3AARA

Crystal structure of lp1ntpdase from legionella pneumophila in complex with amppnp
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
352
structure length
352
Chain Sequence
HSCIAVIDAGSTGSRLHIYSYDTDDTNTPIHIEEIWNKKIKPGFASIQPNSVTIDAYLTMLLADAPIHNIPVYFYATAGMRLLPQSQQKKYYDELEYWFRQQSQWQLVEAKTITGNDEALFDWLAVNYKLDTLKSVQNKSVGVMDMGGASVQIVFPMPKNAEISKHNQVELNIYGQNINLYVHSFLGLGQTEMSHQFLNSPSCFANDYPLPDGESGQGNAPSCKEEVTSLMNSVHKVNQQIQPLLALNPVNEWYSIGGISNLASSQLFHFENSELTNQSLLQQGDNQICHQQWDILNGQYPDDEYLYQYCLLSSYYYALMVDGYGINPNQTIHYIPPEQNLDWTIGVVLHRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a Legionella pneumophila Ecto -Triphosphate Diphosphohydrolase, A Structural and Functional Homolog of the Eukaryotic NTPDases
pubmed doi rcsb
source organism Legionella pneumophila
molecule tags Hydrolase
molecule keywords Ectonucleoside triphosphate diphosphohydrolase I
total genus 111
structure length 352
sequence length 352
ec nomenclature
pdb deposition date 2009-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01150 GDA1_CD39 GDA1/CD39 (nucleoside phosphatase) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3aarA01
3.30.420.150 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Exopolyphosphatase. Domain 2 3aarA02
3ENHA 1NGEA 4BVOA 4J8FA 4CBUA 1GLLO 3WEEA 2VCPA 3VGLA 1HLUA 4CZEA 4CZIA 3DAWA 3D2FA 3QMLA 2CGJA 2V7ZA 2KHOA 3UKRA 3ULEA 4WYBA 3VEZA 4H0TB 1BU6O 4BG8A 2J4RA 2QM1A 4ISEA 5BR9A 3TU5A 3VEOA 4H5WA 3M3ZA 5E26A 4BC2A 3QB0A 3HTVA 1G99A 1LCUA 1QZ5A 5EXWA 2YHWA 3VEYA 1E4FT 5KQDA 1QQMA 3IUCA 5JICA 4K42A 5F2RA 4BRKA 3RSEA 3WEEB 1NGBA 2P9SA 3A5LC 2UYTA 4FOEA 1J6ZA 1U6ZA 5I9EB 1NGAA 3QBWA 2QWPA 4H0YB 1JCEA 1Q18A 1QQOA 4CZHA 3D7EO 2FF6A 4BRHA 4JHDB 5AZIA 3VF2A 5AQTA 1KAXA 3ATVA 1DEJA 3FZFA 2D0OA 4BR9A 2NLXA 2FSJA 5BPMA 1Y64A 3ZX0A 1ZXOA 3QICA 3ZX2A 4C23A 4GNIA 1MWMA 2W40A 4KBOA 3SMSA 5AQWA 2AP1A 4BQLA 3CJBA 3P4IA 1BDGA 3R6MA 4NO7A 3UE5A 3C7NA 5AQQA 3D2EB 1TUUA 4DB3A 3HSCA 4BVPA 3DXMA 4IZ9A 3MCPA 2P9KB 3LDLA 3O8MA 4DCHA 2PAVA 1P8ZA 3O80A 1BUPA 4DQ8A 3A0IX 3VEWA 4JD2A 5BRFA 4FPBA 3ZEUB 2YCHA 4BRMA 5FPDA 1T44A 3H3OB 3U9ZA 3LDQA 4BRAA 4K43A 4IJAA 4WQ4C 1YXQA 5AQLA 4B1UB 3VEVA 4M63C 5BPNA 1CZAN 2E1ZA 4WQ5C 3CJCA 1TUYA 2YI1A 3D2EA 3VENA 1NGDA 4FWRA 2OANA 3UB5A 5KQ8A 2CH6A 3A5NC 5KPTA 4H5TA 3CJ9A 1U2VB 1YUWA 1DKGD 1XC3A 4PKIA 4O8KA 3VOVA 2V7YA 5FPNA 1RFQA 4BQZA 3MN9A 2P9UB 4Y0WA 3QFUA 3CJ7A 4QS7A 1NBWA 4RTFD 3BP8A 4FWLA 4RCHA 2IIRA 4PL7A 4IJNA 5AQYA 1V4SA 3LM9A 3VERA 1C0GA 3WQTA 1ATRA 5JLHA 1EQYA 4DHYA 1GLAG 1T6CA 1Z05A 3DXKA 2E88A 4A2AA 3CERA 3GDQA 3MK6A 3FGUA 4EHTA 3O4WA 2CH5A 2IVNA 3EN9A 1T6DA 5ADXH 5BRHA 4BGBA 1U2VA 4I6MB 5EY4A 1H1VA 4H03B 5LY3A 2QWQA 3W0LA 3ID8A 3ENOA 4H0VB 3MN6A 1R59O 1HKBA 3EO3A 4M7YA 4JHDA 3L0QA 5AQFA 5AZIB 1TYQB 1GLCG 3FZKA 3FFKB 4CBWA 4FO0A 5AQOA 1NGIA 2DPNA 3ATUA 3RSEB 4K25A 5AZJA 3H1QA 3B8AX 3W3DA 5AQUA 3WXKA 5JMVA 3BUZB 2ZGZA 4AM7A 5AQMA 1S3XA 4BC3A 1RGIA 4BR7A 3SK3A 4YDUA 3DWLA 2WUSA 4NB4A 3FLCO 2V52B 4MO4A 2D0PA 4B1WB 4QS8A 2FSNA 2Q1NA 3LM2A 4CZJA 3EKUA 5AQIA 3ULEB 1GLJO 1HPMA 2D4WA 4FSVA 4CI6A 4CJ7A 5BREA 4F9OA 3H46O 1SAZA 1KAZA 2W41A 1OKJA 4FL9A 2A40A 2YHXA 3SMPA 2QWOA 4WQ4A 5AZJB 2Q31A 3M1FA 3CJAA 3KHYA 3WT0A 2QWRA 1HX1A 1ATSA 4HWIA 2NZTA 3IFRA 4I6MA 5AQSA 3L4IA 3VF4A 4BRQA 2HF4A 3HM8A 1MA9B 5TKYA 2YJFA 4B1VA 4FOIA 3S41A 2F9WA 1KXPA 1E4GT 1SQKA 2GTDA 2HF3A 4O5FA 3ZETA 3IMXA 1BO5O 5AQHA 4A61A 1SZ2A 1YAGA 3EL2A 3D2FB 3TPQA 4BR2A 2E2OA 3GG4A 1ESVA 1HKCA 3CHWA 2FF3B 2Q0UA 3G25A 1NGGA 4B1ZA 3UKUA 1IJJA 2P9PA 4FWOA 4CZKA 5LJVA 3CJ1A 1NMDA 2P9NA 4FWKA 3F9MA 1BA1A 3VEXA 2BTFA 4K41A 2A42A 1IG8A 2IVOA 1NWKA 3U4LA 3FZMA 1KAYA 4JN4A 1ATNA 2E20A 1C0FA 2HOEA 3AAQA 2Q0RA 4MLEA 4EHUA 3M6GA 1BA0A 3FZHA 2GEMA 5EOYA 3MDQA 3QFPA 4LC9B 2GWJA 2E2PA 4MO5A 5AQKA 3WXLA 5AR0A 3R9PA 1NGCA 4GY2B 5BRDA 1LOTB 3A8YA 3VETA 2D1KA 3CI5A 3WUHA 1GLBG 5AQNA 3QDKA 4PKHA 2AA4A 5AFUA 3MN7A 2A41A 2A6AA 2BUPA 4BRNA 1TYQA 3CETA 1V4TA 2CGLA 2I7NA 1ZBSA 3O5BA 1NGJA 3WXJA 5AFUH 3H1VX 1NLVA 1XQSC 3SJHA 4BRLA 2H3GX 5EX5A 1K8KA 4IO8A 3DJCA 3GOIA 3H45C 1QQNA 4YDUC 4H0PA 4QS9A 5AQXA 4A2BA 4CZGA 4EFHA 4BC5A 3JXUA 4B1XB 2FLOA 4CD3A 3GE1A 4BRCA 4BRGA 4BRDA 4M7XA 4BGAA 2P9IB 4XH1A 3VGMA 1X3MA 2V51B 2VWBA 4BREA 4BRFA 3LL3A 1JCFA 3DXKB 4BRPA 2CGKA 4FWPA 2YHYA 3C0BA 3I8BA 5BN8A 4Z94A 4CZFA 1NM1A 1MDUB 5AQZA 5B8HA 2P9NB 4ISGA 3A5MC 4B1YB 3KZBA 2I7PA 2FXUA 4RWTA 1NGFA 4HTLA 2ASMA 3VGKA 3ZEUA 2P9LB 3ZETB 5KPZA 4BR0A 5CE3A 3LDPA 1X3NA 1JCGA 5FPMA 2E1YA 2GUPA 3AARA 2PBDA 2QXLA 3O1BA 4B9QA 3C7NB 3L6QA 4XEIA 4AM6A 2E8AA 1ZC6A 2P9IA 3AAPA 1HKGA 5AQVA 2QWNA 1BG3A 5ELZA 4IXCA 1BOTO 5JLFA 1QHAA 4H5NA 4BRIA 1GLFO 5BPLA 5F0XA 3U8XA 2E2QA 2P9KA 3BF3A 3FR0A 2A3ZA 2P9SB 4H5RA 3U9DA 1QZ6A 1HUXA 3GL1A 2GELA 1MWKA 4CBXA 3KVGA 2YJEA 3IDHA 5EVZA 3HBTA 1RDWX 4CD1A 2Q97A 1HJOA 2A5XA 3QBXA 2ZWHA 5AQGA 5F1XA 1K8KB 4L3QA 4BROA 4FWSA 3MN5A 3WQUA 5ADXA 2HMPA 3VF6A 4ISFA 2Q36A 4A62A 3CIPA 3H3NO 3VESA 5AQRA 3J8AA 4PKGA 2Q2RA 3JS6A 3UKRB 5FPEA 4EAHD 4H0XB 4EIAA 2QW9A 1NGHA 2IVPA 3FE1A 3R8EA 1DGKN 1GLDG 2NRHA 3FZLA 3O08A 3BEXA 4BG9A 2P9UA 2P9LA 4H0OA 2ZF5O 4JD2B 1YVNA 1GLEG 3CQYA 5AQPA 3SLCA 3WXIA 4FPAA 4JNEA 4BR5A 3UKUB 3HI0A 2GWKA 1D4XA 3A5OC 3I33A 5LJWA 2FSKA 1WUAA 2ASOA 1Z6RA 3BF1A 4PL8A 4MLHA 3DXMB 4WQ5A 4E1JA 4H5VA 2ZGYA 4XH4A 2F9TA 3EKSA 1WOQA 1X9JA 3CQXA 3O1WA 1BWFO 2P9PB 3OHRA 4FWMA 4FWNA 4IWVA 2E2NA 4CZMA 3LDOA 3EZWA 3GBTA 3HZ6A 4JAXA 3VPZA 4XH5A 2ASPA 3O6WA 4BR4A 4BC4A 4FWQA 3ZX3A 3H6EA 1S22A 5KPRA 2ITMA 1XUPO 4CZLA 5AQJA 2EWSA 5E84A 3LDNA 2QWMA 2VYPA 2QWLA 3MMVA 5BN9A 3AY9A
chains in the Genus database with same CATH superfamily
4BVOA 2ZJPL 4FJHA 4M3UA 4J8FA 4CBUA 1GLLO 1HLUA 3N4QA 3DYAA 3QMLA 2CGJA 4F8RA 2V7ZA 5CYQA 4MDAA 4E7JA 2KHOA 4BY9C 4WYBA 2F96A 1E3MA 2QM1A 3G71N 4KHWA 4JK8A 3TU5A 4FJLA 1HMVA 5E26A 1VSFA 2QKKA 3HTVA 1LCUA 5EXWA 2YHWA 1FKOA 5KQDA 1QQMA 4LY7A 4W5NA 5F2RA 1VK0A 3FFIA 5HOOA 4LF5K 1VRUA 4DV2K 1Q82O 3AO1A 2W42A 3I8DA 2LSNA 2UXCK 1VSHA 1NK8A 1RT7A 2DFEA 1JCEA 1QQOA 2FF6A 4JHDB 3VF2A 2GBZA 3BGRA 1KAXA 3L2RA 3ATVA 4FJIA 4BE2A 4LSLA 3SUOA 4OX9K 3QICA 1NJYA 2P51A 1KQSM 4KBOA 4IOXA 4BQLA 4H4MA 4ZTFA 4CEEA 1BDGA 3R6MA 4O8UA 4QAGA 3UE5A 1HNIA 4G9ZA 2OZSA 3ZSVA 2UXBK 3DXMA 4IZ9A 3MCPA 4CEFA 3SV4A 1NJZA 2DTUA 4DQ8A 3VEWA 3PSIA 5BRFA 1LW0A 1S9GA 4FPBA 3ZEUB 4C1NK 4KO0A 4KH6A 3SAHA 4K43A 5GIPA 4WQ4C 5LMUK 1A5WA 1HQEA 3CJCA 2VGNA 1NGDA 2O8DB 2IAJA 1DT9A 2HB5A 2PYJA 1RBUA 4W5RA 4FWRA 2OANA 4JKHA 1NOYA 3CJ9A 1S1XA 4PKIA 4W5OA 4DR3K 1WN7A 1BIZA 3MECA 4BQZA 4FJ9A 3QFUA 4YHHK 2HVIA 3BP8A 2IIRA 2IOCA 4IJNA 5C10A 5M1NA 3THYA 1QS4A 4DKWA 5LL6Z 4IOCL 4J2BA 3DXKA 2E88A 1BQMA 3KKSA 4A2AA 1KVBA 3TSQA 3MK6A 4EHTA 4CJ4A 4FLVA 3O4WA 3EN9A 2ZJRL 4DR1K 1OH8A 5BRHA 2ZJQL 4BGBA 1YF5L 1U2VA 4I6MB 1EWRA 3VA3A 3HJFA 4Q0BA 1U48A 2GX9A 1RT1A 3D6RA 5GAGP 3HVTA 4FLXA 1Q86O 1HKBA 3M8QA 4NLBA 3EO3A 4C1NI 5AZIB 4DLGA 3S3NA 4KPYA 3AA2A 3IG1A 3V1OA 5C24A 3B6PA 1BI4A 3H1QA 4JKBA 5JMVA 5AQMA 1OH7A 4X65K 3T69A 1RGIA 4RG8A 3TAGA 3DWLA 4DQPA 4NB4A 4LH5A 1LW2A 2FSNA 3QEIA 4CJ3A 2HHUA 4CZJA 5T7BA 5AQIA 3MXJA 4DMNA 5GINA 1N34K 4F9OA 4OJRA 4Q5VA 2HNDA 5GAEP 3AVJA 4BE1A 1OKJA 2R7YA 1S6QA 2YHXA 1C0TA 3A2FA 3TI0A 4RW9A 4WQ4A 3AO2A 2O8FA 2O8EA 4CEAA 3CJAA 4CW7B 3WT0A 2HBLA 4OVLA 5AQSA 1S9EA 3L4IA 5JS2A 1TGOA 4FJMA 4B1VA 3OS1A 3V1RA 1UAXA 2DFFA 2HF3A 1E4GT 2GTDA 2ZD1A 4GVMA 4JI3K 4GVEA 3CFPA 3D2FB 4KHPK 4X66K 1ZBFA 1J5OA 4YOXA 3CHWA 2Q0UA 1T03A 3ZT2A 3EEQA 3SAGA 3CM5A 1VHXA 4JV5K 1IJJA 1FW6A 1BI4B 1ITGA 1BA1A 2DY4A 5M1OA 4JKCA 4K41A 4F2RA 3BZCA 3HVRA 3HP9A 3G10A 3QEVA 1WSJA 4DV0K 4KH5A 4DSIA 4IG3A 3BY5A 1NJIO 3FZHA 3DLKA 3MDQA 1VSIA 3J7ZO 3R9PA 2E6MA 4GY2B 4H4OA 5HROA 3AA4A 3CCSN 3DOKA 4U67L 2AA4A 3AV9A 4FM1A 3CF5L 4N5SA 4JKGA 3DLGA 1V4TA 3WXJA 4DFPA 1ZBSA 3CC7N 4F2SA 1QSYA 3MXIA 3O9QA 1XQSC 3SJHA 3V6DA 3L3VA 1JLCA 