4Q0BA

Crystal structure of hiv-1 reverse transcriptase in complex with gap-rna/dna and nevirapine
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
555
structure length
555
Chain Sequence
b'VPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTNSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 reverse transcriptase, p66 subunit
publication title Structures of HIV-1 RT-RNA/DNA ternary complexes with dATP and nevirapine reveal conformational flexibility of RNA/DNA: insights into requirements for RNase H cleavage.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase, hydrolase/rna/dna/inhibitor
total genus 142
structure length 555
sequence length 555
chains with identical sequence C
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2014-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4q0bA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4q0bA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4q0bA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4q0bA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4q0bA05
5EU7A 2B6AB 4RNMA 5J2PA 3OYEA 2OPPA 2YKNB 2YKMA 4RW9A 3C94A 2EHGA 4WFXA 2DFHA 4KSEB 1LV5A 2OA8A 1N56A 4DFKA 4CE9A 1BQNB 5I3UA 3QIOA 4F4YA 4PA1A 1RBTA 5SWMA 1VRUA 4F4KA 2FBTA 4XIUA 2BRKA 2HNYA 3MEEB 3ZSZA 3V6DB 4RW7B 1SV5A 2RKIA 4OGCA 4N56A 5DMRA 1I39A 1XR5A 3DOLB 4ZP8A 4CEEA 4I2QA 1VSHA 4AILC 4CJLA 2XWYA 3L2QA 1I6JA 5F8HA 5KGXA 5HROB 2C28A 3BSNA 1WNEA 1FK9B 1IH7A 4F8RA 1RTIB 2JC0A 1C0TA 4OKKA 3HO1A 1W0HA 1NJZA 2HVHA 3H4DA 4M42A 4RU9A 2W8LA 5KT2A 2IMWP 3CDEA 4NLYA 1S6QA 1T94A 2OPRB 1LWCA 5FRMA 5KG2A 5EWGA 1HYZA 4TQRA 4EYIB 1FKPB 3ZSVA 3S3MA 3PVXA 2OPSB 2X74A 4CGFA 1Z25A 2HHVA 1Q9XA 3MXJA 1UAXA 1YTUA 2XY8A 1KCFA 1C2PA 2ATQA 1GX5A 2ZKUA 4ZVEA 4WXWA 3KLVA 5EWEA 3DLBA 3QO9A 1IO2A 3SI6A 3JYTB 3MEGA 2E9ZA 1RTHB 2RF2B 5KFLA 1RBRA 2W9BA 4ECYA 3ZT3A 2FVQA 1JLAA 2FC0A 1VSIA 2NUBA 4K4UA 3AA5X 1L3TA 1TV6A 3NBPA 4M3YA 1S1XB 3DLHA 4DG1B 4KV8B 2IJNA 4DL4A 1VSFA 4O44A 4RNHA 2V4QA 2B43A 4TYAA 1RTJA 1S6PB 3NCIA 1RCHA 1J5OA 3QGGA 1HMVB 5KG0A 5KG6A 4BE0A 4CEBA 1C1BB 4M3RA 1DTQB 1IKXB 1CZ9A 4DQQA 4E7HA 3FQKA 1QS4A 3V1QA 3QLHB 4JRPA 3PW4A 1VSDA 4MK9A 1RDCA 1TKXA 1VSEA 4FJ9A 4J2EA 4H54A 3KHHA 4CHPA 5J2QB 3CQ8A 3SCXA 2FBVA 1S1UA 2ASDA 5KFXA 3M8RA 2IDOA 1JLQB 3O3FA 4AHCA 4KFBB 5KFJA 3AVAA 1RYRA 5F8IA 4NLPA 4ICLA 3P5JA 3OYFA 2XY5A 4E7KA 5DG8A 1MMLA 2Z1IA 2D41A 3QGIA 4CJRA 4J9QA 3MECB 2IM1A 2ITGA 2FLLA 4FLXA 5FDLA 1I3AA 5F9NA 4I9QA 4Z4GA 4FJ8A 1IKVA 3RB6A 4I7FB 5HRRA 4RW6A 4K8XA 3B6PA 3SI8A 1T8EA 1SH0A 3QGHA 3HXMA 4FXDA 4ID5A 4WFZA 2HAIA 4E7LA 4PUOB 4CFBA 3SUPA 4NYNA 1RT5A 3KHLA 3RAQA 4YR2A 1JLCB 4XPEA 1UOCA 3H40A 2P5GA 2YNGA 4J9KA 4ECRA 2JEGA 4TQSA 3LP0B 4G1QA 4IRDA 2YNIB 1O1WA 1XWLA 3K57A 4OKJA 3ITHA 4NRUA 5KGWA 4JS4A 4FBUA 4WE1B 3V4IA 4M3WA 3OL7A 4J9PA 1KFDA 4LQ3A 1HRHA 3NH2A 4CJTA 3HP6A 3HVAA 4BDYA 3N6LA 5KFNA 1GOAA 4IR1A 5KG1A 1C1CA 5I42B 4LQ9A 4K4XA 4BWJA 4EYHB 3AVCA 3TAPA 4J9LA 1LW2A 3DI6B 5L9XA 2WB4A 4BE1A 4K8ZA 3KLGA 3KLFB 3PO4A 4Q8EA 4Z4FA 4ZTJA 3C6UB 4ECVA 4DFMA 1KVBA 3OS1A 5EWFA 3HPHA 4DQPA 5CZ2A 2I1RA 1TVRB 4IG3B 1D1UA 2FJXA 3AVKA 4C8KA 4MFBB 2WHOA 4ECSA 1BIZA 4FJ5A 1RDBA 2G8IA 1TGOA 4Q5VA 2PYLA 1TK0A 2BE2B 3KOAA 2ASJA 4KTQA 5DK5A 2OPQB 1L3SA 1CXUA 3BGRB 1SKSA 5DLFA 3L2UA 4KPYA 1R0AB 3LPUA 1VRTA 4F3OA 1T7PA 3I5AA 2HHQA 4ELVA 4FJMA 4OKEA 2VG7B 3AVLA 3PZPA 4OLAA 3PO5A 2XI2A 4RNNA 1S49A 4GVMA 3SV3A 4DTNA 1S1VB 1C0UB 1RT2A 1B9DA 1D0EA 1BGXT 4CFCA 2B4JA 4NLUA 3DOKA 1HYSB 3CYMA 4CJ4A 1NOYA 5HBMB 3F9KA 4Q44A 1NOZA 4FS2A 4X2BA 2AGOA 5D3GA 4CF8A 1X9SA 5CYQA 3DRPB 3BR9A 3CWJA 4FM1A 3RRGA 3OYDA 2ZQBA 4Y34A 4QWBA 1KTQA 3K58A 1Q9YA 2OYQA 2AQ4A 4ZMMA 3IG1A 3LANA 1HPZA 4IRKA 1UA0A 5FRNA 3SUOA 3GV5B 2KFZA 3BQ1A 4ZVFA 3RAXA 4DF8A 3OHBA 2UVVA 4DEZA 3E01A 1KLMB 5DQIA 5F9LA 4ECZA 3CDWA 2RN2A 4KE5A 3DYAA 2EC0A 2E4LA 4IFYA 3OHAA 4N5SA 2C2RA 1TKZB 2UUWA 3NDKA 3QIPA 1RA7A 4FLTA 4GW6A 3K59A 2IAJB 2IJFA 4W5NA 1X1PA 1ASUA 3RR8A 3RRHA 2DPJA 4Q0BA 2ZD1B 4IFVB 3PHEA 2XY6A 2P51A 1HQEB 4O4GB 3KK2A 3V81A 1IKYA 4E1NA 3NH0A 2VG5A 1QUVA 2WTFA 1NKCA 3NGYA 3LP2B 3MXMA 1U04A 1DLOA 2HMIB 4WFYA 3KJVA 2DY4A 1Z4UA 3VA3A 4M3ZA 3L2WA 4CJWA 1L5UA 3M9NB 4DMNA 1U47A 3NGIA 2HNZB 2ALZA 4JRQA 4NLTA 1N6QA 3C6TA 4YP3A 3CM6A 4ECWA 1JX4A 2R2TA 3RBDA 1RT4B 4AHSA 1WAJA 4J2BA 1TKDA 4Q43A 2R2RA 3ZSQA 3ASMA 1N5YB 3KLEB 5F8GA 3KTQA 1S9FA 1ZBIA 4KO0A 1HQUB 5DGBA 3NHGA 4RW4B 1X9MA 2HNDB 3M8PA 3VQ9A 3PX0A 4CF2A 1WSJA 3HK2A 4KKOB 3SFUA 4Z4IA 4CCHA 2DFFA 2FLNA 1WSGA 4DTUA 4ZPCA 4J9MA 5C24A 3N6NA 4DFPA 3DLEA 1KVCA 3QZ8A 2HW3A 1SUQA 4EP5A 4QWCA 4QAGA 3MFHA 4CHNA 4CGIA 2IOCA 1VSMA 4YQWA 3G10A 3QNNA 1NJWA 4EBDA 4H8KA 4F4XA 3AO2A 2JEIA 3AO5A 3L2VA 5J2PB 2Q3SA 2V0NA 2OPPB 2YKMB 4RW9B 2AGQA 1S48A 5KFQA 3G6YA 3UQSA 3ZSRA 4RUCA 3K5OA 3H2LA 4FCYA 2IGIA 2O4IA 3VQBA 4IH6A 4H4MA 4YFUA 2R8IA 4KTWA 1Q8IA 3EYZA 3QESA 1NKBA 1VRUB 4GC7A 1WLJA 2G8FA 5KG5A 3IGVA 2HNYB 2UUTA 2KZZA 1U09A 1RNHA 3OJUA 1SV5B 2BQ3A 2RKIB 4ZPBA 4M41A 4K50A 3EZUA 4I2QB 4KB7A 2WRMA 3PUFA 5FROA 1RT3A 1QSLA 3QETA 3BJYA 3T3FA 4FJKA 1ZTTA 1K1QA 4W5RA 3OL8A 4DF4A 4C8LA 