4DR1K

Crystal structure of the apo 30s ribosomal subunit from thermus thermophilus (hb8)
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
116
structure length
116
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome
total genus 25
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4dr1K00
4JI5K 4GKJK 4X65K 4X64K 4JI8K 1J5EK 4AQYK 1XMQK 4DR3K 1HNWK 5LMUK 1XNQK 4KHPK 4NXMK 4DV2K 2UXCK 4DR6K 3OTOK 4LF9K 4JI3K 4DR5K 2HHHK 1N34K 4CVNE 4LF8K 4DV4K 2UUBK 1IBKK 4B3TK 1IBLK 4YY3K 4YHHK 4JV5K 2ZM6K 2UUCK 4JI7K 5A2QO 3T1YK 4DR1K 3T1HK 4DR4K 4B3SK 4DUZK 4LF6K 2UXBK 4DR2K 4LFAK 4DV0K 5IWAK 1IBMK 4JI6K 4DV6K 4K0KK 4LF4K 4V19S 3J81O 4LFBK 2E5LK 4JI0K 1XNRK 4X66K 3J80O 5BR8K 4B3RK 3JAMO 3J7YP 4DR7K 5LMNK 4DV1K 4JI4K 1I94K 4B3MK 4LFCK 4DV7K 4X62K 2UXDK 1N36K 1FJGK 1HNZK 4JI1K 2UUAK 5LL6Z 4LF7K 4NXNK 4CW7B 1N33K 4GKKK 2F4VK 4JI2K 5AJ3K 3J7AP 5IT9O 1N32K 4JYAK 4DV5K 1XMOK 2UU9K 1HR0K 4OX9K 2VQEK 4DUYK 4DV3K 5FLXO 2VQFK 1HNXK 4LF5K
chains in the Genus database with same CATH superfamily
4JI5K 4DWIA 1EX4A 5BPNA 3O9QA 1R59O 3SPZA 4H0XB 2Q31A 4N56A 3BP8A 1NGEA 1NOYA 2B5JA 2OZMA 2QWMA 2UXCK 1NGHA 3H08A 2P9KA 3NBPA 4GY2B 4ISFA 2P1JA 1N34K 4CVNE 2D5RA 3QDKA 1Q18A 1CXUA 1FXXA 3CD6N 5BPLA 4BRIA 1NGDA 3AAPA 3CJAA 4H03B 5FPEA 1YJWN 4O44A 2E1ZA 4EZ9A 4FWKA 2Z1HA 1SL0A 4PQUA 4FXDA 4FJHA 4LSLA 2NRZA 5IWAK 1DEJA 3QEXA 1Z26A 1HUXA 4ILJA 5HLFA 2VWBA 1WN7A 5DK5A 2BDPA 4KI6A 3S3NA 1W7AA 3JS6A 4CEBA 1LW0A 1VQNN 3OS2A 4CJ7A 1Q9YA 2O8BB 3H1QA 5BRHA 1HQEA 1RNHA 4CHPA 1NJWA 4M3UA 2IS3A 4E1NA 1BOTO 4R5PA 2OPSA 4A57A 3EEQA 3MXJA 4FLZA 5HP1A 3D0PA 4NO7A 3SMPA 3TARA 3NH2A 2ZD1A 3K9KA 4EAHD 3G4SN 1J53A 3MN6A 3EO3A 1NK0A 4OVLA 5AFUH 3VQEA 4FJJA 4G9ZA 4MDBA 4U67L 4BC3A 1XC9A 4ZTJA 1N33K 4BR7A 3P1GA 3JYTA 3LPTA 3V1RA 1SKRA 3CJBA 4MLHA 4CEQA 5C25A 3PO4A 4F8RA 1N32K 4JKCA 3SNNA 4CZJA 1IG9A 2Q1NA 3CIPA 4B1WB 4PL7A 3MMVA 1TYQA 1HMVA 4EFHA 3O3GA 4CEDA 2XY5A 3IKMA 3CQXA 2XRIA 1B92A 2IGIA 1HR0K 2W40A 4H8KA 1RILA 5KQDA 1JLGA 3LPUA 4W5TA 3LDLA 4FLTA 3NAEA 2ZJPL 1MWMA 4I2PA 3ZX3A 3M8SA 4X64K 3O9RA 1M90O 3THXA 4XH4A 3H3NO 2YV0X 3BZCA 5TKWA 3TAMA 2JWLA 3LALA 3DXMA 4CFDA 3PX6A 3VQAA 3OTOK 2QWRA 4O5FA 3THYA 5LY3A 1EKEA 1BCMA 4F2SA 4BR5A 1JLCA 4Z4HA 5FPNA 4DTJA 3SPYA 1WSGA 2WONA 2NRHA 4JV5K 2RF2A 4JI7K 3D7EO 3GG4A 3DJCA 1S6QA 3QIOA 3VEVA 3CXCM 1CZAN 4CJPA 3F5TA 4IEEA 1QSSA 1GOCA 3TAPA 2IDOA 5M1QA 2NLXA 1JCEA 1QE1A 4MFBA 2P9IA 3A5NC 1RGIA 3B8AX 3NF9A 5CZ1A 2YJEA 1GOAA 1OVQA 5M1FA 1D9FA 3BDPA 4CJQA 4DSLA 1UOCA 1RTIA 2GEMA 5AQMA 4KRFA 4KHSA 3DAWA 5F0XA 3LZIA 4ID5A 1NKEA 4NYFA 4CCHA 1RBVA 4DV7K 3ZETB 2X6SA 4J2EA 3AARA 4FZXC 4BGAA 3V9ZA 4CHNA 3ZT2A 1BQNA 4JN4A 4IWVA 2EWSA 3H46O 5C2DA 2IVNA 3PSFA 2Z1IA 1ASUA 3G0ZA 3O3HA 1VQLN 3N4QA 5CY4A 3OYHA 4ELTA 1HNIA 1XHZA 2O4IA 3RVCA 2IVOA 1YITN 4YNQA 4HCCA 4KHYA 4LF5K 4CGHA 4JI8K 2W41A 3L4IA 1BI4B 3CERA 1XMQK 5C15A 5C42A 4DQPA 3OJSA 2Z1JA 3MAQA 1HNVA 2HHQA 4NXMK 1P90A 3RTVA 3ITHA 3B6OA 4DSEA 4DR5K 2J4RA 3LDNA 4KV8A 3DRRA 4M3RA 4YY3K 2KFZA 3V9UA 2FF3B 3MDQA 1D8YA 3CM5A 5A2QO 3T1YK 2A40A 3AVCA 3T1HK 2Q36A 4DFMA 4WYBA 4FOEA 2CGJA 4CK3A 5JLFA 1ZXOA 4NCGA 1RT1A 1QQOA 1K8KB 4ZHRA 1EXQA 2HMIA 3O8MA 1WSFA 4BY9C 3UKUA 4WE1A 3VQBA 4DSKA 4LF4K 4Z0UA 4LFBK 4B9NA 3LP2A 2DFEA 3C95A 4CZIA 4ELVA 5AZJA 4R79A 4B3RK 5FDLA 1W97L 3WXMB 5SZTA 3A8YA 4FVMA 1JXBA 1LCUA 2QWNA 3EE8A 2P9UA 1LW2A 2HHTA 3WNFA 1KVAA 2UXDK 4OKJA 3O80A 1YHQN 4DCHA 4BRQA 4FWQA 1V4SA 4AM6A 3ZEUB 4DTXA 1JLFA 2YHWA 4DTNA 1X9WA 1KAYA 2ZGYA 4AHCA 1VQ4N 3L2VA 1NGJA 4PWDA 3ASMA 2KZZA 3HPGA 1ATNA 1HYSA 1RT3A 1HQUA 3C6UA 3DMJA 3O5BA 4L8RB 1BISA 4AHVA 3WXLA 2FLOA 2YHAA 1GLEG 1U2VA 1IKXA 1LAVA 1LWCA 2A1SA 4IG0A 4DF4A 1VSLA 3VTHA 3NGIA 4HUGA 2GUPA 4B1XB 4O4GA 3WNHA 4KO0A 1J5OA 4FJ8A 2KFNA 1CZBA 2P5GA 4IG3A 4B9UA 4CFAA 4GVEA 2NUBA 1NKBA 4CJ4A 1HYVA 4E7LA 2I5JA 5AQOA 1X3NA 4DV2K 3CPWM 3HM9A 3CJ7A 3RMCA 1S5JA 2G8WA 4IFVA 4BDPA 1NJYA 1XWLA 2ZM6K 4CZLA 1S6PA 2F9WA 4PKGA 4M63C 3NVKA 3SV4A 1T8EA 3UKRA 1VQ7N 5GADP 3IRXA 4RW9A 4CJSA 4ISEA 3V9SA 2O8FB 1W2BM 3AA3A 3I0SA 3PUFA 4BQZA 3WXIA 4O0JA 2YHBA 1MA9B 1Y64A 4FW1A 4K41A 4Y0WA 4WQ4C 3LWLA 3NHGA 2X6NA 4FWMA 3HOSA 5F2RA 3KZBA 1BIZA 2QEXN 1UA1A 2QA4N 2QKBA 1WSHA 2NRWA 3MEGA 5GAHP 4X66K 3CFRA 3U3YA 5C10A 5JVGL 1WB9A 4UY8O 1Y97A 5BR8K 1RFQA 3JAMO 3NH1A 1T44A 4N41A 4OJRA 3BY5A 2AJQA 3HRGA 4KTZA 3U3GA 1XUPO 2NRVA 2VYPA 1Z6RA 1JLEA 4ILHA 4OO1J 4FK0A 1EQYA 3HPOA 2W6LA 3E66A 1QZ5A 3ZSVA 4C23A 1TL1A 3OYMA 4I2QA 5KRSA 2HF4A 3D2FB 2NZTA 3SUNA 4LF7K 4CJRA 2I7PA 1SKWA 1IKWA 2PFUA 4JHDB 3DLEA 4PL8A 4FM0A 1BU6O 1VHXA 3K5MA 4DLEA 1LAWA 4CGJA 4CECA 4GV6A 2VQEK 3L2WA 3CCQN 1RDBA 4LD0A 1Q81O 4FVUA 3HZ6A 4FK4A 1ATRA 2YNFA 5DM7L 5GIPA 3V4IA 2P9NA 2XY7A 4X65K 4Z94A 3OBWA 4JKGA 2PZSA 3KK1A 4DFJA 3WUHA 4CHQA 3ULDA 3PIPL 3UE5A 5DM6L 4CGDA 4IOXA 4IO8A 3ZYYX 4DV4K 4KHWA 3HP9A 4B3TK 2IC3A 2Y1IA 3DOKA 3TR8A 3D2EB 1C0TA 2HVHA 5HRPA 