4O8UA

Structure of pf2046
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
227
structure length
227
Chain Sequence
b'SRIVAADTGGAVLDETFEPIGLIATVAVLVEKPYRSAKEVMVKYANPYDYDLTGRQAIRDEVLLAIELARKVKPDVIHLDSTLGGIELRKLDEPTIDALGISDKGKEVWKELSKDLQPLARKFWEETNIEIVAIGKSSVPVRIAEIYAGIYSAKWGIENVEKEGHLIIGLPRYMEVNIKDGKIIGRSLDPREGGLYGSAEVSVPEGVKWEIYPNPVARRFMIFEIFS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein PF2046
publication title Crystal structure of a novel non-Pfam protein PF2046 solved using low resolution B-factor sharpening and multi-crystal averaging methods
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Unknown function
total genus 57
structure length 227
sequence length 227
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2013-12-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.440 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4o8uA00
4YOYA 4YOXA 4YORA 4YOWA 4YOTA 5CHIA 4O8UA 4YOUA 4YOVA
chains in the Genus database with same CATH superfamily
2Z1GA 3AVCA 2YNIA 3O6WA 5AQXA 4F2RA 2UUAK 2QWOA 2YHXA 4JKDA 5F0XA 3FR0A 1EP4A 2ZM6K 4DR5K 3VF4A 1VQPN 4CD1A 1YVNA 2OTJN 4JEPA 1J5OA 3PUFA 4EZ9A 3QMLA 3ZSRA 4BREA 4B8AB 1QSLA 2ATQA 4C1NK 3MN5A 1ATSA 4BRIA 1VQ9N 1FXXA 3F73A 1JKHA 1HYVA 5E41A 4AILC 2P9SB 1EWQA 1N36K 2F8SA 4E1MA 3O9QA 4RCHA 4WCEL 5BPMA 1MU2A 4BRDA 4OPJA 5AQNA 4C8NA 4CEEA 3BP8A 4L8RB 4XH5A 4I6MB 3TR8A 4KRFA 4DUYK 4YHHK 4O55A 4CJEA 1X3MA 2CH5A 1A5XA 4CF2A 1SS6A 2WTUA 1ILYA 2F9TA 3H3NO 1K8KA 3NH1A 1XWLA 3SQ1A 2HHVA 2B5JA 3FZKA 4C8MA 3HOSA 4EHUA 3THYB 1TV6A 5T7BA 1TUYA 2UUCK 1RT2A 3T1YK 5M1PA 4JI0K 2HB5A 4M63C 2W42A 1NJYA 1RBVA 3O4WA 3ZETB 1IG8A 2X78A 1D9DA 2VYPA 3DRSA 1ZBUA 2GUIA 4H5NA 1A5VA 5FPNA 1TKDA 1SZ2A 4EHTA 3SUPA 4IJNA 1NGHA 3MWPA 3NF9A 4EIAA 3TAGA 3U3YA 4LF7K 4KH4A 1WSGA 4IXCA 1FJGK 4CVNE 2A42A 3QINA 4ELUA 3M3ZA 5K14A 3BY5A 1BA1A 3VOVA 3CM6A 4CJ7A 4NYNA 5FRMA 4LSLA 5EX5A 3CCVN 2OPPA 4IEEA 3UKUB 3OYFA 5DM7L 1DTTA 3DXKA 2FC0A 5AQYA 3HPGA 3AVAA 3WNGA 4CEQA 4FZYA 4DUZK 3D2EA 4CZIA 4CZMA 3S3NA 5LMUK 3ZSXA 1NKBA 1I94K 3O9RA 2P9NB 3SCXA 4WQ5C 5HRNA 4L3QA 1X3NA 3FE1A 4A5AA 2QKBA 2FLOA 1E3MA 4LFAK 3HL8A 2WBNA 1NGCA 4K41A 4M41A 1RBTA 4FWLA 3ZX0A 1J6ZA 2O8CA 3U9ZA 3FFKB 5JS2A 2O8EB 2YNHA 3WNHA 4CJLA 4ZHRA 1QHAA 1QZ6A 4BRAA 5J2MA 4CEBA 4JI1K 1CZAN 2NRWA 2P9IA 4FLYA 3O3HA 4KB1A 1IG9A 1BI4A 3UKRA 5F1XA 4BRQA 1RDBA 3V6DA 3QICA 2JLEA 3KD5E 4JI4K 3AA5X 5KRSA 5M1FA 4B3OA 1ZBLA 1YAGA 1JCFA 1XC9A 2WUSA 5I9EB 2GWJA 1WSJA 1JXBA 1RBUA 3CFOA 4Z0UA 4QS8A 3A8YA 1RGIA 1BU6O 3A2FA 3C6TA 1NGEA 3SBTA 5ADXH 3KJVA 3E01A 1C6VA 4I9LA 2A6AA 4DQIA 2F9WA 4JNEA 3OYEA 3J8AA 2E2NA 3PSFA 2HHQA 4C8OA 4E7LA 3QEIA 4DSEA 4CJTA 3SJHA 4NXMK 3QEPA 4WE1A 2QWRA 1RBSA 5AQSA 4BRFA 4IOXA 3AVLA 2OPQA 4NCBA 1NNEA 4A2BA 5C15A 3L4QA 2ZGYA 2RN2A 4KI4A 1BWFO 4CIGA 2VG6A 4HUGA 3WXJA 5HBMA 4DS5A 2H3GX 3WQUA 2HBJA 3V9XA 2Q36A 3PV8A 4FWSA 3BZKA 3VGLA 4A61A 2HMPA 4DTMA 1U45A 4PY5A 4ID1A 5C0YA 2VG7A 4DTNA 3KLFA 4PL7A 3KTQA 3RSEB 3QNNA 2PFUA 4NCAA 1E4GT 2HHUA 4CF8A 2HHSA 1U47A 2CGKA 4FK4A 5AQIA 4CZFA 2VQEK 4FJ8A 2PBDA 4DSKA 3D2FB 4J2DA 4CD3A 1HUXA 1U4BA 2QXLA 4AHSA 3TAMA 4AHCA 1Q8IA 4W5RA 1NOZA 5JVGL 4ZTJA 1C0MA 4KAZA 4J2AA 1HMVA 4DKWA 1IJJA 2Q1NA 3D2EB 3WNFA 4V19S 3LDLA 1BUPA 2HNZA 3GBTA 4BVPA 3H45C 3HT3A 4CCHA 1RTJA 3DLRA 2UYTA 3OA9A 1UWBA 4LF9K 1LAWA 3OYGA 3ZEUA 1N8RO 4CHNA 4O44A 3LDQA 3DYAA 4QS9A 1VSKA 1TVRA 1ZBHA 1VQ8N 3ULDA 3CC4N 1K6YA 3LPUA 4GNIA 4CBWA 3IFRA 1SL0A 4BR0A 4W5NA 1HJOA 2E5LK 3O3GA 1O1WA 2XY8A 4AHRA 1W0HA 3C95A 3DXMB 3O80A 1KD1O 3VTIA 4CJRA 1N34K 3CCRN 3EZWA 4FWNA 2KHOA 4B9VA 4FJHA 2P9KB 4IO9L 1NM1A 4FPAA 1SAZA 1T6DA 3NCIA 3LAMA 4B1YB 4CEOA 2G8HA 2G8KA 3NHGA 4DV4K 2O8BB 3NH2A 5AQZA 1KAYA 4YDUC 1S72N 3TSPA 3VEXA 1L3SA 1S22A 3NMUA 2P5GA 3L3VA 5EVZA 4U7BA 2KFNA 3FZHA 1RDCA 3FZMA 1GLCG 4CZEA 1XC3A 3K2PA 3AAQA 1SV5A 5FPMA 3OJUA 5BRFA 5C12A 1HX1A 3QEXA 1S9GA 1JLQA 3HPHA 4FWMA 2NNWA 4FLUA 3FGUA 3LP1A 1V4TA 5ELZA 3MWTA 2IDOA 2I7NA 2NRVA 3NVMA 4H4MA 4BG9A 4ISGA 4DCHA 4BR9A 1IKVA 1RDWX 1X1PA 3ZT3A 4CJ4A 2A40A 1NGDA 1D5AA 2W6LA 2YHAA 3U8XA 3VEVA 1UA0A 1NK9A 1V4SA 4QCLA 4DV5K 4M42A 1B9DA 1BOTO 1QTMA 3K5NA 1S1VA 1NK0A 4IG3A 4B9UA 4KHYA 3QIPA 3E9PA 1RTIA 4X65K 3D7EO 3VQ9A 3CCUN 1Q86O 3SYZA 1ZBIA 4BG8A 2XY7A 3TWHA 1QQNA 4NLCA 2FF6A 2FXUA 4F9OA 3CMEN 4EP5A 3QLHA 5KPRA 2OCEA 3C0BA 2ZJQL 1RNHA 1WLJA 4IZ9A 3V9UA 4NLBA 2YHBA 5C2FA 3JYTA 5KGWA 4BROA 4DFMA 1S5JA 4MO5A 5AQJA 1CZ9A 3SV4A 3VQAA 4IEIA 1HQEA 3ZEUB 2ZJRL 3OYNA 3H1VX 2D0CA 3LALA 1HPMA 1ESVA 4RG8A 1WAFA 3KKSA 3MMVA 1SKRA 4K25A 2DY4A 4KHUA 5M1NA 5AZJA 4KFBA 3AO3A 1EKEA 4H8KA 4KHSA 3EE8A 5AQHA 1WN7A 4H0VB 5FDLA 4JK7A 1TUUA 3SZ2A 2QA4N 1SKWA 3TTCA 1VSFA 1W9HA 4IFVA 4ILHA 4FWOA 1GOAA 3AVHA 1Q82O 2P9UA 3CG7A 4BC5A 3ZT2A 5CY4A 3WXIA 3LZIA 1RCHA 4B1XB 3AGRA 3O9UA 4HHTA 4DQRA 3S3OA 4DTXA 5HLFA 3OTOK 4AQYK 1JLBA 3QFUA 1O13A 4F8RA 3AO5A 2BH1A 4CIFA 2XO7A 5GIOA 3G6EN 4NYFA 3ENBA 4ILJA 3ID8A 1B9FA 4M3UA 3EKUA 4DSIA 1BCMA 4AF1A 3RMCA 3WEEB 4OPAA 3MXJA 3ZX3A 1BGXT 3M1FA 1BIUA 1JL2A 4DSLA 3AO1A 4FJ5A 1BDGA 2ZQBA 3MEGA 3AAPA 5AQRA 1RT6A 4JI3K 4OLBA 3IRXA 3DM2A 5HP1A 2QWLA 4R5PA 4RW8A 4AHUA 3M5RA 4YOTA 3M8QA 1KVCA 3AVGA 4DTPA 3G4SN 3DLBA 3PO4A 1VSHA 4Z4FA 1XQSC 5LMNK 2QWMA 1NGBA 1WNSA 1UAXA 3MECA 1T44A 2PYJA 5A2QO 2PZSA 3L0QA 4N76A 1RT5A 3DI6A 1HRHA 1KSPA 4EZ6A 2KW4A 3RMDA 5KQ8A 5F2RA 3MXMA 1ITGA 1J54A 5KQDA 4O8KA 3DOKA 4OKJA 4DLGA 2B4JA 4J8FA 4BC2A 4B3MK 1SL1A 4O5BA 4JHDB 2IOCA 4DFKA 3CFPA 5AQFA 4OPKA 3MN7A 1VSJA 2D1KA 3FFIA 5BRHA 1SKSA 1NLVA 4RWTA 1KTQA 1MWMA 3O1BA 2HHWA 1P90A 3VEWA 4YOWA 1U49A 1IV0A 3KLEA 3CCEN 4JK9A 4K43A 3EEQA 1DTQA 4HVJA 2QK9A 1VSIA 4IO8A 1TKXA 3AA3A 4JD2B 5GIPA 3C7NA 4FWRA 4RW7A 3DOLA 3TAQA 3ZYYX 2D5RA 4RW6A 1ASVA 3VERA 1JLGA 4DTJA 3P38A 2UU9K 1LWEA 3GE1A 5JLFA 2AP1A 4K42A 3PLAA 1ZBFA 3HYFA 4KTZA 4BE0A 4KV8A 2GUPA 4GV9A 5EU7A 5CYQA 4CHZA 2R7YA 1HYSA 2KTQA 2DPNA 4JAXA 3IAYA 3AVKA 3WNEA 4N56A 3H08A 3OYLA 3HPOA 3VQQA 4EFHA 4CF1A 1TL1A 2Z1IA 2KLAA 4BRKA 2CGJA 3EZ5A 2XY6A 3TSQA 1BIZA 3JS6A 4CI6A 4FWPA 2V51B 4EAHD 4WF9L 3PIOL 4JKGA 4DSFA 3VQDA 3EN9A 3KLHA 3UE5A 2BGGA 3AO2A 3O9TA 2G8UA 2QEXN 3BF3A 4WQ4A 4GV6A 2UXBK 4W5TA 2FF3B 4DV2K 3BF1A 4U67L 4JI7K 2GTDA 4E7IA 3KWGA 2IVOA 4KHWA 1KAXA 2FBVA 3ATVA 1VQ7N 4DR1K 2GX9A 3KWIA 5BREA 1X9SA 3GL1A 1OH5A 5ADXA 5GAGP 4ISFA 3ZSYA 4QOZB 3EY1A 1RT1A 4KHNA 4HTUA 2KQ2A 3CQYA 1ATNA 4CJKA 3B6OA 1VAZA 3L2QA 1Q9XA 1BQMA 2E1ZA 5D3GA 3NE6A 3AVNA 5EOYA 3ID6A 4HTLA 2UUBK 2IVNA 3CCJN 