4DR1K

Crystal structure of the apo 30s ribosomal subunit from thermus thermophilus (hb8)
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
116
structure length
116
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome
total genus 25
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4dr1K00
5AJ3K 4DV2K 1XMOK 1HNZK 4X64K 4CVNE 4JI7K 1N33K 4LF5K 4DR5K 4JYAK 4LFAK 4GKKK 4DV1K 2UXBK 2F4VK 4LF4K 4DUYK 4YHHK 4LFCK 4V19S 4JI8K 4JV5K 4B3SK 4JI0K 4LF9K 5BR8K 5IT9O 4DR3K 4CW7B 4JI3K 4DR6K 2VQFK 4DV0K 4DV3K 2UXCK 4DV7K 4X66K 2UUAK 5FLXO 4DR1K 4X62K 5LMNK 4DR2K 4OX9K 2UUBK 3T1HK 3J7AP 4DV5K 4DR7K 4JI1K 4KHPK 2UXDK 4JI6K 3OTOK 1IBMK 5LMUK 1XNRK 4YY3K 1IBLK 3JAMO 4B3MK 1FJGK 4GKJK 1XNQK 2VQEK 2E5LK 4JI5K 4K0KK 4B3TK 1XMQK 4LF8K 2UU9K 1HNWK 1N36K 4JI4K 4DV4K 4AQYK 2HHHK 3J7YP 4NXMK 3J81O 4JI2K 1IBKK 4LFBK 1N32K 3J80O 4DR4K 5IWAK 4DV6K 5LL6Z 1N34K 4DUZK 2ZM6K 4NXNK 2UUCK 3T1YK 1HNXK 1HR0K 4X65K 5A2QO 1J5EK 4LF6K 4B3RK 1I94K 4LF7K
chains in the Genus database with same CATH superfamily
4PUOA 1HKBA 4BREA 4AHVA 1JLQA 4LC9B 2YHBA 2G8WA 2HF3A 5DM7L 3CPEA 1IG9A 3CPWM 4K8ZA 1VQ9N 2PY5A 4FWMA 4FJNA 3RTVA 4BQZA 5E26A 4V19S 4OO1J 3ZETA 2ZE2A 3LAMA 4DKWA 2P1JA 4JKDA 2YNHA 3K2PA 3D0PA 1NJZA 4PL8A 4HTLA 4H4MA 4I2QA 4JK8A 3RSEA 4PKIA 4CZMA 3SMPA 1RBUA 5CYQA 5JVGL 4O5FA 4FJ7A 5AZJB 4RW8A 1A5WA 3RR7A 1D5AA 4YNQA 3NMUA 1WUAA 4FM0A 2RPIA 5C0YA 3K0SA 2Q2RA 1FKPA 1NK8A 1NJWA 5AQYA 3V9XA 3MECA 3SI6A 2NZTA 4K25A 4PA1A 4DB3A 3QEWA 3I8BA 2H3GX 4N56A 3HSCA 1KD1O 2HNYA 4LH5A 1S22A 2HHWA 3AO5A 4C8KA 1KXPA 3G71N 2CGJA 1GLDG 4CE9A 3OJSA 2F96A 1RBSA 5KGWA 4YOUA 3J7YP 2YHYA 5FPDA 3J81O 3TAPA 4IJAA 1SKSA 3K5LA 4H0TB 1HYVA 2O8BB 3SV4A 1FK9A 3ULDA 1C6VA 1HQEA 5LL6Z 4HCCA 1G15A 1EXQA 3SMSA 4CJKA 3NE6A 5C42A 3AVLA 1S1WA 2Z1IA 4QAGA 4CIEA 4JEPA 4F2RA 3WNGA 1VQ8N 3T1AA 3FFIA 2GWJA 4B9SA 4FZYA 4LF7K 3ID6A 4OJRA 4IFYA 4DV2K 4N41A 2WFBA 2ASPA 1BU6O 3GOIA 4FWKA 5HL7L 4R79A 4L8RB 1J5OA 3ZSXA 2WTUA 3FZHA 2OPSA 4NLBA 3VESA 4RCHA 3V1QA 4YOTA 1TK0A 5CZ2A 3F5TA 4YHHK 1CZ9A 3OYCA 3LZIA 3MAQA 1GLAG 3THVA 1NNEA 3OY9A 4NCGA 2QM1A 4NO7A 3ISNC 1S1XA 4W5QA 5AQMA 3VTHA 1NLVA 1Z05A 1TKTA 3AVGA 3LDLA 4KB1A 4GW6A 4DU1A 3UKUB 1EP4A 2IVNA 4IDHA 3AAQA 5JMVA 5BRDA 3DJCA 4CEDA 1S1VA 2GWKA 4JK9A 5AQVA 1ASWA 3U8XA 2GV9A 2Q97A 5SWMA 1QVFM 3S3OA 2E20A 5KQDA 4FWNA 1YI2N 4G9ZA 2IS3A 2P9IA 5M1FA 1Q82O 3R6MA 4B1ZA 2Q3SA 2XY7A 3LALA 5AZIA 4B9NA 3DOKA 4GV9A 4DU4A 4CGGA 4JS4A 1NGBA 5HRNA 2HNZA 1T6DA 4KKOA 3BF3A 4GKJK 1D9DA 3CERA 3K58A 1BOTO 3SQ4A 4B3TK 5KPTA 3AY9A 4JRPA 3TAMA 2DTUA 1NM1A 4CD1A 2G8IA 3AO1A 3U6FA 2I7NA 2F9WA 3LDQA 4CHYA 2X74A 4BDZA 4CEEA 5ELZA 4F2SA 3GE1A 4GNIA 1IH7A 4CJWA 4KPYA 1QZ5A 1WOQA 4LSNA 1TYQA 3L2QA 1BIUA 3GG4A 3CM6A 3IG1A 2VGMA 4XIUA 3VA0A 4RW7A 5HLFA 3AO4A 4H03B 4ELTA 3DXMA 2W6KA 3QO9A 4FYDA 1K6YA 1XQSC 1ZYQA 2X78A 1J54A 2E8AA 4B9TA 2V7YA 5BREA 3OYDA 4JI7K 2KFZA 4IO8A 4CJQA 1YTUA 4DSLA 4CERA 3EE9A 3NF8A 5M1OA 3I0RA 3LANA 3LL3A 4M3RA 4DF8A 3I0SA 4KTZA 1SKWA 2YHXA 3DYAA 5GAEP 1TK8A 4O55A 3SJJA 5GIPA 3DRSA 4DTMA 4O0IA 3QIOA 4CFBA 1Q8IA 4DR3K 3OS2A 3KK2A 2B4JA 3VGMA 2GUIA 1HX1A 3CQ8A 3WNHA 1YF5L 5E84A 4KHSA 4CESA 5GIOA 1JJ2M 1BQNA 3QBXA 4KTWA 5BRHA 5KRSA 2UUAK 3IDHA 1ZBIA 3CC2N 1GLBG 3ZSZA 5KPRA 5FPEA 1U4BA 2FBYA 4DSKA 1B92A 1RDCA 1MWKA 4TSXA 3ZLJA 5AQJA 3OTOK 1QQCA 4FK2A 3L2UA 3FGUA 3CJ1A 1LOTB 3W0LA 4CF8A 5AQQA 2O8FA 2O4GA 3JAMO 4IFEA 2OTLN 2OZSA 1NGDA 3WXLA 2ATQA 4JN4A 1E4FT 1V4TA 3CQXA 4KHUA 4MO5A 4EP5A 3THXA 2VG6A 4CF1A 1X3NA 5FRNA 4DSIA 3DLEA 1TK5A 3OYHA 3ZX3A 2ASOA 3T69A 3VN5A 2GTDA 1E3MA 3V1RA 4NXMK 2ZWHA 4JI2K 4A5BA 4EZ9A 3VMFB 4OKJA 5BPNA 2OYQA 3LWMA 2WUSA 4DQRA 1WSEA 1WN7A 3P1GA 2ZM6K 3KLHA 4IXCA 3W3DA 1Q9XA 1GLFO 2Y1JA 3CJ9A 3T1YK 1JXEA 2YNGA 4JKBA 3QINA 4X65K 1VQLN 4CHOA 2AA4A 2HBLA 1U2VB 5AJ3K 3MX2A 4OGEA 1YTAA 1XMOK 1BI4A 4CVNE 2IOCA 4FLZA 4FJ9A 3HTVA 4K42A 4MLHA 1C0MA 3CJBA 1JLGA 2UXBK 3H1VX 2O8DA 1NJXA 1SL2A 2I7PA 2OANA 3HJFA 3VQ9A 4WCEL 4CW7B 2JLEA 4JKFA 4WFNL 2IGIA 4CZJA 4HUFA 2G8VA 1U48A 2P9NB 4AM6A 5F1XA 3AVFA 4AHTA 4O44A 3SK3A 3SQ0A 4H5WA 4E7IA 1N6QA 1ZBSA 1NKBA 1N5YA 3L2WA 1QHAA 3O5BA 3QBWA 3CHWA 1P8ZA 5KRTA 1IBMK 4M3YA 4E3SA 3AVKA 3OYBA 3P39A 1KFDA 3O4NA 3KWGA 2NLXA 1VQNN 2VYPA 4NLCA 3M8SA 1YJNN 3OYGA 5EY4A 1BHLA 2FBTA 4CJLA 1U2VA 1TKDA 2UU9K 1GOAA 3C94A 3ITHA 3DLBA 3Q7CA 4DV4K 1K9MO 1CZAN 4DSJA 4HCBA 4BRIA 4CD3A 3MEDA 2WONA 4U7BA 2E1ZA 4CECA 3LDNA 4AHRA 4AHSA 2KZZA 3VTIA 2JGUA 2PYLA 4FJMA 3F73A 1KQSM 3JXUA 4C23A 1WSFA 4A2AA 2QWRA 3HOTA 2OPQA 3N4PA 4HUEA 1KCFA 1VSEA 1RTJA 4KREA 3PIOL 1HYSA 2XHBA 4FM1A 4ID5A 3O3GA 1V4SA 3QETA 1W9HA 1QE1A 1REVA 4HUGA 2BANA 2HVIA 1ZBFA 1VRTA 3QICA 5BN8A 1NGHA 1SV5A 4BE0A 3PX6A 3IRXA 4YOXA 1DGKN 3A0IX 4JKGA 4B08A 4MDBA 4RWTA 2O8EA 3SAGA 1NJIO 3B6OA 3H1QA 4A5AA 4FJIA 5FPMA 1YT3A 2ZJRL 3THWA 1LCUA 2YNFA 4DTSA 1KRPA 1MA9B 4JS5A 4FJJA 3LM9A 3KJVA 2QXLA 1BL3A 4FW2A 1U6ZA 