1VSFA

Asv integrase core domain with mn(ii) cofactor and hepes ligand, high mg concentration form
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
146
structure length
146
Chain Sequence
GLGPLQIWQTDFTLEPRMAPRSWLAVTVDTASSAIVVTQHGRVTSVAAQHHWATAIAVLGRPKAIKTDNGSCFTSKSTREWLARWGIAHTTGIPGNSQGQAMVERANRLLKDKIRVLAEGDGFMKRIPTSKQGELLAKAMYALNHF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The catalytic domain of avian sarcoma virus integrase: conformation of the active-site residues in the presence of divalent cations.
pubmed doi rcsb
source organism Rous sarcoma virus (strain schmidt-ruppin)
molecule tags Endoribonuclease
molecule keywords INTEGRASE
total genus 51
structure length 146
sequence length 146
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1995-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1vsfA00
1L3SA 4RG8A 3AVHA 3LP0A 4DLEA 4FXDA 2B6AA 1TGOA 3LANA 4W5RA 4AHVA 4CF1A 3NAEA 1F21A 3RMCA 1ZBLA 3PO5A 1B9FA 1S1UA 1VSJA 4F2SA 1JL1A 4M3RA 1BCMA 1JKHA 3TWHA 3SUPA 4DTMA 1BQNA 2G8UA 4HUEA 3V9SA 4M3WA 4LSNA 2QKKA 4I2QA 4E7KA 1JL2A 3RMBA 3AO1A 4OKJA 3CM6A 4HCCA 1UAXA 2HMIA 2X74A 1BISA 2IDOA 3SPZA 1SKWA 3DMJA 3S3MA 2LSNA 3RR8A 3OS0A 1CZ9A 4DTSA 4NYNA 3TAMA 3KTQA 1JLEA 4CFAA 3K5MA 3QNOA 3CG7A 4CEOA 1J5OA 3TAQA 1KFDA 1HNVA 1U49A 3M8PA 3JYTA 5C24A 4R5PA 4FJMA 1KVBA 4PWDA 4DQSA 4FJGA 1WSGA 3OYDA 2QXFA 4HVJA 4BDYA 2X6NA 3SPYA 5KGXA 4DTRA 3U3GA 3PX6A 4FZYA 2E4LA 5HP1A 1N5YA 2A1SA 4B9UA 4FZZA 2KFNA 4LSLA 1QSSA 3TI0A 4IFVA 5KGWA 3VN5A 4AHUA 1TK8A 4FJJA 3AVNA 2Z1IA 4H4MA 1FXXA 4BE0A 4RW7A 4L8RB 1TAUA 4Q5VA 3VQPA 3AV9A 1C0MA 4I7FA 4B8AB 3M8RA 1X9SA 3DRSA 2XRIA 1X9MA 2G8IA 1GOCA 4HUGA 1A5WA 3CFRA 4CJ3A 1LV5A 3AO5A 4B9TA 3NFAA 3SQ2A 3OYLA 1B92A 2XHBA 4FJXA 4PY5A 1K6YA 3LP2A 1KVAA 1MU2A 1RT7A 1WSFA 1O1WA 1WSJA 5CYMA 4CECA 3C95A 1FKOA 3DOKA 1WAFA 1JLAA 3IRXA 3VQ5A 3OYJA 1RDDA 3KLGA 5J2MA 3HPOA 1VSFA 3SQ1A 1S1XA 4CGHA 3UIQA 4GMJB 2G8FA 1SUQA 1LW0A 1HQEA 1WSIA 4CHZA 3PUFA 1VK0A 4E89A 2G8KA 4J2DA 4M42A 2RPIA 4BDZA 1I39A 3KIOA 3MECA 4Z4HA 4O44A 1KTQA 2HNDA 3NDKA 4KHYA 1UA1A 3IG1A 1D9DA 3K57A 2KQ2A 4OLAA 1GOAA 1YT3A 3DYAA 3HVTA 4CJVA 3LPUA 3MEGA 3OYBA 2ZQBA 4E0DA 1BQMA 4OPJA 4FK2A 4OGEA 4KHQA 3TAFA 3RMAA 5DK5A 2KTQA 2OYQA 1RCHA 2G8WA 2FBTA 4AH9A 4NYFA 1LAVA 3KKSA 4ELVA 4J2AA 3ZCMA 3AVFA 1RBTA 3AVGA 3D45A 5HBMA 4DS5A 3E01A 2KFZA 4CE9A 3C6UA 3AVMA 3KJVA 3SJJA 1TAQA 3OYAA 4DS4A 3ZSWA 1XC9A 4KB0A 2YNFA 3OVNA 4E19A 3T3FA 2HHWA 3VQEA 1J9AA 1RDCA 1RTHA 3HYFA 5FROA 1QS4A 4IDKA 4N5SA 4O5BA 4DTUA 3A2FA 3DLBA 2FC0A 4DQRA 3OJSA 3NH1A 4ELTA 3HL8A 2DFHA 2E6MA 3KLFA 3AVLA 3AVAA 2AJQA 4C8MA 4OGCA 4Z4CA 2GUIA 3EY1A 1XHZA 4DG1A 2Y1IA 3OYMA 4B9VA 1ASUA 2OZSA 3CFPA 1SKRA 1Z26A 4CERA 4PQUA 3KKRA 3MAQA 3O4NA 3ZSOA 3CQ8A 1CXQA 3HP9A 4YNQA 1JLCA 3DI6A 4FJNA 3QEWA 1KLNA 2G8VA 1SL0A 3HJFA 3F73A 3OJUA 4CHQA 5HRNA 2YNHA 1RTJA 1NJYA 1BL3A 3T19A 1L3TA 3ZSXA 4LY7A 4CGGA 1LW2A 2FBXA 3S9HA 1VRTA 1C1BA 4M3TA 1XI1A 3NF9A 4CJFA 4F8RA 2Z1GA 4B08A 3PV8A 1W9HA 2F96A 2BE2A 3K2PA 3QEIA 1L3UA 2D0AA 2RF2A 3WNFA 3AO4A 2ZD1A 3L2RA 3NE6A 4H4OA 3O3HA 4FZXC 2YHAA 4CJQA 4CEFA 3NH2A 3AVBA 3K5OA 2BDPA 4HCBA 4KHWA 1HMVA 1RILA 3KK2A 4B3OA 4FM0A 3AVCA 4FW1A 3TAGA 1TKXA 3HM9A 4C8NA 3HPGA 3SYZA 4IKFA 4B8CA 1VSIA 3DLKA 3O3GA 2WOMA 3OS2A 1WSEA 3K5NA 2D0CA 4FJ9A 2KZZA 3V9UA 3RR7A 1NK0A 4KB1A 4DTXA 4IG3A 1HYSA 3DLEA 1C6VA 4FLZA 3NH0A 3VA0A 4KFBA 1QTMA 3VQ6A 4ID5A 2X6SA 3L2QA 5J1EA 4CF2A 4CK2A 1HRHA 3LWMA 2VG6A 4LH4A 4E7JA 2IAJA 3V1RA 1FKPA 1BI4B 2XY6A 3NGYA 4FW2A 3TR8A 1S5JA 3KD5E 3K58A 4CEQA 3K59A 1S9GA 1TK5A 3KLHA 3QLHA 2XO7A 4QAGA 3KD1E 1ASVA 3NF8A 3ISNC 1L3VA 1SKSA 2F8SA 5SZTA 2EX3A 3HO1A 1DLOA 1REVA 2OPPA 3TAEA 4ICLA 4BE1A 3ITHA 4DTOA 1QHTA 1WN7A 5I3UA 5C42A 1RBVA 4FJ8A 3L3VA 1KVCA 4CJEA 4OKEA 4Z4EA 4IBNA 2IOCA 3C94A 5KRSA 3QEXA 1NK6A 4E7HA 4F3TA 4PA1A 1XHXA 4CJRA 3QEVA 3IAYA 4CK3A 5HROA 3O4QA 2QK9A 1EXQA 4M45A 1WAJA 4W5TA 2YHBA 3QO9A 4G1QA 1WLJA 3ZT2A 3SQ4A 4MFBA 3LAMA 2Z1HA 4W5OA 4H8KA 1TKTA 4ZTFA 1NJWA 1D8YA 1TL1A 1QE1A 4WE1A 3AA3A 5DMRA 4DTJA 1HNIA 4E3SA 2QKBA 5CZ2A 4KREA 4DFMA 4CJPA 4KAZA 1LAWA 3MXJA 2A1RA 4N41A 4Z4IA 1HYVA 2Z1JA 1BIZA 2ITGA 3B6PA 4JRPA 1L5UA 4CHYA 3EYZA 1NOYA 4MQ3A 4Z4GA 2DY4A 3DM2A 5FRMA 1NOZA 4CFCA 3O3FA 1NKEA 4I9LA 1RBRA 1NK9A 4RW6A 3VQ8A 2E6LA 1WNSA 2PY5A 3PY8A 1BHLA 3QINA 4CJSA 4DTPA 4DSLA 3WNEA 1IKWA 4DFKA 2IC3A 3SI6A 1T03A 3V9WA 4KHNA 4FVMA 1JLQA 1RTIA 1JLFA 2JGUA 3QERA 1QSLA 2Y1JA 1Q9YA 2R7YA 1UOCA 1R0AA 3LP1A 1JLGA 3LP3A 4C8KA 1ITGA 4CJLA 4F4KA 3LDSA 2VG5A 2EHGA 2HHUA 1IO2A 4FLYA 4BWMA 3L8BA 1VRUA 3HK2A 2B4JA 1NJXA 2P1JA 4FK0A 1VSDA 4KTQA 4RW4A 4FLTA 1I3AA 4AHSA 3DRRA 3VQBA 3WNGA 4PUOA 4J2BA 3MEEA 1S6QA 1RBSA 3THVA 4HTUA 4CJWA 3LALA 2P5GA 3SV4A 1SL2A 3DLRA 1S6PA 5J2PA 3CFOA 2G8HA 4FJ5A 3VQ4A 4CF8A 3RRHA 1YTAA 2XY5A 3HVRA 3ALYA 3EZ5A 1HJRA 4W5NA 2Q3SA 4B9MA 5SWMA 5KI6A 1JLBA 3VQDA 4DFPA 3TABA 2YV0X 2D5RA 4DLGA 2PYLA 3OYFA 1U04A 4DU4A 4DQPA 3KLIA 1YTUA 1X1PA 4O0IA 4J2EA 2BGGA 2DTUA 2OPRA 1YVUA 4UQGA 2HVHA 1QSYA 5K14A 1D5AA 1ZBIA 4EZ9A 4M3UA 4O4GA 5HRPA 3HXMA 4DWIA 4FCYA 1VSHA 2YKMA 4CGDA 3L2VA 1TV6A 3VQQA 4DQIA 2JLEA 2F8TA 2DFEA 1EKEA 3VA3A 4CEDA 1C1AA 3ZSQA 4FJ7A 3NF7A 5FDLA 3SQ0A 4E7IA 4RW9A 4KHUA 3I0RA 3K5LA 1KRPA 4Y1DA 4FM1A 2FBYA 3BGRA 3I0SA 5CZ1A 3LWLA 3QNNA 5CY4A 4K8XA 4DSIA 2OPSA 3M8SA 4CJTA 3QETA 2RN2A 4DSJA 2ZE2A 3L2WA 2HHQA 1B9DA 1QQCA 1C0TA 1VSLA 3G10A 4O55A 4M3ZA 2B5JA 1G15A 2D0BA 4CEAA 1C0UA 4DU1A 3U3YA 4KHSA 4FJHA 3L2UA 1ASWA 4F2RA 4ZHRA 3V6DA 3B6OA 4I2PA 3NHGA 3AO3A 2YKNA 4N56A 1SL1A 1RBUA 4FLWA 3ZT3A 1TVRA 3AO2A 3NF6A 4DF8A 3RMDA 4CHOA 1C1CA 3G0ZA 1NK7A 4RW8A 4EZ6A 4E7LA 5C25A 3S3OA 3QIOA 4IG0A 4FLUA 4BE2A 1LWCA 4CHNA 4FK4A 1LWEA 2HHVA 2PYJA 3MXIA 1JXEA 4CJ5A 3I8DA 4CCHA 4DF4A 5T7BA 4QCLA 4JS4A 1A5XA 1RT5A 1ZBUA 5J2NA 2XY8A 2YNGA 4YFUA 4OJRA 2HVIA 1BCOA 4JS5A 3OYNA 1NK8A 1VSKA 2OZMA 4CIEA 1RDBA 3DRPA 4DTNA 3SCXA 4DMNA 2GV9A 5E41A 4Y1CA 2RKIA 1IG9A 2W42A 1TK0A 4C8OA 1Q8IA 3MEDA 5EU7A 3LZIA 5J2QA 2OPQA 3OYGA 3RWUA 2O4IA 4NCAA 4I9QA 4B9SA 1NK4A 4OVLA 4B9NA 4AHRA 1S9EA 1UA0A 1KCFA 1RT6A 4W5QA 4CGIA 2P5OA 1Q9XA 4BDPA 1ZBHA 3KLEA 3TARA 1KFSA 4CF9A 4KKOA 1BIUA 3CM5A 1IH7A 4CFBA 1TL3A 4KRFA 4CHPA 3V9ZA 4C8LA 4FJLA 4QOZB 1RDAA 3QESA 1A5VA 3CYMA 3SUOA 1S1TA 2ETJA 4CEZA 3VQAA 3SZ2A 1IKXA 2NUBA 3JSMA 4CIGA 2KZMA 1GOBA 2IGIA 1TKDA 4OPKA 1J53A 3SUQA 1DTTA 4ZTJA 3RTVA 4CK1A 4CGJA 4FM2A 3VQ9A 2O4GA 3F9KA 3T1AA 3HP6A 5KRTA 1FK9A 4CIFA 4FJIA 3ZT1A 3PO4A 3ZT4A 3P1GA 1EP4A 1RTDA 3OY9A 4FJKA 4M3YA 4LD0A 4HHTA 3ULDA 1NK5A 1T7PA 3TANA 1HYZA 1EETA 3DOLA 1J54A 1WSHA 4KO0A 4CEBA 4CF0A 4BWJA 4E1NA 4BACA 1UWBA 3L3UA 4FLXA 3KK3A 2XY7A 3D0PA 1KLMA 3OYIA 5I42A 3ZSZA 3TAPA 1RNHA 3LPTA 5D3GA 1Y97A 1NKBA 3VQCA 1U48A 4O0JA 4DSEA 3U6FA 4N76A 1U45A 5FRNA 1RT3A 1VSMA 3WNHA 2HW3A 4KTZA 3H08A 1X9WA 2FBVA 2HB5A 3AA2A 4CJ4A 3LZJA 4JRQA 1ZYQA 2VWJA 3ZSYA 5HLFA 2HNYA 3P5JA 1TKZA 2VG7A 1RT2A 2VWKA 3NBPA 3P83D 4HUFA 1CLQA 4IFYA 4OLBA 2HNZA 3HT3A 4NCBA 2YNIA 3V81A 4AILC 1CXUA 3HPHA 4EP4A 4CJUA 5JS1A 3OYCA 3BDPA 4DSKA 1JXBA 3M8QA 1U47A 2HHTA 1RT4A 1BGXT 3NCIA 4KV8A 1HQUA 4KPYA 3RRGA 2ATQA 4Q0BA 1T8EA 2X78A 4N47A 4DU3A 3FFIA 3V4IA 4GW6A 4CGFA 1IKYA 4M3XA 3AVIA 4B9LA 1EX4A 1ZBFA 4KI4A 1T05A 2HHSA 3QIPA 3ZSVA 3V1QA 3C6TA 2I5JA 3MXMA 4OKKA 1S1WA 1NKCA 4FYDA 4CESA 1HPZA 4LH5A 3ZT0A 2OA8A 3DLHA 4ELUA 1W0HA 4Z4FA 3AA5X 3NGZA 1CZBA 4Z0UA 1XWLA 3S3NA 4AHCA 3VQ7A 3DLGA 4AHTA 3NGIA 2DFFA 5HRRA 1BI4A 1NJZA 2P51A 4CJKA 4FLVA 1Z25A 4TSXA 2GBZA 4GVMA 1VSEA 1D9FA 4K8ZA 5CYQA 4ID1A 3AA4A 5KTQA 4DFJA 1LWFA 3OS1A 4EP5A 4CEEA 4KI6A 4M41A 3SUNA 3SV3A 4XIUA 3HSTB 1N6QA 3OYHA 1SV5A 1U4BA 1S1VA 1DTQA 4DQQA 3QEPA 3IS9A 2IS3A 1KSPA 2BANA 2HHXA 3ASMA 4CFDA 3SNNA 3AVJA 1IKVA 5JS2A 4E1MA 3KK1A 4F3OA 2PZSA 3OYKA 4DSFA 4KTWA 1RT1A 2WONA 4NCGA 4JLHA 3V1OA 5HRSA 3PX0A 2KW4A 3PX4A 3OYEA 3ZSRA 3V9XA 3LAKA 3AVKA
chains in the Genus database with same CATH superfamily
