2IOCA

The crystal structure of trex1 explains the 3' nucleotide specificity and reveals a polyproline ii helix for protein partenring
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
230
structure length
218
Chain Sequence
TLPHGHMQTLIFLDLEATGLPSSRPEVTELCLLAVHRRALENQGHPPPVPRPPRVVDKLSLCIAPGKACSPGASEITGLSKAELEVQGRQRFDDNLAILLRAFLQRQPQPCCLVAHNGDRYDFPLLQTELARLSTPSPLDGTFCVDSIAALKALEQASKSYSLGSIYTRLYWQAPTDSHTAEGDVLTLLSICQWKPQALLQWVDEHARPFSTVKPMYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Three prime repair exonuclease 1
publication title The Crystal Structure of TREX1 Explains the 3' Nucleotide Specificity and Reveals a Polyproline II Helix for Protein Partnering.
pubmed doi rcsb
source organism Mus musculus
total genus 68
structure length 218
sequence length 230
chains with identical sequence B
ec nomenclature ec 3.1.11.2: Exodeoxyribonuclease III.
pdb deposition date 2006-10-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2iocA01
4CGDA 3ULDA 4K8XA 3V9UA 5J2NA 3VQ4A 4DTNA 4M41A 3AO2A 3LP2A 3QIPA 3V9XA 1SL1A 4E1MA 4M3TA 5HLFA 1W0HA 4JRPA 4KB0A 4OGCA 4E0DA 3NCIA 4CJLA 3DI6A 3OYIA 3NF6A 4F8RA 5C24A 2X78A 4KPYA 3AVAA 1RTHA 4OVLA 2OPRA 2B5JA 4DTRA 3KK1A 4NCGA 2G8VA 4M45A 2BE2A 4CGJA 4I2QA 3VQCA 3V9SA 1KFDA 4ID1A 4OLAA 4G1QA 4QAGA 4B9NA 4Q0BA 1QE1A 1RT6A 4W5QA 3NE6A 1NKEA 2D0BA 2KW4A 4BWMA 4B9LA 1TK8A 2ZD1A 3NH2A 1UWBA 4FJ9A 3ZT3A 4OPKA 4IFVA 1BISA 1N6QA 4N47A 2XO7A 4BDYA 3AVCA 1IKYA 3M8SA 4FLUA 3NGZA 4F2RA 2HHUA 4I9QA 1C1CA 1LWFA 4CEFA 3RMBA 3VQ7A 3SQ0A 3DOKA 1BL3A 3VQ8A 4KRFA 1G15A 1LW2A 4B9TA 3NF7A 2F8TA 4QCLA 3VQDA 3KJVA 1SL0A 4CESA 4C8OA 4B3OA 3HYFA 3ZSZA 3U6FA 4CJVA 2GBZA 4CJWA 3KLGA 1RNHA 4FYDA 5KGXA 3PO5A 1U4BA 3M8PA 3L2WA 3LWLA 4KHWA 4JS4A 3SUNA 1WSEA 1CZ9A 5CY4A 4CHOA 3HM9A 4M3RA 3PY8A 4Z0UA 3VN5A 3OS1A 4J2BA 4DSIA 1L5UA 3I0RA 2G8HA 1U47A 4TSXA 3UIQA 2AJQA 3T1AA 3K57A 4J2AA 4CK2A 4PA1A 1Z26A 4E7HA 4Z4HA 4B9UA 3KD5E 3SQ2A 4F3OA 4F2SA 3WNHA 3T3FA 3HVRA 1IKWA 3G0ZA 4JS5A 4CFCA 1Z25A 4DF4A 3QESA 1RT7A 1GOBA 4CEAA 4CJTA 4CJRA 3F9KA 1ZBUA 5K14A 3OYMA 4Q5VA 4XIUA 3L2QA 4DWIA 1TK0A 1VSFA 1RDAA 4C8LA 4E7JA 1RT2A 4NCAA 1BCMA 4CJ4A 4DS5A 5D3GA 3C6UA 4WE1A 3V1RA 4DQQA 1BQMA 1TL3A 4DFJA 4DU3A 2YNFA 4I9LA 1XC9A 1U04A 2YNIA 1A5VA 4KHSA 1JLGA 1KCFA 4KV8A 3OYGA 1HYZA 2VG7A 3CYMA 3OYFA 3VA0A 1UA1A 4B9VA 2YKMA 2D5RA 2HHSA 5DK5A 2Q3SA 1X9SA 1QHTA 3AVBA 3G10A 2G8FA 2DTUA 1NK0A 4GMJB 4LY7A 4B9SA 4KKOA 4CJKA 2KZZA 3ZCMA 3PX4A 1NK8A 1XHXA 3KIOA 3VQ9A 2JLEA 3AA5X 3RRGA 3KK2A 2X74A 3NFAA 3NAEA 3S9HA 3LALA 3HPHA 4CGFA 4M3YA 4CF2A 1JL1A 3B6OA 4DQIA 4DQPA 3O4QA 4Y1DA 3KLHA 4CEBA 1SV5A 3SV4A 3QETA 3IG1A 1B92A 3PUFA 1D9FA 1J5OA 4IFYA 3HT3A 4CCHA 3WNFA 4DSEA 2HNYA 3S3OA 4DSKA 4FZZA 1KFSA 3LAMA 4Z4FA 4BE0A 3FFIA 4ELVA 3A2FA 2E6LA 3HVTA 1K6YA 4O4GA 4FM0A 4FM2A 4ZTFA 3L3VA 2I5JA 4CHNA 1EETA 2RKIA 3AO4A 1CLQA 4I2PA 4OJRA 3MXMA 2O4GA 4CIGA 3OYDA 1Q9XA 4HCBA 1ASVA 4CECA 1C1AA 1QQCA 4KI6A 3RR7A 2XY5A 4BE1A 4GW6A 1HRHA 1VSKA 3DLEA 4LSLA 1S5JA 1S6PA 3VQQA 2VWJA 3DMJA 1UA0A 3E01A 4CFAA 5KRSA 3HK2A 5HRSA 4PUOA 1NK5A 4BE2A 2IAJA 4EZ6A 3V9WA 1CXQA 4MQ3A 1X1PA 4FJXA 4FK4A 5FRNA 4BDPA 4C8MA 1LWCA 4IBNA 4ELTA 2D0CA 4AILC 5HP1A 1EX4A 1L3SA 4CEEA 3L2VA 1EXQA 2YNHA 1BIZA 3DM2A 1ZBFA 3LP1A 5EU7A 3OYHA 3HP6A 4DQRA 4DSFA 3CFPA 4M42A 2FC0A 3KLIA 2ATQA 1RBUA 2G8KA 3SUQA 4AHTA 4FJLA 3AO5A 4IDKA 3IRXA 3EY1A 2WONA 3CFOA 3M8QA 3TAFA 1UAXA 3V1OA 1JXEA 1L3UA 1ZYQA 2X6SA 4O0JA 1C6VA 3AVHA 3AVJA 5CZ1A 4E89A 1A5XA 1EP4A 1HYVA 5HBMA 3VQBA 3QNNA 1JLFA 4JLHA 3THVA 5J2QA 1JLEA 2VWKA 2P1JA 4DTXA 2Y1IA 1YTUA 4W5NA 1RBRA 2IC3A 4CHPA 3C6TA 4RW7A 3NH0A 3OY9A 1TK5A 4DTMA 3L3UA 4O5BA 3CFRA 3PX0A 1BI4B 3AVLA 4HUEA 3AVFA 2YHAA 3C95A 3IS9A 1WSIA 3OYBA 1JLQA 1QTMA 4HCCA 4CGHA 3S3MA 4RW4A 3TABA 4O55A 3C94A 4K8ZA 2DY4A 3QEXA 4FJ5A 5SWMA 2ITGA 1RT3A 1YVUA 3JSMA 2PYJA 2HHWA 2ETJA 1W9HA 4QOZB 2HNDA 3ZT4A 4RW8A 2P51A 4KTZA 3V81A 2YNGA 4B8AB 3OS0A 5CYQA 1WLJA 1KTQA 1RDDA 1WAFA 5JS2A 4Z4CA 1JL2A 4OKEA 2PYLA 4W5TA 1VRUA 1SKWA 1S6QA 3K2PA 3HL8A 4AHRA 4DF8A 4AHVA 4CEDA 4BDZA 4DTUA 3NH1A 1RT5A 2OPPA 1NKBA 2IOCA 1JLAA 4NCBA 2Z1HA 3O3HA 1T7PA 1KVBA 4MFBA 1Y97A 2GUIA 1ZBLA 4E7KA 4FZYA 2ZE2A 4CF0A 3K5OA 4DTSA 1RTDA 3NBPA 3AVIA 3TR8A 1RT1A 3DLKA 3VQAA 1REVA 4E7LA 3OYJA 2FBYA 3KLFA 1JLBA 4KFBA 3SQ1A 4M3UA 3CQ8A 2G8WA 1WNSA 4M3WA 4LSNA 4CJSA 1HYSA 3NHGA 3MAQA 4N76A 1HJRA 4DSJA 1KLNA 3LDSA 2NUBA 3LPUA 3AA3A 5J1EA 3SPZA 4KHQA 4CJEA 2HVHA 2OPSA 3ZSRA 5DMRA 4HTUA 4C8KA 2OZSA 1C0MA 5FDLA 3KKRA 1BIUA 4FK0A 2HHVA 3ZSYA 3H08A 1L3VA 1D8YA 4N56A 2HNZA 2FBTA 1SKRA 3ALYA 3OYKA 3QEPA 4OKJA 1RDBA 3QNOA 1TL1A 4OPJA 3TARA 4ELUA 2BGGA 3LP0A 4YFUA 4FLWA 3ITHA 3LPTA 1VRTA 4CIEA 2QXFA 2O4IA 1KVCA 5CZ2A 1FKPA 3HJFA 4CFBA 4CF8A 4CEOA 4KTQA 4CJFA 4CJQA 4EZ9A 1VSMA 1RCHA 1S9GA 3PV8A 3RWUA 1QSSA 2OA8A 1VSHA 3I8DA 3SPYA 2GV9A 1RTJA 3T19A 3OYAA 2G8IA 4CHYA 1TAUA 4FLXA 2WOMA 3BGRA 3DRRA 1J53A 2RF2A 1LAWA 1FKOA 4DU4A 4DMNA 2KQ2A 1BGXT 4KHNA 2IGIA 1S1UA 1KLMA 3HPOA 1A5WA 4M3XA 1I3AA 3QINA 3PX6A 5KTQA 4FJGA 2XRIA 1QSYA 4DU1A 3OVNA 3DRSA 4H8KA 3D45A 4CIFA 1L3TA 4HUFA 2OZMA 2QK9A 3EYZA 3AA2A 4EP5A 2R7YA 1IG9A 3RR8A 4B9MA 4CEZA 2IS3A 3QEIA 4FLYA 1DTTA 4FJ7A 5E41A 4DTOA 4O0IA 2F8SA 1C0UA 3MECA 3HSTB 3QEWA 1D9DA 3ZSVA 5SZTA 2KTQA 1HPZA 2FBVA 1XWLA 4W5OA 2HB5A 3M8RA 3OYNA 1GOAA 4F4KA 1S1TA 1DLOA 4DQSA 1JLCA 4FW1A 4KO0A 4LH5A 4KHUA 4FLZA 4DS4A 5T7BA 3V4IA 2IDOA 2XY8A 4DLEA 1BCOA 4Y1CA 4CJ5A 4RW6A 1RDCA 4RW9A 4BWJA 1BHLA 1WN7A 4H4MA 4PQUA 2VG6A 3B6PA 3QO9A 3AV9A 5HRPA 2XY6A 1U48A 3CM5A 4KB1A 1CZBA 1QS4A 2BANA 3V1QA 3K5NA 4ID5A 3OS2A 3SQ4A 4Z4EA 2E4LA 3KLEA 1X9MA 4AH9A 3D0PA 3TAPA 1RBVA 4B08A 1TV6A 3KK3A 1RBTA 2Z1GA 1R0AA 5FRMA 2QKBA 3MXJA 4NYFA 4IG0A 3DLBA 3RMDA 2DFFA 1S9EA 4CK1A 3P83D 3OJSA 4CK3A 4JRQA 1D5AA 3SUOA 3DYAA 4FW2A 4FCYA 3ZSQA 3AVKA 3LWMA 3SYZA 3SUPA 2HVIA 4FJ8A 4HHTA 3MEEA 1N5YA 3TAQA 4ICLA 4R5PA 1Q9YA 3BDPA 4AHUA 4KAZA 1TKTA 1YTAA 4HVJA 3HPGA 3EZ5A 2PY5A 1IH7A 1LAVA 3NF9A 4CGGA 3WNGA 3OJUA 4DLGA 5I3UA 3ZSXA 1C1BA 5KGWA 1HQUA 2HHXA 4F3TA 3SNNA 4FZXC 3KKSA 1HQEA 3MEDA 4H4OA 1T03A 1IKVA 2JGUA 1IKXA 5C25A 1KVAA 1VSJA 4FLTA 4CERA 4KI4A 1TAQA 4OGEA 2W42A 1NK7A 5J2MA 3NF8A 3WNEA 3F73A 1NK9A 4CFDA 3SV3A 2YHBA 4N5SA 4KTWA 4CEQA 1SKSA 2YKNA 3ASMA 4CJUA 3AVMA 3OYEA 1T8EA 5CYMA 4FJJA 3ZSOA 3HO1A 3V9ZA 1ZBHA 2DFHA 3KD1E 3K5LA 4ZTJA 1I39A 1Q8IA 2F96A 4EP4A 3PO4A 2KFZA 1HNVA 4O44A 1LW0A 4Z4IA 4CJ3A 1S1WA 1XHZA 1WSFA 4OKKA 4FM1A 1B9DA 3SJJA 5JS1A 1XI1A 1JKHA 4DG1A 2EHGA 3OYCA 2Z1IA 1MU2A 3ZSWA 2HMIA 5C42A 3DLRA 1HMVA 3OYLA 2G8UA 3MXIA 4C8NA 1ASWA 2KFNA 1NK4A 1J9AA 3TAEA 2A1RA 1NK6A 2OYQA 4CGIA 1TGOA 4GVMA 4FJKA 3P5JA 1CXUA 1NOZA 2RPIA 5HRRA 1TKXA 4CHQA 5J2PA 2KZMA 2RN2A 3IAYA 1C0TA 1WAJA 3NGYA 3VQ6A 3VQ5A 4FJHA 4FXDA 3TAGA 1NJXA 3P1GA 2YV0X 1GOCA 1U49A 1FXXA 4LH4A 3ZT1A 2E6MA 1RT4A 1J54A 3DLGA 2PZSA 4FJIA 1ITGA 4HUGA 3NDKA 3QERA 4RG8A 3L2RA 1WSJA 3O3FA 5FROA 1NJYA 4PWDA 1WSGA 1KRPA 1KSPA 4IG3A 4B8CA 2ZQBA 4PY5A 4CF1A 3ZT0A 4CF9A 3VA3A 1LV5A 4FVMA 4AHCA 1T05A 3TANA 1EKEA 1TKDA 1O1WA 3L2UA 2Z1JA 1U45A 1RBSA 4UQGA 2VG5A 4DTJA 4DFMA 1VSIA 4E19A 2LSNA 4ZHRA 3LANA 5HRNA 4M3ZA 1WSHA 3VQEA 3L8BA 5I42A 2HHTA 4KHYA 4L8RB 4DTPA 3O4NA 4OLBA 3QIOA 3QLHA 1NJZA 3HP9A 4FK2A 4BACA 2X6NA 3JYTA 3O3GA 2HW3A 4J2EA 2FBXA 2D0AA 1VSDA 3LZJA 1X9WA 3RMCA 1YT3A 1FK9A 1TKZA 1VSLA 3KTQA 1S1XA 4AHSA 3U3YA 3MEGA 4CE9A 3SI6A 2QKKA 1B9FA 1VK0A 4DSLA 3VQPA 2B4JA 4NYNA 3K59A 3RTVA 4Z4GA 2A1SA 3AO3A 5HROA 3AVGA 1LWEA 1SL2A 3ISNC 3K5MA 1NOYA 2XHBA 3K58A 1TVRA 1QSLA 1ASUA 3AA4A 4E3SA 1BQNA 4FJNA 1RTIA 4CJPA 3S3NA 3DRPA 2HHQA 1SUQA 3SCXA 4I7FA 5KRTA 3DLHA 3U3GA 4DFKA 3V6DA 1DTQA 5KI6A 3SZ2A 1NJWA 1UOCA 3AVNA 3DOLA 2P5OA 4E7IA 4IKFA 4J2DA 4YNQA 4LD0A 4FJMA 1IO2A 3NGIA 1F21A 3TAMA 3AO1A 2XY7A 2DFEA 4E1NA 3QEVA 1S1VA 3CM6A 3HXMA 2B6AA 3I0SA 4CHZA 4DFPA 3TWHA 1ZBIA 2EX3A 2OPQA 1RILA 3LAKA 3LP3A 4FLVA 1HNIA 2Y1JA 3CG7A 3RRHA 2P5GA 4N41A 4KREA 3ZT2A 1NKCA 1JXBA 3LZIA 4W5RA 2BDPA 3RMAA 1BI4A 3TI0A 1VSEA
chains in the Genus database with same CATH superfamily
