4Q0BA

Crystal structure of hiv-1 reverse transcriptase in complex with gap-rna/dna and nevirapine
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
555
structure length
555
Chain Sequence
VPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTNSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of HIV-1 RT-RNA/DNA ternary complexes with dATP and nevirapine reveal conformational flexibility of RNA/DNA: insights into requirements for RNase H cleavage.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase, hydrolase/rna/dna/inhibitor
molecule keywords HIV-1 reverse transcriptase, p66 subunit
total genus 142
structure length 555
sequence length 555
chains with identical sequence C
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2014-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4q0bA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4q0bA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4q0bA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4q0bA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4q0bA05
2XHBA 2A1SA 1LAWA 2FJWA 4IRKA 4CE9A 3PX4A 3OL6A 4B9TA 2IM1A 4ZP9A 1X9WA 2R8KA 4CIFA 4W5QA 1S10A 3L3VA 4PWDB 5CYMB 2IC3B 5KFQA 4RNHA 5KFYA 1BCMA 3AV9A 2C2DA 2HNDB 3QNOA 4M45A 3VA0A 4KTWA 3NGYA 4CHNA 1KFDA 1Z4UA 3PZPA 1Y97A 2AWZA 2XGQA 2OH2A 1RT3A 1RTHB 4FXDA 2WTFA 3LP2A 1RT4B 2XI3A 4NLSA 3RAQA 1VSKA 3H5XA 4NLYA 1IKXB 5JS1A 4GVMA 3OJUA 1IKWB 5J2PA 3QIPB 4CK2A 3ZT4A 3PR4A 4FLTA 1C0TA 4DTOA 2WOMB 2DTUA 1C1CA 4F2RA 2D0BA 4DL2A 4DQIA 3C6UB 1NJYA 1A5VA 3DRSB 5KI6A 4J9QA 4QWAA 5T14A 2G8UA 3K5OA 5KFFA 3PW2A 3H98A 1SV5A 1U04A 2OPPA 2EHGA 3VA3A 3OHBA 4F8RA 4ECZA 4KRFA 4CJVA 1ZBLA 3IAYA 2KTQA 2ZE2B 3MECB 2RPIA 4CEQA 4O3QA 3NHGA 4MIAA 3M9OB 4FLZA 3PO5A 4O0JA 3SPZA 3HSTB 1N5YA 1LWFA 4E7LA 5DQIA 2Y1IA 4K4UA 1LWCB 3KLEA 1GOAA 1NJWA 2XY8A 3V9ZA 1RT2B 2FVPA 5HROB 2FVCA 1T8EA 1JX4A 3GIJA 4M3WA 4G1QA 4DTJA 2FJXA 4E7IA 3NGIA 5E41A 3GQCA 1ZTTA 3QGHA 3SV3A 1JLBA 2UVUA 3DRRA 1NK0A 2BQ3A 4K4VA 4AHCA 4WYWA 1C0UA 2ASJA 3SJJA 1SUQB 4FK2A 2P5GA 4Q45A 1S5JA 1KTQA 4DSJA 2PYLA 1VRUA 5KFDA 4LH5A 4Y2CA 4F4YA 2WCXA 2BGGA 1JL2A 4E0DA 1BCOA 3OSPA 1RT7B 1IKXA 3DLKB 5HBMB 1HNIA 1U09A 3RAXA 2Y1JA 3NBPA 4B3OB 4K8XA 1C1CB 2ZQBA 4U7CA 4NLQA 3QETA 2V0NA 1JLEB 4J9SA 3KNAA 3HM9A 4NCGA 5CYQA 2YKNB 4PA1A 4TQSA 3OYGA 4ED8A 1K6YA 2G8HA 1I39A 1RYRA 2JEIA 3IRXB 3CM5A 1TK0A 1QE1A 4DU3A 4OPJA 3VQ9A 3SYZA 2JEGA 2E9RX 4E1NA 1S4FA 3HP9A 4ED6A 2V4RA 4E7JA 1C2PA 3KLGA 4YP3A 3QINA 3DOKA 4Z4GA 3G6VA 5KFKA 2R8HA 1REVB 1DTTA 3ZSXA 4CGGA 2O5DA 3NE6A 4TYBA 2HHVA 4Q43A 3AVFA 3SFGA 4HUFA 5EUHA 4YQWA 4M42A 1HRHA 2CJQA 1JLCB 4O3NA 5EWEA 1Q9YA 1KRPA 4FJMA 3TAPA 4FS1A 1DLOB 3BQ1A 1SL0A 1SH3A 3HL8A 3SUQA 1T05A 1ZBFA 1J9AA 4HTUA 3MTKA 4OLAA 4PWDA 4TY8B 2XCPA 4CF0A 4M94A 5KT6A 3HPOA 2VWKA 4RW8B 3HO1A 3L3UA 2W9AA 2W8LA 4ZVHA 1QHTA 4CJWA 3AVHA 2HHXA 1T03B 3OS1A 1JLFB 3OYJA 3KLHA 3JSMA 3CDWA 4MKAA 3H5SA 1TGOA 1WLJA 4OVLA 1RTIB 5DQHA 1U47A 1JL1A 3OYKA 2EC0A 2F8TA 4DS4A 4QWEA 3KKSA 4KAIA 3L8BA 4WZMA 4EBCA 2W9BB 5HP1A 4CHOA 4NRUA 1S6PA 4NRTA 5KTQA 1XI1A 1S6PB 1RBVA 2HAIA 3BSAA 4ZMMA 4CK1A 2ZD1B 4W5TA 3GV7B 3BSCA 5F8MA 3AVBA 1YT3A 3DRRB 3H2LA 1S9EA 2OPRB 4E7HA 3TAMB 3AA3A 5KFTA 1T94A 3KMQA 3HXMA 4DQPA 2ASLA 4K4SA 4CGHA 4FK4A 4KPYA 2RF2B 2V9WA 1UWBA 1VRUB 3RRGA 2YNIA 4NLUA 1HPZB 3FQKA 4QWBA 2IM0A 4C8NA 2YV0X 5DLGA 4CJUA 4CK3A 2HNZB 4NLGA 1VK0A 2OYQA 4CJPA 4CGIA 3P5JA 4LSNB 3RMDA 4R5PA 3NF6A 2AGOA 3MAQA 3O3GA 1WSGA 3C6UA 4WFXA 2HHQA 2XI2A 4NLXA 4DTPA 4IKAA 2JLEA 3OJSA 4FJLA 4Z4HA 2YNGB 4UQGA 2YKMB 3I5CA 3DM2B 1S1WA 4O4GA 5F8JA 4FJ5A 3DI6A 3HP6A 4Z0UA 1RBTA 1XC9A 3QEIA 4IFYB 4I2QB 1RBSA 4CHYA 3M8QA 4JLHA 4IG0B 1RA6A 3K2PA 3KLHB 4DTMA 4ZPBA 4RW7B 1SKRA 3KLGB 2FC0A 1RTIA 4ELTA 1HARA 3M9NB 1N48A 1A5XA 2D3ZA 2CKWA 1VSEA 4LD0A 3T5JA 2HWHA 4NYNA 4E3SA 4OKKA 3MFHA 3AO1A 4OKEA 2Z1IA 3CWJA 4BWMA 4EP5A 3ZT0A 4J2EA 1WAJA 4KSEB 3NAIA 1ASUA 4CJRA 3MR5A 4O3OA 4CF9A 4IH5A 1RTDA 4MFBB 2X6NA 2HMIB 2RN2A 1FXXA 3OYDA 4Q8EA 1C1BA 3QZ8A 3HYFA 3QESA 4I2PB 4TY8A 4JV1A 2R8GA 4NYFA 3KMSA 4RW6B 5J2NB 3PW4A 2QXFA 4CJKA 3L2VA 4ZVGA 3BQ0A 4X2BA 2IDOA 1NOYA 1XHZA 1KCFA 3I5BA 2IM2A 4BWJA 4KE5A 1ZBUA 4NLTA 4K4TA 1HYSB 4QW9A 4B9NA 2XC9A 3V6DA 5KFLA 1C6VA 1TL3A 3BGRB 5KGWA 3PO4A 3DOLB 4K4ZA 3LANA 4LSLB 5C42B 3AA5X 3CIZA 3NGDA 2E6MA 4ZHRA 1S49A 3L2WA 3RWUA 3KK1B 4G1QB 3HHKA 5F8NA 4F3OA 2PYJA 3AVCA 1TKZB 4PUOA 3RBDA 4CFAA 2WHOA 3I0SB 1CZ9A 1JLBB 4XO0A 1BQMA 3CJ2A 2BANA 4Y2AA 4WXOA 1VSDA 5KFCA 2JGUA 4FLWA 1ZBIA 3TAMA 4FZYA 2IOCA 2HVHA 3O3HA 3C6TB 4N5SA 1RT4A 2JC1A 4FLXA 1XR5A 3NDKA 4IDKB 4HUGA 2VG5A 4LQ9A 3CVKA 4M3XA 3OL7A 1FKPA 3AA4A 1FKOB 5C24B 4K4XA 4KHMA 2HNZA 3ZSWA 4LSNA 3Q8SB 4CGFA 3FQLA 3NF8A 3MEDA 1VSLA 5KRSA 3H08A 2RKIB 2HHSA 3QLHB 3TAEA 1L3VA 3AVMA 4DSIA 5L9XA 2KZZA 3AVIA 3SUNA 3LP3A 4FJXA 3OHAA 4MK8A 5CYMA 1L5UA 4KI6A 4K4WA 3CQ8A 5SZTA 4ZTJA 1JXBA 2OZMA 4QCLA 1QE1B 1VSMA 4IFYA 4KHRA 3AO5A 1JLQA 1S1TA 4RNOA 1NKBA 2G8VA 4HCBA 3DOKB 5KT2A 2VG6B 2VG5B 2W8KA 3ASMA 2VG6A 1TK5A 2YHBA 1IH7A 2O4GA 2JEJA 1JXLA 1IM4A 4HYKA 3KK1A 2FVQA 1S48A 3QIDA 1D1UA 2FLPA 2ZD1A 