3AVHA 4W5RA 1U2VA 3RMCA 2QWPA 1S1UA 4F2SA 5DM7L 1JKHA 2E20A 4IEIA 4LSNA 3THXB 2KLAA 4NLCA 3R3LA 1UAXA 2HMIA 4A2BA 3AAQA 4FWMA 3H45C 1JLEA 1J5OA 1X3NA 2O8DB 1HNVA 3ULEA 2FF3B 1U49A 3M8PA 4HVJA 3W0LA 2P9NA 4DTRA 1TUYA 3JAMO 3WQUA 3GDQA 3AVNA 3BUZB 4RW7A 4WQ5C 4LF8K 5AQZA 4IWVA 4CBUA 2Q0RA 3NFAA 1R59O 4LFBK 1K6YA 4X66K 1TK0A 1JCEA 3SQ1A 3D2FA 3KLGA 4JKGB 4ILGB 2G8FA 4K0KK 2D0PA 1LW0A 4BC4A 3WQTA 4BDZA 4PHTX 3VEWA 4KHYA 3NDKA 1MWKA 2UXDK 4JKFA 4OLAA 1GOAA 3EKSA 3HVTA 1EWRA 3LPUA 4FWRA 3TAFA 5DK5A 2KTQA 3LDNA 2OYQA 4CJ7A 2FBTA 2HBLA 3ZCMA 2P9NB 4CZEA 4DS5A 3C6UA 3AVMA 3KJVA 3OYAA 3ZSWA 2YNFA 4MDAA 1RDCA 5ELZA 3HYFA 4H03B 4GVEA 2FC0A 1BU6O 4H0TB 3D2EB 4JI6K 3HL8A 1W97L 3CCVN 3AVAA 4B9VA 3EY1A 4WFAL 2Y1IA 2OZSA 1YXQA 3ZSOA 4BROA 1CXQA 2ZF5O 1KLNA 2G8VA 3DLLL 4F9OA 5HRNA 1BL3A 2W6LA 1L3TA 3CMEN 1C1BA 3CERA 3SJHA 3PV8A 1W9HA 4UY8O 4H4OA 4FZXC 2VYPA 2YHAA 3H46O 4KHWA 1HMVA 2IVPA 3KK2A 4QS7A 1N34K 4FW1A 1TKXA 1VSIA 2WOMA 3K5NA 3ATVA 2D0CA 3MN5A 3V9UA 1NK0A 3CCJN 1ESVA 4DTXA 3DLEA 1QTMA 3VQ6A 3L2QA 1T6CA 3DXMA 2GX9A 4FPAA 3CJAA 4BQLA 3V1RA 1S5JA 3K58A 2E2QA 1SZ2A 1TK5A 5EXWA 4DV3K 3CHWA 3NF8A 3ISNC 3SMPA 1KAYA 4YOTA 2V7ZA 1DLOA 3TAEA 3M3ZA 4CD3A 2NRWA 4BE1A 4DTOA 1QHTA 5C42A 1RBVA 4FJ8A 1VQPN 4OKEA 2UU9K 2IOCA 4E7HA 4F3TA 3O4QA 2OCEA 1EXQA 4M45A 1WAJA 4CZHA 3SQ4A 3LAMA 3O9UA 2QWQA 2YJFA 3MN6A 4U7BA 4JNEA 2UUBK 1LAWA 3MXJA 2A1RA 4N41A 2VCPA 1XMQK 2ASPA 1HNZK 1NOYA 4MQ3A 4DR5K 3O80A 5FRMA 1Q86O 3FGUA 3BP8A 2PY5A 2E6LA 2NRRA 3MCPA 4DSLA 1GLAG 1GLEG 4DFKA 4CZIA 1JLFA 1BUPA 1BA1A 5KQDA 1R0AA 3LP1A 2OANA 4F4KA 3LDSA 4PKGA 4BRMA 5EX5A 5C2DA 2I7NA 3HK2A 2HMPA 3BEXA 1NJXA 3OBWA 5AFUA 3CJ9A 4BG8A 4BC5A 4H0OA 3MEEA 2P5GA 3DLRA 5J2PA 3ZX0A 1HKBA 3CF5L 3HVRA 3O6WA 2PFUA 3A5MC 5KI6A 5SWMA 3LM2A 2YV0X 3VOVA 4J2EA 2HVHA 5GIPA 5K14A 3VEYA 4CGDA 1E4FT 1EKEA 3VA3A 2GTDA 4LF4K 3SQ0A 2AP1A 4E7IA 4RW9A 3I0RA 3TSQA 3VEVA 4JI8K 4JI1K 3QETA 2ZE2A 3BF3A 3CCQN 1B9DA 1VSLA 3G10A 1XUPO 4JHDB 2B5JA 1G15A 4GNIA 3U3YA 4CZMA 4KHSA 3L2UA 1GLJO 3I56N 4F2RA 4ZHRA 4I2PA 1DGKN 2JWKA 3AO3A 2YKNA 4N56A 2P9IA 1SL1A 4IOXA 4EHUA 3RMDA 3G0ZA 1ZXOA 4RW8A 3QIOA 3ZEUB 4BE2A 3SBTA 3QDKA 3LDQA 1DEJA 1JXEA 4X62K 4CCHA 2OTLN 3VESA 4JS4A 2D0OA 1RT5A 1X3MA 2YNGA 2QWMA 3CC4N 2HVIA 3VMFB 1BCOA 1YUWA 4JS5A 3OYNA 1NK8A 1VSKA 2OZMA 1QZ6A 3DRPA 4DMNA 2RKIA 1IG9A 4BY9C 4C8OA 1TUUA 3CQYA 3MEDA 5EU7A 4NCAA 4EAHD 4AM7A 3O9TA 4AHRA 3J7ZO 1S9EA 2FXUA 4CGIA 4JKGA 2PBDA 1BIUA 4CZFA 1TL3A 4CHPA 4C8LA 3J8AA 1A5VA 3CYMA 5F2RA 2ETJA 1M90O 3VQAA 3SZ2A 2E1ZA 2NUBA 1OVYA 4OPKA 1DTTA 3VQ9A 3F9KA 3T1AA 3HP6A 2NNWA 3ULDA 1NK5A 3TANA 3DAWA 1EETA 1HNXK 5BR8K 4CF0A 4BWJA 3ZETB 3CPWM 3GOIA 3L3UA 2XY7A 5I42A 3CCSN 3TAPA 3LPTA 1U48A 2BUPA 4O0JA 2IVNA 1BOTO 2EWSA 3WXJA 1S3XA 4BR0A 1NBWA 1VSMA 3WNHA 4DR6K 3K9JA 5AQGA 5KQ8A 3N4QA 1X9WA 2Q1NA 4H5WA 4G9ZA 3LDPA 3ZSYA 5HLFA 3P5JA 1TKZA 2VWKA 4Y0WA 1HR0K 4KBOA 4IFYA 4AILC 4EP4A 4C1NK 1ILYA 3VGMA 4DSKA 4BR9A 5MLCQ 4KPYA 3RRGA 4JHDA 5BPMA 2X78A 4A61A 1IKYA 4XH4A 5FLXO 1ZBFA 4KI4A 3TSPA 1T05A 3ZSVA 3MXMA 4OKKA 4FYDA 4CESA 3M5RA 1IBMK 4AHCA 5HRRA 3FZLA 1WBDA 4TSXA 1EQYA 2GBZA 4YDUA 1VSEA 3Q7BA 1LWFA 4CEEA 4M41A 3E9OA 3HSTB 4XIUA 5ADXH 4MO4A 3OYHA 2FLOA 2O8DA 3IS9A 1XNQK 2QWNA 2BANA 4CFDA 5LJVA 4F3OA 1WOQA 4KTWA 1RT1A 4DV1K 4IFEA 3PX0A 3OYEA 5IWAK 4FL9A 5ADXA 1L3SA 4RG8A 4FXDA 2H3GX 4CF1A 1VAZA 4M3RA 5GAGP 3TWHA 4DUYK 1BQNA 3V9SA 3CI5A 1YJWN 3RSEA 1EO1A 2HSTA 4B1ZA 4IDHA 2NLXA 4HCCA 3ATUA 2IDOA 1SKWA 1SS6A 3DMJA 2LSNA 3C6HA 4NYNA 3O9RA 3TAMA 4B1XB 3KTQA 1GLFO 4EFHA 5C15A 3TAQA 3Q7CA 1DKGD 3P31A 1N33K 2F7TA 4BDYA 3T69A 3U3GA 4FZZA 5GAEP 2E4LA 4DV0K 1N5YA 1IBLK 1OKJA 1TK8A 5KGWA 4FJJA 1TAUA 4H4MA 5AQUA 2E2OA 4Q5VA 3AV9A 5AQFA 2CGJA 4B8AB 4JK7A 4B3TK 5AQWA 1X9MA 1LV5A 3BZKA 5C12A 3SQ2A 3OYLA 1B92A 2XHBA 4FJXA 4PY5A 1XQSC 1MU2A 1RT7A 5CYMA 3VQ5A 3C95A 3DOKA 5J2MA 3HPOA 1NGAA 2YHWA 4GMJB 4CW7B 1HQEA 4CHZA 3PUFA 1VK0A 4J2DA 3W3DA 3MECA 5KPRA 3NMUA 5KPZA 5FPMA 3K57A 2KQ2A 2VGMA 1C0FA 3DYAA 3O1WA 3OYBA 1JJ2M 4JKBA 1LAVA 3KKSA 4K41A 5M1OA 4J2AA 1K8KB 4JK8A 1TAQA 4KB0A 3T3FA 2HHWA 2O8BB 3VQEA 1J9AA 5FROA 4DTUA 3VF6A 4LFAK 3A2FA 4M7XA 3NH1A 3A0IX 1NGFA 3LL3A 4XH5A 3KLFA 3WT0A 4OGCA 1XHZA 1ASUA 3CFPA 1SKRA 1Z26A 3O4NA 3C7NA 3HP9A 4YNQA 1JLCA 4JEPA 4MLHA 1RGIA 1SL0A 3OJUA 1VQ9N 4DQ8A 3A5NC 5KPTA 1NJYA 4LY7A 4FPBA 1QQNA 3S9HA 3WEEA 3NF9A 3ID6A 2Z1GA 2F96A 3K2PA 3QEIA 5E84A 3VEOA 3AO4A 2ZD1A 3O3HA 4HCBA 4CJQA 1K9MO 1RILA 1MDUB 1FJGK 4B3OA 3SBGA 3F2KA 3HPGA 3O3GA 2IVOA 3RR7A 4KB1A 1HYSA 4IG3A 1C6VA 3EZWA 4FLZA 3VA0A 2FSJA 4CF2A 1Q81O 4B1VA 1OH8A 1BA0A 2XY6A 3TR8A 1WBBA 1S9GA 2XO7A 4QAGA 3KD1E 5AQTA 2EX3A 2FF6A 1REVA 3ITHA 1Z05A 4A62A 3T7ZA 4CJEA 1N36K 5KRSA 1NK6A 4PA1A 3IAYA 3OW2M 4CK3A 5HROA 2O8EB 2UXBK 4A59A 4CD1A 3ZT2A 4MFBA 3VTHA 4A5BA 1VQNN 1NJWA 4BRKA 4WE1A 3JS6A 3AA3A 4DTJA 2QKBA 5CZ2A 4FWKA 4Z4IA 1HYVA 3MX5A 2Q31A 2Q2RA 2ITGA 3B6PA 5AZJA 4JRPA 1L5UA 1NOZA 4CFCA 3O3FA 3QBWA 2ITMA 1NKEA 4I9LA 1NK9A 2WBNA 4CJSA 5GADP 3ID8A 5E26A 1IKWA 5IT9O 1V4SA 4BGAA 1JLQA 3QERA 1RDWX 4FWSA 4KH4A 5CE3A 2R7YA 3LP3A 4BRQA 3J7AP 4FLYA 3L8BA 1VRUA 2HF4A 2B4JA 3PIPL 2P9KA 3A5LC 4KTQA 3CPEA 4BRDA 4BRLA 3DXMB 3DRRA 4FWQA 4J2BA 4LF7K 3THVA 2F9TA 3LALA 1SL2A 2G8HA 3VQ4A 1KD1O 1VQ4N 3KHYA 3ALYA 3M1FA 4W5NA 1Q7YO 1EWQA 2D5RA 2FSNA 1U04A 1YTUA 2WC9A 4O0IA 3G4SN 4OPAA 1YVUA 3VERA 2JWLA 4UQGA 4BRNA 5BRDA 1IV0A 3IFRA 1D5AA 4H0VB 4M3UA 1GLBG 4O4GA 1ATNA 4FCYA 3EEQA 4IEEA 4DQIA 2JLEA 2F8TA 1Y64A 3MN7A 2P9PA 4O5FA 4IO9L 4FJ7A 5FPNA 3HTVA 5FDLA 3OHRA 1XMOK 4BQZA 3BZCA 1KRPA 4Y1DA 3LWLA 5CY4A 2KKZA 2OPSA 3E66A 5AZIB 4CJTA 4PKIA 2RN2A 3UB5A 1NU0A 2HHQA 1C0TA 1BO5O 3PLAA 3F5TA 2HBMA 4DU1A 4FJHA 1ASWA 2ZJQL 3V6DA 4CZKA 3GG4A 1XC3A 3CC2N 4YORA 3ZT3A 3OTOK 3B8AX 3NF6A 3L0QA 5M1QA 4CHOA 3MN9A 4JK9A 5H1SQ 1NK7A 2QEXN 1X9JA 4B3MK 2O8EA 3JXUA 2PYJA 3VEXA 3MXIA 4CJ5A 2XY8A 4YFUA 5BRFA 4JN4A 2UUCK 4PL8A 2P9SA 1J6ZA 5AQLA 3D2FB 2GV9A 4EHTA 1VQKN 4I6MB 4WFBL 3UKUA 3ZLJA 3THYA 2D4WA 3HZ6A 4OVLA 3ENBA 3J81O 4C23A 4B9NA 2ASMA 4GV9A 2P5OA 4BDPA 2P9PB 3KLEA 3TARA 4K43A 1KFSA 4CF9A 4GKJK 3MDQA 3O1BA 4FJLA 1QQMA 1RDAA 3EN9A 4MLEA 3SUOA 1S1TA 1WB9A 4B1YB 4CEZA 5AZJB 5M1FA 3LDLA 4JI2K 5M1KA 1TKDA 1J53A 4ZTJA 1SQKA 4DV5K 3H6EA 3PO4A 1RTDA 3QBXA 4M3YA 4E1NA 3DOLA 1J54A 4DR7K 1FW6A 4IXCA 1UWBA 3D0PA 5BPNA 3ZSZA 3CXCM 4DSEA 4N76A 3RSEB 5FRNA 4YDUC 2HW3A 3SLCA 3H08A 4ILJA 3ZYYX 2FBVA 2HB5A 2E88A 1ZYQA 3FLCO 3U4LA 4QS9A 4KH5A 3U9ZA 4HUFA 3NBPA 3P83D 3CIPA 4NCBA 4DV7K 3HPHA 4CJUA 3OYCA 3T1HK 2QWRA 1RT4A 2HHTA 3NCIA 3CCMN 1HQUA 4BC2A 4N47A 4MDBA 3AVIA 1EX4A 4KH6A 1S1WA 4ELUA 3ZT0A 3DLHA 1TYQA 4Z4FA 3OA9A 3NGZA 1YJ9N 4Z0UA 1XWLA 4M63C 1BI4A 4CJKA 3L6QA 4FLVA 1E4GT 2A41A 2YJEA 2D1KA 4KHPK 1KQSM 4K8ZA 4WYBA 1N6QA 3A5OC 1S1VA 4DQQA 3QEPA 3UE5A 2P9KB 3SNNA 2P9UB 3AVJA 2NRZA 3KK1A 1VQON 2PZSA 4JAXA 4DV4K 3DXKA 5EOYA 4JLHA 3IMXA 2KW4A 3PX4A 3ZSRA 4CIFA 5EVZA 3V9XA 3AVKA 3LP0A 4DLEA 2B6AA 1NLVA 5C10A 3NAEA 1F21A 1ZBLA 3AY9A 4LF9K 1B9FA 1VSJA 1JL1A 4FO0A 1BCMA 3P4IA 4B1WB 3SUPA 4BRHA 1Q18A 4JI4K 2G8UA 4HUEA 4M3WA 4I2QA 1YHQN 4CBWA 3RMBA 1IJJA 3AO1A 3CM6A 2X74A 4RTFD 2QWLA 3SPZA 3G71N 4WQ5A 2V52B 3OS0A 2KHOA 4EIAA 3CD6N 4CFAA 3K5MA 3QNOA 1NMDA 4JI3K 2NZTA 3JYTA 5C24A 4R5PA 4FJMA 1WSGA 4PKHA 4XH1A 3OYDA 2RHKA 2X6NA 3SPYA 4FZYA 3FE1A 3SK3A 2A1SA 4B9UA 4LF5K 2KFNA 4ISFA 4CI6A 1QSSA 4JI0K 3TI0A 4IFVA 3VN5A 4AHUA 4L8RB 1FXXA 4IZ9A 4BE0A 3DRSA 2XRIA 1GOCA 4HUGA 1A5WA 3CFRA 4B9TA 2E8AA 2YCHA 1HNWK 4NXNK 4JKDA 2UUAK 3FR0A 3LP2A 1WSFA 3GE1A 1KVAA 2RE2A 1O1WA 1WSJA 4BC3A 1WAFA 5LMNK 1JLAA 3IRXA 1VSFA 1S1XA 4BR2A 3UIQA 4DCHA 2QA4N 1WSIA 1NGCA 5GAHP 4E89A 4O44A 2HNDA 3ZX3A 1S72N 4L3QA 2Q36A 1YT3A 4CJVA 1JCFA 4OPJA 4KHQA 4JV5K 2A6AA 4A2AA 1IG8A 1QVFM 1RCHA 1V4TA 4J8FA 5AJ3K 4AH9A 2O8FA 4NYFA 4JKHA 3AVFA 3AVGA 3FFKB 1ZBSA 5HBMA 3E01A 4CE9A 4DS4A 1XC9A 1T3VA 3AAPA 3WEEB 3OVNA 5AZIA 1RTHA 1QS4A 3PSFA 4IDKA 3D7EO 3MX2A 1YAGA 4JKCA 4DQRA 4ELTA 2DFHA 2E6MA 4C8MA 4Z4CA 2GUIA 4DG1A 2OTJN 5LMUK 3GL1A 4CERA 1QVGM 4PQUA 3KKRA 3T1YK 4RWTA 3CQ8A 4LF6K 5AQIA 1U2VB 2O8FB 3DI6A 4FJNA 3IDHA 1NNEA 2HOEA 3ZETA 3N4PA 3F73A 2YNHA 2ZGYA 4CGGA 1LW2A 5LJWA 1VRTA 5BN9A 3CCLN 3KZBA 2BE2A 4A57A 3J80O 1L3UA 2D0AA 2RF2A 3L2RA 2HHHK 3DWLA 4CEFA 3AVBA 3K5OA 3NH2A 1OH6A 3AARA 1KAXA 4FM0A 3AVCA 3MWPA 3TAGA 4IKFA 3HM9A 4B8CA 3DLKA 1NG9A 4FJ9A 3OS2A 3NH0A 2NRXA 1GLCG 4H5RA 3KVGA 1J5EK 3O5BA 3LWMA 3K0SA 2VG6A 4E7JA 5BRHA 2BH1A 1FKPA 1BI4B 2ZJRL 4FW2A 3KD5E 4CEQA 3SAFA 3K59A 1YJNN 4WF9L 3KLHA 2WTUA 3QICA 2O8CA 4B1UB 1ASVA 3O9SA 1OH7A 5SZTA 3HO1A 4ICLA 3LDOA 3WXLA 5I3UA 1WN7A 3L3VA 1KVCA 3THWA 1BWFO 3C94A 3QEXA 3QEVA 1XHXA 4CJRA 2QK9A 1QHAA 4X64K 2YHBA 3QO9A 4G1QA 4A5AA 3H1VX 4W5OA 4H8KA 1TKTA 4ZTFA 5DMRA 4E3SA 2P9LB 4KREA 4CJPA 4KAZA 1KC8O 5C0YA 3HSCA 5DM6L 3H3OB 3DJCA 3DM2A 2DY4A 4IJAA 1N32K 3PY8A 1WNSA 1BHLA 1MWMA 2A40A 3QINA 3WNEA 4DV2K 3SI6A 4FVMA 3EO3A 3HI0A 1RTIA 4YOWA 1Q9YA 2UXCK 1UOCA 3WXIA 5CHIA 4WQ4C 1JCGA 3TTDA 1ITGA 3CCEN 2VG5A 2EHGA 4YOVA 2HHUA 4BWMA 2DPNA 3IKMA 4FVUA 1LCUA 4BRFA 4V19S 4FK0A 1VSDA 3LM9A 5B8HA 4JI5K 1I3AA 2WUSA 3CJBA 3R9PA 1RBSA 4CJWA 4DR4K 3SV4A 3CFOA 1P8ZA 3EE8A 1YTAA 3I33A 3O4WA 2XY5A 3EZ5A 1HJRA 2Q3SA 3P38A 3VQDA 4LC9B 2P9SB 2PYLA 4DLGA 4BR4A 3OYFA 4KRFA 3EE9A 4DQPA 3KLIA 3E1YA 2BGGA 4H0XB 4YHHK 2OPRA 3VETA 3F9MA 4I6MA 3HXMA 3L2VA 3VQQA 4RCHA 3QMLA 3ZSQA 3NF7A 1K8KA 3K5LA 4FM1A 1KXPA 5CZ1A 3I0SA 4K8XA 1HUXA 4DSIA 1DT9A 2GELA 4C1NI 3UKRA 3OBYA 4O55A 3E9PA 5JLHA 5M1NA 2D0BA 3THWB 4CEAA 1C0UA 3ZX2A 2QTDA 3NHGA 3SAHA 3NVMA 1TVRA 3AO2A 4FWOA 4BR5A 5AQXA 4EZ6A 3S3OA 5C25A 4NXMK 4FLUA 5HOOA 4CHNA 1LWEA 4FOIA 3R6MA 3I8DA 4DF4A 2HF3A 4NO7A 5T7BA 4CZGA 2V51B 4DHYA 4IJNA 2A3ZA 5J2NA 3THYB 4OJRA 2ZJPL 1YF5L 1HPMA 4CIEA 3VGLA 4H0YB 3OYGA 1VQ7N 1NK4A 5C2FA 3VENA 1VQ6N 3MK6A 3G25A 1RT6A 4YOXA 3FZHA 3P39A 1ZBHA 1IH7A 4CFBA 4DUZK 3V9ZA 4B3RK 4BGBA 3CQXA 2NRVA 3CJ7A 5JVGL 1C0GA 3JSMA 4AM6A 