1RBRA

Structural study of mutants of escherichia coli ribonuclease hi with enhanced thermostability
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
155
structure length
155
Chain Sequence
MLKQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAAIVALEALKEPCEVILSTDSQYVRQGITQWIHNWKKRGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERCDELARAAAMNPTLEDTGYQVEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural study of mutants of Escherichia coli ribonuclease HI with enhanced thermostability.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase(endoribonuclease)
molecule keywords RIBONUCLEASE H
total genus 50
structure length 155
sequence length 155
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 1993-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1rbrA00
3PUFA 4DQSA 1KFSA 4FXDA 4KPYA 4KTQA 3SCXA 1L3UA 4CGGA 1KCFA 2G8FA 2DFHA 4FW2A 2ZE2A 1RT5A 3ZSVA 2IC3A 1WN7A 4IDKA 2NUBA 1RBSA 1S1XA 1ASVA 1LW2A 1REVA 3NBPA 3HP6A 1LV5A 2HMIA 3HPHA 4OVLA 1TK0A 3S3NA 2E6LA 3MXJA 2F8SA 5DMRA 3OS1A 1CZ9A 3PO5A 2XY7A 4CFBA 3KLEA 3HVTA 2W42A 1A5VA 1RT1A 5KGXA 1NK7A 1SL0A 4NCAA 4HCCA 3B6PA 4CF8A 4EP5A 2D0AA 3PX0A 2GUIA 4DTJA 1TAQA 1NJZA 4J2BA 2HVIA 4FLZA 5FROA 3O4QA 3TAQA 5HRRA 2G8VA 3IRXA 3DRSA 5HP1A 3KD5E 1ZYQA 5HRNA 1XHZA 1HNVA 1BHLA 1WAFA 4KKOA 4JRPA 4IFYA 3NF7A 2HNDA 4QCLA 3V4IA 4ELTA 3V9ZA 1SKSA 4CEDA 3MEGA 4H4MA 4MQ3A 1CZBA 4Z4CA 1NOYA 4B9SA 5SWMA 4KRFA 3MXMA 5KI6A 2YNGA 3D45A 3OYMA 4CCHA 1TGOA 1U04A 4JS4A 4DSIA 4DFJA 3ASMA 3P5JA 1FK9A 3ULDA 3RMAA 4CK1A 2I5JA 4LSNA 2OPRA 1J54A 3CYMA 1ASUA 1JL2A 1K6YA 4AHTA 4Q5VA 3OYJA 4DLEA 1SKWA 3RR7A 4F3OA 1W9HA 2QKKA 3NH1A 3ZSRA 1DTTA 3QNOA 1ZBFA 2AJQA 3O4NA 3V9WA 3KKRA 4BWJA 4CGDA 3QEVA 1T7PA 4O44A 4NYFA 1LAWA 1QSYA 3ZT2A 2D5RA 4CGFA 4CIGA 4OGEA 4M45A 3F73A 2RKIA 1X1PA 1UA0A 4OPJA 1CLQA 4CJKA 3WNEA 1NK0A 1EKEA 3G10A 4RW9A 3EY1A 4FJJA 3P1GA 2KW4A 3RTVA 4DSFA 4FJ7A 3LALA 3QESA 3L2VA 1TKTA 1UWBA 3AVBA 4CJ5A 4N56A 3OYKA 4CF0A 4HTUA 3AA4A 4E7HA 3V81A 1X9WA 1KRPA 3TAEA 3AVIA 2DFFA 4WE1A 3SV4A 3TAFA 1A5WA 4KREA 1FXXA 4QAGA 4I7FA 2KTQA 4KB0A 1WSJA 3ITHA 1NK6A 2Z1GA 4RW6A 3L2WA 1IH7A 1CXUA 2VG7A 1HNIA 3PV8A 1R0AA 1JLAA 3K5OA 4EZ9A 1RT7A 1FKOA 4CF2A 2P1JA 4B9TA 4DQRA 4CFAA 4IFVA 5I42A 4O0IA 1N6QA 1BISA 4M3XA 2D0BA 3SUOA 3E01A 3KLIA 4I2QA 3QEPA 3K57A 3WNHA 1BCMA 5I3UA 4DF4A 1C6VA 4B8AB 4CGHA 4UQGA 3SUQA 4E89A 1WAJA 2PYLA 3H08A 1JKHA 4BE0A 3QIOA 4DWIA 4OLBA 3RRHA 1WSGA 1C1AA 3M8SA 4F3TA 2YNHA 2KFNA 1D5AA 3TARA 4B9NA 5CZ2A 2GBZA 1UAXA 4RW4A 4R5PA 1A5XA 1BIUA 2RN2A 4B8CA 3KIOA 4N5SA 4RW7A 4M3RA 3VQ9A 1RTJA 4W5QA 4F2SA 2HNYA 5C24A 3TWHA 1U49A 2F96A 4E19A 4N76A 3ZT1A 3OYBA 4OKKA 1C0MA 4OKEA 3TR8A 2X78A 3O3FA 4YNQA 3AVAA 1KVBA 2Z1IA 1RDAA 1RCHA 3V1QA 3LWMA 3NGIA 1NK5A 5FRMA 1S6PA 3KK1A 3L2QA 1Q8IA 3CFPA 4KAZA 1BQNA 4FZXC 3DI6A 3LZJA 2X74A 3KJVA 3IS9A 3TANA 3CFRA 3VQCA 4M3UA 2IAJA 2WOMA 4M42A 1ZBHA 4KO0A 1J53A 1VSKA 2JGUA 3T3FA 1BQMA 1VK0A 4B08A 4BE2A 1IKXA 5KRTA 1TL1A 3HP9A 2YHBA 2FBYA 2O4IA 1BI4B 4M3WA 4E3SA 1WNSA 3QNNA 1QE1A 1TAUA 4LH5A 1W0HA 2X6NA 1T05A 3TI0A 4Q0BA 3OVNA 4CEOA 2B5JA 1NK8A 3AO3A 3MAQA 4DSEA 5C25A 3CM5A 2HHWA 3KLFA 5J2QA 3V9XA 1L3TA 3OYHA 4EZ6A 4DFPA 4JRQA 2OYQA 3CQ8A 1MU2A 4C8MA 1LWFA 4NCBA 4I9QA 2IS3A 1QS4A 1Z26A 1S1WA 2ATQA 3OYIA 3DM2A 3JYTA 3JSMA 4DF8A 1UA1A 4FJIA 2BANA 2IGIA 3CFOA 3OJUA 3S3MA 2G8WA 3FFIA 3VQQA 5CYQA 4DTUA 3U6FA 3MEEA 1C0TA 1EP4A 3QEXA 5J1EA 1U4BA 3VQ6A 3QEIA 4JLHA 4IG0A 3OYGA 5KTQA 1SKRA 1BCOA 4C8KA 1T03A 3V1RA 1RTHA 3HL8A 5E41A 4FCYA 2ETJA 1RTDA 4FYDA 2KQ2A 2BDPA 1VSHA 4CJEA 1NJYA 1TK8A 3VQBA 4E7LA 4M3YA 4CJSA 5HRPA 1RBVA 1RT4A 4KB1A 4KI6A 2X6SA 2WONA 3DMJA 4AHUA 3HO1A 4HVJA 3CM6A 4KTZA 4LD0A 3VQ4A 2LSNA 4CHZA 1RT3A 4FZZA 1Q9XA 1JLFA 3AVLA 2HW3A 1Z25A 1TKZA 3SQ2A 3AO4A 3AVGA 2P5OA 1RTIA 4CGIA 4K8XA 4LH4A 3V1OA 2DTUA 1BGXT 2E4LA 2QXFA 3AVFA 3DLGA 4KHYA 4OLAA 4PY5A 3LP0A 3DLKA 4EP4A 1XI1A 4N41A 3AVKA 4FJ8A 2FBTA 1EETA 2OPSA 3U3YA 1KVAA 4LY7A 4FJ9A 3AVMA 5EU7A 3NH0A 3AV9A 2A1RA 4FM2A 4W5RA 1D8YA 4FJ5A 3SV3A 4K8ZA 1RT6A 1WSHA 1WSEA 4AHCA 4ZHRA 3OS0A 1NKEA 3KK3A 2F8TA 5FDLA 1QTMA 1SL1A 4RW8A 3OYFA 3HM9A 3NDKA 2Z1JA 3AA5X 1Y97A 4J2AA 4Z4FA 1TKXA 1GOBA 4BDYA 1ZBIA 2HVHA 3BGRA 3HVRA 1JLBA 2VG5A 3DRRA 2DFEA 4BDZA 5HROA 1I3AA 4CHYA 3M8RA 4CHQA 1RBRA 3KKSA 3NFAA 4MFBA 3TABA 4Z4HA 4LSLA 4DTRA 4ICLA 2B6AA 1YTAA 2JLEA 4DQIA 4CIFA 4FJMA 2HB5A 4W5OA 4DQQA 1X9MA 3TAMA 4DU1A 3PY8A 3DLRA 4HUFA 4Z4GA 3MXIA 3NF9A 5HRSA 1C1BA 3AVNA 2YHAA 1QSLA 1KFDA 2ZD1A 1KLNA 1WLJA 1ZBUA 2XHBA 2Z1HA 4BE1A 2Y1IA 3VA3A 1KTQA 3OY9A 4PUOA 2IDOA 5D3GA 3QEWA 4GVMA 3AA3A 1HPZA 3S9HA 2KZMA 4CERA 3OYDA 3G0ZA 4JS5A 1VSMA 3OYEA 3K58A 3WNGA 3SQ1A 4E0DA 4FM1A 3ZT4A 4CJQA 1O1WA 3NH2A 4OJRA 4DU3A 2QKBA 3NE6A 2VWKA 3DYAA 1GOAA 4DU4A 1L5UA 2Y1JA 2XRIA 1JL1A 4CJPA 2YNIA 1G15A 1VSLA 4FLYA 1VSIA 3UIQA 1DTQA 4ID1A 1NK4A 1IKYA 3OYLA 2G8UA 3AVJA 3SJJA 4CHPA 4DSJA 4DS5A 4BDPA 3NAEA 4TSXA 1VRUA 5T7BA 1HQUA 2A1SA 2VG6A 2FBVA 3K2PA 4E7JA 2HHTA 1J9AA 4GW6A 3SQ4A 4DLGA 2HHXA 4PA1A 4KHUA 4IBNA 1D9DA 1VSFA 4RG8A 1YT3A 4CEZA 3VQ8A 5SZTA 3IG1A 4CF1A 4B9VA 1QSSA 4Z0UA 4XIUA 3ZSOA 3WNFA 2G8KA 2HHQA 3U3GA 4CEEA 4CJWA 3VQ5A 3P83D 4CFCA 1NKBA 4KI4A 1C1CA 3SQ0A 3K5NA 1NKCA 4J2DA 1S6QA 3LZIA 1NJXA 3V9UA 4BWMA 3RRGA 1S5JA 4ELVA 2RPIA 3LAKA 3LP2A 4CJUA 3C95A 2XY5A 1S1UA 1SV5A 3LP1A 4GMJB 1TV6A 2GV9A 3V9SA 1JXBA 4KFBA 3OYCA 4PQUA 1C0UA 3AVCA 3LANA 3L8BA 3PX6A 4C8LA 4O55A 2BGGA 1HRHA 3NCIA 3ZT3A 4DFKA 4Y1DA 3NF8A 3VQEA 1LWCA 2XY6A 2PY5A 3LAMA 3M8PA 2IOCA 4CJFA 2HNZA 1QQCA 3ZCMA 3OJSA 3S3OA 1XHXA 2G8IA 4G1QA 3O3GA 1IKVA 3ALYA 1RBTA 5KRSA 4B9MA 3HSTB 4ID5A 5CZ1A 3DLHA 4W5TA 5FRNA 4E1NA 4CJLA 2EHGA 3HPOA 1N5YA 4FK0A 4FLTA 4FM0A 4CJTA 1RDDA 2O4GA 3PO4A 3I8DA 4DS4A 2KFZA 4FVMA 5CY4A 1L3VA 3QIPA 3HJFA 3EYZA 4FLUA 3ZSQA 3RMDA 1IO2A 1HJRA 4L8RB 4KHNA 2E6MA 3SPZA 1S9GA 4CJ3A 4FJKA 3HPGA 3SPYA 4DTNA 1IG9A 1LAVA 1J5OA 3OS2A 2OZMA 1FKPA 1NJWA 4HUGA 2FC0A 1ASWA 1LWEA 2OZSA 4HCBA 1B92A 4M3ZA 4E1MA 1Q9YA 4CHOA 1B9DA 4DQPA 3HXMA 4FK2A 3HYFA 4CIEA 2VWJA 4DTSA 1U47A 4O4GA 2XY8A 3ZSYA 3LWLA 1TK5A 1VSEA 1HYZA 5KGWA 4J2EA 3L3VA 1JLCA 1X9SA 4ZTFA 3SUPA 2ZQBA 4FJGA 4H8KA 3TAGA 5K14A 4DMNA 3CG7A 3HT3A 1RDCA 4H4OA 4ZTJA 3VQPA 4NYNA 3DOLA 5CYMA 1RT2A 1BI4A 2OPPA 1RDBA 4NCGA 3O3HA 3PX4A 4ELUA 3LDSA 4PWDA 1CXQA 3ISNC 2G8HA 4Z4IA 4CEQA 3KTQA 3F9KA 4OPKA 3VA0A 1S1VA 2HHUA 1T8EA 1RNHA 3ZSXA 3AO1A 3VQAA 1ITGA 1S1TA 1RILA 1VSDA 1NK9A 2ITGA 4M3TA 3VQ7A 1WSFA 3SYZA 4CGJA 4AHRA 3OYNA 4B9LA 4O0JA 3MECA 4CJVA 3K59A 2D0CA 1L3SA 1U45A 1JLGA 4AILC 4AHSA 3ZT0A 3DOKA 5DK5A 4QOZB 1EX4A 2YKNA 3ZSZA 5C42A 1WSIA 3LPTA 3A2FA 3NGYA 3KLGA 3KLHA 4FLXA 2B4JA 3QERA 1SUQA 4F2RA 4OKJA 2QK9A 3HK2A 1QHTA 4DTXA 4CESA 4KV8A 3QLHA 3EZ5A 1RBUA 1VRTA 1KSPA 5JS2A 4KHWA 4N47A 4E7IA 3SI6A 3SNNA 1F21A 3B6OA 1XWLA 1KVCA 3C6UA 3VQDA 3IAYA 4Z4EA 1TVRA 2KZZA 4FJHA 2YNFA 4I2PA 3K5MA 2R7YA 3VN5A 3T19A 4CE9A 3T1AA 4CHNA 2DY4A 4CK2A 3AO5A 1DLOA 5HBMA 2P51A 4DTMA 4FJLA 3AA2A 4E7KA 4O5BA 4DFMA 2P5GA 2OPQA 1GOCA 3K5LA 1JLEA 3I0RA 1HYVA 1YTUA 3NGZA 1JLQA 4FLWA 2FBXA 2OA8A 3KD1E 3KK2A 4I9LA 4CJRA 3SZ2A 5J2MA 3DRPA 3LP3A 4CEFA 4CJ4A 4HHTA 3RMCA 3THVA 1I39A 3NHGA 2Q3SA 3MEDA 4FLVA 1NOZA 3QETA 1TL3A 3L2RA 4DSLA 1YVUA 1HMVA 1JXEA 4F8RA 4DTPA 1B9FA 1LW0A 4B3OA 3QO9A 3TAPA 2HHVA 4DG1A 1HYSA 4BACA 3LPUA 4DTOA 3SUNA 1VSJA 4B9UA 4C8OA 4DSKA 4F4KA 1HQEA 4FW1A 2RF2A 3NF6A 1S9EA 2EX3A 3L2UA 4IKFA 4FJXA 4CF9A 3RWUA 1BL3A 1IKWA 1EXQA 3DLBA 4C8NA 4AH9A 2XO7A 1ZBLA 1TKDA 3C6TA 4CFDA 3AO2A 4FZYA 3M8QA 3L3UA 4OGCA 2YV0X 3RR8A 4HUEA 2PZSA 2HHSA 1XC9A 4AHVA 4YFUA 4IG3A 4CEAA 2YKMA 4W5NA 3QINA 1UOCA 4KHQA 3ZSWA 4CEBA 3D0PA 5J2NA 3V6DA 1SL2A 1KLMA 1BIZA 4M41A 4FK4A 4Y1CA 3I0SA 5JS1A 3BDPA 1D9FA 3RMBA 4KTWA 2PYJA 3AVHA 3DLEA 4CECA 4CK3A 3C94A 5J2PA 5HLFA 4KHSA 1U48A 2BE2A 4FJNA 3OYAA
chains in the Genus database with same CATH superfamily