4EP4A 3GYNA 3D45A 2BQUA 1BL3A 4CJTA 3OYBA 4OGEA 5HLFB 4DG1B 3OSNA 4RNFA 4DSFA 4ECTA 1IKVA 3BJYA 4O3SA 3CYMA 1OS5A 4CJEA 1ZBHA 3OVNA 4ID5B 2UVWA 4CIGA 4Y3CA 3PW5A 3PY8A 3K5NA 2QE5A 1QSLA 1QAJA 2BR0A 4M3TA 5FROA 1JXEA 2JEFA 4I9LA 3ZT1A 1NKEA 3SQ4A 2IS3A 4R5PB 3AVAA 4FM0A 2QKBA 1QSYA 3TARA 5FDLB 2HNYB 1U4BA 4ED1A 3OL8A 2IJNA 4C8LA 1TKZA 4PUOB 2G8WA 5KFRA 1S1WB 4O4GB 3K59A 3UDLA 1YTUA 2KFZA 4CFDA 3ALYA 5KFIA 1C0UB 3Q8QB 1RCHA 1W9HA 1VSHA 4CEBA 4RW6A 4KO0A 1UA1A 1JLQB 1S1TB 1KSPA 4KO0B 4CGJA 4ZP7A 3WNGA 4BE1A 3SQ1A 1D0EA 4KTQA 2GBZA 1S1UB 3M9MB 3UQSA 5KFNA 5F8GA 1BQNA 4DL3A 1C0TB 3E51A 1JLCA 3LDSA 2VG7B 3FFIA 4NCGB 4NZ0A 4OPKA 1N6QB 2HMIA 2BQRA 3LALA 4H8KA 1VSJA 3ISND 3RB3A 4KHNA 1LW2B 4ECQA 3ZSQA 4Y34A 4OL8A 4LH4A 1IKYA 4RW7A 4TY9A 4GMJB 4IRDA 2KQ2A 5KG7A 3LP1A 1S9GB 4URSA 4PQUA 4H4MB 3U6FA 1RT3B 4OJRA 1QAIA 5DG8A 1REVA 4J2BA 1NHUA 3NAEA 3U3YA 4C8KA 5DLFA 4KHUA 1NK7A 5EWGA 3LZIA 1FKOA 5J2QA 3AVLA 3UR0A 5J2QB 1LWCA 1S1XB 3TANA 4LSLA 1TL1B 4DTUA 4AILC 3CO9A 1J53A 4FM1A 2HNYA 3EPGA 3V1RA 4ZVFA 3EZ5A 1RT6A 3WNEA 4DTXA 3VQSA 4B8AB 3MR3A 4KV8A 1SH0A 4MFBA 5KFZA 1RT5A 4I9QA 3VN5A 4CJQA 4Z4IA 2ITGA 3NCIA 5HLFA 3QIOA 2G8IA 4NLRA 4CIEA 4IFVB 4TSXA 1N56A 1HYZA 1T03A 5JXSA 4CJ4A 3O4NA 2FJVA 3KIOA 3N6LA 1RILA 3NH2A 4YR0A 4OGCA 5DQGA 3MECA 3SFUA 1HYVA 3ZT2A 3M8PB 1TV6A 4DF8A 1LWEB 2IAJB 4FJ7A 5EDWA 4FJ9A 5J2MB 4IQXA 4DL4A 4ECRA 3QEVA 5FDLA 2XWYA 2RKIA 4ZHRB 2HWIA 3TWHA 3QEWA 1UOCA 4DLEA 1FK9B 3HVRA 4EZ9A 4Q44A 3DI6B 4FJ8A 4GW6A 5HRPA 2WRMA 3DRPB 3T5KA 2F8SA 5FRNA 3SI8A 2EX3A 4MK9A 3RB6A 1VSIA 1GX5A 2VWJA 2G8FA 1TAUA 1T7PA 3DMJB 3C6TA 3C94A 5DK5A 2R8IA 4DFKA 3FDSA 3OS2A 3OYEA 1LV5A 1TVRB 4CEOA 1D5AA 3ITHB 4IR1A 3NFAA 1R0AA 4YNQA 2BDPA 3KKRA 3QEXA 3IS9B 1BI4B 5C24A 3OYAA 3KLIA 5J2MA 3ZT3A 2XY7A 1ASVA 2D0AA 2VG7A 3EPIA 4KFBB 2AGQA 4KAZA 3HJFA 5L1KA 5JS2A 2R7YA 5KFWA 1N6QA 1S0OA 2W7PA 2YKNA 1C1BB 4NCBA 2B5JA 3G0ZA 5KG1A 5KT7A 3C95A 2OPPB 2W42A 4YFUA 1KHWA 3OS0A 1WNEA 3IGNA 4CEFA 4NLPA 2IJFA 4EO6A 2IBKA 1A5WA 3HKWA 2WK4A 4DTRA 3M8QB 4IG0A 3Q8RB 1EETB 4PQUB 3CM6A 1W0HA 1D9DA 4H4MA 3OYHA 2XO7A 3KHLA 4TLRA 5KG6A 4ZP6A 4J9LA 3TI0A 1DTTB 1SL2A 1RDCA 3TR8A 4YR3A 1TL3B 3LAMA 1S1XA 5SWMA 2E9ZA 1TK8A 1S6QB 3EY1A 1S6QA 3SQ0A 4KBIA 3LPUA 2ILYA 3D0PA 4DF4A 1RDRA 3SCXA 3FFIB 3NH0A 5KG5A 3PV8A 1QSSA 1J5OB 3KJVA 3OY9A 3I0SA 1EXQA 1O1WA 3N6NA 4EEYA 1IKVB 4R0EA 2C22A 5KFXA 1J54A 1U49A 1WSIA 4DS5A 4IFVA 1BHLA 4JV2A 2PY5A 4XPCA 4WE1B 3F73A 3PJWA 3AVJA 3ZSVA 3V81A 3EYZA 4ID5A 4JRPA 2IGIA 3AVGA 3TAGA 3L2QA 1HYSA 1RBUA 4KB0A 3RBEA 4FW2A 4JUZA 2J6SA 2Z1JA 1XHXA 5HRRA 3CJ0A 3KLEB 3CJ4A 1D8YA 4IH7A 3V4IA 4ZPAA 3VQ5A 1TKXB 1L3UA 4DU1A 1K1QA 1QUVA 3MR2A 1QTMA 4O3PA 2IC3A 1KLMB 4B8CA 4O44B 4MIBA 3LZJA 4MK7A 3SUPA 1RDDA 2D5RA 4F2SA 2BANB 4CJSA 4NLDA 3OYNA 3H5YA 3S9HA 4DL5A 4ZTFA 2F96A 2ASDA 5JUMA 5KFJA 3FRZA 1CSJA 1QS4A 1IG9A 2W9CB 4H54A 2D7SA 1SKSA 2FLNA 4CEAA 3TQ1A 2QKKA 2OPQB 2I1RA 3L2UA 4ECWA 1RDBA 2BE2A 2UUWA 1RYSA 4FJHA 1TL1A 4G3IA 4EBEA 4DEZA 4L8RB 4B3OA 5C5JA 2X74A 1HQEA 3CDUA 3RMAA 1N4LA 3ULDA 3HPHA 5CZ1A 2AJQA 1Q8IA 5DG7A 4F50A 2AU0A 4LY7A 4B08A 3ICLA 4CJLA 5I42A 4FZXC 4ECVA 3M8RA 4CJ3A 1YTAA 3QO9B 2HVIA 3MEGA 5HRSA 2C2EA 3HVWA 3P1GA 4KHWA 3ITHA 4KKOA 2OPQA 4RW4B 1SH2A 4JS4A 4ECYA 2ETJA 3BGRA 1QQCA 4E89A 4BE2A 4DL7A 2UUTA 4F4KA 5KT3A 2D0CA 5CZ2A 2WOMA 3H40A 3U3GA 3K57A 3RMCA 4CFBA 4CERA 1EP4A 4H4OA 4QWCA 1KLMA 3QERA 3HT3A 1ZTWA 2E6LA 2KW4A 4KHYA 4ZP8A 1L3TA 2XGPA 3D28A 4N41A 4IH6A 4I2PA 1CXQA 2E9TA 2JC0A 3V1QA 1HJRA 3IN5A 2YNIB 3O4QA 2GUIA 1YVUA 1TVRA 5KG3A 4C8OA 2W7OA 3JYTB 1TV6B 1S97A 2A1RA 2HHWA 1WN7A 1ZYQA 1LWFB 4KKOB 2DPIA 4DSLA 3VQ6A 3PUFA 3LWMA 2LSNA 1JLEA 3DDKA 4FLVA 4FZZA 4TYAA 2HHUA 2GV9A 3KJVB 4F4WA 3MXMA 3V9SA 3IRXA 2ILZA 4CJFA 4Y1DA 3TAFA 1HMVB 1JLAB 3ZSOA 1HMVA 2D41A 5J1EA 3HVAA 4FCYA 4F4ZA 1NKCA 1UWBB 1WNSA 4BDYA 1TAQA 4B9LA 3WNHA 3PX0A 4FJKA 5J2PB 2OPSB 3DLKA 5HBMA 4RNNA 2FBVA 1MU2A 5KFBA 1BGXT 3GIIA 1JIHA 4GC7A 1NK4A 4TXSA 2G8KA 3CDEA 2B6AA 4WFYA 1NK6A 1LAVA 5D3GA 4Q8FA 5KFEA 4M3RA 2WB4A 4FJJA 1KVAA 2ALZA 5HRNA 2R2UA 1NJXA 4RUAA 3NGZA 4BACA 3SUOA 3SZ2A 4KI4A 1NK8A 1IKYB 4DFJA 1LW2A 5KFSA 4WFZA 5EU7A 3RB0A 1DTQA 4M3ZA 3MEEA 1X9SA 4OLBA 4JV0A 3V9UA 1TKTB 2D3UA 3ZSRA 3G6YA 4FJGA 4K8ZA 1S1VB 1WAFA 1BIZA 3H4BA 3DOLA 3HVTA 3BDPA 3LWLA 4F3TA 5C42A 4Q0BB 2C28A 3V4IB 4MKBA 1HNVA 1BISA 2FVSA 3OYMA 1DLOA 4CHZA 2YNHB 4RG8A 1RA7A 5CY4A 4CCHA 1K1SA 4IR9A 4R8UB 2HW3A 5L1JA 4ECXA 2NUBA 4J9OA 4RZRA 2DFFA 5FRMA 4J9KA 4B9VA 3MR6A 3NMAA 2P1JA 5I42B 2X78A 4FLYA 4FVMA 4FJIA 1GX6A 4DTNA 3CFPA 2KFNA 4QPXA 4ELUA 2RF2A 2BRKA 4JS5A 2W9CA 3VQ4A 1DTQB 3GIKA 3JSMB 3KD5E 3A2FA 4MQ3A 3EZUA 2QK9A 1HQUB 4J2DA 2IAJA 3O3FA 3IS9A 3G6XA 2BE2B 3M8PA 2ZKUA 2UVRA 3NBPB 2AQ4A 3V6DB 4ELVA 1RTJB 4M41A 2ATQA 2RDJA 3KOAA 2X6SA 4NLWA 2E4LA 2B6AB 2AX1A 4WYLA 3VQ7A 4CGDA 4URGA 3LP0B 3T1AA 4EZ6A 2KZMA 3GV5B 4O44A 3S3OA 5KG2A 4Y1CA 3KD1E 4J2AA 4KB7A 4M95A 1EETA 4EO8A 1TP7A 1S9FA 2O4IA 3MEEB 4FBTA 3BSOA 1WSFA 5K14A 4EYIB 4IDKA 4DMNA 1JLGB 4DSEA 3VQPA 1S1UA 1I3AA 3V6HA 3T19A 2FVRA 4BE0A 1L3SA 5F9NA 3QNNA 3KHRA 4ICLB 4RW9B 1JKHB 1Z25A 2R2SA 4DQQA 