2IVPA 3L3VA 5AQUA 2E6LA 3OHRA 4BR9A 3TAFA 1L5UA 4AHTA 3P4IA 1D4XA 3H1VX 4RW7A 2OYQA 3GDQA 1O13A 1LOTB 3AV9A 2BE2A 4FM2A 5AQRA 4RW6A 4WFBL 4ICLA 3HK2A 3CI5A 2YX6A 3T19A 3T1AA 3HL8A 4NLCA 4BRPA 4FWNA 3F2KA 4YOVA 3AVGA 3WNGA 4KKOA 3ZSZA 3LM2A 4E19A 2F96A 4RCHA 3QO9A 3WEEB 3MX2A 4IEIA 5AQQA 2ITMA 4E1MA 1BA0A 5CHIA 3ZLJA 3VEZA 1BGXT 1QQCA 4OGEA 4DTSA 1TKTA 3CQYA 3ZSXA 4A2AA 1TAQA 3CG7A 1EETA 5BR9A 2FXUA 2X78A 4OLBA 4XH5A 1WAFA 4IJAA 4N76A 4FYDA 5AQJA 3P83D 5KPTA 2UUAK 3RSEA 1NK8A 4F3OA 1WLJA 5EVZA 5HL7L 4A5BA 3PY8A 5JMVA 4E7KA 3ZSWA 4FW2A 3CPEA 1B9DA 5FRMA 5KGWA 1BUPA 1VSIA 3QESA 2YJFA 1C6VA 4FLXA 3U8XA 2O8DB 3AVFA 1U49A 4JAXA 3SQ4A 3K5LA 2CH5A 1Q9XA 3O3FA 3CETA 4QS9A 4M42A 3NE6A 2WUSA 3SAFA 4B9TA 5JICA 3KTQA 5FPMA 4CD1A 2PY5A 3M3ZA 2UUBK 3PLAA 4DFPA 3FR0A 3MN7A 1IV0A 2F7TA 1TK5A 3MEEA 1D9DA 3W0LA 3LANA 3ZCMA 1S1VA 4Z4IA 3U9DA 3DLHA 4KH4A 2VWJA 4LF6K 3HVTA 5F1XA 1RDWX 2UXBK 1NK4A 1BG3A 4BROA 5ELZA 1KFDA 5M1NA 1U47A 5E84A 3CF5L 4YORA 1P8ZA 3CHWA 4HHTA 4DV0K 4CZFA 4I6MA 4Z4CA 2P5OA 2BGGA 4DQSA 3FFIA 5I42A 1VQON 1VSEA 4FSVA 4DMNA 1OH8A 5J2MA 3OS0A 2Q0RA 5AQYA 1JLAA 5GINA 4BC5A 1WBDA 3AGKA 3BGRA 5K14A 4DR7K 4W5NA 4H4OA 4EHTA 3F73A 2HSTA 4BRCA 2XY8A 4BG8A 3O4WA 1EWRA 3H3OB 1VQMN 3IUCA 3OS1A 3RWUA 3P38A 2O8EB 4FOIA 3NVMA 3CMEN 1ESVA 4CEZA 4CW7B 1M1KO 1RDDA 1C0MA 2ZE2A 2QXFA 2PBDA 4JK8A 1H1VA 3VN5A 4BRGA 4M3TA 3P39A 5KTQA 2FSNA 3PO5A 2PAVA 3ZT4A 2AP1A 1U45A 5M1KA 3NDKA 5AQGA 4DV3K 4FM1A 1YVNA 5GIOA 1NOZA 1YF5L 3K0SA 2CH6A 2A41A 3VQ6A 1NJZA 4AQYK 4MO4A 1HNWK 4I7FA 4J2DA 4CF1A 4CJ3A 5AQSA 4BRMA 4CBWA 3VGKA 1S72N 2HHXA 4KHPK 5MLCQ 3O9UA 3FZHA 1NNEA 3ULEA 4FO0A 3VF6A 4GMJB 3ZSRA 4JK9A 3H6EA 5I9EB 1VQ8N 2RHKA 4RTFD 2HHUA 2OPRA 1RT4A 4F9OA 4DQ8A 1L3VA 4KHUA 3CFOA 1VSDA 3RRHA 3VESA 5D3GA 3KKSA 4B9VA 4CIFA 3AGRA 3DLKA 2OA8A 3Q7CA 3I8DA 4DTUA 4A5AA 1T7PA 4DU3A 4WQ5C 5DMRA 4C1NK 3OY9A 4A59A 1RTHA 1HJOA 2VGMA 4DSJA 3LWMA 3CFPA 3C94A 3OYAA 1BQMA 1CZ9A 2P9PB 5LMNK 3QETA 4KB0A 2BTFA 2R7YA 1SZ2A 4Y1DA 1A5VA 3DRSA 2A42A 4DQQA 2XY6A 3DXKA 4BDYA 3VA0A 1JLQA 3G25A 1NMNA 5AQLA 1HNZK 4BWMA 1HJRA 4DTOA 4M7YA 3I55N 3TI0A 2QKKA 4BG9A 1L3SA 4OLAA 1KCFA 4FZZA 4GKKK 3C6HA 1QSLA 4GNIA 4OKEA 1DTTA 4HVJA 4W5QA 4AHSA 3T69A 4KREA 5EXWA 1RCHA 1SKSA 2A6AA 1VSJA 4JKEA 3QNNA 2WC9A 3ID8A 3TSQA 4AILC 3VQ9A 2HNYA 5HOOA 5C24A 3TPQA 1J5EK 3OA9A 4RW8A 3K58A 3AO2A 5J2PA 2HNDA 2QWPA 3U4LA 3JSMA 3DYAA 5AQTA 3WNEA 1S1TA 3CC2N 2A5XA 4M3XA 4C8NA 3AVBA 1YJ9N 4Y1CA 5AZIA 3AVMA 4DR4K 1IG8A 2KLAA 4WQ4A 3Q7BA 1BHLA 1D5AA 3LDOA 3VPZA 4H0TB 3EN9A 2GTDA 4Q5VA 2NRTA 1N6QA 1QVGM 2O8CB 3IMXA 4DG1A 4LFAK 1JXEA 3PV8A 2HF3A 4BWJA 1VAZA 3THWB 5E26A 4GV3A 2D0PA 1JCGA 4CF0A 4IOCL 4KH5A 5FRNA 2HBMA 1XNRK 3VA3A 5ADXA 3C7NB 3KLEA 3E1YA 1VRUA 3THVA 4B9SA 4C8KA 4CEFA 5LJVA 1OH5A 1U4BA 3QFUA 1VQ5N 3CMAN 2QW9A 1ATSA 3AVIA 2LSNA 3O08A 4BVPA 4RG8A 1QVFM 3NGYA 3ENBA 2P9SB 2ZJRL 1C1AA 2YNIA 1VK0A 4CGFA 3KK3A 1N8RO 1KSPA 1ZBHA 1YTAA 3CCSN 4JI1K 4KI4A 4IBNA 1J6ZA 4H0PA 3MK6A 4CF2A 4J2AA 2O8BA 4BRAA 4JI2K 3MECA 3L0QA 4B1YB 3P5JA 3TAEA 1L3UA 3J7AP 4IO9L 1RT5A 4UQGA 3OYCA 3MN9A 4PKHA 3D6RA 1NK7A 4BDZA 4B1UB 2HHVA 4ELUA 2FBXA 3BZKA 1ZBUA 3SQ0A 4YOXA 4JEPA 4C8LA 4A62A 1XNQK 1Z05A 5HRSA 3LZJA 4JRPA 2RPIA 4DS4A 4CF9A 4LF9K 3J8AA 1HKGA 3OYNA 4BRNA 4BRDA 3V81A 4JD2B 5AQXA 4YHHK 1SUQA 3OYBA 3QIPA 2GBZA 1DGKN 1TUYA 3AVLA 5CYQA 2YKNA 3S3MA 3E01A 4K43A 5C2FA 3LAMA 5FPDA 2E2PA 5CE3A 5AQKA 3EKSA 1KAZA 3VTIA 2NRRA 1NLVA 3SUPA 4JNEA 2Q0UA 1NK9A 1ZBFA 4CFCA 3I8BA 4CHZA 1BO5O 4CJVA 2V7ZA 3B6PA 2V51B 2P9LB 1HPZA 3SI6A 1TUUA 2G8HA 3R9PA 1J9AA 5KQ8A 1VQKN 2ZF5O 5GAGP 3HT3A 3ZSYA 4YDUA 1O1WA 3DLBA 3KLFA 1RDAA 4CZEA 1K8AO 5CYMA 2G8VA 1NK5A 2WTUA 3UB5A 5KGXA 1S9EA 1YT3A 3CYMA 3HPHA 3ALYA 4I9LA 5AQFA 3VGLA 4CJKA 5H1SQ 3NGZA 1IJJA 1IKVA 5SWMA 3E9OA 1UWBA 2F4VK 2P9KB 1NGCA 5IT9O 1KD1O 1GLBG 1C0FA 1RTJA 3EYZA 3AVAA 1WBBA 2IAJA 3VETA 4OPAA 1GLCG 3VF2A 2VQFK 1Q86O 5J2NA 2HOEA 1QTMA 2OCEA 3ZETA 4RWTA 1WSJA 3AA5X 3TU5A 2ETJA 2UYTA 1K73O 1T6CA 3CJ9A 1C0UA 4IDHA 2F9TA 3AAQA 4DTMA 3KD1E 3TANA 2GX9A 4DR6K 1HKBA 1MDUB 2RKIA 3DLRA 2WBNA 4AF1A 1V4TA 4FJGA 3VGMA 2UUCK 3KIOA 1NGBA 3VQ4A 3AVJA 1T05A 2G8FA 3O9SA 4CD3A 3K2PA 3QEPA 1JL2A 1B9FA 3KLGA 4GVMA 2FBYA 1ZBSA 2E6MA 4FLVA 3NH0A 1BI4A 2E2QA 2HVIA 2CGLA 4BR2A 1X3MA 1T03A 4BE1A 4DB3A 4BGBA 1ZYQA 4JKAA 4IFEA 5AQHA 1N5YA 1W9HA 3SZ2A 3QEWA 5C0YA 5BPMA 3CCJN 2E5LK 4ID1A 4C8OA 3O9TA 3R3LA 4CJFA 4M45A 2VG6A 4BE2A 2X74A 3TAQA 1KQSM 1KTQA 5JS2A 4MLEA 4DTPA 4CGIA 1TYQB 4JS5A 2CGKA 3ATUA 4JI4K 1I94K 3K5OA 4JKDA 4E7HA 3K57A 1K8KA 2FF6A 1Q82O 2FSJA 1S3XA 3LDSA 1FJGK 5AQPA 4BR0A 2OANA 4FJKA 3K59A 3THXB 4CJ5A 4CIEA 4DFKA 1RT6A 4FJMA 1GLLO 1EO1A 4CJUA 3V9WA 1Q8IA 3L2QA 3OVNA 3DXMB 1WOQA 3THYB 4B1ZA 4A61A 4AM7A 3IDHA 5AQVA 3HJFA 4YOTA 3LDPA 1TKDA 3T3FA 3AY9A 5KPRA 3TABA 2DFHA 3CCRN 4DHYA 4OPKA 3AVKA 1YTUA 1QHAA 3ZEUA 4FJ7A 3AO5A 2FBTA 3FGUA 4CK1A 2W42A 