3AARA

Crystal structure of lp1ntpdase from legionella pneumophila in complex with amppnp
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
352
structure length
352
Chain Sequence
HSCIAVIDAGSTGSRLHIYSYDTDDTNTPIHIEEIWNKKIKPGFASIQPNSVTIDAYLTMLLADAPIHNIPVYFYATAGMRLLPQSQQKKYYDELEYWFRQQSQWQLVEAKTITGNDEALFDWLAVNYKLDTLKSVQNKSVGVMDMGGASVQIVFPMPKNAEISKHNQVELNIYGQNINLYVHSFLGLGQTEMSHQFLNSPSCFANDYPLPDGESGQGNAPSCKEEVTSLMNSVHKVNQQIQPLLALNPVNEWYSIGGISNLASSQLFHFENSELTNQSLLQQGDNQICHQQWDILNGQYPDDEYLYQYCLLSSYYYALMVDGYGINPNQTIHYIPPEQNLDWTIGVVLHRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Ectonucleoside triphosphate diphosphohydrolase I
publication title Crystal Structure of a Legionella pneumophila Ecto -Triphosphate Diphosphohydrolase, A Structural and Functional Homolog of the Eukaryotic NTPDases
pubmed doi rcsb
source organism Legionella pneumophila
total genus 111
structure length 352
sequence length 352
ec nomenclature
pdb deposition date 2009-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01150 GDA1_CD39 GDA1/CD39 (nucleoside phosphatase) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3aarA01
3.30.420.150 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Exopolyphosphatase. Domain 2 3aarA02
1GLAG 5AQUA 2GWJA 3FZKA 2D0OA 3M3ZA 1C0GA 1Z05A 2P9KB 4RTFD 5FPMA 2P9KA 4XEIA 3DXKB 2NZTA 3GBTA 2J4RA 1T6CA 1DKGD 1YXQA 3O6WA 5ELZA 3DXKA 1JCEA 1YAGA 1G99A 2A42A 4BC3A 3W3DA 2QM1A 5BN9A 4BG9A 3C0BA 4H0YB 3DXMB 4EHUA 3H6EA 2OANA 5BREA 2V52B 2ZGZA 4ISFA 5KPTA 3H1QA 3VESA 4BR7A 1GLBG 4BRKA 3HBTA 3KVGA 3ATUA 4BC5A 3EKSA 4BRMA 2E1ZA 4CD1A 2AP1A 4L3QA 3A5NC 5AQNA 3FE1A 3FGUA 3QMLA 3WEEB 5AFUA 4FWKA 2FSKA 3WEEA 4BVOA 2GUPA 3LDQA 1C0FA 3MN6A 4CBUA 5AQSA 2E8AA 4PKGA 2ITMA 1ESVA 3AY9A 4FSVA 3HM8A 3LDOA 4F9OA 4YDUC 3G25A 3DJCA 4QS8A 4BVPA 4B1WB 4EIAA 5AQQA 3O1WA 3UE5A 1J6ZA 1GLJO 3I33A 3L0QA 3L6QA 4NB4A 1E4GT 3ZX0A 5AQMA 1HKCA 3SMSA 4H03B 2CGJA 5CE3A 2FXUA 1ZXOA 3QB0A 4MLEA 3SJHA 4BC2A 2FSNA 3TU5A 2QWPA 5JLFA 1T6DA 4BRAA 4H0TB 3VENA 4JAXA 4H5TA 3KHYA 4M63C 2FSJA 2A41A 4YDUA 2GEMA 5EOYA 5JLHA 1TYQB 4CI6A 5JMVA 2BTFA 1TUUA 1TYQA 3H3OB 5AQRA 3IUCA 4A61A 4EHTA 4PKHA 4C23A 3LDNA 1ATSA 3O4WA 3U8XA 4BC4A 3QBWA 4WQ5C 2Q1NA 3VF2A 3LDPA 4BR5A 2W41A 3QICA 2BUPA 4CJ7A 3F9MA 4ISGA 3QBXA 4JN4A 3QFPA 1H1VA 5ADXA 1ATRA 3UKUB 3VEYA 3MN7A 3UKUA 1MWMA 4BRDA 1KAYA 2YHWA 1BA1A 3JXUA 5AQZA 3S41A 1WOQA 1BO5O 4PL8A 3ATVA 3IFRA 1T44A 3CI5A 1S22A 4JD2B 4EFHA 1NGGA 2E2OA 1K8KB 5LY3A 2P9IB 4JD2A 1JCFA 4WQ5A 1K8KA 4GNIA 3MN9A 3ULEB 2E88A 2Q0UA 5AFUH 3RSEB 1HKGA 3ULEA 5BR9A 4BRHA 3RSEA 3HI0A 2VWBA 4BR9A 3W0LA 2VCPA 1MA9B 2QWQA 4K41A 5AQXA 3EN9A 4IXCA 1X9JA 5F0XA 2P9LB 1ZC6A 4M7YA 4H5VA 4O8KA 2V51B 2P9LA 5E84A 2A6AA 2QWLA 3R8EA 3P4IA 1XUPO 4BROA 2E2NA 2DPNA 3AAQA 4BR4A 4FWOA 3WXJA 4QS7A 3DXMA 3O08A 4FOIA 4FWSA 3M6GA 3M1FA 4PL7A 3QFUA 3OHRA 1D4XA 1GLCG 2CH6A 4I6MB 2CH5A 4I6MA 4H5WA 5TKYA 4DHYA 5AQKA 3VEOA 4CZLA 2V7YA 2Q31A 1HUXA 2E1YA 2P9NB 3CERA 4EAHD 2D1KA 5FPEA 2P9NA 2I7PA 1NGEA 3H45C 1NGBA 1NWKA 1Z6RA 3ENOA 3O5BA 1X3NA 1HKBA 1ATNA 2ASOA 1XC3A 1QQMA 4FO0A 4BGAA 3U9DA 2A5XA 2WUSA 4H5RA 1MWKA 4HTLA 4AM7A 4A62A 5AQIA 2Q2RA 2YCHA 5AQOA 1RGIA 4DQ8A 2FF6A 5BRDA 2F9WA 3GL1A 3VGMA 1NGAA 4B1ZA 2QWNA 1RFQA 5KQDA 2CGLA 2QXLA 4FPBA 3VF6A 3ZEUB 3R6MA 5ADXH 4LC9B 3ZEUA 4DB3A 4FWRA 2KHOA 4MO4A 2V7ZA 2ZF5O 1GLFO 3FZFA 3O8MA 4QS9A 3GOIA 4BRLA 1QQOA 3CQXA 3U9ZA 5AQPA 3WXKA 4BRIA 5E26A 3FZMA 2QWOA 3A8YA 3BF1A 3WQUA 3UKRB 4FWMA 4GY2B 2HF3A 1BUPA 3UKRA 5AQFA 4IJAA 4MLHA 5AQHA 2AA4A 5EVZA 1S3XA 2P9SB 4Y0WA 5BPMA 4RWTA 1QHAA 3LM2A 2P9SA 4HWIA 3SK3A 4E1JA 3IDHA 1GLEG 2P9PB 2QWRA 3EO3A 3WXLA 4CZGA 2FLOA 2P9PA 2D4WA 5AQYA 1NGIA 1OKJA 3VOVA 3D2FB 1NM1A 1QQNA 3C7NB 4IJNA 1HJOA 1BDGA 3D2EB 3D2FA 3C7NA 5KQ8A 4H0PA 3D2EA 3VETA 3DWLA 3L4IA 5F1XA 4JNEA 1HX1A 4CZMA 1U6ZA 3A5OC 3CIPA 3O80A 3BF3A 5LJWA 2ASPA 1U2VB 4A2BA 4RCHA 2P9IA 3AARA 1BOTO 4WQ4C 1U2VA 2HOEA 3DAWA 4B1VA 1TUYA 1ZBSA 2YI1A 3VEVA 4IWVA 3HSCA 4JHDB 5AQTA 2UYTA 1NGDA 4BREA 4JHDA 5EX5A 1DGKN 2W40A 2QW9A 2ZGYA 3CHWA 4MO5A 3WUHA 2E20A 1CZAN 1KXPA 3D7EO 5F2RA 4BRNA 3U4LA 5BPNA 3J8AA 4FWLA 4CBXA 1NBWA 3QDKA 1NLVA 3MDQA 3FZHA 4CZFA 3A5LC 3LDLA 3ID8A 3WXIA 4H0OA 5BPLA 3VF4A 1JCGA 2D0PA 4FWQA 2VYPA 4K43A 1BG3A 3VEXA 4B1YB 3A0IX 1KAXA 4CZKA 4WQ4A 3BP8A 2PAVA 3GE1A 4AM6A 5B8HA 1X3MA 2E2QA 2PBDA 2NRHA 3CJCA 3EKUA 4B1UB 4H0VB 3VGKA 3MCPA 4BR0A 4CZHA 2GWKA 4BQLA 4CZIA 3FLCO 3VPZA 1NGJA 3CJ9A 5JICA 2ZWHA 4B9QA 4FL9A 4DCHA 1DEJA 2A3ZA 3SLCA 3EL2A 3FR0A 1WUAA 1P8ZA 1V4TA 1NGFA 3WQTA 4BG8A 3LM9A 4FOEA 1BU6O 2IVPA 3VERA 2FF3B 3EZWA 1SZ2A 5BRHA 1HPMA 3CJAA 3A5MC 4H5NA 5BRFA 1IG8A 2HF4A 3H3NO 3KZBA 3MMVA 4H0XB 4BR2A 4K42A 5AQLA 1GLLO 3WT0A 2ASMA 3AAPA 2Q0RA 5AR0A 1KAZA 1R59O 3CJ1A 4BRQA 2YHYA 3HZ6A 1YUWA 3H1VX 5AZJB 4Z94A 1BA0A 2YJFA 1XQSC 2QWMA 5AZJA 1BWFO 3GG4A 1GLDG 3VEZA 3ZX3A 4ISEA 5I9EB 5AQVA 2P9UB 4CD3A 2NLXA 1LCUA 2P9UA 3GDQA 3I8BA 2Q97A 3BUZB 1NGHA 2IVOA 4K25A 1V4SA 3O1BA 3IMXA 3TPQA 4CZJA 1E4FT 2A40A 3UB5A 3HTVA 1QZ6A 1LOTB 4FWPA 1EQYA 3H46O 5AZIB 4CBWA 4BRGA 2Q36A 5AZIA 4BQZA 3CETA 4J8FA 2GTDA 3B8AX 3FFKB 3SMPA 4IO8A 3R9PA 5AQJA 4BRCA 4BRFA 1HLUA 4FWNA 4XH5A 2F9TA 1NGCA 3MK6A 4M7XA 5AQWA 4O5FA 2IIRA 4FPAA 4A2AA 3MN5A 4BRPA 2GELA 2YHXA 4PKIA 3ZETB 4BGBA 3FZLA 5FPDA 2YJEA 3VEWA 3ZETA 4KBOA 3CJBA 1MDUB 1NMDA 3BEXA 4B1XB 4NO7A 5AQGA 2HMPA 2I7NA 1QZ5A 2IVNA 4CZEA 3ZX2A 5KPZA 1IJJA 5KPRA 4XH4A 1SQKA 3CJ7A 3VGLA 5BN8A 5EXWA 1YVNA 2E2PA 3LL3A 2H3GX 3JS6A 1Q18A 5FPNA 3ENHA 5LJVA 4IZ9A 1SAZA 1Y64A 2CGKA 5EY4A 4WYBA 4XH1A 1RDWX 3CQYA 2EWSA
chains in the Genus database with same CATH superfamily
5AQUA 3FZKA 2O8CB 3HP9A 3HXMA 2KFNA 3L2WA 1YF5L 2P9KB 1N5YA 5FPMA 2ITGA 3T3FA 3DXKB 2NZTA 3GBTA 3NF7A 1HNZK 3CCLN 1T6CA 1YXQA 1KTQA 2JGUA 4CEEA 1XWLA 4H8KA 4BC3A 1NKEA 3G10A 3OYKA 2VGNA 3DXMB 4DFPA 5BREA 4JI0K 2V52B 2ZGZA 4ISFA 4AH9A 4JKEA 4CHPA 5KPTA 1N36K 4B3OA 5KTQA 3EE8A 4JI6K 2X6SA 1TK5A 3EKSA 1NKBA 4DSKA 4CD1A 1QE1A 1HQUA 2G8KA 1S72N 4ILJA 5KI6A 3QMLA 3WEEA 3BGRA 3MN6A 5GAHP 5AQSA 4K0KK 3AGRA 3C6TA 4KO0A 1ESVA 2Z1JA 4FSVA 3LDOA 1RT1A 1TKXA 4QS8A 3AVLA 5SWMA 4QCLA 4FJ7A 3O1WA 3D6RA 3UE5A 1J6ZA 1IBMK 4CHYA 4HHTA 4NLCA 4FW2A 3I33A 1E4GT 1RTDA 2FBXA 4L8RB 2F4VK 3G4SN 3SMSA 3OS0A 3I8DA 5DM7L 4E7JA 5C0YA 2O8DB 1RBUA 4BDZA 3AO3A 3P38A 4CFCA 4MLEA 3LP0A 2P5GA 3K5OA 1BGXT 5EU7A 4JAXA 1LWCA 3L3UA 2FSJA 4LSNA 3AVGA 3THWB 3AVNA 5EOYA 1TYQB 3OYBA 1VSHA 4CGGA 3MWTA 3AVHA 4V19S 4PKHA 4CJSA 1O1WA 5I42A 3CYMA 1ATSA 1LAWA 1WAJA 3OYJA 1HYZA 4IG3A 4IDKA 3F9MA 3NGYA 5J1EA 4ISGA 3QFPA 2X78A 1H1VA 3MN7A 4KTWA 1O13A 3UKUA 1MWMA 4BRDA 1ASWA 1KAYA 2YHWA 4NLBA 3ZSYA 5M1KA 4IBNA 4TSXA 1NKCA 4YFUA 1T44A 3M8PA 1WLJA 3QEIA 4JD2A 4WQ5A 1K8KA 5M1FA 3OJSA 1N33K 4Y1DA 4CIGA 4BRHA 4OLBA 1TV6A 4BR9A 2VCPA 4IXCA 4DLEA 4KHPK 4H5VA 3HYFA 1FKOA 3CPWM 4B08A 2XY5A 2E6MA 4EZ9A 5J2QA 3QETA 4O5BA 3R3LA 3NH1A 4IFVA 2QTDA 1QSYA 3MAQA 3DXMA 3V9UA 2IS3A 1VSEA 3P83D 4DSFA 3SAGA 3OBYA 4FWSA 4KHSA 3E9LA 1UOCA 3OHRA 1ZBHA 3KKRA 4GV9A 2BH1A 5TKYA 4KI6A 5AQKA 4MFBA 3VEOA 2BE2A 4B3SK 3NVMA 4EAHD 4B9TA 1HYSA 2P9NA 2I7PA 3DLBA 3H45C 1VSJA 3ENOA 3P5JA 1EXQA 4Z0UA 4ILGB 5CHIA 2P51A 2XY8A 3V81A 4HTLA 1Q9XA 4AHVA 3THVA 1L3SA 2YCHA 5CYMA 1RGIA 1UA1A 4OPHA 5BRDA 4G1QA 2WONA 3GL1A 3VGMA 5KQDA 2CGLA 4KH6A 5C15A 3SAFA 5ADXH 3ZEUA 3DLEA 4FWRA 4JKFA 3NAEA 2KHOA 4AF1A 4MO4A 2V7ZA 2ZF5O 1GLFO 1RDCA 3O8MA 4Z4EA 4QS9A 4DS5A 4JS4A 1RTJA 3FZMA 1HYVA 4GY2B 4M45A 4FLYA 3TAPA 1E3MA 1A5WA 4IJAA 1N8RO 2HW3A 5BPMA 1WSEA 4EP5A 4ELVA 4E1JA 4H4MA 5LMNK 4C8MA 4F2RA 2QWRA 4N56A 4NCGA 5HROA 4MDBA 1NGIA 2KFZA 1OKJA 2PFUA 3C7NB 3RRGA 1HJOA 1LW2A 3D2EA 2F8TA 3DWLA 5F1XA 3VQEA 4F3TA 1X1PA 4YOXA 1ZBLA 2F7TA 4CF9A 3CIPA 1BIUA 3O80A 3BF3A 3EY1A 3MXMA 3ZSOA 3IAYA 4RCHA 3AARA 1BOTO 2HOEA 3DAWA 4B1VA 4DUZK 4W5TA 4AQYK 4QAGA 3LPUA 1OH7A 4CF2A 