4O8UA

Structure of pf2046
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
227
structure length
227
Chain Sequence
SRIVAADTGGAVLDETFEPIGLIATVAVLVEKPYRSAKEVMVKYANPYDYDLTGRQAIRDEVLLAIELARKVKPDVIHLDSTLGGIELRKLDEPTIDALGISDKGKEVWKELSKDLQPLARKFWEETNIEIVAIGKSSVPVRIAEIYAGIYSAKWGIENVEKEGHLIIGLPRYMEVNIKDGKIIGRSLDPREGGLYGSAEVSVPEGVKWEIYPNPVARRFMIFEIFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Uncharacterized protein PF2046
publication title Crystal structure of a novel non-Pfam protein PF2046 solved using low resolution B-factor sharpening and multi-crystal averaging methods
pubmed doi rcsb
source organism Pyrococcus furiosus
total genus 57
structure length 227
sequence length 227
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2013-12-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.440 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4o8uA00
4YOTA 4YOYA 4YOVA 4O8UA 4YOUA 5CHIA 4YOWA 4YOXA 4YORA
chains in the Genus database with same CATH superfamily
5SZTA 4A2AA 4BWJA 3K57A 4ZHRA 1QTMA 3T7ZA 4A62A 4JS4A 2BGGA 3CJCA 3SJJA 1W9HA 2YHAA 1ZBUA 4MQ3A 5JLHA 1F21A 2W41A 4A5BA 3IRXA 4CZEA 3WXMB 4E7KA 1RBUA 4CESA 2NRWA 4H0VB 2YI1A 2QKBA 3ZT4A 4W5QA 2Y1IA 1VQ8N 2F7TA 4H03B 4FZYA 3MMVA 4ISEA 3UKRB 2IVNA 3ID6A 4EZ6A 1XC9A 4NXNK 3D2EB 1ZBHA 3AVMA 3OJUA 2P9SA 5M1OA 3MN9A 3KD5E 3CFPA 2KQ2A 3LALA 3ZYYX 2Q97A 5AQNA 1ATRA 3EE9A 1S9GA 4FJJA 4CEFA 4F4KA 3WQUA 1I3AA 4ILJA 4DS5A 1GLJO 2ASMA 5AQKA 3R6MA 3OYNA 3AA4A 3J7AP 3T1HK 2RHKA 4KHUA 5AQPA 1TL3A 4WQ5C 5HLFA 2YHWA 2E4LA 3KK3A 4JK7A 4CERA 4XH1A 3F5TA 3S9HA 3WUHA 5HL7L 2CH5A 3CM5A 2P9KB 3M3ZA 1IBLK 3M1FA 4PL8A 3MEEA 4FJ5A 5CZ2A 1RBVA 3KWGA 5EY4A 3NF7A 4DQPA 3CCSN 1IBMK 3QETA 3LPUA 4CEEA 1QZ6A 1WLJA 3KWIA 4JKGB 1WOQA 4H4MA 1N33K 1D9DA 3ZSRA 3WNFA 3K5MA 4E1NA 3WNGA 4BR7A 4OKEA 3K58A 3RR7A 1RT5A 1GOAA 3SUNA 3HTVA 2NRZA 1YUWA 4FJ7A 1LWCA 4DHYA 1QS4A 1BHLA 4CW7B 2QM1A 2O8EA 4YORA 1HR0K 3DRRA 1NM1A 1WSGA 4RG8A 3ULEA 2BE2A 3VF6A 3VTIA 4CHYA 1TK0A 4IG0A 2QWQA 3B6OA 2O8DB 4JI0K 1IV0A 4RWTA 4B8CA 2HHUA 2E2NA 4KB1A 2QXLA 1EXQA 5CYQA 2ZGZA 4CJ4A 3AVIA 3U6FA 5M1NA 5C24A 1QSYA 1RBRA 2OZSA 3IKMA 1Z26A 2QWMA 3CPWM 3LAMA 4QOZB 3FZMA 1X9JA 3V9XA 3NH1A 4N41A 3SUOA 2IGIA 1MA9B 2OTJN 1C0UA 2YNGA 3O4QA 4DMNA 3CXCM 3EO3A 3CQYA 4DSKA 5KPRA 4BRIA 4CFAA 2X6NA 5J2QA 5FDLA 3C6TA 4PA1A 1BL3A 1T05A 4JI6K 4OPJA 1CXQA 3VQ8A 3JS6A 4DF4A 1C0TA 3KVGA 1OH7A 4PKIA 1SQKA 2A3ZA 3THXB 5CZ1A 4HTLA 3TAMA 4DLEA 3BZKA 2QK9A 3DLEA 4CJ3A 3P1GA 1BQMA 2GEMA 1JL1A 1WN7A 1YVUA 5AR0A 1J5EK 4CEBA 3AVNA 3K9JA 1S22A 4M3TA 5AQYA 2YHBA 3NGYA 2FSKA 1FKOA 5B8HA 2FSNA 3IG1A 3OYGA 4OKKA 1UOCA 4ELTA 3N4QA 1BISA 5JLFA 3D2EA 1RBSA 4OX9K 3RMDA 2IVPA 1C6VA 3H3NO 4ZTJA 1HMVA 1JXEA 4AHVA 3P83D 1WBDA 3VEVA 3JAMO 1CZ9A 1VHXA 3ULDA 1CZAN 2YCHA 3A5MC 1GLLO 3CHWA 4O44A 2P5GA 1LWFA 4JKEA 2OPSA 3GBTA 3IDHA 3AO5A 4O5FA 5AZJA 3NGZA 1W2BM 3A0IX 5KPZA 4MDAA 3K0SA 3U4LA 3BDPA 3ZT2A 3DMJA 2O8BA 3ALYA 4CJEA 1ASUA 1BIUA 2Z1IA 4JV5K 4X65K 3U9DA 4X62K 2CGJA 3KLIA 1NNEA 4DV6K 3O9QA 5FPMA 4CEAA 4M45A 4NYNA 1NKCA 4F2SA 2X6SA 4CZHA 1P8ZA 4H5NA 1NWKA 2ZGYA 3CJ7A 5C0YA 2XY6A 3J7YP 3PO4A 2QWOA 3KLGA 2PZSA 3VMFB 3TAFA 4PUOA 3CCRN 2P1JA 4CGDA 2P9LB 3JXUA 4DFKA 4GV9A 1N5YA 3JYTA 3QMLA 2J4RA 2KW4A 1XNRK 3DM2A 1W0HA 2YNIA 1SL1A 2Z1JA 4LF4K 2VGMA 3VQAA 3E9LA 2QW9A 4LF6K 4FVUA 4PKGA 3S3MA 3D45A 2P9IB 1S1TA 1A5WA 4N5SA 4Z4HA 2FC0A 1JLCA 4CD1A 3OYIA 1YF5L 3LPTA 1B9DA 3H1QA 2HHSA 3VQ4A 1U45A 4I7FA 3KIOA 3A5NC 2DFHA 4DQQA 1XHZA 4E1MA 5AQFA 3CYMA 1RDAA 3DXMB 3MEGA 3LZJA 1GLAG 3SV3A 3ZT0A 2O8DA 1VQ4N 1ESVA 1CZBA 4XEIA 3VETA 4CZMA 3UKUA 4HWIA 5GIPA 4CECA 3K5LA 2VYPA 3SPZA 3C6UA 4FJGA 3LP0A 4BRAA 2KZZA 1YXQA 4JN4A 3QB0A 1BI4B 2YNFA 3LP2A 4IG3A 4JD2B 5HOOA 4EP4A 3EL2A 1A5XA 3CCUN 4KREA 2NNWA 4FVMA 3MWTA 4AF1A 1JLAA 3O3FA 2WFBA 3KKRA 4KI4A 3CCLN 4RW7A 4DR3K 3OYJA 1KTQA 3OS0A 5EU7A 4KH5A 4DTMA 4DUZK 5AZIB 2ZE2A 5C2FA 5KQ8A 4BRLA 4DV2K 4A61A 4PWDA 4N76A 3TAGA 3TR8A 4NYFA 4CJ7A 3I8BA 1HNWK 1C0FA 1A5VA 5LMNK 2D5RA 5AQGA 4DSIA 2BTFA 4HVJA 3CCQN 4K41A 3ATVA 4MO4A 1L3UA 1J5OA 5KGWA 1S72N 5JS2A 4FSVA 1G15A 3VQDA 1LOTB 4CJSA 4FWQA 3AY9A 4CEZA 2HF3A 2GBZA 4AILC 4JKBA 3PIPL 2I7NA 1IJJA 4OJRA 2IC3A 4RW9A 4K8XA 3WXJA 4B3TK 4ID5A 4IDHA 2E2QA 1N8RO 3AA5X 5BREA 3F9MA 1NK7A 1EWRA 4B9MA 1DGKN 3AVFA 3DYAA 5ELZA 1RDUA 4CJKA 1KFSA 4YDUA 3QBWA 1H1VA 1TL1A 4KBOA 1VQ6N 3C0BA 3LANA 2E88A 4IFYA 2KHOA 4FM1A 3H6EA 1HNVA 1HNZK 4DFMA 1VRUA 3WXIA 3I0SA 3KK1A 4FLVA 1ASWA 4E7JA 3C7NB 1NGEA 4ID1A 4CI6A 5FROA 4BR2A 4DR1K 2FBYA 3O5BA 3D6RA 3CCVN 5GINA 1O1WA 4M3WA 4AHRA 3SAFA 1G99A 1BIZA 2F9TA 3L2QA 1M1KO 1EP4A 3ZX0A 1GLFO 3LL3A 4JI4K 3GOIA 4FK2A 3G4SN 4K42A 1Z05A 2E5LK 1JCFA 3MDQA 3VGKA 5LJWA 2KLAA 4FM0A 3DLRA 4BC4A 3DI6A 2F4VK 3TI0A 1QQOA 1S1VA 2D0CA 3LDLA 3CFOA 1E4FT 2UYTA 2AP1A 4FLZA 3TTDA 3O6WA 5BPMA 3NVKA 1TK5A 2QTDA 3OW2M 3QFPA 3DXKB 4BRKA 5KI6A 5LJVA 1NMNA 4R5PA 3QNNA 4GV3A 4AHTA 3V1RA 3L2WA 3HPOA 2XY8A 1RTHA 5H1SQ 1HNXK 1GOCA 2HVIA 1ATNA 1ZBSA 4GNIA 1U2VB 1N34K 4F2RA 3AGRA 1HJOA 2BANA 2HNYA 4CBXA 3M8PA 1MDUB 4Q0BA 3OYFA 2P9NA 3M8SA 3VGLA 1S1XA 2D0OA 1NGIA 4M3XA 5F0XA 5KRTA 1VSJA 4OLAA 4KRFA 2GWKA 1BI4A 4JD2A 1LV5A 4W5NA 3MN5A 5HROA 1LAWA 3C65A 5ADXH 1P90A 2YV0X 4B3MK 4I9LA 5BR9A 4OPHA 4DR4K 5SWMA 5HRPA 2Q3SA 4KFBA 4EZ9A 1ASVA 4O55A 3P38A 4DR2K 1HX1A 1KAZA 1C0GA 2NRHA 3PSFA 4CCHA 3AO1A 5AQSA 5JMVA 1DTQA 4DFPA 3H45C 3KLEA 4NCAA 4Z4EA 4IFEA 3QLHA 3DWLA 1BOTO 4CFCA 1S6PA 1NJYA 3TSQA 4DTOA 1N32K 2F9WA 1MU2A 3HI0A 1ITGA 5LY3A 2OYQA 2ASPA 4BR4A 3DLGA 3OYMA 1M90O 3OYAA 1NK9A 4NO7A 1TKTA 3MWPA 4QS8A 4DR6K 1GLDG 4RW6A 2BDPA 3QERA 5LL6Z 3ZSVA 3AVKA 5HBMA 1SKSA 3ZEUB 5CY4A 4M63C 3QEIA 3EYZA 4FWRA 4DG1A 3DOKA 1NGGA 5BR8K 2V51B 1B9FA 3M5RA 3VQBA 1QQNA 3GE1A 4JS5A 1L3TA 2QEXN 2UUAK 2W6LA 3FZKA 5BN9A 4KTZA 3AO4A 4WQ5A 3U3YA 2B4JA 3ITHA 3LDOA 5HRRA 4OO1J 3SQ2A 3T3FA 5C12A 1JLQA 4IEIA 4WFAL 2AA4A 2GELA 3HL8A 4KHYA 4C8NA 1EO1A 1XMOK 3AVJA 4AHCA 4AHUA 1T8EA 3KK2A 3TABA 1ZBIA 2P9PA 4DTSA 4HUFA 2Z1GA 3RR8A 3THYB 1VQ7N 4I2PA 4UQGA 5AQHA 4YOWA 3I33A 1VQ5N 4FWNA 4FLTA 4BQZA 2HHTA 1X9MA 4DV4K 1RILA 3VPZA 1Z25A 2EHGA 3ZSZA 4JRQA 3MK6A 4FCYA 3CC4N 4R79A 3ENOA 5M1KA 4LF9K 2Q31A 4J8FA 4GY2B 5BRHA 3EKSA 2OCEA 3I55N 3HXMA 4BROA 3QFUA 2UXDK 4Z4CA 3O08A 5JICA 2E6MA 3NF8A 4YY3K 3M8QA 1NU0A 2NUBA 3OS1A 3OYDA 1SL2A 1NGCA 3MXIA 2F96A 1VQMN 2X78A 1TKDA 4KHSA 3G10A 5K14A 2YJFA 4KH4A 3E9OA 3PY8A 1NK5A 3HM8A 3CJBA 3MN7A 1VSKA 1KLMA 3L6QA 1ZBFA 4A57A 4I6MA 1WSIA 