1RBRA

Structural study of mutants of escherichia coli ribonuclease hi with enhanced thermostability
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
155
structure length
155
Chain Sequence
MLKQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAAIVALEALKEPCEVILSTDSQYVRQGITQWIHNWKKRGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERCDELARAAAMNPTLEDTGYQVEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE H
publication title Structural study of mutants of Escherichia coli ribonuclease HI with enhanced thermostability.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase(endoribonuclease)
total genus 50
structure length 155
sequence length 155
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 1993-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1rbrA00
2DFHA 1JL1A 1JLCA 2NUBA 3VQ4A 3QESA 2PYJA 1IKYA 1TKDA 3HO1A 1JLQA 1SKRA 1HYVA 3CFRA 3L3UA 3TAMA 3RRGA 1GOBA 1TKTA 3NF8A 4CEBA 4KHQA 2VG7A 4KV8A 4E0DA 4PY5A 1D8YA 3IRXA 2P1JA 5JS2A 4B3OA 2HW3A 2YNGA 4XIUA 1TKXA 1BI4A 4OKJA 3NAEA 3ZCMA 4DWIA 5EU7A 1WN7A 1Q9XA 2G8VA 4F8RA 4HUFA 3KLHA 5HP1A 3P83D 3HP9A 4DTRA 5KRTA 4FJJA 3L2QA 4FJNA 3ZT0A 3PUFA 3TR8A 4OKKA 4CCHA 1DLOA 2OPQA 4DSLA 2F8TA 2QKKA 3K5NA 4KREA 2KZZA 2HHWA 1Q8IA 3C6UA 4C8KA 4F4KA 4FZYA 4DQSA 3MEGA 3T19A 3WNEA 1S9GA 1S9EA 4ZTJA 1YVUA 4KKOA 4DFPA 1C0MA 4CESA 3AVCA 1QSLA 3LP2A 1RDDA 4CE9A 2Y1IA 2GBZA 2RKIA 3AVAA 1U49A 2F96A 1TVRA 4WE1A 4CJLA 1J54A 4KTQA 2HHXA 2A1SA 1VSDA 2IC3A 4CHQA 2PYLA 3AVKA 4AHVA 4C8NA 4FCYA 4N47A 1VRUA 3NF7A 4FLVA 4Q5VA 3HVRA 3CG7A 3MXMA 4RW6A 3IAYA 3AVIA 1T05A 3M8RA 1NJZA 3LPTA 1SL1A 4AHRA 3O3HA 4I2PA 4KAZA 4CGDA 4ELTA 3MECA 3K58A 4B8CA 3CFPA 4F2SA 5KGXA 3OYBA 1VSKA 3DOKA 2BANA 1X9SA 3OYCA 1LWCA 4M45A 4E89A 3O3FA 1XWLA 1LW0A 2QK9A 4E7IA 4CJUA 3SUNA 1Z26A 2OPSA 4FK4A 2E4LA 1WNSA 4FVMA 4CK1A 5HRPA 3HK2A 4DQQA 4C8OA 4ZHRA 4CGGA 3NHGA 2KFNA 3DLEA 2ATQA 4CJEA 3LWMA 3HSTB 4M42A 2YHAA 3MXIA 4CIEA 1S1VA 3SNNA 2OZSA 3DRPA 3NH2A 3UIQA 1HNVA 1NK8A 2LSNA 3HP6A 4W5QA 3ZSWA 4DF4A 4E7KA 3D0PA 2Z1IA 4DSFA 3AO1A 4N41A 3HJFA 5I42A 1NOYA 4KFBA 3U3YA 3AA5X 3VQDA 3A2FA 2P5GA 2FBXA 4J2BA 3HL8A 4Y1DA 4CEZA 4NCBA 1O1WA 3OYIA 1RCHA 1LAWA 4Z4GA 1C0TA 4BE2A 1QHTA 2I5JA 3CM6A 3EZ5A 5J2PA 3PV8A 4IG0A 1KVCA 2D0AA 1HPZA 3LP3A 4NYNA 3DRRA 4NYFA 2P51A 4O44A 4B08A 4CJ3A 5KRSA 3CM5A 1T03A 1KFSA 3RWUA 1I39A 3K5LA 4KO0A 4H8KA 4FJIA 2DFFA 2HHTA 4CEOA 3V9XA 5HRSA 4QOZB 1CZ9A 3LANA 3OVNA 4M41A 3DYAA 1RTJA 4B9LA 5D3GA 3P5JA 3VQ8A 1ITGA 1KTQA 3V9UA 1RBUA 4QCLA 3AVNA 3TANA 2G8HA 4DQIA 1FKOA 3ASMA 3ZSRA 1T8EA 1LW2A 1Y97A 1BIZA 2KW4A 3PO4A 3D45A 1NK4A 4Y1CA 1RDBA 3AA3A 4M3TA 3F73A 4JS4A 4CIGA 3QEXA 1YTUA 1WAFA 2YHBA 4EZ6A 5J2MA 4G1QA 1NK7A 4HVJA 3DLHA 2XHBA 3VQCA 4B9UA 3CFOA 3RRHA 4QAGA 3SI6A 3U6FA 1RBRA 2Q3SA 5DMRA 4FLZA 3T3FA 1J5OA 5K14A 3WNGA 4CJQA 3TAFA 2O4GA 2B6AA 1MU2A 1S1UA 1ZYQA 3M8SA 1BI4B 4CJKA 1N5YA 1B9DA 1D5AA 4O5BA 4DLEA 2BGGA 1RDAA 1VSHA 3K5OA 3MEDA 4CJ4A 3QNNA 4CGFA 5C42A 1TK5A 4FJLA 4FK0A 4CEEA 2QXFA 3TAQA 1U45A 1UA1A 4BWMA 3HYFA 4Z4CA 1CLQA 3I0RA 5J1EA 4I9QA 3QEVA 4IFYA 2FC0A 1N6QA 1S6QA 1QSYA 4DSIA 3KD5E 1HMVA 4MQ3A 4K8XA 2IAJA 3OS2A 3G10A 3O4QA 1TK8A 4DTSA 4F2RA 2RPIA 4Z0UA 4BACA 1NK5A 1BGXT 1FXXA 3KK2A 2XY8A 4E1MA 3CQ8A 3VQ9A 3DLKA 5CZ2A 3OYHA 2F8SA 1TGOA 4CFDA 3VA3A 4E7LA 1BQMA 4O0JA 4DG1A 4DFJA 3TAEA 1L3UA 3RR7A 3QLHA 4FJGA 3DI6A 4CHOA 4FLUA 2FBYA 3MEEA 3L3VA 1JLEA 1WSIA 3QEPA 1IKVA 3KLEA 2G8WA 5C24A 4YFUA 5J2NA 1RTDA 4W5OA 1LAVA 1VSMA 1JLAA 1J9AA 2D5RA 4DQRA 4W5NA 4Z4HA 1EKEA 4CFAA 3DLGA 3HT3A 1BHLA 5FDLA 4DTUA 4J2EA 3NBPA 3TWHA 4OPKA 3PX0A 3NF6A 4DSKA 3RR8A 1HJRA 4HCCA 4KHNA 2DFEA 4OLAA 2RN2A 1RDCA 4Z4IA 1QS4A 4DSEA 1XI1A 3NDKA 4HTUA 3ZSXA 4FJ8A 4CJWA 3KTQA 4N76A 1TK0A 4LY7A 4DQPA 2KTQA 2E6MA 3KLIA 1JXBA 4FM1A 3ZSVA 2KQ2A 4IG3A 3MAQA 4KHYA 1R0AA 3ITHA 1ZBUA 3EY1A 2DTUA 4AHCA 3K57A 4E7JA 4DS4A 1HRHA 3SQ0A 1I3AA 4FK2A 4M3XA 4H4OA 3AO5A 4KHSA 1BCOA 3KLGA 3K59A 4CF9A 1DTTA 3OYJA 1NJWA 3BGRA 3HM9A 4E7HA 4RW8A 3LAMA 1JKHA 3OYKA 3LDSA 4BDZA 4KB1A 4KRFA 2DY4A 1F21A 2PY5A 3SPYA 2Z1GA 1RT5A 1REVA 3VQPA 3NGIA 1ZBLA 4FXDA 1WSGA 3OYMA 2HVIA 3AO4A 5HRNA 1CZBA 1U04A 4AHTA 4FLXA 4HUEA 1KRPA 4HUGA 1NKEA 3LPUA 3QIPA 4KI4A 4FZZA 1SV5A 2YV0X 3QIOA 3IG1A 4CF1A 4OKEA 2IGIA 3S3NA 4CJVA 3NH1A 3M8QA 4LH5A 3OJUA 1KCFA 1IH7A 3ZT4A 3DRSA 1A5WA 3SQ4A 1NJYA 2RF2A 4M3YA 2AJQA 1T7PA 2HNZA 1NOZA 4C8LA 3AVJA 4JLHA 3SCXA 5I3UA 4BE1A 1EXQA 3S3OA 4K8ZA 2YNHA 4DTJA 4EP4A 4CJFA 3SYZA 1X9MA 1WAJA 4FJ5A 5FRNA 3OYGA 1S1TA 5SWMA 3L2RA 3KIOA 4J2AA 4KHWA 4CF8A 4ELUA 1UA0A 4B8AB 3S9HA 4DTXA 1TV6A 1QSSA 1NKBA 2IDOA 4FW2A 4LD0A 3T1AA 3WNHA 3PX4A 5FROA 4F3OA 4B9MA 1U48A 5FRMA 3QEWA 1ZBHA 2B4JA 1VSLA 1RBTA 1W9HA 4CEDA 3L8BA 4M3WA 2HNYA 1SL0A 3TI0A 3TAGA 1RTHA 2YNFA 3OYEA 4FZXC 1A5VA 1NK9A 1S1WA 3IS9A 1VSFA 2G8FA 4AHUA 4CHYA 4AH9A 4M3RA 1WSEA 4DSJA 3LZJA 3ZT2A 4CHPA 3NCIA 4CJPA 2G8UA 4H4MA 4IKFA 4CHZA 3O3GA 3ISNC 4I2QA 2WOMA 3EYZA 1NK0A 4PUOA 1UWBA 2HHSA 4JRPA 4DTPA 2G8KA 4KTZA 4OPJA 3HPOA 3VQQA 3PX6A 4ZTFA 1SKWA 4NCAA 4AHSA 1GOCA 1RT3A 2E6LA 3SUQA 3OYFA 1JLFA 1WSJA 1B92A 5KGWA 3DOLA 3JYTA 3RMDA 2Z1HA 5HROA 1JL2A 3RMBA 4EZ9A 2IS3A 4CGIA 4AILC 1KVAA 4L8RB 1EETA 1ZBFA 2OYQA 1UOCA 3DM2A 1LV5A 1DTQA 4FJ7A 2JLEA 3CYMA 3I8DA 3V9SA 1B9FA 3VA0A 3V9WA 3SZ2A 1KVBA 3RMAA 3VN5A 1VSJA 1X9WA 4C8MA 4E3SA 4KTWA 4CF2A 5DK5A 1SKSA 2HVHA 4DMNA 3TABA 4MFBA 3KK1A 1L5UA 1ZBIA 3ULDA 3WNFA 3VQ7A 4DTOA 4DU3A 3SJJA 4PQUA 1JLGA 1TAUA 1C0UA 2KFZA 3F9KA 5CZ1A 2QKBA 2W42A 4W5RA 1JLBA 3AA2A 4RW4A 4CJSA 3SUOA 3AO3A 1Q9YA 4PWDA 3LP0A 1K6YA 4FLYA 3LWLA 2XY7A 1C1BA 2ZD1A 2XY6A 1LWEA 3V4IA 4EP5A 1EX4A 3AA4A 3KKSA 3KKRA 4LSNA 3VQ5A 4R5PA 2OZMA 2A1RA 2Z1JA 4CF0A 2VWJA 3KD1E 3THVA 2VG5A 1FKPA 1HQUA 1VK0A 1VSEA 4I9LA 4TSXA 3OS1A 4DFKA 3PY8A 1W0HA 1RTIA 2X6NA 3AVFA 3LAKA 4CECA 3LZIA 4CJ5A 1IG9A 3K2PA 3C94A 1RT2A 3ALYA 4FLTA 4FJMA 1C1AA 2YKMA 2D0CA 2X6SA 4IBNA 4ICLA 3ZSOA 4PA1A 4DTMA 3QERA 1U4BA 1BL3A 3OYAA 1RBVA 4OLBA 3RMCA 2G8IA 1C1CA 1C6VA 2BE2A 3JSMA 5HRRA 4YNQA 3PO5A 2IOCA 3VQ6A 4B9TA 1TKZA 1CXQA 3SUPA 4BE0A 2FBVA 5KTQA 3B6PA 4KHUA 3C95A 4OGCA 3KK3A 1NJXA 3M8PA 2YKNA 3U3GA 3K5MA 3RTVA 3L2VA 3SQ2A 1HNIA 3SPZA 3OYNA 4FYDA 1NK6A 1WSHA 2XRIA 4RW9A 3E01A 2X74A 3QINA 3OYLA 1Z25A 4CEAA 3KJVA 4CEQA 4FJHA 1CXUA 4IFVA 3HPHA 3G0ZA 4DFMA 3QEIA 1KLMA 4NCGA 1VSIA 4OVLA 1IKWA 4O0IA 2HHUA 3AVHA 4J2DA 2HMIA 4DF8A 3C6TA 2EX3A 4FJKA 1BISA 2JGUA 4GW6A 5C25A 2HB5A 4KI6A 4CGJA 3V1QA 3VQEA 1JXEA 5CYMA 4CHNA 2VG6A 4FW1A 1ASVA 4BDYA 1RNHA 1L3SA 1WLJA 4ID1A 4N56A 3L2UA 4DLGA 1SUQA 4HCBA 3DLRA 3B6OA 4OJRA 1HYZA 2WONA 3AO2A 3OYDA 4DTNA 2HHQA 1BCMA 4FM0A 3H08A 4B9VA 1FK9A 3HXMA 2OPPA 3OY9A 1L3TA 4Z4EA 3ZT1A 5JS1A 1S6PA 4LSLA 4OGEA 1TL3A 1WSFA 5CY4A 1RBSA 3VQBA 3HPGA 3HVTA 1HQEA 2GUIA 2HHVA 3LALA 5HBMA 3OS0A 5KI6A 3MXJA 2Y1JA 1TL1A 3DMJA 4KPYA 1QE1A 2GV9A 3NGZA 3P1GA 3V1RA 3KLFA 3O4NA 4CERA 2B5JA 3L2WA 5T7BA 4ID5A 2XO7A 1IKXA 3SV3A 4B9NA 5E41A 4N5SA 4CK3A 2PZSA 1GOAA 4F3TA 1KFDA 4CFCA 1X1PA 1RT4A 1ASUA 1SL2A 4Q0BA 3AVLA 4RW7A 4DS5A 2OA8A 3BDPA 3TAPA 1D9FA 3NFAA 4CGHA 1UAXA 2KZMA 1RT1A 4HHTA 4DU4A 4W5TA 2HNDA 1NKCA 1A5XA 4CIFA 3TARA 1XHXA 1RILA 2ITGA 4GVMA 3ZSZA 4CEFA 4KB0A 3S3MA 4BDPA 4JRQA 1RT6A 3OJSA 3DLBA 2O4IA 1XHZA 2ZE2A 1QQCA 3SQ1A 1KSPA 4DU1A 3V9ZA 1BIUA 1YTAA 3I0SA 3QETA 4JS5A 4CK2A 1U47A 3NE6A 1D9DA 3NGYA 4IDKA 2VWKA 4O4GA 4E1NA 5SZTA 1ASWA 5CYQA 3ZSYA 3V81A 1L3VA 4BWJA 4ELVA 2X78A 3LP1A 4Z4FA 2EHGA 2BDPA 1J53A 1RT7A 5J2QA 4UQGA 4CFBA 2FBTA 4B9SA 3SV4A 4LH4A 3NH0A 3ZSQA 1S1XA 1YT3A 4FLWA 4FM2A 2OPRA 1LWFA 1TAQA 3V6DA 4E19A 2R7YA 4CJRA 2ETJA 4M3UA 3AVGA 1VRTA 2XY5A 2YNIA 2D0BA 4RG8A 1S5JA 4O55A 3ZT3A 3VQAA 4M3ZA 3AV9A 1KLNA 1IO2A 1XC9A 3AVMA 4CJTA 5HLFA 4I7FA 3QNOA 2P5OA 4FJ9A 3QO9A 1BQNA 3AVBA 1G15A 4GMJB 4FJXA 2ZQBA 3V1OA 3NF9A 1EP4A 3FFIA 1QTMA 1HYSA
chains in the Genus database with same CATH superfamily