4JHDA 3CHWA 3J7ZO 4MO5A 2OCEA 5E41A 4ID1A 2GV9A 2A1SA 1NK9A 3J8AA 2O8BB 2WOMA 5FROA 3FZHA 3LDLA 3ID8A 4H0OA 5BPLA 4Z4CA 1ZBUA 4FLTA 3MEEA 1KQSM 1JL1A 4B1YB 1OH8A 4CJUA 3T1YK 1KAXA 4AHCA 3BP8A 2JWLA 4DSJA 1WBBA 3EKUA 1EO1A 4H0VB 3VGKA 3MCPA 3E66A 4NXNK 1A5XA 4CZHA 3THYB 1SL0A 1TL1A 2ETJA 3E1YA 2E6LA 3VPZA 2KZZA 1NGFA 3WQTA 2IGIA 3LM9A 1BQMA 3OYIA 4A59A 5KRTA 2PZSA 1SZ2A 3F9KA 4E3SA 3SUOA 5BRHA 2FBVA 4KB1A 4M3XA 1U04A 3AA2A 2HF4A 3H3NO 3LANA 3KZBA 3LDSA 1KVCA 3PY8A 1GLLO 1TKZA 2ASMA 2HNZA 2BGGA 3ZT3A 3O3FA 2YHYA 3HZ6A 3PUFA 1YUWA 3H1VX 4W5NA 3VQBA 2QWMA 5AZJA 4FJ9A 4OKKA 3CCSN 3GG4A 4JI3K 1GLDG 4DV4K 3ZX3A 4ISEA 2HHQA 4CJWA 2NRZA 3G6EN 3GDQA 4M3YA 3NF8A 4B8AB 2IVOA 4FJHA 1HJRA 1V4SA 4CZJA 1X9SA 1HNIA 2A40A 1QQCA 3HTVA 4JI1K 3SQ2A 3Q7BA 1S6QA 1VQ6N 1LOTB 4JKCA 1EQYA 4CBWA 4YY3K 3SV4A 5AZIA 4CIFA 4N41A 3CETA 3B8AX 3N4PA 1NGCA 3MK6A 4M7XA 4QOZB 1D9FA 5D3GA 4A2AA 1LWEA 3MN5A 4EP4A 1UAXA 3NGIA 4KBOA 3CJBA 3O4QA 4B3MK 4DV7K 3K57A 3SYZA 3ZX2A 2D0CA 2QKKA 1IJJA 3CF5L 3VQ9A 4AHTA 1VQ7N 3M8RA 1NOZA 2WC9A 2E2PA 1WSHA 4LY7A 4NYFA 4JI4K 1NOYA 1ZYQA 5FPNA 3MXIA 4ILHA 4IZ9A 1SAZA 3OVNA 3PSIA 4F2SA 5EY4A 4YOUA 4XH1A 1JLGA 1RDWX 3M8SA 1GLAG 1VRTA 4RTFD 4HCBA 4C8KA 4XEIA 1VSIA 4LSLA 4DLGA 3P39A 5JS1A 1JCEA 3DLRA 5K14A 3ID6A 3TAGA 1G99A 2A42A 2F96A 4PWDA 1CLQA 5HBMA 1J5OA 2HNYA 5IWAK 4H0YB 4EHUA 2BANA 2OANA 4CJQA 1HMVA 3L2UA 4CJLA 1S6PA 1RBVA 3KVGA 4BRMA 4JI2K 3KLIA 2E1ZA 2KQ2A 3FE1A 3IRXA 2HHTA 3AVKA 3WEEB 5AFUA 1C0TA 1Z26A 4BVOA 3I0SA 2OYQA 3LDQA 5MLCQ 1KCFA 3EYZA 3V9ZA 1YITN 3T1AA 1IO2A 4FM1A 1TL3A 2E8AA 4DG1A 2G8WA 3AY9A 2OPSA 2IAJA 4YDUC 4CJKA 1FJGK 4B1WB 4EIAA 1D8YA 1NG9A 3L3VA 4JS5A 3NVKA 1HKCA 1LW0A 2CGJA 5CE3A 2FXUA 4BDPA 4LF7K 1J54A 3Q7CA 3OYMA 3QB0A 5M1OA 3I0RA 2PYJA 2FSNA 3PV8A 5HRRA 4ZTFA 3B6PA 4FW1A 5JLFA 2KKZA 4BRAA 4H0TB 3VENA 3KHYA 4M63C 3HOTA 4BY9C 2JWKA 2BTFA 3PSFA 4GV6A 2HBLA 2LSNA 4EHTA 3KD1E 4C23A 3TR8A 3IKMA 3G71N 2FBTA 3U8XA 3DOLA 4NYNA 4BC4A 1RTHA 3QICA 3C65A 2BUPA 4CJ7A 4LF5K 1J9AA 4E1MA 4DSLA 4JN4A 2VG7A 3UKUB 4AHSA 1FW6A 4LF4K 4JV5K 3K5MA 3ULDA 3E9OA 1BO5O 4PL8A 3ATVA 3SQ0A 3MECA 4B9NA 2DTUA 1S22A 4JD2B 4DV3K 1NGGA 1T03A 2E2OA 1K8KB 5LY3A 1CZBA 2OZSA 1FXXA 3MN9A 1HQEA 2Q0UA 4ID5A 1HKGA 3ULEA 2YNHA 3HI0A 3RSEA 4KI4A 3W0LA 4K41A 3SV3A 1VQKN 2OTLN 4OX9K 1X9JA 5F0XA 4CK3A 4B9SA 2D5RA 3OYAA 2OZMA 4DR4K 4KHQA 4H4OA 3AVJA 3R8EA 4YOWA 4BROA 3HVRA 3AAQA 1VQMN 4DTRA 2I5JA 5HLFA 4CEFA 4QS7A 3O08A 5HOOA 4FOIA 3M6GA 4J2EA 2X6NA 3CFPA 1GLCG 1XI1A 4LH4A 3SUNA 4DHYA 4EZ6A 4C8OA 1VSFA 2ZM6K 4IKFA 2FBYA 2VQFK 2Q31A 2P9NB 3VMFB 4CHNA 3VQPA 3WNHA 1YJNN 4Q0BA 4IOXA 4DTSA 3O5BA 1DTQA 1HKBA 4CF1A 1QQMA 4FO0A 3U9DA 2A5XA 1JL2A 3LAKA 4H5RA 1MWKA 4MQ3A 2P5OA 3NE6A 4FJKA 5AQOA 4J2DA 4WF9L 3P1GA 2OPQA 2F9WA 4FK4A 4FYDA 4DR5K 3PX0A 4YHHK 3ZEUB 1CZ9A 5DM6L 4FJXA 3HJFA 1QTMA 3TTCA 3CXCM 3I55N 3CG7A 4WCEL 4W5OA 3AVBA 1FKPA 3ZYYX 1NMNA 2QWOA 3CFOA 4HTUA 4CCHA 3UKRA 1VSDA 3SNNA 3LP2A 1UWBA 4CFBA 3CPEA 4Y0WA 1TK0A 5GIOA 4E7IA 4KHWA 2VGMA 4CERA 3SK3A 4DQIA 4CFAA 3IDHA 4BE0A 4CZGA 3DLLL 2D4WA 4PY5A 3VOVA 3V9XA 3MWPA 3ISNC 3MX2A 3TANA 1NM1A 1OH5A 4DTMA 3D2EB 1BDGA 4F3OA 3VQ8A 4U7BA 4DS4A 1JLQA 1VSLA 3J7YP 4FK0A 1HX1A 1RBSA 4DV5K 3JSMA 1GOAA 4A5AA 4DF8A 4PUOA 4OVLA 2NRTA 4DQQA 5LJWA 3HPHA 5FRMA 4WQ4C 4FM2A 3ZT0A 1IBKK 2UXBK 1ZBSA 2D0AA 3TARA 3V1RA 3M5RA 3VEVA 5AQTA 4JHDB 2G8VA 1D9DA 1WSFA 4BREA 4FXDA 2O8FA 3J80O 2W40A 2QW9A 3WUHA 4JKBA 2XY6A 1CZAN 1KXPA 3R1XA 4BRNA 2HHUA 5C2FA 4K8XA 4CBXA 1GOCA 3QDKA 1NLVA 4DKWA 3A5LC 3SPZA 1K8AO 2NUBA 1VQPN 1Q86O 4Z4GA 3VF4A 3HT3A 1JCGA 2IDOA 3KK2A 2JLEA 3VEXA 4KHUA 2YHAA 3A0IX 1NJZA 2QKBA 5KRSA 2PAVA 4AM6A 4DV1K 1C1CA 5B8HA 4GVEA 2E2QA 1RT4A 4OLAA 4M3TA 4IOCL 1BL3A 1NNEA 4PQUA 2GWKA 1W0HA 4CZIA 3FLCO 1TVRA 1NGJA 3CJ9A 2HHWA 4MDAA 2ZWHA 4B9QA 1M1KO 4DCHA 4FJ5A 4CEQA 3EL2A 4JK9A 3ZSRA 2W6LA 4DFMA 1YHQN 4CIEA 4FVUA 1VSMA 4Z4IA 3A5MC 4M41A 3OS2A 1OH6A 1HNXK 4H5NA 4DWIA 4DTNA 4H0XB 1JXEA 3MMVA 3CFRA 1K73O 3HPGA 4CJTA 2GX9A 5AQLA 1WBDA 3AAPA 2DFHA 2Q0RA 3CJ1A 4BRQA 1TKTA 5AZJB 4Z94A 2YJFA 3CCUN 1A5VA 3NBPA 1EWRA 2B4JA 3VEZA 3TABA 1WAFA 5AQVA 1LAVA 3QERA 2P9UA 3I8BA 2YKMA 1NGHA 1WSIA 1S1VA 3AGKA 3TPQA 3UB5A 1SKWA 4C1NK 3KWIA 5C10A 4FJMA 3CC7N 1NK6A 4FJ8A 5AZIB 2NRWA 2Q36A 3K2PA 4LF9K 4J8FA 2GTDA 3FFKB 2UUAK 3SMPA 4IOAL 3LWMA 3S3NA 1JLEA 4J2AA 2F9TA 2UUCK 4CEZA 4BDYA 3NFAA 3VQAA 3HP6A 2VG6A 2GELA 1VQ9N 2YHXA 4PKIA 4BGBA 2E4LA 3VQ7A 2YJEA 4DQSA 3ZETA 3O4NA 3VN5A 3IG1A 3AA5X 3DLGA 1SKSA 3V4IA 4LFAK 1NMDA 3BEXA 3HVTA 2OPRA 3K59A 3AA4A 5CZ1A 1IKVA 3OYFA 3VA0A 2YNIA 5CZ2A 4A5BA 3VTHA 3CCVN 4HCCA 3JS6A 1Q18A 4I9LA 2BDPA 3ENHA 1Y64A 3V9WA 2CGKA 4WYBA 2GWJA 3M3ZA 1T8EA 3S3OA 1C0GA 1Z05A 4ELTA 1W7AA 2QEXN 5T7BA 1DKGD 3O6WA 1Y97A 4FVMA 5ELZA 1U47A 2HHSA 2E5LK 1YAGA 3J7AP 1T05A 3NGZA 2QI2A 4JKDA 1WSGA 2QM1A 4LFCK 3DRPA 5BN9A 4BG9A 3G0ZA 1ZBFA 4CGDA 1HNWK 4KRFA 3H6EA 1J53A 4RW4A 3H1QA 4BR7A 4M3UA 3HBTA 1BQNA 3RMCA 2WTUA 2AP1A 4L3QA 1KFDA 3A5NC 3K0SA 3FGUA 4O44A 4GV3A 4CEBA 1RILA 4IO9L 2FSKA 2D0BA 3SJJA 3OTOK 3ZSZA 2ATQA 1C0FA 1VQ5N 4CBUA 3LP3A 1KD1O 2A1RA 2UXCK 1S1XA 4PKGA 2ITMA 3CCQN 3HM8A 4F9OA 3QEWA 2UU9K 3WXMB 1ZBIA 1NK7A 1JLFA 3QIOA 1GLJO 4KREA 3L0QA 4NB4A 3L6QA 3C6HA 3ZX0A 5AQMA 2NRXA 4KHNA 3LALA 1ZXOA 3OYGA 5GIPA 3QESA 2B6AA 3SJHA 4BC2A 1RDUA 4CJ3A 4A57A 4LD0A 1T6DA 4H5TA 4M42A 4DR3K 4YDUA 2GEMA 5JLHA 4DUYK 4CI6A 3H3OB 4X65K 4A61A 3EEQA 1RT3A 3LDNA 3SQ4A 4ZHRA 3QBWA 3VF2A 2Q1NA 3QEVA 2W41A 3VA3A 3VQ5A 3S3MA 4RW9A 3VQQA 3L4QA 4LF8K 5C24A 1ATRA 1RCHA 3VEYA 2Z1HA 1QSSA 3ZSXA 4RG8A 2G8HA 3KIOA 3BDPA 4C8LA 4IEEA 3AA3A 5CYQA 3JXUA 5AQZA 3S41A 4RW7A 5SZTA 2P1JA 3CI5A 4WFAL 3V1OA 3E9PA 1VAZA 4GNIA 3ULEB 5AFUH 3RSEB 5BR9A 1IKXA 1IH7A 4DV2K 2VWBA 2QWQA 3EN9A 3CMAN 4KAZA 4Z4FA 4M7YA 2P9LA 5E84A 1T3VA 4FM0A 3ZT1A 3P4IA 2PYLA 3VQ6A 2ZJRL 2DPNA 2Y1IA 2QA4N 4BR4A 1EP4A 1X9WA 3ZCMA 4CJEA 4B9UA 4M3WA 5DK5A 3JAMO 3L2RA 4KTZA 4JI7K 4PL7A 5AJ3K 1I94K 3K9KA 1D4XA 2G8IA 2CH6A 2YNFA 2O4IA 1ASVA 4I6MA 2V7YA 1KC8O 1BCMA 4C8NA 1HUXA 3O9SA 4IFEA 3PX6A 2HHHK 1YTUA 3TAFA 1XNQK 2RPIA 4JRQA 1NGEA 3N4QA 4OPKA 4DQPA 4CK2A 1NGBA 1NWKA 4JK8A 4WFBL 4BE1A 1X3NA 4ICLA 1ATNA 4YOTA 1XC3A 3KKSA 4BGAA 3AVAA 3HPOA 3C95A 3TSPA 3KD5E 4AM7A 1Q7YO 5AQIA 2Q2RA 1S9EA 5M1PA 2IOCA 4DQ8A 3T1HK 2FF6A 3BY5A 1JLBA 4B3TK 1NU0A 4B1ZA 2QWNA 1RFQA 3ZT2A 3HM9A 3PIPL 2XHBA 5A2QO 4FPBA 4CF8A 1TAQA 1VQ4N 4LC9B 4FCYA 1BCOA 1Q9YA 1CXQA 3CCRN 4ELUA 4DFJA 3GOIA 3TTDA 2HHVA 1QQOA 3CQXA 5AQPA 5M1QA 1RDDA 2XRIA 3AVIA 3CC2N 2WFBA 3SPYA 2UUBK 3BF1A 1NJXA 3KLEA 3UKRB 2VQEK 1W2BM 4PHTX 2HF3A 1BUPA 4DV0K 2RF2A 4O8UA 5AQFA 4CGJA 5AQHA 3KJVA 4JI8K 4RWTA 4IFYA 1QHAA 2O8EA 2P9SA 4HWIA 1BI4A 3AVMA 2RKIA 3QLHA 3T19A 5J2MA 4IG0A 3WXLA 4OKJA 2FLOA 2P9PA 2DFEA 2ZD1A 1C1AA 1SUQA 1IV0A 1QQNA 4IJNA 2QXFA 3D2FA 2HBJA 3WNEA 1YIJN 4H0PA 3VETA 4R79A 2UXDK 1W97L 4CZMA 5JVGL 3A5OC 1J5EK 1DTTA 1SV5A 2ZJQL 1RT6A 1SS6A 4YORA 1RT7A 3K58A 1U2VA 3LZJA 4E7LA 1M90O 2AJQA 4OGCA 2YI1A 3V6DA 3HSCA 2O8FB 2UYTA 2W42A 1NGDA 2WBNA 3DRSA 3D0PA 1YVUA 5EX5A 1EKEA 1NK4A 1KVAA 3D7EO 5C12A 5F2RA 4CVNE 3U4LA 4O0JA 1RBRA 1ASUA 2GBZA 3MDQA 4CZFA 1TAUA 3WXIA 3ZT4A 2GUIA 3F5TA 1B9DA 4FWQA 2VYPA 4K43A 1BG3A 1B9FA 2HB5A 4CZKA 4WQ4A 3AVFA 3GE1A 5DMRA 1YI2N 4Z4HA 2YKNA 3PX4A 4I2PA 4B1UB 1VK0A 4BR0A 3KLHA 3HO1A 4BQLA 3NF6A 2NNWA 4I7FA 4OPJA 3AV9A 3SQ1A 5JICA 1QVGM 1VRUA 2A3ZA 3SLCA 1WUAA 1P8ZA 4BG8A 3PIOL 1XHZA 1BU6O 1CXUA 4OO1J 2HVIA 4KKOA 1HPZA 3QEXA 3EZWA 2RN2A 4HVJA 1P90A 4FJLA 4N5SA 1XMOK 5GAGP 4JK7A 3CJAA 3K5NA 1TKDA 3HL8A 4KH5A 1IG8A 2HMIA 4BR2A 2XO7A 4K42A 4B3RK 3EE9A 3RMAA 3WT0A 4FJJA 4DSEA 3RWUA 1Q81O 3DLHA 1BA0A 1XQSC 4CJ4A 1SKRA 1OVYA 1BWFO 1RNHA 1KRPA 5GINA 3NF9A 5LL6Z 4CHQA 2P9UB 3IS9A 4CD3A 1BISA 1GOBA 1C0UA 2NLXA 3THXA 4N47A 3BUZB 5J2NA 4KFBA 4Y1CA 3AO1A 4K25A 3L2VA 3IMXA 4B9VA 1E4FT 2RHKA 3TAEA 1VQLN 5HRPA 3OYCA 3C6UA 4FWPA 