4Q0BA

Crystal structure of hiv-1 reverse transcriptase in complex with gap-rna/dna and nevirapine
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
555
structure length
555
Chain Sequence
VPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTNSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of HIV-1 RT-RNA/DNA ternary complexes with dATP and nevirapine reveal conformational flexibility of RNA/DNA: insights into requirements for RNase H cleavage.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase, hydrolase/rna/dna/inhibitor
molecule keywords HIV-1 reverse transcriptase, p66 subunit
total genus 142
structure length 555
sequence length 555
chains with identical sequence C
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2014-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4q0bA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4q0bA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4q0bA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4q0bA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4q0bA05
3CDUA 1SUQA 2AGQA 4KO0A 4ZPAA 4KKOA 1C1BB 4M94A 1IKWB 4Y1CA 3AVMA 4IFYA 3V9ZA 3PW0A 3UPFA 4NLRA 3TANA 3KKRA 4DF4A 2E6LA 3FFIA 3QINA 1C0UA 5T7BA 3DLEB 2F8TA 3H08A 3RAQA 4RNNA 1IH7A 4RW4B 3IG1A 1S0MA 1MU2B 1VSMA 4CEQA 4KB1A 4E7IA 4W5QA 1WN7A 3BGRB 2XY5A 1BI4B 2R2TA 4LSNB 4FK2A 4DL7A 4GVMA 1NK8A 1TQLA 4KV8B 1KVAA 3BQ2A 1ZBLA 2A1RA 2XWYA 3H4BA 3MTKA 3N6LA 4CK3A 2BRLA 1QUVA 1NJWA 4F50A 4B3OA 3FSIA 3SI6A 1RDRA 3AVKA 4ZPCA 4EBEA 3NH0A 1SV5A 1TKXA 1TL1A 1ASVA 4EYHB 5DLFA 4I7FA 2AQ4A 4XPEA 2ILZA 1NK5A 1HARA 4ELTA 4CK2A 5F9NA 3HHKA 4KPYA 2BANA 2FJVA 2FVRA 5KFNA 2QV6A 3DRSA 4DL6A 1U47A 4F4ZA 4Q8FA 4QWCA 3MEGA 4NLPA 5C5JA 4KTQA 1KLMA 2C2DA 4W5TA 1NJXA 4ECWA 2IJNA 4FJHA 1LAWA 5HRPA 3BR9A 3NMAA 1QHTA 1NKEA 4E7HA 1SKWA 1JLBB 4IH7A 2DPJA 1GX5A 4PQUB 3LPTA 3MAQA 3H4DA 2GIQA 4K50A 5KFBA 4F4XA 1ASUA 3HYFA 5EU7A 1NOYA 3SQ1A 4FVMA 2FBYA 3V1RA 4DSLA 4O5BA 4M3XA 2IAJA 4IDKA 1HRHA 5KGWA 5DGAA 5DG7A 3L3UA 2B5JA 4DTNA 4WZQA 2P5GA 4FW2A 1WLJA 4Q5VA 4G3IA 3GV5B 2EC0A 2IM2A 4E1NA 4W5NA 1BGXT 3EPIA 3C95A 4J9NA 4CK1A 3HPOA 4OGCA 3EYZA 3KLFA 2IM1A 2FLNA 3OHAA 5DG9A 1JLCA 4GW6A 4DSFA 1S48A 1MMLA 1LW2B 3HO1A 3M9MB 4KTZA 3P83D 2C2EA 3QGGA 4M95A 1NJYA 4RNOA 2YHBA 4DMNA 3O3GA 4HCCA 5FRNA 3ZSZA 3S3MA 3ZSQA 2VWKA 3GV8B 1WNSA 3E01B 3S9HA 2FBTA 3LAMA 2UVVA 4O44A 3ZT0A 3H59A 3UR0A 2AGOA 3AO1A 4L8RB 5C24B 4HKQA 3WNFA 3KLEB 2KTQA 4F3OA 3MEDB 2WOMB 4FZXC 5KG3A 2OPQB 4NRUA 3DLGB 2E4LA 5KT7A 4BWJA 4J9RA 4OVLA 2IM0A 3D45A 2YNGB 3QIOA 2HNDB 4LSLB 1JLGB 2DFFA 3OHBA 1N5YB 1RT2B 2IC3A 4URGA 4CEFA 2ZKUA 5KTQA 1HYSA 3RB3A 4ZVEA 2W9CA 4ED1A 4CFDA 1IKVA 3LDSA 3ITHA 4YQWA 2XCPA 5KRTA 3DOLA 1BQNB 3LZJA 2Y1JA 3OL8A 3RAXA 3CJ5A 1CXQA 3ZT4A 1L3TA 4KREA 4CE9A 4IBNA 4Z4EA 4Y1DA 1HNVB 4AH9A 4O3QA 3PW7A 4IRDA 4NLQA 2HHSA 4M3UA 5C42B 1QSSA 1S1WB 2XGPA 1JL1A 3LP1B 4OJRA 3MXMA 3T5KA 2W9AA 4WYWA 4FLXA 1WAFA 2JEJA 3KJVA 2IBKA 5KFRA 2F8SA 4ZHRB 3IRXA 3OSPA 3RRHA 1TK5A 2XRIA 4E19A 3SUQA 4TYAA 5F8GA 3PUFA 5I3UB 4YMEA 3Q8PB 3LP0A 4CHQA 1G15A 3FRZA 4CERA 3RMBA 1NKCA 5HP1A 1N6QB 2AX1A 3CFPA 3AA5X 1KHWA 3CFRA 4M42A 3QLHA 1HMVB 3KK3B 3QZ7A 4M41A 4ECRA 1KRPA 4N47A 3KLEA 1RTJB 4EP4A 3LP2B 4R8UB 1J9AA 1WSFA 1S9GA 4CJPA 1TP7A 4EEYA 3NGYA 3KHGA 3AVNA 1BCOA 3CM6A 3SQ4A 4EO6A 3DRRA 3OYGA 3AV9A 4KHYA 3GIIA 3L2WA 4ZVHA 1X9SA 3MR2A 4BDYA 1WSEA 3QYYA 1U45A 1HQEB 3PVXA 5F8HA 3VA0A 5KFYA 4ED8A 4ZMMA 2R2RA 3NBPA 4CJEA 4AHUA 2YKMB 1T7PA 1NOZA 3GIKA 1TKTB 1RT5A 1XHXA 1GOAA 1IKYB 3GYNA 1VSEA 3G6XA 1XR7A 1XHZA 1S9GB 1N5YA 4LSLA 4O3PA 3VQCA 1RTIA 4U6PA 3QGHA 4GMJB 3OY9A 3M8RA 2W8LA 4ED6A 5KG4A 2ZE2A 3CO9A 2G8FA 1TL3A 2BE2A 2R8GA 3MECA 3QEIA 4DU1A 3V81A 4MK8A 2W42A 3BSAA 3V6HA 5C24A 4Y34A 1LWCA 3LAKA 4KHWA 3C94A 2ATLA 2R8IA 2D41A 3HSTB 4NLGA 4HUFA 4I2QA 4FZZA 4ID5A 1C0TA 3K5OA 5I42B 2IC3B 1D9DA 3DYAA 1HQUA 4RW9B 1S1VB 3T3FA 4MKAA 3DMJB 3OS1A 3RR8A 3KIOA 2WONA 4MFBB 3MEEB 1S9FA 5KG7A 3MEGB 4URQU 3MFHA 4FLWA 2FLPA 2WONB 4MFBA 3OYNA 3RR7A 4OLAA 2J6TA 3DOKB 2VG5B 3CVKA 1FKOA 1K1QA 3CIZA 5KT2A 3PV8A 1IG9A 3VQSA 4J9LA 3TAQA 1TAQA 4JV2A 1NNDA 3RB0A 1REVA 4QWBA 4IG0A 4WZMA 3L2QA 1BQNA 4DQRA 2VG6B 3KLVA 4IG3A 1HQEA 2HWIA 3OLBA 4FLVA 1S0OA 3ZSRA 3RBDA 4ZTFA 3I5BA 5L1JA 4FW1A 1FK9A 3VQPA 5KFGA 4FBTA 4DU4A 4UQGA 3I0SB 4K4ZA 3H5YA 3TAGA 4DFJA 4FJ8A 2ZD1A 4TQRA 3OS0A 4DQQA 4IFVB 3AVCA 4Q43A 3PZPA 4DQIA 3KTQA 2ZD1B 4CIGA 1DTTB 3I5CA 4NLYA 1WSIA 2EX3A 2AX0A 3IGVA 1LWEA 4KSEB 3EPGA 2FBXA 2ITGA 2BDPA 4XPCA 5FDLA 1J53A 5F8IA 4O0JA 4YR2A 3SUPA 3HVAA 3NBPB 4IFYB 3TWHA 3U6FA 2WHOA 4FJNA 2XC9A 2IGIA 1JX4A 3NFAA 3ALYA 1ZBHA 1RDDA 4Y2AA 4NLXA 1RT3B 3DOLB 1TV6A 4G1QA 4DQSA 1YT3A 4CEOA 3NF6A 4KBIA 4WE1B 4C8OA 3KHLA 3H98A 1S97A 1I39A 2A1SA 4TY8A 3MECB 2HHWA 3OYMA 1S1TA 1UWBB 4BE2A 3I0RA 1CSJA 2YNFA 4DSIA 2OPPB 2HWHA 5KFUA 4W5RA 3IS9A 1S1VA 5E41A 1FK9B 3NF9A 5CYQA 4YNQA 4KTWA 2P5OA 2HHXA 2JEIA 5T14A 2JGUA 1TVRA 1KVCA 1A5XA 4DTJA 1HPZB 3DM2A 4KE5A 4E7JA 4JRQA 5HLFB 1N56A 1QS4A 3QEPA 4OL8A 3KMSA 1JXEA 1VSIA 2ASLA 5J2NB 1LW0B 5KFLA 3OYKA 1N4LA 2E9RX 2OPSB 4QWDA 3IGNA 2E9TA 