3F2KA 2DFHA 5F2RA 1WBDA 1VQLN 1TKDA 2P9PA 5KQDA 1HYVA 4JI6K 3L3UA 1GOBA 4L3QA 4CEBA 2VG7A 4E0DA 4PY5A 1SZ2A 5JS2A 2KLAA 2YNGA 3NAEA 1TKXA 3EEQA 4DWIA 1OKJA 3ZCMA 2G8VA 1WN7A 4JI8K 3ID8A 5HP1A 1BWFO 5KRTA 3IMXA 1QVFM 3PUFA 4OKKA 2OPQA 3DXKA 2NNWA 4C8KA 4DQSA 1YVUA 4KKOA 4DFPA 5AQMA 4CESA 1QSLA 2A41A 1RDDA 4MO5A 4CE9A 2GBZA 2RKIA 3AVAA 1U49A 2OTJN 1TVRA 4CJLA 2HHXA 2A1SA 4AHVA 3J81O 4C8NA 3TSQA 4FCYA 3CJCA 5GIPA 3DWLA 3HVRA 3C7NB 3MXMA 5AFUH 4BR4A 4JI5K 4F9OA 5AZJB 3O3HA 4O5FA 3MECA 3K58A 3CFPA 5KGXA 5M1FA 1X9SA 2BANA 3OYCA 4M45A 1XWLA 3C7NA 3UB5A 3BZCA 1YXQA 4CJUA 2E4LA 2BH1A 4H0PA 5AZJA 1N32K 3CHWA 5HRPA 4CK1A 4LF8K 3VTHA 5AQTA 4JI3K 4BG9A 1K8AO 2UUAK 1HNWK 1T3VA 1Q82O 3MXIA 4GKJK 3PSIA 3NH2A 3UIQA 4LFAK 2LSNA 4DF4A 3CC2N 4GV9A 4DSFA 3SJHA 3AA5X 3VQDA 2GUPA 4DHYA 2P5GA 2JWLA 3HL8A 4Y1DA 4NCBA 4OX9K 1RCHA 3CD6N 4BE2A 1GLFO 3CM6A 5C15A 4IG0A 3LP3A 3DRRA 3LDOA 5EOYA 4B08A 4CJ3A 4B3RK 3CM5A 4KBOA 5BR9A 4QOZB 1CZ9A 3LANA 3M5RA 3VEYA 3P5JA 1ITGA 1KTQA 3HOTA 1IG8A 4AF1A 3CCQN 3BF3A 1T8EA 1BIZA 4Y1CA 1RDBA 3AA3A 4M3TA 4JS4A 4O8KA 2QTDA 4JKGA 4YOXA 4B9UA 2HF3A 3CCVN 1N8RO 4ISGA 3SLCA 5K14A 4CJQA 1ESVA 4K25A 4CZLA 3O6WA 4C1NI 5BN8A 3M8SA 3OA9A 3M6GA 1TK5A 4FJLA 2QXFA 4BROA 3HYFA 4Z4CA 3MN6A 1Q86O 4FWMA 3KD5E 4MQ3A 4K8XA 3QFPA 5JMVA 3O4QA 4BC4A 1NK5A 1VQ4N 4IO9L 1W2BM 3BZKA 5CZ2A 1TGOA 4E7LA 1M90O 4FJGA 1L3UA 2QWNA 3MEEA 4WYBA 5C24A 1RTDA 5FPEA 1Q7YO 3CCEN 2EWSA 1BA1A 2FXUA 1W97L 3TTFA 3HT3A 5LMUK 2HSTA 5FDLA 4DTUA 3PX0A 3K0SA 3TWHA 2VCPA 3NF6A 4ISFA 2P9UB 4HCCA 4KHNA 3E9LA 1VQ8N 1QS4A 1XI1A 2QI2A 4FJ8A 5AQJA 4FM1A 3H1QA 3K57A 4DV4K 2P9UA 1CZAN 4H4OA 3AO5A 3MK6A 1SAZA 4KHSA 2KKZA 3OYJA 4DV1K 4GV6A 3LAMA 1JKHA 3CETA 3OYKA 3LDSA 4BDZA 4KRFA 2DY4A 2Z1GA 3VEZA 1RT5A 4QS9A 1REVA 3NGIA 1RFQA 3AO4A 2P9SB 5B8HA 1CZBA 3SMSA 4AHTA 3BF1A 4XH4A 2F4VK 1LCUA 2PFUA 4KI4A 3H46O 3GBTA 3K9JA 2IGIA 4E1JA 4KH6A 3FZFA 4CJVA 4LH5A 4U67L 3H3OB 3MX5A 1KCFA 1IH7A 3ZEUB 3CI5A 3SQ4A 1T44A 1T7PA 3T69A 2P9SA 3J8AA 3AVJA 3MX2A 4BE1A 3S3OA 4DV5K 1Z05A 4K41A 4A59A 3SYZA 4KHPK 3KIOA 4J2AA 4KHWA 4CF8A 3S9HA 3BY5A 3ZEUA 4DTXA 5TKWA 4U7BA 3WNHA 4FL9A 3QEWA 4PKHA 2QA4N 1W9HA 3VGLA 1OVQA 3TI0A 1YI2N 1RTHA 3O4WA 2YNFA 4AHUA 2BTFA 1WSEA 4DR5K 4H4MA 4IKFA 4PUOA 4I2QA 1NK0A 4DV6K 4BRIA 4KTZA 3VF2A 4OPJA 3HPOA 3PX6A 3ZETB 2QWOA 1RT3A 2A42A 4CBUA 3SUQA 2A3ZA 3Q7CA 5KGWA 1JCEA 1E4FT 3UKRA 3RMDA 4FVUA 1JL2A 4EZ9A 2IS3A 3VEWA 4AILC 4PL7A 4L8RB 1IBMK 3ZETA 4FJ7A 1DTQA 3CYMA 5CR4A 1B9FA 3SZ2A 4JK9A 3RMAA 4GNIA 3VN5A 4KTWA 4IJAA 4H5TA 4CF2A 5AQOA 4ILGB 4DMNA 3TABA 2NRXA 4JEPA 1ZBIA 3VQ7A 4DTOA 4DU3A 5AQGA 3VEXA 2KFZA 5BR8K 3WXIA 2QKBA 4W5RA 4RW4A 1Q9YA 3AO3A 4FLYA 3LWLA 2E5LK 2XY7A 1C1BA 3VGKA 1EX4A 1T6DA 2OZMA 2Z1JA 2VG5A 4M7XA 1HQUA 2ASOA 3TTDA 4DR3K 1VSEA 4TSXA 4DFKA 3ALYA 2NRRA 1YITN 3NMUA 5AQWA 4PA1A 1U4BA 1BL3A 1RBVA 4IZ9A 4GKKK 3JSMA 5HRRA 2NRVA 4DUZK 3LM2A 2FBVA 2ZF5O 2P9NB 2Q2RA 3A5NC 3O80A 3K5MA 3THXB 3L2VA 4FYDA 1WSHA 3QDKA 3E01A 3OYLA 4BRMA 1I94K 1CXUA 3HPHA 3G0ZA 4CVNE 4NLCA 1IKWA 3AVHA 5AQUA 4EAHD 3T1HK 2HMIA 3C6TA 3F9MA 4BC2A 3THXA 2JGUA 5C25A 2VYPA 4FPAA 2HOEA 5FPNA 1J6ZA 1X3NA 2VG6A 3CCRN 4FWKA 2HBJA 3L2UA 1SUQA 4HCBA 3DLRA 4OJRA 3OYDA 2WONA 5BRFA 1BA0A 2OPPA 3HXMA 3OY9A 4K0KK 3LDPA 1S6PA 4LF5K 4OGEA 1RBSA 2VGMA 3U9ZA 5LJVA 5KI6A 2Y1JA 3DMJA 3KLFA 3O4NA 4CERA 1NGIA 3SV3A 4B9NA 4BR7A 3SMPA 3OBYA 4JYAK 1ATRA 4G9ZA 1ASUA 3S41A 1SL2A 5HOOA 3AVLA 2NRZA 4RW7A 3BDPA 3H1VX 3TAPA 5F0XA 4CGHA 3L0QA 3PIOL 4HHTA 2E1YA 5KPZA 4W5TA 1NKCA 1A5XA 5ELZA 4GVMA 2ITGA 4CEFA 4BDPA 4H0OA 3OJSA 2O4IA 2ITMA 4CW7B 3V9ZA 3CERA 4CK2A 3NGYA 1HNXK 5SZTA 1ASWA 3A8YA 1L3VA 4ELVA 2X78A 3LP1A 4Z4FA 1J53A 3SBGA 5GAGP 4FWPA 3LDQA 1RDWX 2ZWHA 3IUCA 3O9TA 3W3DA 3ZSQA 1S1XA 3V6DA 4CJ7A 4M3UA 3AVGA 1VRTA 2YNIA 4RG8A 2Q31A 3VQAA 3ENOA 4FJ9A 5HLFA 3QNOA 2P5OA 1BQNA 1G15A 1EP4A 4JD2B 1HYSA 1JLCA 2Q0UA 1JLQA 4BC5A 1D8YA 3IRXA 3HOSA 2YJEA 4OKJA 1BI4A 4BVOA 3VF4A 1Q9XA 4K42A 1WBBA 3KLHA 3P83D 4FJNA 3ZT0A 5C2DA 4KREA 4CCHA 1DLOA 3ULEB 2HHWA 4F4KA 3WQTA 3MEGA 3WNEA 1S9GA 1S9EA 4ZTJA 1C0MA 3OBWA 3O1WA 4PL8A 3HRGA 2PBDA 3G4SN 4KTQA 4WE1A 1J54A 3VENA 4PKGA 4KH4A 3ULEA 4LF6K 4H0TB 4CHQA 4JI4K 4CD1A 2ZM6K 4X66K 4A57A 4H0YB 3CG7A 2GWKA 3A0IX 3AVIA 2V7YA 4YHHK 1T05A 3M8RA 1NJZA 3IAYA 2WC9A 2H3GX 1R59O 1SL1A 4AHRA 4KAZA 4ELTA 4CZJA 1TUYA 3IFRA 3PIPL 3DXMB 3O3FA 4WQ5A 2QK9A 2A5XA 4FK4A 1WNSA 5AQYA 4FVMA 4C8OA 5BPLA 4CGGA 5AQLA 3O9SA 3DXMA 3DLEA 3QBXA 4M42A 2YHAA 5EVZA 1GLLO 5AQIA 4BGAA 1HNVA 3ZSWA 4CZEA 2Z1IA 4OO1J 1NM1A 3AO1A 4N41A 3HJFA 1E3MA 3A2FA 4B1VA 4J2BA 1ZBSA 1O1WA 3MMVA 1LAWA 1K8KB 3AAQA 5J2PA 1C0GA 1QHTA 3QICA 2ZGYA 3CF5L 4NYNA 3RWUA 3K5LA 4JKFA 2DFFA 5TKYA 2HHTA 4JKEA 4M41A 4MLEA 2P9KB 1RTJA 5AQPA 5D3GA 3VQ8A 2W41A 1K8KA 1LOTB 4QS8A 1RBUA 1WB9A 4WCEL 1EWRA 1FKOA 4M63C 2CGLA 3D45A 2CGJA 3R6MA 2P9KA 1NK7A 2WTUA 5EY4A 3RRHA 3SI6A 2ZJQL 3U9DA 2DPNA 4FLZA 2P9PB 3T3FA 2O4GA 2B6AA 1MU2A 1ZYQA 4R79A 1N5YA 4O5BA 3VEOA 3JS6A 5C42A 4CEEA 1UA1A 3I0RA 5J1EA 3DXKB 4IFYA 4BRLA 1S6QA 1QSYA 2CH5A 4JN4A 2YHWA 5AQSA 1TK8A 2RPIA 4DR6K 3DLKA 2FSNA 3D2EB 3QLHA 3DI6A 3PLAA 5GADP 4B1ZA 2FBYA 1WSIA 2VQFK 3I56N 2G8WA 4YFUA 5J2NA 1N34K 2RE2A 4DB3A 5C2FA 1VSMA 2D5RA 3D2EA 4FPBA 4W5NA 1ZC6A 3DLGA 3AGKA 3CJ1A 1HJRA 4DR7K 4OLAA 2RN2A 4Z4IA 3KTQA 2KTQA 4DQPA 2UUCK 1GLEG 2GEMA 2E6MA 4KHYA 3EY1A 4DS4A 1HKCA 4M3XA 3L4IA 1DTTA 4FOEA 1NJWA 3BGRA 4RW8A 4WQ5C 1YJWN 3IKMA 1F21A 3SPYA 3KK7A 4CZGA 4FXDA 4B3SK 2HVIA 3OYMA 3FLCO 1NGJA 3GL1A 5HRNA 4YOYA 1U04A 2E2QA 4FLXA 1OH8A 4EFHA 1NKEA 1YUWA 1SV5A 2F9WA 4CF1A 2O8FA 3UKUA 3NH1A 3QFUA 3OJUA 3ENHA 3LM9A 1NGCA 2RF2A 3HM8A 5I3UA 1KXPA 4BRGA 4CJFA 1WAJA 4FJ5A 1S1TA 5SWMA 3L2RA 3EO3A 4CBXA 3C65A 1UA0A 1TV6A 1V4TA 1QSSA 1NKBA 4MDAA 5FROA 5FRMA 1U48A 5GAEP 4JKGB 2E2OA 3GG4A 3THYA 3MWTA 4CZMA 4FZXC 1NK9A 1IJJA 1VSFA 2G8FA 3N4QA 1U2VB 4M3RA 4DSJA 1TUUA 3NCIA 1W7AA 2G8UA 3O3GA 3EYZA 1UWBA 4JRPA 3K9KA 3CPWM 3VQQA 3E1YA 2ZJPL 1U2VA 2E6LA 4CGIA 1FJGK 5AR0A 1ZBFA 3ZX3A 1BU6O 1UOCA 1LV5A 3H6EA 3I8DA 3VA0A 3FZMA 1KVBA 2E8AA 3CIPA 5DK5A 4DV7K 4MFBA 3KK1A 1L5UA 3ULDA 5IWAK 1SQKA 3I33A 3GOIA 2W42A 3AA2A 3SAFA 3SUOA 4PWDA 3CCUN 3LP0A 1K6YA 3O5BA 1LWEA 3AA4A 4B1WB 2A1RA 1BDGA 1FKPA 1OH6A 4Z94A 2F7TA 4I9LA 3PY8A 2NRTA 1IG9A 4J2DA 3AVFA 3NVKA 4CECA 4FLTA 1RT2A 1SS6A 1C1AA 4RCHA 2X6SA 3D2FA 4IBNA 4ICLA 3ZSOA 1ATSA 1KAXA 1NU0A 4IEEA 4OLBA 4FWRA 5I9EB 4JI1K 4B9TA 4BY9C 4BE0A 1KD1O 3B6PA 4KHUA 3DAWA 3F5TA 3M8PA 1HNIA 5AQKA 3CC7N 2XRIA 2HBLA 3KJVA 4CEQA 3J7ZO 4FJHA 5CHIA 3FZLA 4DFMA 1KLMA 4NCGA 1VSIA 4C23A 1NWKA 4XEIA 1GLDG 2HB5A 4KI6A 3V1QA 5CYMA 1ASVA 4BDYA 1HKBA 1OVYA 3DLLL 4ID1A 2HHQA 1HYZA 1O13A 4OPHA 4DTNA 1BCMA 4FM0A 4B9VA 3HBTA 1L3TA 3ZT1A 4FWLA 4LSLA 5AQHA 2FF3B 3O9UA 3VQBA 2D0OA 4DQ8A 4BRAA 3HPGA 1HQEA 5HBMA 3M1FA 4KPYA 2GV9A 2OANA 3V1RA 2B5JA 5T7BA 3U4LA 4H03B 4ID5A 2XO7A 1GLJO 2PZSA 1EQYA 4CI6A 1X1PA 2Q36A 3MCPA 1P8ZA 3ATVA 3D7EO 3CPEA 3UKRB 1XHXA 3L4QA 1RILA 4DV3K 3S3MA 4I6MA 4JRQA 3AY9A 1XNRK 1MWKA 4DUYK 1XHZA 4PHTX 2ZE2A 1QQCA 3O1BA 3SQ1A 1KSPA 3MWPA 1YTAA 2ASMA 4H5RA 5AQNA 4JS5A 4E1NA 2IVPA 3BEXA 1NG9A 2EHGA 3VEVA 2BDPA 1RT7A 2I7PA 4B9SA 3SV4A 4YOTA 1BUPA 3N4PA 1YT3A 2QXLA 3CJ9A 3QBWA 3T7ZA 1VQKN 3CMAN 1VQ6N 4CJTA 2UUBK 3GE1A 2IVNA 3NF9A 4GV3A 4BR2A 1QTMA 2NUBA 1JL1A 2GX9A 1S3XA 3QESA 2PYJA 1IKYA 1EWQA 3HO1A 2VWBA 3CFRA 4BR5A 4JK7A 3NF8A 2P1JA 4B3OA 2HW3A 4WFAL 1GLAG 4FJJA 3TR8A 4B9QA 2QKKA 2KZZA 1Q8IA 2QW9A 4LFBK 1HPMA 2E20A 1V4SA 3FR0A 4NO7A 4JKAA 3CCJN 3D6RA 4JNEA 2Y1IA 5HL7L 2E2PA 2PYLA 4IOXA 4N47A 1QQNA 1VRUA 4FLVA 2V51B 4RW6A 3LPTA 1Z6RA 3QMLA 4I2PA 4CGDA 1NNEA 4B8CA 1Q18A 4BR0A 3C0BA 5LJWA 3CQXA 1VSKA 3DOKA 1LWCA 4E89A 3HZ6A 3SK3A 3SUNA 2NLXA 2OPSA 1QQOA 3LDNA 4EHUA 4HTLA 1VHXA 2GELA 3NHGA 4DR4K 2KFNA 5ADXA 3HSTB 1DEJA 1S1VA 3SNNA 5MLCQ 3HP6A 5KPTA 4B3MK 3R3LA 5I42A 4YOUA 3U3YA 3W0LA 2O8EA 4MLHA 4XH1A 1VQON 1QHAA 4Z4GA 3GDQA 3PV8A 1KVCA 4NYFA 2P51A 4O44A 4FJIA 1I39A 4KO0A 4CEOA 3OVNA 3DYAA 3WXKA 5JVGL 1YJ9N 3ZX0A 4QCLA 3AVNA 3TANA 1YF5L 2KW4A 4WQ4A 2YHBA 4JKHA 2V52B 2J4RA 3CFOA 3IDHA 1NJIO 4X62K 1J5OA 3O9RA 3WNGA 5KQ8A 5AZIA 3TAFA 1BG3A 1BI4B 4DLEA 2BGGA 1RDAA 1XMQK 4FK0A 4CJ4A 3CCSN 4BWMA 1CLQA 3QEVA 2FC0A 1NGEA 1GLCG 4DSIA 1HMVA 4X65K 3OS2A 1BGXT 1FXXA 2XY8A 5JLFA 3VQ9A 3OYHA 3VA3A 1BQMA 4O0JA 4DG1A 5C12A 2CH6A 3L3VA 3QEPA 3FE1A 4YY3K 3KLEA 2O8DB 1LAVA 4CBWA 1JLAA 1J9AA 4DQRA 1DT9A 4Z4HA 3I55N 1EKEA 4CFAA 1BHLA 3BUZB 4J2EA 5JICA 1JCGA 3VETA 4BR9A 2DFEA 2O8DA 4LC9B 3ZSXA 2CGKA 4CJWA 4N76A 4LY7A 4LF7K 3KLIA 2AP1A 4BRFA 4BQLA 4IG3A 1MWMA 2DTUA 4AHCA 4E7JA 1HRHA 5CE3A 4M7YA 3SQ0A 1VAZA 1BCOA 3K59A 4RTFD 3VTIA 3P31A 5M1KA 4E7HA 1P90A 2PY5A 4JKBA 3VQPA 2UYTA 1ZBLA 1WSGA 1HNZK 2UU9K 4HUGA 3QIPA 3TPQA 2YV0X 3QIOA 3IG1A 3WXJA 1GLBG 3M8QA 1WOQA 3ZT4A 4M3YA 2AJQA 4C8LA 4JLHA 1DGKN 3SCXA 3ZYYX 4K8ZA 2YNHA 4DTJA 4EP4A 3TSUA 3C6HA 5ADXH 3KHYA 4ELUA 3L6QA 3MN5A 2IDOA 2FF6A 4FW2A 3PX4A 3WXLA 1ZBHA 1VSLA 1RBTA 3L8BA 2UXCK 4M3WA 1SL0A 2O8CA 4DR1K 3OYEA 4JKDA 1A5VA 3IS9A 4CHYA 4CZKA 3LZJA 3ZT2A 4CJPA 4CHZA 3KWIA 2HHSA 4DTPA 3G6EN 4ZTFA 4NCAA 1X3MA 4AHSA 3EKUA 1B92A 4CD3A 3JYTA 5HROA 3VOVA 1NBWA 3UE5A 3RMBA 1N33K 5H1SQ 4K43A 1EETA 2A6AA 3CCMN 4DV0K 3DM2A 1NGFA 2JLEA 5C10A 1HX1A 1MDUB 3KVGA 1VSJA 4C8MA 4IWVA 4E3SA 1SKSA 1OH7A 3WNFA 4CZIA 4PQUA 5AQQA 1TAUA 3CJ7A 1HLUA 4MDBA 4O8UA 2NRWA 5CZ1A 4CJSA 3EZWA 2ZD1A 2XY6A 3V4IA 4EP5A 3KKRA 4LSNA 3HTVA 3CCLN 1KC8O 1VK0A 1W0HA 1RTIA 2X6NA 3LAKA 3JAMO 3C94A 2YKMA 2FSJA 3QERA 1ATNA 1IBLK 3RSEB 3JXUA 2UXDK 3RMCA 2QWRA 1C1CA 2BE2A 3TSPA 5BRDA 2IOCA 3FZKA 3VPZA 5BPMA 3CXCM 3AAPA 3SAHA 3G25A 3C95A 4OGCA 3U3GA 2D0PA 1YVNA 3SPZA 4FO0A 3RSEA 4FWSA 1NK6A 3ATUA 2O8FB 3UKUB 5C0YA 1ZXOA 4MO4A 3H3NO 3WT0A 3QEIA 2HHUA 4O0IA 1X9JA 4NB4A 4DF8A 3BP8A 4A5AA 1S72N 4FJKA 1BISA 4V19S 2RHKA 3VQEA 1Q81O 4FWQA 4CHNA 4NLBA 2GWJA 2KHOA 1L3SA 1WLJA 4N56A 4DLGA 2GTDA 2P9LB 1HR0K 3AO2A 1MA9B 3H08A 3WXMB 5JVHL 2QWMA 4BREA 4Z4EA 5JS1A 1TL3A 