3AARA

Crystal structure of lp1ntpdase from legionella pneumophila in complex with amppnp
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
352
structure length
352
Chain Sequence
HSCIAVIDAGSTGSRLHIYSYDTDDTNTPIHIEEIWNKKIKPGFASIQPNSVTIDAYLTMLLADAPIHNIPVYFYATAGMRLLPQSQQKKYYDELEYWFRQQSQWQLVEAKTITGNDEALFDWLAVNYKLDTLKSVQNKSVGVMDMGGASVQIVFPMPKNAEISKHNQVELNIYGQNINLYVHSFLGLGQTEMSHQFLNSPSCFANDYPLPDGESGQGNAPSCKEEVTSLMNSVHKVNQQIQPLLALNPVNEWYSIGGISNLASSQLFHFENSELTNQSLLQQGDNQICHQQWDILNGQYPDDEYLYQYCLLSSYYYALMVDGYGINPNQTIHYIPPEQNLDWTIGVVLHRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ectonucleoside triphosphate diphosphohydrolase I
publication title Crystal Structure of a Legionella pneumophila Ecto -Triphosphate Diphosphohydrolase, A Structural and Functional Homolog of the Eukaryotic NTPDases
pubmed doi rcsb
source organism Legionella pneumophila
molecule tags Hydrolase
total genus 111
structure length 352
sequence length 352
ec nomenclature
pdb deposition date 2009-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01150 GDA1_CD39 GDA1/CD39 (nucleoside phosphatase) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3aarA01
3.30.420.150 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Exopolyphosphatase. Domain 2 3aarA02
4FPAA 4MLEA 4AM6A 3SMPA 3WUHA 4FWRA 3VEWA 2GEMA 5JICA 3UKRB 2Q36A 2QWPA 4J8FA 1RDWX 1NGHA 3AARA 3VGLA 1ZXOA 4QS9A 5BRDA 5F1XA 1JCFA 3GDQA 1E4GT 3QFUA 1MA9B 3FLCO 4BGBA 4EHUA 2VWBA 2FSNA 1TYQB 1U2VB 2YCHA 4F9OA 2E2NA 2VYPA 2A42A 2EWSA 5AQVA 3VEVA 1K8KB 3CI5A 3EN9A 3CQYA 1X9JA 1YUWA 2AP1A 3CJ7A 5AQQA 4DB3A 3ZETB 2PBDA 2P9NA 5AQXA 3G25A 3FZKA 2P9UB 5JLHA 4RWTA 1ATNA 2Q2RA 1XUPO 4H5NA 2P9LA 3FE1A 4FWSA 3LM2A 4EIAA 5ADXA 3UE5A 1NMDA 4FWLA 3DXMB 4YDUC 3SK3A 3MN7A 2OANA 3GG4A 1EQYA 4YDUA 5LY3A 5AQLA 4CI6A 3L0QA 5TKYA 5AQGA 1ZBSA 4ISGA 3O80A 4I6MB 3ZEUB 4BRHA 3HI0A 5F0XA 1ATSA 4JN4A 1QQNA 2V52B 3GOIA 1SAZA 1YVNA 3W0LA 2P9NB 1NGGA 4BRKA 5LJWA 2P9LB 1YXQA 2E8AA 5E84A 3O1WA 3IMXA 4H0YB 3QFPA 4BRCA 4BR2A 3LDNA 2CGKA 2F9TA 1CZAN 4BC2A 3QB0A 2D1KA 3QICA 4B1ZA 5KPTA 3H3NO 2KHOA 3UB5A 2ZGZA 1BG3A 5JLFA 3I33A 2E2QA 4WQ5C 3ZX2A 4IO8A 3W3DA 2FLOA 1MDUB 3D2FA 3O6WA 3BEXA 3A5NC 1U6ZA 3VEZA 1V4TA 3ULEA 4GNIA 2GUPA 3A5MC 3MN6A 4FWNA 5EY4A 5EX5A 2CGLA 3WEEB 4K25A 4BRAA 2YHYA 5BN9A 3CJAA 2WUSA 3F9MA 3HTVA 4BRDA 1NGAA 2DPNA 1HJOA 2P9IA 3IFRA 5JMVA 3HSCA 3ATUA 3WT0A 2GWKA 1QQMA 4FOEA 1NGEA 1DKGD 4K42A 1GLEG 3D2EB 4FO0A 2E20A 3VF4A 4MO5A 3LDPA 1WOQA 5ADXH 4FSVA 4BC5A 1P8ZA 4CBXA 1BOTO 4FWMA 1BU6O 1KAXA 5AQNA 5BREA 1TUUA 2Q97A 1NGCA 4CZMA 3P4IA 4BRFA 2QXLA 4IJAA 5FPMA 2F9WA 3H1VX 2E1YA 3VF6A 3R8EA 3AY9A 4M63C 5AQHA 3CERA 1T6DA 3QDKA 2H3GX 2QWRA 4CZEA 2HOEA 3H46O 4O5FA 5AFUA 1QZ6A 5AZIA 1JCGA 5BR9A 4BVOA 5ELZA 2IVOA 3EKSA 4GY2B 5FPDA 3O08A 3OHRA 1Y64A 4H0TB 5AQKA 2GWJA 2D0OA 4DQ8A 3HZ6A 2W40A 1QZ5A 4MLHA 1NWKA 2NRHA 4M7XA 1XC3A 1NGJA 4NO7A 1DGKN 3S41A 5AR0A 3VEYA 4CZLA 3C7NB 4EFHA 5AQYA 4CZKA 1BDGA 3U8XA 1IJJA 3KZBA 4FOIA 5AQFA 4EHTA 5AZIB 3VERA 2FSKA 4BRQA 4CZHA 1QQOA 4HTLA 1GLJO 2Q1NA 3ZX0A 3MK6A 2Q0UA 1NLVA 1C0GA 3FFKB 4H5VA 2PAVA 4B1VA 1LOTB 2V51B 4H5RA 4A61A 2W41A 3MCPA 3TPQA 4WQ4C 3L4IA 4BRLA 5AQPA 3H6EA 4A62A 1QHAA 4IZ9A 2QWLA 3A0IX 3J8AA 4JHDA 1C0FA 2QWMA 3VESA 5EVZA 4FWQA 4H03B 3WQTA 3L6QA 4BRIA 4BQZA 1HLUA 4BREA 3O5BA 4DHYA 5LJVA 3WXJA 4CBUA 1V4SA 3CETA 3CHWA 4AM7A 2P9KA 4BVPA 4H0PA 3BUZB 2YJFA 1RFQA 1J6ZA 4WQ5A 3VGMA 2GELA 2ZF5O 3MDQA 2CH6A 4FL9A 3ID8A 3O8MA 3FGUA 3FZHA 5KQ8A 2CGJA 3CJ1A 4B1UB 4JD2A 4WYBA 3QBWA 4JHDB 1NM1A 3DXKA 4CBWA 1BWFO 1HX1A 1GLAG 1GLBG 4KBOA 1E4FT 1NGBA 2AA4A 1X3NA 5FPEA 4XH1A 1S3XA 2IIRA 4B1YB 3BF1A 4CZJA 4H5TA 3A8YA 1JCEA 1SQKA 4BR0A 1BO5O 1GLCG 3EKUA 4PKGA 3U9DA 1T6CA 3D2FB 4RTFD 3BF3A 3GBTA 3H1QA 5AQRA 4CZGA 3IDHA 3VENA 4BR7A 3ULEB 4QS7A 3VEXA 5KQDA 4CJ7A 3EZWA 3VPZA 3WXKA 4JD2B 1RGIA 3RSEA 2YI1A 2QWNA 3WQUA 2E2PA 5AQWA 3H45C 5E26A 5AQIA 5AQSA 4BG9A 1HUXA 2P9IB 3UKRA 1MWKA 4HWIA 5BRHA 3CJBA 1SZ2A 1H1VA 2FSJA 4O8KA 2E2OA 2IVNA 1Z05A 1GLFO 2FF3B 5AQTA 5CE3A 3QBXA 4PL7A 3R6MA 1OKJA 3MN5A 2QW9A 2IVPA 3ZX3A 4BRGA 3VEOA 4QS8A 5AQZA 4BG8A 1BUPA 2Q31A 2HF3A 1BA0A 4MO4A 5BPMA 1ZC6A 2ASOA 1NGDA 4BC3A 3RSEB 4ISFA 3ZETA 4B1XB 5BN8A 4E1JA 3O1BA 5BRFA 1G99A 2P9UA 4BRMA 2NZTA 4DCHA 2BUPA 4JNEA 3TU5A 4M7YA 3DJCA 3DXMA 3U9ZA 3LM9A 1S22A 2D4WA 5I9EB 3ENOA 4PKHA 4FPBA 2A3ZA 4H0VB 4XH5A 5F2RA 3I8BA 2A5XA 2E1ZA 2CH5A 4L3QA 4XEIA 5FPNA 4I6MA 3ZEUA 3R9PA 1ESVA 4LC9B 4PKIA 3KVGA 4BR9A 1IG8A 1GLLO 4ISEA 2V7ZA 2ASMA 3UKUA 5AZJA 3SJHA 2ZWHA 3WXLA 4IXCA 1KAYA 3D7EO 2QWOA 4WQ4A 3DAWA 1KXPA 3WXIA 3EO3A 2FF6A 4BR4A 4H0XB 5AQMA 1BA1A 1NBWA 3A5OC 1Q18A 4NB4A 3VF2A 1XQSC 5EOYA 3ATVA 3VETA 1Z6RA 2P9PA 2HF4A 3C0BA 4PL8A 4XH4A 4BRPA 3M6GA 4BC4A 1ATRA 2A6AA 1X3MA 2P9SA 2QM1A 1GLDG 2BTFA 2I7PA 4H5WA 1LCUA 2YHWA 1WUAA 1KAZA 3SMSA 3UKUB 5AZJB 3CJ9A 3HM8A 1TUYA 3LDOA 3WEEA 1NGFA 2QWQA 5AFUH 3GE1A 4JAXA 3M3ZA 3A5LC 3FZMA 1DEJA 3B8AX 1YAGA 3QMLA 3FR0A 4BQLA 2ITMA 3FZFA 5B8HA 4Y0WA 1HKGA 1NGIA 5KPZA 2VCPA 3FZLA 4B9QA 1HKBA 2D0PA 3VOVA 2P9PB 5EXWA 3IUCA 4B1WB 3M1FA 3LDQA 3D2EA 2J4RA 3O4WA 2P9SB 3GL1A 4BROA 1HKCA 4A2AA 4K43A 5BPNA 2P9KB 3KHYA 3EL2A 5KPRA 3ENHA 2HMPA 4A2BA 3JS6A 2Q0RA 4CZIA 2NLXA 5AQJA 3U4LA 2YJEA 3AAPA 2FXUA 4FWKA 1T44A 3LDLA 3VGKA 3CQXA 4CZFA 3LL3A 2A41A 4H0OA 3DXKB 4C23A 5AQOA 4BR5A 3BP8A 4EAHD 2UYTA 3CIPA 4BRNA 1MWMA 1D4XA 1R59O 2A40A 4IJNA 4CD1A 3MN9A 4FWPA 2ASPA 3CJCA 4CD3A 5BPLA 4FWOA 4IWVA 2YHXA 3HBTA 3JXUA 4K41A 2I7NA 1TYQA 3MMVA 1U2VA 1HPMA 5AQUA 2V7YA 2ZGYA 4Z94A 2GTDA 4RCHA 2E88A 3SLCA 3AAQA 3C7NA 3H3OB 1K8KA 3DWLA 4BGAA
chains in the Genus database with same CATH superfamily
4MLEA 4KH6A 4M3TA 4R79A 3H08A 2GEMA 5H1SQ 4JKDA 4Z4CA 3UKRB 4LH4A 4BY9C 4CJ3A 3TAMA 3VGLA 4JS5A 3QFUA 4DQSA 3F2KA 2YCHA 3ZSRA 2WBNA 2E2NA 2VYPA 3PO4A 4NCBA 4DR3K 2RF2A 3EN9A 1X9JA 2ZJQL 5M1QA 2VWKA 1KRPA 1N34K 1VQ8N 3ZETB 3G25A 4ID1A 1XUPO 4H5NA 4FWSA 4EIAA 2X74A 3DI6A 1C1CA 2G8HA 4Z4FA 1NMDA 3G10A 3DLLL 3OJUA 2OANA 3GG4A 4AHTA 5AQLA 3T3FA 1EKEA 2BANA 3HI0A 1B9DA 1SL2A 4CJQA 4CHNA 2XY6A 2V52B 3GOIA 1YTUA 2HVIA 3W0LA 1N6QA 4JRQA 2HHSA 4DSFA 1NGGA 5EU7A 1IV0A 2E8AA 3HP9A 3O1WA 3C94A 3SQ0A 5M1PA 3CCQN 4BR2A 3LDNA 1TKXA 2F9TA 4IFEA 3QB0A 3C6AA 1L3UA 1BG3A 1QSLA 2E2QA 3AVMA 2RPIA 3ZX2A 4FJJA 2IOCA 3NVMA 3OYDA 3BEXA 3SQ1A 3VEZA 1KVAA 2GBZA 3OW2M 4IOCL 3I55N 5EY4A 3MECA 4BRAA 3LPUA 3CJAA 2VG7A 5CR4A 4BRDA 3OYGA 1NGAA 3C6HA 2O8DB 4DU4A 3E9PA 3ITHA 1TVRA 2OPPA 2D5RA 2NRWA 4MDAA 3M8RA 1DKGD 5FDLA 5KI6A 3P83D 4O4GA 4CEBA 2KQ2A 5DM7L 3D2EB 4RW7A 4Y1DA 2G8FA 4MO5A 3LDPA 3SZ2A 1U49A 4CBXA 4ELVA 4FWMA 2HHTA 4YOYA 1TGOA 4FLWA 1NGCA 4DUYK 4IJAA 1KVCA 5FPMA 4DLEA 3ZT3A 3H1VX 3R8EA 4M63C 3SPZA 3D6RA 4JI0K 3ZSYA 2QWRA 3LDSA 2HOEA 4O5FA 5AZIA 1JCGA 4BVOA 5ELZA 2G8WA 3DYAA 5FPDA 1NJYA 3K5LA 3OHRA 5AQKA 2GWJA 1QTMA 4F2SA 3C65A 4MLHA 1TK0A 5KRSA 4HVJA 4M7XA 2HHVA 4FLVA 3VEYA 1DGKN 3Q7CA 4LF5K 4HUGA 3DMJA 2AJQA 3C7NB 3BZCA 3L2QA 1RBRA 3MAQA 1M90O 4QOZB 1WB9A 3VQ5A 5FRMA 1JLAA 2HHHK 3RRGA 3KZBA 4DQRA 4EHTA 4RW6A 4JKCA 3K5OA 4DSKA 1QQOA 3SUNA 1GLJO 4GV9A 2Q1NA 4KI6A 3MK6A 3R1XA 3J7ZO 2VGMA 3RMDA 2PAVA 4GV3A 3WNGA 3SUPA 1RBUA 4A61A 2P5GA 4JI2K 2YKMA 4BE2A 4CERA 4JI8K 1J5OA 4I2PA 4B9MA 4JHDA 2QWMA 3VESA 2HHQA 4FWQA 4BRIA 3CMAN 1HMVA 3MWPA 3WXJA 3I0RA 3V1QA 2O8FA 4BVPA 3BUZB 1VQMN 1J6ZA 4WQ5A 5K14A 2GELA 3ZSXA 3MDQA 3ID8A 3HL8A 4JD2A 3VQ6A 3QBWA 1NM1A 2NRRA 3I56N 3KKSA 4FM1A 1GLAG 1GLBG 1RT2A 4KBOA 4MDBA 5FLXO 1E4FT 4A57A 4B3TK 4FW2A 4CFDA 3KLHA 1VQ7N 4XH1A 1S3XA 3A8YA 1SQKA 5D3GA 4BR0A 5C24A 1FXXA 3M8QA 1JKHA 3CFRA 1RDCA 2B5JA 3EKUA 3U9DA 4KH4A 3PX6A 3VQ4A 4FZZA 2RN2A 3BF3A 3GBTA 4O8UA 4CZGA 3KD1E 3ULEB 3V81A 4IO9L 4CJ7A 3QIPA 4E7HA 4KTZA 5KRTA 4DV4K 3NH2A 5DM6L 3ZSOA 4B9UA 3CCEN 4J2EA 3WQUA 4CK2A 2E2PA 5AQSA 1HUXA 1P90A 3UKRA 3CF5L 1RBSA 3ZCMA 3CJBA 3OY9A 