3G6VA 4BWMA 1C1CA 3EZUA 4KRFA 3K59A 2HHTA 1REVB 4RG8A 3RMDA 1ITGA 1ZTWA 1UA1A 3DRSB 1JL2A 2JC1A 3V6DA 1FKOB 1IO2A 3VQ7A 5EUHA 2B4JA 4NLTA 3G86A 1L3VA 3OSNA 2D5RA 1LW0A 1JLQB 4DSEA 1T3NA 5KFQA 3NAHA 3JSMA 2OYQA 3V1QA 4J9OA 1NHUA 4KKOB 1BQMA 3HKWA 1XC9A 3DM2B 4OLBA 3LWLA 4RW9A 2W8KA 1T8EA 3T5HA 4ID5B 1QTMA 4TLRA 1LWFA 1N48A 4K4YA 4DTMA 1J54A 4IG0B 1LAVA 2HVIA 3IRXB 4RNMA 4ZP7A 3V6JA 3N6NA 5KT6A 5HROA 5DQIA 4CJLA 4NYFA 1RTIB 4RNHA 4CESA 2WCXA 2D0BA 3ZSOA 4B08A 5HRSA 2KFNA 4LQ3A 3NHGA 3NF8A 3NH2A 1L3UA 3GIJA 3I8DA 3E51A 1TV6B 2F96A 4M3ZA 2IAJB 4JLHA 2IMWP 4ZVGA 5C25B 4NRTA 3T19A 3L2RA 4J2DA 1JLFA 4H4OA 2RDIA 2VG6A 2I5JB 1RYSA 1JLFB 4H4OB 4B9UA 1JLEA 5C25A 3AO3A 5FRMA 4J9MA 1BISA 1LV5A 4CGDA 5FDLB 1B92A 2WB4A 1U09A 2IDOA 1XR6A 1ZETA 2X74A 4EP5A 2DY4A 3RMAA 1KLMB 4R8UA 3IS9B 4ICLA 4ZP8A 4ECZA 4KV8A 2P51A 3OYEA 3Q8SB 1BI4A 4C8KA 1CLQA 2G8KA 1DLOB 1I3AA 4HHTA 3SPYA 3VQBA 3C6UB 1F21A 1IKYA 4FBUA 2UVRA 5HLFA 4I2QB 1LWFB 4IG3B 3B6OA 3ULDA 5JS1A 2X78A 1WNEA 5J1EB 5CZ2A 3C6UA 3V9UA 1JLEB 3IAYA 3NGZA 2HHUA 4Q45A 4CHPA 1CXUA 1RBUA 1JIHA 1A5VA 3HVTB 1DLOA 4CFCA 2NUBA 4C8LA 4LY7A 4JS4A 4FK0A 1U04A 4FS1A 3S3OA 1ASWA 1WSHA 1SUQB 2GV9A 4BE0A 1R0AA 1K1SA 1IKXB 5KFXA 3ZT1A 5EWFA 2GUIA 4ECTA 2QE5A 4CGFA 3AO4A 4J2BA 3NAIA 1XR5A 1JKHB 4FJMA 4KI6A 1C0UB 5F9LA 5KFOA 3M9NB 3H5UA 2KQ2A 1HQUB 1UA0A 5C42A 2GC8A 3MXJA 3QESA 2R7YA 4Q8EA 3Q8RB 5HP1B 3PW2A 4YFUA 4M3RA 1HPZA 3RBEA 3HPGA 1W25A 3TVKA 3KK1A 3CWJA 2R8JA 4YP3A 1BIUA 1HNIB 4DTOA 5CYMA 2R2UA 4FXDA 3VA3A 4IH6A 2UVUA 1BQMB 3OL7A 1QSLA 4GC6A 1XWLA 4LQ9A 1U48A 1S1TB 1UWBA 4B9TA 4NYNA 1TKZA 3V9SA 5L9XA 1VSHA 3QIDA 3M8QB 1KVBA 5HRRA 3CJ3A 1RT4A 4URSA 3K5MA 1RBRA 4KHNA 4CJ3A 1TKTA 4R5PA 3ISND 4RW8A 3H40A 2C22A 4JRPA 1W9HA 3QEXA 4JUZA 3T1AA 1QAIA 3VQDA 2VWJA 4DL3A 4M45A 2XGQA 1C1BA 1KCFA 4FS2A 4G1QB 2ASDA 4CHOA 3KMQA 3CFOA 4DS4A 1ZBUA 5KFZA 4KI4A 4K4UA 4DWIA 1RT1A 3PO5A 1HJRA 2XO7A 3OYBA 1JLQA 3DRRB 3OYAA 5DG8A 4PUOA 4ED0A 1SKSA 5JS2A 3D5MA 1FKPB 2YNHB 4RW6B 2FVSA 3NGIA 4J2AA 3KNAA 3DLBA 4K8XA 4QW9A 4JV0A 1EP4B 4O55A 3QZ8A 4KAZA 3LP1A 3LANA 3AVJA 4R5PB 3QNNA 3CQ8A 4MK9A 5KG2A 2YV0X 4IR9A 1A5WA 3C6TB 3RRGA 3FQLA 4IDKB 1Q8IA 1S1UB 1J5OB 4MK7A 4FJKA 4J9SA 4DTRA 1J5OA 3TAMA 4YR3A 3OYHA 3ZSXA 3LP0B 5KFFA 4ID1A 4NCAA 4N5SA 2BR0A 3M8PA 1C6VA 1SH3A 2J6SA 3HL8A 5EWEA 2YNFB 3BSCA 1T94A 1JLAA 3THVA 1CZBA 5EWGA 2BE2B 3VQQA 2R8HA 1DTQA 3BREA 5DLGA 2VA3A 3KKSA 5DGBA 1RA7A 1Z25A 5JXSA 3HM9A 3RMCA 1JKHA 2Y1IA 4DF8A 5KFPA 1RT7A 2XCAA 1T03A 4EBCA 4ELVA 4FLZA 3P1GA 4B8AB 4HUEA 4WYLA 4ECXA 1S9EB 4CGJA 4WFZA 4O3NA 3KK3A 2B43A 1I6JA 1S1XA 2QXFA 1TKDA 4LD0A 1RDAA 3NH1A 3PY8A 1BCMA 1YVFA 2HAIA 1VSLA 2R2SA 4GC7A 3OL9A 3ICLA 2E6MA 2FVCA 1TKXB 5K14A 1S5JA 2RDJA 4CGHA 1IKVB 4CCHA 2QKBA 3MR5A 4E7KA 3HP6A 1X9WA 5KG6A 1W0HA 1VSDA 4AHTA 4TQSA 4O3SA 1LWCB 3LP2A 4CJTA 5KT4A 2HW3A 2JC0A 1MU2A 2PY5A 4MIAA 2JEGA 4DG1A 4ELUA 3RB4A 4AHRA 3NAEA 3PX6A 2YKMA 4K4VA 4H54A 2HNYB 1D1UA 3SJJA 4CJ4A 5J2MB 2YNHA 4EYIB 4HUGA 3SV4A 4ECUA 3PX4A 3OYIA 3PO4A 4WXOA 4CGIA 2ASJA 4CEZA 3MF5A 3G10A 3ZSWA 4J9PA 2YKNB 3ITHB 4NLOA 4ECVA 4XO0A 1JXLA 5KRSA 5J2MA 2Z1HA 1NKBA 2YNIB 3GIMA 2V9WA 3KD5E 3V81B 5D3GA 3FDSA 2OZSA 3VQ8A 1HMVA 4PY5A 4TY8B 1TK8A 4ECSA 4FJGA 4RW4A 2RPIA 1EXQA 1SKRA 3AVAA 2EHGA 5DQGA 4MH8A 2C2RA 3FFIB 2FJXA 2KZMA 1KHVA 2CKWA 4C8NA 2JEFA 4QPXA 4ED2A 4KHMA 2HNZB 5CYQB 3ZT2A 4MIBA 3HXMA 4NLUA 1YTAA 3VQ4A 3SNNA 2RF2B 2G8VA 2ETJA 2X6SA 4ED3A 1B9FA 3BGRA 5KT5A 4CEAA 2VG7B 1RAJA 1JXBA 3LALA 4IRKA 1Z4UA 3TQ1A 1QE1A 1KFDA 3OYDA 4DS5A 4CJVA 1RYRA 4AHSA 4CF1A 5KFSA 5L1LA 3ISNC 3V6DB 1QE1B 5HBMB 1BHLA 4CJSA 3CM5A 1NK0A 3MR3A 3KLIB 1RTDA 4K4SA 5F8JA 3QIPA 4O4GA 3HPHA 2JLEA 3I0SA 2BANB 1IKWA 4ZP6A 1L5UA 2Z1IA 3V1OA 2B5JB 2XY6A 3CDWA 5CY4A 3QNOA 1D9FA 4AHCA 4PWDA 3O3HA 2W9CB 1O1WA 4CEDA 4ZP9A 3DDKA 1YVUA 3G0ZA 3U3GA 1RDCA 2RN2A 4X2BA 4FJ7A 1GOBA 4NLWA 1ZYQA 4YR0A 2BQRA 2HHVA 4DG1B 2V4QA 3AA4A 3KLFB 4F4WA 1QSYA 1WSGA 2UVWA 1IM4A 4E0DA 5KFHA 3D28A 2LSNA 4KHSA 5HROB 1OS5A 3NCIA 4O4RA 1HYZA 2G8WA 2FBVA 2OZMA 2CJQA 3H5XA 3B6PA 4O44B 4NCGA 2D3ZA 4M3TA 4MQ3A 4ECQA 2GBZA 4F2SA 1HNIA 5KI6A 4LH4A 3VQ6A 4CJUA 2DFEA 4RW7B 3CJ4A 2QKKA 4IKAA 2OPSA 4FJ5A 1WSJA 4O3RA 4KO0B 5DQHA 4Y2CA 4OPKA 3PJXA 1K6YA 4WFYA 1VSKA 1Q9YA 1RTDB 3OL6A 3FQKA 2X6NA 2DFHA 3SPZA 3HJFA 5DK5A 3K58A 1NJZA 3KLGB 1HYSB 2WK4A 2VG5A 3V9XA 4RW7A 4TXSA 1VSFA 1S4FA 4DSJA 3DI6B 3TABA 1SL2A 3SYZA 2FVPA 5KT3A 4IOBA 3TAFA 3KK2B 2J6UA 3MFIA 3DMJA 3CJ2A 3N6MA 4O0IA 1RTJA 3DLKA 3PR4A 1VSJA 3KOAA 4DL4A 4FLYA 4WE1A 3NE6A 3KLHA 3DRPA 4Q44A 1RILA 4Z0UA 5J2QB 5CYMB 3OLAA 3K2PA 3KHRA 4B3OB 5HRNA 2OA8A 4FM1A 4PA1A 3RTVA 2OPRA 2IA6A 1ZBIA 3LZIA 5I3UA 1JLBA 2OPPA 2YNGA 2D7SA 4ECYA 4ED7A 4FJ9A 2XI2A 1GOCA 4J2EA 4FK4A 3LWMA 3JSMB 3QIPB 3OYJA 5D3GB 4W5OA 3MEDA 4M3WA 3OYCA 3DOKA 3SZ2A 1CZ9A 3HK2A 4KAIA 3L2UA 4RUAA 2HVHA 2AJQA 2VG7A 3U3YA 1RTHB 1IKXA 2RF2A 4IRCA 2BRKA 3WNEA 4CEBA 1VRUB 3BSOA 1HNVA 4AILC 5J2NA 4B9VA 1N6QA 2IM3A 1Z26A 4FLTA 3O4QA 4NLDA 4Y3CA 3QO9B 1VRUA 4LH5A 3SUNA 3Q8QB 2F8EX 3NL0A 2HNYA 2O4IA 4FZYA 4N76A 4NCGB 3VQEA 4CJFA 4K4XA 3SQ2A 2XI3A 1S10A 4N41A 3PJWA 3QEWA 