1RBRA

Structural study of mutants of escherichia coli ribonuclease hi with enhanced thermostability
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
155
structure length
155
Chain Sequence
MLKQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAAIVALEALKEPCEVILSTDSQYVRQGITQWIHNWKKRGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERCDELARAAAMNPTLEDTGYQVEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase(endoribonuclease)
molecule keywords RIBONUCLEASE H
publication title Structural study of mutants of Escherichia coli ribonuclease HI with enhanced thermostability.
pubmed doi rcsb
source organism Escherichia coli
total genus 50
structure length 155
sequence length 155
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 1993-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1rbrA00
3M8SA 3SUNA 4FYDA 4IG3A 4CECA 3OYAA 1S5JA 3NGYA 3MEGA 1TKZA 3T19A 3KIOA 4CERA 3OYEA 1TL1A 2HNDA 3EZ5A 1SKWA 1NJXA 3L3VA 1J5OA 4M3YA 5HP1A 2Y1JA 1S1XA 3KD1E 3QEPA 2HNZA 1SV5A 4IFVA 3AVHA 1BQMA 2NUBA 3S3MA 3DLGA 3CFRA 1K6YA 4UQGA 4DTOA 1LWCA 2IDOA 2KQ2A 1LV5A 2Z1JA 1HNIA 4YFUA 3FFIA 3PV8A 4RW6A 2GBZA 3LAMA 3U3YA 1VK0A 4DSEA 3SI6A 4ELTA 3TI0A 4CEOA 3M8RA 4H4MA 1IO2A 3QO9A 4HUGA 3RTVA 3DLEA 1RTJA 4DS4A 4CJQA 4FVMA 4O0JA 4WE1A 4FJIA 4FM1A 1Y97A 1W0HA 2X6SA 4CCHA 4OLBA 4HVJA 1WAFA 4LY7A 4FJXA 4FLYA 5KGWA 2O4IA 2YV0X 4CJFA 4CHOA 4E1NA 2HHWA 1NOZA 3HPOA 1U48A 1C1BA 4W5RA 3OS1A 1GOBA 3TWHA 3LP2A 1U49A 1TGOA 1TKTA 3K5LA 3P5JA 3SQ1A 1TKXA 4CHNA 1RBUA 1GOCA 4CEFA 1W9HA 4CEAA 2RKIA 4CEBA 4FZZA 4GVMA 4XIUA 1HMVA 3KJVA 1XI1A 1TV6A 3SNNA 4CGGA 3S3NA 3VQ5A 4CGJA 1NKCA 1UA0A 1QHTA 4OKKA 2PZSA 4B9NA 2OPQA 1RILA 4DTSA 3EY1A 1NOYA 4IBNA 1S1TA 4DQIA 1WSEA 4LH5A 4L8RB 2P5GA 4DQQA 4F3TA 4KRFA 4BACA 3O3HA 1S1UA 4M41A 4Z4CA 4CJ3A 5HRNA 3HSTB 1RTIA 1A5XA 3TAFA 3BGRA 3HL8A 3RR7A 4J2EA 4B3OA 3ZT0A 1LAWA 1NJZA 1ITGA 4CJVA 5HLFA 4J2DA 3KLGA 3CM5A 4E0DA 3ZSRA 1ZBUA 3LP3A 1QE1A 2GUIA 2GV9A 4KO0A 2OZSA 3C95A 3V9ZA 1YVUA 4E19A 4Z4IA 2W42A 3ZT3A 1SL0A 1VSJA 4NCAA 2YHBA 2P51A 1REVA 3CYMA 3TR8A 3OYJA 1BIUA 2B5JA 3I8DA 4OLAA 1FKPA 3IRXA 4CJWA 2OYQA 4KREA 1L3VA 3O4QA 3AVLA 1KVAA 2HVHA 4JS4A 1JLBA 4FJGA 3DLKA 4ID5A 4F3OA 4B9UA 4FZYA 1BCMA 1HQEA 4CGDA 1DLOA 1VSKA 2VG6A 4AHSA 4CF2A 3A2FA 4IG0A 4CHYA 4M45A 4CFAA 4DFPA 4CGHA 3K5OA 4RW4A 2BDPA 1B9DA 3KKRA 5EU7A 4ELUA 1D9DA 1JLEA 3F9KA 4QOZB 1JL2A 1WSGA 4M42A 3I0RA 1BL3A 2EX3A 1KCFA 4CJSA 1LW2A 3NCIA 3MECA 1F21A 1NK6A 3HO1A 4DFJA 4HCCA 3LP0A 4CJRA 1RBVA 3M8PA 2XHBA 3VQQA 2FBYA 3S9HA 4PA1A 2ZE2A 4DLEA 2FBTA 3O4NA 1QTMA 4FJLA 1EXQA 3VQBA 1RBTA 3KTQA 3WNHA 3P1GA 4CJUA 4OKEA 2G8WA 2KFNA 3TAMA 1RT1A 1RCHA 3LWLA 2FBVA 3DLHA 4C8OA 1EKEA 2XRIA 3NAEA 5FRMA 4DWIA 3L2QA 2AJQA 1C6VA 3HK2A 2Y1IA 4DQRA 4I2QA 3LALA 1RT7A 5KTQA 3CG7A 3L2WA 4FK0A 5CZ1A 3ZSWA 2F8SA 4LD0A 2KW4A 4QCLA 3LWMA 1NK9A 1WSJA 3NE6A 3SPZA 3M8QA 4O55A 3LPUA 3HVTA 4B9LA 1IH7A 3ZSQA 2YKMA 3AVIA 2Z1HA 4E7JA 5KRSA 5D3GA 1LWFA 2WOMA 3HXMA 1HYZA 3SQ4A 1YT3A 3AVNA 3AVCA 4M3RA 3LZJA 1RTDA 4DTNA 1IKWA 4I9LA 4OVLA 3CQ8A 4FJKA 2X78A 1A5VA 4CFCA 1TK8A 1X9MA 3C6UA 1WAJA 3RMAA 4BDPA 1S9EA 3SJJA 3OYNA 1HRHA 4ZHRA 3K5NA 4Z4EA 4CESA 4JS5A 2RPIA 3MEEA 3L8BA 3KD5E 4LH4A 5DMRA 3VQDA 3ITHA 4HUEA 3AO1A 3DRRA 4DU1A 3V1OA 1TK5A 1J54A 3DOKA 4FW2A 3WNFA 4BWMA 1HYSA 4F4KA 3AVFA 2IGIA 1I39A 4B8AB 4ELVA 4Z0UA 2D0AA 1RT5A 4KKOA 1XHZA 4DF4A 2VG7A 3L3UA 3SCXA 3THVA 5E41A 1X1PA 4CK2A 4Y1DA 4W5QA 3SQ2A 1X9WA 1XHXA 4EP5A 4B9MA 2XY7A 1B92A 4Q0BA 4NYFA 1UOCA 2IAJA 3SV4A 1ASWA 3LPTA 3V1RA 1FK9A 4BDZA 5I3UA 3HPHA 3KK2A 1C0TA 3OYFA 1L5UA 4DFKA 1BISA 4KI6A 2HHSA 2PYLA 4RW8A 1NK8A 1WN7A 1RDBA 5I42A 1RTHA 3ASMA 1O1WA 4I2PA 3CFOA 3NGZA 3F73A 3VA3A 1IKVA 3QLHA 2HVIA 3CM6A 2QKKA 3WNGA 3SYZA 3T3FA 2B6AA 4KTZA 1VRUA 1S1WA 5KRTA 3DLRA 4O44A 4E7IA 3VA0A 4FJMA 3ZSVA 1HQUA 2IC3A 3ZSYA 4KB1A 4C8NA 3S3OA 5KI6A 5HRPA 1N5YA 4NCBA 1B9FA 4CK3A 3AO3A 4IDKA 4E7HA 3HT3A 1NK4A 3C94A 2OA8A 4KV8A 4OJRA 2HHVA 3DRPA 2Z1GA 4B08A 1RDAA 3AVBA 3JYTA 4CHPA 3OS0A 3NF6A 4CK1A 3K5MA 1ASVA 1CZBA 1DTQA 1D8YA 3OS2A 2G8KA 1SUQA 4ID1A 3OYGA 3TAQA 4IFYA 3QETA 4ZTFA 4M3UA 3D45A 4KHUA 3TAGA 3VQ6A 4E7LA 3VQ7A 3KLIA 1S9GA 1Z26A 4FW1A 4CJTA 4Q5VA 3V1QA 2HHQA 1CLQA 3KK1A 1LWEA 3QINA 1HNVA 1TKDA 4Z4HA 2X74A 3ZSZA 2X6NA 5J2QA 5FDLA 4B9SA 3SQ0A 1IKXA 4FJ5A 4E7KA 1YTUA 4FLVA 2QXFA 1S1VA 5J2PA 1R0AA 4FJJA 3ZT4A 4B8CA 1YTAA 1CXUA 4M3ZA 4NCGA 1IKYA 3AA2A 1VSLA 3C6TA 3D0PA 3PO5A 2ZD1A 1KLMA 1LW0A 1GOAA 1Z25A 3AV9A 4O5BA 5HRRA 3SV3A 3QEVA 2D0BA 1JLAA 1RT6A 1WSIA 2E6LA 4JRPA 1BQNA 1KVBA 1RT4A 4PQUA 1QS4A 1RBSA 3VQPA 3RRGA 4DSLA 1EETA 2EHGA 3NFAA 4BDYA 1U04A 3K57A 3E01A 1U45A 2G8HA 4AILC 2DTUA 3HP6A 1XC9A 4DSKA 4Z4GA 1XWLA 1JKHA 1VSDA 3AA5X 4E89A 4KHWA 4CHZA 4KFBA 2YNFA 4AHVA 3QESA 4DLGA 4OPJA 5C24A 3V9UA 4ZTJA 3OVNA 1RT3A 1KRPA 1JLQA 4HTUA 4FLXA 4J2AA 3NF9A 1KVCA 4M3WA 4N56A 5FRNA 4FJ9A 4DSIA 1Q9YA 2JGUA 1G15A 4CFDA 1VSHA 4EZ9A 1VRTA 3I0SA 4CIGA 4ICLA 3MXIA 1BI4B 3HVRA 1ZBIA 3NF8A 1BIZA 4DTRA 1TK0A 4C8LA 3RMDA 4JLHA 4NYNA 4KTWA 3NBPA 1NK0A 2PY5A 4CJKA 1T8EA 5JS1A 3LP1A 3B6PA 3VQ9A 4CF1A 4FJ7A 2VWJA 2ZQBA 1RDDA 4E3SA 5KGXA 2IOCA 1RT2A 2D0CA 1QSLA 4CJPA 3RRHA 3ISNC 1ZBFA 4KHQA 3RMCA 3TARA 3AVGA 2DFHA 3KKSA 5CY4A 3HP9A 4QAGA 1VSEA 3ZSXA 4HHTA 4K8ZA 1WNSA 3MXJA 3NF7A 2FBXA 2YHAA 3PUFA 4KTQA 2BANA 5SWMA 4FK4A 1IG9A 1JXEA 1ZBLA 4DQPA 4FZXC 1L3TA 4CIEA 3DOLA 3AVMA 4OGCA 3VQ4A 3OYCA 3NHGA 3DLBA 2QK9A 3PO4A 4B9TA 2G8FA 5CYQA 4K8XA 4DFMA 4DMNA 1C1CA 5HBMA 3SUOA 4DG1A 1Q8IA 1TVRA 5JS2A 4DS5A 1ZYQA 2BGGA 4CJ4A 3WNEA 1CZ9A 4DU3A 1U47A 4PY5A 4MFBA 3V9XA 1S6QA 3K2PA 5C42A 3AO2A 3OYLA 2G8IA 3K58A 1JLGA 2YNHA 2DFEA 4O0IA 4FCYA 2BE2A 4OGEA 3OJSA 2XY6A 3L2UA 1VSIA 2B4JA 4W5OA 3OYBA 1KLNA 4FM0A 3QEWA 3V81A 4Z4FA 3LAKA 4PWDA 1EP4A 1WSHA 3T1AA 3NH2A 2HHXA 5CYMA 1JL1A 5J1EA 2F8TA 1DTTA 1I3AA 1HJRA 1D5AA 5DK5A 4JRQA 3DYAA 4CJLA 3NH1A 3VQCA 1L3SA 3VQAA 3K59A 2XY5A 2HMIA 4M3XA 3O3FA 4PUOA 3V9WA 2HHUA 1QSSA 3NGIA 3VQEA 3AVKA 3HYFA 1VSFA 4AH9A 4DQSA 2JLEA 4BWJA 4W5TA 3KLFA 3KLEA 2IS3A 4R5PA 2HHTA 2XY8A 4M3TA 4W5NA 4FLTA 2G8UA 3RR8A 1C1AA 3V6DA 2RF2A 4O4GA 1JLCA 2DFFA 4BE0A 1TAQA 4CGIA 4DU4A 3OYHA 3PX4A 4CEEA 1S6PA 2WONA 3OY9A 3LDSA 3U6FA 3TANA 1TL3A 4CFBA 4KI4A 3B6OA 1BI4A 4FM2A 3SZ2A 4N76A 1JXBA 1UWBA 3OYMA 3RWUA 2HW3A 4FLWA 2O4GA 3AVAA 5HRSA 3P83D 3OYIA 1Q9XA 4KB0A 4F2SA 4I9QA 3CFPA 1BCOA 4DTUA 4KHNA 1A5WA 3VQ8A 1SL2A 5HROA 1VSMA 2FC0A 4H8KA 4EP4A 3MAQA 2DY4A 3IG1A 3IS9A 3HM9A 4KAZA 1KFDA 3KLHA 3ZT2A 4DTXA 2Q3SA 2OPSA 1ZBHA 2R7YA 1MU2A 4B9VA 4DSJA 1UAXA 4TSXA 4FJNA 2ATQA 1C0MA 4MQ3A 3VN5A 1RNHA 3G0ZA 3ZT1A 2OPRA 4AHCA 2XO7A 4GW6A 3SUQA 4F8RA 2QKBA 1KFSA 1FXXA 2P1JA 4RW7A 3MEDA 1NKBA 4HUFA 3IAYA 5J2NA 1NJWA 3NH0A 3NDKA 2A1SA 2YKNA 3AA3A 4CF8A 4CJ5A 5T7BA 3SUPA 4CF0A 4DTJA 3QNNA 3UIQA 1J9AA 4GMJB 3QIPA 4FLZA 1SKSA 2KZMA 2F96A 5SZTA 4DTMA 4C8KA 3TABA 2KFZA 3G10A 4RW9A 2HNYA 4DF8A 2KZZA 1EX4A 3QEXA 2D5RA 1ASUA 1QQCA 4CGFA 2OZMA 5C25A 3L2VA 1X9SA 4BE1A 4CEZA 1WLJA 1RDCA 4I7FA 3EYZA 2OPPA 4F2RA 4C8MA 2YNGA 3PX0A 3SPYA 1T03A 4FJHA 2HB5A 4OPKA 4HCBA 4G1QA 3RMBA 3L2RA 4AHUA 4N47A 4YNQA 1KTQA 1HYVA 5CZ2A 4CF9A 4CE9A 1NKEA 3AVJA 2RN2A 3V9SA 1NK5A 1D9FA 3DM2A 4LSNA 2YNIA 1N6QA 3AO5A 3OYDA 5K14A 4BE2A 3TAEA 2E4LA 1T7PA 1KSPA 1TAUA 2VWKA 1T05A 2ETJA 4FLUA 1C0UA 1BGXT 3OJUA 1UA1A 2LSNA 2P5OA 1SL1A 2PYJA 3PY8A 4J2BA 1NJYA 4DTPA 5FROA 3H08A 2ITGA 4CEDA 4FK2A 4CJEA 4FJ8A 4KPYA 4DSFA 1L3UA 3QNOA 3ULDA 2VG5A 1JLFA 3DRSA 5J2MA 3PX6A 3MXMA 1QSYA 3ZSOA 3HJFA 4H4OA 3ZCMA 2G8VA 3QIOA 4RG8A 2Z1IA 3BDPA 4AHTA 4EZ6A 3JSMA 3TAPA 3LZIA 2I5JA 4IKFA 1J53A 1LAVA 1HPZA 4CIFA 4KHSA 3AA4A 3AO4A 3DMJA 4CEQA 4N5SA 3V4IA 4KHYA 3O3GA 3LANA 3QEIA 2A1RA 1CXQA 4LSLA 3DI6A 1FKOA 4OKJA 3U3GA 4CHQA 3OYKA 3KK3A 2E6MA 3QERA 4FXDA 2KTQA 4E1MA 3HPGA 1BHLA 1WSFA 3ALYA 4Y1CA 4AHRA 4N41A 1RBRA 1SKRA 1U4BA 1NK7A
chains in the Genus database with same CATH superfamily