3NGIA 3G25A 1JCEA 1LAVA 1Z26A 4BQZA 1UOCA 2A1RA 4GKJK 1YTAA 3WT0A 2O8FA 3AA4A 4FJ9A 2RE2A 5KRTA 3CI5A 2YHWA 3C94A 3ZSVA 3H6EA 3O8MA 4FZXC 4Z4GA 2YCHA 4AHVA 4YY3K 3D45A 3QBXA 4H5RA 5BPLA 4FJNA 4IFYA 2ZF5O 4EP4A 3SQ4A 3OW2M 3C7NB 3VTHA 3K0SA 2P9PB 1KVBA 4FSVA 4YFUA 5JICA 1XI1A 3BZCA 4FJ7A 1NMDA 4B1WB 3DLLL 3BUZB 4RW9A 4Y1CA 3BDPA 4H4OA 1VQ6N 1GLLO 3MEEA 3L2UA 1VSLA 1C0UA 4KTWA 2P5OA 4YOXA 3FLCO 4PWDA 4ID5A 3VQ8A 4CFDA 4CF9A 4JS5A 3S3MA 1RT7A 4OX9K 4IJAA 3DJCA 4AM7A 3THWA 3HTVA 3OS1A 5SZTA 4I2PA 1F21A 2V52B 5BN8A 4FVUA 3L2VA 1J5EK 3CYMA 4CBUA 5FLXO 1JLFA 3ITHA 4BR7A 4FOEA 1LWCA 2W41A 1G15A 2DFHA 5AQLA 2KFZA 3MCPA 3RR7A 4UY8O 1T03A 2HNDA 4E1NA 3FZFA 4CERA 4F3TA 3U9DA 1QSYA 1K9MO 5FRNA 1HKCA 4RTFD 1T6CA 4C8KA 2BE2A 4DWIA 1DT9A 1HLUA 1K8KB 4DV1K 3LP2A 3VF2A 3KK1A 4H0PA 3NF6A 3NVKA 1X9JA 1DGKN 4O5FA 4LH5A 4BRMA 1GLBG 1S9EA 4H5TA 4E7KA 5JMVA 2Q3SA 1HQUA 3O4QA 3TANA 5M1OA 4LFBK 2PY5A 3CM5A 3Q7BA 3WUHA 4ILGB 3ENOA 1S1XA 3I0RA 3VENA 3AVBA 1EXQA 3TAEA 2O8DA 4H0OA 4BRPA 4G1QA 3K5LA 4HWIA 5DM6L 3DRRA 3LDNA 4QS7A 3NDKA 2E6LA 2RKIA 4FYDA 2F96A 4IOAL 1GLAG 3IKMA 3L6QA 4FO0A 3TABA 1W7AA 2ZE2A 5LJVA 5J2PA 4CEAA 4CF0A 3R1XA 3S9HA 5EY4A 4IDKA 1WBBA 1W2BM 3P39A 3DLHA 3DXKB 3AY9A 3OS0A 4CGDA 4E3SA 3N4PA 1CXUA 3AVMA 1WSEA 2HBKA 4H0YB 4A57A 4DTUA 2YV0X 2Z1JA 1NGIA 3FZLA 1OH6A 4LF8K 4B9SA 4LF5K 4JLHA 3L4IA 3O5BA 3AO4A 1XNQK 4H5VA 4JK8A 4BDPA 4FJMA 4CE9A 3ZLJA 3HVRA 3OJSA 1EX4A 3WXLA 4WFBL 2O8CB 2I7PA 3LWLA 3RWUA 4WFAL 3OYAA 4AH9A 4BWMA 2G8FA 2KZZA 5BRDA 1YJWN 4CZGA 4CGFA 2P9IB 4YOVA 2Y1IA 5DK5A 1P8ZA 1XMQK 3HSTB 4MFBA 2ETJA 3THWB 1BI4B 3UKRB 3ASMA 4FK2A 2P1JA 4ELTA 5C10A 1RDAA 4FJGA 1OH8A 1KCFA 4LF4K 3ZT4A 1K73O 4N5SA 2HBMA 4JKHA 4K8ZA 1VQKN 3HVTA 5JVHL 4YORA 1TYQA 1IBKK 4W5OA 1YJNN 3EYZA 2QM1A 3CJ1A 4BRLA 3LWMA 4E7HA 4DQQA 1BQNA 1LOTB 3E66A 3CETA 5J1EA 2A5XA 1WUAA 3LDOA 1NK6A 4Y0WA 4CBXA 3SMSA 3G71N 2VG5A 3MK6A 1BG3A 2HHTA 2BDPA 3AVFA 2FSJA 3CC2N 4ISEA 3TTDA 2FBYA 1DEJA 3J7AP 4CGJA 1VQMN 4A5BA 2JGUA 2ZD1A 3VESA 4GY2B 2YKMA 3DAWA 3IUCA 1RT3A 1TAQA 1XMOK 1FKPA 1LWFA 1NK5A 1C1AA 1D8YA 4CFBA 3CQ8A 3SI6A 5HL7L 3SQ2A 1NK8A 2J4RA 3CJBA 1CZBA 4FLXA 3V9SA 2HVIA 2Q0UA 1D9FA 3B8AX 4CJSA 4BGBA 4FPBA 3NF8A 4CHPA 4DR2K 1IKWA 1DLOA 3VQBA 1YT3A 3DWLA 1RTDA 2HHHK 3MX2A 3KVGA 3C6UA 3O4NA 1QSSA 2Z1HA 4JI2K 4W5QA 3CMAN 4KKOA 2HMIA 3SV3A 3C6AA 2UXDK 4M3ZA 1VQ4N 4M3WA 1SQKA 4DR7K 3DLKA 3KLGA 3LAKA 4GW6A 4Q0BA 3ZSQA 4YOUA 2ZGZA 4GMJB 3KD1E 3F9KA 3A5OC 3NH0A 2GEMA 4CECA 4DF4A 1JCGA 1HYZA 3VQ6A 3OYBA 1ZYQA 4J2BA 1QS4A 4TSXA 4BDZA 5KI6A 3VPZA 2W6KA 3I8BA 4Y1DA 1TK8A 1HNWK 4Z4EA 1YVUA 4WQ5A 1NOYA 5AZIA 4FOIA 3R3LA 4NO7A 3CPEA 5AQKA 1U04A 2OANA 4CHYA 3HZ6A 4BQLA 2VGNA 4CJVA 3VETA 5GADP 4LD0A 1YHQN 3CXCM 1KRPA 3TARA 3CC7N 2EX3A 4LFCK 4I9QA 2XY5A 4RW4A 3NF7A 1M1KO 3HRGA 4CGIA 1GLDG 1LW0A 3VF6A 1Z05A 2A1SA 4JRPA 4DR4K 1Z25A 3OS2A 3I55N 3CF5L 1LW2A 3OYHA 4DSJA 1HNVA 3HM8A 1YF5L 4CW7B 5J2QA 4B9QA 3V1OA 1T05A 2GWKA 1R59O 5AQVA 3R6MA 3HI0A 4BACA 3T3FA 4CHQA 1NK7A 1DKGD 1S3XA 1VSEA 2YKNA 4Z4HA 2Y1JA 2QWNA 3THXA 4BDYA 2QI2A 1IBLK 3OY9A 3TSUA 4WFNL 3PY8A 1YIJN 4B9NA 2P9SA 3SLCA 4DTOA 1VRTA 2HF3A 4KHQA 3SMPA 4BR4A 1KAZA 2X74A 3V4IA 3QERA 1WSIA 2RHKA 2XRIA 4JV5K 4B3TK 3K9JA 1X9MA 4A2AA 4DFJA 3KK2A 3E9OA 4DV3K 4BRGA 1KC8O 1T3VA 3DMJA 1GLFO 1IKXA 2FBTA 1U2VA 4O8UA 4PUOA 1RDUA 4CJPA 5I42A 4DMNA 1E4FT 3U6FA 4FVMA 3THYA 3O08A 5AJ3K 4FW2A 5BN9A 2ITMA 3SAGA 3SQ0A 1GOCA 3HSCA 4FK0A 1J53A 2EHGA 3TTFA 2BANA 4CK3A 3PO5A 4CJ5A 3C6HA 3J7YP 4PKHA 3OYIA 2ZJPL 1GLJO 2NRRA 2D0PA 3T69A 1L3UA 3PX0A 4AM6A 2W40A 3QO9A 4FLWA 1KXPA 1GOBA 1LCUA 3OYJA 4LY7A 1RFQA 2JWLA 3IG1A 1OVQA 3QNOA 2XHBA 1U48A 5IT9O 2A41A 4CK2A 5FPDA 3CFRA 5HRRA 3RTVA 4PKIA 2YJEA 4BE1A 2P9LA 3VA0A 3L2RA 4CGHA 4FLTA 4PL8A 3CD6N 3WXKA 3V81A 4FM0A 3LDSA 1VRUA 3EO3A 4XIUA 4DQSA 3EL2A 3CCSN 4DQPA 3VGMA 4H03B 2IIRA 4B1ZA 5AZIB 3UKUA 2AA4A 5LL6Z 3MXIA 2GELA 3SUOA 3GG4A 5JLHA 4H0TB 4OPHA 3NGZA 3SUNA 1TKTA 1VQNN 4M7YA 3PX6A 2P9NA 3P1GA 2VCPA 3AVIA 5AZJB 3K9KA 4NB4A 3NGYA 4QAGA 5AQPA 1S1UA 1JLEA 3W0LA 3QEVA 3SPYA 1H1VA 3LL3A 1LV5A 3LZJA 2O8EA 4JI5K 4FL9A 4YOYA 3K58A 2P9UB 4PKGA 4CJQA 2HW3A 3OVNA 1WSFA 2YI1A 3J7ZO 2OPSA 3CJCA 2DTUA 3THXB 3SBGA 1NGGA 1TK5A 1UA1A 1XUPO 4O4GA 1HJRA 5AFUH 4DFPA 3Q7CA 1C0GA 4YDUA 1EO1A 1WOQA 4HUEA 1T8EA 3GOIA 5LJWA 3NFAA 3SPZA 4MLEA 3HJFA 4FLVA 3ZSOA 5JS1A 4CJ3A 4MLHA 3MX5A 1JL1A 2NRXA 1NGJA 4FJIA 4JKEA 3ZCMA 2QWPA 3KLIA 3CCQN 3RVCA 4BC3A 2OZMA 4CZJA 4B08A 1HKBA 1YI2N 4GVEA 5KPTA 5GINA 2WC9A 3CJ7A 1KFDA 1U2VB 1MA9B 3CCLN 4B1UB 4LH4A 1QZ5A 4FJKA 3MDQA 3SAFA 3AARA 4A59A 5H1SQ 1FKOA 3ISNC 1EETA 2IC3A 4JKBA 4NXNK 1QQCA 2YJFA 2NRZA 5AQTA 1EWRA 1RBRA 1VHXA 4FM2A 2X6SA 3KKRA 5CZ2A 4A62A 3L8BA 1NKCA 4YNQA 4N47A 3QETA 4J2EA 2AJQA 1TL3A 5CYMA 2HVHA 1Q18A 2E2OA 4IWVA 1IO2A 1SL2A 3VN5A 5SWMA 3K5OA 2GBZA 1VSMA 3M8RA 4KB0A 2F4VK 4WYBA 2P51A 3DRPA 3RSEA 4JS4A 4AHTA 1JLCA 2EWSA 3EKSA 3THVA 2P9LB 3O9SA 2YNFA 1KFSA 4C23A 3D2FA 3ZSZA 4CIEA 4BWJA 4M45A 4MDAA 4IFEA 1Q81O 2NLXA 1W97L 2IVPA 4DV7K 3A5MC 1OKJA 4IG0A 5HRPA 4CGGA 4IBNA 3CQXA 3TI0A 5AQGA 3A5LC 4DTSA 4CZKA 4BR2A 1S6PA 4KBOA 4IOCL 5HROA 1KQSM 1BISA 3LP0A 4FLZA 2D0OA 5CHIA 4CEDA 3KK7A 4KHPK 3UB5A 2OYQA 2QXFA 1J9AA 2CGLA 5C25A 4Z94A 3N4QA 3VEYA 5AR0A 5CZ1A 1VK0A 3T1HK 4FJJA 4H5WA 2I5JA 3ALYA 4B1VA 2IGIA 1FK9A 4DTRA 4B8CA 2G8IA 4BY9C 2IS3A 4JKGB 3VQ5A 3MCAB 2HSTA 3NBPA 1NG9A 3DXMA 4BC4A 5FROA 1XNRK 4JI6K 2E6MA 3G0ZA 1VQON 2VWKA 3R8EA 4GKKK 2DFEA 3OBWA 1BA0A 2Q31A 2P9KA 4DR3K 4CZLA 4GV3A 3RRHA 1NWKA 3V9WA 4LSNA 3MN9A 3T7ZA 3K57A 1C0TA 4K8XA 5KPZA 1G99A 3M8SA 2QW9A 2O8BA 5E84A 1S1TA 3QIOA 4MDBA 4DQ8A 3L2WA 1MWKA 4O0JA 4PA1A 5AQQA 1WSHA 5TKYA 2E88A 2QWQA 4HCBA 4KPYA 1YTUA 2UXCK 4GVMA 1RT4A 3E9LA 4X64K 1VQ5N 3IMXA 3QFPA 3J80O 3LPTA 4M3YA 2KZMA 3U4LA 4BRHA 4OGCA 4BR5A 3VA3A 4B9TA 5AQMA 2Q2RA 4FJXA 4DB3A 4JKAA 4DHYA 4BE2A 3F9MA 1YXQA 5BR9A 3QDKA 3MEDA 3RRGA 2OZSA 4JRQA 3JAMO 2O8FB 1CXQA 1IKYA 2HF4A 3CIPA 3OYKA 3NAEA 2F8TA 3AVJA 3HM9A 3CPWM 3B6PA 3OHRA 3WXMB 3K59A 5LY3A 3E1YA 4KH5A 4Q5VA 4PQUA 3AGKA 3O1WA 1RTHA 3OYDA 3TAPA 4XEIA 3D6RA 1NJZA 2YX6A 3ZSWA 3SJJA 3CJAA 1QQOA 5AQOA 1L3VA 5EXWA 3R9PA 2E2QA 2QKKA 3L3UA 3PSIA 5C42A 1RDDA 2VWJA 4DF8A 1OH7A 2NZTA 2ASMA 3AV9A 4KTQA 1K8AO 1HR0K 3HXMA 3K5MA 3GDQA 4LF6K 3I8DA 2O4GA 4FM1A 4KREA 2E8AA 3O3FA 5I3UA 5HRSA 4K0KK 2HOEA 3I56N 1FW6A 1C1BA 4E7JA 2A3ZA 3H3OB 3LM9A 4F4KA 3ULEA 1L3TA 1Y97A 1TAUA 3VGKA 4R79A 4E0DA 4ZTFA 4X62K 5AQWA 2CH6A 3VEZA 1NJXA 4JN4A 5AQUA 2BUPA 