4IO8A 3DJCA 4XIUA 3GOIA 3H45C 4H0PA 4A2BA 1KCFA 4BDYA 2JWKA 4IDKA 4J2DA 3U6FA 1FKPA 3K9JA 3OBYA 4B1XB 2FLOA 4LF4K 3DOLA 3GE1A 4BRGA 1S5JA 2FC0A 4GKKK 1L3TA 3VGMA 4BRFA 4MFBA 2CGKA 1Q81O 4FWPA 3S9HA 4CJRA 3OYEA 4OPKA 4CIEA 5FRNA 4Z94A 1HYZA 5B8HA 3L8BA 2NRWA 2XY8A 4KV8A 1C1BA 4JI6K 1LWFA 1L3UA 2KZZA 4HTLA 5KPZA 5HL7L 3M8RA 1RDAA 3AO3A 4BR0A 5CE3A 4CIFA 2KQ2A 3VQ9A 5FPMA 3KLEA 1T7PA 4FK0A 4XEIA 4HHTA 2P5GA 2E8AA 1HYVA 2P9IA 3AAPA 3SPYA 5EU7A 1BG3A 4DSEA 1X9WA 1GLFO 2E4LA 5F0XA 1KSPA 3SPZA 3OS2A 4CJPA 2A3ZA 2P5OA 1N36K 2P9SB 3LPUA 2KZMA 4H5RA 4GKJK 2NRZA 1HUXA 2GELA 1WNSA 2FBYA 3IKMA 3KVGA 2YJEA 1L5UA 1HJRA 3HBTA 4CD1A 2Q97A 1HJOA 2A5XA 2Q3SA 4DTXA 1KLMA 1NOZA 4A5AA 5F1XA 1HR0K 2PFUA 1JLQA 3I0RA 3WQUA 4YOTA 3MEDA 4N56A 3TTFA 4DF8A 3VESA 5AQRA 3JS6A 3UKRB 1VQ7N 1VQNN 4AHSA 4EAHD 1TKDA 1TL3A 1NKBA 2JWLA 4DSJA 4YOWA 4CJ5A 4CJVA 3G0ZA 2HHQA 1IH7A 4CF9A 3V81A 1BIUA 5E41A 4C8MA 2ZF5O 4JD2B 1XWLA 3WXIA 4JNEA 1BISA 1TVRA 3NFAA 1NJXA 5C42A 4B9SA 5LJWA 3RMBA 1LV5A 4B9UA 3KK1A 4PL8A 2BDPA 3C6HA 3F9KA 2EX3A 4DSLA 4E0DA 3DXMB 4E1JA 1X9JA 4FWMA 2P9PB 3AVHA 2WONA 4CGIA 4YORA 4DR6K 2E2NA 3THVA 3HZ6A 3WNGA 4FM0A 2UUAK 1N32K 5FRMA 4XH5A 4OLBA 4BR4A 2WTUA 1JKHA 1KC8O 4CE9A 3OYJA 2YNIA 4ZHRA 4NLCA 1Z26A 1ASUA 4Z4FA 3HM9A 2EHGA 3ID6A 3CQ8A 4AILC 2KW4A 1X9SA 4GW6A 3DLLL 4C8LA 3AY9A 4ELVA 1XMOK 3OYIA 5J2NA 3J7AP 3PV8A 3N4PA 1RILA 4CZEA 1VQKN 1TKXA 4OGCA 3UKRA 4FLTA 4H0TB 1BU6O 3TAQA 1KD1O 4FJ8A 5BR9A 1RBRA 3CXCM 5CZ2A 3SQ0A 1KFDA 5I3UA 4FCYA 5AJ3K 1R0AA 4IEEA 1G99A 3KIOA 3VEYA 1J9AA 1E4FT 5DK5A 2OTJN 3PIPL 4OO1J 3LAMA 2O8FB 1RDDA 3VQ6A 3CFRA 4BRKA 3RSEA 1NGBA 2P9SA 2O8BA 1TV6A 1J6ZA 5I9EB 1JL1A 1NGAA 3OS0A 3O9TA 2QWPA 2OTLN 4B8AB 4B3SK 3U3YA 4CZHA 5AZIA 4DV1K 3MWPA 4AHTA 1QSSA 2PYLA 3SUPA 2FSJA 3ZX2A 4FK2A 4GNIA 4CJEA 4RW4A 1HRHA 3SMSA 1G15A 2AP1A 5K14A 4LFBK 3CJBA 2KLAA 1RTIA 3HSTB 3NVKA 4NO7A 4CEOA 1NG9A 4DB3A 1JLGA 3HSCA 2D5RA 3AVAA 2YHBA 3O8MA 3RMCA 4DCHA 1HNZK 3O80A 4IEIA 1BUPA 3A0IX 4JD2A 3OYBA 3KJVA 4CJLA 4B9NA 3NF8A 2XY7A 5CZ1A 1FXXA 3U9ZA 4KHUA 3LDQA 4FZYA 3O9RA 4JS4A 4B1UB 3VEVA 3NH2A 1YJWN 1BCMA 2YI1A 3P39A 3D2EA 3OBWA 3VENA 4JKDA 5JVHL 3VQ4A 3E9LA 1YVUA 5A2QO 3UB5A 4O44A 3QLHA 5HBMA 3A5NC 1QTMA 2VWKA 4WFBL 3TANA 1GOCA 1IBLK 2IGIA 1YUWA 1U2VB 1U49A 1DKGD 1XC3A 3O9SA 4O8KA 3VOVA 4MQ3A 1RCHA 3MXMA 3TABA 1TL1A 4QS7A 4RTFD 4JKEA 4FWLA 4PL7A 4PY5A 1NK5A 4M41A 1V4SA 3VERA 3MX2A 1ATRA 3CCVN 4KB0A 4DHYA 2O8CB 1JLEA 3CERA 4WFNL 4E7IA 4FVUA 5ADXH 3CCJN 4FYDA 4KHQA 3C65A 1EO1A 1JXBA 2IS3A 4PQUA 2KTQA 4DR7K 3JYTA 4M3ZA 3ZLJA 3V9SA 4LSNA 3RMAA 3L0QA 2I5JA 3G4SN 4A59A 3SCXA 2E5LK 3DI6A 3LANA 5FLXO 3M8PA 4CVNE 1NGIA 4QCLA 4E1MA 3CC2N 3SAFA 3RSEB 5HRPA 5AZJA 3W3DA 4CGDA 4B3OA 4DTUA 1EWQA 3AVFA 4NCAA 1RT6A 3DRSA 1IKXA 1RBVA 4BC3A 3THWA 1RBTA 4YOUA 1RT4A 4KTQA 2WUSA 3CM6A 3HPGA 2D0PA 4DG1A 4FJ5A 4LFAK 2HHVA 4B1WB 1XI1A 3WNEA 3LM2A 3SUNA 2BANA 3ULEB 4PUOA 2D4WA 3SV3A 4CI6A 3L2WA 1KAZA 4IBNA 4CJSA 4JI2K 1LWCA 4KREA 4FL9A 3NGZA 4DTSA 1EX4A 4AQYK 2Q31A 1D5AA 4KHYA 2QWRA 4R5PA 4N76A 1ATSA 4BRQA 3HM8A 2F7TA 4ZTJA 5TKYA 2YJFA 3E9PA 4NXNK 4KH4A 5CYMA 2G8IA 1SQKA 4O5FA 1BO5O 1IKYA 4DV3K 3LDSA 3MX5A 1SZ2A 3EL2A 2WC9A 2E2OA 1S1VA 2D0AA 3DM2A 3VTIA 4J2AA 2OCEA 5KI6A 4GMJB 4A5BA 4B1ZA 4G1QA 3RRHA 3UKUA 4FWOA 4CESA 3CJ1A 1NMDA 2P9NA 4FWKA 3VEXA 2BTFA 3NF7A 3SYZA 1IG8A 2IVOA 3LP3A 3FZMA 2Y1JA 4JN4A 3HRGA 2OZMA 1T3VA 2HOEA 3AAQA 4EP5A 3K5MA 5CY4A 5JS1A 1NKEA 3WNHA 2GWJA 3WXLA 4GV3A 5D3GA 5AR0A 1KVCA 2Z1JA 3P31A 4KHSA 1VQPN 4HUEA 3VQDA 3F2KA 4FLYA 2HHTA 5AQNA 2YNFA 2HHWA 4X62K 4JRQA 3MN7A 3TARA 2A41A 4E7KA 1BQNA 2XHBA 2A1SA 1YJ9N 3CETA 1NGJA 1JLBA 3H1VX 2VGMA 1XNQK 2YNGA 4DQRA 4DTPA 4M3YA 1YITN 1TAQA 5AQXA 4CZGA 4B9VA 4BC5A 4DTRA 1U47A 3JXUA 4CD3A 1OVYA 4BRDA 4BGAA 3NH0A 2YX6A 4DF4A 3KK7A 3LL3A 4DTOA 3PY8A 3I8BA 4AHCA 5BN8A 5AQZA 4DLEA 3P1GA 4R79A 3KZBA 2I7PA 1NU0A 3J7YP 3E1YA 1WSFA 2ASMA 4EZ6A 4UY8O 3ZETB 1IBMK 3LWLA 4CJFA 3LDPA 5J2MA 3LZIA 1JCGA 4CHNA 4OLAA 3AARA 2E6LA 2PBDA 3O1BA 4B9QA 3C7NB 3L6QA 4CHZA 4M3XA 1SV5A 3AA3A 1ZC6A 4ICLA 3C6AA 3RMDA 4JKAA 2NRTA 5JLFA 4DS5A 4H5NA 2NRVA 1B9FA 4CJUA 2E2QA 1QHTA 1HPZA 5J1EA 3U9DA 4B3TK 3GL1A 4FJJA 3KLIA 1WAFA 4O0JA 3QBXA 4JI8K 5GIOA 4HUGA 3CMAN 5M1KA 1K73O 3O3HA 4GV9A 3ZT4A 1CXUA 4WE1A 3VF6A 4ISFA 2VG7A 1C0MA 3E01A 3J8AA 1NK9A 4DSKA 4H0XB 4HVJA 4AHVA 2QK9A 3EYZA 4OKJA 3H08A 3FE1A 2HVHA 4BG9A 2NRHA 1NJWA 3BEXA 1ILYA 2P9LA 1IV0A 4FJGA 4N41A 3P83D 5AQPA 1HNVA 4CFBA 2ATQA 1EKEA 1S1WA 2GWKA 3AVIA 2VQFK 4DFJA 3A5OC 3NVMA 2FSKA 1WUAA 2ASOA 3BF1A 2YKNA 4MLHA 4WQ5A 4IFVA 2F9TA 3EKSA 3D45A 1SKSA 2HBJA 4CF1A 1YTUA 5C15A 4CZMA 4E19A 3LDOA 2JLEA 3GBTA 5JVGL 4JI1K 4DTJA 2OPSA 4BC4A 5LMNK 3NE6A 4ID5A 4IKFA 3H6EA 5KPRA 2ITMA 4CZLA 4BACA 3LDNA 3K0SA 5C2FA 2AJQA 3TAFA 1W0HA 1T8EA 3VTHA 1DLOA 2B5JA 3AVKA 4CJQA 2ETJA 4BDZA 2HHXA 1VRTA 4CZIA 4M42A 3C6UA 3D2FA 3AGRA 3ULEA 3VEZA 3ZT1A 4BG8A 2J4RA 4FVMA 3SJJA 3PX4A 3T1YK 1IG9A 1S72N 4JS5A 3HK2A 5KRSA 3VEOA 3DLRA 3R3LA 4DQSA 4H5WA 4ELTA 3M3ZA 4BC2A 3QB0A 3CCQN 1QZ5A 4DUZK 1VAZA 3SQ1A 2F8TA 2RF2A 4K42A 5M1QA 3EE9A 4FLZA 3WEEB 3A5LC 2OYQA 3KK2A 4FM2A 4FOEA 2VQEK 3QBWA 4H0YB 4YNQA 2HHSA 1Q18A 1VSMA 3D7EO 4BRHA 2D0BA 5M1FA 3OY9A 3PO4A 5AQTA 4QOZB 3FZFA 3VQPA 4KHNA 4K0KK 4BR9A 2NLXA 3PO5A 2NUBA 1Y64A 3ZX0A 1ZXOA 1UA1A 1MWMA 4U7BA 1I39A 3ZT3A 5AQWA 2FBTA 3OJUA 3P4IA 2QI2A 1CZ9A 3D2EB 1TUUA 3CYMA 1NK4A 2P9KB 3LDLA 4CGJA 4CF8A 3WXMB 4AHRA 1IO2A 3PX6A 2YCHA 4BRMA 5FPDA 3H3OB 4BRAA 4YY3K 2VG6A 2G8UA 2RN2A 4N47A 4M63C 1RDUA 2E1ZA 2OPRA 3RRGA 1NK6A 4KB1A 3CD6N 3OYNA 1W9HA 3O4QA 3VQEA 4CEZA 4CFAA 1LAVA 4BWMA 3BZKA 1K9MO 3RR7A 1U4BA 3LAKA 2V7YA 1L3SA 2NRRA 5FPNA 5CR4A 1RFQA 2UUBK 3L2QA 2P9UB 3ZYYX 4CGHA 3HOSA 3MWTA 3CJ7A 2QTDA 4KTZA 4RCHA 3TSPA 5AQYA 4E3SA 1C0GA 3WQTA 2VWJA 5JLHA 1Z05A 4EZ9A 3J81O 4AF1A 1DTTA 2X74A 3SUQA 1FK9A 1ZBUA 3GDQA 4CECA 3FGUA 1KRPA 1FJGK 1TAUA 5LY3A 4H03B 3E9OA 3M5RA 3ID8A 1GOBA 4KRFA 2X78A 3THWB 3QNNA 3MN6A 3OW2M 1QE1A 2HBMA 5C2DA 5AQFA 1TYQB 4AH9A 1RBSA 2WBNA 4RW8A 3DLEA 4CJWA 3FFKB 3PIOL 4GV6A 4CBWA 4FLUA 4FO0A 5AQOA 2OPQA 1WSIA 2DPNA 3KLFA 4K25A 3ITHA 5AQUA 3WXKA 3BUZB 2ZGZA 4AM7A 5HP1A 1C1AA 3WNFA 3R1XA 3NHGA 3NDKA 5FROA 1S3XA 4X64K 3QESA 3AA5X 4HCCA 4BR7A 1RDBA 2ZE2A 3SK3A 2V52B 2Z1GA 3C94A 4PA1A 3QIPA 1SUQA 5I42A 2Q1NA 4DV7K 3KKRA 2DFHA 3EKUA 1GLJO 1Y97A 4DFMA 1YIJN 3RR8A 4B8CA 3H46O 1SAZA 3PUFA 3RWUA 3SMPA 3HPHA 2QWOA 5AZJB 4FK4A 3KHYA 5DM7L 3AO5A 3HOTA 3ISNC 3ZSOA 1A5XA 1HX1A 1YT3A 4I6MA 2NZTA 1B9DA 2HF4A 1LAWA 1MA9B 2HW3A 4YFUA 3HPOA 3ZETA 2F9WA 1KXPA 4NYFA 3V9ZA 4DU3A 3IMXA 5KGWA 4CFCA 4A61A 4F4KA 3OYMA 1YAGA 3VQBA 1N8RO 1SKWA 3TPQA 4BR2A 4OPHA 3GG4A 1HKCA 4FXDA 3MEEA 5C0YA 3VQAA 3ASMA 3CCEN 2HNZA 3AVCA 4IG0A 5LJVA 2XY5A 3O3GA 4OGEA 4TSXA 1WSEA 3U4LA 4LF8K 1RTDA 3AVGA 3VN5A 2D0CA 1C0FA 3LP0A 4KFBA 2Q0RA 3Q7BA 3CCRN 4HUFA 2G8WA 2NNWA 3M6GA 5HRSA 4MDBA 1ZYQA 5EOYA 3F5TA 1TK8A 4MO5A 4KI6A 5AQKA 1I3AA 4I9QA 4ID1A 3KD5E 3ZSYA 2D1KA 4WF9L 4JK7A 3WUHA 4KAZA 3VQ7A 3NH1A 3PSFA 4ILGB 3ZCMA 3I56N 2BUPA 4LFCK 2X6SA 1TYQA 2CGLA 4ELUA 4M3WA 1NLVA 3F73A 1K8AO 4BRLA 2H3GX 5EX5A 1K8KA 3HP6A 4QS9A 4EFHA 1JLAA 5SWMA 4DTMA 4E1NA 3KWIA 4NCGA 3ALYA 4XH1A 3HO1A 2V51B 3UIQA 4B08A 4BRPA 2ZM6K 3VMFB 1UOCA 1NM1A 1MDUB 3HXMA 5C12A 3A5MC 3JAMO 4FZXC 4Z4HA 2HSTA 1C1CA 2FXUA 4RWTA 1NGFA 3T1AA 4DSFA 3VQ8A 5GAHP 3TAEA 1X3NA 1W2BM 2E1YA 2GUPA 4C8KA 4CEQA 3L4QA 4JKFA 3QEPA 3SZ2A 1EP4A 3I55N 1TK0A 2BH1A 4AM6A 1OH5A 1BL3A 3AVBA 2O4IA 4IXCA 1CXQA 1BOTO 4J2EA 2NRXA 1B92A 1QHAA 4BRIA 3CCUN 2P9KA 3K5OA 4B9LA 3FR0A 3K59A 1L3VA 1MWKA 4CBXA 3IDHA 5EVZA 1RDWX 1C0UA 4OPJA 4F3TA 4LD0A 4ILJA 3OVNA 2W6LA 4W5TA 1XNRK 5AQGA 3AVMA 4E89A 1K8KB 4L3QA 3Q7CA 5ADXA 4A62A 3NF6A 4LF9K 1VQ8N 3S3MA 3ULDA 3K2PA 1JXEA 4M45A 1XMQK 4CEDA 3NF9A 2XY6A 3AGKA 3T19A 4CIGA 1BGXT 4B9TA 3OYDA 2QW9A 3K9KA 3EE8A 1BCOA 2IVPA 3TTCA 1DGKN 1GLDG 