4O8UA

Structure of pf2046
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
227
structure length
227
Chain Sequence
SRIVAADTGGAVLDETFEPIGLIATVAVLVEKPYRSAKEVMVKYANPYDYDLTGRQAIRDEVLLAIELARKVKPDVIHLDSTLGGIELRKLDEPTIDALGISDKGKEVWKELSKDLQPLARKFWEETNIEIVAIGKSSVPVRIAEIYAGIYSAKWGIENVEKEGHLIIGLPRYMEVNIKDGKIIGRSLDPREGGLYGSAEVSVPEGVKWEIYPNPVARRFMIFEIFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein PF2046
publication title Crystal structure of a novel non-Pfam protein PF2046 solved using low resolution B-factor sharpening and multi-crystal averaging methods
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Unknown function
total genus 57
structure length 227
sequence length 227
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2013-12-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.440 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4o8uA00
4YOTA 4YORA 4YOWA 4YOXA 4YOUA 5CHIA 4YOYA 4O8UA 4YOVA
chains in the Genus database with same CATH superfamily
2UXCK 3CQYA 3SK3A 2V7ZA 4DLEA 3MN9A 3CJ1A 1JL1A 4CEDA 4CCHA 1VSDA 1BCMA 4FJNA 3NVKA 1DTTA 3L2VA 4C8NA 4FLXA 2E8AA 2O8CA 3V4IA 3NF9A 3QB0A 2WONA 3C6AA 2HHUA 4DQ8A 3V6DA 4L3QA 4RCHA 4JKGB 4J2AA 3LAKA 4GW6A 4ZTJA 2IVNA 5DMRA 4BRGA 4BC2A 3JAMO 2A3ZA 1OVYA 4JHDA 4Z4IA 1RDWX 3TAGA 5MLCQ 1KLNA 4M3UA 4JI7K 2P9IB 4H4OA 4E7LA 4DTRA 1GLFO 5AQIA 3OYFA 3FZLA 4B9UA 3I56N 1F21A 3T1YK 4I7FA 1HRHA 2WBNA 4DQIA 3M6GA 4DTJA 4OPJA 3PIPL 1QSLA 4JS5A 2BANA 4JV5K 3G6EN 4HTLA 3A2FA 3H1VX 5AQTA 1T3VA 4C1NK 1FW6A 4CFBA 4KTQA 3QBWA 1NKEA 3P31A 1SQKA 3AVLA 4CERA 1O13A 5B8HA 2ZE2A 5KGXA 1NJZA 3CCEN 1JLBA 4Z4FA 4KHSA 4IO8A 4JAXA 4N5SA 5AQFA 5KPZA 4KO0A 4Z4EA 2NZTA 4IWVA 4E7IA 5FROA 1HNVA 3ZETB 4CGIA 3L2QA 1HKBA 2Q1NA 1TVRA 5AQZA 4FLTA 3QNOA 1RDAA 3C94A 2Z1JA 3GBTA 2P9PA 3QERA 4M3XA 3HP9A 2IIRA 2X6NA 2HOEA 3ZSWA 4IEEA 4DV3K 3FLCO 3AGRA 1NGFA 4GVMA 4H0TB 3G10A 4DR1K 2GWKA 4J2BA 4BWJA 3CJ7A 3PV8A 2BDPA 3QEWA 4H0XB 1X3NA 2W41A 4DS4A 3RR7A 4FJXA 3SUQA 1NM1A 3F2KA 1WSEA 3NGIA 1MU2A 5CE3A 1S1XA 3AVIA 4MDAA 3T3FA 4H0PA 2FLOA 3M8QA 4CD3A 2Z1HA 1TK5A 1IG8A 1YTAA 5HROA 2O8BB 5AFUA 3L0QA 4KFBA 4WQ5A 4JS4A 1FK9A 4B8CA 4M3ZA 3TU5A 4BRFA 3EYZA 5BPNA 3O9QA 2GUIA 4MLEA 5SZTA 3TANA 1HNZK 4CECA 1YVNA 2HF3A 2KFZA 4JD2A 4CJ7A 2HBMA 3WXIA 3CCJN 4H5RA 1NOYA 1JKHA 3DRRA 3IRXA 4GV6A 4BE0A 2I7PA 3VEXA 3MX2A 3T19A 4F9OA 4KV8A 4CJTA 4FZZA 2D0PA 1M90O 4EIAA 4DTPA 2P9NA 3ZX2A 4DSEA 2W6LA 1WUAA 1LV5A 3DWLA 1K8KB 4FK2A 2CH5A 5C12A 1EKEA 4DQPA 4AQYK 4C8OA 1K73O 2G8VA 1NJXA 3VTIA 4M7YA 2W42A 4GV9A 2KZZA 3HBTA 3HJFA 3KKSA 4HCCA 3LDSA 5BPMA 4CHNA 2P51A 4DSFA 1HYVA 1SL0A 5IT9O 4OKKA 1S3XA 3PX4A 1S1TA 4IDHA 2FSJA 1I3AA 5C15A 5BR9A 2VCPA 4YOXA 4IFYA 2P5GA 4HUFA 1OH6A 4FWMA 5C2DA 1N32K 4KREA 1BO5O 3LWLA 1NGJA 4DSJA 3MEEA 4FXDA 1NK4A 2G8IA 2NRZA 1S1VA 1UOCA 4PKIA 4JKHA 1TK8A 3THYB 4PY5A 1QQMA 3BF3A 2BTFA 3OVNA 3K5NA 3CETA 1GLAG 1HQUA 3QETA 4FJ5A 2IVOA 4FWQA 3IFRA 1KQSM 2P9SA 4IXCA 4CZEA 5AQLA 4RTFD 1LWEA 5KQ8A 1NGAA 2RN2A 4B9MA 2O8CB 2CH6A 5HLFA 1MWMA 4B3MK 3RMDA 3AA2A 1GLEG 4FJKA 1QVGM 4K0KK 4U67L 2XY8A 5DK5A 2G8FA 3LALA 4ISFA 3TSUA 2Z1IA 4O8KA 3K0SA 3LWMA 3ID6A 3AVNA 2XRIA 4MO5A 3I0SA 1T05A 2AA4A 4JHDB 1WSIA 1L5UA 3U9ZA 5BREA 1VRUA 4B1YB 4HUGA 3AV9A 1YJWN 2D0AA 4WCEL 3CJBA 4NYFA 3CCQN 3AVFA 1IBMK 1GOBA 3O4NA 3F5TA 1N5YA 4O5BA 5ADXH 4AM6A 5AQYA 2YNIA 3L4QA 2UUCK 2KW4A 4XEIA 3EKSA 4B1UB 4FW2A 2YI1A 4CJ4A 3DLHA 3WXKA 2F9WA 1U6ZA 1BIZA 5SWMA 3V9WA 1MDUB 3O9RA 3ZCMA 1ILYA 3EE8A 1L3SA 1HJOA 1O1WA 1TL3A 2FF6A 4DFMA 3MN7A 3P38A 4B9VA 4CFDA 3CCSN 2QTDA 1RNHA 1NWKA 3KVGA 4I2QA 4LC9B 2O8FA 4H5NA 3NCIA 1D9FA 3CCLN 2X78A 3OBYA 3ZEUA 1S6PA 3SAHA 1LW0A 1XNQK 3L8BA 4DTUA 4JYAK 1KXPA 3FZMA 2HHWA 4Z4GA 3NBPA 1S9EA 4AH9A 5ELZA 1OVQA 3L4IA 3V1OA 4DCHA 5AQPA 2UXDK 1EQYA 3WNGA 4RW7A 1SS6A 1GOAA 1HMVA 4FWOA 3MEGA 5F2RA 4CD1A 1RBUA 2ATQA 3P1GA 4LF5K 2FBTA 3GL1A 5JVGL 1VQPN 1KFSA 4DR7K 5AQSA 4DFKA 3NFAA 1U2VA 1KVCA 1D8YA 1Q7YO 3FFKB 4DUZK 3AO1A 3LL3A 3ZX3A 3SMSA 4DTSA 3C6HA 1VSIA 4WF9L 4AHUA 5AQNA 2EX3A 1JLGA 5GINA 2QWNA 2DFHA 3LM2A 3L3UA 2HHXA 1JCFA 3THWA 3DAWA 3KHYA 2IS3A 4BRHA 3EL2A 4JD2B 4DV5K 2GWJA 1QS4A 4J2DA 1ESVA 4L8RB 1C6VA 3VENA 4NXMK 3ZSXA 3IKMA 1ATSA 4M3YA 3IDHA 3QFUA 4FOEA 2OPSA 3SI6A 4FJIA 4WFAL 4YDUA 1NGGA 3TSQA 1XMQK 3WNEA 1KAXA 3TWHA 1VRTA 5KPRA 3OYHA 2P9NB 4CEAA 3SJJA 3VERA 4OO1J 4RW4A 2HMPA 2ZD1A 3C7NA 1S22A 3SPYA 4BDPA 2ZQBA 3HL8A 4EHTA 1YI2N 4X64K 4DR5K 1HR0K 1EO1A 3ENBA 2QEXN 3OYBA 1VSLA 4B1VA 4YOVA 3RSEB 2VWBA 3CI5A 2UXBK 2KTQA 1WNSA 2NUBA 1YITN 5AQJA 1T8EA 3RWUA 3AVAA 4OPHA 1RT4A 2PYLA 4WE1A 3VGKA 4RWTA 4EZ9A 3EO3A 3O8MA 5FDLA 4CJWA 2KLAA 3WEEA 4DF4A 3CQXA 3ZSRA 4FPAA 3M1FA 4E89A 3F9MA 1VHXA 2ZM6K 3KK2A 5BN9A 3CERA 3NH0A 3ENOA 4CW7B 3CF5L 3AVHA 3HVTA 2OANA 4HWIA 1Z25A 1IKXA 1BHLA 4W5RA 1IV0A 1A5XA 3N4PA 3D45A 1JLFA 3O1WA 2QKKA 1D5AA 2G8UA 5D3GA 4H5TA 4JI6K 5GADP 2DTUA 3BY5A 1S1UA 2ASMA 4FM2A 3TARA 1W9HA 5JLFA 4PA1A 3OYDA 5EXWA 3OJUA 4H4MA 5HBMA 3CJAA 2IOCA 1SL2A 4FWPA 4KHPK 4FSVA 4ILJA 2AP1A 3CCRN 5DM6L 4Y0WA 3KTQA 1RGIA 2YNHA 1VQ5N 2FBYA 2HHHK 3L3VA 5AJ3K 1J5EK 3WNFA 3SUOA 1NNEA 1IBKK 4I9QA 4MFBA 5BRFA 4DSKA 4BGBA 4AHCA 4YOUA 1U45A 1RFQA 2JWKA 3F73A 1YIJN 3O6WA 1L3VA 4LFAK 3U6FA 3LPTA 4IDKA 1GLJO 2VGMA 4FWLA 1SV5A 3OYNA 3HP6A 3KK1A 1WAFA 4Y1DA 1N33K 2A42A 3K5MA 1BIUA 1S6QA 3AAPA 1UA0A 2UUAK 2XY7A 1VQ7N 1CZBA 3R1XA 1LCUA 4RW6A 3S3NA 3O9UA 1HKGA 4N56A 2ITGA 1K6YA 3AARA 4IOXA 2RHKA 3ATUA 5FLXO 3TTCA 1CXUA 2V52B 3KLGA 4CF2A 3SV3A 3FZFA 2D0CA 4KH5A 1RBVA 2F8TA 3OY9A 4BQZA 2YJFA 2O8EB 3THXB 3LP1A 3ZEUB 3L6QA 4JK8A 2Q0UA 4H0OA 3VGLA 3HO1A 1W0HA 5KGWA 4PUOA 1VQLN 1N34K 2NRVA 1HKCA 1KFDA 3VN5A 2RPIA 4M41A 3DXMB 1LWCA 2NNWA 2YHBA 3CFPA 4O5FA 4CBUA 1C1AA 4JNEA 1QE1A 4YY3K 2HVIA 4CF9A 4WQ4C 3CM6A 3KWIA 4DV7K 5FPEA 4KHQA 1S1WA 1WAJA 1GLBG 5CYQA 4CGFA 4E0DA 4PKHA 4IO9L 5EY4A 3SQ0A 1K9MO 2HNYA 3BEXA 3ZSOA 3I0RA 4FO0A 1YT3A 2HNZA 3EEQA 4GV3A 3VGMA 4KHYA 4PWDA 2A6AA 4CF0A 1VSEA 3ZSVA 3QEIA 1RBSA 2ZGZA 4RG8A 4BR2A 3MXMA 4JK9A 5F0XA 2OPPA 3ASMA 4B9LA 1TV6A 4ILHA 1VQNN 1VSJA 4DSIA 2KKZA 3DMJA 3TABA 2HMIA 3E01A 3HOSA 3V9XA 4F2RA 5M1QA 3THWB 3M5RA 2OZSA 3KD5E 4JI4K 1RDDA 1RCHA 4FCYA 5AZIA 2DFEA 3HTVA 4NCAA 1HNIA 4XH1A 4C8MA 4BRNA 3CM5A 3D2FB 1QZ6A 2NRTA 3VQPA 4IEIA 3ZSYA 2VG6A 3DLBA 4YFUA 3C7NB 3VQBA 1DT9A 3VF4A 2YHWA 1XMOK 5FRNA 2KHOA 1R59O 4ZHRA 1QSYA 1WSFA 3DLEA 5KRSA 3BP8A 1HJRA 1KSPA 3EKUA 1HYZA 3DYAA 1VQ6N 4CFAA 2NRHA 4FLZA 3HYFA 1BUPA 3L2WA 1VSFA 4BRKA 