4RUCA 1HQEB 4CECA 1I6JA 4DLGA 3QZ7A 4NLVA 3MFIA 3QLHA 4QOZB 5D3GB 4B9SA 1RT5B 1B92A 2I5JB 4PY5A 2YNFB 1SV5B 3NF7A 4RW8A 1XWLA 3L2RA 1IO2A 3KLFA 3DYAB 4TN2A 4WE1A 3IG1A 1CXUA 2ZE2A 3P83D 2QV6A 4QAGA 3KK2A 3QO9A 1X9MA 1S9GA 3QEPA 1RTHA 3N6MA 4FYDA 1Z26A 3KHGA 3K58A 1KLNA 1LWEA 2DFEA 1JLGA 3AO4A 3BR9A 3V1OA 3SQ2A 4RW4A 3LPTA 4Z4CA 3HVTB 3E01B 1UA0A 4ICLA 4RW9A 4ZPCA 4J9NA 2FBXA 3QGIA 1RT1A 4YMEA 5C25A 3V9WA 5HROA 1G15A 1ASWA 2WONB 2XRIA 4KTZA 1D9FA 2FLLA 5KGXA 5DMRA 4CEDA 4ED0A 4AHTA 1NHVA 3K5MA 3B6OA 3G86A 2DPJA 3CFRA 1RBRA 1CZBA 4M3YA 2Z1HA 3IGVA 3QGGA 4DQSA 5KG4A 4AHVA 2IM3A 4M3UA 3M8SA 3I5AA 4RU9A 4DSKA 1RAJA 1C1AA 3V81B 1HPZA 3VQCA 1EX4A 4CHPA 1UAXA 1WSEA 1TKTA 3QYYA 1NK5A 2FBYA 3CJ5A 4IG3B 3KTQA 3KLIB 1F21A 1RTJA 3E01A 1SKWA 3BREA 4O5BA 4BDPA 1TKXA 2GIRA 2R2RA 1U48A 4J9PA 4Z4EA 4OKJA 3LP0A 4ID1A 4WXWA 3AVNA 2YKMA 3H5UA 5KFAA 3FSIA 2B4JA 4LQ3A 5KFMA 4N47A 3DLEA 2PZSA 1KVBA 1S9EB 2OPRA 4KB1A 1JLAA 5J1EB 4E19A 1RNHA 3LP1B 4GC6A 3PW7A 2V4QA 5KFGA 3T3FA 4HCCA 4NYZA 1KFSA 2FBTA 3NH1A 4W5OA 4FBUA 3RB4A 1HQUA 3MF5A 3ZSYA 3QIPA 1R0AB 3PJXA 4B9UA 1IKWA 1MU2B 1BI4A 3TABA 1MMLA 4HVJA 3NL0A 3TVKA 3MEDB 1RT6B 1Q9XA 4Z4FA 1GOBA 2YNHA 5I3UB 4I7FB 1T05B 4TQRA 1RTDB 1J5OA 3H4DA 3AVKA 4R8UA 4FW1A 2I5JA 3OLBA 3VQ8A 3BQ2A 4ED7A 3DLGA 2B5JB 4DTSA 3VQBA 4URQU 4KHSA 1LW0B 4CF8A 4HUEA 3KLFB 2Q3SA 3OYLA 4N76A 4KHQA 3MEGB 5K14B 4J9RA 5DGBA 1S0NA 1GOCA 3D5MA 3I0RA 3SNNA 4J9MA 4ZVEA 1EKEA 2DFHA 1TKDA 3ZCMA 5HP1B 3PVXA 3T5LA 4Q0BA 2XCAA 2W9BA 2AX0A 1HNVB 4B9MA 3T5HA 1JKHA 4AHUA 1VSFA 3RRHA 3CJ3A 5F8LA 1VRTA 4CF1A 5C25B 2C2RA 3NKYA 5KG0A 3MXJA 3DRSA 1NJZA 2ATLA 4O55A 1EP4B 4H4OB 3WNFA 1BQMB 2YHAA 3KHHA 3NF9A 3DLGB 4W5NA 3DMJA 1LW0A 2RDIA 3LP2B 2R2TA 5KT4A 3IG1B 3HPGA 4FS2A 2P51A 1RT7A 4DU4A 2P5OA 2VA3A 4CF2A 3DLBA 1FKPB 4C8MA 3PHEA 1BQNB 1KHVA 4IOBA 4IG3A 2IMWP 1NNDA 4O0IA 3ZSZA 5KRTA 3NAHA 4KREA 1CLQA 4KFBA 3MXIA 2DY4A 4ZPDA 4ECUA 4I7FA 4CJ5A 4IKFA 3PW0A 3HK2A 3DLRA 1X1PA 3KK3A 4N56A 1FK9A 3LAKA 5DG9A 3DM2A 2HHTA 4QWDA 2YNFA 1ITGA 3DLEB 1T3NA 1ZETA 5KFHA 5L1IA 3DRPA 2F8EX 4EYHB 3SPYA 4U6PA 3OYIA 2HNDA 4IRCA 2OA8A 4WZQA 4NLOA 3DLHA 2XY6A 3AA2A 2AGPA 4O3RA 3VQDA 3OYCA 3RMBA 1NK9A 4XPEA 1NOZA 5KFOA 5T7BA 1S1VA 4DFMA 4O4RA 3OYFA 4HKQA 3OLAA 3B6PA 3THVA 1XR6A 3BSNA 4ED3A 1SL1A 4K50A 3PX6A 2BRLA 4DFPA 5F8HA 1C0MA 1TQLA 3I8DA 4DQRA 3KLVA 3CG7A 4AH9A 3OL9A 2XY5A 4KV8B 3S3NA 1YVFA 2Z1GA 4ECSA 3AO2A 1B9DA 3F9KA 3V9XA 1B9FA 4DWIA 2YNGA 3PR5B 4CEZA 1RDAA 2HB5A 5KFPA 3K5LA 3ISNC 3RTVA 4F4XA 5J2NA 4I2QA 2B43A 3SV4A 3AO3A 1JLFA 3VQAA 4CEEA 4E1MA 3DYAA 2J6UA 3KK2B 3V6JA 4AHRA 3CFOA 4FM2A 4E7KA 1S0MA 4EBDA 4CHQA 3VQEA 1N5YB 1HNIB 2GIQA 5KFUA 4JRQA 1WSHA 2VA2A 1BIUA 4IBNA 3RR8A 3I0RB 2UVVA 3UIQA 3G10A 3VQQA 4QW8A 1RT2A 3UPFA 5DGAA 3TAQA 3RR7A 4NCAA 1RT1B 2IA6A 2GC8A 2WONA 4CFCA 1U45A 3H59A 3KK3B 1VRTB 5CYQB 4MH8A 5I3UA 4K4YA 3GIMA 4RNMA 5KFVA 3V6KA 3Q8PB 1W25A 3S3MA 5L1LA 4DG1A 4ED2A 2OZSA 3GV8B 1SUQA 4XIUA 4FLUA 4FK0A 5F9LA 4AHSA 4YR2A 4CESA 4Q5VA 4BDZA 2R8JA 4DL6A 4W5RA 5F8IA 1XR7A 5EWFA 2J6TA 4HHTA 3GILA 2OPSA 3JYTA 4FJNA 1WSJA 5KT5A 1KVCA 3SI6A
chains in the Genus database with same CATH superfamily
2FJWA 2AV5A 4Y0FA 4CE9A 5BPLA 3M2RA 3PX4A 5AQHA 1X5TA 4N7TA 2IM1A 1FJGF 1NSPA 3A5MC 3IM9A 5F41A 3MCPA 4PWDB 4YY3J 5CYMB 3MD1A 5KFYA 3AV9A 2C2DA 4FWQA 1H3DA 4WQ4A 3POTA 3D68A 4DR2K 4OI3A 1Z4UA 1HA1A 2XHWA 4FXDA 3LP2A 2OTLS 4ERDA 3JS6A 4NLYA 2ZDOA 3B82A 4DV6J 4DCOB 5JS1A 3OJUA 5AQNA 5J2PA 2DNYA 3HLUA 3M1FA 2N4DA 4WTOB 3FEXB 1C1CA 5CABA 3B4MA 4AXJA 2P9NB 1LFWA 2VUGA 5GAEU 2RHSB 4J9QA 5T14A 2LKZA 4NYPA 4LJMA 3H98A 1SV5A 2F63A 3ZZPA 2OPPA 1R3NA 4KRFA 1SI9A 4JI3F 1FRIA 2CPEA 2KTQA 2ZE2B 3T1YJ 2RPIA 4CEQA 4KR0B 4O3QA 3M9OB 1UZDA 4MIWA 3WEEB 1N5YA 1WKKA 5DQIA 2DNKA 1VOMA 1Q0NA 3WDOA 4DX6A 2Y1IA 1VIOA 4DV7F 1TL7A 3V9ZA 2AEFA 4OJGA 2AP6A 2R7WA 2QRRA 3NS7B 2YX4A 4JI5K 4AQYF 1YKWA 1Y64A 1JLBA 1HI1A 3M6WA 2SXLA 2BQ3A 4K4VA 4WYWA 4H4KC 2HZAA 2ASJA 4FK2A 2CZ4A 3DGPB 2V7ZA 2E1PA 5A76A 2PYLA 2VC1A 5KFDA 4KH6A 3M05A 4Y2CA 1JL2A 2H3EB 2XMTA 4GRSA 2NXUA 3OSPA 3THPA 5HBMB 3AQOA 3HM8A 1WBBA 2D1CA 4HT5A 4B3OB 4K8XA 1IQTA 3D7SB 4NLQA 1JLEB 3CJTA 2O8CA 4PG8A 2RSQA 2RT3A 4M63C 4TQSA 3TA0A 5C2GA 3VPZA 1I39A 3OR1B 4V1Ak 1WC0A 2JEIA 3IRXB 1QE1A 2BJ3A 3VEXA 2JEGA 2E9RX 4P2FA 3HP9A 4OLOA 3I56S 3TYTA 3G6VA 2R8HA 1RE1B 1REVB 3ZSXA 1KVJA 5I3PA 3VGKA 5J1PA 4GVBB 1RADB 4JI1J 2PC6A 4Q43A 3SIPB 3DLLL 2WZ1A 1JLCB 3EGZA 1WG4A 5EWEA 1KRPA 3BQ1A 5A2QY 2VU5A 3O8WA 4FWNA 1FTRA 3RZAA 3ID8A 3W9JA 2BV3A 2MGZB 4PWDA 2YJEA 4GKJK 1LOUA 2W9AA 2W8LA 1QHTA 4CJWA 4OYIA 3AVHA 1JLFB 2M9KA 3KLHA 3JSMA 4MKAA 3H5SA 4OVLA 2E5LK 5D4NA 2GO8A 1JL1A 4B3MK 2CIMA 1KAZA 4B02A 3J81j 3KKSA 3L8BA 4KRWA 4CWBA 2AEJA 1YGYA 3LO3A 1JJHA 4DJBA 5HP1A 5ETKA 4ILGB 4NRUA 2NQPA 3P6YC 1XI1A 4KHPK 1N5QA 3BSAA 4ZMMA 3AT1B 5IFMA 1IR1A 2QIFA 4IOXA 3BSCA 1QAXA 1RLCL 1CS4A 2C3OA 1NRKA 3MM8A 2QL5B 3H2LA 1S9EA 1XQSC 1HR0F 2KXNB 5KFTA 3R6LB 1QQMA 1QLNA 3NEKA 5AQLA 4FK4A 4IDHA 1UWBA 1VRUB 3RRGA 2YNIA 2MJUA 2GO9A 4NLUA 4G6VB 4P2XA 5EGYA 4QWBA 3G4SN 2IM0A 2YV0X 2ADCA 4NLGA 4A8OA 1MN9A 4CJPA 3P5JA 1NCLA 1Q16B 3L7OA 