1VSFA

Asv integrase core domain with mn(ii) cofactor and hepes ligand, high mg concentration form
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
146
structure length
146
Chain Sequence
GLGPLQIWQTDFTLEPRMAPRSWLAVTVDTASSAIVVTQHGRVTSVAAQHHWATAIAVLGRPKAIKTDNGSCFTSKSTREWLARWGIAHTTGIPGNSQGQAMVERANRLLKDKIRVLAEGDGFMKRIPTSKQGELLAKAMYALNHF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endoribonuclease
molecule keywords INTEGRASE
publication title The catalytic domain of avian sarcoma virus integrase: conformation of the active-site residues in the presence of divalent cations.
pubmed doi rcsb
source organism Rous sarcoma virus (strain schmidt-ruppin)
total genus 51
structure length 146
sequence length 146
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1995-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1vsfA00
3NF8A 4DTRA 3HP9A 4FZZA 3K5LA 5FROA 3F9KA 3K58A 3PX4A 4Z4GA 1TKZA 3AO4A 4DFPA 1TK5A 4CHOA 1IG9A 1RNHA 4FK0A 1YTUA 1CXQA 3ITHA 3NGYA 4M45A 4AHSA 2X74A 2QKKA 4FVMA 1SV5A 5J2NA 1BI4A 3OJSA 3V4IA 3KTQA 1VSJA 2VG7A 1BIZA 1A5XA 1S9EA 1JLQA 3HVTA 5T7BA 5J2QA 4ZHRA 4CFBA 1VSIA 1VSFA 3ZSYA 1L5UA 1U49A 3K5NA 4J2DA 3U3YA 2O4IA 2VG5A 1LV5A 3K5MA 2RF2A 3SUOA 2HHSA 1WSEA 2I5JA 4FK4A 3NE6A 1Y97A 1C1CA 3KLEA 2ZQBA 4XIUA 3LAMA 3CFPA 4HTUA 1FKOA 3V6DA 2OZMA 1QHTA 3VQPA 4FM0A 1KCFA 3PO5A 1RBVA 3AO1A 4HVJA 4E1NA 4NCAA 1K6YA 4FJMA 3NF6A 2QK9A 4JRPA 4NYNA 1KVAA 1IKXA 4OGCA 2HNDA 1KRPA 3CM5A 4I2PA 1RTJA 3AVLA 4FLYA 2D0BA 1TKDA 2WOMA 4FLVA 2PY5A 1JKHA 1KVCA 2RPIA 4FJHA 3SI6A 3V9WA 4O0JA 3T19A 4DF8A 4H8KA 3CG7A 1TV6A 3QNOA 4CEDA 4OKKA 4JRQA 4B8CA 1ZBLA 1NOYA 1BCMA 4C8MA 3SCXA 3VQ9A 3VQ5A 3EYZA 4DF4A 3RR7A 3DLEA 3L8BA 4F2RA 4CERA 1J5OA 4RW7A 3G10A 2KFNA 1U4BA 4KO0A 4E89A 3HK2A 3PX0A 4ZTJA 3OY9A 3MXMA 1LAVA 3T3FA 4K8ZA 1NK6A 4ID1A 3TAQA 4F2SA 4KRFA 3M8RA 3HYFA 4CGFA 3VN5A 4CK2A 4DTOA 3RMCA 4Z4FA 1BQMA 3H08A 2OA8A 1WNSA 4AHRA 3OJUA 3ZSQA 4FLXA 2E6MA 5FDLA 3NH0A 4GMJB 1HRHA 4N56A 1QQCA 4E7IA 1L3TA 2E4LA 4FM1A 1D8YA 3SQ4A 4CJUA 5SZTA 4DWIA 4RG8A 1U04A 4I2QA 4CEAA 1O1WA 4PWDA 4YFUA 1I3AA 4O44A 1IKYA 3L3UA 3NHGA 4FJ8A 1QSSA 4M3XA 3EY1A 3ZT3A 1WAJA 4KTQA 3VQ6A 1ZBIA 1RILA 3NH1A 2HHXA 4HUFA 3RMAA 5HLFA 4OLBA 4C8KA 3SV4A 4W5TA 2HW3A 4M3WA 4CHYA 1NJZA 1HYZA 4E7KA 3QEXA 5J1EA 4Z4EA 3OYHA 3KKRA 1TKXA 2IDOA 2O4GA 5KTQA 3LWMA 3PY8A 4FZXC 4CJ5A 1UA1A 1HYVA 2BE2A 3DOKA 5K14A 1YTAA 1TAQA 3FFIA 1Q8IA 4IDKA 1RT3A 1LWCA 4BDYA 2BANA 3M8PA 3NH2A 2KFZA 4BWMA 4FJGA 5HRPA 1JXBA 4CF8A 4DTUA 2X6SA 1JLCA 1F21A 3DLKA 4KHQA 3HJFA 4DTXA 4LH4A 2YKMA 3AVGA 4Z4CA 1X1PA 5D3GA 4KREA 5KI6A 3VQDA 3TABA 1X9MA 1RDCA 3WNHA 1VRUA 3RTVA 3PX6A 1VSHA 3LWLA 3HVRA 4FJ9A 4E3SA 1UA0A 3LPTA 4CJLA 4B9UA 4W5NA 4WE1A 1RT4A 2HHQA 3M8QA 3NF9A 4CEOA 3DLGA 1HQUA 2P5GA 4E7LA 2LSNA 3B6OA 1BI4B 1NK0A 4FJ5A 1C1BA 4DU4A 3ZSZA 2X78A 4J2BA 2OZSA 2AJQA 4I9LA 1VRTA 4C8OA 1T7PA 3QIPA 4CJVA 1WLJA 1J9AA 4CJRA 5J2PA 2DFFA 3QO9A 2G8HA 3AVNA 3KLGA 4HCBA 3ASMA 1NJYA 1FXXA 4CEEA 4TSXA 1RT2A 1ASWA 4OGEA 4CJFA 3L2UA 1L3VA 3AA5X 3RWUA 5KRSA 1QSYA 3G0ZA 3NFAA 3ZSWA 1JLAA 1S1VA 3QERA 4FJ7A 3O4QA 1TL3A 4DU1A 3SQ2A 4KB1A 4E1MA 2HHTA 3C6TA 3TAMA 4CEFA 1VSMA 3E01A 4HCCA 5I3UA 1L3SA 3I8DA 3JSMA 4F3OA 5KGWA 4DSKA 2KTQA 4JS4A 4FLTA 1RDAA 3ZSRA 4DQSA 1U47A 4DMNA 4DSJA 1CZBA 3NF7A 4KTZA 4N5SA 4NCBA 2FBYA 5HBMA 3OYEA 4DLEA 4FM2A 4PUOA 3S9HA 4CF0A 3BGRA 1S1XA 4BWJA 4I7FA 2XY8A 4CGDA 2ZD1A 1XHZA 1WAFA 3A2FA 4CJPA 1BIUA 4KHWA 5DMRA 4E7HA 2VWKA 2ZE2A 4F4KA 4AH9A 4DTJA 4O0IA 4B08A 3WNEA 4DS4A 2XY7A 3LDSA 3VQAA 4B9SA 2FBVA 2KZZA 5CY4A 3KLHA 1UOCA 4N76A 1D9DA 2YHBA 4M3ZA 3BDPA 3DI6A 3CM6A 1RT1A 1SL1A 3SUQA 4JLHA 4KAZA 1HJRA 4DLGA 3TARA 3ZCMA 5HRNA 3NGZA 1SKWA 4EZ9A 4O4GA 1HPZA 2A1RA 4CJ4A 3O3HA 1ASUA 4CGJA 4E19A 4UQGA 1EXQA 5CYQA 2GBZA 3LP0A 1S1UA 3AVFA 4BE0A 4B8AB 2DFEA 4KV8A 2OYQA 1D5AA 2JGUA 5C25A 1VSKA 1J53A 3VQ4A 1EX4A 2Q3SA 4J2AA 4K8XA 4RW4A 1VK0A 4B3OA 1REVA 1W0HA 4PY5A 3IRXA 4Z4HA 3DRSA 3M8SA 3KIOA 3SQ1A 4CJEA 2YHAA 3AVAA 2EHGA 4EP5A 3DLHA 4DQIA 3OYKA 3WNFA 1ZBHA 1B92A 3P83D 3MEEA 4Z0UA 3VQEA 4EP4A 2Z1HA 2YNFA 3NCIA 1DTQA 3P5JA 4OPKA 4EZ6A 4KHSA 4I9QA 4RW6A 4FZYA 3HT3A 3TI0A 3VQ7A 1C0UA 3TAGA 1ZBUA 2KZMA 1EKEA 2B5JA 3V9XA 3VA0A 1QTMA 1UAXA 4QCLA 5HP1A 1ZYQA 3DLRA 4CF2A 2G8FA 4CK1A 3OYAA 3NDKA 1SL2A 4E0DA 4FJJA 4DU3A 2HVIA 3DYAA 5I42A 5EU7A 3TAFA 2IOCA 1JLGA 3SPYA 3SNNA 1QSLA 4B9LA 4CGHA 4AILC 2PZSA 1I39A 1S1TA 1VSLA 3RRGA 4DQPA 3KD5E 4FLUA 5J2MA 3ZSXA 1NK5A 4YNQA 3DLBA 3VQCA 3LZIA 4M3UA 1YVUA 3IAYA 5KGXA 2PYLA 1RDBA 2IC3A 4DSLA 4GW6A 3MEGA 4C8NA 4CEQA 4JS5A 3RRHA 4W5QA 4M3YA 3HO1A 4IG3A 5KRTA 3PV8A 1ASVA 4KHNA 3I0RA 1WSHA 3RMBA 4M3TA 2IGIA 3KK1A 3L2WA 1BL3A 1B9DA 2EX3A 3D0PA 1C6VA 4FLZA 4F3TA 1NK8A 3NGIA 4QAGA 4CHQA 3PO4A 4AHTA 2YKNA 4CJTA 4KHUA 2D0CA 3ZSVA 1GOBA 2B6AA 1RBRA 3AO3A 1SL0A 2QKBA 2HNZA 3C6UA 2F8SA 1NK9A 1GOAA 3AVIA 1YT3A 4KKOA 4CGIA 3ULDA 5C42A 3HL8A 4W5RA 4ELTA 2R7YA 3OYDA 3C94A 1G15A 4OKEA 1U48A 4CIEA 3RR8A 1EP4A 3LANA 1Q9XA 4M41A 3V1OA 3QEVA 2XY5A 4B9TA 1HMVA 4CCHA 1DLOA 3AVKA 1WSIA 1HNIA 1TVRA 3LP1A 4ELVA 1TAUA 3K59A 4CJSA 1JLBA 2RKIA 3HSTB 2PYJA 3OYIA 2GV9A 1LWFA 3KKSA 1UWBA 1IKWA 1BGXT 2OPRA 3ZT1A 3K57A 3UIQA 2Z1IA 1N5YA 4LY7A 3OYJA 3NBPA 4NYFA 3V1QA 4CHNA 2RN2A 1RT6A 3SZ2A 2HHVA 3KJVA 4KB0A 2YNGA 3OVNA 4MQ3A 3QLHA 4Y1CA 3KLFA 2P5OA 4MFBA 4KPYA 2G8VA 3TANA 3K2PA 2G8UA 3V1RA 1C0MA 3KLIA 3U3GA 4CFDA 3NAEA 4ELUA 4FJXA 2YNHA 4PA1A 3ZT2A 2QXFA 3OYBA 1KLMA 2D5RA 1CLQA 2Y1IA 1HNVA 1IO2A 4BE2A 1X9SA 1TK0A 4E7JA 4CHZA 3V9ZA 1XI1A 1TKTA 3DRRA 2DFHA 4DTPA 3IG1A 3LP2A 3AVMA 3MXJA 1NK7A 3SUPA 4IFYA 4Q5VA 2VWJA 4DG1A 4FYDA 1QS4A 4OKJA 4CECA 3IS9A 2HHWA 4KFBA 4FCYA 1BCOA 3S3OA 2ETJA 4CJQA 3VQ8A 4OLAA 5JS1A 2P51A 4IG0A 1RTDA 3QNNA 4IKFA 1TL1A 1FKPA 4CIGA 3O3FA 3JYTA 4Q0BA 3AVHA 1RBSA 3CFOA 4BE1A 4ZTFA 3HPOA 2XY6A 4DQRA 3TAEA 1DTTA 4FW1A 1NJWA 3V9UA 1RBTA 2W42A 4DTNA 3AO5A 2FC0A 3VQQA 4FJIA 1NKCA 1A5VA 3S3MA 3LAKA 3D45A 2F96A 2FBTA 2GUIA 2HNYA 1CZ9A 2VG6A 3AA3A 4FW2A 4AHUA 4C8LA 4N41A 2JLEA 2OPQA 4AHVA 4FJNA 1ITGA 2XO7A 3SQ0A 1S9GA 1JL2A 1XC9A 2P1JA 1NOZA 5E41A 4CF9A 3EZ5A 3B6PA 1LWEA 4M3RA 2ITGA 2B4JA 5JS2A 1HYSA 2BGGA 1VSEA 2HVHA 3TAPA 1EETA 3K5OA 4CEZA 3SPZA 1TK8A 1RCHA 2G8IA 2OPSA 2FBXA 4FXDA 3ALYA 1S1WA 1A5WA 3VQBA 1NKEA 1SKRA 1JLEA 2D0AA 3OYMA 4Y1DA 1Z25A 2YNIA 3I0SA 3OS0A 3SV3A 1C1AA 1NK4A 4FJKA 1RBUA 3L3VA 1R0AA 4QOZB 1IH7A 4BDZA 4CE9A 3F73A 1MU2A 1ZBFA 3VA3A 4IFVA 3S3NA 4RW8A 3OS1A 1KSPA 5HRRA 4BDPA 4O55A 1Z26A 5C24A 3TR8A 3OYNA 4LSNA 4AHCA 4G1QA 4FJLA 2Z1JA 1N6QA 4CEBA 4L8RB 3QEIA 3HM9A 4ID5A 3PUFA 1L3UA 4HUEA 3DRPA 3KK2A 1LW0A 2YV0X 4CJWA 1WSGA 3QETA 3QIOA 4R5PA 1RDDA 3L2QA 1SKSA 2OPPA 3LPUA 1JLFA 5CYMA 4KHYA 4PQUA 1KTQA 3OYFA 3CQ8A 4DFJA 3HPHA 3HP6A 3OYLA 4B9MA 3QEPA 1WN7A 4CK3A 2NUBA 3AA2A 1C0TA 3OS2A 3KD1E 2X6NA 1XHXA 2ATQA 3ISNC 4FK2A 3AA4A 1T03A 3MEDA 1W9HA 3RMDA 2HMIA 3QINA 3OYGA 4DFMA 3U6FA 4J2EA 1WSFA 3AVBA 5CZ2A 4KTWA 1SUQA 3TWHA 3T1AA 3O4NA 4CIFA 3V9SA 4B9NA 1FK9A 4OJRA 1VSDA 4B9VA 5HRSA 3L2VA 4KI6A 3LZJA 1BHLA 4DS5A 1JL1A 1RT5A 4IBNA 4H4OA 4DSEA 3THVA 3QEWA 3P1GA 5DK5A 1B9FA 1KVBA 4KI4A 3LALA 2F8TA 1NJXA 3MECA 3CFRA 5HROA 2G8KA 1S6PA 2XRIA 1HQEA 2XHBA 3DOLA 5FRMA 1T05A 3MXIA 4HUGA 4W5OA 3L2RA 1S5JA 4RW9A 2KW4A 3MAQA 4BACA 2Y1JA 3LP3A 4DQQA 2E6LA 1T8EA 2HHUA 3SJJA 3ZT0A 2IAJA 4CESA 3KK3A 1NKBA 1Q9YA 3DMJA 5FRNA 2DY4A 3AO2A 1QE1A 1WSJA 1S6QA 4CFAA 4N47A 4HHTA 1KFDA 4LD0A 3AVJA 4OVLA 3OYCA 4M42A 3CYMA 1LW2A 4DTSA 3AV9A 2KQ2A 3HPGA 4DSIA 4OPJA 1BQNA 4O5BA 1J54A 2A1SA 1RTHA 2IS3A 4DSFA 4H4MA 3ZSOA 4CJKA 3QESA 4CJ3A 2DTUA 4DTMA 4ICLA 1LAWA 5CZ1A 3ZT4A 3O3GA 1X9WA 1D9FA 4CHPA 1IKVA 1KLNA 2BDPA 3WNGA 4DFKA 1TGOA 4CF1A 4CGGA 3V81A 3SYZA 2G8WA 1BISA 2Z1GA 4NCGA 4GVMA 1KFSA 5SWMA 3SUNA 2WONA 4LH5A 1RT7A 4CFCA 3AVCA 1GOCA 3DM2A 4LSLA 1JXEA 4FLWA 1RTIA 3C95A 4Z4IA 1CXUA 1XWLA 1U45A 4F8RA 2HB5A 3HXMA
chains in the Genus database with same CATH superfamily