4ICLA 2QWMA 3NF8A 3KZBA 3D0PA 3AA3A 5CZ2A 5AR0A 1ASVA 3AAQA 4WYBA 3AVBA 4CZGA 2E88A 2Z1GA 3FZKA 2J4RA 2ZJPL 3A5NC 4LFBK 3HVRA 2FBVA 1QHAA 3DXKA 5C24A 5GAHP 3ATVA 5AQHA 4KH4A 3AA4A 3SJHA 4MDBA 3ZT3A 4BGAA 4YNQA 3A5OC 1JLQA 1GLCG 5H1SQ 3KLIA 3SQ4A 4B3SK 4KB0A 2YHAA 3AA5X 4DLGA 4MLHA 3D2EA 4DKWA 2FF3B 3LZJA 4CI6A 2QXFA 5AQGA 2E2NA 5KRTA 4QS8A 4E1NA 3QNNA 3VPZA 4E1JA 3NAEA 4KHWA 3HXMA 3THVA 1BA1A 3C6TA 2JGUA 4LY7A 5A2QO 4G1QA 3RVCA 3UE5A 4FJJA 1BWFO 4DR3K 4DQQA 4C8KA 1VQ4N 4FW1A 1DLOA 3VQEA 4FWSA 4JLHA 5LL6Z 1U4BA 3IUCA 3VQ7A 1QZ5A 4JKDA 3PUFA 3SPZA 3K9JA 5CHIA 3BDPA 3NE6A 3TAEA 2CGJA 1TUUA 3RRHA 4FM1A 4LH4A 3ZT2A 4F8RA 4H0VB 2WC9A 1OH5A 5EOYA 5JICA 2HHTA 4DFPA 3CMAN 3KIOA 3U3YA 2XHBA 3O4WA 2E6MA 3HI0A 4R5PA 1U04A 3T1AA 3S9HA 4H03B 5AQQA 3VQCA 1NKCA 2F8SA 3MXJA 2A1SA 3VTHA 2HBJA 5EX5A 3VEZA 4BROA 5GIPA 4X66K 3RRGA 4YOWA 1U47A 4HHTA 3PO5A 4PL7A 3SQ2A 1GLDG 1TAUA 4CHOA 1T6CA 4BRPA 5BPLA 3CMEN 5GAEP 3LAMA 4OKJA 3AO4A 2V51B 1KVBA 1RTHA 4BREA 1ZC6A 2P9LA 3ALYA 1SKRA 3QFPA 3OYIA 3LZIA 1IKYA 4MQ3A 1NLVA 2ETJA 3LANA 4CHYA 2FSKA 5J2NA 4XH5A 1P8ZA 5BRHA 3GDQA 3O80A 3OYKA 4A57A 3SNNA 2NRXA 4RW8A 4BDYA 4K43A 5FPNA 3L2RA 3RMBA 3VF2A 4LF8K 4B1ZA 1HQEA 3DJCA 1L3UA 1KTQA 3KLFA 4E7HA 3PX0A 2O8DA 1VAZA 4O55A 4ELVA 4BR4A 1NK6A 4W5NA 3WXLA 3S3OA 3OYAA 2HVHA 1IKWA 1TYQA 2PZSA 3ZYYX 4HUEA 4DU4A 1QQOA 2XO7A 3KLHA 2YNGA 2A1RA 3LDQA 3J7AP 3CJCA 4OPKA 1KCFA 3VA3A 1ZBSA 4WFBL 3OYJA 1NOZA 4O8UA 4DV1K 4BVOA 1XHZA 3UKRA 2RF2A 3O1BA 1KVAA 4WFNL 1CXQA 2H3GX 2P9UA 4EHUA 3P39A 2HW3A 3AGKA 3P5JA 4NCGA 2ITMA 4X62K 3GE1A 1T6DA 1BISA 4CJRA 2XY6A 3UKUA 3U3GA 4NLCA 1C1CA 4DR4K 4LSNA 2I5JA 1IKVA 3QEPA 2OCEA 4JKFA 1IBLK 5AZIB 1KLMA 4IFEA 3VMFB 4DV2K 3AVCA 3H45C 1BL3A 4M45A 3ENHA 4M3RA 2VWJA 2HB5A 1YF5L 3OYGA 3M8RA 1VQKN 1XC3A 4HCBA 1A5WA 5K14A 3HM8A 4A2AA 1W7AA 2X6SA 1P90A 4CGDA 2FSNA 1NJYA 1RTIA 2E2OA 3CC4N 1Q86O 1NU0A 1X9WA 1YJ9N 3G0ZA 1REVA 1BI4A 3H3OB 1NGDA 3TTFA 1LW2A 4BDZA 5AQRA 1C0GA 4DHYA 1SKWA 1LAVA 3MN6A 4YORA 4BE1A 2B6AA 2CGKA 3LP0A 3KLEA 4B08A 3HRGA 4BC5A 4N41A 4IJNA 5FRMA 3VQAA 2P9PB 1J53A 2P9KA 3J8AA 1WOQA 1IG9A 4HTUA 4O0IA 4DU3A 4IKFA 4WQ5C 2YV0X 3HSCA 1IJJA 2WOMA 3OBWA 3H6EA 2Y1JA 3SCXA 1XI1A 1JCEA 4I6MA 2AJQA 1GOCA 1FXXA 1YUWA 3QESA 3D2EB 1WSGA 1NK5A 3DLGA 4DTXA 2QI2A 1LOTB 4A59A 4CHPA 3WUHA 3T7ZA 3ZLJA 4BR0A 4IOAL 2BH1A 3T1HK 1RBRA 3AVKA 3FGUA 2V7YA 5AFUH 4FLWA 4AHRA 1DKGD 4FVUA 1B9DA 3AVJA 3HPGA 4GNIA 1R0AA 4DUYK 4CZJA 3BZCA 1XWLA 3VOVA 2ZJRL 3QBXA 4JKBA 4BQLA 2ASOA 4JKGA 3VEOA 3WQUA 3M8SA 1NGEA 3J7ZO 4BRQA 1Z26A 5IWAK 1D4XA 3EY1A 3NGZA 3NGYA 1T44A 3HZ6A 3CD6N 3VQ4A 4JKCA 5M1FA 4HVJA 3C65A 3MAQA 3AO2A 4QCLA 5EU7A 1TKXA 2OTJN 1HNXK 2YHXA 1VSMA 4JK7A 4XH4A 4CK1A 3V9UA 5F1XA 1KAYA 3SYZA 2YX6A 1T03A 5E26A 1DEJA 2GX9A 5CR4A 1NK0A 3IG1A 2E5LK 3TTDA 2VQEK 5AQVA 5JLHA 3K2PA 4GMJB 1L3TA 4E3SA 1FKOA 4NXNK 4FL9A 1JJ2M 4CHZA 2Q97A 3VEYA 4ZTFA 1Q9XA 4F3TA 3WQTA 4ID5A 3TAPA 1VQON 4BWMA 3OYCA 1HPMA 1QSSA 3MCAB 4A5BA 2KFNA 3ULEA 4JRPA 2EHGA 4DV6K 3MDQA 3QMLA 1U48A 2GEMA 4H0YB 4CJEA 4FPBA 4GVEA 3AVGA 1YHQN 4ID1A 3ULDA 5FPDA 3QO9A 5M1NA 2Q0RA 3N4QA 4CF8A 4F2SA 2VQFK 1WB9A 3OW2M 4BR5A 4Z4CA 2D4WA 4EAHD 1BA0A 3R8EA 5KPTA 3LDOA 1CZ9A 2D1KA 3R3LA 4JN4A 4DWIA 2O8DB 4FLVA 1Y97A 5EVZA 4BRLA 3DOLA 1J6ZA 1C0MA 4OLBA 4B1WB 3FZHA 1NJIO 2P9SB 4FJMA 3C0BA 2RE2A 4M7XA 1NJWA 4CZIA 3Q7CA 3JS6A 2CGLA 3V1QA 1ZBUA 2G8HA 3VQ9A 2O4GA 2IDOA 1HUXA 3WNHA 4W5OA 2WTUA 4CJKA 2XY5A 3SBGA 2P9UB 4DB3A 4KTWA 5AQOA 3U4LA 5GAGP 4BR9A 1UWBA 1TKTA 3RMCA 2YCHA 1SUQA 4JI0K 1TK0A 3UKUB 2D5RA 4O4GA 4GKKK 3AVMA 2E2PA 5LY3A 2QK9A 1VQ9N 4XIUA 1X9MA 3SBTA 3TAFA 4CGHA 1Q82O 1YXQA 1J9AA 3K9KA 3VQQA 1VSHA 4CESA 1KD1O 4CIEA 2F9TA 4M42A 5CYMA 3VQ6A 4PL8A 1N36K 1JCGA 4CEQA 1WBBA 3S41A 3NF6A 1G99A 2GUPA 4B9SA 3SUPA 1FKPA 3C95A 4TSXA 3TAQA 4LF9K 5C10A 1EP4A 4OGCA 2GV9A 1YTUA 4A2BA 3CFOA 1BI4B 3C6UA 1NMDA 1SAZA 2O8FB 4M3WA 2OPRA 3MEDA 4K25A 3CC2N 4KBOA 1HYSA 1BCOA 1IO2A 1CZAN 1YAGA 5AQWA 2NRWA 2OZMA 2B5JA 2IAJA 2P9KB 3T69A 3V1RA 5HRRA 4GY2B 4BRIA 4FLUA 4AHTA 1N6QA 4B8AB 3CG7A 2VG5A 1NBWA 3DLRA 3CFRA 4ELTA 4CVNE 4NB4A 3SUNA 3DRSA 1CLQA 3QLHA 1TKDA 1H1VA 3BUZB 5BR8K 3WT0A 3THYA 3U9DA 4NO7A 4AF1A 3KK7A 4I6MB 1U2VB 4CGJA 5J1EA 4JI3K 3I8BA 3G4SN 2BGGA 4GKJK 3IS9A 3H3NO 1GLLO 3G71N 4YDUC 4FJ8A 4IFVA 5HP1A 4DFJA 1WBDA 2QA4N 3OYLA 3L2UA 3OS1A 1HNWK 5HOOA 5AQKA 3DI6A 3A8YA 1TL1A 3HPOA 1JLCA 4CK3A 2KZMA 1ASWA 3DRPA 3O4QA 1WLJA 2Q3SA 2E1YA 4BVPA 5E41A 4ISEA 2QWQA 1SL1A 3V9SA 4H5WA 2E6LA 4KTZA 1C0FA 2YNFA 1MWKA 4H8KA 3FFIA 3DOKA 4LD0A 2GBZA 1NGBA 1W2BM 4R79A 3SAFA 5C25A 4KAZA 1VK0A 3E9LA 1Q9YA 4NYNA 5M1KA 4AILC 2QWRA 3CYMA 5HRPA 2G8WA 3HT3A 4IBNA 5ADXA 3W3DA 5FPMA 3PSFA 4Z94A 5CY4A 4M3TA 4BR7A 3ISNC 4JKEA 5LMNK 2PBDA 4CJQA 4LSLA 3VEWA 4FJHA 3FE1A 5HL7L 3WEEB 2P1JA 4CFCA 3DM2A 3F9KA 3FR0A 3ZSZA 2Q2RA 4CEFA 1RTDA 1VQMN 4FJLA 1EWQA 1BQNA 5C0YA 3ULEB 2KQ2A 2RKIA 4AM7A 1W97L 5DM7L 4B9TA 3TR8A 3E1YA 3SMPA 5KI6A 1KC8O 2O4IA 3BZKA 4BE2A 1Z05A 1I94K 3MN5A 4OPAA 4BG9A 1XC9A 3VQDA 3I33A 4DR6K 1OH7A 1V4TA 2P5OA 1S5JA 1ZYQA 1VSKA 4A5AA 5JVHL 4FVMA 1NKBA 3HSTB 1JLEA 4DG1A 3GOIA 1BDGA 1X9SA 2G8KA 4DF8A 4KRFA 1JXEA 2NRRA 4JEPA 3AO3A 5TKWA 1ZBHA 1B92A 1KAZA 4LH5A 4DV0K 5J2QA 1VQ8N 5JS2A 3P83D 4FJGA 1IH7A 3NDKA 4PKGA 2W40A 4FWKA 4Q0BA 4CJ5A 3ZT4A 4A62A 4BC4A 4B9QA 4CJ3A 3QINA 1ZBIA 1QTMA 3CCUN 5HRNA 4BRCA 3CIPA 2A41A 1A5VA 3TAMA 2ZWHA 1WSJA 1ZXOA 1YJNN 3RTVA 5BN8A 2HBLA 4OLAA 1ATNA 4CK2A 3D6RA 4FYDA 4DTOA 4OGEA 2Y1IA 1SZ2A 3OYEA 4CJVA 1V4SA 2QWLA 3K5LA 2OYQA 2WFBA 4UY8O 4YOTA 2WUSA 3O3FA 1EWRA 2ASPA 1EX4A 2E2QA 4ILGB 5KTQA 4E7KA 2YKMA 4FM0A 1RT2A 4Z0UA 2VYPA 3QDKA 4OKEA 3RSEA 3OJSA 2Q36A 3E9PA 3H08A 4CIGA 4Y1CA 4OX9K 3SQ1A 1XHXA 4CEEA 1Q81O 1TUYA 4K8XA 1E3MA 3MK6A 1E4GT 1E4FT 3J7YP 3PY8A 1T7PA 3UIQA 1RTJA 4FZYA 4KH6A 4FWRA 2IVPA 3SZ2A 1NK9A 1K8AO 3HPHA 3RR8A 1ZBLA 4DV4K 3B6PA 1QHTA 3KJVA 2X74A 5AZJA 1HPZA 3HK2A 4X65K 1NGCA 2ZF5O 3P4IA 1KRPA 3LDPA 2OTLN 3B8AX 5C42A 4LF4K 3ZX0A 4K42A 4QS9A 1NG9A 2QW9A 2QXLA 4A61A 4J8FA 5LJWA 3JYTA 3NH2A 4I2PA 4DQSA 4DTNA 2B4JA 2R7YA 4N76A 2W6KA 4RW9A 2E4LA 3S3MA 3KKRA 1NGHA 1JL2A 3PLAA 4QS7A 5TKYA 5I42A 4KI6A 1BU6O 3WXJA 4YOYA 4CEBA 2HSTA 4BACA 4CJFA 3VA0A 5LMUK 2HHVA 1BGXT 4CF1A 5AQUA 1QVFM 3CHWA 4CBXA 2UUBK 3K5OA 1LAWA 4Q5VA 2EWSA 5J2MA 2ZGYA 2FXUA 3VETA 1YVUA 3D7EO 2LSNA 1RT3A 1S72N 2A40A 4BG8A 4KPYA 2NLXA 4FJ7A 2HF4A 4CZKA 1Y64A 4JI1K 2GELA 3QEXA 2Q31A 4NLBA 5I9EB 5J2PA 4KHUA 4CJSA 5HRSA 1NMNA 2YJEA 3V9ZA 3ZT0A 4YHHK 3PO4A 