2YJFA 3THYB 1WSFA 3O9QA 3VERA 3HVTA 4H0XB 2P9LA 3LALA 3MXJA 1QE1A 3ZX2A 3L2WA 3HSCA 2HF4A 5E41A 4N5SA 4CFCA 3MCAB 2OA8A 4DS5A 4AM6A 3NFAA 1UAXA 1RT1A 4A61A 2HNDA 3TARA 2HBKA 3ZSZA 4IJNA 1RT6A 2ZGZA 4DU1A 1BIUA 2Q1NA 2W6KA 2QEXN 1U47A 3NE6A 1D9DA 4IDKA 4O4GA 4IFEA 5CYQA 4PKIA 5J2QA 4UQGA 3WQUA 4FM2A 1TAQA 2R7YA 4CJRA 2ETJA 2XY5A 2D0BA 1S5JA 3ZT3A 1XMOK 3AV9A 4BG8A 4DV2K 4B1XB 3AVMA 3AVBA 4GMJB 1XUPO 4FJXA 2ZQBA 1IV0A 3OTOK 3VQ4A 4XH5A 1SKRA 3TAMA 3RRGA 1TKTA 4KHQA 3D2FB 4KV8A 4IDHA 4JI2K 4XIUA 5EU7A 4F8RA 4HUFA 3B8AX 3HP9A 4DTRA 3L2QA 3J80O 5FLXO 4DSLA 4IO8A 2F8TA 3K5NA 4JI0K 3C6UA 4FZYA 3R1XA 5E84A 5LY3A 3T19A 1NMDA 1C0FA 1S22A 2A40A 3AVCA 3LP2A 1H1VA 2F96A 4RWTA 1VSDA 1QVGM 2IC3A 3AVKA 1VQPN 2FLOA 4WFBL 5BN9A 1YIJN 3NF7A 4Q5VA 2P9IB 4YORA 1YJNN 1JCFA 3O8MA 2OCEA 4F2SA 2YHXA 2E88A 1FW6A 3OYBA 4H0VB 3E66A 1LW0A 2BUPA 4E7IA 2P9IA 2YHYA 1Z26A 5E26A 3C6AA 2WUSA 1QZ6A 4BRKA 3G71N 5BREA 3HK2A 4DQQA 1NGBA 4ZHRA 3ENBA 2ATQA 4DCHA 4FWNA 4CJEA 2E2NA 3LWMA 4A5BA 3FGUA 4CIEA 4JHDB 5GINA 2OZSA 3DRPA 1NK8A 4W5QA 4E7KA 3D0PA 1YHQN 4FOIA 2D4WA 1NOYA 4KFBA 4I6MB 4IOCL 2FBXA 4CEZA 3OYIA 4JHDA 1C0TA 2I5JA 3EKSA 3EZ5A 3EE9A 2D0AA 1HPZA 5KRSA 1T03A 4C1NK 1KFSA 5LMNK 4H8KA 3V9XA 3TTCA 5HRSA 4B9LA 4UY8O 2NZTA 3V9UA 2G8HA 4CZHA 4DQIA 3KWGA 5DM7L 4BRHA 3ASMA 3ZSRA 3SAGA 1LW2A 1Y97A 3PO4A 1NK4A 2HBMA 2FSKA 3F73A 4CIGA 5BPNA 3AARA 3QEXA 1YTUA 1WAFA 4EZ6A 3ZLJA 5J2MA 4G1QA 3DLHA 4HVJA 2XHBA 3VQCA 4QAGA 3U6FA 1RBRA 2Q3SA 5DMRA 4EIAA 5EX5A 1OH5A 1RGIA 2WBNA 2Q97A 1S1UA 3VGMA 4CJKA 1B9DA 1D5AA 1KQSM 3THWB 1VSHA 3K5OA 3MEDA 1KAZA 3QNNA 4CGFA 4B1YB 1U45A 3TAQA 4J8FA 4GVEA 1XNQK 4I9QA 1N6QA 5EXWA 3Q7BA 2IAJA 1NMNA 3G10A 2W40A 4DTSA 4Z0UA 4BACA 3THWA 3KK2A 3NVMA 4AM7A 1Y64A 4E1MA 5FPDA 3VMFB 3CQ8A 2F8SA 4CFDA 1HJOA 4DFJA 4BRQA 4AQYK 3TAEA 3RR7A 3J7AP 4CHOA 4B1UB 4FLUA 1JLEA 1IKVA 4W5OA 3MDQA 2VQEK 4BRPA 5BRHA 3FFKB 2IIRA 5AQZA 3NBPA 2QWQA 4OPKA 4DSKA 1D4XA 3RR8A 1RDCA 4DSEA 5M1NA 3NDKA 4HTUA 1TK0A 4DKWA 4BRDA 3R9PA 4WFNL 1JXBA 3ZSVA 2KQ2A 1NGAA 4BQZA 1TYQB 2WFBA 3MAQA 4JI7K 1R0AA 3ITHA 1ZBUA 4JKCA 4ILHA 1I3AA 4FK2A 1E4GT 3E9OA 3KLGA 4CF9A 2QM1A 3LDLA 3HM9A 1TYQA 4KB1A 4A2AA 2Q0RA 3CJAA 2P9NA 5GIOA 2O8EB 4HUEA 1KRPA 5AQXA 1NGHA 3LPUA 4FZZA 1VQ5N 3S3NA 4OKEA 5DM6L 3T1YK 1VQMN 1EO1A 5LL6Z 3DRSA 1A5WA 1NJYA 4DR2K 2HNZA 4YOWA 1NOZA 4GY2B 3HI0A 1RDUA 4IEIA 3EN9A 1EXQA 3J7YP 4KH5A 1X9MA 5FRNA 3OYGA 4EHTA 4QS7A 2OTLN 3OHRA 4B8AB 4NXNK 4H5VA 4LD0A 3T1AA 4BRNA 4B9MA 4F3OA 2B4JA 4YDUA 4CEDA 5F1XA 2HNYA 3TAGA 5M1QA 1S1WA 2PAVA 5AZIB 4YOVA 1QQMA 2YCHA 4AH9A 1K73O 1M1KO 4CHPA 2AA4A 3ISNC 5M1OA 2WOMA 4IXCA 1N36K 2G8KA 1SKWA 1DKGD 3R8EA 2E1ZA 1YAGA 1GOCA 3VF6A 3OYFA 5KPRA 4LFCK 1JLFA 1WSJA 3DOLA 3CQYA 4FSVA 2Z1HA 3P39A 3ID6A 4HWIA 1KVAA 1VQ7N 2ZJRL 2OYQA 3QB0A 3CMEN 2YX6A 4H5NA 3V9SA 3V9WA 4LF4K 1X9WA 3I8BA 2I7NA 4BC3A 4Y0WA 2HVHA 2QWPA 1K9MO 1XQSC 5AQVA 3SJJA 2JWKA 1JLGA 1C0UA 3F9KA 4JK8A 1JLBA 1WUAA 4FWOA 3WUHA 3KKSA 4R5PA 3VQ5A 3SBTA 3KD1E 4CF0A 2VWJA 3THVA 3H45C 4JD2A 5AJ3K 3OS1A 4F2RA 3AGRA 1KAYA 3LZIA 4CJ5A 3K2PA 4FJMA 3DJCA 5AQFA 2D0CA 4DTMA 5M1PA 2O8BB 3OYAA 5IT9O 2G8IA 2HMPA 2YI1A 1C6VA 1IBKK 2VGNA 5AFUA 4X64K 4YNQA 3PO5A 3VQ6A 1TKZA 4CZFA 1CXQA 4H5WA 3SUPA 1BOTO 5KTQA 1NJXA 3KK3A 3RTVA 2YKNA 2HHHK 3SQ2A 2O8BA 3OYNA 1T6CA 2IVOA 3TU5A 4RW9A 2X74A 3QINA 1Z25A 2D1KA 4CEAA 3KZBA 3PSFA 4A2BA 4IFVA 1U6ZA 4A62A 3A5LC 4OVLA 4LF9K 2EX3A 4GW6A 5AQRA 4CGJA 1JXEA 1NLVA 4FW1A 3EL2A 1RNHA 4BRCA 3WEEB 3P38A 2F9TA 3B6OA 1NGGA 1FK9A 2V7ZA 4BVPA 3CC4N 2O8CB 5CY4A 2QWLA 2GUIA 3WEEA 2HHVA 1VQ9N 3OS0A 4NXMK 1TL1A 3NGZA 3P1GA 1G99A 1NGDA 4B3TK 4BGBA 1HKGA 1IKXA 4CK3A 4YDUC 1GOAA 4F3TA 3VESA 1KFDA 5GAHP 2UXBK 1RT4A 3E9PA 1J5EK 4Q0BA 1HUXA 3RVCA 3M3ZA 1D9FA 3LL3A 1JJ2M 1QZ5A 2KZMA 4WQ4C 3A5OC 4DU4A 4ILJA 1BO5O 4CIFA 3EE8A 3FZHA 4KB0A 1XC3A 4JV5K 3DLBA 2W6LA 3OW2M 2ASPA 3I0SA 3QETA 1ILYA 3A5MC 2VWKA 5FPMA 3V81A 3ZSYA 4JAXA 4BWJA 4ISEA 4CFBA 2FBTA 4LH4A 3P4IA 3NH0A 4OPAA 4FLWA 5JLHA 2OPRA 1LWFA 4E19A 3CJBA 2NRHA 4WF9L 4O55A 4M3ZA 3O08A 1KLNA 1IO2A 1XC9A 4IOAL 4I7FA 3MN7A 3QO9A 3U8XA 1VQNN 3V1OA 3MN9A 3FFIA 5A2QO
chains in the Genus database with same CATH topology
2DFHA 1JL1A 1JLCA 2NUBA 3VQ4A 3QESA 2PYJA 1IKYA 1TKDA 3HO1A 1JLQA 1SKRA 1HYVA 3CFRA 3L3UA 3TAMA 3RRGA 1GOBA 1TKTA 3NF8A 4CEBA 4KHQA 2VG7A 4KV8A 4E0DA 4PY5A 1D8YA 3IRXA 2P1JA 5JS2A 4B3OA 2HW3A 2YNGA 4XIUA 1TKXA 1BI4A 4OKJA 3NAEA 3ZCMA 4DWIA 5EU7A 1WN7A 1Q9XA 2G8VA 4F8RA 4HUFA 3KLHA 5HP1A 3P83D 3HP9A 4DTRA 5KRTA 4FJJA 3L2QA 4FJNA 3ZT0A 3PUFA 3TR8A 4OKKA 4CCHA 1DLOA 2OPQA 4DSLA 2F8TA 2QKKA 3K5NA 4KREA 2KZZA 2HHWA 1Q8IA 3C6UA 4C8KA 4F4KA 4FZYA 4DQSA 3MEGA 3T19A 3WNEA 1S9GA 1S9EA 4ZTJA 1YVUA 4KKOA 4DFPA 1C0MA 4CESA 3AVCA 1QSLA 3LP2A 1RDDA 4CE9A 2Y1IA 2GBZA 2RKIA 3AVAA 1U49A 2F96A 1TVRA 4WE1A 4CJLA 1J54A 4KTQA 2HHXA 2A1SA 1VSDA 2IC3A 4CHQA 2PYLA 3AVKA 4AHVA 4C8NA 4FCYA 4N47A 1VRUA 3NF7A 4FLVA 4Q5VA 3HVRA 3CG7A 3MXMA 4RW6A 3IAYA 3AVIA 1T05A 3M8RA 1NJZA 3LPTA 1SL1A 4AHRA 3O3HA 4I2PA 4KAZA 4CGDA 4ELTA 3MECA 3K58A 4B8CA 3CFPA 4F2SA 5KGXA 3OYBA 1VSKA 3DOKA 2BANA 1X9SA 3OYCA 1LWCA 4M45A 4E89A 3O3FA 1XWLA 1LW0A 2QK9A 4E7IA 4CJUA 3SUNA 1Z26A 2OPSA 4FK4A 2E4LA 1WNSA 4FVMA 4CK1A 5HRPA 3HK2A 4DQQA 4C8OA 4ZHRA 4CGGA 3NHGA 2KFNA 3DLEA 2ATQA 4CJEA 3LWMA 3HSTB 4M42A 2YHAA 3MXIA 4CIEA 1S1VA 3SNNA 2OZSA 3DRPA 3NH2A 3UIQA 1HNVA 1NK8A 2LSNA 3HP6A 4W5QA 3ZSWA 4DF4A 4E7KA 3D0PA 2Z1IA 4DSFA 3AO1A 4N41A 3HJFA 5I42A 1NOYA 4KFBA 3U3YA 3AA5X 3VQDA 3A2FA 2P5GA 2FBXA 4J2BA 3HL8A 4Y1DA 4CEZA 4NCBA 1O1WA 3OYIA 1RCHA 1LAWA 4Z4GA 1C0TA 4BE2A 1QHTA 2I5JA 3CM6A 3EZ5A 5J2PA 3PV8A 4IG0A 1KVCA 2D0AA 1HPZA 3LP3A 4NYNA 3DRRA 4NYFA 2P51A 4O44A 4B08A 4CJ3A 5KRSA 3CM5A 1T03A 1KFSA 3RWUA 1I39A 3K5LA 4KO0A 4H8KA 4FJIA 2DFFA 2HHTA 4CEOA 3V9XA 5HRSA 4QOZB 1CZ9A 3LANA 3OVNA 4M41A 3DYAA 1RTJA 4B9LA 5D3GA 3P5JA 3VQ8A 1ITGA 1KTQA 3V9UA 1RBUA 4QCLA 3AVNA 3TANA 2G8HA 4DQIA 1FKOA 3ASMA 3ZSRA 1T8EA 1LW2A 1Y97A 1BIZA 2KW4A 3PO4A 3D45A 1NK4A 4Y1CA 1RDBA 3AA3A 4M3TA 3F73A 4JS4A 4CIGA 3QEXA 1YTUA 1WAFA 2YHBA 4EZ6A 5J2MA 4G1QA 1NK7A 4HVJA 3DLHA 2XHBA 3VQCA 4B9UA 3CFOA 3RRHA 4QAGA 3SI6A 3U6FA 1RBRA 2Q3SA 5DMRA 4FLZA 3T3FA 1J5OA 5K14A 3WNGA 4CJQA 3TAFA 2O4GA 2B6AA 1MU2A 1S1UA 1ZYQA 3M8SA 1BI4B 4CJKA 1N5YA 1B9DA 1D5AA 4O5BA 4DLEA 2BGGA 1RDAA 1VSHA 3K5OA 3MEDA 4CJ4A 3QNNA 4CGFA 5C42A 1TK5A 4FJLA 4FK0A 4CEEA 2QXFA 3TAQA 1U45A 1UA1A 4BWMA 3HYFA 4Z4CA 1CLQA 3I0RA 5J1EA 4I9QA 3QEVA 4IFYA 2FC0A 1N6QA 1S6QA 1QSYA 4DSIA 3KD5E 1HMVA 4MQ3A 4K8XA 2IAJA 3OS2A 3G10A 3O4QA 1TK8A 4DTSA 4F2RA 2RPIA 4Z0UA 4BACA 1NK5A 1BGXT 1FXXA 3KK2A 2XY8A 4E1MA 3CQ8A 3VQ9A 3DLKA 5CZ2A 3OYHA 2F8SA 1TGOA 4CFDA 3VA3A 4E7LA 1BQMA 4O0JA 4DG1A 4DFJA 3TAEA 1L3UA 3RR7A 3QLHA 4FJGA 3DI6A 4CHOA 4FLUA 2FBYA 3MEEA 3L3VA 1JLEA 1WSIA 3QEPA 1IKVA 3KLEA 2G8WA 5C24A 4YFUA 5J2NA 1RTDA 4W5OA 1LAVA 1VSMA 1JLAA 1J9AA 2D5RA 4DQRA 4W5NA 4Z4HA 1EKEA 4CFAA 3DLGA 3HT3A 1BHLA 5FDLA 4DTUA 4J2EA 3NBPA 3TWHA 4OPKA 3PX0A 3NF6A 4DSKA 3RR8A 1HJRA 4HCCA 4KHNA 2DFEA 4OLAA 2RN2A 1RDCA 4Z4IA 1QS4A 4DSEA 1XI1A 3NDKA 4HTUA 3ZSXA 4FJ8A 4CJWA 3KTQA 4N76A 1TK0A 4LY7A 4DQPA 2KTQA 2E6MA 3KLIA 1JXBA 4FM1A 3ZSVA 2KQ2A 4IG3A 3MAQA 4KHYA 1R0AA 3ITHA 1ZBUA 3EY1A 2DTUA 4AHCA 3K57A 4E7JA 4DS4A 1HRHA 3SQ0A 1I3AA 4FK2A 4M3XA 4H4OA 3AO5A 4KHSA 1BCOA 3KLGA 3K59A 4CF9A 1DTTA 3OYJA 1NJWA 3BGRA 3HM9A 4E7HA 4RW8A 3LAMA 1JKHA 3OYKA 3LDSA 4BDZA 4KB1A 4KRFA 2DY4A 1F21A 2PY5A 3SPYA 2Z1GA 1RT5A 1REVA 3VQPA 3NGIA 1ZBLA 4FXDA 1WSGA 3OYMA 2HVIA 3AO4A 5HRNA 1CZBA 1U04A 4AHTA 4FLXA 4HUEA 1KRPA 4HUGA 1NKEA 3LPUA 3QIPA 4KI4A 4FZZA 1SV5A 2YV0X 3QIOA 3IG1A 4CF1A 4OKEA 2IGIA 3S3NA 4CJVA 3NH1A 3M8QA 4LH5A 3OJUA 1KCFA 1IH7A 3ZT4A 3DRSA 1A5WA 3SQ4A 1NJYA 2RF2A 4M3YA 2AJQA 1T7PA 2HNZA 1NOZA 4C8LA 3AVJA 4JLHA 3SCXA 5I3UA 4BE1A 1EXQA 3S3OA 4K8ZA 2YNHA 4DTJA 4EP4A 4CJFA 3SYZA 1X9MA 1WAJA 4FJ5A 5FRNA 3OYGA 1S1TA 5SWMA 3L2RA 3KIOA 4J2AA 4KHWA 4CF8A 4ELUA 1UA0A 4B8AB 3S9HA 4DTXA 1TV6A 1QSSA 1NKBA 2IDOA 4FW2A 4LD0A 3T1AA 3WNHA 3PX4A 5FROA 4F3OA 4B9MA 1U48A 5FRMA 3QEWA 1ZBHA 2B4JA 1VSLA 1RBTA 1W9HA 4CEDA 3L8BA 4M3WA 2HNYA 1SL0A 3TI0A 3TAGA 1RTHA 2YNFA 3OYEA 4FZXC 1A5VA 1NK9A 1S1WA 3IS9A 1VSFA 2G8FA 4AHUA 4CHYA 4AH9A 4M3RA 1WSEA 4DSJA 3LZJA 3ZT2A 4CHPA 3NCIA 4CJPA 2G8UA 4H4MA 4IKFA 4CHZA 3O3GA 3ISNC 4I2QA 2WOMA 3EYZA 1NK0A 4PUOA 1UWBA 2HHSA 4JRPA 4DTPA 2G8KA 4KTZA 4OPJA 3HPOA 3VQQA 3PX6A 4ZTFA 1SKWA 4NCAA 4AHSA 1GOCA 1RT3A 2E6LA 3SUQA 3OYFA 1JLFA 1WSJA 1B92A 5KGWA 3DOLA 3JYTA 3RMDA 2Z1HA 5HROA 1JL2A 3RMBA 4EZ9A 2IS3A 4CGIA 4AILC 1KVAA 4L8RB 1EETA 1ZBFA 2OYQA 1UOCA 3DM2A 1LV5A 1DTQA 4FJ7A 2JLEA 3CYMA 3I8DA 3V9SA 1B9FA 3VA0A 3V9WA 3SZ2A 1KVBA 3RMAA 3VN5A 1VSJA 1X9WA 4C8MA 4E3SA 4KTWA 4CF2A 5DK5A 1SKSA 2HVHA 4DMNA 3TABA 4MFBA 3KK1A 1L5UA 1ZBIA 3ULDA 3WNFA 3VQ7A 4DTOA 4DU3A 3SJJA 4PQUA 1JLGA 1TAUA 1C0UA 2KFZA 3F9KA 5CZ1A 2QKBA 2W42A 4W5RA 1JLBA 3AA2A 4RW4A 4CJSA 3SUOA 3AO3A 1Q9YA 4PWDA 