1RBRA

Structural study of mutants of escherichia coli ribonuclease hi with enhanced thermostability
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
155
structure length
155
Chain Sequence
MLKQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAAIVALEALKEPCEVILSTDSQYVRQGITQWIHNWKKRGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERCDELARAAAMNPTLEDTGYQVEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE H
publication title Structural study of mutants of Escherichia coli ribonuclease HI with enhanced thermostability.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase(endoribonuclease)
total genus 50
structure length 155
sequence length 155
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 1993-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1rbrA00
5I3UA 4LD0A 1D5AA 4XIUA 3S9HA 1ITGA 4OGCA 1XHXA 3ZSYA 4QOZB 2BANA 2OPRA 1RCHA 2HHQA 1QTMA 4JLHA 3QO9A 1T8EA 4KHQA 1HNVA 3AVIA 4CK1A 1KCFA 2O4GA 4FJLA 2XY6A 2YNGA 1RTIA 3K2PA 4KRFA 4M3UA 4N76A 4CHYA 4DTOA 1QS4A 1JLAA 4CFBA 4CJQA 2G8IA 3G10A 1RDCA 2Y1JA 3V9WA 1TAUA 3AA2A 3OYLA 4FJ8A 4OVLA 5HP1A 3OS2A 3MAQA 1UAXA 4DSEA 1KLMA 3AVLA 4DFKA 3PV8A 3CQ8A 2YV0X 3CM6A 4KTQA 2Z1GA 4DQPA 1QSSA 3RRHA 1TGOA 2VWKA 2YNIA 3VQAA 4CFDA 1C1AA 3NDKA 4FLZA 4FCYA 3SUQA 4FM1A 1MU2A 4ID1A 1RT2A 4NYNA 2HNDA 1X9MA 3D45A 3DRSA 3HPGA 3NCIA 3QIPA 1TVRA 1CXQA 4E19A 5KGXA 2E6MA 3DLBA 5FRMA 4RW4A 1SL0A 1JLCA 2RN2A 3K5NA 4BE2A 3U3YA 3QNOA 3U6FA 4B9VA 4J2AA 3HSTB 3ZT0A 1L3TA 4KAZA 1RBTA 3DI6A 3DLKA 4CJ4A 4CHQA 1A5VA 3VQ9A 1WSEA 1L3SA 4FJKA 4BACA 4RW9A 1A5XA 1RDAA 1S6QA 1JLGA 3IG1A 1Y97A 4CGJA 2XO7A 1S9EA 1TKZA 3AVAA 2P5GA 4F4KA 4CF1A 3KK3A 1VSMA 2ATQA 1XI1A 5SWMA 2OZMA 1RT1A 2ITGA 5E41A 4O0JA 3AO2A 3LWMA 4CCHA 4NYFA 3NE6A 1IKVA 4J2EA 4M3XA 4Q5VA 4N56A 4KI6A 4FK2A 1RBSA 1BL3A 1N6QA 3D0PA 3NH0A 2G8KA 3RR8A 3ITHA 4BWJA 2XY7A 3ISNC 1ZBUA 5JS1A 1A5WA 2X6NA 4FM2A 4CERA 4CEQA 1CLQA 3OJSA 2QXFA 3AO4A 4O44A 3K58A 4KO0A 3CFPA 5C42A 4FJ9A 2OZSA 5C24A 3OYMA 4RG8A 5EU7A 3VQPA 3CYMA 3ZSRA 4JS5A 3RR7A 3KK2A 3PUFA 3T19A 4JRQA 3S3OA 1HYVA 3LZIA 3SUPA 1TK8A 4FLUA 4DFMA 5FRNA 3ZSQA 1JLEA 2HNZA 3H08A 4LSLA 3HVRA 3NH1A 4DSJA 1B9DA 4OLBA 3OYDA 4DQSA 3CFRA 3NF8A 2KTQA 4CECA 3K5MA 4HHTA 1TAQA 1WSHA 4B9LA 4H4OA 3OS1A 1WSFA 1X9SA 2KQ2A 4H4MA 3VQ7A 4CF2A 1EP4A 2EX3A 1WAJA 4E1MA 4C8OA 4E7KA 2YHBA 4NCGA 4FJXA 5DMRA 4DF8A 1HRHA 4OPJA 4FLVA 2LSNA 5CZ2A 1VSFA 1ZYQA 3AVCA 3LWLA 1RBUA 3THVA 4EP5A 3DMJA 4CGDA 3VQEA 3HL8A 3LPUA 3QEIA 3B6PA 3VQCA 5J2MA 1BQNA 1KTQA 4AHCA 1CZ9A 3L2RA 3KLEA 4IG3A 1IG9A 3I8DA 3TAEA 2IAJA 1RT7A 3V9ZA 1QHTA 3O4NA 1D9FA 3ZSVA 1BCMA 1HMVA 4M45A 2B5JA 4CIGA 1REVA 5HRSA 5HRNA 1BGXT 3C6TA 3SQ0A 3RTVA 2XRIA 4LH5A 3WNEA 1S1WA 2Z1IA 4CJ5A 2VG5A 4AILC 4F3TA 4FM0A 5CYQA 3SNNA 4CHPA 2GBZA 1X9WA 3KD5E 2YHAA 1W9HA 4M3TA 4W5NA 1L3UA 3I0SA 2P5OA 3SQ4A 1RNHA 3QIOA 2OPSA 4PA1A 3OY9A 3TARA 4B8AB 4E7IA 1LAVA 1KSPA 2PY5A 4CEFA 3LAKA 4OKJA 4Z4IA 1RDDA 1RTJA 1IKWA 1RDBA 3MEGA 3S3NA 2HHSA 1J54A 3KKRA 1WN7A 1B92A 3AO3A 3KIOA 5CY4A 4F2RA 3CG7A 3AA3A 1XC9A 1EETA 4CJRA 4E7LA 4FJJA 3C6UA 3OYEA 4I9LA 1JLQA 1QE1A 3AO5A 4PY5A 5J2NA 2OYQA 4ELUA 1VRTA 5KTQA 3LALA 2Z1JA 3F9KA 4RW7A 2BDPA 2XHBA 1RT5A 3M8RA 1TK0A 4KB1A 3ULDA 1C0UA 1G15A 1TL3A 4E3SA 1DTQA 3SV3A 3HPOA 3L2WA 3MECA 3TAFA 4F2SA 2F8SA 2DY4A 1NKCA 2Q3SA 1JL2A 1U04A 1NOYA 4B9NA 5JS2A 2BGGA 1BI4A 3TAQA 1GOCA 1VSEA 4DTPA 1XHZA 4OGEA 4DTRA 3AVMA 4FJMA 2GUIA 1QQCA 4CK3A 4OLAA 1NK0A 2D0BA 1O1WA 1WLJA 1BI4B 4CJVA 1HJRA 2DTUA 2BE2A 5C25A 4CGFA 4CJEA 1GOBA 1S1VA 3IRXA 4FJNA 3C94A 4Q0BA 4Z4EA 3MEEA 3V4IA 1S1UA 4KTWA 3ZSXA 4DTUA 3RMCA 1U49A 3QEXA 3RWUA 1WSJA 5HBMA 3HM9A 3OYIA 5KRSA 4HCBA 4L8RB 2Y1IA 4M3YA 3LANA 2F8TA 1RT4A 4FK0A 1C1CA 1U48A 3ZSWA 3VQ4A 3WNHA 4EZ6A 3P1GA 5DK5A 3LDSA 4DSFA 1D8YA 2P51A 4E7JA 3EY1A 4WE1A 4JS4A 2XY5A 4DSIA 2IC3A 4IBNA 3NGZA 4FJ5A 4CE9A 3LP2A 3KKSA 3IS9A 4CFCA 1J53A 2EHGA 4E1NA 4FJHA 4J2BA 4ELVA 1HQEA 4QCLA 3PX6A 4OJRA 4AHRA 3HP9A 2HW3A 3ALYA 3DOLA 4AHVA 2D0AA 4CJ3A 4B9MA 3VA0A 4KPYA 1J9AA 4DLGA 4KHYA 4GMJB 1WSIA 1HQUA 1IH7A 1YTAA 4RW8A 5KI6A 2HHWA 3WNFA 3SYZA 1ASVA 3V1RA 2FC0A 1UWBA 2HHXA 3QEPA 1JXEA 1JXBA 2IGIA 3O3HA 3OYNA 3OYGA 3VA3A 1U45A 4C8LA 3KLFA 1ZBHA 1XWLA 3T1AA 3DLHA 3VQ5A 3DLGA 1Z26A 2RKIA 3OYCA 3F73A 4CFAA 5D3GA 4ELTA 1HYSA 4CJPA 3TI0A 4ZTFA 4OKEA 4KHNA 3A2FA 4I2PA 3OYBA 1QSLA 4BDPA 3L8BA 4OPKA 3V1OA 2QKBA 2D0CA 3BGRA 1UA0A 5SZTA 3M8SA 3CFOA 1ZBFA 4Y1DA 4DFJA 4FLYA 4HVJA 3OYHA 3V9UA 1IKXA 4KHSA 2FBXA 3HPHA 4ICLA 4EP4A 3TANA 2QK9A 4IFYA 3P5JA 1EKEA 2OA8A 2IOCA 1BCOA 4BDYA 2WOMA 4KHWA 4CEAA 4E0DA 1I39A 1RILA 2HNYA 2VG7A 1SKSA 4CJSA 3AVHA 1KVBA 4QAGA 3DLRA 3L3UA 4FZZA 3AVFA 3QEVA 1YTUA 4HCCA 2HHTA 2WONA 3ZT3A 1SKRA 3ZSOA 1S1XA 1JKHA 1JLBA 4W5OA 3SCXA 1KFDA 1LWFA 4AH9A 3QEWA 2HVIA 4C8KA 3ZSZA 1D9DA 1VSIA 1IO2A 3BDPA 3SV4A 4M3ZA 3LPTA 5J2PA 1LAWA 1S5JA 1W0HA 2DFHA 4IDKA 4CJWA 4O0IA 4MQ3A 3QINA 3HT3A 3MXMA 1C6VA 4BE0A 1NK5A 3NGYA 4B08A 3HXMA 1EX4A 1HNIA 4B9TA 3E01A 1GOAA 1KLNA 1KRPA 2HVHA 1BHLA 4NCBA 4KREA 3TAMA 2VG6A 1R0AA 4DS5A 4KV8A 4LSNA 3LP1A 3OVNA 3HP6A 4CIEA 4M3RA 1T7PA 4M42A 2HB5A 3VQBA 4CJFA 4GVMA 3KD1E 3TAPA 3V1QA 4R5PA 1NJWA 5FDLA 3VQQA 2FBTA 4O55A 2KZMA 1T03A 1ASUA 3SPZA 1RBRA 1NKBA 3RRGA 4IKFA 3OYKA 4K8ZA 1HPZA 2NUBA 1C1BA 3MXJA 2JLEA 4JRPA 4CF0A 1JLFA 2D5RA 1CZBA 4CJTA 5T7BA 4CHZA 2YNHA 3C95A 1UA1A 3OYFA 3K5LA 2KFZA 2OPQA 3DOKA 3B6OA 1VRUA 4B8CA 3ASMA 2DFFA 4F3OA 4H8KA 1IKYA 3KLHA 4CGGA 4E89A 2G8HA 3TABA 3HK2A 2HHVA 2B6AA 3WNGA 2HHUA 5HRRA 1U4BA 4GW6A 4HTUA 4FLTA 3NBPA 1FKOA 2I5JA 3PY8A 3NF9A 4DQQA 4DU4A 1JL1A 4LH4A 3TWHA 1LW2A 4I9QA 4I2QA 3VQ6A 4N41A 1NJZA 1BISA 4KB0A 4HUFA 2G8FA 2G8VA 4CEDA 3DYAA 4IG0A 1I3AA 4FW1A 3VQDA 1T05A 1TKDA 1NJXA 2G8UA 4DQIA 5K14A 2XY8A 3KLIA 4Z0UA 5KRTA 3K57A 3EYZA 2IS3A 4CEZA 5HROA 3EZ5A 4PQUA 3V9SA 4F8RA 4YNQA 3HJFA 1VSDA 3O3GA 1NK7A 3T3FA 3DRRA 4J2DA 4DU1A 3DLEA 1TKXA 3U3GA 4DTXA 1B9FA 5HRPA 1KFSA 1Q8IA 1LWEA 3SUNA 3PO4A 4DSLA 1S9GA 2YNFA 3VN5A 3TR8A 4CEEA 4NCAA 2IDOA 4KFBA 3O3FA 3S3MA 2KFNA 3ZT2A 3RMAA 4FJ7A 4CHNA 1TK5A 1F21A 4KI4A 5HLFA 1C0TA 3FFIA 2X74A 3IAYA 3AVNA 4C8MA 1VSHA 4LY7A 1S1TA 1L5UA 1NK6A 3JYTA 3PX0A 1TL1A 4W5RA 4W5QA 2P1JA 1FK9A 1Q9YA 4DWIA 4FK4A 1RBVA 1BIUA 4FW2A 1KVCA 3NAEA 1BQMA 1VSJA 1LWCA 2Z1HA 4E7HA 3QETA 3SQ2A 4DS4A 3M8QA 4M41A 4CIFA 1NK4A 3ZT4A 4Z4HA 1C0MA 4KHUA 1S6PA 3HO1A 4DTSA 2HMIA 4DSKA 3LZJA 4EZ9A 4FZYA 2KZZA 2KW4A 4CJLA 1RTHA 1SV5A 1TKTA 1LW0A 4C8NA 1K6YA 3AVBA 3AVKA 1NK9A 4FJGA 1ASWA 3QERA 4M3WA 3AV9A 1SUQA 1RTDA 2RPIA 4FJIA 4ZTJA 2YKMA 2OPPA 4CF9A 2FBYA 2GV9A 3L2VA 3SZ2A 2PYLA 2PZSA 2PYJA 4UQGA 2E6LA 1NOZA 5CZ1A 4FLXA 2R7YA 3V6DA 4CESA 3L2QA 3K59A 2F96A 4G1QA 4B9UA 5J1EA 1NJYA 4DU3A 2ZD1A 4AHTA 1FXXA 2FBVA 4Z4CA 4TSXA 2X78A 3LP0A 3OYJA 4HUGA 4FLWA 3AO1A 2DFEA 3QLHA 4N5SA 4DQRA 1HYZA 3SUOA 3PO5A 2O4IA 4MFBA 3KK1A 2W42A 5J2QA 3CM5A 3OYAA 2A1RA 1WNSA 3DRPA 4O5BA 1NK8A 1UOCA 3OS0A 1VSKA 1LV5A 3SQ1A 1CXUA 4AHUA 3NHGA 3V81A 4KKOA 4IFVA 4PWDA 1BIZA 4ID5A 4B9SA 1WAFA 1ZBLA 3AVGA 1ZBIA 1VK0A 3HVTA 3L3VA 5FROA 1U47A 3NH2A 4CF8A 4BWMA 1QSYA 4BDZA 2ZQBA 3RMDA 3NF6A 4PUOA 4DTMA 3QESA 4DTNA 1YVUA 2A1SA 3JSMA 4FYDA 1RT3A 4N47A 1Z25A 1WSGA 3I0RA 3MXIA 1KVAA 4HUEA 3LP3A 4CEBA 2VWJA 4CJKA 3OJUA 3L2UA 4CEOA 3V9XA 1EXQA 3KTQA 3M8PA 1VSLA 2ETJA 4FVMA 3PX4A 4FXDA 3RMBA 3LAMA 4CGHA 3ZCMA 4OKKA 1TV6A 3KJVA 4BE1A 2RF2A 1N5YA 2B4JA 1L3VA 4Z4FA 4YFUA 3NFAA 4Z4GA 4CGIA 1RT6A 4AHSA 1YT3A 1SKWA 3SI6A 2YKNA 3K5OA 5CYMA 5KGWA 4Y1CA 3AA4A 3MEDA 3G0ZA 4I7FA 1FKPA 3NF7A 4RW6A 3NGIA 4DFPA 3P83D 5I42A 4FZXC 4W5TA 4K8XA 1J5OA 4CK2A 1DTTA 2QKKA 3DM2A 3SPYA 3AVJA 2JGUA 3UIQA 3HYFA 3O4QA 4CJUA 4DLEA 4DTJA 4KTZA 4CHOA 3QNNA 1NKEA 4ZHRA 1SL2A 2X6SA 4O4GA 2ZE2A 3ZT1A 1DLOA 4DMNA 2G8WA 4B3OA 3AA5X 3KLGA 4DF4A 3SJJA 4DG1A 1X1PA 2E4LA 2AJQA 1SL1A 3TAGA 1Q9XA 3VQ8A
chains in the Genus database with same CATH superfamily