4DTRA 5FROA 3PX4A 1YTUA 4FK0A 3FZHA 4AHSA 4FVMA 3KTQA 2VG7A 5AFUH 3Q7CA 3FFKB 3HZ6A 3M5RA 4H5RA 4ZHRA 1HR0K 3BY5A 3CF5L 3U3YA 2O4IA 4U67L 2RF2A 2I5JA 2NRTA 4FK4A 3KLEA 1C1CA 2ZQBA 3IKMA 3CFPA 3O08A 2D0OA 1KCFA 1K9MO 2GWJA 4HVJA 4E1NA 2QK9A 3O80A 2BUPA 2ZJRL 4OGCA 5FPMA 2HNDA 5M1QA 3VGKA 3CCMN 1NGFA 4I2PA 3VERA 1Z6RA 4FLYA 1TKDA 1NGIA 2V51B 1KVCA 3R8EA 3CG7A 4BG8A 3QNOA 2HBMA 3E9OA 1ZBLA 3MCPA 3EYZA 4FWLA 4F2RA 3DLEA 3L8BA 5M1OA 2QWRA 4CERA 1OH8A 4E89A 3OY9A 3TAQA 4KRFA 1Q7YO 4YOYA 2A41A 4DR5K 3DAWA 3OJUA 3ZSQA 2E6MA 4O8KA 1ESVA 4JHDA 4FM1A 4DWIA 1HUXA 1U04A 4I2QA 4CEAA 1O1WA 4BQZA 3AARA 4M3XA 4FJ8A 3HI0A 4G9ZA 3HSCA 3NH1A 2HHXA 3RMAA 5HLFA 4OLBA 4YDUA 2HW3A 1HYZA 4BRPA 5KTQA 3PY8A 4CJ5A 1UA1A 4K42A 1YTAA 3FFIA 4IDKA 1IJJA 3EKSA 5HRPA 1G99A 1JLCA 4Z4CA 1X1PA 3CHWA 4KREA 1X9MA 1VRUA 5C15A 2GTDA 4LF5K 4WE1A 4DCHA 1RT4A 3H6EA 4M7YA 2P5GA 3DLLL 2LSNA 2IVNA 4CW7B 4DU4A 4J2BA 3EE9A 5KQDA 1WLJA 5J2PA 4B3MK 4JI1K 5BPLA 3PIPL 4EAHD 4HCBA 4CJFA 3L2UA 1RT2A 3AA5X 5KRSA 5LY3A 1TL3A 3BEXA 3C6TA 1VSMA 4HCCA 3KWGA 4F3OA 3JSMA 4CJ7A 4LC9B 1RDAA 3ZSRA 1U47A 4YY3K 4DSJA 4KTZA 4PUOA 4NCBA 3KK7A 2UXCK 4LF8K 3A2FA 4F4KA 4AH9A 4DTJA 2A3ZA 4YHHK 1NJIO 4O8UA 2QI2A 4DV1K 1UOCA 3BDPA 3CM6A 1RT1A 1SL1A 1P8ZA 3SUQA 1HJRA 3P31A 1SKWA 5AQXA 1HPZA 2A1RA 3R1XA 1KC8O 4E19A 3DXMA 3A8YA 5LJVA 3THXB 1T6DA 2Q97A 4JI3K 5GIOA 1J53A 3VQ4A 1VQ9N 4JK9A 1JCGA 4B3OA 5EVZA 3IRXA 4GV6A 2D4WA 2KLAA 2EHGA 3P83D 4EP4A 4A61A 4I9QA 1NMDA 3TI0A 3TAGA 1C0UA 2KZMA 1ZBUA 1EKEA 3W0LA 5HP1A 4JKGB 2G8FA 4JI4K 3OYAA 2HVIA 3DYAA 4WCEL 1QSLA 4NLCA 4B9LA 4CZLA 4MO4A 1I39A 1VSLA 2NRVA 5B8HA 4FLUA 3VPZA 3ZSXA 3D2FB 3ZLJA 3DLBA 3FZFA 3LZIA 1YVUA 2PYLA 4M3YA 3J7AP 5JMVA 4BRDA 4BC3A 4IG3A 3PV8A 1ASVA 3I0RA 1YI2N 2IGIA 4DV6K 1C6VA 4M7XA 5KPTA 4BGAA 1VAZA 4CJTA 1XMOK 3ZSVA 2UUAK 2QKBA 1RBRA 3ULDA 3OYDA 2FSNA 3C94A 1G15A 1YXQA 4FWOA 4NB4A 1U48A 3LANA 3QEVA 2XY5A 1ATSA 5EX5A 1DLOA 4B3TK 1BO5O 1QZ5A 3NMUA 4CJSA 3RSEB 3KKSA 1IKWA 1BGXT 4JK8A 4CZEA 2Z1IA 2FSJA 3NBPA 4CHNA 3OBYA 3SZ2A 1RT6A 2Q1NA 3ZEUB 4KB0A 2P5OA 3CCSN 3K2PA 2E1YA 3KLIA 3NAEA 4FJXA 3FZLA 4PA1A 1GLCG 2QXFA 1KLMA 1WUAA 2Y1IA 1HNVA 4BE2A 2E2QA 2YJEA 3THYB 1TK0A 4E7JA 3VGMA 4CHZA 1XI1A 3ENHA 3T1YK 4GVEA 3LM2A 3LP2A 4CZIA 4U7BA 5TKYA 1D4XA 3SUPA 3IFRA 2VWJA 4DG1A 4IXCA 3O9TA 2HHWA 4FCYA 1BCOA 1QVFM 3QNNA 5AQOA 2FF3B 3QBWA 3HPOA 4DQRA 4FW1A 4WQ5A 1XNQK 2BH1A 2W42A 4DTNA 4AF1A 3P38A 2FC0A 3KVGA 5AZJA 3D45A 3I56N 1VQMN 2HNYA 1CZ9A 1JCFA 2JLEA 4AHVA 3A5OC 1ITGA 1S9GA 1JL2A 4B1XB 4B1ZA 1NOZA 3CCEN 4M3RA 2ITGA 1RDUA 2YJFA 3K5OA 3ZYYX 2OPSA 1MWKA 1S1WA 4JKEA 3WEEA 1I94K 3VQBA 4PHTX 3ZX0A 1YIJN 1QZ6A 1OH6A 1R0AA 4GNIA 1IH7A 4BR9A 4BDZA 1GLEG 2UXDK 3F73A 1ZBFA 4BDPA 3UKRA 2OTJN 4FWPA 3TR8A 4LSNA 2ZM6K 2PFUA 5AQKA 4QS7A 4L8RB 3LDPA 4ID5A 5EXWA 2YV0X 3I8BA 4R5PA 1SKSA 2OPPA 3HPHA 4B9MA 1NGGA 3KD1E 3EL2A 2ATQA 3ISNC 4FK2A 4AM6A 3CCQN 2GELA 1VQNN 2P9SB 3TWHA 3T1AA 4CZKA 1WOQA 4DV2K 4OJRA 4B9NA 1HKGA 1JL1A 4IBNA 4H4OA 4JKFA 1RGIA 5FPEA 3WXKA 1QHAA 4A59A 2O8DB 5HROA 1IBKK 2E20A 3O1WA 4WQ4C 2ASOA 4PL8A 3RWUA 4JI5K 2Y1JA 2HHUA 4H0VB 3SJJA 4CESA 3C7NB 1KQSM 3M3ZA 5CHIA 3VF2A 3AO2A 3GG4A 4CFAA 4N47A 1KFDA 4H0OA 4BG9A 3OYCA 5AQUA 1E4FT 2FF6A 3AV9A 4DR3K 1BA1A 1YAGA 2A1SA 2IS3A 5FPDA 4CJ3A 3BF1A 4ICLA 1LAWA 5CZ1A 3CJ7A 2P9LB 3O4WA 4CVNE 2BDPA 3WNGA 4DFKA 2QWPA 4A62A 4A2AA 2Z1GA 4NCGA 2F7TA 3AVCA 4LSLA 1JXEA 2YHWA 1XWLA 1U45A 2HB5A 3NF8A 4FZZA 3K58A 4C23A 4XH5A 3JXUA 1CXQA 4M45A 3LDNA 2X74A 3J7ZO 4JK7A 4JI0K 4A5BA 1JLQA 4A2BA 5T7BA 1BDGA 1VSIA 1VSFA 3J8AA 4J2DA 2V7ZA 2V52B 3SUOA 1LCUA 3KHYA 3PIOL 3HBTA 3L4QA 1YUWA 3VQPA 3AO1A 4KBOA 1J6ZA 3MX2A 4B9QA 3NF6A 4JI6K 3G4SN 1K73O 5IWAK 2O8EB 4FLVA 2PY5A 5AQRA 4FJHA 3SI6A 4DF8A 1YJWN 3QBXA 1BCMA 3FR0A 4O5FA 4C8MA 3SCXA 3VQ5A 4JD2A 3T1HK 4RW7A 3ULEB 2FSKA 3HK2A 3PX0A 4ZTJA 1LAVA 3T3FA 4X64K 4K8ZA 4ID1A 4F2SA 4JKAA 3M8RA 4K41A 4CGFA 3VN5A 5M1NA 3I55N 4DTOA 4BRFA 1BQMA 1WNSA 4JI7K 1HNXK 5EOYA 3NH0A 1L3TA 1D8YA 3P39A 5AQNA 3G6EN 3NHGA 3L3UA 4DR7K 2HOEA 1U6ZA 5BN9A 5BREA 2A5XA 3ZT3A 1WAJA 3VQ6A 4HUFA 4CHYA 1NJZA 1NGEA 4E7KA 4GV3A 1TKXA 4HTLA 3CCLN 5GADP 5AZIA 2BE2A 3O9UA 5K14A 4X65K 1Q8IA 1RT3A 1LWCA 3O9QA 2BANA 1MA9B 3VETA 4BDYA 3NH2A 4CF8A 3WXLA 1F21A 4QS9A 3WXIA 4LF6K 2WC9A 1RDCA 3WNHA 1W97L 3D2EA 1UA0A 3LPTA 4B9UA 4W5NA 4FO0A 3M8QA 2QWMA 4CEOA 3DLGA 5AQWA 1WBDA 4H0YB 3AGRA 2X78A 1KXPA 4FWQA 3VF6A 3QIPA 4CJVA 2KHOA 1J9AA 3OHRA 2DFFA 3QO9A 5AJ3K 4MDAA 3AVNA 3KLGA 3FZMA 4CEEA 3O1BA 1L3VA 4LFAK 3JAMO 4JKHA 3G0ZA 3ZSWA 2V7YA 4BC2A 3QERA 2UUCK 3O4QA 4DU1A 4WFNL 4IO9L 2UYTA 3TAMA 1L3SA 4DQSA 4XEIA 5FPNA 4DLEA 5HBMA 3OYEA 4BWJA 4CGDA 4I7FA 4EHTA 1XHZA 1WAFA 5DMRA 4B08A 3WNEA 3H1QA 4N76A 2Q36A 4CD1A 4JLHA 1E4GT 3PSIA 3MMVA 2CH5A 3TARA 2IVOA 4EZ9A 4GKJK 4NXMK 1EXQA 2GBZA 4CZJA 3AVFA 4OPAA 4B8AB 2AA4A 2DFEA 2WBNA 1D5AA 5C25A 1VSKA 2NRHA 3B8AX 3K0SA 4K8XA 4RW4A 4JHDB 5BPNA 3M8SA 5GAHP 3SQ1A 3LDOA 4CJEA 2YHAA 4RCHA 5JLHA 3CQYA 3DLHA 5HL7L 4DQIA 1B92A 3E9LA 2Z1HA 2YNFA 4EZ6A 4OPKA 2JWKA 1DEJA 5M1KA 2B5JA 3VA0A 1HLUA 1UAXA 1ZYQA 3DLRA 3RVCA 1ILYA 1SL2A 1MWMA 1NM1A 4DU3A 5ELZA 5EU7A 2IOCA 1JLGA 4YORA 2Q2RA 4CGHA 4B1VA 3CJAA 2PZSA 3ZETA 3RRGA 5J2MA 3C6AA 1OVYA 3GL1A 4Z94A 4M3UA 4WF9L 5BRDA 5C2DA 1C0FA 5KGXA 4DSLA 1O13A 3RRHA 2ASPA 1WSHA 4KHPK 4FLZA 2F9TA 2PAVA 5AQHA 3GDQA 4QAGA 3VTHA 4BR5A 3NGIA 4KHUA 2D0CA 4DR6K 2HNZA 3C6UA 2F8SA 4KKOA 3AAQA 5C42A 3HL8A 1M90O 4ELTA 5C0YA 4OKEA 1Q9XA 4B9TA 1WSIA 1TVRA 3PLAA 4IDHA 3K59A 3DWLA 2RKIA 3HSTB 1NU0A 3OYIA 3HO1A 1LWFA 3ZT1A 1KAZA 1BU6O 2OPRA 3K57A 1N5YA 4LY7A 4V19S 4PKHA 3V1QA 3TTFA 3KJVA 2YNGA 4MQ3A 1S72N 3QLHA 4MFBA 2O8FA 4FPBA 2G8UA 3BZKA 1TUUA 3OYBA 2D5RA 4FPAA 2JWLA 4KH6A 2YX6A 3EN9A 4MLEA 3SLCA 2QEXN 1Z05A 4FOIA 3VQ8A 3DXMB 1TL1A 1FKPA 4YOXA 3L4IA 4JI8K 1RBSA 2ASMA 5AR0A 2XY6A 5C2FA 5AFUA 5LMUK 1NJWA 4A57A 3AO5A 4FJIA 2Q0RA 3KZBA 1NKCA 1A5VA 3LAKA 3D7EO 4AM7A 2FBTA 4CZMA 2GUIA 4FW2A 4B3SK 4N41A 4AHUA 4C8LA 1N36K 4FJNA 2Q31A 3CCRN 1XC9A 5LJWA 2WUSA 3CJ9A 3EE8A 4CF9A 3EZ5A 3CQXA 5JS2A 1HYSA 3WQUA 1EETA 1BWFO 4CEZA 3SPZA 1TK8A 1RCHA 2G8IA 4IJAA 1A5WA 1SKRA 4Y1DA 1Z25A 3I0SA 4FJKA 3L3VA 4CE9A 3VOVA 2HHTA 4C8KA 1V4SA 3S3NA 4RW8A 4O55A 3VEOA 2OANA 2Z1JA 5JLFA 3TPQA 5A2QO 1NGCA 3GOIA 5ADXH 3DRPA 5C12A 4CJWA 5DM7L 3QETA 1RDDA 4PQUA 5CYMA 3HP6A 1EQYA 3QEPA 1VQKN 4CK3A 1C0TA 3ZX3A 1XHXA 2X6NA 2HMIA 4J2EA 4DFMA 2NLXA 5CZ2A 4KTWA 4JKCA 3TSPA 4CIFA 1FK9A 4B9VA 3LZJA 1BHLA 1FJGK 3THVA 2O8CA 4DHYA 2HF4A 5DK5A 4KI4A 1NJXA 3CFRA 4IEEA 2XHBA 1T05A 4HUGA 4FWSA 2KW4A 3ZT0A 3KK3A 4AQYK 4H0PA 2YHXA 5FRNA 2DY4A 1S6QA 2P9IA 4HHTA 4IFEA 3EZWA 5GAEP 4X66K 3N4QA 1BA0A 3HPGA 4JV5K 4OPJA 2A42A 1Q82O 1J54A 2UU9K 1NLVA 4H4MA 2DTUA 4DTMA 1WBBA 5JVGL 4LFCK 2P9UA 1D9FA 1GLJO 3MX5A 5AZJB 4CF1A 3DXKB 4JAXA 4GVMA 1N34K 4LH5A 1GOCA 3DM2A 3C95A 1HJOA 5KPRA 3CC2N 4E1JA 4Z4GA 3AO4A 1TK5A 3VEWA 4CHOA 1RNHA 3NGYA 1NGJA 5J2NA 1BI4A 3OJSA 3V4IA 3T69A 3A5MC 3WEEB 3O8MA 3DXKA 1BIZA 1QQOA 2DPNA 3HVTA 4DUZK 4BRNA 1VQ8N 2VG5A 3UKRB 3UB5A 3K5MA 3WXMB 2HHSA 5AQMA 1WSEA 3CCVN 1Y97A 3V6DA 4XIUA 3LAMA 1T44A 5JICA 4HTUA 1QHTA 3VGLA 4FM0A 2IVPA 1XNRK 1K6YA 4CBWA 2VGMA 4RTFD 4JRPA 1IKXA 2P9KA 2P9NA 4A5AA 2CGJA 3CM5A 1RTJA 3AVLA 2D0BA 4C1NI 4MO5A 2WOMA 4BVOA 2RPIA 3V9WA 3DJCA 4O0JA 3T19A 1X9JA 1T6CA 1TV6A 4CEDA 4OKKA 4JRQA 1NOYA 2E8AA 2KFNA 1J5OA 3G10A 1U4BA 3MWTA 3BZCA 2RHKA 1YJNN 1NK6A 3QFPA 1IV0A 1XUPO 2I7PA 3AY9A 3SMPA 3VEVA 3HYFA 3PSFA 4Z4FA 3H08A 2VCPA 2OA8A 5MLCQ 4YOUA 1NGDA 3G71N 2FXUA 3UE5A 5GINA 4GMJB 1HRHA 1QQCA 3SQ4A 4CJUA 5SZTA 4H5NA 5F2RA 4EFHA 4PWDA 4YFUA 4O44A 1M1KO 4H03B 1QSSA 3EY1A 2F4VK 3VESA 2W41A 1ZBIA 1GLFO 3I33A 1RILA 3CCUN 1BG3A 3SV4A 4W5TA 2OTLN 3OYHA 3KKRA 2IDOA 4FZXC 5F0XA 3LWMA 1EWQA 1HYVA 4FL9A 3FE1A 2WFBA 4R79A 3M8PA 2KFZA 4BWMA 4FJGA 1JXBA 4DTUA 2F9WA 2X6SA 1VQLN 3DLKA 4DTXA 4LH4A 1IBLK 1K8AO 1HNZK 1TYQA 2Q0UA 3TABA 4X62K 3RTVA 3PX6A 1VSHA 3LWLA 3HVRA 4FJ9A 4UY8O 2W6KA 3M6GA 4BR2A 2HHQA 3H46O 4H0TB 5AQSA 4GY2B 1HQUA 1VQON 5LL6Z 3B6OA 1OH7A 1U2VA 4I9LA 1VRTA 4C8OA 1T7PA 4B1UB 2G8HA 5BR9A 3A5NC 2QWQA 2HF3A 4TSXA 4OGEA 1QSYA 3NFAA 3E9PA 1JLAA 1S1VA 3C65A 4KB1A 4E1MA 3SMSA 5GAGP 3I8DA 4ISGA 3VENA 4DSKA 4JS4A 2KKZA 4FLTA 4DMNA 3NF7A 4N5SA 1K8KA 4NLBA 4CF0A 3CPEA 1S1XA 2XY8A 2ZD1A 3Q7BA 1BIUA 4E7HA 1E3MA 3K9JA 2ZE2A 3A5LC 2XY7A 3VQAA 4B9SA 4XH1A 5BN8A 2KZZA 1QVGM 4DB3A 3KLHA 3OBWA 3QICA 4M3ZA 4JD2B 3DI6A 2VQEK 4KAZA 4DLGA 3NGZA 5HRNA 2P9PB 2IIRA 3UKUA 4JNEA 3LDQA 4CGJA 5CYQA 1S1UA 2OYQA 2JGUA 3FGUA 2AP1A 1EX4A 4B1YB 4FVUA 5IT9O 4J2AA 1GLAG 4BVPA 3QB0A 1W0HA 4BRAA 5JVHL 2D1KA 4IJNA 3OYKA 3WNFA 2P9PA 3VQEA 4Z0UA 3NCIA 1DTQA 2J4RA 4KHSA 1SQKA 3MN9A 3HT3A 3CJ1A 3V9XA 5GIPA 4CK1A 3NDKA 3NVMA 3CPWM 5AZIB 3TAFA 4BRMA 3MN7A 3SPYA 5I42A 3MK6A 1VQ5N 3FZKA 4DUYK 4DQPA 3KD5E 4ILGB 4YNQA 2QXLA 1NK5A 3VEYA 1OH5A 2NRRA 1RDBA 1NGHA 2IC3A 4GW6A 3THWB 4C8NA 1C0GA 4PL7A 1JJ2M 3OA9A 3D2EB 4ISEA 3RMBA 3KK1A 3L2WA 1BL3A 2ZGYA 3D0PA 1NK8A 3PO4A 3AO3A 3LDLA 5CR4A 5AQVA 1YVNA 1WB9A 4BC5A 2O8BA 1NK9A 1YT3A 3BP8A 5BPMA 1W2BM 3F9MA 3CCJN 3VEXA 3THWA 1HX1A 4M41A 3J7YP 3V1OA 1X3MA 4CCHA 3AVKA 1HNIA 1JLBA 1UWBA 4BY9C 1XQSC 3CERA 4NYFA 3F2KA 3OVNA 3HRGA 4Y1CA 3CMAN 4KPYA 3F5TA 4IWVA 3TANA 3V1RA 1C0MA 1VQ7N 4CFDA 1SS6A 4ELUA 5AQLA 4B1WB 1CLQA 3SJHA 3V9ZA 1KD1O 3DRRA 1N32K 2DFHA 2QWLA 4DTPA 3MXJA 1NK7A 4IFYA 4Q5VA 4F9OA 1CZAN 1HPMA 2WTUA 4OKJA 3IS9A 4KFBA 3S3OA 4IG0A 4IKFA 3CD6N 4CIGA 3JYTA 4K0KK 3AVHA 5E84A 3TAEA 5F1XA 1DTTA 1BUPA 3V9UA 3MWPA 1VQPN 2YHYA 4H5VA 4I6MA 4CBXA 3S3MA 3AA3A 4BR4A 3R9PA 2NRWA 4YOVA 3SQ0A 2P1JA 2E5LK 4DQ8A 4OO1J 2HBJA 1LWEA 4DV0K 3TAPA 2QTDA 4LFBK 4BRGA 1SZ2A 4KH4A 4FXDA 3ALYA 4QS8A 4EIAA 3ZETB 2CH6A 2ZJQL 1QQNA 1NK4A 4IO8A 1RBUA 5AQZA 4CZFA 5KPZA 2W6LA 1KAYA 5E26A 5C24A 3OYNA 4J8FA 1SAZA 3O6WA 2NRZA 4FJLA 3E1YA 1N6QA 3TSQA 4CEBA 3HM9A 4HUEA 3KK2A 5I9EB 1LW0A 3QIOA 4KHYA 3H3OB 4DKWA 2GX9A 3H1VX 3OYLA 4IOXA 3AA2A 