3PUFA 1WB9A 4KTQA 1L3UA 1KCFA 2QW9A 2RHKA 4FW2A 1RT5A 1ASVA 4NB4A 4Y0WA 3OBYA 4FWMA 5M1FA 2HF4A 4HTLA 3HPHA 5BN8A 3CCEN 3MXJA 3NVKA 4N41A 4M3WA 3VMFB 2W42A 3HVTA 1RT1A 5KGXA 1SL0A 2QXLA 3B6PA 3VGLA 4DTJA 4FSVA 4FLZA 5FROA 1NGGA 2G8VA 3EE8A 2E2OA 4X64K 4J8FA 5AQFA 4GKKK 1SKSA 3MEGA 4Z4CA 1NOYA 2YHXA 3MX2A 3MXMA 3OYMA 4CCHA 3HM8A 1TGOA 1YVNA 4JS4A 3QFPA 3P5JA 4WQ5C 3ULDA 4LSNA 2OPRA 1J54A 2AA4A 3RR7A 4AHTA 4Q5VA 4IOXA 1SKWA 5AZIA 1BOTO 3O4NA 1QVFM 1VHXA 2QM1A 3ZT2A 4BR0A 3F73A 1X1PA 1CLQA 3O8MA 3BUZB 3G10A 4RW9A 3EY1A 4DSFA 4FJJA 3DXMA 1EO1A 2YI1A 4CF0A 4HTUA 4E7HA 2QWMA 1KRPA 1HKCA 3TAFA 1FXXA 4QAGA 4I7FA 2Z1GA 1R0AA 1CXUA 5GAGP 2FF3B 5AQKA 2AP1A 4M3XA 2D0BA 4WQ4C 2PBDA 3CCVN 2NRWA 4UQGA 4CVNE 2PYLA 3WXMB 1TYQB 4OLBA 3CETA 3CC4N 4FWLA 3RRHA 1U2VB 3M8SA 1RGIA 2GWKA 4F3TA 2YNHA 5CZ2A 4HWIA 4RW4A 1A5XA 5AQUA 4JYAK 3VQ9A 4W5QA 5C24A 2HHHK 3ZX0A 1GLDG 1Z05A 3CJ9A 3TR8A 3O3FA 2X78A 3AVAA 1KVBA 3LWMA 3NGIA 1RCHA 3CJAA 1NK5A 3VENA 1Q8IA 4FZXC 3LZJA 2X74A 3VQCA 2IAJA 5M1KA 1HNWK 5BR9A 2P9NB 1BQMA 4M7XA 1VK0A 2E2QA 1NGCA 3CXCM 1ZC6A 5IWAK 1TAUA 2X6NA 1T05A 3OVNA 1N32K 2B5JA 5ELZA 4DSEA 1W7AA 5EXWA 4EZ6A 4DFPA 3CCMN 2OYQA 3E9LA 3G4SN 4NCBA 4I9QA 2IS3A 1QS4A 3CF5L 2ATQA 3JSMA 2BANA 5CR4A 4DTUA 4BRFA 3U6FA 1N36K 3MEEA 1C0TA 1EP4A 5J1EA 3R9PA 4IG0A 5C12A 5KTQA 3OYGA 4DV4K 3V1RA 5AQYA 2FSNA 4I6MB 5E41A 4FCYA 2ETJA 1RTDA 4FYDA 3IMXA 3WXIA 1VQMN 3VOVA 2OTLN 3KWIA 5HRPA 1RBVA 4KB1A 1T3VA 4AHUA 1QVGM 4JEPA 3CM6A 4HVJA 1V4TA 4K0KK 5GADP 3SQ2A 3AO4A 2DTUA 3V1OA 2QXFA 4OX9K 3LP0A 1XI1A 5AQRA 3AVKA 4BRNA 1KD1O 2OPSA 4LY7A 5BRDA 4NO7A 3NH0A 4OO1J 4W5RA 1OKJA 2NZTA 3SV3A 4AHCA 3OS0A 4H5NA 3LDNA 2O8DA 3OYFA 3NDKA 1C0GA 3THYB 1Y97A 2IVNA 3H1QA 4J2AA 4BDYA 5HROA 3M8RA 4FL9A 1RBRA 4MFBA 3TABA 4DTRA 4LSLA 4FJMA 2WC9A 2JLEA 1YTAA 2P9SB 2HB5A 2H3GX 4W5OA 4A5BA 1KFDA 3CMAN 2ZD1A 3SLCA 1WLJA 3MN9A 3WUHA 4BG8A 1C0FA 3OA9A 1KTQA 4MDBA 4CERA 4JS5A 3E9PA 3WNGA 1NGHA 1HX1A 3NE6A 3BZCA 4DU4A 4BR5A 2Y1JA 4K42A 5AQPA 4CJPA 3UIQA 5KPRA 1NK4A 3MMVA 3SJJA 3ZX2A 4DSJA 3HBTA 2JWLA 5T7BA 2A1SA 2W40A 1QQMA 2BUPA 3K2PA 3SQ4A 2HHXA 4PA1A 4IBNA 4CEZA 3CI5A 3WXLA 2EWSA 3WNFA 5CHIA 2VCPA 3I55N 3T1YK 3JXUA 4O8UA 2PAVA 3TSUA 3VQ5A 4LFAK 4B1YB 1C1CA 5E84A 5JVHL 4J2DA 2CGLA 3FE1A 2D1KA 5M1NA 3V9UA 3LAKA 4CJUA 3C95A 4A62A 2XY5A 1SV5A 1ATSA 3V9SA 4GMJB 1TV6A 3OYCA 5E26A 3CJCA 3AVCA 3PX6A 4IO9L 4C8LA 4WYBA 3ZT3A 3J80O 4B3RK 3NF8A 3VQEA 1LWCA 1VQ4N 5MLCQ 2GELA 5M1PA 1QQCA 3ZCMA 3OJSA 2G8IA 3FZMA 2GTDA 3S41A 1IKVA 5KRSA 1NLVA 3HSTB 4ID5A 2QWPA 4E1NA 4FK0A 4FLTA 4V19S 4FM0A 1IJJA 3CCLN 5JLHA 5CY4A 1L3VA 3VEVA 3RMDA 1HJRA 4AF1A 4LF9K 1QZ6A 4BR2A 4O5FA 4DV0K 4AM7A 4HUGA 1B92A 4M3ZA 3ULEA 4BC5A 4CHOA 4DV6K 3SMSA 4DTSA 4O4GA 3BEXA 4J2EA 1HYZA 4ZTFA 1V4SA 3TAGA 4DR1K 3FFKB 4H4OA 4ZTJA 3VQPA 3O3HA 5CYMA 1RT2A 5CE3A 4BQLA 2ZGYA 5BRHA 1IBMK 1WBBA 5AZJB 3F9KA 1Z6RA 5KQ8A 4FO0A 3SAFA 2QEXN 3O9SA 3CD6N 4LFCK 1ITGA 3TPQA 5EX5A 2ITGA 4M3TA 3VQ7A 4CGJA 2QTDA 4BREA 4AHSA 3ZT0A 4UY8O 1EX4A 4BRQA 5C42A 2Y1IA 4H0YB 4FLXA 3NGYA 1SUQA 4F2RA 3FGUA 3U9DA 4CW7B 1KSPA 4E7IA 3SNNA 3O4WA 3VQDA 4M7YA 2KZZA 4BRLA 3MDQA 4MDAA 3C65A 4DV5K 3VN5A 4CE9A 3U9ZA 3T1AA 4DR5K 2VGMA 5BN9A 5C0YA 2VQFK 4JKFA 4CK2A 3AO5A 1DLOA 4DTMA 4FJLA 4QS9A 4K25A 4E7KA 1NGJA 5BREA 2P5GA 4FLWA 1IBLK 2OA8A 4I9LA 4EAHD 1HLUA 5LY3A 3Q7BA 4FLVA 4DSLA 4PKIA 4F8RA 3VETA 3QO9A 3T69A 2HHVA 4DTOA 3LPUA 4IJNA 3SUNA 5AQXA 2A3ZA 1S9EA 4FJXA 2ZJPL 4PKHA 3RWUA 4JK9A 5ADXA 4AH9A 1ZBLA 2XO7A 3WQTA 3SAGA 4OGCA 2YV0X 3RR8A 2HHSA 1EQYA 1NMDA 4YFUA 3VERA 2YKMA 4DR6K 4DCHA 3QBXA 3IKMA 2V51B 2IVPA 4Y1CA 5JS1A 1XC3A 2NRZA 2Q0RA 4DKWA 2PYJA 3AVHA 1Q18A 4CECA 3RRGA 2BE2A 4KPYA 1VQPN 2F9WA 3SCXA 2G8FA 2DFHA 3ZSVA 3OBWA 2IC3A 1WN7A 4FPAA 2NUBA 4YHHK 4XH4A 1LV5A 3S3NA 3OS1A 3J81O 4NCAA 5B8HA 4HCCA 2NNWA 3PX0A 5AQNA 1TAQA 4DB3A 4NLCA 2Q1NA 3O4QA 4JKHA 5HRRA 3IRXA 2GX9A 3KD5E 5HRNA 1BO5O 4JRPA 2P9LA 4KKOA 4IFYA 3K9KA 4QCLA 1S22A 2Q2RA 4MQ3A 1CZBA 4FWRA 5SWMA 1I94K 5AQZA 3CC7N 4YOYA 4DFJA 1KC8O 3RMAA 2I5JA 3OYJA 3O9TA 4DLEA 3EZWA 1W9HA 4M63C 1DTTA 1ZBFA 3V9WA 5DM6L 1HNZK 4BWJA 3WT0A 4CGDA 1T7PA 3ID6A 1LAWA 3F9MA 1K8KA 4CIGA 2KLAA 3A5MC 3CC2N 1UA0A 4OPJA 4WQ5A 3P1GA 4FJ7A 3LALA 3EN9A 3L2VA 1TKTA 3UB5A 1UWBA 4N56A 3V81A 1X9WA 1SZ2A 3IDHA 3M1FA 2E1ZA 3SV4A 1KAZA 1A5WA 4KB0A 3ITHA 1NK6A 3PV8A 1IH7A 1E3MA 1HNIA 2W41A 3HTVA 3K5OA 3QMLA 1RT7A 1FKOA 4YOVA 1E4FT 4CFAA 5I42A 1H1VA 4WFNL 1WOQA 4XH5A 5I3UA 4CZJA 1C6VA 4B8AB 4CGHA 3SUQA 1WAJA 2ASOA 3QIOA 3NMUA 4DWIA 4H0VB 1MWKA 3ZEUB 1YXQA 3THWB 1LCUA 5C15A 2P9IB 2GBZA 4R5PA 4GNIA 4M3RA 4JI0K 1RTJA 2YCHA 3EE9A 4F2SA 3TSPA 2F96A 4E19A 2BH1A 3CCQN 4OKEA 2Z1IA 4NLBA 2QWLA 2A5XA 3V1QA 5FRMA 5AQTA 1S6PA 1BQNA 1NGFA 3ENOA 3TANA 3CFRA 4BRMA 2WOMA 1ZBHA 3T3FA 1TL1A 1W2BM 4E3SA 2UUAK 3TI0A 4B3SK 1NK8A 5C25A 2UUBK 2HHWA 3FLCO 3KLFA 3RSEA 2UXCK 3CQ8A 1LWFA 1XNRK 4A2BA 1Z26A 3JYTA 4DV3K 2G8WA 4PKGA 5CYQA 3CCJN 3ATVA 2W6KA 3FZHA 1U4BA 4JLHA 4IFEA 4FWOA 1RTHA 3HL8A 3G71N 1BU6O 2UUCK 2VGNA 1TK8A 3U4LA 4M3YA 3HZ6A 3AGRA 3OHRA 5AZJA 2X6SA 1FW6A 3HO1A 3I56N 4CHZA 1RT3A 1JLFA 4RWTA 1TKZA 3AVGA 2P5OA 4CGIA 3AVFA 4OLAA 4KHYA 1DEJA 3UKUB 3R3LA 3W3DA 2FBTA 5F2RA 3U3YA 1KVAA 1BG3A 5EU7A 2ZJRL 4FOIA 2FSKA 4ISGA 1RT6A 3WQUA 3ZX3A 3H6EA 3UKRB 1WUAA 3BF3A 3N4QA 4Z4FA 3FZLA 2VG5A 3FR0A 3M6GA 2A40A 4BDZA 4CHYA 3LDLA 2UU9K 3MK6A 4JK7A 4CHQA 1X9JA 4Z4HA 2B6AA 2DPNA 3D2EB 3TAMA 1K8KB 2QWRA 3DLRA 3NF9A 4K43A 1QSLA 3O9RA 2IDOA 5D3GA 3AA3A 4BRDA 2KZMA 3GL1A 3DXMB 3SQ1A 4E0DA 2FF6A 4CJQA 1O1WA 3UE5A 4DU3A 1YAGA 2QKBA 2VWKA 2E20A 3N4PA 4BRIA 3L0QA 2O8EB 2GWJA 1VSIA 3R8EA 3OYLA 5AQJA 2ZWHA 4KH5A 3O1BA 3LDQA 2FBVA 2O8BB 4GW6A 4IO8A 3CMEN 3T1HK 1RFQA 3MN5A 3VQ8A 3IG1A 4B9VA 4Z0UA 1RDWX 1E4GT 3JS6A 1QHAA 4CJWA 4WF9L 1VQ8N 1N34K 4BWMA 4QS7A 3O5BA 4ELVA 4BRCA 5FPNA 5JVGL 1D4XA 1JXBA 4KFBA 4MLHA 4PQUA 1NMNA 4JD2A 2BGGA 3NCIA 4KH6A 3DJCA 2IOCA 4BGBA 2O8FB 1XHXA 4U7BA 3O3GA 1RBTA 3H45C 3DLHA 2CGJA 4CJLA 3HPOA 1N5YA 4BR7A 3VTIA 3CCRN 5GIOA 4JKAA 4BR9A 3L4IA 2P9UB 3EYZA 4L8RB 1S9GA 4CJ3A 4FJKA 2OZMA 1NJWA 3O1WA 3C0BA 2FC0A 5LJVA 4HCBA 2YJEA 3C7NB 4CJ7A 4DQPA 3HXMA 4CIEA 2VWJA 1U47A 3ZSYA 1VSEA 5KGWA 5BRFA 1JLCA 2Q97A 1X9SA 3SUPA 4B3TK 2ZQBA 4YDUC 4FJGA 4WFAL 5GAEP 4LC9B 3SAHA 3TSQA 3VEXA 4NYNA 4JKGA 1NWKA 4XEIA 1RDBA 4NCGA 3SBGA 3LDSA 1MA9B 4DQ8A 1CXQA 2G8HA 1GLLO 1RNHA 3RSEB 3VQAA 1S1TA 2P9KB 2QI2A 1WSFA 2HBMA 3SYZA 4AHRA 1SQKA 4O0JA 3O9UA 1P8ZA 2D0CA 4CJVA 1L3SA 1NBWA 4CBUA 2YKNA 3CQYA 3ZSZA 5BPMA 1WSIA 3CIPA 3A2FA 3LPTA 4KBOA 3OTOK 3KLHA 2B4JA 3QERA 4GV9A 2QK9A 5TKYA 1QHTA 1JCFA 1K73O 3QLHA 3EZ5A 4H0PA 5JS2A 4Z4EA 1TVRA 5AZIB 4FJHA 1WBDA 3K5MA 3W0LA 2P9UA 4BR4A 4CHNA 1U6ZA 2DY4A 3PIPL 2P51A 3HOTA 4DFMA 5C2FA 1JLEA 2QWQA 5AQSA 3NGZA 2FBXA 5J2MA 4GKJK 3O9QA 3BY5A 3NHGA 1CZAN 1KAYA 3VF2A 1NOZA 4B1WB 1GLFO 3TAPA 4DG1A 2ZGZA 4C8OA 1HQEA 2RF2A 3EKUA 2EX3A 4IKFA 3K9JA 4CF9A 5ADXH 3NVMA 1IKWA 3KVGA 3DLBA 4C8NA 3M8QA 2CGKA 3SBTA 5HL7L 1NNEA 4B9QA 4W5NA 4KHQA 4H5RA 4LF6K 4JNEA 3V6DA 3AY9A 1BIZA 4M41A 3ZLJA 3I0SA 5GAHP 1M90O 1D9FA 4YOUA 2O8BA 3DLEA 1N33K 3C94A 4ILHA 1Q81O 3DXKA 3DLLL 4DQSA 1KFSA 4BC2A 1TUYA 2F7TA 1FJGK 1BA1A 3C6HA 4QS8A 2CH5A 1S1XA 3MWTA 4GY2B 4BC4A 3J8AA 3D2EA 3HP6A 1XMQK 2HMIA 1TK0A 3KZBA 2E6LA 2F8SA 2XY7A 3KLEA 1A5VA 1QZ5A 1JCEA 4EP5A 2D0AA 1NJZA 4J2BA 3ID8A 4IEIA 1ZYQA 4C1NI 1HNVA 1WAFA 4YY3K 3NF7A 3V4IA 1HJOA 3SK3A 4CEDA 4H4MA 1NGEA 2ZJQL 2F9TA 3D45A 4JI5K 1U04A 3QICA 4DSIA 1FK9A 4CK1A 3CYMA 1NM1A 4H0XB 4DV7K 1GLEG 4LFBK 2QKKA 3NH1A 4JKCA 4A59A 3QEVA 2RE2A 4NYFA 1IV0A 3GG4A 4CGFA 4X62K 3MCPA 2HBLA 2HBKA 4CJKA 4DHYA 3D2FB 2KW4A 1T6CA 4H03B 4DR3K 2HBJA 3AVBA 5AQGA 4CJ5A 3OYKA 3AA4A 2P9IA 5BPLA 3TAEA 4WE1A 2KTQA 1WSJA 3R6MA 1VQLN 4FWNA 4WCEL 4CF2A 2P1JA 1N8RO 3VESA 4DQRA 3BF1A 4O0IA 1N6QA 3QEPA 3K57A 3WNHA 5AQQA 5JMVA 3QB0A 1ILYA 4DUYK 1WSGA 3PLAA 1C1AA 1OVYA 3HRGA 2KFNA 4B9NA 1UAXA 1BIUA 2RN2A 1YIJN 2ZM6K 4RW7A 5AQIA 1U49A 3EL2A 3VTHA 4OKKA 4BGAA 1C0MA 3GE1A 1RDAA 4KAZA 5GINA 3DI6A 3KJVA 3IS9A 4H5WA 4FVUA 4BRPA 1J53A 2JGUA 3JAMO 1EWRA 3LM9A 4L3QA 4BE2A 5AJ3K 3DWLA 2FBYA 1BI4B 4CZKA 1W0HA 3CQXA 4Q0BA 2P9LB 1IG8A 3THXA 5KPTA 5EY4A 3U8XA 3V9XA 3OYHA 3KHYA 1YHQN 2IVOA 5FPMA 1S1WA 4YOTA 4DF8A 3DM2A 2IGIA 3VQQA 4CD3A 3QEXA 4MO4A 1T44A 3VQ6A 2HMPA 2O8CB 1BCOA 4A2AA 1VQNN 2JWKA 1DT9A 1NJYA 3J7ZO 4CJSA 1RT4A 3SMPA 3THYA 3VQ4A 2LSNA 4FZZA 1Q9XA 1ATNA 1Z25A 5AQMA 4EFHA 1W97L 2OTJN 4FWQA 3CHWA 2WTUA 2E4LA 4EP4A 2UXDK 4FJ8A 5A2QO 4B1ZA 2V7YA 2QA4N 4LF7K 4A5AA 2A1RA 4FM2A 1D8YA 4BY9C 2NRTA 3KK3A 4FWSA 3E66A 5FDLA 3CJ7A 2I7PA 3HM9A 1SL1A 3A0IX 5EOYA 3ZETA 4BVOA 1TKXA 1GOBA 2HVHA 2P9SA 3DRRA 1MDUB 3T7ZA 3NFAA 3KKSA 4PHTX 4MLEA 4DQIA 4DUZK 4IDHA 4DQQA 1NGIA 4DU1A 3PY8A 2VQEK 1QQOA 4Z4GA 3ZYYX 3I8BA 1TYQA 5HRSA 5KPZA 2YHAA 1ATRA 2Z1HA 3BP8A 4BE1A 3VA3A 2D4WA 4PUOA 4GVMA 1XUPO 3S9HA 3OYDA 3H3OB 1BWFO 3K58A 4FM1A 3ZT4A 1XMOK 4OJRA 1X3MA 1NGBA 2E88A 1Q7YO 2PFUA 1GOAA 3DYAA 4JI6K 1JL1A 1G15A 4FWKA 1DTQA 3MCAB 4YOXA 3AVJA 3WXKA 4DS5A 1X3NA 1GLAG 2VG6A 4LF5K 3EEQA 2ASMA 1J9AA 4FWPA 4RCHA 4KHUA 1Q82O 1D9DA 1VSFA 4RG8A 4JI3K 1YT3A 5SZTA 3J7YP 4CF1A 1VQ6N 3U3GA 4JI2K 2F4VK 3P83D 4CFCA 1NKBA 4LF8K 1XNQK 3IUCA 3K5NA 1NKCA 3LM2A 4BQZA 1S6QA 5F1XA 4BG9A 2GUPA 3LZIA 4C1NK 1NJXA 3PSFA 1S5JA 3HSCA 3VGMA 1BA0A 4BC3A 1J6ZA 3LANA 2HF3A 4EHTA 1NGDA 1HRHA 1OH8A 4Y1DA 4JHDA 2PY5A 2HSTA 3VEWA 3ALYA 5CZ1A 5FRNA 1DGKN 2EHGA 4CJTA 1RDDA 2O4GA 4JKDA 3I8DA 3ENHA 2QWNA 2KFZA 4JV5K 4FVMA 3B8AX 3AARA 3ZSQA 4CZFA 2E6MA 4O8KA 2P9KA 4DTNA 1LAVA 3SPYA 2ZF5O 1FKPA 1ASWA 1LWEA 1J5EK 4E1MA 1Q9YA 4FK2A 3D6RA 2XY8A 3LWLA 4E1JA 1TK5A 4OPHA 2UXBK 1VQ7N 4DMNA 3CG7A 2KHOA 3HT3A 3H1VX 5M1OA 3PX4A 5C2DA 1BI4A 2OPPA 4Z94A 1HKGA 3ISNC 4DR7K 3RVCA 3KTQA 3VA0A 1S1VA 2NLXA 2QWOA 1NK9A 3PIOL 3PSIA 5LL6Z 3OYNA 1KQSM 3K59A 4G9ZA 1U45A 1JLGA 2ITMA 3DOKA 4QOZB 4H5VA 3F2KA 3L4QA 4KH4A 3KLGA 4FJIA 4OKJA 4CESA 4KV8A 4CZMA 1VRTA 1LOTB 3VF4A 4N47A 5BR8K 1F21A 3B6OA 1XWLA 