2VG7A

Crystal structures of hiv-1 reverse transcriptase complexes with thiocarbamate non-nucleoside inhibitors
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
550
structure length
544
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords REVERSE TRANSCRIPTASE/RIBONUCLEASE H
publication title Crystal Structures of HIV-1 Reverse Transcriptase Complexes with Thiocarbamate Non-Nucleoside Inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 137
structure length 544
sequence length 550
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2007-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2vg7A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2vg7A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2vg7A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2vg7A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2vg7A05
2XGQA 3AVFA 2F96A 1HQUB 4AH9A 1UA1A 4RW4A 3ZT4A 3QZ7A 4NLRA 1YVUA 1NHVA 3AVKA 3HVTA 4YP3A 4G1QA 3EY1A 1HQUA 2XCAA 3I5BA 4FBTA 3QETA 2KW4A 4KREA 4WZMA 2Y1JA 3LWMA 4FJMA 2YHAA 2FC0A 4ICLA 5DG8A 3OYLA 4CHYA 2FVPA 1LWFB 1B9FA 2OH2A 2VG6A 4DQRA 5KT6A 3SI6A 4ECSA 3NE6A 3V9UA 4O4GB 4B9VA 4EYIB 3VQ8A 2DFEA 3I0SA 1ZBFA 3KHRA 4J2EA 1HPZB 1IG9A 1LWFA 3SQ4A 3KLEB 5KT4A 1SV5B 3DMJA 4FJKA 4O4GA 1J53A 2IOCA 3PW0A 3MEEA 5KG1A 5KFLA 1FXXA 4CEEA 4W5RA 3S3MA 2VG7B 4LSLB 1HMVB 1QAIA 1C0UB 1HPZA 3ZSXA 5L1JA 3LPTA 5SZTA 4FLZA 4B3OA 4MKBA 3Q8PB 3QERA 3GV7B 4LSLA 1IH7A 4Y3CA 1HMVA 2XHBA 4M3WA 4NLVA 1S1UB 2XGPA 1C0UA 3MECB 3QO9B 1HRHA 4FM2A 2ASJA 4W5TA 3KLIB 2W7PA 4E7LA 2R8JA 4Q8EA 4B8CA 5J2PB 3B6OA 5DGBA 3BQ0A 1CZBA 5C25B 4CHNA 1J5OB 4RU9A 3D5MA 1Q9XA 2P5OA 4J9SA 2Q3SA 4DL4A 3V9ZA 4EYHB 3KLIA 4FXDA 4F50A 3OLBA 3ASMA 5J2PA 3VQBA 5HRPA 4M42A 4EBEA 5C25A 1BCMA 3KKRA 1J5OA 5KRTA 4KAZA 2R7YA 2KFZA 1Z26A 3OHBA 3HO1A 4J9RA 3V9WA 3OYNA 4Z0UA 3CFOA 3ZT3A 3H59A 5FRMA 4NLUA 3QESA 4QAGA 1KSPA 3KMQA 4KTWA 5KT7A 1NHUA 5C5JA 3BSOA 4NZ0A 3K5LA 4DTSA 4CK2A 4DLGA 2AJQA 2B5JA 3VQCA 1NKBA 2GC8A 1KLNA 3V9XA 4FLXA 4FJ9A 4CJVA 4F4WA 1GX5A 4KHNA 1VRUA 4I2PB 3BREA 4HUEA 1NK9A 3DLKB 3BQ1A 2J6UA 4K4TA 4DQQA 3NDKA 3V9SA 3VA3A 2YNIB 4TN2A 4JS5A 4IG3B 3V6DB 1Q9YA 4NYFA 1TVRB 2G8FA 4TSXA 4ZP9A 4YFUA 3HYFA 3CM5A 5D3GA 3DLKA 4R5PB 3WNGA 1W9HA 4CJ3A 4CJQA 1RDCA 1XWLA 2YNIA 1C1BB 3BJYA 4IG3A 3V6DA 3PZPA 1TVRA 2JC1A 4CJ4A 2EX3A 3HP6A 3AO5A 1BHLA 4J9KA 2KZZA 1C1BA 1YTUA 2FBVA 4F2RA 3S3OA 4CF1A 2G8KA 3G10A 4EZ6A 3KD5E 3PUFA 5KG4A 4CJPA 4Y34A 4NLOA 1JLFB 1D5AA 2E9ZA 4NLSA 4ZHRB 1IKXB 3CJ4A 2WONB 4KB7A 2HVIA 1A5WA 1BQNB 4ZVFA 1N56A 1KVBA 2IM1A 3SJJA 3HM9A 4ID5B 1JLFA 1FK9A 4KV8A 1IKXA 1JLEB 4KTQA 1NK6A 1VSKA 5J2MB 1RBVA 3L2VA 4TY9A 4K4ZA 2R2SA 2YNHB 5J2QB 4JS4A 1JLEA 4CEFA 4MFBB 3CJ0A 1QSSA 4FJ7A 5J2MA 1RT6B 5HP1B 4C8LA 3OS2A 3DLGB 2YNHA 5KFUA 5J2QA 4I7FB 5HBMB 3RBEA 2XY7A 4J9OA 3VQAA 4WFYA 4EO6A 2FLPA 4CEZA 5CYQB 1OS5A 3DLRA 4Y2CA 4JV2A 1RBUA 1ZETA 4DTJA 1XHZA 3SCXA 4KB0A 4CESA 1VSFA 3QEIA 3DLGA 4RW6B 3S3NA 4I2QB 1RT5B 2D7SA 1JLCB 4CJ5A 4I7FA 5HBMA 4HCBA 5L1LA 4E1MA 4N56A 5CYQA 2Z1GA 3PO5A 4F4XA 4ECRA 4Q43A 4ECUA 1S1XB 3DRRB 4RW6A 4I2QA 2E9RX 1RT5A 3ISNC 3OY9A 1JLCA 4G3IA 4KE5A 4CGJA 1S48A 1JL1A 4CGDA 4WXWA 4QCLA 1LW0B 4QPXA 3T5JA 4B9LA 2CKWA 5FRNA 2JEFA 4LY7A 1S1XA 3DRRA 1N48A 5KFFA 4CFCA 4NLDA 2VG5B 3OL8A 3RAXA 3JYTA 2AGQA 1LW0A 3T5LA 3G0ZA 3NCIA 2WB4A 2X6NA 2P1JA 5L9XA 3AVBA 4DL7A 3KLGB 4M94A 3OHAA 2VG5A 2F8EX 3O3GA 1REVA 5CYMB 3OLAA 3OL7A 1RT7B 4BE1A 1NJYA 3BSAA 3DLEB 3UR0A 2HAIA 1K1SA 4CJUA 1C0MA 3KLGA 3SV4A 4TY8B 5KG7A 4PY5A 2F8TA 1BIUA 5CYMA 1BISA 4FZYA 1JXEA 4RG8A 4CIEA 4DFPA 3V81B 3MEDA 2WK4A 3DLEA 2IDOA 3VQ5A 3LALA 4M3TA 3MEGB 4TY8A 3Q8SB 2ALZA 3AA2A 4FK4A 4QWEA 3SQ0A 3LANA 1S1TA 3CJ5A 3V81A 4E19A 1UA0A 1S0OA 2ATLA 3T5HA 3VQ6A 2IC3B 4WZQA 3DLBA 3MEGA 4ZPDA 2KZMA 4CHOA 4RNFA 5E41A 3RRGA 2Y1IA 4HYKA 4IQXA 4NLQA 3TAEA 1JXBA 3TARA 1U04A 2PY5A 4B9MA 3OYBA 2IC3A 2XI3A 5KFAA 2QKBA 2BE2B 4LQ9A 3OL9A 1JLQB 1T03A 2VWKA 2ETJA 5KFJA 5JXSA 1S9EB 1SL2A 3AA4A 3MFIA 3NL0A 4IDKB 2BE2A 1KLMB 3HP9A 4M3UA 2ILYA 4UQGA 3HHKA 2QV6A 4EBDA 3IN5A 1S9EA 3M8SA 3HK2A 2C2DA 1TK0A 4IDKA 2BQUA 3AVIA 3K5OA 4CF9A 1BGXT 3M8PB 4CE9A 3HVRA 1N4LA 1ZTWA 4FLVA 5JUMA 5DK5A 4HUGA 3E01B 1JLBB 2HVHA 3LP0B 2XWYA 3GILA 3UPFA 4FJGA 1KVCA 3TAGA 1GOBA 4KKOA 3RTVA 3M8PA 1SKSA 1RTDB 3MR6A 2OPSA 1D1UA 1JIHA 2XI2A 1QTMA 3PR4A 2E6LA 3E01A 1JLBA 3LP0A 3RBDA 1TAQA 3AA5X 4KFBB 1TL1B 4AHSA 2V9WA 4KHYA 5KFKA 1RTDA 3M9NB 4EBCA 4M45A 1CXUA 4K50A 2QK9A 2B4JA 3ALYA 1FKOB 2BQ3A 2RN2A 3NMAA 5KGXA 4KFBA 1IO2A 4DS4A 1TL1A 3VQPA 4IKFA 3KK2B 3OYMA 4Z4IA 2OYQA 1LAVA 3MFHA 4IRKA 1EXQA 3SQ1A 1FKOA 3PX0A 4DSKA 3F9KA 1D0EA 2HHWA 3PW5A 3KLVA 2IGIA 4CJWA 3LAKA 4AHRA 3KK2A 4FJLA 3QIPB 3EZ5A 4PWDB 4DSJA 4CJTA 4H4MB 4EO8A 5JS2A 3KKSA 3H5UA 4DTRA 1DTQB 4Y2AA 2W9CB 3OYGA 4ZVEA 4C8OA 2UUWA 1NJXA 3L2RA 1U45A 4CJEA 2GUIA 2UVUA 3QIPA 2IJFA 1S49A 5KFQA 4PWDA 2V0NA 4CK1A 1UOCA 4H4MA 2D0CA 4E7JA 1DTQA 4E7HA 3FSIA 3Q8QB 2AGPA 1I39A 3K58A 4DFKA 1IKWA 3THVA 4KB1A 4W5QA 3CJ3A 3SI8A 2OPRB 2JEGA 1IM4A 4K4VA 3DOKB 4ICLB 1TGOA 3T5KA 4GC6A 3HVWA 3GQCA 3CYMA 3LWLA 