1HRHA 4CHZA 1I39A 3C6AA 3PLAA 5FRNA 4G9ZA 4B9LA 3VQ4A 1QS4A 4IO8A 5AQJA 3R9PA 4BRCA 4W5QA 2F8SA 4BRFA 1HLUA 4IEIA 3DM2A 4JKGA 4FWNA 5JS2A 2YX6A 4DTOA 3P31A 2IIRA 1VQON 4DR1K 5CR4A 4RW6A 1JXBA 1YTAA 1R0AA 3ZETB 1NK0A 3FZLA 5FPDA 1K6YA 5C25A 4FZXC 3SZ2A 1NJIO 3LZIA 2Y1JA 3KK1A 4CJRA 5AQGA 4AHUA 2I7NA 4DF4A 1QZ5A 2IVNA 4I9QA 3KTQA 4CW7B 4KHYA 5KPRA 4LFBK 4DTUA 2PY5A 1SQKA 3CJ7A 5EXWA 4O4GA 1ILYA 5LMUK 5HL7L 4CESA 4CECA 2G8FA 4FWKA 2EWSA 2D0OA 2YHBA 5BR8K 1VQNN 2O8CA 3CM6A 4CGFA 2NRVA 2OA8A 1VSKA 2P9KA 2J4RA 1QHTA 4DV6K 3DXKA 3SUQA 4F4KA 3DYAA 3W3DA 1W9HA 3HSTB 3C0BA 4JYAK 1C1BA 3RMDA 3O9UA 3T7ZA 4UY8O 4JKAA 4DR7K 1WNSA 1L3TA 3SUPA 3VESA 2VWKA 3OW2M 1GLBG 2HBKA 4BRKA 4X64K 3ATUA 4BC5A 3AO2A 4BE2A 5AQNA 1DLOA 4DMNA 3TSUA 3SBGA 3MCAB 1S5JA 4E7KA 4M3ZA 2GUPA 4J2BA 5FLXO 4M3RA 3OYDA 1F21A 1XC9A 1KSPA 1RBTA 3ITHA 2XY7A 4C1NI 4OJRA 3MEGA 1Q82O 3G25A 3DJCA 5C42A 4BVPA 1L3VA 1TGOA 3NH2A 3OS1A 1N34K 5AQQA 1L3UA 2HVHA 5HRSA 3TI0A 1YJWN 4H03B 1D5AA 4RW8A 4KH4A 3CM5A 1KVBA 2B5JA 2O8DA 3J81O 3KK3A 3ENBA 3TU5A 4DU3A 4R5PA 4JRPA 2QWPA 1DT9A 4B8CA 3TSQA 3EZ5A 2A41A 4CJFA 1C6VA 5KGXA 3THWA 1JLAA 3DRRA 5JMVA 2ZE2A 3B6OA 1TUUA 1TYQA 4NXMK 3WNFA 5AQRA 3IUCA 3KLGA 3MXJA 4CEOA 3U3YA 1IBLK 2DY4A 4YOYA 1C0MA 1LWFA 4F8RA 3O4WA 1S1UA 1FK9A 5TKWA 5CY4A 4WQ5C 4BR5A 1WSJA 3LDPA 1KLMA 2YV0X 1WN7A 2G8UA 1X9MA 3QBXA 1I3AA 5ADXA 1NK8A 1WB9A 4KTQA 4X66K 4FZYA 2EX3A 1EX4A 4W5RA 4GKKK 1BA1A 4BACA 4O55A 1WOQA 4DU1A 3IFRA 4IDHA 1RT5A 4EFHA 3O3GA 4DU4A 4K8ZA 1NJWA 4CGIA 4B9MA 2P9IB 3OYNA 1JCFA 4HUFA 2E88A 3OA9A 2KW4A 4O0IA 1MA9B 3NDKA 2HHXA 5AQXA 1HNVA 1MU2A 2P9LB 1ZC6A 1S1TA 3AO5A 2HBMA 4O8KA 2V51B 2A6AA 4U67L 1EETA 2QWLA 1XUPO 3KWGA 2E2NA 2OTJN 3NCIA 4FWOA 5FDLA 3CD6N 4LH5A 3WXJA 3PO5A 1NJYA 4DR6K 3M1FA 3QIPA 4WE1A 3QFUA 4E19A 4ZTJA 4I2QA 1VQ8N 1N32K 2DFFA 4I6MB 3RR7A 4FJIA 2CH5A 1RT2A 3O9QA 4H5WA 1EWQA 4CZLA 1RTIA 3HRGA 2HSTA 4X62K 2E1YA 3CERA 2ZJPL 5IT9O 2D1KA 4CJVA 5FPEA 1Z25A 3LAMA 1IG9A 3AVCA 2R7YA 4FLZA 1Z6RA 3PO4A 4CK1A 2ASOA 3A2FA 2WUSA 3DI6A 3U3GA 4CE9A 3RMBA 4A62A 4FJNA 3CCEN 2W6KA 1B92A 4DFKA 3O9TA 1NGAA 3SBTA 4CHOA 1ITGA 2FC0A 2QXLA 1XNRK 3SI6A 5HP1A 3VF6A 4Q5VA 3S9HA 3NMUA 3R6MA 4GW6A 4BWJA 4DB3A 3ZSVA 5GADP 3CCJN 3VTIA 3FZFA 4FK2A 4BRLA 2Z1IA 3U9ZA 3JYTA 3WXKA 4BRIA 3F2KA 5E26A 3E01A 1IKYA 4HUGA 1QSLA 3LP1A 3A8YA 3WQUA 4FWMA 5KGWA 3SAHA 3I56N 3QO9A 4YOVA 4MLHA 4WFNL 2AA4A 5EVZA 1S3XA 2P9SB 1U45A 2O8EB 3CC4N 4CFDA 1BI4B 1OVQA 3LM2A 3CMEN 4CJ5A 2KTQA 4E7HA 4E89A 1GLEG 3OYHA 4OGEA 2P9PB 3EO3A 3TAQA 5AQYA 3DMJA 3BZKA 3D2FB 4FLVA 1K9MO 1U4BA 1TK8A 3C7NA 5KQ8A 1YJ9N 5I3UA 3BZCA 5HRNA 1T7PA 3L4IA 4JNEA 1U6ZA 4JKHA 4GKJK 2ASPA 1U2VB 4A2BA 2IC3A 2P9IA 2Z1GA 3C94A 1TUYA 3CCMN 4LF6K 4IWVA 1QVFM 1U48A 1N6QA 3U6FA 3NHGA 1RDBA 4AHRA 4GVMA 2VG5A 3TWHA 3ALYA 1DGKN 2ZGYA 3H08A 3DLKA 2E20A 1KLNA 1U49A 5BPNA 1S1WA 4DTPA 1IKWA 2YNGA 4FWLA 1NBWA 3MX5A 1G15A 1NK5A 2O8BA 2RE2A 3OY9A 2VWJA 2D0PA 3CQ8A 1BIZA 3ZSWA 3K5LA 2QK9A 4KB0A 3T69A 3NH0A 1REVA 3VQDA 3RTVA 4DTXA 1X3MA 2NRRA 3ZLJA 2PBDA 2NRHA 3CJCA 4OKEA 3QNOA 4CF0A 3RRHA 3THYA 4UQGA 3O9RA 3F73A 3LPTA 4FL9A 1DEJA 3FR0A 2OPPA 1V4TA 2Q3SA 5H1SQ 4FOEA 2IVPA 3VERA 3HOSA 3QINA 2FF3B 4CJPA 4E1NA 2O4GA 5JVHL 1SL1A 1VHXA 4FLWA 1HPMA 5M1NA 5BRFA 4HUEA 3SCXA 3O3HA 4KV8A 3M8QA 4FJGA 3TTFA 1BHLA 3LWLA 4KPYA 3FFIA 3MEDA 5AR0A 1KAZA 1R59O 3WNGA 3OYEA 3K9JA 3V9SA 3RR8A 3ASMA 4NCBA 4DTJA 5I9EB 3THXB 1YT3A 3RVCA 1Q8IA 1XHXA 4FZZA 3OJUA 1LCUA 1JJ2M 2Q97A 1SL2A 3D45A 3O1BA 2KZMA 2X74A 3KLFA 1QZ6A 3OBWA 3L2QA 5C2DA 1UA0A 4PA1A 3H46O 1JKHA 4BRGA 1HR0K 4OPAA 4FLXA 4NCAA 4BQZA 2ZQBA 1S9GA 4JKGB 3DOKA 3TAMA 3QEPA 2HNDA 4JLHA 4XH5A 5J2PA 3L8BA 5AQWA 4O5FA 4CEDA 4JI5K 3KK7A 4FPAA 4N76A 4E0DA 4JEPA 4BRPA 3QNNA 2KLAA 4FLUA 1XMQK 3OYLA 3VEWA 4AILC 3HK2A 4DSIA 1JLCA 4DR2K 4XIUA 1MDUB 1L5UA 4B1XB 4NO7A 3VQCA 2HMPA 4GMJB 4CZEA 5KPZA 2EHGA 4XH4A 3ZSQA 3AO4A 3VGLA 5BN8A 1YVNA 4CGHA 4YNQA 4BWMA 5GAEP 3LL3A 2H3GX 4DQRA 5LJVA 3V1QA 1RDAA 1KFSA 3UIQA 4CEAA 3CQYA 1LV5A
chains in the Genus database with same CATH topology
1GLAG 5AQUA 2GWJA 3FZKA 2D0OA 3M3ZA 1C0GA 1Z05A 1VQNN 1YF5L 2P9KB 4RTFD 2NRVA 5FPMA 2P9KA 4XEIA 2QEXN 3DXKB 2NZTA 3GBTA 2J4RA 3CCLN 1T6CA 1DKGD 1YXQA 3O6WA 3P39A 5ELZA 3DXKA 1JCEA 1YAGA 3ID6A 1G99A 2A42A 2QI2A 3W3DA 4JKDA 4BC3A 2QM1A 5BN9A 4BG9A 3C0BA 2VGNA 4UY8O 3O9UA 3T7ZA 4H0YB 3DXMB 4EHUA 4JKAA 3H6EA 2OANA 5BREA 2V52B 2ZGZA 4ISFA 4JKEA 5KPTA 3H1QA 3VESA 4BR7A 3OW2M 1GLBG 2HBKA 4BRKA 3EE8A 3HBTA 3KVGA 3ATUA 4BC5A 3EKSA 4BRMA 2E1ZA 4CD1A 2AP1A 4L3QA 3A5NC 5AQNA 3FE1A 3FGUA 1S72N 4ILJA 3TSUA 4GV3A 3QMLA 3SBGA 3WEEB 5AFUA 4IO9L 3MCAB 4FWKA 2FSKA 3WEEA 4BVOA 2GUPA 3LDQA 5MLCQ 1YITN 1C0FA 3MN6A 5GAHP 1VQ5N 4CBUA 1KD1O 5AQSA 3AGRA 2E8AA 4PKGA 2ITMA 1ESVA 3CCQN 3PIOL 3AY9A 4C1NI 4FSVA 3HM8A 3LDOA 4F9OA 4YDUC 1Q82O 3G25A 3DJCA 4QS8A 3WXMB 4BVPA 4B1WB 4EIAA 5AQQA 3O1WA 3D6RA 3UE5A 1J6ZA 1GLJO 4NLCA 3I33A 3L0QA 3L6QA 4NB4A 1YJWN 1E4GT 3C6HA 3ZX0A 5AQMA 3G4SN 1HKCA 2NRXA 3NVKA 3SMSA 4H03B 2CGJA 4KH4A 5CE3A 2FXUA 5DM7L 5C0YA 3Q7CA 3P38A 1ZXOA 3QB0A 5M1OA 5GIPA 3ENBA 4MLEA 3SJHA 4BC2A 1RDUA 2FSNA 3TU5A 4A57A 2QWPA 1DT9A 5JLFA 2KKZA 1T6DA 4BRAA 4H0TB 3VENA 4JAXA 4H5TA 3KHYA 3TSQA 4M63C 2FSJA 3HOTA 4BY9C 2A41A 4YDUA 2GEMA 5EOYA 5JLHA 1TYQB 2JWKA 4CI6A 5JMVA 2BTFA 4GV6A 1TUUA 1TYQA 3MWTA 3H3OB 2HBLA 5AQRA 3IUCA 4A61A 4EHTA 4PKHA 4C23A 3IKMA 4YOYA 3LDNA 1ATSA 3O4WA 3G71N 3U8XA 5TKWA 4BC4A 3QBWA 4WQ5C 2Q1NA 3VF2A 3LDPA 4BR5A 2W41A 3QICA 3C65A 2BUPA 4CJ7A 3F9MA 4ISGA 3QBXA 4JN4A 3QFPA 3L4QA 1H1VA 5ADXA 1ATRA 3UKUB 3VEYA 3MN7A 1O13A 3UKUA 1MWMA 4BRDA 1KAYA 2YHWA 4NLBA 4IEEA 5M1KA 1BA1A 3JXUA 5AQZA 3S41A 1WOQA 3E9OA 1BO5O 4PL8A 3ATVA 3IFRA 1T44A 4IDHA 3CI5A 1S22A 4JD2B 4EFHA 1NGGA 4WFAL 2E2OA 1K8KB 5LY3A 3E9PA 2P9IB 4JD2A 1JCFA 4WQ5A 1K8KA 5M1FA 1VAZA 4GNIA 3MN9A 3ULEB 2E88A 2Q0UA 3OA9A 5AFUH 3RSEB 1HKGA 3ULEA 5BR9A 4BRHA 3RSEA 3HI0A 2VWBA 4BR9A 3W0LA 2VCPA 1MA9B 2QWQA 4K41A 5AQXA 3EN9A 3CMAN 1VQKN 4IXCA 2OTLN 1X9JA 5F0XA 2P9LB 1ZC6A 4M7YA 2HBMA 4H5VA 4O8KA 2V51B 2P9LA 5E84A 2A6AA 1T3VA 3CPWM 4U67L 2QWLA 3R8EA 3P4IA 1XUPO 4YOWA 3KWGA 4BROA 2E2NA 2DPNA 2ZJRL 3AAQA 3R3LA 1VQMN 2OTJN 2QTDA 2QA4N 4BR4A 4FWOA 3CD6N 3WXJA 4QS7A 3DXMA 3O08A 5HOOA 4FOIA 3SAGA 3OBYA 4FWSA 3M6GA 3E9LA 3M1FA 4PL7A 3QFUA 3OHRA 3K9KA 1D4XA 1VQ8N 1GLCG 2CH6A 4I6MB 2CH5A 3O9QA 4GV9A 2BH1A 4I6MA 4H5WA 5TKYA 4DHYA 5AQKA 3VEOA 4CZLA 2V7YA 3NVMA 3HRGA 1KC8O 2HSTA 2Q31A 1HUXA 2E1YA 2P9NB 3CERA 3VMFB 4EAHD 2D1KA 2ZJPL 5FPEA 3O9SA 4IFEA 2P9NA 2I7PA 1YJNN 1NGEA 3H45C 3N4QA 4IOXA 1NGBA 1NWKA 1Z6RA 3ENOA 3O5BA 1X3NA 4JK8A 4WFBL 1HKBA 1ATNA 2ASOA 4ILGB 5CHIA 4YOTA 1XC3A 1QQMA 4FO0A 4BGAA 3U9DA 2A5XA 2WUSA 4H5RA 1MWKA 3TSPA 4HTLA 4AM7A 1Q7YO 4A62A 5AQIA 2Q2RA 3CCEN 2YCHA 5AQOA 5M1PA 1RGIA 4WF9L 4DQ8A 3O9TA 2FF6A 4OPHA 5BRDA 2F9WA 3GL1A 3VGMA 1NGAA 4B1ZA 2QWNA 1RFQA 3SBTA 5KQDA 2CGLA 3PIPL 2QXLA 4FPBA 1VQ4N 4KH6A 5C15A 3VF6A 3ZEUB 3SAFA 3R6MA 5ADXH 3NMUA 4LC9B 3ZEUA 4DB3A 4FWRA 4JKFA 5DM6L 2KHOA 3CCRN 5GADP 4AF1A 4MO4A 2V7ZA 3CCJN 3TTCA 2ZF5O 3VTIA 1GLFO 3FZFA 3I55N 3CXCM 3O8MA 4QS9A 3GOIA 4BRLA 3TTDA 1QQOA 3CQXA 3U9ZA 5AQPA 4WCEL 5M1QA 3WXKA 4BRIA 3F2KA 5E26A 3CC2N 2WFBA 3ZYYX 3FZMA 2QWOA 3A8YA 3BF1A 3WQUA 3UKRB 1W2BM 4FWMA 4GY2B 4PHTX 3SAHA 3I56N 2HF3A 1BUPA 3UKRA 4O8UA 5AQFA 4IJAA 4YOVA 4MLHA 1N8RO 5AQHA 4WFNL 2AA4A 5EVZA 1S3XA 2P9SB 3CPEA 4Y0WA 5BPMA 5GIOA 4RWTA 3CC4N 1QHAA 3LM2A 2P9SA 2VGMA 3CMEN 4HWIA 3SK3A 4E1JA 3IDHA 1GLEG 2P9PB 2QWRA 3EO3A 3WXLA 4CZGA 2FLOA 2P9PA 2D4WA 5AQYA 3DLLL 4MDBA 1NGIA 1OKJA 2PFUA 3D2FB 3MWPA 3VOVA 3MX2A 1NM1A 1QQNA 3C7NB 4IJNA 1K9MO 1HJOA 1BDGA 3D2EB 3D2FA 2HBJA 3C7NA 5KQ8A 4U7BA 4H0PA 3D2EA 3VETA 4R79A 1YIJN 1YJ9N 3DWLA 1W97L 3L4IA 4JNEA 5F1XA 1HX1A 4CZMA 5JVGL 4YOXA 4A5AA 2F7TA 1U6ZA 3A5OC 3CIPA 4JKHA 2NRTA 2ZJQL 3O80A 3BF3A 5LJWA 1SS6A 1U2VB 2ASPA 4YORA 