3VTIA 2GWKA 1J5EK 1T03A 1W9HA 3QINA 3T7ZA 3U6FA 3AVBA 4YOWA 1OKJA 4H5WA 1VSDA 2ZWHA 4BRKA 5HRSA 1RFQA 4KI6A 1RT5A 2O8FB 3QFUA 3QEWA 2F8TA 2G8KA 1S6PA 2XRIA 4NO7A 3DOLA 5FRMA 3MXIA 3VF4A 4BACA 1T8EA 4JI2K 1KAXA 2E2OA 4DTSA 2CGLA 4BR0A 3G25A 2VYPA 4CJKA 5H1SQ 4BRIA 3ZT4A 3O3GA 1X9WA 3S41A 4CHPA 1IKVA 1DKGD 3HTVA 1YITN 3ENOA 3SYZA 2G8WA 1H1VA 5SWMA 4DR4K 2WONA 1NMNA 1Q86O 4Z4IA 1CXUA 4NXNK 3HP9A 4XH4A 2ZGZA 3K5LA 3F9KA 4CZHA 1TKZA 4DFPA 1IG9A 3IDHA 3ITHA 4EHUA 2QKKA 1SV5A 4GV9A 1VSJA 3O9SA 1S9EA 1A5XA 2E88A 5J2QA 3M1FA 4CFBA 3VEZA 2HMPA 2ITMA 3ZSYA 1L5UA 1U49A 3K5NA 1LV5A 1YF5L 3P4IA 3NE6A 2OZMA 2GUPA 1BOTO 1FKOA 3BF3A 3R6MA 4DV5K 3PO5A 1RBVA 4NCAA 4FJMA 2H3GX 1R59O 3LL3A 5DM6L 4FOEA 3U4LA 4NYNA 1KVAA 1HNWK 1KRPA 1P90A 4WQ4A 1JKHA 1HKCA 2QA4N 2OCEA 4H8KA 3HM8A 3ID6A 5AQQA 4B8CA 4BC4A 3MCAB 3CJBA 3VQ9A 4DF4A 3RR7A 3C0BA 4FWKA 4KO0A 3MXMA 3W3DA 1JCEA 4PKGA 4KH5A 3EKUA 1VQ6N 4CK2A 2O8CB 3RMCA 3L0QA 3THXA 1GLDG 3WUHA 4AHRA 5EY4A 3J81O 4FLXA 5FDLA 2HBKA 4N56A 5M1PA 4E7IA 2E4LA 3SBGA 2GEMA 3FLCO 2NNWA 4RG8A 1I3AA 3ATVA 3OW2M 1IKYA 4PKIA 2P9IB 5BRHA 3CC4N 2ZJPL 3GBTA 2QWOA 4FWRA 4H5TA 4KTQA 1S3XA 4M3WA 4WYBA 3QEXA 4ILJA 1OVQA 4JKGA 5J1EA 4Z4EA 4RWTA 2O4GA 3QMLA 4L3QA 3C6HA 1ZC6A 2P9UB 4K43A 3DOKA 2CGKA 1TAQA 4FSVA 2HHHK 3D2FA 3HJFA 4KHQA 3CMEN 2YKMA 3AVGA 4BQLA 5D3GA 5KI6A 2A40A 3VQDA 1NBWA 3ID8A 4E3SA 3U8XA 2QWNA 4CJLA 5CE3A 5KQ8A 3NF9A 2E2NA 4E7LA 1NK0A 1BI4B 4FJ5A 4H0XB 1C1BA 3O9RA 3ZSZA 2OZSA 3AAPA 2AJQA 4CJRA 3ASMA 1NJYA 1FXXA 1ASWA 4JN4A 4JKDA 3QDKA 4FJ7A 4YDUC 3A0IX 5AQTA 3SQ2A 3RSEA 4CEFA 3E01A 2BTFA 3J80O 5I3UA 5KGWA 2KTQA 2PBDA 3WQTA 1XMQK 1X3NA 3ZEUA 1CZBA 4BREA 2P9KB 2FBYA 2P9NB 4FM2A 3S9HA 3BGRA 5LMNK 5AQIA 4KHWA 4CJPA 4IEIA 2VWKA 2ZF5O 4O0IA 1LOTB 4DS4A 2UXBK 3LDSA 3THYA 4IZ9A 2FBVA 5CY4A 3SAGA 1NGBA 1Y64A 1D9DA 2YHBA 4IOAL 5AQGA 2VGNA 4BGBA 4FWNA 2YCHA 4MDBA 3ZCMA 3ZX2A 4O4GA 3TSUA 4CJ4A 3O3HA 3MN6A 1ASUA 3HOSA 4UQGA 1EO1A 3LP0A 4BE0A 1VHXA 1DT9A 4KV8A 5BRFA 2QM1A 2Q3SA 4PY5A 1VK0A 4M63C 1REVA 4MLHA 2I7NA 4Z4HA 3DRSA 3KIOA 1EWRA 3AVAA 4EP5A 1IBMK 4BR7A 4DR1K 1ZBHA 3MEEA 4LF7K 3P5JA 4BRQA 3CJCA 4RW6A 4FZYA 3VQ7A 3ATUA 4CD3A 4JEPA 4ILHA 1QTMA 4QCLA 4FWMA 5ADXA 2NZTA 4CF2A 3TTDA 4FJJA 4E0DA 3CETA 3SNNA 3L6QA 1IG8A 4AILC 1S1TA 3ENBA 3VQCA 1HKBA 3IAYA 4YOTA 2A6AA 3MEGA 1TYQB 4CEQA 1NGAA 4JS5A 4W5QA 3JS6A 4Y0WA 5KRTA 3WT0A 4KHNA 2E1ZA 4M3TA 3MDQA 1FW6A 1B9DA 2EX3A 4F3TA 4CHQA 4LF4K 4AHTA 2YKNA 3K9KA 3GE1A 1GOBA 2B6AA 1U2VB 1SL0A 3CXCM 1GOAA 3AVIA 4CGIA 4BRLA 3LM9A 4W5RA 1NWKA 2R7YA 2FLOA 1NG9A 3OTOK 4CIEA 3RR8A 1EP4A 2RE2A 3CI5A 3SAFA 1XC3A 1HMVA 4ELVA 3LP1A 1TAUA 2PYJA 3H3NO 2GV9A 2P9SA 4OX9K 3UIQA 3OYJA 2HHVA 2NRXA 2RN2A 1K8KB 3KLFA 4GKKK 3AGKA 2G8VA 1GLBG 1V4TA 3U3GA 2YNHA 2W40A 3ZT2A 2O8DA 4OPHA 1IO2A 1X9SA 1TUYA 3H45C 1GLLO 1TKTA 4BRCA 3IG1A 5BR8K 3D6RA 3AVMA 3C7NA 4BROA 3U9ZA 4FYDA 4DV3K 1QS4A 1S22A 4CECA 3UKUB 5M1FA 4OLAA 2ETJA 4CJQA 5JS1A 2P51A 2HSTA 1RTDA 3O3FA 4Q0BA 3CFOA 4BE1A 4ZTFA 1RDWX 2P9LA 1RBTA 5TKWA 3VQQA 3E66A 4CI6A 4ISFA 2F96A 2VG6A 1W7AA 1MDUB 1ZXOA 2OPQA 2QW9A 2XO7A 5AQFA 3HOTA 5C10A 1YJ9N 5E41A 1YHQN 1Q81O 3B6PA 2B4JA 2BGGA 1VSEA 2HVHA 3N4PA 2FBXA 4WFAL 4IOCL 1NKEA 1NNEA 1JLEA 1DGKN 2D0AA 3OYMA 2VWBA 2YNIA 3OS0A 3SV3A 1C1AA 4QOZB 3SK3A 1MU2A 1N8RO 3VA3A 4IFVA 1KSPA 3BUZB 3OS1A 5HRRA 3TU5A 4DR2K 1ATNA 3KWIA 1Z26A 4AHCA 4G1QA 4JYAK 1QQMA 3QEIA 3PUFA 1L3UA 4JKBA 3EO3A 1N33K 3O5BA 4WQ5C 1WSGA 5AQPA 4WFBL 3L2QA 5AQJA 3LPUA 1JLFA 2O8BB 1KTQA 3OYFA 3WXJA 4CZGA 3CQ8A 4DFJA 2UUBK 2O8EA 1WN7A 2NUBA 3R3LA 3OS2A 2VQFK 3AA4A 3MEDA 5HOOA 3RMDA 3OYGA 3MN5A 1WSFA 1ATRA 1SUQA 3ULEA 3O4NA 3V9SA 3SBTA 3CC7N 3L2VA 4DS5A 4DSEA 3P1GA 1B9FA 1KVBA 2EWSA 3LALA 1T3VA 3MECA 1HQEA 5FLXO 1ZBSA 2D0PA 4CBUA 1S5JA 4RW9A 4W5OA 3L2RA 3MAQA 1Q18A 3LP3A 2E6LA 4DQQA 4LF9K 1NKBA 1Q9YA 2IAJA 3VMFB 4DV4K 2E2PA 3DMJA 1QE1A 1WSJA 4LD0A 3AVJA 4OVLA 4M42A 3CYMA 1LW2A 3CIPA 3IUCA 4HWIA 2KQ2A 4DSIA 3TTCA 1BQNA 4O5BA 1RTHA 4K25A 4DSFA 3ZSOA 3QESA 3IMXA 4BRHA 1VQ4N 3EEQA 1KLNA 4DV7K 1TGOA 4I6MB 4CGGA 3V81A 2HBLA 1BISA 3NVKA 1KFSA 3SUNA 1RT7A 4CFCA 5AQYA 3SAHA 4FLWA 1RTIA 4C1NK 2YI1A 4B3RK 4F8RA 3U9DA 3HXMA
chains in the Genus database with same CATH topology
3NF8A 4DTRA 3HP9A 4FZZA 3K5LA 5FROA 3F9KA 3K58A 3PX4A 4Z4GA 1TKZA 3AO4A 4DFPA 1TK5A 4CHOA 1IG9A 1RNHA 4FK0A 1YTUA 1CXQA 3ITHA 3NGYA 4M45A 4AHSA 2X74A 2QKKA 4FVMA 1SV5A 5J2NA 1BI4A 3OJSA 3V4IA 3KTQA 1VSJA 2VG7A 1BIZA 1A5XA 1S9EA 1JLQA 3HVTA 5T7BA 5J2QA 4ZHRA 4CFBA 1VSIA 1VSFA 3ZSYA 1L5UA 1U49A 3K5NA 4J2DA 3U3YA 2O4IA 2VG5A 1LV5A 3K5MA 2RF2A 3SUOA 2HHSA 1WSEA 2I5JA 4FK4A 3NE6A 1Y97A 1C1CA 3KLEA 2ZQBA 4XIUA 3LAMA 3CFPA 4HTUA 1FKOA 3V6DA 2OZMA 1QHTA 3VQPA 4FM0A 1KCFA 3PO5A 1RBVA 3AO1A 4HVJA 4E1NA 4NCAA 1K6YA 4FJMA 3NF6A 2QK9A 4JRPA 4NYNA 1KVAA 1IKXA 4OGCA 2HNDA 1KRPA 3CM5A 4I2PA 1RTJA 3AVLA 4FLYA 2D0BA 1TKDA 2WOMA 4FLVA 2PY5A 1JKHA 1KVCA 2RPIA 4FJHA 3SI6A 3V9WA 4O0JA 3T19A 4DF8A 4H8KA 3CG7A 1TV6A 3QNOA 4CEDA 4OKKA 4JRQA 4B8CA 1ZBLA 1NOYA 1BCMA 4C8MA 3SCXA 3VQ9A 3VQ5A 3EYZA 4DF4A 3RR7A 3DLEA 3L8BA 4F2RA 4CERA 1J5OA 4RW7A 3G10A 2KFNA 1U4BA 4KO0A 4E89A 3HK2A 3PX0A 4ZTJA 3OY9A 3MXMA 1LAVA 3T3FA 4K8ZA 1NK6A 4ID1A 3TAQA 4F2SA 4KRFA 3M8RA 3HYFA 4CGFA 3VN5A 4CK2A 4DTOA 3RMCA 4Z4FA 1BQMA 3H08A 2OA8A 1WNSA 4AHRA 3OJUA 3ZSQA 4FLXA 2E6MA 5FDLA 3NH0A 4GMJB 1HRHA 4N56A 1QQCA 4E7IA 1L3TA 2E4LA 4FM1A 1D8YA 3SQ4A 4CJUA 5SZTA 4DWIA 4RG8A 1U04A 4I2QA 4CEAA 1O1WA 4PWDA 4YFUA 1I3AA 4O44A 1IKYA 3L3UA 3NHGA 4FJ8A 1QSSA 4M3XA 3EY1A 3ZT3A 1WAJA 4KTQA 3VQ6A 1ZBIA 1RILA 3NH1A 2HHXA 4HUFA 3RMAA 5HLFA 4OLBA 4C8KA 3SV4A 4W5TA 2HW3A 4M3WA 4CHYA 1NJZA 1HYZA 4E7KA 3QEXA 5J1EA 4Z4EA 3OYHA 3KKRA 1TKXA 2IDOA 2O4GA 5KTQA 3LWMA 3PY8A 4FZXC 4CJ5A 1UA1A 1HYVA 2BE2A 3DOKA 5K14A 1YTAA 1TAQA 3FFIA 1Q8IA 4IDKA 1RT3A 1LWCA 4BDYA 2BANA 3M8PA 3NH2A 2KFZA 4BWMA 4FJGA 5HRPA 1JXBA 4CF8A 4DTUA 2X6SA 1JLCA 1F21A 3DLKA 4KHQA 3HJFA 4DTXA 4LH4A 2YKMA 3AVGA 4Z4CA 1X1PA 5D3GA 4KREA 5KI6A 3VQDA 3TABA 1X9MA 1RDCA 3WNHA 1VRUA 3RTVA 3PX6A 1VSHA 3LWLA 3HVRA 4FJ9A 4E3SA 1UA0A 3LPTA 4CJLA 4B9UA 4W5NA 4WE1A 1RT4A 2HHQA 3M8QA 3NF9A 4CEOA 3DLGA 1HQUA 2P5GA 4E7LA 2LSNA 3B6OA 1BI4B 1NK0A 4FJ5A 1C1BA 4DU4A 3ZSZA 2X78A 4J2BA 2OZSA 2AJQA 4I9LA 1VRTA 4C8OA 1T7PA 3QIPA 4CJVA 1WLJA 1J9AA 4CJRA 5J2PA 2DFFA 3QO9A 2G8HA 3AVNA 3KLGA 4HCBA 3ASMA 1NJYA 1FXXA 4CEEA 4TSXA 1RT2A 1ASWA 4OGEA 4CJFA 3L2UA 1L3VA 3AA5X 3RWUA 5KRSA 1QSYA 3G0ZA 3NFAA 3ZSWA 1JLAA 1S1VA 3QERA 4FJ7A 3O4QA 1TL3A 4DU1A 3SQ2A 4KB1A 4E1MA 2HHTA 3C6TA 3TAMA 4CEFA 1VSMA 3E01A 4HCCA 5I3UA 1L3SA 3I8DA 3JSMA 4F3OA 5KGWA 4DSKA 2KTQA 4JS4A 4FLTA 1RDAA 3ZSRA 4DQSA 1U47A 4DMNA 4DSJA 1CZBA 3NF7A 4KTZA 4N5SA 4NCBA 2FBYA 5HBMA 3OYEA 4DLEA 4FM2A 4PUOA 3S9HA 4CF0A 3BGRA 1S1XA 4BWJA 4I7FA 2XY8A 4CGDA 2ZD1A 1XHZA 1WAFA 3A2FA 4CJPA 1BIUA 4KHWA 5DMRA 4E7HA 2VWKA 2ZE2A 4F4KA 4AH9A 4DTJA 4O0IA 4B08A 3WNEA 4DS4A 2XY7A 3LDSA 3VQAA 4B9SA 2FBVA 2KZZA 5CY4A 3KLHA 1UOCA 4N76A 1D9DA 2YHBA 4M3ZA 3BDPA 3DI6A 3CM6A 1RT1A 1SL1A 3SUQA 4JLHA 4KAZA 1HJRA 4DLGA 3TARA 3ZCMA 5HRNA 3NGZA 1SKWA 4EZ9A 4O4GA 1HPZA 2A1RA 4CJ4A 3O3HA 1ASUA 4CGJA 4E19A 4UQGA 1EXQA 5CYQA 2GBZA 3LP0A 1S1UA 3AVFA 4BE0A 4B8AB 2DFEA 4KV8A 2OYQA 1D5AA 2JGUA 5C25A 1VSKA 1J53A 3VQ4A 1EX4A 2Q3SA 4J2AA 4K8XA 4RW4A 1VK0A 4B3OA 1REVA 1W0HA 4PY5A 3IRXA 4Z4HA 3DRSA 3M8SA 3KIOA 3SQ1A 4CJEA 2YHAA 3AVAA 2EHGA 4EP5A 3DLHA 4DQIA 3OYKA 3WNFA 1ZBHA 1B92A 3P83D 3MEEA 4Z0UA 3VQEA 4EP4A 2Z1HA 2YNFA 3NCIA 1DTQA 3P5JA 4OPKA 4EZ6A 4KHSA 4I9QA 4RW6A 4FZYA 3HT3A 3TI0A 3VQ7A 1C0UA 3TAGA 1ZBUA 2KZMA 1EKEA 2B5JA 3V9XA 3VA0A 1QTMA 1UAXA 4QCLA 5HP1A 1ZYQA 3DLRA 4CF2A 2G8FA 4CK1A 3OYAA 3NDKA 1SL2A 4E0DA 4FJJA 4DU3A 2HVIA 3DYAA 5I42A 5EU7A 3TAFA 2IOCA 1JLGA 3SPYA 3SNNA 1QSLA 4B9LA 4CGHA 4AILC 2PZSA 1I39A 1S1TA 1VSLA 3RRGA 4DQPA 3KD5E 4FLUA 5J2MA 3ZSXA 1NK5A 4YNQA 3DLBA 3VQCA 3LZIA 4M3UA 1YVUA 3IAYA 5KGXA 2PYLA 1RDBA 2IC3A 4DSLA 4GW6A 3MEGA 4C8NA 4CEQA 4JS5A 3RRHA 4W5QA 4M3YA 3HO1A 4IG3A 5KRTA 3PV8A 1ASVA 4KHNA 3I0RA 1WSHA 3RMBA 4M3TA 2IGIA 3KK1A 3L2WA 1BL3A 1B9DA 2EX3A 3D0PA 1C6VA 4FLZA 4F3TA 1NK8A 3NGIA 4QAGA 4CHQA 3PO4A 4AHTA 2YKNA 4CJTA 4KHUA 2D0CA 3ZSVA 1GOBA 2B6AA 1RBRA 3AO3A 1SL0A 2QKBA 2HNZA 3C6UA 2F8SA 1NK9A 1GOAA 3AVIA 1YT3A 4KKOA 4CGIA 3ULDA 5C42A 3HL8A 4W5RA 4ELTA 2R7YA 3OYDA 3C94A 1G15A 4OKEA 1U48A 4CIEA 3RR8A 1EP4A 3LANA 1Q9XA 4M41A 3V1OA 3QEVA 2XY5A 4B9TA 1HMVA 4CCHA 1DLOA 3AVKA 1WSIA 1HNIA 1TVRA 3LP1A 4ELVA 1TAUA 3K59A 4CJSA 1JLBA 2RKIA 3HSTB 2PYJA 3OYIA 2GV9A 1LWFA 3KKSA 1UWBA 1IKWA 1BGXT 2OPRA 3ZT1A 3K57A 3UIQA 2Z1IA 1N5YA 4LY7A 3OYJA 3NBPA 4NYFA 3V1QA 4CHNA 2RN2A 1RT6A 3SZ2A 2HHVA 3KJVA 4KB0A 2YNGA 3OVNA 4MQ3A 3QLHA 4Y1CA 3KLFA 2P5OA 4MFBA 4KPYA 2G8VA 3TANA 3K2PA 2G8UA 3V1RA 1C0MA 3KLIA 3U3GA 4CFDA 3NAEA 4ELUA 4FJXA 2YNHA 4PA1A 3ZT2A 2QXFA 3OYBA 1KLMA 2D5RA 1CLQA 2Y1IA 1HNVA 1IO2A 4BE2A 1X9SA 1TK0A 4E7JA 4CHZA 3V9ZA 1XI1A 1TKTA 3DRRA 2DFHA 4DTPA 3IG1A 3LP2A 3AVMA 