1RBRA

Structural study of mutants of escherichia coli ribonuclease hi with enhanced thermostability
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
155
structure length
155
Chain Sequence
b'MLKQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAAIVALEALKEPCEVILSTDSQYVRQGITQWIHNWKKRGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERCDELARAAAMNPTLEDTGYQVEV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE H
publication title Structural study of mutants of Escherichia coli ribonuclease HI with enhanced thermostability.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase(endoribonuclease)
total genus 50
structure length 155
sequence length 155
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 1993-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1rbrA00
3OYIA 4I2PA 4KHYA 2EX3A 4CJTA 1HQEA 5HLFA 4N47A 3AVFA 4IG0A 1XWLA 4CHNA 4KB1A 1Z26A 3SQ1A 4M3ZA 5SWMA 2Z1HA 3OY9A 1NK8A 4O5BA 3DLRA 5I42A 2HHWA 1EETA 4DQPA 3I0RA 3SUOA 4CEAA 4FK0A 3V9ZA 3SUNA 1JLBA 3OJSA 4DWIA 2RN2A 3G0ZA 3HK2A 1BI4A 5KRSA 3K5OA 3KK3A 1KRPA 2VWKA 3NH1A 1FKOA 1J54A 4DFMA 1L3VA 2Y1IA 3QINA 3QO9A 3OYHA 3K5NA 2G8FA 1IH7A 3ZSRA 1SV5A 4E7HA 4W5OA 5HP1A 4ZTJA 3ZSXA 1TKTA 2OPSA 4DLEA 3K5LA 2YNIA 4HVJA 4BDZA 1G15A 3IG1A 1SKWA 4NCAA 1RTJA 4RG8A 2HHVA 4I9QA 3WNEA 5KGWA 4HTUA 2IOCA 1UAXA 1UA0A 4E19A 3K57A 3CG7A 1O1WA 3NF8A 4DTMA 4KHQA 1L3SA 1HNIA 3E01A 3TAMA 4DFKA 1HYVA 3ZCMA 1NK6A 3DLGA 1S1WA 3AVNA 4N5SA 2JGUA 1UOCA 3NGZA 4NYNA 3BGRA 3T19A 2RF2A 3ZSZA 5HRPA 3OYNA 3ZT2A 1C1CA 5I3UA 1SL2A 3AO3A 4K8XA 3SUQA 1YTUA 1W9HA 3O3FA 5D3GA 4Y1CA 4DS5A 4FLUA 4ELTA 3OS0A 1RT1A 4DFJA 3S3MA 4GVMA 4CJLA 4W5QA 1Y97A 1IKXA 3JSMA 5E41A 1NJWA 2FBYA 1C1AA 3C94A 3ZSYA 4BWJA 1KTQA 1NOYA 4OLBA 1ZBHA 1Q8IA 4CF8A 1JKHA 2FBVA 4CGHA 1S1UA 1GOBA 3AA3A 4NCGA 4RW8A 4R5PA 4E7KA 2KFZA 3VQBA 3SQ0A 2O4GA 3LAMA 1NK4A 1QSLA 1TV6A 4FJHA 3NDKA 4FLVA 1BQNA 3OYAA 1EXQA 3AO4A 4B9TA 1J5OA 1S1TA 1D9FA 3NF9A 4CGGA 4GMJB 4DTUA 3QEPA 1VK0A 1ZBFA 4HUEA 3AVKA 4FJNA 2IDOA 1X1PA 5KGXA 2ZQBA 1C0UA 4J2AA 3C6UA 2P1JA 3C6TA 1TVRA 3D45A 3NE6A 5J2PA 2JLEA 3TABA 1RCHA 4CIGA 1KFSA 2NUBA 4E7JA 3ISNC 1X9WA 4DQSA 4NCBA 1CLQA 2QK9A 1N5YA 3HVTA 5FDLA 2EHGA 1HYZA 1WSEA 3RRHA 4KRFA 3HP9A 3LZJA 4FLYA 3RR7A 2HHUA 3L8BA 1RT6A 1TK8A 3NGYA 1BCMA 3OYKA 4RW6A 1JLCA 3DRRA 1RT7A 1Z25A 4DQRA 2IS3A 4CERA 2G8WA 2PZSA 3LANA 3EZ5A 5J2QA 4CFAA 3TARA 1TGOA 3KTQA 2ATQA 2XHBA 4DQQA 1VSMA 4CJEA 3RR8A 4KI4A 1EP4A 1JXEA 3KK1A 2F8SA 2G8UA 3V6DA 2G8KA 1QQCA 4AILC 1BQMA 1U45A 1RBVA 2PYLA 3VQCA 3AVGA 2HHXA 1BISA 4ELVA 4FYDA 3QESA 2G8IA 2Z1GA 3MEDA 1RT3A 3LP3A 4I9LA 1RT2A 1XHXA 3LWMA 1T7PA 2GV9A 3HJFA 3MECA 2I5JA 1T03A 4CJQA 3DLKA 4GW6A 1VSHA 4DF4A 1NK0A 3RMAA 3TAQA 2XY7A 1TAUA 1D8YA 2FBXA 5CYQA 2OZMA 3KD5E 2OA8A 4RW7A 3AVAA 3HO1A 2RPIA 4AHSA 4AHRA 3V9XA 4CEDA 1VSKA 1RDCA 3IAYA 2HHTA 3KLIA 1JLGA 3DLBA 4M3WA 3THVA 3OYJA 4KREA 3B6OA 3LAKA 3NF6A 3V4IA 1BIZA 1UWBA 1UA1A 5CZ2A 4IFYA 4Z4FA 4NYFA 4CEFA 3MEGA 5KRTA 2ETJA 4FCYA 4B8AB 4CK2A 4FK2A 3HM9A 4CF1A 4M42A 1S1XA 4KHSA 4M3TA 4KAZA 3SPZA 1W0HA 4B08A 3DI6A 4LD0A 4AHCA 1RT5A 3AVCA 4OPKA 1X9MA 3AA5X 2G8VA 3HVRA 1NKCA 4EP4A 3P1GA 3TI0A 3OYEA 3AVJA 1S6PA 1IG9A 4J2BA 4Q5VA 1FKPA 1KCFA 2B6AA 3ITHA 1YT3A 4CF0A 3L2WA 4W5RA 3NHGA 3QETA 4JRPA 4WE1A 3RMCA 4BE0A 4C8LA 2YKNA 3FFIA 1XHZA 3CM6A 4AH9A 4DTXA 3PX4A 3LZIA 4FJ5A 4FJMA 4OGCA 1K6YA 2BE2A 2GUIA 3VQ7A 1S5JA 1TKZA 1VSIA 1WNSA 2ITGA 3ZSOA 3I8DA 3V81A 1SL1A 1RDDA 3IRXA 2KZMA 1QTMA 4FJLA 4FVMA 4CCHA 4B9VA 1RTHA 3DOLA 3PV8A 3LP2A 5KI6A 4C8NA 3NH0A 4ID1A 3NF7A 1S9EA 1WAFA 4YNQA 1FK9A 4LH5A 3VQ6A 2R7YA 3QNNA 3KLEA 3PX6A 4DSJA 4HCCA 2HHQA 4YFUA 4FW1A 4DQIA 4J2EA 5K14A 4CEZA 4JS5A 2E4LA 1U04A 3S9HA 1C6VA 3AVHA 4FM0A 4FW2A 4CECA 1WAJA 4CJWA 4W5TA 3QEXA 1ZBUA 3L3VA 4CJPA 2HMIA 4H8KA 3K58A 4CFCA 3QIOA 2XO7A 2QKKA 4FJGA 5HRSA 1KLNA 4F2SA 3PUFA 2OPRA 4JRQA 2B5JA 1HRHA 2Z1IA 1VSEA 1VSJA 4DSLA 3AVIA 1QHTA 2HNYA 3U6FA 5SZTA 2X6NA 3EY1A 1SL0A 1GOCA 4CEQA 4DTOA 3ZSVA 2Q3SA 5C24A 4B9LA 4HCBA 2HHSA 4CGDA 1KFDA 2P51A 4FLZA 3PO4A 1S1VA 3KIOA 1D5AA 4JS4A 3SQ2A 1TAQA 4CGFA 4IG3A 3OYDA 1ZBLA 1SKRA 3HP6A 4M45A 5DK5A 4FLXA 1JLEA 1KVAA 4ID5A 4FJIA 2KFNA 2OYQA 2OPPA 1J53A 3VN5A 3KLFA 3M8SA 2HW3A 3DYAA 3S3NA 3VQDA 1CZBA 1JLAA 1WSHA 4CJ5A 2A1SA 4CJ4A 4EP5A 1T8EA 4LH4A 4I7FA 4DLGA 4KTZA 4OKJA 1ASUA 1RBTA 4DU4A 4UQGA 1A5VA 1IKYA 1CXUA 1SKSA 3F9KA 1ZYQA 3HT3A 4KI6A 1NKEA 2X74A 2P5OA 1L3TA 1KLMA 3HPOA 4EZ9A 2F8TA 1YVUA 1BIUA 3HPGA 3AA4A 3HXMA 4F3OA 4H4OA 1HPZA 1NK9A 3VQ4A 4EZ6A 3OYCA 1JLFA 4CJSA 4BACA 4DF8A 1R0AA 5EU7A 3VQ9A 2X6SA 1QSYA 4KHUA 2A1RA 1QSSA 1BCOA 4BE2A 2DFFA 1CZ9A 3ZSWA 4B8CA 3KLHA 4CHPA 4E1NA 1J9AA 4E7LA 2W42A 4CHOA 4FK4A 3M8QA 4N56A 4OLAA 4FJKA 2Z1JA 1C0TA 4OKEA 3RRGA 4B9UA 4DG1A 4N41A 3O4QA 1S9GA 5HBMA 3AV9A 3VQAA 3OYBA 5C25A 2IAJA 5FRMA 1RTIA 4HHTA 2KZZA 2B4JA 4KO0A 3RTVA 1U4BA 3F73A 3VQ5A 3O3HA 1RBUA 4TSXA 4OGEA 1WN7A 3DRPA 4CJVA 3KK2A 1NKBA 4PY5A 1ASWA 4BE1A 4DTRA 3SUPA 3NBPA 4HUGA 2IGIA 4HUFA 2VG5A 2ZD1A 3P83D 3O3GA 3L2QA 1DLOA 3QEIA 1U48A 3K2PA 1BHLA 4QCLA 4IKFA 5C42A 2QKBA 1LWFA 3WNGA 1LW2A 3U3YA 3SQ4A 4O4GA 5FROA 4OPJA 3TAFA 2YHAA 4F2RA 2LSNA 3KKSA 4CESA 4Z4CA 3CFRA 4FLWA 4O55A 3MAQA 4Z4GA 1CXQA 4PWDA 4QOZB 2KW4A 4DTJA 1C1BA 4FJ7A 3ZT3A 2FBTA 1X9SA 3EYZA 1KVCA 4BDYA 4CJKA 3OYLA 3AVLA 3SZ2A 1A5XA 3QERA 3JYTA 5HRRA 1RILA 1HJRA 2KTQA 1RT4A 4CEEA 3AO2A 1IKVA 4DMNA 2QXFA 3NFAA 4OVLA 4XIUA 4DU3A 4CJ3A 3AO1A 1RDBA 3MXJA 4RW9A 1LAWA 3NH2A 4DTPA 1NJYA 4B9SA 1LAVA 4CIEA 4CHYA 3NCIA 3OYMA 4FZYA 1NOZA 3LP0A 2FC0A 2O4IA 1C0MA 3SCXA 2PYJA 3IS9A 5KTQA 3V9WA 3MXMA 1U47A 1LW0A 3CFOA 4C8KA 1Q9XA 4FZXC 1ZBIA 5J2NA 1HYSA 1TL1A 4CF2A 5HRNA 3OVNA 3U3GA 4E3SA 4PA1A 1GOAA 3VQEA 1B9DA 2YNHA 3V1RA 4ZHRA 4LSNA 1A5WA 1NK7A 3TR8A 3HL8A 1S6QA 3KKRA 4OJRA 2VG7A 2Y1JA 3PX0A 2PY5A 4DSIA 4J2DA 2VG6A 4BDPA 1TL3A 2RKIA 2BDPA 4DSKA 3SPYA 1VSLA 3L2UA 4E0DA 4L8RB 2X78A 4OKKA 4M3XA 4O0JA 1NK5A 1IO2A 4M3UA 3SV3A 4DTSA 3QLHA 2YKMA 3C95A 4CHQA 4CK3A 2BANA 4Y1DA 3A2FA 2HVHA 5JS1A 2WOMA 1JL1A 1VSFA 4LSLA 4CJUA 3SYZA 4FXDA 3VQPA 4H4MA 4F4KA 3WNFA 3HYFA 3WNHA 1LV5A 1BGXT 4Z4EA 1RTDA 2HVIA 3ULDA 3CM5A 3TANA 4O0IA 2YNGA 3ZT0A 4Z0UA 3V9UA 4IDKA 3S3OA 5J2MA 3NAEA 1WSFA 3SJJA 3H08A 3LPTA 3MEEA 5J1EA 1HQUA 3OYFA 4KB0A 2OZSA 1TK5A 3D0PA 1YTAA 4Q0BA 3M8PA 4CF9A 4FZZA 3DRSA 3K5MA 2AJQA 3SNNA 1VRTA 4MQ3A 2VWJA 2D5RA 2DTUA 4E7IA 4CJFA 3AVMA 3OS2A 4B9NA 4PQUA 4M3YA 5FRNA 1I3AA 1DTQA 2GBZA 3TAPA 3LP1A 2XY6A 2IC3A 3OJUA 4Z4IA 2D0AA 2G8HA 1L5UA 3ASMA 4CEBA 3QEWA 1I39A 1LWEA 1VSDA 4KKOA 3OYGA 3CFPA 3QNOA 1JL2A 3TAGA 3MXIA 1KSPA 3DLEA 2XY8A 3DOKA 4B9MA 4ICLA 4CIFA 4FM1A 1JXBA 1NJXA 4KTWA 1N6QA 4E1MA 1HNVA 4PUOA 4AHVA 2YNFA 4MFBA 4FJ9A 3RMBA 1TK0A 1ITGA 3VQ8A 1WLJA 3TAEA 1D9DA 3L2RA 1BI4B 4F8RA 1FXXA 1LWCA 4FM2A 3BDPA 3L3UA 4KHWA 3ZT4A 4KTQA 1B92A 3CYMA 1NJZA 3VQQA 3OS1A 4M41A 1EX4A 3I0SA 3LDSA 2ZE2A 1IKWA 4DSEA 1Q9YA 2BGGA 2YHBA 4DS4A 2DY4A 1EKEA 1KVBA 4CK1A 4DSFA 4C8OA 4W5NA 1SUQA 4KV8A 1F21A 4CEOA 3M8RA 3SV4A 3T1AA 4CFDA 3VA0A 4B3OA 3UIQA 4FJ8A 3TWHA 3KD1E 1ASVA 3T3FA 1MU2A 2DFHA 5CZ1A 4CGJA 3RWUA 1B9FA 1RDAA 2F96A 3ZSQA 1L3UA 2XY5A 4O44A 2E6MA 1WSJA 2WONA 4AHUA 4AHTA 4DU1A 4IFVA 1TKXA 2D0CA 3QEVA 4K8ZA 1RBSA 4BWMA 1XI1A 3VA3A 4KHNA 5T7BA 1REVA 4C8MA 3KJVA 3ZT1A 3V1QA 2HNDA 1JLQA 4Z4HA 1VRUA 3B6PA 3HSTB 4G1QA 4RW4A 4ELUA 4DFPA 1QS4A 3G10A 3LALA 3QIPA 3KLGA 3L2VA 2XRIA 5DMRA 3P5JA 3DLHA 3NGIA 3DM2A 4CGIA 4JLHA 4IBNA 4DTNA 3AVBA 3AO5A 2OPQA 1WSIA 3HPHA 3LPUA 4CFBA 3RMDA 4FJXA 3DMJA 5CY4A 2E6LA 3V9SA 5CYMA 2KQ2A 1HMVA 1DTTA 1QE1A 4LY7A 3SI6A 1XC9A 1TKDA 4F3TA 4ZTFA 1BL3A 3LWLA 3CQ8A 1U49A 1T05A 3ALYA 2YV0X 4CE9A 2P5GA 2HB5A 5HROA 4M3RA 4CJRA 4QAGA 3AA2A 4KPYA 4I2QA 4E89A 3PY8A 3V1OA 2D0BA 5JS2A 1RBRA 3PO5A 2DFEA 4FLTA 2HNZA 4KFBA 3K59A 4CHZA 1RNHA 4FJJA 3O4NA 1WSGA 4N76A
chains in the Genus database with same CATH superfamily
