2IOCA

The crystal structure of trex1 explains the 3' nucleotide specificity and reveals a polyproline ii helix for protein partenring
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
230
structure length
218
Chain Sequence
TLPHGHMQTLIFLDLEATGLPSSRPEVTELCLLAVHRRALENQGHPPPVPRPPRVVDKLSLCIAPGKACSPGASEITGLSKAELEVQGRQRFDDNLAILLRAFLQRQPQPCCLVAHNGDRYDFPLLQTELARLSTPSPLDGTFCVDSIAALKALEQASKSYSLGSIYTRLYWQAPTDSHTAEGDVLTLLSICQWKPQALLQWVDEHARPFSTVKPMYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of TREX1 Explains the 3' Nucleotide Specificity and Reveals a Polyproline II Helix for Protein Partnering.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
molecule keywords Three prime repair exonuclease 1
total genus 68
structure length 218
sequence length 230
chains with identical sequence B
ec nomenclature ec 3.1.11.2: Exodeoxyribonuclease III.
pdb deposition date 2006-10-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2iocA01
3T3FA 1LV5A 1SL2A 1HYVA 4EZ6A 2DY4A 4NYNA 3NH0A 4DQQA 4FZXC 3L2QA 1RT3A 2HNZA 5HRPA 3M8RA 4CJSA 3CQ8A 3PV8A 5HP1A 1SKWA 3SV4A 4CEOA 1Z25A 2HNYA 2A1RA 5J2NA 4FJLA 4CF1A 4KRFA 4CJKA 1ASVA 3MECA 4DSFA 3OYNA 1XC9A 3K5MA 3K59A 3DLGA 3LPTA 4CFBA 1NK0A 4C8KA 1TV6A 4AHUA 3SNNA 1U47A 1JLCA 4J2BA 1TL1A 3VN5A 1HJRA 3RWUA 2D0AA 3PUFA 3V9SA 3QEXA 4DSJA 4DQSA 3SQ1A 1TAQA 2D5RA 4HUGA 1VSEA 1NK7A 1NOYA 3O3FA 3OYAA 4F2RA 3TR8A 3L3UA 3EY1A 4FLUA 4OKKA 4E19A 3ZSZA 1HYSA 1Y97A 3AA3A 4F2SA 2GV9A 3NGIA 4DU4A 1L3SA 4E1NA 4BDYA 1ZBFA 4ICLA 1TKDA 2IC3A 1HPZA 1CZBA 1MU2A 1QE1A 1ITGA 1FKOA 5C25A 5KTQA 3TWHA 1KRPA 4CHPA 3O4QA 4NCGA 1L3TA 3VQQA 3LPUA 2YNGA 2IAJA 4JLHA 3L3VA 4CFCA 4C8NA 2QK9A 2LSNA 1FK9A 1FXXA 1D8YA 1EETA 1RT6A 3VQ6A 3OYHA 4K8ZA 1QS4A 1LAWA 3AA2A 2ZQBA 3SPZA 4B9LA 4BWJA 4CF9A 3LWMA 2BGGA 4QCLA 3AVNA 2YV0X 2XHBA 3C94A 3DRRA 5CYMA 3I8DA 3QINA 4CGFA 1ZYQA 2HHVA 4CHYA 4IDKA 3LANA 3HJFA 1JLEA 3K5NA 1RTIA 2PY5A 3S9HA 5E41A 2ZD1A 3ZSOA 4R5PA 3G10A 4CGHA 5KGWA 3K5LA 1BQMA 3NE6A 1J9AA 1N5YA 1L3UA 3RRGA 5T7BA 5J2MA 3VQ9A 4CFDA 1BIUA 3LP1A 3NH1A 1C0TA 1IKVA 1HRHA 3ULDA 1GOCA 3IG1A 1QSLA 3CFPA 4N41A 1S1XA 4CEFA 4B3OA 5J2PA 2BDPA 2ITGA 2Z1JA 3SI6A 2OZMA 4JRPA 3AO3A 2G8WA 3LZIA 2P51A 3OS2A 4B9NA 4KFBA 2A1SA 1S5JA 3OJUA 3RR8A 2KFNA 1SKSA 1EP4A 1X9WA 3AVMA 1R0AA 4L8RB 4DTPA 1SV5A 3P83D 4J2EA 4Z4IA 3SUQA 1T8EA 5KI6A 1HYZA 2FBVA 1LW0A 1WSFA 5SWMA 3HXMA 4KTZA 4ELVA 4I2PA 4E89A 1CZ9A 4GMJB 1JLAA 4ID5A 2ETJA 3AVGA 4Z4EA 3OYLA 3K57A 4N5SA 1XI1A 1WAJA 1A5XA 4DTRA 1W9HA 3KKSA 3LP2A 3HM9A 2XY8A 4CJTA 2G8FA 2G8UA 3DOLA 3K5OA 4DTNA 3AVHA 5HRRA 4BWMA 3QESA 4KPYA 3DM2A 3VQ4A 1WSGA 2YKMA 2Z1IA 1DTTA 2KTQA 3KKRA 4E7KA 2OPQA 3CG7A 3NHGA 4ELTA 5C42A 3KK2A 3IAYA 3NF7A 3ZT2A 4BDZA 1TAUA 3TAFA 1YT3A 1BCOA 4IBNA 4FJJA 3H08A 3V1RA 1BCMA 2KQ2A 3WNHA 4HUFA 3OS0A 4DTUA 3O3GA 3OYCA 2FBXA 2VG5A 4DF4A 3KLIA 4QAGA 1SL0A 1QHTA 2HW3A 4DMNA 4LSLA 2BANA 2VWKA 4FLXA 2KFZA 3NF8A 3HT3A 3MXIA 3TANA 4O55A 1X1PA 3TAMA 3OYFA 1IH7A 4FLVA 4KV8A 3ZSWA 4BE1A 4FM1A 2P5GA 2IS3A 2Z1HA 1NJZA 4I9QA 1BI4A 1J54A 3M8PA 1KVCA 1VSHA 4KI6A 2DFFA 4RW8A 1U4BA 3M8SA 3HSTB 4E1MA 4OPKA 3D0PA 4HTUA 4FZYA 3V9UA 4FJXA 3P1GA 1RT7A 2RN2A 4DFKA 3ZT0A 4DG1A 5C24A 4FLZA 4DF8A 3G0ZA 3VQPA 3OYGA 1S9GA 1UWBA 2FBYA 4N47A 3ZT4A 4Z4CA 5SZTA 4HCCA 3SJJA 4C8OA 2DTUA 2XO7A 4F3TA 4M3TA 2JLEA 4LH4A 1QSYA 3DLHA 1DTQA 3MEEA 3TAQA 1ASWA 4AHRA 1K6YA 1BIZA 4BE0A 1O1WA 5JS2A 3HO1A 3O4NA 4ZHRA 4GVMA 4W5OA 3I0SA 3CFRA 2G8HA 4W5QA 4BE2A 1BHLA 4DTMA 2DFHA 3F73A 4C8MA 3OYBA 3VQBA 4HUEA 3QNNA 2FBTA 1NKBA 4FJKA 2AJQA 4Y1DA 3ZSRA 2Y1IA 1RT1A 4WE1A 1S6PA 3L8BA 4JS5A 3DYAA 1D5AA 4ID1A 3V9ZA 2P5OA 3C6TA 3VQ7A 3TAGA 3KK3A 3T1AA 4ZTJA 4OVLA 2XY5A 2OA8A 5JS1A 2JGUA 1ZBUA 4M45A 3DMJA 4HVJA 2HVIA 1KCFA 3AO4A 5CZ2A 3DI6A 1S1VA 3LWLA 3V9WA 3PX6A 4KB0A 2P1JA 1RDDA 3EYZA 3NBPA 3AVKA 1C0UA 1RBUA 2YKNA 3QIPA 1ASUA 3ZCMA 1B92A 4FJ9A 4DSEA 3WNGA 2NUBA 1VSDA 4CGGA 1RTJA 4NCAA 1VSJA 4KHUA 3VQEA 1WN7A 1L5UA 3B6OA 1KFSA 1NKEA 1RCHA 4DQRA 1B9DA 3BGRA 4H8KA 3OYMA 4PWDA 4M42A 1RT2A 2F8SA 4CJ4A 1D9DA 3V81A 2XY7A 4RW9A 1RT5A 4DS5A 4IG0A 4CJPA 3QEWA 4FK2A 3QO9A 4AHTA 4CHOA 3M8QA 4FJNA 4DFMA 2HHWA 2W42A 3QEPA 3SYZA 1QSSA 4IG3A 3HPHA 4FVMA 3VQAA 4MQ3A 4OJRA 4AILC 4CJ3A 4JS4A 2E4LA 3VQ5A 4DSLA 4FJMA 3RTVA 4HCBA 2R7YA 1F21A 3ZSYA 4JRQA 4M3XA 4NYFA 4CFAA 3L2WA 3QNOA 3IRXA 3NDKA 5HRSA 4FJ5A 3HPGA 3FFIA 3SQ2A 3SCXA 1RDAA 3AO1A 1S9EA 1KLNA 2OYQA 4EZ9A 5CY4A 3QETA 1BI4B 4O5BA 1N6QA 4CIGA 3LAMA 1JKHA 3NH2A 1VK0A 3EZ5A 2Q3SA 3NGYA 4CEAA 1XHXA 1L3VA 3OVNA 3DLEA 1C1CA 3L2RA 4OLBA 1VRTA 1IO2A 4FW2A 2HVHA 4FK0A 3DLRA 1KVBA 4PUOA 1T03A 3LP0A 1TGOA 3CYMA 4RW6A 1LWFA 3RMBA 3IS9A 3THVA 3AO5A 4CHQA 3ALYA 3KD1E 2RPIA 4I2QA 4LSNA 2YNHA 3V1QA 4UQGA 1NK5A 1KTQA 1VSFA 2IOCA 2QXFA 4RW4A 3OYKA 5DMRA 3TARA 5D3GA 1C6VA 3E01A 1RTDA 1LW2A 1A5VA 4H4MA 1NOZA 3NCIA 2BE2A 1RDCA 2HMIA 2VG7A 2EX3A 3ZSVA 4KTQA 3VQ8A 3HVTA 4CF8A 4FYDA 3DLKA 2VWJA 4W5RA 1C1BA 1Z26A 2B5JA 4CK3A 5J2QA 4KHWA 1WNSA 3ITHA 1SUQA 5KRTA 4PQUA 1FKPA 2PYJA 4M3RA 4CESA 1CXQA 1TKTA 4CHZA 3UIQA 3I0RA 3AVBA 3NF9A 2OPSA 4M3ZA 2OPRA 2G8IA 4E7LA 3HL8A 3O3HA 3QERA 4OPJA 4PY5A 3KJVA 1JLGA 1JXEA 3LP3A 4FZZA 1JLQA 3QLHA 4AHVA 4B8AB 1IKWA 1RBRA 3OYJA 2XY6A 3C6UA 1DLOA 3AV9A 1NJXA 4E3SA 3HPOA 2G8VA 2O4IA 2O4GA 3P5JA 4DSIA 3HK2A 3DRPA 4CGJA 3VQCA 4CJRA 1U48A 4W5TA 1NK9A 4DFPA 4B08A 3KK1A 1TK5A 4K8XA 3K58A 1GOAA 4FM0A 2E6LA 2RKIA 1TKXA 3SUPA 3MXJA 1RBSA 4N56A 4DQIA 2HHQA 4KHSA 5I42A 4CJEA 1C1AA 1IG9A 4CJFA 3U6FA 1CXUA 2RF2A 2ZE2A 4NCBA 1SKRA 3JYTA 5FDLA 3VQDA 1I3AA 4XIUA 4IFYA 3U3YA 4KKOA 4GW6A 3LZJA 1JLBA 4FJHA 2D0BA 4B9UA 5EU7A 1EX4A 1WSIA 3KD5E 2WONA 1WAFA 1X9MA 3V1OA 1G15A 4TSXA 4DWIA 2HHTA 4J2AA 1S1TA 4DS4A 1RT4A 1WSJA 2XRIA 3SZ2A 4CE9A 3RRHA 4LD0A 3RMAA 1KFDA 4O0JA 4CGIA 4CERA 2E6MA 1ZBIA 2I5JA 2PYLA 4CJLA 3MEGA 1XHZA 4DLGA 4G1QA 1IKYA 4FJGA 3ZSXA 4CJVA 4DTJA 1BISA 4FLYA 4KB1A 1NK6A 4CK2A 1BGXT 1BQNA 2DFEA 4AHSA 5FROA 1GOBA 2D0CA 3AO2A 3ASMA 3OYEA 3DOKA 3SUNA 3CFOA 4KHNA 3K2PA 1EXQA 2X78A 3S3OA 2IGIA 3DLBA 3RR7A 4O44A 4KAZA 3L2VA 4CHNA 3AVLA 1UOCA 3HVRA 3KLHA 5HBMA 4KREA 1S1WA 1A5WA 3C95A 4OGEA 3V6DA 3PX0A 4DSKA 3NF6A 4F4KA 2HHUA 3T19A 4C8LA 1JL2A 1CLQA 3S3NA 4F3OA 2PZSA 1ZBHA 3V4IA 4B9SA 5HRNA 2Y1JA 1QQCA 1RBTA 1WSEA 2X6NA 4CF2A 1J53A 2B4JA 4DU3A 3U3GA 4LY7A 4B8CA 2HHSA 3SPYA 2KW4A 2OZSA 3OY9A 3KLFA 3PX4A 3HP6A 4CCHA 4DFJA 3AA4A 2IDOA 4FJ7A 1JLFA 3A2FA 2WOMA 1REVA 3LDSA 2KZMA 3SQ0A 1J5OA 3PY8A 1X9SA 4B9VA 4CIEA 1YTUA 1NK8A 1B9FA 5FRMA 4FLWA 3RMDA 1W0HA 3KLGA 4ZTFA 4KO0A 4CJQA 3KIOA 1T05A 4O4GA 3TAEA 3NAEA 4ELUA 5KRSA 4FJ8A 2G8KA 3B6PA 3MEDA 3NGZA 4CEZA 1VSIA 4W5NA 3MXMA 1YVUA 4DLEA 1BL3A 4N76A 4FJIA 3ZT3A 4CEBA 4B9TA 3BDPA 2ATQA 1KLMA 3CM5A 3HYFA 4Z0UA 3SUOA 4CEEA 2QKKA 3LAKA 4KHQA 3OJSA 4CJ5A 1HQUA 2B6AA 4E7IA 1TK8A 1NKCA 1Q8IA 2VG6A 3AVIA 3WNEA 4FLTA 1LWCA 4EP4A 3HP9A 3PO4A 3QIOA 5FRNA 1U04A 3AVAA 2HB5A 3KLEA 4FCYA 1JL1A 5CZ1A 2HNDA 3TI0A 1KVAA 1VSMA 1XWLA 2YHAA 4CEQA 2Z1GA 4CK1A 2OPPA 4DTSA 3QEIA 1D9FA 3V9XA 2QKBA 2HHXA 4DTOA 4I9LA 4IFVA 4PA1A 4M3WA 4OKEA 2GBZA 4DU1A 1UA1A 1NK4A 3VA3A 1S1UA 5KGXA 1NJYA 1UAXA 1RBVA 4M3YA 3AVCA 2YNIA 4F8RA 1U49A 4LH5A 3MAQA 1RILA 1HNIA 4J2DA 3JSMA 1IKXA 5HROA 1I39A 2YHBA 1WSHA 4MFBA 3AA5X 1LAVA 4OKJA 1RDBA 4Q5VA 4FM2A 1TKZA 4Z4FA 1HNVA 4EP5A 2F96A 4Z4GA 3S3MA 2X74A 2KZZA 1C0MA 4Q0BA 4CF0A 1HQEA 1WLJA 5K14A 4CECA 4YNQA 3SV3A 1VSKA 5I3UA 4M41A 1Q9YA 4FXDA 4CGDA 2GUIA 1U45A 1HMVA 3DRSA 1JXBA 4DTXA 1KSPA 4I7FA 4E7HA 4YFUA 4M3UA 5DK5A 3ISNC 1RNHA 1NJWA 3AVFA 2F8TA 1TVRA 3WNFA 4KHYA 3OYIA 1VRUA 4FK4A 4RG8A 1VSLA 3ZSQA 4AHCA 4BACA 3RMCA 1UA0A 1T7PA 3QEVA 3F9KA 1S6QA 3CM6A 4KI4A 3AVJA 3NFAA 1LWEA 3ZT1A 4E7JA 4KTWA 2FC0A 4OGCA 1QTMA 4Z4HA 4O0IA 3KTQA 4RW7A 4CIFA 4AH9A 2EHGA 3L2UA 3TAPA 1SL1A 3OYDA 2YNFA 4Y1CA 3SQ4A 3VA0A 1TL3A 5HLFA 4H4OA 4HHTA 4OLAA 2X6SA 5J1EA 1ZBLA 4CJWA 1Q9XA 3D45A 4BDPA 4QOZB 4FW1A 1TK0A 4CEDA 4CJUA 4DQPA 4IKFA 4E0DA 5CYQA 3TABA 3PO5A 1EKEA 1RTHA 1YTAA 3LALA 3OS1A 4B9MA
chains in the Genus database with same CATH superfamily
