2IOCA

The crystal structure of trex1 explains the 3' nucleotide specificity and reveals a polyproline ii helix for protein partenring
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
230
structure length
218
Chain Sequence
b'TLPHGHMQTLIFLDLEATGLPSSRPEVTELCLLAVHRRALENQGHPPPVPRPPRVVDKLSLCIAPGKACSPGASEITGLSKAELEVQGRQRFDDNLAILLRAFLQRQPQPCCLVAHNGDRYDFPLLQTELARLSTPSPLDGTFCVDSIAALKALEQASKSYSLGSIYTRLYWQAPTDSHTAEGDVLTLLSICQWKPQALLQWVDEHARPFSTVKPMYG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Three prime repair exonuclease 1
publication title The Crystal Structure of TREX1 Explains the 3' Nucleotide Specificity and Reveals a Polyproline II Helix for Protein Partnering.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 68
structure length 218
sequence length 230
chains with identical sequence B
ec nomenclature ec 3.1.11.2: Exodeoxyribonuclease III.
pdb deposition date 2006-10-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2iocA01
4DSFA 1DLOA 3AVAA 1VSFA 5HRRA 4H4OA 3VQ5A 1BISA 4IG0A 4CIGA 4CF9A 4BACA 4DFPA 4O5BA 4E7HA 3LDSA 4WE1A 5J2MA 3SQ4A 4LSLA 4FK4A 3F9KA 2FBVA 4EP5A 1R0AA 1J5OA 5CY4A 4FJ5A 3SUQA 1JL1A 2HMIA 3HPOA 4CJRA 4CK2A 1XI1A 4HCCA 3HXMA 2DFHA 1L3TA 5HLFA 5K14A 3OYDA 4DQIA 1C0UA 3TAFA 3IAYA 3H08A 3ZSQA 4BDPA 4NCGA 4BWJA 1WAJA 1VSEA 1KLMA 3KJVA 4FJ7A 3OYBA 2ZQBA 3VQPA 4DMNA 2R7YA 3ZT3A 4KHQA 2HHQA 2OZSA 1JLFA 1Q8IA 3VQAA 3PX0A 4CHZA 1SUQA 5FDLA 3TARA 3OYLA 4FLYA 3AA3A 3S3OA 1W9HA 1T7PA 4DQPA 3DM2A 3MXJA 2HHVA 2HHWA 3CM5A 4AHTA 2G8FA 3RMAA 3JYTA 1HYSA 3HVTA 2P1JA 3OY9A 4CJ4A 1LAVA 1WSGA 4M3WA 2XY5A 3VQ7A 4ZTFA 4Z4FA 1RT6A 4GMJB 2G8HA 1UOCA 1RDCA 1HYZA 4YFUA 1RCHA 1RT1A 3DLBA 1D8YA 3U6FA 3O3HA 1BHLA 2E6LA 4E7LA 2XHBA 4Y1DA 2KQ2A 3CQ8A 3K5LA 1IKWA 1NK0A 3ZSOA 3AVHA 3WNEA 4CGJA 3LPTA 1C0MA 3A2FA 4FW2A 4JLHA 5I3UA 3D0PA 2D0AA 2OPRA 4DQSA 4CJTA 4FJXA 1RBTA 2F96A 3QEIA 4C8NA 4B9LA 4H8KA 4BDZA 1IKXA 4CJKA 3NH2A 4Z4IA 4CHYA 1JLQA 1SV5A 5HP1A 3T3FA 1S1TA 3OYKA 2E4LA 1C6VA 1ASUA 4AILC 4FJGA 4FJNA 2YHBA 1A5VA 3L2VA 3LP1A 1NK7A 3DLRA 4CF1A 1S1XA 3QIPA 4CGGA 1HNVA 2QKKA 3KKSA 1BIUA 1BCMA 3LP3A 3NGIA 4O55A 3QETA 2GBZA 2XY8A 4DWIA 4OJRA 3QEXA 4KI4A 3P1GA 2IDOA 4FLZA 2YNIA 5J2QA 2P5GA 1LW0A 4ID5A 1RTDA 3SUOA 1ZBHA 2I5JA 3DRRA 2B5JA 3TANA 1NJWA 3VQ9A 3DLKA 4CFCA 1JXBA 4IKFA 1CZBA 3WNHA 2OPPA 3NF9A 4KO0A 3M8RA 1KCFA 3L2UA 3P5JA 2D0BA 2WONA 1X9SA 3L3UA 4K8ZA 1TV6A 3SUNA 1CXQA 2HNDA 3KLEA 4F2SA 1TAUA 3SV3A 2G8WA 4AHUA 1RNHA 1W0HA 2VWKA 4KKOA 5CYQA 4BE2A 1S1UA 1GOCA 3SCXA 1HPZA 1VSMA 4IG3A 1RTHA 1VSIA 2JGUA 4ZHRA 3LZJA 4CCHA 4ELTA 2B6AA 4C8LA 3T1AA 3PX6A 2ZD1A 4DSEA 1CZ9A 1O1WA 3VQCA 4CESA 1IH7A 1J54A 3LAMA 1U48A 4FZZA 3VQ6A 3K2PA 4BE1A 2DY4A 2Z1JA 2Z1HA 3VQ8A 3SQ1A 1KFSA 3LP0A 3HL8A 2QK9A 4BDYA 2YV0X 3DMJA 3L2QA 4AHVA 4KREA 3LZIA 3HYFA 1NK6A 4M3XA 4DSIA 1RT5A 2YNGA 3L2RA 3DLGA 2RPIA 4E7JA 2PZSA 2F8TA 3OVNA 2EHGA 3NFAA 5SZTA 3OYGA 2LSNA 1LWCA 2YKMA 1BL3A 3OYEA 1IG9A 3P83D 3RR8A 3OS0A 1IO2A 2Y1JA 2G8IA 2F8SA 5KGXA 4QOZB 3QO9A 3G10A 1JLGA 1LW2A 2HHUA 4FM1A 1Q9YA 5HRPA 1J9AA 4ICLA 4Z4HA 2P5OA 1RBUA 1ZBFA 3ASMA 1BQNA 3RRHA 3DOKA 3U3GA 2KZZA 4DTOA 1REVA 1HYVA 3QEPA 2IS3A 4RG8A 4FJ8A 3PV8A 3OYMA 3ZSWA 1Z26A 3DLEA 4N47A 4HUFA 1N6QA 2GV9A 1C1AA 3V81A 3RMCA 3IRXA 1F21A 4B3OA 4KB1A 3QLHA 4AHRA 5JS1A 3TAGA 4PA1A 4DLGA 3V1OA 4RW9A 4BE0A 1RT7A 1SL2A 4FZYA 4OLBA 3NF6A 3SJJA 1DTQA 3NH1A 3IS9A 1ZYQA 4FK2A 2OPSA 1HMVA 4W5QA 3HJFA 1WSEA 4DU3A 2HNZA 2NUBA 4CIFA 5KRSA 3OYIA 2A1RA 4EP4A 3B6PA 3I0SA 3NDKA 3VN5A 3NGYA 5C42A 3LWLA 4OGCA 4DSJA 1U04A 4KAZA 3HPHA 4CEBA 3NBPA 3KLHA 4OKEA 1TAQA 1KRPA 4CK1A 2IAJA 1YVUA 4AH9A 3KLGA 2D5RA 5KRTA 2GUIA 5CZ2A 3HT3A 4OLAA 3ALYA 1BIZA 3AO3A 4IDKA 4DSKA 1HQUA 4CERA 3PX4A 1WN7A 3CG7A 1XC9A 4KTWA 1LV5A 4OPKA 3AO1A 3PUFA 4OPJA 3ZT0A 1SKWA 4FJ9A 3PO4A 1YTUA 3NCIA 4LSNA 4DTRA 3TAQA 1KVAA 4FJLA 1KTQA 1GOBA 3O4NA 3VQ4A 3SZ2A 1KFDA 2EX3A 4C8MA 2E6MA 3V1RA 2XO7A 3SQ2A 1VSHA 4RW8A 3QEWA 1BQMA 1KSPA 4CJ5A 3QNNA 4QCLA 2VG5A 5I42A 3RRGA 1JLCA 3IG1A 3L2WA 4RW7A 4M3ZA 3V9SA 5E41A 3WNGA 3I8DA 3VA3A 1CLQA 4I2QA 4I7FA 1TKDA 2WOMA 3LANA 1Z25A 1VSKA 3VA0A 3NF8A 1TK8A 1U49A 3PY8A 2KFNA 3KIOA 1L3SA 1TVRA 4EZ9A 1TKTA 1BCOA 2X74A 1DTTA 1S6QA 4CJEA 4CEZA 3V9UA 5DMRA 4W5RA 4B9UA 5DK5A 1FK9A 3S3NA 1ZBIA 4FYDA 3RR7A 1IKVA 2ETJA 3OYCA 1RDBA 3C95A 3CM6A 4CECA 1SKRA 2B4JA 4CHPA 3QEVA 3ZSYA 3G0ZA 4R5PA 4DTPA 4DFKA 1SL0A 3KK1A 1TKXA 4Z4GA 1RBRA 5HRNA 3NHGA 4CJPA 1XHZA 1D9DA 3LALA 2YHAA 2FC0A 4J2AA 4CHOA 3LPUA 1UA1A 1U4BA 1G15A 3VQDA 3AA4A 4CE9A 1NOZA 1HJRA 4CGHA 2PY5A 1L3UA 2OZMA 2KFZA 5SWMA 3AA2A 4DTMA 4DQQA 3V9ZA 1HQEA 2OPQA 3NE6A 1U45A 3HP9A 1RT3A 3K58A 1C1BA 4DTNA 3L8BA 5J1EA 4B9NA 1WSJA 3LAKA 4FJKA 1S5JA 4LH4A 3VQQA 4KHWA 5D3GA 3KD1E 4G1QA 3WNFA 4FXDA 4OGEA 1VK0A 4OKJA 4ID1A 4CK3A 3OYFA 3E01A 3S3MA 4Q0BA 2FBTA 3ZT1A 1HNIA 2IGIA 4NYNA 1B9DA 4CJFA 4CJQA 1X9MA 4DF8A 1VSLA 2BE2A 2G8UA 3KD5E 4N76A 3ZSRA 1Q9XA 3BGRA 1EX4A 3MEGA 4FVMA 3ISNC 4RW6A 4N56A 4DTJA 2VWJA 1JLBA 3OJUA 1ITGA 4B08A 1NJXA 3V9XA 1N5YA 2G8VA 3ULDA 2RN2A 4DLEA 3QESA 4KTQA 4Z4CA 4DU1A 4CEFA 1ASWA 4CHQA 3AVLA 1S1VA 1S9GA 2VG6A 5CYMA 2QXFA 4CJUA 4N5SA 3MECA 1D5AA 4CGFA 3ZSZA 1B9FA 3LWMA 3V6DA 4FLWA 1WLJA 1JKHA 1T03A 4NYFA 4DTSA 3SPZA 1NKCA 1ZBUA 3ZCMA 1IKYA 3DI6A 4HVJA 4KHSA 4PQUA 1LWEA 1QHTA 4CGIA 4FLTA 1XHXA 2DFFA 4JRQA 4B9SA 4CFDA 1RILA 1BI4A 1WAFA 1WSIA 4FM2A 1EETA 3AVGA 4CFAA 4FLXA 4CJ3A 1B92A 3QINA 4CJSA 3HP6A 3MXIA 4F2RA 2AJQA 4I2PA 3SQ0A 4I9LA 4MFBA 4CGDA 4B9MA 2KTQA 1RDAA 3TR8A 1NK4A 4K8XA 4M3UA 3K59A 3OYJA 3SYZA 2HVIA 1T05A 4PWDA 4M42A 2HHXA 3O4QA 5J2NA 3SNNA 1BI4B 1TKZA 4HHTA 3MEDA 3TWHA 1Y97A 4DG1A 2YNHA 1WSFA 3K5MA 4N41A 1FXXA 3AV9A 5EU7A 1QS4A 4UQGA 3OYHA 1TK0A 5FRNA 4KTZA 4F3TA 4FJHA 4LH5A 3HO1A 1KVCA 2X78A 4LY7A 4TSXA 3V4IA 1TK5A 3BDPA 2RKIA 3C94A 1RTJA 4E89A 3MAQA 4CEQA 2ITGA 2XY7A 1RTIA 4FK0A 3AVNA 1C0TA 3M8SA 1RT2A 3TI0A 3AO5A 3HK2A 3ZT4A 4FZXC 4EZ6A 5C24A 2KW4A 3ITHA 1VSJA 4E0DA 2HHSA 2BDPA 2HB5A 4HUEA 3OYAA 3NGZA 1A5WA 4KHYA 1MU2A 4JS5A 1YT3A 2HVHA 2IOCA 1JLEA 3AVCA 4B8CA 1S6PA 4B8AB 3DRPA 4HTUA 4F4KA 1EKEA 1JXEA 4CHNA 3OS2A 3LP2A 3V1QA 1A5XA 4E1NA 4CJLA 3EYZA 3CFPA 3TABA 4XIUA 1UA0A 4DS4A 3KTQA 3SI6A 5T7BA 1NJZA 3K57A 4W5TA 1TGOA 4FLVA 3DOLA 3AA5X 1NK9A 2Z1IA 4E7IA 3U3YA 3SUPA 1NK8A 3JSMA 4LD0A 4ELUA 4FCYA 3RMDA 2BGGA 4NCAA 3AVKA 3AO4A 3T19A 1RBVA 4DQRA 1GOAA 2PYLA 3KK3A 4O4GA 2VG7A 4CEOA 4CJVA 3NAEA 3S9HA 3C6UA 3K5NA 3TAEA 2QKBA 3MXMA 4KHNA 5HROA 4J2BA 1C1CA 4CEAA 4MQ3A 1JLAA 2ATQA 1TL3A 4IFVA 4OVLA 5JS2A 1ZBLA 2Z1GA 1D9FA 4C8OA 3KKRA 3AVJA 2O4IA 1RT4A 1NOYA 1RBSA 3HM9A 4PUOA 1LWFA 2P51A 3HSTB 4O0IA 3I0RA 4F8RA 2RF2A 3K5OA 4E7KA 3KK2A 3O3FA 1FKOA 2X6SA 3MEEA 2XY6A 2X6NA 3PO5A 1QQCA 1UAXA 2O4GA 4KI6A 1LAWA 1S9EA 3OS1A 1TL1A 4Y1CA 3DLHA 4FLUA 4M3TA 4BWMA 2G8KA 1QTMA 1X9WA 3VQEA 5J2PA 4DSLA 1QE1A 3TAMA 4F3OA 3QERA 3L3VA 4DFJA 3QIOA 2HHTA 3HVRA 1BGXT 4Q5VA 2FBYA 4I9QA 1I39A 2OA8A 2KZMA 2IC3A 4CFBA 4FJIA 2FBXA 3KLFA 1HRHA 4QAGA 3RMBA 3ZT2A 4FJMA 4HUGA 4M45A 4IFYA 2DFEA 4DTXA 4KB0A 4CEDA 1FKPA 4JS4A 3HPGA 4DS5A 3NF7A 4B9VA 2A1SA 4M41A 4FJJA 4NCBA 4E3SA 2BANA 1KLNA 1SKSA 4CF2A 5KGWA 2W42A 3QNOA 4YNQA 4B9TA 4GW6A 4J2DA 5HBMA 1J53A 4IBNA 4KRFA 4CEEA 1L5UA 2Q3SA 4Z0UA 4FM0A 3FFIA 3ZSXA 3EY1A 1S1WA 4DU4A 1NK5A 1T8EA 2Y1IA 4O44A 2XRIA 3O3GA 2YKNA 1SL1A 4Z4EA 1VRUA 1K6YA 4H4MA 5C25A 3NH0A 3F73A 1QSSA 3RWUA 4KPYA 3M8PA 1VRTA 4O0JA 4AHSA 4CIEA 4KHUA 2D0CA 4E1MA 3KLIA 4DF4A 3OJSA 5HRSA 3SV4A 1ASVA 1WSHA 3OYNA 3TAPA 2DTUA 4DFMA 1NKEA 3AO2A 4J2EA 4FW1A 4KV8A 3EZ5A 2PYJA 1UWBA 1VSDA 2YNFA 1WNSA 3AVIA 4CF8A 4M3YA 1EXQA 3DYAA 4CJWA 4ZTJA 1CXUA 1X1PA 4C8KA 2JLEA 3V9WA 4L8RB 2ZE2A 4E19A 1RDDA 1QSLA 3ZSVA 4ELVA 4KFBA 4DTUA 5FRMA 3CFRA 3RTVA 1U47A 4W5OA 5FROA 1QSYA 5KTQA 4OKKA 1YTAA 4CF0A 3UIQA 1KVBA 2HW3A 4RW4A 1I3AA 3B6OA 3C6TA 3AVBA 3D45A 4HCBA 1JL2A 1NKBA 4GVMA 4M3RA 3AVFA 1EP4A 3SPYA 3THVA 1NJYA 5KI6A 4JRPA 4W5NA 2HNYA 1XWLA 4AHCA 3AVMA 1L3VA 5CZ1A 3CFOA 2OYQA 3CYMA 4PY5A 3DRSA 3M8QA 3VQBA
chains in the Genus database with same CATH superfamily
