4DR1K

Crystal structure of the apo 30s ribosomal subunit from thermus thermophilus (hb8)
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
116
structure length
116
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
total genus 25
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4dr1K00
2UU9K 4AQYK 4DUZK 5A2QO 3OTOK 4B3RK 4YHHK 2HHHK 4X65K 1HNWK 4JI1K 4DR4K 4B3TK 2VQFK 1XMQK 4JI7K 4JI3K 2UUAK 4LF9K 4CVNE 5BR8K 4GKJK 3J81O 1IBMK 2UXCK 4LF5K 4X66K 2UUBK 3T1YK 2UXDK 5IWAK 4JI0K 1XNQK 3J7AP 4DV3K 3JAMO 1FJGK 3J7YP 1HNZK 4KHPK 1N36K 4DV5K 4DR5K 4DV0K 4JI5K 4K0KK 1N33K 5IT9O 4JV5K 1IBKK 4B3SK 4JYAK 4LFCK 2UXBK 4GKKK 2ZM6K 4DR1K 4JI6K 1N32K 4JI4K 4LF4K 5LL6Z 4LFAK 1N34K 1HR0K 4LFBK 5AJ3K 4OX9K 4DR3K 5LMNK 4V19S 2E5LK 5FLXO 4CW7B 1HNXK 4LF6K 4DR6K 4DV7K 4DV1K 4DV2K 3T1HK 4X62K 1XMOK 4LF8K 1J5EK 4DR7K 1I94K 4LF7K 4NXNK 4X64K 4DV6K 4B3MK 2UUCK 3J80O 4JI2K 2F4VK 1XNRK 2VQEK 5LMUK 4DUYK 4YY3K 1IBLK 4DR2K 4JI8K 4DV4K 4NXMK
chains in the Genus database with same CATH superfamily
2V51B 3V9WA 2QTDA 5CYMA 1RDCA 5SWMA 3O9RA 4GVEA 2E8AA 2FLOA 3DRSA 3FZLA 5FPMA 4U7BA 3BZKA 4PA1A 3P83D 3F73A 2HHXA 3FFIA 3L2VA 4O0IA 3R1XA 3VQPA 1BOTO 3LPTA 4O5FA 4PL8A 3JAMO 4YOWA 1RBTA 2VCPA 3MWTA 4IG0A 2CH6A 4YOVA 2OTLN 2E1YA 1WLJA 1N8RO 3OYLA 3I33A 2OZMA 2UXBK 1EWQA 2VYPA 4CBXA 3VN5A 1YF5L 4Q5VA 1TKDA 2Q1NA 5EXWA 1N5YA 1KLMA 5LL6Z 1CZAN 3T1AA 4MLHA 1LAVA 4BRQA 4JKHA 1JLCA 3NVKA 4B1WB 1BCMA 1JLBA 4V19S 3QESA 2Q0UA 1QZ5A 4CIFA 1ZC6A 2KLAA 2EHGA 1ZBIA 1M90O 3HVTA 4DQ8A 2QM1A 2A42A 5AQKA 1BL3A 4WQ5A 4PQUA 3CJ7A 1XWLA 4OLBA 3SI6A 4X62K 5JLFA 3UKUA 4NYNA 5FRMA 4FJ5A 1A5VA 2NRHA 4QCLA 3MN9A 3NH0A 4CHOA 4FK4A 3L3UA 1RTJA 3VENA 3PO5A 4ID1A 4E7JA 3CQ8A 4LY7A 1T7PA 4IJNA 2AJQA 4DSFA 1SQKA 4DQRA 3H1QA 2P9NB 4NXMK 4CHPA 4H5NA 2WOMA 3L2UA 1TYQB 5F2RA 2WTUA 5CY4A 4WCEL 3ENOA 3NF6A 3IFRA 4JHDA 4DFMA 3SZ2A 1BI4A 4PHTX 2P9UB 5GIPA 1OKJA 4ILGB 4O44A 3U3YA 4QOZB 1WSEA 4JI7K 3V9UA 5AQZA 4K42A 4M7XA 3FE1A 4BROA 3S3OA 2A41A 3SYZA 4FJMA 4HUEA 2P9KB 3WT0A 3ZT3A 4M45A 3QNOA 4DV3K 1H1VA 4DSJA 3HYFA 3QEVA 1WAJA 5TKWA 3AVBA 2F7TA 2P5OA 3F2KA 1MWKA 4CGHA 3E9OA 3OYHA 2V7YA 4CZFA 5MLCQ 2IDOA 3G71N 3EE8A 5DMRA 4AHTA 1GLLO 3HOSA 2YHWA 1WSJA 3LP3A 3A5OC 5I42A 5FPDA 3AV9A 4LSLA 1BGXT 4KH4A 2HHUA 5M1NA 4HUGA 3L2QA 3GL1A 1XC3A 2O8DA 4WE1A 5TKYA 4B8AB 2NRRA 2Y1JA 4MDAA 5KPRA 4E1MA 1NK8A 1VSKA 4J2EA 3CI5A 3S3NA 3B6PA 5AZIB 3CETA 1WSGA 4NCGA 1Q86O 4DHYA 3OYEA 1ITGA 3ENHA 4CGJA 3D2EA 2E20A 1P90A 4FCYA 4CE9A 1KFDA 2D0AA 1Z05A 4KTZA 3WNEA 2OANA 3K5NA 4RG8A 3VF2A 2OPQA 4DTNA 4CHNA 4GV6A 4DV4K 4OJRA 2HBKA 2DTUA 3ZYYX 4JK8A 1VQ5N 2YCHA 2E2OA 3SMPA 3QMLA 4IEIA 1Q9YA 1S22A 4KI6A 5SZTA 4KBOA 5AZJB 3L0QA 3L4QA 3KK2A 4BGBA 2DFHA 3V4IA 3PY8A 3PIOL 5AQHA 4JKFA 1XMQK 3P31A 4BQLA 3G25A 4K8XA 2G8HA 2PY5A 1QTMA 3LANA 2X74A 4RW4A 3OW2M 4H0XB 4H8KA 1K8KA 4CK3A 2ITGA 4B1VA 1DKGD 1KFSA 4DV5K 4PKIA 4BC2A 3SAGA 1YVUA 4OVLA 3OYFA 3KIOA 1FKOA 3K9KA 3K2PA 2XO7A 4HVJA 4AF1A 4JN4A 3O08A 4IO9L 4MLEA 4CJPA 1Z6RA 3TSQA 4GV3A 1EX4A 3CM5A 3LAKA 3AVFA 4CF0A 3MXMA 4KREA 4BRFA 3HOTA 1N34K 3KWIA 2Y1IA 5HRSA 4DR3K 2FBTA 4KAZA 3LPUA 2EWSA 2E5LK 5J2PA 3O8MA 4KRFA 4Z4GA 1EETA 3ZT2A 4YNQA 4B9TA 1WOQA 4H5TA 3ZT1A 3FGUA 1S1TA 3AO3A 2JGUA 4KO0A 1A5XA 1QSLA 3LDQA 2PFUA 4CZMA 4H0TB 4DV2K 5GAGP 3LM2A 4E7HA 3QBXA 5E41A 1HKCA 2GTDA 3RR8A 1NJXA 3BGRA 4IXCA 3O4QA 2UUCK 2X78A 3THXB 1NWKA 4IBNA 1NK7A 4KHNA 3BUZB 1ATSA 3L8BA 3SPYA 2ZD1A 3DRPA 2VWBA 1U2VB 4W5RA 2QKBA 1NGHA 1J6ZA 4J8FA 1Q8IA 4BRDA 3CCRN 4CZLA 3SBTA 1NGCA 4QS8A 5CYQA 3KK1A 4L3QA 5HL7L 3O80A 1HPMA 4DTRA 2BE2A 3CCEN 1IG8A 2FBYA 4LF9K 1GOAA 3R3LA 5C2DA 3J81O 3AY9A 3ATUA 1TYQA 4J2DA 2UXDK 1W2BM 3CC4N 4I7FA 4FJHA 1C1CA 1Q81O 5M1KA 4B9QA 2P9UA 3O1BA 1I3AA 1F21A 5LJVA 1QVGM 3KWGA 2IVNA 4PL7A 3AVLA 4B1ZA 3QFUA 2D4WA 2P9KA 4WFBL 3DYAA 4ELVA 3MX2A 2V52B 4BDYA 4FWOA 4KH6A 2XY7A 5AQNA 4WQ4C 4Z4HA 4NCBA 4CJ7A 3J7ZO 2OCEA 4BE1A 3V81A 4B1YB 1HYZA 4B08A 4BDPA 2E4LA 4GVMA 1GLDG 2FBVA 1NOYA 2CGJA 4F3TA 3H46O 5CHIA 3AO1A 3VETA 1YT3A 1BQMA 4CJ3A 1LOTB 1VAZA 3ZX3A 2YNGA 1VQKN 5CR4A 3T1HK 1ZYQA 3D7EO 4BRPA 4N76A 1NGDA 3R9PA 3U4LA 3H6EA 1HJOA 3CIPA 4X64K 1ZBLA 1TK0A 4M3TA 1YJNN 3J80O 5BRDA 1HKBA 3ZSVA 1S6PA 2F4VK 1TKZA 1J5OA 1XNRK 2LSNA 2P9IB 5LMUK 1OH6A 1IG9A 1VQLN 5AZIA 4JI8K 2OYQA 5JLHA 4ISEA 2KZMA 4AQYK 3ZX2A 3AAQA 2P1JA 4QS9A 3MCPA 4H0PA 1ASUA 4CF1A 1RDWX 1B9FA 3ZT4A 1JL1A 3HO1A 2IC3A 3ZCMA 3MXIA 1HLUA 1X3NA 4CJRA 1BA0A 2I5JA 3ATVA 1RT6A 2QEXN 2UUAK 3T69A 1RGIA 2HBMA 4CVNE 4B1UB 2UXCK 1IBMK 4DSEA 3OYIA 2Q3SA 3QICA 2QWLA 4X66K 1EO1A 3NGYA 2VGNA 4FLTA 1JLGA 5AZJA 4B3OA 4A62A 1C0MA 4H5VA 4FOEA 3SQ0A 4DF4A 4K0KK 3QFPA 5EX5A 3TTFA 1ZBSA 4JV5K 5AQVA 1LWCA 2P51A 2A1SA 3A5MC 3PIPL 4OKJA 1VSEA 1ZBHA 5AQSA 4CF9A 4GKKK 2GWKA 2W6KA 4QAGA 3NGZA 4DR1K 4BWMA 1RT7A 2QWMA 3TAEA 3BDPA 1HJRA 5LJWA 4CCHA 2BUPA 4ZTFA 4YOUA 1TGOA 4EHUA 3M5RA 4R79A 3ISNC 