4LD0A 1N34K 4XIUA 1RCHA 1QTMA 3P39A 1O13A 3AVIA 4CK1A 3WXJA 1KCFA 3AARA 4YOWA 2YNGA 5M1NA 1QVFM 3CCMN 5KPZA 4DTOA 3G10A 3E9LA 2Y1JA 3AA2A 3C6HA 4OVLA 4FPBA 4DCHA 1J5EK 4DSEA 3LL3A 3ATUA 2YV0X 3I55N 3RRHA 4PKGA 4JKFA 4CZIA 5BN8A 4ID1A 1OKJA 3GBTA 4CZJA 4BRMA 3QIPA 1CXQA 5KGXA 3CC4N 4K25A 5FRMA 4QS8A 2UUAK 1ATRA 1JLCA 3U3YA 1T3VA 3FLCO 3ZYYX 3HI0A 1A5XA 1RDAA 1S6QA 1JLGA 3O8MA 3IG1A 4CGJA 3AVAA 2P5GA 2P9KB 1XI1A 2OZMA 1RT1A 2AA4A 4BGBA 1OH5A 5AQIA 2VQFK 4M7XA 2FXUA 4NO7A 2EWSA 2YI1A 4M3XA 4Q5VA 4N56A 5BR8K 2OANA 3CPEA 4WFNL 4FK2A 3D0PA 3ITHA 1BO5O 1A5WA 2X6NA 4CERA 4CEQA 2FSNA 2VYPA 4JI2K 4R79A 4BQZA 1I94K 3N4QA 3U4LA 3OYMA 3SAHA 3VQPA 3RR7A 1HYVA 2CGKA 4FLUA 4YDUA 4DFMA 1HKCA 2QI2A 3HVRA 5H1SQ 1B9DA 3CFRA 1VQMN 2KTQA 4BRPA 4HHTA 4B9LA 3IUCA 3OS1A 4H4MA 4B9QA 3VQ7A 1EP4A 1WAJA 5AQFA 1SS6A 4FJXA 1HRHA 4OPJA 1CZAN 4FLVA 1HLUA 5CZ2A 1VSFA 1ZYQA 1RBUA 3THVA 3R8EA 3VQEA 1DEJA 5J2MA 2NZTA 3I8DA 2IAJA 3VTIA 3V9ZA 1BCMA 1W7AA 1W97L 4M45A 4FVUA 3QFPA 2E8AA 5HRSA 1BGXT 3J8AA 2ZF5O 4DV1K 4HTLA 2XRIA 4LH5A 4CJ5A 2VG5A 2WUSA 4FM0A 3KD5E 1W9HA 1K8KA 2P5OA 3SQ4A 4GKJK 3VESA 3TARA 4EIAA 1K8KB 2IVNA 2V51B 4H0TB 1KSPA 2PY5A 2P9PA 2IVPA 3UB5A 3MEGA 1RDBA 1WN7A 3CHWA 3KIOA 4F2RA 1XC9A 3AA3A 2GELA 4CJRA 4FJJA 3C6UA 3OYEA 2D0OA 3EE8A 1JLQA 5J2NA 4YOXA 3EEQA 1GLJO 3F9KA 3CCQN 4O8KA 2CGJA 1G99A 3DWLA 2XHBA 3AAQA 1P90A 3VEYA 1DTQA 3SV3A 2F8SA 3TAFA 4F2SA 1JL2A 5JMVA 5JS2A 1BI4A 2GUIA 5M1FA 4DV6K 2D0BA 1WLJA 1BI4B 4CJVA 2VCPA 5C25A 1S1VA 3QICA 4Z4EA 4JKAA 4IKFA 1S1UA 3ZSXA 3RMCA 1U49A 3HM9A 2FSJA 2F8TA 3LANA 5AQPA 1GLBG 3WNHA 4EZ6A 1S3XA 1D8YA 4DSIA 2XY5A 2UXCK 4IBNA 3NGZA 1NGJA 3KKSA 4MLEA 3IS9A 3S41A 4CFCA 4FJHA 4ELVA 4FWNA 5C0YA 4OJRA 4AHRA 1BDGA 3PSFA 2HW3A 1U2VA 3ALYA 4B1UB 4CJ3A 4KPYA 4KHYA 5AQRA 5IWAK 4BR7A 2HHWA 3V1RA 2Q97A 5ELZA 4LFCK 2HHXA 2IGIA 3T7ZA 5BRHA 3T1AA 3DLHA 3DLGA 1Z26A 2RKIA 4H0VB 4WQ4C 4CFAA 3Q7CA 3TI0A 4KHNA 1HKBA 4YOVA 4BDPA 5AQNA 2IVOA 1MWMA 5SZTA 1ZBFA 4Y1DA 2P9SA 4I6MA 4FLYA 4NLCA 3VGMA 3HPHA 4ICLA 2QWRA 3TANA 2QK9A 4IFYA 4RTFD 3WQUA 3NVMA 2OA8A 2Q36A 3CI5A 4JI4K 2WOMA 2HSTA 4CEAA 1RILA 4IFEA 3AVHA 4QAGA 3L3UA 1YTUA 1NG9A 3AVFA 2HHTA 4HCCA 3SMPA 3ZT3A 5KPTA 1ZC6A 3WXLA 2FLOA 4JI3K 4WQ4A 4AH9A 4BREA 3QEWA 3A8YA 1XC3A 1IO2A 1NM1A 5BPNA 3CCEN 4JKGB 3LPTA 1S5JA 5EVZA 4IDKA 4O0IA 4MQ3A 4BR2A 1XUPO 3MXMA 3C6AA 1KAZA 3J81O 1EX4A 3E01A 4ISFA 4BRDA 1BHLA 4KREA 1J6ZA 3EE9A 4DV0K 1HNXK 1V4SA 1GLEG 4M3RA 1NBWA 4M42A 3CCSN 3L6QA 3MCAB 1QZ5A 4H5RA 4O55A 4XEIA 4FWRA 4NLBA 5LMUK 4BRGA 1HPZA 4A5BA 3MXJA 1DKGD 4JRPA 2D5RA 1CZBA 4CJTA 5T7BA 4CHZA 2YNHA 1TYQB 2OPQA 1VRUA 4H8KA 2I7PA 4IOXA 2G8HA 2VGMA 2B6AA 4GW6A 1FKOA 3SAFA 3Q7BA 1JL1A 4LH4A 3MN5A 3TWHA 1LW2A 1EWRA 2NRWA 4Z94A 1BISA 4CZLA 4HUFA 4CEDA 2A5XA 4IG0A 1I3AA 3VQDA 4DQIA 2XY8A 4E1JA 3O9SA 4CEZA 4BVOA 4PQUA 2I7NA 3HJFA 3DRRA 3U3GA 3NVKA 3MN7A 5AQSA 1KFSA 1Q8IA 4XH4A 4YY3K 3VN5A 3TR8A 3MDQA 4CZEA 2KFNA 1U6ZA 4CVNE 3W3DA 1F21A 3SLCA 3THYA 2W40A 2X74A 4DV4K 4X65K 3AVNA 4AM6A 3FR0A 2O8DB 4W5RA 3R1XA 4DWIA 1ATNA 1RBVA 3NAEA 1KVCA 1LWCA 2Z1HA 4E7HA 3QETA 3VETA 3ZT4A 3HO1A 1WOQA 4DTSA 4DSKA 3QBXA 3JS6A 2KW4A 4CJLA 1SV5A 4FJGA 4M3WA 2ZWHA 3O9QA 4FJIA 4BG9A 3FZMA 3KWIA 4CF9A 2GV9A 2PYLA 4DUZK 3VENA 2QWNA 2NRHA 4FLXA 3V6DA 1XMQK 5M1OA 4G1QA 4AHTA 3MN6A 2FBVA 4Z4CA 5LJVA 2X78A 3OYJA 2DFEA 1QZ6A 3D7EO 5J2QA 5EOYA 3CM5A 3OYAA 3DRPA 4ISGA 4AHUA 3NHGA 3CQYA 4IFVA 4PWDA 1JCEA 3AVGA 4DUYK 4ILHA 2V52B 1U47A 4CF8A 3CJCA 4PKIA 5TKWA 3RMDA 4PUOA 1XNRK 5AR0A 3JSMA 3CETA 2E2OA 5EY4A 3MXIA 3ENOA 4K41A 4CEBA 3IDHA 3OJUA 1GLDG 2PAVA 3K9KA 1WB9A 1VSLA 2ETJA 3PX4A 3RMBA 3LAMA 1TV6A 1L3VA 4DV5K 4Z4FA 2NRVA 3NFAA 1NGAA 4EFHA 2YKNA 5KGWA 3MEDA 4DFPA 4W5TA 4CK2A 1DTTA 3DJCA 2QKKA 3TSQA 3HYFA 1NKEA 3QBWA 4V19S 4B3RK 2G8WA 3L0QA 4DF4A 4YOYA 3SJJA 2E4LA 4ISEA 3VEWA 3VQ8A 4J8FA 5I3UA 4BRLA 3S9HA 4OGCA 2HHQA 3VEOA 2P9NA 2DPNA 1T8EA 1HNVA 4FJLA 1VQNN 1YXQA 1RTIA 3K2PA 4CHYA 1QS4A 2G8IA 1RDCA 2QA4N 4DR5K 1EO1A 5HP1A 2GEMA 4DFKA 1KLMA 4F9OA 3AGRA 3CQ8A 3CM6A 5HOOA 2VWKA 4FOIA 3VQAA 1E3MA 4JYAK 4FCYA 5CE3A 1IBLK 1RT2A 1KAYA 2HNDA 1X9MA 3D45A 3LDPA 3HPGA 3NCIA 4WFBL 4E19A 3DLBA 5M1KA 2V7YA 1SL0A 4GV6A 3J7AP 3ZT0A 3T69A 4JD2A 4L3QA 4CHQA 3ZX3A 3BZCA 4FJKA 3WEEA 5F1XA 4JD2B 1VQ7N 4F4KA 4CF1A 3FZLA 2ATQA 5LY3A 5E41A 4O0JA 3AO2A 1XMOK 4NYFA 3NE6A 1KQSM 2ZJQL 4KI6A 1RBSA 1N6QA 5M1PA 2NNWA 4BWJA 3ISNC 1ZBUA 3BUZB 5GIOA 5GAEP 1NGFA 3OJSA 4O44A 3AO4A 3CFPA 5C24A 3VGKA 3CYMA 5ADXH 4EHUA 1NMNA 5FRNA 4JKEA 1JLEA 4BVPA 3NH1A 3OYDA 3CCRN 4IDHA 3NF8A 1BG3A 4CECA 1WSHA 3ENHA 4MLHA 1T6DA 3ULEA 1X9SA 2KQ2A 1N8RO 4E7KA 5AZJA 4DF8A 1WBDA 4H5TA 2O8BA 4DQ8A 3LWLA 3DMJA 3EZWA 5AZJB 3VQCA 1BQNA 1IG9A 4IG3A 3TPQA 2O8BB 3O5BA 3ZSVA 2WFBA 1HMVA 2B5JA 5HRNA 3ENBA 3C6TA 3O6WA 2YCHA 5JVHL 3WNEA 3RTVA 1S1WA 3O80A 4PKHA 4AILC 5CYQA 4CHPA 1M1KO 4M3TA 4OX9K 3KHYA 3I0SA 4FL9A 4JKCA 3FE1A 2OPSA 4MO4A 4BRIA 4B8AB 4E7IA 1ZBSA 4JI8K 4Z4IA 3VPZA 3S3NA 1J54A 3KKRA 2YHYA 5CY4A 3CG7A 4MDAA 1EETA 1N33K 5B8HA 3SJHA 2KLAA 1ATSA 3J80O 4H5NA 4ELUA 3LALA 2BDPA 5KQDA 1RT5A 4KB1A 3BY5A 3D2EA 3KWGA 3HBTA 2F9TA 4JN4A 4E3SA 3L2WA 5JLFA 1NKCA 4BY9C 2Q3SA 3D2EB 5BRDA 5I9EB 4B9NA 2BGGA 3TAQA 3C65A 1VSEA 4DTPA 4BROA 5AQTA 4CK3A 2F7TA 1VHXA 4CGFA 4UY8O 4CJEA 1GOBA 4BRCA 3IRXA 4FJNA 4Q0BA 1X9JA 3RWUA 4HCBA 4L8RB 4M3YA 4YDUC 1RT4A 4OPAA 4BR0A 3VQ4A 4JKDA 4GKKK 3P1GA 4B3SK 1NGGA 4WE1A 4JS4A 3P31A 4FJ5A 3VEZA 3VTHA 1E4GT 2KKZA 4E1NA 4QCLA 1IJJA 2ZM6K 3K0SA 4LF7K 4AHVA 2D0AA 4B9MA 3D6RA 3VA0A 4BRAA 1HQUA 5KI6A 3PIPL 3PIOL 3WNFA 2E2NA 1ASVA 5AQOA 3VA3A 1ZBHA 2UU9K 1YVNA 4CBWA 4CZMA 3VQ5A 3SMSA 1HYSA 4HWIA 4H5VA 3ATVA 2QTDA 3A2FA 3ZX2A 3OYBA 5KPRA 5AQWA 1NGCA 3V1OA 3CMEN 2D0CA 4RWTA 2RHKA 3M8SA 4X64K 4CBUA 3OYHA 5E26A 1IKXA 2FBXA 4EP4A 3P5JA 3WQTA 1EKEA 1YJWN 2IOCA 1BCOA 5AQQA 4BDYA 4GY2B 4E0DA 3DAWA 3CCUN 1KVBA 1D4XA 5AQXA 2QWMA 2ZGZA 4H0PA 3SCXA 1KFDA 5DM7L 2HVIA 1D9DA 1VSIA 3THXA 3BDPA 1YAGA 3E66A 2DFHA 2BTFA 3OBYA 3VF6A 1NK5A 4B08A 4B9TA 1KLNA 5A2QO 4NCBA 2NRXA 4A59A 3VEVA 2ZJRL 5C15A 3OVNA 3HP6A 5AQVA 1T7PA 4CJFA 3TAPA 1GLCG 3V1QA 4R5PA 1NJWA 5FDLA 2P9PB 1ASUA 3SPZA 1RBRA 3PLAA 4XH1A 2NUBA 1C1BA 3TTCA 1JLFA 3C95A 3K5LA 4FWOA 3DOKA 4RCHA 4F3OA 3G6EN 1IKYA 4PL8A 5HRRA 3MMVA 3E1YA 4DR2K 1SZ2A 4DQQA 4DU4A 3RVCA 3VQ6A 1YF5L 4LF4K 4BRHA 3CJAA 1T05A 4Z0UA 4NXMK 2F9WA 3CJ1A 5HROA 3EZ5A 3H3NO 1VSDA 3T3FA 3BZKA 1NMDA 1M90O 1ILYA 3AY9A 3H1QA 4H0YB 4JHDA 1KC8O 3PO4A 2IDOA 4LC9B 4KFBA 3ZT2A 3IKMA 3RMAA 4JHDB 1C0TA 3R3LA 3R6MA 3IAYA 2HOEA 1VSHA 4FO0A 1NK6A 1U2VB 1TL1A 1GLLO 4W5QA 1FK9A 4CD1A 1Q9YA 1BQMA 3CMAN 4JI6K 4KHUA 3VOVA 2O8EA 3P4IA 4JEPA 2YHWA 1TKTA 1LW0A 1K6YA 3AVKA 2O8EB 4MDBA 1SUQA 1RTDA 1HR0K 4ZTJA 4A62A 2PZSA 3W0LA 2YJFA 1NOZA 5CZ1A 3C0BA 3T1HK 2P9SB 4I6MB 3L2QA 4B9UA 2QXLA 4X66K 1RDWX 2ZD1A 1FXXA 2OTLN 4HUGA 4DQRA 4IJAA 1HYZA 4AF1A 2W42A 3KK1A 2A1RA 1WNSA 1UOCA 1VSKA 1TUUA 3N4PA 4KH6A 4KKOA 3OTOK 2FF6A 1WAFA 1ZBLA 3HVTA 5EX5A 4QS9A 2UUCK 4BWMA 4JI7K 1QSYA 2ZQBA 3NF6A 3EO3A 4FYDA 3CJ9A 1Z6RA 1WSGA 2VWJA 1YJ9N 4CZFA 2O8FA 1ESVA 4FVMA 2NRRA 3FZFA 4CGHA 3ZCMA 1N5YA 4YFUA 3G0ZA 3ID8A 4DR7K 4RW6A 3RSEA 4K8XA 1C0GA 3L4QA 4CJUA 1SL2A 3CJ7A 3QNNA 3JAMO 3RSEB 3QMLA 4O4GA 4CZHA 2ZE2A 4X62K 3ZT1A 4DMNA 3BF3A 2AJQA 1SQKA 2HF4A 3TAGA 1Q9XA 3K5MA 1D5AA 3TSPA 1ITGA 1XHXA 1HPMA 3ZSYA 2BANA 4QOZB 4JLHA 4KHQA 4BRFA 2E2PA 1GLFO 2WBNA 4KRFA 4ILGB 4N76A 5LL6Z 3LDQA 1JLAA 4CFBA 3V9WA 1TAUA 4FJ8A 3OYLA 4K43A 2ZGYA 3OS2A 1UAXA 3PV8A 2E88A 1S72N 4KTQA 4DQPA 5JVGL 2YNIA 5GAGP 3BP8A 4CFDA 1C1AA 3MWPA 4FM1A 1MU2A 3VERA 4NYNA 3FGUA 3EKUA 4RW4A 3K5NA 4BE2A 4B9VA 4J2AA 4A2BA 3HSTB 1XNQK 3MX2A 1RBTA 3DI6A 4FWPA 3L4IA 4CJ4A 1A5VA 3I8BA 1WSEA 4BACA 3THYB 1Y97A 4MO5A 3KK3A 1VSMA 3H1VX 3OA9A 5AQZA 4C1NI 4H5WA 2P9UA 4JAXA 5M1QA 1BL3A 1HJOA 3NH0A 4JNEA 5JS1A 4FM2A 2P9UB 4JI5K 1CLQA 5FPNA 2QXFA 4KO0A 1JCGA 4FJ9A 2PBDA 5AFUA 4RG8A 3KK2A 3T19A 4JRQA 1N32K 3VEXA 3LZIA 3SUPA 2UUBK 3H08A 4LSLA 3D2FA 4DSJA 1V4TA 2A6AA 2HHHK 1TAQA 1WSFA 2GTDA 2VQEK 2ASMA 4BRNA 4C8OA 2YHBA 5DMRA 2QWPA 5AQKA 3HL8A 3PSIA 3QEIA 1KTQA 4AHCA 1CZ9A 5LJWA 3KLEA 2ASPA 4JK7A 1QHTA 4BG8A 3O4NA 5FPDA 4FWSA 3QDKA 1NJIO 2YJEA 1VQLN 2Z1IA 3OW2M 3SNNA 2D1KA 1T44A 2GBZA 1X9WA 2YHAA 4LF6K 3CC7N 4W5NA 1L3UA 3OY9A 1RFQA 3H46O 2QEXN 1LAVA 4CI6A 4CEFA 4DHYA 3MCPA 1RDDA 1RTJA 2JWLA 1VQ8N 1B92A 3AO3A 5BREA 5AZIA 1E4FT 4I9LA 5IT9O 3FFKB 1Q18A 1QE1A 2Q2RA 2QM1A 1YI2N 2OYQA 1VRTA 4BR5A 5KTQA 1C0FA 4KBOA 1W2BM 4RW7A 2BUPA 5DM6L 1TK0A 2A41A 1JCFA 2P9NB 3ULDA 1G15A 1TL3A 4LFAK 3HPOA 5HL7L 2DY4A 3QB0A 3EKSA 1P8ZA 3THWA 1NOYA 4AQYK 1VQ4N 3J7YP 4DTRA 3AVMA 5FLXO 1O1WA 3HOTA 1DGKN 5BN9A 3MX5A 1NU0A 4LFBK 3V4IA 3A0IX 1MA9B 3QEXA 5HBMA 5KRSA 1C1CA 1TUYA 3ZSWA 2QWQA 3DLLL 5DK5A 3I56N 4O8UA 3WEEB 2P51A 4E7JA 2UXBK 3HRGA 3TTDA 4CE9A 3LP2A 1JJ2M 1J53A 4ILJA 1HQEA 2NRZA 2J4RA 3HP9A 2P9LA 2GUPA 2HBKA 3DOLA 2AP1A 1WSIA 4EHTA 5JICA 1IH7A 1YTAA 4RW8A 3SYZA 1YUWA 3GL1A 2FC0A 5AQLA 1JXEA 4C8LA 3OYNA 3OYGA 3KLFA 1XWLA 2D4WA 3O4WA 4KHPK 3F2KA 4WCEL 2FSKA 1Q81O 4ELTA 4CJPA 4I2PA 1QSLA 4OPKA 3BGRA 5AQUA 1UA0A 3CFOA 3ULEB 4YHHK 4B1VA 4FPAA 3V9UA 4KHSA 1LCUA 2Q0UA 3UKRA 2WTUA 4IEEA 4BGAA 2WONA 3UKRB 4CZKA 1VQ5N 1JLBA 3KK7A 4Y0WA 1K8AO 5J2PA 4CJWA 3HT3A 1YJNN 1C6VA 2P9IA 3NGYA 3C7NA 1K9MO 3HXMA 1HNIA 1KRPA 1R59O 1X3NA 2QW9A 1VQPN 3TAMA 1R0AA 2P9IB 3C7NB 2E2QA 5C2FA 4LSNA 3LP1A 3VQBA 4WFAL 4GVMA 3KD1E 1QQOA 3VQQA 3U8XA 1T03A 1NKBA 4FSVA 3RRGA 4K8ZA 4C1NK 1BOTO 1Q7YO 3IMXA 4CF0A 3A5NC 3OYFA 2KFZA 2Q1NA 4B8CA 3ASMA 2DFFA 1HNWK 3J7ZO 2HHVA 3TABA 3WNGA 4HTUA 3NBPA 2I5JA 3PY8A 3B8AX 4I2QA 4N41A 1NJZA 4KB0A 2G8FA 4FW1A 4LF5K 3KLIA 3EYZA 4IEIA 2IS3A 1NGHA 4YNQA 3R9PA 4DTXA 4OO1J 5HRPA 1LWEA 3SUNA 1S9GA 2A3ZA 2YNFA 4CEEA 3O3FA 4JKHA 4FJ7A 4CHNA 1WUAA 4KI4A 3SAGA 2D0PA 2P9KA 4H03B 1NGBA 3WUHA 3H6EA 5FPMA 1Q82O 4IWVA 4C8MA 1L5UA 3JYTA 2P1JA 4A2AA 1BIUA 5BPMA 3K9JA 3M8QA 1NK4A 4Z4HA 1C0MA 1RGIA 1S6PA 5GIPA 1HKGA 2HMIA 4EZ9A 3LZJA 3LDLA 