4CGDA 4BQZA 3V9UA 2ZJRL 2HBJA 4M3TA 4OGCA 4NO7A 3OYIA 2P9IA 3NF6A 4KPYA 3FZLA 1JJ2M 2G8VA 5GIPA 1KFDA 1WBDA 4DR6K 1QE1A 5TKWA 4W5QA 3PLAA 4B1UB 3CJ7A 3P4IA 1TK8A 4GV6A 4OPKA 4N47A 4Z94A 1HX1A 4H5WA 4I9QA 3RMBA 4IFEA 4CEFA 1VQLN 3VQ8A 1BA0A 1GLEG 1LW2A 4QCLA 1WOQA 4K43A 5C2FA 4B3OA 3HYFA 3U6FA 2BTFA 4B1ZA 1U4BA 3LWLA 1X3NA 2A42A 4M3RA 2HBLA 1NBWA 3OS1A 1K9MO 4ISEA 2FSNA 4CZLA 3O5BA 5AFUH 4E7HA 4Z4HA 4M7XA 3ID6A 4F2SA 5H1SQ 3WNHA 3D7EO 1IKWA 3HVRA 2IVOA 3FZFA 5K14A 1TK0A 1RDAA 4WYBA 3ENBA 4C8LA 2YX6A 5F1XA 4BREA 3C6UA 2FSJA 2JWKA 3THWA 1XC9A 2HF4A 2VG7A 4KBOA 3CYMA 5BR9A 1QHTA 3AVBA 4WQ5A 4LY7A 3VEOA 3WQUA 3ZCMA 3S9HA 3NFAA 4UY8O 5GAEP 3J80O 3U8XA 3IG1A 3PUFA 4CCHA 4FZZA 2JWLA 4BE0A 4DCHA 3HVTA 3SAGA 3L3VA 4JI3K 3AO4A 4I2PA 1HNWK 1Q9XA 4CECA 3RR7A 3VTHA 3O08A 1HRHA 4LSLA 1S5JA 3VQQA 3DMJA 4WQ4A 4BRQA 4CFAA 5KRSA 3HK2A 1U2VB 5AQTA 3C7NA 3L4IA 4FJXA 5FRNA 4C8MA 4ILJA 3L6QA 2D0CA 5HP1A 1EX4A 1L3SA 4H0OA 2QW9A 3ENOA 3VETA 2EWSA 4DR4K 2YNHA 1BIZA 4DQRA 3HI0A 2G8KA 4FJLA 4DKWA 4IDKA 3SJHA 3CFOA 4MLEA 3OA9A 3MWPA 3T7ZA 2X6SA 2QA4N 3QBXA 3AVHA 3AVJA 5CZ1A 2O8FB 1A5XA 1EP4A 3J7ZO 3ZX2A 1J5EK 4DTXA 3C6TA 4RW7A 1Z6RA 4JKDA 3OY9A 3UE5A 3L3UA 4O5BA 5E84A 1KAXA 1VQ6N 2Q0UA 3EE9A 4CGHA 4O55A 2DY4A 3DXMA 3D2FB 3K9JA 2QTDA 4C23A 2ZJQL 2HHWA 4FWNA 2WFBA 2ETJA 1W9HA 2O8CB 3WEEB 2Q36A 2YNGA 3OS0A 5CYQA 1WLJA 5JS2A 5FPDA 3WUHA 4W5TA 5BR8K 4X66K 4YOVA 3HTVA 4AHVA 1NGHA 1RT5A 1NKBA 2IOCA 2Z1HA 4FZYA 4MFBA 4CF0A 4DV6K 4C1NK 1W97L 1G99A 4FWLA 3NBPA 3BZKA 4DTSA 1EWRA 3LDNA 1RT1A 1HNXK 2O8BB 4M3UA 3CQ8A 1WNSA 4M3WA 3TPQA 1DT9A 3CMEN 4CJSA 3MAQA 2WC9A 2QI2A 4BRLA 2NUBA 2ZM6K 3A5OC 3P31A 4CJEA 1VQKN 1FW6A 3ZSRA 4FK0A 5FDLA 1NM1A 3G6EN 3VEWA 2HNZA 1YHQN 3T69A 3F9MA 3BZCA 3TARA 4FLWA 3LPTA 4LFAK 1NGIA 3E9LA 2OTLN 4X65K 1M1KO 4KTQA 1GLFO 4B1WB 4EZ9A 1RCHA 3PV8A 3RWUA 2OA8A 3O1WA 3O6WA 2VQEK 3T19A 4FOEA 4PL8A 4DU4A 1IJJA 1FKOA 4DMNA 2VWBA 3UKUB 1P8ZA 3L0QA 4CZJA 3O80A 1S1UA 3QINA 4EIAA 4GY2B 3I55N 4BR7A 1QSYA 1Q82O 3OVNA 4CIFA 3D45A 2P9LA 4CBUA 4HUFA 1VQ7N 3EYZA 4XH4A 1X9JA 3RR8A 3QEIA 2F8SA 1DTTA 4FJ7A 4DTOA 1C0UA 1D9DA 5SZTA 3A5NC 3JAMO 1HPZA 2HB5A 4BR0A 3M8RA 3KVGA 4F4KA 1RFQA 4FWOA 5T7BA 3U4LA 2XY8A 3V4IA 4DLEA 4RW6A 1RDCA 3H3NO 3B6PA 2BUPA 3CPWM 4JKFA 4MO5A 1EWQA 3K5NA 4ID5A 4IO9L 1K8KB 1S22A 2E4LA 1KD1O 3KK3A 1RBTA 3FR0A 2UXBK 2DFFA 4CK3A 3EKUA 3EN9A 1D5AA 2CGJA 3AVKA 1WBBA 1N5YA 1K8AO 1R59O 3JS6A 1TKTA 1YTAA 2PY5A 1YJ9N 3NF9A 1LAVA 4DLGA 2I7PA 3SBTA 3SBGA 4C1NI 2UXCK 1NNEA 2NZTA 1IKVA 3KZBA 5C25A 1KVAA 1VSJA 4FLTA 4KI4A 2W42A 1NK9A 5J2MA 4HWIA 3F73A 2YHBA 4N5SA 5AQVA 4Q0BA 2A6AA 4CJUA 5C2DA 3FE1A 3V9ZA 3TTFA 4ZTJA 1Q8IA 1HNVA 4R79A 1LW0A 4MDBA 4XH5A 5JS1A 3UB5A 4BC2A 4DG1A 2EHGA 3OYCA 2HMIA 3OYLA 1Q86O 3MXIA 2KFNA 3O9TA 1NK4A 2OYQA 4BRAA 2A1RA 3K0SA 2NRVA 3S41A 1CXUA 2W41A 4CHQA 4I6MB 3O9SA 1WAJA 2QWRA 1YUWA 4IZ9A 1NJXA 2E6MA 1RT4A 3DLGA 3A5LC 1HR0K 2UYTA 4FVUA 4DV1K 1WSJA 5FROA 5AQGA 5BPNA 1KRPA 4CF1A 4CF9A 3IKMA 3I56N 1O1WA 2A3ZA 4K42A 3L2UA 3WXJA 1W2BM 3MX5A 4UQGA 4BRIA 2LSNA 1ZXOA 1LCUA 3EE8A 4IEEA 4BC4A 4CI6A 1NGAA 2HOEA 4E1JA 1OVQA 1NJZA 3HP9A 4FK2A 3R3LA 3ZLJA 4J2EA 4EAHD 1VSDA 3LZJA 2E1ZA 5DM7L 1FK9A 4LF6K 1VQON 4LF8K 3U3YA 2QKKA 2CH6A 4QS7A 4Z4GA 1N32K 3O1BA 1SL2A 2KLAA 3ISNC 3O4WA 1TVRA 1QSLA 4O8KA 4E3SA 5FPEA 4WQ5C 3S3NA 3SCXA 1E4FT 5AR0A 3V6DA 3QICA 3CI5A 5LMNK 4BRHA 2P5OA 5BRDA 4YNQA 4XH1A 1IO2A 3DWLA 1F21A 3QB0A 3LDQA 4E1NA 4PKHA 1MWKA 1D4XA 5LL6Z 2O8DB 4CHZA 3TWHA 5FLXO 2O8FA 1ZBIA 3MN9A 4MO4A 3ENHA 4KREA 2P5GA 4BRGA 2D1KA 3LZIA 5ADXH 4YOWA 4K8XA 5ELZA 2HF3A 3V9XA 3LP2A 3QIPA 1SL1A 3D2FA 5HLFA 4KB0A 3IDHA 4CJLA 1GLLO 2X78A 3VGLA 3AVAA 3N4PA 4NCGA 3WEEA 4ID1A 2P9UB 2P9SB 2D0BA 2ZD1A 2W6LA 3ZT3A 1BISA 3DLLL 2XO7A 3G71N 1N6QA 4BDYA 3M8SA 1IKYA 4FLUA 3H6EA 4F2RA 2HHUA 2F9TA 2FSKA 3SQ0A 1Q7YO 3JXUA 1BL3A 2D4WA 1V4TA 1G15A 3CHWA 4B1XB 3NF7A 3VQDA 3KJVA 2O8BA 3MK6A 4B1VA 2IVPA 3MCAB 3D2EB 4CD1A 1C0GA 3VN5A 4J2BA 2ASPA 4DSIA 1U47A 3K57A 4B9UA 3SQ2A 3E66A 1Z25A 1ZBUA 2HBMA 4DWIA 3BEXA 1XUPO 2OCEA 1YI2N 4BRNA 1RT2A 1BCMA 3H1QA 3ZETB 5D3GA 3V1RA 1BQMA 1TL3A 4I9LA 1U04A 1JLGA 4KV8A 4WFBL 3OYFA 4B9VA 2E2NA 2D5RA 5DK5A 3R9PA 5BPMA 4GMJB 4CJKA 1YJNN 3PX4A 5JVGL 1NK8A 1XHXA 3VQ9A 3EO3A 2JLEA 3AA5X 3RRGA 3HPHA 3UKUA 1BWFO 3O8MA 1JL1A 1XMQK 3CETA 4G9ZA 4CEBA 1B92A 1D9FA 4IFYA 1BDGA 3WNFA 4DSEA 4PKGA 4O4GA 4FM2A 2I5JA 4JK9A 5AZIB 2RKIA 4OJRA 4HCBA 2O4GA 4NXMK 3WXIA 3W3DA 4KI6A 3VESA 5CHIA 3DLEA 1GLBG 3TSUA 2VWJA 1N34K 4CZMA 2P9NB 1ZBSA 2IAJA 3WT0A 3ZEUB 4EZ6A 3V9WA 4MQ3A 5AQIA 4BDPA 4DR1K 1O13A 1VQNN 1K8KA 1S3XA 2OANA 4CEEA 2Q97A 3WXKA 1VHXA 5EU7A 3OYHA 3KLIA 2F7TA 4A2AA 1RBUA 3ZX3A 3EY1A 3IRXA 3VEVA 2WONA 3TAFA 3V1OA 2E20A 1ZYQA 1C6VA 4DTNA 4BG9A 3VQBA 4JLHA 1JLEA 2E8AA 2Y1IA 1YTUA 4W5NA 2UXDK 1RBRA 4H0TB 5AQUA 4DTMA 2VGNA 4JK8A 4YDUC 3AVFA 3R8EA 1JLQA 1GLDG 1KQSM 3TABA 4K8ZA 2QWMA 2HHHK 4FJ5A 5SWMA 3J7AP 1YVUA 1HKGA 5GIOA 2QWPA 4JEPA 4QOZB 2HNDA 4RW8A 2P51A 4KTZA 4DB3A 4H0YB 4B8AB 1WAFA 4Z4CA 1JL2A 3KK7A 2E1YA 3FZKA 4CEDA 2VYPA 3NH1A 4NCBA 1ZBLA 4IO8A 2ZE2A 5AQXA 1RTDA 5I9EB 1HJOA 4I6MA 4E7LA 1OVYA 1JLBA 5GINA 4DSJA 3U9ZA 1KLNA 4IOCL 3P38A 1GLAG 4KHQA 3J8AA 4OPHA 4HTUA 1C0MA 3KKRA 4GNIA 3CCQN 1L3VA 4U7BA 1RDWX 1D8YA 4LF4K 4QS8A 2FBTA 3OYKA 4OKJA 4JV5K 3QNOA 5M1OA 4OPJA 3LP0A 1H1VA 4YFUA 3ITHA 4CIEA 2QXFA 4CF8A 1QZ5A 4CEOA 3QBWA 4ISGA 4B1YB 2F9WA 4DR7K 3OYAA 1TAUA 2GEMA 4ILHA 3DRRA 1J53A 1YJWN 4DUZK 3HPOA 1A5WA 3PX6A 2XRIA 2FF3B 4H8KA 1VQ8N 2J4RA 1L3TA 3AA2A 4EP5A 4JI5K 3PSIA 4FLYA 3HSTB 5F0XA 4JI0K 3C6AA 2O8DA 2FBVA 5M1NA 1GOAA 3SAHA 4DQSA 3T1HK 4KHUA 4LH5A 4A57A 4GKJK 4DS4A 3SMPA 3M6GA 1BCOA 4H5VA 4Y1CA 3TTCA 1BHLA 3IUCA 1WN7A 4FOIA 4H4MA 3QO9A 3AV9A 4BC5A 5HRPA 4KB1A 3CM5A 3THYB 5HOOA 2ZGZA 5AQSA 3OS2A 3KLEA 1X9MA 4AH9A 2AA4A 5E26A 1RBVA 2P9UA 2P9SA 4B08A 4B3RK 1NMNA 5FRMA 1KAYA 1SS6A 4RWTA 1YIJN 3DLBA 3RMDA 1S9EA 3SUOA 3LWMA 4NLCA 5FPMA 3SYZA 2HVIA 4FJ8A 1Q9YA 4ICLA 1DGKN 5BN9A 4AHUA 4KAZA 4JI2K 4HVJA 3HPGA 4YOUA 3GDQA 3ZSXA 1C1BA 3HSCA 5KGWA 2QWNA 4F3TA 3SNNA 3KKSA 1HQEA 4A61A 4FWSA 1Q18A 2E88A 3D2EA 4OGEA 4FPBA 3NF8A 2YI1A 4CJ7A 4K41A 4KHNA 4KTWA 2YKNA 3ASMA 4CZHA 3AVMA 2ZGYA 3OYEA 1ZBHA 2E5LK 3K5LA 2PAVA 4IWVA 2F96A 2KFZA 3PO4A 1IBLK 1XHZA 1NGBA 1N36K 4BRCA 1XI1A 3ZETA 1MU2A 4BR2A 1HMVA 2G8UA 4OX9K 3RVCA 4A62A 1OKJA 4GVMA 5HRRA 1TKXA 2RN2A 3IAYA 1C0TA 3NGYA 1WB9A 3VQ5A 1XMOK 1U49A 1GOCA 1NGCA 1J54A 1YITN 3VGMA 3H1VX 3CJ9A 3O3FA 1NJYA 3C65A 3A0IX 1KSPA 4IDHA 4B8CA 3ZT0A 4FL9A 4FVMA 4E19A 2CGKA 2GWKA 4ZHRA 5AZIA 5I42A 3VF2A 4WCEL 1ATRA 1ZC6A 2FBXA 4A59A 4NLBA 3W0LA 1YT3A 1VQPN 1TKZA 3R6MA 4AHSA 4CE9A 5B8HA 4FPAA 3QFPA 2B4JA 4NYNA 3BUZB 3RTVA 2A1SA 2P9NA 3EZWA 3ZEUA 3AVGA 3K5MA 2YJFA 1OH6A 1BQNA 4YDUA 4FJNA 3ULEA 4CJPA 2HHQA 4I7FA 4OPAA 3U3GA 4DFKA 4JNEA 3AVNA 4DR5K 4E7IA 1KC8O 3DJCA 4LD0A 5AQLA 1TUUA 3HOTA 3SAFA 4H0XB 2P9KA 2XY7A 1SQKA 3QEVA 3CM6A 3GE1A 4DFPA 2YJEA 5JLHA 4N41A 3CG7A 2BDPA 3RMAA 5GAHP 3TI0A 3ULDA 3SLCA 3VQ4A 4WF9L 5J2NA 3AO2A 2YCHA 1W0HA 4JRPA 3DI6A 5BRFA 4B3TK 1RTHA 1TUYA 4OVLA 2OPRA 4DTRA 3LDPA 3KK1A 4M45A 4CGJA 3VQCA 4OLAA 3F2KA 2YHYA 2NLXA 4QAGA 1RT6A 3NE6A 4B9LA 3NH2A 3CC2N 1UWBA 4FWKA 3NGZA 1C1CA 1LWFA 1ATSA 4BRFA 4B9TA 2F8TA 4JKEA 1SL0A 4C8OA 4AF1A 4CJVA 1RNHA 2QWQA 3L2WA 3WXMB 4JS4A 3SUNA 1EO1A 1CZ9A 4CHOA 4AQYK 1TYQB 3LDLA 4Z0UA 1L5UA 3I0RA 2G8HA 4TSXA 2AJQA 3T1AA 3P39A 4J2AA 3DAWA 4PA1A 3K9KA 1NG9A 3T3FA 4QS9A 3G0ZA 4JS5A 1DEJA 1RT7A 3A8YA 4BGAA 1GOBA 4CEAA 4CJTA 4Y0WA 3N4QA 3OYMA 3L2QA 3AGRA 3OBYA 2QEXN 4NCAA 4FWQA 4WE1A 4DFJA 4DQQA 2GELA 2YNFA 2YNIA 4KHSA 1A5VA 1KCFA 3OYGA 1MWMA 5BRHA 3CD6N 2HHSA 3G10A 2DTUA 4U67L 5C0YA 3KK2A 5AQJA 3VOVA 3NAEA 3DXKB 3LALA 4DV2K 2YHWA 4CF2A 4V19S 4DQIA 2ZF5O 3O4QA 4Y1DA 4BR9A 2NRXA 3KLHA 1XNRK 3CCSN 3MCPA 3HT3A 4DSKA 2YHXA 2HNYA 3LL3A 3S3OA 4Z4FA 3FFIA 4ELVA 4FM0A 4JI4K 2UU9K 1EETA 4AM7A 3OYDA 1ASVA 4BROA 4BE1A 4GW6A 5EOYA 1VSKA 1NU0A 3GG4A 1UA0A 4KH5A 1OH8A 3THYA 2QXLA 4F9OA 2BH1A 1CXQA 3T1YK 4DV5K 1LWCA 4IBNA 4ELTA 5EXWA 2IVNA 3L2VA 1EXQA 4NXNK 3J81O 3VTIA 2VGMA 3DM2A 3HP6A 1ZBFA 4DSFA 1NJIO 2NRRA 3CFPA 4AHTA 3M8QA 4M7YA 1JXEA 4JAXA 4B9QA 1HYVA 5HBMA 4LC9B 3QNNA 1JLFA 3THVA 1W7AA 5J2QA 2P1JA 3NH0A 4MDAA 3PX0A 2FF6A 1BI4B 4HUEA 4HCCA 2YHAA 3C95A 1WSIA 3OYBA 3H45C 3S3MA 4RW4A 3C94A 3NVKA 3QEXA 1IBKK 3JSMA 2PYJA 4YOYA 3AGKA 3ZT4A 3HBTA 3O9RA 3V81A 3H3OB 3OHRA 1KTQA 1VQ4N 4BY9C 2PYLA 5EY4A 4CD3A 1VRUA 5C12A 5KQ8A 1SKWA 1S6QA 3K2PA 5AQHA 3CC7N 4AHRA 1T6DA 1XQSC 4BDZA 4DTUA 2OPPA 1JLAA 2KHOA 1T7PA 5AFUA 3AVIA 3VQAA 3KLFA 2A5XA 2FBYA 4KFBA 3SQ1A 4JI7K 4IOAL 2D0OA 2G8WA 1HYSA 3NHGA 4N76A 4DR3K 3LDSA 4DV4K 3SMSA 3AA3A 4FWPA 4EHTA 5J1EA 5M1PA 2HVHA 2OPSA 5DMRA 2UUBK 4C8KA 2OZSA 1N33K 2HHVA 1BIUA 3MWTA 5IWAK 3ALYA 3ID8A 4FSVA 2NRTA 1RDBA 3MN7A 5AQKA 1TL1A 4ELUA 2BGGA 1JCGA 3HJFA 4CFBA 4CJFA 1VSMA 3VMFB 3CMAN 1QSSA 4JYAK 2GV9A 4B3MK 4CHYA 4BC3A 2E2OA 2WOMA 4FLXA 2RF2A 1LAWA 3KHYA 2KQ2A 1BGXT 1OH7A 1BOTO 4FJGA 4CZIA 3VEZA 4NB4A 2OZMA 4JN4A 2QK9A 2R7YA 1WUAA 2ASMA 1IG9A 1MDUB 2IS3A 5E41A 4O0IA 3MECA 3ZSVA 5BN8A 2KTQA 1HKBA 4JI8K 1XWLA 4W5OA 3ULEB 5MLCQ 2H3GX 3AY9A 1S1TA 1DLOA 4FW1A 4KO0A 5AQMA 2IDOA 3LM2A 4CJ5A 1VQ9N 3THXB 5KPTA 4IJNA 4RW9A 1NLVA 4PQUA 2VG6A 4LF7K 2XY6A 2P9KB 1QS4A 5EVZA 4Z4EA 3D0PA 1R0AA 1TV6A 1FJGK 3CCVN 2QKBA 3CQYA 3MXJA 4ISFA 1KXPA 3P83D 3DYAA 5AQOA 5DM6L 3ZYYX 3SUPA 4HHTA 3BDPA 3TAQA 4HTLA 5AQNA 3CC4N 3EZ5A 4CGGA 4CZGA 5I3UA 3WNGA 2IIRA 2HBKA 1I94K 3CCEN 2QWLA 3MEDA 4H4OA 3RSEB 2JGUA 1NGEA 1HLUA 4CERA 1TAQA 3UKRB 1TYQA 4CZKA 4RTFD 4BRDA 3FGUA 3WNEA 4CFDA 2HHXA 1SKSA 5CYMA 4CBWA 3ZSOA 1GLJO 1QVFM 1J6ZA 3HO1A 2DFHA 3BF1A 3KD1E 1I39A 4GV3A 3MMVA 4Z4IA 2GTDA 1WSFA 4OKKA 4FM1A 1B9DA 3GOIA 1JKHA 2Z1IA 3ZSWA 1Z05A 1NK6A 1J9AA 4CGIA 3P5JA 2RPIA 3AARA 5J2PA 4XEIA 3EEQA 4FJHA 2AP1A 3P1GA 