3QBXA 4R5PA 2FPHX 4WFXA 4IKAA 1BXNA 2FB0A 2CQIA 1YLXA 1C0FA 2YH0A 2QI2A 5DDRC 1RBTA 4GVLA 3MCNA 4ZPWR 1MWZA 1YJWS 1K8AT 3BZCA 3QEIA 1OY8A 4I2QB 1CLFA 5HAOA 3VAGA 3MN6A 1OYDA 1T9VA 4DTMA 4ZPBA 2M3DA 1YHQN 2CQCA 1RTIA 9RUBA 4K41A 4C97A 2V52B 1A5XA 1WJ9A 2Z2YB 2V8VA 1VSEA 4LD0A 1T6CA 4E3SA 4OO1J 4OKEA 3PEHA 2Z1IA 2YKOA 2ZNYA 2DIUA 2QLBB 2MDAA 5C2DA 5A8RB 3WC0A 4KSEB 3NAIA 4CJRA 3S7RA 1RU1A 3MR5A 1Q78A 1RTDA 4NMLA 2L08A 2ZOMA 3HJVA 3LDLA 2ZJQL 3NMUA 2I38A 3ENWA 3QESA 1VMBA 4TY8A 4ZPTR 1P90A 2QA4S 3WQTA 3KMSA 2R42A 5AZJB 1HBOA 4IEEA 3BQ0A 2VFTA 1XHZA 3I5BA 3CF5L 5AQJA 4UUWA 1U1LA 1TL3A 2ZF5O 3PO4A 3DOLB 5E3PA 2KJVA 5DM6L 2E6MA 3RWUA 3L2WA 4G1QB 3CEDA 4FNIA 4FYVB 3MX5A 3KXDA 2H1YA 3AVCA 1TKZB 4PUOA 3FZBA 4NXMJ 4WQ5A 1U1MA 4DX8H 4JI4J 1J5EF 3I0SB 3G25A 1VBKA 4USTA 3KJQB 4FLWA 1ZBIA 5FIIA 2HVHA 1U2CA 2MLYA 1NPKA 1X4HA 3C6TB 1HNXJ 4DCJB 2ZUGA 4HTLA 3X1LB 1NZAA 1XR5A 4YOYA 4HUGA 4CZLA 2VG5A 4FZVA 2HBJA 5C24B 1M5PC 2HNZA 3ZSWA 3DXMA 4FL9A 3Q8SB 2Y9HA 3UD5A 2ZHAA 1VSLA 5KRSA 2JZ5A 5KPZA 1X5PA 5AR0A 2RKIB 4DV6K 4X4OA 3EE8A 3QLHB 1T95A 2O01C 4X64K 3ZLJA 4JB8B 5U47A 4FJXA 3OHAA 2BH1A 2RE1A 1QUPA 3N28A 1FW6A 1F1BB 4QCLA 4C4WA 5JJBA 5GVQA 2XWXA 2MKKA 5FJ4A 3F9MA 2XHCA 4RNOA 5GMDA 4DR1J 1ILYA 2AT1B 4BLGA 1TK5A 2XMMA 3SMPA 2UU9F 1FHTA 3U27A 2ROGA 4LREA 1WG5A 2I0XA 2R9LA 3NS6A 2FVQA 2P9LA 3Q89A 3HCXA 4IUFA 1HWIA 4BG9A 3H42A 1NH7A 2FLPA 4BRCA 2ZWHA 1IUJA 4OHZA 3R27A 1R0CB 4CJTA 2JDJA 3OYBA 2D3O1 1HL6A 2LQJA 4H5WA 4BGBA 4RNFA 4V19X 2OP5A 3BJYA 5BREA 4DV6F 3CYMA 2VBXA 4CJEA 1BC6A 2E7VA 5M1FA 1YI2S 2UVWA 2ZH4A 4CIGA 4TU8A 2DCUB 4Y3CA 1S77D 1JMTA 4I9LA 3ZT1A 1K73O 2NZ4A 3NGSA 3AVAA 2ATCB 2F9TA 1HNWK 4J9VA 1ZM9A 1QSYA 1NLKL 2B9WA 2VQEK 2E2PA 2IJNA 1S76D 3C16A 3UDLA 2VPWB 3ALYA 5IM0A 3O6WA 1RCHA 1BG3A 2JHEA 4BRHA 2J7UA 2P5VA 1FXRA 4BE1A 3FMBA 3SQ1A 3L7PA 2RNEA 4PABA 2E8AA 1X7VA 4LF1A 1GAOA 5IV3A 5F0XA 4RU2A 1NH8A 1P27B 3E51A 1NMEB 3VGSA 4FWPA 3FFIA 5BRDA 3IR6B 2K7KA 4NCGB 4DR5J 1YJNS 4OPKA 1CVJA 3OW2R 1YBUA 1F5CA 2A41A 2DTJA 4UOHA 4KHNA 1Q8KA 3DGVA 2P9PA 2QG9B 2KQ2A 5BN9A 4X62F 1N36J 1D9AA 4URSA 1F60B 2N7YA 4PQUA 2V8GA 4H4MB 3QATA 3LPYA 5DG8A 2AYBA 4J2BA 4WTYA 4A8WA 3U3YA 1UETA 2ZBCA 5EVZA 2VDIA 3EXCX 2GWJA 3OTOJ 3ZTQA 1LWCA 1AB8A 1VAZA 1PSDA 1TL1B 1CQMA 3DHXA 2Z2MA 4AILC 1M90T 2HQ3A 2V2QA 2EBGA 4CLKA 4ZVFA 1O51A 3WNEA 4DTXA 3MR3A 4KV8A 2ZBQA 2QL7B 3VN5A 4ZA1A 1I94K 4BR5A 4Z4IA 5HLFA 4JI5F 3EVMA 4LRCA 3CD6S 4CJ4A 3N6LA 1BWEA 1RILA 4QS8A 2P9KA 4B3SJ 3NH2A 1AT1B 5DQGA 3UKRB 1X5OA 4A5BA 2KU7A 4DXLA 1HYVA 3J7Z5 1H2VZ 1I1GA 1WF0A 4DF8A 1LWEB 2IAJB 1VYAA 3EJMA 1G4CA 4DL4A 5BR9A 4W90B 5FDLA 1S0VA 2RKIA 2P9LB 1CJVA 3QEWA 1NPRA 2VF3A 4FP9A 1Q7YO 3DI6B 3NVMA 4GW6A 2F8MA 2WRMA 4X65K 3CCMS 3QDKA 3SI8A 4RWTA 3R1XA 4MK9A 3RB6A 4KJIA 1SVDA 4V19J 1T7PA 1U2VA 4KBOA 3C94A 3UWTA 5FPDA 4DFKA 2Q2RA 3HRGA 2M8HA 2HFNA 1TVRB 3ILLA 2LYVA 3W2VB 2HVZA 3O5BA 4CEOA 3ITHB 1S7IA 4YNQA 2JWKA 3QEXA 4BC4A 3IS9B 1BI4B 2IMOA 4CQ1A 1LNQA 2F65A 4LVNP 2IY5B 3RU0A 3OXFA 3R7NB 5TKWA 1RWNB 3ZT3A 1FA0A 1UKUA 1GK8A 5BRHA 3VQTA 1JQGA 2FJDB 2VG7A 3EPIA 5AQKA 3G96A 2AGQA 2DD8S 4OYXA 2R7YA 1OVQA 1QVGM 4FVUA 2FF6A 3J7ZO 2BVZA 2BKPA 3CCLS 4OI6A 3C95A 4YFUA 3OS0A 3WXMB 2N3OA 4FPAA 2HFUA 2IBKA 4OIXA 5ELZA 2A40A 3QWUA 2WK4A 4A8FA 1EETB 4PQUB 2C1EB 4CRJA 1YX2A 1EKRA 1D9DA 2XO7A 4CW7B 5GAHI 2XNQA 4ZP6A 2BE9B 1RDCA 1N0UA 3TR8A 1TL3B 1TK8A 1FJGK 3SQ0A 2HHHJ 3LPUA 4RPFA 2FYXA 1U1NA 3D0PA 4DF4A 5K8OA 3FFIB 1V9OA 4U8VA 1N34F 3NH0A 1UMJA 5KG5A 3PV8A 3C46A 3KJVA 5HMXA 3OY9A 1NGJA 5LT5A 3N6NA 4EEYA 1WD6A 2YWEA 6FD1A 1IKVB 2JLGA 4R0EA 4DR2F 3A13A 4B1XB 1PIEA 2IJRA 1BHLA 1SQFA 2CZ9A 4JV2A 2PY5A 1REGX 4WE1B 4LFBK 3F73A 3PJWA 2YX7A 3AVGA 1VLYA 3CCJS 4JV5K 3SEOA 2W4DA 2J6SA 4RUHA 1HKBA 2Z1JA 3G8TA 1XHXA 4QIVA 2MKIA 2PGCA 3CJ0A 1IBMK 2NRHA 2OHDA 2HBYB 3FZMA 3I4HX 3A3NB 4M5JA 1XN9A 5K20B 1KLMB 4B8CA 4BGAA 2P9SA 4F2SA 2CDQA 2GVZA 4DL5A 4ZTFA 4LF8F 3CCLN 1AXQA 2F96A 1DJ0A 1A7GE 2ASDA 3J7YI 4KH0B 4I6MB 3HX9A 4GKKJ 1IG9A 3TX8A 4DR6K 1NU4A 1QVFR 2BM1A 2D7SA 1SKSA 3TPQA 1HFEL 4CEAA 1OH5A 1U2RA 4OI0A 4ECWA 2UUWA 1P9QC 4FJHA 4DV5F 2UXBF 4OPHA 4B1WB 3M30A 2A6AA 3THYA 3OTOF 1HWUA 2C3MA 3Q7CA 2X74A 1Q7YT 2G0CA 4EWTA 3CDUA 1XIQA 5JVGQ 3HPHA 3L4BC 3O9SA 1HBNA 2G9OA 4B08A 4MO5A 2C2NA 2IYGA 2N82B 1IBMF 4ECVA 3DFEA 2J8SA 4CJ3A 5CCLA 4YORA 1UEKA 5BYSA 1Z2ZA 3QO9B 1TR0A 1Q95G 3PNIA 4OV1A 3F44A 4A59A 3O9QA 4LT6A 5C7PA 3P1GA 3ITHA 4KKOA 5FPMA 1DKGD 2ETJA 2RJZA 2UUTA 3D4JA 4YDUA 1UCNA 5CZ2A 2YWWA 3MM5B 2WOMA 4PR6A 3MM5A 1UWAA 4CT9A 4YOUA 4CERA 4H4OA 4N77A 1ZTWA 3KJFB 3S8SA 4JHDB 3RVCA 3D28A 4IH6A 4I2PA 5BXIA 1U1RA 1CXQA 2HFVA 4ZN1A 1YQHA 3IN5A 3R5GA 5CHIA 1YRTA 2GUIA 4NLBA 2ZVIA 2M8DB 1IR0A 2FSKA 1TL5A 5B0CA 2KDOA 1TV6B 2KHOA 4FXWA 2A1RA 1ZYQA 2OELA 1GXUA 4U67Q 2DPIA 4PXDA 4ZK7M 3VQ6A 3LWMA 1A0OB 3D6MB 2LSNA 1JLEA 3OFEA 1VBZA 4FLVA 2VBYA 1VK8A 1BWFO 2A3ZA 3KJVB 1J2VA 3IRXA 3CIPA 4Y1DA 3TAFA 1JLAB 3K17A 3JQMA 1DAXA 2V9KA 4FCYA 4F4ZA 3OA9A 1LXJA 4BC9A 4Y0WA 4CH1A 3W66A 1ZBTA 2QMXA 5H9FK 2HG4A 4FJKA 3CPEA 1XMOF 1J6ZA 5HVFA 5E3QA 2HS4A 3N5FA 2O66A 1FRJA 3UN5A 3GIIA 4QS9A 4DUZF 4GC7A 1NPPA 