3V1QA 4NO7A 4CZHA 4MO5A 3H08A 2IAJA 3ZSXA 1L5UA 1NG9A 5M1FA 3V9ZA 1SAZA 2JWLA 4RW8A 4I6MB 2NNWA 4Z0UA 2YJFA 1RILA 2RKIA 4H03B 1EP4A 2FBXA 3V1RA 4DFJA 2XHBA 2D5RA 2P9PB 4W5TA 3T3FA 4G1QA 1VQNN 3KLFA 5AQYA 4IOXA 1BUPA 1WAFA 2HB5A 4LF8K 4JLHA 2Q0RA 1QS4A 1CXUA 4IJAA 5EU7A 3OJUA 3VEWA 4KPYA 4RW6A 1W97L 3O6WA 1T3VA 4CZEA 3WNGA 4GNIA 3SUPA 2VG7A 1KQSM 4CZJA 1X9JA 4CGDA 4BVPA 1D5AA 3VEXA 1VSIA 2YX6A 1HQUA 3OBYA 4BVOA 2QWNA 1NJIO 3M6GA 3SAHA 3QEPA 4F9OA 3E1YA 4FWQA 3C65A 3THXA 4DU3A 1L3UA 1RT1A 5FDLA 3ID8A 5E84A 1YITN 2ASOA 1U2VA 2QXLA 3WNHA 5BPLA 1GLBG 1NOZA 4DTOA 3L6QA 3CM6A 1VQ9N 2HHVA 1X3MA 1RCHA 4PKGA 4E1NA 4BGAA 1YIJN 4IFVA 4OGCA 5KTQA 2OPPA 3VQ8A 4EAHD 3MN5A 3O4WA 5HBMA 3CFPA 1N36K 1LWFA 1RT3A 2NZTA 2G8IA 4H0OA 5FPNA 2IS3A 2F9TA 3IG1A 3THVA 4NLCA 2HF3A 2A1RA 4ELUA 4JYAK 4WQ4A 2HMIA 4DTJA 5E26A 4DB3A 3RWUA 1YJWN 2O4IA 3OS1A 1GLFO 5KRTA 3ZETB 4DG1A 4M3XA 1FW6A 1MU2A 1SKSA 4N56A 1QQCA 3K59A 5I9EB 4B9LA 4E0DA 3VTHA 3PSFA 3KK7A 4CJQA 3F9KA 3I55N 1WB9A 1KTQA 1DGKN 4FWLA 3GOIA 4WYBA 3MWPA 3BF3A 2B6AA 4C8MA 2KHOA 4FZZA 4EHTA 1WBBA 1J5EK 4HCBA 2HHTA 3KLGA 3LDSA 2YNFA 5BREA 4JRPA 2OTJN 1WSHA 3GDQA 2XRIA 1DTQA 1JJ2M 3OS2A 1UWBA 5FROA 1TUUA 1SS6A 3TABA 1NM1A 5KQ8A 2UU9K 4JD2B 2BDPA 3AVJA 1RFQA 3ITHA 1K9MO 4FLZA 2F96A 1K8AO 4CFCA 1IKWA 1WNSA 3BEXA 4FL9A 3AO5A 4CZGA 5HOOA 1UAXA 2P9IA 1HNWK 3U6FA 2W42A 2A40A 4HWIA 5C24A 4I9QA 1R59O 3MCAB 3AVKA 4CJFA 1TKXA 3Q7CA 1TAUA 5AQWA 2HNYA 3HRGA 3TTDA 5KI6A 3LDPA 1T6CA 1S1VA 3MEGA 3HSTB 3I0SA 4FWKA 2NLXA 3CYMA 4CJEA 1N33K 3DXKA 1K6YA 3NDKA 5J1EA 3TWHA 3IDHA 3S9HA 2VGMA 3VQ4A 3HP9A 4H0YB 3I56N 2Q2RA 2YJEA 4BR9A 4DCHA 2X6NA 1WSFA 2B5JA 5FPEA 3VOVA 1JLAA 4OKKA 4FSVA 4PKHA 2A5XA 2XY6A 4FJIA 5HLFA 2IVPA 2NUBA 1JCFA 4IWVA 3TSPA 4AM7A 3IRXA 3UB5A 4E7KA 3K5LA 4ZHRA 4XH4A 5BR9A 4DU4A 2IVOA 1S1UA 4IEEA 4PY5A 3AA5X 2BTFA 4ISFA 5AQIA 5J2QA 3O9TA 4YDUA 4NXNK 3V9XA 5D3GA 3P4IA 4I6MA 3THYB 4FOIA 3DLKA 4K25A 4N5SA 2P9PA 4FVUA 4FWPA 3KKRA 4BC5A 2YKMA 1XC9A 3HM9A 1HNVA 1XUPO 4HCCA 3EKUA 4X65K 3MK6A 5ELZA 2YHBA 2WFBA 2DPNA 3CCUN 3BP8A 1S72N 1U45A 4AHVA 2KFZA 4KTQA 2F9WA 3QBWA 3R6MA 3ZEUB 4GKJK 2DY4A 4CEQA 2GUIA 3VQ5A 3N4PA 3OHRA 5B8HA 3CCQN 5HRRA 3OA9A 5C10A 2PYLA 1KXPA 4FYDA 3E01A 1YTAA 1A5WA 1NK4A 4BE2A 2NRTA 4DS4A 5HROA 5HRPA 4BDZA 4ICLA 1ATRA 2E88A 3TAPA 2RE2A 3CD6N 3NH1A 5K14A 4CFBA 4WFAL 4Z4EA 1YHQN 2G8VA 1VSMA 1VQ8N 4F2RA 2RPIA 1VSJA 1U6ZA 1HR0K 3M8PA 4HUFA 4CFDA 3DLHA 1V4TA 5C15A 2ZJRL 2I7NA 4YFUA 4CHQA 4JKAA 3CFRA 1HNXK 2F8SA 3OYMA 1NU0A 4KH5A 3QB0A 3RR7A 3D45A 4KB0A 5C12A 2QKKA 1BA1A 3ZETA 5AQLA 3ULEB 4DV7K 1LWEA 1VSDA 2FSKA 2ASPA 3W3DA 3F9MA 4DV1K 1ASVA 3ASMA 3U8XA 4B1XB 4FWRA 4BQZA 1BG3A 3SUOA 4H5RA 3M8SA 3QO9A 4AH9A 1BWFO 1I94K 4N41A 2BGGA 4DV6K 5FRNA 3RSEB 3ZSRA 4Y1CA 1DT9A 2HHWA 4BG9A 4DS5A 3VQBA 4JK9A 2W40A 3ZX0A 1EKEA 4DR2K 1RDDA 4XIUA 1VRUA 3KK3A 4DU1A 2ZWHA 3VEYA 2ZGYA 3CJ9A 4L8RB 1NGAA 2Q97A 5DK5A 3EEQA 2E1ZA 3CCVN 1VK0A 3W0LA 4BRIA 3LM9A 4MDBA 3VQEA 1C0GA 2HOEA 3AGRA 3HL8A 2AA4A 4RTFD 1C0UA 4DSKA 4W5NA 1S9EA 2ATQA 1FKPA 2D0OA 3DRRA 4M42A 3CC2N 4CFAA 1SV5A 1NGGA 4JD2A 4LD0A 3WXIA 1TAQA 2Q36A 1BDGA 2HSTA 2FXUA 3ZSQA 3G10A 5KGWA 1TKTA 1D4XA 3CCJN 3T1YK 4K41A 3SNNA 3SBGA 4FJGA 3FFKB 3MECA 3HZ6A 4JI0K 4KHWA 4O8KA 4O5BA 3LL3A 3QLHA 5H1SQ 1CZ9A 1JXBA 4B9SA 4C1NK 3FZKA 4CZIA 5GADP 4PUOA 4I9LA 4KHUA 5IT9O 2NRXA 3EL2A 4B3SK 4FLWA 1RBSA 3RMDA 4KKOA 3LDNA 4DLEA 3WEEB 1L3TA 2P9NA 3T7ZA 4FZXC 4JI6K 3UIQA 3CHWA 1ATNA 2QWRA 4NYFA 4E3SA 1HYSA 1KD1O 1U04A 1V4SA 3NBPA 3IKMA 1JLEA 5LMNK 1KC8O 5AQUA 5LY3A 4ELTA 3OYDA 1C1BA 4FVMA 5FLXO 3OYNA 3AA3A 1NJZA 4BR0A 5JS1A 3O9QA 1NGFA 4BWJA 2ZJQL 3MN7A 3VQCA 4CBUA 3E9PA 2UYTA 4EP5A 4KTWA 3VQ7A 4JS4A 4DR6K 4IZ9A 3PX0A 4BRHA 2ZF5O 3DLLL 3NGIA 1RDUA 4A59A 3LZIA 4CI6A 3QEWA 2KFNA 3VQQA 1XMOK 3CPWM 3NMUA 2P9SB 4CERA 4ZTJA 2YHXA 4JKGB 3O3GA 4DWIA 4FJXA 1KVAA 3OBWA 3SK3A 4JS5A 5AR0A 4FJ9A 4AHUA 3GBTA 4CJVA 2XY5A 4LH4A 4CF2A 2KQ2A 3NHGA 3MXJA 3K58A 1SL0A 1VRTA 3CF5L 1NK6A 2HHHK 3H1VX 3A5NC 4DTSA 3AVIA 3THYA 1XHXA 3O4NA 2HW3A 1C0TA 2YI1A 5C25A 1DEJA 1U4BA 3JS6A 5AQPA 4CJ5A 2UUBK 1IKYA 4CIEA 1UA1A 4CECA 3DM2A 4FWMA 4IO8A 1NKCA 3D0PA 2VG5A 1HNZK 3OYCA 2IIRA 4FLYA 4CEAA 1NJYA 3KD5E 3BY5A 2HMPA 2ASMA 3F5TA 4A5AA 3ZEUA 4E1JA 3LWLA 1NLVA 3C6AA 3VEOA 1Z25A 3ALYA 5F0XA 4AILC 1OH8A 1NKBA 3DLEA 1NKEA 2FF6A 3V6DA 1VHXA 1JLFA 2YV0X 4BG8A 1IO2A 2WC9A 5AQOA 1QSYA 1TVRA 4KHSA 1QQNA 3AVGA 2FSJA 4DSLA 1JL2A 1TK5A 1BI4B 4LSNA 4J2BA 1MWMA 5CZ1A 5KPTA 4DTXA 2O8FB 3HK2A 4UY8O 3K57A 4DKWA 2WBNA 1T03A 1SL1A 1SL2A 3S3MA 4FLVA 3K0SA 2FC0A 3VEVA 1WBDA 4LF7K 2YHAA 4AHRA 4O8UA 2QWQA 5AQGA 3ULEA 1TUYA 3CJCA 3RVCA 3O9UA 3SCXA 3SLCA 1MDUB 4B8CA 4CGIA 4C8NA 4M63C 1YI2N 4CJSA 2ZGZA 1LW2A 5AFUA 2A3ZA 4FJKA 3LP2A 4R5PA 1REVA 3FLCO 2YHYA 3TU5A 3RSEA 4FJ8A 4B9NA 2P5GA 4F8RA 4HTLA 3IUCA 4M3YA 3C0BA 2B4JA 2O8DB 3M8RA 3UKRB 3KHYA 3J8AA 3E9LA 5EVZA 3VQDA 4CZKA 