3B6PA 2OPRA 5E41A 1SS6A 3ASMA 3V1OA 2GUPA 4BVPA 4AH9A 4WFBL 2FXUA 4XH4A 2NRTA 4DTJA 2GWJA 4BRPA 1KSPA 4CFDA 3NE6A 2RKIA 4NLCA 4PHTX 3Q7CA 1NK8A 1FKPA 2E6LA 2FBXA 2VG5A 5AQJA 1BA0A 4Y1CA 2ZD1A 4FK4A 2O4GA 1FW6A 3QICA 4M3UA 3WXKA 3O3HA 3CIPA 2G8FA 4EAHD 2V7YA 3BUZB 3VQPA 1SUQA 3MECA 3D0PA 4FPAA 3CCEN 4YHHK 3VA0A 1K8KA 1JXBA 4FXDA 4ILGB 4IXCA 4FK0A 4H0YB 1KQSM 4F9OA 4LD0A 1XI1A 1WBBA 4BRFA 2QWRA 3OY9A 2W40A 1QZ5A 4OGEA 3VF2A 5F1XA 5T7BA 4RCHA 2ZM6K 1OVQA 1OVYA 4ISFA 4GKJK 3O9SA 4B9TA 4LF5K 3B8AX 4DQIA 5KRSA 4E89A 1U47A 1KLNA 4AM7A 1TUUA 1SL0A 3HPHA 2G8VA 1DEJA 3ISNC 3BF1A 1T7PA 3O9TA 3HP9A 2F8SA 4M42A 1TGOA 3CI5A 1WUAA 5GAEP 4JKHA 3KK7A 2A5XA 2VQFK 4CIFA 5BPNA 4FJMA 1TKXA 1C0MA 3FLCO 1YJWN 1YJNN 2QWNA 1X9WA 2AJQA 3NHGA 4UY8O 3VOVA 4CEQA 4PL7A 4BG9A 1Q18A 1DTTA 1HQUA 3LDNA 2D0PA 1UA0A 1X3MA 3IUCA 2QXFA 4E3SA 4L3QA 3EY1A 4Z4FA 3VGMA 1TYQB 1HKCA 5FPEA 2GV9A 4N56A 3DLHA 1R0AA 5F2RA 1WSEA 4WYBA 4O8KA 3F73A 3WXLA 4EIAA 2YNHA 3BEXA 3P31A 3TAEA 4XIUA 3SUPA 1T6CA 4EP5A 3ENBA 1IKXA 3G25A 1JJ2M 4M3YA 3L3UA 3UKRA 2O8CB 2DY4A 3O9RA 5C42A 4Z0UA 5FPNA 1RT4A 3MEDA 1C1CA 4DQ8A 5FPDA 1YJ9N 3NH2A 2ETJA 2E8AA 1KC8O 2UXCK 2VG6A 2CH6A 3L2VA 1HYZA 5KTQA 5M1FA 4E7HA 2OANA 3AV9A 2HB5A 4B9SA 3NVMA 4IKFA 4FZZA 1Q7YO 1HJRA 4CZGA 4BWMA 3V9SA 4KHPK 4Z4IA 4FYDA 4QS7A 3FFIA 4O8UA 1KAXA 4WCEL 2HHXA 1JCGA 1BO5O 1D9FA 4GMJB 1IG9A 2GX9A 4G9ZA 5KPTA 2P9KA 3NH0A 2HSTA 3CM6A 2KTQA 5DM6L 3PX0A 3VQCA 3SPYA 1JLBA 2NZTA 5MLCQ 4LF7K 3CJ1A 2P51A 3KTQA 5I42A 4YOUA 3U8XA 3RSEB 3TARA 1YHQN 1KCFA 3RMAA 4JKGA 4JK9A 4CIGA 2HMPA 3FE1A 2G8UA 1JCEA 3SNNA 1IKWA 3CCMN 2PAVA 1NGJA 3RTVA 1RTJA 2OPPA 3OHRA 3ZSOA 2XY5A 3PO5A 4JKAA 1KVAA 2HHWA 1RDDA 3ZSQA 3HT3A 2PYJA 4A5AA 4BRQA 3DAWA 1BGXT 3DOLA 4H5RA 4Z4GA 5JVHL 3AARA 1RTDA 3AVCA 1EKEA 2A41A 3UIQA 5DM7L 4EHTA 3VQ6A 3P39A 3FGUA 4J2EA 2JWKA 4MLEA 4CHQA 1JKHA 3L3VA 1WAJA 1NGAA 3VTHA 5LMUK 2X74A 1L3VA 3KZBA 4CHZA 4B1XB 1QQCA 1TAQA 1EX4A 5ADXA 4FJLA 5EOYA 1XQSC 2DFFA 1NG9A 3VQ9A 1VQON 4I2QA 1ILYA 1JL2A 3TPQA 3DLLL 2Q1NA 4A59A 4H5VA 2LSNA 3TSPA 4BC5A 1FJGK 2I7PA 3BZCA 4K43A 2RN2A 3C95A 4WFNL 1HLUA 1LCUA 1KVBA 3L2UA 3VQ7A 4F3TA 3OTOK 3QEWA 3O80A 3W3DA 4BDYA 1JLGA 5AQRA 3JSMA 4BRCA 3GL1A 1BCOA 2NRXA 3SUQA 2ZWHA 3THXA 3U9ZA 4KHWA 4CJRA 3BGRA 4C1NK 4FO0A 1QSSA 3AA2A 4DLGA 1LWEA 4E1JA 1Q9YA 3OYCA 3BF3A 3SQ0A 2HVHA 3CFRA 1KD1O 2D1KA 1VSLA 4FWSA 2D0BA 3MN6A 3MCPA 4GV6A 5HRNA 4JYAK 4CEOA 3HK2A 2V7ZA 4JHDB 2G8IA 1S5JA 4CZLA 3VQEA 4B9UA 1T3VA 3OBWA 1QE1A 3SCXA 4JKCA 4YFUA 4FWLA 4DTRA 1RGIA 4B1VA 4IJNA 5AQIA 4B1YB 5FLXO 5AFUA 2HMIA 3AVGA 3D7EO 3IFRA 3I8DA 4DV0K 2A1RA 2O4IA 4E19A 3K2PA 3HVTA 1OH5A 5AQVA 5M1PA 3E01A 3M8RA 2FLOA 4E7IA 3F2KA 4CEDA 1YVNA 4YOTA 2FF3B 4LY7A 1EETA 1X9SA 4KHNA 1I39A 3O1BA 4X64K 3EZWA 4RW8A 5CR4A 3QEPA 1RDBA 1Z6RA 3NF6A 4AHSA 1BWFO 5AJ3K 5HRSA 4U7BA 1HYSA 1C1BA 4CJLA 1ZBLA 2G8WA 1O13A 4M7XA 3VF4A 2HNDA 3CC2N 4TSXA 2F8TA 4A2BA 1BUPA 1UWBA 2P9UB 4DV5K 4E0DA 2OTLN 4LFBK 5J2PA 3KJVA 3PX4A 3HSCA 1X1PA 4KHQA 5IWAK 2WTUA 1K73O 4C8LA 2P9LA 3TWHA 1NGBA 3ATUA 4KI6A 1IBKK 4IJAA 3TANA 3CC7N 2RPIA 4WQ4C 5TKWA 2YJEA 4B3SK 3ZLJA 2G8HA 4EHUA 4DSFA 4BY9C 5AQMA 2P9IA 4C8MA 2HW3A 1TVRA 2B6AA 4BC2A 1LAVA 1VK0A 4W5RA 1U48A 2QA4N 2Q0RA 4J2BA 4E7LA 3AVHA 4H0XB 4CF9A 3AA3A 2E20A 3J8AA 4JI1K 4YDUC 3T19A 2I5JA 4B9VA 3E66A 3DXMA 1S1WA 1FK9A 4K25A 4B08A 3ZX2A 3AVBA 3EEQA 1WSHA 1RBTA 5AQTA 4NXMK 3S41A 1IKYA 4FL9A 3SI6A 1NMDA 5BRDA 3G6EN 4ELUA 2VQEK 1YI2N 2P5OA 3L4QA 1VRTA 3TSUA 4FLUA 3V9ZA 2ZJPL 1NOYA 3QIPA 4DU3A 1ZXOA 1VSHA 2RF2A 4CHPA 4CJ5A 3ZETB 4DKWA 3ID8A 3SJHA 1D5AA 3FFKB 4BRMA 4KB0A 2XRIA 2O8EB 5AZIA 2YX6A 4JI7K 3SAGA 3HP6A 3L8BA 4CF2A 4CK3A 3V81A 3K5OA 4O5BA 3ULEB 3NDKA 3RWUA 3K59A 4H8KA 1J6ZA 1JLEA 2VCPA 4FOEA 1VQNN 3NAEA 1D4XA 4EFHA 4OKJA 3T1AA 1T6DA 1HUXA 1RT2A 2Z1HA 5CHIA 4FW1A 4YNQA 3G0ZA 4DTNA 3MXMA 2CGLA 4MO5A 2G8KA 3MXJA 1X3NA 3O3GA 4BACA 4JK8A 4RTFD 2BUPA 2FF6A 5I9EB 3HOSA 4ISGA 4BREA 4WF9L 2E2PA 4DB3A 3CF5L 4M3ZA 5JS1A 4CE9A 3L0QA 3CCJN 2A40A 1VSDA 4B9QA 4IFVA 4H5WA 3H46O 4J2AA 2VGNA 4FW2A 4B1ZA 5IT9O 3SV4A 1UA1A 1MWMA 3OYLA 3LM9A 3OJSA 5E26A 5AFUH 4ILHA 3VEXA 2IS3A 4M3RA 2E2OA 3SK3A 3RRHA 4PKHA 1GLBG 4X66K 1RT6A 4HHTA 3V9WA 4BRHA 5FRMA 2UXBK 3H3OB 1J9AA 3R3LA 1Q82O 3DLBA 3SMPA 3SBGA 3V9UA 1XHXA 4DV7K 3VERA 4OGCA 4BR0A 3HVRA 1BDGA 3FZLA 1IO2A 1NKEA 3C7NA 4JI3K 1BU6O 4O0JA 4DU1A 1QQMA 3SAHA 4CJFA 1NGDA 1YTAA 4CGIA 3LM2A 5M1QA 3VQ5A 2ZJRL 2A1SA 3R9PA 3ZT1A 1DLOA 4QS9A 1W97L 5KGXA 5C2DA 4BRGA 4DSJA 2P9UA 4GVMA 1VAZA 2NLXA 3D2FB 3EE8A 3WEEB 5E84A 5AQOA 3VENA 3MX2A 2YHYA 3O1WA 4JI5K 4Z94A 4WE1A 1EQYA 5AZJB 3RMCA 4BDPA 2O8FB 1V4TA 2KFZA 3EKUA 2QWLA 1GLEG 1RT1A 3MX5A 2O8BB 4FJ8A 1Q9XA 1TAUA 3DXKA 4HUEA 1BCMA 3VN5A 4HTUA 3KKSA 4Q5VA 3W0LA 3P4IA 4CD3A 4BGBA 1CLQA 1U2VA 1HQEA 2HBJA 4KH6A 3A5LC 4DQRA 1I94K 2PYLA 3M6GA 1NJXA 3O8MA 1ZC6A 2GUIA 5AQZA 3WNEA 4BQLA 2NRRA 3KLFA 4FPBA 4CJUA 3K5NA 2VWBA 2ATQA 4C1NI 3HRGA 1YIJN 1K6YA 4DTUA 3V1QA 4M7YA 2KFNA 3J80O 5HP1A 4DF8A 3NBPA 1OH8A 5DMRA 4IOXA 1VQ9N 3OYKA 1TUYA 3U3GA 3LWMA 3NGIA 1NJZA 3F9KA 4JLHA 3KHYA 4CJPA 1S3XA 3ZETA 5A2QO 2A42A 3ZT3A 4JI2K 2R7YA 1V4SA 2HHVA 4BDZA 4LFCK 3QEXA 3E9PA 1MWKA 1VQLN 2VWJA 1NK6A 5GAGP 3VESA 2YKMA 1EWQA 2WONA 3O4WA 1SZ2A 4ICLA 1E4GT 3O9UA 3OYHA 4MFBA 3UKUB 2DFEA 4IO9L 3LDPA 4DSLA 3Q7BA 1VQPN 3QINA 3AAPA 4JRPA 4H5TA 4CF0A 2GTDA 4KO0A 3L2RA 1T44A 4DR5K 3EN9A 3P5JA 3VA3A 3LAKA 3N4PA 2HOEA 3ZEUA 4O4GA 3PX6A 4H4OA 2HBKA 3HOTA 1Q81O 4XH5A 2B5JA 4BRDA 4CBWA 4FJNA 3TTCA 1N36K 1DT9A 3VEZA 4CHOA 4DTXA 4KV8A 4DR7K 3QDKA 2HNZA 3S3NA 3BY5A 4NLBA 3J81O 4FWMA 5AQWA 3PLAA 1WAFA 1YAGA 4FLYA 3R1XA 3SQ1A 4CJQA 1HKGA 3FZHA 3RVCA 4LH4A 3QESA 5AQLA 1IG8A 4H0OA 3MAQA 4KAZA 1S1UA 2FBVA 3I0RA 3THYA 3CMAN 3T1YK 3CETA 2XO7A 4L8RB 4CJWA 1Q8IA 1SKRA 5CYMA 1E3MA 1XNQK 1L5UA 2VG7A 3J7ZO 3PUFA 3OBYA 5EX5A 5GADP 2RE2A 2JWLA 4OPKA 5GAHP 5CE3A 4K0KK 3QBXA 5J1EA 3HO1A 1UAXA 3TAPA 3DLKA 3HBTA 4GW6A 4YOYA 3D2FA 4LSLA 3V6DA 5C25A 3WEEA 2HHHK 1C1AA 4LC9B 4B9NA 4NCBA 1GOBA 4CJVA 4B9LA 2E1YA 1U6ZA 4BR9A 4QCLA 3NMUA 5TKYA 3OVNA 2UUCK 2HF4A 3TAQA 2O8FA 3H1VX 1VSIA 1KXPA 3HJFA 4LSNA 2ZJQL 2EX3A 4CF8A 2ZF5O 5J2NA 1OKJA 4OVLA 4B8AB 4DWIA 3WQTA 3EZ5A 4FJIA 3C94A 3G71N 3VEYA 3OYEA 1Y97A 3C6HA 3SZ2A 5I3UA 1QHTA 4N47A 2VWKA 3WNHA 3S3OA 3ZSYA 4DV3K 2DTUA 1BG3A 4HUGA 3A2FA 3HM9A 1T03A 4CF1A 2WUSA 4DQSA 2FSJA 2UUBK 4IO8A 3KD1E 3PIOL 2KZMA 1YTUA 1WNSA 4KTWA 4FJKA 2HHQA 5JVGL 4IOCL 3KLHA 3SMSA 5EXWA 3BP8A 1RT3A 2Q0UA 3SYZA 1S9EA 2XY7A 4CZJA 