3BDPA 2P9UA 5DM6L 3OA9A 1Z25A 1YVNA 5SZTA 1GLEG 3CQYA 3SLCA 3QNOA 2G8FA 3ENBA 3AO4A 5CHIA 3UKUB 4KTWA 3HI0A 3U3GA 1QVFM 3I33A 1Z6RA 3OYHA 1UWBA 5TKWA 3CC4N 2ZGYA 4XH4A 1D8YA 3CQXA 2B4JA 1BWFO 4LH4A 3OYCA 4FJKA 4IWVA 3JSMA 3MEGA 3K58A 2Z1HA 3VPZA 4JAXA 1VQ4N 4OKEA 2ASPA 3O6WA 1KFSA 4CK3A 4JI4K 4FWQA 1RNHA 3SQ4A 5C25A 2FBVA 3ZX3A 4B9MA 2B6AA 2RPIA 4CFDA 1S22A 1XUPO 4EP4A 5AQJA 1WB9A 1M1KO 3DMJA 3V1QA 2QWMA 5HRNA 1M90O 3P38A 2QWLA 3MMVA 1RT2A 2X6NA 3ENHA 1NGEA 4CF2A 4CK1A 3THXA 3WEEA 1VQLN 2VCPA 3TAPA 3VGLA 3J80O 2RHKA 4C8NA 4I7FA 3ZT0A 3HL8A 3OYAA 1NMNA 3DAWA 4RW6A 1W7AA 3QEWA 4YOYA 1JL2A 4AHUA 3CCLN 3O3FA 4ISEA 1F21A 1S6PA 3EY1A 4HCBA 1KTQA 4CEBA 4HTUA 1D9FA 4O5BA 4BE0A 4O55A 4DV6K 3SQ2A 1HYSA 3IUCA 5JICA 1U04A 3NGYA 4JI0K 3QINA 2UYTA 3D0PA 2YHAA 1U6ZA 4OKKA 1RDCA 2VG5A 3TR8A 3IRXA 4I9LA 4JI7K 3AVNA 3C95A 3MAQA 4JYAK 1DEJA 1JJ2M 2D0OA 4JKGB 3OTOK 5BPMA 1VQMN 4CGGA 4DQIA 3HYFA 4C23A 5J2PA 4LF6K 2W40A 1WSGA 1N5YA 1KLNA 4IFEA 1GOAA 4B3RK 1IKWA 3C7NA 5AQQA 4BVPA 2PAVA 4CHYA 1P8ZA 5BR8K 4BWJA 1J54A 4CJKA 1SL0A 4DV4K 1T44A 1VQ6N 4IJAA 4K8ZA 1YXQA 5AQLA 5KGXA 3L3UA 1IKVA 5BPNA 1NNEA 1CZAN 3OYLA 1RTJA 4WQ5C 1TUYA 3VQQA 3ZSXA 1YJNN 5KQ8A 4Y1CA 2CH6A 4FZZA 4FLWA 3O9UA 1YI2N 1OVQA 5KPTA 2ITGA 3QETA 4H5TA 3VQ5A 4DFKA 4DWIA 1K6YA 4DR4K 4FJNA 4DTNA 2OA8A 3SBGA 3MN9A 4FW1A 4Y0WA 1NBWA 3E66A 4JI5K 1RT5A 1S1TA 1WBBA 3LM9A 4JEPA 4NXMK 1N6QA 1EQYA 1VSEA 1GLAG 1WBDA 1T6CA 3OYGA 3QIOA 1U45A 1TKTA 4JK9A 2KFZA 3CPEA 4L8RB 2CH5A 2IVNA 1T6DA 4KKOA 1NKCA 5EY4A 1H1VA 3KD1E 3OYFA 2QWQA 3W0LA 3TWHA 4A57A 3ENOA 4H0VB 3DRRA 1R59O 2QXFA 1KVAA 4M7YA 4JHDA 4C8OA 1GLCG 3LP2A 2WFBA 3FZKA 3OYKA 4M3RA 3V4IA 2XRIA 2HHHK 3MCAB 5FDLA 3ATUA 4Z0UA 3QO9A 1XHXA 1TK5A 3B8AX 1RTHA 2JGUA 4FW2A 3QEXA 1N33K 3K5LA 4YDUA 1P90A 3TTDA 3FLCO 4MO4A 3LP1A 4Z4EA 4QS8A 5HRRA 2KFNA 3NMUA 1C6VA 4CHPA 1CLQA 1HPMA 4FSVA 4KI4A 1VSJA 3V9XA 1Q9XA 4CJ7A 5BREA 1S1UA 3AVLA 2UU9K 2W41A 4IDHA 1Q8IA 5H1SQ 5J2QA 4DR5K 1OH6A 4F3OA 5M1PA 2A40A 3V9UA 4V19S 1VSKA 3M1FA 2O8CA 1CZBA 1Q7YO 2G8KA 1VSDA 1O1WA 2YKMA 4HWIA 3VF4A 3IFRA 5KTQA 3CFOA 1UA0A 4OPAA 5MLCQ 5IWAK 3KTQA 4FOIA 1HQUA 1VQ5N 3NBPA 2YNHA 2HNYA 3P5JA 3S41A 1LWEA 5AQHA 1WLJA 3IS9A 3LZJA 1VQON 3KLGA 4CERA 1ESVA 2O8EB 1QVGM 4FJXA 2FF3B 4Z4CA 4WCEL 4CHOA 3G25A 1NGGA 1D9DA 2P9PA 4CZKA 1DTQA 4JLHA 1MU2A 3ZSRA 3F9MA 2UUCK 4DQQA 4DU1A 2YV0X 2A42A 1SKRA 1NWKA 2P1JA 1ZBHA 4IFYA 2ZQBA 1KAYA 2KKZA 1IBKK 2UXDK 4UQGA 2G8VA 3EZ5A 2HMIA 4CGFA 1ATNA 2E20A 4FJ7A 3HT3A 4MLEA 4I2PA 4EHUA 1BA0A 1A5VA 2GEMA 3QFPA 2BE2A 4LC9B 2E2PA 3IAYA 4NCBA 4CHQA 1NGCA 4PHTX 5BRDA 1LOTB 4E7LA 2QEXN 3A8YA 3VETA 3CI5A 1J5EK 4WFAL 1GLBG 4Z4GA 3KWGA 3QDKA 4CJTA 4PKHA 3SBTA 3NAEA 5AFUA 4CF0A 2A6AA 3LPTA 3THXB 4BRNA 2F4VK 2Z1IA 2I7NA 3O5BA 4BDPA 4DV5K 3QERA 4K8XA 5AFUH 1O13A 3CCMN 3K5NA 2Y1IA 4YDUC 1QQNA 3ZSWA 1QSLA 1ZBLA 3PX0A 3THYB 1X1PA 4Z4IA 4IO9L 4BRCA 1QQCA 4M7XA 2P9IB 4PWDA 2O8BB 1X3MA 2IDOA 1VQ9N 3DLBA 2VWBA 3T1HK 4BREA 3T3FA 1SL2A 1JCFA 3DXKB 4DU4A 1YHQN 5GADP 2FBXA 2YHYA 4LF7K 3C0BA 3NCIA 3I0SA 1NK0A 3L2UA 4CZFA 1WSHA 2P9NB 4ISGA 4W5QA 1XC9A 4ILHA 2HBKA 4B1YB 4CK2A 3M8SA 3ZEUA 3VGKA 5HLFA 2W6KA 2P9LB 1NK7A 2BGGA 5DMRA 3ZSZA 2IC3A 2RE2A 3TSUA 4NYNA 3SI6A 3CPWM 1J53A 2QXLA 1W97L 2QA4N 1Q9YA 1VSLA 2O8DA 1I94K 4O4GA 1EETA 5AQVA 1HKGA 1ASVA 2QWNA 2GUIA 5ELZA 1ZBIA 2PY5A 4RW7A 3PLAA 5BPLA 1SL1A 4I2QA 3U8XA 3BF3A 1BHLA 2WOMA 1XHZA 1QZ6A 3RVCA 1JLFA 3G6EN 2ZWHA 3CG7A 1ASWA 2PZSA 4E7HA 4BROA 4FWSA 3MN5A 4IOAL 2HMPA 1TKZA 2QKBA 2Q36A 3C6TA 3NGIA 3CIPA 3H3NO 4PKGA 2Q2RA 3OJSA 5FPEA 4M3TA 3LWMA 3K57A 1YTAA 1HNWK 2A1RA 1SS6A 4EIAA 4B3MK 1NGHA 3VA0A 3SNNA 3O4NA 3R8EA 3FZLA 3O08A 2G8HA 4H0OA 4FPAA 3B6OA 3TAMA 4CCHA 4BR5A 3DRPA 2RKIA 4DUYK 1D4XA 3L2VA 3KK3A 2OPPA 1X9MA 5KRTA 2F8SA 3RTVA 4H5VA 2GV9A 1WOQA 3O1WA 3OHRA 3ZSQA 2XO7A 3T7ZA 4FWNA 4DR2K 4DS4A 3EZWA 1WAJA 4O0IA 4JRPA 1HNXK 3V9WA 4Y1DA 1T05A 3DLHA 1RT3A 3S3OA 3VQCA 2O4GA 4YOVA 1REVA 2EWSA 4H8KA 5E84A 3KLHA 5IT9O 3CMEN 2VYPA 1EXQA 5BN9A 3LALA
chains in the Genus database with same CATH topology
3ENHA 1NGEA 4BVOA 3VTHA 2ZJPL 4J8FA 4CBUA 1GLLO 3N4PA 3WEEA 1VQLN 2VCPA 3VGLA 1HLUA 4CZEA 3N4QA 1VQKN 2RHKA 4CZIA 3DAWA 3D2FA 3QMLA 2CGJA 3AGRA 2V7ZA 4YOYA 4MDAA 4BY9C 2KHOA 3UKRA 3ULEA 4WYBA 3VEZA 4H0TB 3CCLN 1BU6O 4BG8A 2J4RA 2QM1A 4ISEA 1KD1O 3G71N 5BR9A 3CXCM 1S72N 4JK8A 3TU5A 3VEOA 3R3LA 4H5WA 3M3ZA 5E26A 4BC2A 3QB0A 3HTVA 1G99A 1LCUA 1QZ5A 4IEEA 2YHWA 1VAZA 5EXWA 1E4FT 3VEYA 2OTJN 5KQDA 3PIPL 4OO1J 1QQMA 3IUCA 5JICA 4K42A 5M1QA 3EE9A 5F2RA 4BRKA 3RSEA 3WEEB 1NGBA 2P9SA 3A5LC 5HOOA 2UYTA 4FOEA 1J6ZA 1U6ZA 1Q82O 5I9EB 1NGAA 3QBWA 3O9TA 2QWPA 4H0YB 2OTLN 1JCEA 1Q18A 1QQOA 4CZHA 3D7EO 2FF6A 4BRHA 4JHDB 5AZIA 3VF2A 5M1FA 3MWPA 5AQTA 1KAXA 3ATVA 1DEJA 3FZFA 1JJ2M 2D0OA 4JKGB 3CCQN 4BR9A 2NLXA 2FSJA 5BPMA 1VQMN 1Y64A 3ZX0A 1ZXOA 3QICA 3ZX2A 4C23A 4GNIA 1MWMA 4U7BA 1KQSM 2W40A 4KBOA 3SMSA 4IOXA 5AQWA 2AP1A 4BQLA 3CJBA 2KLAA 3P4IA 4IFEA 1BDGA 3NVKA 2QI2A 3R6MA 4O8UA 4NO7A 3UE5A 3C7NA 5AQQA 3D2EB 4G9ZA 1TUUA 4DB3A 3HSCA 4BVPA 3DXMA 4IZ9A 3MCPA 2P9KB 3LDLA 3O8MA 4DCHA 2PAVA 1P8ZA 3O80A 3WXMB 4IEIA 1BUPA 4DQ8A 3A0IX 3VEWA 4JD2A 5BRFA 4FPBA 3ZEUB 2YCHA 4BRMA 5FPDA 4C1NK 1T44A 3H3OB 3U9ZA 1VQ6N 3LDQA 4BRAA 3O9RA 4KH6A 3SAHA 4K43A 4IJAA 5GIPA 4WQ4C 1YXQA 5AQLA 4B1UB 3VEVA 4M63C 1RDUA 5BPNA 1YJWN 1CZAN 2E1ZA 4WQ5C 3CJCA 1TUYA 2VGNA 2YI1A 3P39A 3CD6N 3D2EA 3OBWA 1NGDA 3VENA 4JKDA 5JVHL 1DT9A 3E9LA 4FWRA 2OANA 1YJNN 4JKHA 3UB5A 5KQ8A 2CH6A 3A5NC 1YI2N 3O9UA 4WFBL 5KPTA 4H5TA 1K9MO 3CJ9A 1U2VB 1YUWA 1DKGD 1XC3A 3O9SA 4O8KA 4PKIA 3VOVA 2V7YA 2NRRA 5FPNA 5CR4A 1RFQA 4BQZA 3SBGA 3MN9A 2P9UB 3ZYYX 4Y0WA 3QFUA 3HOSA 3MWTA 3CJ7A 2QTDA 4QS7A 1NBWA 3E66A 4JKEA 4RTFD 3BP8A 4FWLA 4RCHA 2IIRA 4PL7A 4IJNA 5C10A 3TSPA 5AQYA 1V4SA 3LM9A 3VERA 1C0GA 3WQTA 4JEPA 5M1NA 3MX2A 1ATRA 5JLHA 1EQYA 4DHYA 1GLAG 4DKWA 3CCVN 1T6CA 1Z05A 4IOCL 4AF1A 3DXKA 2E88A 4JK9A 4A2AA 3TSQA 3CERA 3GDQA 3MK6A 3FGUA 3CPEA 4EHTA 4WFNL 4FVUA 3O4WA 2CH5A 2IVNA 3EN9A 1T6DA 5ADXH 2ZJRL 3CCJN 5BRHA 2ZJQL 4BGBA 1YF5L 1U2VA 4I6MB 5EY4A 1H1VA 3C65A 4H03B 5LY3A 1EO1A 2QWQA 3E9OA 3M5RA 2GX9A 3ID8A 3W0LA 4A57A 3D6RA 3ENOA 4H0VB 5GAGP 3MN6A 1R59O 3OW2M 1Q86O 1HKBA 2HBMA 5C2DA 4NLBA 3EO3A 4M7YA 4JHDA 3L0QA 5AQFA 5AZIB 4C1NI 1TYQB 1GLCG 3G4SN 4A59A 2WBNA 2WFBA 3FFKB 3FZKA 3PIOL 4GV6A 4CBWA 4FO0A 5AQOA 1NGIA 3MCAB 2DPNA 3ATUA 3CC2N 3SAFA 3RSEB 4K25A 5AZJA 3H1QA 3B8AX 3W3DA 5AQUA 3WXKA 4JKBA 5JMVA 3BUZB 2ZGZA 4AM7A 3R1XA 5AQMA 1S3XA 4BC3A 3T69A 1RGIA 4BR7A 4YOUA 3SK3A 4YDUA 1P90A 3DWLA 3TTDA 2WUSA 4NB4A 3FLCO 2V52B 4MO4A 2D0PA 4B1WB 4QS8A 2FSNA 2Q1NA 3LM2A 4CZJA 3NMUA 3EKUA 5AQIA 3ULEB 1GLJO 1HPMA 2D4WA 4FSVA 1YIJN 4CI6A 4CJ7A 5BREA 5GINA 4F9OA 3H46O 1SAZA 1KAZA 2W41A 5GAEP 4IDHA 1OKJA 5H1SQ 4FL9A 2A40A 2YHXA 5M1PA 3SMPA 2QWOA 4WQ4A 5AZJB 2Q31A 3M1FA 3CJAA 3KHYA 5DM7L 1Q7YO 3HOTA 3WT0A 2HBLA 2QWRA 1HX1A 1ATSA 4HWIA 2NZTA 3IFRA 4I6MA 5AQSA 3L4IA 3VF4A 4BRQA 2HF4A 3HM8A 4OPAA 5MLCQ 1MA9B 2F7TA 5TKYA 2YJFA 3E9PA 4B1VA 4FOIA 1VQ5N 4KH4A 3S41A 2F9WA 1KXPA 1E4GT 1SQKA 2GTDA 2HF3A 4O5FA 3ZETA 3IMXA 1BO5O 5AQHA 4GVEA 4A61A 3MX5A 1SZ2A 1YAGA 3EL2A 1VQON 1N8RO 3D2FB 3TPQA 4BR2A 2WC9A 2E2OA 4YOXA 4OPHA 3GG4A 1ESVA 1HKCA 3VTIA 1QVGM 3CHWA 2FF3B 2Q0UA 5C0YA 4WCEL 3G25A 1NGGA 3CCEN 4A5BA 3SAGA 4B1ZA 3UKUA 1IJJA 2P9PA 4FWOA 4CZKA 5LJVA 3CJ1A 1NMDA 2P9NA 4FWKA 3F9MA 1BA1A 3VEXA 2BTFA 5M1OA 4JKCA 4K41A 2A42A 1IG8A 2IVOA 1NWKA 3U4LA 3FZMA 1KAYA 2KKZA 4JN4A 3HRGA 1ATNA 1T3VA 1C0FA 2E20A 2HOEA 3AAQA 2Q0RA 4KH5A 4MLEA 3Q7BA 3CCRN 2NNWA 3M6GA 1BA0A 4MDBA 4EHUA 1NJIO 3FZHA 2GEMA 5EOYA 3MDQA 3F5TA 3QFPA 4LC9B 2GWJA 2E2PA 4MO5A 5AQKA 3J7ZO 3WXLA 4GV3A 5AR0A 3R9PA 1NGCA 4PHTX 4GY2B 3P31A 5BRDA 1LOTB 1VQPN 2QEXN 3A8YA 3VETA 2D1KA 4WF9L 3CI5A 3F2KA 4JK7A 1GLBG 3WUHA 3KWGA 5AQNA 4WFAL 3CCSN 3QDKA 4PKHA 3SBTA 4U67L 2AA4A 5AFUA 