1KTVA 3JQKA 4TXSA 1YJVA 5IWAF 2B6AA 1N33F 1SIWB 1NK6A 2R2UA 1FRKA 1YWXA 2ZH6A 1O13A 1K44A 1NK8A 1IKYB 4A4JA 4OHVA 4WFZA 5EU7A 3LOUA 4FKXA 4OLBA 4TU9A 4JV0A 4FJGA 1VQON 1WAFA 1BIZA 3BDPA 3LWLA 4ITSA 3V4IB 4MKBA 4BVPA 2CQ0A 2CQGA 1KD1T 2FVSA 2UUAK 3OYMA 4ID8A 5D0GA 2DHAA 4CD3A 2YNHB 5IWAJ 1N33J 2CH5A 5CY4A 4CCHA 3MMVA 1YITS 4IR9A 1YJTA 4BHQA 1VQ8N 4DUZJ 5L1JA 2DJWA 2CG4A 1F2GA 2MKJA 4J9KA 1FE4A 2DNZA 5I42B 4GV9A 5IWAK 1N33K 2CQ2A 4QPXA 2BRKA 4LF4F 1DTQB 3MHYA 3A2FA 1ACMB 4GKJJ 4J2DA 2W24A 3O44A 2BE2B 3M8PA 2ZKUA 4EK2A 4J90A 5T7LA 3V6DB 5IT4A 3O5TB 3F2KA 3ETMA 3KOAA 3D2FA 2X6SA 3VQ7A 2GAGC 3EMTA 3PYFA 3LP0B 4LBIA 3PSFA 5TKYA 3NNCA 2GZOA 1Y5NB 4Y1CA 3KD1E 3EKSA 4WYBA 1HNXK 1TP7A 3MEEB 1ZPWX 3J7AP 5DDQC 5KOXA 2XS7A 4DMNA 1JJ2M 4WU2A 4FWSA 4DSEA 3VQPA 1JWWA 2K1RA 1I3AA 3T19A 4WFBQ 1Y10A 2QEXS 4HLBA 5F9NA 2MQOA 1W7WA 1JKHB 1Z25A 2NPFA 2O8EA 1RQ0A 1HQEB 3G2XA 3QZ7A 3H0PA 3ELHA 4NLVA 3MFIA 3EZOA 3B78A 4QOZB 4P72A 2IVPA 3NCRA 4ZJLA 1X4GA 3U8XA 1EWQA 1XWLA 2IVFB 3J81U 4S0MA 3CCEN 1YBTA 2ZGYA 5M2RA 2FDNA 3DRYA 4CT8A 3ZETB 3VF4A 1K73T 3CULA 3KK2A 2DRAA 1X9MA 5I3QA 3A8KA 5A8KA 4DUYK 2IIHA 3A12A 3N6MA 4CJ7A 4FYDA 3JTOA 1VQ6N 2DFEA 3BF3A 1JLGA 3FMWA 5I4MA 4BR4A 3P49B 3SQ2A 1Q8LA 4LFAJ 1XNQF 2W41A 2WVDA 3O4WA 1BUXA 1UA0A 4PG4A 3CCUN 4QS7A 3V9WA 5C25A 4UTGA 5C15A 5E33A 1V4TA 4IJAA 1Q82O 3DU5A 4WWSA 5DM7Q 4AHTA 3K5MA 4HVZA 2BJ9A 1VLOA 5ETVA 4FOEA 2FHJD 1RBRA 2O8BA 4M3YA 4FPRA 3ZZYA 2Z1HA 2ZJRL 1YJUA 3IGVA 3QGGA 5KG4A 1CJTA 1XMQJ 2DISA 1RAJA 5HOOA 1Q86T 2B4OA 1EX4A 1WSEA 1TKTA 1V3RA 4FF2A 1VQ4N 2P9UA 1NK5A 2DO4A 4YUDA 2MB0B 3Q22A 3KLIB 4OX9F 1F21A 3QT5A 2UUBF 3E01A 3BREA 4BDPA 5DS7A 3V4MA 2GIRA 4H0XB 2YHYA 2KH9A 2HZVA 1NGGA 1B3TA 2ZJPQ 3ILJA 2YKMA 5KFAA 3FSIA 1B70B 2CRLA 1XNQK 4ZLPA 1X4BA 4MLHA 1IG8A 2B7BB 1N0VC 3T41A 1KVBA 1S9EB 2FQQB 1C4CA 3PW7A 2J0SD 3GMGA 4CZMA 2FBTA 3CMAS 2BUNA 2DRBA 5AQUA 4A8KA 1YJRA 2UUCK 4K5RA 1T9XA 5AXMA 3MI7X 2CYYA 1BMQB 1BE4A 4HVJA 4IYQA 3HSZA 1FDBA 3F41A 1NG9A 1Q86O 1RT6B 2ACMA 1Q9XA 2OTJN 1J5OA 3SSRA 5JVHQ 4R8UA 2I5JA 4WQ4C 3HHLC 4JI3K 4Z37A 4ED7A 5IZHA 4DTSA 3D6TB 4RKUC 1D8ZA 1WSRA 1GLLO 4IO9Q 3VQBA 2MYFA 4DPOA 1HBOB 3TRGA 4HUEA 2Q3SA 2RDDA 3ZFVA 4Y2MA 2Z56B 1GOCA 3MUTP 2GQ2A 1RDUA 3FZ2A 4OYAA 3SNNA 4ZVEA 5G0RA 4DV3J 2YQ1A 3GZ7A 2XCAA 5F2RA 2CG8A 4ZN3A 1JKHA 4AHUA 2QSWA 2V2VA 3CJ3A 1T9YA 2ZM6F 4CF1A 5GAEP 2C2RA 3AJ2A 2ZJQQ 1RAOA 4O55A 1EP4B 2HYIB 2YHAA 4YEAA 4DV1J 3PG9A 4X62K 4OMFG 1RAGB 3CJ1A 1CJTB 3DMJA 2KHCA 5ETQA 2RDIA 5B0GA 1ICEB 2R2TA 2GGPA 1P6TA 4LF8K 2Z8QA 2P5OA 2VA3A 3TUPA 4CF2A 4C8MA 3EWGA 1T3VA 3G82B 3K8VA 1KHVA 2ZOFA 4ISFA 2OSQA 2P2CB 2VBWA 2C2MB 2EWHA 1NNDA 3WT0A 3DOMA 4OZ5A 2DITA 4KFBA 4ZPDA 4DCPB 3DLRA 3UE5A 1X1PA 2QLXA 2VQFK 2DH9A 2VKZG 1ITGA 4AL7A 2E1ZA 1ZETA 3RBZA 2B7CB 5KFHA 3DRPA 4D3HA 2PD1A 2P9SB 4ZOSA 4ZVTB 2ZH2A 2CNOB 2NSCA 4IRCA 3ZETA 1XK8A 4O3RA 1FJCA 1T6DA 3VQDA 3RMBA 3VF0B 5CE3A 4B3SF 4K0KJ 2E29A 5D4PA 5KFOA 2WSFC 1OMSA 4YOVA 1X4EA 2XLJA 1SL1A 4K50A 4X4TA 1U24A 1C0MA 1YSJA 3JSYA 3KG1A 2XY5A 4KV8B 3NNHA 3MPVA 4X65F 2Z1GA 1ZAXA 3F9KA 4DWIA 1IVZA 1I51B 3F56A 5LMNJ 4X4UA 4FYYB 1MA9B 4L6V3 2BBEA 3WX8A 2HB5A 3GL1A 5E3CA 2Y0SD 1FCAA 5J2NA 4I2QA 3FJ2A 3DYAA 2J9DE 3V6JA 1W2IA 5BR8J 4E7KA 3J81O 3TUZC 4CHQA 4HEA9 4NA3A 3MN7A 1BIUA 4IBNA 2UVVA 2DR8A 3UIQA 2A1BA 4ETXA 4RCHA 4HDGA 2E5IA 4H5NA 4DUYJ 1RHKB 1N8RO 5DGAA 3RR7A 4OPAA 1N5VA 1DFDA 3A4TA 2NRZA 3IR5B 2M4MA 1U45A 3H6EA 3KK3B 1VRTB 3DN9A 1U0HA 2RS8A 4RBUA 3OTBA 3K5PA 1TL4A 5KFVA 2M5YA 3HHLD 3MCAB 4ZCLA 1MWYA 3B6BA 4DG1A 3JXUA 2OZSA 3GV8B 1NGAA 3W7BA 4FLUA 2UV8A 4CESA 2E1MC 5B0AA 1GTHA 1FT8A 2LCWA 1V5VA 3EVOA 1XR7A 4R25A 2OTJS 3LGHA 3LDOA 2B8QA 2F9DA 2OPSA 3E3XA 4L75A 4X64J 1WSJA 1KVCA 2A1SA 2MTLA 1RHRB 1VC5A 4LFAF 1XNQJ 4KHPJ 1MLAA 1X9WA 3CQYA 2R8KA 5BR8F 4F67A 1HBUB 3L3VA 1YF5L 2IC3B 4QR0A 2MKCA 1BCMA 3C14A 4PWUA 2F4FA 1X4CA 1YJNN 4M45A 3VA0A 3N4QA 3V2UC 1KFDA 4ANDA 2KVQE 1Y97A 3RJMB 2XGQA 4CLYA 2EK1A 3M8WA 3BN7A 4NLSA 1ZM4A 3RAQA 5EHHA 1ZOTA 1VSKA 4DOZA 4ZIVA 5HQLA 1IKXB 1FJEB 4ILMA 1IKWB 3MMBB 5A2QU 3QIPB 4CK2A 3ZT4A 1GMVA 3PR4A 1RBAA 4CNYA 2DTUA 2E88A 4F2RA 2D0BA 2J0QD 4WBFA 1RBLA 4DQIA 3QAEA 5IC4B 4K0KF 2Z58B 1FXLA 4HT7A 3N4PA 5D0EA 3K5OA 4M5DA 1ZA1B 2ASMA 4ZJQA 1U04A 3OVBA 2UU9J 3VA3A 1FD2A 1EARA 3OHBA 2KM8B 1Q81O 3IAYA 4I6WA 2YWFA 4MIAA 3B54A 4JI4K 3SPZA 1IM6A 1LWFA 1O6XA 2NUHA 3KLEA 1GOAA 3DOMB 1NSQA 1BLUA 2FVPA 5HROB 3QRRA 2FVCA 5AQRA 3VZHA 1H98A 1JX4A 1WEYA 4G1QA 3AGKA 3DDIA 1RI7A 2CA9A 4E7IA 1WI6A 3NGIA 1ZTTA 2J9CA 1N5SA 3SV3A 1JJ2R 3MM8B 1NK0A 2XMUA 1C0UA 2AD9A 2I7NA 4HI2A 4EI2A 3KFWX 2P5GA 1W26A 1VQNS 2YPZA 5AQWA 4F4YA 3VCDA 4FWLA 2XMAA 3UD3P 4E0DA 1RT7B 2F7VA 3M32A 2QMUB 2ZH7A 1U09A 4EU0A 4P10A 2GW8A 4RBTA 5H9FJ 2OGUA 2M7SA 2HLTA 4ED5A 4JKGB 2ZQBA 1M1KO 4U7CA 2Q0RA 3QETA 3KNGA 3A3OB 4J9SA 1UW4A 5IQ6A 3GG1A 4EFHA 4NB4A 3MAAB 3OYGA 2KJWA 3OR1A 2G8HA 1RYRA 4UOGA 1WC4A 5ETSA 4DU3A 3VQ9A 1WTBA 1VQ8S 2UU9K 2XBPA 5FLXY 2CFXA 4YP3A 1PC5A 3QINA 5KFKA 3M2VB 4OYMA 3SLCA 2V63A 4CD1A 4CGGA 4NWBA 1TU0B 3TTFA 2CGKA 4YQWA 1OY6A 4O3NA 3TAPA 4FS1A 1DLOB 4WFAQ 1FXDA 3HL8A 1ZBFA 1U7LA 4PHTX 1J9AA 