3KJVB 3PW4A 3DLKB 1VK0A 3JYTA 4M3YA 4TYBA 3PHEA 4KFBA 4DFMA 4Z4IA 3CDEA 3V4IA 1HYVA 1SL0A 4KB0A 2ZE2B 4QW8A 1KTQA 3QLHB 2OPQA 4J9QA 4CF9A 1KLNA 4WFXA 5J2PB 4Z4HA 2OPRB 4F4KA 3DLEA 2B6AB 5KFJA 1RDBA 3KHHA 3K5LA 4Z4CA 1QQCA 1EETB 2V0NA 4CHZA 3WNHA 4DU3A 4I2PB 4IQXA 4HTUA 2I5JA 2P1JA 4E7LA 4B9LA 1RBVA 3KLIA 1RNHA 3BDPA 3EY1A 4QCLA 3O3FA 1U4BA 2BGGA 2ALZA 3VQAA 4B9MA 4BDZA 4H8KA 4CFAA 5SZTA 2HNDA 2FJWA 3H2LA 1C1CB 4U7CA 4BE1A 3AVGA 2WOMA 4TY9A 4DTUA 3HVWA 5KFAA 2O5DA 2VA2A 4Q0BA 5KFMA 3O4NA 1S6QB 3HVTA 3EZ5A 3D0PA 4ZPDA 5SWMA 2Z1JA 3AVBA 1RT6B 4CJKA 4CJRA 3UIQA 1TVRB 3BQ1A 1NK4A 2W7PA 4TSXA 4PWDB 2FLLA 1S6QA 4CJWA 4MKBA 4K8ZA 1S1XB 1TL3B 3OS2A 5KFCA 4BDPA 3GILA 3ASMA 2W7OA 3JYTB 4DL5A 2PYJA 3V6KA 3ZT3A 3V9WA 5L1KA 4JS5A 4N56A 4FJIA 2IJFA 2D0CA 2KW4A 3CG7A 4I9LA 4K4WA 1Y97A 1KSPA 1KFSA 3QO9A 5KFVA 3QEVA 4CJQA 4HCBA 1SH0A 1NHVA 4RU9A 2HNZA 3DYAB 3AO5A 4ZPBA 2ATQA 1LW2A 3SFGA 4O4GB 2PZSA 5J1EA 1TL1B 5KFIA 3AA3A 5J2QA 4CHNA 3PX0A 2KFZA 4RW8B 1EKEA 4Z4GA 3KD1E 1RT7B 1L3SA 1RT2A 1S6PA 1RCHA 4F2RA 4E1MA 4Q0BB 1TK0A 1UOCA 4QWAA 3ZSYA 3IN5A 2Q3SA 3SFUA 4IR1A 1ZBFA 3L2VA 5KFTA 5KG1A 4FJJA 3M8SA 4ICLB 4EZ6A 2D3UA 2YNIA 1YTUA 3KK1B 3BQ0A 5FROA 4DFPA 3TAMB 4E3SA 2AWZA 4EO8A 2HMIB 4O3OA 2DPIA 5CZ1A 4CEEA 2YKNA 3OJUA 4QOZB 3DLRA 1B9DA 2W9BB 3DRPB 3RWUA 3K5NA 2RKIA 2D0AA 4ZHRA 3SUOA 5KG5A 1RBTA 4C8MA 1X9MA 2HHQA 4FJLA 5DMRA 4IKFA 1D8YA 2KZZA 3F73A 4F4YA 3K57A 3OVNA 2XY8A 4DL2A 1BL3A 2G8HA 1EP4A 2FVQA 4RZRA 3WNGA 1DTQB 3TAPA 1R0AB 4F3TA 1WAJA 4KFBB 4QWEA 3DLHA 4NCBA 3M8QA 4I7FB 1TKZB 2OH2A 1D5AA 1SL1A 5I42A 2I1RA 4OKJA 1EETA 4TN2A 5KFEA 3TAEA 4DTPA 3VQ5A 2HMIA 5F8NA 5KFKA 2C28A 3G6YA 1SH2A 4HYKA 4ZTJA 3T5LA 4NLSA 5L1IA 4FM0A 4CF2A 1NK7A 2IS3A 3H5SA 4QAGA 3I0RB 3NKYA 4NZ0A 4CFBA 3DLGA 3V4IB 1S9EA 4EBDA 4PQUA 3RB6A 5KFWA 2XY7A 1JLCB 4FM2A 5EDWA 5KGXA 1VRTB 3QERA 4J9KA 1T03B 3NGDA 2FC0A 2Z1GA 3F9KA 3PW5A 4EZ9A 4KB7A 5KG0A 1VRTA 3HT3A 5F8LA 3TARA 1T05A 3SCXA 4FCYA 3MEEA 3HVRA 1S1WA 4KHUA 4FJXA 4IH5A 3P5JA 4OPJA 1S49A 3NF7A 2V4RA 3KLGA 1C1AA 3ZSVA 2G8UA 3L3VA 2UUWA 4R0EA 3L8BA 2B6AA 1GX6A 2QK9A 2RKIB 3SQ0A 3AVFA 2IOCA 5J2PA 2HB5A 1SV5B 4DLGA 4ZVFA 4NLVA 1QAJA 4Z4FA 3OYLA 1S1UA 4JV1A 1DTTA 3T5JA 5JUMA 1JLGA 4DTXA 4FYDA 4IFVA 2WRMA 1TAUA 4DFKA 2G8IA 2GIRA 2BQUA 4LSNA 4CGGA 4DQPA 4B9NA 1JLAB 2XHBA 1NK9A 3SI8A 4XIUA 3IG1B 1RBSA 2R8KA 4NYZA 3DI6A 2DTUA 4CJ5A 1FKPA 4RW6A 4WXWA 1TGOA 4AHVA 3BSNA 3S3NA 1FXXA 4CECA 3OJSA 4BACA 3UQSA 3LPUA 3KLHB 3CJ0A 4HVJA 4E89A 4F8RA 2BQ3A 2ILYA 3I5AA 4OKKA 3AVHA 3OYFA 4CF8A 3KK2A 3AO2A 1D0EA 4H4MB 1RTHA 1RA6A 1UAXA 4B9SA 5KFDA 2E9ZA 3ZCMA 5HBMA 3QETA 5F8MA 1LWEB 3LP3A 3AA2A 2YHAA 3AVLA 2O4GA 3AVIA 1S0NA 3A2FA 3MR6A 3TR8A 3VQ9A 3M8PB 4I2PA 3UDLA 1S6PB 1RT1B 1C0TB 3GV7B 2AGPA 2W9BA 3QGIA 4CF0A 3NDKA 1RT6A 3GQCA 4RUCA 1XI1A 4DLEA 2UUTA 4FLUA 3PR5B 4RNFA 2WTFA 3MXIA 1ZTTA 4I9QA 3VN5A 4CHYA 4KHRA 3C6TA 1BIZA 1X1PA 3HP9A 4DEZA 2ZQBA 4KHQA 1EX4A 1RT4B 4OKEA 1T05B 4DTSA 1C0MA 4CIEA 1C2PA 4OGEA 4B8CA 2AU0A 4K4TA 1Q9XA 4DSKA 2PYLA 1U49A 1RT5B 3SV3A 4PUOB 3E01A 1NK6A 5K14B 3TI0A 1RT3A 4H4MA 3M9OB 3CYMA 4CIFA 3BJYA
chains in the Genus database with same CATH superfamily
3CDUA 4AL5A 5BN9A 1MDUB 2UXCJ 3GL1A 4ZPAA 4X64K 4JI0J 2H3EB 1MLAA 1IKWB 3VV2B 2KM8B 3V9ZA 3PW0A 4BBYA 3T1HJ 1P8GA 4A8SA 1TL5A 4ED5A 3QINA 2MZQA 3DLEB 3R5GA 2DKOB 3MUTP 3RAQA 1B3TA 2GX9A 2G4BA 1VJQA 2YHYA 2V52B 4X66F 4KB1A 1CQMA 1FWLA 3HHLD 4WYBA 2UUBK 1YUWA 1ZPVA 3CSKA 1GH8A 4NA2A 3N79A 3CPWM 3OR1A 3IR7B 3B8AX 3SI6A 4Z7YA 3GIRA 3M2RA 3QBCA 3W61A 2O8BA 1B0TA 1TL1A 1OH8A 3GOIA 3IDHA 5HANA 2ASPA 2KFYA 4FVCA 4OI1A 1HARA 4Y00A 2P8IA 3GR1A 1WI8A 5F9NA 2HFZA 2Z30B 3HHKA 2BANA 5FPDA 4F3QA 2VBWA 2M0GB 2HFNA 3F2KA 1U47A 4DL6A 1FD2A 3W64A 2RRAA 1VQKS 2YWKA 4L3NA 5C5JA 3BO2A 4KTQA 1KLMA 4ECWA 2D3O1 3EL2A 2V4JA 2UUAJ 5EY4A 4AQYK 2CG4A 1Y4ZB 1GXLA 1GX5A 1PKUA 3MAQA 3F41A 1ASUA 5EU7A 3SQ1A 4FVMA 1FJCA 5BRDA 3V1RA 1TL7A 4M3XA 4GY2B 2IAJA 4IDKA 2AYGA 4HACB 5DGAA 3ULEA 2B5JA 4WZQA 5K8OA 1CJVA 2CPZA 4BQZA 2LQ8A 1YHQN 5T7LB 4WQ4A 2IM2A 4E1NA 4W5NA 1XC3A 1BGXT 2P9EA 3C95A 2CQBA 3LOUA 4OYWA 5B0AA 1HBNB 2YBVA 4Z37A 4WP9A 4DKWA 5DG9A 1JLCA 1F9HA 2HHPA 3HO1A 4KTZA 3QGGA 4BRKA 2YHBA 3O3GA 4HCCA 4J7CA 3ZSZA 3ZSQA 2A6OA 3GV8B 1WNSA 2UXBJ 5AQPA 1NM2A 1JCGA 3UR0A 2BZ2A 4BLGA 3WEEA 4PWWA 2V50A 2QLWA 5GAEP 1IBLJ 2KTQA 3I55S 5IC6B 4F3OA 3SDEA 2WOMB 3HFKA 1ZM3A 2OPQB 4NRUA 5BN8A 3DLGB 3D2EB 2E4LA 4J9RA 2IM0A 4OVLA 1NGFA 3U1NA 2IVNA 2MKJA 2D3OR 3UKUB 4RWTA 2I7PA 3H90A 2O3DA 1N5YB 4JI8K 5KTQA 4ZVEA 2W9CA 3NWGA 1IKVA 3A3PB 5KAKA 2XCPA 3LZJA 2Y1JA 3CJ5A 3VVTA 1CXQA 1L3TA 2YHWA 1PC4A 1JJ2R 2AEFA 4B02A 4NLQA 2HHSA 5C42B 1QSSA 2IMOA 2IY5B 2XYHB 1JL1A 4W90B 4CLSA 2OKQA 3HFZB 2H5IB 3T5KA 2W9AA 5AQZA 4DUZK 3MM5B 4DCPB 3MMBB 4J5OA 4I1TA 3CPEA 4P52A 4OO1J 2F8SA 1TMJA 1O6XA 3ENVA 1Q79A 1UFWA 3H1VX 3W5XA 4ZOSA 3Q8PB 2DPNA 2QW9A 3EDQB 3DU5A 4CERA 3L4BC 2J9DA 2M70A 7FD1A 1CPZA 3W66A 2VPYB 1GQEA 2GWJA 1PYOB 2VJVA 1KHWA 3CFRA 3A8YA 1HMVB 2A10A 3QZ7A 4GKKK 2XTJP 4QU7A 1HL6A 3KLEA 4UY85 4DQ8A 3LP2B 5THWA 4R8UB 1NDKA 2PIIA 1S9GA 4EEYA 3Q2TC 3NGYA 4NL5A 4NMLA 1HA1A 3CXCM 2GO9A 