3QBXA 4JI4K 2CH6A 3U9ZA 4ISFA 4CJSA 1WB9A 5GIPA 1N33K 1NGEA 2P9KA 2HNYA 2A1RA 4CJKA 2DPNA 3K0SA 3K5MA 4ILJA 4AHUA 4H5WA 2O8BB 4JNEA 1JLCA 3VPZA 3PUFA 4UY8O 2D5RA 4HUGA 4F2RA 3MN5A 1DGKN 4BC2A 4OKKA 2NZTA 3ZSZA 1Y97A 3AA3A 1K9MO 3VGMA 1HYSA 4DU4A 4E1NA 3ZX2A 4Z4FA 1CZBA 1FKOA 4BC4A 2F7TA 3LDPA 1SAZA 1L3TA 3LPUA 3MWPA 5TKWA 1FK9A 1D8YA 1RT6A 1N34K 1QS4A 4H0TB 4QCLA 3LWMA 2BGGA 1K8KB 2J4RA 3OW2M 1SS6A 3DRRA 5CYMA 3K9JA 2HHVA 1YITN 1BA0A 4CHYA 1EO1A 5B8HA 3KK7A 3HJFA 4R5PA 3G10A 1BQMA 5GAGP 4E1JA 4H5TA 2E2PA 1QSLA 4B3OA 5AQIA 5J2PA 2ITGA 4JRPA 2G8WA 5M1PA 3LZIA 2YX6A 4KFBA 1S5JA 4A61A 3RR8A 5C15A 1SKSA 3AVMA 1R0AA 4DTPA 1SV5A 3FLCO 3KWGA 4J2EA 3SUQA 3CD6N 1NMNA 4JK8A 4CZEA 4YOWA 5SWMA 4ELVA 1NGFA 4E89A 3WQTA 1EWQA 1JLAA 2FSJA 4JD2A 4N5SA 3SLCA 3J7AP 3CQXA 4DTRA 1W9HA 2KHOA 3HM9A 1VQ8N 4CJTA 3DOLA 3QESA 4BWMA 1YAGA 1WSGA 2CGLA 1MWKA 3SK3A 3KKRA 2HOEA 5AZJB 4IO9L 1OVYA 3KK2A 3IAYA 3ZT2A 1HR0K 1BCOA 5KPRA 1BCMA 1QQNA 3WNHA 1EWRA 1NGCA 4MO5A 3OYCA 4DF4A 4ISGA 1V4SA 2BANA 3HT3A 5EVZA 3TAMA 4KV8A 3PIOL 3QICA 4BE1A 4FM1A 3I33A 4FOIA 1C0GA 1TYQB 1YI2N 5EXWA 4KI6A 4RW8A 4E1MA 5JVGL 3V9UA 2RE2A 4YHHK 5BRDA 3ZT0A 4DG1A 4FLZA 4DF8A 3TSPA 3OYGA 3FR0A 2XO7A 2WBNA 4M3TA 1HUXA 4LH4A 4WYBA 1QSYA 4DV3K 2HBMA 1K6YA 1BIZA 4ZHRA 5CE3A 4YOYA 3HI0A 3CCJN 4PHTX 4C8MA 3VQBA 3F5TA 1NKBA 2NRZA 2IVPA 4Y1DA 4A5BA 3ZSRA 1RT1A 1D5AA 3VQ7A 2O8DB 3TAGA 1JCGA 4JKHA 1OH6A 4BC5A 4JI3K 2JGUA 1BA1A 2OANA 2VWBA 5BR8K 3VEXA 2HVIA 3V9WA 3PX6A 4EAHD 4KH5A 1C0UA 3QIPA 1ASUA 2P9LB 4A2BA 4DSEA 3WNGA 4IZ9A 2NUBA 1RTJA 5AQYA 4EIAA 4NCAA 1VSJA 4KHUA 1WN7A 3OYMA 4FWLA 1KAYA 3Q7CA 1NWKA 1NBWA 1KD1O 1KAXA 4CJPA 2D0PA 3QEWA 3QO9A 4CHOA 4YOVA 4NO7A 5DM7L 3SYZA 2P9NB 4FVMA 3AARA 2KKZA 3ZEUA 4JS4A 2E4LA 3VQ5A 2F9TA 4JKAA 2R7YA 3ZSYA 4B9QA 3EL2A 3M5RA 4FJ5A 3SCXA 3AO1A 1S9EA 4B1WB 1XC3A 2QA4N 5AQXA 2RHKA 3O9QA 4BRFA 2E20A 4BRGA 2E8AA 1C1CA 4OLBA 5KPTA 3ENHA 1HLUA 1VRTA 2HVHA 1RGIA 3OBYA 1YJNN 3RMBA 4CHQA 3KD1E 3V1QA 2RPIA 4I2QA 4UQGA 1NK5A 4YDUC 1VSFA 4C1NI 3TARA 3IKMA 1C6VA 1NGDA 4EFHA 3CCRN 2Q1NA 4DR5K 5AQOA 2EX3A 5AQNA 4KTQA 3O9TA 2D0OA 3AAQA 4FYDA 3GE1A 1FJGK 2ASOA 3ITHA 5KRTA 4PQUA 1FKPA 2PYJA 1YVNA 1TKTA 4CHZA 2IIRA 3C7NA 3TU5A 3CC7N 3K9KA 1JLGA 1JXEA 1QQMA 1JLQA 4B8AB 1ZXOA 1IKWA 3C6UA 2P9IA 2G8VA 3H1VX 3EE9A 4CGJA 2BUPA 3VQCA 1U48A 3SMSA 1NK9A 4DFPA 5BPMA 3LDOA 2RKIA 3MXJA 4N56A 4H03B 1CXUA 3GDQA 5A2QO 4FWPA 1SKRA 3M1FA 1I3AA 4KKOA 4GW6A 1JLBA 4FJHA 2YHYA 2QWRA 5EU7A 1WSIA 3THWA 3NVMA 1X9MA 3V1OA 1R59O 1S1TA 1WSJA 2XRIA 4CE9A 4LD0A 1KFDA 1LCUA 2E6MA 4Y0WA 4FJGA 4DTJA 2W6LA 4FLYA 3BF1A 4BVPA 3UKRB 1TUYA 1BGXT 2DFEA 3BZCA 2D0CA 3TTFA 4CBXA 5AQKA 4CHNA 3J8AA 4IOCL 4M7YA 4KH4A 1S1WA 3PX0A 3V6DA 4F4KA 2E1ZA 4DHYA 1CLQA 3T19A 4IEEA 3ENBA 1Q81O 4B9SA 5FPDA 2Q2RA 3VENA 3WEEB 3T1YK 3ZYYX 3U3GA 2HHSA 2KW4A 1Z05A 4BG9A 5JMVA 5GIOA 4CCHA 3DXKA 4DFJA 4C23A 4PL8A 1JLFA 3A2FA 3LDQA 2WOMA 1REVA 2ZM6K 1YHQN 1J5OA 1NK8A 3HTVA 3EKUA 1W0HA 3QDKA 4JKGB 1T05A 2ZJRL 2NRRA 4ELUA 1N32K 4CEZA 3CMAN 3WT0A 4W5NA 4DLEA 2A41A 4M63C 4N76A 4CEEA 4KHQA 3OJSA 1TK8A 2VG6A 3WNEA 3THYB 1LWCA 4G9ZA 3QIOA 1U04A 2Q0RA 2VCPA 3AVAA 2HB5A 3O80A 4BR9A 3KLEA 1LOTB 4FCYA 2HNDA 3TI0A 2Z1GA 1D9FA 3BF3A 4DTOA 2NRWA 4PA1A 2GBZA 4DU1A 1NK4A 5E26A 1UAXA 1RBVA 4M3YA 3U9DA 3JSMA 5HROA 4MDAA 3C65A 1QVGM 2UXDK 2YHBA 3QFPA 4DV5K 4MFBA 1LAVA 3AGRA 1TKZA 5F1XA 1VQ7N 4IEIA 4CECA 1VSKA 2ZGYA 1ILYA 2GUIA 3BY5A 3DRSA 1JXBA 4QS7A 4I7FA 5MLCQ 1TVRA 3WNFA 2A42A 1VSLA 4AHCA 4BACA 2FXUA 4KI4A 2Q36A 3CQYA 3ZT1A 4KTWA 2FC0A 3SMPA 3N4QA 4O0IA 4F3TA 4CIFA 3L2UA 1MDUB 4Y1CA 4CJWA 1Q9XA 1TK0A 4DUZK 3HSCA 4CJUA 3CCUN 5CYQA 3SAFA 1EKEA 1RTHA 3LALA 3SAHA 3OS1A 4B9MA 3E9OA 3T3FA 2DY4A 3NH0A 1RT3A 4JHDA 5AQMA 2O8EA 2P9IB 3E9PA 1SKWA 5I9EB 4DV0K 5IWAK 1XC9A 3K59A 4CFBA 1VQ9N 3CI5A 3VN5A 3A5NC 4DQSA 1NOYA 3O3FA 2UUCK 2A6AA 4E19A 4KH6A 4F2SA 3NGIA 1Y64A 1HNWK 3FGUA 4ICLA 4IOXA 3VTIA 5C25A 5KTQA 5BN8A 4NCGA 2W6KA 3VQQA 3QBWA 3VESA 2IAJA 3CPEA 4JLHA 2QK9A 3MN9A 1EETA 5GAEP 2O8FB 4B1UB 4K8ZA 3CJ1A 3DXMB 2V7ZA 3SPZA 1HNXK 4BWJA 4CF9A 3JXUA 4H0PA 4OPAA 3I8DA 1KQSM 4H5NA 4CGFA 3L4IA 4BR7A 3LANA 1W97L 2PY5A 3G4SN 4JKFA 2E1YA 4CGHA 1J9AA 1BO5O 3B8AX 3VQ9A 1HPMA 4CFDA 3LP1A 1IKVA 3ULDA 1GOCA 1HKBA 4X64K 2WTUA 3CFPA 4ILGB 1S1XA 4CEFA 3T1HK 2Z1JA 3SI6A 3AAPA 3ZX0A 2P51A 3OS2A 3DAWA 2A1SA 3LL3A 2QWMA 2KFNA 1X9WA 3P83D 4H5RA 4H0OA 5KI6A 1NGIA 4KTZA 1CZ9A 3O9UA 3EO3A 3K57A 1WAJA 3FZMA 3WXJA 3KKSA 2XY8A 2G8UA 5HRRA 1S72N 2YKMA 3ZEUB 2OPQA 3CG7A 2D1KA 1C0FA 3H08A 3V1RA 3VEWA 3T7ZA 2VG5A 3O4WA 2HW3A 4DMNA 4LSLA 2KFZA 4O55A 4FLVA 1IH7A 3CJAA 4RTFD 1OH5A 3O1BA 1J54A 1KVCA 1VSHA 1U4BA 2CGKA 4OPKA 4HTUA 4FJXA 2YHXA 1NMDA 3G0ZA 1UWBA 5AR0A 4N47A 4HCCA 3ZETA 5LL6Z 2UXCK 2A5XA 4B1YB 3ULEB 3MEEA 2O8DA 4O8KA 2NLXA 1O1WA 2GWJA 3O4NA 1ESVA 4GVMA 3I0SA 5LMNK 1QZ5A 3CFRA 2G8HA 4W5QA 1BHLA 2DFHA 5AQJA 3F73A 4JAXA 2Y1IA 3DYAA 4ID1A 3KK3A 2XY5A 5JS1A 3VETA 4M45A 4HVJA 3DI6A 1YXQA 4JEPA 3RSEA 3EYZA 4FJ9A 1NNEA 3ZCMA 1NG9A 2UUAK 3L0QA 1WBDA 4CGGA 3G6EN 3VQEA 1L5UA 4B3TK 1KFSA 1NKEA 1RCHA 4DQRA 1RT2A 1VQKN 4ILHA 4CJ4A 3PIPL 1K73O 1D9DA 2HBLA 3V81A 2XY7A 4RW9A 1YJ9N 3L6QA 3DJCA 4FK2A 3M8QA 4DFMA 4YOUA 3QEPA 3HPHA 4BR5A 3HOSA 3VQAA 3CCVN 4OJRA 1SQKA 3OTOK 5KQDA 4DSLA 4HCBA 3O9SA 3LDNA 3QNOA 3W0LA 3IRXA 5HRSA 4NLBA 5CY4A 3TSUA 3QETA 4FWRA 3LAMA 3NH2A 2NRTA 4H5VA 1VK0A 5FPMA 3EZ5A 3DXKB 1XHXA 1L3VA 3OVNA 4CBUA 5AQSA 1IO2A 4FK0A 3DLRA 1KVBA 4PUOA 1T6CA 3CYMA 3LP0A 3SBGA 5C2FA 3IUCA 3H45C 3AO5A 2YI1A 1X3MA 3P31A 2HSTA 2P9KB 1KTQA 2IOCA 2QXFA 2UYTA 3D2EA 4RW4A 3J7ZO 3NCIA 4A59A 3TTCA 1M1KO 3CC2N 4CZLA 3NMUA 1D4XA 4CF8A 1NGHA 1C1BA 2WUSA 5J2QA 4CK3A 2IVOA 2ZJPL 4M3RA 1CXQA 4M3ZA 3AVBA 2G8IA 2OPSA 4BGAA 3O3HA 4L3QA 4OPJA 3TTDA 4FZZA 4AHVA 4BRIA 3OYJA 2XY6A 3HPOA 4DB3A 4DSIA 3HK2A 5AZJA 4X65K 3A0IX 3DWLA 3KK1A 3MCAB 1IBLK 1NU0A 5M1OA 4DUYK 4FM0A 3SUPA 1RBSA 5TKYA 5GADP 2NRVA 2PBDA 4GV9A 2QWQA 3JYTA 5FDLA 3H1QA 2ITMA 3LZJA 2I7PA 3M6GA 4JKCA 4DS4A 1RT4A 3SZ2A 3RMAA 4CERA 2FSKA 1ZBIA 4J8FA 3ZETB 4CJLA 1T44A 2I7NA 4DV7K 2V7YA 4KB1A 4JI2K 1NK6A 5AFUH 1JCEA 1HJOA 3H6EA 1GOBA 1HX1A 3HBTA 4BRMA 3OYEA 3DOKA 1GLDG 5JVHL 4KAZA 1T3VA 1XUPO 1OH8A 1UOCA 5M1FA 2P9LA 3C95A 2HHUA 3NF6A 1JL2A 2GWKA 5EOYA 3S3NA 1ZBHA 1QQCA 1RBTA 1WSEA 4CF2A 2B4JA 4DU3A 5BPNA 4B8CA 4BR4A 3SPYA 4LF9K 3KLFA 3PX4A 4A62A 3GOIA 3MDQA 2IDOA 4FJ7A 2WC9A 2VGNA 3NVKA 5M1NA 4NLCA 3FZKA 3KHYA 1YUWA 1X9SA 4X62K 1T6DA 1YTUA 4ZTFA 4KO0A 2FF3B 4O4GA 3NAEA 2HMPA 4FJ8A 3B6PA 3HZ6A 3MEDA 3THYA 1Q86O 3S41A 1YVUA 2IVNA 4FJIA 4CEBA 3FZHA 2ATQA 4Z0UA 3HYFA 3SUOA 3RSEB 2VYPA 4BRHA 1BG3A 4F9OA 1JL1A 3H3OB 3QB0A 2A3ZA 1XWLA 4CEQA 3V9XA 3E9LA 4OKEA 1S1UA 5KGXA 3AVCA 4JI0K 4WFNL 3VF4A 3MAQA 1U49A 3F2KA 1HNIA 3UB5A 4DCHA 5AQHA 4LF6K 1WSHA 1XNRK 4K43A 1HNVA 4EP5A 4Z4GA 3S3MA 4JN4A 4Q0BA 4FWQA 3CMEN 1WLJA 5K14A 5I3UA 1Q9YA 4FXDA 4CGDA 3WXLA 3R3LA 1G99A 3AVFA 4DR2K 2F8TA 1VQLN 4KHYA 5LJWA 1VRUA 3RMCA 1T7PA 1VHXA 3QEVA 3CF5L 3F9KA 4CVNE 3CM6A 4BVOA 3P4IA 5M1KA 1BDGA 4E7JA 4DV6K 3KWIA 3TAPA 4AH9A 3P39A 3OYDA 2YNFA 1Q82O 4CZHA 3SQ4A 5J1EA 5AQRA 4CBWA 4CEDA 3VF6A 1LV5A 3ATVA 4EZ6A 4FZXC 3L2QA 2HNZA 5HRPA 4BRNA 3Q7BA 5AJ3K 5J2NA 1ASVA 3MECA 4IOAL 3OYNA 5JICA 4C8KA 1TV6A 2BH1A 3M3ZA 2GEMA 4J2BA 3RWUA 4LF5K 3QEXA 4BREA 3O08A 3SQ1A 1NK7A 4B3SK 3TR8A 3L3UA 5FLXO 3EY1A 4FLUA 3A5LC 3TPQA 1L3SA 4BDYA 1ZBFA 1TKDA 2IC3A 1HPZA 1ITGA 1KRPA 2VQFK 4CHPA 5AQPA 3O4QA 2YNGA 3L3VA 4Z94A 2LSNA 1QQOA 1BOTO 3OYHA 4XH1A 1LAWA 1NGGA 3AVNA 2XHBA 4OO1J 3QINA 2FLOA 1ZYQA 4WQ5C 3QFUA 3K5NA 1RTIA 1XQSC 3MN7A 3S9HA 2ZD1A 3MX2A 3ZSOA 3RRGA 5KGWA 3K5LA 1N5YA 2ZJQL 5T7BA 5HOOA 4PKIA 3NH1A 1C0TA 1IBKK 4GKJK 5H1SQ 4DR6K 3C6HA 2BDPA 4JKDA 4CZMA 2OZMA 4YOXA 3AO3A 4CZGA 2EWSA 1EP4A 1BU6O 2VGMA 2P9UB 1NGJA 1U2VB 1T8EA 1HYZA 1WSFA 2PAVA 4I2PA 4ID5A 1XMOK 2ETJA 3OYLA 4IJNA 1VQMN 1XI1A 4H0YB 4MLEA 3VEZA 3LP2A 2G8FA 3AVHA 4BG8A 4JI8K 4KPYA 2Z1IA 4CI6A 4DV4K 2KTQA 4E7KA 3NHGA 2QM1A 5C42A 4RCHA 3NF7A 1TAUA 3TAFA 4IBNA 3OHRA 2KQ2A 1Q18A 4DTUA 3OS0A 4OX9K 1QHTA 4A5AA 4FLXA 1NGBA 3NF8A 3MXIA 5AQQA 4XH5A 3WXIA 3OYFA 3ZSWA 2IS3A 1NJZA 4MDBA 2DFFA 2FSNA 4FSVA 2OCEA 2RN2A 4DFKA 3D2EB 4JI5K 1DT9A 5C24A 4IDHA 4EHTA 1S9GA 2FBYA 3ZT4A 3CJBA 5SZTA 3SJJA 5EX5A 3WEEA 3DLHA 4BY9C 3ID6A 5BREA 4AHRA 1ASWA 4BE0A 1DEJA 3MCPA 3FE1A 3T69A 4W5OA 4JI6K 1TYQA 3THXB 4V19S 4BE2A 1RDUA 4DTMA 3OYBA 5F0XA 2FBTA 4FJKA 2AJQA 3O9RA 4BGBA 4WE1A 3L8BA 2P5OA 4BQZA 5AQLA 3T1AA 4ZTJA 2GELA 2ZWHA 3ULEA 2OA8A 1ZBUA 3DMJA 3WUHA 5CZ2A 3AO4A 1JJ2M 1RDDA 4M7XA 3NBPA 3H46O 4I6MA 2YKNA 1B92A 1GLLO 5CR4A 1YF5L 4DR1K 4GNIA 4YOTA 1YJWN 4H8KA 3CXCM 4M42A 2F8SA 1RT5A 3CETA 4AHTA 4FJNA 2D4WA 2W42A 1QSSA 1WUAA 3CCQN 4BRCA 4CJ3A 5KPZA 4FJMA 1F21A 3UKUB 4M3XA 3L2WA 4MO4A 5AZIA 2AA4A 3I55N 3O5BA 1KLNA 2OYQA 1GLBG 3MWTA 4O5BA 1W7AA 1JKHA 4CEAA 1T03A 1TGOA 3THVA 3IS9A 2O8EB 1RDWX 4LSNA 4RWTA 3HRGA 3BZKA 4KHPK 5DMRA 5D3GA 1LW2A 1A5VA 1NOZA 3I8BA 4H0VB 1JCFA 2VG7A 3BUZB 3ZSVA 3DLKA 1ATNA 2VWJA 1Z26A 2B5JA 4QS8A 2OTJN 1WNSA 3W3DA 3PSIA 3G71N 2A40A 3NF9A 2OPRA 3HL8A 2V51B 3KJVA 1NLVA 4CD3A 3QLHA 5BRFA 2P9NA 5HL7L 4E3SA 1HKGA 1WBBA 4BR2A 2O4IA 2O4GA 1V4TA 4W5TA 1TK5A 3THWB 4K8XA 3K58A 2E6LA 1TKXA 3KVGA 5LMUK 2HHQA 4DQIA 4KHSA 4CJEA 2Q0UA 3U6FA 2P9UA 2RF2A 2Q31A 2ZE2A 1TUUA 4XIUA 1N36K 3U4LA 2QW9A 3BP8A 4AM6A 3EN9A 3OBWA 5BN9A 4B9UA 1CZAN 1EX4A 4CW7B 3KD5E 1G15A 4J2AA 2GTDA 3RRHA 3VEVA 3O8MA 2JWLA 3EE8A 4IXCA 1XNQK 5LJVA 2I5JA 1QVFM 1VQNN 2PYLA 1XHZA 3MEGA 3EEQA 3ZSXA 4CJVA 4FWKA 1P90A 5JLFA 4AHSA 4YY3K 3AO2A 3ASMA 5GINA 4YORA 1VQ4N 1IV0A 3K2PA 1EXQA 3S3OA 3A5OC 3DLBA 1EQYA 3RR7A 5BRHA 4JI7K 3L2VA 3AVLA 1U6ZA 3KLHA 4KREA 1GLCG 4OGEA 5AQVA 1KAZA 3LDLA 2QWPA 4F3OA 2PZSA 3V4IA 4XH4A 4HWIA 1X3NA 3ATUA 5C10A 4DR3K 1J53A 3CCSN 5ADXH 4LY7A 2OZSA 4B3RK 1K8KA 2KZMA 4LF8K 1B9FA 4FLWA 3KLGA 4U67L 