4JKGA 3OYIA 1S3XA 4KHYA 4CJTA 5HLFA 4N47A 3AVFA 1XWLA 3SQ1A 5SWMA 2Z1HA 3ZEUA 4LC9B 1GLCG 3N4QA 3DLRA 1OH5A 4JNEA 1EETA 4BRPA 1XMOK 2RN2A 4FWKA 4CZJA 3TTDA 3K5OA 3KK3A 3UKRB 4JK9A 4BROA 3CJBA 3QINA 1S22A 3QO9A 4H0TB 2ASOA 3E9OA 1NJIO 3C7NA 3QBWA 4W5OA 3DAWA 2OPSA 3CCLN 4HVJA 1KAXA 1RTJA 1C0FA 3WNEA 2IOCA 1W2BM 4JD2B 1QVGM 4ILJA 3LM9A 3R1XA 4MO5A 4DFKA 5HL7L 3DLGA 4JYAK 3NGZA 3SUQA 1W9HA 5CE3A 3U9ZA 2FSNA 1Z05A 4GVMA 4W5QA 3ZSYA 2GTDA 1ZBHA 1WBBA 2FBVA 3CCRN 3FZLA 4R5PA 4E7KA 2KFZA 3VQBA 3NDKA 3AO4A 2ZGYA 2NRVA 1J5OA 2Q2RA 4DTUA 1X1PA 4OPAA 1YAGA 1TVRA 1OVYA 3D45A 3TABA 4CIGA 2ZJPL 1BU6O 1X9WA 3HI0A 4DB3A 1Q18A 3AAQA 3GL1A 2QK9A 3HVTA 3U8XA 3J81O 2EHGA 3SAGA 3CC7N 1HLUA 4DQRA 1KC8O 3LANA 1U6ZA 1K8KB 3AGRA 3TARA 4LF4K 4KI4A 3V6DA 2YHYA 4MDAA 2PYLA 3VEZA 3NVKA 2O8FA 5C2DA 3VQCA 1NGAA 4DR1K 3QESA 2Z1GA 3IUCA 4I9LA 1XHXA 4LFAK 4K0KK 4EAHD 3HJFA 2UYTA 3VF6A 1NK0A 3RMAA 3TAQA 3OA9A 5AQLA 2FBXA 5CYQA 3KD5E 3HO1A 4AHSA 2A40A 4CEDA 1VSKA 2HHTA 4M3WA 2OCEA 3OYJA 1ESVA 3LAKA 3NF6A 3DXKB 4GV9A 5CZ2A 3G25A 4NYFA 4CEFA 4B8AB 4CK2A 3L6QA 4B08A 3DI6A 1RT5A 3AVCA 4A5BA 3AA5X 1KAZA 4EP4A 3TI0A 2JWKA 1H1VA 5AZJB 4CF0A 3ITHA 5AQRA 2YKNA 2E1ZA 4AH9A 3EE9A 5BRHA 3VQ7A 1S5JA 1WNSA 1SL1A 3FE1A 1RDDA 2YI1A 2O8BA 4FWPA 4FJLA 3PV8A 4DR7K 2O8CB 3NF7A 2R7YA 3QNNA 3KLEA 3VTIA 1P8ZA 4FW1A 4DQIA 4CZKA 1C6VA 2GWKA 1WAJA 4CJWA 1ZBUA 4H8KA 3K58A 3QIOA 3C6AA 2B5JA 1HRHA 4DSLA 1VQKN 2HNYA 4BR2A 5GAGP 2X6NA 3I8BA 2HHSA 4H0PA 5GINA 2P51A 4FLZA 1S1VA 1TAQA 3VGMA 4ID5A 4X64K 4FJIA 2OPPA 2PBDA 4BR0A 2HW3A 2E88A 4BY9C 1WSHA 3ZLJA 4DV2K 2A1SA 2QEXN 4IOCL 4BR7A 4LH4A 2P9SB 4I7FA 4DLGA 3ULEA 5LY3A 3FZKA 4A61A 1N8RO 4ILHA 3WXLA 1ZYQA 4OX9K 1M90O 1YVUA 3AA4A 3HOSA 1HNXK 4DF8A 1R0AA 3VQ9A 2X6SA 1HKGA 1X3NA 3ZSWA 4JKFA 4E1NA 4CHOA 4N56A 4MLHA 4OKEA 4B9UA 3VQAA 3OYBA 1WOQA 5FRMA 1RTIA 4JV5K 1N32K 1O13A 4KO0A 4CBXA 1U4BA 2NRXA 4OGEA 4PY5A 5M1OA 5AFUH 4I9QA 1QQMA 2VG5A 3J7YP 1G99A 1BHLA 3M3ZA 1OVQA 3WQTA 5C42A 3WNGA 3SQ4A 5FROA 4OPJA 3TAFA 2GUPA 4F2RA 4CESA 1FW6A 5JICA 5E26A 4H03B 4WQ5C 1CXQA 5GAHP 4QOZB 3F2KA 2A41A 1KVCA 4BDYA 4CJKA 4BRNA 3JYTA 3ZX0A 1RT4A 4C1NK 3U9DA 4CJ3A 3MXJA 4DTPA 5FPDA 3A8YA 2JWLA 4BC4A 4FOEA 1M1KO 1NGFA 3F5TA 3MXMA 1LW0A 1Q9XA 5J2NA 3HRGA 4CF2A 3OVNA 3U3GA 2YNHA 5BR8K 3ZX3A 3HL8A 2BTFA 2ASMA 1S6QA 4OJRA 4DSIA 4BGBA 1VQPN 1TL3A 1VSLA 4BRGA 4E0DA 4OKKA 2P9LA 2HBLA 4M3UA 4CHQA 3ENBA 5JS1A 4LSLA 3Q7BA 4F4KA 3HYFA 4K41A 1BGXT 3ULDA 3CM5A 4IJNA 3QDKA 3D2FA 3ZETB 3MEEA 3OYFA 5CR4A 3D6RA 3SNNA 1VRTA 3VEXA 2VWJA 2DTUA 4E7IA 4CJFA 3OS2A 2IVOA 4JN4A 4IEIA 1I3AA 3TAPA 5EXWA 3OJUA 4JKGB 2G8HA 3ASMA 1I39A 1VSDA 4KKOA 3CFPA 4DR2K 3MXIA 1JL2A 3DOKA 2BH1A 3ZEUB 4O5FA 4FM1A 4JI8K 2F9WA 3MN7A 1HNVA 3GG4A 4MFBA 4GKJK 2UUAK 1RDUA 3E9PA 4ILGB 4FM2A 3BDPA 1ZBSA 4X65K 3CYMA 3DWLA 4BRKA 1EX4A 2ZE2A 5FPEA 4DSEA 4DS4A 4DSFA 5AQUA 3C7NB 4W5NA 4CEOA 3SV4A 3T1AA 3EO3A 3B8AX 1DEJA 1NMNA 1RDAA 2E6MA 4AHTA 1JCFA 3IDHA 4C8MA 3KJVA 4J8FA 3ZT1A 2HNDA 4G1QA 4I6MA 5JMVA 4IFEA 3P39A 3L2VA 2XRIA 5DMRA 4B1UB 3MK6A 4RCHA 4B1ZA 3PSIA 4DQ8A 4DTNA 4IBNA 3EKSA 2AA4A 3CJAA 3RVCA 4CFBA 3DMJA 5LJWA 2E6LA 4KREA 4LY7A 4JI4K 4JI0K 2KHOA 3EL2A 1U49A 2P5GA 2HB5A 2A42A 5HROA 4IO8A 4M3RA 3AA2A 3LM2A 4I2QA 3KWIA 4MLEA 2HSTA 2D0BA 2D4WA 2DFEA 4KFBA 3K59A 4IO9L 2NNWA 3MCPA 1WSGA 2EX3A 4LF8K 4CHNA 2I7NA 5JVGL 4KB1A 3OY9A 1TYQA 4IZ9A 1LCUA 3THYA 3SUOA 3THWA 1EO1A 1KRPA 2VWKA 3NH1A 2O8FB 4HTLA 1SS6A 4YORA 1SV5A 3ZSXA 3HBTA 1WBDA 4KBOA 3OTOK 1V4TA 2QW9A 3IG1A 5BPLA 5KPZA 4RG8A 2E2OA 4H0OA 3K57A 3NF8A 4B1WB 4DTMA 2O8EA 3LDNA 1L3SA 3E01A 4BVPA 4N5SA 1K9MO 2CH6A 3T19A 1SL2A 3L0QA 2RF2A 1C1CA 3CC2N 3O3FA 5D3GA 5F2RA 4Y1CA 3PLAA 3RSEA 4XEIA 1IKXA 4CI6A 2QWNA 3C94A 4LF5K 4BWJA 4YOXA 1KTQA 4IDHA 4CGHA 1S1UA 4NCGA 3AA3A 3SQ0A 4RTFD 2O4GA 3LDPA 3O9SA 1NK4A 1TV6A 3G4SN 4FJ9A 4AM7A 3OYAA 1EXQA 1D9FA 3NF9A 4CGGA 4GMJB 3PIPL 1NGCA 2O8BB 2UXBK 1QZ5A 5KGXA 1C0UA 4K25A 2P1JA 3NE6A 1RCHA 1KFSA 2NUBA 1CLQA 4NCBA 3M5RA 1N5YA 1E3MA 3OBYA 1HNZK 3UE5A 1WSEA 4KRFA 2VWBA 3L8BA 4B3TK 2D0OA 3J7AP 3NGYA 1BCMA 3OYKA 1RT7A 1Z25A 4CERA 2G8WA 5J2QA 4GV6A 4CFAA 3KTQA 3RR8A 4CJEA 2F8SA 3WUHA 2G8KA 1U45A 1RBVA 4ELVA 1HPMA 2G8IA 2HBKA 3LP3A 3CPEA 2I7PA 3MECA 2QTDA 4JI3K 5F0XA 4X66K 4JKDA 1TAUA 4XH5A 1D8YA 2OZMA 3ULEB 4AHRA 4NXMK 3KLIA 4OO1J 1OKJA 4OPHA 2V7ZA 3B6OA 4IFYA 4CJ7A 2CH5A 5KRTA 2ETJA 4FCYA 1VQ5N 1JCGA 4M3TA 4DR4K 4FSVA 4LD0A 4AHCA 5E84A 4OPKA 1X9MA 3TTCA 3HVRA 1NGDA 3OYEA 1NLVA 3AVJA 4J2BA 3TSPA 1FKPA 4Q5VA 3TU5A 3THVA 2E2PA 4CZIA 4JRPA 3FFIA 1BOTO 3CM6A 4DTXA 3PX4A 1YI2N 4FJ5A 2GUIA 3V81A 3ATUA 3ZSOA 2KZMA 1Y64A 4B9VA 3DXMA 5KI6A 4CZFA 4CBUA 2IVPA 4YNQA 4LH5A 1DKGD 5K14A 4CEZA 1U04A 3F9MA 1K8AO 4W5TA 4BGAA 4WFAL 2VCPA 3CCVN 2E1YA 3OW2M 5AQQA 2UU9K 1QHTA 3U6FA 3EY1A 1GOCA 3JAMO 4QS7A 3VEWA 3VPZA 4HCBA 1KFDA 3PO4A 1D5AA 3OYDA 2QWOA 3BUZB 2NRZA 4M45A 1IJJA 4FLXA 4JI1K 1KVAA 2KFNA 3IKMA 4WQ4A 1J53A 4BR9A 3S3NA 3VQDA 1CZBA 1QQNA 3QFPA 1JLAA 5LMUK 4QS8A 4CJ4A 4EP5A 1T8EA 3R3LA 4O8KA 4KTZA 1NGBA 1ASUA 1RBTA 2QWRA 1IKYA 1CXUA 3CJ1A 3F9KA 2OTJN 4KI6A 4MDBA 2V51B 3AY9A 4JHDA 4B1YB 3CI5A 4YOVA 2A5XA 3HPGA 4F3OA 1OH6A 4EZ6A 5AQSA 3OYCA 1JLFA 4CJSA 3VESA 4KHUA 2A1RA 1BCOA 3MX2A 1OH7A 4GNIA 4B8CA 3P38A 1KXPA 3O1BA 5BPNA 4FJKA 3KK7A 4CZLA 1C0TA 4FVUA 3O4QA 3AV9A 3D2FB 3S41A 3F73A 2GELA 3VEVA 3VQ5A 4TSXA 1WN7A 5DM7L 2V52B 5ADXA 3P83D 3O3GA 3QEIA 3DLLL 4B3RK 2QWPA 2YCHA 1LWFA 3GOIA 1LW2A 4O4GA 3G6EN 2YHAA 1S72N 3KKSA 4FLWA 5AJ3K 2HHHK 3THXA 5M1QA 3ZT3A 1X9SA 4FPAA 4H5RA 3SZ2A 1T3VA 4RWTA 3NVMA 2W40A 3O80A 4H5NA 5AQHA 4XH4A 4XIUA 2IVNA 3AO1A 4RW9A 3SK3A 3OYMA 1NOZA 2O4IA 4DKWA 3SCXA 1BA1A 1U47A 3CFOA 4C8KA 1U2VA 4KH6A 2HBMA 4EHUA 1TL1A 3BY5A 4PA1A 1GOAA 3H3NO 3HOTA 1NK7A 4BRMA 4JKCA 3VTHA 4FL9A 4A2AA 3KKRA 1NNEA 2VG7A 3BZCA 3PX0A 2VG6A 2P9PA 1WB9A 3HZ6A 3M6GA 4BDPA 2RKIA 3TTFA 3AARA 5AQFA 1JJ2M 4L8RB 2X78A 4M3XA 5FPNA 4I6MB 3C65A 3VGKA 4DTSA 3QLHA 3C95A 4CK3A 2F9TA 4Y1DA 4K42A 2Q97A 1JL1A 4CJUA 2NRWA 4FXDA 2HBJA 3VQPA 1RTDA 3WT0A 3TANA 1XNQK 3E1YA 3V9UA 4JKAA 3S3OA 5J2MA 3SJJA 2HOEA 4DHYA 3GE1A 3H08A 3LPTA 4BRLA 1YTAA 4Q0BA 2AJQA 2V7YA 2D5RA 4PQUA 3D7EO 4Z4IA 3SBGA 3CPWM 2WC9A 1L5UA 4CEBA 4BRHA 2UUCK 5KPTA 3R6MA 3TAGA 3DLEA 2XY8A 1NWKA 4ICLA 1TYQB 3THYB 1N6QA 3THWB 4AHVA 3H3OB 3CIPA 3TAEA 3L2RA 1LWCA 4KHWA 5GAEP 5AQXA 5HOOA 1NJZA 4M41A 1IBMK 3CQYA 4A59A 5M1PA 1QQOA 4KV8A 4FWSA 1J5EK 3A5MC 1RFQA 3D2EA 3TWHA 1MU2A 2DFHA 2XY5A 4O44A 3R8EA 4AHUA 2WONA 4DU1A 2H3GX 4KHNA 2O8EB 3V1QA 1VRUA 3HSTB 4RW4A 4ELUA 3NMUA 1EWRA 4DUZK 5BRFA 4WFBL 1YXQA 3VENA 1YJWN 3RSEB 2GWJA 3ATVA 4JLHA 3AVBA 2FF3B 1KAYA 1WSIA 1T6CA 3V9SA 1DTTA 1QE1A 1XC9A 4F3TA 3LWLA 1T05A 4CE9A 4CJRA 2HF4A 4WCEL 4B1VA 1NGJA 3FZFA 5M1NA 1SZ2A 4E89A 3G71N 1LOTB 4CHZA 1RNHA 4DR3K 2PFUA 1NG9A 1QHAA 5GIOA 3TSQA 1N33K 4IG0A 1Z26A 1YIJN 4M3ZA 1ATSA 4FWOA 1NK8A 2HHWA 5AQYA 4DV7K 4DQPA 2ZJRL 3JS6A 2ZM6K 3I0RA 1HKBA 3WXKA 3ENHA 3OJSA 2WTUA 1OH8A 2ZWHA 3O8MA 3G0ZA 2NLXA 3HK2A 4MO4A 1BI4A 5KRSA 1FKOA 4WFNL 4DFMA 1SAZA 1L3VA 2Y1IA 3I55N 5IT9O 3K5NA 3OYHA 4A2BA 4IEEA 2G8FA 3ZYYX 3EKUA 4YOYA 4E7HA 5HP1A 1HJOA 4LF6K 2EWSA 1TKTA 4DLEA 3ENOA 2YNIA 4BDZA 4NCAA 2HHVA 1E4GT 4KH5A 5KGWA 4HTUA 1UA0A 3CG7A 1O1WA 4EFHA 1HNIA 3TAMA 2Q0UA 3ZCMA 4V19S 3AVNA 3H1VX 4JI6K 3BGRA 3ZSZA 3OYNA 1YTUA 3ZT2A 3BF1A 4PKHA 4ELTA 4DS5A 4FLUA 3OS0A 4DFJA 4CZGA 3S3MA 5AQPA 3JSMA 1NJWA 3VGLA 1NOYA 5TKWA 1Q8IA 3A5LC 4CF8A 1JKHA 4L3QA 4BRAA 2P9IA 2E5LK 4FJHA 5TKYA 3WEEA 3WQUA 3EZWA 4B9TA 1HR0K 1S1TA 2UUBK 1ZBFA 5KQ8A 1YJ9N 4FJNA 2IDOA 4B3SK 1MWMA 3FFKB 2QA4N 4J2AA 3C6UA 5BR9A 3DXMB 5AQMA 2A3ZA 5F1XA 2JLEA 4E7JA 3ISNC 4DQSA 3MCAB 4WQ5A 1HYZA 3WXMB 1ZC6A 3LZJA 4JAXA 1XQSC 4RW6A 3IFRA 3DRRA 2PZSA 2IS3A 4DV0K 1W7AA 3EZ5A 2NRTA 1TGOA 1YF5L 2XHBA 4DQQA 3HTVA 1JXEA 4PKIA 3KK1A 2G8UA 1J6ZA 4AILC 5LJVA 1BQMA 1GLLO 1BISA 4FYDA 1YVNA 3HSCA 3T69A 3LWMA 1RT2A 4H0VB 4BR4A 4GW6A 4DF4A 3IMXA 3O6WA 1VQ4N 1NMDA 4RW7A 4HWIA 1GLBG 1JLGA 1TUUA 4H0XB 5ADXH 3I56N 1BIZA 3UKUA 1UWBA 3BF3A 1UA1A 3AGKA 4JHDB 4Z4FA 1GLFO 1XNRK 3HM9A 4CF1A 5AQJA 4KHSA 3CJ9A 4KAZA 1W0HA 4PHTX 5M1FA 2G8VA 1ILYA 1EWQA 1NKCA 4DV3K 1GLAG 3P1GA 3CHWA 2HMPA 1HNWK 2B6AA 3L2WA 1YT3A 3LDQA 3QETA 4W5RA 5AQNA 1XHZA 3ID6A 1DT9A 4JI5K 3CJCA 4OGCA 1K6YA 2BE2A 1TKZA 2ITGA 3EE8A 2CGLA 3IRXA 4EIAA 1RTHA 5BREA 1YITN 4O8UA 3CCJN 1Q86O 4AQYK 3VEOA 3LL3A 4ID1A 3VQ6A 3PX6A 4CZMA 4J2EA 4GKKK 4YDUA 4FM0A 3AVHA 3QMLA 3L3VA 4CJPA 4FJGA 4CFCA 2KLAA 5HRSA 3PUFA 4JRQA 3THXB 1VSEA 1VSJA 5EY4A 3AVIA 4G9ZA 5EX5A 1SL0A 4CEQA 4B9LA 5C24A 3MN5A 4CGDA 4AF1A 3KIOA 3CCQN 5C10A 4CGFA 1SKRA 3HP6A 4K43A 5DK5A 5KPRA 3CERA 2OYQA 3VN5A 3KLFA 3M8SA 3P31A 4A5AA 3BP8A 3FGUA 4FO0A 1U2VB 4OKJA 1A5VA 4PL8A 5A2QO 4XH1A 2P9PB 1NKEA 2P5OA 2F8TA 1BIUA 4M7YA 4DR6K 1HPZA 5EOYA 1SQKA 4BACA 1QSSA 5AQZA 2DFFA 4CHPA 3T1YK 2W42A 3CJ7A 4FK4A 3A5NC 5M1KA 2Z1JA 4WQ4C 4FWNA 3RRGA 4DG1A 1S9GA 5HBMA 2IAJA 4Z94A 4HHTA 2B4JA 5C0YA 3FLCO 3O3HA 1RBUA 1HUXA 3DRPA 1NKBA 3EN9A 1ASWA 3QFUA 4DTRA 2IGIA 4HUFA 4DR5K 3L2QA 1U48A 1DLOA 5BRDA 4BRFA 4IKFA 2QKBA 5C15A 1MWKA 3VF4A 2LSNA 4Z4CA 3CFRA 2UXDK 4O55A 4Z4GA 4PWDA 1C1BA 1NGEA 3OBWA 4ISGA 2FBTA 4FJ7A 3EYZA 2P9UA 3OYLA 1A5XA 3QERA 1MDUB 1RILA 2PAVA 3GBTA 4CEEA 4IOAL 1W97L 2QXFA 3NFAA 4OVLA 1NJYA 3SMSA 4B9SA 4CIEA 4CHYA 3NCIA 3LP0A 3MWPA 5KTQA 2FF6A 3CF5L 3V9WA 5B8HA 1V4SA 5AQGA 4FZXC 1VQON 2FSKA 1ZBIA 5HRNA 3EEQA 3VQEA 5AQOA 1B9DA 3D2EB 3V1RA 4FWLA 4LSNA 1A5WA 3TR8A 2Y1JA 4FWMA 2P9NA 3T1HK 5DM6L 4O0JA 1NK5A 1IO2A 1GLEG 1ZXOA 5AZIA 3A2FA 2HVHA 4BC5A 2F4VK 2WOMA 4BRQA 1VSFA 1BO5O 4H4MA 3WNFA 4NXNK 1GLDG 3WNHA 1NU0A 4Z4EA 1VQLN 3VMFB 2CGJA 4O0IA 3ZT0A 4Z0UA 1X3MA 1BUPA 5FPMA 3NAEA 2O8DA 1WSFA 3CCMN 4JKEA 4KB0A 2OZSA 1TK5A 4CF9A 3CCSN 2NZTA 1YUWA 1QVFM 4MQ3A 4DV5K 1X9JA 5IWAK 3Q7CA 4M3YA 2GBZA 2XY6A 2YJEA 5KQDA 2WUSA 3QEWA 4AM6A 1LWEA 3OYGA 3QNOA 3GDQA 3K9JA 1BWFO 1JXBA 1NJXA 4KTWA 4PUOA 3OHRA 2Q36A 2P9LB 3RMBA 1ITGA 3VQ8A 4DV1K 2NRRA 3CQXA 4B3MK 