4ELUA 4JI8K 1DTQA 4DQRA 1ZBFA 2QM1A 3CPEA 3SV4A 3I8DA 1BQMA 3I55N 4CJUA 4BRDA 2IGIA 3MWPA 3THXA 2O8EA 4C23A 4JRQA 3DXKB 1DGKN 1RT5A 4V19S 2VG7A 3NH1A 1EETA 3OYMA 3W0LA 4DMNA 4O44A 3DXMA 1D9DA 4KHNA 3A5MC 3H46O 2E1ZA 4OVLA 2OA8A 2JWLA 3A0IX 3LM9A 5GIOA 3MXIA 4LF6K 4CJLA 1TGOA 4EZ6A 4BRAA 5I3UA 3ZSQA 3EE9A 3LP2A 4F4KA 4B3TK 4N47A 1QQCA 1J54A 4K8ZA 3DLLL 4OJRA 3CPWM 3NMUA 1OKJA 4JKAA 3SLCA 2D0BA 3M8PA 2QWPA 3B6OA 5AQXA 2BE2A 4MO4A 4CE9A 2YKNA 3OA9A 1RDUA 1NGIA 1UAXA 1NK8A 3K59A 1J5OA 1ITGA 4WQ4A 3TSPA 2P9IA 3IMXA 2PAVA 3ZT1A 4CZLA 4W5TA 2E20A 3J80O 3EN9A 4QAGA 3QEVA 4FK0A 4EP5A 3OS2A 4CGGA 1C0TA 1Q18A 1ATRA 4FLYA 3R9PA 3JSMA 5JS1A 3V81A 3AO5A 3MX5A 4EP4A 3D2FA 2PFUA 2F96A 4CZMA 4J2EA 3VQ8A 3H1QA 2UYTA 3AY9A 1WSHA 3IAYA 2QKBA 4CBWA 1SKSA 3HOTA 3CC7N 3PX6A 4BRMA 3MWTA 2A5XA 3K57A 4AHVA 3ZETA 2P9LB 3VF6A 4ISGA 4CZFA 3Q7BA 4Z4HA 1MA9B 4DSLA 2QWOA 1G15A 1LWFA 4IG0A 4IG3A 3VQ5A 1I39A 3K58A 1HX1A 1JXBA 1X9JA 2OPQA 2F7TA 4IZ9A 5T7BA 4IOCL 5M1PA 4W5QA 5AZJB 4E7JA 1XQSC 3MCPA 3QIOA 3CQ8A 2GTDA 4K41A 1N8RO 4CIFA 4KKOA 3BGRA 1TYQB 3LDLA 4CEZA 1X1PA 4B9NA 4H5VA 1XNRK 3EZ5A 3M3ZA 2DPNA 3O9SA 4IJAA 2IC3A 3UB5A 4JI2K 4B3RK 4JI5K 4CJPA 1EXQA 3U8XA 2BUPA 5BRDA 2ZJQL 1RBTA 3CCMN 3GG4A 3E9OA 3MMVA 4E1MA 1RT1A 2O8BA 3VEVA 3DLKA 4AHSA 4CZHA 3PIOL 2FBXA 1RT6A 1ASUA 1B9FA 3VESA 2JLEA 4KI4A 3UKRB 1OH8A 4FK4A 2HHSA 3MECA 3G25A 3TI0A 1XUPO 4KB1A 1S9GA 3J81O 3O3GA 3JXUA 4FJ9A 2VWKA 3O5BA 3O08A 1FJGK 3QICA 3NHGA 3OHRA 3CCVN 3LDNA 2PY5A 2F4VK 3EZWA 1JLAA 1TKZA 3QIPA 4F3OA 2D0OA 2HNDA 1BOTO 1NK7A 2VGNA 3E66A 2PYJA 3PSIA 3NF7A 3LPUA 5KQDA 1U49A 4B3OA 1C1BA 1K8KA 5JMVA 3SAGA 3CJ9A 5C2FA 3LP3A 3NVMA 3ID8A 4FOIA 1TAQA 3O9TA 4LFCK 2YHYA 4FWNA 1Q8IA 4E19A 4G9ZA 1HLUA 1Z6RA 2UU9K 3KWGA 4PHTX 2HBKA 4B1XB 3O3HA 1WN7A 4QOZB 3KK3A 5E84A 1C0UA 4I9LA 5CZ1A 4U7BA 4NCBA 2DFFA 1RDCA 4O0JA 4CHQA 1RDBA 3KD1E 4BC3A 1X3MA 2I7NA 4BY9C 3WXMB 4C8LA 2HHQA 4DR2K 3CXCM 1QQNA 3R6MA 3HM9A 4UQGA 4DU1A 5AQMA 4DTMA 4FZXC 4PQUA 1BG3A 3RMAA 4CEOA 4EFHA 4LF7K 3ITHA 3OTOK 4C1NI 5M1OA 2DY4A 3TPQA 1UA1A 4DS5A 1M1KO 4M63C 3BF1A 2FC0A 1RT7A 3OS0A 5LJVA 1RILA 3A5LC
chains in the Genus database with same CATH topology
3CQYA 3SK3A 3CCUN 1P90A 4BRCA 2V7ZA 3CIPA 2A41A 3F9MA 3MN9A 2FSNA 3CJ1A 5BN9A 2ZWHA 2E2OA 3CC4N 1Q86O 1ZXOA 3CERA 1YJNN 3ENOA 1YJ9N 3NVKA 3CF5L 5BN8A 2HBLA 1ATNA 2E8AA 2OANA 4HWIA 3H3OB 1NGDA 3TTFA 3D6RA 3QB0A 5AQRA 1C0GA 3N4PA 4DHYA 3C6AA 3O1WA 3MN6A 4DQ8A 4YORA 4H5TA 2CGKA 3HRGA 4L3QA 4BC5A 1SZ2A 4IJNA 4RCHA 4JKGB 5GADP 2P9PB 2IVNA 1V4SA 2QWLA 2P9KA 4BC2A 2ASMA 3J8AA 2A3ZA 1WOQA 2WFBA 4BRGA 4UY8O 4YOTA 1OVYA 4JHDA 2WUSA 5JLFA 1RDWX 5EXWA 2ASPA 4ILGB 2E2QA 5MLCQ 3CJAA 4WQ5C 4FWPA 2P9IB 1GLFO 2VYPA 3QDKA 3FZLA 4FSVA 3HSCA 2Q36A 3E9PA 1IJJA 4ILJA 5AQIA 2AP1A 3RSEA 3I56N 3CCRN 5DM6L 4Y0WA 3OBWA 1RGIA 3H6EA 2WBNA 1Q81O 3M6GA 1TUYA 1VQ5N 1JCEA 3MK6A 4I6MA 1E4GT 1E4FT 3PIPL 1YUWA 3G6EN 4HTLA 3H1VX 5AQTA 1T3VA 4KH6A 4C1NK 3D2EB 5BRFA 4FWRA 2IVPA 3QBWA 3P31A 1SQKA 4BGBA 1O13A 4YOUA 1RFQA 1K8AO 2JWKA 2QI2A 5B8HA 1LOTB 4A59A 3CCEN 3WUHA 3T7ZA 1YIJN 3O6WA 4BR0A 4IOAL 2BH1A 4IO8A 4JAXA 5AQFA 1GLJO 2VGMA 3FGUA 4FWLA 2V7YA 5AFUH 5AZJA 5KPZA 2NZTA 1DKGD 4IWVA 1NGCA 2ZF5O 4FVUA 3P4IA 3LDPA 3ZETB 4GNIA 2OTLN 3B8AX 2A42A 1HKBA 2Q1NA 4CZJA 3AAPA 3VOVA 5AQZA 3R1XA 2ZJRL 1VQ7N 3ZX0A 1LCUA 4K42A 3QBXA 4JKBA 4BQLA 2ASOA 4QS9A 3O9UA 4JKGA 1HKGA 2QW9A 2QXLA 3GBTA 4A61A 4J8FA 3VEOA 3WQUA 5LJWA 2P9PA 1NGEA 3J7ZO 4BRQA 1D4XA 2IIRA 1T44A 3HZ6A 3AARA 3CD6N 2HOEA 4IOXA 2RHKA 3ATUA 4JKCA 4IEEA 3FLCO 5M1FA 3AGRA 3C65A 3TTCA 2V52B 1NGHA 1NGFA 3FZFA 3PLAA 4H0TB 4QS7A 5TKYA 2GWKA 4KH5A 3CJ7A 2OTJN 2YHXA 4JK7A 1BU6O 4XH4A 4H0XB 1X3NA 2W41A 5F1XA 3WXJA 4BQZA 4YOYA 1KAYA 1NM1A 2HSTA 2YJFA 2YX6A 5E26A 1DEJA 2GX9A 3F2KA 5CR4A 3ZEUB 3L6QA 4JK8A 2Q0UA 4H0OA 3VGLA 3TTDA 5AQVA 5CE3A 5JLHA 4MDAA 4H0PA 5AQUA 2FLOA 1QVFM 1VQLN 4FL9A 1JJ2M 2Q97A 3CHWA 2NRVA 4CBXA 1HKCA 4CD3A 3VEYA 1IG8A 2EWSA 3WQTA 5AFUA 2ZGYA 3DXMB 3L0QA 1VQON 2FXUA 3VETA 4WQ5A 2NNWA 1HPMA 3TU5A 4BRFA 4O5FA 4CBUA 5BPNA 4JNEA 3MCAB 3O9QA 4MLEA 3D7EO 4A5BA 4WQ4C 3ULEA 3KWIA 5FPEA 1S72N 2A40A 4BG8A 2NLXA 2HF4A 1GLBG 3MDQA 3QMLA 4CZKA 1Y64A 2GEMA 4H0YB 1YVNA 2HF3A 4FPBA 4GVEA 4JD2A 4CJ7A 2HBMA 4PKHA 5EY4A 4IO9L 1YHQN 1K9MO 3WXIA 3CCJN 5FPDA 4H5RA 5M1NA 3BEXA 2Q0RA 3N4QA 4FO0A 4GV6A 2GELA 2I7PA 2Q31A 3VEXA 4GV3A 3MX2A 3VGMA 2A6AA 4NLBA 3OW2M 4BR5A 4F9OA 2D4WA 4EAHD 5I9EB 1BA0A 2D0PA 1M90O 4EIAA 3R8EA 5KPTA 3LDOA 2YJEA 4BR2A 2D1KA 2P9NA 2ZGZA 3R3LA 4JN4A 3ZX2A 4JK9A 5F0XA 1WUAA 3DWLA 1K8KB 5EVZA 4BRLA 4ILHA 2CH5A 2QM1A 3CPEA 5C12A 1VQNN 2KKZA 1J6ZA 1K73O 3HOSA 4B1WB 3I55N 3FZHA 3VTIA 4BRDA 4M7YA 5M1QA 1NJIO 2P9SB 3MWPA 3M5RA 4C23A 4GV9A 3C0BA 3HBTA 2RE2A 4M7XA 3DXKB 1DGKN 5AZIA 3HTVA 4CZIA 3Q7CA 5BPMA 3JS6A 2CGLA 4XH1A 3W0LA 4BRNA 3D2FB 1HUXA 3DXMA 1QZ6A 2NRTA 3A5MC 3H46O 2E1ZA 1S3XA 2JWLA 3A0IX 3LM9A 4IEIA 3SBGA 2P9UB 4IDHA 4DB3A 5GIOA 2FSJA 5AQOA 5C15A 3C7NB 3U4LA 1DT9A 4BRAA 2VCPA 3VF4A 4BR9A 5GAGP 2YHWA 5BR9A 4YOXA 3EE9A 2KHOA 1R59O 4FWMA 5C2DA 2YCHA 3BP8A 1BO5O 3UKUB 3EKUA 1NGJA 2E2PA 5LY3A 1VQ6N 1VQ9N 2NRHA 3DLLL 3SBTA 2NRZA 1Q82O 1BUPA 1YXQA 4PKIA 3CPWM 3K9KA 4JKHA 1OKJA 4JKAA 3NMUA 3SLCA 4BRKA 1KD1O 1QQMA 2F9TA 2QWMA 3BF3A 2BTFA 2QWPA 5AQXA 4MO4A 4PL8A 3KZBA 1JCGA 3OA9A 1RDUA 3S41A 1G99A 3CETA 3AAQA 2GUPA 1GLAG 1NGIA 4WYBA 5AR0A 2IVOA 4CZGA 4FWQA 2E88A 3IFRA 3FZKA 4WQ4A 1KQSM 3TSPA 2J4RA 5C10A 2P9IA 3A5NC 3IMXA 2ZJPL 2PAVA 2P9SA 4CZLA 4IXCA 2E20A 4CZEA 3EN9A 5AQLA 4RTFD 1QHAA 3DXKA 4A2BA 5KQ8A 1NGAA 5GAHP 1Q18A 3ATVA 2CH6A 5AQHA 1ATRA 4KH4A 1MWMA 4BGAA 3SJHA 4MDBA 1NMDA 1SAZA 1GLEG 3A5OC 1QVGM 1GLCG 3R9PA 5H1SQ 4U67L 3CC2N 3MX5A 4K25A 3D2FA 2PFUA 4KBOA 4ISFA 3TSUA 4MLHA 4O8KA 3D2EA 3ID6A 4DKWA 2FF3B 4CZMA 3H1QA 1CZAN 2UYTA 1YAGA 3AY9A 2NRWA 4MO5A 5AQWA 4CI6A 2P9KB 5AQGA 2E2NA 3T69A 4QS8A 4CBWA 2AA4A 4JHDB 4GY2B 4BRIA 3VPZA 4E1JA 3HOTA 3U9ZA 5BREA 1NBWA 4B1YB 3CC7N 4BRMA 3MWTA 2A5XA 1YJWN 1BA1A 3ZETA 2P9LB 3VF6A 4NB4A 3CJBA 4WCEL 3RVCA 4ISGA 4CZFA 3UE5A 3Q7BA 1MA9B 1H1VA 3BUZB 1BWFO 3WT0A 2QWOA 3CCQN 3U9DA 4NO7A 4AF1A 3KK7A 1VQ4N 4I6MB 1U2VB 3F5TA 4FWSA 3IUCA 5ADXH 3I8BA 4AM6A 1QZ5A 3G4SN 5AQYA 3H3NO 3L4QA 4JKDA 4XEIA 3EKSA 4B1UB 3K9JA 1GLLO 5CHIA 3G71N 2YI1A 4YDUC 1HX1A 3WXKA 2F9WA 2CGJA 1TUUA 1U6ZA 1X9JA 1MDUB 2QA4N 3O9RA 2F7TA 4IZ9A 1ILYA 3EE8A 4H0VB 5HOOA 4IOCL 2WC9A 5AQKA 1HJOA 5M1PA 5EOYA 5AZJB 1XQSC 2FF6A 3MCPA 3A8YA 3MN7A 3P38A 5JICA 2GTDA 4K41A 2QTDA 3CCSN 1N8RO 