5HRRA 4O8KA 4OKJA 3WXMB 3HVRA 3EZ5A 1NK0A 3QBXA 3R6MA 1OKJA 5HRSA 1VQ9N 5A2QO 1FKOA 3AA3A 4QS8A 3N4QA 3R3LA 1ZBIA 3AVLA 4FJ8A 1ZC6A 2ASOA 4BC3A 1JLFA 3ZETA 2YKNA 2PYLA 3QEXA 1S5JA 4DTOA 2NZTA 4DCHA 2HBLA 4BDZA 2BUPA 3S3MA 4M7YA 1BI4A 5HLFA 1KD1O 3LM9A 5I9EB 5E41A 2A3ZA 4BE1A 1RT7A 4PUOA 1KCFA 1KSPA 2E1ZA 2HVHA 4L3QA 3NF6A 1UA1A 3EE8A 1ESVA 1L3VA 1OVYA 3LZIA 3THWA 1TAUA 3EY1A 1QVGM 4ISEA 3UKUA 5AZJA 2KW4A 3SJHA 3BGRA 1TKZA 4CJSA 3CC7N 5SZTA 3WXLA 3D7EO 2QWOA 4K0KK 4FJIA 5CYMA 3WXIA 3P5JA 4IG0A 2FF6A 3E9LA 2D0BA 2XHBA 3QESA 4DKWA 4GW6A 2W42A 1Q18A 1XQSC 5AJ3K 4CJEA 3ATVA 3C0BA 4XH4A 2P9PA 4PL8A 2F96A 1Q9YA 3KK1A 3O9UA 4BC4A 4X65K 1O13A 1RT4A 4N41A 3KD5E 2HHXA 3L3VA 2I7PA 4Q0BA 2YHWA 3CXCM 3F73A 3P31A 2QWQA 4IEIA 3A5LC 1Z25A 3FZMA 2KKZA 3MEEA 2O8DA 4AQYK 5B8HA 5BR8K 1HKGA 1NGIA 5KPZA 2VCPA 4B9QA 1HKBA 3VOVA 4B1WB 2NNWA 1LW2A 3AA4A 2XY5A 3VN5A 1J9AA 3D2EA 1QS4A 3NF9A 4R5PA 4BROA 3KHYA 1N5YA 4X62K 1NKEA 4LF4K 2HMPA 3NDKA 4X64K 3V6DA 2HBKA 3AAPA 2QXFA 2FXUA 4FWKA 3L2WA 1YJ9N 2DTUA 1FW6A 3VGKA 3SYZA 3CQXA 3IRXA 4CW7B 3DXKB 4C23A 4M3YA 3DLGA 3BP8A 3VTHA 4EAHD 2EX3A 4CJKA 3CCSN 4BRNA 3CJCA 1NKCA 3ZSVA 1SUQA 4NXNK 1J53A 1WSGA 4NXMK 2YHXA 3VA3A 3E1YA 3K58A 2I7NA 1W97L 2V7YA 4EP4A 3L3UA 1NMNA 3MWTA 3C7NA 1K8KA 3HP6A 4CJWA 1S1WA 3ENHA 2E20A 4BGAA 2HHUA 3SMPA 4GKJK 3VEWA 3THXB 2O8EB 3QEVA 3QEIA 3M5RA 5JICA 3VQ9A 3QINA 3PX4A 2O8CB 3OYLA 4DSIA 2Z1HA 3VQQA 2ZM6K 2HHWA 4ZHRA 4PY5A 4NLBA 1VQNN 1MA9B 3FLCO 4DR1K 2VWBA 2FSNA 1TYQB 1W0HA 1U2VB 1S1UA 4E7IA 4F9OA 2D0CA 4JKFA 4KHUA 4E1NA 4M3XA 3M8SA 1YF5L 5J2PA 1VQLN 5AQQA 2ZD1A 2HB5A 2P9NA 3KIOA 3QEWA 3PUFA 3FZKA 4RWTA 1VSDA 2P9LA 3FE1A 3O3FA 4G9ZA 4LFAK 4KHQA 3UE5A 4JYAK 4C1NI 3RRHA 1IBKK 2JWKA 5FROA 2D0AA 4KHSA 4O55A 1C1AA 5TKYA 5AQGA 1W7AA 4C8MA 4JI1K 4JI7K 4JLHA 1KTQA 5F0XA 1XC9A 2P51A 4JKAA 4JN4A 1S9EA 1EXQA 1SAZA 2OA8A 1VSFA 3K57A 5LJWA 1YXQA 1KFSA 2F8SA 4CVNE 3QNNA 4DQPA 5E84A 3IMXA 3QFPA 4E0DA 4FJGA 3VQPA 2CGKA 4DTUA 1WNSA 1FK9A 1JL1A 4B1ZA 4CGFA 3CM6A 1X1PA 3DLRA 3DM2A 3V4IA 1VSJA 3T69A 4IO8A 4KHYA 2IC3A 1MDUB 3UIQA 3RR7A 3O6WA 4KTWA 3A5NC 4CJUA 3NGIA 4FZXC 3AVNA 3ULEA 4GNIA 1JL2A 1I39A 1VSMA 2XRIA 2XY8A 4E89A 5EX5A 2CGLA 3JYTA 3KJVA 5BN9A 1RDUA 4AILC 1TL3A 3QLHA 1S72N 4CGGA 4IKFA 4O44A 2PY5A 1YIJN 2I5JA 1TKTA 3O9RA 1HJRA 2ZE2A 2HSTA 3WT0A 4FOEA 1QQMA 4NCAA 1VQ5N 3LALA 1HPZA 4K42A 4FJ9A 4IFYA 4OKEA 4FSVA 2KZMA 1P8ZA 2XY7A 1BOTO 1BU6O 4OGCA 3HT3A 2P5OA 1Q86O 3A2FA 2NUBA 4CZMA 2FC0A 1C1BA 3NBPA 5GINA 3Q7BA 3O9SA 5LL6Z 1RT5A 4YOUA 2F9WA 3V9UA 3VF6A 3AY9A 3O4NA 1T6DA 2H3GX 1QZ6A 1NK6A 4CEOA 4ILJA 4J2BA 2IVOA 4WFBL 4GY2B 5HBMA 3NFAA 3AVIA 4CJRA 4YHHK 3HRGA 1QZ5A 1OH7A 2PYJA 4C1NK 4DR6K 1EX4A 1NWKA 2NRHA 4CEEA 4HCBA 1XC3A 3PIOL 4NO7A 1T7PA 5AR0A 3HOTA 3CFOA 4EFHA 5AQYA 4FJLA 3O9QA 5HRNA 4CZKA 4F2RA 1BDGA 5M1FA 3WNEA 3U8XA 4B8CA 4DMNA 1CZ9A 5AQFA 2YNIA 4A5BA 3VERA 4DR4K 1QE1A 4CZHA 3QNOA 1XWLA 4HTLA 4DQQA 3ZX0A 3N4PA 2QI2A 1VK0A 1RDBA 3FFKB 3AVFA 3NF8A 4H4MA 2OTLN 4PHTX 5I42A 2V51B 3TTDA 4CF1A 1OVQA 4Z4EA 3L4IA 1B92A 4CHOA 3OYHA 4TSXA 4IZ9A 4E3SA 2VQFK 1C0FA 4DV1K 4H03B 1VRTA 2X6SA 4I2QA 4LFBK 1RT6A 5HL7L 4LY7A 4DHYA 4OPKA 5CY4A 2UXCK 2WFBA 4CBUA 4FJKA 3CHWA 1RTHA 2YV0X 3DLKA 4AM7A 1K9MO 3K9JA 2IS3A 3SAFA 4CHZA 2YJFA 4DR5K 3WNHA 2A1SA 1NJWA 1ASVA 2ZF5O 2CH6A 1RT3A 4FL9A 1HYZA 1XI1A 2YX6A 4DSJA 3CJ1A 4B9VA 4DV2K 2KFNA 3DXKA 3L2UA 1YITN 1WBDA 2AA4A 3NCIA 4OX9K 4CJTA 1SL1A 2UUAK 5JVGL 3AO5A 1BQMA 4CZJA 2ATQA 1JCEA 1RBTA 1Y97A 2UU9K 1BO5O 1GLCG 3KLEA 3T1HK 3IG1A 5AQRA 3IDHA 1X9SA 3VENA 4BR7A 2NRZA 3MCAB 1HNZK 4KHWA 1JLGA 3VQAA 3EZWA 3WXKA 3G71N 3L8BA 4E7KA 4IG3A 3RSEA 1IKXA 5DMRA 3V9XA 3THXA 2QWNA 2O8EA 3NVKA 5AQWA 5E26A 3NE6A 1XHXA 3V1OA 4BG9A 3G0ZA 4BE0A 4GVMA 4HWIA 5BRHA 1H1VA 3HYFA 4EZ9A 2FSJA 1Z05A 1J54A 1Q8IA 4LF6K 3MN5A 2QW9A 2IVPA 3ZX3A 4BACA 1MU2A 3AV9A 1BUPA 5KGXA 3SUQA 5BPMA 4A59A 4CIFA 4A5AA 5BN8A 5CYQA 3O1BA 4DU1A 3DOKA 1M1KO 4WE1A 3U9ZA 4M41A 4FJHA 2D4WA 4FW1A 4CJLA 3AO4A 1HRHA 4ZTFA 3CCJN 4JI3K 3DOLA 1OH8A 4XEIA 5FPNA 1S1XA 1VSLA 4LD0A 4BR9A 4WFAL 3NGYA 1VQ4N 3T1YK 4B3RK 4MFBA 3K2PA 3TSUA 2ZWHA 4IXCA 3AA2A 3DLEA 1OH5A 4ELUA 1RCHA 5TKWA 5SWMA 3TARA 5EOYA 1Z6RA 1HNXK 3C95A 3M6GA 1L5UA 1ATRA 3OJSA 1WSJA 3SQ4A 4H5WA 2B4JA 5HP1A 2VGNA 2FBVA 4CEAA 5GADP 3HVTA 4FZYA 3AVBA 4DF8A 1DEJA 3FR0A 3FZFA 1KLMA 4Y0WA 3PX0A 4M3UA 1R0AA 2D0PA 3IUCA 1HR0K 1U04A 1RILA 3AGRA 3O3GA 1QSSA 3CCRN 2P9SB 3EYZA 4E7JA 1BGXT 1HKCA 2RE2A 3D45A 5KPRA 2Q0RA 3ULDA 2KTQA 1LWEA 2NLXA 4GKKK 3CYMA 3O9TA 1IKVA 4M42A 2RHKA 3LDLA 4CZFA 4CHPA 1Q81O 2A41A 4RG8A 1UA0A 3OVNA 2JLEA 1WSEA 1S1VA 5AQOA 4GMJB 1B9FA 5M1NA 4KAZA 4DTPA 5T7BA 3DRRA 4CD1A 1BQNA 3DRPA 4CFBA 4FWPA 4F3OA 4JI6K 2ASPA 4K8XA 1KQSM 1VQ6N 3OYMA 2BDPA 3DLBA 1LWCA 2P1JA 4FK0A 4DR2K 4Z94A 4C8OA 3MEDA 4H4OA 1U48A 3I8DA 2HBJA 4AM6A 3MXIA 4AHRA 2HNYA 4FWRA 4DU3A 3CCMN 2OCEA 2QWPA 4J8FA 1NGHA 3AARA 3CC4N 1NNEA 3SBTA 4AHVA 4DV5K 2DFEA 3OYEA 3LAKA 5F1XA 1JCFA 4W5RA 2Z1IA 3GDQA 4Y1CA 4EHUA 3CQ8A 1NG9A 2A42A 2EWSA 1NK4A 3CI5A 3CQYA 1YUWA 3CJ7A 1YI2N 4J2DA 2HMIA 2HNDA 2P9UB 2Q2RA 2IAJA 3LM2A 4JK8A 3FFIA 3I0SA 5CHIA 3KLIA 3IS9A 4FCYA 3CM5A 1C0UA 3U6FA 1EQYA 4DQIA 2OZMA 4CI6A 3QIOA 4MQ3A 4NYFA 2ITGA 2HW3A 1ZBSA 2W6LA 5J2QA 3O80A 1ZBLA 2UXDK 1JLBA 5GAEP 2OPSA 4BRKA 1SV5A 1F21A 1REVA 5MLCQ 1NJZA 4JV5K 1CZAN 4BC2A 3EEQA 2D1KA 1HNVA 3O3HA 5KPTA 3BY5A 2RKIA 3H3NO 3UB5A 4NLCA 4L8RB 4B8AB 3RVCA 3ENBA 4YNQA 4FLZA 3W3DA 1XHZA 4N76A 2FLOA 4DV7K 4DTSA 1S6PA 4C8KA 5FRNA 3K9KA 2FBXA 1V4TA 3TAPA 4DFJA 2QTDA 4CHQA 3LPTA 4DTJA 1EWQA 3NH0A 3A5MC 3MN6A 1LV5A 3WEEB 3E66A 4B9TA 2YHYA 3C6UA 4IOAL 3HTVA 2O4IA 5HRPA 3PSFA 4E19A 2DPNA 1HJOA 3IFRA 2DFFA 4DG1A 5LMNK 3HSCA 1EP4A 3ATUA 4Z4HA 1VSHA 1A5WA 1TV6A 4CFAA 1FJGK 3PV8A 1S6QA 4OPAA 3VF4A 4FO0A 5C15A 5ADXH 4BC5A 4DV0K 1UOCA 1KAXA 4FYDA 1TUUA 3HPGA 4C8NA 1WSFA 3P4IA 2QXLA 4DFMA 4I9QA 4Z4GA 3SV4A 4ILGB 5DK5A 5AQHA 3SUOA 4HTUA 1N8RO 3H46O 1IKWA 2HBMA 2WOMA 5BR9A 4CECA 1Q9XA 3EKSA 4O0JA 4FLYA 3RMCA 3S3NA 1Y64A 4PA1A 2D0OA 1IO2A 3HZ6A 2W40A 4CGDA 3OYAA 4FVUA 1HQUA 1KVBA 3TAFA 3U3YA 2UUBK 1NOYA 3P38A 4CZLA 1U45A 3PY8A 4KPYA 1RBVA 2R7YA 2F8TA 1IJJA 4FOIA 4KKOA 5AZIB 3AO3A 4X66K 3J7AP 2FBTA 2Q0UA 1VQON 1VSIA 1TKDA 4H5VA 4B1VA 5KGWA 1UAXA 1U47A 1LOTB 4EZ6A 4YOTA 5C12A 3TPQA 4WQ4C 3LP1A 3TAEA 5AQPA 3H6EA 4NCGA 4KTQA 4FJMA 2QWLA 2Z1GA 3A0IX 3SCXA 3OYNA 3ZSZA 3JAMO 4DLGA 1BHLA 3ID6A 1N32K 3BZKA 4YY3K 2XO7A 1V4SA 1YHQN 3VQBA 4W5OA 1T05A 3O8MA 4B1UB 2YHBA 4WYBA 4JHDB 1CXQA 5IT9O 2WONA 3ZT2A 4YORA 1X3NA 5FPEA 4B1YB 2IIRA 3CC2N 1WSHA 4H5TA 2O8FB 4KO0A 1G15A 1D9FA 1XNQK 1QHTA 4H8KA 5C0YA 4M45A 3D2FB 4HCCA 4B3OA 3H1QA 1ZYQA 1YT3A 4QS7A 3VEXA 3KLFA 1C6VA 1RTDA 5J2MA 3PO5A 3LP0A 3AGKA 4JD2B 2UXBK 1RGIA 2YI1A 4G1QA 4I9LA 3KWIA 4CEZA 3H45C 5AQIA 3TABA 5HROA 2P9IB 1RT1A 1MWKA 1NJXA 3ZSWA 1SZ2A 2E2OA 2EHGA 4LSLA 2FF3B 5AQTA 5CE3A 3OYFA 1QVFM 4PL7A 3THYB 3QERA 3TAQA 1CLQA 2QEXN 4BRGA 4WCEL 1YJNN 4DSLA 5AQZA 4LF8K 4IDHA 4MO4A 1NGDA 2Q3SA 3HO1A 4ISFA 2E6MA 4B1XB 4DTXA 3TSQA 5BRFA 2P9UA 4BRMA 3IAYA 1NOZA 1VSEA 4CHYA 1S22A 3ENOA 4AHSA 4FPBA 3VTIA 4XH5A 5F2RA 4FXDA 2PFUA 3S9HA 4B3MK 2CH5A 3R9PA 3LANA 3VQEA 4PKIA 1IG8A 3WNFA 3LAMA 2ASMA 4B9LA 1RTJA 1XMQK 1BI4B 1KAYA 3AO2A 3G4SN 4DS5A 1D5AA 1VQPN 3PLAA 2G8IA 3DAWA 3AVKA 3EO3A 3HJFA 4ICLA 4BR4A 4H0XB 5AQMA 1NK5A 1NBWA 3A5OC 4OPHA 3VETA 3LWMA 1ZBUA 3AVCA 4BRPA 2E6LA 5J1EA 5GIOA 1X3MA 4OGEA 2QM1A 3OYBA 3OYKA 3ZYYX 2BTFA 4QCLA 3NGZA 3THWB 2WTUA 4DTRA 1L3SA 1WUAA 3SMSA 3F5TA 3UKUB 4GVEA 5AZJB 3CJ9A 2YNFA 5GAHP 3HM8A 1NK8A 4LF9K 1TUYA 3LDOA 3WEEA 3MXJA 3GE1A 4JAXA 3B8AX 1HNWK 1I3AA 1IKYA 1O1WA 4JKGB 5IWAK 4DFPA 3FZLA 5JS2A 4C8LA 4AHUA 1S9GA 2P9PB 1A5XA 5J2NA 3M1FA 3O4WA 1A5VA 2J4RA 1KLNA 4A2AA 3PIPL 3TI0A 3KKRA 2P9KB 3EL2A 2UUCK 3JS6A 3SBGA 3U4LA 2HNZA 4BWMA 2O4GA 4YOWA 1WAFA 3RR8A 4E1MA 3TANA 3MEGA 3EE9A 4M3ZA 4FVMA 1ZBFA 3LL3A 