2YV0X 1FXXA 2ZJPL 3DXKA 2PZSA 1M90O 2NRHA 1CZAN 4CVNE 4HUGA 3NDKA 3QERA 4RG8A 4BR5A 1WSGA 3CCRN 4IG3A 2GWJA 4H0PA 1LV5A 4AHCA 1EKEA 1TKDA 4JKCA 3D6RA 2Z1JA 1U45A 4DFMA 2VG5A 4DTJA 5KPRA 4JI1K 3LANA 4AM6A 5HRNA 1WSHA 1Q81O 3VGKA 3O4NA 3QLHA 1IV0A 1MA9B 3O3GA 5AZJB 2HW3A 4KH4A 3RMCA 3VPZA 1V4SA 3SI6A 1B9FA 4DSLA 1E4GT 3VQPA 1BUPA 3TSQA 2E2PA 5HROA 1NOYA 3AA4A 1RTIA 3DRPA 1SUQA 5KRTA 3DLHA 1KAZA 4JKHA 1DTQA 5KI6A 3SZ2A 1NJWA 1UOCA 4YY3K 3DOLA 4YHHK 3CERA 4FJMA 3NGIA 3R1XA 1XNQK 3AO1A 1QQNA 2DFEA 4IJAA 1S72N 1HUXA 3MN5A 3HXMA 3I0SA 4BRMA 2OPQA 1RILA 3CQXA 3IFRA 4JHDB 3LAKA 3LP3A 5M1QA 3ZT2A 4DV7K 4GVEA 1BI4A 2V7YA 4BQLA 1QVGM 4M41A 3GBTA 4E1MA 4BG8A 4E0DA 3NCIA 4F8RA 3KWIA 5C24A 2B5JA 4FWMA 2BE2A 4I2QA 3V9SA 3KWGA 4G1QA 4B9NA 1NKEA 3PIPL 2KW4A 4BWMA 2KKZA 3E9OA 4JD2B 4IFVA 3MDQA 3AVCA 4JKGB 5LJWA 3MX2A 4DV3K 3VQ7A 2QM1A 4H5NA 2ITMA 3DOKA 3FLCO 3C6HA 4KRFA 5AQRA 4CESA 4BVPA 3ZSZA 5AQPA 2GBZA 4CJWA 3KLGA 4FYDA 3B8AX 5KGXA 3PO5A 3M8PA 4DUYK 4KHWA 2A41A 1WSEA 3HM9A 2ZWHA 5CY4A 3CCMN 2PFUA 4PL7A 3PY8A 2FLOA 3UIQA 2RHKA 3E9PA 1EQYA 3HZ6A 4CK2A 4A5AA 1Z26A 1JCEA 4BRPA 3KD5E 4F3OA 4O8UA 5KQDA 3QMLA 4CFCA 4DF4A 3QESA 3J7YP 4CJRA 3F9KA 4Q5VA 4XIUA 4IOXA 1VSFA 4E7JA 2NRWA 4CJ4A 4DS5A 5M1FA 3GL1A 5AQWA 4DU3A 3Q7BA 1UA1A 2VQFK 1HYZA 3VA0A 2YKMA 2Q3SA 4JK7A 1X9SA 4GKKK 2G8FA 1NK0A 4FWRA 2P9PB 4B9SA 4KKOA 2KZZA 2QWOA 3KIOA 2X74A 4CGFA 4M3YA 3OTOK 3LDOA 3VF4A 3M3ZA 3CJAA 3B6OA 4DQPA 4LFCK 4DR2K 1JCFA 1SV5A 3SV4A 3QETA 1J5OA 1RDUA 1BG3A 4BR4A 4H5TA 3VERA 1KFSA 3LAMA 3L4QA 3TSPA 3A2FA 2E6LA 5GADP 1K6YA 4ZTFA 2GX9A 4CHNA 1CLQA 3MXMA 2O8EB 4CIGA 4WFNL 1X3MA 1C1AA 1QQCA 2XY5A 1XC3A 1OH5A 1S6PA 2V52B 3THXA 3E01A 2GUPA 2WBNA 2E2QA 5HRSA 4PUOA 1NK5A 3EL2A 4BE2A 5LJVA 2HSTA 1X1PA 4FK4A 5EX5A 3ATVA 1IBMK 2NRZA 4AILC 4LF9K 3CJBA 3LP1A 5ADXA 4M42A 2FC0A 2ATQA 3U9DA 3SUQA 2NNWA 3EKSA 3AO5A 2Q0RA 2W40A 4KH6A 1UAXA 1L3UA 4O0JA 3BP8A 1HPMA 4E89A 3TTDA 2VWKA 1SZ2A 2IC3A 4CHPA 1TK5A 5KPZA 3CFRA 4FJ9A 3AVLA 3IS9A 1QTMA 3RSEA 1SAZA 2FXUA 5F2RA 4A2BA 1K73O 2PBDA 4L3QA 3UKRA 2ITGA 2P9IB 1RT3A 4YOXA 5AQZA 5GAGP 5IT9O 5A2QO 4PHTX 5JICA 3AAQA 1RDDA 4O5FA 5C10A 3CPEA 4OKEA 5FPNA 4LFBK 3E1YA 3HL8A 1QZ6A 4DF8A 3LM9A 3O3HA 1KVBA 1Y97A 1LOTB 2GUIA 4E7KA 3SK3A 3K5OA 1ATNA 4A5BA 1NGJA 2CGLA 3TR8A 3DLKA 4DV0K 2I7NA 1REVA 3OYJA 4DHYA 3WXLA 4B3SK 3QFUA 4LSNA 1HJRA 3CJCA 4H03B 4H0VB 3CCUN 2VCPA 3LPUA 2D0PA 3SPZA 1QQOA 1NGGA 1VQMN 3IMXA 3ZSYA 3H08A 5CR4A 4N56A 1SKRA 3QEPA 1VRTA 1BA1A 2O4IA 3ZX0A 1KVCA 5CZ2A 1FKPA 5AZJA 3THWB 4CJQA 1S9GA 5C15A 3G4SN 4LF5K 1VSHA 4JKBA 3I8DA 3HOSA 3SPYA 1VQ5N 1RTJA 2G8IA 3BGRA 3H46O 4JI6K 4CZEA 4IXCA 4CZFA 4EHUA 2IGIA 1KLMA 4EFHA 4M3XA 4KHPK 1I3AA 5KTQA 3NVMA 1N8RO 4DU1A 1IG8A 1VAZA 3DRSA 3I8BA 3VENA 3BY5A 4OO1J 1NGFA 1U2VA 4B9MA 4CEZA 5AQFA 5JMVA 3QEWA 1U6ZA 2DPNA 3I33A 3ATUA 3MN6A 4JHDA 3OYNA 2Q1NA 4IEIA 5AJ3K 1JLCA 1YAGA 4BRKA 4FLZA 3CJ1A 3G25A 1E3MA 3CXCM 2CH5A 4BWJA 1HKCA 2V51B 3PSFA 1ILYA 1U48A 4X64K 5LMUK 3F5TA 1CZBA 2BANA 3BF3A 3C7NB 3V1QA 2WTUA 3HRGA 3O9UA 4PKIA 3SQ4A 3M1FA 3M5RA 1NMDA 3TAPA 3NMUA 2Z1GA 3C0BA 1QHAA 5LY3A 3QDKA 4NYFA 4JD2A 4IG0A 4CK1A 3OJSA 4JRQA 4JKGA 4WFAL 4FW2A 1BO5O 3FFKB 4DQ8A 3ZSQA 4FCYA 3A5MC 3MEEA 4YORA 4WQ4C 4R5PA 2O8CA 1BU6O 4H5RA 4K0KK 2ASOA 1IH7A 3OJUA 4K25A 1HQUA 3FZHA 5JVHL 4FZXC 4CBXA 1C0FA 1T03A 3CCLN 1IKXA 4J8FA 3DXMB 4JKAA 1T3VA 1NK7A 4YOTA 3AAPA 3SV3A 1YVNA 4CEQA 3Q7CA 1T8EA 4FJJA 1T44A 2W6KA 4MLHA 4EP4A 1RGIA 2Q31A 4O44A 2Q2RA 4CJ3A 1S1WA 3HM8A 5CE3A 1DKGD 1YXQA 3SJJA 1HNZK 5HL7L 5C42A 1GLCG 3DLRA 2UUAK 4C8NA 1ASWA 3TAEA 4FJKA 1TGOA 1NOZA 2KZMA 2P9PA 3VQ6A 4FXDA 3TAGA 4M63C 1P90A 4LH4A 3ZT1A 4ILGB 4BGBA 2RE2A 4FJIA 1ITGA 3WQTA 4RCHA 3L2RA 5M1KA 4PWDA 4PY5A 2ZQBA 3VA3A 4GV9A 4BVOA 1T05A 3TANA 2HMPA 1RBSA 1ESVA 1NWKA 1VSIA 3CIPA 1NGDA 4M3ZA 3OBWA 3VQEA 3L8BA 2HHTA 4KHYA 4L8RB 4DTPA 4OLBA 2O8EA 3QIOA 3CCJN 4BACA 2X6NA 3VEYA 3JYTA 2D0AA 2UUCK 1X9WA 5BREA 1VSLA 3KTQA 1S1XA 3MEGA 2F4VK 1QQMA 1VK0A 2WUSA 5BPLA 3O9QA 3VF6A 3K59A 2OTJN 3AO3A 1LWEA 1T6CA 5AQYA 2XHBA 3K58A 1ASUA 4FO0A 5TKYA 4X62K 1Y64A 2A40A 4IKFA 4J2DA 2P9LB 2V7ZA 3TAMA 4CW7B 1YF5L 1S1VA 3CF5L 2B6AA 3FZMA 5AQQA 2EX3A 3VEXA 5JLFA 2Y1JA 3OW2M 4FLVA 1HNIA 3TU5A 3RRHA 3PIOL 1NKCA 1JXBA 4W5RA 1VSEA
chains in the Genus database with same CATH topology
4CGDA 3ULDA 4K8XA 3V9UA 5J2NA 3VQ4A 4DTNA 4M41A 3AO2A 3LP2A 3QIPA 3V9XA 1SL1A 4E1MA 4M3TA 5HLFA 1W0HA 4JRPA 4KB0A 4OGCA 4E0DA 3NCIA 4CJLA 3DI6A 3OYIA 3NF6A 4F8RA 5C24A 2X78A 4KPYA 3AVAA 1RTHA 4OVLA 2OPRA 2B5JA 4DTRA 3KK1A 4NCGA 2G8VA 4M45A 2BE2A 4CGJA 4I2QA 3VQCA 3V9SA 1KFDA 4ID1A 4OLAA 4G1QA 4QAGA 4B9NA 4Q0BA 1QE1A 1RT6A 4W5QA 3NE6A 1NKEA 2D0BA 2KW4A 4BWMA 4B9LA 1TK8A 2ZD1A 3NH2A 1UWBA 4FJ9A 3ZT3A 4OPKA 4IFVA 1BISA 1N6QA 4N47A 2XO7A 4BDYA 3AVCA 1IKYA 3M8SA 4FLUA 3NGZA 4F2RA 2HHUA 4I9QA 1C1CA 1LWFA 4CEFA 3RMBA 3VQ7A 3SQ0A 3DOKA 1BL3A 3VQ8A 4KRFA 1G15A 1LW2A 4B9TA 3NF7A 2F8TA 4QCLA 3VQDA 3KJVA 1SL0A 4CESA 4C8OA 4B3OA 3HYFA 3ZSZA 3U6FA 4CJVA 2GBZA 4CJWA 3KLGA 1RNHA 4FYDA 5KGXA 3PO5A 1U4BA 3M8PA 3L2WA 3LWLA 4KHWA 4JS4A 3SUNA 1WSEA 1CZ9A 5CY4A 4CHOA 3HM9A 4M3RA 3PY8A 4Z0UA 3VN5A 3OS1A 4J2BA 4DSIA 1L5UA 3I0RA 2G8HA 1U47A 4TSXA 3UIQA 2AJQA 3T1AA 3K57A 4J2AA 4CK2A 4PA1A 1Z26A 4E7HA 4Z4HA 4B9UA 3KD5E 3SQ2A 4F3OA 4F2SA 3WNHA 3T3FA 3HVRA 1IKWA 3G0ZA 4JS5A 4CFCA 1Z25A 4DF4A 3QESA 1RT7A 1GOBA 4CEAA 4CJTA 4CJRA 3F9KA 1ZBUA 5K14A 3OYMA 4Q5VA 4XIUA 3L2QA 4DWIA 1TK0A 1VSFA 1RDAA 4C8LA 4E7JA 1RT2A 4NCAA 1BCMA 4CJ4A 4DS5A 5D3GA 3C6UA 4WE1A 3V1RA 4DQQA 1BQMA 1TL3A 4DFJA 4DU3A 2YNFA 4I9LA 1XC9A 1U04A 2YNIA 1A5VA 4KHSA 1JLGA 1KCFA 4KV8A 3OYGA 1HYZA 2VG7A 3CYMA 3OYFA 3VA0A 1UA1A 4B9VA 2YKMA 2D5RA 2HHSA 5DK5A 2Q3SA 1X9SA 1QHTA 3AVBA 3G10A 2G8FA 2DTUA 1NK0A 4GMJB 4LY7A 4B9SA 4KKOA 4CJKA 2KZZA 3ZCMA 3PX4A 1NK8A 1XHXA 3KIOA 3VQ9A 2JLEA 3AA5X 3RRGA 3KK2A 2X74A 3NFAA 3NAEA 3S9HA 3LALA 3HPHA 4CGFA 4M3YA 4CF2A 1JL1A 3B6OA 4DQIA 4DQPA 3O4QA 4Y1DA 3KLHA 4CEBA 1SV5A 3SV4A 3QETA 3IG1A 1B92A 3PUFA 1D9FA 1J5OA 4IFYA 3HT3A 4CCHA 3WNFA 4DSEA 2HNYA 3S3OA 4DSKA 4FZZA 1KFSA 3LAMA 4Z4FA 4BE0A 3FFIA 4ELVA 3A2FA 2E6LA 3HVTA 1K6YA 4O4GA 4FM0A 4FM2A 4ZTFA 3L3VA 2I5JA 4CHNA 1EETA 2RKIA 3AO4A 1CLQA 4I2PA 4OJRA 3MXMA 2O4GA 4CIGA 3OYDA 1Q9XA 4HCBA 1ASVA 4CECA 1C1AA 1QQCA 4KI6A 3RR7A 2XY5A 4BE1A 4GW6A 1HRHA 1VSKA 3DLEA 4LSLA 1S5JA 1S6PA 3VQQA 2VWJA 3DMJA 1UA0A 3E01A 4CFAA 5KRSA 3HK2A 5HRSA 4PUOA 1NK5A 4BE2A 2IAJA 4EZ6A 3V9WA 1CXQA 4MQ3A 1X1PA 4FJXA 4FK4A 5FRNA 4BDPA 4C8MA 1LWCA 4IBNA 4ELTA 2D0CA 4AILC 5HP1A 1EX4A 1L3SA 4CEEA 3L2VA 1EXQA 2YNHA 1BIZA 3DM2A 1ZBFA 3LP1A 5EU7A 3OYHA 3HP6A 4DQRA 4DSFA 3CFPA 4M42A 2FC0A 3KLIA 2ATQA 1RBUA 2G8KA 3SUQA 4AHTA 4FJLA 3AO5A 4IDKA 3IRXA 3EY1A 2WONA 3CFOA 3M8QA 3TAFA 1UAXA 3V1OA 1JXEA 1L3UA 1ZYQA 2X6SA 4O0JA 1C6VA 3AVHA 3AVJA 5CZ1A 4E89A 1A5XA 1EP4A 1HYVA 5HBMA 3VQBA 3QNNA 1JLFA 4JLHA 3THVA 5J2QA 1JLEA 2VWKA 2P1JA 4DTXA 2Y1IA 1YTUA 4W5NA 1RBRA 2IC3A 4CHPA 3C6TA 4RW7A 3NH0A 3OY9A 1TK5A 4DTMA 3L3UA 4O5BA 3CFRA 3PX0A 1BI4B 3AVLA 4HUEA 3AVFA 2YHAA 3C95A 3IS9A 1WSIA 3OYBA 1JLQA 1QTMA 4HCCA 4CGHA 3S3MA 4RW4A 3TABA 4O55A 3C94A 4K8ZA 2DY4A 3QEXA 4FJ5A 5SWMA 2ITGA 1RT3A 1YVUA 3JSMA 2PYJA 2HHWA 2ETJA 1W9HA 4QOZB 2HNDA 3ZT4A 4RW8A 2P51A 4KTZA 3V81A 2YNGA 4B8AB 3OS0A 5CYQA 1WLJA 1KTQA 1RDDA 1WAFA 5JS2A 4Z4CA 1JL2A 4OKEA 2PYLA 4W5TA 1VRUA 1SKWA 1S6QA 3K2PA 3HL8A 4AHRA 4DF8A 4AHVA 4CEDA 4BDZA 4DTUA 3NH1A 1RT5A 2OPPA 1NKBA 2IOCA 1JLAA 4NCBA 2Z1HA 3O3HA 1T7PA 1KVBA 4MFBA 1Y97A 2GUIA 1ZBLA 4E7KA 4FZYA 2ZE2A 4CF0A 3K5OA 4DTSA 1RTDA 3NBPA 3AVIA 3TR8A 1RT1A 3DLKA 3VQAA 1REVA 4E7LA 3OYJA 2FBYA 3KLFA 1JLBA 4KFBA 3SQ1A 4M3UA 3CQ8A 2G8WA 1WNSA 4M3WA 4LSNA 4CJSA 1HYSA 3NHGA 3MAQA 4N76A 1HJRA 4DSJA 1KLNA 3LDSA 2NUBA 3LPUA 3AA3A 5J1EA 3SPZA 4KHQA 4CJEA 2HVHA 2OPSA 3ZSRA 5DMRA 4HTUA 4C8KA 2OZSA 1C0MA 5FDLA 3KKRA 1BIUA 4FK0A 2HHVA 3ZSYA 3H08A 1L3VA 1D8YA 4N56A 2HNZA 2FBTA 1SKRA 3ALYA 3OYKA 3QEPA 4OKJA 1RDBA 3QNOA 1TL1A 4OPJA 3TARA 4ELUA 2BGGA 3LP0A 4YFUA 4FLWA 3ITHA 3LPTA 1VRTA 4CIEA 2QXFA 2O4IA 1KVCA 5CZ2A 1FKPA 3HJFA 4CFBA 4CF8A 4CEOA 4KTQA 4CJFA 4CJQA 4EZ9A 1VSMA 1RCHA 1S9GA 3PV8A 3RWUA 1QSSA 2OA8A 1VSHA 3I8DA 3SPYA 2GV9A 1RTJA 3T19A 3OYAA 2G8IA 4CHYA 1TAUA 4FLXA 2WOMA 3BGRA 3DRRA 1J53A 2RF2A 1LAWA 1FKOA 4DU4A 4DMNA 2KQ2A 1BGXT 4KHNA 2IGIA 1S1UA 1KLMA 3HPOA 1A5WA 4M3XA 1I3AA 3QINA 3PX6A 5KTQA 4FJGA 2XRIA 1QSYA 4DU1A 3OVNA 3DRSA 4H8KA 3D45A 4CIFA 1L3TA 4HUFA 2OZMA 2QK9A 3EYZA 3AA2A 4EP5A 2R7YA 1IG9A 3RR8A 4B9MA 4CEZA 2IS3A 3QEIA 4FLYA 1DTTA 4FJ7A 5E41A 4DTOA 4O0IA 2F8SA 1C0UA 3MECA 3HSTB 3QEWA 1D9DA 3ZSVA 5SZTA 2KTQA 1HPZA 2FBVA 1XWLA 4W5OA 2HB5A 3M8RA 3OYNA 1GOAA 4F4KA 1S1TA 1DLOA 4DQSA 1JLCA 4FW1A 4KO0A 4LH5A 4KHUA 4FLZA 4DS4A 5T7BA 3V4IA 2IDOA 2XY8A 4DLEA 1BCOA 4Y1CA 4CJ5A 4RW6A 1RDCA 4RW9A 4BWJA 1BHLA 1WN7A 4H4MA 4PQUA 2VG6A 3B6PA 3QO9A 3AV9A 5HRPA 2XY6A 1U48A 3CM5A 4KB1A 1CZBA 1QS4A 2BANA 3V1QA 3K5NA 4ID5A 3OS2A 3SQ4A 4Z4EA 2E4LA 