4YOYA 1ZBFA 4AHSA 3VGLA 1BCOA 4FJ7A 1GLCG 3OS0A 5AFUH 3FZMA 4BR4A 1QZ6A 4KHPK 3VEZA 1HX1A 4C8KA 4M3RA 3O9SA 1D9DA 1KRPA 4KFBA 1S1XA 1DTTA 1YJ9N 2NRZA 3CFOA 3M8QA 4FK0A 3FZFA 3D2FB 4LFCK 3AO4A 4GMJB 3PX6A 2KKZA 2NRWA 1IKXA 2QWOA 1HMVA 4W5QA 3BZCA 3S41A 3MN6A 3KLEA 1N32K 3NAEA 2HVIA 3C6TA 3QEIA 3CMEN 2HNDA 2O8EB 4JEPA 3DLBA 4E89A 4IFYA 4LFBK 1ZXOA 2JWKA 4CW7B 3WEEA 3CERA 3VGKA 3SPZA 1O13A 3VQ6A 3P39A 4CK2A 3H3OB 3NF9A 1UOCA 4C8OA 4DQQA 3ZSYA 4MQ3A 3MDQA 3TAQA 1I39A 4A2AA 1U47A 1RBVA 5BN9A 3PSIA 2VWJA 4M3ZA 4JKDA 4BRAA 3H45C 5KRSA 1K8KB 2ZE2A 5CZ2A 3ENBA 1NNEA 2Q31A 3HT3A 4CF8A 5HRNA 3TANA 4MO4A 1LV5A 4JI2K 3WXMB 4Z4FA 2X6SA 1N6QA 2OPRA 1Q18A 3SQ2A 1ASWA 5C2FA 3MEDA 4TSXA 4YY3K 3NFAA 3OJSA 3G6EN 2HBJA 4FM0A 2HHQA 1NJWA 2P9SA 3OYAA 3EZWA 4JKGA 1D8YA 4YHHK 4CHZA 2CGLA 3DI6A 3I0RA 1FXXA 4JAXA 4U67L 1QVFM 1W0HA 3PO4A 3QERA 3R8EA 1YUWA 4H4OA 1BHLA 4DR4K 2IOCA 1VQ6N 2EX3A 4DF8A 2G8WA 1S5JA 2DFEA 3CPEA 5J2NA 4W5OA 4CJKA 4QS7A 1UA0A 3NF8A 4Z4CA 4FW2A 3E66A 3CJBA 4DSIA 5AQTA 4FO0A 4DFPA 4XH5A 5KPZA 1VQPN 3J7YP 1QQMA 2YNHA 2O8BB 4DTPA 3SAFA 3NH2A 4GW6A 5T7BA 3RRHA 3JYTA 3KZBA 3U3GA 5F1XA 3DJCA 3IMXA 3A5LC 1IBKK 1E4GT 4J2AA 3MAQA 3CXCM 4I2PA 1XHZA 3VQ9A 3I8BA 3I8DA 3ZT0A 4FLXA 4FZYA 1LCUA 4JKBA 4KV8A 2ZQBA 3RTVA 2D1KA 4JI4K 3CJAA 1KAYA 1C0FA 3CJ1A 1HRHA 2KTQA 2GV9A 3A8YA 4FJNA 3UE5A 4CJUA 3C7NB 3OY9A 1ILYA 1RNHA 2E6LA 3HPGA 4XH1A 4HTUA 4E7IA 4OPHA 3VESA 1YXQA 1YVNA 3ZSOA 5C0YA 4A2BA 3KD1E 4IG3A 1JXEA 4OPJA 3AVAA 1JCEA 4CJWA 3NCIA 1VQ7N 3LZJA 3CG7A 4RCHA 2G8FA 3WXLA 1B92A 2O8FA 2XY8A 1KAZA 4CESA 1JLQA 4A5BA 1HKGA 4Q0BA 3GE1A 1RDBA 2VQEK 4K43A 1G15A 4FM1A 2RHKA 3LDOA 4DTUA 4CJLA 4H0VB 3AGKA 2AP1A 4O55A 3DWLA 1TL3A 4AHCA 4RWTA 3O5BA 4KHQA 5HP1A 1E4FT 2A6AA 3HM8A 3THWB 4E19A 3JSMA 5M1QA 5A2QO 4B3RK 3SJJA 4AM6A 4FM2A 3OYGA 4DMNA 3G4SN 4A57A 1NK9A 1VQ4N 3IS9A 4B3TK 1KLNA 3PUFA 4BR5A 4N47A 3A0IX 3KLHA 3O3HA 1SKWA 3MMVA 4OO1J 2E6MA 4B9VA 3KTQA 1SZ2A 4WFNL 5BRHA 1XQSC 2GBZA 1X1PA 3WQTA 5AQQA 4BRGA 3J7AP 4HHTA 1OH7A 2HHSA 3LP1A 3AA4A 3L4IA 2F8TA 4YOXA 2G8KA 4CJTA 3KJVA 2O4GA 3UKRA 1WSIA 4FK2A 4BRKA 4RW9A 4JI5K 1FK9A 4F3OA 2J4RA 3VTIA 2P9LB 3OVNA 1T05A 3TAMA 4EFHA 4Y0WA 4DLGA 4OPAA 3RMBA 4CIGA 2WONA 4G9ZA 3GG4A 1RTIA 3SQ1A 5JS2A 4LF4K 4BRMA 1GLEG 1HUXA 5AJ3K 4OX9K 3AA2A 3P38A 4BR7A 2D0BA 3KLIA 1RTHA 4DQSA 3Q7BA 3D2FA 4XEIA 1HNIA 3U9ZA 1EXQA 1VSLA 3DMJA 3H3NO 3QDKA 5EY4A 4BREA 1HPZA 2E2QA 5BPMA 2BH1A 2O8CB 4UQGA 3LALA 2O8EA 4DQIA 1EWRA 1GOCA 3WXKA 1M1KO 3O3FA 3M1FA 1NGJA 3DXMB 4KHYA 4CK1A 1C1AA 4O0JA 1BIUA 3L3VA 3V1OA 3DLGA 4CD1A 3C94A 3HP6A 5C42A 3AAPA 2QK9A 4DQPA 2V7ZA 1W9HA 2ETJA 1X9MA 4BC4A 3U9DA 4YOTA 3RMAA 3DLRA 3ID6A 3WUHA 3K5OA 3EY1A 1J9AA 3HXMA 1C6VA 2HF4A 3SV4A 3AVHA 1NGEA 3OYJA 4Z4IA 4EZ9A 4M3UA 4IDHA 4O4GA 5JVHL 4KI4A 4CD3A 4ISGA 4M3WA 5GAHP 2PZSA 3P5JA 4JI1K 5CE3A 1O1WA 1G99A 1LAWA 1R0AA 2GEMA 2VQFK 3MX5A 3K9JA 4IFEA 2W6LA 4OGEA 4JI3K 4JK7A 4BC3A 2KZZA 4IDKA 5AQFA 3TTCA 3CCMN 1Q7YO 4BE0A 4JNEA 1Z26A 2DFFA 1J54A 3LAMA 2QI2A 3O1WA 1FJGK 3OYKA 2ZJPL 5AQMA 1OVQA 5AQXA 3SJHA 4CEBA 4ILHA 4K8ZA 4FWSA 1XI1A 3VPZA 2YKNA 1ZBUA 4CHYA 1QHAA 2ZM6K 4FJLA 4H4MA 3TSUA 4C23A 1S3XA 3QETA 2GELA 1VSHA 3HSCA 5KQDA 3WQUA 1HYVA 2O8BA 4LFAK 2PYJA 2E2PA 2R7YA 4RW7A 4CGFA 4PWDA 1RT4A 5EOYA 1KCFA 4H5WA 3TR8A 1U48A 4BR2A 4NCAA 3EN9A 3VA0A 2OZSA 4LF6K 1GLJO 4CEZA 1S9GA 2VWKA 1NK0A 1D9FA 3SQ4A 4ID5A 3AVMA 1L3VA 4B9MA 5ADXA 4CBWA 3VF4A 3TPQA 1U49A 3VA3A 4BRCA 2GX9A 3C7NA 5JVGL 4DR7K 3NF7A 3P1GA 1KSPA 4CEDA 4OLAA 1GLAG 1B9DA 2PAVA 1RT2A 2OA8A 3LDLA 4BACA 1IBLK 3CCLN 3ZLJA 5ADXH 1CLQA 3PLAA 4CGGA 3KVGA 1RTDA 1TK8A 3OTOK 4Y1DA 1RT5A 4BRNA 3LWMA 4CEFA 3CCSN 2Z1GA 3PV8A 3LP0A 3A2FA 3SUNA 2HNZA 5GINA 3WXJA 4M41A 5JMVA 4E7LA 4M7YA 1BQNA 4DTMA 1HQEA 3L2RA 3IAYA 4CEOA 1T6DA 4BY9C 3THWA 5IWAK 1KVBA 3QIPA 3VGMA 1WN7A 4JKEA 1VQMN 4LH5A 4FJJA 4F2SA 2NRVA 2HBLA 2GWJA 3EO3A 3AVCA 3EE9A 3HPHA 4DV0K 4IKFA 2VG6A 1GOBA 3WNFA 2W41A 2PBDA 3RMCA 1VSFA 2QW9A 3N4QA 4FXDA 3G0ZA 2Z1JA 3VF6A 5J2MA 1JCGA 3HPOA 3QINA 1IH7A 3DOKA 3C95A 1X9WA 4C8LA 3M3ZA 3V9SA 2P9LA 3UKUB 5BPNA 2Z1HA 3EYZA 1T44A 3TARA 1Q9XA 1NMDA 1Q82O 1KVCA 3KKSA 1NMNA 1EQYA 3B6OA 3TI0A 5GIOA 1QQOA 4IOAL 1OVYA 2QA4N 2E2NA 3CQXA 4GV9A 3B8AX 4JHDB 1VQON 4WQ5C 4B3MK 4IOCL 1ESVA 4I2QA 4B9UA 2JLEA 2WUSA 1NGIA 3DAWA 4FWNA 1S6QA 3DXKB 5GAEP 5M1PA 3JXUA 2O8CA 5M1OA 3AVNA 4JRQA 2RF2A 1NBWA 1S1WA 1Y64A 3DXMA 2ITMA 3FR0A 4DUZK 2I7PA 3VQAA 1RBUA 1CXQA 3C6HA 3K5MA 2FF3B 4KB1A 3HBTA 1K73O 4BRLA 1OH5A 5DM6L 4OPKA 1X9SA 4NB4A 5BR8K 4LF5K 2Z1IA 4NLBA 4CJ4A 3VERA 1MA9B 2KW4A 3EKSA 3MEEA 5BRFA 1XNQK 4F4KA 1Y97A 2D0CA 3HJFA 3CQYA 4EZ6A 3OYBA 1J53A 4MFBA 4DR5K 3CC7N 3SUQA 1L3SA 2FSNA 1LW0A 4DFKA 1BO5O 2OPSA 3RRGA 2CGKA 2IGIA 4A61A 3PX4A 2YNIA 1DLOA 4Z94A 3CMAN 5DM7L 4CEEA 4EIAA 1RDAA 2CH5A 1KAXA 1IKVA 4EP4A 3QNNA 5BN8A 1RBRA 3TAFA 1TV6A 1TL1A 2G8UA 2D0PA 5AQRA 2BANA 1YTUA 3EZ5A 3DOLA 3VMFB 4FLUA 3SV3A 4OKEA 1W7AA 5KGXA 2H3GX 4JKCA 3QIOA 1P8ZA 2GUPA 4GY2B 5I3UA 2QXFA 3NVMA 1BU6O 1QE1A 3D2EB 4WF9L 2HVHA 1JKHA 4YDUC 5JICA 5AQJA 1SUQA 1CZBA 3C6UA 3D6RA 3ZSZA 1SKRA 3BF1A 4YORA 1T8EA 1QSSA 4ILJA 3AARA 4FPAA 3L2WA 1BISA 3NE6A 3SMSA 1E3MA 4FW1A 3FZHA 4FPBA 1NK5A 1IJJA 4C1NI 3ZSWA 3HI0A 1IV0A 3AO2A 3QEXA 3HVRA 1YAGA 4DUYK 1NGBA 2RN2A 3HTVA 1QHTA 3TAGA 4LC9B 1WUAA 1BIZA 3T19A 3ULDA 2QWPA