4FZYA 3BF1A 5KQ8A 2KZZA 4C8NA 5BPLA 3AVBA 4BRKA 3QERA 4IZ9A 3TSUA 2RPIA 2F4VK 2OPPA 3L2VA 4UQGA 3TTFA 3ID6A 4H0XB 3K59A 2F96A 5J1EA 4DU3A 4JK9A 3DXMA 4TSXA 4FLWA 2KHOA 3AO1A 3QLHA 4N5SA 3SK3A 3PO5A 1NK8A 4O5BA 3SBGA 1XQSC 3DXMB 4QS7A 1CXUA 2E5LK 1BIZA 3L3VA 4FWMA 4GNIA 3CD6N 3P38A 3HM8A 5LMNK 4BDZA 3THXB 3QESA 4DTNA 2A1SA 1QQMA 4BR4A 2V7ZA 1KVAA 4B3MK 3LP3A 3ZX0A 1IBMK 3L2UA 4B1YB 4CEOA 3V9XA 1EXQA 3KTQA 3M8PA 4FXDA 2NRTA 5GINA 3LDNA 4OKKA 3G25A 2Q31A 3KJVA 2RF2A 2B4JA 4CGIA 1QQNA 5FPEA 3SI6A 4O5FA 3K5OA 5CYMA 4I7FA 4FZXC 2VGNA 2QWOA 3UIQA 1T6CA 3AVJA 2JGUA 4JV5K 4IOCL 4CHOA 1EWQA 1FJGK 1DLOA 4B3OA 3FZKA 3GG4A 4CJ7A 4B1ZA 2E1ZA 4DG1A 1SL1A 1YITN 1HUXA 3O1BA 2OPRA 3AGKA 4PL7A 3QO9A 2O4GA 4JK8A 2XY6A 4M3UA 5TKYA 4H0OA 4CJQA 1KD1O 3HZ6A 3T1YK 3MAQA 3AVLA 1NGIA 2Z1GA 1QSSA 1TGOA 4BC4A 3NDKA 4FLZA 3SUQA 4BR9A 5AQHA 3CERA 3EN9A 3DRSA 1TVRA 2E6MA 4U7BA 3CC2N 2RN2A 4DKWA 3QNOA 3U6FA 3M1FA 1L3TA 4KAZA 3E9OA 3DLKA 3VQ9A 4YOTA 1L3SA 4JI0K 4LF8K 4RW9A 1VQ6N 5F2RA 2XO7A 1S9EA 1TKZA 2ITMA 3O9RA 5SWMA 2ITGA 3LWMA 4CCHA 3HSCA 3WXIA 5CHIA 1IKVA 1Z05A 4A61A 4J2EA 3FZHA 4GV9A 4FWQA 2G8KA 3RR8A 2XY7A 4NB4A 3K58A 5C42A 2OZSA 4CW7B 5EU7A 1NLVA 3CCVN 3ZSRA 1IV0A 4JS5A 1HX1A 3PUFA 1TK8A 3S3OA 4K0KK 4WYBA 4DR1K 3ZSQA 4OLBA 2HNZA 4U67L 4DQSA 2HF3A 3O9UA 2E1YA 2VWBA 4H4OA 4G9ZA 3OBWA 5CR4A 3O08A 4CF2A 2EX3A 4E1MA 3WXKA 4NCGA 4BC5A 3GE1A 4IOAL 2LSNA 3AVCA 4M63C 4M7YA 4EP5A 4CGDA 1VQ9N 5C12A 3LPUA 3B6PA 3L2RA 4GV3A 2YHXA 3H3OB 3TAEA 1RT7A 1D9FA 3U9DA 5BRFA 3CQXA 4KH5A 4CIGA 1REVA 4JKGA 4BQLA 3SQ0A 2E20A 3LM9A 4B1XB 2RE2A 4F3TA 5C10A 4FWLA 2O8FB 3QFUA 4DR3K 1OH6A 1RNHA 3QIOA 4PA1A 4IXCA 2QWLA 3LM2A 2GWJA 4KH4A 3LAKA 4OKJA 3NMUA 2HHSA 1IKWA 2A40A 5AQYA 3WT0A 1VQON 1LOTB 4E7LA 5AQJA 3AO5A 4DV3K 2Q0RA 1TYQA 4PHTX 2Z1JA 3A5MC 4B1WB 2HMPA 3M8RA 2ZJPL 1C0UA 1NGDA 3MECA 2FF3B 1HNZK 1ZXOA 1BA0A 3ZLJA 3F9MA 1U04A 1OH7A 4CD3A 1GOCA 1XHZA 4OGEA 3ZETA 4FJMA 1QQCA 4OLAA 1NK0A 5BR9A 1HJRA 2DTUA 2BE2A 4EAHD 3DXKA 3ZETB 5E84A 3C94A 3MEEA 4FWKA 1BUPA 4KTWA 4DTUA 3A5OC 1WSJA 4PY5A 1S22A 1SAZA 3DXKB 3OYIA 1KAXA 2Y1IA 4BC3A 4FK0A 3CJBA 1U48A 5AJ3K 1VQKN 1OH8A 3LDSA 4YOUA 4DSFA 1IBKK 3O1WA 1OVQA 3EY1A 2IC3A 2EHGA 4J2BA 3PX6A 2O8DA 3GDQA 4DR4K 1J9AA 1VAZA 4DLGA 4GMJB 3MWTA 1UWBA 4A5AA 3QEPA 1JXBA 3O3HA 1U45A 3AAPA 3TU5A 3OYCA 3F73A 3VGLA 5D3GA 4ZTFA 4IO8A 4OKEA 3HTVA 4LF9K 3ZEUA 3L8BA 3D2FB 2QKBA 2CH6A 2GWKA 4DFJA 3ZEUB 4HVJA 1FW6A 2CH5A 2GX9A 2JWKA 5AFUH 3CF5L 3M3ZA 1EQYA 4KHWA 1I39A 2HNYA 2VG7A 1SKSA 4CJSA 4FZZA 3DLRA 4IO9L 3CCLN 3QEVA 1OVYA 1SKRA 1YIJN 3ZSOA 1YHQN 3G71N 1S1XA 1K73O 1JKHA 2A42A 4W5OA 2BH1A 1LWFA 2O8CA 2UXDK 4C8KA 1IG8A 1X3MA 3ZSZA 3SV4A 4M3ZA 1BU6O 1LAWA 1W0HA 2OCEA 3VMFB 2O8CB 3QINA 1RDUA 1MWKA 4BE0A 4YORA 1GOAA 2HVHA 4JKBA 2VG6A 5GAHP 4DS5A 1NGEA 4KV8A 2PFUA 3UKUA 4CIEA 1GLAG 2HB5A 4DV7K 5F0XA 2FBTA 1WBBA 2KZMA 3UKUB 3OYKA 4DB3A 1NWKA 2HBJA 1QHAA 4CZGA 1Y64A 5AZIB 2JLEA 3BEXA 4DV2K 1UA1A 5C2DA 4IJNA 3B6OA 1DT9A 3KLHA 4CGGA 4E89A 3HK2A 2HHUA 1U4BA 5JLHA 4FLTA 3NF9A 4WQ5C 3LDOA 4I9QA 3KZBA 3THWB 4DR6K 2G8VA 3DYAA 1TKDA 2G8UA 2W6KA 4FOEA 1NJXA 3GOIA 5K14A 3K57A 5KRTA 3O9TA 2H3GX 3A5LC 3MK6A 3V9SA 4F8RA 3O3GA 4J2DA 1NK7A 4DU1A 3DLEA 1TKXA 4AM7A 2YX6A 1B9FA 1H1VA 5GADP 2W41A 4DSLA 4NCAA 3S3MA 5EXWA 1TK5A 4WQ5A 5HLFA 3F5TA 3FFIA 1KXPA 2ASOA 5ADXA 4LY7A 1S1TA 2WC9A 2P9LB 3PX0A 1Q86O 4FK4A 2HBLA 4FW2A 1VSJA 3SQ2A 4DS4A 4M41A 4CIFA 3UE5A 3U9ZA 1BWFO 4GVEA 1MDUB 3WXMB 1RTHA 3CIPA 2CGLA 1NK9A 1ASWA 3AV9A 3I33A 4WF9L 2YKMA 5AQGA 2FBYA 3SZ2A 2PYJA 1BA1A 3JXUA 2E6LA 3MN9A 4K42A 2R7YA 4CESA 5AQMA 1NJYA 4C23A 3LP0A 3G4SN 4JI1K 3SUOA 3E9PA 2O4IA 4MFBA 3VF2A 4BRQA 3OS0A 1LV5A 3SQ1A 3V81A 4BC2A 3CXCM 4ID5A 4B9SA 1ZBIA 1VK0A 2UYTA 5FROA 3KVGA 3NH2A 4OPHA 4CBXA 4DTMA 1YVUA 1RT3A 4N47A 1Z25A 4XH5A 3I0RA 4HUEA 3OHRA 3M5RA 4CJKA 3VF4A 3CPWM 3CCJN 4BE1A 4Z4GA 1RT6A 3M6GA 4NXNK 2NLXA 1YT3A 4AHSA 1SKWA 1NNEA 4Y1CA 3AA4A 5MLCQ 3NGIA 5I42A 1FKPA 3NF7A 1N36K 4B3TK 3P83D 1J5OA 2OTJN 2W6LA 3DM2A 3SPYA 3IFRA 3O4QA 4DTJA 4DLEA 4KTZA 3H45C 1QVGM 4ZHRA 2X6SA 2HBMA 3HOSA 3SBTA 3AA5X 3KLGA 3EL2A 1X1PA 2IIRA 4A57A
chains in the Genus database with same CATH topology
5I3UA 4LD0A 1D5AA 4XIUA 3S9HA 1ITGA 4OGCA 1XHXA 3ZSYA 4QOZB 2BANA 2OPRA 1RCHA 2HHQA 1QTMA 4JLHA 3QO9A 1T8EA 4KHQA 1HNVA 3AVIA 4CK1A 1KCFA 2O4GA 4FJLA 2XY6A 2YNGA 1RTIA 3K2PA 4KRFA 4M3UA 4N76A 4CHYA 4DTOA 1QS4A 1JLAA 4CFBA 4CJQA 2G8IA 3G10A 1RDCA 2Y1JA 3V9WA 1TAUA 3AA2A 3OYLA 4FJ8A 4OVLA 5HP1A 3OS2A 3MAQA 1UAXA 4DSEA 1KLMA 3AVLA 4DFKA 3PV8A 3CQ8A 2YV0X 3CM6A 4KTQA 2Z1GA 4DQPA 1QSSA 3RRHA 1TGOA 2VWKA 2YNIA 3VQAA 4CFDA 1C1AA 3NDKA 4FLZA 4FCYA 3SUQA 4FM1A 1MU2A 4ID1A 1RT2A 4NYNA 2HNDA 1X9MA 3D45A 3DRSA 3HPGA 3NCIA 3QIPA 1TVRA 1CXQA 4E19A 5KGXA 2E6MA 3DLBA 5FRMA 4RW4A 1SL0A 1JLCA 2RN2A 3K5NA 4BE2A 3U3YA 3QNOA 3U6FA 4B9VA 4J2AA 3HSTB 3ZT0A 1L3TA 4KAZA 1RBTA 3DI6A 3DLKA 4CJ4A 4CHQA 1A5VA 3VQ9A 1WSEA 1L3SA 4FJKA 4BACA 4RW9A 1A5XA 1RDAA 1S6QA 1JLGA 3IG1A 1Y97A 4CGJA 2XO7A 1S9EA 1TKZA 3AVAA 2P5GA 4F4KA 4CF1A 3KK3A 1VSMA 2ATQA 1XI1A 5SWMA 2OZMA 1RT1A 2ITGA 5E41A 4O0JA 3AO2A 3LWMA 4CCHA 4NYFA 3NE6A 1IKVA 4J2EA 4M3XA 4Q5VA 4N56A 4KI6A 4FK2A 1RBSA 1BL3A 1N6QA 3D0PA 3NH0A 2G8KA 3RR8A 3ITHA 4BWJA 2XY7A 3ISNC 1ZBUA 5JS1A 1A5WA 2X6NA 4FM2A 4CERA 4CEQA 1CLQA 3OJSA 2QXFA 3AO4A 4O44A 3K58A 4KO0A 3CFPA 5C42A 4FJ9A 2OZSA 5C24A 3OYMA 4RG8A 5EU7A 3VQPA 3CYMA 3ZSRA 4JS5A 3RR7A 3KK2A 3PUFA 3T19A 4JRQA 3S3OA 1HYVA 3LZIA 3SUPA 1TK8A 4FLUA 4DFMA 5FRNA 3ZSQA 1JLEA 2HNZA 3H08A 4LSLA 3HVRA 3NH1A 4DSJA 1B9DA 4OLBA 3OYDA 4DQSA 3CFRA 3NF8A 2KTQA 4CECA 3K5MA 4HHTA 1TAQA 1WSHA 4B9LA 4H4OA 3OS1A 1WSFA 1X9SA 2KQ2A 4H4MA 3VQ7A 4CF2A 1EP4A 2EX3A 1WAJA 4E1MA 4C8OA 4E7KA 2YHBA 4NCGA 4FJXA 5DMRA 4DF8A 1HRHA 4OPJA 4FLVA 2LSNA 5CZ2A 1VSFA 1ZYQA 3AVCA 3LWLA 1RBUA 3THVA 4EP5A 3DMJA 4CGDA 3VQEA 3HL8A 3LPUA 3QEIA 3B6PA 3VQCA 5J2MA 1BQNA 1KTQA 4AHCA 1CZ9A 3L2RA 3KLEA 4IG3A 1IG9A 3I8DA 3TAEA 2IAJA 1RT7A 3V9ZA 1QHTA 3O4NA 1D9FA 3ZSVA 1BCMA 1HMVA 4M45A 2B5JA 4CIGA 1REVA 5HRSA 5HRNA 1BGXT 3C6TA 3SQ0A 3RTVA 2XRIA 4LH5A 3WNEA 1S1WA 2Z1IA 4CJ5A 2VG5A 4AILC 4F3TA 4FM0A 5CYQA 3SNNA 4CHPA 2GBZA 1X9WA 3KD5E 2YHAA 1W9HA 4M3TA 4W5NA 1L3UA 3I0SA 2P5OA 3SQ4A 1RNHA 3QIOA 2OPSA 4PA1A 3OY9A 3TARA 4B8AB 4E7IA 1LAVA 1KSPA 2PY5A 4CEFA 3LAKA 4OKJA 4Z4IA 1RDDA 1RTJA 1IKWA 1RDBA 3MEGA 3S3NA 2HHSA 1J54A 3KKRA 1WN7A 1B92A 3AO3A 3KIOA 5CY4A 4F2RA 3CG7A 3AA3A 1XC9A 1EETA 4CJRA 4E7LA 4FJJA 3C6UA 3OYEA 4I9LA 1JLQA 1QE1A 3AO5A 4PY5A 5J2NA 2OYQA 4ELUA 1VRTA 5KTQA 3LALA 2Z1JA 3F9KA 4RW7A 2BDPA 2XHBA 1RT5A 3M8RA 1TK0A 4KB1A 3ULDA 1C0UA 1G15A 1TL3A 4E3SA 1DTQA 3SV3A 3HPOA 3L2WA 3MECA 3TAFA 4F2SA 2F8SA 2DY4A 1NKCA 2Q3SA 1JL2A 1U04A 1NOYA 4B9NA 5JS2A 2BGGA 1BI4A 3TAQA 1GOCA 1VSEA 4DTPA 1XHZA 4OGEA 4DTRA 3AVMA 4FJMA 2GUIA 1QQCA 4CK3A 4OLAA 1NK0A 2D0BA 1O1WA 1WLJA 1BI4B 4CJVA 1HJRA 2DTUA 2BE2A 5C25A 4CGFA 4CJEA 1GOBA 1S1VA 3IRXA 4FJNA 3C94A 4Q0BA 4Z4EA 3MEEA 3V4IA 1S1UA 4KTWA 3ZSXA 4DTUA 3RMCA 1U49A 3QEXA 3RWUA 1WSJA 5HBMA 3HM9A 3OYIA 5KRSA 4HCBA 4L8RB 2Y1IA 4M3YA 3LANA 2F8TA 1RT4A 4FK0A 1C1CA 1U48A 3ZSWA 3VQ4A 3WNHA 4EZ6A 3P1GA 5DK5A 3LDSA 4DSFA 1D8YA 2P51A 4E7JA 3EY1A 4WE1A 4JS4A 2XY5A 4DSIA 2IC3A 4IBNA 3NGZA 4FJ5A 4CE9A 3LP2A 3KKSA 3IS9A 4CFCA 1J53A 2EHGA 4E1NA 4FJHA 4J2BA 4ELVA 1HQEA 4QCLA 3PX6A 4OJRA 4AHRA 3HP9A 2HW3A 3ALYA 3DOLA 4AHVA 2D0AA 4CJ3A 4B9MA 3VA0A 4KPYA 1J9AA 4DLGA 4KHYA 4GMJB 1WSIA 1HQUA 1IH7A 1YTAA 4RW8A 5KI6A 2HHWA 3WNFA 3SYZA 1ASVA 3V1RA 2FC0A 1UWBA 2HHXA 3QEPA 1JXEA 1JXBA 2IGIA 3O3HA 3OYNA 3OYGA 3VA3A 1U45A 4C8LA 3KLFA 1ZBHA 1XWLA 3T1AA 3DLHA 3VQ5A 3DLGA 1Z26A 2RKIA 3OYCA 3F73A 4CFAA 5D3GA 4ELTA 1HYSA 4CJPA 3TI0A 4ZTFA 4OKEA 4KHNA 3A2FA 4I2PA 3OYBA 1QSLA 4BDPA 3L8BA 4OPKA 3V1OA 2QKBA 2D0CA 3BGRA 1UA0A 5SZTA 3M8SA 3CFOA 1ZBFA 4Y1DA 4DFJA 4FLYA 4HVJA 3OYHA 3V9UA 1IKXA 4KHSA 2FBXA 3HPHA 4ICLA 4EP4A 3TANA 2QK9A 4IFYA 3P5JA 1EKEA 2OA8A 2IOCA 1BCOA 4BDYA 2WOMA 4KHWA 4CEAA 4E0DA 1I39A 1RILA 2HNYA 2VG7A 1SKSA 4CJSA 3AVHA 1KVBA 4QAGA 3DLRA 3L3UA 4FZZA 3AVFA 3QEVA 1YTUA 4HCCA 2HHTA 2WONA 3ZT3A 1SKRA 3ZSOA 1S1XA 1JKHA 1JLBA 4W5OA 3SCXA 1KFDA 1LWFA 4AH9A 3QEWA 2HVIA 4C8KA 3ZSZA 1D9DA 1VSIA 1IO2A 3BDPA 3SV4A 4M3ZA 3LPTA 5J2PA 1LAWA 1S5JA 1W0HA 2DFHA 4IDKA 4CJWA 4O0IA 4MQ3A 3QINA 3HT3A 3MXMA 1C6VA 4BE0A 1NK5A 3NGYA 4B08A 3HXMA 1EX4A 1HNIA 4B9TA 3E01A 1GOAA 1KLNA 1KRPA 2HVHA 1BHLA 4NCBA 4KREA 3TAMA 2VG6A 1R0AA 4DS5A 4KV8A 4LSNA 3LP1A 3OVNA 3HP6A 4CIEA 4M3RA 1T7PA 4M42A 2HB5A 3VQBA 4CJFA 4GVMA 3KD1E 3TAPA 3V1QA 4R5PA 1NJWA 5FDLA 3VQQA 2FBTA 4O55A 2KZMA 1T03A 1ASUA 3SPZA 1RBRA 1NKBA 3RRGA 4IKFA 3OYKA 4K8ZA 1HPZA 2NUBA 1C1BA 3MXJA 2JLEA 4JRPA 4CF0A 1JLFA 2D5RA 1CZBA 4CJTA 5T7BA 4CHZA 2YNHA 3C95A 1UA1A 3OYFA 3K5LA 2KFZA 2OPQA 3DOKA 3B6OA 1VRUA 4B8CA 3ASMA 2DFFA 4F3OA 4H8KA 1IKYA 3KLHA 4CGGA 4E89A 2G8HA 3TABA 3HK2A 2HHVA 2B6AA 3WNGA 2HHUA 5HRRA 1U4BA 4GW6A 4HTUA 4FLTA 3NBPA 1FKOA 2I5JA 