1BWFO 2NNWA 3L4QA 3JAMO 3KIOA 3TAEA 3LM9A 3NGZA 1VSIA 3DLLL 5AQGA 3IDHA 2CGJA 3ZT3A 3UKUA 3BDPA 1GLAG 1HKCA 3CM5A 3ENOA 2QKKA 3LAKA 2CH5A 1Q8IA 3PO4A 5FRNA 3HP9A 1X9JA 2WFBA 2YHAA 1KXPA 2OPPA 2QKBA 4GV6A 4DV2K 1UA1A 5BR9A 1K8AO 4F8RA 4LH5A 3SJHA 1RILA 4J2DA 1I39A 3AA5X 4FWSA 4AQYK 1QHAA 4OKJA 4X66K 2W40A 3P38A 2KZZA 3GL1A 2AP1A 4M41A 3FFKB 1U45A 2ZGZA 4DTXA 1KSPA 4M3UA 5DK5A 1H1VA 5ELZA 4NXNK 4FK4A 3ZLJA 1E4FT 3FZFA 3NFAA 5JLHA 3ZX3A 4OGCA 3J81O 2E2OA 1SL1A 5E84A 4B3MK 4OLAA 1TL3A 5HLFA 2P9PB 2X6SA 4BDPA 1ZBLA 3D45A 3C7NB 3VOVA 4EHUA 4DQPA 4IKFA 4E0DA 4GKKK 3TABA 3PO5A 4JKEA 4XEIA 3WQUA 1SL2A 1HYVA 4NYNA 4DQQA 3M8RA 3CQ8A 3PV8A 5HP1A 3SV4A 4WFAL 4CEOA 1Z25A 4FJLA 4KRFA 4CF1A 4DSFA 3EKSA 3CPWM 3VTHA 3DLGA 3LPTA 1NK0A 3SNNA 1FW6A 1U47A 3VGLA 1Z6RA 4YDUA 1TL1A 1HJRA 2D0AA 3V9SA 2KLAA 4DSJA 3LM2A 1TAQA 4FOEA 1VSEA 3OYAA 4AF1A 4C1NK 3VGKA 4FWNA 2GV9A 4R79A 2UUBK 1MU2A 1QE1A 3TWHA 2BTFA 3AY9A 2FF6A 2E2NA 3IFRA 4CFCA 4C8NA 1FXXA 5AQWA 3VQ6A 3AA2A 2ZQBA 4B9LA 5EY4A 2QWOA 1HNZK 2YV0X 3C94A 4K25A 1S22A 2VQEK 4GV3A 4IDKA 2GUPA 1DKGD 4BROA 1JLEA 4BR0A 5E41A 1VAZA 4JYAK 4PL7A 3MK6A 1L3UA 3NE6A 2HF3A 5J2MA 3DXMA 1BIUA 4CJ7A 3D7EO 1HRHA 2O8CB 1E3MA 3IG1A 1W2BM 3R1XA 4N41A 3O1WA 2V52B 1VQON 4JD2B 4B1ZA 3OA9A 4B9NA 4K42A 1J6ZA 3OJUA 4PKHA 3C6AA 4WFBL 4L8RB 4A2AA 4Z4IA 3HM8A 2FBVA 1LW0A 2PFUA 3HXMA 4O8UA 4GMJB 4DKWA 3AVGA 3SAGA 3A8YA 4ISEA 4Z4EA 5AQTA 2O8FA 4OPHA 1RFQA 2QI2A 3KZBA 1A5XA 1GLEG 3CC4N 3K5OA 4JI1K 4DTNA 3G25A 3DM2A 4B1VA 3VQ4A 3I56N 1U2VA 1E4GT 1DTTA 2UU9K 4ELTA 3O6WA 4BDZA 1YT3A 4LC9B 5C12A 4FJJA 4IFEA 4HUFA 3O3GA 2FBXA 1SL0A 3KLIA 4QAGA 2VWKA 3CIPA 4JK7A 4JKGA 4NB4A 3TANA 1X1PA 4I9QA 2QWNA 4HTLA 2P5GA 3WXKA 2Z1HA 1BI4A 4AM7A 3M8PA 4KBOA 1VQ6N 4BRPA 3M8SA 3HSTB 3D0PA 4FZYA 3P1GA 1RT7A 5DM6L 3VQPA 3N4PA 4Z4CA 4C8OA 2DTUA 2JLEA 2E88A 4JKBA 4WQ4C 1DTQA 4IWVA 3TAQA 1GLJO 5JS2A 3HO1A 1MA9B 4U7BA 4KHWA 4HUEA 3QNNA 4MLHA 5AQFA 4I6MB 4JS5A 1S6PA 3UKRA 2GX9A 3V9ZA 3C6TA 3CJCA 4OVLA 3CJ7A 4DR7K 1KCFA 1KC8O 1VQPN 1S1VA 5FPNA 3LWLA 4KB0A 2P1JA 2ZF5O 3AVKA 1RBUA 4JV5K 3QMLA 1VSDA 4BRQA 3R8EA 4QS9A 3B6OA 2P9SA 1B9DA 3BGRA 4PWDA 2NRHA 3CJ9A 4DS5A 4IG0A 3CHWA 3CCEN 4WCEL 5BPLA 2HHWA 2YHWA 1IBMK 2NRXA 4IG3A 3VEYA 3ID8A 4MQ3A 4AILC 3RTVA 4JRQA 4NYFA 4CFAA 3HOTA 3NDKA 3HPGA 3FFIA 3SQ2A 1RDAA 5LY3A 4EZ9A 3GBTA 5M1QA 1BI4B 3SBTA 1N6QA 4CIGA 1BUPA 2Q3SA 3NGYA 1IJJA 3DLEA 3L2RA 4CZIA 4FW2A 1MWMA 2HHHK 4DQ8A 4RW6A 1LWFA 3ALYA 2YNHA 3OYKA 1M90O 1ATRA 3E01A 1RTDA 4H4MA 2BE2A 1RDCA 2HMIA 3VQ8A 1NM1A 3HVTA 2QTDA 4FO0A 4W5RA 3R6MA 1SUQA 4GVEA 4CESA 4BRDA 3UIQA 4LF7K 3I0RA 4CD1A 5CHIA 4E7LA 2OTLN 2YJFA 2F4VK 3QERA 1SZ2A 4PY5A 5F2RA 3LP3A 1IG8A 1S3XA 1RBRA 2QWLA 1DLOA 3UE5A 3AV9A 1NJXA 1NGAA 1OH7A 4JK9A 3P5JA 3DRPA 2QXLA 3CCMN 3CERA 5C2DA 3WXMB 4CJRA 1NJIO 2O8CA 2F9WA 4B08A 4LFAK 1OKJA 1GOAA 4WQ5A 5KQ8A 2H3GX 5I42A 1C1AA 1IG9A 4CJFA 4K41A 4NCBA 3PSFA 4WF9L 5FPEA 3VQDA 1P8ZA 4IFYA 1ATSA 3U3YA 3RVCA 1I94K 1ZC6A 2D0BA 1WOQA 2WONA 1WAFA 3J7YP 4TSXA 3JS6A 4DWIA 2HHTA 2UXBK 3E1YA 2O8BA 4BQLA 2YJEA 2JWKA 4O0JA 4CGIA 3MN6A 2HF4A 1Q7YO 2HBJA 4DLGA 4G1QA 1IKYA 4O5FA 1BISA 5IT9O 3D2FA 4B1XB 4CK2A 1BQNA 5FROA 3SUNA 3CFOA 4KHNA 4BC3A 3PLAA 2X78A 2IGIA 4NXMK 4O44A 2E5LK 3C0BA 3HVRA 5HBMA 1A5WA 4DSKA 4A57A 4C8LA 5HRNA 2Y1JA 2X6NA 3MX5A 3OY9A 2YCHA 4BRKA 3HP6A 3AA4A 3F9MA 3VF2A 4CZFA 3LDSA 3VERA 3SQ0A 4B9VA 4CIEA 5FRMA 3RMDA 4CJQA 2Q97A 2QEXN 5AQUA 3EZWA 5KRSA 5ADXA 2G8KA 4BRAA 1QZ6A 3BEXA 3MXMA 3D2FB 3CCLN 1BL3A 1YIJN 3R9PA 4BRLA 4B9TA 3AGKA 1KLMA 2ASPA 4FWOA 1J5EK 4CJ5A 1HQUA 2B6AA 4E7IA 1NKCA 3AVIA 3H3NO 4FLTA 2ASMA 4EP4A 5CZ1A 1N8RO 2P9SB 3PY8A 1KVAA 1VSMA 4CK1A 3QEIA 3MMVA 4GY2B 4DTSA 3U8XA 4LFCK 4FPBA 4WQ4A 2E2QA 2HHXA 4I9LA 4IFVA 4M3WA 3THXA 3VA3A 1NJYA 5AFUA 2YNIA 4CZKA 2HBKA 3J80O 5GAHP 1IKXA 3VEOA 4CZJA 3A5MC 5AQZA 4Q5VA 1RDBA 4FM2A 2F96A 2X74A 4K0KK 4FL9A 1C0MA 4CF0A 3E66A 3FZLA 1HQEA 4YNQA 3SV3A 4DV1K 4FPAA 2W41A 1HMVA 4LFBK 1GLFO 4E7HA 4YFUA 3ISNC 1RNHA 1NJWA 1ZBSA 1VQ5N 3OYIA 1OVQA 4RG8A 3ZSQA 1UA0A 4IJAA 1S6QA 2P9PA 4FWMA 3AVJA 1LWEA 1XMQK 1QTMA 4Z4HA 3KTQA 4RW7A 3D6RA 4JHDB 2EHGA 3TSQA 5C0YA 3VA0A 4H0XB 4H4OA 4HHTA 3VMFB 4LF4K 4QOZB 4FW1A 1O13A 4FVUA 4PKGA 4IO8A 5AZIB 3GG4A 1YTAA 3IMXA 4DR4K
chains in the Genus database with same CATH topology
3T3FA 1LV5A 1SL2A 1HYVA 4EZ6A 2DY4A 4NYNA 3NH0A 4DQQA 4FZXC 3L2QA 1RT3A 2HNZA 5HRPA 3M8RA 4CJSA 3CQ8A 3PV8A 5HP1A 1SKWA 3SV4A 4CEOA 1Z25A 2HNYA 2A1RA 5J2NA 4FJLA 4CF1A 4KRFA 4CJKA 1ASVA 3MECA 4DSFA 3OYNA 1XC9A 3K5MA 3K59A 3DLGA 3LPTA 4CFBA 1NK0A 4C8KA 1TV6A 4AHUA 3SNNA 1U47A 1JLCA 4J2BA 1TL1A 3VN5A 1HJRA 3RWUA 2D0AA 3PUFA 3V9SA 3QEXA 4DSJA 4DQSA 3SQ1A 1TAQA 2D5RA 4HUGA 1VSEA 1NK7A 1NOYA 3O3FA 3OYAA 4F2RA 3TR8A 3L3UA 3EY1A 4FLUA 4OKKA 4E19A 3ZSZA 1HYSA 1Y97A 3AA3A 4F2SA 2GV9A 3NGIA 4DU4A 1L3SA 4E1NA 4BDYA 1ZBFA 4ICLA 1TKDA 2IC3A 1HPZA 1CZBA 1MU2A 1QE1A 1ITGA 1FKOA 5C25A 5KTQA 3TWHA 1KRPA 4CHPA 3O4QA 4NCGA 1L3TA 3VQQA 3LPUA 2YNGA 2IAJA 4JLHA 3L3VA 4CFCA 4C8NA 2QK9A 2LSNA 1FK9A 1FXXA 1D8YA 1EETA 1RT6A 3VQ6A 3OYHA 4K8ZA 1QS4A 1LAWA 3AA2A 2ZQBA 3SPZA 4B9LA 4BWJA 4CF9A 3LWMA 2BGGA 4QCLA 3AVNA 2YV0X 2XHBA 3C94A 3DRRA 5CYMA 3I8DA 3QINA 4CGFA 1ZYQA 2HHVA 4CHYA 4IDKA 3LANA 3HJFA 1JLEA 3K5NA 1RTIA 2PY5A 3S9HA 5E41A 2ZD1A 3ZSOA 4R5PA 3G10A 4CGHA 5KGWA 3K5LA 1BQMA 3NE6A 1J9AA 1N5YA 1L3UA 3RRGA 5T7BA 5J2MA 3VQ9A 4CFDA 1BIUA 3LP1A 3NH1A 1C0TA 1IKVA 1HRHA 3ULDA 1GOCA 3IG1A 1QSLA 3CFPA 4N41A 1S1XA 4CEFA 4B3OA 5J2PA 2BDPA 2ITGA 2Z1JA 3SI6A 2OZMA 4JRPA 3AO3A 2G8WA 3LZIA 2P51A 3OS2A 4B9NA 4KFBA 2A1SA 1S5JA 3OJUA 3RR8A 2KFNA 1SKSA 1EP4A 1X9WA 3AVMA 1R0AA 4L8RB 4DTPA 1SV5A 3P83D 4J2EA 4Z4IA 3SUQA 1T8EA 5KI6A 1HYZA 2FBVA 1LW0A 1WSFA 5SWMA 3HXMA 4KTZA 4ELVA 4I2PA 4E89A 1CZ9A 4GMJB 1JLAA 4ID5A 2ETJA 3AVGA 4Z4EA 3OYLA 3K57A 4N5SA 1XI1A 1WAJA 1A5XA 4DTRA 1W9HA 3KKSA 3LP2A 3HM9A 2XY8A 4CJTA 2G8FA 2G8UA 3DOLA 3K5OA 4DTNA 3AVHA 5HRRA 4BWMA 3QESA 4KPYA 3DM2A 3VQ4A 1WSGA 2YKMA 2Z1IA 1DTTA 2KTQA 3KKRA 4E7KA 2OPQA 3CG7A 3NHGA 4ELTA 5C42A 3KK2A 3IAYA 3NF7A 3ZT2A 4BDZA 1TAUA 3TAFA 1YT3A 1BCOA 4IBNA 4FJJA 3H08A 3V1RA 1BCMA 2KQ2A 3WNHA 4HUFA 3OS0A 4DTUA 3O3GA 3OYCA 2FBXA 2VG5A 4DF4A 3KLIA 4QAGA 1SL0A 1QHTA 2HW3A 4DMNA 4LSLA 2BANA 2VWKA 4FLXA 2KFZA 3NF8A 3HT3A 3MXIA 3TANA 4O55A 1X1PA 3TAMA 3OYFA 1IH7A 4FLVA 4KV8A 3ZSWA 4BE1A 4FM1A 2P5GA 2IS3A 2Z1HA 1NJZA 4I9QA 1BI4A 1J54A 3M8PA 1KVCA 1VSHA 4KI6A 2DFFA 4RW8A 1U4BA 3M8SA 3HSTB 4E1MA 4OPKA 3D0PA 4HTUA 4FZYA 3V9UA 4FJXA 3P1GA 1RT7A 2RN2A 4DFKA 3ZT0A 4DG1A 5C24A 4FLZA 4DF8A 3G0ZA 3VQPA 3OYGA 1S9GA 1UWBA 2FBYA 4N47A 3ZT4A 4Z4CA 5SZTA 4HCCA 3SJJA 4C8OA 2DTUA 2XO7A 4F3TA 4M3TA 2JLEA 4LH4A 1QSYA 3DLHA 1DTQA 3MEEA 3TAQA 1ASWA 4AHRA 1K6YA 1BIZA 4BE0A 1O1WA 5JS2A 3HO1A 3O4NA 4ZHRA 4GVMA 4W5OA 3I0SA 3CFRA 2G8HA 4W5QA 4BE2A 1BHLA 4DTMA 2DFHA 3F73A 4C8MA 3OYBA 3VQBA 4HUEA 3QNNA 2FBTA 1NKBA 4FJKA 2AJQA 4Y1DA 3ZSRA 2Y1IA 1RT1A 4WE1A 1S6PA 3L8BA 4JS5A 3DYAA 1D5AA 4ID1A 3V9ZA 2P5OA 3C6TA 3VQ7A 3TAGA 3KK3A 3T1AA 4ZTJA 4OVLA 2XY5A 2OA8A 5JS1A 2JGUA 1ZBUA 4M45A 3DMJA 4HVJA 2HVIA 1KCFA 3AO4A 5CZ2A 3DI6A 1S1VA 3LWLA 3V9WA 3PX6A 4KB0A 2P1JA 1RDDA 3EYZA 3NBPA 3AVKA 1C0UA 1RBUA 2YKNA 3QIPA 1ASUA 3ZCMA 1B92A 4FJ9A 4DSEA 3WNGA 2NUBA 1VSDA 4CGGA 1RTJA 4NCAA 1VSJA 4KHUA 3VQEA 1WN7A 1L5UA 3B6OA 1KFSA 1NKEA 1RCHA 4DQRA 1B9DA 3BGRA 4H8KA 3OYMA 4PWDA 4M42A 1RT2A 2F8SA 4CJ4A 1D9DA 3V81A 2XY7A 4RW9A 1RT5A 4DS5A 4IG0A 4CJPA 3QEWA 4FK2A 3QO9A 4AHTA 4CHOA 3M8QA 4FJNA 4DFMA 2HHWA 2W42A 3QEPA 3SYZA 1QSSA 4IG3A 3HPHA 4FVMA 3VQAA 4MQ3A 4OJRA 4AILC 4CJ3A 4JS4A 2E4LA 3VQ5A 4DSLA 4FJMA 3RTVA 4HCBA 2R7YA 1F21A 3ZSYA 4JRQA 4M3XA 4NYFA 4CFAA 3L2WA 3QNOA 3IRXA 3NDKA 5HRSA 4FJ5A 3HPGA 3FFIA 3SQ2A 3SCXA 1RDAA 3AO1A 1S9EA 1KLNA 2OYQA 4EZ9A 5CY4A 3QETA 1BI4B 4O5BA 1N6QA 4CIGA 3LAMA 1JKHA 3NH2A 1VK0A 3EZ5A 2Q3SA 3NGYA 4CEAA 1XHXA 1L3VA 3OVNA 3DLEA 1C1CA 3L2RA 4OLBA 1VRTA 1IO2A 4FW2A 2HVHA 4FK0A 3DLRA 1KVBA 4PUOA 1T03A 3LP0A 1TGOA 3CYMA 4RW6A 1LWFA 3RMBA 3IS9A 3THVA 3AO5A 4CHQA 3ALYA 3KD1E 2RPIA 4I2QA 4LSNA 2YNHA 3V1QA 4UQGA 1NK5A 1KTQA 1VSFA 2IOCA 2QXFA 4RW4A 3OYKA 5DMRA 3TARA 5D3GA 1C6VA 3E01A 1RTDA 1LW2A 1A5VA 4H4MA 1NOZA 3NCIA 2BE2A 1RDCA 2HMIA 2VG7A 2EX3A 3ZSVA 4KTQA 3VQ8A 3HVTA 4CF8A 4FYDA 3DLKA 2VWJA 4W5RA 1C1BA 1Z26A 2B5JA 4CK3A 5J2QA 4KHWA 1WNSA 3ITHA 1SUQA 5KRTA 4PQUA 1FKPA 2PYJA 4M3RA 4CESA 1CXQA 1TKTA 4CHZA 3UIQA 3I0RA 3AVBA 3NF9A 2OPSA 4M3ZA 2OPRA 2G8IA 4E7LA 3HL8A 3O3HA 3QERA 4OPJA 4PY5A 3KJVA 1JLGA 1JXEA 3LP3A 4FZZA 1JLQA 3QLHA 4AHVA 4B8AB 1IKWA 1RBRA 3OYJA 2XY6A 3C6UA 1DLOA 3AV9A 1NJXA 4E3SA 3HPOA 2G8VA 2O4IA 2O4GA 3P5JA 4DSIA 3HK2A 3DRPA 4CGJA 3VQCA 4CJRA 1U48A 4W5TA 1NK9A 4DFPA 4B08A 3KK1A 1TK5A 4K8XA 3K58A 1GOAA 4FM0A 2E6LA 2RKIA 1TKXA 3SUPA 3MXJA 1RBSA 4N56A 4DQIA 2HHQA 4KHSA 5I42A 4CJEA 1C1AA 1IG9A 4CJFA 3U6FA 1CXUA 2RF2A 2ZE2A 4NCBA 1SKRA 3JYTA 5FDLA 3VQDA 1I3AA 4XIUA 4IFYA 3U3YA 4KKOA 4GW6A 3LZJA 1JLBA 4FJHA 2D0BA 4B9UA 5EU7A 