3CF5L

Thiopeptide antibiotic thiostrepton bound to the large ribosomal subunit of deinococcus radiodurans
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
104
structure length
104
Chain Sequence
RRKLRTRRKVRTTTAASGRLRLSVYRSSKHIYAQIIDDSRGQTLAAASSAALKSGNKTDTAAAVGKALAAAAAEKGIKQVVFDRGSYKYHGRVKALADAAREGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S RIBOSOMAL PROTEIN L33
publication title Translational Regulation Via L11: Molecular Switches on the Ribosome Turned on and Off by Thiostrepton and Micrococcin.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 17
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2008-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00861 Ribosomal_L18p Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.100 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3cf5L01
1VQ9N 2ZJPL 5GAEP 3CCEN 3CD6N 5HL7L 5DM6L 1KD1O 1YJNN 1YHQN 1VQ6N 4UY8O 3G71N 1VQ4N 3CCUN 3G6EN 3CCMN 2OTLN 1M90O 1VQON 1QVGM 3CC7N 2ZJQL 3CPWM 3CF5L 5DM7L 4WFNL 1Q81O 1YJ9N 1QVFM 1YI2N 4IOCL 1JJ2M 1K9MO 1YITN 4WF9L 5JVHL 1YJWN 3DLLL 5MLCQ 3CCQN 5GAGP 5H1SQ 3I55N 4WCEL 1VQLN 1YIJN 3CMAN 1VQ8N 3PIOL 1Q7YO 1VQ7N 3CCVN 3CCSN 4IO9L 3PIPL 3CCLN 1VQMN 3CCJN 3OW2M 2QEXN 4WFAL 1OVYA 1Q82O 1ILYA 1KQSM 2ZJRL 1VQNN 1NJIO 1N8RO 3CMEN 5GADP 1KC8O 1K8AO 4IOAL 3CCRN 3CXCM 5JVGL 3CC2N 3I56N 1S72N 2OTJN 1K73O 3G4SN 4WFBL 1W2BM 3CC4N 4U67L 1VQPN 5GAHP 1Q86O 1M1KO 1VQ5N 1VQKN 3J7ZO 2QA4N
chains in the Genus database with same CATH superfamily
4FLZA 2WONA 1I39A 3VETA 4LFBK 3D2EA 1YHQN 3JS6A 3GOIA 1JLQA 3U3GA 3SJHA 2E2PA 3G6EN 1ATNA 1XC9A 1SL1A 5F2RA 4FZZA 2OTLN 1ASVA 3ZLJA 4AM6A 3O5BA 4I2QA 2PBDA 3MECA 3VGKA 5AQMA 4DHYA 1CXQA 2QI2A 3VEZA 2V52B 3K0SA 3LAKA 2P9LA 3O1BA 1TL3A 4CIFA 4GY2B 1BI4A 1RTJA 2E2NA 1TV6A 5AQQA 1KXPA 4PA1A 4BG8A 4DG1A 1RBUA 4BQLA 2KZZA 3WXKA 4NLCA 2IS3A 3DLLL 3LZJA 4KTZA 3VEYA 1HR0K 2AP1A 5AQOA 4J2DA 1RBRA 3TAGA 1NKEA 5GIOA 4FM1A 4EZ6A 1C6VA 1RDAA 4C1NI 2IVPA 2D0OA 4BE2A 1XNRK 2RN2A 1TK0A 2W42A 2HHHK 2P9KB 4FWRA 3GE1A 4FM0A 3WUHA 2ITMA 3PO5A 3QEXA 2XY5A 3LDOA 2RE2A 2A5XA 3OW2M 2HB5A 4CJPA 4FLTA 5A2QO 2GTDA 1IJJA 5BN9A 5EY4A 1NGCA 5HP1A 1BUPA 3CQ8A 2QWRA 3AARA 3RVCA 3VQEA 1TAQA 3KK3A 4E7LA 1K8AO 1V4TA 5AZJB 4OPAA 5KQDA 2OZSA 4DSEA 3MAQA 1UOCA 4DTNA 4FWSA 4CD3A 3VA0A 3KK1A 4RW8A 3H3OB 4FLXA 1DEJA 1VQPN 3K59A 5BREA 1QTMA 1YAGA 1GOCA 3HPGA 1RTIA 3SBGA 4AHCA 3CJ7A 4CJTA 1BOTO 4C8MA 4A59A 2RHKA 4OX9K 5M1QA 5BN8A 4DWIA 3FFIA 1IV0A 1JLGA 3K57A 1I94K 2I7NA 3VEVA 4FXDA 1GLCG 3QINA 3CIPA 2HMIA 1KD1O 3OYHA 3TAPA 4IZ9A 4Z4FA 1HMVA 1CZ9A 1XQSC 2JGUA 1T8EA 4B9UA 2FBVA 3QBXA 1X9WA 5M1KA 4PWDA 2GUPA 3C6AA 1KCFA 2VWBA 4BQZA 4HUEA 2G8FA 3KKSA 4ILHA 1OH7A 4IBNA 4A2AA 1TK8A 3DI6A 3M8SA 2P9KA 1NK0A 3CQYA 3LDLA 4IOCL 1HPMA 2X6NA 1MWMA 5AQUA 4FO0A 1OKJA 4ISEA 4DTSA 2F9TA 1KAXA 4JI7K 3TAFA 5I42A 4Z94A 4O44A 4LF4K 1ITGA 3LANA 1FKPA 4FSVA 5GAGP 4FCYA 2HVIA 4KBOA 5ADXA 3SV4A 4FJXA 1OH5A 3AVKA 2NRZA 3DWLA 4NYNA 2ATQA 3PO4A 2Q36A 3SBTA 1VQLN 4CJEA 3TPQA 5AZJA 1KTQA 4B3TK 2ZD1A 5KQ8A 3DM2A 3CCLN 2P9NB 3AVCA 5B8HA 1IBKK 1JL2A 1RILA 4B9VA 3CG7A 5EVZA 2A40A 5TKWA 4WFAL 1JLAA 3LP1A 3AA2A 3QEPA 4OJRA 3QFPA 5AQKA 4A62A 2UXBK 5KPZA 4E0DA 4C1NK 1X9SA 1EXQA 3DXMB 4OPKA 1HKBA 3CMEN 3NDKA 5I9EB 3QIOA 4MO4A 5FLXO 4HTLA 3TI0A 1U48A 3F9KA 3D6RA 4CGFA 2ETJA 3SMSA 4YFUA 3KLHA 3A5MC 4CBUA 3QB0A 1IG8A 1YT3A 3ZT2A 4F4KA 3AAQA 1ZBIA 1DKGD 1NGGA 4DUZK 5I3UA 2OA8A 3OS1A 2GX9A 1W0HA 1KVCA 3SI6A 3D2FB 1BISA 4CEBA 4FJ7A 4MLEA 1YF5L 1BIZA 3LAMA 1R59O 2GWJA 2EHGA 3CC7N 3SQ4A 3MX5A 2ZJQL 4N56A 4HCCA 5HBMA 3TAMA 1JXEA 4DCHA 1ZBLA 4AH9A 2F9WA 3V9WA 4EFHA 2P9NA 2QKBA 3DLRA 2D0AA 1TYQB 3VQ8A 3OYCA 4BWJA 4GV9A 4LSLA 4CJUA 4CHOA 1EX4A 4DF4A 5E41A 4ZHRA 3SMPA 4N76A 4FOEA 3IMXA 4I9LA 3ZYYX 2CH5A 4BRIA 3DXMA 4IFYA 3WT0A 3IRXA 3VEOA 4EIAA 1S1WA 1OH6A 4C8LA 1RDWX 1J5OA 1RT2A 3V1RA 3AVBA 2HNZA 4BRQA 1HYZA 3EZWA 4CEDA 1QE1A 3PIOL 1VQ8N 4DR6K 4IEIA 3CCVN 3HSCA 2HHTA 3CERA 3DLEA 3HVRA 1NGAA 4H5TA 3H1VX 1VQMN 2ASPA 1X9MA 1D4XA 1HKCA 5FPNA 2YNHA 2HNDA 2Q3SA 2W40A 2BTFA 4OO1J 4WQ5A 1KSPA 1IBLK 3HOTA 2ZGZA 2HBKA 3KLIA 3VQ7A 4ILGB 1KAYA 2P1JA 3D2FA 1TKTA 4CERA 3OYMA 5BPLA 3TSPA 4BRAA 1HUXA 2KLAA 1LW2A 2OCEA 4FZXC 1K73O 4KTWA 1HYSA 4YOTA 2HHVA 4B1ZA 4LF9K 4M3TA 5EOYA 5HOOA 3I8DA 3KK2A 2FSJA 2BGGA 1M1KO 4EP4A 3C94A 1TYQA 1ATRA 3OYNA 3QESA 3KD1E 4NYFA 3SNNA 1RTDA 4BC2A 3BUZB 1IG9A 4L8RB 5AZIB 3CCUN 2BDPA 3I8BA 3RMDA 4KHQA 3B6OA 3P1GA 1QS4A 3ID8A 4BC5A 4PL7A 3CF5L 1TKXA 1HQEA 4LF7K 4IOXA 2IGIA 5AFUH 3R9PA 4ICLA 3CFOA 1L3UA 2QWLA 2F8SA 4RG8A 3ULDA 2KFNA 3ID6A 4JD2B 4PKHA 4FJ8A 3F9MA 5IWAK 2DY4A 4FWPA 4H0PA 1XMQK 5MLCQ 3NVMA 1FKOA 3I33A 3K58A 4BG9A 4CIGA 4FJGA 3BEXA 3FZFA 3KHYA 2E6MA 3UB5A 3THWB 3HJFA 1Q7YO 4B3SK 2QTDA 3WNEA 4CF9A 4HHTA 1WSEA 3PX4A 2DFEA 1NJZA 3EN9A 1YTAA 1K8KB 4CHNA 4RW6A 1Q9YA 1YVNA 2V7ZA 3PLAA 5FPEA 4CJ4A 3RR8A 4B8AB 4PKIA 3VPZA 4DV0K 4DSJA 4JI5K 1C0FA 2OPRA 3HI0A 4BR5A 2IAJA 1HJOA 3TSUA 4B1YB 2QXLA 3SUPA 2W6LA 4IOAL 5AZIA 4KH6A 2UYTA 4DF8A 1TL1A 3KLFA 3QIPA 2O4IA 1WN7A 4M41A 3AVIA 1VSJA 4WFBL 3DMJA 4PL8A 1YVUA 3CM6A 3J8AA 4FJJA 2P9PB 3T3FA 4FVMA 3C65A 3ZETB 3TTFA 2YHWA 4HTUA 4DTMA 1BG3A 5FPDA 3VQ5A 3EKUA 4JD2A 1UWBA 1U2VB 1SKRA 2J4RA 1T7PA 2F8TA 2W6KA 2XY6A 5HLFA 4M63C 1B92A 4MQ3A 3M8QA 2NRWA 2WUSA 5J1EA 3AGRA 3FZHA 1HPZA 3IFRA 2E5LK 1T3VA 1S6QA 4Z4IA 2ZF5O 3A0IX 2YHAA 3DAWA 3VF2A 3THWA 4QS9A 5C2DA 3OYKA 3ZX0A 5BR8K 4FJ5A 3M8RA 3EEQA 1EP4A 1RCHA 4NO7A 4FK4A 4Y0WA 2WTUA 1Z26A 1SZ2A 2VGNA 3K5NA 2D0BA 3CFRA 1K8KA 4FK0A 3LP2A 5CYQA 1Z25A 4DU1A 3MN5A 5BPMA 1S1TA 2G8HA 3V81A 4GV6A 1NNEA 4X65K 4YHHK 2JWLA 3NAEA 4C8KA 3W0LA 1NOYA 3WEEB 3MXJA 1VSKA 4JI2K 1E3MA 1HNZK 1KRPA 1VAZA 3DLGA 5AFUA 1NGEA 1JCEA 3HP9A 4KB0A 4YOXA 4EAHD 1WSIA 4MO5A 2E20A 4MLHA 3NH2A 2P9PA 4JK7A 2QEXN 2UUCK 3CJ9A 2G8UA 4DV7K 2DTUA 3ZETA 3MN7A 3FZMA 3SPZA 1VHXA 2BE2A 3MMVA 1VQNN 4O55A 2YHXA 3QO9A 1U2VA 1CLQA 2VQEK 3I0RA 4JKFA 4O8UA 4MDAA 2YNGA 4O4GA 3E9LA 2BH1A 2NRRA 4H0TB 3KKRA 1J54A 3UKRB 4W5OA 1N5YA 1KLNA 4NCBA 2O8FB 1U47A 3K9JA 3QFUA 3HBTA 4HVJA 1EQYA 3QNNA 1EO1A 3P38A 2CGJA 3LWLA 4M7YA 1T44A 4QCLA 3SAGA 4DS4A 5AQLA 3LALA 4BRFA 3AA4A 4G9ZA 4LF6K 4CZMA 3D0PA 1C0GA 4N5SA 2HHWA 4ELTA 1NU0A 4BACA 1M90O 4ISFA 3ZX3A 4BY9C 3T19A 4FJKA 2FF3B 1HNXK 3WEEA 3F5TA 1JXBA 4KFBA 3CPWM 5AQWA 1S3XA 2VWKA 3T1YK 1XHZA 3DLKA 1NWKA 1Q18A 3VOVA 1QVFM 4NXNK 4CZLA 3J7AP 1YI2N 4FLUA 3KLGA 3SAHA 1BO5O 4TSXA 4DFPA 4JLHA 5KGXA 4LD0A 2EX3A 1S9EA 1HX1A 1LV5A 3BGRA 4CESA 1TUYA 1WB9A 3SAFA 4DFMA 2DFHA 5JS1A 1KVAA 1NJYA 3KIOA 3E01A 4F3OA 4CK1A 1A5XA 1Q8IA 4M3XA 4FWLA 3CCSN 1IKWA 3UKRA 4BRDA 4LH5A 1G15A 2O8FA 