4JI8K

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
116
structure length
116
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
total genus 25
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4ji8K00
4DV4K 2UUBK 1N34K 4OX9K 4LF7K 4NXMK 4DV0K 4X64K 5BR8K 1XMQK 2UU9K 3J81O 4AQYK 4DV6K 1HNXK 4JV5K 4B3TK 4LF8K 1HNWK 2HHHK 4DR5K 4DR1K 4DR2K 4X65K 1HR0K 4JI4K 2VQFK 1XNQK 4KHPK 5LMNK 3OTOK 4JI2K 1IBMK 1N36K 4B3RK 2UUCK 4JI5K 4JI1K 3J7YP 4JI8K 4B3SK 4X62K 4YY3K 5LL6Z 4JI6K 5FLXO 5AJ3K 1FJGK 1N33K 4DV7K 3J80O 4K0KK 3J7AP 1I94K 4JI3K 2ZM6K 1XMOK 4DR3K 4LFBK 4DR7K 4DR4K 4B3MK 1IBLK 4DUYK 4JI7K 4YHHK 5A2QO 4LF4K 4NXNK 4JI0K 4DV5K 1HNZK 3T1YK 4DUZK 4DV1K 2F4VK 4GKJK 2VQEK 2UXBK 4CW7B 5LMUK 1N32K 4LFAK 4V19S 3T1HK 1IBKK 4LF9K 4CVNE 2UXDK 2UUAK 4DV2K 4JYAK 4LFCK 5IT9O 4GKKK 1XNRK 4DV3K 4LF5K 4DR6K 4X66K 5IWAK 1J5EK 2E5LK 4LF6K 2UXCK 3JAMO
chains in the Genus database with same CATH superfamily
3KK7A 3CJBA 4B8CA 1N34K 4BWMA 4NXMK 3MEGA 2B4JA 1LWCA 3CFOA 3H08A 4DV0K 4UY8O 5J2PA 3BF1A 3VMFB 3J81O 4AQYK 4I2PA 5CYQA 1YVNA 4U67L 4WFAL 1HQEA 4YOXA 4GVMA 4N41A 3OYLA 1DEJA 4O8UA 5LY3A 3VEYA 4W5RA 2W6LA 3O3FA 5HLFA 3OTOK 3VGKA 1BI4A 3V4IA 2EWSA 2P9KB 2J4RA 3C6UA 2BE2A 2LSNA 3ZSYA 4HUEA 1C0MA 3JXUA 2YKMA 3KKSA 1YTUA 3H45C 5DK5A 1YT3A 2PFUA 4W5QA 4CFCA 3JS6A 4JS5A 2XY8A 3FGUA 3HVRA 1SQKA 4E0DA 2E6LA 5BPNA 4Y1DA 2KZMA 3ENHA 4PQUA 3SPYA 4O8KA 5AQHA 3U3YA 3QEWA 2O4GA 1VQ7N 3P39A 3HT3A 3MAQA 3KZBA 4AILC 2VWBA 4CJ7A 3K57A 5KGXA 3NF8A 3L2RA 4NXNK 4DSIA 2VGMA 1HNZK 3IFRA 4CJ3A 4R5PA 1HX1A 3TR8A 3NH1A 3EZ5A 3QFPA 3FFIA 3SUQA 4DB3A 4OGEA 4LFAK 4BR9A 4DTXA 5BRHA 4KHNA 2XY6A 3N4QA 3HOTA 3NH0A 1XWLA 1E3MA 4JYAK 4N56A 1QSSA 2HBKA 2OANA 2YHBA 3D2EA 2E88A 2A3ZA 1W7AA 1SKWA 3ZLJA 4JKFA 3SNNA 3VGMA 4IKFA 3OYAA 3PSFA 1J5EK 1B92A 3JAMO 5LJVA 5LJWA 2NRRA 4WYBA 4N47A 1OH6A 4LF7K 2H3GX 2JLEA 3VGLA 4HTLA 4CZJA 5KRTA 1UA0A 2HHQA 3NVKA 1YVUA 2WC9A 2KTQA 2VWKA 2B6AA 3UIQA 5M1KA 5AQMA 2BUPA 3TI0A 1QVGM 1VQPN 4CK2A 3TANA 4BC5A 3KLHA 3OS2A 4B1XB 2KZZA 1QQOA 4WQ4C 1HPMA 2A5XA 3F9KA 1LAVA 2KW4A 1HNIA 3VENA 2ATQA 4B1ZA 1GOBA 4E7KA 1SUQA 4BRAA 3VQCA 4CFBA 3HZ6A 1HLUA 3VEVA 2ETJA 2P9UA 1S72N 1YIJN 4CZKA 1FXXA 3C6HA 5EY4A 3O6WA 3VETA 3OYEA 3OYJA 2P9PA 2D0CA 2PY5A 1WSJA 4KHWA 3U9DA 5F2RA 4M3RA 1MA9B 1NGBA 3ALYA 3NFAA 4CECA 4Z4GA 4JNEA 3OS1A 4MLEA 3UKRA 3O80A 3VA0A 5AQPA 3DLRA 3S3MA 4YFUA 2YHYA 3OYBA 3DRPA 1OVYA 2A42A 4DCHA 4BRNA 1UOCA 4BVPA 4JRPA 4YNQA 4C1NK 2D0BA 5E84A 3O9QA 4JHDA 3CJ7A 2UXBK 4I6MA 3K59A 5AQGA 4O5FA 1VQ4N 3AVFA 4IFVA 3MMVA 2A1SA 3SQ4A 1U49A 3NVMA 3EE9A 4BRMA 4KTZA 1EWQA 3THYA 1U48A 3OBYA 3O4WA 2YJEA 4JRQA 1VSMA 4H4OA 4NLBA 3SJHA 3OBWA 3V1QA 5CZ1A 3MXIA 1WLJA 4IOXA 5FPDA 3LP3A 5FPMA 3VF2A 4FM0A 4JKBA 4BRFA 4JK9A 4WQ5A 3C7NB 2HSTA 4CGFA 4CK3A 1C1CA 4CJEA 3B6PA 1VSDA 3SYZA 3THXB 4IEIA 3TAMA 4X64K 3V9XA 1XMQK 2UU9K 3HSCA 3ZSQA 3NGIA 4DFKA 3HPOA 4AHSA 4H0OA 2YHXA 3M8PA 4JV5K 3TU5A 3ULDA 1YJWN 4N76A 1VSJA 5F0XA 1U04A 3V81A 1VQKN 3WXMB 2HHHK 3H1QA 3ZT1A 4IFYA 1UWBA 1KXPA 2VQFK 5DM7L 1EQYA 3SLCA 5JS2A 4CHNA 3OYIA 4JI2K 1ZBUA 1BU6O 4IJNA 3DLLL 1E4FT 1NKEA 2FF3B 4YOTA 4JI8K 1Z25A 3E66A 1OH7A 4BR4A 1SKSA 2HHTA 3K5LA 3KK1A 2OYQA 1NKBA 1FKOA 3J7AP 4E7JA 2HHSA 1D5AA 3AA5X 3LDSA 1Z05A 4BQLA 2P9LB 4JEPA 4ISEA 1IKVA 3PIOL 4QOZB 1ZBSA 4W5NA 1CXQA 1VHXA 4IDHA 3KLIA 2Q3SA 1ATNA 1SZ2A 4KHYA 1C0TA 4CJKA 3LDOA 1XHZA 4IG0A 1OH8A 2OTJN 3O3GA 2P51A 3VEXA 5EU7A 2ZD1A 4CFAA 1T6CA 3LDNA 3LM2A 4BG8A 4J2AA 1Q82O 1J54A 2QW9A 3AAPA 3M8RA 1TAUA 1TYQB 3ATUA 3OHRA 1IBKK 4PY5A 2OPPA 1T8EA 3VEZA 4CJSA 2DFHA 4CJRA 4CZFA 3ASMA 3L4IA 4DLEA 2NRZA 3SV4A 3ZT4A 4XEIA 4BE1A 3W0LA 4H5WA 1QZ5A 2CGLA 1U45A 4DSKA 4DV3K 4FJGA 2O8DA 2GTDA 2FBVA 1W2BM 1CZBA 4FJIA 3WXKA 3ATVA 4PHTX 3B8AX 1Q7YO 4CIGA 1SL2A 1N5YA 4JLHA 5BN8A 5JLHA 4CIEA 5E41A 4FM1A 4OX9K 1J6ZA 2CGJA 1BIZA 2Q2RA 4M63C 3DOLA 4ZTJA 4H03B 4KV8A 3H1VX 4I7FA 1HPZA 2CH5A 4LF8K 1K8KA 1HNWK 5AFUH 3LALA 2O8CB 3NBPA 4AHVA 4OLAA 2QKKA 4BRLA 1KQSM 4DQIA 3WXIA 3QERA 1ITGA 3V1RA 3VQ5A 4E1NA 2Y1IA 1NGDA 3ZX2A 4KAZA 4YY3K 5DM6L 2FSKA 4E7IA 5MLCQ 4H5RA 3VA3A 3HL8A 3IKMA 1CXUA 1FJGK 3VF6A 4HVJA 5SZTA 1J5OA 4I6MB 4JKEA 1DT9A 3AO3A 1TK0A 2IS3A 4MFBA 4JS4A 3IRXA 4M3TA 4N5SA 3CJ1A 5EXWA 4HCBA 4EZ9A 4M3WA 5EOYA 3BZCA 4JI7K 1ZBLA 1DTTA 2YNIA 2ASMA 4FK2A 4Z4CA 4BROA 2G8WA 2O4IA 2G8HA 2CH6A 2E2QA 2NRVA 2F4VK 5CE3A 3K5OA 4FLVA 1JCEA 5KTQA 4RWTA 1N32K 4O44A 4H5VA 1T05A 5AQOA 1RDBA 4KBOA 1KVBA 4FW1A 1DLOA 1RDUA 4Q5VA 3D7EO 5BRDA 3MN7A 4BDZA 4BR7A 2ITMA 4CEQA 5I9EB 3M3ZA 4AF1A 4C8KA 5JS1A 4CBWA 1VSIA 3B6OA 4BE0A 3NF9A 4DTSA 2BDPA 1XUPO 4QS8A 3QETA 3LM9A 5AQNA 1REVA 1Z6RA 4CERA 2FXUA 4XIUA 1D9DA 1RTIA 3NH2A 4C8LA 3CQXA 4PL8A 1EP4A 4F9OA 2GUPA 2HOEA 2YHWA 1V4TA 5I42A 2OPRA 3G10A 4AHCA 3K5MA 2QWNA 3THWA 1D9FA 3VQPA 1C0GA 4ICLA 3AVAA 4FOIA 3L2QA 2QWPA 4KHPK 3OJUA 1VQ9N 5JVHL 1JL2A 4FLWA 3NGZA 3O4NA 