3GDQA 4CGFA 1Y64A 1SKWA 1NK4A 5EVZA 1JLFA 1QVGM 3THWB 4DSEA 4B3OA 2WOMA 2ITGA 1S6QA 4CGGA 4AQYK 1SV5A 1R59O 3IS9A 3CJAA 2P9NB 4BVOA 4NCGA 4CFBA 4JEPA 4DU4A 3QO9A 4JKFA 1HPMA 4JKDA 2Q2RA 2QKKA 4FJ9A 3T69A 4PQUA 4CVNE 1J53A 4QAGA 4F3OA 2OPQA 2PY5A 4C8KA 1U04A 1RTIA 1IKVA 4FJHA 3AO3A 4LF8K 2JGUA 3CERA 4JAXA 5KQDA 1QVFM 2IOCA 4JI8K 4Y1DA 1YITN 1RT7A 3AGKA 5DK5A 1U4BA 1TYQA 3SLCA 2HBLA 3UE5A 1CXUA 4IZ9A 2PFUA 3E1YA 4MLHA 1U49A 4W5OA 2XHBA 2ITMA 3UB5A 4BE1A 3ZSXA 1K9MO 4CBUA 4HCBA 4FLWA 2HBMA 3IAYA 2V52B 1GLCG 2PBDA 1NGFA 3VQQA 2O8CA 3L4IA 1LW0A 4CGHA 1QHAA 1TV6A 3I56N 1FXXA 1NGHA 2BH1A 3CG7A 3MCAB 1RFQA 4OPAA 4WQ4A 1HRHA 3A5OC 3HSTB 3HPGA 3DJCA 3ZX3A 4B1UB 3R8EA 5AQUA 1XMQK 3PV8A 5GIOA 3OA9A 4O0IA 3LP3A 1SAZA 1WSJA 2E1ZA 1ATSA 5AQXA 3NFAA 4CK1A 3VEWA 4FWKA 1Q86O 4FOIA 4KKOA 1ZYQA 4FJXA 5FRNA 1XUPO 3DRPA 3A8YA 3VEOA 4IEEA 2OZMA 1W7AA 1XC3A 2P9PB 3DRSA 4CZFA 3NCIA 3OS2A 1TK8A 1NJWA 3OYBA 1HKBA 3RSEA 4F8RA 3HYFA 4DS4A 2P9SB 1WSFA 1OH6A 4DV1K 5J2MA 4AM6A 4FZXC 3AVAA 4CGJA 2NRVA 4BR5A 1YT3A 3K9KA 3TTFA 4G1QA 3V4IA 4FM2A 2JLEA 4KPYA 1BA1A 3AAQA 4FWPA 1NOZA 1N6QA 4YOVA 4BC3A 2Y1JA 2W6KA 3SBTA 2IAJA 3O4NA 4CZIA 5C10A 3QEVA 2WBNA 4I9QA 2WC9A 2A6AA 4ELVA 4LFAK 4H0TB 4GVEA 4DCHA 1QSLA 1VSEA 1VSMA 2QI2A 1DKGD 2ASOA 1TKZA 3RMBA 1RDCA 4I6MB 3ZCMA 3IMXA 5BN8A 2Q36A 1NJIO 2YKNA 3FR0A 3QNOA 1RDWX 4JNEA 3THVA 1RCHA 3THWA 4IDKA 5BRFA 3QIOA 3LZIA 4W5TA 4MDBA 3FZFA 5C15A 3NF9A 1BQNA 4IWVA 1VQKN 4FLXA 2YHXA 1KRPA 2IVOA 3RRGA 4CJTA 5AQQA 1NLVA 4DUYK 2OA8A 3LWLA 1RNHA 4B3RK 2H3GX 3H08A 1KVCA 4B1WB 4ZTFA 3WT0A 3ENHA 3CPEA 3CQXA 4CHNA 1K8KB 4CZKA 3TU5A 3SQ4A 1LW2A 1K8AO 1IH7A 2KKZA 4IBNA 2ZQBA 4H0PA 1REVA 4BE2A 3CMEN 2IIRA 3AVLA 1WB9A 1B92A 3C6AA 1HNIA 4YOXA 2FBTA 2QWPA 4DFJA 4BRNA 4LH5A 1NKBA 4CK2A 4BE0A 4RW4A 2DPNA 4C8OA 4BG8A 1J54A 1KFDA 3LP1A 2CGKA 5BPLA 4C23A 1L3SA 2D4WA 1NBWA 4NB4A 4IOAL 4FWOA 3ZSWA 1D8YA 3PSIA 4KTQA 3AO2A 4HCCA 1HYVA 4BGAA 4CIEA 2IDOA 4GKKK 4U67L 5D3GA 4V19S 1NK0A 1XWLA 4JHDA 3CQ8A 3HZ6A 1VSFA 4K8ZA 4DTPA 3GG4A 3CJ9A 2D0AA 3LDQA 3CD6N 4OLBA 3LDSA 4PY5A 1HPZA 2UU9K 4J2DA 4Y0WA 1KAYA 2EWSA 4M41A 2W42A
chains in the Genus database with same CATH topology
4A2AA 3O4WA 1SZ2A 1E4GT 3C7NB 4A5AA 3O9UA 3UKUB 4BRQA 1NGEA 3DAWA 4CI6A 4IO9L 4BR2A 3LDPA 3O5BA 3D6RA 3T7ZA 3Q7BA 5GINA 3CCVN 4H5RA 1VQPN 4A62A 3AAPA 5JVHL 3AARA 3CJCA 4H5TA 3SAFA 1G99A 2F9TA 2A41A 2GTDA 5JLHA 5DM7L 4EHTA 2W41A 1M1KO 4A5BA 1T44A 3ZX0A 1GLFO 3EN9A 3LL3A 3P39A 3FGUA 4CZEA 3N4PA 2HOEA 3GOIA 3WXMB 3ZEUA 2JWKA 2NRWA 3G4SN 4MLEA 2HBKA 4K42A 1Z05A 4H0VB 3HOTA 2YI1A 1JCFA 3MDQA 1Q81O 4XH5A 3VGKA 5LJWA 2KLAA 1NGAA 3VTHA 4BRDA 4BC4A 1QQOA 1VQ8N 2F7TA 4H03B 4CBWA 3TTCA 3KZBA 4B1XB 3LDLA 3MMVA 1E4FT 4ISEA 2UYTA 1DT9A 2AP1A 3UKRB 3VEZA 5ADXA 2IVNA 3ID6A 3TTDA 3D2EB 5EOYA 1XQSC 3QDKA 3O6WA 5BPMA 1VQON 3NVKA 2QTDA 4NLBA 1ILYA 2P9SA 5M1OA 3OW2M 3MN9A 4FWMA 3QFPA 3DXKB 5AQWA 4BRKA 1YAGA 3TPQA 3PLAA 5LJVA 3DLLL 2Q1NA 3R1XA 4A59A 4H5VA 2Q97A 3ZYYX 5AQNA 4GV3A 1ATRA 1HKGA 3EE9A 3TSPA 3FZHA 3RVCA 4BC5A 2I7PA 5H1SQ 4K43A 4WFNL 1HLUA 5AQLA 1IG8A 1LCUA 4H0OA 1ATNA 1ZBSA 4GNIA 1U2VB 3WQUA 4ILJA 3AGRA 1GLJO 2ASMA 1HJOA 3O80A 5AQKA 3W3DA 3CMAN 3R6MA 3CETA 5AQRA 4CBXA 2RHKA 5AQPA 4BRCA 1MDUB 3GL1A 4WQ5C 2P9NA 2YHWA 2NRXA 3J7ZO 3VGLA 3OBYA 2D0OA 2ZWHA 4JK7A 5EX5A 1NGIA 3U9ZA 5F0XA 5GADP 2RE2A 2JWLA 4XH1A 3F5TA 3WUHA 4C1NK 5GAHP 2GWKA 5HL7L 2CH5A 4FO0A 5CE3A 3QBXA 4JD2A 2P9KB 3M3ZA 3MN5A 3M1FA 4PL8A 4E1JA 3C65A 3HBTA 3BF3A 5ADXH 1P90A 3KWGA 4YOYA 3D2FA 1KD1O 2D1KA 5EY4A 3WEEA 5BR9A 4FWSA 4OPHA 3CCSN 3MN6A 3MCPA 4LC9B 4GV6A 1QZ6A 3KWIA 3P38A 4JKGB 2V7ZA 1WOQA 1HX1A 1KAZA 4JHDB 1C0GA 2NRHA 2E1YA 1U6ZA 4BR9A 4CZLA 5AQSA 5JMVA 1T3VA 3H45C 3OBWA 3NMUA 5TKYA 4JKCA 4IFEA 4BR7A 3DWLA 2HF4A 4FWLA 1BOTO 1RGIA 4B1VA 4IJNA 5AQIA 3H1VX 4B1YB 5AFUA 3TSQA 3HTVA 1KXPA 3D7EO 3IFRA 2F9WA 2NRZA 1YUWA 3HI0A 2ZJQL 5AQVA 5M1PA 5LY3A 4DHYA 2ASPA 2FLOA 2ZF5O 4BR4A 3F2KA 1YVNA 4YOTA 1OKJA 2FF3B 1M90O 2QM1A 3WQTA 4NO7A 4YORA 3MWPA 4QS8A 3G71N 3O1BA 3VEYA 3EZWA 3C6HA 1NM1A 1GLDG 3ULEA 5CR4A 3VF6A 3VTIA 1Z6RA 3ZEUB 1BG3A 2QWQA 4M63C 4FWRA 1NGGA 1BWFO 4RWTA 4U7BA 2V51B 2E2NA 2QXLA 3M5RA 2ZGZA 2WUSA 1QQNA 3GE1A 2QEXN 2FSJA 1O13A 4M7XA 3FZKA 4IO8A 3VF4A 5M1NA 5BN9A 3PIOL 3CC2N 4WQ5A 3IKMA 4A2BA 2QWMA 1BUPA 3LDOA 2P9UB 3CPWM 3FZMA 1X9JA 4OO1J 2OTLN 5JVGL 4IOCL 3HSCA 5C12A 3SMSA 5EXWA 3BP8A 4IEIA 2Q0UA 4WFAL 2AA4A 1MA9B 2GELA 4CZJA 1K73O 2OTJN 2P9LA 3GDQA 1NGBA 3ATUA 1EO1A 1Y64A 4IJAA 3CXCM 5EVZA 3EO3A 3CC7N 3CQYA 4WQ4C 1QVGM 5TKWA 5KPRA 2YJEA 4BRIA 2P9PA 4EHUA 1VQ7N 5AQHA 4YOWA 5AQMA 4BY9C 3I33A 1R59O 2P9IA 1VQ5N 3CJAA 4FWNA 3JS6A 4BQZA 3KVGA 2P9NB 4BC2A 4BVOA 4PKIA 1SQKA 2A3ZA 4JEPA 3VPZA 4HTLA 2QA4N 2Q0RA 1HPMA 4JKFA 3MK6A 4JKDA 2Q2RA 4H0XB 3CC4N 4R79A 3ENOA 3T69A 3J8AA 2E20A 5M1KA 4YDUC 2Q31A 4J8FA 3E66A 4GY2B 5BRHA 3EKSA 2GEMA 3DXMA 3I55N 5AR0A 4BROA 3QFUA 4K25A 3CERA 4JAXA 3O08A 5JICA 5KQDA 1QVFM 3ZX2A 1S22A 3K9JA 5AQYA 1NGCA 1YITN 1VQMN 3AGKA 2FSKA 1TYQA 3SLCA 5AQTA 4FL9A 3S41A 5B8HA 2FSNA 1NMDA 2HBLA 2YJFA 5BRDA 4KH4A 3N4QA 3G6EN 5JLFA 3D2EA 3UE5A 3E9OA 4IZ9A 1YI2N 2IVPA 2PFUA 3L4QA 3E1YA 3TSUA 4MLHA 3H3NO 3HM8A 2ZJPL 3CJBA 3MN7A 3VEVA 1CZAN 3L6QA 1ZXOA 2YCHA 2ITMA 4I6MA 3UB5A 4A57A 3ZETB 3A5MC 1SS6A 4CBUA 1K9MO 1GLLO 3CHWA 2HBMA 4DKWA 3ID8A 3SJHA 2GUPA 3FFKB 4JKEA 4BRMA 2V52B 3GBTA 3IDHA 4BVPA 1GLCG 4WFBL 4O5FA 2FXUA 2PBDA 4XH4A 1NGFA 2NRTA 5AZIA 2YX6A 5AZJA 1W2BM 2GWJA 4BRPA 3A0IX 3SAGA 3L4IA 5KPZA 4MDAA 4NLCA 3U4LA 4PHTX 3Q7CA 1QHAA 3ULEB 3I56N 1J6ZA 5AQJA 1BA0A 2VCPA 1NGHA 2BH1A 4FOEA 1VQNN 3QICA 3U9DA 1D4XA 3WXKA 4EFHA 3CIPA 3MCAB 1T6DA 1RFQA 1HUXA 4OPAA 4WQ4A 2CGJA 4EAHD 2V7YA 3BUZB 3A5OC 3O9QA 5FPMA 4FPAA 3DJCA 5CHIA 3ZX3A 3CCEN 2CGLA 1K8KA 4MO5A 4ILGB 4B1UB 3R8EA 4CZHA 5AQUA 1P8ZA 4IXCA 4H0YB 1X3NA 4H5NA 1KQSM 4JK8A 4RTFD 2BUPA 1NWKA 5GIOA 2ZGYA 3CJ7A 4F9OA 2FF6A 3OA9A 5I9EB 3HOSA 5C0YA 4ISGA 1SAZA 4BREA 2E1ZA 4BRFA 2QWRA 4WF9L 2E2PA 2QWOA 1ATSA 1QZ5A 2W40A 4DB3A 3VF2A 3CF5L 3VMFB 5AQXA 5F1XA 4RCHA 3CCRN 2P9LB 3JXUA 4FWKA 3VEWA 1Q86O 3L0QA 1OVYA 2A40A 4FOIA 3CCJN 4GV9A 3QMLA 2J4RA 4B9QA 1XUPO 4ISFA 3VEOA 3A8YA 3O9SA 3H46O 4H5WA 2VGNA 4IEEA 2VGMA 3B8AX 1XC3A 2P9PB 3E9LA 4CZFA 2QW9A 4B1ZA 4AM7A 1HKBA 1MWMA 4FVUA 1TUUA 3LM9A 4PKGA 3RSEA 5E26A 5AFUH 4ILHA 2P9IB 2P9SB 3VEXA 1DEJA 3BF1A 2E2OA 3SK3A 3O9TA 4AM6A 4CD1A 4PKHA 1GLBG 1YF5L 3CI5A 1WUAA 3H1QA 4BRHA 5GAEP 4JKHA 2NRVA 3KK7A 2A5XA 3H3OB 4BR5A 3K9KA 3TTFA 3A5NC 3R3LA 5BPNA 