2NRXA 4H0OA 3MX5A 3V1RA 1SL0A 3B6OA 2YNHA 4FLTA 4DF4A 2O8BB 2VG6A 2UYTA 3DRSA 4F3TA 2O8CA 1D4XA 3HM9A 4CGIA 1HYSA 2ZJPL 3MN9A 4KFBA 3LP2A 4W5TA 2QK9A 3V9ZA 3CCLN 3HBTA 4CK1A 4K41A 1TYQA 2KZZA 1U2VA 5AQUA 2ZGYA 4RCHA 2E88A 2DY4A 4IEEA 1BCMA 1EWRA 3DWLA 4ELTA 4FPAA 3WUHA 4JI4K 3AVGA 1HYVA 3TR8A 4BDPA 4W5QA 4FK2A 3CPEA 2Q36A 1RDWX 4HUFA 1WN7A 4OLAA 1ZXOA 4QS9A 1NKBA 5BRDA 3OBWA 1E4GT 4BGBA 4CEQA 3HSTB 2VQEK 4K8ZA 5GAGP 5AQVA 3S3OA 4V19S 3VEVA 1K8KB 4KRFA 3T19A 3IKMA 4KI4A 3SI6A 4EP5A 2AP1A 4DB3A 2FBYA 2PBDA 3LZJA 5AQXA 3OYJA 3RMBA 3ZLJA 5JLHA 4XIUA 2BGGA 1ATNA 5ADXA 4KHPK 3KK7A 2G8KA 4JEPA 1BL3A 3OYCA 1N36K 5LMUK 1RNHA 4FWLA 3DXMB 4YDUC 3NHGA 5I3UA 3OS2A 3SK3A 3MN7A 3SV3A 4YDUA 5LY3A 4JS4A 4KV8A 3L0QA 5HOOA 4ISGA 4KREA 1DT9A 1VSKA 4I6MB 3ZEUB 4BRHA 3QETA 4N5SA 1ATSA 1JLEA 1QQNA 4CJ5A 3D0PA 1QSYA 3MX2A 4DTMA 5CZ2A 1YVNA 2P9NB 4O5BA 3RMAA 2P9LB 4CF0A 2BE2A 4KHNA 4H0YB 4BRCA 1I94K 4FLXA 3VQCA 3AVHA 3QICA 3OTOK 2KHOA 2ZGZA 1ILYA 1CZBA 4M3RA 5JLFA 3I33A 4AH9A 1YVUA 3U3GA 1T3VA 2Z1JA 4WQ5C 3JSMA 2BH1A 1SKRA 1TL1A 3D2FA 1NK7A 1NK9A 3J7YP 4JKBA 2KFZA 1U6ZA 4YFUA 1JJ2M 5JS1A 2GUPA 4FWNA 4OKKA 4K25A 1IG9A 3C6TA 4W5NA 2WUSA 3F9MA 5C10A 5C2DA 1WSIA 2P9IA 5JMVA 2IDOA 4CGJA 1JLCA 1FKPA 1D8YA 2GWKA 4LSNA 1NGEA 2QA4N 3HPOA 4Z0UA 1ASUA 3THYA 1GLEG 1WOQA 4IBNA 3SPYA 3HXMA 5AQNA 1Z26A 4Q5VA 3RWUA 5BREA 3CFPA 2Q97A 1EETA 4QAGA 4BRFA 1K73O 4CIGA 5GIPA 2LSNA 1E3MA 3TSPA 3PSIA 4B3SK 2OTJN 3TTFA 3MXMA 2E1YA 1L3TA 3LWLA 1NU0A 1JLQA 3BDPA 3K5NA 3CERA 3QDKA 2W6KA 4KB1A 4RW4A 4CZEA 4E7LA 1VRUA 2JWLA 1GOAA 3NMUA 4ZTJA 4FK4A 5AFUA 4HHTA 4WFNL 2QKBA 4UY8O 2DFHA 1LAVA 4Z4IA 2YHAA 3O08A 4H0TB 4PWDA 3HOSA 1XMOK 4DQ8A 1T03A 1SS6A 4B9SA 3TTCA 4CJVA 4B9NA 3T1AA 1NGJA 4CCHA 1LW0A 3S41A 3KK3A 4RW8A 3P1GA 3AA5X 1JXBA 4GV6A 2KLAA 2OZSA 2FSKA 4RW9A 4BRQA 1NJIO 1NLVA 1C0GA 1HNIA 1KC8O 4KB0A 2Y1IA 1X9MA 1CXUA 4H5RA 4OPJA 2W41A 2JGUA 3MCPA 2PZSA 4FLUA 4CK3A 1LWFA 4M3WA 1X9WA 4BRLA 2X78A 4A62A 1QHAA 4DSEA 2NRTA 3P39A 3J8AA 4UQGA 3THVA 5M1KA 4JKGA 5EVZA 1T8EA 3WQTA 3L6QA 4BQZA 1HLUA 4BREA 3OS1A 3O5BA 5LJVA 4KH5A 3CETA 3VMFB 1ZBHA 2P9KA 3CMEN 4J2AA 4H0PA 1RFQA 1ITGA 1K6YA 3CD6N 3VGMA 3ZT4A 3TAGA 3CG7A 4HUEA 4LH5A 1VHXA 3FGUA 1BIUA 3FZHA 5KQ8A 4CF9A 2CGJA 2E5LK 3SNNA 3RTVA 4CBWA 1BWFO 1HX1A 1DTTA 2O8BA 3CCUN 4IDKA 1TAQA 1NGBA 1WBBA 1BCOA 3KTQA 2Y1JA 1SKSA 3BF1A 3VA0A 2WC9A 1ASWA 4OJRA 1EO1A 4DUZK 4JKEA 4LFCK 2B6AA 4DV6K 1J5EK 4I7FA 1XNRK 4PKGA 1T6CA 3SQ2A 3LP3A 3AVJA 4RTFD 3OYIA 4JI5K 2OYQA 2OPRA 2IGIA 5KQDA 3T7ZA 3ZT1A 3K5MA 3VPZA 1Q82O 3CPWM 4WF9L 1W2BM 3M8PA 3L2RA 3L2VA 1VAZA 4FJ7A 2NRVA 1DLOA 2IVNA 1RDDA 2OPQA 4OVLA 1VQKN 3DLHA 1GLFO 1WLJA 3NH1A 4B08A 4OO1J 1YJWN 4DV3K 3J80O 3VEOA 2VWJA 2G8VA 3B6PA 4BG8A 4JK7A 2Q31A 3VQ8A 2HF3A 1BA0A 3VQDA 3RSEB 3ZT0A 1IH7A 2A1RA 4E1JA 2ZJRL 1G99A 1BISA 3TWHA 1KFDA 4FM0A 4F4KA 4CJ4A 4DTNA 3F9KA 4ILHA 3ISNC 4LF7K 4CGHA 3TU5A 4JNEA 4CIEA 2E4LA 3L4QA 3K59A 3DJCA 3DXMA 4DS4A 3QO9A 4F8RA 4PKHA 4H0VB 1JXEA 3OBYA 1D9DA 4DR7K 4CJPA 3I8BA 2A5XA 4I6MA 3ZEUA 3SAGA 4LC9B 3KVGA 1TK8A 4U67L 4ID5A 3VQ7A 1GLLO 1W9HA 1N33K 2V7ZA 5CZ1A 3ASMA 4N47A 3E9OA 1LAWA 1RTIA 4N56A 4CF8A 4FJXA 4WQ4A 1KXPA 4CJFA 3K0SA 1BA1A 4FJNA 3ALYA 4NB4A 3VF2A 3KK2A 1RDAA 4BDYA 2HF4A 3NF7A 2A6AA 2P9SA 4AHCA 1GLDG 4CFCA 4IFVA 4FM2A 4IOXA 1LCUA 1KAZA 1C0MA 3G6EN 1C0TA 4FJ5A 1NGFA 5AFUH 5C42A 3J81O 3M3ZA 1K8AO 1UWBA 1YAGA 3SJJA 2YNGA 3QMLA 1GOBA 4BQLA 2ITMA 2G8UA 3QEPA 4NYNA 4OLBA 4U7BA 1HQEA 4YOVA 5EXWA 4JK9A 2GX9A 1IBMK 2F7TA 2GUIA 3LDQA 2ZQBA 4YOXA 3GL1A 2X6NA 1S1TA 2VG5A 4K43A 5BPNA 3SAHA 1IBLK 3OS0A 4O0IA 4PQUA 3HPHA 1BIZA 3E01A 4A2BA 4CZIA 3AVAA 5AQJA 2YJEA 4DFKA 1T44A 4CEDA 4CF2A 3KLGA 1WAJA 4DWIA 4AF1A 4JRPA 2ETJA 1YTAA 1SKWA 1TK5A 3OA9A 3NAEA 4BR5A 3CIPA 1U4BA 5KTQA 4BWJA 1MWMA 5C2FA 1R59O 2A40A 4IJNA 3AO1A 2GV9A 4CE9A 4CD3A 5C25A 5BPLA 5JVHL 3KWGA 1GOCA 4FWOA 1QQCA 4IWVA 3JXUA 3CCVN 1DTQA 3MMVA 4CEFA 5M1OA 3V9SA 1HPMA 4JKHA 1Q7YO 1OH6A 3O4QA 2GTDA 3V9WA 3SLCA 2F4VK 3AAQA 3H3OB 4CESA 3HK2A 2QKKA 3ZSQA
chains in the Genus database with same CATH topology
4FPAA 4MLEA 4AM6A 3SMPA 3WUHA 4KH6A 4FWRA 3VEWA 4R79A 2GEMA 5H1SQ 3CCMN 3CPEA 4JKDA 3M5RA 5JICA 3UKRB 2Q36A 2QWPA 4J8FA 1RDWX 4BY9C 1NGHA 3AARA 3CC4N 3VGLA 3SBTA 1ZXOA 4QS9A 5BRDA 3OBWA 1JCFA 5F1XA 3GDQA 1E4GT 3QFUA 4NLBA 1VQNN 1MA9B 3FLCO 4BGBA 4EHUA 2VWBA 2FSNA 1TYQB 3F2KA 1U2VB 2YCHA 4F9OA 2WBNA 2E2NA 4JKFA 2VYPA 2A42A 2EWSA 5AQVA 5GAGP 3VEVA 1K8KB 3CI5A 1YF5L 3CQYA 1X9JA 1YUWA 3EN9A 3IKMA 5M1QA 2AP1A 3CJ7A 5AQQA 4DB3A 2ZJQL 1YI2N 1VQ8N 3ZETB 2PBDA 2P9NA 5AQXA 3G25A 3FZKA 2P9UB 5JLHA 4RWTA 1ATNA 2Q2RA 1XUPO 4H5NA 2P9LA 3FE1A 4FWSA 3LM2A 3KK7A 4JK8A 4EIAA 5ADXA 4JEPA 4G9ZA 5CHIA 3UE5A 1NMDA 4C1NI 4FWLA 3DXMB 4YDUC 3DLLL 2JWKA 3SK3A 3MN7A 2OANA 3GG4A 1EQYA 4YDUA 5LY3A 5AQLA 4CI6A 3L0QA 5HOOA 5TKYA 5AQGA 1ZBSA 4ISGA 1DT9A 3O80A 4I6MB 3ZEUB 4BRHA 3HI0A 5F0XA 1ATSA 4JKAA 4JN4A 1QQNA 2V52B 3GOIA 3MX2A 1SAZA 1YVNA 3W0LA 2P9NB 5GAEP 1NGGA 4BRKA 5LJWA 2P9LB 1YXQA 2E8AA 5E84A 3O1WA 3IMXA 4H0YB 5M1PA 3QFPA 4BRCA 3CCQN 4BR2A 3LDNA 2CGKA 5MLCQ 2F9TA 1CZAN 4IFEA 4BC2A 3QB0A 2D1KA 3QICA 3C6AA 4B1ZA 5KPTA 3H3NO 2KHOA 3UB5A 2ZGZA 1ILYA 4NLCA 1BG3A 5JLFA 3I33A 2E2QA 1T3VA 4WQ5C 3T69A 3ZX2A 2BH1A 3ENBA 4IO8A 3RVCA 3W3DA 2FLOA 1MDUB 3D2FA 4JKBA 3NVMA 3O6WA 3BEXA 3A5NC 1U6ZA 3K9KA 1V4TA 3VEZA 1JJ2M 2QTDA 3ULEA 4GNIA 2GUPA 3A5MC 3MN6A 4FWNA 5EY4A 5EX5A 3I55N 2CGLA 4IOCL 3OW2M 3WEEB 4K25A 4BRAA 3E66A 1S72N 2YHYA 1RDUA 5BN9A 3CJAA 2WUSA 3F9MA 3HTVA 4IOAL 5CR4A 4BRDA 5C10A 1NGAA 3C6HA 1YIJN 2DPNA 1HJOA 3E9PA 3O9RA 5C2DA 2P9IA 3IFRA 5JMVA 2HSTA 3HSCA 3ATUA 3WT0A 2GWKA 1QQMA 2NRWA 1NGEA 4FOEA 4MDAA 1DKGD 2QA4N 1VQ5N 4OPAA 4K42A 5DM7L 1GLEG 3D2EB 4FO0A 3VF4A 4MO5A 3LDPA 1WOQA 5C15A 5ADXH 4FSVA 4BC5A 1P8ZA 4CBXA 1BOTO 4FWMA 1BU6O 1KAXA 5AQNA 4YOYA 5BREA 1Q86O 1TUUA 2Q97A 1NGCA 4CZMA 3P4IA 4BRFA 2QXLA 4IJAA 5FPMA 1K73O 5GIPA 5GINA 3Q7BA 3TSPA 3O9SA 4ILGB 4YOUA 2OTJN 3TTFA 2F9WA 3H1VX 2E1YA 3VF6A 3R8EA 3AY9A 4M63C 5AQHA 3D6RA 3CERA 1T6DA 3QDKA 2H3GX 2QWRA 4CZEA 1N8RO 2JWLA 3NMUA 2HOEA 3H46O 4O5FA 5AFUA 1QZ6A 2HBMA 5AZIA 1JCGA 5BR9A 4BVOA 5ELZA 4WFNL 4ILJA 2IVOA 4WFBL 3EKSA 4GY2B 4UY8O 5FPDA 3O08A 3OHRA 1Y64A 4H0TB 5AQKA 2GWJA 3HOSA 2D0OA 4DQ8A 3HZ6A 2W40A 3HRGA 1QZ5A 1SS6A 3C65A 4MLHA 3TTCA 4C1NK 4FVUA 1NWKA 2NRHA 4M7XA 1XC3A 3PIOL 1NGJA 4NO7A 1DGKN 3S41A 3Q7CA 3P38A 5AR0A 3VEYA 4CZLA 3C7NB 3HOTA 4EFHA 5AQYA 3O9QA 4CZKA 1M90O 1BDGA 5M1FA 4GV6A 3U8XA 1IJJA 3KZBA 4FOIA 2KLAA 5AQFA 4EHTA 4A5BA 4JKCA 5AZIB 3VERA 2FSKA 4BRQA 4CZHA 1QQOA 4HTLA 1GLJO 4GV9A 2Q1NA 3ZX0A 1NJIO 3N4PA 2QI2A 3MK6A 3R1XA 3J7ZO 2Q0UA 1VQON 1NLVA 1C0GA 2VGMA 3FFKB 4H5VA 2PAVA 4B1VA 1KC8O 4GV3A 2OTLN 1LOTB 4PHTX 2V51B 4H5RA 3TTDA 4A61A 2W41A 3MCPA 4YOTA 5C12A 3TPQA 4WQ4C 3L4IA 4BRLA 5AQPA 3H6EA 4A62A 1QHAA 4IZ9A 2QWLA 3A0IX 2NRTA 3P39A 3J8AA 4JHDA 1C0FA 4JKGA 2QWMA 5M1KA 3VESA 5EVZA 4FWQA 4H03B 3WQTA 3L6QA 4BRIA 3CMAN 4BQZA 1HLUA 4BREA 3MWPA 3O5BA 4DHYA 5LJVA 5HL7L 3ID6A 3WXJA 4KH5A 2WFBA 4CBUA 1V4SA 3CETA 3VMFB 1YHQN 3CHWA 1K9MO 4AM7A 3K9JA 2P9KA 4BVPA 3SAFA 3CMEN 4H0PA 3BUZB 1VQMN 2YJFA 1RFQA 3CD6N 1J6ZA 4WQ5A 3VGMA 2GELA 2ZF5O 3MDQA 2CH6A 4FL9A 3ID8A 3O8MA 3FGUA 2YX6A 3FZHA 5KQ8A 2CGJA 3CJ1A 4B1UB 4JD2A 4WYBA 3QBWA 4JHDB 1NM1A 2NRRA 3DXKA 3I56N 1YITN 4CBWA 1BWFO 1HX1A 1GLAG 1GLBG 4KBOA 3CCUN 4MDBA 1E4FT 4A57A 1NGBA 2AA4A 4YORA 1X3NA 1VQ7N 5FPEA 4XH1A 1S3XA 2IIRA 4B1YB 5JVGL 3BF1A 2WC9A 4CZJA 3CC2N 4H5TA 3A8YA 1JCEA 1SQKA 1EO1A 4JKEA 4BR0A 1BO5O 1GLCG 5C0YA 3EKUA 4PKGA 3U9DA 4KH4A 1T6CA 3D2FB 4RTFD 3BF3A 3GBTA 4O8UA 3H1QA 5AQRA 4CZGA 3IDHA 3VENA 4BR7A 3ULEB 4QS7A 3VEXA 4IO9L 5KQDA 2NRZA 3MCAB 4CJ7A 3T7ZA 3EZWA 3VPZA 3WXKA 3AGKA 3G71N 1Q82O 4JD2B 1RGIA 3CPWM 3RSEA 2YI1A 5DM6L 3CCEN 2QWNA 3KWIA 3WQUA 3NVKA 2E2PA 5AQWA 4WF9L 3H45C 5E26A 5AQIA 5AQSA 4BG9A 1HUXA 1W2BM 1P90A 2P9IB 