3CJCA 4LD0A 4K43A 2O8EB 3GE1A 3J7YP 4E3SA 2NRWA 3OYFA 1IG9A 2GV9A 4OLBA 4CZMA 1IKYA 1X3MA 4DLGA 4BR5A 4Z4FA 3O9UA 1WUAA 4PUOA 3U3GA 4EAHD 4JI3K 5HL7L 1EO1A 5FRNA 2YJFA 3SUOA 1Z26A 5HBMA 1TVRA 3AVNA 3GOIA 2P9IB 4WQ4A 4BRDA 4DR4K 4FWKA 3CETA 1NOZA 1RGIA 2HHWA 3CM6A 3S9HA 1IO2A 3TAEA 4IJAA 4JKGA 3OYGA 3G25A 3LP1A 4GW6A 3ZSVA 3U9ZA 4KB1A 3M5RA 4FK4A 3EYZA 4H5TA 3AA3A 3AVKA 4DTOA 3QESA 4M45A 2HBMA 3U8XA 4FVMA 3HO1A 3OYCA 3AVBA 1NJWA 1RTJA 2RKIA 4A61A 2UUAK 4FWMA 4QAGA 4DU1A 1K8KB 4FJ5A 3ISNC 4B9LA 5GINA 3ENOA 4JKHA 1EETA 4FK0A 3VEOA 4FLTA 4O55A 4FM2A 4B9MA 4DR6K 1NMDA 1U2VA 1ZYQA 3PSIA 4BY9C 4H0YB 3MN6A 1BGXT 4DQQA 3ZEUA 2IIRA 4IG3A 3PIPL 5FROA 2Y1JA 3SAFA 1LCUA 1NWKA 1TL1A 5AQXA 1HNXK 5TKYA 4FJNA 3GL1A 4CZGA 2JWKA 1RBSA 4B8AB 3O9TA 3MEDA 3CYMA 2NRTA 5HRNA 5AQRA 3K5NA 3A0IX 4FPAA 4FJHA 3ZX3A 2BGGA 4B3RK 3PO4A 3AGKA 4M41A 3ULEA 4JI5K 3SZ2A 3L3UA 2E1ZA 4B9UA 1LOTB 1QQMA 3AO2A 2ZJRL 3P5JA 3M6GA 2HMPA 2QWRA 4DKWA 4CGIA 2Q0RA 5AQUA 1ASVA 5FLXO 2QWMA 1VSEA 3ID8A 4OPAA 2RE2A 3J80O 3VQAA 1JLGA 2B5JA 2ZGYA 1K73O 1S9GA 4FJJA 1GLBG 4JD2B 4TSXA 3EEQA 3ZX0A 4CZHA 2P9NB 3DXMA 2FC0A 2HHXA 3U6FA 2VGNA 4B3MK 1NJIO 4NYFA 5AQTA 5KPTA 1KFSA 1NU0A 1TK5A 4DU4A 2KHOA 3VPZA 3T3FA 4JAXA 4DMNA 2VWJA 4FLXA 3DAWA 4I9LA 3ZETB 3V9UA 5AQSA 3D0PA 4CHYA 4CHQA 2ZE2A 3VOVA 3R3LA 4CIFA 1X9MA 1FK9A 1XHXA 1RILA 4CK1A 4B1UB 4IZ9A 4E1MA 4CBXA 4CJ4A 1BQNA 4XH1A 1YAGA 4Z4HA 3EO3A 2A6AA 3CXCM 5E26A 3O9RA 4K25A 2AP1A 3LPUA 5JICA 4DSJA 1WNSA 1ATRA 1TUYA 5FPEA 1BHLA 1OKJA 3CG7A 3CD6N 2ITGA 3I56N 4A57A 3UKUA 4CCHA 4LF6K 4DS4A 4EFHA 3CERA 4E19A 1G99A 3OYNA 1C6VA 3CCSN 1FW6A 1TAQA 1DGKN 1VSLA 3RMCA 1NGCA 1DTQA 1S9EA 4B1VA 4CHPA 2OZSA 4CHZA 4IDKA 1JLEA 5BR8K 2Z1IA 3HP6A 4IEEA 2XHBA 2XO7A 1VQON 4U7BA 1YITN 1UAXA 2E20A 1TK8A 5C15A 1TUUA 2IAJA 3TSPA 5LMNK 1MU2A 1LW2A 3I0RA 1NLVA 3FZFA 3G0ZA 3CIPA 2KKZA 4FZZA 4BVOA 4DHYA 3DMJA 2F8SA 3O08A 4E7LA 3E9PA 2QWOA 3QIPA 2GWKA 5T7BA 4DF8A 4FPBA 1NGEA 4KH6A 4DV7K 4FJ7A 3AVGA 3WQUA 3EKSA 4CGGA 2NUBA 4F3OA 1RDDA 2RN2A 2E4LA 1JCGA 1KSPA 3ZCMA 5CHIA 4AH9A 3J7ZO 3CHWA 2ZJPL 3WEEA 4A59A 1NJXA 3MCPA 1IBLK 5FDLA 4QCLA 3EY1A 3VQQA 3SMPA 3D2FB 3OW2M 5C24A 1U2VB 5KI6A 1RCHA 4KB0A 3FR0A 3VERA 1BIUA 4AM6A 1BL3A 3ZEUB 2VQEK 3QEVA 2YKNA 4Y1CA 1ZBHA 3T19A 3V9WA 2RPIA 4KKOA 4HUGA 4PKHA 3C95A 3CC2N 5C10A 1VSHA 3G71N 2Q0UA 3HRGA 4YDUC 1NG9A 1L3UA 3SAGA 3QNNA 3O1WA 5AZJA 3OYHA 3I8BA 4WFBL 4RW4A 4KHSA 1HQUA 5M1OA 4DV4K 1VQMN 3ZT2A 3E01A 5KPRA 3F2KA 1LWEA 2WTUA 5AQKA 2G8KA 3M1FA 1GOAA 4CESA 3AAQA 3TARA 1JLCA 3GDQA 3C94A 4JN4A 3WUHA 2FBXA 2GX9A 3QLHA 5AQWA 4DV6K 1F21A 3DLBA 3TTDA 1T3VA 3BUZB 1GLEG 1Q9YA 1BI4B 2KQ2A 2DFFA 3HBTA 3KWGA 5FPNA 3NE6A 3DXMB 1WSEA 1NJZA 3KJVA 4DTMA 4RW8A 4DF4A 4OKKA 4CEOA 2ZGZA 3QEXA 1S1WA 5GIPA 3PV8A 4LSNA 2IDOA 3C6TA 2O8FA 5AJ3K 1NGFA 4J2BA 3VQ8A 4BRQA 3I55N 3M8SA 1I94K 1GLLO 5CY4A 4KH4A 4XH5A 2G8IA 1XMOK 4L3QA 3HPHA 2ZQBA 4BC4A 1SL0A 5HRPA 3RTVA 1RT6A 4DQPA 1Y64A 3CQYA 4CGHA 2FBTA 3LDQA 1R59O 1C1AA 5A2QO 1NK8A 3QEIA 3UKUB 3MXMA 4OKJA 2F9TA 2V52B 4PWDA 1KVAA 3KHYA 1IV0A 4B9NA 3SQ1A 1HJOA 3L2VA 1QZ6A 3RMBA 3MEEA 2HB5A 2OPSA 3EZWA 4E89A 4DG1A 1NK0A 3RVCA 1W0HA 1RT3A 1WAFA 2QXLA 3OYMA 3F5TA 1S1UA 1GLJO 3CQ8A 4J8FA 2WBNA 1BG3A 4DTPA 2D4WA 2YX6A 3D2EB 4NYNA 3ZSXA 1GLFO 1WSHA 4LH4A 2GEMA 4GNIA 1SKRA 1GLDG 1IKXA 1SV5A 2E8AA 4ID5A 3ZT0A 4LF5K 3DM2A 2HNDA 2P9SA 3VQ6A 4DSFA 2YHAA 4A2BA 4Q0BA 1X9WA 3BGRA 2JGUA 4M7YA 4FVUA 2UUBK 1L5UA 2VG7A 4FL9A 1VRUA 5JVGL 1TKZA 1S5JA 3NGYA 1W97L 1BCOA 3TABA 1RT5A 3VQBA 3H3OB 3NAEA 3WNFA 3VQDA 1T7PA 3HYFA 5J2QA 1L3SA 1WSIA 4L8RB 4LSLA 3RMDA 4FO0A 1ZC6A 1EXQA 3SJJA 4IFEA 4OKEA 4EZ6A 2NNWA 4CJVA 1K9MO 3CF5L 3V9SA 2O8BA 2PAVA 1HKCA 1NGGA 2P9UB 4FWQA 1RBTA 1HRHA 2W41A 3Q7BA 4C8OA 1YXQA 2P9PB 3CI5A 5J1EA 4K41A 1WSGA 3BF3A 3LANA 4CEBA 4CFDA 4IO9L 1Q81O 3I33A 1VRTA 3UKRB 1E4GT 4K0KK 2JWLA 2AA4A 2F96A 1WBBA 5HRSA 2I5JA 4ELVA 4DR3K 4BC3A 1K6YA 3THVA 4CGJA 4OPKA 1NKCA 4FWOA 4FJ8A 1HYSA 3QFUA 5JMVA 5HOOA 1KTQA 4JHDB 3TAPA 3H46O 4CF9A 3KLFA 3PX0A 2QWLA 1V4SA 3DXKA 4KRFA 1RBVA 2NLXA 2OA8A 5BRFA 4NLCA 2WONA 3O4QA 5AR0A 4I2QA 1KAYA 3AVCA 1RBRA 2DPNA 3THYB 3TTFA 2QXFA 1Y97A 1KD1O 1JLFA 1YUWA 1RDWX 3CCVN 4B9TA 1S6PA 4Z0UA 4NB4A 3QIOA 1TKXA 1NM1A 4ISGA 3O3HA 3TSQA 4MLHA 4K8ZA 4XH4A 3WQTA 3HPGA 3PO5A 4BRGA 3CJ9A 2RF2A 1O1WA 3L2WA 1TGOA 1HKBA 4C8MA 4GV9A 3WNHA 2WOMA 1XQSC 1NOYA 4WE1A 2D5RA 4CF2A 5AZIA 4DTJA 2G8VA 1C0UA 3MWTA 3ZSRA 2ZWHA 4W5TA 4LC9B 3HK2A 2OTLN 2X6SA 4KREA 4FLZA 4FOEA 3MECA 1D8YA 3KK3A 5LL6Z 4IOAL 3E9LA 3KK2A 3EL2A 3K2PA 1VQ8N 5KGWA 5ADXA 3JSMA 4BRKA 3AVJA 4CZEA 2ZM6K 5C2FA 4LFBK 4BGAA 1Q9XA 4ID1A 2A1RA 1S22A 3NF7A 1NK5A 2D0AA 2Z1JA 3DI6A 2Z1HA 3HSTB 4OPJA 3RWUA 1N6QA 4GY2B 1Q86O 5F1XA 4AHUA 4UQGA 4JI0K 3DJCA 4OPHA 4CJUA 3BZKA 4DV5K 3RR7A 2QKBA 1J9AA 1VSKA 3FZHA 4KFBA 4CW7B 3CCEN 3L4QA 3A5NC 2YNHA 4V19S 4OJRA 4DWIA 1HJRA 4LF9K 3N4PA 2E2NA 3AGRA 