4Q0BA

Crystal structure of hiv-1 reverse transcriptase in complex with gap-rna/dna and nevirapine
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
555
structure length
555
Chain Sequence
VPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTNSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 reverse transcriptase, p66 subunit
publication title Structures of HIV-1 RT-RNA/DNA ternary complexes with dATP and nevirapine reveal conformational flexibility of RNA/DNA: insights into requirements for RNase H cleavage.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase, hydrolase/rna/dna/inhibitor
total genus 142
structure length 555
sequence length 555
chains with identical sequence C
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2014-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4q0bA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4q0bA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4q0bA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4q0bA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4q0bA05
1N6QB 4DTJA 3LAMA 4QWDA 3NH1A 1S1UB 1HQUB 3LALA 1Y97A 4ZP7A 3OYLA 3TVKA 3HK2A 4K4ZA 3NBPB 3PX0A 3NHGA 5KT5A 4ECZA 4RW8A 4B9NA 4QW9A 4LH4A 4G3IA 3C95A 5C25B 3HP6A 4FJ5A 1IKYB 1YTUA 4QPXA 3SUQA 4J2BA 1QSSA 1SL0A 5EU7A 2IDOA 4R8UA 2IMWP 4QWBA 4F3TA 4DL7A 3MEEB 4YR2A 4RW7A 1KSPA 4ICLA 4R5PB 3SQ2A 1TKZB 4JRQA 4FK2A 4FJNA 4O3SA 3SUNA 4FJJA 1S1XA 4B9LA 1HPZA 1TQLA 2VA3A 1UAXA 4GVMA 4IG3B 4J9LA 1I3AA 3WNHA 2BQUA 2PY5A 4H54A 4ID1A 5D3GA 1S0NA 3IN5A 3OJUA 3DLKB 3KMQA 3OS0A 2B6AA 4JLHA 4B3OA 3O3GA 1XC9A 2IS3A 4QAGA 4XPEA 1O1WA 1KLMB 4CJTA 4DTPA 1K1QA 3PJWA 3SFUA 3SYZA 1XI1A 1RTIB 4J9PA 3DOLB 3SV3A 3QLHB 2O5DA 1U47A 3V4IB 2WB4A 2OPRB 4EYIB 3SPYA 3KJVA 3DLEB 1RT7B 1BQMB 4DL4A 3VN5A 3HHKA 1CLQA 3IG1A 4CGDA 4KHWA 2WONB 3ZSWA 1ZTTA 4W5TA 2B5JA 1LWCA 1DLOA 1HRHA 4JS4A 1BI4A 1TKXA 2J6UA 1RT1B 4ED7A 2OPQA 5KFQA 3I0SA 4CHOA 2GBZA 4E1MA 4YMEA 2C22A 3HM9A 1NK0A 3LP1A 2ILZA 4HKQA 5JS2A 2HB5A 4F3OA 5KG5A 2XY6A 2VG5A 4DFPA 1DTTB 4EZ6A 4AHCA 3DLGB 1JLAA 3EZUA 3M8QB 3AO3A 1FKOB 4LSNA 4DSJA 2ASJA 4CEFA 3MR6A 3OY9A 3K58A 3AVMA 1RYSA 3ZT1A 3PY8A 4EO8A 3LANA 4PUOA 4FZXC 2W42A 4CGGA 4F4XA 1L3SA 1U04A 4IOBA 1RT6B 5KFYA 3C6TB 2D7SA 3RB6A 3QETA 3QYYA 4ZPDA 4NCGB 1SL1A 4JUZA 1RBVA 3WNGA 4ECSA 1NOYA 2Y1IA 1RDBA 4J9QA 1C0TB 1BQNA 5I42A 4L8RB 4ED1A 4IR1A 4RNHA 3SZ2A 4HUEA 4RW8B 3N6NA 3L8BA 4FXDA 3OSNA 2HNYA 3H4DA 3PX4A 2OPPA 4F4ZA 3IAYA 2HHVA 3LAKA 3T5LA 4BWJA 4TYAA 4FLUA 2DPIA 5KG7A 3VQDA 4OPJA 1HNVA 1X1PA 4IKAA 3KK3B 2XHBA 5HRPA 3QGGA 4Z4FA 4CJWA 4RW7B 2FC0A 3KLGA 2XWYA 4RW4A 1QUVA 2O4IA 4IRCA 4NCAA 5JXSA 1SV5A 3VQ8A 1IKXA 1S1XB 2GUIA 4O55A 3OJSA 4FLWA 1HPZB 4CEQA 4BACA 2HHTA 3MXJA 4KTQA 4E0DA 5D3GB 3VQEA 3SI6A 1JKHA 3M8PA 4Y3CA 3V9SA 3RTVA 2F96A 1I6JA 4FJLA 4B9SA 3OYIA 4NLOA 2LSNA 2AGQA 2V4RA 1J53A 5F8IA 1Q9XA 1ASWA 4HUGA 4B9TA 3NF9A 5KFUA 1TGOA 4CEOA 2HVIA 1JLCB 1N48A 3VQPA 4PA1A 3KJVB 5L1KA 1XR6A 4HYKA 4FBTA 1VSDA 3AVBA 3HVRA 2R8GA 3MXMA 1JLEA 3FRZA 3F9KA 4FBUA 1VRTA 2WCXA 2B5JB 4DFJA 4DSLA 1LWCB 3L2RA 1BI4B 1A5VA 2D0CA 1TKXB 1TVRA 1NHVA 3LZJA 3KLIA 3HPOA 1NK9A 3EYZA 4O4GA 2Z1IA 2R8IA 2OPQB 4JRPA 3I0SB 4QCLA 3ZSOA 1QTMA 1S1VA 3HKWA 3RMCA 4CJKA 2JC0A 4JS5A 4M42A 1KTQA 1QS4A 1WSGA 2R2TA 2B4JA 4HUFA 3AVKA 1ASVA 3LPTA 4BWMA 1JLAB 2OPSA 3K59A 1ZBHA 1S5JA 4LSNB 1S9FA 2IBKA 3G6XA 3DOKB 3Q8PB 3O4NA 5HP1A 1CSJA 3NGDA 3FDSA 2HWIA 2RN2A 4DTOA 1L3VA 4PUOB 3KHHA 2FLLA 4DSKA 3SPZA 3ISND 4KSEB 3L3UA 4K4SA 1KHWA 1X9WA 3AVCA 4Z4CA 2GIQA 4J2AA 4FZZA 1BQNB 4URSA 2KFZA 4GC7A 5I42B 3QIPA 2FVRA 1C2PA 4FVMA 1GOCA 3TAGA 4EBCA 1T7PA 3CDWA 3QO9A 4WYLA 3DI6A 1SKWA 2C2DA 4E7KA 2HNYB 2OPPB 2J6SA 4MK8A 1EX4A 4FM1A 1JX4A 1UOCA 2ZE2A 4DFMA 1S9GB 1NKCA 1HNVB 4R0EA 4KREA 1SL2A 4J9MA 4FLVA 3CJ5A 1EETA 1N5YB 3BSOA 3KLGB 4RW4B 4CJFA 5KGXA 2V0NA 4ED3A 4DSEA 1RA7A 1FKPB 1SV5B 2ASLA 2BQRA 3SUOA 5FRNA 1RBRA 1IKXB 2YNHA 3WNFA 5CYQA 1YVUA 3LP3A 1S6QB 3PW4A 3THVA 1VK0A 1RTDB 1KRPA 2FBXA 1JXEA 4DL3A 3A2FA 4MH8A 3M8PB 1YTAA 3KK1A 5C42A 3VQ9A 3OL7A 4LQ3A 1RBSA 3OS2A 5KFAA 5EDWA 1JXBA 3HVWA 5J2PB 4E3SA 3NH0A 1QSYA 4TQSA 4KBIA 4K4TA 3TARA 2FBVA 4CJ5A 1QAJA 1KCFA 1VSIA 3G6VA 4TQRA 5KFPA 3NH2A 2G8HA 1SKSA 2UUTA 3O3FA 4DL5A 3K57A 4F4WA 4DL2A 3ZSXA 1JLEB 5KT4A 3QESA 3LP2B 3D45A 1VRTB 3OYMA 2WRMA 1S6PA 1TVRB 3KLIB 2IAJA 2KZZA 4DQRA 5DQGA 4DQIA 4O4GB 1ZBUA 4KRFA 3SFGA 3S3OA 4CESA 1S10A 1B9FA 1S1VB 1K6YA 4EZ9A 3PZPA 3L2UA 4URQU 1DTQB 3CVKA 3RR7A 3DMJA 5SWMA 3GIJA 3SV4A 4KB1A 4BDPA 4F2SA 4XO0A 1LAWA 2OYQA 4PWDA 3IRXB 3P5JA 1S97A 2ETJA 1JLBA 5F8MA 3KMSA 3LWLA 1Z4UA 5HP1B 2JGUA 4RW9A 4CIEA 5HBMA 4ZVEA 3OLBA 1EKEA 4IKFA 2UVVA 5EUHA 5KFIA 3GYNA 3MR2A 4Q45A 3HP9A 2ZKUA 4DMNA 3MR3A 4AH9A 2ATQA 2RPIA 4NZ0A 2G8UA 1C1AA 4CGHA 2G8WA 4K4XA 4I2QB 1Q8IA 4CGIA 1RT2A 3DRSB 3UQSA 3OL8A 1NK8A 5KFFA 3QIPB 4Y1CA 4PQUB 2HNZB 1X9MA 1WSFA 4O3RA 1GX5A 3DI6B 1U4BA 4IR9A 3AVIA 4O44B 4ZP6A 3MECA 3V1QA 5KG3A 3VQ7A 2RF2A 4CFAA 3TAMA 2ZE2B 2YNGA 1KFSA 2VWJA 3VQCA 1S1TA 3UIQA 1D5AA 5FRMA 3CJ3A 5HRNA 4URGA 3F73A 3T5KA 1RDAA 5I3UA 5KFCA 4I2PA 4I7FA 4OJRA 3EZ5A 