4A2BA 4RCHA 2P9IA 3AARA 1BOTO 4WQ4C 1U2VA 2HOEA 3DAWA 4B1VA 1TUYA 1ZBSA 1M90O 3CCMN 2YI1A 3M5RA 3VEVA 4IWVA 1QVFM 3HSCA 4JHDB 5AQTA 2UYTA 1NGDA 2WBNA 4BREA 4JHDA 5EX5A 1DGKN 2W40A 2QW9A 2ZGYA 3CHWA 4MO5A 3WUHA 3J7ZO 4JKBA 2E20A 1CZAN 1KXPA 3D7EO 3R1XA 5F2RA 3U4LA 4BRNA 5BPNA 5C12A 5C2FA 3J8AA 4FWLA 4CBXA 1NBWA 3QDKA 1NLVA 3MDQA 3FZHA 3MX5A 4CZFA 4DKWA 3A5LC 3LDLA 3ID8A 3WXIA 4H0OA 5BPLA 1K8AO 1VQPN 3F5TA 2RE2A 1Q86O 3VF4A 1JCGA 1KQSM 2D0PA 4FWQA 2VYPA 4K43A 1BG3A 3VEXA 4B1YB 3A0IX 1KAXA 4CZKA 4WQ4A 3BP8A 2PAVA 3GE1A 3T69A 4AM6A 1YI2N 5B8HA 1X3MA 2NRRA 2E2QA 2JWLA 4GVEA 2PBDA 2NRHA 3CJCA 3EKUA 1EO1A 4B1UB 4H0VB 4IOCL 3VGKA 3MCPA 3E66A 4BR0A 4CZHA 2GWKA 4BQLA 3E1YA 4CZIA 3FLCO 3VPZA 2NNWA 3O9RA 1NGJA 3CJ9A 4MDAA 2ZWHA 4B9QA 5JICA 1M1KO 4FL9A 4DCHA 1DEJA 1QVGM 2A3ZA 3SLCA 3EL2A 3FR0A 1WUAA 1P8ZA 1V4TA 1NGFA 4JK9A 3WQTA 3LM9A 4BG8A 5H1SQ 4FOEA 4A59A 1BU6O 2IVPA 3VERA 1YHQN 4OO1J 3HOSA 2FF3B 3EZWA 1SZ2A 1P90A 5JVHL 4FVUA 5BRHA 1HPMA 5GAGP 4JK7A 3CJAA 3A5MC 5M1NA 4H5NA 5BRFA 4KH5A 1IG8A 2HF4A 3H3NO 3KZBA 3MMVA 4H0XB 4BR2A 1K73O 4K42A 3EE9A 2GX9A 5AQLA 3TTFA 1GLLO 3WT0A 2ASMA 3AAPA 2Q0RA 5AR0A 1KAZA 1R59O 3CJ1A 4BRQA 2YHYA 3HZ6A 1YUWA 3H1VX 5AZJB 1Q81O 4Z94A 1BA0A 2YJFA 1XQSC 2QWMA 5AZJA 3CCUN 3K9JA 1OVYA 1BWFO 3GG4A 3CCSN 1GLDG 3VEZA 3ZX3A 5GINA 4ISEA 5I9EB 5AQVA 2NRZA 2P9UB 4CD3A 3RVCA 2NLXA 3G6EN 1LCUA 2P9UA 3GDQA 3I8BA 1JJ2M 2Q97A 3BUZB 1NGHA 2IVOA 3AGKA 4K25A 1V4SA 3O1BA 3IMXA 3TPQA 4CZJA 1E4FT 2A40A 2RHKA 3UB5A 3HTVA 4C1NK 1VQLN 3KWIA 1QZ6A 5C10A 3OBWA 3Q7BA 3CC7N 1VQ6N 1LOTB 4JKCA 4FWPA 1EQYA 5C2DA 3H46O 3C6AA 5AZIB 2NRWA 4CBWA 3PLAA 4BRGA 2Q36A 4OPAA 5AZIA 4G9ZA 4BQZA 3CETA 4J8FA 2GTDA 3B8AX 3FFKB 3SMPA 3N4PA 4IO8A 4JKGB 5AQJA 3R9PA 4BRCA 4IOAL 4BRFA 1HLUA 4IEIA 4JKGA 4FWNA 4XH5A 2YX6A 2F9TA 3P31A 1NGCA 3MK6A 4M7XA 5AQWA 4O5FA 2IIRA 1VQON 3KK7A 4FPAA 4JEPA 5CR4A 4A2AA 3MN5A 4BRPA 2KLAA 2GELA 1VQ9N 2YHXA 4PKIA 3ZETB 4BGBA 3FZLA 5FPDA 2YJEA 3VEWA 3ZETA 4KBOA 3CJBA 1MDUB 1NJIO 1NMDA 3BEXA 4B1XB 4NO7A 5AQGA 2HMPA 2I7NA 1QZ5A 2IVNA 4CZEA 3ZX2A 5KPZA 1IJJA 3CF5L 5KPRA 4XH4A 1VQ7N 1SQKA 3CJ7A 3VGLA 3VTHA 5EXWA 1YVNA 2WC9A 4A5BA 5BN8A 2E2PA 3CCVN 1ILYA 5GAEP 3LL3A 2H3GX 3JS6A 1Q18A 5FPNA 3ENHA 5HL7L 4ILHA 5LJVA 4IZ9A 1SAZA 1Y64A 2CGKA 4YOUA 5EY4A 4WYBA 4XH1A 1RDWX 3CQYA 2EWSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GLA G;  5AQU A;  2GWJ A;  3FZK A;  2D0O A;  3M3Z A;  1C0G A;  1Z05 A;  2P9K B;  4RTF D;  5FPM A;  2P9K A;  4XEI A;  3DXK B;  2NZT A;  3GBT A;  2J4R A;  1T6C A;  1DKG D;  1YXQ A;  3O6W A;  5ELZ A;  3DXK A;  1JCE A;  1YAG A;  1G99 A;  2A42 A;  4BC3 A;  3W3D A;  2QM1 A;  5BN9 A;  4BG9 A;  3C0B A;  4H0Y B;  3DXM B;  4EHU A;  3H6E A;  2OAN A;  5BRE A;  2V52 B;  2ZGZ A;  4ISF A;  5KPT A;  3H1Q A;  3VES A;  4BR7 A;  1GLB G;  4BRK A;  3HBT A;  3KVG A;  3ATU A;  4BC5 A;  3EKS A;  4BRM A;  2E1Z A;  4CD1 A;  2AP1 A;  4L3Q A;  3A5N C;  5AQN A;  3FE1 A;  3FGU A;  3QML A;  3WEE B;  5AFU A;  4FWK A;  2FSK A;  3WEE A;  4BVO A;  2GUP A;  3LDQ A;  1C0F A;  3MN6 A;  4CBU A;  5AQS A;  2E8A A;  4PKG A;  2ITM A;  1ESV A;  3AY9 A;  4FSV A;  3HM8 A;  3LDO A;  4F9O A;  4YDU C;  3G25 A;  3DJC A;  4QS8 A;  4BVP A;  4B1W B;  4EIA A;  5AQQ A;  3O1W A;  3UE5 A;  1J6Z A;  1GLJ O;  3I33 A;  3L0Q A;  3L6Q A;  4NB4 A;  1E4G T;  3ZX0 A;  5AQM A;  1HKC A;  3SMS A;  4H03 B;  2CGJ A;  5CE3 A;  2FXU A;  1ZXO A;  3QB0 A;  4MLE A;  3SJH A;  4BC2 A;  2FSN A;  3TU5 A;  2QWP A;  5JLF A;  1T6D A;  4BRA A;  4H0T B;  3VEN A;  4JAX A;  4H5T A;  3KHY A;  4M63 C;  2FSJ A;  2A41 A;  4YDU A;  2GEM A;  5EOY A;  5JLH A;  1TYQ B;  4CI6 A;  5JMV A;  2BTF A;  1TUU A;  1TYQ A;  3H3O B;  5AQR A;  3IUC A;  4A61 A;  4EHT A;  4PKH A;  4C23 A;  3LDN A;  1ATS A;  3O4W A;  3U8X A;  4BC4 A;  3QBW A;  4WQ5 C;  2Q1N A;  3VF2 A;  3LDP A;  4BR5 A;  2W41 A;  3QIC A;  2BUP A;  4CJ7 A;  3F9M A;  4ISG A;  3QBX A;  4JN4 A;  3QFP A;  1H1V A;  5ADX A;  1ATR A;  3UKU B;  3VEY A;  3MN7 A;  3UKU A;  1MWM A;  4BRD A;  1KAY A;  2YHW A;  1BA1 A;  3JXU A;  5AQZ A;  3S41 A;  1WOQ A;  1BO5 O;  4PL8 A;  3ATV A;  3IFR A;  1T44 A;  3CI5 A;  1S22 A;  4JD2 B;  4EFH A;  1NGG A;  2E2O A;  1K8K B;  5LY3 A;  2P9I B;  4JD2 A;  1JCF A;  4WQ5 A;  1K8K A;  4GNI A;  3MN9 A;  3ULE B;  2E88 A;  2Q0U A;  5AFU H;  3RSE B;  1HKG A;  3ULE A;  5BR9 A;  4BRH A;  3RSE A;  3HI0 A;  2VWB A;  4BR9 A;  3W0L A;  2VCP A;  1MA9 B;  2QWQ A;  4K41 A;  5AQX A;  3EN9 A;  4IXC A;  1X9J A;  5F0X A;  2P9L B;  1ZC6 A;  4M7Y A;  4H5V A;  4O8K A;  2V51 B;  2P9L A;  5E84 A;  2A6A A;  2QWL A;  3R8E A;  3P4I A;  1XUP O;  4BRO A;  2E2N A;  2DPN A;  3AAQ A;  4BR4 A;  4FWO A;  3WXJ A;  4QS7 A;  3DXM A;  3O08 A;  4FOI A;  4FWS A;  3M6G A;  3M1F A;  4PL7 A;  3QFU A;  3OHR A;  1D4X A;  1GLC G;  2CH6 A;  4I6M B;  2CH5 A;  4I6M A;  4H5W A;  5TKY A;  4DHY A;  5AQK A;  3VEO A;  4CZL A;  2V7Y A;  2Q31 A;  1HUX A;  2E1Y A;  2P9N B;  3CER A;  4EAH D;  2D1K A;  5FPE A;  2P9N A;  2I7P A;  1NGE A;  3H45 C;  1NGB A;  1NWK A;  1Z6R A;  3ENO A;  3O5B A;  1X3N A;  1HKB A;  1ATN A;  2ASO A;  1XC3 A;  1QQM A;  4FO0 A;  4BGA A;  3U9D A;  2A5X A;  2WUS A;  4H5R A;  1MWK A;  4HTL A;  4AM7 A;  4A62 A;  5AQI A;  2Q2R A;  2YCH A;  5AQO A;  1RGI A;  4DQ8 A;  2FF6 A;  5BRD A;  2F9W A;  3GL1 A;  3VGM A;  1NGA A;  4B1Z A;  2QWN A;  1RFQ A;  5KQD A;  2CGL A;  2QXL A;  4FPB A;  3VF6 A;  3ZEU B;  3R6M A;  5ADX H;  4LC9 B;  3ZEU A;  4DB3 A;  4FWR A;  2KHO A;  4MO4 A;  2V7Z A;  2ZF5 O;  1GLF O;  3FZF A;  3O8M A;  4QS9 A;  3GOI A;  4BRL A;  1QQO A;  3CQX A;  3U9Z A;  5AQP A;  3WXK A;  4BRI A;  5E26 A;  3FZM A;  2QWO A;  3A8Y A;  3BF1 A;  3WQU A;  3UKR B;  4FWM A;  4GY2 B;  2HF3 A;  1BUP A;  3UKR A;  5AQF A;  4IJA A;  4MLH A;  5AQH A;  2AA4 A;  5EVZ A;  1S3X A;  2P9S B;  4Y0W A;  5BPM A;  4RWT A;  1QHA A;  3LM2 A;  2P9S A;  4HWI A;  3SK3 A;  4E1J A;  3IDH A;  1GLE G;  2P9P B;  2QWR A;  3EO3 A;  3WXL A;  4CZG A;  2FLO A;  2P9P A;  2D4W A;  5AQY A;  1NGI A;  1OKJ A;  3VOV A;  3D2F B;  1NM1 A;  1QQN A;  3C7N B;  4IJN A;  1HJO A;  1BDG A;  3D2E B;  3D2F A;  3C7N A;  5KQ8 A;  4H0P A;  3D2E A;  3VET A;  3DWL A;  3L4I A;  5F1X A;  4JNE A;  1HX1 A;  4CZM A;  1U6Z A;  3A5O C;  3CIP A;  3O80 A;  3BF3 A;  5LJW A;  2ASP A;  1U2V B;  4A2B A;  4RCH A;  2P9I A;  3AAR A;  1BOT O;  4WQ4 C;  1U2V A;  2HOE A;  3DAW A;  4B1V A;  1TUY A;  1ZBS A;  2YI1 A;  3VEV A;  4IWV A;  3HSC A;  4JHD B;  5AQT A;  2UYT A;  1NGD A;  4BRE A;  4JHD A;  5EX5 A;  1DGK N;  2W40 A;  2QW9 A;  2ZGY A;  3CHW A;  4MO5 A;  3WUH A;  2E20 A;  1CZA N;  1KXP A;  3D7E O;  5F2R A;  4BRN A;  3U4L A;  5BPN A;  3J8A A;  4FWL A;  4CBX A;  1NBW A;  3QDK A;  1NLV A;  3MDQ A;  3FZH A;  4CZF A;  3A5L C;  3LDL A;  3ID8 A;  3WXI A;  4H0O A;  5BPL A;  3VF4 A;  1JCG A;  2D0P A;  4FWQ A;  2VYP A;  4K43 A;  1BG3 A;  3VEX A;  4B1Y B;  3A0I X;  1KAX A;  4CZK A;  4WQ4 A;  3BP8 A;  2PAV A;  3GE1 A;  4AM6 A;  5B8H A;  1X3M A;  2E2Q A;  2PBD A;  2NRH A;  3CJC A;  3EKU A;  4B1U B;  4H0V B;  3VGK A;  3MCP A;  4BR0 A;  4CZH A;  2GWK A;  4BQL A;  4CZI A;  3FLC O;  3VPZ A;  1NGJ A;  3CJ9 A;  5JIC A;  2ZWH A;  4B9Q A;  4FL9 A;  4DCH A;  1DEJ A;  2A3Z A;  3SLC A;  3EL2 A;  3FR0 A;  1WUA A;  1P8Z A;  1V4T A;  1NGF A;  3WQT A;  4BG8 A;  3LM9 A;  4FOE A;  1BU6 O;  2IVP A;  3VER A;  2FF3 B;  3EZW A;  1SZ2 A;  5BRH A;  1HPM A;  3CJA A;  3A5M C;  4H5N A;  5BRF A;  1IG8 A;  2HF4 A;  3H3N O;  3KZB A;  3MMV A;  4H0X B;  4BR2 A;  4K42 A;  5AQL A;  1GLL O;  3WT0 A;  2ASM A;  3AAP A;  2Q0R A;  5AR0 A;  1KAZ A;  1R59 O;  3CJ1 A;  4BRQ A;  2YHY A;  3HZ6 A;  1YUW A;  3H1V X;  5AZJ B;  4Z94 A;  1BA0 A;  2YJF A;  1XQS C;  2QWM A;  5AZJ A;  1BWF O;  3GG4 A;  1GLD G;  3VEZ A;  3ZX3 A;  4ISE A;  5I9E B;  5AQV A;  2P9U B;  4CD3 A;  2NLX A;  1LCU A;  2P9U A;  3GDQ A;  3I8B A;  2Q97 A;  3BUZ B;  1NGH A;  2IVO A;  4K25 A;  1V4S A;  3O1B A;  3IMX A;  3TPQ A;  4CZJ A;  1E4F T;  2A40 A;  3UB5 A;  3HTV A;  1QZ6 A;  1LOT B;  4FWP A;  1EQY A;  3H46 O;  5AZI B;  4CBW A;  4BRG A;  2Q36 A;  5AZI A;  4BQZ A;  3CET A;  4J8F A;  2GTD A;  3B8A X;  3FFK B;  3SMP A;  4IO8 A;  3R9P A;  5AQJ A;  4BRC A;  4BRF A;  1HLU A;  4FWN A;  4XH5 A;  2F9T A;  1NGC A;  3MK6 A;  4M7X A;  5AQW A;  4O5F A;  2IIR A;  4FPA A;  4A2A A;  3MN5 A;  4BRP A;  2GEL A;  2YHX A;  4PKI A;  3ZET B;  4BGB A;  3FZL A;  5FPD A;  2YJE A;  3VEW A;  3ZET A;  4KBO A;  3CJB A;  1MDU B;  1NMD A;  3BEX A;  4B1X B;  4NO7 A;  5AQG A;  2HMP A;  2I7N A;  1QZ5 A;  2IVN A;  4CZE A;  3ZX2 A;  5KPZ A;  1IJJ A;  5KPR A;  4XH4 A;  1SQK A;  3CJ7 A;  3VGL A;  5BN8 A;  5EXW A;  1YVN A;  2E2P A;  3LL3 A;  2H3G X;  3JS6 A;  1Q18 A;  5FPN A;  3ENH A;  5LJV A;  4IZ9 A;  1SAZ A;  1Y64 A;  2CGK A;  5EY4 A;  4WYB A;  4XH1 A;  1RDW X;  3CQY A;  2EWS A; 