chains in the Genus database with same CATH topology
2UU9K 4AQYK 4DUZK 5A2QO 3OTOK 4B3RK 4YHHK 2HHHK 4X65K 1HNWK 4JI1K 4DR4K 4B3TK 2VQFK 1XMQK 4JI7K 4JI3K 2UUAK 4LF9K 4CVNE 5BR8K 4GKJK 3J81O 1IBMK 2UXCK 4LF5K 4X66K 2UUBK 3T1YK 2UXDK 5IWAK 4JI0K 1XNQK 3J7AP 4DV3K 3JAMO 1FJGK 3J7YP 1HNZK 4KHPK 1N36K 4DV5K 4DR5K 4DV0K 4JI5K 4K0KK 1N33K 5IT9O 4JV5K 1IBKK 4B3SK 4JYAK 4LFCK 2UXBK 4GKKK 2ZM6K 4DR1K 4JI6K 1N32K 4JI4K 4LF4K 5LL6Z 4LFAK 1N34K 1HR0K 4LFBK 5AJ3K 4OX9K 4DR3K 5LMNK 4V19S 2E5LK 5FLXO 4CW7B 1HNXK 4LF6K 4DR6K 4DV7K 4DV1K 4DV2K 3T1HK 4X62K 1XMOK 4LF8K 1J5EK 4DR7K 1I94K 4LF7K 4NXNK 4X64K 4DV6K 4B3MK 2UUCK 3J80O 4JI2K 2F4VK 1XNRK 2VQEK 5LMUK 4DUYK 4YY3K 1IBLK 4DR2K 4JI8K 4DV4K 4NXMK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UU9 K;  4AQY K;  4DUZ K;  5A2Q O;  3OTO K;  4B3R K;  4YHH K;  2HHH K;  4X65 K;  1HNW K;  4JI1 K;  4DR4 K;  4B3T K;  2VQF K;  1XMQ K;  4JI7 K;  4JI3 K;  2UUA K;  4LF9 K;  4CVN E;  5BR8 K;  4GKJ K;  3J81 O;  1IBM K;  2UXC K;  4LF5 K;  4X66 K;  2UUB K;  3T1Y K;  2UXD K;  5IWA K;  4JI0 K;  1XNQ K;  3J7A P;  4DV3 K;  3JAM O;  1FJG K;  3J7Y P;  1HNZ K;  4KHP K;  1N36 K;  4DV5 K;  4DR5 K;  4DV0 K;  4JI5 K;  4K0K K;  1N33 K;  5IT9 O;  4JV5 K;  1IBK K;  4B3S K;  4JYA K;  4LFC K;  2UXB K;  4GKK K;  2ZM6 K;  4DR1 K;  4JI6 K;  1N32 K;  4JI4 K;  4LF4 K;  5LL6 Z;  4LFA K;  1N34 K;  1HR0 K;  4LFB K;  5AJ3 K;  4OX9 K;  4DR3 K;  5LMN K;  4V19 S;  2E5L K;  5FLX O;  4CW7 B;  1HNX K;  4LF6 K;  4DR6 K;  4DV7 K;  4DV1 K;  4DV2 K;  3T1H K;  4X62 K;  1XMO K;  4LF8 K;  1J5E K;  4DR7 K;  1I94 K;  4LF7 K;  4NXN K;  4X64 K;  4DV6 K;  4B3M K;  2UUC K;  3J80 O;  4JI2 K;  2F4V K;  1XNR K;  2VQE K;  5LMU K;  4DUY K;  4YY3 K;  1IBL K;  4DR2 K;  4JI8 K;  4DV4 K;  4NXM K; 
#chains in the Genus database with same CATH topology
 2V51 B;  3V9W A;  2QTD A;  5CYM A;  1RDC A;  5SWM A;  3O9R A;  4GVE A;  2E8A A;  2FLO A;  3DRS A;  3FZL A;  5FPM A;  4U7B A;  3BZK A;  4PA1 A;  3P83 D;  3F73 A;  2HHX A;  3FFI A;  3L2V A;  4O0I A;  3R1X A;  3VQP A;  1BOT O;  3LPT A;  4O5F A;  4PL8 A;  3JAM O;  4YOW A;  1RBT A;  2VCP A;  3MWT A;  4IG0 A;  2CH6 A;  4YOV A;  2OTL N;  2E1Y A;  1WLJ A;  1N8R O;  3OYL A;  3I33 A;  2OZM A;  2UXB K;  1EWQ A;  2VYP A;  4CBX A;  3VN5 A;  1YF5 L;  4Q5V A;  1TKD A;  2Q1N A;  5EXW A;  1N5Y A;  1KLM A;  5LL6 Z;  1CZA N;  3T1A A;  4MLH A;  1LAV A;  4BRQ A;  4JKH A;  1JLC A;  3NVK A;  4B1W B;  1BCM A;  1JLB A;  4V19 S;  3QES A;  2Q0U A;  1QZ5 A;  4CIF A;  1ZC6 A;  2KLA A;  2EHG A;  1ZBI A;  1M90 O;  3HVT A;  4DQ8 A;  2QM1 A;  2A42 A;  5AQK A;  1BL3 A;  4WQ5 A;  4PQU A;  3CJ7 A;  1XWL A;  4OLB A;  3SI6 A;  4X62 K;  5JLF A;  3UKU A;  4NYN A;  5FRM A;  4FJ5 A;  1A5V A;  2NRH A;  4QCL A;  3MN9 A;  3NH0 A;  4CHO A;  4FK4 A;  3L3U A;  1RTJ A;  3VEN A;  3PO5 A;  4ID1 A;  4E7J A;  3CQ8 A;  4LY7 A;  1T7P A;  4IJN A;  2AJQ A;  4DSF A;  1SQK A;  4DQR A;  3H1Q A;  2P9N B;  4NXM K;  4CHP A;  4H5N A;  2WOM A;  3L2U A;  1TYQ B;  5F2R A;  2WTU A;  5CY4 A;  4WCE L;  3ENO A;  3NF6 A;  3IFR A;  4JHD A;  4DFM A;  3SZ2 A;  1BI4 A;  4PHT X;  2P9U B;  5GIP A;  1OKJ A;  4ILG B;  4O44 A;  3U3Y A;  4QOZ B;  1WSE A;  4JI7 K;  3V9U A;  5AQZ A;  4K42 A;  4M7X A;  3FE1 A;  4BRO A;  3S3O A;  2A41 A;  3SYZ A;  4FJM A;  4HUE A;  2P9K B;  3WT0 A;  3ZT3 A;  4M45 A;  3QNO A;  4DV3 K;  1H1V A;  4DSJ A;  3HYF A;  3QEV A;  1WAJ A;  5TKW A;  3AVB A;  2F7T A;  2P5O A;  3F2K A;  1MWK A;  4CGH A;  3E9O A;  3OYH A;  2V7Y A;  4CZF A;  5MLC Q;  2IDO A;  3G71 N;  3EE8 A;  5DMR A;  4AHT A;  1GLL O;  3HOS A;  2YHW A;  1WSJ A;  3LP3 A;  3A5O C;  5I42 A;  5FPD A;  3AV9 A;  4LSL A;  1BGX T;  4KH4 A;  2HHU A;  5M1N A;  4HUG A;  3L2Q A;  3GL1 A;  1XC3 A;  2O8D A;  4WE1 A;  5TKY A;  4B8A B;  2NRR A;  2Y1J A;  4MDA A;  5KPR A;  4E1M A;  1NK8 A;  1VSK A;  4J2E A;  3CI5 A;  3S3N A;  3B6P A;  5AZI B;  3CET A;  1WSG A;  4NCG A;  1Q86 O;  4DHY A;  3OYE A;  1ITG A;  3ENH A;  4CGJ A;  3D2E A;  2E20 A;  1P90 A;  4FCY A;  4CE9 A;  1KFD A;  2D0A A;  1Z05 A;  4KTZ A;  3WNE A;  2OAN A;  3K5N A;  4RG8 A;  3VF2 A;  2OPQ A;  4DTN A;  4CHN A;  4GV6 A;  4DV4 K;  4OJR A;  2HBK A;  2DTU A;  3ZYY X;  4JK8 A;  1VQ5 N;  2YCH A;  2E2O A;  3SMP A;  3QML A;  4IEI A;  1Q9Y A;  1S22 A;  4KI6 A;  5SZT A;  4KBO A;  5AZJ B;  3L0Q A;  3L4Q A;  3KK2 A;  4BGB A;  2DFH A;  3V4I A;  3PY8 A;  3PIO L;  5AQH A;  4JKF A;  1XMQ K;  3P31 A;  4BQL A;  3G25 A;  4K8X