3KLEA 1X9MA 4AH9A 3D0PA 3TAPA 1RBVA 4B08A 1TV6A 3KK3A 1RBTA 2Z1GA 1R0AA 5FRMA 2QKBA 3MXJA 4NYFA 4IG0A 3DLBA 3RMDA 2DFFA 1S9EA 4CK1A 3P83D 3OJSA 4CK3A 4JRQA 1D5AA 3SUOA 3DYAA 4FW2A 4FCYA 3ZSQA 3AVKA 3LWMA 3SYZA 3SUPA 2HVIA 4FJ8A 4HHTA 3MEEA 1N5YA 3TAQA 4ICLA 4R5PA 1Q9YA 3BDPA 4AHUA 4KAZA 1TKTA 1YTAA 4HVJA 3HPGA 3EZ5A 2PY5A 1IH7A 1LAVA 3NF9A 4CGGA 3WNGA 3OJUA 4DLGA 5I3UA 3ZSXA 1C1BA 5KGWA 1HQUA 2HHXA 4F3TA 3SNNA 4FZXC 3KKSA 1HQEA 3MEDA 4H4OA 1T03A 1IKVA 2JGUA 1IKXA 5C25A 1KVAA 1VSJA 4FLTA 4CERA 4KI4A 1TAQA 4OGEA 2W42A 1NK7A 5J2MA 3NF8A 3WNEA 3F73A 1NK9A 4CFDA 3SV3A 2YHBA 4N5SA 4KTWA 4CEQA 1SKSA 2YKNA 3ASMA 4CJUA 3AVMA 3OYEA 1T8EA 5CYMA 4FJJA 3ZSOA 3HO1A 3V9ZA 1ZBHA 2DFHA 3KD1E 3K5LA 4ZTJA 1I39A 1Q8IA 2F96A 4EP4A 3PO4A 2KFZA 1HNVA 4O44A 1LW0A 4Z4IA 4CJ3A 1S1WA 1XHZA 1WSFA 4OKKA 4FM1A 1B9DA 3SJJA 5JS1A 1XI1A 1JKHA 4DG1A 2EHGA 3OYCA 2Z1IA 1MU2A 3ZSWA 2HMIA 5C42A 3DLRA 1HMVA 3OYLA 2G8UA 3MXIA 4C8NA 1ASWA 2KFNA 1NK4A 1J9AA 3TAEA 2A1RA 1NK6A 2OYQA 4CGIA 1TGOA 4GVMA 4FJKA 3P5JA 1CXUA 1NOZA 2RPIA 5HRRA 1TKXA 4CHQA 5J2PA 2KZMA 2RN2A 3IAYA 1C0TA 1WAJA 3NGYA 3VQ6A 3VQ5A 4FJHA 4FXDA 3TAGA 1NJXA 3P1GA 2YV0X 1GOCA 1U49A 1FXXA 4LH4A 3ZT1A 2E6MA 1RT4A 1J54A 3DLGA 2PZSA 4FJIA 1ITGA 4HUGA 3NDKA 3QERA 4RG8A 3L2RA 1WSJA 3O3FA 5FROA 1NJYA 4PWDA 1WSGA 1KRPA 1KSPA 4IG3A 4B8CA 2ZQBA 4PY5A 4CF1A 3ZT0A 4CF9A 3VA3A 1LV5A 4FVMA 4AHCA 1T05A 3TANA 1EKEA 1TKDA 1O1WA 3L2UA 2Z1JA 1U45A 1RBSA 4UQGA 2VG5A 4DTJA 4DFMA 1VSIA 4E19A 2LSNA 4ZHRA 3LANA 5HRNA 4M3ZA 1WSHA 3VQEA 3L8BA 5I42A 2HHTA 4KHYA 4L8RB 4DTPA 3O4NA 4OLBA 3QIOA 3QLHA 1NJZA 3HP9A 4FK2A 4BACA 2X6NA 3JYTA 3O3GA 2HW3A 4J2EA 2FBXA 2D0AA 1VSDA 3LZJA 1X9WA 3RMCA 1YT3A 1FK9A 1TKZA 1VSLA 3KTQA 1S1XA 4AHSA 3U3YA 3MEGA 4CE9A 3SI6A 2QKKA 1B9FA 1VK0A 4DSLA 3VQPA 2B4JA 4NYNA 3K59A 3RTVA 4Z4GA 2A1SA 3AO3A 5HROA 3AVGA 1LWEA 1SL2A 3ISNC 3K5MA 1NOYA 2XHBA 3K58A 1TVRA 1QSLA 1ASUA 3AA4A 4E3SA 1BQNA 4FJNA 1RTIA 4CJPA 3S3NA 3DRPA 2HHQA 1SUQA 3SCXA 4I7FA 5KRTA 3DLHA 3U3GA 4DFKA 3V6DA 1DTQA 5KI6A 3SZ2A 1NJWA 1UOCA 3AVNA 3DOLA 2P5OA 4E7IA 4IKFA 4J2DA 4YNQA 4LD0A 4FJMA 1IO2A 3NGIA 1F21A 3TAMA 3AO1A 2XY7A 2DFEA 4E1NA 3QEVA 1S1VA 3CM6A 3HXMA 2B6AA 3I0SA 4CHZA 4DFPA 3TWHA 1ZBIA 2EX3A 2OPQA 1RILA 3LAKA 3LP3A 4FLVA 1HNIA 2Y1JA 3CG7A 3RRHA 2P5GA 4N41A 4KREA 3ZT2A 1NKCA 1JXBA 3LZIA 4W5RA 2BDPA 3RMAA 1BI4A 3TI0A 1VSEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CGD A;  3ULD A;  4K8X A;  3V9U A;  5J2N A;  3VQ4 A;  4DTN A;  4M41 A;  3AO2 A;  3LP2 A;  3QIP A;  3V9X A;  1SL1 A;  4E1M A;  4M3T A;  5HLF A;  1W0H A;  4JRP A;  4KB0 A;  4OGC A;  4E0D A;  3NCI A;  4CJL A;  3DI6 A;  3OYI A;  3NF6 A;  4F8R A;  5C24 A;  2X78 A;  4KPY A;  3AVA A;  1RTH A;  4OVL A;  2OPR A;  2B5J A;  4DTR A;  3KK1 A;  4NCG A;  2G8V A;  4M45 A;  2BE2 A;  4CGJ A;  4I2Q A;  3VQC A;  3V9S A;  1KFD A;  4ID1 A;  4OLA A;  4G1Q A;  4QAG A;  4B9N A;  4Q0B A;  1QE1 A;  1RT6 A;  4W5Q A;  3NE6 A;  1NKE A;  2D0B A;  2KW4 A;  4BWM A;  4B9L A;  1TK8 A;  2ZD1 A;  3NH2 A;  1UWB A;  4FJ9 A;  3ZT3 A;  4OPK A;  4IFV A;  1BIS A;  1N6Q A;  4N47 A;  2XO7 A;  4BDY A;  3AVC A;  1IKY A;  3M8S A;  4FLU A;  3NGZ A;  4F2R A;  2HHU A;  4I9Q A;  1C1C A;  1LWF A;  4CEF A;  3RMB A;  3VQ7 A;  3SQ0 A;  3DOK A;  1BL3 A;  3VQ8 A;  4KRF A;  1G15 A;  1LW2 A;  4B9T A;  3NF7 A;  2F8T A;  4QCL A;  3VQD A;  3KJV A;  1SL0 A;  4CES A;  4C8O A;  4B3O A;  3HYF A;  3ZSZ A;  3U6F A;  4CJV A;  2GBZ A;  4CJW A;  3KLG A;  1RNH A;  4FYD A;  5KGX A;  3PO5 A;  1U4B A;  3M8P A;  3L2W A;  3LWL A;  4KHW A;  4JS4 A;  3SUN A;  1WSE A;  1CZ9 A;  5CY4 A;  4CHO A;  3HM9 A;  4M3R A;  3PY8 A;  4Z0U A;  3VN5 A;  3OS1 A;  4J2B A;  4DSI A;  1L5U A;  3I0R A;  2G8H A;  1U47 A;  4TSX A;  3UIQ A;  2AJQ A;  3T1A A;  3K57 A;  4J2A A;  4CK2 A;  4PA1 A;  1Z26 A;  4E7H A;  4Z4H A;  4B9U A;  3KD5 E;  3SQ2 A;  4F3O A;  4F2S A;  3WNH A;  3T3F A;  3HVR A;  1IKW A;  3G0Z A;  4JS5 A;  4CFC A;  1Z25 A;  4DF4 A;  3QES A;  1RT7 A;  1GOB A;  4CEA A;  4CJT A;  4CJR A;  3F9K A;  1ZBU A;  5K14 A;  3OYM A;  4Q5V A;  4XIU A;  3L2Q A;  4DWI A;  1TK0 A;  1VSF A;  1RDA A;  4C8L A;  4E7J A;  1RT2 A;  4NCA A;  1BCM A;  4CJ4 A;  4DS5 A;  5D3G A;  3C6U A;  4WE1 A;  3V1R A;  4DQQ A;  1BQM A;  1TL3 A;  4DFJ A;  4DU3 A;  2YNF A;  4I9L A;  1XC9 A;  1U04 A;  2YNI A;  1A5V A;  4KHS A;  1JLG A;  1KCF A;  4KV8 A;  3OYG A;  1HYZ A;  2VG7 A;  3CYM A;  3OYF A;  3VA0 A;  1UA1 A;  4B9V A;  2YKM A;  2D5R A;  2HHS A;  5DK5 A;  2Q3S A;  1X9S A;  1QHT A;  3AVB A;  3G10 A;  2G8F A;  2DTU A;  1NK0 A;  4GMJ B;  4LY7 A;  4B9S A;  4KKO A;  4CJK A;  2KZZ A;  3ZCM A;  3PX4 A;  1NK8 A;  1XHX A;  3KIO A;  3VQ9 A;  2JLE A;  3AA5 X;  3RRG A;  3KK2 A;  2X74 A;  3NFA A;  3NAE A;  3S9H A;  3LAL A;  3HPH A;  4CGF A;  4M3Y A;  4CF2 A;  1JL1 A;  3B6O A;  4DQI A;  4DQP A;  3O4Q A;  4Y1D A;  3KLH A;  4CEB A;  1SV5 A;  3SV4 A;  3QET A;  3IG1 A;  1B92 A;  3PUF A;  1D9F A;  1J5O A;  4IFY A;  3HT3 A;  4CCH A;  3WNF A;  4DSE A;  2HNY A;  3S3O A;  4DSK A;  4FZZ A;  1KFS A;  3LAM A;  4Z4F A;  4BE0 A;  3FFI A;  4ELV A;  3A2F A;  2E6L A;  3HVT A;  1K6Y A;  4O4G A;  4FM0 A;  4FM2 A;  4ZTF A;  3L3V A;  2I5J A;  4CHN A;  1EET A;  2RKI A;  3AO4 A;  1CLQ A;  4I2P A;  4OJR A;  3MXM A;  2O4G A;  4CIG A;  3OYD A;  1Q9X A;  4HCB A;  1ASV A;  4CEC A;  1C1A A;  1QQC A;  4KI6 A;  3RR7 A;  2XY5 A;  4BE1 A;  4GW6 A;  1HRH A;  1VSK A;  3DLE A;  4LSL A;  1S5J A;  1S6P A;  3VQQ A;  2VWJ A;  3DMJ A;  1UA0 A;  3E01 A;  4CFA A;  5KRS A;  3HK2 A;  5HRS A;  4PUO A;  1NK5 A;  4BE2 A;  2IAJ A;  4EZ6 A;  3V9W A;  1CXQ A;  4MQ3 A;  1X1P A;  4FJX A;  4FK4 A;  5FRN A;  4BDP A;  4C8M A;  1LWC A;  4IBN A;  4ELT A;  2D0C A;  4AIL C;  5HP1 A;  1EX4 A;  1L3S A;  4CEE A;  3L2V A;  1EXQ A;  2YNH A;  1BIZ A;  3DM2 A;  1ZBF A;  3LP1 A;  5EU7 A;  3OYH A;  3HP6 A;  4DQR A;  4DSF A;  3CFP A;  4M42 A;  2FC0 A;  3KLI A;  2ATQ A;  1RBU A;  2G8K A;  3SUQ A;  4AHT A;  4FJL A;  3AO5 A;  4IDK A;  3IRX A;  3EY1 A;  2WON A;  3CFO A;  3M8Q A;  3TAF A;  1UAX A;  3V1O A;  1JXE A;  1L3U A;  1ZYQ A;  2X6S A;  4O0J A;  1C6V A;  3AVH A;  3AVJ A;  5CZ1 A;  4E89 A;  1A5X A;  1EP4 A;  1HYV A;  5HBM A;  3VQB A;  3QNN A;  1JLF A;  4JLH A;  3THV A;  5J2Q A;  1JLE A;  2VWK A;  2P1J A;  4DTX A;  2Y1I A;  1YTU A;  4W5N A;  1RBR A;  2IC3 A;  4CHP A;  3C6T A;  4RW7 A;  3NH0 A;  3OY9 A;  1TK5 A;  4DTM A;  3L3U A;  4O5B A;  3CFR A;  3PX0 A;  1BI4 B;  3AVL A;  4HUE A;  3AVF A;  2YHA A;  3C95 A;  3IS9 A;  1WSI A;  3OYB A;  1JLQ A;  1QTM A;  4HCC A;  4CGH A;  3S3M A;  4RW4 A;  3TAB A;  4O55 A;  3C94 A;  4K8Z A;  2DY4 A;  3QEX A;  4FJ5 A;  5SWM A;  2ITG A;  1RT3 A;  1YVU A;  3JSM A;  2PYJ A;  2HHW A;  2ETJ A;  1W9H A;  4QOZ B;  2HND A;  3ZT4 A;  4RW8 A;  2P51 A;  4KTZ A;  3V81 A;  2YNG A;  4B8A B;  3OS0 A;  5CYQ A;  1WLJ A;  1KTQ A;  1RDD A;  1WAF A;  5JS2 A;  4Z4C A;  1JL2 A;  4OKE A;  2PYL A;  4W5T A;  1VRU A;  1SKW A;  1S6Q A;  3K2P A;  3HL8 A;  4AHR A;  4DF8 A;  4AHV A;  4CED A;  4BDZ A;  4DTU A;  3NH1 A;  1RT5 A;  2OPP A;  1NKB A;  2IOC A;  1JLA A;  4NCB A;  2Z1H A;  3O3H A;  1T7P A;  1KVB A;  4MFB A;  1Y97 A;  2GUI A;  1ZBL A;  4E7K A;  4FZY A;  2ZE2 A;  4CF0 A;  3K5O A;  4DTS A;  1RTD A;  3NBP A;  3AVI A;  3TR8 A;  1RT1 A;  3DLK A;  3VQA A;  1REV A;  4E7L A;  3OYJ A;  2FBY A;  3KLF A;  1JLB A;  4KFB A;  3SQ1 A;  4M3U A;  3CQ8 A;  2G8W A;  1WNS A;  4M3W A;  4LSN A;  4CJS A;  1HYS A;  3NHG A;  3MAQ A;  4N76 A;  1HJR A;  4DSJ A;  1KLN A;  3LDS A;  2NUB A;  3LPU A;  3AA3 A;  5J1E A;  3SPZ A;  4KHQ A;  4CJE A;  2HVH A;  2OPS A;  3ZSR A;  5DMR A;  4HTU A;  4C8K A;  2OZS A;  1C0M A;  5FDL A;  3KKR A;  1BIU A;  4FK0 A;  2HHV A;  3ZSY A;  3H08 A;  1L3V A;  1D8Y A;  4N56 A;  2HNZ A;  2FBT A;  1SKR A;  3ALY A;  3OYK A;  3QEP A;  4OKJ A;  1RDB A;  3QNO A;  1TL1 A;  4OPJ A;  3TAR A;  4ELU A;  2BGG A;  3LP0 A;  4YFU A;  4FLW A;  3ITH A;  3LPT A;  1VRT A;  4CIE A;  2QXF A;  2O4I A;  1KVC A;  5CZ2 A;  1FKP A;  3HJF A;  4CFB A;  4CF8 A;  4CEO A;  4KTQ A;  4CJF A;  4CJQ A;  4EZ9 A;  1VSM A;  1RCH A;  1S9G A;  3PV8 A;  3RWU A;  1QSS A;  2OA8 A;  1VSH A;  3I8D A;  3SPY A;  2GV9 A;  1RTJ A;  3T19 A;  3OYA A;  2G8I A;  4CHY A;  1TAU A;  4FLX A;  2WOM A;  3BGR A;  3DRR A;  1J53 A;  2RF2 A;  1LAW A;  1FKO A;  4DU4 A;  4DMN A;  2KQ2 A;  1BGX T;  4KHN A;  2IGI A;  1S1U A;  1KLM A;  3HPO A;  1A5W A;  4M3X A;  1I3A A;  3QIN A;  3PX6 A;  5KTQ A;  4FJG A;  2XRI A;  1QSY A;  4DU1 A;  3OVN A;  3DRS A;  4H8K A;  3D45 A;  4CIF A;  1L3T A;  4HUF A;  2OZM A;  2QK9 A;  3EYZ A;  3AA2 A;  4EP5 A;  2R7Y A;  1IG9 A;  3RR8 A;  4B9M A;  4CEZ A;  2IS3 A;  3QEI A;  4FLY A;  1DTT A;  4FJ7 A;  5E41 A;  4DTO A;  4O0I A;  2F8S A;  1C0U A;  3MEC A;  3HST B;  3QEW A;  1D9D A;  3ZSV A;  5SZT A;  2KTQ A;  1HPZ A;  2FBV A;  1XWL A;  4W5O A;  2HB5 A;  3M8R A;  3OYN A;  1GOA A;  4F4K A;  1S1T A;  1DLO