2KZMA 1WUAA 3RTVA 4FM2A 2QM1A 5KRTA 4FJIA 3VEZA 3P1GA 1EP4A 3OY9A 4LD0A 2YI1A 2W41A 2P9IB 4FLXA 3KK3A 1KLMA 1RNHA 2Q0UA 1NKBA 3VQCA 3U6FA 1D4XA 1U45A 4IOCL 2NRTA 3O08A 3KK7A 4WFNL 2HNYA 2VG7A 1RT2A 4Z94A 2YNIA 3VF2A 5JS1A 4DR3K 1JXBA 1U47A 4K25A 4KV8A 1T8EA 4DU3A 3FFIA 1I94K 4GW6A 4CGFA 4LFCK 3TSUA 4B9LA 1YVNA 3CCRN 1M1KO 3V1QA 3C6TA 2I5JA 5AQYA 4LH5A 2OA8A 1W0HA 1T44A 3AA5X 5AQMA 4GKKK 3S3NA 1HX1A 3VQ7A 3DLGA 4AHTA 3NGIA 3EL2A 2P9UA 5TKYA 3PSIA 3FZKA 4GVMA 5CYQA 2VGNA 4ISGA 3O9QA 3SUNA 4BREA 5AQKA 2AA4A 1SV5A 4ISEA 3U9DA 1DTQA 4H5VA 2IS3A 1KSPA 3ASMA 1IKVA 5JS2A 3D6RA 1VQLN 4DSFA 2WONA 4NCGA 3V1OA 3HM8A 3LAKA 1TGOA 3LANA 3PO5A 1P90A 4FSVA 4AHVA 2YX6A 2VWBA 4YY3K 3UKRB 4GY2B 4DTMA 5BREA 2QXLA 5F1XA 2QKKA 4E7KA 3MMVA 1JL2A 4OKJA 1HLUA 3BY5A 5GINA 1BISA 3QB0A 3RR8A 3S3MA 4WCEL 3KWIA 3TTCA 1CZ9A 4DTSA 4H0PA 3SAGA 1LOTB 3CG7A 4CEOA 3THXA 1NGDA 4O8KA 1KFDA 1RFQA 4JYAK 1KVBA 4PWDA 4DQSA 4FJGA 1G99A 2QXFA 3CETA 5KGXA 3PX6A 5HP1A 4LSLA 1U6ZA 2Z1IA 1RDUA 5AQNA 3VQPA 1C0MA 3RVCA 4I7FA 2BTFA 4BR7A 3M8RA 1X9SA 2G8IA 1XNRK 3CJ1A 1K73O 4CJ3A 3AO5A 2UYTA 2YHXA 4CECA 4R79A 1FKOA 2PAVA 3OYJA 1RDDA 4CGHA 4DKWA 2CGKA 1SUQA 1CZAN 5GIOA 3ZEUA 1KAZA 4M42A 2RPIA 3ULEB 1I39A 3KIOA 4Z4HA 1VHXA 1KTQA 3FZMA 5EY4A 5JMVA 1UA1A 3IG1A 1D9DA 4BRCA 4E0DA 3MEGA 4JKAA 2ZQBA 3J7YP 1BQMA 4FK2A 4OGEA 1O13A 3L4IA 3RMAA 4BRGA 4MO5A 3U8XA 2G8WA 3C7NB 5AQJA 4ELVA 1RBTA 3D45A 2VQFK 3K9KA 2KFZA 1W2BM 3SJJA 2CH5A 4E19A 3RRHA 2P9LA 4N5SA 4O5BA 4H5TA 3DLBA 3C65A 3OJSA 2ASOA 2QI2A 3BF1A 3AVLA 2AJQA 4F8RA 3QFPA 3OYMA 3TTFA 3MAQA 3SMSA 2ZGZA 3VTIA 1HKCA 1E3MA 1NMNA 3D2EA 3QEWA 3HJFA 4CHQA 1RTJA 3T19A 2QW9A 3ZSXA 2FBXA 4M3TA 4WQ4A 1XI1A 4JKEA 4CJFA 4OX9K 4B08A 1IBKK 4DB3A 3NE6A 3WNFA 1ZC6A 1VQ8N 2BDPA 2QWOA 5LL6Z 4QS8A 1Z6RA 4E1JA 4HWIA 3SYZA 4C8NA 1VQ5N 1WSEA 1BDGA 4GV6A 5AQSA 2KZZA 3L4QA 2Q97A 4JI7K 4KFBA 4ID5A 2X6SA 4YOYA 5J1EA 3WXKA 5AQOA 4CK2A 1HRHA 4LH4A 1HJOA 2IAJA 2WFBA 3NGYA 2GWKA 3IUCA 4DR2K 3AGRA 3S41A 3QLHA 1BG3A 1ATRA 4NLBA 1L3VA 4BRIA 1SKSA 3TU5A 1NGBA 2F8SA 5FPDA 1YIJN 2OPPA 3EKUA 4DR1K 2W40A 4Z4EA 4IBNA 1GLLO 1OVQA 1HKGA 3C6AA 4PL7A 2E5LK 1NM1A 3CCUN 3G6EN 4W5TA 1WLJA 4FWPA 4AF1A 2Z1HA 5JLFA 1D8YA 1TL1A 1QE1A 5TKWA 1HNIA 4DFMA 2Z1JA 1BIZA 4CHYA 3EYZA 4Z4GA 4JD2A 2CGLA 1RBRA 4RW6A 3VQ8A 4DTPA 2E2PA 3KWGA 2IC3A 1T03A 3V9WA 1H1VA 4KHNA 2I7PA 3WXMB 2JGUA 5A2QO 2F4VK 1QSLA 2Y1JA 1JLGA 4CJLA 3VF4A 1IO2A 2NRHA 5FPEA 2P1JA 2A42A 4K42A 4RW4A 4GV3A 4CZLA 4FLTA 5BR9A 2GUPA 2E1YA 4AHSA 3VQBA 3WNGA 4PUOA 3O8MA 4BRAA 4IO8A 3H1QA 3M6GA 2V7YA 1S6QA 4HTUA 1NGEA 3WUHA 5F0XA 4XEIA 1S6PA 3CC7N 4FJ5A 4CF8A 4YOUA 3DXKB 2HBJA 4B9MA 4DFPA 1JLBA 3TABA 3HOTA 2HHSA 4DU4A 2DTUA 1X1PA 4OO1J 2IIRA 1QSYA 5HL7L 1ZBIA 4EZ9A 3HRGA 5HRPA 4DWIA 1VSHA 2GWJA 3GBTA 2YKMA 4BG9A 4H5NA 1TV6A 2DFEA 4CEDA 4CBXA 3HBTA 2CH6A 1C1AA 1NWKA 1N8RO 4KHUA 1TYQB 2FBYA 3A8YA 3BGRA 4AQYK 3QNNA 4FWNA 3M8SA 3HOSA 4DSJA 4NB4A 3L2WA 1QQCA 3ENOA 4O8UA 4M3ZA 4M7YA 3VPZA 3B6OA 2YHYA 4HTLA 2HBKA 1RBUA 4FLWA 1ATSA 2W6KA 5AR0A 4DF8A 2F9WA 1C1CA 4E7LA 2O8BA 1MA9B 4IG0A 1LWCA 2FSKA 4FK4A 4BVOA 2HHVA 3MWTA 5AQVA 4QCLA 1W7AA 4X65K 1A5XA 3AGKA 1ZBUA 5BPLA 3H3NO 1RDBA 4DTNA 3SCXA 2GEMA 5E41A 4Y1CA 3CJCA 2W42A 1Q8IA 3LZIA 5J2QA 1NGJA 2OPQA 3FZFA 3RWUA 2O4IA 5LY3A 4I9QA 4B9SA 3NVKA 1UA0A 1KCFA 4W5QA 1Q9XA 3R1XA 4CZJA 4KKOA 3CM5A 4U67L 2VQEK 4QOZB 3QESA 3I8BA 1QZ5A 3R8EA 1IKXA 1NJIO 4CIGA 1GOBA 2IGIA 5CR4A 3SUQA 4CK1A 4CGJA 2O4GA 5AFUH 3UKUB 1FK9A 3ZT1A 3ZT4A 3E9LA 4FJKA 4HHTA 1T7PA 1HYZA 4KO0A 4CEBA 1WSHA 4BACA 5AQRA 1NGIA 1VQMN 3OYIA 5D3GA 1Y97A 4B3SK 2ZM6K 2A5XA 4BVPA 1RT3A 3PIOL 1GLDG 4KTZA 5AQPA 3AA2A 4CJ4A 3LZJA 4JRQA 2VWJA 4ILHA 4B9QA 4IOAL 1NGGA 1CLQA 3C0BA 4OLBA 2HNZA 3HT3A 1YITN 5M1PA 3V81A 1K8AO 1CXUA 3VGKA 3BDPA 5AQHA 3M8QA 3I55N 1BGXT 4BRPA 4JD2B 2ATQA 4Q0BA 5BN8A 3QFUA 5AQQA 5JICA 3V4IA 4M3XA 4DV6K 3QIPA 1NKCA 1HPZA 5I9EB 2O8CB 1S22A 1T6DA 3MCAB 1OH5A 1CZBA 3TPQA 2G8KA 2DFFA 1NJZA 2P51A 1Z25A 1D9FA 4ID1A 1YI2N 3AA4A 5KTQA 4DFJA 3OS1A 4EP5A 5JVHL 4KI6A 3SV3A 1Q82O 1NGHA 1U4BA 2E2NA 4CVNE 2HHXA 2ZWHA 1QQOA 4FWLA 4OPHA 4E1MA 3OYKA 3CMAN 4FOEA 5HRSA 3ENHA 2J4RA 4C8KA 1SAZA
chains in the Genus database with same CATH topology
1L3SA 4RG8A 3AVHA 3LP0A 4DLEA 4FXDA 2B6AA 1TGOA 3LANA 4W5RA 4AHVA 4CF1A 3NAEA 1F21A 3RMCA 1ZBLA 3PO5A 1B9FA 1S1UA 1VSJA 4F2SA 1JL1A 4M3RA 1BCMA 1JKHA 3TWHA 3SUPA 4DTMA 1BQNA 2G8UA 4HUEA 3V9SA 4M3WA 4LSNA 2QKKA 4I2QA 4E7KA 1JL2A 3RMBA 3AO1A 4OKJA 3CM6A 4HCCA 1UAXA 2HMIA 2X74A 1BISA 2IDOA 3SPZA 1SKWA 3DMJA 3S3MA 2LSNA 3RR8A 3OS0A 1CZ9A 4DTSA 4NYNA 3TAMA 3KTQA 1JLEA 4CFAA 3K5MA 3QNOA 3CG7A 4CEOA 1J5OA 3TAQA 1KFDA 1HNVA 1U49A 3M8PA 3JYTA 5C24A 4R5PA 4FJMA 1KVBA 4PWDA 4DQSA 4FJGA 1WSGA 3OYDA 2QXFA 4HVJA 4BDYA 2X6NA 3SPYA 5KGXA 4DTRA 3U3GA 3PX6A 4FZYA 2E4LA 5HP1A 1N5YA 2A1SA 4B9UA 4FZZA 2KFNA 4LSLA 1QSSA 3TI0A 4IFVA 5KGWA 3VN5A 4AHUA 1TK8A 4FJJA 3AVNA 2Z1IA 4H4MA 1FXXA 4BE0A 4RW7A 4L8RB 1TAUA 4Q5VA 3VQPA 3AV9A 1C0MA 4I7FA 4B8AB 3M8RA 1X9SA 3DRSA 2XRIA 1X9MA 2G8IA 1GOCA 4HUGA 1A5WA 3CFRA 4CJ3A 1LV5A 3AO5A 4B9TA 3NFAA 3SQ2A 3OYLA 1B92A 2XHBA 4FJXA 4PY5A 1K6YA 3LP2A 1KVAA 1MU2A 1RT7A 1WSFA 1O1WA 1WSJA 5CYMA 4CECA 3C95A 1FKOA 3DOKA 1WAFA 1JLAA 3IRXA 3VQ5A 3OYJA 1RDDA 3KLGA 5J2MA 3HPOA 1VSFA 3SQ1A 1S1XA 4CGHA 3UIQA 4GMJB 2G8FA 1SUQA 1LW0A 1HQEA 1WSIA 4CHZA 3PUFA 1VK0A 4E89A 2G8KA 4J2DA 4M42A 2RPIA 4BDZA 1I39A 3KIOA 3MECA 4Z4HA 4O44A 1KTQA 2HNDA 3NDKA 4KHYA 1UA1A 3IG1A 1D9DA 3K57A 2KQ2A 4OLAA 1GOAA 1YT3A 3DYAA 3HVTA 4CJVA 3LPUA 3MEGA 3OYBA 2ZQBA 4E0DA 1BQMA 4OPJA 4FK2A 4OGEA 4KHQA 3TAFA 3RMAA 5DK5A 2KTQA 2OYQA 1RCHA 2G8WA 2FBTA 4AH9A 4NYFA 1LAVA 3KKSA 4ELVA 4J2AA 3ZCMA 3AVFA 1RBTA 3AVGA 3D45A 5HBMA 4DS5A 3E01A 2KFZA 4CE9A 3C6UA 3AVMA 3KJVA 3SJJA 1TAQA 3OYAA 4DS4A 3ZSWA 1XC9A 4KB0A 2YNFA 3OVNA 4E19A 3T3FA 2HHWA 3VQEA 1J9AA 1RDCA 1RTHA 3HYFA 5FROA 1QS4A 4IDKA 4N5SA 4O5BA 4DTUA 3A2FA 3DLBA 2FC0A 4DQRA 3OJSA 3NH1A 4ELTA 3HL8A 2DFHA 2E6MA 3KLFA 3AVLA 3AVAA 2AJQA 4C8MA 4OGCA 4Z4CA 2GUIA 3EY1A 1XHZA 4DG1A 2Y1IA 3OYMA 4B9VA 1ASUA 2OZSA 3CFPA 1SKRA 1Z26A 4CERA 4PQUA 3KKRA 3MAQA 3O4NA 3ZSOA 3CQ8A 1CXQA 3HP9A 4YNQA 1JLCA 3DI6A 4FJNA 3QEWA 1KLNA 2G8VA 1SL0A 3HJFA 3F73A 3OJUA 4CHQA 5HRNA 2YNHA 1RTJA 1NJYA 1BL3A 3T19A 1L3TA 3ZSXA 4LY7A 4CGGA 1LW2A 2FBXA 3S9HA 1VRTA 1C1BA 4M3TA 1XI1A 3NF9A 4CJFA 4F8RA 2Z1GA 4B08A 3PV8A 1W9HA 2F96A 2BE2A 3K2PA 3QEIA 1L3UA 2D0AA 2RF2A 3WNFA 3AO4A 2ZD1A 3L2RA 3NE6A 4H4OA 3O3HA 4FZXC 2YHAA 4CJQA 4CEFA 3NH2A 3AVBA 3K5OA 2BDPA 4HCBA 4KHWA 1HMVA 1RILA 3KK2A 4B3OA 4FM0A 3AVCA 4FW1A 3TAGA 1TKXA 3HM9A 4C8NA 3HPGA 3SYZA 4IKFA 4B8CA 1VSIA 3DLKA 3O3GA 2WOMA 3OS2A 1WSEA 3K5NA 2D0CA 4FJ9A 2KZZA 3V9UA 3RR7A 1NK0A 4KB1A 4DTXA 4IG3A 1HYSA 3DLEA 1C6VA 4FLZA 3NH0A 3VA0A 4KFBA 1QTMA 3VQ6A 4ID5A 2X6SA 3L2QA 5J1EA 4CF2A 4CK2A 1HRHA 3LWMA 2VG6A 4LH4A 4E7JA 2IAJA 3V1RA 1FKPA 1BI4B 2XY6A 3NGYA 4FW2A 3TR8A 1S5JA 3KD5E 3K58A 4CEQA 3K59A 1S9GA 1TK5A 3KLHA 3QLHA 2XO7A 4QAGA 3KD1E 1ASVA 3NF8A 3ISNC 1L3VA 1SKSA 2F8SA 5SZTA 2EX3A 3HO1A 1DLOA 1REVA 2OPPA 3TAEA 4ICLA 4BE1A 3ITHA 4DTOA 1QHTA 1WN7A 5I3UA 5C42A 1RBVA 4FJ8A 3L3VA 1KVCA 4CJEA 4OKEA 4Z4EA 4IBNA 2IOCA 3C94A 5KRSA 3QEXA 1NK6A 4E7HA 4F3TA 4PA1A 1XHXA 4CJRA 3QEVA 3IAYA 4CK3A 5HROA 3O4QA 2QK9A 1EXQA 4M45A 1WAJA 4W5TA 2YHBA 3QO9A 4G1QA 1WLJA 3ZT2A 3SQ4A 4MFBA 3LAMA 2Z1HA 4W5OA 4H8KA 1TKTA 4ZTFA 1NJWA 1D8YA 1TL1A 1QE1A 4WE1A 3AA3A 5DMRA 4DTJA 1HNIA 4E3SA 2QKBA 5CZ2A 4KREA 4DFMA 4CJPA 4KAZA 1LAWA 3MXJA 2A1RA 4N41A 4Z4IA 1HYVA 2Z1JA 1BIZA 2ITGA 3B6PA 4JRPA 1L5UA 4CHYA 3EYZA 1NOYA 4MQ3A 4Z4GA 2DY4A 3DM2A 5FRMA 1NOZA 4CFCA 3O3FA 1NKEA 4I9LA 1RBRA 1NK9A 4RW6A 3VQ8A 2E6LA 1WNSA 2PY5A 3PY8A 1BHLA 3QINA 4CJSA 4DTPA 4DSLA 3WNEA 1IKWA 4DFKA 2IC3A 3SI6A 1T03A 3V9WA 4KHNA 4FVMA 1JLQA 1RTIA 1JLFA 2JGUA 3QERA 1QSLA 2Y1JA 1Q9YA 2R7YA 1UOCA 1R0AA 3LP1A 1JLGA 3LP3A 4C8KA 1ITGA 4CJLA 4F4KA 3LDSA 2VG5A 2EHGA 2HHUA 1IO2A 4FLYA 4BWMA 3L8BA 1VRUA 3HK2A 2B4JA 1NJXA 2P1JA 4FK0A 1VSDA 4KTQA 4RW4A 4FLTA 1I3AA 4AHSA 3DRRA 3VQBA 3WNGA 4PUOA 4J2BA 3MEEA 1S6QA 1RBSA 3THVA 4HTUA 4CJWA 3LALA 2P5GA 3SV4A 1SL2A 3DLRA 1S6PA 5J2PA 3CFOA 2G8HA 4FJ5A 3VQ4A 4CF8A 3RRHA 1YTAA 2XY5A 3HVRA 3ALYA 3EZ5A 1HJRA 4W5NA 2Q3SA 4B9MA 5SWMA 5KI6A 1JLBA 3VQDA 4DFPA 3TABA 2YV0X 2D5RA 4DLGA 2PYLA 3OYFA 1U04A 4DU4A 4DQPA 3KLIA 1YTUA 1X1PA 4O0IA 4J2EA 2BGGA 2DTUA 2OPRA 1YVUA 4UQGA 2HVHA 1QSYA 5K14A 1D5AA 1ZBIA 4EZ9A 4M3UA 4O4GA 5HRPA 3HXMA 4DWIA 4FCYA 1VSHA 2YKMA 4CGDA 3L2VA 1TV6A 3VQQA 4DQIA 2JLEA 2F8TA 2DFEA 1EKEA 3VA3A 4CEDA 1C1AA 3ZSQA 4FJ7A 3NF7A 5FDLA 3SQ0A 4E7IA 4RW9A 4KHUA 3I0RA 3K5LA 1KRPA 4Y1DA 4FM1A 2FBYA 3BGRA 3I0SA 5CZ1A 3LWLA 3QNNA 5CY4A 4K8XA 4DSIA 2OPSA 3M8SA 4CJTA 3QETA 2RN2A 4DSJA 2ZE2A 3L2WA 2HHQA 1B9DA 1QQCA 1C0TA 1VSLA 3G10A 4O55A 4M3ZA 2B5JA 1G15A 2D0BA 4CEAA 1C0UA 4DU1A 3U3YA 4KHSA 4FJHA 3L2UA 1ASWA 4F2RA 4ZHRA 3V6DA 3B6OA 4I2PA 3NHGA 3AO3A 2YKNA 4N56A 1SL1A 1RBUA 4FLWA 3ZT3A 