3OVAA 1HBUA 5B0CA 1IN0A 4BDYA 1WSEA 4RU2A 3QYYA 4JBCA 5F8HA 3VA0A 4JKEA 5KFYA 4ZMMA 2BKPA 5JMVA 1JJCB 4AHUA 4F36A 1NOZA 1TKTB 1U25A 2I9SA 3G6XA 2M7SA 1XHZA 1N5YA 2BA9A 2R7TA 1RTIA 4GMJB 4ED6A 1ITPA 3CO9A 5K8NA 4P71A 2OJ3A 1FTRA 3MMAA 3MAHA 4UZBA 1LWCA 4KHWA 1SBRA 2HS3A 1TL7B 2DCLA 2D41A 3HSTB 4NLGA 4MLEA 1WHXA 3EM1A 3MUMP 3KUEA 5DM7L 1VC6A 4NA3A 3DCAA 3OBWA 1HQUA 4JI3F 3T3FA 1CVJA 1V3SA 3OS1A 2V8PA 2CWKA 2DNHA 4J9VA 3W9IA 1LXNA 4M5DA 3MFHA 3A1YG 4K0KJ 4OJGA 4BRAA 2WONB 3OYNA 1WG1A 3DRXA 3PV8A 3TAQA 2CPXA 2HBJA 1TAQA 4JV2A 2ZM6J 1NO8A 1RAHB 4QWBA 4NA1A 1UP1A 3UB5A 2ZC3A 3D2FB 4OQJA 2VG6B 2A42A 3AD9C 3OLBA 3ZSRA 4OYAA 2A3JA 5B7WA 5AXNA 2VFSA 3UKUA 4K59A 2DB1A 4FBTA 2FZGB 3TAGA 4IFVB 2VU5A 1K73T 2ZD1B 4M1KA 4CIGA 3ZZYA 3EXYA 2AX0A 1GFWB 2LXIA 4KSEB 3HJVA 3EPGA 2BDPA 3IMXA 1K8AT 3G71S 1J53A 5F8IA 3MCAB 5BYSA 1G4CA 3AD7C 1YJWS 2FGOA 4IFYB 3TWHA 2QXLA 1T02A 3PYGA 1VQLS 1JX4A 3NFAA 1RDDA 4DV7F 1WC6A 1N8RO 3N28A 2YWFA 1UW9A 2P5VA 2RE1A 1PG5B 1RWNB 4KBIA 3J81U 2LLZA 2V2ZA 4OX7A 4A2AA 4WK1A 4LVOP 3CD7A 4TY8A 3OYMA 2KKHA 4OZ3A 3I0RA 2MQOA 2YNFA 2XMTA 2BE7D 1FEHA 2HQGA 4BRGA 4RPFA 2HHXA 2P9PB 2ZZTA 3CCSS 4A8MP 1I94K 4F67A 1A5XA 2I2YA 4E7JA 2LDYA 2Z2YB 4DR1K 3ZTPA 1J5EK 1HKGA 2AW0A 5M1OA 1VSIA 5LJ5Y 3GCWP 3O2IA 1U1PA 2V6AA 5LJVA 5KOWA 2W2PP 4YB1P 2XM3A 3IGNA 3G6VA 3CMQA 2JNJA 3EZUA 4KRFA 2ZH4A 4M5IA 3RMDA 1G7CB 1YBUA 1Q8LA 4QR0A 3DRSB 2JC1A 4DR2K 1FKOB 3VQ7A 1KQSM 3D6TB 3G86A 2E44A 5A0YA 4CNZA 1LW0A 2K1RB 1QDUB 4OI4A 1R8BA 5H1SV 1U1MA 3JTOA 2OYQA 1OMSA 1K0TA 2U1AA 5C0YA 4KKOB 1BQMA 2XMUA 4RW9A 1N88A 5KPTA 1U1RA 2W8KA 4XDCA 4NXNF 3M30B 4KY3A 4F0HA 2O8EB 4OYBA 3CC7N 1LWFA 1N48A 1U1QA 3VWSA 2VH7A 4ED4A 4IG0B 3V6JA 4WFBL 1WUAA 2QWNA 4NYFA 4XH5A 4LRBA 1VHIA 3UD3P 3OHRA 1YJ9S 4AE5A 4M8LA 4A8QA 4LVNP 4UW2A 1WOOA 5A8RB 3I8DA 4F0KA 2IDLA 5E33A 2F96A 3OUYA 4QIFA 4ZVGA 5BRHA 4J2DA 4OYPA 1E6VA 2RDIA 4DV0F 2I5JB 3I96A 4H4OB 4DUYK 4HHUA 2LU2A 1XMBA 5FRMA 2FC9A 3MM7B 4J9MA 1BISA 2ZBPA 3CEDA 3HD2A 4Z7CA 4IYQA 4CGDA 4JI2J 1B92A 4CW7B 1U09A 2P2CB 1D8ZA 2IDOA 2Y0BB 2C3UA 5HMYA 2QSWA 4LBHA 4IJAA 2MQPA 4F0MA 2KXNB 3IS9B 2E2QA 3DGPA 4ECZA 3FRYA 4C23A 4DMZA 2P51A 3OYEA 1BI4A 2E7VA 4PRFA 4C8KA 3VGSA 2MQMA 3Q23A 4LF5J 1F21A 1FE0A 3O6WA 5EX0A 1VQYA 2YTCA 5HLFA 1EKSA 4A57A 1K8KA 4TNOA 3HSGA 3R8EA 1JLEB 4AM7A 3IAYA 3NGZA 1FDBA 4Q45A 2GVDB 1CXUA 1RBUA 4GKKJ 4CHPA 1A5VA 4M63A 2YJFA 2Q43A 2W1BA 5A0YB 4DV3F 3MM9A 3S3OA 1SUQB 4WK3A 2LA6A 3HOSA 1R0AA 4NXNJ 5KFXA 3ZT1A 4H03B 4CZJA 3CDBA 4ECTA 1U8WA 2QE5A 4KRWA 2IRUA 5ETVA 2HZVA 4DX7A 5HO4A 4F9OA 2NS1B 4KI6A 1C0UB 2J0WA 5F9LA 5KFOA 3GZ7A 3G82B 3NS6A 3DC2A 1HQUB 5C42A 3MXJA 3QESA 2RHKA 3IM9A 2BOPA 3GFYA 4Q8EA 1WOPA 3I8BA 3R5CA 4CZEA 1MG7A 4YFUA 2KDOA 4WP8A 3RBEA 3G6ES 3EVOA 4A8XA 2VUGA 2QJ3A 5AZJA 4FXDA 2NRZA 4IH6A 1KS2A 4P73A 1BQMB 1QSLA 5KPZA 4MJKA 2LEAA 5L9XA 1VSHA 4QIGA 5L38A 5HRRA 3CJ3A 1F5CA 4E2FB 1OYDA 2IBOA 3R7NB 1RBRA 3H40A 1ELOA 4JKBA 1W9HA 4ENOA 4JI5J 5KQDA 3L09A 3C8YA 4FWKA 4OYOA 3BH6B 2ZM6K 2XGQA 1UJ4A 1C1BA 1KCFA 4G1QB 4CHOA 4DS4A 1ZBUA 3M1VA 5M2UA 2VBYA 3D54A 1R8CA 3H8YA 3PO5A 5LMNF 4FYYB 3D6RA 5HL7L 5DG8A 4ZJLA 4E8UA 2P9LA 1SKSA 5JS2A 3NGIA 3DLBA 1Q8KA 3WXKA 2EPIA 3VAMA 3QZ8A 1UCNA 1FERA 2V2KA 4UOFA 4MK9A 2XLIA 3BBCA 5IOLA 2HQCA 5HMXA 3WC2A 1UZHA 2LFVA 2VF3A 4IDKB 1Q8IA 2YQ3A 1Z05A 2W2OP 1X4AA 4YHHK 3ILIA 3UE2A 5CCLA 4YR3A 1NSKL 4N5SA 2ZJRQ 3OTCA 5AQJA 3FBBA 2YX7A 1C6VA 3PG9A 3O9SA 5A2QY 3THVA 5EWGA 3I55N 1R31A 3CCUS 2HLTA 1RWKB 3N9UC 1FNXH 2VA3A 1C0FA 2B7BB 3GJTB 1VQLN 1JKHA 4RLEA 3WIUA 2RB7A 1T03A 4ELVA 1AFJA 4YY3K 3P1GA 3Q8YA 1I1GA 2VICA 2YXLA 2NRRA 4WFZA 4O3NA 4I4BA 4LF8K 3KK3A 1S1XA 2YWGA 1RDAA 1RK8A 2VCPA 3S41A 4EAHD 3RSEA 1HNZK 2KXHA 2P9IA 3OL9A 1TKXB 1IJJA 2RDJA 2NSCA 4CO1A 2QKBA 2FHKA 3FVYA 5J1NA 3W0LA 4AHTA 1YITS 2UYTA 1LWCB 2AV5A 4KH4A 2JC0A 1SC6A 3SQOP 4MIAA 2JEGA 4DG1A 4ELUA 4AHRA 2AT1B 4H54A 2HNYB 2CJ9A 3M6VA 3BN4A 5J2MB 3C15B 4FZVA 2GVZA 2BXJA 2WBMA 3MM8B 1Q7LB 1HR0J 3QAUA 2YY3A 4ECUA 2W4DA 2FJAB 3NGSA 1YIJS 1S6OA 1YAGA 4CGIA 4ZK7M 4L6V3 4U7BA 4RJVA 3G10A 1ZPWX 3ZSWA 4H0PA 1QAXA 2LKZA 3ITHB 4NLOA 4XO0A 1JXLA 5IT4A 5KRSA 3FUYA 4WPAA 1TUVA 4FOEA 4EU0A 3EE3A 3FC9A 2OFHX 5DDPC 1FF2A 5IWAF 2PDAA 5AT1B 2NXEA 1LXJA 1YRUA 3MI7X 1RWVB 3FKBA 2FJEB 5D4PA 1VQNN 2HGLA 2CPFA 4RW4A 2ZNYA 4MH8A 1IR1A 1S7HA 2KZMA 3QNWB 4J9UE 2QA4G 3OTBA 4HT5A 1NLKL 4AD6A 1Z1ZA 1QUPA 4ED2A 3MPYA 1YZ7A 1RWWB 3CULA 3E8OA 4JKDA 2BJ1A 3HXMA 2HBYB 2CQ4A 1YTAA 3TOQA 1GAOA 3SNNA 1XN9A 2CQ3A 5B0EA 2G8VA 3BGRA 4DV4J 3D7EO 5KT5A 2VG7B 2ASMA 4Y2KA 1JXBA 4IRKA 3LALA 1Z4UA 2FZCB 3BBFA 1KFDA 3OYDA 4AHSA 1FJGK 4NLCA 2E5GA 5L1LA 4CF1A 3ISNC 4BVPA 1QE1B 1BHLA 1FNMA 4L72B 1NK0A 4K4SA 4DCOB 4O4GA 3I4PA 3I0SA 4XH4A 1NUEA 1IKWA 2ZWPA 3CDWA 5CY4A 1D9FA 4PWDA 4IUFA 4Q2MA 3X3UA 2I6WA 3U3GA 1BMQB 2ZFHA 3BUZB 2RN2A 3GP9A 1HHQA 4JV5K 2ZDOA 1BHNA 4DG1B 1YI2S 4F4WA 3POTB 2R9LA 4CLYA 4E0DA 2QWQA 4DV2K 1PJ6A 4IO1A 1S22A 1Q5VA 4O4RA 1AYEA 3QRRA 4OX8A 3B6PA 2ZJPQ 2NQPA 2GGPA 4O44B 2RS8A 4FWSA 4MQ3A 2E2NA 3W8GA 4DR4F 4LH4A 5MLCV 4KH6A 3R9PA 4I0WA 3IFRA 2Q6CA 4O3RA 1ZOTA 2LQ9A 1K6YA 4A62A 4DI6A 3UKRA 2AHOB 