1KVCA 1T6DA 3IAYA 3KWGA 2E8AA 5AQLA 3VPZA 4B1XB 3QDKA 1XQSC 2VYPA 4F9OA 3AA2A 1OVQA 4ISFA 3MX5A 3K5LA 1GOCA 3I0RA 1YTUA 1JLQA 5AR0A 3KK2A 3SZ2A 4CJRA 4CEFA 4CJ4A 2E1YA 3RMCA 3THVA 1I39A 3GOIA 2Q3SA 3ZEUA 3QETA 2NRXA 4BROA 1YVUA 1JXEA 4B1VA 3CCSN 1B9FA 4DTPA 4B3OA 1HYSA 4F4KA 4AQYK 4K41A 1BL3A 3MN6A 3C6TA 5AQVA 4MO5A 3L3UA 1Y64A 2PZSA 1JJ2M 4IZ9A 5I9EB 1XC9A 4JD2B 4AHVA 4JI1K 3P4IA 4CEBA 5J2NA 1SL2A 1KLMA 4FK4A 3C7NA 2D0OA 3P31A 3QFUA 3BDPA 4KTWA 4CK3A 2V7ZA 5HLFA 1S72N 4FXDA 4CGGA 2ZE2A 2ASPA 4IDKA 1RBSA 1LW2A 1REVA 3NBPA 3E1YA 4OVLA 2CH6A 4CZGA 5DMRA 1CZ9A 3PO5A 4CFBA 2O8EA 4WQ4A 3ULEB 1NK7A 1VQ9N 4CF8A 5C10A 2HVIA 2GUIA 3TAQA 3DRSA 3TTFA 5HP1A 1NGAA 3D7EO 5DM7L 3H3NO 1XHZA 1BHLA 5JICA 3VEOA 4ILJA 2HNDA 1SAZA 5F0XA 1KXPA 3DXKB 4JKBA 4ELTA 3V9ZA 4KRFA 3CPWM 4B9SA 1IBKK 5KI6A 4DR4K 2J4RA 2YNGA 3VEZA 3ASMA 5LMUK 3Q7CA 1JL2A 1ASUA 1K6YA 3KK7A 4F3OA 4H0TB 2NRHA 4XH1A 3ZSRA 3QNOA 2FLOA 2AJQA 4JKEA 3KKRA 4H0OA 1R59O 4O44A 1QSYA 2A41A 2D5RA 1K8AO 4OGEA 4M45A 2RKIA 3FZKA 5KQDA 2WBNA 3WNEA 2Q31A 1NK0A 1EKEA 4IJAA 2D0PA 3RTVA 3QESA 4C23A 3F5TA 3AVIA 3IFRA 2DFFA 4NXMK 2WFBA 4CI6A 3G6EN 4KREA 1SS6A 1OH7A 2WUSA 3TTCA 4AM6A 4GVEA 4RW6A 4K8ZA 3L2WA 2VG7A 4EZ9A 1JLAA 4JN4A 4IEEA 1YJ9N 4B9TA 4IFVA 1BISA 3SUOA 3P38A 3E01A 3KLIA 4I2QA 3GBTA 1BCMA 4DF4A 1YF5L 4E89A 3H08A 1JKHA 4IXCA 1HR0K 3ATUA 4BE0A 3AGKA 3D2FA 3UKRA 3QBWA 1D5AA 4X66K 3TARA 4IOAL 1O13A 4B8CA 3KIOA 4N5SA 4BRAA 1BDGA 2HNYA 3TWHA 4N76A 3ZT1A 3OYBA 4H5TA 4CZHA 4CZEA 4YNQA 4JI7K 3KK1A 3L2QA 3CFPA 4CZLA 4PL8A 2YJFA 4A61A 4M3UA 4M42A 5FLXO 4CBXA 4KO0A 1VSKA 4B08A 4I6MA 1IKXA 2GEMA 4JHDB 3HP9A 5KRTA 2YHBA 2O4IA 1GLCG 3QNNA 1WNSA 1QE1A 2P9NA 1YJWN 4LH5A 4CEOA 3AO3A 3MAQA 1S3XA 3CM5A 5J2QA 1YI2N 1L3TA 5M1QA 4JRQA 3O80A 1MU2A 4C8MA 3OYIA 4JI8K 1UA1A 4BVPA 3S3MA 3OJUA 3CFOA 3CERA 3FFIA 5BPNA 3SJHA 3QEIA 3H46O 1SKRA 2OANA 3AAQA 4C8KA 1T03A 1U2VA 2FXUA 2KQ2A 2BDPA 1VSHA 4YOWA 4CJEA 3VQBA 2VWBA 4E7LA 2O8FA 3OW2M 2OCEA 4KI6A 4LF4K 4JKGB 3DMJA 2WONA 4KTZA 4BRHA 4LD0A 1EWQA 3C6AA 2IIRA 3LL3A 3AVLA 2HW3A 4IOCL 1RTIA 4K8XA 4LH4A 1BGXT 3VEYA 3DLGA 4PY5A 4YORA 3DLKA 4GV6A 5AQOA 1EETA 1NJIO 3ENBA 4ISEA 3AAPA 4FJ9A 3AVMA 3AV9A 1TUUA 1VQKN 4FJ5A 3O6WA 1WSHA 1WSEA 4ZHRA 4X65K 1MWMA 1YUWA 1NKEA 2F8TA 5JLFA 1QTMA 4DV1K 4RW8A 1NU0A 2Z1JA 3VF6A 2KKZA 3AA5X 1ZBIA 2FSJA 3CJ1A 3BGRA 3HVRA 1JLBA 3WEEA 1ZXOA 2DFEA 3G25A 1I3AA 2YHWA 4KHPK 4ICLA 4CIFA 1X9MA 4HUFA 3MXIA 1C1BA 3AVNA 1KLNA 1ZBUA 2XHBA 1GLJO 3K0SA 2Q0UA 3OY9A 3FZFA 3QEWA 2O8DB 1HPZA 1NG9A 3EO3A 3G0ZA 1VSMA 3OYEA 3A8YA 3NH2A 5AFUH 2NRVA 4WFBL 3BZKA 1L5UA 1M1KO 1P90A 1BUPA 2XRIA 4CZIA 3WXJA 2YNIA 1VSLA 4FLYA 4ID1A 1IKYA 2G8UA 4CHPA 4BDPA 3NAEA 4TSXA 1VRUA 1HQUA 4EHUA 5HOOA 4E7JA 2HHTA 3THWA 4DLGA 4NXNK 5AQWA 1YITN 3P39A 1QSSA 2G8KA 4XIUA 3ZSOA 2HHQA 4JI4K 4BRKA 4CEEA 5LJWA 4DR2K 4KI4A 3SQ0A 2P9PA 4DV2K 3DAWA 2RPIA 3EKSA 1VQ5N 3LP2A 1S1UA 3LP1A 1OH5A 2GV9A 2E5LK 1C0UA 3L8BA 5LMNK 1HKBA 1YJNN 3LDPA 2E2PA 4O55A 4DFKA 3MWPA 2XY6A 1JCGA 3LAMA 3TTDA 3M8PA 5FPDA 2A42A 4CJFA 2HNZA 3S3OA 2A6AA 4G1QA 4B9MA 3VGKA 4W5TA 5GIPA 3A5NC 3PO4A 4DS4A 5AFUA 3I33A 3CCUN 3QIPA 3HJFA 4FLUA 4KHNA 1IO2A 3O08A 3SPZA 3E9OA 1GLBG 3HPGA 1IG9A 3HI0A 1J5OA 3OS2A 2OZSA 4B3MK 5H1SQ 1B9DA 3HOSA 3HYFA 4IWVA 3L3VA 1QQNA 1DKGD 5AQHA 2UYTA 3L6QA 4H8KA 5K14A 1RDCA 4FPBA 3DOLA 4ELUA 4FOEA 2HOEA 3WEEB 4PWDA 4Z4IA 2BTFA 4CEQA 5FPEA 4A57A 3THXB 4OPKA 1VQON 2HHUA 3LDOA 3A5OC 1T8EA 2YHYA 1Q86O 3M5RA 3ZSXA 3UKUA 3AO1A 3J7AP 1VSDA 1RILA 1ZBSA 4U67L 3M3ZA 4B9LA 3MECA 4AILC 4BRGA 5DK5A 3HK2A 4CD1A 4DTXA 1RBUA 4KHWA 3ZETB 3SI6A 3R1XA 5EVZA 3C6UA 4YDUA 2YNFA 4I2PA 4OPAA 2R7YA 1OH6A 3T19A 5HBMA 2W6LA 2E2NA 2V52B 4O5BA 2OPQA 1HYVA 4EIAA 4RTFD 5TKWA 3KD1E 3DRPA 3LP3A 4HHTA 3MEDA 1VAZA 1HNXK 1TL3A 3L2RA 1HMVA 1ESVA 1LW0A 4PL7A 2I7NA 4BACA 4B9UA 4DSKA 1VSJA 3MN7A 4ILGB 5IT9O 2NRRA 4FW1A 3NF6A 3L2UA 1HUXA 2P9PB 3CPEA 1EXQA 1G99A 1TKDA 4CFDA 4B1UB 1KAXA 3AO2A 4FZYA 4JAXA 1K9MO 4HUEA 2O8CA 3TU5A 4R79A 4IG3A 1RDUA 4CEAA 3A5LC 3QINA 1UOCA 3ZSWA 3GDQA 3D0PA 4GV3A 4CBWA 2YX6A 2Q36A 4JK8A 1HPMA 3RMBA 5J2PA 3CJBA 4KHSA 1U48A 4FJNA 3OYAA
chains in the Genus database with same CATH topology
3PUFA 4DQSA 1KFSA 4FXDA 4KPYA 4KTQA 3SCXA 1L3UA 4CGGA 1KCFA 2G8FA 2DFHA 4FW2A 2ZE2A 1RT5A 3ZSVA 2IC3A 1WN7A 4IDKA 2NUBA 1RBSA 1S1XA 1ASVA 1LW2A 1REVA 3NBPA 3HP6A 1LV5A 2HMIA 3HPHA 4OVLA 1TK0A 3S3NA 2E6LA 3MXJA 2F8SA 5DMRA 3OS1A 1CZ9A 3PO5A 2XY7A 4CFBA 3KLEA 3HVTA 2W42A 1A5VA 1RT1A 5KGXA 1NK7A 1SL0A 4NCAA 4HCCA 3B6PA 4CF8A 4EP5A 2D0AA 3PX0A 2GUIA 4DTJA 1TAQA 1NJZA 4J2BA 2HVIA 4FLZA 5FROA 3O4QA 3TAQA 5HRRA 2G8VA 3IRXA 3DRSA 5HP1A 3KD5E 1ZYQA 5HRNA 1XHZA 1HNVA 1BHLA 1WAFA 4KKOA 4JRPA 4IFYA 3NF7A 2HNDA 4QCLA 3V4IA 4ELTA 3V9ZA 1SKSA 4CEDA 3MEGA 4H4MA 4MQ3A 1CZBA 4Z4CA 1NOYA 4B9SA 5SWMA 4KRFA 3MXMA 5KI6A 2YNGA 3D45A 3OYMA 4CCHA 1TGOA 1U04A 4JS4A 4DSIA 4DFJA 3ASMA 3P5JA 1FK9A 3ULDA 3RMAA 4CK1A 2I5JA 4LSNA 2OPRA 1J54A 3CYMA 1ASUA 1JL2A 1K6YA 4AHTA 4Q5VA 3OYJA 4DLEA 1SKWA 3RR7A 4F3OA 1W9HA 2QKKA 3NH1A 3ZSRA 1DTTA 3QNOA 1ZBFA 2AJQA 3O4NA 3V9WA 3KKRA 4BWJA 4CGDA 3QEVA 1T7PA 4O44A 4NYFA 1LAWA 1QSYA 3ZT2A 2D5RA 4CGFA 4CIGA 4OGEA 4M45A 3F73A 2RKIA 1X1PA 1UA0A 4OPJA 1CLQA 4CJKA 3WNEA 1NK0A 1EKEA 3G10A 4RW9A 3EY1A 4FJJA 3P1GA 2KW4A 3RTVA 4DSFA 4FJ7A 3LALA 3QESA 3L2VA 1TKTA 1UWBA 3AVBA 4CJ5A 4N56A 3OYKA 4CF0A 4HTUA 3AA4A 4E7HA 3V81A 1X9WA 1KRPA 3TAEA 3AVIA 2DFFA 4WE1A 3SV4A 3TAFA 1A5WA 4KREA 1FXXA 4QAGA 4I7FA 2KTQA 4KB0A 1WSJA 3ITHA 1NK6A 2Z1GA 4RW6A 3L2WA 1IH7A 1CXUA 2VG7A 1HNIA 3PV8A 1R0AA 1JLAA 3K5OA 4EZ9A 1RT7A 1FKOA 4CF2A 2P1JA 4B9TA 4DQRA 4CFAA 4IFVA 5I42A 4O0IA 1N6QA 1BISA 4M3XA 2D0BA 3SUOA 3E01A 3KLIA 4I2QA 3QEPA 3K57A 3WNHA 1BCMA 5I3UA 4DF4A 1C6VA 4B8AB 4CGHA 4UQGA 3SUQA 4E89A 1WAJA 2PYLA 3H08A 1JKHA 4BE0A 3QIOA 4DWIA 4OLBA 3RRHA 1WSGA 1C1AA 3M8SA 4F3TA 2YNHA 2KFNA 1D5AA 3TARA 4B9NA 5CZ2A 2GBZA 1UAXA 4RW4A 4R5PA 1A5XA 1BIUA 2RN2A 4B8CA 3KIOA 4N5SA 4RW7A 4M3RA 3VQ9A 1RTJA 4W5QA 4F2SA 2HNYA 5C24A 3TWHA 1U49A 2F96A 4E19A 4N76A 3ZT1A 3OYBA 4OKKA 1C0MA 4OKEA 3TR8A 2X78A 3O3FA 4YNQA 3AVAA 1KVBA 2Z1IA 1RDAA 1RCHA 3V1QA 3LWMA 3NGIA 1NK5A 5FRMA 1S6PA 3KK1A 3L2QA 1Q8IA 3CFPA 4KAZA 1BQNA 4FZXC 3DI6A 3LZJA 2X74A 3KJVA 3IS9A 3TANA 3CFRA 3VQCA 4M3UA 2IAJA 2WOMA 4M42A 1ZBHA 4KO0A 1J53A 1VSKA 2JGUA 3T3FA 1BQMA 1VK0A 4B08A 4BE2A 1IKXA 5KRTA 1TL1A 3HP9A 2YHBA 2FBYA 2O4IA 1BI4B 4M3WA 4E3SA 1WNSA 3QNNA 1QE1A 1TAUA 4LH5A 1W0HA 2X6NA 1T05A 3TI0A 4Q0BA 3OVNA 4CEOA 2B5JA 1NK8A 3AO3A 3MAQA 4DSEA 5C25A 3CM5A 2HHWA 3KLFA 5J2QA 3V9XA 1L3TA 3OYHA 4EZ6A 4DFPA 4JRQA 2OYQA 3CQ8A 1MU2A 4C8MA 1LWFA 4NCBA 4I9QA 2IS3A 1QS4A 1Z26A 1S1WA 2ATQA 3OYIA 3DM2A 3JYTA 3JSMA 4DF8A 1UA1A 4FJIA 2BANA 2IGIA 3CFOA 3OJUA 3S3MA 2G8WA 3FFIA 3VQQA 5CYQA 4DTUA 3U6FA 3MEEA 1C0TA 1EP4A 3QEXA 5J1EA 1U4BA 3VQ6A 3QEIA 4JLHA 4IG0A 3OYGA 5KTQA 1SKRA 1BCOA 4C8KA 1T03A 3V1RA 1RTHA 3HL8A 5E41A 4FCYA 2ETJA 1RTDA 4FYDA 2KQ2A 2BDPA 1VSHA 4CJEA 1NJYA 1TK8A 3VQBA 4E7LA 4M3YA 4CJSA 5HRPA 1RBVA 1RT4A 4KB1A 4KI6A 2X6SA 2WONA 3DMJA 4AHUA 3HO1A 4HVJA 3CM6A 4KTZA 4LD0A 3VQ4A 2LSNA 4CHZA 1RT3A 4FZZA 1Q9XA 1JLFA 3AVLA 2HW3A 1Z25A 1TKZA 3SQ2A 3AO4A 3AVGA 2P5OA 1RTIA 4CGIA 4K8XA 4LH4A 3V1OA 2DTUA 1BGXT 2E4LA 2QXFA 3AVFA 3DLGA 4KHYA 4OLAA 4PY5A 3LP0A 3DLKA 4EP4A 1XI1A 4N41A 3AVKA 4FJ8A 2FBTA 1EETA 2OPSA 3U3YA 1KVAA 4LY7A 4FJ9A 3AVMA 5EU7A 3NH0A 3AV9A 2A1RA 4FM2A 4W5RA 1D8YA 4FJ5A 3SV3A 4K8ZA 1RT6A 1WSHA 1WSEA 4AHCA 4ZHRA 3OS0A 1NKEA 3KK3A 2F8TA 5FDLA 1QTMA 1SL1A 4RW8A 3OYFA 3HM9A 3NDKA 2Z1JA 3AA5X 1Y97A 4J2AA 4Z4FA 1TKXA 1GOBA 4BDYA 1ZBIA 2HVHA 3BGRA 3HVRA 1JLBA 2VG5A 3DRRA 2DFEA 4BDZA 5HROA 1I3AA 4CHYA 3M8RA 4CHQA 1RBRA 3KKSA 3NFAA 4MFBA 3TABA 4Z4HA 4LSLA 4DTRA 4ICLA 2B6AA 1YTAA 2JLEA 4DQIA 4CIFA 4FJMA 2HB5A 4W5OA 4DQQA 1X9MA 3TAMA 4DU1A 3PY8A 3DLRA 4HUFA 4Z4GA 3MXIA 3NF9A 5HRSA 1C1BA 3AVNA 2YHAA 1QSLA 1KFDA 2ZD1A 1KLNA 1WLJA 1ZBUA 2XHBA 2Z1HA 4BE1A 2Y1IA 3VA3A 1KTQA 3OY9A 4PUOA 2IDOA 5D3GA 3QEWA 4GVMA 3AA3A 1HPZA 3S9HA 2KZMA 4CERA 3OYDA 3G0ZA 4JS5A 1VSMA 3OYEA 3K58A 3WNGA 3SQ1A 4E0DA 4FM1A 3ZT4A 4CJQA 1O1WA 3NH2A 4OJRA 4DU3A 2QKBA 3NE6A 2VWKA 3DYAA 1GOAA 4DU4A 1L5UA 2Y1JA 2XRIA 1JL1A 4CJPA 2YNIA 1G15A 1VSLA 4FLYA 1VSIA 3UIQA 1DTQA 4ID1A 1NK4A 1IKYA 3OYLA 2G8UA 3AVJA 3SJJA 4CHPA 4DSJA 4DS5A 4BDPA 3NAEA 4TSXA 1VRUA 5T7BA 1HQUA 2A1SA 2VG6A 2FBVA 3K2PA 4E7JA 2HHTA 1J9AA 4GW6A 3SQ4A 4DLGA 2HHXA 4PA1A 4KHUA 4IBNA 1D9DA 1VSFA 4RG8A 1YT3A 4CEZA 3VQ8A 5SZTA 3IG1A 4CF1A 4B9VA 1QSSA 4Z0UA 4XIUA 3ZSOA 3WNFA 2G8KA 2HHQA 3U3GA 4CEEA 4CJWA 3VQ5A 3P83D 4CFCA 1NKBA 4KI4A 1C1CA 3SQ0A 3K5NA 1NKCA 4J2DA 1S6QA 3LZIA 1NJXA 3V9UA 4BWMA 3RRGA 1S5JA 4ELVA 2RPIA 3LAKA 3LP2A 4CJUA 3C95A 2XY5A 1S1UA 1SV5A 3LP1A 4GMJB 1TV6A 2GV9A 3V9SA 1JXBA 4KFBA 3OYCA 4PQUA 1C0UA 3AVCA 3LANA 3L8BA 3PX6A 4C8LA 4O55A 2BGGA 1HRHA 3NCIA 3ZT3A 4DFKA 4Y1DA 3NF8A 3VQEA 1LWCA 2XY6A 2PY5A 3LAMA 3M8PA 2IOCA 4CJFA 2HNZA 1QQCA 3ZCMA 