1RBRA

Structural study of mutants of escherichia coli ribonuclease hi with enhanced thermostability
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
155
structure length
155
Chain Sequence
MLKQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAAIVALEALKEPCEVILSTDSQYVRQGITQWIHNWKKRGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERCDELARAAAMNPTLEDTGYQVEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural study of mutants of Escherichia coli ribonuclease HI with enhanced thermostability.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase(endoribonuclease)
molecule keywords RIBONUCLEASE H
total genus 50
structure length 155
sequence length 155
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 1993-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1rbrA00
4CIFA 3O3GA 1LV5A 4FK2A 4CJ5A 3QNOA 4FJGA 4CJFA 1IKXA 4E7LA 5KRTA 1NJXA 2YNIA 4FXDA 4DS4A 4CK2A 3ZSYA 1VSFA 2HVIA 4H4OA 3AVMA 3JYTA 3NF6A 3SZ2A 5C25A 4F3OA 4FLTA 3C6TA 3AVNA 4Y1DA 1RT3A 2B5JA 3JSMA 1ZBLA 1NKCA 1B92A 1NK6A 4I9LA 1BI4B 2YHAA 2EHGA 3DYAA 4CJPA 3HVRA 4JRQA 4IDKA 3NE6A 4DS5A 1T03A 1FXXA 3UIQA 4DTUA 1D8YA 2DTUA 3V9UA 3OYKA 1NOYA 2OA8A 1U4BA 2B4JA 3O3HA 3SI6A 5C42A 1JLEA 4M3TA 3L2RA 1VSEA 1ASVA 1QQCA 3LALA 4DTNA 4OGEA 2XO7A 5KGWA 2VG7A 4CK1A 1HNVA 5I42A 3HPHA 1NK8A 2IS3A 3KD5E 1VSIA 4FLYA 2ZE2A 4O0JA 3L2UA 2PY5A 3D0PA 4F4KA 4DU3A 4B08A 4CEAA 1JL1A 3P1GA 3VQ8A 3U6FA 5HLFA 4F2RA 2HHXA 3AO2A 4CGDA 4DMNA 1BCOA 4J2DA 3SUQA 3RRGA 4FJ7A 2P5OA 2JGUA 3EYZA 4CEDA 4EZ9A 4KHSA 1XC9A 1BGXT 3O4NA 4MFBA 3TAEA 1L3SA 5DMRA 1C1BA 4E0DA 1RT6A 4M3WA 3AA4A 4NCGA 4F3TA 4KHQA 2P5GA 2X78A 1X9SA 2IAJA 3VQAA 1J54A 4HUFA 1BISA 1Y97A 3EZ5A 2HHUA 3SUNA 2G8KA 4OPJA 1SV5A 2D0AA 3HPGA 4DQQA 1TK8A 1NK5A 5FDLA 1IKYA 1LWFA 1YT3A 4CJWA 4Z4HA 2PYLA 2OPPA 1SL2A 1KFSA 5J2QA 4FLVA 3LANA 2E6MA 4B8CA 3SPYA 4FJJA 4CEZA 4DU1A 1WSFA 1KRPA 2LSNA 4AHTA 3ZT2A 4HCCA 1S6PA 4W5OA 3OYHA 3WNEA 2ITGA 4M41A 3LPUA 2DY4A 3VQPA 4PWDA 1VK0A 4LD0A 4FK0A 3U3GA 4CJQA 3V9WA 4NCAA 3B6PA 3B6OA 4FLXA 3PO4A 2Y1IA 4H4MA 4EZ6A 1VSLA 1T7PA 1Z25A 1KVCA 1F21A 4KV8A 4OVLA 4KI6A 3DOKA 4E1NA 4BWMA 1TL1A 3T1AA 4HCBA 4I2PA 1D9FA 1CZBA 4QAGA 3HPOA 3P5JA 1JLQA 2YNFA 3SV4A 3MXMA 1UA0A 1T8EA 1NJWA 3S3MA 2D5RA 3KLIA 4FZYA 5FRNA 2VG6A 4FM0A 4OGCA 1KFDA 1HNIA 1ASWA 2KW4A 4CESA 4KHUA 4M3YA 1LW0A 3NHGA 1KCFA 4DSIA 4DTSA 1U49A 3NGYA 1QE1A 3OVNA 2BE2A 4IBNA 3THVA 1TAQA 3ZSOA 2G8HA 4FJNA 5HRRA 4KHNA 3OYBA 3I8DA 2QK9A 3DLEA 3LDSA 4DSFA 4AHVA 1WLJA 3SUPA 4FCYA 4Z4FA 3HXMA 1RTHA 4FZZA 3NH0A 4FJ5A 4ID1A 1TK0A 3CYMA 3AO1A 4JS4A 3RWUA 3HK2A 2QXFA 3KLHA 3VQ5A 3NCIA 3KLFA 3DLHA 2F8SA 3O3FA 5CYQA 4KPYA 1VSMA 4C8NA 2YNHA 4Q5VA 4BE2A 3K57A 4E7JA 3RMDA 4KHWA 3OJUA 1EETA 4CFCA 1BQNA 1Q9XA 3CM5A 3KLGA 4LH4A 3KIOA 4DSKA 1S1WA 3HL8A 1BIZA 4CEFA 4E1MA 3DLKA 4NYNA 4W5RA 3L2QA 1D5AA 4CGGA 3HM9A 4B9MA 4TSXA 3BDPA 2NUBA 1ZBHA 2BGGA 1GOBA 4DSJA 1JLAA 1RT4A 4N56A 3IRXA 1RILA 4M45A 3VQCA 3CG7A 1JLFA 2Z1JA 3ZCMA 3V9SA 3IG1A 5T7BA 3VA3A 3SJJA 3OYAA 3ZT4A 4O5BA 2OYQA 4B9LA 3O4QA 1S9GA 5KTQA 1RTIA 2DFFA 2QKBA 2FBTA 3F73A 3HYFA 4CJVA 4CHYA 4EP4A 3LAMA 1TKTA 4Z4CA 4DTJA 2G8WA 1RDCA 4KRFA 2HW3A 3PX0A 1TGOA 1T05A 5HRSA 3L2WA 4OKEA 3QNNA 3OYEA 4I9QA 4ZTJA 1ITGA 2XY8A 4BDPA 3SNNA 1S5JA 1IG9A 1WSJA 4H8KA 3ITHA 2VWJA 4L8RB 2B6AA 1NKEA 4B8AB 3NAEA 3HO1A 2PZSA 2IOCA 1KTQA 4BDYA 1SKRA 1L3VA 3VN5A 3M8RA 4DTRA 2GV9A 1WAJA 4DWIA 2P51A 4YFUA 1QS4A 2ETJA 4FW2A 3KKSA 4YNQA 3OYDA 3OJSA 1HQUA 5FRMA 1EP4A 2RN2A 1TKZA 1FK9A 2VG5A 2G8UA 4ELTA 3KK3A 2R7YA 4DG1A 4Z4GA 3V1OA 1VRTA 4CJLA 3MECA 1RT5A 3KK2A 1SL0A 1I39A 4BE0A 4CGJA 3TARA 3G10A 3TAFA 4I2QA 3VQEA 2HMIA 1CXQA 3VQ4A 1IO2A 1VRUA 3PV8A 4CJEA 3LZIA 4J2EA 1A5VA 1Z26A 4FVMA 5E41A 3AVGA 4DQSA 1LAWA 4C8OA 4AHUA 1RCHA 1JXBA 2O4IA 3DLRA 4OKJA 4M3RA 1SL1A 4FK4A 1B9FA 1QSLA 2D0CA 4HUEA 1X9MA 1Q9YA 4FJXA 3QETA 3WNFA 3VQBA 3HJFA 5HBMA 4OLBA 2P1JA 3OYCA 3V81A 3DRRA 3NDKA 3TANA 3FFIA 3WNGA 1C1AA 5SWMA 1W9HA 1S9EA 4FYDA 1CXUA 2DFHA 2BANA 2E6LA 1RDAA 4KTZA 3L2VA 1JLGA 1KVAA 3AO4A 3LPTA 2F8TA 3I0SA 1G15A 1VSHA 4OKKA 1C1CA 4QCLA 2RKIA 1U47A 3PX4A 1RBUA 5CZ1A 1A5XA 1X1PA 1IKWA 4OJRA 3OYJA 2G8VA 1QSSA 3SQ0A 4KO0A 3NGIA 1ZBIA 1LWEA 1C0TA 3KJVA 2F96A 4LSLA 1O1WA 4KREA 1NK4A 3AO3A 1KLNA 3TWHA 2G8IA 2XRIA 4MQ3A 1NJZA 4DFKA 1NK9A 1JLCA 3HSTB 1TKDA 4GMJB 1FKOA 3RRHA 1Q8IA 1ZYQA 3RMAA 3K58A 3AVLA 4IG3A 3H08A 3V6DA 1NK0A 4Z4EA 4N5SA 3MXIA 2KQ2A 4DFJA 3ULDA 2W42A 1X9WA 4AILC 3TAMA 2YV0X 4CK3A 1JKHA 4HUGA 3QEXA 3T19A 1HJRA 5KGXA 4R5PA 3OYGA 3KLEA 1NJYA 4M3XA 1QSYA 3RMCA 2HHVA 3CM6A 3VQ9A 4CJTA 4N47A 1FKPA 4DTXA 3MXJA 3DRPA 4AHRA 4KHYA 5FROA 3DRSA 3HP6A 3OS2A 1UA1A 3I0RA 3WNHA 1S1UA 4CERA 4DLGA 3CFRA 3AA2A 5J2NA 4F2SA 3SQ4A 2HB5A 4O4GA 4Y1CA 3TR8A 4CEEA 1TKXA 4CEQA 3QLHA 4AHSA 1BQMA 1REVA 3AO5A 4CF1A 5KRSA 2HHTA 3E01A 2Z1IA 3DLBA 3VQ7A 3S3NA 4KB1A 3PUFA 4ICLA 3TAGA 3VQDA 2YKMA 2WOMA 3NH2A 3V1QA 3QEPA 1J5OA 1RBTA 3LP1A 2IDOA 4CGHA 1HYSA 2HVHA 3T3FA 1JXEA 1GOAA 3IS9A 4LH5A 3OY9A 3SV3A 4FJMA 4DQRA 3MAQA 3VQ6A 4Q0BA 4BWJA 3ZT0A 5SZTA 1L3TA 4CECA 3AVFA 1HMVA 4FJKA 1RBRA 2RPIA 1JLBA 3AVIA 1WSHA 5K14A 4GVMA 2EX3A 1HRHA 2D0BA 2E4LA 4DTOA 1R0AA 3QINA 3VA0A 5EU7A 2YKNA 5J2MA 3G0ZA 1XHZA 5D3GA 1WSIA 1L3UA 1HYVA 1ASUA 1BIUA 1KVBA 3RTVA 3LP0A 4Z4IA 4B9SA 4CF2A 3D45A 3QERA 4DTMA 3RMBA 1U45A 1VSDA 3DI6A 3NBPA 4HVJA 1SKSA 4CJKA 3DLGA 4F8RA 3CQ8A 4FJHA 3BGRA 5CZ2A 3ASMA 4FW1A 4JRPA 1A5WA 2HHQA 4W5QA 3HT3A 3S9HA 4PY5A 5CYMA 1VSKA 1WN7A 4KKOA 1UOCA 3K5MA 4IFVA 4GW6A 4J2BA 1K6YA 3KKRA 4FJIA 4BDZA 3MEGA 2I5JA 1CLQA 2OZMA 4E7HA 4OPKA 4QOZB 4RG8A 4DU4A 1WSEA 4DF4A 2FBXA 1RT7A 1UWBA 3QEWA 5HP1A 3LP3A 1TAUA 3F9KA 1LAVA 1B9DA 3TAQA 1RBSA 2FBYA 3NGZA 1C6VA 4AHCA 2VWKA 1QHTA 1YVUA 2YNGA 2OPSA 4CF8A 4ZHRA 5J1EA 2Y1JA 3TI0A 1IKVA 3PO5A 3QIOA 4B9UA 2G8FA 2OPRA 3A2FA 4WE1A 4BACA 4DF8A 1WAFA 4E7IA 1RTJA 2XY7A 4KTQA 2HNYA 1C0MA 3K5OA 1D9DA 1UAXA 4LSNA 4UQGA 3OS0A 4CFAA 4C8MA 1VSJA 3CFOA 3U3YA 4O44A 2A1SA 3PY8A 4RW4A 3V1RA 2KFNA 1HPZA 2ATQA 1SKWA 4KTWA 5HRNA 5J2PA 4DSLA 4M3ZA 3ISNC 1RT1A 1RBVA 1I3AA 4K8XA 3OS1A 3OYLA 3OYMA 4FJ9A 1BL3A 2IC3A 3K2PA 4RW9A 4IKFA 3AVKA 4C8LA 3NF8A 1TL3A 1WSGA 1C0UA 4KFBA 3K5NA 3LWMA 2OPQA 3ZT1A 4FJ8A 1TVRA 4AH9A 4DTPA 4JS5A 1U48A 4NCBA 4CJ3A 3TABA 2BDPA 1IH7A 4B3OA 1YTUA 4HHTA 1BCMA 1KSPA 3TAPA 4CFBA 3KD1E 3ZSVA 2HNDA 3OYIA 3QEIA 3ZSZA 3ALYA 3L3UA 1RTDA 4B9VA 4CGFA 4RW7A 3SQ1A 1YTAA 4W5TA 4CEBA 1NKBA 3ZSWA 4PQUA 1HYZA 3QO9A 3KK1A 1N6QA 3RR7A 1MU2A 2GUIA 4NYFA 3PX6A 4KAZA 2PYJA 3AA3A 3MEEA 4B9TA 4CF9A 4E89A 4FLUA 4M3UA 3NFAA 4C8KA 1J9AA 4O0IA 5I3UA 4IG0A 2Z1HA 4FM1A 4OLAA 1DTTA 3DMJA 5CY4A 4IFYA 3NF9A 4CJ4A 4CIGA 3EY1A 5JS2A 3AV9A 4CEOA 4CGIA 4I7FA 3RR8A 4G1QA 2KZZA 3M8QA 2JLEA 4DQIA 2ZQBA 3AVHA 3QESA 4CHNA 2AJQA 4DLEA 4KB0A 3AVBA 3QIPA 2X74A 4N41A 2FC0A 4ELUA 3C6UA 3AVJA 3VQQA 3V4IA 1U04A 4FZXC 4CE9A 3P83D 1S1VA 4XIUA 3V9ZA 4DFPA 4RW6A 2O4GA 2HHWA 1RNHA 2KTQA 2RF2A 4KI4A 3LWLA 2IGIA 3NH1A 2X6NA 1CZ9A 1KLMA 2HNZA 4CF0A 3K5LA 3SUOA 4CJUA 1NOZA 1ZBUA 5HRPA 2XHBA 3SYZA 3SQ2A 1TK5A 4CHOA 3LP2A 3C94A 3HP9A 1JL2A 3OYFA 2HHSA 1W0HA 5HROA 1L5UA 1SUQA 3M8PA 4PUOA 3ZSXA 3CFPA 2QKKA 4ELVA 3C95A 4CCHA 2OZSA 2KZMA 4CJRA 4W5NA 4Z0UA 2DFEA 4CJSA 3L3VA 3SCXA 1XHXA 3LZJA 3QEVA 4E19A 4E3SA 3S3OA 4K8ZA 1ZBFA 4E7KA 1EXQA 3V9XA 2Q3SA 5KI6A 1HQEA 1WNSA 4CHZA 2ZD1A 1EKEA 3AVAA 3KTQA 3ZSQA 3MEDA 1GOCA 3ZT3A 4DSEA 4FJLA 1N5YA 1RDDA 1NK7A 4BE1A 3L8BA 5JS1A 4DQPA 3SPZA 4O55A 5C24A 4JLHA 4CIEA 4CFDA 1DLOA 5DK5A 4HTUA 4B9NA 1DTQA 4EP5A 3K59A 2XY5A 1XI1A 4N76A 1J53A 2GBZA 2A1RA 1LW2A 3AVCA 1S1XA 4FM2A 4J2AA 3DM2A 1RT2A 2YHBA 3HVTA 4FLZA 1BI4A 3OYNA 3AA5X 4FLWA 2X6SA 3IAYA 1EX4A 4M42A 2KFZA 4PA1A 4ID5A 4CHPA 1XWLA 3LAKA 1TV6A 1RDBA 1LWCA 2FBVA 2Z1GA 4RW8A 4ZTFA 3NF7A 1BHLA 4LY7A 3DOLA 4DFMA 1S1TA 1S6QA 2XY6A 3ZSRA 3M8SA 1QTMA 2WONA 4CHQA
chains in the Genus database with same CATH superfamily