2P9IB 4G1QA 2NNWA 2JWKA 3J7ZO 1FK9A 4CBXA 1G99A 2B6AA 4DSFA 3SUQA 2HBJA 4K8ZA 4PKIA 3LAKA 3GL1A 3R6MA 4QOZB 4AHRA 2F8SA 3GBTA 3KK7A 4KTQA 2G8UA 4DUZK 2E4LA 3NF6A 3SJHA 5HRNA 4JS4A 4HTUA 2YNHA 4WQ5A 1YJNN 3MWPA 2QK9A 1KRPA 5LJWA 4F2RA 3RMDA 2E20A 4O8UA 4CIGA 4XH1A 1JLBA 4EZ6A 5BN9A 1LV5A 2QM1A 4JI0K 3JXUA 1VQPN 4GW6A 3FFKB 4M3YA 3H45C 3HSTB 1JL1A 3HO1A 2HMPA 4PY5A 1NJXA 3AA2A 3MWTA 4LY7A 3HTVA 3RMAA 5JLHA 5J2QA 2RN2A 5KI6A 2O8FA 3K9JA 1XC3A 1NBWA 3KK2A 3KD5E 1A5WA 4CZGA 3WXJA 4TSXA 4M41A 4CHYA 1E4GT 4BVOA 4N5SA 3TWHA 1QZ6A 3AA4A 3QNOA 1GOBA 2D0CA 2DFFA 1ZC6A 5LL6Z 5AR0A 1UA0A 4PUOA 1T6DA 5M1PA 4KBOA 4DU4A 3U6FA 3W3DA 1WAJA 4FLWA 4OPJA 1C1BA 3M1FA 4KTWA 3SQ1A 4JKHA 4JYAK 2YNGA 1RBUA 4AH9A 4N47A 3EY1A 4OX9K 1YVUA 4H4MA 3BF3A 4DUYK 4FJXA 3A5LC 4OKKA 1HNXK 1HLUA 2HHWA 2ITGA 3SQ2A 5BRDA 1CLQA 1XHXA 1S9GA 4RW4A 2QI2A 4M3WA 3SAGA 4CJTA 3D2FA 3MXIA 2Y1JA 3DM2A 1BA1A 4CJEA 4MQ3A 3QLHA 1TVRA 2OPQA 3KWGA 4BC2A 4Z4EA 3QB0A 2ZWHA 3DI6A 4HCBA 1BDGA 4JKFA 4JHDA 5EU7A 2KKZA 5EY4A 3UKUB 3VQPA 4KHQA 3ZX2A 4IKFA 1YUWA 4BRFA 1IBLK 3VF4A 2B4JA 2HHSA 3NF8A 1IH7A 4BR4A 4B9LA 3UIQA 4H5TA 5J1EA 2BANA 5AZJB 1MWKA 1RT7A 4H0VB 1NGFA 3PX0A 2OTLN 3RR7A 1YIJN 3QBWA 4K25A 4CBUA 2V7YA 3I33A 1TKXA 2P9UB 1ASWA 1EWQA 4DR2K 3VEYA 1SAZA 3SBGA 4KPYA 4M3ZA 3L8BA 5T7BA 3E9PA 3R1XA 3OW2M 4WFAL 4V19S 3J81O 3SCXA 3VEXA 3D2EA 3L6QA 1XQSC 1TK0A 4CJWA 2V52B 3J80O 5I3UA 3LP3A 3VERA 1SL1A 1OKJA 4CGGA 1WNSA 4M7XA 1WSEA 3TTCA 4BC4A 4YFUA 2D0OA 2VCPA 1U2VB 2ZGZA 2ZJQL 1SL2A 4KHNA 4HTLA 1X9SA 4B3MK 4LFCK 1IKYA 4H5NA 5HRRA 1N36K 2NRXA 3G10A 2KZMA 3VENA 1U6ZA 4H0OA 4IZ9A 3GE1A 3HP6A 3FZFA 1BL3A 3ENHA 5AJ3K 1BIUA 4H5WA 3ZT3A 3CM6A 4NB4A 3WEEA 2ASOA 4NLBA 3NFAA 4HUFA 1MU2A 1W0HA 1XMOK 4FJ5A 2UU9K 4PA1A 3SMSA 3CCUN 1JJ2M 4QAGA 2IIRA 1KVBA 4QS7A 3UKRB 2OTJN 4IJNA 3QBXA 3IS9A 2GWJA 4FL9A 1C0GA 3FLCO 3L4QA 2JGUA 3HBTA 3V9XA 3AVNA 4CZMA 3CC7N 1CXQA 3BEXA 4DTRA 4O8KA 2HBLA 3I0RA 3NCIA 3K5NA 3IFRA 3EZ5A 1SS6A 1GLDG 4DLGA 2DPNA 2FC0A 1NK6A 1DLOA 3OYDA 4OPHA 3ENOA 3FE1A 3RR8A 1NKCA 3I56N 1ZBLA 1KLNA 4FLUA 3AO1A 4B9MA 3VQ7A 4H5VA 5JS1A 2OZSA 2E1YA 3PX4A 1NMDA 1X9MA 3LM9A 3C6AA 3DWLA 5EOYA 4CI6A 3HYFA 1REVA 4B3SK 3NMUA 3QERA 4FZYA 3F9MA 4GV9A 2O8DA 4Q0BA 3M5RA 3O4QA 1QHTA 4LC9B 4A2BA 2I7NA 2D4WA 4FWLA 5JVHL 5CZ2A 4YOWA 4JI6K 4CZKA 1NG9A 4E1JA 1YXQA 3SK3A 3VOVA 3O6WA 3KLIA 4EP5A 4FJLA 2HW3A 2GELA 3U9ZA 3OYEA 2YI1A 3TSUA 3J7YP 1KVCA 2FBVA 4L3QA 3HSCA 4QS8A 1RBSA 4QCLA 1I39A 3CC4N 4E0DA 2KTQA 1FKPA 4JKBA 3S41A 2P9NB 4BRKA 4W5OA 4FJNA 3AO4A 4EP4A 3KHYA 2YCHA 4JKGB 1LWEA 3KLHA 1OH7A 3M8PA 1JCFA 1KLMA 4DS5A 4JRQA 3O1BA 1YI2N 3NF7A 1S1WA 2KHOA 1HKCA 3O4NA 4HWIA 4DQRA 4DV5K 1OH6A 1RT2A 1X1PA 4NYNA 5BN8A 4FK2A 1DTQA 3A2FA 1NGAA 3M8QA 3PSIA 2Q3SA 4CEAA 1VQ9N 4H5RA 1F21A 4FPBA 3OBYA 4WCEL 4F3TA 3M8RA 4FWRA 3ISNC 2IOCA 5HROA 1KC8O 2O8EA 5E41A 1C1CA 2DY4A 3ZT0A 4C1NI 3OYLA 4B8CA 3V1QA 3CJ1A 2D0AA 3R8EA 3LP0A 1K9MO 4LF8K 4DQIA 1IBKK 1BCOA 3OYGA 3FZMA 4O0IA 3MN5A 2O4GA 4BQLA 4FJIA 3EL2A 3TSPA 1GLFO 1HPMA 4NCAA 2F8TA 3C0BA 2PYLA 1UAXA 5KPZA 3VQ5A 4B1VA 3AVHA 2G8IA 5B8HA 1KXPA 1VSHA 1GLAG 4FLYA 3CCLN 4K0KK 3SJJA 3OYFA 3SLCA 5TKYA 3RSEB 4E7IA 1QSYA 4DU1A 3SBTA 1G15A 1RDUA 2P51A 1NM1A 1DKGD 2ZQBA 1Q7YO 1VSFA 3ZT1A 1NJIO 3LP1A 2WOMA 2GWKA 5HBMA 4OGCA 4MDAA 1HX1A 1U48A 3KJVA 4KB1A 2FSKA 2GV9A 4CF8A 1LWFA 3EE9A 2D0BA 2EX3A 3ZX0A 4WFNL 4BACA 1QS4A 1Z25A 3LL3A 4NXNK 4B08A 2BUPA 3LDQA 2Q97A 2QTDA 1ITGA 1TAUA 1VQ6N 2HNZA 3IAYA 3MXMA 1E4FT 3OJUA 1T3VA 1TV6A 2P9PA 3T7ZA 4KAZA 3EZWA 2XHBA 3GOIA 4U7BA 4IOAL 3MEDA 2XO7A 4IXCA 4EHUA 4BREA 4J2BA 2QWOA 4E3SA 4GKJK 3HXMA 1WSIA 2BH1A 2ASPA 3HVRA 5LMUK 4I6MB 4BE0A 1A5XA 3MCAB 2E8AA 4CK2A 2E2OA 3FZLA 3V1OA 5ADXH 1FKOA 3TTFA 3VMFB 2G8KA 4NCBA 1K6YA 2HHHK 2KQ2A 3L2UA 4DSIA 4HUEA 5BRFA 1XI1A 3L2RA 3HI0A 1IO2A 4DR1K 3QINA 3WQTA 1L3TA 2A3ZA 1NGGA 2EHGA 3WQUA 2QXLA 5FROA 3S9HA 4FPAA 3ZSQA 5CR4A 5AQZA 2HBKA 5KRTA 4MO5A 3OYKA 3QMLA 1QQMA 1HRHA 4KH6A 1IBMK 4AHUA 3WXKA 4LSNA 2VG7A 4CESA 2KW4A 3VEOA 1E3MA 5M1OA 4YOYA 3AO3A 3KVGA 4CE9A 4JLHA 3CCEN 2DTUA 2HB5A 4CJLA 2GUIA 2PYJA 1OVYA 3O1WA 1S1UA 4E7JA 1U04A 3C65A 4ISGA 3BF1A 1KAXA 2YKMA 4B3OA 4Z4FA 1NU0A 2YHXA 4LH5A 4XIUA 2O8CA 4IFYA 3VQ8A 1BWFO 4B9QA 3WT0A 3G6EN 3S3OA 3FZKA 2VGNA 1ZBIA 3A0IX 3RMBA 3THWA 4K8XA 3RRGA 3QFPA 3CJCA 3SYZA 1GLJO 4YOUA 5EX5A 1RBTA 3C7NA 3ULEB 4CEOA 4DKWA 4ZTFA 1RTDA 4W5RA 2QWQA 3BUZB 2D1KA 1S1XA 3E9LA 2ASMA 5AQWA 2Z1GA 3CCVN 5FLXO 2P9SA 3ATVA 3A5MC 3VEWA 3ZSOA 3G71N 4DF8A 3HM8A 1R0AA 1ILYA 1TGOA 3VQDA 3QICA 5GAEP 4J8FA 4DR3K 4KFBA 1J54A 4O55A 2AA4A 4FCYA 3DLGA 2OPPA 1DT9A 3QEVA 4FJ9A 3KWIA 3TAGA 2JLEA 1YAGA 4JI3K 1RDCA 2YHYA 1S22A 2W6KA 3IG1A 1HYZA 3C6TA 1TK8A 3DOLA 4ILGB 1NGIA 1SQKA 1WUAA 4FWOA 2A1RA 3CCMN 5AQIA 1ASVA 3CQ8A 4BRHA 1I3AA 1VSKA 3DLLL 3TTDA 1SV5A 4O5BA 1RBRA 3M6GA 4JK7A 5C12A 3L3UA 3DXKB 4CFBA 3F9KA 5AQNA 2VWKA 5AFUA 1JKHA 4K42A 4DV6K 4CEEA 4C8MA 3P31A 4YDUC 1NWKA 2E2NA 4JD2A 1TKZA 3PIOL 2E88A 2H3GX 3D45A 4FWSA 4B8AB 1QQNA 4IDKA 3SV3A 3MX5A 4DV1K 1VSMA 2ATQA 3ID6A 1KFSA 1TL3A 4EIAA 3MCPA 4LH4A 4CHOA 2Q2RA 4CZHA 4X62K 4H0YB 1VRTA 4BRLA 3KKRA 4I9QA 2P9LA 2RE2A 1EP4A 4FWPA 3SAHA 4CERA 2VG5A 3EKUA 2QWLA 3V6DA 1X9JA 4Z4GA 3HOTA 3SUOA 3OYIA 2WFBA 4E89A 3QEIA 1FW6A 3N4PA 3A5OC 3OYJA 3VQCA 5AZIB 5BREA 4WF9L 4XEIA 4PHTX 3VQQA 3DRPA 4F4KA