3MN9A 3M8SA 4FYDA 1JCFA 2O8EA 3KIOA 2HNDA 1C0GA 4JEPA 1T44A 3ULEB 4IFVA 3AVHA 3S3MA 3DLGA 3CFRA 3QBXA 3CC7N 1XC3A 5A2QO 3C0BA 3THXA 2GBZA 1NGGA 2YHYA 4ELTA 3M8RA 5CE3A 1IO2A 3QO9A 4HUGA 4O0JA 3SAGA 3CMAN 1W0HA 2NRXA 4CCHA 1WAFA 3U4LA 3FFKB 2O4IA 3N4QA 1C1BA 4W5RA 4GY2B 1X9JA 3LP2A 1U49A 1TKTA 3P5JA 3G71N 2O8FA 4CEBA 1GOCA 1W9HA 2RKIA 4GVMA 1XMOK 3SNNA 3C65A 5BR8K 2OPQA 1RILA 1NOYA 4DQIA 1WSEA 4LH5A 2P9PA 1Q7YO 4U67L 4DQQA 2UUAK 4F3TA 3O3HA 1S1UA 3HSTB 4B1UB 4BR9A 3TAFA 4DR5K 3ZT0A 1RGIA 1LAWA 3UKUA 5HLFA 3CM5A 4E0DA 1YVNA 1ZBUA 3I56N 2OZSA 3MK6A 3V9ZA 2HHHK 3VEXA 5EX5A 4CBXA 1YVUA 1ATSA 5ELZA 3O6WA 2W42A 2HBMA 4LF9K 4NCAA 2YHBA 1IBLK 3TR8A 1MA9B 3IRXA 2OYQA 1H1VA 4KREA 2HVHA 1MWKA 4JS4A 4FJGA 5AQWA 3BZKA 4IDHA 4ID5A 5JVGL 4B9UA 1HQEA 3VPZA 1DLOA 1BUPA 4CHYA 4DFPA 3K5OA 1RDWX 4IWVA 4M42A 2QWLA 1BL3A 5AFUA 2EX3A 1KCFA 3SLCA 3LDLA 3P31A 2H3GX 4DKWA 4DFJA 4CJRA 3M8PA 1GLAG 2Q2RA 4PA1A 2ZE2A 2FBTA 3UKUB 2HSTA 3WXKA 4CJUA 3CIPA 3TAMA 3LWLA 3DLHA 2CGLA 1M90O 2BUPA 3L2QA 2QWOA 4DQRA 2V7YA 3LALA 5EY4A 1HKBA 1Q86O 5KTQA 3L2WA 2F8SA 3F9MA 4LD0A 2KW4A 4QCLA 2Q36A 1YIJN 3HXMA 3LZJA 5GAHP 1A5VA 1TK8A 1WAJA 4NLCA 2FSKA 4BDPA 3D7EO 4B3RK 3SJJA 3OYNA 3W3DA 5TKYA 1HRHA 3J7AP 3L8BA 4AM6A 4LH4A 3VQDA 4HUEA 2V51B 3V1OA 1TK5A 1J54A 1VQNN 2WUSA 1P8ZA 4F4KA 3AVFA 4Z0UA 1RT5A 3AAQA 4KKOA 2VG7A 3SAFA 3ATUA 5E41A 1EQYA 4Y1DA 3WXLA 4B1XB 2XY7A 4LF6K 1ASWA 5KPRA 5I3UA 3QFPA 4JV5K 2HHSA 3MWPA 1NK8A 4DR6K 4I2PA 3CFOA 4DV0K 3T3FA 5BRFA 3VA0A 3N4PA 1HQUA 3PLAA 4CZKA 3ZSYA 3H45C 4YOTA 2A42A 3C7NB 3TTFA 1NGCA 1B9FA 4CK3A 4IDKA 4IOAL 3HT3A 4KV8A 3ID8A 4B08A 3JYTA 4CHPA 3NF6A 4CK1A 1SUQA 4ID1A 4IFYA 4FWLA 4M3UA 4B1VA 3D45A 3TAGA 3VESA 4JI3K 1CLQA 1Z26A 4Q5VA 4PHTX 4BR4A 3ZSZA 5FDLA 1IKXA 4FLVA 4M3ZA 5J2PA 4FJJA 3ZT4A 1YTAA 2P9IA 1VSLA 3D0PA 4FPBA 3PO5A 1JLAA 1BQNA 1RT4A 1QS4A 1RBSA 4CZMA 1NGHA 4RWTA 1HX1A 4O8KA 4WFNL 1XC9A 4Z4GA 1JKHA 3ZEUA 1RT3A 1JLQA 4AQYK 4FJ9A 4JK7A 3ID6A 4ILHA 3Q7CA 3M6GA 2OTLN 3RMDA 4JLHA 4NYNA 4C1NK 1NK0A 4CJKA 1HKGA 3LP1A 3P38A 2VWJA 1RDDA 4WQ5A 3HZ6A 2O8BB 5H1SQ 1RT2A 2IVNA 4LF8K 3L6QA 3ISNC 1ZBFA 3RMCA 3TARA 3AVGA 3ZSXA 4DQ8A 2P9IB 3MXJA 2FBXA 1HPMA 2GTDA 4MDBA 1JXEA 4CZHA 1HJOA 4H0XB 1GLFO 1L3TA 4CIEA 4YOXA 3NHGA 2QK9A 4DHYA 2CGKA 2W40A 3KHYA 5CYQA 1YJ9N 4DFMA 1C1CA 5HBMA 3ZEUB 4DS5A 2BGGA 1U47A 4MFBA 3V9XA 3SBTA 4BRGA 3R3LA 5C0YA 3MMVA 3L2UA 4X66K 1N36K 4YOYA 1VSIA 2B4JA 4W5OA 4FM0A 4Z4FA 2ZJQL 1N34K 5ADXA 3T1AA 3NH2A 2GWJA 2F8TA 1HJRA 1D5AA 3GOIA 4OPHA 2HMIA 4YY3K 3V9WA 1KC8O 1NMNA 1KXPA 5GAEP 3AVKA 4DQSA 2JLEA 3TPQA 4W5TA 3BZCA 4R5PA 4FVUA 4W5NA 4H5WA 4MO4A 2YJEA 3ENBA 3V6DA 2GUPA 2RF2A 3VGLA 1NGEA 2DFFA 3OHRA 5GAGP 3UB5A 3CCJN 3THYA 2WONA 3OY9A 4BC4A 1BI4A 1SAZA 1T6CA 3RSEA 2HW3A 4FLWA 5HRSA 3P83D 1Q9XA 4I9QA 3CFPA 3F5TA 1A5WA 4EP4A 3MAQA 5AQPA 3KLHA 3ZT2A 4DTXA 4YOVA 2OPSA 2R7YA 1MU2A 3A8YA 3JS6A 1HNWK 1XMQK 1C0MA 3VN5A 5M1KA 4AHCA 4GW6A 3VEVA 5GADP 2P1JA 3MEDA 3O4WA 3IAYA 5J2NA 1NJWA 1DKGD 3NDKA 2YKNA 4CF8A 1YJNN 4CJ5A 5M1NA 3CF5L 2ZJPL 4FLZA 2KZMA 2F96A 5SZTA 4C8KA 2QWPA 2HNYA 4WYBA 3VOVA 5C25A 3L2VA 3ZX2A 3H3OB 2OCEA 1T03A 5AQMA 2HB5A 4OPKA 1IG8A 3RMBA 2Q1NA 1J5EK 1HYVA 4CE9A 1NKEA 3QICA 2RE2A 2YNIA 4CZLA 2ZGYA 1ZC6A 3LL3A 1T05A 1LCUA 1BGXT 1DGKN 2P5OA 3RVCA 3TTDA 5FROA 2ITGA 4FJ8A 4DV7K 4ISGA 1L3UA 3ULDA 1QSYA 1G99A 2G8VA 4NLBA 3O1WA 2NRVA 3BDPA 3A5NC 3TAPA 1J53A 1LAVA 2NRRA 4CIFA 3V4IA 1SQKA 4KHYA 4CD3A 1FKOA 4CJ7A 1LOTB 2YJFA 3FZKA 3HPGA 1WSFA 3ALYA 3CCRN 3WXJA 3SUNA 3A5LC 3NGYA 1TKZA 3KVGA 3EZ5A 3OYEA 1WB9A 1SKWA 1J5OA 2Y1JA 1S1XA 3KD1E 5AZIA 1BQMA 2NUBA 1M1KO 4DTOA 4WFAL 2IDOA 2KQ2A 2O8DB 4YFUA 4A59A 2E20A 4QS7A 4RW6A 3BP8A 5C2FA 3O9SA 4C23A 3DXMA 3KWIA 3U3YA 3SI6A 3TI0A 4H4MA 2P9LB 1NU0A 3VF2A 1T6DA 1TUUA 4WE1A 4FJIA 3C6AA 5AQSA 5KGWA 3WQTA 1GLJO 4CJFA 3SJHA 4E1NA 3JAMO 3OS1A 3TWHA 4E1JA 3HSCA 4EFHA 1TUYA 3K5LA 3IDHA 4I6MA 5KQDA 4XIUA 4M63C 3KJVA 1XI1A 1P90A 3O9QA 3VQ5A 4CGJA 1UA0A 1QHTA 4PKGA 2PZSA 2I7NA 4HTLA 4JI0K 4IBNA 1S1TA 4L8RB 1J6ZA 3OA9A 3CD6N 1HLUA 2Q0UA 2ZM6K 4J2EA 4FO0A 4B3OA 1W2BM 3DXMB 1ITGA 5FLXO 4AM7A 3LP3A 4BRCA 3EKSA 4WF9L 5LJVA 2ASPA 2I7PA 1BIUA 1OH7A 1L3VA 3O4QA 2ITMA 3AGRA 3DLKA 4F3OA 1EWQA 1KAXA 1E4GT 4CGDA 4AHSA 3A2FA 1U2VB 3ULEA 4IOCL 2OTJN 3GL1A 1B9DA 3PIOL 3O08A 4O5FA 1NBWA 4LF5K 3F9KA 1TYQB 1JL2A 3I0RA 1W97L 1QQOA 5BPNA 1V4SA 1VQ5N 3HRGA 2XHBA 2ASOA 3VQQA 3O4NA 3E9LA 1RCHA 1EKEA 3NAEA 4DWIA 3HOSA 4UY8O 5CZ1A 3ZSWA 3L4IA 1IJJA 3LWMA 1BOTO 1WSJA 3LPUA 3HVTA 1C0FA 2Z1HA 3AVIA 4E7JA 5KRSA 4Y0WA 2WOMA 2AJQA 3I33A 1IKWA 5AQVA 3U8XA 4H03B 1S22A 1S9EA 2ZF5O 2IIRA 4JKCA 5M1PA 3J8AA 4ZHRA 3K5NA 3H1QA 3VEYA 2RPIA 3MEEA 2NLXA 3ITHA 4BRKA 3AO1A 4DU1A 2FF6A 4RCHA 4BY9C 4FW2A 3WNFA 4BRPA 2IGIA 3MX2A 1JCEA 4BC3A 3L3UA 1OH8A 4GNIA 4CK2A 1X9WA 4W5QA 3SQ2A 5AQOA 4EP5A 4NYFA 1UOCA 2IAJA 3SV4A 4IEIA 1FK9A 4BDZA 4K25A 3KK2A 4RW8A 1RDBA 3ASMA 3NGZA 3F73A 3VA3A 1IKVA 2AP1A 2QKKA 3SYZA 1S72N 3AAPA 1S1WA 5KRTA 3DLRA 1BWFO 4FJMA 4KB1A 1VHXA 4C8NA 3AO3A 5LJWA 4E7HA 4FPAA 4OJRA 2HHVA 1BO5O 1EWRA 3OS0A 3O5BA 4EAHD 3K9KA 2G8KA 3TAQA 3QETA 4ZTFA 4JKBA 4KHUA 3VEOA 4GV3A 3VQ6A 3VQ7A 3KLIA 4CJTA 3V1QA 2HHQA 3G6EN 3KK1A 2X74A 2X6NA 3SQ0A 1WBDA 4FJ5A 2IVOA 4H5RA 3HM8A 4NCGA 1IKYA 1VQKN 3C6TA 1KD1O 1Z25A 4O5BA 3SV3A 4B3SK 4EHUA 1NGFA 3VQPA 1EETA 3NFAA 3VEWA 3VETA 3VF4A 3K57A 2G8HA 2QKBA 4H0PA 3HP6A 4DSKA 3DLLL 4KHWA 4CHZA 3D2FB 4DLGA 4GV9A 4J2AA 4M3WA 1ATNA 3NF9A 1KVCA 1VQ4N 3SK3A 5FRNA 3ENOA 1NGDA 1Q9YA 1G15A 1OVYA 4CFDA 2D1KA 2P9SB 4CIGA 3E1YA 4ICLA 3LDPA 3HVRA 4U7BA 3NF8A 4DTRA 4H0TB 3TTCA 1X3NA 4FWQA 4C8LA 1FW6A 4KTWA 2PY5A 5JS1A 1T8EA 1YXQA 4CF1A 4B1ZA 4FWOA 4H5TA 1K8KB 4CJPA 3RRHA 4QS9A 2DFHA 3QDKA 3KKSA 5CY4A 3HP9A 2E5LK 4HHTA 3TU5A 2BANA 5SWMA 1IG9A 3OYCA 5DM6L 3PO4A 2P9UB 4ISFA 4B9TA 3C7NA 4LFAK 3R8EA 1DEJA 4XH4A 4DG1A 1Q8IA 1TVRA 2VQFK 4BRIA 4CJ4A 1CZ9A 2O8CA 4FWMA 5FPDA 3AO2A 3OYLA 2G8IA 4O0IA 2E2NA 2XY6A 3OJSA 2BH1A 2P9NA 3OYBA 4DV1K 3V81A 4RTFD 1NGAA 5CYMA 5JLHA 1JL1A 3WXIA 2A6AA 1I3AA 4JK8A 1NJIO 4JRQA 3DYAA 1O13A 3CJAA 4BVOA 4M3XA 2QM1A 3EKUA 1NLVA 3NGIA 2VGMA 3SAHA 3VQEA 4YOUA 1VSFA 1IBMK 4BWJA 3KLFA 1OH6A 3KLEA 1NGJA 1YF5L 2HF3A 4CVNE 1JLCA 4BE0A 1TAQA 3CCSN 2O8CB 2EWSA 3DAWA 3B6OA 1JXBA 1UWBA 3FE1A 4JNEA 5AQHA 3OYIA 5GIPA 4F2SA 1R59O 3VQ8A 2P9NB 1BA0A 1Z05A 3IG1A 3H6EA 3HM9A 4KAZA 2ZGZA 1KFDA 2PBDA 3MDQA 2O8BA 3WEEB 2Q3SA 2GEMA 1JCGA 4B9VA 1UAXA 2ATQA 3EZWA 1RNHA 3G0ZA 2OPRA 3DJCA 1FXXA 4RW7A 4HUFA 3UIQA 4CF0A 4DTJA 1J9AA 1SKSA 2KFZA 4DV6K 3G10A 4MLEA 4DF8A 3QEXA 2D5RA 3FZHA 3HBTA 4PL7A 1RDCA 2RHKA 4I7FA 3EEQA 2PFUA 4F2RA 4C8MA 3SPYA 3CCLN 1HKCA 4AHUA 4YDUC 4YNQA 1KTQA 2YI1A 4R79A 5CZ2A 4FWKA 3VTHA 2A5XA 1D9FA 3DM2A 1NGIA 4LSNA 3AO5A 1T3VA 5K14A 3TAEA 3D2EB 3SBGA 1T7PA 1TAUA 3FZLA 2E8AA 2VWKA 5BRHA 3NMUA 3CXCM 1SL1A 3R6MA 4GKJK 3PY8A 3Q7BA 4FOIA 4DTPA 3H08A 4CEDA 3ZX3A 3KK7A 4KPYA 4JK9A 4DSFA 5J2MA 1VQMN 3DRSA 1JLFA 3HJFA 3ZSOA 4H4OA 3WXMB 3QFUA 4MDAA 3QIOA 4RG8A 4BRAA 2Z1IA 4JI4K 3JSMA 2I5JA 1DT9A 2FSJA 4KHSA 3KZBA 1YAGA 2QWMA 4ILJA 4BREA 4CEQA 3LANA 3QEIA 4IKFA 4LSLA 4CHQA 3OYKA 4OKJA 2KTQA 1Q81O 2E6MA 3ZX0A 4IXCA 3QERA 4E1MA 3H1VX 1RBRA 1U4BA 2YX6A 3OYAA 5LMUK 3MEGA 3T19A 4BRNA 4CERA 1TL1A 1U6ZA 1NJXA 4M3YA 5HP1A 5BN8A 3QEPA 4MO5A 4QS8A 3O80A 1ZBSA 3PIPL 3VERA 3EE9A 1LWCA 1LV5A 2Z1JA 1HNIA 3PV8A 3MCAB 1N32K 1VK0A 4AF1A 1K9MO 3A5OC 2QEXN 2VGNA 3EE8A 3RTVA 3DLEA 4DV3K 1YUWA 4CJQA 1KAYA 2GX9A 3ATVA 3A5MC 4H0YB 3UKRB 2X6SA 4FLYA 2YV0X 3BEXA 4MLHA 1NOZA 1GLCG 3SQ1A 1KQSM 1RDUA 4FZZA 2A40A 1HMVA 3VGMA 4JKDA 4CGGA 1NKCA 1ZXOA 1WUAA 3R1XA 4DTSA 2UYTA 2P5GA 4BACA 4LF7K 4FWPA 1VQ7N 5EOYA 4DR7K 4L3QA 4G9ZA 4BVPA 4CJ3A 4Z4CA 4IEEA 1A5XA 2QI2A 3BGRA 3JXUA 3RR7A 2CH6A 1QQNA 2YHWA 1NJZA 3ZSRA 1QE1A 2GV9A 2VQEK 3C95A 4E19A 1GLDG 5JLFA 1VSJA 5AQZA 1REVA 2B5JA 1FKPA 3W0LA 3AVLA 3R9PA 4BQLA 2NZTA 4BR2A 4WQ4C 2E2OA 2FXUA 1VSKA 3BF1A 3I55N 5HOOA 1X3MA 4IG0A 4M45A 4B9QA 2BDPA 4RW4A 1JLEA 4QOZB 2GWKA 3GDQA 2Q0RA 5JMVA 5I9EB 2O8DA 1LW2A 4IO8A 3MECA 1NK6A 2NNWA 4HCCA 2D4WA 3LP0A 1I94K 4A61A 3M5RA 3AY9A 3MN6A 4IJNA 3MX5A 4JI1K 5C12A 4DLEA 1QTMA 2P9LA 4FJLA 4A62A 1EXQA 3VQBA 1RBTA 3LM2A 2G8WA 2KFNA 3U9DA 1RT1A 3QMLA 4NO7A 5GINA 2XRIA 4CZGA 5DM7L 1RT7A 3CG7A 3E9PA 5HL7L 1ATRA 3SPZA 3M8QA 4O55A 2FSNA 4B9LA 1IH7A 4BRHA 5D3GA 1LWFA 3SQ4A 1YT3A 1D4XA 3AVCA 3AVNA 4M3RA 5FPMA 4I9LA 4OVLA 4FJKA 2X78A 1X9MA 4Z4EA 4CESA 4JS5A 4LFCK 3KD5E 2PAVA 4H5VA 1CZAN 1NG9A 4B8AB 4ELVA 5EVZA 4K0KK 4FWSA 3SCXA 3GG4A 1X1PA 4Q0BA 4B9MA 3J81O 3QB0A 3LPTA 3V1RA 4XH1A 3E9OA 1C0TA 2NRWA 3FLCO 1XQSC 4KI6A 4BG8A 3SMPA 2PYLA 1WN7A 5I42A 1RTHA 5JVHL 4DB3A 3QLHA 1MWMA 3CJBA 2B6AA 3CQXA 1VRUA 4E7IA 4EHTA 2IC3A 5E84A 5KI6A 1U2VA 2E1YA 5HRPA 4DV4K 2F9WA 1GLLO 2F9TA 1TYQA 3DRPA 1IV0A 4CZIA 1RDAA 3AVBA 2KLAA 3K5MA 4GKKK 3CJ7A 5F0XA 1D8YA 4M7XA 4YHHK 4JKFA 3OYGA 4CBUA 2VYPA 4BROA 4FW1A 3AGKA 3U9ZA 1VQON 3EL2A 1LWEA 3QINA 1TKDA 1Q82O 3O8MA 4Z4HA 4CBWA 2ZJRL 1N8RO 1YTUA 4A5AA 5C2DA 1R0AA 2OANA 1CXUA 4JKGA 3AA2A 1YITN 1LW0A 3AV9A 2D0BA 1RT6A 1WSIA 4JRPA 5BRDA 4PQUA 3RRGA 4DSLA 4BDYA 2DTUA 4AILC 2D0PA 5F1XA 4E89A 3AA5X 2VWBA 2YNFA 4KHPK 3QESA 3D6RA 4OPJA 4ZTJA 2HHXA 3OVNA 5AQIA 4HTUA 4J8FA 4FLXA 3MCPA 2V52B 4JHDA 1VQPN 5KPTA 5AQFA 3S41A 1VSHA 4EZ9A 3OBYA 1VRTA 2ASMA 4DR4K 1HNXK 3MXIA 3CPWM 1ZBIA 3NBPA 3B6PA 3G25A 4FJ7A 2ZQBA 4E3SA 1MDUB 5KGXA 1EO1A 1K73O 1QSLA 4JYAK 4KHQA 2QWQA 1VSEA 4K8ZA 1KAZA 4JKGB 5TKWA 1WNSA 4JD2B 4XEIA 3NF7A 4CW7B 2UXCK 3PUFA 2P9KA 3ZETB 1ZBLA 4FL9A 3DOLA 4OGCA 2E88A 1QHAA 4LF4K 4OX9K 4ILGB 5AQUA 3MN7A 4DMNA 4B3TK 2HMPA 3IMXA 4PY5A 4JHDB 1S6QA 3K2PA 5AQLA 2YNHA 2WTUA 4FCYA 2F7TA 2BE2A 3MN5A 1OKJA 1KLNA 3QEWA 3DXKA 3T1YK 4GV6A 3LAKA 5CHIA 1EP4A 4H5NA 5J1EA 5LY3A 1BDGA 5DK5A 4H0OA 3VQCA 1NGBA 3L4QA 3K59A 2YHXA 5BN9A 4PUOA 1V4TA 5FPNA 2P9KB 3FGUA 4AH9A 5KPZA 3BY5A 2IS3A 3BF3A 2HHTA 3J7YP 3D2FA 4FLTA 2G8UA 5C15A 4JAXA 1NM1A 5AQNA 4CGIA 1W7AA 3CCUN 3PX4A 4CEEA 1S6PA 