3MXJA 1NK7A 3SUPA 4IFYA 4Q5VA 2VWJA 4DG1A 4FYDA 1QS4A 4OKJA 4CECA 3IS9A 2HHWA 4KFBA 4FCYA 1BCOA 3S3OA 2ETJA 4CJQA 3VQ8A 4OLAA 5JS1A 2P51A 4IG0A 1RTDA 3QNNA 4IKFA 1TL1A 1FKPA 4CIGA 3O3FA 3JYTA 4Q0BA 3AVHA 1RBSA 3CFOA 4BE1A 4ZTFA 3HPOA 2XY6A 4DQRA 3TAEA 1DTTA 4FW1A 1NJWA 3V9UA 1RBTA 2W42A 4DTNA 3AO5A 2FC0A 3VQQA 4FJIA 1NKCA 1A5VA 3S3MA 3LAKA 3D45A 2F96A 2FBTA 2GUIA 2HNYA 1CZ9A 2VG6A 3AA3A 4FW2A 4AHUA 4C8LA 4N41A 2JLEA 2OPQA 4AHVA 4FJNA 1ITGA 2XO7A 3SQ0A 1S9GA 1JL2A 1XC9A 2P1JA 1NOZA 5E41A 4CF9A 3EZ5A 3B6PA 1LWEA 4M3RA 2ITGA 2B4JA 5JS2A 1HYSA 2BGGA 1VSEA 2HVHA 3TAPA 1EETA 3K5OA 4CEZA 3SPZA 1TK8A 1RCHA 2G8IA 2OPSA 2FBXA 4FXDA 3ALYA 1S1WA 1A5WA 3VQBA 1NKEA 1SKRA 1JLEA 2D0AA 3OYMA 4Y1DA 1Z25A 2YNIA 3I0SA 3OS0A 3SV3A 1C1AA 1NK4A 4FJKA 1RBUA 3L3VA 1R0AA 4QOZB 1IH7A 4BDZA 4CE9A 3F73A 1MU2A 1ZBFA 3VA3A 4IFVA 3S3NA 4RW8A 3OS1A 1KSPA 5HRRA 4BDPA 4O55A 1Z26A 5C24A 3TR8A 3OYNA 4LSNA 4AHCA 4G1QA 4FJLA 2Z1JA 1N6QA 4CEBA 4L8RB 3QEIA 3HM9A 4ID5A 3PUFA 1L3UA 4HUEA 3DRPA 3KK2A 1LW0A 2YV0X 4CJWA 1WSGA 3QETA 3QIOA 4R5PA 1RDDA 3L2QA 1SKSA 2OPPA 3LPUA 1JLFA 5CYMA 4KHYA 4PQUA 1KTQA 3OYFA 3CQ8A 4DFJA 3HPHA 3HP6A 3OYLA 4B9MA 3QEPA 1WN7A 4CK3A 2NUBA 3AA2A 1C0TA 3OS2A 3KD1E 2X6NA 1XHXA 2ATQA 3ISNC 4FK2A 3AA4A 1T03A 3MEDA 1W9HA 3RMDA 2HMIA 3QINA 3OYGA 4DFMA 3U6FA 4J2EA 1WSFA 3AVBA 5CZ2A 4KTWA 1SUQA 3TWHA 3T1AA 3O4NA 4CIFA 3V9SA 4B9NA 1FK9A 4OJRA 1VSDA 4B9VA 5HRSA 3L2VA 4KI6A 3LZJA 1BHLA 4DS5A 1JL1A 1RT5A 4IBNA 4H4OA 4DSEA 3THVA 3QEWA 3P1GA 5DK5A 1B9FA 1KVBA 4KI4A 3LALA 2F8TA 1NJXA 3MECA 3CFRA 5HROA 2G8KA 1S6PA 2XRIA 1HQEA 2XHBA 3DOLA 5FRMA 1T05A 3MXIA 4HUGA 4W5OA 3L2RA 1S5JA 4RW9A 2KW4A 3MAQA 4BACA 2Y1JA 3LP3A 4DQQA 2E6LA 1T8EA 2HHUA 3SJJA 3ZT0A 2IAJA 4CESA 3KK3A 1NKBA 1Q9YA 3DMJA 5FRNA 2DY4A 3AO2A 1QE1A 1WSJA 1S6QA 4CFAA 4N47A 4HHTA 1KFDA 4LD0A 3AVJA 4OVLA 3OYCA 4M42A 3CYMA 1LW2A 4DTSA 3AV9A 2KQ2A 3HPGA 4DSIA 4OPJA 1BQNA 4O5BA 1J54A 2A1SA 1RTHA 2IS3A 4DSFA 4H4MA 3ZSOA 4CJKA 3QESA 4CJ3A 2DTUA 4DTMA 4ICLA 1LAWA 5CZ1A 3ZT4A 3O3GA 1X9WA 1D9FA 4CHPA 1IKVA 1KLNA 2BDPA 3WNGA 4DFKA 1TGOA 4CF1A 4CGGA 3V81A 3SYZA 2G8WA 1BISA 2Z1GA 4NCGA 4GVMA 1KFSA 5SWMA 3SUNA 2WONA 4LH5A 1RT7A 4CFCA 3AVCA 1GOCA 3DM2A 4LSLA 1JXEA 4FLWA 1RTIA 3C95A 4Z4IA 1CXUA 1XWLA 1U45A 4F8RA 2HB5A 3HXMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NF8 A;  4DTR A;  3HP9 A;  4FZZ A;  3K5L A;  5FRO A;  3F9K A;  3K58 A;  3PX4 A;  4Z4G A;  1TKZ A;  3AO4 A;  4DFP A;  1TK5 A;  4CHO A;  1IG9 A;  1RNH A;  4FK0 A;  1YTU A;  1CXQ A;  3ITH A;  3NGY A;  4M45 A;  4AHS A;  2X74 A;  2QKK A;  4FVM A;  1SV5 A;  5J2N A;  1BI4 A;  3OJS A;  3V4I A;  3KTQ A;  1VSJ A;  2VG7 A;  1BIZ A;  1A5X A;  1S9E A;  1JLQ A;  3HVT A;  5T7B A;  5J2Q A;  4ZHR A;  4CFB A;  1VSI A;  1VSF A;  3ZSY A;  1L5U A;  1U49 A;  3K5N A;  4J2D A;  3U3Y A;  2O4I A;  2VG5 A;  1LV5 A;  3K5M A;  2RF2 A;  3SUO A;  2HHS A;  1WSE A;  2I5J A;  4FK4 A;  3NE6 A;  1Y97 A;  1C1C A;  3KLE A;  2ZQB A;  4XIU A;  3LAM A;  3CFP A;  4HTU A;  1FKO A;  3V6D A;  2OZM A;  1QHT A;  3VQP A;  4FM0 A;  1KCF A;  3PO5 A;  1RBV A;  3AO1 A;  4HVJ A;  4E1N A;  4NCA A;  1K6Y A;  4FJM A;  3NF6 A;  2QK9 A;  4JRP A;  4NYN A;  1KVA A;  1IKX A;  4OGC A;  2HND A;  1KRP A;  3CM5 A;  4I2P A;  1RTJ A;  3AVL A;  4FLY A;  2D0B A;  1TKD A;  2WOM A;  4FLV A;  2PY5 A;  1JKH A;  1KVC A;  2RPI A;  4FJH A;  3SI6 A;  3V9W A;  4O0J A;  3T19 A;  4DF8 A;  4H8K A;  3CG7 A;  1TV6 A;  3QNO A;  4CED A;  4OKK A;  4JRQ A;  4B8C A;  1ZBL A;  1NOY A;  1BCM A;  4C8M A;  3SCX A;  3VQ9 A;  3VQ5 A;  3EYZ A;  4DF4 A;  3RR7 A;  3DLE A;  3L8B A;  4F2R A;  4CER A;  1J5O A;  4RW7 A;  3G10 A;  2KFN A;  1U4B A;  4KO0 A;  4E89 A;  3HK2 A;  3PX0 A;  4ZTJ A;  3OY9 A;  3MXM A;  1LAV A;  3T3F A;  4K8Z A;  1NK6 A;  4ID1 A;  3TAQ A;  4F2S A;  4KRF A;  3M8R A;  3HYF A;  4CGF A;  3VN5 A;  4CK2 A;  4DTO A;  3RMC A;  4Z4F A;  1BQM A;  3H08 A;  2OA8 A;  1WNS A;  4AHR A;  3OJU A;  3ZSQ A;  4FLX A;  2E6M A;  5FDL A;  3NH0 A;  4GMJ B;  1HRH A;  4N56 A;  1QQC A;  4E7I A;  1L3T A;  2E4L A;  4FM1 A;  1D8Y A;  3SQ4 A;  4CJU A;  5SZT A;  4DWI A;  4RG8 A;  1U04 A;  4I2Q A;  4CEA A;  1O1W A;  4PWD A;  4YFU A;  1I3A A;  4O44 A;  1IKY A;  3L3U A;  3NHG A;  4FJ8 A;  1QSS A;  4M3X A;  3EY1 A;  3ZT3 A;  1WAJ A;  4KTQ A;  3VQ6 A;  1ZBI A;  1RIL A;  3NH1 A;  2HHX A;  4HUF A;  3RMA A;  5HLF A;  4OLB A;  4C8K A;  3SV4 A;  4W5T A;  2HW3 A;  4M3W A;  4CHY A;  1NJZ A;  1HYZ A;  4E7K A;  3QEX A;  5J1E A;  4Z4E A;  3OYH A;  3KKR A;  1TKX A;  2IDO A;  2O4G A;  5KTQ A;  3LWM A;  3PY8 A;  4FZX C;  4CJ5 A;  1UA1 A;  1HYV A;  2BE2 A;  3DOK A;  5K14 A;  1YTA A;  1TAQ A;  3FFI A;  1Q8I A;  4IDK A;  1RT3 A;  1LWC A;  4BDY A;  2BAN A;  3M8P A;  3NH2 A;  2KFZ A;  4BWM A;  4FJG A;  5HRP A;  1JXB A;  4CF8 A;  4DTU A;  2X6S A;  1JLC A;  1F21 A;  3DLK A;  4KHQ A;  3HJF A;  4DTX A;  4LH4 A;  2YKM A;  3AVG A;  4Z4C A;  1X1P A;  5D3G A;  4KRE A;  5KI6 A;  3VQD A;  3TAB A;  1X9M A;  1RDC A;  3WNH A;  1VRU A;  3RTV A;  3PX6 A;  1VSH A;  3LWL A;  3HVR A;  4FJ9 A;  4E3S A;  1UA0 A;  3LPT A;  4CJL A;  4B9U A;  4W5N A;  4WE1 A;  1RT4 A;  2HHQ A;  3M8Q A;  3NF9 A;  4CEO A;  3DLG A;  1HQU A;  2P5G A;  4E7L A;  2LSN A;  3B6O A;  1BI4 B;  1NK0 A;  4FJ5 A;  1C1B A;  4DU4 A;  3ZSZ A;  2X78 A;  4J2B A;  2OZS A;  2AJQ A;  4I9L A;  1VRT A;  4C8O A;  1T7P A;  3QIP A;  4CJV A;  1WLJ A;  1J9A A;  4CJR A;  5J2P A;  2DFF A;  3QO9 A;  2G8H A;  3AVN A;  3KLG A;  4HCB A;  3ASM A;  1NJY A;  1FXX A;  4CEE A;  4TSX A;  1RT2 A;  1ASW A;  4OGE A;  4CJF A;  3L2U A;  1L3V A;  3AA5 X;  3RWU A;  5KRS A;  1QSY A;  3G0Z A;  3NFA A;  3ZSW A;  1JLA A;  1S1V A;  3QER A;  4FJ7 A;  3O4Q A;  1TL3 A;  4DU1 A;  3SQ2 A;  4KB1 A;  4E1M A;  2HHT A;  3C6T A;  3TAM A;  4CEF A;  1VSM A;  3E01 A;  4HCC A;  5I3U A;  1L3S A;  3I8D A;  3JSM A;  4F3O A;  5KGW A;  4DSK A;  2KTQ A;  4JS4 A;  4FLT A;  1RDA A;  3ZSR A;  4DQS A;  1U47 A;  4DMN A;  4DSJ A;  1CZB A;  3NF7 A;  4KTZ A;  4N5S A;  4NCB A;  2FBY A;  5HBM A;  3OYE A;  4DLE A;  4FM2 A;  4PUO A;  3S9H A;  4CF0 A;  3BGR A;  1S1X A;  4BWJ A;  4I7F A;  2XY8 A;  4CGD A;  2ZD1 A;  1XHZ A;  1WAF A;  3A2F A;  4CJP A;  1BIU A;  4KHW A;  5DMR A;  4E7H A;  2VWK A;  2ZE2 A;  4F4K A;  4AH9 A;  4DTJ A;  4O0I A;  4B08 A;  3WNE A;  4DS4 A;  2XY7 A;  3LDS A;  3VQA A;  4B9S A;  2FBV A;  2KZZ A;  5CY4 A;  3KLH A;  1UOC A;  4N76 A;  1D9D A;  2YHB A;  4M3Z A;  3BDP A;  3DI6 A;  3CM6 A;  1RT1 A;  1SL1 A;  3SUQ A;  4JLH A;  4KAZ A;  1HJR A;  4DLG A;  3TAR A;  3ZCM A;  5HRN A;  3NGZ A;  1SKW A;  4EZ9 A;  4O4G A;  1HPZ A;  2A1R A;  4CJ4 A;  3O3H A;  1ASU A;  4CGJ A;  4E19 A;  4UQG A;  1EXQ A;  5CYQ A;  2GBZ A;  3LP0 A;  1S1U A;  3AVF A;  4BE0 A;  4B8A B;  2DFE A;  4KV8 A;  2OYQ A;  1D5A A;  2JGU A;  5C25 A;  1VSK A;  1J53 A;  3VQ4 A;  1EX4 A;  2Q3S A;  4J2A A;  4K8X A;  4RW4 A;  1VK0 A;  4B3O A;  1REV A;  1W0H A;  4PY5 A;  3IRX A;  4Z4H A;  3DRS A;  3M8S A;  3KIO A;  3SQ1 A;  4CJE A;  2YHA A;  3AVA A;  2EHG A;  4EP5 A;  3DLH A;  4DQI A;  3OYK A;  3WNF A;  1ZBH A;  1B92 A;  3P83 D;  3MEE A;  4Z0U A;  3VQE A;  4EP4 A;  2Z1H A;  2YNF A;  3NCI A;  1DTQ A;  3P5J A;  4OPK A;  4EZ6 A;  4KHS A;  4I9Q A;  4RW6 A;  4FZY A;  3HT3 A;  3TI0 A;  3VQ7 A;  1C0U A;  3TAG A;  1ZBU A;  2KZM A;  1EKE A;  2B5J A;  3V9X A;  3VA0 A;  1QTM A;  1UAX A;  4QCL A;  5HP1 A;  1ZYQ A;  3DLR A;  4CF2 A;  2G8F A;  4CK1 A;  3OYA A;  3NDK A;  1SL2 A;  4E0D A;  4FJJ A;  4DU3 A;  2HVI A;  3DYA A;  5I42 A;  5EU7 A;  3TAF A;  2IOC A;  1JLG A;  3SPY A;  3SNN A;  1QSL A;  4B9L A;  4CGH A;  4AIL C;  2PZS A;  1I39 A;  1S1T A;  1VSL A;  3RRG A;  4DQP A;  3KD5 E;  4FLU A;  5J2M A;  3ZSX A;  1NK5 A;  4YNQ A;  3DLB A;  3VQC A;  3LZI A;  4M3U A;  1YVU A;  3IAY A;  5KGX A;  2PYL A;  1RDB A;  2IC3 A;  4DSL A;  4GW6 A;  3MEG A;  4C8N A;  4CEQ A;  4JS5 A;  3RRH A;  4W5Q A;  4M3Y A;  3HO1 A;  4IG3 A;  5KRT A;  3PV8 A;  1ASV A;  4KHN A;  3I0R A;  1WSH A;  3RMB A;  4M3T A;  2IGI A;  3KK1 A;  3L2W A;  1BL3 A;  1B9D A;  2EX3 A;  3D0P A;  1C6V A;  4FLZ A;  4F3T A;  1NK8 A;  3NGI A;  4QAG A;  4CHQ A;  3PO4 A;  4AHT A;  2YKN A;  4CJT A;  4KHU A;  2D0C A;  3ZSV A;  1GOB A;  2B6A A;  1RBR A;  3AO3 A;  1SL0 A;  2QKB A;  2HNZ A;  3C6U A;  2F8S A;  1NK9 A;  1GOA A;  3AVI A;  1YT3 A;  4KKO A;  4CGI A;  3ULD A;  5C42 A;  3HL8 A;  4W5R A;  4ELT A;  2R7Y A;  3OYD A;  3C94 A;  1G15 A;  4OKE A;  1U48 A;  4CIE A;  3RR8 A;  1EP4 A;  3LAN A;  1Q9X A;  4M41 A;  3V1O A;  3QEV A;  2XY5 A;  4B9T A;  1HMV A;  4CCH A;  1DLO A;  3AVK A;  1WSI A;  1HNI A;  1TVR A;  3LP1 A;  4ELV A;  1TAU A;  3K59 A;  4CJS A;  1JLB A;  2RKI A;  3HST B;  2PYJ A;  3OYI A;  2GV9 A;  1LWF A;  3KKS A;  1UWB A;  1IKW A;  1BGX T;  2OPR A;  3ZT1 A;  3K57 A;  3UIQ A;  2Z1I A;  1N5Y A;  4LY7 A;  3OYJ A;  3NBP A;  4NYF A;  3V1Q A;  4CHN A;  2RN2 A;  1RT6 A;  