3MN7A 4ILGB 2A41A 2A6AA 3I56N 3CF5L 2BUPA 4BRNA 4JKGA 1TYQA 1YJ9N 3CETA 1V4TA 2CGLA 2I7NA 1ZBSA 3O5BA 1NGJA 3WXJA 3CC7N 5AFUH 3H1VX 1NLVA 1O13A 1XQSC 2VGMA 3O9QA 2H3GX 5EX5A 1K8KA 3SJHA 4BRLA 3CCMN 4IO8A 3DJCA 3GOIA 3H45C 1QQNA 4YDUC 4H0PA 4QS9A 5AQXA 4A2BA 1YITN 4CZGA 2JWKA 4EFHA 4BC5A 3JXUA 3K9JA 3OBYA 4B1XB 2FLOA 4CD3A 4IO9L 3KWIA 3GE1A 4BRCA 1OVYA 4BRGA 4BRDA 4M7XA 4BGAA 2P9IB 4XH1A 3VGMA 1K8AO 1X3MA 2V51B 1VQ9N 2YX6A 2VWBA 4BREA 3KK7A 3LL3A 1JCFA 3DXKB 4BRFA 4BRPA 1YHQN 2CGKA 5GADP 1Q81O 4FWPA 2YHYA 3C0BA 3I8BA 3VMFB 5BN8A 4Z94A 4CZFA 1NM1A 1MDUB 5AQZA 5B8HA 5C12A 2P9NB 4ISGA 2NRWA 4ILHA 2HBKA 3A5MC 4B1YB 4R79A 3KZBA 2I7PA 2HSTA 2FXUA 4RWTA 1NGFA 3E1YA 2ASMA 4HTLA 3VGKA 3ZEUA 4UY8O 2P9LB 3ZETB 5KPZA 5HL7L 5GAHP 4BR0A 5CE3A 3LDPA 1X3NA 1JCGA 2RE2A 3TSUA 1W2BM 3CPWM 5FPMA 2E1YA 2GUPA 3AARA 2PBDA 2QXLA 1W97L 3O1BA 3L4QA 4JKFA 4B9QA 2QA4N 3C7NB 3L6QA 4XEIA 3I55N 2BH1A 4AM6A 2E8AA 1ZC6A 2P9IA 3AAPA 1HKGA 3C6AA 5AQVA 2QWNA 4JKAA 2NRTA 1BG3A 5ELZA 4IXCA 1BOTO 5JLFA 2NRXA 1QHAA 4H5NA 4BRIA 1GLFO 2NRVA 3PLAA 3CCUN 5BPLA 5F0XA 3U8XA 2E2QA 2P9KA 3BF3A 3FR0A 2A3ZA 2P9SB 4H5RA 3U9DA 2NRZA 1QZ6A 1HUXA 3GL1A 2GELA 1MWKA 3RVCA 3IKMA 4CBXA 3KVGA 2YJEA 3IDHA 5EVZA 3HBTA 1RDWX 4CD1A 2Q97A 1HJOA 2A5XA 3QBXA 5GIOA 3G6EN 4ILJA 2ZWHA 3CMAN 4A5AA 5M1KA 5AQGA 5F1XA 1K73O 2PFUA 4GV9A 1K8KB 4L3QA 4BROA 4FWSA 3MN5A 3Q7CA 3WQUA 4IOAL 5ADXA 2HMPA 4YOTA 3VF6A 4ISFA 2Q36A 4A62A 1VQ8N 3CIPA 3H3NO 3TTFA 3VESA 5AQRA 3J8AA 4PKGA 2Q2RA 3JS6A 3UKRB 1VQ7N 1VQNN 5FPEA 4EAHD 3AGKA 4H0XB 1SS6A 2JWLA 4EIAA 2QW9A 4YOWA 3K9KA 1NGHA 3EE8A 2IVPA 3FE1A 3TTCA 3R8EA 1DGKN 1GLDG 2NRHA 3FZLA 3O08A 3BEXA 4BG9A 1ILYA 2P9UA 5DM6L 2P9LA 3OA9A 4H0OA 2ZF5O 4JD2B 1YVNA 1GLEG 3CQYA 5AQPA 3SLCA 3WXIA 4FPAA 4JNEA 3ENBA 4BR5A 5CHIA 3UKUB 3HI0A 2GWKA 1D4XA 3A5OC 1QVFM 3I33A 3NVMA 2FSKA 1WUAA 5LJWA 2ASOA 1Z6RA 3BF1A 4PL8A 5TKWA 3C6HA 4MLHA 3CC4N 3DXMB 4WQ5A 4E1JA 4H5VA 2ZGYA 4XH4A 2F9TA 3EKSA 1WOQA 1X9JA 3CQXA 3O1WA 1BWFO 2P9PB 3OHRA 4FWMA 2HBJA 3T7ZA 4YORA 4FWNA 4IWVA 2E2NA 5C15A 4CZMA 3LDOA 3EZWA 3GBTA 3HZ6A 4JAXA 3VPZA 5JVGL 1VQ4N 4XH5A 2ASPA 3O6WA 4BR4A 4BC4A 4FWQA 1KC8O 3ZX3A 4NLCA 3H6EA 1S22A 5KPRA 2ITMA 1XUPO 4CZLA 4YOVA 5AQJA 2EWSA 1M1KO 5E84A 3LDNA 2QWMA 1M90O 3ID6A 3CMEN 2VYPA 5C2FA 3P38A 2QWLA 3DLLL 3MMVA 5BN9A 3AY9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ENH A;  1NGE A;  4BVO A;  4J8F A;  4CBU A;  1GLL O;  3WEE A;  2VCP A;  3VGL A;  1HLU A;  4CZE A;  4CZI A;  3DAW A;  3D2F A;  3QML A;  2CGJ A;  2V7Z A;  2KHO A;  3UKR A;  3ULE A;  4WYB A;  3VEZ A;  4H0T B;  1BU6 O;  4BG8 A;  2J4R A;  2QM1 A;  4ISE A;  5BR9 A;  3TU5 A;  3VEO A;  4H5W A;  3M3Z A;  5E26 A;  4BC2 A;  3QB0 A;  3HTV A;  1G99 A;  1LCU A;  1QZ5 A;  5EXW A;  2YHW A;  3VEY A;  1E4F T;  5KQD A;  1QQM A;  3IUC A;  5JIC A;  4K42 A;  5F2R A;  4BRK A;  3RSE A;  3WEE B;  1NGB A;  2P9S A;  3A5L C;  2UYT A;  4FOE A;  1J6Z A;  1U6Z A;  5I9E B;  1NGA A;  3QBW A;  2QWP A;  4H0Y B;  1JCE A;  1Q18 A;  1QQO A;  4CZH A;  3D7E O;  2FF6 A;  4BRH A;  4JHD B;  5AZI A;  3VF2 A;  5AQT A;  1KAX A;  3ATV A;  1DEJ A;  3FZF A;  2D0O A;  4BR9 A;  2NLX A;  2FSJ A;  5BPM A;  1Y64 A;  3ZX0 A;  1ZXO A;  3QIC A;  3ZX2 A;  4C23 A;  4GNI A;  1MWM A;  2W40 A;  4KBO A;  3SMS A;  5AQW A;  2AP1 A;  4BQL A;  3CJB A;  3P4I A;  1BDG A;  3R6M A;  4NO7 A;  3UE5 A;  3C7N A;  5AQQ A;  3D2E B;  1TUU A;  4DB3 A;  3HSC A;  4BVP A;  3DXM A;  4IZ9 A;  3MCP A;  2P9K B;  3LDL A;  3O8M A;  4DCH A;  2PAV A;  1P8Z A;  3O80 A;  1BUP A;  4DQ8 A;  3A0I X;  3VEW A;  4JD2 A;  5BRF A;  4FPB A;  3ZEU B;  2YCH A;  4BRM A;  5FPD A;  1T44 A;  3H3O B;  3U9Z A;  3LDQ A;  4BRA A;  4K43 A;  4IJA A;  4WQ4 C;  1YXQ A;  5AQL A;  4B1U B;  3VEV A;  4M63 C;  5BPN A;  1CZA N;  2E1Z A;  4WQ5 C;  3CJC A;  1TUY A;  2YI1 A;  3D2E A;  3VEN A;  1NGD A;  4FWR A;  2OAN A;  3UB5 A;  5KQ8 A;  2CH6 A;  3A5N C;  5KPT A;  4H5T A;  3CJ9 A;  1U2V B;  1YUW A;  1DKG D;  1XC3 A;  4PKI A;  4O8K A;  3VOV A;  2V7Y A;  5FPN A;  1RFQ A;  4BQZ A;  3MN9 A;  2P9U B;  4Y0W A;  3QFU A;  3CJ7 A;  4QS7 A;  1NBW A;  4RTF D;  3BP8 A;  4FWL A;  4RCH A;  2IIR A;  4PL7 A;  4IJN A;  5AQY A;  1V4S A;  3LM9 A;  3VER A;  1C0G A;  3WQT A;  1ATR A;  5JLH A;  1EQY A;  4DHY A;  1GLA G;  1T6C A;  1Z05 A;  3DXK A;  2E88 A;  4A2A A;  3CER A;  3GDQ A;  3MK6 A;  3FGU A;  4EHT A;  3O4W A;  2CH5 A;  2IVN A;  3EN9 A;  1T6D A;  5ADX H;  5BRH A;  4BGB A;  1U2V A;  4I6M B;  5EY4 A;  1H1V A;  4H03 B;  5LY3 A;  2QWQ A;  3W0L A;  3ID8 A;  3ENO A;  4H0V B;  3MN6 A;  1R59 O;  1HKB A;  3EO3 A;  4M7Y A;  4JHD A;  3L0Q A;  5AQF A;  5AZI B;  1TYQ B;  1GLC G;  3FZK A;  3FFK B;  4CBW A;  4FO0 A;  5AQO A;  1NGI A;  2DPN A;  3ATU A;  3RSE B;  4K25 A;  5AZJ A;  3H1Q A;  3B8A X;  3W3D A;  5AQU A;  3WXK A;  5JMV A;  3BUZ B;  2ZGZ A;  4AM7 A;  5AQM A;  1S3X A;  4BC3 A;  1RGI A;  4BR7 A;  3SK3 A;  4YDU A;  3DWL A;  2WUS A;  4NB4 A;  3FLC O;  2V52 B;  4MO4 A;  2D0P A;  4B1W B;  4QS8 A;  2FSN A;  2Q1N A;  3LM2 A;  4CZJ A;  3EKU A;  5AQI A;  3ULE B;  1GLJ O;  1HPM A;  2D4W A;  4FSV A;  4CI6 A;  4CJ7 A;  5BRE A;  4F9O A;  3H46 O;  1SAZ A;  1KAZ A;  2W41 A;  1OKJ A;  4FL9 A;  2A40 A;  2YHX A;  3SMP A;  2QWO A;  4WQ4 A;  5AZJ B;  2Q31 A;  3M1F A;  3CJA A;  3KHY A;  3WT0 A;  2QWR A;  1HX1 A;  1ATS A;  4HWI A;  2NZT A;  3IFR A;  4I6M A;  5AQS A;  3L4I A;  3VF4 A;  4BRQ A;  2HF4 A;  3HM8 A;  1MA9 B;  5TKY A;  2YJF A;  4B1V A;  4FOI A;  3S41 A;  2F9W A;  1KXP A;  1E4G T;  1SQK A;  2GTD A;  2HF3 A;  4O5F A;  3ZET A;  3IMX A;  1BO5 O;  5AQH A;  4A61 A;  1SZ2 A;  1YAG A;  3EL2 A;  3D2F B;  3TPQ A;  4BR2 A;  2E2O A;  3GG4 A;  1ESV A;  1HKC A;  3CHW A;  2FF3 B;  2Q0U A;  3G25 A;  1NGG A;  4B1Z A;  3UKU A;  1IJJ A;  2P9P A;  4FWO A;  4CZK A;  5LJV A;  3CJ1 A;  1NMD A;  2P9N A;  4FWK A;  3F9M A;  1BA1 A;  3VEX A;  2BTF A;  4K41 A;  2A42 A;  1IG8 A;  2IVO A;  1NWK A;  3U4L A;  3FZM A;  1KAY A;  4JN4 A;  1ATN A;  2E20 A;  1C0F A;  2HOE A;  3AAQ A;  2Q0R A;  4MLE A;  4EHU A;  3M6G A;  1BA0 A;  3FZH A;  2GEM A;  5EOY A;  3MDQ A;  3QFP A;  4LC9 B;  2GWJ A;  2E2P A;  4MO5 A;  5AQK A;  3WXL A;  5AR0 A;  3R9P A;  1NGC A;  4GY2 B;  5BRD A;  1LOT B;  3A8Y A;  3VET A;  2D1K A;  3CI5 A;  3WUH A;  1GLB G;  5AQN A;  3QDK A;  4PKH A;  2AA4 A;  5AFU A;  3MN7 A;  2A41 A;  2A6A A;  2BUP A;  4BRN A;  1TYQ A;  3CET A;  1V4T A;  2CGL A;  2I7N A;  1ZBS A;  3O5B A;  1NGJ A;  3WXJ A;  5AFU H;  3H1V X;  1NLV A;  1XQS C;  3SJH A;  4BRL A;  2H3G X;  5EX5 A;  1K8K A;  4IO8 A;  3DJC A;  3GOI A;  3H45 C;  1QQN A;  4YDU C;  4H0P A;  4QS9 A;  5AQX A;  4A2B A;  4CZG A;  4EFH A;  4BC5 A;  3JXU A;  4B1X B;  2FLO A;  4CD3 A;  3GE1 A;  4BRC A;  4BRG A;  4BRD A;  4M7X A;  4BGA A;  2P9I B;  4XH1 A;  3VGM A;  1X3M A;  2V51 B;  2VWB A;  4BRE A;  4BRF A;  3LL3 A;  1JCF A;  3DXK B;  4BRP A;  2CGK A;  4FWP A;  2YHY A;  3C0B A;  3I8B A;  5BN8 A;  4Z94 A;  4CZF A;  1NM1 A;  1MDU B;  5AQZ A;  5B8H A;  2P9N B;  4ISG A;  3A5M C;  4B1Y B;  3KZB A;  2I7P A;  2FXU A;  4RWT A;  1NGF A;  4HTL A;  2ASM A;  3VGK A;  3ZEU A;  2P9L B;  3ZET B;  5KPZ A;  4BR0 A;  5CE3 A;  3LDP A;  1X3N A;  1JCG A;  5FPM A;  2E1Y A;  2GUP A;  3AAR A;  2PBD A;  2QXL A;  3O1B A;  4B9Q A;  3C7N B;  3L6Q A;  4XEI A;  4AM6 A;  2E8A A;  1ZC6 A;  2P9I A;  3AAP A;  1HKG A;  5AQV A;  2QWN A;  1BG3 A;  5ELZ A;  4IXC A;  1BOT O;  5JLF A;  1QHA A;  4H5N A;  4BRI A;  1GLF O;  5BPL A;  5F0X A;  3U8X A;  2E2Q A;  2P9K A;  3BF3 A;  3FR0 A;  2A3Z A;  2P9S B;  4H5R A;  3U9D A;  1QZ6 A;  1HUX A;  3GL1 A;  2GEL A;  1MWK A;  4CBX A;  3KVG A;  2YJE A;  3IDH A;  5EVZ A;  3HBT A;  1RDW X;  4CD1 A;  2Q97 A;  1HJO A;  2A5X A;  3QBX A;  2ZWH A;  5AQG A;  5F1X A;  1K8K B;  4L3Q A;  4BRO A;  4FWS A;  3MN5 A;  3WQU A;  5ADX A;  2HMP A;  3VF6 A;  4ISF A;  2Q36 A;  4A62 A;  3CIP A;  3H3N O;  3VES A;  5AQR A;  3J8A A;  4PKG A;  2Q2R A;  3JS6 A;  3UKR B;  5FPE A;  4EAH D;  4H0X B;  4EIA A;  2QW9 A;  1NGH A;  2IVP A;  3FE1 A;  3R8E A;  1DGK N;  1GLD G;  2NRH A;  3FZL A;  3O08 A;  3BEX A;  4BG9 A;  2P9U A;  2P9L A;  4H0O A;  2ZF5 O;  4JD2 B;  1YVN A;  1GLE G;  3CQY A;  5AQP A;  3SLC A;  3WXI A;  4FPA A;  4JNE A;  4BR5 A;  3UKU B;  3HI0 A;  2GWK A;  1D4X A;  3A5O C;  3I33 A;  5LJW A;  2FSK A;  1WUA A;  2ASO A;  1Z6R A;  3BF1 A;  4PL8 A;  4MLH A;  3DXM B;  4WQ5 A;  4E1J A;  4H5V A;  2ZGY A;  4XH4 A;  2F9T A;  3EKS A;  1WOQ A;  1X9J A;  3CQX A;  3O1W A;  1BWF O;  2P9P B;  3OHR A;  4FWM A;  4FWN A;  4IWV A;  2E2N A;  4CZM A;  3LDO A;  3EZW A;  3GBT A;  3HZ6 A;  4JAX A;  3VPZ A;  4XH5 A;  2ASP A;  3O6W A;  4BR4 A;  4BC4 A;  4FWQ A;  3ZX3 A;  3H6E A;  1S22 A;  5KPR A;  2ITM A;  1XUP O;  4CZL A;  5AQJ A;  2EWS A;  5E84 A;  3LDN A;  2QWM A;  2VYP A;  2QWL A;  3MMV A;  5BN9 A;  3AY9 A; 
