATNA 1OVQA 4WF9L 1J5OA 1VSDA 4EHTA 3E9PA 5FPEA 2FBYA 4OKKA 5AQWA 5I9EB 4DFKA 4E7HA 4GMJB 2QWQA 1J54A 3DM2A 4ZTFA 2E1YA 1UAXA 4FJNA 1S1TA 3AVBA 3TSUA 1ZC6A 3V9UA 1EETA 1TAUA 1CZ9A 3FR0A 5A2QO 2RPIA 4J2DA 4CJFA 4UQGA 1N6QA 3J81O 3KLIA 4O55A 4JK8A 2O8DB 1S5JA 2X78A 2HHUA 5AZJB 3VEVA 3HM8A 4DCHA 2DTUA 4LFBK 4IFYA 4FW2A 5GIOA 1ZBUA 4K8ZA 5AQJA 2FLOA 5ADXA 1Q81O 1KVCA 4DV6K 3B6OA 5AQRA 4I6MB 4M3TA 2NRTA 4BR2A 4CGHA 4CZLA 1NMNA 3CCSN 5AQGA 4NYFA 3L3VA 2YNFA 3SCXA 4Z4GA 2UXCK 1GLDG 4KHWA 4GY2B 4FWKA 3ZYYX 3R8EA 2OZMA 4GNIA 1Q8IA 2E6MA 4DS4A 5KTQA 4BRDA 5SZTA 2O8BB 1XQSC 5ADXH 3AVHA 4B9NA 3AVKA 3H3OB 4E1JA 3HOSA 1YVNA 4DTUA 1RBTA 3VQEA 4EP5A 1U49A 5BRFA 1Q18A 1GLLO 4CF2A 4W5QA 2ETJA 4J2BA 2F4VK 4DMNA 5CE3A 3T1YK 2GUIA 1Q86O 1XHXA 2B5JA 3BZKA 4HHTA 3CM5A 2X6SA 3ZX0A 2YJEA 3LM2A 4CGJA 2B6AA 3KLGA 5CY4A 4LSLA 4NLBA 4WQ4A 1RTIA 2NNWA 3UKUB 3K0SA 3VESA 4C8MA 4CJPA 2Y1JA 4CHNA 3SQ0A 1L3TA 3VA3A 2P9UA 2PBDA 2NRWA 4KREA 4B1ZA 4BR9A 4FJXA 2DFHA 2E2PA 1R0AA 3QIPA 2YNGA 1NBWA 4E1NA 4LF8K 2OPSA 1WLJA 2BGGA 4DG1A 3VF6A 3OYLA 1WSEA 2D1KA 3MMVA 2Q36A 2WUSA 2W40A 1QQMA 3OVNA 1N32K 3TTFA 4DQPA 2V7YA 5C25A 4JKGA 3I55N 4CHPA 5F2RA 5EY4A 4AHTA 4MQ3A 5AQHA 3CCJN 2UUAK 4FO0A 3C6AA 4J2EA 1VSKA 4IJAA 1NGGA 1JLAA 1TYQB 4FW1A 4CFDA 4IDHA 4LH4A 1GOBA 3AVJA 3NGZA 3BF3A 4XH4A 4FLXA 4JK7A 4FJJA 3RR8A 2VYPA 2ZE2A 4DTJA 3TR8A 3CFPA 2W6KA 1CXQA 2D0OA 2E4LA 4Z4CA 1TUUA 2QWNA 3LZIA 3WQTA 4BROA 2KLAA 4CFCA 3CFOA 4O8UA 1XWLA 3P83D 4CK1A 3CM6A 2E2QA 3TAEA 3DLBA 2O8FA 3O5BA 2FF6A 3RSEB 3O6WA 4EAHD 3OYDA 3G71N 4EHUA 2VGNA 2A3ZA 2QKBA 2J4RA 1V4SA 3D2EB 3DXKB 1TK5A 4NO7A 1RBVA 4FM2A 4IBNA 3S3OA 3TANA 1C0TA 1BIZA 3CJBA 4YOVA 4YHHK 3DAWA 3TWHA 4KHPK 4BDPA 5AZJA 2HVIA 4O8KA 3P4IA 5AQKA 3OS2A 4CJKA 1A5VA 3ZSYA 1VAZA 4DR6K 3NH0A 4QCLA 3AA3A 2PYLA 2P1JA 1NK9A 1JJ2M 2HW3A 1YJNN 1U4BA 4DQ8A 3CCLN 4PKHA 2G8FA 5KPZA 4LSNA 3ATVA 3R3LA 1RDBA 4FPBA 1R59O 2QM1A 2QXFA 3IS9A 3OYGA 3ENBA 1HNIA 3VEZA 4E7JA 4X64K 1U04A 3K5NA 2HBLA 4FWSA 5AQIA 4N56A 4KH4A 3AVMA 1WSHA 3VQ8A 3OYMA 1TKTA 5FPDA 3DLLL 4BG9A 1HYVA 1C6VA 2JWLA 4EP4A 4BRNA 4IOAL 3V4IA 1GLFO 3SK3A 2QWRA 3NGIA 4DLEA 1XUPO 4ILJA 1NK4A 3A5LC 2E1ZA 1QS4A 1NKBA 1IKWA 2FC0A 3JXUA 3ULEB 2KTQA 5HL7L 3VENA 1IV0A 3F2KA 4B9VA 4DR2K 1XC3A 5LMNK 3OYHA 3O9TA 2Q2RA 4B8CA 3VQQA 1J5EK 2YCHA 4LD0A 4CBUA 4IOCL 4CFAA 2E8AA 1JL2A 2HNYA 4MLEA 5AFUA 4O0JA 3C6UA 1EWRA 4ISGA 1SAZA 4XH1A 5J2NA 4H4MA 1WAJA 4CJEA 1QVGM 4NYNA 3DI6A 1YJWN 5AQPA 1XMOK 1HJOA 1KFDA 4B9SA 5GAGP 2OA8A 4BR4A 4JI0K 1VQ6N 4PUOA 1KSPA 3VQBA 1D5AA 4CHQA 3DRRA 4FJIA 2WFBA 4F3OA 2Z1IA 4BE2A 3U6FA 4B3TK 3CCEN 1SKRA 4CZGA 3VF4A 4B8AB 2BH1A 5FROA 5AFUH 4DU3A 3LDLA 2B4JA 1T8EA 1TK8A 3L0QA 4B9LA 1NJIO 3QNOA 1WNSA 3QLHA 4RG8A 4DS5A 5AQVA 3VQPA 1IBKK 1YHQN 1ZBSA 1JCEA 3NF9A 4OVLA 3NE6A 4BRMA 4IEEA 1W7AA 3SMPA 4W5OA 1S1UA 1MDUB 1BHLA 5BR9A 1LW0A 4C23A 2Z1JA 4IO9L 1W9HA 3LP0A 2NUBA 3M8RA 4NXNK 4H5RA 3JS6A 4YDUA 3G4SN 2UU9K 1VRUA 2HF3A 4CFBA 4KI4A 4R79A 3FZFA 1VQ8N 4MLHA 3TTDA 3M8PA 2E5LK 1YXQA 2P5OA 4DFPA 5KQ8A 1TUYA 4MO5A 1UWBA 4CBXA 1ZBFA 1SL2A 3D2EA 4B9QA 3MX5A 1S9GA 4G1QA 2OPPA 2CH6A 2A5XA 4PA1A 2AP1A 4CF1A 1GLAG 5M1OA 1BISA 1JKHA 3QEVA 4B1UB 4OPHA 5LY3A 1WSGA 4KFBA 3TTCA 4KHUA 3WNGA 3VQAA 4PKGA 2KZZA 5H1SQ 3TU5A 5AQUA 4HCBA 5CZ1A 5JICA 3RWUA 3TAPA 4DSKA 3CG7A 4V19S 2GX9A 2DFEA 3HO1A 1NK0A 1JLFA 1JLBA 4AF1A 3OYIA 2IVPA 3LZJA 2P9SB 3LPTA 4MFBA 2FSJA 2RE2A 4FYDA 4BGAA 4DV3K 1RT6A 3SBGA 3KLEA 4A57A 4ISEA 4DR4K 1L3UA 1T03A 4DTXA 4CF0A 3MX2A 4BRLA 2Q3SA 4Z4HA 1BI4B 2I7NA 3VQDA 2VCPA 3O9RA 4JK9A 1J53A 4FLYA 1JXEA 1JCFA 4ZHRA 5GAHP 3C95A 1WSIA 3TSQA 1NWKA 3KKSA 3RMCA 1ATRA 2D0PA 5JMVA 4FJKA 4JKDA 3VQ6A 4DTOA 3EKUA 1SQKA 3HT3A 1YTAA 1YJ9N 2E6LA 4DUZK 4A61A 5I42A 3VN5A 4BC4A 5BRDA 3E9OA 4JI4K 4A62A 1WOQA 1BQMA 4BWJA 4PL8A 2OYQA 5EOYA 4ELVA 4AHUA 2VG7A 3J7AP 4CD1A 5M1NA 3I8BA 5K14A 4QAGA 2HHTA 4CZHA 3RVCA 1BWFO 2P9UB 5FRMA 4FJMA 4DB3A 4C8NA 1LAWA 3VGMA 1QSLA 2P9IA 3QETA 4B3MK 3ZCMA 3NH1A 3R9PA 4BQZA 3KVGA 2PFUA 1NKEA 3VEOA 2QI2A 3CQXA 3K5OA 4JLHA 3SUPA 4JV5K 3A8YA 5HLFA 4AILC 2JWKA 1HLUA 2YKNA 3CJ9A 3VPZA 2XY8A 1O13A 4W5TA 4IJNA 3CF5L 4CE9A 1MU2A 3MN9A 3KK3A 3THXA 3DYAA 4WFNL 1IG8A 1HKGA 1I3AA 5HROA 2ITGA 3CC2N 1GLJO 3RMAA 3CCQN 3IG1A 4L3QA 5GIPA 1D8YA 2IAJA 3W3DA 3MCAB 4A5AA 1U2VB 3V6DA 2PZSA 5HOOA 3L6QA 4H0XB 1BGXT 3I33A 2GBZA 4DSJA 1DLOA 2RKIA 2HHVA 2IVNA 3CERA 4FSVA 4CHYA 2PY5A 5BN8A 1XNRK 4BDZA 1QHAA 1ZXOA 1RGIA 5FPMA 1C1CA 4KO0A 4N76A 1YITN 3AY9A 4B9MA 2FSKA 3KK1A 4CJ7A 1OKJA 3BEXA 4BE0A 1LAVA 1KXPA 4WFAL 3SAFA 2P9PA 3VGLA 5JS1A 4L8RB 2O8FB 4CZFA 4W5NA 3H08A 4KI6A 1IKVA 3EKSA 1ILYA 1M1KO 1S6PA 3DOKA 3O4QA 1YTUA 4PY5A 3AA5X 3ISNC 2RN2A 2CGKA 4K42A 4CJUA 2QK9A 4E3SA 3LALA 5TKYA 3CJAA 3PUFA 4ID5A 1NK8A 3HSTB 2WTUA 3PO4A 2HHSA 3VQ4A 3WNHA 2ZQBA 4IZ9A 2F7TA 3G6EN 1HYZA 3ZEUA 3MAQA 4FZXC 4LF7K 3D45A 3HYFA 3NH2A 1RBUA 2VGMA 1TKXA 1GLCG 1JXBA 3FZLA 3UKRA 3AVNA 3MWTA 4BRQA 2KQ2A 3HTVA 2P9SA 4ILHA 5LJVA 1RNHA 2VWBA 1G15A 4ZTJA 3LDNA 4OLAA 1C1AA 3TAMA 3AVLA 2GTDA 4CZMA 4A5BA 1BUPA 5AQLA 4DSFA 3V9WA 1ZYQA 3QINA 4LF4K 1C0UA 5KPTA 4O5BA 4IG0A 3K5LA 3O8MA 4H03B 4FLTA 3BP8A 5C0YA 4B9UA 2Q0UA 1QQOA 4FPAA 2G8UA 2WBNA 3VOVA 1BI4A 4GKJK 3QFUA 3C94A 4DV1K 2OPRA 5LL6Z 4DV0K 4KRFA 3MWPA 2YI1A 4RW4A 4M41A 4YNQA 4FWRA 3NFAA 4QS8A 3U3GA 3LWLA 3PIPL 1JLQA 3MXMA 4PKIA 3QEPA 2P9KA 3ZT2A 1LV5A 3ULDA 3EZ5A 4FK0A 1QHTA 1NK5A 4Z94A 4OPKA 1NGEA 3CQYA 4H5NA 3V1QA 1DKGD 2HMIA 3HP9A 1EKEA 4DTPA 3CYMA 5CHIA 2R7YA 4K25A 2ATQA 4B1VA 1C0MA 3L2VA 2PAVA 1IO2A 1L3SA 3NF6A 1HNVA 3VQ5A 4LF9K 4AHRA 4JD2B 3RRGA 4FWOA 3AO5A 2IGIA 3QO9A 1U48A 4CIFA 3AA2A 5FDLA 3ZT1A 2WOMA 4KKOA 3WXKA 1RBSA 1WB9A 3K2PA 5D3GA 5AQMA 2HHWA 5IT9O 3N4PA 4CD3A 1N34K 5M1KA 1G99A 4KTWA 3OYFA 1RT3A 2X74A 4NXMK 1IKYA 3F73A 4BE1A 3BF1A 4AM7A 4DSIA 1C0FA 4TSXA 2I7PA 4F2SA 3QBXA 5KGXA 3S3NA 4FOEA 2Q31A 4HUFA 3EL2A 1U47A 4FLZA 1J9AA 1U2VA 3K9KA 3B6PA 4KH5A 4CZEA 4JHDA 1NJWA 2D0CA 4B9TA 5BPNA 2D5RA 4YFUA 4CEZA 1VQ4N 2E88A 4H4OA 1ASVA 2XY5A 4ID1A 1K8AO 2GUPA 2P9LA 4FWNA 3OJUA 4GVEA 4FL9A 1BCMA 1E4FT 4NB4A 2ASMA 3H1VX 1DEJA 4DU4A 3SUNA 3KJVA 1S1VA 