1Q82O 3FLCO 5AQFA 1YJWN 3SMPA 3SBGA 1YJNN 2QWNA 1BA1A 3AAQA 3DXMB 3VERA 4BR0A 4FWPA 1BDGA 4UY8O 3FZLA 3VOVA 1GLAG 4PL7A 4BG9A 1VQ4N 1ESVA 1Q18A 3C7NA 4XEIA 3VETA 4CZMA 3LDNA 1BU6O 3UKUA 4YOVA 4HWIA 4BC3A 5GIPA 2D0PA 3SBTA 1X3MA 3IUCA 1QQMA 2VYPA 3SAHA 1NGDA 4CZIA 5C10A 4L3QA 2WBNA 3LM2A 1TYQB 5M1QA 3VGMA 1YXQA 2WC9A 4BRAA 4JN4A 1HKCA 3QB0A 2ZJRL 5FPEA 3R9PA 4JD2B 4QS9A 5HOOA 1W97L 2A6AA 5C2DA 4BRGA 4H0TB 3EL2A 2P9UA 4GVEA 5F2RA 4WYBA 4DCHA 3CCUN 4O8KA 1VAZA 2NLXA 3D2FB 3EE8A 2NNWA 3WXLA 4EIAA 3WEEB 2QI2A 3BEXA 5E84A 1DKGD 5AQOA 2ASOA 3MWTA 3P31A 4AF1A 3VENA 3MX2A 2WFBA 4I6MB 2YHYA 1T6CA 3IMXA 3O1WA 3CCLN 5BN8A 2Q36A 1NJIO 3ENBA 3FR0A 3G25A 1RDWX 4JNEA 4KH5A 4Z94A 1JJ2M 1EQYA 5BRFA 5AZJB 3UKRA 5AZIB 4MDBA 3FZFA 5C15A 5C2FA 5KQ8A 4BRLA 4IWVA 4A61A 1VQKN 3O9RA 2YHXA 1V4TA 3EKUA 2IVOA 2QWLA 1GLEG 5FPNA 3MX5A 5AQQA 1NLVA 4CJ7A 3DXKA 3I8BA 4DQ8A 5FPDA 1YJ9N 2E8AA 2H3GX 1KC8O 3W0LA 2CH6A 1C0FA 5M1FA 4B1WB 2OANA 3ENHA 3WT0A 3P4IA 4CD3A 3CPEA 4BGBA 3CQXA 3NVMA 1K8KB 1U2VA 5AQGA 4CZKA 2HBJA 3TU5A 1Q7YO 4KH6A 3A5LC 4CZGA 1K8AO 2KKZA 3M6GA 2BTFA 3CCQN 4H0PA 3O8MA 4QS7A 1ZC6A 4K41A 3ATVA 4MO4A 5AQZA 4O8UA 1KAXA 1S72N 4WCEL 3CMEN 2IIRA 4BQLA 2NRRA 4FSVA 3C6AA 4YOXA 2QWPA 4FPBA 1JCGA 4BRNA 1LOTB 1BO5O 4FWQA 2DPNA 2VWBA 4BG8A 2GX9A 3HRGA 4C1NI 4G9ZA 1YIJN 3AY9A 2CGKA 5BPLA 4C23A 2HF3A 5KPTA 4M7YA 2D4WA 1NBWA 4NB4A 2P9KA 4JKBA 2HSTA 4IOAL 5DM6L 3PIPL 2I7NA 4FWOA 1IJJA 3WXJA 2NZTA 5MLCQ 4IDHA 3CJ1A 4IOXA 1VQ9N 2E2QA 4BGAA 1N8RO 4YOUA 1TUYA 3U8XA 3RSEB 5BREA 3F9MA 1YHQN 3KHYA 4U67L 1DGKN 1S3XA 3ZETA 5ELZA 2A42A 4JKGA 1RDUA 4JK9A 2HMPA 3FE1A 4JHDA 3HZ6A 1JCEA 4YDUA 3QBWA 1V4SA 3GG4A 1H1VA 4KBOA 1VQ6N 3C0BA 2E88A 2KHOA 2PAVA 1NGJA 3CJ9A 3LDQA 3CCMN 3H6EA 3CD6N 3OHRA 4JKAA 3E9PA 1MWKA 1VQLN 5GAGP 3VESA 4Y0WA 3WXIA 1KAYA 2EWSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YOT A;  4YOY A;  4YOV A;  4O8U A;  4YOU A;  5CHI A;  4YOW A;  4YOX A;  4YOR A; 
#chains in the Genus database with same CATH topology
 5SZT A;  4A2A A;  4BWJ A;  3K57 A;  4ZHR A;  1QTM A;  3T7Z A;  4A62 A;  4JS4 A;  2BGG A;  3CJC A;  3SJJ A;  1W9H A;  2YHA A;  1ZBU A;  4MQ3 A;  5JLH A;  1F21 A;  2W41 A;  4A5B A;  3IRX A;  4CZE A;  3WXM B;  4E7K A;  1RBU A;  4CES A;  2NRW A;  4H0V B;  2YI1 A;  2QKB A;  3ZT4 A;  4W5Q A;  2Y1I A;  1VQ8 N;  2F7T A;  4H03 B;  4FZY A;  3MMV A;  4ISE A;  3UKR B;  2IVN A;  3ID6 A;  4EZ6 A;  1XC9 A;  4NXN K;  3D2E B;  1ZBH A;  3AVM A;  3OJU A;  2P9S A;  5M1O A;  3MN9 A;  3KD5 E;  3CFP A;  2KQ2 A;  3LAL A;  3ZYY X;  2Q97 A;  5AQN A;  1ATR A;  3EE9 A;  1S9G A;  4FJJ A;  4CEF A;  4F4K A;  3WQU A;  1I3A A;  4ILJ A;  4DS5 A;  1GLJ O;  2ASM A;  5AQK A;  3R6M A;  3OYN A;  3AA4 A;  3J7A P;  3T1H K;  2RHK A;  4KHU A;  5AQP A;  1TL3 A;  4WQ5 C;  5HLF A;  2YHW A;  2E4L A;  3KK3 A;  4JK7 A;  4CER A;  4XH1 A;  3F5T A;  3S9H A;  3WUH A;  5HL7 L;  2CH5 A;  3CM5 A;  2P9K B;  3M3Z A;  1IBL K;  3M1F A;  4PL8 A;  3MEE A;  4FJ5 A;  5CZ2 A;  1RBV A;  3KWG A;  5EY4 A;  3NF7 A;  4DQP A;  3CCS N;  1IBM K;  3QET A;  3LPU A;  4CEE A;  1QZ6 A;  1WLJ A;  3KWI A;  4JKG B;  1WOQ A;  4H4M A;  1N33 K;  1D9D A;  3ZSR A;  3WNF A;  3K5M A;  4E1N A;  3WNG A;  4BR7 A;  4OKE A;  3K58 A;  3RR7 A;  1RT5 A;  1GOA A;  3SUN A;  3HTV A;  2NRZ A;  1YUW A;  4FJ7 A;  1LWC A;  4DHY A;  1QS4 A;  1BHL A;  4CW7 B;  2QM1 A;  2O8E A;  4YOR A;  1HR0 K;  3DRR A;  1NM1 A;  1WSG A;  4RG8 A;  3ULE A;  2BE2 A;  3VF6 A;  3VTI A;  4CHY A;  1TK0 A;  4IG0 A;  2QWQ A;  3B6O A;  2O8D B;  4JI0 K;  1IV0 A;  4RWT A;  4B8C A;  2HHU A;  2E2N A;  4KB1 A;  2QXL A;  1EXQ A;  5CYQ A;  2ZGZ A;  4CJ4 A;  3AVI A;  3U6F A;  5M1N A;  5C24 A;  1QSY A;  1RBR A;  2OZS A;  3IKM A;  1Z26 A;  2QWM A;  3CPW M;  3LAM A;  4QOZ B;  3FZM A;  1X9J A;  3V9X A;  3NH1 A;  4N41 A;  3SUO A;  2IGI A;  1MA9 B;  2OTJ N;  1C0U A;  2YNG A;  3O4Q A;  4DMN A;  3CXC M;  3EO3 A;  3CQY A;  4DSK A;  5KPR A;  4BRI A;  4CFA A;  2X6N A;  5J2Q A;  5FDL A;  3C6T A;  4PA1 A;  1BL3 A;  1T05 A;  4JI6 K;  4OPJ A;  1CXQ A;  3VQ8 A;  3JS6 A;  4DF4 A;  1C0T A;  3KVG A;  1OH7 A;  4PKI A;  1SQK A;  2A3Z A;  3THX B;  5CZ1 A;  4HTL A;  3TAM A;  4DLE A;  3BZK A;  2QK9 A;  3DLE A;  4CJ3 A;  3P1G A;  1BQM A;  2GEM A;  1JL1 A;  1WN7 A;  1YVU A;  5AR0 A;  1J5E K;  4CEB A;  3AVN A;  3K9J A;  1S22 A;  4M3T A;  5AQY A;  2YHB A;  3NGY A;  2FSK A;  1FKO A;  5B8H A;  2FSN A;  3IG1 A;  3OYG A;  4OKK A;  1UOC A;  4ELT A;  3N4Q A;  1BIS A;  5JLF A;  3D2E A;  1RBS A;  4OX9 K;  3RMD A;  2IVP A;  1C6V A;  3H3N O;  4ZTJ A;  1HMV A;  1JXE A;  4AHV A;  3P83 D;  1WBD A;  3VEV A;  3JAM O;  1CZ9 A;  1VHX A;  3ULD A;  1CZA N;  2YCH A;  3A5M C;  1GLL O;  3CHW A;  4O44 A;  2P5G A;  1LWF A;  4JKE A;  2OPS A;  3GBT A;  3IDH A;  3AO5 A;  4O5F A;  5AZJ A;  3NGZ A;  1W2B M;  3A0I X;  5KPZ A;  4MDA A;  3K0S A;  3U4L A;  3BDP A;  3ZT2 A;  3DMJ A;  2O8B A;  3ALY A;  4CJE A;  1ASU A;  1BIU A;  2Z1I A;  4JV5 K;  4X65 K;  3U9D A;  4X62 K;  2CGJ A;  3KLI A;  1NNE A;  4DV6 K;  3O9Q A;  5FPM A;  4CEA A;  4M45 A;  4NYN A;  1NKC A;  4F2S A;  2X6S A;  4CZH A;  1P8Z A;  4H5N A;  1NWK A;  2ZGY A;  3CJ7 A;  5C0Y A;  2XY6 A;  3J7Y P;  3PO4 A;  2QWO A;  3KLG A;  2PZS A;  3VMF B;  3TAF A;  4PUO A;  3CCR N;  2P1J A;  4CGD A;  2P9L B;  3JXU A;  4DFK A;  4GV9 A;  1N5Y A;  3JYT A;  3QML A;  2J4R A;  2KW4 A;  1XNR K;  3DM2 A;  1W0H A;  2YNI A;  1SL1 A;  2Z1J A;  4LF4 K;  2VGM A;  3VQA A;  3E9L A;  2QW9 A;  4LF6 K;  4FVU A;  4PKG A;  3S3M A;  3D45 A;  2P9I B;  1S1T A;  1A5W A;  4N5S A;  4Z4H A;  2FC0 A;  1JLC A;  4CD1 A;  3OYI A;  1YF5 L;  3LPT A;  1B9D A;  3H1Q A;  2HHS A;  3VQ4 A;  1U45 A;  4I7F A;  3KIO A;  3A5N C;  2DFH A;  4DQQ A;  1XHZ A;  4E1M A;  5AQF A;  3CYM A;  1RDA A;  3DXM B;  3MEG A;  3LZJ A;  1GLA G;  3SV3 A;  3ZT0 A;  2O8D A;  1VQ4 N;  1ESV A;  1CZB A;  4XEI A;  3VET A;  4CZM A;  3UKU A;  4HWI A;  5GIP A;  4CEC A;  3K5L A;  2VYP A;  3SPZ A;  3C6U A;  4FJG A;  3LP0 A;  4BRA A;  2KZZ A;  1YXQ A;  4JN4 A;  3QB0 A;  1BI4 B;  2YNF A;  3LP2 A;  4IG3 A;  4JD2 B;  5HOO A;  4EP4 A;  3EL2 A;  1A5X A;  3CCU N;  4KRE A;  2NNW A;  4FVM A;  3MWT A;  4AF1 A;  1JLA A;  3O3F A;  2WFB A;  3KKR A;  4KI4 A;  3CCL N;  4RW7 A;  4DR3 K;  3OYJ A;  1KTQ A;  3OS0 A;  5EU7 A;  4KH5 A;  4DTM A;  4DUZ K;  5AZI B;  2ZE2 A;  5C2F A;  5KQ8 A;  4BRL A;  4DV2 K;  4A61 A;  4PWD A;  4N76 A;  3TAG A;  3TR8 A;  4NYF A;  4CJ7 A;  3I8B A;  1HNW K;  1C0F