3UKRA 1MWKA 4HWIA 5BRHA 1VAZA 3CF5L 3CJBA 1SZ2A 1H1VA 2NRVA 2FSJA 4O8KA 2E2OA 2IVNA 1Z05A 3WXMB 1VQKN 1GLFO 2FF3B 5AQTA 5CE3A 3QBXA 4OO1J 1QVFM 4PL7A 3R6MA 1OKJA 3MN5A 2QW9A 2IVPA 3ZX3A 1YJWN 1VQ9N 2QEXN 4BRGA 4WCEL 1YJNN 3VEOA 4QS8A 5AQZA 4BG8A 3N4QA 1BUPA 3R3LA 4JK7A 2Q31A 2HF3A 1BA0A 4IDHA 4MO4A 5BPMA 1ZC6A 2ASOA 1NGDA 4A59A 4A5AA 4BC3A 3RSEB 4ISFA 3ZETA 4B1XB 5BN8A 4E1JA 3O1BA 3TSQA 2ZJRL 5BRFA 1G99A 2P9UA 4BRMA 2NZTA 4DCHA 2HBLA 4ILHA 2BUPA 4JNEA 3TU5A 4M7YA 3L4QA 3DJCA 3DXMA 1M1KO 3U9ZA 1KD1O 3LM9A 1S22A 2D4WA 5I9EB 3ENOA 4PKHA 4FPBA 3VTIA 2A3ZA 4H0VB 3OBYA 4XH5A 5F2RA 3I8BA 3CCJN 2A5XA 2E1ZA 2PFUA 2CH5A 4L3QA 4XEIA 5FPNA 4I6MA 1VQLN 3ZEUA 3EE8A 3R9PA 3SAGA 1ESVA 4LC9B 4PKIA 3KVGA 1OVYA 4BR9A 4U67L 1IG8A 4WFAL 1GLLO 1QVGM 4ISEA 1VQ4N 2V7ZA 2ASMA 3UKUA 5AZJA 3SJHA 3TSUA 3E9OA 3CC7N 2ZWHA 3WXLA 4IXCA 1KAYA 1VQPN 3D7EO 2QWOA 3G4SN 3PLAA 4WQ4A 3DAWA 1KXPA 3WXIA 5TKWA 3EO3A 2FF6A 3E9LA 4BR4A 4H0XB 5AQMA 1BA1A 1NBWA 3A5OC 4DKWA 1Q18A 4NB4A 4OPHA 3VF2A 1XQSC 5EOYA 3ATVA 3VETA 1Z6RA 2P9PA 2HF4A 3C0BA 4PL8A 4XH4A 4BRPA 3O9UA 3M6GA 4BC4A 1ATRA 1O13A 2A6AA 5GIOA 1X3MA 2P9SA 2QM1A 1GLDG 3ZYYX 2BTFA 2I7PA 4H5WA 4IOXA 1LCUA 2YHWA 1WUAA 3CXCM 1KAZA 3SMSA 3F5TA 3UKUB 4GVEA 5AZJB 3P31A 2VGNA 3CJ9A 3DWLA 5GAHP 3HM8A 3G6EN 5GADP 1TUYA 3LDOA 3WEEA 1NGFA 2QWQA 4IEIA 5AFUH 3GE1A 4JAXA 3M3ZA 3A5LC 1K8AO 3FZMA 1DEJA 2KKZA 3B8AX 1YAGA 3QMLA 3FR0A 4BQLA 2ITMA 3FZFA 4JKGB 5B8HA 4Y0WA 1HKGA 1NGIA 5KPZA 2VCPA 3FZLA 4B9QA 1HKBA 2D0PA 3VOVA 4U7BA 2P9PB 4YOVA 5EXWA 3IUCA 4B1WB 2GX9A 2NNWA 4JK9A 2F7TA 3AGRA 3M1FA 3LDQA 3CCRN 3D2EA 2J4RA 3O4WA 2P9SB 4YOXA 3GL1A 4BROA 1HKCA 4A2AA 4K43A 5BPNA 2RE2A 3PIPL 3SAHA 2P9KB 3KHYA 3EL2A 5KPRA 3ENHA 2HMPA 4A2BA 3JS6A 2Q0RA 3SBGA 4CZIA 2NLXA 5AQJA 3U4LA 2YJEA 2HBKA 3AAPA 2FXUA 4FWKA 4YOWA 1YJ9N 1T44A 3O9TA 2RHKA 3LDLA 3VGKA 3EE9A 3CQXA 4CZFA 1Q81O 3LL3A 2A41A 2NRXA 4H0OA 3DXKB 3MX5A 4C23A 4AF1A 5AQOA 3OA9A 5M1NA 4BR5A 3BP8A 3VTHA 4EAHD 2UYTA 3CIPA 3CCSN 4BRNA 1MWMA 5C2FA 1D4XA 1R59O 2A40A 4IJNA 4CD1A 2ZJPL 3MN9A 4FWPA 2ASPA 3CJCA 4CD3A 1KQSM 1VQ6N 5BPLA 5JVHL 3KWGA 4FWOA 4IWVA 3CCLN 2YHXA 3HBTA 3JXUA 3E1YA 3CCVN 4K41A 2I7NA 1TYQA 1W97L 3MMVA 1U2VA 5M1OA 1HPMA 4JKHA 5AQUA 2V7YA 2ZGYA 1Q7YO 4Z94A 2GTDA 4RCHA 2E88A 3SLCA 3MWTA 3AAQA 3C7NA 4IEEA 3H3OB 1K8KA 2HBJA 2E20A 4BGAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FPA A;  4MLE A;  4AM6 A;  3SMP A;  3WUH A;  4FWR A;  3VEW A;  2GEM A;  5JIC A;  3UKR B;  2Q36 A;  2QWP A;  4J8F A;  1RDW X;  1NGH A;  3AAR A;  3VGL A;  1ZXO A;  4QS9 A;  5BRD A;  5F1X A;  1JCF A;  3GDQ A;  1E4G T;  3QFU A;  1MA9 B;  3FLC O;  4BGB A;  4EHU A;  2VWB A;  2FSN A;  1TYQ B;  1U2V B;  2YCH A;  4F9O A;  2E2N A;  2VYP A;  2A42 A;  2EWS A;  5AQV A;  3VEV A;  1K8K B;  3CI5 A;  3EN9 A;  3CQY A;  1X9J A;  1YUW A;  2AP1 A;  3CJ7 A;  5AQQ A;  4DB3 A;  3ZET B;  2PBD A;  2P9N A;  5AQX A;  3G25 A;  3FZK A;  2P9U B;  5JLH A;  4RWT A;  1ATN A;  2Q2R A;  1XUP O;  4H5N A;  2P9L A;  3FE1 A;  4FWS A;  3LM2 A;  4EIA A;  5ADX A;  3UE5 A;  1NMD A;  4FWL A;  3DXM B;  4YDU C;  3SK3 A;  3MN7 A;  2OAN A;  3GG4 A;  1EQY A;  4YDU A;  5LY3 A;  5AQL A;  4CI6 A;  3L0Q A;  5TKY A;  5AQG A;  1ZBS A;  4ISG A;  3O80 A;  4I6M B;  3ZEU B;  4BRH A;  3HI0 A;  5F0X A;  1ATS A;  4JN4 A;  1QQN A;  2V52 B;  3GOI A;  1SAZ A;  1YVN A;  3W0L A;  2P9N B;  1NGG A;  4BRK A;  5LJW A;  2P9L B;  1YXQ A;  2E8A A;  5E84 A;  3O1W A;  3IMX A;  4H0Y B;  3QFP A;  4BRC A;  4BR2 A;  3LDN A;  2CGK A;  2F9T A;  1CZA N;  4BC2 A;  3QB0 A;  2D1K A;  3QIC A;  4B1Z A;  5KPT A;  3H3N O;  2KHO A;  3UB5 A;  2ZGZ A;  1BG3 A;  5JLF A;  3I33 A;  2E2Q A;  4WQ5 C;  3ZX2 A;  4IO8 A;  3W3D A;  2FLO A;  1MDU B;  3D2F A;  3O6W A;  3BEX A;  3A5N C;  1U6Z A;  3VEZ A;  1V4T A;  3ULE A;  4GNI A;  2GUP A;  3A5M C;  3MN6 A;  4FWN A;  5EY4 A;  5EX5 A;  2CGL A;  3WEE B;  4K25 A;  4BRA A;  2YHY A;  5BN9 A;  3CJA A;  2WUS A;  3F9M A;  3HTV A;  4BRD A;  1NGA A;  2DPN A;  1HJO A;  2P9I A;  3IFR A;  5JMV A;  3HSC A;  3ATU A;  3WT0 A;  2GWK A;  1QQM A;  4FOE A;  1NGE A;  1DKG D;  4K42 A;  1GLE G;  3D2E B;  4FO0 A;  2E20 A;  3VF4 A;  4MO5 A;  3LDP A;  1WOQ A;  5ADX H;  4FSV A;  4BC5 A;  1P8Z A;  4CBX A;  1BOT O;  4FWM A;  1BU6 O;  1KAX A;  5AQN A;  5BRE A;  1TUU A;  2Q97 A;  1NGC A;  4CZM A;  3P4I A;  4BRF A;  2QXL A;  4IJA A;  5FPM A;  2F9W A;  3H1V X;  2E1Y A;  3VF6 A;  3R8E A;  3AY9 A;  4M63 C;  5AQH A;  3CER A;  1T6D A;  3QDK A;  2H3G X;  2QWR A;  4CZE A;  2HOE A;  3H46 O;  4O5F A;  5AFU A;  1QZ6 A;  5AZI A;  1JCG A;  5BR9 A;  4BVO A;  5ELZ A;  2IVO A;  3EKS A;  4GY2 B;  5FPD A;  3O08 A;  3OHR A;  1Y64 A;  4H0T B;  5AQK A;  2GWJ A;  2D0O A;  4DQ8 A;  3HZ6 A;  2W40 A;  1QZ5 A;  4MLH A;  1NWK A;  2NRH A;  4M7X A;  1XC3 A;  1NGJ A;  4NO7 A;  1DGK N;  3S41 A;  5AR0 A;  3VEY A;  4CZL A;  3C7N B;  4EFH A;  5AQY A;  4CZK A;  1BDG A;  3U8X A;  1IJJ A;  3KZB A;  4FOI A;  5AQF A;  4EHT A;  5AZI B;  3VER A;  2FSK A;  4BRQ A;  4CZH A;  1QQO A;  4HTL A;  1GLJ O;  2Q1N A;  3ZX0 A;  3MK6 A;  2Q0U A;  1NLV A;  1C0G A;  3FFK B;  4H5V A;  2PAV A;  4B1V A;  1LOT B;  2V51 B;  4H5R A;  4A61 A;  2W41 A;  3MCP A;  3TPQ A;  4WQ4 C;  3L4I A;  4BRL A;  5AQP A;  3H6E A;  4A62 A;  1QHA A;  4IZ9 A;  2QWL A;  3A0I X;  3J8A A;  4JHD A;  1C0F A;  2QWM A;  3VES A;  5EVZ A;  4FWQ A;  4H03 B;  3WQT A;  3L6Q A;  4BRI A;  4BQZ A;  1HLU A;  4BRE A;  3O5B A;  4DHY A;  5LJV A;  3WXJ A;  4CBU A;  1V4S A;  3CET A;  3CHW A;  4AM7 A;  2P9K A;  4BVP A;  4H0P A;  3BUZ B;  2YJF A;  1RFQ A;  1J6Z A;  4WQ5 A;  3VGM A;  2GEL A;  2ZF5 O;  3MDQ A;  2CH6 A;  4FL9 A;  3ID8 A;  3O8M A;  3FGU A;  3FZH A;  5KQ8 A;  2CGJ A;  3CJ1 A;  4B1U B;  4JD2 A;  4WYB A;  3QBW A;  4JHD B;  1NM1 A;  3DXK A;  4CBW A;  1BWF O;  1HX1 A;  1GLA G;  1GLB G;  4KBO A;  1E4F T;  1NGB A;  2AA4 A;  1X3N A;  5FPE A;  4XH1 A;  1S3X A;  2IIR A;  4B1Y B;  3BF1 A;  4CZJ A;  4H5T A;  3A8Y A;  1JCE A;  1SQK A;  4BR0 A;  1BO5 O;  1GLC G;  3EKU A;  4PKG A;  3U9D A;  1T6C A;  3D2F B;  4RTF D;  3BF3 A;  3GBT A;  3H1Q A;  5AQR A;  4CZG A;  3IDH A;  3VEN A;  4BR7 A;  3ULE B;  4QS7 A;  3VEX A;  5KQD A;  4CJ7 A;  3EZW A;  3VPZ A;  3WXK A;  4JD2 B;  1RGI A;  3RSE A;  2YI1 A;  2QWN A;  3WQU A;  2E2P A;  5AQW A;  3H45 C;  5E26 A;  5AQI A;  5AQS A;  4BG9 A;  1HUX A;  2P9I B;  3UKR A;  1MWK A;  4HWI A;  5BRH A;  3CJB A;  1SZ2 A;  1H1V A;  2FSJ A;  4O8K A;  2E2O A;  2IVN A;  1Z05 A;  1GLF O;  2FF3 B;  5AQT A;  5CE3 A;  3QBX A;  4PL7 A;  3R6M A;  1OKJ A;  3MN5 A;  2QW9 A;  2IVP A;  3ZX3 A;  4BRG A;  3VEO A;  4QS8 A;  5AQZ A;  4BG8 A;  1BUP A;  2Q31 A;  2HF3 A;  1BA0 A;  4MO4 A;  5BPM A;  1ZC6 A;  2ASO A;  1NGD A;  4BC3 A;  3RSE B;  4ISF A;  3ZET A;  4B1X B;  5BN8 A;  4E1J A;  3O1B A;  5BRF A;  1G99 A;  2P9U A;  4BRM A;  2NZT A;  4DCH A;  2BUP A;  4JNE A;  3TU5 A;  4M7Y A;  3DJC A;  3DXM A;  3U9Z A;  3LM9 A;  1S22 A;  2D4W A;  5I9E B;  3ENO A;  4PKH A;  4FPB A;  2A3Z A;  4H0V B;  4XH5 A;  5F2R A;  3I8B A;  2A5X A;  2E1Z A;  2CH5 A;  4L3Q A;  4XEI A;  5FPN A;  4I6M A;  3ZEU A;  3R9P A;  1ESV A;  4LC9 B;  4PKI A;  3KVG A;  4BR9 A;  1IG8 A;  1GLL O;  4ISE A;  2V7Z A;  2ASM A;  3UKU A;  5AZJ A;  3SJH A;  2ZWH A;  3WXL A;  4IXC A;  1KAY A;  3D7E O;  2QWO A;  4WQ4 A;  3DAW A;  1KXP A;  3WXI A;  3EO3 A;  2FF6 A;  4BR4 A;  4H0X B;  5AQM A;  1BA1 A;  1NBW A;  3A5O C;  1Q18 A;  4NB4 A;  3VF2 A;  1XQS C;  5EOY A;  3ATV A;  3VET A;  1Z6R A;  2P9P A;  2HF4 A;  3C0B A;  4PL8 A;  4XH4 A;  4BRP A;  3M6G A;  4BC4 A;  1ATR A;  2A6A A;  1X3M A;  2P9S A;  2QM1 A;  1GLD G;  2BTF A;  2I7P A;  4H5W A;  1LCU A;  2YHW A;  1WUA A;  1KAZ A;  3SMS A;  3UKU B;  5AZJ B;  3CJ9 A;  3HM8 A;  1TUY A;  3LDO A;  3WEE A;  1NGF A;  2QWQ A;  5AFU H;  3GE1 A;  4JAX A;  3M3Z A;  3A5L C;  3FZM A;  1DEJ A;  3B8A X;  1YAG A;  3QML A;  3FR0 A;  4BQL A;  2ITM A;  3FZF A;  5B8H A;  4Y0W A;  1HKG A;  1NGI A;  5KPZ A;  2VCP A;  3FZL A;  4B9Q A;  1HKB A;  2D0P A;  3VOV A;  2P9P B;  5EXW A;  3IUC A;  4B1W B;  3M1F A;  3LDQ A;  3D2E A;  2J4R A;  3O4W A;  2P9S B;  3GL1 A;  4BRO A;  1HKC A;  4A2A A;  4K43 A;  5BPN A;  2P9K B;  3KHY A;  3EL2 A;  5KPR A;  3ENH A;  2HMP A;  4A2B A;  3JS6 A;  2Q0R A;  4CZI A;  2NLX A;  5AQJ A;  3U4L A;  2YJE A;  3AAP A;  2FXU A;  4FWK A;  1T44 A;  3LDL A;  3VGK A;  3CQX A;  4CZF A;  3LL3 A;  2A41 A;  4H0O A;  3DXK B;  4C23 A;  5AQO A;  4BR5 A;  3BP8 A;  4EAH D;  2UYT A;  3CIP A;  4BRN A;  1MWM A;  1D4X A;  1R59 O;  2A40 A;  4IJN A;  4CD1 A;  3MN9 A;  4FWP A;  2ASP A;  3CJC A;  4CD3 A;  5BPL A;  4FWO A;  4IWV A;  2YHX A;  3HBT A;  3JXU A;  4K41 A;  2I7N A;  1TYQ A;  3MMV A;  1U2V A;  1HPM A;  5AQU A;  2V7Y A;  2ZGY A;  4Z94 A;  2GTD A;  4RCH A;  2E88 A;  3SLC A;  3AAQ A;  3C7N A;  3H3O B;  1K8K A;  3DWL A;  4BGA A; 