chains in the Genus database with same CATH topology
4JI5K 4GKJK 4X65K 4X64K 4JI8K 1J5EK 4AQYK 1XMQK 4DR3K 1HNWK 5LMUK 1XNQK 4KHPK 4NXMK 4DV2K 2UXCK 4DR6K 3OTOK 4LF9K 4JI3K 4DR5K 2HHHK 1N34K 4CVNE 4LF8K 4DV4K 2UUBK 1IBKK 4B3TK 1IBLK 4YY3K 4YHHK 4JV5K 2ZM6K 2UUCK 4JI7K 5A2QO 3T1YK 4DR1K 3T1HK 4DR4K 4B3SK 4DUZK 4LF6K 2UXBK 4DR2K 4LFAK 4DV0K 5IWAK 1IBMK 4JI6K 4DV6K 4K0KK 4LF4K 4V19S 3J81O 4LFBK 2E5LK 4JI0K 1XNRK 4X66K 3J80O 5BR8K 4B3RK 3JAMO 3J7YP 4DR7K 5LMNK 4DV1K 4JI4K 1I94K 4B3MK 4LFCK 4DV7K 4X62K 2UXDK 1N36K 1FJGK 1HNZK 4JI1K 2UUAK 5LL6Z 4LF7K 4NXNK 4CW7B 1N33K 4GKKK 2F4VK 4JI2K 5AJ3K 3J7AP 5IT9O 1N32K 4JYAK 4DV5K 1XMOK 2UU9K 1HR0K 4OX9K 2VQEK 4DUYK 4DV3K 5FLXO 2VQFK 1HNXK 4LF5K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI5 K;  4GKJ K;  4X65 K;  4X64 K;  4JI8 K;  1J5E K;  4AQY K;  1XMQ K;  4DR3 K;  1HNW K;  5LMU K;  1XNQ K;  4KHP K;  4NXM K;  4DV2 K;  2UXC K;  4DR6 K;  3OTO K;  4LF9 K;  4JI3 K;  4DR5 K;  2HHH K;  1N34 K;  4CVN E;  4LF8 K;  4DV4 K;  2UUB K;  1IBK K;  4B3T K;  1IBL K;  4YY3 K;  4YHH K;  4JV5 K;  2ZM6 K;  2UUC K;  4JI7 K;  5A2Q O;  3T1Y K;  4DR1 K;  3T1H K;  4DR4 K;  4B3S K;  4DUZ K;  4LF6 K;  2UXB K;  4DR2 K;  4LFA K;  4DV0 K;  5IWA K;  1IBM K;  4JI6 K;  4DV6 K;  4K0K K;  4LF4 K;  4V19 S;  3J81 O;  4LFB K;  2E5L K;  4JI0 K;  1XNR K;  4X66 K;  3J80 O;  5BR8 K;  4B3R K;  3JAM O;  3J7Y P;  4DR7 K;  5LMN K;  4DV1 K;  4JI4 K;  1I94 K;  4B3M K;  4LFC K;  4DV7 K;  4X62 K;  2UXD K;  1N36 K;  1FJG K;  1HNZ K;  4JI1 K;  2UUA K;  5LL6 Z;  4LF7 K;  4NXN K;  4CW7 B;  1N33 K;  4GKK K;  2F4V K;  4JI2 K;  5AJ3 K;  3J7A P;  5IT9 O;  1N32 K;  4JYA K;  4DV5 K;  1XMO K;  2UU9 K;  1HR0 K;  4OX9 K;  2VQE K;  4DUY K;  4DV3 K;  5FLX O;  2VQF K;  1HNX K;  4LF5 K; 
#chains in the Genus database with same CATH topology
 4JI5 K;  4DWI A;  1EX4 A;  5BPN A;  3O9Q A;  1R59 O;  3SPZ A;  4H0X B;  2Q31 A;  4N56 A;  3BP8 A;  1NGE A;  1NOY A;  2B5J A;  2OZM A;  2QWM A;  2UXC K;  1NGH A;  3H08 A;  2P9K A;  3NBP A;  4GY2 B;  4ISF A;  2P1J A;  1N34 K;  4CVN E;  2D5R A;  3QDK A;  1Q18 A;  1CXU A;  1FXX A;  3CD6 N;  5BPL A;  4BRI A;  1NGD A;  3AAP A;  3CJA A;  4H03 B;  5FPE A;  1YJW N;  4O44 A;  2E1Z A;  4EZ9 A;  4FWK A;  2Z1H A;  1SL0 A;  4PQU A;  4FXD A;  4FJH A;  4LSL A;  2NRZ A;  5IWA K;  1DEJ A;  3QEX A;  1Z26 A;  1HUX A;  4ILJ A;  5HLF A;  2VWB A;  1WN7 A;  5DK5 A;  2BDP A;  4KI6 A;  3S3N A;  1W7A A;  3JS6 A;  4CEB A;  1LW0 A;  1VQN N;  3OS2 A;  4CJ7 A;  1Q9Y A;  2O8B B;  3H1Q A;  5BRH A;  1HQE A;  1RNH A;  4CHP A;  1NJW A;  4M3U A;  2IS3 A;  4E1N A;  1BOT O;  4R5P A;  2OPS A;  4A57 A;  3EEQ A;  3MXJ A;  4FLZ A;  5HP1 A;  3D0P A;  4NO7 A;  3SMP A;  3TAR A;  3NH2 A;  2ZD1 A;  3K9K A;  4EAH D;  3G4S N;  1J53 A;  3MN6 A;  3EO3 A;  1NK0 A;  4OVL A;  5AFU H;  3VQE A;  4FJJ A;  4G9Z A;  4MDB A;  4U67 L;  4BC3 A;  1XC9 A;  4ZTJ A;  1N33 K;  4BR7 A;  3P1G A;  3JYT A;  3LPT A;  3V1R A;  1SKR A;  3CJB A;  4MLH A;  4CEQ A;  5C25 A;  3PO4 A;  4F8R A;  1N32 K;  4JKC A;  3SNN A;  4CZJ A;  1IG9 A;  2Q1N A;  3CIP A;  4B1W B;  4PL7 A;  3MMV A;  1TYQ A;  1HMV A;  4EFH A;  3O3G A;  4CED A;  2XY5 A;  3IKM A;  3CQX A;  2XRI A;  1B92 A;  2IGI A;  1HR0 K;  2W40 A;  4H8K A;  1RIL A;  5KQD A;  1JLG A;  3LPU A;  4W5T A;  3LDL A;  4FLT A;  3NAE A;  2ZJP L;  1MWM A;  4I2P A;  3ZX3 A;  3M8S A;  4X64 K;  3O9R A;  1M90 O;  3THX A;  4XH4 A;  3H3N O;  2YV0 X;  3BZC A;  5TKW A;  3TAM A;  2JWL A;  3LAL A;  3DXM A;  4CFD A;  3PX6 A;  3VQA A;  3OTO K;  2QWR A;  4O5F A;  3THY A;  5LY3 A;  1EKE A;  1BCM A;  4F2S A;  4BR5 A;  1JLC A;  4Z4H A;  5FPN A;  4DTJ A;  3SPY A;  1WSG A;  2WON A;  2NRH A;  4JV5 K;  2RF2 A;  4JI7 K;  3D7E O;  3GG4 A;  3DJC A;  1S6Q A;  3QIO A;  3VEV A;  3CXC M;  1CZA N;  4CJP A;  3F5T A;  4IEE A;  1QSS A;  1GOC A;  3TAP A;  2IDO A;  5M1Q A;  2NLX A;  1JCE A;  1QE1 A;  4MFB A;  2P9I A;  3A5N C;  1RGI A;  3B8A X;  3NF9 A;  5CZ1 A;  2YJE A;  1GOA A;  1OVQ A;  5M1F A;  1D9F A;  3BDP A;  4CJQ A;  4DSL A;  1UOC A;  1RTI A;  2GEM A;  5AQM A;  4KRF A;  4KHS A;  3DAW A;  5F0X A;  3LZI A;  4ID5 A;  1NKE A;  4NYF A;  4CCH A;  1RBV A;  4DV7 K;  3ZET B;  2X6S A;  4J2E A;  3AAR A;  4FZX C;  4BGA A;  3V9Z A;  4CHN A;  3ZT2 A;  1BQN A;  4JN4 A;  4IWV A;  2EWS A;  3H46 O;  5C2D A;  2IVN A;  3PSF A;  2Z1I A;  1ASU A;  3G0Z A;  3O3H A;  1VQL N;  3N4Q A;  5CY4 A;  3OYH A;  4ELT A;  1HNI A;  1XHZ A;  2O4I A;  