1EX4A 1WSIA 3KD5E 2WONA 1WAFA 1X9MA 3V1OA 1G15A 4TSXA 4DWIA 2HHTA 4J2AA 1S1TA 4DS4A 1RT4A 1WSJA 2XRIA 3SZ2A 4CE9A 3RRHA 4LD0A 3RMAA 1KFDA 4O0JA 4CGIA 4CERA 2E6MA 1ZBIA 2I5JA 2PYLA 4CJLA 3MEGA 1XHZA 4DLGA 4G1QA 1IKYA 4FJGA 3ZSXA 4CJVA 4DTJA 1BISA 4FLYA 4KB1A 1NK6A 4CK2A 1BGXT 1BQNA 2DFEA 4AHSA 5FROA 1GOBA 2D0CA 3AO2A 3ASMA 3OYEA 3DOKA 3SUNA 3CFOA 4KHNA 3K2PA 1EXQA 2X78A 3S3OA 2IGIA 3DLBA 3RR7A 4O44A 4KAZA 3L2VA 4CHNA 3AVLA 1UOCA 3HVRA 3KLHA 5HBMA 4KREA 1S1WA 1A5WA 3C95A 4OGEA 3V6DA 3PX0A 4DSKA 3NF6A 4F4KA 2HHUA 3T19A 4C8LA 1JL2A 1CLQA 3S3NA 4F3OA 2PZSA 1ZBHA 3V4IA 4B9SA 5HRNA 2Y1JA 1QQCA 1RBTA 1WSEA 2X6NA 4CF2A 1J53A 2B4JA 4DU3A 3U3GA 4LY7A 4B8CA 2HHSA 3SPYA 2KW4A 2OZSA 3OY9A 3KLFA 3PX4A 3HP6A 4CCHA 4DFJA 3AA4A 2IDOA 4FJ7A 1JLFA 3A2FA 2WOMA 1REVA 3LDSA 2KZMA 3SQ0A 1J5OA 3PY8A 1X9SA 4B9VA 4CIEA 1YTUA 1NK8A 1B9FA 5FRMA 4FLWA 3RMDA 1W0HA 3KLGA 4ZTFA 4KO0A 4CJQA 3KIOA 1T05A 4O4GA 3TAEA 3NAEA 4ELUA 5KRSA 4FJ8A 2G8KA 3B6PA 3MEDA 3NGZA 4CEZA 1VSIA 4W5NA 3MXMA 1YVUA 4DLEA 1BL3A 4N76A 4FJIA 3ZT3A 4CEBA 4B9TA 3BDPA 2ATQA 1KLMA 3CM5A 3HYFA 4Z0UA 3SUOA 4CEEA 2QKKA 3LAKA 4KHQA 3OJSA 4CJ5A 1HQUA 2B6AA 4E7IA 1TK8A 1NKCA 1Q8IA 2VG6A 3AVIA 3WNEA 4FLTA 1LWCA 4EP4A 3HP9A 3PO4A 3QIOA 5FRNA 1U04A 3AVAA 2HB5A 3KLEA 4FCYA 1JL1A 5CZ1A 2HNDA 3TI0A 1KVAA 1VSMA 1XWLA 2YHAA 4CEQA 2Z1GA 4CK1A 2OPPA 4DTSA 3QEIA 1D9FA 3V9XA 2QKBA 2HHXA 4DTOA 4I9LA 4IFVA 4PA1A 4M3WA 4OKEA 2GBZA 4DU1A 1UA1A 1NK4A 3VA3A 1S1UA 5KGXA 1NJYA 1UAXA 1RBVA 4M3YA 3AVCA 2YNIA 4F8RA 1U49A 4LH5A 3MAQA 1RILA 1HNIA 4J2DA 3JSMA 1IKXA 5HROA 1I39A 2YHBA 1WSHA 4MFBA 3AA5X 1LAVA 4OKJA 1RDBA 4Q5VA 4FM2A 1TKZA 4Z4FA 1HNVA 4EP5A 2F96A 4Z4GA 3S3MA 2X74A 2KZZA 1C0MA 4Q0BA 4CF0A 1HQEA 1WLJA 5K14A 4CECA 4YNQA 3SV3A 1VSKA 5I3UA 4M41A 1Q9YA 4FXDA 4CGDA 2GUIA 1U45A 1HMVA 3DRSA 1JXBA 4DTXA 1KSPA 4I7FA 4E7HA 4YFUA 4M3UA 5DK5A 3ISNC 1RNHA 1NJWA 3AVFA 2F8TA 1TVRA 3WNFA 4KHYA 3OYIA 1VRUA 4FK4A 4RG8A 1VSLA 3ZSQA 4AHCA 4BACA 3RMCA 1UA0A 1T7PA 3QEVA 3F9KA 1S6QA 3CM6A 4KI4A 3AVJA 3NFAA 1LWEA 3ZT1A 4E7JA 4KTWA 2FC0A 4OGCA 1QTMA 4Z4HA 4O0IA 3KTQA 4RW7A 4CIFA 4AH9A 2EHGA 3L2UA 3TAPA 1SL1A 3OYDA 2YNFA 4Y1CA 3SQ4A 3VA0A 1TL3A 5HLFA 4H4OA 4HHTA 4OLAA 2X6SA 5J1EA 1ZBLA 4CJWA 1Q9XA 3D45A 4BDPA 4QOZB 4FW1A 1TK0A 4CEDA 4CJUA 4DQPA 4IKFA 4E0DA 5CYQA 3TABA 3PO5A 1EKEA 1RTHA 1YTAA 3LALA 3OS1A 4B9MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T3F A;  1LV5 A;  1SL2 A;  1HYV A;  4EZ6 A;  2DY4 A;  4NYN A;  3NH0 A;  4DQQ A;  4FZX C;  3L2Q A;  1RT3 A;  2HNZ A;  5HRP A;  3M8R A;  4CJS A;  3CQ8 A;  3PV8 A;  5HP1 A;  1SKW A;  3SV4 A;  4CEO A;  1Z25 A;  2HNY A;  2A1R A;  5J2N A;  4FJL A;  4CF1 A;  4KRF A;  4CJK A;  1ASV A;  3MEC A;  4DSF A;  3OYN A;  1XC9 A;  3K5M A;  3K59 A;  3DLG A;  3LPT A;  4CFB A;  1NK0 A;  4C8K A;  1TV6 A;  4AHU A;  3SNN A;  1U47 A;  1JLC A;  4J2B A;  1TL1 A;  3VN5 A;  1HJR A;  3RWU A;  2D0A A;  3PUF A;  3V9S A;  3QEX A;  4DSJ A;  4DQS A;  3SQ1 A;  1TAQ A;  2D5R A;  4HUG A;  1VSE A;  1NK7 A;  1NOY A;  3O3F A;  3OYA A;  4F2R A;  3TR8 A;  3L3U A;  3EY1 A;  4FLU A;  4OKK A;  4E19 A;  3ZSZ A;  1HYS A;  1Y97 A;  3AA3 A;  4F2S A;  2GV9 A;  3NGI A;  4DU4 A;  1L3S A;  4E1N A;  4BDY A;  1ZBF A;  4ICL A;  1TKD A;  2IC3 A;  1HPZ A;  1CZB A;  1MU2 A;  1QE1 A;  1ITG A;  1FKO A;  5C25 A;  5KTQ A;  3TWH A;  1KRP A;  4CHP A;  3O4Q A;  4NCG A;  1L3T A;  3VQQ A;  3LPU A;  2YNG A;  2IAJ A;  4JLH A;  3L3V A;  4CFC A;  4C8N A;  2QK9 A;  2LSN A;  1FK9 A;  1FXX A;  1D8Y A;  1EET A;  1RT6 A;  3VQ6 A;  3OYH A;  4K8Z A;  1QS4 A;  1LAW A;  3AA2 A;  2ZQB A;  3SPZ A;  4B9L A;  4BWJ A;  4CF9 A;  3LWM A;  2BGG A;  4QCL A;  3AVN A;  2YV0 X;  2XHB A;  3C94 A;  3DRR A;  5CYM A;  3I8D A;  3QIN A;  4CGF A;  1ZYQ A;  2HHV A;  4CHY A;  4IDK A;  3LAN A;  3HJF A;  1JLE A;  3K5N A;  1RTI A;  2PY5 A;  3S9H A;  5E41 A;  2ZD1 A;  3ZSO A;  4R5P A;  3G10 A;  4CGH A;  5KGW A;  3K5L A;  1BQM A;  3NE6 A;  1J9A A;  1N5Y A;  1L3U A;  3RRG A;  5T7B A;  5J2M A;  3VQ9 A;  4CFD A;  1BIU A;  3LP1 A;  3NH1 A;  1C0T A;  1IKV A;  1HRH A;  3ULD A;  1GOC A;  3IG1 A;  1QSL A;  3CFP A;  4N41 A;  1S1X A;  4CEF A;  4B3O A;  5J2P A;  2BDP A;  2ITG A;  2Z1J A;  3SI6 A;  2OZM A;  4JRP A;  3AO3 A;  2G8W A;  3LZI A;  2P51 A;  3OS2 A;  4B9N A;  4KFB A;  2A1S A;  1S5J A;  3OJU A;  3RR8 A;  2KFN A;  1SKS A;  1EP4 A;  1X9W A;  3AVM A;  1R0A A;  4L8R B;  4DTP A;  1SV5 A;  3P83 D;  4J2E A;  4Z4I A;  3SUQ A;  1T8E A;  5KI6 A;  1HYZ A;  2FBV A;  1LW0 A;  1WSF A;  5SWM A;  3HXM A;  4KTZ A;  4ELV A;  4I2P A;  4E89 A;  1CZ9 A;  4GMJ B;  1JLA A;  4ID5 A;  2ETJ A;  3AVG A;  4Z4E A;  3OYL A;  3K57 A;  4N5S A;  1XI1 A;  1WAJ A;  1A5X A;  4DTR A;  1W9H A;  3KKS A;  3LP2 A;  3HM9 A;  2XY8 A;  4CJT A;  2G8F A;  2G8U A;  3DOL A;  3K5O A;  4DTN A;  3AVH A;  5HRR A;  4BWM A;  3QES A;  4KPY A;  3DM2 A;  3VQ4 A;  1WSG A;  2YKM A;  2Z1I A;  1DTT A;  2KTQ A;  3KKR A;  4E7K A;  2OPQ A;  3CG7 A;  3NHG A;  4ELT A;  5C42 A;  3KK2 A;  3IAY A;  3NF7 A;  3ZT2 A;  4BDZ A;  1TAU A;  3TAF A;  1YT3 A;  1BCO A;  4IBN A;  4FJJ A;  3H08 A;  3V1R A;  1BCM A;  2KQ2 A;  3WNH A;  4HUF A;  3OS0 A;  4DTU A;  3O3G A;  3OYC A;  2FBX A;  2VG5 A;  4DF4 A;  3KLI A;  4QAG A;  1SL0 A;  1QHT A;  2HW3 A;  4DMN A;  4LSL A;  2BAN A;  2VWK A;  4FLX A;  2KFZ A;  3NF8 A;  3HT3 A;  3MXI A;  3TAN A;  4O55 A;  1X1P A;  3TAM A;  3OYF A;  1IH7 A;  4FLV A;  4KV8 A;  3ZSW A;  4BE1 A;  4FM1 A;  2P5G A;  2IS3 A;  2Z1H A;  1NJZ A;  4I9Q A;  1BI4 A;  1J54 A;  3M8P A;  1KVC A;  1VSH A;  4KI6 A;  2DFF A;  4RW8 A;  1U4B A;  3M8S A;  3HST B;  4E1M A;  4OPK A;  3D0P A;  4HTU A;  4FZY A;  3V9U A;  4FJX A;  3P1G A;  1RT7 A;  2RN2 A;  4DFK A;  3ZT0 A;  4DG1 A;  5C24 A;  4FLZ A;  4DF8 A;  3G0Z A;  3VQP A;  3OYG A;  1S9G A;  1UWB A;  2FBY A;  4N47 A;  3ZT4 A;  4Z4C A;  5SZT A;  4HCC A;  3SJJ A;  4C8O A;  2DTU A;  2XO7 A;  4F3T A;  4M3T A;  2JLE A;  4LH4 A;  1QSY A;  3DLH A;  1DTQ A;  3MEE A;  3TAQ A;  1ASW A;  4AHR A;  1K6Y A;  1BIZ A;  4BE0 A;  1O1W A;  5JS2 A;  3HO1 A;  3O4N A;  4ZHR A;  4GVM A;  4W5O A;  3I0S A;  3CFR A;  2G8H A;  4W5Q A;  4BE2 A;  1BHL A;  4DTM A;  2DFH A;  3F73 A;  4C8M A;  3OYB A;  3VQB A;  4HUE A;  3QNN A;  2FBT A;  1NKB A;  4FJK A;  2AJQ A;  4Y1D A;  3ZSR A;  2Y1I A;  1RT1 A;  4WE1 A;  1S6P A;  3L8B A;  4JS5 A;  3DYA A;  1D5A A;  4ID1 A;  3V9Z A;  2P5O A;  3C6T A;  3VQ7 A;  3TAG A;  3KK3 A;  3T1A A;  4ZTJ A;  4OVL A;  2XY5 A;  2OA8 A;  5JS1 A;  2JGU A;  1ZBU A;  4M45 A;  3DMJ A;  4HVJ A;  2HVI A;  1KCF A;  3AO4 A;  5CZ2 A;  3DI6 A;  1S1V A;  3LWL A;  3V9W A;  3PX6 A;  4KB0 A;  2P1J A;  1RDD A;  3EYZ A;  3NBP A;  3AVK A;  1C0U A;  1RBU A;  2YKN A;  3QIP A;  1ASU A;  3ZCM A;  1B92 A;  4FJ9 A;  4DSE A;  3WNG A;  2NUB A;  1VSD A;  4CGG A;  1RTJ A;  4NCA A;  1VSJ A;  4KHU A;  3VQE A;  1WN7 A;  1L5U A;  3B6O A;  1KFS A;  1NKE A;  1RCH A;  4DQR A;  1B9D A;  3BGR A;  4H8K A;  3OYM A;  4PWD A;  4M42 A;  1RT2 A;  2F8S A;  4CJ4 A;  1D9D A;  3V81 A;  2XY7 A;  4RW9 A;  1RT5 A;  4DS5 A;  4IG0 A;  4CJP A;  3QEW A;  4FK2 A;  3QO9 A;  4AHT A;  4CHO A;  3M8Q A;  4FJN A;  4DFM A;  2HHW A;  2W42 A;  3QEP A;  3SYZ A;  1QSS A;  4IG3 A;  3HPH A;  4FVM A;  3VQA A;  4MQ3 A;  4OJR A;  4AIL C;  4CJ3 A;  4JS4 A;  2E4L A;  3VQ5 A;  4DSL A;  4FJM A;  3RTV A;  4HCB A;  2R7Y A;  1F21 A;  3ZSY A;  4JRQ A;  4M3X A;  4NYF A;  4CFA A;  3L2W A;  3QNO A;  3IRX A;  3NDK A;  5HRS A;  4FJ5 A;  3HPG A;  3FFI A;  3SQ2 A;  3SCX A;  1RDA A;  3AO1 A;  1S9E A;  1KLN A;  2OYQ A;  4EZ9 A;  5CY4 A;  3QET A;  1BI4 B;  4O5B A;  1N6Q A;  4CIG A;  3LAM A;  1JKH A;  3NH2 A;  1VK0 A;  3EZ5 A;  2Q3S A;  3NGY A;  4CEA A;  1XHX A;  1L3V A;  3OVN A;  3DLE A;  1C1C A;  3L2R A;  4OLB A;  1VRT A;  1IO2 A;  4FW2 A;  2HVH A;  4FK0 A;  3DLR A;  1KVB A;  4PUO A;  1T03 A;  3LP0 A;  1TGO A;  3CYM A;  4RW6 A;  1LWF A;  3RMB A;  3IS9 A;  3THV A;  3AO5 A;  4CHQ A;  3ALY A;  3KD1 E;  2RPI A;  4I2Q A;  4LSN A;  2YNH A;  3V1Q A;  4UQG A;  1NK5 A;  1KTQ A;  1VSF A;  2IOC A;  2QXF A;  4RW4 A;  3OYK A;  5DMR A;  3TAR A;  5D3G A;  1C6V A;  3E01 A;  1RTD A;  1LW2 A;  1A5V A;  4H4M A;  1NOZ A;  3NCI A;  2BE2 A;  1RDC A;  2HMI A;  2VG7 A;  2EX3 A;  3ZSV A;  4KTQ A;  3VQ8 A;  3HVT A;  4CF8 A;  4FYD A;  3DLK A;  2VWJ A;  4W5R A;  1C1B A;  1Z26 A;  2B5J A;  4CK3 A;  5J2Q A;  4KHW A;  1WNS A;  3ITH A;  1SUQ A;  5KRT A;  4PQU A;  1FKP A;  2PYJ A;  4M3R A;  4CES A;  1CXQ A;  1TKT A;  4CHZ A;  3UIQ A;  3I0R A;  3AVB A;  3NF9 A;  2OPS A;  4M3Z A;  2OPR A;  2G8I A;  4E7L A;  3HL8 A;  3O3H A;  3QER A;  4OPJ A;  4PY5 A;  3KJV A;  1JLG A;  1JXE A;  3LP3 A;  4FZZ A;  1JLQ A;  3QLH A;  4AHV A;  4B8A B;  1IKW A;  1RBR A;  3OYJ A;  2XY6 A;  3C6U A;  1DLO A;  3AV9 A;  1NJX A;  4E3S A;  3HPO A;  2G8V A;  2O4I A;  2O4G A;  3P5J A;  4DSI A;  3HK2 A;  3DRP A;  4CGJ A;  3VQC A;  4CJR A;  1U48 A;  4W5T A;  1NK9 