1JLGB 4DL2A 3P83D 2VG6B 3O3HA 5F9NA 4M95A 2P5GA 1U47A 2OPRA 1VSHA 4ECXA 4DTNA 1I6JA 3DOKA 2D5RA 2YNFB 1SH2A 3I0SB 2JC0A 1JLGA 5DQHA 3PW4A 3OYJA 3DMJB 4TQSA 2HHXA 2UUTA 4MQ3A 4X2BA 3MEEB 3PX6A 3EYZA 3SZ2A 2C2EA 3PJWA 3RB3A 2YNFA 3H5YA 4B08A 4BWJA 3NAEA 4NLXA 4Q0BA 5EWGA 2C2RA 4B3OB 4H4OB 1L3TA 3UDLA 1B92A 3C6TA 3SUOA 3NH1A 3NBPB 4N5SA 3KHLA 4H8KA 3EPGA 4XPEA 2FBXA 4CHQA 1S5JA 2KFNA 3OYEA 4O44B 4IG0B 1QS4A 4H4OA 4CGHA 4KBIA 5KFOA 2HNYA 2G8HA 2KTQA 1S10A 3NBPA 4F2SA 2FBTA 2RPIA 5KG3A 4O44A 2IAJA 4IG0A 2FVSA 1U48A 1J54A 3FDSA 1RBTA 3ZT2A 3QNNA 2KQ2A 3M9MB 3RR7A 4FK0A 3AV9A 4Z4GA 2BGGA 4B9NA 3SUQA 4Z4CA 4DS5A 1XI1A 2O4IA 3ZCMA 1U4BA 4OGEA 4CJSA 2HNZB 5CY4A 3H4DA 1JXLA 1RILA 3G6VA 4NRTA 1NK7A 2B5JB 2JEJA 3V6HA 1EP4B 4NYZA 2HNZA 4CEBA 2UVWA 1C2PA 4CJRA 1KRPA 1VRUB 1ZBIA 5KFMA 1S1VB 3L2UA 1VK0A 3HL8A 2WTFA 4J9MA 1NK4A 2DFHA 3B6PA 1EP4A 1ASWA 5D3GB 5KFCA 4MK9A 1S1VA 1LW2B 3PHEA 5KT5A 1VSDA 1TV6B 4MK8A 3NAHA 4DG1B 3QZ8A 3KHGA 1N5YB 3NH0A 4FLYA 1CLQA 1RDBA 1S0NA 4QW8A 1J9AA 2GIRA 1FKPB 3NGDA 1LW2A 2R8HA 1C6VA 5HRSA 4CFBA 1S97A 4CJFA 4DF4A 1TV6A 4F3OA 1NKEA 4KHQA 4DG1A 3HKWA 4DL6A 4CF0A 4DTOA 1N5YA 3PV8A 3MTKA 4ZVGA 3EPIA 1BCOA 1FKPA 2R2RA 4N41A 5KFXA 3PX4A 4MH8A 3OS1A 1RT4A 3HT3A 3OYHA 3IG1B 2W9AA 3CDUA 5KRSA 5HRRA 4M41A 4O3SA 1FK9B 4KV8B 1Z25A 4FM0A 1A5VA 4KSEB 4IH5A 3QINA 1KVAA 4Q5VA 3IG1A 2VWJA 5KFIA 1NK0A 1RTIA 1R0AB 5F9LA 4E7IA 4O3NA 2G8UA 4WYWA 3P5JA 3O3FA 1T8EA 2RDIA 3U6FA 4DQPA 1R0AA 2R8IA 3RB4A 2UVRA 2XRIA 5CZ2A 1HARA 4OGCA 1JX4A 4ZP8A 1T3NA 4M3RA 5FROA 4F8RA 4NLTA 4HKQA 4OKJA 2HHQA 3AVGA 1L5UA 2R2UA 1JKHA 1KFDA 3DYAB 5DQGA 5K14B 3VQQA 3K2PA 4J9PA 4O0IA 3V4IB 1N6QB 1LV5A 4OJRA 4IR1A 3WNFA 3MR2A 3MR3A 5F8JA 3SFGA 3DOLA 1CXQA 4GC7A 2EC0A 3SFUA 2YKNB 3DYAA 3N6LA 1YT3A 5K14A 4O4RA 4IFYA 3ITHB 2ITGA 3V4IA 1N6QA 4URGA 5FDLB 2Z1IA 4CF2A 2ZE2B 4BDZA 1JLAA 3DM2B 3QGHA 3KK3B 3SQ2A 1UWBB 3TANA 4OKKA 4RNNA 4J9NA 5C24B 3M9OB 2YKNA 1W25A 3JYTB 3ITHA 3I5CA 3TAMB 4BE2A 4KAIA 1Q8IA 5KFBA 5FDLA 1BI4B 4O5BA 2ZE2A 4K4XA 3AVHA 5J2NA 3HVAA 3DM2A 3GV5B 3KK3A 5HLFA 1UWBA 5EDWA 4M3ZA 4GMJB 3SUNA 1ITGA 5C24A 4ZP7A 4KO0B 1REVB 4DSEA 2HW3A 3LP2A 3WNHA 5T14A 3TAMA 4JV0A 3TABA 5KG5A 3RMBA 2HHVA 3H5XA 4K4UA 3L3UA 1BI4A 2QKKA 4FJNA 2FLLA 3D0PA 4JUZA 4BDPA 1L3UA 4KO0A 5DLFA 4HVJA 2FJXA 1ZBHA 3CDWA 3AVCA 3MEDB 3L3VA 3QYYA 1X9MA 3UQSA 3BR9A 3TI0A 1HYSB 3SNNA 3OSPA 3NAIA 1RT3B 1TKZB 4IR9A 1XR6A 1Z4UA 1NK8A 1S1TB 1MMLA 2R2TA 4YQWA 1SKRA 3SUPA 1HQEB 2WCXA 3RWUA 4WE1A 1D9FA 2B43A 4CERA 4K8XA 4QWAA 1HYSA 3QEPA 2WHOA 4TQRA 4Z4FA 3DI6B 3QIOA 1RT3A 1TKZA 1SKWA 2W42A 3QNOA 3AO1A 1HQEA 3SPZA 3MAQA 4O3OA 2ASLA 3CIZA 5F8LA 1WSJA 3T3FA 4CJLA 3NF9A 3DI6A 1VSEA 4K4WA 2IM3A 4KHRA 2C22A 1T03B 4FCYA 2BQRA 5KFYA 3L2QA 3A2FA 5J1EA 2GBZA 2DPIA 3SYZA 3CQ8A 1RAJA 5HROB 3AVNA 2E4LA 5KFNA 4EP5A 3Q8RB 1SH3A 4K8ZA 4E1NA 3IRXB 3NH2A 4IBNA 3CJ2A 4OLAA 3L2WA 4I9QA 5HROA 3V6KA 4WFZA 4J2BA 4ED7A 1WNSA 4ED8A 3HPHA 3IRXA 2IJNA 1CSJA 1T05A 4IH7A 4KKOB 1RYSA 4RW8B 2IBKA 2OPSB 4CHZA 4URSA 4TXSA 5DG9A 1NJZA 4RNMA 4TYBA 1RYRA 5KFSA 4DQIA 4KI6A 3CWJA 4RNHA 1RT1B 2E9TA 4CFDA 3DLHA 4FYDA 4RW8A 1RDRA 3LPUA 3GIMA 4F4YA 2D3ZA 4JRQA 4FVMA 1NOYA 3AO2A 4CCHA 1RT1A 1TP7A 3BSNA 1XR7A 2PYLA 3SV3A 2P51A 2VA3A 1EETB 1K6YA 3AO3A 4NYNA 3PY8A 3TWHA 4E7KA 1RDAA 2D3UA 4MK7A 1HNIB 5EUHA 1TKDA 2DFFA 2BDPA 5EWFA 3KOAA 4KI4A 1EETA 2FVQA 3PVXA 2J6TA 4DF8A 4ED0A 4EP4A 4ZTFA 2HHSA 4MIAA 3KNAA 4YMEA 1HNIA 4BWMA 1Y97A 4XPCA 2B6AA 4IRDA 4YR0A 4RUCA 4C8KA 3QEVA 4HCCA 3OS0A 1RTHB 3H98A 4EEYA 2I5JB 4EZ9A 4DQSA 4LH5A 3H5SA 4FLUA 3K5MA 1IKWB 1HYZA 4KRFA 4DSIA 3ZSZA 1I3AA 3ZSRA 4B9UA 3KLFB 1L3SA 1RTHA 1KTQA 2RDJA 2I5JA 2IMWP 3KIOA 2Z1JA 5KT3A 3KLHA 2QE5A 2W8KA 3MXMA 3NGYA 5F8HA 4DU1A 4YR3A 1QSYA 1S6PA 2V4RA 3C6UA 4JV1A 2E6MA 3QIDA 3KLFA 5KFPA 4OLBA 2HB5A 4FJHA 2XY5A 4GVMA 2IA6A 2J6SA 4DTXA 4R0EA 3RB6A 2OZMA 3TVKA 4ELTA 1TK5A 2OPQB 1WSHA 3M8QA 4OVLA 1HYVA 3AO4A 1VSIA 3U3YA 3QLHB 4RNOA 4E89A 3VA0A 3HPOA 3T19A 4QWCA 2RKIA 4Q0BB 3NF8A 4NLPA 5HRNA 1TQLA 3OJSA 4F4ZA 4NCAA 4CFAA 3C94A 4AHUA 2OPQA 5EU7A 3NGIA 4J9QA 3G6XA 3QLHA 3C6TB 3M8RA 1S9FA 4W5NA 2X74A 4CJKA 2G8VA 3H08A 3LAMA 3OYCA 4RUAA 1WSFA 3PW2A 4CGIA 3RMAA 3PO4A 2HNYB 3V1RA 2AQ4A 4DU3A 5KFRA 5DQIA 4GW6A 1RCHA 3OYDA 4FLTA 2G8IA 4JRPA 1K1QA 3RRHA 3H2LA 2IAJB 1ZTTA 1TK8A 1RA6A 5KG0A 4ID1A 4AHCA 1MU2B 4O3QA 2VA2A 2BRKA 4ZPBA 3KHHA 1TKXB 1ZYQA 4ED3A 3FFIB 2F8SA 1KCFA 1BQMB 3PW7A 1S6QB 4O3PA 3KLEA 3NGZA 3T1AA 1WNEA 1QE1B 1MU2A 1SV5A 3E51A 3MXJA 3WNEA 1TKXA 3I5AA 2VG7A 3FFIA 2D41A 4WXOA 2LSNA 2AX1A 3CVKA 5KFEA 1WLJA 1NK5A 3GIIA 1BQMA 1S6QA 4QOZB 3K57A 4KPYA 1BIZA 4CEDA 1QE1A 1X9SA 1DTTB 1VSLA 1C1CB 3AA3A 1S1UA 2WOMB 3MECA 3QO9A 3VQEA 1A5XA 1SUQB 4ECYA 1DTTA 4FZZA 4FS1A 1C1CA 3LP3A 3ZSOA 5T7BA 1U09A 2HWHA 4ECQA 4E0DA 2WOMA 4CF8A 4ZTJA 4ZP6A 4Y1CA 2PZSA 4FM1A 1TKTB 3O4QA 1SUQA 1ZBUA 4WYLA 3CO9A 3ICLA 3N6MA 4AHVA 1TAUA 2HHUA 1TKTA 4IKAA 4DL3A 1RBRA 5DMRA 3TAFA 4ED6A 3OYKA 4RW9B 3GYNA 4W5OA 3KJVB 1RTJB 4FJJA 4HHTA 2R8GA 1S4FA 4PUOB 3NHGA 4E3SA 4CGGA 1RT4B 4NRUA 4AILC 3ZT0A 2JEIA 5SWMA 2DY4A 4RW9A 1RBSA 1KFSA 4I2PA 