3OJSA 3S3OA 1XHXA 2G8IA 4G1QA 3O3GA 1IKVA 3ALYA 1RBTA 5KRSA 4B9MA 3HSTB 4ID5A 5CZ1A 3DLHA 4W5TA 5FRNA 4E1NA 4CJLA 2EHGA 3HPOA 1N5YA 4FK0A 4FLTA 4FM0A 4CJTA 1RDDA 2O4GA 3PO4A 3I8DA 4DS4A 2KFZA 4FVMA 5CY4A 1L3VA 3QIPA 3HJFA 3EYZA 4FLUA 3ZSQA 3RMDA 1IO2A 1HJRA 4L8RB 4KHNA 2E6MA 3SPZA 1S9GA 4CJ3A 4FJKA 3HPGA 3SPYA 4DTNA 1IG9A 1LAVA 1J5OA 3OS2A 2OZMA 1FKPA 1NJWA 4HUGA 2FC0A 1ASWA 1LWEA 2OZSA 4HCBA 1B92A 4M3ZA 4E1MA 1Q9YA 4CHOA 1B9DA 4DQPA 3HXMA 4FK2A 3HYFA 4CIEA 2VWJA 4DTSA 1U47A 4O4GA 2XY8A 3ZSYA 3LWLA 1TK5A 1VSEA 1HYZA 5KGWA 4J2EA 3L3VA 1JLCA 1X9SA 4ZTFA 3SUPA 2ZQBA 4FJGA 4H8KA 3TAGA 5K14A 4DMNA 3CG7A 3HT3A 1RDCA 4H4OA 4ZTJA 3VQPA 4NYNA 3DOLA 5CYMA 1RT2A 1BI4A 2OPPA 1RDBA 4NCGA 3O3HA 3PX4A 4ELUA 3LDSA 4PWDA 1CXQA 3ISNC 2G8HA 4Z4IA 4CEQA 3KTQA 3F9KA 4OPKA 3VA0A 1S1VA 2HHUA 1T8EA 1RNHA 3ZSXA 3AO1A 3VQAA 1ITGA 1S1TA 1RILA 1VSDA 1NK9A 2ITGA 4M3TA 3VQ7A 1WSFA 3SYZA 4CGJA 4AHRA 3OYNA 4B9LA 4O0JA 3MECA 4CJVA 3K59A 2D0CA 1L3SA 1U45A 1JLGA 4AILC 4AHSA 3ZT0A 3DOKA 5DK5A 4QOZB 1EX4A 2YKNA 3ZSZA 5C42A 1WSIA 3LPTA 3A2FA 3NGYA 3KLGA 3KLHA 4FLXA 2B4JA 3QERA 1SUQA 4F2RA 4OKJA 2QK9A 3HK2A 1QHTA 4DTXA 4CESA 4KV8A 3QLHA 3EZ5A 1RBUA 1VRTA 1KSPA 5JS2A 4KHWA 4N47A 4E7IA 3SI6A 3SNNA 1F21A 3B6OA 1XWLA 1KVCA 3C6UA 3VQDA 3IAYA 4Z4EA 1TVRA 2KZZA 4FJHA 2YNFA 4I2PA 3K5MA 2R7YA 3VN5A 3T19A 4CE9A 3T1AA 4CHNA 2DY4A 4CK2A 3AO5A 1DLOA 5HBMA 2P51A 4DTMA 4FJLA 3AA2A 4E7KA 4O5BA 4DFMA 2P5GA 2OPQA 1GOCA 3K5LA 1JLEA 3I0RA 1HYVA 1YTUA 3NGZA 1JLQA 4FLWA 2FBXA 2OA8A 3KD1E 3KK2A 4I9LA 4CJRA 3SZ2A 5J2MA 3DRPA 3LP3A 4CEFA 4CJ4A 4HHTA 3RMCA 3THVA 1I39A 3NHGA 2Q3SA 3MEDA 4FLVA 1NOZA 3QETA 1TL3A 3L2RA 4DSLA 1YVUA 1HMVA 1JXEA 4F8RA 4DTPA 1B9FA 1LW0A 4B3OA 3QO9A 3TAPA 2HHVA 4DG1A 1HYSA 4BACA 3LPUA 4DTOA 3SUNA 1VSJA 4B9UA 4C8OA 4DSKA 4F4KA 1HQEA 4FW1A 2RF2A 3NF6A 1S9EA 2EX3A 3L2UA 4IKFA 4FJXA 4CF9A 3RWUA 1BL3A 1IKWA 1EXQA 3DLBA 4C8NA 4AH9A 2XO7A 1ZBLA 1TKDA 3C6TA 4CFDA 3AO2A 4FZYA 3M8QA 3L3UA 4OGCA 2YV0X 3RR8A 4HUEA 2PZSA 2HHSA 1XC9A 4AHVA 4YFUA 4IG3A 4CEAA 2YKMA 4W5NA 3QINA 1UOCA 4KHQA 3ZSWA 4CEBA 3D0PA 5J2NA 3V6DA 1SL2A 1KLMA 1BIZA 4M41A 4FK4A 4Y1CA 3I0SA 5JS1A 3BDPA 1D9FA 3RMBA 4KTWA 2PYJA 3AVHA 3DLEA 4CECA 4CK3A 3C94A 5J2PA 5HLFA 4KHSA 1U48A 2BE2A 4FJNA 3OYAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PUF A;  4DQS A;  1KFS A;  4FXD A;  4KPY A;  4KTQ A;  3SCX A;  1L3U A;  4CGG A;  1KCF A;  2G8F A;  2DFH A;  4FW2 A;  2ZE2 A;  1RT5 A;  3ZSV A;  2IC3 A;  1WN7 A;  4IDK A;  2NUB A;  1RBS A;  1S1X A;  1ASV A;  1LW2 A;  1REV A;  3NBP A;  3HP6 A;  1LV5 A;  2HMI A;  3HPH A;  4OVL A;  1TK0 A;  3S3N A;  2E6L A;  3MXJ A;  2F8S A;  5DMR A;  3OS1 A;  1CZ9 A;  3PO5 A;  2XY7 A;  4CFB A;  3KLE A;  3HVT A;  2W42 A;  1A5V A;  1RT1 A;  5KGX A;  1NK7 A;  1SL0 A;  4NCA A;  4HCC A;  3B6P A;  4CF8 A;  4EP5 A;  2D0A A;  3PX0 A;  2GUI A;  4DTJ A;  1TAQ A;  1NJZ A;  4J2B A;  2HVI A;  4FLZ A;  5FRO A;  3O4Q A;  3TAQ A;  5HRR A;  2G8V A;  3IRX A;  3DRS A;  5HP1 A;  3KD5 E;  1ZYQ A;  5HRN A;  1XHZ A;  1HNV A;  1BHL A;  1WAF A;  4KKO A;  4JRP A;  4IFY A;  3NF7 A;  2HND A;  4QCL A;  3V4I A;  4ELT A;  3V9Z A;  1SKS A;  4CED A;  3MEG A;  4H4M A;  4MQ3 A;  1CZB A;  4Z4C A;  1NOY A;  4B9S A;  5SWM A;  4KRF A;  3MXM A;  5KI6 A;  2YNG A;  3D45 A;  3OYM A;  4CCH A;  1TGO A;  1U04 A;  4JS4 A;  4DSI A;  4DFJ A;  3ASM A;  3P5J A;  1FK9 A;  3ULD A;  3RMA A;  4CK1 A;  2I5J A;  4LSN A;  2OPR A;  1J54 A;  3CYM A;  1ASU A;  1JL2 A;  1K6Y A;  4AHT A;  4Q5V A;  3OYJ A;  4DLE A;  1SKW A;  3RR7 A;  4F3O A;  1W9H A;  2QKK A;  3NH1 A;  3ZSR A;  1DTT A;  3QNO A;  1ZBF A;  2AJQ A;  3O4N A;  3V9W A;  3KKR A;  4BWJ A;  4CGD A;  3QEV A;  1T7P A;  4O44 A;  4NYF A;  1LAW A;  1QSY A;  3ZT2 A;  2D5R A;  4CGF A;  4CIG A;  4OGE A;  4M45 A;  3F73 A;  2RKI A;  1X1P A;  1UA0 A;  4OPJ A;  1CLQ A;  4CJK A;  3WNE A;  1NK0 A;  1EKE A;  3G10 A;  4RW9 A;  3EY1 A;  4FJJ A;  3P1G A;  2KW4 A;  3RTV A;  4DSF A;  4FJ7 A;  3LAL A;  3QES A;  3L2V A;  1TKT A;  1UWB A;  3AVB A;  4CJ5 A;  4N56 A;  3OYK A;  4CF0 A;  4HTU A;  3AA4 A;  4E7H A;  3V81 A;  1X9W A;  1KRP A;  3TAE A;  3AVI A;  2DFF A;  4WE1 A;  3SV4 A;  3TAF A;  1A5W A;  4KRE A;  1FXX A;  4QAG A;  4I7F A;  2KTQ A;  4KB0 A;  1WSJ A;  3ITH A;  1NK6 A;  2Z1G A;  4RW6 A;  3L2W A;  1IH7 A;  1CXU A;  2VG7 A;  1HNI A;  3PV8 A;  1R0A A;  1JLA A;  3K5O A;  4EZ9 A;  1RT7 A;  1FKO A;  4CF2 A;  2P1J A;  4B9T A;  4DQR A;  4CFA A;  4IFV A;  5I42 A;  4O0I A;  1N6Q A;  1BIS A;  4M3X A;  2D0B A;  3SUO A;  3E01 A;  3KLI A;  4I2Q A;  3QEP A;  3K57 A;  3WNH A;  1BCM A;  5I3U A;  4DF4 A;  1C6V A;  4B8A B;  4CGH A;  4UQG A;  3SUQ A;  4E89 A;  1WAJ A;  2PYL A;  3H08 A;  1JKH A;  4BE0 A;  3QIO A;  4DWI A;  4OLB A;  3RRH A;  1WSG A;  1C1A A;  3M8S A;  4F3T A;  2YNH A;  2KFN A;  1D5A A;  3TAR A;  4B9N A;  5CZ2 A;  2GBZ A;  1UAX A;  4RW4 A;  4R5P A;  1A5X A;  1BIU A;  2RN2 A;  4B8C A;  3KIO A;  4N5S A;  4RW7 A;  4M3R A;  3VQ9 A;  1RTJ A;  4W5Q A;  4F2S A;  2HNY A;  5C24 A;  3TWH A;  1U49 A;  2F96 A;  4E19 A;  4N76 A;  3ZT1 A;  3OYB A;  4OKK A;  1C0M A;  4OKE A;  3TR8 A;  2X78 A;  3O3F A;  4YNQ A;  3AVA A;  1KVB A;  2Z1I A;  1RDA A;  1RCH A;  3V1Q A;  3LWM A;  3NGI A;  1NK5 A;  5FRM A;  1S6P A;  3KK1 A;  3L2Q A;  1Q8I A;  3CFP A;  4KAZ A;  1BQN A;  4FZX C;  3DI6 A;  3LZJ A;  2X74 A;  3KJV A;  3IS9 A;  3TAN A;  3CFR A;  3VQC A;  4M3U A;  2IAJ A;  2WOM A;  4M42 A;  1ZBH A;  4KO0 A;  1J53 A;  1VSK A;  2JGU A;  3T3F A;  1BQM A;  1VK0 A;  4B08 A;  4BE2 A;  1IKX A;  5KRT A;  1TL1 A;  3HP9 A;  2YHB A;  2FBY A;  2O4I A;  1BI4 B;  4M3W A;  4E3S A;  1WNS A;  3QNN A;  1QE1 A;  1TAU A;  4LH5 A;  1W0H A;  2X6N A;  1T05 A;  3TI0 A;  4Q0B A;  3OVN A;  4CEO A;  2B5J A;  1NK8 A;  3AO3 A;  3MAQ A;  4DSE A;  5C25 A;  3CM5 A;  2HHW A;  3KLF A;  5J2Q A;  3V9X A;  1L3T A;  3OYH A;  4EZ6 A;  4DFP A;  4JRQ A;  2OYQ A;  3CQ8 A;  1MU2 A;  4C8M A;  1LWF A;  4NCB A;  4I9Q A;  2IS3 A;  1QS4 A;  1Z26 A;  1S1W A;  2ATQ A;  3OYI A;  3DM2 A;  3JYT A;  3JSM A;  4DF8 A;  1UA1 A;  4FJI A;  2BAN A;  2IGI A;  3CFO A;  3OJU A;  3S3M A;  2G8W A;  3FFI A;  3VQQ A;  5CYQ A;  4DTU A;  3U6F A;  3MEE A;  1C0T A;  1EP4 A;  3QEX A;  5J1E A;  1U4B A;  3VQ6 A;  3QEI A;  4JLH A;  4IG0 A;  3OYG A;  5KTQ A;  1SKR A;  1BCO A;  4C8K A;  1T03 A;  3V1R A;  1RTH A;  3HL8 A;  5E41 A;  4FCY A;  2ETJ A;  1RTD A;  4FYD A;  2KQ2 A;  2BDP A;  1VSH A;  4CJE A;  1NJY A;  1TK8 A;  3VQB A;  4E7L A;  4M3Y A;  4CJS A;  5HRP A;  1RBV A;  1RT4 A;  4KB1 A;  4KI6 A;  2X6S A;  2WON A;  3DMJ A;  4AHU A;  3HO1 A;  4HVJ A;  3CM6 A;  4KTZ A;  4LD0 A;  3VQ4 A;  2LSN A;  4CHZ A;  1RT3 A;  4FZZ A;  1Q9X A;  1JLF A;  3AVL A;  2HW3 A;  1Z25 A;  1TKZ A;  3SQ2 A;  3AO4 A;  3AVG A;  2P5O A;  1RTI A;  4CGI A;  4K8X A;  4LH4 A;  3V1O A;  2DTU A;  1BGX T;  2E4L A;  2QXF A;  3AVF A;  3DLG A;  4KHY A;  4OLA A;  4PY5 A;  3LP0 A;  3DLK A;  4EP4 A;  1XI1 A;  4N41 A;  3AVK A;  4FJ8 A;  2FBT A;  1EET A;  2OPS A;  3U3Y A;  1KVA A;  4LY7 A;  4FJ9 A;  3AVM A;  5EU7 A;  3NH0 A;  3AV9 A;  2A1R A;  4FM2 A;  4W5R A;  1D8Y A;  4FJ5 A;  3SV3 A;  4K8Z A;  1RT6 A;  1WSH A;  1WSE A;  4AHC A;  4ZHR A;  3OS0 A;  1NKE A;  3KK3 A;  2F8T A;  5FDL A;  1QTM A;  1SL1 A;  4RW8 A;  3OYF A;  3HM9 A;  3NDK A;  2Z1J A;  3AA5 X;  1Y97 A;  4J2A A;  4Z4F A;  1TKX A;  1GOB A;  4BDY A;  1ZBI A;  2HVH A;  3BGR A;  3HVR A;  1JLB A;  2VG5 A;  3DRR A;  2DFE A;  4BDZ A;  5HRO A;  1I3A A;  4CHY A;  3M8R A;  4CHQ A;  1RBR A;  3KKS A;  3NFA A;  4MFB A;  3TAB A;  4Z4H A;  4LSL A;  4DTR A;  4ICL A;  2B6A A;  1YTA A;  2JLE A;  4DQI A;  4CIF A;  4FJM A;  2HB5 A;  4W5O A;  4DQQ A;  1X9M A;  3TAM A;  4DU1 A;  3PY8 A;  3DLR A;  4HUF A;  4Z4G A;  3MXI A;  3NF9 A;  5HRS A;  1C1B A;  3AVN A;  2YHA A;  1QSL A;  1KFD A;  2ZD1 A;  1KLN A;  1WLJ A;  1ZBU A;  2XHB A;  2Z1H A;  4BE1 A;  2Y1I A;  3VA3 A;  1KTQ A;  3OY9 A;  4PUO A;  2IDO A;  5D3G A;  3QEW A;  4GVM A;  3AA3 A;  1HPZ A;  3S9H A;  2KZM A;  4CER A;  3OYD A;  3G0Z A;  4JS5 A;  1VSM A;  3OYE A;  3K58 A;  3WNG A;  3SQ1 A;  4E0D A;  4FM1 A;  3ZT4 A;  4CJQ A;  1O1W A;  3NH2 A;  4OJR A;  4DU3 A;  2QKB A;  3NE6 A;  2VWK A;  3DYA A;  1GOA A;  4DU4 A;  1L5U A;  2Y1J A;  2XRI A;  1JL1 A;  4CJP A;  2YNI A;  1G15 A;  1VSL A;  4FLY A;  1VSI A;  3UIQ A;  1DTQ A;  4ID1 A;  1NK4 A;  1IKY A;  3OYL A;  2G8U A;  3AVJ A;  3SJJ A;  4CHP A;  4DSJ A;  4DS5 A;  4BDP A;  3NAE A;  4TSX A;  1VRU A;  5T7B A;  1HQU A;  2A1S A;  2VG6 A;  2FBV A;  3K2P A;  4E7J A;  2HHT A;  1J9A A;  4GW6 A;  3SQ4 A;  4DLG A;  2HHX A;  4PA1 A;  4KHU A;  4IBN A;  1D9D A;  1VSF A;  4RG8 A;  1YT3 A;  4CEZ A;  3VQ8 A;  5SZT A;  3IG1 A;  4CF1 A;  4B9V A;  1QSS A;  4Z0U A;  4XIU A;  3ZSO A;  3WNF A;  2G8K A;  2HHQ A;  3U3G A;  4CEE A;  4CJW A;  3VQ5 A;  3P83 D;  4CFC A;  1NKB A;  4KI4 A;  1C1C A;  3SQ0 A;  3K5N A;  1NKC