A;  2G8H A;  2PY5 A;  1QTM A;  3LAN A;  2X74 A;  4RW4 A;  3OW2 M;  4H0X B;  4H8K A;  1K8K A;  4CK3 A;  2ITG A;  4B1V A;  1DKG D;  1KFS A;  4DV5 K;  4PKI A;  4BC2 A;  3SAG A;  1YVU A;  4OVL A;  3OYF A;  3KIO A;  1FKO A;  3K9K A;  3K2P A;  2XO7 A;  4HVJ A;  4AF1 A;  4JN4 A;  3O08 A;  4IO9 L;  4MLE A;  4CJP A;  1Z6R A;  3TSQ A;  4GV3 A;  1EX4 A;  3CM5 A;  3LAK A;  3AVF A;  4CF0 A;  3MXM A;  4KRE A;  4BRF A;  3HOT A;  1N34 K;  3KWI A;  2Y1I A;  5HRS A;  4DR3 K;  2FBT A;  4KAZ A;  3LPU A;  2EWS A;  2E5L K;  5J2P A;  3O8M A;  4KRF A;  4Z4G A;  1EET A;  3ZT2 A;  4YNQ A;  4B9T A;  1WOQ A;  4H5T A;  3ZT1 A;  3FGU A;  1S1T A;  3AO3 A;  2JGU A;  4KO0 A;  1A5X A;  1QSL A;  3LDQ A;  2PFU A;  4CZM A;  4H0T B;  4DV2 K;  5GAG P;  3LM2 A;  4E7H A;  3QBX A;  5E41 A;  1HKC A;  2GTD A;  3RR8 A;  1NJX A;  3BGR A;  4IXC A;  3O4Q A;  2UUC K;  2X78 A;  3THX B;  1NWK A;  4IBN A;  1NK7 A;  4KHN A;  3BUZ B;  1ATS A;  3L8B A;  3SPY A;  2ZD1 A;  3DRP A;  2VWB A;  1U2V B;  4W5R A;  2QKB A;  1NGH A;  1J6Z A;  4J8F A;  1Q8I A;  4BRD A;  3CCR N;  4CZL A;  3SBT A;  1NGC A;  4QS8 A;  5CYQ A;  3KK1 A;  4L3Q A;  5HL7 L;  3O80 A;  1HPM A;  4DTR A;  2BE2 A;  3CCE N;  1IG8 A;  2FBY A;  4LF9 K;  1GOA A;  3R3L A;  5C2D A;  3J81 O;  3AY9 A;  3ATU A;  1TYQ A;  4J2D A;  2UXD K;  1W2B M;  3CC4 N;  4I7F A;  4FJH A;  1C1C A;  1Q81 O;  5M1K A;  4B9Q A;  2P9U A;  3O1B A;  1I3A A;  1F21 A;  5LJV A;  1QVG M;  3KWG A;  2IVN A;  4PL7 A;  3AVL A;  4B1Z A;  3QFU A;  2D4W A;  2P9K A;  4WFB L;  3DYA A;  4ELV A;  3MX2 A;  2V52 B;  4BDY A;  4FWO A;  4KH6 A;  2XY7 A;  5AQN A;  4WQ4 C;  4Z4H A;  4NCB A;  4CJ7 A;  3J7Z O;  2OCE A;  4BE1 A;  3V81 A;  4B1Y B;  1HYZ A;  4B08 A;  4BDP A;  2E4L A;  4GVM A;  1GLD G;  2FBV A;  1NOY A;  2CGJ A;  4F3T A;  3H46 O;  5CHI A;  3AO1 A;  3VET A;  1YT3 A;  1BQM A;  4CJ3 A;  1LOT B;  1VAZ A;  3ZX3 A;  2YNG A;  1VQK N;  5CR4 A;  3T1H K;  1ZYQ A;  3D7E O;  4BRP A;  4N76 A;  1NGD A;  3R9P A;  3U4L A;  3H6E A;  1HJO A;  3CIP A;  4X64 K;  1ZBL A;  1TK0 A;  4M3T A;  1YJN N;  3J80 O;  5BRD A;  1HKB A;  3ZSV A;  1S6P A;  2F4V K;  1TKZ A;  1J5O A;  1XNR K;  2LSN A;  2P9I B;  5LMU K;  1OH6 A;  1IG9 A;  1VQL N;  5AZI A;  4JI8 K;  2OYQ A;  5JLH A;  4ISE A;  2KZM A;  4AQY K;  3ZX2 A;  3AAQ A;  2P1J A;  4QS9 A;  3MCP A;  4H0P A;  1ASU A;  4CF1 A;  1RDW X;  1B9F A;  3ZT4 A;  1JL1 A;  3HO1 A;  2IC3 A;  3ZCM A;  3MXI A;  1HLU A;  1X3N A;  4CJR A;  1BA0 A;  2I5J A;  3ATV A;  1RT6 A;  2QEX N;  2UUA K;  3T69 A;  1RGI A;  2HBM A;  4CVN E;  4B1U B;  2UXC K;  1IBM K;  4DSE A;  3OYI A;  2Q3S A;  3QIC A;  2QWL A;  4X66 K;  1EO1 A;  3NGY A;  2VGN A;  4FLT A;  1JLG A;  5AZJ A;  4B3O A;  4A62 A;  1C0M A;  4H5V A;  4FOE A;  3SQ0 A;  4DF4 A;  4K0K K;  3QFP A;  5EX5 A;  3TTF A;  1ZBS A;  4JV5 K;  5AQV A;  1LWC A;  2P51 A;  2A1S A;  3A5M C;  3PIP L;  4OKJ A;  1VSE A;  1ZBH A;  5AQS A;  4CF9 A;  4GKK K;  2GWK A;  2W6K A;  4QAG A;  3NGZ A;  4DR1 K;  4BWM A;  1RT7 A;  2QWM A;  3TAE A;  3BDP A;  1HJR A;  5LJW A;  4CCH A;  2BUP A;  4ZTF A;  4YOU A;  1TGO A;  4EHU A;  3M5R A;  4R79 A;  3ISN C;  3V1Q A;  4NO7 A;  4CZH A;  4MO5 A;  3H08 A;  2IAJ A;  3ZSX A;  1L5U A;  1NG9 A;  5M1F A;  3V9Z A;  1SAZ A;  2JWL A;  4RW8 A;  4I6M B;  2NNW A;  4Z0U A;  2YJF A;  1RIL A;  2RKI A;  4H03 B;  1EP4 A;  2FBX A;  3V1R A;  4DFJ A;  2XHB A;  2D5R A;  2P9P B;  4W5T A;  3T3F A;  4G1Q A;  1VQN N;  3KLF A;  5AQY A;  4IOX A;  1BUP A;  1WAF A;  2HB5 A;  4LF8 K;  4JLH A;  2Q0R A;  1QS4 A;  1CXU A;  4IJA A;  5EU7 A;  3OJU A;  3VEW A;  4KPY A;  4RW6 A;  1W97 L;  3O6W A;  1T3V A;  4CZE A;  3WNG A;  4GNI A;  3SUP A;  2VG7 A;  1KQS M;  4CZJ A;  1X9J A;  4CGD A;  4BVP A;  1D5A A;  3VEX A;  1VSI A;  2YX6 A;  1HQU A;  3OBY A;  4BVO A;  2QWN A;  1NJI O;  3M6G A;  3SAH A;  3QEP A;  4F9O A;  3E1Y A;  4FWQ A;  3C65 A;  3THX A;  4DU3 A;  1L3U A;  1RT1 A;  5FDL A;  3ID8 A;  5E84 A;  1YIT N;  2ASO A;  1U2V A;  2QXL A;  3WNH A;  5BPL A;  1GLB G;  1NOZ A;  4DTO A;  3L6Q A;  3CM6 A;  1VQ9 N;  2HHV A;  1X3M A;  1RCH A;  4PKG A;  4E1N A;  4BGA A;  1YIJ N;  4IFV A;  4OGC A;  5KTQ A;  2OPP A;  3VQ8 A;  4EAH D;  3MN5 A;  3O4W A;  5HBM A;  3CFP A;  1N36 K;  1LWF A;  1RT3 A;  2NZT A;  2G8I A;  4H0O A;  5FPN A;  2IS3 A;  2F9T A;  3IG1 A;  3THV A;  4NLC A;  2HF3 A;  2A1R A;  4ELU A;  4JYA K;  4WQ4 A;  2HMI A;  4DTJ A;  5E26 A;  4DB3 A;  3RWU A;  1YJW N;  2O4I A;  3OS1 A;  1GLF O;  5KRT A;  3ZET B;  4DG1 A;  4M3X A;  1FW6 A;  1MU2 A;  1SKS A;  4N56 A;  1QQC A;  3K59 A;  5I9E B;  4B9L A;  4E0D A;  3VTH A;  3PSF A;  3KK7 A;  4CJQ A;  3F9K A;  3I55 N;  1WB9 A;  1KTQ A;  1DGK N;  4FWL A;  3GOI A;  4WYB A;  3MWP A;  3BF3 A;  2B6A A;  4C8M A;  2KHO A;  4FZZ A;  4EHT A;  1WBB A;  1J5E K;  4HCB A;  2HHT A;  3KLG A;  3LDS A;  2YNF A;  5BRE A;  4JRP A;  2OTJ N;  1WSH A;  3GDQ A;  2XRI