4DV6K 4LC9B 2V7YA 5CE3A 5HOOA 1ATRA 2KKZA 4CFAA 3LP3A 5BR8K 5KTQA 3KHYA 1KLNA 3P5JA 2NRHA 3M8PA 4ICLA 4OKEA 4CK1A 3V9ZA 1T7PA 2G8WA 3WQTA 3H1QA 4OO1J 1NGAA 4B3SK 4E89A 2G8VA 3T19A 3HP9A 4CESA 4HCCA 4G9ZA 2Q0RA 1VSDA 2ITGA 4CJFA 3RMBA 4MQ3A 1HNZK 2IAJA 2VWBA 4WQ4C 3IS9A 3JXUA 1GLEG 1IH7A 5C2DA 2ASPA 3A5NC 3F5TA 2B6AA 4NCGA 3SNNA 2FBXA 2GV9A 3QESA 1JJ2M 1KLMA 3HO1A 1MDUB 2F7TA 5FPEA 1XHZA 1WBDA 3D0PA 5MLCQ 3PIPL 4X66K 2O8DB 3SK3A 3WEEA 5C24A 3LDPA 4BRNA 3G10A 4JKCA 2FSNA 1KVAA 2FSKA 4OLAA 2WFBA 2WONA 4B9MA 3VQ4A 1JLAA 1Z6RA 3T1AA 2D0BA 3HK2A 4IDHA 2RPIA 5CR4A 3VMFB 3A0IX 4F3OA 3W3DA 4I7FA 5BPNA 3H46O 3ZT1A 2D4WA 4ELVA 1HKGA 4DV0K 1QVFM 2E2PA 4E1JA 4DU4A 1YUWA 2V7ZA 1R0AA 1VQLN 1JXEA 1HNIA 2HNYA 4B9LA 3TAFA 4M3TA 5E26A 3VQ7A 3VQCA 4C8LA 4Z4CA 4F2SA 3LM2A 2NUBA 3ZT0A 4CHOA 4JHDA 1WAJA 3HOTA 3V1QA 1U6ZA 1N6QA 1TK0A 4DU3A 3VQPA 3BGRA 4XH4A 1A5WA 4FXDA 3QEWA 3U3GA 1YJ9N 4OVLA 1BL3A 2E4LA 4JD2A 3ULEB 4O0IA 2VGMA 4FZZA 3ATUA 3CERA 1NJWA 3KZBA 1ASUA 2E20A 4FWKA 3TPQA 5KGXA 3I33A 1NJIO 1BCOA 3MAQA 2OA8A 5B8HA 3C65A 1ZC6A 3DLGA 2Q97A 2E1YA 3ENHA 4Z4IA 4IKFA 5IWAK 1TYQB 3CCMN 1S1WA 3OBYA 4DLEA 3VQEA 1NMNA 2JWKA 2HBLA 5M1KA 2PAVA 3CHWA 3QBWA 4M7XA 4OKKA 4DG1A 4PHTX 1C1CA 4CZHA 5J2NA 3SAHA 1NGFA 1QVGM 3M6GA 1N5YA 4BVOA 5GAEP 2DFFA 4FW1A 2HHXA 1Q7YO 1NU0A 5DMRA 4XH1A 1C0FA 4CJUA 1N33K 1WB9A 2X6NA 3BEXA 3P83D 1HNXK 3EE9A 4I6MA 2OTLN 1QHTA 4DS4A 3IDHA 2BTFA 4MO4A 4JYAK 1X9WA 2NRTA 1QE1A 4B3RK 4FWQA 5AFUA 1L5UA 3DLEA 1TKZA 3RMAA 1HPZA 1YITN 3KIOA 3HBTA 5GAHP 4BGAA 2YHYA 1TGOA 1EQYA 4KO0A 5TKWA 1BHLA 3P4IA 4H0XB 1I3AA 3CJ9A 1Y64A 3RR8A 1BO5O 1ZBSA 1D4XA 1I39A 1Q9YA 3PX4A 3HP6A 1NBWA 2YNGA 3ZETA 3P31A 1ASWA 4HUFA 4C1NI 2VQFK 3JSMA 4OGEA 4M3RA 4E19A 4CEZA 3OYMA 2D0AA 4JI8K 1REVA 1N32K 3QB0A 1RILA 4I2QA 4UQGA 3I0SA 2QTDA 4BRCA 2OPRA 3AA2A 3SUQA 4KH6A 4FJLA 4CJWA 2PYLA 2O4IA 4FCYA 1ZXOA 5M1QA 3F2KA 4OJRA 2LSNA 3UIQA 4CFCA 3OYCA 4KI6A 3V1RA 3TU5A 2ASOA 4DU1A 1XHXA 1B92A 1QQMA 1S6QA 4CEFA 3VEOA 1SUQA 3S41A 3KK3A 1IBMK 3LANA 1CLQA 1NK4A 4DR6K 4M3XA 2RF2A 4JKFA 3ZX2A 4N41A 2ZWHA 2WOMA 3J81O 2P9PA 1M90O 3MN6A 1NKEA 1OVYA
chains in the Genus database with same CATH topology
4KBOA 5BRDA 4IOCL 3O6WA 1ESVA 1YJWN 5AQXA 1KQSM 4CZGA 2P9IB 2D0OA 2QWOA 2YHXA 4JKDA 3MMVA 5F0XA 3FR0A 3KK7A 5CHIA 1P8ZA 4YOVA 4K25A 3UB5A 2CGLA 3VF4A 1VQPN 5M1NA 3UKRB 4CD1A 5AZJA 1YVNA 4Z94A 3N4QA 2OTJN 4JEPA 3VEYA 5C10A 3EE8A 5AQHA 5AR0A 4H0VB 4H5WA 1K73O 4JK7A 1TUUA 2HBMA 4JKHA 2QA4N 3QMLA 4BREA 3TTCA 4B1VA 1VQKN 4C1NK 3MN5A 4YORA 1ATSA 5JVHL 1TYQA 4BRIA 4BY9C 4JKGB 4ILHA 3MCAB 1VQ9N 4FWOA 2HSTA 1YJNN 1Q82O 2QM1A 2P9UA 4BC5A 3CJ1A 4BRLA 1YITN 2P9SB 3DXMA 4BC4A 1LOTB 3WXIA 3E66A 3CETA 2A5XA 3O9QA 4RCHA 4B1XB 4WCEL 1WUAA 5BPMA 3AGRA 3LDOA 3O9UA 1VQON 4BRDA 4Y0WA 3R8EA 5AQNA 3SMSA 3OBWA 4CBXA 1BA0A 2Q31A 2P9KA 3G71N 3MK6A 1BG3A 3QFUA 4CZLA 1O13A 2FSJA 3BP8A 3CC2N 1NWKA 4XH5A 4GV3A 4ISEA 3TTDA 4I6MB 3MN9A 1DEJA 3T7ZA 2BH1A 1VQMN 5KPZA 1G99A 5GIOA 4A5BA 3G6EN 3ENBA 2QW9A 4ILJA 3ID8A 3VESA 4GY2B 5E84A 3DAWA 1X3MA 2CH5A 3IUCA 3EKUA 4MDBA 4DQ8A 1SS6A 1ILYA 4AF1A 2F9TA 3WEEB 3H3NO 4OPAA 1MWKA 1K8KA 3ZX3A 5AQQA 3M1FA 3HOSA 3FZKA 5TKYA 2E88A 2QWQA 1BDGA 4EHUA 5HL7L 3AAPA 5AQRA 1VQ5N 3E9LA 2QWLA 3IMXA 2J4RA 1TUYA 3CJBA 3QFPA 3U4LA 5M1PA 4BRHA 4BR5A 4M63C 3M5RA 4YOTA 2Q0UA 3B8AX 4BGBA 4FPBA 3O4WA 5AQMA 3ZETB 2Q2RA 1IG8A 4DB3A 4JKAA 4DHYA 3G4SN 2VYPA 3DWLA 3F9MA 3MX2A 3KVGA 1YXQA 5BR9A 1XQSC 3QDKA 4H5NA 2QWMA 1NGBA 5FPNA 1SZ2A 2HF4A 3CIPA 4EHTA 3CMAN 4IJNA 1T44A 1NGHA 3L0QA 3C6AA 1VQ4N 3MWPA 3CPWM 5KQ8A 1SQKA 5F2RA 4EIAA 5KQDA 4KH4A 4O8KA 3OHRA 4IXCA 3WXMB 5LY3A 4J8FA 2A42A 4BC2A 3E1YA 3M3ZA 4KH5A 4YOUA 2ZGZA 4JHDB 1BA1A 5AQFA 3VOVA 4CJ7A 3MN7A 3AGKA 3O1WA 2D1KA 5BRHA 1NLVA 5EX5A 4RWTA 4XEIA 3CCVN 3A5OC 1MWMA 2GEMA 3O1BA 3D6RA 4IEEA 2YX6A 1JCGA 1P90A 3UKUB 3VEWA 3CJAA 5DM7L 4YOWA 1QQOA 3DXKA 4JK9A 5AQOA 4K43A 5AQYA 5EXWA 3R9PA 3CCEN 4IO8A 2E2QA 3D2EA 3VPZA 4CZIA 4CZMA 4JD2B 5GIPA 3C7NA 3I8BA 4FWRA 2NZTA 3ZYYX 2ASMA 4WQ5A 3O9RA 2P9NB 1K8AO 4WQ5C 3VERA 4L3QA 3GDQA 1X3NA 4FOIA 3FE1A 3R3LA 5AZIA 3P38A 4NO7A 4A5AA 3CPEA 5AQKA 2E8AA 2OANA 3HZ6A 4BQLA 2FLOA 2HOEA 2VGNA 3GE1A 5JLFA 2AP1A 4K42A 3VETA 5GADP 2WBNA 2A3ZA 3I56N 1NGCA 3H3OB 3LM9A 3PLAA 1YHQN 3ULEA 4K41A 3CXCM 4FWLA 3CC7N 3VGKA 3ZX0A 1J6ZA 4R79A 3U9ZA 2GUPA 3FFKB 4GV9A 5AQWA 2CH6A 3VEZA 1M1KO 3HRGA 4JN4A 1GLDG 5AQUA 1QHAA 1Z05A 3VF6A 1QZ6A 2BUPA 2DPNA 4JAXA 4BRAA 3I55N 4LC9B 2V7YA 5CE3A 3CF5L 5HOOA 1ATRA 1CZAN 2KKZA 2NRWA 2P9IA 3HM8A 1YF5L 4B9QA 4EFHA 2GWKA 1R59O 3UKRA 5AQVA 3KHYA 5F1XA 3R6MA 4BRQA 3HI0A 2KLAA 2NRHA 2CGJA 3QICA 4BG9A 1DKGD 4BRKA 1S3XA 3TSQA 3WQTA 2QWNA 3H1QA 4OO1J 3JS6A 4CI6A 1NGAA 4FWPA 5M1FA 2QI2A 2V51B 4EAHD 4WF9L 3PIOL 1YAGA 1JCFA 4JKGA 2WUSA 5I9EB 2GWJA 3TSUA 4WFNL 3EN9A 1YIJN 4QS8A 3UE5A 2P9SA 3SLCA 3A8YA 4G9ZA 1RGIA 1BU6O 2HF3A 1NGEA 2Q0RA 3O9TA 3SBTA 2QEXN 3SMPA 5ADXH 3BF3A 4BR4A 1KAZA 2A6AA 4WQ4A 2VWBA 2F9WA 4JNEA 4GV6A 3J8AA 4WQ4C 2E2NA 2FF3B 3JXUA 1GLEG 2RHKA 5C2DA 2ASPA 3BF1A 3K9JA 4U67L 2GTDA 4A2AA 3A5NC 3KWGA 2IVOA 3F5TA 1KAXA 3SJHA 3E9OA 4BRGA 1KC8O 2QWRA 5AQSA 4BRFA 1JJ2M 1T3VA 3ATVA 1VQ7N 4IOXA 1MDUB 2GX9A 2F7TA 5FPEA 3KWIA 5BREA 1GLFO 1U2VA 3GL1A 5MLCQ 4A2BA 5C15A 4O8UA 5ADXA 1RDUA 3L4QA 3SK3A 3WEEA 5GAGP 2ZGYA 4ISFA 3LDPA 4BRNA 1E4FT 3CQYA 1ATNA 1BWFO 4JKCA 2FSNA 1VAZA 2FSKA 3WXJA 3O08A 5BN9A 2ITMA 3SAGA 2E1ZA 2H3GX 2WFBA 3WQUA 1Z6RA 3HSCA 2HBJA 5EOYA 3ID6A 2Q36A 4HTLA 2IVNA 3TTFA 3CCJN 4FWSA 3VGLA 4A61A 2HMPA 3G25A 4IDHA 1JCEA 5CR4A 5C0YA 3C6HA 3VMFB 4PKHA 3A0IX 4PL7A 3RSEB 1GLJO 2NRRA 2D0PA 2PFUA 3T69A 3H46O 3W3DA 4BQZA 5BPNA 4AM6A 2W40A 1E4GT 1KXPA 1LCUA 2D4WA 1HKGA 2CGKA 5AQIA 1QVFM 2E2PA 1RFQA 4CZFA 4E1JA 3WT0A 2JWLA 1YUWA 2PBDA 3D2FB 2V7ZA 2RE2A 4CD3A 2A41A 1HUXA 1VQLN 2QXLA 3CI5A 5JVGL 5FPDA 2YHWA 5E26A 3H6EA 3O8MA 4PKIA 2YJEA 2YCHA 2P9LA 3LM2A 4DKWA 3QBXA 4PL8A 4JHDA 1IJJA 2Q1NA 4H5RA 5BPLA 3CD6N 2ZF5O 3D2EB 3WXKA 3HOTA 3OW2M 1U6ZA 3C7NB 3VTHA 3EO3A 3LDLA 1BUPA 3EL2A 3CCSN 3VGMA 2P9PB 3GBTA 4XH4A 4BVPA 3H45C 4H03B 2IIRA 4FSVA 4B1ZA 5AZIB 3UKUA 2AA4A 5JICA 1YJ9N 2GELA 2UYTA 3OA9A 3GG4A 1NMDA 5JLHA 4JD2A 4H0TB 4OPHA 4B1WB 3DLLL 3ULEB 3BUZB 2VGMA 3ATUA 3CERA 1VQNN 1VQ6N 4M7YA 1GLLO 3ZEUA 3KZBA 2P9NA 1N8RO 2VCPA 2E20A 5AZJB 3LDQA 4FWKA 3TPQA 3K9KA 3I33A 1NJIO 4NB4A 4QS9A 5B8HA 4YOXA 1VQ8N 3C65A 5AQPA 3CC4N 3FLCO 3W0LA 1ZC6A 4GNIA 2Q97A 2E1YA 1H1VA 3LL3A 3ENHA 4CBWA 3IFRA 4BR0A 4IJAA 3DJCA 1TYQB 4AM7A 1HJOA 3HTVA 