2VG7A

Crystal structures of hiv-1 reverse transcriptase complexes with thiocarbamate non-nucleoside inhibitors
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
550
structure length
544
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of HIV-1 Reverse Transcriptase Complexes with Thiocarbamate Non-Nucleoside Inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords REVERSE TRANSCRIPTASE/RIBONUCLEASE H
total genus 137
structure length 544
sequence length 550
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2007-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2vg7A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2vg7A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2vg7A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2vg7A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2vg7A05
4HUFA 2AGPA 2BQUA 1I6JA 4K4TA 1X1PA 3PW7A 5KG2A 4NLSA 3M9OB 4DSKA 1S6PA 4NLVA 3V1OA 3F9KA 3FFIB 5KFSA 2BE2A 3KHHA 4TSXA 3AO5A 5CY4A 4OLBA 4KPYA 4CF2A 3E01B 3LP2A 2RDIA 4EZ9A 2R2SA 4FLVA 2VG6A 2JLEA 4CFBA 4M41A 2ILZA 2VG5B 2B4JA 1T03A 3T5KA 5HP1B 4M3WA 2FLPA 1DLOA 3M8QA 2W7PA 2D0BA 4FVMA 3MECA 1KSPA 2V4RA 1VRTB 1NOZA 4FJLA 5L1IA 3OYCA 1RILA 4FM2A 1RT1B 3KK1A 4TQRA 3BSOA 1IM4A 4DFMA 2ZD1B 4B8CA 2G8UA 2O4GA 2JEFA 1JLGB 2ATLA 4ZVEA 3VA0A 1Z25A 3HSTB 4IH6A 3QNOA 1N6QA 5CYQA 2FJWA 3CDUA 4YQWA 3QLHA 3SUNA 1RT7B 4KAIA 4PWDB 5KG7A 4IKFA 2V4QA 4AILC 5JXSA 3EZUA 2BRLA 3NH1A 1LV5A 3PX6A 5J1EB 4R0EA 5HLFA 4KBIA 1TKZB 3L8BA 3M8QB 4RW8A 4ZP6A 3RRGA 4ZHRB 4ECXA 1TKTB 3ZT4A 1KVAA 4Y2AA 5T14A 4CJQA 2O5DA 3FDSA 1JL2A 4FZXC 3OYLA 1DTQA 2FVPA 2BQ3A 3SZ2A 2AWZA 4AHSA 4DQQA 2I1RA 2JEGA 1QUVA 3GV7B 2HB5A 1JIHA 5K14B 4Z0UA 4XO0A 4J9LA 3DM2A 4DQPA 2D3ZA 1VSDA 1KRPA 3L3VA 3LAKA 1Z4UA 2HNYA 4K4XA 1RBVA 3MFIA 4TY8A 3ZT3A 4J2DA 3VQBA 3DMJA 2IM3A 4ZVHA 3AA4A 4B9SA 4OGCA 4EP4A 1RA7A 1S0NA 3KIOA 4KE5A 5KFVA 4I2QB 2YKMB 5JS2A 4CJ3A 2FVCA 5KG1A 4BDPA 2RN2A 4J9QA 3RAXA 2IJFA 2J6UA 4RNNA 4DG1A 1FK9A 4DL7A 3K5LA 1WNSA 2R8JA 4KAZA 1IH7A 5EWEA 4EBCA 1S9FA 4B9NA 5L9XA 4FJGA 2D0AA 3AVMA 4DU3A 4OKEA 1BHLA 2YNIB 3ZCMA 1S0OA 1S6QA 2HWHA 2HHSA 3AVKA 5FRNA 1SUQB 2JC0A 5CZ1A 2HHXA 4OGEA 1KTQA 4CFDA 4F4YA 2HHWA 1WLJA 1ASUA 1S9EA 1NKCA 3DOKB 2VA2A 1LWFA 1N5YA 3ITHA 4CJEA 3DLGA 4CJUA 4QWAA 2ZE2B 4MH8A 4TN2A 2GV9A 3H2LA 2BDPA 4I9QA 4CGFA 5KTQA 3HKWA 3C94A 4Z4IA 3NAIA 1VSJA 3KOAA 1F21A 1C0TA 3C6TA 4DSFA 3OL9A 3LZIA 4MK9A 2ASDA 4CHNA 4IRDA 2IA6A 3OSPA 2V9WA 4F2RA 4ECVA 4UQGA 4YMEA 2XGQA 4HUEA 3BJYA 1XR5A 3PW5A 1N56A 2B6AA 3DRRB 1T8EA 1SH0A 4DEZA 2DFHA 2HMIA 3ZT2A 4B9LA 4DWIA 4IFYA 1YVUA 3LP2B 4I7FB 3D5MA 4LY7A 1RTIA 4ZPCA 2IAJB 3RBDA 2WB4A 3OY9A 3OSNA 1R0AB 1LW0B 1S1UB 3M8RA 2ALZA 1NKEA 4Y3CA 2C22A 3V1QA 3AVGA 3RWUA 3OYNA 1D5AA 1JL1A 3KJVA 4LH5A 1C6VA 3K5MA 2BANA 5HROB 2YNHA 4QPXA 1SL1A 3LP0B 1JX4A 4FM0A 2RF2B 4FJIA 3QEXA 4FM1A 4LQ3A 4MK8A 3SJJA 3V9ZA 2WOMB 2IOCA 3ITHB 2JGUA 2XGPA 4JV2A 3KK1B 2P5GA 3DLHA 5HBMA 3QYYA 1N4LA 3S3OA 4NYNA 3NH2A 4FW1A 4NLXA 1C1BA 3EY1A 1U47A 1T3NA 4DTSA 1SUQA 2IC3A 1L3TA 3RMAA 3C6TB 3T19A 4R5PA 2FBYA 3GV8B 1HNVB 1WSGA 5KFIA 1U09A 4IFVA 1WAFA 3BREA 3KLFA 3ZSZA 2VG5A 1SL0A 4DLGA 3O4NA 4DQSA 5SWMA 1LWEB 4K4VA 3TQ1A 1T05B 1ZTWA 1TL1B 1X9MA 1TV6A 4O0IA 4Y1CA 3I5AA 1JXLA 3SI6A 3GIKA 1HARA 2YNGA 3NGDA 2C28A 5JS1A 3SNNA 4L8RB 5KG6A 5KFKA 2XI3A 4PQUA 2IC3B 1UA1A 4CJLA 4KHSA 3DLKA 3FRZA 4CEZA 3HVWA 3QEPA 5KFBA 1T7PA 2FVRA 3H5UA 4FS2A 3MXJA 2AGOA 3ZSRA 3CM6A 2JC1A 4O3RA 2R8HA 4W5RA 4IH7A 4WFXA 3QIPA 3SYZA 4E7JA 3G6YA 2OPPA 3VQ4A 1DTTA 2UUWA 1RTDA 3OLBA 2YKNA 2HVHA 2G8FA 3JSMB 3AVJA 3DYAA 3RR7A 1CLQA 2C2EA 4IBNA 4FJMA 4ECTA 2CJQA 4NLPA 3MAQA 4JRQA 1KLMB 4E0DA 2NUBA 4B08A 3AA2A 1MMLA 1MU2B 2DFEA 4ZPAA 1VK0A 2A1SA 4FJHA 4N47A 2HWIA 4FBTA 2ASJA 3NL0A 4M3UA 3U3YA 2YV0X 2QXFA 2HHQA 3L2RA 2W7OA 4MIBA 2YKMA 3SUOA 4E7HA 2BE2B 4KB0A 4IDKB 3ISNC 2B6AB 5J1EA 1RT2B 3Q8PB 3E51A 4DTPA 2Z1JA 3KLEB 3V6HA 4KI4A 1FKOB 3LPUA 3H40A 1RT5B 4FK4A 3QINA 4PQUB 4F4KA 4RW4B 4J2EA 2XI2A 3KLHA 3OYKA 2O4IA 3PZPA 4EBDA 2E6MA 1IKWB 3QERA 3ZSWA 4NLGA 1LWCB 2CKWA 1VRUB 4NLTA 1TQLA 3DLGB 4GVMA 3OYEA 4B3OA 5EWFA 2OH2A 5F8IA 4QW9A 4O5BA 4H4OB 4FS1A 4O3NA 5KG3A 1KCFA 3VQ7A 1RDCA 1LAWA 1UAXA 4KI6A 4O4GB 4O0JA 3H98A 5KFGA 3ZSQA 3LWMA 4CHYA 1JXEA 1KHVA 3RAQA 4PWDA 3UPFA 1S9GA 3H59A 3KMQA 3UIQA 2VG6B 1RT2A 3BQ2A 1RTDB 1S4FA 4KB7A 1LAVA 2XY6A 2G8KA 3DRRA 2OPPB 4G3IA 4CGDA 3VQEA 2PY5A 4FXDA 4F3TA 4Q8EA 3NF6A 1WSEA 1BIZA 3CQ8A 5DMRA 5HRSA 2R2UA 1ZBUA 3AVNA 4NCAA 2AQ4A 2JEIA 1HYSA 3L2QA 4DLEA 4NLRA 1EX4A 4NRUA 4X2BA 3I8DA 1B9DA 1HNIB 2OYQA 1U48A 4K4ZA 5K14A 1ZBIA 3MEGB 2IM0A 1S1TB 5L1KA 3ASMA 4YFUA 3DDKA 2XO7A 3TARA 4Q8FA 4TLRA 3OVNA 4FLTA 3G10A 3DRSB 4CHZA 4FJ7A 3VQ6A 1D0EA 1VRUA 3V81A 3C6UB 1VSEA 4URGA 3DLRA 3NAEA 4PA1A 2KZMA 4RW7B 2W9BB 2IJNA 3EZ5A 1HNVA 3KHLA 3TI0A 3P1GA 4LQ9A 4WFYA 3HJFA 3OHAA 3MEEA 4O3PA 3O3GA 3M9NB 1J9AA 2Z1IA 3T5JA 1ZYQA 4RW9A 1QHTA 3MXMA 5HBMB 4OVLA 4DF8A 3V6KA 4EZ6A 4DFJA 1J54A 4ECUA 3CJ3A 1BQNB 2QE5A 1QE1B 3DLBA 1SV5A 2A1RA 3SPZA 3LANA 4LH4A 5C42B 2RF2A 3N6NA 1RBSA 4NLOA 3C6UA 3KNAA 2AGQA 4KHRA 