1U4BA 4IFVA 3PSFA 3VQCA 2HHQA 5CYMA 3LDQA 3MWTA 3L2RA 4HCBA 2E1ZA 2G8WA 1Q82O 1A5VA 2IDOA 2UUBK 4BRPA 4JS4A 4DFKA 3EZ5A 3K5MA 3AO4A 3H46O 2YNFA 1HKGA 2B4JA 4KREA 1J9AA 2QWPA 4DLEA 1NJIO 1NLVA 3DJCA 5AR0A 4JNEA 1TKDA 3R1XA 1X3MA 3BZCA 3ENOA 5BPNA 1Y64A 3SUQA 5KI6A 3CC4N 1X1PA 4CECA 1S22A 3WXIA 3O3FA 3WXLA 3EY1A 3ZSOA 1T03A 1VQ5N 1LAVA 2YI1A 3BF1A 3RWUA 1KVBA 4FPBA 4RCHA 1MWKA 1ZYQA 4E89A 4FLWA 4GVMA 3V9ZA 1NGBA 1YTUA 3IS9A 5C2FA 4GKKK 2HBJA 3NCIA 2F7TA 2NNWA 1ZXOA 1VQ6N 1WSGA 1NGHA 1NGDA 3DOLA 5C24A 1FW6A 4IFEA 3TTDA 1O1WA 3S3OA 3HK2A 4CHYA 3MWPA 3NGYA 2HBLA 3T1HK 1L5UA 4ZTFA 4CJFA 4AM7A 1Q81O 2B6AA 3SQ1A 4GVEA 3D7EO 1VSHA 1HLUA 1I3AA 4OPJA 1T05A 3VEWA 4Z4HA 4NB4A 4FWQA 4Q5VA 2Q0UA 2O4GA 4F9OA 4WF9L 3O8MA 4DV4K 3CCQN 4H0VB 3HPHA 1NMNA 3A2FA 4KO0A 4CK2A 4I2PA 3ZSVA 2I5JA 4AILC 4BR0A 3P31A 4CEZA 1N33K 4O8KA 1SKSA 5DMRA 2D5RA 5M1FA 1VRUA 4Z4CA 4OKKA 1B9FA 2QXFA 3VMFB 4B1WB 4BRGA 4LFAK 1ILYA 1S1XA 4CZGA 3LM9A 1LAWA 1QQCA 4GNIA 4KRFA 2YCHA 1BIUA 3CXCM 4FZYA 3ZT0A 1NKBA 1BL3A 1BWFO 4K25A 3FZLA 3G4SN 4NXMK 3AVGA 3O9QA 3VGMA 2B5JA 1U45A 1SS6A 4U67L 3V9SA 4GMJB 5AQTA 2P51A 3BP8A 3C0BA 4E1JA 3OYAA 4CE9A 5E26A 2P9IB 4CGIA 4OKJA 5GAEP 1HYVA 4YY3K 3IDHA 4XIUA 4CF1A 2V51B 1N32K 3OHRA 5HRPA 2LSNA 3PX0A 1D8YA 4H5RA 1VSIA 1U6ZA 1FXXA 4DTUA 3J81O 3L2QA 5M1OA 4JS5A 4F2SA 1RT3A 4A5BA 4WFNL 1ASWA 4GKJK 3T7ZA 4BE0A 4HWIA 4DTOA 4JK9A 4KB1A 5JVHL 4CK3A 2HHXA 2A42A 4FJ9A 1MA9B 3L8BA 1HRHA 1GLEG 1DTTA 1EETA 3CJBA 5AQRA 3EE8A 2YJFA 1NK8A 4CGGA 5IT9O 1RT7A 3HVTA 3WNFA 3SUNA 3NGIA 2KHOA 4DFJA 5JLFA 3DYAA 3AVFA 4IO9L 3G25A 3RMCA 3PIPL 1LCUA 3ASMA 1BGXT 4CEFA 3CCJN 4U7BA 4RW7A 1S9GA 3AY9A 5FRMA 3HL8A 3VF4A 3VQ4A 4LFCK 3QICA 4DR5K 5J2MA 2Z1JA 2P9IA 3HXMA 4BRMA 1JLCA 4JI6K 4DR7K 3G10A 4RTFD 4DQPA 3B8AX 1A5WA 3CETA 1XNQK 4CVNE 4ISGA 2EWSA 1NK5A 1RT1A 1W2BM 2PYJA 5BRHA 3UE5A 3CYMA 3Q7CA 4H5WA 4AHVA 1QHTA 3WQTA 2QKKA 4Q0BA 3OBWA 4JK8A 1P90A 3CI5A 4OGEA 3VN5A 4B1VA 3GL1A 1NJWA 4M3WA 4YOYA 3LWMA 1U49A 1CZBA 3ZCMA 3OS0A 4UY8O 4KHUA 4XH1A 3WXJA 3O9UA 2GELA 1VSMA 3O3HA 4CF0A 3H1QA 4FWOA 2NRHA 2IOCA 1ZBSA 5AQVA 5TKYA 3VTIA 3U9DA 4DUYK 1K9MO 4JKGB 3U6FA 3TAEA 3QEVA 4B9TA 2QWMA 4M45A 5M1PA 4FJHA 4DV2K 3A5LC 4BDPA 3RR7A 3A8YA 3BDPA 4CJQA 4K43A 1WLJA 4F3TA 1VSDA 3O6WA 5CE3A 3O9TA 2WFBA 4CJWA 5H1SQ 4L3QA 2P9SB 4DR4K 3HP6A 3I55N 4M3ZA 3V1QA 1ZBHA 3LDPA 1EKEA 3MXIA 5AJ3K 4BGAA 1YIJN 1REVA 3UKUB 1MDUB 1VQ7N 3RRGA 4I9QA 3CPEA 4AQYK 4KPYA 2KTQA 2KW4A 5EXWA 1RT5A 3NFAA 3LP0A 2VCPA 3O4QA 4DTJA 4FLYA 2RPIA 3NH0A 1BQNA 3AGKA 2FSKA 1KQSM 2X78A 1OH8A 5DK5A 4H4OA 4JYAK 3M1FA 2O8DB 1XC3A 3OVNA 2CGLA 4LF5K 1WAJA 4O5BA 2GUIA 2A6AA 4K0KK 5F0XA 4BR4A 3LPUA 4FJMA 4DB3A 1GLLO 2A1SA 4BC3A 1CZAN 2QWQA 3QEWA 3RMBA 4CIEA 2NRTA 2BANA 4QAGA 4K42A 5LMUK 4CZJA 1RBTA 3MDQA 2XRIA 1XHXA 5D3GA 5KRSA 4JKGA 4DR1K 1HNWK 2VQFK 2JLEA 3OYEA 2YKMA 4DTRA 1C1CA 3AVHA 3HRGA 5HL7L 1GLBG 3T69A 5T7BA 2O8EB 4IDHA 4LY7A 3BF3A 3L2UA 3ULEB 2P9SA 4C8NA 2IC3A 3CCMN 2Y1IA 1QVGM 3NF6A 1WSHA 3UKUA 2FXUA 3CHWA 2HSTA 2NUBA 3R8EA 1RFQA 3K5OA 1ZBUA 1ASUA 1RDDA 4I6MB 2E6LA 3J7YP 1NK6A 3MEGA 2ZE2A 4BRCA 4FLVA 1YITN 4XH4A 3CQXA 5CY4A 1IKYA 1J5EK 4B3RK 4HUGA 4WQ5C 2F96A 1FK9A 1E4FT 2O8DA 4CFCA 1EWQA 2Y1JA 5LL6Z 5AQHA 3P5JA 2P5GA 4CZHA 1NGJA 3HO1A 2QK9A 2ZGYA 3QETA 3VQBA 3R3LA 2G8IA 3TAQA 1S1VA 5LJWA 3HSTB 4J2AA 4W5TA 4B3MK 5CZ2A 3V6DA 1X3NA 3E9PA 4JKCA 4K8XA 2VG6A 4MFBA 2UXCK 3NF7A 3GDQA 4RWTA 3K9KA 2VGMA 1NOZA 3HPOA 1DGKN 1Y97A 1ZBFA 2CH6A 4CZIA 5GADP 2YHBA 3SV3A 2A41A 4IKFA 5JMVA 1BA1A 2XHBA 3ATVA 2NRVA 3M8PA 4DSKA 4BDYA 2E2QA 2O8EA 1X9JA 5JVGL 3CC2N 4CHZA 4J8FA 3ULEA 3PX6A 1BA0A 2OTJN 5CR4A 1TVRA 2BUPA 2H3GX 3VEXA 1HNIA 4A2BA 1SQKA 3E1YA 1NM1A 4NLBA 3QNOA 3S3MA 4OKEA 4PQUA 2ZQBA 5ELZA 3KVGA 4DSFA 4I6MA 2WOMA 3BZKA 2PY5A 3L2WA 3GG4A 2KKZA 3D45A 4BRHA 4UQGA 1VQ9N 4C8OA 4DV3K 3MX2A 3CCEN 3MCAB 4CGHA 4IDKA 1YJNN 2JWKA 4CJSA 1WAFA 1JLEA 4IXCA 3AAPA 2PYLA 5KPRA 2G8VA 3L0QA 1W7AA 4A57A 1C0MA 4CI6A 4V19S 3O08A 5DM7L 4ELUA 1YJ9N 5GIPA 3NBPA 4CEAA 1LWCA 2KQ2A 1LW0A 4FOIA 3VF6A 2ZWHA 2G8KA 2Z1GA 3LL3A 1WBBA 4G1QA 1QQOA 3C6HA 4Z4EA 4KTQA 4DV1K 3JSMA 2WC9A 3AO5A 4IJAA 3VERA 4H0YB 3THVA 4W5RA 1Z6RA 3WNGA 3J80O 1BU6O 3SQ0A 1VSEA 1HNVA 3CJ1A 4BRNA 4DSLA 3P83D 4CJLA 4Y1CA 4E1MA 3A5NC 4E3SA 4CCHA 2E88A 4FYDA 1VRTA 4O5FA 1NGIA 3B6PA 3M6GA 3VQAA 1C0TA 2OPSA 1NK9A 3THYB 2VG7A 5BR9A 4DSIA 3SUOA 3VTHA 4RW4A 4CF2A 4B9LA 3ZSQA 1LWFA 4KH4A 4AF1A 4YNQA 2HOEA 2YV0X 1N6QA 3SK3A 3TSQA 4DU4A 1RT4A 5AQXA 4BR2A 1VSFA 4DTPA 4I7FA 4F8RA 3JAMO 3FLCO 3S3NA 2D1KA 1ATSA 5ADXH 4AHSA 3U3YA 1SUQA 4H5VA 4R79A 2DFFA 3IUCA 1NGFA 3ITHA 3VQ9A 2XO7A 2OPQA 5GAHP 1WUAA 4BE1A 1OVQA 4CGJA 3ENHA 4CEOA 4JKEA 4CW7B 2Z1HA 4CEEA 3VA3A 4IJNA 2ZJPL 3L6QA 5AQYA 2YKNA 2Q2RA 4M7XA 4H0OA 3U9ZA 2PAVA 4DQ8A 4Z0UA 3H45C 4YOUA 2Q31A 3TR8A 3AVNA 4YOVA 3EYZA 1E4GT 3NGZA 4EHUA 4H03B 3V1OA 2O8CB 1QZ5A 4FPAA 1HQUA 4IO8A 3ZSXA 3AVLA 4B9SA 1NG9A 3PY8A 1JCFA 1QQMA 3THYA 3CJAA 4WQ4A 4CHPA 1H1VA 1BCMA 4CBXA 4BVPA 3ZX2A 3K2PA 3E66A 1SL2A 4KHYA 2A3ZA 1D5AA 3O4NA 2VWJA 1SAZA 1KFSA 3VQDA 4KHSA 3L4QA 1WNSA 4WCEL 4DV5K 2FC0A 4K41A 4J2EA 3CMAN 4KV8A 3C7NB 3LDSA 1GLDG 4CFAA 1B9DA 4F2RA 1GOBA 1WOQA 3OYDA 4J2BA 4AHUA 3IAYA 4DV6K 3MXMA 1T6DA 1DTQA 1GLAG 3MCPA 4FVUA 3EL2A 3OYGA 3LZIA 3AO2A 1EWRA 3O4WA 4HUFA 4K8ZA 4W5NA 4A5AA 1KC8O 3E9OA 3NF9A 3AV9A 1WSJA 4BVOA 4CJ3A 2R7YA 3V9UA 2QWNA 4PKGA 4FWMA 4B1XB 3DXKB 1QSSA 3AVAA 4LC9B 4CD1A 3I56N 1S72N 4EHTA 5M1NA 1KFDA 4FJIA 2GEMA 2YJEA 3AA5X 3ZEUB 1GOAA 3PUFA 5HRRA 4CZEA 3V9XA 4FK2A 4M42A 2O8CA 2GV9A 1UAXA 3WXMB 4JI0K 4CFBA 1VQKN 4B9MA 5C10A 2UXDK 3L3VA 4NCGA 2Z1IA 3N4PA 1C0UA 3JYTA 3SQ2A 2ASMA 1YXQA 3IG1A 5LMNK 1WBDA 3KK7A 1VQON 4H8KA 4PY5A 5EU7A 3C7NA 4E7IA 1NBWA 1Z05A 5C42A 2W41A 4B9QA 4DQSA 5J2PA 1JJ2M 3MEDA 1FJGK 1TKZA 1Q9XA 3QBWA 3PSIA 1IKVA 4FL9A 3O3GA 3FGUA 5FROA 4KHNA 4MDBA 3P4IA 4AHTA 5EX5A 4IWVA 2HHSA 2PFUA 1QQNA 2D0CA 3DXKA 4BR7A 5C15A 4DR2K 1XI1A 4ELVA 3M5RA 3AO3A 3ZEUA 3TTCA 5HRSA 3L3UA 4NCAA 4OVLA 4A61A 1XWLA 3SCXA 1OVYA 2PZSA 1LOTB 4CZFA 4CJ7A 3O9SA 3LPTA 3L2VA 5JS2A 3K5LA 2FBTA 3ISNC 2RKIA 1BCOA 4DMNA 5SWMA 1RDBA 4WQ4C 3U4LA 3TANA 4JKHA 3R6MA 2D4WA 4M3RA 3NVKA 4KI4A 3OJUA 2HHUA 3ZT3A 2UU9K 5C12A 3NE6A 3O80A 2DPNA 4CGDA 4ID1A 1RBSA 1HJRA 3KJVA 4CJRA 1S6PA 4CZKA 3RMAA 1ESVA 1JLBA 2ASOA 4FWKA 3CM5A 3BY5A 2VYPA 3DRRA 3CD6N 4BDZA 1W9HA 3FR0A 3KZBA 4OGCA 4FW1A 4BREA 4JI1K 4BWMA 4DR3K 5J2NA 1S1UA 5AQFA 1D9DA 3THXB 3NF8A 2WBNA 4E7HA 2HW3A 2XY7A 1MU2A 5C25A 5LY3A 3OS2A 2Q0RA 4C23A 4AHRA 4JI3K 3G0ZA 3OTOK 3PV8A 4IG3A 4Z4GA 4CBWA 4QS7A 2P5OA 3LDNA 3VQQA 3W3DA 3VENA 4KI6A 1YUWA 1YJWN 3AA3A 3QLHA 3QERA 3LP3A 2IIRA 4GV3A 3H3NO 2QW9A 