4CERA 1EO1A 2ASOA 3AVIA 3AVGA 4KHSA 5AQNA 4O4GA 3R1XA 1HNXK 4M45A 4DQIA 2KFNA 2UXDK 1KAZA 3ALYA 5DMRA 3ASMA 4M3YA 4A2BA 3KD1E 4DTRA 2BDPA 3V9XA 4WE1A 1D9DA 3LAKA 3NHGA 2ZJRL 5AQSA 1X1PA 1NM1A 4DTMA 1IH7A 4JYAK 1JCGA 1VSEA 3NCIA 4B3RK 2BANA 2QEXN 4Z4FA 2KKZA 3HK2A 4GVMA 5JLFA 1TV6A 5FPNA 3PO5A 3CCUN 3T7ZA 1BIUA 1RDAA 3PV8A 2NRHA 3CCMN 1I39A 3NF7A 3CETA 1K9MO 1VQLN 4KPYA 5KRSA 3O4WA 3HBTA 4X65K 1KC8O 1HQEA 3GE1A 1WBDA 3VQ9A 3DLKA 4CW7B 1S72N 5HBMA 3PX0A 4JRQA 4Q5VA 1JLCA 3SMSA 2DPNA 4CIEA 3NVMA 1Y64A 1HPZA 1ZBHA 3VA0A 2E2NA 3HPHA 4KB1A 3THYA 1BG3A 3MXIA 4K8XA 2FBXA 2HNZA 1WSJA 1Q9YA 2OZSA 5EVZA 3C0BA 4LF6K 1XI1A 1HRHA 3EYZA 5C12A 3TAGA 3FLCO 1JL1A 3PSIA 2UXBK 3L8BA 3P39A 2F96A 3ZSZA 3V9ZA 2QKKA 4Q0BA 2W42A 4ICLA 4DFJA 3WEEB 4KBOA 2O8CA 5J1EA 5BPMA 3MDQA 3QERA 3THWB 3Q7BA 5C2DA 1D4XA 1KD1O 3E9LA 4CEOA 3V81A 4BR5A 2YHXA 3JYTA 4DTSA 3R6MA 3SNNA 4JKAA 3PX4A 3HL8A 3CHWA 1I94K 4B3SK 1NGFA 2IDOA 4CEEA 3SUOA 2GWJA 3DLRA 2P9IB 4GV9A 2V7ZA 1RDUA 2H3GX 1LCUA 3GDQA 1X3MA 4JD2A 1VSHA 4AHCA 5M1PA 3KLFA 1RBRA 3T19A 3SUQA 4R5PA 4CJVA 3ZT0A 3WNFA 2Q97A 5CYQA 3AO1A 5AR0A 4FJ8A 4LF5K 2UUBK 1U6ZA 4I2QA 2HB5A 4CVNE 2KFZA 4CJSA 3SPYA 1QZ6A 2A6AA 4IO8A 3THXB 5IWAK 3SJJA 5T7BA 5E26A 5HRPA 3L2WA 5I3UA 5FRNA 4AH9A 4CBWA 2W6LA 2YNIA 4O44A 1OH6A 1HR0K 4RW7A 3CJ7A 4DR1K 3HM9A 3CIPA 3HZ6A 1NOYA 5FLXO 4QS9A 3VQCA 3A5MC 5SWMA 3RRHA 3AO3A 3RMDA 4KTZA 3T1AA 3TABA 1NU0A 4O5FA 4N47A 1H1VA 5F0XA 4EZ9A 1LW2A 3AGRA 4JI2K 3OYCA 4JEPA 2P9PB 3LDSA 4BDYA 2A1RA 1RDWX 2Z1GA 1IKXA 5F1XA 2YJFA 4CGFA 4CEFA 5LJWA 4ELTA 1SL1A 3VEWA 4DU1A 4KB0A 2YKMA 1C1BA 4KH6A 2QWLA 1ITGA 4XH5A 1NGCA 4CZKA 4Y1CA 3TI0A 3MN6A 2ASPA 1VHXA 2NLXA 3QB0A 3QFPA 3CPEA 3MK6A 3SZ2A 1ZBLA 3U9DA 3MEDA 3KLHA 1ESVA 3L4QA 2QWMA 3O80A 4IXCA 4HUGA 3CD6N 3DXMA 1N33K 3DRPA 3OBYA 3T1HK 5AZIB 2QW9A 4CECA 2O4IA 3G0ZA 3OYBA 3ZEUB 1N8RO 3NDKA 3VMFB 3LM9A 1VSIA 5AJ3K 1TKDA 1QTMA 2F9WA 4M3UA 1HUXA 4WQ5A 3F9MA 3ITHA 4W5RA 4M42A 3UKRB 4A2AA 4IEIA 2G8KA 1SUQA 1RT5A 1NGJA 3JSMA 3SYZA 3K9JA 4JI1K 3H45C 4BACA 3KZBA 1S1XA 3H46O 4JAXA 3BY5A 1Z6RA 1YAGA 1KVBA 4K41A 1VRTA 4CJ5A 3VEYA 4KAZA 1W0HA 3AO2A 4QOZB 1KAYA 1NK6A 1NNEA 5JVHL 3HPGA 4GV3A 1T3VA 3MEGA 4PL7A 4DQQA 3V1OA 4BQLA 5J2PA 2X6NA 3PLAA 3E1YA 2F8SA 4G9ZA 4YORA 4M3RA 4HWIA 2EHGA 1HYSA 2FBVA 1WN7A 3WEEA 3SQ1A 3AV9A 2ZGZA 3SJHA 3K59A 4BRCA 2P9KB 3EY1A 3THWA 3KWIA 4OX9K 1T44A 3GBTA 3D2FA 2IOCA 3H6EA 1W2BM 1SKSA 3QICA 2IC3A 3SPZA 3S3MA 1E3MA 1BA1A 4LY7A 4HCCA 3NAEA 4FWQA 3DRSA 4DKWA 4JKCA 4B1WB 2Q0RA 3WXJA 1KQSM 2ZGYA 4OPAA 3FE1A 4CJRA 4N5SA 1UA1A 3WT0A 3C6HA 4AHVA 3SQ4A 4U67L 5KI6A 3ZSWA 3PSFA 4IFEA 5EU7A 3LDPA 1VQON 4E19A 2FBTA 4CF9A 4M3ZA 2QWOA 3DJCA 4J8FA 1FK9A 2O4GA 5CYMA 3S9HA 3F9KA 4M63C 4C8LA 3P1GA 3A2FA 3OS0A 4CF8A 4NLCA 3O4NA 3C65A 3SI6A 1JLEA 3ATUA 2QXLA 3LPUA 1NJYA 2VWKA 3I0SA 4DV5K 4CESA 1FKPA 2OPQA 4E1MA 4F3TA 2EX3A 1HQUA 3ZX3A 4DR5K 1TL1A 3THVA 1MWKA 4IFVA 3O1BA 4BRKA 3SV3A 4JHDB 1HPMA 3J7ZO 1DT9A 1L3VA 2P9LB 4FLUA 3OYJA 1KAXA 1QSYA 4DV7K 4HTUA 2GV9A 3IFRA 4BY9C 3AARA 5AQOA 3O3GA 1EWQA 3HSCA 3W0LA 2UUCK 1NGHA 1ASUA 4K0KK 1DGKN 3LP2A 1SL0A 1RDDA 3K58A 4F2RA 2V51B 3V9SA 3L2QA 4FK4A 4RW6A 1VQNN 2NRRA 4XEIA 4H8KA 3L4IA 3LDQA 2HHQA 1RT1A 4A59A 3TAQA 3T69A 5EXWA 1JLGA 4JI3K 4FWMA 2ZM6K 5KRTA 4FLVA 3O3HA 4RCHA 1T05A 2V52B 1WBBA 3LP1A 1QVFM 3V1RA 1BA0A 4C8OA 5AZIA 3CQ8A 3OYKA 3LP3A 3UE5A 4ELUA 4B3OA 1GLEG 3KD5E 5JLHA 1MA9B 3JAMO 1OH7A 4JN4A 3ZSOA 4DV4K 1VQMN 1HNWK 4CJ4A 2A40A 3EZWA 2CGJA 4BC2A 4JS5A 2VQFK 3J80O 3AVAA 4JKBA 4B1YB 5C15A 1O1WA 3QDKA 3HPOA 3ZSVA 3TARA 4NCBA 4DSEA 4OLBA 2FXUA 3OYAA 1NGIA 1NMDA 4M3XA 4CIGA 4DSLA 3DOLA 4DLGA 2RF2A 3D6RA 4RW9A 3NGYA 2VWJA 5DK5A 2E20A 3VETA 1GOAA 3THYB 3ZETA 3KWGA 2KHOA 4U7BA 1E4GT 1KVAA 3GG4A 2HSTA 4OJRA 4O0IA 3CMAN 4C1NK 3SV4A 5HRRA 3D7EO 3LAMA 1VSMA 3CFRA 1QZ5A 4ISFA 1SKWA 3U4LA 5GAEP 1NK7A 1YF5L 4IOXA 4Z0UA 1X9WA 2O8CB 3FFIA 4CJWA 1QQNA 1RT2A 2OTLN 1Z05A 2HHHK 4Z4IA 3MN5A 4DV2K 2HBJA 4FJ5A 1OVYA 3NMUA 4JKEA 3LWMA 3U3YA 2OTJN 3QEXA 3HXMA 2JLEA 3IKMA 1T6DA 1RCHA 3P5JA 2YHAA 2ITMA 4CEBA 5BPLA 4FK2A 4BGBA 1J6ZA 2A1SA 2LSNA 1VQPN 1XHZA 1VQ9N 3CCVN 5J2MA 3K5MA 4H0YB 2JGUA 3M3ZA 4FWPA 4E0DA 2CGLA 4OGEA 4H0OA 4FWLA 3PY8A 2XRIA 1B92A 1LWFA 4X62K 4F8RA 3O9QA 2HMPA 1RTJA 3RTVA 3KHYA 4OGCA 2KW4A 3WQUA 3EO3A 2GEMA 4M3WA 4IG3A 4CEDA 4YOYA 3CCRN 4FJGA 4BRAA 4FM1A 3CJ1A 2D4WA 5AQTA 3ZSXA 2O8EA 3BUZB 3MCPA 1NJZA 1K8KB 1RT4A 1RTHA 3LANA 1YUWA 3MECA 2HHXA 4CCHA 3QEWA 3DLEA 1IG9A 3BDPA 1NGBA 3ID6A 1N36K 1OH8A 2VG6A 4KTQA 1VSLA 2CH5A 4H0VB 4FLWA 1IBMK 3TPQA 2IS3A 1KLNA 4JI7K 5CR4A 2OCEA 3SAGA 4I2PA 3VEXA 4X66K 3O3FA 3OYEA 1FXXA 1N5YA 2ZWHA 4M7YA 4RW8A 4F4KA 1RFQA 3KTQA 4DQRA 1DTTA 4FM0A 3AVCA 4DWIA 1QE1A 3VQ7A 4FVMA 1Q82O 4NCGA 4BG8A 3NF8A 4GW6A 2A41A 3SQ2A 1VSFA 1WAFA 3HRGA 1OH5A 1FW6A 1SS6A 3AO4A 3QBWA 4Y1DA 1KTQA 4JRPA 4XIUA 4GKKK 3OTOK 1NJXA 1EP4A 3EEQA 4FCYA 4H0PA 1X9SA 3ZX2A 1A5WA 2HBKA 1YI2N 3DXMB 2G8IA 3ZT3A 1TGOA 4HVJA 4I9LA 4UY8O 2P9NB 4BVOA 4FZYA 4MDAA 5BN9A 2IVOA 4LH5A 3OY9A 3OYNA 3MEEA 3ZSRA 2BUPA 3VTHA 3E66A 2F8TA 1BOTO 2NRXA 2HOEA 2O8DA 3H1QA 1T7PA 1T6CA 4BRHA 2OANA 4FJLA 3LDOA 3EE8A 3C6TA 2VG5A 1FJGK 3B8AX 2YV0X 1EXQA 4WQ4C 1NOZA 2A42A
chains in the Genus database with same CATH topology