2GBZA 1X3NA 1S1XA 1CZ9A 4JK8A 4CZLA 4KPYA 1SS6A 2W40A 2KFNA 4A5BA 4GKKK 1RFQA 4H5NA 1YI2N 2O8DB 4MQ3A 4FXDA 1IJJA 2O8BB 5DMRA 4F3TA 3IDHA 2QM1A 3QBXA 4FLYA 3K9KA 1IG8A 3OVNA 3SV3A 3CPWM 4PKIA 3ZYYX 3RSEA 5KQ8A 2EX3A 1RT7A 5H1SQ 5C0YA 3MX5A 3VQEA 3V9ZA 1O13A 2YCHA 3EKUA 2HVIA 4BG9A 2HF4A 2FF6A 4DR2K 5GAHP 3NHGA 1IKWA 4A2AA 1OVQA 1VK0A 4B3OA 3T69A 3CMEN 1RNHA 3PLAA 4NCGA 4K8XA 3CCRN 3AVLA 3IUCA 1WN7A 3PY8A 3DXKB 4PKGA 1NGIA 3DRRA 4B1WB 4DSLA 3TAQA 3MK6A 3O9SA 1B9FA 1ILYA 1YTAA 3F73A 1BCMA 3HI0A 5GAEP 4FCYA 3CC7N 4JKAA 3NCIA 4DFPA 2UYTA 3AA4A 1NK4A 2CGKA 1EKEA 4FJMA 1BISA 3AO4A 1KC8O 4YHHK 4CEEA 1KLNA 2PZSA 1SL1A 1BDGA 4DTUA 4GVEA 3V6DA 1X9JA 2FLOA 4Z94A 3DOKA 4CZIA 2IVOA 2IVPA 1QE1A 4Y0WA 4CJWA 1QTMA 5KQDA 3KLGA 3KVGA 4GV3A 1KLMA 3LWLA 3T1HK 1Q18A 2ZF5O 3LL3A 2WFBA 1QSYA 4FWNA 5IT9O 3PX4A 4KTQA 4AHRA 3QINA 5AZIB 4GMJB 2D1KA 1JLBA 1ATSA 3CCJN 3AY9A 3SBTA 4DSEA 4X66K 3SPZA 3LZJA 3FE1A 1KAXA 5AFUA 4CF8A 3GG4A 3L0QA 3C7NA 4O5BA 4ILJA 4CJTA 4OGCA 3HM9A 4A5AA 3THXA 2R7YA 3THWB 4CEAA 5CZ2A 2E2OA 3QB0A 2ZJQL 1JCFA 4DR1K 4BR2A 5GIOA 2I7NA 4X65K 2WUSA 1VAZA 3DLGA 4DS5A 3LP2A 2UUCK 4DQ8A 3DWLA 1NGJA 1XC3A 1NGAA 2GWJA 4BRHA 3SQ0A 4B3SK 1JXBA 1JLAA 2NRHA 4K42A 1I3AA 4H4MA 3ZSWA 4BRIA 2YNFA 5GADP 3LWMA 3QDKA 3HM8A 2X74A 1T03A 5I3UA 4Z4EA 1JXEA 4LY7A 4J2DA 5EX5A 4WF9L 4YORA 3SI6A 2IGIA 3FLCO 2HHUA 5M1FA 1VQ5N 1W9HA 4EP5A 3CFPA 2ASPA 2VG6A 1ESVA 3PX6A 2HNZA 2DY4A 2P9LA 4JKGB 5GAGP 3NDKA 3R1XA 1T44A 4PA1A 1WAJA 3VESA 3BY5A 1NK9A 4M3ZA 3RSEB 1BA0A 4AM7A 2PYLA 4HUFA 3OY9A 4J2EA 1SAZA 1RTHA 1A5XA 3LP0A 4CJ5A 3P38A 1TYQA 3LPTA 4CJQA 1VQLN 2BTFA 4LFCK 3EE8A 2GUIA 3MXJA 4FLUA 4ELUA 2E2PA 3UE5A 3FZLA 5BN9A 2GELA 4FWPA 5TKWA 2AJQA 5IWAK 4KI4A 1ASWA 4B9QA 3K9JA 5ELZA 5HROA 2YV0X 1RDAA 4M3XA 1CLQA 3BP8A 2QWQA 1S1TA 4KTWA 3Q7CA 3KD1E 3SCXA 3A5MC 3LAMA 1U6ZA 3L8BA 4OO1J 3WXLA 3MN9A 4CD1A 5AQLA 4DR5K 3QICA 3ENBA 4CJPA 3D6RA 1NMNA 3I8DA 2O8CA 1D4XA 4LH5A 4E7HA 3IS9A 4ZTFA 3ULEB 1QQCA 5K14A 3CC4N 5M1PA 1XI1A 4JKDA 2FBYA 4BR0A 1HKGA 1BOTO 1QQNA 3DLKA 5ADXH 2Q36A 2VG5A 3WXJA 4FW2A 4MDBA 4IO8A 4IBNA 5JLFA 3MDQA 4M3UA 1N33K 1A5WA 4BRPA 4NO7A 4GV6A 4NCAA 3CPEA 2DTUA 1Q8IA 2XRIA 4CHOA 4OVLA 3VQ9A 4BDYA 2Z1GA 2D0PA 3CJAA 3SMSA 3DLEA 3S41A 1WSFA 2HBLA 3MX2A 3ID6A 1QVFM 2NZTA 4H0TB 4O0IA 1NK6A 1JKHA 3T1YK 2VCPA 4DU3A 2P5OA 4F2SA 4CF1A 4YOWA 3MWPA 1HYZA 5BPLA 1LAWA 2FSNA 1N8RO 5FRMA 3OA9A 4WFNL 3AA2A 4YOYA 3JYTA 2V51B 3CFRA 5AQZA 3ZSZA 3CCQN 5J2NA 3AO1A 3ITHA 1GLCG 2KFZA 3KKRA 3SBGA 1LV5A 4BQZA 1BWFO 3AVIA 2IVNA 2UXCK 4F4KA 3C0BA 3FFKB 1TKDA 3LDLA 4DFJA 2V7YA 2HVHA 3KWIA 5AQJA 4EIAA 3A2FA 3AVHA 5CYMA 3HTVA 2X78A 3SUPA 3VQ7A 3VN5A 1L3VA 2Q97A 1OH5A 4KI6A 2F7TA 3P83D 4R79A 4B3TK 1TV6A 1VQNN 2G8UA 4C1NI 1ASUA 4C8NA 4JI4K 4KO0A 3R6MA 4B1YB 4FYDA 3TAGA 4DTRA 3OYKA 4E1JA 1P8ZA 1RBUA 3EN9A 1IBMK 1N36K 1VSFA 1C1BA 5D3GA 4F8RA 3G4SN 2F9WA 3TSUA 3FZKA 4JI6K 2O8EA 2YI1A 4O0JA 1QSLA 2QK9A 3DYAA 1NGHA 5BR9A 3HXMA 4RTFD 4DTNA 1ZBFA 3WEEB 4IOCL 1RDCA 2IC3A 3OYDA 1JJ2M 3CCLN 3LDPA 3HOSA 4DUYK 1HMVA 3IMXA 2P9IA 2OCEA 3KD5E 4H0XB 3M8QA 4KHQA 2IOCA 2X6NA 4CBUA 4RW7A 5SWMA 3PUFA 3AV9A 4DV1K 4BE2A 1KCFA 3E9OA 2V7ZA 2OZMA 5KPZA 1X9SA 4FJXA 1G15A 3J8AA 4FWLA 3R8EA 3NMUA 2HF3A 5CR4A 4CVNE 2UXDK 4IWVA 5C12A 4DV2K 3CCMN 1DKGD 1T6DA 5AZJB 3A5OC 1RT1A 4B08A 4BDPA 5AQVA 1XNRK 4MO5A 5C42A 1BA1A 1MWKA 3VTIA 4MO4A 2YNGA 1EWRA 2EHGA 4O4GA 2BH1A 3WNGA 3OJSA 5M1QA 2KLAA 1KRPA 3QO9A 5AQQA 4CGDA 1IH7A 4CI6A 1U47A 1TKTA 4H0VB 1NJYA 1HYVA 2Q31A 4RW9A 4DFMA 1VQ6N 4CEFA 3SQ2A 1L3TA 1KFDA 2G8FA 3VF4A 3QNOA 4JKCA 5BREA 1A5VA 4M3YA 2BANA 2HNYA 2QTDA 4NCBA 1MWMA 4DQSA 3RMAA 4RW6A 1X1PA 1NBWA 1KAZA 1BO5O 4RCHA 1XNQK 1JLQA 2DFEA 5KRSA 3K58A 3CMAN 1GOCA 4Z4IA 2O8FB 2E1YA 4CE9A 4C23A 3HJFA 4G9ZA 2HHVA 3SAHA 1M1KO 1HNVA 1S1VA 4G1QA 3AARA 1WB9A 4KHUA 4HTUA 2Q1NA 4CEZA 5BPMA 3P1GA 3KLEA 3A8YA 2A40A 4B9VA 3HVTA 4DR7K 5C2DA 5M1NA 1C0FA 5J2MA 1RTDA 5AQFA 4JD2A 5EVZA 3TWHA 1H1VA 1ZBIA 2QEXN 2P9NA 2P5GA 2P9KA 4FWSA 3P31A 2HBJA 3ZT3A 1NK7A 2VYPA 3E1YA 3T7ZA 3C6AA 2HMIA 4FWRA 3TTCA 4DUZK 3QBWA 4B9SA 4WQ5C 1WBDA 1YHQN 2OPQA 3ZETA 3S3NA 4FZYA 4EP4A 1J53A 3WNEA 3RR8A 1JL1A 1BQMA 3KTQA 1MDUB 4M42A 3VQ4A 3OS0A 1GLAG 1R0AA 2W42A 4PL7A 1XC9A 1FKPA 2P9SB 3NF6A 4BC2A 4ILGB 2I7PA 3W3DA 4I9QA 3H6EA 3I0SA 3MN5A 1YF5L 2E6MA 3CCUN 3P4IA 3V1OA 4W5OA 2XY5A 3QMLA 2XY7A 2PYJA 4BWJA 4AHTA 4YOVA 1TL3A 1B9DA 2FSJA 4FJKA 1YJ9N 3ZSOA 3SUNA 2A41A 4CJLA 1QHAA 1HR0K 4EHTA 4CD3A 4H0PA 4HCCA 3L2UA 3L3VA 4CJFA 4HHTA 4RG8A 1CZAN 3AVMA 3VTHA 3DLHA 4FZXC 3LAKA 4JK7A 3H3NO 3O5BA 3T1AA 3IAYA 4M7XA 1HUXA 3GBTA 3MCAB 4JI1K 3FZMA 4X62K 3KIOA 3TPQA 1QHTA 4H8KA 1K8AO 4ISFA 5B8HA 3LZIA 4EHUA 2P1JA 3O1BA 3VEWA 4ILHA 3SK3A 4YDUA 2QI2A 4MDAA 4YOUA 3C65A 5AQYA 3TAFA 2RHKA 1YJNN 3L6QA 2F8TA 1M90O 3HP9A 1S6QA 1EX4A 1P90A 4ZHRA 1UA1A 3UB5A 2HW3A 5C25A 4IXCA 4A62A 1LWFA 3O8MA 4BREA 4LF4K 4HWIA 1NNEA 3DRSA 2PBDA 5HP1A 1WOQA 1RT2A 4FSVA 1ZXOA 3D2FA 3QEPA 1U4BA 4BACA 4BGBA 5HRRA 2QA4N 2W6KA 3CM5A 4GKJK 2ASOA 3RRHA 4BRCA 5LMUK 4CF0A 3IG1A 4KH5A 1I39A 2NRXA 2D0OA 4CEDA 3G6EN 3BDPA 4ELTA 3F9MA 4FJ9A 3RRGA 3U4LA 4F2RA 4FJLA 3BEXA 3AO5A 4QS7A 4WCEL 3D45A 3S3OA 1QS4A 3K0SA 1LW0A 5AQIA 1RT4A 1BUPA 1KVCA 1S3XA 4QS9A 4DQRA 2E5LK 3R9PA 3A5LC 3WT0A