1NWKA 3KVGA 3CMAN 4LC9B 3O4WA 1TYQB 3LDLA 4H5NA 3CCLN 3HI0A 3OBYA 3ZEUA 4H5VA 3SAHA 3M3ZA 2E1YA 4H03B 4BVPA 5AQQA 2DPNA 1KXPA 2QWQA 3O9SA 3FZMA 4ISEA 4IJAA 3UB5A 3VTHA 2HBJA 4H5WA 5EX5A 3VEZA 4BROA 3U8XA 5GIPA 2BUPA 1C0FA 5BRDA 4YOWA 2ZJQL 3CCMN 3GG4A 1MWKA 5ELZA 3L4IA 3E9OA 3MMVA 4DCHA 4PL7A 3VEVA 5AQPA 1GLDG 4CZHA 3PIOL 1EQYA 3VESA 1T6CA 1SS6A 1NGBA 4BRPA 1W2BM 5BPLA 3UKRB 3CMEN 5GAEP 4R79A 3SAFA 3G25A 5F2RA 4FWOA 4CD1A 2V51B 3E9LA 1XUPO 4BREA 1ZC6A 2P9LA 5M1KA 2QWRA 3GL1A 5JVGL 1VQPN 3QFPA 3JXUA 1NLVA 5AQSA 3O5BA 3O08A 3QICA 5ADXA 2FSKA 3W3DA 1U2VA 5FPMA 3OHRA 3CCVN 3LDNA 4XH5A 1P8ZA 5BRHA 3EZWA 4Z94A 3GDQA 1Q7YO 3O80A 4A57A 4BR7A 4JKEA 2NRXA 3FFKB 2PBDA 2D0OA 3LL3A 1BOTO 4K43A 5FPNA 3ZX3A 2VGNA 3E66A 3VF2A 4B1ZA 3DJCA 3SMSA 3VEWA 3FE1A 5HL7L 3WEEB 1VAZA 4BR4A 3C6HA 3FR0A 4WF9L 2Q2RA 5KQDA 3WXLA 5AQNA 1VQMN 1K8KA 5JMVA 3SAGA 3CJ9A 5C2FA 3NVMA 5GINA 3ID8A 4FOIA 3O9TA 2QWNA 2YHYA 3LM2A 5C0YA 4FWNA 3ULEB 1TYQA 4G9ZA 1HLUA 4AM7A 1Z6RA 3ZYYX 1W97L 1JCFA 1QQOA 5DM7L 3KWGA 4PHTX 2HBKA 3DAWA 3KHYA 4B1XB 4BRHA 3EL2A 4JD2B 3E1YA 3LDQA 3SMPA 2GWJA 3CJCA 1ESVA 1KC8O 5E84A 3VENA 3IKMA 1Z05A 1ATSA 3MN5A 1ZBSA 3IDHA 3QFUA 4FOEA 4OPAA 4BG9A 4WFBL 3I33A 4U7BA 4WFAL 4O8UA 4YDUA 1NGGA 3TSQA 1V4TA 4BVOA 4BC3A 1X3MA 2I7NA 3UKRA 1KAXA 3O1BA 4WFNL 4A5AA 4BY9C 5KPRA 3WXMB 2H3GX 2P9UA 2P9NB 5JVHL 3VERA 1QQNA 3P39A 4EHUA 3CXCM 4OO1J 3AGKA 2HMPA 3C7NA 1S22A 3R6MA 5AQMA 2ITMA 4EHTA 1YI2N 1BG3A 1EO1A 3GE1A 1BDGA 1T6DA 3ENBA 3GOIA 3UKUA 2QEXN 4EFHA 4NLCA 4B1VA 4YOVA 3RSEB 2VWBA 2NRRA 4C1NI 5M1OA 3CI5A 4JEPA 5TKWA 3TPQA 1YITN 4JKFA 5AZIB 5AQJA 1KAZA 4IFEA 3VMFB 4OPHA 1M1KO 4M63C 3H45C 3VGKA 4RWTA 1VQ8N 3EO3A 3O8MA 3ENHA 3BF1A 2KLAA 4PKGA 3WEEA 2W40A 4FWKA 3CQXA 5LJVA 1YF5L 1VQKN 3A5LC 1XC3A 4A62A 4BC4A 4B9QA 4FPAA 3M1FA 3HM8A 4A2AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YOT A;  4YOR A;  4YOW A;  4YOX A;  4YOU A;  5CHI A;  4YOY A;  4O8U A;  4YOV A; 
#chains in the Genus database with same CATH topology
 2UXC K;  3CQY A;  3SK3 A;  2V7Z A;  4DLE A;  3MN9 A;  3CJ1 A;  1JL1 A;  4CED A;  4CCH A;  1VSD A;  1BCM A;  4FJN A;  3NVK A;  1DTT A;  3L2V A;  4C8N A;  4FLX A;  2E8A A;  2O8C A;  3V4I A;  3NF9 A;  3QB0 A;  2WON A;  3C6A A;  2HHU A;  4DQ8 A;  3V6D A;  4L3Q A;  4RCH A;  4JKG B;  4J2A A;  3LAK A;  4GW6 A;  4ZTJ A;  2IVN A;  5DMR A;  4BRG A;  4BC2 A;  3JAM O;  2A3Z A;  1OVY A;  4JHD A;  4Z4I A;  1RDW X;  3TAG A;  5MLC Q;  1KLN A;  4M3U A;  4JI7 K;  2P9I B;  4H4O A;  4E7L A;  4DTR A;  1GLF O;  5AQI A;  3OYF A;  3FZL A;  4B9U A;  3I56 N;  1F21 A;  3T1Y K;  4I7F A;  1HRH A;  2WBN A;  4DQI A;  3M6G A;  4DTJ A;  4OPJ A;  3PIP L;  1QSL A;  4JS5 A;  2BAN A;  4JV5 K;  3G6E N;  4HTL A;  3A2F A;  3H1V X;  5AQT A;  1T3V A;  4C1N K;  1FW6 A;  4CFB A;  4KTQ A;  3QBW A;  1NKE A;  3P31 A;  1SQK A;  3AVL A;  4CER A;  1O13 A;  5B8H A;  2ZE2 A;  5KGX A;  1NJZ A;  3CCE N;  1JLB A;  4Z4F A;  4KHS A;  4IO8 A;  4JAX A;  4N5S A;  5AQF A;  5KPZ A;  4KO0 A;  4Z4E A;  2NZT A;  4IWV A;  4E7I A;  5FRO A;  1HNV A;  3ZET B;  4CGI A;  3L2Q A;  1HKB A;  2Q1N A;  1TVR A;  5AQZ A;  4FLT A;  3QNO A;  1RDA A;  3C94 A;  2Z1J A;  3GBT A;  2P9P A;  3QER A;  4M3X A;  3HP9 A;  2IIR A;  2X6N A;  2HOE A;  3ZSW A;  4IEE A;  4DV3 K;  3FLC O;  3AGR A;  1NGF A;  4GVM A;  4H0T B;  3G10 A;  4DR1 K;  2GWK A;  4J2B A;  4BWJ A;  3CJ7 A;  3PV8 A;  2BDP A;  3QEW A;  4H0X B;  1X3N A;  2W41 A;  4DS4 A;  3RR7 A;  4FJX A;  3SUQ A;  1NM1 A;  3F2K A;  1WSE A;  3NGI A;  1MU2 A;  5CE3 A;  1S1X A;  3AVI A;  4MDA A;  3T3F A;  4H0P A;  2FLO A;  3M8Q A;  4CD3 A;  2Z1H A;  1TK5 A;  1IG8 A;  1YTA A;  5HRO A;  2O8B B;  5AFU A;  3L0Q A;  4KFB A;  4WQ5 A;  4JS4 A;  1FK9 A;  4B8C A;  4M3Z A;  3TU5 A;  4BRF A;  3EYZ A;  5BPN A;  3O9Q A;  2GUI A;  4MLE A;  5SZT A;  3TAN A;  1HNZ K;  4CEC A;  1YVN A;  2HF3 A;  2KFZ A;  4JD2 A;  4CJ7 A;  2HBM A;  3WXI A;  3CCJ N;  4H5R A;  1NOY A;  1JKH A;  3DRR A;  3IRX A;  4GV6 A;  4BE0 A;  2I7P A;  3VEX A;  3MX2 A;  3T19 A;  4F9O A;  4KV8 A;  4CJT A;  4FZZ A;  2D0P A;  1M90 O;  4EIA A;  4DTP A;  2P9N A;  3ZX2 A;  4DSE A;  2W6L A;  1WUA A;  1LV5 A;  3DWL A;  1K8K B;  4FK2 A;  2CH5 A;  5C12 A;  1EKE A;  4DQP A;  4AQY K;  4C8O A;  1K73 O;  2G8V A;  1NJX A;  3VTI A;  4M7Y A;  2W42 A;  4GV9 A;  2KZZ A;  3HBT A;  3HJF A;  3KKS A;  4HCC A;  3LDS A;  5BPM A;  4CHN A;  2P51 A;  4DSF A;  1HYV A;  1SL0 A;  5IT9 O;  4OKK A;  1S3X A;  3PX4 A;  1S1T A;  4IDH A;  2FSJ A;  1I3A A;  5C15 A;  5BR9 A;  2VCP A;  4YOX A;  4IFY A;  2P5G A;  4HUF A;  1OH6 A;  4FWM A;  5C2D A;  1N32 K;  4KRE A;  1BO5 O;  3LWL A;  1NGJ A;  4DSJ A;  3MEE A;  4FXD A;  1NK4 A;  2G8I A;  2NRZ A;  1S1V A;  1UOC A;  4PKI A;  4JKH A;  1TK8 A;  3THY B;  4PY5 A;  1QQM A;  3BF3 A;  2BTF A;  3OVN A;  3K5N A;  3CET A;  1GLA G;  1HQU A;  3QET A;  4FJ5 A;  2IVO A;  4FWQ A;  3IFR A;  1KQS M;  2P9S A;  4IXC A;  4CZE A;  5AQL A;  4RTF D;  1LWE A;  5KQ8 A;  1NGA A;  2RN2 A;  4B9M A;  2O8C B;  2CH6 A;  5HLF A;  1MWM A;  4B3M K;  3RMD A;  3AA2 A;  1GLE G;  4FJK A;  1QVG M;  4K0K K;  4U67 L;  2XY8 A;  5DK5 A;  2G8F A;  3LAL A;  4ISF A;  3TSU A;  2Z1I A;  4O8K A;  3K0S A;  3LWM A;  3ID6 A;  3AVN A;  2XRI A;  4MO5 A;  3I0S A;  1T05 A;  2AA4 A;  4JHD B;  1WSI A;  1L5U A;  3U9Z A;  5BRE A;  1VRU A;  4B1Y B;  4HUG A;  3AV9 A;  1YJW N;  2D0A A;  4WCE L;  3CJB A;  4NYF A;  3CCQ N;  3AVF A;  1IBM K;  1GOB A;  3O4N A;  3F5T A;  1N5Y A;  4O5B A;  5ADX H;  4AM6 A;  5AQY A;  2YNI A;  3L4Q A;  2UUC K;  2KW4 A;  4XEI A;  3EKS A;  4B1U B;  4FW2 A;  2YI1 A;  4CJ4 A;  3DLH A;  3WXK A;  2F9W A;  1U6Z A;  1BIZ A;  5SWM A;  3V9W A;  1MDU B;  3O9R A;  3ZCM A;  1ILY A;  3EE8 A;  1L3S A;  1HJO A;  1O1W A;  1TL3 A;  2FF6 A;  4DFM A;  3MN7 A;  3P38 A;  4B9V A;  4CFD A;  3CCS N;  2QTD A;  1RNH A;  1NWK A;  3KVG A;  4I2Q A;  4LC9 B;  2O8F A;  4H5N A;  3NCI A;  1D9F A;  3CCL N;  2X78 A;  3OBY A;  3ZEU A;  1S6P A;  3SAH A;  1LW0 A;  1XNQ K;  3L8B A;  4DTU A;  4JYA K;  1KXP A;  3FZM A;  2HHW A;  4Z4G A;  3NBP A;  1S9E A;  4AH9 A;  5ELZ A;  1OVQ A;  3L4I A;  3V1O A;  4DCH A;  5AQP A;  2UXD K;  1EQY A;  3WNG A;  4RW7 A;  1SS6 A;  1GOA A;  1HMV A;  4FWO A;  3MEG A;  5F2R A;  4CD1 A;  1RBU A;  2ATQ A;  3P1G A;  4LF5 K;  2FBT A;  3GL1 A;  5JVG L;  1VQP N;  1KFS A;  4DR7 K;  5AQS A;  4DFK A;  3NFA A;  1U2V A;  1KVC A;  1D8Y A;  1Q7Y O;  3FFK B;  4DUZ K;  3AO1 A;  3LL3 A;  3ZX3 A;  3SMS A;  