3CJ9A 3VPZA 1O13A 3M6GA 5CE3A 5LJWA 3IDHA 4IJNA 3VEWA 1Q86O 3CF5L 3ZX0A 2YJEA 3LM2A 3MN9A 4KH6A 1HKCA 5GADP 1VQ5N 2QWLA 4XH5A 4WFNL 1NGCA 1IG8A 4I6MA 1HKGA 4FVUA 4CZKA 3CC2N 3MN6A 1GLJO 2ASPA 4ILGB 2NNWA 4L3QA 4NLBA 4WQ4A 5GIPA 3CCQN 2NLXA 3QB0A 3QFPA 3CPEA 3MK6A 3UKUB 3W3DA 3MCAB 4A5AA 1U2VB 3U9DA 4WFBL 1ESVA 5HOOA 3L6QA 4H0XB 3VESA 3L4QA 2QWMA 3I33A 3O80A 2P9UA 2PBDA 4IXCA 3DXMA 2NRWA 3CD6N 3OBYA 4B1ZA 5AQXA 5AZIB 2IVNA 2QW9A 3CERA 3N4QA 4FSVA 4BR9A 2E2PA 2RHKA 1NBWA 3ZEUB 5BN8A 3F5TA 1N8RO 3WXIA 3AGKA 3VMFB 3GOIA 3PIOL 1M90O 1QHAA 1ZXOA 1RGIA 3LM9A 5FPMA 2F9WA 3VF6A 1HUXA 1YITN 4EFHA 3AY9A 4WQ5A 2FSKA 4CJ7A 2GELA 2D1KA 3F9MA 3MMVA 1OKJA 2Q36A 2FSNA 2W40A 2WUSA 3BEXA 3UKRB 4A2AA 1KXPA 1QQMA 3D2FB 4CZJA 2P9PA 3SAFA 2YX6A 4WFAL 1NGDA 4IEIA 3TTFA 3VGLA 4CZFA 2V7YA 3GL1A 4CI6A 3O9UA 3EKSA 4JKGA 1NGJA 4FOIA 3I55N 1ILYA 2QWPA 5KQDA 5F2RA 1WUAA 3K9JA 5EY4A 3H45C 5AQHA 3KK7A 2EWSA 3CCJN 1M1KO 3KZBA 3C6AA 4FO0A 4YOXA 3H46O 4JAXA 5C10A 3ID8A 1Z6RA 2FF3B 1YAGA 4IJAA 1NGGA 2CGKA 4K41A 4K42A 1TYQB 3P31A 3VEYA 4IDHA 3SAHA 3UKUA 4YOTA 1KAYA 5TKYA 3CJAA 5JVHL 5DM6L 3C7NB 4GV3A 1T3VA 3BF3A 4XH4A 4EIAA 4PL7A 4JK7A 2VYPA 4BQLA 3PLAA 4IZ9A 3E1YA 4G9ZA 3J8AA 2D0OA 4YORA 2F7TA 1TUUA 3IUCA 3G6EN 4HWIA 3ZEUA 2QWNA 2VGMA 3WEEA 2ZGZA 3WQTA 4BROA 2KLAA 5TKWA 1GLCG 3SJHA 4H5TA 2P9KB 4O8UA 5AQZA 4BRCA 3KWIA 3FZLA 4RWTA 3CJCA 3UKRA 1T44A 3GBTA 3D2FA 3H6EA 2NRVA 1W2BM 3AAPA 2E2QA 3MWTA 3QICA 4JKHA 3FFKB 1K8KA 2QTDA 3EE9A 3HTVA 1X9JA 3O5BA 4BRQA 1BA1A 3VTIA 2FF6A 2P9SA 4ILHA 4FWQA 5LJVA 3OW2M 3RSEB 3O6WA 2BTFA 2VWBA 4DKWA 4EAHD 3G71N 3LDNA 4EHUA 4JKCA 2VGNA 1MWMA 4B1WB 2A3ZA 2GTDA 2Q0RA 3WXJA 1BUPA 2ZGYA 4OPAA 4A5BA 4CZMA 1KQSM 3FE1A 5AQLA 3S41A 2J4RA 3WT0A 3C6HA 1V4SA 4U67L 5AQQA 5KPTA 1TYQA 5ELZA 3O8MA 4H03B 3D2EB 3DXKB 4IFEA 4NO7A 3BP8A 3LDPA 1VQON 5C0YA 2Q0UA 1NGAA 1QQOA 1SZ2A 3O1WA 4FPAA 2WBNA 3ENHA 3OBWA 3VOVA 5BRHA 3QFUA 3CJBA 5E84A 4YOVA 4Y0WA 3DAWA 1BU6O 2QWOA 3DJCA 4J8FA 5AZJA 4H5VA 4O8KA 3P4IA 5AQKA 4M63C 4QS7A 2ZJPL 3MWPA 2YI1A 3FZKA 3CI5A 1VAZA 3LL3A 4FWRA 3WUHA 4QS8A 4NLCA 4RTFD 3VERA 4BR7A 3C65A 3H3NO 1JJ2M 3I56N 3NVKA 3UB5A 1YJNN 3ATUA 3PIPL 2QXLA 3U8XA 1IJJA 4PKIA 2P9KA 4AM6A 4B1XB 4DQ8A 1S22A 4CZIA 5B8HA 3CCLN 4PKHA 5KPZA 4IWVA 1C0GA 3MN7A 3ATVA 3ZX3A 4Z94A 1NGEA 3R3LA 3CXCM 1MWKA 3CQYA 3O1BA 4FPBA 1R59O 4H5NA 1P90A 3WXMB 4JHDB 4BRKA 3RSEA 1DKGD 1HPMA 2QM1A 3EN9A 3ENBA 3J7ZO 1DT9A 5CHIA 4K25A 4B1VA 3VEZA 1NLVA 2P9LB 3HOTA 2PAVA 3DWLA 2P9NA 5BRFA 3SLCA 1KAXA 2HBLA 5BREA 4FWSA 5AQIA 4BREA 3IFRA 4BY9C 3AARA 4JD2B 4KH4A 5AQOA 3DXKA 4FWOA 4M7XA 3O08A 3HSCA 3OA9A 3W0LA 5FPDA 4H0TB 3DLLL 4BG9A 4BRPA 1NGHA 3FZMA 2JWLA 5EX5A 4BRNA 1DGKN 4PHTX 3M5RA 1GLBG 3VF2A 3WXKA 4IOAL 5AQMA 1GLFO 2E2OA 3N4PA 4CD3A 2V51B 3SK3A 4OO1J 5M1KA 1G99A 2QWRA 1XUPO 4ILJA 1ATSA 2HF4A 1VQNN 2NRRA 2GWKA 3A5LC 3BF1A 4XEIA 4AM7A 1C0FA 2E1ZA 1W97L 2ZF5O 3L4IA 3LDQA 3JXUA 2I7PA 4JKFA 3ULEB 5HL7L 3HI0A 3VENA 3QBXA 5GINA 3F2KA 4A59A 4BRIA 4FOEA 2Q31A 1XC3A 3ZETB 3EL2A 4BR0A 1S3XA 3O9TA 3T69A 1U2VA 5EXWA 3K9KA 4FWMA 2Q2RA 4MDBA 1Q7YO 4KH5A 4CZEA 2YCHA 3VGKA 4JHDA 3QMLA 4RCHA 5BPNA 2V52B 1QVFM 3SBTA 1VQ4N 4CBUA 1BA0A 4IOCL 2IIRA 5AZIA 2E88A 2E8AA 3UE5A 1K8AO 2GUPA 2P9LA 4H5WA 4BRFA 4FWNA 1GLEG 4MLEA 5AFUA 4GVEA 5JLHA 4FL9A 3U9ZA 1MA9B 1E4FT 4MO4A 4ISGA 1SAZA 4JN4A 4XH1A 3Q7CA 4NB4A 1VQMN 4DHYA 2ASMA 3H1VX 2A40A 3EZWA 1DEJA 2CGJA 3P38A 5KPRA 5JVGL 4BC2A 1QVGM 1YJWN 2WC9A 3M1FA 5AQPA 1HX1A 1EO1A 2ASOA 1HJOA 4JKBA 4B1YB 5AQNA 5C15A 3A5OC 1BDGA 3R1XA 3QDKA 5GAGP 3CC7N 5M1QA 4BR4A 1VQ6N 2FXUA 1NGIA 1NMDA 2YHYA 1K73O 1KAZA 3AAQA 4K43A 4BC3A 4YOUA 4A2BA 3FZHA 3D6RA 4HTLA 2WFBA 3ULEA 2E20A 2ZJRL 3FGUA 5AQSA 3CCEN 1NM1A 3G25A 3A5NC 3VETA 4CZGA 3VF4A 3WXLA 5C2FA 2BH1A 5AFUH 1JCGA 3ZETA 2ZJQL 4WYBA 1EQYA 3LDLA 2QEXN 3KWGA 2KHOA 4U7BA 1E4GT 3C7NA 5MLCQ 5AQFA 2KKZA 3GG4A 3L0QA 5M1FA 2HSTA 5JLFA 1NJIO 5FPNA 5DM7L 2W41A 3T7ZA 3CCUN 3CMAN 5AQVA 4C1NK 1YHQN 1ZBSA 3D7EO 1JCEA 1X3NA 4JNEA 1QZ5A 4ISFA 3U4LA 2NRHA 1VQKN 4BC5A 4IEEA 4YDUC 2NZTA 1CZAN 3SMPA 4BRMA 5GAEP 3CCMN 3CETA 1YF5L 4IOXA 1K9MO 1MDUB 1VQLN 1YIJN 3CPWM 5BR9A 1QQNA 2YHWA 4C23A 2UYTA 2OTLN 3O4WA 4IO9L 3HBTA 1KC8O 1Z05A 3ENOA 3MN5A 3GE1A 2HBJA 1OVYA 4H5RA 3JS6A 4YDUA 4C1NI 3NMUA 4JKEA 3G4SN 2OTJN 2HF3A 4JKGB 3CC4N 1S72N 3IMXA 4WCEL 1LOTB 3TSPA 3IKMA 4R79A 3FZFA 1T6DA 1VQ8N 4MLHA 3TTDA 3SMSA 2ITMA 5BPLA 2Q1NA 2DPNA 1YXQA 1VQ7N 1HKBA 4F9OA 1BO5O 2NRZA 2QA4N 3NVMA 1Y64A 3O9SA 5AQYA 1J6ZA 4BGBA 4BRGA 5KQ8A 1TUYA 1VQPN 4BVPA 4MO5A 4CBXA 2E2NA 1BG3A 3D2EA 4B9QA 1VQ9N 3MX5A 3CCVN 1P8ZA 3C0BA 2CH6A 2A5XA 4LC9B 4H0YB 5EVZA 3M3ZA 4FWPA 2AP1A 2CGLA 5C12A 4H0OA 4FWLA 1GLAG 5M1OA 3A0IX 2AA4A 3FLCO 3O9QA 4WQ5C 2HMPA 1V4TA 3CMEN 3KHYA 2HBMA 2F9TA 3P39A 3WQUA 4B1UB 3EO3A 2GEMA 4OPHA 5LY3A 4YOWA 3OHRA 3TTCA 4KBOA 3WEEB 4YOYA 3CCRN 4GV6A 4PKGA 5H1SQ 3TU5A 4BRAA 5AQUA 5BPMA 5JICA 1ATNA 3MDQA 2GX9A 3Q7BA 5C2DA 3CJ1A 4WF9L 1D4XA 1KD1O 3E9LA 2D4WA 5AQTA 4BR5A 2YHXA 4EHTA 3BUZB 3E9PA 3MCPA 5FPEA 1K8KB 4AF1A 1YUWA 2IVPA 5AQWA 5I9EB 2P9SB 3R6MA 4JKAA 2FSJA 3CHWA 2QWQA 1NGFA 2E1YA 2RE2A 1NGBA 3ID6A 3TSUA 4BGAA 1ZC6A 2GWJA 2P9IB 4GV9A 2CH5A 2V7ZA 4H0VB 3SBGA 3TPQA 3FR0A 1RDUA 4ISEA 4A57A 2H3GX 1LCUA 3GDQA 1X3MA 4JD2A 5M1PA 5CR4A 3SAGA 3VEXA 3MX2A 2ZWHA 4M7YA 4BRLA 1RFQA 2I7NA 4JK8A 2Q97A 2VCPA 3O9RA 4JK9A 1JCFA 5AR0A 5GAHP 5AZJB 3VEVA 3TSQA 3HM8A 1NWKA 4WQ4C 4DCHA 1Q82O 1ATRA 2D0PA 5JMVA 4BG8A 1U6ZA 4JKDA 2A41A 3EKUA 1SQKA 1YJ9N 5GIOA 3HRGA 1QZ6A 2A6AA 5AQJA 4A61A 4IO8A 4BC4A 2FLOA 1SS6A 3QBWA 5BRDA 5ADXA 1Q81O 3E9OA 4A62A 1WOQA 5AQRA 4I6MB 2NRTA 4PL8A 5E26A 4BR2A 4CZLA 5EOYA 4CD1A 3CCSN 5M1NA 5AQGA 3I8BA 4CBWA 4H0PA 3ZX2A 4CZHA 2HBKA 1BWFO 2P9UB 1GLDG 3RVCA 3DXMB 1YI2N 4DB3A 3CJ7A 4GY2B 4FWKA 3CIPA 3HZ6A 3VGMA 3ZYYX 4UY8O 2P9NB 2P9IA 4QS9A 3R8EA 3A5MC 4BVOA 4MDAA 5BN9A 2IVOA 4GNIA 3R9PA 4BQZA 2BUPA 3KVGA 4O5FA 3VTHA 2PFUA 3E66A 1H1VA 4BRDA 1BOTO 5F0XA 1XQSC 5ADXH 3AGRA 2NRXA 2HOEA 4JEPA 2P9PB 3H1QA 3H3OB 3VEOA 1T6CA 4BRHA 4E1JA 1YVNA 2QI2A 3CQXA 2OANA 1RDWX 3HOSA 3LDOA 3EE8A 3A8YA 5F1XA 2YJFA 2JWKA 1HLUA 3B8AX 1Q18A 1GLLO 2A42A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q86 O;  1KQS M;  3CF5 L;  3CCR N;  5H1S Q;  1VQM N;  1VQ5 N;  5GAD P;  4WFN L;  4U67 L;  5JVG L;  4WF9 L;  3CC2 N;  1KD1 O;  1VQO N;  3CCQ N;  1QVG M;  1YJW N;  4WFB L;  3CD6 N;  5GAG P;  3CC7 N;  2ZJP L;  1VQ6 N;  1K73 O;  1N8R O;  1JJ2 M;  3I56 N;  1YJN N;  3PIO L;  1M90 O;  3PIP L;  2ZJR L;  3CCE N;  1YIT N;  3CCL N;  2ZJQ L;  4WFA L;  2QEX N;  5MLC Q;  3CXC M;  5GAH P;  1NJI O;  5DM7 L;  1Q82 O;  3I55 N;  1ILY A;  3CCU N;  3CMA N;  3J7Z O;  1YHQ N;  1YJ9 N;  1M1K O;  3CCJ N;  1VQK N;  3CCM N;  1Q81 O;  5GAE P;  1K9M O;  1VQL N;  1YIJ N;  3CPW M;  2OTL N;  4IO9 L;  1KC8 O;  3DLL L;  3CCS N;  5JVH L;  1OVY A;  5DM6 L;  3G4S N;  4IOA L;  3CC4 N;  2OTJ N;  1YI2 N;  1S72 N;  4WCE L;  3G6E N;  1VQ8 N;  4UY8 O;  1VQN N;  1VQ7 N;  2QA4 N;  5HL7 L;  1VQP N;  1VQ9 N;  3CCV N;  1W2B M;  1Q7Y O;  3OW2 M;  1QVF M;  1VQ4 N;  4IOC L;  3CME N;  3G71 N;  1K8A O; 