#chains in the Genus database with same CATH topology
 4MLE A;  4KH6 A;  4M3T A;  4R79 A;  3H08 A;  2GEM A;  5H1S Q;  4JKD A;  4Z4C A;  3UKR B;  4LH4 A;  4BY9 C;  4CJ3 A;  3TAM A;  3VGL A;  4JS5 A;  3QFU A;  4DQS A;  3F2K A;  2YCH A;  3ZSR A;  2WBN A;  2E2N A;  2VYP A;  3PO4 A;  4NCB A;  4DR3 K;  2RF2 A;  3EN9 A;  1X9J A;  2ZJQ L;  5M1Q A;  2VWK A;  1KRP A;  1N34 K;  1VQ8 N;  3ZET B;  3G25 A;  4ID1 A;  1XUP O;  4H5N A;  4FWS A;  4EIA A;  2X74 A;  3DI6 A;  1C1C A;  2G8H A;  4Z4F A;  1NMD A;  3G10 A;  3DLL L;  3OJU A;  2OAN A;  3GG4 A;  4AHT A;  5AQL A;  3T3F A;  1EKE A;  2BAN A;  3HI0 A;  1B9D A;  1SL2 A;  4CJQ A;  4CHN A;  2XY6 A;  2V52 B;  3GOI A;  1YTU A;  2HVI A;  3W0L A;  1N6Q A;  4JRQ A;  2HHS A;  4DSF A;  1NGG A;  5EU7 A;  1IV0 A;  2E8A A;  3HP9 A;  3O1W A;  3C94 A;  3SQ0 A;  5M1P A;  3CCQ N;  4BR2 A;  3LDN A;  1TKX A;  2F9T A;  4IFE A;  3QB0 A;  3C6A A;  1L3U A;  1BG3 A;  1QSL A;  2E2Q A;  3AVM A;  2RPI A;  3ZX2 A;  4FJJ A;  2IOC A;  3NVM A;  3OYD A;  3BEX A;  3SQ1 A;  3VEZ A;  1KVA A;  2GBZ A;  3OW2 M;  4IOC L;  3I55 N;  5EY4 A;  3MEC A;  4BRA A;  3LPU A;  3CJA A;  2VG7 A;  5CR4 A;  4BRD A;  3OYG A;  1NGA A;  3C6H A;  2O8D B;  4DU4 A;  3E9P A;  3ITH A;  1TVR A;  2OPP A;  2D5R A;  2NRW A;  4MDA A;  3M8R A;  1DKG D;  5FDL A;  5KI6 A;  3P83 D;  4O4G A;  4CEB A;  2KQ2 A;  5DM7 L;  3D2E B;  4RW7 A;  4Y1D A;  2G8F A;  4MO5 A;  3LDP A;  3SZ2 A;  1U49 A;  4CBX A;  4ELV A;  4FWM A;  2HHT A;  4YOY A;  1TGO A;  4FLW A;  1NGC A;  4DUY K;  4IJA A;  1KVC A;  5FPM A;  4DLE A;  3ZT3 A;  3H1V X;  3R8E A;  4M63 C;  3SPZ A;  3D6R A;  4JI0 K;  3ZSY A;  2QWR A;  3LDS A;  2HOE A;  4O5F A;  5AZI A;  1JCG A;  4BVO A;  5ELZ A;  2G8W A;  3DYA A;  5FPD A;  1NJY A;  3K5L A;  3OHR A;  5AQK A;  2GWJ A;  1QTM A;  4F2S A;  3C65 A;  4MLH A;  1TK0 A;  5KRS A;  4HVJ A;  4M7X A;  2HHV A;  4FLV A;  3VEY A;  1DGK N;  3Q7C A;  4LF5 K;  4HUG A;  3DMJ A;  2AJQ A;  3C7N B;  3BZC A;  3L2Q A;  1RBR A;  3MAQ A;  1M90 O;  4QOZ B;  1WB9 A;  3VQ5 A;  5FRM A;  1JLA A;  2HHH K;  3RRG A;  3KZB A;  4DQR A;  4EHT A;  4RW6 A;  4JKC A;  3K5O A;  4DSK A;  1QQO A;  3SUN A;  1GLJ O;  4GV9 A;  2Q1N A;  4KI6 A;  3MK6 A;  3R1X A;  3J7Z O;  2VGM A;  3RMD A;  2PAV A;  4GV3 A;  3WNG A;  3SUP A;  1RBU A;  4A61 A;  2P5G A;  4JI2 K;  2YKM A;  4BE2 A;  4CER A;  4JI8 K;  1J5O A;  4I2P A;  4B9M A;  4JHD A;  2QWM A;  3VES A;  2HHQ A;  4FWQ A;  4BRI A;  3CMA N;  1HMV A;  3MWP A;  3WXJ A;  3I0R A;  3V1Q A;  2O8F A;  4BVP A;  3BUZ B;  1VQM N;  1J6Z A;  4WQ5 A;  5K14 A;  2GEL A;  3ZSX A;  3MDQ A;  3ID8 A;  3HL8 A;  4JD2 A;  3VQ6 A;  3QBW A;  1NM1 A;  2NRR A;  3I56 N;  3KKS A;  4FM1 A;  1GLA G;  1GLB G;  1RT2 A;  4KBO A;  4MDB A;  5FLX O;  1E4F T;  4A57 A;  4B3T K;  4FW2 A;  4CFD A;  3KLH A;  1VQ7 N;  4XH1 A;  1S3X A;  3A8Y A;  1SQK A;  5D3G A;  4BR0 A;  5C24 A;  1FXX A;  3M8Q A;  1JKH A;  3CFR A;  1RDC A;  2B5J A;  3EKU A;  3U9D A;  4KH4 A;  3PX6 A;  3VQ4 A;  4FZZ A;  2RN2 A;  3BF3 A;  3GBT A;  4O8U A;  4CZG A;  3KD1 E;  3ULE B;  3V81 A;  4IO9 L;  4CJ7 A;  3QIP A;  4E7H A;  4KTZ A;  5KRT A;  4DV4 K;  3NH2 A;  5DM6 L;  3ZSO A;  4B9U A;  3CCE N;  4J2E A;  3WQU A;  4CK2 A;  2E2P A;  5AQS A;  1HUX A;  1P90 A;  3UKR A;  3CF5 L;  1RBS A;  3ZCM A;  3CJB A;  3OY9 A;  5HRR A;  4O8K A;  4OKJ A;  3WXM B;  3HVR A;  3EZ5 A;  1NK0 A;  3QBX A;  3R6M A;  1OKJ A;  5HRS A;  1VQ9 N;  5A2Q O;  1FKO A;  3AA3 A;  4QS8 A;  3N4Q A;  3R3L A;  1ZBI A;  3AVL A;  4FJ8 A;  1ZC6 A;  2ASO A;  4BC3 A;  1JLF A;  3ZET A;  2YKN A;  2PYL A;  3QEX A;  1S5J A;  4DTO A;  2NZT A;  4DCH A;  2HBL A;  4BDZ A;  2BUP A;  3S3M A;  4M7Y A;  1BI4 A;  5HLF A;  1KD1 O;  3LM9 A;  5I9E B;  5E41 A;  2A3Z A;  4BE1 A;  1RT7 A;  4PUO A;  1KCF A;  1KSP A;  2E1Z A;  2HVH A;  4L3Q A;  3NF6 A;  1UA1 A;  3EE8 A;  1ESV A;  1L3V A;  1OVY A;  3LZI A;  3THW A;  1TAU A;  3EY1 A;  1QVG M;  4ISE A;  3UKU A;  5AZJ A;  2KW4 A;  3SJH A;  3BGR A;  1TKZ A;  4CJS A;  3CC7 N;  5SZT A;  3WXL A;  3D7E O;  2QWO A;  4K0K K;  4FJI A;  5CYM A;  3WXI A;  3P5J A;  4IG0 A;  2FF6 A;  3E9L A;  2D0B A;  2XHB A;  3QES A;  4DKW A;  4GW6 A;  2W42 A;  1Q18 A;  1XQS C;  5AJ3 K;  4CJE A;  3ATV A;  3C0B A;  4XH4 A;  2P9P A;  4PL8 A;  2F96 A;  1Q9Y A;  3KK1 A;  3O9U A;  4BC4 A;  4X65 K;  1O13 A;  1RT4 A;  4N41 A;  3KD5 E;  2HHX A;  3L3V A;  2I7P A;  4Q0B A;  2YHW A;  3CXC M;  3F73 A;  3P31 A;  2QWQ A;  4IEI A;  3A5L C;  1Z25 A;  3FZM A;  2KKZ A;  3MEE A;  2O8D A;  4AQY K;  5B8H A;  5BR8 K;  1HKG A;  1NGI A;  5KPZ A;  2VCP A;  4B9Q A;  1HKB A;  3VOV A;  4B1W B;  2NNW A;  1LW2 A;  3AA4 A;  2XY5 A;  3VN5 A;  1J9A A;  3D2E A;  1QS4 A;  3NF9 A;  4R5P A;  4BRO A;  3KHY A;  1N5Y A;  4X62 K;  1NKE A;  4LF4 K;  2HMP A;  3NDK A;  4X64 K;  3V6D A;  2HBK A;  3AAP A;  2QXF A;  2FXU A;  4FWK A;  3L2W A;  1YJ9 N;  2DTU A;  1FW6 A;  3VGK A;  3SYZ A;  3CQX A;  3IRX A;  4CW7 B;  3DXK B;  4C23 A;  4M3Y A;  3DLG A;  3BP8 A;  3VTH A;  4EAH D;  2EX3 A;  4CJK A;  3CCS N;  4BRN A;  3CJC A;  1NKC A;  3ZSV A;  1SUQ A;  4NXN K;  1J53 A;  1WSG A;  4NXM K;  2YHX A;  3VA3 A;  3E1Y A;  3K58 A;  2I7N A;  1W97 L;  2V7Y A;  4EP4 A;  3L3U A;  1NMN A;  3MWT A;  3C7N A;  1K8K A;  3HP6 A;  4CJW A;  1S1W A;  3ENH A;  2E20 A;  4BGA A;  2HHU A;  3SMP A;  4GKJ K;  3VEW A;  3THX B;  2O8E B;  3QEV A;  3QEI A;  3M5R A;  5JIC A;  3VQ9 A;  3QIN A;  3PX4 A;  2O8C B;  3OYL A;  4DSI A;  2Z1H A;  3VQQ A;  2ZM6 K;  2HHW A;  4ZHR A;  4PY5 A;  4NLB A;  1VQN N;  1MA9 B;  3FLC O;  4DR1 K;  2VWB A;  2FSN A;  1TYQ B;  1W0H A;  1U2V B;  1S1U A;  4E7I A;  4F9O A;  2D0C A;  4JKF A;  4KHU A;  4E1N A;  4M3X A;  3M8S A;  1YF5 L;  5J2P A;  1VQL N;  5AQQ A;  2ZD1 A;  2HB5 A;  2P9N A;  3KIO A;  3QEW A;  3PUF A;  3FZK A;  4RWT A;  1VSD A;  2P9L A;  3FE1 A;  3O3F A;  4G9Z A;  4LFA K;  4KHQ A;  3UE5 A;  4JYA K;  4C1N I;  3RRH A;  1IBK K;  2JWK A;  5FRO A;  2D0A A;  4KHS A;  4O55 A;  1C1A A;  5TKY A;  5AQG A;  1W7A A;  4C8M A;  4JI1 K;  4JI7 K;  4JLH A;  1KTQ A;  5F0X A;  1XC9 A;  2P51 A;  4JKA A;  4JN4 A;  1S9E A;  1EXQ A;  1SAZ A;  2OA8 A;  1VSF A;  3K57 A;  5LJW A;  1YXQ A;  1KFS A;  2F8S A;  4CVN E;  3QNN A;  4DQP A;  5E84 A;  3IMX A;  3QFP A;  4E0D A;  4FJG A;  3VQP A;  2CGK A;  4DTU A;  1WNS A;  1FK9 A;  1JL1 A;  4B1Z A;  4CGF A;  3CM6 A;  1X1P A;  3DLR A;  3DM2 A;  3V4I A;  1VSJ A;  3T69 A;  4IO8 A;  4KHY A;  2IC3 A;  1MDU B;  3UIQ A;  3RR7 A;  3O6W A;  4KTW A;  3A5N C;  4CJU A;  3NGI A;  4FZX C;  3AVN A;  3ULE A;  4GNI A;  1JL2 A;  1I39 A;  1VSM A;  2XRI A;  2XY8 A;  4E89 A;  5EX5 A;  2CGL A;  3JYT A;  3KJV A;  5BN9 A;  1RDU A;  4AIL C;  1TL3 A;  3QLH A;  1S72 N;  4CGG A;  4IKF A;  4O44 A;  2PY5 A;  1YIJ N;  2I5J A;  1TKT A;  3O9R A;  1HJR A;  2ZE2 A;  2HST A;  3WT0 A;  4FOE A;  1QQM A;  4NCA A;  1VQ5 N;  3LAL