4Q0BA

Crystal structure of hiv-1 reverse transcriptase in complex with gap-rna/dna and nevirapine
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
555
structure length
555
Chain Sequence
VPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTNSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase, hydrolase/rna/dna/inhibitor
molecule keywords HIV-1 reverse transcriptase, p66 subunit
publication title Structures of HIV-1 RT-RNA/DNA ternary complexes with dATP and nevirapine reveal conformational flexibility of RNA/DNA: insights into requirements for RNase H cleavage.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
total genus 142
structure length 555
sequence length 555
chains with identical sequence C
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2014-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4q0bA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4q0bA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4q0bA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4q0bA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4q0bA05
1TL1A 2HNYA 4K4TA 4EO6A 2YNGA 1HYSB 3RRHA 4DTSA 4ED8A 3QGHA 2ZE2A 4OVLA 1QHTA 3HVWA 4Z4CA 1N5YB 2R7YA 1CLQA 3S3NA 1S9GB 3Q8QB 3SUNA 2ETJA 4ICLA 5KFRA 3H98A 4OPKA 4B9VA 2G8VA 3DLHA 2W9BA 3V6DB 1K6YA 1I6JA 4KTZA 3SFUA 4OKKA 1WAFA 4ZVGA 4FLZA 1JLFB 3OYDA 2JEGA 2W7OA 2BDPA 5KFIA 4O3SA 4W5OA 4G1QB 3O4NA 4KV8A 5HLFB 3RAQA 4RW6B 1U47A 2D0BA 3CFPA 4RW8A 3OL9A 1RTHA 2JEJA 3V1QA 3KLHB 4EZ6A 1TQLA 5KFTA 2ATLA 3HK2A 4NRUA 5F9NA 5KG1A 3MXIA 5DQHA 2XGQA 2BR0A 3SUPA 3IRXB 3VQSA 3L3UA 1VSKA 2KZMA 3T5JA 2FBVA 4WFYA 4DSFA 1RDRA 4DF8A 4FLVA 2WONB 1RNHA 4TSXA 1OS5A 3DYAB 4ED6A 3KMQA 3AVFA 2PYJA 1RT5B 1JLGB 4KHWA 2KW4A 2YKMA 4B9LA 3VQ5A 3VQ6A 2HNYB 3UDLA 1LWEA 4CJSA 3AO1A 2XCAA 2YNGB 1L3SA 1ZBLA 1RA7A 3T5LA 4R8UB 5DK5A 1SKWA 5L1JA 3GILA 5KFSA 3MEDB 1C1BA 4JRPA 2HHXA 4M45A 4ICLB 1S10A 4U6PA 4CF1A 3QIPB 5KG5A 3WNGA 3AVNA 2W9BB 3CJ5A 1LW2A 1NOZA 2HNZA 3L2WA 2HHTA 4TQRA 3T19A 4M3YA 4XPEA 4MIAA 3AVMA 5KRSA 1S0NA 1S9FA 3ZSWA 4CEBA 4CERA 3V9WA 1VSLA 1S49A 4CGIA 4E3SA 1X9SA 4G3IA 4K4UA 4MK9A 4CIEA 3TAPA 5J2PA 2PY5A 2AJQA 3TARA 3IAYA 1RTHB 3Q8SB 2FBYA 3RMCA 2RDIA 4K4XA 1Z25A 4JS5A 3V9UA 3VQEA 2BQRA 2AGQA 5KG2A 4CFCA 2FC0A 4FYDA 3HVRA 4KAIA 3MF5A 4WFXA 5JXSA 3N6LA 1RTIA 5DG8A 3G6VA 3LWLA 4H54A 4B9TA 4KHYA 4FJIA 2IS3A 4ECZA 2PZSA 2D41A 2YKMB 3PW5A 1BCOA 4DL5A 1ZETA 4ZVHA 1WLJA 5KFVA 3DM2A 1LWEB 2VG7A 4F4XA 5KT7A 3TAMA 2WHOA 3OS0A 3ZSYA 4J2BA 1S1XA 3G6YA 3H4DA 2D3UA 4FJJA 4K8XA 4ED2A 4KB7A 1DTQA 5KT2A 4CJRA 5I42A 1KVAA 2OPQA 4HUEA 4GMJB 5EWEA 3KNAA 4IQXA 1LW2B 1EXQA 3OS1A 1TKXA 1B9DA 2HNZB 3H2LA 4NLSA 4NZ0A 1ZBFA 3MECB 3NHGA 1HQUA 2BRLA 1TKZA 2Z1IA 1RYRA 3V4IA 1RDDA 3ZCMA 3CJ4A 4AH9A 5J2PB 4RU9A 2V4QA 4C8LA 3LZJA 3D0PA 1XC9A 3H5SA 1WN7A 1VSHA 1T94A 3QEWA 2P1JA 2X6NA 4F3TA 3OSPA 2G8FA 3BR9A 1CXUA 4KI6A 3DOLA 1NK9A 4RG8A 4FS2A 1J53A 3MXJA 4CJTA 4M3XA 3DLEA 4QW9A 1B9FA 2BRKA 3TANA 4KBIA 2Z1JA 2JGUA 2XY5A 1JL1A 4M94A 4AILC 3PJWA 3K58A 4KE5A 5HRSA 5KFHA 4H8KA 3HVTA 3DM2B 4NCAA 1WSGA 1UWBA 3I5BA 5F9LA 2HHVA 3PW7A 3RB0A 2IOCA 3KK1A 1S1XB 3H59A 3PX6A 3SJJA 1NHUA 1DTQB 4URGA 4EEYA 3K5LA 3GQCA 5I42B 4DSEA 3I5AA 3LP1B 3AO3A 3DMJA 4Q43A 1MMLA 4M41A 3N6NA 4LSNA 4NLGA 3VQ8A 3HP9A 4CIFA 3CO9A 1KVBA 2FLLA 1ZTWA 3UIQA 1KSPA 2E9ZA 1TKZB 2W9CA 2QKBA 1TL3A 4DL4A 4OLAA 3KLIA 3V4IB 1N56A 1LWFA 2E6MA 4JV0A 3CVKA 4DTPA 1S1UB 3TR8A 4EP4A 3NH1A 1QE1B 4L8RB 2KFNA 4O0IA 1LAVA 3PZPA 1NOYA 1X9WA 4H4OB 2A1RA 3DOLB 1W9HA 1RTDA 5KFFA 4DG1A 1IKWB 3ZSOA 4LY7A 3LAKA 4H4MA 4FVMA 4WYWA 1C1CA 1JLAA 1CXQA 3G6XA 4FK0A 2YKNA 1N4LA 5KFCA 3PHEA 4NLWA 4ECYA 2LSNA 3MR3A 4ECQA 3FRZA 3CIZA 4CEEA 4QWEA 3HVTB 4B9MA 1JXEA 3L2VA 4E19A 4OL8A 4FJHA 4O4GA 1WSIA 3QZ7A 5DG9A 2QKKA 4J9QA 4Z4HA 5KRTA 1BQNA 1NHVA 3KK1B 3CG7A 4O44A 1U49A 2IGIA 4MQ3A 4MKBA 2BQUA 1CZ9A 1XR5A 4ZP7A 3OL6A 3VN5A 1S1WA 2GV9A 4FJ7A 3MTKA 4NYFA 1BI4B 4LSNB 1REVB 1S48A 4CJ5A 3NDKA 2F8SA 2WB4A 1TL3B 1SUQA 1TK5A 3KLIB 1HQEB 1LWFB 3SUQA 2OH2A 3F9KA 2ZKUA 2O4IA 5I3UA 3CJ3A 4DQIA 2HB5A 3OYGA 5KT5A 4ECXA 1RTDB 3ZSQA 4AHRA 1YT3A 4H4MB 1BISA 2GUIA 4LH4A 1C1CB 1DTTA 3JSMB 5L1LA 4OGEA 2UUWA 1FKPB 4FZXC 2XC9A 3L2QA 3TQ1A 3MR2A 5F8MA 3DRPA 2IMWP 4E7HA 4DF4A 2YHAA 4HTUA 4FW1A 3CQ8A 4CHPA 5C5JA 4O4GB 3FDSA 1VK0A 3KKRA 1EX4A 4C8MA 1NKEA 1KTQA 3LP0B 4CECA 1KLMA 1S1WB 4AHUA 3OYJA 2HNDA 4YNQA 3NAHA 3PR5B 2R8KA 4ID5A 1J54A 3V6JA 4OKEA 2FVQA 1JXLA 4DFKA 2AU0A 3IGNA 4NLDA 4YMEA 1ASWA 4PUOA 3OYBA 1SV5A 4TY8B 1CSJA 2XY6A 4GW6A 1SUQB 1C0UA 1F21A 4O0JA 4RZRA 3H40A 5I3UB 1XR6A 5SWMA 4HCCA 4U7CA 4WZMA 1JLCA 1S0MA 3AA3A 4GC7A 5KFLA 3FSIA 1ASVA 2D7SA 4BDZA 3OLAA 4KFBB 3OYHA 3KIOA 4DLEA 3OYIA 2FJVA 4EBCA 1DTTB 2IDOA 4CJLA 3OY9A 4FJ8A 1RDAA 4DTXA 4RNNA 3GIKA 1VSJA 3KK2A 4N56A 3KD5E 1RT2A 2ASJA 3HM9A 2WTFA 1C0TA 5HP1B 3VQAA 3DRPB 1TV6A 4ELVA 3HPGA 2ZD1B 2VA2A 1C6VA 1J5OB 4K8ZA 1RT7A 2QXFA 3MEEB 1RT1A 2GIQA 5DLGA 4FW2A 2OYQA 4Y2AA 5KFMA 1KLMB 2BANB 3GIIA 1NJZA 4IRKA 2HNDB 5HROA 3L3VA 4N47A 1NJWA 4I7FB 4ID5B 3HT3A 4ZPCA 5EDWA 1NK5A 4J9NA 5K14B 4UQGA 1TAUA 1SV5B 2UVWA 4GC6A 