4IFEA 1VSFA 4CIGA 2Q31A 2HF4A 4DFPA 4DV2K 5J2MA 4FVUA 1N32K 1JL1A 4QS9A 4CJRA 2PFUA 4CK2A 4HCCA 4WF9L 5K14A 4IO9L 1C0UA 3IAYA 2QWPA 3ZSQA 1H1VA 1WAJA 4DV6K 1D4XA 2Q2RA 2Q97A 4KHQA 3VQAA 3U8XA 1SUQA 1GLDG 1ATNA 4X62K 3DM2A 4BG9A 4CZHA 2G8FA 3THYB 1QHAA 1WSGA 4M3WA 2XY5A 3VQ7A 1UOCA 1RDCA 1RT1A 4K42A 4DV1K 3VESA 3ZSOA 3AVHA 4GV3A 1HPMA 2D0AA 4A2AA 4A61A 4CJTA 4DQSA 4C8NA 2BUPA 1JLQA 3M5RA 3J7ZO 1EWRA 3H1QA 5AZJB 3OYKA 2E4LA 5DM7L 1ASUA 2GX9A 4FJGA 3F2KA 1A5VA 2VQEK 1BUPA 3QIPA 3HBTA 4JHDA 4CGGA 1BCMA 4ILJA 4DR4K 2XY8A 3SMSA 3P1GA 4FLZA 1LW0A 1ZBHA 2I5JA 4CFCA 2E1ZA 3DLKA 1CZBA 1NGBA 1KCFA 3P5JA 3WQUA 5KPZA 2O8CB 1JCEA 1TAUA 4AHUA 5CYQA 1VQ7N 1GOCA 4IG3A 1ATSA 3HRGA 5JLHA 3CCMN 3AARA 3T1AA 2ZD1A 1O1WA 3VQCA 1U48A 3K2PA 2DY4A 2Z1HA 3VQ8A 1KFSA 3LP0A 2FXUA 2YV0X 4AHVA 3E66A 3LZIA 3HYFA 3SJHA 3WEEA 1RT5A 1TUUA 4MO4A 3DLGA 1S22A 2RPIA 1M1KO 2PZSA 1LWCA 1BL3A 1IG9A 1IO2A 5KGXA 4NXMK 4GV9A 1JLGA 1LW2A 3CC2N 4BGAA 1J9AA 2P9LB 3G25A 1WBDA 3WXMB 1ZBFA 3ASMA 4DTOA 3OBYA 1HYVA 3QEPA 1XMOK 2YI1A 2NZTA 4XH4A 3PSIA 4B1VA 4HUFA 3V81A 5BPLA 3RMCA 4CZMA 5LJWA 3TAGA 5AR0A 1RT7A 3A0IX 3ENHA 3BUZB 3SJJA 1ZYQA 3IS9A 3A5NC 1YUWA 1HR0K 4CZJA 3T7ZA 4JKGB 3DWLA 3VN5A 3NGYA 4KAZA 3GG4A 3NBPA 4OKEA 2F9TA 1KRPA 4CK1A 2D5RA 5KRTA 2GUIA 4NO7A 3HT3A 1ILYA 3ALYA 1BIZA 3AAPA 5I9EB 4DCHA 4CERA 3MX2A 1P8ZA 2V51B 3CG7A 5JVHL 1XC9A 3K0SA 3ZT0A 3P38A 4LSNA 4M7XA 1KVAA 4FJLA 3MCAB 3L4IA 3SK3A 5F2RA 3SQ2A 3LM2A 4CZKA 5LY3A 1MDUB 2P9IA 4A5AA 3IG1A 3WXLA 5JLFA 3V9SA 5E41A 3I8DA 3VA3A 4DR6K 1CLQA 4I2QA 2O8FA 4X64K 1L3SA 1U2VB 1TVRA 4EZ9A 4LFBK 1TKTA 3EEQA 1YJNN 1BCOA 3U4LA 3UKRB 4CJEA 3V9UA 5DMRA 1ZBIA 5JMVA 3OYCA 1RDBA 1SKRA 2UUBK 2HBKA 4CHPA 3ZSYA 1SL0A 3ID8A 4NLBA 4JI3K 5AQXA 3P31A 4FWSA 2D4WA 3QFUA 2CH6A 3SAGA 4CE9A 1NOZA 3LDNA 1BWFO 2CGKA 5LMNK 5M1FA 1RDWX 4JK9A 3AA2A 4DQQA 2QM1A 3NE6A 4FWPA 2UYTA 3VF2A 3LAKA 1S5JA 4LH4A 5KPTA 5D3GA 1IBMK 1VK0A 3E1YA 5GINA 4BR5A 4IOAL 3E01A 1I94K 4CJQA 4CJFA 3GL1A 4DF8A 1VSLA 4BRMA 2G8UA 2WFBA 3EZWA 3ZSRA 4N76A 3CCUN 4FVMA 3MWPA 4DTJA 3OJUA 4B08A 2QEXN 2KHOA 3NMUA 2IVPA 4CHQA 3LWMA 3MECA 4FK4A 1T03A 1XMQK 3SPZA 1Q86O 3CJAA 1QHTA 4FLTA 4CGIA 3N4QA 4B9SA 4CFDA 1RILA 1BI4A 4FM2A 4BRLA 4WFNL 3ULEB 4C1NI 3AVGA 3WQTA 2WUSA 3QINA 4CJSA 3MXIA 2AJQA 4I2PA 4CGDA 4B9MA 3TR8A 1HNZK 3MN7A 5JVGL 4PWDA 2Q36A 3O4QA 1TKZA 3TWHA 1Y97A 3FZKA 4DG1A 5FPDA 1FXXA 3AV9A 5FRNA 4KTZA 1KD1O 4FJHA 4KH6A 3ZETB 1RTJA 2Q0RA 4E89A 3MAQA 4CZGA 2ITGA 2XY7A 1IG8A 3J7AP 1C0TA 3BY5A 2NRXA 1QVGM 4FZXC 5MLCQ 4EZ6A 2KW4A 4GKKK 1VSJA 3SMPA 4YOWA 5EXWA 3Q7BA 4YOVA 1A5WA 2FSJA 4X66K 5M1KA 1O13A 1JLEA 4B8CA 1S6PA 2E2OA 4B8AB 4HTUA 1BA0A 3TSUA 3LP2A 1YVNA 5FPNA 3QMLA 1UA0A 4DS4A 1NM1A 1NJZA 3K57A 4WQ4C 1JCGA 3DOLA 3MDQA 1NK9A 2Z1IA 4E7IA 3U3YA 1NK8A 4ELUA 3R9PA 3RMDA 2YCHA 1ATRA 3AVKA 3C6AA 4YOTA 2PYLA 3KK3A 1WB9A 4CJVA 3C6UA 3K5NA 3TAEA 4KHNA 2ATQA 5JS2A 1DKGD 4NLCA 1ZBLA 4C8OA 3AVJA 4XH1A 3I0RA 4F8RA 3N4PA 3AGKA 4O5FA 1N8RO 1HNXK 4EIAA 4KI6A 1LAWA 3CJCA 3I55N 4CVNE 3VQEA 1BA1A 1M90O 4BRIA 1Q7YO 4FWNA 3OA9A 1K8KA 2HHTA 3VEVA 5BRFA 2FBYA 2OA8A 2IC3A 4H0OA 1T6CA 2FBXA 1HRHA 3I8BA 4M45A 4BC5A 1FKPA 3HPGA 5AFUH 4H5NA 1RDUA 4M41A 3VETA 4NCBA 3TSPA 3UE5A 2W42A 1BDGA 3O9UA 4J2DA 1YIJN 3QB0A 5HBMA 1J53A 4IDHA 1EQYA 4H5TA 4IBNA 4Z0UA 1S1WA 5E26A 1GLEG 4AQYK 1SL1A 5AQIA 4Z4EA 1VRUA 2OCEA 4AHSA 4CIEA 1X3NA 1J6ZA 4BRQA 5AQLA 4PKIA 4KHUA 1J5EK 2QWOA 5AQGA 5HRSA 3SV4A 3OYNA 3TAPA 1MA9B 1XQSC 3AO2A 4FW1A 4I6MA 3VPZA 1UWBA 1VSDA 4XH5A 1WNSA 3AVIA 4CF8A 1EXQA 1GLCG 3DYAA 1CXUA 1X1PA 1YAGA 3I56N 5TKYA 2ZE2A 3CC7N 4ELVA 4DTUA 5FRMA 3CFRA 1U47A 1NU0A 3J8AA 1IJJA 5FROA 4OKKA 2HW3A 2OANA 3B6OA 4JKFA 3D45A 1JL2A 1Q18A 4M3RA 1EP4A 3SPYA 4IJNA 3THVA 4FL9A 4BR7A 5KI6A 4JRPA 4W5NA 3VGKA 1L3VA 4RWTA 2PBDA 1OH7A 4PL8A 4MDAA 1DEJA 1BISA 1VQLN 4BACA 4WE1A 4B1WB 2FBVA 1R0AA 5CY4A 2HMIA 1KAXA 2ASPA 4IXCA 4NCGA 3KJVA 1VSEA 1K8AO 4DMNA 2R7YA 4HTLA 3SAHA 4ISGA 3FZHA 4LF8K 1Q8IA 4JN4A 4OX9K 1WUAA 3OYLA 5GAEP 1T7PA 3MXJA 4AHTA 5EOYA 1HYSA 3HVTA 1NNEA 3OY9A 4CJ4A 3R6MA 2P9KB 3ENOA 4JI5K 1GLAG 4Z4FA 1RT6A 4GMJB 4A62A 4BG8A 5BN8A 1D8YA 3QBWA 2XHBA 4Y1DA 3CQ8A 1MWKA 1IKWA 3HI0A 2A3ZA 3MK6A 2O8BA 4KHPK 4PHTX 3LPTA 4FW2A 5I3UA 1RBTA 4FWLA 1E4GT 3AAQA 1IKXA 3NH2A 4Z4IA 4JKHA 4CHYA 2P9SA 1VQ5N 3T3FA 1S1TA 4BRAA 4AILC 4FJNA 3THXA 1NK7A 4CZFA 1HNVA 3A8YA 2QKKA 3KKSA 4WYBA 3LP3A 5AZIB 4BC4A 4JI8K 4K0KK 4O55A 2QWLA 4EHUA 4JAXA 2IDOA 4BGBA 2YNIA 5J2QA 2P9NB 2P5GA 4ID5A 2W6LA 3DRRA 3TANA 1NJWA 3DXKA 1ESVA 2OPPA 4KO0A 2WONA 4K8ZA 1TV6A 2HNDA 1HKGA 3SV3A 2VWKA 1VQ4N 3VTHA 1S1UA 3SCXA 1RTHA 2JGUA 4ZHRA 3DLLL 3PX6A 2D0PA 4CESA 2I7NA 1IH7A 4FZZA 3VQ6A 3D2EB 4F9OA 3SQ1A 3RSEB 1VQ9N 3HOSA 2HF3A 3OVNA 3NFAA 4JI7K 5BPNA 1QZ6A 2F8SA 3P83D 4QOZB 3OS0A 3U9DA 2G8IA 2W6KA 3QO9A 3VEWA 1Q9YA 3W0LA 5HRPA 3ZYYX 4DV7K 3DOKA 4B3TK 1REVA 3BF3A 3PV8A 3ZSWA 3ID6A 1Z26A 3CPWM 3VGLA 4B3RK 3DLEA 1N6QA 1C1AA 4B3OA 1F21A 4IEEA 1VHXA 1Z6RA 4IO8A 3AY9A 3UKUB 4RTFD 4DLGA 4BE0A 5AQVA 5M1OA 5C15A 4OLBA 2KKZA 5KQ8A 1DTQA 5ELZA 4FK2A 1T44A 2HNZA 4UY8O 5KRSA 4CBWA 3UB5A 3I0SA 3NDKA 3ZX0A 4DSJA 3MCPA 1U04A 4WFAL 3HPHA 1U6ZA 2I7PA 2ZJRL 2E88A 3C7NB 2IAJA 4AH9A 3KLGA 5CZ2A 4A57A 2NRZA 3RVCA 1LV5A 4YDUA 2HBLA 3NCIA 3R1XA 3TAQA 1NGIA 4MLEA 1KTQA 1GOBA 4BC3A 1KFDA 2EX3A 1R59O 3U9ZA 2JWLA 3CI5A 4DHYA 2VG5A 5I42A 4JKAA 4U67L 1VQNN 2WOMA 5LL6Z 3A5LC 3VA0A 3NF8A 1TK8A 1U49A 2FF3B 3PY8A 4FSVA 3MN6A 1DTTA 1S6QA 1GLFO 5H1SQ 4B9UA 1IKVA 3C95A 3CM6A 4CECA 3HM8A 1IBLK 4DFKA 3SAFA 4Z4GA 1D9DA 4CHOA 3AA4A 5C2FA 3G6EN 1HJRA 4CGHA 4C23A 4H5VA 2F4VK 3V9ZA 4FWMA 1HQEA 2OPQA 1U45A 1RT3A 3TPQA 2GEMA 4DTNA 4FWOA 3L8BA 4CBUA 4B9NA 5IWAK 1WSJA 4JI0K 3VQQA 4KHWA 1FW6A 3KD1E 2ASMA 4OGEA 4YORA 3VEOA 3MWTA 2QWMA 2FBTA 3LDQA 1B9DA 3R8EA 1VAZA 4H0XB 3EE8A 1T3VA 2BE2A 3KVGA 1HJOA 4Y0WA 1EX4A 4RW6A 1SS6A 2ASOA 2G8VA 3ENBA 3OHRA 3QESA 3O9TA 3Q7CA 1HLUA 4CEFA 3VOVA 4CGFA 1D5AA 3V6DA 1WLJA 1JKHA 1CZAN 3DI6A 2WTUA 4KHSA 1LWEA 4GVEA 4JRQA 2ZGYA 1WAFA 4CZIA 1TYQB 1JJ2M 4CFAA 4FLXA 2E5LK 1B92A 1OVYA 3SQ0A 3GOIA 4BQZA 3K59A 1P90A 4BR4A 2O8DA 3FR0A 4HHTA 3T69A 2YNHA 1K9MO 3K5MA 4N41A 4UQGA 5EU7A 2IVOA 3OYHA 1TK0A 4F3TA 3D2FB 4LH5A 4LY7A 3V4IA 1QQMA 3CJ7A 4JYAK 4CEQA 4FK0A 3TI0A 3THWB 4E0DA 5ADXA 3QBXA 1KC8O 2BDPA 1LOTB 1W7AA 3CIPA 1MU2A 1NBWA 4BRGA 4JS5A 1QVFM 2IOCA 4GNIA 3AVCA 3ZX2A 3DRPA 1EKEA 4CHNA 4DUYK 4JD2A 1A5XA 4J8FA 4JK7A 2J4RA 1MWMA 3O1WA 4W5TA 3SBGA 3AA5X 3JSMA 4LD0A 4FCYA 2BGGA 4NCAA 3AO4A 4DQRA 2VG7A 3S9HA 1K73O 3MXMA 3R3LA 4CEAA 4IFVA 2Z1GA 3KKRA 4PUOA 4E7KA 4DKWA 3KK2A 1VQ6N 1FKOA 1DT9A 5C2DA 1TL1A 1YXQA 2D0OA 2DPNA 4Y1CA 5ADXH 4BWMA 1X9WA 1QE1A 3O08A 4B1YB 3L3VA 4YOYA 4DFJA 3M6GA 3QIOA 3HVRA 2GWJA 4I9QA 2V7ZA 5M1PA 2ZM6K 4YOXA 4FJIA 3W3DA 4FJMA 4HUGA 4KB0A 4CEDA 4JS4A 4HWIA 4B9VA 4FJJA 4B1XB 4E3SA 2BANA 1KLNA 1SKSA 4JI4K 4CF2A 3QNOA 3KWGA 1NGCA 4YNQA 4B9TA 4GW6A 2YHYA 1L5UA 5M1NA 1T8EA 1NK5A 4O44A 3CQXA 3LDPA 4H4MA 5C25A 3F73A 4KPYA 3NVKA 4DV3K 4O0JA 4AM7A 4PL7A 2A6AA 2O8EA 1WSHA 1NKEA 2A41A 4DR7K 4J2EA 2PYJA 4DV0K 1IBKK 4CJWA 1OVQA 4ZTJA 2P9PB 4L8RB 3ZEUA 4E19A 1RDDA 1QSLA 3QDKA 5BRDA 2P9UA 4W5OA 3UIQA 4RW4A 3C6TA 3NVMA 4EAHD 4BVPA 4HCBA 1NKBA 3TTFA 5CZ1A 3CFOA 2OYQA 3CCJN 4PY5A 4DSFA 1DLOA 4LF7K 2ZF5O 3AVAA 2HHHK 4H4OA 5BRHA 4O5BA 3DXMB 3LDSA 4WQ5C 4BY9C 4EP5A 1DGKN 1J5OA 4BVOA 3SUQA 4JKCA 3K9KA 3HXMA 2DFHA 3THYA 5HLFA 3OYDA 4BC2A 4BDPA 1KLMA 2NRVA 2ZQBA 4Z94A 2FSNA 4CZEA 1JLFA 2OZSA 3O9QA 4CHZA 5FDLA 4FLYA 3KZBA 1W9HA 2HHVA 4DQPA 2HHWA 3CMEN 3RMAA 2P1JA 4V19S 2W41A 2G8HA 3DLBA 4LF6K 4OO1J 3U6FA 3O3HA 1BHLA 2E6LA 1Y64A 5AZJA 3O8MA 2F7TA 4DQ8A 4CGJA 1C0MA 3A2FA 4JLHA 2F96A 4DB3A 3QEIA 4B9LA 1VQPN 3CJBA 1SV5A 5HP1A 4BRCA 2A40A 2YHBA 3L2VA 4CF1A 2O8CA 2E2NA 3CQYA 4OJRA 4YDUC 3QEXA 1OH6A 2NLXA 4YY3K 3VQ9A 4DV5K 1JXBA 4IZ9A 4IKFA 3WNHA 3L2UA 4JHDB 3L3UA 2E20A 3ZLJA 1BG3A 3O1BA 4AF1A 1QZ5A 2ZJPL 3PSFA 1YJ9N 1VSMA 1VSIA 2D1KA 4CCHA 4C8LA 3JXUA 4DSEA 1XC3A 1J54A 3VF4A 4BRKA 1VQKN 1N34K 2P9LA 2QK9A 4KREA 3DMJA 3L2QA 3VF6A 4M3XA 4DSIA 2YNGA 3L2RA 3OYGA 5SZTA 4M3ZA 3OYEA 2YKMA 5AQMA 3KHYA 2HHUA 5EX5A 4Z4HA 3OTOK 1RBUA 3CHWA 3RRHA 1BQNA 3CF5L 3WEEB 4BR0A 4RG8A 4FJ8A 1NG9A 1T6DA 5AQUA 4B1ZA 3PLAA 2E8AA 2GV9A 1NGFA 1HX1A 3HZ6A 4H0TB 4JKGA 3CJ1A 5JS1A 4RW9A 1SL2A 4FZYA 3NF6A 5F0XA 5FPEA 3NH1A 3F5TA 1HMVA 4W5QA 1WSEA 4DU3A 2NUBA 4CIFA 3BF1A 2ZWHA 3B6PA 4MDBA 5C42A 4OGCA 4GKJK 4ILGB 3KLHA 4FOEA 1TAQA 3MX5A 1YVUA 2GUPA 3DJCA 3A5MC 4DSKA 4JI2K 3BZCA 4CZLA 3PX4A 3L0QA 4MLHA 3AO1A 4OPKA 2A5XA 1YTUA 4FWKA 4DTRA 3GBTA 5IT9O 2AA4A 3VQ4A 3WUHA 1E4FT 1U2VA 4C8MA 3V1RA 2E6MA 4ILHA 1NWKA 3AGRA 4RW8A 2QXLA 3UKRA 3O80A 1BQMA 3CC4N 3QEWA 4CJ5A 3QNNA 5C0YA 1JLCA 4RW7A 1Q82O 4I7FA 1TKDA 2QWNA 3LANA 3GDQA 2KFNA 3KIOA 4DUZK 3I33A 4IJAA 4CEZA 4FYDA 4W5RA 3S3NA 4EFHA 3RR7A 2ETJA 2P9IB 4BROA 2B4JA 4R5PA 3G0ZA 2O8FB 3LDOA 3CJ9A 4J2AA 5GIOA 4CJPA 1XHZA 3LALA 2YHAA 1G99A 1NGHA 1U4BA 2UUCK 1G15A 1E3MA 2ITMA 3E9LA 3VEYA 2PY5A 1L3UA 4DTMA 2Q1NA 3HP9A 3L4QA 3VEXA 3CCQN 3EKSA 4FJKA 4JI6K 5HL7L 2GWKA 3O5BA 4FXDA 1BU6O 4OKJA 4ID1A 5HOOA 3OYFA 3S3MA 5AQZA 3ZT1A 1HNIA 4NYNA 3KD5E 3BGRA 4KH5A 4N56A 1N33K 2VWJA 1S3XA 3V9XA 1N5YA 2RN2A 1ZC6A 4DLEA 3ULEA 1W97L 1ASWA 3AVLA 1S9GA 5CYMA 3WXIA 1Q81O 3ZSZA 1RGIA 4PQUA 4FLWA 4NYFA 4DTSA 3ZCMA 1IKYA 4HVJA 1XHXA 2DFFA 4KH4A 1WSIA 2YX6A 3VTIA 4DV4K 3OW2M 1EETA 4NXNK 3HP6A 4I9LA 1GLBG 2KTQA 1RDAA 4K8XA 3OYJA 3SYZA 3ZETA 1T05A 3S41A 3H3NO 4YHHK 4M42A 2HHXA 5J2NA 4OPHA 2HOEA 1BI4B 3C0BA 3MEDA 1EO1A 4WQ4A 3TTDA 1C0GA 3VENA 1QS4A 1NGDA 3IMXA 3HO1A 1KVCA 4TSXA 1TK5A 2RKIA 3C94A 1RTIA 5BREA 3HK2A 3AO5A 3ZT4A 5C24A 1YITN 2HHSA 3J7YP 4HUEA 3OYAA 5EY4A 3G4SN 4LF4K 2QWQA 2NRRA 4GV6A 1EWQA 1BO5O 2ZGZA 3VGMA 4JV5K 3OS2A 5LMUK 4CJLA 4WFBL 3TABA 3KTQA 3QFPA 1ZBSA 4BRFA 4FLVA 4K25A 1OH8A 3H6EA 4BREA 3O9RA 4CBXA 