A;  1HPZ A;  4K42 A;  4FJ9 A;  4IFY A;  4OKE A;  4FSV A;  2KZM A;  1P8Z A;  2XY7 A;  1BOT O;  1BU6 O;  4OGC A;  3HT3 A;  2P5O A;  1Q86 O;  3A2F A;  2NUB A;  4CZM A;  2FC0 A;  1C1B A;  3NBP A;  5GIN A;  3Q7B A;  3O9S A;  5LL6 Z;  1RT5 A;  4YOU A;  2F9W A;  3V9U A;  3VF6 A;  3AY9 A;  3O4N A;  1T6D A;  2H3G X;  1QZ6 A;  1NK6 A;  4CEO A;  4ILJ A;  4J2B A;  2IVO A;  4WFB L;  4GY2 B;  5HBM A;  3NFA A;  3AVI A;  4CJR A;  4YHH K;  3HRG A;  1QZ5 A;  1OH7 A;  2PYJ A;  4C1N K;  4DR6 K;  1EX4 A;  1NWK A;  2NRH A;  4CEE A;  4HCB A;  1XC3 A;  3PIO L;  4NO7 A;  1T7P A;  5AR0 A;  3HOT A;  3CFO A;  4EFH A;  5AQY A;  4FJL A;  3O9Q A;  5HRN A;  4CZK A;  4F2R A;  1BDG A;  5M1F A;  3WNE A;  3U8X A;  4B8C A;  4DMN A;  1CZ9 A;  5AQF A;  2YNI A;  4A5B A;  3VER A;  4DR4 K;  1QE1 A;  4CZH A;  3QNO A;  1XWL A;  4HTL A;  4DQQ A;  3ZX0 A;  3N4P A;  2QI2 A;  1VK0 A;  1RDB A;  3FFK B;  3AVF A;  3NF8 A;  4H4M A;  2OTL N;  4PHT X;  5I42 A;  2V51 B;  3TTD A;  4CF1 A;  1OVQ A;  4Z4E A;  3L4I A;  1B92 A;  4CHO A;  3OYH A;  4TSX A;  4IZ9 A;  4E3S A;  2VQF K;  1C0F A;  4DV1 K;  4H03 B;  1VRT A;  2X6S A;  4I2Q A;  4LFB K;  1RT6 A;  5HL7 L;  4LY7 A;  4DHY A;  4OPK A;  5CY4 A;  2UXC K;  2WFB A;  4CBU A;  4FJK A;  3CHW A;  1RTH A;  2YV0 X;  3DLK A;  4AM7 A;  1K9M O;  3K9J A;  2IS3 A;  3SAF A;  4CHZ A;  2YJF A;  4DR5 K;  3WNH A;  2A1S A;  1NJW A;  1ASV A;  2ZF5 O;  2CH6 A;  1RT3 A;  4FL9 A;  1HYZ A;  1XI1 A;  2YX6 A;  4DSJ A;  3CJ1 A;  4B9V A;  4DV2 K;  2KFN A;  3DXK A;  3L2U A;  1YIT N;  1WBD A;  2AA4 A;  3NCI A;  4OX9 K;  4CJT A;  1SL1 A;  2UUA K;  5JVG L;  3AO5 A;  1BQM A;  4CZJ A;  2ATQ A;  1JCE A;  1RBT A;  1Y97 A;  2UU9 K;  1BO5 O;  1GLC G;  3KLE A;  3T1H K;  3IG1 A;  5AQR A;  3IDH A;  1X9S A;  3VEN A;  4BR7 A;  2NRZ A;  3MCA B;  1HNZ K;  4KHW A;  1JLG A;  3VQA A;  3EZW A;  3WXK A;  3G71 N;  3L8B A;  4E7K A;  4IG3 A;  3RSE A;  1IKX A;  5DMR A;  3V9X A;  3THX A;  2QWN A;  2O8E A;  3NVK A;  5AQW A;  5E26 A;  3NE6 A;  1XHX A;  3V1O A;  4BG9 A;  3G0Z A;  4BE0 A;  4GVM A;  4HWI A;  5BRH A;  1H1V A;  3HYF A;  4EZ9 A;  2FSJ A;  1Z05 A;  1J54 A;  1Q8I A;  4LF6 K;  3MN5 A;  2QW9 A;  2IVP A;  3ZX3 A;  4BAC A;  1MU2 A;  3AV9 A;  1BUP A;  5KGX A;  3SUQ A;  5BPM A;  4A59 A;  4CIF A;  4A5A A;  5BN8 A;  5CYQ A;  3O1B A;  4DU1 A;  3DOK A;  1M1K O;  4WE1 A;  3U9Z A;  4M41 A;  4FJH A;  2D4W A;  4FW1 A;  4CJL A;  3AO4 A;  1HRH A;  4ZTF A;  3CCJ N;  4JI3 K;  3DOL A;  1OH8 A;  4XEI A;  5FPN A;  1S1X A;  1VSL A;  4LD0 A;  4BR9 A;  4WFA L;  3NGY A;  1VQ4 N;  3T1Y K;  4B3R K;  4MFB A;  3K2P A;  3TSU A;  2ZWH A;  4IXC A;  3AA2 A;  3DLE A;  1OH5 A;  4ELU A;  1RCH A;  5TKW A;  5SWM A;  3TAR A;  5EOY A;  1Z6R A;  1HNX K;  3C95 A;  3M6G A;  1L5U A;  1ATR A;  3OJS A;  1WSJ A;  3SQ4 A;  4H5W A;  2B4J A;  5HP1 A;  2VGN A;  2FBV A;  4CEA A;  5GAD P;  3HVT A;  4FZY A;  3AVB A;  4DF8 A;  1DEJ A;  3FR0 A;  3FZF A;  1KLM A;  4Y0W A;  3PX0 A;  4M3U A;  1R0A A;  2D0P A;  3IUC A;  1HR0 K;  1U04 A;  1RIL A;  3AGR A;  3O3G A;  1QSS A;  3CCR N;  2P9S B;  3EYZ A;  4E7J A;  1BGX T;  1HKC A;  2RE2 A;  3D45 A;  5KPR A;  2Q0R A;  3ULD A;  2KTQ A;  1LWE A;  2NLX A;  4GKK K;  3CYM A;  3O9T A;  1IKV A;  4M42 A;  2RHK A;  3LDL A;  4CZF A;  4CHP A;  1Q81 O;  2A41 A;  4RG8 A;  1UA0 A;  3OVN A;  2JLE A;  1WSE A;  1S1V A;  5AQO A;  4GMJ B;  1B9F A;  5M1N A;  4KAZ A;  4DTP A;  5T7B A;  3DRR A;  4CD1 A;  1BQN A;  3DRP A;  4CFB A;  4FWP A;  4F3O A;  4JI6 K;  2ASP A;  4K8X A;  1KQS M;  1VQ6 N;  3OYM A;  2BDP A;  3DLB A;  1LWC A;  2P1J A;  4FK0 A;  4DR2 K;  4Z94 A;  4C8O A;  3MED A;  4H4O A;  1U48 A;  3I8D A;  2HBJ A;  4AM6 A;  3MXI A;  4AHR A;  2HNY A;  4FWR A;  4DU3 A;  3CCM N;  2OCE A;  2QWP A;  4J8F A;  1NGH A;  3AAR A;  3CC4 N;  1NNE A;  3SBT A;  4AHV A;  4DV5 K;  2DFE A;  3OYE A;  3LAK A;  5F1X A;  1JCF A;  4W5R A;  2Z1I A;  3GDQ A;  4Y1C A;  4EHU A;  3CQ8 A;  1NG9 A;  2A42 A;  2EWS A;  1NK4 A;  3CI5 A;  3CQY A;  1YUW A;  3CJ7 A;  1YI2 N;  4J2D A;  2HMI A;  2HND A;  2P9U B;  2Q2R A;  2IAJ A;  3LM2 A;  4JK8 A;  3FFI A;  3I0S A;  5CHI A;  3KLI A;  3IS9 A;  4FCY A;  3CM5 A;  1C0U A;  3U6F A;  1EQY A;  4DQI A;  2OZM A;  4CI6 A;  3QIO A;  4MQ3 A;  4NYF A;  2ITG A;  2HW3 A;  1ZBS A;  2W6L A;  5J2Q A;  3O80 A;  1ZBL A;  2UXD K;  1JLB A;  5GAE P;  2OPS A;  4BRK A;  1SV5 A;  1F21 A;  1REV A;  5MLC Q;  1NJZ A;  4JV5 K;  1CZA N;  4BC2 A;  3EEQ A;  2D1K A;  1HNV A;  3O3H A;  5KPT A;  3BY5 A;  2RKI A;  3H3N O;  3UB5 A;  4NLC A;  4L8R B;  4B8A B;  3RVC A;  3ENB A;  4YNQ A;  4FLZ A;  3W3D A;  1XHZ A;  4N76 A;  2FLO A;  4DV7 K;  4DTS A;  1S6P A;  4C8K A;  5FRN A;  3K9K A;  2FBX A;  1V4T A;  3TAP A;  4DFJ A;  2QTD A;  4CHQ A;  3LPT A;  4DTJ A;  1EWQ A;  3NH0 A;  3A5M C;  3MN6 A;  1LV5 A;  3WEE B;  3E66 A;  4B9T A;  2YHY A;  3C6U A;  4IOA L;  3HTV A;  2O4I A;  5HRP A;  3PSF A;  4E19 A;  2DPN A;  1HJO A;  3IFR A;  2DFF A;  4DG1 A;  5LMN K;  3HSC A;  1EP4 A;  3ATU A;  4Z4H A;  1VSH A;  1A5W A;  1TV6 A;  4CFA A;  1FJG K;  3PV8 A;  1S6Q A;  4OPA A;  3VF4 A;  4FO0 A;  5C15 A;  5ADX H;  4BC5 A;  4DV0 K;  1UOC A;  1KAX A;  4FYD A;  1TUU A;  3HPG A;  4C8N A;  1WSF A;  3P4I A;  2QXL A;  4DFM A;  4I9Q A;  4Z4G A;  3SV4 A;  4ILG B;  5DK5 A;  5AQH A;  3SUO A;  4HTU A;  1N8R O;  3H46 O;  1IKW A;  2HBM A;  2WOM A;  5BR9 A;  4CEC A;  1Q9X A;  3EKS A;  4O0J A;  4FLY A;  3RMC A;  3S3N A;  1Y64 A;  4PA1 A;  2D0O A;  1IO2 A;  3HZ6 A;  2W40 A;  4CGD A;  3OYA A;  4FVU A;  1HQU A;  1KVB A;  3TAF A;  3U3Y A;  2UUB K;  1NOY A;  3P38 A;  4CZL A;  1U45 A;  3PY8 A;  4KPY A;  1RBV A;  2R7Y A;  2F8T A;  1IJJ A;  4FOI A;  4KKO A;  5AZI B;  3AO3 A;  4X66 K;  3J7A P;  2FBT A;  2Q0U A;  1VQO N;  1VSI A;  1TKD A;  4H5V A;  4B1V A;  5KGW A;  1UAX A;  1U47 A;  1LOT B;  4EZ6 A;  4YOT A;  5C12 A;  3TPQ A;  4WQ4 C;  3LP1 A;  3TAE A;  5AQP A;  3H6E A;  4NCG A;  4KTQ A;  4FJM A;  2QWL A;  2Z1G A;  3A0I X;  3SCX A;  3OYN A;  3ZSZ A;  3JAM O;  4DLG A;  1BHL A;  3ID6 A;  1N32 K;  3BZK A;  4YY3 K;  2XO7 A;  1V4S A;  1YHQ N;  3VQB A;  4W5O A;  1T05 A;  3O8M A;  4B1U B;  2YHB A;  4WYB A;  4JHD B;  1CXQ A;  5IT9 O;  2WON A;  3ZT2 A;  4YOR A;  1X3N A;  5FPE A;  4B1Y B;  2IIR A;  3CC2 N;  1WSH A;  4H5T A;  2O8F B;  4KO0 A;  1G15 A;  1D9F A;  1XNQ K;  1QHT A;  4H8K A;  5C0Y A;  4M45 A;  3D2F B;  4HCC A;  4B3O A;  3H1Q A;  1ZYQ A;  1YT3 A;  4QS7 A;  3VEX A;  3KLF A;  1C6V A;  1RTD A;  5J2M A;  3PO5 A;  3LP0 A;  3AGK A;  4JD2 B;  2UXB K;  1RGI A;  2YI1 A;  4G1Q A;  4I9L A;  3KWI A;  4CEZ A;  3H45 C;  5AQI A;  3TAB A;  5HRO A;  2P9I B;  1RT1 A;  1MWK A;  1NJX A;  3ZSW A;  1SZ2 A;  2E2O A;  2EHG A;  4LSL A;  2FF3 B;  5AQT A;  5CE3 A;  3OYF A;  1QVF M;  4PL7 A;  3THY B;  3QER A;  3TAQ A;  1CLQ A;  2QEX N;  4BRG A;  4WCE L;  1YJN N;  4DSL A;  5AQZ A;  4LF8 K;  4IDH A;  4MO4 A;  1NGD A;  2Q3S A;  3HO1 A;  4ISF A;  2E6M A;  4B1X B;  4DTX A;  3TSQ A;  5BRF A;  2P9U A;  4BRM A;  3IAY A;  1NOZ A;  1VSE A;  4CHY A;  1S22 A;  3ENO A;  4AHS A;  4FPB A;  3VTI A;  4XH5 A;  5F2R A;  4FXD A;  2PFU A;  3S9H A;  4B3M K;  2CH5 A;  3R9P A;  3LAN A;  3VQE A;  4PKI A;  1IG8 A;  3WNF A;  3LAM A;  2ASM A;  4B9L A;  1RTJ A;  1XMQ K;  1BI4 B;  1KAY A;  3AO2 A;  3G4S N;  4DS5 A;  1D5A A;  1VQP N;  3PLA A;  2G8I A;  3DAW A;  3AVK A;  3EO3 A;  3HJF A;  4ICL A;  4BR4 A;  4H0X B;  5AQM A;  1NK5 A;  1NBW A;  3A5O C;  4OPH A;  3VET A;  3LWM A;  1ZBU A;  3AVC A;  4BRP A;  2E6L A;  5J1E A;  5GIO A;  1X3M A;  4OGE A;  2QM1 A;  3OYB A;  3OYK A;  3ZYY X;  2BTF A;  4QCL A;  3NGZ A;  3THW B;  2WTU A;  4DTR A;  1L3S A;  1WUA A;  3SMS A;  3F5T A;  3UKU B;  4GVE A;  5AZJ B;  3CJ9 A;  2YNF A;  5GAH P;  3HM8 A;  1NK8 A;  4LF9 K;  1TUY A;  3LDO A;  3WEE A;  3MXJ A;  3GE1 A;  4JAX A;  3B8A X;  1HNW K;  1I3A A;  1IKY A;  