2EWSA 4QS7A 3O3GA 1OVQA 4FK2A 4RWTA 4CZEA 4FJGA 1IKXA 3IDHA 5FPDA 4E7LA 3FZMA 2YNIA 1DKGD 5I9EB 4YDUC 2W6LA 4JKGA 1ZBLA 3AVNA 3QFUA 2EHGA 1ZC6A 4DTUA 1D8YA 3V9UA 3OYKA 3O08A 3KZBA 1U4BA 1NOYA 4OX9K 3TSPA 4OGEA 4CK1A 4BC4A 5I42A 2UXBK 1S22A 3VETA 4B08A 4CEAA 3P1GA 5EVZA 2P5OA 3WEEA 3OBYA 5JLHA 1ZXOA 3IUCA 5DMRA 1EO1A 4E0DA 3AA4A 3C7NA 3M5RA 4KHQA 5M1PA 1U2VB 4BQZA 1NGFA 3CCEN 2QWMA 1BWFO 4OPJA 1SV5A 4DQQA 1ATSA 1SL2A 1KFSA 3LANA 4B8CA 3PIOL 4DU1A 1KRPA 1WSFA 2LSNA 3A5MC 1OH8A 2ITGA 3LPUA 2DY4A 3U3GA 1HNXK 3AY9A 4CJQA 3B6PA 2FF6A 1T7PA 4OVLA 3DOKA 4IOXA 1YITN 3K0SA 2YNFA 4YOVA 3CPWM 2E1YA 3SLCA 2VG6A 4FM0A 3J7AP 1HNIA 4CESA 4M7XA 3CI5A 1GLCG 1KCFA 4JK8A 4H5VA 1TYQB 3OVNA 4JKHA 1C0FA 3VEWA 3DLEA 4FWLA 4WCEL 1VQLN 4LF6K 4BR0A 4ID1A 3RWUA 3KLHA 2O8DB 3EN9A 3NCIA 3KLFA 4C8NA 3K57A 4IEIA 4PKGA 5E26A 5AJ3K 3KVGA 1Q18A 3HL8A 4Z94A 1DEJA 2NZTA 4NYNA 2E2PA 5AQHA 1D5AA 3HM9A 4B9MA 4G9ZA 1OVYA 1JLAA 2V52B 4BVPA 4M45A 1KQSM 3H1QA 3CG7A 1JLFA 2Z1JA 3V9SA 3IG1A 3O8MA 3OYAA 3ZT4A 3VTIA 2DFFA 2QKBA 2FBTA 4A5AA 3LAMA 5EX5A 3O9QA 4JNEA 4H0OA 5HRSA 3CCSN 1YJWN 4I9QA 4X62K 1J6ZA 1XQSC 4H8KA 3ITHA 3TSUA 4C1NK 1NKEA 4Y0WA 4IO9L 1SKRA 4YORA 3H3NO 1O13A 3THXB 4DTRA 4OO1J 1WAJA 2IVPA 2ETJA 3VF4A 4YNQA 3OYDA 5JLFA 1FK9A 4Z4GA 3CF5L 3EE9A 3KK2A 3TARA 3G10A 3TAFA 4BRKA 4CJEA 4J2EA 4DQSA 3L6QA 4C8OA 1RCHA 3T69A 4OKJA 2BTFA 1B9FA 2V7ZA 5HBMA 5BRFA 4OLBA 1NG9A 2BH1A 3VESA 1C1AA 2QTDA 5SWMA 1W9HA 1S9EA 3L2VA 1RDAA 4K41A 1X3NA 1KVAA 2F8TA 4AM6A 4ISEA 1U47A 3AAQA 3O5BA 3VF6A 3F5TA 3J8AA 4OJRA 4FPBA 1K9MO 1X3MA 1NWKA 3VENA 3TWHA 2OANA 5KPTA 2XRIA 4MQ3A 4FWNA 3K58A 4Z4EA 1NK0A 3H08A 4N5SA 2P9IA 4MO4A 2O8BB 5FLXO 4LF9K 3A5LC 2O8EB 4F8RA 3EKSA 4R5PA 3OYGA 5IWAK 4CW7B 2UXCK 3CM6A 4CJTA 4KHYA 3DRPA 4HTLA 3BP8A 5FROA 3A5NC 3OS2A 2YI1A 3H3OB 3IMXA 3TR8A 2GELA 5EY4A 1JCEA 4BRQA 3OTOK 5KRSA 1RGIA 3CJ7A 4FO0A 2YCHA 3E01A 4B1XB 4KB1A 3PUFA 2P9PB 3VQDA 2VQFK 5FPMA 1HYSA 4FJMA 3IS9A 3S41A 3MAQA 4DUYK 5SZTA 1L3TA 4FJKA 1TUYA 1JLBA 5HL7L 5TKWA 2QM1A 2NLXA 4GVMA 4DTOA 1R0AA 5EU7A 1XHZA 1HYVA 3UKUA 1BIUA 4BR2A 4Z4IA 4CF2A 1S3XA 3QERA 1U45A 2HOEA 1VSDA 3DI6A 1NGIA 4HVJA 5CZ2A 2ZJRL 3OBWA 3HT3A 5CYMA 4CZLA 3K5MA 1P90A 4FJIA 4BDZA 3MEGA 3ULEB 4OPKA 4RG8A 1WSEA 4B1VA 1RT7A 3D2EA 3F9MA 3O9TA 3H45C 1LAVA 4DQ8A 1B9DA 1RBSA 1C6VA 3Q7BA 3TI0A 4GV6A 2G8FA 2QA4N 5TKYA 4BRDA 1IG8A 4NXNK 4CZMA 4J8FA 2ATQA 2A6AA 3GG4A 3O1BA 4K8XA 5AQJA 3MMVA 1E4GT 2DPNA 4C8LA 3NF8A 3FGUA 1WSGA 3CCQN 2QWQA 4B3SK 4M7YA 4DTPA 2BDPA 5C2FA 4HHTA 3TAPA 4NB4A 3ALYA 3ENBA 4CGFA 4RW7A 2F7TA 4X65K 3SQ1A 5ELZA 4JKFA 4PQUA 1VQON 2GTDA 5AQVA 4NYFA 3LM9A 4IDHA 4H0TB 5I3UA 5AQKA 4H5RA 4IG0A 1QVGM 2P9SB 2E20A 2IVNA 5JS2A 4CGIA 3HZ6A 3M8QA 1GLDG 3QESA 4CHNA 1BUPA 2O8FA 4KB0A 3QIPA 4IZ9A 2FC0A 2Q2RA 3VQQA 1IBKK 4X64K 3P83D 1S1VA 2O4GA 1XNQK 2KTQA 2RF2A 3OW2M 1KLMA 2HNZA 3K5LA 4CJUA 2XHBA 4JN4A 3HP9A 1S72N 5GAEP 1L5UA 4PUOA 4BRPA 1SUQA 3M8PA 4BR4A 2WTUA 3CFPA 2QKKA 3QFPA 1NGEA 4CJSA 1YJ9N 2E2QA 4E3SA 2D4WA 4K8ZA 1ZBFA 4U7BA 4E7KA 3CCLN 3V9XA 2Q3SA 3NVKA 1EKEA 3MEDA 2HHHK 1RDDA 1RDWX 2NRVA 4O55A 1YJNN 2QWLA 4CFDA 4BRNA 1IJJA 5E84A 1XI1A 3MX2A 2GBZA 2A1RA 3DM2A 4FLZA 3IAYA 2HF3A 1XMQK 4IJNA 4PA1A 2OTLN 1RDBA 1M1KO 3KK7A 2P9IB 2PFUA 4JKAA 3MWPA 4ZTFA 3NF7A 4DV2K 2E1ZA 4EFHA 1S1TA 1S6QA 4LH4A 4CHQA 2UYTA 4CIFA 3QNOA 4ILGB 5KRTA 1NJXA 3VEYA 5LMUK 4FXDA 4GVEA 4CK2A 1BG3A 1VSFA 3SZ2A 5C25A 4F3OA 4FLTA 3C6TA 1N6QA 1RT3A 3JSMA 1NKCA 1B92A 4I9LA 1BI4B 2YHAA 4DS5A 1T03A 4IDKA 3AAPA 3NE6A 3UIQA 1VQ7N 1WB9A 4NLCA 3VF2A 1HKGA 4GV3A 5C42A 1JLEA 3O6WA 1MDUB 3L2RA 1VSEA 2XO7A 1JCFA 5KGWA 1HNVA 3CCRN 3K9KA 3KD5E 1VSIA 3C6AA 2ZE2A 4F4KA 3D0PA 4NO7A 3U6FA 3ULEA 3VQ8A 3D2FB 3AO2A 1BCOA 4H5TA 4FL9A 2Q36A 4CBXA 4CEDA 4EZ9A 1BGXT 5M1NA 1L3SA 1RT6A 4M3WA 4NCGA 4F3TA 4JKDA 1X9SA 1BISA 4DKWA 3EZ5A 3CQYA 2HHUA 3SUNA 1EWRA 3HPGA 3QDKA 1IKYA 1YT3A 3UKUB 2OPPA 4FWMA 2QXLA 5J2QA 3VGKA 4FLVA 2E88A 2E6MA 3GBTA 4PKIA 4AHTA 4HCCA 3OYHA 5C2DA 1Z6RA 1VK0A 2F4VK 3V9WA 3PO4A 3B6OA 2P9LA 5AQRA 4KH5A 4EZ6A 1VSLA 1Z25A 1KVCA 1F21A 2P9PA 4JEPA 4KV8A 1TL1A 3HBTA 4QAGA 3SAFA 3S3MA 1G99A 3UB5A 5FRNA 5LJWA 1HKCA 5BPNA 3FFKB 5LL6Z 2KW4A 4M3YA 4BC5A 5AQSA 3NGYA 2Q31A 1TAQA 3MDQA 3CJ1A 5HRRA 4WFAL 4KHNA 1N36K 4DR4K 3DXMB 1WBDA 3LDSA 2HBJA 1BDGA 3SUPA 3O1WA 3QB0A 4BY9C 4FJ5A 4JS4A 3DLHA 3GOIA 4JKEA 5CYQA 4Q5VA 1RDUA 3OJUA 4CFCA 3D2EB 1BQNA 3CM5A 3KIOA 4WFNL 1S1WA 1QQOA 4E1MA 4FWPA 4JAXA 2D1KA 4W5RA 4TSXA 3BDPA 1ZBHA 1DGKN 4DSJA 5CR4A 3IRXA 1RILA 5AZIA 4BRMA 4AQYK 3VA3A 1QVFM 4O5BA 3P4IA 3O4QA 5KTQA 2RHKA 3RSEB 3I56N 4CHYA 3SBGA 4EP4A 4DTJA 3PX0A 3L2WA 3QNNA 3U9ZA 4ZTJA 1ITGA 4BDPA 3SNNA 1IG9A 2A3ZA 4L8RB 2UUBK 1EWQA 4LF7K 5AQMA 4DV1K 3VN5A 2KLAA 4YFUA 5ADXH 4A5BA 3OJSA 1QQMA 3AGKA 3O80A 4EHUA 4ELTA 5FRMA 2KHOA 4CBWA 4DG1A 2W41A 1VRTA 1RT5A 1SL0A 1VQMN 4CGJA 1ATRA 3VQ4A 1IO2A 3FE1A 4BR7A 4H0PA 1A5VA 4EIAA 1LAWA 2O4IA 1JXBA 3VEXA 3DLRA 2YJFA 3CJAA 4FK4A 1QSLA 2CGJA 3WNFA 3VQBA 5EOYA 4BREA 4YOYA 3TANA 3DJCA 4FYDA 4BRCA 4KTZA 4BRLA 1JLGA 3HOTA 3AO4A 2FSKA 4QCLA 2RKIA 4A57A 5AFUA 3PX4A 1RBUA 3CC7N 2CH5A 1IKWA 3PSFA 3SQ0A 1QSSA 4LSLA 1O1WA 4KREA 1NK4A 1KLNA 3FZKA 5BRHA 1KAZA 1JLCA 1NK9A 3HSTB 4GMJB 3RRHA 4E1JA 3AVLA 3V6DA 3SAHA 4IOCL 1XMOK 2KQ2A 1DT9A 3ULDA 2E2OA 3THWB 3D7EO 3QMLA 4DV5K 3TAMA 2YV0X 4CK3A 4U67L 5KGXA 3NMUA 3CHWA 4AHRA 3DRSA 3HP6A 5M1FA 3MN9A 5KPRA 3CFRA 4DR5K 1W97L 4F2SA 2HBKA 1IBLK 4A59A 4O4GA 4Y1CA 2GUPA 4MLEA 1REVA 4QS9A 4LF8K 3E1YA 1C0GA 4ICLA 4WQ4C 5AQXA 3THXA 3V1QA 5AQZA 1RBTA 3LP1A 1BA0A 2AA4A 5LY3A 4LF4K 3J7YP 4IWVA 3CJ9A 4BG8A 2WBNA 1HMVA 1RBRA 1WSHA 5BR9A 3VA0A 1KVBA 4B3RK 4FWOA 4MDBA 4B9SA 3D45A 4DTMA 3RMBA 4NXMK 3NBPA 5GINA 4FJHA 1U2VA 3BGRA 3KWIA 3ASMA 3L4QA 5AQFA 1A5WA 2HHQA 3N4PA 4W5QA 3LDPA 2O8CB 1VSKA 1WN7A 4KKOA 1R59O 4IFVA 4GW6A 1K6YA 4L3QA 1I94K 1OH7A 1CLQA 3CC2N 1K8AO 1X9JA 2A41A 3QEWA 2NRRA 3TAQA 2VWKA 1YVUA 4ZHRA 4KBOA 3TU5A 3QIOA 1VQNN 1N8RO 1H1VA 3A2FA 1RTJA 3CMAN 3K5OA 1D9DA 1UAXA 4UQGA 2NRXA 5AQGA 3THYB 1D4XA 2A1SA 3TPQA 4LFAK 3BF1A 4BQLA 2QEXN 1BO5O 4DSLA 4M3ZA 1RT1A 3C65A 3IFRA 5LJVA 4FJ9A 3OYMA 4GKKK 3K2PA 3LL3A 3TTDA 3BZKA 4FOIA 1KC8O 3ZT1A 4DV0K 2E5LK 3THYA 1TVRA 4JS5A 4CJ3A 3TABA 3M3ZA 3K9JA 3O9UA 2YHYA 4I6MA 3QEIA 3ZSZA 1M90O 4DR7K 1RTDA 4FWKA 4B9VA 3CCUN 1NKBA 3ZSWA 1HYZA 3QO9A 3KK1A 4JI6K 3AARA 4KAZA 4A2BA 3AA3A 3MEEA 5AZIB 4YOXA 4M3UA 4FLUA 3NFAA 5H1SQ 2YHXA 5JVGL 2ZQBA 3AVHA 3ENOA 4AM7A 4ELUA 3HK2A 4CE9A 1KAXA 4DR2K 3VEOA 2VQEK 3CXCM 2ASOA 3R1XA 3G25A 4XEIA 4BR9A 3SUOA 3BUZB 1ZBUA 1TK5A 1NMNA 3LP2A 3EKUA 3J81O 3OYFA 5AQLA 4ELVA 1YXQA 1GLJO 3C95A 2OZSA 2KZMA 1NGBA 3L3VA 3SCXA 1HR0K 1JJ2M 4YOUA 3QICA 4JI4K 1WNSA 3SBTA 4DV6K 3T1HK 4WFBL 1N5YA 1XC3A 1NK7A 5AQYA 5GIPA 4YHHK 1VQ4N 4JLHA 3E9OA 4CIEA 4DR1K 1DLOA 4HTUA 1DTQA 3K59A 2XY5A 1LW2A 3AVCA 1S1XA 4FM2A 5B8HA 1HJOA 1KXPA 4FLWA 1BI4A 3WQTA 3CJCA 2KFZA 1XWLA 3DXKB 3LAKA 1LWCA 1SS6A 3WXLA 2JWKA 1BHLA 4LY7A 3DOLA 3VTHA 3MK6A 4DV7K 4O8KA 1ASVA 5FPNA 5GAHP 1LV5A 5M1QA 3SK3A 3R6MA 2Q0RA 4DS4A 4H4OA 3AVMA 3NF6A 2GEMA 3C6HA 3UE5A 2B5JA 1Z05A 3DYAA 4JRQA 5KPZA 1FXXA 2DTUA 3RSEA 1SZ2A 3W3DA 2B4JA 5JICA 3O3HA 2VGMA 1QQCA 5C12A 3U9DA 3VGLA 3LM2A 1MWKA 2JWLA 4O0JA 2PY5A 4DU3A 4F2RA 1JL1A 3KHYA 2VYPA 4CGDA 4J2DA 3A5OC 4B1YB 3WXJA 3MWTA 3EYZA 4KHSA 4B1UB 4JK7A 3R8EA 4MFBA 3TAEA 2HBLA 3VEVA 2X78A 3VQAA 3BZCA 5AZJB 1Y97A 3ENHA 1TK8A 1GLEG 2PYLA 5AQOA 1S6PA 5BREA 4CZJA 3PLAA 4BVOA 4PWDA 5ADXA 1VQKN 4NCAA 3ID8A 4H5NA 1NGAA 3U4LA 3WQUA 1ATNA 4BWMA 1YF5L 2GWKA 1NU0A 4I2PA 1D9FA 4A2AA 3HPOA 1JLQA 2UXDK 1NJWA 3KLIA 2ZF5O 4YOWA 3Q7CA 4FZYA 2J4RA 4OGCA 4FWSA 1KFDA 1Y64A 1ASWA 1LW0A 5C15A 1U49A 3WUHA 2G8HA 5AR0A 5BPLA 3I8DA 4DSFA 4AHVA 2QWOA 4FCYA 4IOAL 2ASMA 3HXMA 1RTHA 4FZZA 4Z4FA 1GLFO 5C0YA 3NH0A 1T3VA 1YHQN 1JCGA 3VQ5A 3O3FA 2YNHA 4KHWA 3T1YK 4B1ZA 2PAVA 1BIZA 5BN9A 3L2QA 4B9QA 1W7AA 2O8CA 2NUBA 3D2FA 1P8ZA 3THWA 2Q1NA 3VQCA 3EL2A 2VGNA 4JI5K 3SJJA 1S9GA 3DAWA 2FSNA 1T6CA 3HYFA 3F73A 4CJVA 4CZHA 1TKTA 1HKBA 2G8WA 1RDCA 4KRFA 2HW3A 1TGOA 1T05A 2P9LB 4OKEA 3OYEA 3G71N 1S5JA 1WSJA 2VWJA 4B8AB 3NAEA 3HO1A 4BDYA 2V51B 3M8RA 4DWIA 2P51A 1QS4A 5KQDA 2ZGYA 1HQUA 5F2RA 1TKZA 2VG5A 2P9UB 2G8UA 3KK3A 2R7YA 4GV9A 2IVOA 3MECA 4ILJA 1I39A 3O9SA 3TSQA 2QW9A 2HMIA 2I7PA 1MWMA 4K43A 3PV8A 4JKCA 3I8BA 1OH5A 3HTVA 5E41A 4H03B 4AHUA 4YOTA 1HNWK 4M3RA 1HNZK 3SMPA 2D0CA 4GNIA 4HUEA 1X9MA 1Q9YA 4FJXA 1VHXA 3HJFA 4DB3A 3OYCA 4R79A 3NDKA 3FFIA 3WNGA 4K25A 3CJBA 1CXUA 2E6LA 4JYAK 1G15A 3H46O 4H0YB 3VMFB 2P9NB 3OHRA 4CZIA 2AP1A 4RTFD 5CZ1A 1NGGA 4KO0A 3NGIA 4BGAA 1ZBIA 3KJVA 4JI0K 3AO3A 2QWPA 3NVMA 4MDAA 4AF1A 1TKDA 1FKOA 4CZFA 1WUAA 1NGHA 4BRHA 4IG3A 3SAGA 1VQ5N 2Q0UA 2W42A 3A0IX 3I33A 2O8FB 3DXMA 3QEXA 4HUGA 1NJYA 3T19A 4LF5K 3RMCA 2E2NA 3FZFA 2QWRA 4N47A 4DTXA 2RE2A 3MXJA 2WFBA 2HMPA 1UA1A 3LDLA 1S1UA 2OCEA 3E9LA 3AA2A 5J2NA 3SQ4A 2HB5A 4CEQA 4CEEA 1TKXA 1BQMA 4FWRA 3FLCO 5M1KA 2Z1IA 3BY5A 3S3NA 3CIPA 3TAGA 3RVCA 1BU6O 3HSCA 3DLLL 3NH2A 3QEPA 3BF3A 1NM1A 3T3FA 1JXEA 1GOAA 4LH5A 3SV3A 3M6GA 2P9KB 4Q0BA 4BWJA 4CJ7A 1V4TA 2RPIA 5K14A 2GWJA 2EX3A 4MLHA 3TTFA 3CCJN 2E4LA 3QINA 5J2MA 2YKNA 3G0ZA 1NLVA 5D3GA 2QWNA 1L3UA 1K73O 3IKMA 4JK9A 4WQ5A 4F9OA 4BRGA 3L0QA 5GADP 3DLGA 1V4SA 1Q7YO 4JRPA 1SAZA 2Q97A 4PY5A 1EQYA 4FPAA 3ZX3A 2CH6A 2I5JA 4MO5A 2OZMA 4QOZB 4JD2A 3JXUA 2FBXA 1UWBA 5HP1A 3LP3A 1TAUA 3F9KA 1ILYA 3NGZA 4AHCA 1GLBG 4JI2K 2YNGA 1HLUA 4WQ5C 2Y1JA 1IKVA 3ATUA 5MLCQ 2OPRA 1WAFA 1BA1A 4LFBK 2XY7A 4KTQA 2HNYA 1C0MA 4DR6K 4OPAA 4LSNA 4CI6A 3OS0A 4CFAA 4C8MA 1VSJA 3U3YA 4RW4A 3H1VX 1J5EK 1HPZA 2NRWA 1SKWA 5HRNA 5J2PA 3UKRB 4C1NI 2P9UA 3ISNC 5AQNA 4FVUA 1RBVA 4KH4A 3VEZA 3OS1A 3OYLA 3WXMB 2IC3A 4RW9A 3AVKA 4JKBA 4GY2B 1C0UA 4KFBA 2OPQA 2UUCK 4DCHA 1IH7A 4B3OA 4YDUA 1YTUA 1BCMA 1XNRK 1KSPA 3KD1E 3P31A 1QZ5A 4CVNE 1Q82O 1LCUA 4BRFA 3H6EA 3P39A 3T7ZA 3E9PA 1WOQA 1MU2A 2KKZA 3PX6A 2PYJA 3W0LA 4C8KA 4DHYA 4O0IA 4XH4A 1IV0A 2Z1HA 2D0OA 2ITMA 3R9PA 3CCVN 1U6ZA 