1TVRA 3AO2A 3NF6A 4DF8A 3RMDA 4CHOA 1C1CA 3G0ZA 1NK7A 4RW8A 4EZ6A 4E7LA 5C25A 3S3OA 3QIOA 4IG0A 4FLUA 4BE2A 1LWCA 4CHNA 4FK4A 1LWEA 2HHVA 2PYJA 3MXIA 1JXEA 4CJ5A 3I8DA 4CCHA 4DF4A 5T7BA 4QCLA 4JS4A 1A5XA 1RT5A 1ZBUA 5J2NA 2XY8A 2YNGA 4YFUA 4OJRA 2HVIA 1BCOA 4JS5A 3OYNA 1NK8A 1VSKA 2OZMA 4CIEA 1RDBA 3DRPA 4DTNA 3SCXA 4DMNA 2GV9A 5E41A 4Y1CA 2RKIA 1IG9A 2W42A 1TK0A 4C8OA 1Q8IA 3MEDA 5EU7A 3LZIA 5J2QA 2OPQA 3OYGA 3RWUA 2O4IA 4NCAA 4I9QA 4B9SA 1NK4A 4OVLA 4B9NA 4AHRA 1S9EA 1UA0A 1KCFA 1RT6A 4W5QA 4CGIA 2P5OA 1Q9XA 4BDPA 1ZBHA 3KLEA 3TARA 1KFSA 4CF9A 4KKOA 1BIUA 3CM5A 1IH7A 4CFBA 1TL3A 4KRFA 4CHPA 3V9ZA 4C8LA 4FJLA 4QOZB 1RDAA 3QESA 1A5VA 3CYMA 3SUOA 1S1TA 2ETJA 4CEZA 3VQAA 3SZ2A 1IKXA 2NUBA 3JSMA 4CIGA 2KZMA 1GOBA 2IGIA 1TKDA 4OPKA 1J53A 3SUQA 1DTTA 4ZTJA 3RTVA 4CK1A 4CGJA 4FM2A 3VQ9A 2O4GA 3F9KA 3T1AA 3HP6A 5KRTA 1FK9A 4CIFA 4FJIA 3ZT1A 3PO4A 3ZT4A 3P1GA 1EP4A 1RTDA 3OY9A 4FJKA 4M3YA 4LD0A 4HHTA 3ULDA 1NK5A 1T7PA 3TANA 1HYZA 1EETA 3DOLA 1J54A 1WSHA 4KO0A 4CEBA 4CF0A 4BWJA 4E1NA 4BACA 1UWBA 3L3UA 4FLXA 3KK3A 2XY7A 3D0PA 1KLMA 3OYIA 5I42A 3ZSZA 3TAPA 1RNHA 3LPTA 5D3GA 1Y97A 1NKBA 3VQCA 1U48A 4O0JA 4DSEA 3U6FA 4N76A 1U45A 5FRNA 1RT3A 1VSMA 3WNHA 2HW3A 4KTZA 3H08A 1X9WA 2FBVA 2HB5A 3AA2A 4CJ4A 3LZJA 4JRQA 1ZYQA 2VWJA 3ZSYA 5HLFA 2HNYA 3P5JA 1TKZA 2VG7A 1RT2A 2VWKA 3NBPA 3P83D 4HUFA 1CLQA 4IFYA 4OLBA 2HNZA 3HT3A 4NCBA 2YNIA 3V81A 4AILC 1CXUA 3HPHA 4EP4A 4CJUA 5JS1A 3OYCA 3BDPA 4DSKA 1JXBA 3M8QA 1U47A 2HHTA 1RT4A 1BGXT 3NCIA 4KV8A 1HQUA 4KPYA 3RRGA 2ATQA 4Q0BA 1T8EA 2X78A 4N47A 4DU3A 3FFIA 3V4IA 4GW6A 4CGFA 1IKYA 4M3XA 3AVIA 4B9LA 1EX4A 1ZBFA 4KI4A 1T05A 2HHSA 3QIPA 3ZSVA 3V1QA 3C6TA 2I5JA 3MXMA 4OKKA 1S1WA 1NKCA 4FYDA 4CESA 1HPZA 4LH5A 3ZT0A 2OA8A 3DLHA 4ELUA 1W0HA 4Z4FA 3AA5X 3NGZA 1CZBA 4Z0UA 1XWLA 3S3NA 4AHCA 3VQ7A 3DLGA 4AHTA 3NGIA 2DFFA 5HRRA 1BI4A 1NJZA 2P51A 4CJKA 4FLVA 1Z25A 4TSXA 2GBZA 4GVMA 1VSEA 1D9FA 4K8ZA 5CYQA 4ID1A 3AA4A 5KTQA 4DFJA 1LWFA 3OS1A 4EP5A 4CEEA 4KI6A 4M41A 3SUNA 3SV3A 4XIUA 3HSTB 1N6QA 3OYHA 1SV5A 1U4BA 1S1VA 1DTQA 4DQQA 3QEPA 3IS9A 2IS3A 1KSPA 2BANA 2HHXA 3ASMA 4CFDA 3SNNA 3AVJA 1IKVA 5JS2A 4E1MA 3KK1A 4F3OA 2PZSA 3OYKA 4DSFA 4KTWA 1RT1A 2WONA 4NCGA 4JLHA 3V1OA 5HRSA 3PX0A 2KW4A 3PX4A 3OYEA 3ZSRA 3V9XA 3LAKA 3AVKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L3S A;  4RG8 A;  3AVH A;  3LP0 A;  4DLE A;  4FXD A;  2B6A A;  1TGO A;  3LAN A;  4W5R A;  4AHV A;  4CF1 A;  3NAE A;  1F21 A;  3RMC A;  1ZBL A;  3PO5 A;  1B9F A;  1S1U A;  1VSJ A;  4F2S A;  1JL1 A;  4M3R A;  1BCM A;  1JKH A;  3TWH A;  3SUP A;  4DTM A;  1BQN A;  2G8U A;  4HUE A;  3V9S A;  4M3W A;  4LSN A;  2QKK A;  4I2Q A;  4E7K A;  1JL2 A;  3RMB A;  3AO1 A;  4OKJ A;  3CM6 A;  4HCC A;  1UAX A;  2HMI A;  2X74 A;  1BIS A;  2IDO A;  3SPZ A;  1SKW A;  3DMJ A;  3S3M A;  2LSN A;  3RR8 A;  3OS0 A;  1CZ9 A;  4DTS A;  4NYN A;  3TAM A;  3KTQ A;  1JLE A;  4CFA A;  3K5M A;  3QNO A;  3CG7 A;  4CEO A;  1J5O A;  3TAQ A;  1KFD A;  1HNV A;  1U49 A;  3M8P A;  3JYT A;  5C24 A;  4R5P A;  4FJM A;  1KVB A;  4PWD A;  4DQS A;  4FJG A;  1WSG A;  3OYD A;  2QXF A;  4HVJ A;  4BDY A;  2X6N A;  3SPY A;  5KGX A;  4DTR A;  3U3G A;  3PX6 A;  4FZY A;  2E4L A;  5HP1 A;  1N5Y A;  2A1S A;  4B9U A;  4FZZ A;  2KFN A;  4LSL A;  1QSS A;  3TI0 A;  4IFV A;  5KGW A;  3VN5 A;  4AHU A;  1TK8 A;  4FJJ A;  3AVN A;  2Z1I A;  4H4M A;  1FXX A;  4BE0 A;  4RW7 A;  4L8R B;  1TAU A;  4Q5V A;  3VQP A;  3AV9 A;  1C0M A;  4I7F A;  4B8A B;  3M8R A;  1X9S A;  3DRS A;  2XRI A;  1X9M A;  2G8I A;  1GOC A;  4HUG A;  1A5W A;  3CFR A;  4CJ3 A;  1LV5 A;  3AO5 A;  4B9T A;  3NFA A;  3SQ2 A;  3OYL A;  1B92 A;  2XHB A;  4FJX A;  4PY5 A;  1K6Y A;  3LP2 A;  1KVA A;  1MU2 A;  1RT7 A;  1WSF A;  1O1W A;  1WSJ A;  5CYM A;  4CEC A;  3C95 A;  1FKO A;  3DOK A;  1WAF A;  1JLA A;  3IRX A;  3VQ5 A;  3OYJ A;  1RDD A;  3KLG A;  5J2M A;  3HPO A;  1VSF A;  3SQ1 A;  1S1X A;  4CGH A;  3UIQ A;  4GMJ B;  2G8F A;  1SUQ A;  1LW0 A;  1HQE A;  1WSI A;  4CHZ A;  3PUF A;  1VK0 A;  4E89 A;  2G8K A;  4J2D A;  4M42 A;  2RPI A;  4BDZ A;  1I39 A;  3KIO A;  3MEC A;  4Z4H A;  4O44 A;  1KTQ A;  2HND A;  3NDK A;  4KHY A;  1UA1 A;  3IG1 A;  1D9D A;  3K57 A;  2KQ2 A;  4OLA A;  1GOA A;  1YT3 A;  3DYA A;  3HVT A;  4CJV A;  3LPU A;  3MEG A;  3OYB A;  2ZQB A;  4E0D A;  1BQM A;  4OPJ A;  4FK2 A;  4OGE A;  4KHQ A;  3TAF A;  3RMA A;  5DK5 A;  2KTQ A;  2OYQ A;  1RCH A;  2G8W A;  2FBT A;  4AH9 A;  4NYF A;  1LAV A;  3KKS A;  4ELV A;  4J2A A;  3ZCM A;  3AVF A;  1RBT A;  3AVG A;  3D45 A;  5HBM A;  4DS5 A;  3E01 A;  2KFZ A;  4CE9 A;  3C6U A;  3AVM A;  3KJV A;  3SJJ A;  1TAQ A;  3OYA A;  4DS4 A;  3ZSW A;  1XC9 A;  4KB0 A;  2YNF A;  3OVN A;  4E19 A;  3T3F A;  2HHW A;  3VQE A;  1J9A A;  1RDC A;  1RTH A;  3HYF A;  5FRO A;  1QS4 A;  4IDK A;  4N5S A;  4O5B A;  4DTU A;  3A2F A;  3DLB A;  2FC0 A;  4DQR A;  3OJS A;  3NH1 A;  4ELT A;  3HL8 A;  2DFH A;  2E6M A;  3KLF A;  3AVL A;  3AVA A;  2AJQ A;  4C8M A;  4OGC A;  4Z4C A;  2GUI A;  3EY1 A;  1XHZ A;  4DG1 A;  2Y1I A;  3OYM A;  4B9V A;  1ASU A;  2OZS A;  3CFP A;  1SKR A;  1Z26 A;  4CER A;  4PQU A;  3KKR A;  3MAQ A;  3O4N A;  3ZSO A;  3CQ8 A;  1CXQ A;  3HP9 A;  4YNQ A;  1JLC A;  3DI6 A;  4FJN A;  3QEW A;  1KLN A;  2G8V A;  1SL0 A;  3HJF A;  3F73 A;  3OJU A;  4CHQ A;  5HRN A;  2YNH A;  1RTJ A;  1NJY A;  1BL3 A;  3T19 A;  1L3T A;  3ZSX A;  4LY7 A;  4CGG A;  1LW2 A;  2FBX A;  3S9H A;  1VRT A;  1C1B A;  4M3T A;  1XI1 A;  3NF9 A;  4CJF A;  4F8R A;  2Z1G A;  4B08 A;  3PV8 A;  1W9H A;  2F96 A;  2BE2 A;  3K2P A;  3QEI A;  1L3U A;  2D0A A;  2RF2 A;  3WNF A;  3AO4 A;  2ZD1 A;  3L2R A;  3NE6 A;  4H4O A;  3O3H A;  4FZX C;  2YHA A;  4CJQ A;  4CEF A;  3NH2 A;  3AVB A;  3K5O A;  2BDP A;  4HCB A;  4KHW A;  1HMV A;  1RIL A;  3KK2 A;  4B3O A;  4FM0 A;  3AVC A;  4FW1 A;  3TAG A;  1TKX A;  3HM9 A;  4C8N A;  3HPG A;  3SYZ A;  4IKF A;  4B8C A;  1VSI A;  3DLK A;  3O3G A;  2WOM A;  3OS2 A;  1WSE A;  3K5N A;  2D0C A;  4FJ9 A;  2KZZ A;  3V9U A;  3RR7 A;  1NK0 A;  4KB1 A;  4DTX A;  4IG3 A;  1HYS A;  3DLE A;  1C6V A;  4FLZ A;  3NH0 A;  3VA0 A;  4KFB A;  1QTM A;  3VQ6 A;  4ID5 A;  2X6S A;  3L2Q A;  5J1E A;  4CF2 A;  4CK2 A;  1HRH A;  3LWM A;  2VG6 A;  4LH4 A;  4E7J A;  2IAJ A;  3V1R A;  1FKP A;  1BI4 B;  2XY6 A;  3NGY A;  4FW2 A;  3TR8 A;  1S5J A;  3KD5 E;  3K58 A;  4CEQ A;  3K59 A;  1S9G A;  1TK5 A;  3KLH A;  3QLH A;  2XO7 A;  4QAG A;  3KD1 E;  1ASV A;  3NF8 A;  3ISN C;  1L3V A;  1SKS A;  2F8S A;  5SZT A;  2EX3 A;  3HO1 A;  1DLO A;  1REV A;  2OPP A;  3TAE A;  4ICL A;  4BE1 A;  3ITH A;  4DTO A;  1QHT A;  1WN7 A;  5I3U A;  5C42 A;  1RBV A;  4FJ8 A;  3L3V A;  1KVC A;  4CJE A;  4OKE A;  4Z4E A;  4IBN A;  2IOC A;  3C94 A;  5KRS A;  3QEX A;  1NK6 A;  4E7H A;  4F3T A;  4PA1 A;  1XHX A;  4CJR A;  3QEV A;  3IAY A;  4CK3 A;  5HRO A;  3O4Q A;  2QK9 A;  1EXQ A;  4M45 A;  1WAJ A;  4W5T A;  2YHB A;  3QO9 A;  4G1Q A;  1WLJ A;  3ZT2 A;  3SQ4 A;  4MFB A;  3LAM A;  2Z1H A;  4W5O A;  4H8K A;  1TKT A;  4ZTF A;  1NJW A;  1D8Y A;  1TL1 A;  1QE1 A;  4WE1 A;  3AA3 A;  5DMR A;  4DTJ A;  1HNI A;  4E3S A;  2QKB A;  5CZ2 A;  4KRE A;  4DFM A;  4CJP A;  4KAZ A;  1LAW A;  3MXJ A;  2A1R A;  4N41 A;  4Z4I A;  1HYV A;  2Z1J A;  1BIZ A;  2ITG A;  3B6P A;  4JRP A;  1L5U A;  4CHY A;  3EYZ A;  1NOY A;  4MQ3 A;  4Z4G A;  2DY4 A;  3DM2 A;  5FRM A;  1NOZ A;  4CFC A;  3O3F A;  1NKE A;  4I9L A;  1RBR A;  1NK9 A;  4RW6 A;  3VQ8 A;  2E6L A;  1WNS A;  2PY5 A;  3PY8 A;  1BHL A;  3QIN A;  4CJS A;  4DTP A;  4DSL A;  3WNE A;  1IKW A;  4DFK A;  2IC3 A;  3SI6 A;  1T03 A;  3V9W A;  4KHN A;  4FVM A;  1JLQ A;  1RTI A;  1JLF A;  2JGU A;  3QER A;  1QSL A;  2Y1J A;  1Q9Y A;  2R7Y A;  1UOC A;  1R0A A;  3LP1 A;  1JLG A;  3LP3 A;  4C8K A;  1ITG A;  4CJL A;  4F4K A;  3LDS A;  2VG5 A;  2EHG A;  2HHU A;  1IO2 A;  4FLY A;  4BWM A;  3L8B A;  1VRU A;  3HK2 A;  2B4J A;  1NJX A;  2P1J A;  4FK0 A;  1VSD A;  4KTQ A;  4RW4 A;  4FLT A;  1I3A A;  4AHS A;  3DRR A;  3VQB A;  3WNG A;  4PUO A;  4J2B A;  3MEE A;  1S6Q A;  1RBS A;  3THV A;  4HTU A;  4CJW A;  3LAL A;  2P5G A;  3SV4 A;  1SL2 A;  3DLR A;  1S6P A;  5J2P A;  3CFO A;  2G8H A;  4FJ5 A;  3VQ4 A;  4CF8 A;  3RRH A;  1YTA A;  2XY5 A;  3HVR A;  3ALY A;  3EZ5 A;  1HJR A;  4W5N A;  2Q3S A;  4B9M A;  5SWM A;  5KI6 A;  1JLB A;  3VQD A;  4DFP A;  3TAB A;  2YV0 X;  2D5R A;  4DLG A;  2PYL A;  3OYF A;  1U04 A;  4DU4 A;  4DQP A;  3KLI A;  1YTU A;  1X1P A;  4O0I A;  4J2E A;  2BGG A;  2DTU A;  2OPR A;  1YVU A;  4UQG A;  2HVH A;  1QSY A;  5K14 A;  1D5A A;  1ZBI A;  4EZ9 A;  4M3U A;  4O4G A;  5HRP A;  3HXM A;  4DWI A;  4FCY A;  1VSH A;  2YKM A;  4CGD A;  3L2V A;  1TV6 A;  3VQQ A;  4DQI A;  2JLE A;  2F8T A;  2DFE A;  1EKE A;  3VA3 A;  4CED A;  1C1A A;  3ZSQ A;  4FJ7 A;  3NF7 A;  5FDL A;  3SQ0 A;  4E7I A;  4RW9 A;  4KHU A;  3I0R A;  3K5L A;  1KRP A;  4Y1D A;  4FM1 