1BI4B 4F8RA 2GEMA 3L3UA 2Q0RA 3ZT4A 4WF9L 4KTQA 1B92A 3VF2A 3VQQA 3I0SA 3LDSA 1IKWA 2YHBA 5AQIA 2DY4A 2KKZA 4M7XA 1F21A 4IJAA 3VA0A 4C23A 3WXJA 3UIQA 3KD1E 4CGJA 5CZ1A 1L3UA 1E4FT 3A5OC 1WSJA 3QEVA 5CHIA 1XI1A 3VA3A 4JI7K 1REVA 2QXLA 1JLQA 2YX6A 1QS4A 1IV0A 4CW7B 3NGIA 3DM2A 3PSFA 4CGIA 2P9KA 2W6KA 1VQ9N 3E66A 3AO5A 3LPUA 3HPHA 4H0YB 3RMDA 4FJXA 5CYMA 2KQ2A 2W6LA 1KD1O 4JI2K 2P9IB 5MLCQ 2J4RA 3WEEB 3ALYA 4BRCA 4BC3A 4QAGA 4NLBA 4R79A 4DUYK 3PY8A 3R9PA 3K0SA 3V1OA 1VQMN 3PO5A 4ISEA 4FLTA 5H1SQ 2OANA 1N36K 3WXIA 4FJJA 3O4NA 3BZKA 3QBXA 4N76A 4I2PA 1HQEA 4LFCK 3VETA 4FWQA 4O5BA 1YJNN 5I42A 3MDQA 4H5WA 4CZEA 2FXUA 1NBWA 4CEAA 3V9ZA 3SUNA 4FK0A 1JLBA 4DWIA 4CD3A 2VQEK 5I9EB 1J54A 4BR5A 1DGKN 2E2QA 1D4XA 2Q1NA 1IH7A 1RDWX 3ZSRA 2F7TA 3O9QA 3C0BA 4ZTJA 1FJGK 3C6HA 3K5LA 4BC2A 1G15A 3MWTA 3O5BA 1SKWA 3L4QA 1UAXA 4E19A 4B9QA 4GY2B 4BRDA 4F9OA 4KHQA 3UKUB 1HYVA 4FWRA 1NK6A 1S1WA 2BUPA 2JGUA 1UOCA 3VEYA 2ZGZA 2QI2A 4NYNA 5HRPA 5I3UA 3O08A 1BDGA 2VGMA 4K8XA 3AO3A 2FSJA 4BRIA 4FPBA 1RT1A 3SAFA 4CJLA 1Y97A 5E41A 2RHKA 2FBYA 1C1AA 4OLBA 3CXCM 4LF9K 4RW8A 1GOBA 3N4PA 4WYBA 1RGIA 3LAMA 2HHQA 1NGHA 3MMVA 1NGGA 4FLVA 1QSLA 1BQNA 3FZMA 3QEPA 1YHQN 1VK0A 2QWMA 4HUEA 2QM1A 3AVKA 3E9LA 1KQSM 2ZQBA 4IOXA 4BQZA 5AQTA 3C6TA 5J2PA 4DV4K 1TUYA 5AQWA 5GIPA 5FDLA 3RRHA 3HP9A 3RR7A 4FLYA 2HHUA 1RT6A 1TK8A 2FLOA 3TPQA 1JLCA 3A0IX 3SMPA 2ATQA 1VSMA 1EP4A 5ELZA 3MN9A 1IBKK 1QQCA 3UKRA 4BVOA 4JEPA 3AVGA 2HHXA 4NLCA 4JK7A 1ATNA 3L4IA 3MEDA 1RT3A 1T7PA 3KWGA 2GV9A 1T03A 2I5JA 4PKGA 4CJQA 1IBLK 3DLKA 1VSHA 2XY7A 2OA8A 3AVAA 2RPIA 3V9XA 1RDCA 3IAYA 3DLBA 4JD2A 5BPMA 3V4IA 1BG3A 3MEGA 3CETA 4FK2A 2QWQA 4H5TA 4M42A 1S1XA 2AP1A 3SPZA 1S6PA 1IG9A 1KCFA 3NHGA 4YOUA 3RMCA 4WE1A 4BE0A 4C8LA 5FLXO 4JKHA 3SAHA 4Y0WA 4YHHK 4FJMA 1VSIA 4ISFA 3I8DA 1QTMA 4CBWA 4FVMA 4CCHA 3DOLA 2WBNA 4BQLA 3LP2A 1Q82O 4C8NA 2QWLA 3NH0A 1VQ8N 2GX9A 1S9EA 1WAFA 1FK9A 4DSJA 4HCCA 4BG8A 4GVEA 2VQFK 4YFUA 4JS5A 2RE2A 2A6AA 2E4LA 2ZF5O 3S9HA 4FW2A 4CECA 3QEXA 1T6DA 2QKKA 2D0PA 2HMIA 5AR0A 2XO7A 1KLNA 4F2SA 2OPRA 3LDOA 1K8KA 4U7BA 2Z1IA 4DV6K 3KVGA 1XMQK 2P9UB 3K9KA 5SZTA 5LL6Z 1VQ7N 4DTOA 3ZSVA 2Q3SA 4JS4A 3SQ2A 4IG3A 1ZBLA 5AQKA 1JLEA 3CMAN 3DYAA 3H6EA 4CJ5A 1VHXA 3U4LA 2HF3A 3M1FA 4UQGA 4DU4A 1SKSA 4E1JA 3HT3A 1CZAN 3DXKA 3O4WA 3HM8A 4YDUC 1HX1A 2P9NB 2VYPA 2X74A 1XC3A 1L3TA 1KLMA 3HPOA 4EZ9A 3HXMA 4H4OA 1NK9A 3VQ4A 5EU7A 1QSYA 1WUAA 3MX5A 3TSUA 1HKCA 1R59O 4BREA 4BE2A 1CZ9A 5AZIB 3KLHA 1J9AA 4E7LA 2CGKA 5AZJA 3M8QA 3P4IA 4CD1A 4OLAA 1N34K 4N41A 4A57A 2YJFA 5C25A 4PL7A 2KZZA 1VQ6N 2O8DB 2W41A 3RTVA 1BA0A 4KHPK 3KK2A 4CJVA 4BE1A 4U67L 5JLFA 3NBPA 4HUGA 3SUPA 2O8CA 2ZD1A 1ATRA 4A62A 3K2PA 4QCLA 1GLJO 3U3YA 3I33A 2YHWA 3MAQA 2E2NA 2OTLN 2KW4A 4DTJA 1Q7YO 1Q81O 3AVLA 5HRRA 1HJRA 1NM1A 2KTQA 1IG8A 5JLHA 3AO2A 3CCEN 1IKVA 4DMNA 4NO7A 4DU3A 1RDBA 3NH2A 1LAWA 1LAVA 3PIOL 4FZYA 2FC0A 3CC4N 3T7ZA 1C0MA 2PYJA 3CCUN 3IS9A 4QS9A 2P9SA 1T44A 1I94K 3J8AA 1HYSA 4JKBA 3VERA 4E3SA 4ZHRA 3O9TA 3W3DA 1C0GA 2PY5A 4J2DA 4FOIA 2DPNA 1JCEA 3CD6N 2BDPA 4DSKA 3SPYA 3L2UA 1NGIA 2UXCK 1P90A 3QICA 5EVZA 3FZHA 4JK8A 5JVHL 3SV3A 3VOVA 2YKMA 2BANA 3W0LA 5BN8A 3SYZA 2P9KB 5C12A 2Q31A 3ID8A 1LV5A 2HVIA 3SBTA 2YNGA 3UB5A 4IDKA 3QB0A 3SJHA 5J1EA 1HQUA 3D0PA 3M8PA 5LMNK 4FZZA 3DRSA 3K5MA 2ITMA 3AVMA 4EHTA 4B9NA 3J7ZO 5FRNA 4YY3K 1DTQA 2VGNA 3LP1A 3BEXA 2IC3A 2D0AA 2ZJQL 4LFBK 5AQVA 1KSPA 4B9MA 1XUPO 3AAPA 4CIFA 2D1KA 5BN9A 4B1XB 4GV3A 4E1MA 2YNFA 3SLCA 3KZBA 1TK0A 1WLJA 1D9DA 4IWVA 1FXXA 2E20A 4NB4A 3KHYA 3OS1A 4CZHA 2ASPA 1Q9YA 1VQNN 4CVNE 2BGGA 3J80O 1QZ6A 2WFBA 1EKEA 3ZX2A 5AFUA 1KVBA 4CK1A 4C8OA 1SUQA 3M8RA 4CFDA 4B3OA 4IXCA 4FJ8A 4X62K 1ASVA 3T3FA 3JXUA 3RWUA 1B9FA 3DJCA 2F96A 3ZSQA 5GADP 1MA9B 3LDLA 4K8ZA 3O1WA 1TKXA 2D0CA 1EQYA 4IFVA 1RBSA 3H45C 4BWMA 2IIRA 5T7BA 4LF7K 4Z4HA 1VAZA 2YHXA 3B6PA 4DFPA 3G10A 3LALA 3QIPA 3KLGA 3MN6A 2E8AA 3O9RA 3P5JA 4H5VA 3DLHA 3CMEN 4BG9A 3O9UA 2OPQA 4YOTA 4YOWA 4KH4A 5CY4A 5C2FA 1HMVA 3SI6A 1TKDA 4ZTFA 3ZETA 1BL3A 4M63C 3CQ8A 2YV0X 2NRHA 4DCHA 4KPYA 4UY8O 3H1QA 5JS2A 1RBRA 3H46O 2HNZA 3FR0A 1Z6RA 1K73O 4C1NI 3LZIA
chains in the Genus database with same CATH topology
3OYIA 4I2PA 4KHYA 2EX3A 4CJTA 1HQEA 5HLFA 4N47A 3AVFA 4IG0A 1XWLA 4CHNA 4KB1A 1Z26A 3SQ1A 4M3ZA 5SWMA 2Z1HA 3OY9A 1NK8A 4O5BA 3DLRA 5I42A 2HHWA 1EETA 4DQPA 3I0RA 3SUOA 4CEAA 4FK0A 3V9ZA 3SUNA 1JLBA 3OJSA 4DWIA 2RN2A 3G0ZA 3HK2A 1BI4A 5KRSA 3K5OA 3KK3A 1KRPA 2VWKA 3NH1A 1FKOA 1J54A 4DFMA 1L3VA 2Y1IA 3QINA 3QO9A 3OYHA 3K5NA 2G8FA 1IH7A 3ZSRA 1SV5A 4E7HA 4W5OA 5HP1A 4ZTJA 3ZSXA 1TKTA 2OPSA 4DLEA 3K5LA 2YNIA 4HVJA 4BDZA 1G15A 3IG1A 1SKWA 4NCAA 1RTJA 4RG8A 2HHVA 4I9QA 3WNEA 5KGWA 4HTUA 2IOCA 1UAXA 1UA0A 4E19A 3K57A 3CG7A 1O1WA 3NF8A 4DTMA 4KHQA 1L3SA 1HNIA 3E01A 3TAMA 4DFKA 1HYVA 3ZCMA 1NK6A 3DLGA 1S1WA 3AVNA 4N5SA 2JGUA 1UOCA 3NGZA 4NYNA 3BGRA 3T19A 2RF2A 3ZSZA 5HRPA 3OYNA 3ZT2A 1C1CA 5I3UA 1SL2A 3AO3A 4K8XA 3SUQA 1YTUA 1W9HA 3O3FA 5D3GA 4Y1CA 4DS5A 4FLUA 4ELTA 3OS0A 1RT1A 4DFJA 3S3MA 4GVMA 4CJLA 4W5QA 1Y97A 1IKXA 3JSMA 5E41A 1NJWA 2FBYA 1C1AA 3C94A 3ZSYA 4BWJA 1KTQA 1NOYA 4OLBA 1ZBHA 1Q8IA 4CF8A 1JKHA 2FBVA 4CGHA 1S1UA 1GOBA 3AA3A 4NCGA 4RW8A 4R5PA 4E7KA 2KFZA 3VQBA 3SQ0A 2O4GA 3LAMA 1NK4A 1QSLA 1TV6A 4FJHA 3NDKA 4FLVA 1BQNA 3OYAA 1EXQA 3AO4A 4B9TA 1J5OA 1S1TA 1D9FA 3NF9A 4CGGA 4GMJB 4DTUA 3QEPA 1VK0A 1ZBFA 4HUEA 3AVKA 4FJNA 2IDOA 1X1PA 5KGXA 2ZQBA 1C0UA 4J2AA 3C6UA 2P1JA 3C6TA 1TVRA 3D45A 3NE6A 5J2PA 2JLEA 3TABA 1RCHA 4CIGA 1KFSA 2NUBA 4E7JA 3ISNC 1X9WA 4DQSA 4NCBA 1CLQA 2QK9A 1N5YA 3HVTA 5FDLA 2EHGA 1HYZA 1WSEA 3RRHA 4KRFA 3HP9A 3LZJA 4FLYA 3RR7A 2HHUA 3L8BA 1RT6A 1TK8A 3NGYA 1BCMA 3OYKA 4RW6A 1JLCA 3DRRA 1RT7A 1Z25A 4DQRA 2IS3A 4CERA 2G8WA 2PZSA 3LANA 3EZ5A 5J2QA 4CFAA 3TARA 1TGOA 3KTQA 2ATQA 2XHBA 4DQQA 1VSMA 4CJEA 3RR8A 4KI4A 1EP4A 1JXEA 3KK1A 2F8SA 2G8UA 3V6DA 2G8KA 1QQCA 4AILC 1BQMA 1U45A 1RBVA 2PYLA 3VQCA 3AVGA 2HHXA 1BISA 4ELVA 4FYDA 3QESA 2G8IA 2Z1GA 3MEDA 1RT3A 3LP3A 4I9LA 1RT2A 1XHXA 3LWMA 1T7PA 2GV9A 3HJFA 3MECA 2I5JA 1T03A 4CJQA 3DLKA 4GW6A 1VSHA 4DF4A 1NK0A 3RMAA 3TAQA 2XY7A 1TAUA 1D8YA 2FBXA 5CYQA 2OZMA 3KD5E 2OA8A 4RW7A 3AVAA 3HO1A 2RPIA 4AHSA 4AHRA 3V9XA 4CEDA 1VSKA 1RDCA 3IAYA 2HHTA 3KLIA 1JLGA 3DLBA 4M3WA 3THVA 3OYJA 4KREA 3B6OA 3LAKA 3NF6A 3V4IA 1BIZA 1UWBA 1UA1A 5CZ2A 4IFYA 4Z4FA 4NYFA 4CEFA 3MEGA 5KRTA 2ETJA 4FCYA 4B8AB 4CK2A 4FK2A 3HM9A 4CF1A 4M42A 1S1XA 4KHSA 4M3TA 4KAZA 3SPZA 1W0HA 4B08A 3DI6A 4LD0A 4AHCA 1RT5A 3AVCA 4OPKA 1X9MA 3AA5X 2G8VA 3HVRA 1NKCA 4EP4A 3P1GA 3TI0A 3OYEA 3AVJA 1S6PA 1IG9A 4J2BA 4Q5VA 1FKPA 1KCFA 2B6AA 3ITHA 1YT3A 4CF0A 3L2WA 4W5RA 3NHGA 3QETA 4JRPA 4WE1A 3RMCA 4BE0A 4C8LA 2YKNA 3FFIA 1XHZA 3CM6A 4AH9A 4DTXA 3PX4A 3LZIA 4FJ5A 4FJMA 4OGCA 1K6YA 2BE2A 2GUIA 3VQ7A 1S5JA 1TKZA 1VSIA 1WNSA 2ITGA 3ZSOA 3I8DA 3V81A 1SL1A 1RDDA 3IRXA 2KZMA 1QTMA 4FJLA 4FVMA 4CCHA 4B9VA 1RTHA 3DOLA 3PV8A 3LP2A 5KI6A 4C8NA 3NH0A 4ID1A 3NF7A 1S9EA 1WAFA 4YNQA 1FK9A 4LH5A 3VQ6A 2R7YA 3QNNA 3KLEA 3PX6A 4DSJA 4HCCA 2HHQA 4YFUA 4FW1A 4DQIA 4J2EA 5K14A 4CEZA 4JS5A 2E4LA 1U04A 3S9HA 1C6VA 3AVHA 4FM0A 4FW2A 4CECA 1WAJA 4CJWA 4W5TA 3QEXA 1ZBUA 3L3VA 4CJPA 2HMIA 4H8KA 3K58A 4CFCA 3QIOA 2XO7A 2QKKA 4FJGA 5HRSA 1KLNA 4F2SA 3PUFA 2OPRA 4JRQA 2B5JA 1HRHA 2Z1IA 1VSEA 1VSJA 4DSLA 3AVIA 1QHTA 2HNYA 3U6FA 5SZTA 2X6NA 3EY1A 1SL0A 1GOCA 4CEQA 4DTOA 3ZSVA 2Q3SA 5C24A 4B9LA 4HCBA 2HHSA 4CGDA 1KFDA 2P51A 4FLZA 3PO4A 1S1VA 3KIOA 1D5AA 4JS4A 3SQ2A 1TAQA 4CGFA 4IG3A 3OYDA 1ZBLA 1SKRA 3HP6A 4M45A 5DK5A 4FLXA 1JLEA 1KVAA 4ID5A 4FJIA 2KFNA 2OYQA 2OPPA 1J53A 3VN5A 3KLFA 3M8SA 2HW3A 3DYAA 3S3NA 3VQDA 1CZBA 1JLAA 1WSHA 4CJ5A 2A1SA 4CJ4A 4EP5A 1T8EA 4LH4A 4I7FA 4DLGA 4KTZA 4OKJA 1ASUA 1RBTA 4DU4A 4UQGA 1A5VA 1IKYA 1CXUA 1SKSA 3F9KA 1ZYQA 3HT3A 4KI6A 1NKEA 2X74A 2P5OA 1L3TA 1KLMA 3HPOA 4EZ9A 2F8TA 1YVUA 1BIUA 3HPGA 3AA4A 3HXMA 4F3OA 4H4OA 1HPZA 1NK9A 3VQ4A 4EZ6A 3OYCA 1JLFA 4CJSA 4BACA 4DF8A 1R0AA 5EU7A 3VQ9A 2X6SA 1QSYA 4KHUA 2A1RA 1QSSA 1BCOA 4BE2A 2DFFA 1CZ9A 3ZSWA 4B8CA 3KLHA 4CHPA 4E1NA 1J9AA 4E7LA 2W42A 4CHOA 4FK4A 3M8QA 4N56A 4OLAA 4FJKA 2Z1JA 1C0TA 4OKEA 3RRGA 4B9UA 4DG1A 4N41A 3O4QA 1S9GA 5HBMA 3AV9A 3VQAA 3OYBA 5C25A 2IAJA 5FRMA 1RTIA 4HHTA 2KZZA 2B4JA 4KO0A 3RTVA 1U4BA 3F73A 3VQ5A 3O3HA 1RBUA 4TSXA 4OGEA 1WN7A 3DRPA 4CJVA 3KK2A 1NKBA 4PY5A 1ASWA 4BE1A 4DTRA 3SUPA 3NBPA 4HUGA 2IGIA 4HUFA 2VG5A 2ZD1A 3P83D 3O3GA 3L2QA 1DLOA 3QEIA 1U48A 3K2PA 1BHLA 4QCLA 4IKFA 5C42A 2QKBA 1LWFA 3WNGA 1LW2A 3U3YA 3SQ4A 4O4GA 5FROA 4OPJA 3TAFA 2YHAA 4F2RA 2LSNA 3KKSA 4CESA 4Z4CA 3CFRA 4FLWA 4O55A 3MAQA 4Z4GA 1CXQA 4PWDA 4QOZB 2KW4A 4DTJA 1C1BA 4FJ7A 3ZT3A 2FBTA 1X9SA 3EYZA 1KVCA 4BDYA 4CJKA 3OYLA 3AVLA 3SZ2A 1A5XA 3QERA 3JYTA 5HRRA 1RILA 1HJRA 2KTQA 1RT4A 4CEEA 3AO2A 1IKVA 4DMNA 2QXFA 3NFAA 4OVLA 4XIUA 4DU3A 4CJ3A 3AO1A 1RDBA 3MXJA 4RW9A 1LAWA 3NH2A 4DTPA 1NJYA 4B9SA 1LAVA 4CIEA 4CHYA 3NCIA 3OYMA 4FZYA 1NOZA 3LP0A 2FC0A 2O4IA 