2P9SA 3LDSA 3THWA 3O1BA 3U6FA 3TANA 4FM2A 2A3ZA 3SZ2A 4N76A 3RWUA 3OYMA 3OW2M 4LC9B 4DR3K 4KB0A 1E3MA 3LM9A 3WUHA 3CETA 4CZJA 2DY4A 1SL2A 3CJ1A 1VSMA 1K8AO 2O8EB 3IS9A 3DXKB 5BPLA 1K8KA 2F4VK 4TSXA 4FJNA 4M7YA 5BREA 5AQJA 2WFBA 5BR9A 1SS6A 1KFSA 1NKBA 3THXB 3TSPA 2P9UA 2QWNA 5T7BA 3QNNA 3QIPA 3PSIA 4DTMA 3TABA 4RW9A 3HOTA 2GELA 1EX4A 3K0SA 4CGFA 2WC9A 4BE1A 3THWB 2YNGA 3PX0A 4G1QA 4A2AA 2E2QA 4N47A 2O8FB 4DV2K 1E4FT 2RN2A 1NK5A 3OYDA 4YORA 1KSPA 4OPAA 2P9PB 4FLUA 1C0UA 1UA1A 2LSNA 1QZ6A 4FK2A 5AFUH 3QNOA 2VG5A 3PX6A 4FOEA 3MXMA 3ZCMA 4K43A 4WQ5C 4AHTA 1QQMA 4EZ6A 2KHOA 3LZIA 2V7ZA 4N5SA 3O3GA 1CXQA 3KK3A 4FXDA 2IVPA 1BHLA 2QA4N 4AHRA 1ESVA 4DCHA 1NK7A 4IG3A 4CECA 1S5JA 3J80O 3L3VA 3WEEA 2HNZA 1SV5A 4IZ9A 3HI0A 3C6HA 4WFBL 1K6YA 4UQGA 2ZWHA 2A41A 2QW9A 3FFIA 4KBOA 3LAMA 4DSEA 4CEOA 4DV5K 3T1HK 4BRQA 4YOWA 1RTJA 4DS4A 2FLOA 4FVMA 1OVQA 5AQGA 4BR0A 4FM1A 1Y97A 1WOQA 1VQ9N 2DPNA 4HVJA 4FJXA 4LY7A 4OLBA 4NXNK 4CHOA 2HHWA 4X62K 3PSFA 5AQXA 3HPOA 1U48A 3CC2N 1GOBA 1TGOA 5LL6Z 3O9UA 1TKXA 4CHNA 4DUZK 1YI2N 1RBUA 4K41A 4CEFA 4CEAA 1TV6A 4HWIA 3S3NA 3D2EA 4OKKA 3WT0A 4B9NA 3EY1A 4BC2A 2W41A 5B8HA 4KRFA 4BQZA 3T7ZA 4NB4A 4M41A 5HRNA 4IO9L 1RTIA 2Q31A 3HL8A 4B1WB 4J2DA 4CJVA 3KLGA 3HTVA 2GUIA 4KO0A 3BUZB 5BPMA 3J7ZO 3GE1A 4DUYK 1IBKK 1YJWN 4Z4IA 1JJ2M 3ZT3A 1SL0A 5AZJA 3IKMA 2YCHA 2P51A 3CYMA 5CR4A 3OYJA 2CH5A 4PKHA 3I8DA 4OLAA 4CJWA 1KVAA 3B8AX 3IFRA 1JLBA 4FZYA 1QVFM 1BCMA 4CF2A 2VG6A 4DR1K 4CFAA 3EO3A 1HR0K 4CGHA 4ELUA 3KKRA 5EU7A 1QZ5A 1D9DA 2JWLA 1WSGA 4CJSA 3NCIA 3HO1A 1F21A 1VQ8N 4JI7K 1RBVA 1BG3A 3VENA 2VCPA 2FBYA 3S9HA 3KTQA 3WNHA 3P1GA 4CD1A 4OKEA 1FJGK 2FBVA 4FWNA 2D0OA 4C8OA 3UKRA 4JI6K 3FR0A 5FRMA 1C6VA 3HK2A 3E66A 2Y1IA 4I2QA 5M1FA 3LDQA 3CMEN 1GLEG 4FK0A 1N33K 4BRFA 1VQLN 1RFQA 5AZJB 1SZ2A 1NK9A 3NE6A 2HBJA 3LDOA 2AA4A 3ZSQA 2YKMA 4OO1J 1HYZA 1RTDA 4JKEA 4DTNA 4B1YB 3CQ8A 4CFCA 3C6UA 3RMAA 3NVKA 4JKHA 3H46O 5IT9O 5DMRA 1NWKA 3DRRA 5F2RA 3DOKA 4BWMA 1HYSA 4Z94A 3MWTA 1I39A 2D0AA 1QVGM 1XHZA 1OH5A 4DF4A 4WCEL 3THVA 4JI8K 1XHXA 1B92A 3CI5A 3P4IA 4BRDA 3HPHA 4FWRA 3OYFA 1L5UA 4DFKA 1BISA 5ADXH 2QTDA 2W6LA 1O1WA 2NRHA 4NXMK 5EXWA 3G4SN 2UXBK 4PL8A 2HVIA 3CM6A 3WNGA 4KTZA 4O44A 3WQUA 5AQKA 3ZSVA 3M3ZA 3S3OA 3T69A 1N5YA 4CI6A 4NCBA 1NK4A 3C94A 2OA8A 3EN9A 5KQ8A 2Z1GA 1Q18A 1ASVA 1CZBA 1DTQA 4F9OA 3OS2A 3ENHA 2Q97A 3IUCA 4JN4A 3CCQN 4E7LA 1S9GA 1HNVA 1ILYA 3UE5A 5AQYA 5J2QA 4B9SA 1VAZA 5AQQA 4E7KA 2QXFA 1S1VA 4B8CA 4K42A 4BC5A 2ZD1A 1KLMA 1GOAA 5HRRA 3QEVA 4LFBK 2E6LA 1KVBA 4A57A 2EHGA 4BR7A 1U45A 1U04A 3E01A 4X65K 3OBWA 4YDUA 2UXDK 1XWLA 1VSDA 3VF6A 4KFBA 4AHVA 5C24A 3V9UA 3I8BA 3FZFA 1KRPA 5M1QA 4N56A 1Z6RA 5IWAK 3QBWA 4A5BA 1XNRK 4DSIA 2JGUA 3CHWA 4DR2K 3THYB 3I0SA 2E2PA 1BI4B 4KH5A 1BIZA 3RSEB 1TK0A 1HNZK 5AQRA 3GBTA 4O8UA 4B3MK 3VQ9A 4FSVA 1NMDA 2BTFA 2CGJA 4IJAA 2IOCA 2D0CA 1BA1A 5E26A 1NNEA 4QAGA 3CJCA 2YHAA 4KTQA 4FK4A 3VGKA 4DQPA 3OTOK 4FZXC 4XH5A 3AVMA 3KWGA 3VQ4A 3DLBA 4ISEA 2G8FA 4K8XA 3SUOA 3CJ9A 4JI5K 5JS2A 1ZYQA 3DWLA 4C1NI 3WNEA 4DU3A 4IOXA 4JI2K 3O9RA 4BGAA 1XNQK 5C42A 5AQTA 3CPEA 3K58A 1JLGA 2DFEA 3TSUA 4BRLA 4OGEA 2FF3B 3M1FA 5MLCQ 1GLBG 3L0QA 3CCMN 2QXLA 4PWDA 2UUCK 1WSHA 3LDNA 1DTTA 4CJLA 4CZFA 1VQ6N 2WBNA 3NH1A 3FZMA 1L3SA 3VEZA 3VQAA 2XY5A 1XUPO 1Y64A 3O3FA 3CC4N 2HF4A 2HHUA 1QSSA 2JWKA 3HYFA 3CCEN 2XY8A 2NRTA 4M3TA 3RR8A 1C1AA 4GVEA 4O4GA 3O9TA 3P39A 4BR5A 4DU4A 3OYHA 3CERA 1TL3A 4CFBA 4KI4A 2HBLA 2HOEA 2O4GA 3AVAA 5AR0A 4CZEA 3K9JA 1BCOA 4DTUA 4KHNA 5HROA 2FC0A 4H8KA 2KKZA 4BGBA 3CCVN 5M1OA 3SMSA 4H0VB 3VTIA 1ZBHA 4DSJA 5AZIB 5GIOA 1S3XA 4MQ3A 4JD2A 3ZT1A 2XO7A 3SUQA 4F8RA 3TSQA 1YHQN 3ZETA 4A2BA 4BRMA 3NH0A 2A1SA 3AA3A 3SUPA 3CQYA 4GMJB 4WQ4A 2KZZA 1ASUA 1QQCA 2OZMA 1X9SA 4PKIA 4CEZA 4IFEA 1WLJA 3EYZA 5FPEA 2OPPA 1WBBA 4FJHA 3A0IX 4HCBA 2W6KA 2UUBK 3L2RA 2UU9K 2NRZA 3ZYYX 4I6MB 4CF9A 5AJ3K 3AVJA 3H3NO 3V9SA 4BG9A 1N6QA 4BE2A 2E1ZA 2E4LA 3VMFB 1HUXA 2HBKA 2ETJA 3AARA 1BU6O 3OJUA 2PYJA 4J2BA 4JKAA 1NJYA 4X64K 4CJEA 3F2KA 3NVMA 4KH4A 4V19S 5C10A 2QWRA 5JICA 1HPZA 4KH6A 2J4RA 3AA4A 3AO4A 3DMJA 3ZLJA 5LMNK 2A1RA 3U3GA 3DI6A 4EIAA 4Y1CA 4N41A 1SKRA
chains in the Genus database with same CATH topology
3M8SA 3SUNA 4FYDA 4IG3A 4CECA 3OYAA 1S5JA 3NGYA 3MEGA 1TKZA 3T19A 3KIOA 4CERA 3OYEA 1TL1A 2HNDA 3EZ5A 1SKWA 1NJXA 3L3VA 1J5OA 4M3YA 5HP1A 2Y1JA 1S1XA 3KD1E 3QEPA 2HNZA 1SV5A 4IFVA 3AVHA 1BQMA 2NUBA 3S3MA 3DLGA 3CFRA 1K6YA 4UQGA 4DTOA 1LWCA 2IDOA 2KQ2A 1LV5A 2Z1JA 1HNIA 4YFUA 3FFIA 3PV8A 4RW6A 2GBZA 3LAMA 3U3YA 1VK0A 4DSEA 3SI6A 4ELTA 3TI0A 4CEOA 3M8RA 4H4MA 1IO2A 3QO9A 4HUGA 3RTVA 3DLEA 1RTJA 4DS4A 4CJQA 4FVMA 4O0JA 4WE1A 4FJIA 4FM1A 1Y97A 1W0HA 2X6SA 4CCHA 4OLBA 4HVJA 1WAFA 4LY7A 4FJXA 4FLYA 5KGWA 2O4IA 2YV0X 4CJFA 4CHOA 4E1NA 2HHWA 1NOZA 3HPOA 1U48A 1C1BA 4W5RA 3OS1A 1GOBA 3TWHA 3LP2A 1U49A 1TGOA 1TKTA 3K5LA 3P5JA 3SQ1A 1TKXA 4CHNA 1RBUA 1GOCA 4CEFA 1W9HA 4CEAA 2RKIA 4CEBA 4FZZA 4GVMA 4XIUA 1HMVA 3KJVA 1XI1A 1TV6A 3SNNA 4CGGA 3S3NA 3VQ5A 4CGJA 1NKCA 1UA0A 1QHTA 4OKKA 2PZSA 4B9NA 2OPQA 1RILA 4DTSA 3EY1A 1NOYA 4IBNA 1S1TA 4DQIA 1WSEA 4LH5A 4L8RB 2P5GA 4DQQA 4F3TA 4KRFA 4BACA 3O3HA 1S1UA 4M41A 4Z4CA 4CJ3A 5HRNA 3HSTB 1RTIA 1A5XA 3TAFA 3BGRA 3HL8A 3RR7A 4J2EA 4B3OA 3ZT0A 1LAWA 1NJZA 1ITGA 4CJVA 5HLFA 4J2DA 3KLGA 3CM5A 4E0DA 3ZSRA 1ZBUA 3LP3A 1QE1A 2GUIA 2GV9A 4KO0A 2OZSA 3C95A 3V9ZA 1YVUA 4E19A 4Z4IA 2W42A 3ZT3A 1SL0A 1VSJA 4NCAA 2YHBA 2P51A 1REVA 3CYMA 3TR8A 3OYJA 1BIUA 2B5JA 3I8DA 4OLAA 1FKPA 3IRXA 4CJWA 2OYQA 4KREA 1L3VA 3O4QA 3AVLA 1KVAA 2HVHA 4JS4A 1JLBA 4FJGA 3DLKA 4ID5A 4F3OA 4B9UA 4FZYA 1BCMA 1HQEA 4CGDA 1DLOA 1VSKA 2VG6A 4AHSA 4CF2A 3A2FA 4IG0A 4CHYA 4M45A 4CFAA 4DFPA 4CGHA 3K5OA 4RW4A 2BDPA 1B9DA 3KKRA 5EU7A 4ELUA 1D9DA 1JLEA 3F9KA 4QOZB 1JL2A 1WSGA 4M42A 3I0RA 1BL3A 2EX3A 1KCFA 4CJSA 1LW2A 3NCIA 3MECA 1F21A 1NK6A 3HO1A 4DFJA 4HCCA 3LP0A 4CJRA 1RBVA 3M8PA 2XHBA 3VQQA 2FBYA 3S9HA 4PA1A 2ZE2A 4DLEA 2FBTA 3O4NA 1QTMA 4FJLA 1EXQA 3VQBA 1RBTA 3KTQA 3WNHA 3P1GA 4CJUA 4OKEA 2G8WA 2KFNA 3TAMA 1RT1A 1RCHA 3LWLA 2FBVA 3DLHA 4C8OA 1EKEA 2XRIA 3NAEA 5FRMA 4DWIA 3L2QA 2AJQA 1C6VA 3HK2A 2Y1IA 4DQRA 4I2QA 3LALA 1RT7A 5KTQA 3CG7A 3L2WA 4FK0A 5CZ1A 3ZSWA 2F8SA 4LD0A 2KW4A 4QCLA 3LWMA 1NK9A 1WSJA 3NE6A 3SPZA 3M8QA 4O55A 3LPUA 3HVTA 4B9LA 1IH7A 3ZSQA 2YKMA 3AVIA 2Z1HA 4E7JA 5KRSA 5D3GA 1LWFA 2WOMA 3HXMA 1HYZA 3SQ4A 1YT3A 3AVNA 3AVCA 4M3RA 3LZJA 1RTDA 4DTNA 1IKWA 4I9LA 4OVLA 3CQ8A 4FJKA 2X78A 1A5VA 4CFCA 1TK8A 1X9MA 3C6UA 1WAJA 3RMAA 4BDPA 1S9EA 3SJJA 3OYNA 1HRHA 4ZHRA 3K5NA 4Z4EA 4CESA 4JS5A 2RPIA 3MEEA 3L8BA 3KD5E 4LH4A 5DMRA 3VQDA 3ITHA 4HUEA 3AO1A 3DRRA 4DU1A 3V1OA 1TK5A 1J54A 3DOKA 4FW2A 3WNFA 4BWMA 1HYSA 4F4KA 3AVFA 2IGIA 1I39A 4B8AB 4ELVA 4Z0UA 2D0AA 1RT5A 4KKOA 1XHZA 4DF4A 2VG7A 3L3UA 3SCXA 3THVA 5E41A 1X1PA 4CK2A 4Y1DA 4W5QA 3SQ2A 1X9WA 1XHXA 4EP5A 4B9MA 2XY7A 1B92A 4Q0BA 4NYFA 1UOCA 2IAJA 3SV4A 1ASWA 3LPTA 3V1RA 1FK9A 4BDZA 5I3UA 3HPHA 3KK2A 1C0TA 3OYFA 1L5UA 4DFKA 1BISA 4KI6A 2HHSA 2PYLA 4RW8A 1NK8A 1WN7A 1RDBA 5I42A 1RTHA 3ASMA 1O1WA 4I2PA 3CFOA 3NGZA 3F73A 3VA3A 1IKVA 3QLHA 2HVIA 3CM6A 2QKKA 3WNGA 3SYZA 3T3FA 2B6AA 4KTZA 1VRUA 1S1WA 5KRTA 3DLRA 4O44A 4E7IA 3VA0A 4FJMA 3ZSVA 1HQUA 2IC3A 3ZSYA 4KB1A 4C8NA 3S3OA 5KI6A 5HRPA 1N5YA 4NCBA 1B9FA 4CK3A 3AO3A 4IDKA 4E7HA 3HT3A 1NK4A 3C94A 2OA8A 4KV8A 4OJRA 2HHVA 3DRPA 2Z1GA 4B08A 1RDAA 3AVBA 3JYTA 4CHPA 3OS0A 3NF6A 4CK1A 3K5MA 1ASVA 1CZBA 1DTQA 1D8YA 3OS2A 2G8KA 1SUQA 4ID1A 3OYGA 3TAQA 4IFYA 3QETA 4ZTFA 4M3UA 3D45A 4KHUA 3TAGA 3VQ6A 4E7LA 3VQ7A 3KLIA 1S9GA 1Z26A 4FW1A 4CJTA 4Q5VA 3V1QA 2HHQA 1CLQA 3KK1A 1LWEA 3QINA 1HNVA 1TKDA 4Z4HA 2X74A 3ZSZA 2X6NA 5J2QA 5FDLA 4B9SA 3SQ0A 1IKXA 4FJ5A 4E7KA 1YTUA 4FLVA 2QXFA 1S1VA 5J2PA 1R0AA 4FJJA 3ZT4A 4B8CA 1YTAA 1CXUA 4M3ZA 4NCGA 1IKYA 3AA2A 1VSLA 3C6TA 3D0PA 3PO5A 2ZD1A 1KLMA 1LW0A 1GOAA 1Z25A 3AV9A 4O5BA 5HRRA 3SV3A 3QEVA 2D0BA 1JLAA 1RT6A 1WSIA 2E6LA 4JRPA 1BQNA 1KVBA 1RT4A 4PQUA 1QS4A 1RBSA 3VQPA 3RRGA 4DSLA 1EETA 2EHGA 3NFAA 4BDYA 1U04A 3K57A 3E01A 1U45A 2G8HA 4AILC 2DTUA 3HP6A 1XC9A 4DSKA 4Z4GA 1XWLA 1JKHA 1VSDA 3AA5X 4E89A 4KHWA 4CHZA 4KFBA 2YNFA 4AHVA 3QESA 4DLGA 4OPJA 5C24A 3V9UA 4ZTJA 3OVNA 1RT3A 1KRPA 1JLQA 4HTUA 4FLXA 4J2AA 3NF9A 1KVCA 4M3WA 4N56A 5FRNA 4FJ9A 4DSIA 1Q9YA 2JGUA 1G15A 4CFDA 1VSHA 4EZ9A 1VRTA 3I0SA 4CIGA 4ICLA 3MXIA 1BI4B 3HVRA 1ZBIA 3NF8A 1BIZA 4DTRA 1TK0A 4C8LA 3RMDA 4JLHA 4NYNA 4KTWA 3NBPA 1NK0A 2PY5A 4CJKA 1T8EA 5JS1A 3LP1A 3B6PA 3VQ9A 4CF1A 4FJ7A 2VWJA 2ZQBA 1RDDA 4E3SA 5KGXA 2IOCA 1RT2A 2D0CA 1QSLA 4CJPA 3RRHA 3ISNC 1ZBFA 4KHQA 3RMCA 3TARA 3AVGA 2DFHA 3KKSA 5CY4A 3HP9A 4QAGA 1VSEA 3ZSXA 4HHTA 4K8ZA 1WNSA 3MXJA 3NF7A 2FBXA 2YHAA 3PUFA 4KTQA 2BANA 5SWMA 4FK4A 1IG9A 1JXEA 1ZBLA 4DQPA 4FZXC 1L3TA 4CIEA 3DOLA 3AVMA 4OGCA 3VQ4A 3OYCA 3NHGA 3DLBA 2QK9A 3PO4A 4B9TA 2G8FA 5CYQA 4K8XA 4DFMA 4DMNA 1C1CA 5HBMA 3SUOA 4DG1A 1Q8IA 1TVRA 5JS2A 4DS5A 1ZYQA 2BGGA 4CJ4A 3WNEA 1CZ9A 4DU3A 