3DMJA 4FZXC 2XI3A 4DL7A 4ECTA 1C0TB 5HLFA 5L1LA 3CJ4A 3ZSWA 3KKRA 1EETA 5T14A 1S1WA 4K4VA 3NF6A 4J2AA 5J2MA 1SH3A 1S6QB 3CFRA 4CEQA 1ZETA 4FK2A 1LWCB 3NKYA 4YR0A 2FLPA 2KFNA 1JLFA 5JXSA 4ED7A 5KRTA 4AHTA 5DGAA 1NJYA 3K5NA 3GILA 4DSFA 1REVA 3AA3A 5KFDA 5KFZA 4RZRA 3ZT0A 1TKTA 3V6JA 4XPCA 4HUEA 4CJQA 5CYMA 3ISND 3QO9B 1MU2B 1LW0A 4JV1A 3GIJA 3VQ6A 4CEOA 3MEGB 4HUGA 5KT4A 4CF0A 3LWLA 2W9BB 1TL1A 4OPJA 3F73A 1U49A 2D3ZA 1JLAB 2YNFA 3NF7A 2E6LA 1S9GA 1TV6B 2X78A 3NBPB 3MEDA 4WZMA 4NLGA 4J2DA 4FJLA 3TQ1A 4O44B 2CJQA 3G6XA 3D45A 3Q8QB 5E41A 1RTJB 3CVKA 1KVAA 1J5OB 5KFAA 3QIDA 4H4OA 2P1JA 1FKOA 4FJHA 4FLWA 3O4QA 2XCPA 1TKXB 2KQ2A 4ECUA 3SUQA 1B92A 3LWMA 4DL2A 1S1UB 2W9CA 3OYKA 3PW2A 1KLNA 2RDJA 3SUNA 3NF9A 4ICLB 4J9SA 1D8YA 4I9LA 1UWBA 2BQRA 1J54A 5F8MA 1BCMA 2FJWA 2FVCA 1S0NA 4FM0A 4M95A 5FDLB 5KG3A 2YKNA 3KLHA 4FW1A 1IKVB 4Z4EA 1RTDA 4GMJB 2A1SA 1QAJA 4EZ6A 2J6UA 2F96A 4RW6B 1SL1A 2Z1GA 4FBTA 1TL3A 4ID5B 3RWUA 3OLBA 4M45A 4CF1A 3AVGA 2D3UA 3HKWA 4CK2A 2XHBA 1K1SA 1RT5B 2V9WA 4LSNA 2GIQA 3OYBA 1JKHA 1NK4A 3I0SA 2YNGB 4QOZB 3IGNA 4JS5A 4NLDA 4G1QB 1D9FA 2JC1A 2QK9A 1S9EA 3KHGA 2HHTA 3V1RA 5KFCA 3U6FA 4ECXA 4RUAA 3ITHB 2XCAA 1QE1A 3V4IB 3SPYA 4E3SA 2YHBA 4N47A 4QCLA 1C1CB 3ZCMA 4W5TA 2ZE2A 3TI0A 4TN2A 3EZ5A 1LW2B 2G8WA 5JS2A 2J6SA 1LWEB 4JUZA 1LAWA 1EP4A 1JXBA 2IC3A 3ISNC 4ZPDA 1K6YA 4ZHRA 1NK9A 5DLGA 1C6VA 5KTQA 3KLGB 5KFUA 5KT6A 1T03A 4ZVGA 3HSTB 2JEFA 1BI4A 2HVIA 3I8DA 4DLGA 1BQMA 2E9TA 2O5DA 2VA3A 2XRIA 2Z1JA 1DTTA 4FJIA 4J9OA 1XI1A 3LAMA 4FLYA 3GIKA 5KG7A 2XGPA 4ED1A 4C8MA 2FBYA 3QNOA 1WNSA 1QQCA 3TAMA 4DQSA 3DLGA 4PQUB 5CY4A 4BDPA 3AVIA 4DL5A 2GV9A 3VN5A 3HVWA 3PW7A 4CFAA 4O0JA 4RG8A 3OVNA 3UR0A 3A2FA 4B9MA 4NLQA 2JEJA 4DSEA 4B9VA 2ILYA 2FBXA 3I5CA 3KK3A 3O3GA 4O3NA 1VRTB 4DTPA 2W42A 3CG7A 1VSLA 3IRXA 3H5UA 4U7CA 3KK1A 4O0IA 4EP4A 1RT2B 4NLRA 4TXSA 3KD1E 4ED6A 3MR3A 1BCOA 1RT7A 3DOKB 5KG4A 1GX6A 2Z1HA 3M8QA 4M3XA 1JL1A 5KT3A 5L1JA 4O3SA 5KFTA 1IKWA 4K4YA 1ZBHA 3PY8A 4FZZA 2PYJA 5HRSA 3K5LA 1Y97A 4PWDA 1RDAA 1KFSA 2W9AA 5D3GB 4ZPAA 2VA2A 1JXEA 3KMQA 2BRLA 2CKWA 2QKKA 2AJQA 5CYQB 3ZT4A 5KT5A 1LWFB 4JV2A 3O4NA 3HM9A 3L3UA 3D28A 1ASWA 1ASVA 5KFKA 3IG1B 1HPZB 4DTOA 4CHYA 3NGDA 1S5JA 3LP3A 4KREA 5KFPA 3LP1A 3E01B 3OL9A 3DRRA 4CJ3A 3T5JA 2PZSA 1J53A 3DYAB 4IFYB 4CFDA 4FJXA 1A5VA 1U4BA 4TSXA 3QEVA 2G8KA 3H5SA 3QIPB 1Z26A 1S4FA 3VQCA 1J9AA 2GBZA 1KRPA 1NHVA 1FXXA 2R7YA 3MR2A 3KK2B 3V81B 1IKYB 4ZP6A 2VG5B 4IG0A 1L3UA 3RB0A 3BSOA 3MF5A 4CEZA 1DLOB 4KHWA 3MTKA 2WONA 1CZBA 3KNAA 3D5MA 3RMDA 3CJ3A 3S9HA 3HP9A 3P83D 3QZ7A 4DTRA 4DSIA 4CIFA 2EX3A 5HRPA 3VQAA 2FVSA 3C6TB 1N6QB 4DSKA 4U6PA 1RBUA 5JS1A 4CEAA 4HTUA 4R5PA 4M94A 3T5KA 3DM2A 2R8GA 3VQ4A 4M3UA 4FJ7A 3H5XA 4F2RA 4CEFA 2ETJA 4KO0B 4N41A 2XY7A 1XC9A 4ZTFA 3M8PB 4MKAA 4CJ5A 4IKAA 4CK3A 2ASLA 3AVFA 3SYZA 4IR9A 1JLEB 5J1EA 3P1GA 1EKEA 4KI6A 3V9UA 4ED2A 3PX6A 3DLEB 1N48A 3DLKA 1SUQB 2WK4A 4KAIA 2QXFA 3OYAA 3NAHA 3CFPA 5KFYA 4WZQA 2KW4A 2AGPA 1JLBA 1JLGA 4O4RA 4F3TA 4GC6A 2F8SA 2D5RA 4FYDA 2OPQA 3JSMA 3CJ5A 3HVTA 1R0AA 3IS9B 2QKBA 1GOCA 5L1IA 4B3OA 3PW5A 3TABA 4H4MB 3DDKA 4KHQA 4NCAA 2UVUA 3QEPA 5C25A 4OVLA 4PY5A 2WOMA 4ELTA 4HHTA 1B9FA 4CGGA 4NLXA 4FJJA 2F8EX 4EEYA 5EDWA 4CESA 2FJVA 5KI6A 3V6HA 2OZSA 4R0EA 3NAEA 3PX4A 4G3IA 1RT3B 2G8VA 4DWIA 2R8JA 3RB4A 2AU0A 1VSJA 1S1TA 2KZMA 1ZBFA 2UVWA 3PV8A 1SKWA 3AA2A 1VK0A 3OL6A 3AVNA 1ZBUA 4O3RA 2I5JA 2Y1IA 4BWMA 4HCCA 4B9SA 5HLFB 1U45A 4KHYA 3FSIA 1EETB 3V6KA 5F8NA 1S1WB 5KFBA 1WSIA 4RW8A 4YNQA 4F4ZA 3HPGA 5J2MB 2VWJA 4EZ9A 1JL2A 4O3QA 4NCGA 4DL6A 3I0RA 4ECQA 2KTQA 5DG9A 1JLFB 4R8UA 2BGGA 3T1AA 1YT3A 3LZJA 2W7PA 2IM0A 2D0CA 4IKFA 5I3UB 4FW2A 5CZ1A 4NLVA 4KHSA 1TKTB 4C8NA 2IBKA 1CLQA 5CYMB 3VQEA 2FVRA 1LW0B 3OJSA 2D0AA 3V9SA 5KFFA 1ZYQA 4TY8A 3BQ0A 3KD5E 3ZSOA 4YR3A 1TL1B 4E19A 3QEXA 3FFIA 4B9LA 2QV6A 4MIBA 3ICLA 2YNFB 1ITGA 3E51A 4NRTA 3OYNA 1S9GB 2DTUA 3MEDB 3HPOA 1HARA 5L1KA 1JXLA 3RMAA 5KFIA 2VWKA 3Q8SB 4CJVA 3LZIA 4H4OB 4IDKA 3MFIA 1HNVA 1FKOB 4RW4A 3EPGA 2P5OA 1C0MA 3EPIA 4I2PA 4DTXA 3C95A 3QEWA 2PY5A 3H4BA 4MQ3A 5J2NA 2W9CB 1BIUA 3CIZA 3SZ2A 3OSNA 2OH2A 3M8SA 4FLVA 5HRNA 5EUHA 3PR4A 3WNFA 5HP1A 1UWBB 4CJUA 1UA1A 4CJFA 3NF8A 3SPZA 3OYLA 2XC9A 4DSJA 5KFEA 3NH1A 4OGEA 4ZVHA 1ZBLA 4CGHA 3KLHB 3KLIA 1RTDB 3FQLA 4FK4A 4B9UA 2YNHA 3I5BA 1S0MA 4UQGA 4TYBA 1TL3B 3VQDA 1RT6A 4Z0UA 4AHVA 3B6OA 3TANA 3RMCA 1HNIA 3T19A 3OLAA 3GQCA 3OYHA 4E7JA 4LSNB 3RR7A 3RMBA 1JKHB 2HHSA 4LH4A 3I0SB 2BANA 4Y1DA 3LALA 4FZYA 4KB1A 4CEDA 1S9EB 3OYJA 3HHKA 4IRCA 3K2PA 2V4RA 2VG6A 4KHMA 4LSLA 1U48A 3DRSA 1QE1B 3UPFA 5C42A 2B5JA 4URGA 1NK7A 1QSYA 3U3YA 1RDDA 4URSA 3CM5A 5F8LA 5K14A 4WYWA 3IN5A 4KB0A 2ZE2B 2DPIA 2IM2A 1XHXA 3CDUA 1RT1A 3VQSA 1EP4B 2IC3B 1EX4A 1OS5A 4ZHRB 4CJEA 1QTMA 3VQPA 4CGDA 2E9RX 3H08A 1T03B 1RBVA 1T05A 4ED8A 1BI4B 1JIHA 2B6AA 4F4WA 1G15A 4WXOA 1BQMB 4KAZA 3THVA 1W25A 1DTTB 1A5WA 1A5XA 3PJXA 4B9TA 4RNOA 3VQ5A 4CF9A 5JUMA 1BQNA 2C2DA 3TAMB 2J6TA 5KT7A 4J9NA 3DLGB 1IM4A 4WYLA 3KHRA 4XO0A 3SQ2A 3V9XA 3LPTA 4IQXA 3MEEA 1MU2A 3D0PA 3RB3A 3V6DA 4FLZA 4RW7A 1SH2A 1KHWA 4F50A 4FS1A 3KK3B 3V9ZA 4FK0A 2IS3A 4O3OA 