2C28A 1C0UB 3BGRA 3KJVB 4CGDA 4E0DA 3ISNC 4MKAA 3WNFA 1ASUA 4Q8FA 4F50A 4JV1A 3KK3B 2Z1HA 3K5NA 1JLCB 3BSNA 4CEAA 3RMDA 4EBDA 1QAJA 3PV8A 4DL2A 3SV4A 4K4ZA 1VRTA 1W0HA 3DLKA 1JLQA 1S4FA 4Q0BA 3TAFA 5HBMB 5KFUA 1GOCA 3OYFA 1JLEB 4CK3A 1S1TB 4J9OA 1XR7A 5DQGA 3ALYA 3VQ9A 4TY9A 3NF8A 1RT7B 3I0RA 4W5TA 5F8IA 1I39A 2OPRB 3V1RA 4M3WA 2J6SA 3NH2A 3HHKA 3EYZA 3C94A 4NLYA 1WSJA 4R5PB 5SZTA 4NCBA 5HROB 4K4YA 2DFFA 2I5JB 2C2EA 4QWCA 2V4RA 4ECWA 3EY1A 4FLWA 4FM0A 3KHHA 2FVCA 2HHSA 4IRCA 4LSLA 4NLTA 4EP5A 3BGRB 1HNVB 4DSIA 5DLFA 3ASMA 4PY5A 5DGBA 4DFPA 1I3AA 4CHOA 3NL0A 1WSHA 5DG7A 3ZSVA 4WXWA 3CFRA 1ZBUA 3V1OA 4IRDA 1VRTB 3DLKB 3G86A 3C95A 5C42A 2IBKA 1EP4A 3DLGA 2HWIA 2D3ZA 3CFOA 1XI1A 1XWLA 1T7PA 3QZ8A 4XO0A 4B3OA 2ALZA 3I0RB 4YR0A 1SH0A 3UPFA 3ICLA 2P5OA 4HYKA 4DTJA 4NCGA 2Y1IA 1TL1B 4K4VA 4CEFA 3CM5A 4QWDA 3QNNA 2VA3A 3VA0A 2DPIA 4FLYA 2HHQA 3NMAA 4CFDA 2ZE2B 3DLBA 1FKOA 1D8YA 4CEOA 5KG6A 4F4WA 4RNOA 3GIJA 2BE2A 4ZVFA 1SKRA 4B9UA 3E01A 3LPUA 4Q5VA 4IKAA 5DMRA 3M9NB 4DTMA 3LAMA 2JEFA 4O5BA 1A5VA 1FXXA 4KV8B 3HKWA 3GYNA 4IFVA 2WCXA 4RW8B 3PR4A 1RT3A 2G8WA 4CFAA 3KHLA 4KTWA 1NK7A 5C42B 1NK4A 4CHYA 2E9TA 3L8BA 1EP4B 5L9XA 2YNIA 3DLGB 4TYAA 1RBVA 4B3OB 3OS2A 3IS9A 2R2TA 5KFKA 4ZP8A 1U04A 3QNOA 2KFZA 4FBUA 4EBEA 1VRUA 4TXSA 3KKSA 4J9LA 1LAWA 3RR7A 4NCGB 4OGCA 5L1KA 4MFBA 2W42A 2RKIA 4DL6A 5F8JA 5EWGA 3OHAA 5JUMA 2O4GA 1FKOB 4ECVA 4O3PA 2QV6A 3AVIA 1C1BB 1YVFA 3ZSZA 4WFZA 3BQ1A 2J6UA 1HARA 2QE5A 3LP2A 2D0CA 3TAGA 5KFPA 4DWIA 2EHGA 3P1GA 4XIUA 1TKTA 3LDSA 2R2RA 1SL1A 2E6LA 3SZ2A 2YNFA 2ITGA 3DRSA 4J9RA 4QPXA 5C24A 3GV8B 2C22A 3ZT0A 2IAJA 1S6PA 1HPZA 1UAXA 1YTUA 4CJ4A 1IKYA 1UA1A 4F4KA 4FZZA 2XRIA 1RT3B 3QINA 1L5UA 2ASDA 1JIHA 4AHVA 4YR3A 3HXMA 2YNIB 1K1SA 3QIDA 3LZIA 2HMIA 4O3RA 3RTVA 3KD1E 1RTIB 3AO2A 3RWUA 3D28A 4M3TA 4ECUA 3GIMA 4PQUA 2HAIA 3JYTA 3NGZA 2WK4A 4HCBA 1VRUB 1HNIA 4ECSA 3M8PA 3CJ2A 1L3VA 5EWFA 4MFBB 4FJ9A 2RKIB 2VG7B 3VQPA 2IC3A 2UVVA 3TAMB 2G8HA 4RNFA 1KFSA 4DS5A 4M3ZA 4ZHRA 5KFOA 4ZP6A 1VSEA 3NGYA 1T05A 1SH3A 1T3NA 2ILYA 1X1PA 2OPQB 3LP2B 3BQ0A 4ED3A 1TP7A 1D1UA 1C2PA 5KG4A 1TKTB 1TKXB 3QEPA 3OSNA 4XPCA 4YQWA 3C6UA 2YNFB 1HQUB 4ZPAA 3FQKA 3DRSB 4NLOA 3OHBA 1HYVA 3KOAA 2IAJB 1U4BA 3ZT3A 1HPZB 2EX3A 5F8HA 1S9EA 4B8AB 1JL2A 2B5JA 1C0MA 2JC1A 4YFUA 4CHQA 3I0SA 1HJRA 2GBZA 2AGOA 2Z1GA 4J9SA 4Z4GA 4PWDA 3QYYA 3NGIA 3U3GA 2HMIB 2WOMA 4E89A 4ZTJA 4IH5A 3DLEB 5KFAA 1VSIA 4TQSA 2CJQA 2AGPA 2QK9A 3BQ2A 2C2DA 1HNIB 1NNDA 3NE6A 3K59A 1RT6A 2OZSA 2OA8A 2KZZA 1HMVA 4CJKA 2FBTA 1UWBB 4QW8A 2FVSA 2W9AA 4FLXA 3H08A 1KVCA 5CYQA 3Q8RB 4ECRA 4IKFA 3H5UA 1TK8A 1T05B 2GC8A 4M3UA 3ITHA 4EYIB 3KLEA 1JKHA 3DMJB 1QQCA 2IJFA 4QWBA 4IR1A 1FK9A 3KHRA 4MK7A 3L2RA 5KT3A 4J2EA 4I2PA 5KG3A 2J6TA 3PX0A 3C6UB 2ILZA 1Q8IA 3S9HA 2W9CB 4KAZA 4CJVA 4J2AA 1S9EB 4URSA 3HPOA 3OYKA 3C6TA 2DPJA 2B5JB 1KLNA 3HSTB 4LQ9A 5KG0A 4KO0A 4BE2A 2RF2A 3I0SB 4NLVA 5J1EA 4EYHB 3SQ1A 4BWJA 4E7KA 4DG1B 1B92A 1YTAA 3V81A 3OVNA 2WOMB 1BGXT 4JLHA 1JLAB 4ELUA 2YKNB 3ZT1A 1KFDA 1JLBA 3VA3A 4K4WA 1BCMA 4KPYA 4N76A 3O3FA 1UOCA 3VQCA 4NYZA 5J2QA 1S1VA 4RUAA 1S97A 3MXMA 4E7IA 4K4SA 1BQNB 1IKXA 5CYQB 3NF7A 4O44B 3DI6A 1SL0A 4O3NA 4B08A 5C25A 4Z4IA 1HRHA 4DQQA 3MR5A 3ITHB 2PYLA 4BDPA 1SKSA 3KLEB 1JKHB 4DL3A 2KTQA 4K50A 1IKVA 2R8GA 2XY8A 3DOKA 4FJLA 4Y3CA 4FK4A 4I2PB 3DRRA 4CF8A 2BQ3A 2R8JA 3TAEA 1SH2A 3BSCA 5CY4A 2W8KA 3LWMA 3C6TB 4RNMA 4DSKA 1KCFA 3OYEA 5KGWA 4IG3A 2VG5A 4DQRA 3AVKA 1EKEA 5JS2A 4JV2A 4KRFA 4HVJA 4DU4A 4EO8A 3IG1A 2VWJA 3V81B 1VSMA 1Y97A 4B8CA 3BSOA 4QOZB 2O5DA 4RW4A 1W25A 1JLBB 2FBXA 3NAEA 3NKYA 2WRMA 1XHZA 1D9DA 3K57A 1TKDA 4ZPBA 4LD0A 4E7LA 1TAQA 3A2FA 1RT4A 1U48A 2F8EX 1RA6A 3S3OA 2FJWA 1S1VB 1A5WA 4IOBA 1WSEA 3MEGA 2IM1A 2FLPA 5KFNA 1IKXB 2RPIA 1Z4UA 3DI6B 2HVIA 2AX0A 3RBDA 1MU2A 2XI2A 2ASLA 4HHTA 4LH5A 4NRTA 3B6OA 2F96A 2UUTA 4J9MA 4CCHA 4CJEA 3PO5A 5T7BA 4OJRA 3RRGA 1T03A 4MIBA 4IBNA 3I8DA 3DRRB 4PUOB 4CF9A 3QGIA 1Z26A 5KGXA 4IG0A 1QTMA 4N5SA 3THVA 4DTRA 5D3GA 1ZBIA 4O55A 1LWCA 1HYSA 4RUCA 4IG3B 2VG5B 3VQ4A 5KFXA 2R8IA 3RBEA 3RMAA 3SFGA 4E1MA 3B6PA 3IG1B 4YP3A 1BL3A 2E9RX 3RB3A 3SQ4A 2E4LA 1N5YA 3BSAA 3KTQA 2XY7A 1S9GA 3PW2A 1Q9XA 4RW4B 2B43A 3OL8A 3NF6A 4AHTA 4W5NA 1VSFA 3KK2B 3M9MB 1WNEA 1RT2B 5EUHA 1JXBA 1C0TB 1QS4A 1TV6B 1QSLA 4JUZA 1RT4B 1GOBA 4GVMA 4G1QA 4Y34A 4KHNA 3MEGB 4RW6A 1RT1B 1MU2B 4DSLA 1ZTTA 2D5RA 3QGGA 3QESA 4FS1A 3HJFA 1T03B 4NLUA 3K5OA 4DQSA 2WONA 3VQ7A 4CGJA 2G8IA 3DYAA 3AVJA 4IG0B 1RBRA 4ELTA 5D3GB 2OPSA 4F3OA 4KSEB 3N6MA 4CJFA 4FXDA 1LWCB 4TN2A 3NF9A 4CGGA 4CK2A 4DS4A 4R8UA 3AA2A 3V9XA 2KQ2A 3MEDA 3MAQA 3M8RA 4CF2A 3KMSA 3QIPA 3O3HA 1JLQB 4MK8A 4QAGA 4Q0BB 1GX6A 5KG7A 5KFBA 3V6KA 4IH6A 3HVAA 4FZYA 3OYMA 4CJQA 1VSDA 2X78A 4F2SA 1O1WA 3H5YA 3NH0A 1BHLA 1LW0A 2FJXA 5KT4A 4URQU 1GOAA 4R0EA 3H4BA 3NFAA 2EC0A 1RBTA 2G8KA 4B9SA 4KHSA 2JLEA 1QSSA 1T8EA 4FM2A 4N41A 4O4RA 4CEDA 2XCPA 1RDBA 4LSLB 1QSYA 3MFIA 3CDWA 2I1RA 4KB0A 2OPSB 5KFJA 4HKQA 1CZBA 4ECTA 4F8RA 4CHZA 4CJ3A 2B6AA 4OLBA 1S5JA 2XGPA 4MH8A 2UVRA 4F4ZA 3RAXA 4J9PA 2IA6A 3M8SA 4WYLA 3LALA 3MECA 1D5AA 4NLXA 5F8LA 4WZQA 1KRPA 5KFYA 3QETA 3SNNA 2P5GA 