A;  4DQS A;  1JLC A;  4FW1 A;  4KO0 A;  4LH5 A;  4KHU A;  4FLZ A;  4DS4 A;  5T7B A;  3V4I A;  2IDO A;  2XY8 A;  4DLE A;  1BCO A;  4Y1C A;  4CJ5 A;  4RW6 A;  1RDC A;  4RW9 A;  4BWJ A;  1BHL A;  1WN7 A;  4H4M A;  4PQU A;  2VG6 A;  3B6P A;  3QO9 A;  3AV9 A;  5HRP A;  2XY6 A;  1U48 A;  3CM5 A;  4KB1 A;  1CZB A;  1QS4 A;  2BAN A;  3V1Q A;  3K5N A;  4ID5 A;  3OS2 A;  3SQ4 A;  4Z4E A;  2E4L A;  3KLE A;  1X9M A;  4AH9 A;  3D0P A;  3TAP A;  1RBV A;  4B08 A;  1TV6 A;  3KK3 A;  1RBT A;  2Z1G A;  1R0A A;  5FRM A;  2QKB A;  3MXJ A;  4NYF A;  4IG0 A;  3DLB A;  3RMD A;  2DFF A;  1S9E A;  4CK1 A;  3P83 D;  3OJS A;  4CK3 A;  4JRQ A;  1D5A A;  3SUO A;  3DYA A;  4FW2 A;  4FCY A;  3ZSQ A;  3AVK A;  3LWM A;  3SYZ A;  3SUP A;  2HVI A;  4FJ8 A;  4HHT A;  3MEE A;  1N5Y A;  3TAQ A;  4ICL A;  4R5P A;  1Q9Y A;  3BDP A;  4AHU A;  4KAZ A;  1TKT A;  1YTA A;  4HVJ A;  3HPG A;  3EZ5 A;  2PY5 A;  1IH7 A;  1LAV A;  3NF9 A;  4CGG A;  3WNG A;  3OJU A;  4DLG A;  5I3U A;  3ZSX A;  1C1B A;  5KGW A;  1HQU A;  2HHX A;  4F3T A;  3SNN A;  4FZX C;  3KKS A;  1HQE A;  3MED A;  4H4O A;  1T03 A;  1IKV A;  2JGU A;  1IKX A;  5C25 A;  1KVA A;  1VSJ A;  4FLT A;  4CER A;  4KI4 A;  1TAQ A;  4OGE A;  2W42 A;  1NK7 A;  5J2M A;  3NF8 A;  3WNE A;  3F73 A;  1NK9 A;  4CFD A;  3SV3 A;  2YHB A;  4N5S A;  4KTW A;  4CEQ A;  1SKS A;  2YKN A;  3ASM A;  4CJU A;  3AVM A;  3OYE A;  1T8E A;  5CYM A;  4FJJ A;  3ZSO A;  3HO1 A;  3V9Z A;  1ZBH A;  2DFH A;  3KD1 E;  3K5L A;  4ZTJ A;  1I39 A;  1Q8I A;  2F96 A;  4EP4 A;  3PO4 A;  2KFZ A;  1HNV A;  4O44 A;  1LW0 A;  4Z4I A;  4CJ3 A;  1S1W A;  1XHZ A;  1WSF A;  4OKK A;  4FM1 A;  1B9D A;  3SJJ A;  5JS1 A;  1XI1 A;  1JKH A;  4DG1 A;  2EHG A;  3OYC A;  2Z1I A;  1MU2 A;  3ZSW A;  2HMI A;  5C42 A;  3DLR A;  1HMV A;  3OYL A;  2G8U A;  3MXI A;  4C8N A;  1ASW A;  2KFN A;  1NK4 A;  1J9A A;  3TAE A;  2A1R A;  1NK6 A;  2OYQ A;  4CGI A;  1TGO A;  4GVM A;  4FJK A;  3P5J A;  1CXU A;  1NOZ A;  2RPI A;  5HRR A;  1TKX A;  4CHQ A;  5J2P A;  2KZM A;  2RN2 A;  3IAY A;  1C0T A;  1WAJ A;  3NGY A;  3VQ6 A;  3VQ5 A;  4FJH A;  4FXD A;  3TAG A;  1NJX A;  3P1G A;  2YV0 X;  1GOC A;  1U49 A;  1FXX A;  4LH4 A;  3ZT1 A;  2E6M A;  1RT4 A;  1J54 A;  3DLG A;  2PZS A;  4FJI A;  1ITG A;  4HUG A;  3NDK A;  3QER A;  4RG8 A;  3L2R A;  1WSJ A;  3O3F A;  5FRO A;  1NJY A;  4PWD A;  1WSG A;  1KRP A;  1KSP A;  4IG3 A;  4B8C A;  2ZQB A;  4PY5 A;  4CF1 A;  3ZT0 A;  4CF9 A;  3VA3 A;  1LV5 A;  4FVM A;  4AHC A;  1T05 A;  3TAN A;  1EKE A;  1TKD A;  1O1W A;  3L2U A;  2Z1J A;  1U45 A;  1RBS A;  4UQG A;  2VG5 A;  4DTJ A;  4DFM A;  1VSI A;  4E19 A;  2LSN A;  4ZHR A;  3LAN A;  5HRN A;  4M3Z A;  1WSH A;  3VQE A;  3L8B A;  5I42 A;  2HHT A;  4KHY A;  4L8R B;  4DTP A;  3O4N A;  4OLB A;  3QIO A;  3QLH A;  1NJZ A;  3HP9 A;  4FK2 A;  4BAC A;  2X6N A;  3JYT A;  3O3G A;  2HW3 A;  4J2E A;  2FBX A;  2D0A A;  1VSD A;  3LZJ A;  1X9W A;  3RMC A;  1YT3 A;  1FK9 A;  1TKZ A;  1VSL A;  3KTQ A;  1S1X A;  4AHS A;  3U3Y A;  3MEG A;  4CE9 A;  3SI6 A;  2QKK A;  1B9F A;  1VK0 A;  4DSL A;  3VQP A;  2B4J A;  4NYN A;  3K59 A;  3RTV A;  4Z4G A;  2A1S A;  3AO3 A;  5HRO A;  3AVG A;  1LWE A;  1SL2 A;  3ISN C;  3K5M A;  1NOY A;  2XHB A;  3K58 A;  1TVR A;  1QSL A;  1ASU A;  3AA4 A;  4E3S A;  1BQN A;  4FJN A;  1RTI A;  4CJP A;  3S3N A;  3DRP A;  2HHQ A;  1SUQ A;  3SCX A;  4I7F A;  5KRT A;  3DLH A;  3U3G A;  4DFK A;  3V6D A;  1DTQ A;  5KI6 A;  3SZ2 A;  1NJW A;  1UOC A;  3AVN A;  3DOL A;  2P5O A;  4E7I A;  4IKF A;  4J2D A;  4YNQ A;  4LD0 A;  4FJM A;  1IO2 A;  3NGI A;  1F21 A;  3TAM A;  3AO1 A;  2XY7 A;  2DFE A;  4E1N A;  3QEV A;  1S1V A;  3CM6 A;  3HXM A;  2B6A A;  3I0S A;  4CHZ A;  4DFP A;  3TWH A;  1ZBI A;  2EX3 A;  2OPQ A;  1RIL A;  3LAK A;  3LP3 A;  4FLV A;  1HNI A;  2Y1J A;  3CG7 A;  3RRH A;  2P5G A;  4N41 A;  4KRE A;  3ZT2 A;  1NKC A;  1JXB A;  3LZI A;  4W5R A;  2BDP A;  3RMA A;  1BI4 A;  3TI0 A;  1VSE A; 
#chains in the Genus database with same CATH topology
 4CGD A;  4BQZ A;  3V9U A;  2ZJR L;  2HBJ A;  4M3T A;  4OGC A;  4NO7 A;  3OYI A;  2P9I A;  3NF6 A;  4KPY A;  3FZL A;  1JJ2 M;  2G8V A;  5GIP A;  1KFD A;  1WBD A;  4DR6 K;  1QE1 A;  5TKW A;  4W5Q A;  3PLA A;  4B1U B;  3CJ7 A;  3P4I A;  1TK8 A;  4GV6 A;  4OPK A;  4N47 A;  4Z94 A;  1HX1 A;  4H5W A;  4I9Q A;  3RMB A;  4IFE A;  4CEF A;  1VQL N;  3VQ8 A;  1BA0 A;  1GLE G;  1LW2 A;  4QCL A;  1WOQ A;  4K43 A;  5C2F A;  4B3O A;  3HYF A;  3U6F A;  2BTF A;  4B1Z A;  1U4B A;  3LWL A;  1X3N A;  2A42 A;  4M3R A;  2HBL A;  1NBW A;  3OS1 A;  1K9M O;  4ISE A;  2FSN A;  4CZL A;  3O5B A;  5AFU H;  4E7H A;  4Z4H A;  4M7X A;  3ID6 A;  4F2S A;  5H1S Q;  3WNH A;  3D7E O;  1IKW A;  3HVR A;  2IVO A;  3FZF A;  5K14 A;  1TK0 A;  1RDA A;  4WYB A;  3ENB A;  4C8L A;  2YX6 A;  5F1X A;  4BRE A;  3C6U A;  2FSJ A;  2JWK A;  3THW A;  1XC9 A;  2HF4 A;  2VG7 A;  4KBO A;  3CYM A;  5BR9 A;  1QHT A;  3AVB A;  4WQ5 A;  4LY7 A;  3VEO A;  3WQU A;  3ZCM A;  3S9H A;  3NFA A;  4UY8 O;  5GAE P;  3J80 O;  3U8X A;  3IG1 A;  3PUF A;  4CCH A;  4FZZ A;  2JWL A;  4BE0 A;  4DCH A;  3HVT A;  3SAG A;  3L3V A;  4JI3 K;  3AO4 A;  4I2P A;  1HNW K;  1Q9X A;  4CEC A;  3RR7 A;  3VTH A;  3O08 A;  1HRH A;  4LSL A;  1S5J A;  3VQQ A;  3DMJ A;  4WQ4 A;  4BRQ A;  4CFA A;  5KRS A;  3HK2 A;  1U2V B;  5AQT A;  3C7N A;  3L4I A;  4FJX A;  5FRN A;  4C8M A;  4ILJ A;  3L6Q A;  2D0C A;  5HP1 A;  1EX4 A;  1L3S A;  4H0O A;  2QW9 A;  3ENO A;  3VET A;  2EWS A;  4DR4 K;  2YNH A;  1BIZ A;  4DQR A;  3HI0 A;  2G8K A;  4FJL A;  4DKW A;  4IDK A;  3SJH A;  3CFO A;  4MLE A;  3OA9 A;  3MWP A;  3T7Z A;  2X6S A;  2QA4 N;  3QBX A;  3AVH A;  3AVJ A;  5CZ1 A;  2O8F B;  1A5X A;  1EP4 A;  3J7Z O;  3ZX2 A;  1J5E K;  4DTX A;  3C6T A;  4RW7 A;  1Z6R A;  4JKD A;  3OY9 A;  3UE5 A;  3L3U A;  4O5B A;  5E84 A;  1KAX A;  1VQ6 N;  2Q0U A;  3EE9 A;  4CGH A;  4O55 A;  2DY4 A;  3DXM A;  3D2F B;  3K9J A;  2QTD A;  4C23 A;  2ZJQ L;  2HHW A;  4FWN A;  2WFB A;  2ETJ A;  1W9H A;  2O8C B;  3WEE B;  2Q36 A;  2YNG A;  3OS0 A;  5CYQ A;  1WLJ A;  5JS2 A;  5FPD A;  3WUH A;  4W5T A;  5BR8 K;  4X66 K;  4YOV A;  3HTV A;  4AHV A;  1NGH A;  1RT5 A;  1NKB A;  2IOC A;  2Z1H A;  4FZY A;  4MFB A;  4CF0 A;  4DV6 K;  4C1N K;  1W97 L;  1G99 A;  4FWL A;  3NBP A;  3BZK A;  4DTS A;  1EWR A;  3LDN A;  1RT1 A;  1HNX K;  2O8B B;  4M3U A;  3CQ8 A;  1WNS A;  4M3W A;  3TPQ A;  1DT9 A;  3CME N;  4CJS A;  3MAQ A;  2WC9 A;  2QI2 A;  4BRL A;  2NUB A;  2ZM6 K;  3A5O C;  3P31 A;  4CJE A;  1VQK N;  1FW6 A;  3ZSR A;  4FK0 A;  5FDL A;  1NM1 A;  3G6E N;  3VEW A;  2HNZ A;  1YHQ N;  3T69 A;  3F9M A;  3BZC A;  3TAR A;  4FLW A;  3LPT A;  4LFA K;  1NGI A;  3E9L A;  2OTL N;  4X65 K;  1M1K O;  4KTQ A;  1GLF O;  4B1W B;  4EZ9 A;  1RCH A;  3PV8 A;  3RWU A;  2OA8 A;  3O1W A;  3O6W A;  2VQE K;  3T19 A;  4FOE A;  4PL8 A;  4DU4 A;  1IJJ A;  1FKO A;  4DMN A;  2VWB A;  3UKU B;  1P8Z A;  3L0Q A;  4CZJ A;  3O80 A;  1S1U A;  3QIN A;  4EIA A;  4GY2 B;  3I55 N;  4BR7 A;  1QSY A;  1Q82 O;  3OVN A;  4CIF A;  3D45 A;  2P9L A;  4CBU A;  4HUF A;  1VQ7 N;  3EYZ A;  4XH4 A;  1X9J A;  3RR8 A;  3QEI A;  2F8S A;  1DTT A;  4FJ7 A;  4DTO A;  1C0U A;  1D9D A;  5SZT A;  3A5N C;  3JAM O;  1HPZ A;  2HB5 A;  4BR0 A;  3M8R A;  3KVG A;  4F4K A;  1RFQ A;  4FWO A;  5T7B A;  3U4L A;  2XY8 A;  3V4I A;  4DLE A;  4RW6 A;  1RDC A;  3H3N O;  3B6P A;  2BUP A;  3CPW M;  4JKF A;  4MO5 A;  1EWQ A;  3K5N A;  4ID5 A;  4IO9 L;  1K8K B;  1S22 A;  2E4L A;  1KD1 O;  3KK3 A;  1RBT A;  3FR0 A;  2UXB K;  2DFF A;  4CK3 A;  3EKU A;  3EN9 A;  1D5A A;  2CGJ A;  3AVK A;  1WBB A;  1N5Y A;  1K8A O;  1R59 O;  3JS6 A;  1TKT A;  1YTA A;  2PY5 A;  1YJ9 N;  3NF9 A;  1LAV A;  4DLG A;  2I7P A;  3SBT A;  3SBG A;  4C1N I;  2UXC K;  1NNE A;  2NZT A;  1IKV A;  3KZB A;  5C25 A;  1KVA A;  1VSJ A;  4FLT A;  4KI4 A;  2W42 A;  1NK9 A;  5J2M A;  4HWI A;  3F73 A;  2YHB A;  4N5S A;  5AQV A;  4Q0B A;  2A6A A;  4CJU A;  5C2D A;  3FE1 A;  3V9Z A;  3TTF A;  4ZTJ A;  1Q8I A;  1HNV A;  4R79 A;  1LW0 A;  4MDB A;  4XH5 A;  5JS1 A;  3UB5 A;  4BC2 A;  4DG1 A;  2EHG A;  3OYC A;  2HMI A;  3OYL A;  1Q86 O;  3MXI A;  2KFN A;  3O9T A;  1NK4 A;  2OYQ A;  4BRA A;  2A1R A;  3K0S A;  2NRV A;  3S41 A;  1CXU A;  2W41 A;  4CHQ A;  4I6M B;  3O9S A;  1WAJ A;  2QWR A;  1YUW A;  4IZ9 A;  1NJX A;  2E6M A;  1RT4 A;  3DLG A;  3A5L C;  1HR0 K;  2UYT A;  4FVU A;  4DV1 K;  1WSJ A;  5FRO A;  5AQG A;  5BPN A;  1KRP A;  4CF1 A;  4CF9 A;  3IKM A;  3I56 N;  1O1W A;  2A3Z A;  4K42 A;  3L2U A;  3WXJ A;  1W2B M;  3MX5 A;  4UQG A;  4BRI A;  2LSN A;  1ZXO A;  1LCU A;  3EE8 A;  4IEE A;  4BC4 A;  4CI6 A;  1NGA A;  2HOE A;  4E1J A;  1OVQ A;  1NJZ A;  3HP9 A;  4FK2 A;  3R3L A;  3ZLJ A;  4J2E A;  4EAH D;  1VSD A;  3LZJ A;  2E1Z A;  5DM7 L;  1FK9 A;  4LF6 K;  1VQO N;  4LF8 K;  3U3Y A;  2QKK A;  2CH6 A;  4QS7 A;  4Z4G A;  1N32 K;  3O1B A;  1SL2 