4DTS A;  3C6H A;  1VSI A;  4WF9 L;  4AHU A;  5AQN A;  2EX3 A;  1JLG A;  5GIN A;  2QWN A;  2DFH A;  3LM2 A;  3L3U A;  2HHX A;  1JCF A;  3THW A;  3DAW A;  3KHY A;  2IS3 A;  4BRH A;  3EL2 A;  4JD2 B;  4DV5 K;  2GWJ A;  1QS4 A;  4J2D A;  1ESV A;  4L8R B;  1C6V A;  3VEN A;  4NXM K;  3ZSX A;  3IKM A;  1ATS A;  4M3Y A;  3IDH A;  3QFU A;  4FOE A;  2OPS A;  3SI6 A;  4FJI A;  4WFA L;  4YDU A;  1NGG A;  3TSQ A;  1XMQ K;  3WNE A;  1KAX A;  3TWH A;  1VRT A;  5KPR A;  3OYH A;  2P9N B;  4CEA A;  3SJJ A;  3VER A;  4OO1 J;  4RW4 A;  2HMP A;  2ZD1 A;  3C7N A;  1S22 A;  3SPY A;  4BDP A;  2ZQB A;  3HL8 A;  4EHT A;  1YI2 N;  4X64 K;  4DR5 K;  1HR0 K;  1EO1 A;  3ENB A;  2QEX N;  3OYB A;  1VSL A;  4B1V A;  4YOV A;  3RSE B;  2VWB A;  3CI5 A;  2UXB K;  2KTQ A;  1WNS A;  2NUB A;  1YIT N;  5AQJ A;  1T8E A;  3RWU A;  3AVA A;  4OPH A;  1RT4 A;  2PYL A;  4WE1 A;  3VGK A;  4RWT A;  4EZ9 A;  3EO3 A;  3O8M A;  5FDL A;  4CJW A;  2KLA A;  3WEE A;  4DF4 A;  3CQX A;  3ZSR A;  4FPA A;  3M1F A;  4E89 A;  3F9M A;  1VHX A;  2ZM6 K;  3KK2 A;  5BN9 A;  3CER A;  3NH0 A;  3ENO A;  4CW7 B;  3CF5 L;  3AVH A;  3HVT A;  2OAN A;  4HWI A;  1Z25 A;  1IKX A;  1BHL A;  4W5R A;  1IV0 A;  1A5X A;  3N4P A;  3D45 A;  1JLF A;  3O1W A;  2QKK A;  1D5A A;  2G8U A;  5D3G A;  4H5T A;  4JI6 K;  5GAD P;  2DTU A;  3BY5 A;  1S1U A;  2ASM A;  4FM2 A;  3TAR A;  1W9H A;  5JLF A;  4PA1 A;  3OYD A;  5EXW A;  3OJU A;  4H4M A;  5HBM A;  3CJA A;  2IOC A;  1SL2 A;  4FWP A;  4KHP K;  4FSV A;  4ILJ A;  2AP1 A;  3CCR N;  5DM6 L;  4Y0W A;  3KTQ A;  1RGI A;  2YNH A;  1VQ5 N;  2FBY A;  2HHH K;  3L3V A;  5AJ3 K;  1J5E K;  3WNF A;  3SUO A;  1NNE A;  1IBK K;  4I9Q A;  4MFB A;  5BRF A;  4DSK A;  4BGB A;  4AHC A;  4YOU A;  1U45 A;  1RFQ A;  2JWK A;  3F73 A;  1YIJ N;  3O6W A;  1L3V A;  4LFA K;  3U6F A;  3LPT A;  4IDK A;  1GLJ O;  2VGM A;  4FWL A;  1SV5 A;  3OYN A;  3HP6 A;  3KK1 A;  1WAF A;  4Y1D A;  1N33 K;  2A42 A;  3K5M A;  1BIU A;  1S6Q A;  3AAP A;  1UA0 A;  2UUA K;  2XY7 A;  1VQ7 N;  1CZB A;  3R1X A;  1LCU A;  4RW6 A;  3S3N A;  3O9U A;  1HKG A;  4N56 A;  2ITG A;  1K6Y A;  3AAR A;  4IOX A;  2RHK A;  3ATU A;  5FLX O;  3TTC A;  1CXU A;  2V52 B;  3KLG A;  4CF2 A;  3SV3 A;  3FZF A;  2D0C A;  4KH5 A;  1RBV A;  2F8T A;  3OY9 A;  4BQZ A;  2YJF A;  2O8E B;  3THX B;  3LP1 A;  3ZEU B;  3L6Q A;  4JK8 A;  2Q0U A;  4H0O A;  3VGL A;  3HO1 A;  1W0H A;  5KGW A;  4PUO A;  1VQL N;  1N34 K;  2NRV A;  1HKC A;  1KFD A;  3VN5 A;  2RPI A;  4M41 A;  3DXM B;  1LWC A;  2NNW A;  2YHB A;  3CFP A;  4O5F A;  4CBU A;  1C1A A;  4JNE A;  1QE1 A;  4YY3 K;  2HVI A;  4CF9 A;  4WQ4 C;  3CM6 A;  3KWI A;  4DV7 K;  5FPE A;  4KHQ A;  1S1W A;  1WAJ A;  1GLB G;  5CYQ A;  4CGF A;  4E0D A;  4PKH A;  4IO9 L;  5EY4 A;  3SQ0 A;  1K9M O;  2HNY A;  3BEX A;  3ZSO A;  3I0R A;  4FO0 A;  1YT3 A;  2HNZ A;  3EEQ A;  4GV3 A;  3VGM A;  4KHY A;  4PWD A;  2A6A A;  4CF0 A;  1VSE A;  3ZSV A;  3QEI A;  1RBS A;  2ZGZ A;  4RG8 A;  4BR2 A;  3MXM A;  4JK9 A;  5F0X A;  2OPP A;  3ASM A;  4B9L A;  1TV6 A;  4ILH A;  1VQN N;  1VSJ A;  4DSI A;  2KKZ A;  3DMJ A;  3TAB A;  2HMI A;  3E01 A;  3HOS A;  3V9X A;  4F2R A;  5M1Q A;  3THW B;  3M5R A;  2OZS A;  3KD5 E;  4JI4 K;  1RDD A;  1RCH A;  4FCY A;  5AZI A;  2DFE A;  3HTV A;  4NCA A;  1HNI A;  4XH1 A;  4C8M A;  4BRN A;  3CM5 A;  3D2F B;  1QZ6 A;  2NRT A;  3VQP A;  4IEI A;  3ZSY A;  2VG6 A;  3DLB A;  4YFU A;  3C7N B;  3VQB A;  1DT9 A;  3VF4 A;  2YHW A;  1XMO K;  5FRN A;  2KHO A;  1R59 O;  4ZHR A;  1QSY A;  1WSF A;  3DLE A;  5KRS A;  3BP8 A;  1HJR A;  1KSP A;  3EKU A;  1HYZ A;  3DYA A;  1VQ6 N;  4CFA A;  2NRH A;  4FLZ A;  3HYF A;  1BUP A;  3L2W A;  1VSF A;  4BRK A;  4ICL A;  2QWM A;  3NF8 A;  3KZB A;  3D0P A;  3AA3 A;  5CZ2 A;  5AR0 A;  1ASV A;  3AAQ A;  4WYB A;  3AVB A;  4CZG A;  2E88 A;  2Z1G A;  3FZK A;  2J4R A;  2ZJP L;  3A5N C;  4LFB K;  3HVR A;  2FBV A;  1QHA A;  3DXK A;  5C24 A;  5GAH P;  3ATV A;  5AQH A;  4KH4 A;  3AA4 A;  3SJH A;  4MDB A;  3ZT3 A;  4BGA A;  4YNQ A;  3A5O C;  1JLQ A;  1GLC G;  5H1S Q;  3KLI A;  3SQ4 A;  4B3S K;  4KB0 A;  2YHA A;  3AA5 X;  4DLG A;  4MLH A;  3D2E A;  4DKW A;  2FF3 B;  3LZJ A;  4CI6 A;  2QXF A;  5AQG A;  2E2N A;  5KRT A;  4QS8 A;  4E1N A;  3QNN A;  3VPZ A;  4E1J A;  3NAE A;  4KHW A;  3HXM A;  3THV A;  1BA1 A;  3C6T A;  2JGU A;  4LY7 A;  5A2Q O;  4G1Q A;  3RVC A;  3UE5 A;  4FJJ A;  1BWF O;  4DR3 K;  4DQQ A;  4C8K A;  1VQ4 N;  4FW1 A;  1DLO A;  3VQE A;  4FWS A;  4JLH A;  5LL6 Z;  1U4B A;  3IUC A;  3VQ7 A;  1QZ5 A;  4JKD A;  3PUF A;  3SPZ A;  3K9J A;  5CHI A;  3BDP A;  3NE6 A;  3TAE A;  2CGJ A;  1TUU A;  3RRH A;  4FM1 A;  4LH4 A;  3ZT2 A;  4F8R A;  4H0V B;  2WC9 A;  1OH5 A;  5EOY A;  5JIC A;  2HHT A;  4DFP A;  3CMA N;  3KIO A;  3U3Y A;  2XHB A;  3O4W A;  2E6M A;  3HI0 A;  4R5P A;  1U04 A;  3T1A A;  3S9H A;  4H03 B;  5AQQ A;  3VQC A;  1NKC A;  2F8S A;  3MXJ A;  2A1S A;  3VTH A;  2HBJ A;  5EX5 A;  3VEZ A;  4BRO A;  5GIP A;  4X66 K;  3RRG A;  4YOW A;  1U47 A;  4HHT A;  3PO5 A;  4PL7 A;  3SQ2 A;  1GLD G;  1TAU A;  4CHO A;  1T6C A;  4BRP A;  5BPL A;  3CME N;  5GAE P;  3LAM A;  4OKJ A;  3AO4 A;  2V51 B;  1KVB A;  1RTH A;  4BRE A;  1ZC6 A;  2P9L A;  3ALY A;  1SKR A;  3QFP A;  3OYI A;  3LZI A;  1IKY A;  4MQ3 A;  1NLV A;  2ETJ A;  3LAN A;  4CHY A;  2FSK A;  5J2N A;  4XH5 A;  1P8Z A;  5BRH A;  3GDQ A;  3O80 A;  3OYK A;  4A57 A;  3SNN A;  2NRX A;  4RW8 A;  4BDY A;  4K43 A;  5FPN A;  3L2R A;  3RMB A;  3VF2 A;  4LF8 K;  4B1Z A;  1HQE A;  3DJC A;  1L3U A;  1KTQ A;  3KLF A;  4E7H A;  3PX0 A;  2O8D A;  1VAZ A;  4O55 A;  4ELV A;  4BR4 A;  1NK6 A;  4W5N A;  3WXL A;  3S3O A;  3OYA A;  2HVH A;  1IKW A;  1TYQ A;  2PZS A;  3ZYY X;  4HUE A;  4DU4 A;  1QQO A;  2XO7 A;  3KLH A;  2YNG A;  2A1R A;  3LDQ A;  3J7A P;  3CJC A;  4OPK A;  1KCF A;  3VA3 A;  1ZBS A;  4WFB L;  3OYJ A;  1NOZ A;  4O8U A;  4DV1 K;  4BVO A;  1XHZ A;  3UKR A;  2RF2 A;  3O1B A;  1KVA A;  4WFN L;  1CXQ A;  2H3G X;  2P9U A;  4EHU A;  3P39 A;  2HW3 A;  3AGK A;  3P5J A;  4NCG A;  2ITM A;  4X62 K;  3GE1 A;  1T6D A;  1BIS A;  4CJR A;  2XY6 A;  3UKU A;  3U3G A;  4NLC A;  1C1C A;  4DR4 K;  4LSN A;  2I5J A;  1IKV A;  3QEP A;  2OCE A;  4JKF A;  1IBL K;  5AZI B;  1KLM A;  4IFE A;  3VMF B;  4DV2 K;  3AVC A;  3H45 C;  1BL3 A;  4M45 A;  3ENH A;  4M3R A;  2VWJ A;  2HB5 A;  1YF5 L;  3OYG A;  3M8R A;  1VQK N;  1XC3 A;  4HCB A;  1A5W A;  5K14 A;  3HM8 A;  4A2A A;  1W7A A;  2X6S A;  