1C0MA 3SCXA 2PYJA 3IS9A 5KTQA 3V9WA 3MXMA 1U47A 1LW0A 3CFOA 4C8KA 1Q9XA 4FZXC 1ZBIA 5J2NA 1HYSA 1TL1A 4CF2A 5HRNA 3OVNA 3U3GA 4E3SA 4PA1A 1GOAA 3VQEA 1B9DA 2YNHA 3V1RA 4ZHRA 4LSNA 1A5WA 1NK7A 3TR8A 3HL8A 1S6QA 3KKRA 4OJRA 2VG7A 2Y1JA 3PX0A 2PY5A 4DSIA 4J2DA 2VG6A 4BDPA 1TL3A 2RKIA 2BDPA 4DSKA 3SPYA 1VSLA 3L2UA 4E0DA 4L8RB 2X78A 4OKKA 4M3XA 4O0JA 1NK5A 1IO2A 4M3UA 3SV3A 4DTSA 3QLHA 2YKMA 3C95A 4CHQA 4CK3A 2BANA 4Y1DA 3A2FA 2HVHA 5JS1A 2WOMA 1JL1A 1VSFA 4LSLA 4CJUA 3SYZA 4FXDA 3VQPA 4H4MA 4F4KA 3WNFA 3HYFA 3WNHA 1LV5A 1BGXT 4Z4EA 1RTDA 2HVIA 3ULDA 3CM5A 3TANA 4O0IA 2YNGA 3ZT0A 4Z0UA 3V9UA 4IDKA 3S3OA 5J2MA 3NAEA 1WSFA 3SJJA 3H08A 3LPTA 3MEEA 5J1EA 1HQUA 3OYFA 4KB0A 2OZSA 1TK5A 3D0PA 1YTAA 4Q0BA 3M8PA 4CF9A 4FZZA 3DRSA 3K5MA 2AJQA 3SNNA 1VRTA 4MQ3A 2VWJA 2D5RA 2DTUA 4E7IA 4CJFA 3AVMA 3OS2A 4B9NA 4PQUA 4M3YA 5FRNA 1I3AA 1DTQA 2GBZA 3TAPA 3LP1A 2XY6A 2IC3A 3OJUA 4Z4IA 2D0AA 2G8HA 1L5UA 3ASMA 4CEBA 3QEWA 1I39A 1LWEA 1VSDA 4KKOA 3OYGA 3CFPA 3QNOA 1JL2A 3TAGA 3MXIA 1KSPA 3DLEA 2XY8A 3DOKA 4B9MA 4ICLA 4CIFA 4FM1A 1JXBA 1NJXA 4KTWA 1N6QA 4E1MA 1HNVA 4PUOA 4AHVA 2YNFA 4MFBA 4FJ9A 3RMBA 1TK0A 1ITGA 3VQ8A 1WLJA 3TAEA 1D9DA 3L2RA 1BI4B 4F8RA 1FXXA 1LWCA 4FM2A 3BDPA 3L3UA 4KHWA 3ZT4A 4KTQA 1B92A 3CYMA 1NJZA 3VQQA 3OS1A 4M41A 1EX4A 3I0SA 3LDSA 2ZE2A 1IKWA 4DSEA 1Q9YA 2BGGA 2YHBA 4DS4A 2DY4A 1EKEA 1KVBA 4CK1A 4DSFA 4C8OA 4W5NA 1SUQA 4KV8A 1F21A 4CEOA 3M8RA 3SV4A 3T1AA 4CFDA 3VA0A 4B3OA 3UIQA 4FJ8A 3TWHA 3KD1E 1ASVA 3T3FA 1MU2A 2DFHA 5CZ1A 4CGJA 3RWUA 1B9FA 1RDAA 2F96A 3ZSQA 1L3UA 2XY5A 4O44A 2E6MA 1WSJA 2WONA 4AHUA 4AHTA 4DU1A 4IFVA 1TKXA 2D0CA 3QEVA 4K8ZA 1RBSA 4BWMA 1XI1A 3VA3A 4KHNA 5T7BA 1REVA 4C8MA 3KJVA 3ZT1A 3V1QA 2HNDA 1JLQA 4Z4HA 1VRUA 3B6PA 3HSTB 4G1QA 4RW4A 4ELUA 4DFPA 1QS4A 3G10A 3LALA 3QIPA 3KLGA 3L2VA 2XRIA 5DMRA 3P5JA 3DLHA 3NGIA 3DM2A 4CGIA 4JLHA 4IBNA 4DTNA 3AVBA 3AO5A 2OPQA 1WSIA 3HPHA 3LPUA 4CFBA 3RMDA 4FJXA 3DMJA 5CY4A 2E6LA 3V9SA 5CYMA 2KQ2A 1HMVA 1DTTA 1QE1A 4LY7A 3SI6A 1XC9A 1TKDA 4F3TA 4ZTFA 1BL3A 3LWLA 3CQ8A 1U49A 1T05A 3ALYA 2YV0X 4CE9A 2P5GA 2HB5A 5HROA 4M3RA 4CJRA 4QAGA 3AA2A 4KPYA 4I2QA 4E89A 3PY8A 3V1OA 2D0BA 5JS2A 1RBRA 3PO5A 2DFEA 4FLTA 2HNZA 4KFBA 3K59A 4CHZA 1RNHA 4FJJA 3O4NA 1WSGA 4N76A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OYI A;  4I2P A;  4KHY A;  2EX3 A;  4CJT A;  1HQE A;  5HLF A;  4N47 A;  3AVF A;  4IG0 A;  1XWL A;  4CHN A;  4KB1 A;  1Z26 A;  3SQ1 A;  4M3Z A;  5SWM A;  2Z1H A;  3OY9 A;  1NK8 A;  4O5B A;  3DLR A;  5I42 A;  2HHW A;  1EET A;  4DQP A;  3I0R A;  3SUO A;  4CEA A;  4FK0 A;  3V9Z A;  3SUN A;  1JLB A;  3OJS A;  4DWI A;  2RN2 A;  3G0Z A;  3HK2 A;  1BI4 A;  5KRS A;  3K5O A;  3KK3 A;  1KRP A;  2VWK A;  3NH1 A;  1FKO A;  1J54 A;  4DFM A;  1L3V A;  2Y1I A;  3QIN A;  3QO9 A;  3OYH A;  3K5N A;  2G8F A;  1IH7 A;  3ZSR A;  1SV5 A;  4E7H A;  4W5O A;  5HP1 A;  4ZTJ A;  3ZSX A;  1TKT A;  2OPS A;  4DLE A;  3K5L A;  2YNI A;  4HVJ A;  4BDZ A;  1G15 A;  3IG1 A;  1SKW A;  4NCA A;  1RTJ A;  4RG8 A;  2HHV A;  4I9Q A;  3WNE A;  5KGW A;  4HTU A;  2IOC A;  1UAX A;  1UA0 A;  4E19 A;  3K57 A;  3CG7 A;  1O1W A;  3NF8 A;  4DTM A;  4KHQ A;  1L3S A;  1HNI A;  3E01 A;  3TAM A;  4DFK A;  1HYV A;  3ZCM A;  1NK6 A;  3DLG A;  1S1W A;  3AVN A;  4N5S A;  2JGU A;  1UOC A;  3NGZ A;  4NYN A;  3BGR A;  3T19 A;  2RF2 A;  3ZSZ A;  5HRP A;  3OYN A;  3ZT2 A;  1C1C A;  5I3U A;  1SL2 A;  3AO3 A;  4K8X A;  3SUQ A;  1YTU A;  1W9H A;  3O3F A;  5D3G A;  4Y1C A;  4DS5 A;  4FLU A;  4ELT A;  3OS0 A;  1RT1 A;  4DFJ A;  3S3M A;  4GVM A;  4CJL A;  4W5Q A;  1Y97 A;  1IKX A;  3JSM A;  5E41 A;  1NJW A;  2FBY A;  1C1A A;  3C94 A;  3ZSY A;  4BWJ A;  1KTQ A;  1NOY A;  4OLB A;  1ZBH A;  1Q8I A;  4CF8 A;  1JKH A;  2FBV A;  4CGH A;  1S1U A;  1GOB A;  3AA3 A;  4NCG A;  4RW8 A;  4R5P A;  4E7K A;  2KFZ A;  3VQB A;  3SQ0 A;  2O4G A;  3LAM A;  1NK4 A;  1QSL A;  1TV6 A;  4FJH A;  3NDK A;  4FLV A;  1BQN A;  3OYA A;  1EXQ A;  3AO4 A;  4B9T A;  1J5O A;  1S1T A;  1D9F A;  3NF9 A;  4CGG A;  4GMJ B;  4DTU A;  3QEP A;  1VK0 A;  1ZBF A;  4HUE A;  3AVK A;  4FJN A;  2IDO A;  1X1P A;  5KGX A;  2ZQB A;  1C0U A;  4J2A A;  3C6U A;  2P1J A;  3C6T A;  1TVR A;  3D45 A;  3NE6 A;  5J2P A;  2JLE A;  3TAB A;  1RCH A;  4CIG A;  1KFS A;  2NUB A;  4E7J A;  3ISN C;  1X9W A;  4DQS A;  4NCB A;  1CLQ A;  2QK9 A;  1N5Y A;  3HVT A;  5FDL A;  2EHG A;  1HYZ A;  1WSE A;  3RRH A;  4KRF A;  3HP9 A;  3LZJ A;  4FLY A;  3RR7 A;  2HHU A;  3L8B A;  1RT6 A;  1TK8 A;  3NGY A;  1BCM A;  3OYK A;  4RW6 A;  1JLC A;  3DRR A;  1RT7 A;  1Z25 A;  4DQR A;  2IS3 A;  4CER A;  2G8W A;  2PZS A;  3LAN A;  3EZ5 A;  5J2Q A;  4CFA A;  3TAR A;  1TGO A;  3KTQ A;  2ATQ A;  2XHB A;  4DQQ A;  1VSM A;  4CJE A;  3RR8 A;  4KI4 A;  1EP4 A;  1JXE A;  3KK1 A;  2F8S A;  2G8U A;  3V6D A;  2G8K A;  1QQC A;  4AIL C;  1BQM A;  1U45 A;  1RBV A;  2PYL A;  3VQC A;  3AVG A;  2HHX A;  1BIS A;  4ELV A;  4FYD A;  3QES A;  2G8I A;  2Z1G A;  3MED A;  1RT3 A;  3LP3 A;  4I9L A;  1RT2 A;  1XHX A;  3LWM A;  1T7P A;  2GV9 A;  3HJF A;  3MEC A;  2I5J A;  1T03 A;  4CJQ A;  3DLK A;  4GW6 A;  1VSH A;  4DF4 A;  1NK0 A;  3RMA A;  3TAQ A;  2XY7 A;  1TAU A;  1D8Y A;  2FBX A;  5CYQ A;  2OZM A;  3KD5 E;  2OA8 A;  4RW7 A;  3AVA A;  3HO1 A;  2RPI A;  4AHS A;  4AHR A;  3V9X A;  4CED A;  1VSK A;  1RDC A;  3IAY A;  2HHT A;  3KLI A;  1JLG A;  3DLB A;  4M3W A;  3THV A;  3OYJ A;  4KRE A;  3B6O A;  3LAK A;  3NF6 A;  3V4I A;  1BIZ A;  1UWB A;  1UA1 A;  5CZ2 A;  4IFY A;  4Z4F A;  4NYF A;  4CEF A;  3MEG A;  5KRT A;  2ETJ A;  4FCY A;  4B8A B;  4CK2 A;  4FK2 A;  3HM9 A;  4CF1 A;  4M42 A;  1S1X A;  4KHS A;  4M3T A;  4KAZ A;  3SPZ A;  1W0H A;  4B08 A;  3DI6 A;  4LD0 A;  4AHC A;  1RT5 A;  3AVC A;  4OPK A;  1X9M A;  3AA5 X;  2G8V A;  3HVR A;  1NKC A;  4EP4 A;  3P1G A;  3TI0 A;  3OYE A;  3AVJ A;  1S6P A;  1IG9 A;  4J2B A;  4Q5V A;  1FKP A;  1KCF A;  2B6A A;  3ITH A;  1YT3 A;  4CF0 A;  3L2W A;  4W5R A;  3NHG A;  3QET A;  4JRP A;  4WE1 A;  3RMC A;  4BE0 A;  4C8L A;  2YKN A;  3FFI A;  1XHZ A;  3CM6 A;  4AH9 A;  4DTX A;  3PX4 A;  3LZI A;  4FJ5 A;  4FJM A;  4OGC A;  1K6Y A;  2BE2 A;  2GUI A;  3VQ7 A;  1S5J A;  1TKZ A;  1VSI A;  1WNS A;  2ITG A;  3ZSO A;  3I8D A;  3V81 A;  1SL1 A;  1RDD A;  3IRX A;  2KZM A;  1QTM A;  4FJL A;  4FVM A;  4CCH A;  4B9V A;  1RTH A;  3DOL A;  3PV8 A;  3LP2 A;  5KI6 A;  4C8N A;  3NH0 A;  4ID1 A;  3NF7 A;  1S9E A;  1WAF A;  4YNQ A;  1FK9 A;  4LH5 A;  3VQ6 A;  2R7Y A;  3QNN A;  3KLE A;  3PX6 A;  4DSJ A;  4HCC A;  2HHQ A;  4YFU A;  4FW1 A;  4DQI A;  4J2E A;  5K14 A;  4CEZ A;  4JS5 A;  2E4L A;  1U04 A;  3S9H A;  1C6V A;  3AVH A;  4FM0 A;  4FW2 A;  4CEC A;  1WAJ A;  4CJW A;  4W5T A;  3QEX A;  1ZBU A;  3L3V A;  4CJP A;  2HMI A;  4H8K A;  3K58 A;  4CFC A;  3QIO A;  2XO7 A;  2QKK A;  4FJG A;  5HRS A;  1KLN A;  4F2S A;  3PUF A;  2OPR A;  4JRQ A;  2B5J A;  1HRH A;  2Z1I A;  1VSE A;  1VSJ A;  4DSL A;  3AVI A;  1QHT A;  2HNY A;  3U6F A;  5SZT A;  2X6N A;  3EY1 A;  1SL0 A;  1GOC A;  4CEQ A;  4DTO A;  3ZSV A;  2Q3S A;  5C24 A;  4B9L A;  4HCB A;  2HHS A;  4CGD A;  1KFD A;  2P51 A;  4FLZ A;  3PO4 A;  1S1V A;  3KIO A;  1D5A A;  4JS4 A;  3SQ2 A;  1TAQ A;  4CGF A;  4IG3 A;  3OYD A;  1ZBL A;  1SKR A;  3HP6 A;  4M45 A;  5DK5 A;  4FLX A;  1JLE A;  1KVA A;  4ID5 A;  4FJI A;  2KFN A;  2OYQ A;  2OPP A;  1J53 A;  3VN5 A;  3KLF A;  3M8S A;  2HW3 A;  3DYA A;  3S3N A;  3VQD A;  1CZB A;  1JLA A;  1WSH A;  4CJ5 A;  2A1S A;  4CJ4 A;  4EP5 A;  1T8E A;  4LH4 A;  4I7F A;  4DLG A;  4KTZ A;  4OKJ A;  1ASU A;  1RBT A;  4DU4 A;  4UQG A;  1A5V A;  1IKY A;  1CXU A;  1SKS A;  3F9K A;  1ZYQ A;  3HT3 A;  4KI6 A;  1NKE A;  2X74 A;  2P5O A;  1L3T A;  1KLM A;  3HPO A;  4EZ9 A;  2F8T A;  1YVU A;  1BIU A;  3HPG A;  3AA4 A;  3HXM A;  4F3O A;  4H4O A;  1HPZ A;  1NK9 A;  3VQ4 A;  4EZ6 A;  3OYC A;  1JLF A;  4CJS A;  4BAC A;  4DF8 A;  1R0A A;  5EU7 A;  3VQ9 A;  2X6S A;  1QSY A;  4KHU A;  2A1R A;  1QSS A;  1BCO A;  4BE2 A;  2DFF A;  1CZ9 A;  3ZSW A;  4B8C A;  3KLH A;  4CHP A;  4E1N A;  1J9A A;  4E7L A;  2W42 A;  4CHO A;  4FK4 A;  3M8Q A;  4N56 A;  4OLA A;  4FJK A;  2Z1J A;  1C0T A;  4OKE A;  3RRG A;  4B9U A;  4DG1 A;  4N41 A;  3O4Q A;  1S9G A;  5HBM A;  3AV9 A;  3VQA A;  3OYB A;  5C25 A;  2IAJ A;  5FRM A;  1RTI A;  4HHT A;  2KZZ A;  2B4J A;  4KO0 A;  3RTV A;  1U4B A;  3F73 A;  3VQ5 A;  3O3H A;  1RBU A;  4TSX A;  4OGE A;  1WN7 A;  3DRP A;  4CJV A;  3KK2 A;  1NKB A;  4PY5 A;  1ASW A;  4BE1 A;  4DTR A;  3SUP A;  3NBP A;  4HUG A;  2IGI A;  4HUF A;  2VG5 A;  2ZD1 A;  3P83 D;  3O3G A;  3L2Q A;  1DLO A;  3QEI A;  1U48 A;  3K2P A;  1BHL A;  4QCL A;  4IKF A;  5C42 A;  2QKB A;  1LWF A;  3WNG A;  1LW2 A;  3U3Y A;  3SQ4 A;  4O4G A;  5FRO A;  4OPJ A;  3TAF A;  2YHA A;  4F2R A;  2LSN A;  3KKS A;  4CES A;  4Z4C A;  3CFR A;  4FLW A;  4O55 A;  3MAQ A;  4Z4G A;  1CXQ A;  4PWD A;  