3TVKA 5KI6A 4M42A 3OLBA 1LW0B 1KHWA 4KHRA 2AQ4A 4FBTA 5KFZA 1R0AA 4DFJA 4RNHA 5CZ2A 2AWZA 3SUOA 4DU3A 1RTJA 3M8QA 5FRMA 3OYCA 4AHCA 3V6HA 4W5QA 5HRRA 4DEZA 4DLGA 4W5RA 2IM2A 1IG9A 3HPHA 1N6QA 4YR2A 2BE2B 2XO7A 4C8OA 3E01B 2R2UA 1K1QA 4IDKA 3KLFA 1NKBA 3TWHA 2VWKA 4FCYA 2B6AB 3LP1A 4IFVB 4WXOA 1ZYQA 1SL2A 3T1AA 2AX1A 4KI4A 5J2NA 3G10A 3CDUA 1QUVA 1S0OA 3UR0A 3FFIA 4F4YA 3IS9B 5FRNA 5KFWA 4KHMA 4BDYA 1S1UA 4M95A 4Y1DA 1QE1A 1WAJA 4Z0UA 3KLGA 4AHSA 2JEIA 1R0AB 4H4OA 4E1NA 2DFEA 3UQSA 1IKWA 1RBSA 3MR6A 3NGDA 3Q8PB 3D45A 1D0EA 1RTJB 4IR9A 3M8QB 4NYNA 1ZBHA 5FDLA 1Q9YA 4QWAA 3OJSA 4Q44A 1N6QB 3QO9A 3OJUA 4CJUA 3HP6A 4KHUA 4CIGA 1D9FA 1EETA 4ZTFA 1RDCA 1IM4A 3RB4A 4IDKB 1J9AA 3HO1A 3KLFB 5C24B 5KTQA 4Z4FA 1S6PB 3BREA 2HHWA 1IKYB 3DLRA 3AVAA 4RW9A 3QEXA 4JS4A 3TABA 1BI4A 4DTOA 3QIOA 3PY8A 3SPZA 4HUGA 3NBPA 3E51A 4CEQA 5J2NB 1BIZA 4FJGA 1REVA 1C1AA 4DL7A 3PVXA 4BACA 3H5XA 3FFIB 1HQEA 4J9KA 2X74A 1RYSA 4PQUB 1BQMA 3JYTB 2VG6A 2HWHA 3KLGB 2JC0A 3WNHA 3G0ZA 5KFGA 4I9LA 3M8PB 4CEZA 5EU7A 2IJNA 2IC3B 1L3UA 3JSMA 1NK0A 4CF0A 3ULDA 5FDLB 1IO2A 4Z4EA 4ZHRB 2FLNA 1FKPA 5E41A 3SV3A 1LV5A 2CKWA 3SPYA 4ZP9A 3ZT2A 3QO9B 1WNSA 5FROA 3AA5X 4ED1A 1EETB 4C8KA 3OYNA 3QEIA 3D5MA 4ZVEA 3SCXA 4ED7A 4EZ9A 3AO5A 4DSJA 3FQLA 3ZSRA 3LP0A 3CDEA 3MFHA 1NK6A 4ZMMA 2D0AA 4RW9B 4KB1A 4CESA 3F73A 2B4JA 4JRQA 2XWYA 3CWJA 1UA0A 5CYMA 3M9OB 3NBPB 4CE9A 5J2MA 4PWDB 3BDPA 4ZPDA 1NJYA 2NUBA 4TY8A 4C8NA 5F8GA 3EPIA 2FVRA 1YVUA 4J2DA 3DDKA 4DU1A 1ITGA 3IGVA 3P83D 3P5JA 2R2SA 3KLVA 1BQMB 4IH7A 2VG6B 3QEVA 4DQPA 5T14A 3AVGA 4CFBA 4I2QA 5CZ1A 4Q8EA 2XHBA 1RT6B 4PA1A 1HMVB 2A1SA 3CM6A 3VQQA 4KFBA 4I9QA 2Q3SA 2DFHA 5HRNA 4M3RA 3SQ2A 3TAQA 3RMBA 4DFMA 5KFEA 3PO4A 5HP1A 3OYLA 3SYZA 4KREA 4Q45A 4X2BA 1TVRA 1A5XA 3AVCA 2ZD1A 1DLOA 1FK9B 5JS1A 4KKOA 3CYMA 2GIRA 2OZMA 1J5OA 3QERA 1RBUA 4FJ5A 4ED0A 3MEEA 3PW0A 3LP3A 3NCIA 1JX4A 4HUFA 2IM0A 2YHBA 2OPPA 4DTUA 1U09A 2BANA 5F8NA 3EPGA 4Y1CA 2XI3A 4RW7A 4Y2CA 4I7FA 3CJ0A 5KFQA 4KO0B 1NKCA 2RF2B 5CYMB 2YNHA 2P51A 3T3FA 1RCHA 5J1EB 1N48A 3TI0A 4NLRA 5K14A 5J2MB 4E7JA 3I5CA 2IM3A 4DMNA 4FM1A 1S6QA 3AVBA 4CHNA 1HYZA 1XHXA 3QLHA 3KJVA 2Y1JA 2HHUA 4OPJA 2X6SA 3EZUA 3AVHA 3K5MA 3KK3A 3V9SA 4BWMA 3AV9A 3T5HA 4FLTA 4I2QB 5DGAA 5J2QB 2V9WA 2G8UA 1BIUA 1TGOA 1WSFA 4WE1A 2YV0X 3PW4A 5HBMA 5C25B 4KTQA 4IFYA 3NAIA 3AO4A 3SI6A 3IN5A 1JLEA 3RR8A 4NLQA 1S1TA 2R8HA 3S3MA 1TVRB 5L1IA 1IKVB 2RN2A 3ZSXA 1DLOB 4KKOB 4F2RA 2HW3A 3GV7B 3SQ0A 3U6FA 2V0NA 3DOKB 5KFDA 3VQBA 3GV5B 2C2RA 3EZ5A 3AVLA 3L2UA 3AA4A 2OPRA 4NLPA 2W7PA 3SI8A 4BE1A 2OPPB 4R5PA 2ZQBA 2W8LA 4CK1A 3OYAA 2I5JA 1NJXA 4RW7B 3O4QA 4OKJA 3U3YA 5KT6A 1NK8A 2YNHB 1L3TA 1G15A 3PUFA 1QAIA 2FVPA 3PX4A 4CGFA 3T5KA 1RILA 1S6QB 3BJYA 4BE0A 4ID1A 1HNVA 3QLHB 2HVHA 3WNEA 1IH7A 4FK2A 4TYBA 4DTNA 3V6DA 4KHQA 4FJKA 3ZT4A 4QCLA 4FJXA 1JLFA 3HYFA 4FJNA 1TK0A 2F8TA 3O3GA 2BGGA 5HLFA 5DQIA 4WE1B 4B9NA 3LANA 4FLUA 3KLHA 3VQDA 4IFYB 1GX5A 3OL7A 3HL8A 4TLRA 4FJMA 1KHVA 4CJPA 3RB6A 3LPTA 1U45A 4O3QA 3IRXA 2DTUA 3K2PA 2ATQA 2DY4A 4CGHA 5HRPA 1X9MA 3PJXA 1RAJA 4LQ3A 3KHGA 2RDJA 4CJWA 3ISND 2UVUA 1RT5A 1JLGA 4O3OA 3V9ZA
chains in the Genus database with same CATH superfamily
4ISGA 2O8DA 1P27B 1EKRA 2YWWA 1M0SA 4CIOA 3QGHA 3CNQP 2GVDB 4OVLA 1R31A 3HVWA 1N5YB 3S3NA 2ACYA 5GADU 4EFHA 2XZTB 4ICLA 5KFRA 5HJXA 3DLHA 2PE8A 3V6DB 3BDEA 2CJKA 1I6JA 1IWGA 2FUG9 3ZTQA 4OKKA 1FXDA 2BDPA 4HEA9 4ENOA 1RCOB 5AQFA 4G1QB 1Q7LB 5HLFB 3CFPA 4YS2A 4C0OC 2CH6A 1TQLA 3HK2A 5KG1A 2EKYA 3SAFA 3IWNC 4FWPA 3J7YP 2DXFA 3CC4N 2BR0A 4EAHD 4S0MA 5T41A 1VSKA 3T5JA 1N5VA 2GO9A 4ZLLA 4LF8J 4OZ1A 2VKRA 3HSGA 1CJVA 4ED6A 3RW6A 3AVFA 1GTEA 2YKMA 4A5AA 5HMYA 2HNYB 4NYOA 4CJSA 1UP1A 1L3SA 4K59A 2E5JA 3DC2A 1EB0A 4CM0A 1XMOK 4LFCJ 3BR8A 3VVTA 4X62K 2QFIA 4M45A 2ZOMA 1S10A 1VQ7N 4IO1A 3BH6B 2OP5A 3AVNA 2C3UA 4HACA 4TQRA 1M5OC 4XPEA 3AVMA 1S0NA 2QSWA 2KHCA 3FSXA 4C98A 3ZSWA 3D6TB 3JQMA 4OJGA 2EWSA 2NLWA 3PFEA 3VGKA 4C3KA 2RU9A 4MK9A 3TAPA 4CIEA 2HRYA 2PY5A 1RWVB 2VQFJ 3RMCA 3NNHA 1DQ8A 1WF2A 4AM6A 4JS5A 5GAGU 2MQQA 2FC0A 2JRSA 2PBDA 4FYDA 5K8PA 4CZJA 2E5LF 2UYTA 3JSBA 3G71N 2E5LK 2ZFHA 4B9TA 3E9OA 3P45B 4MO4A 2PZSA 2LYVA 3PRDA 4BROA 3PW5A 4DL5A 1NXIA 4HHUA 3T7ZA 5F0XA 1WLJA 1RWKB 2EBEA 2RRNA 4ILGB 3OS0A 3ZSYA 2GHWA 3H4DA 4H4KA 4FJJA 5H1SQ 4KB7A 3MN9A 4CJRA 1NDCA 1SJ1A 4AL7A 3BB5A 4BC3A 2BTFA 2MQ8A 5EWEA 3R1HA 1ZAXA 3QMLA 1B3TA 1LW2B 1EXQA 2R7TA 1TKXA 2HNZB 3H2LA 4NZ0A 3C19A 1B9DA 1P1LA 4P75A 4DR2K 2FY8A 4IOCQ 5J2PB 2QEXS 4RU9A 1FF2A 1HJOA 4C8LA 3D0PA 2YWGA 1XC9A 1WN7A 2NYHA 4GVBA 2P1JA 3OBWA 2G8FA 4KI6A 3DOLA 1FD2A 1O51A 1NK9A 2XS5A 4X4QA 3MXJA 3G8SA 3DCAA 2MKYA 1RLDA 2BRKA 2VBXA 2B8PA 2CQ3A 3J81j 2GS8A 3BUZB 3QNWB 3MM9B 2PEHA 2HQIA 2YHYA 1DARA 4A8WA 5HRSA 2VL1A 2BJDA 3HVTA 3DM2B 4NCAA 5C2FA 1UWBA 1LXJA 2PT0A 2R7RA 1XMQF 3RB0A 2OJ3A 4P7TA 4URGA 4EEYA 3QBXA 1N5QA 1HI0P 4DSEA 4AFFA 2LU1A 2ATCB 1IBLF 1WOSA 3S6EA 3MMAB 3VEZA 3PKYA 4CO3A 1KVBA 2FLLA 3UIQA 1KSPA 2E9ZA 1GLBG 4DL4A 1N56A 1LWFA 1D3WA 2N7YA 4JV0A 2V6AA 5BPNA 1FE0A 4O0IA 3QJLA 5FD1A 4H4OB 1CZAN 1W9HA 1MN9A 4LY7A 1R8CA 2KVIA 3A5NC 4JI1F 3DJCA 1N4LA 2UU9F 