4LH4A 1S0MA 2G8WA 2HMIB 3KJVA 4ZPCA 1RTJA 2QXFA 4PUOA 2XY6A 3I8DA 3H4BA 1C0TB 3FQLA 4OKEA 1WSIA 4U6PA 3MR5A 2RF2B 1RA7A 2IS3A 4N47A 4DFMA 1QUVA 3I0RB 4R5PA 2HMIA 5F8IA 1RTIB 3H40A 4IFVB 4DL5A 1X9WA 1YTAA 5KFDA 2ZQBA 2ZKUA 2IM2A 4KTZA 4J2DA 2YV0X 3LZJA 1C0TA 2PYJA 3N6NA 4I9LA 2RF2A 4FW2A 4O3RA 3I0RA 5F8MA 4IFVA 1RNHA 2OA8A 4M3XA 2BRLA 1KHVA 3OVNA 1NJWA 2FJWA 3BSCA 3ZT1A 3ISND 4CIFA 3BDPA 4FZXC 1CZ9A 3QGGA 2JLEA 1TL3B 1JKHB 3LZIA 1RDDA 3QEXA 2YNGB 1SH0A 4NCBA 4ZHRA 4MIBA 4WFXA 1QHTA 3U3GA 4OPJA 3UIQA 1S1WB 2WONA 4DEZA 4URQU 2W7OA 3OYAA 3AVJA 4CEQA 1BQNA 2FVCA 4DTUA 2UVVA 4FK2A 3HXMA 4KHMA 1TL3A 1RT2B 3NFAA 3DOLB 1XR5A 4ID5A 4IOBA 2YNGA 1GOAA 4IFYB 4IH6A 2O4GA 1S1WA 1ASVA 1HNVB 3EZUA 1C1AA 2XC9A 1JLAB 1ZBLA 1UAXA 1YVFA 3QGIA 3NF6A 1RT2A 2ASDA 1LAWA 3F73A 3VN5A 1DLOB 2ATQA 3ZSYA 1XC9A 4MFBA 4M3YA 3HSTB 4QWBA 2XO7A 1HNVA 2Z1HA 2V4QA 1VSMA 1RT6A 5HP1A 5J2NB 1X1PA 3AVAA 5KGWA 4NLYA 5HLFB 2I1RA 5KFTA 4Y1DA 4LQ3A 4ED2A 1IKVB 3LP2B 4RW7B 1DLOA 1EX4A 2X78A 1WSEA 1D9DA 4NLGA 1G15A 3AVMA 3HJFA 4ELUA 1NKCA 4DLEA 2W8LA 3CG7A 2ILZA 4DSFA 3GIJA 4JLHA 1VSJA 4N76A 4ZPAA 1IKVA 1WAFA 4RW7A 3OYIA 1WN7A 1JL2A 4KHWA 3NF7A 4K4YA 3PJXA 5I3UB 3KMSA 4MKAA 3PR5B 1U49A 2WRMA 3MF5A 5KG6A 4FS2A 1O1WA 2AU0A 1SL0A 4CEOA 3OYFA 2JGUA 3NKYA 4AHTA 1NNDA 4WE1B 1WAJA 4ECWA 3VQ7A 5I3UA 3QEWA 3VQ4A 3ZSQA 4YNQA 4B9TA 4DMNA 2FBYA 3P1GA 3CDEA 4J2AA 4CGFA 4Z4HA 4KHSA 3GV8B 4PA1A 4BACA 1W0HA 4FJXA 5KFZA 2A1SA 4TYAA 4J9LA 4O0JA 2AX0A 3TAQA 3KK1B 4OPKA 4ECTA 3L8BA 1S9GB 5CZ1A 2IM0A 3DRPB 3K5NA 2DTUA 1SL1A 1RT7A 1B9DA 3CFPA 4ED1A 3D28A 5DG7A 2AGOA 5J1EB 5KFWA 4FLWA 3KK1A 4QWDA 1LWEB 2OPPB 1S9GA 1GOCA 2O5DA 4BDYA 3DRPA 4B8AB 1QAJA 4HUFA 5L1IA 1VRTB 3OJUA 4FW1A 4Z4EA 5KTQA 1LWCB 4YR2A 2R8KA 2DPJA 1LWEA 3VQSA 2OPPA 4FJ5A 5KFHA 4FJ8A 2FVRA 5EWEA 3G86A 2GV9A 4B9SA 1F21A 3CFRA 2D0AA 1T7PA 1VRTA 4DSLA 3JSMB 5F8GA 1XHXA 3K59A 4K4SA 4LSNB 5KG2A 1LWCA 1T05B 3OL6A 1QSLA 3FRZA 4Q45A 4CECA 4ECVA 3V1OA 2GIQA 5KT2A 3S9HA 4DTPA 3RAQA 1QQCA 3RMCA 3JSMA 4O55A 4DTMA 4LSNA 3SPYA 4XO0A 3RB0A 4CEAA 4CK3A 4R8UB 1JLQA 2YKMB 4F3TA 2C28A 2BR0A 4C8NA 1IKYB 3KTQA 3CM6A 2W9BB 3FQKA 2YHBA 3RMDA 4OL8A 1KLMA 4QW9A 4Q8FA 4R8UA 2YKMA 4H54A 2X6SA 1GX6A 2XCPA 4CHPA 4DWIA 4HTUA 3OSNA 4L8RB 1IKYA 2W9BA 2HNDB 4C8MA 2NUBA 3ZSVA 4CIGA 2HWIA 1NOZA 4F4KA 2FLNA 2BANB 4LD0A 5C42B 4DFJA 2HNDA 1EKEA 5KFVA 4KHUA 2B6AB 4TLRA 4FJIA 3TR8A 2FJVA 5KFGA 4ECZA 4PQUB 2BANA 3LP1B 5C42A 3DDKA 3C95A 4NCGB 4IRCA 4Q44A 3O4NA 4ELVA 5F8NA 3D45A 1T94A 5I42B 3BQ2A 3LDSA 2XY8A 3IGNA 4PQUA 1BL3A 3LP1A 4FBUA 3ZSWA 3BGRB 3IS9B 1KHWA 3VQDA 3KLHB 4NCGA 4BE0A 4XIUA 4NLWA 5L1KA 3TAPA 2CJQA 2AWZA 3RR8A 5DLGA 5I42A 3MXIA 3IGVA 1S6PB 1WSGA 3C6UB 4U7CA 3DRSB 3AVLA 3IAYA 3V6JA 1HJRA 3BGRA 2ZD1B 2EHGA 3V1QA 1ASUA 3IS9A 5DGAA 2OZSA 5KI6A 1D8YA 2D0BA 3VQ9A 2A1RA 4RW4B 3KD1E 3DRSA 5JS1A 3ULDA 3GIKA 3M8QB 3TQ1A 2ZD1A 3G6YA 1L3VA 4RZRA 4ZMMA 3HVTB 2W9CA 3HPGA 4G1QB 4ZVHA 2RKIB 2HHTA 4DU4A
chains in the Genus database with same CATH superfamily
3AVFA 2F96A 1HQUB 3SJHA 4AH9A 3PFOA 1UA1A 4RW4A 2LVWA 4GKJF 1IBMK 3HSGA 1VBYA 4JI4F 1S99A 2CQBA 3QSIA 1YVUA 1M1HA 1XMOK 4CW7B 4G1QA 4C7QA 2J0WA 2UYTA 2O8CA 1SQKA 4FBTA 1H7WA 3AJ2A 3QETA 2KW4A 5ETMA 2W4CA 2Y1JA 3LWMA 2MJNA 3TVYA 2YHAA 2FYXA 2XMTA 1ELOA 1RHUB 4TNOA 4X64K 4LC9B 3WQUA 4EI2A 3OYLA 2OH2A 4KBOA 4DQRA 1H0HB 4ECSA 4O4GB 1ZAWA 3QJPA 4EYIB 2XYGB 2M88A 1VQMS 5AJ3K 3I0SA 2DNQA 1ZBFA 1HPZB 1IG9A 1BE4A 3RAMA 3SQ4A 3EICA 2IHR1 1X3NA 1ATNA 2IOCA 4HH0A 3MEEA 5KFLA 3HHLA 4PG7A 5AQUA 1ICEB 1HMVB 1YQHA 1N5QA 4F9OA 3J7YP 1C0UB 4FF4A 3LPTA 4RL1A 2LA6A 4B3OA 1LWXA 3D6MB 1GTEA 1IH7A 3CEDA 5K9FA 2XHBA 3GMGA 4NLVA 2DO0A 4LR7A 3E1YA 4LVNP 2ASJA 4F02A 2QL9B 2W7PA 1QVGR 1SKUB 4LF1A 5J2PB 3B6OA 1CZBA 3CUNA 4FPRA 4RU9A 4J9VA 3D5MA 3RU0A 3J7ZO 4JI3J 1T95A 2F7VA 3V9ZA 2LDYA 4CO1A 3GOIA 4FXDA 2YHXA 1PIEA 3VQBA 4DQ8A 3H42A 1BCMA 2R7YA 2PEHA 2YX4A 4LFBF 4I64A 1Z26A 1F5AA 3WX8A 3OYNA 3M1VA 3HTVA 4DR1K 1YKWA 3ZT3A 3H59A 2WB1D 3KDNA 5FRMA 2ZUGA 2UUBF 4QAGA 3KMQA 1VK3A 4KTWA 2DNRA 4BVPA 4CJ7A 3LL3A 3BSOA 3K5LA 4DLGA 1ZM3A 2DR7A 2R42A 2GC8A 4FJ9A 1RACB 4F4WA 1GX5A 2B7BB 4QIEA 1VQPS 1VRUA 4HUEA 3BQ1A 4K4TA 3SXLA 3V9SA 2C2NA 4JS5A 3CQYA 1FW6A 4IG3B 1TVRB 2HS4A 2G8FA 2GGPA 4YFUA 3CM5A 2QX0A 1UPPA 1YAGA 5KOWA 5B8HA 4X4UA 3P39A 3JAMO 4CJQA 2R3VA 1RDCA 2HBKA 2CJKA 4ZVOB 2WW4A 1VK8A 2ZEJA 2JC1A 1E4FT 4RBUA 4LIWA 2WSFC 2AJ2A 3HP6A 1BHLA 3H1VX 3R8YA 5AE1A 2I6WA 2V34A 4F2RA 2CNKB 3S3OA 2NPIA 3DHWC 4CF1A 1D5AA 3NOGA 3ZNJ1 1HLUA 4NLSA 3J7Z5 3GIRA 3ZTQA 3DXBA 4I69A 3QGPA 1B64A 2ZBPA 4KGZB 4OX7A 3QWUA 1WC5A 2K06A 2W2OP 3M2RA 1KVBA 3GB0A 4USVA 2IVFB 2O8EB 3HM9A 2Z8QA 3NS7B 3VZIA 4TY9A 2E5HA 4DPYA 3HHDA 4OI2A 1P1LA 3CJ8A 1CC8A 2GX9A 2CFXA 1WORA 1L3KA 1S76D 4KH5A 2B4PA 3O9RA 5J2MA 4LF4K 3EXCX 3DLJA 3ZETA 2OSQA 3EVOA 3F44A 3B82A 4ISFA 1RXOB 2XBPA 5J2QA 2OD6A 1KVIA 2FTRA 5HBMB 2ZJRQ 3OR2A 4EO6A 2FLPA 5CYQB 1OS5A 3IFEA 1ZETA 2HYIB 4KB0A 3EGZA 3QEIA 3DLGA 3GJTB 2ZJQQ 1ZZNA 4NA2A 4A59A 2PE8A 1JLCB 3WC2A 4I7FA 2RRNA 4UQTA 4OO1J 3TP2A 5A6PA 2Z1GA 4ZA1A 4DCJB 4ECUA 1XUPO 4RW6A 1RT5A 1MN9A 3EL2A 