4IH7A 4K4SA 3DOLA 1YVUA 3IRXB 2BQUA 2IM3A 3GV7B 3SV4A 3KK1B 5HROA 4EO6A 4EBEA 1QSSA 4AH9A 2IA6A 4RNFA 1NK8A 4KHRA 1SL2A 4AHUA 1FK9A 4KTZA 4K4WA 3KMSA 1RT7B 1BL3A 1WSEA 1RTIA 3M8QB 4BDZA 1IKWB 1F21A 3HT3A 4CERA 4PWDB 3LAKA 3TR8A 1RILA 3VQ8A 3Q8PB 3CFOA 3SQ0A 4K4TA 2OPRA 4J9RA 3GIMA 2JLEA 3AVJA 3LDSA 4KI4A 4E7IA 3MR6A 4E89A 4ZP9A 1FKPA 3TAFA 3M9OB 2OPSA 1NNDA 2GC8A 4FM2A 4DU1A 2HHUA 3LP1B 2R2UA 3PJWA 4MK7A 3DRRB 4JV0A 4CIGA 4ELUA 3HJFA 4Q8FA 5KFVA 2G8HA 4CJKA 3JYTA 4IBNA 4Y2AA 4E1MA 1RTHA 2RF2A 1NK0A 4NLSA 2X6SA 3QERA 1RAJA 1S10A 4IOBA 2F8TA 2YV0X 4IG0B 2LSNA 4JLHA 1S1XA 4B08A 4DG1A 4KV8A 3MXIA 3ZSYA 1S0OA 1S6PA 3SQ1A 2WONB 4F2SA 1HMVA 1C1BA 4KRFA 1DTQA 4QWEA 1IKXA 4URQU 1QAIA 4KHUA 3QLHA 4CGJA 3G6VA 1NKEA 3TAGA 3OYMA 4E0DA 4MIAA 5KFHA 1VSKA 1EXQA 3AV9A 4B8CA 5J2QA 3AO4A 3ZT2A 3V1OA 5KFSA 4R5PB 1ZTWA 4YMEA 3GV8B 1JLQA 3DM2B 2GIRA 3KKSA 4DL3A 4KFBA 1CSJA 1LWEA 1WSHA 3ALYA 2X6NA 3FRZA 1W9HA 3AVBA 3SFGA 2D0BA 2HHXA 4NCBA 4NLWA 4NYZA 3MECA 2RPIA 3CJ0A 2A1RA 5J1EB 3WNGA 4DQRA 5KFMA 4FLUA 3RTVA 2XO7A 4HUFA 4Y2CA 1WAFA 4KBIA 5KFOA 1QHTA 3AA4A 2D7SA 3DLKB 4BE2A 3Q8RB 4I7FA 3EY1A 3L8BA 2W8KA 3DLRA 4W5QA 2ILZA 4QWAA 3S3NA 4Q0BB 2JGUA 1JLBB 4PUOA 4PQUA 1RBSA 1JLGB 4DU4A 2O4GA 2G8UA 4TLRA 3SQ4A 3ZT1A 1RA6A 3JSMB 3G86A 1JLCA 4DTSA 3HVTB 4B9NA 3LP0A 3CJ2A 2R8HA 2YNIA 3KJVB 5KFRA 3PR5B 4HCBA 2GUIA 4B3OB 4IH5A 4DTJA 2YHAA 3ULDA 4WE1A 4QWDA 5C25B 4ED0A 4QW9A 4CECA 2WOMB 3TAQA 4OL8A 4DTMA 5I42A 4FJNA 2BDPA 3DI6A 3H98A 1NK5A 1T3NA 3TWHA 4AHRA 3QYYA 4EBCA 4DQIA 2C2EA 3U3GA 3UDLA 3V9WA 3KLFA 3TARA 1C1AA 4CHQA 4Q45A 1S1TB 1LWFA 1KHVA 3C6UA 4EO8A 5C24B 2I5JB 1TVRA 2DFEA 4IG3A 1D5AA 4Y3CA 4MFBA 3K5MA 3MR5A 2Y1JA 1BISA 1TAQA 3VQ7A 4RW8B 1YTAA 2BE2A 4ID1A 5DG7A 4B8AB 4NCGB 1GOBA 3VA0A 3I0RB 3HYFA 3NMAA 3BGRA 1D9DA 4R8UB 1NK6A 4K4ZA 1N4LA 1TQLA 3KIOA 4NYFA 3NL0A 1TK5A 2VG7A 5KFGA 3OS2A 4Z4CA 1KSPA 3HVRA 5F8JA 2R2SA 1S1VA 1C0UA 3H59A 3T5HA 3SNNA 4O5BA 4DSLA 4TY8B 1HYSA 4TY9A 4ED3A 3AO1A 4BACA 5HBMA 3L2RA 3FFIB 1NHUA 4QW8A 3GYNA 3NAIA 1LAVA 4Z4HA 3DRPA 3UIQA 3OY9A 1YVFA 4NLOA 5DQHA 1L3VA 2HHWA 2ATLA 4DLEA 3DMJB 3BSCA 4HVJA 1TAUA 3QINA 4IDKB 1HNVB 4CHOA 2HWHA 3IAYA 2E6MA 3OYCA 3OYGA 4ZP7A 5KFWA 3CO9A 4NZ0A 1KLMA 4I2PB 5SZTA 3NGZA 1TK8A 1JLEA 4Y1CA 3O3HA 2XGQA 5J2NB 2AX0A 5KRSA 2R8KA 1XHZA 4DU3A 4DFJA 4MK8A 3BSAA 1TKZA 2AX1A 2C22A 4CK1A 3MAQA 4QPXA 3HL8A 3SJJA 2IAJA 3AVHA 2RDIA 4W5OA 3S3OA 5HP1B 2ZD1A 1REVB 4IFVA 1SL0A 1RDRA 3AVMA 1HQEA 3GIIA 4O4GA 2BR0A 1HYVA 3G0ZA 2WCXA 4OJRA 4CJSA 1IG9A 2HB5A 1WN7A 4O3PA 3LP2A 3WNHA 3WNEA 4CIEA 1NJXA 3KLIB 1XR6A 2HWIA 2OZMA 2HMIA 3IS9A 5DQGA 4MKBA 3BREA 4LY7A 3TVKA 3OS0A 1TP7A 2YNHB 3ZSXA 1XR7A 3NFAA 1RT6B 2HNZA 1SKRA 1S97A 4C8OA 2AWZA 3QEIA 4MH8A 4DS4A 1HNIB 4FJGA 2W7OA 3NE6A 4O55A 4LD0A 1RT4A 3PW0A 2BANB 3VQQA 3T5LA 3N6MA 4OPKA 3RBEA 1HJRA 4LH5A 1N5YA 3KLEA 1HQUA 2VG6B 5C5JA 3BDPA 4N76A 2HNDA 4M3TA 4LSLB 3DRSB 2UVRA 4CJPA 4L8RB 4KKOA 5C42B 2B5JB 2QE5A 4KHNA 4DS5A 4CHZA 3TAEA 4HYKA 3OYIA 3M9MB 3FDSA 4FVMA 3L3VA 3H5YA 1BHLA 5K14B 1WSFA 4OLBA 5T7BA 3AO3A 1RT1B 4HKQA 3OSPA 3BQ2A 1X9WA 1RYSA 2FVPA 1T05B 1CXQA
chains in the Genus database with same CATH superfamily
2B6AB 2V94A 5IT4A 4AXIA 3SQOP 4RNMA 3HI9A 2Q2RA 2YKNB 2DR6A 4RW9A 2I7NA 2O8BB 2DFHA 1QTNB 4DFKA 2KXFA 2RQ4A 2FC8A 1XN9A 1GAOA 1AFIA 4WIIA 3MK6A 4KQZA 2HHHK 4KGKA 2HHPA 3BM7A 2HNYA 3CTRA 4RW7B 3Q7CA 1SV5A 4X4PA 3HLUA 1YJRA 3BF3A 5DMRA 1YSJA 3CC4S 5EN1A 4CEEA 4I2QA 1NGBA 1VSHA 1CC8A 2P9IA 1I51B 1JWWA 1IBKF 3DXMA 4DKWA 5HROB 1S59A 2CNNB 1IQZA 5D0EA 4OYIA 4K42A 3D1OA 6FD1A 3NCPA 2WSCC 3G8SA 4F8RA 4ILJA 2QMUB 4IWVA 4WU2A 4OKKA 2Z57B 1ITPA 4BRNA 2PE8A 3FBEA 3HSJA 2HVHA 1MWKA 2I6WA 4M42A 3VF6A 1JJ4A 1S6QA 1U8SA 2PIIA 4AXJA 4OI1A 5KG2A 4JKGA 3F56A 1HYZA 5BYRA 4TQRA 4EYIB 2RRBA 2OPSB 4BR0A 1Z25A 2HHVA 3IMQJ 1KCFA 1C2PA 2ATQA 3GIRA 4DV4K 3SI6A 1CJKB 2ZZMA 4JI4F 4ZDNA 5KFLA 1S6OA 4CLSA 5G0RA 2DNRA 4DR5K 2FVQA 2FC0A 2CQCA 2OCEA 1L3TA 1OYEA 2AP1A 3PIPL 2H5EA 3WZ0A 4JI3J 2IJNA 4YDUA 4RBTA 4RNHA 3V4MA 3BUZB 3T1YK 3ZX0A 3NCIA 1HMVB 4M3RA 2UU9F 1DTQB 3WHIA 1F3VA 3V1QA 3FNNA 4ES3A 5AT1B 1VSDA 4MK9A 2DO0A 3VEOA 1TKXA 3EM1A 2V9KA 1SI9A 1DHMA 5J2QB 1GLLO 2QMXA 3P49B 2CVIA 1YJ9N 1CJVA 3CB4A 2PC6A 3O3FA 2E2OA 4AHCA 3AVAA 5F8IA 2Q31A 1B7YB 3P5JA 2QA2A 2XY5A 3VGKA 5ETSA 5DG8A 4F25A 3L95X 3MCOA 4J9QA 1HR0J 4C1NI 2ITGA 2HBKA 1I3AA 4I9QA 1IKVA 2Y0SD 3MEKA 4RW6A 5A8KB 1IBLK 3EMTA 3SI8A 3HXMA 2O8FA 2C2NA 4CW7B 1RT5A 3JS9A 1JLCB 4LIWA 4JI2F 2VGMA 2RJZA 2H51B 2QLJB 4TQSA 1YI2S 2E5LF 1HHTP 1EZZB 3BPSP 5HVHA 3ITHA 2OELA 2R7TA 2RE1A 3HP6A 5DETA 4U96A 4BDYA 3BF4A 2DRDA 5KFNA 3QRQA 5I42B 2QO3A 3MMBA 3MR7A 4EYHB 2N7YA 4LF8F 4K5RA 1YHQS 3VCDA 2WB4A 3QJPA 4A8YA 1FWLA 3JSYA 4GVBB 4NE9C 2W2PP 4USUA 2V2VA 5LXRA 2AIRB 4ECVA 3UWTA 1LKZA 2VJVA 4DFMA 1BDGA 2QWPA 1WG4A 5HSPA 3HPHA 2K1RB 4DPOA 4KPCA 3UNGC 1FX4A 1R27B 1MDUB 3HTVA 1O8BA 5DZ7A 3HHLD 1RI7A 4ECSA 1VQLS 3OBIA 4G9ZA 4CZHA 1RDBA 4ZKAA 4DZ6A 1H1VA 3HHLB 4AUKA 2QWOA 2BE2B 2W4CA 4KGVB 4YN3B 5BRDA 2XNQA 3TA0A 1VC0A 1L3SA 4IFEA 3BGRB 2QWMA 5G4DA 2ZH8A 4C11B 2L9NA 3LPUA 4CZJA 2RT3A 1T7PA 4L6V3 2HHQA 4JOUA 4I6MB 