3LP0A 1K6YA 4FLYA 3LWLA 2XY7A 1C1BA 2ZD1A 2XY6A 1LWEA 3V4IA 4EP5A 1EX4A 3AA4A 3KKSA 3KKRA 4LSNA 3VQ5A 4R5PA 2OZMA 2A1RA 2Z1JA 4CF0A 2VWJA 3KD1E 3THVA 2VG5A 1FKPA 1HQUA 1VK0A 1VSEA 4I9LA 4TSXA 3OS1A 4DFKA 3PY8A 1W0HA 1RTIA 2X6NA 3AVFA 3LAKA 4CECA 3LZIA 4CJ5A 1IG9A 3K2PA 3C94A 1RT2A 3ALYA 4FLTA 4FJMA 1C1AA 2YKMA 2D0CA 2X6SA 4IBNA 4ICLA 3ZSOA 4PA1A 4DTMA 3QERA 1U4BA 1BL3A 3OYAA 1RBVA 4OLBA 3RMCA 2G8IA 1C1CA 1C6VA 2BE2A 3JSMA 5HRRA 4YNQA 3PO5A 2IOCA 3VQ6A 4B9TA 1TKZA 1CXQA 3SUPA 4BE0A 2FBVA 5KTQA 3B6PA 4KHUA 3C95A 4OGCA 3KK3A 1NJXA 3M8PA 2YKNA 3U3GA 3K5MA 3RTVA 3L2VA 3SQ2A 1HNIA 3SPZA 3OYNA 4FYDA 1NK6A 1WSHA 2XRIA 4RW9A 3E01A 2X74A 3QINA 3OYLA 1Z25A 4CEAA 3KJVA 4CEQA 4FJHA 1CXUA 4IFVA 3HPHA 3G0ZA 4DFMA 3QEIA 1KLMA 4NCGA 1VSIA 4OVLA 1IKWA 4O0IA 2HHUA 3AVHA 4J2DA 2HMIA 4DF8A 3C6TA 2EX3A 4FJKA 1BISA 2JGUA 4GW6A 5C25A 2HB5A 4KI6A 4CGJA 3V1QA 3VQEA 1JXEA 5CYMA 4CHNA 2VG6A 4FW1A 1ASVA 4BDYA 1RNHA 1L3SA 1WLJA 4ID1A 4N56A 3L2UA 4DLGA 1SUQA 4HCBA 3DLRA 3B6OA 4OJRA 1HYZA 2WONA 3AO2A 3OYDA 4DTNA 2HHQA 1BCMA 4FM0A 3H08A 4B9VA 1FK9A 3HXMA 2OPPA 3OY9A 1L3TA 4Z4EA 3ZT1A 5JS1A 1S6PA 4LSLA 4OGEA 1TL3A 1WSFA 5CY4A 1RBSA 3VQBA 3HPGA 3HVTA 1HQEA 2GUIA 2HHVA 3LALA 5HBMA 3OS0A 5KI6A 3MXJA 2Y1JA 1TL1A 3DMJA 4KPYA 1QE1A 2GV9A 3NGZA 3P1GA 3V1RA 3KLFA 3O4NA 4CERA 2B5JA 3L2WA 5T7BA 4ID5A 2XO7A 1IKXA 3SV3A 4B9NA 5E41A 4N5SA 4CK3A 2PZSA 1GOAA 4F3TA 1KFDA 4CFCA 1X1PA 1RT4A 1ASUA 1SL2A 4Q0BA 3AVLA 4RW7A 4DS5A 2OA8A 3BDPA 3TAPA 1D9FA 3NFAA 4CGHA 1UAXA 2KZMA 1RT1A 4HHTA 4DU4A 4W5TA 2HNDA 1NKCA 1A5XA 4CIFA 3TARA 1XHXA 1RILA 2ITGA 4GVMA 3ZSZA 4CEFA 4KB0A 3S3MA 4BDPA 4JRQA 1RT6A 3OJSA 3DLBA 2O4IA 1XHZA 2ZE2A 1QQCA 3SQ1A 1KSPA 4DU1A 3V9ZA 1BIUA 1YTAA 3I0SA 3QETA 4JS5A 4CK2A 1U47A 3NE6A 1D9DA 3NGYA 4IDKA 2VWKA 4O4GA 4E1NA 5SZTA 1ASWA 5CYQA 3ZSYA 3V81A 1L3VA 4BWJA 4ELVA 2X78A 3LP1A 4Z4FA 2EHGA 2BDPA 1J53A 1RT7A 5J2QA 4UQGA 4CFBA 2FBTA 4B9SA 3SV4A 4LH4A 3NH0A 3ZSQA 1S1XA 1YT3A 4FLWA 4FM2A 2OPRA 1LWFA 1TAQA 3V6DA 4E19A 2R7YA 4CJRA 2ETJA 4M3UA 3AVGA 1VRTA 2XY5A 2YNIA 2D0BA 4RG8A 1S5JA 4O55A 3ZT3A 3VQAA 4M3ZA 3AV9A 1KLNA 1IO2A 1XC9A 3AVMA 4CJTA 5HLFA 4I7FA 3QNOA 2P5OA 4FJ9A 3QO9A 1BQNA 3AVBA 1G15A 4GMJB 4FJXA 2ZQBA 3V1OA 3NF9A 1EP4A 3FFIA 1QTMA 1HYSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DFH A;  1JL1 A;  1JLC A;  2NUB A;  3VQ4 A;  3QES A;  2PYJ A;  1IKY A;  1TKD A;  3HO1 A;  1JLQ A;  1SKR A;  1HYV A;  3CFR A;  3L3U A;  3TAM A;  3RRG A;  1GOB A;  1TKT A;  3NF8 A;  4CEB A;  4KHQ A;  2VG7 A;  4KV8 A;  4E0D A;  4PY5 A;  1D8Y A;  3IRX A;  2P1J A;  5JS2 A;  4B3O A;  2HW3 A;  2YNG A;  4XIU A;  1TKX A;  1BI4 A;  4OKJ A;  3NAE A;  3ZCM A;  4DWI A;  5EU7 A;  1WN7 A;  1Q9X A;  2G8V A;  4F8R A;  4HUF A;  3KLH A;  5HP1 A;  3P83 D;  3HP9 A;  4DTR A;  5KRT A;  4FJJ A;  3L2Q A;  4FJN A;  3ZT0 A;  3PUF A;  3TR8 A;  4OKK A;  4CCH A;  1DLO A;  2OPQ A;  4DSL A;  2F8T A;  2QKK A;  3K5N A;  4KRE A;  2KZZ A;  2HHW A;  1Q8I A;  3C6U A;  4C8K A;  4F4K A;  4FZY A;  4DQS A;  3MEG A;  3T19 A;  3WNE A;  1S9G A;  1S9E A;  4ZTJ A;  1YVU A;  4KKO A;  4DFP A;  1C0M A;  4CES A;  3AVC A;  1QSL A;  3LP2 A;  1RDD A;  4CE9 A;  2Y1I A;  2GBZ A;  2RKI A;  3AVA A;  1U49 A;  2F96 A;  1TVR A;  4WE1 A;  4CJL A;  1J54 A;  4KTQ A;  2HHX A;  2A1S A;  1VSD A;  2IC3 A;  4CHQ A;  2PYL A;  3AVK A;  4AHV A;  4C8N A;  4FCY A;  4N47 A;  1VRU A;  3NF7 A;  4FLV A;  4Q5V A;  3HVR A;  3CG7 A;  3MXM A;  4RW6 A;  3IAY A;  3AVI A;  1T05 A;  3M8R A;  1NJZ A;  3LPT A;  1SL1 A;  4AHR A;  3O3H A;  4I2P A;  4KAZ A;  4CGD A;  4ELT A;  3MEC A;  3K58 A;  4B8C A;  3CFP A;  4F2S A;  5KGX A;  3OYB A;  1VSK A;  3DOK A;  2BAN A;  1X9S A;  3OYC A;  1LWC A;  4M45 A;  4E89 A;  3O3F A;  1XWL A;  1LW0 A;  2QK9 A;  4E7I A;  4CJU A;  3SUN A;  1Z26 A;  2OPS A;  4FK4 A;  2E4L A;  1WNS A;  4FVM A;  4CK1 A;  5HRP A;  3HK2 A;  4DQQ A;  4C8O A;  4ZHR A;  4CGG A;  3NHG A;  2KFN A;  3DLE A;  2ATQ A;  4CJE A;  3LWM A;  3HST B;  4M42 A;  2YHA A;  3MXI A;  4CIE A;  1S1V A;  3SNN A;  2OZS A;  3DRP A;  3NH2 A;  3UIQ A;  1HNV A;  1NK8 A;  2LSN A;  3HP6 A;  4W5Q A;  3ZSW A;  4DF4 A;  4E7K A;  3D0P A;  2Z1I A;  4DSF A;  3AO1 A;  4N41 A;  3HJF A;  5I42 A;  1NOY A;  4KFB A;  3U3Y A;  3AA5 X;  3VQD A;  3A2F A;  2P5G A;  2FBX A;  4J2B A;  3HL8 A;  4Y1D A;  4CEZ A;  4NCB A;  1O1W A;  3OYI A;  1RCH A;  1LAW A;  4Z4G A;  1C0T A;  4BE2 A;  1QHT A;  2I5J A;  3CM6 A;  3EZ5 A;  5J2P A;  3PV8 A;  4IG0 A;  1KVC A;  2D0A A;  1HPZ A;  3LP3 A;  4NYN A;  3DRR A;  4NYF A;  2P51 A;  4O44 A;  4B08 A;  4CJ3 A;  5KRS A;  3CM5 A;  1T03 A;  1KFS A;  3RWU A;  1I39 A;  3K5L A;  4KO0 A;  4H8K A;  4FJI A;  2DFF A;  2HHT A;  4CEO A;  3V9X A;  5HRS A;  4QOZ B;  1CZ9 A;  3LAN A;  3OVN A;  4M41 A;  3DYA A;  1RTJ A;  4B9L A;  5D3G A;  3P5J A;  3VQ8 A;  1ITG A;  1KTQ A;  3V9U A;  1RBU A;  4QCL A;  3AVN A;  3TAN A;  2G8H A;  4DQI A;  1FKO A;  3ASM A;  3ZSR A;  1T8E A;  1LW2 A;  1Y97 A;  1BIZ A;  2KW4 A;  3PO4 A;  3D45 A;  1NK4 A;  4Y1C A;  1RDB A;  3AA3 A;  4M3T A;  3F73 A;  4JS4 A;  4CIG A;  3QEX A;  1YTU A;  1WAF A;  2YHB A;  4EZ6 A;  5J2M A;  4G1Q A;  1NK7 A;  4HVJ A;  3DLH A;  2XHB A;  3VQC A;  4B9U A;  3CFO A;  3RRH A;  4QAG A;  3SI6 A;  3U6F A;  1RBR A;  2Q3S A;  5DMR A;  4FLZ A;  3T3F A;  1J5O A;  5K14 A;  3WNG A;  4CJQ A;  3TAF A;  2O4G A;  2B6A A;  1MU2 A;  1S1U A;  1ZYQ A;  3M8S A;  1BI4 B;  4CJK A;  1N5Y A;  1B9D A;  1D5A A;  4O5B A;  4DLE A;  2BGG A;  1RDA A;  1VSH A;  3K5O A;  3MED A;  4CJ4 A;  3QNN A;  4CGF A;  5C42 A;  1TK5 A;  4FJL A;  4FK0 A;  4CEE A;  2QXF A;  3TAQ A;  1U45 A;  1UA1 A;  4BWM A;  3HYF A;  4Z4C A;  1CLQ A;  3I0R A;  5J1E A;  4I9Q A;  3QEV A;  4IFY A;  2FC0 A;  1N6Q A;  1S6Q A;  1QSY A;  4DSI A;  3KD5 E;  1HMV A;  4MQ3 A;  4K8X A;  2IAJ A;  3OS2 A;  3G10 A;  3O4Q A;  1TK8 A;  4DTS A;  4F2R A;  2RPI A;  4Z0U A;  4BAC A;  1NK5 A;  1BGX T;  1FXX A;  3KK2 A;  2XY8 A;  4E1M A;  3CQ8 A;  3VQ9 A;  3DLK A;  5CZ2 A;  3OYH A;  2F8S A;  1TGO A;  4CFD A;  3VA3 A;  4E7L A;  1BQM A;  4O0J A;  4DG1 A;  4DFJ A;  3TAE A;  1L3U A;  3RR7 A;  3QLH A;  4FJG A;  3DI6 A;  4CHO A;  4FLU A;  2FBY A;  3MEE A;  3L3V A;  1JLE A;  1WSI A;  3QEP A;  1IKV A;  3KLE A;  2G8W A;  5C24 A;  4YFU A;  5J2N A;  1RTD A;  4W5O A;  1LAV A;  1VSM A;  1JLA A;  1J9A A;  2D5R A;  4DQR A;  4W5N A;  4Z4H A;  1EKE A;  4CFA A;  3DLG A;  3HT3 A;  1BHL A;  5FDL A;  4DTU A;  4J2E A;  3NBP A;  3TWH A;  4OPK A;  3PX0 A;  3NF6 A;  4DSK A;  3RR8 A;  1HJR A;  4HCC A;  4KHN A;  2DFE A;  4OLA A;  2RN2 A;  1RDC A;  4Z4I A;  1QS4 A;  4DSE A;  1XI1 A;  3NDK A;  4HTU A;  3ZSX A;  4FJ8 A;  4CJW A;  3KTQ A;  4N76 A;  1TK0 A;  4LY7 A;  4DQP A;  2KTQ A;  2E6M A;  3KLI A;  1JXB A;  4FM1 A;  3ZSV A;  2KQ2 A;  4IG3 A;  3MAQ A;  4KHY A;  1R0A A;  3ITH A;  1ZBU A;  3EY1 A;  2DTU A;  4AHC A;  3K57 A;  4E7J A;  4DS4 A;  1HRH A;  3SQ0 A;  1I3A A;  4FK2 A;  4M3X A;  4H4O A;  3AO5 A;  4KHS A;  1BCO A;  3KLG A;  3K59 A;  4CF9 A;  1DTT A;  3OYJ A;  1NJW A;  3BGR A;  3HM9 A;  4E7H A;  4RW8 A;  3LAM A;  1JKH A;  3OYK A;  3LDS A;  4BDZ A;  4KB1 A;  4KRF A;  2DY4 A;  1F21 A;  2PY5 A;  3SPY A;  2Z1G A;  1RT5 A;  1REV A;  3VQP A;  3NGI A;  1ZBL A;  4FXD A;  1WSG A;  3OYM A;  2HVI A;  3AO4 A;  5HRN A;  1CZB A;  1U04 A;  4AHT A;  4FLX A;  4HUE A;  1KRP A;  4HUG A;  1NKE A;  3LPU A;  3QIP A;  4KI4 A;  4FZZ A;  1SV5 A;  2YV0 X;  3QIO A;  3IG1 A;  4CF1 A;  4OKE A;  2IGI A;  3S3N A;  4CJV A;  3NH1 A;  3M8Q A;  4LH5 A;  3OJU A;  1KCF A;  1IH7 A;  3ZT4 A;  3DRS A;  1A5W A;  3SQ4 A;  1NJY A;  2RF2 A;  4M3Y A;  2AJQ A;  1T7P A;  2HNZ A;  1NOZ A;  4C8L A;  3AVJ A;  4JLH A;  3SCX A;  5I3U A;  4BE1 A;  1EXQ A;  3S3O A;  4K8Z A;  2YNH A;  4DTJ A;  4EP4 A;  4CJF A;  3SYZ A;  1X9M A;  1WAJ A;  4FJ5 A;  5FRN A;  3OYG A;  1S1T A;  5SWM A;  3L2R A;  3KIO A;  4J2A A;  4KHW A;  4CF8 A;  4ELU A;  1UA0 A;  4B8A B;  3S9H A;  4DTX A;  1TV6 A;  1QSS A;  1NKB A;  2IDO A;  4FW2 A;  4LD0 A;  3T1A A;  3WNH A;  3PX4 A;  5FRO A;  4F3O A;  4B9M A;  1U48 A;  5FRM A;  3QEW A;  1ZBH A;  2B4J A;  1VSL A;  1RBT A;  1W9H A;  4CED A;  3L8B A;  4M3W A;  2HNY A;  1SL0 A;  3TI0 A;  3TAG A;  1RTH A;  2YNF A;  3OYE A;  4FZX C;  1A5V A;  1NK9 A;  1S1W A;  3IS9 A;  1VSF A;  2G8F A;  4AHU A;  4CHY A;  4AH9 A;  4M3R A;  1WSE A;  4DSJ A;  3LZJ A;  3ZT2 A;  4CHP A;  3NCI A;  4CJP A;  2G8U A;  4H4M A;  4IKF A;  4CHZ A;  3O3G A;  3ISN C;  4I2Q A;  2WOM A;  3EYZ A;  1NK0 A;  4PUO A;  1UWB A;  2HHS A;  4JRP A;  4DTP A;  2G8K A;  4KTZ A;  4OPJ A;  3HPO A;  3VQQ A;  3PX6 A;  4ZTF A;  1SKW A;  4NCA A;  4AHS A;  1GOC A;  1RT3 A;  2E6L A;  3SUQ A;  3OYF A;  1JLF A;  1WSJ A;  1B92 A;  5KGW A;  3DOL A;  3JYT A;  3RMD A;  2Z1H A;  5HRO A;  1JL2 A;  3RMB A;  4EZ9 A;  2IS3 A;  4CGI A;  4AIL C;  1KVA A;  4L8R B;  1EET A;  1ZBF A;  2OYQ A;  1UOC A;  3DM2 A;  1LV5 A;  