3SZ2 A;  2HHV A;  3KJV A;  4KB0 A;  2YNG A;  3OVN A;  4MQ3 A;  3QLH A;  4Y1C A;  3KLF A;  2P5O A;  4MFB A;  4KPY A;  2G8V A;  3TAN A;  3K2P A;  2G8U A;  3V1R A;  1C0M A;  3KLI A;  3U3G A;  4CFD A;  3NAE A;  4ELU A;  4FJX A;  2YNH A;  4PA1 A;  3ZT2 A;  2QXF A;  3OYB A;  1KLM A;  2D5R A;  1CLQ A;  2Y1I A;  1HNV A;  1IO2 A;  4BE2 A;  1X9S A;  1TK0 A;  4E7J A;  4CHZ A;  3V9Z A;  1XI1 A;  1TKT A;  3DRR A;  2DFH A;  4DTP A;  3IG1 A;  3LP2 A;  3AVM A;  3MXJ A;  1NK7 A;  3SUP A;  4IFY A;  4Q5V A;  2VWJ A;  4DG1 A;  4FYD A;  1QS4 A;  4OKJ A;  4CEC A;  3IS9 A;  2HHW A;  4KFB A;  4FCY A;  1BCO A;  3S3O A;  2ETJ A;  4CJQ A;  3VQ8 A;  4OLA A;  5JS1 A;  2P51 A;  4IG0 A;  1RTD A;  3QNN A;  4IKF A;  1TL1 A;  1FKP A;  4CIG A;  3O3F A;  3JYT A;  4Q0B A;  3AVH A;  1RBS A;  3CFO A;  4BE1 A;  4ZTF A;  3HPO A;  2XY6 A;  4DQR A;  3TAE A;  1DTT A;  4FW1 A;  1NJW A;  3V9U A;  1RBT A;  2W42 A;  4DTN A;  3AO5 A;  2FC0 A;  3VQQ A;  4FJI A;  1NKC A;  1A5V A;  3S3M A;  3LAK A;  3D45 A;  2F96 A;  2FBT A;  2GUI A;  2HNY A;  1CZ9 A;  2VG6 A;  3AA3 A;  4FW2 A;  4AHU A;  4C8L A;  4N41 A;  2JLE A;  2OPQ A;  4AHV A;  4FJN A;  1ITG A;  2XO7 A;  3SQ0 A;  1S9G A;  1JL2 A;  1XC9 A;  2P1J A;  1NOZ A;  5E41 A;  4CF9 A;  3EZ5 A;  3B6P A;  1LWE A;  4M3R A;  2ITG A;  2B4J A;  5JS2 A;  1HYS A;  2BGG A;  1VSE A;  2HVH A;  3TAP A;  1EET A;  3K5O A;  4CEZ A;  3SPZ A;  1TK8 A;  1RCH A;  2G8I A;  2OPS A;  2FBX A;  4FXD A;  3ALY A;  1S1W A;  1A5W A;  3VQB A;  1NKE A;  1SKR A;  1JLE A;  2D0A A;  3OYM A;  4Y1D A;  1Z25 A;  2YNI A;  3I0S A;  3OS0 A;  3SV3 A;  1C1A A;  1NK4 A;  4FJK A;  1RBU A;  3L3V A;  1R0A A;  4QOZ B;  1IH7 A;  4BDZ A;  4CE9 A;  3F73 A;  1MU2 A;  1ZBF A;  3VA3 A;  4IFV A;  3S3N A;  4RW8 A;  3OS1 A;  1KSP A;  5HRR A;  4BDP A;  4O55 A;  1Z26 A;  5C24 A;  3TR8 A;  3OYN A;  4LSN A;  4AHC A;  4G1Q A;  4FJL A;  2Z1J A;  1N6Q A;  4CEB A;  4L8R B;  3QEI A;  3HM9 A;  4ID5 A;  3PUF A;  1L3U A;  4HUE A;  3DRP A;  3KK2 A;  1LW0 A;  2YV0 X;  4CJW A;  1WSG A;  3QET A;  3QIO A;  4R5P A;  1RDD A;  3L2Q A;  1SKS A;  2OPP A;  3LPU A;  1JLF A;  5CYM A;  4KHY A;  4PQU A;  1KTQ A;  3OYF A;  3CQ8 A;  4DFJ A;  3HPH A;  3HP6 A;  3OYL A;  4B9M A;  3QEP A;  1WN7 A;  4CK3 A;  2NUB A;  3AA2 A;  1C0T A;  3OS2 A;  3KD1 E;  2X6N A;  1XHX A;  2ATQ A;  3ISN C;  4FK2 A;  3AA4 A;  1T03 A;  3MED A;  1W9H A;  3RMD A;  2HMI A;  3QIN A;  3OYG A;  4DFM A;  3U6F A;  4J2E A;  1WSF A;  3AVB A;  5CZ2 A;  4KTW A;  1SUQ A;  3TWH A;  3T1A A;  3O4N A;  4CIF A;  3V9S A;  4B9N A;  1FK9 A;  4OJR A;  1VSD A;  4B9V A;  5HRS A;  3L2V A;  4KI6 A;  3LZJ A;  1BHL A;  4DS5 A;  1JL1 A;  1RT5 A;  4IBN A;  4H4O A;  4DSE A;  3THV A;  3QEW A;  3P1G A;  5DK5 A;  1B9F A;  1KVB A;  4KI4 A;  3LAL A;  2F8T A;  1NJX A;  3MEC A;  3CFR A;  5HRO A;  2G8K A;  1S6P A;  2XRI A;  1HQE A;  2XHB A;  3DOL A;  5FRM A;  1T05 A;  3MXI A;  4HUG A;  4W5O A;  3L2R A;  1S5J A;  4RW9 A;  2KW4 A;  3MAQ A;  4BAC A;  2Y1J A;  3LP3 A;  4DQQ A;  2E6L A;  1T8E A;  2HHU A;  3SJJ A;  3ZT0 A;  2IAJ A;  4CES A;  3KK3 A;  1NKB A;  1Q9Y A;  3DMJ A;  5FRN A;  2DY4 A;  3AO2 A;  1QE1 A;  1WSJ A;  1S6Q A;  4CFA A;  4N47 A;  4HHT A;  1KFD A;  4LD0 A;  3AVJ A;  4OVL A;  3OYC A;  4M42 A;  3CYM A;  1LW2 A;  4DTS A;  3AV9 A;  2KQ2 A;  3HPG A;  4DSI A;  4OPJ A;  1BQN A;  4O5B A;  1J54 A;  2A1S A;  1RTH A;  2IS3 A;  4DSF A;  4H4M A;  3ZSO A;  4CJK A;  3QES A;  4CJ3 A;  2DTU A;  4DTM A;  4ICL A;  1LAW A;  5CZ1 A;  3ZT4 A;  3O3G A;  1X9W A;  1D9F A;  4CHP A;  1IKV A;  1KLN A;  2BDP A;  3WNG A;  4DFK A;  1TGO A;  4CF1 A;  4CGG A;  3V81 A;  3SYZ A;  2G8W A;  1BIS A;  2Z1G A;  4NCG A;  4GVM A;  1KFS A;  5SWM A;  3SUN A;  2WON A;  4LH5 A;  1RT7 A;  4CFC A;  3AVC A;  1GOC A;  3DM2 A;  4LSL A;  1JXE A;  4FLW A;  1RTI A;  3C95 A;  4Z4I A;  1CXU A;  1XWL A;  1U45 A;  4F8R A;  2HB5 A;  3HXM A; 
#chains in the Genus database with same CATH topology
 4DTR A;  5FRO A;  3PX4 A;  1YTU A;  4FK0 A;  3FZH A;  4AHS A;  4FVM A;  3KTQ A;  2VG7 A;  5AFU H;  3Q7C A;  3FFK B;  3HZ6 A;  3M5R A;  4H5R A;  4ZHR A;  1HR0 K;  3BY5 A;  3CF5 L;  3U3Y A;  2O4I A;  4U67 L;  2RF2 A;  2I5J A;  2NRT A;  4FK4 A;  3KLE A;  1C1C A;  2ZQB A;  3IKM A;  3CFP A;  3O08 A;  2D0O A;  1KCF A;  1K9M O;  2GWJ A;  4HVJ A;  4E1N A;  2QK9 A;  3O80 A;  2BUP A;  2ZJR L;  4OGC A;  5FPM A;  2HND A;  5M1Q A;  3VGK A;  3CCM N;  1NGF A;  4I2P A;  3VER A;  1Z6R A;  4FLY A;  1TKD A;  1NGI A;  2V51 B;  1KVC A;  3R8E A;  3CG7 A;  4BG8 A;  3QNO A;  2HBM A;  3E9O A;  1ZBL A;  3MCP A;  3EYZ A;  4FWL A;  4F2R A;  3DLE A;  3L8B A;  5M1O A;  2QWR A;  4CER A;  1OH8 A;  4E89 A;  3OY9 A;  3TAQ A;  4KRF A;  1Q7Y O;  4YOY A;  2A41 A;  4DR5 K;  3DAW A;  3OJU A;  3ZSQ A;  2E6M A;  4O8K A;  1ESV A;  4JHD A;  4FM1 A;  4DWI A;  1HUX A;  1U04 A;  4I2Q A;  4CEA A;  1O1W A;  4BQZ A;  3AAR A;  4M3X A;  4FJ8 A;  3HI0 A;  4G9Z A;  3HSC A;  3NH1 A;  2HHX A;  3RMA A;  5HLF A;  4OLB A;  4YDU A;  2HW3 A;  1HYZ A;  4BRP A;  5KTQ A;  3PY8 A;  4CJ5 A;  1UA1 A;  4K42 A;  1YTA A;  3FFI A;  4IDK A;  1IJJ A;  3EKS A;  5HRP A;  1G99 A;  1JLC A;  4Z4C A;  1X1P A;  3CHW A;  4KRE A;  1X9M A;  1VRU A;  5C15 A;  2GTD A;  4LF5 K;  4WE1 A;  4DCH A;  1RT4 A;  3H6E A;  4M7Y A;  2P5G A;  3DLL L;  2LSN A;  2IVN A;  4CW7 B;  4DU4 A;  4J2B A;  3EE9 A;  5KQD A;  1WLJ A;  5J2P A;  4B3M K;  4JI1 K;  5BPL A;  3PIP L;  4EAH D;  4HCB A;  4CJF A;  3L2U A;  1RT2 A;  3AA5 X;  5KRS A;  5LY3 A;  1TL3 A;  3BEX A;  3C6T A;  1VSM A;  4HCC A;  3KWG A;  4F3O A;  3JSM A;  4CJ7 A;  4LC9 B;  1RDA A;  3ZSR A;  1U47 A;  4YY3 K;  4DSJ A;  4KTZ A;  4PUO A;  4NCB A;  3KK7 A;  2UXC K;  4LF8 K;  3A2F A;  4F4K A;  4AH9 A;  4DTJ A;  2A3Z A;  4YHH K;  1NJI O;  4O8U A;  2QI2 A;  4DV1 K;  1UOC A;  3BDP A;  3CM6 A;  1RT1 A;  1SL1 A;  1P8Z A;  3SUQ A;  1HJR A;  3P31 A;  1SKW A;  5AQX A;  1HPZ A;  2A1R A;  3R1X A;  1KC8 O;  4E19 A;  3DXM A;  3A8Y A;  5LJV A;  3THX B;  1T6D A;  2Q97 A;  4JI3 K;  5GIO A;  1J53 A;  3VQ4 A;  1VQ9 N;  4JK9 A;  1JCG A;  4B3O A;  5EVZ A;  3IRX A;  4GV6 A;  2D4W A;  2KLA A;  2EHG A;  3P83 D;  4EP4 A;  4A61 A;  4I9Q A;  1NMD A;  3TI0 A;  3TAG A;  1C0U A;  2KZM A;  1ZBU A;  1EKE A;  3W0L A;  5HP1 A;  4JKG B;  2G8F A;  4JI4 K;  3OYA A;  2HVI A;  3DYA A;  4WCE L;  1QSL A;  4NLC A;  4B9L A;  4CZL A;  4MO4 A;  1I39 A;  1VSL A;  2NRV A;  5B8H A;  4FLU A;  3VPZ A;  3ZSX A;  3D2F B;  3ZLJ A;  3DLB A;  3FZF A;  3LZI A;  1YVU A;  2PYL A;  4M3Y A;  3J7A P;  5JMV A;  4BRD A;  4BC3 A;  4IG3 A;  3PV8 A;  1ASV A;  3I0R A;  1YI2 N;  2IGI A;  4DV6 K;  1C6V A;  4M7X A;  5KPT A;  4BGA A;  1VAZ A;  4CJT A;  1XMO K;  3ZSV A;  2UUA K;  2QKB A;  1RBR A;  3ULD A;  3OYD A;  2FSN A;  3C94 A;  1G15 A;  1YXQ A;  4FWO A;  4NB4 A;  1U48 A;  3LAN A;  3QEV A;  2XY5 A;  1ATS A;  5EX5 A;  1DLO A;  4B3T K;  1BO5 O;  1QZ5 A;  3NMU A;  4CJS A;  3RSE B;  3KKS A;  1IKW A;  1BGX T;  4JK8 A;  4CZE A;  2Z1I A;  2FSJ A;  3NBP A;  4CHN A;  3OBY A;  3SZ2 A;  1RT6 A;  2Q1N A;  3ZEU B;  4KB0 A;  2P5O A;  3CCS N;  3K2P A;  2E1Y A;  3KLI A;  3NAE A;  4FJX A;  3FZL A;  4PA1 A;  1GLC G;  2QXF A;  1KLM A;  1WUA A;  2Y1I A;  1HNV A;  4BE2 A;  2E2Q A;  2YJE A;  3THY B;  1TK0 A;  4E7J A;  3VGM A;  4CHZ A;  1XI1 A;  3ENH A;  3T1Y K;  4GVE A;  3LM2 A;  3LP2 A;  4CZI A;  4U7B A;  5TKY A;  1D4X A;  3SUP A;  3IFR A;  2VWJ A;  4DG1 A;  4IXC A;  3O9T A;  2HHW A;  4FCY A;  1BCO A;  1QVF M;  3QNN A;  5AQO A;  2FF3 B;  3QBW A;  3HPO A;  4DQR A;  4FW1 A;  4WQ5 A;  1XNQ K;  2BH1 A;  2W42 A;  4DTN A;  4AF1 A;  3P38 A;  2FC0 A;  3KVG A;  5AZJ A;  3D45 A;  3I56 N;  1VQM N;  2HNY A;  1CZ9 A;  1JCF A;  2JLE A;  4AHV A;  3A5O C;  1ITG A;  1S9G A;  1JL2 A;  4B1X B;  4B1Z A;  1NOZ A;  3CCE N;  4M3R A;  2ITG A;  1RDU A;  2YJF A;  3K5O A;  3ZYY X;  2OPS A;  1MWK A;  1S1W A;  4JKE A;  3WEE A;  1I94 K;  3VQB A;  4PHT X;  3ZX0 A;  1YIJ N;  1QZ6 A;  1OH6 A;  1R0A A;  4GNI A;  1IH7 A;  4BR9 A;  4BDZ A;  1GLE G;  2UXD K;  3F73 A;  1ZBF A;  4BDP A;  3UKR A;  2OTJ N;  4FWP A;  3TR8 A;  4LSN A;  2ZM6 K;  2PFU A;  5AQK A;  4QS7 A;  4L8R B;  3LDP A;  4ID5 A;  5EXW A;  2YV0 X;  3I8B A;  4R5P A;  1SKS A;  2OPP A;  3HPH A;  4B9M A;  1NGG A;  3KD1 E;  3EL2 A;  2ATQ A;  3ISN C;  4FK2 A;  4AM6 A;  3CCQ N;  2GEL A;  1VQN N;  2P9S B;  3TWH A;  3T1A A;  4CZK A;  1WOQ A;  4DV2 K;  4OJR A;  4B9N A;  1HKG A;  1JL1 A;  4IBN A;  4H4O A;  4JKF A;  1RGI A;  5FPE A;  3WXK A;  1QHA A;  4A59 A;  2O8D B;  5HRO A;  1IBK K;  2E20 A;  3O1W A;  4WQ4 C;  2ASO A;  4PL8 A;  3RWU A;  4JI5 K;  2Y1J A;  2HHU A;  4H0V B;  3SJJ A;  4CES A;  3C7N B;  1KQS M;  3M3Z A;  5CHI A;  3VF2 A;  3AO2 A;  3GG4 A;  4CFA A;  4N47 A;  1KFD A;  4H0O A;  4BG9 A;  3OYC A;  5AQU A;  1E4F T;  2FF6 A;  3AV9 A;  4DR3 K;  1BA1 A;  1YAG A;  2A1S A;  2IS3 A;  5FPD A;  4CJ3 A;  3BF1 A;  4ICL A;  1LAW