3RVC A;  2IVO A;  1YIT N;  4YNQ A;  4HCC A;  4KHY A;  4LF5 K;  4CGH A;  4JI8 K;  2W41 A;  3L4I A;  1BI4 B;  3CER A;  1XMQ K;  5C15 A;  5C42 A;  4DQP A;  3OJS A;  2Z1J A;  3MAQ A;  1HNV A;  2HHQ A;  4NXM K;  1P90 A;  3RTV A;  3ITH A;  3B6O A;  4DSE A;  4DR5 K;  2J4R A;  3LDN A;  4KV8 A;  3DRR A;  4M3R A;  4YY3 K;  2KFZ A;  3V9U A;  2FF3 B;  3MDQ A;  1D8Y A;  3CM5 A;  5A2Q O;  3T1Y K;  2A40 A;  3AVC A;  3T1H K;  2Q36 A;  4DFM A;  4WYB A;  4FOE A;  2CGJ A;  4CK3 A;  5JLF A;  1ZXO A;  4NCG A;  1RT1 A;  1QQO A;  1K8K B;  4ZHR A;  1EXQ A;  2HMI A;  3O8M A;  1WSF A;  4BY9 C;  3UKU A;  4WE1 A;  3VQB A;  4DSK A;  4LF4 K;  4Z0U A;  4LFB K;  4B9N A;  3LP2 A;  2DFE A;  3C95 A;  4CZI A;  4ELV A;  5AZJ A;  4R79 A;  4B3R K;  5FDL A;  1W97 L;  3WXM B;  5SZT A;  3A8Y A;  4FVM A;  1JXB A;  1LCU A;  2QWN A;  3EE8 A;  2P9U A;  1LW2 A;  2HHT A;  3WNF A;  1KVA A;  2UXD K;  4OKJ A;  3O80 A;  1YHQ N;  4DCH A;  4BRQ A;  4FWQ A;  1V4S A;  4AM6 A;  3ZEU B;  4DTX A;  1JLF A;  2YHW A;  4DTN A;  1X9W A;  1KAY A;  2ZGY A;  4AHC A;  1VQ4 N;  3L2V A;  1NGJ A;  4PWD A;  3ASM A;  2KZZ A;  3HPG A;  1ATN A;  1HYS A;  1RT3 A;  1HQU A;  3C6U A;  3DMJ A;  3O5B A;  4L8R B;  1BIS A;  4AHV A;  3WXL A;  2FLO A;  2YHA A;  1GLE G;  1U2V A;  1IKX A;  1LAV A;  1LWC A;  2A1S A;  4IG0 A;  4DF4 A;  1VSL A;  3VTH A;  3NGI A;  4HUG A;  2GUP A;  4B1X B;  4O4G A;  3WNH A;  4KO0 A;  1J5O A;  4FJ8 A;  2KFN A;  1CZB A;  2P5G A;  4IG3 A;  4B9U A;  4CFA A;  4GVE A;  2NUB A;  1NKB A;  4CJ4 A;  1HYV A;  4E7L A;  2I5J A;  5AQO A;  1X3N A;  4DV2 K;  3CPW M;  3HM9 A;  3CJ7 A;  3RMC A;  1S5J A;  2G8W A;  4IFV A;  4BDP A;  1NJY A;  1XWL A;  2ZM6 K;  4CZL A;  1S6P A;  2F9W A;  4PKG A;  4M63 C;  3NVK A;  3SV4 A;  1T8E A;  3UKR A;  1VQ7 N;  5GAD P;  3IRX A;  4RW9 A;  4CJS A;  4ISE A;  3V9S A;  2O8F B;  1W2B M;  3AA3 A;  3I0S A;  3PUF A;  4BQZ A;  3WXI A;  4O0J A;  2YHB A;  1MA9 B;  1Y64 A;  4FW1 A;  4K41 A;  4Y0W A;  4WQ4 C;  3LWL A;  3NHG A;  2X6N A;  4FWM A;  3HOS A;  5F2R A;  3KZB A;  1BIZ A;  2QEX N;  1UA1 A;  2QA4 N;  2QKB A;  1WSH A;  2NRW A;  3MEG A;  5GAH P;  4X66 K;  3CFR A;  3U3Y A;  5C10 A;  5JVG L;  1WB9 A;  4UY8 O;  1Y97 A;  5BR8 K;  1RFQ A;  3JAM O;  3NH1 A;  1T44 A;  4N41 A;  4OJR A;  3BY5 A;  2AJQ A;  3HRG A;  4KTZ A;  3U3G A;  1XUP O;  2NRV A;  2VYP A;  1Z6R A;  1JLE A;  4ILH A;  4OO1 J;  4FK0 A;  1EQY A;  3HPO A;  2W6L A;  3E66 A;  1QZ5 A;  3ZSV A;  4C23 A;  1TL1 A;  3OYM A;  4I2Q A;  5KRS A;  2HF4 A;  3D2F B;  2NZT A;  3SUN A;  4LF7 K;  4CJR A;  2I7P A;  1SKW A;  1IKW A;  2PFU A;  4JHD B;  3DLE A;  4PL8 A;  4FM0 A;  1BU6 O;  1VHX A;  3K5M A;  4DLE A;  1LAW A;  4CGJ A;  4CEC A;  4GV6 A;  2VQE K;  3L2W A;  3CCQ N;  1RDB A;  4LD0 A;  1Q81 O;  4FVU A;  3HZ6 A;  4FK4 A;  1ATR A;  2YNF A;  5DM7 L;  5GIP A;  3V4I A;  2P9N A;  2XY7 A;  4X65 K;  4Z94 A;  3OBW A;  4JKG A;  2PZS A;  3KK1 A;  4DFJ A;  3WUH A;  4CHQ A;  3ULD A;  3PIP L;  3UE5 A;  5DM6 L;  4CGD A;  4IOX A;  4IO8 A;  3ZYY X;  4DV4 K;  4KHW A;  3HP9 A;  4B3T K;  2IC3 A;  2Y1I A;  3DOK A;  3TR8 A;  3D2E B;  1C0T A;  2HVH A;  5HRP A;  2IVP A;  3L3V A;  5AQU A;  2E6L A;  3OHR A;  4BR9 A;  3TAF A;  1L5U A;  4AHT A;  3P4I A;  1D4X A;  3H1V X;  4RW7 A;  2OYQ A;  3GDQ A;  1O13 A;  1LOT B;  3AV9 A;  2BE2 A;  4FM2 A;  5AQR A;  4RW6 A;  4WFB L;  4ICL A;  3HK2 A;  3CI5 A;  2YX6 A;  3T19 A;  3T1A A;  3HL8 A;  4NLC A;  4BRP A;  4FWN A;  3F2K A;  4YOV A;  3AVG A;  3WNG A;  4KKO A;  3ZSZ A;  3LM2 A;  4E19 A;  2F96 A;  4RCH A;  3QO9 A;  3WEE B;  3MX2 A;  4IEI A;  5AQQ A;  2ITM A;  4E1M A;  1BA0 A;  5CHI A;  3ZLJ A;  3VEZ A;  1BGX T;  1QQC A;  4OGE A;  4DTS A;  1TKT A;  3CQY A;  3ZSX A;  4A2A A;  1TAQ A;  3CG7 A;  1EET A;  5BR9 A;  2FXU A;  2X78 A;  4OLB A;  4XH5 A;  1WAF A;  4IJA A;  4N76 A;  4FYD A;  5AQJ A;  3P83 D;  5KPT A;  2UUA K;  3RSE A;  1NK8 A;  4F3O A;  1WLJ A;  5EVZ A;  5HL7 L;  4A5B A;  3PY8 A;  5JMV A;  4E7K A;  3ZSW A;  4FW2 A;  3CPE A;  1B9D A;  5FRM A;  5KGW A;  1BUP A;  1VSI A;  3QES A;  2YJF A;  1C6V A;  4FLX A;  3U8X A;  2O8D B;  3AVF A;  1U49 A;  4JAX A;  3SQ4 A;  3K5L A;  2CH5 A;  1Q9X A;  3O3F A;  3CET A;  4QS9 A;  4M42 A;  3NE6 A;  2WUS A;  3SAF A;  4B9T A;  5JIC A;  3KTQ A;  5FPM A;  4CD1 A;  2PY5 A;  3M3Z A;  2UUB K;  3PLA A;  4DFP A;  3FR0 A;  3MN7 A;  1IV0 A;  2F7T A;  1TK5 A;  3MEE A;  1D9D A;  3W0L A;  3LAN A;  3ZCM A;  1S1V A;  4Z4I A;  3U9D A;  3DLH A;  4KH4 A;  2VWJ A;  4LF6 K;  3HVT A;  5F1X A;  1RDW X;  2UXB K;  1NK4 A;  1BG3 A;  4BRO A;  5ELZ A;  1KFD A;  5M1N A;  1U47 A;  5E84 A;  3CF5 L;  4YOR A;  1P8Z A;  3CHW A;  4HHT A;  4DV0 K;  4CZF A;  4I6M A;  4Z4C A;  2P5O A;  2BGG A;  4DQS A;  3FFI A;  5I42 A;  1VQO N;  1VSE A;  4FSV A;  4DMN A;  1OH8 A;  5J2M A;  3OS0 A;  2Q0R A;  5AQY A;  1JLA A;  5GIN A;  4BC5 A;  1WBD A;  3AGK A;  3BGR A;  5K14 