4CJ4A 4CIGA 3ZEUB 3EY1A 3PSIA 4CEOA 1E4FT 3B8AX 3RR8A 2KZZA 2JLEA 4DQIA 4DLEA 3AVBA 2X74A 4N41A 3C6UA 3HI0A 4FZXC 4JV5K 1U04A 3V9ZA 4DFPA 4JI1K 4KI4A 3LWLA 2X6NA 4CF0A 3P38A 4DV3K 5LMNK 4WQ4A 5HRPA 3SYZA 3SQ2A 4JI8K 4CHOA 1NGJA 3C94A 4X66K 1JL2A 2HHSA 1W0HA 5HROA 1N34K 5AQPA 3LDQA 4ISFA 4CCHA 1VAZA 4CJRA 4W5NA 4Z0UA 3ZEUA 3QEVA 1TYQA 4E19A 3S3OA 4I6MB 5KI6A 5A2QO 2ZD1A 3AVAA 1VQ9N 3ZSQA 3KTQA 3ZT3A 4DSEA 4FJLA 4BE1A 3L8BA 5JS1A 5CHIA 4H0VB 3SPZA 5C24A 1KAYA 1T44A 1NGDA 4B9NA 1N32K 1J53A 4J2AA 3HVTA 2YHBA 3AA5X 1OH6A 2X6SA 1EX4A 4M42A 4DUZK 3QBXA 2W6KA 3KWGA 3CMEN 4CHPA 1TV6A 2FBVA 4JKGB 3ID6A 2YJEA 2Z1GA 3A8YA 4RW8A 1VQPN 5GIOA 1N33K 1QTMA 5DM7L 2WONA 3J7ZO 2HF4A 4CJ5A 4IFEA 4CJFA 2OTJN 2F9WA 3ZSYA 1MA9B 2HVIA 2IIRA 3JYTA 4Y1DA 2YHWA 4FOEA 3CPEA 1NK6A 1XUPO 3HVRA 4CJPA 2VCPA 4NCBA 2P9SA 3CQXA 3JAMO 3C0BA 2OA8A 2GX9A 3SI6A 4B3TK 4M3TA 3LALA 4DTNA 2VG7A 2CGLA 3HPHA 1NK8A 2IS3A 4PKHA 3HOSA 4FLYA 3L2UA 1YUWA 5HLFA 2HHXA 2NRTA 4DMNA 3SUQA 3RRGA 4FJ7A 2JGUA 1XC9A 3O4NA 5AQUA 1C1BA 2P5GA 2NRZA 2IAJA 1J54A 4CZKA 4HUFA 2BUPA 2G8KA 4V19S 2D0AA 4FSVA 1NK5A 5FDLA 4CJWA 1LWFA 4Z4HA 4WYBA 1FJGK 3SPYA 2W40A 4FJJA 4CEZA 4XH5A 3ZT2A 4W5OA 2HSTA 3WNEA 4M41A 3ZLJA 3VQPA 3J80O 3I55N 3EZWA 4LD0A 4FK0A 3MCPA 4FLXA 3CCMN 2Y1IA 2A5XA 4H4MA 4KI6A 4E1NA 3T1AA 2UUAK 4HCBA 1CZBA 1T8EA 3P5JA 3SV4A 3MXMA 1UA0A 3HM8A 2D5RA 5AQWA 4GKJK 4JD2B 1ZBSA 4KHUA 3NHGA 3FZHA 4DSIA 4DTSA 1CZAN 1QE1A 4IBNA 2BE2A 4B1WB 3THVA 3ZSOA 4FJNA 3OYBA 2QK9A 2O8EA 5C10A 5AQIA 4CD3A 3G6EN 2UU9K 4BC3A 1WLJA 5BRDA 2FF3B 2FXUA 5EXWA 1TK0A 3CYMA 3AO1A 3QBWA 2QXFA 2F8SA 4KPYA 1VSMA 4E7JA 4BRIA 3RMDA 4BE2A 4C23A 1E3MA 1EETA 1Q9XA 3KLGA 4DSKA 5JVHL 5AQQA 3GDQA 4CEFA 3DLKA 1WBBA 2QI2A 1NMDA 3WEEB 4CGGA 1NBWA 3R3LA 2BGGA 1GOBA 2ZJPL 4CZGA 1RT4A 4CBUA 4HWIA 4N56A 2FSJA 5M1OA 3ZCMA 4PL7A 5T7BA 4B9LA 2OYQA 3FZLA 1RTIA 3G4SN 2A42A 3WT0A 4JI3K 4Z4CA 2WC9A 2XY8A 4DR3K 2B6AA 2PZSA 3O9RA 3OA9A 2IOCA 1KTQA 1YIJN 1L3VA 1QZ6A 4NLBA 2GV9A 4KH6A 2CGKA 4FW2A 3KKSA 4EAHD 1EP4A 2RN2A 2NRHA 3ZETB 5KQ8A 3V1OA 4CJLA 3E66A 4BE0A 4I2QA 3VQEA 1CXQA 1VRUA 3LZIA 1Z26A 4FVMA 3AVGA 4OPHA 1SL1A 3CERA 1W2BM 3QETA 1NGCA 3M1FA 3SMSA 3TTCA 3BEXA 2P1JA 2O8BA 4O5FA 4BR5A 4IEEA 3V81A 3DRRA 2DFHA 2BANA 3LPTA 3I0SA 3SJHA 3UKRA 1OKJA 1VSHA 4A61A 4BG9A 4OKKA 1C1CA 1QHAA 4EHTA 3ZX0A 4KHPK 1A5XA 1X1PA 2G8VA 3OYJA 3O4WA 1LWEA 1C0TA 2F96A 4O8UA 3F2KA 3WXKA 4JI7K 2G8IA 3MN7A 1NJZA 4DFKA 1Q8IA 2ZWHA 1ZYQA 3RMAA 4M63C 3MXIA 4DFJA 1X9WA 4AILC 2H3GX 1RFQA 1JKHA 3DXKA 3GE1A 1HJRA 3KLEA 4M3XA 1QSYA 2HHVA 3VQ9A 1FKPA 1K8KB 1YI2N 4JHDB 3I0RA 3CD6N 3WNHA 3FR0A 1ESVA 4CERA 3D6RA 4DLGA 3QLHA 4AHSA 2ZGZA 5F1XA 4CF1A 3AO5A 3MX5A 4A62A 3DLBA 3VQ7A 4K42A 4PHTX 3L4IA 2YKMA 2WOMA 1K8KA 1J5OA 2HVHA 2HHTA 4CGHA 2IDOA 3MCAB 3OY9A 4DQRA 3VQ6A 3ZT0A 1SQKA 3EO3A 2V7YA 4CECA 1HUXA 3AVFA 3AVIA 3VERA 3N4QA 2O8DA 1HRHA 2D0BA 4UY8O 4PL8A 1IBMK 1HX1A 5F0XA 1WSIA 1Q81O 2YX6A 4ILHA 1ASUA 1VQ6N 3LDNA 3RTVA 3LP0A 1HPMA 1BOTO 2PBDA 1SKSA 1YVNA 3CC4N 4CJKA 2I7NA 3CQ8A 2P9KA 4FW1A 3S9HA 4XH1A 1UOCA 4J2BA 3KKRA 4E7HA 2D0PA 4DU4A 4DF4A 1GLAG 1LOTB 3MN5A 2FBYA 3DWLA 2ZJQL 1QHTA 3ZETA 4CF8A 2OPSA 5J1EA 1KD1O 3HRGA 3PO5A 4RCHA 4IO8A 4B9UA 3JS6A 4WE1A 5BN8A 3VPZA 4BACA 4DF8A 4E7IA 2FLOA 2F9TA 3CFOA 3PY8A 4O44A 3V1RA 2KFNA 4BRAA 4H5WA 4KTWA 5HOOA 1TUUA 2HBMA 3CETA 1I3AA 5AFUH 1BL3A 4IXCA 4BROA 4IKFA 4IJAA 1TL3A 3K5NA 1QQNA 3LWMA 4FJ8A 2NNWA 3AGRA 4AH9A 3EE8A 1U48A 3C7NB 4BC2A 4H0XB 4CFBA 5JMVA 3ZSVA 2HNDA 3OYIA 4CD1A 5CE3A 3EEQA 3L3UA 1NJIO 1Q86O 1YTAA 4BGBA 4W5TA 4CEBA 3RR7A 2GUIA 2A40A 1NNEA 3PIPL 4B9TA 4CF9A 4E89A 1J9AA 5AQTA 4FM1A 4OLAA 1DTTA 3DMJA 5CY4A 4IFYA 1FW6A 3NF9A 2E8AA 3ATVA 3WXIA 2ZM6K 3MN6A 3AV9A 4I7FA 4G1QA 5AZJA 2AJQA 1VQ8N 3ZYYX 4DV4K 2P9NA 3AVJA 3V4IA 5DM6L 4XIUA 4RW6A 2HHWA 4LFCK 1RNHA 2IGIA 4ISGA 1CZ9A 3NH1A 4FWQA 1NOZA 3U8XA 3ZSXA 4YY3K 4JHDA 2DFEA 1XHXA 3LZJA 1EXQA 5FPEA 4CHZA 1HQEA 4LC9B 3VGMA 1YAGA 1GOCA 2WUSA 4DQPA 3LDOA 5IT9O 5DK5A 4EP5A 1T6DA 4N76A 4QS8A 1RT2A 2ASPA 4WF9L 3OYNA 3ZX2A 4ID5A 5BR8K 4B3MK 1GLLO 5GAGP 3GL1A 4K0KK 5BPMA 4DFMA 2XY6A 2VWBA 3ZSRA 3VOVA 3M8SA
chains in the Genus database with same CATH topology
4CIFA 3O3GA 1LV5A 4FK2A 4CJ5A 3QNOA 4FJGA 4CJFA 1IKXA 4E7LA 5KRTA 1NJXA 2YNIA 4FXDA 4DS4A 4CK2A 3ZSYA 1VSFA 2HVIA 4H4OA 3AVMA 3JYTA 3NF6A 3SZ2A 5C25A 4F3OA 4FLTA 3C6TA 3AVNA 4Y1DA 1RT3A 2B5JA 3JSMA 1ZBLA 1NKCA 1B92A 1NK6A 4I9LA 1BI4B 2YHAA 2EHGA 3DYAA 4CJPA 3HVRA 4JRQA 4IDKA 3NE6A 4DS5A 1T03A 1FXXA 3UIQA 4DTUA 1D8YA 2DTUA 3V9UA 3OYKA 1NOYA 2OA8A 1U4BA 2B4JA 3O3HA 3SI6A 5C42A 1JLEA 4M3TA 3L2RA 1VSEA 1ASVA 1QQCA 3LALA 4DTNA 4OGEA 2XO7A 5KGWA 2VG7A 4CK1A 1HNVA 5I42A 3HPHA 1NK8A 2IS3A 3KD5E 1VSIA 4FLYA 2ZE2A 4O0JA 3L2UA 2PY5A 3D0PA 4F4KA 4DU3A 4B08A 4CEAA 1JL1A 3P1GA 3VQ8A 3U6FA 5HLFA 4F2RA 2HHXA 3AO2A 4CGDA 4DMNA 1BCOA 4J2DA 3SUQA 3RRGA 4FJ7A 2P5OA 2JGUA 3EYZA 4CEDA 4EZ9A 4KHSA 1XC9A 1BGXT 3O4NA 4MFBA 3TAEA 1L3SA 5DMRA 1C1BA 4E0DA 1RT6A 4M3WA 3AA4A 4NCGA 4F3TA 4KHQA 2P5GA 2X78A 1X9SA 2IAJA 3VQAA 1J54A 4HUFA 1BISA 1Y97A 3EZ5A 2HHUA 3SUNA 2G8KA 4OPJA 1SV5A 2D0AA 3HPGA 4DQQA 1TK8A 1NK5A 5FDLA 1IKYA 1LWFA 1YT3A 4CJWA 4Z4HA 2PYLA 2OPPA 1SL2A 1KFSA 5J2QA 4FLVA 3LANA 2E6MA 4B8CA 3SPYA 4FJJA 4CEZA 4DU1A 1WSFA 1KRPA 2LSNA 4AHTA 3ZT2A 4HCCA 1S6PA 4W5OA 3OYHA 3WNEA 2ITGA 4M41A 3LPUA 2DY4A 3VQPA 4PWDA 1VK0A 4LD0A 4FK0A 3U3GA 4CJQA 3V9WA 4NCAA 3B6PA 3B6OA 4FLXA 3PO4A 2Y1IA 4H4MA 4EZ6A 1VSLA 1T7PA 1Z25A 1KVCA 1F21A 4KV8A 4OVLA 4KI6A 3DOKA 4E1NA 4BWMA 1TL1A 3T1AA 4HCBA 4I2PA 1D9FA 1CZBA 4QAGA 3HPOA 3P5JA 1JLQA 2YNFA 3SV4A 3MXMA 1UA0A 1T8EA 1NJWA 3S3MA 2D5RA 3KLIA 4FZYA 5FRNA 2VG6A 4FM0A 4OGCA 1KFDA 1HNIA 1ASWA 2KW4A 4CESA 4KHUA 4M3YA 1LW0A 3NHGA 1KCFA 4DSIA 4DTSA 1U49A 3NGYA 1QE1A 3OVNA 2BE2A 4IBNA 3THVA 1TAQA 3ZSOA 2G8HA 4FJNA 5HRRA 4KHNA 3OYBA 3I8DA 2QK9A 3DLEA 3LDSA 4DSFA 4AHVA 1WLJA 3SUPA 4FCYA 4Z4FA 3HXMA 1RTHA 4FZZA 3NH0A 4FJ5A 4ID1A 1TK0A 3CYMA 3AO1A 4JS4A 3RWUA 3HK2A 2QXFA 3KLHA 3VQ5A 3NCIA 3KLFA 3DLHA 2F8SA 3O3FA 5CYQA 4KPYA 1VSMA 4C8NA 2YNHA 4Q5VA 4BE2A 3K57A 4E7JA 3RMDA 4KHWA 3OJUA 1EETA 4CFCA 1BQNA 1Q9XA 3CM5A 3KLGA 4LH4A 3KIOA 4DSKA 1S1WA 3HL8A 1BIZA 4CEFA 4E1MA 3DLKA 4NYNA 4W5RA 3L2QA 1D5AA 4CGGA 3HM9A 4B9MA 4TSXA 3BDPA 2NUBA 1ZBHA 2BGGA 1GOBA 4DSJA 1JLAA 1RT4A 4N56A 3IRXA 1RILA 4M45A 3VQCA 3CG7A 1JLFA 2Z1JA 3ZCMA 3V9SA 3IG1A 5T7BA 3VA3A 3SJJA 3OYAA 3ZT4A 4O5BA 2OYQA 4B9LA 3O4QA 1S9GA 5KTQA 1RTIA 2DFFA 2QKBA 2FBTA 3F73A 3HYFA 4CJVA 4CHYA 4EP4A 3LAMA 1TKTA 4Z4CA 4DTJA 2G8WA 1RDCA 4KRFA 2HW3A 3PX0A 1TGOA 1T05A 5HRSA 3L2WA 4OKEA 3QNNA 3OYEA 4I9QA 4ZTJA 1ITGA 2XY8A 4BDPA 3SNNA 1S5JA 1IG9A 1WSJA 4H8KA 3ITHA 2VWJA 4L8RB 2B6AA 1NKEA 4B8AB 3NAEA 3HO1A 2PZSA 2IOCA 1KTQA 4BDYA 1SKRA 1L3VA 3VN5A 3M8RA 4DTRA 2GV9A 1WAJA 4DWIA 2P51A 4YFUA 1QS4A 2ETJA 4FW2A 3KKSA 4YNQA 3OYDA 3OJSA 1HQUA 5FRMA 1EP4A 2RN2A 1TKZA 1FK9A 2VG5A 2G8UA 4ELTA 3KK3A 2R7YA 4DG1A 4Z4GA 3V1OA 1VRTA 4CJLA 3MECA 1RT5A 3KK2A 1SL0A 1I39A 4BE0A 4CGJA 3TARA 3G10A 3TAFA 4I2QA 3VQEA 2HMIA 1CXQA 3VQ4A 1IO2A 1VRUA 3PV8A 4CJEA 3LZIA 4J2EA 1A5VA 1Z26A 4FVMA 5E41A 3AVGA 4DQSA 1LAWA 4C8OA 4AHUA 1RCHA 1JXBA 2O4IA 3DLRA 4OKJA 4M3RA 1SL1A 4FK4A 1B9FA 1QSLA 2D0CA 4HUEA 1X9MA 1Q9YA 4FJXA 3QETA 3WNFA 3VQBA 3HJFA 5HBMA 4OLBA 2P1JA 3OYCA 3V81A 3DRRA 3NDKA 3TANA 3FFIA 3WNGA 1C1AA 5SWMA 1W9HA 1S9EA 4FYDA 1CXUA 2DFHA 2BANA 2E6LA 1RDAA 4KTZA 3L2VA 1JLGA 1KVAA 3AO4A 3LPTA 2F8TA 3I0SA 1G15A 1VSHA 4OKKA 1C1CA 4QCLA 2RKIA 1U47A 3PX4A 1RBUA 5CZ1A 1A5XA 1X1PA 1IKWA 4OJRA 3OYJA 2G8VA 1QSSA 3SQ0A 4KO0A 3NGIA 1ZBIA 1LWEA 1C0TA 3KJVA 2F96A 4LSLA 1O1WA 4KREA 1NK4A 3AO3A 1KLNA 3TWHA 2G8IA 2XRIA 4MQ3A 1NJZA 4DFKA 1NK9A 1JLCA 3HSTB 1TKDA 4GMJB 1FKOA 3RRHA 1Q8IA 1ZYQA 3RMAA 3K58A 3AVLA 4IG3A 3H08A 3V6DA 1NK0A 4Z4EA 4N5SA 3MXIA 2KQ2A 4DFJA 3ULDA 2W42A 1X9WA 4AILC 3TAMA 2YV0X 4CK3A 1JKHA 4HUGA 3QEXA 3T19A 1HJRA 5KGXA 4R5PA 3OYGA 3KLEA 1NJYA 4M3XA 1QSYA 3RMCA 2HHVA 3CM6A 3VQ9A 4CJTA 4N47A 1FKPA 4DTXA 3MXJA 3DRPA 4AHRA 4KHYA 5FROA 3DRSA 3HP6A 3OS2A 1UA1A 3I0RA 3WNHA 1S1UA 4CERA 4DLGA 3CFRA 3AA2A 5J2NA 4F2SA 3SQ4A 2HB5A 4O4GA 4Y1CA 3TR8A 4CEEA 1TKXA 4CEQA 3QLHA 4AHSA 1BQMA 1REVA 3AO5A 4CF1A 5KRSA 2HHTA 3E01A 2Z1IA 3DLBA 3VQ7A 3S3NA 4KB1A 3PUFA 4ICLA 3TAGA 3VQDA 2YKMA 2WOMA 3NH2A 3V1QA 3QEPA 1J5OA 1RBTA 3LP1A 2IDOA 4CGHA 1HYSA 2HVHA 3T3FA 1JXEA 1GOAA 3IS9A 4LH5A 3OY9A 3SV3A 4FJMA 4DQRA 3MAQA 3VQ6A 4Q0BA 4BWJA 3ZT0A 5SZTA 1L3TA 4CECA 3AVFA 1HMVA 4FJKA 1RBRA 2RPIA 1JLBA 3AVIA 1WSHA 5K14A 4GVMA 2EX3A 1HRHA 2D0BA 2E4LA 4DTOA 1R0AA 3QINA 3VA0A 5EU7A 2YKNA 5J2MA 3G0ZA 1XHZA 5D3GA 1WSIA 1L3UA 1HYVA 1ASUA 1BIUA 1KVBA 3RTVA 3LP0A 4Z4IA 4B9SA 4CF2A 3D45A 3QERA 4DTMA 3RMBA 1U45A 1VSDA 3DI6A 3NBPA 4HVJA 1SKSA 4CJKA 3DLGA 4F8RA 3CQ8A 4FJHA 3BGRA 5CZ2A 3ASMA 4FW1A 4JRPA 1A5WA 2HHQA 4W5QA 3HT3A 3S9HA 4PY5A 5CYMA 1VSKA 1WN7A 4KKOA 1UOCA 3K5MA 4IFVA 4GW6A 4J2BA 1K6YA 3KKRA 4FJIA 4BDZA 3MEGA 2I5JA 1CLQA 