A;  4J2D A;  1S6Q A;  3LZI A;  1NJX A;  3V9U A;  4BWM A;  3RRG A;  1S5J A;  4ELV A;  2RPI A;  3LAK A;  3LP2 A;  4CJU A;  3C95 A;  2XY5 A;  1S1U A;  1SV5 A;  3LP1 A;  4GMJ B;  1TV6 A;  2GV9 A;  3V9S A;  1JXB A;  4KFB A;  3OYC A;  4PQU A;  1C0U A;  3AVC A;  3LAN A;  3L8B A;  3PX6 A;  4C8L A;  4O55 A;  2BGG A;  1HRH A;  3NCI A;  3ZT3 A;  4DFK A;  4Y1D A;  3NF8 A;  3VQE A;  1LWC A;  2XY6 A;  2PY5 A;  3LAM A;  3M8P A;  2IOC A;  4CJF A;  2HNZ A;  1QQC A;  3ZCM A;  3OJS A;  3S3O A;  1XHX A;  2G8I A;  4G1Q A;  3O3G A;  1IKV A;  3ALY A;  1RBT A;  5KRS A;  4B9M A;  3HST B;  4ID5 A;  5CZ1 A;  3DLH A;  4W5T A;  5FRN A;  4E1N A;  4CJL A;  2EHG A;  3HPO A;  1N5Y A;  4FK0 A;  4FLT A;  4FM0 A;  4CJT A;  1RDD A;  2O4G A;  3PO4 A;  3I8D A;  4DS4 A;  2KFZ A;  4FVM A;  5CY4 A;  1L3V A;  3QIP A;  3HJF A;  3EYZ A;  4FLU A;  3ZSQ A;  3RMD A;  1IO2 A;  1HJR A;  4L8R B;  4KHN A;  2E6M A;  3SPZ A;  1S9G A;  4CJ3 A;  4FJK A;  3HPG A;  3SPY A;  4DTN A;  1IG9 A;  1LAV A;  1J5O A;  3OS2 A;  2OZM A;  1FKP A;  1NJW A;  4HUG A;  2FC0 A;  1ASW A;  1LWE A;  2OZS A;  4HCB A;  1B92 A;  4M3Z A;  4E1M A;  1Q9Y A;  4CHO A;  1B9D A;  4DQP A;  3HXM A;  4FK2 A;  3HYF A;  4CIE A;  2VWJ A;  4DTS A;  1U47 A;  4O4G A;  2XY8 A;  3ZSY A;  3LWL A;  1TK5 A;  1VSE A;  1HYZ A;  5KGW A;  4J2E A;  3L3V A;  1JLC A;  1X9S A;  4ZTF A;  3SUP A;  2ZQB A;  4FJG A;  4H8K A;  3TAG A;  5K14 A;  4DMN A;  3CG7 A;  3HT3 A;  1RDC A;  4H4O A;  4ZTJ A;  3VQP A;  4NYN A;  3DOL A;  5CYM A;  1RT2 A;  1BI4 A;  2OPP A;  1RDB A;  4NCG A;  3O3H A;  3PX4 A;  4ELU A;  3LDS A;  4PWD A;  1CXQ A;  3ISN C;  2G8H A;  4Z4I A;  4CEQ A;  3KTQ A;  3F9K A;  4OPK A;  3VA0 A;  1S1V A;  2HHU A;  1T8E A;  1RNH A;  3ZSX A;  3AO1 A;  3VQA A;  1ITG A;  1S1T A;  1RIL A;  1VSD A;  1NK9 A;  2ITG A;  4M3T A;  3VQ7 A;  1WSF A;  3SYZ A;  4CGJ A;  4AHR A;  3OYN A;  4B9L A;  4O0J A;  3MEC A;  4CJV A;  3K59 A;  2D0C A;  1L3S A;  1U45 A;  1JLG A;  4AIL C;  4AHS A;  3ZT0 A;  3DOK A;  5DK5 A;  4QOZ B;  1EX4 A;  2YKN A;  3ZSZ A;  5C42 A;  1WSI A;  3LPT A;  3A2F A;  3NGY A;  3KLG A;  3KLH A;  4FLX A;  2B4J A;  3QER A;  1SUQ A;  4F2R A;  4OKJ A;  2QK9 A;  3HK2 A;  1QHT A;  4DTX A;  4CES A;  4KV8 A;  3QLH A;  3EZ5 A;  1RBU A;  1VRT A;  1KSP A;  5JS2 A;  4KHW A;  4N47 A;  4E7I A;  3SI6 A;  3SNN A;  1F21 A;  3B6O A;  1XWL A;  1KVC A;  3C6U A;  3VQD A;  3IAY A;  4Z4E A;  1TVR A;  2KZZ A;  4FJH A;  2YNF A;  4I2P A;  3K5M A;  2R7Y A;  3VN5 A;  3T19 A;  4CE9 A;  3T1A A;  4CHN A;  2DY4 A;  4CK2 A;  3AO5 A;  1DLO A;  5HBM A;  2P51 A;  4DTM A;  4FJL A;  3AA2 A;  4E7K A;  4O5B A;  4DFM A;  2P5G A;  2OPQ A;  1GOC A;  3K5L A;  1JLE A;  3I0R A;  1HYV A;  1YTU A;  3NGZ A;  1JLQ A;  4FLW A;  2FBX A;  2OA8 A;  3KD1 E;  3KK2 A;  4I9L A;  4CJR A;  3SZ2 A;  5J2M A;  3DRP A;  3LP3 A;  4CEF A;  4CJ4 A;  4HHT A;  3RMC A;  3THV A;  1I39 A;  3NHG A;  2Q3S A;  3MED A;  4FLV A;  1NOZ A;  3QET A;  1TL3 A;  3L2R A;  4DSL A;  1YVU A;  1HMV A;  1JXE A;  4F8R A;  4DTP A;  1B9F A;  1LW0 A;  4B3O A;  3QO9 A;  3TAP A;  2HHV A;  4DG1 A;  1HYS A;  4BAC A;  3LPU A;  4DTO A;  3SUN A;  1VSJ A;  4B9U A;  4C8O A;  4DSK A;  4F4K A;  1HQE A;  4FW1 A;  2RF2 A;  3NF6 A;  1S9E A;  2EX3 A;  3L2U A;  4IKF A;  4FJX A;  4CF9 A;  3RWU A;  1BL3 A;  1IKW A;  1EXQ A;  3DLB A;  4C8N A;  4AH9 A;  2XO7 A;  1ZBL A;  1TKD A;  3C6T A;  4CFD A;  3AO2 A;  4FZY A;  3M8Q A;  3L3U A;  4OGC A;  2YV0 X;  3RR8 A;  4HUE A;  2PZS A;  2HHS A;  1XC9 A;  4AHV A;  4YFU A;  4IG3 A;  4CEA A;  2YKM A;  4W5N A;  3QIN A;  1UOC A;  4KHQ A;  3ZSW A;  4CEB A;  3D0P A;  5J2N A;  3V6D A;  1SL2 A;  1KLM A;  1BIZ A;  4M41 A;  4FK4 A;  4Y1C A;  3I0S A;  5JS1 A;  3BDP A;  1D9F A;  3RMB A;  4KTW A;  2PYJ A;  3AVH A;  3DLE A;  4CEC A;  4CK3 A;  3C94 A;  5J2P A;  5HLF A;  4KHS A;  1U48 A;  2BE2 A;  4FJN A;  3OYA A; 
#chains in the Genus database with same CATH topology
 3PUF A;  1WB9 A;  4KTQ A;  1L3U A;  1KCF A;  2QW9 A;  2RHK A;  4FW2 A;  1RT5 A;  1ASV A;  4NB4 A;  4Y0W A;  3OBY A;  4FWM A;  5M1F A;  2HF4 A;  4HTL A;  3HPH A;  5BN8 A;  3CCE N;  3MXJ A;  3NVK A;  4N41 A;  4M3W A;  3VMF B;  2W42 A;  3HVT A;  1RT1 A;  5KGX A;  1SL0 A;  2QXL A;  3B6P A;  3VGL A;  4DTJ A;  4FSV A;  4FLZ A;  5FRO A;  1NGG A;  2G8V A;  3EE8 A;  2E2O A;  4X64 K;  4J8F A;  5AQF A;  4GKK K;  1SKS A;  3MEG A;  4Z4C A;  1NOY A;  2YHX A;  3MX2 A;  3MXM A;  3OYM A;  4CCH A;  3HM8 A;  1TGO A;  1YVN A;  4JS4 A;  3QFP A;  3P5J A;  4WQ5 C;  3ULD A;  4LSN A;  2OPR A;  1J54 A;  2AA4 A;  3RR7 A;  4AHT A;  4Q5V A;  4IOX A;  1SKW A;  5AZI A;  1BOT O;  3O4N A;  1QVF M;  1VHX A;  2QM1 A;  3ZT2 A;  4BR0 A;  3F73 A;  1X1P A;  1CLQ A;  3O8M A;  3BUZ B;  3G10 A;  4RW9 A;  3EY1 A;  4DSF A;  4FJJ A;  3DXM A;  1EO1 A;  2YI1 A;  4CF0 A;  4HTU A;  4E7H A;  2QWM A;  1KRP A;  1HKC A;  3TAF A;  1FXX A;  4QAG A;  4I7F A;  2Z1G A;  1R0A A;  1CXU A;  5GAG P;  2FF3 B;  5AQK A;  2AP1 A;  4M3X A;  2D0B A;  4WQ4 C;  2PBD A;  3CCV N;  2NRW A;  4UQG A;  4CVN E;  2PYL A;  3WXM B;  1TYQ B;  4OLB A;  3CET A;  3CC4 N;  4FWL A;  3RRH A;  1U2V B;  3M8S A;  1RGI A;  2GWK A;  4F3T A;  2YNH A;  5CZ2 A;  4HWI A;  4RW4 A;  1A5X A;  5AQU A;  4JYA K;  3VQ9 A;  4W5Q A;  5C24 A;  2HHH K;  3ZX0 A;  1GLD G;  1Z05 A;  3CJ9 A;  3TR8 A;  3O3F A;  2X78 A;  3AVA A;  1KVB A;  3LWM A;  3NGI A;  1RCH A;  3CJA A;  1NK5 A;  3VEN A;  1Q8I A;  4FZX C;  3LZJ A;  2X74 A;  3VQC A;  2IAJ A;  5M1K A;  1HNW K;  5BR9 A;  2P9N B;  1BQM A;  4M7X A;  1VK0 A;  2E2Q A;  1NGC A;  3CXC M;  1ZC6 A;  5IWA K;  1TAU A;  2X6N A;  1T05 A;  3OVN A;  1N32 K;  2B5J A;  5ELZ A;  4DSE A;  1W7A A;  5EXW A;  4EZ6 A;  4DFP A;  3CCM N;  2OYQ A;  3E9L A;  3G4S N;  4NCB A;  4I9Q A;  2IS3 A;  1QS4 A;  3CF5 L;  2ATQ A;  3JSM A;  2BAN A;  5CR4 A;  4DTU A;  4BRF A;  3U6F A;  1N36 K;  3MEE A;  1C0T A;  1EP4 A;  5J1E A;  3R9P A;  4IG0 A;  5C12 A;  5KTQ A;  3OYG A;  4DV4 K;  3V1R A;  5AQY A;  2FSN A;  4I6M B;  5E41 A;  4FCY A;  2ETJ A;  1RTD A;  4FYD A;  3IMX A;  3WXI A;  1VQM N;  3VOV A;  2OTL N;  3KWI A;  5HRP A;  1RBV A;  4KB1 A;  1T3V A;  4AHU A;  1QVG M;  4JEP A;  3CM6 A;  4HVJ A;  1V4T A;  4K0K K;  5GAD P;  3SQ2 A;  3AO4 A;  2DTU A;  3V1O A;  2QXF A;  4OX9 K;  3LP0 A;  1XI1 A;  5AQR A;  3AVK A;  4BRN A;  1KD1 O;  2OPS A;  4LY7 A;  5BRD A;  4NO7 A;  3NH0 A;  4OO1 J;  4W5R A;  1OKJ A;  2NZT A;  3SV3 A;  4AHC A;  3OS0 A;  4H5N A;  3LDN A;  2O8D A;  3OYF A;  3NDK A;  1C0G A;  3THY B;  1Y97 A;  2IVN A;  3H1Q A;  4J2A A;  4BDY A;  5HRO A;  3M8R A;  4FL9 A;  1RBR A;  4MFB A;  3TAB A;  4DTR A;  4LSL A;  4FJM A;  2WC9 A;  2JLE A;  1YTA A;  2P9S B;  2HB5 A;  2H3G X;  4W5O A;  4A5B A;  1KFD A;  3CMA N;  2ZD1 A;  3SLC A;  1WLJ A;  3MN9 A;  3WUH A;  4BG8 A;  1C0F A;  3OA9 A;  1KTQ A;  4MDB A;  4CER A;  4JS5 A;  3E9P A;  3WNG A;  1NGH A;  1HX1 A;  3NE6 A;  3BZC A;  4DU4 A;  4BR5 A;  2Y1J A;  4K42 A;  5AQP A;  4CJP A;  3UIQ A;  5KPR A;  1NK4 A;  3MMV A;  3SJJ A;  3ZX2 A;  4DSJ A;  3HBT A;  2JWL A;  5T7B A;  2A1S A;  2W40 A;  1QQM A;  2BUP A;  3K2P A;  3SQ4 A;  2HHX A;  4PA1 A;  4IBN A;  4CEZ A;  3CI5 A;  3WXL A;  2EWS A;  3WNF A;  5CHI A;  2VCP A;  3I55 N;  3T1Y K;  3JXU A;  4O8U A;  2PAV A;  3TSU A;  3VQ5 A;  4LFA K;  4B1Y B;  1C1C A;  5E84 A;  5JVH L;  4J2D A;  2CGL A;  3FE1 A;  2D1K A;  5M1N A;  3V9U A;  3LAK A;  4CJU A;  3C95 A;  4A62 A;  2XY5 A;  1SV5 A;  1ATS A;  3V9S A;  4GMJ B;  1TV6 A;  3OYC A;  5E26 A;  3CJC A;  3AVC A;  3PX6 A;  4IO9 L;  4C8L A;  4WYB A;  3ZT3 A;  3J80 O;  4B3R K;  3NF8 A;  3VQE A;  1LWC A;  1VQ4 N;  5MLC Q;  2GEL A;  5M1P A;  1QQC A;  3ZCM A;  3OJS A;  2G8I A;  3FZM A;  2GTD A;  3S41 A;  1IKV A;  5KRS A;  1NLV A;  3HST B;  4ID5 A;  2QWP A;  4E1N A;  4FK0 A;  4FLT A;  4V19 S;  4FM0 A;  1IJJ A;  3CCL N;  5JLH A;  5CY4 A;  1L3V A;  3VEV A;  3RMD A;  1HJR A;  4AF1 A;  4LF9 K;  1QZ6 A;  4BR2 A;  4O5F A;  4DV0 K;  4AM7 A;  4HUG A;  1B92 A;  4M3Z A;  3ULE A;  4BC5 A;  4CHO A;  4DV6 K;  3SMS A;  4DTS A;  4O4G A;  3BEX A;  4J2E A;  1HYZ A;  4ZTF A;  1V4S A;  3TAG A;  4DR1 K;  3FFK B;  4H4O A;  4ZTJ A;  3VQP A;  3O3H A;  5CYM A;  1RT2 A;  5CE3 A;  4BQL A;  2ZGY A;  5BRH A;  1IBM K;  1WBB A;  5AZJ B;  3F9K A;  1Z6R A;  5KQ8 A;  4FO0 A;  3SAF A;  2QEX N;  3O9S A;  3CD6 N;  4LFC K;  1ITG A;  3TPQ A;  5EX5 A;  2ITG A;  4M3T A;  3VQ7 A;  4CGJ A;  2QTD A;  4BRE A;  4AHS A;  3ZT0 A;  4UY8 O;  1EX4 A;  4BRQ A;  5C42 A;  2Y1I A;  4H0Y B;  4FLX A;  3NGY A;  1SUQ A;  4F2R A;  3FGU A;  3U9D A;  4CW7 B;  1KSP A;  4E7I A;  3SNN A;  3O4W A;  3VQD A;  4M7Y A;  2KZZ A;  4BRL A;  3MDQ A;  4MDA A;  3C65 A;  4DV5 K;  3VN5 A;  4CE9 A;  3U9Z A;  3T1A A;  4DR5 K;  2VGM A;  5BN9 A;  5C0Y A;  2VQF K;  4JKF A;  4CK2 A;  3AO5 A;  1DLO A;  4DTM A;  4FJL A;  4QS9 A;  4K25 A;  4E7K A;  1NGJ A;  5BRE A;  2P5G A;  4FLW A;  1IBL K;  2OA8 