3H6EA 4DTXA 4ID5A 4YDUA 3WNHA 4DQIA 2FBYA 3HM8A 2Q1NA 3ATUA 1L3SA 5CHIA 4PHTX 4ILJA 2E2OA 3OYJA 5JICA 1O13A 3P39A 3ALYA 1BQMA 1RBVA 3ZSYA 4R5PA 3OBYA 3SLCA 1SKWA 5J2QA 4DQQA 3HTVA 3O1WA 3EO3A 2HF4A 4KH5A 4DKWA 2ZM6K 3OJSA 2E8AA 4JKAA 3KD5E 3AVMA 2E4LA 1U04A 4H0XB 4BR9A 2ZJRL 2NRXA 3LM2A 4EZ9A 1N36K 4B9NA 2FF6A 3TU5A 1NJXA 1KAZA 3CCRN 2FLOA 1DT9A 4BC4A 1ZC6A 5F1XA 4CJ5A 4O0IA 1CXUA 3L4IA 3NH1A 3SPYA 3ZSWA 3THXA 3MK6A 1BHLA 4E7JA 3VQPA 3TABA 4QS8A 1TUUA 2HVHA 3MN9A 4OPHA 5FPMA 2E1YA 5KRTA 2P9UB 1C1AA 2HF3A 3J7ZO 4FJNA 1NK4A 2QA4N 3AO1A 4FW2A 3DLHA 5CZ1A 3HZ6A 4DU3A 5FRNA 3F2KA 3DOKA 1QZ6A 2ITGA 4E7KA 5AQSA 5BRDA 4JI4K 3SYZA 4CF8A 3WQUA 3AVJA 5HROA 2AJQA 3OYIA 2YHYA 2Q97A 4KHWA 1JKHA 1BDGA 4N47A 1NK7A 4KAZA 4KHPK 1V4SA 4WYBA 2GBZA 4WE1A 3RTVA 5JLHA 2OANA 1WSFA 2IVNA 1VSLA 3N4QA 3VGLA 1D9FA 5C0YA 5KGWA 1SV5A 4RW9A 3VESA 3OYFA 2OPPA 2FBXA 3U8XA 5GINA 3T1AA 5BRFA 1JCGA 4H5NA 1QSLA 3ZT4A 1QSYA 3V4IA 3A5OC 4CFDA 1TGOA 4ZTJA 3OY9A 3KWIA 2AA4A 1LWEA 2YX6A 3RSEB 1K6YA 4B1UB 2O8BB 1RT6A 2P9UA 3S41A 3TWHA 2KFZA 4Y1DA 1N8RO 4DQRA 4DS5A 2KZMA 4M3UA 3HM9A 2QWOA 1J53A 3KTQA 1GLJO 1JL1A 4JHDB 3QEIA 1L3TA 5AQGA 3MEEA 1RGIA 3OYBA 2A1RA 2OZMA 2GWKA 3SZ2A 1L3VA 2V7YA 4FJLA 4YDUC 4PUOA 1UA1A 4H4MA 4CHQA 4DLGA 1Q86O 1IBMK 2X6SA 4LF8K 1NMDA 3KLEA 1IO2A 1R0AA 2X74A 2YNIA 1UA0A 3DRSA 4YOWA 5KTQA 3UIQA 4FWNA 1DLOA 3FZKA 5DM6L 2UUAK 4JI8K 3G71N 1VQ4N 1IH7A 3Q7BA 4XH5A 3KWGA 1IKXA 3M3ZA 4EP5A 3FE1A 1RTHA 3CJCA 4BGBA 3DLBA 3NHGA 4B08A 1XUPO 4QOZB 3HT3A 4X62K 4B3OA 1QHAA 3RSEA 3HOSA 3IKMA 1XMOK 1GLFO 3EKSA 3OYLA 5AQPA 3DRPA 2O8BA 2NZTA 3JXUA 4JEPA 5AQNA 1JLFA 2IVOA 5SZTA 4O0JA 3OA9A 4JAXA 1F21A 1TK5A 4JKDA 4CEQA 5AQIA 3ZSRA 4OLBA 2VG5A 4X66K 3D2EB 4JN4A 4JRQA 3TARA 2I7PA 4CJKA 3F73A 4X64K 4JV5K 3C95A 3S9HA 4JKBA 4JRPA 1RNHA 1VK0A 4JHDA 5AQJA 1W97L 1G99A 1J6ZA 4LSNA 2P9LB 3GBTA 2RF2A 3QMLA 3C6UA 4XEIA 3RRHA 4LH4A 2F4VK 4KKOA 1BI4B 1P8ZA 3O9RA 4BRLA 1S5JA 5AQZA 2XY8A 4BRKA 5K14A 4CJVA 4M3YA 5HRNA 4FM2A 1N34K 2HMPA 3QDKA 1KLMA 3CFPA 4GW6A 5E84A 1T6CA 4IG0A 1NKCA 3MN6A 4B8CA 5KPTA 3H08A 3FFKB 3ZT1A 4OLAA 4IEEA 3NMUA 5LJVA 5FDLA 2FSNA 4BROA 4E19A 2NLXA 3HYFA 2HNYA 3EE9A 2CGKA 3VQ6A 1RDCA 4N41A 2QM1A 3SJJA 3I0SA 3C6TA 1RDUA 2OYQA 1TAUA 1C1BA 4YORA 3ENBA 4E1NA 1SL0A 2D0PA 2HBMA 3ZSZA 4W5QA
chains in the Genus database with same CATH topology
4JD2A 1U2VB 4YOYA 3N4PA 2J4RA 4M63C 2ASMA 3VETA 2NRWA 2WUSA 3AGRA 3D2EA 3FZHA 3JS6A 1YHQN 3IFRA 4UY8O 3GOIA 1T3VA 3SJHA 1YXQA 2E2PA 1ATNA 3G6EN 2ZF5O 4XH1A 3O9UA 5F2RA 3WXJA 3A0IX 2OTLN 4AM6A 3KK7A 3O5BA 1VQON 2GELA 3DAWA 3VF2A 2PBDA 4QS9A 5C2DA 3ZX0A 3VGKA 5AQMA 4DHYA 2QI2A 3C7NA 3H1QA 2V52B 3VEZA 1NBWA 1Z05A 4FWOA 3O1BA 2P9LA 4NO7A 2W41A 2NRHA 4Y0WA 4B9QA 1SZ2A 1ZBSA 2VGNA 5AQVA 5TKYA 3VTIA 4GY2B 3U9DA 1K9MO 1JJ2M 1K8KA 4JKGB 2E2NA 3MN5A 5AQQA 1KXPA 2QWMA 4BG8A 5BPMA 5M1PA 4BQLA 3WXKA 4NLCA 4GV6A 3A5LC 3QBWA 3A8YA 3DLLL 4K43A 4FL9A 3VEYA 3FGUA 4MDBA 3P4IA 3O6WA 5CE3A 3O9TA 2WFBA 2AP1A 2JWLA 5H1SQ 4L3QA 2P9SB 5AQOA 5EX5A 3W0LA 3I55N 5GIOA 3LDPA 4IWVA 2PFUA 3WEEB 4BGAA 1QQNA 1YIJN 3DXKA 3UKUB 1MDUB 4BR7A 5C15A 4C1NI 2IVPA 1VQ7N 3CPEA 2D0OA 1VAZA 3M5RA 3ZEUA 3TTCA 5AFUA 2P9KB 4FWRA 1NGEA 1JCEA 3GE1A 5EXWA 3WUHA 4YOXA 4EAHD 4MO5A 2ITMA 2E20A 4MLHA 4A61A 3LDOA 2RE2A 2A5XA 2P9PA 4JK7A 3OW2M 2VCPA 2QEXN 3CJ9A 1OVYA 3ZETA 3AGKA 3MN7A 3FZMA 2FSKA 1KQSM 2GTDA 1IJJA 5BN9A 3MMVA 1VQNN 1LOTB 2YHXA 5EY4A 1NGCA 1U2VA 3M1FA 1XC3A 4CZFA 2CGLA 4CJ7A 3O9SA 1BUPA 2A6AA 2QWRA 3AARA 3RVCA 4JKFA 5F0XA 4O8UA 4MDAA 1K8AO 1V4TA 4BR4A 5AZJB 4OPAA 5KQDA 4WQ4C 3E9LA 2BH1A 2NRRA 4FWSA 1GLLO 4H0TB 4JKHA 3U4LA 3R6MA 2D4WA 3UKRB 4DB3A 3NVKA 4BC3A 1CZAN 2QWQA 3H3OB 3K9JA 1DEJA 3QFUA 3HBTA 5BREA 1VQPN 1EQYA 2NRTA 1YAGA 3P38A 5C12A 1EO1A 2CGJA 3O80A 3SBGA 3CJ7A 2DPNA 1BOTO 4K42A 4A59A 4CZJA 2RHKA 3MDQA 4M7YA 5M1QA 5BN8A 1T44A 4JKGA 3SAGA 5AQLA 4CZKA 1ESVA 4BRFA 2ASOA 4G9ZA 4FWKA 2I7NA 3VEVA 2VYPA 1GLCG 3CIPA 3CD6N 3HRGA 5HL7L 1GLBG 3T69A 3FR0A 3KZBA 4IDHA 4CZMA 1KD1O 1C0GA 4IZ9A 1XQSC 3BF3A 3ULEB 4BREA 2P9SA 3QBXA 3CCMN 1M90O 4ISFA 3ZX3A 1QVGM 5M1KA 5AQFA 2GUPA 2FF3B 4BY9C 3C6AA 3WEEA 3F5TA 3CPWM 2VWBA 3UKUA 4BQZA 5AQWA 1S3XA 4ILHA 2WBNA 2FXUA 3CHWA 2HSTA 1NWKA 1Q18A 3VOVA 4A2AA 3R8EA 1RFQA 5LY3A 1QVFM 2Q0RA 4C23A 4CZLA 2P9KA 3CQYA 3LDLA 4IOCL 1HPMA 1YI2N 4I6MB 3SAHA 1BO5O 1MWMA 5AQUA 4BRCA 4FO0A 4QS7A 4CBWA 1OKJA 4ISEA 1YITN 4XH4A 3LDNA 3CQXA 2F9TA 3W3DA 1KAXA 3VENA 1HX1A 1YUWA 4Z94A 1YJWN 4WQ5C 2IIRA 1TUYA 4GV3A 1E4FT 4FSVA 5GAGP 3H3NO 2QW9A 3SAFA 3H6EA 4KBOA 5ADXA 4YDUA 3HM8A 2Q1NA 5AQHA 3ATUA 2NRZA 5CHIA 3DWLA 4CZHA 4PHTX 1NGJA 2Q36A 4ILJA 2E2OA 3SBTA 2ZGYA 1VQLN 3TPQA 5AZJA 5JICA 1O13A 3P39A 3R3LA 4FWLA 5LJWA 3CCSN 5KQ8A 3UKRA 4BRDA 3OBYA 3SLCA 3CCLN 2P9NB 1X3NA 3E9PA 3HTVA 4JKCA 3O1WA 5B8HA 3EO3A 3LDQA 3MWTA 2HF4A 4KH5A 5EVZA 4DKWA 2E8AA 4JKAA 2A40A 5TKWA 4WFAL 2E1ZA 3GDQA 1Q82O 4RWTA 3K9KA 4BRPA 4H0XB 3QFPA 5AQKA 4A62A 2VGMA 4BR9A 2ZJRL 5KPZA 1DGKN 2CH6A 3H46O 4C1NK 1HKGA 2NRXA 3DXMB 3LM2A 4CZIA 1HKBA 2QWPA 1NJIO 3CMEN 1NLVA 3DJCA 5GADP 5AR0A 4JNEA 2FF6A 3TU5A 2A41A 5JMVA 5I9EB 1BA1A 3ATVA 4MO4A 2NRVA 3R1XA 1X3MA 4HTLA 2E2QA 1KAZA 1X9JA 3CCRN 5JVGL 3CC2N 2FLOA 3ENOA 5BPNA 1DT9A 4BC4A 4J8FA 3D6RA 1ZC6A 1Y64A 3SMSA 3ULEA 1BA0A 5F1XA 2OTJN 5CR4A 3L4IA 3A5MC 4CBUA 2BUPA 2H3GX 3CC4N 3VEXA 3QB0A 3MK6A 1IG8A 1S22A 3AAQA 3WXIA 4A2BA 1SQKA 3E1YA 4QS8A 1TUUA 1NM1A 4NLBA 3WXLA 3MN9A 4OPHA 1DKGD 3KVGA 5ELZA 2E1YA 5FPMA 1NGGA 2P9UB 1VQ5N 2YI1A 4I6MA 3BF1A 2GX9A 3J7ZO 2HF3A 4FPBA 4RCHA 2QA4N 1MWKA 3GG4A 2KKZA 1VQ9N 4BRHA 3D2FB 3HZ6A 3MX2A 1NGBA 5C2FA 5FPDA 3CCEN 4MLEA 3MCAB 1YF5L 3F2KA 1QZ6A 2HBJA 2F7TA 2NNWA 1ZXOA 1YJNN 1VQ6N 1NGHA 1NGDA 2JWKA 5AQSA 5BRDA 4IXCA 1R59O 2GWJA 3AAPA 4IFEA 3TTDA 5KPRA 3WQUA 3MWPA 3CC7N 3MX5A 3L0QA 2ZJQL 4A57A 2HBLA 4CI6A 3O08A 4DCHA 5DM7L 2YHYA 2Q97A 4AM7A 2F9WA 1BDGA 1YJ9N 1Q81O 5GIPA 4EFHA 4GVEA 3D7EO 1V4SA 2P9NA 1HLUA 4WYBA 3VEWA 1TYQB 5JLHA 2OANA 4NB4A 4FWQA 4FOIA 4GV9A 2IVNA 2Q0UA 3VF6A 2ZWHA 3LL3A 4F9OA 3N4QA 3VGLA 5C0YA 4WF9L 3SMPA 1QQOA 3C6HA 4FOEA 3IMXA 3O8MA 3ZYYX 2CH5A 2WC9A 4BRIA 4IJAA 3DXMA 3VESA 3CCQN 4H0VB 3VERA 3WT0A 4H0YB 1Z6RA 3VEOA 1BU6O 4EIAA 3U8XA 1RDWX 3CJ1A 4BRNA 5GINA 5BRFA 1JCGA 4H5NA 4BRQA 3EZWA 3PIOL 1VQ8N 3A5NC 4IEIA 3CCVN 4BR0A 3HSCA 3A5OC 3P31A 3CERA 1NGAA 4H5TA 2E88A 3H1VX 3KWIA 2AA4A 2ASPA 4O5FA 1D4XA 2YX6A 1NGIA 4O8KA 3RSEB 1VQMN 1HKCA 5FPNA 5M1FA 3M6GA 2W40A 2BTFA 4B1UB 4OO1J 4WQ5A 3VMFB 4B1WB 4BRGA 5BR9A 3HOTA 2ZGZA 1ILYA 2P9UA 2HBKA 4CZGA 3S41A 4CD3A 4ILGB 3LM9A 1KAYA 3VTHA 4GNIA 4KH4A 4AF1A 1N8RO 3D2FA 2YCHA 2HOEA 2QWOA 3SK3A 3TSQA 5BPLA 1GLJO 3TSPA 3CXCM 5AQXA 