A;  2FBY A;  3BGR A;  3I0S A;  5CZ1 A;  3LWL A;  3QNN A;  5CY4 A;  4K8X A;  4DSI A;  2OPS A;  3M8S A;  4CJT A;  3QET A;  2RN2 A;  4DSJ A;  2ZE2 A;  3L2W A;  2HHQ A;  1B9D A;  1QQC A;  1C0T A;  1VSL A;  3G10 A;  4O55 A;  4M3Z A;  2B5J A;  1G15 A;  2D0B A;  4CEA A;  1C0U A;  4DU1 A;  3U3Y A;  4KHS A;  4FJH A;  3L2U A;  1ASW A;  4F2R A;  4ZHR A;  3V6D A;  3B6O A;  4I2P A;  3NHG A;  3AO3 A;  2YKN A;  4N56 A;  1SL1 A;  1RBU A;  4FLW A;  3ZT3 A;  1TVR A;  3AO2 A;  3NF6 A;  4DF8 A;  3RMD A;  4CHO A;  1C1C A;  3G0Z A;  1NK7 A;  4RW8 A;  4EZ6 A;  4E7L A;  5C25 A;  3S3O A;  3QIO A;  4IG0 A;  4FLU A;  4BE2 A;  1LWC A;  4CHN A;  4FK4 A;  1LWE A;  2HHV A;  2PYJ A;  3MXI A;  1JXE A;  4CJ5 A;  3I8D A;  4CCH A;  4DF4 A;  5T7B A;  4QCL A;  4JS4 A;  1A5X A;  1RT5 A;  1ZBU A;  5J2N A;  2XY8 A;  2YNG A;  4YFU A;  4OJR A;  2HVI A;  1BCO A;  4JS5 A;  3OYN A;  1NK8 A;  1VSK A;  2OZM A;  4CIE A;  1RDB A;  3DRP A;  4DTN A;  3SCX A;  4DMN A;  2GV9 A;  5E41 A;  4Y1C A;  2RKI A;  1IG9 A;  2W42 A;  1TK0 A;  4C8O A;  1Q8I A;  3MED A;  5EU7 A;  3LZI A;  5J2Q A;  2OPQ A;  3OYG A;  3RWU A;  2O4I A;  4NCA A;  4I9Q A;  4B9S A;  1NK4 A;  4OVL A;  4B9N A;  4AHR A;  1S9E A;  1UA0 A;  1KCF A;  1RT6 A;  4W5Q A;  4CGI A;  2P5O A;  1Q9X A;  4BDP A;  1ZBH A;  3KLE A;  3TAR A;  1KFS A;  4CF9 A;  4KKO A;  1BIU A;  3CM5 A;  1IH7 A;  4CFB A;  1TL3 A;  4KRF A;  4CHP A;  3V9Z A;  4C8L A;  4FJL A;  4QOZ B;  1RDA A;  3QES A;  1A5V A;  3CYM A;  3SUO A;  1S1T A;  2ETJ A;  4CEZ A;  3VQA A;  3SZ2 A;  1IKX A;  2NUB A;  3JSM A;  4CIG A;  2KZM A;  1GOB A;  2IGI A;  1TKD A;  4OPK A;  1J53 A;  3SUQ A;  1DTT A;  4ZTJ A;  3RTV A;  4CK1 A;  4CGJ A;  4FM2 A;  3VQ9 A;  2O4G A;  3F9K A;  3T1A A;  3HP6 A;  5KRT A;  1FK9 A;  4CIF A;  4FJI A;  3ZT1 A;  3PO4 A;  3ZT4 A;  3P1G A;  1EP4 A;  1RTD A;  3OY9 A;  4FJK A;  4M3Y A;  4LD0 A;  4HHT A;  3ULD A;  1NK5 A;  1T7P A;  3TAN A;  1HYZ A;  1EET A;  3DOL A;  1J54 A;  1WSH A;  4KO0 A;  4CEB A;  4CF0 A;  4BWJ A;  4E1N A;  4BAC A;  1UWB A;  3L3U A;  4FLX A;  3KK3 A;  2XY7 A;  3D0P A;  1KLM A;  3OYI A;  5I42 A;  3ZSZ A;  3TAP A;  1RNH A;  3LPT A;  5D3G A;  1Y97 A;  1NKB A;  3VQC A;  1U48 A;  4O0J A;  4DSE A;  3U6F A;  4N76 A;  1U45 A;  5FRN A;  1RT3 A;  1VSM A;  3WNH A;  2HW3 A;  4KTZ A;  3H08 A;  1X9W A;  2FBV A;  2HB5 A;  3AA2 A;  4CJ4 A;  3LZJ A;  4JRQ A;  1ZYQ A;  2VWJ A;  3ZSY A;  5HLF A;  2HNY A;  3P5J A;  1TKZ A;  2VG7 A;  1RT2 A;  2VWK A;  3NBP A;  3P83 D;  4HUF A;  1CLQ A;  4IFY A;  4OLB A;  2HNZ A;  3HT3 A;  4NCB A;  2YNI A;  3V81 A;  4AIL C;  1CXU A;  3HPH A;  4EP4 A;  4CJU A;  5JS1 A;  3OYC A;  3BDP A;  4DSK A;  1JXB A;  3M8Q A;  1U47 A;  2HHT A;  1RT4 A;  1BGX T;  3NCI A;  4KV8 A;  1HQU A;  4KPY A;  3RRG A;  2ATQ A;  4Q0B A;  1T8E A;  2X78 A;  4N47 A;  4DU3 A;  3FFI A;  3V4I A;  4GW6 A;  4CGF A;  1IKY A;  4M3X A;  3AVI A;  4B9L A;  1EX4 A;  1ZBF A;  4KI4 A;  1T05 A;  2HHS A;  3QIP A;  3ZSV A;  3V1Q A;  3C6T A;  2I5J A;  3MXM A;  4OKK A;  1S1W A;  1NKC A;  4FYD A;  4CES A;  1HPZ A;  4LH5 A;  3ZT0 A;  2OA8 A;  3DLH A;  4ELU A;  1W0H A;  4Z4F A;  3AA5 X;  3NGZ A;  1CZB A;  4Z0U A;  1XWL A;  3S3N A;  4AHC A;  3VQ7 A;  3DLG A;  4AHT A;  3NGI A;  2DFF A;  5HRR A;  1BI4 A;  1NJZ A;  2P51 A;  4CJK A;  4FLV A;  1Z25 A;  4TSX A;  2GBZ A;  4GVM A;  1VSE A;  1D9F A;  4K8Z A;  5CYQ A;  4ID1 A;  3AA4 A;  5KTQ A;  4DFJ A;  1LWF A;  3OS1 A;  4EP5 A;  4CEE A;  4KI6 A;  4M41 A;  3SUN A;  3SV3 A;  4XIU A;  3HST B;  1N6Q A;  3OYH A;  1SV5 A;  1U4B A;  1S1V A;  1DTQ A;  4DQQ A;  3QEP A;  3IS9 A;  2IS3 A;  1KSP A;  2BAN A;  2HHX A;  3ASM A;  4CFD A;  3SNN A;  3AVJ A;  1IKV A;  5JS2 A;  4E1M A;  3KK1 A;  4F3O A;  2PZS A;  3OYK A;  4DSF A;  4KTW A;  1RT1 A;  2WON A;  4NCG A;  4JLH A;  3V1O A;  5HRS A;  3PX0 A;  2KW4 A;  3PX4 A;  3OYE A;  3ZSR A;  3V9X A;  3LAK A;  3AVK A; 
#chains in the Genus database with same CATH topology
 3AVH A;  4W5R A;  1U2V A;  3RMC A;  2QWP A;  1S1U A;  4F2S A;  5DM7 L;  1JKH A;  2E20 A;  4IEI A;  4LSN A;  3THX B;  2KLA A;  4NLC A;  3R3L A;  1UAX A;  2HMI A;  4A2B A;  3AAQ A;  4FWM A;  3H45 C;  1JLE A;  1J5O A;  1X3N A;  2O8D B;  1HNV A;  3ULE A;  2FF3 B;  1U49 A;  3M8P A;  4HVJ A;  3W0L A;  2P9N A;  4DTR A;  1TUY A;  3JAM O;  3WQU A;  3GDQ A;  3AVN A;  3BUZ B;  4RW7 A;  4WQ5 C;  4LF8 K;  5AQZ A;  4IWV A;  4CBU A;  2Q0R A;  3NFA A;  1R59 O;  4LFB K;  1K6Y A;  4X66 K;  1TK0 A;  1JCE A;  3SQ1 A;  3D2F A;  3KLG A;  4JKG B;  4ILG B;  2G8F A;  4K0K K;  2D0P A;  1LW0 A;  4BC4 A;  3WQT A;  4BDZ A;  4PHT X;  3VEW A;  4KHY A;  3NDK A;  1MWK A;  2UXD K;  4JKF A;  4OLA A;  1GOA A;  3EKS A;  3HVT A;  1EWR A;  3LPU A;  4FWR A;  3TAF A;  5DK5 A;  2KTQ A;  3LDN A;  2OYQ A;  4CJ7 A;  2FBT A;  2HBL A;  3ZCM A;  2P9N B;  4CZE A;  4DS5 A;  3C6U A;  3AVM A;  3KJV A;  3OYA A;  3ZSW A;  2YNF A;  4MDA A;  1RDC A;  5ELZ A;  3HYF A;  4H03 B;  4GVE A;  2FC0 A;  1BU6 O;  4H0T B;  3D2E B;  4JI6 K;  3HL8 A;  1W97 L;  3CCV N;  3AVA A;  4B9V A;  3EY1 A;  4WFA L;  2Y1I A;  2OZS A;  1YXQ A;  3ZSO A;  4BRO A;  1CXQ A;  2ZF5 O;  1KLN A;  2G8V A;  3DLL L;  4F9O A;  5HRN A;  1BL3 A;  2W6L A;  1L3T A;  3CME N;  1C1B A;  3CER A;  3SJH A;  3PV8 A;  1W9H A;  4UY8 O;  4H4O A;  4FZX C;  2VYP A;  2YHA A;  3H46 O;  4KHW A;  1HMV A;  2IVP A;  3KK2 A;  4QS7 A;  1N34 K;  4FW1 A;  1TKX A;  1VSI A;  2WOM A;  3K5N A;  3ATV A;  2D0C A;  3MN5 A;  3V9U A;  1NK0 A;  3CCJ N;  1ESV A;  4DTX A;  3DLE A;  1QTM A;  3VQ6 A;  3L2Q A;  1T6C A;  3DXM A;  2GX9 A;  4FPA A;  3CJA A;  4BQL A;  3V1R A;  1S5J A;  3K58 A;  2E2Q A;  1SZ2 A;  1TK5 A;  5EXW A;  4DV3 K;  3CHW A;  3NF8 A;  3ISN C;  3SMP A;  1KAY A;  4YOT A;  2V7Z A;  1DLO A;  3TAE A;  3M3Z A;  4CD3 A;  2NRW A;  4BE1 A;  4DTO A;  1QHT A;  5C42 A;  1RBV A;  4FJ8 A;  1VQP N;  4OKE A;  2UU9 K;  2IOC A;  4E7H A;  4F3T A;  3O4Q A;  2OCE A;  1EXQ A;  4M45 A;  1WAJ A;  4CZH A;  3SQ4 A;  3LAM A;  3O9U A;  2QWQ A;  2YJF A;  3MN6 A;  4U7B A;  4JNE A;  2UUB K;  1LAW A;  3MXJ A;  2A1R A;  4N41 A;  2VCP A;  1XMQ K;  2ASP A;  1HNZ K;  1NOY A;  4MQ3 A;  4DR5 K;  3O80 A;  5FRM A;  1Q86 O;  3FGU A;  3BP8 A;  2PY5 A;  2E6L A;  2NRR A;  3MCP A;  4DSL A;  1GLA G;  1GLE G;  4DFK A;  4CZI A;  1JLF A;  1BUP A;  1BA1 A;  5KQD A;  1R0A A;  3LP1 A;  2OAN A;  4F4K A;  3LDS A;  4PKG A;  4BRM A;  5EX5 A;  5C2D A;  2I7N A;  3HK2 A;  2HMP A;  3BEX A;  1NJX A;  3OBW A;  5AFU A;  3CJ9 A;  4BG8 A;  4BC5 A;  4H0O A;  3MEE A;  2P5G A;  3DLR A;  5J2P A;  3ZX0 A;  1HKB A;  3CF5 L;  3HVR A;  3O6W A;  2PFU A;  3A5M C;  5KI6 A;  5SWM A;  3LM2 A;  2YV0 X;  3VOV A;  4J2E A;  2HVH A;  5GIP A;  5K14 A;  3VEY A;  4CGD A;  1E4F T;  1EKE A;  3VA3 A;  2GTD A;  4LF4 K;  3SQ0 A;  2AP1 A;  4E7I A;  4RW9 A;  3I0R A;  3TSQ A;  3VEV A;  4JI8 K;  4JI1 K;  3QET A;  2ZE2 A;  3BF3 A;  3CCQ N;  1B9D A;  1VSL A;  3G10 A;  1XUP O;  4JHD B;  2B5J A;  1G15 A;  4GNI A;  3U3Y A;  4CZM A;  4KHS A;  3L2U A;  1GLJ O;  3I56 N;  4F2R A;  4ZHR A;  4I2P A;  1DGK N;  2JWK A;  3AO3 A;  2YKN A;  4N56 A;  2P9I A;  1SL1 A;  4IOX A;  4EHU A;  3RMD A;  3G0Z A;  1ZXO A;  4RW8 A;  3QIO A;  3ZEU B;  4BE2 A;  3SBT A;  3QDK A;  3LDQ A;  1DEJ A;  1JXE A;  4X62 K;  4CCH A;  2OTL N;  3VES A;  4JS4 A;  2D0O A;  1RT5 A;  1X3M A;  2YNG A;  2QWM A;  3CC4 N;  2HVI A;  3VMF B;  1BCO A;  1YUW A;  4JS5 A;  3OYN A;  1NK8 A;  1VSK A;  2OZM A;  1QZ6 A;  3DRP A;  4DMN A;  2RKI A;  1IG9 A;  4BY9 C;  4C8O A;  1TUU A;  3CQY A;  3MED A;  5EU7 A;  4NCA A;  4EAH D;  4AM7 A;  3O9T A;  4AHR A;  3J7Z O;  1S9E A;  2FXU A;  4CGI A;  4JKG A;  2PBD A;  1BIU A;  4CZF A;  1TL3 A;  4CHP A;  4C8L A;  3J8A A;  1A5V A;  3CYM A;  5F2R A;  2ETJ A;  1M90 O;  3VQA A;  3SZ2 A;  2E1Z A;  2NUB A;  1OVY A;  4OPK A;  1DTT A;  3VQ9 A;  3F9K A;  3T1A A;  3HP6 A;  2NNW A;  3ULD A;  1NK5 A;  3TAN A;  3DAW A;  1EET A;  1HNX K;  5BR8 K;  4CF0 A;  4BWJ A;  3ZET B;  3CPW M;  3GOI A;  3L3U A;  2XY7 A;  5I42 A;  3CCS N;  3TAP A;  3LPT A;  1U48 A;  2BUP A;  4O0J A;  2IVN A;  1BOT O;  2EWS A;  3WXJ A;  1S3X A;  4BR0 A;  1NBW A;  1VSM A;  3WNH A;  4DR6 K;  3K9J A;  5AQG A;  5KQ8 A;  3N4Q A;  1X9W A;  2Q1N A;  4H5W A;  4G9Z A;  3LDP A;  3ZSY A;  5HLF A;  3P5J A;  1TKZ A;  2VWK A;  4Y0W A;  1HR0 K;  4KBO A;  4IFY A;  4AIL C;  4EP4 A;  4C1N K;  1ILY A;  3VGM A;  4DSK A;  4BR9 A;  5MLC Q;  4KPY A;  3RRG A;  4JHD A;  5BPM A;  2X78 A;  4A61 A;  1IKY A;  4XH4 A;  5FLX O;  1ZBF A;  4KI4 A;  3TSP A;  1T05 A;  3ZSV A;  3MXM A;  4OKK A;  4FYD A;  4CES A;  3M5R A;  1IBM K;  4AHC A;  5HRR A;  3FZL A;  1WBD A;  4TSX A;  1EQY A;  2GBZ A;  4YDU A;  1VSE A;  3Q7B A;  1LWF A;  4CEE A;  4M41 A;  3E9O A;  3HST B;  4XIU A;  5ADX H;  4MO4 A;  3OYH A;  2FLO A;  2O8D A;  3IS9 A;  1XNQ K;  2QWN A;  2BAN A;  4CFD A;  5LJV A;  4F3O A;  1WOQ A;  4KTW A;  1RT1 A;  4DV1 K;  4IFE