A;  4I9L A;  4EAH D;  1HLU A;  5LY3 A;  3Q7B A;  4FLV A;  4DSL A;  4PKI A;  4F8R A;  3VET A;  3QO9 A;  3T69 A;  2HHV A;  4DTO A;  3LPU A;  4IJN A;  3SUN A;  5AQX A;  2A3Z A;  1S9E A;  4FJX A;  2ZJP L;  4PKH A;  3RWU A;  4JK9 A;  5ADX A;  4AH9 A;  1ZBL A;  2XO7 A;  3WQT A;  3SAG A;  4OGC A;  2YV0 X;  3RR8 A;  2HHS A;  1EQY A;  1NMD A;  4YFU A;  3VER A;  2YKM A;  4DR6 K;  4DCH A;  3QBX A;  3IKM A;  2V51 B;  2IVP A;  4Y1C A;  5JS1 A;  1XC3 A;  2NRZ A;  2Q0R A;  4DKW A;  2PYJ A;  3AVH A;  1Q18 A;  4CEC A;  3RRG A;  2BE2 A;  4KPY A;  1VQP N;  2F9W A;  3SCX A;  2G8F A;  2DFH A;  3ZSV A;  3OBW A;  2IC3 A;  1WN7 A;  4FPA A;  2NUB A;  4YHH K;  4XH4 A;  1LV5 A;  3S3N A;  3OS1 A;  3J81 O;  4NCA A;  5B8H A;  4HCC A;  2NNW A;  3PX0 A;  5AQN A;  1TAQ A;  4DB3 A;  4NLC A;  2Q1N A;  3O4Q A;  4JKH A;  5HRR A;  3IRX A;  2GX9 A;  3KD5 E;  5HRN A;  1BO5 O;  4JRP A;  2P9L A;  4KKO A;  4IFY A;  3K9K A;  4QCL A;  1S22 A;  2Q2R A;  4MQ3 A;  1CZB A;  4FWR A;  5SWM A;  1I94 K;  5AQZ A;  3CC7 N;  4YOY A;  4DFJ A;  1KC8 O;  3RMA A;  2I5J A;  3OYJ A;  3O9T A;  4DLE A;  3EZW A;  1W9H A;  4M63 C;  1DTT A;  1ZBF A;  3V9W A;  5DM6 L;  1HNZ K;  4BWJ A;  3WT0 A;  4CGD A;  1T7P A;  3ID6 A;  1LAW A;  3F9M A;  1K8K A;  4CIG A;  2KLA A;  3A5M C;  3CC2 N;  1UA0 A;  4OPJ A;  4WQ5 A;  3P1G A;  4FJ7 A;  3LAL A;  3EN9 A;  3L2V A;  1TKT A;  3UB5 A;  1UWB A;  4N56 A;  3V81 A;  1X9W A;  1SZ2 A;  3IDH A;  3M1F A;  2E1Z A;  3SV4 A;  1KAZ A;  1A5W A;  4KB0 A;  3ITH A;  1NK6 A;  3PV8 A;  1IH7 A;  1E3M A;  1HNI A;  2W41 A;  3HTV A;  3K5O A;  3QML A;  1RT7 A;  1FKO A;  4YOV A;  1E4F T;  4CFA A;  5I42 A;  1H1V A;  4WFN L;  1WOQ A;  4XH5 A;  5I3U A;  4CZJ A;  1C6V A;  4B8A B;  4CGH A;  3SUQ A;  1WAJ A;  2ASO A;  3QIO A;  3NMU A;  4DWI A;  4H0V B;  1MWK A;  3ZEU B;  1YXQ A;  3THW B;  1LCU A;  5C15 A;  2P9I B;  2GBZ A;  4R5P A;  4GNI A;  4M3R A;  4JI0 K;  1RTJ A;  2YCH A;  3EE9 A;  4F2S A;  3TSP A;  2F96 A;  4E19 A;  2BH1 A;  3CCQ N;  4OKE A;  2Z1I A;  4NLB A;  2QWL A;  2A5X A;  3V1Q A;  5FRM A;  5AQT A;  1S6P A;  1BQN A;  1NGF A;  3ENO A;  3TAN A;  3CFR A;  4BRM A;  2WOM A;  1ZBH A;  3T3F A;  1TL1 A;  1W2B M;  4E3S A;  2UUA K;  3TI0 A;  4B3S K;  1NK8 A;  5C25 A;  2UUB K;  2HHW A;  3FLC O;  3KLF A;  3RSE A;  2UXC K;  3CQ8 A;  1LWF A;  1XNR K;  4A2B A;  1Z26 A;  3JYT A;  4DV3 K;  2G8W A;  4PKG A;  5CYQ A;  3CCJ N;  3ATV A;  2W6K A;  3FZH A;  1U4B A;  4JLH A;  4IFE A;  4FWO A;  1RTH A;  3HL8 A;  3G71 N;  1BU6 O;  2UUC K;  2VGN A;  1TK8 A;  3U4L A;  4M3Y A;  3HZ6 A;  3AGR A;  3OHR A;  5AZJ A;  2X6S A;  1FW6 A;  3HO1 A;  3I56 N;  4CHZ A;  1RT3 A;  1JLF A;  4RWT A;  1TKZ A;  3AVG A;  2P5O A;  4CGI A;  3AVF A;  4OLA A;  4KHY A;  1DEJ A;  3UKU B;  3R3L A;  3W3D A;  2FBT A;  5F2R A;  3U3Y A;  1KVA A;  1BG3 A;  5EU7 A;  2ZJR L;  4FOI A;  2FSK A;  4ISG A;  1RT6 A;  3WQU A;  3ZX3 A;  3H6E A;  3UKR B;  1WUA A;  3BF3 A;  3N4Q A;  4Z4F A;  3FZL A;  2VG5 A;  3FR0 A;  3M6G A;  2A40 A;  4BDZ A;  4CHY A;  3LDL A;  2UU9 K;  3MK6 A;  4JK7 A;  4CHQ A;  1X9J A;  4Z4H A;  2B6A A;  2DPN A;  3D2E B;  3TAM A;  1K8K B;  2QWR A;  3DLR A;  3NF9 A;  4K43 A;  1QSL A;  3O9R A;  2IDO A;  5D3G A;  3AA3 A;  4BRD A;  2KZM A;  3GL1 A;  3DXM B;  3SQ1 A;  4E0D A;  2FF6 A;  4CJQ A;  1O1W A;  3UE5 A;  4DU3 A;  1YAG A;  2QKB A;  2VWK A;  2E20 A;  3N4P A;  4BRI A;  3L0Q A;  2O8E B;  2GWJ A;  1VSI A;  3R8E A;  3OYL A;  5AQJ A;  2ZWH A;  4KH5 A;  3O1B A;  3LDQ A;  2FBV A;  2O8B B;  4GW6 A;  4IO8 A;  3CME N;  3T1H K;  1RFQ A;  3MN5 A;  3VQ8 A;  3IG1 A;  4B9V A;  4Z0U A;  1RDW X;  1E4G T;  3JS6 A;  1QHA A;  4CJW A;  4WF9 L;  1VQ8 N;  1N34 K;  4BWM A;  4QS7 A;  3O5B A;  4ELV A;  4BRC A;  5FPN A;  5JVG L;  1D4X A;  1JXB A;  4KFB A;  4MLH A;  4PQU A;  1NMN A;  4JD2 A;  2BGG A;  3NCI A;  4KH6 A;  3DJC A;  2IOC A;  4BGB A;  2O8F B;  1XHX A;  4U7B A;  3O3G A;  1RBT A;  3H45 C;  3DLH A;  2CGJ A;  4CJL A;  3HPO A;  1N5Y A;  4BR7 A;  3VTI A;  3CCR N;  5GIO A;  4JKA A;  4BR9 A;  3L4I A;  2P9U B;  3EYZ A;  4L8R B;  1S9G A;  4CJ3 A;  4FJK A;  2OZM A;  1NJW A;  3O1W A;  3C0B A;  2FC0 A;  5LJV A;  4HCB A;  2YJE A;  3C7N B;  4CJ7 A;  4DQP A;  3HXM A;  4CIE A;  2VWJ A;  1U47 A;  3ZSY A;  1VSE A;  5KGW A;  5BRF A;  1JLC A;  2Q97 A;  1X9S A;  3SUP A;  4B3T K;  2ZQB A;  4YDU C;  4FJG A;  4WFA L;  5GAE P;  4LC9 B;  3SAH A;  3TSQ A;  3VEX A;  4NYN A;  4JKG A;  1NWK A;  4XEI A;  1RDB A;  4NCG A;  3SBG A;  3LDS A;  1MA9 B;  4DQ8 A;  1CXQ A;  2G8H A;  1GLL O;  1RNH A;  3RSE B;  3VQA A;  1S1T A;  2P9K B;  2QI2 A;  1WSF A;  2HBM A;  3SYZ A;  4AHR A;  1SQK A;  4O0J A;  3O9U A;  1P8Z A;  2D0C A;  4CJV A;  1L3S A;  1NBW A;  4CBU A;  2YKN A;  3CQY A;  3ZSZ A;  5BPM A;  1WSI A;  3CIP A;  3A2F A;  3LPT A;  4KBO A;  3OTO K;  3KLH A;  2B4J A;  3QER A;  4GV9 A;  2QK9 A;  5TKY A;  1QHT A;  1JCF A;  1K73 O;  3QLH A;  3EZ5 A;  4H0P A;  5JS2 A;  4Z4E A;  1TVR A;  5AZI B;  4FJH A;  1WBD A;  3K5M A;  3W0L A;  2P9U A;  4BR4 A;  4CHN A;  1U6Z A;  2DY4 A;  3PIP L;  2P51 A;  3HOT A;  4DFM A;  5C2F A;  1JLE A;  2QWQ A;  5AQS A;  3NGZ A;  2FBX A;  5J2M A;  4GKJ K;  3O9Q A;  3BY5 A;  3NHG A;  1CZA N;  1KAY A;  3VF2 A;  1NOZ A;  4B1W B;  1GLF O;  3TAP A;  4DG1 A;  2ZGZ A;  4C8O A;  1HQE A;  2RF2 A;  3EKU A;  2EX3 A;  4IKF A;  3K9J A;  4CF9 A;  5ADX H;  3NVM A;  1IKW A;  3KVG A;  3DLB A;  4C8N A;  3M8Q A;  2CGK A;  3SBT A;  5HL7 L;  1NNE A;  4B9Q A;  4W5N A;  4KHQ A;  4H5R A;  4LF6 K;  4JNE A;  3V6D A;  3AY9 A;  1BIZ A;  4M41 A;  3ZLJ A;  3I0S A;  5GAH P;  1M90 O;  1D9F A;  4YOU A;  2O8B A;  3DLE A;  1N33 K;  3C94 A;  4ILH A;  1Q81 O;  3DXK A;  3DLL L;  4DQS A;  1KFS A;  4BC2 A;  1TUY A;  2F7T A;  1FJG K;  1BA1 A;  3C6H A;  4QS8 A;  2CH5 A;  1S1X A;  3MWT A;  4GY2 B;  4BC4 A;  3J8A A;  3D2E A;  3HP6 A;  1XMQ K;  2HMI A;  1TK0 A;  3KZB A;  2E6L A;  2F8S A;  2XY7 A;  3KLE A;  1A5V A;  1QZ5 A;  1JCE A;  4EP5 A;  2D0A A;  1NJZ A;  4J2B A;  3ID8 A;  4IEI A;  1ZYQ A;  4C1N I;  1HNV A;  1WAF A;  4YY3 K;  3NF7 A;  3V4I A;  1HJO A;  3SK3 A;  4CED A;  4H4M A;  1NGE A;  2ZJQ L;  2F9T A;  3D45 A;  4JI5 K;  1U04 A;  3QIC A;  4DSI A;  1FK9 A;  4CK1 A;  3CYM A;  1NM1 A;  4H0X B;  4DV7 K;  1GLE G;  4LFB K;  2QKK A;  3NH1 A;  4JKC A;  4A59 A;  3QEV A;  2RE2 A;  4NYF A;  1IV0 A;  3GG4 A;  4CGF A;  4X62 K;  3MCP A;  2HBL A;  2HBK A;  4CJK A;  4DHY A;  3D2F B;  2KW4 A;  1T6C A;  4H03 B;  4DR3 K;  2HBJ A;  3AVB A;  5AQG A;  4CJ5 A;  3OYK A;  3AA4 A;  2P9I A;  5BPL A;  3TAE A;  4WE1 A;  2KTQ A;  1WSJ A;  3R6M A;  1VQL N;  4FWN A;  4WCE L;  4CF2 A;  2P1J A;  1N8R O;  3VES A;  4DQR A;  3BF1 A;  4O0I A;  1N6Q A;  3QEP A;  3K57 A;  3WNH A;  5AQQ A;  5JMV A;  3QB0 A;  1ILY A;  4DUY K;  1WSG A;  3PLA A;  1C1A A;  1OVY A;  3HRG A;  2KFN A;  4B9N A;  1UAX A;  1BIU A;  2RN2 A;  1YIJ N;  2ZM6 K;  4RW7 A;  5AQI A;  1U49 A;  3EL2 A;  3VTH A;  4OKK A;  4BGA A;  1C0M A;  3GE1 A;  1RDA A;  4KAZ A;  5GIN A;  3DI6 A;  3KJV A;  3IS9 A;  4H5W A;  4FVU A;  4BRP A;  1J53 A;  2JGU A;  3JAM O;  1EWR A;  3LM9 A;  4L3Q A;  4BE2 A;  5AJ3 K;  3DWL A;  2FBY A;  1BI4 B;  4CZK A;  1W0H A;  3CQX A;  4Q0B A;  2P9L B;  1IG8 A;  3THX A;  5KPT A;  5EY4 A;  3U8X A;  3V9X A;  3OYH A;  3KHY A;  1YHQ N;  2IVO A;  5FPM A;  1S1W A;  4YOT A;  4DF8 A;  3DM2 A;  2IGI A;  3VQQ A;  4CD3 A;  3QEX A;  4MO4 A;  1T44 A;  3VQ6 A;  2HMP A;  2O8C B;  1BCO A;  4A2A A;  1VQN N;  2JWK A;  1DT9 A;  1NJY A;  3J7Z O;  4CJS A;  1RT4 A;  3SMP A;  3THY A;  3VQ4 A;  2LSN A;  4FZZ A;  1Q9X A;  1ATN A;  1Z25 A;  5AQM A;  4EFH A;  1W97 L;  2OTJ N;  4FWQ A;  3CHW A;  2WTU A;  2E4L A;  4EP4 A;  2UXD K;  4FJ8 A;  5A2Q O;  4B1Z A;  2V7Y A;  2QA4 N;  4LF7 K;  4A5A A;  2A1R A;  4FM2 A;  1D8Y A;  4BY9 C;  2NRT A;  3KK3 A;  4FWS A;  3E66 A;  5FDL A;  3CJ7 A;  2I7P A;  3HM9 A;  1SL1 A;  3A0I X;  5EOY A;  3ZET A;  4BVO A;  1TKX A;  1GOB A;  2HVH A;  2P9S A;  3DRR A;  1MDU B;  3T7Z A;  3NFA A;  3KKS A;  4PHT X;  4MLE A;  4DQI A;  4DUZ K;  4IDH A;  4DQQ A;  1NGI A;  4DU1 A;  3PY8 A;  2VQE K;  1QQO A;  4Z4G A;  3ZYY X;  3I8B A;  1TYQ A;  5HRS A;  5KPZ A;  2YHA A;  1ATR A;  2Z1H A;  3BP8 A;  4BE1 A;  3VA3 A;  2D4W A;  4PUO A;  4GVM A;  1XUP O;  3S9H A;  3OYD A;  3H3O B;  1BWF O;  3K58 A;  4FM1 A;  3ZT4 A;  1XMO K;  4OJR A;  1X3M A;  1NGB A;  2E88 A;  1Q7Y O;  2PFU A;  1GOA A;  3DYA A;  4JI6 K;  1JL1 A;  1G15 A;  4FWK A;  1DTQ A;  3MCA B;  4YOX A;  3AVJ A;  3WXK A;  4DS5 A;  1X3N A;  1GLA G;  2VG6 A;  4LF5 K;  3EEQ A;  2ASM A;  1J9A A;  4FWP A;  4RCH A;  4KHU A;  1Q82 O;  1D9D A;  1VSF A;  4RG8 A;  4JI3 K;  1YT3 A;  5SZT A;  3J7Y P;  4CF1 A;  1VQ6 N;  3U3G A;  4JI2 K;  2F4V K;  3P83 D;  4CFC A;  1NKB A;  4LF8 K;  1XNQ K;  3IUC A;  3K5N A;  1NKC A;  3LM2 A;  4BQZ A;  1S6Q A;  5F1X A;  4BG9 A;  2GUP A;  3LZI A;  4C1N K;  1NJX A;  3PSF A;  