3RBXA 4FJMA 2XI2A 1S49A 2XTJP 4GVMA 2R7SA 4DTNA 4U7BA 3S41A 1AXQA 3QAEA 3R5GA 1VQPS 5J1NA 1HYSB 2F9TA 2ZOMA 1SBRA 3G82B 3W5ZA 2NXNA 3Q89A 2D0OA 3EWGA 5D3GA 2AKWB 2PO4A 2EVZA 5A8RB 1X9SA 2ZQBA 3C7NB 3R8YA 4QWBA 3US5A 3LDPA 2BUNA 1GLCG 3IG1A 1M0SA 1UA0A 1ZA2B 3AXKA 1BG3A 2Z2LA 3QWPA 1KLMB 3NRBA 4DV0F 3CDWA 2LKZA 4PXCA 3DYAA 2EC0A 4CO1A 1T02A 4N5SA 4CI6A 1F5AA 3OUYA 2GAGC 2FY8A 1RA7A 4GW6A 4CP5A 5E0OA 1I94K 4I68A 2YHYA 2ZD1B 3PHEA 2FSJA 3KK2A 2OTLN 1QUVA 2BACA 2ZH1A 3LP2B 3GG4A 4AM7A 4FWSA 3QFWA 4BQZA 2DY4A 2E1RA 2RD5C 2WVBA 4G6VB 1L5UA 2ALZA 3BDEA 3BZQA 3BGFA 2KG0A 3AFGA 4ECWA 2R2TA 2K3KA 2AJ0A 2HLTA 3EZOA 1Q8KA 3MD1A 2R2RA 4BG8A 1N5YB 3GR1A 3O4WA 3NHGA 1X9MA 2L9DA 2GJ2A 4WWSA 4KKOB 2EPIA 2DFFA 2FLNA 2A0FB 2Q97A 4ZPVR 3MWBA 2R4FA 5C24A 4DFPA 2HSEB 1WDDA 1FJEB 1QVFR 4NEYA 3QZ8A 5CH7B 3M1FA 4MDAA 1HNWK 2C2MB 3OR2B 5DDOC 3J7YU 1RWWB 3OV7A 1HPMA 2ZGZA 5HL7Q 4CHNA 1S22A 5IV3A 4LF4F 3G10A 3QNNA 1VQ9N 1NJWA 3LDLA 4QOTA 2W7AA 4F4XA 3DKDA 3AO2A 2B7CB 1URNA 3G71N 3AO5A 1HBOB 1S48A 1MG7A 3D0IE 3UQSA 3EKUA 4RUCA 2Q0RA 5AQGA 5C10A 4C1NK 2FHKA 1NM1A 2DNHA 3VQBA 1Q8IA 4C9DA 5HVFA 3HI0A 1NKBA 3VF0B 1VRUB 1WLJA 2G8FA 5GMKa 4LBHA 5JJBA 4FWLA 4ZPBA 4M8LA 2DR5A 1P1TA 2IVMA 2WRMA 4F0KA 3QDKA 1TMJA 3QETA 4I69A 4I64A 4BRMA 3OFFA 1ZTTA 4FYYB 3OL8A 3RRKA 3JSBA 4FZXC 2XI3A 1SIWB 2MKYA 3HHDA 8AT1B 1BD6A 2DEIA 4C3LA 5TKWA 4M5DA 5ITHA 3ZSWA 4YEAA 1S1WA 3AJ2A 4K4VA 1TELA 5AQKA 4CEQA 2YX7A 3MAHA 3NOGA 5IT9O 3AAWB 4P6QA 4FK2A 1LWCB 3NKYA 4OZ1A 3IR5B 2YI1A 1NGCA 5T7LB 3VHQA 2E7WA 2XQCA 2BZ2A 3B8HA 1NJYA 1V3RA 2EC2A 1REVA 2XBPA 5JMVA 4WFNL 4XPCA 4XAKA 1Q81T 1GXUA 1MU2B 2DNLA 1LW0A 4WF9L 4DCPB 2CQBA 3GJRB 2OEJA 3GIJA 3MEGB 5JVGQ 2F5GA 5LSLA 1RK8A 1KQGB 2B3TB 2C3OA 3FLCO 1F3FA 4I0WA 4FKXA 2E6LA 2ZJQQ 2FF3B 1TV6B 1R7IA 4YHHF 2VD3A 4JI5K 4ZK7M 4O44B 1RHUB 3D45A 1J5OB 4DV5J 5KFAA 3QIDA 4H4OA 1WHXA 2P1JA 2M5YA 4CNYA 3CCMN 1OH6A 3L4BC 3O4QA 2XCPA 3QATA 2KQ2A 4PABA 2E1PA 4ECUA 5KPZA 3OFHA 2W9CA 3PW2A 1KLNA 1C4AA 2I8EA 3NF9A 1NHKL 1JJ2M 1SCJB 2HBLA 1UWBA 3AH6A 1J54A 3QBWA 3HKZD 2AJ4A 3MCSA 1BCMA 2FJWA 1F0XA 1RAFB 4FM0A 1HBMB 5KG3A 2YKNA 4FW1A 4ALZA 1N32F 2J6UA 1SL1A 4LFCJ 4LF5K 5M1OA 4K2XA 1T0TV 2OTJN 2VBYA 1TL3A 2MZRA 9ATCB 4CF1A 3AVGA 2FZGB 2XHBA 3QNWB 1ROFA 2GIQA 4BRLA 3CF5Q 2E2PA 1JKHA 1NK4A 2YNGB 4JS5A 3J81O 1D9FA 3AA9A 3D3BJ 2CQ1A 4ECXA 4IOCQ 4A48A 1BWFO 2XNRA 3WEEB 1C1CB 4PQAA 2BMBA 4RUBA 4W5TA 4TN2A 4OJ3A 1NG9A 5JS2A 2J6SA 3OFGA 2IIRA 1HD0A 3ISNC 1NK9A 3D6TB 5DLGA 2QYCA 5KTQA 3T1HJ 1Q0NA 1LOTB 5GAHP 4Y2MA 1T03A 4NI2B 4ZVGA 3O9TA 5JVHL 2V69A 2E9TA 2U2FA 4C2MA 2DRBA 3R7BB 2XRIA 4QR0A 7FD1A 1DTTA 3A0IX 4B3SJ 2FBYA 3MURP 4FOEA 1XMOK 3QNOA 1PAEX 3QBCA 4DQSA 1TL7B 2EFPA 3WXLA 3VN5A 4AQYJ 4RG8A 2P9LA 3A2FA 5C2FA 8ATCB 4DSEA 2XSJB 2ILYA 5HVGA 2Q6BA 3KK3A 3I5CA 1VRTB 4DTPA 2BW2A 1NGDA 2Q79A 3NS6A 4EIAA 4BQLA 3QFPA 1FE0A 2MJUA 4UZCA 1RT2B 4NLRA 5AQJA 3AQOA 3MR3A 2V34A 3GOIA 1BCOA 1WC6A 4MKYA 5KFTA 1YXQA 4FZZA 3GJSB 3K5LA 1KFSA 2W9AA 3ZYYX 2VA2A 4BC5A 5M1KA 5CR4A 2OKQA 4LFBK 2ZOGA 4Y00A 3CCSN 1W2BM 2HK2A 3R1HA 4LC9B 3R9LA 1IWAA 1HPZB 1GLBG 3LDNA 3NGDA 3I55N 3LP1A 3E01B 4NXMJ 1KP6A 3OL9A 3T5JA 3G6EN 1J53A 2WBMA 5LOQA 2AT1B 3ETMA 3QEVA 2KT5A 1J9AA 3L3CA 2GBZA 3EE8A 3LGHA 1RWKB 2KVQE 1NHVA 4F4AA 1IKYB 4JYAF 3R8EA 1RKIA 3TYTA 3G8QA 4ZS6A 1VFJA 3CCZA 4DCOB 3CJAA 3MM5A 1CJTA 3MF5A 4DV3F 1H2TZ 3TP2A 4KHWA 4OIXA 1CZBA 3C14A 2DKOB 4PXBA 4H0OA 3CD6N 3A8IA 3W2WA 4LF7K 3P83D 2GELA 4WYBA 4DTRA 2MKJA 3ZZZA 4CIFA 2D4WA 5HRPA 4KH1B 2FVSA 1N6QB 1VI7A 4RJVA 4KC5A 3MCAB 1RBUA 1YJTA 4CEAA 4R5PA 3R2CJ 4M94A 3MX2A 2Q1LA 4GRSA 3VQ4A 1M5PC 2W6LA 3H1VX 4CEFA 1HW8A 4N41A 2DPNA 1XC9A 3KZBA 3M8PB 3O9QA 3BR8A 3D2EB 4A8FA 1O0PA 1J5EJ 4FF1A 1JLEB 4K5SA 5A6WA 3V9UA 3DLEB 1U1NA 1G99A 1SUQB 2KO1A 2WK4A 5LY3A 4KAIA 4FF4A 4PG8A 5L46A 3CFPA 5KFYA 3R2DJ 4DCHA 1JLBA 4BVPA 1JLGA 5DM6L 1Q7LB 4GC6A 2X3DA 2J7UA 2E2NA 4QU7A 2J9CA 2QKBA 3QJJA 3M30B 5L1IA 3PRVA 4JV5J 1H0HB 3TZZA 2Q43A 4NCAA 4YUDA 1H38A 2B4VA 3QEPA 3ZTRA 3P96A 4J37A 4CO3A 2CJBA 2WOMA 3CC4N 4JD2A 1CBKA 1RAIB 3S6EA 2I38A 4USWA 3UO0A 4UW2A 3N9UC 1RUSA 3V6HA 4DV1F 1RT3B 4BHQA 3CC2S 1FEEA 1VSJA 1ZBFA 1RAAB 3QFUA 3PV8A 3AA2A 3JAMO 1ZBUA 2QTWA 4WFAQ 2XMTA 5GAHI 1U45A 4YB5A 3FSIA 2E1CA 4HACA 1KVJA 4L3NA 5B0FA 1SZ2A 3IKMA 4RW8A 4YNQA 3U1MA 3HPGA 2DRAA 4EZ9A 4M5JA 4WQ5A 3HF5A 4O3QA 4NCGA 2MY8A 2KFYA 4R8UA 2BGGA 4Y2KA 1YT3A 2NRVA 1RU2A 1HKCA 3CSKA 1OO0B 3DOMB 4DQ8A 2FXUA 2VFTA 2Y8YA 4WFBL 2XZTB 4IYQA 4LBIA 4X84A 3IAM9 4C97A 2ZITA 1OY8A 1TKTB 5D0GA 2N7CA 1CLQA 1UAWA 3GBTA 2MQNA 1HHSA 5EX0A 4JKDA 2RAQA 3UD5A 3ZSOA 4MIBA 4FOIA 2RSQA 3E51A 1VQMS 4NRTA 1S9GB 1VHFA 1G4CA 4CM2A 2QT7A 1HARA 5L1KA 1CQNA 1JXLA 5KFIA 5MLCQ 3Q8SB 1R8HA 1NNEA 3BBFA 2X3GA 1Z2ZA 3O5BA 2UXCF 3EPGA 3DGPB 3C95A 3WC0A 4RWTA 2PY5A 1FF2A 4DR6K 4HT7A 3IC1A 3OSNA 2AEJA 1NM2A 4C6AA 1KC8O 4FLVA 3NWRA 1KKHA 1XQSC 3WNFA 3K9JA 1WOOA 4IO1A 3HSCA 4DV2K 5BPMA 4ZITA 2VIHA 1YG0A 3GPAA 1XEZA 4DSJA 4ZVHA 4U7UK 4B1WB 1P8ZA 3RAMA 4DUZK 1RTDB 4DV6J 2C2OB 5HANA 4TYBA 2ADBA 1K73O 1RT6A 3U4LA 3TANA 3RW6A 1C0GA 3E9LA 3GQCA 1HNIA 3T19A 3OLAA 3M6VA 2H5IB 3I8BA 4NXNF 