A;  5CZ1 A;  3CJ7 A;  2P9L B;  3O4W A;  4CVN E;  2BDP A;  3WNG A;  4DFK A;  2QWP A;  4A62 A;  4A2A A;  2Z1G A;  4NCG A;  2F7T A;  3AVC A;  4LSL A;  1JXE A;  2YHW A;  1XWL A;  1U45 A;  2HB5 A;  3NF8 A;  4FZZ A;  3K58 A;  4C23 A;  4XH5 A;  3JXU A;  1CXQ A;  4M45 A;  3LDN A;  2X74 A;  3J7Z O;  4JK7 A;  4JI0 K;  4A5B A;  1JLQ A;  4A2B A;  5T7B A;  1BDG A;  1VSI A;  1VSF A;  3J8A A;  4J2D A;  2V7Z A;  2V52 B;  3SUO A;  1LCU A;  3KHY A;  3PIO L;  3HBT A;  3L4Q A;  1YUW A;  3VQP A;  3AO1 A;  4KBO A;  1J6Z A;  3MX2 A;  4B9Q A;  3NF6 A;  4JI6 K;  3G4S N;  1K73 O;  5IWA K;  2O8E B;  4FLV A;  2PY5 A;  5AQR A;  4FJH A;  3SI6 A;  4DF8 A;  1YJW N;  3QBX A;  1BCM A;  3FR0 A;  4O5F A;  4C8M A;  3SCX A;  3VQ5 A;  4JD2 A;  3T1H K;  4RW7 A;  3ULE B;  2FSK A;  3HK2 A;  3PX0 A;  4ZTJ A;  1LAV A;  3T3F A;  4X64 K;  4K8Z A;  4ID1 A;  4F2S A;  4JKA A;  3M8R A;  4K41 A;  4CGF A;  3VN5 A;  5M1N A;  3I55 N;  4DTO A;  4BRF A;  1BQM A;  1WNS A;  4JI7 K;  1HNX K;  5EOY A;  3NH0 A;  1L3T A;  1D8Y A;  3P39 A;  5AQN A;  3G6E N;  3NHG A;  3L3U A;  4DR7 K;  2HOE A;  1U6Z A;  5BN9 A;  5BRE A;  2A5X A;  3ZT3 A;  1WAJ A;  3VQ6 A;  4HUF A;  4CHY A;  1NJZ A;  1NGE A;  4E7K A;  4GV3 A;  1TKX A;  4HTL A;  3CCL N;  5GAD P;  5AZI A;  2BE2 A;  3O9U A;  5K14 A;  4X65 K;  1Q8I A;  1RT3 A;  1LWC A;  3O9Q A;  2BAN A;  1MA9 B;  3VET A;  4BDY A;  3NH2 A;  4CF8 A;  3WXL A;  1F21 A;  4QS9 A;  3WXI A;  4LF6 K;  2WC9 A;  1RDC A;  3WNH A;  1W97 L;  3D2E A;  1UA0 A;  3LPT A;  4B9U A;  4W5N A;  4FO0 A;  3M8Q A;  2QWM A;  4CEO A;  3DLG A;  5AQW A;  1WBD A;  4H0Y B;  3AGR A;  2X78 A;  1KXP A;  4FWQ A;  3VF6 A;  3QIP A;  4CJV A;  2KHO A;  1J9A A;  3OHR A;  2DFF A;  3QO9 A;  5AJ3 K;  4MDA A;  3AVN A;  3KLG A;  3FZM A;  4CEE A;  3O1B A;  1L3V A;  4LFA K;  3JAM O;  4JKH A;  3G0Z A;  3ZSW A;  2V7Y A;  4BC2 A;  3QER A;  2UUC K;  3O4Q A;  4DU1 A;  4WFN L;  4IO9 L;  2UYT A;  3TAM A;  1L3S A;  4DQS A;  4XEI A;  5FPN A;  4DLE A;  5HBM A;  3OYE A;  4BWJ A;  4CGD A;  4I7F A;  4EHT A;  1XHZ A;  1WAF A;  5DMR A;  4B08 A;  3WNE A;  3H1Q A;  4N76 A;  2Q36 A;  4CD1 A;  4JLH A;  1E4G T;  3PSI A;  3MMV A;  2CH5 A;  3TAR A;  2IVO A;  4EZ9 A;  4GKJ K;  4NXM K;  1EXQ A;  2GBZ A;  4CZJ A;  3AVF A;  4OPA A;  4B8A B;  2AA4 A;  2DFE A;  2WBN A;  1D5A A;  5C25 A;  1VSK A;  2NRH A;  3B8A X;  3K0S A;  4K8X A;  4RW4 A;  4JHD B;  5BPN A;  3M8S A;  5GAH P;  3SQ1 A;  3LDO A;  4CJE A;  2YHA A;  4RCH A;  5JLH A;  3CQY A;  3DLH A;  5HL7 L;  4DQI A;  1B92 A;  3E9L A;  2Z1H A;  2YNF A;  4EZ6 A;  4OPK A;  2JWK A;  1DEJ A;  5M1K A;  2B5J A;  3VA0 A;  1HLU A;  1UAX A;  1ZYQ A;  3DLR A;  3RVC A;  1ILY A;  1SL2 A;  1MWM A;  1NM1 A;  4DU3 A;  5ELZ A;  5EU7 A;  2IOC A;  1JLG A;  4YOR A;  2Q2R A;  4CGH A;  4B1V A;  3CJA A;  2PZS A;  3ZET A;  3RRG A;  5J2M A;  3C6A A;  1OVY A;  3GL1 A;  4Z94 A;  4M3U A;  4WF9 L;  5BRD A;  5C2D A;  1C0F A;  5KGX A;  4DSL A;  1O13 A;  3RRH A;  2ASP A;  1WSH A;  4KHP K;  4FLZ A;  2F9T A;  2PAV A;  5AQH A;  3GDQ A;  4QAG A;  3VTH A;  4BR5 A;  3NGI A;  4KHU A;  2D0C A;  4DR6 K;  2HNZ A;  3C6U A;  2F8S A;  4KKO A;  3AAQ A;  5C42 A;  3HL8 A;  1M90 O;  4ELT A;  5C0Y A;  4OKE A;  1Q9X A;  4B9T A;  1WSI A;  1TVR A;  3PLA A;  4IDH A;  3K59 A;  3DWL A;  2RKI A;  3HST B;  1NU0 A;  3OYI A;  3HO1 A;  1LWF A;  3ZT1 A;  1KAZ A;  1BU6 O;  2OPR A;  3K57 A;  1N5Y A;  4LY7 A;  4V19 S;  4PKH A;  3V1Q A;  3TTF A;  3KJV A;  2YNG A;  4MQ3 A;  1S72 N;  3QLH A;  4MFB A;  2O8F A;  4FPB A;  2G8U A;  3BZK A;  1TUU A;  3OYB A;  2D5R A;  4FPA A;  2JWL A;  4KH6 A;  2YX6 A;  3EN9 A;  4MLE A;  3SLC A;  2QEX N;  1Z05 A;  4FOI A;  3VQ8 A;  3DXM B;  1TL1 A;  1FKP A;  4YOX A;  3L4I A;  4JI8 K;  1RBS A;  2ASM A;  5AR0 A;  2XY6 A;  5C2F A;  5AFU A;  5LMU K;  1NJW A;  4A57 A;  3AO5 A;  4FJI A;  2Q0R A;  3KZB A;  1NKC A;  1A5V A;  3LAK A;  3D7E O;  4AM7 A;  2FBT A;  4CZM A;  2GUI A;  4FW2 A;  4B3S K;  4N41 A;  4AHU A;  4C8L A;  1N36 K;  4FJN A;  2Q31 A;  3CCR N;  1XC9 A;  5LJW A;  2WUS A;  3CJ9 A;  3EE8 A;  4CF9 A;  3EZ5 A;  3CQX A;  5JS2 A;  1HYS A;  3WQU A;  1EET A;  1BWF O;  4CEZ A;  3SPZ A;  1TK8 A;  1RCH A;  2G8I A;  4IJA A;  1A5W A;  1SKR A;  4Y1D A;  1Z25 A;  3I0S A;  4FJK A;  3L3V A;  4CE9 A;  3VOV A;  2HHT A;  4C8K A;  1V4S A;  3S3N A;  4RW8 A;  4O55 A;  3VEO A;  2OAN A;  2Z1J A;  5JLF A;  3TPQ A;  5A2Q O;  1NGC A;  3GOI A;  5ADX H;  3DRP A;  5C12 A;  4CJW A;  5DM7 L;  3QET A;  1RDD A;  4PQU A;  5CYM A;  3HP6 A;  1EQY A;  3QEP A;  1VQK N;  4CK3 A;  1C0T A;  3ZX3 A;  1XHX A;  2X6N A;  2HMI A;  4J2E A;  4DFM A;  2NLX A;  5CZ2 A;  4KTW A;  4JKC A;  3TSP A;  4CIF A;  1FK9 A;  4B9V A;  3LZJ A;  1BHL A;  1FJG K;  3THV A;  2O8C A;  4DHY A;  2HF4 A;  5DK5 A;  4KI4 A;  1NJX A;  3CFR A;  4IEE A;  2XHB A;  1T05 A;  4HUG A;  4FWS A;  2KW4 A;  3ZT0 A;  3KK3 A;  4AQY K;  4H0P A;  2YHX A;  5FRN A;  2DY4 A;  1S6Q A;  2P9I A;  4HHT A;  4IFE A;  3EZW A;  5GAE P;  4X66 K;  3N4Q A;  1BA0 A;  3HPG A;  4JV5 K;  4OPJ A;  2A42 A;  1Q82 O;  1J54 A;  2UU9 K;  1NLV A;  4H4M A;  2DTU A;  4DTM A;  1WBB A;  5JVG L;  4LFC K;  2P9U A;  1D9F A;  1GLJ O;  3MX5 A;  5AZJ B;  4CF1 A;  3DXK B;  4JAX A;  4GVM A;  1N34 K;  4LH5 A;  1GOC A;  3DM2 A;  3C95 A;  1HJO A;  5KPR A;  3CC2 N;  4E1J A;  4Z4G A;  3AO4 A;  1TK5 A;  3VEW A;  4CHO A;  1RNH A;  3NGY A;  1NGJ A;  5J2N A;  1BI4 A;  3OJS A;  3V4I A;  3T69 A;  3A5M C;  3WEE B;  3O8M A;  3DXK A;  1BIZ A;  1QQO A;  2DPN A;  3HVT A;  4DUZ K;  4BRN A;  1VQ8 N;  2VG5 A;  3UKR B;  3UB5 A;  3K5M A;  3WXM B;  2HHS A;  5AQM A;  1WSE A;  3CCV N;  1Y97 A;  3V6D A;  4XIU A;  3LAM A;  1T44 A;  5JIC A;  4HTU A;  1QHT A;  3VGL A;  4FM0 A;  2IVP A;  1XNR K;  1K6Y A;  4CBW A;  2VGM A;  4RTF D;  4JRP A;  1IKX A;  2P9K A;  2P9N A;  4A5A A;  2CGJ A;  3CM5 A;  1RTJ A;  3AVL A;  2D0B A;  4C1N I;  4MO5 A;  2WOM A;  4BVO A;  2RPI A;  3V9W A;  3DJC A;  4O0J A;  3T19 A;  1X9J A;  1T6C A;  1TV6 A;  4CED A;  4OKK A;  4JRQ A;  1NOY A;  2E8A A;  2KFN A;  1J5O A;  3G10 A;  1U4B A;  3MWT A;  3BZC A;  2RHK A;  1YJN N;  1NK6 A;  3QFP A;  1IV0 A;  1XUP O;  2I7P A;  3AY9 A;  3SMP A;  3VEV A;  3HYF A;  3PSF A;  4Z4F A;  3H08 A;  2VCP A;  2OA8 A;  5MLC Q;  4YOU A;  1NGD A;  3G71 N;  2FXU A;  3UE5 A;  5GIN A;  4GMJ B;  1HRH A;  1QQC A;  3SQ4 A;  4CJU A;  5SZT A;  4H5N A;  5F2R A;  4EFH A;  4PWD A;  4YFU A;  4O44 A;  1M1K O;  4H03 B;  1QSS A;  3EY1 A;  2F4V K;  3VES A;  2W41 A;  1ZBI A;  1GLF O;  3I33 A;  1RIL A;  3CCU N;  1BG3 A;  3SV4 A;  4W5T A;  2OTL N;  3OYH A;  3KKR A;  2IDO A;  4FZX C;  5F0X A;  3LWM A;  1EWQ A;  1HYV A;  4FL9 A;  3FE1 A;  2WFB A;  4R79 A;  3M8P A;  2KFZ A;  4BWM A;  4FJG A;  1JXB A;  4DTU A;  2F9W A;  2X6S A;  1VQL N;  3DLK A;  4DTX A;  4LH4 A;  1IBL K;  1K8A O;  1HNZ K;  1TYQ A;  2Q0U A;  3TAB A;  4X62 K;  3RTV A;  3PX6 A;  1VSH A;  3LWL A;  3HVR A;  4FJ9 A;  4UY8 O;  2W6K A;  3M6G A;  4BR2 A;  2HHQ A;  3H46 O;  4H0T B;  5AQS A;  4GY2 B;  1HQU A;  1VQO N;  5LL6 Z;  3B6O A;  1OH7 A;  1U2V A;  4I9L A;  1VRT A;  4C8O A;  1T7P A;  4B1U B;  2G8H A;  5BR9 A;  3A5N C;  2QWQ A;  2HF3 A;  4TSX A;  4OGE A;  1QSY A;  3NFA A;  3E9P A;  1JLA A;  1S1V A;  3C65 A;  4KB1 A;  4E1M A;  3SMS A;  5GAG P;  3I8D A;  4ISG A;  3VEN A;  4DSK A;  4JS4 A;  2KKZ A;  4FLT A;  4DMN A;  3NF7 A;  4N5S A;  1K8K A;  4NLB A;  4CF0 A;  3CPE A;  1S1X A;  2XY8 A;  2ZD1 A;  3Q7B A;  1BIU A;  4E7H A;  1E3M A;  3K9J A;  2ZE2 A;  3A5L C;  2XY7 A;  3VQA A;  4B9S A;  4XH1 A;  5BN8 A;  2KZZ A;  1QVG M;  4DB3 A;  3KLH A;  3OBW A;  3QIC A;  4M3Z A;  4JD2 B;  3DI6 A;  2VQE K;  4KAZ A;  4DLG A;  3NGZ A;  5HRN A;  2P9P B;  2IIR A;  3UKU A;  4JNE A;  3LDQ A;  4CGJ A;  5CYQ A;  1S1U A;  2OYQ A;  2JGU A;  3FGU A;  2AP1 A;  1EX4 A;  4B1Y B;  4FVU A;  5IT9 O;  4J2A A;  1GLA G;  4BVP A;  3QB0 A;  1W0H A;  4BRA A;  5JVH L;  2D1K A;  4IJN A;  3OYK A;  3WNF A;  2P9P A;  3VQE A;  4Z0U A;  3NCI A;  1DTQ A;  2J4R A;  4KHS A;  1SQK A;  3MN9 A;  3HT3 A;  3CJ1 A;  3V9X A;  5GIP A;  4CK1 A;  3NDK A;  3NVM A;  3CPW M;  5AZI B;  3TAF A;  4BRM A;  3MN7 A;  3SPY A;  5I42 A;  3MK6 A;  1VQ5 N;  3FZK A;  4DUY K;  4DQP A;  3KD5 E;  4ILG B;  4YNQ A;  2QXL A;  1NK5 A;  3VEY A;  1OH5 A;  2NRR A;  1RDB A;  1NGH A;  2IC3 A;  4GW6 A;  3THW B;  4C8N A;  1C0G A;  4PL7 A;  1JJ2 M;  3OA9 A;  3D2E B;  4ISE A;  3RMB A;  3KK1 A;  3L2W A;  1BL3 A;  2ZGY A;  3D0P A;  1NK8 A;  3PO4 A;  3AO3 A;  3LDL A;  5CR4 A;  5AQV A;  1YVN A;  1WB9 A;  4BC5 A;  2O8B A;  1NK9 A;  1YT3 A;  3BP8 A;  5BPM A;  1W2B M;  3F9M A;  3CCJ N;  3VEX A;  3THW A;  1HX1 A;  4M41 A;  3J7Y P;  3V1O A;  1X3M A;  4CCH A;  3AVK A;  1HNI A;  1JLB A;  1UWB A;  4BY9 C;  1XQS C;  3CER A;  4NYF A;  3F2K A;  3OVN A;  3HRG A;  4Y1C A;  3CMA N;  4KPY A;  3F5T A;  4IWV A;  3TAN A;  3V1R A;  1C0M A;  1VQ7 N;  4CFD A;  1SS6 A;  4ELU A;  