2X78A 3LP0B 2RKIA 1WSIA 2ITGA 1TL3A 4M3TA 2EC0A 1LWFA 3CDUA 2E9RX 5CYQB 1VSLA 4IDKA 1NJYA 4ECTA 2BQ3A 3PUFA 2ALZA 4NCBA 2A1SA 4KO0A 1A5WA 2Z1HA 1RA6A 3OYAA 4F4YA 1W0HA 3V1RA 4Q0BA 2W8LA 4FYDA 3SNNA 3KK1B 5DGBA 4FS2A 4FJ9A 5C42B 4ZPCA 4K8XA 3PR4A 3P83D 2GC8A 2WK4A 3KLHA 4JV2A 1T8EA 1QSLA 3Q8RB 2OA8A 2D3UA 3PO5A 3NE6A 1WNEA 3NF7A 4EBDA 4FM2A 3NAIA 1TL1B 1WNSA 3HVTA 1JIHA 4DF8A 5J2QA 5L9XA 3MR5A 4O3PA 4WFZA 3UDLA 3HYFA 4DWIA 1S6PB 1W25A 2IAJB 4Q8EA 1ZBFA 4F2RA 1SUQA 2IGIA 1S49A 4GW6A 2UVWA 1UA1A 4KHYA 5KG1A 3PW0A 1ZTWA 3Q8SB 2ATLA 4O0JA 3KLEB 5KFEA 1F21A 4IRDA 3DMJB 3MFHA 4OGCA 1SH3A 1JLQA 4NRTA 4PWDB 3L2VA 1G15A 3CM6A 1JLBB 3HSTB 1RT3A 2C2RA 3CFOA 3OL6A 4Y2AA 5HBMB 4NLPA 3ZT4A 3AO5A 2RDIA 2R2UA 3ZSZA 2E6MA 4DQSA 4NRUA 5L1JA 2UVRA 5KRSA 3H40A 4H4OA 2FBTA 2BRKA 1B9DA 1TK8A 1RTJA 1BCOA 1RT2B 4EP4A 1RT5A 3D0PA 2FVCA 1EP4A 2XC9A 4FK4A 4W5OA 3H5UA 3RRGA 3MECB 3VQSA 3E01A 4CF2A 4CEBA 4KV8A 4ZMMA 3S9HA 3U3YA 1QE1A 1S1TB 4ID5B 4NLWA 1MU2A 5C24A 4QWAA 5I3UB 4XPCA 4F50A 4I7FB 2B43A 4H8KA 4B8AB 2RKIB 3KTQA 1R0AA 1TL3B 3H08A 3FFIA 4YQWA 2IM2A 1LWFB 2IJFA 4Z0UA 4ECVA 4E7IA 3GQCA 2HMIA 3QERA 4RG8A 3EY1A 1XHZA 1IKWB 4IDKB 1HYZA 4KPYA 4RUCA 3QZ8A 3V9WA 4C8OA 3NMAA 4KO0B 2R2SA 5KT6A 3P1GA 2AGPA 3BGRA 1RCHA 4ZTFA 3JSMA 3NF8A 1XHXA 3KK2A 1IG9A 3KLHB 5J2NA 3HO1A 1ZETA 1JLFA 4QWEA 4DFKA 3C94A 4G1QA 1JL1A 4FW2A 4CEEA 4NLUA 4OPKA 1TAQA 2R8HA 3QIOA 3HVTB 2QV6A 4R8UB 4KHRA 2Y1JA 4RNNA 4TXSA 5KG4A 4ICLB 4IBNA 4AHSA 4KB0A 2RDJA 2F8SA 2XRIA 1VSMA 3T3FA 1NNDA 4TLRA 5KFBA 2IC3A 1SUQB 4FJ8A 3OVNA 4WFXA 3G86A 2HHUA 1REVA 1TKTA 3M9NB 3AA2A 3RAQA 3MAQA 4F4KA 2BGGA 5F9LA 4CECA 5KFZA 4TYBA 1CZBA 2D0AA 4TY9A 1LAVA 4E19A 5CZ1A 2P51A 2JEFA 3B6OA 4KHQA 2FBYA 1B92A 1JLQB 4B9MA 4MQ3A 4ECQA 5KT7A 1RYRA 2B6AB 4CJRA 4B3OB 2YHAA 5KT3A 1RT3B 5KTQA 2YNIA 4PY5A 2FLPA 3K5NA 4ZHRA 2Z1GA 1KHVA 1N56A 4N76A 4W5QA 4FLYA 1HARA 3RMDA 3DM2A 1D8YA 4CJ4A 4CHYA 5F9NA 3VQ4A 5KFKA 4H4OB 3IG1B 2IOCA 4M3WA 4CFBA 3BSNA 2FVQA 4KTWA 2AGOA 4TY8A 2DFEA 4M45A 3HVAA 4WXWA 2EX3A 4ZP8A 1RT5B 2E4LA 1DLOB 4K4VA 3IGNA 2Z1JA 3H5YA 5FROA 4BE0A 4HTUA 3TI0A 3H5XA 4J9RA 4DSFA 3H5SA 1YVFA 4J2EA 5SZTA 4WFYA 2YHBA 3LP1B 2BANA 4ED0A 3TAEA 2FVPA 1C1CA 3OYNA 5KFRA 4ZVHA 2VG5B 1QE1B 1LV5A 3CJ0A 1MU2B 1KVCA 5C24B 4CHZA 4QOZB 1U49A 5C5JA 3NGZA 3RBEA 4ELTA 2UUWA 3CYMA 1R0AB 3AO2A 1LWEA 3FFIB 3H2LA 3PVXA 2AWZA 1KVAA 3DLHA 2C28A 1TK0A 4FJIA 2FJXA 3KHLA 3HL8A 4B9UA 1W9HA 2WOMA 3ITHA 4CFDA 4HCCA 4NLVA 1T03A 3SUPA 4C8NA 4BE2A 3AO4A 5K14A 3HXMA 4NLGA 2JEIA 1NK6A 3RWUA 3HT3A 4ZPBA 4DG1A 2AJQA 4ECXA 4MK7A 3N6MA 3BGRB 2XY8A 3JSMB 3TAQA 3KK2B 2DFHA 5F8HA 3SQ0A 4E7LA 4B9VA 3BQ1A 4DU3A 3BSCA 3CQ8A 1ZYQA 3MFIA 2DPJA 5J2NB 4CE9A 4CHNA 4KKOA 2GIRA 3PV8A 5KFTA 2C2EA 4CJQA 1UWBA 3S3NA 4F8RA 4YR0A 3KHRA 3S3MA 2P5OA 4EP5A 2V4QA 2IM0A 3I5AA 4NLRA 3KD1E 4WE1A 3OHAA 1T3NA 1J9AA 3I0RA 4I9QA 2UVUA 3QGIA 4Z4GA 2E9ZA 4QWCA 1REVB 4RW6A 3KKRA 1NK7A 3CDEA 1T94A 1HYSA 2NUBA 2HHSA 4DU4A 3ZSQA 5KI6A 4O3QA 3AVAA 3DLBA 5JUMA 1JKHB 3RBDA 3QNNA 5KFLA 3NL0A 5KFMA 1TV6A 4CK1A 4CK2A 5KG0A 3RMBA 3N6LA 1CZ9A 1C0MA 4O5BA 4KE5A 5T14A 3H4BA 2D5RA 4J2DA 2YKMA 2W7OA 4ZHRB 4AHUA 4UQGA 4MKBA 4K4WA 3M8RA 1S1UA 3V6HA 3MTKA 1HQUA 2KZMA 3AVLA 4M95A 3MEDA 4CJPA 3QEIA 1J5OA 3U6FA 3NAEA 3GIKA 4RNMA 3KKSA 2G8VA 3VQAA 3NCIA 1XR7A 3BDPA 2AX1A 1KVBA 1RBTA 3OYEA 2VG7A 1NHUA 4M41A 1ZBLA 2D3ZA 3V9UA 4CF1A 1HMVA 2W9BA 3T1AA 1ZBIA 2G8IA 1ITGA 1S9EA 3AA5X 4Q44A 1WSHA 4KHMA 2KW4A 4R5PA 1TKZA 3DRRA 4DTUA 4FJMA 2OPSB 4CIFA 3JYTA 4DTNA 1NJZA 2R7YA 3MEGA 4U7CA 1LW2A 1SH0A 2HHXA 5JS1A 4J9OA 4EEYA 3KHGA 4O0IA 3EPGA 2P5GA 3V6KA 3DLKA 4TN2A 3ITHB 3AVGA 4IFYA 1T03B 4FJHA 5K14B 3BR9A 3BJYA 1IM4A 3H98A 3OYBA 4DG1B 1KLMA 5KFDA 1NK4A 4Q43A 3QEWA 3SQ1A 3HPHA 3DOLA 3BQ0A 2XI3A 4E7JA 3AVJA 4NYZA 5T7BA 3V4IA 3QO9B 4ECWA 3DLEA 1RT7A 2XI2A 3PJXA 4Q5VA 4EBEA 3OYGA 4FK0A 4K50A 1UWBB 4CF9A 4DTRA 4M94A 3QNOA 3GIIA 2BE2A 3NF6A 3OYHA 2AU0A 2A1RA 4RNOA 2IM1A 4CJUA 5EWFA 4LH5A 1EETB 1RT1A 4K4YA 4WE1B 1BGXT 3I0RB 1D0EA 3CO9A 4K4UA 3KIOA 3T5HA 3T19A 4IH5A 4H4MA 4NLXA 4OL8A 2YNHB 4DTMA 3RB4A 4DQPA 4CF0A 1DTTA 1VRUA 4CJ3A 3DYAA 4MFBA 5DG9A 1TP7A 4RW6B 2XGQA 2XO7A 4ELUA 2F8EX 2XCPA 4RZRA 3ASMA 1FKOA 4CJEA 4CHPA 3IGVA 3O4QA 1HYSB 2BR0A 1T05A 1RNHA 1MMLA 4OGEA 2R2RA 2D0BA 3ZSVA 1VSFA 4FJXA 1D9DA 1VSHA 5FDLA 4HVJA 3C6TA 4MIAA 4RUAA 3PO4A 1FXXA 3TAFA 4NCGA 4Q8FA 2YKMB 3SI8A 1N4LA 2HWHA 5HROA 3QGHA 4TSXA 4CEAA 1JL2A 5DK5A 3MEDB 2QKKA 3CWJA 1C0TA 3V1OA 1J5OB 4GMJB 1TKDA 1S0OA 3WNEA 4DF4A 2ZD1A 1QHTA 5KFNA 3RAXA 3I8DA 2VG7B 3GV7B 5KFVA 4DS5A 3BQ2A 2FJVA 4WZQA 3ZT2A 2IJNA 1HMVB 3KK3A 2W9BB 3RB3A 5KRTA 1NKEA 3GV8B 4LSLA 1S9EB 3OSPA 5KFXA 1IH7A 3AA4A 4LQ9A 2CJQA 2E9TA 3C6UA 3DRRB 3NDKA 2P1JA 4CJVA 4KHUA 1HQEA 4WYWA 2F8TA 3JYTB 3V6DA 3MEGB 1QAIA 4RW9B 5F8JA 5DGAA 3V6JA 2YNFA 3M8SA 1LW2B 4E1NA 3D5MA 4CF8A 4ED6A 1U45A 3TANA 1FK9A 1BISA 4IFYB 1RDCA 3GILA 4DEZA 1KLNA 2XCAA 2X6NA 4YP3A 1BHLA 2IA6A 5KT2A 4YFUA 4Y2CA 2E6LA 3RB0A 4J9SA 4DTXA 3ZT3A 3RMAA 1RDDA 3OYKA 5F8GA 1JLCA 2HAIA 4KAIA 3ICLA 4ED8A 1GX6A 2OH2A 4KTZA 4W5NA 4KB7A 3AVFA 4CEZA 2RF2B 4HHTA 2JC1A 3TAMB 2QXFA 1J54A 2YNGB 