A;  1DTQ A;  1JJ2 M;  3OS2 A;  1UWB A;  5FRO A;  1TUU A;  1SS6 A;  3TAB A;  1NM1 A;  5KQ8 A;  2UU9 K;  4JD2 B;  2BDP A;  3AVJ A;  1RFQ A;  3ITH A;  1K9M O;  4FLZ A;  2F96 A;  1K8A O;  4CFC A;  1IKW A;  1WNS A;  3BEX A;  4FL9 A;  3AO5 A;  4CZG A;  5HOO A;  1UAX A;  2P9I A;  1HNW K;  3U6F A;  2W42 A;  2A40 A;  4HWI A;  5C24 A;  4I9Q A;  1R59 O;  3MCA B;  3AVK A;  4CJF A;  1TKX A;  3Q7C A;  1TAU A;  5AQW A;  2HNY A;  3HRG A;  3TTD A;  5KI6 A;  3LDP A;  1T6C A;  1S1V A;  3MEG A;  3HST B;  3I0S A;  4FWK A;  2NLX A;  3CYM A;  4CJE A;  1N33 K;  3DXK A;  1K6Y A;  3NDK A;  5J1E A;  3TWH A;  3IDH A;  3S9H A;  2VGM A;  3VQ4 A;  3HP9 A;  4H0Y B;  3I56 N;  2Q2R A;  2YJE A;  4BR9 A;  4DCH A;  2X6N A;  1WSF A;  2B5J A;  5FPE A;  3VOV A;  1JLA A;  4OKK A;  4FSV A;  4PKH A;  2A5X A;  2XY6 A;  4FJI A;  5HLF A;  2IVP A;  2NUB A;  1JCF A;  4IWV A;  3TSP A;  4AM7 A;  3IRX A;  3UB5 A;  4E7K A;  3K5L A;  4ZHR A;  4XH4 A;  5BR9 A;  4DU4 A;  2IVO A;  1S1U A;  4IEE A;  4PY5 A;  3AA5 X;  2BTF A;  4ISF A;  5AQI A;  5J2Q A;  3O9T A;  4YDU A;  4NXN K;  3V9X A;  5D3G A;  3P4I A;  4I6M A;  3THY B;  4FOI A;  3DLK A;  4K25 A;  4N5S A;  2P9P A;  4FVU A;  4FWP A;  3KKR A;  4BC5 A;  2YKM A;  1XC9 A;  3HM9 A;  1HNV A;  1XUP O;  4HCC A;  3EKU A;  4X65 K;  3MK6 A;  5ELZ A;  2YHB A;  2WFB A;  2DPN A;  3CCU N;  3BP8 A;  1S72 N;  1U45 A;  4AHV A;  2KFZ A;  4KTQ A;  2F9W A;  3QBW A;  3R6M A;  3ZEU B;  4GKJ K;  2DY4 A;  4CEQ A;  2GUI A;  3VQ5 A;  3N4P A;  3OHR A;  5B8H A;  3CCQ N;  5HRR A;  3OA9 A;  5C10 A;  2PYL A;  1KXP A;  4FYD A;  3E01 A;  1YTA A;  1A5W A;  1NK4 A;  4BE2 A;  2NRT A;  4DS4 A;  5HRO A;  5HRP A;  4BDZ A;  4ICL A;  1ATR A;  2E88 A;  3TAP A;  2RE2 A;  3CD6 N;  3NH1 A;  5K14 A;  4CFB A;  4WFA L;  4Z4E A;  1YHQ N;  2G8V A;  1VSM A;  1VQ8 N;  4F2R A;  2RPI A;  1VSJ A;  1U6Z A;  1HR0 K;  3M8P A;  4HUF A;  4CFD A;  3DLH A;  1V4T A;  5C15 A;  2ZJR L;  2I7N A;  4YFU A;  4CHQ A;  4JKA A;  3CFR A;  1HNX K;  2F8S A;  3OYM A;  1NU0 A;  4KH5 A;  3QB0 A;  3RR7 A;  3D45 A;  4KB0 A;  5C12 A;  2QKK A;  1BA1 A;  3ZET A;  5AQL A;  3ULE B;  4DV7 K;  1LWE A;  1VSD A;  2FSK A;  2ASP A;  3W3D A;  3F9M A;  4DV1 K;  1ASV A;  3ASM A;  3U8X A;  4B1X B;  4FWR A;  4BQZ A;  1BG3 A;  3SUO A;  4H5R A;  3M8S A;  3QO9 A;  4AH9 A;  1BWF O;  1I94 K;  4N41 A;  2BGG A;  4DV6 K;  5FRN A;  3RSE B;  3ZSR A;  4Y1C A;  1DT9 A;  2HHW A;  4BG9 A;  4DS5 A;  3VQB A;  4JK9 A;  2W40 A;  3ZX0 A;  1EKE A;  4DR2 K;  1RDD A;  4XIU A;  1VRU A;  3KK3 A;  4DU1 A;  2ZWH A;  3VEY A;  2ZGY A;  3CJ9 A;  4L8R B;  1NGA A;  2Q97 A;  5DK5 A;  3EEQ A;  2E1Z A;  3CCV N;  1VK0 A;  3W0L A;  4BRI A;  3LM9 A;  4MDB A;  3VQE A;  1C0G A;  2HOE A;  3AGR A;  3HL8 A;  2AA4 A;  4RTF D;  1C0U A;  4DSK A;  4W5N A;  1S9E A;  2ATQ A;  1FKP A;  2D0O A;  3DRR A;  4M42 A;  3CC2 N;  4CFA A;  1SV5 A;  1NGG A;  4JD2 A;  4LD0 A;  3WXI A;  1TAQ A;  2Q36 A;  1BDG A;  2HST A;  2FXU A;  3ZSQ A;  3G10 A;  5KGW A;  1TKT A;  1D4X A;  3CCJ N;  3T1Y K;  4K41 A;  3SNN A;  3SBG A;  4FJG A;  3FFK B;  3MEC A;  3HZ6 A;  4JI0 K;  4KHW A;  4O8K A;  4O5B A;  3LL3 A;  3QLH A;  5H1S Q;  1CZ9 A;  1JXB A;  4B9S A;  4C1N K;  3FZK A;  4CZI A;  5GAD P;  4PUO A;  4I9L A;  4KHU A;  5IT9 O;  2NRX A;  3EL2 A;  4B3S K;  4FLW A;  1RBS A;  3RMD A;  4KKO A;  3LDN A;  4DLE A;  3WEE B;  1L3T A;  2P9N A;  3T7Z A;  4FZX C;  4JI6 K;  3UIQ A;  3CHW A;  1ATN A;  2QWR A;  4NYF A;  4E3S A;  1HYS A;  1KD1 O;  1U04 A;  1V4S A;  3NBP A;  3IKM A;  1JLE A;  5LMN K;  1KC8 O;  5AQU A;  5LY3 A;  4ELT A;  3OYD A;  1C1B A;  4FVM A;  5FLX O;  3OYN A;  3AA3 A;  1NJZ A;  4BR0 A;  5JS1 A;  3O9Q A;  1NGF A;  4BWJ A;  2ZJQ L;  3MN7 A;  3VQC A;  4CBU A;  3E9P A;  2UYT A;  4EP5 A;  4KTW A;  3VQ7 A;  4JS4 A;  4DR6 K;  4IZ9 A;  3PX0 A;  4BRH A;  2ZF5 O;  3DLL L;  3NGI A;  1RDU A;  4A59 A;  3LZI A;  4CI6 A;  3QEW A;  2KFN A;  3VQQ A;  1XMO K;  3CPW M;  3NMU A;  2P9S B;  4CER A;  4ZTJ A;  2YHX A;  4JKG B;  3O3G A;  4DWI A;  4FJX A;  1KVA A;  3OBW A;  3SK3 A;  4JS5 A;  5AR0 A;  4FJ9 A;  4AHU A;  3GBT A;  4CJV A;  2XY5 A;  4LH4 A;  4CF2 A;  2KQ2 A;  3NHG A;  3MXJ A;  3K58 A;  1SL0 A;  1VRT A;  3CF5 L;  1NK6 A;  2HHH K;  3H1V X;  3A5N C;  4DTS A;  3AVI A;  3THY A;  1XHX A;  3O4N A;  2HW3 A;  1C0T A;  2YI1 A;  5C25 A;  1DEJ A;  1U4B A;  3JS6 A;  5AQP A;  4CJ5 A;  2UUB K;  1IKY A;  4CIE A;  1UA1 A;  4CEC A;  3DM2 A;  4FWM A;  4IO8 A;  1NKC A;  3D0P A;  2VG5 A;  1HNZ K;  3OYC A;  2IIR A;  4FLY A;  4CEA A;  1NJY A;  3KD5 E;  3BY5 A;  2HMP A;  2ASM A;  3F5T A;  4A5A A;  3ZEU A;  4E1J A;  3LWL A;  1NLV A;  3C6A A;  3VEO A;  1Z25 A;  3ALY A;  5F0X A;  4AIL C;  1OH8 A;  1NKB A;  3DLE A;  1NKE A;  2FF6 A;  3V6D A;  1VHX A;  1JLF A;  2YV0 X;  4BG8 A;  1IO2 A;  2WC9 A;  5AQO A;  1QSY A;  1TVR A;  4KHS A;  1QQN A;  3AVG A;  2FSJ A;  4DSL A;  1JL2 