1U47A 4PY5A 4MFBA 3V9XA 1S6QA 3K2PA 5C42A 3AO2A 3OYLA 2G8IA 3K58A 1JLGA 2YNHA 2DFEA 4O0IA 4FCYA 2BE2A 4OGEA 3OJSA 2XY6A 3L2UA 1VSIA 2B4JA 4W5OA 3OYBA 1KLNA 4FM0A 3QEWA 3V81A 4Z4FA 3LAKA 4PWDA 1EP4A 1WSHA 3T1AA 3NH2A 2HHXA 5CYMA 1JL1A 5J1EA 2F8TA 1DTTA 1I3AA 1HJRA 1D5AA 5DK5A 4JRQA 3DYAA 4CJLA 3NH1A 3VQCA 1L3SA 3VQAA 3K59A 2XY5A 2HMIA 4M3XA 3O3FA 4PUOA 3V9WA 2HHUA 1QSSA 3NGIA 3VQEA 3AVKA 3HYFA 1VSFA 4AH9A 4DQSA 2JLEA 4BWJA 4W5TA 3KLFA 3KLEA 2IS3A 4R5PA 2HHTA 2XY8A 4M3TA 4W5NA 4FLTA 2G8UA 3RR8A 1C1AA 3V6DA 2RF2A 4O4GA 1JLCA 2DFFA 4BE0A 1TAQA 4CGIA 4DU4A 3OYHA 3PX4A 4CEEA 1S6PA 2WONA 3OY9A 3LDSA 3U6FA 3TANA 1TL3A 4CFBA 4KI4A 3B6OA 1BI4A 4FM2A 3SZ2A 4N76A 1JXBA 1UWBA 3OYMA 3RWUA 2HW3A 4FLWA 2O4GA 3AVAA 5HRSA 3P83D 3OYIA 1Q9XA 4KB0A 4F2SA 4I9QA 3CFPA 1BCOA 4DTUA 4KHNA 1A5WA 3VQ8A 1SL2A 5HROA 1VSMA 2FC0A 4H8KA 4EP4A 3MAQA 2DY4A 3IG1A 3IS9A 3HM9A 4KAZA 1KFDA 3KLHA 3ZT2A 4DTXA 2Q3SA 2OPSA 1ZBHA 2R7YA 1MU2A 4B9VA 4DSJA 1UAXA 4TSXA 4FJNA 2ATQA 1C0MA 4MQ3A 3VN5A 1RNHA 3G0ZA 3ZT1A 2OPRA 4AHCA 2XO7A 4GW6A 3SUQA 4F8RA 2QKBA 1KFSA 1FXXA 2P1JA 4RW7A 3MEDA 1NKBA 4HUFA 3IAYA 5J2NA 1NJWA 3NH0A 3NDKA 2A1SA 2YKNA 3AA3A 4CF8A 4CJ5A 5T7BA 3SUPA 4CF0A 4DTJA 3QNNA 3UIQA 1J9AA 4GMJB 3QIPA 4FLZA 1SKSA 2KZMA 2F96A 5SZTA 4DTMA 4C8KA 3TABA 2KFZA 3G10A 4RW9A 2HNYA 4DF8A 2KZZA 1EX4A 3QEXA 2D5RA 1ASUA 1QQCA 4CGFA 2OZMA 5C25A 3L2VA 1X9SA 4BE1A 4CEZA 1WLJA 1RDCA 4I7FA 3EYZA 2OPPA 4F2RA 4C8MA 2YNGA 3PX0A 3SPYA 1T03A 4FJHA 2HB5A 4OPKA 4HCBA 4G1QA 3RMBA 3L2RA 4AHUA 4N47A 4YNQA 1KTQA 1HYVA 5CZ2A 4CF9A 4CE9A 1NKEA 3AVJA 2RN2A 3V9SA 1NK5A 1D9FA 3DM2A 4LSNA 2YNIA 1N6QA 3AO5A 3OYDA 5K14A 4BE2A 3TAEA 2E4LA 1T7PA 1KSPA 1TAUA 2VWKA 1T05A 2ETJA 4FLUA 1C0UA 1BGXT 3OJUA 1UA1A 2LSNA 2P5OA 1SL1A 2PYJA 3PY8A 4J2BA 1NJYA 4DTPA 5FROA 3H08A 2ITGA 4CEDA 4FK2A 4CJEA 4FJ8A 4KPYA 4DSFA 1L3UA 3QNOA 3ULDA 2VG5A 1JLFA 3DRSA 5J2MA 3PX6A 3MXMA 1QSYA 3ZSOA 3HJFA 4H4OA 3ZCMA 2G8VA 3QIOA 4RG8A 2Z1IA 3BDPA 4AHTA 4EZ6A 3JSMA 3TAPA 3LZIA 2I5JA 4IKFA 1J53A 1LAVA 1HPZA 4CIFA 4KHSA 3AA4A 3AO4A 3DMJA 4CEQA 4N5SA 3V4IA 4KHYA 3O3GA 3LANA 3QEIA 2A1RA 1CXQA 4LSLA 3DI6A 1FKOA 4OKJA 3U3GA 4CHQA 3OYKA 3KK3A 2E6MA 3QERA 4FXDA 2KTQA 4E1MA 3HPGA 1BHLA 1WSFA 3ALYA 4Y1CA 4AHRA 4N41A 1RBRA 1SKRA 1U4BA 1NK7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M8S A;  3SUN A;  4FYD A;  4IG3 A;  4CEC A;  3OYA A;  1S5J A;  3NGY A;  3MEG A;  1TKZ A;  3T19 A;  3KIO A;  4CER A;  3OYE A;  1TL1 A;  2HND A;  3EZ5 A;  1SKW A;  1NJX A;  3L3V A;  1J5O A;  4M3Y A;  5HP1 A;  2Y1J A;  1S1X A;  3KD1 E;  3QEP A;  2HNZ A;  1SV5 A;  4IFV A;  3AVH A;  1BQM A;  2NUB A;  3S3M A;  3DLG A;  3CFR A;  1K6Y A;  4UQG A;  4DTO A;  1LWC A;  2IDO A;  2KQ2 A;  1LV5 A;  2Z1J A;  1HNI A;  4YFU A;  3FFI A;  3PV8 A;  4RW6 A;  2GBZ A;  3LAM A;  3U3Y A;  1VK0 A;  4DSE A;  3SI6 A;  4ELT A;  3TI0 A;  4CEO A;  3M8R A;  4H4M A;  1IO2 A;  3QO9 A;  4HUG A;  3RTV A;  3DLE A;  1RTJ A;  4DS4 A;  4CJQ A;  4FVM A;  4O0J A;  4WE1 A;  4FJI A;  4FM1 A;  1Y97 A;  1W0H A;  2X6S A;  4CCH A;  4OLB A;  4HVJ A;  1WAF A;  4LY7 A;  4FJX A;  4FLY A;  5KGW A;  2O4I A;  2YV0 X;  4CJF A;  4CHO A;  4E1N A;  2HHW A;  1NOZ A;  3HPO A;  1U48 A;  1C1B A;  4W5R A;  3OS1 A;  1GOB A;  3TWH A;  3LP2 A;  1U49 A;  1TGO A;  1TKT A;  3K5L A;  3P5J A;  3SQ1 A;  1TKX A;  4CHN A;  1RBU A;  1GOC A;  4CEF A;  1W9H A;  4CEA A;  2RKI A;  4CEB A;  4FZZ A;  4GVM A;  4XIU A;  1HMV A;  3KJV A;  1XI1 A;  1TV6 A;  3SNN A;  4CGG A;  3S3N A;  3VQ5 A;  4CGJ A;  1NKC A;  1UA0 A;  1QHT A;  4OKK A;  2PZS A;  4B9N A;  2OPQ A;  1RIL A;  4DTS A;  3EY1 A;  1NOY A;  4IBN A;  1S1T A;  4DQI A;  1WSE A;  4LH5 A;  4L8R B;  2P5G A;  4DQQ A;  4F3T A;  4KRF A;  4BAC A;  3O3H A;  1S1U A;  4M41 A;  4Z4C A;  4CJ3 A;  5HRN A;  3HST B;  1RTI A;  1A5X A;  3TAF A;  3BGR A;  3HL8 A;  3RR7 A;  4J2E A;  4B3O A;  3ZT0 A;  1LAW A;  1NJZ A;  1ITG A;  4CJV A;  5HLF A;  4J2D A;  3KLG A;  3CM5 A;  4E0D A;  3ZSR A;  1ZBU A;  3LP3 A;  1QE1 A;  2GUI A;  2GV9 A;  4KO0 A;  2OZS A;  3C95 A;  3V9Z A;  1YVU A;  4E19 A;  4Z4I A;  2W42 A;  3ZT3 A;  1SL0 A;  1VSJ A;  4NCA A;  2YHB A;  2P51 A;  1REV A;  3CYM A;  3TR8 A;  3OYJ A;  1BIU A;  2B5J A;  3I8D A;  4OLA A;  1FKP A;  3IRX A;  4CJW A;  2OYQ A;  4KRE A;  1L3V A;  3O4Q A;  3AVL A;  1KVA A;  2HVH A;  4JS4 A;  1JLB A;  4FJG A;  3DLK A;  4ID5 A;  4F3O A;  4B9U A;  4FZY A;  1BCM A;  1HQE A;  4CGD A;  1DLO A;  1VSK A;  2VG6 A;  4AHS A;  4CF2 A;  3A2F A;  4IG0 A;  4CHY A;  4M45 A;  4CFA A;  4DFP A;  4CGH A;  3K5O A;  4RW4 A;  2BDP A;  1B9D A;  3KKR A;  5EU7 A;  4ELU A;  1D9D A;  1JLE A;  3F9K A;  4QOZ B;  1JL2 A;  1WSG A;  4M42 A;  3I0R A;  1BL3 A;  2EX3 A;  1KCF A;  4CJS A;  1LW2 A;  3NCI A;  3MEC A;  1F21 A;  1NK6 A;  3HO1 A;  4DFJ A;  4HCC A;  3LP0 A;  4CJR A;  1RBV A;  3M8P A;  2XHB A;  3VQQ A;  2FBY A;  3S9H A;  4PA1 A;  2ZE2 A;  4DLE A;  2FBT A;  3O4N A;  1QTM A;  4FJL A;  1EXQ A;  3VQB A;  1RBT A;  3KTQ A;  3WNH A;  3P1G A;  4CJU A;  4OKE A;  2G8W A;  2KFN A;  3TAM A;  1RT1 A;  1RCH A;  3LWL A;  2FBV A;  3DLH A;  4C8O A;  1EKE A;  2XRI A;  3NAE A;  5FRM A;  4DWI A;  3L2Q A;  2AJQ A;  1C6V A;  3HK2 A;  2Y1I A;  4DQR A;  4I2Q A;  3LAL A;  1RT7 A;  5KTQ A;  3CG7 A;  3L2W A;  4FK0 A;  5CZ1 A;  3ZSW A;  2F8S A;  4LD0 A;  2KW4 A;  4QCL A;  3LWM A;  1NK9 A;  1WSJ A;  3NE6 A;  3SPZ A;  3M8Q A;  4O55 A;  3LPU A;  3HVT A;  4B9L A;  1IH7 A;  3ZSQ A;  2YKM A;  3AVI A;  2Z1H A;  4E7J A;  5KRS A;  5D3G A;  1LWF A;  2WOM A;  3HXM A;  1HYZ A;  3SQ4 A;  1YT3 A;  3AVN A;  3AVC A;  4M3R A;  3LZJ A;  1RTD A;  4DTN A;  1IKW A;  4I9L A;  4OVL A;  3CQ8 A;  4FJK A;  2X78 A;  1A5V A;  4CFC A;  1TK8 A;  1X9M A;  3C6U A;  1WAJ A;  3RMA A;  4BDP A;  1S9E A;  3SJJ A;  3OYN A;  1HRH A;  4ZHR A;  3K5N A;  4Z4E A;  4CES A;  4JS5 A;  2RPI A;  3MEE A;  3L8B A;  3KD5 E;  4LH4 A;  5DMR A;  3VQD A;  3ITH A;  4HUE A;  3AO1 A;  3DRR A;  4DU1 A;  3V1O A;  1TK5 A;  1J54 A;  3DOK A;  4FW2 A;  3WNF A;  4BWM A;  1HYS A;  4F4K A;  3AVF A;  2IGI A;  1I39 A;  4B8A B;  4ELV A;  4Z0U A;  2D0A A;  1RT5 A;  4KKO A;  1XHZ A;  4DF4 A;  2VG7 A;  3L3U A;  3SCX A;  3THV A;  5E41 A;  1X1P A;  4CK2 A;  4Y1D A;  4W5Q A;  3SQ2 A;  1X9W A;  1XHX A;  4EP5 A;  4B9M A;  2XY7 A;  1B92 A;  4Q0B A;  4NYF A;  1UOC A;  2IAJ A;  3SV4 A;  1ASW A;  3LPT A;  3V1R A;  1FK9 A;  4BDZ A;  5I3U A;  3HPH A;  3KK2 A;  1C0T A;  3OYF A;  1L5U A;  4DFK A;  1BIS A;  4KI6 A;  2HHS A;  2PYL A;  4RW8 A;  1NK8 A;  1WN7 A;  1RDB A;  5I42 A;  1RTH A;  3ASM A;  1O1W A;  4I2P A;  3CFO A;  3NGZ A;  3F73 A;  3VA3 A;  1IKV A;  3QLH A;  2HVI A;  3CM6 A;  2QKK A;  3WNG A;  3SYZ A;  3T3F A;  2B6A A;  4KTZ A;  1VRU A;  1S1W A;  5KRT A;  3DLR A;  4O44 A;  4E7I A;  3VA0 A;  4FJM A;  3ZSV A;  1HQU A;  2IC3 A;  3ZSY A;  4KB1 A;  4C8N A;  3S3O A;  5KI6 A;  5HRP A;  1N5Y A;  4NCB A;  1B9F A;  4CK3 A;  3AO3 A;  4IDK A;  4E7H A;  3HT3 A;  1NK4 A;  3C94 A;  2OA8 A;  4KV8 A;  4OJR A;  2HHV A;  3DRP A;  2Z1G A;  4B08 A;  1RDA A;  3AVB A;  3JYT A;  4CHP A;  3OS0 A;  3NF6 A;  4CK1 A;  3K5M A;  1ASV A;  1CZB A;  1DTQ A;  1D8Y A;  3OS2 A;  2G8K A;  1SUQ A;  4ID1 A;  3OYG A;  3TAQ A;  4IFY A;  3QET A;  4ZTF A;  4M3U A;  3D45 A;  4KHU A;  3TAG A;  3VQ6 A;  4E7L A;  3VQ7 A;  3KLI A;  1S9G A;  1Z26 A;  4FW1 A;  4CJT A;  4Q5V A;  3V1Q A;  2HHQ A;  1CLQ A;  3KK1 A;  1LWE A;  3QIN A;  1HNV A;  1TKD A;  4Z4H A;  2X74 A;  3ZSZ A;  2X6N A;  5J2Q A;  5FDL A;  4B9S A;  3SQ0 A;  1IKX A;  4FJ5 A;  4E7K A;  1YTU A;  4FLV A;  2QXF A;  1S1V A;  5J2P A;  1R0A A;  4FJJ A;  3ZT4 A;  4B8C A;  1YTA A;  1CXU A;  4M3Z A;  4NCG A;  1IKY A;  3AA2 A;  1VSL A;  3C6T A;  3D0P A;  3PO5 A;  2ZD1 A;  1KLM A;  1LW0 A;  1GOA A;  1Z25 A;  3AV9 A;  4O5B A;  5HRR A;  3SV3 A;  3QEV A;  2D0B A;  1JLA A;  1RT6 A;  1WSI A;  2E6L A;  4JRP A;  1BQN A;  1KVB A;  1RT4 A;  4PQU A;  1QS4 A;  1RBS A;  3VQP A;  3RRG A;  4DSL A;  1EET A;  2EHG A;  3NFA A;  4BDY A;  1U04 A;  3K57 A;  3E01 A;  1U45 A;  2G8H A;  4AIL C;  2DTU A;  3HP6 A;  1XC9 A;  4DSK A;  4Z4G A;  1XWL A;  1JKH A;  1VSD A;  3AA5 X;  4E89 A;  4KHW A;  4CHZ A;  4KFB A;  2YNF A;  4AHV A;  3QES A;  4DLG A;  4OPJ A;  5C24 A;  3V9U A;  4ZTJ A;  3OVN A;  1RT3 A;  1KRP A;  1JLQ A;  4HTU A;  4FLX A;  4J2A A;  3NF9 A;  1KVC A;  4M3W A;  4N56 A;  5FRN A;  4FJ9 A;  4DSI A;  1Q9Y A;  2JGU A;  1G15 A;  4CFD A;  1VSH A;  4EZ9 A;  1VRT A;  3I0S A;  4CIG A;  4ICL A;  3MXI A;  1BI4 B;  3HVR A;  1ZBI A;  3NF8 A;  1BIZ A;  4DTR A;  1TK0 A;  4C8L A;  3RMD A;  4JLH A;  4NYN A;  4KTW A;  3NBP A;  1NK0 A;  2PY5 A;  4CJK A;  1T8E A;  5JS1 A;  3LP1 A;  3B6P A;  3VQ9 A;  4CF1 A;  4FJ7 A;  2VWJ A;  2ZQB A;  1RDD A;  4E3S A;  5KGX A;  2IOC A;  1RT2 A;  2D0C A;  1QSL A;  4CJP A;  3RRH A;  3ISN C;  1ZBF A;  4KHQ A;  3RMC A;  3TAR A;  3AVG A;  2DFH A;  3KKS A;  5CY4 A;  3HP9 A;  4QAG