3SJJA 4RU9A 2DFFA 2ZQBA 4DTSA 2BE2B 2GV9A 3ZSRA 4B8CA 2YKNA 1XWLA 4I2PB 1Z25A 1NJWA 3V9ZA 3FSIA 4BE1A 4H4MB 3CJ2A 4ZP9A 3VQBA 3HPGA 1SH2A 5HRSA 4J9KA 2CKWA 1VRUB 3DYAB 4MFBB 4M3UA 4MKAA 1C1BA 2OZSA 4CJSA 3DOKA 3OYFA 2XY5A 1EXQA 4C8LA 3OS1A 4ZVGA 1T05B 4Z4IA 3Q8QB 3BSAA 4Q0BB 1KFDA 2HVHA 5FDLB 3BREA 4IFVA 4N47A 4CGFA 4IQXA 3L2QA 4DLGA 3SCXA 5DMRA 4NYFA 5HROB 5DQIA 3G10A 3K5LA 3VA3A 4CCHA 4E7HA 1L3UA 4B08A 4M3YA 5F8NA 3OYDA 1NKBA 2ZD1B 5J2QB 3OLAA 1VSKA 4Y34A 3ALYA 1BL3A 1S1WA 2XY7A 4IRKA 5KFGA 4LY7A 1Q9YA 2QKBA 1GOAA 3I5BA 4CGJA 4GC6A 4CJLA 2DTUA 4FLXA 1S9GA 3CFPA 4IG0A 4EYHB 5KG6A 4DU1A 3PHEA 4LSLB 1N5YA 4OVLA 3NGYA 3C6UB 4KFBA 1WSEA 4WZMA 3L2WA 4NLYA 5J2MA 3T5JA 1IKVA 4OKJA 2I1RA 1FKPA 3FQKA 3G6YA 1HQEB 3VQ6A 1S6QA 2W8KA 1RTDA 3V6DB 2PYLA 4OLAA 5KFOA 3OYCA 3VA0A 2YNFB 4ZPAA 2KQ2A 1U48A 3DDKA 4KI6A 4ECYA 1FK9B 4AILC 2JLEA 4FJ7A 1A5XA 3AO1A 4HCBA 3VQQA 3VQ5A 3PW2A 1RILA 2I5JA 3AVNA 3UPFA 4FLZA 4ECRA 1RTJB 1D1UA 5J2PA 5F8LA 1JXLA 1NJXA 2VA2A 5HRRA 2WTFA 1C0UA 5DQHA 4BDYA 1EP4B 4NLSA 3D28A 1RDRA 5CZ2A 3E01B 5EWGA 4KV8B 3LP2A 3V81A 4NYNA 4FCYA 2ILYA 4JV0A 1RT4A 1JLGA 1L3TA 2YKNB 3KD5E 4M3XA 4OKEA 4OKKA 3QINA 3IS9A 2ASDA 5DLFA 3TAPA 4ZVFA 2JEJA 2XGPA 3DRPA 1DTQA 4NLDA 3M9OB 3EPIA 2HMIB 1C1BB 1NOZA 3IRXA 3OYJA 2W9CA 4LD0A 5KGWA 3AA3A 1HNIA 5J1EA 1WN7A 4AHTA 1LW0A 4EO6A 2WHOA 4M3RA 4FZYA 3M9MB 3KLFA 2FVSA 2OZMA 4ELVA 1VSEA 4N41A 3K5MA 4IFVB 3AVHA 1SKRA 1JLFB 1BIUA 4G1QB 1WSJA 1XR5A 3L3VA 2KFNA 4I2QA 2PYJA 2HNDA 3DRSA 3TWHA 1HYVA 2QK9A 2VG6A 2R8JA 4PQUA 2HNZA 3QIDA 4FLTA 1S1WB 4XIUA 4O44A 1RBUA 3G0ZA 3KNAA 4NLQA 1WLJA 4CEDA 5KFHA 4IH7A 2IC3B 4CIGA 4Y1DA 4IG0B 2W7PA 1TKTB 4BDZA 4U6PA 4AHVA 5DG8A 4C8KA 5DG7A 3LP0A 1S48A 2HW3A 4KFBB 5HLFA 4Z4EA 3PW5A 3MXIA 5J2MB 1IKVB 3QEVA 1C6VA 3OL9A 1RTHA 5CYMA 3LWMA 2YNIB 2W9AA 2VWKA 4AHRA 4DL6A 4FM0A 1N6QA 2HHQA 3ULDA 3TABA 4KI4A 3DM2B 4FJKA 3K5OA 4J9NA 1TAUA 1CXQA 3E51A 3NBPA 5L1LA 2G8FA 2I5JB 4JV1A 3QZ7A 4OLBA 4ECUA 2AX0A 4TY8B 1Z26A 5KFSA 1NK5A 2JEGA 5C25A 1C0UB 1IKYA 4X2BA 4CFCA 1L5UA 4ED2A 4CERA 4DLEA 3V9XA 4MIBA 1TL1A 4MK9A 1YT3A 1S0MA 2FLNA 4E89A 4N56A 3MEEA 2BANB 3V81B 1C1CB 2X6SA 4CK3A 1I39A 3CIZA 1RT4B 1JLGB 2R8KA 4ZTJA 1U09A 3RRHA 3IS9B 3AV9A 4IG3A 2D41A 1LWEB 3OHBA 1IO2A 4M3ZA 5CY4A 3KLEA 1S4FA 5KG2A 4DQQA 1D9FA 3DRPB 4I9LA 3PX6A 3ISNC 2AQ4A 2WOMB 3I5CA 3O3HA 3NFAA 3GV5B 2DY4A 2W9CB 1HNIB 5J1EB 1LW0B 4C8MA 1BCMA 4KHSA 3PW7A 4O3NA 3KLFB 1RTIA 3SQ4A 3QLHA 4YR3A 1X9SA 3NKYA 1HJRA 3TR8A 2OPRA 3QEPA 4O3OA 1BQMA 4KKOB 4N5SA 2G8KA 2FJWA 4DSIA 3LZIA 2WONA 5DLGA 4IH6A 2HNDB 3K2PA 4KHNA 2KTQA 5EWEA 5L1IA 2VG6B 1UA0A 4KAZA 1VSJA 2O4GA 3CG7A 2PZSA 3KLVA 1GOBA 1WAFA 3ZCMA 4FJGA 3CJ4A 1WAJA 2IM3A 1BIZA 1TK5A 4WXOA 1K1SA 5E41A 1OS5A 3CM5A 1RAJA 3NGIA 3RR8A 3B6PA 4ID5A 4Z4HA 2YV0X 1QQCA 3DLGA 4QW8A 2QE5A 4DS4A 2BDPA 3M8QA 2J6TA 4RNFA 4CHQA 4YNQA 3KOAA 2EHGA 4O4RA 3DLRA 5HLFB 4K8ZA 3H59A 3ZT0A 1CXUA 4FS1A 3LPUA 2HHWA 3NAHA 2X74A 5KFWA 3ZSYA 4W5RA 4FW1A 1TV6B 2Q3SA 3QEXA 5KFJA 2BRLA 3CFRA 3PR5B 1RTHB 1IKWA 1RT6A 3LDSA 5CYMB 3UR0A 2V9WA 3MF5A 3GIMA 3FQLA 4NLTA 1ASUA 3TQ1A 3U3GA 3HJFA
chains in the Genus database with same CATH superfamily
1N6QB 3LAMA 2HBYB 1G99A 1S1UB 1HBUB 1WUUA 3LALA 4ANEA 4GKJK 1SCJB 3HK2A 3VGTA 3NHGA 4H5VA 5KT5A 1WDTA 4ECZA 2KFYA 4RW8A 1RWVB 1NU0A 2J8AA 4CZHA 4FKYA 1IKYB 1YTUA 3SUQA 4J2BA 3Q89A 2LXIA 4QWBA 3D6TB 4DL7A 2W4CA 4RW7A 4LR7A 3GWCA 4ICLA 1CEZA 2F4VK 3SQ2A 5A8RA 4JRQA 4CRJA 4JEPA 3VTHA 4O3SA 3SUNA 1HW9A 2I38A 4CLYA 4B9LA 1TQLA 1TFWA 3GZ7A 4FDFA 4B3TJ 1FFGB 2F7VA 2QZ8A 1T9VA 2W4DA 1KWMA 2VPXB 5D3GA 3OJUA 1ATSA 1YRTA 4I68A 4QR2A 1ZAXA 2J0SD 1FDDA 4LF7K 3O3GA 2EW9A 4FPRA 1SJ3P 4CJTA 3FKBA 1UVMA 1K1QA 3PJWA 4NLCA 1XI1A 4LFCJ 3QT7A 2Z0GA 3OR2B 2O5DA 4P2MA 4CDIA 2WB4A 2OPRB 4EYIB 3SPYA 3AB4B 4K0KK 1VLYA 1WF1A 3VN5A 3HHKA 3IG1A 4KHWA 2CGKA 1N5SA 1ZTTA 4W5TA 1J2VA 5F0XA 1YI2S 1BI4A 1XMOK 2RU3A 1Y5IB 2YHWA 1H2TZ 2B56A 4PKGA 5KFQA 1KNZA 3I0SA 3FGUA 3D1OA 4DCPB 2PE8A 4HKQA 5KG5A 2AEFA 5HJXA 3WZ0A 1UEVA 2ZITA 1DTTB 2P9PB 2AD9A 1NGGA 2X3DA 3M8QB 1U8SA 4LSNA 3J7AP 1XUPO 2BE7D 1NGFA 1RACB 3DC2A 3KDOA 2XB2D 3LANA 4NXMF 4ZVSB 4F4XA 1L3SA 1U04A 4K7QA 4KR0B 2CH6A 5KFYA 2EFOA 3QETA 4ZPDA 1OH5A 2CG4A 1SL1A 4JI7F 3AHPA 4DUYJ 3WNGA 3G2XA 4IJAA 1UVKA 3M1FA 1T3VA 3L0QA 1BQNA 1RK8A 4FYWB 3GFZA 2EI5A 5HQMA 1EQYA 4IR1A 3ATUA 3SZ2A 3J80U 2OEJA 2YKQA 2HNYA 3AJDA 1A9NB 2VD3A 3PX4A 4JD2B 2OPPA 2DEIA 4RTFD 5M1KA 4BWJA 4FLUA 4CH0S 5BYQA 1X1PA 1KN6A 1NGEA 2O8DA 3KK3B 2C3PA 5FPEA 2XHBA 4LR9A 2BW2A 4GV3A 4WFAL 5D4OA 3C8YA 1GAOA 2QEXS 2DHAA 4C8ZA 4QS8A 2HEKA 5JMVA 5DS7A 4RW4A 4IRCA 4AUKA 1IKXA 1S1XB 2GUIA 1MSWD 3M30B 1R7IA 5E3PA 4BACA 2HHTA 4DV4J 2ZGZA 1OY9A 4F4AA 4XEIA 4AT1B 4KTQA 4E0DA 4FYVB 2GELA 2B7CB 3RTVA 1I6JA 2IYGA 3GFXA 2G1HA 2AGQA 3WQPA 2V4RA 5F8IA 1WORA 2G0IA 2KHOA 1Q9XA 4HUGA 3NF9A 1SQFA 3MOZA 3M8YA 1YIJN 3KJVB 1K8KA 5HN0A 4FBTA 3HVRA 2ZNZA 3RZAA 1BOTO 3F9KA 3CW2C 1SJQA 3CJAA 2AIRB 2B5JB 4B3MF 5H1SQ 4DCJB 3NP5A 2D0CA 4I0WA 3KLIA 1IV0A 3EYZA 3PFOA 3LW5C 2DHHA 4NX9A 1QTMA 5D0RA 3RMCA 4ES3A 3MN6A 1S7HA 2KYXA 4JS5A 1WSGA 4LT6A 2EWHA 1ASVA 3LPTA 1IQZA 