5EVZA 3P39A 2VGMA 1RBVA 2H3GX 4O4GA 2NRTA 3G71N 5BR8K 5HROA 4J2BA 1C1CA 4H0PA 4MQ3A 1JLAA 4OVLA 1TL3A 3KK7A 2WC9A 2QTDA 3H45C 1D9FA 4FWRA 1OKJA 2O4IA 1RT4A 4IOCL 1RBSA 3HM9A 2P51A 4H03B 2QA4N 2RF2A 3K5OA 4CJ7A 4B3MK 1HKCA 1ZXOA 3O3FA 3MEEA 2XY6A 2X6NA 1WBBA 1XNQK 3OS1A 3DLHA 4FLUA 2G8KA 1QTMA 4FO0A 5J2PA 4DSLA 4F3OA 5AJ3K 1V4SA 1BGXT 2PAVA 4JKEA 1I39A 3KLFA 4QAGA 4FPAA 3RMBA 3ZT2A 4DTXA 4IFYA 3HOTA 1K8KB 5LJVA 2IIRA 4QS8A 3FFKB 1KAZA 3SLCA 2FF6A 2Q3SA 3FFIA 3PIPL 5AQFA 1NGAA 2QW9A 1QSSA 3H1VX 1VQMN 3M8PA 1VRTA 2D0CA 4E1MA 4L3QA 4DF4A 3VMFB 1ASVA 4KV8A 4PKHA 2YNFA 3T1HK 4M3YA 4BQLA 4EHTA 4X65K 3PIOL 2JLEA 5FPMA 4YOUA 3QICA 5KTQA 4M63C 4I6MB 1KVBA 5KQDA 2OTJN 1I3AA 3AVBA 4R79A 4GVMA 3AVFA 3P4IA 4CW7B 2HNYA 1XWLA 4AHCA 2UUAK 4G9ZA 5CE3A 3CYMA 1IV0A 3M8QA 3ATUA 5HRRA 3VQ5A 4B1UB 4IG0A 4CF9A 4KBOA 4MO5A 4E7HA 4JEPA 4LSLA 3SQ4A 4PKGA 3F9KA 4FJ5A 3WXKA 2WBNA 3HPOA 1S72N 1XI1A 4IEIA 1SQKA 1L3TA 4DQIA 2UXBK 3T1YK 3TAFA 3H08A 2P9KA 4XEIA 4BWJA 4FJ7A 1VQ8N 4M7YA 3OYBA 3IUCA 3VQPA 3ZT3A 2HHQA 3TSQA 2NRHA 3PX0A 3TARA 2BTFA 3EN9A 3AA3A 3S3OA 1KXPA 3MMVA 3CM5A 3JYTA 3J81O 1LAVA 4RCHA 4ZTFA 3CETA 3FLCO 3EO3A 1HYZA 2IVNA 1RCHA 5AQPA 4YFUA 5CR4A 4BR2A 4E7LA 2KQ2A 2VCPA 3O4WA 3K5LA 1NK0A 3WNEA 2FLOA 3D0PA 3O6WA 2OPRA 4FJXA 3FE1A 5AZIA 4H8KA 4BDZA 4CJKA 5CHIA 1HUXA 5BN9A 3IKMA 2P9NA 4H0YB 1C6VA 2E2QA 2O8BB 2RE2A 3LP1A 3DLRA 1S1XA 2OTLN 3K9JA 4K43A 1BIUA 3NGIA 5AQTA 1KAYA 3QETA 2GBZA 4KI4A 4DWIA 3O9SA 2P9SB 1NGJA 4LFAK 1RTDA 3SUOA 2B5JA 3THXB 3PO4A 3NF9A 3EL2A 3M8RA 1X9SA 2D0BA 1YF5L 3D2EA 1KQSM 4F2SA 3SUNA 1CXQA 3KLEA 5AQQA 3RSEA 2G8WA 1JCFA 1RNHA 1W0HA 3C6HA 4KKOA 4BE2A 4H5WA 1HPZA 3LZJA 4B3SK 4ELTA 2B6AA 3DXKB 1CZ9A 4FWQA 3LAMA 5AQSA 3L6QA 4BE1A 2Z1JA 1SAZA 3HL8A 4BDYA 1NK6A 1XNRK 3CCEN 3HTVA 4E7JA 4H0VB 2F8TA 2EHGA 2LSNA 3RR8A 5JICA 2CGJA 3KWIA 3BZKA 2Y1JA 4O8KA 3H46O 3G10A 3M3ZA 3CMAN 4FM1A 3JAMO 4ICLA 5KPRA 5GADP 1XUPO 2P5OA 2KZZA 3U3GA 3UKUA 3ATVA 1NLVA 2IS3A 3OYMA 4N47A 2VYPA 3IRXA 4KB1A 3QLHA 4AHRA 4PA1A 3V1OA 4K41A 5E84A 5A2QO 3C7NA 3H3OB 2OPSA 3HJFA 3WXJA 4NB4A 3OYIA 1BOTO 2A1RA 4EP4A 1HNWK 3LWLA 5FLXO 4CEBA 2CH5A 2RHKA 4C1NK 3CCLN 4AM6A 4OLAA 4IDKA 3AO3A 5AQJA 1HQUA 3HSCA 5AQOA 1C0FA 3VEZA 1WN7A 2VGNA 4KTWA 1SKWA 3PUFA 4OPJA 4FJ9A 2AP1A 4BRNA 3O4NA 3SZ2A 2XO7A 1VSHA 3CCVN 1KSPA 3EE9A 4QCLA 3RRGA 3L2WA 3WNGA 5AFUA 5C12A 4IWVA 2E2PA 4DR1K 1Z25A 1VSKA 1X3MA 5M1QA 2X74A 4BRHA 4JK8A 5AQWA 5DK5A 1FK9A 4BRDA 4WCEL 1NGEA 3QEVA 4O8UA 4DTPA 3JS6A 4FOIA 2QI2A 3KK1A 1TKXA 1RBRA 4BR9A 5HRNA 4A2BA 3NHGA 2FC0A 3LPUA 1UA1A 3VQDA 2HBJA 2NRWA 2OZMA 4BRPA 1OH5A 2KFZA 3F9MA 5SWMA 3K58A 1C1BA 3CCSN 4QS7A 5J1EA 1TUYA 3LL3A 4DR2K 4G1QA 2YJEA 3WNFA 3IDHA 3J80O 4IOXA 4CK3A 3BEXA 3TU5A 3CD6N 4Q0BA 2HSTA 2IGIA 3B8AX 3LDLA 1X9MA 1YJWN 4DR5K 3CERA 1Q9XA 1V4TA 3FZFA 3MEGA 3ISNC 3CXCM 5GAHP 1LCUA 2Q0UA 1JLBA 1ITGA 1NJXA 3BP8A 3ULDA 1TYQA 3E9OA 2CGLA 4H5RA 4KTQA 4Z4CA 4DU1A 1S1VA 2VG6A 2QXFA 4CJUA 4N5SA 4GY2B 1B9FA 1NKCA 2UXCK 1NJIO 1GLJO 1ZBUA 3VERA 5C10A 1NMNA 4A5BA 2GELA 1WOQA 4CJ3A 4DR3K 1QQNA 4F2RA 4MFBA 3D2FA 1NK4A 2V7YA 4M3UA 2HVIA 2HMPA 2ZJQL 2QWRA 4E1JA 3SNNA 1NGGA 3THWA 1WSFA 2X78A 3BDPA 4CD3A 2O8DB 2GTDA 3AVNA 2VWBA 1RT2A 3M8SA 5GIPA 3ITHA 5AQHA 2YHWA 3FZMA 4JKDA 2HB5A 4FPBA 3NGZA 4KHYA 3A5OC 1YT3A 5AQNA 2HVHA 1FJGK 4F4KA 1JXEA 3V1QA 3FGUA 4E1NA 3EYZA 3LM9A 3CFPA 4XIUA 4ISEA 3CCRN 3SI6A 5T7BA 1RFQA 4CI6A 1TGOA 2KLAA 1QQOA 3SUPA 2FSKA 3SBTA 4LF9K 3EKUA 3MN9A 4JD2B 3T19A 3FZLA 1GOAA 3E9PA 3NAEA 4CEOA 1VQON 4LF5K 2QKBA 2UU9K 2JWKA 3GE1A 4ISFA 3CPEA 4OPAA 4B9QA 1NOYA 1LWFA 3HSTB 2A42A 4O0IA 1YI2N 2X6SA 3PO5A 1QQCA 1UAXA 2O4GA 1S9EA 3D7EO 4M3TA 3TAMA 4LFCK 4CD1A 3QERA 2YHXA 4Q5VA 3ZX3A 2KZMA 4CFBA 3DAWA 5F1XA 4JNEA 3TTCA 2DFEA 4LC9B 5DM6L 2VQFK 4DS5A 3NF7A 2A1SA 2YJFA 2EWSA 5KGWA 3OBWA 1NMDA 3MN5A 5BR9A 4CEEA 3D6RA 4KRFA 4FM0A 1Z05A 3ZSXA 3EY1A 4DU4A 2Y1IA 3O3GA 2V52B 2XRIA 5GAGP 1X9JA 2YKNA 1K6YA 5BPMA 3NH0A 3RWUA 2P9PA 1GLLO 1SZ2A 2F9WA 3M1FA 1N36K 4JKBA 3KLIA 5AQKA 3OJSA 3C65A 2DTUA 5TKWA 4WQ5A 4DFMA 1YHQN 3EZ5A 1W2BM 4U7BA 5AQRA 3WT0A 4C8KA 3V9WA 3ZSVA 4KFBA 3RTVA 2O8EB 1QSYA 3IFRA 1YTAA 4CF0A 2HBMA 4JI1K 1HKBA 2W40A 3DXMA 1NJYA 2BH1A 3ZEUB 2UXDK 2E1YA 4A59A 3AVMA 5B8HA 2P9UB 2NNWA 5AQYA 3DRSA 3VQBA
chains in the Genus database with same CATH topology
4DSFA 1DLOA 3AVAA 1VSFA 5HRRA 4H4OA 3VQ5A 1BISA 4IG0A 4CIGA 4CF9A 4BACA 4DFPA 4O5BA 4E7HA 3LDSA 4WE1A 5J2MA 3SQ4A 4LSLA 4FK4A 3F9KA 2FBVA 4EP5A 1R0AA 1J5OA 5CY4A 4FJ5A 3SUQA 1JL1A 2HMIA 3HPOA 4CJRA 4CK2A 1XI1A 4HCCA 3HXMA 2DFHA 1L3TA 5HLFA 5K14A 3OYDA 4DQIA 1C0UA 3TAFA 3IAYA 3H08A 3ZSQA 4BDPA 4NCGA 4BWJA 1WAJA 1VSEA 1KLMA 3KJVA 4FJ7A 3OYBA 2ZQBA 3VQPA 4DMNA 2R7YA 3ZT3A 4KHQA 2HHQA 2OZSA 1JLFA 1Q8IA 3VQAA 3PX0A 4CHZA 1SUQA 5FDLA 3TARA 3OYLA 4FLYA 3AA3A 3S3OA 1W9HA 1T7PA 4DQPA 3DM2A 3MXJA 2HHVA 2HHWA 3CM5A 4AHTA 2G8FA 3RMAA 3JYTA 1HYSA 3HVTA 2P1JA 3OY9A 4CJ4A 1LAVA 1WSGA 4M3WA 2XY5A 3VQ7A 4ZTFA 4Z4FA 1RT6A 4GMJB 2G8HA 1UOCA 1RDCA 1HYZA 4YFUA 1RCHA 1RT1A 3DLBA 1D8YA 3U6FA 3O3HA 1BHLA 2E6LA 4E7LA 2XHBA 4Y1DA 2KQ2A 3CQ8A 3K5LA 1IKWA 1NK0A 3ZSOA 3AVHA 3WNEA 4CGJA 3LPTA 1C0MA 3A2FA 4FW2A 4JLHA 5I3UA 3D0PA 2D0AA 2OPRA 4DQSA 4CJTA 4FJXA 1RBTA 2F96A 3QEIA 4C8NA 4B9LA 4H8KA 4BDZA 1IKXA 4CJKA 3NH2A 4Z4IA 4CHYA 1JLQA 1SV5A 5HP1A 3T3FA 1S1TA 3OYKA 2E4LA 1C6VA 1ASUA 4AILC 4FJGA 4FJNA 2YHBA 1A5VA 3L2VA 3LP1A 1NK7A 3DLRA 4CF1A 1S1XA 3QIPA 4CGGA 1HNVA 2QKKA 3KKSA 1BIUA 1BCMA 3LP3A 3NGIA 4O55A 3QETA 2GBZA 2XY8A 4DWIA 4OJRA 3QEXA 4KI4A 3P1GA 2IDOA 4FLZA 2YNIA 5J2QA 2P5GA 1LW0A 4ID5A 1RTDA 3SUOA 1ZBHA 2I5JA 3DRRA 2B5JA 3TANA 1NJWA 3VQ9A 3DLKA 4CFCA 1JXBA 4IKFA 1CZBA 3WNHA 2OPPA 3NF9A 4KO0A 3M8RA 1KCFA 3L2UA 3P5JA 2D0BA 2WONA 1X9SA 3L3UA 4K8ZA 1TV6A 3SUNA 1CXQA 2HNDA 3KLEA 4F2SA 1TAUA 3SV3A 2G8WA 4AHUA 1RNHA 1W0HA 2VWKA 4KKOA 5CYQA 4BE2A 1S1UA 1GOCA 3SCXA 1HPZA 1VSMA 4IG3A 1RTHA 1VSIA 2JGUA 4ZHRA 3LZJA 4CCHA 4ELTA 2B6AA 4C8LA 3T1AA 3PX6A 2ZD1A 4DSEA 1CZ9A 1O1WA 3VQCA 4CESA 1IH7A 1J54A 3LAMA 1U48A 4FZZA 3VQ6A 3K2PA 4BE1A 2DY4A 2Z1JA 2Z1HA 3VQ8A 3SQ1A 1KFSA 3LP0A 3HL8A 2QK9A 4BDYA 2YV0X 3DMJA 3L2QA 4AHVA 4KREA 3LZIA 3HYFA 1NK6A 4M3XA 4DSIA 1RT5A 2YNGA 3L2RA 3DLGA 2RPIA 4E7JA 2PZSA 2F8TA 3OVNA 2EHGA 3NFAA 5SZTA 3OYGA 2LSNA 1LWCA 2YKMA 1BL3A 3OYEA 1IG9A 3P83D 3RR8A 3OS0A 1IO2A 2Y1JA 2G8IA 2F8SA 5KGXA 4QOZB 3QO9A 3G10A 1JLGA 1LW2A 2HHUA 4FM1A 1Q9YA 5HRPA 1J9AA 4ICLA 4Z4HA 2P5OA 1RBUA 1ZBFA 3ASMA 1BQNA 3RRHA 3DOKA 3U3GA 2KZZA 4DTOA 1REVA 1HYVA 3QEPA 2IS3A 4RG8A 4FJ8A 3PV8A 3OYMA 3ZSWA 1Z26A 3DLEA 4N47A 4HUFA 1N6QA 2GV9A 1C1AA 3V81A 3RMCA 3IRXA 1F21A 4B3OA 4KB1A 3QLHA 4AHRA 5JS1A 3TAGA 4PA1A 4DLGA 3V1OA 4RW9A 4BE0A 1RT7A 1SL2A 4FZYA 4OLBA 3NF6A 3SJJA 1DTQA 3NH1A 3IS9A 1ZYQA 4FK2A 2OPSA 1HMVA 4W5QA 3HJFA 1WSEA 4DU3A 2HNZA 2NUBA 4CIFA 5KRSA 3OYIA 2A1RA 4EP4A 3B6PA 3I0SA 3NDKA 3VN5A 3NGYA 5C42A 3LWLA 4OGCA 4DSJA 1U04A 4KAZA 3HPHA 4CEBA 3NBPA 3KLHA 4OKEA 1TAQA 1KRPA 4CK1A 2IAJA 1YVUA 4AH9A 3KLGA 2D5RA 5KRTA 2GUIA 5CZ2A 3HT3A 4OLAA 3ALYA 1BIZA 3AO3A 4IDKA 4DSKA 1HQUA 4CERA 3PX4A 1WN7A 3CG7A 1XC9A 4KTWA 1LV5A 4OPKA 3AO1A 3PUFA 4OPJA 3ZT0A 1SKWA 4FJ9A 3PO4A 1YTUA 3NCIA 4LSNA 4DTRA 3TAQA 1KVAA 4FJLA 1KTQA 1GOBA 3O4NA 3VQ4A 3SZ2A 1KFDA 2EX3A 4C8MA 2E6MA 3V1RA 2XO7A 3SQ2A 1VSHA 4RW8A 3QEWA 1BQMA 1KSPA 4CJ5A 3QNNA 4QCLA 2VG5A 5I42A 3RRGA 1JLCA 3IG1A 3L2WA 4RW7A 4M3ZA 3V9SA 5E41A 3WNGA 3I8DA 3VA3A 1CLQA 4I2QA 4I7FA 1TKDA 2WOMA 3LANA 1Z25A 1VSKA 3VA0A 3NF8A 1TK8A 1U49A 3PY8A 2KFNA 3KIOA 1L3SA 1TVRA 4EZ9A 1TKTA 1BCOA 2X74A 1DTTA 1S6QA 4CJEA 4CEZA 3V9UA 5DMRA 4W5RA 4B9UA 5DK5A 1FK9A 3S3NA 1ZBIA 4FYDA 3RR7A 1IKVA 2ETJA 3OYCA 1RDBA 3C95A 3CM6A 4CECA 1SKRA 2B4JA 4CHPA 3QEVA 3ZSYA 3G0ZA 4R5PA 4DTPA 4DFKA 1SL0A 3KK1A 1TKXA 4Z4GA 1RBRA 5HRNA 3NHGA 4CJPA 1XHZA 1D9DA 3LALA 2YHAA 2FC0A 4J2AA 4CHOA 3LPUA 1UA1A 1U4BA 1G15A 3VQDA 3AA4A 4CE9A 1NOZA 1HJRA 4CGHA 2PY5A 1L3UA 2OZMA 2KFZA 5SWMA 3AA2A 4DTMA 4DQQA 3V9ZA 1HQEA 2OPQA 3NE6A 1U45A 3HP9A 1RT3A 3K58A 1C1BA 4DTNA 3L8BA 5J1EA 4B9NA 1WSJA 3LAKA 4FJKA 1S5JA 4LH4A 3VQQA 4KHWA 5D3GA 3KD1E 4G1QA 3WNFA 4FXDA 4OGEA 1VK0A 4OKJA 4ID1A 4CK3A 3OYFA 3E01A 3S3MA 4Q0BA 2FBTA 3ZT1A 1HNIA 2IGIA 4NYNA 1B9DA 4CJFA 4CJQA 1X9MA 4DF8A 1VSLA 2BE2A 2G8UA 3KD5E 4N76A 3ZSRA 1Q9XA 3BGRA 1EX4A 3MEGA 4FVMA 3ISNC 4RW6A 4N56A 4DTJA 2VWJA 1JLBA 3OJUA 1ITGA 4B08A 1NJXA 3V9XA 1N5YA 2G8VA 3ULDA 2RN2A 4DLEA 3QESA 4KTQA 4Z4CA 4DU1A 4CEFA 1ASWA 4CHQA 3AVLA 1S1VA 1S9GA 2VG6A 5CYMA 2QXFA 4CJUA 4N5SA 3MECA 1D5AA 4CGFA 3ZSZA 1B9FA 3LWMA 3V6DA 4FLWA 1WLJA 1JKHA 1T03A 4NYFA 4DTSA 3SPZA 1NKCA 1ZBUA 3ZCMA 1IKYA 3DI6A 4HVJA 4KHSA 4PQUA 1LWEA 1QHTA 4CGIA 4FLTA 1XHXA 2DFFA 4JRQA 4B9SA 4CFDA 1RILA 1BI4A 1WAFA 1WSIA 4FM2A 1EETA 3AVGA 4CFAA 4FLXA 4CJ3A 1B92A 3QINA 4CJSA 3HP6A 3MXIA 4F2RA 2AJQA 4I2PA 3SQ0A 4I9LA 4MFBA 4CGDA 4B9MA 2KTQA 1RDAA 3TR8A 1NK4A 4K8XA 4M3UA 3K59A 3OYJA 3SYZA 2HVIA 1T05A 4PWDA 4M42A 2HHXA 3O4QA 5J2NA 3SNNA 1BI4B 1TKZA 4HHTA 