chains in the Genus database with same CATH topology
4DV4K 2UUBK 1N34K 4OX9K 4LF7K 4NXMK 4DV0K 4X64K 5BR8K 1XMQK 2UU9K 3J81O 4AQYK 4DV6K 1HNXK 4JV5K 4B3TK 4LF8K 1HNWK 2HHHK 4DR5K 4DR1K 4DR2K 4X65K 1HR0K 4JI4K 2VQFK 1XNQK 4KHPK 5LMNK 3OTOK 4JI2K 1IBMK 1N36K 4B3RK 2UUCK 4JI5K 4JI1K 3J7YP 4JI8K 4B3SK 4X62K 4YY3K 5LL6Z 4JI6K 5FLXO 5AJ3K 1FJGK 1N33K 4DV7K 3J80O 4K0KK 3J7AP 1I94K 4JI3K 2ZM6K 1XMOK 4DR3K 4LFBK 4DR7K 4DR4K 4B3MK 1IBLK 4DUYK 4JI7K 4YHHK 5A2QO 4LF4K 4NXNK 4JI0K 4DV5K 1HNZK 3T1YK 4DUZK 4DV1K 2F4VK 4GKJK 2VQEK 2UXBK 4CW7B 5LMUK 1N32K 4LFAK 4V19S 3T1HK 1IBKK 4LF9K 4CVNE 2UXDK 2UUAK 4DV2K 4JYAK 4LFCK 5IT9O 4GKKK 1XNRK 4DV3K 4LF5K 4DR6K 4X66K 5IWAK 1J5EK 2E5LK 4LF6K 2UXCK 3JAMO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV4 K;  2UUB K;  1N34 K;  4OX9 K;  4LF7 K;  4NXM K;  4DV0 K;  4X64 K;  5BR8 K;  1XMQ K;  2UU9 K;  3J81 O;  4AQY K;  4DV6 K;  1HNX K;  4JV5 K;  4B3T K;  4LF8 K;  1HNW K;  2HHH K;  4DR5 K;  4DR1 K;  4DR2 K;  4X65 K;  1HR0 K;  4JI4 K;  2VQF K;  1XNQ K;  4KHP K;  5LMN K;  3OTO K;  4JI2 K;  1IBM K;  1N36 K;  4B3R K;  2UUC K;  4JI5 K;  4JI1 K;  3J7Y P;  4JI8 K;  4B3S K;  4X62 K;  4YY3 K;  5LL6 Z;  4JI6 K;  5FLX O;  5AJ3 K;  1FJG K;  1N33 K;  4DV7 K;  3J80 O;  4K0K K;  3J7A P;  1I94 K;  4JI3 K;  2ZM6 K;  1XMO K;  4DR3 K;  4LFB K;  4DR7 K;  4DR4 K;  4B3M K;  1IBL K;  4DUY K;  4JI7 K;  4YHH K;  5A2Q O;  4LF4 K;  4NXN K;  4JI0 K;  4DV5 K;  1HNZ K;  3T1Y K;  4DUZ K;  4DV1 K;  2F4V K;  4GKJ K;  2VQE K;  2UXB K;  4CW7 B;  5LMU K;  1N32 K;  4LFA K;  4V19 S;  3T1H K;  1IBK K;  4LF9 K;  4CVN E;  2UXD K;  2UUA K;  4DV2 K;  4JYA K;  4LFC K;  5IT9 O;  4GKK K;  1XNR K;  4DV3 K;  4LF5 K;  4DR6 K;  4X66 K;  5IWA K;  1J5E K;  2E5L K;  4LF6 K;  2UXC K;  3JAM O; 
#chains in the Genus database with same CATH topology
 3KK7 A;  3CJB A;  4B8C A;  1N34 K;  4BWM A;  4NXM K;  3MEG A;  2B4J A;  1LWC A;  3CFO A;  3H08 A;  4DV0 K;  4UY8 O;  5J2P A;  3BF1 A;  3VMF B;  3J81 O;  4AQY K;  4I2P A;  5CYQ A;  1YVN A;  4U67 L;  4WFA L;  1HQE A;  4YOX A;  4GVM A;  4N41 A;  3OYL A;  1DEJ A;  4O8U A;  5LY3 A;  3VEY A;  4W5R A;  2W6L A;  3O3F A;  5HLF A;  3OTO K;  3VGK A;  1BI4 A;  3V4I A;  2EWS A;  2P9K B;  2J4R A;  3C6U A;  2BE2 A;  2LSN A;  3ZSY A;  4HUE A;  1C0M A;  3JXU A;  2YKM A;  3KKS A;  1YTU A;  3H45 C;  5DK5 A;  1YT3 A;  2PFU A;  4W5Q A;  4CFC A;  3JS6 A;  4JS5 A;  2XY8 A;  3FGU A;  3HVR A;  1SQK A;  4E0D A;  2E6L A;  5BPN A;  4Y1D A;  2KZM A;  3ENH A;  4PQU A;  3SPY A;  4O8K A;  5AQH A;  3U3Y A;  3QEW A;  2O4G A;  1VQ7 N;  3P39 A;  3HT3 A;  3MAQ A;  3KZB A;  4AIL C;  2VWB A;  4CJ7 A;  3K57 A;  5KGX A;  3NF8 A;  3L2R A;  4NXN K;  4DSI A;  2VGM A;  1HNZ K;  3IFR A;  4CJ3 A;  4R5P A;  1HX1 A;  3TR8 A;  3NH1 A;  3EZ5 A;  3QFP A;  3FFI A;  3SUQ A;  4DB3 A;  4OGE A;  4LFA K;  4BR9 A;  4DTX A;  5BRH A;  4KHN A;  2XY6 A;  3N4Q A;  3HOT A;  3NH0 A;  1XWL A;  1E3M A;  4JYA K;  4N56 A;  1QSS A;  2HBK A;  2OAN A;  2YHB A;  3D2E A;  2E88 A;  2A3Z A;  1W7A A;  1SKW A;  3ZLJ A;  4JKF A;  3SNN A;  3VGM A;  4IKF A;  3OYA A;  3PSF A;  1J5E K;  1B92 A;  3JAM O;  5LJV A;  5LJW A;  2NRR A;  4WYB A;  4N47 A;  1OH6 A;  4LF7 K;  2H3G X;  2JLE A;  3VGL A;  4HTL A;  4CZJ A;  5KRT A;  1UA0 A;  2HHQ A;  3NVK A;  1YVU A;  2WC9 A;  2KTQ A;  2VWK A;  2B6A A;  3UIQ A;  5M1K A;  5AQM A;  2BUP A;  3TI0 A;  1QVG M;  1VQP N;  4CK2 A;  3TAN A;  4BC5 A;  3KLH A;  3OS2 A;  4B1X B;  2KZZ A;  1QQO A;  4WQ4 C;  1HPM A;  2A5X A;  3F9K A;  1LAV A;  2KW4 A;  1HNI A;  3VEN A;  2ATQ A;  4B1Z A;  1GOB A;  4E7K A;  1SUQ A;  4BRA A;  3VQC A;  4CFB A;  3HZ6 A;  1HLU A;  3VEV A;  2ETJ A;  2P9U A;  1S72 N;  1YIJ N;  4CZK A;  1FXX A;  3C6H A;  5EY4 A;  3O6W A;  3VET A;  3OYE A;  3OYJ A;  2P9P A;  2D0C A;  2PY5 A;  1WSJ A;  4KHW A;  3U9D A;  5F2R A;  4M3R A;  1MA9 B;  1NGB A;  3ALY A;  3NFA A;  4CEC A;  4Z4G A;  4JNE A;  3OS1 A;  4MLE A;  3UKR A;  3O80 A;  3VA0 A;  5AQP A;  3DLR A;  3S3M A;  4YFU A;  2YHY A;  3OYB A;  3DRP A;  1OVY A;  2A42 A;  4DCH A;  4BRN A;  1UOC A;  4BVP A;  4JRP A;  4YNQ A;  4C1N K;  2D0B A;  5E84 A;  3O9Q A;  4JHD A;  3CJ7 A;  2UXB K;  4I6M A;  3K59 A;  5AQG A;  4O5F A;  1VQ4 N;  3AVF A;  4IFV A;  3MMV A;  2A1S A;  3SQ4 A;  1U49 A;  3NVM A;  3EE9 A;  4BRM A;  4KTZ A;  1EWQ A;  3THY A;  1U48 A;  3OBY A;  3O4W A;  2YJE A;  4JRQ A;  1VSM A;  4H4O A;  4NLB A;  3SJH A;  3OBW A;  3V1Q A;  5CZ1 A;  3MXI A;  1WLJ A;  4IOX A;  5FPD A;  3LP3 A;  5FPM A;  