3MTKA 3CMAN 4IO8A 4TY8B 4CYUB 2XCPA 3SSQA 4RW8B 4BR2A 3L3UA 2PEHA 3UDEA 3O6QA 1T03B 3OS1A 2RQMA 1VBXA 1WLJA 1JJ4A 2ACYA 2EXUA 2EC0A 2QFIA 4DS4A 4A8QA 4KAIA 2ZUAA 2W9BB 3QNWB 1Z2LA 3ZX3A 3IMXA 1RCXB 5EX5A 5KTQA 3R6MA 1S6PB 1RBVA 4CK1A 4K5SA 2ZD1B 3GV7B 4CZFA 5F8MA 2J76E 2UUCJ 1YT3A 3DRRB 2OPRB 4E7HA 3AA3A 5HL7L 2HFZA 3EX7B 2BMBA 3BZQA 2RRBA 5HVGA 3KMQA 2VOOA 4DQPA 1CQNA 2ASLA 4K4SA 4CGHA 4KPYA 2V9WA 3DWLA 1WC6A 4JI8F 3OD2A 4FOIA 1HPMA 2RIJA 2DT9A 4KQZA 3QT7A 3K9JA 2HNZB 4M7XA 2UUCF 4NMXA 1BQXA 3RMDA 4LMZA 3MAQA 2AGOA 1WSGA 4NLXA 3OV7A 2CQHA 3BB5A 1ELOA 3WC2A 2JLEA 3JS9A 1U6ZA 5L9NA 3U4LA 4UQGA 2YKMB 1S1WA 4O4GA 1N32K 3DI6A 4Z0UA 4CVNE 4CZGA 1RBSA 2N3LA 4IG0B 4JLHA 1RA6A 4A8XA 3KLHB 3ZEUA 4WIIA 3C15B 2OTLN 1HARA 2PEBA 4C3LA 3RG6A 5H1SQ 4U7BA 3QFHA 3KWGA 3TA1A 4JI0J 3BF1A 1OVYA 3AO1A 2D3OR 2NYHA 4BROA 3PIOL 1YIJS 4BWMA 3H3OB 4J2EA 3OXGA 2F4VF 1WAJA 3MUMP 5AQVA 4O3OA 1RWVB 2RQ4A 1H7WA 2X6NA 2RMLA 3HYFA 5KQDA 4I2PB 2RE2A 4JI1F 5BPNA 4RW6B 2YKQA 5LSOA 2QXFA 1WC1A 3L2VA 4ZVGA 3M4XA 4X2BA 3CCZA 2OJ3A 1GTEA 4NLTA 1HYSB 1CPZA 2EEYA 4FWRA 3V6DA 4DKWA 2CGJA 3TTDA 2DGUA 1Y4ZB 4PXCA 3LANA 2KG1A 3NLCA 5KAKA 4DX5A 1NLVA 4W92B 2PYJA 2UYTA 4A5AA 2CGLA 3C14B 4DR3F 4F25A 3CJ2A 3UVJB 2ALYB 1P9YA 1VSDA 3VWSA 2JGUA 2Y1LB 3TAMA 4FZYA 2IOCA 2QFJA 3O3HA 5D4LA 2DHGA 4DR7J 1QY7A 1N34J 3HDSA 2MKHA 4PZVA 4U67L 4LQ9A 4X4RA 3OL7A 2ZHBA 3AA4A 1UJ5A 4KGXB 3CCJN 3FQLA 3NF8A 4OX7A 3R2DJ 3Q2SC 3MEDA 2W2MP 3H08A 1Y0HA 4PKIA 5B8HA 4OQJA 3TAEA 1L3VA 3SK3A 1ZZFA 4DSIA 1W2BM 5L9XA 3BO4A 2KZZA 2PDAA 1LCUA 4MK8A 3RSEA 5CYMA 3ZTSA 4KI6A 4K4WA 3CQ8A 5SZTA 4ZTJA 1JXBA 1Q79A 2OZMA 1QE1B 1VSMA 4IFYA 4KHRA 2VH7A 3CC2N 4NZ7A 1JLQA 1S1TA 2Q43A 3DOKB 4NX9A 2VG6B 1YI2N 1U1OA 1E6VA 3ASMA 2VG6A 2IHR1 1IH7A 2O4GA 1LOTB 4B9QA 4B1ZA 1VQPS 4DR7K 2JEJA 1JXLA 1NSKL 3KK1A 1S48A 2KKZA 4EP4A 1GMWA 2QA4N 3D45A 4QIFA 4JOUA 1VQ6S 1BL3A 1NEEA 4OGEA 2DGQA 2AJ2A 4QIWD 2CWXA 3J81Y 4ECTA 1IKVA 1EJ7L 2R7QA 1FRHA 3QBWA 4O3SA 1OQ6A 2PMWA 4ATNA 4DU7A 3OVNA 2Q31A 2LDYA 3LPEA 3CC7N 1R31A 2MKSA 3HSJA 3PW5A 4FPIA 3K5NA 4PRFA 3D54A 1QSLA 1OQ3A 1QAJA 2BKOA 5FROA 1JXEA 3HHLA 4HHHA 1H0HB 5HK4A 2JEFA 4R5PB 4FM0A 2Z0GA 2W1BA 5FDLB 1U4BA 5A0YA 4OV6A 4DN9A 5CD4H 4C8LA 2AMCB 2N4CA 2G8WA 5KFRA 4V19S 1KNZA 2CVEA 3THXB 1D4XA 1PC4A 5C10A 2ZDPA 3Q8QB 1G99A 1Y7PA 1VSHA 1WB9A 1YIJN 3PEJA 2V6AA 2CPIA 4RW6A 4KO0A 1H7XA 2JWNA 4KO0B 2DGVA 5FLXO 2V68A 4DX7A 2XM3A 1D0EA 1SPBP 4JI2J 5KFNA 1DRZA 5F8GA 1BQNA 4MYTA 4LR9A 3CCQN 4DL3A 1C0TB 3ULEB 4N8OA 4JKGA 1EQYA 2E5GA 1EHWA 2IVNA 1EQMA 4MDAA 3VAHA 3IFRA 3T6BA 2QN6B 4DHVA 4J8FA 1URNA 4ZITA 3Q2TC 1N36F 2MHNA 4QIEA 1DT9A 4K0KK 4Y34A 2LECA 4RW7A 3LP1A 3M1VB 1TMMA 3SJHA 2YX1A 1REVA 2Q79A 2HSTA 4HWIA 4C8KA 2DRDA 4M63A 1VQYA 2LDIA 2DR5A 1TELA 5EWGA 3AVLA 5J2QB 1S1XB 8AT1B 4YOWA 3N9UC 3LF0A 3OBWA 4C23A 2HNYA 3EPGA 3V1RA 1R89A 4B8AB 5HQMA 2Z4PA 1GLBG 2GQQA 1SH0A 2MGZA 3M6UA 1GLAG 5K5MA 1RT5A 5KFZA 4I9QA 4CJQA 2HQCA 4OZ1A 1GLEG 4YY3K 4LF8J 1TUWA 3IR7B 4CIEA 1WKJA 4IFVB 4TSXA 6AT1B 4BR9A 2FJVA 4C8YA 2DHXA 1RUSA 3KIOA 2QXLA 1AW0A 1N36K 4OGCA 3SFUA 3QFWA 4XH5A 4YHHF 2NRRA 2V8PA 4FJ7A 4FJ9A 2KFYA 1BO5O 1O0PA 4IQXA 5IXUA 4FF4A 3CPWM 2O1PA 4B1YB 1HNZK 1JNZB 2XWYA 3U7JA 3TWHA 4IOCQ 1FK9B 4EZ9A 4H0VB 4QU6A 4LFCK 2E5JA 3LGNA 2F8SA 5LMUK 2AIRB 2EX3A 1RFQA 2JL9A 2G8FA 1TAUA 4UOCA 1F6TA 4N8NA 3E2EA 3K2YA 3VVTA 2LEAA 3OS2A 1SQKA 4JYAK 1O5JA 1ZC6A 3BH7B 3TJAA 3BPSP 5D6GA 3OYAA 1F2HA 3KLIA 4USMA 5J2MA 4I68A 3MM6B 2VZ9A 3GCWP 3W8GA 2IYIA 1WHXA 1CJVB 3MCMA 5L1KA 2QTDA 2B9YA 1GQEA 1S0OA 2C3UA 2KYXA 2W7PA 4NCBA 2IRUA 4ZPVR 2V50A 2MSSA 3THXA 5KT7A 2W42A 5HJXA 1WNEA 4NLPA 1VQ5S 4EO6A 3HKWA 4IG0A 3Q8RB 2LQBA 5C12A 5AXKA 5AE3A 5BN8A 3EN9A 4JKDA 3GIRA 4TLRA 3AA9A 3M6GA 3R3TA 1SL2A 2CUYA 1S1XA 5SWMA 5HQ8A 5D0HA 3EY1A 2FY8A 2MQPA 3MM9B 4CH0S 3JAMO 4NI2A 2VC0A 2LMIA 3HF5A 4USHA 1RDRA 5BR8K 5A0YB 1VQ5N 3Q83A 1D09B 2BJ7A 3NCQA 1EXQA 2FZCB 3UVJA 4RL1A 2ZZMA 2C22A 3QMLA 5D77A 1U49A 2NXEA 3CJKB 4O8UA 4DS5A 5CAAA 5FPEA 5IQQA 4A8SA 3BGOP 4ID5A 4NZ6A 3CCMN 5L8RC 2MMYA 3L2QA 1RBUA 4DL0C 4KB0A 3RBEA 1VHIA 1IXKA 1NUEA 2RRNA 2ZZNA 4X4QA 1VISA 1D8YA 1OH6A 4ZPAA 3VQ5A 1TKXB 4C0BA 4O5FA 1K1QA 4LF5J 1QUVA 3MR2A 2O8FA 4XTTA 2OANA 3T1HF 3LZJA 1N5TA 1HNWF 1N52B 3MM7A 1RDDA 2XMWA 2D5RA 4NLDA 3QWPA 3OYNA 3S9HA 3D1QA 4L72B 3GBTA 3MOZA 3CD0A 5DO2A 5KFJA 1CSJA 1QS4A 2W9CB 2L3MA 4C6AA 1ZA2B 2PI4A 3ETOA 4ISGA 2I1RA 4JD2A 4PKDB 5LL6d 2LQ8A 1RYSA 1TL1A 1IBLF 3D0GE 4ZVPB 4JI0F 4CO0A 3MM6A 4L8RB 1KQGB 1P1LA 3H45C 2RU3A 4DV2K 3RMAA 1N4LA 1WEZA 5CZ1A 4NPOA 5ETMA 4DUYF 4CJLA 4PQAA 4BC2A 3KK7A 1WTFA 1RK8A 4Y2KA 2Q36A 4A46A 3TTCA 4GY2B 3T1HK 3MEGA 3C7NB 3C7NA 1JXVA 2CQ3A 1WDDA 4EHTA 4RJVA 3DAWA 4ECYA 3GONA 4BE2A 3M2UB 4FWMA 3HFZB 5KT3A 1M5HA 4JI2F 3U3GA 3K57A 3RMCA 1P1TA 4DN0A 5KOWA 2WVBA 2GMJA 1R6YA 4OHXA 5IT9U 4I6YA 2DR6A 4ZP8A 2V67A 1M90O 4DR6J 2ZFHA 1ZPVA 5HANA 3W9HA 4H0OA 2DBBA 3V1QA 1HJRA 4CBWA 1YVUA 1TVRA 5KG3A 1VQ9S 2I8EA 2W7OA 3KG0A 5C2CA 1S97A 2QMWA 1FEHA 1KQSR 4GV6A 3PUFA 1MDUB 1FD8A 5L38A 4KGZB 2NS1B 5M1QA 2CAJA 4ES1A 4TYAA 3ZNJ1 2RD5C 2CJ9A 3U1NA 4P6QA 2CDRB 4JHDA 4CLLA 4CJFA 4I4BA 2JFKA 