4LH4A 5CCLA 4EK2A 2BANA 1HI1A 4Y1DA 2HQCA 4LRCA 4BBYA 1FJGJ 5IT0A 5D15A 2VG6A 3N4QA 3DRSA 1EB0A 2B5JA 2XB2D 1N34F 4URGA 2JOQA 2E7XA 2J0WA 2D0PA 1YHQN 3MD3A 1RXOB 3SSSA 3CM5A 5F8LA 5K14A 3IN5A 3OTOF 4KB0A 3KG4A 2IM2A 2KHOA 3VQSA 4ZHRB 5IXUA 2JH3A 3UCZP 3ID6A 1OPIA 3OA9A 1GMWD 3IBCB 1WORA 3QT5A 1T05A 5LJ3Y 4CZFA 2QG9B 4F4WA 2WSFC 1T3VA 3WXIA 1BQMB 1Q95G 2KRBA 1KWMA 3THVA 1CZAN 5H9EJ 4GO7X 1CG2A 2BKPA 4DR4K 3MPDA 3TAMB 2ZBPA 1VJQA 5CAAA 3SQ2A 1YLXA 1MU2A 5GADP 3D0PA 1RGVA 1SH2A 2XMAA 4FS1A 2DR9A 1Q8LA 4FK0A 4H0VB 4L3QA 4MLEA 1V6HA 4GKJF 1NGAA 3IRXB 3Q7BA 1RISA 2CH5A 3KK1B 3D0HE 4UY8T 4EBEA 5F3TA 4PG7A 1QSSA 3AY9A 2NSCA 2J9EA 5LSRA 4AHUA 1FK9A 4KTZA 5DJBA 1BL3A 2DCUB 3M8QB 3IWLA 1WF1A 4LRAA 4BDZA 2DGSA 1IKWB 5F0WA 4R25A 4D3HA 3HT3A 4CERA 2KLAA 4PWDB 3LAKA 3CCJS 3EKSA 3A13A 3VQ8A 5HI7A 1JMTA 4X62F 3E9OA 2OPRA 2DJWA 3PIOQ 2A18A 3LA0A 3GIMA 2JLEA 1H74A 5FLXY 5AJ3F 4ZP9A 1FKPA 3CCLS 1DURA 4RCHA 5LJ5Y 2ZUAA 3DLLQ 2GC8A 1KOHA 4I67A 1GMVA 2IA0A 4CIGA 3CMAN 3ZTOA 2P5VA 2HBZB 1LEOA 3K8WA 4ATNA 4E1MA 1RTHA 4NA3A 2RF2A 5BN9A 4NLSA 4BCAA 2IYGA 1RAJA 1S10A 4USHA 1ZH5A 1S1XA 4B08A 4DG1A 4KV8A 1UEUA 3QMLA 1S6PA 3SQ1A 2RQMA 1JCEA 4KRFA 4ES1A 5AZIA 2DNZA 1GLJO 1MWYA 3IBWA 2R7UA 3OYMA 4B8CA 3C6AA 1NLKL 2OLWA 3U1NA 1M5HA 1YGYA 3AO4A 3MCPA 2A2CA 4TLQA 1JLQA 2GIRA 3KKSA 3ADAC 2E1ZA 4KFBA 1WSHA 3ALYA 3GCWP 3FRZA 1XNQK 4DOZA 1SJQA 3ILOA 3O9UA 1OYDA 1NB2A 4UQTA 2D0BA 4OI6A 2YX4A 4TU8A 4JNEA 3MECA 2A1RA 3WNGA 3MN9A 2X51A 4JKEA 2A3JA 4KT0C 3THPA 1RACB 3AA4A 2ZH2A 2VICA 3DLKB 4PG4A 3O2IA 5KQ8A 4C3MA 1EJ7L 3DLRA 1IBMK 2ILZA 1S7IA 4ZVUB 3S3NA 4Q0BB 4PUOA 2P9KB 4LFAK 4JHDB 4OX9F 1FERA 2J9DE 4RUHA 5K8PA 3D68A 3SQ4A 2OP5A 1RA6A 2X1GA 2VQFK 3N01A 1S72N 3HVTB 4YY3J 4I56A 4DU7A 2YNIA 3KJVB 4ZVQB 1MA9B 4IH5A 3PKYA 1U6FA 4DTJA 4DX7A 4LRFA 5C25B 5LXYA 4QW9A 3EE3A 3NGTA 3LPYA 2YPZA 2MQMA 3MMAB 1VK8A 1VRQC 4A57A 1NK5A 2GVDB 4AHRA 3DWLA 3DDNA 3RZAA 1UJ5A 4DQIA 4HR2A 2E5GA 2C2EA 2V50A 3UDLA 3Q23A 1KN6A 2KDOA 2K3IA 4Z37A 2VQEF 1R8AA 3JQJA 1HFEL 1S1TB 3W63A 1P1LA 4QIVA 2QMWA 4N8NA 2I5JB 3R3TA 1D5AA 1HNXK 2JZ5A 1J27A 1BISA 4CLUA 2O3DA 2MLYA 2NRTA 3SBGA 1VQ4N 5DG7A 4B8AB 4CLPA 3THTA 3NMAA 4K4ZA 1N4LA 3FBCA 4DL0C 3KIOA 4BC2A 3R27A 5LMUJ 2UV8G 1N33F 4HLBA 1CC7A 3H46O 4Z4CA 3GE9A 1V3ZA 3HVRA 5GADI 1P90A 2Y3YA 1T11A 2ZM6F 3T5HA 3KHYA 4DSLA 3MAAB 2N3LA 3BKUA 3AO1A 3A3NB 5HBMA 2K06A 3KJFB 4ILLA 1XNRJ 3ZX3A 2E5HA 1NHUA 3HBTA 4JB8B 4O5FA 3UIQA 4NLOA 3O9SA 3AAQA 5GAHU 1L3VA 2V6AA 1S12A 3BEGB 2ZWPA 4OPAA 3QINA 3ZTPA 2NPFA 3IAYA 3R5DA 4C0BA 3OYCA 3OYGA 1O51A 1EAYC 2ACMA 1NSQA 3UN5A 2D1CA 5HAOA 5SZTA 3NGZA 1TK8A 1JLEA 2QM1A 4Y1CA 3RSEB 4Q7AA 2XGQA 2P9NB 1JQGA 2KVIA 4EWTA 2R8KA 3JB9k 1TKZA 2C22A 4LF9F 3MAQA 1QUPA 2MZTA 3SJJA 3HM8A 3NS7B 4W4MA 2NYHA 4LF6J 3HJVA 2DVIA 4IFVA 1UTAA 1HQEA 2FGOA 4O4GA 2WCXA 4CJSA 3C66A 3SSQA 2DH9A 1T9XA 2IPOB 3KJQB 2NRXA 4CIEA 3KLIB 1XR6A 2OZMA 3H7HB 4P71A 2B56A 1U0HA 3TVKA 3OS0A 1XUPO 2G2ZA 2MKSA 3TUPA 1M90O 1YK9A 2Q66A 4C8OA 1VK3A 2W7OA 4DV7K 2HQDA 4OYOA 2LFVA 4JI7J 4ZPTR 2J0QD 3KG0A 5FPEA 4X4QA 4OPKA 4QYRA 2Y0BB 2CVEA 2EBEA 2NZCA 2C42A 1IM6A 4JI6K 1QZ5A 4L8RB 2WW4A 5C42B 2QE5A 4K8RA 4DS5A 2F3JA 3A1YG 1Q1KA 4HYKA 3LL3A 2YPYA 5B8HA 3L3VA 2YTCA 3A8YA 2GV1A 1X9WA 2I7PA 2NCKL 5EU7A 3OTEA 3AGRA 3M2RB 3RVCA 2HF4A 5BR9A 2OPPA 3Q0AA 2YKMA 4TU9A 3C94A 1PSDA 2EHGA 2HFUA 4DN9A 2HURA 3D9BA 1U1OA 1LV5A 4M63C 4BC4A 3KUEA 4F4YA 3FC9A 5SWMA 2L3MA 4P7VA 2ZF5O 2A10A 1M1GA 2BRKA 3MEEB 3V6DB 3D4JA 3VTIA 3WT0A 2PMWA 5BRFA 5IT9U 4N56A 5A6PA 5DM7L 3DOLB 2HK3A 5CCMA 2JJ4D 3VWSA 2PEHA 3VOVA 4J8FA 1I6JA 3CJ1A 3OW2R 1DY3A 1ZBTA 1WNEA 2EI5A 2BM0A 1M1HA 3BKFA 3M32A 2GNKA 1RTIB 3JXOA 2CNKB 1BXNA 1C0TA 3FUYA 3EX7B 1B4SA 3MXHP 2CXEA 1HI8A 3T9NA 3FZBA 4A8KA 1NJZA 3DGPA 3GMGA 4GY2B 4RU9A 2DCLA 4WBFA 5BR8F 1XK8A 4CWBA 3IM9A 5C15A 1KAXA 2UUAK 3P5BP 5FRMA 3G25A 3HX9A 3VZHA 3O08A 3D1HA 3S3MA 5IWAK 1K44A 2LQ5A 1YUWA 4I6WA 2X74A 4CGFA 5A8WA 2J76E 2F63A 2H1YA 1RHKB 3MXJA 3FKBA 1YTUA 2LDIA 3V5RA 1NB7A 2ZKUA 1YJWS 5EWEA 3QO9A 4AT1B 3JYTB 4M5HA 1TUVA 4OFZA 3UFCX 5AQFA 5LSOA 4BRAA 3I32A 4ZVRB 2OANA 1RBRA 2V51B 2CGLA 3ZT3A 4KY3A 1JLAA 4DR7F 4X65F 4K4UA 2QWQA 3NBPA 1R0CB 4FWRA 4OV1A 3DLHA 1VSFA 2B43A 4L74A 3SCLE 1RCHA 4CEBA 1C1BB 1U2RA 3EO3A 1ILYA 3TSQA 1VSEA 3THWA 3KHHA 3M6GA 4OYZA 4GKKF 2FBVA 1I1GA 4EMDA 5KFJA 2L08A 4ICLA 5GAGP 5KPTA 3OXLA 2E66A 1RLCL 2Z1IA 2D41A 4CJRA 1Q7YO 2NXCA 2IM1A 3DRXA 5FDLA 2E8AA 5F9NA 4ZN3A 3RB6A 2M7SA 1H7WA 1KS2A 5HRRA 1AB8A 4K8XA 2E5IA 2WBRA 5HK4A 4ID5A 1PYTA 3CD0A 3ONQA 1RCOB 3SUPA 4J9VA 4A8QA 3A8KA 1LNQA 2V63A 3RAQA 3THYA 4YR2A 1UOCA 3H40A 3KWGA 2YWEA 3JTNA 3VAGA 3LP0B 4G1QA 4IRDA 3ELHA 1O1WA 4PRFA 5ETKA 1XWLA 4DV5K 1URRA 4NRUA 4JS4A 3V4IA 3GYGA 3OL7A 2KXHA 3NH2A 4CJTA 3HVAA 4NB4A 4FPRA 5LM7E 2MQOA 3OVAA 2LQJA 4IR1A 4BWJA 4LQ9A 1S3XA 2DGXA 1FRMA 1YBTA 4OYBA 1D9AA 1QM9A 2HG4A 4J9LA 1UVMA 3DI6B 1HD1A 5L9XA 4JKAA 3OPKA 2NUUG 4K8ZA 3ZFVA 3KLGA 3KLFB 3ILJA 3M4XA 4YOYA 2UXDK 2FJEB 4OZ2A 4Z4FA 3C6UB 3GG0A 3OBWA 1KVBA 2F7VA 3OS1A 5EWFA 1DBDA 2I1RA 1TVRB 2CUYA 2JFKA 3IDHA 2O8EB 1D1UA 2IDLA 4DR2F 3TJAA 1ZS6A 2RUSA 1BIZA 1FRKA 4X66F 