2R8IA 3DOKA 1ZBLA 2WTFA 3QIDA 3CYMA 4DU1A 4CJWA 2HNYB 1IKYB 3SI8A 2R8GA 4WE1B 3MEDB 4CHPA 3G0ZA 4R5PB 3OJUA 3NMAA 5C25A 4KHMA 1EXQA 3JSMA 4TQSA 3P5JA 2IMWP 1ASWA 2ITGA 3I0RB 1ZTTA 5KRSA 4NCGB 5KFAA 3VQQA 3RBEA 4JV1A 4FZYA 4ICLA 3GQCA 3KTQA 5KFYA 2QK9A 5D3GB 5J2QB 2XRIA 1QE1A 1REVB 4MFBB 1JLAB 4M3TA 4RW4A 1Q9YA 3K5OA 1QSLA 1XR7A 4FBUA 3HXMA 1TK5A 4DL3A 2W9AA 4CEEA 3M9MB 1N48A 2FBTA 3QZ7A 3NGZA 3TAPA 3PX4A 4N76A 3HHKA 3MECB 2OZSA 4DTRA 1TV6B 3K2PA 3AVLA 3BQ1A 2BANB 5I3UB 3T5HA 3K5NA 2OPRA 4RZRA 1NJYA 2ASLA 1QTMA 3SFGA 1KVCA 4F8RA 1Q9XA 3OYHA 4JRPA 3VQPA 4CEDA 1TKZA 4NLWA 4J9KA 3JYTA 4J9MA 4DL6A 4HHTA 1WNEA 3U6FA 1SKRA 2Y1IA 1U45A 4KTQA 1CXUA 5J2MA 1IKYA 1D9DA 5DK5A 2FJVA 1U04A 3PV8A 2UVUA 3CJ5A 4J9RA 5KI6A 1Y97A 1QAIA 4N5SA 4N41A 1C0UB 1IKWA 3HT3A 1U49A 3NE6A 4FJXA 1C1AA 3V1RA 3TAMB 2HVIA 2X6NA 4LD0A 3S3MA 2VA3A 2BGGA 2IGIA 1W25A 4DTXA 3DM2B 1Q8IA 3RMCA 5KFPA 1HRHA 1ASVA 4MFBA 2F8EX 4FJKA 1A5VA 3NF7A 1LW2B 4E89A 2DY4A 3GIJA 3AVCA 5KT7A 1VSMA 5I42A 2ZQBA 4MKAA 4EO6A 1TL1A 2W42A 1SH2A 3RRHA 1RYRA 3PW4A 4NYZA 1BCMA 3CFPA 2OPQA 4O3QA 4Q44A 1RTHA 1CXQA 4B8AB 3QEIA 3V9UA 1QSSA 1A5XA 3SUPA 4Z4EA 2BRKA 2FVSA 3DMJB 3BSNA 3ULDA 4YR0A 3KLGA 1HQUA 4WYWA 5F9LA 3SCXA 4CESA 3NF8A 4YP3A 4Q45A 5KFHA 3HVTB 4ZPDA 1QAJA 1J5OB 3VQCA 1RDBA 4YR2A 2RKIB 1JLCA 1JLBA 4IRCA 1TKXA 4QOZB 1I3AA 2OA8A 4ID5A 3OL8A 4N56A 1YT3A 4KHWA 4LSLB 2IDOA 3TVKA 3GIIA 4KB1A 3HM9A 2F8TA 2WRMA 3BSCA 4CHOA 2EX3A 2XCAA 4Z4GA 4NLDA 1QSYA 1IKXB 5CYMA 4DSLA 1HQUB 4ELUA 4RW8B 3MEEB 1KLNA 3HP9A 4QWBA 5DLFA 1TKDA 1LW0A 4CGIA 3PUFA 2OPQB 3M8PB 1NOYA 1S48A 4JV0A 2PYJA 2FVQA 1DTQB 2E9ZA 4EEYA 4ID5B 3QETA 1WSJA 4CEFA 4I9LA 5I42B 1JLQA 2HNDB 3QO9B 4FW2A 4CERA 3LP0A 1JLGA 3RMBA 3NBPB 3KMSA 4E1NA 2RDJA 1GX5A 2B5JA 3RB3A 5KFWA 1GOCA 3TR8A 4ED2A 4EYHB 3KLVA 3HPOA 2HHTA 4FLZA 1XI1A 1L3UA 3KLEA 2FLLA 3QLHB 3SQ4A 1RT3B 1RT6B 5CYQB 4DL4A 4TYAA 1NK4A 3H5SA 3PO5A 4C8KA 1IKVA 3QNNA 5KFDA 4ICLB 1ZBFA 2ZD1A 4CEBA 3AO2A 1C0MA 1GX6A 1S9GB 5F8LA 4FJ9A 4JUZA 4XPCA 2WHOA 1KFSA 4HCBA 3UDLA 4ZHRA 4WXOA 5E41A 1EKEA 5DQIA 4QWDA 2ETJA 3MEGA 3T5LA 2OPSA 2WK4A 5DG7A 5KFRA 2D41A 1RT5A 3OYIA 2UVWA 1D9FA 4R8UA 1IKXA 2DPJA 4AHVA 4RUAA 4NCBA 2HNZA 2G8VA 2W9CB 3SQ2A 4OLAA 3E01A 1BIUA 4RG8A 4OJRA 1XHZA 1NHVA 3HPHA 3SUQA 2JEJA 1HPZB 2R2TA 3ALYA 3AV9A 4KKOA 4F50A 3AO4A 2R2RA 2VG7B 1IO2A 4IG0B 4K8ZA 4ZP7A 3VA3A 3U3GA 4KHUA 3NKYA 4DTJA 3V9SA 1XHXA 3HK2A 4M95A 4FJ5A 4Y2CA 2AX1A 1Z26A 1BL3A 1RCHA 2KQ2A 3NBPA 2YNFA 4ECQA 5HP1A 3WNEA 1RTHB 2C2DA 4BE1A 4GMJB 1T03B 3ZT1A 4OKKA 2X78A 2PYLA 3V81B 4J9OA 2WCXA 4CF1A 4URSA 1FK9B 3OJSA 3OYAA 3V6DB 3MFHA 4URQU 4CK3A 3QIPB 5HRRA 4F2SA 1K1SA 1HQEA 1NK0A 5C24B 3H5YA 4FJNA 3EPGA 4H4MB 2E6LA 3D28A 4FJJA 1HNIA 4K8XA 4FLUA 4WE1A 3LP3A 2E9RX 3CM5A 3LAMA 4W5QA 3OHBA 3ZSXA 3KD5E 4LSNA 1GOBA 3RMDA 4CJSA 1W9HA 4CEAA 1G15A 4AH9A 4IDKA 3L3UA 4KTWA 1SH3A 5DQHA 4JS4A 1XR6A 5KFUA 2HHUA 5KFQA 5HRNA 4TY9A 3OYMA 2RKIA 4OPJA 1QQCA 2W9CA 1TK8A 1W0HA 1LWEA 4CJ5A 3CDEA 3TAEA 4F4ZA 1JXBA 4W5OA 4IR9A 3ZSOA 1TAQA 4BWJA 3SQ0A 2IBKA 3IRXB 4DFKA 3KLGB 4DQRA 4DF4A 4AHCA 5C25B 2YHAA 2I5JB 4GW6A 2OPSB 5KFMA 4FLYA 1BQMB 4ED3A 3CJ2A 2GBZA 4CF9A 4DU4A 4IG0A 3G6VA 4CJKA 3VQDA 2OPRB 4CHQA 2GIQA 1S1XB 3PO4A 4DS5A 1YVFA 4ELTA 2WOMA 3S9HA 4J2BA 3Q8SB 4FYDA 1NKBA 4RU9A 3D45A 2FJXA 3L2VA 3KK3B 2J6TA 5KT4A 4CIEA 4WYLA 4FLXA 1NK8A 1TAUA 3AVHA 4KHYA 2PZSA 4AHUA 2OZMA 4CEQA 3CFRA 4OKJA 2ILYA 3AA3A 4ECSA 3BQ0A 4ED0A 4TXSA 5EDWA 1NJXA 3NGIA 1N6QB 3C95A 1SKSA 3FQKA 5J2QA 5F8HA 1C2PA 1B9FA 2KZZA 1S1WB 5FRMA 4DSEA 4M3RA 3MXIA 4B9TA 4HCCA 2F8SA 1NNDA 5KFNA 4RNOA 4O3OA 4IKAA 5J2MB 3NDKA 3HO1A 3PR5B 2HHVA 5KFJA 4K4WA 4ECWA 4G1QB 3IGVA 3KLIB 1UWBB 1JLFA 4KO0B 2IM2A 3PJWA 5DGAA 2R8KA 5KG5A 4RNHA 3TABA 1VSIA 5EUHA 4F4XA 1NJZA 2ZKUA 4YR3A 3Q8RB 3S3NA 3SQ1A 5I3UA 3K58A 5KRTA 4QW8A 4NLUA 2Q3SA 2HW3A 3MR3A 5KFLA 4ECRA 4BE0A 2XWYA 4ECYA 1S6PB 2ZE2A 5F9NA 3PW0A 3VQ5A 2DFFA 3RTVA 4PY5A 4ZVGA 5DG8A 4ED1A 4CGGA 2P1JA 5CZ2A 4ED6A 4RW9B 1RTJB 3IG1A 1MU2A 5KFZA 5KFOA 3M8PA 3FSIA 1JLFB 4KO0A 3H4BA 1RAJA 2RPIA 3VQ8A 4K4UA 3I0SB 2VWKA 3KK3A 4G1QA 1S6QB 1C0TB 5DLGA 2ATQA 1RTIB 4RW7A 5C5JA 2W9BA 1JKHA 4I7FA 5KFCA 3WNFA 3V6DA 5JUMA 4NCGA 1S1XA 5F8MA 3RB6A 3DI6B 3AO1A 1JLEA 3LP1B 2HAIA 3BDPA 3THVA 3ZSYA 3LPTA 1BCOA 4CF0A 4KSEB 1TK0A 4FCYA 5KFTA 3B6OA 2BR0A 3AVBA 2UVVA 3HL8A 5DQGA 4Z4FA 1C1BB 2XC9A 2DTUA 2KW4A 4KV8B 1TL3A 3NAHA 3OS2A 4MKBA 2FLNA 5C24A 4CFCA 4DG1B 2XCPA 4DSIA 3VN5A 3PR4A 1TKXB 3TANA 3SPYA 3OYJA 4Z4CA 1S10A 1BISA 4BACA 1FKPB 1D1UA 1S97A 1RDAA 4M94A 4XPEA 3LDSA 4IG3B 3AVAA 2GIRA 4LSNB 3HVTA 2UUTA 4IFVB 4ED8A 2QV6A 3N6MA 1BI4B 3PX0A 1L5UA 3CJ4A 4M45A 3JYTB 1D8YA 3KLIA 1VSHA 5HLFB 4OL8A 4BDYA 1S1UA 3MEDA 4Q43A 3CG7A 1UA0A 1RTJA 3V4IB 4E1MA 4H4OA 3CO9A 4DFPA 3NH0A 3IAYA 4F3OA 1NK9A 3DRSA 1U4BA 3K57A 1FKPA 3H08A 2G8HA 1HYZA 4CF8A 4RNFA 1ITGA 3VQAA 3ZSVA 3V6JA 4ZP8A 1SKWA 3AVIA 2D7SA 3IGNA 4HUGA 4DQIA 1NHUA 4FK0A 3IG1B 3GYNA 4O55A 1FKOA 1BGXT 4NYFA 4ZTJA 3HPGA 4QWEA 2E4LA 4Y34A 3N6LA 4FZZA 2IM1A 4CJ4A 2Z1GA 5T7BA 4PUOB 1RT4A 4ZP9A 4DTMA 2BQRA 1NK5A 2KTQA 3WNHA 1TVRA 3EPIA 