#chains in the Genus database with same CATH topology
 5AQU A;  3FZK A;  2O8C B;  3HP9 A;  3HXM A;  2KFN A;  3L2W A;  1YF5 L;  2P9K B;  1N5Y A;  5FPM A;  2ITG A;  3T3F A;  3DXK B;  2NZT A;  3GBT A;  3NF7 A;  1HNZ K;  3CCL N;  1T6C A;  1YXQ A;  1KTQ A;  2JGU A;  4CEE A;  1XWL A;  4H8K A;  4BC3 A;  1NKE A;  3G10 A;  3OYK A;  2VGN A;  3DXM B;  4DFP A;  5BRE A;  4JI0 K;  2V52 B;  2ZGZ A;  4ISF A;  4AH9 A;  4JKE A;  4CHP A;  5KPT A;  1N36 K;  4B3O A;  5KTQ A;  3EE8 A;  4JI6 K;  2X6S A;  1TK5 A;  3EKS A;  1NKB A;  4DSK A;  4CD1 A;  1QE1 A;  1HQU A;  2G8K A;  1S72 N;  4ILJ A;  5KI6 A;  3QML A;  3WEE A;  3BGR A;  3MN6 A;  5GAH P;  5AQS A;  4K0K K;  3AGR A;  3C6T A;  4KO0 A;  1ESV A;  2Z1J A;  4FSV A;  3LDO A;  1RT1 A;  1TKX A;  4QS8 A;  3AVL A;  5SWM A;  4QCL A;  4FJ7 A;  3O1W A;  3D6R A;  3UE5 A;  1J6Z A;  1IBM K;  4CHY A;  4HHT A;  4NLC A;  4FW2 A;  3I33 A;  1E4G T;  1RTD A;  2FBX A;  4L8R B;  2F4V K;  3G4S N;  3SMS A;  3OS0 A;  3I8D A;  5DM7 L;  4E7J A;  5C0Y A;  2O8D B;  1RBU A;  4BDZ A;  3AO3 A;  3P38 A;  4CFC A;  4MLE A;  3LP0 A;  2P5G A;  3K5O A;  1BGX T;  5EU7 A;  4JAX A;  1LWC A;  3L3U A;  2FSJ A;  4LSN A;  3AVG A;  3THW B;  3AVN A;  5EOY A;  1TYQ B;  3OYB A;  1VSH A;  4CGG A;  3MWT A;  3AVH A;  4V19 S;  4PKH A;  4CJS A;  1O1W A;  5I42 A;  3CYM A;  1ATS A;  1LAW A;  1WAJ A;  3OYJ A;  1HYZ A;  4IG3 A;  4IDK A;  3F9M A;  3NGY A;  5J1E A;  4ISG A;  3QFP A;  2X78 A;  1H1V A;  3MN7 A;  4KTW A;  1O13 A;  3UKU A;  1MWM A;  4BRD A;  1ASW A;  1KAY A;  2YHW A;  4NLB A;  3ZSY A;  5M1K A;  4IBN A;  4TSX A;  1NKC A;  4YFU A;  1T44 A;  3M8P A;  1WLJ A;  3QEI A;  4JD2 A;  4WQ5 A;  1K8K A;  5M1F A;  3OJS A;  1N33 K;  4Y1D A;  4CIG A;  4BRH A;  4OLB A;  1TV6 A;  4BR9 A;  2VCP A;  4IXC A;  4DLE A;  4KHP K;  4H5V A;  3HYF A;  1FKO A;  3CPW M;  4B08 A;  2XY5 A;  2E6M A;  4EZ9 A;  5J2Q A;  3QET A;  4O5B A;  3R3L A;  3NH1 A;  4IFV A;  2QTD A;  1QSY A;  3MAQ A;  3DXM A;  3V9U A;  2IS3 A;  1VSE A;  3P83 D;  4DSF A;  3SAG A;  3OBY A;  4FWS A;  4KHS A;  3E9L A;  1UOC A;  3OHR A;  1ZBH A;  3KKR A;  4GV9 A;  2BH1 A;  5TKY A;  4KI6 A;  5AQK A;  4MFB A;  3VEO A;  2BE2 A;  4B3S K;  3NVM A;  4EAH D;  4B9T A;  1HYS A;  2P9N A;  2I7P A;  3DLB A;  3H45 C;  1VSJ A;  3ENO A;  3P5J A;  1EXQ A;  4Z0U A;  4ILG B;  5CHI A;  2P51 A;  2XY8 A;  3V81 A;  4HTL A;  1Q9X A;  4AHV A;  3THV A;  1L3S A;  2YCH A;  5CYM A;  1RGI A;  1UA1 A;  4OPH A;  5BRD A;  4G1Q A;  2WON A;  3GL1 A;  3VGM A;  5KQD A;  2CGL A;  4KH6 A;  5C15 A;  3SAF A;  5ADX H;  3ZEU A;  3DLE A;  4FWR A;  4JKF A;  3NAE A;  2KHO A;  4AF1 A;  4MO4 A;  2V7Z A;  2ZF5 O;  1GLF O;  1RDC A;  3O8M A;  4Z4E A;  4QS9 A;  4DS5 A;  4JS4 A;  1RTJ A;  3FZM A;  1HYV A;  4GY2 B;  4M45 A;  4FLY A;  3TAP A;  1E3M A;  1A5W A;  4IJA A;  1N8R O;  2HW3 A;  5BPM A;  1WSE A;  4EP5 A;  4ELV A;  4E1J A;  4H4M A;  5LMN K;  4C8M A;  4F2R A;  2QWR A;  4N56 A;  4NCG A;  5HRO A;  4MDB A;  1NGI A;  2KFZ A;  1OKJ A;  2PFU A;  3C7N B;  3RRG A;  1HJO A;  1LW2 A;  3D2E A;  2F8T A;  3DWL A;  5F1X A;  3VQE A;  4F3T A;  1X1P A;  4YOX A;  1ZBL A;  2F7T A;  4CF9 A;  3CIP A;  1BIU A;  3O80 A;  3BF3 A;  3EY1 A;  3MXM A;  3ZSO A;  3IAY A;  4RCH A;  3AAR A;  1BOT O;  2HOE A;  3DAW A;  4B1V A;  4DUZ K;  4W5T A;  4AQY K;  4QAG A;  3LPU A;  1OH7 A;  4CF2 A;  4JHD A;  3CHW A;  3J7Z O;  4MO5 A;  2OCE A;  5E41 A;  4ID1 A;  2GV9 A;  2A1S A;  1NK9 A;  3J8A A;  2O8B B;  2WOM A;  5FRO A;  3FZH A;  3LDL A;  3ID8 A;  4H0O A;  5BPL A;  4Z4C A;  1ZBU A;  4FLT A;  3MEE A;  1KQS M;  1JL1 A;  4B1Y B;  1OH8 A;  4CJU A;  3T1Y K;  1KAX A;  4AHC A;  3BP8 A;  2JWL A;  4DSJ A;  1WBB A;  3EKU A;  1EO1 A;  4H0V B;  3VGK A;  3MCP A;  3E66 A;  4NXN K;  1A5X A;  4CZH A;  3THY B;  1SL0 A;  1TL1 A;  2ETJ A;  3E1Y A;  2E6L A;  3VPZ A;  2KZZ A;  1NGF A;  3WQT A;  2IGI A;  3LM9 A;  1BQM A;  3OYI A;  4A59 A;  5KRT A;  2PZS A;  1SZ2 A;  3F9K A;  4E3S A;  3SUO A;  5BRH A;  2FBV A;  4KB1 A;  4M3X A;  1U04 A;  3AA2 A;  2HF4 A;  3H3N O;  3LAN A;  3KZB A;  3LDS A;  1KVC A;  3PY8 A;  1GLL O;  1TKZ A;  2ASM A;  2HNZ A;  2BGG A;  3ZT3 A;  3O3F A;  2YHY A;  3HZ6 A;  3PUF A;  1YUW A;  3H1V X;  4W5N A;  3VQB A;  2QWM A;  5AZJ A;  4FJ9 A;  4OKK A;  3CCS N;  3GG4 A;  4JI3 K;  1GLD G;  4DV4 K;  3ZX3 A;  4ISE A;  2HHQ A;  4CJW A;  2NRZ A;  3G6E N;  3GDQ A;  4M3Y A;  3NF8 A;  4B8A B;  2IVO A;  4FJH A;  1HJR A;  1V4S A;  4CZJ A;  1X9S A;  1HNI A;  2A40 A;  1QQC A;  3HTV A;  4JI1 K;  3SQ2 A;  3Q7B A;  1S6Q A;  1VQ6 N;  1LOT B;  4JKC A;  1EQY A;  4CBW A;  4YY3 K;  3SV4 A;  5AZI A;  4CIF A;  4N41 A;  3CET A;  3B8A X;  3N4P A;  1NGC A;  3MK6 A;  4M7X A;  4QOZ B;  1D9F A;  5D3G A;  4A2A A;  1LWE A;  3MN5 A;  4EP4 A;  1UAX A;  3NGI A;  4KBO A;  3CJB A;  3O4Q A;  4B3M K;  4DV7 K;  3K57 A;  3SYZ A;  3ZX2 A;  2D0C A;  2QKK A;  1IJJ A;  3CF5 L;  3VQ9 A;  4AHT A;  1VQ7 N;  3M8R A;  1NOZ A;  2WC9 A;  2E2P A;  1WSH A;  4LY7 A;  4NYF A;  4JI4 K;  1NOY A;  1ZYQ A;  5FPN A;  3MXI A;  4ILH A;  4IZ9 A;  1SAZ A;  3OVN A;  3PSI A;  4F2S A;  5EY4 A;  4YOU A;  4XH1 A;  1JLG A;  1RDW X;  3M8S A;  1GLA G;  1VRT A;  4RTF D;  4HCB A;  4C8K A;  4XEI A;  1VSI A;  4LSL A;  4DLG A;  3P39 A;  5JS1 A;  1JCE A;  3DLR A;  5K14 A;  3ID6 A;  3TAG A;  1G99 A;  2A42 A;  2F96 A;  4PWD A;  1CLQ A;  5HBM A;  1J5O A;  2HNY A;  5IWA K;  4H0Y B;  4EHU A;  2BAN A;  2OAN A;  4CJQ A;  1HMV A;  3L2U A;  4CJL A;  1S6P A;  1RBV A;  3KVG A;  4BRM A;  4JI2 K;  3KLI A;  2E1Z A;  2KQ2 A;  3FE1 A;  3IRX A;  2HHT A;  3AVK A;  3WEE B;  5AFU A;  1C0T A;  1Z26 A;  4BVO A;  3I0S A;  2OYQ A;  3LDQ A;  5MLC Q;  1KCF A;  3EYZ A;  3V9Z A;  1YIT N;  3T1A A;  1IO2 A;  4FM1 A;  1TL3 A;  2E8A A;  4DG1 A;  2G8W A;  3AY9 A;  2OPS A;  2IAJ A;  4YDU C;  4CJK A;  1FJG K;  4B1W B;  4EIA A;  1D8Y A;  1NG9 A;  3L3V A;  4JS5 A;  3NVK A;  1HKC A;  1LW0 A;  2CGJ A;  5CE3 A;  2FXU A;  4BDP A;  4LF7 K;  1J54 A;  3Q7C A;  3OYM A;  3QB0 A;  5M1O A;  3I0R A;  2PYJ A;  2FSN A;  3PV8 A;  5HRR A;  4ZTF A;  3B6P A;  4FW1 A;  5JLF A;  2KKZ A;  4BRA A;  4H0T B;  3VEN A;  3KHY A;  4M63 C;  3HOT A;  4BY9 C;  2JWK A;  2BTF A;  3PSF A;  4GV6 A;  2HBL A;  2LSN A;  4EHT A;  3KD1 E;  4C23 A;  3TR8 A;  3IKM A;  3G71 N;  2FBT A;  3U8X A;  3DOL A;  4NYN A;  4BC4 A;  1RTH A;  3QIC A;  3C65 A;  2BUP A;  4CJ7 A;  4LF5 K;  1J9A A;  4E1M A;  4DSL A;  4JN4 A;  2VG7 A;  3UKU B;  4AHS A;  1FW6 A;  4LF4 K;  4JV5 K;  3K5M A;  3ULD A;  3E9O A;  1BO5 O;  4PL8 A;  3ATV A;  3SQ0 A;  3MEC A;  4B9N A;  2DTU A;  1S22 A;  4JD2 B;  4DV3 K;  1NGG A;  1T03 A;  2E2O A;  1K8K B;  5LY3 A;  1CZB A;  2OZS A;  1FXX A;  3MN9 A;  1HQE A;  2Q0U A;  4ID5 A;  1HKG A;  3ULE A;  2YNH A;  3HI0 A;  3RSE A;  4KI4 A;  3W0L A;  4K41 A;  3SV3 A;  1VQK N;  2OTL N;  4OX9 K;  1X9J A;  5F0X A;  4CK3 A;  4B9S A;  2D5R