1O1W A;  4JKG B;  5IWA K;  4DFP A;  3FZL A;  5JS2 A;  4C8L A;  4AHU A;  1S9G A;  2P9P B;  1A5X A;  5J2N A;  3M1F A;  3O4W A;  1A5V A;  2J4R A;  1KLN A;  4A2A A;  3PIP L;  3TI0 A;  3KKR A;  2P9K B;  3EL2 A;  2UUC K;  3JS6 A;  3SBG A;  3U4L A;  2HNZ A;  4BWM A;  2O4G A;  4YOW A;  1WAF A;  3RR8 A;  4E1M A;  3TAN A;  3MEG A;  3EE9 A;  4M3Z A;  4FVM A;  1ZBF A;  3LL3 A;  2NRX A;  4H0O A;  3MX5 A;  3V1R A;  1SL0 A;  3B6O A;  2YNH A;  4FLT A;  4DF4 A;  2O8B B;  2VG6 A;  2UYT A;  3DRS A;  4F3T A;  2O8C A;  1D4X A;  3HM9 A;  4CGI A;  1HYS A;  2ZJP L;  3MN9 A;  4KFB A;  3LP2 A;  4W5T A;  2QK9 A;  3V9Z A;  3CCL N;  3HBT A;  4CK1 A;  4K41 A;  1TYQ A;  2KZZ A;  1U2V A;  5AQU A;  2ZGY A;  4RCH A;  2E88 A;  2DY4 A;  4IEE A;  1BCM A;  1EWR A;  3DWL A;  4ELT A;  4FPA A;  3WUH A;  4JI4 K;  3AVG A;  1HYV A;  3TR8 A;  4BDP A;  4W5Q A;  4FK2 A;  3CPE A;  2Q36 A;  1RDW X;  4HUF A;  1WN7 A;  4OLA A;  1ZXO A;  4QS9 A;  1NKB A;  5BRD A;  3OBW A;  1E4G T;  4BGB A;  4CEQ A;  3HST B;  2VQE K;  4K8Z A;  5GAG P;  5AQV A;  3S3O A;  4V19 S;  3VEV A;  1K8K B;  4KRF A;  3T19 A;  3IKM A;  4KI4 A;  3SI6 A;  4EP5 A;  2AP1 A;  4DB3 A;  2FBY A;  2PBD A;  3LZJ A;  5AQX A;  3OYJ A;  3RMB A;  3ZLJ A;  5JLH A;  4XIU A;  2BGG A;  1ATN A;  5ADX A;  4KHP K;  3KK7 A;  2G8K A;  4JEP A;  1BL3 A;  3OYC A;  1N36 K;  5LMU K;  1RNH A;  4FWL A;  3DXM B;  4YDU C;  3NHG A;  5I3U A;  3OS2 A;  3SK3 A;  3MN7 A;  3SV3 A;  4YDU A;  5LY3 A;  4JS4 A;  4KV8 A;  3L0Q A;  5HOO A;  4ISG A;  4KRE A;  1DT9 A;  1VSK A;  4I6M B;  3ZEU B;  4BRH A;  3QET A;  4N5S A;  1ATS A;  1JLE A;  1QQN A;  4CJ5 A;  3D0P A;  1QSY A;  3MX2 A;  4DTM A;  5CZ2 A;  1YVN A;  2P9N B;  4O5B A;  3RMA A;  2P9L B;  4CF0 A;  2BE2 A;  4KHN A;  4H0Y B;  4BRC A;  1I94 K;  4FLX A;  3VQC A;  3AVH A;  3QIC A;  3OTO K;  2KHO A;  2ZGZ A;  1ILY A;  1CZB A;  4M3R A;  5JLF A;  3I33 A;  4AH9 A;  1YVU A;  3U3G A;  1T3V A;  2Z1J A;  4WQ5 C;  3JSM A;  2BH1 A;  1SKR A;  1TL1 A;  3D2F A;  1NK7 A;  1NK9 A;  3J7Y P;  4JKB A;  2KFZ A;  1U6Z A;  4YFU A;  1JJ2 M;  5JS1 A;  2GUP A;  4FWN A;  4OKK A;  4K25 A;  1IG9 A;  3C6T A;  4W5N A;  2WUS A;  3F9M A;  5C10 A;  5C2D A;  1WSI A;  2P9I A;  5JMV A;  2IDO A;  4CGJ A;  1JLC A;  1FKP A;  1D8Y A;  2GWK A;  4LSN A;  1NGE A;  2QA4 N;  3HPO A;  4Z0U A;  1ASU A;  3THY A;  1GLE G;  1WOQ A;  4IBN A;  3SPY A;  3HXM A;  5AQN A;  1Z26 A;  4Q5V A;  3RWU A;  5BRE A;  3CFP A;  2Q97 A;  1EET A;  4QAG A;  4BRF A;  1K73 O;  4CIG A;  5GIP A;  2LSN A;  1E3M A;  3TSP A;  3PSI A;  4B3S K;  2OTJ N;  3TTF A;  3MXM A;  2E1Y A;  1L3T A;  3LWL A;  1NU0 A;  1JLQ A;  3BDP A;  3K5N A;  3CER A;  3QDK A;  2W6K A;  4KB1 A;  4RW4 A;  4CZE A;  4E7L A;  1VRU A;  2JWL A;  1GOA A;  3NMU A;  4ZTJ A;  4FK4 A;  5AFU A;  4HHT A;  4WFN L;  2QKB A;  4UY8 O;  2DFH A;  1LAV A;  4Z4I A;  2YHA A;  3O08 A;  4H0T B;  4PWD A;  3HOS A;  1XMO K;  4DQ8 A;  1T03 A;  1SS6 A;  4B9S A;  3TTC A;  4CJV A;  4B9N A;  3T1A A;  1NGJ A;  4CCH A;  1LW0 A;  3S41 A;  3KK3 A;  4RW8 A;  3P1G A;  3AA5 X;  1JXB A;  4GV6 A;  2KLA A;  2OZS A;  2FSK A;  4RW9 A;  4BRQ A;  1NJI O;  1NLV A;  1C0G A;  1HNI A;  1KC8 O;  4KB0 A;  2Y1I A;  1X9M A;  1CXU A;  4H5R A;  4OPJ A;  2W41 A;  2JGU A;  3MCP A;  2PZS A;  4FLU A;  4CK3 A;  1LWF A;  4M3W A;  1X9W A;  4BRL A;  2X78 A;  4A62 A;  1QHA A;  4DSE A;  2NRT A;  3P39 A;  3J8A A;  4UQG A;  3THV A;  5M1K A;  4JKG A;  5EVZ A;  1T8E A;  3WQT A;  3L6Q A;  4BQZ A;  1HLU A;  4BRE A;  3OS1 A;  3O5B A;  5LJV A;  4KH5 A;  3CET A;  3VMF B;  1ZBH A;  2P9K A;  3CME N;  4J2A A;  4H0P A;  1RFQ A;  1ITG A;  1K6Y A;  3CD6 N;  3VGM A;  3ZT4 A;  3TAG A;  3CG7 A;  4HUE A;  4LH5 A;  1VHX A;  3FGU A;  1BIU A;  3FZH A;  5KQ8 A;  4CF9 A;  2CGJ A;  2E5L K;  3SNN A;  3RTV A;  4CBW A;  1BWF O;  1HX1 A;  1DTT A;  2O8B A;  3CCU N;  4IDK A;  1TAQ A;  1NGB A;  1WBB A;  1BCO A;  3KTQ A;  2Y1J A;  1SKS A;  3BF1 A;  3VA0 A;  2WC9 A;  1ASW A;  4OJR A;  1EO1 A;  4DUZ K;  4JKE A;  4LFC K;  2B6A A;  4DV6 K;  1J5E K;  4I7F A;  1XNR K;  4PKG A;  1T6C A;  3SQ2 A;  3LP3 A;  3AVJ A;  4RTF D;  3OYI A;  4JI5 K;  2OYQ A;  2OPR A;  2IGI A;  5KQD A;  3T7Z A;  3ZT1 A;  3K5M A;  3VPZ A;  1Q82 O;  3CPW M;  4WF9 L;  1W2B M;  3M8P A;  3L2R A;  3L2V A;  1VAZ A;  4FJ7 A;  2NRV A;  1DLO A;  2IVN A;  1RDD A;  2OPQ A;  4OVL A;  1VQK N;  3DLH A;  1GLF O;  1WLJ A;  3NH1 A;  4B08 A;  4OO1 J;  1YJW N;  4DV3 K;  3J80 O;  3VEO A;  2VWJ A;  2G8V A;  3B6P A;  4BG8 A;  4JK7 A;  2Q31 A;  3VQ8 A;  2HF3 A;  1BA0 A;  3VQD A;  3RSE B;  3ZT0 A;  1IH7 A;  2A1R A;  4E1J A;  2ZJR L;  1G99 A;  1BIS A;  3TWH A;  1KFD A;  4FM0 A;  4F4K A;  4CJ4 A;  4DTN A;  3F9K A;  4ILH A;  3ISN C;  4LF7 K;  4CGH A;  3TU5 A;  4JNE A;  4CIE A;  2E4L A;  3L4Q A;  3K59 A;  3DJC A;  3DXM A;  4DS4 A;  3QO9 A;  4F8R A;  4PKH A;  4H0V B;  1JXE A;  3OBY A;  1D9D A;  4DR7 K;  4CJP A;  3I8B A;  2A5X A;  4I6M A;  3ZEU A;  3SAG A;  4LC9 B;  3KVG A;  1TK8 A;  4U67 L;  4ID5 A;  3VQ7 A;  1GLL O;  1W9H A;  1N33 K;  2V7Z A;  5CZ1 A;  3ASM A;  4N47 A;  3E9O A;  1LAW A;  1RTI A;  4N56 A;  4CF8 A;  4FJX A;  4WQ4 A;  1KXP A;  4CJF A;  3K0S A;  1BA1 A;  4FJN A;  3ALY A;  4NB4 A;  3VF2 A;  3KK2 A;  1RDA A;  4BDY A;  2HF4 A;  3NF7 A;  2A6A A;  2P9S A;  4AHC A;  1GLD G;  4CFC A;  4IFV A;  4FM2 A;  4IOX A;  1LCU A;  1KAZ A;  1C0M A;  3G6E N;  1C0T A;  4FJ5 A;  1NGF A;  5AFU H;  5C42 A;  3J81 O;  3M3Z A;  1K8A O;  1UWB A;  1YAG A;  3SJJ A;  2YNG A;  3QML A;  1GOB A;  4BQL A;  2ITM A;  2G8U A;  3QEP A;  4NYN A;  4OLB A;  4U7B A;  1HQE A;  4YOV A;  5EXW A;  4JK9 A;  2GX9 A;  1IBM K;  2F7T A;  2GUI A;  3LDQ A;  2ZQB A;  4YOX A;  3GL1 A;  2X6N A;  1S1T A;  2VG5 A;  4K43 A;  5BPN A;  3SAH A;  1IBL K;  3OS0 A;  4O0I A;  4PQU A;  3HPH A;  1BIZ A;  3E01 A;  4A2B A;  4CZI A;  3AVA A;  5AQJ A;  2YJE A;  4DFK A;  1T44 A;  4CED A;  4CF2 A;  3KLG A;  1WAJ A;  4DWI A;  4AF1 A;  4JRP A;  2ETJ A;  1YTA A;  1SKW A;  1TK5 A;  3OA9 A;  3NAE A;  4BR5 A;  3CIP A;  1U4B A;  5KTQ A;  4BWJ A;  1MWM A;  5C2F A;  1R59 O;  2A40 A;  4IJN A;  3AO1 A;  2GV9 A;  4CE9 A;  4CD3 A;  5C25 A;  5BPL A;  5JVH L;  3KWG A;  1GOC A;  4FWO A;  1QQC A;  4IWV A;  3JXU A;  3CCV N;  1DTQ A;  3MMV A;  4CEF A;  5M1O A;  3V9S A;  1HPM A;  4JKH A;  1Q7Y O;  1OH6 A;  3O4Q A;  2GTD A;  3V9W A;  3SLC A;  2F4V K;  3AAQ A;  3H3O B;  4CES A;  3HK2 A;  2QKK A;  3ZSQ A; 
#chains in the Genus database with same CATH homology
 4FPA A;  4MLE A;  4AM6 A;  3SMP A;  3WUH A;  4KH6 A;  4FWR A;  3VEW A;  4R79 A;  2GEM A;  5H1S Q;  3CCM N;  3CPE A;  4JKD A;  3M5R A;  5JIC A;  3UKR B;  2Q36 A;  2QWP A;  4J8F A;  1RDW X;  4BY9 C;  1NGH A;  3AAR A;  3CC4 N;  3VGL A;  3SBT A;  1ZXO A;  4QS9 A;  5BRD A;  3OBW A;  1JCF A;  5F1X A;  3GDQ A;  1E4G T;  3QFU A;  4NLB A;  1VQN N;  1MA9 B;  3FLC O;  4BGB A;  4EHU A;  2VWB A;  2FSN A;  1TYQ B;  3F2K A;  1U2V B;  2YCH A;  4F9O A;  2WBN A;  2E2N A;  4JKF A;  2VYP A;  2A42 A;  2EWS A;  5AQV A;  5GAG P;  3VEV A;  1K8K B;  3CI5 A;  1YF5 L;  3CQY A;  1X9J A;  1YUW A;  3EN9 A;  3IKM A;  5M1Q A;  2AP1 A;  3CJ7 A;  5AQQ A;  4DB3 A;  2ZJQ L;  1YI2 N;  1VQ8 N;  3ZET B;  2PBD A;  2P9N A;  5AQX A;  3G25 A;  3FZK A;  2P9U B;  5JLH A;  4RWT A;  1ATN A;  2Q2R A;  1XUP O;  4H5N A;  2P9L A;  3FE1 A;  4FWS A;  3LM2 A;  3KK7 A;  4JK8 A;  4EIA A;  5ADX A;  4JEP A;  4G9Z A;  5CHI A;  3UE5 A;  1NMD A;  4C1N I;  4FWL A;  3DXM B;  4YDU C;  3DLL L;  2JWK A;  3SK3 A;  3MN7 A;  2OAN A;  3GG4 A;  1EQY A;  4YDU A;  5LY3 A;  5AQL A;  4CI6 A;  3L0Q A;  5HOO A;  5TKY A;  5AQG A;  1ZBS A;  4ISG A;  1DT9 A;  3O80 A;  4I6M B;  3ZEU B;  4BRH A;  3HI0 A;  5F0X A;  1ATS A;  4JKA A;  4JN4 A;  1QQN A;  2V52 B;  3GOI A;  3MX2 A;  1SAZ A;  1YVN A;  3W0L A;  2P9N B;  5GAE P;  1NGG A;  4BRK A;  5LJW A;  2P9L B;  