1DTQ A;  4FJ7 A;  2JLE A;  3CYM A;  3I8D A;  3V9S A;  1B9F A;  3VA0 A;  3V9W A;  3SZ2 A;  1KVB A;  3RMA A;  3VN5 A;  1VSJ A;  1X9W A;  4C8M A;  4E3S A;  4KTW A;  4CF2 A;  5DK5 A;  1SKS A;  2HVH A;  4DMN A;  3TAB A;  4MFB A;  3KK1 A;  1L5U A;  1ZBI A;  3ULD A;  3WNF A;  3VQ7 A;  4DTO A;  4DU3 A;  3SJJ A;  4PQU A;  1JLG A;  1TAU A;  1C0U A;  2KFZ A;  3F9K A;  5CZ1 A;  2QKB A;  2W42 A;  4W5R A;  1JLB A;  3AA2 A;  4RW4 A;  4CJS A;  3SUO A;  3AO3 A;  1Q9Y A;  4PWD A;  3LP0 A;  1K6Y A;  4FLY A;  3LWL A;  2XY7 A;  1C1B A;  2ZD1 A;  2XY6 A;  1LWE A;  3V4I A;  4EP5 A;  1EX4 A;  3AA4 A;  3KKS A;  3KKR A;  4LSN A;  3VQ5 A;  4R5P A;  2OZM A;  2A1R A;  2Z1J A;  4CF0 A;  2VWJ A;  3KD1 E;  3THV A;  2VG5 A;  1FKP A;  1HQU A;  1VK0 A;  1VSE A;  4I9L A;  4TSX A;  3OS1 A;  4DFK A;  3PY8 A;  1W0H A;  1RTI A;  2X6N A;  3AVF A;  3LAK A;  4CEC A;  3LZI A;  4CJ5 A;  1IG9 A;  3K2P A;  3C94 A;  1RT2 A;  3ALY A;  4FLT A;  4FJM A;  1C1A A;  2YKM A;  2D0C A;  2X6S A;  4IBN A;  4ICL A;  3ZSO A;  4PA1 A;  4DTM A;  3QER A;  1U4B A;  1BL3 A;  3OYA A;  1RBV A;  4OLB A;  3RMC A;  2G8I A;  1C1C A;  1C6V A;  2BE2 A;  3JSM A;  5HRR A;  4YNQ A;  3PO5 A;  2IOC A;  3VQ6 A;  4B9T A;  1TKZ A;  1CXQ A;  3SUP A;  4BE0 A;  2FBV A;  5KTQ A;  3B6P A;  4KHU A;  3C95 A;  4OGC A;  3KK3 A;  1NJX A;  3M8P A;  2YKN A;  3U3G A;  3K5M A;  3RTV A;  3L2V A;  3SQ2 A;  1HNI A;  3SPZ A;  3OYN A;  4FYD A;  1NK6 A;  1WSH A;  2XRI A;  4RW9 A;  3E01 A;  2X74 A;  3QIN A;  3OYL A;  1Z25 A;  4CEA A;  3KJV A;  4CEQ A;  4FJH A;  1CXU A;  4IFV A;  3HPH A;  3G0Z A;  4DFM A;  3QEI A;  1KLM A;  4NCG A;  1VSI A;  4OVL A;  1IKW A;  4O0I A;  2HHU A;  3AVH A;  4J2D A;  2HMI A;  4DF8 A;  3C6T A;  2EX3 A;  4FJK A;  1BIS A;  2JGU A;  4GW6 A;  5C25 A;  2HB5 A;  4KI6 A;  4CGJ A;  3V1Q A;  3VQE A;  1JXE A;  5CYM A;  4CHN A;  2VG6 A;  4FW1 A;  1ASV A;  4BDY A;  1RNH A;  1L3S A;  1WLJ A;  4ID1 A;  4N56 A;  3L2U A;  4DLG A;  1SUQ A;  4HCB A;  3DLR A;  3B6O A;  4OJR A;  1HYZ A;  2WON A;  3AO2 A;  3OYD A;  4DTN A;  2HHQ A;  1BCM A;  4FM0 A;  3H08 A;  4B9V A;  1FK9 A;  3HXM A;  2OPP A;  3OY9 A;  1L3T A;  4Z4E A;  3ZT1 A;  5JS1 A;  1S6P A;  4LSL A;  4OGE A;  1TL3 A;  1WSF A;  5CY4 A;  1RBS A;  3VQB A;  3HPG A;  3HVT A;  1HQE A;  2GUI A;  2HHV A;  3LAL A;  5HBM A;  3OS0 A;  5KI6 A;  3MXJ A;  2Y1J A;  1TL1 A;  3DMJ A;  4KPY A;  1QE1 A;  2GV9 A;  3NGZ A;  3P1G A;  3V1R A;  3KLF A;  3O4N A;  4CER A;  2B5J A;  3L2W A;  5T7B A;  4ID5 A;  2XO7 A;  1IKX A;  3SV3 A;  4B9N A;  5E41 A;  4N5S A;  4CK3 A;  2PZS A;  1GOA A;  4F3T A;  1KFD A;  4CFC A;  1X1P A;  1RT4 A;  1ASU A;  1SL2 A;  4Q0B A;  3AVL A;  4RW7 A;  4DS5 A;  2OA8 A;  3BDP A;  3TAP A;  1D9F A;  3NFA A;  4CGH A;  1UAX A;  2KZM A;  1RT1 A;  4HHT A;  4DU4 A;  4W5T A;  2HND A;  1NKC A;  1A5X A;  4CIF A;  3TAR A;  1XHX A;  1RIL A;  2ITG A;  4GVM A;  3ZSZ A;  4CEF A;  4KB0 A;  3S3M A;  4BDP A;  4JRQ A;  1RT6 A;  3OJS A;  3DLB A;  2O4I A;  1XHZ A;  2ZE2 A;  1QQC A;  3SQ1 A;  1KSP A;  4DU1 A;  3V9Z A;  1BIU A;  1YTA A;  3I0S A;  3QET A;  4JS5 A;  4CK2 A;  1U47 A;  3NE6 A;  1D9D A;  3NGY A;  4IDK A;  2VWK A;  4O4G A;  4E1N A;  5SZT A;  1ASW A;  5CYQ A;  3ZSY A;  3V81 A;  1L3V A;  4BWJ A;  4ELV A;  2X78 A;  3LP1 A;  4Z4F A;  2EHG A;  2BDP A;  1J53 A;  1RT7 A;  5J2Q A;  4UQG A;  4CFB A;  2FBT A;  4B9S A;  3SV4 A;  4LH4 A;  3NH0 A;  3ZSQ A;  1S1X A;  1YT3 A;  4FLW A;  4FM2 A;  2OPR A;  1LWF A;  1TAQ A;  3V6D A;  4E19 A;  2R7Y A;  4CJR A;  2ETJ A;  4M3U A;  3AVG A;  1VRT A;  2XY5 A;  2YNI A;  2D0B A;  4RG8 A;  1S5J A;  4O55 A;  3ZT3 A;  3VQA A;  4M3Z A;  3AV9 A;  1KLN A;  1IO2 A;  1XC9 A;  3AVM A;  4CJT A;  5HLF A;  4I7F A;  3QNO A;  2P5O A;  4FJ9 A;  3QO9 A;  1BQN A;  3AVB A;  1G15 A;  4GMJ B;  4FJX A;  2ZQB A;  3V1O A;  3NF9 A;  1EP4 A;  3FFI A;  1QTM A;  1HYS A; 
#chains in the Genus database with same CATH topology
 3F2K A;  2DFH A;  5F2R A;  1WBD A;  1VQL N;  1TKD A;  2P9P A;  5KQD A;  1HYV A;  4JI6 K;  3L3U A;  1GOB A;  4L3Q A;  4CEB A;  2VG7 A;  4E0D A;  4PY5 A;  1SZ2 A;  5JS2 A;  2KLA A;  2YNG A;  3NAE A;  1TKX A;  3EEQ A;  4DWI A;  1OKJ A;  3ZCM A;  2G8V A;  1WN7 A;  4JI8 K;  3ID8 A;  5HP1 A;  1BWF O;  5KRT A;  3IMX A;  1QVF M;  3PUF A;  4OKK A;  2OPQ A;  3DXK A;  2NNW A;  4C8K A;  4DQS A;  1YVU A;  4KKO A;  4DFP A;  5AQM A;  4CES A;  1QSL A;  2A41 A;  1RDD A;  4MO5 A;  4CE9 A;  2GBZ A;  2RKI A;  3AVA A;  1U49 A;  2OTJ N;  1TVR A;  4CJL A;  2HHX A;  2A1S A;  4AHV A;  3J81 O;  4C8N A;  3TSQ A;  4FCY A;  3CJC A;  5GIP A;  3DWL A;  3HVR A;  3C7N B;  3MXM A;  5AFU H;  4BR4 A;  4JI5 K;  4F9O A;  5AZJ B;  3O3H A;  4O5F A;  3MEC A;  3K58 A;  3CFP A;  5KGX A;  5M1F A;  1X9S A;  2BAN A;  3OYC A;  4M45 A;  1XWL A;  3C7N A;  3UB5 A;  3BZC A;  1YXQ A;  4CJU A;  2E4L A;  2BH1 A;  4H0P A;  5AZJ A;  1N32 K;  3CHW A;  5HRP A;  4CK1 A;  4LF8 K;  3VTH A;  5AQT A;  4JI3 K;  4BG9 A;  1K8A O;  2UUA K;  1HNW K;  1T3V A;  1Q82 O;  3MXI A;  4GKJ K;  3PSI A;  3NH2 A;  3UIQ A;  4LFA K;  2LSN A;  4DF4 A;  3CC2 N;  4GV9 A;  4DSF A;  3SJH A;  3AA5 X;  3VQD A;  2GUP A;  4DHY A;  2P5G A;  2JWL A;  3HL8 A;  4Y1D A;  4NCB A;  4OX9 K;  1RCH A;  3CD6 N;  4BE2 A;  1GLF O;  3CM6 A;  5C15 A;  4IG0 A;  3LP3 A;  3DRR A;  3LDO A;  5EOY A;  4B08 A;  4CJ3 A;  4B3R K;  3CM5 A;  4KBO A;  5BR9 A;  4QOZ B;  1CZ9 A;  3LAN A;  3M5R A;  3VEY A;  3P5J A;  1ITG A;  1KTQ A;  3HOT A;  1IG8 A;  4AF1 A;  3CCQ N;  3BF3 A;  1T8E A;  1BIZ A;  4Y1C A;  1RDB A;  3AA3 A;  4M3T A;  4JS4 A;  4O8K A;  2QTD A;  4JKG A;  4YOX A;  4B9U A;  2HF3 A;  3CCV N;  1N8R O;  4ISG A;  3SLC A;  5K14 A;  4CJQ A;  1ESV A;  4K25 A;  4CZL A;  3O6W A;  4C1N I;  5BN8 A;  3M8S A;  3OA9 A;  3M6G A;  1TK5 A;  4FJL A;  2QXF A;  4BRO A;  3HYF A;  4Z4C A;  3MN6 A;  1Q86 O;  4FWM A;  3KD5 E;  4MQ3 A;  4K8X A;  3QFP A;  5JMV A;  3O4Q A;  4BC4 A;  1NK5 A;  1VQ4 N;  4IO9 L;  1W2B M;  3BZK A;  5CZ2 A;  1TGO A;  4E7L A;  1M90 O;  4FJG A;  1L3U A;  2QWN A;  3MEE A;  4WYB A;  5C24 A;  1RTD A;  5FPE A;  1Q7Y O;  3CCE N;  2EWS A;  1BA1 A;  2FXU A;  1W97 L;  3TTF A;  3HT3 A;  5LMU K;  2HST A;  5FDL A;  4DTU A;  3PX0 A;  3K0S A;  3TWH A;  2VCP A;  3NF6 A;  4ISF A;  2P9U B;  4HCC A;  4KHN A;  3E9L A;  1VQ8 N;  1QS4 A;  1XI1 A;  2QI2 A;  4FJ8 A;  5AQJ A;  4FM1 A;  3H1Q A;  3K57 A;  4DV4 K;  2P9U A;  1CZA N;  4H4O A;  3AO5 A;  3MK6 A;  1SAZ A;  4KHS A;  2KKZ A;  3OYJ A;  4DV1 K;  4GV6 A;  3LAM A;  1JKH A;  3CET A;  3OYK A;  3LDS A;  4BDZ A;  4KRF A;  2DY4 A;  2Z1G A;  3VEZ A;  1RT5 A;  4QS9 A;  1REV A;  3NGI A;  1RFQ A;  3AO4 A;  2P9S B;  5B8H A;  1CZB A;  3SMS A;  4AHT A;  3BF1 A;  4XH4 A;  2F4V K;  1LCU A;  2PFU A;  4KI4 A;  3H46 O;  3GBT A;  3K9J A;  2IGI A;  4E1J A;  4KH6 A;  3FZF A;  4CJV A;  4LH5 A;  4U67 L;  3H3O B;  3MX5 A;  1KCF A;  1IH7 A;  3ZEU B;  3CI5 A;  3SQ4 A;  1T44 A;  1T7P A;  3T69 A;  2P9S A;  3J8A A;  3AVJ A;  3MX2 A;  4BE1 A;  3S3O A;  4DV5 K;  1Z05 A;  4K41 A;  4A59 A;  3SYZ A;  4KHP K;  3KIO A;  4J2A A;  4KHW A;  4CF8 A;  3S9H A;  3BY5 A;  3ZEU A;  4DTX A;  5TKW A;  4U7B A;  3WNH A;  4FL9 A;  3QEW A;  4PKH A;  2QA4 N;  1W9H A;  3VGL A;  1OVQ A;  3TI0 A;  1YI2 N;  1RTH A;  3O4W A;  2YNF A;  4AHU A;  2BTF A;  1WSE A;  4DR5 K;  4H4M A;  4IKF A;  4PUO A;  4I2Q A;  1NK0 A;  4DV6 K;  4BRI A;  4KTZ A;  3VF2 A;  4OPJ A;  3HPO A;  3PX6 A;  3ZET B;  2QWO A;  1RT3 A;  2A42 A;  4CBU A;  3SUQ A;  2A3Z A;  3Q7C A;  5KGW A;  1JCE A;  1E4F T;  3UKR A;  3RMD A;  4FVU A;  1JL2 A;  4EZ9 A;  2IS3 A;  3VEW A;  4AIL C;  4PL7 A;  4L8R B;  1IBM K;  3ZET A;  4FJ7 A;  1DTQ A;  3CYM A;  5CR4 A;  1B9F A;  3SZ2 A;  4JK9 A;  3RMA A;  4GNI A;  3VN5 A;  4KTW A;  4IJA A;  4H5T A;  4CF2 A;  5AQO A;  4ILG B;  4DMN A;  3TAB A;  2NRX A;  4JEP A;  1ZBI A;  3VQ7 A;  4DTO A;  4DU3 A;  5AQG A;  3VEX A;  2KFZ A;  5BR8 K;  3WXI A;  2QKB A;  4W5R A;  4RW4 A;  1Q9Y A;  3AO3 A;  4FLY A;  3LWL A;  2E5L K;  2XY7 A;  1C1B A;  3VGK A;  1EX4 A;  1T6D A;  2OZM A;  2Z1J A;  2VG5 A;  4M7X A;  1HQU A;  2ASO A;  3TTD A;  4DR3 K;  1VSE A;  4TSX A;  4DFK A;  3ALY A;  2NRR A;  1YIT N;  3NMU A;  5AQW A;  4PA1 A;  1U4B A;  1BL3 A;  1RBV A;  4IZ9 A;  4GKK K;  3JSM A;  5HRR A;  2NRV A;  4DUZ K;  3LM2 A;  2FBV A;  2ZF5 O;  2P9N B;  2Q2R A;  3A5N C;  3O80 A;  3K5M A;  3THX B;  3L2V A;  4FYD A;  1WSH A;  3QDK A;  3E01 A;  3OYL A;  4BRM A;  1I94 K;  1CXU A;  3HPH A;  3G0Z A;  4CVN E;  4NLC A;  1IKW A;  3AVH A;  5AQU A;  4EAH D;  3T1H K;  2HMI A;  3C6T A;  3F9M A;  4BC2 A;  3THX A;  2JGU A;  5C25 A;  2VYP A;  4FPA A;  2HOE A;  5FPN A;  1J6Z A;  1X3N A;  2VG6 A;  3CCR N;  4FWK A;  2HBJ A;  3L2U A;  1SUQ A;  4HCB A;  3DLR A;  4OJR A;  3OYD A;  2WON A;  5BRF A;  1BA0 A;  2OPP A;  3HXM A;  3OY9 A;  4K0K K;  3LDP A;  1S6P A;  4LF5 K;  4OGE A;  1RBS A;  2VGM A;  3U9Z A;  5LJV A;  5KI6 