1TGOA 2UZAA 2UUBJ 4K0KJ 3HFKA 2HKEA 1QAYA 4X64K 4NLBA 3QMQA 5LMNF 3B4DA 2DIUA 5M2UA 2R7RA 5DLFA 3L2UA 3THXB 2O8DB 4MYTA 2R7OA 4F3OA 3DHWC 3AVLA 3PZPA 1DZ5A 4RNNA 2B8PA 4ED4A 3HOTA 3SV3A 1C0UB 4CFCA 4DUYK 2EG1A 2AEMA 4NLUA 1UW4A 2CQPA 2H48B 3VEZA 2ZC4A 4S0MA 4WFNQ 3HZEA 2GWKA 2M2BA 4WF9Q 4X2BA 5GMEA 3EVMA 2GJFA 1SKUB 5CYQA 3GYXB 3P8BB 2O01C 3K0SA 2F4VK 3NMRA 2UXBK 2OYQA 1IQTA 1HBUB 2MQLA 2ATCB 4ZVFA 3RAXA 3CJRA 4ILRA 2WVFA 5F9LA 4ECZA 1NO8A 2RN2A 3QRRA 4KE5A 1KXPA 4IFYA 1OJ4A 3OHAA 4H0TB 5CQGA 3MMCA 4AQYK 2UUWA 3QIPA 4FLTA 3FBFA 3K59A 2IAJB 4GKJJ 1VC6A 2LXIA 3RR8A 2DPJA 3WQTA 5FD1A 4Q0BA 3PRDA 1NAQA 3V81A 4BR5A 1I3OB 3NH0A 3HULA 2VG5A 3S7RA 3NGYA 1UZHA 2GHPA 4F36A 3UDCA 1DLOA 2HMIB 3KJVA 1Z4UA 4M3ZA 3IP0A 3M9NB 2NXEA 1RHMB 2HNZB 1FNXH 4NLTA 3C6TA 2NQPA 4YP3A 2QSFA 4IEEA 4OJGA 1JX4A 1T9VA 2YQ1A 1RT4B 4E8UA 1ZZNA 3ZXWA 1HKBA 4AHSA 1WAJA 1LFPA 2ZBRA 2A41A 3KLEB 5F8GA 5EVZA 2MZJA 4KO0A 1HQUB 4WTYA 3ZZOA 4RW4B 2DHHA 4CF2A 3PYDA 1WSJA 3HK2A 3H3OB 3SFUA 2O67A 1FEHA 1WSGA 1HQ2A 3JQMA 3FZMA 4JI3F 3HSGA 1KVCA 4QWCA 2IVOA 5IM0A 3MFHA 3KXDA 1JCGA 1IBKK 4DX5A 1ESVA 4EBDA 4H8KA 2CWKA 3BBBA 5ETMA 2H54B 4RW9B 3N79A 2RH3A 3JAMU 3ZSRA 4FCYA 2V8PA 2IGIA 2F9WA 4JKHA 5JVHQ 2MB0B 2HRTA 3QESA 2CQHA 4GC7A 2XSFA 2P2CB 2HNYB 5BRHA 1HR0F 1U09A 2CA9A 2GMLA 3OJUA 1SV5B 2R7XA 2BQ3A 4PR6A 2F7TA 3GFHA 3ENHA 4FWOA 4M41A 2CPIA 4H5WA 3EZUA 4I2QB 1E6VA 3PUFA 5FROA 3LQVA 2P9IB 5CE3A 3DXMB 3BJYA 2ZH3A 3I87A 4RLEA 2GEMA 1OSCA 2HFOA 4UOGA 2H5JB 4FJKA 5AQQA 4W5RA 3PLAA 5E5NA 2DNKA 4AM6A 4PKHA 4JI4K 3D6HB 3ZZYA 4L72B 5HLFA 3QAUA 1JB0C 4OI0A 4DR3J 3VMFB 3CJ4A 4PYAA 2XHCA 4Y0WA 5T14A 1IVZA 2O66A 2K7KA 3H6EA 5J2MA 1S6QB 1F9HA 1K0TA 2W40A 4OX6A 2FLPA 1JLFA 4JKGB 2FB0A 3L09A 4X4UA 1VJWA 1WHYA 2UU9K 4CBXA 2B9YA 1VHXA 4DSFA 3N28A 3AA3A 4FPBA 1RWNB 4QS9A 4RZRA 2V4JA 2PI5A 3FCHA 2OI2A 5CYMA 2FPHX 3ISND 3W60A 3R6LB 2XG8A 2ZJRQ 4JV1A 5D0HA 4WK3A 2IYIA 3VGLA 2GWJA 2AJ2A 5KPRA 2RRAA 3LGNA 4OPJA 4A8OA 5G0RB 2ZH5A 1VQ6S 3NF7A 3M2UA 3L4IA 2X78A 3A8EA 1NZAA 3MEDA 2L41A 1YZ7A 4FJLA 2DNNA 2CJQA 3AD9C 3TEHB 1KVAA 2NRRA 3C15A 3ATVA 1FKOA 1IJEB 2W4PA 5GAEP 4U95A 2MLZA 1VIXA 1TKXB 3HZ6A 3CPWM 1IR1A 2O8CA 2HLUA 3IR7B 1CJVB 4OJ1A 3FZLA 3SLCA 4PG5A 3PSFA 3SDEA 2RDJA 4JI2K 1YRTA 1B70B 3AARA 2OO4A 5CHIA 1UCNA 3W65A 2FLOA 5A76A 3W3SA 4J9SA 2E5LK 2XHWA 3DCAA 2CQ4A 3A3PB 3TPQA 1RADB 4N8OA 5F8MA 1CEZA 1TMMA 1LXNA 3BF1A 1N36F 3PCOB 2YBVA 2MXYA 4IOAQ 2BJDA 1EQYA 1IKVB 4KH6A 1RHJB 4EZ6A 4LF8K 4RW6B 5BREA 2KM8C 4CTAA 2Z1GA 1IV0A 2Z2ZA 1NEEA 1OH8A 3RWUA 4HTJA 2O8FB 5FLXO 2D3UA 5F3ZA 1K1SA 1RT5B 3BBCA 4FF3A 4NLCA 2NLXA 2C3UA 3I0SA 2MHEA 3BZKA 1PYSB 3L9ZA 4ZIWA 2XYPB 3KHGA 2VC1A 4DU8A 2HHTA 3ENOA 5DM6Q 3U6FA 3ITHB 2DGWA 3SCJE 4DPYA 4DMZA 1SJ3P 1QE1A 2P8IA 1T9UA 3SPYA 1U8WA 4QCLA 3PSIA 3MMBB 1X5PA 2ZE2A 3EZ5A 3VAHA 1LWEB 4JUZA 1EP4A 2ZDOA 4J5OA 1C6VA 1U25A 5KT6A 2BABA 3MUVP 1WACA 1WOQA 3NG8A 4B3MJ 2BXJA 3I8DA 3T9ZA 4JI1J 2YQ3A 4CH1A 1NZ8A 3LAMA 3ENVA 3CCVS 4J90A 4C8MA 3GIKA 5DDQC 1Y3KA 1WNSA 3DLGA 4CIOA 2XYGB 5LT5A 3GSDA 4BDPA 5CY4A 2HAFA 1RWMB 1N88A 4O23A 3SAGA 3OVNA 3SMSA 3VAJA 2JEJA 3LH2S 4MLHA 1QZ6A 3EXYA 3OT9A 5E3RA 1H73A 1FVSA 3QICA 1UZDA 2FSKA 2DXEA 2VDIA 4TXSA 4DV0K 3KD1E 3ISZA 5KG4A 1RT7A 4LREA 5CYJA 4A59A 4M3XA 1JL1A 4O3SA 1M5KC 1OVYA 4G65A 3PY8A 2ZC3A 4BRPA 1RDAA 5D3GB 2ASYA 2VFUA 4ZPAA 1SC3B 1JXEA 4KHPF 2CKWA 3CCQS 5KT5A 2G1HA 4JV2A 1T6CA 1Q81O 3O4NA 1KQSM 3L3UA 2FUG9 3D28A 3CCTA 4AD6A 2LA4A 3IG1B 1GT8A 3BH7B 4DTOA 2D3O1 3LP3A 2ZH7A 4KREA 4A8SA 3I6PA 4USTA 4F7VA 2RIJA 2ASOA 5C2GA 2AJFE 1S0VA 3DYAB 5K8MA 1FDAA 3OUYB 3TTDA 2GO8A 3SSRA 3IRWP 3EVWA 3MR2A 3KK2B 1YJUA 4ZP6A 3IWXA 3GCXP 3BSOA 1XMQJ 3VAIA 2NR0A 2RHQB 2WONA 3KNAA 3D5MA 3QB0A 2Z2YB 3CJ3A 2JWNA 3S9HA 3CCRN 3QZ7A 1XTZA 4EFHA 4LF4K 9RUBA 3VQAA 2MJNA 1RHQB 1SJFA 1QVGM 2ZBIA 3NXZA 3CEDA 3U9ZA 5AQOA 4M3UA 4FJ7A 5GAEI 2RNEA 3X1LB 3LM2A 3NWGA 1P9QC 4JP8A 3EGWB 2PAVA 2ASLA 1MWZA 4BR9A 3AVFA 3MHYA 3QT6A 1X3MA 3AB4B 5I3PA 2B4UA 1P27B 1EKEA 1TUWA 4GO5X 2KJVA 1VQON 3PX6A 5DRKA 1N48A 2QXFA 3R7SB 3OVSA 2UUCJ 4ZVPB 4HH0A 3HHNB 1OH7A 1H72C 2IVNA 1X7VA 3Q8VA 2XMWA 3FZHA 2LYVA 5EXWA 2D5RA 1RAGB 4YB6A 4RWWA 4HI1A 3RBZA 2XULA 2HQFA 1YJNN 1GOCA 2VBWA 3ENQA 3TABA 1W97L 2HHHJ 1YBAA 5AXMA 5AQZA 2GVZA 4LIRA 3S8SA 2B0GA 4PY5A 4NYOA 2ABYA 3HHLC 2QTDA 3JQKA 2PD1A 3ULEA 2F8EX 4EEYA 5EDWA 1VQ7N 5KI6A 2OZSA 4R0EA 3HD1A 3NAEA 4MJKA 4LFCF 3UI3A 3P6YC 3TUIC 4J9UE 2ZWHA 3SBMA 3E8OA 2PA8D 2KZMA 1FRHA 3A4TA 4DPTA 2UVWA 4OI2A 3AVNA 4LF2A 2E7VA 2FZKB 4O3RA 3WIUA 2Y1IA 5EX3A 1Y5NB 4M5DB 1CPZA 4KHYA 4WJBA 4NA2A 1S1WB 5FPNA 1WSIA 2K7JA 4A4JA 4YHHK 4ECQA 1OSDA 5DG9A 4FO0A 4PZVA 2ZEJA 3T1AA 3LZJA 3U27A 1R31A 4Y6IA 2D0CA 3PEHA 1T3OA 1LFWA 4FW2A 4V1Ak 3T1HF 5CZ1A 3GG1A 4KHSA 4DV4J 7AT1B 2IBKA 4IDHA 3VQEA 3EDQB 4C8ZA 2FVRA 1LW0B 2IIHA 2CJ9A 1KQFB 3OJSA 4FVCA 1FFWB 2FHMA 2QIFA 1V9OA 5GIOA 3BQ0A 2QA4N 4ZJQA 4YR3A 2QYGA 2VU5A 2CYYA 4DR5J 3QEXA 4Q2LA 2QV6A 4B3SF 3ICLA 1ITGA 4ID8A 3OYNA 2BKNA 3ZEUA 4CD1A 3RMAA 4HT5A 3T1YJ 2MDAA 2LDYA 4FKYA 4IO9Q 2HBRB 1A6LA 3LZIA 4H4OB 1N32K 4IDKA 4RW4A 2P5OA 3VF4A 5AQPA 5FPDA 4M1KA 2CZ9A 3H4BA 4MQ3A 5J2NA 