2X6NA 2WFBA 2IIHA 3K58A 2HK3A 1HYSB 1HBNA 3V9XA 2ZH9A 1VSFA 1IG8A 1SL2A 2RRBA 3WC0A 4G65A 2BACA 1TL4A 3KK7A 3GPAA 3PYDA 5AQKA 4B1VA 3N6MA 3P5BP 4N77A 1RCOB 3NCQA 1LNQA 5GADP 3KLHA 5H9FK 4Q44A 5E5NA 4BC7A 2GNKA 4HACA 2OELA 2OA8A 2NXUA 5HOOA 1ZBIA 3LZIA 3JSBA 3FZHA 2PA3A 3O8MA 2JWKA 3CETA 1ZBSA 4ED7A 4YOVA 2XI2A 1S59A 4J2EA 4FK4A 3LWMA 3JSMB 3CB4A 2VFRA 4ISGA 4W5OA 4M3WA 2M88A 3K7RA 2PMWA 3F44A 2DRBA 3ZO7A 2BVZA 1VFJA 1DY3A 2XS5A 3EO3A 1MW7A 4DR6K 4DV6J 4RUAA 2HVHA 2HGMA 3ELHA 2VG7A 2DNKA 2J4RA 1RTHB 1UETA 4IRCA 4CEBA 5J2NA 1N6QA 2IM3A 4LFAF 3O4QA 3BO3A 3R7BB 3H45C 3M8YA 4DV4F 1Q86T 3EGNA 2O4IA 3T9NA 1KAZA 1UVMA 3J8AA 5GAGP 2VKZG 2ZH3A 4GV3A 4K4XA 3KUGA 1MROB 3PJWA 3QEWA 4X66K 2MZTA 1Z6RA 1SL0A 4B3TF 4KB0A 4QW8A 3QLHB 5K5MA 2P9NB 1R6VA 3ADAC 1V5VA 2XB2D 3L4IA 2K8GA 1UTAA 4EFAC 3AY9A 3WXJA 5KFJA 1BLUA 3K5LA 4X4SA 4O5FA 4X4RA 4Z4CA 4Y28C 3KWGA 3VALA 3SBMA 4KGKA 1KD1O 1NGDA 3WNHA 1HNZJ 2ZITA 4IQXA 1Q16B 4E7LA 4B9LA 1RBVA 1NCLA 1RNHA 2Y0SD 3O3FA 2BGGA 3TVZA 3VQAA 1VCTA 2KI2A 3CJ7A 2M8HA 3OBIA 2HZAA 4K0KK 3SBGA 2RUGA 5ETQA 3FCVA 2HNDA 1HNXK 2D1KA 2FJWA 3B4MA 3G4SN 1C1CB 2QL5B 3AVGA 2HBMA 3KDNA 3HVWA 3BYPA 4Q0BA 3O4NA 3HVTA 2QG9B 3BF3A 3IAM9 2RHQB 3OA9A 4ZIWA 3LH2S 3AVBA 3UDCA 2P9SB 4CJRA 3M30A 5M1NA 2W7PA 3CJKA 1PYSB 3ATUA 1S6QA 3HM8A 1MN9A 4CJWA 4HDHA 3DDIA 1M0SA 2N7CA 1XERA 4OZLA 4R25A 3CCWA 3QDKA 2PO4A 3O9RA 4RBUA 2QLXA 1VQ8S 1OVQA 4JI1J 3HHNB 2WVEA 3NG8A 5AJ3K 2Q3PA 4LFCJ 5JLFA 2HK2A 2NCKL 5E2QA 2ZJRL 4H5VA 4K4WA 3HOTA 1XEZA 1VQPS 2E5IA 3UNYA 3QEVA 4HCBA 4KQZA 1SH0A 1NHVA 1B64A 4C7QA 4RU9A 3DYAB 3AO5A 3HBTA 3GFHA 2FQQB 5J1EA 1TL1B 4LF4F 3OTEA 3AA3A 1RJJA 4CHNA 4S0MA 1UEVA 4Z4GA 5IFMA 1RT7B 4DPXA 1S6PA 4F2RA 3UCUP 4JI5K 1UOCA 5D6GA 3O1BA 4BRIA 3M2UA 1REGX 5AQXA 4U67L 4WFBQ 2CQIA 4ANDA 5FROA 3PFEA 2EWHA 4I68A 1VJWA 2H4YB 2MKCA 2IDEA 4EO8A 4FWQA 2YKNA 4QOZB 8ATCB 1B9DA 4B3MF 4TU8A 3W2WB 3K5NA 3CUNA 1VQMS 4N7TA 3UN3A 1RBTA 4C8MA 1BC6A 2ASOA 5FLXY 4FJLA 4V19J 4U7UK 3RRKA 5DMRA 5JICA 3EX7B 5MAOA 3DGVA 1K0VA 2FSNA 4FSVA 2L9WA 2G0IA 2E1CA 3H2VE 3ZLJA 1EP4A 2XO6A 4OHYA 1WAJA 2C3MA 4LBPA 2ZZMA 2WAQD 3C3LA 1NPKA 2OO4A 1SL1A 2DHXA 3B82A 1WKJA 4OKJA 4YDDB 5I3PA 1TUWA 1R3NA 1NGIA 1MSWD 3ZZ0A 1DBDA 4FP9A 5ADXA 1NK7A 3I9V9 2EKNA 4QR1A 5AFUH 2MJUA 1AW0A 2QGFB 1EQ0A 3RB6A 2XY7A 2LQBA 3OFGA 3R5DA 5KFWA 2LEBA 4FM2A 4J9KA 1T03B 4ILMA 3WHIA 3QRQA 3NGDA 4IEIA 4ZLLA 1U2RA 2F63A 1CBKA 2BW7A 3HT3A 1HW9A 1T05A 3SCXA 3HVRA 5IQ6A 4KHUA 3UDEA 2ABYA 1F2GA 4O0NA 3ZTRA 3KLGA 1RTZA 1W2IA 1C1AA 1U1NA 3H1QA 1YIJN 1E6VB 6FD1A 1GX6A 3B78A 2RKIB 3P31A 3HDSA 1B4SA 2IOCA 4Y0FA 2DNQA 1LWXA 3TNVA 4XH1A 2JFKA 1BXNA 2F4VF 2GFFA 1CC8A 2QO3A 3OYLA 1S1UA 4JV1A 1DTTA 4O8KA 4JHDA 2Q0RA 2ACYA 5JUMA 2VODA 3ATVA 4IFVA 4BRMA 4ZCLA 1N34J 2DGOA 1ZM2A 4DQPA 3ILJA 3SI8A 4XIUA 3IG1B 3FZLA 2R8KA 5A6PA 2DTUA 4LC9B 4RW6A 4WXWA 4AHVA 1R7IA 3BSNA 3FMWA 1E6YB 3R6MA 3LPUA 4M63C 3NY0A 2CQ0A 2P9KB 4LF9J 1FRKA 7AT1B 2F4FA 2ILYA 4LF1A 1T9VA 2RUSA 2ZJPL 3IWXA 2NZ4A 4CF8A 5K20B 3HHEA 3MD3A 4B1UB 2MMYA 1N54B 3Q8UA 1DKGD 4B9SA 1ZZFA 2DBBA 2E1YA 3TUZC 1BY9A 3NS5A 2YHAA 1ZZNA 3AVIA 2E5LJ 2E5JA 2HGNA 5MLCQ 1ZXOA 1KR4A 3M8PB 3TQEA 4GVEA 3WUHA 3TW0A 1F9EB 1EQYA 1S6PB 1RT1B 3GWCA 2AGPA 2W9BA 3QGIA 2HWTA 2P9SA 3Q22A 4LF7J 1BA1A 2XYGB 3OT9A 2VQFF 1NPRA 4RUCA 2UUTA 3OR1B 4FLUA 1JK9B 2WTFA 3VN5A 1OPZA 1BIZA 4KHQA 1RT4B 4OKEA 5FIIA 5LSOA 3M3ZA 1U6FA 3FGUA 4PKGA 4B8CA 4K4TA 4DSKA 4CDIA 3K0JA 2CNOB 2Z2ZA 1JNZB 1YITN 2FB0A 2OTLN 1H7WA 3KNGA 1NK6A 3PNIA 2M52A 3TI0A 2A40A 2K06A 1RT3A 3M9OB 3CYMA 3HZ6A 3TUJC 4CIFA 2AGQA 3DOMB 3TZXA 4KKOA 1C1BB 1SPBP 2ZBCA 4JB8B 4Y1CA 2LP4A 3AVMA 4IFYA 3V4MA 4C6AA 3TANA 3DHWC 4BRFA 2UXBK 3IRWP 1Y9OA 2CNKB 1HUXA 3AB2B 2Z58B 3KVGA 2A18A 4BREA 3OTDA 3MMVA 4RW4B 1HIYA 1VSMA 4E7IA 4W5QA 3VVUA 5AR0A 2VPXB 2XY5A 1BI4B 2MLZA 4LSNB 1GMWA 3UD4P 1TQLA 4KV8B 1RGVA 3BQ2A 2HBRB 4PXBA 2L08A 3N6LA 2AA4A 3VERA 2NSBA 2V7YA 2F3JA 1QUVA 4M5GA 1YJUA 1YK9A 3C14B 3ZTQA 1SV5A 1TKXA 3KG4A 1Y5LB 2F8HA 3VHQA 1X4FA 5DO2A 3MCMA 2OP5A 4I7FA 4USIA 2MGZB 1Z2ZA 3ZNUA 1KC8T 5AQFA 1NK5A 4XTTA 4CK2A 4KPYA 2FJVA 3UWTA 2MHEA 1HHTP 4A8OA 1URNA 1D09B 5KFNA 1JXVA 5F3ZA 3I32A 2A6MA 3DRSA 2N3OA 3BEXA 2GO8A 2NZCA 4HDGA 4BCAA 2VC0A 4GO5X 4WIIA 1EJ7L 4NLPA 4W5TA 2Q66A 2MTLA 1LAWA 1UPMB 1RZMA 2CVEA 2DGXA 4A59A 3P8BB 2QL9B 2KN4A 2NRXA 3BDEA 3BZKA 3LPTA 4PQUB 4EWTA 2QA4N 3VF2A 2GIQA 4WQ5A 2XSJA 2HQ3A 4KT0C 1YX2A 1NOYA 3N5BA 2FBYA 3O3LA 3AQOA 3AH6A 1N5VA 2DH9A 1S0VA 4G9ZA 5JMNA 3WIVA 1NJIO 3BF4A 2X51A 1HRHA 1VGYA 1GXTA 4LR9A 4NZ6A 3R2CJ 3R1HA 2HIQA 3AAWB 3CCMS 4OJ1A 4PXDA 3MDQA 2HRYA 4DPYA 2E7XA 3KG1A 2MJNA 4CK1A 3Q2SC 4OGCA 3TA0A 1X0PA 1RAFB 4JI7F 2FLNA 4NO7A 4DR7J 3J80O 4BS2A 5GAHP 4DSFA 3UKRB 4K2JA 3CGIA 1HLUA 3M9MB 3JS9A 3CI5A 2X1BA 1RHUB 2B9EA 4G6VB 2C2MB 2VWKA 4FWNA 4QU6A 1ACMB 5IT0A 2KHOA 3SSRA 4PPZA 2E5HA 2HAFA 3WX4A 2AGOA 3M6GA 4U67Q 2DR6A 4USKA 2HVEA 3AO1A 4U8VA 1MWZA 1QZ6A 3WNFA 3MEDB 2GX8A 5J1PA 4FZXC 2EVZA 5KQ8A 2E5LF 1AUSL 1QQMA 4LSLB 2DFFA 4IO8A 3OHBA 1KP6A 4URGA 3G2XA 5C2GA 1N52B 3LDSA 1VDHA 4PYDA 3AD8C 3GYGA 1SS6A 4IQMA 3O9QA 3DOLA 4OZ0A 3NP5A 2MQLA 3ZNJ1 1SQGA 