5AQL A;  4B1W B;  1CLQ A;  3SJH A;  3V9Z A;  1KD1 O;  3DRR A;  1N32 K;  2DFH A;  2QWL A;  4DTP A;  3MXJ A;  1NK7 A;  4IFY A;  4Q5V A;  4F9O A;  1CZA N;  1HPM A;  2WTU A;  4OKJ A;  3IS9 A;  4KFB A;  3S3O A;  4IG0 A;  4IKF A;  3CD6 N;  4CIG A;  3JYT A;  4K0K K;  3AVH A;  5E84 A;  3TAE A;  5F1X A;  1DTT A;  1BUP A;  3V9U A;  3MWP A;  1VQP N;  2YHY A;  4H5V A;  4I6M A;  4CBX A;  3S3M A;  3AA3 A;  4BR4 A;  3R9P A;  2NRW A;  4YOV A;  3SQ0 A;  2P1J A;  2E5L K;  4DQ8 A;  4OO1 J;  2HBJ A;  1LWE A;  4DV0 K;  3TAP A;  2QTD A;  4LFB K;  4BRG A;  1SZ2 A;  4KH4 A;  4FXD A;  3ALY A;  4QS8 A;  4EIA A;  3ZET B;  2CH6 A;  2ZJQ L;  1QQN A;  1NK4 A;  4IO8 A;  1RBU A;  5AQZ A;  4CZF A;  5KPZ A;  2W6L A;  1KAY A;  5E26 A;  5C24 A;  3OYN A;  4J8F A;  1SAZ A;  3O6W A;  2NRZ A;  4FJL A;  3E1Y A;  1N6Q A;  3TSQ A;  4CEB A;  3HM9 A;  4HUE A;  3KK2 A;  5I9E B;  1LW0 A;  3QIO A;  4KHY A;  3H3O B;  4DKW A;  2GX9 A;  3H1V X;  3OYL A;  4IOX A;  3AA2 A;  3VTI A;  2GWK A;  1J5E K;  1T03 A;  1W9H A;  3QIN A;  3T7Z A;  3U6F A;  3AVB A;  4YOW A;  1OKJ A;  4H5W A;  1VSD A;  2ZWH A;  4BRK A;  5HRS A;  1RFQ A;  4KI6 A;  1RT5 A;  2O8F B;  3QFU A;  3QEW A;  2F8T A;  2G8K A;  1S6P A;  2XRI A;  4NO7 A;  3DOL A;  5FRM A;  3MXI A;  3VF4 A;  4BAC A;  1T8E A;  4JI2 K;  1KAX A;  2E2O A;  4DTS A;  2CGL A;  4BR0 A;  3G25 A;  2VYP A;  4CJK A;  5H1S Q;  4BRI A;  3ZT4 A;  3O3G A;  1X9W A;  3S41 A;  4CHP A;  1IKV A;  1DKG D;  3HTV A;  1YIT N;  3ENO A;  3SYZ A;  2G8W A;  1H1V A;  5SWM A;  4DR4 K;  2WON A;  1NMN A;  1Q86 O;  4Z4I A;  1CXU A;  4NXN K;  3HP9 A;  4XH4 A;  2ZGZ A;  3K5L A;  3F9K A;  4CZH A;  1TKZ A;  4DFP A;  1IG9 A;  3IDH A;  3ITH A;  4EHU A;  2QKK A;  1SV5 A;  4GV9 A;  1VSJ A;  3O9S A;  1S9E A;  1A5X A;  2E88 A;  5J2Q A;  3M1F A;  4CFB A;  3VEZ A;  2HMP A;  2ITM A;  3ZSY A;  1L5U A;  1U49 A;  3K5N A;  1LV5 A;  1YF5 L;  3P4I A;  3NE6 A;  2OZM A;  2GUP A;  1BOT O;  1FKO A;  3BF3 A;  3R6M A;  4DV5 K;  3PO5 A;  1RBV A;  4NCA A;  4FJM A;  2H3G X;  1R59 O;  3LL3 A;  5DM6 L;  4FOE A;  3U4L A;  4NYN A;  1KVA A;  1HNW K;  1KRP A;  1P90 A;  4WQ4 A;  1JKH A;  1HKC A;  2QA4 N;  2OCE A;  4H8K A;  3HM8 A;  3ID6 A;  5AQQ A;  4B8C A;  4BC4 A;  3MCA B;  3CJB A;  3VQ9 A;  4DF4 A;  3RR7 A;  3C0B A;  4FWK A;  4KO0 A;  3MXM A;  3W3D A;  1JCE A;  4PKG A;  4KH5 A;  3EKU A;  1VQ6 N;  4CK2 A;  2O8C B;  3RMC A;  3L0Q A;  3THX A;  1GLD G;  3WUH A;  4AHR A;  5EY4 A;  3J81 O;  4FLX A;  5FDL A;  2HBK A;  4N56 A;  5M1P A;  4E7I A;  2E4L A;  3SBG A;  2GEM A;  3FLC O;  2NNW A;  4RG8 A;  1I3A A;  3ATV A;  3OW2 M;  1IKY A;  4PKI A;  2P9I B;  5BRH A;  3CC4 N;  2ZJP L;  3GBT A;  2QWO A;  4FWR A;  4H5T A;  4KTQ A;  1S3X A;  4M3W A;  4WYB A;  3QEX A;  4ILJ A;  1OVQ A;  4JKG A;  5J1E A;  4Z4E A;  4RWT A;  2O4G A;  3QML A;  4L3Q A;  3C6H A;  1ZC6 A;  2P9U B;  4K43 A;  3DOK A;  2CGK A;  1TAQ A;  4FSV A;  2HHH K;  3D2F A;  3HJF A;  4KHQ A;  3CME N;  2YKM A;  3AVG A;  4BQL A;  5D3G A;  5KI6 A;  2A40 A;  3VQD A;  1NBW A;  3ID8 A;  4E3S A;  3U8X A;  2QWN A;  4CJL A;  5CE3 A;  5KQ8 A;  3NF9 A;  2E2N A;  4E7L A;  1NK0 A;  1BI4 B;  4FJ5 A;  4H0X B;  1C1B A;  3O9R A;  3ZSZ A;  2OZS A;  3AAP A;  2AJQ A;  4CJR A;  3ASM A;  1NJY A;  1FXX A;  1ASW A;  4JN4 A;  4JKD A;  3QDK A;  4FJ7 A;  4YDU C;  3A0I X;  5AQT A;  3SQ2 A;  3RSE A;  4CEF A;  3E01 A;  2BTF A;  3J80 O;  5I3U A;  5KGW A;  2KTQ A;  2PBD A;  3WQT A;  1XMQ K;  1X3N A;  3ZEU A;  1CZB A;  4BRE A;  2P9K B;  2FBY A;  2P9N B;  4FM2 A;  3S9H A;  3BGR A;  5LMN K;  5AQI A;  4KHW A;  4CJP A;  4IEI A;  2VWK A;  2ZF5 O;  4O0I A;  1LOT B;  4DS4 A;  2UXB K;  3LDS A;  3THY A;  4IZ9 A;  2FBV A;  5CY4 A;  3SAG A;  1NGB A;  1Y64 A;  1D9D A;  2YHB A;  4IOA L;  5AQG A;  2VGN A;  4BGB A;  4FWN A;  2YCH A;  4MDB A;  3ZCM A;  3ZX2 A;  4O4G A;  3TSU A;  4CJ4 A;  3O3H A;  3MN6 A;  1ASU A;  3HOS A;  4UQG A;  1EO1 A;  3LP0 A;  4BE0 A;  1VHX A;  1DT9 A;  4KV8 A;  5BRF A;  2QM1 A;  2Q3S A;  4PY5 A;  1VK0 A;  4M63 C;  1REV A;  4MLH A;  2I7N A;  4Z4H A;  3DRS A;  3KIO A;  1EWR A;  3AVA A;  4EP5 A;  1IBM K;  4BR7 A;  4DR1 K;  1ZBH A;  3MEE A;  4LF7 K;  3P5J A;  4BRQ A;  3CJC A;  4RW6 A;  4FZY A;  3VQ7 A;  3ATU A;  4CD3 A;  4JEP A;  4ILH A;  1QTM A;  4QCL A;  4FWM A;  5ADX A;  2NZT A;  4CF2 A;  3TTD A;  4FJJ A;  4E0D A;  3CET A;  3SNN A;  3L6Q A;  1IG8 A;  4AIL C;  1S1T A;  3ENB A;  3VQC A;  1HKB A;  3IAY A;  4YOT A;  2A6A A;  3MEG A;  1TYQ B;  4CEQ A;  1NGA A;  4JS5 A;  4W5Q A;  3JS6 A;  4Y0W A;  5KRT A;  3WT0 A;  4KHN A;  2E1Z A;  4M3T A;  3MDQ A;  1FW6 A;  1B9D A;  2EX3 A;  4F3T A;  4CHQ A;  4LF4 K;  4AHT A;  2YKN A;  3K9K A;  3GE1 A;  1GOB A;  2B6A A;  1U2V B;  1SL0 A;  3CXC M;  1GOA A;  3AVI A;  4CGI A;  4BRL A;  3LM9 A;  4W5R A;  1NWK A;  2R7Y A;  2FLO A;  1NG9 A;  3OTO K;  4CIE A;  3RR8 A;  1EP4 A;  2RE2 A;  3CI5 A;  3SAF A;  1XC3 A;  1HMV A;  4ELV A;  3LP1 A;  1TAU A;  2PYJ A;  3H3N O;  2GV9 A;  2P9S A;  4OX9 K;  3UIQ A;  3OYJ A;  2HHV A;  2NRX A;  2RN2 A;  1K8K B;  3KLF A;  4GKK K;  3AGK A;  2G8V A;  1GLB G;  1V4T A;  3U3G A;  2YNH A;  2W40 A;  3ZT2 A;  2O8D A;  4OPH A;  1IO2 A;  1X9S A;  1TUY A;  3H45 C;  1GLL O;  1TKT A;  4BRC A;  3IG1 A;  5BR8 K;  3D6R A;  3AVM A;  3C7N A;  4BRO A;  3U9Z A;  4FYD A;  4DV3 K;  1QS4 A;  1S22 A;  4CEC A;  3UKU B;  5M1F A;  4OLA A;  2ETJ A;  4CJQ A;  5JS1 A;  2P51 A;  2HST A;  1RTD A;  3O3F A;  4Q0B A;  3CFO A;  4BE1 A;  4ZTF A;  1RDW X;  2P9L A;  1RBT A;  5TKW A;  3VQQ A;  3E66 A;  4CI6 A;  4ISF A;  2F96 A;  2VG6 A;  1W7A A;  1MDU B;  1ZXO A;  2OPQ A;  2QW9 A;  2XO7 A;  5AQF A;  3HOT A;  5C10 A;  1YJ9 N;  5E41 A;  1YHQ N;  1Q81 O;  3B6P A;  2B4J A;  2BGG A;  1VSE A;  2HVH A;  3N4P A;  2FBX A;  4WFA L;  4IOC L;  1NKE A;  1NNE A;  1JLE A;  1DGK N;  2D0A A;  3OYM A;  2VWB A;  2YNI A;  3OS0 A;  3SV3 A;  1C1A A;  4QOZ B;  3SK3 A;  1MU2 A;  1N8R O;  3VA3 A;  4IFV A;  1KSP A;  3BUZ B;  3OS1 A;  5HRR A;  3TU5 A;  4DR2 K;  1ATN A;  3KWI A;  1Z26 A;  4AHC A;  4G1Q A;  4JYA K;  1QQM A;  3QEI A;  3PUF A;  1L3U A;  4JKB A;  3EO3 A;  1N33 K;  3O5B A;  4WQ5 C;  1WSG A;  5AQP A;  4WFB L;  3L2Q A;  5AQJ A;  3LPU A;  1JLF A;  2O8B B;  1KTQ A;  3OYF A;  3WXJ A;  4CZG A;  3CQ8 A;  4DFJ A;  2UUB K;  2O8E A;  1WN7 A;  2NUB A;  3R3L A;  3OS2 A;  2VQF K;  3AA4 A;  3MED A;  5HOO A;  3RMD A;  3OYG A;  3MN5 A;  1WSF A;  1ATR A;  1SUQ A;  3ULE A;  3O4N A;  3V9S A;  3SBT A;  3CC7 N;  3L2V A;  4DS5 A;  4DSE A;  3P1G A;  1B9F A;  1KVB A;  2EWS A;  3LAL A;  1T3V A;  3MEC A;  1HQE A;  5FLX O;  1ZBS A;  2D0P A;  4CBU A;  1S5J A;  4RW9 A;  4W5O A;  3L2R A;  3MAQ A;  1Q18 A;  3LP3 A;  2E6L A;  4DQQ A;  4LF9 K;  1NKB A;  1Q9Y A;  2IAJ A;  3VMF B;  4DV4 K;  2E2P A;  3DMJ A;  1QE1 A;  1WSJ A;  4LD0 A;  3AVJ A;  4OVL A;  4M42 A;  3CYM A;  1LW2 A;  3CIP A;  3IUC A;  4HWI A;  2KQ2 A;  4DSI A;  3TTC A;  1BQN A;  4O5B A;  1RTH A;  4K25 A;  4DSF A;  3ZSO A;  3QES A;  3IMX A;  4BRH A;  1VQ4 N;  3EEQ A;  1KLN A;  4DV7 K;  1TGO A;  4I6M B;  4CGG A;  3V81 A;  2HBL A;  1BIS A;  3NVK A;  1KFS A;  3SUN A;  1RT7 A;  4CFC A;  5AQY A;  3SAH A;  4FLW A;  1RTI A;  4C1N K;  2YI1 A;  4B3R K;  4F8R A;  3U9D A;  3HXM A; 
#chains in the Genus database with same CATH homology
 3NF8 A;  4DTR A;  3HP9 A;  4FZZ A;  3K5L A;  5FRO A;  3F9K A;  3K58 A;  3PX4 A;  4Z4G A;  1TKZ A;  3AO4 A;  4DFP A;  1TK5 A;  4CHO A;  1IG9 A;  1RNH A;  4FK0 A;  1YTU A;  1CXQ A;  3ITH A;  3NGY A;  4M45 A;  4AHS A;  2X74 A;  2QKK A;  4FVM A;  1SV5 A;  5J2N A;  1BI4 A;  3OJS A;  3V4I A;  3KTQ A;  1VSJ A;  2VG7 A;  1BIZ A;  1A5X A;  1S9E A;  1JLQ A;  3HVT A;  5T7B A;  5J2Q A;  4ZHR A;  4CFB A;  1VSI A;  1VSF A;  3ZSY A;  1L5U A;  1U49 A;  3K5N A;  4J2D A;  3U3Y A;  2O4I A;  2VG5 A;  1LV5 A;  3K5M A;  2RF2 A;  3SUO A;  2HHS A;  1WSE A;  2I5J A;  4FK4 A;  3NE6 A;  1Y97 A;  1C1C A;  3KLE A;  2ZQB A;  4XIU A;  3LAM A;  3CFP A;  4HTU A;  1FKO A;  3V6D A;  2OZM A;  1QHT A;  3VQP A;  4FM0 A;  1KCF A;  3PO5 A;  1RBV A;  3AO1 A;  4HVJ A;  4E1N A;  4NCA A;  1K6Y A;  4FJM A;  3NF6 A;  2QK9 A;  4JRP A;  4NYN A;  1KVA A;  1IKX A;  4OGC A;  2HND A;  1KRP A;  3CM5 A;  4I2P A;  1RTJ A;  3AVL A;  4FLY A;  2D0B A;  1TKD A;  2WOM A;  4FLV A;  2PY5 A;  1JKH A;  1KVC A;  2RPI A;  4FJH A;  3SI6 A;  3V9W A;  4O0J A;  3T19 A;  4DF8 A;  4H8K A;  3CG7 A;  1TV6 A;  3QNO A;  4CED A;  4OKK A;  4JRQ A;  4B8C A;  1ZBL A;  1NOY A;  1BCM A;  4C8M A;  3SCX A;  3VQ9 A;  3VQ5 A;  3EYZ A;  4DF4 A;  3RR7 A;  3DLE A;  3L8B A;  4F2R A;  4CER A;  1J5O A;  4RW7 A;  3G10 A;  2KFN A;  1U4B A;  4KO0 A;  4E89 A;  3HK2 A;  3PX0 A;  4ZTJ A;  3OY9 A;  3MXM A;  1LAV A;  3T3F A;  4K8Z A;  1NK6 A;  4ID1 A;  3TAQ A;  4F2S A;  4KRF A;  3M8R A;  3HYF A;  4CGF A;  3VN5 A;  4CK2 A;  4DTO A;  3RMC A;  4Z4F A;  1BQM A;  3H08 A;  2OA8 A;  1WNS A;  4AHR A;  3OJU A;  