4FL9A 4YOYA 2V52B 5BN8A 3CCMN 4FVUA 2P9UB 4PKGA 3OBYA 3DXMB 3O80A 4CBUA 1KD1O 2JWKA 3VTIA 2HBLA 2YI1A 5M1KA 2PAVA 3J7ZO 4BR7A 4FOEA 3CHWA 3QBWA 3CCRN 3EZWA 4FWNA 4M7XA 2KHOA 3CJCA 2W41A 4PHTX 2P9KB 3SBGA 1NGGA 4CZHA 5AQLA 3SAHA 4IO9L 3MCPA 1NM1A 1NGFA 4FPAA 1SAZA 1T6DA 4UY8O 1QVGM 1XUPO 3M6GA 4B1YB 5AFUH 4BVOA 3Q7CA 3FZFA 5GAEP 1Q7YO 3U9DA 1C0GA 1K9MO 4YDUA 1EO1A 5AQZA 4XH1A 1C0FA 1WOQA 1KAYA 1HKCA 3GOIA 3BEXA 1T6CA 4RTFD 4YDUC 3TSPA 5LJWA 1S72N 3VEXA 4MLEA 1DT9A 1S22A 1HLUA 3NMUA 1K8KB 3EE9A 4MLHA 4I6MA 3MX5A 2OTLN 3VF2A 5EVZA 4U7BA 3IDHA 4H0PA 2NRXA 1NGJA 2BTFA 4JKEA 1X9JA 3NVKA 4MO4A 1DGKN 3FZHA 2NRTA 2QWPA 3FZMA 4O5FA 1GLCG 4BRMA 4FWQA 5AFUA 4CZEA 3CCQN 1XC3A 3RVCA 4BC3A 1GLBG 3AAQA 5FPMA 4CZJA 4H5TA 1HKBA 1YI2N 4GVEA 5KPTA 5JMVA 5GINA 2WC9A 5BRFA 3CJ7A 1U2VB 3HBTA 1MA9B 5C12A 5GAHP 3CCLN 1HX1A 2YHYA 4B1UB 4BGAA 1EQYA 1QZ5A 5M1OA 3MDQA 5TKWA 4FWMA 2NNWA 3SAFA 3AARA 4A59A 3FGUA 3Q7BA 5H1SQ 3WUHA 4ILGB 1V4TA 3ENOA 5ELZA 3MWTA 4JKBA 2YJFA 3P4IA 4H0XB 3CJ9A 2I7NA 1Y64A 2NRVA 3NVMA 1BO5O 2NRZA 3VENA 1ZBSA 1D4XA 4ISGA 4DCHA 4BR9A 1RDWX 5AQTA 1NBWA 4H0OA 4BRPA 3ZETA 3P31A 4A62A 2A40A 4C1NI 4HWIA 1NGDA 5DM6L 3U8XA 3LDNA 4QS7A 3VEVA 1V4SA 3QB0A 1Q18A 2E2OA 4IWVA 4IOAL 1GLAG 3IKMA 3L6QA 4FO0A 1BOTO 2QTDA 5LJVA 4BRCA 4WYBA 3R1XA 3RSEA 4KH6A 5EY4A 3E9PA 1W2BM 3D7EO 3P39A 3CCUN 1Q86O 2EWSA 4BG8A 3DXKB 1ZXOA 3AY9A 3EKSA 5M1QA 1QQNA 3F2KA 4NLCA 2FF6A 2P9LB 3O9SA 2FXUA 3N4PA 4F9OA 4C23A 3D2FA 3CMEN 3TU5A 2ASOA 2HBKA 5KPRA 3C0BA 4H0YB 2ZJQL 4A57A 1QQMA 4IZ9A 1NGIA 3VEOA 3FZLA 4MDAA 4IFEA 4NLBA 1Q81O 3S41A 3L4IA 5C2FA 3O5BA 2ZJPL 4BROA 2NLXA 4H5VA 4JK8A 4MO5A 1W97L 5AQJA 3PIPL 2IVPA 4JKFA 3WXLA 3ZX2A 3A5MC 1OKJA 2I7PA 4WFBL 2ZWHA 4IEIA 4WFAL 3ZEUB 2ZJRL 3CQXA 2P9PA 3H1VX 1M90O 3MN6A 1HPMA 5AQGA 3A5LC 4CZKA 1OVYA 4BR2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YOY A;  4YOX A;  4YOR A;  4YOW A;  4YOT A;  5CHI A;  4O8U A;  4YOU A;  4YOV A; 
#chains in the Genus database with same CATH topology
 2Z1G A;  3AVC A;  2YNI A;  3O6W A;  5AQX A;  4F2R A;  2UUA K;  2QWO A;  2YHX A;  4JKD A;  5F0X A;  3FR0 A;  1EP4 A;  2ZM6 K;  4DR5 K;  3VF4 A;  1VQP N;  4CD1 A;  1YVN A;  2OTJ N;  4JEP A;  1J5O A;  3PUF A;  4EZ9 A;  3QML A;  3ZSR A;  4BRE A;  4B8A B;  1QSL A;  2ATQ A;  4C1N K;  3MN5 A;  1ATS A;  4BRI A;  1VQ9 N;  1FXX A;  3F73 A;  1JKH A;  1HYV A;  5E41 A;  4AIL C;  2P9S B;  1EWQ A;  1N36 K;  2F8S A;  4E1M A;  3O9Q A;  4RCH A;  4WCE L;  5BPM A;  1MU2 A;  4BRD A;  4OPJ A;  5AQN A;  4C8N A;  4CEE A;  3BP8 A;  4L8R B;  4XH5 A;  4I6M B;  3TR8 A;  4KRF A;  4DUY K;  4YHH K;  4O55 A;  4CJE A;  1X3M A;  2CH5 A;  1A5X A;  4CF2 A;  1SS6 A;  2WTU A;  1ILY A;  2F9T A;  3H3N O;  1K8K A;  3NH1 A;  1XWL A;  3SQ1 A;  2HHV A;  2B5J A;  3FZK A;  4C8M A;  3HOS A;  4EHU A;  3THY B;  1TV6 A;  5T7B A;  1TUY A;  2UUC K;  1RT2 A;  3T1Y K;  5M1P A;  4JI0 K;  2HB5 A;  4M63 C;  2W42 A;  1NJY A;  1RBV A;  3O4W A;  3ZET B;  1IG8 A;  2X78 A;  1D9D A;  2VYP A;  3DRS A;  1ZBU A;  2GUI A;  4H5N A;  1A5V A;  5FPN A;  1TKD A;  1SZ2 A;  4EHT A;  3SUP A;  4IJN A;  1NGH A;  3MWP A;  3NF9 A;  4EIA A;  3TAG A;  3U3Y A;  4LF7 K;  4KH4 A;  1WSG A;  4IXC A;  1FJG K;  4CVN E;  2A42 A;  3QIN A;  4ELU A;  3M3Z A;  5K14 A;  3BY5 A;  1BA1 A;  3VOV A;  3CM6 A;  4CJ7 A;  4NYN A;  5FRM A;  4LSL A;  5EX5 A;  3CCV N;  2OPP A;  4IEE A;  3UKU B;  3OYF A;  5DM7 L;  1DTT A;  3DXK A;  2FC0 A;  5AQY A;  3HPG A;  3AVA A;  3WNG A;  4CEQ A;  4FZY A;  4DUZ K;  3D2E A;  4CZI A;  4CZM A;  3S3N A;  5LMU K;  3ZSX A;  1NKB A;  1I94 K;  3O9R A;  2P9N B;  3SCX A;  4WQ5 C;  5HRN A;  4L3Q A;  1X3N A;  3FE1 A;  4A5A A;  2QKB A;  2FLO A;  1E3M A;  4LFA K;  3HL8 A;  2WBN A;  1NGC A;  4K41 A;  4M41 A;  1RBT A;  4FWL A;  3ZX0 A;  1J6Z A;  2O8C A;  3U9Z A;  3FFK B;  5JS2 A;  2O8E B;  2YNH A;  3WNH A;  4CJL A;  4ZHR A;  1QHA A;  1QZ6 A;  4BRA A;  5J2M A;  4CEB A;  4JI1 K;  1CZA N;  2NRW A;  2P9I A;  4FLY A;  3O3H A;  4KB1 A;  1IG9 A;  1BI4 A;  3UKR A;  5F1X A;  4BRQ A;  1RDB A;  3V6D A;  3QIC A;  2JLE A;  3KD5 E;  4JI4 K;  3AA5 X;  5KRS A;  5M1F A;  4B3O A;  1ZBL A;  1YAG A;  1JCF A;  1XC9 A;  2WUS A;  5I9E B;  2GWJ A;  1WSJ A;  1JXB A;  1RBU A;  3CFO A;  4Z0U A;  4QS8 A;  3A8Y A;  1RGI A;  1BU6 O;  3A2F A;  3C6T A;  1NGE A;  3SBT A;  5ADX H;  3KJV A;  3E01 A;  1C6V A;  4I9L A;  2A6A A;  4DQI A;  2F9W A;  4JNE A;  3OYE A;  3J8A A;  2E2N A;  3PSF A;  2HHQ A;  4C8O A;  4E7L A;  3QEI A;  4DSE A;  4CJT A;  3SJH A;  4NXM K;  3QEP A;  4WE1 A;  2QWR A;  1RBS A;  5AQS A;  4BRF A;  4IOX A;  3AVL A;  2OPQ A;  4NCB A;  1NNE A;  4A2B A;  5C15 A;  3L4Q A;  2ZGY A;  2RN2 A;  4KI4 A;  1BWF O;  4CIG A;  2VG6 A;  4HUG A;  3WXJ A;  5HBM A;  4DS5 A;  2H3G X;  3WQU A;  2HBJ A;  3V9X A;  2Q36 A;  3PV8 A;  4FWS A;  3BZK A;  3VGL A;  4A61 A;  2HMP A;  4DTM A;  1U45 A;  4PY5 A;  4ID1 A;  5C0Y A;  2VG7 A;  4DTN A;  3KLF A;  4PL7 A;  3KTQ A;  3RSE B;  3QNN A;  2PFU A;  4NCA A;  1E4G T;  2HHU A;  4CF8 A;  2HHS A;  1U47 A;  2CGK A;  4FK4 A;  5AQI A;  4CZF A;  2VQE K;  4FJ8 A;  2PBD A;  4DSK A;  3D2F B;  4J2D A;  4CD3 A;  1HUX A;  1U4B A;  2QXL A;  4AHS A;  3TAM A;  4AHC A;  1Q8I A;  4W5R A;  1NOZ A;  5JVG L;  4ZTJ A;  1C0M A;  4KAZ A;  4J2A A;  1HMV A;  4DKW A;  1IJJ A;  2Q1N A;  3D2E B;  3WNF A;  4V19 S;  3LDL A;  1BUP A;  2HNZ A;  3GBT A;  4BVP A;  3H45 C;  3HT3 A;  4CCH A;  1RTJ A;  3DLR A;  2UYT A;  3OA9 A;  1UWB A;  4LF9 K;  1LAW A;  3OYG A;  3ZEU A;  1N8R O;  4CHN A;  4O44 A;  3LDQ A;  3DYA A;  4QS9 A;  1VSK A;  1TVR A;  1ZBH A;  1VQ8 N;  3ULD A;  3CC4 N;  1K6Y A;  3LPU A;  4GNI A;  4CBW A;  3IFR A;  1SL0 A;  4BR0 A;  4W5N A;  1HJO A;  2E5L K;  3O3G A;  1O1W A;  2XY8 A;  4AHR A;  1W0H A;  3C95 A;  3DXM B;  3O80 A;  1KD1 O;  3VTI A;  4CJR A;  1N34 K;  3CCR N;  3EZW A;  4FWN A;  2KHO A;  4B9V A;  4FJH A;  2P9K B;  4IO9 L;  1NM1 A;  4FPA A;  1SAZ A;  1T6D A;  3NCI A;  3LAM A;  4B1Y B;  4CEO A;  2G8H A;  2G8K A;  3NHG A;  4DV4 K;  2O8B B;  3NH2 A;  5AQZ A;  1KAY A;  4YDU C;  1S72 N;  3TSP A;  3VEX A;  1L3S A;  1S22 A;  3NMU A;  2P5G A;  3L3V A;  5EVZ A;  4U7B A;  2KFN A;  3FZH A;  1RDC A;  3FZM A;  1GLC G;  4CZE A;  1XC3 A;  3K2P A;  3AAQ A;  1SV5 A;  5FPM A;  3OJU A;  5BRF A;  5C12 A;  1HX1 A;  3QEX A;  1S9G A;  1JLQ A;  3HPH A;  4FWM A;  2NNW A;  4FLU A;  3FGU A;  3LP1 A;  1V4T A;  5ELZ A;  3MWT A;  2IDO A;  2I7N A;  2NRV A;  3NVM A;  4H4M A;  4BG9 