1P90 A;  4CGD A;  2FSN A;  1NJY A;  1RTI A;  2E2O A;  3CC4 N;  1Q86 O;  1NU0 A;  1X9W A;  1YJ9 N;  3G0Z A;  1REV A;  1BI4 A;  3H3O B;  1NGD A;  3TTF A;  1LW2 A;  4BDZ A;  5AQR A;  1C0G A;  4DHY A;  1SKW A;  1LAV A;  3MN6 A;  4YOR A;  4BE1 A;  2B6A A;  2CGK A;  3LP0 A;  3KLE A;  4B08 A;  3HRG A;  4BC5 A;  4N41 A;  4IJN A;  5FRM A;  3VQA A;  2P9P B;  1J53 A;  2P9K A;  3J8A A;  1WOQ A;  1IG9 A;  4HTU A;  4O0I A;  4DU3 A;  4IKF A;  4WQ5 C;  2YV0 X;  3HSC A;  1IJJ A;  2WOM A;  3OBW A;  3H6E A;  2Y1J A;  3SCX A;  1XI1 A;  1JCE A;  4I6M A;  2AJQ A;  1GOC A;  1FXX A;  1YUW A;  3QES A;  3D2E B;  1WSG A;  1NK5 A;  3DLG A;  4DTX A;  2QI2 A;  1LOT B;  4A59 A;  4CHP A;  3WUH A;  3T7Z A;  3ZLJ A;  4BR0 A;  4IOA L;  2BH1 A;  3T1H K;  1RBR A;  3AVK A;  3FGU A;  2V7Y A;  5AFU H;  4FLW A;  4AHR A;  1DKG D;  4FVU A;  1B9D A;  3AVJ A;  3HPG A;  4GNI A;  1R0A A;  4DUY K;  4CZJ A;  3BZC A;  1XWL A;  3VOV A;  2ZJR L;  3QBX A;  4JKB A;  4BQL A;  2ASO A;  4JKG A;  3VEO A;  3WQU A;  3M8S A;  1NGE A;  3J7Z O;  4BRQ A;  1Z26 A;  5IWA K;  1D4X A;  3EY1 A;  3NGZ A;  3NGY A;  1T44 A;  3HZ6 A;  3CD6 N;  3VQ4 A;  4JKC A;  5M1F A;  4HVJ A;  3C65 A;  3MAQ A;  3AO2 A;  4QCL A;  5EU7 A;  1TKX A;  2OTJ N;  1HNX K;  2YHX A;  1VSM A;  4JK7 A;  4XH4 A;  4CK1 A;  3V9U A;  5F1X A;  1KAY A;  3SYZ A;  2YX6 A;  1T03 A;  5E26 A;  1DEJ A;  2GX9 A;  5CR4 A;  1NK0 A;  3IG1 A;  2E5L K;  3TTD A;  2VQE K;  5AQV A;  5JLH A;  3K2P A;  4GMJ B;  1L3T A;  4E3S A;  1FKO A;  4NXN K;  4FL9 A;  1JJ2 M;  4CHZ A;  2Q97 A;  3VEY A;  4ZTF A;  1Q9X A;  4F3T A;  3WQT A;  4ID5 A;  3TAP A;  1VQO N;  4BWM A;  3OYC A;  1HPM A;  1QSS A;  3MCA B;  4A5B A;  2KFN A;  3ULE A;  4JRP A;  2EHG A;  4DV6 K;  3MDQ A;  3QML A;  1U48 A;  2GEM A;  4H0Y B;  4CJE A;  4FPB A;  4GVE A;  3AVG A;  1YHQ N;  4ID1 A;  3ULD A;  5FPD A;  3QO9 A;  5M1N A;  2Q0R A;  3N4Q A;  4CF8 A;  4F2S A;  2VQF K;  1WB9 A;  3OW2 M;  4BR5 A;  4Z4C A;  2D4W A;  4EAH D;  1BA0 A;  3R8E A;  5KPT A;  3LDO A;  1CZ9 A;  2D1K A;  3R3L A;  4JN4 A;  4DWI A;  2O8D B;  4FLV A;  1Y97 A;  5EVZ A;  4BRL A;  3DOL A;  1J6Z A;  1C0M A;  4OLB A;  4B1W B;  3FZH A;  1NJI O;  2P9S B;  4FJM A;  3C0B A;  2RE2 A;  4M7X A;  1NJW A;  4CZI A;  3Q7C A;  3JS6 A;  2CGL A;  3V1Q A;  1ZBU A;  2G8H A;  3VQ9 A;  2O4G A;  2IDO A;  1HUX A;  3WNH A;  4W5O A;  2WTU A;  4CJK A;  2XY5 A;  3SBG A;  2P9U B;  4DB3 A;  4KTW A;  5AQO A;  3U4L A;  5GAG P;  4BR9 A;  1UWB A;  1TKT A;  3RMC A;  2YCH A;  1SUQ A;  4JI0 K;  1TK0 A;  3UKU B;  2D5R A;  4O4G A;  4GKK K;  3AVM A;  2E2P A;  5LY3 A;  2QK9 A;  1VQ9 N;  4XIU A;  1X9M A;  3SBT A;  3TAF A;  4CGH A;  1Q82 O;  1YXQ A;  1J9A A;  3K9K A;  3VQQ A;  1VSH A;  4CES A;  1KD1 O;  4CIE A;  2F9T A;  4M42 A;  5CYM A;  3VQ6 A;  4PL8 A;  1N36 K;  1JCG A;  4CEQ A;  1WBB A;  3S41 A;  3NF6 A;  1G99 A;  2GUP A;  4B9S A;  3SUP A;  1FKP A;  3C95 A;  4TSX A;  3TAQ A;  4LF9 K;  5C10 A;  1EP4 A;  4OGC A;  2GV9 A;  1YTU A;  4A2B A;  3CFO A;  1BI4 B;  3C6U A;  1NMD A;  1SAZ A;  2O8F B;  4M3W A;  2OPR A;  3MED A;  4K25 A;  3CC2 N;  4KBO A;  1HYS A;  1BCO A;  1IO2 A;  1CZA N;  1YAG A;  5AQW A;  2NRW A;  2OZM A;  2B5J A;  2IAJ A;  2P9K B;  3T69 A;  3V1R A;  5HRR A;  4GY2 B;  4BRI A;  4FLU A;  4AHT A;  1N6Q A;  4B8A B;  3CG7 A;  2VG5 A;  1NBW A;  3DLR A;  3CFR A;  4ELT A;  4CVN E;  4NB4 A;  3SUN A;  3DRS A;  1CLQ A;  3QLH A;  1TKD A;  1H1V A;  3BUZ B;  5BR8 K;  3WT0 A;  3THY A;  3U9D A;  4NO7 A;  4AF1 A;  3KK7 A;  4I6M B;  1U2V B;  4CGJ A;  5J1E A;  4JI3 K;  3I8B A;  3G4S N;  2BGG A;  4GKJ K;  3IS9 A;  3H3N O;  1GLL O;  3G71 N;  4YDU C;  4FJ8 A;  4IFV A;  5HP1 A;  4DFJ A;  1WBD A;  2QA4 N;  3OYL A;  3L2U A;  3OS1 A;  1HNW K;  5HOO A;  5AQK A;  3DI6 A;  3A8Y A;  1TL1 A;  3HPO A;  1JLC A;  4CK3 A;  2KZM A;  1ASW A;  3DRP A;  3O4Q A;  1WLJ A;  2Q3S A;  2E1Y A;  4BVP A;  5E41 A;  4ISE A;  2QWQ A;  1SL1 A;  3V9S A;  4H5W A;  2E6L A;  4KTZ A;  1C0F A;  2YNF A;  1MWK A;  4H8K A;  3FFI A;  3DOK A;  4LD0 A;  2GBZ A;  1NGB A;  1W2B M;  4R79 A;  3SAF A;  5C25 A;  4KAZ A;  1VK0 A;  3E9L A;  1Q9Y A;  4NYN A;  5M1K A;  4AIL C;  2QWR A;  3CYM A;  5HRP A;  2G8W A;  3HT3 A;  4IBN A;  5ADX A;  3W3D A;  5FPM A;  3PSF A;  4Z94 A;  5CY4 A;  4M3T A;  4BR7 A;  3ISN C;  4JKE A;  5LMN K;  2PBD A;  4CJQ A;  4LSL A;  3VEW A;  4FJH A;  3FE1 A;  5HL7 L;  3WEE B;  2P1J A;  4CFC A;  3DM2 A;  3F9K A;  3FR0 A;  3ZSZ A;  2Q2R A;  4CEF A;  1RTD A;  1VQM N;  4FJL A;  1EWQ A;  1BQN A;  5C0Y A;  3ULE B;  2KQ2 A;  2RKI A;  4AM7 A;  1W97 L;  5DM7 L;  4B9T A;  3TR8 A;  3E1Y A;  3SMP A;  5KI6 A;  1KC8 O;  2O4I A;  3BZK A;  4BE2 A;  1Z05 A;  1I94 K;  3MN5 A;  4OPA A;  4BG9 A;  1XC9 A;  3VQD A;  3I33 A;  4DR6 K;  1OH7 A;  1V4T A;  2P5O A;  1S5J A;  1ZYQ A;  1VSK A;  4A5A A;  5JVH L;  4FVM A;  1NKB A;  3HST B;  1JLE A;  4DG1 A;  3GOI A;  1BDG A;  1X9S A;  2G8K A;  4DF8 A;  4KRF A;  1JXE A;  2NRR A;  4JEP A;  3AO3 A;  5TKW A;  1ZBH A;  1B92 A;  1KAZ A;  4LH5 A;  4DV0 K;  5J2Q A;  1VQ8 N;  5JS2 A;  3P83 D;  4FJG A;  1IH7 A;  3NDK A;  4PKG A;  2W40 A;  4FWK A;  4Q0B A;  4CJ5 A;  3ZT4 A;  4A62 A;  4BC4 A;  4B9Q A;  4CJ3 A;  3QIN A;  1ZBI A;  1QTM A;  3CCU N;  5HRN A;  4BRC A;  3CIP A;  2A41 A;  1A5V A;  3TAM A;  2ZWH A;  1WSJ A;  1ZXO A;  1YJN N;  3RTV A;  5BN8 A;  2HBL A;  4OLA A;  1ATN A;  4CK2 A;  3D6R A;  4FYD A;  4DTO A;  4OGE A;  2Y1I A;  1SZ2 A;  3OYE A;  4CJV A;  1V4S A;  2QWL A;  3K5L A;  2OYQ A;  2WFB A;  4UY8 O;  4YOT A;  2WUS A;  3O3F A;  1EWR A;  2ASP A;  1EX4 A;  2E2Q A;  4ILG B;  5KTQ A;  4E7K A;  2YKM A;  4FM0 A;  1RT2 A;  4Z0U A;  2VYP A;  3QDK A;  4OKE A;  3RSE A;  3OJS A;  2Q36 A;  3E9P A;  3H08 A;  4CIG A;  4Y1C A;  4OX9 K;  3SQ1 A;  1XHX A;  4CEE A;  1Q81 O;  1TUY A;  4K8X A;  1E3M A;  3MK6 A;  1E4G T;  1E4F T;  3J7Y P;  3PY8 A;  1T7P A;  3UIQ A;  1RTJ A;  4FZY A;  4KH6 A;  4FWR A;  2IVP A;  3SZ2 A;  1NK9 A;  1K8A O;  3HPH A;  3RR8 A;  1ZBL A;  4DV4 K;  3B6P A;  1QHT A;  3KJV A;  2X74 A;  5AZJ A;  1HPZ A;  3HK2 A;  4X65 K;  1NGC A;  2ZF5 O;  3P4I A;  1KRP A;  3LDP A;  2OTL N;  3B8A X;  5C42 A;  4LF4 K;  3ZX0 A;  4K42 A;  4QS9 A;  1NG9 A;  2QW9 A;  2QXL A;  4A61 A;  4J8F A;  5LJW A;  3JYT A;  3NH2 A;  4I2P A;  4DQS A;  4DTN A;  2B4J A;  2R7Y A;  4N76 A;  2W6K A;  4RW9 A;  2E4L A;  3S3M A;  3KKR A;  1NGH A;  1JL2 A;  3PLA A;  4QS7 A;  5TKY A;  5I42 A;  4KI6 A;  1BU6 O;  3WXJ A;  4YOY A;  4CEB A;  2HST