4QOZ B;  2KW4 A;  4DTJ A;  1C1B A;  4FJ7 A;  3ZT3 A;  2FBT A;  1X9S A;  3EYZ A;  1KVC A;  4BDY A;  4CJK A;  3OYL A;  3AVL A;  3SZ2 A;  1A5X A;  3QER A;  3JYT A;  5HRR A;  1RIL A;  1HJR A;  2KTQ A;  1RT4 A;  4CEE A;  3AO2 A;  1IKV A;  4DMN A;  2QXF A;  3NFA A;  4OVL A;  4XIU A;  4DU3 A;  4CJ3 A;  3AO1 A;  1RDB A;  3MXJ A;  4RW9 A;  1LAW A;  3NH2 A;  4DTP A;  1NJY A;  4B9S A;  1LAV A;  4CIE A;  4CHY A;  3NCI A;  3OYM A;  4FZY A;  1NOZ A;  3LP0 A;  2FC0 A;  2O4I A;  1C0M A;  3SCX A;  2PYJ A;  3IS9 A;  5KTQ A;  3V9W A;  3MXM A;  1U47 A;  1LW0 A;  3CFO A;  4C8K A;  1Q9X A;  4FZX C;  1ZBI A;  5J2N A;  1HYS A;  1TL1 A;  4CF2 A;  5HRN A;  3OVN A;  3U3G A;  4E3S A;  4PA1 A;  1GOA A;  3VQE A;  1B9D A;  2YNH A;  3V1R A;  4ZHR A;  4LSN A;  1A5W A;  1NK7 A;  3TR8 A;  3HL8 A;  1S6Q A;  3KKR A;  4OJR A;  2VG7 A;  2Y1J A;  3PX0 A;  2PY5 A;  4DSI A;  4J2D A;  2VG6 A;  4BDP A;  1TL3 A;  2RKI A;  2BDP A;  4DSK A;  3SPY A;  1VSL A;  3L2U A;  4E0D A;  4L8R B;  2X78 A;  4OKK A;  4M3X A;  4O0J A;  1NK5 A;  1IO2 A;  4M3U A;  3SV3 A;  4DTS A;  3QLH A;  2YKM A;  3C95 A;  4CHQ A;  4CK3 A;  2BAN A;  4Y1D A;  3A2F A;  2HVH A;  5JS1 A;  2WOM A;  1JL1 A;  1VSF A;  4LSL A;  4CJU A;  3SYZ A;  4FXD A;  3VQP A;  4H4M A;  4F4K A;  3WNF A;  3HYF A;  3WNH A;  1LV5 A;  1BGX T;  4Z4E A;  1RTD A;  2HVI A;  3ULD A;  3CM5 A;  3TAN A;  4O0I A;  2YNG A;  3ZT0 A;  4Z0U A;  3V9U A;  4IDK A;  3S3O A;  5J2M A;  3NAE A;  1WSF A;  3SJJ A;  3H08 A;  3LPT A;  3MEE A;  5J1E A;  1HQU A;  3OYF A;  4KB0 A;  2OZS A;  1TK5 A;  3D0P A;  1YTA A;  4Q0B A;  3M8P A;  4CF9 A;  4FZZ A;  3DRS A;  3K5M A;  2AJQ A;  3SNN A;  1VRT A;  4MQ3 A;  2VWJ A;  2D5R A;  2DTU A;  4E7I A;  4CJF A;  3AVM A;  3OS2 A;  4B9N A;  4PQU A;  4M3Y A;  5FRN A;  1I3A A;  1DTQ A;  2GBZ A;  3TAP A;  3LP1 A;  2XY6 A;  2IC3 A;  3OJU A;  4Z4I A;  2D0A A;  2G8H A;  1L5U A;  3ASM A;  4CEB A;  3QEW A;  1I39 A;  1LWE A;  1VSD A;  4KKO A;  3OYG A;  3CFP A;  3QNO A;  1JL2 A;  3TAG A;  3MXI A;  1KSP A;  3DLE A;  2XY8 A;  3DOK A;  4B9M A;  4ICL A;  4CIF A;  4FM1 A;  1JXB A;  1NJX A;  4KTW A;  1N6Q A;  4E1M A;  1HNV A;  4PUO A;  4AHV A;  2YNF A;  4MFB A;  4FJ9 A;  3RMB A;  1TK0 A;  1ITG A;  3VQ8 A;  1WLJ A;  3TAE A;  1D9D A;  3L2R A;  1BI4 B;  4F8R A;  1FXX A;  1LWC A;  4FM2 A;  3BDP A;  3L3U A;  4KHW A;  3ZT4 A;  4KTQ A;  1B92 A;  3CYM A;  1NJZ A;  3VQQ A;  3OS1 A;  4M41 A;  1EX4 A;  3I0S A;  3LDS A;  2ZE2 A;  1IKW A;  4DSE A;  1Q9Y A;  2BGG A;  2YHB A;  4DS4 A;  2DY4 A;  1EKE A;  1KVB A;  4CK1 A;  4DSF A;  4C8O A;  4W5N A;  1SUQ A;  4KV8 A;  1F21 A;  4CEO A;  3M8R A;  3SV4 A;  3T1A A;  4CFD A;  3VA0 A;  4B3O A;  3UIQ A;  4FJ8 A;  3TWH A;  3KD1 E;  1ASV A;  3T3F A;  1MU2 A;  2DFH A;  5CZ1 A;  4CGJ A;  3RWU A;  1B9F A;  1RDA A;  2F96 A;  3ZSQ A;  1L3U A;  2XY5 A;  4O44 A;  2E6M A;  1WSJ A;  2WON A;  4AHU A;  4AHT A;  4DU1 A;  4IFV A;  1TKX A;  2D0C A;  3QEV A;  4K8Z A;  1RBS A;  4BWM A;  1XI1 A;  3VA3 A;  4KHN A;  5T7B A;  1REV A;  4C8M A;  3KJV A;  3ZT1 A;  3V1Q A;  2HND A;  1JLQ A;  4Z4H A;  1VRU A;  3B6P A;  3HST B;  4G1Q A;  4RW4 A;  4ELU A;  4DFP A;  1QS4 A;  3G10 A;  3LAL A;  3QIP A;  3KLG A;  3L2V A;  2XRI A;  5DMR A;  3P5J A;  3DLH A;  3NGI A;  3DM2 A;  4CGI A;  4JLH A;  4IBN A;  4DTN A;  3AVB A;  3AO5 A;  2OPQ A;  1WSI A;  3HPH A;  3LPU A;  4CFB A;  3RMD A;  4FJX A;  3DMJ A;  5CY4 A;  2E6L A;  3V9S A;  5CYM A;  2KQ2 A;  1HMV A;  1DTT A;  1QE1 A;  4LY7 A;  3SI6 A;  1XC9 A;  1TKD A;  4F3T A;  4ZTF A;  1BL3 A;  3LWL A;  3CQ8 A;  1U49 A;  1T05 A;  3ALY A;  2YV0 X;  4CE9 A;  2P5G A;  2HB5 A;  5HRO A;  4M3R A;  4CJR A;  4QAG A;  3AA2 A;  4KPY A;  4I2Q A;  4E89 A;  3PY8 A;  3V1O A;  2D0B A;  5JS2 A;  1RBR A;  3PO5 A;  2DFE A;  4FLT A;  2HNZ A;  4KFB A;  3K59 A;  4CHZ A;  1RNH A;  4FJJ A;  3O4N A;  1WSG A;  4N76 A; 
#chains in the Genus database with same CATH topology
 4JKG A;  3OYI A;  1S3X A;  4KHY A;  4CJT A;  5HLF A;  4N47 A;  3AVF A;  1XWL A;  3SQ1 A;  5SWM A;  2Z1H A;  3ZEU A;  4LC9 B;  1GLC G;  3N4Q A;  3DLR A;  1OH5 A;  4JNE A;  1EET A;  4BRP A;  1XMO K;  2RN2 A;  4FWK A;  4CZJ A;  3TTD A;  3K5O A;  3KK3 A;  3UKR B;  4JK9 A;  4BRO A;  3CJB A;  3QIN A;  1S22 A;  3QO9 A;  4H0T B;  2ASO A;  3E9O A;  1NJI O;  3C7N A;  3QBW A;  4W5O A;  3DAW A;  2OPS A;  3CCL N;  4HVJ A;  1KAX A;  1RTJ A;  1C0F A;  3WNE A;  2IOC A;  1W2B M;  4JD2 B;  1QVG M;  4ILJ A;  3LM9 A;  3R1X A;  4MO5 A;  4DFK A;  5HL7 L;  3DLG A;  4JYA K;  3NGZ A;  3SUQ A;  1W9H A;  5CE3 A;  3U9Z A;  2FSN A;  1Z05 A;  4GVM A;  4W5Q A;  3ZSY A;  2GTD A;  1ZBH A;  1WBB A;  2FBV A;  3CCR N;  3FZL A;  4R5P A;  4E7K A;  2KFZ A;  3VQB A;  3NDK A;  3AO4 A;  2ZGY A;  2NRV A;  1J5O A;  2Q2R A;  4DTU A;  1X1P A;  4OPA A;  1YAG A;  1TVR A;  1OVY A;  3D45 A;  3TAB A;  4CIG A;  2ZJP L;  1BU6 O;  1X9W A;  3HI0 A;  4DB3 A;  1Q18 A;  3AAQ A;  3GL1 A;  2QK9 A;  3HVT A;  3U8X A;  3J81 O;  2EHG A;  3SAG A;  3CC7 N;  1HLU A;  4DQR A;  1KC8 O;  3LAN A;  1U6Z A;  1K8K B;  3AGR A;  3TAR A;  4LF4 K;  4KI4 A;  3V6D A;  2YHY A;  4MDA A;  2PYL A;  3VEZ A;  3NVK A;  2O8F A;  5C2D A;  3VQC A;  1NGA A;  4DR1 K;  3QES A;  2Z1G A;  3IUC A;  4I9L A;  1XHX A;  4LFA K;  4K0K K;  4EAH D;  3HJF A;  2UYT A;  3VF6 A;  1NK0 A;  3RMA A;  3TAQ A;  3OA9 A;  5AQL A;  2FBX A;  5CYQ A;  3KD5 E;  3HO1 A;  4AHS A;  2A40 A;  4CED A;  1VSK A;  2HHT A;  4M3W A;  2OCE A;  3OYJ A;  1ESV A;  3LAK A;  3NF6 A;  3DXK B;  4GV9 A;  5CZ2 A;  3G25 A;  4NYF A;  4CEF A;  4B8A B;  4CK2 A;  3L6Q A;  4B08 A;  3DI6 A;  1RT5 A;  3AVC A;  4A5B A;  3AA5 X;  1KAZ A;  4EP4 A;  3TI0 A;  2JWK A;  1H1V A;  5AZJ B;  4CF0 A;  3ITH A;  5AQR A;  2YKN A;  2E1Z A;  4AH9 A;  3EE9 A;  5BRH A;  3VQ7 A;  1S5J A;  1WNS A;  1SL1 A;  3FE1 A;  1RDD A;  2YI1 A;  2O8B A;  4FWP A;  4FJL A;  3PV8 A;  4DR7 K;  2O8C B;  3NF7 A;  2R7Y A;  3QNN A;  3KLE A;  3VTI A;  1P8Z A;  4FW1 A;  4DQI A;  4CZK A;  1C6V A;  2GWK A;  1WAJ A;  4CJW A;  1ZBU A;  4H8K A;  3K58 A;  3QIO A;  3C6A A;  2B5J A;  1HRH A;  4DSL A;  1VQK N;  2HNY A;  4BR2 A;  5GAG P;  2X6N A;  3I8B A;  2HHS A;  4H0P A;  5GIN A;  2P51 A;  4FLZ A;  1S1V A;  1TAQ A;  3VGM A;  4ID5 A;  4X64 K;  4FJI A;  2OPP A;  2PBD A;  4BR0 A;  2HW3 A;  2E88 A;  4BY9 C;  1WSH A;  3ZLJ A;  4DV2 K;  2A1S A;  2QEX N;  4IOC L;  4BR7 A;  4LH4 A;  2P9S B;  4I7F A;  4DLG A;  3ULE A;  5LY3 A;  3FZK A;  4A61 A;  1N8R O;  4ILH A;  3WXL A;  1ZYQ A;  4OX9 K;  1M90 O;  1YVU A;  3AA4 A;  3HOS A;  1HNX K;  4DF8 A;  1R0A A;  3VQ9 A;  2X6S A;  1HKG A;  1X3N A;  3ZSW A;  4JKF A;  4E1N A;  4CHO A;  4N56 A;  4MLH A;  4OKE A;  4B9U A;  3VQA A;  3OYB A;  1WOQ A;  5FRM A;  1RTI A;  4JV5 K;  1N32 K;  1O13 A;  4KO0 A;  4CBX A;  1U4B A;  2NRX A;  4OGE A;  4PY5 A;  5M1O A;  5AFU H;  4I9Q A;  1QQM A;  2VG5 A;  3J7Y P;  1G99 A;  1BHL A;  3M3Z A;  1OVQ A;  3WQT A;  5C42 A;  3WNG A;  3SQ4 A;  5FRO A;  4OPJ A;  3TAF A;  2GUP A;  4F2R A;  4CES A;  1FW6 A;  5JIC A;  5E26 A;  4H03 B;  4WQ5 C;  1CXQ A;  5GAH P;  4QOZ B;  3F2K A;  2A41 A;  1KVC A;  4BDY A;  4CJK A;  4BRN A;  3JYT A;  3ZX0 A;  1RT4 A;  4C1N K;  3U9D A;  4CJ3 A;  3MXJ A;  4DTP A;  5FPD A;  3A8Y A;  2JWL A;  4BC4 A;  4FOE A;  1M1K O;  1NGF A;  3F5T A;  3MXM A;  1LW0 A;  1Q9X A;  5J2N A;  3HRG A;  4CF2 A;  3OVN A;  3U3G A;  2YNH A;  5BR8 K;  3ZX3 A;  3HL8 A;  2BTF A;  2ASM A;  1S6Q A;  4OJR A;  4DSI A;  4BGB A;  1VQP N;  1TL3 A;  1VSL A;  4BRG A;  4E0D A;  4OKK A;  2P9L A;  2HBL A;  4M3U A;  4CHQ A;  3ENB A;  5JS1 A;  4LSL A;  3Q7B A;  4F4K A;  3HYF A;  4K41 A;  1BGX T;  3ULD A;  3CM5 A;  4IJN A;  3QDK A;  3D2F A;  3ZET B;  3MEE A;  3OYF A;  5CR4 A;  3D6R A;  3SNN A;  1VRT A;  3VEX A;  2VWJ A;  2DTU A;  4E7I A;  4CJF A;  3OS2 A;  2IVO A;  4JN4 A;  4IEI A;  1I3A A;  3TAP A;  5EXW A;  3OJU A;  4JKG B;  2G8H A;  3ASM A;  1I39 A;  1VSD A;  4KKO A;  3CFP A;  4DR2 K;  3MXI A;  1JL2 A;  3DOK A;  2BH1 A;  3ZEU B;  4O5F A;  4FM1 A;  4JI8 K;  2F9W A;  3MN7 A;  1HNV A;  3GG4 A;  4MFB A;  4GKJ K;  2UUA K;  1RDU A;  3E9P A;  4ILG B;  4FM2 A;  3BDP A;  1ZBS A;  4X65 K;  3CYM A;  3DWL A;  4BRK A;  1EX4 A;  2ZE2 A;  5FPE A;  4DSE A;  4DS4 A;  4DSF A;  5AQU A;  3C7N B;  4W5N A;  4CEO A;  3SV4 A;  3T1A A;  3EO3 A;  3B8A X;  1DEJ A;  1NMN A;  1RDA A;  2E6M A;  4AHT A;  1JCF A;  3IDH A;  4C8M A;  3KJV A;  4J8F A;  3ZT1 A;  2HND A;  4G1Q A;  4I6M A;  5JMV A;  4IFE A;  3P39 A;  3L2V A;  2XRI A;  5DMR A;  4B1U B;  3MK6 A;  4RCH A;  4B1Z A;  3PSI A;  4DQ8 A;  4DTN A;  4IBN A;  3EKS A;  2AA4 A;  3CJA A;  3RVC A;  4CFB A;  3DMJ A;  5LJW A;  2E6L A;  4KRE A;  4LY7 A;  4JI4 K;  4JI0 K;  2KHO A;  3EL2 A;  1U49 A;  2P5G A;  2HB5 A;  2A42 A;  5HRO A;  4IO8 A;  4M3R A;  3AA2 A;  3LM2 A;  4I2Q A;  3KWI A;  4MLE A;  2HST A;  2D0B A;  2D4W A;  2DFE A;  4KFB A;  3K59 A;  4IO9 L;  2NNW A;  3MCP