A;  1VSE A;  3ZSX A;  4HHT A;  4K8Z A;  1WNS A;  3MXJ A;  3NF7 A;  2FBX A;  2YHA A;  3PUF A;  4KTQ A;  2BAN A;  5SWM A;  4FK4 A;  1IG9 A;  1JXE A;  1ZBL A;  4DQP A;  4FZX C;  1L3T A;  4CIE A;  3DOL A;  3AVM A;  4OGC A;  3VQ4 A;  3OYC A;  3NHG A;  3DLB A;  2QK9 A;  3PO4 A;  4B9T A;  2G8F A;  5CYQ A;  4K8X A;  4DFM A;  4DMN A;  1C1C A;  5HBM A;  3SUO A;  4DG1 A;  1Q8I A;  1TVR A;  5JS2 A;  4DS5 A;  1ZYQ A;  2BGG A;  4CJ4 A;  3WNE A;  1CZ9 A;  4DU3 A;  1U47 A;  4PY5 A;  4MFB A;  3V9X A;  1S6Q A;  3K2P A;  5C42 A;  3AO2 A;  3OYL A;  2G8I A;  3K58 A;  1JLG A;  2YNH A;  2DFE A;  4O0I A;  4FCY A;  2BE2 A;  4OGE A;  3OJS A;  2XY6 A;  3L2U A;  1VSI A;  2B4J A;  4W5O A;  3OYB A;  1KLN A;  4FM0 A;  3QEW A;  3V81 A;  4Z4F A;  3LAK A;  4PWD A;  1EP4 A;  1WSH A;  3T1A A;  3NH2 A;  2HHX A;  5CYM A;  1JL1 A;  5J1E A;  2F8T A;  1DTT A;  1I3A A;  1HJR A;  1D5A A;  5DK5 A;  4JRQ A;  3DYA A;  4CJL A;  3NH1 A;  3VQC A;  1L3S A;  3VQA A;  3K59 A;  2XY5 A;  2HMI A;  4M3X A;  3O3F A;  4PUO A;  3V9W A;  2HHU A;  1QSS A;  3NGI A;  3VQE A;  3AVK A;  3HYF A;  1VSF A;  4AH9 A;  4DQS A;  2JLE A;  4BWJ A;  4W5T A;  3KLF A;  3KLE A;  2IS3 A;  4R5P A;  2HHT A;  2XY8 A;  4M3T A;  4W5N A;  4FLT A;  2G8U A;  3RR8 A;  1C1A A;  3V6D A;  2RF2 A;  4O4G A;  1JLC A;  2DFF A;  4BE0 A;  1TAQ A;  4CGI A;  4DU4 A;  3OYH A;  3PX4 A;  4CEE A;  1S6P A;  2WON A;  3OY9 A;  3LDS A;  3U6F A;  3TAN A;  1TL3 A;  4CFB A;  4KI4 A;  3B6O A;  1BI4 A;  4FM2 A;  3SZ2 A;  4N76 A;  1JXB A;  1UWB A;  3OYM A;  3RWU A;  2HW3 A;  4FLW A;  2O4G A;  3AVA A;  5HRS A;  3P83 D;  3OYI A;  1Q9X A;  4KB0 A;  4F2S A;  4I9Q A;  3CFP A;  1BCO A;  4DTU A;  4KHN A;  1A5W A;  3VQ8 A;  1SL2 A;  5HRO A;  1VSM A;  2FC0 A;  4H8K A;  4EP4 A;  3MAQ A;  2DY4 A;  3IG1 A;  3IS9 A;  3HM9 A;  4KAZ A;  1KFD A;  3KLH A;  3ZT2 A;  4DTX A;  2Q3S A;  2OPS A;  1ZBH A;  2R7Y A;  1MU2 A;  4B9V A;  4DSJ A;  1UAX A;  4TSX A;  4FJN A;  2ATQ A;  1C0M A;  4MQ3 A;  3VN5 A;  1RNH A;  3G0Z A;  3ZT1 A;  2OPR A;  4AHC A;  2XO7 A;  4GW6 A;  3SUQ A;  4F8R A;  2QKB A;  1KFS A;  1FXX A;  2P1J A;  4RW7 A;  3MED A;  1NKB A;  4HUF A;  3IAY A;  5J2N A;  1NJW A;  3NH0 A;  3NDK A;  2A1S A;  2YKN A;  3AA3 A;  4CF8 A;  4CJ5 A;  5T7B A;  3SUP A;  4CF0 A;  4DTJ A;  3QNN A;  3UIQ A;  1J9A A;  4GMJ B;  3QIP A;  4FLZ A;  1SKS A;  2KZM A;  2F96 A;  5SZT A;  4DTM A;  4C8K A;  3TAB A;  2KFZ A;  3G10 A;  4RW9 A;  2HNY A;  4DF8 A;  2KZZ A;  1EX4 A;  3QEX A;  2D5R A;  1ASU A;  1QQC A;  4CGF A;  2OZM A;  5C25 A;  3L2V A;  1X9S A;  4BE1 A;  4CEZ A;  1WLJ A;  1RDC A;  4I7F A;  3EYZ A;  2OPP A;  4F2R A;  4C8M A;  2YNG A;  3PX0 A;  3SPY A;  1T03 A;  4FJH A;  2HB5 A;  4OPK A;  4HCB A;  4G1Q A;  3RMB A;  3L2R A;  4AHU A;  4N47 A;  4YNQ A;  1KTQ A;  1HYV A;  5CZ2 A;  4CF9 A;  4CE9 A;  1NKE A;  3AVJ A;  2RN2 A;  3V9S A;  1NK5 A;  1D9F A;  3DM2 A;  4LSN A;  2YNI A;  1N6Q A;  3AO5 A;  3OYD A;  5K14 A;  4BE2 A;  3TAE A;  2E4L A;  1T7P A;  1KSP A;  1TAU A;  2VWK A;  1T05 A;  2ETJ A;  4FLU A;  1C0U A;  1BGX T;  3OJU A;  1UA1 A;  2LSN A;  2P5O A;  1SL1 A;  2PYJ A;  3PY8 A;  4J2B A;  1NJY A;  4DTP A;  5FRO A;  3H08 A;  2ITG A;  4CED A;  4FK2 A;  4CJE A;  4FJ8 A;  4KPY A;  4DSF A;  1L3U A;  3QNO A;  3ULD A;  2VG5 A;  1JLF A;  3DRS A;  5J2M A;  3PX6 A;  3MXM A;  1QSY A;  3ZSO A;  3HJF A;  4H4O A;  3ZCM A;  2G8V A;  3QIO A;  4RG8 A;  2Z1I A;  3BDP A;  4AHT A;  4EZ6 A;  3JSM A;  3TAP A;  3LZI A;  2I5J A;  4IKF A;  1J53 A;  1LAV A;  1HPZ A;  4CIF A;  4KHS A;  3AA4 A;  3AO4 A;  3DMJ A;  4CEQ A;  4N5S A;  3V4I A;  4KHY A;  3O3G A;  3LAN A;  3QEI A;  2A1R A;  1CXQ A;  4LSL A;  3DI6 A;  1FKO A;  4OKJ A;  3U3G A;  4CHQ A;  3OYK A;  3KK3 A;  2E6M A;  3QER A;  4FXD A;  2KTQ A;  4E1M A;  3HPG A;  1BHL A;  1WSF A;  3ALY A;  4Y1C A;  4AHR A;  4N41 A;  1RBR A;  1SKR A;  1U4B A;  1NK7 A; 
#chains in the Genus database with same CATH topology
 3MN9 A;  3M8S A;  4FYD A;  1JCF A;  2O8E A;  3KIO A;  2HND A;  1C0G A;  4JEP A;  1T44 A;  3ULE B;  4IFV A;  3AVH A;  3S3M A;  3DLG A;  3CFR A;  3QBX A;  3CC7 N;  1XC3 A;  5A2Q O;  3C0B A;  3THX A;  2GBZ A;  1NGG A;  2YHY A;  4ELT A;  3M8R A;  5CE3 A;  1IO2 A;  3QO9 A;  4HUG A;  4O0J A;  3SAG A;  3CMA N;  1W0H A;  2NRX A;  4CCH A;  1WAF A;  3U4L A;  3FFK B;  2O4I A;  3N4Q A;  1C1B A;  4W5R A;  4GY2 B;  1X9J A;  3LP2 A;  1U49 A;  1TKT A;  3P5J A;  3G71 N;  2O8F A;  4CEB A;  1GOC A;  1W9H A;  2RKI A;  4GVM A;  1XMO K;  3SNN A;  3C65 A;  5BR8 K;  2OPQ A;  1RIL A;  1NOY A;  4DQI A;  1WSE A;  4LH5 A;  2P9P A;  1Q7Y O;  4U67 L;  4DQQ A;  2UUA K;  4F3T A;  3O3H A;  1S1U A;  3HST B;  4B1U B;  4BR9 A;  3TAF A;  4DR5 K;  3ZT0 A;  1RGI A;  1LAW A;  3UKU A;  5HLF A;  3CM5 A;  4E0D A;  1YVN A;  1ZBU A;  3I56 N;  2OZS A;  3MK6 A;  3V9Z A;  2HHH K;  3VEX A;  5EX5 A;  4CBX A;  1YVU A;  1ATS A;  5ELZ A;  3O6W A;  2W42 A;  2HBM A;  4LF9 K;  4NCA A;  2YHB A;  1IBL K;  3TR8 A;  1MA9 B;  3IRX A;  2OYQ A;  1H1V A;  4KRE A;  2HVH A;  1MWK A;  4JS4 A;  4FJG A;  5AQW A;  3BZK A;  4IDH A;  4ID5 A;  5JVG L;  4B9U A;  1HQE A;  3VPZ A;  1DLO A;  1BUP A;  4CHY A;  4DFP A;  3K5O A;  1RDW X;  4IWV A;  4M42 A;  2QWL A;  1BL3 A;  5AFU A;  2EX3 A;  1KCF A;  3SLC A;  3LDL A;  3P31 A;  2H3G X;  4DKW A;  4DFJ A;  4CJR A;  3M8P A;  1GLA G;  2Q2R A;  4PA1 A;  2ZE2 A;  2FBT A;  3UKU B;  2HST A;  3WXK A;  4CJU A;  3CIP A;  3TAM A;  3LWL A;  3DLH A;  2CGL A;  1M90 O;  2BUP A;  3L2Q A;  2QWO A;  4DQR A;  2V7Y A;  3LAL A;  5EY4 A;  1HKB A;  1Q86 O;  5KTQ A;  3L2W A;  2F8S A;  3F9M A;  4LD0 A;  2KW4 A;  4QCL A;  2Q36 A;  1YIJ N;  3HXM A;  3LZJ A;  5GAH P;  1A5V A;  1TK8 A;  1WAJ A;  4NLC A;  2FSK A;  4BDP A;  3D7E O;  4B3R K;  3SJJ A;  3OYN A;  3W3D A;  5TKY A;  1HRH A;  3J7A P;  3L8B A;  4AM6 A;  4LH4 A;  3VQD A;  4HUE A;  2V51 B;  3V1O A;  1TK5 A;  1J54 A;  1VQN N;  2WUS A;  1P8Z A;  4F4K A;  3AVF A;  4Z0U A;  1RT5 A;  3AAQ A;  4KKO A;  2VG7 A;  3SAF A;  3ATU A;  5E41 A;  1EQY A;  4Y1D A;  3WXL A;  4B1X B;  2XY7 A;  4LF6 K;  1ASW A;  5KPR A;  5I3U A;  3QFP A;  4JV5 K;  2HHS A;  3MWP A;  1NK8 A;  4DR6 K;  4I2P A;  3CFO A;  4DV0 K;  3T3F A;  5BRF A;  3VA0 A;  3N4P A;  1HQU A;  3PLA A;  4CZK A;  3ZSY A;  3H45 C;  4YOT A;  2A42 A;  3C7N B;  3TTF A;  1NGC A;  1B9F A;  4CK3 A;  4IDK A;  4IOA L;  3HT3 A;  4KV8 A;  3ID8 A;  4B08 A;  3JYT A;  4CHP A;  3NF6 A;  4CK1 A;  1SUQ A;  4ID1 A;  4IFY A;  4FWL A;  4M3U A;  4B1V A;  3D45 A;  3TAG A;  3VES A;  4JI3 K;  1CLQ A;  1Z26 A;  4Q5V A;  4PHT X;  4BR4 A;  3ZSZ A;  5FDL A;  1IKX A;  4FLV A;  4M3Z A;  5J2P A;  4FJJ A;  3ZT4 A;  1YTA A;  2P9I A;  1VSL A;  3D0P A;  4FPB A;  3PO5 A;  1JLA A;  1BQN A;  1RT4 A;  1QS4 A;  1RBS A;  4CZM A;  1NGH A;  4RWT A;  1HX1 A;  4O8K A;  4WFN L;  1XC9 A;  4Z4G A;  1JKH A;  3ZEU A;  1RT3 A;  1JLQ A;  4AQY K;  4FJ9 A;  4JK7 A;  3ID6 A;  4ILH A;  3Q7C A;  3M6G A;  2OTL N;  3RMD A;  4JLH A;  4NYN A;  4C1N K;  1NK0 A;  4CJK A;  1HKG A;  3LP1 A;  3P38 A;  2VWJ A;  1RDD A;  4WQ5 A;  3HZ6 A;  2O8B B;  5H1S Q;  1RT2 A;  2IVN A;  4LF8 K;  3L6Q A;  3ISN C;  1ZBF A;  3RMC A;  3TAR A;  3AVG A;  3ZSX A;  4DQ8 A;  2P9I B;  3MXJ A;  2FBX A;  1HPM A;  2GTD A;  4MDB A;  1JXE A;  4CZH A;  1HJO A;  4H0X B;  1GLF O;  1L3T A;  4CIE A;  4YOX A;  3NHG A;  2QK9 A;  4DHY A;  2CGK A;  2W40 A;  3KHY A;  5CYQ A;  1YJ9 N;  4DFM A;  1C1C A;  5HBM A;  3ZEU B;  4DS5 A;  2BGG A;  1U47 A;  4MFB A;  3V9X A;  3SBT A;  4BRG A;  3R3L A;  5C0Y A;  3MMV A;  3L2U A;  4X66 K;  1N36 K;  4YOY A;  1VSI A;  2B4J A;  4W5O A;  4FM0 A;  4Z4F A;  2ZJQ L;  1N34 K;  5ADX A;  3T1A A;  3NH2 A;  2GWJ A;  2F8T A;  1HJR A;  1D5A A;  3GOI A;  4OPH A;  2HMI A;  4YY3 K;  3V9W A;  1KC8 O;  1NMN A;  1KXP A;  5GAE P;  3AVK A;  4DQS A;  2JLE A;  3TPQ A;  4W5T A;  3BZC A;  4R5P A;  4FVU A;  4W5N A;  4H5W A;  4MO4 A;  2YJE A;  3ENB A;  3V6D A;  2GUP A;  2RF2 A;  3VGL A;  1NGE A;  2DFF A;  3OHR A;  5GAG P;  3UB5 A;  3CCJ N;  3THY A;  2WON A;  3OY9 A;  4BC4 A;  1BI4 A;  1SAZ A;  1T6C A;  3RSE A;  2HW3 A;  4FLW A;  5HRS A;  3P83 D;  1Q9X A;  4I9Q A;  3CFP A;  3F5T A;  1A5W A;  4EP4 A;  3MAQ A;  5AQP A;  3KLH A;  3ZT2 A;  4DTX A;  4YOV A;  2OPS A;  2R7Y A;  1MU2 A;  3A8Y A;  3JS6 A;  1HNW K;  1XMQ K;  1C0M A;  3VN5 A;  5M1K A;  4AHC A;  4GW6 A;  3VEV A;  5GAD P;  2P1J A;  3MED A;  3O4W A;  3IAY A;  5J2N A;  1NJW A;  1DKG D;  3NDK A;  2YKN A;  4CF8 A;  1YJN N;  4CJ5 A;  5M1N A;  3CF5 L;  2ZJP L;  4FLZ A;  2KZM A;  2F96 A;  5SZT A;  4C8K A;  2QWP A;  2HNY A;  4WYB A;  3VOV A;  5C25 A;  3L2V A;  3ZX2 A;  3H3O B;  2OCE A;  1T03 A;  5AQM A;  2HB5 A;  4OPK A;  1IG8 A;  3RMB A;  2Q1N A;  1J5E K;  1HYV A;  4CE9 A;  1NKE A;  3QIC A;  2RE2 A;  2YNI A;  4CZL A;  2ZGY A;  1ZC6 A;  3LL3 A;  1T05 A;  1LCU A;  1BGX T;  1DGK N;  2P5O A;  3RVC A;  3TTD A;  5FRO A;  2ITG A;  4FJ8 