A;  1A5V A;  5LMN K;  2D5R A;  5AQG A;  4DSI A;  2BTF A;  4HVJ A;  3CCQ N;  4K41 A;  3ATV A;  4MO4 A;  1L3U A;  1J5O A;  5KGW A;  1S72 N;  5JS2 A;  4FSV A;  1G15 A;  3VQD A;  1LOT B;  4CJS A;  4FWQ A;  3AY9 A;  4CEZ A;  2HF3 A;  2GBZ A;  4AIL C;  4JKB A;  3PIP L;  2I7N A;  1IJJ A;  4OJR A;  2IC3 A;  4RW9 A;  4K8X A;  3WXJ A;  4B3T K;  4ID5 A;  4IDH A;  2E2Q A;  1N8R O;  3AA5 X;  5BRE A;  3F9M A;  1NK7 A;  1EWR A;  4B9M A;  1DGK N;  3AVF A;  3DYA A;  5ELZ A;  1RDU A;  4CJK A;  1KFS A;  4YDU A;  3QBW A;  1H1V A;  1TL1 A;  4KBO A;  1VQ6 N;  3C0B A;  3LAN A;  2E88 A;  4IFY A;  2KHO A;  4FM1 A;  3H6E A;  1HNV A;  1HNZ K;  4DFM A;  1VRU A;  3WXI A;  3I0S A;  3KK1 A;  4FLV A;  1ASW A;  4E7J A;  3C7N B;  1NGE A;  4ID1 A;  4CI6 A;  5FRO A;  4BR2 A;  4DR1 K;  2FBY A;  3O5B A;  3D6R A;  3CCV N;  5GIN A;  1O1W A;  4M3W A;  4AHR A;  3SAF A;  1G99 A;  1BIZ A;  2F9T A;  3L2Q A;  1M1K O;  1EP4 A;  3ZX0 A;  1GLF O;  3LL3 A;  4JI4 K;  3GOI A;  4FK2 A;  3G4S N;  4K42 A;  1Z05 A;  2E5L K;  1JCF A;  3MDQ A;  3VGK A;  5LJW A;  2KLA A;  4FM0 A;  3DLR A;  4BC4 A;  3DI6 A;  2F4V K;  3TI0 A;  1QQO A;  1S1V A;  2D0C A;  3LDL A;  3CFO A;  1E4F T;  2UYT A;  2AP1 A;  4FLZ A;  3TTD A;  3O6W A;  5BPM A;  3NVK A;  1TK5 A;  2QTD A;  3OW2 M;  3QFP A;  3DXK B;  4BRK A;  5KI6 A;  5LJV A;  1NMN A;  4R5P A;  3QNN A;  4GV3 A;  4AHT A;  3V1R A;  3L2W A;  3HPO A;  2XY8 A;  1RTH A;  5H1S Q;  1HNX K;  1GOC A;  2HVI A;  1ATN A;  1ZBS A;  4GNI A;  1U2V B;  1N34 K;  4F2R A;  3AGR A;  1HJO A;  2BAN A;  2HNY A;  4CBX A;  3M8P A;  1MDU B;  4Q0B A;  3OYF A;  2P9N A;  3M8S A;  3VGL A;  1S1X A;  2D0O A;  1NGI A;  4M3X A;  5F0X A;  5KRT A;  1VSJ A;  4OLA A;  4KRF A;  2GWK A;  1BI4 A;  4JD2 A;  1LV5 A;  4W5N A;  3MN5 A;  5HRO A;  1LAW A;  3C65 A;  5ADX H;  1P90 A;  2YV0 X;  4B3M K;  4I9L A;  5BR9 A;  4OPH A;  4DR4 K;  5SWM A;  5HRP A;  2Q3S A;  4KFB A;  4EZ9 A;  1ASV A;  4O55 A;  3P38 A;  4DR2 K;  1HX1 A;  1KAZ A;  1C0G A;  2NRH A;  3PSF A;  4CCH A;  3AO1 A;  5AQS A;  5JMV A;  1DTQ A;  4DFP A;  3H45 C;  3KLE A;  4NCA A;  4Z4E A;  4IFE A;  3QLH A;  3DWL A;  1BOT O;  4CFC A;  1S6P A;  1NJY A;  3TSQ A;  4DTO A;  1N32 K;  2F9W A;  1MU2 A;  3HI0 A;  1ITG A;  5LY3 A;  2OYQ A;  2ASP A;  4BR4 A;  3DLG A;  3OYM A;  1M90 O;  3OYA A;  1NK9 A;  4NO7 A;  1TKT A;  3MWP A;  4QS8 A;  4DR6 K;  1GLD G;  4RW6 A;  2BDP A;  3QER A;  5LL6 Z;  3ZSV A;  3AVK A;  5HBM A;  1SKS A;  3ZEU B;  5CY4 A;  4M63 C;  3QEI A;  3EYZ A;  4FWR A;  4DG1 A;  3DOK A;  1NGG A;  5BR8 K;  2V51 B;  1B9F A;  3M5R A;  3VQB A;  1QQN A;  3GE1 A;  4JS5 A;  1L3T A;  2QEX N;  2UUA K;  2W6L A;  3FZK A;  5BN9 A;  4KTZ A;  3AO4 A;  4WQ5 A;  3U3Y A;  2B4J A;  3ITH A;  3LDO A;  5HRR A;  4OO1 J;  3SQ2 A;  3T3F A;  5C12 A;  1JLQ A;  4IEI A;  4WFA L;  2AA4 A;  2GEL A;  3HL8 A;  4KHY A;  4C8N A;  1EO1 A;  1XMO K;  3AVJ A;  4AHC A;  4AHU A;  1T8E A;  3KK2 A;  3TAB A;  1ZBI A;  2P9P A;  4DTS A;  4HUF A;  2Z1G A;  3RR8 A;  3THY B;  1VQ7 N;  4I2P A;  4UQG A;  5AQH A;  4YOW A;  3I33 A;  1VQ5 N;  4FWN A;  4FLT A;  4BQZ A;  2HHT A;  1X9M A;  4DV4 K;  1RIL A;  3VPZ A;  1Z25 A;  2EHG A;  3ZSZ A;  4JRQ A;  3MK6 A;  4FCY A;  3CC4 N;  4R79 A;  3ENO A;  5M1K A;  4LF9 K;  2Q31 A;  4J8F A;  4GY2 B;  5BRH A;  3EKS A;  2OCE A;  3I55 N;  3HXM A;  4BRO A;  3QFU A;  2UXD K;  4Z4C A;  3O08 A;  5JIC A;  2E6M A;  3NF8 A;  4YY3 K;  3M8Q A;  1NU0 A;  2NUB A;  3OS1 A;  3OYD A;  1SL2 A;  1NGC A;  3MXI A;  2F96 A;  1VQM N;  2X78 A;  1TKD A;  4KHS A;  3G10 A;  5K14 A;  2YJF A;  4KH4 A;  3E9O A;  3PY8 A;  1NK5 A;  3HM8 A;  3CJB A;  3MN7 A;  1VSK A;  1KLM A;  3L6Q A;  1ZBF A;  4A57 A;  4I6M A;  1WSI A;  3B6P A;  2OPR A;  5E41 A;  1SS6 A;  3ASM A;  3V1O A;  2GUP A;  4BVP A;  4AH9 A;  4WFB L;  2FXU A;  4XH4 A;  2NRT A;  4DTJ A;  2GWJ A;  4BRP A;  1KSP A;  4CFD A;  3NE6 A;  2RKI A;  4NLC A;  4PHT X;  3Q7C A;  1NK8 A;  1FKP A;  2E6L A;  2FBX A;  2VG5 A;  5AQJ A;  1BA0 A;  4Y1C A;  2ZD1 A;  4FK4 A;  2O4G A;  1FW6 A;  3QIC A;  4M3U A;  3WXK A;  3O3H A;  3CIP A;  2G8F A;  4EAH D;  2V7Y A;  3BUZ B;  3VQP A;  1SUQ A;  3MEC A;  3D0P A;  4FPA A;  3CCE N;  4YHH K;  3VA0 A;  1K8K A;  1JXB A;  4FXD A;  4ILG B;  4IXC A;  4FK0 A;  4H0Y B;  1KQS M;  4F9O A;  4LD0 A;  1XI1 A;  1WBB A;  4BRF A;  2QWR A;  3OY9 A;  2W40 A;  1QZ5 A;  4OGE A;  3VF2 A;  5F1X A;  5T7B A;  4RCH A;  2ZM6 K;  1OVQ A;  1OVY A;  4ISF A;  4GKJ K;  3O9S A;  4B9T A;  4LF5 K;  3B8A X;  4DQI A;  5KRS A;  4E89 A;  1U47 A;  1KLN A;  4AM7 A;  1TUU A;  1SL0 A;  3HPH A;  2G8V A;  1DEJ A;  3ISN C;  3BF1 A;  1T7P A;  3O9T A;  3HP9 A;  2F8S A;  4M42 A;  1TGO A;  3CI5 A;  1WUA A;  5GAE P;  4JKH A;  3KK7 A;  2A5X A;  2VQF K;  4CIF A;  5BPN A;  4FJM A;  1TKX A;  1C0M A;  3FLC O;  1YJW N;  1YJN N;  2QWN A;  1X9W A;  2AJQ A;  3NHG A;  4UY8 O;  3VOV A;  4CEQ A;  4PL7 A;  4BG9 A;  1Q18 A;  1DTT A;  1HQU A;  3LDN A;  2D0P A;  1UA0 A;  1X3M A;  3IUC A;  2QXF A;  4E3S A;  4L3Q A;  3EY1 A;  4Z4F A;  3VGM A;  1TYQ B;  1HKC A;  5FPE A;  2GV9 A;  4N56 A;  3DLH A;  1R0A A;  5F2R A;  1WSE A;  4WYB A;  4O8K A;  3F73 A;  3WXL A;  4EIA A;  2YNH A;  3BEX A;  3P31 A;  3TAE A;  4XIU A;  3SUP A;  1T6C A;  4EP5 A;  3ENB A;  1IKX A;  3G25 A;  1JJ2 M;  4M3Y A;  3L3U A;  3UKR A;  2O8C B;  2DY4 A;  3O9R A;  5C42 A;  4Z0U A;  5FPN A;  1RT4 A;  3MED A;  1C1C A;  4DQ8 A;  5FPD A;  1YJ9 N;  3NH2 A;  2ETJ A;  2E8A A;  1KC8 O;  2UXC K;  2VG6 A;  2CH6 A;  3L2V A;  1HYZ A;  5KTQ A;  5M1F A;  4E7H A;  2OAN A;  3AV9 A;  2HB5 A;  4B9S A;  3NVM A;  4IKF A;  4FZZ A;  1Q7Y O;  1HJR A;  4CZG A;  4BWM A;  3V9S A;  4KHP K;  4Z4I A;  4FYD A;  4QS7 A;  3FFI A;  4O8U A;  1KAX A;  4WCE L;  2HHX A;  1JCG A;  1BO5 O;  1D9F A;  4GMJ B;  1IG9 A;  2GX9 A;  4G9Z A;  5KPT A;  2P9K A;  3NH0 A;  2HST A;  3CM6 A;  2KTQ A;  5DM6 L;  3PX0 A;  3VQC A;  3SPY A;  1JLB A;  2NZT A;  5MLC Q;  4LF7 K;  3CJ1 A;  2P51 A;  3KTQ A;  5I42 A;  4YOU A;  3U8X A;  3RSE B;  3TAR A;  1YHQ N;  1KCF A;  3RMA A;  4JKG A;  4JK9 A;  4CIG A;  2HMP A;  3FE1 A;  2G8U A;  1JCE A;  3SNN A;  1IKW A;  3CCM N;  2PAV A;  1NGJ A;  3RTV A;  1RTJ A;  2OPP A;  3OHR A;  3ZSO A;  2XY5 A;  3PO5 A;  4JKA A;  1KVA A;  2HHW A;  1RDD A;  3ZSQ A;  3HT3 A;  2PYJ A;  4A5A A;  4BRQ A;  3DAW A;  1BGX T;  3DOL A;  4H5R A;  4Z4G A;  5JVH L;  3AAR A;  1RTD A;  3AVC A;  1EKE A;  2A41 A;  3UIQ A;  5DM7 L;  4EHT A;  3VQ6 A;  3P39 A;  3FGU A;  4J2E A;  