1J5EK 1ZA2B 4BC2A 2ZHAA 3F56A 4KPCA 4BVOA 2VICA 1LK7A 2NCKL 3D7SB 4E19A 1TMMA 4OL8A 1SB6A 2B51A 3QZ7A 2QKKA 4J9QA 1BQNA 1HBNA 2GHPA 3W63A 4BC7A 5JMNA 3VN5A 1S1WA 3DRXA 2GV9A 3FSYA 3MTKA 2MLXA 1FRJA 3WX4A 2AJ1A 2ZC4A 3HTVA 3X3UA 3W66A 5FPDA 1S48A 1WC6A 1TL3B 1SUQA 1TK5A 2RDDA 5I3UA 3CJ3A 3T1HJ 4DQIA 5KT5A 4ECXA 3H3OB 1WDDA 3IFRA 4H4MB 2O67A 1C1CB 2V7YA 5C12A 5ETVA 2MQLA 2XC9A 3W5XA 3DRPA 2W2MP 4FW1A 4CHPA 2OD4A 3M6VA 2EVZA 3EXYA 3FDSA 4DR3F 1REGX 4DR7J 3ETMA 3R1LA 4LF4K 4CECA 3RJMB 1Y5IB 3L7UA 1FX4A 3OYJA 2HNDA 2QN6B 2Y1RI 1JCEA 3V6JA 2GWKA 4DFKA 1R43A 3U02A 1GXUA 2G4BA 1ASWA 2XZWA 2P9SA 2H5IB 1S7HA 1AFIA 1D4XA 2RHSB 3D1OA 3TX0A 2YKOA 4PL8A 4HCCA 1UZHA 4U7CA 3O5TB 1S0MA 3EM1A 4QIWD 4JI5F 4F25A 5KFLA 3A3PB 4JI5K 1VGYA 4BDZA 2F9DA 3OLAA 1TUWA 3KIOA 3OYIA 2UUAJ 1R59O 1DTTB 5D6GA 3CULA 1RDAA 1HHTP 1VSJA 3OR2A 3WXLA 1RT2A 2LA6A 1DRZA 1XNQK 4GKJJ 1C0TA 1NH8A 3LM9A 4IJNA 3IR6B 1TV6A 2YJFA 1NGGA 3J7AN 1K47A 1URNA 1QTNB 1J5OB 4JI7F 4IOXA 3UDCA 3MEEB 1RT1A 1QZ5A 2W2NP 4FW2A 2I9SA 1H38A 4JKEA 1WHVA 1RGIA 4IRKA 3L3VA 1F9EB 3GSDA 1KQFB 3QBCA 2MSTA 1R7IA 1KN6A 4HDHA 3POTA 3NWRA 2RT3A 1SV5B 2UVWA 3GIRA 5F0WA 1C0UB 3BGRA 2DK2A 1T11A 1U26A 3ISNC 4MKAA 2ZVSA 1N33K 4L74A 1JLCB 2KL8A 1NZAA 3OT9A 3RMDA 2HS4A 2XSJB 4BGAA 4F3QA 1RAFB 5JJBA 1LXNA 3RU0A 3DLKA 5JVGQ 3C7NA 2UUCK 1VS3A 3OTCA 2F9JA 3A8JA 1QQOA 3OYFA 1JLEB 2B9EA 4J37A 1K8AO 1KDNA 1HNXF 2P2CB 3NF8A 3I0RA 4W5TA 3GLJA 1I39A 1RACB 3QSIA 1WSJA 5SZTA 2C2EA 2B56A 2V4RA 2CVEA 4NA1A 4ECWA 3EY1A 1QVFM 2IFXA 1IN0A 2MGZB 3KHHA 2C3OA 2DR6A 3HDSA 4XH1A 4EP5A 3GWCA 4DSIA 3FNNA 2O01C 5FPMA 3S7RA 4USIA 2MHNA 3ASMA 4PY5A 4X4RA 1EWQA 4BRFA 1I3AA 4FPBA 1FRKA 1XIQA 1WSHA 5DG7A 2QWOA 4E8UA 1ZBUA 1Q86O 1VRTB 3EGZA 2DH9A 5AFUA 3C14A 4JB8B 4JI8J 5C42A 2DIUA 1K8KB 1SC6A 2XMUA 4W98A 2YKPA 2D3ZA 3CFOA 1XI1A 4XO0A 3J7YI 4YR0A 2WVBA 2H65B 3AAQA 4IUFA 5DO2A 1IJFB 2CPJA 4DTJA 1RAGB 4NCGA 1TL1B 3N79A 4K4VA 3CM5A 1S22A 4NO7A 3QNNA 2VA3A 1R27B 2AEMA 3NMAA 4IEEA 4CFDA 1S6OA 5KG6A 4RTFD 3GPAA 5I3QA 4F4WA 4FWOA 4YOYA 2BE2A 2YY3A 4YY3J 3B54A 1DFDA 1JJ2M 2E29A 2IJRA 1T3OA 4BBYA 4YN3B 4DV5J 4DV3F 3PNIA 5DMRA 4HR2A 2EFNA 4OHVA 2GMHA 1N32F 1OH5A 4JAXA 1BLUA 3R27A 3J81O 5E84A 1A5VA 1JJCB 2NUUG 3GYNA 1BD6A 1ZM3A 1YHQS 2WCXA 4RW8B 3PR4A 1ZPVA 1RT3A 3CCJN 4CFAA 2G8WA 3KHLA 3O1BA 2G1HA 4CZMA 5L9XA 1TFYA 2AF6A 3VF2A 1VLOA 3IS9A 5KFKA 4ZP8A 4OYXA 5IT9Y 1UVNA 1FXLA 3F5TA 5EY4A 1VRUA 4LF9J 3UE5A 2GX9A 3IDHA 5BPLA 2QIFA 4XDCA 2H54B 5JUMA 2O4GA 4UUWA 3CQXA 3AVIA 1C1BB 5GMDA 1PKUA 1EARA 3NS7B 4WFZA 4JN4A 1HARA 1UJ5A 2GHVC 3TAGA 3O6WA 2Z30B 4DWIA 4XIUA 1IBKK 4UOFA 4J8FA 4CP5A 2BBEA 1KTVA 3TZYA 2QA1A 1NSPA 4QPXA 1VQLN 1YTUA 3CPEA 4XDDA 3UNGC 5TKWA 3GFHA 3HZEA 4F4KA 3H6EA 1EQYA 3F0NA 5JMVA 1L5UA 2AEJA 1KD1T 4YR3A 2MKHA 2G2YA 2H3GX 3LZIA 2DR9A 3I8BA 1B7FA 1RTIB 3RWUA 3WQPA 1RAHB 4M3TA 2A10A 4MTPA 4FOIA 4PQUA 1TTHB 1FDNA 2IBOA 2NRXA 4NI2A 2RAQA 3CJ2A 1L3VA 3IO1A 2HGMA 2VQEF 4KYZA 4FXWA 2VQEK 4FNIA 2YX4A 4BR9A 4RLEA 5D8HB 4DS5A 4M3ZA 3M1VA 5KFOA 4ZP6A 4DV0F 5A0YB 4KH4A 1T05A 1N5TA 2OPQB 3BQ0A 2RILA 4LRFA 4CZHA 2UXDK 4AL6A 3LM2A 4FYXB 1HQUB 3DRSB 2XLKA 1U4BA 2JZ5A 1GLCG 1HPZB 2MKCA 2ZZTA 2CNLB 4FP9A 3F41A 2DD8S 2B5JA 3J80U 5B8HA 2J0WA 4CHQA 3I0SA 4BR7A 1SJQA 1HJRA 3QWPA 2BM1A 1HD0A 2CGLA 1YRXA 3IR7B 2WOMA 4ZTJA 4IH5A 3P8BB 4DBQA 3MWTA 1VSIA 1G99A 3KUGA 4QR2A 2DGSA 3OFHA 1FJGK 1S12A 5C10A 1NGEA 2OZSA 3H2VE 3VV2B 1WJ9A 2LXUA 1BO5O 3H08A 2HFOA 5H9FK 3QPIA 3H5UA 4OX8A 2GC8A 2ZJPQ 1TUGB 2FSJA 3W7BA 4PKHA 5KT3A 1YITN 2QL9B 5IT4A 5E3RA 3T69A 2ILZA 3S9HA 4CJVA 4J2AA 4X62J 1YKWA 1T9VA 2K8GA 2FZGB 2J9CA 3CC7S 4LF5F 3M2RB 2GEMA 1HNWF 3LDOA 4M5GA 4LF5K 4C3LA 5J1EA 1QY7A 2IVOA 3M5RA 3MDFA 3CJCA 4BWJA 4DG1B 1YTAA 1VHIA 1FO1A 4USVA 1BGXT 2MSSA 4I56A 3E8OA 3HZ6A 3QFHA 4R25A 4F9OA 4K4WA 2HBZB 3ATVA 4QZVB 2EBGA 1CJTB 4FWNA 3TNVA 3PIPL 3DLLL 3GP9A 1U1RA 5DJBA 2E5LJ 1IKXA 5CYQB 3NF7A 4LT6A 4KHPF 1WC4A 2YXLA 3JTNA 1VQ9N 1HRHA 2PYLA 1SKSA 2OCEA 1JKHB 3RAMA 4PRFA 2KTQA 2V9KA 2O8FB 1VR6A 4Q2MA 4GO5X 2RRBA 2YPZA 1R8AA 4I2PB 4CF8A 2R7XA 2BQ3A 3WQTA 2U2FA 4K42A 2PMZD 2GJ2A 3NMUA 1SH2A 3BSCA 3A1YG 4LJMA 2ZWHA 2A42A 4TNOA 4CNZA 3AGKA 4P2MA 4YB1P 1MROA 4KH5A 4IG3A 3IM8A 4OQJA 1T44A 3AVKA 4JV2A 2V8VA 3IG1A 4CO0A 2Q2RA 3V81B 1NLVA 2P9LA 3O9SA 3B82A 1W25A 2FBXA 3VEVA 3TSPA 4HT5A 3R8EA 1Z2LA 2VFSA 4WFNL 3A2FA 4JKCA 1RT4A 4ILRA 4LBPA 2YWKA 1ZOTA 4IOBA 1N36F 1X4DA 1MG7A 3DI6B 1S6UA 2HVIA 2AX0A 3UFCX 1VQOS 5GMKa 4HHTA 1YI2S 2G0JA 2UUTA 4CJEA 4OJRA 5AQMA 3HRGA 4IBNA 1XMQJ 3KXDA 3R3TA 3R97A 5KGXA 4IG0A 4JKGA 4N5SA 1ZBIA 2E1CA 1LWCA 1HYSA 1PSDA 4RUCA 3HHLD 2R8IA 4H5VA 2ZBQA 3RBEA 3RMAA 2ZM6K 3SFGA 4EU0A 3BO2A 3B6PA 3VCDA 3VOVA 1FA0A 4YP3A 5CH7B 1BL3A 3SQ4A 4LC9B 1YJNS 2XY7A 5E33A 2PA3A 2EG2A 1CULB 5IZHA 1WNEA 1C4CA 5EX0A 2VJUA 2OHDA 2GIFA 3R5JB 3P5TL 5U47A 3RYLA 4KY3A 3MEGB 2RJZA 3CJTA 2DO4A 2LQ5A 2GVZA 2ZBRA 1YJWS 2Q1NA 1J5EJ 2UU9J 4OO1J 2YX6A 2KYZA 2CNKB 4WQ4A 2CH5A 3GU0A 3QESA 2QM1A 3DDIA 1KWMA 3HJFA 3VHQA 1T03B 3K5OA 1DKGD 1LQ9A 1W26A 2WONA 1N34K 3DAWA 3HOTA 2G8IA 2QL7B 1OY9A 3O80A 3SSQA 3RZAA 1RBRA 1CC7A 1NDPA 2YTCA 3H7HB 3N6MA 4AL5A 