A;  4DV7 K;  4ISG A;  1L3U A;  3ULD A;  1QSY A;  1G99 A;  2G8V A;  4NLB A;  3O1W A;  2NRV A;  3BDP A;  3A5N C;  3TAP A;  1J53 A;  1LAV A;  2NRR A;  4CIF A;  3V4I A;  1SQK A;  4KHY A;  4CD3 A;  1FKO A;  4CJ7 A;  1LOT B;  2YJF A;  3FZK A;  3HPG A;  1WSF A;  3ALY A;  3CCR N;  3WXJ A;  3SUN A;  3A5L C;  3NGY A;  1TKZ A;  3KVG A;  3EZ5 A;  3OYE A;  1WB9 A;  1SKW A;  1J5O A;  2Y1J A;  1S1X A;  3KD1 E;  5AZI A;  1BQM A;  2NUB A;  1M1K O;  4DTO A;  4WFA L;  2IDO A;  2KQ2 A;  2O8D B;  4YFU A;  4A59 A;  2E20 A;  4QS7 A;  4RW6 A;  3BP8 A;  5C2F A;  3O9S A;  4C23 A;  3DXM A;  3KWI A;  3U3Y A;  3SI6 A;  3TI0 A;  4H4M A;  2P9L B;  1NU0 A;  3VF2 A;  1T6D A;  1TUU A;  4WE1 A;  4FJI A;  3C6A A;  5AQS A;  5KGW A;  3WQT A;  1GLJ O;  4CJF A;  3SJH A;  4E1N A;  3JAM O;  3OS1 A;  3TWH A;  4E1J A;  3HSC A;  4EFH A;  1TUY A;  3K5L A;  3IDH A;  4I6M A;  5KQD A;  4XIU A;  4M63 C;  3KJV A;  1XI1 A;  1P90 A;  3O9Q A;  3VQ5 A;  4CGJ A;  1UA0 A;  1QHT A;  4PKG A;  2PZS A;  2I7N A;  4HTL A;  4JI0 K;  4IBN A;  1S1T A;  4L8R B;  1J6Z A;  3OA9 A;  3CD6 N;  1HLU A;  2Q0U A;  2ZM6 K;  4J2E A;  4FO0 A;  4B3O A;  1W2B M;  3DXM B;  1ITG A;  5FLX O;  4AM7 A;  3LP3 A;  4BRC A;  3EKS A;  4WF9 L;  5LJV A;  2ASP A;  2I7P A;  1BIU A;  1OH7 A;  1L3V A;  3O4Q A;  2ITM A;  3AGR A;  3DLK A;  4F3O A;  1EWQ A;  1KAX A;  1E4G T;  4CGD A;  4AHS A;  3A2F A;  1U2V B;  3ULE A;  4IOC L;  2OTJ N;  3GL1 A;  1B9D A;  3PIO L;  3O08 A;  4O5F A;  1NBW A;  4LF5 K;  3F9K A;  1TYQ B;  1JL2 A;  3I0R A;  1W97 L;  1QQO A;  5BPN A;  1V4S A;  1VQ5 N;  3HRG A;  2XHB A;  2ASO A;  3VQQ A;  3O4N A;  3E9L A;  1RCH A;  1EKE A;  3NAE A;  4DWI A;  3HOS A;  4UY8 O;  5CZ1 A;  3ZSW A;  3L4I A;  1IJJ A;  3LWM A;  1BOT O;  1WSJ A;  3LPU A;  3HVT A;  1C0F A;  2Z1H A;  3AVI A;  4E7J A;  5KRS A;  4Y0W A;  2WOM A;  2AJQ A;  3I33 A;  1IKW A;  5AQV A;  3U8X A;  4H03 B;  1S22 A;  1S9E A;  2ZF5 O;  2IIR A;  4JKC A;  5M1P A;  3J8A A;  4ZHR A;  3K5N A;  3H1Q A;  3VEY A;  2RPI A;  3MEE A;  2NLX A;  3ITH A;  4BRK A;  3AO1 A;  4DU1 A;  2FF6 A;  4RCH A;  4BY9 C;  4FW2 A;  3WNF A;  4BRP A;  2IGI A;  3MX2 A;  1JCE A;  4BC3 A;  3L3U A;  1OH8 A;  4GNI A;  4CK2 A;  1X9W A;  4W5Q A;  3SQ2 A;  5AQO A;  4EP5 A;  4NYF A;  1UOC A;  2IAJ A;  3SV4 A;  4IEI A;  1FK9 A;  4BDZ A;  4K25 A;  3KK2 A;  4RW8 A;  1RDB A;  3ASM A;  3NGZ A;  3F73 A;  3VA3 A;  1IKV A;  2AP1 A;  2QKK A;  3SYZ A;  1S72 N;  3AAP A;  1S1W A;  5KRT A;  3DLR A;  1BWF O;  4FJM A;  4KB1 A;  1VHX A;  4C8N A;  3AO3 A;  5LJW A;  4E7H A;  4FPA A;  4OJR A;  2HHV A;  1BO5 O;  1EWR A;  3OS0 A;  3O5B A;  4EAH D;  3K9K A;  2G8K A;  3TAQ A;  3QET A;  4ZTF A;  4JKB A;  4KHU A;  3VEO A;  4GV3 A;  3VQ6 A;  3VQ7 A;  3KLI A;  4CJT A;  3V1Q A;  2HHQ A;  3G6E N;  3KK1 A;  2X74 A;  2X6N A;  3SQ0 A;  1WBD A;  4FJ5 A;  2IVO A;  4H5R A;  3HM8 A;  4NCG A;  1IKY A;  1VQK N;  3C6T A;  1KD1 O;  1Z25 A;  4O5B A;  3SV3 A;  4B3S K;  4EHU A;  1NGF A;  3VQP A;  1EET A;  3NFA A;  3VEW A;  3VET A;  3VF4 A;  3K57 A;  2G8H A;  2QKB A;  4H0P A;  3HP6 A;  4DSK A;  3DLL L;  4KHW A;  4CHZ A;  3D2F B;  4DLG A;  4GV9 A;  4J2A A;  4M3W A;  1ATN A;  3NF9 A;  1KVC A;  1VQ4 N;  3SK3 A;  5FRN A;  3ENO A;  1NGD A;  1Q9Y A;  1G15 A;  1OVY A;  4CFD A;  2D1K A;  2P9S B;  4CIG A;  3E1Y A;  4ICL A;  3LDP A;  3HVR A;  4U7B A;  3NF8 A;  4DTR A;  4H0T B;  3TTC A;  1X3N A;  4FWQ A;  4C8L A;  1FW6 A;  4KTW A;  2PY5 A;  5JS1 A;  1T8E A;  1YXQ A;  4CF1 A;  4B1Z A;  4FWO A;  4H5T A;  1K8K B;  4CJP A;  3RRH A;  4QS9 A;  2DFH A;  3QDK A;  3KKS A;  5CY4 A;  3HP9 A;  2E5L K;  4HHT A;  3TU5 A;  2BAN A;  5SWM A;  1IG9 A;  3OYC A;  5DM6 L;  3PO4 A;  2P9U B;  4ISF A;  4B9T A;  3C7N A;  4LFA K;  3R8E A;  1DEJ A;  4XH4 A;  4DG1 A;  1Q8I A;  1TVR A;  2VQF K;  4BRI A;  4CJ4 A;  1CZ9 A;  2O8C A;  4FWM A;  5FPD A;  3AO2 A;  3OYL A;  2G8I A;  4O0I A;  2E2N A;  2XY6 A;  3OJS A;  2BH1 A;  2P9N A;  3OYB A;  4DV1 K;  3V81 A;  4RTF D;  1NGA A;  5CYM A;  5JLH A;  1JL1 A;  3WXI A;  2A6A A;  1I3A A;  4JK8 A;  1NJI O;  4JRQ A;  3DYA A;  1O13 A;  3CJA A;  4BVO A;  4M3X A;  2QM1 A;  3EKU A;  1NLV A;  3NGI A;  2VGM A;  3SAH A;  3VQE A;  4YOU A;  1VSF A;  1IBM K;  4BWJ A;  3KLF A;  1OH6 A;  3KLE A;  1NGJ A;  1YF5 L;  2HF3 A;  4CVN E;  1JLC A;  4BE0 A;  1TAQ A;  3CCS N;  2O8C B;  2EWS A;  3DAW A;  3B6O A;  1JXB A;  1UWB A;  3FE1 A;  4JNE A;  5AQH A;  3OYI A;  5GIP A;  4F2S A;  1R59 O;  3VQ8 A;  2P9N B;  1BA0 A;  1Z05 A;  3IG1 A;  3H6E A;  3HM9 A;  4KAZ A;  2ZGZ A;  1KFD A;  2PBD A;  3MDQ A;  2O8B A;  3WEE B;  2Q3S A;  2GEM A;  1JCG A;  4B9V A;  1UAX A;  2ATQ A;  3EZW A;  1RNH A;  3G0Z A;  2OPR A;  3DJC A;  1FXX A;  4RW7 A;  4HUF A;  3UIQ A;  4CF0 A;  4DTJ A;  1J9A A;  1SKS A;  2KFZ A;  4DV6 K;  3G10 A;  4MLE A;  4DF8 A;  3QEX A;  2D5R A;  3FZH A;  3HBT A;  4PL7 A;  1RDC A;  2RHK A;  4I7F A;  3EEQ A;  2PFU A;  4F2R A;  4C8M A;  3SPY A;  3CCL N;  1HKC A;  4AHU A;  4YDU C;  4YNQ A;  1KTQ A;  2YI1 A;  4R79 A;  5CZ2 A;  4FWK A;  3VTH A;  2A5X A;  1D9F A;  3DM2 A;  1NGI A;  4LSN A;  3AO5 A;  1T3V A;  5K14 A;  3TAE A;  3D2E B;  3SBG A;  1T7P A;  1TAU A;  3FZL A;  2E8A A;  2VWK A;  5BRH A;  3NMU A;  3CXC M;  1SL1 A;  3R6M A;  4GKJ K;  3PY8 A;  3Q7B A;  4FOI A;  4DTP A;  3H08 A;  4CED A;  3ZX3 A;  3KK7 A;  4KPY A;  4JK9 A;  4DSF A;  5J2M A;  1VQM N;  3DRS A;  1JLF A;  3HJF A;  3ZSO A;  4H4O A;  3WXM B;  3QFU A;  4MDA A;  3QIO A;  4RG8 A;  4BRA A;  2Z1I A;  4JI4 K;  3JSM A;  2I5J A;  1DT9 A;  2FSJ A;  4KHS A;  3KZB A;  1YAG A;  2QWM A;  4ILJ A;  4BRE A;  4CEQ A;  3LAN A;  3QEI A;  4IKF A;  4LSL A;  4CHQ A;  3OYK A;  4OKJ A;  2KTQ A;  1Q81 O;  2E6M A;  3ZX0 A;  4IXC A;  3QER A;  4E1M A;  3H1V X;  1RBR A;  1U4B A;  2YX6 A;  3OYA A;  5LMU K;  3MEG A;  3T19 A;  4BRN A;  4CER A;  1TL1 A;  1U6Z A;  1NJX A;  4M3Y A;  5HP1 A;  5BN8 A;  3QEP A;  4MO5 A;  4QS8 A;  3O80 A;  1ZBS A;  3PIP L;  3VER A;  3EE9 A;  1LWC A;  1LV5 A;  2Z1J A;  1HNI A;  3PV8 A;  3MCA B;  1N32 K;  1VK0 A;  4AF1 A;  1K9M O;  3A5O C;  2QEX N;  2VGN A;  3EE8 A;  3RTV A;  3DLE A;  4DV3 K;  1YUW A;  4CJQ A;  1KAY A;  2GX9 A;  3ATV A;  3A5M C;  4H0Y B;  3UKR B;  2X6S A;  4FLY A;  2YV0 X;  3BEX A;  4MLH A;  1NOZ A;  1GLC G;  3SQ1 A;  1KQS M;  1RDU A;  4FZZ A;  2A40 A;  1HMV A;  3VGM A;  4JKD A;  4CGG A;  1NKC A;  1ZXO A;  1WUA A;  3R1X A;  4DTS A;  2UYT A;  2P5G A;  4BAC A;  4LF7 K;  4FWP A;  1VQ7 N;  5EOY A;  4DR7 K;  4L3Q A;  4G9Z A;  4BVP A;  4CJ3 A;  4Z4C A;  4IEE A;  1A5X A;  2QI2 A;  3BGR A;  3JXU A;  3RR7 A;  2CH6 A;  1QQN A;  2YHW A;  1NJZ A;  3ZSR A;  1QE1 A;  2GV9 A;  2VQE K;  3C95 A;  4E19 A;  1GLD G;  5JLF A;  1VSJ A;  5AQZ A;  1REV A;  2B5J A;  1FKP A;  3W0L A;  3AVL A;  3R9P A;  4BQL A;  2NZT A;  4BR2 A;  4WQ4 C;  2E2O A;  2FXU A;  1VSK A;  3BF1 A;  3I55 N;  5HOO A;  1X3M A;  4IG0 A;  4M45 A;  4B9Q A;  2BDP A;  4RW4 A;  1JLE A;  4QOZ B;  2GWK A;  3GDQ A;  2Q0R A;  5JMV A;  5I9E B;  2O8D A;  1LW2 A;  4IO8 A;  3MEC A;  1NK6 A;  2NNW A;  4HCC A;  2D4W A;  3LP0 A;  1I94 K;  4A61 A;  3M5R A;  3AY9 A;  3MN6 A;  4IJN A;  3MX5 A;  4JI1 K;  5C12 A;  4DLE A;  1QTM A;  2P9L A;  4FJL A;  4A62 A;  1EXQ A;  3VQB A;  1RBT A;  3LM2 A;  2G8W A;  2KFN A;  3U9D A;  1RT1 A;  3QML A;  4NO7 A;  5GIN A;  2XRI A;  4CZG A;  5DM7 L;  1RT7 A;  3CG7 A;  3E9P A;  5HL7 L;  1ATR A;  3SPZ A;  3M8Q A;  4O55 A;  2FSN A;  4B9L A;  1IH7 A;  4BRH A;  5D3G A;  1LWF A;  3SQ4 A;  1YT3 A;  1D4X A;  3AVC A;  3AVN A;  4M3R A;  5FPM A;  4I9L A;  4OVL A;  4FJK A;  2X78 A;  1X9M A;  4Z4E A;  4CES A;  4JS5 A;  4LFC K;  3KD5 E;  2PAV A;  4H5V A;  1CZA N;  1NG9 A;  4B8A B;  4ELV A;  5EVZ A;  4K0K K;  4FWS A;  3SCX A;  3GG4 A;  1X1P A;  4Q0B A;  4B9M A;  3J81 O;  3QB0 A;  3LPT A;  3V1R A;  4XH1 A;  3E9O A;  1C0T A;  2NRW A;  3FLC O;  1XQS C;  4KI6 A;  4BG8 A;  3SMP A;  2PYL A;  1WN7 A;  5I42 A;  1RTH A;  5JVH L;  4DB3 A;  3QLH A;  1MWM A;  3CJB A;  2B6A A;  3CQX A;  1VRU A;  4E7I A;  4EHT A;  2IC3 A;  5E84 A;  5KI6 A;  1U2V A;  2E1Y A;  5HRP A;  4DV4 K;  2F9W A;  1GLL O;  2F9T A;  1TYQ A;  3DRP A;  1IV0 A;  4CZI A;  1RDA A;  3AVB A;  2KLA A;  3K5M A;  4GKK K;  3CJ7 A;  5F0X A;  1D8Y A;  4M7X A;  4YHH K;  4JKF A;  3OYG A;  4CBU A;  2VYP A;  4BRO A;  4FW1 A;  3AGK A;  3U9Z A;  1VQO N;  3EL2 A;  1LWE A;  3QIN A;  1TKD A;  1Q82 O;  3O8M A;  4Z4H A;  4CBW A;  2ZJR L;  1N8R O;  1YTU A;  4A5A A;  5C2D A;  1R0A A;  2OAN A;  1CXU A;  4JKG A;  3AA2 A;  1YIT N;  1LW0 A;  3AV9 A;  2D0B A;  1RT6 A;  1WSI A;  4JRP A;  5BRD A;  4PQU A;  3RRG A;  4DSL A;  4BDY A;  2DTU A;  4AIL C;  2D0P A;  5F1X A;  4E89 A;  3AA5 X;  2VWB A;  2YNF A;  4KHP K;  3QES A;  3D6R A;  4OPJ A;  4ZTJ A;  2HHX A;  3OVN A;  5AQI A;  4HTU A;  4J8F A;  4FLX A;  3MCP A;  2V52 B;  4JHD A;  1VQP N;  5KPT A;  5AQF A;  3S41 A;  1VSH A;  4EZ9 A;  3OBY A;  1VRT