2W9CB 1BIUA 2YQ0A 4B3TF 4CO4A 1EARA 4FWKA 2OJ3A 3HFZB 4DHVA 2P9SA 2QLWA 1HX1A 5HRNA 4ITSA 2FZCB 1FD8A 5EUHA 3PR4A 3B54A 4OZJA 1UWBB 4CJUA 1TYQA 1QAXA 2F4FA 4A2BA 2GIFA 1WKLA 4OGEA 2BH1A 2KN4A 3ZZ0A 2Z2MA 1IBLJ 4YB1P 1KEKA 2AZ1A 4PEOA 3UCGA 4FK4A 1TZ0A 3D2WA 2CQ3A 2QX0A 3I5BA 2KYXA 1NGHA 1TL3B 1JCFA 4Z0UA 2E2QA 3B6OA 1RU1A 4NXMF 3A3OB 2Z58B 4CI0B 2IRXA 3RR7A 1JKHB 2VBZA 1FA0A 2JRSA 2DT9A 2HFZA 1T95A 3MMJA 1UJ6A 1WSRA 4LSLA 1U02A 4R79A 1E3MA 1PJ6A 1PBAA 3CNQP 4R0JA 4BRFA 4ENOA 2HSTA 2LXFA 2FIUA 4PG6A 1YIJS 1PIEA 4TNOA 2DPIA 3MCNA 2MKIA 1RT1A 1EX4A 2D74B 4CJEA 1QTMA 3VQPA 4QYZK 2DBBA 1MMDA 4IEIA 1T03B 2DNPA 1RBVA 2YH1A 4ED8A 3J7AN 1FHTA 4WXOA 4ZLJA 3T41A 3OXGA 1DTTB 1A5WA 1A5XA 4B9TA 3UKUA 4RNOA 4CF9A 5AQXA 5JUMA 1BQNA 3Q2SC 4CRJA 1ZPWX 1NBWA 5BYQA 1J5EF 3LPTA 4IQXA 3RB3A 2FHOB 3OHRA 3RU0A 2P9LB 1KHWA 3KK3B 3JSRA 1OMSA 5AZJB 2IVYA 2IS3A 4O3OA 4K4SA 1YVUA 2ALYB 4CBUA 2YWGA 3A5NC 3UDVA 2IM3A 3GV7B 4DV2F 3SV4A 4XEIA 2FJAB 3LO3A 4USIA 1U2FA 1SL2A 4B17A 4DJBA 1WTFA 1WSEA 2KG1A 2XLIA 3UN2A 1GXLA 1YBUA 4ZVSB 1ULRA 2P9GA 1F5BA 1T9WA 4JV5F 4JYAK 3TZWA 3H42A 1RILA 3W7BA 3Q8PB 4K4TA 2A40A 4J9RA 4CZIA 2C3PA 5AQIA 4DV3K 1SS6A 4KI4A 4E89A 2DTJA 2HGMA 3GP9A 3M9OB 3A5LC 2BE7D 2JVOA 3P38A 4DU1A 3LP1B 2CQGA 1Y5IB 1CVJA 2D3OR 4PXEA 3HJFA 3AY0A 1UVJA 5KFVA 3TTFA 3VVTA 1VGYA 2G8HA 2G1DA 1SJ1A 3M6WA 4IBNA 2ROGA 4Y2AA 1I94J 2QRRA 2X6SA 3QERA 2HQ3A 1XBWA 2E29A 2LSNA 1YRUA 4JLHA 1KVIA 2DR7A 3MM5B 1CJTB 4C4WA 2FHJA 4ZPWR 2CH6A 4P75A 3C14B 4HTIA 1WC3A 4DXLA 3W2WB 4QWEA 1IKXA 1LOUA 4LJMA 1KD1T 3QLHA 4CGJA 5A0YA 4CBWA 1NKEA 4FYVB 4WPAA 3GJTB 4MIAA 2ZH6A 1U0SA 2KYZA 3WX4A 3DGVA 4USMA 1CS4A 3ZT2A 5I3QA 4ILMA 4R5PB 4YMEA 1LWEA 2X6NA 1W9HA 4HL9A 3O1WA 1WJ9A 1BUXA 3VALA 1DQAA 2HPUA 3SFGA 1WBBA 2HHXA 4NLWA 1UVIA 2RPIA 3CJ0A 2NRZA 1NDCA 3ENWA 4FLUA 2ZJQL 4Y2CA 1WAFA 4KBIA 5KFOA 1M1KT 1QHTA 4KH5A 1X4BA 3Q8RB 4I7FA 3FMWA 2HRUA 1CLFA 4DV1K 3EY1A 3L8BA 3CXCR 5AQWA 2MZ1A 2MKCA 1U24A 4LR8A 1SC1B 1JLBB 1JLGB 4DU4A 3D6RA 2POKA 4WP8A 2PGCA 4TLRA 3D2FA 5H9FK 2U1AA 4DTSA 2I9SA 2R8HA 4HCBA 4P2FA 1SB6A 2W41A 1HWUA 3HSZA 2KB2A 2DGVA 3N0VA 4CLYA 4WE1A 3J7ZT 4ETXA 4QWDA 3JTPA 3HMJG 1PAUB 4OLOA 2WOMB 3TAQA 2CIMA 4JD2B 2VPXB 1WUAA 1SQFA 4RX6A 4E98A 4QU6A 4CLLA 4FJNA 4EI2A 1W7WA 5E84A 1Z1ZA 4DR1F 4DV6F 1YJ9S 3TWHA 3H90A 4PPZA 3QYYA 1JNRB 5D4LA 3U3GA 1N36J 5F0UA 1F6TA 3TARA 1C1AA 3I4HX 4Q45A 5DM7Q 2HWTA 3JS6A 3P3DA 4ANEA 2XS5A 2DFEA 4IG3A 2QLXA 2QGFB 4M5KA 3ZZRA 3CF5L 4Y3CA 1FJGF 2IVFB 4MFBA 4HACB 4D3GA 4RW8B 1ZAWA 5AFUA 2CDQA 4USJC 3W61A 3AOCA 4NCGB 3VA0A 4UY8O 4R8UB 3S01A 2VHGA 1NK6A 4I1TA 4OZ3A 5D8HB 4NYFA 2XLKA 4LBPA 2HS0A 2UXCK 2VG7A 5KFGA 2BJEA 2DNMA 3F44A 5JMNA 2DHSA 2R2SA 1S1VA 1ZAXA 3H59A 2RRNA 3TEGA 1HNZF 4OYMA 1N5SA 3NGUA 5L8RC 1VQ6N 4ED3A 1Y0HA 4BACA 4JKFA 2AHOB 2LMIA 1WOSA 5EX5A 4J7CA 1NXIA 4JI5J 2XMVA 1YF5L 3DRPA 1ZM2A 4H5NA 5A2QY 3HSDA 5B0CA 3DMJB 1SC4B 1TAUA 4CHOA 5E3AA 2HWHA 1WHVA 3QGPA 2G4BA 3DRYA 1RBLA 2JLFA 4NZ0A 3VGSA 3CCUN 2AX0A 3BYRA 3BO3A 2VWBA 4NXNK 4DFJA 2AX1A 1WC1A 3AVHA 4W5OA 3ILLA 3S3OA 2V8VA 5CHCB 5IV4A 3J80Y 1RDRA 2P9UA 2VJUA 3G0ZA 1N34K 1EKSA 2MEWA 1NU0A 1NJXA 4IZ9A 3OTOK 1ZC6A 2HWIA 4LF5J 4LY7A 1RHRB 1X0FA 1RT6B 2W24A 4KHPJ 3H1QA 1S97A 3GZ7A 3QEIA 1HNIB 3NE6A 2XMKA 2VZ9A 4O55A 3VQQA 2BANB 3N6MA 1HJRA 4LH5A 1HBNA 3ATUA 4FSVA 3MM6A 3DHXA 5C2CA 2BOPA 2VG6B 5C5JA 4UY85 2HNDA 2W01A 3RGIA 1VBXA 1A9NB 3DRSB 2UVRA 1U6BA 2VPZB 2ZGYA 2B5JB 4KHNA 4YOTA 1QQOA 4CHZA 3TAEA 3NEKA 3OYIA 4OLPA 4NA1A 5K14B 1PC5A 2P9PA 2F9DA 1FX2A 3AO3A 4HKQA 3BQ2A 3MM7A 3F41A 4GKJK 1VQNN 5BJRA 5CXTA 2FVPA 4PKIA 3UN3A 1T05B 1CXQA 5AQUA 5BPNA 3HZGA 5AQMA 4OZNA 1T9YA 5J2PA 1OY6A 4QR2A 4P10A 2OTLS 4DI6A 1KBRA 4WFXA 1XMOJ 2OA8A 1N56A 2AA4A 4CE9A 3O3LA 3J8AA 3BKTA 3LF0A 5E3QA 3QIOA 4CYUA 1ZM9A 3PFEA 3P5TL 1RBTA 3PM9A 2MQ8A 3VR1A 4XIUA 2FBTA 4X62K 1EIYB 2FJDB 2RKIA 2QL5B 1DRZA 3DXSX 1RDUA 1CULA 2KI2A 5AJ3K 4B3RK 1FW6A 4U67Q 1CQMA 2HVDA 3PFOA 1YJ7A 3L2QA 3OQ2A 5F8HA 5KGXA 2HEKA 1FK9B 4FWMA 3O9RA 4BGAA 2G0JA 1IR2A 4YY3F 3HO1A 4JEPA 2FSNA 1W0HA 4BRIA 1WDTA 2DH8A 2W8LA 3H25A 2IMWP 3CDEA 3AQPA 2CQIA 5D77A 4NLYA 3WQUA 4LFBJ 2XMUA 2OPRB 4OHWA 2DGOA 1VQ9S 3CD5A 2E44A 1FKPB 3G71S 2OHDA 3ZSVA 1UL3A 3PVXA 4TKTA 1S7HA 1VQ8N 2JVRA 2CJXB 1Q9XA 1ZAVA 3SJHA 3ZNJ1 2XY8A 3Q8UA 3HRGA 2QFIA 4ZVEA 3KLVA 1FRJA 3DLBA 3EJMA 1VQKN 1IO2A 3N5BA 1F2GA 4WCEL 2E9ZA 1P6TA 1RTHB 3Q86A 2RF2B 1AZSA 2BOAA 2G9OA 2W9BA 2CNOB 3CT9A 4ECYA 1SJRA 2CNLB 4WFAL 3AA5X 3CCEN 1F5CA 1VCTA 4M3YA 1VQ5N 1S1XB 2BJ9A 4DG1B 4KV8B 4DL4A 2XM3A 2V8GA 2EKYA 1RTJA 1S6PB 3QGGA 4NOHA 5KG0A 4BE0A 3U1LA 5AZIB 1N54B 1CZ9A 2QXLA 4MMOA 4E7HA 1QS4A 5LMUF 4ANCA 4JRPA 4P52A 1OWXA 1RDCA 5ETOA 2A42A 1FXDA 2QC3A 2LQ8A 4FJ9A 4QIWD 1GEHA 2GGPA 1MSWD 2MGZA 5FLXU 4OX9K 3SCXA 1ZZFA 5SUHA 1S1UA 2ASDA 3GFZA 5KFXA 4W92B 3AXMA 3LDOA 3M8RA 1JLQB 3O8WA 5AR0A 2HQIA 3BYPA 4KFBB 2GTDA 1RYRA 3FCWA 1WG5A 3OYFA 2YCHA 4C0HA 4E7KA 2B8QA 1MMLA 1XNRF 1FXLA 4O8UA 1F60B 3GFYA 3DN9A 3MECB 2FLLA 4FLXA 5D4PA 1ACMB 1YDLA 4Z4GA 3J7YP 2DNQA 1OIAA 2DY1A 4FVUA 2BJ3A 5DDPC 4AL7A 4U8YA 3L7OA 2H4YB 4E2FB 3K0JA 1T8EA 1SH0A 4FXDA 3DAWA 4WFZA 