A;  1TK5 A;  1BI4 B;  4LSN A;  4J2B A;  1MWM A;  5CZ1 A;  5KPT A;  4DTX A;  2O8F B;  3HK2 A;  4UY8 O;  3K57 A;  4DKW A;  2WBN A;  1T03 A;  1SL1 A;  1SL2 A;  3S3M A;  4FLV A;  3K0S A;  2FC0 A;  3VEV A;  1WBD A;  4LF7 K;  2YHA A;  4AHR A;  4O8U A;  2QWQ A;  5AQG A;  3ULE A;  1TUY A;  3CJC A;  3RVC A;  3O9U A;  3SCX A;  3SLC A;  1MDU B;  4B8C A;  4CGI A;  4C8N A;  4M63 C;  1YI2 N;  4CJS A;  2ZGZ A;  1LW2 A;  5AFU A;  2A3Z A;  4FJK A;  3LP2 A;  4R5P A;  1REV A;  3FLC O;  2YHY A;  3TU5 A;  3RSE A;  4FJ8 A;  4B9N A;  2P5G A;  4F8R A;  4HTL A;  3IUC A;  4M3Y A;  3C0B A;  2B4J A;  2O8D B;  3M8R A;  3UKR B;  3KHY A;  3J8A A;  3E9L A;  5EVZ A;  3VQD A;  4CZK A;  4YOY A;  1ZBF A;  4AHS A;  3VGL A;  1BCO A;  4FJ7 A;  1GLC G;  3OS0 A;  5AFU H;  3FZM A;  4BR4 A;  1QZ6 A;  4KHP K;  3VEZ A;  1HX1 A;  4C8K A;  4M3R A;  3O9S A;  1D9D A;  1KRP A;  4KFB A;  1S1X A;  1DTT A;  1YJ9 N;  2NRZ A;  3CFO A;  3M8Q A;  4FK0 A;  3FZF A;  3D2F B;  4LFC K;  3AO4 A;  4GMJ B;  3PX6 A;  2KKZ A;  2NRW A;  1IKX A;  2QWO A;  1HMV A;  4W5Q A;  3BZC A;  3S41 A;  3MN6 A;  3KLE A;  1N32 K;  3NAE A;  2HVI A;  3C6T A;  3QEI A;  3CME N;  2HND A;  2O8E B;  4JEP A;  3DLB A;  4E89 A;  4IFY A;  4LFB K;  1ZXO A;  2JWK A;  4CW7 B;  3WEE A;  3CER A;  3VGK A;  3SPZ A;  1O13 A;  3VQ6 A;  3P39 A;  4CK2 A;  3H3O B;  3NF9 A;  1UOC A;  4C8O A;  4DQQ A;  3ZSY A;  4MQ3 A;  3MDQ A;  3TAQ A;  1I39 A;  4A2A A;  1U47 A;  1RBV A;  5BN9 A;  3PSI A;  2VWJ A;  4M3Z A;  4JKD A;  4BRA A;  3H45 C;  5KRS A;  1K8K B;  2ZE2 A;  5CZ2 A;  3ENB A;  1NNE A;  2Q31 A;  3HT3 A;  4CF8 A;  5HRN A;  3TAN A;  4MO4 A;  1LV5 A;  4JI2 K;  3WXM B;  4Z4F A;  2X6S A;  1N6Q A;  2OPR A;  1Q18 A;  3SQ2 A;  1ASW A;  5C2F A;  3MED A;  4TSX A;  4YY3 K;  3NFA A;  3OJS A;  3G6E N;  2HBJ A;  4FM0 A;  2HHQ A;  1NJW A;  2P9S A;  3OYA A;  3EZW A;  4JKG A;  1D8Y A;  4YHH K;  4CHZ A;  2CGL A;  3DI6 A;  3I0R A;  1FXX A;  4JAX A;  4U67 L;  1QVF M;  1W0H A;  3PO4 A;  3QER A;  3R8E A;  1YUW A;  4H4O A;  1BHL A;  4DR4 K;  2IOC A;  1VQ6 N;  2EX3 A;  4DF8 A;  2G8W A;  1S5J A;  2DFE A;  3CPE A;  5J2N A;  4W5O A;  4CJK A;  4QS7 A;  1UA0 A;  3NF8 A;  4Z4C A;  4FW2 A;  3E66 A;  3CJB A;  4DSI A;  5AQT A;  4FO0 A;  4DFP A;  4XH5 A;  5KPZ A;  1VQP N;  3J7Y P;  1QQM A;  2YNH A;  2O8B B;  4DTP A;  3SAF A;  3NH2 A;  4GW6 A;  5T7B A;  3RRH A;  3JYT A;  3KZB A;  3U3G A;  5F1X A;  3DJC A;  3IMX A;  3A5L C;  1IBK K;  1E4G T;  4J2A A;  3MAQ A;  3CXC M;  4I2P A;  1XHZ A;  3VQ9 A;  3I8B A;  3I8D A;  3ZT0 A;  4FLX A;  4FZY A;  1LCU A;  4JKB A;  4KV8 A;  2ZQB A;  3RTV A;  2D1K A;  4JI4 K;  3CJA A;  1KAY A;  1C0F A;  3CJ1 A;  1HRH A;  2KTQ A;  2GV9 A;  3A8Y A;  4FJN A;  3UE5 A;  4CJU A;  3C7N B;  3OY9 A;  1ILY A;  1RNH A;  2E6L A;  3HPG A;  4XH1 A;  4HTU A;  4E7I A;  4OPH A;  3VES A;  1YXQ A;  1YVN A;  3ZSO A;  5C0Y A;  4A2B A;  3KD1 E;  4IG3 A;  1JXE A;  4OPJ A;  3AVA A;  1JCE A;  4CJW A;  3NCI A;  1VQ7 N;  3LZJ A;  3CG7 A;  4RCH A;  2G8F A;  3WXL A;  1B92 A;  2O8F A;  2XY8 A;  1KAZ A;  4CES A;  1JLQ A;  4A5B A;  1HKG A;  4Q0B A;  3GE1 A;  1RDB A;  2VQE K;  4K43 A;  1G15 A;  4FM1 A;  2RHK A;  3LDO A;  4DTU A;  4CJL A;  4H0V B;  3AGK A;  2AP1 A;  4O55 A;  3DWL A;  1TL3 A;  4AHC A;  4RWT A;  3O5B A;  4KHQ A;  5HP1 A;  1E4F T;  2A6A A;  3HM8 A;  3THW B;  4E19 A;  3JSM A;  5M1Q A;  5A2Q O;  4B3R K;  3SJJ A;  4AM6 A;  4FM2 A;  3OYG A;  4DMN A;  3G4S N;  4A57 A;  1NK9 A;  1VQ4 N;  3IS9 A;  4B3T K;  1KLN A;  3PUF A;  4BR5 A;  4N47 A;  3A0I X;  3KLH A;  3O3H A;  1SKW A;  3MMV A;  4OO1 J;  2E6M A;  4B9V A;  3KTQ A;  1SZ2 A;  4WFN L;  5BRH A;  1XQS C;  2GBZ A;  1X1P A;  3WQT A;  5AQQ A;  4BRG A;  3J7A P;  4HHT A;  1OH7 A;  2HHS A;  3LP1 A;  3AA4 A;  3L4I A;  2F8T A;  4YOX A;  2G8K A;  4CJT A;  3KJV A;  2O4G A;  3UKR A;  1WSI A;  4FK2 A;  4BRK A;  4RW9 A;  4JI5 K;  1FK9 A;  4F3O A;  2J4R A;  3VTI A;  2P9L B;  3OVN A;  1T05 A;  3TAM A;  4EFH A;  4Y0W A;  4DLG A;  4OPA A;  3RMB A;  4CIG A;  2WON A;  4G9Z A;  3GG4 A;  1RTI A;  3SQ1 A;  5JS2 A;  4LF4 K;  4BRM A;  1GLE G;  1HUX A;  5AJ3 K;  4OX9 K;  3AA2 A;  3P38 A;  4BR7 A;  2D0B A;  3KLI A;  1RTH A;  4DQS A;  3Q7B A;  3D2F A;  4XEI A;  1HNI A;  3U9Z A;  1EXQ A;  1VSL A;  3DMJ A;  3H3N O;  3QDK A;  5EY4 A;  4BRE A;  1HPZ A;  2E2Q A;  5BPM A;  2BH1 A;  2O8C B;  4UQG A;  3LAL A;  2O8E A;  4DQI A;  1EWR A;  1GOC A;  3WXK A;  1M1K O;  3O3F A;  3M1F A;  1NGJ A;  3DXM B;  4KHY A;  4CK1 A;  1C1A A;  4O0J A;  1BIU A;  3L3V A;  3V1O A;  3DLG A;  4CD1 A;  3C94 A;  3HP6 A;  5C42 A;  3AAP A;  2QK9 A;  4DQP A;  2V7Z A;  1W9H A;  2ETJ A;  1X9M A;  4BC4 A;  3U9D A;  4YOT A;  3RMA A;  3DLR A;  3ID6 A;  3WUH A;  3K5O A;  3EY1 A;  1J9A A;  3HXM A;  1C6V A;  2HF4 A;  3SV4 A;  3AVH A;  1NGE A;  3OYJ A;  4Z4I A;  4EZ9 A;  4M3U A;  4IDH A;  4O4G A;  5JVH L;  4KI4 A;  4CD3 A;  