A;  4DR7 K;  4W5N A;  4H4O A;  4EHT A;  3F73 A;  2HST A;  4BRC A;  2XY8 A;  4BG8 A;  3O4W A;  1EWR A;  3H3O B;  1VQM N;  3IUC A;  3OS1 A;  3RWU A;  3P38 A;  2O8E B;  4FOI A;  3NVM A;  3CME N;  1ESV A;  4CEZ A;  4CW7 B;  1M1K O;  1RDD A;  1C0M A;  2ZE2 A;  2QXF A;  2PBD A;  4JK8 A;  1H1V A;  3VN5 A;  4BRG A;  4M3T A;  3P39 A;  5KTQ A;  2FSN A;  3PO5 A;  2PAV A;  3ZT4 A;  2AP1 A;  1U45 A;  5M1K A;  3NDK A;  5AQG A;  4DV3 K;  4FM1 A;  1YVN A;  5GIO A;  1NOZ A;  1YF5 L;  3K0S A;  2CH6 A;  2A41 A;  3VQ6 A;  1NJZ A;  4AQY K;  4MO4 A;  1HNW K;  4I7F A;  4J2D A;  4CF1 A;  4CJ3 A;  5AQS A;  4BRM A;  4CBW A;  3VGK A;  1S72 N;  2HHX A;  4KHP K;  5MLC Q;  3O9U A;  3FZH A;  1NNE A;  3ULE A;  4FO0 A;  3VF6 A;  4GMJ B;  3ZSR A;  4JK9 A;  3H6E A;  5I9E B;  1VQ8 N;  2RHK A;  4RTF D;  2HHU A;  2OPR A;  1RT4 A;  4F9O A;  4DQ8 A;  1L3V A;  4KHU A;  3CFO A;  1VSD A;  3RRH A;  3VES A;  5D3G A;  3KKS A;  4B9V A;  4CIF A;  3AGR A;  3DLK A;  2OA8 A;  3Q7C A;  3I8D A;  4DTU A;  4A5A A;  1T7P A;  4DU3 A;  4WQ5 C;  5DMR A;  4C1N K;  3OY9 A;  4A59 A;  1RTH A;  1HJO A;  2VGM A;  4DSJ A;  3LWM A;  3CFP A;  3C94 A;  3OYA A;  1BQM A;  1CZ9 A;  2P9P B;  5LMN K;  3QET A;  4KB0 A;  2BTF A;  2R7Y A;  1SZ2 A;  4Y1D A;  1A5V A;  3DRS A;  2A42 A;  4DQQ A;  2XY6 A;  3DXK A;  4BDY A;  3VA0 A;  1JLQ A;  3G25 A;  1NMN A;  5AQL A;  1HNZ K;  4BWM A;  1HJR A;  4DTO A;  4M7Y A;  3I55 N;  3TI0 A;  2QKK A;  4BG9 A;  1L3S A;  4OLA A;  1KCF A;  4FZZ A;  4GKK K;  3C6H A;  1QSL A;  4GNI A;  4OKE A;  1DTT A;  4HVJ A;  4W5Q A;  4AHS A;  3T69 A;  4KRE A;  5EXW A;  1RCH A;  1SKS A;  2A6A A;  1VSJ A;  4JKE A;  3QNN A;  2WC9 A;  3ID8 A;  3TSQ A;  4AIL C;  3VQ9 A;  2HNY A;  5HOO A;  5C24 A;  3TPQ A;  1J5E K;  3OA9 A;  4RW8 A;  3K58 A;  3AO2 A;  5J2P A;  2HND A;  2QWP A;  3U4L A;  3JSM A;  3DYA A;  5AQT A;  3WNE A;  1S1T A;  3CC2 N;  2A5X A;  4M3X A;  4C8N A;  3AVB A;  1YJ9 N;  4Y1C A;  5AZI A;  3AVM A;  4DR4 K;  1IG8 A;  2KLA A;  4WQ4 A;  3Q7B A;  1BHL A;  1D5A A;  3LDO A;  3VPZ A;  4H0T B;  3EN9 A;  2GTD A;  4Q5V A;  2NRT A;  1N6Q A;  1QVG M;  2O8C B;  3IMX A;  4DG1 A;  4LFA K;  1JXE A;  3PV8 A;  2HF3 A;  4BWJ A;  1VAZ A;  3THW B;  5E26 A;  4GV3 A;  2D0P A;  1JCG A;  4CF0 A;  4IOC L;  4KH5 A;  5FRN A;  2HBM A;  1XNR K;  3VA3 A;  5ADX A;  3C7N B;  3KLE A;  3E1Y A;  1VRU A;  3THV A;  4B9S A;  4C8K A;  4CEF A;  5LJV A;  1OH5 A;  1U4B A;  3QFU A;  1VQ5 N;  3CMA N;  2QW9 A;  1ATS A;  3AVI A;  2LSN A;  3O08 A;  4BVP A;  4RG8 A;  1QVF M;  3NGY A;  3ENB A;  2P9S B;  2ZJR L;  1C1A A;  2YNI A;  1VK0 A;  4CGF A;  3KK3 A;  1N8R O;  1KSP A;  1ZBH A;  1YTA A;  3CCS N;  4JI1 K;  4KI4 A;  4IBN A;  1J6Z A;  4H0P A;  3MK6 A;  4CF2 A;  4J2A A;  2O8B A;  4BRA A;  4JI2 K;  3MEC A;  3L0Q A;  4B1Y B;  3P5J A;  3TAE A;  1L3U A;  3J7A P;  4IO9 L;  1RT5 A;  4UQG A;  3OYC A;  3MN9 A;  4PKH A;  3D6R A;  1NK7 A;  4BDZ A;  4B1U B;  2HHV A;  4ELU A;  2FBX A;  3BZK A;  1ZBU A;  3SQ0 A;  4YOX A;  4JEP A;  4C8L A;  4A62 A;  1XNQ K;  1Z05 A;  5HRS A;  3LZJ A;  4JRP A;  2RPI A;  4DS4 A;  4CF9 A;  4LF9 K;  3J8A A;  1HKG A;  3OYN A;  4BRN A;  4BRD A;  3V81 A;  4JD2 B;  5AQX A;  4YHH K;  1SUQ A;  3OYB A;  3QIP A;  2GBZ A;  1DGK N;  1TUY A;  3AVL A;  5CYQ A;  2YKN A;  3S3M A;  3E01 A;  4K43 A;  5C2F A;  3LAM A;  5FPD A;  2E2P A;  5CE3 A;  5AQK A;  3EKS A;  1KAZ A;  3VTI A;  2NRR A;  1NLV A;  3SUP A;  4JNE A;  2Q0U A;  1NK9 A;  1ZBF A;  4CFC A;  3I8B A;  4CHZ A;  1BO5 O;  4CJV A;  2V7Z A;  3B6P A;  2V51 B;  2P9L B;  1HPZ A;  3SI6 A;  1TUU A;  2G8H A;  3R9P A;  1J9A A;  5KQ8 A;  1VQK N;  2ZF5 O;  5GAG P;  3HT3 A;  3ZSY A;  4YDU A;  1O1W A;  3DLB A;  3KLF A;  1RDA A;  4CZE A;  1K8A O;  5CYM A;  2G8V A;  1NK5 A;  2WTU A;  3UB5 A;  5KGX A;  1S9E A;  1YT3 A;  3CYM A;  3HPH A;  3ALY A;  4I9L A;  5AQF A;  3VGL A;  4CJK A;  5H1S Q;  3NGZ A;  1IJJ A;  1IKV A;  5SWM A;  3E9O A;  1UWB A;  2F4V K;  2P9K B;  1NGC A;  5IT9 O;  1KD1 O;  1GLB G;  1C0F A;  1RTJ A;  3EYZ A;  3AVA A;  1WBB A;  2IAJ A;  3VET A;  4OPA A;  1GLC G;  3VF2 A;  2VQF K;  1Q86 O;  5J2N A;  2HOE A;  1QTM A;  2OCE A;  3ZET A;  4RWT A;  1WSJ A;  3AA5 X;  3TU5 A;  2ETJ A;  2UYT A;  1K73 O;  1T6C A;  3CJ9 A;  1C0U A;  4IDH A;  2F9T A;  3AAQ A;  4DTM A;  3KD1 E;  3TAN A;  2GX9 A;  4DR6 K;  1HKB A;  1MDU B;  2RKI A;  3DLR A;  2WBN A;  4AF1 A;  1V4T A;  4FJG A;  3VGM A;  2UUC K;  3KIO A;  1NGB A;  3VQ4 A;  3AVJ A;  1T05 A;  2G8F A;  3O9S A;  4CD3 A;  3K2P A;  3QEP A;  1JL2 A;  1B9F A;  3KLG A;  4GVM A;  2FBY A;  1ZBS A;  2E6M A;  4FLV A;  3NH0 A;  1BI4 A;  2E2Q A;  2HVI A;  2CGL A;  4BR2 A;  1X3M A;  1T03 A;  4BE1 A;  4DB3 A;  4BGB A;  1ZYQ A;  4JKA A;  4IFE A;  5AQH A;  1N5Y A;  1W9H A;  3SZ2 A;  3QEW A;  5C0Y A;  5BPM A;  3CCJ N;  2E5L K;  4ID1 A;  4C8O A;  3O9T A;  3R3L A;  4CJF A;  4M45 A;  2VG6 A;  4BE2 