3MEDA 3TWHA 1Y97A 4DG1A 2YNHA 1WSFA 3K5MA 4N41A 1FXXA 3AV9A 5EU7A 1QS4A 4UQGA 3OYHA 1TK0A 5FRNA 4KTZA 4F3TA 4FJHA 4LH5A 3HO1A 1KVCA 2X78A 4LY7A 4TSXA 3V4IA 1TK5A 3BDPA 2RKIA 3C94A 1RTJA 4E89A 3MAQA 4CEQA 2ITGA 2XY7A 1RTIA 4FK0A 3AVNA 1C0TA 3M8SA 1RT2A 3TI0A 3AO5A 3HK2A 3ZT4A 4FZXC 4EZ6A 5C24A 2KW4A 3ITHA 1VSJA 4E0DA 2HHSA 2BDPA 2HB5A 4HUEA 3OYAA 3NGZA 1A5WA 4KHYA 1MU2A 4JS5A 1YT3A 2HVHA 2IOCA 1JLEA 3AVCA 4B8CA 1S6PA 4B8AB 3DRPA 4HTUA 4F4KA 1EKEA 1JXEA 4CHNA 3OS2A 3LP2A 3V1QA 1A5XA 4E1NA 4CJLA 3EYZA 3CFPA 3TABA 4XIUA 1UA0A 4DS4A 3KTQA 3SI6A 5T7BA 1NJZA 3K57A 4W5TA 1TGOA 4FLVA 3DOLA 3AA5X 1NK9A 2Z1IA 4E7IA 3U3YA 3SUPA 1NK8A 3JSMA 4LD0A 4ELUA 4FCYA 3RMDA 2BGGA 4NCAA 3AVKA 3AO4A 3T19A 1RBVA 4DQRA 1GOAA 2PYLA 3KK3A 4O4GA 2VG7A 4CEOA 4CJVA 3NAEA 3S9HA 3C6UA 3K5NA 3TAEA 2QKBA 3MXMA 4KHNA 5HROA 4J2BA 1C1CA 4CEAA 4MQ3A 1JLAA 2ATQA 1TL3A 4IFVA 4OVLA 5JS2A 1ZBLA 2Z1GA 1D9FA 4C8OA 3KKRA 3AVJA 2O4IA 1RT4A 1NOYA 1RBSA 3HM9A 4PUOA 1LWFA 2P51A 3HSTB 4O0IA 3I0RA 4F8RA 2RF2A 3K5OA 4E7KA 3KK2A 3O3FA 1FKOA 2X6SA 3MEEA 2XY6A 2X6NA 3PO5A 1QQCA 1UAXA 2O4GA 4KI6A 1LAWA 1S9EA 3OS1A 1TL1A 4Y1CA 3DLHA 4FLUA 4M3TA 4BWMA 2G8KA 1QTMA 1X9WA 3VQEA 5J2PA 4DSLA 1QE1A 3TAMA 4F3OA 3QERA 3L3VA 4DFJA 3QIOA 2HHTA 3HVRA 1BGXT 4Q5VA 2FBYA 4I9QA 1I39A 2OA8A 2KZMA 2IC3A 4CFBA 4FJIA 2FBXA 3KLFA 1HRHA 4QAGA 3RMBA 3ZT2A 4FJMA 4HUGA 4M45A 4IFYA 2DFEA 4DTXA 4KB0A 4CEDA 1FKPA 4JS4A 3HPGA 4DS5A 3NF7A 4B9VA 2A1SA 4M41A 4FJJA 4NCBA 4E3SA 2BANA 1KLNA 1SKSA 4CF2A 5KGWA 2W42A 3QNOA 4YNQA 4B9TA 4GW6A 4J2DA 5HBMA 1J53A 4IBNA 4KRFA 4CEEA 1L5UA 2Q3SA 4Z0UA 4FM0A 3FFIA 3ZSXA 3EY1A 1S1WA 4DU4A 1NK5A 1T8EA 2Y1IA 4O44A 2XRIA 3O3GA 2YKNA 1SL1A 4Z4EA 1VRUA 1K6YA 4H4MA 5C25A 3NH0A 3F73A 1QSSA 3RWUA 4KPYA 3M8PA 1VRTA 4O0JA 4AHSA 4CIEA 4KHUA 2D0CA 4E1MA 3KLIA 4DF4A 3OJSA 5HRSA 3SV4A 1ASVA 1WSHA 3OYNA 3TAPA 2DTUA 4DFMA 1NKEA 3AO2A 4J2EA 4FW1A 4KV8A 3EZ5A 2PYJA 1UWBA 1VSDA 2YNFA 1WNSA 3AVIA 4CF8A 4M3YA 1EXQA 3DYAA 4CJWA 4ZTJA 1CXUA 1X1PA 4C8KA 2JLEA 3V9WA 4L8RB 2ZE2A 4E19A 1RDDA 1QSLA 3ZSVA 4ELVA 4KFBA 4DTUA 5FRMA 3CFRA 3RTVA 1U47A 4W5OA 5FROA 1QSYA 5KTQA 4OKKA 1YTAA 4CF0A 3UIQA 1KVBA 2HW3A 4RW4A 1I3AA 3B6OA 3C6TA 3AVBA 3D45A 4HCBA 1JL2A 1NKBA 4GVMA 4M3RA 3AVFA 1EP4A 3SPYA 3THVA 1NJYA 5KI6A 4JRPA 4W5NA 2HNYA 1XWLA 4AHCA 3AVMA 1L3VA 5CZ1A 3CFOA 2OYQA 3CYMA 4PY5A 3DRSA 3M8QA 3VQBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DSF A;  1DLO A;  3AVA A;  1VSF A;  5HRR A;  4H4O A;  3VQ5 A;  1BIS A;  4IG0 A;  4CIG A;  4CF9 A;  4BAC A;  4DFP A;  4O5B A;  4E7H A;  3LDS A;  4WE1 A;  5J2M A;  3SQ4 A;  4LSL A;  4FK4 A;  3F9K A;  2FBV A;  4EP5 A;  1R0A A;  1J5O A;  5CY4 A;  4FJ5 A;  3SUQ A;  1JL1 A;  2HMI A;  3HPO A;  4CJR A;  4CK2 A;  1XI1 A;  4HCC A;  3HXM A;  2DFH A;  1L3T A;  5HLF A;  5K14 A;  3OYD A;  4DQI A;  1C0U A;  3TAF A;  3IAY A;  3H08 A;  3ZSQ A;  4BDP A;  4NCG A;  4BWJ A;  1WAJ A;  1VSE A;  1KLM A;  3KJV A;  4FJ7 A;  3OYB A;  2ZQB A;  3VQP A;  4DMN A;  2R7Y A;  3ZT3 A;  4KHQ A;  2HHQ A;  2OZS A;  1JLF A;  1Q8I A;  3VQA A;  3PX0 A;  4CHZ A;  1SUQ A;  5FDL A;  3TAR A;  3OYL A;  4FLY A;  3AA3 A;  3S3O A;  1W9H A;  1T7P A;  4DQP A;  3DM2 A;  3MXJ A;  2HHV A;  2HHW A;  3CM5 A;  4AHT A;  2G8F A;  3RMA A;  3JYT A;  1HYS A;  3HVT A;  2P1J A;  3OY9 A;  4CJ4 A;  1LAV A;  1WSG A;  4M3W A;  2XY5 A;  3VQ7 A;  4ZTF A;  4Z4F A;  1RT6 A;  4GMJ B;  2G8H A;  1UOC A;  1RDC A;  1HYZ A;  4YFU A;  1RCH A;  1RT1 A;  3DLB A;  1D8Y A;  3U6F A;  3O3H A;  1BHL A;  2E6L A;  4E7L A;  2XHB A;  4Y1D A;  2KQ2 A;  3CQ8 A;  3K5L A;  1IKW A;  1NK0 A;  3ZSO A;  3AVH A;  3WNE A;  4CGJ A;  3LPT A;  1C0M A;  3A2F A;  4FW2 A;  4JLH A;  5I3U A;  3D0P A;  2D0A A;  2OPR A;  4DQS A;  4CJT A;  4FJX A;  1RBT A;  2F96 A;  3QEI A;  4C8N A;  4B9L A;  4H8K A;  4BDZ A;  1IKX A;  4CJK A;  3NH2 A;  4Z4I A;  4CHY A;  1JLQ A;  1SV5 A;  5HP1 A;  3T3F A;  1S1T A;  3OYK A;  2E4L A;  1C6V A;  1ASU A;  4AIL C;  4FJG A;  4FJN A;  2YHB A;  1A5V A;  3L2V A;  3LP1 A;  1NK7 A;  3DLR A;  4CF1 A;  1S1X A;  3QIP A;  4CGG A;  1HNV A;  2QKK A;  3KKS A;  1BIU A;  1BCM A;  3LP3 A;  3NGI A;  4O55 A;  3QET A;  2GBZ A;  2XY8 A;  4DWI A;  4OJR A;  3QEX A;  4KI4 A;  3P1G A;  2IDO A;  4FLZ A;  2YNI A;  5J2Q A;  2P5G A;  1LW0 A;  4ID5 A;  1RTD A;  3SUO A;  1ZBH A;  2I5J A;  3DRR A;  2B5J A;  3TAN A;  1NJW A;  3VQ9 A;  3DLK A;  4CFC A;  1JXB A;  4IKF A;  1CZB A;  3WNH A;  2OPP A;  3NF9 A;  4KO0 A;  3M8R A;  1KCF A;  3L2U A;  3P5J A;  2D0B A;  2WON A;  1X9S A;  3L3U A;  4K8Z A;  1TV6 A;  3SUN A;  1CXQ A;  2HND A;  3KLE A;  4F2S A;  1TAU A;  3SV3 A;  2G8W A;  4AHU A;  1RNH A;  1W0H A;  2VWK A;  4KKO A;  5CYQ A;  4BE2 A;  1S1U A;  1GOC A;  3SCX A;  1HPZ A;  1VSM A;  4IG3 A;  1RTH A;  1VSI A;  2JGU A;  4ZHR A;  3LZJ A;  4CCH A;  4ELT A;  2B6A A;  4C8L A;  3T1A A;  3PX6 A;  2ZD1 A;  4DSE A;  1CZ9 A;  1O1W A;  3VQC A;  4CES A;  1IH7 A;  1J54 A;  3LAM A;  1U48 A;  4FZZ A;  3VQ6 A;  3K2P A;  4BE1 A;  2DY4 A;  2Z1J A;  2Z1H A;  3VQ8 A;  3SQ1 A;  1KFS A;  3LP0 A;  3HL8 A;  2QK9 A;  4BDY A;  2YV0 X;  3DMJ A;  3L2Q A;  4AHV A;  4KRE A;  3LZI A;  3HYF A;  1NK6 A;  4M3X A;  4DSI A;  1RT5 A;  2YNG A;  3L2R A;  3DLG A;  2RPI A;  4E7J A;  2PZS A;  2F8T A;  3OVN A;  2EHG A;  3NFA A;  5SZT A;  3OYG A;  2LSN A;  1LWC A;  2YKM A;  1BL3 A;  3OYE A;  1IG9 A;  3P83 D;  3RR8 A;  3OS0 A;  1IO2 A;  2Y1J A;  2G8I A;  2F8S A;  5KGX A;  4QOZ B;  3QO9 A;  3G10 A;  1JLG A;  1LW2 A;  2HHU A;  4FM1 A;  1Q9Y A;  5HRP A;  1J9A A;  4ICL A;  4Z4H A;  2P5O A;  1RBU A;  1ZBF A;  3ASM A;  1BQN A;  3RRH A;  3DOK A;  3U3G A;  2KZZ A;  4DTO A;  1REV A;  1HYV A;  3QEP A;  2IS3 A;  4RG8 A;  4FJ8 A;  3PV8 A;  3OYM A;  3ZSW A;  1Z26 A;  3DLE A;  4N47 A;  4HUF A;  1N6Q A;  2GV9 A;  1C1A A;  3V81 A;  3RMC A;  3IRX A;  1F21 A;  4B3O A;  4KB1 A;  3QLH A;  4AHR A;  5JS1 A;  3TAG A;  4PA1 A;  4DLG A;  3V1O A;  4RW9 A;  4BE0 A;  1RT7 A;  1SL2 A;  4FZY A;  4OLB A;  3NF6 A;  3SJJ A;  1DTQ A;  3NH1 A;  3IS9 A;  1ZYQ A;  4FK2 A;  2OPS A;  1HMV A;  4W5Q A;  3HJF A;  1WSE A;  4DU3 A;  2HNZ A;  2NUB A;  4CIF A;  5KRS A;  3OYI A;  2A1R A;  4EP4 A;  3B6P A;  3I0S A;  3NDK A;  3VN5 A;  3NGY A;  5C42 A;  3LWL A;  4OGC A;  4DSJ A;  1U04 A;  4KAZ A;  3HPH A;  4CEB A;  3NBP A;  3KLH A;  4OKE A;  1TAQ A;  1KRP A;  4CK1 A;  2IAJ A;  1YVU A;  4AH9 A;  3KLG A;  2D5R A;  5KRT A;  2GUI A;  5CZ2 A;  3HT3 A;  4OLA A;  3ALY A;  1BIZ A;  3AO3 A;  4IDK A;  4DSK A;  1HQU A;  4CER A;  3PX4 A;  1WN7 A;  3CG7 A;  1XC9 A;  4KTW A;  1LV5 A;  4OPK A;  3AO1 A;  3PUF A;  4OPJ A;  3ZT0 A;  1SKW A;  4FJ9 A;  3PO4 A;  1YTU A;  3NCI A;  4LSN A;  4DTR A;  3TAQ A;  1KVA A;  4FJL A;  1KTQ A;  1GOB A;  3O4N A;  3VQ4 A;  3SZ2 A;  1KFD A;  2EX3 A;  4C8M A;  2E6M A;  3V1R A;  2XO7 A;  3SQ2 A;  1VSH A;  4RW8 A;  3QEW A;  1BQM A;  1KSP A;  4CJ5 A;  3QNN A;  4QCL A;  2VG5 A;  5I42 A;  3RRG A;  1JLC A;  3IG1 A;  3L2W A;  4RW7 A;  4M3Z A;  3V9S A;  5E41 A;  3WNG A;  3I8D A;  3VA3 A;  1CLQ A;  4I2Q A;  4I7F A;  1TKD A;  2WOM A;  3LAN A;  1Z25 A;  1VSK A;  3VA0 A;  3NF8 A;  1TK8 A;  1U49 A;  3PY8 A;  2KFN A;  3KIO A;  1L3S A;  1TVR A;  4EZ9 A;  1TKT A;  1BCO A;  2X74 A;  1DTT A;  1S6Q A;  4CJE A;  4CEZ A;  3V9U A;  5DMR A;  4W5R A;  4B9U A;  5DK5 A;  1FK9 A;  3S3N A;  1ZBI A;  4FYD A;  3RR7 A;  1IKV A;  2ETJ A;  3OYC A;  1RDB A;  3C95 A;  3CM6 A;  4CEC A;  1SKR A;  2B4J A;  4CHP A;  3QEV A;  3ZSY A;  3G0Z A;  4R5P A;  4DTP A;  4DFK A;  1SL0 A;  3KK1 A;  1TKX A;  4Z4G A;  1RBR A;  5HRN A;  3NHG A;  4CJP A;  1XHZ A;  1D9D A;  3LAL A;  2YHA A;  2FC0 A;  4J2A A;  4CHO A;  3LPU A;  1UA1 A;  1U4B A;  1G15 A;  3VQD A;  3AA4 A;  4CE9 A;  1NOZ A;  1HJR A;  4CGH A;  2PY5 A;  1L3U A;  2OZM A;  2KFZ A;  5SWM A;  3AA2 A;  4DTM A;  4DQQ A;  3V9Z A;  1HQE A;  2OPQ A;  3NE6 A;  1U45 A;  3HP9 A;  1RT3 A;  3K58 A;  1C1B A;  4DTN A;  3L8B A;  5J1E A;  4B9N A;  1WSJ A;  3LAK A;  4FJK A;  1S5J A;  4LH4 A;  3VQQ A;  4KHW A;  5D3G A;  3KD1 E;  4G1Q A;  3WNF A;  4FXD A;  4OGE A;  1VK0 A;  4OKJ A;  4ID1 A;  4CK3 A;  3OYF A;  3E01 A;  3S3M A;  4Q0B A;  2FBT A;  3ZT1 A;  1HNI A;  2IGI A;  4NYN A;  1B9D A;  4CJF A;  4CJQ A;  1X9M A;  4DF8 A;  1VSL A;  2BE2 A;  2G8U A;  3KD5 E;  4N76 A;  3ZSR A;  1Q9X A;  3BGR A;  1EX4 A;  3MEG A;  4FVM A;  3ISN C;  4RW6 A;  4N56 A;  4DTJ A;  2VWJ A;  1JLB A;  3OJU A;  1ITG A;  4B08 A;  1NJX A;  3V9X A;  1N5Y A;  2G8V A;  3ULD A;  2RN2 A;  4DLE A;  3QES A;  4KTQ A;  4Z4C A;  4DU1 A;  4CEF A;  1ASW A;  4CHQ A;  3AVL A;  1S1V A;  1S9G A;  2VG6 A;  5CYM A;  2QXF A;  4CJU A;  4N5S A;  3MEC A;  1D5A A;  4CGF A;  3ZSZ A;  1B9F A;  3LWM A;  3V6D A;  4FLW A;  1WLJ A;  1JKH A;  1T03 A;  4NYF A;  4DTS A;  3SPZ A;  1NKC A;  1ZBU A;  3ZCM A;  1IKY A;  3DI6 A;  4HVJ A;  4KHS A;  4PQU A;  1LWE A;  1QHT A;  4CGI A;  4FLT A;  1XHX A;  2DFF A;  4JRQ A;  4B9S A;  4CFD