1S5J A;  3HSC A;  3VGM A;  1BA0 A;  4BC3 A;  1J6Z A;  3LAN A;  2HF3 A;  4EHT A;  1NGD A;  1HRH A;  1OH8 A;  4Y1D A;  4JHD A;  2PY5 A;  2HST A;  3VEW A;  3ALY A;  5CZ1 A;  5FRN A;  1DGK N;  2EHG A;  4CJT A;  1RDD A;  2O4G A;  4JKD A;  3I8D A;  3ENH A;  2QWN A;  2KFZ A;  4JV5 K;  4FVM A;  3B8A X;  3AAR A;  3ZSQ A;  4CZF A;  2E6M A;  4O8K A;  2P9K A;  4DTN A;  1LAV A;  3SPY A;  2ZF5 O;  1FKP A;  1ASW A;  1LWE A;  1J5E K;  4E1M A;  1Q9Y A;  4FK2 A;  3D6R A;  2XY8 A;  3LWL A;  4E1J A;  1TK5 A;  4OPH A;  2UXB K;  1VQ7 N;  4DMN A;  3CG7 A;  2KHO A;  3HT3 A;  3H1V X;  5M1O A;  3PX4 A;  5C2D A;  1BI4 A;  2OPP A;  4Z94 A;  1HKG A;  3ISN C;  4DR7 K;  3RVC A;  3KTQ A;  3VA0 A;  1S1V A;  2NLX A;  2QWO A;  1NK9 A;  3PIO L;  3PSI A;  5LL6 Z;  3OYN A;  1KQS M;  3K59 A;  4G9Z A;  1U45 A;  1JLG A;  2ITM A;  3DOK A;  4QOZ B;  4H5V A;  3F2K A;  3L4Q A;  4KH4 A;  3KLG A;  4FJI A;  4OKJ A;  4CES A;  4KV8 A;  4CZM A;  1VRT A;  1LOT B;  3VF4 A;  4N47 A;  5BR8 K;  1F21 A;  3B6O A;  1XWL A;  1KVC A;  1T6D A;  3IAY A;  3KWG A;  2E8A A;  5AQL A;  3VPZ A;  4B1X B;  3QDK A;  1XQS C;  2VYP A;  4F9O A;  3AA2 A;  1OVQ A;  4ISF A;  3MX5 A;  3K5L A;  1GOC A;  3I0R A;  1YTU A;  1JLQ A;  5AR0 A;  3KK2 A;  3SZ2 A;  4CJR A;  4CEF A;  4CJ4 A;  2E1Y A;  3RMC A;  3THV A;  1I39 A;  3GOI A;  2Q3S A;  3ZEU A;  3QET A;  2NRX A;  4BRO A;  1YVU A;  1JXE A;  4B1V A;  3CCS N;  1B9F A;  4DTP A;  4B3O A;  1HYS A;  4F4K A;  4AQY K;  4K41 A;  1BL3 A;  3MN6 A;  3C6T A;  5AQV A;  4MO5 A;  3L3U A;  1Y64 A;  2PZS A;  1JJ2 M;  4IZ9 A;  5I9E B;  1XC9 A;  4JD2 B;  4AHV A;  4JI1 K;  3P4I A;  4CEB A;  5J2N A;  1SL2 A;  1KLM A;  4FK4 A;  3C7N A;  2D0O A;  3P31 A;  3QFU A;  3BDP A;  4KTW A;  4CK3 A;  2V7Z A;  5HLF A;  1S72 N;  4FXD A;  4CGG A;  2ZE2 A;  2ASP A;  4IDK A;  1RBS A;  1LW2 A;  1REV A;  3NBP A;  3E1Y A;  4OVL A;  2CH6 A;  4CZG A;  5DMR A;  1CZ9 A;  3PO5 A;  4CFB A;  2O8E A;  4WQ4 A;  3ULE B;  1NK7 A;  1VQ9 N;  4CF8 A;  5C10 A;  2HVI A;  2GUI A;  3TAQ A;  3DRS A;  3TTF A;  5HP1 A;  1NGA A;  3D7E O;  5DM7 L;  3H3N O;  1XHZ A;  1BHL A;  5JIC A;  3VEO A;  4ILJ A;  2HND A;  1SAZ A;  5F0X A;  1KXP A;  3DXK B;  4JKB A;  4ELT A;  3V9Z A;  4KRF A;  3CPW M;  4B9S A;  1IBK K;  5KI6 A;  4DR4 K;  2J4R A;  2YNG A;  3VEZ A;  3ASM A;  5LMU K;  3Q7C A;  1JL2 A;  1ASU A;  1K6Y A;  3KK7 A;  4F3O A;  4H0T B;  2NRH A;  4XH1 A;  3ZSR A;  3QNO A;  2FLO A;  2AJQ A;  4JKE A;  3KKR A;  4H0O A;  1R59 O;  4O44 A;  1QSY A;  2A41 A;  2D5R A;  1K8A O;  4OGE A;  4M45 A;  2RKI A;  3FZK A;  5KQD A;  2WBN A;  3WNE A;  2Q31 A;  1NK0 A;  1EKE A;  4IJA A;  2D0P A;  3RTV A;  3QES A;  4C23 A;  3F5T A;  3AVI A;  3IFR A;  2DFF A;  4NXM K;  2WFB A;  4CI6 A;  3G6E N;  4KRE A;  1SS6 A;  1OH7 A;  2WUS A;  3TTC A;  4AM6 A;  4GVE A;  4RW6 A;  4K8Z A;  3L2W A;  2VG7 A;  4EZ9 A;  1JLA A;  4JN4 A;  4IEE A;  1YJ9 N;  4B9T A;  4IFV A;  1BIS A;  3SUO A;  3P38 A;  3E01 A;  3KLI A;  4I2Q A;  3GBT A;  1BCM A;  4DF4 A;  1YF5 L;  4E89 A;  3H08 A;  1JKH A;  4IXC A;  1HR0 K;  3ATU A;  4BE0 A;  3AGK A;  3D2F A;  3UKR A;  3QBW A;  1D5A A;  4X66 K;  3TAR A;  4IOA L;  1O13 A;  4B8C A;  3KIO A;  4N5S A;  4BRA A;  1BDG A;  2HNY A;  3TWH A;  4N76 A;  3ZT1 A;  3OYB A;  4H5T A;  4CZH A;  4CZE A;  4YNQ A;  4JI7 K;  3KK1 A;  3L2Q A;  3CFP A;  4CZL A;  4PL8 A;  2YJF A;  4A61 A;  4M3U A;  4M42 A;  5FLX O;  4CBX A;  4KO0 A;  1VSK A;  4B08 A;  4I6M A;  1IKX A;  2GEM A;  4JHD B;  3HP9 A;  5KRT A;  2YHB A;  2O4I A;  1GLC G;  3QNN A;  1WNS A;  1QE1 A;  2P9N A;  1YJW N;  4LH5 A;  4CEO A;  3AO3 A;  3MAQ A;  1S3X A;  3CM5 A;  5J2Q A;  1YI2 N;  1L3T A;  5M1Q A;  4JRQ A;  3O80 A;  1MU2 A;  4C8M A;  3OYI A;  4JI8 K;  1UA1 A;  4BVP A;  3S3M A;  3OJU A;  3CFO A;  3CER A;  3FFI A;  5BPN A;  3SJH A;  3QEI A;  3H46 O;  1SKR A;  2OAN A;  3AAQ A;  4C8K A;  1T03 A;  1U2V A;  2FXU A;  2KQ2 A;  2BDP A;  1VSH A;  4YOW A;  4CJE A;  3VQB A;  2VWB A;  4E7L A;  2O8F A;  3OW2 M;  2OCE A;  4KI6 A;  4LF4 K;  4JKG B;  3DMJ A;  2WON A;  4KTZ A;  4BRH A;  4LD0 A;  1EWQ A;  3C6A A;  2IIR A;  3LL3 A;  3AVL A;  2HW3 A;  4IOC L;  1RTI A;  4K8X A;  4LH4 A;  1BGX T;  3VEY A;  3DLG A;  4PY5 A;  4YOR A;  3DLK A;  4GV6 A;  5AQO A;  1EET A;  1NJI O;  3ENB A;  4ISE A;  3AAP A;  4FJ9 A;  3AVM A;  3AV9 A;  1TUU A;  1VQK N;  4FJ5 A;  3O6W A;  1WSH A;  1WSE A;  4ZHR A;  4X65 K;  1MWM A;  1YUW A;  1NKE A;  2F8T A;  5JLF A;  1QTM A;  4DV1 K;  4RW8 A;  1NU0 A;  2Z1J A;  3VF6 A;  2KKZ A;  3AA5 X;  1ZBI A;  2FSJ A;  3CJ1 A;  3BGR A;  3HVR A;  1JLB A;  3WEE A;  1ZXO A;  2DFE A;  3G25 A;  1I3A A;  2YHW A;  4KHP K;  4ICL A;  4CIF A;  1X9M A;  4HUF A;  3MXI A;  1C1B A;  3AVN A;  1KLN A;  1ZBU A;  2XHB A;  1GLJ O;  3K0S A;  2Q0U A;  3OY9 A;  3FZF A;  3QEW A;  2O8D B;  1HPZ A;  1NG9 A;  3EO3 A;  3G0Z A;  1VSM A;  3OYE A;  3A8Y A;  3NH2 A;  5AFU H;  2NRV A;  4WFB L;  3BZK A;  1L5U A;  1M1K O;  1P90 A;  1BUP A;  2XRI A;  4CZI A;  3WXJ A;  2YNI A;  1VSL A;  4FLY A;  4ID1 A;  1IKY A;  2G8U A;  4CHP A;  4BDP A;  3NAE A;  4TSX A;  1VRU A;  1HQU A;  4EHU A;  5HOO A;  4E7J A;  2HHT A;  3THW A;  4DLG A;  4NXN K;  5AQW A;  1YIT N;  3P39 A;  1QSS A;  2G8K A;  4XIU A;  3ZSO A;  2HHQ A;  4JI4 K;  4BRK A;  4CEE A;  5LJW A;  4DR2 K;  4KI4 A;  3SQ0 A;  2P9P A;  4DV2 K;  3DAW A;  2RPI A;  3EKS A;  1VQ5 N;  3LP2 A;  1S1U A;  3LP1 A;  1OH5 A;  2GV9 A;  2E5L K;  1C0U A;  3L8B A;  5LMN K;  1HKB A;  1YJN N;  3LDP A;  2E2P A;  4O55 A;  4DFK A;  3MWP A;  2XY6 A;  1JCG A;  3LAM A;  3TTD A;  3M8P A;  5FPD A;  2A42 A;  4CJF A;  2HNZ A;  3S3O A;  2A6A A;  4G1Q A;  4B9M A;  3VGK A;  4W5T A;  5GIP A;  3A5N C;  3PO4 A;  4DS4 A;  5AFU A;  3I33 A;  3CCU N;  3QIP A;  3HJF A;  4FLU A;  4KHN A;  1IO2 A;  3O08 A;  3SPZ A;  3E9O A;  1GLB G;  3HPG A;  1IG9 A;  3HI0 A;  1J5O A;  3OS2 A;  2OZS A;  4B3M K;  5H1S Q;  1B9D A;  3HOS A;  3HYF A;  4IWV A;  3L3V A;  1QQN A;  1DKG D;  5AQH A;  2UYT A;  3L6Q A;  4H8K A;  5K14 A;  1RDC A;  4FPB A;  3DOL A;  4ELU A;  4FOE A;  2HOE A;  3WEE B;  4PWD A;  4Z4I A;  2BTF A;  4CEQ A;  5FPE A;  4A57 A;  3THX B;  4OPK A;  1VQO N;  2HHU A;  3LDO A;  3A5O C;  1T8E A;  2YHY A;  1Q86 O;  3M5R A;  3ZSX A;  3UKU A;  3AO1 A;  3J7A P;  1VSD A;  1RIL A;  1ZBS A;  4U67 L;  3M3Z A;  4B9L A;  3MEC A;  4AIL C;  4BRG A;  5DK5 A;  3HK2 A;  4CD1 A;  4DTX A;  1RBU A;  4KHW A;  3ZET B;  3SI6 A;  3R1X A;  5EVZ A;  3C6U A;  4YDU A;  2YNF A;  4I2P A;  4OPA A;  2R7Y A;  1OH6 A;  3T19 A;  5HBM A;  2W6L A;  2E2N A;  2V52 B;  4O5B A;  2OPQ A;  1HYV A;  4EIA A;  4RTF D;  5TKW A;  3KD1 E;  3DRP A;  3LP3 A;  4HHT A;  3MED A;  1VAZ A;  1HNX K;  1TL3 A;  3L2R A;  1HMV A;  1ESV A;  1LW0 A;  4PL7 A;  2I7N A;  4BAC A;  4B9U A;  4DSK A;  1VSJ A;  3MN7 A;  4ILG B;  5IT9 O;  2NRR A;  4FW1 A;  3NF6 A;  3L2U A;  1HUX A;  2P9P B;  3CPE A;  1EXQ A;  1G99 A;  1TKD A;  4CFD A;  4B1U B;  1KAX A;  3AO2 A;  4FZY A;  4JAX A;  1K9M O;  4HUE A;  2O8C A;  3TU5 A;  4R79 A;  4IG3 A;  1RDU A;  4CEA A;  3A5L C;  3QIN A;  1UOC A;  3ZSW A;  3GDQ A;  3D0P A;  4GV3 A;  4CBW A;  2YX6 A;  2Q36 A;  4JK8 A;  1HPM A;  3RMB A;  5J2P A;  3CJB A;  4KHS A;  1U48 A;  4FJN A;  3OYA A; 
#chains in the Genus database with same CATH homology
 3PUF A;  4DQS A;  1KFS A;  4FXD A;  4KPY A;  4KTQ A;  3SCX A;  1L3U A;  4CGG A;  1KCF A;  2G8F A;  2DFH A;  4FW2 A;  2ZE2 A;  1RT5 A;  3ZSV A;  2IC3 A;  1WN7 A;  4IDK A;  2NUB A;  1RBS A;  1S1X A;  1ASV A;  1LW2 A;  1REV A;  3NBP A;  3HP6 A;  1LV5 A;  2HMI A;  3HPH A;  4OVL A;  1TK0 A;  3S3N A;  2E6L A;  3MXJ A;  2F8S A;  5DMR A;  3OS1 A;  1CZ9 A;  3PO5 A;  2XY7 A;  4CFB A;  3KLE A;  3HVT A;  2W42 A;  1A5V A;  1RT1 A;  5KGX A;  1NK7 A;  1SL0 A;  4NCA A;  4HCC A;  3B6P A;  4CF8 A;  4EP5 A;  2D0A A;  3PX0 A;  2GUI A;  4DTJ A;  1TAQ A;  1NJZ A;  4J2B A;  2HVI A;  4FLZ A;  5FRO A;  3O4Q A;  3TAQ A;  5HRR A;  2G8V A;  3IRX A;  3DRS A;  5HP1 A;  3KD5 E;  1ZYQ A;  5HRN A;  1XHZ A;  1HNV A;  1BHL A;  1WAF A;  4KKO A;  4JRP A;  4IFY A;  3NF7 A;  2HND A;  4QCL A;  3V4I A;  4ELT A;  3V9Z A;  1SKS A;  4CED A;  3MEG A;  4H4M A;  4MQ3 A;  1CZB A;  4Z4C A;  1NOY A;  4B9S A;  5SWM A;  4KRF A;  3MXM A;  5KI6 A;  2YNG A;  3D45 A;  3OYM A;  4CCH A;  1TGO A;  1U04 A;  4JS4 A;  4DSI A;  4DFJ A;  3ASM A;  3P5J A;  1FK9 A;  3ULD A;  3RMA A;  4CK1 A;  2I5J A;  4LSN A;  2OPR A;  1J54 A;  3CYM A;  1ASU A;  1JL2 A;  1K6Y A;  4AHT A;  4Q5V A;  3OYJ A;  4DLE A;  1SKW A;  3RR7 A;  4F3O A;  1W9H A;  2QKK A;  3NH1 A;  3ZSR A;  1DTT A;  3QNO A;  1ZBF A;  2AJQ A;  3O4N A;  3V9W A;  3KKR A;  4BWJ A;  4CGD A;  3QEV A;  1T7P A;  4O44 A;  4NYF A;  1LAW A;  1QSY A;  3ZT2 A;  2D5R A;  4CGF A;  4CIG A;  4OGE A;  4M45 A;  3F73 A;  2RKI A;  1X1P A;  1UA0 A;  4OPJ A;  1CLQ A;  4CJK A;  3WNE A;  1NK0 A;  1EKE A;  3G10 A;  4RW9 A;  3EY1 A;  4FJJ A;  3P1G A;  