A;  3OYA A;  2OZM A;  4DR4 K;  4KHQ A;  4H4O A;  3AVJ A;  3R8E A;  4YOW A;  4BRO A;  3HVR A;  3AAQ A;  1VQM N;  4DTR A;  2I5J A;  5HLF A;  4CEF A;  4QS7 A;  3O08 A;  5HOO A;  4FOI A;  3M6G A;  4J2E A;  2X6N A;  3CFP A;  1GLC G;  1XI1 A;  4LH4 A;  3SUN A;  4DHY A;  4EZ6 A;  4C8O A;  1VSF A;  2ZM6 K;  4IKF A;  2FBY A;  2VQF K;  2Q31 A;  2P9N B;  3VMF B;  4CHN A;  3VQP A;  3WNH A;  1YJN N;  4Q0B A;  4IOX A;  4DTS A;  3O5B A;  1DTQ A;  1HKB A;  4CF1 A;  1QQM A;  4FO0 A;  3U9D A;  2A5X A;  1JL2 A;  3LAK A;  4H5R A;  1MWK A;  4MQ3 A;  2P5O A;  3NE6 A;  4FJK A;  5AQO A;  4J2D A;  4WF9 L;  3P1G A;  2OPQ A;  2F9W A;  4FK4 A;  4FYD A;  4DR5 K;  3PX0 A;  4YHH K;  3ZEU B;  1CZ9 A;  5DM6 L;  4FJX A;  3HJF A;  1QTM A;  3TTC A;  3CXC M;  3I55 N;  3CG7 A;  4WCE L;  4W5O A;  3AVB A;  1FKP A;  3ZYY X;  1NMN A;  2QWO A;  3CFO A;  4HTU A;  4CCH A;  3UKR A;  1VSD A;  3SNN A;  3LP2 A;  1UWB A;  4CFB A;  3CPE A;  4Y0W A;  1TK0 A;  5GIO A;  4E7I A;  4KHW A;  2VGM A;  4CER A;  3SK3 A;  4DQI A;  4CFA A;  3IDH A;  4BE0 A;  4CZG A;  3DLL L;  2D4W A;  4PY5 A;  3VOV A;  3V9X A;  3MWP A;  3ISN C;  3MX2 A;  3TAN A;  1NM1 A;  1OH5 A;  4DTM A;  3D2E B;  1BDG A;  4F3O A;  3VQ8 A;  4U7B A;  4DS4 A;  1JLQ A;  1VSL A;  3J7Y P;  4FK0 A;  1HX1 A;  1RBS A;  4DV5 K;  3JSM A;  1GOA A;  4A5A A;  4DF8 A;  4PUO A;  4OVL A;  2NRT A;  4DQQ A;  5LJW A;  3HPH A;  5FRM A;  4WQ4 C;  4FM2 A;  3ZT0 A;  1IBK K;  2UXB K;  1ZBS A;  2D0A A;  3TAR A;  3V1R A;  3M5R A;  3VEV A;  5AQT A;  4JHD B;  2G8V A;  1D9D A;  1WSF A;  4BRE A;  4FXD A;  2O8F A;  3J80 O;  2W40 A;  2QW9 A;  3WUH A;  4JKB A;  2XY6 A;  1CZA N;  1KXP A;  3R1X A;  4BRN A;  2HHU A;  5C2F A;  4K8X A;  4CBX A;  1GOC A;  3QDK A;  1NLV A;  4DKW A;  3A5L C;  3SPZ A;  1K8A O;  2NUB A;  1VQP N;  1Q86 O;  4Z4G A;  3VF4 A;  3HT3 A;  1JCG A;  2IDO A;  3KK2 A;  2JLE A;  3VEX A;  4KHU A;  2YHA A;  3A0I X;  1NJZ A;  2QKB A;  5KRS A;  2PAV A;  4AM6 A;  4DV1 K;  1C1C A;  5B8H A;  4GVE A;  2E2Q A;  1RT4 A;  4OLA A;  4M3T A;  4IOC L;  1BL3 A;  1NNE A;  4PQU A;  2GWK A;  1W0H A;  4CZI A;  3FLC O;  1TVR A;  1NGJ A;  3CJ9 A;  2HHW A;  4MDA A;  2ZWH A;  4B9Q A;  1M1K O;  4DCH A;  4FJ5 A;  4CEQ A;  3EL2 A;  4JK9 A;  3ZSR A;  2W6L A;  4DFM A;  1YHQ N;  4CIE A;  4FVU A;  1VSM A;  4Z4I A;  3A5M C;  4M41 A;  3OS2 A;  1OH6 A;  1HNX K;  4H5N A;  4DWI A;  4DTN A;  4H0X B;  1JXE A;  3MMV A;  3CFR A;  1K73 O;  3HPG A;  4CJT A;  2GX9 A;  5AQL A;  1WBD A;  3AAP A;  2DFH A;  2Q0R A;  3CJ1 A;  4BRQ A;  1TKT A;  5AZJ B;  4Z94 A;  2YJF A;  3CCU N;  1A5V A;  3NBP A;  1EWR A;  2B4J A;  3VEZ A;  3TAB A;  1WAF A;  5AQV A;  1LAV A;  3QER A;  2P9U A;  3I8B A;  2YKM A;  1NGH A;  1WSI A;  1S1V A;  3AGK A;  3TPQ A;  3UB5 A;  1SKW A;  4C1N K;  3KWI A;  5C10 A;  4FJM A;  3CC7 N;  1NK6 A;  4FJ8 A;  5AZI B;  2NRW A;  2Q36 A;  3K2P A;  4LF9 K;  4J8F A;  2GTD A;  3FFK B;  2UUA K;  3SMP A;  4IOA L;  3LWM A;  3S3N A;  1JLE A;  4J2A A;  2F9T A;  2UUC K;  4CEZ A;  4BDY A;  3NFA A;  3VQA A;  3HP6 A;  2VG6 A;  2GEL A;  1VQ9 N;  2YHX A;  4PKI A;  4BGB A;  2E4L A;  3VQ7 A;  2YJE A;  4DQS A;  3ZET A;  3O4N A;  3VN5 A;  3IG1 A;  3AA5 X;  3DLG A;  1SKS A;  3V4I A;  4LFA K;  1NMD A;  3BEX A;  3HVT A;  2OPR A;  3K59 A;  3AA4 A;  5CZ1 A;  1IKV A;  3OYF A;  3VA0 A;  2YNI A;  5CZ2 A;  4A5B A;  3VTH A;  3CCV N;  4HCC A;  3JS6 A;  1Q18 A;  4I9L A;  2BDP A;  3ENH A;  1Y64 A;  3V9W A;  2CGK A;  4WYB A;  2GWJ A;  3M3Z A;  1T8E A;  3S3O A;  1C0G A;  1Z05 A;  4ELT A;  1W7A A;  2QEX N;  5T7B A;  1DKG D;  3O6W A;  1Y97 A;  4FVM A;  5ELZ A;  1U47 A;  2HHS A;  2E5L K;  1YAG A;  3J7A P;  1T05 A;  3NGZ A;  2QI2 A;  4JKD A;  1WSG A;  2QM1 A;  4LFC K;  3DRP A;  5BN9 A;  4BG9 A;  3G0Z A;  1ZBF A;  4CGD A;  1HNW K;  4KRF A;  3H6E A;  1J53 A;  4RW4 A;  3H1Q A;  4BR7 A;  4M3U A;  3HBT A;  1BQN A;  3RMC A;  2WTU A;  2AP1 A;  4L3Q A;  1KFD A;  3A5N C;  3K0S A;  3FGU A;  4O44 A;  4GV3 A;  4CEB A;  1RIL A;  4IO9 L;  2FSK A;  2D0B A;  3SJJ A;  3OTO K;  3ZSZ A;  2ATQ A;  1C0F A;  1VQ5 N;  4CBU A;  3LP3 A;  1KD1 O;  2A1R A;  2UXC K;  1S1X A;  4PKG A;  2ITM A;  3CCQ N;  3HM8 A;  4F9O A;  3QEW A;  2UU9 K;  3WXM B;  1ZBI A;  1NK7 A;  1JLF A;  3QIO A;  1GLJ O;  4KRE A;  3L0Q A;  4NB4 A;  3L6Q A;  3C6H A;  3ZX0 A;  5AQM A;  2NRX A;  4KHN A;  3LAL A;  1ZXO A;  3OYG A;  5GIP A;  3QES A;  2B6A A;  3SJH A;  4BC2 A;  1RDU A;  4CJ3 A;  4A57 A;  4LD0 A;  1T6D A;  4H5T A;  4M42 A;  4DR3 K;  4YDU A;  2GEM A;  5JLH A;  4DUY K;  4CI6 A;  3H3O B;  4X65 K;  4A61 A;  3EEQ A;  1RT3 A;  3LDN A;  3SQ4 A;  4ZHR A;  3QBW A;  3VF2 A;  2Q1N A;  3QEV A;  2W41 A;  3VA3 A;  3VQ5 A;  3S3M A;  4RW9 A;  3VQQ A;  3L4Q A;  4LF8 K;  5C24 A;  1ATR A;  1RCH A;  3VEY A;  2Z1H A;  1QSS A;  3ZSX A;  4RG8 A;  2G8H A;  3KIO A;  3BDP A;  4C8L A;  4IEE A;  3AA3 A;  5CYQ A;  3JXU A;  5AQZ A;  3S41 A;  4RW7 A;  5SZT A;  2P1J A;  3CI5 A;  4WFA L;  3V1O A;  3E9P A;  1VAZ A;  4GNI A;  3ULE B;  5AFU H;  3RSE B;  5BR9 A;  1IKX A;  1IH7 A;  4DV2 K;  2VWB A;  2QWQ A;  3EN9 A;  3CMA N;  4KAZ A;  4Z4F A;  4M7Y A;  2P9L A;  5E84 A;  1T3V A;  4FM0 A;  3ZT1 A;  3P4I A;  2PYL A;  3VQ6 A;  2ZJR L;  2DPN A;  2Y1I A;  2QA4 N;  4BR4 A;  1EP4 A;  1X9W A;  3ZCM A;  4CJE A;  4B9U A;  4M3W A;  5DK5 A;  3JAM O;  3L2R A;  4KTZ A;  4JI7 K;  4PL7 A;  5AJ3 K;  1I94 K;  3K9K A;  1D4X A;  2G8I A;  2CH6 A;  2YNF A;  2O4I A;  1ASV A;  4I6M A;  2V7Y A;  1KC8 O;  1BCM A;  4C8N A;  1HUX A;  3O9S A;  4IFE A;  3PX6 A;  2HHH K;  1YTU A;  3TAF A;  1XNQ K;  2RPI A;  4JRQ A;  1NGE A;  3N4Q A;  4OPK A;  4DQP A;  4CK2 A;  1NGB A;  1NWK A;  4JK8 A;  4WFB L;  4BE1 A;  1X3N A;  4ICL A;  1ATN A;  4YOT A;  1XC3 A;  3KKS A;  4BGA A;  3AVA A;  3HPO A;  3C95 A;  3TSP A;  3KD5 E;  4AM7 A;  1Q7Y O;  5AQI A;  2Q2R A;  1S9E A;  5M1P A;  2IOC A;  4DQ8 A;  3T1H K;  2FF6 A;  3BY5 A;  1JLB A;  4B3T K;  1NU0 A;  4B1Z A;  2QWN A;  1RFQ A;  3ZT2 A;  3HM9 A;  3PIP L;  2XHB A;  5A2Q O;  4FPB A;  4CF8 A;  1TAQ A;  1VQ4 N;  4LC9 B;  4FCY A;  1BCO A;  1Q9Y A;  1CXQ A;  3CCR N;  4ELU A;  4DFJ A;  3GOI A;  3TTD A;  2HHV A;  1QQO A;  3CQX A;  5AQP A;  5M1Q A;  1RDD A;  2XRI A;  3AVI A;  3CC2 N;  2WFB A;  3SPY A;  2UUB K;  3BF1 A;  1NJX A;  3KLE A;  3UKR B;  2VQE K;  1W2B M;  4PHT X;  2HF3 A;  1BUP A;  4DV0 K;  2RF2 A;  4O8U A;  5AQF A;  4CGJ A;  5AQH A;  3KJV A;  4JI8 K;  4RWT A;  4IFY A;  1QHA A;  2O8E A;  2P9S A;  4HWI A;  1BI4 A;  3AVM A;  2RKI A;  3QLH A;  3T19 A;  5J2M A;  4IG0 A;  3WXL A;  4OKJ A;  2FLO A;  2P9P A;  2DFE A;  2ZD1 A;  1C1A A;  1SUQ A;  1IV0 A;  1QQN A;  4IJN A;  2QXF A;  3D2F A;  2HBJ A;  3WNE A;  1YIJ N;  4H0P A;  3VET A;  4R79 A;  2UXD K;  1W97 L;  4CZM A;  5JVG L;  3A5O C;  1J5E K;  1DTT A;  1SV5 A;  2ZJQ L;  1RT6 A;  1SS6 A;  4YOR A;  1RT7 A;  3K58 A;  1U2V A;  3LZJ A;  4E7L A;  1M90 O;  2AJQ A;  4OGC A;  2YI1 A;  3V6D A;  3HSC A;  2O8F B;  2UYT A;  2W42 A;  1NGD A;  2WBN A;  3DRS A;  3D0P A;  1YVU A;  5EX5 A;  1EKE A;  1NK4 A;  1KVA A;  3D7E O;  5C12 A;  5F2R A;  4CVN E;  3U4L A;  4O0J A;  1RBR A;  1ASU A;  2GBZ A;  3MDQ A;  4CZF A;  1TAU A;  3WXI A;  3ZT4 A;  2GUI A;  3F5T A;  1B9D A;  4FWQ A;  2VYP A;  4K43 A;  1BG3 A;  1B9F A;  2HB5 A;  4CZK A;  4WQ4 A;  3AVF A;  3GE1 A;  5DMR A;  1YI2 N;  4Z4H A;  2YKN A;  3PX4 A;  4I2P A;  4B1U B;  1VK0 A;  4BR0 A;  3KLH A;  3HO1 A;  4BQL A;  3NF6 A;  2NNW A;  4I7F A;  4OPJ A;  3AV9 A;  3SQ1 A;  5JIC A;  1QVG M;  1VRU A;  2A3Z A;  3SLC A;  1WUA A;  1P8Z A;  4BG8 A;  3PIO L;  1XHZ A;  1BU6 O;  1CXU A;  4OO1 J;  2HVI A;  4KKO A;  1HPZ A;  3QEX A;  3EZW A;  2RN2 A;  4HVJ A;  1P90 A;  4FJL A;  4N5S A;  1XMO K;  5GAG P;  4JK7 A;  3CJA A;  3K5N A;  1TKD A;  3HL8 A;  4KH5 A;  1IG8 A;  2HMI A;  4BR2 A;  2XO7 A;  4K42 A;  4B3R K;  3EE9 A;  3RMA A;  3WT0 