#chains in the Genus database with same CATH topology
 3M6G A;  3IDH A;  1RIL A;  1F21 A;  1WSF A;  3DLH A;  1KLM A;  4OKE A;  3RR7 A;  1VQ5 N;  1HKC A;  5GAD P;  4I6M A;  1SV5 A;  4FVU A;  2D0B A;  2PYJ A;  4ILG B;  4WFB L;  1YVU A;  4KHY A;  1B9D A;  3L2U A;  3I8D A;  2VQE K;  4KHQ A;  5AQX A;  3N4Q A;  2RHK A;  3F5T A;  3WXI A;  3AGK A;  4CK3 A;  3GOI A;  3PIO L;  1M90 O;  1ZBI A;  4PQU A;  4LFA K;  4I7F A;  4EFH A;  2GEL A;  2O8B A;  2FSN A;  4CZJ A;  3G10 A;  2KZM A;  3D2F B;  4DF8 A;  2YX6 A;  1NGD A;  4YY3 K;  4CJ3 A;  4CJT A;  4E7K A;  3GL1 A;  4CI6 A;  3O9U A;  1A5X A;  4FOI A;  2QWP A;  5KQD A;  1WUA A;  1TKZ A;  3KK7 A;  2EWS A;  1NKC A;  4J2A A;  3AVF A;  4YOX A;  1KCF A;  5C10 A;  3ID8 A;  2G8V A;  3PX6 A;  2FF3 B;  4I9Q A;  3L2R A;  1QQC A;  3KIO A;  4CHZ A;  3P31 A;  2AJQ A;  3SAH A;  3UKU A;  4YOT A;  4CK2 A;  5DM6 L;  3C7N B;  3WNE A;  5J2Q A;  4EIA A;  4E7I A;  5C24 A;  1HJR A;  3J8A A;  3IUC A;  4DR3 K;  3ZSQ A;  1FKO A;  2ZD1 A;  3IRX A;  5TKW A;  3QNN A;  4H5T A;  3J7Y P;  5AQZ A;  2XY7 A;  4DF4 A;  4JI6 K;  3K57 A;  4PWD A;  5JS2 A;  4RWT A;  3CJC A;  4EZ6 A;  2NRV A;  3AAP A;  3HVT A;  1CZB A;  4JKH A;  3FFK B;  1K8K A;  2QTD A;  3EE9 A;  1X9J A;  2P51 A;  3VTI A;  3OW2 M;  2BTF A;  2P5G A;  2XO7 A;  4CEQ A;  2XHB A;  1MWM A;  1RTD A;  1REV A;  3S41 A;  4E7L A;  3M8Q A;  4Z4E A;  3QEI A;  5AQQ A;  1TYQ A;  5ELZ A;  1TVR A;  2I5J A;  1NGA A;  1SZ2 A;  3O1W A;  2HVH A;  3ENH A;  3OBW A;  5BRH A;  5E41 A;  5E84 A;  4Y0W A;  1BU6 O;  4FJH A;  4H5V A;  4CJQ A;  4CJL A;  4QS7 A;  2ZJP L;  2YHB A;  3FZK A;  3CI5 A;  2DY4 A;  3L3U A;  3LL3 A;  3WUH A;  4CGI A;  4IKF A;  4RTF D;  3VER A;  4BR7 A;  1XNQ K;  3H3N O;  3I56 N;  3NVK A;  3UB5 A;  2HND A;  3U8X A;  1IJJ A;  1BQN A;  1Z25 A;  4AM6 A;  4B1X B;  1S22 A;  4CZI A;  5B8H A;  4CGD A;  3AA4 A;  5HP1 A;  1YT3 A;  1TL3 A;  2G8W A;  4IWV A;  1C0G A;  3MN7 A;  4FJ9 A;  4DQS A;  3CXC M;  3WXM B;  1P90 A;  3RSE A;  3HP6 A;  3EN9 A;  4OPJ A;  3DMJ A;  3HOT A;  1NLV A;  3DWL A;  2P9N A;  4AHS A;  1LWE A;  3SLC A;  1L5U A;  1B9F A;  5BRE A;  1IBL K;  3ZLJ A;  5LMU K;  3RMB A;  4BRE A;  4FJ7 A;  5KGW A;  3DXK A;  4FZZ A;  1DTQ A;  4M7X A;  4B08 A;  1D9F A;  3O08 A;  4N41 A;  3OA9 A;  4H0T B;  4BRP A;  4KHN A;  3FZM A;  5EX5 A;  1XMQ K;  1BCO A;  4PHT X;  3M5R A;  1GLB G;  3VF2 A;  4JS4 A;  4DFM A;  4BWM A;  2E2O A;  1EX4 A;  2WON A;  4OO1 J;  1ATS A;  2HF4 A;  2GWK A;  1W97 L;  2ZF5 O;  4JI5 K;  4JKF A;  1U45 A;  3HI0 A;  1RT7 A;  5GIN A;  1QSS A;  3BGR A;  4BRI A;  1TK0 A;  3ZET B;  4BR0 A;  3M8S A;  1CLQ A;  1S3X A;  1TAQ A;  4JI8 K;  1Q7Y O;  4MDB A;  3HJF A;  3UIQ A;  3VGK A;  3QML A;  3SBT A;  2IIR A;  1ASW A;  4H5W A;  4BRF A;  3KK2 A;  3U9Z A;  4MO4 A;  1XC9 A;  3Q7C A;  4DHY A;  2G8H A;  4IDK A;  1Y97 A;  3P38 A;  5JVG L;  5KPR A;  4DTN A;  3TAF A;  2WC9 A;  3M1F A;  1S6Q A;  1HX1 A;  3T3F A;  4NCA A;  3BZC A;  2YNH A;  4AQY K;  4DR7 K;  3A5O C;  1BDG A;  3CC7 N;  5M1Q A;  1NG9 A;  2YHY A;  1K73 O;  3MXJ A;  3AAQ A;  4K43 A;  4OKJ A;  4BC3 A;  5HRS A;  4YOU A;  5BR8 K;  3E01 A;  3FZH A;  4HTL A;  3ULE A;  3FGU A;  2Z1H A;  3G25 A;  3A5N C;  5C2F A;  3ZT4 A;  3WXL A;  3IAY A;  4CGG A;  2ZJQ L;  5HRN A;  4WYB A;  4FXD A;  2D0A A;  1EQY A;  3C7N A;  5MLC Q;  3I0R A;  5AQF A;  5M1F A;  1S9E A;  1Q9X A;  5DM7 L;  4E89 A;  2W41 A;  2XY6 A;  1X3N A;  4JNE A;  1HNZ K;  3KKR A;  1LWC A;  1K6Y A;  1VQK N;  2BE2 A;  4BC5 A;  4YDU C;  2NZT A;  1CZA N;  1YIJ N;  3CPW M;  2YHW A;  2UYT A;  1HMV A;  5CZ2 A;  1BL3 A;  3ENO A;  1Z26 A;  3HVR A;  2O8E B;  3QIO A;  4C1N I;  3CC4 N;  4JKG B;  3OS1 A;  1VSJ A;  4CHO A;  2Y1I A;  3OJS A;  3IMX A;  4WCE L;  4HUE A;  1LOT B;  3TSP A;  1KRP A;  2Q1N A;  1VK0 A;  2DFF A;  1VQ7 N;  1HKB A;  4F9O A;  1BO5 O;  2NRZ A;  1S1W A;  3O9S A;  2QA4 N;  5AQY A;  4BRG A;  4BVP A;  1KFS A;  3DLG A;  4CEA A;  4LFC K;  3QES A;  1P8Z A;  4LC9 B;  3D0P A;  1GOC A;  4C8K A;  3A0I X;  2AA4 A;  4WQ5 C;  1UA0 A;  1CXU A;  1V4T A;  1UOC A;  4KV8 A;  3CME N;  2HBM A;  2F9T A;  4YOW A;  5C42 A;  3OHR A;  4GV6 A;  3NBP A;  4DUY K;  1RDC A;  1X9M A;  1ATN A;  1OVQ A;  4WF9 L;  1J5O A;  1VSD A;  4EHT A;  3E9P A;  5FPE A;  2FBY A;  4OKK A;  5AQW A;  5I9E B;  4DFK A;  4E7H A;  4GMJ B;  2QWQ A;  1J54 A;  3DM2 A;  4ZTF A;  2E1Y A;  1UAX A;  4FJN A;  1S1T A;  3AVB A;  3TSU A;  1ZC6 A;  3V9U A;  1EET A;  1TAU A;  1CZ9 A;  3FR0 A;  5A2Q O;  2RPI A;  4J2D A;  4CJF A;  4UQG A;  1N6Q A;  3J81 O;  3KLI A;  4O55 A;  4JK8 A;  2O8D B;  1S5J A;  2X78 A;  2HHU A;  5AZJ B;  3VEV A;  3HM8 A;  4DCH A;  2DTU A;  4LFB K;  4IFY A;  4FW2 A;  5GIO A;  1ZBU A;  4K8Z A;  5AQJ A;  2FLO A;  5ADX A;  1Q81 O;  1KVC A;  4DV6 K;  3B6O A;  5AQR A;  4I6M B;  4M3T A;  2NRT A;  4BR2 A;  4CGH A;  4CZL A;  1NMN A;  3CCS N;  5AQG A;  4NYF A;  3L3V A;  2YNF A;  3SCX A;  4Z4G A;  2UXC K;  1GLD G;  4KHW A;  4GY2 B;  4FWK A;  3ZYY X;  3R8E A;  2OZM A;  4GNI A;  1Q8I A;  2E6M A;  4DS4 A;  5KTQ A;  4BRD A;  5SZT A;  2O8B B;  1XQS C;  5ADX H;  3AVH A;  4B9N A;  3AVK A;  3H3O B;  4E1J A;  3HOS A;  1YVN A;  4DTU A;  1RBT A;  3VQE A;  4EP5 A;  1U49 A;  5BRF A;  1Q18 A;  1GLL O;  4CF2 A;  4W5Q A;  2ETJ A;  4J2B A;  2F4V K;  4DMN A;  5CE3 A;  3T1Y K;  2GUI A;  1Q86 O;  1XHX A;  2B5J A;  3BZK A;  4HHT A;  3CM5 A;  2X6S A;  3ZX0 A;  2YJE A;  3LM2 A;  4CGJ A;  2B6A A;  3KLG A;  5CY4 A;  4LSL A;  4NLB A;  4WQ4 A;  1RTI A;  2NNW A;  3UKU B;  3K0S A;  3VES A;  4C8M A;  4CJP A;  2Y1J A;  4CHN A;  3SQ0 A;  1L3T A;  3VA3 A;  2P9U A;  2PBD A;  2NRW A;  4KRE A;  4B1Z A;  4BR9 A;  4FJX A;  2DFH A;  2E2P A;  1R0A A;  3QIP A;  2YNG A;  1NBW A;  4E1N A;  4LF8 K;  2OPS A;  1WLJ A;  2BGG A;  4DG1 A;  3VF6 A;  3OYL A;  1WSE A;  2D1K A;  3MMV A;  2Q36 A;  2WUS A;  2W40 A;  1QQM A;  3OVN A;  1N32 K;  3TTF A;  4DQP A;  2V7Y A;  5C25 A;  4JKG A;  3I55 N;  4CHP A;  5F2R A;  5EY4 A;  4AHT A;  4MQ3 