A;  4DFP A;  4B08 A;  3KK1 A;  1TK5 A;  4K8X A;  3K58 A;  1GOA A;  4FM0 A;  2E6L A;  2RKI A;  1TKX A;  3SUP A;  3MXJ A;  1RBS A;  4N56 A;  4DQI A;  2HHQ A;  4KHS A;  5I42 A;  4CJE A;  1C1A A;  1IG9 A;  4CJF A;  3U6F A;  1CXU A;  2RF2 A;  2ZE2 A;  4NCB A;  1SKR A;  3JYT A;  5FDL A;  3VQD A;  1I3A A;  4XIU A;  4IFY A;  3U3Y A;  4KKO A;  4GW6 A;  3LZJ A;  1JLB A;  4FJH A;  2D0B A;  4B9U A;  5EU7 A;  1EX4 A;  1WSI A;  3KD5 E;  2WON A;  1WAF A;  1X9M A;  3V1O A;  1G15 A;  4TSX A;  4DWI A;  2HHT A;  4J2A A;  1S1T A;  4DS4 A;  1RT4 A;  1WSJ A;  2XRI A;  3SZ2 A;  4CE9 A;  3RRH A;  4LD0 A;  3RMA A;  1KFD A;  4O0J A;  4CGI A;  4CER A;  2E6M A;  1ZBI A;  2I5J A;  2PYL A;  4CJL A;  3MEG A;  1XHZ A;  4DLG A;  4G1Q A;  1IKY A;  4FJG A;  3ZSX A;  4CJV A;  4DTJ A;  1BIS A;  4FLY A;  4KB1 A;  1NK6 A;  4CK2 A;  1BGX T;  1BQN A;  2DFE A;  4AHS A;  5FRO A;  1GOB A;  2D0C A;  3AO2 A;  3ASM A;  3OYE A;  3DOK A;  3SUN A;  3CFO A;  4KHN A;  3K2P A;  1EXQ A;  2X78 A;  3S3O A;  2IGI A;  3DLB A;  3RR7 A;  4O44 A;  4KAZ A;  3L2V A;  4CHN A;  3AVL A;  1UOC A;  3HVR A;  3KLH A;  5HBM A;  4KRE A;  1S1W A;  1A5W A;  3C95 A;  4OGE A;  3V6D A;  3PX0 A;  4DSK A;  3NF6 A;  4F4K A;  2HHU A;  3T19 A;  4C8L A;  1JL2 A;  1CLQ A;  3S3N A;  4F3O A;  2PZS A;  1ZBH A;  3V4I A;  4B9S A;  5HRN A;  2Y1J A;  1QQC A;  1RBT A;  1WSE A;  2X6N A;  4CF2 A;  1J53 A;  2B4J A;  4DU3 A;  3U3G A;  4LY7 A;  4B8C A;  2HHS A;  3SPY A;  2KW4 A;  2OZS A;  3OY9 A;  3KLF A;  3PX4 A;  3HP6 A;  4CCH A;  4DFJ A;  3AA4 A;  2IDO A;  4FJ7 A;  1JLF A;  3A2F A;  2WOM A;  1REV A;  3LDS A;  2KZM A;  3SQ0 A;  1J5O A;  3PY8 A;  1X9S A;  4B9V A;  4CIE A;  1YTU A;  1NK8 A;  1B9F A;  5FRM A;  4FLW A;  3RMD A;  1W0H A;  3KLG A;  4ZTF A;  4KO0 A;  4CJQ A;  3KIO A;  1T05 A;  4O4G A;  3TAE A;  3NAE A;  4ELU A;  5KRS A;  4FJ8 A;  2G8K A;  3B6P A;  3MED A;  3NGZ A;  4CEZ A;  1VSI A;  4W5N A;  3MXM A;  1YVU A;  4DLE A;  1BL3 A;  4N76 A;  4FJI A;  3ZT3 A;  4CEB A;  4B9T A;  3BDP A;  2ATQ A;  1KLM A;  3CM5 A;  3HYF A;  4Z0U A;  3SUO A;  4CEE A;  2QKK A;  3LAK A;  4KHQ A;  3OJS A;  4CJ5 A;  1HQU A;  2B6A A;  4E7I A;  1TK8 A;  1NKC A;  1Q8I A;  2VG6 A;  3AVI A;  3WNE A;  4FLT A;  1LWC A;  4EP4 A;  3HP9 A;  3PO4 A;  3QIO A;  5FRN A;  1U04 A;  3AVA A;  2HB5 A;  3KLE A;  4FCY A;  1JL1 A;  5CZ1 A;  2HND A;  3TI0 A;  1KVA A;  1VSM A;  1XWL A;  2YHA A;  4CEQ A;  2Z1G A;  4CK1 A;  2OPP A;  4DTS A;  3QEI A;  1D9F A;  3V9X A;  2QKB A;  2HHX A;  4DTO A;  4I9L A;  4IFV A;  4PA1 A;  4M3W A;  4OKE A;  2GBZ A;  4DU1 A;  1UA1 A;  1NK4 A;  3VA3 A;  1S1U A;  5KGX A;  1NJY A;  1UAX A;  1RBV A;  4M3Y A;  3AVC A;  2YNI A;  4F8R A;  1U49 A;  4LH5 A;  3MAQ A;  1RIL A;  1HNI A;  4J2D A;  3JSM A;  1IKX A;  5HRO A;  1I39 A;  2YHB A;  1WSH A;  4MFB A;  3AA5 X;  1LAV A;  4OKJ A;  1RDB A;  4Q5V A;  4FM2 A;  1TKZ A;  4Z4F A;  1HNV A;  4EP5 A;  2F96 A;  4Z4G A;  3S3M A;  2X74 A;  2KZZ A;  1C0M A;  4Q0B A;  4CF0 A;  1HQE A;  1WLJ A;  5K14 A;  4CEC A;  4YNQ A;  3SV3 A;  1VSK A;  5I3U A;  4M41 A;  1Q9Y A;  4FXD A;  4CGD A;  2GUI A;  1U45 A;  1HMV A;  3DRS A;  1JXB A;  4DTX A;  1KSP A;  4I7F A;  4E7H A;  4YFU A;  4M3U A;  5DK5 A;  3ISN C;  1RNH A;  1NJW A;  3AVF A;  2F8T A;  1TVR A;  3WNF A;  4KHY A;  3OYI A;  1VRU A;  4FK4 A;  4RG8 A;  1VSL A;  3ZSQ A;  4AHC A;  4BAC A;  3RMC A;  1UA0 A;  1T7P A;  3QEV A;  3F9K A;  1S6Q A;  3CM6 A;  4KI4 A;  3AVJ A;  3NFA A;  1LWE A;  3ZT1 A;  4E7J A;  4KTW A;  2FC0 A;  4OGC A;  1QTM A;  4Z4H A;  4O0I A;  3KTQ A;  4RW7 A;  4CIF A;  4AH9 A;  2EHG A;  3L2U A;  3TAP A;  1SL1 A;  3OYD A;  2YNF A;  4Y1C A;  3SQ4 A;  3VA0 A;  1TL3 A;  5HLF A;  4H4O A;  4HHT A;  4OLA A;  2X6S A;  5J1E A;  1ZBL A;  4CJW A;  1Q9X A;  3D45 A;  4BDP A;  4QOZ B;  4FW1 A;  1TK0 A;  4CED A;  4CJU A;  4DQP A;  4IKF A;  4E0D A;  5CYQ A;  3TAB A;  3PO5 A;  1EKE A;  1RTH A;  1YTA A;  3LAL A;  3OS1 A;  4B9M A; 
#chains in the Genus database with same CATH topology
 3QBX A;  4JI4 K;  2CH6 A;  3U9Z A;  4ISF A;  4CJS A;  1WB9 A;  5GIP A;  1N33 K;  1NGE A;  2P9K A;  2HNY A;  2A1R A;  4CJK A;  2DPN A;  3K0S A;  3K5M A;  4ILJ A;  4AHU A;  4H5W A;  2O8B B;  4JNE A;  1JLC A;  3VPZ A;  3PUF A;  4UY8 O;  2D5R A;  4HUG A;  4F2R A;  3MN5 A;  1DGK N;  4BC2 A;  4OKK A;  2NZT A;  3ZSZ A;  1Y97 A;  3AA3 A;  1K9M O;  3VGM A;  1HYS A;  4DU4 A;  4E1N A;  3ZX2 A;  4Z4F A;  1CZB A;  1FKO A;  4BC4 A;  2F7T A;  3LDP A;  1SAZ A;  1L3T A;  3LPU A;  3MWP A;  5TKW A;  1FK9 A;  1D8Y A;  1RT6 A;  1N34 K;  1QS4 A;  4H0T B;  4QCL A;  3LWM A;  2BGG A;  1K8K B;  2J4R A;  3OW2 M;  1SS6 A;  3DRR A;  5CYM A;  3K9J A;  2HHV A;  1YIT N;  1BA0 A;  4CHY A;  1EO1 A;  5B8H A;  3KK7 A;  3HJF A;  4R5P A;  3G10 A;  1BQM A;  5GAG P;  4E1J A;  4H5T A;  2E2P A;  1QSL A;  4B3O A;  5AQI A;  5J2P A;  2ITG A;  4JRP A;  2G8W A;  5M1P A;  3LZI A;  2YX6 A;  4KFB A;  1S5J A;  4A61 A;  3RR8 A;  5C15 A;  1SKS A;  3AVM A;  1R0A A;  4DTP A;  1SV5 A;  3FLC O;  3KWG A;  4J2E A;  3SUQ A;  3CD6 N;  1NMN A;  4JK8 A;  4CZE A;  4YOW A;  5SWM A;  4ELV A;  1NGF A;  4E89 A;  3WQT A;  1EWQ A;  1JLA A;  2FSJ A;  4JD2 A;  4N5S A;  3SLC A;  3J7A P;  3CQX A;  4DTR A;  1W9H A;  2KHO A;  3HM9 A;  1VQ8 N;  4CJT A;  3DOL A;  3QES A;  4BWM A;  1YAG A;  1WSG A;  2CGL A;  1MWK A;  3SK3 A;  3KKR A;  2HOE A;  5AZJ B;  4IO9 L;  1OVY A;  3KK2 A;  3IAY A;  3ZT2 A;  1HR0 K;  1BCO A;  5KPR A;  1BCM A;  1QQN A;  3WNH A;  1EWR A;  1NGC A;  4MO5 A;  3OYC A;  4DF4 A;  4ISG A;  1V4S A;  2BAN A;  3HT3 A;  5EVZ A;  3TAM A;  4KV8 A;  3PIO L;  3QIC A;  4BE1 A;  4FM1 A;  3I33 A;  4FOI A;  1C0G A;  1TYQ B;  1YI2 N;  5EXW A;  4KI6 A;  4RW8 A;  4E1M A;  5JVG L;  3V9U A;  2RE2 A;  4YHH K;  5BRD A;  3ZT0 A;  4DG1 A;  4FLZ A;  4DF8 A;  3TSP A;  3OYG A;  3FR0 A;  2XO7 A;  2WBN A;  4M3T A;  1HUX A;  4LH4 A;  4WYB A;  1QSY A;  4DV3 K;  2HBM A;  1K6Y A;  1BIZ A;  4ZHR A;  5CE3 A;  4YOY A;  3HI0 A;  3CCJ N;  4PHT X;  4C8M A;  3VQB A;  3F5T A;  1NKB A;  2NRZ A;  2IVP A;  4Y1D A;  4A5B A;  3ZSR A;  1RT1 A;  1D5A A;  3VQ7 A;  2O8D B;  3TAG A;  1JCG A;  4JKH A;  1OH6 A;  4BC5 A;  4JI3 K;  2JGU A;  1BA1 A;  2OAN A;  2VWB A;  5BR8 K;  3VEX A;  2HVI A;  3V9W A;  3PX6 A;  4EAH D;  4KH5 A;  1C0U A;  3QIP A;  1ASU A;  2P9L B;  4A2B A;  4DSE A;  3WNG A;  4IZ9 A;  2NUB A;  1RTJ A;  5AQY A;  4EIA A;  4NCA A;  1VSJ A;  4KHU A;  1WN7 A;  3OYM A;  4FWL A;  1KAY A;  3Q7C A;  1NWK A;  1NBW A;  1KD1 O;  1KAX A;  4CJP A;  2D0P A;  3QEW A;  3QO9 A;  4CHO A;  4YOV A;  4NO7 A;  5DM7 L;  3SYZ A;  2P9N B;  4FVM A;  3AAR A;  2KKZ A;  3ZEU A;  4JS4 A;  2E4L A;  3VQ5 A;  2F9T A;  4JKA A;  2R7Y A;  3ZSY A;  4B9Q A;  3EL2 A;  3M5R A;  4FJ5 A;  3SCX A;  3AO1 A;  1S9E A;  4B1W B;  1XC3 A;  2QA4 N;  5AQX A;  2RHK A;  3O9Q A;  4BRF A;  2E20 A;  4BRG A;  2E8A A;  1C1C A;  4OLB A;  5KPT A;  3ENH A;  1HLU A;  1VRT A;  2HVH A;  1RGI A;  3OBY A;  1YJN N;  3RMB A;  4CHQ A;  3KD1 E;  3V1Q A;  2RPI A;  4I2Q A;  4UQG A;  1NK5 A;  4YDU C;  1VSF A;  4C1N I;  3TAR A;  3IKM A;  1C6V A;  1NGD A;  4EFH A;  3CCR N;  2Q1N A;  4DR5 K;  5AQO A;  2EX3 A;  5AQN A;  4KTQ A;  3O9T A;  2D0O A;  3AAQ A;  4FYD A;  3GE1 A;  1FJG K;  2ASO A;  3ITH A;  5KRT A;  4PQU A;  1FKP A;  2PYJ A;  1YVN A;  1TKT A;  4CHZ A;  2IIR A;  3C7N A;  3TU5 A;  3CC7 N;  3K9K A;  1JLG A;  1JXE A;  1QQM A;  1JLQ A;  4B8A B;  1ZXO A;  1IKW A;  3C6U A;  2P9I A;  2G8V A;  3H1V X;  3EE9 A;  4CGJ A;  2BUP A;  3VQC A;  1U48 A;  3SMS A;  1NK9 A;  4DFP A;  5BPM A;  3LDO A;  2RKI A;  3MXJ A;  4N56 A;  4H03 B;  1CXU A;  3GDQ A;  5A2Q O;  4FWP A;  1SKR A;  3M1F A;  1I3A A;  4KKO A;  4GW6 A;  1JLB A;  4FJH A;  2YHY A;  2QWR A;  5EU7 A;  1WSI A;  3THW A;  3NVM A;  1X9M A;  3V1O A;  1R59 O;  1S1T A;  1WSJ A;  2XRI A;  4CE9 A;  4LD0 A;  1KFD A;  1LCU A;  2E6M A;  4Y0W A;  4FJG A;  4DTJ A;  2W6L A;  4FLY A;  3BF1 A;  4BVP A;  3UKR B;  1TUY A;  1BGX T;  2DFE A;  3BZC A;  2D0C A;  3TTF A;  4CBX A;  5AQK A;  4CHN A;  3J8A A;  4IOC L;  4M7Y A;  4KH4 A;  1S1W A;  3PX0 A;  3V6D A;  4F4K A;  2E1Z A;  4DHY A;  1CLQ A;  3T19 A;  4IEE A;  3ENB A;  1Q81 O;  4B9S A;  5FPD A;  2Q2R A;  3VEN A;  3WEE B;  3T1Y K;  3ZYY X;  3U3G A;  2HHS A;  2KW4 A;  1Z05 A;  4BG9 A;  5JMV A;  5GIO A;  4CCH A;  3DXK A;  4DFJ A;  4C23 A;  4PL8 A;  1JLF A;  3A2F A;  3LDQ A;  2WOM A;  1REV A;  2ZM6 K;  1YHQ N;  1J5O A;  1NK8 A;  3HTV A;  3EKU A;  1W0H A;  3QDK A;  4JKG B;  1T05 A;  2ZJR L;  2NRR A;  4ELU A;  1N32 K;  4CEZ A;  3CMA N;  3WT0 A;  4W5N A;  4DLE A;  2A41 A;  4M63 C;  4N76 A;  4CEE A;  4KHQ A;  3OJS A;  1TK8 A;  2VG6 A;  3WNE A;  3THY B;  1LWC A;  4G9Z A;  3QIO A;  1U04 A;  2Q0R A;  2VCP A;  3AVA A;  2HB5 A;  3O80 A;  4BR9 A;  3KLE A;  1LOT B;  4FCY A;  2HND A;  3TI0 A;  2Z1G A;  1D9F A;  3BF3 A;  4DTO A;  2NRW A;  4PA1 A;  2GBZ A;  4DU1 A;  1NK4 A;  5E26 A;  