3PY8A 3NF9A 4DQQA 4DU4A 1JL1A 4LH4A 3TWHA 1LW2A 4I9QA 4I2QA 3VQ6A 4N41A 1NJZA 1BISA 4KB0A 4HUFA 2G8FA 2G8VA 4CEDA 3DYAA 4IG0A 1I3AA 4FW1A 3VQDA 1T05A 1TKDA 1NJXA 2G8UA 4DQIA 5K14A 2XY8A 3KLIA 4Z0UA 5KRTA 3K57A 3EYZA 2IS3A 4CEZA 5HROA 3EZ5A 4PQUA 3V9SA 4F8RA 4YNQA 3HJFA 1VSDA 3O3GA 1NK7A 3T3FA 3DRRA 4J2DA 4DU1A 3DLEA 1TKXA 3U3GA 4DTXA 1B9FA 5HRPA 1KFSA 1Q8IA 1LWEA 3SUNA 3PO4A 4DSLA 1S9GA 2YNFA 3VN5A 3TR8A 4CEEA 4NCAA 2IDOA 4KFBA 3O3FA 3S3MA 2KFNA 3ZT2A 3RMAA 4FJ7A 4CHNA 1TK5A 1F21A 4KI4A 5HLFA 1C0TA 3FFIA 2X74A 3IAYA 3AVNA 4C8MA 1VSHA 4LY7A 1S1TA 1L5UA 1NK6A 3JYTA 3PX0A 1TL1A 4W5RA 4W5QA 2P1JA 1FK9A 1Q9YA 4DWIA 4FK4A 1RBVA 1BIUA 4FW2A 1KVCA 3NAEA 1BQMA 1VSJA 1LWCA 2Z1HA 4E7HA 3QETA 3SQ2A 4DS4A 3M8QA 4M41A 4CIFA 1NK4A 3ZT4A 4Z4HA 1C0MA 4KHUA 1S6PA 3HO1A 4DTSA 2HMIA 4DSKA 3LZJA 4EZ9A 4FZYA 2KZZA 2KW4A 4CJLA 1RTHA 1SV5A 1TKTA 1LW0A 4C8NA 1K6YA 3AVBA 3AVKA 1NK9A 4FJGA 1ASWA 3QERA 4M3WA 3AV9A 1SUQA 1RTDA 2RPIA 4FJIA 4ZTJA 2YKMA 2OPPA 4CF9A 2FBYA 2GV9A 3L2VA 3SZ2A 2PYLA 2PZSA 2PYJA 4UQGA 2E6LA 1NOZA 5CZ1A 4FLXA 2R7YA 3V6DA 4CESA 3L2QA 3K59A 2F96A 4G1QA 4B9UA 5J1EA 1NJYA 4DU3A 2ZD1A 4AHTA 1FXXA 2FBVA 4Z4CA 4TSXA 2X78A 3LP0A 3OYJA 4HUGA 4FLWA 3AO1A 2DFEA 3QLHA 4N5SA 4DQRA 1HYZA 3SUOA 3PO5A 2O4IA 4MFBA 3KK1A 2W42A 5J2QA 3CM5A 3OYAA 2A1RA 1WNSA 3DRPA 4O5BA 1NK8A 1UOCA 3OS0A 1VSKA 1LV5A 3SQ1A 1CXUA 4AHUA 3NHGA 3V81A 4KKOA 4IFVA 4PWDA 1BIZA 4ID5A 4B9SA 1WAFA 1ZBLA 3AVGA 1ZBIA 1VK0A 3HVTA 3L3VA 5FROA 1U47A 3NH2A 4CF8A 4BWMA 1QSYA 4BDZA 2ZQBA 3RMDA 3NF6A 4PUOA 4DTMA 3QESA 4DTNA 1YVUA 2A1SA 3JSMA 4FYDA 1RT3A 4N47A 1Z25A 1WSGA 3I0RA 3MXIA 1KVAA 4HUEA 3LP3A 4CEBA 2VWJA 4CJKA 3OJUA 3L2UA 4CEOA 3V9XA 1EXQA 3KTQA 3M8PA 1VSLA 2ETJA 4FVMA 3PX4A 4FXDA 3RMBA 3LAMA 4CGHA 3ZCMA 4OKKA 1TV6A 3KJVA 4BE1A 2RF2A 1N5YA 2B4JA 1L3VA 4Z4FA 4YFUA 3NFAA 4Z4GA 4CGIA 1RT6A 4AHSA 1YT3A 1SKWA 3SI6A 2YKNA 3K5OA 5CYMA 5KGWA 4Y1CA 3AA4A 3MEDA 3G0ZA 4I7FA 1FKPA 3NF7A 4RW6A 3NGIA 4DFPA 3P83D 5I42A 4FZXC 4W5TA 4K8XA 1J5OA 4CK2A 1DTTA 2QKKA 3DM2A 3SPYA 3AVJA 2JGUA 3UIQA 3HYFA 3O4QA 4CJUA 4DLEA 4DTJA 4KTZA 4CHOA 3QNNA 1NKEA 4ZHRA 1SL2A 2X6SA 4O4GA 2ZE2A 3ZT1A 1DLOA 4DMNA 2G8WA 4B3OA 3AA5X 3KLGA 4DF4A 3SJJA 4DG1A 1X1PA 2E4LA 2AJQA 1SL1A 3TAGA 1Q9XA 3VQ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5I3U A;  4LD0 A;  1D5A A;  4XIU A;  3S9H A;  1ITG A;  4OGC A;  1XHX A;  3ZSY A;  4QOZ B;  2BAN A;  2OPR A;  1RCH A;  2HHQ A;  1QTM A;  4JLH A;  3QO9 A;  1T8E A;  4KHQ A;  1HNV A;  3AVI A;  4CK1 A;  1KCF A;  2O4G A;  4FJL A;  2XY6 A;  2YNG A;  1RTI A;  3K2P A;  4KRF A;  4M3U A;  4N76 A;  4CHY A;  4DTO A;  1QS4 A;  1JLA A;  4CFB A;  4CJQ A;  2G8I A;  3G10 A;  1RDC A;  2Y1J A;  3V9W A;  1TAU A;  3AA2 A;  3OYL A;  4FJ8 A;  4OVL A;  5HP1 A;  3OS2 A;  3MAQ A;  1UAX A;  4DSE A;  1KLM A;  3AVL A;  4DFK A;  3PV8 A;  3CQ8 A;  2YV0 X;  3CM6 A;  4KTQ A;  2Z1G A;  4DQP A;  1QSS A;  3RRH A;  1TGO A;  2VWK A;  2YNI A;  3VQA A;  4CFD A;  1C1A A;  3NDK A;  4FLZ A;  4FCY A;  3SUQ A;  4FM1 A;  1MU2 A;  4ID1 A;  1RT2 A;  4NYN A;  2HND A;  1X9M A;  3D45 A;  3DRS A;  3HPG A;  3NCI A;  3QIP A;  1TVR A;  1CXQ A;  4E19 A;  5KGX A;  2E6M A;  3DLB A;  5FRM A;  4RW4 A;  1SL0 A;  1JLC A;  2RN2 A;  3K5N A;  4BE2 A;  3U3Y A;  3QNO A;  3U6F A;  4B9V A;  4J2A A;  3HST B;  3ZT0 A;  1L3T A;  4KAZ A;  1RBT A;  3DI6 A;  3DLK A;  4CJ4 A;  4CHQ A;  1A5V A;  3VQ9 A;  1WSE A;  1L3S A;  4FJK A;  4BAC A;  4RW9 A;  1A5X A;  1RDA A;  1S6Q A;  1JLG A;  3IG1 A;  1Y97 A;  4CGJ A;  2XO7 A;  1S9E A;  1TKZ A;  3AVA A;  2P5G A;  4F4K A;  4CF1 A;  3KK3 A;  1VSM A;  2ATQ A;  1XI1 A;  5SWM A;  2OZM A;  1RT1 A;  2ITG A;  5E41 A;  4O0J A;  3AO2 A;  3LWM A;  4CCH A;  4NYF A;  3NE6 A;  1IKV A;  4J2E A;  4M3X A;  4Q5V A;  4N56 A;  4KI6 A;  4FK2 A;  1RBS A;  1BL3 A;  1N6Q A;  3D0P A;  3NH0 A;  2G8K A;  3RR8 A;  3ITH A;  4BWJ A;  2XY7 A;  3ISN C;  1ZBU A;  5JS1 A;  1A5W A;  2X6N A;  4FM2 A;  4CER A;  4CEQ A;  1CLQ A;  3OJS A;  2QXF A;  3AO4 A;  4O44 A;  3K58 A;  4KO0 A;  3CFP A;  5C42 A;  4FJ9 A;  2OZS A;  5C24 A;  3OYM A;  4RG8 A;  5EU7 A;  3VQP A;  3CYM A;  3ZSR A;  4JS5 A;  3RR7 A;  3KK2 A;  3PUF A;  3T19 A;  4JRQ A;  3S3O A;  1HYV A;  3LZI A;  3SUP A;  1TK8 A;  4FLU A;  4DFM A;  5FRN A;  3ZSQ A;  1JLE A;  2HNZ A;  3H08 A;  4LSL A;  3HVR A;  3NH1 A;  4DSJ A;  1B9D A;  4OLB A;  3OYD A;  4DQS A;  3CFR A;  3NF8 A;  2KTQ A;  4CEC A;  3K5M A;  4HHT A;  1TAQ A;  1WSH A;  4B9L A;  4H4O A;  3OS1 A;  1WSF A;  1X9S A;  2KQ2 A;  4H4M A;  3VQ7 A;  4CF2 A;  1EP4 A;  2EX3 A;  1WAJ A;  4E1M A;  4C8O A;  4E7K A;  2YHB A;  4NCG A;  4FJX A;  5DMR A;  4DF8 A;  1HRH A;  4OPJ A;  4FLV A;  2LSN A;  5CZ2 A;  1VSF A;  1ZYQ A;  3AVC A;  3LWL A;  1RBU A;  3THV A;  4EP5 A;  3DMJ A;  4CGD A;  3VQE A;  3HL8 A;  3LPU A;  3QEI A;  3B6P A;  3VQC A;  5J2M A;  1BQN A;  1KTQ A;  4AHC A;  1CZ9 A;  3L2R A;  3KLE A;  4IG3 A;  1IG9 A;  3I8D A;  3TAE A;  2IAJ A;  1RT7 A;  3V9Z A;  1QHT A;  3O4N A;  1D9F A;  3ZSV A;  1BCM A;  1HMV A;  4M45 A;  2B5J A;  4CIG A;  1REV A;  5HRS A;  5HRN A;  1BGX T;  3C6T A;  3SQ0 A;  3RTV A;  2XRI A;  4LH5 A;  3WNE A;  1S1W A;  2Z1I A;  4CJ5 A;  2VG5 A;  4AIL C;  4F3T A;  4FM0 A;  5CYQ A;  3SNN A;  4CHP A;  2GBZ A;  1X9W A;  3KD5 E;  2YHA A;  1W9H A;  4M3T A;  4W5N A;  1L3U A;  3I0S A;  2P5O A;  3SQ4 A;  1RNH A;  3QIO A;  2OPS A;  4PA1 A;  3OY9 A;  3TAR A;  4B8A B;  4E7I A;  1LAV A;  1KSP A;  2PY5 A;  4CEF A;  3LAK A;  4OKJ A;  4Z4I A;  1RDD A;  1RTJ A;  1IKW A;  1RDB A;  3MEG A;  3S3N A;  2HHS A;  1J54 A;  3KKR A;  1WN7 A;  1B92 A;  3AO3 A;  3KIO A;  5CY4 A;  4F2R A;  3CG7 A;  3AA3 A;  1XC9 A;  1EET A;  4CJR A;  4E7L A;  4FJJ A;  3C6U A;  3OYE A;  4I9L A;  1JLQ A;  1QE1 A;  3AO5 A;  4PY5 A;  5J2N A;  2OYQ A;  4ELU A;  1VRT A;  5KTQ A;  3LAL A;  2Z1J A;  3F9K A;  4RW7 A;  2BDP A;  2XHB A;  1RT5 A;  3M8R A;  1TK0 A;  4KB1 A;  3ULD A;  1C0U A;  1G15 A;  1TL3 A;  4E3S A;  1DTQ A;  3SV3 A;  3HPO A;  3L2W A;  3MEC A;  3TAF A;  4F2S A;  2F8S A;  2DY4 A;  1NKC A;  2Q3S A;  1JL2 A;  1U04 A;  1NOY A;  4B9N A;  5JS2 A;  2BGG A;  1BI4 A;  3TAQ A;  1GOC A;  1VSE A;  4DTP A;  1XHZ A;  4OGE A;  4DTR A;  3AVM A;  4FJM A;  2GUI A;  1QQC A;  4CK3 A;  4OLA A;  1NK0 A;  2D0B A;  1O1W A;  1WLJ A;  1BI4 B;  4CJV A;  1HJR A;  2DTU A;  2BE2 A;  5C25 A;  4CGF A;  4CJE A;  1GOB A;  1S1V A;  3IRX A;  4FJN A;  3C94 A;  4Q0B A;  4Z4E A;  3MEE A;  3V4I A;  1S1U A;  4KTW A;  3ZSX A;  4DTU A;  3RMC A;  1U49 A;  3QEX A;  3RWU A;  1WSJ A;  5HBM A;  3HM9 A;  3OYI A;  5KRS A;  4HCB A;  4L8R B;  2Y1I A;  4M3Y A;  3LAN A;  2F8T A;  1RT4 A;  4FK0 A;  1C1C A;  1U48 A;  3ZSW A;  3VQ4 A;  3WNH A;  4EZ6 A;  3P1G A;  5DK5 A;  3LDS A;  4DSF A;  1D8Y A;  2P51 A;  4E7J A;  3EY1 A;  4WE1 A;  4JS4 A;  2XY5 A;  4DSI A;  2IC3 A;  4IBN A;  3NGZ A;  4FJ5 A;  4CE9 A;  3LP2 A;  3KKS A;  3IS9 A;  4CFC A;  1J53 A;  2EHG A;  4E1N A;  4FJH A;  4J2B A;  4ELV A;  1HQE A;  4QCL A;  3PX6 A;  4OJR A;  4AHR A;  3HP9 A;  2HW3 A;  3ALY A;  3DOL A;  4AHV A;  2D0A A;  4CJ3 A;  4B9M A;  3VA0 A;  4KPY A;  1J9A A;  4DLG A;  4KHY A;  4GMJ B;  1WSI A;  1HQU A;  1IH7 A;  1YTA A;  4RW8 A;  5KI6 A;  2HHW A;  3WNF A;  3SYZ A;  1ASV A;  3V1R A;  2FC0 A;  1UWB A;  2HHX A;  3QEP A;  1JXE A;  1JXB A;  2IGI A;  3O3H A;  3OYN A;  3OYG A;  3VA3 A;  1U45 A;  4C8L A;  3KLF A;  1ZBH A;  1XWL A;  3T1A A;  3DLH A;  3VQ5 A;  3DLG A;  1Z26 A;  2RKI A;  3OYC A;  3F73 A;  4CFA A;  5D3G A;  4ELT A;  1HYS A;  4CJP A;  3TI0 A;  4ZTF A;  4OKE A;  4KHN A;  3A2F A;  4I2P A;  3OYB A;  1QSL A;  4BDP A;  3L8B A;  4OPK A;  3V1O A;  2QKB A;  2D0C A;  3BGR A;  1UA0 A;  5SZT A;  3M8S A;  3CFO A;  1ZBF A;  4Y1D A;  4DFJ A;  4FLY A;  4HVJ A;  3OYH A;  3V9U A;  1IKX A;  4KHS A;  2FBX A;  3HPH A;  4ICL A;  4EP4 A;  3TAN A;  2QK9 A;  4IFY A;  3P5J A;  1EKE A;  2OA8 A;  2IOC A;  1BCO A;  4BDY A;  2WOM A;  4KHW A;  4CEA A;  4E0D A;  1I39 A;  1RIL A;  2HNY A;  2VG7 A;  1SKS A;  4CJS A;  3AVH A;  1KVB A;  4QAG A;  3DLR A;  3L3U A;  4FZZ A;  3AVF A;  3QEV A;  1YTU A;  4HCC A;  2HHT A;  2WON A;  3ZT3 A;  1SKR A;  3ZSO A;  1S1X A;  1JKH A;  1JLB A;  4W5O A;  3SCX A;  1KFD A;  1LWF A;  4AH9 A;  3QEW A;  2HVI A;  4C8K A;  3ZSZ A;  1D9D A;  1VSI A;  1IO2 A;  3BDP A;  3SV4 A;  4M3Z A;  3LPT A;  5J2P A;  1LAW A;  1S5J A;  1W0H A;  2DFH A;  4IDK A;  4CJW A;  4O0I A;  4MQ3 A;  3QIN A;  3HT3 A;  3MXM A;  1C6V A;  4BE0 A;  1NK5 A;  3NGY A;  4B08 A;  3HXM A;  1EX4 A;  1HNI A;  4B9T A;  3E01 A;  1GOA A;  1KLN A;  1KRP A;  2HVH A;  1BHL A;  4NCB A;  4KRE A;  3TAM A;  2VG6 A;  1R0A A;  4DS5 A;  4KV8 A;  4LSN A;  3LP1 A;  3OVN A;  3HP6 A;  4CIE A;  4M3R A;  1T7P A;  4M42 A;  2HB5 A;  3VQB A;  4CJF A;  4GVM A;  3KD1 E;  3TAP A;  3V1Q A;  4R5P A;  1NJW A;  5FDL A;  3VQQ A;  2FBT A;  4O55 A;  2KZM A;  1T03 A;  1ASU A;  3SPZ A;  1RBR A;  