2VPZB 4AD6A 3NF9A 3FMWA 3AA2A 4AE5A 3ELHA 4M63A 1HKAA 2W7AA 3MEDA 3MAQA 4UQTA 3M8RA 2DNKA 4NLCA 3KMSA 5AJ3K 4JKHA 4MK8A 5BYSA 3B4MA 4Q0BB 8ATCB 3CCZA 4DUYK 3M8YA 5LJ5Y 9ATCB 3HVAA 4FZYA 2LQBA 2BE7D 4PKGA 2IYIA 4I67A 1OJ4A 3H5YA 4BS2A 5FLXO 2HEKA 3D3CJ 2JHEA 3H4BA 1W7AA 2EC0A 1V3SA 3WIVA 3UN5A 4OJ3A 5A8KA 1X4GA 4B9SA 4C4WA 1T8EA 4N41A 3VGMA 2D69A 1P9YA 4DR3J 4O4RA 2DXDA 3SQGB 2JDJA 2B4UA 1MMNA 1RDBA 2CA9A 5A8RA 1SJ3P 1QSYA 5B0CA 3EMTA 3NXZA 5KFJA 3HKZD 3AOCA 3FZBA 4BRLA 4CHZA 3LH2S 5F3TA 5F41A 2F40A 3KKFA 4ZCIA 1MDUB 2UVRA 1XNRK 2NXNA 5AT1B 4J9PA 3UN3A 2IA6A 3LALA 5B09A 1F9FA 3GJQB 1D9AA 5F8LA 1KRPA 4JI5J 5CR4A 5KFYA 1UFWA 2QG9B 3S1TA 3VWSA 2HFVA 2QLFB 2BW7A 5KI6A 3W61A 1U0HA 1LW0B 4KHRA 1RWNB 5KFZA 1XNQJ 2FD2A 3OR1B 4DFJA 2DGUA 5ETKA 3BS9A 4LF6F 2Z2YB 2AWZA 5BR9A 3SUOA 1Q1KA 4DU3A 1GEHA 1T3VA 1YVNA 4RCHA 3TA0A 4OX9K 3NG8A 4ES2A 2IM2A 2JX2A 3WIUA 2C42A 4IO9L 1KVKA 3QFUA 4J9VA 2B8QA 4QIGA 1EX8A 3K5PA 4U7BA 3ILJA 1T0TV 4CLZA 3FEYB 2WZ1A 4ISFA 3OUYA 2B6AB 2EKNA 3SCKE 5KQDA 4OYBA 3LP1A 4F7VA 1X4AA 2DGQA 5HMXA 1Y3JA 1SL2A 2W25A 5F1XA 2O8EB 1OO0B 1OYDA 3G10A 4JI0F 3WEEB 4DU8A 3UR0A 1U2RA 4JI0K 3R5BA 3WX8A 2GJFA 5A8WB 5B0AA 5EX3A 2UUCJ 2JEIA 1Y9OA 2EWHA 4Q2LA 2A5XA 3R8YA 2CPYA 2YQ0A 3HSCA 3HMJG 4A47A 3D45A 1D0EA 1RTJB 3G4SS 3M8QB 1ZBHA 4USHA 5AQPA 3UKRB 1RK8A 4QWAA 2B7BB 1MWZA 1T9UA 3QO9A 5K20B 1RAOA 5ETOA 4P10A 3WXIA 4ETXA 4FF1A 2WAQD 4ZTFA 4JD2B 3IWLA 1Q0NA 3QDKA 1RHRB 1SPBP 4IDKB 1FFWB 3HHLA 1SBRA 3UCZP 4Z4FA 1BWEA 3BREA 4M5HA 4OZNA 5HSPA 1IKYB 1YJVA 4RW9A 2HG4A 5ADZA 1TELA 4JS4A 3BKFA 1VDHA 1BI4A 2DYAA 3PY8A 2HPUA 5HVFA 4HUGA 2AZ1A 2DNOA 1AW0A 1VBXA 4UY8T 3M2VA 1IBMF 2FDNA 1HQEA 2M52A 3ULHA 3J7Z5 3M2UA 2YBVA 1S99A 1YRTA 3JYTB 3KLGB 4WP3A 3G0ZA 4NLBA 4I1TA 2HF4A 5LMNF 2XG8A 3WXKA 4CEZA 5LMNK 5B0GA 1L3UA 1OH6A 5FDLB 4Z4EA 4ZHRB 5E41A 4LVNP 1LV5A 3L09A 3CI5A 3BO4A 1H2TZ 2KI2A 1LFPA 2NR0A 5AXNA 2KKHA 5G0RA 4JKBA 5CHIA 5BPMA 1EETB 2W6LA 1F9HA 2VOPA 3OYNA 3D5MA 2MLYA 5CCLA 4ZVEA 3SCXA 4ED7A 2C3YA 2LDYA 2Q0RA 1RU2A 4DSJA 4HL9A 3ZSRA 5ADXA 1SJRA 3FRYA 3CPWR 3PLAA 2V4JB 2B4JA 2O3DA 5CYMA 2J7UA 3ULEB 4CE9A 1RLCL 1ZS6A 2FB0A 3AOAA 4CQ1A 1U25A 5F8GA 3VAMA 2RD5C 3IGVA 3A8IA 2FPHX 3P83D 3QWUA 4IH7A 4ILHA 3TSQA 4BRDA 2F7TA 4DQPA 3AVGA 4K2JA 4KRWA 1BA0A 4Q8EA 3P31A 4I68A 4PA1A 3CM6A 3VQQA 3Q83A 4KFBA 4LBHA 1QD1A 3HBTA 3VF0B 2F8MA 2WW4A 2CUYA 5HP1A 4KREA 1SJFA 3EO3A 4V19X 3AVCA 1HWIA 3RRKA 1DLOA 4JOUA 2Q6CA 1UVIA 2GIRA 2H4WB 3VAJA 1WELA 4ED0A 5HMWA 2ZBCA 4DPWA 2IM0A 3CMES 3D6HB 2PI4A 3CCTA 5D0EA 4Y1CA 3DHWC 4I7FA 2I38A 3CJ0A 4KO0B 3JB9k 4R0JA 3TX8A 4DV2K 1IBKJ 1N48A 4W4MA 3TI0A 4JK7A 4NLRA 5EXWA 5J2MB 2IM3A 4FM1A 2OKQA 3AVBA 4CHNA 3FKBA 1HYZA 2CGJA 3DDNA 2DNNA 4Q7AA 3UCUP 3EZUA 1JQGA 3KK3A 2YCHA 3SCJE 4ATNA 1M1GA 5HQMA 3U1LA 1RFQA 2RH3A 5DGAA 1S7IA 4O0NA 4ZKAA 2SXLA 2G8UA 1FI4A 2DISA 4IFYA 4MJKA 2D0OA 2AJ0A 4CO1A 1OVYA 3CCVN 2HVDA 4OJHA 2IMOA 1S1TA 3S3MA 4ED5A 3KJFB 5L1IA 1IKVB 2E7VA 1RAIB 4KKOB 4F2RA 3GV7B 5E5NA 1OWXA 3GV5B 3EZ5A 1GLAG 2VQEJ 3AA4A 4BG8A 3OYAA 2I5JA 4QIFA 3CB4A 3MM7B 1NPRA 3WHIA 1NK8A 4WTOB 2NRHA 2UXDJ 3PUFA 1RE1B 2M9KA 4JYAF 5DM7L 3CJQA 3T5KA 4JYAK 1RILA 4MDAA 1FWKA 4ID1A 3VAIA 1WUUA 1HNVA 3QLHB 1IH7A 4FK2A 3V6DA 2Y1LB 3S01A 1NGDA 5HI7A 3P96A 3C66A 4QCLA 2P9CA 1FWLA 3HYFA 1HHSA 4HHHA 1KAXA 1ATNA 3O6QA 1QUPA 4ER8A 3O3GA 2BGGA 5HLFA 3D4JA 2QLBB 1AZSB 1GX5A 2CQ4A 2E5GA 3HL8A 1FJGJ 2FHOB 1WDTA 2ZH5A 1ILYA 2DHAA 3K2PA 1R89A 3FBEA 3O9RA 2UP1A 3H3NO 3PJXA 1RAJA 2DITA 4LQ3A 5H9FJ 3KHGA 4OV1A 3EVMA 2RDJA 1NGBA 5T7LB 3ISND 2C3MA 1PBAA 4A2BA 1M5VC 4PKDB 2ZDOA 1QAXA 2J8SA 4XEIA 2HNYA 3SDEA 4L73A 4U67L 3RRHA 1B0TA 4H5TA 2ZE2A 3I56N 3BBBA 4CYUB 4Z4CA 3H98A 3A0IX 1HWJA 3MM8B 1R8BA 1SC4B 4KTZA 4LF5J 1WAFA 1HNWJ 4JKDA 3M30A 4DX5A 2JEGA 1WG1A 3IBWA 3J7ZT 3Q8YA 3MWBA 4K43A 4O3SA 4W5OA 2EW9A 4RW6B 2QMUB 2D0BA 3KDNA 1CJKB 3OL9A 2JEJA 3KLHB 3V1QA 5KFTA 2EFOA 1KQGB 4NRUA 4PG4A 1VJQA 3GCXP 2XYPB 2XGQA 2MY8A 4FWMA 3L3UA 5AQSA 4WFYA 4DSFA 4DF8A 1RAEB 4FLVA 3HD1A 3AGRA 3J7A1 2IVYA 4B02A 2PYJA 1VBKA 3TVZA 1JLGB 4KHWA 3KUHA 1JJ4A 2DPNA 3D0GE 4X4NA 4PYDA 3LPYA 3UDLA 2HQCA 1S72S 1KNZA 1ZBLA 2MPUA 4OIXA 4BRHA 2NQPA 4R8UB 1FRLA 1SKWA 2A2CA 2CPDA 4RBTA 5DS7A 4KBOA 2VFTA 3EZWA 3SCIE 4U6PA 1IUJA 3QIPB 4JKAA 1YBUA 2JL9A 2W9BB 3CJ5A 1LW2A 2QLWA 4DPYA 2HNZA 3L2WA 1WSRA 3O9UA 3OTEA 2POKA 3V9WA 4DR5K 1S49A 4JI6K 4G3IA 1SAZA 5J2PA 3R5DA 3Q8SB 1BWVA 4K4XA 1Z25A 3GFZA 1X4CA 2GZOA 1CG2A 2DNPA 1EKSA 4KAIA 4X4SA 1FDBA 3EWGA 4WFXA 4LIRA 3N6LA 2D9OA 2LA4A 5DG8A 1FWPA 3EVOA 3G6VA 4H54A 4UZCA 2ZHOA 4FJIA 3J80O 2IS3A 3MM9A 1U02A 4M1KA 1ZH5A 2XMTA 3LDPA 4ZLPA 2VBWA 3ENAA 1HKGA 5KFVA 3DM2A 1HQ2A 2VG7A 4WTYA 1RWWB 5KT7A 3TAMA 4F4XA 4LF7F 5KPZA 1UW9A 3G6YA 1VQNN 1KC8T 1WG4A 4HTJA 4PXDA 1KVAA 2LU2A 4HUEA 1VHFA 2IVPA 1V3ZA 1HLUA 3OS1A 4NLSA 1PAEX 4LFBK 4L75A 2WFBA 3NHGA 3CJ8A 3ENVA 1W2BR 3ZCMA 2QX0A 1HR0F 4HLBA 2Q6BA 3MDQA 5I4MA 2C2MB 3LZJA 3BGUA 5IWAF 1RXOB 2X6NA 4WIQA 4F3TA 4CVNE 1CXUA 4FS2A 2CQGA 2HZCA 4M3XA 3VAKA 1SXLA 3OVBA 1YF5L 3K2YA 2E2NA 2VFRA 2DXEA 1B9FA 5BN8A 4KBIA 4U8YA 2Z1JA 4O23A 2XY5A 2AT1B 1HWLA 1VJWA 2VUGA 3PIPQ 3DLLQ 2Y8WA 