2OZMA 4E7HA 4OPKA 4QOZB 4RG8A 4DU4A 1WSEA 4DF4A 2FBXA 1RT7A 1UWBA 3QEWA 5HP1A 3LP3A 1TAUA 3F9KA 1LAVA 1B9DA 3TAQA 1RBSA 2FBYA 3NGZA 1C6VA 4AHCA 2VWKA 1QHTA 1YVUA 2YNGA 2OPSA 4CF8A 4ZHRA 5J1EA 2Y1JA 3TI0A 1IKVA 3PO5A 3QIOA 4B9UA 2G8FA 2OPRA 3A2FA 4WE1A 4BACA 4DF8A 1WAFA 4E7IA 1RTJA 2XY7A 4KTQA 2HNYA 1C0MA 3K5OA 1D9DA 1UAXA 4LSNA 4UQGA 3OS0A 4CFAA 4C8MA 1VSJA 3CFOA 3U3YA 4O44A 2A1SA 3PY8A 4RW4A 3V1RA 2KFNA 1HPZA 2ATQA 1SKWA 4KTWA 5HRNA 5J2PA 4DSLA 4M3ZA 3ISNC 1RT1A 1RBVA 1I3AA 4K8XA 3OS1A 3OYLA 3OYMA 4FJ9A 1BL3A 2IC3A 3K2PA 4RW9A 4IKFA 3AVKA 4C8LA 3NF8A 1TL3A 1WSGA 1C0UA 4KFBA 3K5NA 3LWMA 2OPQA 3ZT1A 4FJ8A 1TVRA 4AH9A 4DTPA 4JS5A 1U48A 4NCBA 4CJ3A 3TABA 2BDPA 1IH7A 4B3OA 1YTUA 4HHTA 1BCMA 1KSPA 3TAPA 4CFBA 3KD1E 3ZSVA 2HNDA 3OYIA 3QEIA 3ZSZA 3ALYA 3L3UA 1RTDA 4B9VA 4CGFA 4RW7A 3SQ1A 1YTAA 4W5TA 4CEBA 1NKBA 3ZSWA 4PQUA 1HYZA 3QO9A 3KK1A 1N6QA 3RR7A 1MU2A 2GUIA 4NYFA 3PX6A 4KAZA 2PYJA 3AA3A 3MEEA 4B9TA 4CF9A 4E89A 4FLUA 4M3UA 3NFAA 4C8KA 1J9AA 4O0IA 5I3UA 4IG0A 2Z1HA 4FM1A 4OLAA 1DTTA 3DMJA 5CY4A 4IFYA 3NF9A 4CJ4A 4CIGA 3EY1A 5JS2A 3AV9A 4CEOA 4CGIA 4I7FA 3RR8A 4G1QA 2KZZA 3M8QA 2JLEA 4DQIA 2ZQBA 3AVHA 3QESA 4CHNA 2AJQA 4DLEA 4KB0A 3AVBA 3QIPA 2X74A 4N41A 2FC0A 4ELUA 3C6UA 3AVJA 3VQQA 3V4IA 1U04A 4FZXC 4CE9A 3P83D 1S1VA 4XIUA 3V9ZA 4DFPA 4RW6A 2O4GA 2HHWA 1RNHA 2KTQA 2RF2A 4KI4A 3LWLA 2IGIA 3NH1A 2X6NA 1CZ9A 1KLMA 2HNZA 4CF0A 3K5LA 3SUOA 4CJUA 1NOZA 1ZBUA 5HRPA 2XHBA 3SYZA 3SQ2A 1TK5A 4CHOA 3LP2A 3C94A 3HP9A 1JL2A 3OYFA 2HHSA 1W0HA 5HROA 1L5UA 1SUQA 3M8PA 4PUOA 3ZSXA 3CFPA 2QKKA 4ELVA 3C95A 4CCHA 2OZSA 2KZMA 4CJRA 4W5NA 4Z0UA 2DFEA 4CJSA 3L3VA 3SCXA 1XHXA 3LZJA 3QEVA 4E19A 4E3SA 3S3OA 4K8ZA 1ZBFA 4E7KA 1EXQA 3V9XA 2Q3SA 5KI6A 1HQEA 1WNSA 4CHZA 2ZD1A 1EKEA 3AVAA 3KTQA 3ZSQA 3MEDA 1GOCA 3ZT3A 4DSEA 4FJLA 1N5YA 1RDDA 1NK7A 4BE1A 3L8BA 5JS1A 4DQPA 3SPZA 4O55A 5C24A 4JLHA 4CIEA 4CFDA 1DLOA 5DK5A 4HTUA 4B9NA 1DTQA 4EP5A 3K59A 2XY5A 1XI1A 4N76A 1J53A 2GBZA 2A1RA 1LW2A 3AVCA 1S1XA 4FM2A 4J2AA 3DM2A 1RT2A 2YHBA 3HVTA 4FLZA 1BI4A 3OYNA 3AA5X 4FLWA 2X6SA 3IAYA 1EX4A 4M42A 2KFZA 4PA1A 4ID5A 4CHPA 1XWLA 3LAKA 1TV6A 1RDBA 1LWCA 2FBVA 2Z1GA 4RW8A 4ZTFA 3NF7A 1BHLA 4LY7A 3DOLA 4DFMA 1S1TA 1S6QA 2XY6A 3ZSRA 3M8SA 1QTMA 2WONA 4CHQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CIF A;  3O3G A;  1LV5 A;  4FK2 A;  4CJ5 A;  3QNO A;  4FJG A;  4CJF A;  1IKX A;  4E7L A;  5KRT A;  1NJX A;  2YNI A;  4FXD A;  4DS4 A;  4CK2 A;  3ZSY A;  1VSF A;  2HVI A;  4H4O A;  3AVM A;  3JYT A;  3NF6 A;  3SZ2 A;  5C25 A;  4F3O A;  4FLT A;  3C6T A;  3AVN A;  4Y1D A;  1RT3 A;  2B5J A;  3JSM A;  1ZBL A;  1NKC A;  1B92 A;  1NK6 A;  4I9L A;  1BI4 B;  2YHA A;  2EHG A;  3DYA A;  4CJP A;  3HVR A;  4JRQ A;  4IDK A;  3NE6 A;  4DS5 A;  1T03 A;  1FXX A;  3UIQ A;  4DTU A;  1D8Y A;  2DTU A;  3V9U A;  3OYK A;  1NOY A;  2OA8 A;  1U4B A;  2B4J A;  3O3H A;  3SI6 A;  5C42 A;  1JLE A;  4M3T A;  3L2R A;  1VSE A;  1ASV A;  1QQC A;  3LAL A;  4DTN A;  4OGE A;  2XO7 A;  5KGW A;  2VG7 A;  4CK1 A;  1HNV A;  5I42 A;  3HPH A;  1NK8 A;  2IS3 A;  3KD5 E;  1VSI A;  4FLY A;  2ZE2 A;  4O0J A;  3L2U A;  2PY5 A;  3D0P A;  4F4K A;  4DU3 A;  4B08 A;  4CEA A;  1JL1 A;  3P1G A;  3VQ8 A;  3U6F A;  5HLF A;  4F2R A;  2HHX A;  3AO2 A;  4CGD A;  4DMN A;  1BCO A;  4J2D A;  3SUQ A;  3RRG A;  4FJ7 A;  2P5O A;  2JGU A;  3EYZ A;  4CED A;  4EZ9 A;  4KHS A;  1XC9 A;  1BGX T;  3O4N A;  4MFB A;  3TAE A;  1L3S A;  5DMR A;  1C1B A;  4E0D A;  1RT6 A;  4M3W A;  3AA4 A;  4NCG A;  4F3T A;  4KHQ A;  2P5G A;  2X78 A;  1X9S A;  2IAJ A;  3VQA A;  1J54 A;  4HUF A;  1BIS A;  1Y97 A;  3EZ5 A;  2HHU A;  3SUN A;  2G8K A;  4OPJ A;  1SV5 A;  2D0A A;  3HPG A;  4DQQ A;  1TK8 A;  1NK5 A;  5FDL A;  1IKY A;  1LWF A;  1YT3 A;  4CJW A;  4Z4H A;  2PYL A;  2OPP A;  1SL2 A;  1KFS A;  5J2Q A;  4FLV A;  3LAN A;  2E6M A;  4B8C A;  3SPY A;  4FJJ A;  4CEZ A;  4DU1 A;  1WSF A;  1KRP A;  2LSN A;  4AHT A;  3ZT2 A;  4HCC A;  1S6P A;  4W5O A;  3OYH A;  3WNE A;  2ITG A;  4M41 A;  3LPU A;  2DY4 A;  3VQP A;  4PWD A;  1VK0 A;  4LD0 A;  4FK0 A;  3U3G A;  4CJQ A;  3V9W A;  4NCA A;  3B6P A;  3B6O A;  4FLX A;  3PO4 A;  2Y1I A;  4H4M A;  4EZ6 A;  1VSL A;  1T7P A;  1Z25 A;  1KVC A;  1F21 A;  4KV8 A;  4OVL A;  4KI6 A;  3DOK A;  4E1N A;  4BWM A;  1TL1 A;  3T1A A;  4HCB A;  4I2P A;  1D9F A;  1CZB A;  4QAG A;  3HPO A;  3P5J A;  1JLQ A;  2YNF A;  3SV4 A;  3MXM A;  1UA0 A;  1T8E A;  1NJW A;  3S3M A;  2D5R A;  3KLI A;  4FZY A;  5FRN A;  2VG6 A;  4FM0 A;  4OGC A;  1KFD A;  1HNI A;  1ASW A;  2KW4 A;  4CES A;  4KHU A;  4M3Y A;  1LW0 A;  3NHG A;  1KCF A;  4DSI A;  4DTS A;  1U49 A;  3NGY A;  1QE1 A;  3OVN A;  2BE2 A;  4IBN A;  3THV A;  1TAQ A;  3ZSO A;  2G8H A;  4FJN A;  5HRR A;  4KHN A;  3OYB A;  3I8D A;  2QK9 A;  3DLE A;  3LDS A;  4DSF A;  4AHV A;  1WLJ A;  3SUP A;  4FCY A;  4Z4F A;  3HXM A;  1RTH A;  4FZZ A;  3NH0 A;  4FJ5 A;  4ID1 A;  1TK0 A;  3CYM A;  3AO1 A;  4JS4 A;  3RWU A;  3HK2 A;  2QXF A;  3KLH A;  3VQ5 A;  3NCI A;  3KLF A;  3DLH A;  2F8S A;  3O3F A;  5CYQ A;  4KPY A;  1VSM A;  4C8N A;  2YNH A;  4Q5V A;  4BE2 A;  3K57 A;  4E7J A;  3RMD A;  4KHW A;  3OJU A;  1EET A;  4CFC A;  1BQN A;  1Q9X A;  3CM5 A;  3KLG A;  4LH4 A;  3KIO A;  4DSK A;  1S1W A;  3HL8 A;  1BIZ A;  4CEF A;  4E1M A;  3DLK A;  4NYN A;  4W5R A;  3L2Q A;  1D5A A;  4CGG A;  3HM9 A;  4B9M A;  4TSX A;  3BDP A;  2NUB A;  1ZBH A;  2BGG A;  1GOB A;  4DSJ A;  1JLA A;  1RT4 A;  4N56 A;  3IRX A;  1RIL A;  4M45 A;  3VQC A;  3CG7 A;  1JLF A;  2Z1J A;  3ZCM A;  3V9S A;  3IG1 A;  5T7B A;  3VA3 A;  3SJJ A;  3OYA A;  3ZT4 A;  4O5B A;  2OYQ A;  4B9L A;  3O4Q A;  1S9G A;  5KTQ A;  1RTI A;  2DFF A;  2QKB A;  2FBT A;  3F73 A;  3HYF A;  4CJV A;  4CHY A;  4EP4 A;  3LAM A;  1TKT A;  4Z4C A;  4DTJ A;  2G8W A;  1RDC A;  4KRF A;  2HW3 A;  3PX0 A;  1TGO A;  1T05 A;  5HRS A;  3L2W A;  4OKE A;  3QNN A;  3OYE A;  4I9Q A;  4ZTJ A;  1ITG A;  2XY8 A;  4BDP A;  3SNN A;  1S5J A;  1IG9 A;  1WSJ A;  4H8K A;  3ITH A;  2VWJ A;  4L8R B;  2B6A A;  1NKE A;  4B8A B;  3NAE A;  3HO1 A;  2PZS A;  2IOC A;  1KTQ A;  4BDY A;  1SKR A;  1L3V A;  3VN5 A;  3M8R A;  4DTR A;  2GV9 A;  1WAJ A;  4DWI A;  2P51 A;  4YFU A;  1QS4 A;  2ETJ A;  4FW2 A;  3KKS A;  4YNQ A;  3OYD A;  3OJS A;  1HQU A;  5FRM A;  1EP4 A;  2RN2 A;  1TKZ A;  1FK9 A;  2VG5 A;  2G8U A;  4ELT A;  3KK3 A;  2R7Y A;  4DG1 A;  4Z4G A;  3V1O A;  1VRT A;  4CJL A;  3MEC A;  1RT5 A;  3KK2 A;  1SL0 A;  1I39 A;  4BE0 A;  4CGJ A;  3TAR A;  3G10 A;  3TAF A;  4I2Q A;  3VQE A;  2HMI A;  1CXQ A;  3VQ4 A;  1IO2 A;  1VRU A;  3PV8 A;  4CJE A;  3LZI A;  4J2E A;  1A5V A;  1Z26 A;  4FVM A;  5E41 A;  3AVG A;  4DQS A;  1LAW A;  4C8O A;  4AHU A;  1RCH A;  1JXB A;  2O4I A;  3DLR A;  4OKJ A;  4M3R A;  1SL1 A;  4FK4 A;  1B9F A;  1QSL A;  2D0C A;  4HUE A;  1X9M A;  1Q9Y A;  4FJX A;  3QET A;  3WNF A;  3VQB A;  3HJF A;  5HBM A;  4OLB A;  2P1J A;  3OYC A;  3V81 A;  3DRR A;  3NDK A;  3TAN A;  3FFI A;  3WNG A;  1C1A A;  5SWM A;  1W9H A;  1S9E A;  4FYD A;  1CXU A;  2DFH A;  2BAN A;  2E6L A;  1RDA A;  4KTZ A;  3L2V A;  1JLG A;  1KVA A;  3AO4 A;  3LPT A;  2F8T A;  3I0S A;  1G15 A;  1VSH A;  4OKK A;  1C1C A;  4QCL A;  2RKI A;  1U47 A;  3PX4 A;  1RBU A;  5CZ1 A;  1A5X A;  1X1P A;  1IKW A;  4OJR A;  3OYJ A;  2G8V A;  1QSS A;  3SQ0 A;  4KO0 A;  3NGI A;  1ZBI A;  1LWE A;  1C0T A;  3KJV A;  2F96 A;  4LSL A;  1O1W A;  4KRE A;  1NK4 A;  3AO3 A;  1KLN A;  3TWH A;  2G8I A;  2XRI A;  4MQ3 A;  1NJZ A;  4DFK A;  1NK9 A;  1JLC A;  3HST B;  1TKD A;  4GMJ B;  1FKO A;  3RRH A;  1Q8I A;  1ZYQ A;  3RMA A;  3K58 A;  3AVL A;  4IG3 A;  3H08 A;  3V6D A;  1NK0 A;  4Z4E A;  4N5S A;  3MXI A;  2KQ2 A;  4DFJ A;  3ULD A;  2W42 A;  1X9W A;  4AIL C;  3TAM A;  2YV0 X;  4CK3 A;  1JKH A;  4HUG A;  3QEX A;  3T19 A;  1HJR A;  5KGX A;  4R5P A;  3OYG A;  3KLE A;  1NJY A;  4M3X A;  1QSY A;  3RMC A;  2HHV A;  3CM6 A;  3VQ9 A;  4CJT A;  4N47 A;  1FKP A;  4DTX A;  3MXJ A;  3DRP A;  4AHR A;  4KHY A;  5FRO A;  3DRS A;  3HP6 A;  3OS2 A;  1UA1 A;  3I0R A;  3WNH A;  1S1U A;  4CER A;  4DLG A;  3CFR A;  3AA2 A;  5J2N A;  4F2S A;  3SQ4 A;  2HB5 A;  4O4G A;  4Y1C A;  3TR8 A;  4CEE A;  1TKX A;  4CEQ A;  3QLH A;  4AHS A;  1BQM A;  1REV A;  3AO5 A;  4CF1 A;  5KRS A;  2HHT A;  3E01 A;  2Z1I A;  3DLB A;  3VQ7 A;  3S3N A;  4KB1 A;  3PUF A;  4ICL A;  3TAG A;  3VQD A;  2YKM A;  2WOM A;  3NH2 A;  3V1Q A;  3QEP A;  1J5O A;  1RBT A;  3LP1 A;  2IDO A;  4CGH A;  1HYS A;  2HVH A;  3T3F A;  1JXE A;  1GOA A;  3IS9 A;  4LH5 A;  3OY9 A;  3SV3 A;  4FJM A;  4DQR A;  3MAQ A;  3VQ6 A;  4Q0B A;  4BWJ A;  3ZT0 A;  5SZT A;  1L3T A;  4CEC A;  3AVF A;  1HMV A;  4FJK A;  1RBR A;  2RPI A;  1JLB A;  3AVI A;  1WSH A;  5K14 A;  4GVM A;  2EX3 A;  1HRH A;  2D0B A;  2E4L A;  4DTO A;  1R0A A;  3QIN A;  3VA0 A;  5EU7 A;  2YKN A;  5J2M A;  3G0Z A;  1XHZ A;  5D3G A;  1WSI A;  1L3U