A;  1RIL A;  1BI4 A;  1WAF A;  1WSI A;  4FM2 A;  1EET A;  3AVG A;  4CFA A;  4FLX A;  4CJ3 A;  1B92 A;  3QIN A;  4CJS A;  3HP6 A;  3MXI A;  4F2R A;  2AJQ A;  4I2P A;  3SQ0 A;  4I9L A;  4MFB A;  4CGD A;  4B9M A;  2KTQ A;  1RDA A;  3TR8 A;  1NK4 A;  4K8X A;  4M3U A;  3K59 A;  3OYJ A;  3SYZ A;  2HVI A;  1T05 A;  4PWD A;  4M42 A;  2HHX A;  3O4Q A;  5J2N A;  3SNN A;  1BI4 B;  1TKZ A;  4HHT A;  3MED A;  3TWH A;  1Y97 A;  4DG1 A;  2YNH A;  1WSF A;  3K5M A;  4N41 A;  1FXX A;  3AV9 A;  5EU7 A;  1QS4 A;  4UQG A;  3OYH A;  1TK0 A;  5FRN A;  4KTZ A;  4F3T A;  4FJH A;  4LH5 A;  3HO1 A;  1KVC A;  2X78 A;  4LY7 A;  4TSX A;  3V4I A;  1TK5 A;  3BDP A;  2RKI A;  3C94 A;  1RTJ A;  4E89 A;  3MAQ A;  4CEQ A;  2ITG A;  2XY7 A;  1RTI A;  4FK0 A;  3AVN A;  1C0T A;  3M8S A;  1RT2 A;  3TI0 A;  3AO5 A;  3HK2 A;  3ZT4 A;  4FZX C;  4EZ6 A;  5C24 A;  2KW4 A;  3ITH A;  1VSJ A;  4E0D A;  2HHS A;  2BDP A;  2HB5 A;  4HUE A;  3OYA A;  3NGZ A;  1A5W A;  4KHY A;  1MU2 A;  4JS5 A;  1YT3 A;  2HVH A;  2IOC A;  1JLE A;  3AVC A;  4B8C A;  1S6P A;  4B8A B;  3DRP A;  4HTU A;  4F4K A;  1EKE A;  1JXE A;  4CHN A;  3OS2 A;  3LP2 A;  3V1Q A;  1A5X A;  4E1N A;  4CJL A;  3EYZ A;  3CFP A;  3TAB A;  4XIU A;  1UA0 A;  4DS4 A;  3KTQ A;  3SI6 A;  5T7B A;  1NJZ A;  3K57 A;  4W5T A;  1TGO A;  4FLV A;  3DOL A;  3AA5 X;  1NK9 A;  2Z1I A;  4E7I A;  3U3Y A;  3SUP A;  1NK8 A;  3JSM A;  4LD0 A;  4ELU A;  4FCY A;  3RMD A;  2BGG A;  4NCA A;  3AVK A;  3AO4 A;  3T19 A;  1RBV A;  4DQR A;  1GOA A;  2PYL A;  3KK3 A;  4O4G A;  2VG7 A;  4CEO A;  4CJV A;  3NAE A;  3S9H A;  3C6U A;  3K5N A;  3TAE A;  2QKB A;  3MXM A;  4KHN A;  5HRO A;  4J2B A;  1C1C A;  4CEA A;  4MQ3 A;  1JLA A;  2ATQ A;  1TL3 A;  4IFV A;  4OVL A;  5JS2 A;  1ZBL A;  2Z1G A;  1D9F A;  4C8O A;  3KKR A;  3AVJ A;  2O4I A;  1RT4 A;  1NOY A;  1RBS A;  3HM9 A;  4PUO A;  1LWF A;  2P51 A;  3HST B;  4O0I A;  3I0R A;  4F8R A;  2RF2 A;  3K5O A;  4E7K A;  3KK2 A;  3O3F A;  1FKO A;  2X6S A;  3MEE A;  2XY6 A;  2X6N A;  3PO5 A;  1QQC A;  1UAX A;  2O4G A;  4KI6 A;  1LAW A;  1S9E A;  3OS1 A;  1TL1 A;  4Y1C A;  3DLH A;  4FLU A;  4M3T A;  4BWM A;  2G8K A;  1QTM A;  1X9W A;  3VQE A;  5J2P A;  4DSL A;  1QE1 A;  3TAM A;  4F3O A;  3QER A;  3L3V A;  4DFJ A;  3QIO A;  2HHT A;  3HVR A;  1BGX T;  4Q5V A;  2FBY A;  4I9Q A;  1I39 A;  2OA8 A;  2KZM A;  2IC3 A;  4CFB A;  4FJI A;  2FBX A;  3KLF A;  1HRH A;  4QAG A;  3RMB A;  3ZT2 A;  4FJM A;  4HUG A;  4M45 A;  4IFY A;  2DFE A;  4DTX A;  4KB0 A;  4CED A;  1FKP A;  4JS4 A;  3HPG A;  4DS5 A;  3NF7 A;  4B9V A;  2A1S A;  4M41 A;  4FJJ A;  4NCB A;  4E3S A;  2BAN A;  1KLN A;  1SKS A;  4CF2 A;  5KGW A;  2W42 A;  3QNO A;  4YNQ A;  4B9T A;  4GW6 A;  4J2D A;  5HBM A;  1J53 A;  4IBN A;  4KRF A;  4CEE A;  1L5U A;  2Q3S A;  4Z0U A;  4FM0 A;  3FFI A;  3ZSX A;  3EY1 A;  1S1W A;  4DU4 A;  1NK5 A;  1T8E A;  2Y1I A;  4O44 A;  2XRI A;  3O3G A;  2YKN A;  1SL1 A;  4Z4E A;  1VRU A;  1K6Y A;  4H4M A;  5C25 A;  3NH0 A;  3F73 A;  1QSS A;  3RWU A;  4KPY A;  3M8P A;  1VRT A;  4O0J A;  4AHS A;  4CIE A;  4KHU A;  2D0C A;  4E1M A;  3KLI A;  4DF4 A;  3OJS A;  5HRS A;  3SV4 A;  1ASV A;  1WSH A;  3OYN A;  3TAP A;  2DTU A;  4DFM A;  1NKE A;  3AO2 A;  4J2E A;  4FW1 A;  4KV8 A;  3EZ5 A;  2PYJ A;  1UWB A;  1VSD A;  2YNF A;  1WNS A;  3AVI A;  4CF8 A;  4M3Y A;  1EXQ A;  3DYA A;  4CJW A;  4ZTJ A;  1CXU A;  1X1P A;  4C8K A;  2JLE A;  3V9W A;  4L8R B;  2ZE2 A;  4E19 A;  1RDD A;  1QSL A;  3ZSV A;  4ELV A;  4KFB A;  4DTU A;  5FRM A;  3CFR A;  3RTV A;  1U47 A;  4W5O A;  5FRO A;  1QSY A;  5KTQ A;  4OKK A;  1YTA A;  4CF0 A;  3UIQ A;  1KVB A;  2HW3 A;  4RW4 A;  1I3A A;  3B6O A;  3C6T A;  3AVB A;  3D45 A;  4HCB A;  1JL2 A;  1NKB A;  4GVM A;  4M3R A;  3AVF A;  1EP4 A;  3SPY A;  3THV A;  1NJY A;  5KI6 A;  4JRP A;  4W5N A;  2HNY A;  1XWL A;  4AHC A;  3AVM A;  1L3V A;  5CZ1 A;  3CFO A;  2OYQ A;  3CYM A;  4PY5 A;  3DRS A;  3M8Q A;  3VQB A; 
#chains in the Genus database with same CATH topology
 4IFE A;  1VSF A;  4CIG A;  2Q31 A;  2HF4 A;  4DFP A;  4DV2 K;  5J2M A;  4FVU A;  1N32 K;  1JL1 A;  4QS9 A;  4CJR A;  2PFU A;  4CK2 A;  4HCC A;  4WF9 L;  5K14 A;  4IO9 L;  1C0U A;  3IAY A;  2QWP A;  3ZSQ A;  1H1V A;  1WAJ A;  4DV6 K;  1D4X A;  2Q2R A;  2Q97 A;  4KHQ A;  3VQA A;  3U8X A;  1SUQ A;  1GLD G;  1ATN A;  4X62 K;  3DM2 A;  4BG9 A;  4CZH A;  2G8F A;  3THY B;  1QHA A;  1WSG A;  4M3W A;  2XY5 A;  3VQ7 A;  1UOC A;  1RDC A;  1RT1 A;  4K42 A;  4DV1 K;  3VES A;  3ZSO A;  3AVH A;  4GV3 A;  1HPM A;  2D0A A;  4A2A A;  4A61 A;  4CJT A;  4DQS A;  4C8N A;  2BUP A;  1JLQ A;  3M5R A;  3J7Z O;  1EWR A;  3H1Q A;  5AZJ B;  3OYK A;  2E4L A;  5DM7 L;  1ASU A;  2GX9 A;  4FJG A;  3F2K A;  1A5V A;  2VQE K;  1BUP A;  3QIP A;  3HBT A;  4JHD A;  4CGG A;  1BCM A;  4ILJ A;  4DR4 K;  2XY8 A;  3SMS A;  3P1G A;  4FLZ A;  1LW0 A;  1ZBH A;  2I5J A;  4CFC A;  2E1Z A;  3DLK A;  1CZB A;  1NGB A;  1KCF A;  3P5J A;  3WQU A;  5KPZ A;  2O8C B;  1JCE A;  1TAU A;  4AHU A;  5CYQ A;  1VQ7 N;  1GOC A;  4IG3 A;  1ATS A;  3HRG A;  5JLH A;  3CCM N;  3AAR A;  3T1A A;  2ZD1 A;  1O1W A;  3VQC A;  1U48 A;  3K2P A;  2DY4 A;  2Z1H A;  3VQ8 A;  1KFS A;  3LP0 A;  2FXU A;  2YV0 X;  4AHV A;  3E66 A;  3LZI A;  3HYF A;  3SJH A;  3WEE A;  1RT5 A;  1TUU A;  4MO4 A;  3DLG A;  1S22 A;  2RPI A;  1M1K O;  2PZS A;  1LWC A;  1BL3 A;  1IG9 A;  1IO2 A;  5KGX A;  4NXM K;  4GV9 A;  1JLG A;  1LW2 A;  3CC2 N;  4BGA A;  1J9A A;  2P9L B;  3G25 A;  1WBD A;  3WXM B;  1ZBF A;  3ASM A;  4DTO A;  3OBY A;  1HYV A;  3QEP A;  1XMO K;  2YI1 A;  2NZT A;  4XH4 A;  3PSI A;  4B1V A;  4HUF A;  3V81 A;  5BPL A;  3RMC A;  4CZM A;  5LJW A;  3TAG A;  5AR0 A;  1RT7 A;  3A0I X;  3ENH A;  3BUZ B;  3SJJ A;  1ZYQ A;  3IS9 A;  3A5N C;  1YUW A;  1HR0 K;  4CZJ A;  3T7Z A;  4JKG B;  3DWL A;  3VN5 A;  3NGY A;  4KAZ A;  3GG4 A;  3NBP A;  4OKE A;  2F9T A;  1KRP A;  4CK1 A;  2D5R A;  5KRT A;  2GUI A;  4NO7 A;  3HT3 A;  1ILY A;  3ALY A;  1BIZ A;  3AAP A;  5I9E B;  4DCH A;  4CER A;  3MX2 A;  1P8Z A;  2V51 B;  3CG7 A;  5JVH L;  1XC9 A;  3K0S A;  3ZT0 A;  3P38 A;  4LSN A;  4M7X A;  1KVA A;  4FJL A;  3MCA B;  3L4I A;  3SK3 A;  5F2R A;  3SQ2 A;  3LM2 A;  4CZK A;  5LY3 A;  1MDU B;  2P9I A;  4A5A A;  3IG1 A;  3WXL A;  5JLF A;  3V9S A;  5E41 A;  3I8D A;  3VA3 A;  4DR6 K;  1CLQ A;  4I2Q A;  2O8F A;  4X64 K;  1L3S A;  1U2V B;  1TVR A;  4EZ9 A;  4LFB K;  1TKT A;  3EEQ A;  1YJN N;  1BCO A;  3U4L A;  3UKR B;  4CJE A;  3V9U A;  5DMR A;  1ZBI A;  5JMV A;  3OYC A;  1RDB A;  1SKR A;  2UUB K;  2HBK A;  4CHP A;  3ZSY A;  1SL0 A;  3ID8 A;  4NLB A;  4JI3 K;  5AQX A;  3P31 A;  4FWS A;  2D4W A;  3QFU A;  2CH6 A;  3SAG A;  4CE9 A;  1NOZ A;  3LDN A;  1BWF O;  2CGK A;  5LMN K;  5M1F A;  1RDW X;  4JK9 A;  3AA2 A;  4DQQ A;  2QM1 A;  3NE6 A;  4FWP A;  2UYT A;  3VF2 A;  3LAK A;  1S5J A;  4LH4 A;  5KPT A;  5D3G A;  1IBM K;  1VK0 A;  3E1Y A;  5GIN A;  4BR5 A;  4IOA L;  3E01 A;  1I94 K;  4CJQ A;  4CJF A;  3GL1 A;  4DF8 A;  1VSL A;  4BRM A;  2G8U A;  2WFB A;  3EZW A;  3ZSR A;  4N76 A;  3CCU N;  4FVM A;  3MWP A;  4DTJ A;  3OJU A;  4B08 A;  2QEX N;  2KHO A;  3NMU A;  2IVP A;  4CHQ A;  3LWM A;  3MEC A;  4FK4 A;  1T03 A;  1XMQ K;  3SPZ A;  1Q86 O;  3CJA A;  1QHT A;  4FLT A;  4CGI A;  3N4Q A;  4B9S A;  4CFD A;  1RIL A;  1BI4 A;  4FM2 A;  4BRL A;  4WFN L;  3ULE B;  4C1N I;  3AVG A;  3WQT A;  2WUS A;  3QIN A;  4CJS A;  3MXI A;  2AJQ A;  4I2P A;  4CGD A;  4B9M A;  3TR8 A;  1HNZ K;  3MN7 A;  5JVG L;  4PWD A;  2Q36 A;  3O4Q A;  1TKZ A;  3TWH A;  1Y97 A;  3FZK A;  4DG1 A;  5FPD A;  1FXX A;  3AV9 A;  5FRN A;  4KTZ A;  1KD1 O;  4FJH A;  4KH6 A;  3ZET B;  1RTJ A;  2Q0R A;  4E89 A;  3MAQ A;  4CZG A;  2ITG A;  2XY7 A;  1IG8 A;  3J7A P;  1C0T A;  3BY5 A;  2NRX A;  1QVG M;  4FZX C;  5MLC Q;  4EZ6 A;  2KW4 A;  4GKK K;  1VSJ A;  3SMP A;  4YOW A;  5EXW A;  3Q7B A;  4YOV A;  1A5W A;  2FSJ A;  4X66 K;  5M1K A;  1O13 A;  1JLE A;  4B8C A;  1S6P A;  2E2O A;  4B8A B;  4HTU A;  1BA0 A;  3TSU A;  3LP2 A;  1YVN A;  5FPN A;  3QML A;  1UA0 A;  4DS4 A;  1NM1 A;  1NJZ A;  3K57 A;  4WQ4 C;  1JCG A;  3DOL A;  3MDQ A;  1NK9 A;  2Z1I A;  4E7I A;  3U3Y A;  1NK8 A;  4ELU A;  3R9P A;  3RMD A;  2YCH A;  1ATR A;  3AVK A;  3C6A A;  4YOT A;  2PYL A;  3KK3 A;  1WB9 A;  4CJV A;  3C6U A;  3K5N A;  3TAE A;  4KHN A;  2ATQ A;  5JS2 A;  1DKG D;  4NLC A;  1ZBL A;  4C8O A;  3AVJ A;  4XH1 A;  3I0R A;  4F8R A;  3N4P A;  3AGK A;  4O5F A;  1N8R O;  1HNX K;  4EIA A;  4KI6 A;  1LAW A;  3CJC A;  3I55 N;  4CVN E;  3VQE A;  1BA1 A;  1M90 O;  4BRI A;  1Q7Y O;  4FWN A;  3OA9 A;  1K8K A;  2HHT A;  3VEV A;  5BRF A;  2FBY A;  2OA8 A;  2IC3 A;  4H0O A;  1T6C A;  2FBX A;  1HRH A;  3I8B A;  4M45 A;  4BC5 A;  1FKP A;  3HPG A;  5AFU H;  4H5N A;  1RDU A;  4M41 A;  3VET A;  4NCB A;  3TSP A;  3UE5 A;  2W42 A;  1BDG A;  3O9U A;  4J2D A;  1YIJ N;  3QB0 A;  5HBM A;  1J53 