A;  4ISG A;  4DCH A;  4BR9 A;  1IKV A;  1RDW X;  1X1P A;  3ZT3 A;  4CJ4 A;  2A40 A;  1NGD A;  1D5A A;  2W6L A;  2YHA A;  3U8X A;  3VEV A;  1UA0 A;  1NK9 A;  1V4S A;  4QCL A;  4DV5 K;  4M42 A;  1B9D A;  1BOT O;  1QTM A;  3K5N A;  1S1V A;  1NK0 A;  4IG3 A;  4B9U A;  4KHY A;  3QIP A;  3E9P A;  1RTI A;  4X65 K;  3D7E O;  3VQ9 A;  3CCU N;  1Q86 O;  3SYZ A;  1ZBI A;  4BG8 A;  2XY7 A;  3TWH A;  1QQN A;  4NLC A;  2FF6 A;  2FXU A;  4F9O A;  3CME N;  4EP5 A;  3QLH A;  5KPR A;  2OCE A;  3C0B A;  2ZJQ L;  1RNH A;  1WLJ A;  4IZ9 A;  3V9U A;  4NLB A;  2YHB A;  5C2F A;  3JYT A;  5KGW A;  4BRO A;  4DFM A;  1S5J A;  4MO5 A;  5AQJ A;  1CZ9 A;  3SV4 A;  3VQA A;  4IEI A;  1HQE A;  3ZEU B;  2ZJR L;  3OYN A;  3H1V X;  2D0C A;  3LAL A;  1HPM A;  1ESV A;  4RG8 A;  1WAF A;  3KKS A;  3MMV A;  1SKR A;  4K25 A;  2DY4 A;  4KHU A;  5M1N A;  5AZJ A;  4KFB A;  3AO3 A;  1EKE A;  4H8K A;  4KHS A;  3EE8 A;  5AQH A;  1WN7 A;  4H0V B;  5FDL A;  4JK7 A;  1TUU A;  3SZ2 A;  2QA4 N;  1SKW A;  3TTC A;  1VSF A;  1W9H A;  4IFV A;  4ILH A;  4FWO A;  1GOA A;  3AVH A;  1Q82 O;  2P9U A;  3CG7 A;  4BC5 A;  3ZT2 A;  5CY4 A;  3WXI A;  3LZI A;  1RCH A;  4B1X B;  3AGR A;  3O9U A;  4HHT A;  4DQR A;  3S3O A;  4DTX A;  5HLF A;  3OTO K;  4AQY K;  1JLB A;  3QFU A;  1O13 A;  4F8R A;  3AO5 A;  2BH1 A;  4CIF A;  2XO7 A;  5GIO A;  3G6E N;  4NYF A;  3ENB A;  4ILJ A;  3ID8 A;  1B9F A;  4M3U A;  3EKU A;  4DSI A;  1BCM A;  4AF1 A;  3RMC A;  3WEE B;  4OPA A;  3MXJ A;  3ZX3 A;  1BGX T;  3M1F A;  1BIU A;  1JL2 A;  4DSL A;  3AO1 A;  4FJ5 A;  1BDG A;  2ZQB A;  3MEG A;  3AAP A;  5AQR A;  1RT6 A;  4JI3 K;  4OLB A;  3IRX A;  3DM2 A;  5HP1 A;  2QWL A;  4R5P A;  4RW8 A;  4AHU A;  3M5R A;  4YOT A;  3M8Q A;  1KVC A;  3AVG A;  4DTP A;  3G4S N;  3DLB A;  3PO4 A;  1VSH A;  4Z4F A;  1XQS C;  5LMN K;  2QWM A;  1NGB A;  1WNS A;  1UAX A;  3MEC A;  1T44 A;  2PYJ A;  5A2Q O;  2PZS A;  3L0Q A;  4N76 A;  1RT5 A;  3DI6 A;  1HRH A;  1KSP A;  4EZ6 A;  2KW4 A;  3RMD A;  5KQ8 A;  5F2R A;  3MXM A;  1ITG A;  1J54 A;  5KQD A;  4O8K A;  3DOK A;  4OKJ A;  4DLG A;  2B4J A;  4J8F A;  4BC2 A;  4B3M K;  1SL1 A;  4O5B A;  4JHD B;  2IOC A;  4DFK A;  3CFP A;  5AQF A;  4OPK A;  3MN7 A;  1VSJ A;  2D1K A;  3FFI A;  5BRH A;  1SKS A;  1NLV A;  4RWT A;  1KTQ A;  1MWM A;  3O1B A;  2HHW A;  1P90 A;  3VEW A;  4YOW A;  1U49 A;  1IV0 A;  3KLE A;  3CCE N;  4JK9 A;  4K43 A;  3EEQ A;  1DTQ A;  4HVJ A;  2QK9 A;  1VSI A;  4IO8 A;  1TKX A;  3AA3 A;  4JD2 B;  5GIP A;  3C7N A;  4FWR A;  4RW7 A;  3DOL A;  3TAQ A;  3ZYY X;  2D5R A;  4RW6 A;  1ASV A;  3VER A;  1JLG A;  4DTJ A;  3P38 A;  2UU9 K;  1LWE A;  3GE1 A;  5JLF A;  2AP1 A;  4K42 A;  3PLA A;  1ZBF A;  3HYF A;  4KTZ A;  4BE0 A;  4KV8 A;  2GUP A;  4GV9 A;  5EU7 A;  5CYQ A;  4CHZ A;  2R7Y A;  1HYS A;  2KTQ A;  2DPN A;  4JAX A;  3IAY A;  3AVK A;  3WNE A;  4N56 A;  3H08 A;  3OYL A;  3HPO A;  3VQQ A;  4EFH A;  4CF1 A;  1TL1 A;  2Z1I A;  2KLA A;  4BRK A;  2CGJ A;  3EZ5 A;  2XY6 A;  3TSQ A;  1BIZ A;  3JS6 A;  4CI6 A;  4FWP A;  2V51 B;  4EAH D;  4WF9 L;  3PIO L;  4JKG A;  4DSF A;  3VQD A;  3EN9 A;  3KLH A;  3UE5 A;  2BGG A;  3AO2 A;  3O9T A;  2G8U A;  2QEX N;  3BF3 A;  4WQ4 A;  4GV6 A;  2UXB K;  4W5T A;  2FF3 B;  4DV2 K;  3BF1 A;  4U67 L;  4JI7 K;  2GTD A;  4E7I A;  3KWG A;  2IVO A;  4KHW A;  1KAX A;  2FBV A;  3ATV A;  1VQ7 N;  4DR1 K;  2GX9 A;  3KWI A;  5BRE A;  1X9S A;  3GL1 A;  1OH5 A;  5ADX A;  5GAG P;  4ISF A;  3ZSY A;  4QOZ B;  3EY1 A;  1RT1 A;  4KHN A;  4HTU A;  2KQ2 A;  3CQY A;  1ATN A;  4CJK A;  3B6O A;  1VAZ A;  3L2Q A;  1Q9X A;  1BQM A;  2E1Z A;  5D3G A;  3NE6 A;  3AVN A;  5EOY A;  3ID6 A;  4HTL A;  2UUB K;  2IVN A;  3CCJ N;  3NGI A;  3G25 A;  1JCE A;  1LAV A;  1Z26 A;  4BQZ A;  1UOC A;  2A1R A;  4GKJ K;  1YTA A;  3WT0 A;  2O8F A;  3AA4 A;  4FJ9 A;  2RE2 A;  5KRT A;  3CI5 A;  2YHW A;  3C94 A;  3ZSV A;  3H6E A;  3O8M A;  4FZX C;  4Z4G A;  2YCH A;  4AHV A;  4YY3 K;  3D45 A;  3QBX A;  4H5R A;  5BPL A;  4FJN A;  4IFY A;  2ZF5 O;  4EP4 A;  3SQ4 A;  3OW2 M;  3C7N B;  3VTH A;  3K0S A;  2P9P B;  1KVB A;  4FSV A;  4YFU A;  5JIC A;  1XI1 A;  3BZC A;  4FJ7 A;  1NMD A;  4B1W B;  3DLL L;  3BUZ B;  4RW9 A;  4Y1C A;  3BDP A;  4H4O A;  1VQ6 N;  1GLL O;  3MEE A;  3L2U A;  1VSL A;  1C0U A;  4KTW A;  2P5O A;  4YOX A;  3FLC O;  4PWD A;  4ID5 A;  3VQ8 A;  4CFD A;  4CF9 A;  4JS5 A;  3S3M A;  1RT7 A;  4OX9 K;  4IJA A;  3DJC A;  4AM7 A;  3THW A;  3HTV A;  3OS1 A;  5SZT A;  4I2P A;  1F21 A;  2V52 B;  5BN8 A;  4FVU A;  3L2V A;  1J5E K;  3CYM A;  4CBU A;  5FLX O;  1JLF A;  3ITH A;  4BR7 A;  4FOE A;  1LWC A;  2W41 A;  1G15 A;  2DFH A;  5AQL A;  2KFZ A;  3MCP A;  3RR7 A;  4UY8 O;  1T03 A;  2HND A;  4E1N A;  3FZF A;  4CER A;  4F3T A;  3U9D A;  1QSY A;  1K9M O;  5FRN A;  1HKC A;  4RTF D;  1T6C A;  4C8K A;  2BE2 A;  4DWI A;  1DT9 A;  1HLU A;  1K8K B;  4DV1 K;  3LP2 A;  3VF2 A;  3KK1 A;  4H0P A;  3NF6 A;  3NVK A;  1X9J A;  1DGK N;  4O5F A;  4LH5 A;  4BRM A;  1GLB G;  1S9E A;  4H5T A;  4E7K A;  5JMV A;  2Q3S A;  1HQU A;  3O4Q A;  3TAN A;  5M1O A;  4LFB K;  2PY5 A;  3CM5 A;  3Q7B A;  3WUH A;  4ILG B;  3ENO A;  1S1X A;  3I0R A;  3VEN A;  3AVB A;  1EXQ A;  3TAE A;  2O8D A;  4H0O A;  4BRP A;  4G1Q A;  3K5L A;  4HWI A;  5DM6 L;  3DRR A;  3LDN A;  4QS7 A;  3NDK A;  2E6L A;  2RKI A;  4FYD A;  2F96 A;  4IOA L;  1GLA G;  3IKM A;  3L6Q A;  4FO0 A;  3TAB A;  1W7A A;  2ZE2 A;  5LJV A;  5J2P A;  4CEA A;  4CF0 A;  3R1X A;  3S9H A;  5EY4 A;  4IDK A;  1WBB A;  1W2B M;  3P39 A;  3DLH A;  3DXK B;  3AY9 A;  3OS0 A;  4CGD A;  4E3S A;  3N4P A;  1CXU A;  3AVM A;  1WSE A;  2HBK A;  4H0Y B;  4A57 A;  4DTU A;  2YV0 X;  2Z1J A;  1NGI A;  3FZL A;  1OH6 A;  4LF8 K;  4B9S A;  4LF5 K;  4JLH A;  3L4I A;  3O5B A;  3AO4 A;  1XNQ K;  4H5V A;  4JK8 A;  4BDP A;  4FJM A;  4CE9 A;  3ZLJ A;  3HVR A;  3OJS A;  1EX4 A;  3WXL A;  4WFB L;  2O8C B;  2I7P A;  3LWL A;  3RWU A;  4WFA L;  3OYA A;  4AH9 A;  4BWM A;  2G8F A;  2KZZ A;  5BRD A;  1YJW N;  4CZG A;  4CGF A;  2P9I B;  4YOV A;  2Y1I A;  5DK5 A;  1P8Z A;  1XMQ K;  3HST B;  4MFB A;  2ETJ A;  3THW B;  1BI4 B;  3UKR B;  3ASM A;  4FK2 A;  2P1J A;  4ELT A;  5C10 A;  1RDA A;  4FJG A;  1OH8 A;  1KCF A;  4LF4 K;  3ZT4 A;  1K73 O;  4N5S A;  2HBM A;  4JKH A;  4K8Z A;  1VQK N;  3HVT A;  5JVH L;  4YOR A;  1TYQ A;  1IBK K;  4W5O A;  1YJN N;  3EYZ A;  2QM1 A;  3CJ1 A;  4BRL A;  3LWM A;  4E7H A;  4DQQ A;  1BQN A;  1LOT B;  3E66 A;  3CET A;  