4AL6A 3FZKA 2F9JA 4JK8A 4G3IA 1EB0A 1M90T 2F9WA 4CGDA 3EX7B 2P9GA 1FHTA 3CCQN 3NCQA 3WUHA 1S1XA 3TJ9A 5KFFA 1X4HA 3OHRA 4FNIA 5ITHA 1MROB 2CPXA 5AE2A 2AGQA 1LW0A 5DS7A 3G0ZA 3NCIA 2WB4A 1X4FA 2X6NA 4B3MK 1UZHA 2G9OA 5IC6B 3P4UB 3R3TA 3T6JA 3OHAA 2VG5A 2F8EX 1BQXA 5KQ8A 2QC3A 5CYMB 3OLAA 4YB5A 1RCXB 1N34J 4BE1A 3EO3A 3PEJA 1NJYA 3DLEB 3B6BA 4ZIVA 3UR0A 2HAIA 1C0MA 2F40A 3SCKE 5KG7A 2O01C 2E8AA 1BIUA 1E4GT 3DC2A 1R8BA 1YIJS 2FPHX 4CIEA 1VLYA 4DCOB 3MEDA 2HOEA 5E7OB 4J7CA 1QJHA 3Q8SB 2Z57B 1KQSM 1UJ6A 3L7OA 1OY8A 1KKHA 4WK1A 3THXA 5KPTA 2FZCB 5FLXO 5DDPC 3DLBA 1YRXA 3T1YJ 4RNFA 1JJHA 5A8WA 4HYKA 1T6DA 1DQ9A 3TARA 3SBTA 4LIRA 2IC3A 5EOYA 2PI4A 4OHVA 2QKBA 3M32B 4JYAF 2BE2B 1D4XA 2E5LK 3OL9A 4K59A 5HJYA 3PACA 2YPZA 4DUZF 2ETJA 3OTBA 5KFJA 1SQGA 1S12A 1FE0A 2HPUA 4TU7A 3MFIA 5HATA 1AFIA 2Y3YA 4CZMA 2OIHA 3LOUA 3HHKA 2VFUA 2VH7A 4AXJA 1NSAA 5AZIB 2CJXB 1S9EA 3M8SA 2C2DA 4LBIA 3QDKA 3AVIA 4CF9A 3M8PB 1UL3A 4FLVA 2HF4A 2E1AA 1VC5A 1S6OA 2XSJB 2IDEA 2HVHA 2XWYA 4A5AA 3UDEA 4FYWB 3GILA 2E2PA 1VRQC 2RE1A 1SKSA 3KWMA 2OPSA 4C9DA 4H0TB 3LP0A 1UEKA 3PDNA 4C11A 4DV6J 4MTPA 4MO5A 4KFBB 2N7YA 2P9LA 4AHSA 2V9WA 3L4IA 3M9NB 4K50A 5LMNF 4CLKA 2HHHJ 4BRQA 4U8VA 3TZZA 1IO2A 4EIAA 3MFHA 1EXQA 4DSKA 3SQ1A 3PX0A 1NNEA 2ZH1A 5IFMA 2J9CA 1W7AA 4BRAA 4V1Ak 4AHRA 3T1HK 3KK2A 3EZ5A 3NNAA 1I5OB 1MA9B 3H5UA 3KKSA 4DTRA 1DTQB 2W9CB 4M5MA 2GAHC 4C8OA 1HI0P 4JKHA 2CVIA 1Q8LA 3QIPA 2VQFK 5KFQA 1KAZA 2V0NA 1RAEB 2QWLA 1WD6A 3MM5A 1P27B 1F2GA 4DFKA 1HL6A 1W26A 3HMJG 2DHGA 3SI8A 4K4VA 3M6GA 2GVZA 3T5KA 2P6SA 3M4XA 2CVEA 2O8FB 2P9IB 3GQCA 3LWLA 3CYMA 3A5OC 3O1BA 5AQRA 2F8MA 4TKTA 2OPRA 2HLUA 4BRDA 4EFHA 1XMOF 3DOKA 1RABB 2V67A 2YNFB 1SH2A 2Z58B 3H2VE 2QEXN 3DMJB 3G96A 3A8IA 3PX6A 4X2BA 4B3RF 2Q0UA 2N4DA 2A5XA 2FGOA 3H5YA 4B08A 3NAEA 3ULHA 3AD8C 5MLCV 5ETRA 4H4OB 1NH7A 1RWKB 1X5TA 3C6TA 3H90A 1YWXA 1KAYA 3BZKA 3ID6A 5AJ3F 5ETSA 2DNNA 3NBPB 3HX9A 3NH1A 3KHLA 2QWNA 4XPEA 4DPTA 1S5JA 1WDDA 3F5TA 3DOMB 4IOAQ 2NCKL 2BW7A 4QR2A 3G2XA 2ZWPA 4CGHA 5KFOA 1T3VA 3D2WA 3L7UA 4CBUA 3RVCA 2Q6BA 3E9OA 4O44A 1BMQB 4IG0A 2RILA 3FDSA 3ZT2A 3QNNA 1NUEA 3UI3A 5BPLA 4LFCF 3CMQA 3MPVA 4A61A 3SUQA 4EHTA 4DV2J 5L46A 5GIOA 1HBNA 2ZITA 1HI1A 5CY4A 3RG6A 3IM8A 3FEZA 2GNKA 1JXLA 1TU0B 3CPWR 3MAAB 2VKRA 1NK7A 2W40A 2JEJA 3HI0A 2HNZA 1C2PA 3M2VB 1K8KB 3G4SN 1YTYA 1ZBIA 3ETMA 4DZ6A 1S1VB 1VQ9S 5C2DA 5GMEA 3AD9C 1VK0A 3HL8A 4DR1F 4C3MA 3CCSN 2QJ3A 3B6PA 2XO6A 1SJFA 5KFCA 4MK9A 1JNRB 2J5AA 4P52A 2IY5B 3R6LB 1VSDA 1U2CA 4P7VA 4C0OC 1M0SA 4BR9A 1AROP 1N5YB 4FLYA 3RUBL 1HR0J 2B4UA 2QL7B 3EXYA 4QW8A 1J9AA 2R8HA 2NRXA 1S97A 4UW2A 4JD2B 3P4IA 1F1BB 1FTRA 1KP6A 3AGKA 3LDOA 3B4DA 4F3OA 3C46A 4PKGA 4PG6A 4CF0A 4DX8H 5AQZA 3MTKA 3U8XA 4BQLA 2PAVA 3F41A 5T7LB 2RUGA 1P9YA 3GFHA 2VONA 2NREA 4ZVTB 4F0MA 3W64A 5KRSA 2NYIA 1FK9B 4KV8B 3VWSA 1S4EA 4QJVA 1FRLA 2HBYB 3QINA 1KVAA 1YJ9N 4Q5VA 5LMUK 5HSPA 4DN9A 4YDUC 4FL9A 2GW8A 2IMOA 3P5JA 1MMNA 1CJUA 2QLJB 2RDIA 5F2RA 1KVKA 2IVYA 5AR0A 5EHHA 1BD6A 3Q0AA 2UVRA 4OGCA 2FC8A 5FROA 4F8RA 4OKJA 1SJQA 1RGVA 2FD2A 3K5PA 2V8PA 3DYAB 2KJWA 3H46O 1J5EJ 1H2VZ 4O0IA 1HWJA 4LF4F 3S8SA 2HQCA 1LV5A 2YHYA 1YT3A 5K14A 1RTZA 5JMVA 4IFYA 1VR6A 2ZH9A 2DNGA 2X51A 2CH6A 5FDLB 2Z1IA 1JLAA 4QU7A 3SQ2A 3CMES 2RSQA 3C8YA 1HNWJ 1G7CB 4BE2A 3TAMB 2ZE2A 1IUJA 3HVAA 3DM2A 5HLFA 4GMJB 3MHYA 1AB8A 4NB4A 4KO0B 4DSEA 1S6UA 1T9YA 5M2UA 5KG5A 2CPEA 3SMPA 2ZJPQ 5CH7B 4RR5A 4KHPJ 2MKCA 5LSLA 3ZLJA 3A5LC 3HOSA 1M5HA 3TZXA 1HBMA 1VGYA 3AVCA 4X66J 2W6LA 4X4VA 3IC1A 2YBVA 4B3MF 5AT1B 2W1BA 3SNNA 5AE3A 1AUDA 1Z4UA 2R2TA 3SUPA 1NAQA 4LF9F 4GV3A 2NXCA 4TQRA 2OTLN 3MPUB 5HQ8A 1TKZA 4P10A 1SKWA 5FJ4A 3SPZA 2P9EA 3MAQA 3ENVA 5A8KB 2QN6B 5BYRA 4YUDA 3BBFA 4BR7A 3T3FA 3NF9A 1NGBA 4I56A 3DI6A 4ZN1A 1TUGB 1NGHA 3HM8A 2CIMA 2ZZMA 2IM3A 1F0XA 3ZNUA 1UPMB 1YJWS 2KXNB 3Q2TC 3NP5A 3CXCR 4DUYJ 3A2FA 1GMWD 4CT8A 2GHVC 2GBZA 3FMBA 1LCUA 3CQ8A 2OSRA 4EWTA 1H2UX 4K8ZA 4CYUA 1VQSA 3I4PA 1XMQF 4IBNA 1M90O 3U7JA 3DXKA 1LQ9A 5HROA 3SDEA 3IR6B 1OO0B 2MKIA 1WNSA 5AFUA 3ENHA 1FF2A 3IRXA 4BY9C 2WVCA 4LUBA 3MD1A 1WKKA 1T05A 4DR3J 4R0JA 1RYSA 1R8HA 4BG8A 1HD1A 3BM7A 2KYXA 2MLXA 3SCLE 1D09B 1ZC6A 4DQIA 3CWJA 4RNHA 3DLHA 5K8MA 1OH7A 3ILJA 3LPUA 1Y3JA 3GIMA 1EQ0A 4F4YA 3PYEA 5AQKA 2CG8A 4FO0A 4FVMA 5G0RB 2NZ4A 3EE8A 1RT1A 1O6XA 3MDFA 2KHCA 1S79A 3OUYA 2RRAA 2IIHA 4UF4A 4E7KA 1U7LA 2QA2A 1HNIB 1TKDA 3HHLC 3FGUA 3O6WA 5LJWA 3CI5A 1PG5B 2FVQA 3PVXA 4ZTFA 3SQOP 2E66A 2DGSA 3BZQA 4IOAL 5HOOA 4CO4A 4BWMA 1RP5A 1IQTA 1NPKA 1Y97A 4XPCA 2BTFA 3QEVA 3OS0A 1RTHB 3KFWX 5ETOA 2PEBA 2Z2YB 3K5MA 3T1HF 1XN9A 1IKWB 1ZH5A 3OPKA 4KRFA 4FN5A 1EWQA 1I3AA 2DISA 4MO4A 2YKQA 1KVJA 1E6VB 3KLFB 3GU0A 1L3SA 4OHXA 2LXIA 2J9EA 2QE5A 2EWHA 1YJNS 2VQFF 2VFTA 2V6AA 2E1YA 4WFBQ 4JV1A 3C6UA 2DXEA 1PCAA 2HB5A 5AQQA 3D7EO 4Z7CA 3TQEA 3EUNA 3D0IE 4DTXA 1R7IA 4P2SA 4ELTA 1OPZA 5I3QA 3R27A 4ETZA 3CJ7A 2OPQB 3M8QA 3EVWA 3BO2A 2DGTA 1VSIA 1SVDA 4RNOA 4JBCA 3MPYA 1FNMA 4OZ5A 3THYA 3VA0A 2C3OA 4QWCA 5DM7Q 4Q0BB 4NLPA 3A8YA 1TQLA 1RWVB 5GINA 4NCAA 4CFAA 1RCOB 3C94A 4KGMA 1CG2A 3R8EA 1GMWA 3D0GE 3M8RA 1CPZA 