1NKB A;  3RRG A;  4IKF A;  3OYK A;  4K8Z A;  1HPZ A;  2NUB A;  1C1B A;  3MXJ A;  2JLE A;  4JRP A;  4CF0 A;  1JLF A;  2D5R A;  1CZB A;  4CJT A;  5T7B A;  4CHZ A;  2YNH A;  3C95 A;  1UA1 A;  3OYF A;  3K5L A;  2KFZ A;  2OPQ A;  3DOK A;  3B6O A;  1VRU A;  4B8C A;  3ASM A;  2DFF A;  4F3O A;  4H8K A;  1IKY A;  3KLH A;  4CGG A;  4E89 A;  2G8H A;  3TAB A;  3HK2 A;  2HHV A;  2B6A A;  3WNG A;  2HHU A;  5HRR A;  1U4B A;  4GW6 A;  4HTU A;  4FLT A;  3NBP A;  1FKO A;  2I5J A;  3PY8 A;  3NF9 A;  4DQQ A;  4DU4 A;  1JL1 A;  4LH4 A;  3TWH A;  1LW2 A;  4I9Q A;  4I2Q A;  3VQ6 A;  4N41 A;  1NJZ A;  1BIS A;  4KB0 A;  4HUF A;  2G8F A;  2G8V A;  4CED A;  3DYA A;  4IG0 A;  1I3A A;  4FW1 A;  3VQD A;  1T05 A;  1TKD A;  1NJX A;  2G8U A;  4DQI A;  5K14 A;  2XY8 A;  3KLI A;  4Z0U A;  5KRT A;  3K57 A;  3EYZ A;  2IS3 A;  4CEZ A;  5HRO A;  3EZ5 A;  4PQU A;  3V9S A;  4F8R A;  4YNQ A;  3HJF A;  1VSD A;  3O3G A;  1NK7 A;  3T3F A;  3DRR A;  4J2D A;  4DU1 A;  3DLE A;  1TKX A;  3U3G A;  4DTX A;  1B9F A;  5HRP A;  1KFS A;  1Q8I A;  1LWE A;  3SUN A;  3PO4 A;  4DSL A;  1S9G A;  2YNF A;  3VN5 A;  3TR8 A;  4CEE A;  4NCA A;  2IDO A;  4KFB A;  3O3F A;  3S3M A;  2KFN A;  3ZT2 A;  3RMA A;  4FJ7 A;  4CHN A;  1TK5 A;  1F21 A;  4KI4 A;  5HLF A;  1C0T A;  3FFI A;  2X74 A;  3IAY A;  3AVN A;  4C8M A;  1VSH A;  4LY7 A;  1S1T A;  1L5U A;  1NK6 A;  3JYT A;  3PX0 A;  1TL1 A;  4W5R A;  4W5Q A;  2P1J A;  1FK9 A;  1Q9Y A;  4DWI A;  4FK4 A;  1RBV A;  1BIU A;  4FW2 A;  1KVC A;  3NAE A;  1BQM A;  1VSJ A;  1LWC A;  2Z1H A;  4E7H A;  3QET A;  3SQ2 A;  4DS4 A;  3M8Q A;  4M41 A;  4CIF A;  1NK4 A;  3ZT4 A;  4Z4H A;  1C0M A;  4KHU A;  1S6P A;  3HO1 A;  4DTS A;  2HMI A;  4DSK A;  3LZJ A;  4EZ9 A;  4FZY A;  2KZZ A;  2KW4 A;  4CJL A;  1RTH A;  1SV5 A;  1TKT A;  1LW0 A;  4C8N A;  1K6Y A;  3AVB A;  3AVK A;  1NK9 A;  4FJG A;  1ASW A;  3QER A;  4M3W A;  3AV9 A;  1SUQ A;  1RTD A;  2RPI A;  4FJI A;  4ZTJ A;  2YKM A;  2OPP A;  4CF9 A;  2FBY A;  2GV9 A;  3L2V A;  3SZ2 A;  2PYL A;  2PZS A;  2PYJ A;  4UQG A;  2E6L A;  1NOZ A;  5CZ1 A;  4FLX A;  2R7Y A;  3V6D A;  4CES A;  3L2Q A;  3K59 A;  2F96 A;  4G1Q A;  4B9U A;  5J1E A;  1NJY A;  4DU3 A;  2ZD1 A;  4AHT A;  1FXX A;  2FBV A;  4Z4C A;  4TSX A;  2X78 A;  3LP0 A;  3OYJ A;  4HUG A;  4FLW A;  3AO1 A;  2DFE A;  3QLH A;  4N5S A;  4DQR A;  1HYZ A;  3SUO A;  3PO5 A;  2O4I A;  4MFB A;  3KK1 A;  2W42 A;  5J2Q A;  3CM5 A;  3OYA A;  2A1R A;  1WNS A;  3DRP A;  4O5B A;  1NK8 A;  1UOC A;  3OS0 A;  1VSK A;  1LV5 A;  3SQ1 A;  1CXU A;  4AHU A;  3NHG A;  3V81 A;  4KKO A;  4IFV A;  4PWD A;  1BIZ A;  4ID5 A;  4B9S A;  1WAF A;  1ZBL A;  3AVG A;  1ZBI A;  1VK0 A;  3HVT A;  3L3V A;  5FRO A;  1U47 A;  3NH2 A;  4CF8 A;  4BWM A;  1QSY A;  4BDZ A;  2ZQB A;  3RMD A;  3NF6 A;  4PUO A;  4DTM A;  3QES A;  4DTN A;  1YVU A;  2A1S A;  3JSM A;  4FYD A;  1RT3 A;  4N47 A;  1Z25 A;  1WSG A;  3I0R A;  3MXI A;  1KVA A;  4HUE A;  3LP3 A;  4CEB A;  2VWJ A;  4CJK A;  3OJU A;  3L2U A;  4CEO A;  3V9X A;  1EXQ A;  3KTQ A;  3M8P A;  1VSL A;  2ETJ A;  4FVM A;  3PX4 A;  4FXD A;  3RMB A;  3LAM A;  4CGH A;  3ZCM A;  4OKK A;  1TV6 A;  3KJV A;  4BE1 A;  2RF2 A;  1N5Y A;  2B4J A;  1L3V A;  4Z4F A;  4YFU A;  3NFA A;  4Z4G A;  4CGI A;  1RT6 A;  4AHS A;  1YT3 A;  1SKW A;  3SI6 A;  2YKN A;  3K5O A;  5CYM A;  5KGW A;  4Y1C A;  3AA4 A;  3MED A;  3G0Z A;  4I7F A;  1FKP A;  3NF7 A;  4RW6 A;  3NGI A;  4DFP A;  3P83 D;  5I42 A;  4FZX C;  4W5T A;  4K8X A;  1J5O A;  4CK2 A;  1DTT A;  2QKK A;  3DM2 A;  3SPY A;  3AVJ A;  2JGU A;  3UIQ A;  3HYF A;  3O4Q A;  4CJU A;  4DLE A;  4DTJ A;  4KTZ A;  4CHO A;  3QNN A;  1NKE A;  4ZHR A;  1SL2 A;  2X6S A;  4O4G A;  2ZE2 A;  3ZT1 A;  1DLO A;  4DMN A;  2G8W A;  4B3O A;  3AA5 X;  3KLG A;  4DF4 A;  3SJJ A;  4DG1 A;  1X1P A;  2E4L A;  2AJQ A;  1SL1 A;  3TAG A;  1Q9X A;  3VQ8 A; 
#chains in the Genus database with same CATH topology
 4LD0 A;  1N34 K;  4XIU A;  1RCH A;  1QTM A;  3P39 A;  1O13 A;  3AVI A;  4CK1 A;  3WXJ A;  1KCF A;  3AAR A;  4YOW A;  2YNG A;  5M1N A;  1QVF M;  3CCM N;  5KPZ A;  4DTO A;  3G10 A;  3E9L A;  2Y1J A;  3AA2 A;  3C6H A;  4OVL A;  4FPB A;  4DCH A;  1J5E K;  4DSE A;  3LL3 A;  3ATU A;  2YV0 X;  3I55 N;  3RRH A;  4PKG A;  4JKF A;  4CZI A;  5BN8 A;  4ID1 A;  1OKJ A;  3GBT A;  4CZJ A;  4BRM A;  3QIP A;  1CXQ A;  5KGX A;  3CC4 N;  4K25 A;  5FRM A;  4QS8 A;  2UUA K;  1ATR A;  1JLC A;  3U3Y A;  1T3V A;  3FLC O;  3ZYY X;  3HI0 A;  1A5X A;  1RDA A;  1S6Q A;  1JLG A;  3O8M A;  3IG1 A;  4CGJ A;  3AVA A;  2P5G A;  2P9K B;  1XI1 A;  2OZM A;  1RT1 A;  2AA4 A;  4BGB A;  1OH5 A;  5AQI A;  2VQF K;  4M7X A;  2FXU A;  4NO7 A;  2EWS A;  2YI1 A;  4M3X A;  4Q5V A;  4N56 A;  5BR8 K;  2OAN A;  3CPE A;  4WFN L;  4FK2 A;  3D0P A;  3ITH A;  1BO5 O;  1A5W A;  2X6N A;  4CER A;  4CEQ A;  2FSN A;  2VYP A;  4JI2 K;  4R79 A;  4BQZ A;  1I94 K;  3N4Q A;  3U4L A;  3OYM A;  3SAH A;  3VQP A;  3RR7 A;  1HYV A;  2CGK A;  4FLU A;  4YDU A;  4DFM A;  1HKC A;  2QI2 A;  3HVR A;  5H1S Q;  1B9D A;  3CFR A;  1VQM N;  2KTQ A;  4BRP A;  4HHT A;  4B9L A;  3IUC A;  3OS1 A;  4H4M A;  4B9Q A;  3VQ7 A;  1EP4 A;  1WAJ A;  5AQF A;  1SS6 A;  4FJX A;  1HRH A;  4OPJ A;  1CZA N;  4FLV A;  1HLU A;  5CZ2 A;  1VSF A;  1ZYQ A;  1RBU A;  3THV A;  3R8E A;  3VQE A;  1DEJ A;  5J2M A;  2NZT A;  3I8D A;  2IAJ A;  3VTI A;  3V9Z A;  1BCM A;  1W7A A;  1W97 L;  4M45 A;  4FVU A;  3QFP A;  2E8A A;  5HRS A;  1BGX T;  3J8A A;  2ZF5 O;  4DV1 K;  4HTL A;  2XRI A;  4LH5 A;  4CJ5 A;  2VG5 A;  2WUS A;  4FM0 A;  3KD5 E;  1W9H A;  1K8K A;  2P5O A;  3SQ4 A;  4GKJ K;  3VES A;  3TAR A;  4EIA A;  1K8K B;  2IVN A;  2V51 B;  4H0T B;  1KSP A;  2PY5 A;  2P9P A;  2IVP A;  3UB5 A;  3MEG A;  1RDB A;  1WN7 A;  3CHW A;  3KIO A;  4F2R A;  1XC9 A;  3AA3 A;  2GEL A;  4CJR A;  4FJJ A;  3C6U A;  3OYE A;  2D0O A;  3EE8 A;  1JLQ A;  5J2N A;  4YOX A;  3EEQ A;  1GLJ O;  3F9K A;  3CCQ N;  4O8K A;  2CGJ A;  1G99 A;  3DWL A;  2XHB A;  3AAQ A;  1P90 A;  3VEY A;  1DTQ A;  3SV3 A;  2F8S A;  3TAF A;  4F2S A;  1JL2 A;  5JMV A;  5JS2 A;  1BI4 A;  2GUI A;  5M1F A;  4DV6 K;  2D0B A;  1WLJ A;  1BI4 B;  4CJV A;  2VCP A;  5C25 A;  1S1V A;  3QIC A;  4Z4E A;  4JKA A;  4IKF A;  1S1U A;  3ZSX A;  3RMC A;  1U49 A;  3HM9 A;  2FSJ A;  2F8T A;  3LAN A;  5AQP A;  1GLB G;  3WNH A;  4EZ6 A;  1S3X A;  1D8Y A;  4DSI A;  2XY5 A;  2UXC K;  4IBN A;  3NGZ A;  1NGJ A;  3KKS A;  4MLE A;  3IS9 A;  3S41 A;  4CFC A;  4FJH A;  4ELV A;  4FWN A;  5C0Y A;  4OJR A;  4AHR A;  1BDG A;  3PSF A;  2HW3 A;  1U2V A;  3ALY A;  4B1U B;  4CJ3 A;  4KPY A;  4KHY A;  5AQR A;  5IWA K;  4BR7 A;  2HHW A;  3V1R A;  2Q97 A;  5ELZ A;  4LFC K;  2HHX A;  2IGI A;  3T7Z A;  5BRH A;  3T1A A;  3DLH A;  3DLG A;  1Z26 A;  2RKI A;  4H0V B;  4WQ4 C;  4CFA A;  3Q7C A;  3TI0 A;  4KHN A;  1HKB A;  4YOV A;  4BDP A;  5AQN A;  2IVO A;  1MWM A;  5SZT A;  1ZBF A;  4Y1D A;  2P9S A;  4I6M A;  4FLY A;  4NLC A;  3VGM A;  3HPH A;  4ICL A;  2QWR A;  3TAN A;  2QK9 A;  4IFY A;  4RTF D;  3WQU A;  3NVM A;  2OA8 A;  2Q36 A;  3CI5 A;  4JI4 K;  2WOM A;  2HST A;  4CEA A;  1RIL A;  4IFE A;  3AVH A;  4QAG A;  3L3U A;  1YTU A;  1NG9 A;  3AVF A;  2HHT A;  4HCC A;  3SMP A;  3ZT3 A;  5KPT A;  1ZC6 A;  3WXL A;  2FLO A;  4JI3 K;  4WQ4 A;  4AH9 A;  4BRE A;  3QEW A;  3A8Y A;  1XC3 A;  1IO2 A;  1NM1 A;  5BPN A;  3CCE N;  4JKG B;  3LPT A;  1S5J A;  5EVZ A;  4IDK A;  4O0I A;  4MQ3 A;  4BR2 A;  1XUP O;  3MXM A;  3C6A A;  1KAZ A;  3J81 O;  1EX4 A;  3E01 A;  4ISF A;  4BRD A;  1BHL A;  4KRE A;  1J6Z A;  3EE9 A;  4DV0 K;  1HNX K;  1V4S A;  1GLE G;  4M3R A;  1NBW A;  4M42 A;  3CCS N;  3L6Q A;  3MCA B;  1QZ5 A;  4H5R A;  4O55 A;  4XEI A;  4FWR A;  4NLB A;  5LMU K;  4BRG A;  1HPZ A;  4A5B A;  3MXJ A;  1DKG D;  4JRP A;  2D5R A;  1CZB A;  4CJT A;  5T7B A;  4CHZ A;  2YNH A;  1TYQ B;  2OPQ A;  1VRU A;  4H8K A;  2I7P A;  4IOX A;  2G8H A;  2VGM A;  2B6A A;  4GW6 A;  1FKO A;  3SAF A;  3Q7B A;  1JL1 A;  4LH4 A;  3MN5 A;  3TWH A;  1LW2 A;  1EWR A;  2NRW A;  4Z94 A;  1BIS A;  4CZL A;  4HUF A;  4CED A;  2A5X A;  4IG0 A;  1I3A A;  3VQD A;  4DQI A;  2XY8 A;  4E1J A;  3O9S A;  4CEZ A;  4BVO A;  4PQU A;  2I7N A;  3HJF A;  3DRR A;  3U3G A;  3NVK A;  3MN7 A;  5AQS A;  1KFS A;  1Q8I A;  4XH4 A;  4YY3 K;  3VN5 A;  3TR8 A;  3MDQ A;  4CZE A;  2KFN A;  1U6Z A;  4CVN E;  3W3D A;  1F21 A;  3SLC A;  3THY A;  2W40 A;  2X74 A;  4DV4 K;  4X65 K;  3AVN A;  4AM6 A;  3FR0 A;  2O8D B;  4W5R A;  3R1X A;  4DWI A;  1ATN A;  1RBV A;  3NAE A;  1KVC A;  1LWC A;  2Z1H A;  4E7H A;  3QET A;  3VET A;  3ZT4 A;  3HO1 A;  1WOQ A;  4DTS A;  4DSK A;  3QBX A;  3JS6 A;  2KW4 A;  4CJL A;  1SV5 A;  4FJG A;  4M3W A;  2ZWH A;  3O9Q A;  4FJI A;  4BG9 A;  3FZM A;  3KWI A;  4CF9 A;  2GV9 A;  2PYL A;  4DUZ K;  3VEN A;  2QWN A;  2NRH A;  4FLX A;  3V6D A;  1XMQ K;  5M1O A;  4G1Q A;  4AHT A;  3MN6 A;  2FBV