5J1E A;  2A5X A;  1WUA A;  3LDO A;  1NK6 A;  4Y0W A;  4CBX A;  3SMS A;  3G71 N;  2VG5 A;  3MK6 A;  1BG3 A;  2HHT A;  2BDP A;  3AVF A;  2FSJ A;  3CC2 N;  4ISE A;  3TTD A;  2FBY A;  1DEJ A;  3J7A P;  4CGJ A;  1VQM N;  4A5B A;  2JGU A;  2ZD1 A;  3VES A;  4GY2 B;  2YKM A;  3DAW A;  3IUC A;  1RT3 A;  1TAQ A;  1XMO K;  1FKP A;  1LWF A;  1NK5 A;  1C1A A;  1D8Y A;  4CFB A;  3CQ8 A;  3SI6 A;  5HL7 L;  3SQ2 A;  1NK8 A;  2J4R A;  3CJB A;  1CZB A;  4FLX A;  3V9S A;  2HVI A;  2Q0U A;  1D9F A;  3B8A X;  4CJS A;  4BGB A;  4FPB A;  3NF8 A;  4CHP A;  4DR2 K;  1IKW A;  1DLO A;  3VQB A;  1YT3 A;  3DWL A;  1RTD A;  2HHH K;  3MX2 A;  3KVG A;  3C6U A;  3O4N A;  1QSS A;  2Z1H A;  4JI2 K;  4W5Q A;  3CMA N;  4KKO A;  2HMI A;  3SV3 A;  3C6A A;  2UXD K;  4M3Z A;  1VQ4 N;  4M3W A;  1SQK A;  4DR7 K;  3DLK A;  3KLG A;  3LAK A;  4GW6 A;  4Q0B A;  3ZSQ A;  4YOU A;  2ZGZ A;  4GMJ B;  3KD1 E;  3F9K A;  3A5O C;  3NH0 A;  2GEM A;  4CEC A;  4DF4 A;  1JCG A;  1HYZ A;  3VQ6 A;  3OYB A;  1ZYQ A;  4J2B A;  1QS4 A;  4TSX A;  4BDZ A;  5KI6 A;  3VPZ A;  2W6K A;  3I8B A;  4Y1D A;  1TK8 A;  1HNW K;  4Z4E A;  1YVU A;  4WQ5 A;  1NOY A;  5AZI A;  4FOI A;  3R3L A;  4NO7 A;  3CPE A;  5AQK A;  1U04 A;  2OAN A;  4CHY A;  3HZ6 A;  4BQL A;  2VGN A;  4CJV A;  3VET A;  5GAD P;  4LD0 A;  1YHQ N;  3CXC M;  1KRP A;  3TAR A;  3CC7 N;  2EX3 A;  4LFC K;  4I9Q A;  2XY5 A;  4RW4 A;  3NF7 A;  1M1K O;  3HRG A;  4CGI A;  1GLD G;  1LW0 A;  3VF6 A;  1Z05 A;  2A1S A;  4JRP A;  4DR4 K;  1Z25 A;  3OS2 A;  3I55 N;  3CF5 L;  1LW2 A;  3OYH A;  4DSJ A;  1HNV A;  3HM8 A;  1YF5 L;  4CW7 B;  5J2Q A;  4B9Q A;  3V1O A;  1T05 A;  2GWK A;  1R59 O;  5AQV A;  3R6M A;  3HI0 A;  4BAC A;  3T3F A;  4CHQ A;  1NK7 A;  1DKG D;  1S3X A;  1VSE A;  2YKN A;  4Z4H A;  2Y1J A;  2QWN A;  3THX A;  4BDY A;  2QI2 A;  1IBL K;  3OY9 A;  3TSU A;  4WFN L;  3PY8 A;  1YIJ N;  4B9N A;  2P9S A;  3SLC A;  4DTO A;  1VRT A;  2HF3 A;  4KHQ A;  3SMP A;  4BR4 A;  1KAZ A;  2X74 A;  3V4I A;  3QER A;  1WSI A;  2RHK A;  2XRI A;  4JV5 K;  4B3T K;  3K9J A;  1X9M A;  4A2A A;  4DFJ A;  3KK2 A;  3E9O A;  4DV3 K;  4BRG A;  1KC8 O;  1T3V A;  3DMJ A;  1GLF O;  1IKX A;  2FBT A;  1U2V A;  4O8U A;  4PUO A;  1RDU A;  4CJP A;  5I42 A;  4DMN A;  1E4F T;  3U6F A;  4FVM A;  3THY A;  3O08 A;  5AJ3 K;  4FW2 A;  5BN9 A;  2ITM A;  3SAG A;  3SQ0 A;  1GOC A;  3HSC A;  4FK0 A;  1J53 A;  2EHG A;  3TTF A;  2BAN A;  4CK3 A;  3PO5 A;  4CJ5 A;  3C6H A;  3J7Y P;  4PKH A;  3OYI A;  2ZJP L;  1GLJ O;  2NRR A;  2D0P A;  3T69 A;  1L3U A;  3PX0 A;  4AM6 A;  2W40 A;  3QO9 A;  4FLW A;  1KXP A;  1GOB A;  1LCU A;  3OYJ A;  4LY7 A;  1RFQ A;  2JWL A;  3IG1 A;  1OVQ A;  3QNO A;  2XHB A;  1U48 A;  5IT9 O;  2A41 A;  4CK2 A;  5FPD A;  3CFR A;  5HRR A;  3RTV A;  4PKI A;  2YJE A;  4BE1 A;  2P9L A;  3VA0 A;  3L2R A;  4CGH A;  4FLT A;  4PL8 A;  3CD6 N;  3WXK A;  3V81 A;  4FM0 A;  3LDS A;  1VRU A;  3EO3 A;  4XIU A;  4DQS A;  3EL2 A;  3CCS N;  4DQP A;  3VGM A;  4H03 B;  2IIR A;  4B1Z A;  5AZI B;  3UKU A;  2AA4 A;  5LL6 Z;  3MXI A;  2GEL A;  3SUO A;  3GG4 A;  5JLH A;  4H0T B;  4OPH A;  3NGZ A;  3SUN A;  1TKT A;  1VQN N;  4M7Y A;  3PX6 A;  2P9N A;  3P1G A;  2VCP A;  3AVI A;  5AZJ B;  3K9K A;  4NB4 A;  3NGY A;  4QAG A;  5AQP A;  1S1U A;  1JLE A;  3W0L A;  3QEV A;  3SPY A;  1H1V A;  3LL3 A;  1LV5 A;  3LZJ A;  2O8E A;  4JI5 K;  4FL9 A;  4YOY A;  3K58 A;  2P9U B;  4PKG A;  4CJQ A;  2HW3 A;  3OVN A;  1WSF A;  2YI1 A;  3J7Z O;  2OPS A;  3CJC A;  2DTU A;  3THX B;  3SBG A;  1NGG A;  1TK5 A;  1UA1 A;  1XUP O;  4O4G A;  1HJR A;  5AFU H;  4DFP A;  3Q7C A;  1C0G A;  4YDU A;  1EO1 A;  1WOQ A;  4HUE A;  1T8E A;  3GOI A;  5LJW A;  3NFA A;  3SPZ A;  4MLE A;  3HJF A;  4FLV A;  3ZSO A;  5JS1 A;  4CJ3 A;  4MLH A;  3MX5 A;  1JL1 A;  2NRX A;  1NGJ A;  4FJI A;  4JKE A;  3ZCM A;  2QWP A;  3KLI A;  3CCQ N;  3RVC A;  4BC3 A;  2OZM A;  4CZJ A;  4B08 A;  1HKB A;  1YI2 N;  4GVE A;  5KPT A;  5GIN A;  2WC9 A;  3CJ7 A;  1KFD A;  1U2V B;  1MA9 B;  3CCL N;  4B1U B;  4LH4 A;  1QZ5 A;  4FJK A;  3MDQ A;  3SAF A;  3AAR A;  4A59 A;  5H1S Q;  1FKO A;  3ISN C;  1EET A;  2IC3 A;  4JKB A;  4NXN K;  1QQC A;  2YJF A;  2NRZ A;  5AQT A;  1EWR A;  1RBR A;  1VHX A;  4FM2 A;  2X6S A;  3KKR A;  5CZ2 A;  4A62 A;  3L8B A;  1NKC A;  4YNQ A;  4N47 A;  3QET A;  4J2E A;  2AJQ A;  1TL3 A;  5CYM A;  2HVH A;  1Q18 A;  2E2O A;  4IWV A;  1IO2 A;  1SL2 A;  3VN5 A;  5SWM A;  3K5O A;  2GBZ A;  1VSM A;  3M8R A;  4KB0 A;  2F4V K;  4WYB A;  2P51 A;  3DRP A;  3RSE A;  4JS4 A;  4AHT A;  1JLC A;  2EWS A;  3EKS A;  3THV A;  2P9L B;  3O9S A;  2YNF A;  1KFS A;  4C23 A;  3D2F A;  3ZSZ A;  4CIE A;  4BWJ A;  4M45 A;  4MDA A;  4IFE A;  1Q81 O;  2NLX A;  1W97 L;  2IVP A;  4DV7 K;  3A5M C;  1OKJ A;  4IG0 A;  5HRP A;  4CGG A;  4IBN A;  3CQX A;  3TI0 A;  5AQG A;  3A5L C;  4DTS A;  4CZK A;  4BR2 A;  1S6P A;  4KBO A;  4IOC L;  5HRO A;  1KQS M;  1BIS A;  3LP0 A;  4FLZ A;  2D0O A;  5CHI A;  4CED A;  3KK7 A;  4KHP K;  3UB5 A;  2OYQ A;  2QXF A;  1J9A A;  2CGL A;  5C25 A;  4Z94 A;  3N4Q A;  3VEY A;  5AR0 A;  5CZ1 A;  1VK0 A;  3T1H K;  4FJJ A;  4H5W A;  2I5J A;  3ALY A;  4B1V A;  2IGI A;  1FK9 A;  4DTR A;  4B8C A;  2G8I A;  4BY9 C;  2IS3 A;  4JKG B;  3VQ5 A;  3MCA B;  2HST A;  3NBP A;  1NG9 A;  3DXM A;  4BC4 A;  5FRO A;  1XNR K;  4JI6 K;  2E6M A;  3G0Z A;  1VQO N;  2VWK A;  3R8E A;  4GKK K;  2DFE A;  3OBW A;  1BA0 A;  2Q31 A;  2P9K A;  4DR3 K;  4CZL A;  4GV3 A;  3RRH A;  1NWK A;  3V9W A;  4LSN A;  3MN9 A;  3T7Z A;  3K57 A;  1C0T A;  4K8X A;  5KPZ A;  1G99 A;  3M8S A;  2QW9 A;  2O8B A;  5E84 A;  1S1T A;  3QIO A;  4MDB A;  4DQ8 A;  3L2W A;  1MWK A;  4O0J A;  4PA1 A;  5AQQ A;  1WSH A;  5TKY A;  2E88 A;  2QWQ A;  4HCB A;  4KPY A;  1YTU A;  2UXC K;  4GVM A;  1RT4 A;  3E9L A;  4X64 K;  1VQ5 N;  3IMX A;  3QFP A;  3J80 O;  3LPT A;  4M3Y A;  2KZM A;  3U4L A;  4BRH A;  4OGC A;  4BR5 A;  3VA3 A;  4B9T A;  5AQM A;  2Q2R A;  4FJX A;  4DB3 A;  4JKA A;  4DHY A;  4BE2 A;  3F9M A;  1YXQ A;  5BR9 A;  3QDK A;  3MED A;  3RRG A;  2OZS A;  4JRQ A;  3JAM O;  2O8F B;  1CXQ A;  1IKY A;  2HF4 A;  3CIP A;  3OYK A;  3NAE A;  2F8T A;  3AVJ A;  3HM9 A;  3CPW M;  3B6P A;  3OHR A;  3WXM B;  3K59 A;  5LY3 A;  3E1Y A;  4KH5 A;  4Q5V A;  4PQU A;  3AGK A;  3O1W A;  1RTH A;  3OYD A;  3TAP A;  4XEI A;  3D6R A;  1NJZ A;  2YX6 A;  3ZSW A;  3SJJ A;  3CJA A;  1QQO A;  5AQO A;  1L3V A;  5EXW A;  3R9P A;  2E2Q A;  2QKK A;  3L3U A;  