A;  2X74 A;  3TAQ A;  1KQS M;  1KTQ A;  5JS2 A;  4MLE A;  4DTP A;  4CGI A;  1TYQ B;  4JS5 A;  2CGK A;  3ATU A;  4JI4 K;  1I94 K;  3K5O A;  4JKD A;  4E7H A;  3K57 A;  1K8K A;  2FF6 A;  1Q82 O;  2FSJ A;  1S3X A;  3LDS A;  1FJG K;  5AQP A;  4BR0 A;  2OAN A;  4FJK A;  3K59 A;  3THX B;  4CJ5 A;  4CIE A;  4DFK A;  1RT6 A;  4FJM A;  1GLL O;  1EO1 A;  4CJU A;  3V9W A;  1Q8I A;  3L2Q A;  3OVN A;  3DXM B;  1WOQ A;  3THY B;  4B1Z A;  4A61 A;  4AM7 A;  3IDH A;  5AQV A;  3HJF A;  4YOT A;  3LDP A;  1TKD A;  3T3F A;  3AY9 A;  5KPR A;  3TAB A;  2DFH A;  3CCR N;  4DHY A;  4OPK A;  3AVK A;  1YTU A;  1QHA A;  3ZEU A;  4FJ7 A;  3AO5 A;  2FBT A;  3FGU A;  4CK1 A;  2W42 A;  2P9I B;  4G1Q A;  2NNW A;  2JWK A;  3J7Z O;  1FK9 A;  4CBX A;  1G99 A;  2B6A A;  4DSF A;  3SUQ A;  2HBJ A;  4K8Z A;  4PKI A;  3LAK A;  3GL1 A;  3R6M A;  4QOZ B;  4AHR A;  2F8S A;  3GBT A;  3KK7 A;  4KTQ A;  2G8U A;  4DUZ K;  2E4L A;  3NF6 A;  3SJH A;  5HRN A;  4JS4 A;  4HTU A;  2YNH A;  4WQ5 A;  1YJN N;  3MWP A;  2QK9 A;  1KRP A;  5LJW A;  4F2R A;  3RMD A;  2E20 A;  4O8U A;  4CIG A;  4XH1 A;  1JLB A;  4EZ6 A;  5BN9 A;  1LV5 A;  2QM1 A;  4JI0 K;  3JXU A;  1VQP N;  4GW6 A;  3FFK B;  4M3Y A;  3H45 C;  3HST B;  1JL1 A;  3HO1 A;  2HMP A;  4PY5 A;  1NJX A;  3AA2 A;  3MWT A;  4LY7 A;  3HTV A;  3RMA A;  5JLH A;  5J2Q A;  2RN2 A;  5KI6 A;  2O8F A;  3K9J A;  1XC3 A;  1NBW A;  3KK2 A;  3KD5 E;  1A5W A;  4CZG A;  3WXJ A;  4TSX A;  4M41 A;  4CHY A;  1E4G T;  4BVO A;  4N5S A;  3TWH A;  1QZ6 A;  3AA4 A;  3QNO A;  1GOB A;  2D0C A;  2DFF A;  1ZC6 A;  5LL6 Z;  5AR0 A;  1UA0 A;  4PUO A;  1T6D A;  5M1P A;  4KBO A;  4DU4 A;  3U6F A;  3W3D A;  1WAJ A;  4FLW A;  4OPJ A;  1C1B A;  3M1F A;  4KTW A;  3SQ1 A;  4JKH A;  4JYA K;  2YNG A;  1RBU A;  4AH9 A;  4N47 A;  3EY1 A;  4OX9 K;  1YVU A;  4H4M A;  3BF3 A;  4DUY K;  4FJX A;  3A5L C;  4OKK A;  1HNX K;  1HLU A;  2HHW A;  2ITG A;  3SQ2 A;  5BRD A;  1CLQ A;  1XHX A;  1S9G A;  4RW4 A;  2QI2 A;  4M3W A;  3SAG A;  4CJT A;  3D2F A;  3MXI A;  2Y1J A;  3DM2 A;  1BA1 A;  4CJE A;  4MQ3 A;  3QLH A;  1TVR A;  2OPQ A;  3KWG A;  4BC2 A;  4Z4E A;  3QB0 A;  2ZWH A;  3DI6 A;  4HCB A;  1BDG A;  4JKF A;  4JHD A;  5EU7 A;  2KKZ A;  5EY4 A;  3UKU B;  3VQP A;  4KHQ A;  3ZX2 A;  4IKF A;  1YUW A;  4BRF A;  1IBL K;  3VF4 A;  2B4J A;  2HHS A;  3NF8 A;  1IH7 A;  4BR4 A;  4B9L A;  3UIQ A;  4H5T A;  5J1E A;  2BAN A;  5AZJ B;  1MWK A;  1RT7 A;  4H0V B;  1NGF A;  3PX0 A;  2OTL N;  3RR7 A;  1YIJ N;  3QBW A;  4K25 A;  4CBU A;  2V7Y A;  3I33 A;  1TKX A;  2P9U B;  1ASW A;  1EWQ A;  4DR2 K;  3VEY A;  1SAZ A;  3SBG A;  4KPY A;  4M3Z A;  3L8B A;  5T7B A;  3E9P A;  3R1X A;  3OW2 M;  4WFA L;  4V19 S;  3J81 O;  3SCX A;  3VEX A;  3D2E A;  3L6Q A;  1XQS C;  1TK0 A;  4CJW A;  2V52 B;  3J80 O;  5I3U A;  3LP3 A;  3VER A;  1SL1 A;  1OKJ A;  4CGG A;  1WNS A;  4M7X A;  1WSE A;  3TTC A;  4BC4 A;  4YFU A;  2D0O A;  2VCP A;  1U2V B;  2ZGZ A;  2ZJQ L;  1SL2 A;  4KHN A;  4HTL A;  1X9S A;  4B3M K;  4LFC K;  1IKY A;  4H5N A;  5HRR A;  1N36 K;  2NRX A;  3G10 A;  2KZM A;  3VEN A;  1U6Z A;  4H0O A;  4IZ9 A;  3GE1 A;  3HP6 A;  3FZF A;  1BL3 A;  3ENH A;  5AJ3 K;  1BIU A;  4H5W A;  3ZT3 A;  3CM6 A;  4NB4 A;  3WEE A;  2ASO A;  4NLB A;  3NFA A;  4HUF A;  1MU2 A;  1W0H A;  1XMO K;  4FJ5 A;  2UU9 K;  4PA1 A;  3SMS A;  3CCU N;  1JJ2 M;  4QAG A;  2IIR A;  1KVB A;  4QS7 A;  3UKR B;  2OTJ N;  4IJN A;  3QBX A;  3IS9 A;  2GWJ A;  4FL9 A;  1C0G A;  3FLC O;  3L4Q A;  2JGU A;  3HBT A;  3V9X A;  3AVN A;  4CZM A;  3CC7 N;  1CXQ A;  3BEX A;  4DTR A;  4O8K A;  2HBL A;  3I0R A;  3NCI A;  3K5N A;  3IFR A;  3EZ5 A;  1SS6 A;  1GLD G;  4DLG A;  2DPN A;  2FC0 A;  1NK6 A;  1DLO A;  3OYD A;  4OPH A;  3ENO A;  3FE1 A;  3RR8 A;  1NKC A;  3I56 N;  1ZBL A;  1KLN A;  4FLU A;  3AO1 A;  4B9M A;  3VQ7 A;  4H5V A;  5JS1 A;  2OZS A;  2E1Y A;  3PX4 A;  1NMD A;  1X9M A;  3LM9 A;  3C6A A;  3DWL A;  5EOY A;  4CI6 A;  3HYF A;  1REV A;  4B3S K;  3NMU A;  3QER A;  4FZY A;  3F9M A;  4GV9 A;  2O8D A;  4Q0B A;  3M5R A;  3O4Q A;  1QHT A;  4LC9 B;  4A2B A;  2I7N A;  2D4W A;  4FWL A;  5JVH L;  5CZ2 A;  4YOW A;  4JI6 K;  4CZK A;  1NG9 A;  4E1J A;  1YXQ A;  3SK3 A;  3VOV A;  3O6W A;  3KLI A;  4EP5 A;  4FJL A;  2HW3 A;  2GEL A;  3U9Z A;  3OYE A;  2YI1 A;  3TSU A;  3J7Y P;  1KVC A;  2FBV A;  4L3Q A;  3HSC A;  4QS8 A;  1RBS A;  4QCL A;  1I39 A;  3CC4 N;  4E0D A;  2KTQ A;  1FKP A;  4JKB A;  3S41 A;  2P9N B;  4BRK A;  4W5O A;  4FJN A;  3AO4 A;  4EP4 A;  3KHY A;  2YCH A;  4JKG B;  1LWE A;  3KLH A;  1OH7 A;  3M8P A;  1JCF A;  1KLM A;  4DS5 A;  4JRQ A;  3O1B A;  1YI2 N;  3NF7 A;  1S1W A;  2KHO A;  1HKC A;  3O4N A;  4HWI A;  4DQR A;  4DV5 K;  1OH6 A;  1RT2 A;  1X1P A;  4NYN A;  5BN8 A;  4FK2 A;  1DTQ A;  3A2F A;  1NGA A;  3M8Q A;  3PSI A;  2Q3S A;  4CEA A;  1VQ9 N;  4H5R A;  1F21 A;  4FPB A;  3OBY A;  4WCE