A;  4IDH A;  1EQY A;  4H5T A;  4IBN A;  4Z0U A;  1S1W A;  5E26 A;  1GLE G;  4AQY K;  1SL1 A;  5AQI A;  4Z4E A;  1VRU A;  2OCE A;  4AHS A;  4CIE A;  1X3N A;  1J6Z A;  4BRQ A;  5AQL A;  4PKI A;  4KHU A;  1J5E K;  2QWO A;  5AQG A;  5HRS A;  3SV4 A;  3OYN A;  3TAP A;  1MA9 B;  1XQS C;  3AO2 A;  4FW1 A;  4I6M A;  3VPZ A;  1UWB A;  1VSD A;  4XH5 A;  1WNS A;  3AVI A;  4CF8 A;  1EXQ A;  1GLC G;  3DYA A;  1CXU A;  1X1P A;  1YAG A;  3I56 N;  5TKY A;  2ZE2 A;  3CC7 N;  4ELV A;  4DTU A;  5FRM A;  3CFR A;  1U47 A;  1NU0 A;  3J8A A;  1IJJ A;  5FRO A;  4OKK A;  2HW3 A;  2OAN A;  3B6O A;  4JKF A;  3D45 A;  1JL2 A;  1Q18 A;  4M3R A;  1EP4 A;  3SPY A;  4IJN A;  3THV A;  4FL9 A;  4BR7 A;  5KI6 A;  4JRP A;  4W5N A;  3VGK A;  1L3V A;  4RWT A;  2PBD A;  1OH7 A;  4PL8 A;  4MDA A;  1DEJ A;  1BIS A;  1VQL N;  4BAC A;  4WE1 A;  4B1W B;  2FBV A;  1R0A A;  5CY4 A;  2HMI A;  1KAX A;  2ASP A;  4IXC A;  4NCG A;  3KJV A;  1VSE A;  1K8A O;  4DMN A;  2R7Y A;  4HTL A;  3SAH A;  4ISG A;  3FZH A;  4LF8 K;  1Q8I A;  4JN4 A;  4OX9 K;  1WUA A;  3OYL A;  5GAE P;  1T7P A;  3MXJ A;  4AHT A;  5EOY A;  1HYS A;  3HVT A;  1NNE A;  3OY9 A;  4CJ4 A;  3R6M A;  2P9K B;  3ENO A;  4JI5 K;  1GLA G;  4Z4F A;  1RT6 A;  4GMJ B;  4A62 A;  4BG8 A;  5BN8 A;  1D8Y A;  3QBW A;  2XHB A;  4Y1D A;  3CQ8 A;  1MWK A;  1IKW A;  3HI0 A;  2A3Z A;  3MK6 A;  2O8B A;  4KHP K;  4PHT X;  3LPT A;  4FW2 A;  5I3U A;  1RBT A;  4FWL A;  1E4G T;  3AAQ A;  1IKX A;  3NH2 A;  4Z4I A;  4JKH A;  4CHY A;  2P9S A;  1VQ5 N;  3T3F A;  1S1T A;  4BRA A;  4AIL C;  4FJN A;  3THX A;  1NK7 A;  4CZF A;  1HNV A;  3A8Y A;  2QKK A;  3KKS A;  4WYB A;  3LP3 A;  5AZI B;  4BC4 A;  4JI8 K;  4K0K K;  4O55 A;  2QWL A;  4EHU A;  4JAX A;  2IDO A;  4BGB A;  2YNI A;  5J2Q A;  2P9N B;  2P5G A;  4ID5 A;  2W6L A;  3DRR A;  3TAN A;  1NJW A;  3DXK A;  1ESV A;  2OPP A;  4KO0 A;  2WON A;  4K8Z A;  1TV6 A;  2HND A;  1HKG A;  3SV3 A;  2VWK A;  1VQ4 N;  3VTH A;  1S1U A;  3SCX A;  1RTH A;  2JGU A;  4ZHR A;  3DLL L;  3PX6 A;  2D0P A;  4CES A;  2I7N A;  1IH7 A;  4FZZ A;  3VQ6 A;  3D2E B;  4F9O A;  3SQ1 A;  3RSE B;  1VQ9 N;  3HOS A;  2HF3 A;  3OVN A;  3NFA A;  4JI7 K;  5BPN A;  1QZ6 A;  2F8S A;  3P83 D;  4QOZ B;  3OS0 A;  3U9D A;  2G8I A;  2W6K A;  3QO9 A;  3VEW A;  1Q9Y A;  3W0L A;  5HRP A;  3ZYY X;  4DV7 K;  3DOK A;  4B3T K;  1REV A;  3BF3 A;  3PV8 A;  3ZSW A;  3ID6 A;  1Z26 A;  3CPW M;  3VGL A;  4B3R K;  3DLE A;  1N6Q A;  1C1A A;  4B3O A;  1F21 A;  4IEE A;  1VHX A;  1Z6R A;  4IO8 A;  3AY9 A;  3UKU B;  4RTF D;  4DLG A;  4BE0 A;  5AQV A;  5M1O A;  5C15 A;  4OLB A;  2KKZ A;  5KQ8 A;  1DTQ A;  5ELZ A;  4FK2 A;  1T44 A;  2HNZ A;  4UY8 O;  5KRS A;  4CBW A;  3UB5 A;  3I0S A;  3NDK A;  3ZX0 A;  4DSJ A;  3MCP A;  1U04 A;  4WFA L;  3HPH A;  1U6Z A;  2I7P A;  2ZJR L;  2E88 A;  3C7N B;  2IAJ A;  4AH9 A;  3KLG A;  5CZ2 A;  4A57 A;  2NRZ A;  3RVC A;  1LV5 A;  4YDU A;  2HBL A;  3NCI A;  3R1X A;  3TAQ A;  1NGI A;  4MLE A;  1KTQ A;  1GOB A;  4BC3 A;  1KFD A;  2EX3 A;  1R59 O;  3U9Z A;  2JWL A;  3CI5 A;  4DHY A;  2VG5 A;  5I42 A;  4JKA A;  4U67 L;  1VQN N;  2WOM A;  5LL6 Z;  3A5L C;  3VA0 A;  3NF8 A;  1TK8 A;  1U49 A;  2FF3 B;  3PY8 A;  4FSV A;  3MN6 A;  1DTT A;  1S6Q A;  1GLF O;  5H1S Q;  4B9U A;  1IKV A;  3C95 A;  3CM6 A;  4CEC A;  3HM8 A;  1IBL K;  4DFK A;  3SAF A;  4Z4G A;  1D9D A;  4CHO A;  3AA4 A;  5C2F A;  3G6E N;  1HJR A;  4CGH A;  4C23 A;  4H5V A;  2F4V K;  3V9Z A;  4FWM A;  1HQE A;  2OPQ A;  1U45 A;  1RT3 A;  3TPQ A;  2GEM A;  4DTN A;  4FWO A;  3L8B A;  4CBU A;  4B9N A;  5IWA K;  1WSJ A;  4JI0 K;  3VQQ A;  4KHW A;  1FW6 A;  3KD1 E;  2ASM A;  4OGE A;  4YOR A;  3VEO A;  3MWT A;  2QWM A;  2FBT A;  3LDQ A;  1B9D A;  3R8E A;  1VAZ A;  4H0X B;  3EE8 A;  1T3V A;  2BE2 A;  3KVG A;  1HJO A;  4Y0W A;  1EX4 A;  4RW6 A;  1SS6 A;  2ASO A;  2G8V A;  3ENB A;  3OHR A;  3QES A;  3O9T A;  3Q7C A;  1HLU A;  4CEF A;  3VOV A;  4CGF A;  1D5A A;  3V6D A;  1WLJ A;  1JKH A;  1CZA N;  3DI6 A;  2WTU A;  4KHS A;  1LWE A;  4GVE A;  4JRQ A;  2ZGY A;  1WAF A;  4CZI A;  1TYQ B;  1JJ2 M;  4CFA A;  4FLX A;  2E5L K;  1B92 A;  1OVY A;  3SQ0 A;  3GOI A;  4BQZ A;  3K59 A;  1P90 A;  4BR4 A;  2O8D A;  3FR0 A;  4HHT A;  3T69 A;  2YNH A;  1K9M O;  3K5M A;  4N41 A;  4UQG A;  5EU7 A;  2IVO A;  3OYH A;  1TK0 A;  4F3T A;  3D2F B;  4LH5 A;  4LY7 A;  3V4I A;  1QQM A;  3CJ7 A;  4JYA K;  4CEQ A;  4FK0 A;  3TI0 A;  3THW B;  4E0D A;  5ADX A;  3QBX A;  1KC8 O;  2BDP A;  1LOT B;  1W7A A;  3CIP A;  1MU2 A;  1NBW A;  4BRG A;  4JS5 A;  1QVF M;  2IOC A;  4GNI A;  3AVC A;  3ZX2 A;  3DRP A;  1EKE A;  4CHN A;  4DUY K;  4JD2 A;  1A5X A;  4J8F A;  4JK7 A;  2J4R A;  1MWM A;  3O1W A;  4W5T A;  3SBG A;  3AA5 X;  3JSM A;  4LD0 A;  4FCY A;  2BGG A;  4NCA A;  3AO4 A;  4DQR A;  2VG7 A;  3S9H A;  1K73 O;  3MXM A;  3R3L A;  4CEA A;  4IFV A;  2Z1G A;  3KKR A;  4PUO A;  4E7K A;  4DKW A;  3KK2 A;  1VQ6 N;  1FKO A;  1DT9 A;  5C2D A;  1TL1 A;  1YXQ A;  2D0O A;  2DPN A;  4Y1C A;  5ADX H;  4BWM A;  1X9W A;  1QE1 A;  3O08 A;  4B1Y B;  3L3V A;  4YOY A;  4DFJ A;  3M6G A;  3QIO A;  3HVR A;  2GWJ A;  4I9Q A;  2V7Z A;  5M1P A;  2ZM6 K;  4YOX A;  4FJI A;  3W3D A;  4FJM A;  4HUG A;  4KB0 A;  4CED A;  4JS4 A;  4HWI A;  4B9V A;  4FJJ A;  4B1X B;  4E3S A;  2BAN A;  1KLN A;  1SKS A;  4JI4 K;  4CF2 A;  3QNO A;  3KWG A;  1NGC A;  4YNQ A;  4B9T A;  4GW6 A;  2YHY A;  1L5U A;  5M1N A;  1T8E A;  1NK5 A;  4O44 A;  3CQX A;  3LDP A;  4H4M A;  5C25 A;  3F73 A;  4KPY A;  3NVK A;  4DV3 K;  4O0J A;  4AM7 A;  4PL7 A;  2A6A A;  2O8E A;  1WSH A;  1NKE A;  2A41 A;  4DR7 K;  4J2E A;  2PYJ A;  4DV0 K;  1IBK K;  4CJW A;  1OVQ A;  4ZTJ A;  2P9P B;  4L8R B;  3ZEU A;  4E19 A;  1RDD A;  1QSL A;  3QDK A;  5BRD A;  2P9U A;  4W5O A;  3UIQ A;  4RW4 A;  3C6T A;  3NVM A;  4EAH D;  4BVP A;  4HCB A;  1NKB A;  3TTF A;  5CZ1 A;  3CFO A;  2OYQ A;  3CCJ N;  4PY5 A;  4DSF A;  1DLO A;  4LF7 K;  2ZF5 O;  3AVA A;  2HHH K;  4H4O A;  5BRH A;  4O5B A;  3DXM B;  3LDS A;  4WQ5 C;  4BY9 C;  4EP5 A;  1DGK N;  1J5O A;  4BVO A;  3SUQ A;  4JKC A;  3K9K A;  3HXM A;  2DFH A;  3THY A;  5HLF A;  3OYD A;  4BC2 A;  4BDP A;  1KLM A;  2NRV A;  2ZQB A;  4Z94 A;  2FSN A;  4CZE A;  1JLF A;  2OZS A;  3O9Q A;  4CHZ A;  5FDL A;  4FLY A;  3KZB A;  1W9H A;  2HHV A;  4DQP A;  2HHW A;  3CME N;  3RMA A;  2P1J A;  4V19 S;  2W41 A;  2G8H A;  3DLB A;  4LF6 K;  4OO1 J;  3U6F A;  3O3H A;  1BHL A;  2E6L A;  1Y64 A;  5AZJ A;  3O8M A;  2F7T A;  4DQ8 A;  4CGJ A;  1C0M A;  3A2F A;  4JLH A;  2F96 A;  4DB3 A;  3QEI A;  4B9L A;  1VQP N;  3CJB A;  1SV5 A;  5HP1 A;  4BRC A;  2A40 A;  2YHB A;  3L2V A;  4CF1 A;  2O8C A;  2E2N A;  3CQY A;  4OJR A;  4YDU C;  3QEX A;  1OH6 A;  2NLX A;  4YY3 K;  3VQ9 A;  4DV5 K;  1JXB A;  4IZ9 A;  4IKF A;  3WNH A;  3L2U A;  4JHD B;  3L3U A;  2E20 A;  3ZLJ A;  1BG3 A;  3O1B A;  4AF1 A;  1QZ5 A;  2ZJP L;  3PSF A;  1YJ9 N;  1VSM A;  1VSI A;  2D1K A;  4CCH A;  4C8L A;  3JXU A;  4DSE A;  1XC3 A;  1J54 A;  3VF4 A;  4BRK A;  1VQK N;  1N34 K;  2P9L A;  2QK9 A;  4KRE A;  3DMJ A;  3L2Q A;  3VF6 A;  4M3X A;  4DSI A;  2YNG A;  3L2R A;  3OYG A;  5SZT A;  4M3Z A;  3OYE A;  2YKM A;  5AQM A;  3KHY A;  2HHU A;  5EX5 A;  4Z4H A;  3OTO K;  1RBU A;  3CHW A;  3RRH A;  1BQN A;  3CF5 L;  3WEE B;  4BR0 A;  4RG8 A;  4FJ8 A;  1NG9 A;  1T6D A;  5AQU A;  4B1Z A;  3PLA A;  2E8A A;  2GV9 A;  1NGF A;  1HX1 A;  3HZ6 A;  4H0T B;  4JKG A;  3CJ1 A;  5JS1 A;  4RW9 A;  1SL2 A;  4FZY A;  3NF6 A;  5F0X A;  5FPE A;  3NH1 A;  3F5T A;  1HMV A;  4W5Q A;  1WSE A;  4DU3 A;  2NUB A;  4CIF A;  3BF1 A;  2ZWH A;  3B6P A;  4MDB A;  5C42 A;  4OGC A;  4GKJ K;  4ILG B;  3KLH A;  4FOE A;  1TAQ A;  3MX5 A;  1YVU A;  2GUP A;  3DJC A;  3A5M C;  4DSK A;  4JI2 K;  3BZC A;  4CZL A;  3PX4 A;  3L0Q A;  4MLH A;  3AO1 A;  4OPK A;  2A5X A;  1YTU A;  4FWK A;  4DTR A;  3GBT A;  5IT9 O;  2AA4 A;  3VQ4 A;  3WUH A;  1E4F T;  1U2V A;  4C8M A;  3V1R A;  2E6M A;  4ILH A;  1NWK A;  3AGR A;  4RW8 A;  2QXL A;  3UKR A;  3O80 A;  1BQM A;  3CC4 N;  3QEW A;  4CJ5 A;  3QNN A;  5C0Y A;  1JLC A;  4RW7 A;  1Q82 O;  4I7F A;  1TKD A;  2QWN A;  3LAN A;  3GDQ A;  2KFN A;  3KIO A;  4DUZ K;  3I33 A;  4IJA A;  4CEZ A;  4FYD A;  4W5R A;  3S3N A;  4EFH A;  3RR7 A;  2ETJ A;  2P9I B;  4BRO A;  2B4J A;  4R5P A;  3G0Z A;  2O8F B;  3LDO A;  3CJ9 A;  4J2A A;  5GIO A;  4CJP A;  1XHZ A;  3LAL A;  2YHA A;  1G99 A;  1NGH A;  1U4B A;  2UUC K;  1G15 A;  1E3M A;  2ITM A;  3E9L A;  3VEY A;  2PY5 A;  1L3U A;  4DTM A;  2Q1N A;  3HP9 A;  3L4Q A;  3VEX A;  3CCQ N;  3EKS A;  4FJK A;  4JI6 K;  5HL7 L;  2GWK A;  3O5B A;  4FXD A;  1BU6 O;  4OKJ A;  4ID1 A;  5HOO A;  3OYF A;  3S3M A;  5AQZ A;  3ZT1 A;  1HNI A;  4NYN A;  3KD5 E;  3BGR A;  4KH5 A;  4N56 A;  1N33 K;  2VWJ A;  1S3X A;  3V9X A;  1N5Y A;  2RN2 A;  1ZC6 A;  4DLE A;  3ULE A;  1W97 L;  1ASW A;  3AVL A;  1S9G A;  5CYM A;  3WXI A;  1Q81 