1WSFA 4M42A 2HNZB 3OS1A 3CWJA 4J9NA 1RT1A 4IOBA 3QGHA 3V4IA 4NLYA 1L3SA 4M3ZA 3FFIA 4KTZA 4MQ3A 3O3FA 3VQSA 2W8KA 4I2PA 1VRTA 1WAJA 4EP5A 4MIAA 3H4DA 3DYAB 4U6PA 2IAJA 1RDDA 2GUIA 4B9MA 4DTOA 3PVXA 4M3YA 3RR8A 4EYIB 3M8SA 3GIMA 2YHBA 4CJFA 3NFAA 1TVRB 5KT3A 4K4YA 1REVA 3OYFA 3SV4A 5D3GA 3WNGA 5L1LA 3KKRA 4PUOA 4DMNA 5HROA 3O4QA 3KLHB 4ZVFA 1BQNA 1RT6A 3MTKA 3FQLA 4CGHA 3F73A 3CDWA 2P5OA 4HKQA 3QEVA 4KREA 1RDRA 3OYDA 1K1QA 4JLHA 3G86A 1WN7A 1CZBA 4IH5A 1A5WA 1NK6A 3ICLA 1CSJA 1NJWA 2FC0A 5J2NB 1RBTA 3OYBA 1K6YA 4DSJA 4DS4A 3BGRA 3CIZA 4NLQA 4W5TA 4E3SA 3IS9B 3LWLA 3NF9A 3QIOA 1S1WA 2KFNA 2XY8A 4LSLA 5KFEA 1LWCA 1HYVA 4C8OA 1YTUA 1WSHA 1HMVA 3KLFB 2WONB 3NCIA 1RT4B 2V0NA 4J9PA 1C1CA 1JLCB 3DRPB 4W5NA 3KK2B 2YNIA 4CFAA 4HYKA 3UR0A 1KVBA 1YTAA 4QCLA 4DL5A 4CJTA 3IN5A 3BSAA 4IG3A 4JS5A 1L3VA 3GV5B 4ZMMA 3QO9A 1OS5A 4FK2A 1I39A 2WONA 2AJQA 4TYBA 2D5RA 3NHGA 5KT2A 5KGWA 4B9UA 4IQXA 3I0RA 4NZ0A 4J2AA 3KD1E 3TAFA 4WZMA 4ZTFA 4O44B 3DOLB 3AA5X 4XIUA 1BQMA 3A2FA 1S5JA 3HP6A 4CK1A 4O4GA 2I5JA 3LZJA 2AU0A 1QS4A 1NK7A 5F8GA 3P83D 1S1VA 3I5BA 3RB0A 1HYSB 1UOCA 4EBEA 3DI6A 1T05A 3TAMA 4QAGA 4GC7A 4CGJA 4CIFA 1DTTB 2IS3A 1RA6A 5C42A 2HMIB 1HJRA 4DTNA 4Q5VA 2G8WA 2YNFB 4O4RA 1C0UA 1GOAA 3UQSA 4M3XA 1IG9A 3PHEA 5L1JA 2AX0A 4U7CA 4C8MA 3V9XA 3QGGA 5J2PA 3NGYA 2QKBA 5FROA 1RT7A 4CEOA 5KG0A 5FDLA 2P51A 2D0CA 2Y1JA 3QGIA 1EETB 5EWGA 2YNGB 5KGXA 1DLOB 4HVJA 3LP1A 4KFBB 2KFZA 2YNHB 4RW6B 1TP7A 5KT5A 2C2RA 3KJVB 3GILA 4K4SA 5F8JA 3MR6A 1JKHB 1RNHA 1LW2A 4R8UB 5KG4A 3MR2A 2Z1HA 3DLEA 3T3FA 4RUCA 3I0SA 1KLMA 4WZQA 2E9TA 1O1WA 1R0AA 3QZ8A 4IR1A 4ID1A 4B9VA 3LALA 2VG7A 3ZT0A 3DOLA 4NRTA 1TGOA 2LSNA 3CFOA 4KKOB 1RBRA 4IFYB 4E7LA 3BR9A 1HPZA 3PJXA 1S49A 4HTUA 2XY7A 4CJVA 2B43A 3PY8A 4CIGA 1KFDA 4Y1DA 2VWJA 3G6XA 3VQ9A 4CECA 5SZTA 3QEWA 1EP4A 3OL7A 1JLQB 1IKVB 3RB4A 4I2QA 3OS0A 4BWMA 4ED7A 3L2UA 1EETA 1LWFB 4J9SA 3QESA 1J5OA 3I5CA 5FDLB 3PW2A 1SL2A 3AO3A 4YNQA 1S1VB 1T94A 4RNMA 1VSFA 1XC9A 4KHNA 3KKSA 1FXXA 4H4MA 2FBXA 1JLAA 4I2PB 4H54A 4OPKA 1KHWA 5DGBA 2X74A 4H8KA 3DLEB 2DPIA 3KHRA 5CYMB 3TAQA 2HNDA 2EC0A 1HMVB 2R7YA 4F4WA 4B3OB 3MR5A 1N5YB 4MK7A 4GC6A 4FJ8A 5KFFA 3B6PA 4WXWA 1X9WA 1B92A 1S9EB 4RW6A 4Q0BA 3H5XA 4KFBA 4FLWA 3L2WA 1WSIA 1TKTA 3EYZA 4AHRA 5J2NA 2FBVA 2G8IA 4K50A 4E7KA 1RT3A 4KRFA 5EU7A 4QWCA 1CZ9A 4TY8B 1RBUA 1J53A 1VSLA 4KHQA 5J2PB 3IRXA 2X6SA 1TL3B 1ZBHA 1RYSA 3DLKB 2YKNB 4DL2A 2B5JB 4ELVA 3V9WA 4CJPA 5KFXA 3AVFA 2D3UA 1JLBB 4BE2A 4E19A 1JLEB 4Q0BB 4AHTA 4CE9A 3IS9A 3OL6A 3O3HA 3SV3A 3BGRB 4WFZA 2J6SA 3K59A 4KV8A 3MF5A 1S0MA 3TAGA 2EHGA 4C8NA 3KK2A 1S1TA 3DRPA 4CK2A 3HVRA 2QKKA 2XHBA 1UWBA 4C8LA 1HQEB 2UVRA 3OLAA 1C1CB 1BI4A 4EO8A 4CCHA 5DG9A 4IRKA 3T1AA 2W8LA 4CJRA 3TWHA 4O44A 4ECZA 3SFUA 5HRPA 3D0PA 3KHGA 1X9SA 3OYGA 4O3SA 4Z4HA 5KT6A 3Q8QB 1ZETA 3ISND 3HVAA 1XWLA 1VSKA 4DTUA 3HYFA 3CVKA 2GC8A 1EP4B 1SV5B 3CJ0A 4BDZA 2XY5A 2F96A 5F8NA 4ZPBA 4E7IA
chains in the Genus database with same CATH superfamily
1CJVA 1M5PC 1QQMA 5LSOA 3THWB 1I6JA 3GWCA 2V2KA 3MPWA 3P31A 2MGZA 4NLSA 4BRAA 1GTEA 1H73A 3Q22A 3V1OA 3F9KA 1B70B 4WK1A 3KHHA 2HOEA 3W8PA 3AO5A 3LP2A 1BU6O 1PAEX 3GE9A 2KXFA 5DDPC 1S7HA 2JLEA 5HL7L 2VG5B 2W2MP 3QRQA 4JI0J 1HL6A 4ZITA 1PC4A 3AAWB 2V4RA 2FC8A 1VQKN 3L95X 4DBQA 4DUYF 1FDDA 3G96A 1YVNA 3VF0B 2HVEA 4FO0A 3GBTA 4WQ4A 2E5LJ 1Z25A 1VQ7S 4LBHA 2O67A 5CYQA 1KP6A 4GVBA 2UUCJ 4ETZA 3L7OA 3LA0A 2AYGA 2V5HG 5M1KA 4F26A 2BRLA 4BQZA 3NMUA 2YHWA 4KBIA 1TKZB 3S6EA 3M8QB 4EFHA 3E1YA 1DAXA 4LF6K 3RRGA 4ZHRB 4TU8A 2J9DE 2P5VA 2QC3A 5T14A 1PYSB 4XDCA 3J7AP 5D4LA 4FZXC 1S4EA 1VAZA 3TR5A 3SZ2A 1RDWX 3FSYA 2APOA 1RWWB 2AWZA 1MG7A 4AHSA 2I1RA 2JEGA 3ADAC 4YOTA 2NSCA 4Z0UA 4FP9A 4OHWA 3CCSN 2UXCF 3DM2A 4PG4A 4JYAJ 1GTHA 4DQPA 1NSPA 2HZCA 3LAKA 3AXMA 2K3IA 1RBVA 5AQWA 3AA4A 1CJKA 3HHLC 2J7WA 3CCQS 1S0NA 3BF3A 3VGTA 4DR1J 1N34J 4I2QB 2YKMB 3JTOA 2V63A 2FVCA 4MDAA 4J9QA 1FXLA 4I69A 2J6UA 1HBUB 4FXVA 1IH7A 5AE2A 1QHAA 4JI6J 2CQIA 2CQ0A 4A8MP 4B9NA 1ZBTA 4FJGA 1BHLA 4M63C 4CLSA 3BUZB 1S6QA 3QRPA 2HWHA 3A0IX 3BKFA 1RHQB 1BQXA 5HL7Q 1U25A 4V19J 4BC2A 1FRIA 1Z6RA 4X65J 1VQSA 3HF5A 1NKCA 3DOKB 5C12A 4J37A 4JV5J 1LWFA 3ITHA 4CJUA 1G6BA 4QWAA 3NNAA 3E8OA 4MH8A 2GV9A 3TTCA 3F5TA 5KTQA 3OFFA 1VC5A 3J81j 3R5JB 3LZIA 3CB4A 4CHNA 1WOQA 3VGSA 2QA1A 2EBGA 3FJ2A 4L74A 3GSIA 1FW6A 2EKNA 4YMEA 2XGQA 1GLBG 5ETNA 3KWIA 1V9OA 5K8NA 1N32F 3DRRB 2LQJA 1SVDA 5E84A 1WC4A 3B6BA 2DFHA 2HMIA 2EK6A 1IBMF 3ZT2A 4OO1J 2ZNYA 4DWIA 1ZM2A 5LXYA 3NCPA 3ZX0A 2P8IA 3CMAS 2BV3A 4XK8C 5D0RA 4ZPCA 2IAJB 2WB4A 3MK6A 1FXRA 3OSNA 1R0AB 2NRVA 2YQ0A 2Q3PA 3CC7S 2NPIA 3DXMB 4OZ3A 3TSUA 4DCJB 3V1QA 4C0BA 3LM2A 1X9JA 3KJVA 3U1MA 1NG9A 2BANA 3KG4A 4DX6A 4JI8J 1SL1A 2NYHA 5K20B 1JX4A 4FM0A 1NMDA 1TUVA 3I8BA 4LQ3A 3CIPA 4MK8A 2DHGA 1N88A 1J5EF 3VF2A 1U1MA 2IOCA 2BKOA 3ITHB 1I94K 3PKMA 1VQ8S 1N4LA 4PXEA 5MAOA 3NH2A 4NLXA 4K0KF 1U47A 4DTSA 4CO2A 1RAIB 1SUQA 2IC3A 3NOGA 1L3TA 3T19A 1OPIA 1U09A 5ETRA 4IFVA 2HVZA 1QQOA 2RUSA 3BREA 2NRRA 1KQKA 2Y0BB 3UCGA 1MNEA 1C4CA 4TNOA 3IWLA 2A3ZA 3Q89A 2KYZA 5JS1A 1NGHA 3MURP 1EZZB 2FSKA 3I9ZA 