A;  4FJJ A;  4DSE A;  3RWU A;  1Q81 O;  3DLH A;  1BA0 A;  1XQS C;  4CJ4 A;  1SKR A;  1OVY A;  1BWF O;  1RNH A;  1KRP A;  5GIN A;  3NF9 A;  5LL6 Z;  4CHQ A;  2P9U B;  3IS9 A;  4CD3 A;  1BIS A;  1GOB A;  1C0U A;  2NLX A;  3THX A;  4N47 A;  3BUZ B;  5J2N A;  4KFB A;  4Y1C A;  3AO1 A;  4K25 A;  3L2V A;  3IMX A;  4B9V A;  1E4F T;  2RHK A;  3TAE A;  1VQL N;  5HRP A;  3OYC A;  3C6U A;  4FWP A;  1HRH A;  4CHZ A;  1I39 A;  3C6A A;  3PLA A;  5FRN A;  4G9Z A;  4B9L A;  3VQ4 A;  1QS4 A;  4IO8 A;  5AQJ A;  3R9P A;  4BRC A;  4W5Q A;  2F8S A;  4BRF A;  1HLU A;  4IEI A;  3DM2 A;  4JKG A;  4FWN A;  5JS2 A;  2YX6 A;  4DTO A;  3P31 A;  2IIR A;  1VQO N;  4DR1 K;  5CR4 A;  4RW6 A;  1JXB A;  1YTA A;  1R0A A;  3ZET B;  1NK0 A;  3FZL A;  5FPD A;  1K6Y A;  5C25 A;  4FZX C;  3SZ2 A;  1NJI O;  3LZI A;  2Y1J A;  3KK1 A;  4CJR A;  5AQG A;  4AHU A;  2I7N A;  4DF4 A;  1QZ5 A;  2IVN A;  4I9Q A;  3KTQ A;  4CW7 B;  4KHY A;  5KPR A;  4LFB K;  4DTU A;  2PY5 A;  1SQK A;  3CJ7 A;  5EXW A;  4O4G A;  1ILY A;  5LMU K;  5HL7 L;  4CES A;  4CEC A;  2G8F A;  4FWK A;  2EWS A;  2D0O A;  2YHB A;  5BR8 K;  1VQN N;  2O8C A;  3CM6 A;  4CGF A;  2NRV A;  2OA8 A;  1VSK A;  2P9K A;  2J4R A;  1QHT A;  4DV6 K;  3DXK A;  3SUQ A;  4F4K A;  3DYA A;  3W3D A;  1W9H A;  3HST B;  3C0B A;  4JYA K;  1C1B A;  3RMD A;  3O9U A;  3T7Z A;  4UY8 O;  4JKA A;  4DR7 K;  1WNS A;  1L3T A;  3SUP A;  3VES A;  2VWK A;  3OW2 M;  1GLB G;  2HBK A;  4BRK A;  4X64 K;  3ATU A;  4BC5 A;  3AO2 A;  4BE2 A;  5AQN A;  1DLO A;  4DMN A;  3TSU A;  3SBG A;  3MCA B;  1S5J A;  4E7K A;  4M3Z A;  2GUP A;  4J2B A;  5FLX O;  4M3R A;  3OYD A;  1F21 A;  1XC9 A;  1KSP A;  1RBT A;  3ITH A;  2XY7 A;  4C1N I;  4OJR A;  3MEG A;  1Q82 O;  3G25 A;  3DJC A;  5C42 A;  4BVP A;  1L3V A;  1TGO A;  3NH2 A;  3OS1 A;  1N34 K;  5AQQ A;  1L3U A;  2HVH A;  5HRS A;  3TI0 A;  1YJW N;  4H03 B;  1D5A A;  4RW8 A;  4KH4 A;  3CM5 A;  1KVB A;  2B5J A;  2O8D A;  3J81 O;  3KK3 A;  3ENB A;  3TU5 A;  4DU3 A;  4R5P A;  4JRP A;  2QWP A;  1DT9 A;  4B8C A;  3TSQ A;  3EZ5 A;  2A41 A;  4CJF A;  1C6V A;  5KGX A;  3THW A;  1JLA A;  3DRR A;  5JMV A;  2ZE2 A;  3B6O A;  1TUU A;  1TYQ A;  4NXM K;  3WNF A;  5AQR A;  3IUC A;  3KLG A;  3MXJ A;  4CEO A;  3U3Y A;  1IBL K;  2DY4 A;  4YOY A;  1C0M A;  1LWF A;  4F8R A;  3O4W A;  1S1U A;  1FK9 A;  5TKW A;  5CY4 A;  4WQ5 C;  4BR5 A;  1WSJ A;  3LDP A;  1KLM A;  2YV0 X;  1WN7 A;  2G8U A;  1X9M A;  3QBX A;  1I3A A;  5ADX A;  1NK8 A;  1WB9 A;  4KTQ A;  4X66 K;  4FZY A;  2EX3 A;  1EX4 A;  4W5R A;  4GKK K;  1BA1 A;  4BAC A;  4O55 A;  1WOQ A;  4DU1 A;  3IFR A;  4IDH A;  1RT5 A;  4EFH A;  3O3G A;  4DU4 A;  4K8Z A;  1NJW A;  4CGI A;  4B9M A;  2P9I B;  3OYN A;  1JCF A;  4HUF A;  2E88 A;  3OA9 A;  2KW4 A;  4O0I A;  1MA9 B;  3NDK A;  2HHX A;  5AQX A;  1HNV A;  1MU2 A;  2P9L B;  1ZC6 A;  1S1T A;  3AO5 A;  2HBM A;  4O8K A;  2V51 B;  2A6A A;  4U67 L;  1EET A;  2QWL A;  1XUP O;  3KWG A;  2E2N A;  2OTJ N;  3NCI A;  4FWO A;  5FDL A;  3CD6 N;  4LH5 A;  3WXJ A;  3PO5 A;  1NJY A;  4DR6 K;  3M1F A;  3QIP A;  4WE1 A;  3QFU A;  4E19 A;  4ZTJ A;  4I2Q A;  1VQ8 N;  1N32 K;  2DFF A;  4I6M B;  3RR7 A;  4FJI A;  2CH5 A;  1RT2 A;  3O9Q A;  4H5W A;  1EWQ A;  4CZL A;  1RTI A;  3HRG A;  2HST A;  4X62 K;  2E1Y A;  3CER A;  2ZJP L;  5IT9 O;  2D1K A;  4CJV A;  5FPE A;  1Z25 A;  3LAM A;  1IG9 A;  3AVC A;  2R7Y A;  4FLZ A;  1Z6R A;  3PO4 A;  4CK1 A;  2ASO A;  3A2F A;  2WUS A;  3DI6 A;  3U3G A;  4CE9 A;  3RMB A;  4A62 A;  4FJN A;  3CCE N;  2W6K A;  1B92 A;  4DFK A;  3O9T A;  1NGA A;  3SBT A;  4CHO A;  1ITG A;  2FC0 A;  2QXL A;  1XNR K;  3SI6 A;  5HP1 A;  3VF6 A;  4Q5V A;  3S9H A;  3NMU A;  3R6M A;  4GW6 A;  4BWJ A;  4DB3 A;  3ZSV A;  5GAD P;  3CCJ N;  3VTI A;  3FZF A;  4FK2 A;  4BRL A;  2Z1I A;  3U9Z A;  3JYT A;  3WXK A;  4BRI A;  3F2K A;  5E26 A;  3E01 A;  1IKY A;  4HUG A;  1QSL A;  3LP1 A;  3A8Y A;  3WQU A;  4FWM A;  5KGW A;  3SAH A;  3I56 N;  3QO9 A;  4YOV A;  4MLH A;  4WFN L;  2AA4 A;  5EVZ A;  1S3X A;  2P9S B;  1U45 A;  2O8E B;  3CC4 N;  4CFD A;  1BI4 B;  1OVQ A;  3LM2 A;  3CME N;  4CJ5 A;  2KTQ A;  4E7H A;  4E89 A;  1GLE G;  3OYH A;  4OGE A;  2P9P B;  3EO3 A;  3TAQ A;  5AQY A;  3DMJ A;  3BZK A;  3D2F B;  4FLV A;  1K9M O;  1U4B A;  1TK8 A;  3C7N A;  5KQ8 A;  1YJ9 N;  5I3U A;  3BZC A;  5HRN A;  1T7P A;  3L4I A;  4JNE A;  1U6Z A;  4JKH A;  4GKJ K;  2ASP A;  1U2V B;  4A2B A;  2IC3 A;  2P9I A;  2Z1G A;  3C94 A;  1TUY A;  3CCM N;  4LF6 K;  4IWV A;  1QVF M;  1U48 A;  1N6Q A;  3U6F A;  3NHG A;  1RDB A;  4AHR A;  4GVM A;  2VG5 A;  3TWH A;  3ALY A;  1DGK N;  2ZGY A;  3H08 A;  3DLK A;  2E20 A;  1KLN A;  1U49 A;  5BPN A;  1S1W A;  4DTP A;  1IKW A;  2YNG A;  4FWL A;  1NBW A;  3MX5 A;  1G15 A;  1NK5 A;  2O8B A;  2RE2 A;  3OY9 A;  2VWJ A;  2D0P A;  3CQ8 A;  1BIZ A;  3ZSW A;  3K5L A;  2QK9 A;  4KB0 A;  3T69 A;  3NH0 A;  1REV A;  3VQD A;  3RTV A;  4DTX A;  1X3M A;  2NRR A;  3ZLJ A;  2PBD A;  2NRH A;  3CJC A;  4OKE A;  3QNO A;  4CF0 A;  3RRH A;  3THY A;  4UQG A;  3O9R A;  3F73 A;  3LPT A;  4FL9 A;  1DEJ A;  3FR0 A;  2OPP A;  1V4T A;  2Q3S A;  5H1S Q;  4FOE A;  2IVP A;  3VER A;  3HOS A;  3QIN A;  2FF3 B;  4CJP A;  4E1N A;  2O4G A;  5JVH L;  1SL1 A;  1VHX A;  4FLW A;  1HPM A;  5M1N A;  5BRF A;  4HUE A;  3SCX A;  3O3H A;  4KV8 A;  3M8Q A;  4FJG A;  3TTF A;  1BHL A;  3LWL A;  4KPY A;  3FFI A;  3MED A;  5AR0 A;  1KAZ A;  1R59 O;  3WNG A;  3OYE A;  3K9J A;  3V9S A;  3RR8 A;  3ASM A;  4NCB A;  4DTJ A;  5I9E B;  3THX B;  1YT3 A;  3RVC A;  1Q8I A;  1XHX A;  4FZZ A;  3OJU A;  1LCU A;  1JJ2 M;  2Q97 A;  1SL2 A;  3D45 A;  3O1B A;  2KZM A;  2X74 A;  3KLF A;  1QZ6 A;  3OBW A;  3L2Q A;  5C2D A;  1UA0 A;  4PA1 A;  3H46 O;  1JKH A;  4BRG A;  1HR0 K;  4OPA A;  4FLX A;  4NCA A;  4BQZ A;  2ZQB A;  1S9G A;  4JKG B;  3DOK A;  3TAM A;  3QEP A;  2HND A;  4JLH A;  4XH5 A;  5J2P A;  3L8B A;  5AQW A;  4O5F A;  4CED A;  4JI5 K;  3KK7 A;  4FPA A;  4N76 A;  4E0D A;  4JEP A;  4BRP A;  3QNN A;  2KLA A;  4FLU A;  1XMQ K;  3OYL A;  3VEW A;  4AIL C;  3HK2 A;  4DSI A;  1JLC A;  4DR2 K;  4XIU A;  1MDU B;  1L5U A;  4B1X B;  4NO7 A;  3VQC A;  2HMP A;  4GMJ B;  4CZE A;  5KPZ A;  2EHG A;  4XH4 A;  3ZSQ A;  3AO4 A;  3VGL A;  5BN8 A;  1YVN A;  4CGH A;  4YNQ A;  4BWM A;  5GAE P;  3LL3 A;  2H3G X;  4DQR A;  5LJV A;  3V1Q A;  1RDA A;  1KFS A;  3UIQ A;  4CEA A;  3CQY A;  1LV5 A; 
#chains in the Genus database with same CATH homology
 1GLA G;  5AQU A;  2GWJ A;  3FZK A;  2D0O A;  3M3Z A;  1C0G A;  1Z05 A;  1VQN N;  1YF5 L;  2P9K B;  4RTF D;  2NRV A;  5FPM A;  2P9K A;  4XEI A;  2QEX N;  3DXK B;  2NZT A;  3GBT A;  2J4R A;  3CCL N;  1T6C A;  1DKG D;  1YXQ A;  3O6W A;  3P39 A;  5ELZ A;  3DXK A;  1JCE A;  1YAG A;  3ID6 A;  1G99 A;  2A42 A;  2QI2 A;  3W3D A;  4JKD A;  4BC3 A;  2QM1 A;  5BN9 A;  4BG9 A;  3C0B A;  2VGN A;  4UY8 O;  3O9U A;  3T7Z A;  4H0Y B;  3DXM B;  4EHU A;  4JKA A;  3H6E A;  2OAN A;  5BRE A;  2V52 B;  2ZGZ A;  4ISF A;  4JKE A;  5KPT A;  3H1Q A;  3VES A;  4BR7 A;  3OW2 M;  1GLB G;  2HBK A;  4BRK A;  3EE8 A;  3HBT A;  3KVG A;  3ATU A;  4BC5 A;  3EKS A;  4BRM A;  2E1Z A;  4CD1 A;  2AP1 A;  4L3Q A;  3A5N C;  5AQN A;  3FE1 A;  3FGU A;  1S72 N;  4ILJ A;  3TSU A;  4GV3 A;  3QML A;  3SBG A;  3WEE B;  5AFU A;  4IO9 L;  3MCA B;  4FWK A;  2FSK A;  3WEE A;  4BVO A;  2GUP A;  3LDQ A;  5MLC Q;  1YIT N;  1C0F A;  3MN6 A;  5GAH P;  1VQ5 N;  4CBU A;  1KD1 O;  5AQS A;  3AGR A;  2E8A A;  4PKG A;  2ITM A;  1ESV A;  3CCQ N;  3PIO L;  3AY9 A;  4C1N I;  4FSV A;  3HM8 A;  3LDO A;  4F9O A;  4YDU C;  1Q82 O;  3G25 A;  3DJC A;  4QS8 A;  3WXM B;  4BVP A;  4B1W B;  4EIA A;  5AQQ A;  3O1W A;  3D6R A;  3UE5 A;  1J6Z A;  1GLJ O;  4NLC A;  3I33 A;  3L0Q A;  3L6Q A;  4NB4 A;  1YJW N;  1E4G T;  3C6H A;  3ZX0 A;  5AQM A;  3G4S N;  1HKC