1HUXA 4JHDB 2KLAA 4BRAA 4BR2A 5AQGA 1BWFO 3FLCO 1K73O 4K25A 2D1KA 3FZLA 1ATSA 5ADXH 1RGIA 3G4SN 3O9QA 4YOTA 3VGMA 4B1ZA 1SS6A 2GWKA 4H5VA 5EOYA 4U67L 5HOOA 2V7YA 4R79A 3IUCA 1NGFA 4YDUC 5GAHP 2FSJA 1WUAA 5AQTA 1Q86O 1M1KO 3BP8A 3C0BA 3ENHA 4JKEA 4E1JA 1NMDA 1TYQA 1ATRA 5E26A 4IJNA 2P9IB 2ZJPL 3L6QA 5GAEP 5AQYA 4BC2A 3BUZB 3IDHA 2Q2RA 4M7XA 4YOWA 4FWNA 2V51B 3FZKA 3OHRA 4H0OA 5AZIB 3U9ZA 5DM6L 2PAVA 4DQ8A 3G71N 1VQ4N 3H45C 3CCUN 4H5RA 2Q31A 4YOUA 3Q7BA 4XH5A 3I8BA 3KWGA 3M3ZA 1U6ZA 4YOVA 3FE1A 3CJCA 4BGBA 5M1OA 3ID8A 4A5BA 1E4GT 4BC5A 4EHUA 4PL7A 3CF5L 4H03B 4WFNL 1XUPO 4IOXA 5AFUH 1QZ5A 1QHAA 4FPAA 3R9PA 4IO8A 3RSEA 3HOSA 3IKMA 2QWLA 3T7ZA 1GLFO 3EKSA 5AQPA 4HWIA 3ID6A 1JCFA 2NZTA 3JXUA 4JEPA 1QQMA 4JD2B 3CJAA 5AQNA 4WQ4A 4PKHA 2IVOA 3F9MA 1H1VA 4CBXA 4JK9A 3OA9A 4BVPA 4JAXA 5JVHL 3ZX2A 2A42A 1MA9B 4FWPA 4JKDA 4H0PA 5AQIA 1GLEG 3E66A 5MLCQ 3D2EB 3NVMA 4JN4A 3I33A 2A3ZA 2I7PA 4BG9A 3CJBA 5AQRA 3BEXA 1SAZA 3EE8A 2YJFA 3FZFA 3L4QA 3KHYA 3UB5A 4WCEL 4JKBA 4K41A 2KHOA 4JHDA 5AQJA 3CMAN 5JLFA 1Q7YO 1W97L 1G99A 2QTDA 1J6ZA 3C7NB 4IO9L 3G25A 2P9LB 1LCUA 3GBTA 3PIPL 1GLDG 3CCJN 3QMLA 4U7BA 4XEIA 1WOQA 3EN9A 3AY9A 1P8ZA 1K8KB 1YVNA 2V7ZA 3O9RA 4BRLA 5FPEA 3PLAA 5AQZA 3VF4A 4BRKA 1T6DA 3QICA 1GLAG 3MCPA 4FVUA 3EL2A 4PKIA 3VPZA 1C0FA 2HMPA 3QDKA 3O4WA 5E84A 2P9IA 3HI0A 4A5AA 1T6CA 4BR5A 4BRMA 1KC8O 1HJOA 3E9OA 4BVOA 3TSUA 4B1YB 2QXLA 4IOAL 3MN6A 5AZIA 2QWNA 5KPTA 3FFKB 4PKGA 4FWMA 4KH6A 2UYTA 3DXKB 4B1XB 4RTFD 3B8AX 4LC9B 3CETA 4IEEA 4CD1A 4EHTA 5M1NA 3I56N 1S72N 3NMUA 4ISGA 5LJVA 2EWSA 2FSNA 2GEMA 2YJEA 3ZEUB 4BROA 4WFBL 1W2BM 5BRHA 2NLXA 4PL8A 3UE5A 3EE9A 2CGKA 3J8AA 3Q7CA 4H5WA 2QM1A 3WQTA 4CZEA 2P9PB 1RDUA 3C65A 3ZETB 3TTFA 3WXMB 2YHWA 4YORA 3ENBA 3OBWA 1VQKN 4JK8A 1P90A 3CI5A 2D0PA 2HBMA 4B1VA 5C10A 3GL1A 1BG3A 3EKUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ9 N;  2ZJP L;  5GAE P;  3CCE N;  3CD6 N;  5HL7 L;  5DM6 L;  1KD1 O;  1YJN N;  1YHQ N;  1VQ6 N;  4UY8 O;  3G71 N;  1VQ4 N;  3CCU N;  3G6E N;  3CCM N;  2OTL N;  1M90 O;  1VQO N;  1QVG M;  3CC7 N;  2ZJQ L;  3CPW M;  3CF5 L;  5DM7 L;  4WFN L;  1Q81 O;  1YJ9 N;  1QVF M;  1YI2 N;  4IOC L;  1JJ2 M;  1K9M O;  1YIT N;  4WF9 L;  5JVH L;  1YJW N;  3DLL L;  5MLC Q;  3CCQ N;  5GAG P;  5H1S Q;  3I55 N;  4WCE L;  1VQL N;  1YIJ N;  3CMA N;  1VQ8 N;  3PIO L;  1Q7Y O;  1VQ7 N;  3CCV N;  3CCS N;  4IO9 L;  3PIP L;  3CCL N;  1VQM N;  3CCJ N;  3OW2 M;  2QEX N;  4WFA L;  1OVY A;  1Q82 O;  1ILY A;  1KQS M;  2ZJR L;  1VQN N;  1NJI O;  1N8R O;  3CME N;  5GAD P;  1KC8 O;  1K8A O;  4IOA L;  3CCR N;  3CXC M;  5JVG L;  3CC2 N;  3I56 N;  1S72 N;  2OTJ N;  1K73 O;  3G4S N;  4WFB L;  1W2B M;  3CC4 N;  4U67 L;  1VQP N;  5GAH P;  1Q86 O;  1M1K O;  1VQ5 N;  1VQK N;  3J7Z O;  2QA4 N; 
#chains in the Genus database with same CATH topology
 4FLZ A;  2WON A;  1I39 A;  3VET A;  4LFB K;  3D2E A;  1YHQ N;  3JS6 A;  3GOI A;  1JLQ A;  3U3G A;  3SJH A;  2E2P A;  3G6E N;  1ATN A;  1XC9 A;  1SL1 A;  5F2R A;  4FZZ A;  2OTL N;  1ASV A;  3ZLJ A;  4AM6 A;  3O5B A;  4I2Q A;  2PBD A;  3MEC A;  3VGK A;  5AQM A;  4DHY A;  1CXQ A;  2QI2 A;  3VEZ A;  2V52 B;  3K0S A;  3LAK A;  2P9L A;  3O1B A;  1TL3 A;  4CIF A;  4GY2 B;  1BI4 A;  1RTJ A;  2E2N A;  1TV6 A;  5AQQ A;  1KXP A;  4PA1 A;  4BG8 A;  4DG1 A;  1RBU A;  4BQL A;  2KZZ A;  3WXK A;  4NLC A;  2IS3 A;  3DLL L;  3LZJ A;  4KTZ A;  3VEY A;  1HR0 K;  2AP1 A;  5AQO A;  4J2D A;  1RBR A;  3TAG A;  1NKE A;  5GIO A;  4FM1 A;  4EZ6 A;  1C6V A;  1RDA A;  4C1N I;  2IVP A;  2D0O A;  4BE2 A;  1XNR K;  2RN2 A;  1TK0 A;  2W42 A;  2HHH K;  2P9K B;  4FWR A;  3GE1 A;  4FM0 A;  3WUH A;  2ITM A;  3PO5 A;  3QEX A;  2XY5 A;  3LDO A;  2RE2 A;  2A5X A;  3OW2 M;  2HB5 A;  4CJP A;  4FLT A;  5A2Q O;  2GTD A;  1IJJ A;  5BN9 A;  5EY4 A;  1NGC A;  5HP1 A;  1BUP A;  3CQ8 A;  2QWR A;  3AAR A;  3RVC A;  3VQE A;  1TAQ A;  3KK3 A;  4E7L A;  1K8A O;  1V4T A;  5AZJ B;  4OPA A;  5KQD A;  2OZS A;  4DSE A;  3MAQ A;  1UOC A;  4DTN A;  4FWS A;  4CD3 A;  3VA0 A;  3KK1 A;  4RW8 A;  3H3O B;  4FLX A;  1DEJ A;  1VQP N;  3K59 A;  5BRE A;  1QTM A;  1YAG A;  1GOC A;  3HPG A;  1RTI A;  3SBG A;  4AHC A;  3CJ7 A;  4CJT A;  1BOT O;  4C8M A;  4A59 A;  2RHK A;  4OX9 K;  5M1Q A;  5BN8 A;  4DWI A;  3FFI A;  1IV0 A;  1JLG A;  3K57 A;  1I94 K;  2I7N A;  3VEV A;  4FXD A;  1GLC G;  3QIN A;  3CIP A;  2HMI A;  1KD1 O;  3OYH A;  3TAP A;  4IZ9 A;  4Z4F A;  1HMV A;  1CZ9 A;  1XQS C;  2JGU A;  1T8E A;  4B9U A;  2FBV A;  3QBX A;  1X9W A;  5M1K A;  4PWD A;  2GUP A;  3C6A A;  1KCF A;  2VWB A;  4BQZ A;  4HUE A;  2G8F A;  3KKS A;  4ILH A;  1OH7 A;  4IBN A;  4A2A A;  1TK8 A;  3DI6 A;  3M8S A;  2P9K A;  1NK0 A;  3CQY A;  3LDL A;  4IOC L;  1HPM A;  2X6N A;  1MWM A;  5AQU A;  4FO0 A;  1OKJ A;  4ISE A;  4DTS A;  2F9T A;  1KAX A;  4JI7 K;  3TAF A;  5I42 A;  4Z94 A;  4O44 A;  4LF4 K;  1ITG A;  3LAN A;  1FKP A;  4FSV A;  5GAG P;  4FCY A;  2HVI A;  4KBO A;  5ADX A;  3SV4 A;  4FJX A;  1OH5 A;  3AVK A;  2NRZ A;  3DWL A;  4NYN A;  2ATQ A;  3PO4 A;  2Q36 A;  3SBT A;  1VQL N;  4CJE A;  3TPQ A;  5AZJ A;  1KTQ A;  4B3T K;  2ZD1 A;  5KQ8 A;  3DM2 A;  3CCL N;  2P9N B;  3AVC A;  5B8H A;  1IBK K;  1JL2 A;  1RIL A;  4B9V A;  3CG7 A;  5EVZ A;  2A40 A;  5TKW A;  4WFA L;  1JLA A;  3LP1 A;  3AA2 A;  3QEP A;  4OJR A;  3QFP A;  5AQK A;  4A62 A;  2UXB K;  5KPZ A;  4E0D A;  4C1N K;  1X9S A;  1EXQ A;  3DXM B;  4OPK A;  1HKB A;  3CME N;  3NDK A;  5I9E B;  3QIO A;  4MO4 A;  5FLX O;  4HTL A;  3TI0 A;  1U48 A;  3F9K A;  3D6R A;  4CGF A;  2ETJ A;  3SMS A;  4YFU A;  3KLH A;  3A5M C;  4CBU A;  3QB0 A;  1IG8 A;  1YT3 A;  3ZT2 A;  4F4K A;  3AAQ A;  1ZBI A;  1DKG D;  1NGG A;  4DUZ K;  5I3U A;  2OA8 A;  3OS1 A;  2GX9 A;  1W0H A;  1KVC A;  3SI6 A;  3D2F B;  1BIS A;  4CEB A;  4FJ7 A;  4MLE A;  1YF5 L;  1BIZ A;  3LAM A;  1R59 O;  2GWJ A;  2EHG A;  3CC7 N;  3SQ4 A;  3MX5 A;  2ZJQ L;  4N56 A;  4HCC A;  5HBM A;  3TAM A;  1JXE A;  4DCH A;  1ZBL A;  4AH9 A;  2F9W A;  3V9W A;  4EFH A;  2P9N A;  2QKB A;  3DLR A;  2D0A A;  1TYQ B;  3VQ8 A;  3OYC A;  4BWJ A;  4GV9 A;  4LSL A;  4CJU A;  4CHO A;  1EX4 A;  4DF4 A;  5E41 A;  4ZHR A;  3SMP A;  4N76 A;  4FOE A;  3IMX A;  4I9L A;  3ZYY X;  2CH5 A;  4BRI A;  3DXM A;  4IFY A;  3WT0 A;  3IRX A;  3VEO A;  4EIA A;  1S1W A;  1OH6 A;  4C8L A;  1RDW X;  1J5O A;  1RT2 A;  3V1R A;  3AVB A;  2HNZ A;  4BRQ A;  1HYZ A;  3EZW A;  4CED A;  1QE1 A;  3PIO L;  1VQ8 N;  4DR6 K;  4IEI A;  3CCV N;  3HSC A;  2HHT A;  3CER A;  3DLE A;  3HVR A;  1NGA A;  4H5T A;  3H1V X;  1VQM N;  2ASP A;  1X9M A;  1D4X A;  1HKC A;  5FPN A;  2YNH A;  2HND A;  