A;  2KLA A;  3ISN C;  3O4W A;  1TVR A;  1QSL A;  4O8K A;  4E3S A;  5FPE A;  4WQ5 C;  3S3N A;  3SCX A;  1E4F T;  5AR0 A;  3V6D A;  3QIC A;  3CI5 A;  5LMN K;  4BRH A;  2P5O A;  5BRD A;  4YNQ A;  4XH1 A;  1IO2 A;  3DWL A;  1F21 A;  3QB0 A;  3LDQ A;  4E1N A;  4PKH A;  1MWK A;  1D4X A;  5LL6 Z;  2O8D B;  4CHZ A;  3TWH A;  5FLX O;  2O8F A;  1ZBI A;  3MN9 A;  4MO4 A;  3ENH A;  4KRE A;  2P5G A;  4BRG A;  2D1K A;  3LZI A;  5ADX H;  4YOW A;  4K8X A;  5ELZ A;  2HF3 A;  3V9X A;  3LP2 A;  3QIP A;  1SL1 A;  3D2F A;  5HLF A;  4KB0 A;  3IDH A;  4CJL A;  1GLL O;  2X78 A;  3VGL A;  3AVA A;  3N4P A;  4NCG A;  3WEE A;  4ID1 A;  2P9U B;  2P9S B;  2D0B A;  2ZD1 A;  2W6L A;  3ZT3 A;  1BIS A;  3DLL L;  2XO7 A;  3G71 N;  1N6Q A;  4BDY A;  3M8S A;  1IKY A;  4FLU A;  3H6E A;  4F2R A;  2HHU A;  2F9T A;  2FSK A;  3SQ0 A;  1Q7Y O;  3JXU A;  1BL3 A;  2D4W A;  1V4T A;  1G15 A;  3CHW A;  4B1X B;  3NF7 A;  3VQD A;  3KJV A;  2O8B A;  3MK6 A;  4B1V A;  2IVP A;  3MCA B;  3D2E B;  4CD1 A;  1C0G A;  3VN5 A;  4J2B A;  2ASP A;  4DSI A;  1U47 A;  3K57 A;  4B9U A;  3SQ2 A;  3E66 A;  1Z25 A;  1ZBU A;  2HBM A;  4DWI A;  3BEX A;  1XUP O;  2OCE A;  1YI2 N;  4BRN A;  1RT2 A;  1BCM A;  3H1Q A;  3ZET B;  5D3G A;  3V1R A;  1BQM A;  1TL3 A;  4I9L A;  1U04 A;  1JLG A;  4KV8 A;  4WFB L;  3OYF A;  4B9V A;  2E2N A;  2D5R A;  5DK5 A;  3R9P A;  5BPM A;  4GMJ B;  4CJK A;  1YJN N;  3PX4 A;  5JVG L;  1NK8 A;  1XHX A;  3VQ9 A;  3EO3 A;  2JLE A;  3AA5 X;  3RRG A;  3HPH A;  3UKU A;  1BWF O;  3O8M A;  1JL1 A;  1XMQ K;  3CET A;  4G9Z A;  4CEB A;  1B92 A;  1D9F A;  4IFY A;  1BDG A;  3WNF A;  4DSE A;  4PKG A;  4O4G A;  4FM2 A;  2I5J A;  4JK9 A;  5AZI B;  2RKI A;  4OJR A;  4HCB A;  2O4G A;  4NXM K;  3WXI A;  3W3D A;  4KI6 A;  3VES A;  5CHI A;  3DLE A;  1GLB G;  3TSU A;  2VWJ A;  1N34 K;  4CZM A;  2P9N B;  1ZBS A;  2IAJ A;  3WT0 A;  3ZEU B;  4EZ6 A;  3V9W A;  4MQ3 A;  5AQI A;  4BDP A;  4DR1 K;  1O13 A;  1VQN N;  1K8K A;  1S3X A;  2OAN A;  4CEE A;  2Q97 A;  3WXK A;  1VHX A;  5EU7 A;  3OYH A;  3KLI A;  2F7T A;  4A2A A;  1RBU A;  3ZX3 A;  3EY1 A;  3IRX A;  3VEV A;  2WON A;  3TAF A;  3V1O A;  2E20 A;  1ZYQ A;  1C6V A;  4DTN A;  4BG9 A;  3VQB A;  4JLH A;  1JLE A;  2E8A A;  2Y1I A;  1YTU A;  4W5N A;  2UXD K;  1RBR A;  4H0T B;  5AQU A;  4DTM A;  2VGN A;  4JK8 A;  4YDU C;  3AVF A;  3R8E A;  1JLQ A;  1GLD G;  1KQS M;  3TAB A;  4K8Z A;  2QWM A;  2HHH K;  4FJ5 A;  5SWM A;  3J7A P;  1YVU A;  1HKG A;  5GIO A;  2QWP A;  4JEP A;  4QOZ B;  2HND A;  4RW8 A;  2P51 A;  4KTZ A;  4DB3 A;  4H0Y B;  4B8A B;  1WAF A;  4Z4C A;  1JL2 A;  3KK7 A;  2E1Y A;  3FZK A;  4CED A;  2VYP A;  3NH1 A;  4NCB A;  1ZBL A;  4IO8 A;  2ZE2 A;  5AQX A;  1RTD A;  5I9E B;  1HJO A;  4I6M A;  4E7L A;  1OVY A;  1JLB A;  5GIN A;  4DSJ A;  3U9Z A;  1KLN A;  4IOC L;  3P38 A;  1GLA G;  4KHQ A;  3J8A A;  4OPH A;  4HTU A;  1C0M A;  3KKR A;  4GNI A;  3CCQ N;  1L3V A;  4U7B A;  1RDW X;  1D8Y A;  4LF4 K;  4QS8 A;  2FBT A;  3OYK A;  4OKJ A;  4JV5 K;  3QNO A;  5M1O A;  4OPJ A;  3LP0 A;  1H1V A;  4YFU A;  3ITH A;  4CIE A;  2QXF A;  4CF8 A;  1QZ5 A;  4CEO A;  3QBW A;  4ISG A;  4B1Y B;  2F9W A;  4DR7 K;  3OYA A;  1TAU A;  2GEM A;  4ILH A;  3DRR A;  1J53 A;  1YJW N;  4DUZ K;  3HPO A;  1A5W A;  3PX6 A;  2XRI A;  2FF3 B;  4H8K A;  1VQ8 N;  2J4R A;  1L3T A;  3AA2 A;  4EP5 A;  4JI5 K;  3PSI A;  4FLY A;  3HST B;  5F0X A;  4JI0 K;  3C6A A;  2O8D A;  2FBV A;  5M1N A;  1GOA A;  3SAH A;  4DQS A;  3T1H K;  4KHU A;  4LH5 A;  4A57 A;  4GKJ K;  4DS4 A;  3SMP A;  3M6G A;  1BCO A;  4H5V A;  4Y1C A;  3TTC A;  1BHL A;  3IUC A;  1WN7 A;  4FOI A;  4H4M A;  3QO9 A;  3AV9 A;  4BC5 A;  5HRP A;  4KB1 A;  3CM5 A;  3THY B;  5HOO A;  2ZGZ A;  5AQS A;  3OS2 A;  3KLE A;  1X9M A;  4AH9 A;  2AA4 A;  5E26 A;  1RBV A;  2P9U A;  2P9S A;  4B08 A;  4B3R K;  1NMN A;  5FRM A;  1KAY A;  1SS6 A;  4RWT A;  1YIJ N;  3DLB A;  3RMD A;  1S9E A;  3SUO A;  3LWM A;  4NLC A;  5FPM A;  3SYZ A;  2HVI A;  4FJ8 A;  1Q9Y A;  4ICL A;  1DGK N;  5BN9 A;  4AHU A;  4KAZ A;  4JI2 K;  4HVJ A;  3HPG A;  4YOU A;  3GDQ A;  3ZSX A;  1C1B A;  3HSC A;  5KGW A;  2QWN A;  4F3T A;  3SNN A;  3KKS A;  1HQE A;  4A61 A;  4FWS A;  1Q18 A;  2E88 A;  3D2E A;  4OGE A;  4FPB A;  3NF8 A;  2YI1 A;  4CJ7 A;  4K41 A;  4KHN A;  4KTW A;  2YKN A;  3ASM A;  4CZH A;  3AVM A;  2ZGY A;  3OYE A;  1ZBH A;  2E5L K;  3K5L A;  2PAV A;  4IWV A;  2F96 A;  2KFZ A;  3PO4 A;  1IBL K;  1XHZ A;  1NGB A;  1N36 K;  4BRC A;  1XI1 A;  3ZET A;  1MU2 A;  4BR2 A;  1HMV A;  2G8U A;  4OX9 K;  3RVC A;  4A62 A;  1OKJ A;  4GVM A;  5HRR A;  1TKX A;  2RN2 A;  3IAY A;  1C0T A;  3NGY A;  1WB9 A;  3VQ5 A;  1XMO K;  1U49 A;  1GOC A;  1NGC A;  1J54 A;  1YIT N;  3VGM A;  3H1V X;  3CJ9 A;  3O3F A;  1NJY A;  3C65 A;  3A0I X;  1KSP A;  4IDH A;  4B8C A;  3ZT0 A;  4FL9 A;  4FVM A;  4E19 A;  2CGK A;  2GWK A;  4ZHR A;  5AZI A;  5I42 A;  3VF2 A;  4WCE L;  1ATR A;  1ZC6 A;  2FBX A;  4A59 A;  4NLB A;  3W0L A;  1YT3 A;  1VQP N;  1TKZ A;  3R6M A;  4AHS A;  4CE9 A;  5B8H A;  4FPA A;  3QFP A;  2B4J A;  4NYN A;  3BUZ B;  3RTV A;  2A1S A;  2P9N A;  3EZW A;  3ZEU A;  3AVG A;  3K5M A;  2YJF A;  1OH6 A;  1BQN A;  4YDU A;  4FJN A;  3ULE A;  4CJP A;  2HHQ A;  4I7F A;  4OPA A;  3U3G A;  4DFK A;  4JNE A;  3AVN A;  4DR5 K;  4E7I A;  1KC8 O;  3DJC A;  4LD0 A;  5AQL A;  1TUU A;  3HOT A;  3SAF A;  4H0X B;  2P9K A;  2XY7 A;  1SQK A;  3QEV A;  3CM6 A;  3GE1 A;  4DFP A;  2YJE A;  5JLH A;  4N41 A;  3CG7 A;  2BDP A;  3RMA A;  5GAH P;  3TI0 A;  3ULD A;  3SLC A;  3VQ4 A;  4WF9 L;  5J2N A;  3AO2 A;  2YCH A;  1W0H A;  4JRP A;  3DI6 A;  5BRF A;  4B3T K;  1RTH A;  1TUY A;  4OVL A;  2OPR A;  4DTR A;  3LDP A;  3KK1 A;  4M45 A;  4CGJ A;  3VQC A;  4OLA A;  3F2K A;  2YHY A;  2NLX A;  4QAG A;  1RT6 A;  3NE6 A;  4B9L A;  3NH2 A;  3CC2 N;  1UWB A;  4FWK A;  3NGZ A;  1C1C A;  1LWF A;  1ATS A;  4BRF A;  4B9T A;  2F8T A;  4JKE A;  1SL0 A;  4C8O A;  4AF1 A;  4CJV A;  1RNH A;  2QWQ A;  3L2W A;  3WXM B;  4JS4 A;  3SUN A;  1EO1 A;  1CZ9 A;  4CHO A;  4AQY K;  1TYQ B;  3LDL A;  4Z0U A;  1L5U A;  3I0R A;  2G8H A;  4TSX A;  2AJQ A;  3T1A A;  3P39 A;  4J2A A;  3DAW A;  4PA1 A;  3K9K A;  1NG9 A;  3T3F A;  4QS9 A;  3G0Z A;  4JS5 A;  1DEJ A;  1RT7 A;  3A8Y A;  4BGA A;  1GOB A;  4CEA A;  4CJT A;  4Y0W A;  3N4Q A;  3OYM A;  3L2Q A;  3AGR A;  3OBY A;  2QEX N;  4NCA A;  4FWQ A;  4WE1 A;  4DFJ A;  4DQQ A;  2GEL A;  2YNF A;  2YNI A;  4KHS A;  1A5V A;  1KCF A;  3OYG A;  1MWM A;  5BRH A;  3CD6 N;  2HHS A;  3G10 A;  2DTU A;  4U67 L;  5C0Y A;  3KK2 A;  5AQJ A;  3VOV A;  3NAE A;  3DXK B;  3LAL A;  4DV2 K;  2YHW A;  4CF2 A;  4V19 S;  4DQI A;  2ZF5 O;  3O4Q A;  4Y1D A;  4BR9 A;  2NRX A;  3KLH A;  1XNR K;  3CCS N;  3MCP A;  3HT3 A;  4DSK A;  2YHX A;  2HNY A;  3LL3 A;  3S3O A;  4Z4F A;  3FFI A;  4ELV A;  4FM0 A;  4JI4 K;  2UU9 K;  1EET A;  4AM7 A;  3OYD A;  1ASV A;  4BRO A;  4BE1 A;  4GW6 A;  5EOY A;  1VSK A;  1NU0 A;  3GG4 A;  1UA0 A;  4KH5 A;  1OH8 A;  3THY A;  2QXL A;  4F9O A;  2BH1 A;  1CXQ A;  3T1Y K;  4DV5 K;  1LWC A;  4IBN A;  4ELT A;  5EXW A;  2IVN A;  3L2V A;  1EXQ A;  4NXN K;  3J81 O;  3VTI A;  2VGM A;  3DM2 A;  3HP6 A;  1ZBF A;  4DSF A;  1NJI O;  2NRR A;  3CFP A;  4AHT A;  3M8Q A;  4M7Y A;  1JXE A;  4JAX A;  4B9Q A;  1HYV A;  5HBM A;  4LC9 B;  3QNN A;  1JLF A;  3THV A;  1W7A A;  5J2Q A;  2P1J A;  3NH0 A;  4MDA A;  3PX0 A;  2FF6 A;  1BI4 B;  4HUE A;  4HCC A;  2YHA A;  3C95 A;  1WSI A;  3OYB A;  3H45 C;  3S3M A;  4RW4 A;  3C94 A;  3NVK A;  3QEX A;  1IBK K;  3JSM A;  2PYJ A;  4YOY A;  3AGK A;  3ZT4 A;  3HBT A;  3O9R A;  3V81 A;  3H3O B;  3OHR A;  1KTQ A;  1VQ4 N;  4BY9 C;  2PYL A;  5EY4 A;  4CD3 A;  1VRU A;  5C12 A;  5KQ8 A;  1SKW A;  1S6Q A;  3K2P A;  5AQH A;  3CC7 N;  4AHR A;  1T6D A;  1XQS C;  4BDZ A;  4DTU A;  2OPP A;  1JLA A;  2KHO A;  1T7P A;  5AFU A;  3AVI A;  3VQA A;  3KLF A;  2A5X A;  2FBY A;  4KFB A;  3SQ1 A;  4JI7 K;  4IOA L;  2D0O A;  2G8W A;  1HYS A;  3NHG A;  4N76 A;  4DR3 K;  3LDS A;  4DV4 K;  3SMS A;  3AA3 A;  4FWP A;  4EHT A;  5J1E A;  5M1P A;  2HVH A;  2OPS A;  5DMR A;  2UUB K;  4C8K A;  2OZS A;  1N33 K;  2HHV A;  1BIU A;  3MWT A;  5IWA K;  3ALY A;  3ID8 A;  4FSV A;  2NRT A;  1RDB A;  3MN7 A;  5AQK A;  1TL1 A;  4ELU A;  2BGG A;  1JCG A;  3HJF A;  4CFB A;  4CJF A;  1VSM A;  3VMF B;  3CMA N;  1QSS A;  4JYA K;  2GV9 A;  4B3M K;  4CHY A;  4BC3 A;  2E2O A;  2WOM A;  4FLX A;  2RF2 A;  1LAW A;  3KHY A;  2KQ2 A;  1BGX T;  1OH7 A;  1BOT O;  4FJG A;  4CZI A;  3VEZ A;  4NB4 A;  2OZM A;  4JN4 A;  2QK9 A;  2R7Y A;  1WUA A;  2ASM A;  1IG9 A;  1MDU B;  2IS3 A;  5E41 A;  4O0I A;  3MEC A;  3ZSV A;  5BN8 A;  2KTQ A;  1HKB A;  4JI8 K;  1XWL A;  4W5O A;  3ULE B;  5MLC Q;  2H3G X;  3AY9 A;  1S1T A;  1DLO A;  4FW1 A;  4KO0 A;  5AQM A;  2IDO A;  3LM2 A;  4CJ5 A;  1VQ9 N;  3THX B;  5KPT A;  4IJN A;  4RW9 A;  1NLV A;  4PQU A;  2VG6 