3PSI A;  5C42 A;  1RDD A;  2VWJ A;  4DF8 A;  1OH7 A;  2NZT A;  2ASM A;  3AV9 A;  4KTQ A;  1K8A O;  1HR0 K;  3HXM A;  3K5M A;  3GDQ A;  4LF6 K;  3I8D A;  2O4G A;  4FM1 A;  4KRE A;  2E8A A;  3O3F A;  5I3U A;  5HRS A;  4K0K K;  2HOE A;  3I56 N;  1FW6 A;  1C1B A;  4E7J A;  2A3Z A;  3H3O B;  3LM9 A;  4F4K A;  3ULE A;  1L3T A;  1Y97 A;  1TAU A;  3VGK A;  4R79 A;  4E0D A;  4ZTF A;  4X62 K;  5AQW A;  2CH6 A;  3VEZ A;  1NJX A;  4JN4 A;  5AQU A;  2BUP A;  4DV6 K;  4LC9 B;  2V7Y A;  5CE3 A;  5HOO A;  1ATR A;  2KKZ A;  4CFA A;  3LP3 A;  5BR8 K;  5KTQ A;  3KHY A;  1KLN A;  3P5J A;  2NRH A;  3M8P A;  4ICL A;  4OKE A;  4CK1 A;  3V9Z A;  1T7P A;  2G8W A;  3WQT A;  3H1Q A;  4OO1 J;  1NGA A;  4B3S K;  4E89 A;  2G8V A;  3T19 A;  3HP9 A;  4CES A;  4HCC A;  4G9Z A;  2Q0R A;  1VSD A;  2ITG A;  4CJF A;  3RMB A;  4MQ3 A;  1HNZ K;  2IAJ A;  2VWB A;  4WQ4 C;  3IS9 A;  3JXU A;  1GLE G;  1IH7 A;  5C2D A;  2ASP A;  3A5N C;  3F5T A;  2B6A A;  4NCG A;  3SNN A;  2FBX A;  2GV9 A;  3QES A;  1JJ2 M;  1KLM A;  3HO1 A;  1MDU B;  2F7T A;  5FPE A;  1XHZ A;  1WBD A;  3D0P A;  5MLC Q;  3PIP L;  4X66 K;  2O8D B;  3SK3 A;  3WEE A;  5C24 A;  3LDP A;  4BRN A;  3G10 A;  4JKC A;  2FSN A;  1KVA A;  2FSK A;  4OLA A;  2WFB A;  2WON A;  4B9M A;  3VQ4 A;  1JLA A;  1Z6R A;  3T1A A;  2D0B A;  3HK2 A;  4IDH A;  2RPI A;  5CR4 A;  3VMF B;  3A0I X;  4F3O A;  3W3D A;  4I7F A;  5BPN A;  3H46 O;  3ZT1 A;  2D4W A;  4ELV A;  1HKG A;  4DV0 K;  1QVF M;  2E2P A;  4E1J A;  4DU4 A;  1YUW A;  2V7Z A;  1R0A A;  1VQL N;  1JXE A;  1HNI A;  2HNY A;  4B9L A;  3TAF A;  4M3T A;  5E26 A;  3VQ7 A;  3VQC A;  4C8L A;  4Z4C A;  4F2S A;  3LM2 A;  2NUB A;  3ZT0 A;  4CHO A;  4JHD A;  1WAJ A;  3HOT A;  3V1Q A;  1U6Z A;  1N6Q A;  1TK0 A;  4DU3 A;  3VQP A;  3BGR A;  4XH4 A;  1A5W A;  4FXD A;  3QEW A;  3U3G A;  1YJ9 N;  4OVL A;  1BL3 A;  2E4L A;  4JD2 A;  3ULE B;  4O0I A;  2VGM A;  4FZZ A;  3ATU A;  3CER A;  1NJW A;  3KZB A;  1ASU A;  2E20 A;  4FWK A;  3TPQ A;  5KGX A;  3I33 A;  1NJI O;  1BCO A;  3MAQ A;  2OA8 A;  5B8H A;  3C65 A;  1ZC6 A;  3DLG A;  2Q97 A;  2E1Y A;  3ENH A;  4Z4I A;  4IKF A;  5IWA K;  1TYQ B;  3CCM N;  1S1W A;  3OBY A;  4DLE A;  3VQE A;  1NMN A;  2JWK A;  2HBL A;  5M1K A;  2PAV A;  3CHW A;  3QBW A;  4M7X A;  4OKK A;  4DG1 A;  4PHT X;  1C1C A;  4CZH A;  5J2N A;  3SAH A;  1NGF A;  1QVG M;  3M6G A;  1N5Y A;  4BVO A;  5GAE P;  2DFF A;  4FW1 A;  2HHX A;  1Q7Y O;  1NU0 A;  5DMR A;  4XH1 A;  1C0F A;  4CJU A;  1N33 K;  1WB9 A;  2X6N A;  3BEX A;  3P83 D;  1HNX K;  3EE9 A;  4I6M A;  2OTL N;  1QHT A;  4DS4 A;  3IDH A;  2BTF A;  4MO4 A;  4JYA K;  1X9W A;  2NRT A;  1QE1 A;  4B3R K;  4FWQ A;  5AFU A;  1L5U A;  3DLE A;  1TKZ A;  3RMA A;  1HPZ A;  1YIT N;  3KIO A;  3HBT A;  5GAH P;  4BGA A;  2YHY A;  1TGO A;  1EQY A;  4KO0 A;  5TKW A;  1BHL A;  3P4I A;  4H0X B;  1I3A A;  3CJ9 A;  1Y64 A;  3RR8 A;  1BO5 O;  1ZBS A;  1D4X A;  1I39 A;  1Q9Y A;  3PX4 A;  3HP6 A;  1NBW A;  2YNG A;  3ZET A;  3P31 A;  1ASW A;  4HUF A;  4C1N I;  2VQF K;  3JSM A;  4OGE A;  4M3R A;  4E19 A;  4CEZ A;  3OYM A;  2D0A A;  4JI8 K;  1REV A;  1N32 K;  3QB0 A;  1RIL A;  4I2Q A;  4UQG A;  3I0S A;  2QTD A;  4BRC A;  2OPR A;  3AA2 A;  3SUQ A;  4KH6 A;  4FJL A;  4CJW A;  2PYL A;  2O4I A;  4FCY A;  1ZXO A;  5M1Q A;  3F2K A;  4OJR A;  2LSN A;  3UIQ A;  4CFC A;  3OYC A;  4KI6 A;  3V1R A;  3TU5 A;  2ASO A;  4DU1 A;  1XHX A;  1B92 A;  1QQM A;  1S6Q A;  4CEF A;  3VEO A;  1SUQ A;  3S41 A;  3KK3 A;  1IBM K;  3LAN A;  1CLQ A;  1NK4 A;  4DR6 K;  4M3X A;  2RF2 A;  4JKF A;  3ZX2 A;  4N41 A;  2ZWH A;  2WOM A;  3J81 O;  2P9P A;  1M90 O;  3MN6 A;  1NKE A;  1OVY A; 
#chains in the Genus database with same CATH homology
 4KBO A;  5BRD A;  4IOC L;  3O6W A;  1ESV A;  1YJW N;  5AQX A;  1KQS M;  4CZG A;  2P9I B;  2D0O A;  2QWO A;  2YHX A;  4JKD A;  3MMV A;  5F0X A;  3FR0 A;  3KK7 A;  5CHI A;  1P8Z A;  4YOV A;  4K25 A;  3UB5 A;  2CGL A;  3VF4 A;  1VQP N;  5M1N A;  3UKR B;  4CD1 A;  5AZJ A;  1YVN A;  4Z94 A;  3N4Q A;  2OTJ N;  4JEP A;  3VEY A;  5C10 A;  3EE8 A;  5AQH A;  5AR0 A;  4H0V B;  4H5W A;  1K73 O;  4JK7 A;  1TUU A;  2HBM A;  4JKH A;  2QA4 N;  3QML A;  4BRE A;  3TTC A;  4B1V A;  1VQK N;  4C1N K;  3MN5 A;  4YOR A;  1ATS A;  5JVH L;  1TYQ A;  4BRI A;  4BY9 C;  4JKG B;  4ILH A;  3MCA B;  1VQ9 N;  4FWO A;  2HST A;  1YJN N;  1Q82 O;  2QM1 A;  2P9U A;  4BC5 A;  3CJ1 A;  4BRL A;  1YIT N;  2P9S B;  3DXM A;  4BC4 A;  1LOT B;  3WXI A;  3E66 A;  3CET A;  2A5X A;  3O9Q A;  4RCH A;  4B1X B;  4WCE L;  1WUA A;  5BPM A;  3AGR A;  3LDO A;  3O9U A;  1VQO N;  4BRD A;  4Y0W A;  3R8E A;  5AQN A;  3SMS A;  3OBW A;  4CBX A;  1BA0 A;  2Q31 A;  2P9K A;  3G71 N;  3MK6 A;  1BG3 A;  3QFU A;  4CZL A;  1O13 A;  2FSJ A;  3BP8 A;  3CC2 N;  1NWK A;  4XH5 A;  4GV3 A;  4ISE A;  3TTD A;  4I6M B;  3MN9 A;  1DEJ A;  3T7Z A;  2BH1 A;  1VQM N;  5KPZ A;  1G99 A;  5GIO A;  4A5B A;  3G6E N;  3ENB A;  2QW9 A;  4ILJ A;  3ID8 A;  3VES A;  4GY2 B;  5E84 A;  3DAW A;  1X3M A;  2CH5 A;  3IUC A;  3EKU A;  4MDB A;  4DQ8 A;  1SS6 A;  1ILY A;  4AF1 A;  2F9T A;  3WEE B;  3H3N O;  4OPA A;  1MWK A;  1K8K A;  3ZX3 A;  5AQQ A;  3M1F A;  3HOS A;  3FZK A;  5TKY A;  2E88 A;  2QWQ A;  1BDG A;  4EHU A;  5HL7 L;  3AAP A;  5AQR A;  1VQ5 N;  3E9L A;  2QWL A;  3IMX A;  2J4R A;  1TUY A;  3CJB A;  3QFP A;  3U4L A;  5M1P A;  4BRH A;  4BR5 A;  4M63 C;  3M5R A;  4YOT A;  2Q0U A;  3B8A X;  4BGB A;  4FPB A;  3O4W A;  5AQM A;  3ZET B;  2Q2R A;  1IG8 A;  4DB3 A;  4JKA A;  4DHY A;  3G4S N;  2VYP A;  3DWL A;  3F9M A;  3MX2 A;  3KVG A;  1YXQ A;  5BR9 A;  1XQS C;  3QDK A;  4H5N A;  2QWM A;  1NGB A;  5FPN A;  1SZ2 A;  2HF4 A;  3CIP A;  4EHT A;  3CMA N;  4IJN A;  1T44 A;  1NGH A;  3L0Q A;  3C6A A;  1VQ4 N;  3MWP A;  3CPW M;  5KQ8 A;  1SQK A;  5F2R A;  4EIA A;  5KQD A;  4KH4 A;  4O8K A;  3OHR A;  4IXC A;  3WXM B;  5LY3 A;  4J8F A;  2A42 A;  4BC2 A;  3E1Y A;  3M3Z A;  4KH5 A;  4YOU A;  2ZGZ A;  4JHD B;  1BA1 A;  5AQF A;  3VOV A;  4CJ7 A;  3MN7 A;  3AGK A;  3O1W A;  2D1K A;  5BRH A;  1NLV A;  5EX5 A;  4RWT A;  4XEI A;  3CCV N;  3A5O C;  1MWM A;  2GEM A;  3O1B A;  3D6R A;  4IEE A;  2YX6 A;  1JCG A;  1P90 A;  3UKU B;  3VEW A;  3CJA A;  5DM7 L;  4YOW A;  1QQO A;  3DXK A;  4JK9 A;  5AQO A;  4K43 A;  5AQY A;  5EXW A;  3R9P A;  3CCE N;  4IO8 A;  2E2Q A;  3D2E A;  3VPZ A;  4CZI A;  4CZM A;  4JD2 B;  5GIP A;  3C7N A;  3I8B A;  4FWR A;  2NZT A;  3ZYY X;  2ASM A;  4WQ5 