A;  1HYV A;  1ASU A;  1BIU A;  1KVB A;  3RTV A;  3LP0 A;  4Z4I A;  4B9S A;  4CF2 A;  3D45 A;  3QER A;  4DTM A;  3RMB A;  1U45 A;  1VSD A;  3DI6 A;  3NBP A;  4HVJ A;  1SKS A;  4CJK A;  3DLG A;  4F8R A;  3CQ8 A;  4FJH A;  3BGR A;  5CZ2 A;  3ASM A;  4FW1 A;  4JRP A;  1A5W A;  2HHQ A;  4W5Q A;  3HT3 A;  3S9H A;  4PY5 A;  5CYM A;  1VSK A;  1WN7 A;  4KKO A;  1UOC A;  3K5M A;  4IFV A;  4GW6 A;  4J2B A;  1K6Y A;  3KKR A;  4FJI A;  4BDZ A;  3MEG A;  2I5J A;  1CLQ A;  2OZM A;  4E7H A;  4OPK A;  4QOZ B;  4RG8 A;  4DU4 A;  1WSE A;  4DF4 A;  2FBX A;  1RT7 A;  1UWB A;  3QEW A;  5HP1 A;  3LP3 A;  1TAU A;  3F9K A;  1LAV A;  1B9D A;  3TAQ A;  1RBS A;  2FBY A;  3NGZ A;  1C6V A;  4AHC A;  2VWK A;  1QHT A;  1YVU A;  2YNG A;  2OPS A;  4CF8 A;  4ZHR A;  5J1E A;  2Y1J A;  3TI0 A;  1IKV A;  3PO5 A;  3QIO A;  4B9U A;  2G8F A;  2OPR A;  3A2F A;  4WE1 A;  4BAC A;  4DF8 A;  1WAF A;  4E7I A;  1RTJ A;  2XY7 A;  4KTQ A;  2HNY A;  1C0M A;  3K5O A;  1D9D A;  1UAX A;  4LSN A;  4UQG A;  3OS0 A;  4CFA A;  4C8M A;  1VSJ A;  3CFO A;  3U3Y A;  4O44 A;  2A1S A;  3PY8 A;  4RW4 A;  3V1R A;  2KFN A;  1HPZ A;  2ATQ A;  1SKW A;  4KTW A;  5HRN A;  5J2P A;  4DSL A;  4M3Z A;  3ISN C;  1RT1 A;  1RBV A;  1I3A A;  4K8X A;  3OS1 A;  3OYL A;  3OYM A;  4FJ9 A;  1BL3 A;  2IC3 A;  3K2P A;  4RW9 A;  4IKF A;  3AVK A;  4C8L A;  3NF8 A;  1TL3 A;  1WSG A;  1C0U A;  4KFB A;  3K5N A;  3LWM A;  2OPQ A;  3ZT1 A;  4FJ8 A;  1TVR A;  4AH9 A;  4DTP A;  4JS5 A;  1U48 A;  4NCB A;  4CJ3 A;  3TAB A;  2BDP A;  1IH7 A;  4B3O A;  1YTU A;  4HHT A;  1BCM A;  1KSP A;  3TAP A;  4CFB A;  3KD1 E;  3ZSV A;  2HND A;  3OYI A;  3QEI A;  3ZSZ A;  3ALY A;  3L3U A;  1RTD A;  4B9V A;  4CGF A;  4RW7 A;  3SQ1 A;  1YTA A;  4W5T A;  4CEB A;  1NKB A;  3ZSW A;  4PQU A;  1HYZ A;  3QO9 A;  3KK1 A;  1N6Q A;  3RR7 A;  1MU2 A;  2GUI A;  4NYF A;  3PX6 A;  4KAZ A;  2PYJ A;  3AA3 A;  3MEE A;  4B9T A;  4CF9 A;  4E89 A;  4FLU A;  4M3U A;  3NFA A;  4C8K A;  1J9A A;  4O0I A;  5I3U A;  4IG0 A;  2Z1H A;  4FM1 A;  4OLA A;  1DTT A;  3DMJ A;  5CY4 A;  4IFY A;  3NF9 A;  4CJ4 A;  4CIG A;  3EY1 A;  5JS2 A;  3AV9 A;  4CEO A;  4CGI A;  4I7F A;  3RR8 A;  4G1Q A;  2KZZ A;  3M8Q A;  2JLE A;  4DQI A;  2ZQB A;  3AVH A;  3QES A;  4CHN A;  2AJQ A;  4DLE A;  4KB0 A;  3AVB A;  3QIP A;  2X74 A;  4N41 A;  2FC0 A;  4ELU A;  3C6U A;  3AVJ A;  3VQQ A;  3V4I A;  1U04 A;  4FZX C;  4CE9 A;  3P83 D;  1S1V A;  4XIU A;  3V9Z A;  4DFP A;  4RW6 A;  2O4G A;  2HHW A;  1RNH A;  2KTQ A;  2RF2 A;  4KI4 A;  3LWL A;  2IGI A;  3NH1 A;  2X6N A;  1CZ9 A;  1KLM A;  2HNZ A;  4CF0 A;  3K5L A;  3SUO A;  4CJU A;  1NOZ A;  1ZBU A;  5HRP A;  2XHB A;  3SYZ A;  3SQ2 A;  1TK5 A;  4CHO A;  3LP2 A;  3C94 A;  3HP9 A;  1JL2 A;  3OYF A;  2HHS A;  1W0H A;  5HRO A;  1L5U A;  1SUQ A;  3M8P A;  4PUO A;  3ZSX A;  3CFP A;  2QKK A;  4ELV A;  3C95 A;  4CCH A;  2OZS A;  2KZM A;  4CJR A;  4W5N A;  4Z0U A;  2DFE A;  4CJS A;  3L3V A;  3SCX A;  1XHX A;  3LZJ A;  3QEV A;  4E19 A;  4E3S A;  3S3O A;  4K8Z A;  1ZBF A;  4E7K A;  1EXQ A;  3V9X A;  2Q3S A;  5KI6 A;  1HQE A;  1WNS A;  4CHZ A;  2ZD1 A;  1EKE A;  3AVA A;  3KTQ A;  3ZSQ A;  3MED A;  1GOC A;  3ZT3 A;  4DSE A;  4FJL A;  1N5Y A;  1RDD A;  1NK7 A;  4BE1 A;  3L8B A;  5JS1 A;  4DQP A;  3SPZ A;  4O55 A;  5C24 A;  4JLH A;  4CIE A;  4CFD A;  1DLO A;  5DK5 A;  4HTU A;  4B9N A;  1DTQ A;  4EP5 A;  3K59 A;  2XY5 A;  1XI1 A;  4N76 A;  1J53 A;  2GBZ A;  2A1R A;  1LW2 A;  3AVC A;  1S1X A;  4FM2 A;  4J2A A;  3DM2 A;  1RT2 A;  2YHB A;  3HVT A;  4FLZ A;  1BI4 A;  3OYN A;  3AA5 X;  4FLW A;  2X6S A;  3IAY A;  1EX4 A;  4M42 A;  2KFZ A;  4PA1 A;  4ID5 A;  4CHP A;  1XWL A;  3LAK A;  1TV6 A;  1RDB A;  1LWC A;  2FBV A;  2Z1G A;  4RW8 A;  4ZTF A;  3NF7 A;  1BHL A;  4LY7 A;  3DOL A;  4DFM A;  1S1T A;  1S6Q A;  2XY6 A;  3ZSR A;  3M8S A;  1QTM A;  2WON A;  4CHQ A; 
#chains in the Genus database with same CATH topology
 2EWS A;  4QS7 A;  3O3G A;  1OVQ A;  4FK2 A;  4RWT A;  4CZE A;  4FJG A;  1IKX A;  3IDH A;  5FPD A;  4E7L A;  3FZM A;  2YNI A;  1DKG D;  5I9E B;  4YDU C;  2W6L A;  4JKG A;  1ZBL A;  3AVN A;  3QFU A;  2EHG A;  1ZC6 A;  4DTU A;  1D8Y A;  3V9U A;  3OYK A;  3O08 A;  3KZB A;  1U4B A;  1NOY A;  4OX9 K;  3TSP A;  4OGE A;  4CK1 A;  4BC4 A;  5I42 A;  2UXB K;  1S22 A;  3VET A;  4B08 A;  4CEA A;  3P1G A;  5EVZ A;  2P5O A;  3WEE A;  3OBY A;  5JLH A;  1ZXO A;  3IUC A;  5DMR A;  1EO1 A;  4E0D A;  3AA4 A;  3C7N A;  3M5R A;  4KHQ A;  5M1P A;  1U2V B;  4BQZ A;  1NGF A;  3CCE N;  2QWM A;  1BWF O;  4OPJ A;  1SV5 A;  4DQQ A;  1ATS A;  1SL2 A;  1KFS A;  3LAN A;  4B8C A;  3PIO L;  4DU1 A;  1KRP A;  1WSF A;  2LSN A;  3A5M C;  1OH8 A;  2ITG A;  3LPU A;  2DY4 A;  3U3G A;  1HNX K;  3AY9 A;  4CJQ A;  3B6P A;  2FF6 A;  1T7P A;  4OVL A;  3DOK A;  4IOX A;  1YIT N;  3K0S A;  2YNF A;  4YOV A;  3CPW M;  2E1Y A;  3SLC A;  2VG6 A;  4FM0 A;  3J7A P;  1HNI A;  4CES A;  4M7X A;  3CI5 A;  1GLC G;  1KCF A;  4JK8 A;  4H5V A;  1TYQ B;  3OVN A;  4JKH A;  1C0F A;  3VEW A;  3DLE A;  4FWL A;  4WCE L;  1VQL N;  4LF6 K;  4BR0 A;  4ID1 A;  3RWU A;  3KLH A;  2O8D B;  3EN9 A;  3NCI A;  3KLF A;  4C8N A;  3K57 A;  4IEI A;  4PKG A;  5E26 A;  5AJ3 K;  3KVG A;  1Q18 A;  3HL8 A;  4Z94 A;  1DEJ A;  2NZT A;  4NYN A;  2E2P A;  5AQH A;  1D5A A;  3HM9 A;  4B9M A;  4G9Z A;  1OVY A;  1JLA A;  2V52 B;  4BVP A;  4M45 A;  1KQS M;  3H1Q A;  3CG7 A;  1JLF A;  2Z1J A;  3V9S A;  3IG1 A;  3O8M A;  3OYA A;  3ZT4 A;  3VTI A;  2DFF A;  2QKB A;  2FBT A;  4A5A A;  3LAM A;  5EX5 A;  3O9Q A;  4JNE A;  4H0O A;  5HRS A;  3CCS N;  1YJW N;  4I9Q A;  4X62 K;  1J6Z A;  1XQS C;  4H8K A;  3ITH A;  3TSU A;  4C1N K;  1NKE A;  4Y0W A;  4IO9 L;  1SKR A;  4YOR A;  3H3N O;  1O13 A;  3THX B;  4DTR A;  4OO1 J;  1WAJ A;  2IVP A;  2ETJ A;  3VF4 A;  4YNQ A;  3OYD A;  5JLF A;  1FK9 A;  4Z4G A;  3CF5 L;  3EE9 A;  3KK2 A;  3TAR A;  3G10 A;  3TAF A;  4BRK A;  4CJE A;  4J2E A;  4DQS A;  3L6Q A;  4C8O A;  1RCH A;  3T69 A;  4OKJ A;  2BTF A;  1B9F A;  2V7Z A;  5HBM A;  5BRF A;  4OLB A;  1NG9 A;  2BH1 A;  3VES A;  1C1A A;  2QTD A;  5SWM A;  1W9H A;  1S9E A;  3L2V A;  1RDA A;  4K41 A;  1X3N A;  1KVA A;  2F8T A;  4AM6 A;  4ISE A;  1U47 A;  3AAQ A;  3O5B A;  3VF6 A;  3F5T A;  3J8A A;  4OJR A;  4FPB A;  1K9M O;  1X3M A;  1NWK A;  3VEN A;  3TWH A;  2OAN A;  5KPT A;  2XRI A;  4MQ3 A;  4FWN A;  3K58 A;  4Z4E A;  1NK0 A;  3H08 A;  4N5S A;  2P9I A;  4MO4 A;  2O8B B;  5FLX O;  4LF9 K;  3A5L C;  2O8E B;  4F8R A;  3EKS A;  4R5P A;  3OYG A;  5IWA K;  4CW7 B;  2UXC K;  3CM6 A;  4CJT A;  4KHY A;  3DRP A;  4HTL A;  3BP8 A;  5FRO A;  3A5N C;  3OS2 A;  2YI1 A;  3H3O B;  3IMX A;  3TR8 A;  2GEL A;  5EY4 A;  1JCE A;  4BRQ A;  3OTO K;  5KRS A;  1RGI A;  3CJ7 A;  4FO0 A;  2YCH A;  3E01 A;  4B1X B;  4KB1 A;  3PUF A;  2P9P B;  3VQD A;  2VQF K;  5FPM A;  1HYS A;  4FJM A;  3IS9 A;  3S41 A;  3MAQ A;  4DUY K;  5SZT A;  1L3T A;  4FJK A;  1TUY A;  1JLB A;  5HL7 L;  5TKW A;  2QM1 A;  2NLX A;  4GVM A;  4DTO A;  1R0A A;  5EU7 A;  1XHZ A;  1HYV A;  3UKU A;  1BIU A;  4BR2 A;  4Z4I A;  4CF2 A;  1S3X A;  3QER A;  1U45 A;  2HOE A;  1VSD A;  3DI6 A;  1NGI A;  4HVJ A;  5CZ2 A;  2ZJR L;  3OBW A;  3HT3 A;  5CYM A;  4CZL A;  3K5M A;  1P90 A;  4FJI A;  4BDZ A;  3MEG A;  3ULE B;  4OPK A;  4RG8 A;  1WSE A;  4B1V A;  1RT7 A;  3D2E A;  3F9M A;  3O9T A;  3H45 C;  1LAV A;  4DQ8 A;  1B9D A;  1RBS A;  1C6V A;  3Q7B A;  3TI0 A;  4GV6 A;  2G8F A;  2QA4 N;  5TKY A;  4BRD A;  1IG8 A;  4NXN K;  4CZM A;  4J8F A;  2ATQ A;  2A6A A;  3GG4 A;  3O1B A;  4K8X A;  5AQJ A;  3MMV A;  1E4G T;  2DPN A;  4C8L A;  3NF8 A;  3FGU A;  1WSG A;  3CCQ N;  2QWQ A;  4B3S K;  4M7Y A;  4DTP A;  2BDP A;  5C2F A;  4HHT A;  3TAP A;  4NB4 A;  3ALY A;  3ENB A;  4CGF A;  4RW7 A;  2F7T A;  4X65 K;  3SQ1 A;  5ELZ A;  4JKF A;  4PQU A;  1VQO N;  2GTD A;  5AQV A;  4NYF A;  3LM9 A;  4IDH A;  4H0T B;  5I3U A;  5AQK A;  4H5R A;  4IG0 A;  1QVG M;  2P9S B;  2E20 A;  2IVN A;  5JS2 A;  4CGI A;  3HZ6 A;  3M8Q A;  1GLD G;  3QES A;  4CHN A;  1BUP A;  2O8F A;  4KB0 A;  3QIP A;  4IZ9 A;  2FC0 A;  2Q2R A;  3VQQ A;  1IBK K;  4X64 K;  3P83 D;  1S1V A;  2O4G A;  1XNQ K;  2KTQ A;  2RF2 A;  3OW2 M;  1KLM A;  2HNZ A;  3K5L A;  4CJU A;  2XHB A;  4JN4 A;  3HP9 A;  1S72 N;  5GAE P;  1L5U A;  4PUO A;  4BRP A;  1SUQ A;  3M8P A;  4BR4 A;  2WTU A;  3CFP A;  2QKK A;  3QFP A;  1NGE A;  4CJS A;  1YJ9 N;  2E2Q A;  4E3S A;  2D4W A;  4K8Z A;  1ZBF A;  4U7B A;  4E7K A;  3CCL N;  3V9X A;  2Q3S A;  3NVK A;  1EKE A;  3MED A;  2HHH K;  1RDD A;  1RDW X;  2NRV A;  4O55 A;  1YJN N;  2QWL A;  4CFD A;  4BRN A;  1IJJ A;  5E84 A;  1XI1 A;  3MX2 A;  2GBZ A;  2A1R A;  3DM2 A;  4FLZ A;  3IAY A;  2HF3 A;  1XMQ K;  4IJN A;  4PA1 A;  2OTL N;  1RDB A;  1M1K O;  3KK7 A;  2P9I B;  2PFU A;  4JKA A;  3MWP A;  4ZTF A;  3NF7 A;  4DV2 K;  2E1Z A;  4EFH A;  1S1T A;  1S6Q A;  4LH4 A;  4CHQ A;  2UYT A;  4CIF A;  3QNO A;  4ILG B;  5KRT A;  1NJX A;  3VEY A;  5LMU K;  4FXD A;  4GVE A;  4CK2 A;  1BG3 A;  1VSF A;  3SZ2 A;  5C25 A;  4F3O A;  4FLT A;  3C6T A;  1N6Q A;  1RT3 A;  3JSM A;  1NKC A;  1B92 A;  4I9L A;  1BI4 B;  2YHA A;  4DS5 A;  1T03 A;  4IDK A;  3AAP A;  3NE6 A;  3UIQ A;  1VQ7 N;  1WB9 A;  4NLC A;  3VF2 A;  1HKG A;  4GV3 A;  5C42 A;  1JLE A;  3O6W A;  1MDU B;  3L2R A;  1VSE A;  2XO7 A;  1JCF A;  5KGW A;  1HNV A;  3CCR N;  3K9K A;  3KD5 E;  1VSI A;  3C6A A;  2ZE2 A;  4F4K A;  3D0P A;  4NO7 A;  3U6F A;  3ULE A;  3VQ8 A;  3D2F B;  3AO2 A;  1BCO A;  4H5T A;  4FL9 A;  2Q36 A;  4CBX A;  4CED A;  4EZ9 A;  1BGX T;  5M1N A;  1L3S A;  1RT6 A;  4M3W A;  4NCG A;  4F3T A;  4JKD A;  1X9S A;  1BIS A;  4DKW A;  3EZ5 A;  3CQY A;  2HHU A;  3SUN A;  1EWR A;  3HPG A;  3QDK A;  1IKY A;  1YT3 A;  3UKU B;  2OPP A;  4FWM A;  2QXL A;  5J2Q A;  3VGK A;  4FLV A;  2E88 A;  2E6M A;  3GBT A;  4PKI A;  4AHT A;  4HCC A;  3OYH A;  5C2D A;  1Z6R A;  1VK0 A;  2F4V K;  3V9W A;  3PO4 A;  3B6O A;  2P9L A;  5AQR A;  4KH5 A;  4EZ6 A;  1VSL A;  1Z25 A;  1KVC A;  1F21 A;  2P9P A;  4JEP A;  4KV8 A;  1TL1 A;  3HBT A;  4QAG A;  3SAF A;  3S3M A;  1G99 A;  3UB5 A;  5FRN A;  5LJW A;  1HKC A;  5BPN A;  3FFK B;  5LL6 Z;  2KW4 A;  4M3Y A;  4BC5 A;  5AQS A;  3NGY A;  2Q31 A;  1TAQ A;  3MDQ A;  3CJ1 A;  5HRR A;  4WFA L;  4KHN A;  1N36 K;  4DR4 K;  3DXM B;  1WBD A;  3LDS A;  2HBJ A;  1BDG A;  3SUP A;  3O1W A;  3QB0 A;  4BY9 C;  4FJ5 A;  4JS4 A;  3DLH A;  3GOI A;  4JKE A;  5CYQ A;  4Q5V A;  1RDU A;  3OJU A;  4CFC A;  3D2E B;  1BQN A;  3CM5 A;  3KIO A;  4WFN L;  1S1W A;  1QQO A;  4E1M A;  4FWP A;  4JAX A;  2D1K A;  4W5R A;  4TSX A;  3BDP A;  1ZBH A;  1DGK N;  4DSJ A;  5CR4 A;  3IRX A;  1RIL A;  5AZI A;  4BRM A;  4AQY K;  3VA3 A;  1QVF M;  4O5B A;  3P4I A;  3O4Q A;  5KTQ A;  2RHK A;  3RSE B;  3I56 N;  4CHY A;  3SBG A;  4EP4 A;  4DTJ A;  3PX0 A;  3L2W A;  3QNN A;  3U9Z A;  4ZTJ A;  1ITG A;  4BDP A;  3SNN A;  1IG9 A;  2A3Z A;  4L8R B;  2UUB K;  1EWQ A;  4LF7 K;  5AQM A;  4DV1 K;  3VN5 A;  2KLA A;  4YFU A;  5ADX H;  4A5B A;  3OJS A;  1QQM A;  3AGK A;  3O80 A;  4EHU A;  4ELT A;  5FRM A;  2KHO A;  4CBW A;  4DG1 A;  2W41 A;  1VRT A;  1RT5 A;  1SL0 A;  1VQM N;  4CGJ A;  1ATR A;  3VQ4 A;  1IO2 A;  3FE1 A;  4BR7 A;  4H0P A;  1A5V A;  4EIA A;  1LAW A;  2O4I A;  1JXB A;  3VEX A;  3DLR A;  2YJF A;  3CJA A;  4FK4 A;  1QSL A;  2CGJ A;  3WNF A;  3VQB A;  5EOY A;  4BRE A;  4YOY A;  3TAN A;  3DJC A;  4FYD A;  4BRC A;  4KTZ A;  4BRL A;  1JLG A;  3HOT A;  3AO4 A;  2FSK A;  4QCL A;  2RKI A;  4A57 A;  5AFU A;  3PX4 A;  1RBU A;  3CC7 N;  2CH5 A;  1IKW A;  3PSF A;  3SQ0 A;  1QSS A;  4LSL A;  1O1W A;  4KRE A;  1NK4 A;  1KLN A;  3FZK A;  5BRH A;  1KAZ A;  1JLC A;  1NK9 A;  3HST B;  4GMJ B;  3RRH A;  4E1J A;  3AVL A;  3V6D A;  3SAH A;  4IOC L;  1XMO K;  2KQ2 A;  1DT9 A;  3ULD A;  2E2O A;  3THW B;  3D7E O;  3QML A;  4DV5 K;  3TAM A;  2YV0 X;  4CK3 A;  4U67 L;  5KGX A;  3NMU A;  3CHW A;  4AHR A;  3DRS A;  3HP6 A;  5M1F A;  3MN9 A;  5KPR A;  3CFR A;  4DR5 K;  1W97 L;  4F2S A;  2HBK A;  1IBL K;  4A59 A;  4O4G A;  4Y1C A;  2GUP A;  4MLE A;  1REV A;  4QS9 A;  4LF8 K;  3E1Y A;  1C0G A;  4ICL A;  4WQ4 C;  5AQX A;  3THX A;  3V1Q A;  5AQZ A;  1RBT A;  3LP1 A;  1BA0 A;  2AA4 A;  5LY3 A;  4LF4 K;  3J7Y P;  4IWV A;  3CJ9 A;  4BG8 A;  2WBN A;  1HMV A;  1RBR A;  1WSH A;  5BR9 A;  3VA0 A;  1KVB A;  4B3R K;  4FWO A;  4MDB A;  4B9S A;  3D45 A;  4DTM A;  3RMB A;  4NXM K;  3NBP A;  5GIN A;  4FJH A;  1U2V A;  3BGR A;  3KWI A;  3ASM A;  3L4Q A;  5AQF A;  1A5W A;  2HHQ A;  3N4P A;  4W5Q A;  3LDP A;  2O8C B;  1VSK A;  1WN7 A;  4KKO A;  1R59 O;  4IFV A;  4GW6 A;  1K6Y A;  4L3Q A;  1I94 K;  1OH7 A;  1CLQ A;  3CC2 N;  1K8A O;  1X9J A;  2A41 A;  3QEW A;  2NRR A;  3TAQ A;  2VWK A;  1YVU A;  4ZHR A;  4KBO A;  3TU5 A;  3QIO A;  1VQN N;  1N8R O;  1H1V A;  3A2F A;  1RTJ A;  3CMA N;  3K5O A;  1D9D A;  1UAX A;  4UQG A;  2NRX A;  5AQG A;  3THY B;  1D4X A;  2A1S A;  3TPQ A;  4LFA K;  3BF1 A;  4BQL A;  2QEX N;  1BO5 O;  4DSL A;  4M3Z A;  1RT1 A;  3C65 A;  3IFR A;  5LJV A;  4FJ9 A;  3OYM A;  4GKK K;  3K2P A;  3LL3 A;  3TTD A;  3BZK A;  4FOI A;  1KC8 O;  3ZT1 A;  4DV0 K;  2E5L K;  3THY A;  1TVR A;  4JS5 A;  4CJ3 A;  3TAB A;  3M3Z A;  3K9J A;  3O9U A;  2YHY A;  4I6M A;  3QEI A;  3ZSZ A;  1M90 O;  4DR7 K;  1RTD A;  4FWK A;  4B9V A;  3CCU N;  1NKB A;  3ZSW A;  1HYZ A;  3QO9 A;  3KK1 A;  4JI6 K;  3AAR A;  4KAZ A;  4A2B A;  3AA3 A;  3MEE A;  5AZI B;  4YOX A;  4M3U A;  4FLU A;  3NFA A;  5H1S Q;  2YHX A;  5JVG L;  2ZQB A;  3AVH A;  3ENO A;  4AM7 A;  4ELU A;  3HK2 A;  4CE9 A;  1KAX A;  4DR2 K;  3VEO A;  2VQE K;  3CXC M;  2ASO A;  3R1X A;  3G25 A;  4XEI A;  4BR9 A;  3SUO A;  3BUZ B;  1ZBU A;  1TK5 A;  1NMN A;  3LP2 A;  3EKU A;  3J81 O;  3OYF A;  5AQL A;  4ELV A;  1YXQ A;  1GLJ O;  3C95 A;  2OZS A;  2KZM A;  1NGB A;  3L3V A;  3SCX A;  1HR0 K;  1JJ2 M;  4YOU A;  3QIC A;  4JI4 K;  1WNS A;  3SBT A;  4DV6 K;  3T1H K;  4WFB L;  1N5Y A;  1XC3 A;  1NK7 A;  5AQY A;  5GIP A;  4YHH K;  1VQ4 N;  4JLH A;  3E9O A;  4CIE A;  4DR1 K;  1DLO A;  4HTU A;  1DTQ A;  3K59 A;  2XY5 A;  1LW2 A;  3AVC A;  1S1X A;  4FM2 A;  5B8H A;  1HJO A;  1KXP A;  4FLW A;  1BI4 A;  3WQT A;  3CJC A;  2KFZ A;  1XWL A;  3DXK B;  3LAK A;  1LWC A;  1SS6 A;  3WXL A;  2JWK A;  1BHL A;  4LY7 A;  3DOL A;  3VTH A;  3MK6 A;  4DV7 K;  4O8K A;  1ASV A;  5FPN A;  5GAH P;  1LV5 A;  5M1Q A;  3SK3 A;  3R6M A;  2Q0R A;  4DS4 A;  4H4O A;  3AVM A;  3NF6 A;  2GEM A;  3C6H A;  3UE5 A;  2B5J A;  1Z05 A;  3DYA A;  4JRQ A;  5KPZ A;  1FXX A;  2DTU A;  3RSE A;  1SZ2 A;  3W3D A;  2B4J A;  5JIC A;  3O3H A;  2VGM A;  1QQC A;  5C12 A;  3U9D A;  3VGL A;  3LM2 A;  1MWK A;  2JWL A;  4O0J A;  2PY5 A;  4DU3 A;  4F2R A;  1JL1 A;  3KHY A;  2VYP A;  4CGD A;  4J2D A;  3A5O C;  4B1Y B;  3WXJ A;  3MWT A;  3EYZ A;  4KHS A;  4B1U B;  4JK7 A;  3R8E A;  4MFB A;  3TAE A;  2HBL A;  3VEV A;  2X78 A;  3VQA A;  3BZC A;  5AZJ B;  1Y97 A;  3ENH A;  1TK8 A;  1GLE G;  2PYL A;  5AQO A;  1S6P A;  5BRE A;  4CZJ A;  3PLA A;  4BVO A;  4PWD A;  5ADX A;  1VQK N;  4NCA A;  3ID8 A;  4H5N A;  1NGA A;  3U4L A;  3WQU A;  1ATN A;  4BWM A;  1YF5 L;  2GWK A;  1NU0 A;  4I2P A;  1D9F A;  4A2A A;  3HPO A;  1JLQ A;  2UXD K;  1NJW A;  3KLI A;  2ZF5 O;  4YOW A;  3Q7C A;  4FZY A;  2J4R A;  4OGC A;  4FWS A;  1KFD A;  1Y64 A;  1ASW A;  1LW0 A;  5C15 A;  1U49 A;  3WUH A;  2G8H A;  5AR0 A;  5BPL A;  3I8D A;  4DSF A;  4AHV A;  2QWO A;  4FCY A;  4IOA L;  2ASM A;  3HXM A;  1RTH A;  4FZZ A;  4Z4F A;  1GLF O;  5C0Y A;  3NH0 A;  1T3V A;  1YHQ N;  1JCG A;  3VQ5 A;  3O3F A;  2YNH A;  4KHW A;  3T1Y K;  4B1Z A;  2PAV A;  1BIZ A;  5BN9 A;  3L2Q A;  4B9Q A;  1W7A A;  2O8C A;  2NUB A;  3D2F A;  1P8Z A;  3THW A;  2Q1N A;  3VQC A;  3EL2 A;  2VGN A;  4JI5 K;  3SJJ A;  1S9G A;  3DAW A;  2FSN A;  1T6C A;  3HYF A;  3F73 A;  4CJV A;  4CZH A;  1TKT A;  1HKB A;  2G8W A;  1RDC A;  4KRF A;  2HW3 A;  1TGO A;  1T05 A;  2P9L B;  4OKE A;  3OYE A;  3G71 N;  1S5J A;  1WSJ A;  2VWJ A;  4B8A B;  3NAE A;  3HO1 A;  4BDY A;  2V51 B;  3M8R A;  4DWI A;  2P51 A;  1QS4 A;  5KQD A;  2ZGY A;  1HQU A;  5F2R A;  1TKZ A;  2VG5 A;  2P9U B;  2G8U A;  3KK3 A;  2R7Y A;  4GV9 A;  2IVO A;  3MEC A;  4ILJ A;  1I39 A;  3O9S A;  3TSQ A;  2QW9 A;  2HMI A;  2I7P A;  1MWM A;  4K43 A;  3PV8 A;  4JKC A;  3I8B A;  1OH5 A;  3HTV A;  5E41 A;  4H03 B;  4AHU A;  4YOT A;  1HNW K;  4M3R A;  1HNZ K;  3SMP A;  2D0C A;  4GNI A;  4HUE A;  1X9M A;  1Q9Y A;  4FJX A;  1VHX A;  3HJF A;  4DB3 A;  3OYC A;  4R79 A;  3NDK A;  3FFI A;  3WNG A;  4K25 A;  3CJB A;  1CXU A;  2E6L A;  4JYA K;  1G15 A;  3H46 O;  4H0Y B;  3VMF B;  2P9N B;  3OHR A;  4CZI A;  2AP1 A;  4RTF D;  5CZ1 A;  1NGG A;  4KO0 A;  3NGI A;  4BGA A;  1ZBI A;  3KJV A;  4JI0 K;  3AO3 A;  2QWP A;  3NVM A;  4MDA A;  4AF1 A;  1TKD A;  1FKO A;  4CZF A;  1WUA A;  1NGH A;  4BRH A;  4IG3 A;  3SAG A;  1VQ5 N;  2Q0U A;  2W42 A;  3A0I X;  3I33 A;  2O8F B;  3DXM A;  3QEX A;  4HUG A;  1NJY A;  3T19 A;  4LF5 K;  3RMC A;  2E2N A;  3FZF A;  2QWR A;  4N47 A;  4DTX A;  2RE2 A;  3MXJ A;  2WFB A;  2HMP A;  1UA1 A;  3LDL A;  1S1U A;  2OCE A;  3E9L A;  3AA2 A;  5J2N A;  3SQ4 A;  2HB5 A;  4CEQ A;  4CEE A;  1TKX A;  1BQM A;  4FWR A;  3FLC O;  5M1K A;  2Z1I A;  3BY5 A;  3S3N A;  3CIP A;  3TAG A;  3RVC A;  1BU6 O;  3HSC A;  3DLL L;  3NH2 A;  3QEP A;  3BF3 A;  1NM1 A;  3T3F A;  1JXE A;  1GOA A;  4LH5 A;  3SV3 A;  3M6G A;  2P9K B;  4Q0B A;  4BWJ A;  4CJ7 A;  1V4T A;  2RPI A;  5K14 A;  2GWJ A;  2EX3 A;  4MLH A;  3TTF A;  3CCJ N;  2E4L A;  3QIN A;  5J2M A;  2YKN A;  3G0Z A;  1NLV A;  5D3G A;  2QWN A;  1L3U A;  1K73 O;  3IKM A;  4JK9 A;  4WQ5 A;  4F9O A;  4BRG A;  3L0Q A;  5GAD P;  3DLG A;  1V4S A;  1Q7Y O;  4JRP A;  1SAZ A;  2Q97 A;  4PY5 A;  1EQY A;  