A;  1WSG A;  2EX3 A;  4LF8 K;  4CHN A;  2I7N A;  5JVG L;  4KB1 A;  3OY9 A;  1TYQ A;  4IZ9 A;  1LCU A;  3THY A;  3SUO A;  3THW A;  1EO1 A;  1KRP A;  2VWK A;  3NH1 A;  2O8F B;  4HTL A;  1SS6 A;  4YOR A;  1SV5 A;  3ZSX A;  3HBT A;  1WBD A;  4KBO A;  3OTO K;  1V4T A;  2QW9 A;  3IG1 A;  5BPL A;  5KPZ A;  4RG8 A;  2E2O A;  4H0O A;  3K57 A;  3NF8 A;  4B1W B;  4DTM A;  2O8E A;  3LDN A;  1L3S A;  3E01 A;  4BVP A;  4N5S A;  1K9M O;  2CH6 A;  3T19 A;  1SL2 A;  3L0Q A;  2RF2 A;  1C1C A;  3CC2 N;  3O3F A;  5D3G A;  5F2R A;  4Y1C A;  3PLA A;  3RSE A;  4XEI A;  1IKX A;  4CI6 A;  2QWN A;  3C94 A;  4LF5 K;  4BWJ A;  4YOX A;  1KTQ A;  4IDH A;  4CGH A;  1S1U A;  4NCG A;  3AA3 A;  3SQ0 A;  4RTF D;  2O4G A;  3LDP A;  3O9S A;  1NK4 A;  1TV6 A;  3G4S N;  4FJ9 A;  4AM7 A;  3OYA A;  1EXQ A;  1D9F A;  3NF9 A;  4CGG A;  4GMJ B;  3PIP L;  1NGC A;  2O8B B;  2UXB K;  1QZ5 A;  5KGX A;  1C0U A;  4K25 A;  2P1J A;  3NE6 A;  1RCH A;  1KFS A;  2NUB A;  1CLQ A;  4NCB A;  3M5R A;  1N5Y A;  1E3M A;  3OBY A;  1HNZ K;  3UE5 A;  1WSE A;  4KRF A;  2VWB A;  3L8B A;  4B3T K;  2D0O A;  3J7A P;  3NGY A;  1BCM A;  3OYK A;  1RT7 A;  1Z25 A;  4CER A;  2G8W A;  5J2Q A;  4GV6 A;  4CFA A;  3KTQ A;  3RR8 A;  4CJE A;  2F8S A;  3WUH A;  2G8K A;  1U45 A;  1RBV A;  4ELV A;  1HPM A;  2G8I A;  2HBK A;  3LP3 A;  3CPE A;  2I7P A;  3MEC A;  2QTD A;  4JI3 K;  5F0X A;  4X66 K;  4JKD A;  1TAU A;  4XH5 A;  1D8Y A;  2OZM A;  3ULE B;  4AHR A;  4NXM K;  3KLI A;  4OO1 J;  1OKJ A;  4OPH A;  2V7Z A;  3B6O A;  4IFY A;  4CJ7 A;  2CH5 A;  5KRT A;  2ETJ A;  4FCY A;  1VQ5 N;  1JCG A;  4M3T A;  4DR4 K;  4FSV A;  4LD0 A;  4AHC A;  5E84 A;  4OPK A;  1X9M A;  3TTC A;  3HVR A;  1NGD A;  3OYE A;  1NLV A;  3AVJ A;  4J2B A;  3TSP A;  1FKP A;  4Q5V A;  3TU5 A;  3THV A;  2E2P A;  4CZI A;  4JRP A;  3FFI A;  1BOT O;  3CM6 A;  4DTX A;  3PX4 A;  1YI2 N;  4FJ5 A;  2GUI A;  3V81 A;  3ATU A;  3ZSO A;  2KZM A;  1Y64 A;  4B9V A;  3DXM A;  5KI6 A;  4CZF A;  4CBU A;  2IVP A;  4YNQ A;  4LH5 A;  1DKG D;  5K14 A;  4CEZ A;  1U04 A;  3F9M A;  1K8A O;  4W5T A;  4BGA A;  4WFA L;  2VCP A;  3CCV N;  2E1Y A;  3OW2 M;  5AQQ A;  2UU9 K;  1QHT A;  3U6F A;  3EY1 A;  1GOC A;  3JAM O;  4QS7 A;  3VEW A;  3VPZ A;  4HCB A;  1KFD A;  3PO4 A;  1D5A A;  3OYD A;  2QWO A;  3BUZ B;  2NRZ A;  4M45 A;  1IJJ A;  4FLX A;  4JI1 K;  1KVA A;  2KFN A;  3IKM A;  4WQ4 A;  1J53 A;  4BR9 A;  3S3N A;  3VQD A;  1CZB A;  1QQN A;  3QFP A;  1JLA A;  5LMU K;  4QS8 A;  4CJ4 A;  4EP5 A;  1T8E A;  3R3L A;  4O8K A;  4KTZ A;  1NGB A;  1ASU A;  1RBT A;  2QWR A;  1IKY A;  1CXU A;  3CJ1 A;  3F9K A;  2OTJ N;  4KI6 A;  4MDB A;  2V51 B;  3AY9 A;  4JHD A;  4B1Y B;  3CI5 A;  4YOV A;  2A5X A;  3HPG A;  4F3O A;  1OH6 A;  4EZ6 A;  5AQS A;  3OYC A;  1JLF A;  4CJS A;  3VES A;  4KHU A;  2A1R A;  1BCO A;  3MX2 A;  1OH7 A;  4GNI A;  4B8C A;  3P38 A;  1KXP A;  3O1B A;  5BPN A;  4FJK A;  3KK7 A;  4CZL A;  1C0T A;  4FVU A;  3O4Q A;  3AV9 A;  3D2F B;  3S41 A;  3F73 A;  2GEL A;  3VEV A;  3VQ5 A;  4TSX A;  1WN7 A;  5DM7 L;  2V52 B;  5ADX A;  3P83 D;  3O3G A;  3QEI A;  3DLL L;  4B3R K;  2QWP A;  2YCH A;  1LWF A;  3GOI A;  1LW2 A;  4O4G A;  3G6E N;  2YHA A;  1S72 N;  3KKS A;  4FLW A;  5AJ3 K;  2HHH K;  3THX A;  5M1Q A;  3ZT3 A;  1X9S A;  4FPA A;  4H5R A;  3SZ2 A;  1T3V A;  4RWT A;  3NVM A;  2W40 A;  3O80 A;  4H5N A;  5AQH A;  4XH4 A;  4XIU A;  2IVN A;  3AO1 A;  4RW9 A;  3SK3 A;  3OYM A;  1NOZ A;  2O4I A;  4DKW A;  3SCX A;  1BA1 A;  1U47 A;  3CFO A;  4C8K A;  1U2V A;  4KH6 A;  2HBM A;  4EHU A;  1TL1 A;  3BY5 A;  4PA1 A;  1GOA A;  3H3N O;  3HOT A;  1NK7 A;  4BRM A;  4JKC A;  3VTH A;  4FL9 A;  4A2A A;  3KKR A;  1NNE A;  2VG7 A;  3BZC A;  3PX0 A;  2VG6 A;  2P9P A;  1WB9 A;  3HZ6 A;  3M6G A;  4BDP A;  2RKI A;  3TTF A;  3AAR A;  5AQF A;  1JJ2 M;  4L8R B;  2X78 A;  4M3X A;  5FPN A;  4I6M B;  3C65 A;  3VGK A;  4DTS A;  3QLH A;  3C95 A;  4CK3 A;  2F9T A;  4Y1D A;  4K42 A;  2Q97 A;  1JL1 A;  4CJU A;  2NRW A;  4FXD A;  2HBJ A;  3VQP A;  1RTD A;  3WT0 A;  3TAN A;  1XNQ K;  3E1Y A;  3V9U A;  4JKA A;  3S3O A;  5J2M A;  3SJJ A;  2HOE A;  4DHY A;  3GE1 A;  3H08 A;  3LPT A;  4BRL A;  1YTA A;  4Q0B A;  2AJQ A;  2V7Y A;  2D5R A;  4PQU A;  3D7E O;  4Z4I A;  3SBG A;  3CPW M;  2WC9 A;  1L5U A;  4CEB A;  4BRH A;  2UUC K;  5KPT A;  3R6M A;  3TAG A;  3DLE A;  2XY8 A;  1NWK A;  4ICL A;  1TYQ B;  3THY B;  1N6Q A;  3THW B;  4AHV A;  3H3O B;  3CIP A;  3TAE A;  3L2R A;  1LWC A;  4KHW A;  5GAE P;  5AQX A;  5HOO A;  1NJZ A;  4M41 A;  1IBM K;  3CQY A;  4A59 A;  5M1P A;  1QQO A;  4KV8 A;  4FWS A;  1J5E K;  3A5M C;  1RFQ A;  3D2E A;  3TWH A;  1MU2 A;  2DFH A;  2XY5 A;  4O44 A;  3R8E A;  4AHU A;  2WON A;  4DU1 A;  2H3G X;  4KHN A;  2O8E B;  3V1Q A;  1VRU A;  3HST B;  4RW4 A;  4ELU A;  3NMU A;  1EWR A;  4DUZ K;  5BRF A;  4WFB L;  1YXQ A;  3VEN A;  1YJW N;  3RSE B;  2GWJ A;  3ATV A;  4JLH A;  3AVB A;  2FF3 B;  1KAY A;  1WSI A;  1T6C A;  3V9S A;  1DTT A;  1QE1 A;  1XC9 A;  4F3T A;  3LWL A;  1T05 A;  4CE9 A;  4CJR A;  2HF4 A;  4WCE L;  4B1V A;  1NGJ A;  3FZF A;  5M1N A;  1SZ2 A;  4E89 A;  3G71 N;  1LOT B;  4CHZ A;  1RNH A;  4DR3 K;  2PFU A;  1NG9 A;  1QHA A;  5GIO A;  3TSQ A;  1N33 K;  4IG0 A;  1Z26 A;  1YIJ N;  4M3Z A;  1ATS A;  4FWO A;  1NK8 A;  2HHW A;  5AQY A;  4DV7 K;  4DQP A;  2ZJR L;  3JS6 A;  2ZM6 K;  3I0R A;  1HKB A;  3WXK A;  3ENH A;  3OJS A;  2WTU A;  1OH8 A;  2ZWH A;  3O8M A;  3G0Z A;  2NLX A;  3HK2 A;  4MO4 A;  1BI4 A;  5KRS A;  1FKO A;  4WFN L;  4DFM A;  1SAZ A;  1L3V A;  2Y1I A;  3I55 N;  5IT9 O;  3K5N A;  3OYH A;  4A2B A;  4IEE A;  2G8F A;  3ZYY X;  3EKU A;  4YOY A;  4E7H A;  5HP1 A;  1HJO A;  4LF6 K;  2EWS A;  1TKT A;  4DLE A;  3ENO A;  2YNI A;  4BDZ A;  4NCA A;  2HHV A;  1E4G T;  4KH5 A;  5KGW A;  4HTU A;  1UA0 A;  3CG7 A;  1O1W A;  4EFH A;  1HNI A;  3TAM A;  2Q0U A;  3ZCM A;  4V19 S;  3AVN A;  3H1V X;  4JI6 K;  3BGR A;  3ZSZ A;  3OYN A;  1YTU A;  3ZT2 A;  3BF1 A;  4PKH A;  4ELT A;  4DS5 A;  4FLU A;  3OS0 A;  4DFJ A;  4CZG A;  3S3M A;  5AQP A;  3JSM A;  1NJW A;  3VGL A;  1NOY A;  5TKW A;  1Q8I A;  3A5L C;  4CF8 A;  1JKH A;  4L3Q A;  4BRA A;  2P9I A;  2E5L K;  4FJH A;  5TKY A;  3WEE A;  3WQU A;  3EZW A;  4B9T A;  1HR0 K;  1S1T A;  2UUB K;  1ZBF A;  5KQ8 A;  1YJ9 N;  4FJN A;  2IDO A;  4B3S K;  1MWM A;  3FFK B;  2QA4 N;  4J2A A;  3C6U A;  5BR9 A;  3DXM B;  5AQM A;  2A3Z A;  5F1X A;  2JLE A;  4E7J A;  3ISN C;  4DQS A;  3MCA B;  4WQ5 A;  1HYZ A;  3WXM B;  1ZC6 A;  3LZJ A;  4JAX A;  1XQS C;  4RW6 A;  3IFR A;  3DRR A;  2PZS A;  2IS3 A;  4DV0 K;  1W7A A;  3EZ5 A;  2NRT A;  1TGO A;  1YF5 L;  2XHB A;  4DQQ A;  3HTV A;  1JXE A;  4PKI A;  3KK1 A;  2G8U A;  1J6Z A;  4AIL C;  5LJV A;  1BQM A;  1GLL O;  1BIS A;  4FYD A;  1YVN A;  3HSC A;  3T69 A;  3LWM A;  1RT2 A;  4H0V B;  4BR4 A;  4GW6 A;  4DF4 A;  3IMX A;  3O6W A;  1VQ4 N;  1NMD A;  4RW7 A;  4HWI A;  1GLB G;  1JLG A;  1TUU A;  4H0X B;  5ADX H;  3I56 N;  1BIZ A;  3UKU A;  1UWB A;  3BF3 A;  1UA1 A;  3AGK A;  4JHD B;  4Z4F A;  1GLF O;  1XNR K;  3HM9 A;  4CF1 A;  5AQJ A;  4KHS A;  3CJ9 A;  4KAZ A;  1W0H A;  4PHT X;  5M1F A;  2G8V A;  1ILY A;  1EWQ A;  1NKC A;  4DV3 K;  1GLA G;  3P1G A;  3CHW A;  2HMP A;  1HNW K;  2B6A A;  3L2W A;  1YT3 A;  3LDQ A;  3QET A;  4W5R A;  5AQN A;  1XHZ A;  3ID6 A;  1DT9 A;  4JI5 K;  3CJC A;  4OGC A;  1K6Y A;  2BE2 A;  1TKZ A;  2ITG A;  3EE8 A;  2CGL A;  3IRX A;  4EIA A;  1RTH A;  5BRE A;  1YIT N;  4O8U A;  3CCJ N;  1Q86 O;  4AQY K;  3VEO A;  3LL3 A;  4ID1 A;  3VQ6 A;  3PX6 A;  4CZM A;  4J2E A;  4GKK K;  4YDU A;  4FM0 A;  3AVH A;  3QML A;  3L3V A;  4CJP A;  4FJG A;  4CFC A;  2KLA A;  5HRS A;  3PUF A;  4JRQ A;  3THX B;  1VSE A;  1VSJ A;  5EY4 A;  3AVI A;  4G9Z A;  5EX5 A;  1SL0 A;  4CEQ A;  4B9L A;  5C24 A;  3MN5 A;  4CGD A;  4AF1 A;  3KIO A;  3CCQ N;  5C10 A;  4CGF A;  1SKR A;  3HP6 A;  4K43 A;  5DK5 A;  5KPR A;  3CER A;  2OYQ A;  3VN5 A;  3KLF A;  3M8S A;  3P31 A;  4A5A A;  3BP8 A;  3FGU A;  4FO0 A;  1U2V B;  4OKJ A;  1A5V A;  4PL8 A;  5A2Q O;  4XH1 A;  2P9P B;  1NKE A;  2P5O A;  2F8T A;  1BIU A;  4M7Y A;  4DR6 K;  1HPZ A;  5EOY A;  1SQK A;  4BAC A;  1QSS A;  5AQZ A;  2DFF A;  4CHP A;  3T1Y K;  2W42 A;  3CJ7 A;  4FK4 A;  3A5N C;  5M1K A;  2Z1J A;  4WQ4 C;  4FWN A;  3RRG A;  4DG1 A;  1S9G A;  5HBM A;  2IAJ A;  4Z94 A;  4HHT A;  2B4J A;  5C0Y A;  3FLC O;  3O3H A;  1RBU A;  1HUX A;  3DRP A;  1NKB A;  3EN9 A;  1ASW A;  3QFU A;  4DTR A;  2IGI A;  4HUF A;  4DR5 K;  3L2Q A;  1U48 A;  1DLO A;  5BRD A;  4BRF A;  4IKF A;  2QKB A;  5C15 A;  1MWK A;  3VF4 A;  2LSN A;  4Z4C A;  3CFR A;  2UXD K;  4O55 A;  4Z4G A;  4PWD A;  1C1B A;  1NGE A;  3OBW A;  4ISG A;  2FBT A;  4FJ7 A;  3EYZ A;  2P9U A;  3OYL A;  1A5X A;  3QER A;  1MDU B;  1RIL A;  2PAV A;  3GBT A;  4CEE A;  4IOA L;  1W97 L;  2QXF A;  3NFA A;  4OVL A;  1NJY A;  3SMS A;  4B9S