4PUOB 1U1QA 4BRHA 4CFBA 2R7QA 3TOQA 2VQEK 4L75A 2HGLA 4KGMA 3NLCA 3PEJA 4HI2A 4XPEA 3W62A 2OGUA 1LCUA 2P5GA 1VQSA 4J9KA 2JEGA 4F0MA 2YNIB 5AZJA 2BX6A 3QPIA 4OKJA 5KGWA 4FBUA 1R6VA 4LF6F 4M3WA 1HRHA 2YXLA 1GXTA 2QA1A 4B3TJ 3CCMS 5LL6Z 3N6LA 1X8DA 2DISA 1HWLA 4ZA1A 3TUJC 4B1VA 3AVCA 1TU0B 1LW2A 4JK8A 4BE1A 1BU6O 1N33K 5K8OA 2VFVA 2RMLA 4Q8EA 2ZM6K 4HHHA 4JI7F 3EEQA 4B1UB 2X1FA 4USVA 2ROEA 5JLFA 2LVWA 2E1YA 3P31A 2WHOA 4H5TA 4FJ5A 4YS2A 4LVOP 2G8IA 4BR2A 2B7BB 2ASJA 5DK5A 2OTJS 4P9SA 3NNAA 3SAFA 1KDNA 2OPQB 1SKSA 1CXUA 3TA2A 4WIQA 4A8XA 2CPFA 1U1MA 1R0AB 4V19X 2BE9B 5D78A 4ELVA 3KUGA 4OLAA 3PO5A 5HQMA 5DS7A 3H2VE 3FR0A 3O8MA 3C6HA 4CD3A 1D0EA 1BGXT 3IFEA 3SMPA 3DOKA 4LF9K 3CYMA 1FRLA 1NOYA 3R5BA 5HBMB 2DXDA 4K7QA 3GR0A 3MMVA 4B1ZA 1IJJA 4FS2A 3IWNC 2AGOA 4CF8A 4FM1A 1U1KA 3UE5A 3RRGA 4V19J 2XEXA 4Y34A 1R43A 3AAPA 4KJIA 1KTQA 1QVFM 4K25A 3K58A 4RTFD 4QBUA 5H1SV 2CFXA 4CZGA 1KAZA 4X4VA 3SUOA 4CO2A 2ZBQA 4DF8A 4FNIA 2YX1A 2C2KB 2LLZA 2E4LA 3BV8A 5HMZA 1TKZB 2MKKA 2M0GB 3CMEN 2PBDA 3CPEA 4W5NA 1ASUA 2W4DA 2OFHX 3FBBA 4DV2J 1YWXA 2CWXA 3MN5A 4GVEA 3ENAA 4IFVB 2XY6A 3H0PA 2P51A 1HQEB 2VODA 2YWFA 4O4GB 2EFQA 4E1NA 2WTFA 3GU0A 2PFDA 2IBOA 4DUZJ 1U04A 3MN6A 2NYIA 3U7JA 1QHAA 4NYPA 3F5TA 3MN7A 1U0HB 4CJWA 4DMNA 1GH8A 4JRQA 2ZZTA 2ZNYA 3CM6A 1HWKA 4CLKA 1U1RA 3RBDA 3DLLL 4J2BA 4CNZA 2VPWB 3ASMA 1ZBIA 1S9FA 3O5TB 3CCSS 1RSCA 4KGXB 3NGRA 1UFKA 1YQHA 4CCHA 2J9DA 3D66A 3I55S 4ZPCA 4J9MA 3CC7S 5RUBA 3G6ES 2HW3A 4EP5A 3Q83A 3UW1A 2CPJA 2HZCA 2A3ZA 1DKGD 4YQWA 1MW7A 5F1XA 2V2KA 3KKFA 3G87A 3CCWA 3NGKA 5AE1A 2JEIA 3J7YI 3L2VA 2Q3SA 2OPPB 2YKMB 2AGQA 5ETNA 1M5SA 1GLFO 5KFQA 3G6YA 3PDNA 1UP1A 2CDRB 3H2LA 4DR4J 2O4IA 4IH6A 4H4MA 2V68A 2R8IA 4KTWA 3KNGA 4RWXA 2N4DA 1NUEA 5AQHA 2QLFB 2XLJA 5KG5A 5BR8K 3UKRA 3CJ8A 4ANDA 4M5MA 1RNHA 5AE2A 4OHYA 4H0XB 3FJ2A 3SQGA 2GX9A 3OBYA 3L6QA 1QSLA 1Y10A 5ETPA 3G96A 3T3FA 3MPUB 1N52B 3AOBA 2X7IA 2GCFA 5K9FA 4CO0A 1RP5A 1K1QA 1SVDA 3M32B 4LR9A 4M63A 3PRBA 4DF4A 2HFVA 4C8LA 3DMJA 1RKJA 4DL7A 4ECTA 1C0TB 4H5RA 2BTFA 3FGVA 3TX8A 1EETA 3EN9A 1SC6A 4DR7K 4X65K 3TJ8A 2VFSA 1N8RT 4JKCA 3CFRA 3MWTA 3WUHA 2K8GA 3L7UA 2KFNA 4ED7A 2EK1A 1CJUA 4GMKA 1O6XA 2IJRA 4AHTA 5DGAA 2I0XA 1GFWB 3K5NA 3GILA 2QEXS 2KT2A 5A8WB 2CPHA 1B0TA 3R5JB 1TL4A 5KFZA 3ZT0A 5AE3A 3V6JA 4HUEA 4CJQA 3QO9B 4GKKK 4CEOA 2N3OA 4HUGA 5KT4A 4DR1J 2Z56B 4IOXA 2H4WB 1TL1A 2D3ZA 4DPUA 1JLAB 2YNFA 1Y7PA 2A2DA 2MSSA 3FZKA 1VISA 1GLAG 3NBPB 2KRRA 2UUBF 4K0KF 2FQQB 1YI2N 2HRYA 2WSEC 3CI5A 3TQ1A 2E1AA 1GK8A 5CD4A 3VETA 5C0YA 3E2EA 3JTOA 1H98A 4X4RA 1FO1A 1U2VA 1XMBA 4Z2XA 1FXRA 3THWB 2A6AA 3CDAA 1B92A 3A8JA 3OYKA 4OYWA 2IRYA 2E1MC 2GQCA 3EICA 2VL1A 1XNQJ 2DYAA 4ICLB 3ZETA 1D8YA 4I9LA 2BQRA 3QFHA 1HNZJ 1BUPA 1S0NA 5FDLB 4ZJLA 1VQLN 3KLHA 2MQPA 4Z4EA 2A1SA 1NCLA 1IBMJ 3OXFA 1R89A 4QS8A 4ID5B 4LFAJ 3OLBA 4M45A 3UB5A 3EXCX 4CK2A 1APSA 4LSNA 2VQFJ 3THYB 2ZH9A 3IAS9 4KYZA 3OYBA 3O44A 3IGNA 3VGMA 4G1QB 2JC1A 3NCQA 2QK9A 1S9EA 5BYSA 5KFCA 3ULHA 4DR2K 5HMXA 1X31C 4RUAA 3G2XA 2XCAA 1HI0P 3V4IB 2PMHA 4UOHA 4X66K 1VQPN 2YHBA 2NRWA 3C46A 4EFAC 3NP5A 5LMNK 3ZCMA 4OHVA 4XTTA 1LAWA 1Q82T 2ZDPA 1Q5YA 2IC3A 4ZPDA 1MWQA 3KLGB 1ATNA 4Y65A 2JHEA 2JEFA 1BI4A 2HBYB 4DLGA 2VUGA 2O5DA 4F0HA 2OIHA 1ZOTA 3TVYA 1HNXJ 4FLYA 4JK9A 1PCAA 5HMWA 3GDQA 5KG7A 2XGPA 1QQCA 2HBMA 4PAAA 3GFXA 1JJ2R 2WBNA 4CT8A 4PQUB 3W5YA 3GONA 2WVEA 3POTA 4OZ0A 3HT0A 3PW7A 4F26A 2J7WA 2J8AA 2CRLA 2IY5B 2CPEA 3D3CJ 4B9MA 4B9VA 3MOJB 2FBXA 3O3GA 4O3NA 4ISFA 3NGSA 2WAQD 2WC9A 1ZM3A 3CG7A 1VSLA 2YKQA 4PWWA 1FKAF 2YKAA 4OHXA 1ZXOA 4ED6A 1OPZA 4CZEA 1FFSB 1WELA 3MM9A 1GX6A 2Z1HA 3PYEA 5KT3A 1V4SA 5L1JA 1DGKN 4K4YA 4MTPA 1ZBHA 3MUMP 4KIAA 2PYJA 5HOOA 1Y97A 3IFRA 1IXKA 3KMQA 3FEZA 5CYQB 3ZT4A 4BC7A 3M3ZA 1WHWA 1YJVA 1LWFB 3LTOA 3HM9A 2KKHA 1S99A 2DNYA 4ERDA 4CHYA 2YWKA 1EWQA 1N0UA 4ZVTB 1S5JA 5KFPA 3DRRA 3RW7A 4CJ3A 3IR6B 2PZSA 3P39A 4IFYB 4CFDA 4FJXA 3MMCB 1U4BA 2RHSB 2G8KA 3H5SA 3QIPB 2MPUA 1Z26A 1S4FA 3VQCA 2C3YA 4DR3F 4L73A 2R7YA 2OMOA 2VKZG 3V81B 2VG5B 2VOOA 4IG0A 2Y8WA 4JI3K 2X1BA 1DLOB 3ET6A 3MTKA 1MROA 4ZCKA 3W2VA 3RMDA 3K7RA 4PXDA 4LSZB 4DSIA 5KQDA 1WF2A 3DXKA 4DV7J 4FPAA 3C6TB 4DSKA 4X4NA 3NOCA 4U6PA 1VC5A 3M05A 3MM8A 2Z30B 1FNMA 4HTUA 4FL9A 2WB1D 3CJTA 5D4NA 2LP4A 3T5KA 3DM2A 2EKNA 2R8GA 4BG9A 3H5XA 2ETJA 4KO0B 4JI6J 2MYFA 4MKAA 1AA1B 5JICA 4P7TA 2DGTA 3VV2B 3SYZA 4DB3A 2RU9A 1TL5A 4IR9A 4C48A 1TUUA 5J1EA 1HR0K 3R1XA 4KI6A 3TTCA 3O6QA 1W2BR 5KOXA 3CMAS 5FJ4A 5A2QO 1BLUA 3DDIA 5IM0B 2JLGA 5AQYA 2DGUA 1H2VZ 2KW4A 2AGPA 2Y1LB 4O4RA 4CQ1A 3AJDA 4ILHA 2F8SA 3WQPA 3ETOA 2H3EB 4FP9A 2OPQA 3JSMA 3CJ5A 1R8CA 1XIQA 1R0AA 3IS9B 5F41A 1V5IB 3KDOA 3W9HA 4B3OA 3U8XA 1VR6A 4KHQA 1X60A 3DDKA 1FFGB 2ZBCA 3CJCA 2PFUA 5AFUH 2UVUA 1RCXB 4BRCA 5IC6B 4OVLA 1BWVA 1GTEA 1OQ3A 1P9YA 3DFEA 1K8KA 4ELTA 1B9FA 3J80O 5I9EB 3I56S 2FJVA 4C98A 1IBCB 1R3NA 1E6YA 4G3IA 1E6VB 1K8AT 3H2UB 2XWXA 4C7QA 3CW2C 1JNZB 2G8VA 2EFNA 3UVJB 1VAZA 4CVNE 4A8WA 2AU0A 2RS8A 2FC9A 4EHUA 1ZA1B 1VK0A 1K0VA 1ZBSA 5HLFB 3PIPQ 3BGLA 4OJHA 4ZVOB 4F4ZA 5J2MB 4RU2A 2UUAJ 3FGUA 1JL2A 3TR5A 1H7XA 4DL6A 3I0RA 2KTQA 2X1AA 3T6JA 1JLFB