3K59A 1S5JA 4PXDA 3G6XA 3DOKB 1PC5A 5L39A 1ZOTA 3CMAN 1C0FA 3WEEB 2RN2A 2QXLA 1HBNA 3R3LA 1NLVA 4DSKA 3VEZA 1UKUA 1T9XA 3ISND 3Q7BA 3BPSP 1ZXOA 4KSEB 1FJEB 1KHWA 2FY8A 1X9WA 4Z4CA 2HIYA 4L73A 4J2AA 2W2QP 1VQ6S 3O5TB 2AA4A 1ZA2B 3GU0A 2L9WA 4O8UA 2Y1RI 3JQKA 3TUIC 3T1HF 1T7PA 3CDWA 4WYLA 8ATCB 1SKWA 3EEQA 4ZN3A 1TUUA 1TL4A 5AQQA 1EX4A 4FM1A 1T0TV 4L3QA 2ZE2A 1NKCA 4K8RA 1HNVB 2WBNA 2L48A 2CQBA 1VQ7S 4OJ1A 2P9KA 4R0EA 4JI4J 3J7AN 2HBQB 4KGZB 1XERA 3G82B 4J9MA 1EETA 1Y11A 4ZCMA 2AJ0A 3AA8A 2O8EB 3F0NA 4DSEA 2RS2A 3EM1A 2X51A 4YOXA 5FPDA 1RBRA 2YNHA 1YZ6A 1YVUA 3LP3A 3PW4A 2A18A 2LXFA 1VK0A 5AZIA 4CLLA 1KQGB 2FBXA 1JXEA 2VV5A 3QWPA 1M5VC 1QQNA 4WU2A 2ADCA 1KEKA 5M1FA 2ITMA 1YJUA 1U1QA 2JWLA 4LQ3A 5KFAA 2UUAJ 5EDWA 1XNRJ 4E3SA 4KBIA 4K4TA 3TARA 3ID6A 2X1BA 2ZH6A 2DNMA 1UW4A 3AOAA 1SKSA 2JX2A 1FX2A 3BN4A 2E1AA 3ZFVA 4ZPTR 3NGTA 4IOXA 4Z2XA 3ZLJA 4YN3B 1S6PA 1N34K 2P9UA 2IAJA 2UUCJ 4DQRA 2MY7A 4O4GB 4CESA 2LFVA 1VQLN 1B9FA 1S1VB 4EZ9A 2Q66A 2FSJA 2KKZA 4B1WB 4RWXA 5SWMA 3UN2A 4ILGB 4BDPA 4YOVA 4F2SA 3KUGA 1S6OA 2ETJA 4JKBA 1PBUA 2HFNA 5JICA 2KG1A 2LEPA 4MKYA 4XK8C 2PI4A 5HP1B 5HBMA 4ZVEA 3J81O 1UZDA 2K7KA 1S99A 3HP9A 2CDRB 4OQJA 3MR3A 2AJ2A 2JJ4D 2ATQA 2RPIA 4NZ0A 3DJCA 1C1AA 4FL9A 1Q82O 2K7JA 3NLCA 1CJTA 2G8WA 2J7KA 5GAHP 4Y1CA 2HNZB 3PRVA 1IBMK 1WHVA 1U4BA 4O44B 2CJKA 3M05A 3QJLA 5MAOA 2VU5A 2RF2A 3MCAB 4H0XB 3TAMA 3HBTA 3H1VX 2R7XA 2VWJA 2VFVA 1D5AA 3UE2A 1JNZB 2HVDA 3T5KA 5KFCA 2AZ1A 4I2PA 1VQ4N 1VQPS 2X78A 2RKIA 2KH9A 1SXLA 1TL3A 2C3YA 3IUCA 2JSXA 5AE2A 2BUNA 1AZSB 1LWFA 4QYZJ 1R0BG 4LFAK 2GMLA 2E9RX 2ZBCA 1YHQS 4ECTA 1YJNN 1SIWB 4LBHA 3OYAA 2B51A 4DV3K 4JI5F 4F4YA 4FWNA 3HHLC 1M90T 2E5LK 3Q23A 4J9UE 4F0MA 4Q0BA 4FYDA 4P75A 3KK1B 2RH3A 1WTBA 4K8XA 3VWSA 2ASPA 5GMDA 2ZWOA 3P83D 3OD2A 1TYQB 3J7YU 2AYGA 4A61A 3NE6A 5DZ7A 3NAIA 4DR5J 1WNSA 1Y5LB 3LF0A 4J5OA 5J2QA 3ZZOA 4C98A 3FSXA 5BR9A 2GVDA 3MR5A 3UDLA 3HYFA 4ITSA 2ROEA 2WUSA 3MWBA 2VQEK 4Q8EA 4QIVA 1ZBFA 4R0JA 3AJ2A 4GW6A 1FERA 1JB0C 4ETZA 1ZTWA 1F1BB 2ATLA 1RP5A 3ZETA 4OHZA 1F21A 5IT0A 3LA0A 5GAEI 3L9ZA 2ZUAA 4OGCA 2XM3A 1KS2A 2R7TA 2JL9A 1JLBB 1X4BA 4ZITA 2VH7A 4ZJQA 2W7AA 2EK1A 4KGXB 4W90B 2HWTA 4K59A 2DB1A 2UV8A 2E6MA 3E8OA 2E7XA 3GJSB 5L8RC 2DNKA 3I55N 2BRKA 1NJIT 1B9DA 1FRIA 1GH8A 5JVGL 4OX7A 1KQSR 1BCOA 1V9OA 4MAKA 3W63A 1HPMA 3HSCA 2FVCA 5HI7A 1EP4A 1CJKA 1KQSM 1NGCA 5IT4A 4W5OA 1HA1A 3MECB 2WAQD 2APOA 2YBVA 4B9QA 2YH0A 1G2EA 2MKYA 2JHEA 3O4WA 4HDGA 4Y2IA 3T6JA 5C24A 3NS6A 2I0XA 4PEOA 5I3UB 4F50A 2Q97A 2B43A 4B8AB 3KTQA 1ITPA 2EG2A 1N5VA 3GFHA 2EG1A 2F4VJ 2IJFA 2OTLS 2DNNA 1YAGA 3VAJA 2RRNA 3GQCA 2HMIA 1VBKA 2VIHA 4KPYA 2E20A 2E1RA 3V9WA 4RU2A 2R2SA 1U6BA 3P1GA 5TKWA 2ZM6K 3D1HA 4CZJA 3H3NO 3R7SB 2RMLA 1U02A 1XHXA 2XLKA 1HBMB 3KLHB 5BXIA 5J2NA 1ZETA 2OMOA 4YUDA 3SLCA 4KHPK 2K1RA 2R7WA 4RPFA 3OVSA 1TL5A 2MDAA 3W1YC 2RQMA 3SCKE 4ICLB 2P6TA 3CJ9A 4KB0A 3B8AX 4V1Ak 5A8RB 3KWIA 2CJAA 4QU6A 2F8SA 4TLRA 2KM8B 5KFBA 2M52A 3C16B 2UU9K 3M7VA 3LDNA 5AE1A 1W7AA 5KFZA 4EFHA 4TYBA 2PBDA 2JEFA 1JLQB 1BD6A 4Y2MA 2XS2A 1HWIA 5KT7A 1RYRA 4KJIA 3FC9A 2E66A 3J80Y 1VC6A 4FWSA 2YHAA 5KT3A 1RT3B 3SMSA 4JI8F 2YNIA 4ZK7M 2FLPA 2OKQA 4ZHRA 3DRXA 4OHWA 1KHVA 4N76A 4FLYA 3L4QA 3G25A 4DR3F 1E3MA 4CHYA 1SVDA 5F9NA 3U02A 3U1NA 5KFKA 4H4OB 3IG1B 4WP9A 1S72S 4GKKK 3BSNA 3HVAA 2ZDOA 2EC2A 1FWLA 1GQEA 3TI0A 4X4NA 2HMPA 3H5SA 5SZTA 4N8NA 3BR8A 4WFYA 5A2QU 1UJ4A 2FVPA 3OYNA 2QX0A 5KFRA 4HEA9 3PRDA 1VQKS 1LV5A 3CJ0A 1KVCA 4LF6F 4QOZB 3RBEA 4ELTA 3FZ2A 1R0AB 3AO2A 3FFIB 5K8PA 1FW6A 1ZBTA 1U1LA 4OHYA 1U2RA 2VFSA 2ZC4A 1H7XA 4FF4A 2H3GX 4FJIA 3MPVA 2NXCA 2YPZA 3IM8A 2Z2YB 5G4DA 3KHLA 2RRAA 2BZ2A 4LR8A 5DM7L 2QLBB 4OYBA 3SUPA 4BE2A 3AO4A 4OMFG 2Z8QA 2JEIA 2VKRA 3N6MA 4L72B 3BGRB 3C15B 2XY8A 4IOCQ 2MZJA 5AQZA 2IHR1 3TAQA 3KK2B 4E7LA 4FPBA 3BSCA 3TEHB 2MEWA 3EKSA 1X7VA 2DPJA 3BB5A 1CVJA 4CE9A 3PV8A 4WFAQ 2DYAA 2V9KA 3MX2A 1UP1A 1UWBA 4EU0A 3S3NA 2CZ9A 2O8DB 2PC6A 4YR0A 2UUBK 3S3MA 5HATA 2QMXA 1IVZA 4JI2F 1MMNA 3OHAA 3KG1A 3I0RA 4JI0F 2UVUA 1LXNA 2Q31A 2CQCA 1QAXA 1F9EB 1M1KT 2BMBA 1OVQA 3HFKA 3KKRA 2Q1NA 2JWNA 1M1GA 3MD3A 4DU4A 4OX8A 5C7PA 3KUHA 5MLCQ 1OYDA 2BOAA 3H46O 4CK2A 3RMBA 5F0UA 2ALYB 3ELHA 4KE5A 2D5RA 1O13A 5KOXA 5E3QA 3OR1B 4UQGA 1RB0A 3M8RA 3C14A 4YY3F 5HQLA 1BUXA 3HHLD 5IZHA 2KZMA 1RQ0A 1WELA 1K8KB 3LO3A 4HH0A 2DH7A 4RNMA 3KKSA 3BDPA 2QGFB 5M1OA 2OGUA 2Y0SD 1KVBA 2KN4A 4M41A 2CQHA 1Q53A 3M2UB 3EDRB 2W9BA 4CF1A 3AOCA 3FK4A 5DO2A 3CJKA 1ZBIA 2G8IA 1N33K 3HD1A 4OZJA 2BVZA 1XNQK 1OY8A 4R5PA 3DRRA 3OTOF 5F3TA 5JVHQ 4ANDA 4HTIA 2IYIA 1R8AA 3CD6N 1DURA 4OZ0A 5A6PA 2OP5A 4GO7X 1HBNB 1LW2A 2M70A 5C2GA 5JS1A 4J9OA 4EEYA 5H9FK 2E5HA 3OVAA 4B3RJ 3EPGA 4F02A 4OI1A 4IFYA 1T03B 5K14B 3BR9A 3BJYA 3H98A 1U1MA 3OYBA 5AJ3J 3CJ7A 1QDUB 2VBYA 1NK4A 3MCMA 1M5HA 3HPHA 4IOAL 4E7JA 4HLBA 3DNCA 2QL7B 3V4IA 2KRBA 3LGHA 3U27A 2L41A 3BH6B 2XI2A 1FEHA 3P3DA 4EBEA 2DJWA 3VEXA 1NAQA 1JJ4A 1X0FA 2G9OA 4N7TA 3NF6A 4DX8H 2AU0A 2OTJN 4HTLA 4RNOA 1RBAA 4CLWA 3K8WA 1FFWB 1EETB 4ZCKA 4WE1B 2B8PA 4K5SA 4X66F 2UXCK 1BGXT 1YJ7A 2P6SA 4H4MA 4C11B 2YNHB 2XSJB 3VF6A 2FQQB 4F0HA 2XTJP 4DQPA 