A;  5AQH A;  3CCJ N;  2UUA K;  4FO0 A;  3C6A A;  4J2E A;  1VSK A;  4IJA A;  1NGG A;  1JLA A;  1TYQ B;  4FW1 A;  4CFD A;  4IDH A;  4LH4 A;  1GOB A;  3AVJ A;  3NGZ A;  3BF3 A;  4XH4 A;  4FLX A;  4JK7 A;  4FJJ A;  3RR8 A;  2VYP A;  2ZE2 A;  4DTJ A;  3TR8 A;  3CFP A;  2W6K A;  1CXQ A;  2D0O A;  2E4L A;  4Z4C A;  1TUU A;  2QWN A;  3LZI A;  3WQT A;  4BRO A;  2KLA A;  4CFC A;  3CFO A;  4O8U A;  1XWL A;  3P83 D;  4CK1 A;  3CM6 A;  2E2Q A;  3TAE A;  3DLB A;  2O8F A;  3O5B A;  2FF6 A;  3RSE B;  3O6W A;  4EAH D;  3OYD A;  3G71 N;  4EHU A;  2VGN A;  2A3Z A;  2QKB A;  2J4R A;  1V4S A;  3D2E B;  3DXK B;  1TK5 A;  4NO7 A;  1RBV A;  4FM2 A;  4IBN A;  3S3O A;  3TAN A;  1C0T A;  1BIZ A;  3CJB A;  4YOV A;  4YHH K;  3DAW A;  3TWH A;  4KHP K;  4BDP A;  5AZJ A;  2HVI A;  4O8K A;  3P4I A;  5AQK A;  3OS2 A;  4CJK A;  1A5V A;  3ZSY A;  1VAZ A;  4DR6 K;  3NH0 A;  4QCL A;  3AA3 A;  2PYL A;  2P1J A;  1NK9 A;  1JJ2 M;  2HW3 A;  1YJN N;  1U4B A;  4DQ8 A;  3CCL N;  4PKH A;  2G8F A;  5KPZ A;  4LSN A;  3ATV A;  3R3L A;  1RDB A;  4FPB A;  1R59 O;  2QM1 A;  2QXF A;  3IS9 A;  3OYG A;  3ENB A;  1HNI A;  3VEZ A;  4E7J A;  4X64 K;  1U04 A;  3K5N A;  2HBL A;  4FWS A;  5AQI A;  4N56 A;  4KH4 A;  3AVM A;  1WSH A;  3VQ8 A;  3OYM A;  1TKT A;  5FPD A;  3DLL L;  4BG9 A;  1HYV A;  1C6V A;  2JWL A;  4EP4 A;  4BRN A;  4IOA L;  3V4I A;  1GLF O;  3SK3 A;  2QWR A;  3NGI A;  4DLE A;  1XUP O;  4ILJ A;  1NK4 A;  3A5L C;  2E1Z A;  1QS4 A;  1NKB A;  1IKW A;  2FC0 A;  3JXU A;  3ULE B;  2KTQ A;  5HL7 L;  3VEN A;  1IV0 A;  3F2K A;  4B9V A;  4DR2 K;  1XC3 A;  5LMN K;  3OYH A;  3O9T A;  2Q2R A;  4B8C A;  3VQQ A;  1J5E K;  2YCH A;  4LD0 A;  4CBU A;  4IOC L;  4CFA A;  2E8A A;  1JL2 A;  2HNY A;  4MLE A;  5AFU A;  4O0J A;  3C6U A;  1EWR A;  4ISG A;  1SAZ A;  4XH1 A;  5J2N A;  4H4M A;  1WAJ A;  4CJE A;  1QVG M;  4NYN A;  3DI6 A;  1YJW N;  5AQP A;  1XMO K;  1HJO A;  1KFD A;  4B9S A;  5GAG P;  2OA8 A;  4BR4 A;  4JI0 K;  1VQ6 N;  4PUO A;  1KSP A;  3VQB A;  1D5A A;  4CHQ A;  3DRR A;  4FJI A;  2WFB A;  4F3O A;  2Z1I A;  4BE2 A;  3U6F A;  4B3T K;  3CCE N;  1SKR A;  4CZG A;  3VF4 A;  4B8A B;  2BH1 A;  5FRO A;  5AFU H;  4DU3 A;  3LDL A;  2B4J A;  1T8E A;  1TK8 A;  3L0Q A;  4B9L A;  1NJI O;  3QNO A;  1WNS A;  3QLH A;  4RG8 A;  4DS5 A;  5AQV A;  3VQP A;  1IBK K;  1YHQ N;  1ZBS A;  1JCE A;  3NF9 A;  4OVL A;  3NE6 A;  4BRM A;  4IEE A;  1W7A A;  3SMP A;  4W5O A;  1S1U A;  1MDU B;  1BHL A;  5BR9 A;  1LW0 A;  4C23 A;  2Z1J A;  4IO9 L;  1W9H A;  3LP0 A;  2NUB A;  3M8R A;  4NXN K;  4H5R A;  3JS6 A;  4YDU A;  3G4S N;  2UU9 K;  1VRU A;  2HF3 A;  4CFB A;  4KI4 A;  4R79 A;  3FZF A;  1VQ8 N;  4MLH A;  3TTD A;  3M8P A;  2E5L K;  1YXQ A;  2P5O A;  4DFP A;  5KQ8 A;  1TUY A;  4MO5 A;  1UWB A;  4CBX A;  1ZBF A;  1SL2 A;  3D2E A;  4B9Q A;  3MX5 A;  1S9G A;  4G1Q A;  2OPP A;  2CH6 A;  2A5X A;  4PA1 A;  2AP1 A;  4CF1 A;  1GLA G;  5M1O A;  1BIS A;  1JKH A;  3QEV A;  4B1U B;  4OPH A;  5LY3 A;  1WSG A;  4KFB A;  3TTC A;  4KHU A;  3WNG A;  3VQA A;  4PKG A;  2KZZ A;  5H1S Q;  3TU5 A;  5AQU A;  4HCB A;  5CZ1 A;  5JIC A;  3RWU A;  3TAP A;  4DSK A;  3CG7 A;  4V19 S;  2GX9 A;  2DFE A;  3HO1 A;  1NK0 A;  1JLF A;  1JLB A;  4AF1 A;  3OYI A;  2IVP A;  3LZJ A;  2P9S B;  3LPT A;  4MFB A;  2FSJ A;  2RE2 A;  4FYD A;  4BGA A;  4DV3 K;  1RT6 A;  3SBG A;  3KLE A;  4A57 A;  4ISE A;  4DR4 K;  1L3U A;  1T03 A;  4DTX A;  4CF0 A;  3MX2 A;  4BRL A;  2Q3S A;  4Z4H A;  1BI4 B;  2I7N A;  3VQD A;  2VCP A;  3O9R A;  4JK9 A;  1J53 A;  4FLY A;  1JXE A;  1JCF A;  4ZHR A;  5GAH P;  3C95 A;  1WSI A;  3TSQ A;  1NWK A;  3KKS A;  3RMC A;  1ATR A;  2D0P A;  5JMV A;  4FJK A;  4JKD A;  3VQ6 A;  4DTO A;  3EKU A;  1SQK A;  3HT3 A;  1YTA A;  1YJ9 N;  2E6L A;  4DUZ K;  4A61 A;  5I42 A;  3VN5 A;  4BC4 A;  5BRD A;  3E9O A;  4JI4 K;  4A62 A;  1WOQ A;  1BQM A;  4BWJ A;  4PL8 A;  2OYQ A;  5EOY A;  4ELV A;  4AHU A;  2VG7 A;  3J7A P;  4CD1 A;  5M1N A;  3I8B A;  5K14 A;  4QAG A;  2HHT A;  4CZH A;  3RVC A;  1BWF O;  2P9U B;  5FRM A;  4FJM A;  4DB3 A;  4C8N A;  1LAW A;  3VGM A;  1QSL A;  2P9I A;  3QET A;  4B3M K;  3ZCM A;  3NH1 A;  3R9P A;  4BQZ A;  3KVG A;  2PFU A;  1NKE A;  3VEO A;  2QI2 A;  3CQX A;  3K5O A;  4JLH A;  3SUP A;  4JV5 K;  3A8Y A;  5HLF A;  4AIL C;  2JWK A;  1HLU A;  2YKN A;  3CJ9 A;  3VPZ A;  2XY8 A;  1O13 A;  4W5T A;  4IJN A;  3CF5 L;  4CE9 A;  1MU2 A;  3MN9 A;  3KK3 A;  3THX A;  3DYA A;  4WFN L;  1IG8 A;  1HKG A;  1I3A A;  5HRO A;  2ITG A;  3CC2 N;  1GLJ O;  3RMA A;  3CCQ N;  3IG1 A;  4L3Q A;  5GIP A;  1D8Y A;  2IAJ A;  3W3D A;  3MCA B;  4A5A A;  1U2V B;  3V6D A;  2PZS A;  5HOO A;  3L6Q A;  4H0X B;  1BGX T;  3I33 A;  2GBZ A;  4DSJ A;  1DLO A;  2RKI A;  2HHV A;  2IVN A;  3CER A;  4FSV A;  4CHY A;  2PY5 A;  5BN8 A;  1XNR K;  4BDZ A;  1QHA A;  1ZXO A;  1RGI A;  5FPM A;  1C1C A;  4KO0 A;  4N76 A;  1YIT N;  3AY9 A;  4B9M A;  2FSK A;  3KK1 A;  4CJ7 A;  1OKJ A;  3BEX A;  4BE0 A;  1LAV A;  1KXP A;  4WFA L;  3SAF A;  2P9P A;  3VGL A;  5JS1 A;  4L8R B;  2O8F B;  4CZF A;  4W5N A;  3H08 A;  4KI6 A;  1IKV A;  3EKS A;  1ILY A;  1M1K O;  1S6P A;  3DOK A;  3O4Q A;  1YTU A;  4PY5 A;  3AA5 X;  3ISN C;  2RN2 A;  2CGK A;  4K42 A;  4CJU A;  2QK9 A;  4E3S A;  3LAL A;  5TKY A;  3CJA A;  3PUF A;  4ID5 A;  1NK8 A;  3HST B;  2WTU A;  3PO4 A;  2HHS A;  3VQ4 A;  3WNH A;  2ZQB A;  4IZ9 A;  2F7T A;  3G6E N;  1HYZ A;  3ZEU A;  3MAQ A;  4FZX C;  4LF7 K;  3D45 A;  3HYF A;  3NH2 A;  1RBU A;  2VGM A;  1TKX A;  1GLC G;  1JXB A;  3FZL A;  3UKR A;  3AVN A;  3MWT A;  4BRQ A;  2KQ2 A;  3HTV A;  2P9S A;  4ILH A;  5LJV A;  1RNH A;  2VWB A;  1G15 A;  4ZTJ A;  3LDN A;  4OLA A;  1C1A A;  3TAM A;  3AVL A;  2GTD A;  4CZM A;  4A5B A;  1BUP A;  5AQL A;  4DSF A;  3V9W A;  1ZYQ A;  3QIN A;  4LF4 K;  1C0U A;  5KPT A;  4O5B A;  4IG0 A;  3K5L A;  3O8M A;  4H03 B;  4FLT A;  3BP8 A;  5C0Y A;  4B9U A;  2Q0U A;  1QQO A;  4FPA A;  2G8U A;  2WBN A;  3VOV A;  1BI4 A;  4GKJ K;  3QFU A;  3C94 A;  4DV1 K;  2OPR A;  5LL6 Z;  4DV0 K;  4KRF A;  3MWP A;  2YI1 A;  4RW4 A;  4M41 A;  4YNQ A;  4FWR A;  3NFA A;  4QS8 A;  3U3G A;  3LWL A;  3PIP L;  1JLQ A;  3MXM A;  4PKI A;  3QEP A;  2P9K A;  3ZT2 A;  1LV5 A;  3ULD A;  3EZ5 A;  4FK0 A;  1QHT A;  1NK5 A;  4Z94 A;  4OPK A;  1NGE A;  3CQY A;  4H5N A;  3V1Q A;  1DKG D;  2HMI A;  3HP9 A;  1EKE A;  4DTP A;  3CYM A;  5CHI A;  2R7Y A;  4K25 A;  2ATQ A;  4B1V A;  1C0M A;  3L2V A;  2PAV A;  1IO2 A;  1L3S A;  3NF6 A;  1HNV A;  3VQ5 A;  4LF9 K;  4AHR A;  4JD2 B;  3RRG A;  4FWO A;  3AO5 A;  2IGI A;  3QO9 A;  1U48 A;  4CIF A;  3AA2 A;  5FDL A;  3ZT1 A;  2WOM A;  4KKO A;  3WXK A;  1RBS A;  1WB9 A;  3K2P A;  5D3G A;  5AQM A;  2HHW A;  5IT9 O;  3N4P A;  4CD3 A;  1N34 K;  5M1K A;  1G99 A;  4KTW A;  3OYF A;  1RT3 A;  2X74 A;  4NXM K;  1IKY A;  3F73 A;  4BE1 A;  3BF1 A;  4AM7 A;  4DSI A;  1C0F A;  4TSX A;  2I7P A;  4F2S A;  3QBX A;  5KGX A;  3S3N A;  4FOE A;  2Q31 A;  4HUF A;  3EL2 A;  1U47 A;  4FLZ A;  1J9A A;  1U2V A;  3K9K A;  3B6P A;  4KH5 A;  4CZE A;  4JHD A;  1NJW A;  2D0C A;  4B9T A;  5BPN A;  2D5R A;  4YFU A;  4CEZ A;  1VQ4 N;  2E88 A;  4H4O A;  1ASV A;  2XY5 A;  4ID1 A;  1K8A O;  2GUP A;  2P9L A;  4FWN A;  3OJU A;  4GVE A;  4FL9 A;  1BCM A;  1E4F T;  4NB4 A;  2ASM A;  3H1V X;  1DEJ A;  4DU4 A;  3SUN A;  3KJV A;  1S1V A;  4CER A;  1EO1 A;  2ASO A;  3AVI A;  3AVG A;  4KHS A;  5AQN A;  4O4G A;  3R1X A;  1HNX K;  4M45 A;  4DQI A;  2KFN A;  2UXD K;  1KAZ A;  3ALY A;  5DMR A;  3ASM A;  4M3Y A;  4A2B A;  3KD1 E;  4DTR A;  2BDP A;  3V9X A;  4WE1 A;  1D9D A;  3LAK A;  3NHG A;  2ZJR L;  5AQS A;  1X1P A;  1NM1 A;  4DTM A;  1IH7 A;  4JYA K;  1JCG A;  1VSE A;  3NCI A;  4B3R K;  2BAN A;  2QEX N;  4Z4F A;  2KKZ A;  3HK2 A;  4GVM A;  5JLF A;  1TV6 A;  5FPN A;  3PO5 A;  3CCU N;  3T7Z A;  1BIU A;  1RDA A;  3PV8 A;  2NRH A;  3CCM N;  1I39 A;  3NF7 A;  3CET A;  1K9M O;  1VQL N;  4KPY A;  5KRS A;  3O4W A;  3HBT A;  4X65 K;  1KC8 O;  1HQE A;  3GE1 A;  1WBD A;  3VQ9 A;  3DLK A;  4CW7 B;  1S72 N;  5HBM A;  3PX0 A;  4JRQ A;  4Q5V A;  1JLC A;  3SMS A;  2DPN A;  4CIE A;  3NVM A;  1Y64 A;  1HPZ A;  1ZBH A;  3VA0 A;  2E2N A;  3HPH A;  4KB1 A;  3THY A;  1BG3 A;  3MXI A;  4K8X A;  2FBX A;  2HNZ A;  1WSJ A;  1Q9Y A;  2OZS A;  5EVZ A;  3C0B A;  4LF6 K;  1XI1 A;  1HRH A;  3EYZ A;  5C12 A;  3TAG A;  3FLC O;  1JL1 A;  3PSI A;  2UXB K;  3L8B A;  3P39 A;  2F96 A;  3ZSZ A;  3V9Z A;  2QKK A;  4Q0B A;  2W42 A;  4ICL A;  4DFJ A;  3WEE B;  4KBO A;  2O8C A;  5J1E A;  5BPM A;  3MDQ A;  3QER A;  3THW B;  3Q7B A;  5C2D A;  1D4X A;  1KD1 O;  3E9L A;  4CEO A;  3V81 A;  4BR5 A;  2YHX A;  3JYT A;  4DTS A;  3R6M A;  3SNN A;  4JKA A;  3PX4 A;  3HL8 A;  3CHW A;  1I94 K;  4B3S K;  1NGF A;  2IDO A;  4CEE A;  3SUO A;  2GWJ A;  3DLR A;  2P9I B;  4GV9 A;  2V7Z A;  1RDU A;  2H3G X;  1LCU A;  3GDQ A;  1X3M A;  4JD2 A;  1VSH A;  4AHC A;  5M1P A;  3KLF A;  1RBR A;  3T19 A;  3SUQ A;  4R5P A;  4CJV A;  3ZT0 A;  3WNF A;  2Q97 A;  5CYQ A;  3AO1 A;  5AR0 A;  4FJ8 A;  4LF5 K;  2UUB K;  1U6Z A;  4I2Q A;  2HB5 A;  4CVN E;  2KFZ A;  4CJS A;  3SPY A;  1QZ6 A;  2A6A A;  4IO8 A;  3THX B;  5IWA K;  3SJJ A;  5T7B A;  5E26 A;  5HRP A;  3L2W A;  5I3U A;  5FRN A;  4AH9 A;  4CBW A;  2W6L A;  2YNI A;  4O44 A;  1OH6 A;  1HR0 K;  4RW7 A;  3CJ7 A;  4DR1 K;  3HM9 A;  3CIP A;  3HZ6 A;  1NOY A;  5FLX O;  4QS9 A;  3VQC A;  3A5M C;  5SWM A;  3RRH A;  3AO3 A;  3RMD A;  4KTZ A;  3T1A A;  3TAB A;  1NU0 A;  4O5F A;  4N47 A;  1H1V A;  5F0X A;  4EZ9 A;  1LW2 A;  3AGR A;  4JI2 K;  3OYC A;  4JEP A;  2P9P B;  3LDS A;  4BDY A;  2A1R A;  1RDW X;  2Z1G A;  1IKX A;  5F1X A;  2YJF A;  4CGF A;  4CEF A;  5LJW A;  4ELT A;  1SL1 A;  3VEW A;  4DU1 A;  4KB0 A;  2YKM A;  1C1B A;  4KH6 A;  2QWL A;  1ITG A;  4XH5 A;  1NGC A;  4CZK A;  4Y1C A;  3TI0 A;  3MN6 A;  2ASP A;  1VHX A;  2NLX A;  3QB0 A;  3QFP A;  3CPE A;  3MK6 A;  3SZ2 A;  1ZBL A;  3U9D A;  3MED A;  3KLH A;  1ESV A;  3L4Q A;  2QWM A;  3O80 A;  4IXC A;  4HUG A;  3CD6 N;  3DXM A;  1N33 K;  3DRP A;  3OBY A;  3T1H K;  5AZI B;  2QW9 A;  4CEC A;  2O4I A;  3G0Z A;  3OYB A;  3ZEU B;  1N8R O;  3NDK A;  3VMF B;  3LM9 A;  1VSI A;  5AJ3 K;  1TKD A;  1QTM A;  2F9W A;  4M3U A;  1HUX A;  4WQ5 A;  3F9M A;  3ITH A;  4W5R A;  4M42 A;  3UKR B;  4A2A A;  4IEI A;  2G8K A;  1SUQ A;  1RT5 A;  1NGJ A;  3JSM A;  3SYZ A;  3K9J A;  4JI1 K;  3H45 C;  4BAC A;  3KZB A;  1S1X A;  3H46 O;  4JAX A;  3BY5 A;  1Z6R A;  1YAG A;  1KVB A;  4K41 A;  1VRT A;  4CJ5 A;  3VEY A;  4KAZ A;  1W0H A;  3AO2 A;  4QOZ B;  1KAY A;  1NK6 A;  1NNE A;  5JVH L;  3HPG A;  4GV3 A;  1T3V A;  3MEG A;  4PL7 A;  4DQQ A;  3V1O A;  4BQL A;  5J2P A;  2X6N A;  3PLA A;  3E1Y A;  2F8S A;  4G9Z A;  4YOR A;  4M3R A;  4HWI A;  2EHG A;  1HYS A;  2FBV A;  1WN7 A;  3WEE A;  3SQ1 A;  3AV9 A;  2ZGZ A;  3SJH A;  3K59 A;  4BRC A;  2P9K B;  3EY1 A;  3THW A;  3KWI A;  4OX9 K;  1T44 A;  3GBT A;  3D2F A;  2IOC A;  3H6E A;  1W2B M;  1SKS A;  3QIC A;  2IC3 A;  3SPZ A;  3S3M A;  1E3M A;  1BA1 A;  4LY7 A;  4HCC A;  3NAE A;  4FWQ A;  3DRS A;  4DKW A;  4JKC A;  4B1W B;  2Q0R A;  3WXJ A;  1KQS M;  2ZGY A;  4OPA A;  3FE1 A;  4CJR A;  4N5S A;  1UA1 A;  3WT0 A;  3C6H A;  4AHV A;  3SQ4 A;  4U67 L;  5KI6 A;  3ZSW A;  3PSF A;  4IFE A;  5EU7 A;  3LDP A;  1VQO N;  4E19 A;  2FBT A;  4CF9 A;  4M3Z A;  2QWO A;  3DJC A;  4J8F A;  1FK9 A;  2O4G A;  5CYM A;  3S9H A;  3F9K A;  4M63 C;  4C8L A;  3P1G A;  3A2F A;  3OS0 A;  4CF8 A;  4NLC A;  3O4N A;  3C65 A;  3SI6 A;  1JLE A;  3ATU A;  2QXL A;  3LPU A;  1NJY A;  2VWK A;  3I0S A;  4DV5 K;  4CES A;  1FKP A;  2OPQ A;  4E1M A;  4F3T A;  2EX3 A;  1HQU A;  3ZX3 A;  4DR5 K;  1TL1 A;  3THV A;  1MWK A;  4IFV A;  3O1B A;  4BRK A;  3SV3 A;  4JHD B;  1HPM A;  3J7Z O;  1DT9 A;  1L3V A;  2P9L B;  4FLU A;  3OYJ A;  1KAX A;  1QSY A;  4DV7 K;  4HTU A;  2GV9 A;  3IFR A;  4BY9 C;  3AAR A;  5AQO A;  3O3G A;  1EWQ A;  3HSC A;  3W0L A;  2UUC K;  1NGH A;  1ASU A;  4K0K K;  1DGK N;  3LP2 A;  1SL0 A;  1RDD A;  3K58 A;  4F2R A;  2V51 B;  3V9S A;  3L2Q A;  4FK4 A;  4RW6 A;  1VQN N;  2NRR A;  4XEI A;  4H8K A;  3L4I A;  3LDQ A;  2HHQ A;  1RT1 A;  4A59 A;  3TAQ A;  3T69 