4FPA A;  3ZX3 A;  2CH6 A;  2I5J A;  4MO5 A;  2OZM A;  4QOZ B;  4JD2 A;  3JXU A;  2FBX A;  1UWB A;  5HP1 A;  3LP3 A;  1TAU A;  3F9K A;  1ILY A;  3NGZ A;  4AHC A;  1GLB G;  4JI2 K;  2YNG A;  1HLU A;  4WQ5 C;  2Y1J A;  1IKV A;  3ATU A;  5MLC Q;  2OPR A;  1WAF A;  1BA1 A;  4LFB K;  2XY7 A;  4KTQ A;  2HNY A;  1C0M A;  4DR6 K;  4OPA A;  4LSN A;  4CI6 A;  3OS0 A;  4CFA A;  4C8M A;  1VSJ A;  3U3Y A;  4RW4 A;  3H1V X;  1J5E K;  1HPZ A;  2NRW A;  1SKW A;  5HRN A;  5J2P A;  3UKR B;  4C1N I;  2P9U A;  3ISN C;  5AQN A;  4FVU A;  1RBV A;  4KH4 A;  3VEZ A;  3OS1 A;  3OYL A;  3WXM B;  2IC3 A;  4RW9 A;  3AVK A;  4JKB A;  4GY2 B;  1C0U A;  4KFB A;  2OPQ A;  2UUC K;  4DCH A;  1IH7 A;  4B3O A;  4YDU A;  1YTU A;  1BCM A;  1XNR K;  1KSP A;  3KD1 E;  3P31 A;  1QZ5 A;  4CVN E;  1Q82 O;  1LCU A;  4BRF A;  3H6E A;  3P39 A;  3T7Z A;  3E9P A;  1WOQ A;  1MU2 A;  2KKZ A;  3PX6 A;  2PYJ A;  3W0L A;  4C8K A;  4DHY A;  4O0I A;  4XH4 A;  1IV0 A;  2Z1H A;  2D0O A;  2ITM A;  3R9P A;  3CCV N;  1U6Z A;  4CJ4 A;  4CIG A;  3ZEU B;  3EY1 A;  3PSI A;  4CEO A;  1E4F T;  3B8A X;  3RR8 A;  2KZZ A;  2JLE A;  4DQI A;  4DLE A;  3AVB A;  2X74 A;  4N41 A;  3C6U A;  3HI0 A;  4FZX C;  4JV5 K;  1U04 A;  3V9Z A;  4DFP A;  4JI1 K;  4KI4 A;  3LWL A;  2X6N A;  4CF0 A;  3P38 A;  4DV3 K;  5LMN K;  4WQ4 A;  5HRP A;  3SYZ A;  3SQ2 A;  4JI8 K;  4CHO A;  1NGJ A;  3C94 A;  4X66 K;  1JL2 A;  2HHS A;  1W0H A;  5HRO A;  1N34 K;  5AQP A;  3LDQ A;  4ISF A;  4CCH A;  1VAZ A;  4CJR A;  4W5N A;  4Z0U A;  3ZEU A;  3QEV A;  1TYQ A;  4E19 A;  3S3O A;  4I6M B;  5KI6 A;  5A2Q O;  2ZD1 A;  3AVA A;  1VQ9 N;  3ZSQ A;  3KTQ A;  3ZT3 A;  4DSE A;  4FJL A;  4BE1 A;  3L8B A;  5JS1 A;  5CHI A;  4H0V B;  3SPZ A;  5C24 A;  1KAY A;  1T44 A;  1NGD A;  4B9N A;  1N32 K;  1J53 A;  4J2A A;  3HVT A;  2YHB A;  3AA5 X;  1OH6 A;  2X6S A;  1EX4 A;  4M42 A;  4DUZ K;  3QBX A;  2W6K A;  3KWG A;  3CME N;  4CHP A;  1TV6 A;  2FBV A;  4JKG B;  3ID6 A;  2YJE A;  2Z1G A;  3A8Y A;  4RW8 A;  1VQP N;  5GIO A;  1N33 K;  1QTM A;  5DM7 L;  2WON A;  3J7Z O;  2HF4 A;  4CJ5 A;  4IFE A;  4CJF A;  2OTJ N;  2F9W A;  3ZSY A;  1MA9 B;  2HVI A;  2IIR A;  3JYT A;  4Y1D A;  2YHW A;  4FOE A;  3CPE A;  1NK6 A;  1XUP O;  3HVR A;  4CJP A;  2VCP A;  4NCB A;  2P9S A;  3CQX A;  3JAM O;  3C0B A;  2OA8 A;  2GX9 A;  3SI6 A;  4B3T K;  4M3T A;  3LAL A;  4DTN A;  2VG7 A;  2CGL A;  3HPH A;  1NK8 A;  2IS3 A;  4PKH A;  3HOS A;  4FLY A;  3L2U A;  1YUW A;  5HLF A;  2HHX A;  2NRT A;  4DMN A;  3SUQ A;  3RRG A;  4FJ7 A;  2JGU A;  1XC9 A;  3O4N A;  5AQU A;  1C1B A;  2P5G A;  2NRZ A;  2IAJ A;  1J54 A;  4CZK A;  4HUF A;  2BUP A;  2G8K A;  4V19 S;  2D0A A;  4FSV A;  1NK5 A;  5FDL A;  4CJW A;  1LWF A;  4Z4H A;  4WYB A;  1FJG K;  3SPY A;  2W40 A;  4FJJ A;  4CEZ A;  4XH5 A;  3ZT2 A;  4W5O A;  2HST A;  3WNE A;  4M41 A;  3ZLJ A;  3VQP A;  3J80 O;  3I55 N;  3EZW A;  4LD0 A;  4FK0 A;  3MCP A;  4FLX A;  3CCM N;  2Y1I A;  2A5X A;  4H4M A;  4KI6 A;  4E1N A;  3T1A A;  2UUA K;  4HCB A;  1CZB A;  1T8E A;  3P5J A;  3SV4 A;  3MXM A;  1UA0 A;  3HM8 A;  2D5R A;  5AQW A;  4GKJ K;  4JD2 B;  1ZBS A;  4KHU A;  3NHG A;  3FZH A;  4DSI A;  4DTS A;  1CZA N;  1QE1 A;  4IBN A;  2BE2 A;  4B1W B;  3THV A;  3ZSO A;  4FJN A;  3OYB A;  2QK9 A;  2O8E A;  5C10 A;  5AQI A;  4CD3 A;  3G6E N;  2UU9 K;  4BC3 A;  1WLJ A;  5BRD A;  2FF3 B;  2FXU A;  5EXW A;  1TK0 A;  3CYM A;  3AO1 A;  3QBW A;  2QXF A;  2F8S A;  4KPY A;  1VSM A;  4E7J A;  4BRI A;  3RMD A;  4BE2 A;  4C23 A;  1E3M A;  1EET A;  1Q9X A;  3KLG A;  4DSK A;  5JVH L;  5AQQ A;  3GDQ A;  4CEF A;  3DLK A;  1WBB A;  2QI2 A;  1NMD A;  3WEE B;  4CGG A;  1NBW A;  3R3L A;  2BGG A;  1GOB A;  2ZJP L;  4CZG A;  1RT4 A;  4CBU A;  4HWI A;  4N56 A;  2FSJ A;  5M1O A;  3ZCM A;  4PL7 A;  5T7B A;  4B9L A;  2OYQ A;  3FZL A;  1RTI A;  3G4S N;  2A42 A;  3WT0 A;  4JI3 K;  4Z4C A;  2WC9 A;  2XY8 A;  4DR3 K;  2B6A A;  2PZS A;  3O9R A;  3OA9 A;  2IOC A;  1KTQ A;  1YIJ N;  1L3V A;  1QZ6 A;  4NLB A;  2GV9 A;  4KH6 A;  2CGK A;  4FW2 A;  3KKS A;  4EAH D;  1EP4 A;  2RN2 A;  2NRH A;  3ZET B;  5KQ8 A;  3V1O A;  4CJL A;  3E66 A;  4BE0 A;  4I2Q A;  3VQE A;  1CXQ A;  1VRU A;  3LZI A;  1Z26 A;  4FVM A;  3AVG A;  4OPH A;  1SL1 A;  3CER A;  1W2B M;  3QET A;  1NGC A;  3M1F A;  3SMS A;  3TTC A;  3BEX A;  2P1J A;  2O8B A;  4O5F A;  4BR5 A;  4IEE A;  3V81 A;  3DRR A;  2DFH A;  2BAN A;  3LPT A;  3I0S A;  3SJH A;  3UKR A;  1OKJ A;  1VSH A;  4A61 A;  4BG9 A;  4OKK A;  1C1C A;  1QHA A;  4EHT A;  3ZX0 A;  4KHP K;  1A5X A;  1X1P A;  2G8V A;  3OYJ A;  3O4W A;  1LWE A;  1C0T A;  2F96 A;  4O8U A;  3F2K A;  3WXK A;  4JI7 K;  2G8I A;  3MN7 A;  1NJZ A;  4DFK A;  1Q8I A;  2ZWH A;  1ZYQ A;  3RMA A;  4M63 C;  3MXI A;  4DFJ A;  1X9W A;  4AIL C;  2H3G X;  1RFQ A;  1JKH A;  3DXK A;  3GE1 A;  1HJR A;  3KLE A;  4M3X A;  1QSY A;  2HHV A;  3VQ9 A;  1FKP A;  1K8K B;  1YI2 N;  4JHD B;  3I0R A;  3CD6 N;  3WNH A;  3FR0 A;  1ESV A;  4CER A;  3D6R A;  4DLG A;  3QLH A;  4AHS A;  2ZGZ A;  5F1X A;  4CF1 A;  3AO5 A;  3MX5 A;  4A62 A;  3DLB A;  3VQ7 A;  4K42 A;  4PHT X;  3L4I A;  2YKM A;  2WOM A;  1K8K A;  1J5O A;  2HVH A;  2HHT A;  4CGH A;  2IDO A;  3MCA B;  3OY9 A;  4DQR A;  3VQ6 A;  3ZT0 A;  1SQK A;  3EO3 A;  2V7Y A;  4CEC A;  1HUX A;  3AVF A;  3AVI A;  3VER A;  3N4Q A;  2O8D A;  1HRH A;  2D0B A;  4UY8 O;  4PL8 A;  1IBM K;  1HX1 A;  5F0X A;  1WSI A;  1Q81 O;  2YX6 A;  4ILH A;  1ASU A;  1VQ6 N;  3LDN A;  3RTV A;  3LP0 A;  1HPM A;  1BOT O;  2PBD A;  1SKS A;  1YVN A;  3CC4 N;  4CJK A;  2I7N A;  3CQ8 A;  2P9K A;  4FW1 A;  3S9H A;  4XH1 A;  1UOC A;  4J2B A;  3KKR A;  4E7H A;  2D0P A;  4DU4 A;  4DF4 A;  1GLA G;  1LOT B;  3MN5 A;  2FBY A;  3DWL A;  2ZJQ L;  1QHT A;  3ZET A;  4CF8 A;  2OPS A;  5J1E A;  1KD1 O;  3HRG A;  3PO5 A;  4RCH A;  4IO8 A;  4B9U A;  3JS6 A;  4WE1 A;  5BN8 A;  3VPZ A;  4BAC A;  4DF8 A;  4E7I A;  2FLO A;  2F9T A;  3CFO A;  3PY8 A;  4O44 A;  3V1R A;  2KFN A;  4BRA A;  4H5W A;  4KTW A;  5HOO A;  1TUU A;  2HBM A;  3CET A;  1I3A A;  5AFU H;  1BL3 A;  4IXC A;  4BRO A;  4IKF A;  4IJA A;  1TL3 A;  3K5N A;  1QQN A;  3LWM A;  4FJ8 A;  2NNW A;  3AGR A;  4AH9 A;  3EE8 A;  1U48 A;  3C7N B;  4BC2 A;  4H0X B;  4CFB A;  5JMV A;  3ZSV A;  2HND A;  3OYI A;  4CD1 A;  5CE3 A;  3EEQ A;  3L3U A;  1NJI O;  1Q86 O;  1YTA A;  4BGB A;  4W5T A;  4CEB A;  3RR7 A;  2GUI A;  2A40 A;  1NNE A;  3PIP L;  4B9T A;  4CF9 A;  4E89 A;  1J9A A;  5AQT A;  4FM1 A;  4OLA A;  1DTT A;  3DMJ A;  5CY4 A;  4IFY A;  1FW6 A;  3NF9 A;  2E8A A;  3ATV A;  3WXI A;  2ZM6 K;  3MN6 A;  3AV9 A;  4I7F A;  4G1Q A;  5AZJ A;  2AJQ A;  1VQ8 N;  3ZYY X;  4DV4 K;  2P9N A;  3AVJ A;  3V4I A;  5DM6 L;  4XIU A;  4RW6 A;  2HHW A;  4LFC K;  1RNH A;  2IGI A;  4ISG A;  1CZ9 A;  3NH1 A;  4FWQ A;  1NOZ A;  3U8X A;  3ZSX A;  4YY3 K;  4JHD A;  2DFE A;  1XHX A;  3LZJ A;  1EXQ A;  5FPE A;  4CHZ A;  1HQE A;  4LC9 B;  3VGM A;  1YAG A;  1GOC A;  2WUS A;  4DQP A;  3LDO A;  5IT9 O;  5DK5 A;  4EP5 A;  1T6D A;  4N76 A;  4QS8 A;  1RT2 A;  2ASP A;  4WF9 L;  3OYN A;  3ZX2 A;  4ID5 A;  5BR8 K;  4B3M K;  1GLL O;  5GAG P;  3GL1 A;  4K0K K;  5BPM A;  4DFM A;  2XY6 A;  2VWB A;  3ZSR A;  3VOV A;  3M8S A; 
#chains in the Genus database with same CATH homology
 4CIF A;  3O3G A;  1LV5 A;  4FK2 A;  4CJ5 A;  3QNO A;  4FJG A;  4CJF A;  1IKX A;  4E7L A;  5KRT A;  1NJX A;  2YNI A;  4FXD A;  4DS4 A;  4CK2 A;  3ZSY A;  1VSF A;  2HVI A;  4H4O A;  3AVM A;  3JYT A;  3NF6 A;  3SZ2 A;  5C25 A;  4F3O A;  4FLT A;  3C6T A;  3AVN A;  4Y1D A;  1RT3 A;  2B5J A;  3JSM A;  1ZBL A;  1NKC A;  1B92 A;  1NK6 A;  4I9L A;  1BI4 B;  2YHA A;  2EHG A;  3DYA A;  4CJP A;  3HVR A;  4JRQ A;  4IDK A;  3NE6 A;  4DS5 A;  1T03 A;  1FXX A;  3UIQ A;  4DTU A;  1D8Y A;  2DTU A;  3V9U A;  3OYK A;  1NOY A;  2OA8 A;  1U4B A;  2B4J A;  3O3H A;  3SI6 A;  5C42 A;  1JLE A;  4M3T A;  3L2R A;  1VSE A;  1ASV A;  1QQC A;  3LAL A;  4DTN A;  4OGE A;  2XO7 A;  5KGW A;  2VG7 A;  4CK1 A;  1HNV A;  5I42 A;  3HPH A;  1NK8 A;  2IS3 A;  3KD5 E;  1VSI A;  4FLY A;  2ZE2 A;  4O0J A;  3L2U A;  2PY5 A;  3D0P A;  4F4K A;  4DU3 A;  4B08 A;  4CEA A;  1JL1 A;  3P1G A;  3VQ8 A;  3U6F A;  5HLF A;  4F2R A;  2HHX A;  3AO2 A;  4CGD A;  4DMN A;  1BCO A;  4J2D A;  3SUQ A;  3RRG A;  4FJ7 A;  2P5O A;  2JGU A;  3EYZ A;  4CED A;  4EZ9 A;  4KHS A;  1XC9 A;  1BGX T;  3O4N A;  4MFB A;  3TAE A;  1L3S A;  5DMR A;  1C1B A;  4E0D A;  1RT6 A;  4M3W A;  3AA4 A;  4NCG A;  4F3T A;  4KHQ A;  2P5G A;  2X78 A;  1X9S A;  2IAJ A;  3VQA A;  1J54 A;  4HUF A;  1BIS A;  1Y97 A;  3EZ5 A;  2HHU A;  3SUN A;  2G8K A;  4OPJ A;  1SV5 A;  2D0A A;  3HPG A;  4DQQ A;  1TK8 A;  1NK5 A;  5FDL A;  1IKY A;  1LWF A;  1YT3 A;  4CJW A;  4Z4H A;  2PYL A;  2OPP A;  1SL2 A;  1KFS A;  5J2Q A;  4FLV A;  3LAN A;  2E6M A;  4B8C A;  3SPY A;  4FJJ A;  4CEZ A;  4DU1 A;  1WSF A;  1KRP A;  2LSN A;  