1RT5A 4FLWA 4FK0A 4YOWA 3T1HK 1U04A 3VGLA 1Z26A 1GLEG 4B1XB 2VG5A 3AA3A 3NDKA 4E7HA 2FSKA 2E6LA 5HOOA 4YORA 1NOZA 4JD2B 3NF6A 2P9SB 2ITGA 4IEIA 3U9DA 3HT3A 4K0KK 5AQKA 2XRIA 3L4IA 3DOLA 2QWPA 1NK6A 2BH1A 2FF3B 3VEVA 4JKEA 4BRAA 4H5RA 3NGYA 3PV8A 3Q7BA 2HBJA 4KH4A 5ADXA 4N76A 3G0ZA 1ZC6A 3L6QA 4A62A 1ATSA 5KPZA 4KHYA 2NUBA 1CZBA 4DTXA 4KI6A 3RRGA 4B1YB 3VA3A 3AGRA 2Q36A 1VSHA 4BC2A 1C1AA 3L3VA 3SQ1A 3AVIA 3M8QA 4I9QA 2HB5A 3CG7A 3AA5X 4ID1A 5JLFA 2IVPA 4FLTA 2A1SA 4OPAA 1YVUA 1U47A 5AQWA 4DS5A 4IO9L 3VF4A 1YIJN 3HRGA 1DTTA 1EX4A 1QQNA 4LFAK 5AQTA 3ZT0A 1EQYA 4BRMA 5KTQA 4M63C 3SPZA 4FLYA 2NRWA 3VQ6A 2X6SA 3VQEA 3FR0A 1LWEA 3AA4A 4IOCL 1C0UA 4AHUA 4DQ8A 2KHOA 2P9SA 5AQOA 3I55N 3EZ5A 2YNIA 4DTOA 2FLOA 1NK9A 3FZKA 4Z4FA 1BWFO 4FJ8A 5SZTA 3TABA 2V51B 3VF2A 1Z6RA 4JRQA 5GAHP 4ELVA 3H3NO 1K73O 1ZBLA 2UUBK 4CZEA 2W6LA 3VGKA 5M1QA 4XEIA 4EHTA 3K57A 2UXDK 4AHCA 4JI6K 4CIGA 1QQMA 3FFKB 2FBXA 5AR0A 1XNRK 1ASVA 3DRRA 4OPHA 2HHVA 2G8FA 4B1UB 3EO3A 1IV0A 1QTMA 3AARA 3NH2A 3CFPA 1J6ZA 4RW9A 3O9TA 2ZJPL 3TI0A 4YOVA 3OHRA 5F0XA 1RBRA 3DLHA 3ZSVA 1KVCA 5EXWA 1VSFA 3C6HA 4CF2A 2QK9A 1MU2A 4KH5A 4DG1A 1IBKK 2EWSA 3J80O 1X3MA 5J2QA 4BG8A 1QZ6A 1VQMN 4XH4A 4OPKA 5EVZA 3I33A 4RG8A 1KAZA 4KAZA 4ZTJA 1HNXK 4KTQA 4Z4GA 3AV9A 4H8KA 3QIPA 3CMAN 3CYMA 5BRFA 4DTJA 3PIPL 1UAXA 3VPZA 1NK0A 4C8LA 4X64K 4QS8A 4DSFA 1IKXA 3QEVA 2P9IB 4CFAA 2FXUA 5AZIB 4IEEA 3TSQA 2F4VK 4J2DA 3CJ7A 3OYLA 3K9JA 2DY4A 2OPRA 5F2RA 4OLAA 4LFCK 1WSIA 4F3TA 3AVJA 2GELA 2Q1NA 5B8HA 4JK7A 4B3SK 3V1OA 1NKCA 3DI6A 3J8AA 3GDQA 2QKKA 1D9FA 4RW4A 3V81A 5ADXH 3SZ2A 3HP9A 1I39A 2RHKA 1NGCA 1WAFA 3KWIA 4DFPA 1X9SA 3MDQA 1L3SA 2B5JA 1R0AA 4FJXA 4O4GA 3SNNA 1TYQB 1SL0A 4FWQA 5JVHL 4BRLA 2QWNA 4H5NA 4DTPA 2A41A 3MWTA 4EP4A 4JHDA 3CCSN 1Q9YA 3CFOA 3DXMB 2D4WA 3WEEB 2B6AA 4OKEA 1KVBA 1SQKA 3ZSWA 3U4LA 4M3TA 3SJHA 3V9ZA 3O4WA 1HKGA 4DLEA 1T6CA 1WAJA 4KH6A 4CHQA 4ISFA 1S1UA 1L3TA 3G10A 3A5LC 2A3ZA 1GLCG 2P9PB 4JI4K 4IDKA 4BACA 3O1BA 5C10A 2KLAA 1I3AA 3QNOA 2NNWA 1HJRA 3V9UA 4Z4EA 4IFVA 1ZXOA 1N34K 1OH8A 3VEWA 2OZMA 1SAZA 5BR9A 3CCLN 1TKZA 3O9QA 3QFUA 3AO3A 1VQON 4DQQA 3AVMA 3CETA 5AQXA 1C0TA 3CFRA 4FK4A 2W41A 1SZ2A 1TL3A 4LF6K 4E1MA 4HVJA 3O9UA 3O9RA 4CJ5A 3RVCA 1CXUA 5C2FA 3N4QA 1VSJA 4WFAL 4Q5VA 3OYEA 4B8CA 4CGDA 4BRQA 1R59O 1S3XA 1NGAA 2O8FB 4LF4K 3BDPA 5FDLA 4CHNA 4GVEA 3LWLA 4XH5A 3WEEA 1NGIA 3L0QA 4YDUC 2FC0A 3EL2A 3THXB 4B9LA 5IT9O 1S9EA 1RCHA 1WBBA 3S9HA 2ZD1A 4ELUA 4FLUA 4E0DA 3VQDA 4X66K 1ZBUA 2P9PA 4CJFA 3IMXA 3ZT3A 1UA1A 2Y1IA 3PUFA 5MLCQ 5HRRA 2YV0X 3MX5A 4M7YA 2QTDA 1TAQA 4FVUA 4CBUA 4BE1A 4FSVA 3ZEUB 3D2FA 4EZ6A 5EOYA 1W2BM 4DTUA 1OH6A 2YCHA 3F2KA 4B9UA 4KHQA 4R5PA 4H5VA 4M7XA 2F7TA 1VQ4N 4FJHA 3M6GA 4FL9A 1WBDA 3OBYA 5AQIA 1RT3A 4JKHA 1BI4B 4O8KA 4NYFA 4FPAA 1HJOA 3SLCA 4F8RA 3LP1A 3WXMB 3E66A 3R8EA 3VEZA 3VENA 2D0BA 2O8DB 3E9OA 1QSYA 1RDUA 4WQ4A 5I42A 3LM2A 1RFQA 5T7BA 2QA4N 5LJVA 4CBXA 3NH1A 4CZGA 2OTJN 3A8YA 4DCHA 2UYTA 2G8UA 2UUCK 3AVCA 1VQPN 5A2QO 4FJ5A 4BROA 3CXCM 1YAGA 1J5EK 2QWLA 3D6RA 1WSHA 1TV6A 3KK3A 1H1VA 2D1KA 3KK1A 2EX3A 3OJUA 4DU3A 4CGIA 4GV6A 1NU0A 1W97L 3QB0A 3O3FA 3QLHA 3ZSRA 2P9UB 4EIAA 4JAXA 3ZEUA 3K5NA 1VHXA 3VETA 1HMVA 3HBTA 2FSJA 4EAHD 4WQ5C 4JI8K 4C1NI 4FCYA 1JLFA 1KC8O 3I56N 2IC3A 5HRPA 2IAJA 4CEAA 1BG3A 1D8YA 3MEEA 3H3OB 3NF7A 3O1WA 4FJLA 3ZX0A 2VGNA 5M1KA 4CFDA 4CEOA 3LDOA 4DR1K 3MCAB 3VQ7A 2KKZA 1S9GA 4NB4A 3ZCMA 3SAFA 2DFFA 3H45C 5HBMA 3PLAA 1JCGA 3AAPA 5AQLA 1T7PA 3CCUN 4FVMA 3UB5A 3L8BA 1EKEA 2VWJA 3L2VA 4PY5A 5I3UA 3C95A 4C8OA 1LW0A 1IBLK 3DAWA 4CK3A 3QERA 3HP6A 3BY5A 1VK0A 4PQUA 5LY3A 1C0FA 1JCFA 5CZ1A 3L2RA 4JI5K 3FZMA 3C6TA 4B9VA 1S5JA 4WQ4C 3T7ZA 3EKUA 4Z4IA 2PFUA 2QWQA 1LAWA 1MDUB 4ISGA 4CCHA 1YITN 1XI1A 1ASUA 2P9UA 5EU7A 3HVRA 3QEPA 1TAUA 2IIRA 2WC9A 4CJRA 3OBWA 5TKWA 4JKGB 2O8EB 1RGIA 3IFRA 4M3UA 1NGGA 1WLJA 5J2NA 3THWB 3FZFA 3LP0A 1OH7A 4C8NA 3E01A 4DLGA 4CF0A 3O08A 4RTFD 3S41A 4J2BA 3LAKA 3ZSOA 3JSMA 1YVNA 4I6MB 3SUPA 1P90A 2GX9A 5DK5A 3PO5A 3CI5A 1RTHA 2P51A 3QEXA 4BWJA 4FXDA 1JLEA 4JYAK 1NMDA 5JS1A 3LPUA 1Q86O 4M3WA 3LDPA 4QS7A 1HNVA 3AVHA 4Y1DA 3EYZA 4Y1CA 3SUOA 1IKVA 3CM5A 4JI0K 3DMJA 3SUQA 2HHSA 3KHYA 2PBDA 2RE2A 3F9KA 3ENBA 3LP3A 4FWRA 4Y0WA 3R3LA 3ZX2A 4WF9L 1BUPA 1JLBA 3GL1A 3KVGA 4CZLA 1XC9A 1QQOA 4DV3K 4H0VB 3P38A 5HROA 4FOIA 4IJNA 3SAHA 3S3MA 4H4OA 4A2BA 3KLGA 4LY7A 3RRHA 3C0BA 3P83D 3HM8A 4X62K 3M3ZA 4E1NA 1BIZA 4OX9K 4ZTFA 3MN7A 3D2EA 2ITMA 4Z4HA 4KHPK 1T05A 1RT1A 4CIFA 3ATVA 3MCPA 3OVNA 4K41A 3LZJA 3SBTA 1BDGA 4HWIA 3MXMA 4W5TA 4XH1A 3WQUA 3RMCA 3TU5A 4O0JA 1RDWX 4CGFA 3OYNA 3H6EA 3TSPA 1WSGA 3BGRA 2BTFA 1UOCA 3F9MA 4I6MA 3OS1A 1C1BA 1N36K 2NRVA 3OYMA 2JWKA 4DFMA 2D5RA 1OVQA 3DLRA 2F8SA 4BRKA 5C2DA 1KAYA 2F9TA 4BR4A 5AFUA 4KBOA 3LPTA 3A5MC 1VSLA 3EE8A 3CJCA 4DHYA 1X9JA 4FPBA 2NRZA 3VQ4A 3QDKA 4CJUA 2CGLA 1TL1A 3LP2A 2BDPA 3L3UA 4FWSA 1LAVA 1J53A 2D0CA 5DMRA 1OH5A 