3RAXA 3AODA 3FSXA 5FD1A 5F2RA 3WQUA 1HWLA 5B09A 4IBNA 4Y1DA 1HNVB 3FBFA 1DT9A 1XQSC 4IRDA 2V51B 4C8YA 4MKVA 4CO3A 4CLWA 2XGPA 2J8AA 4OJRA 3MXMA 2UUAK 4USJC 5D4OA 3R5JB 1WAFA 4CZGA 4QYRA 3RRHA 1TK5A 1N5SA 5CD4A 1QVFR 3SUQA 4PKDB 1FW6A 5F8GA 3OFEA 3U1MA 3MM6B 3CF5Q 5I3UB 4QIWD 4HR2A 3DU6A 4FNIA 1G15A 1AROP 1NBWA 3GJQB 1UVNA 2IA0A 4OYMA 3AA5X 5BR9A 2A41A 3QLHA 1T3VA 1WKKA 3OFHA 3AOCA 1NMDA 3D7SB 1KRPA 3JAMY 2N3LA 4H5TA 2OMLA 3P38A 1WSFA 4NMXA 3ZZPA 1UZDA 2B56A 3KHGA 5GAEI 3AVNA 4R0JA 2APOA 3P45B 5U47A 3OYGA 1EAYC 5CHIA 1OSDA 3TEHB 3MR2A 3M1VB 2MQQA 1U45A 1HQEB 4A4JA 3QFUA 2W2QP 4C97A 2QA1A 2GWKA 4PHTX 4CJEA 3VGMA 2YKMB 3L0QA 4EI2A 8RUCA 4ATNA 4BC3A 1HKBA 2YKPA 3M4XA 1NM1A 4O3PA 2RNEA 1U6BA 4U6PA 3VQCA 2DR7A 4NI2B 4A47A 3THYA 2W8LA 2ZE2A 4OYZA 4RUHA 1TL3A 2BE2A 2QRRA 4MK8A 4BC2A 2W42A 3CT9A 4Y34A 4CBUA 1RISA 2XMJA 2ATLA 3D2WA 3SSQA 4USVA 4ZA1A 4F3MA 2XZTB 4FZZA 1FNOA 2O8EA 1U8SA 1VC0A 5I42B 4U8YA 4JI1F 3TEGA 1RFQA 1XTZA 1ILYA 3E66A 3GG1A 1SVDA 1S1VB 3VOVA 2DHGA 3FGVA 4FKYA 3DMJB 1RCXB 5CXTA 2NNWA 1M5KC 3CCQN 3RR8A 3TTDA 4MFBB 2MDAA 4B3RJ 1DQAA 2MYFA 2P9NA 1TU0B 4CI0B 3CVKA 1FKOA 3FJ2A 4YY3F 1VQ6S 2YH0A 5CYJA 3EUNA 1BQNA 4DQRA 3KLVA 4DV6F 4JKHA 3RBDA 4ZTFA 3L95X 2ZJQQ 3I5BA 5CD4H 1XK8A 2OEMA 1FK9A 1YBTA 4BG9A 2PT0A 3ISZA 4UQGA 3HTVA 5AQVA 4NB4A 3RBXA 3M8ZA 2YX4A 3PYEA 3OS0A 4DQQA 1X3MA 2F4VJ 3PZPA 1QJHA 1WSIA 4NLYA 1NH7A 1LWEA 4GKJK 2H65B 2FF3B 2ITGA 2FBXA 5FDLA 5DM7Q 2L9NA 4OZJA 4YR2A 1S6UA 3HVAA 3NBPB 1KQGB 2QIFA 4USMA 5A2QU 1WJ9A 2FY1A 5E3PA 2JWLA 3G87A 2IGIA 1HNXF 5E7OB 1QQOA 1QTNB 4FPAA 3I56N 4DUZF 1JJ4A 4NLXA 3MDFA 1TV6A 3EXCX 2DR9A 4EUVA 4G1QA 2EFPA 4NASA 5LSLA 2WBRA 3NF6A 4M5LA 3S1TA 2AJ2A 4JKGA 3H98A 3JTNA 5H9EK 2HHWA 2EKYA 1YSJA 1S1TA 4QYZJ 2NLWA 4IOXA 4DSIA 2OPPB 1ZM9A 4CZLA 4W5RA 1S1VA 3NCRA 5HMZA 2P5OA 4KTWA 4OI2A 3RYLA 5T14A 2CQ1A 2X1FA 1KVCA 4DTJA 4WCEQ 4KE5A 1HI8A 4JD2A 5B08A 2J7UA 5HLFB 3QEPA 4OL8A 1UVKA 4UQTA 2R7VA 3OYKA 2OPSB 2E9TA 1AT1B 3EGVA 3D4JA 1UA1A 3EZWA 3CIMA 4JN4A 1WD6A 1IO2A 1FJGF 1EB0A 5EUHA 2B4JA 2ZH6A 1L3VA 1V4SA 3UNGC 2OEKA 5D0RA 3CMAN 1EKRA 2CPYA 2BJ3A 2B9WA 4J9OA 4PEOA 1ULRA 4CLUA 5HATA 3A13A 3DM2B 2MY7A 5HVHA 3LWLA 1SQKA 5EHHA 2OSQA 3C19A 3HLUA 1T9WA 4K4YA 4C98A 1CJKA 4DTMA 4FWOA 3K2YA 1LAVA 2HVIA 3IRXB 2UXDK 4FF3A 3QSYB 5KT6A 4DV2F 4CESA 2D0BA 2QTDA 3ZSOA 4B08A 2O8FA 1O8BA 3T6JA 3H6EA 4KC5A 4AF1A 4IJNA 3NHGA 1EWQA 1CJVB 2AZ3A 2QWLA 3GIJA 1NPPA 1TV6B 2IAJB 4JLHA 2IMWP 5C25B 4WFAL 3T19A 5A8KA 4B1WB 1NGBA 3CC2S 4W98A 3SMSA 1WG4A 4AYBD 1P1TA 1FVSA 3DRYA 4B9UA 1JLEA 5C25A 3AO3A 3ZZZA 2JHEA 1LV5A 2KYXA 1SIWB 5C12A 3N5FA 3ID8A 3BZQA 2ZBQA 3PKMA 2X74A 4KHPK 4EP5A 2G2YA 3RMAA 1KLMB 2I38A 1VQPN 3HI0A 4ICLA 1YJVA 1XMQF 3DFEA 4CM0A 2V8DA 3FZ2A 1X9JA 2OFGX 4LSZB 2UUBJ 4Y2IA 5DZ7A 1N32F 4MYUA 1VHFA 2YQ0A 2F65A 1I3AA 2M4MA 1WUUA 5ETRA 3VQBA 3AJ2A 4OLPA 2XMWA 3C6UB 1IKYA 4FBUA 4CH1A 1VC5A 4IG3B 3B6OA 3MMJA 3ULDA 3PACA 1FRXA 3C6UA 3CC7S 1RWMB 5L39A 3V9UA 2HHUA 2DK2A 2KVIA 4CFCA 3SIPB 4C8LA 3CCMN 4K2XA 1U04A 3PIOQ 3BKFA 4BE0A 1YJTA 1RAOA 4KIAA 5EWFA 4LF6F 2PEBA 4Y6IA 1XR5A 1K9MO 1JKHB 2Y8WA 4FJMA 5GADI 3IP0A 4KYZA 2GC8A 2NRHA 2V8GA 3M6WA 2R7OA 2FY8A 1T6CA 5HP1B 3PW2A 2OSRA 3JSRA 4M3RA 4BR2A 4U95A 5A6WA 2ADCA 1BIUA 1HNIB 2HS0A 3VA3A 2UVUA 2QLBB 2F40A 2YHXA 1S1TB 4B9TA 4JI8J 4NYNA 1TKZA 3V9SA 2NLXA 1HPMA 5CE3A 4B3SK 1RT4A 2NYIA 4URSA 3P6YC 1IBKJ 2AF6A 4KHNA 4FVUA 2PFFB 4QR2A 4RCHA 4LFCF 3QEXA 4LFBF 4HWIA 1R59O 2CH5A 2VWJA 5AQYA 4DL3A 2GQCA 3KMQA 4BR4A 2ASYA 1KQFB 1N36F 1VQKN 1UL3A 4MLHA 4DPWA 1HJRA 5E0OA 3OYBA 1VQ7N 3OYAA 1IWGA 4PUOA 2G2ZA 1FKPB 3QJLA 5BYQA 4DV1K 3KNAA 2CNLB 4K8XA 1TYQB 1EP4B 4KAZA 4R5PB 5TKWA 3QNNA 1XNQF 4IR9A 8AT1B 3C6TB 1V6HA 4WP3A 2C2NA 1FFGB 3FQLA 2CQDA 1YJRA 5JJBA 2OTLS 1IQZA 3J7ZO 2CXEA 5HVFA 4MK7A 4LR8A 3TAMA 2HURA 3OYHA 3LP0B 5KFFA 4NCAA 2HPUA 3MUVP 2J6SA 3JAMO 2YKQA 2N4CA 4L74A 3CD0A 2KO1A 2W24A 4GVLA 1CZBA 2CADA 3VQQA 2J0SD 4J90A 3B54A 1VQ9N 2A3ZA 4LRDA 4DV5K 5JXSA 3HM9A 4F02A 2HS4A 4FLZA 1LK5A 4ECXA 4ILRA 1S9EB 4CGJA 3A8IA 2B43A 1TKDA 1OYEA 1GMVA 3CMES 2P9GA 4OLOA 4DXLA 5LMUK 1XMQK 3DOMA 1BCMA 1YVFA 1ATSA 1LCUA 2FVCA 4XEIA 3HSCA 3L9ZA 3VEYA 5CCMA 4MO4A 4D3HA 2OTJN 5JVHQ 3HP6A 1X9WA 1IBMF 1WC3A 1W0HA 2R7SA 4TQSA 1Y10A 2FHOB 2HBQB 2HW3A 3OTOJ 1Y7PA 1G99A 4GNIA 2AMCB 4B3RK 3W3SA 4QOTA 3RB4A 3EZOA 1EQMA 3ZZUA 1RUSA 1D1UA 5AJ3F 1EHWA 4EYIB 3W62A 4HUGA 1S4EA 1OO0B 4ZCIA 2Q0UA 3OYIA 2ZBRA 2Q2RA 1UEKA 3C2PA 2DNRA 4J9PA 2YKNB 4ECVA 1SQEA 1CULB 3M6UA 5J2MA 1NB2A 3AA8A 2YNIB 2EFOA 2DGVA 2ZOGA 3VZHA 4ZJOA 3KD5E 1FDDA 1VOMA 4X4UA 3A5MC 2DHHA 2RQCA 4QZVB 4PY5A 2ZOFA 5LXRA 3RBZA 2CPEA 1HR0K 4ECSA 3GG0A 3THTA 3FCWA 3NS7B 2HHHK 3J80Y 3NGRA 2ROPA 4RKUC 4YHHF 3FBCA 2PI5A 4YOUA 4MKYA 3W2VA 1NDPA 2CPIA 3RVCA 5G0RB 2RF2B 2H48B 4RWWA 4NPOA 4OZ1A 1FX4A 2ETJA 4RWXA 1B9FA 1IJFB 2VDHA 3AOBA 5IT9U 2GMJA 5KFSA 4DV7K 5HBMB 4CJSA 1H2VZ 4X4VA 1RTDA 4LF8J 3KZBA 2EFNA 3HPHA 5BRFA 3KHYA 2BANB 2HYIB 3VEOA 3V1OA 2B5JB 1O1WA 4CEDA 4ZP9A 1YVUA 4NYPA 3G0ZA 4ES1A 2WZ1A 1KXPA 4FJ7A 1GOBA 1Q95G 1ESVA 4NLWA 3PJ9A 2HHVA 3KLFB 1QSYA 5KFHA 2DGWA 1O13A 3TVYA 1OS5A 3KFWX 4RL1A 1SJFA 