4AHT A;  3ZT2 A;  4HCC A;  1S6P A;  4W5O A;  3OYH A;  3WNE A;  2ITG A;  4M41 A;  3LPU A;  2DY4 A;  3VQP A;  4PWD A;  1VK0 A;  4LD0 A;  4FK0 A;  3U3G A;  4CJQ A;  3V9W A;  4NCA A;  3B6P A;  3B6O A;  4FLX A;  3PO4 A;  2Y1I A;  4H4M A;  4EZ6 A;  1VSL A;  1T7P A;  1Z25 A;  1KVC A;  1F21 A;  4KV8 A;  4OVL A;  4KI6 A;  3DOK A;  4E1N A;  4BWM A;  1TL1 A;  3T1A A;  4HCB A;  4I2P A;  1D9F A;  1CZB A;  4QAG A;  3HPO A;  3P5J A;  1JLQ A;  2YNF A;  3SV4 A;  3MXM A;  1UA0 A;  1T8E A;  1NJW A;  3S3M A;  2D5R A;  3KLI A;  4FZY A;  5FRN A;  2VG6 A;  4FM0 A;  4OGC A;  1KFD A;  1HNI A;  1ASW A;  2KW4 A;  4CES A;  4KHU A;  4M3Y A;  1LW0 A;  3NHG A;  1KCF A;  4DSI A;  4DTS A;  1U49 A;  3NGY A;  1QE1 A;  3OVN A;  2BE2 A;  4IBN A;  3THV A;  1TAQ A;  3ZSO A;  2G8H A;  4FJN A;  5HRR A;  4KHN A;  3OYB A;  3I8D A;  2QK9 A;  3DLE A;  3LDS A;  4DSF A;  4AHV A;  1WLJ A;  3SUP A;  4FCY A;  4Z4F A;  3HXM A;  1RTH A;  4FZZ A;  3NH0 A;  4FJ5 A;  4ID1 A;  1TK0 A;  3CYM A;  3AO1 A;  4JS4 A;  3RWU A;  3HK2 A;  2QXF A;  3KLH A;  3VQ5 A;  3NCI A;  3KLF A;  3DLH A;  2F8S A;  3O3F A;  5CYQ A;  4KPY A;  1VSM A;  4C8N A;  2YNH A;  4Q5V A;  4BE2 A;  3K57 A;  4E7J A;  3RMD A;  4KHW A;  3OJU A;  1EET A;  4CFC A;  1BQN A;  1Q9X A;  3CM5 A;  3KLG A;  4LH4 A;  3KIO A;  4DSK A;  1S1W A;  3HL8 A;  1BIZ A;  4CEF A;  4E1M A;  3DLK A;  4NYN A;  4W5R A;  3L2Q A;  1D5A A;  4CGG A;  3HM9 A;  4B9M A;  4TSX A;  3BDP A;  2NUB A;  1ZBH A;  2BGG A;  1GOB A;  4DSJ A;  1JLA A;  1RT4 A;  4N56 A;  3IRX A;  1RIL A;  4M45 A;  3VQC A;  3CG7 A;  1JLF A;  2Z1J A;  3ZCM A;  3V9S A;  3IG1 A;  5T7B A;  3VA3 A;  3SJJ A;  3OYA A;  3ZT4 A;  4O5B A;  2OYQ A;  4B9L A;  3O4Q A;  1S9G A;  5KTQ A;  1RTI A;  2DFF A;  2QKB A;  2FBT A;  3F73 A;  3HYF A;  4CJV A;  4CHY A;  4EP4 A;  3LAM A;  1TKT A;  4Z4C A;  4DTJ A;  2G8W A;  1RDC A;  4KRF A;  2HW3 A;  3PX0 A;  1TGO A;  1T05 A;  5HRS A;  3L2W A;  4OKE A;  3QNN A;  3OYE A;  4I9Q A;  4ZTJ A;  1ITG A;  2XY8 A;  4BDP A;  3SNN A;  1S5J A;  1IG9 A;  1WSJ A;  4H8K A;  3ITH A;  2VWJ A;  4L8R B;  2B6A A;  1NKE A;  4B8A B;  3NAE A;  3HO1 A;  2PZS A;  2IOC A;  1KTQ A;  4BDY A;  1SKR A;  1L3V A;  3VN5 A;  3M8R A;  4DTR A;  2GV9 A;  1WAJ A;  4DWI A;  2P51 A;  4YFU A;  1QS4 A;  2ETJ A;  4FW2 A;  3KKS A;  4YNQ A;  3OYD A;  3OJS A;  1HQU A;  5FRM A;  1EP4 A;  2RN2 A;  1TKZ A;  1FK9 A;  2VG5 A;  2G8U A;  4ELT A;  3KK3 A;  2R7Y A;  4DG1 A;  4Z4G A;  3V1O A;  1VRT A;  4CJL A;  3MEC A;  1RT5 A;  3KK2 A;  1SL0 A;  1I39 A;  4BE0 A;  4CGJ A;  3TAR A;  3G10 A;  3TAF A;  4I2Q A;  3VQE A;  2HMI A;  1CXQ A;  3VQ4 A;  1IO2 A;  1VRU A;  3PV8 A;  4CJE A;  3LZI A;  4J2E A;  1A5V A;  1Z26 A;  4FVM A;  5E41 A;  3AVG A;  4DQS A;  1LAW A;  4C8O A;  4AHU A;  1RCH A;  1JXB A;  2O4I A;  3DLR A;  4OKJ A;  4M3R A;  1SL1 A;  4FK4 A;  1B9F A;  1QSL A;  2D0C A;  4HUE A;  1X9M A;  1Q9Y A;  4FJX A;  3QET A;  3WNF A;  3VQB A;  3HJF A;  5HBM A;  4OLB A;  2P1J A;  3OYC A;  3V81 A;  3DRR A;  3NDK A;  3TAN A;  3FFI A;  3WNG A;  1C1A A;  5SWM A;  1W9H A;  1S9E A;  4FYD A;  1CXU A;  2DFH A;  2BAN A;  2E6L A;  1RDA A;  4KTZ A;  3L2V A;  1JLG A;  1KVA A;  3AO4 A;  3LPT A;  2F8T A;  3I0S A;  1G15 A;  1VSH A;  4OKK A;  1C1C A;  4QCL A;  2RKI A;  1U47 A;  3PX4 A;  1RBU A;  5CZ1 A;  1A5X A;  1X1P A;  1IKW A;  4OJR A;  3OYJ A;  2G8V A;  1QSS A;  3SQ0 A;  4KO0 A;  3NGI A;  1ZBI A;  1LWE A;  1C0T A;  3KJV A;  2F96 A;  4LSL A;  1O1W A;  4KRE A;  1NK4 A;  3AO3 A;  1KLN A;  3TWH A;  2G8I A;  2XRI A;  4MQ3 A;  1NJZ A;  4DFK A;  1NK9 A;  1JLC A;  3HST B;  1TKD A;  4GMJ B;  1FKO A;  3RRH A;  1Q8I A;  1ZYQ A;  3RMA A;  3K58 A;  3AVL A;  4IG3 A;  3H08 A;  3V6D A;  1NK0 A;  4Z4E A;  4N5S A;  3MXI A;  2KQ2 A;  4DFJ A;  3ULD A;  2W42 A;  1X9W A;  4AIL C;  3TAM A;  2YV0 X;  4CK3 A;  1JKH A;  4HUG A;  3QEX A;  3T19 A;  1HJR A;  5KGX A;  4R5P A;  3OYG A;  3KLE A;  1NJY A;  4M3X A;  1QSY A;  3RMC A;  2HHV A;  3CM6 A;  3VQ9 A;  4CJT A;  4N47 A;  1FKP A;  4DTX A;  3MXJ A;  3DRP A;  4AHR A;  4KHY A;  5FRO A;  3DRS A;  3HP6 A;  3OS2 A;  1UA1 A;  3I0R A;  3WNH A;  1S1U A;  4CER A;  4DLG A;  3CFR A;  3AA2 A;  5J2N A;  4F2S A;  3SQ4 A;  2HB5 A;  4O4G A;  4Y1C A;  3TR8 A;  4CEE A;  1TKX A;  4CEQ A;  3QLH A;  4AHS A;  1BQM A;  1REV A;  3AO5 A;  4CF1 A;  5KRS A;  2HHT A;  3E01 A;  2Z1I A;  3DLB A;  3VQ7 A;  3S3N A;  4KB1 A;  3PUF A;  4ICL A;  3TAG A;  3VQD A;  2YKM A;  2WOM A;  3NH2 A;  3V1Q A;  3QEP A;  1J5O A;  1RBT A;  3LP1 A;  2IDO A;  4CGH A;  1HYS A;  2HVH A;  3T3F A;  1JXE A;  1GOA A;  3IS9 A;  4LH5 A;  3OY9 A;  3SV3 A;  4FJM A;  4DQR A;  3MAQ A;  3VQ6 A;  4Q0B A;  4BWJ A;  3ZT0 A;  5SZT A;  1L3T A;  4CEC A;  3AVF A;  1HMV A;  4FJK A;  1RBR A;  2RPI A;  1JLB A;  3AVI A;  1WSH A;  5K14 A;  4GVM A;  2EX3 A;  1HRH A;  2D0B A;  2E4L A;  4DTO A;  1R0A A;  3QIN A;  3VA0 A;  5EU7 A;  2YKN A;  5J2M A;  3G0Z A;  1XHZ A;  5D3G A;  1WSI A;  1L3U A;  1HYV A;  1ASU A;  1BIU A;  1KVB A;  3RTV A;  3LP0 A;  4Z4I A;  4B9S A;  4CF2 A;  3D45 A;  3QER A;  4DTM A;  3RMB A;  1U45 A;  1VSD A;  3DI6 A;  3NBP A;  4HVJ A;  1SKS A;  4CJK A;  3DLG A;  4F8R A;  3CQ8 A;  4FJH A;  3BGR A;  5CZ2 A;  3ASM A;  4FW1 A;  4JRP A;  1A5W A;  2HHQ A;  4W5Q A;  3HT3 A;  3S9H A;  4PY5 A;  5CYM A;  1VSK A;  1WN7 A;  4KKO A;  1UOC A;  3K5M A;  4IFV A;  4GW6 A;  4J2B A;  1K6Y A;  3KKR A;  4FJI A;  4BDZ A;  3MEG A;  2I5J A;  1CLQ A;  2OZM A;  4E7H A;  4OPK A;  4QOZ B;  4RG8 A;  4DU4 A;  1WSE A;  4DF4 A;  2FBX A;  1RT7 A;  1UWB A;  3QEW A;  5HP1 A;  3LP3 A;  1TAU A;  3F9K A;  1LAV A;  1B9D A;  3TAQ A;  1RBS A;  2FBY A;  3NGZ A;  1C6V A;  4AHC A;  2VWK A;  1QHT A;  1YVU A;  2YNG A;  2OPS A;  4CF8 A;  4ZHR A;  5J1E A;  2Y1J A;  3TI0 A;  1IKV A;  3PO5 A;  3QIO A;  4B9U A;  2G8F A;  2OPR A;  3A2F A;  4WE1 A;  4BAC A;  4DF8 A;  1WAF A;  4E7I A;  1RTJ A;  2XY7 A;  4KTQ A;  2HNY A;  1C0M A;  3K5O A;  1D9D A;  1UAX A;  4LSN A;  4UQG A;  3OS0 A;  4CFA A;  4C8M A;  1VSJ A;  3CFO A;  3U3Y A;  4O44 A;  2A1S A;  3PY8 A;  4RW4 A;  3V1R A;  2KFN A;  1HPZ A;  2ATQ A;  1SKW A;  4KTW A;  5HRN A;  5J2P A;  4DSL A;  4M3Z A;  3ISN C;  1RT1 A;  1RBV A;  1I3A A;  4K8X A;  3OS1 A;  3OYL A;  3OYM A;  4FJ9 A;  1BL3 A;  2IC3 A;  3K2P A;  4RW9 A;  4IKF A;  3AVK A;  4C8L A;  3NF8 A;  1TL3 A;  1WSG A;  1C0U A;  4KFB A;  3K5N A;  3LWM A;  2OPQ A;  3ZT1 A;  4FJ8 A;  1TVR A;  4AH9 A;  4DTP A;  4JS5 A;  1U48 A;  4NCB A;  4CJ3 A;  3TAB A;  2BDP A;  1IH7 A;  4B3O A;  1YTU A;  4HHT A;  1BCM A;  1KSP A;  3TAP A;  4CFB A;  3KD1 E;  3ZSV A;  2HND A;  3OYI A;  3QEI A;  3ZSZ A;  3ALY A;  3L3U A;  1RTD A;  4B9V A;  4CGF A;  4RW7 A;  3SQ1 A;  1YTA A;  4W5T A;  4CEB A;  1NKB A;  3ZSW A;  4PQU A;  1HYZ A;  3QO9 A;  3KK1 A;  1N6Q A;  3RR7 A;  1MU2 A;  2GUI A;  4NYF A;  3PX6 A;  4KAZ A;  2PYJ A;  3AA3 A;  3MEE A;  4B9T A;  4CF9 A;  4E89 A;  4FLU A;  4M3U A;  3NFA A;  4C8K A;  1J9A A;  4O0I A;  5I3U A;  4IG0 A;  2Z1H A;  4FM1 A;  4OLA A;  1DTT A;  3DMJ A;  5CY4 A;  4IFY A;  3NF9 A;  4CJ4 A;  4CIG A;  3EY1 A;  5JS2 A;  3AV9 A;  4CEO A;  4CGI A;  4I7F A;  3RR8 A;  4G1Q A;  2KZZ A;  3M8Q A;  2JLE A;  4DQI A;  2ZQB A;  3AVH A;  3QES A;  4CHN A;  2AJQ A;  4DLE A;  4KB0 A;  3AVB A;  3QIP A;  2X74 A;  4N41 A;  2FC0 A;  4ELU A;  3C6U A;  3AVJ A;  3VQQ A;  3V4I A;  1U04 A;  4FZX C;  4CE9 A;  3P83 D;  1S1V A;  4XIU A;  3V9Z A;  4DFP A;  4RW6 A;  2O4G A;  2HHW A;  1RNH A;  2KTQ A;  2RF2 A;  4KI4 A;  3LWL A;  2IGI A;  3NH1 A;  2X6N A;  1CZ9 A;  1KLM A;  2HNZ A;  4CF0 A;  3K5L A;  3SUO A;  4CJU A;  1NOZ A;  1ZBU A;  5HRP A;  2XHB A;  3SYZ A;  3SQ2 A;  1TK5 A;  4CHO A;  3LP2 A;  3C94 A;  3HP9 A;  1JL2 A;  3OYF A;  2HHS A;  1W0H A;  5HRO A;  1L5U A;  1SUQ A;  3M8P A;  4PUO A;  3ZSX A;  3CFP A;  2QKK A;  4ELV A;  3C95 A;  4CCH A;  2OZS A;  2KZM A;  4CJR A;  4W5N A;  4Z0U A;  2DFE A;  4CJS A;  3L3V A;  3SCX A;  1XHX A;  3LZJ A;  3QEV A;  4E19 A;  4E3S A;  3S3O A;  4K8Z A;  1ZBF A;  4E7K A;  1EXQ A;  3V9X A;  2Q3S A;  5KI6 A;  1HQE A;  1WNS A;  4CHZ A;  2ZD1 A;  1EKE A;  3AVA A;  3KTQ A;  3ZSQ A;  3MED A;  1GOC A;  3ZT3 A;  4DSE A;  4FJL A;  1N5Y A;  1RDD A;  1NK7 A;  4BE1 A;  3L8B A;  5JS1 A;  4DQP A;  3SPZ A;  4O55 A;  5C24 A;  4JLH A;  4CIE A;  4CFD A;  1DLO A;  5DK5 A;  4HTU A;  4B9N A;  1DTQ A;  4EP5 A;  3K59 A;  2XY5 A;  1XI1 A;  4N76 A;  1J53 A;  2GBZ A;  2A1R A;  1LW2 A;  3AVC A;  1S1X A;  4FM2 A;  4J2A A;  3DM2 A;  1RT2 A;  2YHB A;  3HVT A;  4FLZ A;  1BI4 A;  3OYN A;  3AA5 X;  4FLW A;  2X6S A;  3IAY A;  1EX4 A;  4M42 A;  2KFZ A;  4PA1 A;  4ID5 A;  4CHP A;  1XWL A;  3LAK A;  1TV6 A;  1RDB A;  1LWC A;  2FBV A;  2Z1G A;  4RW8 A;  4ZTF A;  3NF7 A;  1BHL A;  4LY7 A;  3DOL A;  4DFM A;  1S1T A;  1S6Q A;  2XY6 A;  3ZSR A;  3M8S A;  1QTM A;  2WON A;  4CHQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...