#chains in the Genus database with same CATH topology
 4BVO A;  2ZJP L;  4FJH A;  4M3U A;  4J8F A;  4CBU A;  1GLL O;  1HLU A;  3N4Q A;  3DYA A;  3QML A;  2CGJ A;  4F8R A;  2V7Z A;  5CYQ A;  4MDA A;  4E7J A;  2KHO A;  4BY9 C;  4WYB A;  2F96 A;  1E3M A;  2QM1 A;  3G71 N;  4KHW A;  4JK8 A;  3TU5 A;  4FJL A;  1HMV A;  5E26 A;  1VSF A;  2QKK A;  3HTV A;  1LCU A;  5EXW A;  2YHW A;  1FKO A;  5KQD A;  1QQM A;  4LY7 A;  4W5N A;  5F2R A;  1VK0 A;  3FFI A;  5HOO A;  4LF5 K;  1VRU A;  4DV2 K;  1Q82 O;  3AO1 A;  2W42 A;  3I8D A;  2LSN A;  2UXC K;  1VSH A;  1NK8 A;  1RT7 A;  2DFE A;  1JCE A;  1QQO A;  2FF6 A;  4JHD B;  3VF2 A;  2GBZ A;  3BGR A;  1KAX A;  3L2R A;  3ATV A;  4FJI A;  4BE2 A;  4LSL A;  3SUO A;  4OX9 K;  3QIC A;  1NJY A;  2P51 A;  1KQS M;  4KBO A;  4IOX A;  4BQL A;  4H4M A;  4ZTF A;  4CEE A;  1BDG A;  3R6M A;  4O8U A;  4QAG A;  3UE5 A;  1HNI A;  4G9Z A;  2OZS A;  3ZSV A;  2UXB K;  3DXM A;  4IZ9 A;  3MCP A;  4CEF A;  3SV4 A;  1NJZ A;  2DTU A;  4DQ8 A;  3VEW A;  3PSI A;  5BRF A;  1LW0 A;  1S9G A;  4FPB A;  3ZEU B;  4C1N K;  4KO0 A;  4KH6 A;  3SAH A;  4K43 A;  5GIP A;  4WQ4 C;  5LMU K;  1A5W A;  1HQE A;  3CJC A;  2VGN A;  1NGD A;  2O8D B;  2IAJ A;  1DT9 A;  2HB5 A;  2PYJ A;  1RBU A;  4W5R A;  4FWR A;  2OAN A;  4JKH A;  1NOY A;  3CJ9 A;  1S1X A;  4PKI A;  4W5O A;  4DR3 K;  1WN7 A;  1BIZ A;  3MEC A;  4BQZ A;  4FJ9 A;  3QFU A;  4YHH K;  2HVI A;  3BP8 A;  2IIR A;  2IOC A;  4IJN A;  5C10 A;  5M1N A;  3THY A;  1QS4 A;  4DKW A;  5LL6 Z;  4IOC L;  4J2B A;  3DXK A;  2E88 A;  1BQM A;  3KKS A;  4A2A A;  1KVB A;  3TSQ A;  3MK6 A;  4EHT A;  4CJ4 A;  4FLV A;  3O4W A;  3EN9 A;  2ZJR L;  4DR1 K;  1OH8 A;  5BRH A;  2ZJQ L;  4BGB A;  1YF5 L;  1U2V A;  4I6M B;  1EWR A;  3VA3 A;  3HJF A;  4Q0B A;  1U48 A;  2GX9 A;  1RT1 A;  3D6R A;  5GAG P;  3HVT A;  4FLX A;  1Q86 O;  1HKB A;  3M8Q A;  4NLB A;  3EO3 A;  4C1N I;  5AZI B;  4DLG A;  3S3N A;  4KPY A;  3AA2 A;  3IG1 A;  3V1O A;  5C24 A;  3B6P A;  1BI4 A;  3H1Q A;  4JKB A;  5JMV A;  5AQM A;  1OH7 A;  4X65 K;  3T69 A;  1RGI A;  4RG8 A;  3TAG A;  3DWL A;  4DQP A;  4NB4 A;  4LH5 A;  1LW2 A;  2FSN A;  3QEI A;  4CJ3 A;  2HHU A;  4CZJ A;  5T7B A;  5AQI A;  3MXJ A;  4DMN A;  5GIN A;  1N34 K;  4F9O A;  4OJR A;  4Q5V A;  2HND A;  5GAE P;  3AVJ A;  4BE1 A;  1OKJ A;  2R7Y A;  1S6Q A;  2YHX A;  1C0T A;  3A2F A;  3TI0 A;  4RW9 A;  4WQ4 A;  3AO2 A;  2O8F A;  2O8E A;  4CEA A;  3CJA A;  4CW7 B;  3WT0 A;  2HBL A;  4OVL A;  5AQS A;  1S9E A;  3L4I A;  5JS2 A;  1TGO A;  4FJM A;  4B1V A;  3OS1 A;  3V1R A;  1UAX A;  2DFF A;  2HF3 A;  1E4G T;  2GTD A;  2ZD1 A;  4GVM A;  4JI3 K;  4GVE A;  3CFP A;  3D2F B;  4KHP K;  4X66 K;  1ZBF A;  1J5O A;  4YOX A;  3CHW A;  2Q0U A;  1T03 A;  3ZT2 A;  3EEQ A;  3SAG A;  3CM5 A;  1VHX A;  4JV5 K;  1IJJ A;  1FW6 A;  1BI4 B;  1ITG A;  1BA1 A;  2DY4 A;  5M1O A;  4JKC A;  4K41 A;  4F2R A;  3BZC A;  3HVR A;  3HP9 A;  3G10 A;  3QEV A;  1WSJ A;  4DV0 K;  4KH5 A;  4DSI A;  4IG3 A;  3BY5 A;  1NJI O;  3FZH A;  3DLK A;  3MDQ A;  1VSI A;  3J7Z O;  3R9P A;  2E6M A;  4GY2 B;  4H4O A;  5HRO A;  3AA4 A;  3CCS N;  3DOK A;  4U67 L;  2AA4 A;  3AV9 A;  4FM1 A;  3CF5 L;  4N5S A;  4JKG A;  3DLG A;  1V4T A;  3WXJ A;  4DFP A;  1ZBS A;  3CC7 N;  4F2S A;  1QSY A;  3MXI A;  3O9Q A;  1XQS C;  3SJH A;  3V6D A;  3L3V A;  1JLC A;  4IO8 A;  3DJC A;  4XIU A;  3GOI A;  3H45 C;  4H0P A;  4A2B A;  1KCF A;  4BDY A;  2JWK A;  4IDK A;  4J2D A;  3U6F A;  1FKP A;  3K9J A;  3OBY A;  4B1X B;  2FLO A;  4LF4 K;  3DOL A;  3GE1 A;  4BRG A;  1S5J A;  2FC0 A;  4GKK K;  1L3T A;  3VGM A;  4BRF A;  4MFB A;  2CGK A;  1Q81 O;  4FWP A;  3S9H A;  4CJR A;  3OYE A;  4OPK A;  4CIE A;  5FRN A;  4Z94 A;  1HYZ A;  5B8H A;  3L8B A;  2NRW A;  2XY8 A;  4KV8 A;  1C1B A;  4JI6 K;  1LWF A;  1L3U A;  2KZZ A;  4HTL A;  5KPZ A;  5HL7 L;  3M8R A;  1RDA A;  3AO3 A;  4BR0 A;  5CE3 A;  4CIF A;  2KQ2 A;  3VQ9 A;  5FPM A;  3KLE A;  1T7P A;  4FK0 A;  4XEI A;  4HHT A;  2P5G A;  2E8A A;  1HYV A;  2P9I A;  3AAP A;  3SPY A;  5EU7 A;  1BG3 A;  4DSE A;  1X9W A;  1GLF O;  2E4L A;  5F0X A;  1KSP A;  3SPZ A;  3OS2 A;  4CJP A;  2A3Z A;  2P5O A;  1N36 K;  2P9S B;  3LPU A;  2KZM A;  4H5R A;  4GKJ K;  2NRZ A;  1HUX A;  2GEL A;  1WNS A;  2FBY A;  3IKM A;  3KVG A;  2YJE A;  1L5U A;  1HJR A;  3HBT A;  4CD1 A;  2Q97 A;  1HJO A;  2A5X A;  2Q3S A;  4DTX A;  1KLM A;  1NOZ A;  4A5A A;  5F1X A;  1HR0 K;  2PFU A;  1JLQ A;  3I0R A;  3WQU A;  4YOT A;  3MED A;  4N56 A;  3TTF A;  4DF8 A;  3VES A;  5AQR A;  3JS6 A;  3UKR B;  1VQ7 N;  1VQN N;  4AHS A;  4EAH D;  1TKD A;  1TL3 A;  1NKB A;  2JWL A;  4DSJ A;  4YOW A;  4CJ5 A;  4CJV A;  3G0Z A;  2HHQ A;  1IH7 A;  4CF9 A;  3V81 A;  1BIU A;  5E41 A;  4C8M A;  2ZF5 O;  4JD2 B;  1XWL A;  3WXI A;  4JNE A;  1BIS A;  1TVR A;  3NFA A;  1NJX A;  5C42 A;  4B9S A;  5LJW A;  3RMB A;  1LV5 A;  4B9U A;  3KK1 A;  4PL8 A;  2BDP A;  3C6H A;  3F9K A;  2EX3 A;  4DSL A;  4E0D A;  3DXM B;  4E1J A;  1X9J A;  4FWM A;  2P9P B;  3AVH A;  2WON A;  4CGI A;  4YOR A;  4DR6 K;  2E2N A;  3THV A;  3HZ6 A;  3WNG A;  4FM0 A;  2UUA K;  1N32 K;  5FRM A;  4XH5 A;  4OLB A;  4BR4 A;  2WTU A;  1JKH A;  1KC8 O;  4CE9 A;  3OYJ A;  2YNI A;  4ZHR A;  4NLC A;  1Z26 A;  1ASU A;  4Z4F A;  3HM9 A;  2EHG A;  3ID6 A;  3CQ8 A;  4AIL C;  2KW4 A;  1X9S A;  4GW6 A;  3DLL L;  4C8L A;  3AY9 A;  4ELV A;  1XMO K;  3OYI A;  5J2N A;  3J7A P;  3PV8 A;  3N4P A;  1RIL A;  4CZE A;  1VQK N;  1TKX A;  4OGC A;  3UKR A;  4FLT A;  4H0T B;  1BU6 O;  3TAQ A;  1KD1 O;  4FJ8 A;  5BR9 A;  1RBR A;  3CXC M;  5CZ2 A;  3SQ0 A;  1KFD A;  5I3U A;  4FCY A;  5AJ3 K;  1R0A A;  4IEE A;  1G99 A;  3KIO A;  3VEY A;  1J9A A;  1E4F T;  5DK5 A;  2OTJ N;  3PIP L;  4OO1 J;  3LAM A;  2O8F B;  1RDD A;  3VQ6 A;  3CFR A;  4BRK A;  3RSE A;  1NGB A;  2P9S A;  2O8B A;  1TV6 A;  1J6Z A;  5I9E B;  1JL1 A;  1NGA A;  3OS0 A;  3O9T A;  2QWP A;  2OTL N;  4B8A B;  4B3S K;  3U3Y A;  4CZH A;  5AZI A;  4DV1 K;  3MWP A;  4AHT A;  1QSS A;  2PYL A;  3SUP A;  2FSJ A;  3ZX2 A;  4FK2 A;  4GNI A;  4CJE A;  4RW4 A;  1HRH A;  3SMS A;  1G15 A;  2AP1 A;  5K14 A;  4LFB K;  3CJB A;  2KLA A;  1RTI A;  3HST B;  3NVK A;  4NO7 A;  4CEO A;  1NG9 A;  4DB3 A;  1JLG A;  3HSC A;  2D5R A;  3AVA A;  2YHB A;  3O8M A;  3RMC A;  4DCH A;  1HNZ K;  3O80 A;  4IEI A;  1BUP A;  3A0I X;  4JD2 A;  3OYB A;  3KJV A;  4CJL A;  4B9N A;  3NF8 A;  2XY7 A;  5CZ1 A;  1FXX A;  3U9Z A;  4KHU A;  3LDQ A;  4FZY A;  3O9R A;  4JS4 A;  4B1U B;  3VEV A;  3NH2 A;  1YJW N;  1BCM A;  2YI1 A;  3P39 A;  3D2E A;  3OBW A;  3VEN A;  4JKD A;  5JVH L;  3VQ4 A;  3E9L A;  1YVU A;  5A2Q O;  3UB5 A;  4O44 A;  3QLH A;  5HBM A;  3A5N C;  1QTM A;  2VWK A;  4WFB L;  3TAN A;  1GOC A;  1IBL K;  2IGI A;  1YUW A;  1U2V B;  1U49 A;  1DKG D;  1XC3 A;  3O9S A;  4O8K A;  3VOV A;  4MQ3 A;  1RCH A;  3MXM A;  3TAB