4L8RB 2QM1A 2XI3A 2IC3B 4EAHD 1V6HA 2O3DA 3TPQA 5HATA 2FSNA 1D8ZA 2HHPA 3GJRB 4G65A 2ZBIA 4QR2A 3W63A 2XZWA 3QEPA 1LXNA 4WP8A 1T7PA 3THPA 1HBUA 2ZGYA 5A0YA 4IH7A 3QIPA 4JI4F 3SYZA 4E7JA 1OYDA 4HT7A 1FFGB 1CS4A 1RTDA 1HJOA 4F9OA 3ZTOA 1ZZNA 3D3CJ 3D67A 4DR3J 2VQEK 1CC7A 3FGUA 4B02A 3L4BC 2GW8A 3GPAA 1UCNA 2W6KA 3CD5A 1QJHA 1V3ZA 2NNWA 4LF4F 3MAQA 5AQQA 4MIWA 5LL6Z 3J7YU 3AA2A 4DPUA 3BF4A 2A1SA 3O9QA 3M2UB 4ISFA 3TX8A 2W6LA 5JMVA 4M3UA 3OXGA 5ETSA 3I4HX 2HHQA 4ZPVR 1IBKK 4GNIA 4E7HA 3ISNC 4YN3B 5J1EA 1RT2B 4P72A 1NHKL 3E51A 4IEIA 4GV3A 4K2XA 2QFJA 3KLEB 3V6HA 4JI3F 4KI4A 1UFLA 4GKKF 3N5FA 5MLCV 2DVIA 2ZKTA 2XI2A 3KLHA 3OYKA 2RQKA 3TEGA 4WP9A 1E6YA 1LWCB 2CPDA 2IBOA 4NLTA 2KKZA 3BH7B 1TQLA 2DGWA 2MKSA 1YZ6A 2BOPA 4FNIA 4H0YB 4FS1A 4C2MA 2P2CB 3AH6A 1UVMA 5I3PA 3FEZA 1RDCA 1FTCA 1HNWF 1RAHB 4KI6A 2LP4A 2CJYB 3MOZA 4O0JA 5KFGA 5DDQC 4CHYA 4IO9L 1Q0NA 2JOQA 5GADP 1WUAA 3KMQA 4J90A 4NI2A 3LDNA 3R1LA 2VWBA 2DTJA 3I31A 1FDBA 3BQ2A 2XY6A 1LAVA 3NLCA 1VBKA 2F9TA 3I32A 2UZAA 2OPPB 4G3IA 4CGDA 4M8LA 3I96A 3QBCA 3NF6A 3WHIA 4DHYA 1SC1B 2R2UA 3AVNA 1XK8A 2ZH1A 2JEIA 1SCJB 3H2VE 5M2RA 4A8KA 1LK5A 1VMBA 2E20A 1B9DA 4LF9F 1ZBIA 5HK4A 5EX0A 4BC9A 3W5ZA 3O1WA 4P7TA 4RO0A 3TARA 4Q8FA 1HBOA 3M30B 4XAKA 3N4WA 4FLTA 2HRTA 3DRSB 2V7YA 4YOXA 1WEXA 1P27B 3V81A 3C6UB 3H0PA 2YX6A 2ROEA 2DJWA 4RW7B 3EZ5A 1HNVA 3ZLJA 3HJFA 3MEEA 4O3PA 1GQEA 2HFUA 3MGJA 5K5MA 3SQOP 1BWEA 1J9AA 4RW9A 1K8AT 3AA9A 3IP0A 4DFJA 1J54A 3GJSB 3ISZA 3HRGA 1NH8A 4ECUA 3CJ3A 4X64K 3CJSA 2LXUA 2RJZA 3SPZA 4LH4A 4JK8A 1BLUA 4NX9A 2XNQA 4ZVOB 2ZC4A 3TU5A 3C6UA 3EM1A 2R8IA 4ANEA 3BO4A 2WTFA 3QIDA 2HNYB 4FDFA 4CP5A 1IKYB 3SI8A 4CHPA 2AW0A 5BR9A 2VDHA 3OTOK 1NGEA 2YJFA 3OJUA 5C25A 1EXQA 5M1NA 3MM7B 1F2GA 2UXDF 3FE1A 3OUYA 1ASWA 3UN3A 2A40A 1F5AA 1OQ6A 1R43A 2ITGA 5HVGA 1FJGK 5KRSA 2FY8A 3W2WB 4JV1A 4FZYA 2NRTA 3KTQA 5D3GB 2O8FA 1RXOB 3EGWB 4CLWA 1QE1A 1REVB 4MYTA 2RHQB 4F7VA 1JLAB 1U1PA 2I8EA 2H51B 1UZHA 3W7BA 3ZFVA 4NYPA 1TK5A 2MHNA 4CEEA 4CZCA 1N48A 2FBTA 3QZ7A 1HW9A 1RAAB 3NGZA 3Q86A 3PX4A 4N76A 2D0OA 1OJ4A 2JLFA 2LQBA 3U7JA 2FHKA 2JZ5A 1N8RO 4QS9A 3BQ1A 1U1KA 3K5NA 1NJYA 5A8RA 1QTMA 2BABA 1FCAA 2F9DA 4A4JA 4F8RA 1Q9XA 2MZSA 3LGNA 3CCEN 2GQQA 3JTPA 4J9KA 4J9MA 1CC8A 1X31C 1EX8A 3C7NA 3U6FA 4U8VA 5L9NA 4KTQA 1IKYA 2UVUA 3ENBA 3CJ5A 1FF2A 4J9RA 4ES1A 4CZEA 1LXJA 5KI6A 1KAZA 2CDRB 4BRLA 1ZAXA 2FJAB 2F4VF 2HGLA 1NPRA 3O9SA 4LVNP 1H72C 4LRFA 3TTDA 2BX6A 1U49A 3CD6S 3UI3A 3NE6A 4FJXA 1C1AA 2HIYA 2G2ZA 2HVIA 1X4GA 1AW0A 4LD0A 4BQLA 2DGSA 2IGIA 4IQMA 2QTDA 1NRKA 3T1YF 3BZCA 1ASVA 4LT6A 4USVA 1X5PA 1MW7A 3IBCB 1LW2B 2OEMA 1R89A 4E89A 3IBWA 3AVCA 4EO6A 3A3OB 1TL1A 3ULEB 2CWKA 2W42A 3RSEA 4ZPWR 1OH8A 4PRFA 3DGPA 2LA4A 3NGUA 1FHTA 1HWUA 4J9VA 1SXLA 2EFGA 4B8AB 3QEIA 3CSKA 1NMEB 1A5XA 3HFKA 4Z4EA 2BRKA 3DMJB 2U1AA 3BSNA 4IO8A 2CH6A 3KLGA 5F9LA 2GFFA 4C6AA 3NF8A 2XULA 2VOOA 1WC6A 2AMCB 2C3OA 4Q45A 2XSJA 3TVYA 1J5OB 1RDBA 4EMDA 1JLCA 3OVAA 4DR2K 2V4JA 2CUYA 4IRCA 2OA8A 3OL8A 2V50A 1U2FA 1R8PA 2P9LB 2CGLA 1FKAF 3LM9A 2N7YA 2CIMA 1NM1A 2CH5A 3SAHA 2QEXN 1IKXB 4DSLA 3TJAA 3UDVA 3K0JA 2M2BA 3C16A 1KLNA 1CULA 4YHHF 4OZ1A 3M8PB 3IKMA 3G6ES 4C11B 2WBNA 1DTQB 4USHA 2HBKA 2H3GX 2E9ZA 4X62K 1RKJA 1VQMN 1GMVA 3KUGA 3GFXA 3GCXP 3QETA 3TA2A 4ZVTB 4CEFA 4YDUA 5I42B 2HNDB 3WXJA 1I94F 3KMSA 1GX5A 4FWPA 3RB3A 4NE9C 2CVIA 4EYHB 4HHHA 2HHTA 4JK7A 1HR0F 2CPJA 1XI1A 2LQ5A 1NK4A 3H5SA 3P3DA 2H54B 2ZHOA 1ITPA 2RS8A 2F7VA 2A1BA 4JI7F 4UF4A 4DV1J 3AO2A 2UUBF 1VR6A 4XPCA 1KFSA 5H9EK 3UDLA 4ZHRA 5GMKa 4WXOA 2AF6A 1EKEA 2ETJA 2B3TB 2JX2A 3M6UA 5DG7A 5KFRA 2DR9A 4EGLA 3OVSA 1GLCG 2CQPA 4OLOA 3TSPA 4G9ZA 2VPXB 4OX9F 1BD6A 2DPJA 3CJRA 2MQMA 3G4SN 2WVCA 2J7KA 2W9CB 4BRMA 4OLAA 3E01A 1BIUA 4RG8A 4OJRA 1XHZA 5JICA 1VFJA 3K5PA 1M0SA 1H38A 2E7XA 3AO4A 4NA2A 4X4OA 2R2RA 2VG7B 1CPZA 4HH0A 4KHUA 2E5LK 3G25A 5AJ3J 2RHKA 3HK2A 1HLWA 4B3MK 4Y2CA 1Z26A 2KQ2A 3UKRA 2MKCA 2WSEC 1SC4B 3WNEA 1VCTA 2DR6A 3PM9A 3AAQA 5IV3A 2L9NA 4X62J 2HBRB 2WCXA 4X4VA 4AL6A 4H5NA 3OYAA 1WHXA 4PAAA 5HRRA 2K1RB 4JI0K 1UVNA 2LEPA 1HQEA 2JRSA 3NNCA 4CW7B 4BRFA 1R8AA 1RWNB 4M5JA 1WC1A 5A8WA 1HNIA 4WE1A 3LP3A 2E9RX 2BZ2A 2DGUA 3ZSXA 2M70A 1F3VA 3RMDA 4CJSA 4TLQA 3POTA 5FLXU 5D6GA 3L3CA 3GR0A 1SH3A 5DQHA 4JS4A 3GFHA 4WKRA 5KFQA 3K8VA 3KJQB 4OPJA 1QQCA 2W9CA 3GB0A 1TK8A 3U4LA 4IJNA 1LWEA 3HCXA 3CDEA 2P9KB 4IR9A 1TAQA 3OFEA 4BWJA 4DR2J 2B8QA 4JI1F 4ZKAA 2IBKA 2WBRA 4DFKA 5TKWA 3KLGB 5AQMA 4RBUA 3UN2A 4F25A 2CQ2A 4USTA 3Q0AA 4FLYA 1Q86T 2UUAF 1BQMB 3TJ8A 4ED3A 3CJ2A 3V4MA 2GBZA 1Q78A 3WDOA 4CF9A 4NO7A 2OPRB 2GIQA 1S1XB 2B56A 4ELTA 4J2BA 3MCAB 3MM9A 2KVIA 3WX4A 1Q8LA 1NKBA 4ZJLA 5KPZA 3L2VA 3FKBA 3M8WA 2J6TA 3J81U 1VBYA 2E5JA 4HACA 2V8VA 4AHUA 5C7PA 2OZMA 4CEQA 3VGMA 3Q8UA 4IJAA 1Z05A 4WFNL 3IO1A 3A8KA 4CLKA 1S12A 2MQNA 4CWBA 5HOOA 2Z2ZA 1ZZFA 3SDEA 4NXNJ 2VZ9A 4DSEA 3HFVA 1Y9OA 3KDNA 3D4JA 2F8SA 4NA1A 1UL3A 1PGZA 5AQYA 2VCPA 3TW0A 6FD1A 2PMWA 3EKSA 1HLUA 5IWAK 3LPYA 3IGVA 2VV5A 3D2EA 4CO1A 1U6ZA 2QA4N 4MO5A 1JLFA 3VOVA 3KKFA 1Q86O 2R8KA 4RNHA 4QYZJ 1VRQC 3EE3A 2FF3B 2AYMA 3ETMA 3O9TA 4ILHA 3LTOA 