5DDOC 4AQYF 3PW7A 3ET6B 3UNYA 2WC9A 2IOCA 2ZF5O 1P1TA 3PX6A 1BDGA 5AE1A 3LPEA 4U8VA 3ZFVA 3UWTA 3HZGA 3DMJA 2CDRB 4M41A 2BZ2A 4B3TF 3EN9A 4J5OA 4CO2A 4B3TK 3O3LA 2W9CA 2QKBA 1TL3A 3V4IB 4CLYA 2E6MA 3PM9A 4BRGA 2BH1A 3CDBA 3CVKA 1S1UB 2EFGA 2KFNA 2R9LA 4DUYJ 1LAVA 3PZPA 2RNEA 4L3QA 2XM3A 3BGOP 1IKWB 3ZSOA 4Z7YA 1FEEA 4H4MA 1C1CA 4FK0A 1L3KA 5KFCA 4NLWA 2PI5A 3EUNA 2LSNA 4ECQA 4OZ0A 2NSBA 3FRZA 1M90O 5ETRA 3PIOL 3OW2R 4WFNQ 4CEEA 4GKKK 4B9MA 3L2VA 5BRHA 4NASA 3OVAA 4FJHA 3PFOA 4H0TB 2YQ3A 2EFQA 1BU6O 1NHVA 2HVEA 3KK1B 3I31A 2BQUA 1CZ9A 3MCAB 4ZP7A 4LR9A 2V2QA 2MKJA 5CD4A 4F0KA 4FJ7A 5LSLA 4IOAL 3KJNB 4LR8A 4J91A 4B3SK 3ILOA 2WSFC 4DDFA 3VGVA 1M5KC 5BR8K 4UZBA 2OH2A 1R8HA 2RQKA 2O4IA 1XNRJ 3TP2A 3W3DA 4OYOA 2VBZA 4YDXA 2H48B 1GLEG 2KHDA 5GAHP 2FZCB 1IR0A 2HB5A 3JS6A 2RIJA 1RTDB 3VAGA 2H5EA 3MZIA 3W2VB 1DTTA 5L1LA 4OGEA 1ZBSA 3G25A 4JI2K 1Q16B 1LOTB 4M5DB 1FKPB 2YPYA 3Q7CA 3G8QA 5AQQA 3MR2A 3AHPA 2F63A 2IMWP 3W62A 4P71A 3BYRA 3CCEN 2YHAA 3G6ES 3ZX2A 4LF6J 2DHHA 4NZ6A 5C5JA 4O4GB 2XQCA 1VK0A 2FC9A 2CQBA 2V2KA 1EX4A 2JWNA 4FPIA 4KH6A 1RHMB 3LP0B 2QTWA 4AHUA 4YNQA 4OYMA 5IT9O 2FVQA 4FL9A 2CZ4A 4WCEL 4LFCF 2BOPA 1YIJN 3K9KA 4PUOA 3OYBA 1SV5A 4TY8B 4J9UE 4NMLA 1C0UA 3D67A 4O0JA 1U0SA 4RZRA 3H40A 1FXRA 3PACA 4HTIA 1XR6A 4DUZF 4MMOA 4WZMA 1JLCA 1WG5A 4GC7A 1T9XA 3FSIA 1ASVA 2DRBA 4OHWA 4DLEA 2VQFF 4JI0J 3KUEA 3THTA 2IDOA 4DTXA 2K3KA 2BM0A 4JKFA 3C16B 3KK2A 3C0BA 2EXUA 1IBCB 3VQAA 5E0OA 3MPDA 1PBUA 3HPGA 2ZD1B 1B4SA 1RWPB 2FHMA 2GO8A 4YB5A 1FNOA 4B1XB 2QXFA 2CPIA 5DLGA 2OYQA 4Y2AA 5KFMA 1KLMB 3WC0A 2QSFA 1NJZA 2P6TA 3U9ZA 1Q8LA 4L6V3 1DT9A 1YJ9N 1NJWA 3TTDA 1M5SA 4WPAA 1NK5A 3HSZA 4NOHA 2MGZA 2FSNA 5ITHA 2PMHA 4GC6A 1X0FA 1F5AA 3D2EB 4E0DA 2HSEB 4Q8FA 5EGYA 4MKYA 4JV1A 4K5SA 2YH1A 3CDAA 3R3LA 2Z1HA 1KOHA 3BSNA 2MZJA 1Q7YO 3BGFA 1QAJA 3OVSA 3FVYA 1VQKN 4YOTA 2P9IB 1VRTA 1S4FA 5IFMA 3CF5L 2EG1A 3TAFA 4JNEA 5HBMB 5KFUA 1K8KA 3CMAN 1E4GT 3BBFA 4K2XA 5BYRA 4J9OA 1XR7A 5KPTA 3K9JA 2LLZA 3ALYA 5LMNJ 4NA3A 2AZ3A 1EHWA 1NLKL 1RT7B 1FDAA 1W7WA 2HK2A 4P73A 5F8IA 2C1EB 1HHQA 2JFDA 4M3WA 3HHKA 2FSKA 4DL0C 3RGIA 2YHXA 4NCBA 5HROB 4K4YA 1C4AA 4QWCA 2DNMA 3I6PA 3FZLA 3QGPA 1AYEA 2BJ1A 4LREA 1V4SA 2R7VA 5RUBA 2RSQA 2IYGA 4FM0A 3MN7A 2FVCA 3KFWX 4LSLA 2ZGZA 2NXUA 3F9MA 4IO9Q 2J76E 2V5HG 1NJIT 3AD9C 1H1VA 1RSCA 1UVKA 1WKJA 4BRAA 2QWQA 4EI2A 3I33A 4CHOA 3DOMA 1PIEA 3NL0A 2E1ZA 4WXWA 1F5CA 3V1OA 3G86A 3TOQA 4WQ5C 4F26A 2JH3A 2LECA 1O8BA 2X3GA 1FHTA 3K89A 1EJ7L 1GXLA 1XWLA 3L9ZA 2CDQA 5TKYA 3SLCA 2E5HA 3HSJA 4YEAA 3HLUA 3WXJA 1YLXA 3OBYA 2P5OA 5CQGA 4HYKA 1T02A 1WBBA 2Y1IA 4F36A 1FNXH 3VA0A 4H0OA 2B4VA 2X7IA 1H2UX 4FLYA 2HHQA 4GV9A 2EC2A 4DV1K 2J0QD 4RNOA 3DXKB 2OTJS 3CCRS 4ZVFA 1SKRA 1TYQA 4B9UA 3E01A 2HLTA 3LPUA 4IKAA 4DV2J 2FJAB 1SCJB 3M9NB 4OI1A 5IS2A 1M1KT 4PXEA 1N54B 2MMYA 4P9SA 4O5BA 1I94K 1NWKA 4IFVA 2J9DA 3M05A 2IIHA 3Q0AA 2KJWA 4CHYA 2KVQE 1YXQA 1LWXA 5F3ZA 3QT7A 3CJBA 1E4FT 4CO4A 1VK8A 4B3OB 1EQMA 2R2TA 3QNOA 4G1PA 1Q79A 2V8PA 3KKSA 1LAWA 2XEXA 4ERDA 4LUBA 2BV3A 1FJEB 4A8OA 4DL6A 1ATRA 3OXGA 2CZ9A 5EWGA 4A8SA 2VGMA 3HFZB 1FKOB 2WBNA 2VPXB 3TU5A 4ES3A 1MWMA 2UUBK 5GIOA 2WBRA 2D0CA 1NGHA 3GONA 4HACB 1NB2A 4WP8A 2E1PA 3DRSA 4JYAJ 5C24A 4NE9C 3ZT0A 1DHMA 1HPZA 1UAXA 3MMCA 3JSYA 1VC0A 1HBMB 1F6TA 1U8WA 2F4VF 2XRIA 4DZDA 2MY7A 2F4VK 2ASDA 2EK6A 4AHVA 4HDGA 2YNIB 1HI1A 2E1AA 3KD1E 5AZIA 4OHXA 3WZ0A 3MAAB 2HAIA 2WK4A 1ZM4A 4HCBA 2QEXN 2CJXB 1K73O 4LSZB 3HX9A 2DVIA 2UV8A 4MFBB 5M2RA 4FJ9A 2RKIB 3H2UB 2IC3A 4MAKA 5BJRA 3Q24A 2A6OA 3J81U 3B78A 1NH7A 3NGYA 4YOUA 1SH3A 5MLCV 1T3NA 2CQHA 2HQGA 1X1PA 2OIHA 2QWRA 3IMQJ 4ED3A 1OY8A 1TP7A 1RBOB 2FLOA 1C2PA 5KG4A 1Q78A 1TKXB 2GELA 4UUXA 4XPCA 1RZMA 2XMMA 5FPNA 3FQKA 3OHBA 1HYVA 1DQAA 4J7CA 4FNHA 2CQPA 3ZT3A 2LXIA 2DNRA 5F8HA 2LEBA 3OV7A 4F4AA 1JL2A 1TL5A 2QRRA 2R4FA 3NVMA 2HF3A 3M3ZA 1Q8KA 4J9SA 2OAUA 4PWDA 1CJUB 3QYYA 1Q4RA 3NGIA 4KGMA 2FIUA 4RX6A 4E89A 1RTZA 4JK8A 4A8XA 4TQSA 1H7XA 3BQ2A 2ASYA 1R8PA 3THXA 5DDQC 3M8WA 1WORA 1HMVA 4CJKA 2FBTA 1UWBB 1T95A 4QW8A 2ZBPA 3SXLA 3M6XA 5CYQA 3GOIA 2RVJA 3C15A 2MZ1A 3EKUA 5D4LA 2YKAA 4MYTA 4M3UA 4FYWB 4M5IA 1JKHA 5B0EA 1QQCA 2DGOA 1O0PA 1GMWD 4ED4A 1U1QA 3PHTA 3BF4A 1GH8A 3SBGA 4I2PA 5KG3A 2J6TA 3CUNA 3EGWB 1Q8IA 4X64K 2XS2A 4BRCA 4BGBA 2KT2A 3OYKA 1KLNA 1NUEA 2RF2A 3ZXWA 1NAQA 5HQLA 5DM7Q 1W2IA 5GAHI 1IR1A 1B92A 5CHCB 3CXCR 1ZC6A 3V81A 2NRWA 3OVNA 4DR5J 4ZS6A 5FJ4A 4JI6J 2GTDA 3T9NA 1VQ6S 3SBTA 4JI8F 1BCMA 3GB0A 4EHUA 2PFDA 2L3MA 4ZA1A 3ZX0A 3VEYA 2V67A 3K0SA 3O3FA 3FFKB 1R6VA 1UOCA 3AODA 1OPZA 2NZCA 3MXMA 4E7IA 3PEJA 1BQNB 2XULA 1CBKA 3DI6A 1F2HA 5C25A 4Z4IA 3ITHB 4ZPWR 3KLEB 4DL3A 3MTJA 2BKPA 4DN9A 1RABB 2R8GA 3QBWA 3DOKA 5K9FA 2XLIA 3HHNB 4Y3CA 4FK4A 4LF7J 4TKTA 4CH0S 4J90A 4B3MK 1RBLA 2HK3A 3GYGA 4RNMA 5IC6B 2UXBK 2D74B 3E2EA 4IJAA 2DH7A 4HH0A 4U67Q 5M1QA 4DQRA 1EKEA 1GAOA 4HVJA 4X4OA 2VWJA 3IP0A 2OD6A 1VSMA 4KJIA 3S8SA 3C6AA 1HFEL 4KGVB 1CULA 1WEYA 2NUHA 4DX7A 5GADP 1HR0J 1WF1A 3NKYA 3AXMA 1RADB 2DCLA 2KT3A 1D9DA 3K57A 4E7LA 1TAQA 5IWAJ 2WSEC 1E6YB 1RA6A 3EGVA 3WT0A 3SAHA 2CJBA 3RSEB 3MEGA 2IM1A 5KFNA 1VQYA 2RPIA 1Z4UA 