4ISG A;  4M3W A;  5GAH P;  2PZS A;  3P5J A;  4JI1 K;  5CE3 A;  1O1W A;  1G99 A;  1LAW A;  1R0A A;  2GEM A;  2VQF K;  3MX5 A;  3K9J A;  4IFE A;  2W6L A;  4OGE A;  4JI3 K;  4JK7 A;  4BC3 A;  2KZZ A;  4IDK A;  5AQF A;  3TTC A;  3CCM N;  1Q7Y O;  4BE0 A;  4JNE A;  1Z26 A;  2DFF A;  1J54 A;  3LAM A;  2QI2 A;  3O1W A;  1FJG K;  3OYK A;  2ZJP L;  5AQM A;  1OVQ A;  5AQX A;  3SJH A;  4CEB A;  4ILH A;  4K8Z A;  4FWS A;  1XI1 A;  3VPZ A;  2YKN A;  1ZBU A;  4CHY A;  1QHA A;  2ZM6 K;  4FJL A;  4H4M A;  3TSU A;  4C23 A;  1S3X A;  3QET A;  2GEL A;  1VSH A;  3HSC A;  5KQD A;  3WQU A;  1HYV A;  2O8B A;  4LFA K;  2PYJ A;  2E2P A;  2R7Y A;  4RW7 A;  4CGF A;  4PWD A;  1RT4 A;  5EOY A;  1KCF A;  4H5W A;  3TR8 A;  1U48 A;  4BR2 A;  4NCA A;  3EN9 A;  3VA0 A;  2OZS A;  4LF6 K;  1GLJ O;  4CEZ A;  1S9G A;  2VWK A;  1NK0 A;  1D9F A;  3SQ4 A;  4ID5 A;  3AVM A;  1L3V A;  4B9M A;  5ADX A;  4CBW A;  3VF4 A;  3TPQ A;  1U49 A;  3VA3 A;  4BRC A;  2GX9 A;  3C7N A;  5JVG L;  4DR7 K;  3NF7 A;  3P1G A;  1KSP A;  4CED A;  4OLA A;  1GLA G;  1B9D A;  2PAV A;  1RT2 A;  2OA8 A;  3LDL A;  4BAC A;  1IBL K;  3CCL N;  3ZLJ A;  5ADX H;  1CLQ A;  3PLA A;  4CGG A;  3KVG A;  1RTD A;  1TK8 A;  3OTO K;  4Y1D A;  1RT5 A;  4BRN A;  3LWM A;  4CEF A;  3CCS N;  2Z1G A;  3PV8 A;  3LP0 A;  3A2F A;  3SUN A;  2HNZ A;  5GIN A;  3WXJ A;  4M41 A;  5JMV A;  4E7L A;  4M7Y A;  1BQN A;  4DTM A;  1HQE A;  3L2R A;  3IAY A;  4CEO A;  1T6D A;  4BY9 C;  3THW A;  5IWA K;  1KVB A;  3QIP A;  3VGM A;  1WN7 A;  4JKE A;  1VQM N;  4LH5 A;  4FJJ A;  4F2S A;  2NRV A;  2HBL A;  2GWJ A;  3EO3 A;  3AVC A;  3EE9 A;  3HPH A;  4DV0 K;  4IKF A;  2VG6 A;  1GOB A;  3WNF A;  2W41 A;  2PBD A;  3RMC A;  1VSF A;  2QW9 A;  3N4Q A;  4FXD A;  3G0Z A;  2Z1J A;  3VF6 A;  5J2M A;  1JCG A;  3HPO A;  3QIN A;  1IH7 A;  3DOK A;  3C95 A;  1X9W A;  4C8L A;  3M3Z A;  3V9S A;  2P9L A;  3UKU B;  5BPN A;  2Z1H A;  3EYZ A;  1T44 A;  3TAR A;  1Q9X A;  1NMD A;  1Q82 O;  1KVC A;  3KKS A;  1NMN A;  1EQY A;  3B6O A;  3TI0 A;  5GIO A;  1QQO A;  4IOA L;  1OVY A;  2QA4 N;  2E2N A;  3CQX A;  4GV9 A;  3B8A X;  4JHD B;  1VQO N;  4WQ5 C;  4B3M K;  4IOC L;  1ESV A;  4I2Q A;  4B9U A;  2JLE A;  2WUS A;  1NGI A;  3DAW A;  4FWN A;  1S6Q A;  3DXK B;  5GAE P;  5M1P A;  3JXU A;  2O8C A;  5M1O A;  3AVN A;  4JRQ A;  2RF2 A;  1NBW A;  1S1W A;  1Y64 A;  3DXM A;  2ITM A;  3FR0 A;  4DUZ K;  2I7P A;  3VQA A;  1RBU A;  1CXQ A;  3C6H A;  3K5M A;  2FF3 B;  4KB1 A;  3HBT A;  1K73 O;  4BRL A;  1OH5 A;  5DM6 L;  4OPK A;  1X9S A;  4NB4 A;  5BR8 K;  4LF5 K;  2Z1I A;  4NLB A;  4CJ4 A;  3VER A;  1MA9 B;  2KW4 A;  3EKS A;  3MEE A;  5BRF A;  1XNQ K;  4F4K A;  1Y97 A;  2D0C A;  3HJF A;  3CQY A;  4EZ6 A;  3OYB A;  1J53 A;  4MFB A;  4DR5 K;  3CC7 N;  3SUQ A;  1L3S A;  2FSN A;  1LW0 A;  4DFK A;  1BO5 O;  2OPS A;  3RRG A;  2CGK A;  2IGI A;  4A61 A;  3PX4 A;  2YNI A;  1DLO A;  4Z94 A;  3CMA N;  5DM7 L;  4CEE A;  4EIA A;  1RDA A;  2CH5 A;  1KAX A;  1IKV A;  4EP4 A;  3QNN A;  5BN8 A;  1RBR A;  3TAF A;  1TV6 A;  1TL1 A;  2G8U A;  2D0P A;  5AQR A;  2BAN A;  1YTU A;  3EZ5 A;  3DOL A;  3VMF B;  4FLU A;  3SV3 A;  4OKE A;  1W7A A;  5KGX A;  2H3G X;  4JKC A;  3QIO A;  1P8Z A;  2GUP A;  4GY2 B;  5I3U A;  2QXF A;  3NVM A;  1BU6 O;  1QE1 A;  3D2E B;  4WF9 L;  2HVH A;  1JKH A;  4YDU C;  5JIC A;  5AQJ A;  1SUQ A;  1CZB A;  3C6U A;  3D6R A;  3ZSZ A;  1SKR A;  3BF1 A;  4YOR A;  1T8E A;  1QSS A;  4ILJ A;  3AAR A;  4FPA A;  3L2W A;  1BIS A;  3NE6 A;  3SMS A;  1E3M A;  4FW1 A;  3FZH A;  4FPB A;  1NK5 A;  1IJJ A;  4C1N I;  3ZSW A;  3HI0 A;  1IV0 A;  3AO2 A;  3QEX A;  3HVR A;  1YAG A;  4DUY K;  1NGB A;  2RN2 A;  3HTV A;  1QHT A;  3TAG A;  4LC9 B;  1WUA A;  1BIZ A;  3T19 A;  3ULD A;  2QWP A; 
#chains in the Genus database with same CATH homology
 2UU9 K;  4AQY K;  4DUZ K;  5A2Q O;  3OTO K;  4B3R K;  4YHH K;  2HHH K;  4X65 K;  1HNW K;  4JI1 K;  4DR4 K;  4B3T K;  2VQF K;  1XMQ K;  4JI7 K;  4JI3 K;  2UUA K;  4LF9 K;  4CVN E;  5BR8 K;  4GKJ K;  3J81 O;  1IBM K;  2UXC K;  4LF5 K;  4X66 K;  2UUB K;  3T1Y K;  2UXD K;  5IWA K;  4JI0 K;  1XNQ K;  3J7A P;  4DV3 K;  3JAM O;  1FJG K;  3J7Y P;  1HNZ K;  4KHP K;  1N36 K;  4DV5 K;  4DR5 K;  4DV0 K;  4JI5 K;  4K0K K;  1N33 K;  5IT9 O;  4JV5 K;  1IBK K;  4B3S K;  4JYA K;  4LFC K;  2UXB K;  4GKK K;  2ZM6 K;  4DR1 K;  4JI6 K;  1N32 K;  4JI4 K;  4LF4 K;  5LL6 Z;  4LFA K;  1N34 K;  1HR0 K;  4LFB K;  5AJ3 K;  4OX9 K;  4DR3 K;  5LMN K;  4V19 S;  2E5L K;  5FLX O;  4CW7 B;  1HNX K;  4LF6 K;  4DR6 K;  4DV7 K;  4DV1 K;  4DV2 K;  3T1H K;  4X62 K;  1XMO K;  4LF8 K;  1J5E K;  4DR7 K;  1I94 K;  4LF7 K;  4NXN K;  4X64 K;  4DV6 K;  4B3M K;  2UUC K;  3J80 O;  4JI2 K;  2F4V K;  1XNR K;  2VQE K;  5LMU K;  4DUY K;  4YY3 K;  1IBL K;  4DR2 K;  4JI8 K;  4DV4 K;  4NXM K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...