2JWK A;  4MLE A;  4CHQ A;  1JKH A;  3L3V A;  1WAJ A;  1NGA A;  3VTH A;  5LMU K;  2X74 A;  1L3V A;  3KZB A;  4CHZ A;  4B1X B;  1QQC A;  1TAQ A;  1EX4 A;  5ADX A;  4FJL A;  5EOY A;  1XQS C;  2DFF A;  1NG9 A;  3VQ9 A;  1VQO N;  4I2Q A;  1ILY A;  1JL2 A;  3TPQ A;  3DLL L;  2Q1N A;  4A59 A;  4H5V A;  2LSN A;  3TSP A;  4BC5 A;  1FJG K;  2I7P A;  3BZC A;  4K43 A;  2RN2 A;  3C95 A;  4WFN L;  1HLU A;  1LCU A;  1KVB A;  3L2U A;  3VQ7 A;  4F3T A;  3OTO K;  3QEW A;  3O80 A;  3W3D A;  4BDY A;  1JLG A;  5AQR A;  3JSM A;  4BRC A;  3GL1 A;  1BCO A;  2NRX A;  3SUQ A;  2ZWH A;  3THX A;  3U9Z A;  4KHW A;  4CJR A;  3BGR A;  4C1N K;  4FO0 A;  1QSS A;  3AA2 A;  4DLG A;  1LWE A;  4E1J A;  1Q9Y A;  3OYC A;  3BF3 A;  3SQ0 A;  2HVH A;  3CFR A;  1KD1 O;  2D1K A;  1VSL A;  4FWS A;  2D0B A;  3MN6 A;  3MCP A;  4GV6 A;  5HRN A;  4JYA K;  4CEO A;  3HK2 A;  2V7Z A;  4JHD B;  2G8I A;  1S5J A;  4CZL A;  3VQE A;  4B9U A;  1T3V A;  3OBW A;  1QE1 A;  3SCX A;  4JKC A;  4YFU A;  4FWL A;  4DTR A;  1RGI A;  4B1V A;  4IJN A;  5AQI A;  4B1Y B;  5FLX O;  5AFU A;  2HMI A;  3AVG A;  3D7E O;  3IFR A;  3I8D A;  4DV0 K;  2A1R A;  2O4I A;  4E19 A;  3K2P A;  3HVT A;  1OH5 A;  5AQV A;  5M1P A;  3E01 A;  3M8R A;  2FLO A;  4E7I A;  3F2K A;  4CED A;  1YVN A;  4YOT A;  2FF3 B;  4LY7 A;  1EET A;  1X9S A;  4KHN A;  1I39 A;  3O1B A;  4X64 K;  3EZW A;  4RW8 A;  5CR4 A;  3QEP A;  1RDB A;  1Z6R A;  3NF6 A;  4AHS A;  1BWF O;  5AJ3 K;  5HRS A;  4U7B A;  1HYS A;  1C1B A;  4CJL A;  1ZBL A;  2G8W A;  1O13 A;  4M7X A;  3VF4 A;  2HND A;  3CC2 N;  4TSX A;  2F8T A;  4A2B A;  1BUP A;  1UWB A;  2P9U B;  4DV5 K;  4E0D A;  2OTL N;  4LFB K;  5J2P A;  3KJV A;  3PX4 A;  3HSC A;  1X1P A;  4KHQ A;  5IWA K;  2WTU A;  1K73 O;  4C8L A;  2P9L A;  3TWH A;  1NGB A;  3ATU A;  4KI6 A;  1IBK K;  4IJA A;  3TAN A;  3CC7 N;  2RPI A;  4WQ4 C;  5TKW A;  2YJE A;  4B3S K;  3ZLJ A;  2G8H A;  4EHU A;  4DSF A;  4BY9 C;  5AQM A;  2P9I A;  4C8M A;  2HW3 A;  1TVR A;  2B6A A;  4BC2 A;  1LAV A;  1VK0 A;  4W5R A;  1U48 A;  2QA4 N;  2Q0R A;  4J2B A;  4E7L A;  3AVH A;  4H0X B;  4CF9 A;  3AA3 A;  2E20 A;  3J8A A;  4JI1 K;  4YDU C;  3T19 A;  2I5J A;  4B9V A;  3E66 A;  3DXM A;  1S1W A;  1FK9 A;  4K25 A;  4B08 A;  3ZX2 A;  3AVB A;  3EEQ A;  1WSH A;  1RBT A;  5AQT A;  4NXM K;  3S41 A;  1IKY A;  4FL9 A;  3SI6 A;  1NMD A;  5BRD A;  3G6E N;  4ELU A;  2VQE K;  1YI2 N;  2P5O A;  3L4Q A;  1VRT A;  3TSU A;  4FLU A;  3V9Z A;  2ZJP L;  1NOY A;  3QIP A;  4DU3 A;  1ZXO A;  1VSH A;  2RF2 A;  4CHP A;  4CJ5 A;  3ZET B;  4DKW A;  3ID8 A;  3SJH A;  1D5A A;  3FFK B;  4BRM A;  4KB0 A;  2XRI A;  2O8E B;  5AZI A;  2YX6 A;  4JI7 K;  3SAG A;  3HP6 A;  3L8B A;  4CF2 A;  4CK3 A;  3V81 A;  3K5O A;  4O5B A;  3ULE B;  3NDK A;  3RWU A;  3K59 A;  4H8K A;  1J6Z A;  1JLE A;  2VCP A;  4FOE A;  1VQN N;  3NAE A;  1D4X A;  4EFH A;  4OKJ A;  3T1A A;  1T6D A;  1HUX A;  1RT2 A;  2Z1H A;  5CHI A;  4FW1 A;  4YNQ A;  3G0Z A;  4DTN A;  3MXM A;  2CGL A;  4MO5 A;  2G8K A;  3MXJ A;  1X3N A;  3O3G A;  4BAC A;  4JK8 A;  4RTF D;  2BUP A;  2FF6 A;  5I9E B;  3HOS A;  4ISG A;  4BRE A;  4WF9 L;  2E2P A;  4DB3 A;  3CF5 L;  4M3Z A;  5JS1 A;  4CE9 A;  3L0Q A;  3CCJ N;  2A40 A;  1VSD A;  4B9Q A;  4IFV A;  4H5W A;  3H46 O;  4J2A A;  2VGN A;  4FW2 A;  4B1Z A;  5IT9 O;  3SV4 A;  1UA1 A;  1MWM A;  3OYL A;  3LM9 A;  3OJS A;  5E26 A;  5AFU H;  4ILH A;  3VEX A;  2IS3 A;  4M3R A;  2E2O A;  3SK3 A;  3RRH A;  4PKH A;  1GLB G;  4X66 K;  1RT6 A;  4HHT A;  3V9W A;  4BRH A;  5FRM A;  2UXB K;  3H3O B;  1J9A A;  3R3L A;  1Q82 O;  3DLB A;  3SMP A;  3SBG A;  3V9U A;  1XHX A;  4DV7 K;  3VER A;  4OGC A;  4BR0 A;  3HVR A;  1BDG A;  3FZL A;  1IO2 A;  1NKE A;  3C7N A;  4JI3 K;  1BU6 O;  4O0J A;  4DU1 A;  1QQM A;  3SAH A;  4CJF A;  1NGD A;  1YTA A;  4CGI A;  3LM2 A;  5M1Q A;  3VQ5 A;  2ZJR L;  2A1S A;  3R9P A;  3ZT1 A;  1DLO A;  4QS9 A;  1W97 L;  5KGX A;  5C2D A;  4BRG A;  4DSJ A;  2P9U A;  4GVM A;  1VAZ A;  2NLX A;  3D2F B;  3EE8 A;  3WEE B;  5E84 A;  5AQO A;  3VEN A;  3MX2 A;  2YHY A;  3O1W A;  4JI5 K;  4Z94 A;  4WE1 A;  1EQY A;  5AZJ B;  3RMC A;  4BDP A;  2O8F B;  1V4T A;  2KFZ A;  3EKU A;  2QWL A;  1GLE G;  1RT1 A;  3MX5 A;  2O8B B;  4FJ8 A;  1Q9X A;  1TAU A;  3DXK A;  4HUE A;  1BCM A;  3VN5 A;  4HTU A;  3KKS A;  4Q5V A;  3W0L A;  3P4I A;  4CD3 A;  4BGB A;  1CLQ A;  1U2V A;  1HQE A;  2HBJ A;  4KH6 A;  3A5L C;  4DQR A;  1I94 K;  2PYL A;  3M6G A;  1NJX A;  3O8M A;  1ZC6 A;  2GUI A;  5AQZ A;  3WNE A;  4BQL A;  2NRR A;  3KLF A;  4FPB A;  4CJU A;  3K5N A;  2VWB A;  2ATQ A;  4C1N I;  3HRG A;  1YIJ N;  1K6Y A;  4DTU A;  3V1Q A;  4M7Y A;  2KFN A;  3J80 O;  5HP1 A;  4DF8 A;  3NBP A;  1OH8 A;  5DMR A;  4IOX A;  1VQ9 N;  3OYK A;  1TUY A;  3U3G A;  3LWM A;  3NGI A;  1NJZ A;  3F9K A;  4JLH A;  3KHY A;  4CJP A;  1S3X A;  3ZET A;  5A2Q O;  2A42 A;  3ZT3 A;  4JI2 K;  2R7Y A;  1V4S A;  2HHV A;  4BDZ A;  4LFC K;  3QEX A;  3E9P A;  1MWK A;  1VQL N;  2VWJ A;  1NK6 A;  5GAG P;  3VES A;  2YKM A;  1EWQ A;  2WON A;  3O4W A;  1SZ2 A;  4ICL A;  1E4G T;  3O9U A;  3OYH A;  4MFB A;  3UKU B;  2DFE A;  4IO9 L;  3LDP A;  4DSL A;  3Q7B A;  1VQP N;  3QIN A;  3AAP A;  4JRP A;  4H5T A;  4CF0 A;  2GTD A;  4KO0 A;  3L2R A;  1T44 A;  4DR5 K;  3EN9 A;  3P5J A;  3VA3 A;  3LAK A;  3N4P A;  2HOE A;  3ZEU A;  4O4G A;  3PX6 A;  4H4O A;  2HBK A;  3HOT A;  1Q81 O;  4XH5 A;  2B5J A;  4BRD A;  4CBW A;  4FJN A;  3TTC A;  1N36 K;  1DT9 A;  3VEZ A;  4CHO A;  4DTX A;  4KV8 A;  4DR7 K;  3QDK A;  2HNZ A;  3S3N A;  3BY5 A;  4NLB A;  3J81 O;  4FWM A;  5AQW A;  3PLA A;  1WAF A;  1YAG A;  4FLY A;  3R1X A;  3SQ1 A;  4CJQ A;  1HKG A;  3FZH A;  3RVC A;  4LH4 A;  3QES A;  5AQL A;  1IG8 A;  4H0O A;  3MAQ A;  4KAZ A;  1S1U A;  2FBV A;  3I0R A;  3THY A;  3CMA N;  3T1Y K;  3CET A;  2XO7 A;  4L8R B;  4CJW A;  1Q8I A;  1SKR A;  5CYM A;  1E3M A;  1XNQ K;  1L5U A;  2VG7 A;  3J7Z O;  3PUF A;  3OBY A;  5EX5 A;  5GAD P;  2RE2 A;  2JWL A;  4OPK A;  5GAH P;  5CE3 A;  4K0K K;  3QBX A;  5J1E A;  3HO1 A;  1UAX A;  3TAP A;  3DLK A;  3HBT A;  4GW6 A;  4YOY A;  3D2F A;  4LSL A;  3V6D A;  5C25 A;  3WEE A;  2HHH K;  1C1A A;  4LC9 B;  4B9N A;  4NCB A;  1GOB A;  4CJV A;  4B9L A;  2E1Y A;  1U6Z A;  4BR9 A;  4QCL A;  3NMU A;  5TKY A;  3OVN A;  2UUC K;  2HF4 A;  3TAQ A;  2O8F A;  3H1V X;  1VSI A;  1KXP A;  3HJF A;  4LSN A;  2ZJQ L;  2EX3 A;  4CF8 A;  2ZF5 O;  5J2N A;  1OKJ A;  4OVL A;  4B8A B;  4DWI A;  