4TVAB 1GLDG 5THWA 3TEHB 3B6OA 3CD5A 4J9MA 3AARA 4DB3A 1RB0A 3MPVA 3RRGA 1T03A 3SQOP 1WC3A 2ZUAA 5IXUA 5K8NA 1S77D 2ITMA 2P9SB 1ZA1B 1KONA 2E2PA 4DTRA 5LY3A 4ID8A 2J4RA 4O55A 2VG5B 4RL1A 5HANA 4E1MA 4P6QA 4B3TJ 3KTQA 2E4LA 2OTLS 1S9GA 4RW4B 3OL8A 5GVQA 2KXFA 3OR2B 2A41A 1NM2A 1Q81O 4U95A 1RT2B 5EUHA 5AQWA 1C0TB 1X0PA 1TV6B 3A3OB 1QSLA 4JUZA 5AQYA 3PCOB 3SEOA 3CMQA 5IM0A 3A13A 4GVMA 2NLXA 4Y34A 4ZIVA 4BC4A 3TUJC 1RT1B 2AMCB 3CE8A 1MU2B 4DV7K 1ZPWX 3VALA 2YI1A 2QJ3A 4K5RA 1XQIA 4FS1A 4GKKJ 3O08A 4BR5A 5GAGP 2LP4A 4NLUA 3KJQB 4FF2A 3POTB 1S57A 5AQUA 3VQ7A 3PYEA 1V9OA 3FZKA 3DYAA 3QRQA 5D3GB 3ZTSA 1NSQA 2XHCA 4F3OA 4FXDA 2OSRA 2NYIA 2V34A 3L0QA 4CGGA 4B3SJ 2O8CB 5JLFA 4V19S 3GJTB 2HMPA 5KOWA 2V50A 4CF2A 2XO6A 4QAGA 3O8MA 5KG7A 3C7NB 4N8NA 5KQ8A 3VGSA 2AIRB 4QS8A 1TUVA 4IH6A 4L3KA 2F4FA 4CJQA 2CQDA 1PJ6A 5E7OB 2BJ8A 4ISEA 2X78A 1LW0A 2FJXA 1LOUA 5M2PA 4URQU 3OR1A 5CYJA 2G8KA 2AYEA 1ZAVA 4KHSA 1QSSA 4FM2A 1S5ZA 1MLAA 2L08A 1A6LA 2XCPA 1U6FA 1EO1A 2R7QA 3MOZA 3N9UC 2I1RA 5LSRA 3BM7A 5K8OA 1Y4ZB 2X1GA 3A3NB 4MLEA 1XBWA 4USWA 4HKQA 3LGHA 2E5IA 1UL3A 3MCPA 1XMOF 4ECTA 4NXMK 3UCGA 4X62F 3MHYA 2B6AA 5EOYA 2Q3PA 2QO3A 2XGPA 4UOCA 4F4ZA 4PABA 2MYFA 4DPXA 3LDLA 3M8SA 4WYLA 3T1YK 3MECA 4DUZJ 3JAMO 5LM7E 3IUCA 1D5AA 5LMUK 4WZQA 3WEEA 3SNNA 2A3ZA 4I4BA 3NOGA 4M42A 1UEKA 5C2CA 5A8WA 4HHJA 3OLBA 5C0YA 3D0IE 1YHQN 1R0BG 2QWLA 4RNHA 1UPPA 3QT6A 3UB5A 3AB2B 1B0PA 1RTJA 4X66F 3M8QA 1FESA 3A8KA 5FRMA 4X66K 4F67A 1U1OA 3UE2A 3BGLA 4DEZA 4DLGA 4W5RA 1IG9A 5AXLA 4DCJB 3PIOQ 4YR2A 2BE2B 3E3XA 5JLHA 4C8OA 2RS8A 4WKRA 2JNJA 4C9DA 2MEWA 4JD2A 2M7SA 2QI2A 1K1QA 3K17A 4IDKA 4DX6A 4NB4A 2H5JB 2ZOFA 3EX7B 3CERA 5FLXU 3ZC4A 4O8UA 4C97A 4IOAQ 2ZITA 4WXOA 4ITSA 5A6WA 4CTAB 1OKJA 4AM7A 2FHJD 3QRRA 1ULRA 1VK3A 2AA4A 2AX1A 4DR2F 4KI4A 5B0FA 1AUSL 1S0OA 4AXJA 1CVJA 3OTBA 2NZTA 3IS9B 1RKJA 4KHMA 4BDYA 3H46O 1QE1A 3KLGA 4AHSA 4N77A 4USKA 2WVFA 2DFEA 3VPZA 3MR6A 4DV4K 3TRGA 4YOWA 3Q8PB 3CCMS 3ENBA 4IR9A 4NYNA 5FDLA 4WU3A 4ZIWA 3NNCA 4Q44A 2K1RA 2DNGA 1N6QB 3OJUA 4BC9A 4CJUA 1NU4A 4IFEA 1D9FA 4YHHK 1EETA 2P5VA 3OXLA 3KLFB 1B7YB 4RR5A 1HBOB 3THWA 4PEOA 2CNNB 3DLRA 3E9PA 1IV0A 2WW8A 4DTOA 3QIOA 3MPYA 4WCEQ 3E51A 4PXBA 2HHHK 5J2NB 1BIZA 4FJGA 3J8AA 1REVA 1Y7PA 3PVXA 2W4CA 4BACA 4X4PA 4ZJQA 2X74A 1RYSA 4PQUB 5EHHA 2AYMA 4I69A 3ZTPA 4NI2B 3ENOA 2VZ9A 5EU7A 1OVQA 2BMBA 4Y2KA 3JSMA 4CF0A 1J5EF 2NS1B 3M1VB 2FLNA 3EZOA 3SV3A 3TVYA 4CBXA 3DRYA 2A2DA 1GFWB 3ISZA 3R6GB 4C8KA 3CPWM 2GQQA 4EZ9A 4DV1J 2QZ8A 3MCNA 3MFHA 2CNOB 5DZ6A 4CD1A 2D0AA 4CESA 3F73A 4JRQA 2XMWA 2XWYA 3MUVP 3M9OB 3NBPB 5J2MA 3BDPA 4EK2A 4HI2A 1NJYA 4C8NA 3OHRA 1YUWA 1ITGA 3EICA 3AAPA 3P5JA 2HZAA 1M5PC 1U1MA 3QEVA 3CC7N 1JB0C 3CCWA 1Z1ZA 3IM9A 4UTGA 5AQHA 2Z2ZA 2BYCA 4XH4A 4I9QA 3CF5Q 4JV5K 3RMBA 6AT1B 5E3QA 4M5JA 1VQMS 3DXMB 1SC3B 4Q45A 2DGWA 3FE1A 3T41A 3J81Y 5BN9A 3VF4A 4KKOA 3FBCA 3CYMA 4DQ8A 3QERA 3QRPA 1RBUA 5ELZA 1UVLA 2XBPA 4LF4F 3PW0A 4HUFA 1RQ0A 2VCPA 1U09A 2BANA 1IVZA 2UUBJ 2ZKTA 3EPGA 1U2FA 5F8NA 5M2UA 3VEOA 5M1KA 2P51A 3T3FA 5J1EB 1NHKL 5D4OA 1YWXA 5K14A 4E7JA 3I5CA 4DMNA 4WFBL 3QLHA 3KJVA 2QT7A 4OPJA 2X6SA 3AVHA 2ZHBA 4NEYA 4OYIA 4BWMA 5GADI 3AA8A 4BHQA 3CEDA 2F4VJ 4YOVA 4FLTA 1SVDA 4I2QB 2HRTA 2F8HA 1M1KO 2V9WA 2A6MA 1F3VA 1BIUA 1RDUA 1WSFA 2RHKA 4H5NA 2YV0X 3D6MB 3TYTA 1XNQF 3AA9A 4KTQA 3SI6A 2IPOB 3RR8A 4NLQA 4OI3A 3BKUA 4WYBA 2RN2A 2B9WA 4PQAA 2DT9A 2HW3A 2CGKA 1NBEB 5KFDA 3VQBA 2C2RA 5L8RC 2OPRA 4OJ1A 5T7LA 4BR0A 2OPPB 4R5PA 1FTRA 5FPEA 1TR0A 2W8LA 1NJXA 1VQON 4FF4A 1YI2N 1UKUA 1MROB 3SBMA 3U3YA 5KT6A 3CHWA 2GA7A 4CGFA 2LQ8A 4KGKA 2FHJA 4BRKA 3BJYA 4KT0C 2P9LB 5ETMA 3MM8A 1P9QC 1N33F 1SQKA 4WJBA 4IWVA 5EX5A 4TYBA 3US5A 4KHQA 3LQVA 4OZ2A 1X7VA 2PAVA 1CLFA 2WVDA 3FJ2A 1TK0A 3NWGA 4B3RF 3BPSP 4B3RK 4I6MA 1CPZA 3IAM9 1YJNN 4WE1B 4B9NA 2ZH9A 1YJUA 2UUCF 3ZZUA 3KLHA 3M6GA 3VQDA 3OL7A 3GG4A 3D2FB 2HGNA 1NNEA 3KG1A 3W9IA 4FJMA 4Z2XA 3RB6A 5JVHL 4O3QA 3R6MA 4DR4K 1IQTA 1IM6A 2DY4A 4DHYA 1X9MA 4F3MA 5GAGI 3BF3A 2RS2A 2XMKA 4CH7A 3HI0A 2KXHA 5DDRC 5AQXA 1JLGA 3VQTA 3V9ZA 1YJWN 3DHXA 5IQQA 3E9LA 1HYSB 3OPKA 1RJJA 4ED8A 5IT0A 2VB6A 2ZVIA 1CLQA 2ETJA 4OPKA 4B9VA 2W9BA 4BLGA 4CM2A 1ICEB 1IG8A 4FLZA 2LVWA 3OYDA 2GGPB 4EWTA 2W7OA 4PG5A 4QYZK 2PD1A 1U6BA 2BKNA 4TLQA 5KFIA 2H3EB 3EDRB 4KV8A 3NLCA 3R6LB 5IV4A 3DN9A 1U47A 2DGTA 3BZKA 1RHUB 4OMFG 3MM5B 1N5SA 3L4BC 2ATLA 1H98A 1IQZA 1U24A 2A40A 2Z57B 2J9EA 3MXIA 3GCWP 1DY3A 2W2QP 2CXEA 2KZMA 1P8ZA 2FBVA 2WONB 1RNHA 3SK3A 4NXNK 4WK3A 4ZN3A 3KMQA 4RWWA 1RT5B 2VOOA 2KW4A 4B9LA 5ETTA 4DOZA 3FBBA 3V5RA 3VQ6A 4EGLA 4JHDB 2YNGB 5GAEU 2XYGB 1RA7A 2WSCC 3HF5A 4RJVA 3T5LA 5DK5A 4RKUC 4YDUA 3GILA 3MEDB 2VPYB 1QM9A 2HHXA 5ETSA 2OSQA 3A5MC 2UXBJ 3T1HK 1PJ7A 1NOZA 3BKTA 2NSCA 4M3YA 5KRSA 2G0CA 4FVCA 1RWXB 1S9FA 2MZTA 3FZMA 4PR6A 1VSLA 1Y5LB 4K4UA 5A2QY 3D7EO 2AJQA 1VMBA 3TARA 3EE8A 1RTHB 2FBYA 2XNQA 1EZZB 5IC4B 3VQEA 2AGQA 2W40A 3LDQA 3GSIA 4CFCA 3MCOA 3HVRA 1Q18A 3OFFA 1H7WA 5JXSA 1WF0A 3LWLA 4KHYA 2MJUA 1KVIA 4ECZA 5A8RB 1Y10A 2HS0A 1Q82O 3L7PA 4FXVA 3JXUA 1Y5NB 4ZVHA 3W2WB 2FJDB 1LWEB 3UDEA 5CXTA 5GINA 4DCOB 3TTCA 3N4QA 4JEPA 4J2BA 