A;  1TL1 A;  4QS7 A;  4RTF D;  4JKE A;  4FWL A;  4PL7 A;  4PY5 A;  1NK5 A;  4M41 A;  1V4S A;  3VER A;  3MX2 A;  1ATR A;  3CCV N;  4KB0 A;  4DHY A;  2O8C B;  1JLE A;  3CER A;  4WFN L;  4E7I A;  4FVU A;  5ADX H;  3CCJ N;  4FYD A;  4KHQ A;  3C65 A;  1EO1 A;  1JXB A;  2IS3 A;  4PQU A;  2KTQ A;  4DR7 K;  3JYT A;  4M3Z A;  3ZLJ A;  3V9S A;  4LSN A;  3RMA A;  3L0Q A;  2I5J A;  3G4S N;  4A59 A;  3SCX A;  2E5L K;  3DI6 A;  3LAN A;  5FLX O;  3M8P A;  4CVN E;  1NGI A;  4QCL A;  4E1M A;  3CC2 N;  3SAF A;  3RSE B;  5HRP A;  5AZJ A;  3W3D A;  4CGD A;  4B3O A;  4DTU A;  1EWQ A;  3AVF A;  4NCA A;  1RT6 A;  3DRS A;  1IKX A;  1RBV A;  4BC3 A;  3THW A;  1RBT A;  4YOU A;  1RT4 A;  4KTQ A;  2WUS A;  3CM6 A;  3HPG A;  2D0P A;  4DG1 A;  4FJ5 A;  4LFA K;  2HHV A;  4B1W B;  1XI1 A;  3WNE A;  3LM2 A;  3SUN A;  2BAN A;  3ULE B;  4PUO A;  2D4W A;  3SV3 A;  4CI6 A;  3L2W A;  1KAZ A;  4IBN A;  4CJS A;  4JI2 K;  1LWC A;  4KRE A;  4FL9 A;  3NGZ A;  4DTS A;  1EX4 A;  4AQY K;  2Q31 A;  1D5A A;  4KHY A;  2QWR A;  4R5P A;  4N76 A;  1ATS A;  4BRQ A;  3HM8 A;  2F7T A;  4ZTJ A;  5TKY A;  2YJF A;  3E9P A;  4NXN K;  4KH4 A;  5CYM A;  2G8I A;  1SQK A;  4O5F A;  1BO5 O;  1IKY A;  4DV3 K;  3LDS A;  3MX5 A;  1SZ2 A;  3EL2 A;  2WC9 A;  2E2O A;  1S1V A;  2D0A A;  3DM2 A;  3VTI A;  4J2A A;  2OCE A;  5KI6 A;  4GMJ B;  4A5B A;  4B1Z A;  4G1Q A;  3RRH A;  3UKU A;  4FWO A;  4CES A;  3CJ1 A;  1NMD A;  2P9N A;  4FWK A;  3VEX A;  2BTF A;  3NF7 A;  3SYZ A;  1IG8 A;  2IVO A;  3LP3 A;  3FZM A;  2Y1J A;  4JN4 A;  3HRG A;  2OZM A;  1T3V A;  2HOE A;  3AAQ A;  4EP5 A;  3K5M A;  5CY4 A;  5JS1 A;  1NKE A;  3WNH A;  2GWJ A;  3WXL A;  4GV3 A;  5D3G A;  5AR0 A;  1KVC A;  2Z1J A;  3P31 A;  4KHS A;  1VQP N;  4HUE A;  3VQD A;  3F2K A;  4FLY A;  2HHT A;  5AQN A;  2YNF A;  2HHW A;  4X62 K;  4JRQ A;  3MN7 A;  3TAR A;  2A41 A;  4E7K A;  1BQN A;  2XHB A;  2A1S A;  1YJ9 N;  3CET A;  1NGJ A;  1JLB A;  3H1V X;  2VGM A;  1XNQ K;  2YNG A;  4DQR A;  4DTP A;  4M3Y A;  1YIT N;  1TAQ A;  5AQX A;  4CZG A;  4B9V A;  4BC5 A;  4DTR A;  1U47 A;  3JXU A;  4CD3 A;  1OVY A;  4BRD A;  4BGA A;  3NH0 A;  2YX6 A;  4DF4 A;  3KK7 A;  3LL3 A;  4DTO A;  3PY8 A;  3I8B A;  4AHC A;  5BN8 A;  5AQZ A;  4DLE A;  3P1G A;  4R79 A;  3KZB A;  2I7P A;  1NU0 A;  3J7Y P;  3E1Y A;  1WSF A;  2ASM A;  4EZ6 A;  4UY8 O;  3ZET B;  1IBM K;  3LWL A;  4CJF A;  3LDP A;  5J2M A;  3LZI A;  1JCG A;  4CHN A;  4OLA A;  3AAR A;  2E6L A;  2PBD A;  3O1B A;  4B9Q A;  3C7N B;  3L6Q A;  4CHZ A;  4M3X A;  1SV5 A;  3AA3 A;  1ZC6 A;  4ICL A;  3C6A A;  3RMD A;  4JKA A;  2NRT A;  5JLF A;  4DS5 A;  4H5N A;  2NRV A;  1B9F A;  4CJU A;  2E2Q A;  1QHT A;  1HPZ A;  5J1E A;  3U9D A;  4B3T K;  3GL1 A;  4FJJ A;  3KLI A;  1WAF A;  4O0J A;  3QBX A;  4JI8 K;  5GIO A;  4HUG A;  3CMA N;  5M1K A;  1K73 O;  3O3H A;  4GV9 A;  3ZT4 A;  1CXU A;  4WE1 A;  3VF6 A;  4ISF A;  2VG7 A;  1C0M A;  3E01 A;  3J8A A;  1NK9 A;  4DSK A;  4H0X B;  4HVJ A;  4AHV A;  2QK9 A;  3EYZ A;  4OKJ A;  3H08 A;  3FE1 A;  2HVH A;  4BG9 A;  2NRH A;  1NJW A;  3BEX A;  1ILY A;  2P9L A;  1IV0 A;  4FJG A;  4N41 A;  3P83 D;  5AQP A;  1HNV A;  4CFB A;  2ATQ A;  1EKE A;  1S1W A;  2GWK A;  3AVI A;  2VQF K;  4DFJ A;  3A5O C;  3NVM A;  2FSK A;  1WUA A;  2ASO A;  3BF1 A;  2YKN A;  4MLH A;  4WQ5 A;  4IFV A;  2F9T A;  3EKS A;  3D45 A;  1SKS A;  2HBJ A;  4CF1 A;  1YTU A;  5C15 A;  4CZM A;  4E19 A;  3LDO A;  2JLE A;  3GBT A;  5JVG L;  4JI1 K;  4DTJ A;  2OPS A;  4BC4 A;  5LMN K;  3NE6 A;  4ID5 A;  4IKF A;  3H6E A;  5KPR A;  2ITM A;  4CZL A;  4BAC A;  3LDN A;  3K0S A;  5C2F A;  2AJQ A;  3TAF A;  1W0H A;  1T8E A;  3VTH A;  1DLO A;  2B5J A;  3AVK A;  4CJQ A;  2ETJ A;  4BDZ A;  2HHX A;  1VRT A;  4CZI A;  4M42 A;  3C6U A;  3D2F A;  3AGR A;  3ULE A;  3VEZ A;  3ZT1 A;  4BG8 A;  2J4R A;  4FVM A;  3SJJ A;  3PX4 A;  3T1Y K;  1IG9 A;  1S72 N;  4JS5 A;  3HK2 A;  5KRS A;  3VEO A;  3DLR A;  3R3L A;  4DQS A;  4H5W A;  4ELT A;  3M3Z A;  4BC2 A;  3QB0 A;  3CCQ N;  1QZ5 A;  4DUZ K;  1VAZ A;  3SQ1 A;  2F8T A;  2RF2 A;  4K42 A;  5M1Q A;  3EE9 A;  4FLZ A;  3WEE B;  3A5L C;  2OYQ A;  3KK2 A;  4FM2 A;  4FOE A;  2VQE K;  3QBW A;  4H0Y B;  4YNQ A;  2HHS A;  1Q18 A;  1VSM A;  3D7E O;  4BRH A;  2D0B A;  5M1F A;  3OY9 A;  3PO4 A;  5AQT A;  4QOZ B;  3FZF A;  3VQP A;  4KHN A;  4K0K K;  4BR9 A;  2NLX A;  3PO5 A;  2NUB A;  1Y64 A;  3ZX0 A;  1ZXO A;  1UA1 A;  1MWM A;  4U7B A;  1I39 A;  3ZT3 A;  5AQW A;  2FBT A;  3OJU A;  3P4I A;  2QI2 A;  1CZ9 A;  3D2E B;  1TUU A;  3CYM A;  1NK4 A;  2P9K B;  3LDL A;  4CGJ A;  4CF8 A;  3WXM B;  4AHR A;  1IO2 A;  3PX6 A;  2YCH A;  4BRM A;  5FPD A;  3H3O B;  4BRA A;  4YY3 K;  2VG6 A;  2G8U A;  2RN2 A;  4N47 A;  4M63 C;  1RDU A;  2E1Z A;  2OPR A;  3RRG A;  1NK6 A;  4KB1 A;  3CD6 N;  3OYN A;  1W9H A;  3O4Q A;  3VQE A;  4CEZ A;  4CFA A;  1LAV A;  4BWM A;  3BZK A;  1K9M O;  3RR7 A;  1U4B A;  3LAK A;  2V7Y A;  1L3S A;  2NRR A;  5FPN A;  5CR4 A;  1RFQ A;  2UUB K;  3L2Q A;  2P9U B;  3ZYY X;  4CGH A;  3HOS A;  3MWT A;  3CJ7 A;  2QTD A;  4KTZ A;  4RCH A;  3TSP A;  5AQY A;  4E3S A;  1C0G A;  3WQT A;  2VWJ A;  5JLH A;  1Z05 A;  4EZ9 A;  3J81 O;  4AF1 A;  1DTT A;  2X74 A;  3SUQ A;  1FK9 A;  1ZBU A;  3GDQ A;  4CEC A;  3FGU A;  1KRP A;  1FJG K;  1TAU A;  5LY3 A;  4H03 B;  3E9O A;  3M5R A;  3ID8 A;  1GOB A;  4KRF A;  2X78 A;  3THW B;  3QNN A;  3MN6 A;  3OW2 M;  1QE1 A;  2HBM A;  5C2D A;  5AQF A;  1TYQ B;  4AH9 A;  1RBS A;  2WBN A;  4RW8 A;  3DLE A;  4CJW A;  3FFK B;  3PIO L;  4GV6 A;  4CBW A;  4FLU A;  4FO0 A;  5AQO A;  2OPQ A;  1WSI A;  2DPN A;  3KLF A;  4K25 A;  3ITH A;  5AQU A;  3WXK A;  3BUZ B;  2ZGZ A;  4AM7 A;  5HP1 A;  1C1A A;  3WNF A;  3R1X A;  3NHG A;  3NDK A;  5FRO A;  1S3X A;  4X64 K;  3QES A;  3AA5 X;  4HCC A;  4BR7 A;  1RDB A;  2ZE2 A;  3SK3 A;  2V52 B;  2Z1G A;  3C94 A;  4PA1 A;  3QIP A;  1SUQ A;  5I42 A;  2Q1N A;  4DV7 K;  3KKR A;  2DFH A;  3EKU A;  1GLJ O;  1Y97 A;  4DFM A;  1YIJ N;  3RR8 A;  4B8C A;  3H46 O;  1SAZ A;  3PUF A;  3RWU A;  3SMP A;  3HPH A;  2QWO A;  5AZJ B;  4FK4 A;  3KHY A;  5DM7 L;  3AO5 A;  3HOT A;  3ISN C;  3ZSO A;  1A5X A;  1HX1 A;  1YT3 A;  4I6M A;  2NZT A;  1B9D A;  2HF4 A;  1LAW A;  1MA9 B;  2HW3 A;  4YFU A;  3HPO A;  3ZET A;  2F9W A;  1KXP A;  4NYF A;  3V9Z A;  4DU3 A;  3IMX A;  5KGW A;  4CFC A;  4A61 A;  4F4K A;  3OYM A;  1YAG A;  3VQB A;  1N8R O;  1SKW A;  3TPQ A;  4BR2 A;  4OPH A;  3GG4 A;  1HKC A;  4FXD A;  3MEE A;  5C0Y A;  3VQA A;  3ASM A;  3CCE N;  2HNZ A;  3AVC A;  4IG0 A;  5LJV A;  2XY5 A;  3O3G A;  4OGE A;  4TSX A;  1WSE A;  3U4L A;  4LF8 K;  1RTD A;  3AVG A;  3VN5 A;  2D0C A;  1C0F A;  3LP0 A;  4KFB A;  2Q0R A;  3Q7B A;  3CCR N;  4HUF A;  2G8W A;  2NNW A;  3M6G A;  5HRS A;  4MDB A;  1ZYQ A;  5EOY A;  3F5T A;  1TK8 A;  4MO5 A;  4KI6 A;  5AQK A;  1I3A A;  4I9Q A;  4ID1 A;  3KD5 E;  3ZSY A;  2D1K A;  4WF9 L;  4JK7 A;  3WUH A;  4KAZ A;  3VQ7 A;  3NH1 A;  3PSF A;  4ILG B;  3ZCM A;  3I56 N;  2BUP A;  4LFC K;  2X6S A;  1TYQ A;  2CGL A;  4ELU A;  4M3W A;  1NLV A;  3F73 A;  1K8A O;  4BRL A;  2H3G X;  5EX5 A;  1K8K A;  3HP6 A;  4QS9 A;  4EFH A;  1JLA A;  5SWM A;  4DTM A;  4E1N A;  3KWI A;  4NCG A;  3ALY A;  4XH1 A;  3HO1 A;  2V51 B;  3UIQ A;  4B08 A;  4BRP A;  2ZM6 K;  3VMF B;  1UOC A;  1NM1 A;  1MDU B;  3HXM A;  5C12 A;  3A5M C;  3JAM O;  4FZX C;  4Z4H A;  2HST A;  1C1C A;  2FXU A;  4RWT A;  1NGF A;  3T1A A;  4DSF A;  3VQ8 A;  5GAH P;  3TAE A;  1X3N A;  1W2B M;  2E1Y A;  2GUP A;  4C8K A;  4CEQ A;  3L4Q A;  4JKF A;  3QEP A;  3SZ2 A;  1EP4 A;  3I55 N;  1TK0 A;  2BH1 A;  4AM6 A;  1OH5 A;  1BL3 A;  3AVB A;  2O4I A;  4IXC A;  1CXQ A;  1BOT O;  4J2E A;  2NRX A;  1B92 A;  1QHA A;  4BRI A;  3CCU N;  2P9K A;  3K5O A;  4B9L A;  3FR0 A;  3K59 A;  1L3V A;  1MWK A;  4CBX A;  3IDH A;  5EVZ A;  1RDW