A;  3PX0 A;  3OYE A;  5IWA K;  4FL9 A;  5ADX A;  1L3S A;  4RG8 A;  4FXD A;  2H3G X;  4CF1 A;  1VAZ A;  4M3R A;  5GAG P;  3TWH A;  4DUY K;  1BQN A;  3V9S A;  3CI5 A;  1YJW N;  3RSE A;  1EO1 A;  2HST A;  4B1Z A;  4IDH A;  2NLX A;  4HCC A;  3ATU A;  2IDO A;  1SKW A;  1SS6 A;  3DMJ A;  2LSN A;  3C6H A;  4NYN A;  3O9R A;  3TAM A;  4B1X B;  3KTQ A;  1GLF O;  4EFH A;  5C15 A;  3TAQ A;  3Q7C A;  1DKG D;  3P31 A;  1N33 K;  2F7T A;  4BDY A;  3T69 A;  3U3G A;  4FZZ A;  5GAE P;  2E4L A;  4DV0 K;  1N5Y A;  1IBL K;  1OKJ A;  1TK8 A;  5KGW A;  4FJJ A;  1TAU A;  4H4M A;  5AQU A;  2E2O A;  4Q5V A;  3AV9 A;  5AQF A;  2CGJ A;  4B8A B;  4JK7 A;  4B3T K;  5AQW A;  1X9M A;  1LV5 A;  3BZK A;  5C12 A;  3SQ2 A;  3OYL A;  1B92 A;  2XHB A;  4FJX A;  4PY5 A;  1XQS C;  1MU2 A;  1RT7 A;  5CYM A;  3VQ5 A;  3C95 A;  3DOK A;  5J2M A;  3HPO A;  1NGA A;  2YHW A;  4GMJ B;  4CW7 B;  1HQE A;  4CHZ A;  3PUF A;  1VK0 A;  4J2D A;  3W3D A;  3MEC A;  5KPR A;  3NMU A;  5KPZ A;  5FPM A;  3K57 A;  2KQ2 A;  2VGM A;  1C0F A;  3DYA A;  3O1W A;  3OYB A;  1JJ2 M;  4JKB A;  1LAV A;  3KKS A;  4K41 A;  5M1O A;  4J2A A;  1K8K B;  4JK8 A;  1TAQ A;  4KB0 A;  3T3F A;  2HHW A;  2O8B B;  3VQE A;  1J9A A;  5FRO A;  4DTU A;  3VF6 A;  4LFA K;  3A2F A;  4M7X A;  3NH1 A;  3A0I X;  1NGF A;  3LL3 A;  4XH5 A;  3KLF A;  3WT0 A;  4OGC A;  1XHZ A;  1ASU A;  3CFP A;  1SKR A;  1Z26 A;  3O4N A;  3C7N A;  3HP9 A;  4YNQ A;  1JLC A;  4JEP A;  4MLH A;  1RGI A;  1SL0 A;  3OJU A;  1VQ9 N;  4DQ8 A;  3A5N C;  5KPT A;  1NJY A;  4LY7 A;  4FPB A;  1QQN A;  3S9H A;  3WEE A;  3NF9 A;  3ID6 A;  2Z1G A;  2F96 A;  3K2P A;  3QEI A;  5E84 A;  3VEO A;  3AO4 A;  2ZD1 A;  3O3H A;  4HCB A;  4CJQ A;  1K9M O;  1RIL A;  1MDU B;  1FJG K;  4B3O A;  3SBG A;  3F2K A;  3HPG A;  3O3G A;  2IVO A;  3RR7 A;  4KB1 A;  1HYS A;  4IG3 A;  1C6V A;  3EZW A;  4FLZ A;  3VA0 A;  2FSJ A;  4CF2 A;  1Q81 O;  4B1V A;  1OH8 A;  1BA0 A;  2XY6 A;  3TR8 A;  1WBB A;  1S9G A;  2XO7 A;  4QAG A;  3KD1 E;  5AQT A;  2EX3 A;  2FF6 A;  1REV A;  3ITH A;  1Z05 A;  4A62 A;  3T7Z A;  4CJE A;  1N36 K;  5KRS A;  1NK6 A;  4PA1 A;  3IAY A;  3OW2 M;  4CK3 A;  5HRO A;  2O8E B;  2UXB K;  4A59 A;  4CD1 A;  3ZT2 A;  4MFB A;  3VTH A;  4A5B A;  1VQN N;  1NJW A;  4BRK A;  4WE1 A;  3JS6 A;  3AA3 A;  4DTJ A;  2QKB A;  5CZ2 A;  4FWK A;  4Z4I A;  1HYV A;  3MX5 A;  2Q31 A;  2Q2R A;  2ITG A;  3B6P A;  5AZJ A;  4JRP A;  1L5U A;  1NOZ A;  4CFC A;  3O3F A;  3QBW A;  2ITM A;  1NKE A;  4I9L A;  1NK9 A;  2WBN A;  4CJS A;  5GAD P;  3ID8 A;  5E26 A;  1IKW A;  5IT9 O;  1V4S A;  4BGA A;  1JLQ A;  3QER A;  1RDW X;  4FWS A;  4KH4 A;  5CE3 A;  2R7Y A;  3LP3 A;  4BRQ A;  3J7A P;  4FLY A;  3L8B A;  1VRU A;  2HF4 A;  2B4J A;  3PIP L;  2P9K A;  3A5L C;  4KTQ A;  3CPE A;  4BRD A;  4BRL A;  3DXM B;  3DRR A;  4FWQ A;  4J2B A;  4LF7 K;  3THV A;  2F9T A;  3LAL A;  1SL2 A;  2G8H A;  3VQ4 A;  1KD1 O;  1VQ4 N;  3KHY A;  3ALY A;  3M1F A;  4W5N A;  1Q7Y O;  1EWQ A;  2D5R A;  2FSN A;  1U04 A;  1YTU A;  2WC9 A;  4O0I A;  3G4S N;  4OPA A;  1YVU A;  3VER A;  2JWL A;  4UQG A;  4BRN A;  5BRD A;  1IV0 A;  3IFR A;  1D5A A;  4H0V B;  4M3U A;  1GLB G;  4O4G A;  1ATN A;  4FCY A;  3EEQ A;  4IEE A;  4DQI A;  2JLE A;  2F8T A;  1Y64 A;  3MN7 A;  2P9P A;  4O5F A;  4IO9 L;  4FJ7 A;  5FPN A;  3HTV A;  5FDL A;  3OHR A;  1XMO K;  4BQZ A;  3BZC A;  1KRP A;  4Y1D A;  3LWL A;  5CY4 A;  2KKZ A;  2OPS A;  3E66 A;  5AZI B;  4CJT A;  4PKI A;  2RN2 A;  3UB5 A;  1NU0 A;  2HHQ A;  1C0T A;  1BO5 O;  3PLA A;  3F5T A;  2HBM A;  4DU1 A;  4FJH A;  1ASW A;  2ZJQ L;  3V6D A;  4CZK A;  3GG4 A;  1XC3 A;  3CC2 N;  4YOR A;  3ZT3 A;  3OTO K;  3B8A X;  3NF6 A;  3L0Q A;  5M1Q A;  4CHO A;  3MN9 A;  4JK9 A;  5H1S Q;  1NK7 A;  2QEX N;  1X9J A;  4B3M K;  2O8E A;  3JXU A;  2PYJ A;  3VEX A;  3MXI A;  4CJ5 A;  2XY8 A;  4YFU A;  5BRF A;  4JN4 A;  2UUC K;  4PL8 A;  2P9S A;  1J6Z A;  5AQL A;  3D2F B;  2GV9 A;  4EHT A;  1VQK N;  4I6M B;  4WFB L;  3UKU A;  3ZLJ A;  3THY A;  2D4W A;  3HZ6 A;  4OVL A;  3ENB A;  3J81 O;  4C23 A;  4B9N A;  2ASM A;  4GV9 A;  2P5O A;  4BDP A;  2P9P B;  3KLE A;  3TAR A;  4K43 A;  1KFS A;  4CF9 A;  4GKJ K;  3MDQ A;  3O1B A;  4FJL A;  1QQM A;  1RDA A;  3EN9 A;  4MLE A;  3SUO A;  1S1T A;  1WB9 A;  4B1Y B;  4CEZ A;  5AZJ B;  5M1F A;  3LDL A;  4JI2 K;  5M1K A;  1TKD A;  1J53 A;  4ZTJ A;  1SQK A;  4DV5 K;  3H6E A;  3PO4 A;  1RTD A;  3QBX A;  4M3Y A;  4E1N A;  3DOL A;  1J54 A;  4DR7 K;  1FW6 A;  4IXC A;  1UWB A;  3D0P A;  5BPN A;  3ZSZ A;  3CXC M;  4DSE A;  4N76 A;  3RSE B;  5FRN A;  4YDU C;  2HW3 A;  3SLC A;  3H08 A;  4ILJ A;  3ZYY X;  2FBV A;  2HB5 A;  2E88 A;  1ZYQ A;  3FLC O;  3U4L A;  4QS9 A;  4KH5 A;  3U9Z A;  4HUF A;  3NBP A;  3P83 D;  3CIP A;  4NCB A;  4DV7 K;  3HPH A;  4CJU A;  3OYC A;  3T1H K;  2QWR A;  1RT4 A;  2HHT A;  3NCI A;  3CCM N;  1HQU A;  4BC2 A;  4N47 A;  4MDB A;  3AVI A;  1EX4 A;  4KH6 A;  1S1W A;  4ELU A;  3ZT0 A;  3DLH A;  1TYQ A;  4Z4F A;  3OA9 A;  3NGZ A;  1YJ9 N;  4Z0U A;  1XWL A;  4M63 C;  1BI4 A;  4CJK A;  3L6Q A;  4FLV A;  1E4G T;  2A41 A;  2YJE A;  2D1K A;  4KHP K;  1KQS M;  4K8Z A;  4WYB A;  1N6Q A;  3A5O C;  1S1V A;  4DQQ A;  3QEP A;  3UE5 A;  2P9K B;  3SNN A;  2P9U B;  3AVJ A;  2NRZ A;  3KK1 A;  1VQO N;  2PZS A;  4JAX A;  4DV4 K;  3DXK A;  5EOY A;  4JLH A;  3IMX A;  2KW4 A;  3PX4 A;  3ZSR A;  4CIF A;  5EVZ A;  3V9X A;  3AVK A;  3LP0 A;  4DLE A;  2B6A A;  1NLV A;  5C10 A;  3NAE A;  1F21 A;  1ZBL A;  3AY9 A;  4LF9 K;  1B9F A;  1VSJ A;  1JL1 A;  4FO0 A;  1BCM A;  3P4I A;  4B1W B;  3SUP A;  4BRH A;  1Q18 A;  4JI4 K;  2G8U A;  4HUE A;  4M3W A;  4I2Q A;  1YHQ N;  4CBW A;  3RMB A;  1IJJ A;  3AO1 A;  3CM6 A;  2X74 A;  4RTF D;  2QWL A;  3SPZ A;  3G71 N;  4WQ5 A;  2V52 B;  3OS0 A;  2KHO A;  4EIA A;  3CD6 N;  4CFA A;  3K5M A;  3QNO A;  1NMD A;  4JI3 K;  2NZT A;  3JYT A;  5C24 A;  4R5P A;  4FJM A;  1WSG A;  4PKH A;  4XH1 A;  3OYD A;  2RHK A;  2X6N A;  3SPY A;  4FZY A;  3FE1 A;  3SK3 A;  2A1S A;  4B9U A;  4LF5 K;  2KFN A;  4ISF A;  4CI6 A;  1QSS A;  4JI0 K;  3TI0 A;  4IFV A;  3VN5 A;  4AHU A;  4L8R B;  1FXX A;  4IZ9 A;  4BE0 A;  3DRS A;  2XRI A;  1GOC A;  4HUG A;  1A5W A;  3CFR A;  4B9T A;  2E8A A;  2YCH A;  1HNW K;  4NXN K;  4JKD A;  2UUA K;  3FR0 A;  3LP2 A;  1WSF A;  3GE1 A;  1KVA A;  2RE2 A;  1O1W A;  1WSJ A;  4BC3 A;  1WAF A;  5LMN K;  1JLA A;  3IRX A;  1VSF A;  1S1X A;  4BR2 A;  3UIQ A;  4DCH A;  2QA4 N;  1WSI A;  1NGC A;  5GAH P;  4E89 A;  4O44 A;  2HND A;  3ZX3 A;  1S72 N;  4L3Q A;  2Q36 A;  1YT3 A;  4CJV A;  1JCF A;  4OPJ A;  4KHQ A;  4JV5 K;  2A6A A;  4A2A A;  1IG8 A;  1QVF M;  1RCH A;  1V4T A;  4J8F A;  5AJ3 K;  4AH9 A;  2O8F A;  4NYF A;  4JKH A;  3AVF A;  3AVG A;  3FFK B;  1ZBS A;  5HBM A;  3E01 A;  4CE9 A;  4DS4 A;  1XC9 A;  1T3V A;  3AAP A;  3WEE B;  3OVN A;  5AZI A;  1RTH A;  1QS4 A;  3PSF A;  4IDK A;  3D7E O;  3MX2 A;  1YAG A;  4JKC A;  4DQR A;  4ELT A;  2DFH A;  2E6M A;  4C8M A;  4Z4C A;  2GUI A;  4DG1 A;  2OTJ N;  5LMU K;  3GL1 A;  4CER A;  1QVG M;  4PQU A;  3KKR A;  3T1Y K;  4RWT A;  3CQ8 A;  4LF6 K;  5AQI A;  1U2V B;  2O8F B;  3DI6 A;  4FJN A;  3IDH A;  1NNE A;  2HOE A;  3ZET A;  3N4P A;  3F73 A;  2YNH A;  2ZGY A;  4CGG A;  1LW2 A;  5LJW A;  1VRT A;  5BN9 A;  3CCL N;  3KZB A;  2BE2 A;  4A57 A;  3J80 O;  1L3U A;  2D0A A;  2RF2 A;  3L2R A;  2HHH K;  3DWL A;  4CEF A;  3AVB A;  3K5O A;  3NH2 A;  1OH6 A;  3AAR A;  1KAX A;  4FM0 A;  3AVC A;  3MWP A;  3TAG A;  4IKF A;  3HM9 A;  4B8C A;  3DLK A;  1NG9 A;  4FJ9 A;  3OS2 A;  3NH0 A;  2NRX A;  1GLC G;  4H5R A;  3KVG A;  1J5E K;  3O5B A;  3LWM A;  3K0S A;  2VG6 A;  4E7J A;  5BRH A;  2BH1 A;  1FKP A;  1BI4 B;  2ZJR L;  4FW2 A;  3KD5 E;  4CEQ A;  3SAF A;  3K59 A;  1YJN N;  4WF9 L;  3KLH A;  2WTU A;  3QIC A;  2O8C A;  4B1U B;  1ASV A;  3O9S A;  1OH7 A;  5SZT A;  3HO1 A;  4ICL A;  3LDO A;  3WXL A;  5I3U A;  1WN7 A;  3L3V A;  1KVC A;  3THW A;  1BWF O;  3C94 A;  3QEX A;  3QEV A;  1XHX A;  4CJR A;  2QK9 A;  1QHA A;  4X64 K;  2YHB A;  3QO9 A;  4G1Q A;  4A5A A;  3H1V X;  4W5O A;  4H8K A;  1TKT A;  4ZTF A;  5DMR A;  4E3S A;  2P9L B;  4KRE A;  4CJP A;  4KAZ A;  1KC8 O;  5C0Y A;  3HSC A;  5DM6 L;  3H3O B;  3DJC A;  3DM2 A;  2DY4 A;  4IJA A;  1N32 K;  3PY8 A;  1WNS A;  1BHL A;  1MWM A;  2A40 A;  3QIN A;  3WNE A;  4DV2 K;  3SI6 A;  4FVM A;  3EO3 A;  3HI0 A;  1RTI A;  4YOW A;  1Q9Y A;  2UXC K;  1UOC A;  3WXI A;  5CHI A;  4WQ4 C;  1JCG A;  3TTD A;  1ITG A;  3CCE N;  2VG5 A;  2EHG A;  4YOV A;  2HHU A;  4BWM A;  2DPN A;  3IKM A;  4FVU A;  1LCU A;  4BRF A;  4V19 S;  4FK0 A;  1VSD A;  3LM9 A;  5B8H A;  4JI5 K;  1I3A A;  2WUS A;  3CJB A;  3R9P A;  1RBS A;  4CJW A;  4DR4 K;  3SV4 A;  3CFO A;  1P8Z A;  3EE8 A;  1YTA A;  3I33 A;  3O4W A;  2XY5 A;  3EZ5 A;  1HJR A;  2Q3S A;  3P38 A;  3VQD A;  4LC9 B;  2P9S B;  2PYL A;  4DLG A;  4BR4 A;  3OYF A;  4KRF A;  