A;  4BAC A;  4CJF A;  3VA0 A;  5LMU K;  2HHV A;  1BGX T;  4CF1 A;  5AQU A;  1QVF M;  3CHW A;  4CBX A;  2UUB K;  3K5O A;  1LAW A;  4Q5V A;  2EWS A;  5J2M A;  2ZGY A;  2FXU A;  3VET A;  1YVU A;  3D7E O;  2LSN A;  1RT3 A;  1S72 N;  2A40 A;  4BG8 A;  4KPY A;  2NLX A;  4FJ7 A;  2HF4 A;  4CZK A;  1Y64 A;  4JI1 K;  2GEL A;  3QEX A;  2Q31 A;  4NLB A;  5I9E B;  5J2P A;  4KHU A;  4CJS A;  5HRS A;  1NMN A;  2YJE A;  3V9Z A;  3ZT0 A;  4YHH K;  3PO4 A;  4ELU A;  4JI8 K;  1DTQ A;  4DQR A;  1ZBF A;  2QM1 A;  3CPE A;  3SV4 A;  3I8D A;  1BQM A;  3I55 N;  4CJU A;  4BRD A;  2IGI A;  3MWP A;  3THX A;  2O8E A;  4C23 A;  4JRQ A;  3DXK B;  1DGK N;  1RT5 A;  4V19 S;  2VG7 A;  3NH1 A;  1EET A;  3OYM A;  3W0L A;  4DMN A;  4O44 A;  3DXM A;  1D9D A;  4KHN A;  3A5M C;  3H46 O;  2E1Z A;  4OVL A;  2OA8 A;  2JWL A;  3A0I X;  3LM9 A;  5GIO A;  3MXI A;  4LF6 K;  4CJL A;  1TGO A;  4EZ6 A;  4BRA A;  5I3U A;  3ZSQ A;  3EE9 A;  3LP2 A;  4F4K A;  4B3T K;  4N47 A;  1QQC A;  1J54 A;  4K8Z A;  3DLL L;  4OJR A;  3CPW M;  3NMU A;  1OKJ A;  4JKA A;  3SLC A;  2D0B A;  3M8P A;  2QWP A;  3B6O A;  5AQX A;  2BE2 A;  4MO4 A;  4CE9 A;  2YKN A;  3OA9 A;  1RDU A;  1NGI A;  1UAX A;  1NK8 A;  3K59 A;  1J5O A;  1ITG A;  4WQ4 A;  3TSP A;  2P9I A;  3IMX A;  2PAV A;  3ZT1 A;  4CZL A;  4W5T A;  2E20 A;  3J80 O;  3EN9 A;  4QAG A;  3QEV A;  4FK0 A;  4EP5 A;  3OS2 A;  4CGG A;  1C0T A;  1Q18 A;  1ATR A;  4FLY A;  3R9P A;  3JSM A;  5JS1 A;  3V81 A;  3AO5 A;  3MX5 A;  4EP4 A;  3D2F A;  2PFU A;  2F96 A;  4CZM A;  4J2E A;  3VQ8 A;  3H1Q A;  2UYT A;  3AY9 A;  1WSH A;  3IAY A;  2QKB A;  4CBW A;  1SKS A;  3HOT A;  3CC7 N;  3PX6 A;  4BRM A;  3MWT A;  2A5X A;  3K57 A;  4AHV A;  3ZET A;  2P9L B;  3VF6 A;  4ISG A;  4CZF A;  3Q7B A;  4Z4H A;  1MA9 B;  4DSL A;  2QWO A;  1G15 A;  1LWF A;  4IG0 A;  4IG3 A;  3VQ5 A;  1I39 A;  3K58 A;  1HX1 A;  1JXB A;  1X9J A;  2OPQ A;  2F7T A;  4IZ9 A;  5T7B A;  4IOC L;  5M1P A;  4W5Q A;  5AZJ B;  4E7J A;  1XQS C;  3MCP A;  3QIO A;  3CQ8 A;  2GTD A;  4K41 A;  1N8R O;  4CIF A;  4KKO A;  3BGR A;  1TYQ B;  3LDL A;  4CEZ A;  1X1P A;  4B9N A;  4H5V A;  1XNR K;  3EZ5 A;  3M3Z A;  2DPN A;  3O9S A;  4IJA A;  2IC3 A;  3UB5 A;  4JI2 K;  4B3R K;  4JI5 K;  4CJP A;  1EXQ A;  3U8X A;  2BUP A;  5BRD A;  2ZJQ L;  1RBT A;  3CCM N;  3GG4 A;  3E9O A;  3MMV A;  4E1M A;  1RT1 A;  2O8B A;  3VEV A;  3DLK A;  4AHS A;  4CZH A;  3PIO L;  2FBX A;  1RT6 A;  1ASU A;  1B9F A;  3VES A;  2JLE A;  4KI4 A;  3UKR B;  1OH8 A;  4FK4 A;  2HHS A;  3MEC A;  3G25 A;  3TI0 A;  1XUP O;  4KB1 A;  1S9G A;  3J81 O;  3O3G A;  3JXU A;  4FJ9 A;  2VWK A;  3O5B A;  3O08 A;  1FJG K;  3QIC A;  3NHG A;  3OHR A;  3CCV N;  3LDN A;  2PY5 A;  2F4V K;  3EZW A;  1JLA A;  1TKZ A;  3QIP A;  4F3O A;  2D0O A;  2HND A;  1BOT O;  1NK7 A;  2VGN A;  3E66 A;  2PYJ A;  3PSI A;  3NF7 A;  3LPU A;  5KQD A;  1U49 A;  4B3O A;  1C1B A;  1K8K A;  5JMV A;  3SAG A;  3CJ9 A;  5C2F A;  3LP3 A;  3NVM A;  3ID8 A;  4FOI A;  1TAQ A;  3O9T A;  4LFC K;  2YHY A;  4FWN A;  1Q8I A;  4E19 A;  4G9Z A;  1HLU A;  1Z6R A;  2UU9 K;  3KWG A;  4PHT X;  2HBK A;  4B1X B;  3O3H A;  1WN7 A;  4QOZ B;  3KK3 A;  5E84 A;  1C0U A;  4I9L A;  5CZ1 A;  4U7B A;  4NCB A;  2DFF A;  1RDC A;  4O0J A;  4CHQ A;  1RDB A;  3KD1 E;  4BC3 A;  1X3M A;  2I7N A;  4BY9 C;  3WXM B;  4C8L A;  2HHQ A;  4DR2 K;  3CXC M;  1QQN A;  3R6M A;  3HM9 A;  4UQG A;  4DU1 A;  5AQM A;  4DTM A;  4FZX C;  4PQU A;  1BG3 A;  3RMA A;  4CEO A;  4EFH A;  4LF7 K;  3ITH A;  3OTO K;  4C1N I;  5M1O A;  2DY4 A;  3TPQ A;  1UA1 A;  4DS5 A;  1M1K O;  4M63 C;  3BF1 A;  2FC0 A;  1RT7 A;  3OS0 A;  5LJV A;  1RIL A;  3A5L C; 
#chains in the Genus database with same CATH homology
 3CQY A;  3SK3 A;  3CCU N;  1P90 A;  4BRC A;  2V7Z A;  3CIP A;  2A41 A;  3F9M A;  3MN9 A;  2FSN A;  3CJ1 A;  5BN9 A;  2ZWH A;  2E2O A;  3CC4 N;  1Q86 O;  1ZXO A;  3CER A;  1YJN N;  3ENO A;  1YJ9 N;  3NVK A;  3CF5 L;  5BN8 A;  2HBL A;  1ATN A;  2E8A A;  2OAN A;  4HWI A;  3H3O B;  1NGD A;  3TTF A;  3D6R A;  3QB0 A;  5AQR A;  1C0G A;  3N4P A;  4DHY A;  3C6A A;  3O1W A;  3MN6 A;  4DQ8 A;  4YOR A;  4H5T A;  2CGK A;  3HRG A;  4L3Q A;  4BC5 A;  1SZ2 A;  4IJN A;  4RCH A;  4JKG B;  5GAD P;  2P9P B;  2IVN A;  1V4S A;  2QWL A;  2P9K A;  4BC2 A;  2ASM A;  3J8A A;  2A3Z A;  1WOQ A;  2WFB A;  4BRG A;  4UY8 O;  4YOT A;  1OVY A;  4JHD A;  2WUS A;  5JLF A;  1RDW X;  5EXW A;  2ASP A;  4ILG B;  2E2Q A;  5MLC Q;  3CJA A;  4WQ5 C;  4FWP A;  2P9I B;  1GLF O;  2VYP A;  3QDK A;  3FZL A;  4FSV A;  3HSC A;  2Q36 A;  3E9P A;  1IJJ A;  4ILJ A;  5AQI A;  2AP1 A;  3RSE A;  3I56 N;  3CCR N;  5DM6 L;  4Y0W A;  3OBW A;  1RGI A;  3H6E A;  2WBN A;  1Q81 O;  3M6G A;  1TUY A;  1VQ5 N;  1JCE A;  3MK6 A;  4I6M A;  1E4G T;  1E4F T;  3PIP L;  1YUW A;  3G6E N;  4HTL A;  3H1V X;  5AQT A;  1T3V A;  4KH6 A;  4C1N K;  3D2E B;  5BRF A;  4FWR A;  2IVP A;  3QBW A;  3P31 A;  1SQK A;  4BGB A;  1O13 A;  4YOU A;  1RFQ A;  1K8A O;  2JWK A;  2QI2 A;  5B8H A;  1LOT B;  4A59 A;  3CCE N;  3WUH A;  3T7Z A;  1YIJ N;  3O6W A;  4BR0 A;  4IOA L;  2BH1 A;  4IO8 A;  4JAX A;  5AQF A;  1GLJ O;  2VGM A;  3FGU A;  4FWL A;  2V7Y A;  5AFU H;  5AZJ A;  5KPZ A;  2NZT A;  1DKG D;  4IWV A;  1NGC A;  2ZF5 O;  4FVU A;  3P4I A;  3LDP A;  3ZET B;  4GNI A;  2OTL N;  3B8A X;  2A42 A;  1HKB A;  2Q1N A;  4CZJ A;  3AAP A;  3VOV A;  5AQZ A;  3R1X A;  2ZJR L;  1VQ7 N;  3ZX0 A;  1LCU A;  4K42 A;  3QBX A;  4JKB A;  4BQL A;  2ASO A;  4QS9 A;  3O9U A;  4JKG A;  1HKG A;  2QW9 A;  2QXL A;  3GBT A;  4A61 A;  4J8F A;  3VEO A;  3WQU A;  5LJW A;  2P9P A;  1NGE A;  3J7Z O;  4BRQ A;  1D4X A;  2IIR A;  1T44 A;  3HZ6 A;  3AAR A;  3CD6 N;  2HOE A;  4IOX A;  2RHK A;  3ATU A;  4JKC A;  4IEE A;  3FLC O;  5M1F A;  3AGR A;  3C65 A;  3TTC A;  2V52 B;  1NGH A;  1NGF A;  3FZF A;  3PLA A;  4H0T B;  4QS7 A;  5TKY A;  2GWK A;  4KH5 A;  3CJ7 A;  2OTJ N;  2YHX A;  4JK7 A;  1BU6 O;  4XH4 A;  4H0X B;  1X3N A;  2W41 A;  5F1X A;  3WXJ A;  4BQZ A;  4YOY A;  1KAY A;  1NM1 A;  2HST A;  2YJF A;  2YX6 A;  5E26 A;  1DEJ A;  2GX9 A;  3F2K A;  5CR4 A;  3ZEU B;  3L6Q A;  4JK8 A;  2Q0U A;  4H0O A;  3VGL A;  3TTD A;  5AQV A;  5CE3 A;  5JLH A;  4MDA A;  4H0P A;  5AQU A;  2FLO A;  1QVF M;  1VQL N;  4FL9 A;  1JJ2 M;  2Q97 A;  3CHW A;  2NRV A;  4CBX A;  1HKC A;  4CD3 A;  3VEY A;  1IG8 A;  2EWS A;  3WQT A;  5AFU A;  2ZGY A;  3DXM B;  3L0Q A;  1VQO N;  2FXU A;  3VET A;  4WQ5 A;  2NNW A;  1HPM