A;  4CIE A;  4CHY A;  3NCI A;  3LP0 A;  3MWP A;  5KTQ A;  2FF6 A;  3CF5 L;  3V9W A;  5B8H A;  1V4S A;  5AQG A;  4FZX C;  1VQO N;  2FSK A;  1ZBI A;  5HRN A;  3EEQ A;  3VQE A;  5AQO A;  1B9D A;  3D2E B;  3V1R A;  4FWL A;  4LSN A;  1A5W A;  3TR8 A;  2Y1J A;  4FWM A;  2P9N A;  3T1H K;  5DM6 L;  4O0J A;  1NK5 A;  1IO2 A;  1GLE G;  1ZXO A;  5AZI A;  3A2F A;  2HVH A;  4BC5 A;  2F4V K;  2WOM A;  4BRQ A;  1VSF A;  1BO5 O;  4H4M A;  3WNF A;  4NXN K;  1GLD G;  3WNH A;  1NU0 A;  4Z4E A;  1VQL N;  3VMF B;  2CGJ A;  4O0I A;  3ZT0 A;  4Z0U A;  1X3M A;  1BUP A;  5FPM A;  3NAE A;  2O8D A;  1WSF A;  3CCM N;  4JKE A;  4KB0 A;  2OZS A;  1TK5 A;  4CF9 A;  3CCS N;  2NZT A;  1YUW A;  1QVF M;  4MQ3 A;  4DV5 K;  1X9J A;  5IWA K;  3Q7C A;  4M3Y A;  2GBZ A;  2XY6 A;  2YJE A;  5KQD A;  2WUS A;  3QEW A;  4AM6 A;  1LWE A;  3OYG A;  3QNO A;  3GDQ A;  3K9J A;  1BWF O;  1JXB A;  1NJX A;  4KTW A;  4PUO A;  3OHR A;  2Q36 A;  2P9L B;  3RMB A;  1ITG A;  3VQ8 A;  4DV1 K;  2NRR A;  3CQX A;  4B3M K;  1BI4 B;  4F8R A;  2GEM A;  3L3U A;  2Q0R A;  3ZT4 A;  4WF9 L;  4KTQ A;  1B92 A;  3VF2 A;  3VQQ A;  3I0S A;  3LDS A;  1IKW A;  2YHB A;  5AQI A;  2DY4 A;  2KKZ A;  4M7X A;  1F21 A;  4IJA A;  3VA0 A;  4C23 A;  3WXJ A;  3UIQ A;  3KD1 E;  4CGJ A;  5CZ1 A;  1L3U A;  1E4F T;  3A5O C;  1WSJ A;  3QEV A;  5CHI A;  1XI1 A;  3VA3 A;  4JI7 K;  1REV A;  2QXL A;  1JLQ A;  2YX6 A;  1QS4 A;  1IV0 A;  4CW7 B;  3NGI A;  3DM2 A;  3PSF A;  4CGI A;  2P9K A;  2W6K A;  1VQ9 N;  3E66 A;  3AO5 A;  3LPU A;  3HPH A;  4H0Y B;  3RMD A;  4FJX A;  5CYM A;  2KQ2 A;  2W6L A;  1KD1 O;  4JI2 K;  2P9I B;  5MLC Q;  2J4R A;  3WEE B;  3ALY A;  4BRC A;  4BC3 A;  4QAG A;  4NLB A;  4R79 A;  4DUY K;  3PY8 A;  3R9P A;  3K0S A;  3V1O A;  1VQM N;  3PO5 A;  4ISE A;  4FLT A;  5H1S Q;  2OAN A;  1N36 K;  3WXI A;  4FJJ A;  3O4N A;  3BZK A;  3QBX A;  4N76 A;  4I2P A;  1HQE A;  4LFC K;  3VET A;  4FWQ A;  4O5B A;  1YJN N;  5I42 A;  3MDQ A;  4H5W A;  4CZE A;  2FXU A;  1NBW A;  4CEA A;  3V9Z A;  3SUN A;  4FK0 A;  1JLB A;  4DWI A;  4CD3 A;  2VQE K;  5I9E B;  1J54 A;  4BR5 A;  1DGK N;  2E2Q A;  1D4X A;  2Q1N A;  1IH7 A;  1RDW X;  3ZSR A;  2F7T A;  3O9Q A;  3C0B A;  4ZTJ A;  1FJG K;  3C6H A;  3K5L A;  4BC2 A;  1G15 A;  3MWT A;  3O5B A;  1SKW A;  3L4Q A;  1UAX A;  4E19 A;  4B9Q A;  4GY2 B;  4BRD A;  4F9O A;  4KHQ A;  3UKU B;  1HYV A;  4FWR A;  1NK6 A;  1S1W A;  2BUP A;  2JGU A;  1UOC A;  3VEY A;  2ZGZ A;  2QI2 A;  4NYN A;  5HRP A;  5I3U A;  3O08 A;  1BDG A;  2VGM A;  4K8X A;  3AO3 A;  2FSJ A;  4BRI A;  4FPB A;  1RT1 A;  3SAF A;  4CJL A;  1Y97 A;  5E41 A;  2RHK A;  2FBY A;  1C1A A;  4OLB A;  3CXC M;  4LF9 K;  4RW8 A;  1GOB A;  3N4P A;  4WYB A;  1RGI A;  3LAM A;  2HHQ A;  1NGH A;  3MMV A;  1NGG A;  4FLV A;  1QSL A;  1BQN A;  3FZM A;  3QEP A;  1YHQ N;  1VK0 A;  2QWM A;  4HUE A;  2QM1 A;  3AVK A;  3E9L A;  1KQS M;  2ZQB A;  4IOX A;  4BQZ A;  5AQT A;  3C6T A;  5J2P A;  4DV4 K;  1TUY A;  5AQW A;  5GIP A;  5FDL A;  3RRH A;  3HP9 A;  3RR7 A;  4FLY A;  2HHU A;  1RT6 A;  1TK8 A;  2FLO A;  3TPQ A;  1JLC A;  3A0I X;  3SMP A;  2ATQ A;  1VSM A;  1EP4 A;  5ELZ A;  3MN9 A;  1IBK K;  1QQC A;  3UKR A;  4BVO A;  4JEP A;  3AVG A;  2HHX A;  4NLC A;  4JK7 A;  1ATN A;  3L4I A;  3MED A;  1RT3 A;  1T7P A;  3KWG A;  2GV9 A;  1T03 A;  2I5J A;  4PKG A;  4CJQ A;  1IBL K;  3DLK A;  1VSH A;  2XY7 A;  2OA8 A;  3AVA A;  2RPI A;  3V9X A;  1RDC A;  3IAY A;  3DLB A;  4JD2 A;  5BPM A;  3V4I A;  1BG3 A;  3MEG A;  3CET A;  4FK2 A;  2QWQ A;  4H5T A;  4M42 A;  1S1X A;  2AP1 A;  3SPZ A;  1S6P A;  1IG9 A;  1KCF A;  3NHG A;  4YOU A;  3RMC A;  4WE1 A;  4BE0 A;  4C8L A;  5FLX O;  4JKH A;  3SAH A;  4Y0W A;  4YHH K;  4FJM A;  1VSI A;  4ISF A;  3I8D A;  1QTM A;  4CBW A;  4FVM A;  4CCH A;  3DOL A;  2WBN A;  4BQL A;  3LP2 A;  1Q82 O;  4C8N A;  2QWL A;  3NH0 A;  1VQ8 N;  2GX9 A;  1S9E A;  1WAF A;  1FK9 A;  4DSJ A;  4HCC A;  4BG8 A;  4GVE A;  2VQF K;  4YFU A;  4JS5 A;  2RE2 A;  2A6A A;  2E4L A;  2ZF5 O;  3S9H A;  4FW2 A;  4CEC A;  3QEX A;  1T6D A;  2QKK A;  2D0P A;  2HMI A;  5AR0 A;  2XO7 A;  1KLN A;  4F2S A;  2OPR A;  3LDO A;  1K8K A;  4U7B A;  2Z1I A;  4DV6 K;  3KVG A;  1XMQ K;  2P9U B;  3K9K A;  5SZT A;  5LL6 Z;  1VQ7 N;  4DTO A;  3ZSV A;  2Q3S A;  4JS4 A;  3SQ2 A;  4IG3 A;  1ZBL A;  5AQK A;  1JLE A;  3CMA N;  3DYA A;  3H6E A;  4CJ5 A;  1VHX A;  3U4L A;  2HF3 A;  3M1F A;  4UQG A;  4DU4 A;  1SKS A;  4E1J A;  3HT3 A;  1CZA N;  3DXK A;  3O4W A;  3HM8 A;  4YDU C;  1HX1 A;  2P9N B;  2VYP A;  2X74 A;  1XC3 A;  1L3T A;  1KLM A;  3HPO A;  4EZ9 A;  3HXM A;  4H4O A;  1NK9 A;  3VQ4 A;  5EU7 A;  1QSY A;  1WUA A;  3MX5 A;  3TSU A;  1HKC A;  1R59 O;  4BRE A;  4BE2 A;  1CZ9 A;  5AZI B;  3KLH A;  1J9A A;  4E7L A;  2CGK A;  5AZJ A;  3M8Q A;  3P4I A;  4CD1 A;  4OLA A;  1N34 K;  4N41 A;  4A57 A;  2YJF A;  5C25 A;  4PL7 A;  2KZZ A;  1VQ6 N;  2O8D B;  2W41 A;  3RTV A;  1BA0 A;  4KHP K;  3KK2 A;  4CJV A;  4BE1 A;  4U67 L;  5JLF A;  3NBP A;  4HUG A;  3SUP A;  2O8C A;  2ZD1 A;  1ATR A;  4A62 A;  3K2P A;  4QCL A;  1GLJ O;  3U3Y A;  3I33 A;  2YHW A;  3MAQ A;  2E2N A;  2OTL N;  2KW4 A;  4DTJ A;  1Q7Y O;  1Q81 O;  3AVL A;  5HRR A;  1HJR A;  1NM1 A;  2KTQ A;  1IG8 A;  5JLH A;  3AO2 A;  3CCE N;  1IKV A;  4DMN A;  4NO7 A;  4DU3 A;  1RDB A;  3NH2 A;  1LAW A;  1LAV A;  3PIO L;  4FZY A;  2FC0 A;  3CC4 N;  3T7Z A;  1C0M A;  2PYJ A;  3CCU N;  3IS9 A;  4QS9 A;  2P9S A;  1T44 A;  1I94 K;  3J8A A;  1HYS A;  4JKB A;  3VER A;  4E3S A;  4ZHR A;  3O9T A;  3W3D A;  1C0G A;  2PY5 A;  4J2D A;  4FOI A;  2DPN A;  1JCE A;  3CD6 N;  2BDP A;  4DSK A;  3SPY A;  3L2U A;  1NGI A;  2UXC K;  1P90 A;  3QIC A;  5EVZ A;  3FZH A;  4JK8 A;  5JVH L;  3SV3 A;  3VOV A;  2YKM A;  2BAN A;  3W0L A;  5BN8 A;  3SYZ A;  2P9K B;  5C12 A;  2Q31 A;  3ID8 A;  1LV5 A;  2HVI A;  3SBT A;  2YNG A;  3UB5 A;  4IDK A;  3QB0 A;  3SJH A;  5J1E A;  1HQU A;  3D0P A;  3M8P A;  5LMN K;  4FZZ A;  3DRS A;  3K5M A;  2ITM A;  3AVM A;  4EHT A;  4B9N A;  3J7Z O;  5FRN A;  4YY3 K;  1DTQ A;  2VGN A;  3LP1 A;  3BEX A;  2IC3 A;  2D0A A;  2ZJQ L;  4LFB K;  5AQV A;  1KSP A;  4B9M A;  1XUP O;  3AAP A;  4CIF A;  2D1K A;  5BN9 A;  4B1X B;  4GV3 A;  4E1M A;  2YNF A;  3SLC A;  3KZB A;  1TK0 A;  1WLJ A;  1D9D A;  4IWV A;  1FXX A;  2E20 A;  4NB4 A;  3KHY A;  3OS1 A;  4CZH A;  2ASP A;  1Q9Y A;  1VQN N;  4CVN E;  2BGG A;  3J80 O;  1QZ6 A;  2WFB A;  1EKE A;  3ZX2 A;  5AFU A;  1KVB A;  4CK1 A;  4C8O A;  1SUQ A;  3M8R A;  4CFD A;  4B3O A;  4IXC A;  4FJ8 A;  4X62 K;  1ASV A;  3T3F A;  3JXU A;  3RWU A;  1B9F A;  3DJC A;  2F96 A;  3ZSQ A;  5GAD P;  1MA9 B;  3LDL A;  4K8Z A;  3O1W A;  1TKX A;  2D0C A;  1EQY A;  4IFV A;  1RBS A;  3H45 C;  4BWM A;  2IIR A;  5T7B A;  4LF7 K;  4Z4H A;  1VAZ A;  2YHX A;  3B6P A;  4DFP A;  3G10 A;  3LAL A;  3QIP A;  3KLG A;  3MN6 A;  2E8A A;  3O9R A;  3P5J A;  4H5V A;  3DLH A;  3CME N;  4BG9 A;  3O9U A;  2OPQ A;  4YOT A;  4YOW A;  4KH4 A;  5CY4 A;  5C2F A;  1HMV A;  3SI6 A;  1TKD A;  4ZTF A;  3ZET A;  1BL3 A;  4M63 C;  3CQ8 A;  2YV0 X;  2NRH A;  4DCH A;  4KPY A;  4UY8 O;  3H1Q A;  5JS2 A;  1RBR A;  3H46 O;  2HNZ A;  3FR0 A;  1Z6R A;  1K73 O;  4C1N I;  3LZI A; 
#chains in the Genus database with same CATH homology
 3OYI A;  4I2P A;  4KHY A;  2EX3 A;  4CJT A;  1HQE A;  5HLF A;  4N47 A;  3AVF A;  4IG0 A;  1XWL A;  4CHN A;  4KB1 A;  1Z26 A;  3SQ1 A;  4M3Z A;  5SWM A;  2Z1H A;  3OY9 A;  1NK8 A;  4O5B A;  3DLR A;  5I42 A;  2HHW A;  1EET A;  4DQP A;  3I0R A;  3SUO A;  4CEA A;  4FK0 A;  3V9Z A;  3SUN A;  1JLB A;  3OJS A;  4DWI A;  2RN2 A;  3G0Z A;  3HK2 A;  1BI4 A;  5KRS A;  3K5O A;  3KK3 A;  1KRP A;  2VWK A;  3NH1 A;  1FKO A;  1J54 A;  4DFM A;  1L3V A;  2Y1I A;  3QIN A;  3QO9 A;  3OYH A;  3K5N A;  2G8F A;  1IH7 A;  3ZSR A;  1SV5 A;  4E7H A;  4W5O A;  5HP1 A;  4ZTJ A;  3ZSX A;  1TKT A;  2OPS A;  4DLE A;  3K5L A;  2YNI A;  4HVJ A;  4BDZ A;  1G15 A;  3IG1 A;  1SKW A;  4NCA A;  1RTJ A;  4RG8 A;  2HHV A;  4I9Q A;  3WNE A;  5KGW A;  4HTU A;  2IOC A;  1UAX A;  1UA0 A;  4E19 A;  3K57 A;  3CG7 A;  1O1W A;  3NF8 A;  4DTM A;  4KHQ A;  1L3S A;  1HNI A;  3E01 A;  3TAM A;  4DFK A;  1HYV A;  3ZCM A;  1NK6 A;  3DLG A;  1S1W A;  3AVN A;  4N5S A;  2JGU A;  1UOC A;  3NGZ A;  4NYN A;  3BGR A;  3T19 A;  2RF2 A;  3ZSZ A;  5HRP A;  3OYN A;  3ZT2 A;  1C1C A;  5I3U A;  1SL2 A;  3AO3 A;  4K8X A;  3SUQ A;  1YTU A;  1W9H A;  3O3F A;  5D3G A;  4Y1C A;  4DS5 A;  4FLU A;  4ELT A;  3OS0 A;  1RT1 A;  4DFJ A;  3S3M A;  4GVM A;  4CJL A;  4W5Q A;  1Y97 A;  1IKX A;  3JSM A;  5E41 A;  1NJW A;  2FBY A;  1C1A A;  3C94 A;  3ZSY A;  4BWJ A;  1KTQ A;  1NOY A;  4OLB A;  1ZBH A;  1Q8I A;  4CF8 A;  1JKH A;  2FBV A;  4CGH A;  1S1U A;  1GOB A;  3AA3 A;  4NCG A;  4RW8 A;  4R5P A;  4E7K A;  2KFZ A;  3VQB A;  3SQ0 A;  2O4G A;  3LAM A;  1NK4 A;  1QSL A;  1TV6 A;  4FJH A;  3NDK A;  