1YBTA 2CG4A 4CO0A 1R8BA 2HW3A 3HTVA 4ECYA 1S6PB 3PW0A 3RTVA 1DT9A 2FYXA 1Q81T 4CGGA 2L08A 1VQ4S 1MU2A 5AQIA 3C7NB 1JLFB 3B78A 1RAJA 4U7UD 2BJ8A 3KK3A 3E2EA 2X1BA 2ATQA 2W9BA 4DR2F 4I7FA 5KFCA 1B4SA 2HGMA 3OPKA 4B3RJ 4NCGA 4PYDA 2UUCF 1MN9A 2HAFA 1JLEA 4A48A 2ACYA 2YX1A 1RBLA 3LPTA 4DR4J 1HKGA 4LRCA 4BR2A 1SJ1A 2KM8B 4OI2A 5KFTA 2BR0A 3AVBA 2UVVA 2OMOA 4Z4FA 4ILRA 2CQ4A 4ZLPA 2XC9A 2P9SB 5C2DA 3OS2A 2ROGA 4W92B 2EFVA 3OHRA 4J9UE 4CFCA 4DG1B 4KGMA 3LDQA 3PR4A 1SI9A 3BGUA 1X4AA 1DGKN 5AQKA 1RLCL 2H4WB 1RDAA 1BWVA 1SQFA 1VIXA 4YDXA 4JI8K 3AA8A 1LFPA 4JK9A 1WWHA 1D8YA 3KLIA 5HLFB 1S1UA 1HKAA 5ETPA 2MZ1A 1MMNA 2P9UB 3GFYA 4H4OA 3CO9A 4DFPA 2ZUGA 5B0AA 3MCSA 2ZVSA 1UVJA 2J9CA 1U4BA 3ZZ0A 3K57A 4BY9C 1QVFM 3H08A 2XEXA 3V2UC 1X5TA 2G0JA 4PKIA 1HBMA 3DU5A 1QQNA 3V6JA 3GG0A 4A8SA 4HUGA 2Z0GA 4RWWA 1IR2A 1R31A 1FJGF 4DV3K 1U2VA 4RWTA 1B0PA 4G1IA 2MYFA 1RT4A 3MWBA 3NS7B 2LCWA 4DTMA 2UUBJ 2K2PA 1RCXB 1TVRA 2R7UA 1WSFA 2DNPA 3RUBL 3OS1A 2CADA 5CH7B 3CWJA 3FBFA 4J9NA 1RT1A 4LF8K 2XSFA 4HH1A 3V4IA 5AZJA 1SB6A 4OZ2A 4OI6A 2P9CA 2MLXA 2VH7A 2YKOA 3MD3A 2CYYA 2ADBA 4OYIA 4HACB 1IQTA 4A61A 1YBUA 3RR8A 2G2YA 3OQ2A 1DJ0A 1DEJA 4CJFA 2P6SA 3NFAA 4RCHA 1TVRB 2IMOA 4U7UK 3GZ7A 3OYFA 1FX4A 3WXKA 3I82A 5L1LA 3FEXB 2CPXA 3KVGA 3O4QA 1HI8A 1RT6A 1N33K 4CGHA 2F5GA 4IDHA 2DGTA 5IC6B 3QEVA 2VPZB 1XNRK 1KD1O 2DNGA 3OYDA 3DGVA 3O08A 1YRXA 3VQTA 2JH3A 2XMWA 4ZS6A 3SSQA 4B3TJ 1CSJA 1RBTA 3OYBA 2W4DA 5EXWA 3Q2TC 2LLZA 2RQMA 3D1QA 2M5YA 4DS4A 2GELA 2ERRA 3IS9B 3LWLA 3CCMN 1K47A 5EGYA 2XY8A 4LSLA 5KFEA 1LWCA 1HYVA 3QSIA 1KS2A 1E6YB 3QPIA 4IWVA 3KLFB 3DXKB 2LQ9A 4QJVA 2NXUA 1JNRB 1T9UA 3HOTA 4I6MA 1S5ZA 4C97A 3W5YA 3KJNB 4JI7K 3R27A 3ENVA 2FZKB 4UUXA 2VUGA 3AOBA 3BBBA 1PJ6A 1L3VA 3GV5B 5EOYA 1WHVA 4ZMMA 3LL3A 1EQMA 3VAMA 4FYVB 1VQLS 4DJBA 4TYBA 2D5RA 1NBEB 4V19S 4JI4J 4AUKA 5KT2A 1S72S 1RHRB 5DM6Q 7FD1A 1UP1A 3U27A 5AXMA 4BC7A 3KD1E 1UEUA 2DO4A 2POKA 1I3OB 1RWMB 4WZMA 3UN5A 5F0XA 4O44B 1J27A 3TUZC 3AA5X 2G9OA 5A8WB 4CH7A 1E3MA 4OI0A 4CK1A 2I5JA 3LZJA 2WZ1A 2AU0A 1F9EB 2CDQA 4L76A 3CJQA 2FY1A 5DZ7A 1N36K 2VU5A 1UOCA 3QWUA 3PIOL 3TO8A 5LT5A 4CIFA 4CVNE 4LF7F 2IS3A 1B99A 5HMYA 5C42A 2PSZA 3WUHA 4B3TK 2WC9A 2CRLA 3M2VA 2D9PA 4BRHA 4PG7A 1IG9A 3CCJN 3CCRN 3QGGA 3NGYA 2QKBA 5FROA 1RT7A 5FDLA 3TTFA 3F0NA 1IM6A 2YNGB 2XS7A 4HVJA 5HVFA 3AQOA 2HF3A 1QTNB 1APSA 2OTLS 2ZZNA 4RW6B 5L46A 3N9UC 5KT5A 4OHYA 2A2DA 1J6ZA 1NDPA 4K43A 5BN8A 3KJVB 5F8JA 4DR4K 2HRUA 3MR6A 5B8HA 1RNHA 1LW2A 2Z1HA 3MR2A 3CD7A 3DLEA 3I0SA 4WZQA 2IA0A 1PIEA 3HZGA 1KR4A 3ZT0A 5CXTA 4GVLA 4KKOB 4E7LA 3BR9A 4HTUA 4OFZA 1K0VA 4CJVA 2B43A 4CIGA 1IBMJ 2VWJA 4I6WA 3VQ9A 2RH3A 3QEWA 1MN7A 1JLQB 1O5JA 1KNZA 4ED7A 4ALZA 1T02A 1LWFB 4DPWA 3QESA 2GX9A 1W7AA 5AXLA 3AO3A 4X4SA 3D54A 2KG0A 1E4GT 2KT5A 2Q97A 2FBXA 4H54A 3J7Z5 5ITHA 1K8KB 3CJCA 4LF7K 4NYOA 5E5NA 2HNDA 2Y1LB 3LOUA 4LFBF 1T9VA 4KHPJ 1LFWA 4GC6A 3B6PA 1S9EB 4RW6A 3TEHB 4CQ1A 4Q0BA 1WC3A 1FEEA 3GLJA 3VZHA 4YOWA 3L2WA 3DCAA 1VQ9N 2WSCC 1TKTA 1S79A 3EYZA 1UAWA 2G8IA 4K50A 4X65K 4NXNK 1J53A 5J2PB 1ZBHA 1RYSA 4IOCL 1ATSA 4CZJA 4XEIA 2GO8A 5C2GA 4LFCF 2B5JB 3NCQA 5J1PA 3FMBA 5KFXA 1F9FA 3AVFA 1WTFA 5LL6d 3TA1A 2WVFA 1JLBB 2MKKA 1VQPS 3HHEA 5GAEP 4Q0BB 2AZ1A 4WIQA 3IS9A 1DHMA 1XMOK 3BGRB 3RBXA 3G87A 2AEFA 1UZDA 4C8NA 1S1TA 2COLA 3DRPA 3R8EA 1HQEB 1C1CB 4DV6J 2E2QA 5F41A 2G1HA 4CCHA 3ZYYX 3MPDA 1MLAA 2W8LA 4CJRA 3QFPA 3D0PA 1CVJA 4BG8A 2OI2A 4O3SA 3UDEA 1LEOA 2ZH8A 4BC3A 5IFMA 2GC8A 3CJ0A 4BDZA 2R3VA 4H0PA 2XY5A 5IT9U 2HFSA 2I9SA 2QTWA 4E7IA 2ZJQQ 3RVCA 4HUFA 2PE8A 2GMHA 5JVGQ 3ZZRA 4BVOA 3PW7A 5KG2A 3TNVA 4HHUA 3L4IA 3E66A 2EFNA 2LDIA 3QJJA 5JVHL 2BE2A 3CD0A 3LQVA 4DV0K 5CY4A 3E01B 1X7VA 2RDIA 2M3DA 2R2SA 3U1LA 3R7SB 1NDKA 2IVMA 2PA8D 1B3TA 2ILZA 4ES2A 3AQPA 1N54B 3T5KA 5D4OA 2GHWA 5HP1B 2FLPA 1WJ9A 3M8QA 2A0FB 3BV8A 4ZLNA 2E44A 1R8HA 3IRWP 4GKKJ 2DGQA 1NOZA 5L1IA 5E3RA 3OYCA 3IMQJ 1RT1B 3KK1A 1QM9A 2VGMA 5FD1A 3BSOA 3DHXA 2G8UA 1Q7LB 2O4GA 2JEFA 3LPEA 4A5AA 5A2QY 1TU0B 3KHYA 3VA0A 5KPTA 1N6QA 3NP5A 5D0HA 3KK7A 5DM6L 3NWGA 3FUYA 5BJRA 1GXLA 3D0HE 4UOCA 4YQWA 3SUNA 4RL1A 3N4QA 5KG7A 2V4QA 1EB0A 4AILC 5JXSA 3NH1A 1CJVB 1EHWA 1LV5A 2BVZA 1YIJS 1VQNS 3L8BA 1YRTA 1IJFB 3G4SS 1R8CA 4ZP6A 4FWSA 5LMNK 4ECXA 1TKTB 3ZT4A 3HSZA 4CJQA 2E7VA 3FDSA 2W24A 3VERA 1O13A 5BRHA 3OYLA 2N4DA 2MQQA 3K0SA 1M1KT 2BKNA 3FCVA 3BF1A 1MWKA 1R27B 3C14A 1VQ4N 4ILJA 4OX9K 5EY4A 1VQON 1JIHA 5K14B 4XO0A 4U9RA 3THWA 2UU9K 2QLFB 3A5MC 4M5HA 1VSDA 3L3VA 1FNMA 1Z4UA 2HNYA 4TY8A 3ZT3A 3M6XA 2NREA 3VQBA 1P8GA 4B9SA 1X60A 4EP4A 1WDTA 2RVJA 4KE5A 3SCKE 2HGNA 1PILA 4DOZA 2P9IA 2RN2A 4DG1A 1FK9A 4RUHA 1F60B 5F3ZA 3KJFB 3JXUA 4JKDA 5L9XA 2D0AA 3AVMA 2CJBA 4OKEA 3GCWP 2Q66A 4IOAQ 3ZCMA 4JI5F 2DXEA 4ID8A 4LRAA 4DPXA 1ATRA 5FRNA 4CLZA 4C0HA 5DZ6A 5CZ1A 2RMLA 4OGEA 1VC6A 4B1YB 2GVDB 1HPMA 2D69A 5BXIA 2HHWA 1VQ6S 2DHHA 3DFEA 4CJEA 2ZE2B 2BDPA 1TTHB 4CGFA 3HKWA 2RQCA 2DRBA 4Z4IA 5LXRA 4L75A 3KOAA 1F21A 4W98A 2J8AA 3AARA 3U9DA 3CI5A 2DHXA 4DSFA 1XNRF 2AZ3A 3PRVA 1FE0A 4MK9A 2VFVA 5KPRA 3MMJA 1YJVA 5HMWA 1HWKA 2LFVA 3FRYA 4F2RA 1FNXH 2WW8A 