L;  4F3T A;  3M8R A;  4FWR A;  3ISN C;  2IOC A;  5HRO A;  1KC8 O;  2O8E A;  5E41 A;  1C1C A;  2DY4 A;  3ZT0 A;  4C1N I;  3OYL A;  4B8C A;  3V1Q A;  3CJ1 A;  2D0A A;  3R8E A;  3LP0 A;  1K9M O;  4LF8 K;  4DQI A;  1IBK K;  1BCO A;  3OYG A;  3FZM A;  4O0I A;  3MN5 A;  2O4G A;  4BQL A;  4FJI A;  3EL2 A;  3TSP A;  1GLF O;  1HPM A;  4NCA A;  2F8T A;  3C0B A;  2PYL A;  1UAX A;  5KPZ A;  3VQ5 A;  4B1V A;  3AVH A;  2G8I A;  5B8H A;  1KXP A;  1VSH A;  1GLA G;  4FLY A;  3CCL N;  4K0K K;  3SJJ A;  3OYF A;  3SLC A;  5TKY A;  3RSE B;  4E7I A;  1QSY A;  4DU1 A;  3SBT A;  1G15 A;  1RDU A;  2P51 A;  1NM1 A;  1DKG D;  2ZQB A;  1Q7Y O;  1VSF A;  3ZT1 A;  1NJI O;  3LP1 A;  2WOM A;  2GWK A;  5HBM A;  4OGC A;  4MDA A;  1HX1 A;  1U48 A;  3KJV A;  4KB1 A;  2FSK A;  2GV9 A;  4CF8 A;  1LWF A;  3EE9 A;  2D0B A;  2EX3 A;  3ZX0 A;  4WFN L;  4BAC A;  1QS4 A;  1Z25 A;  3LL3 A;  4NXN K;  4B08 A;  2BUP A;  3LDQ A;  2Q97 A;  2QTD A;  1ITG A;  1TAU A;  1VQ6 N;  2HNZ A;  3IAY A;  3MXM A;  1E4F T;  3OJU A;  1T3V A;  1TV6 A;  2P9P A;  3T7Z A;  4KAZ A;  3EZW A;  2XHB A;  3GOI A;  4U7B A;  4IOA L;  3MED A;  2XO7 A;  4IXC A;  4EHU A;  4BRE A;  4J2B A;  2QWO A;  4E3S A;  4GKJ K;  3HXM A;  1WSI A;  2BH1 A;  2ASP A;  3HVR A;  5LMU K;  4I6M B;  4BE0 A;  1A5X A;  3MCA B;  2E8A A;  4CK2 A;  2E2O A;  3FZL A;  3V1O A;  5ADX H;  1FKO A;  3TTF A;  3VMF B;  2G8K A;  4NCB A;  1K6Y A;  2HHH K;  2KQ2 A;  3L2U A;  4DSI A;  4HUE A;  5BRF A;  1XI1 A;  3L2R A;  3HI0 A;  1IO2 A;  4DR1 K;  3QIN A;  3WQT A;  1L3T A;  2A3Z A;  1NGG A;  2EHG A;  3WQU A;  2QXL A;  5FRO A;  3S9H A;  4FPA A;  3ZSQ A;  5CR4 A;  5AQZ A;  2HBK A;  5KRT A;  4MO5 A;  3OYK A;  3QML A;  1QQM A;  1HRH A;  4KH6 A;  1IBM K;  4AHU A;  3WXK A;  4LSN A;  2VG7 A;  4CES A;  2KW4 A;  3VEO A;  1E3M A;  5M1O A;  4YOY A;  3AO3 A;  3KVG A;  4CE9 A;  4JLH A;  3CCE N;  2DTU A;  2HB5 A;  4CJL A;  2GUI A;  2PYJ A;  1OVY A;  3O1W A;  1S1U A;  4E7J A;  1U04 A;  3C65 A;  4ISG A;  3BF1 A;  1KAX A;  2YKM A;  4B3O A;  4Z4F A;  1NU0 A;  2YHX A;  4LH5 A;  4XIU A;  2O8C A;  4IFY A;  3VQ8 A;  1BWF O;  4B9Q A;  3WT0 A;  3G6E N;  3S3O A;  3FZK A;  2VGN A;  1ZBI A;  3A0I X;  3RMB A;  3THW A;  4K8X A;  3RRG A;  3QFP A;  3CJC A;  3SYZ A;  1GLJ O;  4YOU A;  5EX5 A;  1RBT A;  3C7N A;  3ULE B;  4CEO A;  4DKW A;  4ZTF A;  1RTD A;  4W5R A;  2QWQ A;  3BUZ B;  2D1K A;  1S1X A;  3E9L A;  2ASM A;  5AQW A;  2Z1G A;  3CCV N;  5FLX O;  2P9S A;  3ATV A;  3A5M C;  3VEW A;  3ZSO A;  3G71 N;  4DF8 A;  3HM8 A;  1R0A A;  1ILY A;  1TGO A;  3VQD A;  3QIC A;  5GAE P;  4J8F A;  4DR3 K;  4KFB A;  1J54 A;  4O55 A;  2AA4 A;  4FCY A;  3DLG A;  2OPP A;  1DT9 A;  3QEV A;  4FJ9 A;  3KWI A;  3TAG A;  2JLE A;  1YAG A;  4JI3 K;  1RDC A;  2YHY A;  1S22 A;  2W6K A;  3IG1 A;  1HYZ A;  3C6T A;  1TK8 A;  3DOL A;  4ILG B;  1NGI A;  1SQK A;  1WUA A;  4FWO A;  2A1R A;  3CCM N;  5AQI A;  1ASV A;  3CQ8 A;  4BRH A;  1I3A A;  1VSK A;  3DLL L;  3TTD A;  1SV5 A;  4O5B A;  1RBR A;  3M6G A;  4JK7 A;  5C12 A;  3L3U A;  3DXK B;  4CFB A;  3F9K A;  5AQN A;  2VWK A;  5AFU A;  1JKH A;  4K42 A;  4DV6 K;  4CEE A;  4C8M A;  3P31 A;  4YDU C;  1NWK A;  2E2N A;  4JD2 A;  1TKZ A;  3PIO L;  2E88 A;  2H3G X;  3D45 A;  4FWS A;  4B8A B;  1QQN A;  4IDK A;  3SV3 A;  3MX5 A;  4DV1 K;  1VSM A;  2ATQ A;  3ID6 A;  1KFS A;  1TL3 A;  4EIA A;  3MCP A;  4LH4 A;  4CHO A;  2Q2R A;  4CZH A;  4X62 K;  4H0Y B;  1VRT A;  4BRL A;  3KKR A;  4I9Q A;  2P9L A;  2RE2 A;  1EP4 A;  4FWP A;  3SAH A;  4CER A;  2VG5 A;  3EKU A;  2QWL A;  3V6D A;  1X9J A;  4Z4G A;  3HOT A;  3SUO A;  3OYI A;  2WFB A;  4E89 A;  3QEI A;  1FW6 A;  3N4P A;  3A5O C;  3OYJ A;  3VQC A;  5AZI B;  5BRE A;  4WF9 L;  4XEI A;  4PHT X;  3VQQ A;  3DRP A;  4F4K A; 
#chains in the Genus database with same CATH homology
 4JI5 K;  4GKJ K;  4X65 K;  4X64 K;  4JI8 K;  1J5E K;  4AQY K;  1XMQ K;  4DR3 K;  1HNW K;  5LMU K;  1XNQ K;  4KHP K;  4NXM K;  4DV2 K;  2UXC K;  4DR6 K;  3OTO K;  4LF9 K;  4JI3 K;  4DR5 K;  2HHH K;  1N34 K;  4CVN E;  4LF8 K;  4DV4 K;  2UUB K;  1IBK K;  4B3T K;  1IBL K;  4YY3 K;  4YHH K;  4JV5 K;  2ZM6 K;  2UUC K;  4JI7 K;  5A2Q O;  3T1Y K;  4DR1 K;  3T1H K;  4DR4 K;  4B3S K;  4DUZ K;  4LF6 K;  2UXB K;  4DR2 K;  4LFA K;  4DV0 K;  5IWA K;  1IBM K;  4JI6 K;  4DV6 K;  4K0K K;  4LF4 K;  4V19 S;  3J81 O;  4LFB K;  2E5L K;  4JI0 K;  1XNR K;  4X66 K;  3J80 O;  5BR8 K;  4B3R K;  3JAM O;  3J7Y P;  4DR7 K;  5LMN K;  4DV1 K;  4JI4 K;  1I94 K;  4B3M K;  4LFC K;  4DV7 K;  4X62 K;  2UXD K;  1N36 K;  1FJG K;  1HNZ K;  4JI1 K;  2UUA K;  5LL6 Z;  4LF7 K;  4NXN K;  4CW7 B;  1N33 K;  4GKK K;  2F4V K;  4JI2 K;  5AJ3 K;  3J7A P;  5IT9 O;  1N32 K;  4JYA K;  4DV5 K;  1XMO K;  2UU9 K;  1HR0 K;  4OX9 K;  2VQE K;  4DUY K;  4DV3 K;  5FLX O;  2VQF K;  1HNX K;  4LF5 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...