4W5NA 3HSZA 4OYWA 3Q24A 2Y1LB 4HHHA 4UOHA 2P9KB 4XTTA 1VQMN 4K7QA 5EN1A 3ZZYA 4HI1A 1K1QA 5M1FA 1R3NA 3RRHA 3K0SA 1FFSB 1R59O 2D0OA 4CNZA 2HSTA 3OW2R 5IXUA 4ID1A 4AHCA 4O3QA 3SQGA 3CTRA 2UZAA 4F04B 1UFLA 2BH1A 3FFIB 1W2BM 2HRTA 2VGMA 1BQMB 1CVJA 2A1BA 1WNEA 1QE1B 1MU2A 4O0NA 3E51A 3KJFB 1N34K 4OX9F 3OTCA 1TKXA 2E5GA 4WXOA 3I55S 2LSNA 2VF3A 3M7VA 3CVKA 5KFEA 3J7YI 2PMWA 1S6QA 3K57A 4AUKA 3EN9A 2E7WA 2KKHA 1UFKA 4BCAA 4DX6A 1X9SA 1DTTB 4RPFA 1S1UA 2CQGA 3MECA 2OMLA 5GAHU 3KG0A 3CCVS 3VQEA 2ZHAA 3HZGA 4OI4A 5BRFA 4FZZA 3T1YK 2LXUA 2HWHA 3QPIA 2ZBIA 4OX6A 1PC5A 4ZP6A 4Y1CA 2PZSA 1U26A 4ZKAA 1WUAA 3FEXB 2J9DA 1NH8A 4WYLA 3KVGA 3CO9A 1YK9A 3J7AP 2DY1A 2K1RA 1TAUA 4U95A 2HHUA 1VQPN 3MX2A 3O8MA 3UB5A 2FJDB 5DMRA 2N7CA 3W9HA 1IBCB 4XAKA 4RW9B 1N88A 3GYNA 2EK6A 3KJVB 3DNCA 3BPSP 3W5ZA 1OSCA 4FJJA 2XZWA 3CCJN 4OYMA 3FSXA 4E3SA 3DGPA 4CGGA 1RT4B 4NRUA 1NGCA 4NLCA 3F56A 3R97A 4AILC 3I32A 1FJGF 1RBSA 1S0MA 4PG4A 2V50A 4OJGA 3VZHA 4GNIA 2QXFA 2XY6A 1NGGA 3I8DA 2G2YA 3SAFA 1WSIA 3W9JA 3P5BP 4N47A 1QUPA 4ES1A 2ZJPL 2CNOB 2YHWA 4Y0WA 3I8BA 1AXQA 3GFYA 2CQ4A 4J2DA 2IM2A 2YV0X 1HBOA 2QI2A 3CF5Q 1NDCA 3CCLS 2UUCJ 3Q7BA 2MPUA 3GSIA 2HBQB 1TZ0A 2UU9F 5F8MA 2ZM6J 4DV6K 2E7XA 4M3XA 1YHQS 3BSCA 3QQCD 5LMUF 4CIFA 3NCPA 2O66A 3BDPA 2XYHB 5H9FJ 1N33J 2HHHK 3MPWA 3MOJB 2YNGB 4B3TF 2UXDF 2NZCA 4GVEA 4AFFA 2W7OA 4CEQA 4IJAA 1BQNA 2UUAF 1Y11A 3PM9A 1BU6O 4DTUA 1CLFA 3CB4A 2F9TA 3W5XA 3J7YU 4IOBA 1VYAA 1GOAA 1VQ5S 3GJRB 3MI7X 1N0UA 1ASVA 4JI4J 1Z1ZA 3GR1A 3SIPB 1WOOA 2O8BB 3QGIA 4ZDNA 2XYPB 2BEFA 2ASDA 3VMFB 1LKZA 4PQAA 1PILA 1RE1B 5LJ5Y 3THTA 3ZSYA 4MFBA 3HSTB 2XO7A 2V4QA 2C3MA 2AKWB 4NLYA 4IXCA 3CCWA 1B0TA 2BXJA 2H5IB 4A8KA 1GLEG 5ETKA 2H65B 3JS6A 1EX4A 2X78A 4NLGA 3D9BA 3HJFA 2QIFA 1QVFM 2V7ZA 3A5NC 3LGNA 4E98A 1HQ2A 2P5VA 1WI6A 3GIJA 3AXMA 2M3DA 1YBTA 4RW7A 1N5VA 2R7UA 3L4BC 2QGFB 5AQTA 3W61A 5I3UB 3BKTA 3PR5B 3ZTOA 1YITS 1O1WA 3NRBA 4OI3A 3KHYA 4E1JA 4CEOA 3OXGA 3D6TB 2FZKB 4LRDA 2JGUA 4N7TA 3NKYA 1NNDA 4WE1B 4ATNA 3C19A 4WPAA 1D9AA 3VVTA 2W41A 1LFPA 4GKKF 3GE1A 2V8DA 4B9TA 1R43A 3K9JA 3DKDA 2GIFA 4NZ7A 2DNKA 4KHSA 2A1SA 4TYAA 4J9LA 1QY7A 1YIJN 1SIZA 2N82B 1ZOTA 4OPKA 4ECTA 3L8BA 3RRKA 1TL5A 2NQPA 3SAGA 2QTWA 2BJEA 2HBLA 2PC6A 2Z56B 1RT7A 4USUA 3D28A 5DG7A 2AGOA 5J1EB 5KFWA 4FLWA 3KK1A 4LF7K 4LFBJ 1RWMB 2LMIA 3KJQB 1MSWD 4LF5J 3G82B 4KH0B 2O5DA 1H1VA 2ZOMA 1VQKS 5L1IA 2MQ8A 5KTQA 2VD3A 2HF3A 2HG4A 3O5TB 4C23A 2OPPA 4FJ5A 5KFHA 4FJ8A 4OYOA 3UN3A 2FVRA 4L3QA 3WQPA 4DV2K 3MPDA 3CFRA 2E2OA 2D1CA 2J9DE 4DSLA 3M30A 3JSMB 5F8GA 2XQCA 3K59A 5BRDA 3W66A 4LSNB 2P9NA 1FD8A 4BR0A 2FUG9 3EGNA 5C7PA 4QQBA 1IJEB 5FIIA 2DO4A 4JI6J 2GVDB 2GIQA 4JI3F 3S9HA 4DR7J 2VPWB 4CZEA 4EK2A 4H0YB 4WFBL 3K8WA 3SPYA 2ROPA 4CZCA 2OI2A 2E2QA 4NLBA 3BF3A 2DJWA 4CZKA 3B8HA 4BRNA 1VQON 3K7RA 2M5YA 4C8NA 1RWNB 3P3DA 2YHBA 5HI7A 1VBXA 2Q97A 1WF2A 5DM7L 1RAFB 2VOOA 3OSNA 4OI0A 4L8RB 2NRHA 5BXIA 1IKYA 2XMWA 3D0HE 1HR0K 5K8NA 2A0FB 2DGQA 3ZSVA 3GG0A 5MLCQ 2HWIA 1G4CA 2HMPA 4DV4J 4C8YA 3C65A 2QM1A 2B6AB 1SIWB 4GO7X 4RBTA 4FYYB 2OLWA 2MKJA 4ILGB 3DDKA 4NCGB 3QFPA 2VGNA 3VAGA 4Q44A 4DV1J 2CZ4A 4ELVA 2R9LA 1FWLA 3QBWA 2DNZA 3IS9B 3KLHB 3TAPA 3E9PA 2AWZA 1VAZA 5DLGA 3IGVA 3HSDA 1S6PB 3DRSB 3IAYA 4GVLA 3V6JA 2ZD1B 1ASUA 1BWVA 4RWWA 2D4WA 2ROGA 3BBBA 5B09A 2GO9A 4PXDA 3VQ9A 1RQ0A 1SI9A 4K5SA 3EWGA 1UWAA 2GMJA 1U6ZA 5JS1A 3K17A 1MDUB 3GIKA 2PI5A 2J0SD 4ZMMA 3HVTB 4DV0J 5AQWA 1MWKA 2BJ3A 5D77A 2DGUA 2Y9HA 2F8HA 1J5EK 4NLRA 3JQMA 3I6PA 4QIWD 1NHVA 3AVKA 3Q8YA 1UW4A 5HL7Q 4BG9A 5JICA 4ED4A 1IWGA 1HQUA 2VPYB 4ZVPB 3IWXA 4WZMA 4MLHA 3MM6B 2OUGA 3M6XA 3QT6A 1B9FA 3OTOK 4YORA 4JI2J 1HNWK 2HQ3A 5KT6A 3NE6A 3ZZTA 3QNWB 3VQ8A 3QBCA 3MTJA 2WFBA 3HLUA 4CLSA 4J2EA 2XLJA 1T02A 3KLEB 1FRJA 3WXJA 4HT5A 4O4GA 5DDQC 3PW0A 4W5RA 1FXXA 4CEEA 3S3MA 2VG7B 4LSLB 4KHPK 1FVSA 3H7HB 1KEKA 4XEIA 3AY0A 4TLQA 5D4LA 2HRYA 1HPZA 3UVJB 1N8RT 3MDQA 1OIAA 2RUSA 1MNEA 3BUZB 5H9EK 4DPUA 1HMVA 2KT2A 4M3WA 5H1SQ 3CF5L 3DGVA 1C0UA 4ER8A 1HRHA 4FM2A 2LEAA 3KLIB 2B9YA 4KR0B 3CC4S 2R8JA 2PO4A 4I4BA 2J0XA 4B8CA 5KAKA 5C25B 4JHDB 2UXCJ 4CVNE 1Q9XA 4J9SA 4EYHB 4U7BA 2CAJA 2P9SB 4DUZJ 3CSKA 5J2PA 1O8BA 3DRXA 5HRPA 4EBEA 4YHHF 1IVZA 2E1CA 5E3QA 2XS7A 3NS6A 5AQVA 2MGZB 3BYRA 3HO1A 4J9RA 4Z0UA 3CJRA 2AYBA 3CFOA 1NZ8A 2ZWHA 1VQ9N 4YDDB 6AT1B 1X4BA 1KSPA 2HVZA 4DUYK 3T1YF 2M8HA 1NHUA 3NGUA 3WXKA 1I94J 2UXBJ 3IP0A 4I2PB 5LM7E 3DLKB 3NG8A 2J6UA 4AE5A 4DQQA 2YNIB 3GZ7A 3V6DB 1NM2A 1DT9A 4NYFA 1NPRA 2CADA 4TSXA 5D3GA 3R5AA 3ZEUB 3WNGA 2YXLA 2V7YA 1W9HA 1UVNA 3MOZA 4DR3K 4IG3A 3PZPA 4AQYJ 1TVRA 1MLAA 3CJKA 2EX3A 2Z4PA 3CNQP 3AO5A 5A8RB 3LUYA 2XHWA 3WXIA 1ZM4A 4J9KA 2KZZA 3H3NO 2R7QA 4DJBA 2FBVA 2BUNA 3S01A 2FDNA 4DMZA 1WBDA 2DGOA 4CJPA 4IO8A 1JLFB 4OYXA 2E9ZA 2OJ3A 2WSEC 4DU7A 4ZHRB 3VCDA 4C48A 4H0XB 1O5JA 3FZLA 1A5WA 1WG4A 3D3CJ 3SJJA 1GLFO 3KZBA 2XSFA 1VSKA 1NO8A 1V3SA 3JQJA 2LQBA 2HHHF 1U6BA 4M5LA 2O8EA 2HVEA 4JS4A 2P8IA 1CJTB 4DV7F 2LQ9A 2FF3B 4H5WA 1T11A 5B0EA 5IV4A 3CJ0A 5ADXA 2CWXA 3TZYA 5HP1B 4C8LA 4GRSA 3D1HA 3OS2A 1YRTA 5KFUA 2PD1A 1RAOA 2XY7A 3VQAA 4FDFA 4CEZA 3DLRA 1RBUA 