1HKBA 5CCMA 4HUEA 1XR5A 1MMDA 7FDRA 3PW5A 2R7QA 4J91A 3U9ZA 1T95A 2ZDOA 1R0BG 3TA0A 1SBRA 2A2CA 2XZDB 4IFYA 5EX5A 2QLXA 2DEJA 2ZHBA 3D2WA 3L6QA 4H0XB 1YVUA 3LP2B 3S8SA 2WW4A 4LY7A 3RBDA 1SJRA 2F9JA 1VQ8N 2ALZA 1Q8KA 4Y3CA 3DKDA 3DXSX 3AVGA 2HWTA 1Y10A 1W7WA 2CPHA 4LH5A 3VEOA 2ZOMA 1GXTA 1C6VA 4P74A 3VAJA 2RDDA 2ZF5O 5HROB 3UVJA 3BO2A 2YNHA 4QPXA 2NZTA 3SDEB 2RF2B 2C2MB 3ONQA 3QEXA 4FM1A 3SJJA 2VHGA 4KH6A 1U6FA 2BJ1A 4ZIWA 4FPIA 2XGPA 3KK1B 4X65F 1FVSA 4PEOA 1Q7YT 3QYYA 5THWA 3CCQN 2M8DB 4FW1A 4WJBA 4FWKA 2LU1A 4PPDA 1T3NA 3J81Y 3WBZA 4OYZA 4CLFA 3RMAA 4RR5A 3KWMA 2BOAA 3BYPA 5BYRA 2PI5A 4GO7X 1WAFA 1YJ7A 5HO4A 1SL0A 3A5NC 5SWMA 3DHWC 1KOOA 1LWEB 3TQ1A 3JAMO 2PGCA 2DGOA 4DXLA 1XQSC 4Y2IA 1X9MA 4BC5A 3I5AA 1JXLA 3SI6A 1HARA 2BJ7A 4KGXB 3MM7A 4ZIVA 5KG6A 3SSRA 4PQUA 2GQ2A 3CC4S 3ID6A 4CTAA 4CJLA 2UUBK 2D3OR 4AQYK 5DS7A 4Q2LA 5GAEU 1W2BR 4PCQA 3H5UA 3MXJA 1NB2A 2AGOA 4HT5A 3HBTA 2FJEB 2JC1A 4O3RA 2DH7A 4HWIA 5C0YA 2OPPA 3VQ4A 3J80O 2UUWA 2YXLA 3PTWA 2V9KA 5D15A 4DHVA 3JSMB 1KD1T 1SJQA 3AVJA 2QWOA 2C2EA 4FJMA 4ECTA 3IR5B 4E0DA 2NUHA 1IVZA 4OPHA 3PHTA 1CLFA 2EWSA 4ZPAA 1MU2B 1VK0A 3ZNJ1 2AA4A 3K2YA 1VQLN 4N47A 1WSVA 2ASJA 3NL0A 1H7XA 4P71A 5AZIB 3L2RA 3MPVA 2W7OA 4MIBA 4PXDA 1RABB 1N33J 2BE2B 1JJ2M 4R25A 5D77A 1IUJA 2KB2A 2VKRA 4DTPA 4BC4A 1FDAA 1BOTO 1TFYA 4FYWB 4A62A 3WC2A 4CYUB 3MWPA 4W4MA 3QINA 5BR8F 3FK4A 1VQMS 5LJ3Y 5F2RA 4J2EA 2O4IA 3NGKA 4TVAB 3PZPA 1IKWB 4JHDB 3UNYA 2CKWA 3HT0A 4JI8F 3HSJA 3DLGB 2OTJN 5IT9O 2OH2A 3DLJA 2MJUA 1KCFA 2C1EB 4P73A 1UAXA 3B54A 2ZBRA 3R7BB 2A6OA 1H3DA 1KHVA 4PWDA 2ZJPQ 2YJEA 1PJ7A 3UIQA 1T9YA 2AKWB 1WBBA 1S4FA 2G8KA 5FPNA 4H5RA 4DV4F 4FXDA 2HS0A 2NRZA 5BPLA 2HURA 2ZZTA 4P2SA 4WQ4C 5BN9A 3UCZP 1CJTA 1G99A 3OBYA 2AQ4A 1HYSA 3L2QA 4DLEA 1C0GA 1FJGJ 4NLRA 4X2BA 3I8DA 1HI1A 1HNIB 2ZUAA 2IIRA 3S1TA 5K14A 1F2HA 2F7TA 3ASMA 1KAXA 2P9GA 4TLRA 3TQEA 3OVNA 3EUNA 4HVZA 1LKZA 3G10A 2AJ1A 1AROP 1VSEA 1NDLA 2O8CA 3NEKA 2P9EA 2W9BB 3HSDA 1GK8A 3UKRB 3OHAA 4C4WA 3C16B 2IVOA 3M2RB 1CQNA 5BR8K 1V5IB 1JB0C 2I38A 3CQYA 2CWXA 2DD8S 3MXMA 4OVLA 3V6KA 1ZXOA 1YJWS 1BQNB 2QE5A 1ZM4A 4K5SA 4E98A 2AP6A 2LXFA 2A1RA 4L3KA 5C42B 4H5TA 3ZZTA 2AGQA 4BGBA 2VPWB 3HHLA 2MLZA 1T0TV 3B8AX 3MUTP 2VKZG 2V51B 3ID8A 3MEDB 3D2FB 1JQGA 4G6VB 3G0ZA 4WTOB 4KHMA 1RP5A 1BA1A 4TQSA 3P96A 1TUYA 4JBCA 2UXDK 4M7XA 2P9PA 2UXBJ 2PT0A 4CLUA 1IBMK 3VQQA 3RBEA 3GQCA 2Z2LA 5KFYA 1X3MA 2QK9A 1Y3JA 2J8SA 2XRIA 3M1VA 1PBAA 4PWWA 3EKUA 4JI2K 3IMXA 2RSQA 2LECA 2B9YA 4FBUA 5F0WA 4DL3A 2W9AA 3M9MB 3OTCA 5AT1B 1S6OA 3HHKA 5DDOC 3AODA 1ZS6A 4J7CA 2OZSA 4DTRA 1TV6B 3LDPA 1MWQA 4JNEA 3AVLA 2BANB 4PXBA 3SMSA 2KVQE 1XJWB 4OI3A 4WF9L 1WORA 1GAOA 2ASLA 2V34A 3W2VB 1NPPA 3OYHA 1TKZA 2D4WA 3DAWA 3ZXWA 3GU0A 3DXMA 4DL6A 3JYTA 2JWLA 1KBRA 1WNEA 3QNWB 4JP8A 1SKRA 2QWLA 1U45A 3ILLA 3D7EO 1U04A 4LBPA 2CQDA 3PV8A 4BR5A 1Y97A 3MMCB 2E2NA 4DR1K 1N34K 4QR1A 4N41A 1KC8T 4K42A 2HHHJ 1C0UB 1S59A 1VBZA 4DCPB 3CC2S 2KI2A 1JWWA 4QZVB 1WF2A 2O8DA 1IWAA 3HZEA 1KQSR 3A1YG 4K7QA 4GMKA 1W25A 4DTXA 3DM2B 5GADU 3BB5A 4FPRA 1HRHA 4MFBA 2YWKA 1PSDA 3L09A 2DY4A 2A18A 4BRGA 2ZBQA 4ILGB 1GMUA 2YI1A 5B0DA 3K9JA 1SH2A 2Z8QA 3MM6A 3AJ1A 5AQJA 3QGPA 4C11A 3PW4A 5M1QA 4NYZA 2E1MC 1BCMA 2V8HA 5JLFA 3CMAN 3NOCA 2DNHA 3NS5A 3V9UA 1QSSA 4ED5A 1TYQA 2FVSA 2J4RA 4YR0A 2AT1B 2E8AA 4CESA 3H7HB 4YP3A 2L48A 5I9EB 4JI1J 1NGIA 4ZPDA 3VQCA 4AXJA 1URNA 1EO1A 2CFXA 2AYEA 1KC8O 1YWXA 3JB9k 3RJMB 4XH5A 4N56A 2DIUA 4KB1A 3HM9A 2KL8A 2QYGA 4CHOA 1FWLA 4ZN3A 3BZKA 3OR2B 4OPAA 4KQZA 5IC4B 4MAKA 1K44A 2DH9A 5MLCQ 3HP9A 4QWBA 1TKDA 1LW0A 3FZ2A 1JJ4A 1MWZA 1QVGR 3W9IA 4C1NK 1S48A 4JV0A 3PACA 4EIAA 3EDRB 4I64A 4UY8O 3O2IA 1XTZA 4YEAA 3IM8A 1WSJA 4X62F 4I9LA 4OV1A 1M1KO 1WF0A 3H8YA 2KO1A 3LP0A 4CERA 3NBPB 4E1NA 2NYIA 2RDJA 2E29A 3QFHA 3F44A 2RRNA 2IIHA 4ED2A 4V1Ak 2E88A 1IJEB 3UD5A 2RAQA 5T7LB 1S22A 3M32A 4DCOB 4DR6J 2E5GA 3W62A 5CYQB 3QFUA 3CE8A 4TYAA 1IKVA 2J9DA 1U02A 4ISEA 4UT4A 4ICLB 1K73T 4CH1A 5E3PA 4CEBA 2V8DA 1WD6A 4DR5F 2OP5A 3TUIC 4JUZA 4AXIA 2WHOA 3T41A 4HCBA 4DR5K 3VR1A 2VQFF 1YJTA 2N7CA 2K7KA 2WK4A 3BPDA 3OYIA 2UVWA 4R8UA 1IKXA 1NAQA 2D1CA 3VV2B 5AQRA 4AHVA 5AE3A 2BUPA 2Z58B 2MZQA 1UVKA 3QT6A 4MKYA 4CBWA 4JD2B 1K0TA 1T6DA 3GE1A 1NHVA 3HPHA 1AZSB 1SIZA 3SUQA 4OYAA 1HPZB 3AV9A 4HTJA 1ILYA 1XMBA 2C3YA 1IO2A 4IG0B 3CXCR 3WT0A 2KJVA 3ILIA 2GVDA 4I6YA 3VA3A 4HDGA 4M95A 4FJ5A 3L4QA 2AX1A 3NBPA 3L7PA 1AUDA 1HBNB 2Y9HA 2ZWPA 1T03B 3ZT1A 4OKKA 2HK3A 3V81B 4J9OA 4URSA 3VZIA 2WVEA 1FK9B 2K06A 1K1SA 4PXCA 1NK0A 5C24B 3O1BA 3EPGA 3RRKA 2IRXA 2M7SA 2E6LA 3D28A 4K8XA 3EZOA 1BG3A 3R1XA 4W5QA 1T6CA 3OTOF 1GOBA 5HQLA 1ZA2B 1W9HA 1G15A 4AH9A 3L3UA 3U02A 5KFUA 3HMJG 3TP2A 2F65A 2RKIA 5AFUH 3CUNA 2I7NA 1W0HA 4LF5K 2HBMA 1JXBA 4W5OA 3THTA 3AB4B 1RGVA 4CZKA 5HVHA 5A76A 4KH1B 3ZETB 4DF4A 2DY9A 2CVEA 3CQXA 2OPSB 2VFUA 2GJIA 3NNHA 1NLKL 1H2VZ 1H2TZ 1E6VB 2HQFA 4DR7K 4IG0A 3D0GE 2XYGB 2IPOB 4K41A 3MM6B 4ZJOA 2R7WA 3PO4A 4DS5A 4U7BA 2WOMA 4KPCA 1JJHA 2O66A 4CO5A 4RU9A 3D45A 3HD1A 3VF6A 4DN0A 4DV6F 3HLUA 2ABYA 3VALA 1KQSM 3AVHA 4KHYA 2PZSA 1GFWB 2AJ0A 4LF9K 1WEYA 