4FLV A;  1BQN A;  3OYA A;  1EXQ A;  3AO4 A;  4B9T A;  1J5O A;  1S1T A;  1D9F A;  3NF9 A;  4CGG A;  4GMJ B;  4DTU A;  3QEP A;  1VK0 A;  1ZBF A;  4HUE A;  3AVK A;  4FJN A;  2IDO A;  1X1P A;  5KGX A;  2ZQB A;  1C0U A;  4J2A A;  3C6U A;  2P1J A;  3C6T A;  1TVR A;  3D45 A;  3NE6 A;  5J2P A;  2JLE A;  3TAB A;  1RCH A;  4CIG A;  1KFS A;  2NUB A;  4E7J A;  3ISN C;  1X9W A;  4DQS A;  4NCB A;  1CLQ A;  2QK9 A;  1N5Y A;  3HVT A;  5FDL A;  2EHG A;  1HYZ A;  1WSE A;  3RRH A;  4KRF A;  3HP9 A;  3LZJ A;  4FLY A;  3RR7 A;  2HHU A;  3L8B A;  1RT6 A;  1TK8 A;  3NGY A;  1BCM A;  3OYK A;  4RW6 A;  1JLC A;  3DRR A;  1RT7 A;  1Z25 A;  4DQR A;  2IS3 A;  4CER A;  2G8W A;  2PZS A;  3LAN A;  3EZ5 A;  5J2Q A;  4CFA A;  3TAR A;  1TGO A;  3KTQ A;  2ATQ A;  2XHB A;  4DQQ A;  1VSM A;  4CJE A;  3RR8 A;  4KI4 A;  1EP4 A;  1JXE A;  3KK1 A;  2F8S A;  2G8U A;  3V6D A;  2G8K A;  1QQC A;  4AIL C;  1BQM A;  1U45 A;  1RBV A;  2PYL A;  3VQC A;  3AVG A;  2HHX A;  1BIS A;  4ELV A;  4FYD A;  3QES A;  2G8I A;  2Z1G A;  3MED A;  1RT3 A;  3LP3 A;  4I9L A;  1RT2 A;  1XHX A;  3LWM A;  1T7P A;  2GV9 A;  3HJF A;  3MEC A;  2I5J A;  1T03 A;  4CJQ A;  3DLK A;  4GW6 A;  1VSH A;  4DF4 A;  1NK0 A;  3RMA A;  3TAQ A;  2XY7 A;  1TAU A;  1D8Y A;  2FBX A;  5CYQ A;  2OZM A;  3KD5 E;  2OA8 A;  4RW7 A;  3AVA A;  3HO1 A;  2RPI A;  4AHS A;  4AHR A;  3V9X A;  4CED A;  1VSK A;  1RDC A;  3IAY A;  2HHT A;  3KLI A;  1JLG A;  3DLB A;  4M3W A;  3THV A;  3OYJ A;  4KRE A;  3B6O A;  3LAK A;  3NF6 A;  3V4I A;  1BIZ A;  1UWB A;  1UA1 A;  5CZ2 A;  4IFY A;  4Z4F A;  4NYF A;  4CEF A;  3MEG A;  5KRT A;  2ETJ A;  4FCY A;  4B8A B;  4CK2 A;  4FK2 A;  3HM9 A;  4CF1 A;  4M42 A;  1S1X A;  4KHS A;  4M3T A;  4KAZ A;  3SPZ A;  1W0H A;  4B08 A;  3DI6 A;  4LD0 A;  4AHC A;  1RT5 A;  3AVC A;  4OPK A;  1X9M A;  3AA5 X;  2G8V A;  3HVR A;  1NKC A;  4EP4 A;  3P1G A;  3TI0 A;  3OYE A;  3AVJ A;  1S6P A;  1IG9 A;  4J2B A;  4Q5V A;  1FKP A;  1KCF A;  2B6A A;  3ITH A;  1YT3 A;  4CF0 A;  3L2W A;  4W5R A;  3NHG A;  3QET A;  4JRP A;  4WE1 A;  3RMC A;  4BE0 A;  4C8L A;  2YKN A;  3FFI A;  1XHZ A;  3CM6 A;  4AH9 A;  4DTX A;  3PX4 A;  3LZI A;  4FJ5 A;  4FJM A;  4OGC A;  1K6Y A;  2BE2 A;  2GUI A;  3VQ7 A;  1S5J A;  1TKZ A;  1VSI A;  1WNS A;  2ITG A;  3ZSO A;  3I8D A;  3V81 A;  1SL1 A;  1RDD A;  3IRX A;  2KZM A;  1QTM A;  4FJL A;  4FVM A;  4CCH A;  4B9V A;  1RTH A;  3DOL A;  3PV8 A;  3LP2 A;  5KI6 A;  4C8N A;  3NH0 A;  4ID1 A;  3NF7 A;  1S9E A;  1WAF A;  4YNQ A;  1FK9 A;  4LH5 A;  3VQ6 A;  2R7Y A;  3QNN A;  3KLE A;  3PX6 A;  4DSJ A;  4HCC A;  2HHQ A;  4YFU A;  4FW1 A;  4DQI A;  4J2E A;  5K14 A;  4CEZ A;  4JS5 A;  2E4L A;  1U04 A;  3S9H A;  1C6V A;  3AVH A;  4FM0 A;  4FW2 A;  4CEC A;  1WAJ A;  4CJW A;  4W5T A;  3QEX A;  1ZBU A;  3L3V A;  4CJP A;  2HMI A;  4H8K A;  3K58 A;  4CFC A;  3QIO A;  2XO7 A;  2QKK A;  4FJG A;  5HRS A;  1KLN A;  4F2S A;  3PUF A;  2OPR A;  4JRQ A;  2B5J A;  1HRH A;  2Z1I A;  1VSE A;  1VSJ A;  4DSL A;  3AVI A;  1QHT A;  2HNY A;  3U6F A;  5SZT A;  2X6N A;  3EY1 A;  1SL0 A;  1GOC A;  4CEQ A;  4DTO A;  3ZSV A;  2Q3S A;  5C24 A;  4B9L A;  4HCB A;  2HHS A;  4CGD A;  1KFD A;  2P51 A;  4FLZ A;  3PO4 A;  1S1V A;  3KIO A;  1D5A A;  4JS4 A;  3SQ2 A;  1TAQ A;  4CGF A;  4IG3 A;  3OYD A;  1ZBL A;  1SKR A;  3HP6 A;  4M45 A;  5DK5 A;  4FLX A;  1JLE A;  1KVA A;  4ID5 A;  4FJI A;  2KFN A;  2OYQ A;  2OPP A;  1J53 A;  3VN5 A;  3KLF A;  3M8S A;  2HW3 A;  3DYA A;  3S3N A;  3VQD A;  1CZB A;  1JLA A;  1WSH A;  4CJ5 A;  2A1S A;  4CJ4 A;  4EP5 A;  1T8E A;  4LH4 A;  4I7F A;  4DLG A;  4KTZ A;  4OKJ A;  1ASU A;  1RBT A;  4DU4 A;  4UQG A;  1A5V A;  1IKY A;  1CXU A;  1SKS A;  3F9K A;  1ZYQ A;  3HT3 A;  4KI6 A;  1NKE A;  2X74 A;  2P5O A;  1L3T A;  1KLM A;  3HPO A;  4EZ9 A;  2F8T A;  1YVU A;  1BIU A;  3HPG A;  3AA4 A;  3HXM A;  4F3O A;  4H4O A;  1HPZ A;  1NK9 A;  3VQ4 A;  4EZ6 A;  3OYC A;  1JLF A;  4CJS A;  4BAC A;  4DF8 A;  1R0A A;  5EU7 A;  3VQ9 A;  2X6S A;  1QSY A;  4KHU A;  2A1R A;  1QSS A;  1BCO A;  4BE2 A;  2DFF A;  1CZ9 A;  3ZSW A;  4B8C A;  3KLH A;  4CHP A;  4E1N A;  1J9A A;  4E7L A;  2W42 A;  4CHO A;  4FK4 A;  3M8Q A;  4N56 A;  4OLA A;  4FJK A;  2Z1J A;  1C0T A;  4OKE A;  3RRG A;  4B9U A;  4DG1 A;  4N41 A;  3O4Q A;  1S9G A;  5HBM A;  3AV9 A;  3VQA A;  3OYB A;  5C25 A;  2IAJ A;  5FRM A;  1RTI A;  4HHT A;  2KZZ A;  2B4J A;  4KO0 A;  3RTV A;  1U4B A;  3F73 A;  3VQ5 A;  3O3H A;  1RBU A;  4TSX A;  4OGE A;  1WN7 A;  3DRP A;  4CJV A;  3KK2 A;  1NKB A;  4PY5 A;  1ASW A;  4BE1 A;  4DTR A;  3SUP A;  3NBP A;  4HUG A;  2IGI A;  4HUF A;  2VG5 A;  2ZD1 A;  3P83 D;  3O3G A;  3L2Q A;  1DLO A;  3QEI A;  1U48 A;  3K2P A;  1BHL A;  4QCL A;  4IKF A;  5C42 A;  2QKB A;  1LWF A;  3WNG A;  1LW2 A;  3U3Y A;  3SQ4 A;  4O4G A;  5FRO A;  4OPJ A;  3TAF A;  2YHA A;  4F2R A;  2LSN A;  3KKS A;  4CES A;  4Z4C A;  3CFR A;  4FLW A;  4O55 A;  3MAQ A;  4Z4G A;  1CXQ A;  4PWD A;  4QOZ B;  2KW4 A;  4DTJ A;  1C1B A;  4FJ7 A;  3ZT3 A;  2FBT A;  1X9S A;  3EYZ A;  1KVC A;  4BDY A;  4CJK A;  3OYL A;  3AVL A;  3SZ2 A;  1A5X A;  3QER A;  3JYT A;  5HRR A;  1RIL A;  1HJR A;  2KTQ A;  1RT4 A;  4CEE A;  3AO2 A;  1IKV A;  4DMN A;  2QXF A;  3NFA A;  4OVL A;  4XIU A;  4DU3 A;  4CJ3 A;  3AO1 A;  1RDB A;  3MXJ A;  4RW9 A;  1LAW A;  3NH2 A;  4DTP A;  1NJY A;  4B9S A;  1LAV A;  4CIE A;  4CHY A;  3NCI A;  3OYM A;  4FZY A;  1NOZ A;  3LP0 A;  2FC0 A;  2O4I A;  1C0M A;  3SCX A;  2PYJ A;  3IS9 A;  5KTQ A;  3V9W A;  3MXM A;  1U47 A;  1LW0 A;  3CFO A;  4C8K A;  1Q9X A;  4FZX C;  1ZBI A;  5J2N A;  1HYS A;  1TL1 A;  4CF2 A;  5HRN A;  3OVN A;  3U3G A;  4E3S A;  4PA1 A;  1GOA A;  3VQE A;  1B9D A;  2YNH A;  3V1R A;  4ZHR A;  4LSN A;  1A5W A;  1NK7 A;  3TR8 A;  3HL8 A;  1S6Q A;  3KKR A;  4OJR A;  2VG7 A;  2Y1J A;  3PX0 A;  2PY5 A;  4DSI A;  4J2D A;  2VG6 A;  4BDP A;  1TL3 A;  2RKI A;  2BDP A;  4DSK A;  3SPY A;  1VSL A;  3L2U A;  4E0D A;  4L8R B;  2X78 A;  4OKK A;  4M3X A;  4O0J A;  1NK5 A;  1IO2 A;  4M3U A;  3SV3 A;  4DTS A;  3QLH A;  2YKM A;  3C95 A;  4CHQ A;  4CK3 A;  2BAN A;  4Y1D A;  3A2F A;  2HVH A;  5JS1 A;  2WOM A;  1JL1 A;  1VSF A;  4LSL A;  4CJU A;  3SYZ A;  4FXD A;  3VQP A;  4H4M A;  4F4K A;  3WNF A;  3HYF A;  3WNH A;  1LV5 A;  1BGX T;  4Z4E A;  1RTD A;  2HVI A;  3ULD A;  3CM5 A;  3TAN A;  4O0I A;  2YNG A;  3ZT0 A;  4Z0U A;  3V9U A;  4IDK A;  3S3O A;  5J2M A;  3NAE A;  1WSF A;  3SJJ A;  3H08 A;  3LPT A;  3MEE A;  5J1E A;  1HQU A;  3OYF A;  4KB0 A;  2OZS A;  1TK5 A;  3D0P A;  1YTA A;  4Q0B A;  3M8P A;  4CF9 A;  4FZZ A;  3DRS A;  3K5M A;  2AJQ A;  3SNN A;  1VRT A;  4MQ3 A;  2VWJ A;  2D5R A;  2DTU A;  4E7I A;  4CJF A;  3AVM A;  3OS2 A;  4B9N A;  4PQU A;  4M3Y A;  5FRN A;  1I3A A;  1DTQ A;  2GBZ A;  3TAP A;  3LP1 A;  2XY6 A;  2IC3 A;  3OJU A;  4Z4I A;  2D0A A;  2G8H A;  1L5U A;  3ASM A;  4CEB A;  3QEW A;  1I39 A;  1LWE A;  1VSD A;  4KKO A;  3OYG A;  3CFP A;  3QNO A;  1JL2 A;  3TAG A;  3MXI A;  1KSP A;  3DLE A;  2XY8 A;  3DOK A;  4B9M A;  4ICL A;  4CIF A;  4FM1 A;  1JXB A;  1NJX A;  4KTW A;  1N6Q A;  4E1M A;  1HNV A;  4PUO A;  4AHV A;  2YNF A;  4MFB A;  4FJ9 A;  3RMB A;  1TK0 A;  1ITG A;  3VQ8 A;  1WLJ A;  3TAE A;  1D9D A;  3L2R A;  1BI4 B;  4F8R A;  1FXX A;  1LWC A;  4FM2 A;  3BDP A;  3L3U A;  4KHW A;  3ZT4 A;  4KTQ A;  1B92 A;  3CYM A;  1NJZ A;  3VQQ A;  3OS1 A;  4M41 A;  1EX4 A;  3I0S A;  3LDS A;  2ZE2 A;  1IKW A;  4DSE A;  1Q9Y A;  2BGG A;  2YHB A;  4DS4 A;  2DY4 A;  1EKE A;  1KVB A;  4CK1 A;  4DSF A;  4C8O A;  4W5N A;  1SUQ A;  4KV8 A;  1F21 A;  4CEO A;  3M8R A;  3SV4 A;  3T1A A;  4CFD A;  3VA0 A;  4B3O A;  3UIQ A;  4FJ8 A;  3TWH A;  3KD1 E;  1ASV A;  3T3F A;  1MU2 A;  2DFH A;  5CZ1 A;  4CGJ A;  3RWU A;  1B9F A;  1RDA A;  2F96 A;  3ZSQ A;  1L3U A;  2XY5 A;  4O44 A;  2E6M A;  1WSJ A;  2WON A;  4AHU A;  4AHT A;  4DU1 A;  4IFV A;  1TKX A;  2D0C A;  3QEV A;  4K8Z A;  1RBS A;  4BWM A;  1XI1 A;  3VA3 A;  4KHN A;  5T7B A;  1REV A;  4C8M A;  3KJV A;  3ZT1 A;  3V1Q A;  2HND A;  1JLQ A;  4Z4H A;  1VRU A;  3B6P A;  3HST B;  4G1Q A;  4RW4 A;  4ELU A;  4DFP A;  1QS4 A;  3G10 A;  3LAL A;  3QIP A;  3KLG A;  3L2V A;  2XRI A;  5DMR A;  3P5J A;  3DLH A;  3NGI A;  3DM2 A;  4CGI A;  4JLH A;  4IBN A;  4DTN A;  3AVB A;  3AO5 A;  2OPQ A;  1WSI A;  3HPH A;  3LPU A;  4CFB A;  3RMD A;  4FJX A;  3DMJ A;  5CY4 A;  2E6L A;  3V9S A;  5CYM A;  2KQ2 A;  1HMV A;  1DTT A;  1QE1 A;  4LY7 A;  3SI6 A;  1XC9 A;  1TKD A;  4F3T A;  4ZTF A;  1BL3 A;  3LWL A;  3CQ8 A;  1U49 A;  1T05 A;  3ALY A;  2YV0 X;  4CE9 A;  2P5G A;  2HB5 A;  5HRO A;  4M3R A;  4CJR A;  4QAG A;  3AA2 A;  4KPY A;  4I2Q A;  4E89 A;  3PY8 A;  3V1O A;  2D0B A;  5JS2 A;  1RBR A;  3PO5 A;  2DFE A;  4FLT A;  2HNZ A;  4KFB A;  3K59 A;  4CHZ A;  1RNH A;  4FJJ A;  3O4N A;  1WSG A;  4N76 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...