1VHXA 1KBRA 2UZAA 3K8WA 1HMVA 2QLFB 2D41A 5CCMA 5IM0B 3HD2A 3HVAA 3MN5A 1X4DA 1FWKA 4ZKAA 3H7HB 3W2WB 1IJFB 4R0JA 1TUUA 4LF4J 1TAQA 1J27A 2ZH1A 3WNHA 3PX0A 1RHQB 3ENOA 4OFZA 3UKUA 3DLKA 1EQ0A 3KYLA 4LF5K 1DARA 1MU2A 5KFBA 5ETOA 1BGXT 2HVDA 4IOCL 1WF1A 1CJKA 3FLCO 8ATCB 1NK4A 1FF2A 1FEEA 4DV4K 2XS5A 2ZJRQ 2KLAA 5KFEA 4M3RA 2WB4A 2XB2D 4FJJA 5J1NA 2ALZA 2XG8A 1NJXA 3NMRA 1YZ6A 4C2MA 3DJCA 3SUOA 3SZ2A 3SMZA 3FZLA 1GXLA 4DV3F 4DFJA 4JEPA 2G1DA 2JNJA 2ZWPA 1IJEB 4FWKA 1X9SA 2V69A 2HIQA 1LKZA 2D3UA 3EVWA 4Q2MA 2QL9B 3TEHB 1RWWB 1ATNA 2FC9A 1NXIA 5DDOC 3H4BA 1SQGA 3DOLA 1KD1O 4F3TA 5C42A 4LR8A 1RWUA 4IO9L 1ZM2A 2DIVA 3K9KA 4CHZA 2R7SA 1RA7A 3HSCA 1K1SA 1E6YA 1G2EA 3WBZA 1Q1KA 4K2JA 2D1KA 4RZRA 4OYWA 5D15A 4B9VA 3MR6A 3NMAA 4KGKA 3ZZ0A 4FLYA 2CPZA 4WFAL 1BY9A 3ILIA 6FDRA 2PFDA 5ETPA 1T0TV 2GMHA 3LDPA 3EZUA 4USIA 1HQUB 2IAJA 3O3FA 3G6XA 3NBPB 3ENHA 2B9EA 1FE0A 4BQLA 3LDQA 4UY85 1XTZA 1HLUA 4WJBA 2B6AB 2C3PA 4WYLA 4CGDA 4URGA 1S72S 3T1AA 3O2IA 3KWMA 3CPWR 2QWMA 2CADA 3VESA 3BBFA 5MAOA 5KG2A 4CI6A 1WC5A 4IXCA 5LSRA 2B4PA 3AB2B 4FBTA 4I6MA 3VAJA 2F4VJ 4IDKA 2FJAB 3TR5A 1K8KA 1L3SA 3LTOA 5CXTA 2DHHA 4DR6F 4ICLB 4RW9B 2XLIA 4LC9B 3FEZA 4RUCA 1U1KA 2MQMA 5D3GB 4DR3K 2D9PA 3WZ0A 4Y65A 1B92A 1GT8A 1ESVA 1WUUA 2I5JB 4HTJA 1SJQA 3NF7A 4KH1B 4RW8A 3QSIA 3ZXWA 3WXIA 4YY3F 3IG1A 3P83D 2QV6A 4QAGA 1S9GA 4DZ6A 1XEZA 2XSJA 2VOPA 1CBKA 2QYGA 1KAXA 1KLNA 3AARA 4RW4A 3LPTA 3MWBA 4ILHA 4DCHA 1UFKA 1KS2A 4J9NA 3QFUA 3FBCA 5E3AA 1HHTP 2X7IA 2BUPA 4YB1P 2OCEA 4F0HA 3CJBA 2G0JA 1YJ9N 3MM7B 4LBHA 2DPJA 3C6AA 2AJ0A 1NGDA 1CZBA 2NRVA 3W65A 4PEOA 1VQ7S 4DQSA 3P31A 2OEJA 1WOOA 4M3UA 3M8SA 4RU9A 4DSKA 4GKKF 3OXLA 3QYYA 3CJ5A 3OT9A 3KTQA 5D0RA 3CJAA 5E84A 3PJ9A 3BR8A 4O5BA 2GIFA 1Q53A 1S99A 4ISEA 4MTPA 2R2RA 4J9PA 4Z4EA 4PYDA 2F9JA 3AVNA 3O1WA 2B4JA 4LSZB 3GFYA 2KB2A 4LQ3A 1OSDA 1KXPA 2PZSA 4DR4J 2OPRA 2VONA 1JLAA 3BGLA 3TU5A 4P2SA 4BRPA 3QJLA 1RKIA 4PXBA 3FBBA 4AT1B 4W5OA 1E6VB 4MDBA 1SS6A 1HQUA 4F3MA 3PJXA 1IKWA 4J91A 3PIPQ 3L4IA 2LU2A 1G7CB 4FWOA 2AEMA 4EIAA 5CH7B 1LXNA 4CLFA 4KT0C 1NB7A 2J9DA 2JJ4D 4Z4FA 2BKNA 2GS8A 2YNHA 5I3UB 1T05B 3AVKA 3TZZA 2QA1A 2VQEF 2OFGX 4JN4A 1RXOB 4LF6K 3VQ8A 1RB0A 3DLGA 3QAUA 5A6PA 3I33A 5BYRA 1RWPB 2V34A 3I56N 1LW0B 3KLFB 3MCSA 3WHIA 5LXYA 2V7YA 4J9RA 2E1CA 1S0NA 5DM7L 4XDDA 4J9MA 1F9EB 1TKDA 2MQNA 2DFHA 1EKEA 3ZCMA 3T5LA 1FRMA 1WI8A 4JKCA 4B9MA 3T5HA 2NYIA 1EKSA 3PKMA 3RRHA 4QPTA 5F8LA 4P9SA 1VRTA 5HJYA 3UCZP 3NKYA 5KG0A 2L9WA 4IZ9A 2GX8A 2FJBB 3DRSA 2KHDA 1NJZA 2ATLA 5GMEA 4H4OB 3WNFA 1BQMB 1RABB 3KHHA 4DI6A 5HMZA 2MY7A 2CWKA 3OBYA 1WHVA 3J7AN 1RLDA 2W7AA 3DGPA 4KGVB 5KT4A 3IG1B 3AOAA 3CJ8A 4BBYA 2V5HG 3JAMU 3DLBA 1EB0A 4IOBA 2YX6A 3NS5A 4IG3A 4A48A 4Q2LA 2WSCC 2BW2A 3LW5C 1NAQA 1U25A 4PCQA 1CLQA 3O08A 4IKFA 1HI8A 3PW0A 2ZH5A 3HK2A 3MMCB 1GLFO 3EUNA 1NGHA 3MMCA 1QQOA 3CETA 4LF6J 3IUCA 2XYHB 2Y1RI 1HKCA 5L1IA 2MZJA 4AL6A 2F8EX 4EYHB 3SPYA 5GAGP 4PKGA 2OLWA 2HNDA 1WORA 3P38A 1YK9A 5H9EJ 2UXCJ 3FUYA 4NLOA 2VPYB 3DLHA 2XY6A 2PE8A 2RQCA 2AGPA 3OYCA 3K0SA 1H73A 2KG0A 4CM2A 1S1VA 3VAKA 3OYFA 4HKQA 3THVA 1XR6A 3H20A 3BSNA 2L9NA 5L46A 2MXYA 3NRBA 2BRLA 4DFPA 3EICA 2RH3A 2QLWA 3I8DA 2P9EA 3OL9A 4JK7A 3ADAC 1WUAA 3Q8VA 1TFWA 1YVFA 4UUXA 1B9FA 3JTPA 3PR5B 3VTHA 2XNRA 2GFFA 4ES2A 2CXEA 2CJBA 1KQKA 3ISNC 2MPUA 3EDRB 3NVKA 1KEKA 3MZIA 3CSKA 2J4RA 4E1MA 2CJKA 4AHRA 2PO4A 3W3SA 4EBDA 3GCXP 3CMES 1N5YB 2H54B 1HNIB 4JI7J 1HKAA 4B3TF 2LXIA 3RR8A 2WVFA 3P4UB 3UB5A 1NGCA 2GHPA 1B0PA 4QW8A 3UPFA 4LIWA 1RT1B 4NCAA 2IA6A 3VEOA 1YVNA 1U0SA 3RW6A 2WONA 5HATA 3H59A 4J7CA 1PYOB 1YJWN 5CYQB 4WFBL 5I3UA 2OI2A 2HVEA 1UAWA 2UXDK 3RUBL 1E6YB 2I7PA 4JKFA 1GEHA 2K06A 3S3MA 4ED2A 4XIUA 3POTB 5IT9O 2FGOA 1HBMA 5F9LA 4AHSA 3CDAA 1WHWA 1HBMB 4Q5VA 1AUSL 3MD3A 5JLFA 4DL6A 3D67A 1UVLA 1HHSA 2P9KB 2FJEB 3BEGB 5AQQA 4HHTA 2HK3A 2EKYA 1K0VA 3GILA 1NDPA 3JYTA 3A8JA 3UDCA 4FJNA 3TWZA 5KT5A 2MQLA 4CLTA 4IRKA 3OL6A 5T41A 1F9FA 3T1HJ 9ATCB 1PYTA 1SB6A 4ZP9A 2WFBA 4LF5F 2MZRA 2DH7A 1ROFA 1UFWA 4CIFA 4W5QA 3O9UA 1S10A 4DV4F 5KFQA 4C7QA 4RNHA 4K59A 2HNDB 3GOIA 4KTWA 1NZ8A 3PZPA 3C65A 3FZFA 1RTHB 5DM6Q 2UV8G 2WTFA 1RT4B 2A3JA 3IBWA 2XI3A 1ULRA 5HO4A 2AZ1A 4PG6A 5LMNK 1X8DA 3R8YA 3VR1A 4J9UE 4P2MA 4FLTA 3C8YA 1C0TA 4BRGA 3EE3A 4BG8A 3TZWA 4DL2A 3C6UB 1NJYA 1NB2A 1A5VA 1GFWB 2K8GA 3N01A 2ZEJA 3D0HE 1S79A 3GJTB 2WVCA 1VJWA 5KFFA 1GMWD 5CHCB 2FGCA 1GMUA 3NG8A 2R7VA 3BO2A 4CJVA 3PRVA 2GVDA 3U9ZA 1CG2A 3BS9A 2H3GX 3D7EO 3CCSN 3NHGA 3IKMA 3PIPL 4O0JA 4JI0K 2D69A 3E9OA 3O1BA 2VL1A 4K4UA 4LFBJ 1LWCB 4BRQA 4DBQA 2HQFA 2UXBK 1RWOB 3J7YU 2DEIA 3GIJA 1HUXA 4YOXA 4X66J 2FJXA 2H9ZA 1OKJA 3R5AA 3GQCA 1RAIB 3R5DA 4OI1A 4BRIA 4W4MA 3DRRA 4AHCA 4C1NK 3WXLA 3SJJA 3QT6A 1SUQB 3MMAB 4YDUC 3CCTA 3TX0A 4Q45A 3PIOQ 1KTQA 1PGZA 4DSJA 1S5JA 4ILRA 4DR5K 1VRUA 2EFOA 4LH5A 2BGGA 2BOAA 1BCOA 3CO0P 5B0BA 2LEBA 2Y1JA 3NBPA 4H0PA 1XMQK 1ZBSA 1TUYA 1RHUB 1C1CB 2Q97A 2C3YA 2ZKTA 3S41A 3HM9A 1M1HA 5CYQA 4PA1A 4ED8A 4F0MA 1V4SA 3EO3A 1K6YA 2WC9A 1G6BA 1TK0A 3CM5A 4OPJA 3SYZA 1UL3A 2K3IA 4E1NA 1T02A 1S4FA 3MR7A 1VQMN 4C3MA 1C2PA 3ZEUB 2GV1A 4Z4GA 4YOEA 1S12A 5DRKA 