A;  3TU5 A;  4BRF A;  4O5F A;  4CBU A;  5BPN A;  4JNE A;  3MCA B;  3O9Q A;  4MLE A;  3D7E O;  4A5B A;  4WQ4 C;  3ULE A;  3KWI A;  5FPE A;  1S72 N;  2A40 A;  4BG8 A;  2NLX A;  2HF4 A;  1GLB G;  3MDQ A;  3QML A;  4CZK A;  1Y64 A;  2GEM A;  4H0Y B;  1YVN A;  2HF3 A;  4FPB A;  4GVE A;  4JD2 A;  4CJ7 A;  2HBM A;  4PKH A;  5EY4 A;  4IO9 L;  1YHQ N;  1K9M O;  3WXI A;  3CCJ N;  5FPD A;  4H5R A;  5M1N A;  3BEX A;  2Q0R A;  3N4Q A;  4FO0 A;  4GV6 A;  2GEL A;  2I7P A;  2Q31 A;  3VEX A;  4GV3 A;  3MX2 A;  3VGM A;  2A6A A;  4NLB A;  3OW2 M;  4BR5 A;  4F9O A;  2D4W A;  4EAH D;  5I9E B;  1BA0 A;  2D0P A;  1M90 O;  4EIA A;  3R8E A;  5KPT A;  3LDO A;  2YJE A;  4BR2 A;  2D1K A;  2P9N A;  2ZGZ A;  3R3L A;  4JN4 A;  3ZX2 A;  4JK9 A;  5F0X A;  1WUA A;  3DWL A;  1K8K B;  5EVZ A;  4BRL A;  4ILH A;  2CH5 A;  2QM1 A;  3CPE A;  5C12 A;  1VQN N;  2KKZ A;  1J6Z A;  1K73 O;  3HOS A;  4B1W B;  3I55 N;  3FZH A;  3VTI A;  4BRD A;  4M7Y A;  5M1Q A;  1NJI O;  2P9S B;  3MWP A;  3M5R A;  4C23 A;  4GV9 A;  3C0B A;  3HBT A;  2RE2 A;  4M7X A;  3DXK B;  1DGK N;  5AZI A;  3HTV A;  4CZI A;  3Q7C A;  5BPM A;  3JS6 A;  2CGL A;  4XH1 A;  3W0L A;  4BRN A;  3D2F B;  1HUX A;  3DXM A;  1QZ6 A;  2NRT A;  3A5M C;  3H46 O;  2E1Z A;  1S3X A;  2JWL A;  3A0I X;  3LM9 A;  4IEI A;  3SBG A;  2P9U B;  4IDH A;  4DB3 A;  5GIO A;  2FSJ A;  5AQO A;  5C15 A;  3C7N B;  3U4L A;  1DT9 A;  4BRA A;  2VCP A;  3VF4 A;  4BR9 A;  5GAG P;  2YHW A;  5BR9 A;  4YOX A;  3EE9 A;  2KHO A;  1R59 O;  4FWM A;  5C2D A;  2YCH A;  3BP8 A;  1BO5 O;  3UKU B;  3EKU A;  1NGJ A;  2E2P A;  5LY3 A;  1VQ6 N;  1VQ9 N;  2NRH A;  3DLL L;  3SBT A;  2NRZ A;  1Q82 O;  1BUP A;  1YXQ A;  4PKI A;  3CPW M;  3K9K A;  4JKH A;  1OKJ A;  4JKA A;  3NMU A;  3SLC A;  4BRK A;  1KD1 O;  1QQM A;  2F9T A;  2QWM A;  3BF3 A;  2BTF A;  2QWP A;  5AQX A;  4MO4 A;  4PL8 A;  3KZB A;  1JCG A;  3OA9 A;  1RDU A;  3S41 A;  1G99 A;  3CET A;  3AAQ A;  2GUP A;  1GLA G;  1NGI A;  4WYB A;  5AR0 A;  2IVO A;  4CZG A;  4FWQ A;  2E88 A;  3IFR A;  3FZK A;  4WQ4 A;  1KQS M;  3TSP A;  2J4R A;  5C10 A;  2P9I A;  3A5N C;  3IMX A;  2ZJP L;  2PAV A;  2P9S A;  4CZL A;  4IXC A;  2E20 A;  4CZE A;  3EN9 A;  5AQL A;  4RTF D;  1QHA A;  3DXK A;  4A2B A;  5KQ8 A;  1NGA A;  5GAH P;  1Q18 A;  3ATV A;  2CH6 A;  5AQH A;  1ATR A;  4KH4 A;  1MWM A;  4BGA A;  3SJH A;  4MDB A;  1NMD A;  1SAZ A;  1GLE G;  3A5O C;  1QVG M;  1GLC G;  3R9P A;  5H1S Q;  4U67 L;  3CC2 N;  3MX5 A;  4K25 A;  3D2F A;  2PFU A;  4KBO A;  4ISF A;  3TSU A;  4MLH A;  4O8K A;  3D2E A;  3ID6 A;  4DKW A;  2FF3 B;  4CZM A;  3H1Q A;  1CZA N;  2UYT A;  1YAG A;  3AY9 A;  2NRW A;  4MO5 A;  5AQW A;  4CI6 A;  2P9K B;  5AQG A;  2E2N A;  3T69 A;  4QS8 A;  4CBW A;  2AA4 A;  4JHD B;  4GY2 B;  4BRI A;  3VPZ A;  4E1J A;  3HOT A;  3U9Z A;  5BRE A;  1NBW A;  4B1Y B;  3CC7 N;  4BRM A;  3MWT A;  2A5X A;  1YJW N;  1BA1 A;  3ZET A;  2P9L B;  3VF6 A;  4NB4 A;  3CJB A;  4WCE L;  3RVC A;  4ISG A;  4CZF A;  3UE5 A;  3Q7B A;  1MA9 B;  1H1V A;  3BUZ B;  1BWF O;  3WT0 A;  2QWO A;  3CCQ N;  3U9D A;  4NO7 A;  4AF1 A;  3KK7 A;  1VQ4 N;  4I6M B;  1U2V B;  3F5T A;  4FWS A;  3IUC A;  5ADX H;  3I8B A;  4AM6 A;  1QZ5 A;  3G4S N;  5AQY A;  3H3N O;  3L4Q A;  4JKD A;  4XEI A;  3EKS A;  4B1U B;  3K9J A;  1GLL O;  5CHI A;  3G71 N;  2YI1 A;  4YDU C;  1HX1 A;  3WXK A;  2F9W A;  2CGJ A;  1TUU A;  1U6Z A;  1X9J A;  1MDU B;  2QA4 N;  3O9R A;  2F7T A;  4IZ9 A;  1ILY A;  3EE8 A;  4H0V B;  5HOO A;  4IOC L;  2WC9 A;  5AQK A;  1HJO A;  5M1P A;  5EOY A;  5AZJ B;  1XQS C;  2FF6 A;  3MCP A;  3A8Y A;  3MN7 A;  3P38 A;  5JIC A;  2GTD A;  4K41 A;  2QTD A;  3CCS N;  1N8R O;  1NWK A;  3KVG A;  3CMA N;  4LC9 B;  3O4W A;  1TYQ B;  3LDL A;  4H5N A;  3CCL N;  3HI0 A;  3OBY A;  3ZEU A;  4H5V A;  3SAH A;  3M3Z A;  2E1Y A;  4H03 B;  4BVP A;  5AQQ A;  2DPN A;  1KXP A;  2QWQ A;  3O9S A;  3FZM A;  4ISE A;  4IJA A;  3UB5 A;  3VTH A;  2HBJ A;  4H5W A;  5EX5 A;  3VEZ A;  4BRO A;  3U8X A;  5GIP A;  2BUP A;  1C0F A;  5BRD A;  4YOW A;  2ZJQ L;  3CCM N;  3GG4 A;  1MWK A;  5ELZ A;  3L4I A;  3E9O A;  3MMV A;  4DCH A;  4PL7 A;  3VEV A;  5AQP A;  1GLD G;  4CZH A;  3PIO L;  1EQY A;  3VES A;  1T6C A;  1SS6 A;  1NGB A;  4BRP A;  1W2B M;  5BPL A;  3UKR B;  3CME N;  5GAE P;  4R79 A;  3SAF A;  3G25 A;  5F2R A;  4FWO A;  4CD1 A;  2V51 B;  3E9L A;  1XUP O;  4BRE A;  1ZC6 A;  2P9L A;  5M1K A;  2QWR A;  3GL1 A;  5JVG L;  1VQP N;  3QFP A;  3JXU A;  1NLV A;  5AQS A;  3O5B A;  3O08 A;  3QIC A;  5ADX A;  2FSK A;  3W3D A;  1U2V A;  5FPM A;  3OHR A;  3CCV N;  3LDN A;  4XH5 A;  1P8Z A;  5BRH A;  3EZW A;  4Z94 A;  3GDQ A;  1Q7Y O;  3O80 A;  4A57 A;  4BR7 A;  4JKE A;  2NRX A;  3FFK B;  2PBD A;  2D0O A;  3LL3 A;  1BOT O;  4K43 A;  5FPN A;  3ZX3 A;  2VGN A;  3E66 A;  3VF2 A;  4B1Z A;  3DJC A;  3SMS A;  3VEW A;  3FE1 A;  5HL7 L;  3WEE B;  1VAZ A;  4BR4 A;  3C6H A;  3FR0 A;  4WF9 L;  2Q2R A;  5KQD A;  3WXL A;  5AQN A;  1VQM N;  1K8K A;  5JMV A;  3SAG A;  3CJ9 A;  5C2F A;  3NVM A;  5GIN A;  3ID8 A;  4FOI A;  3O9T A;  2QWN A;  2YHY A;  3LM2 A;  5C0Y A;  4FWN A;  3ULE B;  1TYQ A;  4G9Z A;  1HLU A;  4AM7 A;  1Z6R A;  3ZYY X;  1W97 L;  1JCF A;  1QQO A;  5DM7 L;  3KWG A;  4PHT X;  2HBK A;  3DAW A;  3KHY A;  4B1X B;  4BRH A;  3EL2 A;  4JD2 B;  3E1Y A;  3LDQ A;  3SMP A;  2GWJ A;  3CJC A;  1ESV A;  1KC8 O;  5E84 A;  3VEN A;  3IKM A;  1Z05 A;  1ATS A;  3MN5 A;  1ZBS A;  3IDH A;  3QFU A;  4FOE A;  4OPA A;  4BG9 A;  4WFB L;  3I33 A;  4U7B A;  4WFA L;  4O8U A;  4YDU A;  1NGG A;  3TSQ A;  1V4T A;  4BVO A;  4BC3 A;  1X3M A;  2I7N A;  3UKR A;  1KAX A;  3O1B A;  4WFN L;  4A5A A;  4BY9 C;  5KPR A;  3WXM B;  2H3G X;  2P9U A;  2P9N B;  5JVH L;  3VER A;  1QQN A;  3P39 A;  4EHU A;  3CXC M;  4OO1 J;  3AGK A;  2HMP A;  3C7N A;  1S22 A;  3R6M A;  5AQM A;  2ITM A;  4EHT A;  1YI2 N;  1BG3 A;  1EO1 A;  3GE1 A;  1BDG A;  1T6D A;  3ENB A;  3GOI A;  3UKU A;  2QEX N;  4EFH A;  4NLC A;  4B1V A;  4YOV A;  3RSE B;  2VWB A;  2NRR A;  4C1N I;  5M1O A;  3CI5 A;  4JEP A;  5TKW A;  3TPQ A;  1YIT N;  4JKF A;  5AZI B;  5AQJ A;  1KAZ A;  4IFE A;  3VMF B;  4OPH A;  1M1K O;  4M63 C;  3H45 C;  3VGK A;  4RWT A;  1VQ8 N;  3EO3 A;  3O8M A;  3ENH A;  3BF1 A;  2KLA A;  4PKG A;  3WEE A;  2W40 A;  4FWK A;  3CQX A;  5LJV A;  1YF5 L;  1VQK N;  3A5L C;  1XC3 A;  4A62 A;  4BC4 A;  4B9Q A;  4FPA A;  3M1F A;  3HM8 A;  4A2A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...