1UAX A;  1RBV A;  4M3Y A;  3U9D A;  3JSM A;  5HRO A;  4MDA A;  3C65 A;  1QVG M;  2UXD K;  2YHB A;  3QFP A;  4DV5 K;  4MFB A;  1LAV A;  3AGR A;  1TKZ A;  5F1X A;  1VQ7 N;  4IEI A;  4CEC A;  1VSK A;  2ZGY A;  1ILY A;  2GUI A;  3BY5 A;  3DRS A;  1JXB A;  4QS7 A;  4I7F A;  5MLC Q;  1TVR A;  3WNF A;  2A42 A;  1VSL A;  4AHC A;  4BAC A;  2FXU A;  4KI4 A;  2Q36 A;  3CQY A;  3ZT1 A;  4KTW A;  2FC0 A;  3SMP A;  3N4Q A;  4O0I A;  4F3T A;  4CIF A;  3L2U A;  1MDU B;  4Y1C A;  4CJW A;  1Q9X A;  1TK0 A;  4DUZ K;  3HSC A;  4CJU A;  3CCU N;  5CYQ A;  3SAF A;  1EKE A;  1RTH A;  3LAL A;  3SAH A;  3OS1 A;  4B9M A;  3E9O A;  3T3F A;  2DY4 A;  3NH0 A;  1RT3 A;  4JHD A;  5AQM A;  2O8E A;  2P9I B;  3E9P A;  1SKW A;  5I9E B;  4DV0 K;  5IWA K;  1XC9 A;  3K59 A;  4CFB A;  1VQ9 N;  3CI5 A;  3VN5 A;  3A5N C;  4DQS A;  1NOY A;  3O3F A;  2UUC K;  2A6A A;  4E19 A;  4KH6 A;  4F2S A;  3NGI A;  1Y64 A;  1HNW K;  3FGU A;  4ICL A;  4IOX A;  3VTI A;  5C25 A;  5KTQ A;  5BN8 A;  4NCG A;  2W6K A;  3VQQ A;  3QBW A;  3VES A;  2IAJ A;  3CPE A;  4JLH A;  2QK9 A;  3MN9 A;  1EET A;  5GAE P;  2O8F B;  4B1U B;  4K8Z A;  3CJ1 A;  3DXM B;  2V7Z A;  3SPZ A;  1HNX K;  4BWJ A;  4CF9 A;  3JXU A;  4H0P A;  4OPA A;  3I8D A;  1KQS M;  4H5N A;  4CGF A;  3L4I A;  4BR7 A;  3LAN A;  1W97 L;  2PY5 A;  3G4S N;  4JKF A;  2E1Y A;  4CGH A;  1J9A A;  1BO5 O;  3B8A X;  3VQ9 A;  1HPM A;  4CFD A;  3LP1 A;  1IKV A;  3ULD A;  1GOC A;  1HKB A;  4X64 K;  2WTU A;  3CFP A;  4ILG B;  1S1X A;  4CEF A;  3T1H K;  2Z1J A;  3SI6 A;  3AAP A;  3ZX0 A;  2P51 A;  3OS2 A;  3DAW A;  2A1S A;  3LL3 A;  2QWM A;  2KFN A;  1X9W A;  3P83 D;  4H5R A;  4H0O A;  5KI6 A;  1NGI A;  4KTZ A;  1CZ9 A;  3O9U A;  3EO3 A;  3K57 A;  1WAJ A;  3FZM A;  3WXJ A;  3KKS A;  2XY8 A;  2G8U A;  5HRR A;  1S72 N;  2YKM A;  3ZEU B;  2OPQ A;  3CG7 A;  2D1K A;  1C0F A;  3H08 A;  3V1R A;  3VEW A;  3T7Z A;  2VG5 A;  3O4W A;  2HW3 A;  4DMN A;  4LSL A;  2KFZ A;  4O55 A;  4FLV A;  1IH7 A;  3CJA A;  4RTF D;  1OH5 A;  3O1B A;  1J54 A;  1KVC A;  1VSH A;  1U4B A;  2CGK A;  4OPK A;  4HTU A;  4FJX A;  2YHX A;  1NMD A;  3G0Z A;  1UWB A;  5AR0 A;  4N47 A;  4HCC A;  3ZET A;  5LL6 Z;  2UXC K;  2A5X A;  4B1Y B;  3ULE B;  3MEE A;  2O8D A;  4O8K A;  2NLX A;  1O1W A;  2GWJ A;  3O4N A;  1ESV A;  4GVM A;  3I0S A;  5LMN K;  1QZ5 A;  3CFR A;  2G8H A;  4W5Q A;  1BHL A;  2DFH A;  5AQJ A;  3F73 A;  4JAX A;  2Y1I A;  3DYA A;  4ID1 A;  3KK3 A;  2XY5 A;  5JS1 A;  3VET A;  4M45 A;  4HVJ A;  3DI6 A;  1YXQ A;  4JEP A;  3RSE A;  3EYZ A;  4FJ9 A;  1NNE A;  3ZCM A;  1NG9 A;  2UUA K;  3L0Q A;  1WBD A;  4CGG A;  3G6E N;  3VQE A;  1L5U A;  4B3T K;  1KFS A;  1NKE A;  1RCH A;  4DQR A;  1RT2 A;  1VQK N;  4ILH A;  4CJ4 A;  3PIP L;  1K73 O;  1D9D A;  2HBL A;  3V81 A;  2XY7 A;  4RW9 A;  1YJ9 N;  3L6Q A;  3DJC A;  4FK2 A;  3M8Q A;  4DFM A;  4YOU A;  3QEP A;  3HPH A;  4BR5 A;  3HOS A;  3VQA A;  3CCV N;  4OJR A;  1SQK A;  3OTO K;  5KQD A;  4DSL A;  4HCB A;  3O9S A;  3LDN A;  3QNO A;  3W0L A;  3IRX A;  5HRS A;  4NLB A;  5CY4 A;  3TSU A;  3QET A;  4FWR A;  3LAM A;  3NH2 A;  2NRT A;  4H5V A;  1VK0 A;  5FPM A;  3EZ5 A;  3DXK B;  1XHX A;  1L3V A;  3OVN A;  4CBU A;  5AQS A;  1IO2 A;  4FK0 A;  3DLR A;  1KVB A;  4PUO A;  1T6C A;  3CYM A;  3LP0 A;  3SBG A;  5C2F A;  3IUC A;  3H45 C;  3AO5 A;  2YI1 A;  1X3M A;  3P31 A;  2HST A;  2P9K B;  1KTQ A;  2IOC A;  2QXF A;  2UYT A;  3D2E A;  4RW4 A;  3J7Z O;  3NCI A;  4A59 A;  3TTC A;  1M1K O;  3CC2 N;  4CZL A;  3NMU A;  1D4X A;  4CF8 A;  1NGH A;  1C1B A;  2WUS A;  5J2Q A;  4CK3 A;  2IVO A;  2ZJP L;  4M3R A;  1CXQ A;  4M3Z A;  3AVB A;  2G8I A;  2OPS A;  4BGA A;  3O3H A;  4L3Q A;  4OPJ A;  3TTD A;  4FZZ A;  4AHV A;  4BRI A;  3OYJ A;  2XY6 A;  3HPO A;  4DB3 A;  4DSI A;  3HK2 A;  5AZJ A;  4X65 K;  3A0I X;  3DWL A;  3KK1 A;  3MCA B;  1IBL K;  1NU0 A;  5M1O A;  4DUY K;  4FM0 A;  3SUP A;  1RBS A;  5TKY A;  5GAD P;  2NRV A;  2PBD A;  4GV9 A;  2QWQ A;  3JYT A;  5FDL A;  3H1Q A;  2ITM A;  3LZJ A;  2I7P A;  3M6G A;  4JKC A;  4DS4 A;  1RT4 A;  3SZ2 A;  3RMA A;  4CER A;  2FSK A;  1ZBI A;  4J8F A;  3ZET B;  4CJL A;  1T44 A;  2I7N A;  4DV7 K;  2V7Y A;  4KB1 A;  4JI2 K;  1NK6 A;  5AFU H;  1JCE A;  1HJO A;  3H6E A;  1GOB A;  1HX1 A;  3HBT A;  4BRM A;  3OYE A;  3DOK A;  1GLD G;  5JVH L;  4KAZ A;  1T3V A;  1XUP O;  1OH8 A;  1UOC A;  5M1F A;  2P9L A;  3C95 A;  2HHU A;  3NF6 A;  1JL2 A;  2GWK A;  5EOY A;  3S3N A;  1ZBH A;  1QQC A;  1RBT A;  1WSE A;  4CF2 A;  2B4J A;  4DU3 A;  5BPN A;  4B8C A;  4BR4 A;  3SPY A;  4LF9 K;  3KLF A;  3PX4 A;  4A62 A;  3GOI A;  3MDQ A;  2IDO A;  4FJ7 A;  2WC9 A;  2VGN A;  3NVK A;  5M1N A;  4NLC A;  3FZK A;  3KHY A;  1YUW A;  1X9S A;  4X62 K;  1T6D A;  1YTU A;  4ZTF A;  4KO0 A;  2FF3 B;  4O4G A;  3NAE A;  2HMP A;  4FJ8 A;  3B6P A;  3HZ6 A;  3MED A;  3THY A;  1Q86 O;  3S41 A;  1YVU A;  2IVN A;  4FJI A;  4CEB A;  3FZH A;  2ATQ A;  4Z0U A;  3HYF A;  3SUO A;  3RSE B;  2VYP A;  4BRH A;  1BG3 A;  4F9O A;  1JL1 A;  3H3O B;  3QB0 A;  2A3Z A;  1XWL A;  4CEQ A;  3V9X A;  3E9L A;  4OKE A;  1S1U A;  5KGX A;  3AVC A;  4JI0 K;  4WFN L;  3VF4 A;  3MAQ A;  1U49 A;  3F2K A;  1HNI A;  3UB5 A;  4DCH A;  5AQH A;  4LF6 K;  1WSH A;  1XNR K;  4K43 A;  1HNV A;  4EP5 A;  4Z4G A;  3S3M A;  4JN4 A;  4Q0B A;  4FWQ A;  3CME N;  1WLJ A;  5K14 A;  5I3U A;  1Q9Y A;  4FXD A;  4CGD A;  3WXL A;  3R3L A;  1G99 A;  3AVF A;  4DR2 K;  2F8T A;  1VQL N;  4KHY A;  5LJW A;  1VRU A;  3RMC A;  1T7P A;  1VHX A;  3QEV A;  3CF5 L;  3F9K A;  4CVN E;  3CM6 A;  4BVO A;  3P4I A;  5M1K A;  1BDG A;  4E7J A;  4DV6 K;  3KWI A;  3TAP A;  4AH9 A;  3P39 A;  3OYD A;  2YNF A;  1Q82 O;  4CZH A;  3SQ4 A;  5J1E A;  5AQR A;  4CBW A;  4CED A;  3VF6 A;  1LV5 A;  3ATV A;  4EZ6 A;  4FZX C;  3L2Q A;  2HNZ A;  5HRP A;  4BRN A;  3Q7B A;  5AJ3 K;  5J2N A;  1ASV A;  3MEC A;  4IOA L;  3OYN A;  5JIC A;  4C8K A;  1TV6 A;  2BH1 A;  3M3Z A;  2GEM A;  4J2B A;  3RWU A;  4LF5 K;  3QEX A;  4BRE A;  3O08 A;  3SQ1 A;  1NK7 A;  4B3S K;  3TR8 A;  3L3U A;  5FLX O;  3EY1 A;  4FLU A;  3A5L C;  3TPQ A;  1L3S A;  4BDY A;  1ZBF A;  1TKD A;  2IC3 A;  1HPZ A;  1ITG A;  1KRP A;  2VQF K;  4CHP A;  5AQP A;  3O4Q A;  2YNG A;  3L3V A;  4Z94 A;  2LSN A;  1QQO A;  1BOT O;  3OYH A;  4XH1 A;  1LAW A;  1NGG A;  3AVN A;  2XHB A;  4OO1 J;  3QIN A;  2FLO A;  1ZYQ A;  4WQ5 C;  3QFU A;  3K5N A;  1RTI A;  1XQS C;  3MN7 A;  3S9H A;  2ZD1 A;  3MX2 A;  3ZSO A;  3RRG A;  5KGW A;  3K5L A;  1N5Y A;  2ZJQ L;  5T7B A;  5HOO A;  4PKI A;  3NH1 A;  1C0T A;  1IBK K;  4GKJ K;  5H1S Q;  4DR6 K;  3C6H A;  2BDP A;  4JKD A;  4CZM A;  2OZM A;  4YOX A;  3AO3 A;  4CZG A;  2EWS A;  1EP4 A;  1BU6 O;  2VGM A;  2P9U B;  1NGJ A;  1U2V B;  1T8E A;  1HYZ A;  1WSF A;  2PAV A;  4I2P A;  4ID5 A;  1XMO K;  2ETJ A;  3OYL A;  4IJN A;  1VQM N;  1XI1 A;  4H0Y B;  4MLE A;  3VEZ A;  3LP2 A;  2G8F A;  3AVH A;  4BG8 A;  4JI8 K;  4KPY A;  2Z1I A;  4CI6 A;  4DV4 K;  2KTQ A;  4E7K A;  3NHG A;  2QM1 A;  5C42 A;  4RCH A;  3NF7 A;  1TAU A;  3TAF A;  4IBN A;  3OHR A;  2KQ2 A;  1Q18 A;  4DTU A;  3OS0 A;  4OX9 K;  1QHT A;  4A5A A;  4FLX A;  1NGB A;  3NF8 A;  3MXI A;  5AQQ A;  4XH5 A;  3WXI A;  3OYF A;  3ZSW A;  2IS3 A;  1NJZ A;  4MDB A;  2DFF A;  2FSN A;  4FSV A;  2OCE A;  2RN2 A;  4DFK A;  3D2E B;  4JI5 K;  1DT9 A;  5C24 A;  4IDH A;  4EHT A;  1S9G A;  2FBY A;  3ZT4 A;  3CJB A;  5SZT A;  3SJJ A;  5EX5 A;  3WEE A;  3DLH A;  4BY9 C;  3ID6 A;  5BRE A;  4AHR A;  1ASW A;  4BE0 A;  1DEJ A;  3MCP A;  3FE1 A;  3T69 A;  4W5O A;  4JI6 K;  1TYQ A;  3THX B;  4V19 S;  4BE2 A;  1RDU A;  4DTM A;  3OYB A;  5F0X A;  2FBT A;  4FJK A;  2AJQ A;  3O9R A;  4BGB A;  4WE1 A;  3L8B A;  2P5O A;  4BQZ A;  5AQL A;  3T1A A;  4ZTJ A;  2GEL A;  2ZWH A;  3ULE A;  2OA8 A;  1ZBU A;  3DMJ A;  3WUH A;  5CZ2 A;  3AO4 A;  1JJ2 M;  1RDD A;  4M7X A;  3NBP A;  3H46 O;  4I6M A;  2YKN A;  1B92 A;  1GLL O;  5CR4 A;  1YF5 L;  4DR1 K;  4GNI A;  4YOT A;  1YJW N;  4H8K A;  3CXC M;  4M42 A;  2F8S A;  1RT5 A;  3CET A;  4AHT A;  4FJN A;  2D4W A;  2W42 A;  1QSS A;  1WUA A;  3CCQ N;  4BRC A;  4CJ3 A;  5KPZ A;  4FJM A;  1F21 A;  3UKU B;  4M3X A;  3L2W A;  4MO4 A;  5AZI A;  2AA4 A;  3I55 N;  3O5B A;  1KLN A;  2OYQ A;  1GLB G;  3MWT A;  4O5B A;  1W7A A;  1JKH A;  4CEA A;  1T03 A;  1TGO A;  3THV A;  3IS9 A;  2O8E B;  1RDW X;  4LSN A;  4RWT A;  3HRG A;  3BZK A;  4KHP K;  5DMR A;  5D3G A;  1LW2 A;  1A5V A;  1NOZ A;  3I8B A;  4H0V B;  1JCF A;  2VG7 A;  3BUZ B;  3ZSV A;  3DLK A;  1ATN A;  2VWJ A;  1Z26 A;  2B5J A;  4QS8 A;  2OTJ N;  1WNS A;  3W3D A;  3PSI A;  3G71 N;  2A40 A;  3NF9 A;  2OPR A;  3HL8 A;  2V51 B;  3KJV A;  1NLV A;  4CD3 A;  3QLH A;  5BRF A;  2P9N A;  5HL7 L;  4E3S A;  1HKG A;  1WBB A;  4BR2 A;  2O4I A;  2O4G A;  1V4T A;  4W5T A;  1TK5 A;  3THW B;  4K8X A;  3K58 A;  2E6L A;  1TKX A;  3KVG A;  5LMU K;  2HHQ A;  4DQI A;  4KHS A;  4CJE A;  