3VF2 A;  4FM0 A;  4JKB A;  4BRF A;  4JK9 A;  4WQ5 A;  3C7N B;  2HST A;  4CGF A;  4CK3 A;  1C1C A;  4CJE A;  3B6P A;  1VSD A;  3SYZ A;  3THX B;  4IEI A;  3TAM A;  4X64 K;  3V9X A;  1XMQ K;  2UU9 K;  3HSC A;  3ZSQ A;  3NGI A;  4DFK A;  3HPO A;  4AHS A;  4H0O A;  2YHX A;  3M8P A;  4JV5 K;  3TU5 A;  3ULD A;  1YJW N;  4N76 A;  1VSJ A;  5F0X A;  1U04 A;  3V81 A;  1VQK N;  3WXM B;  2HHH K;  3H1Q A;  3ZT1 A;  4IFY A;  1UWB A;  1KXP A;  2VQF K;  5DM7 L;  1EQY A;  3SLC A;  5JS2 A;  4CHN A;  3OYI A;  4JI2 K;  1ZBU A;  1BU6 O;  4IJN A;  3DLL L;  1E4F T;  1NKE A;  2FF3 B;  4YOT A;  4JI8 K;  1Z25 A;  3E66 A;  1OH7 A;  4BR4 A;  1SKS A;  2HHT A;  3K5L A;  3KK1 A;  2OYQ A;  1NKB A;  1FKO A;  3J7A P;  4E7J A;  2HHS A;  1D5A A;  3AA5 X;  3LDS A;  1Z05 A;  4BQL A;  2P9L B;  4JEP A;  4ISE A;  1IKV A;  3PIO L;  4QOZ B;  1ZBS A;  4W5N A;  1CXQ A;  1VHX A;  4IDH A;  3KLI A;  2Q3S A;  1ATN A;  1SZ2 A;  4KHY A;  1C0T A;  4CJK A;  3LDO A;  1XHZ A;  4IG0 A;  1OH8 A;  2OTJ N;  3O3G A;  2P51 A;  3VEX A;  5EU7 A;  2ZD1 A;  4CFA A;  1T6C A;  3LDN A;  3LM2 A;  4BG8 A;  4J2A A;  1Q82 O;  1J54 A;  2QW9 A;  3AAP A;  3M8R A;  1TAU A;  1TYQ B;  3ATU A;  3OHR A;  1IBK K;  4PY5 A;  2OPP A;  1T8E A;  3VEZ A;  4CJS A;  2DFH A;  4CJR A;  4CZF A;  3ASM A;  3L4I A;  4DLE A;  2NRZ A;  3SV4 A;  3ZT4 A;  4XEI A;  4BE1 A;  3W0L A;  4H5W A;  1QZ5 A;  2CGL A;  1U45 A;  4DSK A;  4DV3 K;  4FJG A;  2O8D A;  2GTD A;  2FBV A;  1W2B M;  1CZB A;  4FJI A;  3WXK A;  3ATV A;  4PHT X;  3B8A X;  1Q7Y O;  4CIG A;  1SL2 A;  1N5Y A;  4JLH A;  5BN8 A;  5JLH A;  4CIE A;  5E41 A;  4FM1 A;  4OX9 K;  1J6Z A;  2CGJ A;  1BIZ A;  2Q2R A;  4M63 C;  3DOL A;  4ZTJ A;  4H03 B;  4KV8 A;  3H1V X;  4I7F A;  1HPZ A;  2CH5 A;  4LF8 K;  1K8K A;  1HNW K;  5AFU H;  3LAL A;  2O8C B;  3NBP A;  4AHV A;  4OLA A;  2QKK A;  4BRL A;  1KQS M;  4DQI A;  3WXI A;  3QER A;  1ITG A;  3V1R A;  3VQ5 A;  4E1N A;  2Y1I A;  1NGD A;  3ZX2 A;  4KAZ A;  4YY3 K;  5DM6 L;  2FSK A;  4E7I A;  5MLC Q;  4H5R A;  3VA3 A;  3HL8 A;  3IKM A;  1CXU A;  1FJG K;  3VF6 A;  4HVJ A;  5SZT A;  1J5O A;  4I6M B;  4JKE A;  1DT9 A;  3AO3 A;  1TK0 A;  2IS3 A;  4MFB A;  4JS4 A;  3IRX A;  4M3T A;  4N5S A;  3CJ1 A;  5EXW A;  4HCB A;  4EZ9 A;  4M3W A;  5EOY A;  3BZC A;  4JI7 K;  1ZBL A;  1DTT A;  2YNI A;  2ASM A;  4FK2 A;  4Z4C A;  4BRO A;  2G8W A;  2O4I A;  2G8H A;  2CH6 A;  2E2Q A;  2NRV A;  2F4V K;  5CE3 A;  3K5O A;  4FLV A;  1JCE A;  5KTQ A;  4RWT A;  1N32 K;  4O44 A;  4H5V A;  1T05 A;  5AQO A;  1RDB A;  4KBO A;  1KVB A;  4FW1 A;  1DLO A;  1RDU A;  4Q5V A;  3D7E O;  5BRD A;  3MN7 A;  4BDZ A;  4BR7 A;  2ITM A;  4CEQ A;  5I9E B;  3M3Z A;  4AF1 A;  4C8K A;  5JS1 A;  4CBW A;  1VSI A;  3B6O A;  4BE0 A;  3NF9 A;  4DTS A;  2BDP A;  1XUP O;  4QS8 A;  3QET A;  3LM9 A;  5AQN A;  1REV A;  1Z6R A;  4CER A;  2FXU A;  4XIU A;  1D9D A;  1RTI A;  3NH2 A;  4C8L A;  3CQX A;  4PL8 A;  1EP4 A;  4F9O A;  2GUP A;  2HOE A;  2YHW A;  1V4T A;  5I42 A;  2OPR A;  3G10 A;  4AHC A;  3K5M A;  2QWN A;  3THW A;  1D9F A;  3VQP A;  1C0G A;  4ICL A;  3AVA A;  4FOI A;  3L2Q A;  2QWP A;  4KHP K;  3OJU A;  1VQ9 N;  5JVH L;  1JL2 A;  4FLW A;  3NGZ A;  3O4N A;  3CJC A;  4LD0 A;  4K43 A;  2O8E B;  3GE1 A;  3J7Y P;  4E3S A;  2NRW A;  3OYF A;  1IG9 A;  2GV9 A;  4OLB A;  4CZM A;  1IKY A;  1X3M A;  4DLG A;  4BR5 A;  4Z4F A;  3O9U A;  1WUA A;  4PUO A;  3U3G A;  4EAH D;  4JI3 K;  5HL7 L;  1EO1 A;  5FRN A;  2YJF A;  3SUO A;  1Z26 A;  5HBM A;  1TVR A;  3AVN A;  3GOI A;  2P9I B;  4WQ4 A;  4BRD A;  4DR4 K;  4FWK A;  3CET A;  1NOZ A;  1RGI A;  2HHW A;  3CM6 A;  3S9H A;  1IO2 A;  3TAE A;  4IJA A;  4JKG A;  3OYG A;  3G25 A;  3LP1 A;  4GW6 A;  3ZSV A;  3U9Z A;  4KB1 A;  3M5R A;  4FK4 A;  3EYZ A;  4H5T A;  3AA3 A;  3AVK A;  4DTO A;  3QES A;  4M45 A;  2HBM A;  3U8X A;  4FVM A;  3HO1 A;  3OYC A;  3AVB A;  1NJW A;  1RTJ A;  2RKI A;  4A61 A;  2UUA K;  4FWM A;  4QAG A;  4DU1 A;  1K8K B;  4FJ5 A;  3ISN C;  4B9L A;  5GIN A;  3ENO A;  4JKH A;  1EET A;  4FK0 A;  3VEO A;  4FLT A;  4O55 A;  4FM2 A;  4B9M A;  4DR6 K;  1NMD A;  1U2V A;  1ZYQ A;  3PSI A;  4BY9 C;  4H0Y B;  3MN6 A;  1BGX T;  4DQQ A;  3ZEU A;  2IIR A;  4IG3 A;  3PIP L;  5FRO A;  2Y1J A;  3SAF A;  1LCU A;  1NWK A;  1TL1 A;  5AQX A;  1HNX K;  5TKY A;  4FJN A;  3GL1 A;  4CZG A;  2JWK A;  1RBS A;  4B8A B;  3O9T A;  3MED A;  3CYM A;  2NRT A;  5HRN A;  5AQR A;  3K5N A;  3A0I X;  4FPA A;  4FJH A;  3ZX3 A;  2BGG A;  4B3R K;  3PO4 A;  3AGK A;  4M41 A;  3ULE A;  4JI5 K;  3SZ2 A;  3L3U A;  2E1Z A;  4B9U A;  1LOT B;  1QQM A;  3AO2 A;  2ZJR L;  3P5J A;  3M6G A;  2HMP A;  2QWR A;  4DKW A;  4CGI A;  2Q0R A;  5AQU A;  1ASV A;  5FLX O;  2QWM A;  1VSE A;  3ID8 A;  4OPA A;  2RE2 A;  3J80 O;  3VQA A;  1JLG A;  2B5J A;  2ZGY A;  1K73 O;  1S9G A;  4FJJ A;  1GLB G;  4JD2 B;  4TSX A;  3EEQ A;  3ZX0 A;  