4Y2MA 3S3NA 5HBMA 5DZ7A 3F0NA 5ADZA 4E1MA 5CYQA 4KT0C 4C6AA 1BA1A 3UE5A 4ECRA 4EUVA 3DRRB 4WCEQ 1JLCA 3QMQA 3O80A 3THWB 4KE5A 2PGCA 4QCLA 1DQ8A 3R1LA 1FXLA 5FRNA 2JEFA 3VAKA 3D66A 3SK3A 4CFCA 4NLDA 3OL8A 5ETLA 1NLKL 3DDIA 1TL4A 1GEHA 1JWWA 5F41A 2EBGA 3CW2C 4XDCA 2DVIA 3JXOA 5L9XA 3AVBA 3DWLA 3KLGB 2DRAA 4YY3J 1MROA 3O3GA 1REVA 2QL5B 1WG1A 4BROA 1K47A 2ABYA 2AEFA 3BSAA 1K1SA 2ASOA 1X8DA 4LFCJ 3CCMS 4D3HA 4NPOA 2BABA 4DHYA 5CYMA 1R6VA 2C1EB 5F3TA 4FZYA 4JKBA 4PHTX 4ZN3A 3V81B 3MMCA 3VEVA 3DLEA 2IDOA 3LALA 1EWRA 2ALZA 4FK4A 4NWBA 2VJVA 3SSQA 1C0GA 3SQ0A 4KIAA 1S1TA 3PLAA 4EMDA 1UA0A 3AAQA 3T5HA 1V4TA 3N9UC 3R2DJ 1VQLS 4OZ2A 2VFRA 1OH5A 5E41A 1D8ZA 2Y1IA 3RRGA 3NMRA 4WQ4A 3ZZUA 4IQXA 2QXLA 1YZ7A 2BM0A 1JXBA 2DCLA 1XERA 1Q78A 2XI3A 2ACMA 4I6MB 2G0CA 1KBRA 1FNOA 4GVBB 4LQ9A 1PYTA 4DV2F 1T03A 6FD1A 1B0PA 4PKHA 3M32A 3HD1A 4FWPA 2OGUA 5F0XA 4IDKB 2BE2A 3O3LA 2NS1B 3HP9A 4CT9A 2ILYA 3OV7A 2DR5A 3HK2A 2QYCA 2OEJA 3H20A 3SMZA 2BQUA 2VFSA 4ZK7M 3ILLA 1N4LA 5HL7L 3MD3A 5AZIA 3BYPA 1KTVA 3EE3A 2WBMA 2JFKA 3ILOA 5L8RC 4FJGA 1KVCA 2P9UB 3VERA 2DGXA 1GOBA 5A2QY 4HT7A 3M8PA 4KQZA 1RTDB 3MR6A 3CJSA 2XSJA 1FFWB 2KKZA 1HR0F 1W2BR 4ZIWA 4H5VA 1NGIA 1UZDA 1TL1B 3NGSA 2QYGA 2B4JA 3FMWA 1UEUA 5EVZA 1T0TV 2LEBA 3NLCA 3OVBA 3TR5A 4KFBA 1TFYA 3BN4A 4IKFA 1T9XA 4LF8J 2X3DA 4Z4IA 4DUTA 3MCMA 1ZPWX 4IRKA 2V9KA 2QFIA 2HHWA 2ACYA 4PWUA 2GWJA 2UUCK 2AJ1A 1U8WA 1RWXB 4CNYA 1FERA 1CQMA 2ZM6K 3BBCA 4PWDB 2BE9B 4EO8A 5JS2A 4Y2AA 2Q36A 3OYGA 3AHPA 2UUWA 1NJXA 1XEZA 1N33K 5H9FK 3AJDA 2GUIA 1S49A 2F3JA 2Z2MA 1UOCA 4E7JA 2MXYA 1NPPA 1YJNN 1DTQA 4E7HA 4AD6A 4Y65A 2AGPA 2OHDA 5JVHQ 1I39A 3DFEA 2Q31A 1SQFA 5BR8J 3BEXA 2UP1A 1J2VA 4W5QA 3CJ3A 2JEGA 3HD2A 2DGVA 3AH6A 4JI4K 4NXNJ 3MZIA 2JZ5A 5KOXA 3D6HB 2Y0SD 1N52B 1JLGB 3P83D 2VBXA 3O3HA 1J5EF 4HTIA 1OYDA 4IDHA 2WUSA 4ECXA 5DJBA 4GV6A 2D5RA 4BRMA 1P6TA 3I0SB 3DAWA 2P9IA 2JC0A 4CTAB 2AJFE 5AXNA 1F9HA 1XNQJ 1R0CB 2K3KA 3ZC4A 2QA4N 3MEEB 3W2WB 2NRTA 4A47A 2C2EA 9ATCB 5AQYA 2V2VA 3PJWA 5E3PA 4P9SA 2YNFA 4X4PA 4BWJA 3UKRB 1HNWF 1ZPVA 5AQGA 1LEOA 3H25A 1O51A 4B3OB 2E44A 5GIPA 3CD6N 2JH3A 1HBUB 1L3TA 3UDLA 2NZTA 4B3SJ 4WP9A 1A6LA 4F25A 1WKLA 5HJXA 2XG8A 2FBXA 3PTWA 4LFAF 2KFYA 3VAHA 4EGLA 4ES3A 2RD5C 4H4OA 2RQ4A 1O0PA 1I51B 4KHPF 4QBUA 3TA0A 1RHRB 1OVYA 3NBPA 1Y7PA 1MWYA 1JJCB 5KG3A 4YOYA 3DOMA 1U48A 1J54A 3HFZB 1S22A 2KHDA 3I55N 4X66F 2RQKA 3M9MB 1ESVA 1ZBSA 3RR7A 2JLGA 1WC1A 1IBKJ 1FFGB 3AV9A 2C3YA 2BGGA 1VIOA 1T9TA 4B9NA 4Z4CA 4NE9C 4W4MA 2HQDA 2AHOB 4H0VB 2GJFA 2YI1A 2V2QA 2ZDOA 1HI8A 4RTFD 2B4OA 4KPCA 1XNRJ 4I6AA 3CC2S 2QA1A 1XMQJ 1O13A 2AP1A 4LFBK 2EXUA 1OJ4A 2V5HG 3TRGA 2L3MA 3T6BA 4LF5K 1EP4B 4NYZA 3NEKA 3CCRS 2UUBK 1VRUB 2NLXA 4ZLLA 2FHMA 3MAAA 2RQCA 4OPAA 3U9ZA 1NXIA 5I4MA 5KQDA 2WTFA 4J9MA 1EJ7L 1QVFR 2PFDA 2KG0A 1ASWA 2CH5A 3M2VA 1K8KA 3QRQA 4DUYF 4KJIA 1S1VA 3ZFVA 3PHEA 4G9ZA 1TR0A 1TV6B 4JI6K 3MCPA 2LA4A 4DG1B 3QZ8A 3VGVA 3KHGA 4DR7K 1CLQA 3M6UA 4LJMA 2GIRA 1FA0A 4ANCA 2AMCB 2I7PA 4KHQA 1YVNA 3HKWA 4DL6A 4WCEL 1N5YA 2W2QP 2D9OA 4ZVGA 2RS8A 3EPIA 1N8RO 5AQPA 4DR3F 3PX4A 4FSVA 3OS1A 4WK3A 2B3TB 3CDUA 4O3SA 4ILRA 4AYBD 3MX5A 4BR4A 4MAKA 4UY8T 2BVZA 2LQ8A 3B4MA 1Z25A 3TA1A 4FM0A 1A5VA 3CHWA 2KRBA 2MKSA 4CBXA 4GMKA 1ULRA 1Q79A 5KFIA 4DV4K 1NK0A 1K0TA 5GAEP 3ADAC 1RTIA 1R0AB 1FE4A 2J7KA 3GYGA 1R89A 3ZETB 1WOQA 5LJVA 1CBKA 3Q8UA 3U6FA 4WF9Q 2SXLA 2KB2A 4DQPA 3OR2B 4ZJLA 2R8IA 3M1FA 4DV1K 3T69A 5LL6Z 3NS5A 1Q81T 2HQFA 2C3PA 2G0JA 4HKQA 4L3KA 3AVGA 1JKHA 2PFUA 5CCLA 2FGCA 3A1YG 3K2PA 4J9PA 3V4IB 1N6QB 3BGUA 3QT8A 4DCPB 4OJRA 4G1PA 3MR2A 3N0VA 4M8LA 4USMA 1V3ZA 3DOLA 2YKNB 3DYAA 2ZVIA 1ROFA 5E0OA 4O4RA 3ITHB 2K7JA 2ITGA 3BDEA 4ANEA 4X4OA 4BDZA 2YQ3A 3TANA 1UWBB 4IUFA 1NMNA 4RNNA 5C24B 4OI1A 4DV0K 3OFHA 4WP8A 2HFVA 1VQYA 1Q8IA 4JI8J 5FDLA 4O5BA 4K4XA 3AVHA 3FJ2A 5I9EB 5J2NA 3GV5B 5EDWA 5J1PA 4M3ZA 3SUNA 2BV3A 3T7ZA 1UVMA 4I67A 2HW3A 1RKJA 1U2FA 2A40A 5T14A 2DNOA 3TAMA 1Y10A 3RMBA 5LXYA 2HHVA 1YITN 4H03B 2FLLA 4JUZA 3VGTA 4KO0A 4AL7A 5BN8A 1WHYA 2FJXA 2PN6A 1GXTA 5RUBA 3CDWA 2OFGX 4UUXA 3MEDB 3PJ9A 4FPBA 2ASMA 4DU8A 2XMMA 4OX9J 2A42A 3QYYA 3RSEB 3UQSA 2Z2ZA 1HYSB 3QFHA 3FZHA 1K9MO 1RT3B 5JVGQ 2CGLA 4BREA 3ZTPA 1HQEB 3LW5C 4WYBA 3RWUA 1D9FA 4P7TA 1EHWA 3VETA 1U6FA 1NDKA 3GJQB 3D3BJ 4BC3A 1YJ7A 2HS0A 3J81Y 1IM6A 1LXJA 4O3OA 3IBFB 2ASLA 2ZH2A 4K5RA 4QS9A 3CIZA 2XLKA 4K43A 1NHKL 3MM9B 4CJLA 4J37A 3MM8B 5J1NA 1VSEA 1S5ZA 3KDOA 3CCES 4K4WA 1VLOA 2Q6CA 1RJJA 1RHJB 5A8KA 2UXCK 3SYZA 2AZ3A 4OZJA 3Q8RB 1SH3A 2E29A 3JAMY 1W2IA 4E1NA 4DUZK 4BRGA 2GHWA 1QM9A 3MWPA 3RZAA 4I9QA 3HSCA 4WFZA 3D2EB 1XIQA 4ED7A 1P8ZA 5JVHL 4CM2A 2EEYA 3H6EA 1FDNA 1X5OA 2QLBB 2E1PA 1U1LA 3GSDA 2M70A 2FY1A 2IJNA 4F67A 3ID8A 5IWAJ 4IH7A 3HFKA 2GMHA 2OPSB 4CHZA 4URSA 1FWPA 1NJZA 4PCQA 1RYRA 3TO8A 2MZTA 1I94K 4P73A 2OELA 2UXBK 4C11B 5KFSA 4KI6A 4A57A 2E9TA 4CFDA 2R7VA 5AXLA 2HK2A 1VMBA 3R9LA 3WX4A 1RDRA 1JQGA 1UJ5A 1Z2ZA 3EM1A 2B0GA 3PFEA 5C15A 3C14B 2UU9J 4CCHA 4M5DA 3G6ES 2VBWA 3W2VB 5ETQA 3T41A 4FWLA 4UT4A 3C16B 2P51A 1N5SA 2VA3A 1E6YB 2QZ8A 2YWEA 1K6YA 8ATCB 3GFXA 3AO3A 4NYNA 4AQYK 