A;  4Z4C A;  5LJV A;  2X78 A;  3OYJ A;  2DFE A;  1QZ6 A;  3D7E O;  5J2Q A;  5EOY A;  3CM5 A;  3OYA A;  3DRP A;  4ISG A;  4AHU A;  3NHG A;  3CQY A;  4IFV A;  4PWD A;  1JCE A;  3AVG A;  4DUY K;  4ILH A;  2V52 B;  1U47 A;  4CF8 A;  3CJC A;  4PKI A;  5TKW A;  3RMD A;  4PUO A;  1XNR K;  5AR0 A;  3JSM A;  3CET A;  2E2O A;  5EY4 A;  3MXI A;  3ENO A;  4K41 A;  4CEB A;  3IDH A;  3OJU A;  1GLD G;  2PAV A;  3K9K A;  1WB9 A;  1VSL A;  2ETJ A;  3PX4 A;  3RMB A;  3LAM A;  1TV6 A;  1L3V A;  4DV5 K;  4Z4F A;  2NRV A;  3NFA A;  1NGA A;  4EFH A;  2YKN A;  5KGW A;  3MED A;  4DFP A;  4W5T A;  4CK2 A;  1DTT A;  3DJC A;  2QKK A;  3TSQ A;  3HYF A;  1NKE A;  3QBW A;  4V19 S;  4B3R K;  2G8W A;  3L0Q A;  4DF4 A;  4YOY A;  3SJJ A;  2E4L A;  4ISE A;  3VEW A;  3VQ8 A;  4J8F A;  5I3U A;  4BRL A;  3S9H A;  4OGC A;  2HHQ A;  3VEO A;  2P9N A;  2DPN A;  1T8E A;  1HNV A;  4FJL A;  1VQN N;  1YXQ A;  1RTI A;  3K2P A;  4CHY A;  1QS4 A;  2G8I A;  1RDC A;  2QA4 N;  4DR5 K;  1EO1 A;  5HP1 A;  2GEM A;  4DFK A;  1KLM A;  4F9O A;  3AGR A;  3CQ8 A;  3CM6 A;  5HOO A;  2VWK A;  4FOI A;  3VQA A;  1E3M A;  4JYA K;  4FCY A;  5CE3 A;  1IBL K;  1RT2 A;  1KAY A;  2HND A;  1X9M A;  3D45 A;  3LDP A;  3HPG A;  3NCI A;  4WFB L;  4E19 A;  3DLB A;  5M1K A;  2V7Y A;  1SL0 A;  4GV6 A;  3J7A P;  3ZT0 A;  3T69 A;  4JD2 A;  4L3Q A;  4CHQ A;  3ZX3 A;  3BZC A;  4FJK A;  3WEE A;  5F1X A;  4JD2 B;  1VQ7 N;  4F4K A;  4CF1 A;  3FZL A;  2ATQ A;  5LY3 A;  5E41 A;  4O0J A;  3AO2 A;  1XMO K;  4NYF A;  3NE6 A;  1KQS M;  2ZJQ L;  4KI6 A;  1RBS A;  1N6Q A;  5M1P A;  2NNW A;  4BWJ A;  3ISN C;  1ZBU A;  3BUZ B;  5GIO A;  5GAE P;  1NGF A;  3OJS A;  4O44 A;  3AO4 A;  3CFP A;  5C24 A;  3VGK A;  3CYM A;  5ADX H;  4EHU A;  1NMN A;  5FRN A;  4JKE A;  1JLE A;  4BVP A;  3NH1 A;  3OYD A;  3CCR N;  4IDH A;  3NF8 A;  1BG3 A;  4CEC A;  1WSH A;  3ENH A;  4MLH A;  1T6D A;  3ULE A;  1X9S A;  2KQ2 A;  1N8R O;  4E7K A;  5AZJ A;  4DF8 A;  1WBD A;  4H5T A;  2O8B A;  4DQ8 A;  3LWL A;  3DMJ A;  3EZW A;  5AZJ B;  3VQC A;  1BQN A;  1IG9 A;  4IG3 A;  3TPQ A;  2O8B B;  3O5B A;  3ZSV A;  2WFB A;  1HMV A;  2B5J A;  5HRN A;  3ENB A;  3C6T A;  3O6W A;  2YCH A;  5JVH L;  3WNE A;  3RTV A;  1S1W A;  3O80 A;  4PKH A;  4AIL C;  5CYQ A;  4CHP A;  1M1K O;  4M3T A;  4OX9 K;  3KHY A;  3I0S A;  4FL9 A;  4JKC A;  3FE1 A;  2OPS A;  4MO4 A;  4BRI A;  4B8A B;  4E7I A;  1ZBS A;  4JI8 K;  4Z4I A;  3VPZ A;  3S3N A;  1J54 A;  3KKR A;  2YHY A;  5CY4 A;  3CG7 A;  4MDA A;  1EET A;  1N33 K;  5B8H A;  3SJH A;  2KLA A;  1ATS A;  3J80 O;  4H5N A;  4ELU A;  3LAL A;  2BDP A;  5KQD A;  1RT5 A;  4KB1 A;  3BY5 A;  3D2E A;  3KWG A;  3HBT A;  2F9T A;  4JN4 A;  4E3S A;  3L2W A;  5JLF A;  1NKC A;  4BY9 C;  2Q3S A;  3D2E B;  5BRD A;  5I9E B;  4B9N A;  2BGG A;  3TAQ A;  3C65 A;  1VSE A;  4DTP A;  4BRO A;  5AQT A;  4CK3 A;  2F7T A;  1VHX A;  4CGF A;  4UY8 O;  4CJE A;  1GOB A;  4BRC A;  3IRX A;  4FJN A;  4Q0B A;  1X9J A;  3RWU A;  4HCB A;  4L8R B;  4M3Y A;  4YDU C;  1RT4 A;  4OPA A;  4BR0 A;  3VQ4 A;  4JKD A;  4GKK K;  3P1G A;  4B3S K;  1NGG A;  4WE1 A;  4JS4 A;  3P31 A;  4FJ5 A;  3VEZ A;  3VTH A;  1E4G T;  2KKZ A;  4E1N A;  4QCL A;  1IJJ A;  2ZM6 K;  3K0S A;  4LF7 K;  4AHV A;  2D0A A;  4B9M A;  3D6R A;  3VA0 A;  4BRA A;  1HQU A;  5KI6 A;  3PIP L;  3PIO L;  3WNF A;  2E2N A;  1ASV A;  5AQO A;  3VA3 A;  1ZBH A;  2UU9 K;  1YVN A;  4CBW A;  4CZM A;  3VQ5 A;  3SMS A;  1HYS A;  4HWI A;  4H5V A;  3ATV A;  2QTD A;  3A2F A;  3ZX2 A;  3OYB A;  5KPR A;  5AQW A;  1NGC A;  3V1O A;  3CME N;  2D0C A;  4RWT A;  2RHK A;  3M8S A;  4X64 K;  4CBU A;  3OYH A;  5E26 A;  1IKX A;  2FBX A;  4EP4 A;  3P5J A;  3WQT A;  1EKE A;  1YJW N;  2IOC A;  1BCO A;  5AQQ A;  4BDY A;  4GY2 B;  4E0D A;  3DAW A;  3CCU N;  1KVB A;  1D4X A;  5AQX A;  2QWM A;  2ZGZ A;  4H0P A;  3SCX A;  1KFD A;  5DM7 L;  2HVI A;  1D9D A;  1VSI A;  3THX A;  3BDP A;  1YAG A;  3E66 A;  2DFH A;  2BTF A;  3OBY A;  3VF6 A;  1NK5 A;  4B08 A;  4B9T A;  1KLN A;  5A2Q O;  4NCB A;  2NRX A;  4A59 A;  3VEV A;  2ZJR L;  5C15 A;  3OVN A;  3HP6 A;  5AQV A;  1T7P A;  4CJF A;  3TAP A;  1GLC G;  3V1Q A;  4R5P A;  1NJW A;  5FDL A;  2P9P B;  1ASU A;  3SPZ A;  1RBR A;  3PLA A;  4XH1 A;  2NUB A;  1C1B A;  3TTC A;  1JLF A;  3C95 A;  3K5L A;  4FWO A;  3DOK A;  4RCH A;  4F3O A;  3G6E N;  1IKY A;  4PL8 A;  5HRR A;  3MMV A;  3E1Y A;  4DR2 K;  1SZ2 A;  4DQQ A;  4DU4 A;  3RVC A;  3VQ6 A;  1YF5 L;  4LF4 K;  4BRH A;  3CJA A;  1T05 A;  4Z0U A;  4NXM K;  2F9W A;  3CJ1 A;  5HRO A;  3EZ5 A;  3H3N O;  1VSD A;  3T3F A;  3BZK A;  1NMD A;  1M90 O;  1ILY A;  3AY9 A;  3H1Q A;  4H0Y B;  4JHD A;  1KC8 O;  3PO4 A;  2IDO A;  4LC9 B;  4KFB A;  3ZT2 A;  3IKM A;  3RMA A;  4JHD B;  1C0T A;  3R3L A;  3R6M A;  3IAY A;  2HOE A;  1VSH A;  4FO0 A;  1NK6 A;  1U2V B;  1TL1 A;  1GLL O;  4W5Q A;  1FK9 A;  4CD1 A;  1Q9Y A;  1BQM A;  3CMA N;  4JI6 K;  4KHU A;  3VOV A;  2O8E A;  3P4I A;  4JEP A;  2YHW A;  1TKT A;  1LW0 A;  1K6Y A;  3AVK A;  2O8E B;  4MDB A;  1SUQ A;  1RTD A;  1HR0 K;  4ZTJ A;  4A62 A;  2PZS A;  3W0L A;  2YJF A;  1NOZ A;  5CZ1 A;  3C0B A;  3T1H K;  2P9S B;  4I6M B;  3L2Q A;  4B9U A;  2QXL A;  4X66 K;  1RDW X;  2ZD1 A;  1FXX A;  2OTL N;  4HUG A;  4DQR A;  4IJA A;  1HYZ A;  4AF1 A;  2W42 A;  3KK1 A;  2A1R A;  1WNS A;  1UOC A;  1VSK A;  1TUU A;  3N4P A;  4KH6 A;  4KKO A;  3OTO K;  2FF6 A;  1WAF A;  1ZBL A;  3HVT A;  5EX5 A;  4QS9 A;  2UUC K;  4BWM A;  4JI7 K;  1QSY A;  2ZQB A;  3NF6 A;  3EO3 A;  4FYD A;  3CJ9 A;  1Z6R A;  1WSG A;  2VWJ A;  1YJ9 N;  4CZF A;  2O8F A;  1ESV A;  4FVM A;  2NRR A;  3FZF A;  4CGH A;  3ZCM A;  1N5Y A;  4YFU A;  3G0Z A;  3ID8 A;  4DR7 K;  4RW6 A;  3RSE A;  4K8X A;  1C0G A;  3L4Q A;  4CJU A;  1SL2 A;  3CJ7 A;  3QNN A;  3JAM O;  3RSE B;  3QML A;  4O4G A;  4CZH A;  2ZE2 A;  4X62 K;  3ZT1 A;  4DMN A;  3BF3 A;  2AJQ A;  1SQK A;  2HF4 A;  3TAG A;  1Q9X A;  3K5M A;  1D5A A;  3TSP A;  1ITG A;  1XHX A;  1HPM A;  3ZSY A;  2BAN A;  4QOZ B;  4JLH A;  4KHQ A;  4BRF A;  2E2P A;  1GLF O;  2WBN A;  4KRF A;  4ILG B;  4N76 A;  5LL6 Z;  3LDQ A;  1JLA A;  4CFB A;  3V9W A;  1TAU A;  4FJ8 A;  3OYL A;  4K43 A;  2ZGY A;  3OS2 A;  1UAX A;  3PV8 A;  2E88 A;  1S72 N;  4KTQ A;  4DQP A;  5JVG L;  2YNI A;  5GAG P;  3BP8 A;  4CFD A;  1C1A A;  3MWP A;  4FM1 A;  1MU2 A;  3VER A;  4NYN A;  3FGU A;  3EKU A;  4RW4 A;  3K5N A;  4BE2 A;  4B9V A;  4J2A A;  4A2B A;  3HST B;  1XNQ K;  3MX2 A;  1RBT A;  3DI6 A;  4FWP A;  3L4I A;  4CJ4 A;  1A5V A;  3I8B A;  1WSE A;  4BAC A;  3THY B;  1Y97 A;  4MO5 A;  3KK3 A;  1VSM A;  3H1V X;  3OA9 A;  5AQZ A;  4C1N I;  4H5W A;  2P9U A;  4JAX A;  5M1Q A;  1BL3 A;  1HJO A;  3NH0 A;  4JNE A;  5JS1 A;  4FM2 A;  2P9U B;  4JI5 K;  1CLQ A;  5FPN A;  2QXF A;  4KO0 A;  1JCG A;  4FJ9 A;  2PBD A;  5AFU A;  4RG8 A;  3KK2 A;  3T19 A;  4JRQ A;  1N32 K;  3VEX A;  3LZI A;  3SUP A;  2UUB K;  3H08 A;  4LSL A;  3D2F A;  4DSJ A;  1V4T A;  2A6A A;  2HHH K;  1TAQ A;  1WSF A;  2GTD A;  2VQE K;  2ASM A;  4BRN A;  4C8O A;  2YHB A;  5DMR A;  2QWP A;  5AQK A;  3HL8 A;  3PSI A;  3QEI A;  1KTQ A;  4AHC A;  1CZ9 A;  5LJW A;  3KLE A;  2ASP A;  4JK7 A;  1QHT A;  4BG8 A;  3O4N A;  5FPD A;  4FWS A;  3QDK A;  1NJI O;  2YJE A;  1VQL N;  2Z1I A;  3OW2 M;  3SNN A;  2D1K A;  1T44 A;  2GBZ A;  1X9W A;  2YHA A;  4LF6 K;  3CC7 N;  4W5N A;  1L3U A;  3OY9 A;  1RFQ A;  3H46 O;  2QEX N;  1LAV A;  4CI6 A;  4CEF A;  4DHY A;  3MCP A;  1RDD A;  1RTJ A;  2JWL A;  1VQ8 N;  1B92 A;  3AO3 A;  5BRE A;  5AZI A;  1E4F T;  4I9L A;  5IT9 O;  3FFK B;  1Q18 A;  1QE1 A;  2Q2R A;  2QM1 A;  1YI2 N;  2OYQ A;  1VRT A;  4BR5 A;  5KTQ A;  1C0F A;  4KBO A;  1W2B M;  4RW7 A;  2BUP A;  5DM6 L;  1TK0 A;  2A41 A;  1JCF A;  2P9N B;  3ULD A;  1G15 A;  1TL3 A;  4LFA K;  3HPO A;  5HL7 L;  2DY4 A;  3QB0 A;  3EKS A;  1P8Z A;  3THW A;  1NOY A;  4AQY K;  1VQ4 N;  3J7Y P;  4DTR A;  3AVM A;  5FLX O;  1O1W A;  3HOT A;  1DGK N;  5BN9 A;  3MX5 A;  1NU0 A;  4LFB K;  3V4I A;  3A0I X;  1MA9 B;  3QEX A;  5HBM A;  5KRS A;  1C1C A;  1TUY A;  3ZSW A;  2QWQ A;  3DLL L;  5DK5 A;  3I56 N;  4O8U A;  3WEE B;  2P51 A;  4E7J A;  2UXB K;  3HRG A;  3TTD A;  4CE9 A;  3LP2 A;  1JJ2 M;  1J53 A;  4ILJ A;  1HQE A;  2NRZ A;  2J4R A;  3HP9 A;  2P9L A;  2GUP A;  2HBK A;  3DOL A;  2AP1 A;  1WSI A;  4EHT A;  5JIC A;  1IH7 A;  1YTA A;  4RW8 A;  3SYZ A;  1YUW A;  3GL1 A;  2FC0 A;  5AQL A;  1JXE A;  4C8L A;  3OYN A;  3OYG A;  3KLF A;  1XWL A;  2D4W A;  3O4W A;  4KHP K;  3F2K A;  4WCE L;  2FSK A;  1Q81 O;  4ELT A;  4CJP A;  4I2P A;  1QSL A;  4OPK A;  3BGR A;  5AQU A;  1UA0 A;  3CFO A;  3ULE B;  4YHH K;  4B1V A;  4FPA A;  3V9U A;  4KHS A;  1LCU A;  2Q0U A;  3UKR A;  2WTU A;  4IEE A;  4BGA A;  2WON A;  3UKR B;  4CZK A;  1VQ5 N;  1JLB A;  3KK7 A;  4Y0W A;  1K8A O;  5J2P A;  4CJW A;  3HT3 A;  1YJN N;  1C6V A;  2P9I A;  3NGY A;  3C7N A;  