4CZH A;  2P9N B;  3DXM A;  2FC0 A;  2HHX A;  3U6F A;  2VGN A;  4B3M K;  1NJI O;  4NYF A;  5AQT A;  5KPT A;  1KFS A;  1NU0 A;  1TK5 A;  4DU4 A;  2KHO A;  3VPZ A;  3T3F A;  4JAX A;  4DMN A;  2VWJ A;  4FLX A;  3DAW A;  4I9L A;  3ZET B;  3V9U A;  5AQS A;  3D0P A;  4CHY A;  4CHQ A;  2ZE2 A;  3VOV A;  3R3L A;  4CIF A;  1X9M A;  1FK9 A;  1XHX A;  1RIL A;  4CK1 A;  4B1U B;  4IZ9 A;  4E1M A;  4CBX A;  4CJ4 A;  1BQN A;  4XH1 A;  1YAG A;  4Z4H A;  3EO3 A;  2A6A A;  3CXC M;  5E26 A;  3O9R A;  4K25 A;  2AP1 A;  3LPU A;  5JIC A;  4DSJ A;  1WNS A;  1ATR A;  1TUY A;  5FPE A;  1BHL A;  1OKJ A;  3CG7 A;  3CD6 N;  2ITG A;  3I56 N;  4A57 A;  3UKU A;  4CCH A;  4LF6 K;  4DS4 A;  4EFH A;  3CER A;  4E19 A;  1G99 A;  3OYN A;  1C6V A;  3CCS N;  1FW6 A;  1TAQ A;  1DGK N;  1VSL A;  3RMC A;  1NGC A;  1DTQ A;  1S9E A;  4B1V A;  4CHP A;  2OZS A;  4CHZ A;  4IDK A;  1JLE A;  5BR8 K;  2Z1I A;  3HP6 A;  4IEE A;  2XHB A;  2XO7 A;  1VQO N;  4U7B A;  1YIT N;  1UAX A;  2E20 A;  1TK8 A;  5C15 A;  1TUU A;  2IAJ A;  3TSP A;  5LMN K;  1MU2 A;  1LW2 A;  3I0R A;  1NLV A;  3FZF A;  3G0Z A;  3CIP A;  2KKZ A;  4FZZ A;  4BVO A;  4DHY A;  3DMJ A;  2F8S A;  3O08 A;  4E7L A;  3E9P A;  2QWO A;  3QIP A;  2GWK A;  5T7B A;  4DF8 A;  4FPB A;  1NGE A;  4KH6 A;  4DV7 K;  4FJ7 A;  3AVG A;  3WQU A;  3EKS A;  4CGG A;  2NUB A;  4F3O A;  1RDD A;  2RN2 A;  2E4L A;  1JCG A;  1KSP A;  3ZCM A;  5CHI A;  4AH9 A;  3J7Z O;  3CHW A;  2ZJP L;  3WEE A;  4A59 A;  1NJX A;  3MCP A;  1IBL K;  5FDL A;  4QCL A;  3EY1 A;  3VQQ A;  3SMP A;  3D2F B;  3OW2 M;  5C24 A;  1U2V B;  5KI6 A;  1RCH A;  4KB0 A;  3FR0 A;  3VER A;  1BIU A;  4AM6 A;  1BL3 A;  3ZEU B;  2VQE K;  3QEV A;  2YKN A;  4Y1C A;  1ZBH A;  3T19 A;  3V9W A;  2RPI A;  4KKO A;  4HUG A;  4PKH A;  3C95 A;  3CC2 N;  5C10 A;  1VSH A;  3G71 N;  2Q0U A;  3HRG A;  4YDU C;  1NG9 A;  1L3U A;  3SAG A;  3QNN A;  3O1W A;  5AZJ A;  3OYH A;  3I8B A;  4WFB L;  4RW4 A;  4KHS A;  1HQU A;  5M1O A;  4DV4 K;  1VQM N;  3ZT2 A;  3E01 A;  5KPR A;  3F2K A;  1LWE A;  2WTU A;  5AQK A;  2G8K A;  3M1F A;  1GOA A;  4CES A;  3AAQ A;  3TAR A;  1JLC A;  3GDQ A;  3C94 A;  4JN4 A;  3WUH A;  2FBX A;  2GX9 A;  3QLH A;  5AQW A;  4DV6 K;  1F21 A;  3DLB A;  3TTD A;  1T3V A;  3BUZ B;  1GLE G;  1Q9Y A;  1BI4 B;  2KQ2 A;  2DFF A;  3HBT A;  3KWG A;  5FPN A;  3NE6 A;  3DXM B;  1WSE A;  1NJZ A;  3KJV A;  4DTM A;  4RW8 A;  4DF4 A;  4OKK A;  4CEO A;  2ZGZ A;  3QEX A;  1S1W A;  5GIP A;  3PV8 A;  4LSN A;  2IDO A;  3C6T A;  2O8F A;  5AJ3 K;  1NGF A;  4J2B A;  3VQ8 A;  4BRQ A;  3I55 N;  3M8S A;  1I94 K;  1GLL O;  5CY4 A;  4KH4 A;  4XH5 A;  2G8I A;  1XMO K;  4L3Q A;  3HPH A;  2ZQB A;  4BC4 A;  1SL0 A;  5HRP A;  3RTV A;  1RT6 A;  4DQP A;  1Y64 A;  3CQY A;  4CGH A;  2FBT A;  3LDQ A;  1R59 O;  1C1A A;  5A2Q O;  1NK8 A;  3QEI A;  3UKU B;  3MXM A;  4OKJ A;  2F9T A;  2V52 B;  4PWD A;  1KVA A;  3KHY A;  1IV0 A;  4B9N A;  3SQ1 A;  1HJO A;  3L2V A;  1QZ6 A;  3RMB A;  3MEE A;  2HB5 A;  2OPS A;  3EZW A;  4E89 A;  4DG1 A;  1NK0 A;  3RVC A;  1W0H A;  1RT3 A;  1WAF A;  2QXL A;  3OYM A;  3F5T A;  1S1U A;  1GLJ O;  3CQ8 A;  4J8F A;  2WBN A;  1BG3 A;  4DTP A;  2D4W A;  2YX6 A;  3D2E B;  4NYN A;  3ZSX A;  1GLF O;  1WSH A;  4LH4 A;  2GEM A;  4GNI A;  1SKR A;  1GLD G;  1IKX A;  1SV5 A;  2E8A A;  4ID5 A;  3ZT0 A;  4LF5 K;  3DM2 A;  2HND A;  2P9S A;  3VQ6 A;  4DSF A;  2YHA A;  4A2B A;  4Q0B A;  1X9W A;  3BGR A;  2JGU A;  4M7Y A;  4FVU A;  2UUB K;  1L5U A;  2VG7 A;  4FL9 A;  1VRU A;  5JVG L;  1TKZ A;  1S5J A;  3NGY A;  1W97 L;  1BCO A;  3TAB A;  1RT5 A;  3VQB A;  3H3O B;  3NAE A;  3WNF A;  3VQD A;  1T7P A;  3HYF A;  5J2Q A;  1L3S A;  1WSI A;  4L8R B;  4LSL A;  3RMD A;  4FO0 A;  1ZC6 A;  1EXQ A;  3SJJ A;  4IFE A;  4OKE A;  4EZ6 A;  2NNW A;  4CJV A;  1K9M O;  3CF5 L;  3V9S A;  2O8B A;  2PAV A;  1HKC A;  1NGG A;  2P9U B;  4FWQ A;  1RBT A;  1HRH A;  2W41 A;  3Q7B A;  4C8O A;  1YXQ A;  2P9P B;  3CI5 A;  5J1E A;  4K41 A;  1WSG A;  3BF3 A;  3LAN A;  4CEB A;  4CFD A;  4IO9 L;  1Q81 O;  3I33 A;  1VRT A;  3UKR B;  1E4G T;  4K0K K;  2JWL A;  2AA4 A;  2F96 A;  1WBB A;  5HRS A;  2I5J A;  4ELV A;  4DR3 K;  4BC3 A;  1K6Y A;  3THV A;  4CGJ A;  4OPK A;  1NKC A;  4FWO A;  4FJ8 A;  1HYS A;  3QFU A;  5JMV A;  5HOO A;  1KTQ A;  4JHD B;  3TAP A;  3H46 O;  4CF9 A;  3KLF A;  3PX0 A;  2QWL A;  1V4S A;  3DXK A;  4KRF A;  1RBV A;  2NLX A;  2OA8 A;  5BRF A;  4NLC A;  2WON A;  3O4Q A;  5AR0 A;  4I2Q A;  1KAY A;  3AVC A;  1RBR A;  2DPN A;  3THY B;  3TTF A;  2QXF A;  1Y97 A;  1KD1 O;  1JLF A;  1YUW A;  1RDW X;  3CCV N;  4B9T A;  1S6P A;  4Z0U A;  4NB4 A;  3QIO A;  1TKX A;  1NM1 A;  4ISG A;  3O3H A;  3TSQ A;  4MLH A;  4K8Z A;  4XH4 A;  3WQT A;  3HPG A;  3PO5 A;  4BRG A;  3CJ9 A;  2RF2 A;  1O1W A;  3L2W A;  1TGO A;  1HKB A;  4C8M A;  4GV9 A;  3WNH A;  2WOM A;  1XQS C;  1NOY A;  4WE1 A;  2D5R A;  4CF2 A;  5AZI A;  4DTJ A;  2G8V A;  1C0U A;  3MWT A;  3ZSR A;  2ZWH A;  4W5T A;  4LC9 B;  3HK2 A;  2OTL N;  2X6S A;  4KRE A;  4FLZ A;  4FOE A;  3MEC A;  1D8Y A;  3KK3 A;  5LL6 Z;  4IOA L;  3E9L A;  3KK2 A;  3EL2 A;  3K2P A;  1VQ8 N;  5KGW A;  5ADX A;  3JSM A;  4BRK A;  3AVJ A;  4CZE A;  2ZM6 K;  5C2F A;  4LFB K;  4BGA A;  1Q9X A;  4ID1 A;  2A1R A;  1S22 A;  3NF7 A;  1NK5 A;  2D0A A;  2Z1J A;  3DI6 A;  2Z1H A;  3HST B;  4OPJ A;  3RWU A;  1N6Q A;  4GY2 B;  1Q86 O;  5F1X A;  4AHU A;  4UQG A;  4JI0 K;  3DJC A;  4OPH A;  4CJU A;  3BZK A;  4DV5 K;  3RR7 A;  2QKB A;  1J9A A;  1VSK A;  3FZH A;  4KFB A;  4CW7 B;  3CCE N;  3L4Q A;  3A5N C;  2YNH A;  4V19 S;  4OJR A;  4DWI A;  1HJR A;  4LF9 K;  3N4P A;  2E2N A;  3AGR A;  2GBZ A;  1X3N A;  1S1X A;  1CZ9 A;  4JK8 A;  4CZL A;  4KPY A;  1SS6 A;  2W40 A;  2KFN A;  4A5B A;  4GKK K;  1RFQ A;  4H5N A;  1YI2 N;  2O8D B;  4MQ3 A;  4FXD A;  1IJJ A;  2O8B B;  5DMR A;  4F3T A;  3IDH A;  2QM1 A;  3QBX A;  4FLY A;  3K9K A;  1IG8 A;  3OVN A;  3SV3 A;  3CPW M;  4PKI A;  3ZYY X;  3RSE A;  5KQ8 A;  2EX3 A;  1RT7 A;  5H1S Q;  5C0Y A;  3MX5 A;  3VQE A;  3V9Z A;  1O13 A;  2YCH A;  3EKU A;  2HVI A;  4BG9 A;  2HF4 A;  2FF6 A;  4DR2 K;  5GAH P;  3NHG A;  1IKW A;  4A2A A;  1OVQ A;  1VK0 A;  4B3O A;  3T69 A;  3CME N;  1RNH A;  3PLA A;  4NCG A;  4K8X A;  3CCR N;  3AVL A;  3IUC A;  1WN7 A;  3PY8 A;  3DXK B;  4PKG A;  1NGI A;  3DRR A;  4B1W B;  4DSL A;  3TAQ A;  3MK6 A;  3O9S A;  1B9F A;  1ILY A;  1YTA A;  3F73 A;  1BCM A;  3HI0 A;  5GAE P;  4FCY A;  3CC7 N;  4JKA A;  3NCI A;  4DFP A;  2UYT A;  3AA4 A;  1NK4 A;  2CGK A;  1EKE A;  4FJM A;  1BIS A;  3AO4 A;  1KC8 O;  4YHH K;  4CEE A;  1KLN A;  2PZS A;  1SL1 A;  1BDG A;  4DTU A;  4GVE A;  3V6D A;  1X9J A;  2FLO A;  4Z94 A;  3DOK A;  4CZI A;  2IVO A;  2IVP A;  1QE1 A;  4Y0W A;  4CJW A;  1QTM A;  5KQD A;  3KLG A;  3KVG A;  4GV3 A;  1KLM A;  3LWL A;  3T1H K;  1Q18 A;  2ZF5 O;  3LL3 A;  2WFB A;  1QSY A;  4FWN A;  5IT9 O;  3PX4 A;  4KTQ A;  4AHR A;  3QIN A;  5AZI B;  4GMJ B;  2D1K A;  1JLB A;  1ATS A;  3CCJ N;  3AY9 A;  3SBT A;  4DSE A;  4X66 K;  3SPZ A;  3LZJ A;  3FE1 A;  1KAX A;  5AFU A;  4CF8 A;  3GG4 A;  3L0Q A;  3C7N A;  4O5B A;  4ILJ A;  4CJT A;  4OGC A;  3HM9 A;  4A5A A;  3THX A;  2R7Y A;  3THW B;  4CEA A;  5CZ2 A;  2E2O A;  3QB0 A;  2ZJQ L;  1JCF A;  4DR1 K;  4BR2 A;  5GIO A;  2I7N A;  4X65 K;  2WUS A;  1VAZ A;  3DLG A;  4DS5 A;  3LP2 A;  2UUC K;  4DQ8 A;  3DWL A;  1NGJ A;  1XC3 A;  1NGA A;  2GWJ A;  4BRH A;  3SQ0 A;  4B3S K;  1JXB A;  1JLA A;  2NRH A;  4K42 A;  1I3A A;  4H4M A;  3ZSW A;  4BRI A;  2YNF A;  5GAD P;  3LWM A;  3QDK A;  3HM8 A;  2X74 A;  1T03 A;  5I3U A;  4Z4E A;  1JXE A;  4LY7 A;  4J2D A;  5EX5 A;  4WF9 L;  4YOR A;  3SI6 A;  2IGI A;  3FLC O;  2HHU A;  5M1F A;  1VQ5 N;  1W9H A;  4EP5 A;  3CFP A;  2ASP A;  2VG6 A;  1ESV A;  3PX6 A;  2HNZ A;  2DY4 A;  2P9L A;  4JKG B;  5GAG P;  3NDK A;  3R1X A;  1T44 A;  4PA1 A;  1WAJ A;  3VES A;  3BY5 A;  1NK9 A;  4M3Z A;  3RSE B;  1BA0 A;  4AM7 A;  2PYL A;  4HUF A;  3OY9 A;  4J2E A;  1SAZ A;  1RTH A;  1A5X A;  3LP0 A;  4CJ5 A;  3P38 A;  1TYQ A;  3LPT A;  4CJQ A;  1VQL N;  2BTF A;  4LFC K;  3EE8 A;  2GUI A;  3MXJ A;  4FLU A;  4ELU A;  2E2P A;  3UE5 A;  3FZL A;  5BN9 A;  2GEL A;  4FWP A;  5TKW A;  2AJQ A;  5IWA K;  4KI4 A;  1ASW A;  4B9Q A;  3K9J A;  5ELZ A;  5HRO A;  2YV0 X;  1RDA A;  4M3X A;  1CLQ A;  3BP8 A;  2QWQ A;  1S1T A;  4KTW A;  3Q7C A;  3KD1 E;  3SCX A;  3A5M C;  3LAM A;  1U6Z A;  3L8B A;  4OO1 J;  3WXL A;  3MN9 A;  4CD1 A;  5AQL A;  4DR5 K;  3QIC A;  3ENB A;  4CJP A;  3D6R A;  1NMN A;  3I8D A;  2O8C A;  1D4X A;  4LH5 A;  4E7H A;  3IS9 A;  4ZTF A;  3ULE B;  1QQC A;  5K14 A;  3CC4 N;  5M1P A;  1XI1 A;  4JKD A;  2FBY A;  4BR0 A;  1HKG A;  1BOT O;  1QQN A;  3DLK A;  5ADX H;  2Q36 A;  2VG5 A;  3WXJ A;  4FW2 A;  4MDB A;  4IO8 A;  4IBN A;  5JLF A;  3MDQ A;  4M3U A;  1N33 K;  1A5W A;  4BRP A;  4NO7 A;  4GV6 A;  4NCA A;  3CPE A;  2DTU A;  1Q8I A;  2XRI A;  4CHO A;  4OVL A;  3VQ9 A;  4BDY A;  2Z1G A;  2D0P A;  3CJA A;  3SMS A;  3DLE A;  3S41 A;  1WSF A;  2HBL A;  3MX2 A;  3ID6 A;  1QVF M;  2NZT A;  4H0T B;  4O0I A;  1NK6 A;  1JKH A;  3T1Y K;  2VCP A;  4DU3 A;  2P5O A;  4F2S A;  4CF1 A;  4YOW A;  3MWP A;  1HYZ A;  5BPL A;  1LAW A;  2FSN A;  1N8R O;  5FRM A;  3OA9 A;  4WFN L;  3AA2 A;  4YOY A;  3JYT A;  2V51 B;  3CFR A;  5AQZ A;  3ZSZ A;  3CCQ N;  5J2N A;  3AO1 A;  3ITH A;  1GLC G;  2KFZ A;  3KKR A;  3SBG A;  1LV5 A;  4BQZ A;  1BWF O;  3AVI A;  2IVN A;  2UXC K;  4F4K A;  3C0B A;  3FFK B;  1TKD A;  3LDL A;  4DFJ A;  2V7Y A;  2HVH A;  3KWI A;  5AQJ A;  4EIA A;  3A2F A;  3AVH A;  5CYM A;  3HTV A;  2X78 A;  3SUP A;  3VQ7 A;  3VN5 A;  1L3V A;  2Q97 A;  1OH5 A;  4KI6 A;  2F7T A;  3P83 D;  4R79 A;  4B3T K;  1TV6 A;  1VQN N;  2G8U A;  