4GY2B 5G0RA 3QT7A 3MAHA 2DK2A 1WELA 2D3UA 4LF6J 4B3TJ 2UXDJ 3KOAA 5IT4A 4KI4A 2MKHA 5CD4A 4DF8A 2J6TA 4ED0A 1AFJA 1H6KX 2UUAJ 2HHSA 3NXZA 2A6AA 3VEZA 3LA0A 5DDRC 4OZ3A 4G6VB 4YMEA 1HNIA 5B0DA 4B1XB 2Q0RA 3C6HA 2CG4A 3ULEA 4DR4J 1I3OB 4Y00A 2KXHA 2UUCF 2MLYA 2I5JB 1HHTP 4EZ9A 4DQSA 1M5KC 4QU6A 2ZM6F 1HYZA 4DSIA 2MZ1A 3ZSRA 4B1VA 1RTHA 1UVIA 1KTQA 4QIVA 3KNGA 3JB9k 3E9LA 3KIOA 2QMXA 2HQGA 1QTNB 2W8KA 3MXMA 4RWTA 3CJCA 1LFWA 4YR3A 3MMAB 4ZJOA 1BO5O 1YI2S 2ZH4A 3DN9A 1E6VA 3KLFA 5KFPA 2E5IA 4OLBA 1U0HB 4GVMA 3R3LA 5EY4A 4RJVA 1KOHA 4U9RA 1R27B 1FRHA 2BKOA 5AQNA 3HHEA 2P9CA 1WSHA 3Q89A 1HYVA 3AO4A 3LM2A 3VF2A 3QLHB 3O8WA 3HPOA 3T19A 4CQ1A 4NA1A 2KU7A 4B02A 2RKIA 5HRNA 5AZJB 5FLXU 1CJKB 2EWSA 4AHUA 2OPQA 1VIXA 3NGIA 3C6TB 2HK3A 4B3RK 5AFUH 1AZSB 4GKKJ 4CJKA 2QWOA 3L6QA 3LAMA 5ETPA 2RU9A 3M6WA 3OYCA 2AYEA 3FGVA 1SS6A 2DXDA 2KL8A 3PW2A 4BRHA 3NY0A 1FD2A 1WKJA 4DU3A 1IN0A 3VAMA 5DQIA 2M7SA 1RCHA 3OYDA 4PG8A 3H2LA 4PYAA 2VYPA 1RA6A 2BYCA 3AAPA 3FK4A 5KG0A 2P9KA 4FF3A 4OHWA 2MQNA 1FESA 4YEAA 3KHHA 5CA5A 4ED3A 2BKNA 4YY3K 3BH7B 1KCFA 3EDQB 3PW7A 2Z2LA 2GA7A 3HKZD 3NWRA 3NGZA 3Q83A 1SV5A 3VGSA 5C2GA 3VAFA 1KOOA 1N32J 1HWUA 5L9NA 1F2HA 3FFIA 4LFCK 2D41A 2IA0A 1WLJA 4CBWA 1NK5A 1BQMA 2KN4A 1SPBP 4KPYA 1RDWX 1QE1A 4P75A 3CJQA 4NA3A 2KRRA 3MURP 2NRWA 1HWLA 1VSLA 3JTPA 3AA3A 5ETVA 3QO9A 4WQ5A 2CQPA 4WF9L 1SUQB 4ECYA 1DTTA 4FS1A 2V8HA 1U09A 1KQGB 3DU5A 4E0DA 4LF5F 3VESA 2JWNA 2BX6A 3O4QA 4NL5A 4I1TA 1ZA1B 2ZUAA 1ZBUA 2E5JA 3N6MA 4UZCA 2DXFA 4AHVA 5K5MA 1SJ3P 3HF5A 4DL3A 1RBRA 3TAFA 3OYKA 4A8YA 3BN7A 2HSEB 4W5OA 1AUSL 1TYQB 3I9ZA 2XULA 4JI6F 2J0QD 5GADI 4PUOB 1SJ4P 4FXVA 3NHGA 4DR7F 1QAYA 2LU1A 2JEIA 4RW9A 4LH4A 3CIMA 4C4WA 3BZCA 2G8WA 1ZS6A 1ZXOA 2HMIB 2G0IA 3KJVA 3L09A 3I33A 3ENQA 1Q8KA 3FQLA 4OKEA 5D8HB 3L9ZA 4U6PA 3MR5A 1TUUA 1YUWA 4DFMA 3I0RB 4R5PA 5HVGA 2H51B 4IFVB 5KFDA 2ZQBA 2ZKUA 1HHQA 4BGBA 3N6NA 2RE2A 1M5PC 3CCTA 3NCRA 5CCMA 2OA8A 3OVSA 1Q86T 2FJWA 3ZT1A 1BC6A 5JVGL 4HDHA 3WQTA 1FRKA 4DV4F 4LRFA 1RDDA 1SH0A 4NCBA 3PHTA 3U3GA 4L76A 4ILJA 4LF8K 2WONA 1KWMA 3MN6A 4PKDB 3HXMA 4KHMA 1RT2B 1XR5A 4ID5A 2YNGA 2QSFA 4IFYB 4DV1F 1TL7B 4E2FB 3DXMB 4WQ4C 1NGFA 1JLAB 1ZBLA 1UAXA 5CABA 4HHUA 3AXKA 1WI8A 2DT9A 3KWIA 1DLOB 3G25A 3VPZA 2H4WB 4M3YA 1IJJA 1HUXA 1RT6A 3AVAA 5HLFB 5KFTA 2QTDA 2O8BA 3BY5A 4ED2A 2HQIA 2C2KB 2JFDA 4WIIA 2AD9A 1WSEA 2N3OA 3AVMA 5A0YB 3GG4A 5BR8K 5B0BA 1NKCA 3NOCA 2W8LA 2XNRA 2ILZA 5KPRA 4JLHA 4DV0F 2X1AA 4NXNK 2HBJA 1WAFA 3MCNA 3BH6B 1RLCL 4KHWA 3NF7A 4YB6A 5IC4B 3B78A 1X0PA 2DIUA 3I31A 5B0FA 2WRMA 4ZLPA 2CZ9A 3PIOQ 5GADU 2CQCA 1XNQK 4FPIA 3VQ7A 5I3UA 3VQ4A 3N01A 3VEWA 3C2PA 1Q7YT 3U02A 4CDIA 4YNQA 3P1GA 3CDEA 3CCMN 4HVZA 4JI2F 1SB6A 4OX8A 4LF9K 1W0HA 1ATRA 4CRJA 4B3SK 3N4QA 1S9GB 1Q81O 3W62A 3WZ0A 5CZ1A 3DRPB 1U1NA 4NI2B 2DTUA 1SL1A 3CJ1A 1B9DA 3C6AA 2ZHBA 2F1FA 2D1KA 4YHHJ 1LWEB 5E5NA 1H2TZ 4BDYA 4B8AB 4F0HA 1VRTB 5CYJA 4Z4EA 4JI0J 1DRZA 3ZX3A 3AT1B 2DPJA 1IBKK 4CLPA 1YX2A 2WBNA 2V8GA 4RKUC 1GAOA 3G86A 3G82A 4B9SA 1F21A 3N5BA 1T7PA 1GLLO 2FSKA 4C8ZA 2NXEA 3ZTSA 3TU5A 2NUHA 2ZBQA 3HDSA 1XHXA 3DDNA 5KG2A 2HIQA 3ZZOA 2WVDA 1EX8A 1T05B 1SCJB 3OL6A 1XMQK 1QSLA 2UXCF 1Y5LB 3LDLA 4ECVA 4QS7A 4RX6A 2LYVA 3RAQA 1QQCA 3JSMA 4LSNA 3LPEA 4RU2A 2VPXB 1VHXA 4FWNA 4Y28C 3BGLA 3U27A 2YWHA 3H45C 4CEAA 4DR2J 2HZVA 5AQFA 2GVDA 3CQXA 3M5RA 1KQKA 4MYTA 1JLQA 2YKMB 3VGLA 2G4BA 2W01A 1IXKA 3BF4A 4DV5J 2B4VA 4V19S 3KTQA 2W9BB 3BKUA 5A6WA 3FCHA 3WIVA 2Q43A 2B9XA 3RMDA 1KLMA 4QW9A 4H54A 2NNWA 3O9SA 1NGDA 1GX6A 3R5BA 2XCPA 1I94F 4CHPA 4F4AA 2YH1A 2UXBF 4PXBA 5AQOA 4C1NI 1UVKA 3DJCA 2QA4G 3TX0A 4F4KA 3ZO7A 2BANB 4LD0A 3CO0P 1QQMA 1FO1A 4DFJA 5KFVA 4CO0A 4TLRA 1WC4A 3OXFA 5KFGA 4AQYF 4PQUB 2ERRA 1X3MA 3LP1B 1FDDA 3WDOA 4IRCA 4DV7J 3MCOA 1T94A 5M1OA 2FHKA 1A7GE 1C4AA 5I42B 1Y0HA 2W6KA 4OZ0A 3BQ2A 2G13A 3IGNA 1BL3A 4IYQA 2MSSA 4UOGA 3BGRB 5GAGI 4NCGA 2LQJA 4XIUA 4NLWA 5L1KA 4BE0A 2CPFA 4YOTA 1B70B 2AEMA 2UV8A 3MXIA 1SBRA 3C6UB 1S7HA 3ZXWA 2EHGA 4OLOA 3V1QA 1VHIA 3IS9A 5DGAA 3HULA 1D8YA 1FDAA 3VF0B 4L72B 1G2EA 5GMDA 2R4FA 3FFKB 3DRSA 3AB4B 3ULDA 3M8QB 1VJWA 2ZD1A 3G6YA 1L3VA 4RZRA 3HPGA 5EXWA 1WHVA 2CRLA 4KGVB 4ZVHA 1RB0A 2DH7A 3Q23A 2XMKA 3FZBA 3QZ7A 2POKA 3BS9A 3FCVA 4OV6A 5FPDA 3HVTA 4YP3A 3EY1A 2IPOB 1FDBA 3GYXB 2XCAA 3I5BA 3VVUA 3THPA 2HLTA 2FC0A 3I56N 4ICLA 5DG8A 3FNNA 3OR1B 2HFSA 4CHYA 1LWFB 2VG6A 4USIA 1CQNA 3V9UA 3MM6A 4JI8K 4USJC 4CIOA 3Q7CA 4HI2A 1H38A 1R0BG 3KHRA 4WU2A 1VQ8S 3Q8VA 2MYFA 1ITPA 4J90A 4WFAQ 5JLHA 1H74A 2GS8A 3BP8A 2WW8A 3O6QA 1X5SA 4WTYA 2RU3A 2GEMA 3E66A 3ZSXA 5L1JA 2ZNZA 2WBRA 4A8OA 4MKBA 3Q8PB 3IR5B 4LSLA 4OX9K 4YY3F 1S1UB 1V5VA 3OTDA 4DXLA 3MECB 5E33A 1Q82T 4F0KA 2A18A 1TUYA 5DGBA 2OD4A 2VASA 1J5OB 1NBWA 4X62F 5IT9Y 1GLCG 2P5OA 2Q3SA 4M5GA 4DL4A 3CC2N 3PYDA 3KLIA 1Q0NA 4F50A 1VJQA 5GAGU 3OLBA 3ASMA 3LGHA 4M63A 2KM8B 4M42A 5C25A 3OFFA 3KKRA 4JHDA 4AT1B 2KFZA 3K9KA 3G4SS 3O1WA 2K1RB 1BLUA 3V9WA 3CCRN 2P9SA 3VHQA 1B0VA 2BA9A 4NLUA 5LSRA 3CCSS 3QESA 3DRYA 4QR1A 1SAZA 3R7BB 1NBEB 5KT7A 2MGZA 1AT1B 5C5JA 4NZ0A 1WB9A 2B5JA 3P45B 4JKAA 1U2VB 1KLNA 2V69A 4CJVA 