A;  5EXW A;  1JLG A;  4JI3 K;  4FWM A;  2ZM6 K;  5KRT A;  4FLV A;  3O3H A;  4RCH A;  1T05 A;  2V52 B;  1WBB A;  3LP1 A;  1QVF M;  3V1R A;  1BA0 A;  4C8O A;  5AZI A;  3CQ8 A;  3OYK A;  3LP3 A;  3UE5 A;  4ELU A;  4B3O A;  1GLE G;  3KD5 E;  5JLH A;  1MA9 B;  3JAM O;  1OH7 A;  4JN4 A;  3ZSO A;  4DV4 K;  1VQM N;  1HNW K;  4CJ4 A;  2A40 A;  3EZW A;  2CGJ A;  4BC2 A;  4JS5 A;  2VQF K;  3J80 O;  3AVA A;  4JKB A;  4B1Y B;  5C15 A;  1O1W A;  3QDK A;  3HPO A;  3ZSV A;  3TAR A;  4NCB A;  4DSE A;  4OLB A;  2FXU A;  3OYA A;  1NGI A;  1NMD A;  4M3X A;  4CIG A;  4DSL A;  3DOL A;  4DLG A;  2RF2 A;  3D6R A;  4RW9 A;  3NGY A;  2VWJ A;  5DK5 A;  2E20 A;  3VET A;  1GOA A;  3THY B;  3ZET A;  3KWG A;  2KHO A;  4U7B A;  1E4G T;  1KVA A;  3GG4 A;  2HST A;  4OJR A;  4O0I A;  3CMA N;  4C1N K;  3SV4 A;  5HRR A;  3D7E O;  3LAM A;  1VSM A;  3CFR A;  1QZ5 A;  4ISF A;  1SKW A;  3U4L A;  5GAE P;  1NK7 A;  1YF5 L;  4IOX A;  4Z0U A;  1X9W A;  2O8C B;  3FFI A;  4CJW A;  1QQN A;  1RT2 A;  2OTL N;  1Z05 A;  2HHH K;  4Z4I A;  3MN5 A;  4DV2 K;  2HBJ A;  4FJ5 A;  1OVY A;  3NMU A;  4JKE A;  3LWM A;  3U3Y A;  2OTJ N;  3QEX A;  3HXM A;  2JLE A;  3IKM A;  1T6D A;  1RCH A;  3P5J A;  2YHA A;  2ITM A;  4CEB A;  5BPL A;  4FK2 A;  4BGB A;  1J6Z A;  2A1S A;  2LSN A;  1VQP N;  1XHZ A;  1VQ9 N;  3CCV N;  5J2M A;  3K5M A;  4H0Y B;  2JGU A;  3M3Z A;  4FWP A;  4E0D A;  2CGL A;  4OGE A;  4H0O A;  4FWL A;  3PY8 A;  2XRI A;  1B92 A;  1LWF A;  4X62 K;  4F8R A;  3O9Q A;  2HMP A;  1RTJ A;  3RTV A;  3KHY A;  4OGC A;  2KW4 A;  3WQU A;  3EO3 A;  2GEM A;  4M3W A;  4IG3 A;  4CED A;  4YOY A;  3CCR N;  4FJG A;  4BRA A;  4FM1 A;  3CJ1 A;  2D4W A;  5AQT A;  3ZSX A;  2O8E A;  3BUZ B;  3MCP A;  1NJZ A;  1K8K B;  1RT4 A;  1RTH A;  3LAN A;  1YUW A;  3MEC A;  2HHX A;  4CCH A;  3QEW A;  3DLE A;  1IG9 A;  3BDP A;  1NGB A;  3ID6 A;  1N36 K;  1OH8 A;  2VG6 A;  4KTQ A;  1VSL A;  2CH5 A;  4H0V B;  4FLW A;  1IBM K;  3TPQ A;  2IS3 A;  1KLN A;  4JI7 K;  5CR4 A;  2OCE A;  3SAG A;  4I2P A;  3VEX A;  4X66 K;  3O3F A;  3OYE A;  1FXX A;  1N5Y A;  2ZWH A;  4M7Y A;  4RW8 A;  4F4K A;  1RFQ A;  3KTQ A;  4DQR A;  1DTT A;  4FM0 A;  3AVC A;  4DWI A;  1QE1 A;  3VQ7 A;  4FVM A;  1Q82 O;  4NCG A;  4BG8 A;  3NF8 A;  4GW6 A;  2A41 A;  3SQ2 A;  1VSF A;  1WAF A;  3HRG A;  1OH5 A;  1FW6 A;  1SS6 A;  3AO4 A;  3QBW A;  4Y1D A;  1KTQ A;  4JRP A;  4XIU A;  4GKK K;  3OTO K;  1NJX A;  1EP4 A;  3EEQ A;  4FCY A;  4H0P A;  1X9S A;  3ZX2 A;  1A5W A;  2HBK A;  1YI2 N;  3DXM B;  2G8I A;  3ZT3 A;  1TGO A;  4HVJ A;  4I9L A;  4UY8 O;  2P9N B;  4BVO A;  4FZY A;  4MDA A;  5BN9 A;  2IVO A;  4LH5 A;  3OY9 A;  3OYN A;  3MEE A;  3ZSR A;  2BUP A;  3VTH A;  3E66 A;  2F8T A;  1BOT O;  2NRX A;  2HOE A;  2O8D A;  3H1Q A;  1T7P A;  1T6C A;  4BRH A;  2OAN A;  4FJL A;  3LDO A;  3EE8 A;  3C6T A;  2VG5 A;  1FJG K;  3B8A X;  2YV0 X;  1EXQ A;  4WQ4 C;  1NOZ A;  2A42 A; 
#chains in the Genus database with same CATH homology
 3CJ9 A;  3VPZ A;  1O13 A;  3M6G A;  5CE3 A;  5LJW A;  3IDH A;  4IJN A;  3VEW A;  1Q86 O;  3CF5 L;  3ZX0 A;  2YJE A;  3LM2 A;  3MN9 A;  4KH6 A;  1HKC A;  5GAD P;  1VQ5 N;  2QWL A;  4XH5 A;  4WFN L;  1NGC A;  1IG8 A;  4I6M A;  1HKG A;  4FVU A;  4CZK A;  3CC2 N;  3MN6 A;  1GLJ O;  2ASP A;  4ILG B;  2NNW A;  4L3Q A;  4NLB A;  4WQ4 A;  5GIP A;  3CCQ N;  2NLX A;  3QB0 A;  3QFP A;  3CPE A;  3MK6 A;  3UKU B;  3W3D A;  3MCA B;  4A5A A;  1U2V B;  3U9D A;  4WFB L;  1ESV A;  5HOO A;  3L6Q A;  4H0X B;  3VES A;  3L4Q A;  2QWM A;  3I33 A;  3O80 A;  2P9U A;  2PBD A;  4IXC A;  3DXM A;  2NRW A;  3CD6 N;  3OBY A;  4B1Z A;  5AQX A;  5AZI B;  2IVN A;  2QW9 A;  3CER A;  3N4Q A;  4FSV A;  4BR9 A;  2E2P A;  2RHK A;  1NBW A;  3ZEU B;  5BN8 A;  3F5T A;  1N8R O;  3WXI A;  3AGK A;  3VMF B;  3GOI A;  3PIO L;  1M90 O;  1QHA A;  1ZXO A;  1RGI A;  3LM9 A;  5FPM A;  2F9W A;  3VF6 A;  1HUX A;  1YIT N;  4EFH A;  3AY9 A;  4WQ5 A;  2FSK A;  4CJ7 A;  2GEL A;  2D1K A;  3F9M A;  3MMV A;  1OKJ A;  2Q36 A;  2FSN A;  2W40 A;  2WUS A;  3BEX A;  3UKR B;  4A2A A;  1KXP A;  1QQM A;  3D2F B;  4CZJ A;  2P9P A;  3SAF A;  2YX6 A;  4WFA L;  1NGD A;  4IEI A;  3TTF A;  3VGL A;  4CZF A;  2V7Y A;  3GL1 A;  4CI6 A;  3O9U A;  3EKS A;  4JKG A;  1NGJ A;  4FOI A;  3I55 N;  1ILY A;  2QWP A;  5KQD A;  5F2R A;  1WUA A;  3K9J A;  5EY4 A;  3H45 C;  5AQH A;  3KK7 A;  2EWS A;  3CCJ N;  1M1K O;  3KZB A;  3C6A A;  4FO0 A;  4YOX A;  3H46 O;  4JAX A;  5C10 A;  3ID8 A;  1Z6R A;  2FF3 B;  1YAG A;  4IJA A;  1NGG A;  2CGK A;  4K41 A;  4K42 A;  1TYQ B;  3P31 A;  3VEY A;  4IDH A;  3SAH A;  3UKU A;  4YOT A;  1KAY A;  5TKY A;  3CJA A;  5JVH L;  5DM6 L;  3C7N B;  4GV3 A;  1T3V A;  3BF3 A;  4XH4 A;  4EIA A;  4PL7 A;  4JK7 A;  2VYP A;  4BQL A;  3PLA A;  4IZ9 A;  3E1Y A;  4G9Z A;  3J8A A;  2D0O A;  4YOR A;  2F7T A;  1TUU A;  3IUC A;  3G6E N;  4HWI A;  3ZEU A;  2QWN A;  2VGM A;  3WEE A;  2ZGZ A;  3WQT A;  4BRO A;  2KLA A;  5TKW A;  1GLC G;  3SJH A;  4H5T A;  2P9K B;  4O8U A;  5AQZ A;  4BRC A;  3KWI A;  3FZL A;  4RWT A;  3CJC A;  3UKR A;  1T44 A;  3GBT A;  3D2F A;  3H6E A;  2NRV A;  1W2B M;  3AAP A;  2E2Q A;  3MWT A;  3QIC A;  4JKH A;  3FFK B;  1K8K A;  2QTD A;  3EE9 A;  3HTV A;  1X9J A;  3O5B A;  4BRQ A;  1BA1 A;  3VTI A;  2FF6 A;  2P9S A;  4ILH A;  4FWQ A;  5LJV A;  3OW2 M;  3RSE B;  3O6W A;  2BTF A;  2VWB A;  4DKW A;  4EAH D;  3G71 N;  3LDN A;  4EHU A;  4JKC A;  2VGN A;  1MWM A;  4B1W B;  2A3Z A;  2GTD A;  2Q0R A;  3WXJ A;  1BUP A;  2ZGY A;  4OPA A;  4A5B A;  4CZM A;  1KQS M;  3FE1 A;  5AQL A;  3S41 A;  2J4R A;  3WT0 A;  3C6H A;  1V4S A;  4U67 L;  5AQQ A;  5KPT A;  1TYQ A;  5ELZ A;  3O8M A;  4H03 B;  3D2E B;  3DXK B;  4IFE A;  4NO7 A;  3BP8 A;  3LDP A;  1VQO N;  5C0Y A;  2Q0U A;  1NGA A;  1QQO A;  1SZ2 A;  3O1W A;  4FPA A;  2WBN A;  3ENH A;  3OBW A;  3VOV A;  5BRH A;  3QFU A;  3CJB A;  5E84 A;  4YOV A;  4Y0W A;  3DAW A;  1BU6 O;  2QWO A;  3DJC A;  4J8F A;  5AZJ A;  4H5V A;  4O8K A;  3P4I A;  5AQK A;  4M63 C;  4QS7 A;  2ZJP L;  3MWP A;  2YI1 A;  3FZK A;  3CI5 A;  1VAZ A;  3LL3 A;  4FWR