2Q3S A;  2W40 A;  2BTF A;  4OO1 J;  4WQ5 A;  1KSP A;  1IBL K;  3HOT A;  2ZGZ A;  2HBK A;  3KLI A;  3VQ7 A;  4ILG B;  1KAY A;  2P1J A;  3D2F A;  1TKT A;  4CER A;  3OYM A;  5BPL A;  3TSP A;  4BRA A;  1HUX A;  2KLA A;  1LW2 A;  2OCE A;  4FZX C;  1K73 O;  4KTW A;  1HYS A;  4YOT A;  2HHV A;  4B1Z A;  4LF9 K;  4M3T A;  5EOY A;  5HOO A;  3I8D A;  3KK2 A;  2FSJ A;  2BGG A;  1M1K O;  4EP4 A;  3C94 A;  1TYQ A;  1ATR A;  3OYN A;  3QES A;  3KD1 E;  4NYF A;  3SNN A;  1RTD A;  4BC2 A;  3BUZ B;  1IG9 A;  4L8R B;  5AZI B;  3CCU N;  2BDP A;  3I8B A;  3RMD A;  4KHQ A;  3B6O A;  3P1G A;  1QS4 A;  3ID8 A;  4BC5 A;  4PL7 A;  3CF5 L;  1TKX A;  1HQE A;  4LF7 K;  4IOX A;  2IGI A;  5AFU H;  3R9P A;  4ICL A;  3CFO A;  1L3U A;  2QWL A;  2F8S A;  4RG8 A;  3ULD A;  2KFN A;  3ID6 A;  4JD2 B;  4PKH A;  4FJ8 A;  3F9M A;  5IWA K;  2DY4 A;  4FWP A;  4H0P A;  1XMQ K;  5MLC Q;  3NVM A;  1FKO A;  3I33 A;  3K58 A;  4BG9 A;  4CIG A;  4FJG A;  3BEX A;  3FZF A;  3KHY A;  2E6M A;  3UB5 A;  3THW B;  3HJF A;  1Q7Y O;  4B3S K;  2QTD A;  3WNE A;  4CF9 A;  4HHT A;  1WSE A;  3PX4 A;  2DFE A;  1NJZ A;  3EN9 A;  1YTA A;  1K8K B;  4CHN A;  4RW6 A;  1Q9Y A;  1YVN A;  2V7Z A;  3PLA A;  5FPE A;  4CJ4 A;  3RR8 A;  4B8A B;  4PKI A;  3VPZ A;  4DV0 K;  4DSJ A;  4JI5 K;  1C0F A;  2OPR A;  3HI0 A;  4BR5 A;  2IAJ A;  1HJO A;  3TSU A;  4B1Y B;  2QXL A;  3SUP A;  2W6L A;  4IOA L;  5AZI A;  4KH6 A;  2UYT A;  4DF8 A;  1TL1 A;  3KLF A;  3QIP A;  2O4I A;  1WN7 A;  4M41 A;  3AVI A;  1VSJ A;  4WFB L;  3DMJ A;  4PL8 A;  1YVU A;  3CM6 A;  3J8A A;  4FJJ A;  2P9P B;  3T3F A;  4FVM A;  3C65 A;  3ZET B;  3TTF A;  2YHW A;  4HTU A;  4DTM A;  1BG3 A;  5FPD A;  3VQ5 A;  3EKU A;  4JD2 A;  1UWB A;  1U2V B;  1SKR A;  2J4R A;  1T7P A;  2F8T A;  2W6K A;  2XY6 A;  5HLF A;  4M63 C;  1B92 A;  4MQ3 A;  3M8Q A;  2NRW A;  2WUS A;  5J1E A;  3AGR A;  3FZH A;  1HPZ A;  3IFR A;  2E5L K;  1T3V A;  1S6Q A;  4Z4I A;  2ZF5 O;  3A0I X;  2YHA A;  3DAW A;  3VF2 A;  3THW A;  4QS9 A;  5C2D A;  3OYK A;  3ZX0 A;  5BR8 K;  4FJ5 A;  3M8R A;  3EEQ A;  1EP4 A;  1RCH A;  4NO7 A;  4FK4 A;  4Y0W A;  2WTU A;  1Z26 A;  1SZ2 A;  2VGN A;  3K5N A;  2D0B A;  3CFR A;  1K8K A;  4FK0 A;  3LP2 A;  5CYQ A;  1Z25 A;  4DU1 A;  3MN5 A;  5BPM A;  1S1T A;  2G8H A;  3V81 A;  4GV6 A;  1NNE A;  4X65 K;  4YHH K;  2JWL A;  3NAE A;  4C8K A;  3W0L A;  1NOY A;  3WEE B;  3MXJ A;  1VSK A;  4JI2 K;  1E3M A;  1HNZ K;  1KRP A;  1VAZ A;  3DLG A;  5AFU A;  1NGE A;  1JCE A;  3HP9 A;  4KB0 A;  4YOX A;  4EAH D;  1WSI A;  4MO5 A;  2E20 A;  4MLH A;  3NH2 A;  2P9P A;  4JK7 A;  2QEX N;  2UUC K;  3CJ9 A;  2G8U A;  4DV7 K;  2DTU A;  3ZET A;  3MN7 A;  3FZM A;  3SPZ A;  1VHX A;  2BE2 A;  3MMV A;  1VQN N;  4O55 A;  2YHX A;  3QO9 A;  1U2V A;  1CLQ A;  2VQE K;  3I0R A;  4JKF A;  4O8U A;  4MDA A;  2YNG A;  4O4G A;  3E9L A;  2BH1 A;  2NRR A;  4H0T B;  3KKR A;  1J54 A;  3UKR B;  4W5O A;  1N5Y A;  1KLN A;  4NCB A;  2O8F B;  1U47 A;  3K9J A;  3QFU A;  3HBT A;  4HVJ A;  1EQY A;  3QNN A;  1EO1 A;  3P38 A;  2CGJ A;  3LWL A;  4M7Y A;  1T44 A;  4QCL A;  3SAG A;  4DS4 A;  5AQL A;  3LAL A;  4BRF A;  3AA4 A;  4G9Z A;  4LF6 K;  4CZM A;  3D0P A;  1C0G A;  4N5S A;  2HHW A;  4ELT A;  1NU0 A;  4BAC A;  1M90 O;  4ISF A;  3ZX3 A;  4BY9 C;  3T19 A;  4FJK A;  2FF3 B;  1HNX K;  3WEE A;  3F5T A;  1JXB A;  4KFB A;  3CPW M;  5AQW A;  1S3X A;  2VWK A;  3T1Y K;  1XHZ A;  3DLK A;  1NWK A;  1Q18 A;  3VOV A;  1QVF M;  4NXN K;  4CZL A;  3J7A P;  1YI2 N;  4FLU A;  3KLG A;  3SAH A;  1BO5 O;  4TSX A;  4DFP A;  4JLH A;  5KGX A;  4LD0 A;  2EX3 A;  1S9E A;  1HX1 A;  1LV5 A;  3BGR A;  4CES A;  1TUY A;  1WB9 A;  3SAF A;  4DFM A;  2DFH A;  5JS1 A;  1KVA A;  1NJY A;  3KIO A;  3E01 A;  4F3O A;  4CK1 A;  1A5X A;  1Q8I A;  4M3X A;  4FWL A;  3CCS N;  1IKW A;  3UKR A;  4BRD A;  4LH5 A;  1G15 A;  2O8F A;  1U4B A;  4IFV A;  3PSF A;  3VQC A;  2HHQ A;  5CYM A;  3LDQ A;  3MWT A;  3L2R A;  4HCB A;  2E1Z A;  2G8W A;  1Q82 O;  1A5V A;  2IDO A;  2UUB K;  4BRP A;  4JS4 A;  4DFK A;  3EZ5 A;  3K5M A;  3AO4 A;  3H46 O;  2YNF A;  1HKG A;  2B4J A;  4KRE A;  1J9A A;  2QWP A;  4DLE A;  1NJI O;  1NLV A;  3DJC A;  5AR0 A;  4JNE A;  1TKD A;  3R1X A;  1X3M A;  3BZC A;  3ENO A;  5BPN A;  1Y64 A;  3SUQ A;  5KI6 A;  3CC4 N;  1X1P A;  4CEC A;  1S22 A;  3WXI A;  3O3F A;  3WXL A;  3EY1 A;  3ZSO A;  1T03 A;  1VQ5 N;  1LAV A;  2YI1 A;  3BF1 A;  3RWU A;  1KVB A;  4FPB A;  4RCH A;  1MWK A;  1ZYQ A;  4E89 A;  4FLW A;  4GVM A;  3V9Z A;  1NGB A;  1YTU A;  3IS9 A;  5C2F A;  4GKK K;  2HBJ A;  3NCI A;  2F7T A;  2NNW A;  1ZXO A;  1VQ6 N;  1WSG A;  1NGH A;  1NGD A;  3DOL A;  5C24 A;  1FW6 A;  4IFE A;  3TTD A;  1O1W A;  3S3O A;  3HK2 A;  4CHY A;  3MWP A;  3NGY A;  2HBL A;  3T1H K;  1L5U A;  4ZTF A;  4CJF A;  4AM7 A;  1Q81 O;  2B6A A;  3SQ1 A;  4GVE A;  3D7E O;  1VSH A;  1HLU A;  1I3A A;  4OPJ A;  1T05 A;  3VEW A;  4Z4H A;  4NB4 A;  4FWQ A;  4Q5V A;  2Q0U A;  2O4G A;  4F9O A;  4WF9 L;  3O8M A;  4DV4 K;  3CCQ N;  4H0V B;  3HPH A;  1NMN A;  3A2F A;  4KO0 A;  4CK2 A;  4I2P A;  3ZSV A;  2I5J A;  4AIL C;  4BR0 A;  3P31 A;  4CEZ A;  1N33 K;  4O8K A;  1SKS A;  5DMR A;  2D5R A;  5M1F A;  1VRU A;  4Z4C A;  4OKK A;  1B9F A;  2QXF A;  3VMF B;  4B1W B;  4BRG A;  4LFA K;  1ILY A;  1S1X A;  4CZG A;  3LM9 A;  1LAW A;  1QQC A;  4GNI A;  4KRF A;  2YCH A;  1BIU A;  3CXC M;  4FZY A;  3ZT0 A;  1NKB A;  1BL3 A;  1BWF O;  4K25 A;  3FZL A;  3G4S N;  4NXM K;  3AVG A;  3O9Q A;  3VGM A;  2B5J A;  1U45 A;  1SS6 A;  4U67 L;  3V9S A;  4GMJ B;  5AQT A;  2P51 A;  3BP8 A;  3C0B A;  4E1J A;  3OYA A;  4CE9 A;  5E26 A;  2P9I B;  4CGI A;  4OKJ A;  5GAE P;  1HYV A;  4YY3 K;  3IDH A;  4XIU A;  4CF1 A;  2V51 B;  1N32 K;  3OHR A;  5HRP A;  2LSN A;  3PX0 A;  1D8Y A;  4H5R A;  1VSI A;  1U6Z A;  1FXX A;  4DTU A;  3J81 O;  3L2Q A;  5M1O A;  4JS5 A;  4F2S A;  1RT3 A;  4A5B A;  4WFN L;  1ASW A;  4GKJ K;  3T7Z A;  4BE0 A;  4HWI A;  4DTO A;  4JK9 A;  4KB1 A;  5JVH L;  4CK3 A;  2HHX A;  2A42 A;  4FJ9 A;  1MA9 B;  3L8B A;  1HRH A;  1GLE G;  1DTT A;  1EET A;  3CJB A;  5AQR A;  3EE8 A;  2YJF A;  1NK8 A;  4CGG A;  5IT9 O;  1RT7 A;  3HVT A;  3WNF A;  3SUN A;  3NGI A;  2KHO A;  4DFJ A;  5JLF A;  3DYA A;  3AVF A;  4IO9 L;  3G25 A;  3RMC A;  3PIP L;  1LCU A;  3ASM A;  1BGX T;  4CEF A;  3CCJ N;  4U7B A;  4RW7 A;  1S9G A;  3AY9 A;  5FRM A;  3HL8 A;  3VF4 A;  3VQ4 A;  4LFC K;  3QIC A;  4DR5 K;  5J2M A;  2Z1J A;  2P9I A;  3HXM A;  4BRM A;  1JLC A;  4JI6 K;  4DR7 K;  3G10 A;  4RTF D;  4DQP A;  3B8A X;  1A5W A;  3CET A;  1XNQ K;  4CVN E;  4ISG A;  2EWS A;  1NK5 A;  1RT1 A;  1W2B M;  2PYJ A;  5BRH A;  3UE5 A;  3CYM A;  3Q7C A;  4H5W A;  4AHV A;  1QHT A;  3WQT A;  2QKK A;  4Q0B A;  3OBW A;  4JK8 A;  1P90 A;  3CI5 A;  4OGE A;  3VN5 A;  4B1V A;  3GL1 A;  1NJW A;  4M3W A;  4YOY A;  3LWM A;  1U49 A;  1CZB A;  3ZCM A;  3OS0 A;  4UY8 O;  4KHU A;  4XH1 A;  3WXJ A;  3O9U A;  2GEL A;  1VSM A;  3O3H A;  4CF0 A;  3H1Q A;  4FWO A;  2NRH A;  2IOC A;  1ZBS A;  5AQV A;  5TKY A;  3VTI A;  3U9D A;  4DUY K;  1K9M O;  4JKG B;  3U6F A;  3TAE A;  3QEV A;  4B9T A;  2QWM A;  4M45 A;  5M1P A;  4FJH A;  4DV2 K;  3A5L C;  4BDP A;  3RR7 A;  3A8Y A;  3BDP A;  4CJQ A;  4K43 A;  1WLJ A;  4F3T A;  1VSD A;  3O6W A;  5CE3 A;  3O9T A;  2WFB A;  4CJW A;  5H1S Q;  4L3Q A;  2P9S B;  4DR4 K;  3HP6 A;  3I55 N;  4M3Z A;  3V1Q A;  1ZBH A;  3LDP A;  1EKE A;  3MXI A;  5AJ3 K;  4BGA A;  1YIJ N;  1REV A;  3UKU B;  1MDU B;  1VQ7 N;  3RRG A;  4I9Q A;  3CPE A;  4AQY K;  4KPY A;  2KTQ A;  2KW4 A;  5EXW A;  1RT5 A;  3NFA A;  3LP0 A;  2VCP A;  3O4Q A;  4DTJ A;  4FLY A;  2RPI A;  3NH0 A;  1BQN A;  3AGK A;  2FSK A;  1KQS M;  2X78 A;  1OH8 A;  5DK5 A;  4H4O A;  4JYA K;  3M1F A;  2O8D B;  1XC3 A;  3OVN A;  2CGL A;  4LF5 K;  1WAJ A;  4O5B A;  2GUI A;  2A6A A;  4K0K K;  5F0X A;  4BR4 A;  3LPU A;  4FJM A;  4DB3 A;  1GLL O;  2A1S A;  4BC3 A;  1CZA N;  2QWQ A;  3QEW A;  3RMB A;  4CIE A;  2NRT A;  2BAN A;  4QAG A;  4K42 A;  5LMU K;  4CZJ A;  1RBT A;  3MDQ A;  2XRI A;  1XHX A;  5D3G A;  5KRS A;  4JKG A;  4DR1 K;  1HNW K;  2VQF K;  2JLE A;  3OYE A;  2YKM A;  4DTR A;  1C1C A;  3AVH A;  3HRG A;  5HL7 L;  1GLB G;  3T69 A;  5T7B A;  2O8E B;  4IDH A;  4LY7 A;  3BF3 A;  3L2U A;  3ULE B;  2P9S A;  4C8N A;  2IC3 A;  3CCM N;  2Y1I A;  1QVG M;  3NF6 A;  1WSH A;  3UKU A;  2FXU A;  3CHW A;  2HST A;  2NUB A;  3R8E A;  1RFQ A;  3K5O A;  1ZBU A;  1ASU A;  1RDD A;  4I6M B;  2E6L A;  3J7Y P;  1NK6 A;  3MEG A;  2ZE2 A;  4BRC A;  4FLV A;  1YIT N;  4XH4 A;  3CQX A;  5CY4 A;  1IKY A;  1J5E K;  4B3R K;  4HUG A;  4WQ5 C;  2F96 A;  1FK9 A;  1E4F T;  2O8D A;  4CFC A;  1EWQ A;  2Y1J A;  5LL6 Z;  5AQH A;  3P5J A;  2P5G A;  4CZH A;  1NGJ A;  3HO1 A;  2QK9 A;  2ZGY A;  3QET A;  3VQB A;  3R3L A;  2G8I A;  3TAQ A;  1S1V A;  5LJW A;  3HST B;  4J2A A;  4W5T A;  4B3M K;  5CZ2 A;  3V6D A;  1X3N A;  3E9P A;  4JKC A;  4K8X A;  2VG6 A;  4MFB A;  2UXC K;  3NF7 A;  3GDQ A;  4RWT A;  3K9K A;  2VGM A;  1NOZ A;  3HPO A;  1DGK N;  1Y97 A;  1ZBF A;  2CH6 A;  4CZI A;  5GAD P;  2YHB A;  3SV3 A;  2A41 A;  4IKF A;  5JMV A;  1BA1 A;  2XHB A;  3ATV A;  2NRV A;  3M8P A;  4DSK A;  4BDY A;  2E2Q A;  2O8E A;  1X9J A;  5JVG L;  3CC2 N;  4CHZ A;  4J8F A;  3ULE A;  3PX6 A;  1BA0 A;  2OTJ N;  5CR4 A;  1TVR A;  2BUP A;  2H3G X;  3VEX A;  1HNI A;  4A2B A;  1SQK A;  3E1Y A;  1NM1 A;  4NLB A;  3QNO A;  3S3M A;  4OKE A;  4PQU A;  2ZQB A;  5ELZ A;  3KVG A;  4DSF A;  4I6M A;  2WOM A;  3BZK A;  2PY5 A;  3L2W A;  3GG4 A;  2KKZ A;  3D45 A;  4BRH A;  4UQG A;  1VQ9 N;  4C8O A;  4DV3 K;  3MX2 A;  3CCE N;  3MCA B;  4CGH A;  4IDK A;  1YJN N;  2JWK A;  4CJS A;  1WAF A;  1JLE A;  4IXC A;  3AAP A;  2PYL A;  5KPR A;  2G8V A;  3L0Q A;  1W7A A;  4A57 A;  1C0M A;  4CI6 A;  4V19 S;  3O08 A;  5DM7 L;  4ELU A;  1YJ9 N;  5GIP A;  3NBP A;  4CEA A;  1LWC A;  2KQ2 A;  1LW0 A;  4FOI A;  3VF6 A;  2ZWH A;  2G8K A;  2Z1G A;  3LL3 A;  1WBB A;  4G1Q A;  1QQO A;  3C6H A;  4Z4E A;  4KTQ A;  4DV1 K;  3JSM A;  2WC9 A;  3AO5 A;  4IJA A;  3VER A;  4H0Y B;  3THV A;  4W5R A;  1Z6R A;  3WNG A;  3J80 O;  1BU6 O;  3SQ0 A;  1VSE A;  1HNV A;  3CJ1 A;  4BRN A;  4DSL A;  3P83 D;  4CJL A;  4Y1C A;  4E1M A;  3A5N C;  4E3S A;  4CCH A;  2E88 A;  4FYD A;  1VRT A;  4O5F A;  1NGI A;  3B6P A;  3M6G A;  3VQA A;  1C0T A;  2OPS A;  1NK9 A;  3THY B;  2VG7 A;  5BR9 A;  4DSI A;  3SUO A;  3VTH A;  4RW4 A;  4CF2 A;  4B9L A;  3ZSQ A;  1LWF A;  4KH4 A;  4AF1 A;  4YNQ A;  2HOE A;  2YV0 X;  1N6Q A;  3SK3 A;  3TSQ A;  4DU4 A;  1RT4 A;  5AQX A;  4BR2 A;  1VSF A;  4DTP A;  4I7F A;  4F8R A;  3JAM O;  3FLC O;  3S3N A;  2D1K A;  1ATS A;  5ADX H;  4AHS A;  3U3Y A;  1SUQ A;  4H5V A;  4R79 A;  2DFF A;  3IUC A;  1NGF A;  3ITH A;  3VQ9 A;  2XO7 A;  2OPQ A;  5GAH P;  1WUA A;  4BE1 A;  1OVQ A;  4CGJ A;  3ENH A;  4CEO A;  4JKE A;  4CW7 B;  2Z1H A;  4CEE A;  3VA3 A;  4IJN A;  2ZJP L;  3L6Q A;  5AQY A;  2YKN A;  2Q2R A;  4M7X A;  4H0O A;  3U9Z A;  2PAV A;  4DQ8 A;  4Z0U A;  3H45 C;  4YOU A;  2Q31 A;  3TR8 A;  3AVN A;  4YOV A;  3EYZ A;  1E4G T;  3NGZ A;  4EHU A;  4H03 B;  3V1O A;  2O8C B;  1QZ5 A;  4FPA A;  1HQU A;  4IO8 A;  3ZSX A;  3AVL A;  4B9S A;  1NG9 A;  3PY8 A;  1JCF A;  1QQM A;  3THY A;  3CJA A;  4WQ4 A;  4CHP A;  1H1V A;  1BCM A;  4CBX A;  4BVP A;  3ZX2 A;  3K2P A;  3E66 A;  1SL2 A;  4KHY A;  2A3Z A;  1D5A A;  3O4N A;  2VWJ A;  1SAZ A;  1KFS A;  3VQD A;  4KHS A;  3L4Q A;  1WNS A;  4WCE L;  4DV5 K;  2FC0 A;  4K41 A;  4J2E A;  3CMA N;  4KV8 A;  3C7N B;  3LDS A;  1GLD G;  4CFA A;  1B9D A;  4F2R A;  1GOB A;  1WOQ A;  3OYD A;  4J2B A;  4AHU A;  3IAY A;  4DV6 K;  3MXM A;  1T6D A;  1DTQ A;  1GLA G;  3MCP A;  4FVU A;  3EL2 A;  3OYG A;  3LZI A;  3AO2 A;  1EWR A;  3O4W A;  4HUF A;  4K8Z A;  4W5N A;  4A5A A;  1KC8 O;  3E9O A;  3NF9 A;  3AV9 A;  1WSJ A;  4BVO A;  4CJ3 A;  2R7Y A;  3V9U A;  2QWN A;  4PKG A;  4FWM A;  4B1X B;  3DXK B;  1QSS A;  3AVA A;  4LC9 B;  4CD1 A;  3I56 N;  1S72 N;  4EHT A;  5M1N A;  1KFD A;  4FJI A;  2GEM A;  2YJE A;  3AA5 X;  3ZEU B;  1GOA A;  3PUF A;  5HRR A;  4CZE A;  3V9X A;  4FK2 A;  4M42 A;  2O8C A;  2GV9 A;  1UAX A;  3WXM B;  4JI0 K;  4CFB A;  1VQK N;  4B9M A;  5C10 A;  2UXD K;  3L3V A;  4NCG A;  2Z1I A;  3N4P A;  1C0U A;  3JYT A;  3SQ2 A;  2ASM A;  1YXQ A;  3IG1 A;  5LMN K;  1WBD A;  3KK7 A;  1VQO N;  4H8K A;  4PY5 A;  5EU7 A;  3C7N A;  4E7I A;  1NBW A;  1Z05 A;  5C42 A;  2W41 A;  4B9Q A;  4DQS A;  5J2P A;  1JJ2 M;  3MED A;  1FJG K;  1TKZ A;  1Q9X A;  3QBW A;  3PSI A;  1IKV A;  4FL9 A;  3O3G A;  3FGU A;  5FRO A;  4KHN A;  4MDB A;  3P4I A;  4AHT A;  5EX5 A;  4IWV A;  2HHS A;  2PFU A;  1QQN A;  2D0C A;  3DXK A;  4BR7 A;  5C15 A;  4DR2 K;  1XI1 A;  4ELV A;  3M5R A;  3AO3 A;  3ZEU A;  3TTC A;  5HRS A;  3L3U A;  4NCA A;  4OVL A;  4A61 A;  1XWL A;  3SCX A;  1OVY A;  2PZS A;  1LOT B;  4CZF A;  4CJ7 A;  3O9S A;  3LPT A;  3L2V A;  5JS2 A;  3K5L A;  2FBT A;  3ISN C;  2RKI A;  1BCO A;  4DMN A;  5SWM A;  1RDB A;  4WQ4 C;  3U4L A;  3TAN A;  4JKH A;  3R6M A;  2D4W A;  4M3R A;  3NVK A;  4KI4 A;  3OJU A;  2HHU A;  3ZT3 A;  2UU9 K;  5C12 A;  3NE6 A;  3O80 A;  2DPN A;  4CGD A;  4ID1 A;  1RBS A;  1HJR A;  3KJV A;  4CJR A;  1S6P A;  4CZK A;  3RMA A;  1ESV A;  1JLB A;  2ASO