A;  2Y1J A;  3DMJ A;  3KLF A;  3O4N A;  4CER A;  1NGI A;  3SV3 A;  4B9N A;  4BR7 A;  3SMP A;  3OBY A;  4JYA K;  1ATR A;  4G9Z A;  1ASU A;  3S41 A;  1SL2 A;  5HOO A;  3AVL A;  2NRZ A;  4RW7 A;  3BDP A;  3H1V X;  3TAP A;  5F0X A;  4CGH A;  3L0Q A;  3PIO L;  4HHT A;  2E1Y A;  5KPZ A;  4W5T A;  1NKC A;  1A5X A;  5ELZ A;  4GVM A;  2ITG A;  4CEF A;  4BDP A;  4H0O A;  3OJS A;  2O4I A;  2ITM A;  4CW7 B;  3V9Z A;  3CER A;  4CK2 A;  3NGY A;  1HNX K;  5SZT A;  1ASW A;  3A8Y A;  1L3V A;  4ELV A;  2X78 A;  3LP1 A;  4Z4F A;  1J53 A;  3SBG A;  5GAG P;  4FWP A;  3LDQ A;  1RDW X;  2ZWH A;  3IUC A;  3O9T A;  3W3D A;  3ZSQ A;  1S1X A;  3V6D A;  4CJ7 A;  4M3U A;  3AVG A;  1VRT A;  2YNI A;  4RG8 A;  2Q31 A;  3VQA A;  3ENO A;  4FJ9 A;  5HLF A;  3QNO A;  2P5O A;  1BQN A;  1G15 A;  1EP4 A;  4JD2 B;  1HYS A;  1JLC A;  2Q0U A;  1JLQ A;  4BC5 A;  1D8Y A;  3IRX A;  3HOS A;  2YJE A;  4OKJ A;  1BI4 A;  4BVO A;  3VF4 A;  1Q9X A;  4K42 A;  1WBB A;  3KLH A;  3P83 D;  4FJN A;  3ZT0 A;  5C2D A;  4KRE A;  4CCH A;  1DLO A;  3ULE B;  2HHW A;  4F4K A;  3WQT A;  3MEG A;  3WNE A;  1S9G A;  1S9E A;  4ZTJ A;  1C0M A;  3OBW A;  3O1W A;  4PL8 A;  3HRG A;  2PBD A;  3G4S N;  4KTQ A;  4WE1 A;  1J54 A;  3VEN A;  4PKG A;  4KH4 A;  3ULE A;  4LF6 K;  4H0T B;  4CHQ A;  4JI4 K;  4CD1 A;  2ZM6 K;  4X66 K;  4A57 A;  4H0Y B;  3CG7 A;  2GWK A;  3A0I X;  3AVI A;  2V7Y A;  4YHH K;  1T05 A;  3M8R A;  1NJZ A;  3IAY A;  2WC9 A;  2H3G X;  1R59 O;  1SL1 A;  4AHR A;  4KAZ A;  4ELT A;  4CZJ A;  1TUY A;  3IFR A;  3PIP L;  3DXM B;  3O3F A;  4WQ5 A;  2QK9 A;  2A5X A;  4FK4 A;  1WNS A;  5AQY A;  4FVM A;  4C8O A;  5BPL A;  4CGG A;  5AQL A;  3O9S A;  3DXM A;  3DLE A;  3QBX A;  4M42 A;  2YHA A;  5EVZ A;  1GLL O;  5AQI A;  4BGA A;  1HNV A;  3ZSW A;  4CZE A;  2Z1I A;  4OO1 J;  1NM1 A;  3AO1 A;  4N41 A;  3HJF A;  1E3M A;  3A2F A;  4B1V A;  4J2B A;  1ZBS A;  1O1W A;  3MMV A;  1LAW A;  1K8K B;  3AAQ A;  5J2P A;  1C0G A;  1QHT A;  3QIC A;  2ZGY A;  3CF5 L;  4NYN A;  3RWU A;  3K5L A;  4JKF A;  2DFF A;  5TKY A;  2HHT A;  4JKE A;  4M41 A;  4MLE A;  2P9K B;  1RTJ A;  5AQP A;  5D3G A;  3VQ8 A;  2W41 A;  1K8K A;  1LOT B;  4QS8 A;  1RBU A;  1WB9 A;  4WCE L;  1EWR A;  1FKO A;  4M63 C;  2CGL A;  3D45 A;  2CGJ A;  3R6M A;  2P9K A;  1NK7 A;  2WTU A;  5EY4 A;  3RRH A;  3SI6 A;  2ZJQ L;  3U9D A;  2DPN A;  4FLZ A;  2P9P B;  3T3F A;  2O4G A;  2B6A A;  1MU2 A;  1ZYQ A;  4R79 A;  1N5Y A;  4O5B A;  3VEO A;  3JS6 A;  5C42 A;  4CEE A;  1UA1 A;  3I0R A;  5J1E A;  3DXK B;  4IFY A;  4BRL A;  1S6Q A;  1QSY A;  2CH5 A;  4JN4 A;  2YHW A;  5AQS A;  1TK8 A;  2RPI A;  4DR6 K;  3DLK A;  2FSN A;  3D2E B;  3QLH A;  3DI6 A;  3PLA A;  5GAD P;  4B1Z A;  2FBY A;  1WSI A;  2VQF K;  3I56 N;  2G8W A;  4YFU A;  5J2N A;  1N34 K;  2RE2 A;  4DB3 A;  5C2F A;  1VSM A;  2D5R A;  3D2E A;  4FPB A;  4W5N A;  1ZC6 A;  3DLG A;  3AGK A;  3CJ1 A;  1HJR A;  4DR7 K;  4OLA A;  2RN2 A;  4Z4I A;  3KTQ A;  2KTQ A;  4DQP A;  2UUC K;  1GLE G;  2GEM A;  2E6M A;  4KHY A;  3EY1 A;  4DS4 A;  1HKC A;  4M3X A;  3L4I A;  1DTT A;  4FOE A;  1NJW A;  3BGR A;  4RW8 A;  4WQ5 C;  1YJW N;  3IKM A;  1F21 A;  3SPY A;  3KK7 A;  4CZG A;  4FXD A;  4B3S K;  2HVI A;  3OYM A;  3FLC O;  1NGJ A;  3GL1 A;  5HRN A;  4YOY A;  1U04 A;  2E2Q A;  4FLX A;  1OH8 A;  4EFH A;  1NKE A;  1YUW A;  1SV5 A;  2F9W A;  4CF1 A;  2O8F A;  3UKU A;  3NH1 A;  3QFU A;  3OJU A;  3ENH A;  3LM9 A;  1NGC A;  2RF2 A;  3HM8 A;  5I3U A;  1KXP A;  4BRG A;  4CJF A;  1WAJ A;  4FJ5 A;  1S1T A;  5SWM A;  3L2R A;  3EO3 A;  4CBX A;  3C65 A;  1UA0 A;  1TV6 A;  1V4T A;  1QSS A;  1NKB A;  4MDA A;  5FRO A;  5FRM A;  1U48 A;  5GAE P;  4JKG B;  2E2O A;  3GG4 A;  3THY A;  3MWT A;  4CZM A;  4FZX C;  1NK9 A;  1IJJ A;  1VSF A;  2G8F A;  3N4Q A;  1U2V B;  4M3R A;  4DSJ A;  1TUU A;  3NCI A;  1W7A A;  2G8U A;  3O3G A;  3EYZ A;  1UWB A;  4JRP A;  3K9K A;  3CPW M;  3VQQ A;  3E1Y A;  2ZJP L;  1U2V A;  2E6L A;  4CGI A;  1FJG K;  5AR0 A;  1ZBF A;  3ZX3 A;  1BU6 O;  1UOC A;  1LV5 A;  3H6E A;  3I8D A;  3VA0 A;  3FZM A;  1KVB A;  2E8A A;  3CIP A;  5DK5 A;  4DV7 K;  4MFB A;  3KK1 A;  1L5U A;  3ULD A;  5IWA K;  1SQK A;  3I33 A;  3GOI A;  2W42 A;  3AA2 A;  3SAF A;  3SUO A;  4PWD A;  3CCU N;  3LP0 A;  1K6Y A;  3O5B A;  1LWE A;  3AA4 A;  4B1W B;  2A1R A;  1BDG A;  1FKP A;  1OH6 A;  4Z94 A;  2F7T A;  4I9L A;  3PY8 A;  2NRT A;  1IG9 A;  4J2D A;  3AVF A;  3NVK A;  4CEC A;  4FLT A;  1RT2 A;  1SS6 A;  1C1A A;  4RCH A;  2X6S A;  3D2F A;  4IBN A;  4ICL A;  3ZSO A;  1ATS A;  1KAX A;  1NU0 A;  4IEE A;  4OLB A;  4FWR A;  5I9E B;  4JI1 K;  4B9T A;  4BY9 C;  4BE0 A;  1KD1 O;  3B6P A;  4KHU A;  3DAW A;  3F5T A;  3M8P A;  1HNI A;  5AQK A;  3CC7 N;  2XRI A;  2HBL A;  3KJV A;  4CEQ A;  3J7Z O;  4FJH A;  5CHI A;  3FZL A;  4DFM A;  1KLM A;  4NCG A;  1VSI A;  4C23 A;  1NWK A;  4XEI A;  1GLD G;  2HB5 A;  4KI6 A;  3V1Q A;  5CYM A;  1ASV A;  4BDY A;  1HKB A;  1OVY A;  3DLL L;  4ID1 A;  2HHQ A;  1HYZ A;  1O13 A;  4OPH A;  4DTN A;  1BCM A;  4FM0 A;  4B9V A;  3HBT A;  1L3T A;  3ZT1 A;  4FWL A;  4LSL A;  5AQH A;  2FF3 B;  3O9U A;  3VQB A;  2D0O A;  4DQ8 A;  4BRA A;  3HPG A;  1HQE A;  5HBM A;  3M1F A;  4KPY A;  2GV9 A;  2OAN A;  3V1R A;  2B5J A;  5T7B A;  3U4L A;  4H03 B;  4ID5 A;  2XO7 A;  1GLJ O;  2PZS A;  1EQY A;  4CI6 A;  1X1P A;  2Q36 A;  3MCP A;  1P8Z A;  3ATV A;  3D7E O;  3CPE A;  3UKR B;  1XHX A;  3L4Q A;  1RIL A;  4DV3 K;  3S3M A;  4I6M A;  4JRQ A;  3AY9 A;  1XNR K;  1MWK A;  4DUY K;  1XHZ A;  4PHT X;  2ZE2 A;  1QQC A;  3O1B A;  3SQ1 A;  1KSP A;  3MWP A;  1YTA A;  2ASM A;  4H5R A;  5AQN A;  4JS5 A;  4E1N A;  2IVP A;  3BEX A;  1NG9 A;  2EHG A;  3VEV A;  2BDP A;  1RT7 A;  2I7P A;  4B9S A;  3SV4 A;  4YOT A;  1BUP A;  3N4P A;  1YT3 A;  2QXL A;  3CJ9 A;  3QBW A;  3T7Z A;  1VQK N;  3CMA N;  1VQ6 N;  4CJT A;  2UUB K;  3GE1 A;  2IVN A;  3NF9 A;  4GV3 A;  4BR2 A;  1QTM A;  2NUB A;  1JL1 A;  2GX9 A;  1S3X A;  3QES A;  2PYJ A;  1IKY A;  1EWQ A;  3HO1 A;  2VWB A;  3CFR A;  4BR5 A;  4JK7 A;  3NF8 A;  2P1J A;  4B3O A;  2HW3 A;  4WFA L;  1GLA G;  4FJJ A;  3TR8 A;  4B9Q A;  2QKK A;  2KZZ A;  1Q8I A;  2QW9 A;  4LFB K;  1HPM A;  2E20 A;  1V4S A;  3FR0 A;  4NO7 A;  4JKA A;  3CCJ N;  3D6R A;  4JNE A;  2Y1I A;  5HL7 L;  2E2P A;  2PYL A;  4IOX A;  4N47 A;  1QQN A;  1VRU A;  4FLV A;  2V51 B;  4RW6 A;  3LPT A;  1Z6R A;  3QML A;  4I2P A;  4CGD A;  1NNE A;  4B8C A;  1Q18 A;  4BR0 A;  3C0B A;  5LJW A;  3CQX A;  1VSK A;  3DOK A;  1LWC A;  4E89 A;  3HZ6 A;  3SK3 A;  3SUN A;  2NLX A;  2OPS A;  1QQO A;  3LDN A;  4EHU A;  4HTL A;  1VHX A;  2GEL A;  3NHG A;  4DR4 K;  2KFN A;  5ADX A;  3HST B;  1DEJ A;  1S1V A;  3SNN A;  5MLC Q;  3HP6 A;  5KPT A;  4B3M K;  3R3L A;  5I42 A;  4YOU A;  3U3Y A;  3W0L A;  2O8E A;  4MLH A;  4XH1 A;  1VQO N;  1QHA A;  4Z4G A;  3GDQ A;  3PV8 A;  1KVC A;  4NYF A;  2P51 A;  4O44 A;  4FJI A;  1I39 A;  4KO0 A;  4CEO A;  3OVN A;  3DYA A;  3WXK A;  5JVG L;  1YJ9 N;  3ZX0 A;  4QCL A;  3AVN A;  3TAN A;  1YF5 L;  2KW4 A;  4WQ4 A;  2YHB A;  4JKH A;  2V52 B;  2J4R A;  3CFO A;  3IDH A;  1NJI O;  4X62 K;  1J5O A;  3O9R A;  3WNG A;  5KQ8 A;  5AZI A;  3TAF A;  1BG3 A;  1BI4 B;  4DLE A;  2BGG A;  1RDA A;  1XMQ K;  4FK0 A;  4CJ4 A;  3CCS N;  4BWM A;  1CLQ A;  3QEV A;  2FC0 A;  1NGE A;  1GLC G;  4DSI A;  1HMV A;  4X65 K;  3OS2 A;  1BGX T;  1FXX A;  2XY8 A;  5JLF A;  3VQ9 A;  3OYH A;  3VA3 A;  1BQM A;  4O0J A;  4DG1 A;  5C12 A;  2CH6 A;  3L3V A;  3QEP A;  3FE1 A;  4YY3 K;  3KLE A;  2O8D B;  1LAV A;  4CBW A;  1JLA A;  1J9A A;  4DQR A;  1DT9 A;  4Z4H A;  3I55 N;  1EKE A;  4CFA A;  1BHL A;  3BUZ B;  4J2E A;  5JIC A;  1JCG A;  3VET A;  4BR9 A;  2DFE A;  2O8D A;  4LC9 B;  3ZSX A;  2CGK A;  4CJW A;  4N76 A;  4LY7 A;  4LF7 K;  3KLI A;  2AP1 A;  4BRF A;  4BQL A;  4IG3 A;  1MWM A;  2DTU A;  4AHC A;  4E7J A;  1HRH A;  5CE3 A;  4M7Y A;  3SQ0 A;  1VAZ A;  1BCO A;  3K59 A;  4RTF D;  3VTI A;  3P31 A;  5M1K A;  4E7H A;  1P90 A;  2PY5 A;  4JKB A;  3VQP A;  2UYT A;  1ZBL A;  1WSG A;  1HNZ K;  2UU9 K;  4HUG A;  3QIP A;  3TPQ A;  2YV0 X;  3QIO A;  3IG1 A;  3WXJ A;  1GLB G;  3M8Q A;  1WOQ A;  3ZT4 A;  4M3Y A;  2AJQ A;  4C8L A;  4JLH A;  1DGK N;  3SCX A;  3ZYY X;  4K8Z A;  2YNH A;  4DTJ A;  4EP4 A;  3TSU A;  3C6H A;  5ADX H;  3KHY A;  4ELU A;  3L6Q A;  3MN5 A;  2IDO A;  2FF6 A;  4FW2 A;  3PX4 A;  3WXL A;  1ZBH A;  1VSL A;  1RBT A;  3L8B A;  2UXC K;  4M3W A;  1SL0 A;  2O8C A;  4DR1 K;  3OYE A;  4JKD A;  1A5V A;  3IS9 A;  4CHY A;  4CZK A;  3LZJ A;  3ZT2 A;  4CJP A;  4CHZ A;  3KWI A;  2HHS A;  4DTP A;  3G6E N;  4ZTF A;  4NCA A;  1X3M A;  4AHS A;  3EKU A;  1B92 A;  4CD3 A;  3JYT A;  5HRO A;  3VOV A;  1NBW A;  3UE5 A;  3RMB A;  1N33 K;  5H1S Q;  4K43 A;  1EET A;  2A6A A;  3CCM N;  4DV0 K;  3DM2 A;  1NGF A;  2JLE A;  5C10 A;  1HX1 A;  1MDU B;  3KVG A;  1VSJ A;  4C8M A;  4IWV A;  4E3S