4X62F 2HHHJ 1VRUA 2XO7A 2IJRA 1TP7A 2XCPA 4RZRA 5M2PA 3ASMA 1FKOA 2CGJA 5EX5A 1Y4ZB 1RWMB 4OGEA 4NA1A 2DISA 3B8HA 2D0BA 3ZSVA 1ZZNA 1KD1T 3FCHA 4FJXA 2OI2A 1D9DA 4KY3A 5FDLA 5ETSA 1N0UA 4MIAA 4RUAA 4B3SK 3VEYA 2R7SA 2YKMB 1DARA 1BMQB 1N4LA 4FN5A 4L74A 4H4KC 3U7JA 4G6VB 1X5PA 1J5OB 1Q18A 3GYXB 5HQ8A 1S22A 2XBPA 2WVDA 4A62A 4JYAK 1QHTA 5KFNA 5LMUF 4OZ2A 3T7ZA 2VG7B 3FJ2A 4GKJF 3BQ2A 2FJVA 2HF4A 5KRTA 3UCUP 1NKEA 4LSLA 2V8DA 1IH7A 1LOUA 2M2BA 3C6UA 2MQLA 1XQIA 4HT7A 1K8AT 3MR7A 2RT3A 5CCMA 5IQ6A 3UVJA 1NDLA 3EVWA 3JYTB 2WVEA 2V67A 3AGKA 5F8JA 5GAEP 2RAQA 2YNFA 1UVIA 3M8SA 2MB0B 2R3VA 4MJKA 4E1NA 2CFXA 4DV2J 4DZDA 3WX8A 2Q36A 5AQRA 2XCAA 1TUYA 2IA6A 1FE4A 3AT1B 3I9V9 5KT2A 4YOEA 2E6LA 3EE8A 3R3TA 3Q2SC 2MYFA 3RMAA 1GMWA 4TNOA 4DPOA 4WQ4C 3ICLA 2QYGA 5AQJA 3G6ES 4LF7F 2HSTA 1GX6A 2OH2A 1NGJA 1WKKA 1T11A 3PHTA 5LXRA 2RF2B 3TAMB 2V7ZA 3Q83A 4CO1A 5L46A 2DFFA 3ZSRA 2XYGB 3O1WA 1NSQA 3D2EA 2W6LA 1XWLA 1R43A 9ATCB 4I2PB 2DXDA 1GLEG 2W01A 3QRPA 4K0KF 1KOOA 3V9ZA 3DOMA 2CJXB 4BE1A 2YWEA 2HQIA 1GXTA 1CQMA 2ZJRL 3OPKA 3GSIA 4J9KA 5AQNA 3ETMA 1QHAA 4MFBB 1NDCA 2E7WA 1XMOF 3BV8A 2BA9A 2GO9A 2XY5A 1EXQA 2OLWA 3OS1A 1REGX 4I6YA 1T05B 3Q8QB 3W3SA 2KT5A 4Q0BB 4FXVA 3P5TL 1PYTA 5FD1A 3BREA 2IFXA 2VQFK 4IFVA 4N47A 4RUBA 2C1EB 3W2VB 3BGUA 4NYFA 1RAFB 2UZAA 4PXCA 4DHVA 3JS9A 4ZVOB 1KQFB 2NRRA 1MMDA 4M3YA 3ZTRA 4BRNA 1NKBA 5J2QB 4OX6A 2V34A 1S1WA 1GLAG 1Q9YA 3H20A 4CGJA 4GC6A 2DTUA 1JWWA 4JV5F 1S9GA 2QLFB 2L08A 3D6RA 1H74A 5KG6A 2D0PA 3MM8B 1RAAB 2IDLA 1N5YA 3MM6B 2XYPB 3R97A 2ZGYA 4KFBA 2VDHA 5AQXA 3M2RA 1IKVA 2I1RA 1S6QA 4YOTA 2W8KA 1RTDA 3V6DB 4X4OA 4AL7A 2HGNA 1XJWB 5KFOA 4X4TA 3P8BB 2KQ2A 4OX9K 1D4XA 4KI6A 2B4OA 4ECYA 2GQQA 5JVGQ 4AILC 2EFNA 2FPHX 3VQ5A 2GZOA 2DHGA 4CO3A 4ECRA 3H7HB 5J2PA 5F8LA 3HHLB 5THWA 2CIMA 1HHTP 4BDYA 3IFRA 1EP4B 1CQNA 1EIYB 1I94K 1KR4A 2DGVA 5CR4A 1YRUA 3LP2A 3BYRA 3J80O 4NYNA 2W2OP 4J8FA 4FCYA 4ED4A 1VQ9N 2H4WB 1HHSA 1AXQA 2F65A 1S5ZA 2YKNB 4OKKA 4JI8J 2GAGC 3IBWA 5AQKA 2OELA 2EXUA 4CM2A 3T1YK 1VJWA 1RGVA 3K2YA 4ZVFA 5HL7L 4RX6A 2JEJA 1YITS 3K9JA 3DRPA 1DTQA 4NLDA 2HMIB 3FVYA 2H1YA 4TKTA 1F2HA 2VODA 4K5RA 3VGSA 3CCLS 4LD0A 2RILA 2NRZA 2F3JA 1LW0A 4M3RA 1PO6A 3O3LA 3RVCA 2OZMA 3CJ1A 4ELVA 5D8HB 2KL8A 3D0IE 2J7WA 4EHUA 4E98A 3WDOA 4W98A 2W2PP 3IFEA 3PKYA 1RAGB 1XR5A 2K1RB 2B4PA 2G1DA 2HNDA 1IBCB 2ZH7A 4G1PA 2LDIA 4LF6J 2G13A 2VG6A 2I8EA 4ZIWA 1YBUA 2BW7A 4XIUA 1JQGA 1YLXA 5M2UA 1RBUA 4IXCA 3T9NA 3HMJG 5BJRA 4UY8T 2AP6A 3KNAA 3DLLL 4Y1DA 1IWGA 4CQ1A 1AFJA 2AF6A 1RFQA 1Z1ZA 1ACMB 2ZH8A 2NXUA 1IR2A 2DO4A 2HW3A 5HLFA 5JLFA 2COLA 3PW5A 2P9CA 2XZDB 1ELOA 2XNRA 1HWKA 3QEVA 4Q2LA 2MLYA 1W2BR 1N32K 1RTHA 4C1NK 2YNIB 4KQZA 3VEVA 3MPDA 1W2BM 3OTBA 4RBUA 3CQYA 3G4SN 3D67A 2HHQA 3TABA 4KI4A 4H5TA 1GMWD 1KC8T 2AP1A 1YJ9S 2YX7A 3S01A 4OI6A 1IBLJ 2I5JB 5M2RA 4ECUA 4U9RA 3I82A 2AX0A 3MCSA 1Z26A 4F26A 1C0UB 1L5UA 4ED2A 2PMWA 4DLEA 1F60B 4IO1A 2E1CA 4ZN1A 2VBXA 4Z94A 2C2NA 4WQ5C 4N56A 1VQNS 3MEEA 2YH1A 2I7NA 2IY5B 4MKVA 3MTJA 3EUNA 1FFSB 4K42A 2E5JA 3E1YA 2YJEA 3QATA 2RSQA 4HT5A 3AV9A 4F25A 1IO2A 5DM7Q 1S4FA 4YOWA 2ZBRA 3D66A 3JSYA 1Y10A 1RI7A 3ID8A 3GV5B 2G2ZA 1VK3A 5BR8K 4C8MA 2RB7A 3PW7A 1CS4B 1IN0A 5E26A 2KRRA 3SQ4A 2KXHA 1X9SA 3NKYA 3TR8A 5GAGI 3LUYA 5GIOA 1E6VA 2FJWA 3CF5Q 5DLGA 1FRMA 1NGIA 4KHNA 2EBEA 4DR4K 5L1IA 2QSWA 2GW8A 2Q79A 4DX6A 1IJEB 3I56N 3CD5A 2HQFA 4M5DA 3CG7A 1VDHA 2ZOGA 2LA4A 1WAFA 3ZCMA 1KP6A 4FWPA 3R5BA 2IM3A 1BIZA 4WXOA 1QY7A 2Y1LB 2V8GA 3S6EA 1D3WA 3W66A 1Z2ZA 2YV0X 1QQCA 2AJ4A 3QJPA 1FRLA 3DLGA 4QW8A 4DS4A 1IBMF 3PJ9A 1N33J 4G65A 2EHGA 3DLRA 5JMNA 2IDEA 2YWFA 3LPUA 2HHWA 2HZCA 1S76D 2X74A 5KFWA 2HBLA 4KGMA 3VALA 3QEXA 2BRLA 2ZH9A 5IQQA 3VZHA 4E2FB 2CQ2A 2QW9A 1RT6A 3LDSA 3UR0A 5DZ6A 2EKYA 3OBIA 3FQLA 3HJFA 4FVUA 4QOTA 3BUZB 3NH1A 2NREA 2A41A 4P2XA 2QA4N 4LFAF 1YJWN 2RHSB 3TVKA 5AQOA 3PX0A 2FLOA 3LM9A 4FOIA 2QL9B 3IR6B 1FVQA 3RJMB 4JK8A 4QW9A 2O8BA 4LH4A 4DV3F 1Q7LB 4KRWA 3NWGA 1H2UX 4X4SA 2E5LF 3MPUB 2XMKA 1QSSA 1SL0A 5J1NA 5EU7A 3EZWA 3CCVS 2IDOA 1Q7YO 3CJKB 4R8UA 1WC0A 1EKRA 2IMWP 4F3TA 3TJ8A 3RW6A 2DIVA 1KSPA 1N36J 5LSRA 4R5PB 2P9NB 3R2CJ 2RHQB 1K9MO 5E3AA 3O6WA 4AFFA 3WIVA 4M5KA 2VUGA 4DV5J 4AM7A 4GVMA 4IG3B 3HSJA 3VGVA 2HBMA 2GIFA 3FZLA 3R27A 3RBXA 4J9LA 1I3AA 4YDXA 3Q0AA 3PM9A 4H54A 3IWNC 1BQXA 4GVLA 4MYUA 1O51A 2JWKA 3IN5A 3NGRA 4LIWA 4KPCA 1HR0K 3OS0A 2D0OA 3QDKA 3I87A 2IS3A 4QAGA 4XPEA 1O1WA 3VETA 4PYDA 4DTPA 2BTFA 4WP3A 3SFUA 3MM5A 1U6ZA 4D3HA 3RUBL 1U47A 3V4IB 2RIJA 5AQPA 2NUUG 2DPNA 4JI1J 2VZ9A 4OV1A 1XQSC 1BA0A 1GLFO 4M5MA 4GVBB 4Q7AA 2WONB 2JH3A 3ZSWA 2FHOB 1LWCA 3M1VA 2ZH1A 2OPQA 1WI8A 3Q8VA 1HHQA 2KI2A 1KAYA 3M4XA 2WC9A 3VOVA 1VBXA 4ES1A 1WI6A 2KVQE 1RSCA 2YQ1A 4FOEA 4AHCA 1JLAA 1FKOB 4DSJA 2ASJA 2P9SB 4CEFA 3MR6A 3U8XA 3MM7A 3K58A 3TSQA 3AVMA 4DDFA 4HI2A 3ENWA 5IV3A 3R9LA 3RB6A 4DV6F 2D7SA 3DXMA 4JUZA 3IBFB 4I1TA 5M1QA 3VAFA 1NOYA 3W3DA 1NNEA 1FDAA 1RDBA 4J9QA 2BABA 5A76A 4RNHA 4HUEA 3L8BA 2ZEJA 2C3OA 3OSNA 3H4DA 2NPFA 2N3OA 5DDRC 3MEKA 4F4ZA 5K20B 2ZM6F 3LAKA 3T5LA 1Q86T 2GWKA 2NRXA 2DPIA 4NASA 5HRPA 4HI1A 1NLKL 4Z4FA 1FXDA 4X65K 7AT1B 4CJWA 4BC9A 