A;  2NRX A;  3NVK A;  3SMS A;  4H03 B;  2CGJ A;  4KH4 A;  5CE3 A;  2FXU A;  5DM7 L;  5C0Y A;  3Q7C A;  3P38 A;  1ZXO A;  3QB0 A;  5M1O A;  5GIP A;  3ENB A;  4MLE A;  3SJH A;  4BC2 A;  1RDU A;  2FSN A;  3TU5 A;  4A57 A;  2QWP A;  1DT9 A;  5JLF A;  2KKZ A;  1T6D A;  4BRA A;  4H0T B;  3VEN A;  4JAX A;  4H5T A;  3KHY A;  3TSQ A;  4M63 C;  2FSJ A;  3HOT A;  4BY9 C;  2A41 A;  4YDU A;  2GEM A;  5EOY A;  5JLH A;  1TYQ B;  2JWK A;  4CI6 A;  5JMV A;  2BTF A;  4GV6 A;  1TUU A;  1TYQ A;  3MWT A;  3H3O B;  2HBL A;  5AQR A;  3IUC A;  4A61 A;  4EHT A;  4PKH A;  4C23 A;  3IKM A;  4YOY A;  3LDN A;  1ATS A;  3O4W A;  3G71 N;  3U8X A;  5TKW A;  4BC4 A;  3QBW A;  4WQ5 C;  2Q1N A;  3VF2 A;  3LDP A;  4BR5 A;  2W41 A;  3QIC A;  3C65 A;  2BUP A;  4CJ7 A;  3F9M A;  4ISG A;  3QBX A;  4JN4 A;  3QFP A;  3L4Q A;  1H1V A;  5ADX A;  1ATR A;  3UKU B;  3VEY A;  3MN7 A;  1O13 A;  3UKU A;  1MWM A;  4BRD A;  1KAY A;  2YHW A;  4NLB A;  4IEE A;  5M1K A;  1BA1 A;  3JXU A;  5AQZ A;  3S41 A;  1WOQ A;  3E9O A;  1BO5 O;  4PL8 A;  3ATV A;  3IFR A;  1T44 A;  4IDH A;  3CI5 A;  1S22 A;  4JD2 B;  4EFH A;  1NGG A;  4WFA L;  2E2O A;  1K8K B;  5LY3 A;  3E9P A;  2P9I B;  4JD2 A;  1JCF A;  4WQ5 A;  1K8K A;  5M1F A;  1VAZ A;  4GNI A;  3MN9 A;  3ULE B;  2E88 A;  2Q0U A;  3OA9 A;  5AFU H;  3RSE B;  1HKG A;  3ULE A;  5BR9 A;  4BRH A;  3RSE A;  3HI0 A;  2VWB A;  4BR9 A;  3W0L A;  2VCP A;  1MA9 B;  2QWQ A;  4K41 A;  5AQX A;  3EN9 A;  3CMA N;  1VQK N;  4IXC A;  2OTL N;  1X9J A;  5F0X A;  2P9L B;  1ZC6 A;  4M7Y A;  2HBM A;  4H5V A;  4O8K A;  2V51 B;  2P9L A;  5E84 A;  2A6A A;  1T3V A;  3CPW M;  4U67 L;  2QWL A;  3R8E A;  3P4I A;  1XUP O;  4YOW A;  3KWG A;  4BRO A;  2E2N A;  2DPN A;  2ZJR L;  3AAQ A;  3R3L A;  1VQM N;  2OTJ N;  2QTD A;  2QA4 N;  4BR4 A;  4FWO A;  3CD6 N;  3WXJ A;  4QS7 A;  3DXM A;  3O08 A;  5HOO A;  4FOI A;  3SAG A;  3OBY A;  4FWS A;  3M6G A;  3E9L A;  3M1F A;  4PL7 A;  3QFU A;  3OHR A;  3K9K A;  1D4X A;  1VQ8 N;  1GLC G;  2CH6 A;  4I6M B;  2CH5 A;  3O9Q A;  4GV9 A;  2BH1 A;  4I6M A;  4H5W A;  5TKY A;  4DHY A;  5AQK A;  3VEO A;  4CZL A;  2V7Y A;  3NVM A;  3HRG A;  1KC8 O;  2HST A;  2Q31 A;  1HUX A;  2E1Y A;  2P9N B;  3CER A;  3VMF B;  4EAH D;  2D1K A;  2ZJP L;  5FPE A;  3O9S A;  4IFE A;  2P9N A;  2I7P A;  1YJN N;  1NGE A;  3H45 C;  3N4Q A;  4IOX A;  1NGB A;  1NWK A;  1Z6R A;  3ENO A;  3O5B A;  1X3N A;  4JK8 A;  4WFB L;  1HKB A;  1ATN A;  2ASO A;  4ILG B;  5CHI A;  4YOT A;  1XC3 A;  1QQM A;  4FO0 A;  4BGA A;  3U9D A;  2A5X A;  2WUS A;  4H5R A;  1MWK A;  3TSP A;  4HTL A;  4AM7 A;  1Q7Y O;  4A62 A;  5AQI A;  2Q2R A;  3CCE N;  2YCH A;  5AQO A;  5M1P A;  1RGI A;  4WF9 L;  4DQ8 A;  3O9T A;  2FF6 A;  4OPH A;  5BRD A;  2F9W A;  3GL1 A;  3VGM A;  1NGA A;  4B1Z A;  2QWN A;  1RFQ A;  3SBT A;  5KQD A;  2CGL A;  3PIP L;  2QXL A;  4FPB A;  1VQ4 N;  4KH6 A;  5C15 A;  3VF6 A;  3ZEU B;  3SAF A;  3R6M A;  5ADX H;  3NMU A;  4LC9 B;  3ZEU A;  4DB3 A;  4FWR A;  4JKF A;  5DM6 L;  2KHO A;  3CCR N;  5GAD P;  4AF1 A;  4MO4 A;  2V7Z A;  3CCJ N;  3TTC A;  2ZF5 O;  3VTI A;  1GLF O;  3FZF A;  3I55 N;  3CXC M;  3O8M A;  4QS9 A;  3GOI A;  4BRL A;  3TTD A;  1QQO A;  3CQX A;  3U9Z A;  5AQP A;  4WCE L;  5M1Q A;  3WXK A;  4BRI A;  3F2K A;  5E26 A;  3CC2 N;  2WFB A;  3ZYY X;  3FZM A;  2QWO A;  3A8Y A;  3BF1 A;  3WQU A;  3UKR B;  1W2B M;  4FWM A;  4GY2 B;  4PHT X;  3SAH A;  3I56 N;  2HF3 A;  1BUP A;  3UKR A;  4O8U A;  5AQF A;  4IJA A;  4YOV A;  4MLH A;  1N8R O;  5AQH A;  4WFN L;  2AA4 A;  5EVZ A;  1S3X A;  2P9S B;  3CPE A;  4Y0W A;  5BPM A;  5GIO A;  4RWT A;  3CC4 N;  1QHA A;  3LM2 A;  2P9S A;  2VGM A;  3CME N;  4HWI A;  3SK3 A;  4E1J A;  3IDH A;  1GLE G;  2P9P B;  2QWR A;  3EO3 A;  3WXL A;  4CZG A;  2FLO A;  2P9P A;  2D4W A;  5AQY A;  3DLL L;  4MDB A;  1NGI A;  1OKJ A;  2PFU A;  3D2F B;  3MWP A;  3VOV A;  3MX2 A;  1NM1 A;  1QQN A;  3C7N B;  4IJN A;  1K9M O;  1HJO A;  1BDG A;  3D2E B;  3D2F A;  2HBJ A;  3C7N A;  5KQ8 A;  4U7B A;  4H0P A;  3D2E A;  3VET A;  4R79 A;  1YIJ N;  1YJ9 N;  3DWL A;  1W97 L;  3L4I A;  4JNE A;  5F1X A;  1HX1 A;  4CZM A;  5JVG L;  4YOX A;  4A5A A;  2F7T A;  1U6Z A;  3A5O C;  3CIP A;  4JKH A;  2NRT A;  2ZJQ L;  3O80 A;  3BF3 A;  5LJW A;  1SS6 A;  1U2V B;  2ASP A;  4YOR A;  4A2B A;  4RCH A;  2P9I A;  3AAR A;  1BOT O;  4WQ4 C;  1U2V A;  2HOE A;  3DAW A;  4B1V A;  1TUY A;  1ZBS A;  1M90 O;  3CCM N;  2YI1 A;  3M5R A;  3VEV A;  4IWV A;  1QVF M;  3HSC A;  4JHD B;  5AQT A;  2UYT A;  1NGD A;  2WBN A;  4BRE A;  4JHD A;  5EX5 A;  1DGK N;  2W40 A;  2QW9 A;  2ZGY A;  3CHW A;  4MO5 A;  3WUH A;  3J7Z O;  4JKB A;  2E20 A;  1CZA N;  1KXP A;  3D7E O;  3R1X A;  5F2R A;  3U4L A;  4BRN A;  5BPN A;  5C12 A;  5C2F A;  3J8A A;  4FWL A;  4CBX A;  1NBW A;  3QDK A;  1NLV A;  3MDQ A;  3FZH A;  3MX5 A;  4CZF A;  4DKW A;  3A5L C;  3LDL A;  3ID8 A;  3WXI A;  4H0O A;  5BPL A;  1K8A O;  1VQP N;  3F5T A;  2RE2 A;  1Q86 O;  3VF4 A;  1JCG A;  1KQS M;  2D0P A;  4FWQ A;  2VYP A;  4K43 A;  1BG3 A;  3VEX A;  4B1Y B;  3A0I X;  1KAX A;  4CZK A;  4WQ4 A;  3BP8 A;  2PAV A;  3GE1 A;  3T69 A;  4AM6 A;  1YI2 N;  5B8H A;  1X3M A;  2NRR A;  2E2Q A;  2JWL A;  4GVE A;  2PBD A;  2NRH A;  3CJC A;  3EKU A;  1EO1 A;  4B1U B;  4H0V B;  4IOC L;  3VGK A;  3MCP A;  3E66 A;  4BR0 A;  4CZH A;  2GWK A;  4BQL A;  3E1Y A;  4CZI A;  3FLC O;  3VPZ A;  2NNW A;  3O9R A;  1NGJ A;  3CJ9 A;  4MDA A;  2ZWH A;  4B9Q A;  5JIC A;  1M1K O;  4FL9 A;  4DCH A;  1DEJ A;  1QVG M;  2A3Z A;  3SLC A;  3EL2 A;  3FR0 A;  1WUA A;  1P8Z A;  1V4T A;  1NGF A;  4JK9 A;  3WQT A;  3LM9 A;  4BG8 A;  5H1S Q;  4FOE A;  4A59 A;  1BU6 O;  2IVP A;  3VER A;  1YHQ N;  4OO1 J;  3HOS A;  2FF3 B;  3EZW A;  1SZ2 A;  1P90 A;  5JVH L;  4FVU A;  5BRH A;  1HPM A;  5GAG P;  4JK7 A;  3CJA A;  3A5M C;  5M1N A;  4H5N A;  5BRF A;  4KH5 A;  1IG8 A;  2HF4 A;  3H3N O;  3KZB A;  3MMV A;  4H0X B;  4BR2 A;  1K73 O;  4K42 A;  3EE9 A;  2GX9 A;  5AQL A;  3TTF A;  1GLL O;  3WT0 A;  2ASM A;  3AAP A;  2Q0R A;  5AR0 A;  1KAZ A;  1R59 O;  3CJ1 A;  4BRQ A;  2YHY A;  3HZ6 A;  1YUW A;  3H1V X;  5AZJ B;  1Q81 O;  4Z94 A;  1BA0 A;  2YJF A;  1XQS C;  2QWM A;  5AZJ A;  3CCU N;  3K9J A;  1OVY A;  1BWF O;  3GG4 A;  3CCS N;  1GLD G;  3VEZ A;  3ZX3 A;  5GIN A;  4ISE A;  5I9E B;  5AQV A;  2NRZ A;  2P9U B;  4CD3 A;  3RVC A;  2NLX A;  3G6E N;  1LCU A;  2P9U A;  3GDQ A;  3I8B A;  1JJ2 M;  2Q97 A;  3BUZ B;  1NGH A;  2IVO A;  3AGK A;  4K25 A;  1V4S A;  3O1B A;  3IMX A;  3TPQ A;  4CZJ A;  1E4F T;  2A40 A;  2RHK A;  3UB5 A;  3HTV A;  4C1N K;  1VQL N;  3KWI A;  1QZ6 A;  5C10 A;  3OBW A;  3Q7B A;  3CC7 N;  1VQ6 N;  1LOT B;  4JKC A;  4FWP A;  1EQY A;  5C2D A;  3H46 O;  3C6A A;  5AZI B;  2NRW A;  4CBW A;  3PLA A;  4BRG A;  2Q36 A;  4OPA A;  5AZI A;  4G9Z A;  4BQZ A;  3CET A;  4J8F A;  2GTD A;  3B8A X;  3FFK B;  3SMP A;  3N4P A;  4IO8 A;  4JKG B;  5AQJ A;  3R9P A;  4BRC A;  4IOA L;  4BRF A;  1HLU A;  4IEI A;  4JKG A;  4FWN A;  4XH5 A;  2YX6 A;  2F9T A;  3P31 A;  1NGC A;  3MK6 A;  4M7X A;  5AQW A;  4O5F A;  2IIR A;  1VQO N;  3KK7 A;  4FPA A;  4JEP A;  5CR4 A;  4A2A A;  3MN5 A;  4BRP A;  2KLA A;  2GEL A;  1VQ9 N;  2YHX A;  4PKI A;  3ZET B;  4BGB A;  3FZL A;  5FPD A;  2YJE A;  3VEW A;  3ZET A;  4KBO A;  3CJB A;  1MDU B;  1NJI O;  1NMD A;  3BEX A;  4B1X B;  4NO7 A;  5AQG A;  2HMP A;  2I7N A;  1QZ5 A;  2IVN A;  4CZE A;  3ZX2 A;  5KPZ A;  1IJJ A;  3CF5 L;  5KPR A;  4XH4 A;  1VQ7 N;  1SQK A;  3CJ7 A;  3VGL A;  3VTH A;  5EXW A;  1YVN A;  2WC9 A;  4A5B A;  5BN8 A;  2E2P A;  3CCV N;  1ILY A;  5GAE P;  3LL3 A;  2H3G X;  3JS6 A;  1Q18 A;  5FPN A;  3ENH A;  5HL7 L;  4ILH A;  5LJV A;  4IZ9 A;  1SAZ A;  1Y64 A;  2CGK A;  4YOU A;  5EY4 A;  4WYB A;  4XH1 A;  1RDW X;  3CQY A;  2EWS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...