A;  1SKS A;  1OH7 A;  3WNF A;  4CZI A;  4PQU A;  5AQQ A;  1TAU A;  3CJ7 A;  1HLU A;  4MDB A;  4O8U A;  2NRW A;  5CZ1 A;  4CJS A;  3EZW A;  2ZD1 A;  2XY6 A;  3V4I A;  4EP5 A;  3KKR A;  4LSN A;  3HTV A;  3CCL N;  1KC8 O;  1VK0 A;  1W0H A;  1RTI A;  2X6N A;  3LAK A;  3JAM O;  3C94 A;  2YKM A;  2FSJ A;  3QER A;  1ATN A;  1IBL K;  3RSE B;  3JXU A;  2UXD K;  3RMC A;  2QWR A;  1C1C A;  2BE2 A;  3TSP A;  5BRD A;  2IOC A;  3FZK A;  3VPZ A;  5BPM A;  3CXC M;  3AAP A;  3SAH A;  3G25 A;  3C95 A;  4OGC A;  3U3G A;  2D0P A;  1YVN A;  3SPZ A;  4FO0 A;  3RSE A;  4FWS A;  1NK6 A;  3ATU A;  2O8F B;  3UKU B;  5C0Y A;  1ZXO A;  4MO4 A;  3H3N O;  3WT0 A;  3QEI A;  2HHU A;  4O0I A;  1X9J A;  4NB4 A;  4DF8 A;  3BP8 A;  4A5A A;  1S72 N;  4FJK A;  1BIS A;  4V19 S;  2RHK A;  3VQE A;  1Q81 O;  4FWQ A;  4CHN A;  4NLB A;  2GWJ A;  2KHO A;  1L3S A;  1WLJ A;  4N56 A;  4DLG A;  2GTD A;  2P9L B;  1HR0 K;  3AO2 A;  1MA9 B;  3H08 A;  3WXM B;  5JVH L;  2QWM A;  4BRE A;  4Z4E A;  5JS1 A;  1TL3 A;  2YJF A;  3THY B;  1WSF A;  3O9Q A;  3VER A;  3HVT A;  4H0X B;  2P9L A;  3LAL A;  3MXJ A;  1QE1 A;  3ZX2 A;  3L2W A;  3HSC A;  2HF4 A;  5E41 A;  4N5S A;  4CFC A;  3MCA B;  2OA8 A;  4DS5 A;  4AM6 A;  3NFA A;  1UAX A;  1RT1 A;  4A61 A;  2HND A;  3TAR A;  2HBK A;  3ZSZ A;  4IJN A;  1RT6 A;  2ZGZ A;  4DU1 A;  1BIU A;  2Q1N A;  2W6K A;  2QEX N;  1U47 A;  3NE6 A;  1D9D A;  4IDK A;  4O4G A;  4IFE A;  5CYQ A;  4PKI A;  5J2Q A;  4UQG A;  3WQU A;  4FM2 A;  1TAQ A;  2R7Y A;  4CJR A;  2ETJ A;  2XY5 A;  2D0B A;  1S5J A;  3ZT3 A;  1XMO K;  3AV9 A;  4BG8 A;  4DV2 K;  4B1X B;  3AVM A;  3AVB A;  4GMJ B;  1XUP O;  4FJX A;  2ZQB A;  1IV0 A;  3OTO K;  3VQ4 A;  4XH5 A;  1SKR A;  3TAM A;  3RRG A;  1TKT A;  4KHQ A;  3D2F B;  4KV8 A;  4IDH A;  4JI2 K;  4XIU A;  5EU7 A;  4F8R A;  4HUF A;  3B8A X;  3HP9 A;  4DTR A;  3L2Q A;  3J80 O;  5FLX O;  4DSL A;  4IO8 A;  2F8T A;  3K5N A;  4JI0 K;  3C6U A;  4FZY A;  3R1X A;  5E84 A;  5LY3 A;  3T19 A;  1NMD A;  1C0F A;  1S22 A;  2A40 A;  3AVC A;  3LP2 A;  1H1V A;  2F96 A;  4RWT A;  1VSD A;  1QVG M;  2IC3 A;  3AVK A;  1VQP N;  2FLO A;  4WFB L;  5BN9 A;  1YIJ N;  3NF7 A;  4Q5V A;  2P9I B;  4YOR A;  1YJN N;  1JCF A;  3O8M A;  2OCE A;  4F2S A;  2YHX A;  2E88 A;  1FW6 A;  3OYB A;  4H0V B;  3E66 A;  1LW0 A;  2BUP A;  4E7I A;  2P9I A;  2YHY A;  1Z26 A;  5E26 A;  3C6A A;  2WUS A;  1QZ6 A;  4BRK A;  3G71 N;  5BRE A;  3HK2 A;  4DQQ A;  1NGB A;  4ZHR A;  3ENB A;  2ATQ A;  4DCH A;  4FWN A;  4CJE A;  2E2N A;  3LWM A;  4A5B A;  3FGU A;  4CIE A;  4JHD B;  5GIN A;  2OZS A;  3DRP A;  1NK8 A;  4W5Q A;  4E7K A;  3D0P A;  1YHQ N;  4FOI A;  2D4W A;  1NOY A;  4KFB A;  4I6M B;  4IOC L;  2FBX A;  4CEZ A;  3OYI A;  4JHD A;  1C0T A;  2I5J A;  3EKS A;  3EZ5 A;  3EE9 A;  2D0A A;  1HPZ A;  5KRS A;  1T03 A;  4C1N K;  1KFS A;  5LMN K;  4H8K A;  3V9X A;  3TTC A;  5HRS A;  4B9L A;  4UY8 O;  2NZT A;  3V9U A;  2G8H A;  4CZH A;  4DQI A;  3KWG A;  5DM7 L;  4BRH A;  3ASM A;  3ZSR A;  3SAG A;  1LW2 A;  1Y97 A;  3PO4 A;  1NK4 A;  2HBM A;  2FSK A;  3F73 A;  4CIG A;  5BPN A;  3AAR A;  3QEX A;  1YTU A;  1WAF A;  4EZ6 A;  3ZLJ A;  5J2M A;  4G1Q A;  3DLH A;  4HVJ A;  2XHB A;  3VQC A;  4QAG A;  3U6F A;  1RBR A;  2Q3S A;  5DMR A;  4EIA A;  5EX5 A;  1OH5 A;  1RGI A;  2WBN A;  2Q97 A;  1S1U A;  3VGM A;  4CJK A;  1B9D A;  1D5A A;  1KQS M;  3THW B;  1VSH A;  3K5O A;  3MED A;  1KAZ A;  3QNN A;  4CGF A;  4B1Y B;  1U45 A;  3TAQ A;  4J8F A;  4GVE A;  1XNQ K;  4I9Q A;  1N6Q A;  5EXW A;  3Q7B A;  2IAJ A;  1NMN A;  3G10 A;  2W40 A;  4DTS A;  4Z0U A;  4BAC A;  3THW A;  3KK2 A;  3NVM A;  4AM7 A;  1Y64 A;  4E1M A;  5FPD A;  3VMF B;  3CQ8 A;  2F8S A;  4CFD A;  1HJO A;  4DFJ A;  4BRQ A;  4AQY K;  3TAE A;  3RR7 A;  3J7A P;  4CHO A;  4B1U B;  4FLU A;  1JLE A;  1IKV A;  4W5O A;  3MDQ A;  2VQE K;  4BRP A;  5BRH A;  3FFK B;  2IIR A;  5AQZ A;  3NBP A;  2QWQ A;  4OPK A;  4DSK A;  1D4X A;  3RR8 A;  1RDC A;  4DSE A;  5M1N A;  3NDK A;  4HTU A;  1TK0 A;  4DKW A;  4BRD A;  3R9P A;  4WFN L;  1JXB A;  3ZSV A;  2KQ2 A;  1NGA A;  4BQZ A;  1TYQ B;  2WFB A;  3MAQ A;  4JI7 K;  1R0A A;  3ITH A;  1ZBU A;  4JKC A;  4ILH A;  1I3A A;  4FK2 A;  1E4G T;  3E9O A;  3KLG A;  4CF9 A;  2QM1 A;  3LDL A;  3HM9 A;  1TYQ A;  4KB1 A;  4A2A A;  2Q0R A;  3CJA A;  2P9N A;  5GIO A;  2O8E B;  4HUE A;  1KRP A;  5AQX A;  1NGH A;  3LPU A;  4FZZ A;  1VQ5 N;  3S3N A;  4OKE A;  5DM6 L;  3T1Y K;  1VQM N;  1EO1 A;  5LL6 Z;  3DRS A;  1A5W A;  1NJY A;  4DR2 K;  2HNZ A;  4YOW A;  1NOZ A;  4GY2 B;  3HI0 A;  1RDU A;  4IEI A;  3EN9 A;  1EXQ A;  3J7Y P;  4KH5 A;  1X9M A;  5FRN A;  3OYG A;  4EHT A;  4QS7 A;  2OTL N;  3OHR A;  4B8A B;  4NXN K;  4H5V A;  4LD0 A;  3T1A A;  4BRN A;  4B9M A;  4F3O A;  2B4J A;  4YDU A;  4CED A;  5F1X A;  2HNY A;  3TAG A;  5M1Q A;  1S1W A;  2PAV A;  5AZI B;  4YOV A;  1QQM A;  2YCH A;  4AH9 A;  1K73 O;  1M1K O;  4CHP A;  2AA4 A;  3ISN C;  5M1O A;  2WOM A;  4IXC A;  1N36 K;  2G8K A;  1SKW A;  1DKG D;  3R8E A;  2E1Z A;  1YAG A;  1GOC A;  3VF6 A;  3OYF A;  5KPR A;  4LFC K;  1JLF A;  1WSJ A;  3DOL A;  3CQY A;  4FSV A;  2Z1H A;  3P39 A;  3ID6 A;  4HWI A;  1KVA A;  1VQ7 N;  2ZJR L;  2OYQ A;  3QB0 A;  3CME N;  2YX6 A;  4H5N A;  3V9S A;  3V9W A;  4LF4 K;  1X9W A;  3I8B A;  2I7N A;  4BC3 A;  4Y0W A;  2HVH A;  2QWP A;  1K9M O;  1XQS C;  5AQV A;  3SJJ A;  2JWK A;  1JLG A;  1C0U A;  3F9K A;  4JK8 A;  1JLB A;  1WUA A;  4FWO A;  3WUH A;  3KKS A;  4R5P A;  3VQ5 A;  3SBT A;  3KD1 E;  4CF0 A;  2VWJ A;  3THV A;  3H45 C;  4JD2 A;  5AJ3 K;  3OS1 A;  4F2R A;  3AGR A;  1KAY A;  3LZI A;  4CJ5 A;  3K2P A;  4FJM A;  3DJC A;  5AQF A;  2D0C A;  4DTM A;  5M1P A;  2O8B B;  3OYA A;  5IT9 O;  2G8I A;  2HMP A;  2YI1 A;  1C6V A;  1IBK K;  2VGN A;  5AFU A;  4X64 K;  4YNQ A;  3PO5 A;  3VQ6 A;  1TKZ A;  4CZF A;  1CXQ A;  4H5W A;  3SUP A;  1BOT O;  5KTQ A;  1NJX A;  3KK3 A;  3RTV A;  2YKN A;  2HHH K;  3SQ2 A;  2O8B A;  3OYN A;  1T6C A;  2IVO A;  3TU5 A;  4RW9 A;  2X74 A;  3QIN A;  1Z25 A;  2D1K A;  4CEA A;  3KZB A;  3PSF A;  4A2B A;  4IFV A;  1U6Z A;  4A62 A;  3A5L C;  4OVL A;  4LF9 K;  2EX3 A;  4GW6 A;  5AQR A;  4CGJ A;  1JXE A;  1NLV A;  4FW1 A;  3EL2 A;  1RNH A;  4BRC A;  3WEE B;  3P38 A;  2F9T A;  3B6O A;  1NGG A;  1FK9 A;  2V7Z A;  4BVP A;  3CC4 N;  2O8C B;  5CY4 A;  2QWL A;  2GUI A;  3WEE A;  2HHV A;  1VQ9 N;  3OS0 A;  4NXM K;  1TL1 A;  3NGZ A;  3P1G A;  1G99 A;  1NGD A;  4B3T K;  4BGB A;  1HKG A;  1IKX A;  4CK3 A;  4YDU C;  1GOA A;  4F3T A;  3VES A;  1KFD A;  5GAH P;  2UXB K;  1RT4 A;  3E9P A;  1J5E K;  4Q0B A;  1HUX A;  3RVC A;  3M3Z A;  1D9F A;  3LL3 A;  1JJ2 M;  1QZ5 A;  2KZM A;  4WQ4 C;  3A5O C;  4DU4 A;  4ILJ A;  1BO5 O;  4CIF A;  3EE8 A;  3FZH A;  4KB0 A;  1XC3 A;  4JV5 K;  3DLB A;  2W6L A;  3OW2 M;  2ASP A;  3I0S A;  3QET A;  1ILY A;  3A5M C;  2VWK A;  5FPM A;  3V81 A;  3ZSY A;  4JAX A;  4BWJ A;  4ISE A;  4CFB A;  2FBT A;  4LH4 A;  3P4I A;  3NH0 A;  4OPA A;  4FLW A;  5JLH A;  2OPR A;  1LWF A;  4E19 A;  3CJB A;  2NRH A;  4WF9 L;  4O55 A;  4M3Z A;  3O08 A;  1KLN A;  1IO2 A;  1XC9 A;  4IOA L;  4I7F A;  3MN7 A;  3QO9 A;  3U8X A;  1VQN N;  3V1O A;  3MN9 A;  3FFI A;  5A2Q O; 
#chains in the Genus database with same CATH homology
 2DFH A;  1JL1 A;  1JLC A;  2NUB A;  3VQ4 A;  3QES A;  2PYJ A;  1IKY A;  1TKD A;  3HO1 A;  1JLQ A;  1SKR A;  1HYV A;  3CFR A;  3L3U A;  3TAM A;  3RRG A;  1GOB A;  1TKT A;  3NF8 A;  4CEB A;  4KHQ A;  2VG7 A;  4KV8 A;  4E0D A;  4PY5 A;  1D8Y A;  3IRX A;  2P1J A;  5JS2 A;  4B3O A;  2HW3 A;  2YNG A;  4XIU A;  1TKX A;  1BI4 A;  4OKJ A;  3NAE A;  3ZCM A;  4DWI A;  5EU7 A;  1WN7 A;  1Q9X A;  2G8V A;  4F8R A;  4HUF A;  3KLH A;  5HP1 A;  3P83 D;  3HP9 A;  4DTR A;  5KRT A;  4FJJ A;  3L2Q A;  4FJN A;  3ZT0 A;  3PUF A;  3TR8 A;  4OKK A;  4CCH A;  1DLO A;  2OPQ A;  4DSL A;  2F8T A;  2QKK A;  3K5N A;  4KRE A;  2KZZ A;  2HHW A;  1Q8I A;  3C6U A;  4C8K A;  4F4K A;  4FZY A;  4DQS A;  3MEG A;  3T19 A;  3WNE A;  1S9G A;  1S9E A;  4ZTJ A;  1YVU A;  4KKO A;  4DFP A;  1C0M A;  4CES A;  3AVC A;  1QSL A;  3LP2 A;  1RDD A;  4CE9 A;  2Y1I A;  2GBZ A;  2RKI A;  3AVA A;  1U49 A;  2F96 A;  1TVR A;  4WE1 A;  4CJL A;  1J54 A;  4KTQ A;  2HHX A;  2A1S A;  1VSD A;  2IC3 A;  4CHQ A;  2PYL A;  3AVK A;  4AHV A;  4C8N A;  4FCY A;  4N47 A;  1VRU A;  3NF7 A;  4FLV A;  4Q5V A;  3HVR A;  3CG7 A;  3MXM A;  4RW6 A;  3IAY A;  3AVI A;  1T05 A;  3M8R A;  1NJZ A;  3LPT A;  1SL1 A;  4AHR A;  3O3H A;  4I2P A;  4KAZ A;  4CGD A;  4ELT A;  3MEC A;  3K58 A;  4B8C A;  3CFP A;  4F2S A;  5KGX A;  3OYB A;  1VSK A;  3DOK A;  2BAN A;  1X9S A;  3OYC A;  1LWC A;  4M45 A;  4E89 A;  3O3F A;  1XWL A;  1LW0 A;  2QK9 A;  4E7I A;  4CJU A;  3SUN A;  1Z26 A;  2OPS A;  4FK4 A;  2E4L A;  1WNS A;  4FVM A;  4CK1 A;  5HRP A;  3HK2 A;  4DQQ A;  4C8O A;  4ZHR A;  4CGG A;  3NHG A;  2KFN A;  