2Q0U A;  3U6F A;  2P9U A;  2RF2 A;  2Q31 A;  2ZE2 A;  1TUU A;  4XIU A;  1N36 K;  3U4L A;  2QW9 A;  3BP8 A;  4AM6 A;  3EN9 A;  3OBW A;  5BN9 A;  4B9U A;  1CZA N;  1EX4 A;  4CW7 B;  3KD5 E;  1G15 A;  4J2A A;  2GTD A;  3RRH A;  3VEV A;  3O8M A;  2JWL A;  3EE8 A;  4IXC A;  1XNQ K;  5LJV A;  2I5J A;  1QVF M;  1VQN N;  2PYL A;  1XHZ A;  3MEG A;  3EEQ A;  3ZSX A;  4CJV A;  4FWK A;  1P90 A;  5JLF A;  4AHS A;  4YY3 K;  3AO2 A;  3ASM A;  5GIN A;  4YOR A;  1VQ4 N;  1IV0 A;  3K2P A;  1EXQ A;  3S3O A;  3A5O C;  3DLB A;  1EQY A;  3RR7 A;  5BRH A;  4JI7 K;  3L2V A;  3AVL A;  1U6Z A;  3KLH A;  4KRE A;  1GLC G;  4OGE A;  5AQV A;  1KAZ A;  3LDL A;  2QWP A;  4F3O A;  2PZS A;  3V4I A;  4XH4 A;  4HWI A;  1X3N A;  3ATU A;  5C10 A;  4DR3 K;  1J53 A;  3CCS N;  5ADX H;  4LY7 A;  2OZS A;  4B3R K;  1K8K A;  2KZM A;  4LF8 K;  1B9F A;  4FLW A;  3KLG A;  4U67 L;  1BWF O;  2NNW A;  3L4Q A;  3JAM O;  3KIO A;  3TAE A;  3LM9 A;  3NGZ A;  1VSI A;  3DLL L;  5AQG A;  3IDH A;  2CGJ A;  3ZT3 A;  3UKU A;  3BDP A;  1GLA G;  1HKC A;  3CM5 A;  3ENO A;  2QKK A;  3LAK A;  2CH5 A;  1Q8I A;  3PO4 A;  5FRN A;  3HP9 A;  1X9J A;  2WFB A;  2YHA A;  1KXP A;  2OPP A;  2QKB A;  4GV6 A;  4DV2 K;  1UA1 A;  5BR9 A;  1K8A O;  4F8R A;  4LH5 A;  3SJH A;  1RIL A;  4J2D A;  1I39 A;  3AA5 X;  4FWS A;  4AQY K;  1QHA A;  4OKJ A;  4X66 K;  2W40 A;  3P38 A;  2KZZ A;  3GL1 A;  2AP1 A;  4M41 A;  3FFK B;  1U45 A;  2ZGZ A;  4DTX A;  1KSP A;  4M3U A;  5DK5 A;  1H1V A;  5ELZ A;  4NXN K;  4FK4 A;  3ZLJ A;  1E4F T;  3FZF A;  3NFA A;  5JLH A;  3ZX3 A;  4OGC A;  3J81 O;  2E2O A;  1SL1 A;  5E84 A;  4B3M K;  4OLA A;  1TL3 A;  5HLF A;  2P9P B;  2X6S A;  4BDP A;  1ZBL A;  3D45 A;  3C7N B;  3VOV A;  4EHU A;  4DQP A;  4IKF A;  4E0D A;  4GKK K;  3TAB A;  3PO5 A;  4JKE A;  4XEI A;  3WQU A;  1SL2 A;  1HYV A;  4NYN A;  4DQQ A;  3M8R A;  3CQ8 A;  3PV8 A;  5HP1 A;  3SV4 A;  4WFA L;  4CEO A;  1Z25 A;  4FJL A;  4KRF A;  4CF1 A;  4DSF A;  3EKS A;  3CPW M;  3VTH A;  3DLG A;  3LPT A;  1NK0 A;  3SNN A;  1FW6 A;  1U47 A;  3VGL A;  1Z6R A;  4YDU A;  1TL1 A;  1HJR A;  2D0A A;  3V9S A;  2KLA A;  4DSJ A;  3LM2 A;  1TAQ A;  4FOE A;  1VSE A;  3OYA A;  4AF1 A;  4C1N K;  3VGK A;  4FWN A;  2GV9 A;  4R79 A;  2UUB K;  1MU2 A;  1QE1 A;  3TWH A;  2BTF A;  3AY9 A;  2FF6 A;  2E2N A;  3IFR A;  4CFC A;  4C8N A;  1FXX A;  5AQW A;  3VQ6 A;  3AA2 A;  2ZQB A;  4B9L A;  5EY4 A;  2QWO A;  1HNZ K;  2YV0 X;  3C94 A;  4K25 A;  1S22 A;  2VQE K;  4GV3 A;  4IDK A;  2GUP A;  1DKG D;  4BRO A;  1JLE A;  4BR0 A;  5E41 A;  1VAZ A;  4JYA K;  4PL7 A;  3MK6 A;  1L3U A;  3NE6 A;  2HF3 A;  5J2M A;  3DXM A;  1BIU A;  4CJ7 A;  3D7E O;  1HRH A;  2O8C B;  1E3M A;  3IG1 A;  1W2B M;  3R1X A;  4N41 A;  3O1W A;  2V52 B;  1VQO N;  4JD2 B;  4B1Z A;  3OA9 A;  4B9N A;  4K42 A;  1J6Z A;  3OJU A;  4PKH A;  3C6A A;  4WFB L;  4L8R B;  4A2A A;  4Z4I A;  3HM8 A;  2FBV A;  1LW0 A;  2PFU A;  3HXM A;  4O8U A;  4GMJ B;  4DKW A;  3AVG A;  3SAG A;  3A8Y A;  4ISE A;  4Z4E A;  5AQT A;  2O8F A;  4OPH A;  1RFQ A;  2QI2 A;  3KZB A;  1A5X A;  1GLE G;  3CC4 N;  3K5O A;  4JI1 K;  4DTN A;  3G25 A;  3DM2 A;  4B1V A;  3VQ4 A;  3I56 N;  1U2V A;  1E4G T;  1DTT A;  2UU9 K;  4ELT A;  3O6W A;  4BDZ A;  1YT3 A;  4LC9 B;  5C12 A;  4FJJ A;  4IFE A;  4HUF A;  3O3G A;  2FBX A;  1SL0 A;  3KLI A;  4QAG A;  2VWK A;  3CIP A;  4JK7 A;  4JKG A;  4NB4 A;  3TAN A;  1X1P A;  4I9Q A;  2QWN A;  4HTL A;  2P5G A;  3WXK A;  2Z1H A;  1BI4 A;  4AM7 A;  3M8P A;  4KBO A;  1VQ6 N;  4BRP A;  3M8S A;  3HST B;  3D0P A;  4FZY A;  3P1G A;  1RT7 A;  5DM6 L;  3VQP A;  3N4P A;  4Z4C A;  4C8O A;  2DTU A;  2JLE A;  2E88 A;  4JKB A;  4WQ4 C;  1DTQ A;  4IWV A;  3TAQ A;  1GLJ O;  5JS2 A;  3HO1 A;  1MA9 B;  4U7B A;  4KHW A;  4HUE A;  3QNN A;  4MLH A;  5AQF A;  4I6M B;  4JS5 A;  1S6P A;  3UKR A;  2GX9 A;  3V9Z A;  3C6T A;  3CJC A;  4OVL A;  3CJ7 A;  4DR7 K;  1KCF A;  1KC8 O;  1VQP N;  1S1V A;  5FPN A;  3LWL A;  4KB0 A;  2P1J A;  2ZF5 O;  3AVK A;  1RBU A;  4JV5 K;  3QML A;  1VSD A;  4BRQ A;  3R8E A;  4QS9 A;  3B6O A;  2P9S A;  1B9D A;  3BGR A;  4PWD A;  2NRH A;  3CJ9 A;  4DS5 A;  4IG0 A;  3CHW A;  3CCE N;  4WCE L;  5BPL A;  2HHW A;  2YHW A;  1IBM K;  2NRX A;  4IG3 A;  3VEY A;  3ID8 A;  4MQ3 A;  4AIL C;  3RTV A;  4JRQ A;  4NYF A;  4CFA A;  3HOT A;  3NDK A;  3HPG A;  3FFI A;  3SQ2 A;  1RDA A;  5LY3 A;  4EZ9 A;  3GBT A;  5M1Q A;  1BI4 B;  3SBT A;  1N6Q A;  4CIG A;  1BUP A;  2Q3S A;  3NGY A;  1IJJ A;  3DLE A;  3L2R A;  4CZI A;  4FW2 A;  1MWM A;  2HHH K;  4DQ8 A;  4RW6 A;  1LWF A;  3ALY A;  2YNH A;  3OYK A;  1M90 O;  1ATR A;  3E01 A;  1RTD A;  4H4M A;  2BE2 A;  1RDC A;  2HMI A;  3VQ8 A;  1NM1 A;  3HVT A;  2QTD A;  4FO0 A;  4W5R A;  3R6M A;  1SUQ A;  4GVE A;  4CES A;  4BRD A;  3UIQ A;  4LF7 K;  3I0R A;  4CD1 A;  5CHI A;  4E7L A;  2OTL N;  2YJF A;  2F4V K;  3QER A;  1SZ2 A;  4PY5 A;  5F2R A;  3LP3 A;  1IG8 A;  1S3X A;  1RBR A;  2QWL A;  1DLO A;  3UE5 A;  3AV9 A;  1NJX A;  1NGA A;  1OH7 A;  4JK9 A;  3P5J A;  3DRP A;  2QXL A;  3CCM N;  3CER A;  5C2D A;  3WXM B;  4CJR A;  1NJI O;  2O8C A;  2F9W A;  4B08 A;  4LFA K;  1OKJ A;  1GOA A;  4WQ5 A;  5KQ8 A;  2H3G X;  5I42 A;  1C1A A;  1IG9 A;  4CJF A;  4K41 A;  4NCB A;  3PSF A;  4WF9 L;  5FPE A;  3VQD A;  1P8Z A;  4IFY A;  1ATS A;  3U3Y A;  3RVC A;  1I94 K;  1ZC6 A;  2D0B A;  1WOQ A;  2WON A;  1WAF A;  3J7Y P;  4TSX A;  3JS6 A;  4DWI A;  2HHT A;  2UXB K;  3E1Y A;  2O8B A;  4BQL A;  2YJE A;  2JWK A;  4O0J A;  4CGI A;  3MN6 A;  2HF4 A;  1Q7Y O;  2HBJ A;  4DLG A;  4G1Q A;  1IKY A;  4O5F A;  1BIS A;  5IT9 O;  3D2F A;  4B1X B;  4CK2 A;  1BQN A;  5FRO A;  3SUN A;  3CFO A;  4KHN A;  4BC3 A;  3PLA A;  2X78 A;  2IGI A;  4NXM K;  4O44 A;  2E5L K;  3C0B A;  3HVR A;  5HBM A;  1A5W A;  4DSK A;  4A57 A;  4C8L A;  5HRN A;  2Y1J A;  2X6N A;  3MX5 A;  3OY9 A;  2YCH A;  4BRK A;  3HP6 A;  3AA4 A;  3F9M A;  3VF2 A;  4CZF A;  3LDS A;  3VER A;  3SQ0 A;  4B9V A;  4CIE A;  5FRM A;  3RMD A;  4CJQ A;  2Q97 A;  2QEX N;  5AQU A;  3EZW A;  5KRS A;  5ADX A;  2G8K A;  4BRA A;  1QZ6 A;  3BEX A;  3MXM A;  3D2F B;  3CCL N;  1BL3 A;  1YIJ N;  3R9P A;  4BRL A;  4B9T A;  3AGK A;  1KLM A;  2ASP A;  4FWO A;  1J5E K;  4CJ5 A;  1HQU A;  2B6A A;  4E7I A;  1NKC A;  3AVI A;  3H3N O;  4FLT A;  2ASM A;  4EP4 A;  5CZ1 A;  1N8R O;  2P9S B;  3PY8 A;  1KVA A;  1VSM A;  4CK1 A;  3QEI A;  3MMV A;  4GY2 B;  4DTS A;  3U8X A;  4LFC K;  4FPB A;  4WQ4 A;  2E2Q A;  2HHX A;  4I9L A;  4IFV A;  4M3W A;  3THX A;  3VA3 A;  1NJY A;  5AFU A;  2YNI A;  4CZK A;  2HBK A;  3J80 O;  5GAH P;  1IKX A;  3VEO A;  4CZJ A;  3A5M C;  5AQZ A;  4Q5V A;  1RDB A;  4FM2 A;  2F96 A;  2X74 A;  4K0K K;  4FL9 A;  1C0M A;  4CF0 A;  3E66 A;  3FZL A;  1HQE A;  4YNQ A;  3SV3 A;  4DV1 K;  4FPA A;  2W41 A;  1HMV A;  4LFB K;  1GLF O;  4E7H A;  4YFU A;  3ISN C;  1RNH A;  1NJW A;  1ZBS A;  1VQ5 N;  3OYI A;  1OVQ A;  4RG8 A;  3ZSQ A;  1UA0 A;  4IJA A;  1S6Q A;  2P9P A;  4FWM A;  3AVJ A;  1LWE A;  1XMQ K;  1QTM A;  4Z4H A;  3KTQ A;  4RW7 A;  3D6R A;  4JHD B;  2EHG A;  3TSQ A;  5C0Y A;  3VA0 A;  4H0X B;  4H4O A;  4HHT A;  3VMF B;  4LF4 K;  4QOZ B;  4FW1 A;  1O13 A;  4FVU A;  4PKG A;  4IO8 A;  5AZI B;  3GG4 A;  1YTA A;  3IMX A;  4DR4 K; 
#chains in the Genus database with same CATH homology
 3T3F A;  1LV5 A;  1SL2 A;  1HYV A;  4EZ6 A;  2DY4 A;  4NYN A;  3NH0 A;  4DQQ A;  4FZX C;  3L2Q A;  1RT3 A;  2HNZ A;  5HRP A;  3M8R A;  4CJS A;  3CQ8 A;  3PV8 A;  5HP1 A;  1SKW A;  3SV4 A;  4CEO A;  1Z25 A;  2HNY A;  2A1R A;  5J2N A;  4FJL A;  4CF1 A;  4KRF A;  4CJK A;  1ASV A;  3MEC A;  4DSF A;  3OYN A;  1XC9 A;  3K5M A;  3K59 A;  3DLG A;  3LPT A;  4CFB A;  1NK0 A;  4C8K A;  1TV6 A;  4AHU A;  3SNN A;  1U47 A;  1JLC A;  4J2B A;  1TL1 A;  3VN5 A;  1HJR A;  3RWU A;  2D0A A;  3PUF A;  3V9S A;  3QEX A;  4DSJ A;  4DQS A;  3SQ1 A;  1TAQ A;  2D5R A;  4HUG A;  1VSE A;  1NK7 A;  1NOY A;  3O3F A;  3OYA A;  4F2R A;  3TR8 A;  3L3U A;  3EY1 A;  4FLU A;  4OKK A;  4E19 A;  3ZSZ A;  1HYS A;  1Y97 A;  3AA3 A;  4F2S A;  2GV9 A;  3NGI A;  4DU4 A;  1L3S A;  4E1N A;  4BDY A;  1ZBF A;  4ICL A;  1TKD A;  2IC3 A;  1HPZ A;  1CZB A;  1MU2 A;  1QE1 A;  1ITG A;  1FKO A;  5C25 A;  5KTQ A;  3TWH A;  1KRP A;  4CHP A;  3O4Q A;  4NCG A;  1L3T A;  3VQQ A;  3LPU A;  2YNG A;  2IAJ A;  4JLH A;  3L3V A;  4CFC A;  4C8N A;  2QK9 A;  2LSN A;  1FK9 A;  1FXX A;  1D8Y A;  1EET A;  1RT6 A;  3VQ6 A;  3OYH A;  4K8Z A;  1QS4 A;  1LAW A;  3AA2 A;  2ZQB A;  3SPZ A;  4B9L A;  4BWJ A;  4CF9 A;  3LWM A;  2BGG A;  4QCL A;  3AVN A;  2YV0 X;  2XHB A;  3C94 A;  3DRR A;  5CYM A;  3I8D A;  3QIN A;  4CGF A;  1ZYQ A;  2HHV A;  4CHY A;  4IDK A;  3LAN A;  3HJF A;  1JLE A;  3K5N A;  1RTI A;  2PY5 A;  3S9H A;  5E41 A;  2ZD1 A;  3ZSO A;  4R5P A;  3G10 A;  4CGH A;  5KGW A;  3K5L A;  1BQM A;  3NE6 A;  1J9A A;  1N5Y A;  1L3U A;  3RRG A;  5T7B A;  5J2M A;  3VQ9 A;  