3CFRA 5ETOA 2Q79A 4FVCA 2ZWOA 1UJ6A 3AA3A 1XNQF 2NZ4A 5IT9Y 1N6QB 4HL9A 1OPZA 3H45C 3SAFA 2ZH5A 2LA6A 2PFUA 2Z57B 1B9FA 1NUEA 2KZZA 3O5TB 1S1WB 1LK7A 5LOQA 2BJEA 1NNDA 1M5KC 4ZLJA 2CQHA 2WVBA 2B4UA 3VAFA 3OBIA 2W40A 4YB5A 4ECWA 4G1QB 2MZJA 1RHUB 2YWGA 1OVYA 3V5RA 1FJCA 2HHHK 3AJDA 3RG6A 4PYAA 1IQZA 1XMQJ 1Q95G 3PJWA 5DGAA 2DH8A 5KG5A 1VSIA 2IVFB 1ATNA 2ATCB 2X3DA 3CTRA 5BRFA 3SQ1A 2DCLA 3K58A 4KHPF 1FA0A 4QW8A 5AQSA 4NLUA 2Q3SA 5IQ6A 5GIPA 2GV1A 2VBYA 2XWYA 1RB0A 5A0YB 1TL7A 3DOMA 2KXHA 4ISGA 4ZVGA 5DG8A 2E1CA 5HI7A 5CZ2A 4LF6F 4RW9B 4P6QA 5KFOA 3ENHA 3FSIA 3ENAA 2RPIA 3TZZA 3FLCO 1S6QB 2MQLA 2Q6CA 4C8YA 3G6EN 3SBGA 2E7WA 4USKA 3WNFA 2FPHX 3V6DA 4IXCA 4CD1A 3WX8A 3GTYX 1S1XA 3S7RA 5F8MA 2V68A 3FZHA 1I51B 3AO1A 3DDNA 5DJBA 2HAIA 3BDPA 5AQGA 4CF0A 5E26A 1VQ6N 3MZIA 2VIHA 4YB6A 4FCYA 4GKJF 4IO1A 3D2FA 1F6TA 4CYUA 1Q1KA 5DQGA 1RDUA 1C1BB 1HFEL 2FJDB 2KW4A 1XN9A 3NAHA 5ETQA 4H03B 2NLWA 1QAYA 1VBXA 3T1HK 3KNGA 1J5EK 3G71S 1A6LA 1I1GA 3TANA 1XMQK 1S3XA 3SPYA 4Z4CA 1S10A 1FKPB 1CJKB 1AT1B 2HBZB 5CZVA 2KLAA 4M94A 3CC2N 5B0CA 4IYQA 3D66A 1E6VA 2R7SA 2UUTA 4HI2A 1Q79A 4IFVB 4JV5K 3PX0A 4CH0S 3TVZA 3HI9A 3CJ4A 1Z1ZA 4TU9A 1RU1A 4CLLA 4OL8A 2KN4A 3H3OB 2QL7B 4OX6A 3MEDA 4WFNQ 4Q43A 4HTIA 1UA0A 1VQOS 4QPTA 2H48B 2A5XA 1HNXJ 4CD3A 3NH0A 4F3OA 2DHAA 1FKPA 2Q36A 4CF8A 2P6TA 1VDHA 1IG8A 3R5AA 4E8UA 4HR2A 1VLYA 2V67A 5IOLA 3LUYA 3IG1B 3H42A 3GYNA 3W64A 4O55A 2RT3A 2Q43A 4ZTJA 2P9NA 3ZZUA 5AQPA 4Y34A 5H1SV 5LMNJ 3N6LA 4FZZA 2Z1GA 5T7BA 2Z2MA 3JS9A 1T3OA 4ZCKA 3VEZA 4WQ5C 1ZM3A 1PKUA 2HNZB 5L39A 2QYCA 1RAEB 1U1OA 5HMZA 4M3ZA 3ZX3A 3FFIA 4MQ3A 3CCRS 3MX2A 3VQSA 4KH4A 3W1YC 2PO4A 3DDIA 1RBAA 5TKYA 5L8RC 3DYAB 2IAJA 2NCKL 3MUVP 3PVXA 3H20A 4M3YA 2HRYA 2YX4A 4EUVA 4X64F 2YBVA 2YHBA 2H5EA 3DOMB 3HHLB 4USMA 5KT3A 3PNIA 4WCEL 4K4YA 2EG1A 2MKJA 3FNNA 3A5LC 1HI0P 4F0KA 3KKRA 4I0WA 4PUOA 3BGOP 1IBKF 3OTDA 5HQMA 5HROA 3UVJB 4ZVFA 1BQNA 3THXA 4JV5F 3C15A 2P5OA 4KREA 3EGZA 2U2FA 1RWUA 2IVYA 4JLHA 2NUUG 3G86A 1WN7A 4IH5A 2Q6BA 1YJRA 1NK6A 4A8XA 4F04B 2MQPA 1OMSA 4DSJA 4DV0J 1TFWA 4W5TA 2YPYA 3QIOA 1S1WA 2GX8A 2A6AA 2ALYB 1YTUA 1RTZA 1WSHA 4QR0A 1VQ5S 3BEXA 2WONB 5JJBA 1RT4B 2IRUA 1CULB 4H4KA 3T1HJ 3OFGA 1UTAA 1T9TA 2DR8A 4FF3A 2FIUA 4W5NA 4LF1A 2YNIA 4DV3J 4CFAA 2AEJA 2HFOA 1YTAA 3UD3P 4PG8A 2ZWHA 4AFFA 3ZTSA 4DB3A 1VOMA 1X4FA 3SQGA 2XMUA 3DRXA 3US5A 4JS5A 4DV4K 4I6AA 2IYIA 1OS5A 4FK2A 1I39A 5GAGI 2AJ2A 3MEKA 4A2BA 4B9UA 4OJ1A 3I0RA 1YZ7A 3WEEA 3CCTA 4FWOA 2PIIA 3G71N 4FPBA 2QLJB 4USJC 5ETMA 1WB9A 2DPNA 3A2FA 1S5JA 1NSKL 4U95A 4O4GA 3OR1B 3QATA 5AQVA 3RB0A 1S7IA 1HYSB 1IN0A 3DI6A 3TAMA 2XLJA 4CGJA 3CJ7A 1DTTB 2KFYA 3MXHP 3SCLE 4DTNA 5HJYA 2WFBA 3RYLA 1GLFO 5E2QA 2DNQA 1GOAA 3UQSA 4M3XA 4ZOSA 5DDRC 1MSWD 4C8MA 5B0BA 5B08A 2BKPA 2XB2D 1WACA 2D0CA 2MSSA 5CR4A 1DLOB 1X4CA 4ES3A 1MA9B 3DWLA 3LP1A 2M88A 3R2CJ 2ASMA 1SC6A 3PIPL 2YNHB 3B82A 2OGUA 4Y65A 4H0OA 3VF4A 3UKUA 1XQIA 3F41A 4YORA 2QWNA 3E9OA 5BRDA 1JKHB 3O5BA 3OXLA 1HBNA 5KG4A 3T3FA 1JJ2R 3D6MB 5LMUF 2RRAA 4IR1A 1FWKA 2RILA 3T7ZA 4ID1A 2AP1A 1EQYA 4FKXA 3C66A 4NRTA 1TGOA 4DV3F 5GAHP 4IFYB 2ASOA 2OELA 1UJ4A 1KFDA 2B8PA 2IDLA 1R3NA 1X5OA 4UOHA 1IKVB 4M5DA 3SBMA 1SQGA 3L2UA 1EETA 1J5OA 3I5CA 1AA1B 3PW2A 2W41A 5E0OA 2OSQA 4DR7F 1S1VB 1OIAA 1T94A 2M52A 1Y64A 4KHNA 1HHSA 3P49B 2X74A 1U1QA 3ZO7A 3KHRA 4QU7A 3CCSS 2YHXA 1AFJA 2EC0A 4JAXA 3UB5A 2QMUB 4F4WA 3WXLA 3MR5A 1N5YB 4JI5K 4MK7A 3FSXA 4FJ8A 4I1TA 4X4PA 2BUNA 1K73O 1UFWA 4WF9Q 3VTIA 2ZC3A 4YHHJ 2FBVA 4E7KA 4X64J 5EU7A 3MWTA 3T9NA 1CZ9A 5LSRA 1VSLA 4KHQA 4C7QA 3C65A 4WYBA 1TL3B 1X0PA 2QXLA 3HI0A 4L72B 4C3LA 4ELVA 4PG6A 3CJTA 2NQPA 3ZZZA 2C2ZB 4F3QA 1KVIA 2VBWA 5DRKA 2FGOA 2QT7A 4E19A 4BE2A 2GTDA 5C10A 1PYTA 2E1RA 4HLBA 1X4DA 4GRSA 4KV8A 3HKZD 1Q7YO 1ZH5A 3Q7CA 4CK2A 3HVRA 2V8GA 2QKKA 1GLLO 2XHBA 3N79A 3CCUS 1VGYA 4ECZA 3CHWA 2GAGC 1X9SA 3EGNA 3OYGA 4CBXA 4Z4HA 3Q8QB 1XWLA 2GNKA 3IA0A 4HTLA 1P6TA 1EP4B 1SV5B 3CCJS 1VI7A 4QYZK 2JVRA 2X3GA 4NI2B 4LF8F 2AGPA 3J7AN 4EWTA 4K4TA 3BYRA 4AYBD 3TRGA 1TYQB 4MTPA 3UWTA 3M9OB 1S6PA 1G4CA 1JCEA 3FFIB 4TSXA 1NXIA 4KPYA 3O8MA 1X5SA 3R97A 1FEHA 5B09A 1SZ2A 1R6VA 4EZ9A 1P9QC 4GKJK 2CNOB 1JK9B 1KQFB 4CFBA 2OAUA 4F3MA 2B4JA 4OI1A 2P9UA 1U1LA 3B8HA 4M3WA 1JXVA 1DLOA 2D0BA 2W7PA 4FVMA 1UFKA 4NMXA 1K9MO 1KSPA 3UO0A 2VGNA 4CZFA 1VRTB 1BE4A 2LYVA 4NOHA 4X66K 3CCWA 2XNRA 3M32B 4FJLA 3IBFB 4ZVQB 4NPOA 1FFSB 4TQRA 1IM4A 4DFMA 1VQ9S 2KJWA 3VEVA 3CETA 1JLGB 2FUG9 2ATLA 4ZVEA 4ZCIA 2EWHA 4IH6A 2K8GA 1NZAA 3MM9B 5ADZA 3EN9A 3OD2A 2E5HA 2FJWA 3CDUA 1NEEA 3QLHA 5FPEA 5EVZA 3BZQA 4PWDB 3FZMA 3OFHA 4IKFA 2P9SA 2JFDA 3CMES 3OTEA 2EVZA 2CAJA 4KHPK 2KT2A 5J1EB 4CZHA 2JL9A 1N5VA 3BO3A 1WOPA 4RW8A 1KVAA 4MLEA 2GVZB 5C2FA 2Z4PA 2GA7A 3CF5L 4B3RK 4HI1A 2D74B 3TX0A 2JSXA 2FVPA 4DQQA 1SS6A 5A6PA 3MMAB 2D0PA 4J9LA 3ULHA 4DX8H 4C8ZA 1KRPA 4K4XA 4DR5J 5IV4A 3WEEB 3EWGA 4DV1F 2O8EA 4ZVHA 3QMQA 4OGCA 1JCFA 1RA7A 3GSDA 4AM7A 1UPPA 5AFUA 4KY3A 2VL1A 3KG0A 4Y2KA 5JS2A 4CJ3A 4I67A 5KG1A 2VYPA 3RAXA 2IJFA 3UFCX 1Q8BA 4DL7A 4ITSA 5GAHU 3K5LA 1WNSA 1WELA 4BRDA 4KAZA 4BRIA 3FCHA 2P9PB 4P7VA 