O;  3ZSZ A;  1RGI A;  4PQU A;  4FLW A;  4NYF A;  4DTS A;  3ZCM A;  1IKY A;  4HVJ A;  1XHX A;  2DFF A;  4KH4 A;  1WSI A;  2YX6 A;  3VTI A;  4DV4 K;  3OW2 M;  1EET A;  4NXN K;  3HP6 A;  4I9L A;  1GLB G;  2KTQ A;  1RDA A;  4K8X A;  3OYJ A;  3SYZ A;  3ZET A;  1T05 A;  3S41 A;  3H3N O;  4YHH K;  4M42 A;  2HHX A;  5J2N A;  4OPH A;  2HOE A;  1BI4 B;  3C0B A;  3MED A;  1EO1 A;  4WQ4 A;  3TTD A;  1C0G A;  3VEN A;  1QS4 A;  1NGD A;  3IMX A;  3HO1 A;  1KVC A;  4TSX A;  1TK5 A;  2RKI A;  3C94 A;  1RTI A;  5BRE A;  3HK2 A;  3AO5 A;  3ZT4 A;  5C24 A;  1YIT N;  2HHS A;  3J7Y P;  4HUE A;  3OYA A;  5EY4 A;  3G4S N;  4LF4 K;  2QWQ A;  2NRR A;  4GV6 A;  1EWQ A;  1BO5 O;  2ZGZ A;  3VGM A;  4JV5 K;  3OS2 A;  5LMU K;  4CJL A;  4WFB L;  3TAB A;  3KTQ A;  3QFP A;  1ZBS A;  4BRF A;  4FLV A;  4K25 A;  1OH8 A;  3H6E A;  4BRE A;  3O9R A;  4CBX A;  5EVZ A;  3P39 A;  2VGM A;  1RBV A;  2H3G X;  4O4G A;  2NRT A;  3G71 N;  5BR8 K;  5HRO A;  4J2B A;  1C1C A;  4H0P A;  4MQ3 A;  1JLA A;  4OVL A;  1TL3 A;  3KK7 A;  2WC9 A;  2QTD A;  3H45 C;  1D9F A;  4FWR A;  1OKJ A;  2O4I A;  1RT4 A;  4IOC L;  1RBS A;  3HM9 A;  2P51 A;  4H03 B;  2QA4 N;  2RF2 A;  3K5O A;  4CJ7 A;  4B3M K;  1HKC A;  1ZXO A;  3O3F A;  3MEE A;  2XY6 A;  2X6N A;  1WBB A;  1XNQ K;  3OS1 A;  3DLH A;  4FLU A;  2G8K A;  1QTM A;  4FO0 A;  5J2P A;  4DSL A;  4F3O A;  5AJ3 K;  1V4S A;  1BGX T;  2PAV A;  4JKE A;  1I39 A;  3KLF A;  4QAG A;  4FPA A;  3RMB A;  3ZT2 A;  4DTX A;  4IFY A;  3HOT A;  1K8K B;  5LJV A;  2IIR A;  4QS8 A;  3FFK B;  1KAZ A;  3SLC A;  2FF6 A;  2Q3S A;  3FFI A;  3PIP L;  5AQF A;  1NGA A;  2QW9 A;  1QSS A;  3H1V X;  1VQM N;  3M8P A;  1VRT A;  2D0C A;  4E1M A;  4L3Q A;  4DF4 A;  3VMF B;  1ASV A;  4KV8 A;  4PKH A;  2YNF A;  3T1H K;  4M3Y A;  4BQL A;  4EHT A;  4X65 K;  3PIO L;  2JLE A;  5FPM A;  4YOU A;  3QIC A;  5KTQ A;  4M63 C;  4I6M B;  1KVB A;  5KQD A;  2OTJ N;  1I3A A;  3AVB A;  4R79 A;  4GVM A;  3AVF A;  3P4I A;  4CW7 B;  2HNY A;  1XWL A;  4AHC A;  2UUA K;  4G9Z A;  5CE3 A;  3CYM A;  1IV0 A;  3M8Q A;  3ATU A;  5HRR A;  3VQ5 A;  4B1U B;  4IG0 A;  4CF9 A;  4KBO A;  4MO5 A;  4E7H A;  4JEP A;  4LSL A;  3SQ4 A;  4PKG A;  3F9K A;  4FJ5 A;  3WXK A;  2WBN A;  3HPO A;  1S72 N;  1XI1 A;  4IEI A;  1SQK A;  1L3T A;  4DQI A;  2UXB K;  3T1Y K;  3TAF A;  3H08 A;  2P9K A;  4XEI A;  4BWJ A;  4FJ7 A;  1VQ8 N;  4M7Y A;  3OYB A;  3IUC A;  3VQP A;  3ZT3 A;  2HHQ A;  3TSQ A;  2NRH A;  3PX0 A;  3TAR A;  2BTF A;  3EN9 A;  3AA3 A;  3S3O A;  1KXP A;  3MMV A;  3CM5 A;  3JYT A;  3J81 O;  1LAV A;  4RCH A;  4ZTF A;  3CET A;  3FLC O;  3EO3 A;  1HYZ A;  2IVN A;  1RCH A;  5AQP A;  4YFU A;  5CR4 A;  4BR2 A;  4E7L A;  2KQ2 A;  2VCP A;  3O4W A;  3K5L A;  1NK0 A;  3WNE A;  2FLO A;  3D0P A;  3O6W A;  2OPR A;  4FJX A;  3FE1 A;  5AZI A;  4H8K A;  4BDZ A;  4CJK A;  5CHI A;  1HUX A;  5BN9 A;  3IKM A;  2P9N A;  4H0Y B;  1C6V A;  2E2Q A;  2O8B B;  2RE2 A;  3LP1 A;  3DLR A;  1S1X A;  2OTL N;  3K9J A;  4K43 A;  1BIU A;  3NGI A;  5AQT A;  1KAY A;  3QET A;  2GBZ A;  4KI4 A;  4DWI A;  3O9S A;  2P9S B;  1NGJ A;  4LFA K;  1RTD A;  3SUO A;  2B5J A;  3THX B;  3PO4 A;  3NF9 A;  3EL2 A;  3M8R A;  1X9S A;  2D0B A;  1YF5 L;  3D2E A;  1KQS M;  4F2S A;  3SUN A;  1CXQ A;  3KLE A;  5AQQ A;  3RSE A;  2G8W A;  1JCF A;  1RNH A;  1W0H A;  3C6H A;  4KKO A;  4BE2 A;  4H5W A;  1HPZ A;  3LZJ A;  4B3S K;  4ELT A;  2B6A A;  3DXK B;  1CZ9 A;  4FWQ A;  3LAM A;  5AQS A;  3L6Q A;  4BE1 A;  2Z1J A;  1SAZ A;  3HL8 A;  4BDY A;  1NK6 A;  1XNR K;  3CCE N;  3HTV A;  4E7J A;  4H0V B;  2F8T A;  2EHG A;  2LSN A;  3RR8 A;  5JIC A;  2CGJ A;  3KWI A;  3BZK A;  2Y1J A;  4O8K A;  3H46 O;  3G10 A;  3M3Z A;  3CMA N;  4FM1 A;  3JAM O;  4ICL A;  5KPR A;  5GAD P;  1XUP O;  2P5O A;  2KZZ A;  3U3G A;  3UKU A;  3ATV A;  1NLV A;  2IS3 A;  3OYM A;  4N47 A;  2VYP A;  3IRX A;  4KB1 A;  3QLH A;  4AHR A;  4PA1 A;  3V1O A;  4K41 A;  5E84 A;  5A2Q O;  3C7N A;  3H3O B;  2OPS A;  3HJF A;  3WXJ A;  4NB4 A;  3OYI A;  1BOT O;  2A1R A;  4EP4 A;  1HNW K;  3LWL A;  5FLX O;  4CEB A;  2CH5 A;  2RHK A;  4C1N K;  3CCL N;  4AM6 A;  4OLA A;  4IDK A;  3AO3 A;  5AQJ A;  1HQU A;  3HSC A;  5AQO A;  1C0F A;  3VEZ A;  1WN7 A;  2VGN A;  4KTW A;  1SKW A;  3PUF A;  4OPJ A;  4FJ9 A;  2AP1 A;  4BRN A;  3O4N A;  3SZ2 A;  2XO7 A;  1VSH A;  3CCV N;  1KSP A;  3EE9 A;  4QCL A;  3RRG A;  3L2W A;  3WNG A;  5AFU A;  5C12 A;  4IWV A;  2E2P A;  4DR1 K;  1Z25 A;  1VSK A;  1X3M A;  5M1Q A;  2X74 A;  4BRH A;  4JK8 A;  5AQW A;  5DK5 A;  1FK9 A;  4BRD A;  4WCE L;  1NGE A;  3QEV A;  4O8U A;  4DTP A;  3JS6 A;  4FOI A;  2QI2 A;  3KK1 A;  1TKX A;  1RBR A;  4BR9 A;  5HRN A;  4A2B A;  3NHG A;  2FC0 A;  3LPU A;  1UA1 A;  3VQD A;  2HBJ A;  2NRW A;  2OZM A;  4BRP A;  1OH5 A;  2KFZ A;  3F9M A;  5SWM A;  3K58 A;  1C1B A;  3CCS N;  4QS7 A;  5J1E A;  1TUY A;  3LL3 A;  4DR2 K;  4G1Q A;  2YJE A;  3WNF A;  3IDH A;  3J80 O;  4IOX A;  4CK3 A;  3BEX A;  3TU5 A;  3CD6 N;  4Q0B A;  2HST A;  2IGI A;  3B8A X;  3LDL A;  1X9M A;  1YJW N;  4DR5 K;  3CER A;  1Q9X A;  1V4T A;  3FZF A;  3MEG A;  3ISN C;  3CXC M;  5GAH P;  1LCU A;  2Q0U A;  1JLB A;  1ITG A;  1NJX A;  3BP8 A;  3ULD A;  1TYQ A;  3E9O A;  2CGL A;  4H5R A;  4KTQ A;  4Z4C A;  4DU1 A;  1S1V A;  2VG6 A;  2QXF A;  4CJU A;  4N5S A;  4GY2 B;  1B9F A;  1NKC A;  2UXC K;  1NJI O;  1GLJ O;  1ZBU A;  3VER A;  5C10 A;  1NMN A;  4A5B A;  2GEL A;  1WOQ A;  4CJ3 A;  4DR3 K;  1QQN A;  4F2R A;  4MFB A;  3D2F A;  1NK4 A;  2V7Y A;  4M3U A;  2HVI A;  2HMP A;  2ZJQ L;  2QWR A;  4E1J A;  3SNN A;  1NGG A;  3THW A;  1WSF A;  2X78 A;  3BDP A;  4CD3 A;  2O8D B;  2GTD A;  3AVN A;  2VWB A;  1RT2 A;  3M8S A;  5GIP A;  3ITH A;  5AQH A;  2YHW A;  3FZM A;  4JKD A;  2HB5 A;  4FPB A;  3NGZ A;  4KHY A;  3A5O C;  1YT3 A;  5AQN A;  2HVH A;  1FJG K;  4F4K A;  1JXE A;  3V1Q A;  3FGU A;  4E1N A;  3EYZ A;  3LM9 A;  3CFP A;  4XIU A;  4ISE A;  3CCR N;  3SI6 A;  5T7B A;  1RFQ A;  4CI6 A;  1TGO A;  2KLA A;  1QQO A;  3SUP A;  2FSK A;  3SBT A;  4LF9 K;  3EKU A;  3MN9 A;  4JD2 B;  3T19 A;  3FZL A;  1GOA A;  3E9P A;  3NAE A;  4CEO A;  1VQO N;  4LF5 K;  2QKB A;  2UU9 K;  2JWK A;  3GE1 A;  4ISF A;  3CPE A;  4OPA A;  4B9Q A;  1NOY A;  1LWF A;  3HST B;  2A42 A;  4O0I A;  1YI2 N;  2X6S A;  3PO5 A;  1QQC A;  1UAX A;  2O4G A;  1S9E A;  3D7E O;  4M3T A;  3TAM A;  4LFC K;  4CD1 A;  3QER A;  2YHX A;  4Q5V A;  3ZX3 A;  2KZM A;  4CFB A;  3DAW A;  5F1X A;  4JNE A;  3TTC A;  2DFE A;  4LC9 B;  5DM6 L;  2VQF K;  4DS5 A;  3NF7 A;  2A1S A;  2YJF A;  2EWS A;  5KGW A;  3OBW A;  1NMD A;  3MN5 A;  5BR9 A;  4CEE A;  3D6R A;  4KRF A;  4FM0 A;  1Z05 A;  3ZSX A;  3EY1 A;  4DU4 A;  2Y1I A;  3O3G A;  2V52 B;  2XRI A;  5GAG P;  1X9J A;  2YKN A;  1K6Y A;  5BPM A;  3NH0 A;  3RWU A;  2P9P A;  1GLL O;  1SZ2 A;  2F9W A;  3M1F A;  1N36 K;  4JKB A;  3KLI A;  5AQK A;  3OJS A;  3C65 A;  2DTU A;  5TKW A;  4WQ5 A;  4DFM A;  1YHQ N;  3EZ5 A;  1W2B M;  4U7B A;  5AQR A;  3WT0 A;  4C8K A;  3V9W A;  3ZSV A;  4KFB A;  3RTV A;  2O8E B;  1QSY A;  3IFR A;  1YTA A;  4CF0 A;  2HBM A;  4JI1 K;  1HKB A;  2W40 A;  3DXM A;  1NJY A;  2BH1 A;  3ZEU B;  2UXD K;  2E1Y A;  4A59 A;  3AVM A;  5B8H A;  2P9U B;  2NNW A;  5AQY A;  3DRS A;  3VQB A; 
#chains in the Genus database with same CATH homology
 4DSF A;  1DLO A;  3AVA A;  1VSF A;  5HRR A;  4H4O A;  3VQ5 A;  1BIS A;  4IG0 A;  4CIG A;  4CF9 A;  4BAC A;  4DFP A;  4O5B A;  4E7H A;  3LDS A;  4WE1 A;  5J2M A;  3SQ4 A;  4LSL A;  4FK4 A;  3F9K A;  2FBV A;  4EP5 A;  1R0A A;  1J5O A;  5CY4 A;  4FJ5 A;  3SUQ A;  1JL1 A;  2HMI A;  3HPO A;  4CJR A;  4CK2 A;  1XI1 A;  4HCC A;  3HXM A;  2DFH A;  1L3T A;  5HLF A;  5K14 A;  3OYD A;  4DQI A;  1C0U A;  3TAF A;  3IAY A;  3H08 A;  3ZSQ A;  4BDP A;  4NCG A;  4BWJ A;  1WAJ A;  1VSE A;  1KLM A;  3KJV A;  4FJ7 A;  3OYB A;  2ZQB A;  3VQP A;  4DMN A;  2R7Y A;  3ZT3 A;  4KHQ A;  2HHQ A;  2OZS A;  1JLF A;  1Q8I A;  3VQA A;  3PX0 A;  4CHZ A;  1SUQ A;  5FDL A;  3TAR A;  3OYL A;  4FLY A;  3AA3 A;  3S3O A;  1W9H A;  1T7P A;  4DQP A;  3DM2 A;  3MXJ A;  2HHV A;  2HHW A;  3CM5 A;  4AHT A;  2G8F A;  3RMA A;  3JYT A;  1HYS A;  3HVT A;  2P1J A;  3OY9 A;  4CJ4 A;  1LAV A;  1WSG A;  4M3W A;  2XY5 A;  3VQ7 A;  4ZTF A;  4Z4F A;  1RT6 A;  4GMJ B;  2G8H A;  1UOC A;  1RDC A;  1HYZ A;  4YFU A;  1RCH A;  1RT1 A;  3DLB A;  1D8Y A;  3U6F A;  3O3H A;  1BHL A;  2E6L A;  4E7L A;  2XHB A;  4Y1D A;  2KQ2 A;  3CQ8 A;  3K5L A;  1IKW A;  1NK0 A;  3ZSO A;  3AVH A;  3WNE A;  4CGJ A;  3LPT A;  1C0M A;  3A2F A;  4FW2 A;  4JLH A;  5I3U A;  3D0P A;  2D0A A;  2OPR A;  4DQS A;  4CJT A;  4FJX A;  1RBT A;  2F96 A;  3QEI A;  4C8N A;  4B9L A;  4H8K A;  4BDZ A;  1IKX A;  4CJK A;  3NH2 A;  4Z4I A;  4CHY A;  1JLQ A;  1SV5 A;  5HP1 A;  3T3F A;  1S1T A;  3OYK A;  2E4L A;  1C6V A;  1ASU A;  4AIL C;  4FJG A;  4FJN A;  2YHB A;  1A5V A;  3L2V A;  3LP1 A;  1NK7 