A;  4LF7 K;  2XY6 A;  2P9K B;  1QS4 A;  5EVZ A;  4Z4E A;  3D0P A;  1R0A A;  1TV6 A;  1FJG K;  3CCV N;  2QKB A;  3CQY A;  3MXJ A;  4ISF A;  1KXP A;  3P83 D;  3DYA A;  5AQO A;  5DM6 L;  3ZYY X;  3SUP A;  4HHT A;  3BDP A;  3TAQ A;  4HTL A;  5AQN A;  3CC4 N;  3EZ5 A;  4CGG A;  4CZG A;  5I3U A;  3WNG A;  2IIR A;  2HBK A;  1I94 K;  3CCE N;  2QWL A;  3MED A;  4H4O A;  3RSE B;  2JGU A;  1NGE A;  1HLU A;  4CER A;  1TAQ A;  3UKR B;  1TYQ A;  4CZK A;  4RTF D;  4BRD A;  3FGU A;  3WNE A;  4CFD A;  2HHX A;  1SKS A;  5CYM A;  4CBW A;  3ZSO A;  1GLJ O;  1QVF M;  1J6Z A;  3HO1 A;  2DFH A;  3BF1 A;  3KD1 E;  1I39 A;  4GV3 A;  3MMV A;  4Z4I A;  2GTD A;  1WSF A;  4OKK A;  4FM1 A;  1B9D A;  3GOI A;  1JKH A;  2Z1I A;  3ZSW A;  1Z05 A;  1NK6 A;  1J9A A;  4CGI A;  3P5J A;  2RPI A;  3AAR A;  5J2P A;  4XEI A;  3EEQ A;  4FJH A;  2AP1 A;  3P1G A;  2YV0 X;  1FXX A;  2ZJP L;  3DXK A;  2PZS A;  1M90 O;  2NRH A;  1CZA N;  4CVN E;  4HUG A;  3NDK A;  3QER A;  4RG8 A;  4BR5 A;  1WSG A;  3CCR N;  4IG3 A;  2GWJ A;  4H0P A;  1LV5 A;  4AHC A;  1EKE A;  1TKD A;  4JKC A;  3D6R A;  2Z1J A;  1U45 A;  4DFM A;  2VG5 A;  4DTJ A;  5KPR A;  4JI1 K;  3LAN A;  4AM6 A;  5HRN A;  1WSH A;  1Q81 O;  3VGK A;  3O4N A;  3QLH A;  1IV0 A;  1MA9 B;  3O3G A;  5AZJ B;  2HW3 A;  4KH4 A;  3RMC A;  3VPZ A;  1V4S A;  3SI6 A;  1B9F A;  4DSL A;  1E4G T;  3VQP A;  1BUP A;  3TSQ A;  2E2P A;  5HRO A;  1NOY A;  3AA4 A;  1RTI A;  3DRP A;  1SUQ A;  5KRT A;  3DLH A;  1KAZ A;  4JKH A;  1DTQ A;  5KI6 A;  3SZ2 A;  1NJW A;  1UOC A;  4YY3 K;  3DOL A;  4YHH K;  3CER A;  4FJM A;  3NGI A;  3R1X A;  1XNQ K;  3AO1 A;  1QQN A;  2DFE A;  4IJA A;  1S72 N;  1HUX A;  3MN5 A;  3HXM A;  3I0S A;  4BRM A;  2OPQ A;  1RIL A;  3CQX A;  3IFR A;  4JHD B;  3LAK A;  3LP3 A;  5M1Q A;  3ZT2 A;  4DV7 K;  4GVE A;  1BI4 A;  2V7Y A;  4BQL A;  1QVG M;  4M41 A;  3GBT A;  4E1M A;  4BG8 A;  4E0D A;  3NCI A;  4F8R A;  3KWI A;  5C24 A;  2B5J A;  4FWM A;  2BE2 A;  4I2Q A;  3V9S A;  3KWG A;  4G1Q A;  4B9N A;  1NKE A;  3PIP L;  2KW4 A;  4BWM A;  2KKZ A;  3E9O A;  4JD2 B;  4IFV A;  3MDQ A;  3AVC A;  4JKG B;  5LJW A;  3MX2 A;  4DV3 K;  3VQ7 A;  2QM1 A;  4H5N A;  2ITM A;  3DOK A;  3FLC O;  3C6H A;  4KRF A;  5AQR A;  4CES A;  4BVP A;  3ZSZ A;  5AQP A;  2GBZ A;  4CJW A;  3KLG A;  4FYD A;  3B8A X;  5KGX A;  3PO5 A;  3M8P A;  4DUY K;  4KHW A;  2A41 A;  1WSE A;  3HM9 A;  2ZWH A;  5CY4 A;  3CCM N;  2PFU A;  4PL7 A;  3PY8 A;  2FLO A;  3UIQ A;  2RHK A;  3E9P A;  1EQY A;  3HZ6 A;  4CK2 A;  4A5A A;  1Z26 A;  1JCE A;  4BRP A;  3KD5 E;  4F3O A;  4O8U A;  5KQD A;  3QML A;  4CFC A;  4DF4 A;  3QES A;  3J7Y P;  4CJR A;  3F9K A;  4Q5V A;  4XIU A;  4IOX A;  1VSF A;  4E7J A;  2NRW A;  4CJ4 A;  4DS5 A;  5M1F A;  3GL1 A;  5AQW A;  4DU3 A;  3Q7B A;  1UA1 A;  2VQF K;  1HYZ A;  3VA0 A;  2YKM A;  2Q3S A;  4JK7 A;  1X9S A;  4GKK K;  2G8F A;  1NK0 A;  4FWR A;  2P9P B;  4B9S A;  4KKO A;  2KZZ A;  2QWO A;  3KIO A;  2X74 A;  4CGF A;  4M3Y A;  3OTO K;  3LDO A;  3VF4 A;  3M3Z A;  3CJA A;  3B6O A;  4DQP A;  4LFC K;  4DR2 K;  1JCF A;  1SV5 A;  3SV4 A;  3QET A;  1J5O A;  1RDU A;  1BG3 A;  4BR4 A;  4H5T A;  3VER A;  1KFS A;  3LAM A;  3L4Q A;  3TSP A;  3A2F A;  2E6L A;  5GAD P;  1K6Y A;  4ZTF A;  2GX9 A;  4CHN A;  1CLQ A;  3MXM A;  2O8E B;  4CIG A;  4WFN L;  1X3M A;  1C1A A;  1QQC A;  2XY5 A;  1XC3 A;  1OH5 A;  1S6P A;  2V52 B;  3THX A;  3E01 A;  2GUP A;  2WBN A;  2E2Q A;  5HRS A;  4PUO A;  1NK5 A;  3EL2 A;  4BE2 A;  5LJV A;  2HST A;  1X1P A;  4FK4 A;  5EX5 A;  3ATV A;  1IBM K;  2NRZ A;  4AIL C;  4LF9 K;  3CJB A;  3LP1 A;  5ADX A;  4M42 A;  2FC0 A;  2ATQ A;  3U9D A;  3SUQ A;  2NNW A;  3EKS A;  3AO5 A;  2Q0R A;  2W40 A;  4KH6 A;  1UAX A;  1L3U A;  4O0J A;  3BP8 A;  1HPM A;  4E89 A;  3TTD A;  2VWK A;  1SZ2 A;  2IC3 A;  4CHP A;  1TK5 A;  5KPZ A;  3CFR A;  4FJ9 A;  3AVL A;  3IS9 A;  1QTM A;  3RSE A;  1SAZ A;  2FXU A;  5F2R A;  4A2B A;  1K73 O;  2PBD A;  4L3Q A;  3UKR A;  2ITG A;  2P9I B;  1RT3 A;  4YOX A;  5AQZ A;  5GAG P;  5IT9 O;  5A2Q O;  4PHT X;  5JIC A;  3AAQ A;  1RDD A;  4O5F A;  5C10 A;  3CPE A;  4OKE A;  5FPN A;  4LFB K;  3E1Y A;  3HL8 A;  1QZ6 A;  4DF8 A;  3LM9 A;  3O3H A;  1KVB A;  1Y97 A;  1LOT B;  2GUI A;  4E7K A;  3SK3 A;  3K5O A;  1ATN A;  4A5B A;  1NGJ A;  2CGL A;  3TR8 A;  3DLK A;  4DV0 K;  2I7N A;  1REV A;  3OYJ A;  4DHY A;  3WXL A;  4B3S K;  3QFU A;  4LSN A;  1HJR A;  3CJC A;  4H03 B;  4H0V B;  3CCU N;  2VCP A;  3LPU A;  2D0P A;  3SPZ A;  1QQO A;  1NGG A;  1VQM N;  3IMX A;  3ZSY A;  3H08 A;  5CR4 A;  4N56 A;  1SKR A;  3QEP A;  1VRT A;  1BA1 A;  2O4I A;  3ZX0 A;  1KVC A;  5CZ2 A;  1FKP A;  5AZJ A;  3THW B;  4CJQ A;  1S9G A;  5C15 A;  3G4S N;  4LF5 K;  1VSH A;  4JKB A;  3I8D A;  3HOS A;  3SPY A;  1VQ5 N;  1RTJ A;  2G8I A;  3BGR A;  3H46 O;  4JI6 K;  4CZE A;  4IXC A;  4CZF A;  4EHU A;  2IGI A;  1KLM A;  4EFH A;  4M3X A;  4KHP K;  1I3A A;  5KTQ A;  3NVM A;  1N8R O;  4DU1 A;  1IG8 A;  1VAZ A;  3DRS A;  3I8B A;  3VEN A;  3BY5 A;  4OO1 J;  1NGF A;  1U2V A;  4B9M A;  4CEZ A;  5AQF A;  5JMV A;  3QEW A;  1U6Z A;  2DPN A;  3I33 A;  3ATU A;  3MN6 A;  4JHD A;  3OYN A;  2Q1N A;  4IEI A;  5AJ3 K;  1JLC A;  1YAG A;  4BRK A;  4FLZ A;  3CJ1 A;  3G25 A;  1E3M A;  3CXC M;  2CH5 A;  4BWJ A;  1HKC A;  2V51 B;  3PSF A;  1ILY A;  1U48 A;  4X64 K;  5LMU K;  3F5T A;  1CZB A;  2BAN A;  3BF3 A;  3C7N B;  3V1Q A;  2WTU A;  3HRG A;  3O9U A;  4PKI A;  3SQ4 A;  3M1F A;  3M5R A;  1NMD A;  3TAP A;  3NMU A;  2Z1G A;  3C0B A;  1QHA A;  5LY3 A;  3QDK A;  4NYF A;  4JD2 A;  4IG0 A;  4CK1 A;  3OJS A;  4JRQ A;  4JKG A;  4WFA L;  4FW2 A;  1BO5 O;  3FFK B;  4DQ8 A;  3ZSQ A;  4FCY A;  3A5M C;  3MEE A;  4YOR A;  4WQ4 C;  4R5P A;  2O8C A;  1BU6 O;  4H5R A;  4K0K K;  2ASO A;  1IH7 A;  3OJU A;  4K25 A;  1HQU A;  3FZH A;  5JVH L;  4FZX C;  4CBX A;  1C0F A;  1T03 A;  3CCL N;  1IKX A;  4J8F A;  3DXM B;  4JKA A;  1T3V A;  1NK7 A;  4YOT A;  3AAP A;  3SV3 A;  1YVN A;  4CEQ A;  3Q7C A;  1T8E A;  4FJJ A;  1T44 A;  2W6K A;  4MLH A;  4EP4 A;  1RGI A;  2Q31 A;  4O44 A;  2Q2R A;  4CJ3 A;  1S1W A;  3HM8 A;  5CE3 A;  1DKG D;  1YXQ A;  3SJJ A;  1HNZ K;  5HL7 L;  5C42 A;  1GLC G;  3DLR A;  2UUA K;  4C8N A;  1ASW A;  3TAE A;  4FJK A;  1TGO A;  1NOZ A;  2KZM A;  2P9P A;  3VQ6 A;  4FXD A;  3TAG A;  4M63 C;  1P90 A;  4LH4 A;  3ZT1 A;  4ILG B;  4BGB A;  2RE2 A;  4FJI A;  1ITG A;  3WQT A;  4RCH A;  3L2R A;  5M1K A;  4PWD A;  4PY5 A;  2ZQB A;  3VA3 A;  4GV9 A;  4BVO A;  1T05 A;  3TAN A;  2HMP A;  1RBS A;  1ESV A;  1NWK A;  1VSI A;  3CIP A;  1NGD A;  4M3Z A;  3OBW A;  3VQE A;  3L8B A;  2HHT A;  4KHY A;  4L8R B;  4DTP A;  4OLB A;  2O8E A;  3QIO A;  3CCJ N;  4BAC A;  2X6N A;  3VEY A;  3JYT A;  2D0A A;  2UUC K;  1X9W A;  5BRE A;  1VSL A;  3KTQ A;  1S1X A;  3MEG A;  2F4V K;  1QQM A;  1VK0 A;  2WUS A;  5BPL A;  3O9Q A;  3VF6 A;  3K59 A;  2OTJ N;  3AO3 A;  1LWE A;  1T6C A;  5AQY A;  2XHB A;  3K58 A;  1ASU A;  4FO0 A;  5TKY A;  4X62 K;  1Y64 A;  2A40 A;  4IKF A;  4J2D A;  2P9L B;  2V7Z A;  3TAM A;  4CW7 B;  1YF5 L;  1S1V A;  3CF5 L;  2B6A A;  3FZM A;  5AQQ A;  2EX3 A;  3VEX A;  5JLF A;  2Y1J A;  3OW2 M;  4FLV A;  1HNI A;  3TU5 A;  3RRH A;  3PIO L;  1NKC A;  1JXB A;  4W5R A;  1VSE A; 
#chains in the Genus database with same CATH homology
 4CGD A;  3ULD A;  4K8X A;  3V9U A;  5J2N A;  3VQ4 A;  4DTN A;  4M41 A;  3AO2 A;  3LP2 A;  3QIP A;  3V9X A;  1SL1 A;  4E1M A;  4M3T A;  5HLF A;  1W0H A;  4JRP A;  4KB0 A;  4OGC A;  4E0D A;  3NCI A;  4CJL A;  3DI6 A;  3OYI A;  3NF6 A;  4F8R A;  5C24 A;  2X78 A;  4KPY A;  3AVA A;  1RTH A;  4OVL A;  2OPR A;  2B5J A;  4DTR A;  3KK1 A;  4NCG A;  2G8V A;  4M45 A;  2BE2 A;  4CGJ A;  4I2Q A;  3VQC A;  3V9S A;  1KFD A;  4ID1 A;  4OLA A;  4G1Q A;  4QAG A;  4B9N A;  4Q0B A;  1QE1 A;  1RT6 A;  4W5Q A;  3NE6 A;  1NKE A;  2D0B A;  2KW4 A;  4BWM A;  4B9L A;  1TK8 A;  2ZD1 A;  3NH2 A;  1UWB A;  4FJ9 A;  3ZT3 A;  4OPK A;  4IFV A;  1BIS A;  1N6Q A;  4N47 A;  2XO7 A;  4BDY A;  3AVC A;  1IKY A;  3M8S A;  4FLU A;  3NGZ A;  4F2R A;  2HHU A;  4I9Q A;  1C1C A;  1LWF A;  4CEF A;  3RMB A;  3VQ7 A;  3SQ0 A;  3DOK A;  1BL3 A;  3VQ8 A;  4KRF A;  1G15 A;  1LW2 A;  4B9T A;  3NF7 A;  2F8T A;  4QCL A;  3VQD A;  3KJV A;  1SL0 A;  4CES A;  4C8O A;  4B3O A;  3HYF A;  3ZSZ A;  3U6F A;  4CJV A;  2GBZ A;  4CJW A;  3KLG A;  1RNH A;  4FYD A;  5KGX A;  3PO5 A;  1U4B A;  3M8P A;  3L2W A;  3LWL A;  4KHW A;  4JS4 A;  3SUN A;  1WSE A;  1CZ9 A;  5CY4 A;  4CHO A;  3HM9 A;  4M3R A;  3PY8 A;  4Z0U A;  3VN5 A;  3OS1 A;  4J2B A;  4DSI A;  1L5U A;  3I0R A;  2G8H A;  1U47 A;  4TSX A;  3UIQ A;  2AJQ A;  3T1A A;  3K57 A;  4J2A A;  4CK2 A;  4PA1 A;  1Z26 A;  4E7H A;  4Z4H A;  4B9U A;  3KD5 E;  3SQ2 A;  4F3O A;  4F2S A;  3WNH A;  3T3F A;  3HVR A;  1IKW A;  3G0Z A;  4JS5 A;  4CFC A;  1Z25 A;  4DF4 A;  3QES A;  1RT7 A;  1GOB A;  4CEA A;  4CJT A;  4CJR A;  3F9K A;  1ZBU A;  5K14 A;  3OYM A;  4Q5V A;  4XIU A;  3L2Q A;  4DWI A;  1TK0 A;  1VSF A;  1RDA A;  4C8L A;  4E7J A;  1RT2 A;  4NCA A;  1BCM A;  4CJ4 A;  4DS5 A;  5D3G A;  3C6U A;  4WE1 A;  3V1R A;  4DQQ A;  1BQM A;  1TL3 A;  4DFJ A;  4DU3 A;  2YNF A;  4I9L A;  1XC9 A;  1U04 A;  2YNI A;  1A5V A;  4KHS A;  1JLG A;  1KCF A;  4KV8 A;  3OYG A;  1HYZ A;  2VG7 A;  3CYM A;  3OYF A;  3VA0 A;  1UA1 A;  4B9V A;  2YKM A;  2D5R A;  2HHS A;  5DK5 A;  2Q3S A;  1X9S A;  1QHT A;  3AVB A;  3G10 A;  2G8F A;  2DTU A;  1NK0 A;  4GMJ B;  4LY7 A;  4B9S A;  4KKO A;  4CJK A;  2KZZ A;  3ZCM A;  3PX4 A;  1NK8 A;  1XHX A;  3KIO A;  3VQ9 A;  2JLE A;  3AA5 X;  3RRG A;  3KK2 A;  2X74 A;  3NFA A;  3NAE A;  3S9H A;  3LAL A;  3HPH A;  4CGF A;  4M3Y A;  4CF2 A;  1JL1 A;  3B6O A;  4DQI A;  4DQP A;  3O4Q A;  4Y1D A;  3KLH A;  4CEB A;  1SV5 A;  3SV4 A;  3QET A;  3IG1 A;  1B92 A;  3PUF A;  1D9F A;  1J5O A;  4IFY A;  3HT3 A;  4CCH A;  3WNF A;  4DSE A;  2HNY A;  3S3O A;  4DSK A;  4FZZ A;  1KFS A;  3LAM A;  4Z4F A;  4BE0 A;  3FFI A;  4ELV A;  3A2F A;  2E6L A;  3HVT A;  1K6Y A;  4O4G A;  4FM0 A;  4FM2 A;  4ZTF A;  3L3V A;  2I5J A;  4CHN A;  1EET A;  2RKI A;  3AO4 A;  1CLQ A;  4I2P A;  4OJR A;  3MXM A;  2O4G A;  4CIG A;  3OYD A;  1Q9X A;  4HCB A;  1ASV A;  4CEC A;  1C1A A;  1QQC A;  4KI6 A;  3RR7 A;  2XY5 A;  4BE1 A;  4GW6 A;  1HRH A;  1VSK A;  3DLE A;  4LSL A;  1S5J A;  1S6P A;  3VQQ A;  2VWJ A;  3DMJ A;  1UA0 A;  3E01 A;  4CFA A;  5KRS A;  3HK2 A;  5HRS A;  4PUO A;  1NK5 A;  4BE2 A;  2IAJ A;  4EZ6 A;  3V9W A;  1CXQ A;  4MQ3 A;  1X1P A;  4FJX A;  4FK4 A;  5FRN A;  4BDP A;  4C8M A;  1LWC A;  4IBN A;  4ELT A;  2D0C A;  4AIL C;  5HP1 A;  1EX4 A;  1L3S A;  4CEE A;  3L2V A;  1EXQ A;  2YNH A;  1BIZ A;  3DM2 A;  1ZBF A;  3LP1 A;  5EU7 A;  3OYH A;  3HP6 A;  4DQR A;  4DSF A;  3CFP A;  4M42 A;  2FC0 A;  3KLI A;  2ATQ A;  1RBU A;  2G8K A;  3SUQ A;  4AHT A;  4FJL A;  3AO5 A;  4IDK A;  3IRX A;  3EY1 A;  2WON A;  3CFO A;  3M8Q A;  3TAF A;  1UAX A;  3V1O A;  1JXE A;  1L3U A;  1ZYQ A;  2X6S A;  4O0J A;  1C6V A;  3AVH A;  3AVJ A;  5CZ1 A;  4E89 A;  1A5X A;  1EP4 A;  1HYV A;  5HBM A;  3VQB A;  3QNN A;  1JLF A;  4JLH A;  3THV A;  5J2Q A;  1JLE A;  2VWK A;  2P1J A;  4DTX A;  2Y1I A;  1YTU A;  4W5N A;  1RBR A;  2IC3 A;  4CHP A;  3C6T A;  4RW7 A;  3NH0 A;  3OY9 A;  1TK5 A;  4DTM A;  3L3U A;  4O5B A;  3CFR A;  3PX0 A;  1BI4 B;  3AVL A;  4HUE A;  3AVF A;  2YHA A;  3C95 A;  3IS9 A;  1WSI A;  3OYB A;  1JLQ A;  1QTM A;  4HCC A;  4CGH A;  3S3M A;  4RW4 A;  3TAB A;  4O55 A;  3C94 A;  4K8Z A;  2DY4 A;  3QEX A;  4FJ5 A;  5SWM A;  2ITG A;  1RT3 A;  1YVU A;  3JSM A;  2PYJ A;  2HHW A;  2ETJ A;  1W9H A;  4QOZ B;  2HND A;  3ZT4 A;  4RW8 A;  2P51 A;  4KTZ A;  3V81 A;  2YNG A;  4B8A B;  3OS0 A;  5CYQ A;  1WLJ A;  1KTQ A;  1RDD A;  1WAF A;  5JS2 A;  4Z4C A;  1JL2 A;  4OKE A;  2PYL A;  4W5T A;  1VRU A;  1SKW A;  1S6Q A;  3K2P A;  3HL8 A;  4AHR A;  4DF8 A;  4AHV A;  4CED A;  4BDZ A;  4DTU A;  3NH1 A;  1RT5 A;  2OPP A;  1NKB A;  2IOC A;  1JLA A;  4NCB A;  2Z1H A;  3O3H A;  1T7P A;  1KVB A;  4MFB A;  1Y97 A;  2GUI A;  1ZBL A;  4E7K A;  4FZY A;  2ZE2 A;  4CF0 A;  3K5O A;  4DTS A;  1RTD A;  3NBP A;  3AVI A;  3TR8 A;  1RT1 A;  3DLK A;  3VQA A;  1REV A;  4E7L A;  3OYJ A;  2FBY A;  3KLF A;  1JLB A;  4KFB A;  3SQ1 A;  4M3U A;  3CQ8 A;  2G8W A;  1WNS A;  4M3W A;  4LSN A;  4CJS A;  1HYS A;  3NHG A;  3MAQ A;  4N76 A;  1HJR A;  4DSJ A;  1KLN A;  3LDS A;  2NUB A;  3LPU A;  3AA3 A;  5J1E A;  3SPZ A;  4KHQ A;  4CJE A;  2HVH A;  2OPS A;  3ZSR A;  5DMR A;  4HTU A;  4C8K A;  2OZS A;  1C0M A;  5FDL A;  3KKR A;  1BIU A;  4FK0 A;  2HHV A;  3ZSY A;  3H08 A;  1L3V A;  1D8Y A;  4N56 A;  2HNZ A;  2FBT A;  1SKR A;  3ALY A;  3OYK A;  3QEP A;  4OKJ A;  1RDB A;  3QNO A;  1TL1 A;  4OPJ A;  3TAR A;  4ELU A;  2BGG A;  3LP0 A;  4YFU A;  4FLW A;  3ITH A;  3LPT A;  1VRT A;  4CIE A;  2QXF A;  2O4I A;  1KVC A;  5CZ2 A;  1FKP A;  3HJF A;  4CFB A;  4CF8 A;  4CEO A;  4KTQ A;  4CJF A;  4CJQ A;  4EZ9 A;  1VSM A;  1RCH A;  1S9G A;  3PV8 A;  3RWU A;  1QSS A;  2OA8 A;  1VSH A;  3I8D A;  3SPY A;  2GV9 A;  1RTJ A;  3T19 A;  3OYA A;  2G8I A;  4CHY A;  1TAU A;  4FLX A;  2WOM A;  3BGR A;  3DRR A;  1J53 A;  2RF2 A;  1LAW A;  1FKO A;  4DU4 A;  4DMN A;  2KQ2 A;  1BGX T;  4KHN A;  2IGI A;  1S1U A;  1KLM A;  3HPO A;  1A5W A;  4M3X A;  1I3A A;  3QIN A;  3PX6 A;  5KTQ A;  4FJG A;  2XRI A;  1QSY A;  4DU1 A;  3OVN A;  3DRS A;  4H8K A;  3D45 A;  4CIF A;  1L3T A;  4HUF A;  2OZM A;  2QK9 A;  3EYZ A;  3AA2 A;  4EP5 A;  2R7Y A;  1IG9 A;  3RR8 A;  4B9M A;  4CEZ A;  2IS3 A;  3QEI A;  4FLY A;  1DTT A;  4FJ7 A;  5E41 A;  4DTO A;  4O0I A;  2F8S A;  1C0U A;  3MEC A;  3HST B;  3QEW A;  1D9D A;  3ZSV A;  5SZT A;  2KTQ A;  1HPZ A;  2FBV A;  1XWL A;  4W5O A;  2HB5 A;  3M8R A;  3OYN A;  1GOA A;  4F4K A;  1S1T A;  1DLO A;  4DQS A;  1JLC A;  4FW1 A;  4KO0 A;  4LH5 A;  4KHU A;  4FLZ A;  4DS4 A;  5T7B A;  3V4I A;  2IDO A;  2XY8 A;  4DLE A;  1BCO A;  4Y1C A;  4CJ5 A;  4RW6 A;  1RDC A;  4RW9 A;  4BWJ A;  1BHL A;  1WN7 A;  4H4M A;  4PQU A;  2VG6 A;  3B6P A;  3QO9 A;  3AV9 A;  5HRP A;  2XY6 A;  1U48 A;  3CM5 A;  4KB1 A;  1CZB A;  1QS4 A;  2BAN A;  3V1Q A;  3K5N A;  4ID5 A;  3OS2 A;  3SQ4 A;  4Z4E A;  2E4L A;  3KLE A;  1X9M A;  4AH9 A;  3D0P A;  3TAP A;  1RBV A;  4B08 A;  1TV6 A;  3KK3 A;  1RBT A;  2Z1G A;  1R0A A;  5FRM A;  2QKB A;  3MXJ A;  4NYF A;  4IG0 A;  3DLB A;  3RMD A;  2DFF A;  1S9E A;  4CK1 A;  3P83 D;  3OJS A;  4CK3 A;  4JRQ A;  1D5A A;  3SUO A;  3DYA A;  4FW2 A;  4FCY A;  3ZSQ A;  3AVK A;  3LWM A;  3SYZ A;  3SUP A;  2HVI A;  4FJ8 A;  4HHT A;  3MEE A;  1N5Y A;  3TAQ A;  4ICL A;  4R5P A;  1Q9Y A;  3BDP A;  4AHU A;  4KAZ A;  1TKT A;  1YTA A;  4HVJ A;  3HPG A;  3EZ5 A;  2PY5 A;  1IH7 A;  1LAV A;  3NF9 A;  4CGG A;  3WNG A;  3OJU A;  4DLG A;  5I3U A;  3ZSX A;  1C1B A;  5KGW A;  1HQU A;  2HHX A;  4F3T A;  3SNN A;  4FZX C;  3KKS A;  1HQE A;  3MED A;  4H4O A;  1T03 A;  1IKV A;  2JGU A;  1IKX A;  5C25 A;  1KVA A;  1VSJ A;  4FLT A;  4CER A;  4KI4 A;  1TAQ A;  4OGE A;  2W42 A;  1NK7 A;  5J2M A;  3NF8 A;  3WNE A;  3F73 A;  1NK9 A;  4CFD A;  3SV3 A;  2YHB A;  4N5S A;  4KTW A;  4CEQ A;  1SKS A;  2YKN A;  3ASM A;  4CJU A;  3AVM A;  3OYE A;  1T8E A;  5CYM A;  4FJJ A;  3ZSO A;  3HO1 A;  3V9Z A;  1ZBH A;  2DFH A;  3KD1 E;  3K5L A;  4ZTJ A;  1I39 A;  1Q8I A;  2F96 A;  4EP4 A;  3PO4 A;  2KFZ A;  1HNV A;  4O44 A;  1LW0 A;  4Z4I A;  4CJ3 A;  1S1W A;  1XHZ A;  1WSF A;  4OKK A;  4FM1 A;  1B9D A;  3SJJ A;  5JS1 A;  1XI1 A;  1JKH A;  4DG1 A;  2EHG A;  3OYC A;  2Z1I A;  1MU2 A;  3ZSW A;  2HMI A;  5C42 A;  3DLR A;  1HMV A;  3OYL A;  2G8U A;  3MXI A;  4C8N A;  1ASW A;  2KFN A;  1NK4 A;  1J9A A;  3TAE A;  2A1R A;  1NK6 A;  2OYQ A;  4CGI A;  1TGO A;  4GVM A;  4FJK A;  3P5J A;  1CXU A;  1NOZ A;  2RPI A;  5HRR A;  1TKX A;  4CHQ A;  5J2P A;  2KZM A;  2RN2 A;  3IAY A;  1C0T A;  1WAJ A;  3NGY A;  3VQ6 A;  3VQ5 A;  4FJH A;  4FXD A;  3TAG A;  1NJX A;  3P1G A;  2YV0 X;  1GOC A;  1U49 A;  1FXX A;  4LH4 A;  3ZT1 A;  2E6M A;  1RT4 A;  1J54 A;  3DLG A;  2PZS A;  4FJI A;  1ITG A;  4HUG A;  3NDK A;  3QER A;  4RG8 A;  3L2R A;  1WSJ A;  3O3F A;  5FRO A;  1NJY A;  4PWD A;  1WSG A;  1KRP A;  1KSP A;  4IG3 A;  4B8C A;  2ZQB A;  4PY5 A;  4CF1 A;  3ZT0 A;  4CF9 A;  3VA3 A;  1LV5 A;  4FVM A;  4AHC A;  1T05 A;  3TAN A;  1EKE A;  1TKD A;  1O1W A;  3L2U A;  2Z1J A;  1U45 A;  1RBS A;  4UQG A;  2VG5 A;  4DTJ A;  4DFM A;  1VSI A;  4E19 A;  2LSN A;  4ZHR A;  3LAN A;  5HRN A;  4M3Z A;  1WSH A;  3VQE A;  3L8B A;  5I42 A;  2HHT A;  4KHY A;  4L8R B;  4DTP A;  3O4N A;  4OLB A;  3QIO A;  3QLH A;  1NJZ A;  3HP9 A;  4FK2 A;  4BAC A;  2X6N A;  3JYT A;  3O3G A;  2HW3 A;  4J2E A;  2FBX A;  2D0A A;  1VSD A;  3LZJ A;  1X9W A;  3RMC A;  1YT3 A;  1FK9 A;  1TKZ A;  1VSL A;  3KTQ A;  1S1X A;  4AHS A;  3U3Y A;  3MEG A;  4CE9 A;  3SI6 A;  2QKK A;  1B9F A;  1VK0 A;  4DSL A;  3VQP A;  2B4J A;  4NYN A;  3K59 A;  3RTV A;  4Z4G A;  2A1S A;  3AO3 A;  5HRO A;  3AVG A;  1LWE A;  1SL2 A;  3ISN C;  3K5M A;  1NOY A;  2XHB A;  3K58 A;  1TVR A;  1QSL A;  1ASU A;  3AA4 A;  4E3S A;  1BQN A;  4FJN A;  1RTI A;  4CJP A;  3S3N A;  3DRP A;  2HHQ A;  1SUQ A;  3SCX A;  4I7F A;  5KRT A;  3DLH A;  3U3G A;  4DFK A;  3V6D A;  1DTQ A;  5KI6 A;  3SZ2 A;  1NJW A;  1UOC A;  3AVN A;  3DOL A;  2P5O A;  4E7I A;  4IKF A;  4J2D A;  4YNQ A;  4LD0 A;  4FJM A;  1IO2 A;  3NGI A;  1F21 A;  3TAM A;  3AO1 A;  2XY7 A;  2DFE A;  4E1N A;  3QEV A;  1S1V A;  3CM6 A;  3HXM A;  2B6A A;  3I0S A;  4CHZ A;  4DFP A;  3TWH A;  1ZBI A;  2EX3 A;  2OPQ A;  1RIL A;  3LAK A;  3LP3 A;  4FLV A;  1HNI A;  2Y1J A;  3CG7 A;  3RRH A;  2P5G A;  4N41 A;  4KRE A;  3ZT2 A;  1NKC A;  1JXB A;  3LZI A;  4W5R A;  2BDP A;  3RMA A;  1BI4 A;  3TI0 A;  1VSE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...