3WQT A;  3EZ5 A;  4FJI A;  3C94 A;  3G71 N;  3VEY A;  3OYE A;  1Y97 A;  3C6H A;  3SZ2 A;  5I3U A;  1QHT A;  4N47 A;  2VWK A;  3WNH A;  3S3O A;  3ZSY A;  4DV3 K;  2DTU A;  1BG3 A;  4HUG A;  3A2F A;  3HM9 A;  1T03 A;  4CF1 A;  2WUS A;  4DQS A;  2FSJ A;  2UUB K;  4IO8 A;  3KD1 E;  3PIO L;  2KZM A;  1YTU A;  1WNS A;  4KTW A;  4FJK A;  2HHQ A;  5JVG L;  4IOC L;  3KLH A;  3SMS A;  5EXW A;  3BP8 A;  1RT3 A;  2Q0U A;  3SYZ A;  1S9E A;  2XY7 A;  4CZJ A;  3GDQ A;  4CGF A;  1Y64 A;  1SKW A;  1NK4 A;  5EVZ A;  1JLF A;  1QVG M;  3THW B;  4DSE A;  4B3O A;  2WOM A;  2ITG A;  1S6Q A;  4CGG A;  4AQY K;  1SV5 A;  1R59 O;  3IS9 A;  3CJA A;  2P9N B;  4BVO A;  4NCG A;  4CFB A;  4JEP A;  4DU4 A;  3QO9 A;  4JKF A;  1HPM A;  4JKD A;  2Q2R A;  2QKK A;  4FJ9 A;  3T69 A;  4PQU A;  4CVN E;  1J53 A;  4QAG A;  4F3O A;  2OPQ A;  2PY5 A;  4C8K A;  1U04 A;  1RTI A;  1IKV A;  4FJH A;  3AO3 A;  4LF8 K;  2JGU A;  3CER A;  4JAX A;  5KQD A;  1QVF M;  2IOC A;  4JI8 K;  4Y1D A;  1YIT N;  1RT7 A;  3AGK A;  5DK5 A;  1U4B A;  1TYQ A;  3SLC A;  2HBL A;  3UE5 A;  1CXU A;  4IZ9 A;  2PFU A;  3E1Y A;  4MLH A;  1U49 A;  4W5O A;  2XHB A;  2ITM A;  3UB5 A;  4BE1 A;  3ZSX A;  1K9M O;  4CBU A;  4HCB A;  4FLW A;  2HBM A;  3IAY A;  2V52 B;  1GLC G;  2PBD A;  1NGF A;  3VQQ A;  2O8C A;  3L4I A;  1LW0 A;  4CGH A;  1QHA A;  1TV6 A;  3I56 N;  1FXX A;  1NGH A;  2BH1 A;  3CG7 A;  3MCA B;  1RFQ A;  4OPA A;  4WQ4 A;  1HRH A;  3A5O C;  3HST B;  3HPG A;  3DJC A;  3ZX3 A;  4B1U B;  3R8E A;  5AQU A;  1XMQ K;  3PV8 A;  5GIO A;  3OA9 A;  4O0I A;  3LP3 A;  1SAZ A;  1WSJ A;  2E1Z A;  1ATS A;  5AQX A;  3NFA A;  4CK1 A;  3VEW A;  4FWK A;  1Q86 O;  4FOI A;  4KKO A;  1ZYQ A;  4FJX A;  5FRN A;  1XUP O;  3DRP A;  3A8Y A;  3VEO A;  4IEE A;  2OZM A;  1W7A A;  1XC3 A;  2P9P B;  3DRS A;  4CZF A;  3NCI A;  3OS2 A;  1TK8 A;  1NJW A;  3OYB A;  1HKB A;  3RSE A;  4F8R A;  3HYF A;  4DS4 A;  2P9S B;  1WSF A;  1OH6 A;  4DV1 K;  5J2M A;  4AM6 A;  4FZX C;  3AVA A;  4CGJ A;  2NRV A;  4BR5 A;  1YT3 A;  3K9K A;  3TTF A;  4G1Q A;  3V4I A;  4FM2 A;  2JLE A;  4KPY A;  1BA1 A;  3AAQ A;  4FWP A;  1NOZ A;  1N6Q A;  4YOV A;  4BC3 A;  2Y1J A;  2W6K A;  3SBT A;  2IAJ A;  3O4N A;  4CZI A;  5C10 A;  3QEV A;  2WBN A;  4I9Q A;  2WC9 A;  2A6A A;  4ELV A;  4LFA K;  4H0T B;  4GVE A;  4DCH A;  1QSL A;  1VSE A;  1VSM A;  2QI2 A;  1DKG D;  2ASO A;  1TKZ A;  3RMB A;  1RDC A;  4I6M B;  3ZCM A;  3IMX A;  5BN8 A;  2Q36 A;  1NJI O;  2YKN A;  3FR0 A;  3QNO A;  1RDW X;  4JNE A;  3THV A;  1RCH A;  3THW A;  4IDK A;  5BRF A;  3QIO A;  3LZI A;  4W5T A;  4MDB A;  3FZF A;  5C15 A;  3NF9 A;  1BQN A;  4IWV A;  1VQK N;  4FLX A;  2YHX A;  1KRP A;  2IVO A;  3RRG A;  4CJT A;  5AQQ A;  1NLV A;  4DUY K;  2OA8 A;  3LWL A;  1RNH A;  4B3R K;  2H3G X;  3H08 A;  1KVC A;  4B1W B;  4ZTF A;  3WT0 A;  3ENH A;  3CPE A;  3CQX A;  4CHN A;  1K8K B;  4CZK A;  3TU5 A;  3SQ4 A;  1LW2 A;  1K8A O;  1IH7 A;  2KKZ A;  4IBN A;  2ZQB A;  4H0P A;  1REV A;  4BE2 A;  3CME N;  2IIR A;  3AVL A;  1WB9 A;  1B92 A;  3C6A A;  1HNI A;  4YOX A;  2FBT A;  2QWP A;  4DFJ A;  4BRN A;  4LH5 A;  1NKB A;  4CK2 A;  4BE0 A;  4RW4 A;  2DPN A;  4C8O A;  4BG8 A;  1J54 A;  1KFD A;  3LP1 A;  2CGK A;  5BPL A;  4C23 A;  1L3S A;  2D4W A;  1NBW A;  4NB4 A;  4IOA L;  4FWO A;  3ZSW A;  1D8Y A;  3PSI A;  4KTQ A;  3AO2 A;  4HCC A;  1HYV A;  4BGA A;  4CIE A;  2IDO A;  4GKK K;  4U67 L;  5D3G A;  4V19 S;  1NK0 A;  1XWL A;  4JHD A;  3CQ8 A;  3HZ6 A;  1VSF A;  4K8Z A;  4DTP A;  3GG4 A;  3CJ9 A;  2D0A A;  3LDQ A;  3CD6 N;  4OLB A;  3LDS A;  4PY5 A;  1HPZ A;  2UU9 K;  4J2D A;  4Y0W A;  1KAY A;  2EWS A;  4M41 A;  2W42 A; 
#chains in the Genus database with same CATH homology
 4A2A A;  3O4W A;  1SZ2 A;  1E4G T;  3C7N B;  4A5A A;  3O9U A;  3UKU B;  4BRQ A;  1NGE A;  3DAW A;  4CI6 A;  4IO9 L;  4BR2 A;  3LDP A;  3O5B A;  3D6R A;  3T7Z A;  3Q7B A;  5GIN A;  3CCV N;  4H5R A;  1VQP N;  4A62 A;  3AAP A;  5JVH L;  3AAR A;  3CJC A;  4H5T A;  3SAF A;  1G99 A;  2F9T A;  2A41 A;  2GTD A;  5JLH A;  5DM7 L;  4EHT A;  2W41 A;  1M1K O;  4A5B A;  1T44 A;  3ZX0 A;  1GLF O;  3EN9 A;  3LL3 A;  3P39 A;  3FGU A;  4CZE A;  3N4P A;  2HOE A;  3GOI A;  3WXM B;  3ZEU A;  2JWK A;  2NRW A;  3G4S N;  4MLE A;  2HBK A;  4K42 A;  1Z05 A;  4H0V B;  3HOT A;  2YI1 A;  1JCF A;  3MDQ A;  1Q81 O;  4XH5 A;  3VGK A;  5LJW A;  2KLA A;  1NGA A;  3VTH A;  4BRD A;  4BC4 A;  1QQO A;  1VQ8 N;  2F7T A;  4H03 B;  4CBW A;  3TTC A;  3KZB A;  4B1X B;  3LDL A;  3MMV A;  1E4F T;  4ISE A;  2UYT A;  1DT9 A;  2AP1 A;  3UKR B;  3VEZ A;  5ADX A;  2IVN A;  3ID6 A;  3TTD A;  3D2E B;  5EOY A;  1XQS C;  3QDK A;  3O6W A;  5BPM A;  1VQO N;  3NVK A;  2QTD A;  4NLB A;  1ILY A;  2P9S A;  5M1O A;  3OW2 M;  3MN9 A;  4FWM A;  3QFP A;  3DXK B;  5AQW A;  4BRK A;  1YAG A;  3TPQ A;  3PLA A;  5LJV A;  3DLL L;  2Q1N A;  3R1X A;  4A59 A;  4H5V A;  2Q97 A;  3ZYY X;  5AQN A;  4GV3 A;  1ATR A;  1HKG A;  3EE9 A;  3TSP A;  3FZH A;  3RVC A;  4BC5 A;  2I7P A;  5H1S Q;  4K43 A;  4WFN L;  1HLU A;  5AQL A;  1IG8 A;  1LCU A;  4H0O A;  1ATN A;  1ZBS A;  4GNI A;  1U2V B;  3WQU A;  4ILJ A;  3AGR A;  1GLJ O;  2ASM A;  1HJO A;  3O80 A;  5AQK A;  3W3D A;  3CMA N;  3R6M A;  3CET A;  5AQR A;  4CBX A;  2RHK A;  5AQP A;  4BRC A;  1MDU B;  3GL1 A;  4WQ5 C;  2P9N A;  2YHW A;  2NRX A;  3J7Z O;  3VGL A;  3OBY A;  2D0O A;  2ZWH A;  4JK7 A;  5EX5 A;  1NGI A;  3U9Z A;  5F0X A;  5GAD P;  2RE2 A;  2JWL A;  4XH1 A;  3F5T A;  3WUH A;  4C1N K;  5GAH P;  2GWK A;  5HL7 L;  2CH5 A;  4FO0 A;  5CE3 A;  3QBX A;  4JD2 A;  2P9K B;  3M3Z A;  3MN5 A;  3M1F A;  4PL8 A;  4E1J A;  3C65 A;  3HBT A;  3BF3 A;  5ADX H;  1P90 A;  3KWG A;  4YOY A;  3D2F A;  1KD1 O;  2D1K A;  5EY4 A;  3WEE A;  5BR9 A;  4FWS A;  4OPH A;  3CCS N;  3MN6 A;  3MCP A;  4LC9 B;  4GV6 A;  1QZ6 A;  3KWI A;  3P38 A;  4JKG B;  2V7Z A;  1WOQ A;  1HX1 A;  1KAZ A;  4JHD B;  1C0G A;  2NRH A;  2E1Y A;  1U6Z A;  4BR9 A;  4CZL A;  5AQS A;  5JMV A;  1T3V A;  3H45 C;  3OBW A;  3NMU A;  5TKY A;  4JKC A;  4IFE A;  4BR7 A;  3DWL A;  2HF4 A;  4FWL A;  1BOT O;  1RGI A;  4B1V A;  4IJN A;  5AQI A;  3H1V X;  4B1Y B;  5AFU A;  3TSQ A;  3HTV A;  1KXP A;  3D7E O;  3IFR A;  2F9W A;  2NRZ A;  1YUW A;  3HI0 A;  2ZJQ L;  5AQV A;  5M1P A;  5LY3 A;  4DHY A;  2ASP A;  2FLO A;  2ZF5 O;  4BR4 A;  3F2K A;  1YVN A;  4YOT A;  1OKJ A;  2FF3 B;  1M90 O;  2QM1 A;  3WQT A;  4NO7 A;  4YOR A;  3MWP A;  4QS8 A;  3G71 N;  3O1B