X;  1C0U A;  4OPJ A;  4F3T A;  4LD0 A;  4ILJ A;  3OVN A;  2W6L A;  4W5T A;  1XNR K;  5AQG A;  3AVM A;  4E89 A;  1K8K B;  4L3Q A;  3Q7C A;  5ADX A;  4A62 A;  3NF6 A;  4LF9 K;  1VQ8 N;  3S3M A;  3ULD A;  3K2P A;  1JXE A;  4M45 A;  1XMQ K;  4CED A;  3NF9 A;  2XY6 A;  3AGK A;  3T19 A;  4CIG A;  1BGX T;  4B9T A;  3OYD A;  2QW9 A;  3K9K A;  3EE8 A;  1BCO A;  2IVP A;  3TTC A;  1DGK N;  1GLD G;  3BDP A;  2P9U A;  5DM6 L;  3OA9 A;  1Z25 A;  1YVN A;  5SZT A;  1GLE G;  3CQY A;  3SLC A;  3QNO A;  2G8F A;  3ENB A;  3AO4 A;  5CHI A;  3UKU B;  4KTW A;  3HI0 A;  3U3G A;  1QVF M;  3I33 A;  1Z6R A;  3OYH A;  1UWB A;  5TKW A;  3CC4 N;  2ZGY A;  4XH4 A;  1D8Y A;  3CQX A;  2B4J A;  1BWF O;  4LH4 A;  3OYC A;  4FJK A;  4IWV A;  3JSM A;  3MEG A;  3K58 A;  2Z1H A;  3VPZ A;  4JAX A;  1VQ4 N;  4OKE A;  2ASP A;  3O6W A;  1KFS A;  4CK3 A;  4JI4 K;  4FWQ A;  1RNH A;  3SQ4 A;  5C25 A;  2FBV A;  3ZX3 A;  4B9M A;  2B6A A;  2RPI A;  4CFD A;  1S22 A;  1XUP O;  4EP4 A;  5AQJ A;  1WB9 A;  1M1K O;  3DMJ A;  3V1Q A;  2QWM A;  5HRN A;  1M90 O;  3P38 A;  2QWL A;  3MMV A;  1RT2 A;  2X6N A;  3ENH A;  1NGE A;  4CF2 A;  4CK1 A;  3THX A;  3WEE A;  1VQL N;  2VCP A;  3TAP A;  3VGL A;  3J80 O;  2RHK A;  4C8N A;  4I7F A;  3ZT0 A;  3HL8 A;  3OYA A;  1NMN A;  3DAW A;  4RW6 A;  1W7A A;  3QEW A;  4YOY A;  1JL2 A;  4AHU A;  3CCL N;  3O3F A;  4ISE A;  1F21 A;  1S6P A;  3EY1 A;  4HCB A;  1KTQ A;  4CEB A;  4HTU A;  1D9F A;  4O5B A;  4BE0 A;  4O55 A;  4DV6 K;  3SQ2 A;  1HYS A;  3IUC A;  5JIC A;  1U04 A;  3NGY A;  4JI0 K;  3QIN A;  2UYT A;  3D0P A;  2YHA A;  1U6Z A;  4OKK A;  1RDC A;  2VG5 A;  3TR8 A;  3IRX A;  4I9L A;  4JI7 K;  3AVN A;  3C95 A;  3MAQ A;  4JYA K;  1DEJ A;  1JJ2 M;  2D0O A;  4JKG B;  3OTO K;  5BPM A;  1VQM N;  4CGG A;  4DQI A;  3HYF A;  4C23 A;  5J2P A;  4LF6 K;  2W40 A;  1WSG A;  1N5Y A;  1KLN A;  4IFE A;  1GOA A;  4B3R K;  1IKW A;  3C7N A;  5AQQ A;  4BVP A;  2PAV A;  4CHY A;  1P8Z A;  5BR8 K;  4BWJ A;  1J54 A;  4CJK A;  1SL0 A;  4DV4 K;  1T44 A;  1VQ6 N;  4IJA A;  4K8Z A;  1YXQ A;  5AQL A;  5KGX A;  3L3U A;  1IKV A;  5BPN A;  1NNE A;  1CZA N;  3OYL A;  1RTJ A;  4WQ5 C;  1TUY A;  3VQQ A;  3ZSX A;  1YJN N;  5KQ8 A;  4Y1C A;  2CH6 A;  4FZZ A;  4FLW A;  3O9U A;  1YI2 N;  1OVQ A;  5KPT A;  2ITG A;  3QET A;  4H5T A;  3VQ5 A;  4DFK A;  4DWI A;  1K6Y A;  4DR4 K;  4FJN A;  4DTN A;  2OA8 A;  3SBG A;  3MN9 A;  4FW1 A;  4Y0W A;  1NBW A;  3E66 A;  4JI5 K;  1RT5 A;  1S1T A;  1WBB A;  3LM9 A;  4JEP A;  4NXM K;  1N6Q A;  1EQY A;  1VSE A;  1GLA G;  1WBD A;  1T6C A;  3OYG A;  3QIO A;  1U45 A;  1TKT A;  4JK9 A;  2KFZ A;  3CPE A;  4L8R B;  2CH5 A;  2IVN A;  1T6D A;  4KKO A;  1NKC A;  5EY4 A;  1H1V A;  3KD1 E;  3OYF A;  2QWQ A;  3W0L A;  3TWH A;  4A57 A;  3ENO A;  4H0V B;  3DRR A;  1R59 O;  2QXF A;  1KVA A;  4M7Y A;  4JHD A;  4C8O A;  1GLC G;  3LP2 A;  2WFB A;  3FZK A;  3OYK A;  4M3R A;  3V4I A;  2XRI A;  2HHH K;  3MCA B;  5FDL A;  3ATU A;  4Z0U A;  3QO9 A;  1XHX A;  1TK5 A;  3B8A X;  1RTH A;  2JGU A;  4FW2 A;  3QEX A;  1N33 K;  3K5L A;  4YDU A;  1P90 A;  3TTD A;  3FLC O;  4MO4 A;  3LP1 A;  4Z4E A;  4QS8 A;  5HRR A;  2KFN A;  3NMU A;  1C6V A;  4CHP A;  1CLQ A;  1HPM A;  4FSV A;  4KI4 A;  1VSJ A;  3V9X A;  1Q9X A;  4CJ7 A;  5BRE A;  1S1U A;  3AVL A;  2UU9 K;  2W41 A;  4IDH A;  1Q8I A;  5H1S Q;  5J2Q A;  4DR5 K;  1OH6 A;  4F3O A;  5M1P A;  2A40 A;  3V9U A;  4V19 S;  1VSK A;  3M1F A;  2O8C A;  1CZB A;  1Q7Y O;  2G8K A;  1VSD A;  1O1W A;  2YKM A;  4HWI A;  3VF4 A;  3IFR A;  5KTQ A;  3CFO A;  1UA0 A;  4OPA A;  5MLC Q;  5IWA K;  3KTQ A;  4FOI A;  1HQU A;  1VQ5 N;  3NBP A;  2YNH A;  2HNY A;  3P5J A;  3S41 A;  1LWE A;  5AQH A;  1WLJ A;  3IS9 A;  3LZJ A;  1VQO N;  3KLG A;  4CER A;  1ESV A;  2O8E B;  1QVG M;  4FJX A;  2FF3 B;  4Z4C A;  4WCE L;  4CHO A;  3G25 A;  1NGG A;  1D9D A;  2P9P A;  4CZK A;  1DTQ A;  4JLH A;  1MU2 A;  3ZSR A;  3F9M A;  2UUC K;  4DQQ A;  4DU1 A;  2YV0 X;  2A42 A;  1SKR A;  1NWK A;  2P1J A;  1ZBH A;  4IFY A;  2ZQB A;  1KAY A;  2KKZ A;  1IBK K;  2UXD K;  4UQG A;  2G8V A;  3EZ5 A;  2HMI A;  4CGF A;  1ATN A;  2E20 A;  4FJ7 A;  3HT3 A;  4MLE A;  4I2P A;  4EHU A;  1BA0 A;  1A5V A;  2GEM A;  3QFP A;  2BE2 A;  4LC9 B;  2E2P A;  3IAY A;  4NCB A;  4CHQ A;  1NGC A;  4PHT X;  5BRD A;  1LOT B;  4E7L A;  2QEX N;  3A8Y A;  3VET A;  3CI5 A;  1J5E K;  4WFA L;  1GLB G;  4Z4G A;  3KWG A;  3QDK A;  4CJT A;  4PKH A;  3SBT A;  3NAE A;  5AFU A;  4CF0 A;  2A6A A;  3LPT A;  3THX B;  4BRN A;  2F4V K;  2Z1I A;  2I7N A;  3O5B A;  4BDP A;  4DV5 K;  3QER A;  4K8X A;  5AFU H;  1O13 A;  3CCM N;  3K5N A;  2Y1I A;  4YDU C;  1QQN A;  3ZSW A;  1QSL A;  1ZBL A;  3PX0 A;  3THY B;  1X1P A;  4Z4I A;  4IO9 L;  4BRC A;  1QQC A;  4M7X A;  2P9I B;  4PWD A;  2O8B B;  1X3M A;  2IDO A;  1VQ9 N;  3DLB A;  2VWB A;  3T1H K;  4BRE A;  3T3F A;  1SL2 A;  1JCF A;  3DXK B;  4DU4 A;  1YHQ N;  5GAD P;  2FBX A;  2YHY A;  4LF7 K;  3C0B A;  3NCI A;  3I0S A;  1NK0 A;  3L2U A;  4CZF A;  1WSH A;  2P9N B;  4ISG A;  4W5Q A;  1XC9 A;  4ILH A;  2HBK A;  4B1Y B;  4CK2 A;  3M8S A;  3ZEU A;  3VGK A;  5HLF A;  2W6K A;  2P9L B;  1NK7 A;  2BGG A;  5DMR A;  3ZSZ A;  2IC3 A;  2RE2 A;  3TSU A;  4NYN A;  3SI6 A;  3CPW M;  1J53 A;  2QXL A;  1W97 L;  2QA4 N;  1Q9Y A;  1VSL A;  2O8D A;  1I94 K;  4O4G A;  1EET A;  5AQV A;  1HKG A;  1ASV A;  2QWN A;  2GUI A;  5ELZ A;  1ZBI A;  2PY5 A;  4RW7 A;  3PLA A;  5BPL A;  1SL1 A;  4I2Q A;  3U8X A;  3BF3 A;  1BHL A;  2WOM A;  1XHZ A;  1QZ6 A;  3RVC A;  1JLF A;  3G6E N;  2ZWH A;  3CG7 A;  1ASW A;  2PZS A;  4E7H A;  4BRO A;  4FWS A;  3MN5 A;  4IOA L;  2HMP A;  1TKZ A;  2QKB A;  2Q36 A;  3C6T A;  3NGI A;  3CIP A;  3H3N O;  4PKG A;  2Q2R A;  3OJS A;  5FPE A;  4M3T A;  3LWM A;  3K57 A;  1YTA A;  1HNW K;  2A1R A;  1SS6 A;  4EIA A;  4B3M K;  1NGH A;  3VA0 A;  3SNN A;  3O4N A;  3R8E A;  3FZL A;  3O08 A;  2G8H A;  4H0O A;  4FPA A;  3B6O A;  3TAM A;  4CCH A;  4BR5 A;  3DRP A;  2RKI A;  4DUY K;  1D4X A;  3L2V A;  3KK3 A;  2OPP A;  1X9M A;  5KRT A;  2F8S A;  3RTV A;  4H5V A;  2GV9 A;  1WOQ A;  3O1W A;  3OHR A;  3ZSQ A;  2XO7 A;  3T7Z A;  4FWN A;  4DR2 K;  4DS4 A;  3EZW A;  1WAJ A;  4O0I A;  4JRP A;  1HNX K;  3V9W A;  4Y1D A;  1T05 A;  3DLH A;  1RT3 A;  3S3O A;  3VQC A;  2O4G A;  4YOV A;  1REV A;  2EWS A;  4H8K A;  5E84 A;  3KLH A;  5IT9 O;  3CME N;  2VYP A;  1EXQ A;  5BN9 A;  3LAL A; 
#chains in the Genus database with same CATH homology
 3ENH A;  1NGE A;  4BVO A;  3VTH A;  2ZJP L;  4J8F A;  4CBU A;  1GLL O;  3N4P A;  3WEE A;  1VQL N;  2VCP A;  3VGL A;  1HLU A;  4CZE A;  3N4Q A;  1VQK N;  2RHK A;  4CZI A;  3DAW A;  3D2F A;  3QML A;  2CGJ A;  3AGR A;  2V7Z A;  4YOY A;  4MDA A;  4BY9 C;  2KHO A;  3UKR A;  3ULE A;  4WYB A;  3VEZ A;  4H0T B;  3CCL N;  1BU6 O;  4BG8 A;  2J4R A;  2QM1 A;  4ISE A;  1KD1 O;  3G71 N;  5BR9 A;  3CXC M;  1S72 N;  4JK8 A;  3TU5 A;  3VEO A;  3R3L A;  4H5W A;  3M3Z A;  5E26 A;  4BC2 A;  3QB0 A;  3HTV A;  1G99 A;  1LCU A;  1QZ5 A;  4IEE A;  2YHW A;  1VAZ A;  5EXW A;  1E4F T;  3VEY A;  2OTJ N;  5KQD A;  3PIP L;  4OO1 J;  1QQM A;  3IUC A;  5JIC A;  4K42 A;  5M1Q A;  3EE9 A;  5F2R A;  4BRK A;  3RSE A;  3WEE B;  1NGB A;  2P9S A;  3A5L C;  5HOO A;  2UYT A;  4FOE A;  1J6Z A;  1U6Z A;  1Q82 O;  5I9E B;  1NGA A;  3QBW A;  3O9T A;  2QWP A;  4H0Y B;  2OTL N;  1JCE A;  1Q18 A;  1QQO A;  4CZH A;  3D7E O;  2FF6 A;  4BRH A;  4JHD B;  5AZI A;  3VF2 A;  5M1F A;  3MWP A;  5AQT A;  1KAX A;  3ATV A;  1DEJ A;  3FZF A;  1JJ2 M;  2D0O A;  4JKG B;  3CCQ N;  4BR9 A;  2NLX A;  2FSJ A;  5BPM A;  1VQM N;  1Y64 A;  3ZX0 A;  1ZXO A;  3QIC A;  3ZX2 A;  4C23 A;  4GNI A;  1MWM A;  4U7B A;  1KQS M;  2W40 A;  4KBO A;  3SMS A;  4IOX A;  5AQW A;  2AP1 A;  4BQL A;  3CJB A;  2KLA A;  3P4I A;  4IFE A;  1BDG A;  3NVK A;  2QI2 A;  3R6M