3PNIA 1WF1A 4OZ1A 2ZJRL 1NK9A 3BREA 3MUTP 2VB6A 2QLXA 5T41A 5E3CA 4TN2A 1T9VA 2ZJQL 1VOMA 5M2PA 4ZP9A 4WFNQ 3P38A 5K20B 2W7AA 4TU8A 1FJGK 3DLKA 1EAYC 3OBIA 2K7KA 1N36J 3RGIA 4D3GA 5IWAK 2YNIA 1C1BB 1OYEA 2F65A 3V6DA 1VBZA 1HBOB 3VTHA 2MZJA 1GXLA 4CJ4A 2NYHA 3Q86A 3ZEUA 3HI9A 3DU6A 2X7IA 1CS4A 1YTUA 1KD1T 2I0XA 2V52B 2BJ1A 3PIOL 4M7XA 2W4DA 4QOTA 2G8KA 3KD5E 2BUPA 3PUFA 1YJ9S 3AOAA 4CLZA 5KG4A 2QRRA 4YB7A 2MY8A 3Q2SC 2UU9K 1IKXB 1HHSA 4ZVSB 4LREA 5D15A 4KB7A 2HVIA 5A2QO 1BQNB 3DCAA 2IM1A 2Z30B 4CZFA 1JLFA 1VQNS 1JLEB 4JP8A 1VC6A 1M1GA 4LF6K 2CDRB 4B3TK 1NK6A 2UXDK 1EARA 1S3XA 3HZ6A 4HEA9 2UUAK 1RISA 1PJ6A 2YNHB 3NVKA 2KT5A 5GAEI 3ZTRA 2VICA 2H54B 5BPNA 1XC3A 2X1BA 4MFBB 4LF8F 4FJ7A 4DR4K 4NXMJ 1WDTA 4MDBA 4OHZA 1CJTA 4OJ1A 3RBEA 2PA3A 1I1GA 4F3QA 4WFYA 3PG9A 4DTJA 1DJ0A 3SCXA 4I2QB 2D7SA 2G2ZA 1EKSA 4CJ5A 2WVFA 4OZNA 3UCUP 1NGAA 3CCUS 1FJEB 3PO5A 5ETNA 5HO4A 4F4XA 3W8PA 1OY9A 3POTB 1SZ2A 2E9RX 3OY9A 3ISNC 4HTLA 2D9PA 2ZKTA 1S48A 4X4NA 4WXWA 1JB0C 2IDLA 5BR8F 4ALZA 4B9LA 2CKWA 3DRRA 2AF6A 2CZVC 1N48A 3PSFA 4NXNF 2L08A 3THWA 4LFAJ 5JLFA 3JYTA 2DGWA 4F3MA 1Q18A 4LRAA 3T5LA 4HDGA 4ZITA 2MZRA 4IWVA 1W7WA 4PR6A 2CQ2A 2AIRB 4M94A 2GTDA 1Q86O 2D3O1 4GKKK 4BS2A 3W63A 3K8VA 2F63A 1EIYB 3ENAA 1RSCA 5D0HA 4AL5A 2GMLA 1RT7B 4MKYA 1XNQF 2DY9A 3MCAB 4CJUA 1S72S 3KLGA 3SV4A 3VGUA 2VOPA 3R5CA 4TY8B 3MMBB 2F8TA 2K2PA 2DR8A 1JXEA 4RG8A 4DFPA 1S59A 4JKGB 3C66A 2WK4A 2QWMA 3VQ5A 3MN5A 3LTOA 2GELA 3MEGB 4L75A 4B3SF 3UKUA 3AA2A 1UCNA 4K2XA 4ZVUB 4C1NK 2P9PB 3V81A 4E19A 5CE3A 1S0OA 4WZQA 2P9NB 3CCEN 1N32K 2KZMA 5HANA 4CHOA 1R31A 3RJMB 2BJ7A 1U1MA 3TAEA 1U04A 2HURA 4B9MA 4A62A 4NZ6A 1NG9A 4Q7AA 1IBKF 5GAEU 1PC4A 4Y2KA 4LMZA 3I82A 2VWKA 4JI3K 4C97A 5ADXH 3GR0A 2VBZA 5JXSA 4I6MA 1XNRF 3HHLD 4CO5A 3KKFA 4GVBA 2C2MB 5LL6d 4EBDA 4M5JA 2OEKA 2YX6A 3IN5A 4KC5A 4S0MA 1DFDA 5CHIA 4IDKA 4UOFA 3K5OA 1VQ7N 4AM6A 1BGXT 2H3EB 3G87A 1BDGA 1ZTWA 2VWBA 5HN0A 4ENOA 3CJAA 4HUGA 5E26A 1Q7YO 3E01B 1JLBB 5F0UA 3UPFA 3QJJA 3ET6B 4KKOA 3RTVA 1D1UA 1JIHA 5AQMA 1QTMA 2FJAB 5DETA 2E6LA 3VOVA 3TWZA 4OJ3A 2HGLA 2ASPA 3AA5X 1RHMB 2P9UA 1G1XA 4KHYA 5KFKA 2XZTB 1RTDA 2Q79A 4EBCA 2ZGYA 3D6RA 4JI7J 2QK9A 5TKWA 1FKOB 2ZH7A 2BQ3A 5TKYA 2CPIA 2CJYB 5KGXA 4WFAL 4AXIA 1WC3A 1TL1A 1U1PA 3VQPA 4WU3A 2QWPA 2BJ8A 2OYQA 4NEYA 3D4JA 5GMKa 5HMXA 3F9KA 2ADBA 3D6FB 3OBWA 4LBHA 2DYAA 3KLVA 3MR7A 4CJWA 3LAKA 2BBEA 2FC9A 2F9DA 3UD5A 2Y1RI 4M5IA 5SUHA 2GZOA 2UV8G 2LECA 2YH0A 5GAHI 4G1IA 4DSJA 4FF1A 1KAXA 4H4MB 4CJTA 4P2XA 4ZVEA 3ISZA 4KH4A 3SCJE 1WC6A 4QR0A 2J7WA 5M1KA 4CJEA 4CH1A 4PABA 2UVUA 2F4VJ 2DH9A 4PWDA 1T9UA 4WQ5C 3FSIA 3G71N 1F5BA 3Q8QB 2PFFB 6FDRA 1IG8A 3SSRA 1YI2N 3K58A 1WACA 2GHPA 3LPYA 3VEOA 2CJ9A 1Y00A 2MMYA 4I0WA 2VIHA 1IM4A 1HA1A 3ZYYX 4UOCA 4GC6A 5E84A 3HVWA 4DL2A 3D1OA 2NRRA 1YLXA 4W92B 2QFJA 3W9IA 4CLTA 4JKDA 4WBFA 3SCIE 4LBPA 1HKAA 1KN6A 4IEIA 1JLGA 1VISA 3LO3A 2IRUA 4R25A 3EGWB 4TQSA 2HHXA 2IIRA 2UUTA 5AQSA 2ZOFA 2GUPA 3ELHA 2H48B 4XK8C 4Y0FA 2KJVA 4NLXA 4CTAA 4WFNL 5EWGA 4ZLJA 1JCFA 2XS2A 2RRBA 2KVIA 2C2RA 4JI8F 2E88A 5CXTA 3AFGA 3VAJA 3W2WA 1PAEX 1X7VA 2NXNA 2KT3A 1HNXJ 2KXFA 1WTFA 1Q1KA 4N5SA 4H8KA 2W24A 4CHQA 2KFNA 3UKRA 3OYEA 2FIUA 2WAQD 3S7RA 1HBUA 3C7NB 4X84A 2HNYA 2VBYA 3J7A1 2R7OA 2G8HA 2KTQA 1S10A 4F2SA 5GVQA 2FBTA 2L9DA 4A8QA 2JL9A 2IAJA 2RS2A 4B1YB 1IV0A 3IA0A 4A8XA 4V19X 1HD0A 3UFCX 4FK0A 1SJ1A 4MIWA 2HS3A 4DS5A 4PWWA 2O4IA 2VV5A 4OGEA 1GMUA 1QHAA 4DCHA 4K2JA 3P31A 1S7IA 4YHHK 3G6VA 3QRRA 4QIFA 2VJUA 4M5NA 3V6HA 1RDUA 2YQ1A 3IDHA 4CEBA 4CJRA 2A3JA 3J81O 1URNA 1KRPA 3AARA 4JI0K 4H4KA 1WHXA 3QWPA 3L95X 4OLPA 3L2UA 3GDQA 2VQEJ 5I3PA 1UW9A 2AEJA 1NK4A 2DFHA 1EP4A 2ZH3A 3O9TA 3UN5A 3PRVA 5D3GB 5D0EA 4ANDA 4NO7A 1LW2B 5KT5A 3IRWP 1F3VA 1RI7A 1HNZF 3D2FB 3NAHA 1Q16B 2F7TA 3JQKA 3CCJS 3NH0A 3CJKB 2PIIA 1RDBA 3TUZC 1G3OA 1FKPB 5HRSA 1RZMA 4CJFA 1UKUA 1TV6A 4DR2K 1ZAXA 3UD3P 4FWKA 1YBUA 5FPEA 4DG1A 4A8SA 3C15A 4DV5K 2CQIA 1BCOA 5IWAF 1HWKA 1LK7A 4N41A 4RLEA 4MH8A 3HT3A 3OYHA 3IG1B 2W9AA 2JX2A 4BR2A 5HRRA 4IOXA 4ILHA 3QAEA 3TEHB 1Q82O 4KGKA 4BRKA 1EO1A 4IH5A 3OW2M 1YDLA 3O44A 3QFUA 3TTFA 4A2BA 1KQSR 1SJRA 2XM3A 1HLWA 2AA4A 5E3AA 4O3NA 2G8UA 2BOPA 4A8MP 4WYWA 3KUGA 1NMEB 3UE2A 3WXMB 2PMZD 1R0AA 4LF6F 4DV7K 5JMNA 3TUPA 2B8QA 2FHJD 4CLUA 2XRIA 1JX4A 2CGKA 1T3NA 4M3RA 4NLTA 3MEKA 1ACMB 2HHQA 1L5UA 2R2UA 4JI5J 4LSZB 3WEEB 5DQGA 2CA9A 8RUCA 2DNMA 4DR4F 3O2IA 1H98A 1BWFO 1WEYA 2OMOA 3SFGA 4GC7A 2CJAA 3N6LA 4OYPA 1Q7LB 2OTJS 1GLBG 1RU2A 3V4IA 1N6QA 3KK7A 5BR9A 2IBOA 4DR6J 4HLBA 3D67A 4OMFG 5CHCB 3KK3B 1X4DA 4OKKA 3AB2B 1LNQA 4FF2A 2YKNA 1QDUB 3CC7S 3ITHA 1BI4B 4TVAB 1NRKA 1UWBA 2DHXA 5E2QA 1KD1O 1SC1B 5C24A 1REVB 1F60B 4AM7A 3LP2A 2MQQA 3H5XA 4FJNA 2R7WA 3LQVA 4BQZA 4BDPA 3QFWA 1L3UA 5DLFA 4HVJA 2EKNA 2OO4A 2VC0A 4JAXA 1ZBHA 3FE1A 3MMCB 1YJVA 3ILIA 1X4CA 5D6GA 2VU5A 3NAIA 4BGAA 1RAAB 2BOAA 2RAQA 3MWTA 1S1TB 1MMLA 5DRKA 3LDPA 2I8EA 2MHEA 3RSEA 4QWAA 4XDDA 1HYSA 3QEPA 2A2CA 5D0GA 1RT3A 1QZ6A 3QNOA 2DRBA 5IM0B 3AO1A 3ENBA 1HQEA 3TSUA 1KR4A 4UUWA 3KYLA 4ZPWR 5F8LA 1WSJA 2HKEA 1NMDA 4KHRA 2AP6A 2AJ0A 1T03B 4JN4A 4