2O5DA 1RAFB 1Q81T 3IA0A 3Q86A 2HHVA 3SFGA 4HUFA 5EUHA 4M42A 2I6WA 3CD5A 1XMOJ 1Q9YA 4FJMA 1SC6A 1AFJA 1T05A 4ZLNA 3GFHA 4CZKA 1U1PA 2CPDA 4HTUA 1VK3A 5M1OA 3H8YA 4CF0A 4M94A 2NUUG 4HACA 2VWKA 3HO1A 4HACB 4DR4F 2LA4A 4ZVHA 2OMOA 3KUHA 1M5SA 2ZH8A 2HHXA 4ZVOB 2DNQA 1TGOA 3ZX0A 4LUBA 3ILOA 1NNEA 2FTRA 4GMKA 3OYKA 2HGLA 2F8TA 2VV5A 4QWEA 2GWKA 4FPBA 1KOHA 3A5OC 1LWXA 2WW8A 2RILA 3GR1A 3CJCA 4CHOA 2XLKA 2MJNA 2YWKA 3Q8YA 3AAQA 1S6PA 4NRTA 2HMPA 2QO3A 2HAIA 3EDQB 4WKRA 4W5TA 3DRXA 3JTNA 4NA1A 2ZWOA 1NDKA 2VCPA 2YVSA 5F0UA 4CI0B 2E7XA 4DV3K 5HSPA 3PYGA 2DGXA 4QIGA 5IS2A 4QBUA 1VGYA 1VDHA 2JX2A 3HI9A 3VVUA 3HXMA 2ROEA 3EXYA 1QZ6A 2W2PP 2LEPA 3J7A1 2XEXA 1KR4A 1NGIA 4C8NA 4RR5A 5DLGA 4TLQA 4EGLA 4CK3A 1FVSA 3ZX2A 4OX6A 4DPUA 2M52A 4LSNB 1BA1A 3SCLE 4OJHA 2AF6A 4Y28C 1AFIA 3NF6A 3O3GA 4C48A 2DR9A 4DTPA 3FKBA 3OJSA 4FJLA 3B8HA 5B7WA 4M8LA 3HOTA 5CZXA 2ROPA 4DU8A 1NMNA 3IMQJ 2DCLA 1HBUA 4E1JA 2HF3A 3HP6A 5AQPA 1WF2A 1IBMJ 4C11B 3R6GB 4AFFA 4IFYB 4CHYA 3M8QA 3JXOA 2P9PB 4MKVA 3KLGB 3W0LA 1VQ9N 1WDTA 3GYXB 1VIXA 2IA0A 2D3ZA 2CKWA 3TUJC 1NM1A 3H3NO 5AFUA 3GSIA 3MMBA 4NYNA 3MFHA 3I31A 4EAHD 4BRMA 2VIHA 4ED4A 4A8MP 1YITN 3KG4A 1SC3B 4CBUA 2D74B 2QW9A 1VJQA 2W2OP 4CF9A 4MFBB 3US5A 2HMIB 1IJJA 1JCFA 1UTAA 4ER8A 3CC4N 3OYDA 2HS0A 1C1BA 3G87A 4LBPA 3QZ8A 4DUTA 2EFVA 3HSDA 4JV1A 2QX0A 3GYGA 5J2NB 3PW4A 2H51B 2HQDA 3CQXA 4CJKA 1SC1B 2FHKA 3ZZTA 4UY8T 5ADXH 1KCFA 4PL7A 4X66K 4K4TA 4B9NA 4JYAJ 1EZZB 4WCEQ 1YRUA 3AB4B 1BUPA 1RKJA 3UFCX 5KFLA 1DZ5A 3FZKA 5KGWA 4K4ZA 2OMLA 2KVIA 4LSLB 3AA5X 3CIZA 3R97A 3NGDA 4ZHRA 3HHKA 5F8NA 4F3OA 3MWTA 1HJOA 2ASOA 4U7UK 5HVHA 3RBDA 1RBOB 3THTA 4CFAA 2Z30B 3CE8A 1CZ9A 5AZIA 1BQMA 3DLJA 2BANA 2IVOA 4Y2AA 4WXOA 3HOSA 3E9PA 2GX9A 4WQ5C 2YKAA 3SAHA 1UJ6A 4CZCA 3VAFA 3TUIC 3ID6A 4N5SA 1RT4A 4Y6IA 4FLXA 2C42A 1NJIT 1SJRA 3AFGA 3CVKA 4M3XA 1FKOB 4K4XA 4L74A 3B8AX 2HHHF 5MLCQ 4LSNA 5B08A 5T7LB 4CGFA 1J5EJ 2V2KA 2YH1A 3MDFA 4X66F 2HHSA 2O8CB 1QZ5A 3VENA 1PAEX 2ZZTA 3N5BA 3SAGA 3FVYA 1L5UA 4F02A 3BGUA 2XULA 3TA2A 3QT8A 1IBKK 3TJ9A 3R2CJ 1PILA 1XMOK 3AO5A 5M1KA 1NKBA 2G8VA 2Z2LA 5AQZA 1J5EK 4HCBA 5KT2A 2VG5B 2W8KA 4QR2A 2QWQA 4WPAA 2YHBA 2BJ1A 3VEVA 3GG4A 2MQQA 2ZC4A 1R8AA 5IT0A 5MLCV 4F4AA 1XQIA 1AZSB 4BRFA 2ZD1A 4OZ2A 1WC3A 2BQUA 1RGVA 5HLFB 2NRWA 3BO3A 4FN5A 3OSNA 2VFVA 4L3KA 2DGSA 4K43A 3AXKA 4M5NA 3E66A 2NZTA 1U26A 3HT0A 2DNOA 2NXCA 1ZBHA 3BKUA 5H1SV 4EHUA 1HX1A 3GPAA 2GVDB 2HRYA 1XNRK 1MW7A 1OJ4A 3PY8A 4XH1A 4B1VA 2BR0A 4M3TA 1K47A 4QU7A 1NKEA 2IS3A 2K2PA 4ILLA 2EVZA 3CNQP 4O8KA 3OL8A 4FF3A 3LL3A 4MT1A 1S1WB 4O4GB 3K59A 4LF7J 2W2NP 4O23A 2KFZA 2ASPA 5FD1A 3PYDA 2WUSA 2GVZB 5JMNA 4H03B 1GH8A 3BYRA 2XS2A 4AXIA 1MNEA 1UA1A 1DHMA 2OSRA 1JLQB 1S1TB 1LK7A 2NNWA 3WNGA 2ABYA 5C0YA 3P39A 4KTQA 2PT0A 3UQSA 2F5GA 4X4NA 4OZJA 2FZGB 1P8ZA 3IXQA 4BC7A 5GIPA 1X9JA 2VG7B 5M2UA 3D2FB 3TNVA 2E2NA 5DETA 5LSLA 3HI0A 2KN4A 2BQRA 4O0NA 4P73A 3LALA 4H8KA 1VSJA 3ISND 3RB3A 1KKHA 1LW2B 4ECQA 3THWB 4OL8A 4LH4A 3PRBA 1IKYA 3SCJE 3W62A 4H4KA 3DXBA 4GMJB 4OZLA 5KG7A 2U1AA 1S9GB 4AF1A 3HFKA 3O3LA 3MURP 1HQ2A 3U6FA 4OJRA 1QAIA 2KT3A 2VWBA 1NHUA 3J7ZT 5DLFA 1NK7A 1RSCA 3MAHA 5J2QA 3UR0A 3H1VX 1QM9A 1IBLJ 3D1OA 2CPXA 2HBLA 1J53A 2OEMA 3O8MA 1S4EA 4J5OA 4CLUA 4ZLLA 1U0HB 5JMVA 2HEKA 2MZTA 5AXLA 2V8DA 3IFEA 3ZTOA 3C2PA 5AJ3K 3QMQA 1RGIA 4M5IA 3SDEA 2F4VK 3LDNA 1N56A 1HYZA 3BUZB 3O4NA 4LF7F 1H72C 2CNLB 3M1VA 4C9DA 4JP8A 4YR0A 3MECA 3UCGA 4YDXA 4BRNA 4JI1K 3ZT2A 5CYJA 1TV6A 2HBRB 3W61A 2BX6A 5EDWA 2E1YA 1JNRB 4USVA 5F0WA 4A57A 4ECRA 1HD0A 4OZ0A 1MG7A 4K7QA 1H38A 2HWIA 2MZSA 3H25A 4DLEA 1YDLA 3AHPA 3HVRA 3QFPA 1SJ4P 3ENVA 4Q44A 5HRPA 4CO2A 4P52A 3DRPB 5FRNA 3BV8A 3BP8A 1NDCA 4DR2J 4ZVSB 1WKLA 3O9RA 1GX5A 2PSZA 3IAS9 3DMJB 1VQKN 5DZ6A 4BVOA 3C6TA 1YG0A 5DK5A 2R8IA 3R9LA 4EFAC 3CT9A 1CEZA 3OYEA 1LV5A 4IWVA 3LUYA 2A42A 1N34K 3NFAA 1R0AA 2BDPA 3KKRA 2F1FA 5C24A 1MWKA 1KQSM 2HBQB 2HBKA 4LF7K 3A8YA 3THYB 2J8AA 2HKEA 2XY7A 2D0AA 3C3LA 2MZQA 3UI3A 3FE1A 2AP1A 3HJFA 5JS2A 2KYZA 3QQCD 5KFWA 1N6QA 3W9IA 4DV0J 2B4UA 1C1BB 4JNEA 1H2TZ 1VQ7N 2B5JA 2G2YA 2YI1A 3KDNA 5KG1A 2OPPB 1KHWA 4MKYA 3EGVA 1A5WA 4CZEA 3M8QB 3MK6A 1H2UX 3G8QA 4Z94A 3MMJA 3CM6A 3AJDA 1WBDA 4KPCA 4FDFA 4H4MA 3WEEA 3PRDA 3KHLA 5KG6A 4J9LA 3VGLA 3TI0A 4WP8A 4YR3A 2E9ZA 1S6QB 4MAKA 1S6QA 1XERA 3CHWA 2ILYA 2HURA 5AQGA 5A8RA 1VHFA 2QSFA 4BY9C 1DGKN 1J5OB 2H5EA 4DR7F 3N0VA 1Y11A 3BDEA 3HHDA 3PLAA 4M5HA 2A10A 1J54A 2HBMA 1RHMB 2A6OA 3VGVA 4DR3J 4JV5J 4A2AA 1FX2A 1R8PA 2W01A 3AAWB 3ZSVA 5GAEI 3V81A 4NXMF 3PFOA 7FD1A 1ZH5A 1RWMB 1TMJA 2VBZA 3BH6B 4W98A 1HYSA 2R7TA 2B4VA 1RACB 4WF9L 4FW2A 2ZM6K 3H46O 3CGIA 3CJ4A 1SJ3P 5CR4A 3NGRA 1L3UA 3JB9k 1H1VA 4HHUA 1K0TA 4PXEA 1FJGJ 2IC3A 2UUBJ 4O44B 3U02A 4MYUA 4ZLJA 4BQZA 3H5YA 5DJBA 1FDDA 3KHYA 1B7FA 3FRZA 4BC5A 2DPNA 3GB0A 4H54A 4DQ8A 2FLNA 3BKFA 5AQIA 2IRYA 2OPQB 3L2UA 3W64A 2WW4A 1RDBA 4ENOA 1CC7A 2HK2A 1RCOB 4EBEA 4DEZA 2BEFA 1MWQA 3TZXA 3HHEA 2QTWA 4ES3A 1NBWA 1BU6O 1HQEA 1F5AA 2PFFB 3UNYA 3ULDA 2AJQA 1OPZA 1Q8IA 3A1YG 5DG7A 4F3QA 3UW1A 4OX8A 2C2ZB 4M1KA 2YHWA 2GMLA 2HS3A 4JI7F 5M2PA 2HF4A 4AUKA 2HVIA 5C2FA 5HRSA 2C2EA