A;  4O8U A;  4NO7 A;  3UE5 A;  3C7N A;  5AQQ A;  3D2E B;  4G9Z A;  1TUU A;  4DB3 A;  3HSC A;  4BVP A;  3DXM A;  4IZ9 A;  3MCP A;  2P9K B;  3LDL A;  3O8M A;  4DCH A;  2PAV A;  1P8Z A;  3O80 A;  3WXM B;  4IEI A;  1BUP A;  4DQ8 A;  3A0I X;  3VEW A;  4JD2 A;  5BRF A;  4FPB A;  3ZEU B;  2YCH A;  4BRM A;  5FPD A;  4C1N K;  1T44 A;  3H3O B;  3U9Z A;  1VQ6 N;  3LDQ A;  4BRA A;  3O9R A;  4KH6 A;  3SAH A;  4K43 A;  4IJA A;  5GIP A;  4WQ4 C;  1YXQ A;  5AQL A;  4B1U B;  3VEV A;  4M63 C;  1RDU A;  5BPN A;  1YJW N;  1CZA N;  2E1Z A;  4WQ5 C;  3CJC A;  1TUY A;  2VGN A;  2YI1 A;  3P39 A;  3CD6 N;  3D2E A;  3OBW A;  1NGD A;  3VEN A;  4JKD A;  5JVH L;  1DT9 A;  3E9L A;  4FWR A;  2OAN A;  1YJN N;  4JKH A;  3UB5 A;  5KQ8 A;  2CH6 A;  3A5N C;  1YI2 N;  3O9U A;  4WFB L;  5KPT A;  4H5T A;  1K9M O;  3CJ9 A;  1U2V B;  1YUW A;  1DKG D;  1XC3 A;  3O9S A;  4O8K A;  4PKI A;  3VOV A;  2V7Y A;  2NRR A;  5FPN A;  5CR4 A;  1RFQ A;  4BQZ A;  3SBG A;  3MN9 A;  2P9U B;  3ZYY X;  4Y0W A;  3QFU A;  3HOS A;  3MWT A;  3CJ7 A;  2QTD A;  4QS7 A;  1NBW A;  3E66 A;  4JKE A;  4RTF D;  3BP8 A;  4FWL A;  4RCH A;  2IIR A;  4PL7 A;  4IJN A;  5C10 A;  3TSP A;  5AQY A;  1V4S A;  3LM9 A;  3VER A;  1C0G A;  3WQT A;  4JEP A;  5M1N A;  3MX2 A;  1ATR A;  5JLH A;  1EQY A;  4DHY A;  1GLA G;  4DKW A;  3CCV N;  1T6C A;  1Z05 A;  4IOC L;  4AF1 A;  3DXK A;  2E88 A;  4JK9 A;  4A2A A;  3TSQ A;  3CER A;  3GDQ A;  3MK6 A;  3FGU A;  3CPE A;  4EHT A;  4WFN L;  4FVU A;  3O4W A;  2CH5 A;  2IVN A;  3EN9 A;  1T6D A;  5ADX H;  2ZJR L;  3CCJ N;  5BRH A;  2ZJQ L;  4BGB A;  1YF5 L;  1U2V A;  4I6M B;  5EY4 A;  1H1V A;  3C65 A;  4H03 B;  5LY3 A;  1EO1 A;  2QWQ A;  3E9O A;  3M5R A;  2GX9 A;  3ID8 A;  3W0L A;  4A57 A;  3D6R A;  3ENO A;  4H0V B;  5GAG P;  3MN6 A;  1R59 O;  3OW2 M;  1Q86 O;  1HKB A;  2HBM A;  5C2D A;  4NLB A;  3EO3 A;  4M7Y A;  4JHD A;  3L0Q A;  5AQF A;  5AZI B;  4C1N I;  1TYQ B;  1GLC G;  3G4S N;  4A59 A;  2WBN A;  2WFB A;  3FFK B;  3FZK A;  3PIO L;  4GV6 A;  4CBW A;  4FO0 A;  5AQO A;  1NGI A;  3MCA B;  2DPN A;  3ATU A;  3CC2 N;  3SAF A;  3RSE B;  4K25 A;  5AZJ A;  3H1Q A;  3B8A X;  3W3D A;  5AQU A;  3WXK A;  4JKB A;  5JMV A;  3BUZ B;  2ZGZ A;  4AM7 A;  3R1X A;  5AQM A;  1S3X A;  4BC3 A;  3T69 A;  1RGI A;  4BR7 A;  4YOU A;  3SK3 A;  4YDU A;  1P90 A;  3DWL A;  3TTD A;  2WUS A;  4NB4 A;  3FLC O;  2V52 B;  4MO4 A;  2D0P A;  4B1W B;  4QS8 A;  2FSN A;  2Q1N A;  3LM2 A;  4CZJ A;  3NMU A;  3EKU A;  5AQI A;  3ULE B;  1GLJ O;  1HPM A;  2D4W A;  4FSV A;  1YIJ N;  4CI6 A;  4CJ7 A;  5BRE A;  5GIN A;  4F9O A;  3H46 O;  1SAZ A;  1KAZ A;  2W41 A;  5GAE P;  4IDH A;  1OKJ A;  5H1S Q;  4FL9 A;  2A40 A;  2YHX A;  5M1P A;  3SMP A;  2QWO A;  4WQ4 A;  5AZJ B;  2Q31 A;  3M1F A;  3CJA A;  3KHY A;  5DM7 L;  1Q7Y O;  3HOT A;  3WT0 A;  2HBL A;  2QWR A;  1HX1 A;  1ATS A;  4HWI A;  2NZT A;  3IFR A;  4I6M A;  5AQS A;  3L4I A;  3VF4 A;  4BRQ A;  2HF4 A;  3HM8 A;  4OPA A;  5MLC Q;  1MA9 B;  2F7T A;  5TKY A;  2YJF A;  3E9P A;  4B1V A;  4FOI A;  1VQ5 N;  4KH4 A;  3S41 A;  2F9W A;  1KXP A;  1E4G T;  1SQK A;  2GTD A;  2HF3 A;  4O5F A;  3ZET A;  3IMX A;  1BO5 O;  5AQH A;  4GVE A;  4A61 A;  3MX5 A;  1SZ2 A;  1YAG A;  3EL2 A;  1VQO N;  1N8R O;  3D2F B;  3TPQ A;  4BR2 A;  2WC9 A;  2E2O A;  4YOX A;  4OPH A;  3GG4 A;  1ESV A;  1HKC A;  3VTI A;  1QVG M;  3CHW A;  2FF3 B;  2Q0U A;  5C0Y A;  4WCE L;  3G25 A;  1NGG A;  3CCE N;  4A5B A;  3SAG A;  4B1Z A;  3UKU A;  1IJJ A;  2P9P A;  4FWO A;  4CZK A;  5LJV A;  3CJ1 A;  1NMD A;  2P9N A;  4FWK A;  3F9M A;  1BA1 A;  3VEX A;  2BTF A;  5M1O A;  4JKC A;  4K41 A;  2A42 A;  1IG8 A;  2IVO A;  1NWK A;  3U4L A;  3FZM A;  1KAY A;  2KKZ A;  4JN4 A;  3HRG A;  1ATN A;  1T3V A;  1C0F A;  2E20 A;  2HOE A;  3AAQ A;  2Q0R A;  4KH5 A;  4MLE A;  3Q7B A;  3CCR N;  2NNW A;  3M6G A;  1BA0 A;  4MDB A;  4EHU A;  1NJI O;  3FZH A;  2GEM A;  5EOY A;  3MDQ A;  3F5T A;  3QFP A;  4LC9 B;  2GWJ A;  2E2P A;  4MO5 A;  5AQK A;  3J7Z O;  3WXL A;  4GV3 A;  5AR0 A;  3R9P A;  1NGC A;  4PHT X;  4GY2 B;  3P31 A;  5BRD A;  1LOT B;  1VQP N;  2QEX N;  3A8Y A;  3VET A;  2D1K A;  4WF9 L;  3CI5 A;  3F2K A;  4JK7 A;  1GLB G;  3WUH A;  3KWG A;  5AQN A;  4WFA L;  3CCS N;  3QDK A;  4PKH A;  3SBT A;  4U67 L;  2AA4 A;  5AFU A;  3MN7 A;  4ILG B;  2A41 A;  2A6A A;  3I56 N;  3CF5 L;  2BUP A;  4BRN A;  4JKG A;  1TYQ A;  1YJ9 N;  3CET A;  1V4T A;  2CGL A;  2I7N A;  1ZBS A;  3O5B A;  1NGJ A;  3WXJ A;  3CC7 N;  5AFU H;  3H1V X;  1NLV A;  1O13 A;  1XQS C;  2VGM A;  3O9Q A;  2H3G X;  5EX5 A;  1K8K A;  3SJH A;  4BRL A;  3CCM N;  4IO8 A;  3DJC A;  3GOI A;  3H45 C;  1QQN A;  4YDU C;  4H0P A;  4QS9 A;  5AQX A;  4A2B A;  1YIT N;  4CZG A;  2JWK A;  4EFH A;  4BC5 A;  3JXU A;  3K9J A;  3OBY A;  4B1X B;  2FLO A;  4CD3 A;  4IO9 L;  3KWI A;  3GE1 A;  4BRC A;  1OVY A;  4BRG A;  4BRD A;  4M7X A;  4BGA A;  2P9I B;  4XH1 A;  3VGM A;  1K8A O;  1X3M A;  2V51 B;  1VQ9 N;  2YX6 A;  2VWB A;  4BRE A;  3KK7 A;  3LL3 A;  1JCF A;  3DXK B;  4BRF A;  4BRP A;  1YHQ N;  2CGK A;  5GAD P;  1Q81 O;  4FWP A;  2YHY A;  3C0B A;  3I8B A;  3VMF B;  5BN8 A;  4Z94 A;  4CZF A;  1NM1 A;  1MDU B;  5AQZ A;  5B8H A;  5C12 A;  2P9N B;  4ISG A;  2NRW A;  4ILH A;  2HBK A;  3A5M C;  4B1Y B;  4R79 A;  3KZB A;  2I7P A;  2HST A;  2FXU A;  4RWT A;  1NGF A;  3E1Y A;  2ASM A;  4HTL A;  3VGK A;  3ZEU A;  4UY8 O;  2P9L B;  3ZET B;  5KPZ A;  5HL7 L;  5GAH P;  4BR0 A;  5CE3 A;  3LDP A;  1X3N A;  1JCG A;  2RE2 A;  3TSU A;  1W2B M;  3CPW M;  5FPM A;  2E1Y A;  2GUP A;  3AAR A;  2PBD A;  2QXL A;  1W97 L;  3O1B A;  3L4Q A;  4JKF A;  4B9Q A;  2QA4 N;  3C7N B;  3L6Q A;  4XEI A;  3I55 N;  2BH1 A;  4AM6 A;  2E8A A;  1ZC6 A;  2P9I A;  3AAP A;  1HKG A;  3C6A A;  5AQV A;  2QWN A;  4JKA A;  2NRT A;  1BG3 A;  5ELZ A;  4IXC A;  1BOT O;  5JLF A;  2NRX A;  1QHA A;  4H5N A;  4BRI A;  1GLF O;  2NRV A;  3PLA A;  3CCU N;  5BPL A;  5F0X A;  3U8X A;  2E2Q A;  2P9K A;  3BF3 A;  3FR0 A;  2A3Z A;  2P9S B;  4H5R A;  3U9D A;  2NRZ A;  1QZ6 A;  1HUX A;  3GL1 A;  2GEL A;  1MWK A;  3RVC A;  3IKM A;  4CBX A;  3KVG A;  2YJE A;  3IDH A;  5EVZ A;  3HBT A;  1RDW X;  4CD1 A;  2Q97 A;  1HJO A;  2A5X A;  3QBX A;  5GIO A;  3G6E N;  4ILJ A;  2ZWH A;  3CMA N;  4A5A A;  5M1K A;  5AQG A;  5F1X A;  1K73 O;  2PFU A;  4GV9 A;  1K8K B;  4L3Q A;  4BRO A;  4FWS A;  3MN5 A;  3Q7C A;  3WQU A;  4IOA L;  5ADX A;  2HMP A;  4YOT A;  3VF6 A;  4ISF A;  2Q36 A;  4A62 A;  1VQ8 N;  3CIP A;  3H3N O;  3TTF A;  3VES A;  5AQR A;  3J8A A;  4PKG A;  2Q2R A;  3JS6 A;  3UKR B;  1VQ7 N;  1VQN N;  5FPE A;  4EAH D;  3AGK A;  4H0X B;  1SS6 A;  2JWL A;  4EIA A;  2QW9 A;  4YOW A;  3K9K A;  1NGH A;  3EE8 A;  2IVP A;  3FE1 A;  3TTC A;  3R8E A;  1DGK N;  1GLD G;  2NRH A;  3FZL A;  3O08 A;  3BEX A;  4BG9 A;  1ILY A;  2P9U A;  5DM6 L;  2P9L A;  3OA9 A;  4H0O A;  2ZF5 O;  4JD2 B;  1YVN A;  1GLE G;  3CQY A;  5AQP A;  3SLC A;  3WXI A;  4FPA A;  4JNE A;  3ENB A;  4BR5 A;  5CHI A;  3UKU B;  3HI0 A;  2GWK A;  1D4X A;  3A5O C;  1QVF M;  3I33 A;  3NVM A;  2FSK A;  1WUA A;  5LJW A;  2ASO A;  1Z6R A;  3BF1 A;  4PL8 A;  5TKW A;  3C6H A;  4MLH A;  3CC4 N;  3DXM B;  4WQ5 A;  4E1J A;  4H5V A;  2ZGY A;  4XH4 A;  2F9T A;  3EKS A;  1WOQ A;  1X9J A;  3CQX A;  3O1W A;  1BWF O;  2P9P B;  3OHR A;  4FWM A;  2HBJ A;  3T7Z A;  4YOR A;  4FWN A;  4IWV A;  2E2N A;  5C15 A;  4CZM A;  3LDO A;  3EZW A;  3GBT A;  3HZ6 A;  4JAX A;  3VPZ A;  5JVG L;  1VQ4 N;  4XH5 A;  2ASP A;  3O6W A;  4BR4 A;  4BC4 A;  4FWQ A;  1KC8 O;  3ZX3 A;  4NLC A;  3H6E A;  1S22 A;  5KPR A;  2ITM A;  1XUP O;  4CZL A;  4YOV A;  5AQJ A;  2EWS A;  1M1K O;  5E84 A;  3LDN A;  2QWM A;  1M90 O;  3ID6 A;  3CME N;  2VYP A;  5C2F A;  3P38 A;  2QWL A;  3DLL L;  3MMV A;  5BN9 A;  3AY9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...