2OPPA 3U3YA 3KD1E 4FZXC 4KHNA 4NCBA 3DLLL 4FLXA 2YJFA 2YJEA 1E4GT 5K14A 3KD5E 3HL8A 1HLUA 5FPNA 2E2PA 3HPGA 4IZ9A 3PY8A 2I5JA 1TGOA 5AQSA 2HHQA 5CHIA 3NAEA 3VEXA 4DUYK 2A40A 4G1QA 4BQLA 3WXIA 1RDAA 3TTFA 5BN9A 5HP1A 3S3NA 4FWPA 2KTQA 5BR8K 2CH6A 1VSKA 4KFBA 3OA9A 1WSJA 4BGAA 5FROA 1JL1A 3MN5A 2HMIA 4J2AA 2V52B 4BR7A 3VQ5A 2D0OA 4DMNA 1K8KA 4MFBA 1VSMA 5C24A 5FLXO 4GVMA 2E2OA 3AGKA 3V9SA 4BY9C 3O9SA 2HW3A 3BF1A 2P9KB 3J7ZO 4OGCA 4JI1K 4BVOA 4N5SA 3HSTB 4BRHA 3HM9A 3VQCA 4CJTA 4MDAA 1A5XA 2HBMA 1G99A 4YY3K 4DQSA 3CC7N 3RMBA 1EWQA 5M1PA 2E5LK 4J8FA 3VEOA 3BZCA 3QNNA 2A42A 4CHPA 3RR8A 4L3QA 2VWKA 2E88A 3WT0A 2NRXA 3K9KA 4DR4K 1C0GA 2DFEA 3VEYA 4AILC 1Z25A 2AP1A 4FWLA 4BRNA 3BUZB 4FJGA 3OW2M 2QW9A 1NGEA 2GBZA 5HRSA 4KV8A 1HKCA 4DQPA 2ZF5O 3AVBA 1SUQA 3A5NC 4H0PA 1NGJA 3ATUA 4IBNA 1C1CA 4AH9A 1NJYA 5GAGP 3ULEB 1OKJA 4CK2A 1MWMA 4DR5K 4KB0A 1S6PA 4A57A 4JHDB 2HHTA 5JS2A 4Z0UA 1EWRA 1OVYA 1GOBA 2P9KA 4ILJA 4KRFA 1NWKA 1VAZA 2GEMA 1LV5A 1KLMA 1RBVA 4BR0A 4JV5K 3UE5A 1KLNA 3C65A 4Z94A 3EEQA 4JKAA 4WE1A 2Z1HA 4ILGB 3QESA 1RILA 2Q0UA 3QMLA 2QI2A 1O1WA 5C12A 2PAVA 5AFUH 4O8UA 4CI6A 1NKEA 4ICLA 2PZSA 1LWFA 4JLHA 4CEQA 2E6MA 1GLLO 4QCLA 2P9LB 2XY5A 4AF1A 2A5XA 3HZ6A 4DFJA 3DLGA 1DTQA 3CMEN 3SUNA 4CJEA 2Z1JA 4OVLA 5CR4A 3GBTA 4BRPA 3EZWA 3RWUA 3QFPA 3HPOA 1ITGA 2W42A 3CC4N 3M1FA 1ATRA 5I9EB 4YDUA 3PSIA 1YUWA 4B9QA 1XHZA 4BDPA 3MXJA 3CCVN 5H1SQ 1IKYA 2GUPA 3AVAA 1XMQK 3ULEA 2RF2A 1HNWK 3RMDA 1VQ6N 3FE1A 1IG8A 5EX5A 3V6DA 4O5BA 4JNEA 1W7AA 5AZJA 3V9WA 3K5OA 3ALYA 5AQRA 2KW4A 2HNDA 1L3VA 2FBVA 1WNSA 2ZGYA 2Q0RA 3T3FA 2G8KA 4QS9A 4BRDA 5KGXA 3KLIA 4IKFA 4CEZA 3NFAA 4NXNK 1HR0K 3NF9A 3WNFA 1RDBA 4CBWA 4CJ7A 3EKSA 4BR5A 5M1NA 2QEXN 4FZZA 4B3RK 1XUPO 1RBTA 1RNHA 1F21A 4MQ3A 4W5NA 3U9ZA 2KQ2A 4B1WB 1HPZA 1D4XA 2DFHA 3JYTA 1Q81O 3D2FB 4OPJA 1EETA 1GLJO 4BC3A 1YXQA 4CJ4A 3V4IA 1CLQA 1ATNA 3ENOA 1DT9A 2P9LA 3P31A 4J2EA 4DQIA 3IS9A 1XC3A 4DV1K 1T3VA 4IOXA 3G6EN 3UIQA 2O8BA 5JICA 5GINA 4FWOA 4H0XB 3ASMA 3PO4A 2KFNA 2CGKA 4BRCA 1EO1A 4B1VA 4LF9K 2HSTA 2WBNA 2ETJA 1VQ5N 2ASMA 2VQFK 3M5RA 3C6UA 1SL1A 3ZT1A 3TAFA 3A2FA 2D0PA 2XY8A 5CY4A 1L5UA 2P5OA 5C25A 1T44A 5LMNK 3NGZA 3DM2A 3HPHA 4I7FA 4ZHRA 4DV5K 4FM2A 4Q0BA 1QS4A 3O4QA 3TANA 3LDSA 2QXFA 4BRFA 4M3XA 1VQ7N 4WQ5A 4B3MK 2WOMA 1UWBA 3M8PA 1NOYA 3R1XA 4EHUA 1BA0A 3B6PA 2A1RA 3VQPA 3WXJA 4IG0A 2YX6A 2HMPA 1XWLA 4BG9A 4DS4A 4PWDA 3UKUA 2X6NA 2CH5A 1L3UA 3QEIA 3DRPA 1QVGM 1JCEA 4CK1A 4KO0A 5IWAK 4GY2B 1Q7YO 2DPNA 1J9AA 4BDYA 4H0YB 4DSEA 1XHXA 1JXBA 2NRHA 5C15A 5BPLA 1RT4A 4MLEA 3SV3A 4B8AB 5J2PA 2PYJA 2YHAA 3NHGA 4W5OA 1Y97A 3O3HA 5TKYA 1I94K 1UA0A 2BGGA 2R7YA 1CXQA 2QKBA 3DWLA 3MN6A 3SPYA 3MN9A 1JLCA 3PX4A 3O80A 1N33K 1GOCA 3SCXA 4K8XA 4ILHA 2KZMA 3P5JA 4WYBA 2OA8A 1NK5A 2QWOA 4BR9A 3HXMA 3TR8A 3VF6A 4BWMA 3RMAA 4E89A 3HI0A 4RW6A 4CGHA 4CHZA 3WQTA 4GV3A 4BR2A 4FO0A 2E2QA 1X9MA 3TPQA 1IKWA 1VRUA 4DFKA 3K59A 2LSNA 4CF9A 4CGJA 2BE2A 3T19A 5KQ8A 4FOEA 4N47A 2UXCK 1ESVA 1TUYA 2O8CB 1QSSA 1YJ9N 3A5OC 1X1PA 3VQ8A 4DR2K 3U3GA 1Q18A 4CZFA 2YKMA 3P4IA 1U45A 1BISA 4M41A 1VSIA 1ILYA 4C1NK 4CFCA 1ZBHA 3D45A 3EN9A 4K43A 3NGIA 5LMUK 3BP8A 1HNIA 1NG9A 4FW1A 3TAEA 3R9PA 3VQBA 5AQHA 1YJWN 4PKHA 4F9OA 3OYJA 3ZYYX 3I8DA 4CZHA 3OS0A 1A5VA 3C7NB 4DTRA 1IO2A 2ZGZA 4WFBL 2FSNA 2HHUA 3KIOA 4AQYK 3HOSA 3MXIA 2VWBA 1S72N 1BO5O 2HHHK 1TUUA 3TAQA 4LFBK 1NGFA 4H0OA 3K5MA 3KKSA 3MWPA 1VQKN 3CF5L 3CCJN 4CJPA 4CEFA 1DKGD 4UQGA 3TWHA 1FKOA 3WXKA 1IJJA 1NMNA 4BRGA 3DXKB 1B9DA 1BGXT 2HVHA 3KLFA 3UKRB 2IVOA 3E1YA 4PHTX 3MMVA 3ZT2A 1KSPA 3WUHA 1K8AO 2YKNA 1HNZK 4BVPA 4QOZB 3PSFA 3D2EB 2O8CA 4A61A 4YFUA 5GADP 3MEGA 1T8EA 1N8RO 2YI1A 3HVTA 1HQUA 1LW2A 3TTDA 4DWIA 4NCAA 3H46O 4DTNA 1DLOA 2XO7A 1KFSA 4KHWA 4HTUA 4PKGA 3SBGA 5AQPA 3THYB 1YHQN 4NYNA 4JI3K 4M45A 1RDDA 1BA1A 1LWCA 4U67L 3TAGA 1NK4A 4DV0K 4BC4A 3ENHA 3KLEA 3KKRA 3C7NA 2ZQBA 5AQGA 3TTCA 3ID8A 1HYZA 1JKHA 2Z1GA 5KI6A 4I9LA 2JWLA 1M1KO 3CCEN 3D7EO 3J7AP 4E7LA 5AQUA 4B9MA 4C8MA 5FRMA 2A6AA 2HOEA 3CCQN 3DXKA 4H5TA 3CCMN 4GMJB 3G4SN 1SKRA 1XNQK 4CZIA 3ZT4A 3UKRA 1BQMA 3VQQA 5J2MA 3CD6N 2RKIA 5AQZA 4LF8K 1BCOA 2E2NA 3OYIA 3OYAA 3DLKA 1JLAA 4BGBA 4I2PA 1WB9A 2P9NA 2J4RA 3NVKA 3CQYA 5J1EA 2VCPA 4LSLA 3SQ2A 5AQNA 3CJAA 5DM6L 2AJQA 1T03A 1RTIA 2E4LA 4OKKA 3THYA 1NK7A 5AQFA 3OYKA 2D0AA 2O4IA 2IDOA 1K8KB 2Q31A 1VSDA 3M8RA 4HHTA 3G25A 4PL7A 3H08A 4A59A 5LJWA 3O8MA 1RT2A 4M3ZA 2OCEA 3IUCA 2FF6A 2YHWA 4LF5K 4E1JA 4CJVA 2HF4A 4OLBA 2E1YA 1FXXA 2QWMA 3TSUA 3BZKA 1SS6A 4CZKA 4GKKK 4MO4A 3KTQA 4FJKA 3FLCO 4W5RA 2P5GA 3CIPA 4LD0A 1HUXA 1S1TA 3HK2A 4CEBA 2NRRA 1O13A 1Y64A 3KK7A 4BC5A 3IAYA 4DR6K 5CE3A 3ZSQA 3HYFA 5E41A 3CCRN 3C6AA 1TKXA 4FLVA 4DV7K 1X9WA 3IKMA 1M90O 3JS6A 5JLHA 3OYFA 3L4QA 1W0HA 3KZBA 4UY8O 1BCMA 2RN2A 4JKCA 3E9PA 4IOAL 2NRTA 2HBKA 5D3GA 3NBPA 1KAXA 4DR7K 1NBWA 1TVRA 4ISEA 1RT6A 3PX0A 1DEJA 4KI4A 4LH4A 3BEXA 3ZETB 1RTDA 4IWVA 3SYZA 4E19A 3AO2A 1B9FA 4EFHA 3FZLA 1KTQA 4B3OA 2F8TA 1FJGK 4IG3A 3O6WA 2VQEK 5BPMA 1RT7A 2VG7A 2W40A 3RSEB 3NH0A 2G8HA 1FW6A 2BUPA 3NVMA 5CYMA 2EHGA 3ZSYA 4YOYA 4CJ3A 4F4KA 3VQAA 2HHXA 3TARA 2V7ZA 3B8AX 1QSLA 3VERA 3HO1A 1N32K 1HRHA 3WNEA 4DF4A 4BE2A 3AVNA 4DV6K 4F3OA 3E9LA 1S6QA 1HPMA 4DUZK 1KVAA 4M42A 2ZJQL 4E7JA 2XY6A 4AM7A 4CJSA 1JL2A 3VOVA 1U49A 4E7KA 4Z4CA 3EY1A 3AA2A 3NCIA 3MK6A 4JD2A 1QHTA