A;  2ASM A;  4DR4 K;  1HNX K;  3MXI A;  3CPW M;  1ZBI A;  3NBP A;  3B6P A;  3G25 A;  4FJ7 A;  2ZQB A;  4E3S A;  1MDU B;  5KGX A;  1EO1 A;  1K73 O;  1QSL A;  4JYA K;  4KHQ A;  2QWQ A;  1VSE A;  4K8Z A;  1KAZ A;  4JKG B;  5TKW A;  1WNS A;  4JD2 B;  4XEI A;  3NF7 A;  4CW7 B;  2UXC K;  3PUF A;  2P9K A;  3ZET B;  1ZBL A;  4FL9 A;  3DOL A;  4OGC A;  2E88 A;  1QHA A;  4LF4 K;  4OX9 K;  4ILG B;  5AQU A;  3MN7 A;  4DMN A;  4B3T K;  2HMP A;  3IMX A;  4PY5 A;  4JHD B;  1S6Q A;  3K2P A;  5AQL A;  2YNH A;  2WTU A;  4FCY A;  2F7T A;  2BE2 A;  3MN5 A;  1OKJ A;  1KLN A;  3QEW A;  3DXK A;  3T1Y K;  4GV6 A;  3LAK A;  5CHI A;  1EP4 A;  4H5N A;  5J1E A;  5LY3 A;  1BDG A;  5DK5 A;  4H0O A;  3VQC A;  1NGB A;  3L4Q A;  3K59 A;  2YHX A;  5BN9 A;  4PUO A;  1V4T A;  5FPN A;  2P9K B;  3FGU A;  4AH9 A;  5KPZ A;  3BY5 A;  2IS3 A;  3BF3 A;  2HHT A;  3J7Y P;  3D2F A;  4FLT A;  2G8U A;  5C15 A;  4JAX A;  1NM1 A;  5AQN A;  4CGI A;  1W7A A;  3CCU N;  3PX4 A;  4CEE A;  1S6P A;  2P9S A;  3LDS A;  3THW A;  3O1B A;  3U6F A;  3TAN A;  4FM2 A;  2A3Z A;  3SZ2 A;  4N76 A;  3RWU A;  3OYM A;  3OW2 M;  4LC9 B;  4DR3 K;  4KB0 A;  1E3M A;  3LM9 A;  3WUH A;  3CET A;  4CZJ A;  2DY4 A;  1SL2 A;  3CJ1 A;  1VSM A;  1K8A O;  2O8E B;  3IS9 A;  3DXK B;  5BPL A;  1K8K A;  2F4V K;  4TSX A;  4FJN A;  4M7Y A;  5BRE A;  5AQJ A;  2WFB A;  5BR9 A;  1SS6 A;  1KFS A;  1NKB A;  3THX B;  3TSP A;  2P9U A;  2QWN A;  5T7B A;  3QNN A;  3QIP A;  3PSI A;  4DTM A;  3TAB A;  4RW9 A;  3HOT A;  2GEL A;  1EX4 A;  3K0S A;  4CGF A;  2WC9 A;  4BE1 A;  3THW B;  2YNG A;  3PX0 A;  4G1Q A;  4A2A A;  2E2Q A;  4N47 A;  2O8F B;  4DV2 K;  1E4F T;  2RN2 A;  1NK5 A;  3OYD A;  4YOR A;  1KSP A;  4OPA A;  2P9P B;  4FLU A;  1C0U A;  1UA1 A;  2LSN A;  1QZ6 A;  4FK2 A;  5AFU H;  3QNO A;  2VG5 A;  3PX6 A;  4FOE A;  3MXM A;  3ZCM A;  4K43 A;  4WQ5 C;  4AHT A;  1QQM A;  4EZ6 A;  2KHO A;  3LZI A;  2V7Z A;  4N5S A;  3O3G A;  1CXQ A;  3KK3 A;  4FXD A;  2IVP A;  1BHL A;  2QA4 N;  4AHR A;  1ESV A;  4DCH A;  1NK7 A;  4IG3 A;  4CEC A;  1S5J A;  3J80 O;  3L3V A;  3WEE A;  2HNZ A;  1SV5 A;  4IZ9 A;  3HI0 A;  3C6H A;  4WFB L;  1K6Y A;  4UQG A;  2ZWH A;  2A41 A;  2QW9 A;  3FFI A;  4KBO A;  3LAM A;  4DSE A;  4CEO A;  4DV5 K;  3T1H K;  4BRQ A;  4YOW A;  1RTJ A;  4DS4 A;  2FLO A;  4FVM A;  1OVQ A;  5AQG A;  4BR0 A;  4FM1 A;  1Y97 A;  1WOQ A;  1VQ9 N;  2DPN A;  4HVJ A;  4FJX A;  4LY7 A;  4OLB A;  4NXN K;  4CHO A;  2HHW A;  4X62 K;  3PSF A;  5AQX A;  3HPO A;  1U48 A;  3CC2 N;  1GOB A;  1TGO A;  5LL6 Z;  3O9U A;  1TKX A;  4CHN A;  4DUZ K;  1YI2 N;  1RBU A;  4K41 A;  4CEF A;  4CEA A;  1TV6 A;  4HWI A;  3S3N A;  3D2E A;  4OKK A;  3WT0 A;  4B9N A;  3EY1 A;  4BC2 A;  2W41 A;  5B8H A;  4KRF A;  4BQZ A;  3T7Z A;  4NB4 A;  4M41 A;  5HRN A;  4IO9 L;  1RTI A;  2Q31 A;  3HL8 A;  4B1W B;  4J2D A;  4CJV A;  3KLG A;  3HTV A;  2GUI A;  4KO0 A;  3BUZ B;  5BPM A;  3J7Z O;  3GE1 A;  4DUY K;  1IBK K;  1YJW N;  4Z4I A;  1JJ2 M;  3ZT3 A;  1SL0 A;  5AZJ A;  3IKM A;  2YCH A;  2P51 A;  3CYM A;  5CR4 A;  3OYJ A;  2CH5 A;  4PKH A;  3I8D A;  4OLA A;  4CJW A;  1KVA A;  3B8A X;  3IFR A;  1JLB A;  4FZY A;  1QVF M;  1BCM A;  4CF2 A;  2VG6 A;  4DR1 K;  4CFA A;  3EO3 A;  1HR0 K;  4CGH A;  4ELU A;  3KKR A;  5EU7 A;  1QZ5 A;  1D9D A;  2JWL A;  1WSG A;  4CJS A;  3NCI A;  3HO1 A;  1F21 A;  1VQ8 N;  4JI7 K;  1RBV A;  1BG3 A;  3VEN A;  2VCP A;  2FBY A;  3S9H A;  3KTQ A;  3WNH A;  3P1G A;  4CD1 A;  4OKE A;  1FJG K;  2FBV A;  4FWN A;  2D0O A;  4C8O A;  3UKR A;  4JI6 K;  3FR0 A;  5FRM A;  1C6V A;  3HK2 A;  3E66 A;  2Y1I A;  4I2Q A;  5M1F A;  3LDQ A;  3CME N;  1GLE G;  4FK0 A;  1N33 K;  4BRF A;  1VQL N;  1RFQ A;  5AZJ B;  1SZ2 A;  1NK9 A;  3NE6 A;  2HBJ A;  3LDO A;  2AA4 A;  3ZSQ A;  2YKM A;  4OO1 J;  1HYZ A;  1RTD A;  4JKE A;  4DTN A;  4B1Y B;  3CQ8 A;  4CFC A;  3C6U A;  3RMA A;  3NVK A;  4JKH A;  3H46 O;  5IT9 O;  5DMR A;  1NWK A;  3DRR A;  5F2R A;  3DOK A;  4BWM A;  1HYS A;  4Z94 A;  3MWT A;  1I39 A;  2D0A A;  1QVG M;  1XHZ A;  1OH5 A;  4DF4 A;  4WCE L;  3THV A;  4JI8 K;  1XHX A;  1B92 A;  3CI5 A;  3P4I A;  4BRD A;  3HPH A;  4FWR A;  3OYF A;  1L5U A;  4DFK A;  1BIS A;  5ADX H;  2QTD A;  2W6L A;  1O1W A;  2NRH A;  4NXM K;  5EXW A;  3G4S N;  2UXB K;  4PL8 A;  2HVI A;  3CM6 A;  3WNG A;  4KTZ A;  4O44 A;  3WQU A;  5AQK A;  3ZSV A;  3M3Z A;  3S3O A;  3T69 A;  1N5Y A;  4CI6 A;  4NCB A;  1NK4 A;  3C94 A;  2OA8 A;  3EN9 A;  5KQ8 A;  2Z1G A;  1Q18 A;  1ASV A;  1CZB A;  1DTQ A;  4F9O A;  3OS2 A;  3ENH A;  2Q97 A;  3IUC A;  4JN4 A;  3CCQ N;  4E7L A;  1S9G A;  1HNV A;  1ILY A;  3UE5 A;  5AQY A;  5J2Q A;  4B9S A;  1VAZ A;  5AQQ A;  4E7K A;  2QXF A;  1S1V A;  4B8C A;  4K42 A;  4BC5 A;  2ZD1 A;  1KLM A;  1GOA A;  5HRR A;  3QEV A;  4LFB K;  2E6L A;  1KVB A;  4A57 A;  2EHG A;  4BR7 A;  1U45 A;  1U04 A;  3E01 A;  4X65 K;  3OBW A;  4YDU A;  2UXD K;  1XWL A;  1VSD A;  3VF6 A;  4KFB A;  4AHV A;  5C24 A;  3V9U A;  3I8B A;  3FZF A;  1KRP A;  5M1Q A;  4N56 A;  1Z6R A;  5IWA K;  3QBW A;  4A5B A;  1XNR K;  4DSI A;  2JGU A;  3CHW A;  4DR2 K;  3THY B;  3I0S A;  2E2P A;  1BI4 B;  4KH5 A;  1BIZ A;  3RSE B;  1TK0 A;  1HNZ K;  5AQR A;  3GBT A;  4O8U A;  4B3M K;  3VQ9 A;  4FSV A;  1NMD A;  2BTF A;  2CGJ A;  4IJA A;  2IOC A;  2D0C A;  1BA1 A;  5E26 A;  1NNE A;  4QAG A;  3CJC A;  2YHA A;  4KTQ A;  4FK4 A;  3VGK A;  4DQP A;  3OTO K;  4FZX C;  4XH5 A;  3AVM A;  3KWG A;  3VQ4 A;  3DLB A;  4ISE A;  2G8F A;  4K8X A;  3SUO A;  3CJ9 A;  4JI5 K;  5JS2 A;  1ZYQ A;  3DWL A;  4C1N I;  3WNE A;  4DU3 A;  4IOX A;  4JI2 K;  3O9R A;  4BGA A;  1XNQ K;  5C42 A;  5AQT A;  3CPE A;  3K58 A;  1JLG A;  2DFE A;  3TSU A;  4BRL A;  4OGE A;  2FF3 B;  3M1F A;  5MLC Q;  1GLB G;  3L0Q A;  3CCM N;  2QXL A;  4PWD A;  2UUC K;  1WSH A;  3LDN A;  1DTT A;  4CJL A;  4CZF A;  1VQ6 N;  2WBN A;  3NH1 A;  3FZM A;  1L3S A;  3VEZ A;  3VQA A;  2XY5 A;  1XUP O;  1Y64 A;  3O3F A;  3CC4 N;  2HF4 A;  2HHU A;  1QSS A;  2JWK A;  3HYF A;  3CCE N;  2XY8 A;  2NRT A;  4M3T A;  3RR8 A;  1C1A A;  4GVE A;  4O4G A;  3O9T A;  3P39 A;  4BR5 A;  4DU4 A;  3OYH A;  3CER A;  1TL3 A;  4CFB A;  4KI4 A;  2HBL A;  2HOE A;  2O4G A;  3AVA A;  5AR0 A;  4CZE A;  3K9J A;  1BCO A;  4DTU A;  4KHN A;  5HRO A;  2FC0 A;  4H8K A;  2KKZ A;  4BGB A;  3CCV N;  5M1O A;  3SMS A;  4H0V B;  3VTI A;  1ZBH A;  4DSJ A;  5AZI B;  5GIO A;  1S3X A;  4MQ3 A;  4JD2 A;  3ZT1 A;  2XO7 A;  3SUQ A;  4F8R A;  3TSQ A;  1YHQ N;  3ZET A;  4A2B A;  4BRM A;  3NH0 A;  2A1S A;  3AA3 A;  3SUP A;  3CQY A;  4GMJ B;  4WQ4 A;  2KZZ A;  1ASU A;  1QQC A;  2OZM A;  1X9S A;  4PKI A;  4CEZ A;  4IFE A;  1WLJ A;  3EYZ A;  5FPE A;  2OPP A;  1WBB A;  4FJH A;  3A0I X;  4HCB A;  2W6K A;  2UUB K;  3L2R A;  2UU9 K;  2NRZ A;  3ZYY X;  4I6M B;  4CF9 A;  5AJ3 K;  3AVJ A;  3H3N O;  3V9S A;  4BG9 A;  1N6Q A;  4BE2 A;  2E1Z A;  2E4L A;  3VMF B;  1HUX A;  2HBK A;  2ETJ A;  3AAR A;  1BU6 O;  3OJU A;  2PYJ A;  4J2B A;  4JKA A;  1NJY A;  4X64 K;  4CJE A;  3F2K A;  3NVM A;  4KH4 A;  4V19 S;  5C10 A;  2QWR A;  5JIC A;  1HPZ A;  4KH6 A;  2J4R A;  3AA4 A;  3AO4 A;  3DMJ A;  3ZLJ A;  5LMN K;  2A1R A;  3U3G A;  3DI6 A;  4EIA A;  4Y1C A;  4N41 A;  1SKR A; 
#chains in the Genus database with same CATH homology
 3M8S A;  3SUN A;  4FYD A;  4IG3 A;  4CEC A;  3OYA A;  1S5J A;  3NGY A;  3MEG A;  1TKZ A;  3T19 A;  3KIO A;  4CER A;  3OYE A;  1TL1 A;  2HND A;  3EZ5 A;  1SKW A;  1NJX A;  3L3V A;  1J5O A;  4M3Y A;  5HP1 A;  2Y1J A;  1S1X A;  3KD1 E;  3QEP A;  2HNZ A;  1SV5 A;  4IFV A;  3AVH A;  1BQM A;  2NUB A;  3S3M A;  3DLG A;  3CFR A;  1K6Y A;  4UQG A;  4DTO A;  1LWC A;  2IDO A;  2KQ2 A;  1LV5 A;  2Z1J A;  1HNI A;  4YFU A;  3FFI A;  3PV8 A;  4RW6 A;  2GBZ A;  3LAM A;  3U3Y A;  1VK0 A;  4DSE A;  3SI6 A;  4ELT A;  3TI0 A;  4CEO A;  3M8R A;  4H4M A;  1IO2 A;  3QO9 A;  4HUG A;  3RTV A;  3DLE A;  1RTJ A;  4DS4 A;  4CJQ A;  4FVM A;  4O0J A;  4WE1 A;  4FJI A;  4FM1 A;  1Y97 A;  1W0H A;  2X6S A;  4CCH A;  4OLB A;  4HVJ A;  1WAF A;  4LY7 A;  4FJX A;  4FLY A;  5KGW A;  2O4I A;  2YV0 X;  4CJF A;  4CHO A;  4E1N A;  2HHW A;  1NOZ A;  3HPO A;  1U48 A;  1C1B A;  4W5R A;  3OS1 A;  1GOB A;  3TWH A;  3LP2 A;  1U49 A;  1TGO A;  1TKT A;  3K5L A;  3P5J A;  3SQ1 A;  1TKX A;  4CHN A;  1RBU A;  1GOC A;  4CEF A;  1W9H A;  4CEA A;  2RKI A;  4CEB A;  4FZZ A;  4GVM A;  4XIU A;  1HMV A;  3KJV A;  1XI1 A;  1TV6 A;  3SNN A;  4CGG A;  3S3N A;  3VQ5 A;  4CGJ A;  1NKC A;  1UA0 A;  1QHT A;  4OKK A;  2PZS A;  4B9N A;  2OPQ A;  1RIL A;  4DTS A;  3EY1 A;  1NOY A;  4IBN A;  1S1T A;  4DQI A;  1WSE A;  4LH5 A;  4L8R B;  2P5G A;  4DQQ A;  4F3T A;  4KRF A;  4BAC A;  3O3H A;  1S1U A;  4M41 A;  4Z4C A;  4CJ3 A;  5HRN A;  3HST B;  1RTI A;  1A5X A;  3TAF A;  3BGR A;  3HL8 A;  3RR7 A;  4J2E A;  4B3O A;  3ZT0 A;  1LAW A;  1NJZ A;  1ITG A;  4CJV A;  5HLF A;  4J2D A;  3KLG