5LSOA 2FJDB 3WBZA 3JB9k 4DV0J 1QUVA 4YEAA 3VQ8A 1TZ0A 3UVJB 3OJSA 1HPZB 2ZVIA 3MXHP 3EGWB 1RDWX 4DN0A 3I4HX 3MXJA 3BY5A 4FPAA 3J7ZO 3HFZB 5EN1A 2ASMA 4AQYF 2HK2A 1JJ2R 3CCTA 2RNEA 5AQFA 2YHYA 3M8PA 1TMMA 4Y3CA 3U1MA 4A8QA 2BJ9A 2W1BA 2UU9F 2F96A 4FJLA 3OYIA 1JJ2M 2LSNA 1B0VA 3THPA 1J53A 1NMEB 2F7TA 1F5BA 4HDHA 4JV5J 4LF2A 4DB3A 2IIRA 4FF2A 1N48A 3VQPA 1GLDG 3NVKA 3AVBA 2R8GA 1JLEA 3C3LA 2V4JB 3FRZA 4FNIA 3THWB 2FUG9 4FBUA 1VRTA 4UOHA 3CDAA 4DSLA 4K2JA 2DNYA 3L2RA 3CCUN 1TKXB 1TVRA 4JKFA 2OAUA 2AKWB 2M8HA 1FRHA 2ZJRQ 1W97L 2MKJA 1SJ4P 3ET6A 4ISGA 4GKKF 1SJ1A 3T69A 3KYLA 1UVNA 2JC0A 2HRYA 5LJVA 1FHTA 3GR1A 2B4JA 4HUFA 1NGBA 1Y9OA 2MSTA 4BWMA 2BH1A 2NSBA 2DEJA 1PILA 1TU0B 1EX8A 2LEBA 4JHDB 2Z58B 4MO4A 3NGDA 1K73T 3A3OB 2HWIA 1L3VA 4PUOB 4DR2K 2FLLA 4PCQA 1U0HA 2DK2A 4ISFA 4PKIA 3L3UA 4IO8A 2MZ1A 4A8SA 1CJVB 1R31A 1WUAA 1X3NA 4PR6A 4URSA 1X4DA 4BRIA 5I42B 3QIPA 2FVRA 3D0GE 4JAXA 3TAGA 3N9UC 3DI6A 1HD1A 1MWMA 5KQDA 4MK8A 1UOCA 4DFMA 1S9GB 4FP9A 1VS3A 1SL2A 5CZXA 1CC8A 2Q0RA 1WTFA 1N5YB 3HLUA 3BSOA 3KLGB 1HNXK 3I55S 3P96A 2A5XA 4CI0B 3M2RB 1SV5B 4OFZA 2BQRA 3SUOA 4X64K 4IFEA 3UFCX 1S6QB 2HIQA 3NCPA 1RTDB 2UUBF 4DPTA 5GVQA 3T1YJ 1R59O 1U26A 3A2FA 1VBYA 3B82A 3IRWP 4LF4J 3WT0A 2FSNA 5H9EJ 3VQ9A 3LGMA 1Z05A 3CCQS 3C6AA 3OS2A 5AT1B 3MUMP 2AMCB 2BJ1A 5J2PB 4FYXB 3NH0A 3PIOL 3CJSA 3W64A 3CIPA 4TQRA 4L3NA 5KFPA 4FWMA 3NH2A 4W4MA 4JI3K 5D0HA 4DL5A 2NSCA 3K57A 1EKSA 4F4WA 4CLFA 4DL2A 2ZJQQ 1UFKA 3EJMA 3LP2B 3D45A 3H3OB 2FSKA 2NYIA 1F5CA 5EX3A 5DQGA 3QB0A 1S10A 1VQ5S 4P74A 4LF1A 1VLOA 1DTQB 3CVKA 2LKZA 3JXOA 2W40A 1ATNA 3SV4A 4LF5J 1LAWA 5AQVA 1VQMN 2D69A 3P5JA 1S97A 3NGKA 3KMSA 5FPMA 3LWLA 2JGUA 1NGDA 3S41A 1VYAA 1XNQF 4IKFA 3O6QA 3BDEA 2PI5A 2QT7A 3GYNA 3MR2A 2M0GB 1E6YA 4BRPA 2XMMA 2ZKUA 4DMNA 3TPQA 4KIAA 2BM0A 4AXJA 1GK8A 1B4SA 5GAGP 1WSFA 2J0QD 4NZ7A 2HLTA 3DLLQ 4ZP6A 1E4FT 3EGVA 2ROPA 2YNGA 3PG9A 3VQCA 1S1TA 4JK9A 3CJ3A 5HRNA 4DV1K 1F6TA 4URGA 3F73A 4WWSA 1RDAA 1ZPWX 3THYA 4I7FA 3D2WA 1OO0B 1T9TA 4B3TK 1EWQA 3CCES 4M3TA 3A8IA 3UD4P 2A42A 2LLZA 4LVNP 5CYQB 3N01A 4OYZA 2HS4A 2BQ3A 4DCOB 4BRAA 1RA6A 3R1LA 4LFCK 5LMNF 3V1RA 3KG4A 4ILRA 2W8LA 3SNNA 5DGBA 1P8ZA 4FS2A 5C42B 5CAAA 2F9TA 4C23A 3QNWB 1VCTA 2WK4A 1T8EA 3Q8RB 3CCSS 3PO5A 4BVPA 5BR8J 5K8OA 4ZLNA 3L6QA 4EBDA 4RR5A 3ILIA 4IWVA 2N82B 1DBDA 3JQJA 5A0YA 4DF8A 2QLJB 3MMJA 4B3SF 3ULEA 5LL6d 3AFGA 4WFZA 4O3PA 2H5EA 1W25A 2DRBA 2W41A 2DGWA 1WOPA 1SUQA 3T41A 1UA1A 3DHWC 5KG1A 1OVYA 3PYGA 1UFWA 1OY6A 4JYAF 3TUPA 1HNZJ 4AL5A 1RADB 4CH1A 3DMJB 3MFHA 1WF0A 1R3NA 5BPNA 4PWDB 4H03B 3L2VA 4IO9L 2R7UA 3K0SA 4DPUA 4DUYK 2EKNA 2C2RA 8AT1B 5CE3A 3KJQB 1FJGJ 1WSRA 2Y8YA 3AO5A 2R2UA 4NYPA 3WC2A 4NRUA 4NL5A 3FRYA 2F1FA 3H40A 4B1YB 3G71N 2FBTA 4I6MB 4PWWA 2KLAA 4BR5A 3MCOA 1TK8A 1R27B 1SQKA 3RG6A 2D9PA 4M5NA 1ZBSA 1RT2B 3GYGA 1U25A 1FWPA 1T95A 2A6MA 2FC9A 4U67L 4FK4A 4M5DB 3RRGA 2VJVA 2DIUA 3E01A 3IMQJ 3CMEN 3U3YA 3CC7S 1B7FA 5HMYA 1MU2A 4P52A 3H90A 2VB6A 4C0OC 5LT5A 5CHIA 4DV4K 4H8KA 2K3KA 4YQWA 4JKGA 1VQ8N 1SJRA 3C46A 3FE1A 2ZZTA 1UZHA 4IDKB 1HYZA 3EMTA 3G87A 3NMAA 4KO0B 3GJRB 5EY4A 4CNZA 2AGPA 2HURA 2VPWB 2QWPA 1ZAVA 4ZTFA 3JSMA 3NF8A 3E9OA 4Y0WA 5ETQA 1MLAA 4TU9A 2O8BB 1TL7B 4G1QA 3UW1A 1JL1A 4CEEA 2VHGA 4ZCLA 1WJ9A 4I64A 1TAQA 2R8HA 3HVTB 4R8UB 4V19J 3CCJN 3DGPA 4ES2A 4J7CA 4TXSA 4AHSA 2F4FA 3T3FA 1VSMA 2A6OA 1O8BA 2M4MA 1RKIA 4WFXA 4C1NI 3G86A 2HHUA 1REVA 1QD1A 3OQ2A 3POTA 2MZRA 5F9LA 4OYPA 3C6HA 1CZBA 2P51A 3L09A 1U1KA 4XH4A 4KHQA 1RKJA 2ZH5A 5IT9U 5B0BA 1WD6A 4KH6A 4WBFA 4DV7J 4DR6J 4C0BA 1F3VA 2DNPA 5T41A 1IWAA 2AJFE 3K5NA 4BR4A 1N56A 4W5QA 3SSSA 3RMDA 4CO5A 4BR7A 4JOUA 1FRJA 1PGZA 3AXMA 1RWWB 9RUBA 1PSDA 2O8CA 4CFBA 1YDLA 1Y3JA 2H4YB 1MG7A 2AGOA 4OX9F 2DFEA 3UN5A 4PZVA 1RT5B 1DQAA 2EPIA 4K4VA 4BG9A 1N54B 2FIUA 3M1VB 4JI4K 4OYXA 4NYOA 1S6UA 5FROA 4KH0B 4BE0A 4HTUA 3KVGA 3QRRA 2JLGA 1Q4RA 4J9RA 2LQBA 3C19A 3U1LA 3MUTP 1QE1B 5D77A 1OQ3A 1NB7A 1IUJA 4DX7A 1IJJA 2YWKA 1I94F 3NGZA 1P1LA 3OUYA 2UUWA 2DNLA 3X3UA 3TSUA 3PVXA 1KVAA 3DLHA 3CCMS 2C28A 1TK0A 1URNA 3GJQB 2WOMA 4PG6A 4CFDA 1LKZA 5C10A 2UUAK 1XNRK 3MCPA 5AQSA 4OO1J 1L3KA 4JI6J 2QMWA 4DG1A 1YGYA 2AJQA 3HSDA 4JKEA 4A8KA 2YPYA 4B9VA 4DU3A 1QTNB 2WSFC 1GXUA 5ETOA 3H8YA 4ZDNA 2CQ4A 1BDGA 1WACA 2V69A 3C65A 4CHNA 1D09B 1PC4A 5KFTA 3PYFA 2XMJA 5IM0A 1H98A 2CYYA 3QSYB 2UUCK 3IWLA 1J5EF 4F8RA 3WXIA 1RLDA 2P5OA 3WUHA 4EP5A 2V4QA 2IM0A 3I5AA 1B7YB 2UXDJ 2YX1A 3IAS9 1T3NA 1J9AA 1I1GA 3W65A 4Z4GA 4ED5A 3T9ZA 2CQGA 4QS7A 2C2MB 4ZCIA 3G8TA 3U9ZA 1T94A 1QLNA 2B9EA 1H2VZ 5C15A 1X4AA 1Q95G 2B0GA 3ZSQA 2A6AA 3AVAA 5JUMA 3RRKA 3NL0A 2X7IA 1TV6A 4CBWA 2P9IB 3N6LA 2B4VA 2EVZA 1C0MA 2BBEA 4XAKA 3FZFA 2GQ2A 1VK8A 4AHUA 2OEMA 4LF9J 5G0RA 4WFBQ 3BO4A 3V6HA 1HQUA 3MMCA 4M95A 3MEDA 1IBKJ 3QEIA 2O8FA 1VBZA 1N32F 3NAEA 3GIKA 1W2IA 3I9ZA 2VGMA 5GADU 1XR7A 3L95X 4PXEA 2AYEA 1RBTA 1U2FA 3OYEA 4CZEA 1U2VA 4USHA 2V94A 4P73A 3T1AA 1Q8BA 3O8MA 3H42A 3AA5X 4Q44A 4BC7A 4KHMA 1WSHA 3TX8A 2KW4A 4QYZK 2QM1A 2GJFA 3ZNJ1 1UVJA 4DTUA 2IBOA 4NPOA 3AJ1A 2PD1A 4YOUA 4CIFA 3W2WA 2A2DA 4DTNA 2R7YA 2QWLA 1EZZB 4N8OA 2DGQA 1Q1KA 3QFUA 1SH0A 2HHXA 