4C1N I;  1ASU A;  4C8N A;  4JI4 K;  4KO0 A;  3R6M A;  4B1Y B;  4FYD A;  3TAG A;  4DTR A;  3OYK A;  4E1J A;  1P8Z A;  1RBU A;  3EN9 A;  1IBM K;  1N36 K;  1VSF A;  1C1B A;  5D3G A;  4F8R A;  3G4S N;  2F9W A;  3TSU A;  3FZK A;  4JI6 K;  2O8E A;  2YI1 A;  4O0J A;  1QSL A;  2QK9 A;  3DYA A;  1NGH A;  5BR9 A;  3HXM A;  4RTF D;  4DTN A;  1ZBF A;  3WEE B;  4IOC L;  1RDC A;  2IC3 A;  3OYD A;  1JJ2 M;  3CCL N;  3LDP A;  3HOS A;  4DUY K;  1HMV A;  3IMX A;  2P9I A;  2OCE A;  3KD5 E;  4H0X B;  3M8Q A;  4KHQ A;  2IOC A;  2X6N A;  4CBU A;  4RW7 A;  5SWM A;  3PUF A;  3AV9 A;  4DV1 K;  4BE2 A;  1KCF A;  3E9O A;  2V7Z A;  2OZM A;  5KPZ A;  1X9S A;  4FJX A;  1G15 A;  3J8A A;  4FWL A;  3R8E A;  3NMU A;  2HF3 A;  5CR4 A;  4CVN E;  2UXD K;  4IWV A;  5C12 A;  4DV2 K;  3CCM N;  1DKG D;  1T6D A;  5AZJ B;  3A5O C;  1RT1 A;  4B08 A;  4BDP A;  5AQV A;  1XNR K;  4MO5 A;  5C42 A;  1BA1 A;  1MWK A;  3VTI A;  4MO4 A;  2YNG A;  1EWR A;  2EHG A;  4O4G A;  2BH1 A;  3WNG A;  3OJS A;  5M1Q A;  2KLA A;  1KRP A;  3QO9 A;  5AQQ A;  4CGD A;  1IH7 A;  4CI6 A;  1U47 A;  1TKT A;  4H0V B;  1NJY A;  1HYV A;  2Q31 A;  4RW9 A;  4DFM A;  1VQ6 N;  4CEF A;  3SQ2 A;  1L3T A;  1KFD A;  2G8F A;  3VF4 A;  3QNO A;  4JKC A;  5BRE A;  1A5V A;  4M3Y A;  2BAN A;  2HNY A;  2QTD A;  4NCB A;  1MWM A;  4DQS A;  3RMA A;  4RW6 A;  1X1P A;  1NBW A;  1KAZ A;  1BO5 O;  4RCH A;  1XNQ K;  1JLQ A;  2DFE A;  5KRS A;  3K58 A;  3CMA N;  1GOC A;  4Z4I A;  2O8F B;  2E1Y A;  4CE9 A;  4C23 A;  3HJF A;  4G9Z A;  2HHV A;  3SAH A;  1M1K O;  1HNV A;  1S1V A;  4G1Q A;  3AAR A;  1WB9 A;  4KHU A;  4HTU A;  2Q1N A;  4CEZ A;  5BPM A;  3P1G A;  3KLE A;  3A8Y A;  2A40 A;  4B9V A;  3HVT A;  4DR7 K;  5C2D A;  5M1N A;  1C0F A;  5J2M A;  1RTD A;  5AQF A;  4JD2 A;  5EVZ A;  3TWH A;  1H1V A;  1ZBI A;  2QEX N;  2P9N A;  2P5G A;  2P9K A;  4FWS A;  3P31 A;  2HBJ A;  3ZT3 A;  1NK7 A;  2VYP A;  3E1Y A;  3T7Z A;  3C6A A;  2HMI A;  4FWR A;  3TTC A;  4DUZ K;  3QBW A;  4B9S A;  4WQ5 C;  1WBD A;  1YHQ N;  2OPQ A;  3ZET A;  3S3N A;  4FZY A;  4EP4 A;  1J53 A;  3WNE A;  3RR8 A;  1JL1 A;  1BQM A;  3KTQ A;  1MDU B;  4M42 A;  3VQ4 A;  3OS0 A;  1GLA G;  1R0A A;  2W42 A;  4PL7 A;  1XC9 A;  1FKP A;  2P9S B;  3NF6 A;  4BC2 A;  4ILG B;  2I7P A;  3W3D A;  4I9Q A;  3H6E A;  3I0S A;  3MN5 A;  1YF5 L;  2E6M A;  3CCU N;  3P4I A;  3V1O A;  4W5O A;  2XY5 A;  3QML A;  2XY7 A;  2PYJ A;  4BWJ A;  4AHT A;  4YOV A;  1TL3 A;  1B9D A;  2FSJ A;  4FJK A;  1YJ9 N;  3ZSO A;  3SUN A;  2A41 A;  4CJL A;  1QHA A;  1HR0 K;  4EHT A;  4CD3 A;  4H0P A;  4HCC A;  3L2U A;  3L3V A;  4CJF A;  4HHT A;  4RG8 A;  1CZA N;  3AVM A;  3VTH A;  3DLH A;  4FZX C;  3LAK A;  4JK7 A;  3H3N O;  3O5B A;  3T1A A;  3IAY A;  4M7X A;  1HUX A;  3GBT A;  3MCA B;  4JI1 K;  3FZM A;  4X62 K;  3KIO A;  3TPQ A;  1QHT A;  4H8K A;  1K8A O;  4ISF A;  5B8H A;  3LZI A;  4EHU A;  2P1J A;  3O1B A;  3VEW A;  4ILH A;  3SK3 A;  4YDU A;  2QI2 A;  4MDA A;  4YOU A;  3C65 A;  5AQY A;  3TAF A;  2RHK A;  1YJN N;  3L6Q A;  2F8T A;  1M90 O;  3HP9 A;  1S6Q A;  1EX4 A;  1P90 A;  4ZHR A;  1UA1 A;  3UB5 A;  2HW3 A;  5C25 A;  4IXC A;  4A62 A;  1LWF A;  3O8M A;  4BRE A;  4LF4 K;  4HWI A;  1NNE A;  3DRS A;  2PBD A;  5HP1 A;  1WOQ A;  1RT2 A;  4FSV A;  1ZXO A;  3D2F A;  3QEP A;  1U4B A;  4BAC A;  4BGB A;  5HRR A;  2QA4 N;  2W6K A;  3CM5 A;  4GKJ K;  2ASO A;  3RRH A;  4BRC A;  5LMU K;  4CF0 A;  3IG1 A;  4KH5 A;  1I39 A;  2NRX A;  2D0O A;  4CED A;  3G6E N;  3BDP A;  4ELT A;  3F9M A;  4FJ9 A;  3RRG A;  3U4L A;  4F2R A;  4FJL A;  3BEX A;  3AO5 A;  4QS7 A;  4WCE L;  3D45 A;  3S3O A;  1QS4 A;  3K0S A;  1LW0 A;  5AQI A;  1RT4 A;  1BUP A;  1KVC A;  1S3X A;  4QS9 A;  4DQR A;  2E5L K;  3R9P A;  3A5L C;  3WT0 A; 
#chains in the Genus database with same CATH homology
 4DV4 K;  2UUB K;  1N34 K;  4OX9 K;  4LF7 K;  4NXM K;  4DV0 K;  4X64 K;  5BR8 K;  1XMQ K;  2UU9 K;  3J81 O;  4AQY K;  4DV6 K;  1HNX K;  4JV5 K;  4B3T K;  4LF8 K;  1HNW K;  2HHH K;  4DR5 K;  4DR1 K;  4DR2 K;  4X65 K;  1HR0 K;  4JI4 K;  2VQF K;  1XNQ K;  4KHP K;  5LMN K;  3OTO K;  4JI2 K;  1IBM K;  1N36 K;  4B3R K;  2UUC K;  4JI5 K;  4JI1 K;  3J7Y P;  4JI8 K;  4B3S K;  4X62 K;  4YY3 K;  5LL6 Z;  4JI6 K;  5FLX O;  5AJ3 K;  1FJG K;  1N33 K;  4DV7 K;  3J80 O;  4K0K K;  3J7A P;  1I94 K;  4JI3 K;  2ZM6 K;  1XMO K;  4DR3 K;  4LFB K;  4DR7 K;  4DR4 K;  4B3M K;  1IBL K;  4DUY K;  4JI7 K;  4YHH K;  5A2Q O;  4LF4 K;  4NXN K;  4JI0 K;  4DV5 K;  1HNZ K;  3T1Y K;  4DUZ K;  4DV1 K;  2F4V K;  4GKJ K;  2VQE K;  2UXB K;  4CW7 B;  5LMU K;  1N32 K;  4LFA K;  4V19 S;  3T1H K;  1IBK K;  4LF9 K;  4CVN E;  2UXD K;  2UUA K;  4DV2 K;  4JYA K;  4LFC K;  5IT9 O;  4GKK K;  1XNR K;  4DV3 K;  4LF5 K;  4DR6 K;  4X66 K;  5IWA K;  1J5E K;  2E5L K;  4LF6 K;  2UXC K;  3JAM O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...