2KW4 A;  3RTV A;  4DSF A;  4FJ7 A;  3LAL A;  3QES A;  3L2V A;  1TKT A;  1UWB A;  3AVB A;  4CJ5 A;  4N56 A;  3OYK A;  4CF0 A;  4HTU A;  3AA4 A;  4E7H A;  3V81 A;  1X9W A;  1KRP A;  3TAE A;  3AVI A;  2DFF A;  4WE1 A;  3SV4 A;  3TAF A;  1A5W A;  4KRE A;  1FXX A;  4QAG A;  4I7F A;  2KTQ A;  4KB0 A;  1WSJ A;  3ITH A;  1NK6 A;  2Z1G A;  4RW6 A;  3L2W A;  1IH7 A;  1CXU A;  2VG7 A;  1HNI A;  3PV8 A;  1R0A A;  1JLA A;  3K5O A;  4EZ9 A;  1RT7 A;  1FKO A;  4CF2 A;  2P1J A;  4B9T A;  4DQR A;  4CFA A;  4IFV A;  5I42 A;  4O0I A;  1N6Q A;  1BIS A;  4M3X A;  2D0B A;  3SUO A;  3E01 A;  3KLI A;  4I2Q A;  3QEP A;  3K57 A;  3WNH A;  1BCM A;  5I3U A;  4DF4 A;  1C6V A;  4B8A B;  4CGH A;  4UQG A;  3SUQ A;  4E89 A;  1WAJ A;  2PYL A;  3H08 A;  1JKH A;  4BE0 A;  3QIO A;  4DWI A;  4OLB A;  3RRH A;  1WSG A;  1C1A A;  3M8S A;  4F3T A;  2YNH A;  2KFN A;  1D5A A;  3TAR A;  4B9N A;  5CZ2 A;  2GBZ A;  1UAX A;  4RW4 A;  4R5P A;  1A5X A;  1BIU A;  2RN2 A;  4B8C A;  3KIO A;  4N5S A;  4RW7 A;  4M3R A;  3VQ9 A;  1RTJ A;  4W5Q A;  4F2S A;  2HNY A;  5C24 A;  3TWH A;  1U49 A;  2F96 A;  4E19 A;  4N76 A;  3ZT1 A;  3OYB A;  4OKK A;  1C0M A;  4OKE A;  3TR8 A;  2X78 A;  3O3F A;  4YNQ A;  3AVA A;  1KVB A;  2Z1I A;  1RDA A;  1RCH A;  3V1Q A;  3LWM A;  3NGI A;  1NK5 A;  5FRM A;  1S6P A;  3KK1 A;  3L2Q A;  1Q8I A;  3CFP A;  4KAZ A;  1BQN A;  4FZX C;  3DI6 A;  3LZJ A;  2X74 A;  3KJV A;  3IS9 A;  3TAN A;  3CFR A;  3VQC A;  4M3U A;  2IAJ A;  2WOM A;  4M42 A;  1ZBH A;  4KO0 A;  1J53 A;  1VSK A;  2JGU A;  3T3F A;  1BQM A;  1VK0 A;  4B08 A;  4BE2 A;  1IKX A;  5KRT A;  1TL1 A;  3HP9 A;  2YHB A;  2FBY A;  2O4I A;  1BI4 B;  4M3W A;  4E3S A;  1WNS A;  3QNN A;  1QE1 A;  1TAU A;  4LH5 A;  1W0H A;  2X6N A;  1T05 A;  3TI0 A;  4Q0B A;  3OVN A;  4CEO A;  2B5J A;  1NK8 A;  3AO3 A;  3MAQ A;  4DSE A;  5C25 A;  3CM5 A;  2HHW A;  3KLF A;  5J2Q A;  3V9X A;  1L3T A;  3OYH A;  4EZ6 A;  4DFP A;  4JRQ A;  2OYQ A;  3CQ8 A;  1MU2 A;  4C8M A;  1LWF A;  4NCB A;  4I9Q A;  2IS3 A;  1QS4 A;  1Z26 A;  1S1W A;  2ATQ A;  3OYI A;  3DM2 A;  3JYT A;  3JSM A;  4DF8 A;  1UA1 A;  4FJI A;  2BAN A;  2IGI A;  3CFO A;  3OJU A;  3S3M A;  2G8W A;  3FFI A;  3VQQ A;  5CYQ A;  4DTU A;  3U6F A;  3MEE A;  1C0T A;  1EP4 A;  3QEX A;  5J1E A;  1U4B A;  3VQ6 A;  3QEI A;  4JLH A;  4IG0 A;  3OYG A;  5KTQ A;  1SKR A;  1BCO A;  4C8K A;  1T03 A;  3V1R A;  1RTH A;  3HL8 A;  5E41 A;  4FCY A;  2ETJ A;  1RTD A;  4FYD A;  2KQ2 A;  2BDP A;  1VSH A;  4CJE A;  1NJY A;  1TK8 A;  3VQB A;  4E7L A;  4M3Y A;  4CJS A;  5HRP A;  1RBV A;  1RT4 A;  4KB1 A;  4KI6 A;  2X6S A;  2WON A;  3DMJ A;  4AHU A;  3HO1 A;  4HVJ A;  3CM6 A;  4KTZ A;  4LD0 A;  3VQ4 A;  2LSN A;  4CHZ A;  1RT3 A;  4FZZ A;  1Q9X A;  1JLF A;  3AVL A;  2HW3 A;  1Z25 A;  1TKZ A;  3SQ2 A;  3AO4 A;  3AVG A;  2P5O A;  1RTI A;  4CGI A;  4K8X A;  4LH4 A;  3V1O A;  2DTU A;  1BGX T;  2E4L A;  2QXF A;  3AVF A;  3DLG A;  4KHY A;  4OLA A;  4PY5 A;  3LP0 A;  3DLK A;  4EP4 A;  1XI1 A;  4N41 A;  3AVK A;  4FJ8 A;  2FBT A;  1EET A;  2OPS A;  3U3Y A;  1KVA A;  4LY7 A;  4FJ9 A;  3AVM A;  5EU7 A;  3NH0 A;  3AV9 A;  2A1R A;  4FM2 A;  4W5R A;  1D8Y A;  4FJ5 A;  3SV3 A;  4K8Z A;  1RT6 A;  1WSH A;  1WSE A;  4AHC A;  4ZHR A;  3OS0 A;  1NKE A;  3KK3 A;  2F8T A;  5FDL A;  1QTM A;  1SL1 A;  4RW8 A;  3OYF A;  3HM9 A;  3NDK A;  2Z1J A;  3AA5 X;  1Y97 A;  4J2A A;  4Z4F A;  1TKX A;  1GOB A;  4BDY A;  1ZBI A;  2HVH A;  3BGR A;  3HVR A;  1JLB A;  2VG5 A;  3DRR A;  2DFE A;  4BDZ A;  5HRO A;  1I3A A;  4CHY A;  3M8R A;  4CHQ A;  1RBR A;  3KKS A;  3NFA A;  4MFB A;  3TAB A;  4Z4H A;  4LSL A;  4DTR A;  4ICL A;  2B6A A;  1YTA A;  2JLE A;  4DQI A;  4CIF A;  4FJM A;  2HB5 A;  4W5O A;  4DQQ A;  1X9M A;  3TAM A;  4DU1 A;  3PY8 A;  3DLR A;  4HUF A;  4Z4G A;  3MXI A;  3NF9 A;  5HRS A;  1C1B A;  3AVN A;  2YHA A;  1QSL A;  1KFD A;  2ZD1 A;  1KLN A;  1WLJ A;  1ZBU A;  2XHB A;  2Z1H A;  4BE1 A;  2Y1I A;  3VA3 A;  1KTQ A;  3OY9 A;  4PUO A;  2IDO A;  5D3G A;  3QEW A;  4GVM A;  3AA3 A;  1HPZ A;  3S9H A;  2KZM A;  4CER A;  3OYD A;  3G0Z A;  4JS5 A;  1VSM A;  3OYE A;  3K58 A;  3WNG A;  3SQ1 A;  4E0D A;  4FM1 A;  3ZT4 A;  4CJQ A;  1O1W A;  3NH2 A;  4OJR A;  4DU3 A;  2QKB A;  3NE6 A;  2VWK A;  3DYA A;  1GOA A;  4DU4 A;  1L5U A;  2Y1J A;  2XRI A;  1JL1 A;  4CJP A;  2YNI A;  1G15 A;  1VSL A;  4FLY A;  1VSI A;  3UIQ A;  1DTQ A;  4ID1 A;  1NK4 A;  1IKY A;  3OYL A;  2G8U A;  3AVJ A;  3SJJ A;  4CHP A;  4DSJ A;  4DS5 A;  4BDP A;  3NAE A;  4TSX A;  1VRU A;  5T7B A;  1HQU A;  2A1S A;  2VG6 A;  2FBV A;  3K2P A;  4E7J A;  2HHT A;  1J9A A;  4GW6 A;  3SQ4 A;  4DLG A;  2HHX A;  4PA1 A;  4KHU A;  4IBN A;  1D9D A;  1VSF A;  4RG8 A;  1YT3 A;  4CEZ A;  3VQ8 A;  5SZT A;  3IG1 A;  4CF1 A;  4B9V A;  1QSS A;  4Z0U A;  4XIU A;  3ZSO A;  3WNF A;  2G8K A;  2HHQ A;  3U3G A;  4CEE A;  4CJW A;  3VQ5 A;  3P83 D;  4CFC A;  1NKB A;  4KI4 A;  1C1C A;  3SQ0 A;  3K5N A;  1NKC A;  4J2D A;  1S6Q A;  3LZI A;  1NJX A;  3V9U A;  4BWM A;  3RRG A;  1S5J A;  4ELV A;  2RPI A;  3LAK A;  3LP2 A;  4CJU A;  3C95 A;  2XY5 A;  1S1U A;  1SV5 A;  3LP1 A;  4GMJ B;  1TV6 A;  2GV9 A;  3V9S A;  1JXB A;  4KFB A;  3OYC A;  4PQU A;  1C0U A;  3AVC A;  3LAN A;  3L8B A;  3PX6 A;  4C8L A;  4O55 A;  2BGG A;  1HRH A;  3NCI A;  3ZT3 A;  4DFK A;  4Y1D A;  3NF8 A;  3VQE A;  1LWC A;  2XY6 A;  2PY5 A;  3LAM A;  3M8P A;  2IOC A;  4CJF A;  2HNZ A;  1QQC A;  3ZCM A;  3OJS A;  3S3O A;  1XHX A;  2G8I A;  4G1Q A;  3O3G A;  1IKV A;  3ALY A;  1RBT A;  5KRS A;  4B9M A;  3HST B;  4ID5 A;  5CZ1 A;  3DLH A;  4W5T A;  5FRN A;  4E1N A;  4CJL A;  2EHG A;  3HPO A;  1N5Y A;  4FK0 A;  4FLT A;  4FM0 A;  4CJT A;  1RDD A;  2O4G A;  3PO4 A;  3I8D A;  4DS4 A;  2KFZ A;  4FVM A;  5CY4 A;  1L3V A;  3QIP A;  3HJF A;  3EYZ A;  4FLU A;  3ZSQ A;  3RMD A;  1IO2 A;  1HJR A;  4L8R B;  4KHN A;  2E6M A;  3SPZ A;  1S9G A;  4CJ3 A;  4FJK A;  3HPG A;  3SPY A;  4DTN A;  1IG9 A;  1LAV A;  1J5O A;  3OS2 A;  2OZM A;  1FKP A;  1NJW A;  4HUG A;  2FC0 A;  1ASW A;  1LWE A;  2OZS A;  4HCB A;  1B92 A;  4M3Z A;  4E1M A;  1Q9Y A;  4CHO A;  1B9D A;  4DQP A;  3HXM A;  4FK2 A;  3HYF A;  4CIE A;  2VWJ A;  4DTS A;  1U47 A;  4O4G A;  2XY8 A;  3ZSY A;  3LWL A;  1TK5 A;  1VSE A;  1HYZ A;  5KGW A;  4J2E A;  3L3V A;  1JLC A;  1X9S A;  4ZTF A;  3SUP A;  2ZQB A;  4FJG A;  4H8K A;  3TAG A;  5K14 A;  4DMN A;  3CG7 A;  3HT3 A;  1RDC A;  4H4O A;  4ZTJ A;  3VQP A;  4NYN A;  3DOL A;  5CYM A;  1RT2 A;  1BI4 A;  2OPP A;  1RDB A;  4NCG A;  3O3H A;  3PX4 A;  4ELU A;  3LDS A;  4PWD A;  1CXQ A;  3ISN C;  2G8H A;  4Z4I A;  4CEQ A;  3KTQ A;  3F9K A;  4OPK A;  3VA0 A;  1S1V A;  2HHU A;  1T8E A;  1RNH A;  3ZSX A;  3AO1 A;  3VQA A;  1ITG A;  1S1T A;  1RIL A;  1VSD A;  1NK9 A;  2ITG A;  4M3T A;  3VQ7 A;  1WSF A;  3SYZ A;  4CGJ A;  4AHR A;  3OYN A;  4B9L A;  4O0J A;  3MEC A;  4CJV A;  3K59 A;  2D0C A;  1L3S A;  1U45 A;  1JLG A;  4AIL C;  4AHS A;  3ZT0 A;  3DOK A;  5DK5 A;  4QOZ B;  1EX4 A;  2YKN A;  3ZSZ A;  5C42 A;  1WSI A;  3LPT A;  3A2F A;  3NGY A;  3KLG A;  3KLH A;  4FLX A;  2B4J A;  3QER A;  1SUQ A;  4F2R A;  4OKJ A;  2QK9 A;  3HK2 A;  1QHT A;  4DTX A;  4CES A;  4KV8 A;  3QLH A;  3EZ5 A;  1RBU A;  1VRT A;  1KSP A;  5JS2 A;  4KHW A;  4N47 A;  4E7I A;  3SI6 A;  3SNN A;  1F21 A;  3B6O A;  1XWL A;  1KVC A;  3C6U A;  3VQD A;  3IAY A;  4Z4E A;  1TVR A;  2KZZ A;  4FJH A;  2YNF A;  4I2P A;  3K5M A;  2R7Y A;  3VN5 A;  3T19 A;  4CE9 A;  3T1A A;  4CHN A;  2DY4 A;  4CK2 A;  3AO5 A;  1DLO A;  5HBM A;  2P51 A;  4DTM A;  4FJL A;  3AA2 A;  4E7K A;  4O5B A;  4DFM A;  2P5G A;  2OPQ A;  1GOC A;  3K5L A;  1JLE A;  3I0R A;  1HYV A;  1YTU A;  3NGZ A;  1JLQ A;  4FLW A;  2FBX A;  2OA8 A;  3KD1 E;  3KK2 A;  4I9L A;  4CJR A;  3SZ2 A;  5J2M A;  3DRP A;  3LP3 A;  4CEF A;  4CJ4 A;  4HHT A;  3RMC A;  3THV A;  1I39 A;  3NHG A;  2Q3S A;  3MED A;  4FLV A;  1NOZ A;  3QET A;  1TL3 A;  3L2R A;  4DSL A;  1YVU A;  1HMV A;  1JXE A;  4F8R A;  4DTP A;  1B9F A;  1LW0 A;  4B3O A;  3QO9 A;  3TAP A;  2HHV A;  4DG1 A;  1HYS A;  4BAC A;  3LPU A;  4DTO A;  3SUN A;  1VSJ A;  4B9U A;  4C8O A;  4DSK A;  4F4K A;  1HQE A;  4FW1 A;  2RF2 A;  3NF6 A;  1S9E A;  2EX3 A;  3L2U A;  4IKF A;  4FJX A;  4CF9 A;  3RWU A;  1BL3 A;  1IKW A;  1EXQ A;  3DLB A;  4C8N A;  4AH9 A;  2XO7 A;  1ZBL A;  1TKD A;  3C6T A;  4CFD A;  3AO2 A;  4FZY A;  3M8Q A;  3L3U A;  4OGC A;  2YV0 X;  3RR8 A;  4HUE A;  2PZS A;  2HHS A;  1XC9 A;  4AHV A;  4YFU A;  4IG3 A;  4CEA A;  2YKM A;  4W5N A;  3QIN A;  1UOC A;  4KHQ A;  3ZSW A;  4CEB A;  3D0P A;  5J2N A;  3V6D A;  1SL2 A;  1KLM A;  1BIZ A;  4M41 A;  4FK4 A;  4Y1C A;  3I0S A;  5JS1 A;  3BDP A;  1D9F A;  3RMB A;  4KTW A;  2PYJ A;  3AVH A;  3DLE A;  4CEC A;  4CK3 A;  3C94 A;  5J2P A;  5HLF A;  4KHS A;  1U48 A;  2BE2 A;  4FJN A;  3OYA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...