A;  3DLR A;  4CF1 A;  1S1X A;  3QIP A;  4CGG A;  1HNV A;  2QKK A;  3KKS A;  1BIU A;  1BCM A;  3LP3 A;  3NGI A;  4O55 A;  3QET A;  2GBZ A;  2XY8 A;  4DWI A;  4OJR A;  3QEX A;  4KI4 A;  3P1G A;  2IDO A;  4FLZ A;  2YNI A;  5J2Q A;  2P5G A;  1LW0 A;  4ID5 A;  1RTD A;  3SUO A;  1ZBH A;  2I5J A;  3DRR A;  2B5J A;  3TAN A;  1NJW A;  3VQ9 A;  3DLK A;  4CFC A;  1JXB A;  4IKF A;  1CZB A;  3WNH A;  2OPP A;  3NF9 A;  4KO0 A;  3M8R A;  1KCF A;  3L2U A;  3P5J A;  2D0B A;  2WON A;  1X9S A;  3L3U A;  4K8Z A;  1TV6 A;  3SUN A;  1CXQ A;  2HND A;  3KLE A;  4F2S A;  1TAU A;  3SV3 A;  2G8W A;  4AHU A;  1RNH A;  1W0H A;  2VWK A;  4KKO A;  5CYQ A;  4BE2 A;  1S1U A;  1GOC A;  3SCX A;  1HPZ A;  1VSM A;  4IG3 A;  1RTH A;  1VSI A;  2JGU A;  4ZHR A;  3LZJ A;  4CCH A;  4ELT A;  2B6A A;  4C8L A;  3T1A A;  3PX6 A;  2ZD1 A;  4DSE A;  1CZ9 A;  1O1W A;  3VQC A;  4CES A;  1IH7 A;  1J54 A;  3LAM A;  1U48 A;  4FZZ A;  3VQ6 A;  3K2P A;  4BE1 A;  2DY4 A;  2Z1J A;  2Z1H A;  3VQ8 A;  3SQ1 A;  1KFS A;  3LP0 A;  3HL8 A;  2QK9 A;  4BDY A;  2YV0 X;  3DMJ A;  3L2Q A;  4AHV A;  4KRE A;  3LZI A;  3HYF A;  1NK6 A;  4M3X A;  4DSI A;  1RT5 A;  2YNG A;  3L2R A;  3DLG A;  2RPI A;  4E7J A;  2PZS A;  2F8T A;  3OVN A;  2EHG A;  3NFA A;  5SZT A;  3OYG A;  2LSN A;  1LWC A;  2YKM A;  1BL3 A;  3OYE A;  1IG9 A;  3P83 D;  3RR8 A;  3OS0 A;  1IO2 A;  2Y1J A;  2G8I A;  2F8S A;  5KGX A;  4QOZ B;  3QO9 A;  3G10 A;  1JLG A;  1LW2 A;  2HHU A;  4FM1 A;  1Q9Y A;  5HRP A;  1J9A A;  4ICL A;  4Z4H A;  2P5O A;  1RBU A;  1ZBF A;  3ASM A;  1BQN A;  3RRH A;  3DOK A;  3U3G A;  2KZZ A;  4DTO A;  1REV A;  1HYV A;  3QEP A;  2IS3 A;  4RG8 A;  4FJ8 A;  3PV8 A;  3OYM A;  3ZSW A;  1Z26 A;  3DLE A;  4N47 A;  4HUF A;  1N6Q A;  2GV9 A;  1C1A A;  3V81 A;  3RMC A;  3IRX A;  1F21 A;  4B3O A;  4KB1 A;  3QLH A;  4AHR A;  5JS1 A;  3TAG A;  4PA1 A;  4DLG A;  3V1O A;  4RW9 A;  4BE0 A;  1RT7 A;  1SL2 A;  4FZY A;  4OLB A;  3NF6 A;  3SJJ A;  1DTQ A;  3NH1 A;  3IS9 A;  1ZYQ A;  4FK2 A;  2OPS A;  1HMV A;  4W5Q A;  3HJF A;  1WSE A;  4DU3 A;  2HNZ A;  2NUB A;  4CIF A;  5KRS A;  3OYI A;  2A1R A;  4EP4 A;  3B6P A;  3I0S A;  3NDK A;  3VN5 A;  3NGY A;  5C42 A;  3LWL A;  4OGC A;  4DSJ A;  1U04 A;  4KAZ A;  3HPH A;  4CEB A;  3NBP A;  3KLH A;  4OKE A;  1TAQ A;  1KRP A;  4CK1 A;  2IAJ A;  1YVU A;  4AH9 A;  3KLG A;  2D5R A;  5KRT A;  2GUI A;  5CZ2 A;  3HT3 A;  4OLA A;  3ALY A;  1BIZ A;  3AO3 A;  4IDK A;  4DSK A;  1HQU A;  4CER A;  3PX4 A;  1WN7 A;  3CG7 A;  1XC9 A;  4KTW A;  1LV5 A;  4OPK A;  3AO1 A;  3PUF A;  4OPJ A;  3ZT0 A;  1SKW A;  4FJ9 A;  3PO4 A;  1YTU A;  3NCI A;  4LSN A;  4DTR A;  3TAQ A;  1KVA A;  4FJL A;  1KTQ A;  1GOB A;  3O4N A;  3VQ4 A;  3SZ2 A;  1KFD A;  2EX3 A;  4C8M A;  2E6M A;  3V1R A;  2XO7 A;  3SQ2 A;  1VSH A;  4RW8 A;  3QEW A;  1BQM A;  1KSP A;  4CJ5 A;  3QNN A;  4QCL A;  2VG5 A;  5I42 A;  3RRG A;  1JLC A;  3IG1 A;  3L2W A;  4RW7 A;  4M3Z A;  3V9S A;  5E41 A;  3WNG A;  3I8D A;  3VA3 A;  1CLQ A;  4I2Q A;  4I7F A;  1TKD A;  2WOM A;  3LAN A;  1Z25 A;  1VSK A;  3VA0 A;  3NF8 A;  1TK8 A;  1U49 A;  3PY8 A;  2KFN A;  3KIO A;  1L3S A;  1TVR A;  4EZ9 A;  1TKT A;  1BCO A;  2X74 A;  1DTT A;  1S6Q A;  4CJE A;  4CEZ A;  3V9U A;  5DMR A;  4W5R A;  4B9U A;  5DK5 A;  1FK9 A;  3S3N A;  1ZBI A;  4FYD A;  3RR7 A;  1IKV A;  2ETJ A;  3OYC A;  1RDB A;  3C95 A;  3CM6 A;  4CEC A;  1SKR A;  2B4J A;  4CHP A;  3QEV A;  3ZSY A;  3G0Z A;  4R5P A;  4DTP A;  4DFK A;  1SL0 A;  3KK1 A;  1TKX A;  4Z4G A;  1RBR A;  5HRN A;  3NHG A;  4CJP A;  1XHZ A;  1D9D A;  3LAL A;  2YHA A;  2FC0 A;  4J2A A;  4CHO A;  3LPU A;  1UA1 A;  1U4B A;  1G15 A;  3VQD A;  3AA4 A;  4CE9 A;  1NOZ A;  1HJR A;  4CGH A;  2PY5 A;  1L3U A;  2OZM A;  2KFZ A;  5SWM A;  3AA2 A;  4DTM A;  4DQQ A;  3V9Z A;  1HQE A;  2OPQ A;  3NE6 A;  1U45 A;  3HP9 A;  1RT3 A;  3K58 A;  1C1B A;  4DTN A;  3L8B A;  5J1E A;  4B9N A;  1WSJ A;  3LAK A;  4FJK A;  1S5J A;  4LH4 A;  3VQQ A;  4KHW A;  5D3G A;  3KD1 E;  4G1Q A;  3WNF A;  4FXD A;  4OGE A;  1VK0 A;  4OKJ A;  4ID1 A;  4CK3 A;  3OYF A;  3E01 A;  3S3M A;  4Q0B A;  2FBT A;  3ZT1 A;  1HNI A;  2IGI A;  4NYN A;  1B9D A;  4CJF A;  4CJQ A;  1X9M A;  4DF8 A;  1VSL A;  2BE2 A;  2G8U A;  3KD5 E;  4N76 A;  3ZSR A;  1Q9X A;  3BGR A;  1EX4 A;  3MEG A;  4FVM A;  3ISN C;  4RW6 A;  4N56 A;  4DTJ A;  2VWJ A;  1JLB A;  3OJU A;  1ITG A;  4B08 A;  1NJX A;  3V9X A;  1N5Y A;  2G8V A;  3ULD A;  2RN2 A;  4DLE A;  3QES A;  4KTQ A;  4Z4C A;  4DU1 A;  4CEF A;  1ASW A;  4CHQ A;  3AVL A;  1S1V A;  1S9G A;  2VG6 A;  5CYM A;  2QXF A;  4CJU A;  4N5S A;  3MEC A;  1D5A A;  4CGF A;  3ZSZ A;  1B9F A;  3LWM A;  3V6D A;  4FLW A;  1WLJ A;  1JKH A;  1T03 A;  4NYF A;  4DTS A;  3SPZ A;  1NKC A;  1ZBU A;  3ZCM A;  1IKY A;  3DI6 A;  4HVJ A;  4KHS A;  4PQU A;  1LWE A;  1QHT A;  4CGI A;  4FLT A;  1XHX A;  2DFF A;  4JRQ A;  4B9S A;  4CFD A;  1RIL A;  1BI4 A;  1WAF A;  1WSI A;  4FM2 A;  1EET A;  3AVG A;  4CFA A;  4FLX A;  4CJ3 A;  1B92 A;  3QIN A;  4CJS A;  3HP6 A;  3MXI A;  4F2R A;  2AJQ A;  4I2P A;  3SQ0 A;  4I9L A;  4MFB A;  4CGD A;  4B9M A;  2KTQ A;  1RDA A;  3TR8 A;  1NK4 A;  4K8X A;  4M3U A;  3K59 A;  3OYJ A;  3SYZ A;  2HVI A;  1T05 A;  4PWD A;  4M42 A;  2HHX A;  3O4Q A;  5J2N A;  3SNN A;  1BI4 B;  1TKZ A;  4HHT A;  3MED A;  3TWH A;  1Y97 A;  4DG1 A;  2YNH A;  1WSF A;  3K5M A;  4N41 A;  1FXX A;  3AV9 A;  5EU7 A;  1QS4 A;  4UQG A;  3OYH A;  1TK0 A;  5FRN A;  4KTZ A;  4F3T A;  4FJH A;  4LH5 A;  3HO1 A;  1KVC A;  2X78 A;  4LY7 A;  4TSX A;  3V4I A;  1TK5 A;  3BDP A;  2RKI A;  3C94 A;  1RTJ A;  4E89 A;  3MAQ A;  4CEQ A;  2ITG A;  2XY7 A;  1RTI A;  4FK0 A;  3AVN A;  1C0T A;  3M8S A;  1RT2 A;  3TI0 A;  3AO5 A;  3HK2 A;  3ZT4 A;  4FZX C;  4EZ6 A;  5C24 A;  2KW4 A;  3ITH A;  1VSJ A;  4E0D A;  2HHS A;  2BDP A;  2HB5 A;  4HUE A;  3OYA A;  3NGZ A;  1A5W A;  4KHY A;  1MU2 A;  4JS5 A;  1YT3 A;  2HVH A;  2IOC A;  1JLE A;  3AVC A;  4B8C A;  1S6P A;  4B8A B;  3DRP A;  4HTU A;  4F4K A;  1EKE A;  1JXE A;  4CHN A;  3OS2 A;  3LP2 A;  3V1Q A;  1A5X A;  4E1N A;  4CJL A;  3EYZ A;  3CFP A;  3TAB A;  4XIU A;  1UA0 A;  4DS4 A;  3KTQ A;  3SI6 A;  5T7B A;  1NJZ A;  3K57 A;  4W5T A;  1TGO A;  4FLV A;  3DOL A;  3AA5 X;  1NK9 A;  2Z1I A;  4E7I A;  3U3Y A;  3SUP A;  1NK8 A;  3JSM A;  4LD0 A;  4ELU A;  4FCY A;  3RMD A;  2BGG A;  4NCA A;  3AVK A;  3AO4 A;  3T19 A;  1RBV A;  4DQR A;  1GOA A;  2PYL A;  3KK3 A;  4O4G A;  2VG7 A;  4CEO A;  4CJV A;  3NAE A;  3S9H A;  3C6U A;  3K5N A;  3TAE A;  2QKB A;  3MXM A;  4KHN A;  5HRO A;  4J2B A;  1C1C A;  4CEA A;  4MQ3 A;  1JLA A;  2ATQ A;  1TL3 A;  4IFV A;  4OVL A;  5JS2 A;  1ZBL A;  2Z1G A;  1D9F A;  4C8O A;  3KKR A;  3AVJ A;  2O4I A;  1RT4 A;  1NOY A;  1RBS A;  3HM9 A;  4PUO A;  1LWF A;  2P51 A;  3HST B;  4O0I A;  3I0R A;  4F8R A;  2RF2 A;  3K5O A;  4E7K A;  3KK2 A;  3O3F A;  1FKO A;  2X6S A;  3MEE A;  2XY6 A;  2X6N A;  3PO5 A;  1QQC A;  1UAX A;  2O4G A;  4KI6 A;  1LAW A;  1S9E A;  3OS1 A;  1TL1 A;  4Y1C A;  3DLH A;  4FLU A;  4M3T A;  4BWM A;  2G8K A;  1QTM A;  1X9W A;  3VQE A;  5J2P A;  4DSL A;  1QE1 A;  3TAM A;  4F3O A;  3QER A;  3L3V A;  4DFJ A;  3QIO A;  2HHT A;  3HVR A;  1BGX T;  4Q5V A;  2FBY A;  4I9Q A;  1I39 A;  2OA8 A;  2KZM A;  2IC3 A;  4CFB A;  4FJI A;  2FBX A;  3KLF A;  1HRH A;  4QAG A;  3RMB A;  3ZT2 A;  4FJM A;  4HUG A;  4M45 A;  4IFY A;  2DFE A;  4DTX A;  4KB0 A;  4CED A;  1FKP A;  4JS4 A;  3HPG A;  4DS5 A;  3NF7 A;  4B9V A;  2A1S A;  4M41 A;  4FJJ A;  4NCB A;  4E3S A;  2BAN A;  1KLN A;  1SKS A;  4CF2 A;  5KGW A;  2W42 A;  3QNO A;  4YNQ A;  4B9T A;  4GW6 A;  4J2D A;  5HBM A;  1J53 A;  4IBN A;  4KRF A;  4CEE A;  1L5U A;  2Q3S A;  4Z0U A;  4FM0 A;  3FFI A;  3ZSX A;  3EY1 A;  1S1W A;  4DU4 A;  1NK5 A;  1T8E A;  2Y1I A;  4O44 A;  2XRI A;  3O3G A;  2YKN A;  1SL1 A;  4Z4E A;  1VRU A;  1K6Y A;  4H4M A;  5C25 A;  3NH0 A;  3F73 A;  1QSS A;  3RWU A;  4KPY A;  3M8P A;  1VRT A;  4O0J A;  4AHS A;  4CIE A;  4KHU A;  2D0C A;  4E1M A;  3KLI A;  4DF4 A;  3OJS A;  5HRS A;  3SV4 A;  1ASV A;  1WSH A;  3OYN A;  3TAP A;  2DTU A;  4DFM A;  1NKE A;  3AO2 A;  4J2E A;  4FW1 A;  4KV8 A;  3EZ5 A;  2PYJ A;  1UWB A;  1VSD A;  2YNF A;  1WNS A;  3AVI A;  4CF8 A;  4M3Y A;  1EXQ A;  3DYA A;  4CJW A;  4ZTJ A;  1CXU A;  1X1P A;  4C8K A;  2JLE A;  3V9W A;  4L8R B;  2ZE2 A;  4E19 A;  1RDD A;  1QSL A;  3ZSV A;  4ELV A;  4KFB A;  4DTU A;  5FRM A;  3CFR A;  3RTV A;  1U47 A;  4W5O A;  5FRO A;  1QSY A;  5KTQ A;  4OKK A;  1YTA A;  4CF0 A;  3UIQ A;  1KVB A;  2HW3 A;  4RW4 A;  1I3A A;  3B6O A;  3C6T A;  3AVB A;  3D45 A;  4HCB A;  1JL2 A;  1NKB A;  4GVM A;  4M3R A;  3AVF A;  1EP4 A;  3SPY A;  3THV A;  1NJY A;  5KI6 A;  4JRP A;  4W5N A;  2HNY A;  1XWL A;  4AHC A;  3AVM A;  1L3V A;  5CZ1 A;  3CFO A;  2OYQ A;  3CYM A;  4PY5 A;  3DRS A;  3M8Q A;  3VQB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...