chains in the Genus database with same CATH topology
5AJ3K 4DV2K 1XMOK 1HNZK 4X64K 4CVNE 4JI7K 1N33K 4LF5K 4DR5K 4JYAK 4LFAK 4GKKK 4DV1K 2UXBK 2F4VK 4LF4K 4DUYK 4YHHK 4LFCK 4V19S 4JI8K 4JV5K 4B3SK 4JI0K 4LF9K 5BR8K 5IT9O 4DR3K 4CW7B 4JI3K 4DR6K 2VQFK 4DV0K 4DV3K 2UXCK 4DV7K 4X66K 2UUAK 5FLXO 4DR1K 4X62K 5LMNK 4DR2K 4OX9K 2UUBK 3T1HK 3J7AP 4DV5K 4DR7K 4JI1K 4KHPK 2UXDK 4JI6K 3OTOK 1IBMK 5LMUK 1XNRK 4YY3K 1IBLK 3JAMO 4B3MK 1FJGK 4GKJK 1XNQK 2VQEK 2E5LK 4JI5K 4K0KK 4B3TK 1XMQK 4LF8K 2UU9K 1HNWK 1N36K 4JI4K 4DV4K 4AQYK 2HHHK 3J7YP 4NXMK 3J81O 4JI2K 1IBKK 4LFBK 1N32K 3J80O 4DR4K 5IWAK 4DV6K 5LL6Z 1N34K 4DUZK 2ZM6K 4NXNK 2UUCK 3T1YK 1HNXK 1HR0K 4X65K 5A2QO 1J5EK 4LF6K 4B3RK 1I94K 4LF7K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AJ3 K;  4DV2 K;  1XMO K;  1HNZ K;  4X64 K;  4CVN E;  4JI7 K;  1N33 K;  4LF5 K;  4DR5 K;  4JYA K;  4LFA K;  4GKK K;  4DV1 K;  2UXB K;  2F4V K;  4LF4 K;  4DUY K;  4YHH K;  4LFC K;  4V19 S;  4JI8 K;  4JV5 K;  4B3S K;  4JI0 K;  4LF9 K;  5BR8 K;  5IT9 O;  4DR3 K;  4CW7 B;  4JI3 K;  4DR6 K;  2VQF K;  4DV0 K;  4DV3 K;  2UXC K;  4DV7 K;  4X66 K;  2UUA K;  5FLX O;  4DR1 K;  4X62 K;  5LMN K;  4DR2 K;  4OX9 K;  2UUB K;  3T1H K;  3J7A P;  4DV5 K;  4DR7 K;  4JI1 K;  4KHP K;  2UXD K;  4JI6 K;  3OTO K;  1IBM K;  5LMU K;  1XNR K;  4YY3 K;  1IBL K;  3JAM O;  4B3M K;  1FJG K;  4GKJ K;  1XNQ K;  2VQE K;  2E5L K;  4JI5 K;  4K0K K;  4B3T K;  1XMQ K;  4LF8 K;  2UU9 K;  1HNW K;  1N36 K;  4JI4 K;  4DV4 K;  4AQY K;  2HHH K;  3J7Y P;  4NXM K;  3J81 O;  4JI2 K;  1IBK K;  4LFB K;  1N32 K;  3J80 O;  4DR4 K;  5IWA K;  4DV6 K;  5LL6 Z;  1N34 K;  4DUZ K;  2ZM6 K;  4NXN K;  2UUC K;  3T1Y K;  1HNX K;  1HR0 K;  4X65 K;  5A2Q O;  1J5E K;  4LF6 K;  4B3R K;  1I94 K;  4LF7 K; 
#chains in the Genus database with same CATH topology
 4PUO A;  1HKB A;  4BRE A;  4AHV A;  1JLQ A;  4LC9 B;  2YHB A;  2G8W A;  2HF3 A;  5DM7 L;  3CPE A;  1IG9 A;  3CPW M;  4K8Z A;  1VQ9 N;  2PY5 A;  4FWM A;  4FJN A;  3RTV A;  4BQZ A;  5E26 A;  4V19 S;  4OO1 J;  3ZET A;  2ZE2 A;  3LAM A;  4DKW A;  2P1J A;  4JKD A;  2YNH A;  3K2P A;  3D0P A;  1NJZ A;  4PL8 A;  4HTL A;  4H4M A;  4I2Q A;  4JK8 A;  3RSE A;  4PKI A;  4CZM A;  3SMP A;  1RBU A;  5CYQ A;  5JVG L;  4O5F A;  4FJ7 A;  5AZJ B;  4RW8 A;  1A5W A;  3RR7 A;  1D5A A;  4YNQ A;  3NMU A;  1WUA A;  4FM0 A;  2RPI A;  5C0Y A;  3K0S A;  2Q2R A;  1FKP A;  1NK8 A;  1NJW A;  5AQY A;  3V9X A;  3MEC A;  3SI6 A;  2NZT A;  4K25 A;  4PA1 A;  4DB3 A;  3QEW A;  3I8B A;  2H3G X;  4N56 A;  3HSC A;  1KD1 O;  2HNY A;  4LH5 A;  1S22 A;  2HHW A;  3AO5 A;  4C8K A;  1KXP A;  3G71 N;  2CGJ A;  1GLD G;  4CE9 A;  3OJS A;  2F96 A;  1RBS A;  5KGW A;  4YOU A;  3J7Y P;  2YHY A;  5FPD A;  3J81 O;  3TAP A;  4IJA A;  1SKS A;  3K5L A;  4H0T B;  1HYV A;  2O8B B;  3SV4 A;  1FK9 A;  3ULD A;  1C6V A;  1HQE A;  5LL6 Z;  4HCC A;  1G15 A;  1EXQ A;  3SMS A;  4CJK A;  3NE6 A;  5C42 A;  3AVL A;  1S1W A;  2Z1I A;  4QAG A;  4CIE A;  4JEP A;  4F2R A;  3WNG A;  1VQ8 N;  3T1A A;  3FFI A;  2GWJ A;  4B9S A;  4FZY A;  4LF7 K;  3ID6 A;  4OJR A;  4IFY A;  4DV2 K;  4N41 A;  2WFB A;  2ASP A;  1BU6 O;  3GOI A;  4FWK A;  5HL7 L;  4R79 A;  4L8R B;  1J5O A;  3ZSX A;  2WTU A;  3FZH A;  2OPS A;  4NLB A;  3VES A;  4RCH A;  3V1Q A;  4YOT A;  1TK0 A;  5CZ2 A;  3F5T A;  4YHH K;  1CZ9 A;  3OYC A;  3LZI A;  3MAQ A;  1GLA G;  3THV A;  1NNE A;  3OY9 A;  4NCG A;  2QM1 A;  4NO7 A;  3ISN C;  1S1X A;  4W5Q A;  5AQM A;  3VTH A;  1NLV A;  1Z05 A;  1TKT A;  3AVG A;  3LDL A;  4KB1 A;  4GW6 A;  4DU1 A;  3UKU B;  1EP4 A;  2IVN A;  4IDH A;  3AAQ A;  5JMV A;  5BRD A;  3DJC A;  4CED A;  1S1V A;  2GWK A;  4JK9 A;  5AQV A;  1ASW A;  3U8X A;  2GV9 A;  2Q97 A;  5SWM A;  1QVF M;  3S3O A;  2E20 A;  5KQD A;  4FWN A;  1YI2 N;  4G9Z A;  2IS3 A;  2P9I A;  5M1F A;  1Q82 O;  3R6M A;  4B1Z A;  2Q3S A;  2XY7 A;  3LAL A;  5AZI A;  4B9N A;  3DOK A;  4GV9 A;  4DU4 A;  4CGG A;  4JS4 A;  1NGB A;  5HRN A;  2HNZ A;  1T6D A;  4KKO A;  3BF3 A;  4GKJ K;  1D9D A;  3CER A;  3K58 A;  1BOT O;  3SQ4 A;  4B3T K;  5KPT A;  3AY9 A;  4JRP A;  3TAM A;  2DTU A;  1NM1 A;  4CD1 A;  2G8I A;  3AO1 A;  3U6F A;  2I7N A;  2F9W A;  3LDQ A;  4CHY A;  2X74 A;  4BDZ A;  4CEE A;  5ELZ A;  4F2S A;  3GE1 A;  4GNI A;  1IH7 A;  4CJW A;  4KPY A;  1QZ5 A;  1WOQ A;  4LSN A;  1TYQ A;  3L2Q A;  1BIU A;  3GG4 A;  3CM6 A;  3IG1 A;  2VGM A;  4XIU A;  3VA0 A;  4RW7 A;  5HLF A;  3AO4 A;  4H03 B;  