3DLE A;  2ATQ A;  4CJE A;  3LWM A;  3HST B;  4M42 A;  2YHA A;  3MXI A;  4CIE A;  1S1V A;  3SNN A;  2OZS A;  3DRP A;  3NH2 A;  3UIQ A;  1HNV A;  1NK8 A;  2LSN A;  3HP6 A;  4W5Q A;  3ZSW A;  4DF4 A;  4E7K A;  3D0P A;  2Z1I A;  4DSF A;  3AO1 A;  4N41 A;  3HJF A;  5I42 A;  1NOY A;  4KFB A;  3U3Y A;  3AA5 X;  3VQD A;  3A2F A;  2P5G A;  2FBX A;  4J2B A;  3HL8 A;  4Y1D A;  4CEZ A;  4NCB A;  1O1W A;  3OYI A;  1RCH A;  1LAW A;  4Z4G A;  1C0T A;  4BE2 A;  1QHT A;  2I5J A;  3CM6 A;  3EZ5 A;  5J2P A;  3PV8 A;  4IG0 A;  1KVC A;  2D0A A;  1HPZ A;  3LP3 A;  4NYN A;  3DRR A;  4NYF A;  2P51 A;  4O44 A;  4B08 A;  4CJ3 A;  5KRS A;  3CM5 A;  1T03 A;  1KFS A;  3RWU A;  1I39 A;  3K5L A;  4KO0 A;  4H8K A;  4FJI A;  2DFF A;  2HHT A;  4CEO A;  3V9X A;  5HRS A;  4QOZ B;  1CZ9 A;  3LAN A;  3OVN A;  4M41 A;  3DYA A;  1RTJ A;  4B9L A;  5D3G A;  3P5J A;  3VQ8 A;  1ITG A;  1KTQ A;  3V9U A;  1RBU A;  4QCL A;  3AVN A;  3TAN A;  2G8H A;  4DQI A;  1FKO A;  3ASM A;  3ZSR A;  1T8E A;  1LW2 A;  1Y97 A;  1BIZ A;  2KW4 A;  3PO4 A;  3D45 A;  1NK4 A;  4Y1C A;  1RDB A;  3AA3 A;  4M3T A;  3F73 A;  4JS4 A;  4CIG A;  3QEX A;  1YTU A;  1WAF A;  2YHB A;  4EZ6 A;  5J2M A;  4G1Q A;  1NK7 A;  4HVJ A;  3DLH A;  2XHB A;  3VQC A;  4B9U A;  3CFO A;  3RRH A;  4QAG A;  3SI6 A;  3U6F A;  1RBR A;  2Q3S A;  5DMR A;  4FLZ A;  3T3F A;  1J5O A;  5K14 A;  3WNG A;  4CJQ A;  3TAF A;  2O4G A;  2B6A A;  1MU2 A;  1S1U A;  1ZYQ A;  3M8S A;  1BI4 B;  4CJK A;  1N5Y A;  1B9D A;  1D5A A;  4O5B A;  4DLE A;  2BGG A;  1RDA A;  1VSH A;  3K5O A;  3MED A;  4CJ4 A;  3QNN A;  4CGF A;  5C42 A;  1TK5 A;  4FJL A;  4FK0 A;  4CEE A;  2QXF A;  3TAQ A;  1U45 A;  1UA1 A;  4BWM A;  3HYF A;  4Z4C A;  1CLQ A;  3I0R A;  5J1E A;  4I9Q A;  3QEV A;  4IFY A;  2FC0 A;  1N6Q A;  1S6Q A;  1QSY A;  4DSI A;  3KD5 E;  1HMV A;  4MQ3 A;  4K8X A;  2IAJ A;  3OS2 A;  3G10 A;  3O4Q A;  1TK8 A;  4DTS A;  4F2R A;  2RPI A;  4Z0U A;  4BAC A;  1NK5 A;  1BGX T;  1FXX A;  3KK2 A;  2XY8 A;  4E1M A;  3CQ8 A;  3VQ9 A;  3DLK A;  5CZ2 A;  3OYH A;  2F8S A;  1TGO A;  4CFD A;  3VA3 A;  4E7L A;  1BQM A;  4O0J A;  4DG1 A;  4DFJ A;  3TAE A;  1L3U A;  3RR7 A;  3QLH A;  4FJG A;  3DI6 A;  4CHO A;  4FLU A;  2FBY A;  3MEE A;  3L3V A;  1JLE A;  1WSI A;  3QEP A;  1IKV A;  3KLE A;  2G8W A;  5C24 A;  4YFU A;  5J2N A;  1RTD A;  4W5O A;  1LAV A;  1VSM A;  1JLA A;  1J9A A;  2D5R A;  4DQR A;  4W5N A;  4Z4H A;  1EKE A;  4CFA A;  3DLG A;  3HT3 A;  1BHL A;  5FDL A;  4DTU A;  4J2E A;  3NBP A;  3TWH A;  4OPK A;  3PX0 A;  3NF6 A;  4DSK A;  3RR8 A;  1HJR A;  4HCC A;  4KHN A;  2DFE A;  4OLA A;  2RN2 A;  1RDC A;  4Z4I A;  1QS4 A;  4DSE A;  1XI1 A;  3NDK A;  4HTU A;  3ZSX A;  4FJ8 A;  4CJW A;  3KTQ A;  4N76 A;  1TK0 A;  4LY7 A;  4DQP A;  2KTQ A;  2E6M A;  3KLI A;  1JXB A;  4FM1 A;  3ZSV A;  2KQ2 A;  4IG3 A;  3MAQ A;  4KHY A;  1R0A A;  3ITH A;  1ZBU A;  3EY1 A;  2DTU A;  4AHC A;  3K57 A;  4E7J A;  4DS4 A;  1HRH A;  3SQ0 A;  1I3A A;  4FK2 A;  4M3X A;  4H4O A;  3AO5 A;  4KHS A;  1BCO A;  3KLG A;  3K59 A;  4CF9 A;  1DTT A;  3OYJ A;  1NJW A;  3BGR A;  3HM9 A;  4E7H A;  4RW8 A;  3LAM A;  1JKH A;  3OYK A;  3LDS A;  4BDZ A;  4KB1 A;  4KRF A;  2DY4 A;  1F21 A;  2PY5 A;  3SPY A;  2Z1G A;  1RT5 A;  1REV A;  3VQP A;  3NGI A;  1ZBL A;  4FXD A;  1WSG A;  3OYM A;  2HVI A;  3AO4 A;  5HRN A;  1CZB A;  1U04 A;  4AHT A;  4FLX A;  4HUE A;  1KRP A;  4HUG A;  1NKE A;  3LPU A;  3QIP A;  4KI4 A;  4FZZ A;  1SV5 A;  2YV0 X;  3QIO A;  3IG1 A;  4CF1 A;  4OKE A;  2IGI A;  3S3N A;  4CJV A;  3NH1 A;  3M8Q A;  4LH5 A;  3OJU A;  1KCF A;  1IH7 A;  3ZT4 A;  3DRS A;  1A5W A;  3SQ4 A;  1NJY A;  2RF2 A;  4M3Y A;  2AJQ A;  1T7P A;  2HNZ A;  1NOZ A;  4C8L A;  3AVJ A;  4JLH A;  3SCX A;  5I3U A;  4BE1 A;  1EXQ A;  3S3O A;  4K8Z A;  2YNH A;  4DTJ A;  4EP4 A;  4CJF A;  3SYZ A;  1X9M A;  1WAJ A;  4FJ5 A;  5FRN A;  3OYG A;  1S1T A;  5SWM A;  3L2R A;  3KIO A;  4J2A A;  4KHW A;  4CF8 A;  4ELU A;  1UA0 A;  4B8A B;  3S9H A;  4DTX A;  1TV6 A;  1QSS A;  1NKB A;  2IDO A;  4FW2 A;  4LD0 A;  3T1A A;  3WNH A;  3PX4 A;  5FRO A;  4F3O A;  4B9M A;  1U48 A;  5FRM A;  3QEW A;  1ZBH A;  2B4J A;  1VSL A;  1RBT A;  1W9H A;  4CED A;  3L8B A;  4M3W A;  2HNY A;  1SL0 A;  3TI0 A;  3TAG A;  1RTH A;  2YNF A;  3OYE A;  4FZX C;  1A5V A;  1NK9 A;  1S1W A;  3IS9 A;  1VSF A;  2G8F A;  4AHU A;  4CHY A;  4AH9 A;  4M3R A;  1WSE A;  4DSJ A;  3LZJ A;  3ZT2 A;  4CHP A;  3NCI A;  4CJP A;  2G8U A;  4H4M A;  4IKF A;  4CHZ A;  3O3G A;  3ISN C;  4I2Q A;  2WOM A;  3EYZ A;  1NK0 A;  4PUO A;  1UWB A;  2HHS A;  4JRP A;  4DTP A;  2G8K A;  4KTZ A;  4OPJ A;  3HPO A;  3VQQ A;  3PX6 A;  4ZTF A;  1SKW A;  4NCA A;  4AHS A;  1GOC A;  1RT3 A;  2E6L A;  3SUQ A;  3OYF A;  1JLF A;  1WSJ A;  1B92 A;  5KGW A;  3DOL A;  3JYT A;  3RMD A;  2Z1H A;  5HRO A;  1JL2 A;  3RMB A;  4EZ9 A;  2IS3 A;  4CGI A;  4AIL C;  1KVA A;  4L8R B;  1EET A;  1ZBF A;  2OYQ A;  1UOC A;  3DM2 A;  1LV5 A;  1DTQ A;  4FJ7 A;  2JLE A;  3CYM A;  3I8D A;  3V9S A;  1B9F A;  3VA0 A;  3V9W A;  3SZ2 A;  1KVB A;  3RMA A;  3VN5 A;  1VSJ A;  1X9W A;  4C8M A;  4E3S A;  4KTW A;  4CF2 A;  5DK5 A;  1SKS A;  2HVH A;  4DMN A;  3TAB A;  4MFB A;  3KK1 A;  1L5U A;  1ZBI A;  3ULD A;  3WNF A;  3VQ7 A;  4DTO A;  4DU3 A;  3SJJ A;  4PQU A;  1JLG A;  1TAU A;  1C0U A;  2KFZ A;  3F9K A;  5CZ1 A;  2QKB A;  2W42 A;  4W5R A;  1JLB A;  3AA2 A;  4RW4 A;  4CJS A;  3SUO A;  3AO3 A;  1Q9Y A;  4PWD A;  3LP0 A;  1K6Y A;  4FLY A;  3LWL A;  2XY7 A;  1C1B A;  2ZD1 A;  2XY6 A;  1LWE A;  3V4I A;  4EP5 A;  1EX4 A;  3AA4 A;  3KKS A;  3KKR A;  4LSN A;  3VQ5 A;  4R5P A;  2OZM A;  2A1R A;  2Z1J A;  4CF0 A;  2VWJ A;  3KD1 E;  3THV A;  2VG5 A;  1FKP A;  1HQU A;  1VK0 A;  1VSE A;  4I9L A;  4TSX A;  3OS1 A;  4DFK A;  3PY8 A;  1W0H A;  1RTI A;  2X6N A;  3AVF A;  3LAK A;  4CEC A;  3LZI A;  4CJ5 A;  1IG9 A;  3K2P A;  3C94 A;  1RT2 A;  3ALY A;  4FLT A;  4FJM A;  1C1A A;  2YKM A;  2D0C A;  2X6S A;  4IBN A;  4ICL A;  3ZSO A;  4PA1 A;  4DTM A;  3QER A;  1U4B A;  1BL3 A;  3OYA A;  1RBV A;  4OLB A;  3RMC A;  2G8I A;  1C1C A;  1C6V A;  2BE2 A;  3JSM A;  5HRR A;  4YNQ A;  3PO5 A;  2IOC A;  3VQ6 A;  4B9T A;  1TKZ A;  1CXQ A;  3SUP A;  4BE0 A;  2FBV A;  5KTQ A;  3B6P A;  4KHU A;  3C95 A;  4OGC A;  3KK3 A;  1NJX A;  3M8P A;  2YKN A;  3U3G A;  3K5M A;  3RTV A;  3L2V A;  3SQ2 A;  1HNI A;  3SPZ A;  3OYN A;  4FYD A;  1NK6 A;  1WSH A;  2XRI A;  4RW9 A;  3E01 A;  2X74 A;  3QIN A;  3OYL A;  1Z25 A;  4CEA A;  3KJV A;  4CEQ A;  4FJH A;  1CXU A;  4IFV A;  3HPH A;  3G0Z A;  4DFM A;  3QEI A;  1KLM A;  4NCG A;  1VSI A;  4OVL A;  1IKW A;  4O0I A;  2HHU A;  3AVH A;  4J2D A;  2HMI A;  4DF8 A;  3C6T A;  2EX3 A;  4FJK A;  1BIS A;  2JGU A;  4GW6 A;  5C25 A;  2HB5 A;  4KI6 A;  4CGJ A;  3V1Q A;  3VQE A;  1JXE A;  5CYM A;  4CHN A;  2VG6 A;  4FW1 A;  1ASV A;  4BDY A;  1RNH A;  1L3S A;  1WLJ A;  4ID1 A;  4N56 A;  3L2U A;  4DLG A;  1SUQ A;  4HCB A;  3DLR A;  3B6O A;  4OJR A;  1HYZ A;  2WON A;  3AO2 A;  3OYD A;  4DTN A;  2HHQ A;  1BCM A;  4FM0 A;  3H08 A;  4B9V A;  1FK9 A;  3HXM A;  2OPP A;  3OY9 A;  1L3T A;  4Z4E A;  3ZT1 A;  5JS1 A;  1S6P A;  4LSL A;  4OGE A;  1TL3 A;  1WSF A;  5CY4 A;  1RBS A;  3VQB A;  3HPG A;  3HVT A;  1HQE A;  2GUI A;  2HHV A;  3LAL A;  5HBM A;  3OS0 A;  5KI6 A;  3MXJ A;  2Y1J A;  1TL1 A;  3DMJ A;  4KPY A;  1QE1 A;  2GV9 A;  3NGZ A;  3P1G A;  3V1R A;  3KLF A;  3O4N A;  4CER A;  2B5J A;  3L2W A;  5T7B A;  4ID5 A;  2XO7 A;  1IKX A;  3SV3 A;  4B9N A;  5E41 A;  4N5S A;  4CK3 A;  2PZS A;  1GOA A;  4F3T A;  1KFD A;  4CFC A;  1X1P A;  1RT4 A;  1ASU A;  1SL2 A;  4Q0B A;  3AVL A;  4RW7 A;  4DS5 A;  2OA8 A;  3BDP A;  3TAP A;  1D9F A;  3NFA A;  4CGH A;  1UAX A;  2KZM A;  1RT1 A;  4HHT A;  4DU4 A;  4W5T A;  2HND A;  1NKC A;  1A5X A;  4CIF A;  3TAR A;  1XHX A;  1RIL A;  2ITG A;  4GVM A;  3ZSZ A;  4CEF A;  4KB0 A;  3S3M A;  4BDP A;  4JRQ A;  1RT6 A;  3OJS A;  3DLB A;  2O4I A;  1XHZ A;  2ZE2 A;  1QQC A;  3SQ1 A;  1KSP A;  4DU1 A;  3V9Z A;  1BIU A;  1YTA A;  3I0S A;  3QET A;  4JS5 A;  4CK2 A;  1U47 A;  3NE6 A;  1D9D A;  3NGY A;  4IDK A;  2VWK A;  4O4G A;  4E1N A;  5SZT A;  1ASW A;  5CYQ A;  3ZSY A;  3V81 A;  1L3V A;  4BWJ A;  4ELV A;  2X78 A;  3LP1 A;  4Z4F A;  2EHG A;  2BDP A;  1J53 A;  1RT7 A;  5J2Q A;  4UQG A;  4CFB A;  2FBT A;  4B9S A;  3SV4 A;  4LH4 A;  3NH0 A;  3ZSQ A;  1S1X A;  1YT3 A;  4FLW A;  4FM2 A;  2OPR A;  1LWF A;  1TAQ A;  3V6D A;  4E19 A;  2R7Y A;  4CJR A;  2ETJ A;  4M3U A;  3AVG A;  1VRT A;  2XY5 A;  2YNI A;  2D0B A;  4RG8 A;  1S5J A;  4O55 A;  3ZT3 A;  3VQA A;  4M3Z A;  3AV9 A;  1KLN A;  1IO2 A;  1XC9 A;  3AVM A;  4CJT A;  5HLF A;  4I7F A;  3QNO A;  2P5O A;  4FJ9 A;  3QO9 A;  1BQN A;  3AVB A;  1G15 A;  4GMJ B;  4FJX A;  2ZQB A;  3V1O A;  3NF9 A;  1EP4 A;  3FFI A;  1QTM A;  1HYS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...