5IWAJ 1S9FA 2CJ9A 4DU3A 3OW2R 2YNIB 1S0OA 3AVKA 4OYWA 1SUQB 2JC0A 4B3MF 4CFDA 4NLCA 2O8CB 1HW8A 3OVBA 3QBWA 2HBLA 3LDOA 1S9EA 4N8OA 3PCOB 1U8WA 3QJPA 3NAIA 1VSJA 3AT1B 3IDHA 4DV2F 1RJJA 2Q31A 3C6TA 4JKCA 2ASDA 2WUSA 4IRDA 2IA6A 2V9WA 4UQGA 2HPUA 1NU4A 2AEMA 3BJYA 1NGGA 1N56A 1Y3KA 1R6YA 2E66A 4B1WB 3D1HA 3CCLS 5LY3A 1T8EA 5CHCB 3R2DJ 4DPTA 2ZGZA 2GO9A 2J0XA 1ZPVA 1DURA 2QX0A 2EW9A 3SSSA 3P5BP 3G8TA 3ZZYA 3QJLA 4KIAA 4YDDB 4JI4K 3M8RA 2FLOA 2ZH9A 2L41A 1KN6A 2VC1A 1D5AA 1JL1A 3O6WA 2QMXA 1YLXA 2A41A 3K5MA 4RUBA 3DN9A 1HNZJ 3J80U 4ZDNA 4YOYA 1IV0A 5BREA 4A8OA 4FJIA 1GT8A 3CCMS 2WOMB 3JQJA 2JGUA 1UW9A 2W01A 3JQMA 3VGUA 3DLHA 3F2KA 3BEGB 4NYNA 1C1BA 4JI3J 3EY1A 1KVKA 3C6TB 4R5PA 1U1NA 3GV8B 1WSGA 5KFIA 4KGZB 3PYEA 3MR7A 3C3LA 3ZSZA 2VG5A 2QJ3A 2UV8A 4DLGA 4DQSA 4K4VA 3C2PA 5AJ3K 1T05B 1ZTWA 1TL1B 4JHDA 4O0IA 4Y1CA 3FR0A 2FF6A 2YNGA 4C0OC 2C28A 4M5KA 1F9HA 4PKHA 5K9FA 4LF4J 3Q8VA 4WP3A 1XMOF 2G13A 1SAZA 3SK3A 1UA1A 2VODA 2H5IB 4KHSA 3DLKA 3FRZA 3HVWA 4ED4A 3PSFA 3VVTA 3KXDA 1UVIA 2GZOA 4FS2A 5E3QA 3ZSRA 2R8HA 4W5RA 4KR0B 2UP1A 2Z30B 2JNJA 3BKUA 4FF4A 4KRWA 1VS3A 4QIEA 4GV9A 4OZLA 2QA4S 3ULEA 1U6BA 2PA3A 4OJ3A 1Y0HA 1U0HB 3CPWR 5LJVA 3BKTA 1NB7A 3E9LA 3O6QA 3DYAA 3I33A 4CZLA 4RPFA 4LBIA 1KLMB 5K8MA 4B08A 4O23A 3D68A 4WTYA 3GYXB 4FJHA 2HWIA 5A8RB 3FBCA 2CG8A 2HQCA 4B3SJ 1WUUA 4RWXA 2QXFA 3SUOA 4JKAA 2UXDJ 4IDKB 1N5TA 3OV7A 1WKKA 3Q8PB 1L3KA 2DKOB 2F4VK 3LPUA 3P4UB 4PQUB 1WSRA 3Q23A 4EBDA 3FBEA 2E6MA 1UEKA 3QERA 2N3LA 3ZSWA 2MSTA 1B0VA 1VRUB 1YRUA 2KM8C 2XMTA 3ZX2A 4GVMA 2VD3A 1REGX 4B3OA 5EWFA 5DM7Q 4F67A 2JFKA 5KG3A 1SQKA 3RBZA 3VQ7A 3LWMA 4R0JA 1YJ9N 1GLAG 3RAQA 1FRHA 4ETXA 5M1PA 3EEQA 1T44A 2UV8G 4B3RF 3IR7B 4UY8T 2R42A 1SJFA 4BRQA 2CQ1A 4F3TA 4JEPA 5BYQA 4Q8EA 2NXCA 1WSEA 2OMLA 5CAAA 1S72N 2ACMA 2FHJA 2NS1B 3CQ8A 5DMRA 3MOJB 1GNKA 3LF0A 4NCAA 4FOEA 5KOWA 2V6AA 3I4PA 4KGKA 4ANDA 2DCUB 4EK2A 1U48A 1WC5A 2IFXA 3MEGB 5L1KA 2RE1A 2W2PP 2XO7A 2W7AA 5M2PA 1WG4A 3MAHA 1WC0A 1NGFA 4FJ7A 4DX5A 3VQ6A 1VRUA 3GG4A 2ZITA 4URGA 3CGIA 1UETA 2KZMA 1DY3A 2IJNA 3KHLA 3P1GA 2ZM6J 2AJ4A 1KDNA 3LGHA 4WFYA 4YDUC 3MAAA 2PMZD 1HX1A 3O3GA 3M9NB 3AB2B 3T5JA 1QHTA 3H46O 5HBMB 1X8DA 5HSPA 3N4PA 4FYXB 1Q53A 2QEXS 1QE1B 3P4IA 5ETTA 3CPEA 2X51A 3QWPA 2RF2A 1ESVA 4CJWA 1U2CA 1YJUA 3R3LA 2R8GA 2LMIA 3P6YC 3MAAB 1FWPA 1H6KX 3CT9A 3NMAA 2BE7D 2HMPA 2IMWP 3C14B 2QZ8A 1KVJA 2XTJP 1EWQA 2H1YA 2PMHA 4QIGA 3I0RB 1RHMB 4NCGB 1YTYA 4ICLA 4NL5A 1MROA 1RZMA 1FX2A 3QQCD 2YKPA 2Y8WA 4HHJA 4A8WA 2VFTA 4YOVA 1BDGA 2QWRA 4S0MA 1Y7PA 4MFBB 2F63A 2BACA 3G8QA 1ZM9A 3ZTQA 3MN5A 2UXBF 3MN9A 1Q9YA 1QSLA 1XR7A 3HXMA 1G1XA 2PDAA 1NWKA 3TAPA 1VC0A 2DGVA 2O1PA 2E2OA 2CZVC 3MECB 4FWNA 4QIFA 4USIA 1AZSA 4UW2A 4JD2A 3K2PA 1M90T 1YX2A 1EJ7L 3WQPA 2PBDA 3SFGA 4Y6IA 5AQZA 4K8RA 4JRPA 1LCUA 3VQPA 1A0OB 4ZK7M 5AQUA 3IC1A 2Q0UA 1PG5B 4HHTA 2GUPA 2GWJA 2Y1IA 1CXUA 2G0CA 1D9DA 2FJVA 1QAIA 4N5SA 2XYPB 1URRA 3CMEN 2WSFC 1WHYA 4JI3K 2MY7A 3HT3A 4FSVA 2B4OA 5IT0A 1RSCA 6AT1B 1D3WA 2BW7A 3TAMB 2E5IA 3S3MA 4OHVA 1VLOA 5GVQA 4ZVPB 5KFPA 3RW7A 2D1KA 1HWLA 2F8EX 3NF7A 2IYGA 2JJ4D 5KT7A 1VSMA 2KG1A 1GXUA 2ZQBA 4MKAA 3CJKB 1B64A 3LDLA 3OA9A 3UE2A 3VESA 2B4VA 2Q2RA 4H0VB 4JI1K 2J0SD 4OIXA 3CFPA 4O3QA 4Q44A 1R0CB 2VQEF 3ULDA 1K9MT 4NB4A 3TYTA 4QU6A 3PKYA 1HQUA 1BUXA 4PQAA 5H9FJ 1PAUB 1O8BA 5KFHA 4I68A 1QAJA 1ZOTA 2YX7A 4YR2A 2OEJA 1U8SA 2DNOA 1JLBA 2BMBA 3J7A1 4AM6A 4NWBA 4QOZB 1N52B 2CGJA 1YT3A 2B9EA 4KHWA 3ATUA 3MHYA 3TVKA 2HQ3A 5CA5A 3EMTA 4JKFA 4OYPA 2F8TA 2C3PA 2EX3A 4Z4GA 4FF1A 3OBWA 2CA9A 3HSGA 3VGKA 3ENWA 3SCIE 1SJ4P 3ZZOA 5K8OA 2YWWA 4M5MA 5BR8J 2XMAA 4CGIA 1I94J 1YK9A 3PUFA 5CHIA 2OPQB 4F02A 1TL4A 3AOAA 2PYJA 2X1FA 3EXCX 3TJ9A 2LXIA 2EPIA 3DNCA 1JLQA 3CXCM 3QO9B 3HSCA 3QICA 4FW2A 4YY3J 1FJEB 3RMBA 2B5JA 1PCAA 3Q2SC 4B3SF 5KFWA 4JI5J 4WKYA 1UKUA 3TR8A 4I56A 3HPOA 1RWOB 3I56N 5G0RB 4FLZA 4WK3A 4ZPTR 1VQNN 2FLLA 3KLEA 4QQBA 1E4FT 3I55S 2XO6A 1RT3B 3H3NO 5JVGL 4DL4A 4C8KA 4CRJA 2Q1LA 4RU2A 3EGVA 3CF5Q 3QNNA 3J7ZT 4M63A 1UEVA 5KFDA 4L3QA 2ZD1A 1C0MA 4I4BA 3HULA 1S9GB 4FJ9A 3EL2A 9RUBA 2UXCJ 5E41A 5DQIA 4QWDA 3PFOA 1DQAA 2YVSA 3OR1A 3AJ2A 5G4DA 2D41A 1RT5A 4WWSA 1D9FA 1CEZA 4RUAA 1WDDA 3FEYB 4IO9Q 4NCBA 2B9WA 1RQ0A 2HNZA 1Y5LB 2G8VA 2GHPA 5F1XA 4M5LA 2OSRA 4A59A 2PFFB 2UUAK 1NCLA 2VJUA 3MTJA 3J80Y 4CT9A 2R2TA 1NGBA 1GMWA 4NEYA 3CCUN 3POTB 4KKOA 4F50A 5ADXH 3W0LA 1WBDA 4RX6A 1G3OA 2YQ3A 1OQ3A 4UUWA 3MUMP 4DTJA 1YJWN 3V9SA 5FPMA 5F0UA 2EK1A 4YY3K 3M2RA 4ER8A 1RCHA 1N0UA 4FF2A 4ECQA 2EKYA 3FZKA 5LM7E 4OZNA 4P10A 4YY3F 2QA4G 4BG9A 5M1FA 1RTHB 2V52B 2C2DA 1YAGA 2F4VJ 4C3KA 1YI2S 3NXZA 2ZH3A 4CF1A 1PJ5A 2ZJRL 3QRRA 4OYMA 3V6DB 4URQU 3HD2A 3H90A 5HMXA 4F2SA 1Q5YA 1HNZF 3QBXA 4FVUA 3VCDA 3TSQA 4MKVA 4FJJA 4FLUA 3HHNB 1IBLF 4LREA 4IEEA 4I6MB 2R7TA 1IBLK 4LSNA 2MDAA 1RKIA 2ZM6F 2OANA 3C15B 2HLUA 4GVBB 4KTWA 4Z37A 1XR6A 5AZIA 5HRNA 2L9DA 5D8HB 4CZMA 3OYMA 5AQHA 2IJRA 2DO0A 4DU8A 4CJ5A 2Q0RA 4BGAA 4PPZA 1RE1B 4F4ZA 5H9EJ 2B7BB 4ENOA 3IRXB 3UNGC 3KUHA 1IXKA 4DQRA 1K8KA 4AHCA 5C25B 3GL1A 2I5JB 4GW6A 3GYGA 4MYUA 5KFMA 4CLPA 3T69A 3M6VA 2N82B