4CFD A;  1BIU A;  3LP1 A;  3NH1 A;  1C0T A;  1IKV A;  1HRH A;  3ULD A;  1GOC A;  3IG1 A;  1QSL A;  3CFP A;  4N41 A;  1S1X A;  4CEF A;  4B3O A;  5J2P A;  2BDP A;  2ITG A;  2Z1J A;  3SI6 A;  2OZM A;  4JRP A;  3AO3 A;  2G8W A;  3LZI A;  2P51 A;  3OS2 A;  4B9N A;  4KFB A;  2A1S A;  1S5J A;  3OJU A;  3RR8 A;  2KFN A;  1SKS A;  1EP4 A;  1X9W A;  3AVM A;  1R0A A;  4L8R B;  4DTP A;  1SV5 A;  3P83 D;  4J2E A;  4Z4I A;  3SUQ A;  1T8E A;  5KI6 A;  1HYZ A;  2FBV A;  1LW0 A;  1WSF A;  5SWM A;  3HXM A;  4KTZ A;  4ELV A;  4I2P A;  4E89 A;  1CZ9 A;  4GMJ B;  1JLA A;  4ID5 A;  2ETJ A;  3AVG A;  4Z4E A;  3OYL A;  3K57 A;  4N5S A;  1XI1 A;  1WAJ A;  1A5X A;  4DTR A;  1W9H A;  3KKS A;  3LP2 A;  3HM9 A;  2XY8 A;  4CJT A;  2G8F A;  2G8U A;  3DOL A;  3K5O A;  4DTN A;  3AVH A;  5HRR A;  4BWM A;  3QES A;  4KPY A;  3DM2 A;  3VQ4 A;  1WSG A;  2YKM A;  2Z1I A;  1DTT A;  2KTQ A;  3KKR A;  4E7K A;  2OPQ A;  3CG7 A;  3NHG A;  4ELT A;  5C42 A;  3KK2 A;  3IAY A;  3NF7 A;  3ZT2 A;  4BDZ A;  1TAU A;  3TAF A;  1YT3 A;  1BCO A;  4IBN A;  4FJJ A;  3H08 A;  3V1R A;  1BCM A;  2KQ2 A;  3WNH A;  4HUF A;  3OS0 A;  4DTU A;  3O3G A;  3OYC A;  2FBX A;  2VG5 A;  4DF4 A;  3KLI A;  4QAG A;  1SL0 A;  1QHT A;  2HW3 A;  4DMN A;  4LSL A;  2BAN A;  2VWK A;  4FLX A;  2KFZ A;  3NF8 A;  3HT3 A;  3MXI A;  3TAN A;  4O55 A;  1X1P A;  3TAM A;  3OYF A;  1IH7 A;  4FLV A;  4KV8 A;  3ZSW A;  4BE1 A;  4FM1 A;  2P5G A;  2IS3 A;  2Z1H A;  1NJZ A;  4I9Q A;  1BI4 A;  1J54 A;  3M8P A;  1KVC A;  1VSH A;  4KI6 A;  2DFF A;  4RW8 A;  1U4B A;  3M8S A;  3HST B;  4E1M A;  4OPK A;  3D0P A;  4HTU A;  4FZY A;  3V9U A;  4FJX A;  3P1G A;  1RT7 A;  2RN2 A;  4DFK A;  3ZT0 A;  4DG1 A;  5C24 A;  4FLZ A;  4DF8 A;  3G0Z A;  3VQP A;  3OYG A;  1S9G A;  1UWB A;  2FBY A;  4N47 A;  3ZT4 A;  4Z4C A;  5SZT A;  4HCC A;  3SJJ A;  4C8O A;  2DTU A;  2XO7 A;  4F3T A;  4M3T A;  2JLE A;  4LH4 A;  1QSY A;  3DLH A;  1DTQ A;  3MEE A;  3TAQ A;  1ASW A;  4AHR A;  1K6Y A;  1BIZ A;  4BE0 A;  1O1W A;  5JS2 A;  3HO1 A;  3O4N A;  4ZHR A;  4GVM A;  4W5O A;  3I0S A;  3CFR A;  2G8H A;  4W5Q A;  4BE2 A;  1BHL A;  4DTM A;  2DFH A;  3F73 A;  4C8M A;  3OYB A;  3VQB A;  4HUE A;  3QNN A;  2FBT A;  1NKB A;  4FJK A;  2AJQ A;  4Y1D A;  3ZSR A;  2Y1I A;  1RT1 A;  4WE1 A;  1S6P A;  3L8B A;  4JS5 A;  3DYA A;  1D5A A;  4ID1 A;  3V9Z A;  2P5O A;  3C6T A;  3VQ7 A;  3TAG A;  3KK3 A;  3T1A A;  4ZTJ A;  4OVL A;  2XY5 A;  2OA8 A;  5JS1 A;  2JGU A;  1ZBU A;  4M45 A;  3DMJ A;  4HVJ A;  2HVI A;  1KCF A;  3AO4 A;  5CZ2 A;  3DI6 A;  1S1V A;  3LWL A;  3V9W A;  3PX6 A;  4KB0 A;  2P1J A;  1RDD A;  3EYZ A;  3NBP A;  3AVK A;  1C0U A;  1RBU A;  2YKN A;  3QIP A;  1ASU A;  3ZCM A;  1B92 A;  4FJ9 A;  4DSE A;  3WNG A;  2NUB A;  1VSD A;  4CGG A;  1RTJ A;  4NCA A;  1VSJ A;  4KHU A;  3VQE A;  1WN7 A;  1L5U A;  3B6O A;  1KFS A;  1NKE A;  1RCH A;  4DQR A;  1B9D A;  3BGR A;  4H8K A;  3OYM A;  4PWD A;  4M42 A;  1RT2 A;  2F8S A;  4CJ4 A;  1D9D A;  3V81 A;  2XY7 A;  4RW9 A;  1RT5 A;  4DS5 A;  4IG0 A;  4CJP A;  3QEW A;  4FK2 A;  3QO9 A;  4AHT A;  4CHO A;  3M8Q A;  4FJN A;  4DFM A;  2HHW A;  2W42 A;  3QEP A;  3SYZ A;  1QSS A;  4IG3 A;  3HPH A;  4FVM A;  3VQA A;  4MQ3 A;  4OJR A;  4AIL C;  4CJ3 A;  4JS4 A;  2E4L A;  3VQ5 A;  4DSL A;  4FJM A;  3RTV A;  4HCB A;  2R7Y A;  1F21 A;  3ZSY A;  4JRQ A;  4M3X A;  4NYF A;  4CFA A;  3L2W A;  3QNO A;  3IRX A;  3NDK A;  5HRS A;  4FJ5 A;  3HPG A;  3FFI A;  3SQ2 A;  3SCX A;  1RDA A;  3AO1 A;  1S9E A;  1KLN A;  2OYQ A;  4EZ9 A;  5CY4 A;  3QET A;  1BI4 B;  4O5B A;  1N6Q A;  4CIG A;  3LAM A;  1JKH A;  3NH2 A;  1VK0 A;  3EZ5 A;  2Q3S A;  3NGY A;  4CEA A;  1XHX A;  1L3V A;  3OVN A;  3DLE A;  1C1C A;  3L2R A;  4OLB A;  1VRT A;  1IO2 A;  4FW2 A;  2HVH A;  4FK0 A;  3DLR A;  1KVB A;  4PUO A;  1T03 A;  3LP0 A;  1TGO A;  3CYM A;  4RW6 A;  1LWF A;  3RMB A;  3IS9 A;  3THV A;  3AO5 A;  4CHQ A;  3ALY A;  3KD1 E;  2RPI A;  4I2Q A;  4LSN A;  2YNH A;  3V1Q A;  4UQG A;  1NK5 A;  1KTQ A;  1VSF A;  2IOC A;  2QXF A;  4RW4 A;  3OYK A;  5DMR A;  3TAR A;  5D3G A;  1C6V A;  3E01 A;  1RTD A;  1LW2 A;  1A5V A;  4H4M A;  1NOZ A;  3NCI A;  2BE2 A;  1RDC A;  2HMI A;  2VG7 A;  2EX3 A;  3ZSV A;  4KTQ A;  3VQ8 A;  3HVT A;  4CF8 A;  4FYD A;  3DLK A;  2VWJ A;  4W5R A;  1C1B A;  1Z26 A;  2B5J A;  4CK3 A;  5J2Q A;  4KHW A;  1WNS A;  3ITH A;  1SUQ A;  5KRT A;  4PQU A;  1FKP A;  2PYJ A;  4M3R A;  4CES A;  1CXQ A;  1TKT A;  4CHZ A;  3UIQ A;  3I0R A;  3AVB A;  3NF9 A;  2OPS A;  4M3Z A;  2OPR A;  2G8I A;  4E7L A;  3HL8 A;  3O3H A;  3QER A;  4OPJ A;  4PY5 A;  3KJV A;  1JLG A;  1JXE A;  3LP3 A;  4FZZ A;  1JLQ A;  3QLH A;  4AHV A;  4B8A B;  1IKW A;  1RBR A;  3OYJ A;  2XY6 A;  3C6U A;  1DLO A;  3AV9 A;  1NJX A;  4E3S A;  3HPO A;  2G8V A;  2O4I A;  2O4G A;  3P5J A;  4DSI A;  3HK2 A;  3DRP A;  4CGJ A;  3VQC A;  4CJR A;  1U48 A;  4W5T A;  1NK9 A;  4DFP A;  4B08 A;  3KK1 A;  1TK5 A;  4K8X A;  3K58 A;  1GOA A;  4FM0 A;  2E6L A;  2RKI A;  1TKX A;  3SUP A;  3MXJ A;  1RBS A;  4N56 A;  4DQI A;  2HHQ A;  4KHS A;  5I42 A;  4CJE A;  1C1A A;  1IG9 A;  4CJF A;  3U6F A;  1CXU A;  2RF2 A;  2ZE2 A;  4NCB A;  1SKR A;  3JYT A;  5FDL A;  3VQD A;  1I3A A;  4XIU A;  4IFY A;  3U3Y A;  4KKO A;  4GW6 A;  3LZJ A;  1JLB A;  4FJH A;  2D0B A;  4B9U A;  5EU7 A;  1EX4 A;  1WSI A;  3KD5 E;  2WON A;  1WAF A;  1X9M A;  3V1O A;  1G15 A;  4TSX A;  4DWI A;  2HHT A;  4J2A A;  1S1T A;  4DS4 A;  1RT4 A;  1WSJ A;  2XRI A;  3SZ2 A;  4CE9 A;  3RRH A;  4LD0 A;  3RMA A;  1KFD A;  4O0J A;  4CGI A;  4CER A;  2E6M A;  1ZBI A;  2I5J A;  2PYL A;  4CJL A;  3MEG A;  1XHZ A;  4DLG A;  4G1Q A;  1IKY A;  4FJG A;  3ZSX A;  4CJV A;  4DTJ A;  1BIS A;  4FLY A;  4KB1 A;  1NK6 A;  4CK2 A;  1BGX T;  1BQN A;  2DFE A;  4AHS A;  5FRO A;  1GOB A;  2D0C A;  3AO2 A;  3ASM A;  3OYE A;  3DOK A;  3SUN A;  3CFO A;  4KHN A;  3K2P A;  1EXQ A;  2X78 A;  3S3O A;  2IGI A;  3DLB A;  3RR7 A;  4O44 A;  4KAZ A;  3L2V A;  4CHN A;  3AVL A;  1UOC A;  3HVR A;  3KLH A;  5HBM A;  4KRE A;  1S1W A;  1A5W A;  3C95 A;  4OGE A;  3V6D A;  3PX0 A;  4DSK A;  3NF6 A;  4F4K A;  2HHU A;  3T19 A;  4C8L A;  1JL2 A;  1CLQ A;  3S3N A;  4F3O A;  2PZS A;  1ZBH A;  3V4I A;  4B9S A;  5HRN A;  2Y1J A;  1QQC A;  1RBT A;  1WSE A;  2X6N A;  4CF2 A;  1J53 A;  2B4J A;  4DU3 A;  3U3G A;  4LY7 A;  4B8C A;  2HHS A;  3SPY A;  2KW4 A;  2OZS A;  3OY9 A;  3KLF A;  3PX4 A;  3HP6 A;  4CCH A;  4DFJ A;  3AA4 A;  2IDO A;  4FJ7 A;  1JLF A;  3A2F A;  2WOM A;  1REV A;  3LDS A;  2KZM A;  3SQ0 A;  1J5O A;  3PY8 A;  1X9S A;  4B9V A;  4CIE A;  1YTU A;  1NK8 A;  1B9F A;  5FRM A;  4FLW A;  3RMD A;  1W0H A;  3KLG A;  4ZTF A;  4KO0 A;  4CJQ A;  3KIO A;  1T05 A;  4O4G A;  3TAE A;  3NAE A;  4ELU A;  5KRS A;  4FJ8 A;  2G8K A;  3B6P A;  3MED A;  3NGZ A;  4CEZ A;  1VSI A;  4W5N A;  3MXM A;  1YVU A;  4DLE A;  1BL3 A;  4N76 A;  4FJI A;  3ZT3 A;  4CEB A;  4B9T A;  3BDP A;  2ATQ A;  1KLM A;  3CM5 A;  3HYF A;  4Z0U A;  3SUO A;  4CEE A;  2QKK A;  3LAK A;  4KHQ A;  3OJS A;  4CJ5 A;  1HQU A;  2B6A A;  4E7I A;  1TK8 A;  1NKC A;  1Q8I A;  2VG6 A;  3AVI A;  3WNE A;  4FLT A;  1LWC A;  4EP4 A;  3HP9 A;  3PO4 A;  3QIO A;  5FRN A;  1U04 A;  3AVA A;  2HB5 A;  3KLE A;  4FCY A;  1JL1 A;  5CZ1 A;  2HND A;  3TI0 A;  1KVA A;  1VSM A;  1XWL A;  2YHA A;  4CEQ A;  2Z1G A;  4CK1 A;  2OPP A;  4DTS A;  3QEI A;  1D9F A;  3V9X A;  2QKB A;  2HHX A;  4DTO A;  4I9L A;  4IFV A;  4PA1 A;  4M3W A;  4OKE A;  2GBZ A;  4DU1 A;  1UA1 A;  1NK4 A;  3VA3 A;  1S1U A;  5KGX A;  1NJY A;  1UAX A;  1RBV A;  4M3Y A;  3AVC A;  2YNI A;  4F8R A;  1U49 A;  4LH5 A;  3MAQ A;  1RIL A;  1HNI A;  4J2D A;  3JSM A;  1IKX A;  5HRO A;  1I39 A;  2YHB A;  1WSH A;  4MFB A;  3AA5 X;  1LAV A;  4OKJ A;  1RDB A;  4Q5V A;  4FM2 A;  1TKZ A;  4Z4F A;  1HNV A;  4EP5 A;  2F96 A;  4Z4G A;  3S3M A;  2X74 A;  2KZZ A;  1C0M A;  4Q0B A;  4CF0 A;  1HQE A;  1WLJ A;  5K14 A;  4CEC A;  4YNQ A;  3SV3 A;  1VSK A;  5I3U A;  4M41 A;  1Q9Y A;  4FXD A;  4CGD A;  2GUI A;  1U45 A;  1HMV A;  3DRS A;  1JXB A;  4DTX A;  1KSP A;  4I7F A;  4E7H A;  4YFU A;  4M3U A;  5DK5 A;  3ISN C;  1RNH A;  1NJW A;  3AVF A;  2F8T A;  1TVR A;  3WNF A;  4KHY A;  3OYI A;  1VRU A;  4FK4 A;  4RG8 A;  1VSL A;  3ZSQ A;  4AHC A;  4BAC A;  3RMC A;  1UA0 A;  1T7P A;  3QEV A;  3F9K A;  1S6Q A;  3CM6 A;  4KI4 A;  3AVJ A;  3NFA A;  1LWE A;  3ZT1 A;  4E7J A;  4KTW A;  2FC0 A;  4OGC A;  1QTM A;  4Z4H A;  4O0I A;  3KTQ A;  4RW7 A;  4CIF A;  4AH9 A;  2EHG A;  3L2U A;  3TAP A;  1SL1 A;  3OYD A;  2YNF A;  4Y1C A;  3SQ4 A;  3VA0 A;  1TL3 A;  5HLF A;  4H4O A;  4HHT A;  4OLA A;  2X6S A;  5J1E A;  1ZBL A;  4CJW A;  1Q9X A;  3D45 A;  4BDP A;  4QOZ B;  4FW1 A;  1TK0 A;  4CED A;  4CJU A;  4DQP A;  4IKF A;  4E0D A;  5CYQ A;  3TAB A;  3PO5 A;  1EKE A;  1RTH A;  1YTA A;  3LAL A;  3OS1 A;  4B9M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...