A;  3VEY A;  3EZW A;  3C6H A;  1NM1 A;  1GLD G;  3ULE A;  5CR4 A;  3VF6 A;  3VTI A;  1Z6R A;  3ZEU B;  1BG3 A;  2QWQ A;  4M63 C;  4FWR A;  1NGG A;  1BWF O;  4RWT A;  4U7B A;  2V51 B;  2E2N A;  2QXL A;  3M5R A;  2ZGZ A;  2WUS A;  1QQN A;  3GE1 A;  2QEX N;  2FSJ A;  1O13 A;  4M7X A;  3FZK A;  4IO8 A;  3VF4 A;  5M1N A;  5BN9 A;  3PIO L;  3CC2 N;  4WQ5 A;  3IKM A;  4A2B A;  2QWM A;  1BUP A;  3LDO A;  2P9U B;  3CPW M;  3FZM A;  1X9J A;  4OO1 J;  2OTL N;  5JVG L;  4IOC L;  3HSC A;  5C12 A;  3SMS A;  5EXW A;  3BP8 A;  4IEI A;  2Q0U A;  4WFA L;  2AA4 A;  1MA9 B;  2GEL A;  4CZJ A;  1K73 O;  2OTJ N;  2P9L A;  3GDQ A;  1NGB A;  3ATU A;  1EO1 A;  1Y64 A;  4IJA A;  3CXC M;  5EVZ A;  3EO3 A;  3CC7 N;  3CQY A;  4WQ4 C;  1QVG M;  5TKW A;  5KPR A;  2YJE A;  4BRI A;  2P9P A;  4EHU A;  1VQ7 N;  5AQH A;  4YOW A;  5AQM A;  4BY9 C;  3I33 A;  1R59 O;  2P9I A;  1VQ5 N;  3CJA A;  4FWN A;  3JS6 A;  4BQZ A;  3KVG A;  2P9N B;  4BC2 A;  4BVO A;  4PKI A;  1SQK A;  2A3Z A;  4JEP A;  3VPZ A;  4HTL A;  2QA4 N;  2Q0R A;  1HPM A;  4JKF A;  3MK6 A;  4JKD A;  2Q2R A;  4H0X B;  3CC4 N;  4R79 A;  3ENO A;  3T69 A;  3J8A A;  2E20 A;  5M1K A;  4YDU C;  2Q31 A;  4J8F A;  3E66 A;  4GY2 B;  5BRH A;  3EKS A;  2GEM A;  3DXM A;  3I55 N;  5AR0 A;  4BRO A;  3QFU A;  4K25 A;  3CER A;  4JAX A;  3O08 A;  5JIC A;  5KQD A;  1QVF M;  3ZX2 A;  1S22 A;  3K9J A;  5AQY A;  1NGC A;  1YIT N;  1VQM N;  3AGK A;  2FSK A;  1TYQ A;  3SLC A;  5AQT A;  4FL9 A;  3S41 A;  5B8H A;  2FSN A;  1NMD A;  2HBL A;  2YJF A;  5BRD A;  4KH4 A;  3N4Q A;  3G6E N;  5JLF A;  3D2E A;  3UE5 A;  3E9O A;  4IZ9 A;  1YI2 N;  2IVP A;  2PFU A;  3L4Q A;  3E1Y A;  3TSU A;  4MLH A;  3H3N O;  3HM8 A;  2ZJP L;  3CJB A;  3MN7 A;  3VEV A;  1CZA N;  3L6Q A;  1ZXO A;  2YCH A;  2ITM A;  4I6M A;  3UB5 A;  4A57 A;  3ZET B;  3A5M C;  1SS6 A;  4CBU A;  1K9M O;  1GLL O;  3CHW A;  2HBM A;  4DKW A;  3ID8 A;  3SJH A;  2GUP A;  3FFK B;  4JKE A;  4BRM A;  2V52 B;  3GBT A;  3IDH A;  4BVP A;  1GLC G;  4WFB L;  4O5F A;  2FXU A;  2PBD A;  4XH4 A;  1NGF A;  2NRT A;  5AZI A;  2YX6 A;  5AZJ A;  1W2B M;  2GWJ A;  4BRP A;  3A0I X;  3SAG A;  3L4I A;  5KPZ A;  4MDA A;  4NLC A;  3U4L A;  4PHT X;  3Q7C A;  1QHA A;  3ULE B;  3I56 N;  1J6Z A;  5AQJ A;  1BA0 A;  2VCP A;  1NGH A;  2BH1 A;  4FOE A;  1VQN N;  3QIC A;  3U9D A;  1D4X A;  3WXK A;  4EFH A;  3CIP A;  3MCA B;  1T6D A;  1RFQ A;  1HUX A;  4OPA A;  4WQ4 A;  2CGJ A;  4EAH D;  2V7Y A;  3BUZ B;  3A5O C;  3O9Q A;  5FPM A;  4FPA A;  3DJC A;  5CHI A;  3ZX3 A;  3CCE N;  2CGL A;  1K8K A;  4MO5 A;  4ILG B;  4B1U B;  3R8E A;  4CZH A;  5AQU A;  1P8Z A;  4IXC A;  4H0Y B;  1X3N A;  4H5N A;  1KQS M;  4JK8 A;  4RTF D;  2BUP A;  1NWK A;  5GIO A;  2ZGY A;  3CJ7 A;  4F9O A;  2FF6 A;  3OA9 A;  5I9E B;  3HOS A;  5C0Y A;  4ISG A;  1SAZ A;  4BRE A;  2E1Z A;  4BRF A;  2QWR A;  4WF9 L;  2E2P A;  2QWO A;  1ATS A;  1QZ5 A;  2W40 A;  4DB3 A;  3VF2 A;  3CF5 L;  3VMF B;  5AQX A;  5F1X A;  4RCH A;  3CCR N;  2P9L B;  3JXU A;  4FWK A;  3VEW A;  1Q86 O;  3L0Q A;  1OVY A;  2A40 A;  4FOI A;  3CCJ N;  4GV9 A;  3QML A;  2J4R A;  4B9Q A;  1XUP O;  4ISF A;  3VEO A;  3A8Y A;  3O9S A;  3H46 O;  4H5W A;  2VGN A;  4IEE A;  2VGM A;  3B8A X;  1XC3 A;  2P9P B;  3E9L A;  4CZF A;  2QW9 A;  4B1Z A;  4AM7 A;  1HKB A;  1MWM A;  4FVU A;  1TUU A;  3LM9 A;  4PKG A;  3RSE A;  5E26 A;  5AFU H;  4ILH A;  2P9I B;  2P9S B;  3VEX A;  1DEJ A;  3BF1 A;  2E2O A;  3SK3 A;  3O9T A;  4AM6 A;  4CD1 A;  4PKH A;  1GLB G;  1YF5 L;  3CI5 A;  1WUA A;  3H1Q A;  4BRH A;  5GAE P;  4JKH A;  2NRV A;  3KK7 A;  2A5X A;  3H3O B;  4BR5 A;  3K9K A;  3TTF A;  3A5N C;  3R3L A;  5BPN A;  1Q82 O;  3FLC O;  5AQF A;  1YJW N;  3SMP A;  3SBG A;  1YJN N;  2QWN A;  1BA1 A;  3AAQ A;  3DXM B;  3VER A;  4BR0 A;  4FWP A;  1BDG A;  4UY8 O;  3FZL A;  3VOV A;  1GLA G;  4PL7 A;  4BG9 A;  1VQ4 N;  1ESV A;  1Q18 A;  3C7N A;  4XEI A;  3VET A;  4CZM A;  3LDN A;  1BU6 O;  3UKU A;  4YOV A;  4HWI A;  4BC3 A;  5GIP A;  2D0P A;  3SBT A;  1X3M A;  3IUC A;  1QQM A;  2VYP A;  3SAH A;  1NGD A;  4CZI A;  5C10 A;  4L3Q A;  2WBN A;  3LM2 A;  1TYQ B;  5M1Q A;  3VGM A;  1YXQ A;  2WC9 A;  4BRA A;  4JN4 A;  1HKC A;  3QB0 A;  2ZJR L;  5FPE A;  3R9P A;  4JD2 B;  4QS9 A;  5HOO A;  1W97 L;  2A6A A;  5C2D A;  4BRG A;  4H0T B;  3EL2 A;  2P9U A;  4GVE A;  5F2R A;  4WYB A;  4DCH A;  3CCU N;  4O8K A;  1VAZ A;  2NLX A;  3D2F B;  3EE8 A;  2NNW A;  3WXL A;  4EIA A;  3WEE B;  2QI2 A;  3BEX A;  5E84 A;  1DKG D;  5AQO A;  2ASO A;  3MWT A;  3P31 A;  4AF1 A;  3VEN A;  3MX2 A;  2WFB A;  4I6M B;  2YHY A;  1T6C A;  3IMX A;  3O1W A;  3CCL N;  5BN8 A;  2Q36 A;  1NJI O;  3ENB A;  3FR0 A;  3G25 A;  1RDW X;  4JNE A;  4KH5 A;  4Z94 A;  1JJ2 M;  1EQY A;  5BRF A;  5AZJ B;  3UKR A;  5AZI B;  4MDB A;  3FZF A;  5C15 A;  5C2F A;  5KQ8 A;  4BRL A;  4IWV A;  4A61 A;  1VQK N;  3O9R A;  2YHX A;  1V4T A;  3EKU A;  2IVO A;  2QWL A;  1GLE G;  5FPN A;  3MX5 A;  5AQQ A;  1NLV A;  4CJ7 A;  3DXK A;  3I8B A;  4DQ8 A;  5FPD A;  1YJ9 N;  2E8A A;  2H3G X;  1KC8 O;  3W0L A;  2CH6 A;  1C0F A;  5M1F A;  4B1W B;  2OAN A;  3ENH A;  3WT0 A;  3P4I A;  4CD3 A;  3CPE A;  4BGB A;  3CQX A;  3NVM A;  1K8K B;  1U2V A;  5AQG A;  4CZK A;  2HBJ A;  3TU5 A;  1Q7Y O;  4KH6 A;  3A5L C;  4CZG A;  1K8A O;  2KKZ A;  3M6G A;  2BTF A;  3CCQ N;  4H0P A;  3O8M A;  4QS7 A;  1ZC6 A;  4K41 A;  3ATV A;  4MO4 A;  5AQZ A;  4O8U A;  1KAX A;  1S72 N;  4WCE L;  3CME N;  2IIR A;  4BQL A;  2NRR A;  4FSV A;  3C6A A;  4YOX A;  2QWP A;  4FPB A;  1JCG A;  4BRN A;  1LOT B;  1BO5 O;  4FWQ A;  2DPN A;  2VWB A;  4BG8 A;  2GX9 A;  3HRG A;  4C1N I;  4G9Z A;  1YIJ N;  3AY9 A;  2CGK A;  5BPL A;  4C23 A;  2HF3 A;  5KPT A;  4M7Y A;  2D4W A;  1NBW A;  4NB4 A;  2P9K A;  4JKB A;  2HST A;  4IOA L;  5DM6 L;  3PIP L;  2I7N A;  4FWO A;  1IJJ A;  3WXJ A;  2NZT A;  5MLC Q;  4IDH A;  3CJ1 A;  4IOX A;  1VQ9 N;  2E2Q A;  4BGA A;  1N8R O;  4YOU A;  1TUY A;  3U8X A;  3RSE B;  5BRE A;  3F9M A;  1YHQ N;  3KHY A;  4U67 L;  1DGK N;  1S3X A;  3ZET A;  5ELZ A;  2A42 A;  4JKG A;  1RDU A;  4JK9 A;  2HMP A;  3FE1 A;  4JHD A;  3HZ6 A;  1JCE A;  4YDU A;  3QBW A;  1V4S A;  3GG4 A;  1H1V A;  4KBO A;  1VQ6 N;  3C0B A;  2E88 A;  2KHO A;  2PAV A;  1NGJ A;  3CJ9 A;  3LDQ A;  3CCM N;  3H6E A;  3CD6 N;  3OHR A;  4JKA A;  3E9P A;  1MWK A;  1VQL N;  5GAG P;  3VES A;  4Y0W A;  3WXI A;  1KAY A;  2EWS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...