A;  3O9R A;  2P9N B;  1K8A O;  4WQ5 C;  3VER A;  4L3Q A;  3GDQ A;  1X3N A;  4FOI A;  3FE1 A;  3R3L A;  5AZI A;  3P38 A;  4NO7 A;  4A5A A;  3CPE A;  5AQK A;  2E8A A;  2OAN A;  3HZ6 A;  4BQL A;  2FLO A;  2HOE A;  2VGN A;  3GE1 A;  5JLF A;  2AP1 A;  4K42 A;  3VET A;  5GAD P;  2WBN A;  2A3Z A;  3I56 N;  1NGC A;  3H3O B;  3LM9 A;  3PLA A;  1YHQ N;  3ULE A;  4K41 A;  3CXC M;  4FWL A;  3CC7 N;  3VGK A;  3ZX0 A;  1J6Z A;  4R79 A;  3U9Z A;  2GUP A;  3FFK B;  4GV9 A;  5AQW A;  2CH6 A;  3VEZ A;  1M1K O;  3HRG A;  4JN4 A;  1GLD G;  5AQU A;  1QHA A;  1Z05 A;  3VF6 A;  1QZ6 A;  2BUP A;  2DPN A;  4JAX A;  4BRA A;  3I55 N;  4LC9 B;  2V7Y A;  5CE3 A;  3CF5 L;  5HOO A;  1ATR A;  1CZA N;  2KKZ A;  2NRW A;  2P9I A;  3HM8 A;  1YF5 L;  4B9Q A;  4EFH A;  2GWK A;  1R59 O;  3UKR A;  5AQV A;  3KHY A;  5F1X A;  3R6M A;  4BRQ A;  3HI0 A;  2KLA A;  2NRH A;  2CGJ A;  3QIC A;  4BG9 A;  1DKG D;  4BRK A;  1S3X A;  3TSQ A;  3WQT A;  2QWN A;  3H1Q A;  4OO1 J;  3JS6 A;  4CI6 A;  1NGA A;  4FWP A;  5M1F A;  2QI2 A;  2V51 B;  4EAH D;  4WF9 L;  3PIO L;  1YAG A;  1JCF A;  4JKG A;  2WUS A;  5I9E B;  2GWJ A;  3TSU A;  4WFN L;  3EN9 A;  1YIJ N;  4QS8 A;  3UE5 A;  2P9S A;  3SLC A;  3A8Y A;  4G9Z A;  1RGI A;  1BU6 O;  2HF3 A;  1NGE A;  2Q0R A;  3O9T A;  3SBT A;  2QEX N;  3SMP A;  5ADX H;  3BF3 A;  4BR4 A;  1KAZ A;  2A6A A;  4WQ4 A;  2VWB A;  2F9W A;  4JNE A;  4GV6 A;  3J8A A;  4WQ4 C;  2E2N A;  2FF3 B;  3JXU A;  1GLE G;  2RHK A;  5C2D A;  2ASP A;  3BF1 A;  3K9J A;  4U67 L;  2GTD A;  4A2A A;  3A5N C;  3KWG A;  2IVO A;  3F5T A;  1KAX A;  3SJH A;  3E9O A;  4BRG A;  1KC8 O;  2QWR A;  5AQS A;  4BRF A;  1JJ2 M;  1T3V A;  3ATV A;  1VQ7 N;  4IOX A;  1MDU B;  2GX9 A;  2F7T A;  5FPE A;  3KWI A;  5BRE A;  1GLF O;  1U2V A;  3GL1 A;  5MLC Q;  4A2B A;  5C15 A;  4O8U A;  5ADX A;  1RDU A;  3L4Q A;  3SK3 A;  3WEE A;  5GAG P;  2ZGY A;  4ISF A;  3LDP A;  4BRN A;  1E4F T;  3CQY A;  1ATN A;  1BWF O;  4JKC A;  2FSN A;  1VAZ A;  2FSK A;  3WXJ A;  3O08 A;  5BN9 A;  2ITM A;  3SAG A;  2E1Z A;  2H3G X;  2WFB A;  3WQU A;  1Z6R A;  3HSC A;  2HBJ A;  5EOY A;  3ID6 A;  2Q36 A;  4HTL A;  2IVN A;  3TTF A;  3CCJ N;  4FWS A;  3VGL A;  4A61 A;  2HMP A;  3G25 A;  4IDH A;  1JCE A;  5CR4 A;  5C0Y A;  3C6H A;  3VMF B;  4PKH A;  3A0I X;  4PL7 A;  3RSE B;  1GLJ O;  2NRR A;  2D0P A;  2PFU A;  3T69 A;  3H46 O;  3W3D A;  4BQZ A;  5BPN A;  4AM6 A;  2W40 A;  1E4G T;  1KXP A;  1LCU A;  2D4W A;  1HKG A;  2CGK A;  5AQI A;  1QVF M;  2E2P A;  1RFQ A;  4CZF A;  4E1J A;  3WT0 A;  2JWL A;  1YUW A;  2PBD A;  3D2F B;  2V7Z A;  2RE2 A;  4CD3 A;  2A41 A;  1HUX A;  1VQL N;  2QXL A;  3CI5 A;  5JVG L;  5FPD A;  2YHW A;  5E26 A;  3H6E A;  3O8M A;  4PKI A;  2YJE A;  2YCH A;  2P9L A;  3LM2 A;  4DKW A;  3QBX A;  4PL8 A;  4JHD A;  1IJJ A;  2Q1N A;  4H5R A;  5BPL A;  3CD6 N;  2ZF5 O;  3D2E B;  3WXK A;  3HOT A;  3OW2 M;  1U6Z A;  3C7N B;  3VTH A;  3EO3 A;  3LDL A;  1BUP A;  3EL2 A;  3CCS N;  3VGM A;  2P9P B;  3GBT A;  4XH4 A;  4BVP A;  3H45 C;  4H03 B;  2IIR A;  4FSV A;  4B1Z A;  5AZI B;  3UKU A;  2AA4 A;  5JIC A;  1YJ9 N;  2GEL A;  2UYT A;  3OA9 A;  3GG4 A;  1NMD A;  5JLH A;  4JD2 A;  4H0T B;  4OPH A;  4B1W B;  3DLL L;  3ULE B;  3BUZ B;  2VGM A;  3ATU A;  3CER A;  1VQN N;  1VQ6 N;  4M7Y A;  1GLL O;  3ZEU A;  3KZB A;  2P9N A;  1N8R O;  2VCP A;  2E20 A;  5AZJ B;  3LDQ A;  4FWK A;  3TPQ A;  3K9K A;  3I33 A;  1NJI O;  4NB4 A;  4QS9 A;  5B8H A;  4YOX A;  1VQ8 N;  3C65 A;  5AQP A;  3CC4 N;  3FLC O;  3W0L A;  1ZC6 A;  4GNI A;  2Q97 A;  2E1Y A;  1H1V A;  3LL3 A;  3ENH A;  4CBW A;  3IFR A;  4BR0 A;  4IJA A;  3DJC A;  1TYQ B;  4AM7 A;  1HJO A;  3HTV A;  4FL9 A;  4YOY A;  2V52 B;  5BN8 A;  3CCM N;  4FVU A;  2P9U B;  4PKG A;  3OBY A;  3DXM B;  3O80 A;  4CBU A;  1KD1 O;  2JWK A;  3VTI A;  2HBL A;  2YI1 A;  5M1K A;  2PAV A;  3J7Z O;  4BR7 A;  4FOE A;  3CHW A;  3QBW A;  3CCR N;  3EZW A;  4FWN A;  4M7X A;  2KHO A;  3CJC A;  2W41 A;  4PHT X;  2P9K B;  3SBG A;  1NGG A;  4CZH A;  5AQL A;  3SAH A;  4IO9 L;  3MCP A;  1NM1 A;  1NGF A;  4FPA A;  1SAZ A;  1T6D A;  4UY8 O;  1QVG M;  1XUP O;  3M6G A;  4B1Y B;  5AFU H;  4BVO A;  3Q7C A;  3FZF A;  5GAE P;  1Q7Y O;  3U9D A;  1C0G A;  1K9M O;  4YDU A;  1EO1 A;  5AQZ A;  4XH1 A;  1C0F A;  1WOQ A;  1KAY A;  1HKC A;  3GOI A;  3BEX A;  1T6C A;  4RTF D;  4YDU C;  3TSP A;  5LJW A;  1S72 N;  3VEX A;  4MLE A;  1DT9 A;  1S22 A;  1HLU A;  3NMU A;  1K8K B;  3EE9 A;  4MLH A;  4I6M A;  3MX5 A;  2OTL N;  3VF2 A;  5EVZ A;  4U7B A;  3IDH A;  4H0P A;  2NRX A;  1NGJ A;  2BTF A;  4JKE A;  1X9J A;  3NVK A;  4MO4 A;  1DGK N;  3FZH A;  2NRT A;  2QWP A;  3FZM A;  4O5F A;  1GLC G;  4BRM A;  4FWQ A;  5AFU A;  4CZE A;  3CCQ N;  1XC3 A;  3RVC A;  4BC3 A;  1GLB G;  3AAQ A;  5FPM A;  4CZJ A;  4H5T A;  1HKB A;  1YI2 N;  4GVE A;  5KPT A;  5JMV A;  5GIN A;  2WC9 A;  5BRF A;  3CJ7 A;  1U2V B;  3HBT A;  1MA9 B;  5C12 A;  5GAH P;  3CCL N;  1HX1 A;  2YHY A;  4B1U B;  4BGA A;  1EQY A;  1QZ5 A;  5M1O A;  3MDQ A;  5TKW A;  4FWM A;  2NNW A;  3SAF A;  3AAR A;  4A59 A;  3FGU A;  3Q7B A;  5H1S Q;  3WUH A;  4ILG B;  1V4T A;  3ENO A;  5ELZ A;  3MWT A;  4JKB A;  2YJF A;  3P4I A;  4H0X B;  3CJ9 A;  2I7N A;  1Y64 A;  2NRV A;  3NVM A;  1BO5 O;  2NRZ A;  3VEN A;  1ZBS A;  1D4X A;  4ISG A;  4DCH A;  4BR9 A;  1RDW X;  5AQT A;  1NBW A;  4H0O A;  4BRP A;  3ZET A;  3P31 A;  4A62 A;  2A40 A;  4C1N I;  4HWI A;  1NGD A;  5DM6 L;  3U8X A;  3LDN A;  4QS7 A;  3VEV A;  1V4S A;  3QB0 A;  1Q18 A;  2E2O A;  4IWV A;  4IOA L;  1GLA G;  3IKM A;  3L6Q A;  4FO0 A;  1BOT O;  2QTD A;  5LJV A;  4BRC A;  4WYB A;  3R1X A;  3RSE A;  4KH6 A;  5EY4 A;  3E9P A;  1W2B M;  3D7E O;  3P39 A;  3CCU N;  1Q86 O;  2EWS A;  4BG8 A;  3DXK B;  1ZXO A;  3AY9 A;  3EKS A;  5M1Q A;  1QQN A;  3F2K A;  4NLC A;  2FF6 A;  2P9L B;  3O9S A;  2FXU A;  3N4P A;  4F9O A;  4C23 A;  3D2F A;  3CME N;  3TU5 A;  2ASO A;  2HBK A;  5KPR A;  3C0B A;  4H0Y B;  2ZJQ L;  4A57 A;  1QQM A;  4IZ9 A;  1NGI A;  3VEO A;  3FZL A;  4MDA A;  4IFE A;  4NLB A;  1Q81 O;  3S41 A;  3L4I A;  5C2F A;  3O5B A;  2ZJP L;  4BRO A;  2NLX A;  4H5V A;  4JK8 A;  4MO5 A;  1W97 L;  5AQJ A;  3PIP L;  2IVP A;  4JKF A;  3WXL A;  3ZX2 A;  3A5M C;  1OKJ A;  2I7P A;  4WFB L;  2ZWH A;  4IEI A;  4WFA L;  3ZEU B;  2ZJR L;  3CQX A;  2P9P A;  3H1V X;  1M90 O;  3MN6 A;  1HPM A;  5AQG A;  3A5L C;  4CZK A;  1OVY A;  4BR2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...