4ELT A;  3DXM A;  2W6K A;  3QO9 A;  4FYD A;  1K6Y A;  1XQS C;  1ZYQ A;  2X78 A;  1J54 A;  2E8A A;  4B9T A;  2V7Y A;  5BRE A;  3OYD A;  4JI7 K;  2KFZ A;  4IO8 A;  4CJQ A;  1YTU A;  4DSL A;  4CER A;  3EE9 A;  3NF8 A;  5M1O A;  3I0R A;  3LAN A;  3LL3 A;  4M3R A;  4DF8 A;  3I0S A;  4KTZ A;  1SKW A;  2YHX A;  3DYA A;  5GAE P;  1TK8 A;  4O55 A;  3SJJ A;  5GIP A;  3DRS A;  4DTM A;  4O0I A;  3QIO A;  4CFB A;  1Q8I A;  4DR3 K;  3OS2 A;  3KK2 A;  2B4J A;  3VGM A;  2GUI A;  1HX1 A;  3CQ8 A;  3WNH A;  1YF5 L;  5E84 A;  4KHS A;  4CES A;  5GIO A;  1JJ2 M;  1BQN A;  3QBX A;  4KTW A;  5BRH A;  5KRS A;  2UUA K;  3IDH A;  1ZBI A;  3CC2 N;  1GLB G;  3ZSZ A;  5KPR A;  5FPE A;  1U4B A;  2FBY A;  4DSK A;  1B92 A;  1RDC A;  1MWK A;  4TSX A;  3ZLJ A;  5AQJ A;  3OTO K;  1QQC A;  4FK2 A;  3L2U A;  3FGU A;  3CJ1 A;  1LOT B;  3W0L A;  4CF8 A;  5AQQ A;  2O8F A;  2O4G A;  3JAM O;  4IFE A;  2OTL N;  2OZS A;  1NGD A;  3WXL A;  2ATQ A;  4JN4 A;  1E4F T;  1V4T A;  3CQX A;  4KHU A;  4MO5 A;  4EP5 A;  3THX A;  2VG6 A;  4CF1 A;  1X3N A;  5FRN A;  4DSI A;  3DLE A;  1TK5 A;  3OYH A;  3ZX3 A;  2ASO A;  3T69 A;  3VN5 A;  2GTD A;  1E3M A;  3V1R A;  4NXM K;  2ZWH A;  4JI2 K;  4A5B A;  4EZ9 A;  3VMF B;  4OKJ A;  5BPN A;  2OYQ A;  3LWM A;  2WUS A;  4DQR A;  1WSE A;  1WN7 A;  3P1G A;  2ZM6 K;  3KLH A;  4IXC A;  3W3D A;  1Q9X A;  1GLF O;  2Y1J A;  3CJ9 A;  3T1Y K;  1JXE A;  2YNG A;  4JKB A;  3QIN A;  4X65 K;  1VQL N;  4CHO A;  2AA4 A;  2HBL A;  1U2V B;  5AJ3 K;  3MX2 A;  4OGE A;  1YTA A;  1XMO K;  1BI4 A;  4CVN E;  2IOC A;  4FLZ A;  4FJ9 A;  3HTV A;  4K42 A;  4MLH A;  1C0M A;  3CJB A;  1JLG A;  2UXB K;  3H1V X;  2O8D A;  1NJX A;  1SL2 A;  2I7P A;  2OAN A;  3HJF A;  3VQ9 A;  4WCE L;  4CW7 B;  2JLE A;  4JKF A;  4WFN L;  2IGI A;  4CZJ A;  4HUF A;  2G8V A;  1U48 A;  2P9N B;  4AM6 A;  5F1X A;  3AVF A;  4AHT A;  4O44 A;  3SK3 A;  3SQ0 A;  4H5W A;  4E7I A;  1N6Q A;  1ZBS A;  1NKB A;  1N5Y A;  3L2W A;  1QHA A;  3O5B A;  3QBW A;  3CHW A;  1P8Z A;  5KRT A;  1IBM K;  4M3Y A;  4E3S A;  3AVK A;  3OYB A;  3P39 A;  1KFD A;  3O4N A;  3KWG A;  2NLX A;  1VQN N;  2VYP A;  4NLC A;  3M8S A;  1YJN N;  3OYG A;  5EY4 A;  1BHL A;  2FBT A;  4CJL A;  1U2V A;  1TKD A;  2UU9 K;  1GOA A;  3C94 A;  3ITH A;  3DLB A;  3Q7C A;  4DV4 K;  1K9M O;  1CZA N;  4DSJ A;  4HCB A;  4BRI A;  4CD3 A;  3MED A;  2WON A;  4U7B A;  2E1Z A;  4CEC A;  3LDN A;  4AHR A;  4AHS A;  2KZZ A;  3VTI A;  2JGU A;  2PYL A;  4FJM A;  3F73 A;  1KQS M;  3JXU A;  4C23 A;  1WSF A;  4A2A A;  2QWR A;  3HOT A;  2OPQ A;  3N4P A;  4HUE A;  1KCF A;  1VSE A;  1RTJ A;  4KRE A;  3PIO L;  1HYS A;  2XHB A;  4FM1 A;  4ID5 A;  3O3G A;  1V4S A;  3QET A;  1W9H A;  1QE1 A;  1REV A;  4HUG A;  2BAN A;  2HVI A;  1ZBF A;  1VRT A;  3QIC A;  5BN8 A;  1NGH A;  1SV5 A;  4BE0 A;  3PX6 A;  3IRX A;  4YOX A;  1DGK N;  3A0I X;  4JKG A;  4B08 A;  4MDB A;  4RWT A;  2O8E A;  3SAG A;  1NJI O;  3B6O A;  3H1Q A;  4A5A A;  4FJI A;  5FPM A;  1YT3 A;  2ZJR L;  3THW A;  1LCU A;  2YNF A;  4DTS A;  1KRP A;  1MA9 B;  4JS5 A;  4FJJ A;  3LM9 A;  3KJV A;  2QXL A;  1BL3 A;  4FW2 A;  1U6Z A;  1RT5 A;  4FLW A;  4FK0 A;  4YOW A;  3T1H K;  1U04 A;  3VGL A;  1Z26 A;  1GLE G;  4B1X B;  2VG5 A;  3AA3 A;  3NDK A;  4E7H A;  2FSK A;  2E6L A;  5HOO A;  4YOR A;  1NOZ A;  4JD2 B;  3NF6 A;  2P9S B;  2ITG A;  4IEI A;  3U9D A;  3HT3 A;  4K0K K;  5AQK A;  2XRI A;  3L4I A;  3DOL A;  2QWP A;  1NK6 A;  2BH1 A;  2FF3 B;  3VEV A;  4JKE A;  4BRA A;  4H5R A;  3NGY A;  3PV8 A;  3Q7B A;  2HBJ A;  4KH4 A;  5ADX A;  4N76 A;  3G0Z A;  1ZC6 A;  3L6Q A;  4A62 A;  1ATS A;  5KPZ A;  4KHY A;  2NUB A;  1CZB A;  4DTX A;  4KI6 A;  3RRG A;  4B1Y B;  3VA3 A;  3AGR A;  2Q36 A;  1VSH A;  4BC2 A;  1C1A A;  3L3V A;  3SQ1 A;  3AVI A;  3M8Q A;  4I9Q A;  2HB5 A;  3CG7 A;  3AA5 X;  4ID1 A;  5JLF A;  2IVP A;  4FLT A;  2A1S A;  4OPA A;  1YVU A;  1U47 A;  5AQW A;  4DS5 A;  4IO9 L;  3VF4 A;  1YIJ N;  3HRG A;  1DTT A;  1EX4 A;  1QQN A;  4LFA K;  5AQT A;  3ZT0 A;  1EQY A;  4BRM A;  5KTQ A;  4M63 C;  3SPZ A;  4FLY A;  2NRW A;  3VQ6 A;  2X6S A;  3VQE A;  3FR0 A;  1LWE A;  3AA4 A;  4IOC L;  1C0U A;  4AHU A;  4DQ8 A;  2KHO A;  2P9S A;  5AQO A;  3I55 N;  3EZ5 A;  2YNI A;  4DTO A;  2FLO A;  1NK9 A;  3FZK A;  4Z4F A;  1BWF O;  4FJ8 A;  5SZT A;  3TAB A;  2V51 B;  3VF2 A;  1Z6R A;  4JRQ A;  5GAH P;  4ELV A;  3H3N O;  1K73 O;  1ZBL A;  2UUB K;  4CZE A;  2W6L A;  3VGK A;  5M1Q A;  4XEI A;  4EHT A;  3K57 A;  2UXD K;  4AHC A;  4JI6 K;  4CIG A;  1QQM A;  3FFK B;  2FBX A;  5AR0 A;  1XNR K;  1ASV A;  3DRR A;  4OPH A;  2HHV A;  2G8F A;  4B1U B;  3EO3 A;  1IV0 A;  1QTM A;  3AAR A;  3NH2 A;  3CFP A;  1J6Z A;  4RW9 A;  3O9T A;  2ZJP L;  3TI0 A;  4YOV A;  3OHR A;  5F0X A;  1RBR A;  3DLH A;  3ZSV A;  1KVC A;  5EXW A;  1VSF A;  3C6H A;  4CF2 A;  2QK9 A;  1MU2 A;  4KH5 A;  4DG1 A;  1IBK K;  2EWS