3EE9 A;  4DQP A;  3KLI A;  3E1Y A;  2BGG A;  4H0X B;  4YHH K;  2OPR A;  3VET A;  3F9M A;  4I6M A;  3HXM A;  3L2V A;  3VQQ A;  4RCH A;  3QML A;  3ZSQ A;  3NF7 A;  1K8K A;  3K5L A;  4FM1 A;  1KXP A;  5CZ1 A;  3I0S A;  4K8X A;  1HUX A;  4DSI A;  1DT9 A;  2GEL A;  4C1N I;  3UKR A;  3OBY A;  4O55 A;  3E9P A;  5JLH A;  5M1N A;  2D0B A;  3THW B;  4CEA A;  1C0U A;  3ZX2 A;  2QTD A;  3NHG A;  3SAH A;  3NVM A;  1TVR A;  3AO2 A;  4FWO A;  4BR5 A;  5AQX A;  4EZ6 A;  3S3O A;  5C25 A;  4NXM K;  4FLU A;  5HOO A;  4CHN A;  1LWE A;  4FOI A;  3R6M A;  3I8D A;  4DF4 A;  2HF3 A;  4NO7 A;  5T7B A;  4CZG A;  2V51 B;  4DHY A;  4IJN A;  2A3Z A;  5J2N A;  3THY B;  4OJR A;  2ZJP L;  1YF5 L;  1HPM A;  4CIE A;  3VGL A;  4H0Y B;  3OYG A;  1VQ7 N;  1NK4 A;  5C2F A;  3VEN A;  1VQ6 N;  3MK6 A;  3G25 A;  1RT6 A;  4YOX A;  3FZH A;  3P39 A;  1ZBH A;  1IH7 A;  4CFB A;  4DUZ K;  3V9Z A;  4B3R K;  4BGB A;  3CQX A;  2NRV A;  3CJ7 A;  5JVG L;  1C0G A;  3JSM A;  4AM6 A;  2KZM A;  1WUA A;  3RTV A;  4FM2 A;  2QM1 A;  5KRT A;  4FJI A;  3VEZ A;  3P1G A;  1EP4 A;  3OY9 A;  4LD0 A;  2YI1 A;  2W41 A;  2P9I B;  4FLX A;  3KK3 A;  1KLM A;  1RNH A;  2Q0U A;  1NKB A;  3VQC A;  3U6F A;  1D4X A;  1U45 A;  4IOC L;  2NRT A;  3O08 A;  3KK7 A;  4WFN L;  2HNY A;  2VG7 A;  1RT2 A;  4Z94 A;  2YNI A;  3VF2 A;  5JS1 A;  4DR3 K;  1JXB A;  1U47 A;  4K25 A;  4KV8 A;  1T8E A;  4DU3 A;  3FFI A;  1I94 K;  4GW6 A;  4CGF A;  4LFC K;  3TSU A;  4B9L A;  1YVN A;  3CCR N;  1M1K O;  3V1Q A;  3C6T A;  2I5J A;  5AQY A;  4LH5 A;  2OA8 A;  1W0H A;  1T44 A;  3AA5 X;  5AQM A;  4GKK K;  3S3N A;  1HX1 A;  3VQ7 A;  3DLG A;  4AHT A;  3NGI A;  3EL2 A;  2P9U A;  5TKY A;  3PSI A;  3FZK A;  4GVM A;  5CYQ A;  2VGN A;  4ISG A;  3O9Q A;  3SUN A;  4BRE A;  5AQK A;  2AA4 A;  1SV5 A;  4ISE A;  3U9D A;  1DTQ A;  4H5V A;  2IS3 A;  1KSP A;  3ASM A;  1IKV A;  5JS2 A;  3D6R A;  1VQL N;  4DSF A;  2WON A;  4NCG A;  3V1O A;  3HM8 A;  3LAK A;  1TGO A;  3LAN A;  3PO5 A;  1P90 A;  4FSV A;  4AHV A;  2YX6 A;  2VWB A;  4YY3 K;  3UKR B;  4GY2 B;  4DTM A;  5BRE A;  2QXL A;  5F1X A;  2QKK A;  4E7K A;  3MMV A;  1JL2 A;  4OKJ A;  1HLU A;  3BY5 A;  5GIN A;  1BIS A;  3QB0 A;  3RR8 A;  3S3M A;  4WCE L;  3KWI A;  3TTC A;  1CZ9 A;  4DTS A;  4H0P A;  3SAG A;  1LOT B;  3CG7 A;  4CEO A;  3THX A;  1NGD A;  4O8K A;  1KFD A;  1RFQ A;  4JYA K;  1KVB A;  4PWD A;  4DQS A;  4FJG A;  1G99 A;  2QXF A;  3CET A;  5KGX A;  3PX6 A;  5HP1 A;  4LSL A;  1U6Z A;  2Z1I A;  1RDU A;  5AQN A;  3VQP A;  1C0M A;  3RVC A;  4I7F A;  2BTF A;  4BR7 A;  3M8R A;  1X9S A;  2G8I A;  1XNR K;  3CJ1 A;  1K73 O;  4CJ3 A;  3AO5 A;  2UYT A;  2YHX A;  4CEC A;  4R79 A;  1FKO A;  2PAV A;  3OYJ A;  1RDD A;  4CGH A;  4DKW A;  2CGK A;  1SUQ A;  1CZA N;  5GIO A;  3ZEU A;  1KAZ A;  4M42 A;  2RPI A;  3ULE B;  1I39 A;  3KIO A;  4Z4H A;  1VHX A;  1KTQ A;  3FZM A;  5EY4 A;  5JMV A;  1UA1 A;  3IG1 A;  1D9D A;  4BRC A;  4E0D A;  3MEG A;  4JKA A;  2ZQB A;  3J7Y P;  1BQM A;  4FK2 A;  4OGE A;  1O13 A;  3L4I A;  3RMA A;  4BRG A;  4MO5 A;  3U8X A;  2G8W A;  3C7N B;  5AQJ A;  4ELV A;  1RBT A;  3D45 A;  2VQF K;  3K9K A;  2KFZ A;  1W2B M;  3SJJ A;  2CH5 A;  4E19 A;  3RRH A;  2P9L A;  4N5S A;  4O5B A;  4H5T A;  3DLB A;  3C65 A;  3OJS A;  2ASO A;  2QI2 A;  3BF1 A;  3AVL A;  2AJQ A;  4F8R A;  3QFP A;  3OYM A;  3TTF A;  3MAQ A;  3SMS A;  2ZGZ A;  3VTI A;  1HKC A;  1E3M A;  1NMN A;  3D2E A;  3QEW A;  3HJF A;  4CHQ A;  1RTJ A;  3T19 A;  2QW9 A;  3ZSX A;  2FBX A;  4M3T A;  4WQ4 A;  1XI1 A;  4JKE A;  4CJF A;  4OX9 K;  4B08 A;  1IBK K;  4DB3 A;  3NE6 A;  3WNF A;  1ZC6 A;  1VQ8 N;  2BDP A;  2QWO A;  5LL6 Z;  4QS8 A;  1Z6R A;  4E1J A;  4HWI A;  3SYZ A;  4C8N A;  1VQ5 N;  1WSE A;  1BDG A;  4GV6 A;  5AQS A;  2KZZ A;  3L4Q A;  2Q97 A;  4JI7 K;  4KFB A;  4ID5 A;  2X6S A;  4YOY A;  5J1E A;  3WXK A;  5AQO A;  4CK2 A;  1HRH A;  4LH4 A;  1HJO A;  2IAJ A;  2WFB A;  3NGY A;  2GWK A;  3IUC A;  4DR2 K;  3AGR A;  3S41 A;  3QLH A;  1BG3 A;  1ATR A;  4NLB A;  1L3V A;  4BRI A;  1SKS A;  3TU5 A;  1NGB A;  2F8S A;  5FPD A;  1YIJ N;  2OPP A;  3EKU A;  4DR1 K;  2W40 A;  4Z4E A;  4IBN A;  1GLL O;  1OVQ A;  1HKG A;  3C6A A;  4PL7 A;  2E5L K;  1NM1 A;  3CCU N;  3G6E N;  4W5T A;  1WLJ A;  4FWP A;  4AF1 A;  2Z1H A;  5JLF A;  1D8Y A;  1TL1 A;  1QE1 A;  5TKW A;  1HNI A;  4DFM A;  2Z1J A;  1BIZ A;  4CHY A;  3EYZ A;  4Z4G A;  4JD2 A;  2CGL A;  1RBR A;  4RW6 A;  3VQ8 A;  4DTP A;  2E2P A;  3KWG A;  2IC3 A;  1T03 A;  3V9W A;  1H1V A;  4KHN A;  2I7P A;  3WXM B;  2JGU A;  5A2Q O;  2F4V K;  1QSL A;  2Y1J A;  1JLG A;  4CJL A;  3VF4 A;  1IO2 A;  2NRH A;  5FPE A;  2P1J A;  2A42 A;  4K42 A;  4RW4 A;  4GV3 A;  4CZL A;  4FLT A;  5BR9 A;  2GUP A;  2E1Y A;  4AHS A;  3VQB A;  3WNG A;  4PUO A;  3O8M A;  4BRA A;  4IO8 A;  3H1Q A;  3M6G A;  2V7Y A;  1S6Q A;  4HTU A;  1NGE A;  3WUH A;  5F0X A;  4XEI A;  1S6P A;  3CC7 N;  4FJ5 A;  4CF8 A;  4YOU A;  3DXK B;  2HBJ A;  4B9M A;  4DFP A;  1JLB A;  3TAB A;  3HOT A;  2HHS A;  4DU4 A;  2DTU A;  1X1P A;  4OO1 J;  2IIR A;  1QSY A;  5HL7 L;  1ZBI A;  4EZ9 A;  3HRG A;  5HRP A;  4DWI A;  1VSH A;  2GWJ A;  3GBT A;  2YKM A;  4BG9 A;  4H5N A;  1TV6 A;  2DFE A;  4CED A;  4CBX A;  3HBT A;  2CH6 A;  1C1A A;  1NWK A;  1N8R O;  4KHU A;  1TYQ B;  2FBY A;  3A8Y A;  3BGR A;  4AQY K;  3QNN A;  4FWN A;  3M8S A;  3HOS A;  4DSJ A;  4NB4 A;  3L2W A;  1QQC A;  3ENO A;  4O8U A;  4M3Z A;  4M7Y A;  3VPZ A;  3B6O A;  2YHY A;  4HTL A;  2HBK A;  1RBU A;  4FLW A;  1ATS A;  2W6K A;  5AR0 A;  4DF8 A;  2F9W A;  1C1C A;  4E7L A;  2O8B A;  1MA9 B;  4IG0 A;  1LWC A;  2FSK A;  4FK4 A;  4BVO A;  2HHV A;  3MWT A;  5AQV A;  4QCL A;  1W7A A;  4X65 K;  1A5X A;  3AGK A;  1ZBU A;  5BPL A;  3H3N O;  1RDB A;  4DTN A;  3SCX A;  2GEM A;  5E41 A;  4Y1C A;  3CJC A;  2W42 A;  1Q8I A;  3LZI A;  5J2Q A;  1NGJ A;  2OPQ A;  3FZF A;  3RWU A;  2O4I A;  5LY3 A;  4I9Q A;  4B9S A;  3NVK A;  1UA0 A;  1KCF A;  4W5Q A;  1Q9X A;  3R1X A;  4CZJ A;  4KKO A;  3CM5 A;  4U67 L;  2VQE K;  4QOZ B;  3QES A;  3I8B A;  1QZ5 A;  3R8E A;  1IKX A;  1NJI O;  4CIG A;  1GOB A;  2IGI A;  5CR4 A;  3SUQ A;  4CK1 A;  4CGJ A;  2O4G A;  5AFU H;  3UKU B;  1FK9 A;  3ZT1 A;  3ZT4 A;  3E9L A;  4FJK A;  4HHT A;  1T7P A;  1HYZ A;  4KO0 A;  4CEB A;  1WSH A;  4BAC A;  5AQR A;  1NGI A;  1VQM N;  3OYI A;  5D3G A;  1Y97 A;  4B3S K;  2ZM6 K;  2A5X A;  4BVP A;  1RT3 A;  3PIO L;  1GLD G;  4KTZ A;  5AQP A;  3AA2 A;  4CJ4 A;  3LZJ A;  4JRQ A;  2VWJ A;  4ILH A;  4B9Q A;  4IOA L;  1NGG A;  1CLQ A;  3C0B A;  4OLB A;  2HNZ A;  3HT3 A;  1YIT N;  5M1P A;  3V81 A;  1K8A O;  1CXU A;  3VGK A;  3BDP A;  5AQH A;  3M8Q A;  3I55 N;  1BGX T;  4BRP A;  4JD2 B;  2ATQ A;  4Q0B A;  5BN8 A;  3QFU A;  5AQQ A;  5JIC A;  3V4I A;  4M3X A;  4DV6 K;  3QIP A;  1NKC A;  1HPZ A;  5I9E B;  2O8C B;  1S22 A;  1T6D A;  3MCA B;  1OH5 A;  1CZB A;  3TPQ A;  2G8K A;  2DFF A;  1NJZ A;  2P51 A;  1Z25 A;  1D9F A;  4ID1 A;  1YI2 N;  3AA4 A;  5KTQ A;  4DFJ A;  3OS1 A;  4EP5 A;  5JVH L;  4KI6 A;  3SV3 A;  1Q82 O;  1NGH A;  1U4B A;  2E2N A;  4CVN E;  2HHX A;  2ZWH A;  1QQO A;  4FWL A;  4OPH A;  4E1M A;  3OYK A;  3CMA N;  4FOE A;  5HRS A;  3ENH A;  2J4R A;  4C8K A;  1SAZ A; 
#chains in the Genus database with same CATH homology
 1L3S A;  4RG8 A;  3AVH A;  3LP0 A;  4DLE A;  4FXD A;  2B6A A;  1TGO A;  3LAN A;  4W5R A;  4AHV A;  4CF1 A;  3NAE A;  1F21 A;  3RMC A;  1ZBL A;  3PO5 A;  1B9F A;  1S1U A;  1VSJ A;  4F2S A;  1JL1 A;  4M3R A;  1BCM A;  1JKH A;  3TWH A;  3SUP A;  4DTM A;  1BQN A;  2G8U A;  4HUE A;  3V9S A;  4M3W A;  4LSN A;  2QKK A;  4I2Q A;  4E7K A;  1JL2 A;  3RMB A;  3AO1 A;  4OKJ A;  3CM6 A;  4HCC A;  1UAX A;  2HMI A;  2X74 A;  1BIS A;  2IDO A;  3SPZ A;  1SKW A;  3DMJ A;  3S3M A;  2LSN A;  3RR8 A;  3OS0 A;  1CZ9 A;  4DTS A;  4NYN A;  3TAM A;  3KTQ A;  1JLE A;  4CFA A;  3K5M A;  3QNO A;  3CG7 A;  4CEO A;  1J5O A;  3TAQ A;  1KFD A;  1HNV A;  1U49 A;  3M8P A;  3JYT A;  5C24 A;  4R5P A;  4FJM A;  1KVB A;  4PWD A;  4DQS A;  4FJG A;  1WSG A;  3OYD A;  2QXF A;  4HVJ A;  4BDY A;  2X6N A;  3SPY A;  5KGX A;  4DTR A;  3U3G A;  3PX6 A;  4FZY A;  2E4L A;  5HP1 A;  1N5Y A;  2A1S A;  4B9U A;  4FZZ A;  2KFN A;  4LSL A;  1QSS A;  3TI0 A;  4IFV A;  5KGW A;  3VN5 A;  4AHU A;  1TK8 A;  4FJJ A;  3AVN A;  2Z1I A;  4H4M A;  1FXX A;  4BE0 A;  4RW7 A;  4L8R B;  1TAU A;  4Q5V A;  3VQP A;  3AV9 A;  1C0M A;  4I7F A;  4B8A B;  3M8R A;  1X9S A;  3DRS A;  2XRI A;  1X9M A;  2G8I A;  1GOC A;  4HUG A;  1A5W A;  3CFR A;  4CJ3 A;  1LV5 A;  3AO5 A;  4B9T A;  3NFA A;  3SQ2 A;  3OYL A;  1B92 A;  2XHB A;  4FJX A;  4PY5 A;  1K6Y A;  3LP2 A;  1KVA A;  1MU2 A;  1RT7 A;  1WSF A;  1O1W A;  1WSJ A;  5CYM A;  4CEC A;  3C95 A;  1FKO A;  3DOK A;  1WAF A;  1JLA A;  3IRX A;  3VQ5 A;  3OYJ A;  1RDD A;  3KLG A;  5J2M A;  3HPO A;  1VSF A;  3SQ1 A;  1S1X A;  4CGH A;  3UIQ A;  4GMJ B;  2G8F A;  1SUQ A;  1LW0 A;  1HQE A;  1WSI A;  4CHZ A;  3PUF A;  1VK0 A;  4E89 A;  2G8K A;  4J2D A;  4M42 A;  2RPI A;  4BDZ A;  1I39 A;  3KIO A;  3MEC A;  4Z4H A;  4O44 A;  1KTQ A;  2HND A;  3NDK A;  4KHY A;  1UA1 A;  3IG1 A;  1D9D A;  3K57 A;  2KQ2 A;  4OLA A;  1GOA A;  1YT3 A;  3DYA A;  3HVT A;  4CJV A;  3LPU A;  3MEG A;  3OYB A;  2ZQB A;  4E0D A;  1BQM A;  4OPJ A;  4FK2 A;  4OGE A;  4KHQ A;  3TAF A;  3RMA A;  5DK5 A;  2KTQ A;  2OYQ A;  1RCH A;  2G8W A;  2FBT A;  4AH9 A;  4NYF A;  1LAV A;  3KKS A;  4ELV A;  4J2A A;  3ZCM A;  3AVF A;  1RBT A;  3AVG A;  3D45 A;  5HBM A;  4DS5 A;  3E01 A;  2KFZ A;  4CE9 A;  3C6U A;  3AVM A;  3KJV A;  3SJJ A;  1TAQ A;  3OYA A;  4DS4 A;  3ZSW A;  1XC9 A;  4KB0 A;  2YNF A;  3OVN A;  4E19 A;  3T3F A;  2HHW A;  3VQE A;  1J9A A;  1RDC A;  1RTH A;  3HYF A;  5FRO A;  1QS4 A;  4IDK A;  4N5S A;  4O5B A;  4DTU A;  3A2F A;  3DLB A;  2FC0 A;  4DQR A;  3OJS A;  3NH1 A;  4ELT A;  3HL8 A;  2DFH A;  2E6M A;  3KLF A;  3AVL A;  3AVA A;  2AJQ A;  4C8M A;  4OGC A;  4Z4C A;  2GUI A;  3EY1 A;  1XHZ A;  4DG1 A;  2Y1I A;  3OYM A;  4B9V A;  1ASU A;  2OZS A;  3CFP A;  1SKR A;  1Z26 A;  4CER A;  4PQU A;  3KKR A;  3MAQ A;  3O4N A;  3ZSO A;  3CQ8 A;  1CXQ A;  3HP9 A;  4YNQ A;  1JLC A;  3DI6 A;  4FJN A;  3QEW A;  1KLN A;  2G8V A;  1SL0 A;  3HJF A;  3F73 A;  3OJU A;  4CHQ A;  5HRN A;  2YNH A;  1RTJ A;  1NJY A;  1BL3 A;  3T19 A;  1L3T A;  3ZSX A;  4LY7 A;  4CGG A;  1LW2 A;  2FBX A;  3S9H A;  1VRT A;  1C1B A;  4M3T A;  1XI1 A;  3NF9 A;  4CJF A;  4F8R A;  2Z1G A;  4B08 A;  3PV8 A;  1W9H A;  2F96 A;  2BE2 A;  3K2P A;  3QEI A;  1L3U A;  2D0A A;  2RF2 A;  3WNF A;  3AO4 A;  2ZD1 A;  3L2R A;  3NE6 A;  4H4O A;  3O3H A;  4FZX C;  2YHA A;  4CJQ A;  4CEF A;  3NH2 A;  3AVB A;  3K5O A;  2BDP A;  4HCB A;  4KHW A;  1HMV A;  1RIL A;  3KK2 A;  4B3O A;  4FM0 A;  3AVC A;  4FW1 A;  3TAG A;  1TKX A;  3HM9 A;  4C8N A;  3HPG A;  3SYZ A;  4IKF A;  4B8C A;  1VSI A;  3DLK A;  3O3G A;  2WOM A;  3OS2 A;  1WSE A;  3K5N A;  2D0C A;  4FJ9 A;  2KZZ A;  3V9U A;  3RR7 A;  1NK0 A;  4KB1 A;  4DTX A;  4IG3 A;  1HYS A;  3DLE A;  1C6V A;  4FLZ A;  3NH0 A;  3VA0 A;  4KFB A;  1QTM A;  3VQ6 A;  4ID5 A;  2X6S A;  3L2Q A;  5J1E A;  4CF2 A;  4CK2 A;  1HRH A;  3LWM A;  2VG6 A;  4LH4 A;  4E7J A;  2IAJ A;  3V1R A;  1FKP A;  1BI4 B;  2XY6 A;  3NGY A;  4FW2 A;  3TR8 A;  1S5J A;  3KD5 E;  3K58 A;  4CEQ A;  3K59 A;  1S9G A;  1TK5 A;  3KLH A;  3QLH A;  2XO7 A;  4QAG A;  3KD1 E;  1ASV A;  3NF8 A;  3ISN C;  1L3V A;  1SKS A;  2F8S A;  5SZT A;  2EX3 A;  3HO1 A;  1DLO A;  1REV A;  2OPP A;  3TAE A;  4ICL A;  4BE1 A;  3ITH A;  4DTO A;  1QHT A;  1WN7 A;  5I3U A;  5C42 A;  1RBV A;  4FJ8 A;  3L3V A;  1KVC A;  4CJE A;  4OKE A;  4Z4E A;  4IBN A;  2IOC A;  3C94 A;  5KRS A;  3QEX A;  1NK6 A;  4E7H A;  4F3T A;  4PA1 A;  1XHX A;  4CJR A;  3QEV A;  3IAY A;  4CK3 A;  5HRO A;  3O4Q A;  2QK9 A;  1EXQ A;  4M45 A;  1WAJ A;  4W5T A;  2YHB A;  3QO9 A;  4G1Q A;  1WLJ A;  3ZT2 A;  3SQ4 A;  4MFB A;  3LAM A;  2Z1H A;  4W5O A;  4H8K A;  1TKT A;  4ZTF A;  1NJW A;  1D8Y A;  1TL1 A;  1QE1 A;  4WE1 A;  3AA3 A;  5DMR A;  4DTJ A;  1HNI A;  4E3S A;  2QKB A;  5CZ2 A;  4KRE A;  4DFM A;  4CJP A;  4KAZ A;  1LAW A;  3MXJ A;  2A1R A;  4N41 A;  4Z4I A;  1HYV A;  2Z1J A;  1BIZ A;  2ITG A;  3B6P A;  4JRP A;  1L5U A;  4CHY A;  3EYZ A;  1NOY A;  4MQ3 A;  4Z4G A;  2DY4 A;  3DM2 A;  5FRM A;  1NOZ A;  4CFC A;  3O3F A;  1NKE A;  4I9L A;  1RBR A;  1NK9 A;  4RW6 A;  3VQ8 A;  2E6L A;  1WNS A;  2PY5 A;  3PY8 A;  1BHL A;  3QIN A;  4CJS A;  4DTP A;  4DSL A;  3WNE A;  1IKW A;  4DFK A;  2IC3 A;  3SI6 A;  1T03 A;  3V9W A;  4KHN A;  4FVM A;  1JLQ A;  1RTI A;  1JLF A;  2JGU A;  3QER A;  1QSL A;  2Y1J A;  1Q9Y A;  2R7Y A;  1UOC A;  1R0A A;  3LP1 A;  1JLG A;  3LP3 A;  4C8K A;  1ITG A;  4CJL A;  4F4K A;  3LDS A;  2VG5 A;  2EHG A;  2HHU A;  1IO2 A;  4FLY A;  4BWM A;  3L8B A;  1VRU A;  3HK2 A;  2B4J A;  1NJX A;  2P1J A;  4FK0 A;  1VSD A;  4KTQ A;  4RW4 A;  4FLT A;  1I3A A;  4AHS A;  3DRR A;  3VQB A;  3WNG A;  4PUO A;  4J2B A;  3MEE A;  1S6Q A;  1RBS A;  3THV A;  4HTU A;  4CJW A;  3LAL A;  2P5G A;  3SV4 A;  1SL2 A;  3DLR A;  1S6P A;  5J2P A;  3CFO A;  2G8H A;  4FJ5 A;  3VQ4 A;  4CF8 A;  3RRH A;  1YTA A;  2XY5 A;  3HVR A;  3ALY A;  3EZ5 A;  1HJR A;  4W5N A;  2Q3S A;  4B9M A;  5SWM A;  5KI6 A;  1JLB A;  3VQD A;  4DFP A;  3TAB A;  2YV0 X;  2D5R A;  4DLG A;  2PYL A;  3OYF A;  1U04 A;  4DU4 A;  4DQP A;  3KLI A;  1YTU A;  1X1P A;  4O0I A;  4J2E A;  2BGG A;  2DTU A;  2OPR A;  1YVU A;  4UQG A;  2HVH A;  1QSY A;  5K14 A;  1D5A A;  1ZBI A;  4EZ9 A;  4M3U A;  4O4G A;  5HRP A;  3HXM A;  4DWI A;  4FCY A;  1VSH A;  2YKM A;  4CGD A;  3L2V A;  1TV6 A;  3VQQ A;  4DQI A;  2JLE A;  2F8T A;  2DFE A;  1EKE A;  3VA3 A;  4CED A;  1C1A A;  3ZSQ A;  4FJ7 A;  3NF7 A;  5FDL A;  3SQ0 A;  4E7I A;  4RW9 A;  4KHU A;  3I0R A;  3K5L A;  1KRP A;  4Y1D A;  4FM1 A;  2FBY A;  3BGR A;  3I0S A;  5CZ1 A;  3LWL A;  3QNN A;  5CY4 A;  4K8X A;  4DSI A;  2OPS A;  3M8S A;  4CJT A;  3QET A;  2RN2 A;  4DSJ A;  2ZE2 A;  3L2W A;  2HHQ A;  1B9D A;  1QQC A;  1C0T A;  1VSL A;  3G10 A;  4O55 A;  4M3Z A;  2B5J A;  1G15 A;  2D0B A;  4CEA A;  1C0U A;  4DU1 A;  3U3Y A;  4KHS A;  4FJH A;  3L2U A;  1ASW A;  4F2R A;  4ZHR A;  3V6D A;  3B6O A;  4I2P A;  3NHG A;  3AO3 A;  2YKN A;  4N56 A;  1SL1 A;  1RBU A;  4FLW A;  3ZT3 A;  1TVR A;  3AO2 A;  3NF6 A;  4DF8 A;  3RMD A;  4CHO A;  1C1C A;  3G0Z A;  1NK7 A;  4RW8 A;  4EZ6 A;  4E7L A;  5C25 A;  3S3O A;  3QIO A;  4IG0 A;  4FLU A;  4BE2 A;  1LWC A;  4CHN A;  4FK4 A;  1LWE A;  2HHV A;  2PYJ A;  3MXI A;  1JXE A;  4CJ5 A;  3I8D A;  4CCH A;  4DF4 A;  5T7B A;  4QCL A;  4JS4 A;  1A5X A;  1RT5 A;  1ZBU A;  5J2N A;  2XY8 A;  2YNG A;  4YFU A;  4OJR A;  2HVI A;  1BCO A;  4JS5 A;  3OYN A;  1NK8 A;  1VSK A;  2OZM A;  4CIE A;  1RDB A;  3DRP A;  4DTN A;  3SCX A;  4DMN A;  2GV9 A;  5E41 A;  4Y1C A;  2RKI A;  1IG9 A;  2W42 A;  1TK0 A;  4C8O A;  1Q8I A;  3MED A;  5EU7 A;  3LZI A;  5J2Q A;  2OPQ A;  3OYG A;  3RWU A;  2O4I A;  4NCA A;  4I9Q A;  4B9S A;  1NK4 A;  4OVL A;  4B9N A;  4AHR A;  1S9E A;  1UA0 A;  1KCF A;  1RT6 A;  4W5Q A;  4CGI A;  2P5O A;  1Q9X A;  4BDP A;  1ZBH A;  3KLE A;  3TAR A;  1KFS A;  4CF9 A;  4KKO A;  1BIU A;  3CM5 A;  1IH7 A;  4CFB A;  1TL3 A;  4KRF A;  4CHP A;  3V9Z A;  4C8L A;  4FJL A;  4QOZ B;  1RDA A;  3QES A;  1A5V A;  3CYM A;  3SUO A;  1S1T A;  2ETJ A;  4CEZ A;  3VQA A;  3SZ2 A;  1IKX A;  2NUB A;  3JSM A;  4CIG A;  2KZM A;  1GOB A;  2IGI A;  1TKD A;  4OPK A;  1J53 A;  3SUQ A;  1DTT A;  4ZTJ A;  3RTV A;  4CK1 A;  4CGJ A;  4FM2 A;  3VQ9 A;  2O4G A;  3F9K A;  3T1A A;  3HP6 A;  5KRT A;  1FK9 A;  4CIF A;  4FJI A;  3ZT1 A;  3PO4 A;  3ZT4 A;  3P1G A;  1EP4 A;  1RTD A;  3OY9 A;  4FJK A;  4M3Y A;  4LD0 A;  4HHT A;  3ULD A;  1NK5 A;  1T7P A;  3TAN A;  1HYZ A;  1EET A;  3DOL A;  1J54 A;  1WSH A;  4KO0 A;  4CEB A;  4CF0 A;  4BWJ A;  4E1N A;  4BAC A;  1UWB A;  3L3U A;  4FLX A;  3KK3 A;  2XY7 A;  3D0P A;  1KLM A;  3OYI A;  5I42 A;  3ZSZ A;  3TAP A;  1RNH A;  3LPT A;  5D3G A;  1Y97 A;  1NKB A;  3VQC A;  1U48 A;  4O0J A;  4DSE A;  3U6F A;  4N76 A;  1U45 A;  5FRN A;  1RT3 A;  1VSM A;  3WNH A;  2HW3 A;  4KTZ A;  3H08 A;  1X9W A;  2FBV A;  2HB5 A;  3AA2 A;  4CJ4 A;  3LZJ A;  4JRQ A;  1ZYQ A;  2VWJ A;  3ZSY A;  5HLF A;  2HNY A;  3P5J A;  1TKZ A;  2VG7 A;  1RT2 A;  2VWK A;  3NBP A;  3P83 D;  4HUF A;  1CLQ A;  4IFY A;  4OLB A;  2HNZ A;  3HT3 A;  4NCB A;  2YNI A;  3V81 A;  4AIL C;  1CXU A;  3HPH A;  4EP4 A;  4CJU A;  5JS1 A;  3OYC A;  3BDP A;  4DSK A;  1JXB A;  3M8Q A;  1U47 A;  2HHT A;  1RT4 A;  1BGX T;  3NCI A;  4KV8 A;  1HQU A;  4KPY A;  3RRG A;  2ATQ A;  4Q0B A;  1T8E A;  2X78 A;  4N47 A;  4DU3 A;  3FFI A;  3V4I A;  4GW6 A;  4CGF A;  1IKY A;  4M3X A;  3AVI A;  4B9L A;  1EX4 A;  1ZBF A;  4KI4 A;  1T05 A;  2HHS A;  3QIP A;  3ZSV A;  3V1Q A;  3C6T A;  2I5J A;  3MXM A;  4OKK A;  1S1W A;  1NKC A;  4FYD A;  4CES A;  1HPZ A;  4LH5 A;  3ZT0 A;  2OA8 A;  3DLH A;  4ELU A;  1W0H A;  4Z4F A;  3AA5 X;  3NGZ A;  1CZB A;  4Z0U A;  1XWL A;  3S3N A;  4AHC A;  3VQ7 A;  3DLG A;  4AHT A;  3NGI A;  2DFF A;  5HRR A;  1BI4 A;  1NJZ A;  2P51 A;  4CJK A;  4FLV A;  1Z25 A;  4TSX A;  2GBZ A;  4GVM A;  1VSE A;  1D9F A;  4K8Z A;  5CYQ A;  4ID1 A;  3AA4 A;  5KTQ A;  4DFJ A;  1LWF A;  3OS1 A;  4EP5 A;  4CEE A;  4KI6 A;  4M41 A;  3SUN A;  3SV3 A;  4XIU A;  3HST B;  1N6Q A;  3OYH A;  1SV5 A;  1U4B A;  1S1V A;  1DTQ A;  4DQQ A;  3QEP A;  3IS9 A;  2IS3 A;  1KSP A;  2BAN A;  2HHX A;  3ASM A;  4CFD A;  3SNN A;  3AVJ A;  1IKV A;  5JS2 A;  4E1M A;  3KK1 A;  4F3O A;  2PZS A;  3OYK A;  4DSF A;  4KTW A;  1RT1 A;  2WON A;  4NCG A;  4JLH A;  3V1O A;  5HRS A;  3PX0 A;  2KW4 A;  3PX4 A;  3OYE A;  3ZSR A;  3V9X A;  3LAK A;  3AVK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...