2FBVA 3BGFA 2DGQA 4HH0A 4C11A 1HBMB 2X3DA 1N5QA 1HNIA 3L7UA 4RW7B 3CJ4A 3FZFA 3D1QA 4MMOA 4IKAA 2OPSA 3GONA 1GLCG 1QM9A 3CIPA 1WSJA 3PLAA 5DQHA 4OPKA 3PJXA 4A8YA 1GT8A 2DNYA 2V34A 4WFYA 2QWOA 1Q9YA 2Y1LB 1RTDB 3OL6A 4DN9A 5DK5A 5GMEA 3KLGB 4DPTA 4OHVA 3D1OA 3M2VA 4DHYA 3ONQA 3U1LA 5IV3A 3TABA 2FVPA 2E1RA 2N4DA 1WF1A 2FGCA 4JYAF 2VL1A 2R7QA 3K5PA 4IOBA 4WFAQ 3TAFA 2Z57B 2CYYA 3MFIA 2FZKB 5DM6Q 3THYB 1T9YA 1EZZB 1VSJA 3VAKA 5DDRC 2XEXA 3BP8A 2XYPB 1JNRB 3NE6A 3CC2N 4HI2A 4I6YA 4B1XB 2D0OA 2MZRA 4KGVB 3ENQA 4GV6A 5J2QB 4MO5A 3OLAA 2ZNZA 3K2PA 4B3OB 2CQ2A 3RTVA 2IA6A 5I3UA 3RSEB 2DR8A 1JLBA 4YEAA 2OPPA 4JKCA 1HD1A 3R6GB 3D2FA 3ENAA 2D7SA 4MIWA 4ECYA 1VIXA 5GMKa 5D3GB 2WW4A 2CDRB 1SJ1A 2BTFA 3DXMB 2BJ8A 1KC8O 1YF5L 3TA1A 3O80A 3FLCO 3SZ2A 2FLOA 1CZ9A 1UMJA 3FEZA 3MURP 4KAIA 1WOQA 2NRWA 5LL6Z 3T9ZA 2BRKA 3WNEA 1VRUB 3BSOA 4CLZA 2LYVA 1HNVA 2O8BB 1Z26A 4FLTA 1NEEA 3SUNA 3Q8QB 2BBEA 2YWWA 3VTHA 1H3DA 2XI3A 3MAAA 2AJFE 1HI0P 2KJWA 4CP5A 1VK0A 4DR7F 1U7LA 4TYBA 2UUCJ 3A12A 1Y5NB 5D77A 5HMWA 2UUBF 3CD5A 4DFMA 3CDEA 1EIYB 2ZE2B 2OPQA 4PG4A 4CF9A 3PSIA 4LRCA 5J2PB 4QS8A 3G8QA 4Z4HA 2OPRB 3BF1A 2PI4A 1W7WA 3DLEA 4EMDA 3KHHA 3RW7A 1TUYA 1F0XA 2P9UB 1GLDG 4HTUA 1IJEB 1Q8BA 2HVDA 4H0TB 3BDPA 4QCLA 3ENBA 3D68A 4BDZA 3HSDA 1QY7A 3QT8A 5SZTA 3S7RA 1V4TA 3JTPA 2NZTA 2HHHJ 2D74B 3CJAA 4BE1A 2VFVA 2GCFA 4TY9A 5KFAA 5IXUA 2O5DA 3FCHA 3FZBA 4Q2LA 5KFMA 1U6ZA 3MAAB 3VF0B 4IFEA 4L3QA 4ES2A 1WF0A 2IYGA 4ZPDA 1NNEA 1KAXA 2Z1JA 1WORA 3E9OA 4RBVA 2A1BA 3BZCA 3BQ1A 1DRZA 2A6AA 3MGJA 4XK8C 3KXDA 4TSXA 4PWDB 2XG8A 4WCEL 1HBMA 2DD8S 3VQTA 5EGYA 2O8CA 2H5EA 5B0DA 1TL3B 3OS2A 5KFCA 4BDPA 3GILA 1RAIB 1IR0A 2JFDA 3JYTB 2L48A 1JQGA 3GFXA 2FSJA 3IBCB 1YTYA 4LJMA 4PABA 2PYJA 3T69A 2VDIA 3ZT3A 4P74A 5L1KA 4N56A 4P2XA 2J7KA 1DURA 1ZM4A 1U2VA 4DR3J 1Q82O 1UEUA 1BOTO 3PFOA 2D0CA 2DNOA 2RQMA 1D4XA 3EEQA 4QS7A 2XNQA 4DR5K 1KSPA 3QO9A 5KFVA 3U9ZA 3NLCA 3V5RA 3O9TA 1LQ9A 4DUTA 1HJOA 2HNZA 1UW4A 2ATQA 4ZPBA 2H4WB 3A3NB 3W63A 4O4GB 2LXFA 4ZVRB 2QYGA 1XMOJ 2GAHC 2WSFC 1FRHA 3ZXWA 2C3OA 1EKEA 2G0CA 5GAHI 4Z94A 4QIVA 3CNQP 3WXIA 5FLXO 3I33A 1HNZF 1S7IA 1TK0A 5G4DA 1TUGB 2MB0B 5FPMA 4QWAA 3O4WA 4X4QA 2Q3SA 3W8PA 4IR1A 3POTA 5KFTA 2GZOA 4FJJA 2KU7A 3M8SA 2E2OA 4LRFA 4X4OA 1I5OB 3R5AA 4DFPA 4E3SA 2AWZA 4DN0A 4O3OA 4CWBA 1PSDA 2GQ2A 3ZTSA 5BJRA 4ZHRA 5KG5A 4YB6A 3VTIA 2GHWA 3ET6A 1BWVA 1D8YA 3OUYB 2KZZA 4JOUA 3F73A 4NYOA 1GLLO 3T1YF 1BL3A 1VISA 3G8TA 3HHLC 4RZRA 2VQEF 1DTQB 2CZVC 5ETPA 4NXNK 3A4TA 4LF5F 2LQJA 3NNHA 2SXLA 4F3TA 3MCOA 4B3SJ 2PAVA 2O1PA 4NCBA 4HTLA 2E5LK 1NDLA 3TUIC 1D5AA 1RHMB 4TU7A 1XNRF 2I1RA 4CTAB 5BPLA 1EETA 4GKKF 3EDRB 3NOGA 4DR7K 4FF1A 2B51A 3CCVN 5KFKA 2C28A 4HYKA 2J9DE 3T5LA 4ZTJA 4NLSA 4ITSA 2EWSA 3VEWA 3I0RB 2W01A 2B3TB 3N01A 3L7OA 2MSSA 2BMBA 4CFBA 3DLGA 3GMGA 3THXB 1CG2A 1VRTB 2Z1GA 4K0KF 3F9KA 2E1AA 4F26A 4EZ9A 4KB7A 3ET6B 5C2DA 1SI9A 1VRTA 5AJ3J 3H25A 1I94J 4DCHA 4FJXA 4A5AA 1UVLA 4QYZK 3P5JA 1S49A 2P9UA 1YWXA 1ZBTA 3HMJG 3L3VA 3LM9A 4A2BA 1SCJB 2J9CA 1AA1B 3AVFA 2HB5A 4DLGA 4ZVFA 3CCZA 4NLVA 4LUBA 3NVMA 4CTAA 1T6DA 4IEEA 1M5HA 1T44A 1JLGA 1RSCA 3T7ZA 5A8WB 1OQ3A 4DFKA 4CBWA 3Q8VA 2G8IA 2GIRA 4JAXA 2Z2MA 3TSQA 4LSNA 4CGGA 4B9NA 1JLAB 4AT1B 4HL9A 4NI2A 4JI4F 1NK9A 4AL7A 4H0OA 2HFVA 3DI6A 3DDNA 3CJ8A 3W65A 3JQMA 4CJ5A 2RHSB 1TGOA 4PXCA 4CECA 2Z8QA 4FKXA 4OV1A 2GJIA 3KLHB 2BOAA 4GKJJ 3CJ0A 4HVJA 4JNEA 3HCXA 2QEXS 4PYAA 1HFEL 4F8RA 2BQ3A 4BRDA 1U0HB 4OKKA 3T1HK 3KK2A 3AO2A 4C2MA 1D0EA 4OZNA 1U2VB 3ZCMA 1RAEB 1X4DA 3QETA 3QFHA 4CLLA 2O4GA 4ZN3A 1OH6A 3BO4A 3A2FA 3TR8A 3VQ9A 1LFWA 2EW9A 5D8HB 4KH1B 4A61A 2XHWA 1C0TB 2QLJB 3PEHA 5LMUJ 1HNWJ 3GQCA 4DLEA 5BREA 2WSEC 2QWMA 4OHWA 4RNFA 3PR5B 1N32J 3CCEN 3MXIA 2N82B 3QJPA 4NOHA 4CHYA 1X1PA 4KHRA 3AJDA 2HSTA 4DEZA 5CHCB 5BYRA 4I64A 2E66A 1FVQA 4Y2MA 3BBBA 3LGHA 2GS8A 5BR8F 1YGYA 4YOEA 3NEKA 2PYLA 3MPUB 3U8XA 3E01A 3G4SS 4OZ5A 5K14B 2IYIA 2BJDA 3BJYA 4CO5A 1PGZA 1SUQA 4M5HA 4M94A 2BKOA 4TVAB 4BR9A 2GVDA 3EKUA 1R43A 4N8OA 3VAIA 3LPEA 5ETLA 4TLQA 4DF4A 3FFIA 4H5WA 3CMAS 1C0UA 2NRTA 3H08A 2O67A 2Y8YA 2B4VA 1XNRK 1MU2B 5T41A 4QS9A 2C2OB 4J37A 2R2TA 1KDNA 1N34K 5JVHL 4FK2A 4DL7A 1NK8A 3GU0A 2ZZNA 1KVAA 2ZH7A 2RD5C 4HTIA 1SJ4P 3MMCB 2XWYA 3H4BA 3MTKA 4BR0A 2KM8C 4IDHA 4W92B 2QWPA 3C16B 4KGMA 4F50A 3FSIA 4LR7A 1RDRA 3DXBA 4UUWA 2QSFA 3NGUA 3NH0A 4C1NI 3FMBA 2CIMA 2W25A 4EYHB 5DLFA 1PYTA 1IXKA 1UAWA 3CCSN 2C1EB 4ELTA 1UPPA 1NZAA 1LFPA 2R7RA 2QV6A 3CCES 2ZHBA 4F4ZA 1PBAA 4QWCA 3M05A 3MEGA 5AXKA 2DVIA 1S76D 4CIOA 2C2DA 4F04B 4FJHA 5HRPA 1YZ6A 3NMAA 2VONA 4JI6J 4E7HA 2F4VK 3W3DA 1FE4A 1RKJA 1AXQA 5KFBA 3HYFA 4K25A 3J7AN 4RX6A 4UTGA 4PG6A 4DSLA 1HW8A 3MZIA 4O5BA 3BGOP 4PG7A 2BYCA 2CZ9A 5KGWA 5DG7A 3L3UA 4DTNA 2UXCF 2ZH1A 3VGVA 4FW2A 1WLJA 4Q5VA 3SQGA 2UUCF 3EPIA 1S79A 4J9NA 2BABA 2R7XA 2IM1A 2NUUG 1G3OA 5FPNA 3OHAA 3QT6A 2YJEA 4ILLA 1MMLA 1Z2LA 2IIRA 3P83D 2C2EA 4YUDA 3J7YU 3ZETA 4ZKAA 5IWAK 4M95A 1NJYA 2DNLA 4RNOA 4DMNA 3LO3A 5FRNA 3S3MA 4PG5A 4PAAA 5KOXA 3O6QA 4AUKA 5AZIB 3LAMA 3MCNA 2UVVA 3H59A 2HFSA 1F6TA 1NGAA 5C24B 4HKQA 5AQQA 3KLEB 4F7VA 4JI3J 3PXGa 1F60B 1DEJA 2AJ4A 