A;  3WUH A;  4QS8 A;  4NLC A;  4RTF D;  3VER A;  4BR7 A;  3C65 A;  3H3N O;  1JJ2 M;  3I56 N;  3NVK A;  3UB5 A;  1YJN N;  3ATU A;  3PIP L;  2QXL A;  3U8X A;  1IJJ A;  4PKI A;  2P9K A;  4AM6 A;  4B1X B;  4DQ8 A;  1S22 A;  4CZI A;  5B8H A;  3CCL N;  4PKH A;  5KPZ A;  4IWV A;  1C0G A;  3MN7 A;  3ATV A;  3ZX3 A;  4Z94 A;  1NGE A;  3R3L A;  3CXC M;  1MWK A;  3CQY A;  3O1B A;  4FPB A;  1R59 O;  4H5N A;  1P90 A;  3WXM B;  4JHD B;  4BRK A;  3RSE A;  1DKG D;  1HPM A;  2QM1 A;  3EN9 A;  3ENB A;  3J7Z O;  1DT9 A;  5CHI A;  4K25 A;  4B1V A;  3VEZ A;  1NLV A;  2P9L B;  3HOT A;  2PAV A;  3DWL A;  2P9N A;  5BRF A;  3SLC A;  1KAX A;  2HBL A;  5BRE A;  4FWS A;  5AQI A;  4BRE A;  3IFR A;  4BY9 C;  3AAR A;  4JD2 B;  4KH4 A;  5AQO A;  3DXK A;  4FWO A;  4M7X A;  3O08 A;  3HSC A;  3OA9 A;  3W0L A;  5FPD A;  4H0T B;  3DLL L;  4BG9 A;  4BRP A;  1NGH A;  3FZM A;  2JWL A;  5EX5 A;  4BRN A;  1DGK N;  4PHT X;  3M5R A;  1GLB G;  3VF2 A;  3WXK A;  4IOA L;  5AQM A;  1GLF O;  2E2O A;  3N4P A;  4CD3 A;  2V51 B;  3SK3 A;  4OO1 J;  5M1K A;  1G99 A;  2QWR A;  1XUP O;  4ILJ A;  1ATS A;  2HF4 A;  1VQN N;  2NRR A;  2GWK A;  3A5L C;  3BF1 A;  4XEI A;  4AM7 A;  1C0F A;  2E1Z A;  1W97 L;  2ZF5 O;  3L4I A;  3LDQ A;  3JXU A;  2I7P A;  4JKF A;  3ULE B;  5HL7 L;  3HI0 A;  3VEN A;  3QBX A;  5GIN A;  3F2K A;  4A59 A;  4BRI A;  4FOE A;  2Q31 A;  1XC3 A;  3ZET B;  3EL2 A;  4BR0 A;  1S3X A;  3O9T A;  3T69 A;  1U2V A;  5EXW A;  3K9K A;  4FWM A;  2Q2R A;  4MDB A;  1Q7Y O;  4KH5 A;  4CZE A;  2YCH A;  3VGK A;  4JHD A;  3QML A;  4RCH A;  5BPN A;  2V52 B;  1QVF M;  3SBT A;  1VQ4 N;  4CBU A;  1BA0 A;  4IOC L;  2IIR A;  5AZI A;  2E88 A;  2E8A A;  3UE5 A;  1K8A O;  2GUP A;  2P9L A;  4H5W A;  4BRF A;  4FWN A;  1GLE G;  4MLE A;  5AFU A;  4GVE A;  5JLH A;  4FL9 A;  3U9Z A;  1MA9 B;  1E4F T;  4MO4 A;  4ISG A;  1SAZ A;  4JN4 A;  4XH1 A;  3Q7C A;  4NB4 A;  1VQM N;  4DHY A;  2ASM A;  3H1V X;  2A40 A;  3EZW A;  1DEJ A;  2CGJ A;  3P38 A;  5KPR A;  5JVG L;  4BC2 A;  1QVG M;  1YJW N;  2WC9 A;  3M1F A;  5AQP A;  1HX1 A;  1EO1 A;  2ASO A;  1HJO A;  4JKB A;  4B1Y B;  5AQN A;  5C15 A;  3A5O C;  1BDG A;  3R1X A;  3QDK A;  5GAG P;  3CC7 N;  5M1Q A;  4BR4 A;  1VQ6 N;  2FXU A;  1NGI A;  1NMD A;  2YHY A;  1K73 O;  1KAZ A;  3AAQ A;  4K43 A;  4BC3 A;  4YOU A;  4A2B A;  3FZH A;  3D6R A;  4HTL A;  2WFB A;  3ULE A;  2E20 A;  2ZJR L;  3FGU A;  5AQS A;  3CCE N;  1NM1 A;  3G25 A;  3A5N C;  3VET A;  4CZG A;  3VF4 A;  3WXL A;  5C2F A;  2BH1 A;  5AFU H;  1JCG A;  3ZET A;  2ZJQ L;  4WYB A;  1EQY A;  3LDL A;  2QEX N;  3KWG A;  2KHO A;  4U7B A;  1E4G T;  3C7N A;  5MLC Q;  5AQF A;  2KKZ A;  3GG4 A;  3L0Q A;  5M1F A;  2HST A;  5JLF A;  1NJI O;  5FPN A;  5DM7 L;  2W41 A;  3T7Z A;  3CCU N;  3CMA N;  5AQV A;  4C1N K;  1YHQ N;  1ZBS A;  3D7E O;  1JCE A;  1X3N A;  4JNE A;  1QZ5 A;  4ISF A;  3U4L A;  2NRH A;  1VQK N;  4BC5 A;  4IEE A;  4YDU C;  2NZT A;  1CZA N;  3SMP A;  4BRM A;  5GAE P;  3CCM N;  3CET A;  1YF5 L;  4IOX A;  1K9M O;  1MDU B;  1VQL N;  1YIJ N;  3CPW M;  5BR9 A;  1QQN A;  2YHW A;  4C23 A;  2UYT A;  2OTL N;  3O4W A;  4IO9 L;  3HBT A;  1KC8 O;  1Z05 A;  3ENO A;  3MN5 A;  3GE1 A;  2HBJ A;  1OVY A;  4H5R A;  3JS6 A;  4YDU A;  4C1N I;  3NMU A;  4JKE A;  3G4S N;  2OTJ N;  2HF3 A;  4JKG B;  3CC4 N;  1S72 N;  3IMX A;  4WCE L;  1LOT B;  3TSP A;  3IKM A;  4R79 A;  3FZF A;  1T6D A;  1VQ8 N;  4MLH A;  3TTD A;  3SMS A;  2ITM A;  5BPL A;  2Q1N A;  2DPN A;  1YXQ A;  1VQ7 N;  1HKB A;  4F9O A;  1BO5 O;  2NRZ A;  2QA4 N;  3NVM A;  1Y64 A;  3O9S A;  5AQY A;  1J6Z A;  4BGB A;  4BRG A;  5KQ8 A;  1TUY A;  1VQP N;  4BVP A;  4MO5 A;  4CBX A;  2E2N A;  1BG3 A;  3D2E A;  4B9Q A;  1VQ9 N;  3MX5 A;  3CCV N;  1P8Z A;  3C0B A;  2CH6 A;  2A5X A;  4LC9 B;  4H0Y B;  5EVZ A;  3M3Z A;  4FWP A;  2AP1 A;  2CGL A;  5C12 A;  4H0O A;  4FWL A;  1GLA G;  5M1O A;  3A0I X;  2AA4 A;  3FLC O;  3O9Q A;  4WQ5 C;  2HMP A;  1V4T A;  3CME N;  3KHY A;  2HBM A;  2F9T A;  3P39 A;  3WQU A;  4B1U B;  3EO3 A;  2GEM A;  4OPH A;  5LY3 A;  4YOW A;  3OHR A;  3TTC A;  4KBO A;  3WEE B;  4YOY A;  3CCR N;  4GV6 A;  4PKG A;  5H1S Q;  3TU5 A;  4BRA A;  5AQU A;  5BPM A;  5JIC A;  1ATN A;  3MDQ A;  2GX9 A;  3Q7B A;  5C2D A;  3CJ1 A;  4WF9 L;  1D4X A;  1KD1 O;  3E9L A;  2D4W A;  5AQT A;  4BR5 A;  2YHX A;  4EHT A;  3BUZ B;  3E9P A;  3MCP A;  5FPE A;  1K8K B;  4AF1 A;  1YUW A;  2IVP A;  5AQW A;  5I9E B;  2P9S B;  3R6M A;  4JKA A;  2FSJ A;  3CHW A;  2QWQ A;  1NGF A;  2E1Y A;  2RE2 A;  1NGB A;  3ID6 A;  3TSU A;  4BGA A;  1ZC6 A;  2GWJ A;  2P9I B;  4GV9 A;  2CH5 A;  2V7Z A;  4H0V B;  3SBG A;  3TPQ A;  3FR0 A;  1RDU A;  4ISE A;  4A57 A;  2H3G X;  1LCU A;  3GDQ A;  1X3M A;  4JD2 A;  5M1P A;  5CR4 A;  3SAG A;  3VEX A;  3MX2 A;  2ZWH A;  4M7Y A;  4BRL A;  1RFQ A;  2I7N A;  4JK8 A;  2Q97 A;  2VCP A;  3O9R A;  4JK9 A;  1JCF A;  5AR0 A;  5GAH P;  5AZJ B;  3VEV A;  3TSQ A;  3HM8 A;  1NWK A;  4WQ4 C;  4DCH A;  1Q82 O;  1ATR A;  2D0P A;  5JMV A;  4BG8 A;  1U6Z A;  4JKD A;  2A41 A;  3EKU A;  1SQK A;  1YJ9 N;  5GIO A;  3HRG A;  1QZ6 A;  2A6A A;  5AQJ A;  4A61 A;  4IO8 A;  4BC4 A;  2FLO A;  1SS6 A;  3QBW A;  5BRD A;  5ADX A;  1Q81 O;  3E9O A;  4A62 A;  1WOQ A;  5AQR A;  4I6M B;  2NRT A;  4PL8 A;  5E26 A;  4BR2 A;  4CZL A;  5EOY A;  4CD1 A;  3CCS N;  5M1N A;  5AQG A;  3I8B A;  4CBW A;  4H0P A;  3ZX2 A;  4CZH A;  2HBK A;  1BWF O;  2P9U B;  1GLD G;  3RVC A;  3DXM B;  1YI2 N;  4DB3 A;  3CJ7 A;  4GY2 B;  4FWK A;  3CIP A;  3HZ6 A;  3VGM A;  3ZYY X;  4UY8 O;  2P9N B;  2P9I A;  4QS9 A;  3R8E A;  3A5M C;  4BVO A;  4MDA A;  5BN9 A;  2IVO A;  4GNI A;  3R9P A;  4BQZ A;  2BUP A;  3KVG A;  4O5F A;  3VTH A;  2PFU A;  3E66 A;  1H1V A;  4BRD A;  1BOT O;  5F0X A;  1XQS C;  5ADX H;  3AGR A;  2NRX A;  2HOE A;  4JEP A;  2P9P B;  3H1Q A;  3H3O B;  3VEO A;  1T6C A;  4BRH A;  4E1J A;  1YVN A;  2QI2 A;  3CQX A;  2OAN A;  1RDW X;  3HOS A;  3LDO A;  3EE8 A;  3A8Y A;  5F1X A;  2YJF A;  2JWK A;  1HLU A;  3B8A X;  1Q18 A;  1GLL O;  2A42 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...