1K9M O;  3HXM A;  1HNI A;  1KRP A;  1R59 O;  1X3N A;  2QW9 A;  1VQP N;  3TAM A;  1R0A A;  2P9I B;  3C7N B;  2E2Q A;  5C2F A;  4LSN A;  3LP1 A;  3VQB A;  4WFA L;  4GVM A;  3KD1 E;  1QQO A;  3VQQ A;  3U8X A;  1T03 A;  1NKB A;  4FSV A;  3RRG A;  4K8Z A;  4C1N K;  1BOT O;  1Q7Y O;  3IMX A;  4CF0 A;  3A5N C;  3OYF A;  2KFZ A;  2Q1N A;  4B8C A;  3ASM A;  2DFF A;  1HNW K;  3J7Z O;  2HHV A;  3TAB A;  3WNG A;  4HTU A;  3NBP A;  2I5J A;  3PY8 A;  3B8A X;  4I2Q A;  4N41 A;  1NJZ A;  4KB0 A;  2G8F A;  4FW1 A;  4LF5 K;  3KLI A;  3EYZ A;  4IEI A;  2IS3 A;  1NGH A;  4YNQ A;  3R9P A;  4DTX A;  4OO1 J;  5HRP A;  1LWE A;  3SUN A;  1S9G A;  2A3Z A;  2YNF A;  4CEE A;  3O3F A;  4JKH A;  4FJ7 A;  4CHN A;  1WUA A;  4KI4 A;  3SAG A;  2D0P A;  2P9K A;  4H03 B;  1NGB A;  3WUH A;  3H6E A;  5FPM A;  1Q82 O;  4IWV A;  4C8M A;  1L5U A;  3JYT A;  2P1J A;  4A2A A;  1BIU A;  5BPM A;  3K9J A;  3M8Q A;  1NK4 A;  4Z4H A;  1C0M A;  1RGI A;  1S6P A;  5GIP A;  1HKG A;  2HMI A;  4EZ9 A;  3LZJ A;  3LDL A;  4FZY A;  3BF1 A;  5KQ8 A;  2KZZ A;  4C8N A;  5BPL A;  3AVB A;  4BRK A;  3QER A;  4IZ9 A;  3TSU A;  2RPI A;  2F4V K;  2OPP A;  3L2V A;  4UQG A;  3TTF A;  3ID6 A;  4H0X B;  3K59 A;  2F96 A;  5J1E A;  4DU3 A;  4JK9 A;  3DXM A;  4TSX A;  4FLW A;  2KHO A;  3AO1 A;  3QLH A;  4N5S A;  3SK3 A;  3PO5 A;  1NK8 A;  4O5B A;  3SBG A;  1XQS C;  3DXM B;  4QS7 A;  1CXU A;  2E5L K;  1BIZ A;  3L3V A;  4FWM A;  4GNI A;  3CD6 N;  3P38 A;  3HM8 A;  5LMN K;  4BDZ A;  3THX B;  3QES A;  4DTN A;  2A1S A;  1QQM A;  4BR4 A;  2V7Z A;  1KVA A;  4B3M K;  3LP3 A;  3ZX0 A;  1IBM K;  3L2U A;  4B1Y B;  4CEO A;  3V9X A;  1EXQ A;  3KTQ A;  3M8P A;  4FXD A;  2NRT A;  5GIN A;  3LDN A;  4OKK A;  3G25 A;  2Q31 A;  3KJV A;  2RF2 A;  2B4J A;  4CGI A;  1QQN A;  5FPE A;  3SI6 A;  4O5F A;  3K5O A;  5CYM A;  4I7F A;  4FZX C;  2VGN A;  2QWO A;  3UIQ A;  1T6C A;  3AVJ A;  2JGU A;  4JV5 K;  4IOC L;  4CHO A;  1EWQ A;  1FJG K;  1DLO A;  4B3O A;  3FZK A;  3GG4 A;  4CJ7 A;  4B1Z A;  2E1Z A;  4DG1 A;  1SL1 A;  1YIT N;  1HUX A;  3O1B A;  2OPR A;  3AGK A;  4PL7 A;  3QO9 A;  2O4G A;  4JK8 A;  2XY6 A;  4M3U A;  5TKY A;  4H0O A;  4CJQ A;  1KD1 O;  3HZ6 A;  3T1Y K;  3MAQ A;  3AVL A;  1NGI A;  2Z1G A;  1QSS A;  1TGO A;  4BC4 A;  3NDK A;  4FLZ A;  3SUQ A;  4BR9 A;  5AQH A;  3CER A;  3EN9 A;  3DRS A;  1TVR A;  2E6M A;  4U7B A;  3CC2 N;  2RN2 A;  4DKW A;  3QNO A;  3U6F A;  3M1F A;  1L3T A;  4KAZ A;  3E9O A;  3DLK A;  3VQ9 A;  4YOT A;  1L3S A;  4JI0 K;  4LF8 K;  4RW9 A;  1VQ6 N;  5F2R A;  2XO7 A;  1S9E A;  1TKZ A;  2ITM A;  3O9R A;  5SWM A;  2ITG A;  3LWM A;  4CCH A;  3HSC A;  3WXI A;  5CHI A;  1IKV A;  1Z05 A;  4A61 A;  4J2E A;  3FZH A;  4GV9 A;  4FWQ A;  2G8K A;  3RR8 A;  2XY7 A;  4NB4 A;  3K58 A;  5C42 A;  2OZS A;  4CW7 B;  5EU7 A;  1NLV A;  3CCV N;  3ZSR A;  1IV0 A;  4JS5 A;  1HX1 A;  3PUF A;  1TK8 A;  3S3O A;  4K0K K;  4WYB A;  4DR1 K;  3ZSQ A;  4OLB A;  2HNZ A;  4U67 L;  4DQS A;  2HF3 A;  3O9U A;  2E1Y A;  2VWB A;  4H4O A;  4G9Z A;  3OBW A;  5CR4 A;  3O08 A;  4CF2 A;  2EX3 A;  4E1M A;  3WXK A;  4NCG A;  4BC5 A;  3GE1 A;  4IOA L;  2LSN A;  3AVC A;  4M63 C;  4M7Y A;  4EP5 A;  4CGD A;  1VQ9 N;  5C12 A;  3LPU A;  3B6P A;  3L2R A;  4GV3 A;  2YHX A;  3H3O B;  3TAE A;  1RT7 A;  1D9F A;  3U9D A;  5BRF A;  3CQX A;  4KH5 A;  4CIG A;  1REV A;  4JKG A;  4BQL A;  3SQ0 A;  2E20 A;  3LM9 A;  4B1X B;  2RE2 A;  4F3T A;  5C10 A;  4FWL A;  2O8F B;  3QFU A;  4DR3 K;  1OH6 A;  1RNH A;  3QIO A;  4PA1 A;  4IXC A;  2QWL A;  3LM2 A;  2GWJ A;  4KH4 A;  3LAK A;  4OKJ A;  3NMU A;  2HHS A;  1IKW A;  2A40 A;  5AQY A;  3WT0 A;  1VQO N;  1LOT B;  4E7L A;  5AQJ A;  3AO5 A;  4DV3 K;  2Q0R A;  1TYQ A;  4PHT X;  2Z1J A;  3A5M C;  4B1W B;  2HMP A;  3M8R A;  2ZJP L;  1C0U A;  1NGD A;  3MEC A;  2FF3 B;  1HNZ K;  1ZXO A;  1BA0 A;  3ZLJ A;  3F9M A;  1U04 A;  1OH7 A;  4CD3 A;  1GOC A;  1XHZ A;  4OGE A;  3ZET A;  4FJM A;  1QQC A;  4OLA A;  1NK0 A;  5BR9 A;  1HJR A;  2DTU A;  2BE2 A;  4EAH D;  3DXK A;  3ZET B;  5E84 A;  3C94 A;  3MEE A;  4FWK A;  1BUP A;  4KTW A;  4DTU A;  3A5O C;  1WSJ A;  4PY5 A;  1S22 A;  1SAZ A;  3DXK B;  3OYI A;  1KAX A;  2Y1I A;  4BC3 A;  4FK0 A;  3CJB A;  1U48 A;  5AJ3 K;  1VQK N;  1OH8 A;  3LDS A;  4YOU A;  4DSF A;  1IBK K;  3O1W A;  1OVQ A;  3EY1 A;  2IC3 A;  2EHG A;  4J2B A;  3PX6 A;  2O8D A;  3GDQ A;  4DR4 K;  1J9A A;  1VAZ A;  4DLG A;  4GMJ B;  3MWT A;  1UWB A;  4A5A A;  3QEP A;  1JXB A;  3O3H A;  1U45 A;  3AAP A;  3TU5 A;  3OYC A;  3F73 A;  3VGL A;  5D3G A;  4ZTF A;  4IO8 A;  4OKE A;  3HTV A;  4LF9 K;  3ZEU A;  3L8B A;  3D2F B;  2QKB A;  2CH6 A;  2GWK A;  4DFJ A;  3ZEU B;  4HVJ A;  1FW6 A;  2CH5 A;  2GX9 A;  2JWK A;  5AFU H;  3CF5 L;  3M3Z A;  1EQY A;  4KHW A;  1I39 A;  2HNY A;  2VG7 A;  1SKS A;  4CJS A;  4FZZ A;  3DLR A;  4IO9 L;  3CCL N;  3QEV A;  1OVY A;  1SKR A;  1YIJ N;  3ZSO A;  1YHQ N;  3G71 N;  1S1X A;  1K73 O;  1JKH A;  2A42 A;  4W5O A;  2BH1 A;  1LWF A;  2O8C A;  2UXD K;  4C8K A;  1IG8 A;  1X3M A;  3ZSZ A;  3SV4 A;  4M3Z A;  1BU6 O;  1LAW A;  1W0H A;  2OCE A;  3VMF B;  2O8C B;  3QIN A;  1RDU A;  1MWK A;  4BE0 A;  4YOR A;  1GOA A;  2HVH A;  4JKB A;  2VG6 A;  5GAH P;  4DS5 A;  1NGE A;  4KV8 A;  2PFU A;  3UKU A;  4CIE A;  1GLA G;  2HB5 A;  4DV7 K;  5F0X A;  2FBT A;  1WBB A;  2KZM A;  3UKU B;  3OYK A;  4DB3 A;  1NWK A;  2HBJ A;  1QHA A;  4CZG A;  1Y64 A;  5AZI B;  2JLE A;  3BEX A;  4DV2 K;  1UA1 A;  5C2D A;  4IJN A;  3B6O A;  1DT9 A;  3KLH A;  4CGG A;  4E89 A;  3HK2 A;  2HHU A;  1U4B A;  5JLH A;  4FLT A;  3NF9 A;  4WQ5 C;  3LDO A;  4I9Q A;  3KZB A;  3THW B;  4DR6 K;  2G8V A;  3DYA A;  1TKD A;  2G8U A;  2W6K A;  4FOE A;  1NJX A;  3GOI A;  5K14 A;  3K57 A;  5KRT A;  3O9T A;  2H3G X;  3A5L C;  3MK6 A;  3V9S A;  4F8R A;  3O3G A;  4J2D A;  1NK7 A;  4DU1 A;  3DLE A;  1TKX A;  4AM7 A;  2YX6 A;  1B9F A;  1H1V A;  5GAD P;  2W41 A;  4DSL A;  4NCA A;  3S3M A;  5EXW A;  1TK5 A;  4WQ5 A;  5HLF A;  3F5T A;  3FFI A;  1KXP A;  2ASO A;  5ADX A;  4LY7 A;  1S1T A;  2WC9 A;  2P9L B;  3PX0 A;  1Q86 O;  4FK4 A;  2HBL A;  4FW2 A;  1VSJ A;  3SQ2 A;  4DS4 A;  4M41 A;  4CIF A;  3UE5 A;  3U9Z A;  1BWF O;  4GVE A;  1MDU B;  3WXM B;  1RTH A;  3CIP A;  2CGL A;  1NK9 A;  1ASW A;  3AV9 A;  3I33 A;  4WF9 L;  2YKM A;  5AQG A;  2FBY A;  3SZ2 A;  2PYJ A;  1BA1 A;  3JXU A;  2E6L A;  3MN9 A;  4K42 A;  2R7Y A;  4CES A;  5AQM A;  1NJY A;  4C23 A;  3LP0 A;  3G4S N;  4JI1 K;  3SUO A;  3E9P A;  2O4I A;  4MFB A;  3VF2 A;  4BRQ A;  3OS0 A;  1LV5 A;  3SQ1 A;  3V81 A;  4BC2 A;  3CXC M;  4ID5 A;  4B9S A;  1ZBI A;  1VK0 A;  2UYT A;  5FRO A;  3KVG A;  3NH2 A;  4OPH A;  4CBX A;  4DTM A;  1YVU A;  1RT3 A;  4N47 A;  1Z25 A;  4XH5 A;  3I0R A;  4HUE A;  3OHR A;  3M5R A;  4CJK A;  3VF4 A;  3CPW M;  3CCJ N;  4BE1 A;  4Z4G A;  1RT6 A;  3M6G A;  4NXN K;  2NLX A;  1YT3 A;  4AHS A;  1SKW A;  1NNE A;  4Y1C A;  3AA4 A;  5MLC Q;  3NGI A;  5I42 A;  1FKP A;  3NF7 A;  1N36 K;  4B3T K;  3P83 D;  1J5O A;  2OTJ N;  2W6L A;  3DM2 A;  3SPY A;  3IFR A;  3O4Q A;  4DTJ A;  4DLE A;  4KTZ A;  3H45 C;  1QVG M;  4ZHR A;  2X6S A;  2HBM A;  3HOS A;  3SBT A;  3AA5 X;  3KLG A;  3EL2 A;  1X1P A;  2IIR A;  4A57 A; 
#chains in the Genus database with same CATH homology
 5I3U A;  4LD0 A;  1D5A A;  4XIU A;  3S9H A;  1ITG A;  4OGC A;  1XHX A;  3ZSY A;  4QOZ B;  2BAN A;  2OPR A;  1RCH A;  2HHQ A;  1QTM A;  4JLH A;  3QO9 A;  1T8E A;  4KHQ A;  1HNV A;  3AVI A;  4CK1 A;  1KCF A;  2O4G A;  4FJL A;  2XY6 A;  2YNG A;  1RTI A;  3K2P A;  4KRF A;  4M3U A;  4N76 A;  4CHY A;  4DTO A;  1QS4 A;  1JLA A;  4CFB A;  4CJQ A;  2G8I A;  3G10 A;  1RDC A;  2Y1J A;  3V9W A;  1TAU A;  3AA2 A;  3OYL A;  4FJ8 A;  4OVL A;  5HP1 A;  3OS2 A;  3MAQ A;  1UAX A;  4DSE A;  1KLM A;  3AVL A;  4DFK A;  3PV8 A;  3CQ8 A;  2YV0 X;  3CM6 A;  4KTQ A;  2Z1G A;  4DQP A;  1QSS A;  3RRH A;  1TGO A;  2VWK A;  2YNI A;  3VQA A;  4CFD A;  1C1A A;  3NDK A;  4FLZ A;  4FCY A;  3SUQ A;  4FM1 A;  1MU2 A;  4ID1 A;  1RT2 A;  4NYN A;  2HND A;  1X9M A;  3D45 A;  3DRS A;  3HPG A;  3NCI A;  3QIP A;  1TVR A;  1CXQ A;  4E19 A;  5KGX A;  2E6M A;  3DLB A;  5FRM A;  4RW4 A;  1SL0 A;  1JLC A;  2RN2 A;  3K5N A;  4BE2 A;  3U3Y A;  3QNO A;  3U6F A;  4B9V A;  4J2A A;  3HST B;  3ZT0 A;  1L3T A;  4KAZ A;  1RBT A;  3DI6 A;  3DLK A;  4CJ4 A;  4CHQ A;  1A5V A;  3VQ9 A;  1WSE A;  1L3S A;  4FJK A;  4BAC A;  4RW9 A;  1A5X A;  1RDA A;  1S6Q A;  1JLG A;  3IG1 A;  1Y97 A;  4CGJ A;  2XO7 A;  1S9E A;  1TKZ A;  3AVA A;  2P5G A;  4F4K A;  4CF1 A;  3KK3 A;  1VSM A;  2ATQ A;  1XI1 A;  5SWM A;  2OZM A;  1RT1 A;  2ITG A;  5E41 A;  4O0J A;  3AO2 A;  3LWM A;  4CCH A;  4NYF A;  3NE6 A;  1IKV A;  4J2E A;  4M3X A;  4Q5V A;  4N56 A;  4KI6 A;  4FK2 A;  1RBS A;  1BL3 A;  1N6Q A;  3D0P A;  3NH0 A;  2G8K A;  3RR8 A;  3ITH A;  4BWJ A;  2XY7 A;  3ISN C;  1ZBU A;  5JS1 A;  1A5W A;  