1YXQ A;  2E8A A;  5E84 A;  3O1W A;  3IMX A;  4H0Y B;  5M1P A;  3QFP A;  4BRC A;  3CCQ N;  4BR2 A;  3LDN A;  2CGK A;  5MLC Q;  2F9T A;  1CZA N;  4IFE A;  4BC2 A;  3QB0 A;  2D1K A;  3QIC A;  3C6A A;  4B1Z A;  5KPT A;  3H3N O;  2KHO A;  3UB5 A;  2ZGZ A;  1ILY A;  4NLC A;  1BG3 A;  5JLF A;  3I33 A;  2E2Q A;  1T3V A;  4WQ5 C;  3T69 A;  3ZX2 A;  2BH1 A;  3ENB A;  4IO8 A;  3RVC A;  3W3D A;  2FLO A;  1MDU B;  3D2F A;  4JKB A;  3NVM A;  3O6W A;  3BEX A;  3A5N C;  1U6Z A;  3K9K A;  1V4T A;  3VEZ A;  1JJ2 M;  2QTD A;  3ULE A;  4GNI A;  2GUP A;  3A5M C;  3MN6 A;  4FWN A;  5EY4 A;  5EX5 A;  3I55 N;  2CGL A;  4IOC L;  3OW2 M;  3WEE B;  4K25 A;  4BRA A;  3E66 A;  1S72 N;  2YHY A;  1RDU A;  5BN9 A;  3CJA A;  2WUS A;  3F9M A;  3HTV A;  4IOA L;  5CR4 A;  4BRD A;  5C10 A;  1NGA A;  3C6H A;  1YIJ N;  2DPN A;  1HJO A;  3E9P A;  3O9R A;  5C2D A;  2P9I A;  3IFR A;  5JMV A;  2HST A;  3HSC A;  3ATU A;  3WT0 A;  2GWK A;  1QQM A;  2NRW A;  1NGE A;  4FOE A;  4MDA A;  1DKG D;  2QA4 N;  1VQ5 N;  4OPA A;  4K42 A;  5DM7 L;  1GLE G;  3D2E B;  4FO0 A;  3VF4 A;  4MO5 A;  3LDP A;  1WOQ A;  5C15 A;  5ADX H;  4FSV A;  4BC5 A;  1P8Z A;  4CBX A;  1BOT O;  4FWM A;  1BU6 O;  1KAX A;  5AQN A;  4YOY A;  5BRE A;  1Q86 O;  1TUU A;  2Q97 A;  1NGC A;  4CZM A;  3P4I A;  4BRF A;  2QXL A;  4IJA A;  5FPM A;  1K73 O;  5GIP A;  5GIN A;  3Q7B A;  3TSP A;  3O9S A;  4ILG B;  4YOU A;  2OTJ N;  3TTF A;  2F9W A;  3H1V X;  2E1Y A;  3VF6 A;  3R8E A;  3AY9 A;  4M63 C;  5AQH A;  3D6R A;  3CER A;  1T6D A;  3QDK A;  2H3G X;  2QWR A;  4CZE A;  1N8R O;  2JWL A;  3NMU A;  2HOE A;  3H46 O;  4O5F A;  5AFU A;  1QZ6 A;  2HBM A;  5AZI A;  1JCG A;  5BR9 A;  4BVO A;  5ELZ A;  4WFN L;  4ILJ A;  2IVO A;  4WFB L;  3EKS A;  4GY2 B;  4UY8 O;  5FPD A;  3O08 A;  3OHR A;  1Y64 A;  4H0T B;  5AQK A;  2GWJ A;  3HOS A;  2D0O A;  4DQ8 A;  3HZ6 A;  2W40 A;  3HRG A;  1QZ5 A;  1SS6 A;  3C65 A;  4MLH A;  3TTC A;  4C1N K;  4FVU A;  1NWK A;  2NRH A;  4M7X A;  1XC3 A;  3PIO L;  1NGJ A;  4NO7 A;  1DGK N;  3S41 A;  3Q7C A;  3P38 A;  5AR0 A;  3VEY A;  4CZL A;  3C7N B;  3HOT A;  4EFH A;  5AQY A;  3O9Q A;  4CZK A;  1M90 O;  1BDG A;  5M1F A;  4GV6 A;  3U8X A;  1IJJ A;  3KZB A;  4FOI A;  2KLA A;  5AQF A;  4EHT A;  4A5B A;  4JKC A;  5AZI B;  3VER A;  2FSK A;  4BRQ A;  4CZH A;  1QQO A;  4HTL A;  1GLJ O;  4GV9 A;  2Q1N A;  3ZX0 A;  1NJI O;  3N4P A;  2QI2 A;  3MK6 A;  3R1X A;  3J7Z O;  2Q0U A;  1VQO N;  1NLV A;  1C0G A;  2VGM A;  3FFK B;  4H5V A;  2PAV A;  4B1V A;  1KC8 O;  4GV3 A;  2OTL N;  1LOT B;  4PHT X;  2V51 B;  4H5R A;  3TTD A;  4A61 A;  2W41 A;  3MCP A;  4YOT A;  5C12 A;  3TPQ A;  4WQ4 C;  3L4I A;  4BRL A;  5AQP A;  3H6E A;  4A62 A;  1QHA A;  4IZ9 A;  2QWL A;  3A0I X;  2NRT A;  3P39 A;  3J8A A;  4JHD A;  1C0F A;  4JKG A;  2QWM A;  5M1K A;  3VES A;  5EVZ A;  4FWQ A;  4H03 B;  3WQT A;  3L6Q A;  4BRI A;  3CMA N;  4BQZ A;  1HLU A;  4BRE A;  3MWP A;  3O5B A;  4DHY A;  5LJV A;  5HL7 L;  3ID6 A;  3WXJ A;  4KH5 A;  2WFB A;  4CBU A;  1V4S A;  3CET A;  3VMF B;  1YHQ N;  3CHW A;  1K9M O;  4AM7 A;  3K9J A;  2P9K A;  4BVP A;  3SAF A;  3CME N;  4H0P A;  3BUZ B;  1VQM N;  2YJF A;  1RFQ A;  3CD6 N;  1J6Z A;  4WQ5 A;  3VGM A;  2GEL A;  2ZF5 O;  3MDQ A;  2CH6 A;  4FL9 A;  3ID8 A;  3O8M A;  3FGU A;  2YX6 A;  3FZH A;  5KQ8 A;  2CGJ A;  3CJ1 A;  4B1U B;  4JD2 A;  4WYB A;  3QBW A;  4JHD B;  1NM1 A;  2NRR A;  3DXK A;  3I56 N;  1YIT N;  4CBW A;  1BWF O;  1HX1 A;  1GLA G;  1GLB G;  4KBO A;  3CCU N;  4MDB A;  1E4F T;  4A57 A;  1NGB A;  2AA4 A;  4YOR A;  1X3N A;  1VQ7 N;  5FPE A;  4XH1 A;  1S3X A;  2IIR A;  4B1Y B;  5JVG L;  3BF1 A;  2WC9 A;  4CZJ A;  3CC2 N;  4H5T A;  3A8Y A;  1JCE A;  1SQK A;  1EO1 A;  4JKE A;  4BR0 A;  1BO5 O;  1GLC G;  5C0Y A;  3EKU A;  4PKG A;  3U9D A;  4KH4 A;  1T6C A;  3D2F B;  4RTF D;  3BF3 A;  3GBT A;  4O8U A;  3H1Q A;  5AQR A;  4CZG A;  3IDH A;  3VEN A;  4BR7 A;  3ULE B;  4QS7 A;  3VEX A;  4IO9 L;  5KQD A;  2NRZ A;  3MCA B;  4CJ7 A;  3T7Z A;  3EZW A;  3VPZ A;  3WXK A;  3AGK A;  3G71 N;  1Q82 O;  4JD2 B;  1RGI A;  3CPW M;  3RSE A;  2YI1 A;  5DM6 L;  3CCE N;  2QWN A;  3KWI A;  3WQU A;  3NVK A;  2E2P A;  5AQW A;  4WF9 L;  3H45 C;  5E26 A;  5AQI A;  5AQS A;  4BG9 A;  1HUX A;  1W2B M;  1P90 A;  2P9I B;  3UKR A;  1MWK A;  4HWI A;  5BRH A;  1VAZ A;  3CF5 L;  3CJB A;  1SZ2 A;  1H1V A;  2NRV A;  2FSJ A;  4O8K A;  2E2O A;  2IVN A;  1Z05 A;  3WXM B;  1VQK N;  1GLF O;  2FF3 B;  5AQT A;  5CE3 A;  3QBX A;  4OO1 J;  1QVF M;  4PL7 A;  3R6M A;  1OKJ A;  3MN5 A;  2QW9 A;  2IVP A;  3ZX3 A;  1YJW N;  1VQ9 N;  2QEX N;  4BRG A;  4WCE L;  1YJN N;  3VEO A;  4QS8 A;  5AQZ A;  4BG8 A;  3N4Q A;  1BUP A;  3R3L A;  4JK7 A;  2Q31 A;  2HF3 A;  1BA0 A;  4IDH A;  4MO4 A;  5BPM A;  1ZC6 A;  2ASO A;  1NGD A;  4A59 A;  4A5A A;  4BC3 A;  3RSE B;  4ISF A;  3ZET A;  4B1X B;  5BN8 A;  4E1J A;  3O1B A;  3TSQ A;  2ZJR L;  5BRF A;  1G99 A;  2P9U A;  4BRM A;  2NZT A;  4DCH A;  2HBL A;  4ILH A;  2BUP A;  4JNE A;  3TU5 A;  4M7Y A;  3L4Q A;  3DJC A;  3DXM A;  1M1K O;  3U9Z A;  1KD1 O;  3LM9 A;  1S22 A;  2D4W A;  5I9E B;  3ENO A;  4PKH A;  4FPB A;  3VTI A;  2A3Z A;  4H0V B;  3OBY A;  4XH5 A;  5F2R A;  3I8B A;  3CCJ N;  2A5X A;  2E1Z A;  2PFU A;  2CH5 A;  4L3Q A;  4XEI A;  5FPN A;  4I6M A;  1VQL N;  3ZEU A;  3EE8 A;  3R9P A;  3SAG A;  1ESV A;  4LC9 B;  4PKI A;  3KVG A;  1OVY A;  4BR9 A;  4U67 L;  1IG8 A;  4WFA L;  1GLL O;  1QVG M;  4ISE A;  1VQ4 N;  2V7Z A;  2ASM A;  3UKU A;  5AZJ A;  3SJH A;  3TSU A;  3E9O A;  3CC7 N;  2ZWH A;  3WXL A;  4IXC A;  1KAY A;  1VQP N;  3D7E O;  2QWO A;  3G4S N;  3PLA A;  4WQ4 A;  3DAW A;  1KXP A;  3WXI A;  5TKW A;  3EO3 A;  2FF6 A;  3E9L A;  4BR4 A;  4H0X B;  5AQM A;  1BA1 A;  1NBW A;  3A5O C;  4DKW A;  1Q18 A;  4NB4 A;  4OPH A;  3VF2 A;  1XQS C;  5EOY A;  3ATV A;  3VET A;  1Z6R A;  2P9P A;  2HF4 A;  3C0B A;  4PL8 A;  4XH4 A;  4BRP A;  3O9U A;  3M6G A;  4BC4 A;  1ATR A;  1O13 A;  2A6A A;  5GIO A;  1X3M A;  2P9S A;  2QM1 A;  1GLD G;  3ZYY X;  2BTF A;  2I7P A;  4H5W A;  4IOX A;  1LCU A;  2YHW A;  1WUA A;  3CXC M;  1KAZ A;  3SMS A;  3F5T A;  3UKU B;  4GVE A;  5AZJ B;  3P31 A;  2VGN A;  3CJ9 A;  3DWL A;  5GAH P;  3HM8 A;  3G6E N;  5GAD P;  1TUY A;  3LDO A;  3WEE A;  1NGF A;  2QWQ A;  4IEI A;  5AFU H;  3GE1 A;  4JAX A;  3M3Z A;  3A5L C;  1K8A O;  3FZM A;  1DEJ A;  2KKZ A;  3B8A X;  1YAG A;  3QML A;  3FR0 A;  4BQL A;  2ITM A;  3FZF A;  4JKG B;  5B8H A;  4Y0W A;  1HKG A;  1NGI A;  5KPZ A;  2VCP A;  3FZL A;  4B9Q A;  1HKB A;  2D0P A;  3VOV A;  4U7B A;  2P9P B;  4YOV A;  5EXW A;  3IUC A;  4B1W B;  2GX9 A;  2NNW A;  4JK9 A;  2F7T A;  3AGR A;  3M1F A;  3LDQ A;  3CCR N;  3D2E A;  2J4R A;  3O4W A;  2P9S B;  4YOX A;  3GL1 A;  4BRO A;  1HKC A;  4A2A A;  4K43 A;  5BPN A;  2RE2 A;  3PIP L;  3SAH A;  2P9K B;  3KHY A;  3EL2 A;  5KPR A;  3ENH A;  2HMP A;  4A2B A;  3JS6 A;  2Q0R A;  3SBG A;  4CZI A;  2NLX A;  5AQJ A;  3U4L A;  2YJE A;  2HBK A;  3AAP A;  2FXU A;  4FWK A;  4YOW A;  1YJ9 N;  1T44 A;  3O9T A;  2RHK A;  3LDL A;  3VGK A;  3EE9 A;  3CQX A;  4CZF A;  1Q81 O;  3LL3 A;  2A41 A;  2NRX A;  4H0O A;  3DXK B;  3MX5 A;  4C23 A;  4AF1 A;  5AQO A;  3OA9 A;  5M1N A;  4BR5 A;  3BP8 A;  3VTH A;  4EAH D;  2UYT A;  3CIP A;  3CCS N;  4BRN A;  1MWM A;  5C2F A;  1D4X A;  1R59 O;  2A40 A;  4IJN A;  4CD1 A;  2ZJP L;  3MN9 A;  4FWP A;  2ASP A;  3CJC A;  4CD3 A;  1KQS M;  1VQ6 N;  5BPL A;  5JVH L;  3KWG A;  4FWO A;  4IWV A;  3CCL N;  2YHX A;  3HBT A;  3JXU A;  3E1Y A;  3CCV N;  4K41 A;  2I7N A;  1TYQ A;  1W97 L;  3MMV A;  1U2V A;  5M1O A;  1HPM A;  4JKH A;  5AQU A;  2V7Y A;  2ZGY A;  1Q7Y O;  4Z94 A;  2GTD A;  4RCH A;  2E88 A;  3SLC A;  3MWT A;  3AAQ A;  3C7N A;  4IEE A;  3H3O B;  1K8K A;  2HBJ A;  2E20 A;  4BGA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...