A;  3CM5 A;  4E0D A;  3ZSR A;  1ZBU A;  3LP3 A;  1QE1 A;  2GUI A;  2GV9 A;  4KO0 A;  2OZS A;  3C95 A;  3V9Z A;  1YVU A;  4E19 A;  4Z4I A;  2W42 A;  3ZT3 A;  1SL0 A;  1VSJ A;  4NCA A;  2YHB A;  2P51 A;  1REV A;  3CYM A;  3TR8 A;  3OYJ A;  1BIU A;  2B5J A;  3I8D A;  4OLA A;  1FKP A;  3IRX A;  4CJW A;  2OYQ A;  4KRE A;  1L3V A;  3O4Q A;  3AVL A;  1KVA A;  2HVH A;  4JS4 A;  1JLB A;  4FJG A;  3DLK A;  4ID5 A;  4F3O A;  4B9U A;  4FZY A;  1BCM A;  1HQE A;  4CGD A;  1DLO A;  1VSK A;  2VG6 A;  4AHS A;  4CF2 A;  3A2F A;  4IG0 A;  4CHY A;  4M45 A;  4CFA A;  4DFP A;  4CGH A;  3K5O A;  4RW4 A;  2BDP A;  1B9D A;  3KKR A;  5EU7 A;  4ELU A;  1D9D A;  1JLE A;  3F9K A;  4QOZ B;  1JL2 A;  1WSG A;  4M42 A;  3I0R A;  1BL3 A;  2EX3 A;  1KCF A;  4CJS A;  1LW2 A;  3NCI A;  3MEC A;  1F21 A;  1NK6 A;  3HO1 A;  4DFJ A;  4HCC A;  3LP0 A;  4CJR A;  1RBV A;  3M8P A;  2XHB A;  3VQQ A;  2FBY A;  3S9H A;  4PA1 A;  2ZE2 A;  4DLE A;  2FBT A;  3O4N A;  1QTM A;  4FJL A;  1EXQ A;  3VQB A;  1RBT A;  3KTQ A;  3WNH A;  3P1G A;  4CJU A;  4OKE A;  2G8W A;  2KFN A;  3TAM A;  1RT1 A;  1RCH A;  3LWL A;  2FBV A;  3DLH A;  4C8O A;  1EKE A;  2XRI A;  3NAE A;  5FRM A;  4DWI A;  3L2Q A;  2AJQ A;  1C6V A;  3HK2 A;  2Y1I A;  4DQR A;  4I2Q A;  3LAL A;  1RT7 A;  5KTQ A;  3CG7 A;  3L2W A;  4FK0 A;  5CZ1 A;  3ZSW A;  2F8S A;  4LD0 A;  2KW4 A;  4QCL A;  3LWM A;  1NK9 A;  1WSJ A;  3NE6 A;  3SPZ A;  3M8Q A;  4O55 A;  3LPU A;  3HVT A;  4B9L A;  1IH7 A;  3ZSQ A;  2YKM A;  3AVI A;  2Z1H A;  4E7J A;  5KRS A;  5D3G A;  1LWF A;  2WOM A;  3HXM A;  1HYZ A;  3SQ4 A;  1YT3 A;  3AVN A;  3AVC A;  4M3R A;  3LZJ A;  1RTD A;  4DTN A;  1IKW A;  4I9L A;  4OVL A;  3CQ8 A;  4FJK A;  2X78 A;  1A5V A;  4CFC A;  1TK8 A;  1X9M A;  3C6U A;  1WAJ A;  3RMA A;  4BDP A;  1S9E A;  3SJJ A;  3OYN A;  1HRH A;  4ZHR A;  3K5N A;  4Z4E A;  4CES A;  4JS5 A;  2RPI A;  3MEE A;  3L8B A;  3KD5 E;  4LH4 A;  5DMR A;  3VQD A;  3ITH A;  4HUE A;  3AO1 A;  3DRR A;  4DU1 A;  3V1O A;  1TK5 A;  1J54 A;  3DOK A;  4FW2 A;  3WNF A;  4BWM A;  1HYS A;  4F4K A;  3AVF A;  2IGI A;  1I39 A;  4B8A B;  4ELV A;  4Z0U A;  2D0A A;  1RT5 A;  4KKO A;  1XHZ A;  4DF4 A;  2VG7 A;  3L3U A;  3SCX A;  3THV A;  5E41 A;  1X1P A;  4CK2 A;  4Y1D A;  4W5Q A;  3SQ2 A;  1X9W A;  1XHX A;  4EP5 A;  4B9M A;  2XY7 A;  1B92 A;  4Q0B A;  4NYF A;  1UOC A;  2IAJ A;  3SV4 A;  1ASW A;  3LPT A;  3V1R A;  1FK9 A;  4BDZ A;  5I3U A;  3HPH A;  3KK2 A;  1C0T A;  3OYF A;  1L5U A;  4DFK A;  1BIS A;  4KI6 A;  2HHS A;  2PYL A;  4RW8 A;  1NK8 A;  1WN7 A;  1RDB A;  5I42 A;  1RTH A;  3ASM A;  1O1W A;  4I2P A;  3CFO A;  3NGZ A;  3F73 A;  3VA3 A;  1IKV A;  3QLH A;  2HVI A;  3CM6 A;  2QKK A;  3WNG A;  3SYZ A;  3T3F A;  2B6A A;  4KTZ A;  1VRU A;  1S1W A;  5KRT A;  3DLR A;  4O44 A;  4E7I A;  3VA0 A;  4FJM A;  3ZSV A;  1HQU A;  2IC3 A;  3ZSY A;  4KB1 A;  4C8N A;  3S3O A;  5KI6 A;  5HRP A;  1N5Y A;  4NCB A;  1B9F A;  4CK3 A;  3AO3 A;  4IDK A;  4E7H A;  3HT3 A;  1NK4 A;  3C94 A;  2OA8 A;  4KV8 A;  4OJR A;  2HHV A;  3DRP A;  2Z1G A;  4B08 A;  1RDA A;  3AVB A;  3JYT A;  4CHP A;  3OS0 A;  3NF6 A;  4CK1 A;  3K5M A;  1ASV A;  1CZB A;  1DTQ A;  1D8Y A;  3OS2 A;  2G8K A;  1SUQ A;  4ID1 A;  3OYG A;  3TAQ A;  4IFY A;  3QET A;  4ZTF A;  4M3U A;  3D45 A;  4KHU A;  3TAG A;  3VQ6 A;  4E7L A;  3VQ7 A;  3KLI A;  1S9G A;  1Z26 A;  4FW1 A;  4CJT A;  4Q5V A;  3V1Q A;  2HHQ A;  1CLQ A;  3KK1 A;  1LWE A;  3QIN A;  1HNV A;  1TKD A;  4Z4H A;  2X74 A;  3ZSZ A;  2X6N A;  5J2Q A;  5FDL A;  4B9S A;  3SQ0 A;  1IKX A;  4FJ5 A;  4E7K A;  1YTU A;  4FLV A;  2QXF A;  1S1V A;  5J2P A;  1R0A A;  4FJJ A;  3ZT4 A;  4B8C A;  1YTA A;  1CXU A;  4M3Z A;  4NCG A;  1IKY A;  3AA2 A;  1VSL A;  3C6T A;  3D0P A;  3PO5 A;  2ZD1 A;  1KLM A;  1LW0 A;  1GOA A;  1Z25 A;  3AV9 A;  4O5B A;  5HRR A;  3SV3 A;  3QEV A;  2D0B A;  1JLA A;  1RT6 A;  1WSI A;  2E6L A;  4JRP A;  1BQN A;  1KVB A;  1RT4 A;  4PQU A;  1QS4 A;  1RBS A;  3VQP A;  3RRG A;  4DSL A;  1EET A;  2EHG A;  3NFA A;  4BDY A;  1U04 A;  3K57 A;  3E01 A;  1U45 A;  2G8H A;  4AIL C;  2DTU A;  3HP6 A;  1XC9 A;  4DSK A;  4Z4G A;  1XWL A;  1JKH A;  1VSD A;  3AA5 X;  4E89 A;  4KHW A;  4CHZ A;  4KFB A;  2YNF A;  4AHV A;  3QES A;  4DLG A;  4OPJ A;  5C24 A;  3V9U A;  4ZTJ A;  3OVN A;  1RT3 A;  1KRP A;  1JLQ A;  4HTU A;  4FLX A;  4J2A A;  3NF9 A;  1KVC A;  4M3W A;  4N56 A;  5FRN A;  4FJ9 A;  4DSI A;  1Q9Y A;  2JGU A;  1G15 A;  4CFD A;  1VSH A;  4EZ9 A;  1VRT A;  3I0S A;  4CIG A;  4ICL A;  3MXI A;  1BI4 B;  3HVR A;  1ZBI A;  3NF8 A;  1BIZ A;  4DTR A;  1TK0 A;  4C8L A;  3RMD A;  4JLH A;  4NYN A;  4KTW A;  3NBP A;  1NK0 A;  2PY5 A;  4CJK A;  1T8E A;  5JS1 A;  3LP1 A;  3B6P A;  3VQ9 A;  4CF1 A;  4FJ7 A;  2VWJ A;  2ZQB A;  1RDD A;  4E3S A;  5KGX A;  2IOC A;  1RT2 A;  2D0C A;  1QSL A;  4CJP A;  3RRH A;  3ISN C;  1ZBF A;  4KHQ A;  3RMC A;  3TAR A;  3AVG A;  2DFH A;  3KKS A;  5CY4 A;  3HP9 A;  4QAG A;  1VSE A;  3ZSX A;  4HHT A;  4K8Z A;  1WNS A;  3MXJ A;  3NF7 A;  2FBX A;  2YHA A;  3PUF A;  4KTQ A;  2BAN A;  5SWM A;  4FK4 A;  1IG9 A;  1JXE A;  1ZBL A;  4DQP A;  4FZX C;  1L3T A;  4CIE A;  3DOL A;  3AVM A;  4OGC A;  3VQ4 A;  3OYC A;  3NHG A;  3DLB A;  2QK9 A;  3PO4 A;  4B9T A;  2G8F A;  5CYQ A;  4K8X A;  4DFM A;  4DMN A;  1C1C A;  5HBM A;  3SUO A;  4DG1 A;  1Q8I A;  1TVR A;  5JS2 A;  4DS5 A;  1ZYQ A;  2BGG A;  4CJ4 A;  3WNE A;  1CZ9 A;  4DU3 A;  1U47 A;  4PY5 A;  4MFB A;  3V9X A;  1S6Q A;  3K2P A;  5C42 A;  3AO2 A;  3OYL A;  2G8I A;  3K58 A;  1JLG A;  2YNH A;  2DFE A;  4O0I A;  4FCY A;  2BE2 A;  4OGE A;  3OJS A;  2XY6 A;  3L2U A;  1VSI A;  2B4J A;  4W5O A;  3OYB A;  1KLN A;  4FM0 A;  3QEW A;  3V81 A;  4Z4F A;  3LAK A;  4PWD A;  1EP4 A;  1WSH A;  3T1A A;  3NH2 A;  2HHX A;  5CYM A;  1JL1 A;  5J1E A;  2F8T A;  1DTT A;  1I3A A;  1HJR A;  1D5A A;  5DK5 A;  4JRQ A;  3DYA A;  4CJL A;  3NH1 A;  3VQC A;  1L3S A;  3VQA A;  3K59 A;  2XY5 A;  2HMI A;  4M3X A;  3O3F A;  4PUO A;  3V9W A;  2HHU A;  1QSS A;  3NGI A;  3VQE A;  3AVK A;  3HYF A;  1VSF A;  4AH9 A;  4DQS A;  2JLE A;  4BWJ A;  4W5T A;  3KLF A;  3KLE A;  2IS3 A;  4R5P A;  2HHT A;  2XY8 A;  4M3T A;  4W5N A;  4FLT A;  2G8U A;  3RR8 A;  1C1A A;  3V6D A;  2RF2 A;  4O4G A;  1JLC A;  2DFF A;  4BE0 A;  1TAQ A;  4CGI A;  4DU4 A;  3OYH A;  3PX4 A;  4CEE A;  1S6P A;  2WON A;  3OY9 A;  3LDS A;  3U6F A;  3TAN A;  1TL3 A;  4CFB A;  4KI4 A;  3B6O A;  1BI4 A;  4FM2 A;  3SZ2 A;  4N76 A;  1JXB A;  1UWB A;  3OYM A;  3RWU A;  2HW3 A;  4FLW A;  2O4G A;  3AVA A;  5HRS A;  3P83 D;  3OYI A;  1Q9X A;  4KB0 A;  4F2S A;  4I9Q A;  3CFP A;  1BCO A;  4DTU A;  4KHN A;  1A5W A;  3VQ8 A;  1SL2 A;  5HRO A;  1VSM A;  2FC0 A;  4H8K A;  4EP4 A;  3MAQ A;  2DY4 A;  3IG1 A;  3IS9 A;  3HM9 A;  4KAZ A;  1KFD A;  3KLH A;  3ZT2 A;  4DTX A;  2Q3S A;  2OPS A;  1ZBH A;  2R7Y A;  1MU2 A;  4B9V A;  4DSJ A;  1UAX A;  4TSX A;  4FJN A;  2ATQ A;  1C0M A;  4MQ3 A;  3VN5 A;  1RNH A;  3G0Z A;  3ZT1 A;  2OPR A;  4AHC A;  2XO7 A;  4GW6 A;  3SUQ A;  4F8R A;  2QKB A;  1KFS A;  1FXX A;  2P1J A;  4RW7 A;  3MED A;  1NKB A;  4HUF A;  3IAY A;  5J2N A;  1NJW A;  3NH0 A;  3NDK A;  2A1S A;  2YKN A;  3AA3 A;  4CF8 A;  4CJ5 A;  5T7B A;  3SUP A;  4CF0 A;  4DTJ A;  3QNN A;  3UIQ A;  1J9A A;  4GMJ B;  3QIP A;  4FLZ A;  1SKS A;  2KZM A;  2F96 A;  5SZT A;  4DTM A;  4C8K A;  3TAB A;  2KFZ A;  3G10 A;  4RW9 A;  2HNY A;  4DF8 A;  2KZZ A;  1EX4 A;  3QEX A;  2D5R A;  1ASU A;  1QQC A;  4CGF A;  2OZM A;  5C25 A;  3L2V A;  1X9S A;  4BE1 A;  4CEZ A;  1WLJ A;  1RDC A;  4I7F A;  3EYZ A;  2OPP A;  4F2R A;  4C8M A;  2YNG A;  3PX0 A;  3SPY A;  1T03 A;  4FJH A;  2HB5 A;  4OPK A;  4HCB A;  4G1Q A;  3RMB A;  3L2R A;  4AHU A;  4N47 A;  4YNQ A;  1KTQ A;  1HYV A;  5CZ2 A;  4CF9 A;  4CE9 A;  1NKE A;  3AVJ A;  2RN2 A;  3V9S A;  1NK5 A;  1D9F A;  3DM2 A;  4LSN A;  2YNI A;  1N6Q A;  3AO5 A;  3OYD A;  5K14 A;  4BE2 A;  3TAE A;  2E4L A;  1T7P A;  1KSP A;  1TAU A;  2VWK A;  1T05 A;  2ETJ A;  4FLU A;  1C0U A;  1BGX T;  3OJU A;  1UA1 A;  2LSN A;  2P5O A;  1SL1 A;  2PYJ A;  3PY8 A;  4J2B A;  1NJY A;  4DTP A;  5FRO A;  3H08 A;  2ITG A;  4CED A;  4FK2 A;  4CJE A;  4FJ8 A;  4KPY A;  4DSF A;  1L3U A;  3QNO A;  3ULD A;  2VG5 A;  1JLF A;  3DRS A;  5J2M A;  3PX6 A;  3MXM A;  1QSY A;  3ZSO A;  3HJF A;  4H4O A;  3ZCM A;  2G8V A;  3QIO A;  4RG8 A;  2Z1I A;  3BDP A;  4AHT A;  4EZ6 A;  3JSM A;  3TAP A;  3LZI A;  2I5J A;  4IKF A;  1J53 A;  1LAV A;  1HPZ A;  4CIF A;  4KHS A;  3AA4 A;  3AO4 A;  3DMJ A;  4CEQ A;  4N5S A;  3V4I A;  4KHY A;  3O3G A;  3LAN A;  3QEI A;  2A1R A;  1CXQ A;  4LSL A;  3DI6 A;  1FKO A;  4OKJ A;  3U3G A;  4CHQ A;  3OYK A;  3KK3 A;  2E6M A;  3QER A;  4FXD A;  2KTQ A;  4E1M A;  3HPG A;  1BHL A;  1WSF A;  3ALY A;  4Y1C A;  4AHR A;  4N41 A;  1RBR A;  1SKR A;  1U4B A;  1NK7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...