A;  3J80 O;  1X3M A;  5J2Q A;  4BG8 A;  1QZ6 A;  1VQM N;  4XH4 A;  4OPK A;  5EVZ A;  3I33 A;  4RG8 A;  1KAZ A;  4KAZ A;  4ZTJ A;  1HNX K;  4KTQ A;  4Z4G A;  3AV9 A;  4H8K A;  3QIP A;  3CMA N;  3CYM A;  5BRF A;  4DTJ A;  3PIP L;  1UAX A;  3VPZ A;  1NK0 A;  4C8L A;  4X64 K;  4QS8 A;  4DSF A;  1IKX A;  3QEV A;  2P9I B;  4CFA A;  2FXU A;  5AZI B;  4IEE A;  3TSQ A;  2F4V K;  4J2D A;  3CJ7 A;  3OYL A;  3K9J A;  2DY4 A;  2OPR A;  5F2R A;  4OLA A;  4LFC K;  1WSI A;  4F3T A;  3AVJ A;  2GEL A;  2Q1N A;  5B8H A;  4JK7 A;  4B3S K;  3V1O A;  1NKC A;  3DI6 A;  3J8A A;  3GDQ A;  2QKK A;  1D9F A;  4RW4 A;  3V81 A;  5ADX H;  3SZ2 A;  3HP9 A;  1I39 A;  2RHK A;  1NGC A;  1WAF A;  3KWI A;  4DFP A;  1X9S A;  3MDQ A;  1L3S A;  2B5J A;  1R0A A;  4FJX A;  4O4G A;  3SNN A;  1TYQ B;  1SL0 A;  4FWQ A;  5JVH L;  4BRL A;  2QWN A;  4H5N A;  4DTP A;  2A41 A;  3MWT A;  4EP4 A;  4JHD A;  3CCS N;  1Q9Y A;  3CFO A;  3DXM B;  2D4W A;  3WEE B;  2B6A A;  4OKE A;  1KVB A;  1SQK A;  3ZSW A;  3U4L A;  4M3T A;  3SJH A;  3V9Z A;  3O4W A;  1HKG A;  4DLE A;  1T6C A;  1WAJ A;  4KH6 A;  4CHQ A;  4ISF A;  1S1U A;  1L3T A;  3G10 A;  3A5L C;  2A3Z A;  1GLC G;  2P9P B;  4JI4 K;  4IDK A;  4BAC A;  3O1B A;  5C10 A;  2KLA A;  1I3A A;  3QNO A;  2NNW A;  1HJR A;  3V9U A;  4Z4E A;  4IFV A;  1ZXO A;  1N34 K;  1OH8 A;  3VEW A;  2OZM A;  1SAZ A;  5BR9 A;  3CCL N;  1TKZ A;  3O9Q A;  3QFU A;  3AO3 A;  1VQO N;  4DQQ A;  3AVM A;  3CET A;  5AQX A;  1C0T A;  3CFR A;  4FK4 A;  2W41 A;  1SZ2 A;  1TL3 A;  4LF6 K;  4E1M A;  4HVJ A;  3O9U A;  3O9R A;  4CJ5 A;  3RVC A;  1CXU A;  5C2F A;  3N4Q A;  1VSJ A;  4WFA L;  4Q5V A;  3OYE A;  4B8C A;  4CGD A;  4BRQ A;  1R59 O;  1S3X A;  1NGA A;  2O8F B;  4LF4 K;  3BDP A;  5FDL A;  4CHN A;  4GVE A;  3LWL A;  4XH5 A;  3WEE A;  1NGI A;  3L0Q A;  4YDU C;  2FC0 A;  3EL2 A;  3THX B;  4B9L A;  5IT9 O;  1S9E A;  1RCH A;  1WBB A;  3S9H A;  2ZD1 A;  4ELU A;  4FLU A;  4E0D A;  3VQD A;  4X66 K;  1ZBU A;  2P9P A;  4CJF A;  3IMX A;  3ZT3 A;  1UA1 A;  2Y1I A;  3PUF A;  5MLC Q;  5HRR A;  2YV0 X;  3MX5 A;  4M7Y A;  2QTD A;  1TAQ A;  4FVU A;  4CBU A;  4BE1 A;  4FSV A;  3ZEU B;  3D2F A;  4EZ6 A;  5EOY A;  1W2B M;  4DTU A;  1OH6 A;  2YCH A;  3F2K A;  4B9U A;  4KHQ A;  4R5P A;  4H5V A;  4M7X A;  2F7T A;  1VQ4 N;  4FJH A;  3M6G A;  4FL9 A;  1WBD A;  3OBY A;  5AQI A;  1RT3 A;  4JKH A;  1BI4 B;  4O8K A;  4NYF A;  4FPA A;  1HJO A;  3SLC A;  4F8R A;  3LP1 A;  3WXM B;  3E66 A;  3R8E A;  3VEZ A;  3VEN A;  2D0B A;  2O8D B;  3E9O A;  1QSY A;  1RDU A;  4WQ4 A;  5I42 A;  3LM2 A;  1RFQ A;  5T7B A;  2QA4 N;  5LJV A;  4CBX A;  3NH1 A;  4CZG A;  2OTJ N;  3A8Y A;  4DCH A;  2UYT A;  2G8U A;  2UUC K;  3AVC A;  1VQP N;  5A2Q O;  4FJ5 A;  4BRO A;  3CXC M;  1YAG A;  1J5E K;  2QWL A;  3D6R A;  1WSH A;  1TV6 A;  3KK3 A;  1H1V A;  2D1K A;  3KK1 A;  2EX3 A;  3OJU A;  4DU3 A;  4CGI A;  4GV6 A;  1NU0 A;  1W97 L;  3QB0 A;  3O3F A;  3QLH A;  3ZSR A;  2P9U B;  4EIA A;  4JAX A;  3ZEU A;  3K5N A;  1VHX A;  3VET A;  1HMV A;  3HBT A;  2FSJ A;  4EAH D;  4WQ5 C;  4JI8 K;  4C1N I;  4FCY A;  1JLF A;  1KC8 O;  3I56 N;  2IC3 A;  5HRP A;  2IAJ A;  4CEA A;  1BG3 A;  1D8Y A;  3MEE A;  3H3O B;  3NF7 A;  3O1W A;  4FJL A;  3ZX0 A;  2VGN A;  5M1K A;  4CFD A;  4CEO A;  3LDO A;  4DR1 K;  3MCA B;  3VQ7 A;  2KKZ A;  1S9G A;  4NB4 A;  3ZCM A;  3SAF A;  2DFF A;  3H45 C;  5HBM A;  3PLA A;  1JCG A;  3AAP A;  5AQL A;  1T7P A;  3CCU N;  4FVM A;  3UB5 A;  3L8B A;  1EKE A;  2VWJ A;  3L2V A;  4PY5 A;  5I3U A;  3C95 A;  4C8O A;  1LW0 A;  1IBL K;  3DAW A;  4CK3 A;  3QER A;  3HP6 A;  3BY5 A;  1VK0 A;  4PQU A;  5LY3 A;  1C0F A;  1JCF A;  5CZ1 A;  3L2R A;  4JI5 K;  3FZM A;  3C6T A;  4B9V A;  1S5J A;  4WQ4 C;  3T7Z A;  3EKU A;  4Z4I A;  2PFU A;  2QWQ A;  1LAW A;  1MDU B;  4ISG A;  4CCH A;  1YIT N;  1XI1 A;  1ASU A;  2P9U A;  5EU7 A;  3HVR A;  3QEP A;  1TAU A;  2IIR A;  2WC9 A;  4CJR A;  3OBW A;  5TKW A;  4JKG B;  2O8E B;  1RGI A;  3IFR A;  4M3U A;  1NGG A;  1WLJ A;  5J2N A;  3THW B;  3FZF A;  3LP0 A;  1OH7 A;  4C8N A;  3E01 A;  4DLG A;  4CF0 A;  3O08 A;  4RTF D;  3S41 A;  4J2B A;  3LAK A;  3ZSO A;  3JSM A;  1YVN A;  4I6M B;  3SUP A;  1P90 A;  2GX9 A;  5DK5 A;  3PO5 A;  3CI5 A;  1RTH A;  2P51 A;  3QEX A;  4BWJ A;  4FXD A;  1JLE A;  4JYA K;  1NMD A;  5JS1 A;  3LPU A;  1Q86 O;  4M3W A;  3LDP A;  4QS7 A;  1HNV A;  3AVH A;  4Y1D A;  3EYZ A;  4Y1C A;  3SUO A;  1IKV A;  3CM5 A;  4JI0 K;  3DMJ A;  3SUQ A;  2HHS A;  3KHY A;  2PBD A;  2RE2 A;  3F9K A;  3ENB A;  3LP3 A;  4FWR A;  4Y0W A;  3R3L A;  3ZX2 A;  4WF9 L;  1BUP A;  1JLB A;  3GL1 A;  3KVG A;  4CZL A;  1XC9 A;  1QQO A;  4DV3 K;  4H0V B;  3P38 A;  5HRO A;  4FOI A;  4IJN A;  3SAH A;  3S3M A;  4H4O A;  4A2B A;  3KLG A;  4LY7 A;  3RRH A;  3C0B A;  3P83 D;  3HM8 A;  4X62 K;  3M3Z A;  4E1N A;  1BIZ A;  4OX9 K;  4ZTF A;  3MN7 A;  3D2E