3ONQA 3KHGA 3V6KA 3DLKA 3ITHB 3AVGA 1OSDA 3TJ9A 3R1XA 4F0KA 2QEXN 4FJHA 2Z56B 3O08A 1Q81O 1KLMA 1RWXB 4Q43A 3SQ1A 4MTPA 2LECA 3DOLA 2DBBA 1MWYA 2K8GA 3BGOP 2CQIA 4U95A 4DR5K 4GV9A 1VIOA 3W5ZA 4YDDB 3DLEA 3EE3A 1MDUB 3AD8C 1YXQA 3W8GA 2MQOA 3AB2B 3CTRA 1H72C 4Z7YA 2R7RA 2BE2A 4KT0C 4LRFA 1H73A 3J7YP 2IM1A 4CJUA 1WOSA 3IR5B 2GQCA 4LH5A 4MLEA 1RT1A 3FZKA 1B99A 1D0EA 2MTLA 3AQPA 1C4AA 1WHYA 3F56A 1CBKA 4DR4F 3MMAA 4BR2A 4CJ3A 2OUGA 5DG9A 2YKOA 4RW6B 3FCVA 2HS0A 3VAKA 1FVSA 3UKUA 4CHPA 3S8SA 2PN6A 3ZZ0A 1HYSB 3O4QA 2H5JB 3DFEA 3EO3A 1VSFA 4EUVA 3PIOQ 1VSHA 4NCGA 1GTHA 4Q8FA 3HRGA 5ETRA 4YB7A 2HK3A 3QGHA 4TSXA 4CEAA 1JL2A 4B1UB 1UCNA 3V1OA 1RHUB 1EAYC 2PDAA 2QLXA 2FF6A 3WNEA 4DF4A 1EQ0A 2QMUB 5HO4A 4JN4A 3RAXA 3MWTA 1U7LA 2GCFA 2JFKA 1BXNA 3AH6A 3ZT2A 2IJNA 1HMVB 3RB3A 1S9EB 3AA4A 4LQ9A 2GWJA 5E7OB 1RHKB 4USVA 3NDKA 1NXIA 2BJ7A 4QJVA 3OFFA 4TLQA 1HQEA 2J9CA 4ZKAA 2F8TA 1FTRA 2YVSA 1I3OB 5BPMA 4DV1J 3MEGB 3LL3A 1NRKA 5D4NA 2DVIA 4DUTA 3ZTPA 3JTOA 3M2VA 2HHPA 3PDNA 1VQ7N 4CF8A 4YB6A 1RDCA 1QQOA 1E6YB 4DEZA 5C12A 3ULHA 3FGVA 2P5VA 2BV3A 3ZZYA 5ADZA 3RB0A 2I6WA 4DTXA 3ZT3A 4U8YA 2ROGA 5F8GA 4KAIA 1HR0F 2ZWHA 4KTZA 4KB7A 5E33A 1X8DA 2QXFA 2YNGB 2ZF5O 3TTDA 1IJFB 1FNXH 2ZQBA 2MGZB 4DTSA 3GBTA 4B8CA 4P9SA 2VL1A 5HOOA 3THYB 4LVOP 4UT4A 1Z25A 1TMJA 2M5YA 4GY2B 3MMVA 3CJ2A 3VQBA 6AT1B 4ZVTB 3DYAB 1PYSB 2C2OB 4CJSA 5CH7B 3BGLA 1HNWJ 2QG9B 1RWUA 2HZAA 1FD2A 4Z4IA 3GCXP 3QBWA 1KFDA 2FF3B 4NWBA 3F5TA 3EKUA 3L2QA 3SCXA 5AZJA 5DMRA 3H0PA 5HROB 5DQIA 3M6UA 2QFJA 3UN3A 3VA3A 2H51B 2WBMA 2PIIA 3AY9A 3OYDA 2ZD1B 1VSKA 3EXYA 3OLAA 2GUPA 4IRKA 4KGKA 2QKBA 3QT8A 4USUA 2ZWPA 1NM2A 3I5BA 1GOAA 4R79A 4CBUA 4LBIA 3FEYB 3CFPA 4IG0A 4EYHB 4DU1A 2DXEA 1FNOA 2N3LA 2VFTA 1VMBA 6FD1A 2CUYA 5ETLA 4WZMA 3SCJE 1KVJA 4NLYA 4ALZA 4YDUA 4OKJA 1FKPA 3FQKA 3G6YA 5LJWA 4JK7A 1PAEX 1VFJA 2MZTA 3BH7B 2Q43A 3A5NC 3QFPA 4CZGA 3F41A 4EFAC 4X65F 3RSEA 2R7OA 1U48A 2RRBA 1YWXA 3NMRA 2UV8G 2M9KA 3ZX2A 1FK9B 3FEZA 1N8RT 1NG9A 5CABA 4FJ7A 2ZOFA 4BROA 2VDIA 3AO1A 4OIXA 1VQPN 3VQQA 3PW2A 3KNGA 3TOQA 4FNHA 2OJ3A 3KDNA 3UPFA 3M32B 1D1UA 1WG1A 2WTFA 5DQHA 1UPPA 2P9LB 2ATCB 3PRBA 1GFWB 1HBOA 3E01B 3W62A 2CVEA 2NZCA 4FWKA 3NS5A 2XYHB 1KXPA 2KHDA 1F9FA 5IT9Y 2ILYA 1RUSA 4JV0A 1RT4A 1JLGA 3KD5E 2RE1A 1X4HA 5E2QA 2QA4G 3ENAA 3BKUA 4YHHJ 3IS9A 1A7GE 4W92B 5IV4A 2XGPA 4JKGB 3W5YA 2HSEB 3M9OB 4HACA 1WC3A 3P4IA 1C1BB 4CO4A 4CYUB 1DGKN 3IRXA 3OYJA 3HX9A 3D7EO 4MIWA 2VWBA 4OZ3A 2PMZD 3AA3A 1HNIA 5J1EA 3JAMY 3KLFA 2FVSA 4YB1P 3UE5A 3PIPL 2OCEA 1T44A 3D2FA 3K5MA 4BRMA 2GGPA 5RUBA 4H0VB 3FBFA 2WB1D 4C4WA 2ZC3A 1HD0A 4QIFA 4G1QB 3TU5A 1K44A 4I2QA 1CULB 1W26A 1YQHA 4PQUA 3DGPB 4RLEA 2NZ4A 3MM9A 4F9OA 4B17A 2QWNA 3FBBA 4UUWA 3MUVP 4WU3A 3G0ZA 2Y9HA 4NLQA 4CEDA 3J7Z5 4YS2A 3TA0A 3ZEUA 2XMWA 3NWRA 4C8KA 3O5BA 1GEHA 3J81U 1V4TA 2PFUA 1EB0A 3GCWP 1V6HA 3V4MA 5J2MB 3AAPA 2DY9A 4B3RK 5CYMA 2W9AA 3RGIA 1JK9B 5AJ3K 3DWLA 4DL6A 4FM0A 1HNXF 1N6QA 3TJAA 3ULDA 1UMJA 1HBUA 1RCOB 1J5EJ 4WFNL 3K5OA 4NA3A 2YWHA 4AF1A 2MZQA 3C7NB 4OPHA 4MLHA 2G8FA 3CSKA 3FZBA 4OLBA 3PSIA 2O8CB 1XK8A 2XSFA 2OTLN 1C0GA 1FXLA 4AL6A 5KFSA 1MROB 1NK5A 1ZZFA 1MN7A 3LPYA 2QA1A 5BREA 1IKYA 4CFCA 2MY8A 4BR0A 1TL1A 3P49B 2FLNA 4E89A 1BWFO 3V81B 2DTJA 5D4PA 1I39A 3MN7A 4A8WA 3QMQA 5LM7E 2HHHK 2VPZB 3OUYB 4DU8A 4JI3F 4G9ZA 1SC4B 1XIQA 2HF3A 3TUJC 1D9FA 4DR7J 5HMWA 3PX6A 2HBJA 2ZUGA 2G0CA 3OFGA 4HHHA 3VAIA 2AQ4A 2WOMB 5E84A 2XHWA 2QTWA 3AGRA 2W9CB 2R9LA 4DUZJ 1OH6A 4CLZA 2B8QA 3UWTA 4M1KA 4O3NA 2QC3A 2DHXA 3MI7X 4E8UA 2OPRA 2OMLA 4N5SA 4WTYA 2MXYA 3UD5A 5IM0B 1LOTB 1AA1B 2FZCB 1T6CA 1VSJA 2O4GA 2KT3A 3KLVA 1Q16B 3OXLA 3CJ4A 1AW0A 1WKLA 3FZMA 3DXSX 1S77D 4Z4HA 2HAFA 3UCZP 2P9PA 2BDPA 3M8QA 2VC0A 4DXLA 5HMZA 1V5IB 3KOAA 2U2FA 4O4RA 4K8ZA 3H59A 3EVOA 2GAHC 1CXUA 4FS1A 3QRQA 3NAHA 5AQGA 4UZCA 4DV2K 4FW1A 1TV6B 3CFRA 1IKWA 3MF5A 4NLTA 4DBQA 3TQ1A 4NXNJ 4B3TF 3UDEA 2LVWA 4DTJA 1VQKN 3QICA 2GVZB 1U1OA 1HQUB 4PAAA 2I9SA 2Z2MA 4F67A 3D0HE 3NBPB 4C3MA 4DQ8A 3IC1A 4QIWD 1EHWA 5ADXH 3CGIA 1VC5A 1XMQJ 4NB4A 1VQON 4LF8J 4B9NA 4DX5A 2WZ1A 3QJJA 4G3IA 4ILHA 5C25B 1EQMA 3HP6A 4FJ5A 4K43A 4LFCF 4QPXA 7FDRA 3M8ZA 2CWXA 5IWAJ 3UNYA 4AE5A 2C2KB 4Y2KA 3ENHA 3CHWA 4HR2A 1TR0A 4FWQA 1LWXA 1QZ5A 1PIEA 4FJJA 1S1XA 3LGNA 3M30A 1UAXA 4LFBJ 1WHWA 2BJ3A 2E2QA 2HS3A 1OWXA 3DLKB 3WQTA 3CD0A 3Q8UA 4JLHA 4B3OA 2IA0A 1XTZA 1KLMB 1BY9A 2XZTB 3CC4S 3IMXA 3SYZA 1RTIB 4J9PA 3DOLB 3VV2B 3SV3A 3QLHB 2Z57B 4BGBA 5CD4H 3VESA 4ZLPA 3KJVA 3DLEB 1BQMB 1RAEB 1CLQA 1VAZA 4DUYF 1B0PA 3BF3A 1HI8A 1MWZA 1RU2A 2E1ZA 2B5JA 3HM8A 2MHNA 4F36A 4DI6A 3CJBA 2J6UA 1RT1B 2GMJA 4ED7A 3R6MA 4OYAA 1N88A 1SC6A 4CHOA 4E1MA 2C22A 1NK0A 3LP1A 2CXEA 2H54B 2HB5A 5JS2A 6FDRA 2AHOB 2XY6A 1O6XA 1GXLA 2VG5A 2MQPA 4DFPA 1HI1A 4LREA 1I51B 3EZUA 2PMHA 1RAHB 3J7A1 3AO3A 4IDHA 3TZWA 3TW0A 1PYOB 1RYSA 3WEEA 3PY8A 1LK5A 4EO8A 4FZXC 1R8CA 2W42A 4BC4A 3PYEA 4CGGA 1Y00A 4NCGB 2CZVC 2HFZA 3W8PA 2MQQA 3A3NB 4DV4F 1RBVA 3SAGA 4L8RB 5B0GA 2KHCA 4ED1A 1M1HA 3BBBA 4RW8B 3CULA 4FXDA 1G3OA 4ATNA 1FEEA 4BCAA 3CD7A 2Y8WA 4FF3A 1GLLO 2M8DB 4TYAA 5KG7A 3VQDA 1HNVA 3R6LB 4IKAA 3ILLA 1LK7A 