A;  4FWK A;  3CM5 A;  3BY5 A;  2VYP A;  3DRR A;  3CD6 N;  4BDZ A;  1W9H A;  3FR0 A;  3KZB A;  4OGC A;  4FW1 A;  4BRE A;  4JI1 K;  4BWM A;  4DR3 K;  5J2N A;  1S1U A;  5AQF A;  1D9D A;  3THX B;  3NF8 A;  2WBN A;  4E7H A;  2HW3 A;  2XY7 A;  1MU2 A;  5C25 A;  5LY3 A;  3OS2 A;  2Q0R A;  4C23 A;  4AHR A;  4JI3 K;  3G0Z A;  3OTO K;  3PV8 A;  4IG3 A;  4Z4G A;  4CBW A;  4QS7 A;  2P5O A;  3LDN A;  3VQQ A;  3W3D A;  3VEN A;  4KI6 A;  1YUW A;  1YJW N;  3AA3 A;  3QLH A;  3QER A;  3LP3 A;  2IIR A;  4GV3 A;  3H3N O;  2QW9 A;  3H6E A;  4DTX A;  4ID5 A;  4YDU A;  3WNH A;  4DQI A;  2FBY A;  3HM8 A;  2Q1N A;  3ATU A;  1L3S A;  5CHI A;  4PHT X;  4ILJ A;  2E2O A;  3OYJ A;  5JIC A;  1O13 A;  3P39 A;  3ALY A;  1BQM A;  1RBV A;  3ZSY A;  4R5P A;  3OBY A;  3SLC A;  1SKW A;  5J2Q A;  4DQQ A;  3HTV A;  3O1W A;  3EO3 A;  2HF4 A;  4KH5 A;  4DKW A;  2ZM6 K;  3OJS A;  2E8A A;  4JKA A;  3KD5 E;  3AVM A;  2E4L A;  1U04 A;  4H0X B;  4BR9 A;  2ZJR L;  2NRX A;  3LM2 A;  4EZ9 A;  1N36 K;  4B9N A;  2FF6 A;  3TU5 A;  1NJX A;  1KAZ A;  3CCR N;  2FLO A;  1DT9 A;  4BC4 A;  1ZC6 A;  5F1X A;  4CJ5 A;  4O0I A;  1CXU A;  3L4I A;  3NH1 A;  3SPY A;  3ZSW A;  3THX A;  3MK6 A;  1BHL A;  4E7J A;  3VQP A;  3TAB A;  4QS8 A;  1TUU A;  2HVH A;  3MN9 A;  4OPH A;  5FPM A;  2E1Y A;  5KRT A;  2P9U B;  1C1A A;  2HF3 A;  3J7Z O;  4FJN A;  1NK4 A;  2QA4 N;  3AO1 A;  4FW2 A;  3DLH A;  5CZ1 A;  3HZ6 A;  4DU3 A;  5FRN A;  3F2K A;  3DOK A;  1QZ6 A;  2ITG A;  4E7K A;  5AQS A;  5BRD A;  4JI4 K;  3SYZ A;  4CF8 A;  3WQU A;  3AVJ A;  5HRO A;  2AJQ A;  3OYI A;  2YHY A;  2Q97 A;  4KHW A;  1JKH A;  1BDG A;  4N47 A;  1NK7 A;  4KAZ A;  4KHP K;  1V4S A;  4WYB A;  2GBZ A;  4WE1 A;  3RTV A;  5JLH A;  2OAN A;  1WSF A;  2IVN A;  1VSL A;  3N4Q A;  3VGL A;  1D9F A;  5C0Y A;  5KGW A;  1SV5 A;  4RW9 A;  3VES A;  3OYF A;  2OPP A;  2FBX A;  3U8X A;  5GIN A;  3T1A A;  5BRF A;  1JCG A;  4H5N A;  1QSL A;  3ZT4 A;  1QSY A;  3V4I A;  3A5O C;  4CFD A;  1TGO A;  4ZTJ A;  3OY9 A;  3KWI A;  2AA4 A;  1LWE A;  2YX6 A;  3RSE B;  1K6Y A;  4B1U B;  2O8B B;  1RT6 A;  2P9U A;  3S41 A;  3TWH A;  2KFZ A;  4Y1D A;  1N8R O;  4DQR A;  4DS5 A;  2KZM A;  4M3U A;  3HM9 A;  2QWO A;  1J53 A;  3KTQ A;  1GLJ O;  1JL1 A;  4JHD B;  3QEI A;  1L3T A;  5AQG A;  3MEE A;  1RGI A;  3OYB A;  2A1R A;  2OZM A;  2GWK A;  3SZ2 A;  1L3V A;  2V7Y A;  4FJL A;  4YDU C;  4PUO A;  1UA1 A;  4H4M A;  4CHQ A;  4DLG A;  1Q86 O;  1IBM K;  2X6S A;  4LF8 K;  1NMD A;  3KLE A;  1IO2 A;  1R0A A;  2X74 A;  2YNI A;  1UA0 A;  3DRS A;  4YOW A;  5KTQ A;  3UIQ A;  4FWN A;  1DLO A;  3FZK A;  5DM6 L;  2UUA K;  4JI8 K;  3G71 N;  1VQ4 N;  1IH7 A;  3Q7B A;  4XH5 A;  3KWG A;  1IKX A;  3M3Z A;  4EP5 A;  3FE1 A;  1RTH A;  3CJC A;  4BGB A;  3DLB A;  3NHG A;  4B08 A;  1XUP O;  4QOZ B;  3HT3 A;  4X62 K;  4B3O A;  1QHA A;  3RSE A;  3HOS A;  3IKM A;  1XMO K;  1GLF O;  3EKS A;  3OYL A;  5AQP A;  3DRP A;  2O8B A;  2NZT A;  3JXU A;  4JEP A;  5AQN A;  1JLF A;  2IVO A;  5SZT A;  4O0J A;  3OA9 A;  4JAX A;  1F21 A;  1TK5 A;  4JKD A;  4CEQ A;  5AQI A;  3ZSR A;  4OLB A;  2VG5 A;  4X66 K;  3D2E B;  4JN4 A;  4JRQ A;  3TAR A;  2I7P A;  4CJK A;  3F73 A;  4X64 K;  4JV5 K;  3C95 A;  3S9H A;  4JKB A;  4JRP A;  1RNH A;  1VK0 A;  4JHD A;  5AQJ A;  1W97 L;  1G99 A;  1J6Z A;  4LSN A;  2P9L B;  3GBT A;  2RF2 A;  3QML A;  3C6U A;  4XEI A;  3RRH A;  4LH4 A;  2F4V K;  4KKO A;  1BI4 B;  1P8Z A;  3O9R A;  4BRL A;  1S5J A;  5AQZ A;  2XY8 A;  4BRK A;  5K14 A;  4CJV A;  4M3Y A;  5HRN A;  4FM2 A;  1N34 K;  2HMP A;  3QDK A;  1KLM A;  3CFP A;  4GW6 A;  5E84 A;  1T6C A;  4IG0 A;  1NKC A;  3MN6 A;  4B8C A;  5KPT A;  3H08 A;  3FFK B;  3ZT1 A;  4OLA A;  4IEE A;  3NMU A;  5LJV A;  5FDL A;  2FSN A;  4BRO A;  4E19 A;  2NLX A;  3HYF A;  2HNY A;  3EE9 A;  2CGK A;  3VQ6 A;  1RDC A;  4N41 A;  2QM1 A;  3SJJ A;  3I0S A;  3C6T A;  1RDU A;  2OYQ A;  1TAU A;  1C1B A;  4YOR A;  3ENB A;  4E1N A;  1SL0 A;  2D0P A;  2HBM A;  3ZSZ A;  4W5Q A; 
#chains in the Genus database with same CATH homology
 4JD2 A;  1U2V B;  4YOY A;  3N4P A;  2J4R A;  4M63 C;  2ASM A;  3VET A;  2NRW A;  2WUS A;  3AGR A;  3D2E A;  3FZH A;  3JS6 A;  1YHQ N;  3IFR A;  4UY8 O;  3GOI A;  1T3V A;  3SJH A;  1YXQ A;  2E2P A;  1ATN A;  3G6E N;  2ZF5 O;  4XH1 A;  3O9U A;  5F2R A;  3WXJ A;  3A0I X;  2OTL N;  4AM6 A;  3KK7 A;  3O5B A;  1VQO N;  2GEL A;  3DAW A;  3VF2 A;  2PBD A;  4QS9 A;  5C2D A;  3ZX0 A;  3VGK A;  5AQM A;  4DHY A;  2QI2 A;  3C7N A;  3H1Q A;  2V52 B;  3VEZ A;  1NBW A;  1Z05 A;  4FWO A;  3O1B A;  2P9L A;  4NO7 A;  2W41 A;  2NRH A;  4Y0W A;  4B9Q A;  1SZ2 A;  1ZBS A;  2VGN A;  5AQV A;  5TKY A;  3VTI A;  4GY2 B;  3U9D A;  1K9M O;  1JJ2 M;  1K8K A;  4JKG B;  2E2N A;  3MN5 A;  5AQQ A;  1KXP A;  2QWM A;  4BG8 A;  5BPM A;  5M1P A;  4BQL A;  3WXK A;  4NLC A;  4GV6 A;  3A5L C;  3QBW A;  3A8Y A;  3DLL L;  4K43 A;  4FL9 A;  3VEY A;  3FGU A;  4MDB A;  3P4I A;  3O6W A;  5CE3 A;  3O9T A;  2WFB A;  2AP1 A;  2JWL A;  5H1S Q;  4L3Q A;  2P9S B;  5AQO A;  5EX5 A;  3W0L A;  3I55 N;  5GIO A;  3LDP A;  4IWV A;  2PFU A;  3WEE B;  4BGA A;  1QQN A;  1YIJ N;  3DXK A;  3UKU B;  1MDU B;  4BR7 A;  5C15 A;  4C1N I;  2IVP A;  1VQ7 N;  3CPE A;  2D0O A;  1VAZ A;  3M5R A;  3ZEU A;  3TTC A;  5AFU A;  2P9K B;  4FWR A;  1NGE A;  1JCE A;  3GE1 A;  5EXW A;  3WUH A;  4YOX A;  4EAH D;  4MO5 A;  2ITM A;  2E20 A;  4MLH A;  4A61 A;  3LDO A;  2RE2 A;  2A5X A;  2P9P A;  4JK7 A;  3OW2 M;  2VCP A;  2QEX N;  3CJ9 A;  1OVY A;  3ZET A;  3AGK A;  3MN7 A;  3FZM A;  2FSK A;  1KQS M;  2GTD A;  1IJJ A;  5BN9 A;  3MMV A;  1VQN N;  1LOT B;  2YHX A;  5EY4 A;  1NGC A;  1U2V A;  3M1F A;  1XC3 A;  4CZF A;  2CGL A;  4CJ7 A;  3O9S A;  1BUP A;  2A6A A;  2QWR A;  3AAR A;  3RVC A;  4JKF A;  5F0X A;  4O8U A;  4MDA A;  1K8A O;  1V4T A;  4BR4 A;  5AZJ B;  4OPA A;  5KQD A;  4WQ4 C;  3E9L A;  2BH1 A;  2NRR A;  4FWS A;  1GLL O;  4H0T B;  4JKH A;  3U4L A;  3R6M A;  2D4W A;  3UKR B;  4DB3 A;  3NVK A;  4BC3 A;  1CZA N;  2QWQ A;  3H3O B;  3K9J A;  1DEJ A;  3QFU A;  3HBT A;  5BRE A;  1VQP N;  1EQY A;  2NRT A;  1YAG A;  3P38 A;  5C12 A;  1EO1 A;  2CGJ A;  3O80 A;  3SBG A;  3CJ7 A;  2DPN A;  1BOT O;  4K42 A;  4A59 A;  4CZJ A;  2RHK A;  3MDQ A;  4M7Y A;  5M1Q A;  5BN8 A;  1T44 A;  4JKG A;  3SAG A;  5AQL A;  4CZK A;  1ESV A;  4BRF A;  2ASO A;  4G9Z A;  4FWK A;  2I7N A;  3VEV A;  2VYP A;  1GLC G;  3CIP A;  3CD6 N;  3HRG A;  5HL7 L;  1GLB G;  3T69 A;  3FR0 A;  3KZB A;  4IDH A;  4CZM A;  1KD1 O;  1C0G A;  4IZ9 A;  1XQS C;  3BF3 A;  3ULE B;  4BRE A;  2P9S A;  3QBX A;  3CCM N;  1M90 O;  4ISF A;  3ZX3 A;  