A;  2ITM A;  4Z4H A;  4KHP K;  1T05 A;  1RT1 A;  4CIF A;  3ATV A;  3MCP A;  3OVN A;  4K41 A;  3LZJ A;  3SBT A;  1BDG A;  4HWI A;  3MXM A;  4W5T A;  4XH1 A;  3WQU A;  3RMC A;  3TU5 A;  4O0J A;  1RDW X;  4CGF A;  3OYN A;  3H6E A;  3TSP A;  1WSG A;  3BGR A;  2BTF A;  1UOC A;  3F9M A;  4I6M A;  3OS1 A;  1C1B A;  1N36 K;  2NRV A;  3OYM A;  2JWK A;  4DFM A;  2D5R A;  1OVQ A;  3DLR A;  2F8S A;  4BRK A;  5C2D A;  1KAY A;  2F9T A;  4BR4 A;  5AFU A;  4KBO A;  3LPT A;  3A5M C;  1VSL A;  3EE8 A;  3CJC A;  4DHY A;  1X9J A;  4FPB A;  2NRZ A;  3VQ4 A;  3QDK A;  4CJU A;  2CGL A;  1TL1 A;  3LP2 A;  2BDP A;  3L3U A;  4FWS A;  1LAV A;  1J53 A;  2D0C A;  5DMR A;  1OH5 A;  2OPP A;  3U3Y A;  3KD1 E;  4FZX C;  4KHN A;  4NCB A;  3DLL L;  4FLX A;  2YJF A;  2YJE A;  1E4G T;  5K14 A;  3KD5 E;  3HL8 A;  1HLU A;  5FPN A;  2E2P A;  3HPG A;  4IZ9 A;  3PY8 A;  2I5J A;  1TGO A;  5AQS A;  2HHQ A;  5CHI A;  3NAE A;  3VEX A;  4DUY K;  2A40 A;  4G1Q A;  4BQL A;  3WXI A;  1RDA A;  3TTF A;  5BN9 A;  5HP1 A;  3S3N A;  4FWP A;  2KTQ A;  5BR8 K;  2CH6 A;  1VSK A;  4KFB A;  3OA9 A;  1WSJ A;  4BGA A;  5FRO A;  1JL1 A;  3MN5 A;  2HMI A;  4J2A A;  2V52 B;  4BR7 A;  3VQ5 A;  2D0O A;  4DMN A;  1K8K A;  4MFB A;  1VSM A;  5C24 A;  5FLX O;  4GVM A;  2E2O A;  3AGK A;  3V9S A;  4BY9 C;  3O9S A;  2HW3 A;  3BF1 A;  2P9K B;  3J7Z O;  4OGC A;  4JI1 K;  4BVO A;  4N5S A;  3HST B;  4BRH A;  3HM9 A;  3VQC A;  4CJT A;  4MDA A;  1A5X A;  2HBM A;  1G99 A;  4YY3 K;  4DQS A;  3CC7 N;  3RMB A;  1EWQ A;  5M1P A;  2E5L K;  4J8F A;  3VEO A;  3BZC A;  3QNN A;  2A42 A;  4CHP A;  3RR8 A;  4L3Q A;  2VWK A;  2E88 A;  3WT0 A;  2NRX A;  3K9K A;  4DR4 K;  1C0G A;  2DFE A;  3VEY A;  4AIL C;  1Z25 A;  2AP1 A;  4FWL A;  4BRN A;  3BUZ B;  4FJG A;  3OW2 M;  2QW9 A;  1NGE A;  2GBZ A;  5HRS A;  4KV8 A;  1HKC A;  4DQP A;  2ZF5 O;  3AVB A;  1SUQ A;  3A5N C;  4H0P A;  1NGJ A;  3ATU A;  4IBN A;  1C1C A;  4AH9 A;  1NJY A;  5GAG P;  3ULE B;  1OKJ A;  4CK2 A;  1MWM A;  4DR5 K;  4KB0 A;  1S6P A;  4A57 A;  4JHD B;  2HHT A;  5JS2 A;  4Z0U A;  1EWR A;  1OVY A;  1GOB A;  2P9K A;  4ILJ A;  4KRF A;  1NWK A;  1VAZ A;  2GEM A;  1LV5 A;  1KLM A;  1RBV A;  4BR0 A;  4JV5 K;  3UE5 A;  1KLN A;  3C65 A;  4Z94 A;  3EEQ A;  4JKA A;  4WE1 A;  2Z1H A;  4ILG B;  3QES A;  1RIL A;  2Q0U A;  3QML A;  2QI2 A;  1O1W A;  5C12 A;  2PAV A;  5AFU H;  4O8U A;  4CI6 A;  1NKE A;  4ICL A;  2PZS A;  1LWF A;  4JLH A;  4CEQ A;  2E6M A;  1GLL O;  4QCL A;  2P9L B;  2XY5 A;  4AF1 A;  2A5X A;  3HZ6 A;  4DFJ A;  3DLG A;  1DTQ A;  3CME N;  3SUN A;  4CJE A;  2Z1J A;  4OVL A;  5CR4 A;  3GBT A;  4BRP A;  3EZW A;  3RWU A;  3QFP A;  3HPO A;  1ITG A;  2W42 A;  3CC4 N;  3M1F A;  1ATR A;  5I9E B;  4YDU A;  3PSI A;  1YUW A;  4B9Q A;  1XHZ A;  4BDP A;  3MXJ A;  3CCV N;  5H1S Q;  1IKY A;  2GUP A;  3AVA A;  1XMQ K;  3ULE A;  2RF2 A;  1HNW K;  3RMD A;  1VQ6 N;  3FE1 A;  1IG8 A;  5EX5 A;  3V6D A;  4O5B A;  4JNE A;  1W7A A;  5AZJ A;  3V9W A;  3K5O A;  3ALY A;  5AQR A;  2KW4 A;  2HND A;  1L3V A;  2FBV A;  1WNS A;  2ZGY A;  2Q0R A;  3T3F A;  2G8K A;  4QS9 A;  4BRD A;  5KGX A;  3KLI A;  4IKF A;  4CEZ A;  3NFA A;  4NXN K;  1HR0 K;  3NF9 A;  3WNF A;  1RDB A;  4CBW A;  4CJ7 A;  3EKS A;  4BR5 A;  5M1N A;  2QEX N;  4FZZ A;  4B3R K;  1XUP O;  1RBT A;  1RNH A;  1F21 A;  4MQ3 A;  4W5N A;  3U9Z A;  2KQ2 A;  4B1W B;  1HPZ A;  1D4X A;  2DFH A;  3JYT A;  1Q81 O;  3D2F B;  4OPJ A;  1EET A;  1GLJ O;  4BC3 A;  1YXQ A;  4CJ4 A;  3V4I A;  1CLQ A;  1ATN A;  3ENO A;  1DT9 A;  2P9L A;  3P31 A;  4J2E A;  4DQI A;  3IS9 A;  1XC3 A;  4DV1 K;  1T3V A;  4IOX A;  3G6E N;  3UIQ A;  2O8B A;  5JIC A;  5GIN A;  4FWO A;  4H0X B;  3ASM A;  3PO4 A;  2KFN A;  2CGK A;  4BRC A;  1EO1 A;  4B1V A;  4LF9 K;  2HST A;  2WBN A;  2ETJ A;  1VQ5 N;  2ASM A;  2VQF K;  3M5R A;  3C6U A;  1SL1 A;  3ZT1 A;  3TAF A;  3A2F A;  2D0P A;  2XY8 A;  5CY4 A;  1L5U A;  2P5O A;  5C25 A;  1T44 A;  5LMN K;  3NGZ A;  3DM2 A;  3HPH A;  4I7F A;  4ZHR A;  4DV5 K;  4FM2 A;  4Q0B A;  1QS4 A;  3O4Q A;  3TAN A;  3LDS A;  2QXF A;  4BRF A;  4M3X A;  1VQ7 N;  4WQ5 A;  4B3M K;  2WOM A;  1UWB A;  3M8P A;  1NOY A;  3R1X A;  4EHU A;  1BA0 A;  3B6P A;  2A1R A;  3VQP A;  3WXJ A;  4IG0 A;  2YX6 A;  2HMP A;  1XWL A;  4BG9 A;  4DS4 A;  4PWD A;  3UKU A;  2X6N A;  2CH5 A;  1L3U A;  3QEI A;  3DRP A;  1QVG M;  1JCE A;  4CK1 A;  4KO0 A;  5IWA K;  4GY2 B;  1Q7Y O;  2DPN A;  1J9A A;  4BDY A;  4H0Y B;  4DSE A;  1XHX A;  1JXB A;  2NRH A;  5C15 A;  5BPL A;  1RT4 A;  4MLE A;  3SV3 A;  4B8A B;  5J2P A;  2PYJ A;  2YHA A;  3NHG A;  4W5O A;  1Y97 A;  3O3H A;  5TKY A;  1I94 K;  1UA0 A;  2BGG A;  2R7Y A;  1CXQ A;  2QKB A;  3DWL A;  3MN6 A;  3SPY A;  3MN9 A;  1JLC A;  3PX4 A;  3O80 A;  1N33 K;  1GOC A;  3SCX A;  4K8X A;  4ILH A;  2KZM A;  3P5J A;  4WYB A;  2OA8 A;  1NK5 A;  2QWO A;  4BR9 A;  3HXM A;  3TR8 