5AQRA 3Q86A 4K8XA 4ED2A 3I32A 2OLWA 1GQEA 5KT2A 5DETA 2JFKA 2ZWPA 1W2BM 4GMJB 1G6BA 4OYWA 1IBKF 3WDOA 4IQXA 3MUMP 2DR7A 3ZZOA 1ZBFA 3OA9A 2M3DA 1K8AT 4D3GA 5HATA 2M0GB 1XEZA 4NYPA 2BRLA 3G2XA 3SMPA 1K44A 2Z1IA 1GT8A 4NEZA 1RYRA 3QFPA 3V4IA 2UUAK 1RDDA 1OMSA 1RKIA 3CD6S 2JVRA 2V4QA 4LBIA 1U0HB 1HL6A 1YX2A 2P9NA 3H5SA 3JQKA 2QA4S 1DJ0A 1RWOB 1T94A 2CPZA 1VSHA 4WFAL 3QEWA 2WVCA 3B8AX 4M63C 1J53A 3BZCA 2HOEA 4CJTA 1IJJA 4Y2IA 1HX1A 3DLEA 5M1PA 4CJ7A 2MKKA 3TANA 2JGUA 5ETPA 3SCLE 2QLXA 3EKSA 4CBUA 1SQGA 4FYYB 1GK8A 1WB9A 2FF3B 1VQ8S 1WSGA 3I5BA 2HHVA 2PFUA 3KK1A 3P5BP 4NPOA 1S1XB 4KR0B 3H59A 3SJJA 1NHUA 3C8YA 1DTQB 3G4SN 1Q86T 4L72B 3GQCA 5I42B 3I5AA 3LP1B 5B0DA 4Q43A 1MMLA 5AXMA 2UXDF 4FOEA 1X4FA 4L3NA 1ZTWA 1TKZB 3OFEA 4CZCA 4R79A 1BUXA 1AA1B 3KYLA 4EP4A 3TR8A 2LQ9A 1NG9A 1NOYA 5AFUH 1X9WA 4ZVPB 1YSJA 3UKUA 1RTDA 3HM8A 3TUZC 2OFGX 3OW2M 1N8RO 4IQMA 3LAKA 4FVMA 3W2VA 4HT7A 1JLAA 2YKNA 4IYQA 4M5DA 2KJVA 2HURA 4NZ7A 1FJGF 4M8LA 2NRTA 2JVOA 3CIZA 2EPIA 2QMWA 2RE2A 3Q8UA 1VLYA 2W24A 4GNIA 1JXEA 2HBLA 4CT8A 4O4GA 2AJ2A 1WSIA 4MLHA 4Z4HA 3CJKA 2XYHB 3CG7A 4O44A 1CEZA 2IGIA 4MQ3A 4MKBA 1XR5A 1WI6A 3BV8A 2ROEA 2YVSA 1U1KA 2BVZA 1BI4B 4QOTA 4LSNB 2ASOA 4H5WA 1ZZFA 2FJEB 1XMOJ 4NXMJ 4CJ5A 3NDKA 2F8SA 2WB4A 3KLIB 2U1AA 1HQEB 3SUQA 1URRA 2ASMA 3F9KA 3M2UB 4NWBA 2ZKUA 2J7KA 3VF6A 1P6TA 3VR1A 3OYGA 2HIQA 2M70A 3M32A 3D3BJ 1FRHA 3TA1A 5LMUJ 3CCQS 3ZSQA 1YT3A 1BISA 2GUIA 2P9UA 4LH4A 4FYVB 3C16A 2DIVA 2V52B 4FZXC 2YQ1A 2N4DA 5F8MA 1X5OA 4DF4A 3CQ8A 1V5IB 5A6PA 3ZZPA 3NMRA 1TFWA 4BVPA 1KTQA 3IWXA 4X66J 1KLMA 1PC5A 2P9PB 3NAHA 5D15A 3PR5B 1VHXA 3JS9A 1J54A 1JXLA 4NLDA 2Q66A 4YMEA 2IRUA 3JXOA 4C8YA 5DM6L 1CSJA 2XY6A 2EFPA 3FZ2A 2IDEA 3D2EA 5D4NA 3CMEN 3ID6A 4OV6A 5CZXA 1UEVA 3AA3A 4DR2J 5F2RA 4KFBB 3OYHA 4EBCA 4CJLA 3OY9A 4FJ8A 4RNNA 3GIKA 1I3OB 4TU8A 2J8AA 4N56A 3P3DA 5HVGA 5HP1B 4DZ6A 3B6BA 2F9WA 4WK1A 4DV4J 1RT7A 1UWAA 5ETQA 2E20A 1XJWB 1DAXA 4X84A 4I6YA 3GIIA 3ZNUA 1FX2A 3BPDA 1NB7A 5HROA 2D9PA 4I7FB 1LKZA 4ID5B 2N7CA 4K0KK 3HT3A 5EDWA 1ZM9A 5K5MA 2XMVA 3MOJB 2ZJQL 4LFAK 2VBYA 4FPRA 4CGDA 1C0FA 1FFSB 1ASUA 4BR4A 1FERA 2L9WA 3KK3B 2CZVC 2CQ0A 2ZM6F 3MM6B 2KHOA 3I55S 1WTFA 7AT1B 2AP6A 1UFKA 4A8QA 3VGLA 1YQHA 3SV4A 1W0HA 4UY85 1JLQA 1WHWA 4CZLA 3G9CA 2E7XA 1RHJB 2BA9A 3O2IA 1S79A 3MMBB 5HJYA 1GOCA 3W3SA 2MXYA 4CK3A 1S1TB 5IT9U 1SQEA 3A12A 3VQ9A 5GIPA 3Q22A 1PC4A 2FQQB 3RUBL 1RHQB 3G96A 3AQOA 1X4BA 4JBCA 1Q5YA 2J6SA 4USTA 1LFWA 4RBVA 1SZ2A 2DFFA 2I5JB 1O6XA 1X8DA 2KDOA 4FLWA 1N34F 3FZHA 2HHSA 3BN4A 4QYRA 3DXKA 1SIWB 4NLTA 1ROFA 1HNVB 1RWMB 2VH7A 2NRRA 1DURA 3RBZA 3CTRA 3BP8A 1QAYA 2HYIB 2BW2A 3CFRA 5AJ3F 4IRDA 2E1YA 2HRUA 1BG3A 4DUYF 1LEOA 1MWKA 3C95A 1VISA 2IBKA 1BWFO 1S0VA 3TEGA 3ZYYX 2KN4A 4B3OA 2ALZA 1U7LA 2HKEA 1X4EA 1WEXA 1FRIA 3ICLA 4JV5J 3VERA 2C2ZB 3CCUS 1UPMB 4CEFA 3UO0A 4ZPTR 3SDEB 2GCFA 3D54A 3LW5C 2V68A 4OFZA 4M5LA 2ZE2B 1FRMA 1FKOA 4LF4J 4ANCA 3NCQA 1CS4A 1ZM2A 2YWEA 2LXFA 3N28A 2VGNA 4OPAA 4C11B 4ZK7M 2PGCA 1DBDA 1H6KX 3PDNA 2VV5A 2ZC3A 1F0XA 3KVGA 2B7CB 4PCQA 4DCPB 4GY2B 2J0SD 3M30B 4DTMA 1S72N 2XSFA 4P2SA 3MR7A 1LK5A 3TZWA 1HBMA 1FXXA 1AFJA 1XNRF 3I82A 1MWQA 2PFFB 1N0UA 4KTWA 3P4UB 1NK7A 1FFGB 2E9TA 1EP4B 2BABA 3VAFA 4PL7A 2YNIA 3DLGB 4OPHA 2VC1A 4LRAA 3N01A 1N0VC 4QR0A 2DNZA 5LOQA 3MAAA 2KFZA 4FBUA 4EBEA 3AY9A 2DNLA 5C2GA 1U1NA 1RHKB 2DHGA 5L1KA 3LL3A 4MFBA 2RKIA 2B9XA 3ID8A 4DPOA 3KWGA 4USMA 4OX9F 1WACA 3OHAA 4O3PA 2FJBB 1WTBA 1BA1A 3FZFA 5HVHA 1QQMA 2P8IA 2DNQA 2VKZG 2QE5A 2K06A 3MMJA 2VDIA 3CGIA 5LXRA 2Z4PA 5ETLA 2EHGA 3CC2S 3PRVA 4ES1A 3O9QA 1SL1A 2E6LA 4OHZA 3SZ2A 2ITGA 1P8GA 4RO0A 1KQSR 4CT9A 3W5YA 5B08A 1OYEA 2QA4G 1S6PA 3MN6A 2Z0GA 4HVZA 4CJ4A 3P39A 1BUPA 1NSKL 5D0HA 1N33J 3J7AP 1JK9B 3J7YU 2V51B 2GMLA 1G1XA 3HD2A 3HXMA 1CJUA 1K1SA 2DY1A 3QIDA 1XK8A 3RTVA 4O3RA 3EL2A 1K9MT 4B3RJ 4FVUA 3D28A 3GIMA 3MPWA 2DNHA 1HBUB 1ATSA 4ECSA 3M8PA 1NMEB 2VG7B 3VQPA 4DR4J 1AB8A 2BJ3A 2UVVA 3TAMB 1X5SA 2G8HA 1XMQK 1KFSA 2VDHA 2LKZA 5IV3A 5HQ8A 1RBAA 2O8BB 4A8YA 2ILYA 4CO5A 4NL5A 3H90A 3PSIA 3LP2B 1W97L 2OO4A 2FYXA 3OTOF 1IBLK 4ZLJA 1TKTB 6FD1A 3OTOK 3OSNA 4DR6F 3AQPA 4DR6K 2YNFB 4NLOA 4ILJA 2IAJB 3QT5A 1Z2ZA 3T6BA 4CI6A 2GW8A 2JC1A 2ZWOA 3GJSB 2AGOA 1MSWD 2HMIB 4QYZJ 1HNZF 5E3CA 4WFBQ 5KFAA 1HNZK 3FCWA 4JI1K 2AGPA 4WF9L 2UU9K 5E3PA 3N4PA 2YX1A 1QLNA 4H0VB 1HNIB 4CLTA 3N4WA 3CD0A 3K59A 1RT6A 2VHGA 2KZZA 4ZPVR 1EWRA 3R2CJ 1KVCA 3Q8RB 2BEFA 4IKFA 1A0OB 4NXNJ 1TK8A 4C23A 2AJ4A 3ITHA 2F65A 3KLEA 2PN6A 3BY5A 2M5YA 3DMJB 4IR1A 2IJFA 1YBAA 1FK9A 1NZ8A 4QWBA 3N5FA 4BRIA 1A7GE 4DV6F 4DV6K 3E66A 1VQ4S 3C6UB 2W9CB 1VQPS 5AR0A 1S9EB 3CXCM 3HPOA 4BC5A 3HSTB 2DNYA 3CT9A 4LQ9A 5KG0A 3O8WA 3CQYA 4EYHB 3G82A 4YORA 4E7KA 4TU9A 4JLHA 3ZT1A 4ZVUB 3MWPA 3VA3A 4KH1B 1GXTA 2GV1A 4KPYA 1KXPA 2HLUA 1BHNA 1VOMA 1PYSB 1K0VA 1NPPA 1VBYA 3MMVA 3D9BA 5J2QA 1E6YA 4RUAA 3C46A 3RSEA 4DR3K 4K4SA 3NGKA 2DCUB 4O3NA 4NX9A 3NGSA 4JK9A 2DKOB 3L4IA 5JVHQ 4K50A 3EE3A 3CCSS 4DXLA 2D0PA 3G6EN 3EJMA 3M8ZA 2ERRA 3TAEA 2A18A 3DGPB 5H1SV 3O5BA 3R5GA 3GE9A 5CY4A 4AXIA 4F04B 3C6TB 4X65F 4DV2F 2V2ZA 1JNZB 4X65K 5KGWA 2VG5A 3VESA 1VQ5S 2GAHC