1QVG M;  5M1K A;  5AQF A;  2GUP A;  2FF3 B;  4BY9 C;  3C6A A;  3WEE A;  3F5T A;  3CPW M;  2VWB A;  3UKU A;  4BQZ A;  5AQW A;  1S3X A;  4ILH A;  2WBN A;  2FXU A;  3CHW A;  2HST A;  1NWK A;  1Q18 A;  3VOV A;  4A2A A;  3R8E A;  1RFQ A;  5LY3 A;  1QVF M;  2Q0R A;  4C23 A;  4CZL A;  2P9K A;  3CQY A;  3LDL A;  4IOC L;  1HPM A;  1YI2 N;  4I6M B;  3SAH A;  1BO5 O;  1MWM A;  5AQU A;  4BRC A;  4FO0 A;  4QS7 A;  4CBW A;  1OKJ A;  4ISE A;  1YIT N;  4XH4 A;  3LDN A;  3CQX A;  2F9T A;  3W3D A;  1KAX A;  3VEN A;  1HX1 A;  1YUW A;  4Z94 A;  1YJW N;  4WQ5 C;  2IIR A;  1TUY A;  4GV3 A;  1E4F T;  4FSV A;  5GAG P;  3H3N O;  2QW9 A;  3SAF A;  3H6E A;  4KBO A;  5ADX A;  4YDU A;  3HM8 A;  2Q1N A;  5AQH A;  3ATU A;  2NRZ A;  5CHI A;  3DWL A;  4CZH A;  4PHT X;  1NGJ A;  2Q36 A;  4ILJ A;  2E2O A;  3SBT A;  2ZGY A;  1VQL N;  3TPQ A;  5AZJ A;  5JIC A;  1O13 A;  3P39 A;  3R3L A;  4FWL A;  5LJW A;  3CCS N;  5KQ8 A;  3UKR A;  4BRD A;  3OBY A;  3SLC A;  3CCL N;  2P9N B;  1X3N A;  3E9P A;  3HTV A;  4JKC A;  3O1W A;  5B8H A;  3EO3 A;  3LDQ A;  3MWT A;  2HF4 A;  4KH5 A;  5EVZ A;  4DKW A;  2E8A A;  4JKA A;  2A40 A;  5TKW A;  4WFA L;  2E1Z A;  3GDQ A;  1Q82 O;  4RWT A;  3K9K A;  4BRP A;  4H0X B;  3QFP A;  5AQK A;  4A62 A;  2VGM A;  4BR9 A;  2ZJR L;  5KPZ A;  1DGK N;  2CH6 A;  3H46 O;  4C1N K;  1HKG A;  2NRX A;  3DXM B;  3LM2 A;  4CZI A;  1HKB A;  2QWP A;  1NJI O;  3CME N;  1NLV A;  3DJC A;  5GAD P;  5AR0 A;  4JNE A;  2FF6 A;  3TU5 A;  2A41 A;  5JMV A;  5I9E B;  1BA1 A;  3ATV A;  4MO4 A;  2NRV A;  3R1X A;  1X3M A;  4HTL A;  2E2Q A;  1KAZ A;  1X9J A;  3CCR N;  5JVG L;  3CC2 N;  2FLO A;  3ENO A;  5BPN A;  1DT9 A;  4BC4 A;  4J8F A;  3D6R A;  1ZC6 A;  1Y64 A;  3SMS A;  3ULE A;  1BA0 A;  5F1X A;  2OTJ N;  5CR4 A;  3L4I A;  3A5M C;  4CBU A;  2BUP A;  2H3G X;  3CC4 N;  3VEX A;  3QB0 A;  3MK6 A;  1IG8 A;  1S22 A;  3AAQ A;  3WXI A;  4A2B A;  1SQK A;  3E1Y A;  4QS8 A;  1TUU A;  1NM1 A;  4NLB A;  3WXL A;  3MN9 A;  4OPH A;  1DKG D;  3KVG A;  5ELZ A;  2E1Y A;  5FPM A;  1NGG A;  2P9U B;  1VQ5 N;  2YI1 A;  4I6M A;  3BF1 A;  2GX9 A;  3J7Z O;  2HF3 A;  4FPB A;  4RCH A;  2QA4 N;  1MWK A;  3GG4 A;  2KKZ A;  1VQ9 N;  4BRH A;  3D2F B;  3HZ6 A;  3MX2 A;  1NGB A;  5C2F A;  5FPD A;  3CCE N;  4MLE A;  3MCA B;  1YF5 L;  3F2K A;  1QZ6 A;  2HBJ A;  2F7T A;  2NNW A;  1ZXO A;  1YJN N;  1VQ6 N;  1NGH A;  1NGD A;  2JWK A;  5AQS A;  5BRD A;  4IXC A;  1R59 O;  2GWJ A;  3AAP A;  4IFE A;  3TTD A;  5KPR A;  3WQU A;  3MWP A;  3CC7 N;  3MX5 A;  3L0Q A;  2ZJQ L;  4A57 A;  2HBL A;  4CI6 A;  3O08 A;  4DCH A;  5DM7 L;  2YHY A;  2Q97 A;  4AM7 A;  2F9W A;  1BDG A;  1YJ9 N;  1Q81 O;  5GIP A;  4EFH A;  4GVE A;  3D7E O;  1V4S A;  2P9N A;  1HLU A;  4WYB A;  3VEW A;  1TYQ B;  5JLH A;  2OAN A;  4NB4 A;  4FWQ A;  4FOI A;  4GV9 A;  2IVN A;  2Q0U A;  3VF6 A;  2ZWH A;  3LL3 A;  4F9O A;  3N4Q A;  3VGL A;  5C0Y A;  4WF9 L;  3SMP A;  1QQO A;  3C6H A;  4FOE A;  3IMX A;  3O8M A;  3ZYY X;  2CH5 A;  2WC9 A;  4BRI A;  4IJA A;  3DXM A;  3VES A;  3CCQ N;  4H0V B;  3VER A;  3WT0 A;  4H0Y B;  1Z6R A;  3VEO A;  1BU6 O;  4EIA A;  3U8X A;  1RDW X;  3CJ1 A;  4BRN A;  5GIN A;  5BRF A;  1JCG A;  4H5N A;  4BRQ A;  3EZW A;  3PIO L;  1VQ8 N;  3A5N C;  4IEI A;  3CCV N;  4BR0 A;  3HSC A;  3A5O C;  3P31 A;  3CER A;  1NGA A;  4H5T A;  2E88 A;  3H1V X;  3KWI A;  2AA4 A;  2ASP A;  4O5F A;  1D4X A;  2YX6 A;  1NGI A;  4O8K A;  3RSE B;  1VQM N;  1HKC A;  5FPN A;  5M1F A;  3M6G A;  2W40 A;  2BTF A;  4B1U B;  4OO1 J;  4WQ5 A;  3VMF B;  4B1W B;  4BRG A;  5BR9 A;  3HOT A;  2ZGZ A;  1ILY A;  2P9U A;  2HBK A;  4CZG A;  3S41 A;  4CD3 A;  4ILG B;  3LM9 A;  1KAY A;  3VTH A;  4GNI A;  4KH4 A;  4AF1 A;  1N8R O;  3D2F A;  2YCH A;  2HOE A;  2QWO A;  3SK3 A;  3TSQ A;  5BPL A;  1GLJ O;  3TSP A;  3CXC M;  5AQX A;  1HUX A;  4JHD B;  2KLA A;  4BRA A;  4BR2 A;  5AQG A;  1BWF O;  3FLC O;  1K73 O;  4K25 A;  2D1K A;  3FZL A;  1ATS A;  5ADX H;  1RGI A;  3G4S N;  3O9Q A;  4YOT A;  3VGM A;  4B1Z A;  1SS6 A;  2GWK A;  4H5V A;  5EOY A;  4U67 L;  5HOO A;  2V7Y A;  4R79 A;  3IUC A;  1NGF A;  4YDU C;  5GAH P;  2FSJ A;  1WUA A;  5AQT A;  1Q86 O;  1M1K O;  3BP8 A;  3C0B A;  3ENH A;  4JKE A;  4E1J A;  1NMD A;  1TYQ A;  1ATR A;  5E26 A;  4IJN A;  2P9I B;  2ZJP L;  3L6Q A;  5GAE P;  5AQY A;  4BC2 A;  3BUZ B;  3IDH A;  2Q2R A;  4M7X A;  4YOW A;  4FWN A;  2V51 B;  3FZK A;  3OHR A;  4H0O A;  5AZI B;  3U9Z A;  5DM6 L;  2PAV A;  4DQ8 A;  3G71 N;  1VQ4 N;  3H45 C;  3CCU N;  4H5R A;  2Q31 A;  4YOU A;  3Q7B A;  4XH5 A;  3I8B A;  3KWG A;  3M3Z A;  1U6Z A;  4YOV A;  3FE1 A;  3CJC A;  4BGB A;  5M1O A;  3ID8 A;  4A5B A;  1E4G T;  4BC5 A;  4EHU A;  4PL7 A;  3CF5 L;  4H03 B;  4WFN L;  1XUP O;  4IOX A;  5AFU H;  1QZ5 A;  1QHA A;  4FPA A;  3R9P A;  4IO8 A;  3RSE A;  3HOS A;  3IKM A;  2QWL A;  3T7Z A;  1GLF O;  3EKS A;  5AQP A;  4HWI A;  3ID6 A;  1JCF A;  2NZT A;  3JXU A;  4JEP A;  1QQM A;  4JD2 B;  3CJA A;  5AQN A;  4WQ4 A;  4PKH A;  2IVO A;  3F9M A;  1H1V A;  4CBX A;  4JK9 A;  3OA9 A;  4BVP A;  4JAX A;  5JVH L;  3ZX2 A;  2A42 A;  1MA9 B;  4FWP A;  4JKD A;  4H0P A;  5AQI A;  1GLE G;  3E66 A;  5MLC Q;  3D2E B;  3NVM A;  4JN4 A;  3I33 A;  2A3Z A;  2I7P A;  4BG9 A;  3CJB A;  5AQR A;  3BEX A;  1SAZ A;  3EE8 A;  2YJF A;  3FZF A;  3L4Q A;  3KHY A;  3UB5 A;  4WCE L;  4JKB A;  4K41 A;  2KHO A;  4JHD A;  5AQJ A;  3CMA N;  5JLF A;  1Q7Y O;  1W97 L;  1G99 A;  2QTD A;  1J6Z A;  3C7N B;  4IO9 L;  3G25 A;  2P9L B;  1LCU A;  3GBT A;  3PIP L;  1GLD G;  3CCJ N;  3QML A;  4U7B A;  4XEI A;  1WOQ A;  3EN9 A;  3AY9 A;  1P8Z A;  1K8K B;  1YVN A;  2V7Z A;  3O9R A;  4BRL A;  5FPE A;  3PLA A;  5AQZ A;  3VF4 A;  4BRK A;  1T6D A;  3QIC A;  1GLA G;  3MCP A;  4FVU A;  3EL2 A;  4PKI A;  3VPZ A;  1C0F A;  2HMP A;  3QDK A;  3O4W A;  5E84 A;  2P9I A;  3HI0 A;  4A5A A;  1T6C A;  4BR5 A;  4BRM A;  1KC8 O;  1HJO A;  3E9O A;  4BVO A;  3TSU A;  4B1Y B;  2QXL A;  4IOA L;  3MN6 A;  5AZI A;  2QWN A;  5KPT A;  3FFK B;  4PKG A;  4FWM A;  4KH6 A;  2UYT A;  3DXK B;  4B1X B;  4RTF D;  3B8A X;  4LC9 B;  3CET A;  4IEE A;  4CD1 A;  4EHT A;  5M1N A;  3I56 N;  1S72 N;  3NMU A;  4ISG A;  5LJV A;  2EWS A;  2FSN A;  2GEM A;  2YJE A;  3ZEU B;  4BRO A;  4WFB L;  1W2B M;  5BRH A;  2NLX A;  4PL8 A;  3UE5 A;  3EE9 A;  2CGK A;  3J8A A;  3Q7C A;  4H5W A;  2QM1 A;  3WQT A;  4CZE A;  2P9P B;  1RDU A;  3C65 A;  3ZET B;  3TTF A;  3WXM B;  2YHW A;  4YOR A;  3ENB A;  3OBW A;  1VQK N;  4JK8 A;  1P90 A;  3CI5 A;  2D0P A;  2HBM A;  4B1V A;  5C10 A;  3GL1 A;  1BG3 A;  3EKU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...