A;  3VF6 A;  4BWM A;  3RMA A;  4E89 A;  3HI0 A;  4RW6 A;  4CGH A;  4CHZ A;  3WQT A;  4GV3 A;  4BR2 A;  4FO0 A;  2E2Q A;  1X9M A;  3TPQ A;  1IKW A;  1VRU A;  4DFK A;  3K59 A;  2LSN A;  4CF9 A;  4CGJ A;  2BE2 A;  3T19 A;  5KQ8 A;  4FOE A;  4N47 A;  2UXC K;  1ESV A;  1TUY A;  2O8C B;  1QSS A;  1YJ9 N;  3A5O C;  1X1P A;  3VQ8 A;  4DR2 K;  3U3G A;  1Q18 A;  4CZF A;  2YKM A;  3P4I A;  1U45 A;  1BIS A;  4M41 A;  1VSI A;  1ILY A;  4C1N K;  4CFC A;  1ZBH A;  3D45 A;  3EN9 A;  4K43 A;  3NGI A;  5LMU K;  3BP8 A;  1HNI A;  1NG9 A;  4FW1 A;  3TAE A;  3R9P A;  3VQB A;  5AQH A;  1YJW N;  4PKH A;  4F9O A;  3OYJ A;  3ZYY X;  3I8D A;  4CZH A;  3OS0 A;  1A5V A;  3C7N B;  4DTR A;  1IO2 A;  2ZGZ A;  4WFB L;  2FSN A;  2HHU A;  3KIO A;  4AQY K;  3HOS A;  3MXI A;  2VWB A;  1S72 N;  1BO5 O;  2HHH K;  1TUU A;  3TAQ A;  4LFB K;  1NGF A;  4H0O A;  3K5M A;  3KKS A;  3MWP A;  1VQK N;  3CF5 L;  3CCJ N;  4CJP A;  4CEF A;  1DKG D;  4UQG A;  3TWH A;  1FKO A;  3WXK A;  1IJJ A;  1NMN A;  4BRG A;  3DXK B;  1B9D A;  1BGX T;  2HVH A;  3KLF A;  3UKR B;  2IVO A;  3E1Y A;  4PHT X;  3MMV A;  3ZT2 A;  1KSP A;  3WUH A;  1K8A O;  2YKN A;  1HNZ K;  4BVP A;  4QOZ B;  3PSF A;  3D2E B;  2O8C A;  4A61 A;  4YFU A;  5GAD P;  3MEG A;  1T8E A;  1N8R O;  2YI1 A;  3HVT A;  1HQU A;  1LW2 A;  3TTD A;  4DWI A;  4NCA A;  3H46 O;  4DTN A;  1DLO A;  2XO7 A;  1KFS A;  4KHW A;  4HTU A;  4PKG A;  3SBG A;  5AQP A;  3THY B;  1YHQ N;  4NYN A;  4JI3 K;  4M45 A;  1RDD A;  1BA1 A;  1LWC A;  4U67 L;  3TAG A;  1NK4 A;  4DV0 K;  4BC4 A;  3ENH A;  3KLE A;  3KKR A;  3C7N A;  2ZQB A;  5AQG A;  3TTC A;  3ID8 A;  1HYZ A;  1JKH A;  2Z1G A;  5KI6 A;  4I9L A;  2JWL A;  1M1K O;  3CCE N;  3D7E O;  3J7A P;  4E7L A;  5AQU A;  4B9M A;  4C8M A;  5FRM A;  2A6A A;  2HOE A;  3CCQ N;  3DXK A;  4H5T A;  3CCM N;  4GMJ B;  3G4S N;  1SKR A;  1XNQ K;  4CZI A;  3ZT4 A;  3UKR A;  1BQM A;  3VQQ A;  5J2M A;  3CD6 N;  2RKI A;  5AQZ A;  4LF8 K;  1BCO A;  2E2N A;  3OYI A;  3OYA A;  3DLK A;  1JLA A;  4BGB A;  4I2P A;  1WB9 A;  2P9N A;  2J4R A;  3NVK A;  3CQY A;  5J1E A;  2VCP A;  4LSL A;  3SQ2 A;  5AQN A;  3CJA A;  5DM6 L;  2AJQ A;  1T03 A;  1RTI A;  2E4L A;  4OKK A;  3THY A;  1NK7 A;  5AQF A;  3OYK A;  2D0A A;  2O4I A;  2IDO A;  1K8K B;  2Q31 A;  1VSD A;  3M8R A;  4HHT A;  3G25 A;  4PL7 A;  3H08 A;  4A59 A;  5LJW A;  3O8M A;  1RT2 A;  4M3Z A;  2OCE A;  3IUC A;  2FF6 A;  2YHW A;  4LF5 K;  4E1J A;  4CJV A;  2HF4 A;  4OLB A;  2E1Y A;  1FXX A;  2QWM A;  3TSU A;  3BZK A;  1SS6 A;  4CZK A;  4GKK K;  4MO4 A;  3KTQ A;  4FJK A;  3FLC O;  4W5R A;  2P5G A;  3CIP A;  4LD0 A;  1HUX A;  1S1T A;  3HK2 A;  4CEB A;  2NRR A;  1O13 A;  1Y64 A;  3KK7 A;  4BC5 A;  3IAY A;  4DR6 K;  5CE3 A;  3ZSQ A;  3HYF A;  5E41 A;  3CCR N;  3C6A A;  1TKX A;  4FLV A;  4DV7 K;  1X9W A;  3IKM A;  1M90 O;  3JS6 A;  5JLH A;  3OYF A;  3L4Q A;  1W0H A;  3KZB A;  4UY8 O;  1BCM A;  2RN2 A;  4JKC A;  3E9P A;  4IOA L;  2NRT A;  2HBK A;  5D3G A;  3NBP A;  1KAX A;  4DR7 K;  1NBW A;  1TVR A;  4ISE A;  1RT6 A;  3PX0 A;  1DEJ A;  4KI4 A;  4LH4 A;  3BEX A;  3ZET B;  1RTD A;  4IWV A;  3SYZ A;  4E19 A;  3AO2 A;  1B9F A;  4EFH A;  3FZL A;  1KTQ A;  4B3O A;  2F8T A;  1FJG K;  4IG3 A;  3O6W A;  2VQE K;  5BPM A;  1RT7 A;  2VG7 A;  2W40 A;  3RSE B;  3NH0 A;  2G8H A;  1FW6 A;  2BUP A;  3NVM A;  5CYM A;  2EHG A;  3ZSY A;  4YOY A;  4CJ3 A;  4F4K A;  3VQA A;  2HHX A;  3TAR A;  2V7Z A;  3B8A X;  1QSL A;  3VER A;  3HO1 A;  1N32 K;  1HRH A;  3WNE A;  4DF4 A;  4BE2 A;  3AVN A;  4DV6 K;  4F3O A;  3E9L A;  1S6Q A;  1HPM A;  4DUZ K;  1KVA A;  4M42 A;  2ZJQ L;  4E7J A;  2XY6 A;  4AM7 A;  4CJS A;  1JL2 A;  3VOV A;  1U49 A;  4E7K A;  4Z4C A;  3EY1 A;  3AA2 A;  3NCI A;  3MK6 A;  4JD2 A;  1QHT A; 
#chains in the Genus database with same CATH homology
 5AJ3 K;  4DV2 K;  1XMO K;  1HNZ K;  4X64 K;  4CVN E;  4JI7 K;  1N33 K;  4LF5 K;  4DR5 K;  4JYA K;  4LFA K;  4GKK K;  4DV1 K;  2UXB K;  2F4V K;  4LF4 K;  4DUY K;  4YHH K;  4LFC K;  4V19 S;  4JI8 K;  4JV5 K;  4B3S K;  4JI0 K;  4LF9 K;  5BR8 K;  5IT9 O;  4DR3 K;  4CW7 B;  4JI3 K;  4DR6 K;  2VQF K;  4DV0 K;  4DV3 K;  2UXC K;  4DV7 K;  4X66 K;  2UUA K;  5FLX O;  4DR1 K;  4X62 K;  5LMN K;  4DR2 K;  4OX9 K;  2UUB K;  3T1H K;  3J7A P;  4DV5 K;  4DR7 K;  4JI1 K;  4KHP K;  2UXD K;  4JI6 K;  3OTO K;  1IBM K;  5LMU K;  1XNR K;  4YY3 K;  1IBL K;  3JAM O;  4B3M K;  1FJG K;  4GKJ K;  1XNQ K;  2VQE K;  2E5L K;  4JI5 K;  4K0K K;  4B3T K;  1XMQ K;  4LF8 K;  2UU9 K;  1HNW K;  1N36 K;  4JI4 K;  4DV4 K;  4AQY K;  2HHH K;  3J7Y P;  4NXM K;  3J81 O;  4JI2 K;  1IBK K;  4LFB K;  1N32 K;  3J80 O;  4DR4 K;  5IWA K;  4DV6 K;  5LL6 Z;  1N34 K;  4DUZ K;  2ZM6 K;  4NXN K;  2UUC K;  3T1Y K;  1HNX K;  1HR0 K;  4X65 K;  5A2Q O;  1J5E K;  4LF6 K;  4B3R K;  1I94 K;  4LF7 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...