2X6N A;  4FM2 A;  4CER A;  4CEQ A;  1CLQ A;  3OJS A;  2QXF A;  3AO4 A;  4O44 A;  3K58 A;  4KO0 A;  3CFP A;  5C42 A;  4FJ9 A;  2OZS A;  5C24 A;  3OYM A;  4RG8 A;  5EU7 A;  3VQP A;  3CYM A;  3ZSR A;  4JS5 A;  3RR7 A;  3KK2 A;  3PUF A;  3T19 A;  4JRQ A;  3S3O A;  1HYV A;  3LZI A;  3SUP A;  1TK8 A;  4FLU A;  4DFM A;  5FRN A;  3ZSQ A;  1JLE A;  2HNZ A;  3H08 A;  4LSL A;  3HVR A;  3NH1 A;  4DSJ A;  1B9D A;  4OLB A;  3OYD A;  4DQS A;  3CFR A;  3NF8 A;  2KTQ A;  4CEC A;  3K5M A;  4HHT A;  1TAQ A;  1WSH A;  4B9L A;  4H4O A;  3OS1 A;  1WSF A;  1X9S A;  2KQ2 A;  4H4M A;  3VQ7 A;  4CF2 A;  1EP4 A;  2EX3 A;  1WAJ A;  4E1M A;  4C8O A;  4E7K A;  2YHB A;  4NCG A;  4FJX A;  5DMR A;  4DF8 A;  1HRH A;  4OPJ A;  4FLV A;  2LSN A;  5CZ2 A;  1VSF A;  1ZYQ A;  3AVC A;  3LWL A;  1RBU A;  3THV A;  4EP5 A;  3DMJ A;  4CGD A;  3VQE A;  3HL8 A;  3LPU A;  3QEI A;  3B6P A;  3VQC A;  5J2M A;  1BQN A;  1KTQ A;  4AHC A;  1CZ9 A;  3L2R A;  3KLE A;  4IG3 A;  1IG9 A;  3I8D A;  3TAE A;  2IAJ A;  1RT7 A;  3V9Z A;  1QHT A;  3O4N A;  1D9F A;  3ZSV A;  1BCM A;  1HMV A;  4M45 A;  2B5J A;  4CIG A;  1REV A;  5HRS A;  5HRN A;  1BGX T;  3C6T A;  3SQ0 A;  3RTV A;  2XRI A;  4LH5 A;  3WNE A;  1S1W A;  2Z1I A;  4CJ5 A;  2VG5 A;  4AIL C;  4F3T A;  4FM0 A;  5CYQ A;  3SNN A;  4CHP A;  2GBZ A;  1X9W A;  3KD5 E;  2YHA A;  1W9H A;  4M3T A;  4W5N A;  1L3U A;  3I0S A;  2P5O A;  3SQ4 A;  1RNH A;  3QIO A;  2OPS A;  4PA1 A;  3OY9 A;  3TAR A;  4B8A B;  4E7I A;  1LAV A;  1KSP A;  2PY5 A;  4CEF A;  3LAK A;  4OKJ A;  4Z4I A;  1RDD A;  1RTJ A;  1IKW A;  1RDB A;  3MEG A;  3S3N A;  2HHS A;  1J54 A;  3KKR A;  1WN7 A;  1B92 A;  3AO3 A;  3KIO A;  5CY4 A;  4F2R A;  3CG7 A;  3AA3 A;  1XC9 A;  1EET A;  4CJR A;  4E7L A;  4FJJ A;  3C6U A;  3OYE A;  4I9L A;  1JLQ A;  1QE1 A;  3AO5 A;  4PY5 A;  5J2N A;  2OYQ A;  4ELU A;  1VRT A;  5KTQ A;  3LAL A;  2Z1J A;  3F9K A;  4RW7 A;  2BDP A;  2XHB A;  1RT5 A;  3M8R A;  1TK0 A;  4KB1 A;  3ULD A;  1C0U A;  1G15 A;  1TL3 A;  4E3S A;  1DTQ A;  3SV3 A;  3HPO A;  3L2W A;  3MEC A;  3TAF A;  4F2S A;  2F8S A;  2DY4 A;  1NKC A;  2Q3S A;  1JL2 A;  1U04 A;  1NOY A;  4B9N A;  5JS2 A;  2BGG A;  1BI4 A;  3TAQ A;  1GOC A;  1VSE A;  4DTP A;  1XHZ A;  4OGE A;  4DTR A;  3AVM A;  4FJM A;  2GUI A;  1QQC A;  4CK3 A;  4OLA A;  1NK0 A;  2D0B A;  1O1W A;  1WLJ A;  1BI4 B;  4CJV A;  1HJR A;  2DTU A;  2BE2 A;  5C25 A;  4CGF A;  4CJE A;  1GOB A;  1S1V A;  3IRX A;  4FJN A;  3C94 A;  4Q0B A;  4Z4E A;  3MEE A;  3V4I A;  1S1U A;  4KTW A;  3ZSX A;  4DTU A;  3RMC A;  1U49 A;  3QEX A;  3RWU A;  1WSJ A;  5HBM A;  3HM9 A;  3OYI A;  5KRS A;  4HCB A;  4L8R B;  2Y1I A;  4M3Y A;  3LAN A;  2F8T A;  1RT4 A;  4FK0 A;  1C1C A;  1U48 A;  3ZSW A;  3VQ4 A;  3WNH A;  4EZ6 A;  3P1G A;  5DK5 A;  3LDS A;  4DSF A;  1D8Y A;  2P51 A;  4E7J A;  3EY1 A;  4WE1 A;  4JS4 A;  2XY5 A;  4DSI A;  2IC3 A;  4IBN A;  3NGZ A;  4FJ5 A;  4CE9 A;  3LP2 A;  3KKS A;  3IS9 A;  4CFC A;  1J53 A;  2EHG A;  4E1N A;  4FJH A;  4J2B A;  4ELV A;  1HQE A;  4QCL A;  3PX6 A;  4OJR A;  4AHR A;  3HP9 A;  2HW3 A;  3ALY A;  3DOL A;  4AHV A;  2D0A A;  4CJ3 A;  4B9M A;  3VA0 A;  4KPY A;  1J9A A;  4DLG A;  4KHY A;  4GMJ B;  1WSI A;  1HQU A;  1IH7 A;  1YTA A;  4RW8 A;  5KI6 A;  2HHW A;  3WNF A;  3SYZ A;  1ASV A;  3V1R A;  2FC0 A;  1UWB A;  2HHX A;  3QEP A;  1JXE A;  1JXB A;  2IGI A;  3O3H A;  3OYN A;  3OYG A;  3VA3 A;  1U45 A;  4C8L A;  3KLF A;  1ZBH A;  1XWL A;  3T1A A;  3DLH A;  3VQ5 A;  3DLG A;  1Z26 A;  2RKI A;  3OYC A;  3F73 A;  4CFA A;  5D3G A;  4ELT A;  1HYS A;  4CJP A;  3TI0 A;  4ZTF A;  4OKE A;  4KHN A;  3A2F A;  4I2P A;  3OYB A;  1QSL A;  4BDP A;  3L8B A;  4OPK A;  3V1O A;  2QKB A;  2D0C A;  3BGR A;  1UA0 A;  5SZT A;  3M8S A;  3CFO A;  1ZBF A;  4Y1D A;  4DFJ A;  4FLY A;  4HVJ A;  3OYH A;  3V9U A;  1IKX A;  4KHS A;  2FBX A;  3HPH A;  4ICL A;  4EP4 A;  3TAN A;  2QK9 A;  4IFY A;  3P5J A;  1EKE A;  2OA8 A;  2IOC A;  1BCO A;  4BDY A;  2WOM A;  4KHW A;  4CEA A;  4E0D A;  1I39 A;  1RIL A;  2HNY A;  2VG7 A;  1SKS A;  4CJS A;  3AVH A;  1KVB A;  4QAG A;  3DLR A;  3L3U A;  4FZZ A;  3AVF A;  3QEV A;  1YTU A;  4HCC A;  2HHT A;  2WON A;  3ZT3 A;  1SKR A;  3ZSO A;  1S1X A;  1JKH A;  1JLB A;  4W5O A;  3SCX A;  1KFD A;  1LWF A;  4AH9 A;  3QEW A;  2HVI A;  4C8K A;  3ZSZ A;  1D9D A;  1VSI A;  1IO2 A;  3BDP A;  3SV4 A;  4M3Z A;  3LPT A;  5J2P A;  1LAW A;  1S5J A;  1W0H A;  2DFH A;  4IDK A;  4CJW A;  4O0I A;  4MQ3 A;  3QIN A;  3HT3 A;  3MXM A;  1C6V A;  4BE0 A;  1NK5 A;  3NGY A;  4B08 A;  3HXM A;  1EX4 A;  1HNI A;  4B9T A;  3E01 A;  1GOA A;  1KLN A;  1KRP A;  2HVH A;  1BHL A;  4NCB A;  4KRE A;  3TAM A;  2VG6 A;  1R0A A;  4DS5 A;  4KV8 A;  4LSN A;  3LP1 A;  3OVN A;  3HP6 A;  4CIE A;  4M3R A;  1T7P A;  4M42 A;  2HB5 A;  3VQB A;  4CJF A;  4GVM A;  3KD1 E;  3TAP A;  3V1Q A;  4R5P A;  1NJW A;  5FDL A;  3VQQ A;  2FBT A;  4O55 A;  2KZM A;  1T03 A;  1ASU A;  3SPZ A;  1RBR A;  1NKB A;  3RRG A;  4IKF A;  3OYK A;  4K8Z A;  1HPZ A;  2NUB A;  1C1B A;  3MXJ A;  2JLE A;  4JRP A;  4CF0 A;  1JLF A;  2D5R A;  1CZB A;  4CJT A;  5T7B A;  4CHZ A;  2YNH A;  3C95 A;  1UA1 A;  3OYF A;  3K5L A;  2KFZ A;  2OPQ A;  3DOK A;  3B6O A;  1VRU A;  4B8C A;  3ASM A;  2DFF A;  4F3O A;  4H8K A;  1IKY A;  3KLH A;  4CGG A;  4E89 A;  2G8H A;  3TAB A;  3HK2 A;  2HHV A;  2B6A A;  3WNG A;  2HHU A;  5HRR A;  1U4B A;  4GW6 A;  4HTU A;  4FLT A;  3NBP A;  1FKO A;  2I5J A;  3PY8 A;  3NF9 A;  4DQQ A;  4DU4 A;  1JL1 A;  4LH4 A;  3TWH A;  1LW2 A;  4I9Q A;  4I2Q A;  3VQ6 A;  4N41 A;  1NJZ A;  1BIS A;  4KB0 A;  4HUF A;  2G8F A;  2G8V A;  4CED A;  3DYA A;  4IG0 A;  1I3A A;  4FW1 A;  3VQD A;  1T05 A;  1TKD A;  1NJX A;  2G8U A;  4DQI A;  5K14 A;  2XY8 A;  3KLI A;  4Z0U A;  5KRT A;  3K57 A;  3EYZ A;  2IS3 A;  4CEZ A;  5HRO A;  3EZ5 A;  4PQU A;  3V9S A;  4F8R A;  4YNQ A;  3HJF A;  1VSD A;  3O3G A;  1NK7 A;  3T3F A;  3DRR A;  4J2D A;  4DU1 A;  3DLE A;  1TKX A;  3U3G A;  4DTX A;  1B9F A;  5HRP A;  1KFS A;  1Q8I A;  1LWE A;  3SUN A;  3PO4 A;  4DSL A;  1S9G A;  2YNF A;  3VN5 A;  3TR8 A;  4CEE A;  4NCA A;  2IDO A;  4KFB A;  3O3F A;  3S3M A;  2KFN A;  3ZT2 A;  3RMA A;  4FJ7 A;  4CHN A;  1TK5 A;  1F21 A;  4KI4 A;  5HLF A;  1C0T A;  3FFI A;  2X74 A;  3IAY A;  3AVN A;  4C8M A;  1VSH A;  4LY7 A;  1S1T A;  1L5U A;  1NK6 A;  3JYT A;  3PX0 A;  1TL1 A;  4W5R A;  4W5Q A;  2P1J A;  1FK9 A;  1Q9Y A;  4DWI A;  4FK4 A;  1RBV A;  1BIU A;  4FW2 A;  1KVC A;  3NAE A;  1BQM A;  1VSJ A;  1LWC A;  2Z1H A;  4E7H A;  3QET A;  3SQ2 A;  4DS4 A;  3M8Q A;  4M41 A;  4CIF A;  1NK4 A;  3ZT4 A;  4Z4H A;  1C0M A;  4KHU A;  1S6P A;  3HO1 A;  4DTS A;  2HMI A;  4DSK A;  3LZJ A;  4EZ9 A;  4FZY A;  2KZZ A;  2KW4 A;  4CJL A;  1RTH A;  1SV5 A;  1TKT A;  1LW0 A;  4C8N A;  1K6Y A;  3AVB A;  3AVK A;  1NK9 A;  4FJG A;  1ASW A;  3QER A;  4M3W A;  3AV9 A;  1SUQ A;  1RTD A;  2RPI A;  4FJI A;  4ZTJ A;  2YKM A;  2OPP A;  4CF9 A;  2FBY A;  2GV9 A;  3L2V A;  3SZ2 A;  2PYL A;  2PZS A;  2PYJ A;  4UQG A;  2E6L A;  1NOZ A;  5CZ1 A;  4FLX A;  2R7Y A;  3V6D A;  4CES A;  3L2Q A;  3K59 A;  2F96 A;  4G1Q A;  4B9U A;  5J1E A;  1NJY A;  4DU3 A;  2ZD1 A;  4AHT A;  1FXX A;  2FBV A;  4Z4C A;  4TSX A;  2X78 A;  3LP0 A;  3OYJ A;  4HUG A;  4FLW A;  3AO1 A;  2DFE A;  3QLH A;  4N5S A;  4DQR A;  1HYZ A;  3SUO A;  3PO5 A;  2O4I A;  4MFB A;  3KK1 A;  2W42 A;  5J2Q A;  3CM5 A;  3OYA A;  2A1R A;  1WNS A;  3DRP A;  4O5B A;  1NK8 A;  1UOC A;  3OS0 A;  1VSK A;  1LV5 A;  3SQ1 A;  1CXU A;  4AHU A;  3NHG A;  3V81 A;  4KKO A;  4IFV A;  4PWD A;  1BIZ A;  4ID5 A;  4B9S A;  1WAF A;  1ZBL A;  3AVG A;  1ZBI A;  1VK0 A;  3HVT A;  3L3V A;  5FRO A;  1U47 A;  3NH2 A;  4CF8 A;  4BWM A;  1QSY A;  4BDZ A;  2ZQB A;  3RMD A;  3NF6 A;  4PUO A;  4DTM A;  3QES A;  4DTN A;  1YVU A;  2A1S A;  3JSM A;  4FYD A;  1RT3 A;  4N47 A;  1Z25 A;  1WSG A;  3I0R A;  3MXI A;  1KVA A;  4HUE A;  3LP3 A;  4CEB A;  2VWJ A;  4CJK A;  3OJU A;  3L2U A;  4CEO A;  3V9X A;  1EXQ A;  3KTQ A;  3M8P A;  1VSL A;  2ETJ A;  4FVM A;  3PX4 A;  4FXD A;  3RMB A;  3LAM A;  4CGH A;  3ZCM A;  4OKK A;  1TV6 A;  3KJV A;  4BE1 A;  2RF2 A;  1N5Y A;  2B4J A;  1L3V A;  4Z4F A;  4YFU A;  3NFA A;  4Z4G A;  4CGI A;  1RT6 A;  4AHS A;  1YT3 A;  1SKW A;  3SI6 A;  2YKN A;  3K5O A;  5CYM A;  5KGW A;  4Y1C A;  3AA4 A;  3MED A;  3G0Z A;  4I7F A;  1FKP A;  3NF7 A;  4RW6 A;  3NGI A;  4DFP A;  3P83 D;  5I42 A;  4FZX C;  4W5T A;  4K8X A;  1J5O A;  4CK2 A;  1DTT A;  2QKK A;  3DM2 A;  3SPY A;  3AVJ A;  2JGU A;  3UIQ A;  3HYF A;  3O4Q A;  4CJU A;  4DLE A;  4DTJ A;  4KTZ A;  4CHO A;  3QNN A;  1NKE A;  4ZHR A;  1SL2 A;  2X6S A;  4O4G A;  2ZE2 A;  3ZT1 A;  1DLO A;  4DMN A;  2G8W A;  4B3O A;  3AA5 X;  3KLG A;  4DF4 A;  3SJJ A;  4DG1 A;  1X1P A;  2E4L A;  2AJQ A;  1SL1 A;  3TAG A;  1Q9X A;  3VQ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...