3FK4A 2NYHA 3D45A 3PHTA 3SCJE 2YNGB 3J7A1 2PD1A 1DFDA 2V68A 2MY8A 3BPDA 4JI5F 4ZPVR 1IBMJ 2IC3A 3OW2M 2Y9HA 3RB3A 4JP8A 2PSZA 4CFDA 5ETTA 3ITHA 1UVIA 2Q97A 5KRTA 1R6YA 2U2FA 3OL8A 4KREA 3C46A 4CE9A 4Z4EA 3ILOA 2J7WA 4O3QA 3BPSP 3PW7A 2FF6A 1FRJA 1J27A 1S1WB 2LU1A 2ZH8A 2G0JA 4ISFA 4LF6K 6FDRA 5AQLA 1CJUA 1ZC6A 4IWVA 5CZVA 1WC1A 3SCLE 2JEJA 2PMHA 3KJVA 2IBKA 3MN6A 1J2VA 4UOGA 2V7ZA 1TMMA 3OSPA 2XRIA 2YI1A 4JKFA 4WQ5C 4JI0F 2QFJA 3WT0A 3I82A 3LP0A 3R3LA 4AXJA 3G8SA 2M9KA 3MMCA 4DX8H 5HP1A 2AX1A 3E3XA 3S01A 1OWXA 4M42A 2XULA 1IM6A 4M41A 4I6AA 1UVJA 2OEJA 2W2MP 4KPCA 4ECRA 3A3OB 1RTJB 3UD5A 2ZM6F 1J9AA 2FHJD 4JHDB 4CJPA 4V19S 1SKUB 3ENWA 1FJEB 4LF7K 3SQ4A 4EO6A 3DRRA 3R3TA 4KHYA 3GIIA 3R27A 2P9IB 3L2WA 4ZVHA 3N4WA 3PTWA 2CDQA 1FHTA 3AAPA 4ZITA 1T7PA 3OTOF 1XHXA 2IRYA 1LKZA 3GYNA 5JVGQ 1S9GB 3Q0AA 1NBEB 2JRSA 1ROFA 5DRKA 4I67A 2R7UA 9ATCB 3V81A 3V6HA 5C24A 2E1MC 2HIYA 3C94A 1AUDA 3VEVA 1DZ5A 3C6AA 2FJDB 5ETSA 5L46A 4HUFA 2I7NA 1TR0A 4I2QA 4I69A 1YDLA 5ADXH 2J8SA 5TKYA 2IC3B 1D9DA 1KVJA 2HSEB 4DOZA 4OJHA 5D4NA 4RW9B 3KKFA 4Y0WA 4DR6F 4CZIA 1I3OB 2XNRA 1GXUA 3KIOA 3ZZTA 5BPNA 3CCUN 5KG7A 3MEGB 4X4NA 1VQ8N 2EBEA 4ZVSB 2A0FB 4FLWA 4LFAK 3THWA 2UU9K 4MFBA 1IUJA 3K8WA 3RR7A 1VBYA 2AJ0A 1K1QA 1QLNA 1IG9A 1YJWN 1S5ZA 3RB0A 1REVA 2HQFA 1RWPB 1FEEA 4WZMA 2IVOA 3L2QA 3UE5A 1NHKL 3S6EA 1RAGB 1IBCB 4FLVA 1S0OA 1HKCA 5L1JA 4FW1A 5IT9O 2YWEA 2ZWHA 3H5YA 4FJ8A 1V5IB 4TQRA 1VBZA 2AP6A 2VQFK 2ZC4A 4OX9F 2CJBA 4DQIA 1WEZA 5F41A 3I5CA 3EMTA 2EX3A 3SAHA 4WBFA 1M5VC 1VQ5S 1QVFM 1O51A 2GV1A 3H20A 2WHOA 2NUHA 3UO0A 3ALYA 2DEJA 5F0WA 4DUYF 2OD6A 4Y2AA 4CRJA 1RT3B 3DOLB 3W5YA 3VAJA 4DQSA 2GMLA 4NLBA 1A9NB 1S77D 4MT1A 2W6LA 2FIUA 1R0BG 1CJUB 2E88A 1WB9A 3S8SA 1E3MA 5GADU 5ADZA 4OI3A 4LFAJ 1S97A 4DPOA 3MECB 3AQPA 3F56A 1EO1A 1UWBB 3CC4S 5JVGL 4I56A 3LUYA 1RBAA 4BE2A 5LOQA 1Y11A 3QFWA 1CSJA 2HWHA 3F0NA 3IS9A 3ZX2A 3KJFB 1FK9B 3CCLS 5CYQA 4YNQA 2XQCA 2JGUA 1TVRA 1X4EA 2QN6B 4QJVA 2RE2A 1V3ZA 2V8VA 3GLJA 4NEZA 3DM2A 3QFPA 5AZJB 1IVZA 4JRQA 3J81j 1NSAA 2XSJB 2MKSA 1PJ5A 3D9BA 3FZKA 3CPWR 4LF7F 2CUYA 3RW6A 5KFLA 2HLUA 3KJQB 2YPZA 3P39A 4BWMA 1C1CA 1UJ5A 3K59A 2HHTA 4C1NK 1REVB 4RG8A 1ITGA 2DNNA 1ZTWA 2I0XA 3C7NA 4ZVTB 3BR8A 2DY9A 1H72C 1WSVA 4PCQA 2QYCA 3OSNA 2D5RA 2FHMA 2KHCA 4DSEA 1T3NA 4JV5F 5K8PA 3OD2A 4PXEA 1YRXA 4DR3F 4X65K 3T5HA 2DGUA 4ID5B 4ANCA 1QTMA 4TLRA 3CD6S 2KRRA 1BWEA 3BM7A 1J54A 5DDOC 4FWRA 2D9PA 3N6NA 3RU0A 3PRVA 1RTIB 1U1OA 1KN6A 4RNHA 1A0OB 4GKJF 4JI1K 2AEMA 1V3RA 1L3UA 3NH2A 2DISA 1LOUA 3E51A 3R5BA 5GAGU 4M3ZA 3GE1A 2JX2A 3NMRA 3L2RA 1JLFA 1GMWD 4CI6A 3VENA 3DXSX 4CLKA 3I9ZA 3TRGA 3N4QA 5HAOA 2F9DA 5FDLB 2ERRA 1H73A 3HFVA 2CJAA 2D1CA 4K43A 2AYMA 1XR6A 1ZETA 2LDIA 5CAAA 2DY4A 1T11A 3TZZA 4ZP8A 3AARA 2WVFA 1BQXA 4WTYA 3EE9A 2DNGA 2G8KA 4X62K 1DLOB 3QWUA 3SPYA 2JDJA 5DS7A 2GTDA 2B9YA 5AQUA 2UVRA 3JQJA 4I2QB 4CLPA 1QHAA 1SJQA 2YX1A 2J5AA 2X78A 5J1EB 2QA2A 2PFUA 4K42A 2UU9J 1LOTB 3QRPA 2RU9A 3MM6A 2C42A 4ERDA 1RADB 5K9FA 4LY7A 5D4LA 4FK0A 4FS1A 1WSHA 2GV9A 4FF2A 1PO6A 3LDQA 4BRLA 4DCJB 2K1RA 3CCVS 1FXDA 2EI5A 2M5YA 3D3BJ 2YKOA 3W7BA 4CGFA 5CZXA 3AO4A 4J2BA 3ILLA 2IVFB 2VWBA 3IAS9 5IC4B 1Y00A 3IMQJ 4FYVB 2MKKA 2CH6A 4FO0A 2JL9A 2KT2A 1Q53A 3H5UA 3HKZD 2DXFA 4KR0B 1UA0A 2NXJA 3QT5A 4X84A 2R7YA 3Q8RB 1S72S 1HPZA 4NXMF 3HPGA 3H42A 2E8AA 4YOWA 3KK1A 3CWJA 1NSPA 1NMNA 4DTOA 5CYMA 3K8VA 2R2UA 4JI4K 3OL7A 3C6HA 4CH0S 3CD6N 3C65A 1XWLA 1FFSB 1XNRJ 1U48A 1UWBA 1S12A 1ZA2B 1KVBA 4I6WA 1B7FA 3QT7A 3WEEB 1K8AO 1PBUA 4NE9C 4IZ9A 1TKTA 3ISND 4RW8A 2C22A 4WKRA 1VIOA 9RUBA 3E1YA 4LF9K 3T1AA 1QAIA 1TZ0A 4CLFA 3VQDA 3IWNC 1LEOA 2G1DA 2F1FA 1XMOF 4M45A 2M8DB 4FS2A 2ASDA 4DV0K 4M7XA 4OZ2A 2EEYA 2YQ1A 1Q82T 4DWIA 4CZFA 1RT1A 4JK9A 1BDGA 1BD6A 3DRRB 3MM8A 4RTFD 4ED0A 3CJTA 3R9LA 4RW6B 4KHPF 4UY8T 4J2AA 1B0PA 3A5NC 2LCWA 4QW9A 4JV0A 1MMDA 3LP1A 4AL6A 3LANA 3AVJA 4CBXA 2OAUA 2EK6A 3DXMA 3CQ8A 3FNNA 1NGHA 3CJRA 4X65F 5KG2A 3MWTA 3NRBA 3IM8A 2YV0X 4LBIA 1A5WA 2O66A 1JCFA 4HI1A 3EVWA 3HZGA 5C7PA 1HBOA 5GAEU 1S1UB 1J5OB 2AKWB 4FJKA 1NWKA 4J9SA 1X60A 2CA9A 3M8PA 2QMXA 5DJBA 2YNFB 3OVSA 1T94A 4ZS6A 3A8JA 2BE2B 4K5RA 3ID6A 3BREA 3WZ0A 1T0TV 3MM5A 4DF8A 5KFPA 1HNWK 4FN5A 4MTPA 2P9KA 3O1WA 2MKIA 4OIXA 3QSIA 1I6JA 2QXFA 5DM6L 2R4FA 4LD0A 4DV0J 3NH1A 1IBLF 5B0FA 3AJ1A 5I9EB 2GVZB 4L76A 5AFUA 2R2SA 2ZOMA 4A46A 4GC7A 4Q7AA 1X4CA 2ZUAA 1F3FA 3B4DA 2VIHA 1VQON 1S57A 1SZ2A 3MR5A 3JXOA 2V2VA 2NXNA 2C2ZB 2V94A 4DV3K 2BM0A 2F8MA 3LP2A 4CJTA 4CH7A 4V1Ak 4ZDNA 1MU2A 3G6EN 2FPHX 4GO7X 1ATRA 2PY5A 2FXUA 2GMHA 1CJKB 4ZPTR 3NAEA 2QT7A 4LFCK 3JAMU 5M1FA 2YKMA 4K4VA 3IFEA 2GHVC 4CJ4A 5AQGA 2EK1A 3CTRA 2LQ5A 1CJTA 4DR1J 3SV4A 1JJHA 1VYAA 3JB9k 2KL8A 4WXOA 1FRLA 2ASJA 3ZEUA 4CEZA 3MF5A 4A48A 3NVKA 3GYXB 4CJ7A 3ZYYX 3P4UB 3VEZA 1IBKF 2Z1HA 2DHSA 4PKIA 3GIMA 5AQMA 3V81B 2Q31A 3FDSA 1YJNS 1P9YA 1SB6A 1JCEA 3VQ8A 3UVJB 5HI7A 1TK8A 4FJGA 1VLYA 5GIPA 2OD4A 5T7LA 1SKRA 2GW8A 3AVAA 3TP2A 2KKZA 3FFIB 2FJXA 1KHVA 2UUCK 4F4AA 5FJ4A 2B4OA 4C8NA 2P6TA 5HQLA 1HBOB 1VQ4N 2HNZB 4MIBA 3GSDA 1XUPO 2DTJA 3LF0A 5LMNK 3BYRA 3D2EA 1NGJA 3WBZA 1P27B 4C48A 4L73A 2X3GA 4K5SA