3ZSQ A;  4FLX A;  2E6M A;  5FDL A;  3NH0 A;  4GMJ B;  1HRH A;  4N56 A;  1QQC A;  4E7I A;  1L3T A;  2E4L A;  4FM1 A;  1D8Y A;  3SQ4 A;  4CJU A;  5SZT A;  4DWI A;  4RG8 A;  1U04 A;  4I2Q A;  4CEA A;  1O1W A;  4PWD A;  4YFU A;  1I3A A;  4O44 A;  1IKY A;  3L3U A;  3NHG A;  4FJ8 A;  1QSS A;  4M3X A;  3EY1 A;  3ZT3 A;  1WAJ A;  4KTQ A;  3VQ6 A;  1ZBI A;  1RIL A;  3NH1 A;  2HHX A;  4HUF A;  3RMA A;  5HLF A;  4OLB A;  4C8K A;  3SV4 A;  4W5T A;  2HW3 A;  4M3W A;  4CHY A;  1NJZ A;  1HYZ A;  4E7K A;  3QEX A;  5J1E A;  4Z4E A;  3OYH A;  3KKR A;  1TKX A;  2IDO A;  2O4G A;  5KTQ A;  3LWM A;  3PY8 A;  4FZX C;  4CJ5 A;  1UA1 A;  1HYV A;  2BE2 A;  3DOK A;  5K14 A;  1YTA A;  1TAQ A;  3FFI A;  1Q8I A;  4IDK A;  1RT3 A;  1LWC A;  4BDY A;  2BAN A;  3M8P A;  3NH2 A;  2KFZ A;  4BWM A;  4FJG A;  5HRP A;  1JXB A;  4CF8 A;  4DTU A;  2X6S A;  1JLC A;  1F21 A;  3DLK A;  4KHQ A;  3HJF A;  4DTX A;  4LH4 A;  2YKM A;  3AVG A;  4Z4C A;  1X1P A;  5D3G A;  4KRE A;  5KI6 A;  3VQD A;  3TAB A;  1X9M A;  1RDC A;  3WNH A;  1VRU A;  3RTV A;  3PX6 A;  1VSH A;  3LWL A;  3HVR A;  4FJ9 A;  4E3S A;  1UA0 A;  3LPT A;  4CJL A;  4B9U A;  4W5N A;  4WE1 A;  1RT4 A;  2HHQ A;  3M8Q A;  3NF9 A;  4CEO A;  3DLG A;  1HQU A;  2P5G A;  4E7L A;  2LSN A;  3B6O A;  1BI4 B;  1NK0 A;  4FJ5 A;  1C1B A;  4DU4 A;  3ZSZ A;  2X78 A;  4J2B A;  2OZS A;  2AJQ A;  4I9L A;  1VRT A;  4C8O A;  1T7P A;  3QIP A;  4CJV A;  1WLJ A;  1J9A A;  4CJR A;  5J2P A;  2DFF A;  3QO9 A;  2G8H A;  3AVN A;  3KLG A;  4HCB A;  3ASM A;  1NJY A;  1FXX A;  4CEE A;  4TSX A;  1RT2 A;  1ASW A;  4OGE A;  4CJF A;  3L2U A;  1L3V A;  3AA5 X;  3RWU A;  5KRS A;  1QSY A;  3G0Z A;  3NFA A;  3ZSW A;  1JLA A;  1S1V A;  3QER A;  4FJ7 A;  3O4Q A;  1TL3 A;  4DU1 A;  3SQ2 A;  4KB1 A;  4E1M A;  2HHT A;  3C6T A;  3TAM A;  4CEF A;  1VSM A;  3E01 A;  4HCC A;  5I3U A;  1L3S A;  3I8D A;  3JSM A;  4F3O A;  5KGW A;  4DSK A;  2KTQ A;  4JS4 A;  4FLT A;  1RDA A;  3ZSR A;  4DQS A;  1U47 A;  4DMN A;  4DSJ A;  1CZB A;  3NF7 A;  4KTZ A;  4N5S A;  4NCB A;  2FBY A;  5HBM A;  3OYE A;  4DLE A;  4FM2 A;  4PUO A;  3S9H A;  4CF0 A;  3BGR A;  1S1X A;  4BWJ A;  4I7F A;  2XY8 A;  4CGD A;  2ZD1 A;  1XHZ A;  1WAF A;  3A2F A;  4CJP A;  1BIU A;  4KHW A;  5DMR A;  4E7H A;  2VWK A;  2ZE2 A;  4F4K A;  4AH9 A;  4DTJ A;  4O0I A;  4B08 A;  3WNE A;  4DS4 A;  2XY7 A;  3LDS A;  3VQA A;  4B9S A;  2FBV A;  2KZZ A;  5CY4 A;  3KLH A;  1UOC A;  4N76 A;  1D9D A;  2YHB A;  4M3Z A;  3BDP A;  3DI6 A;  3CM6 A;  1RT1 A;  1SL1 A;  3SUQ A;  4JLH A;  4KAZ A;  1HJR A;  4DLG A;  3TAR A;  3ZCM A;  5HRN A;  3NGZ A;  1SKW A;  4EZ9 A;  4O4G A;  1HPZ A;  2A1R A;  4CJ4 A;  3O3H A;  1ASU A;  4CGJ A;  4E19 A;  4UQG A;  1EXQ A;  5CYQ A;  2GBZ A;  3LP0 A;  1S1U A;  3AVF A;  4BE0 A;  4B8A B;  2DFE A;  4KV8 A;  2OYQ A;  1D5A A;  2JGU A;  5C25 A;  1VSK A;  1J53 A;  3VQ4 A;  1EX4 A;  2Q3S A;  4J2A A;  4K8X A;  4RW4 A;  1VK0 A;  4B3O A;  1REV A;  1W0H A;  4PY5 A;  3IRX A;  4Z4H A;  3DRS A;  3M8S A;  3KIO A;  3SQ1 A;  4CJE A;  2YHA A;  3AVA A;  2EHG A;  4EP5 A;  3DLH A;  4DQI A;  3OYK A;  3WNF A;  1ZBH A;  1B92 A;  3P83 D;  3MEE A;  4Z0U A;  3VQE A;  4EP4 A;  2Z1H A;  2YNF A;  3NCI A;  1DTQ A;  3P5J A;  4OPK A;  4EZ6 A;  4KHS A;  4I9Q A;  4RW6 A;  4FZY A;  3HT3 A;  3TI0 A;  3VQ7 A;  1C0U A;  3TAG A;  1ZBU A;  2KZM A;  1EKE A;  2B5J A;  3V9X A;  3VA0 A;  1QTM A;  1UAX A;  4QCL A;  5HP1 A;  1ZYQ A;  3DLR A;  4CF2 A;  2G8F A;  4CK1 A;  3OYA A;  3NDK A;  1SL2 A;  4E0D A;  4FJJ A;  4DU3 A;  2HVI A;  3DYA A;  5I42 A;  5EU7 A;  3TAF A;  2IOC A;  1JLG A;  3SPY A;  3SNN A;  1QSL A;  4B9L A;  4CGH A;  4AIL C;  2PZS A;  1I39 A;  1S1T A;  1VSL A;  3RRG A;  4DQP A;  3KD5 E;  4FLU A;  5J2M A;  3ZSX A;  1NK5 A;  4YNQ A;  3DLB A;  3VQC A;  3LZI A;  4M3U A;  1YVU A;  3IAY A;  5KGX A;  2PYL A;  1RDB A;  2IC3 A;  4DSL A;  4GW6 A;  3MEG A;  4C8N A;  4CEQ A;  4JS5 A;  3RRH A;  4W5Q A;  4M3Y A;  3HO1 A;  4IG3 A;  5KRT A;  3PV8 A;  1ASV A;  4KHN A;  3I0R A;  1WSH A;  3RMB A;  4M3T A;  2IGI A;  3KK1 A;  3L2W A;  1BL3 A;  1B9D A;  2EX3 A;  3D0P A;  1C6V A;  4FLZ A;  4F3T A;  1NK8 A;  3NGI A;  4QAG A;  4CHQ A;  3PO4 A;  4AHT A;  2YKN A;  4CJT A;  4KHU A;  2D0C A;  3ZSV A;  1GOB A;  2B6A A;  1RBR A;  3AO3 A;  1SL0 A;  2QKB A;  2HNZ A;  3C6U A;  2F8S A;  1NK9 A;  1GOA A;  3AVI A;  1YT3 A;  4KKO A;  4CGI A;  3ULD A;  5C42 A;  3HL8 A;  4W5R A;  4ELT A;  2R7Y A;  3OYD A;  3C94 A;  1G15 A;  4OKE A;  1U48 A;  4CIE A;  3RR8 A;  1EP4 A;  3LAN A;  1Q9X A;  4M41 A;  3V1O A;  3QEV A;  2XY5 A;  4B9T A;  1HMV A;  4CCH A;  1DLO A;  3AVK A;  1WSI A;  1HNI A;  1TVR A;  3LP1 A;  4ELV A;  1TAU A;  3K59 A;  4CJS A;  1JLB A;  2RKI A;  3HST B;  2PYJ A;  3OYI A;  2GV9 A;  1LWF A;  3KKS A;  1UWB A;  1IKW A;  1BGX T;  2OPR A;  3ZT1 A;  3K57 A;  3UIQ A;  2Z1I A;  1N5Y A;  4LY7 A;  3OYJ A;  3NBP A;  4NYF A;  3V1Q A;  4CHN A;  2RN2 A;  1RT6 A;  3SZ2 A;  2HHV A;  3KJV A;  4KB0 A;  2YNG A;  3OVN A;  4MQ3 A;  3QLH A;  4Y1C A;  3KLF A;  2P5O A;  4MFB A;  4KPY A;  2G8V A;  3TAN A;  3K2P A;  2G8U A;  3V1R A;  1C0M A;  3KLI A;  3U3G A;  4CFD A;  3NAE A;  4ELU A;  4FJX A;  2YNH A;  4PA1 A;  3ZT2 A;  2QXF A;  3OYB A;  1KLM A;  2D5R A;  1CLQ A;  2Y1I A;  1HNV A;  1IO2 A;  4BE2 A;  1X9S A;  1TK0 A;  4E7J A;  4CHZ A;  3V9Z A;  1XI1 A;  1TKT A;  3DRR A;  2DFH A;  4DTP A;  3IG1 A;  3LP2 A;  3AVM A;  3MXJ A;  1NK7 A;  3SUP A;  4IFY A;  4Q5V A;  2VWJ A;  4DG1 A;  4FYD A;  1QS4 A;  4OKJ A;  4CEC A;  3IS9 A;  2HHW A;  4KFB A;  4FCY A;  1BCO A;  3S3O A;  2ETJ A;  4CJQ A;  3VQ8 A;  4OLA A;  5JS1 A;  2P51 A;  4IG0 A;  1RTD A;  3QNN A;  4IKF A;  1TL1 A;  1FKP A;  4CIG A;  3O3F A;  3JYT A;  4Q0B A;  3AVH A;  1RBS A;  3CFO A;  4BE1 A;  4ZTF A;  3HPO A;  2XY6 A;  4DQR A;  3TAE A;  1DTT A;  4FW1 A;  1NJW A;  3V9U A;  1RBT A;  2W42 A;  4DTN A;  3AO5 A;  2FC0 A;  3VQQ A;  4FJI A;  1NKC A;  1A5V A;  3S3M A;  3LAK A;  3D45 A;  2F96 A;  2FBT A;  2GUI A;  2HNY A;  1CZ9 A;  2VG6 A;  3AA3 A;  4FW2 A;  4AHU A;  4C8L A;  4N41 A;  2JLE A;  2OPQ A;  4AHV A;  4FJN A;  1ITG A;  2XO7 A;  3SQ0 A;  1S9G A;  1JL2 A;  1XC9 A;  2P1J A;  1NOZ A;  5E41 A;  4CF9 A;  3EZ5 A;  3B6P A;  1LWE A;  4M3R A;  2ITG A;  2B4J A;  5JS2 A;  1HYS A;  2BGG A;  1VSE A;  2HVH A;  3TAP A;  1EET A;  3K5O A;  4CEZ A;  3SPZ A;  1TK8 A;  1RCH A;  2G8I A;  2OPS A;  2FBX A;  4FXD A;  3ALY A;  1S1W A;  1A5W A;  3VQB A;  1NKE A;  1SKR A;  1JLE A;  2D0A A;  3OYM A;  4Y1D A;  1Z25 A;  2YNI A;  3I0S A;  3OS0 A;  3SV3 A;  1C1A A;  1NK4 A;  4FJK A;  1RBU A;  3L3V A;  1R0A A;  4QOZ B;  1IH7 A;  4BDZ A;  4CE9 A;  3F73 A;  1MU2 A;  1ZBF A;  3VA3 A;  4IFV A;  3S3N A;  4RW8 A;  3OS1 A;  1KSP A;  5HRR A;  4BDP A;  4O55 A;  1Z26 A;  5C24 A;  3TR8 A;  3OYN A;  4LSN A;  4AHC A;  4G1Q A;  4FJL A;  2Z1J A;  1N6Q A;  4CEB A;  4L8R B;  3QEI A;  3HM9 A;  4ID5 A;  3PUF A;  1L3U A;  4HUE A;  3DRP A;  3KK2 A;  1LW0 A;  2YV0 X;  4CJW A;  1WSG A;  3QET A;  3QIO A;  4R5P A;  1RDD A;  3L2Q A;  1SKS A;  2OPP A;  3LPU A;  1JLF A;  5CYM A;  4KHY A;  4PQU A;  1KTQ A;  3OYF A;  3CQ8 A;  4DFJ A;  3HPH A;  3HP6 A;  3OYL A;  4B9M A;  3QEP A;  1WN7 A;  4CK3 A;  2NUB A;  3AA2 A;  1C0T A;  3OS2 A;  3KD1 E;  2X6N A;  1XHX A;  2ATQ A;  3ISN C;  4FK2 A;  3AA4 A;  1T03 A;  3MED A;  1W9H A;  3RMD A;  2HMI A;  3QIN A;  3OYG A;  4DFM A;  3U6F A;  4J2E A;  1WSF A;  3AVB A;  5CZ2 A;  4KTW A;  1SUQ A;  3TWH A;  3T1A A;  3O4N A;  4CIF A;  3V9S A;  4B9N A;  1FK9 A;  4OJR A;  1VSD A;  4B9V A;  5HRS A;  3L2V A;  4KI6 A;  3LZJ A;  1BHL A;  4DS5 A;  1JL1 A;  1RT5 A;  4IBN A;  4H4O A;  4DSE A;  3THV A;  3QEW A;  3P1G A;  5DK5 A;  1B9F A;  1KVB A;  4KI4 A;  3LAL A;  2F8T A;  1NJX A;  3MEC A;  3CFR A;  5HRO A;  2G8K A;  1S6P A;  2XRI A;  1HQE A;  2XHB A;  3DOL A;  5FRM A;  1T05 A;  3MXI A;  4HUG A;  4W5O A;  3L2R A;  1S5J A;  4RW9 A;  2KW4 A;  3MAQ A;  4BAC A;  2Y1J A;  3LP3 A;  4DQQ A;  2E6L A;  1T8E A;  2HHU A;  3SJJ A;  3ZT0 A;  2IAJ A;  4CES A;  3KK3 A;  1NKB A;  1Q9Y A;  3DMJ A;  5FRN A;  2DY4 A;  3AO2 A;  1QE1 A;  1WSJ A;  1S6Q A;  4CFA A;  4N47 A;  4HHT A;  1KFD A;  4LD0 A;  3AVJ A;  4OVL A;  3OYC A;  4M42 A;  3CYM A;  1LW2 A;  4DTS A;  3AV9 A;  2KQ2 A;  3HPG A;  4DSI A;  4OPJ A;  1BQN A;  4O5B A;  1J54 A;  2A1S A;  1RTH A;  2IS3 A;  4DSF A;  4H4M A;  3ZSO A;  4CJK A;  3QES A;  4CJ3 A;  2DTU A;  4DTM A;  4ICL A;  1LAW A;  5CZ1 A;  3ZT4 A;  3O3G A;  1X9W A;  1D9F A;  4CHP A;  1IKV A;  1KLN A;  2BDP A;  3WNG A;  4DFK A;  1TGO A;  4CF1 A;  4CGG A;  3V81 A;  3SYZ A;  2G8W A;  1BIS A;  2Z1G A;  4NCG A;  4GVM A;  1KFS A;  5SWM A;  3SUN A;  2WON A;  4LH5 A;  1RT7 A;  4CFC A;  3AVC A;  1GOC A;  3DM2 A;  4LSL A;  1JXE A;  4FLW A;  1RTI A;  3C95 A;  4Z4I A;  1CXU A;  1XWL A;  1U45 A;  4F8R A;  2HB5 A;  3HXM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...