1NBWA 4JI8K 3QFWA 3QGGA 4FVCA 3A4TA 3G82A 1QVGR 2E44A 3SBMA 4RW7B 2OIHA 1RGIA 2O4IA 4NXMJ 4NCAA 1DAXA 1WHXA 4O55A 2L3MA 1WG4A 4X4PA 2W25A 4JI7J 1AT1B 3D6HB 4CEQA 3B78A 1X3MA 5D3GB 3VQEA 3SI6A 2V63A 1IR1A 3VQTA 3VZIA 1JKHA 2GEMA 4BC5A 4ZOSA 2RS8A 2AYMA 3CE8A 5AR0A 4CO2A 1LEOA 1WOQA 3C0BA 3CPEA 2UXBF 3CCRS 1ASWA 1WSVA 2Q6BA 3WXKA 4LF6K 4O8KA 4M5LA 4U96A 2GHVC 1XR6A 4HYKA 1VSDA 2LU1A 4A46A 3LTOA 5D4LA 4A2AA 2J76E 3A5LC 3K89A 4DFJA 1RAIB 2RE2A 1FF2A 1RE1B 4RO0A 3CT9A 1BI4B 1NHVA 3LZJA 2FB0A 1VHXA 3N28A 1NK9A 4O4GA 2Z1IA 3HZEA 5BYSA 3L7UA 3I0SB 4QCLA 3ZSOA 3EVMA 1S1VA 2RUGA 1WDDA 1YBTA 3HKWA 3UNGC 4CJKA 1NZ8A 1KTQA 2DH9A 1QS4A 2R2TA 3AVKA 2NLWA 2YQ0A 4JI4F 1S79A 2FGOA 3TYTA 4XDDA 4LRAA 4LSNB 2BACA 3H2UB 2CJYB 3Q8PB 3O9RA 5HP1A 1CSJA 2IMOA 2R4FA 2CH5A 3KHHA 4OV6A 5AE3A 4CWBA 1IBLK 1CPZA 3D3CJ 5IT9O 2BKNA 3KXDA 1D9AA 1N52B 4YOYA 4JI0K 5BN9A 3BF1A 3AVCA 3FLCO 3TVZA 2LQ8A 3OVBA 4B3MJ 4FZZA 3P31A 1BQNB 5IC4B 4RCHA 4ZA1A 1C2PA 1GOCA 5JJBA 2MMYA 5BN8A 2UUAF 4USTA 2HNYB 5SUHA 4EIAA 2OPPB 1Q82T 2J6SA 2N7CA 3DRYA 4DKWA 2F9WA 1JX4A 1YTYA 1SC1B 4NEYA 4KREA 3GFYA 3JAMO 3MAHA 1DKGD 3N4PA 2RQ4A 5B0EA 2FHMA 5EOYA 2FHJA 4RW4B 4CJFA 5KGXA 2V0NA 1RA7A 1AZSA 1FKPB 1IKXB 2BJ8A 3N5FA 4CVNE 3G6EN 4OI4A 3THVA 2UUCF 1FA0A 1MW7A 2MJNA 3CQXA 1U2CA 4B1ZA 4IEEA 4I6WA 4ZJOA 4DL3A 4MH8A 5T7LA 2AEMA 3SAHA 1YTAA 3KK1A 2FJAB 3IWXA 3VERA 3OL7A 3T1HJ 2DR8A 1Z6RA 4CZIA 3HVWA 1TYQA 1QSYA 4GNIA 4ZLLA 4CJ5A 1WEZA 1QAJA 1VSIA 2G8HA 1MN9A 2UUTA 3O3FA 1QZ6A 3ZSXA 1JNRB 1HBOB 5KT4A 1NHKL 4L76A 1VQYA 2VFRA 3GE1A 3KG0A 4WTOB 2WRMA 3KLIB 2KZZA 3UI3A 2LEAA 4DQIA 4A8FA 5F0WA 1ZBUA 4EI2A 3S3OA 3I33A 3NS7B 4BRDA 4A4JA 1AFIA 2IVYA 3PZPA 3L2UA 4URQU 2MZSA 3RR7A 3PXGa 5IFMA 1P8GA 4LJMA 2ACYA 4XO0A 1HI0P 3IRXB 1JLBA 5F8MA 2C3MA 2LMIA 3QT6A 2XMUA 1Z4UA 4A5AA 1M5OC 4CIEA 3R8EA 3RW7A 3OLBA 1EKEA 5D78A 2UVVA 3OXGA 1NMNA 2F9JA 2NRTA 3A8YA 1KKHA 2DXFA 3D2FB 1GMVA 3NNAA 3DDNA 4AH9A 2KYZA 2G8UA 1SPBP 3QT5A 4CZFA 1X31C 4K4XA 4I2QB 4DHYA 4DPXA 1NK8A 3UQSA 3OL8A 5KFFA 4PQUB 2WSEC 4O3RA 3DN9A 4X4VA 3AVIA 4OYIA 3IM9A 3MECA 3VAGA 1N36K 3V1QA 2QL5B 5KG3A 1H6KX 2PGCA 4CFAA 1PJ7A 2XQCA 2ZE2B 1H38A 2HBKA 1KFSA 3ZEUB 2P9KB 4L6V3 3BEXA 4HHJA 2WSCC 4DV5K 4DR5F 4BRLA 5ETKA 1E4GT 5I3UA 4PYAA 3HULA 1UTAA 2EC0A 5B09A 3CDUA 5D6GA 1VSLA 2HVEA 3LDOA 5AZIB 3PCOB 5F1XA 4DR1F 1NJYA 1KVIA 2MPUA 3PUFA 2A1SA 1A5WA 1QUPA 5LMUK 3BYPA 1BLUA 4GRSA 3BEGB 1J6ZA 1W0HA 3A5OC 4CLSA 1F3FA 5ETPA 2UP1A 4ZPCA 4JI1K 1HBMA 2GC8A 1YITN 3KLHA 4JV2A 2OA8A 1U1NA 2KDOA 5AXLA 2Q0UA 4C3LA 4FM2A 1TL1B 3CCLN 1HLWA 2EK6A 3ZTOA 4BRFA 5L9XA 1RLCL 3QAEA 3W0LA 2FTRA 4DWIA 1S6PB 3OBYA 1HJOA 2P9UB 3R6GB 2IAJB 5C2DA 3C16A 2IGIA 1OH7A 4YORA 4KHYA 2QN6B 3PW0A 3Q8SB 1APSA 2GX8A 5HVFA 2A40A 1T6DA 1PCAA 4JI5J 3ZZZA 3M6GA 3D7SB 4L3KA 1NWKA 2HFUA 3ZXWA 1S3XA 1JLQA 3ZX3A 1G6BA 2D3O1 4OPAA 4NRTA 5AQUA 1G15A 3CM6A 1JXVA 3HSTB 1RT3A 4Q2MA 4Y2AA 5AQIA 4ZPWR 5HBMB 2ZFHA 4A57A 3ZT4A 2F4VF 4L75A 3WQUA 2OANA 1JJHA 3HJVA 1B70B 2DR7A 2UVRA 3N4QA 3MN5A 1Y0HA 4H4OA 4DCHA 2DCUB 1LXJA 1CJTB 1WC6A 3DDIA 1YBAA 3WIUA 2KG0A 3L7OA 5HK4A 2FHJD 2YHXA 2MLZA 4DV0K 1YJ9N 4CEBA 2FZGB 4KV8A 3C66A 3RU0A 1FRKA 2PFDA 2DRDA 2HYIB 3A8EA 2CZ4A 3IAM9 3TVYA 3HI9A 4CM0A 2RKIB 1R0AA 1P1TA 4EAHD 1TL3B 3GMGA 3FFIA 4JB8B 4D3GA 2X1GA 3H08A 1M90O 3WXJA 2HQCA 1LWFB 4Z0UA 4RBVA 4ECVA 1ZC6A 2JNJA 2J9DA 3EY1A 5K8NA 3G96A 1IKWB 1XHZA 3SBTA 2VYPA 3BKTA 1VQNN 4C8OA 1AB8A 1UPMB 5KT6A 1WEXA 4MYTA 3GPAA 2NPIA 4JV5K 3BGRA 3C15A 4WKRA 4ZIVA 2YCHA 3KK2A 2GHPA 3GJTB 2EWSA 2F9DA 1IG9A 3WC0A 2FXUA 1UVLA 3D3BJ 4IOCL 2BKOA 3C94A 3D6FB 4FW2A 3NOCA 5AXKA 3HDSA 3QIOA 1DRZA 2QV6A 4KHRA 3R5DA 2Y1JA 4RNNA 2CADA 1UJ6A 2GVDB 2K06A 5KG4A 3KZBA 2JOQA 1NNDA 4FJ8A 4ILLA 2BEFA 1O5JA 1TKTA 2O1PA 2E5GA 3RAQA 3AA2A 2BGGA 3ZETB 3BS9A 3VVTA 3EICA 1RCXB 4UF4A 5CZ1A 3NY0A 3PYDA 4B9MA 2HQDA 3TX0A 5C0YA 4B3OB 4KBOA 2LQJA 1NJIO 4PY5A 1FDNA 1IR0A 3CJTA 3OR1A 3CCZA 1OSCA 4I4BA 3DM2A 3SCLE 4PG8A 2NZTA 1D8YA 3MPYA 4CJ4A 1R8HA 3VQ4A 1FXRA 2IOCA 3TRGA 4PKDB 4KTWA 3AD9C 4TY8A 4WXWA 2EX3A 4ZP8A 1YG0A 2CPJA 1CJKB 2Z1JA 4AXIA 3H5YA 3M2UA 3H5XA 2F8MA 2CPIA 3OTDA 4DSFA 1YVFA 4UOFA 2FHKA 2YHBA 3LP1B 2BANA 3B4DA 4ZVHA 4I56A 5KPTA 2VG5B 2EFVA 5C24B 3CO0P 1FKAF 5C5JA 2QJ3A 2X1AA 4CTAA 4ENOA 2UXBJ 1LWEA 4XDCA 4OI3A 5JVHL 5I3PA 3Q86A 3J8AA 4DR3J 3CCVN 2FJXA 4LF4K 4B9UA 5H9EK 3GL1A 3QQCD 1T03A 4C8NA 2GFFA 3R5CA 5K14A 2XHCA 3HXMA 3HT3A 4WCEL 1DZ5A 5FLXU 4ECXA 1ZM2A 3BQ1A 4DOZA 1Y3KA 1ZYQA 2GS8A 3MFIA 5J2NB 4KKOA 5AFUH 2GIRA 5C2CA 5A2QY 3MMBA 2HGMA 2E5IA 3I6PA 3L4BC 4UQTA 4WPAA 3CNQP 3KD1E 5GADI 4WE1A 1OPIA 4CLKA 1KAZA 4XTTA 3LQVA 3BZQA 4H5NA 1FI4A 4C11A 4NZ6A 2XSJA 5DETA 4LF5K 4QWCA 3EGNA 1RABB 4WK3A 2QWQA 5KAKA 2DITA 3CDEA 3WXMB 3ZZRA 5KI6A 2GNKA 1JKHB 5E3CA 3AAQA 3QNNA 4JP8A 2ZH3A 5KFMA 4CK1A 3NRBA 3TEGA 2PO4A 1D8ZA 3GG1A 4O5BA 5T14A 3GG4A 4J2DA 2YKMA 2W7OA 4YB5A 4ZHRB 4J37A 2L9DA 2IVPA 4MKBA 3AVLA 2KU7A 2F40A 4B3RF 1OQ6A 4A2BA 1J5OA 4JI2J 3R7BB 4FZVA 2ZBIA 1RHJB 5AJ3F 4JI0J 1U6FA 2XNQA 5A6WA 2G8VA 2B7BB 3NCIA 4ZS6A 2AX1A 3ZX0A 4E1JA 3SCIE 2VG7A 3CPWR 2IVOA 1PJ5A 1ZBLA 2D3ZA 3TTCA 3V9UA 2N4CA 1V3RA 3MAAA