2VG7A

Crystal structures of hiv-1 reverse transcriptase complexes with thiocarbamate non-nucleoside inhibitors
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
550
structure length
544
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords REVERSE TRANSCRIPTASE/RIBONUCLEASE H
publication title Crystal Structures of HIV-1 Reverse Transcriptase Complexes with Thiocarbamate Non-Nucleoside Inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 137
structure length 544
sequence length 550
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2007-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2vg7A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2vg7A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2vg7A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2vg7A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2vg7A05
2DFFA 3DRPB 4ECQA 1XI1A 1JL2A 3EPIA 3H2LA 2YNIA 4ZPCA 4DFJA 4Z4GA 1NK5A 1HPZA 3KJVB 3CFPA 3CIZA 4RW4A 1GOCA 4HUFA 4NRTA 1VRUB 3IG1A 4I2PB 3AO1A 1S1UA 1N5YA 1RT6A 1S0NA 1TL1A 3RB4A 2VG7B 1TKXB 3VQEA 2OPSA 2B6AB 4BWJA 3TAMB 3DI6A 1HYVA 3GV7B 3QERA 1HNIB 4F50A 2AX1A 3SUOA 1VK0A 2AGQA 5KFNA 1RT7B 3M9MB 3HPHA 5CZ1A 4FM0A 4DQRA 2ETJA 4PWDB 4O3NA 4M3UA 5DQIA 4J9PA 4FK2A 3P5JA 2AJQA 4YQWA 4WXOA 4KAZA 3ITHB 2XY6A 4IDKA 1NKBA 2ASLA 1S1TA 3WNEA 4QOZB 4WZMA 5T7BA 5F8MA 2IC3B 3NCIA 2BQRA 3I0SB 4DTNA 4KI6A 2OPPB 1HRHA 4BDPA 3OYHA 3KKSA 3QGIA 4K8ZA 2XCAA 2V4QA 4CJTA 3MFIA 2FBTA 5F8LA 4DFMA 3TAQA 2KW4A 5KFKA 3AV9A 3BGRB 3KLFB 3NAIA 3DLEA 1S48A 4ICLA 3PR4A 3V1RA 3DM2B 4IBNA 2WTFA 3MEGB 1S1WA 4CJ4A 1LWCA 3NBPA 2XGPA 2VG6B 1YTUA 5KGXA 3LPUA 2WONB 4CJEA 3BSAA 4FJXA 3CQ8A 1HPZB 1BQMB 1S10A 4IG3A 4FVMA 4DS5A 5L1IA 3NGDA 5KFLA 3G6XA 3F9KA 3SQ1A 4WZQA 4OKEA 1X1PA 1HNVB 1XR5A 4KFBA 2R8KA 1NK8A 4Q8FA 1ASUA 3HVWA 3HP9A 3PV8A 2KTQA 3RAXA 3HJFA 1C0UB 2OH2A 1QAJA 4ZVGA 5HROA 4NYNA 3KLHB 1RDAA 4CIFA 3OYFA 1FKOB 3O3FA 2B5JA 1JX4A 2Z1JA 2R2TA 5E41A 1D1UA 4CESA 1MU2A 4IH5A 2GIRA 3OJSA 2D5RA 2JEIA 1SV5A 3SFGA 5F8NA 1O1WA 1D5AA 1WAFA 3QEPA 1ZBFA 4CFBA 3OYLA 4FJNA 2GIQA 4IKAA 1S0MA 3OS1A 2HNYA 4WFZA 4E19A 1G15A 4HHTA 3OL8A 2FLLA 1REVA 2Z1IA 4DU3A 1LWFA 5KFGA 4R5PA 1BI4B 1BIZA 4DQPA 3TR8A 2D0AA 2HHQA 1L3SA 4O3SA 4EEYA 1ASWA 4LSNB 1RT5B 1BCOA 3M8PB 4FK0A 4R0EA 2FBXA 4E1MA 4DSJA 4AHUA 3DLEB 1SH0A 3BQ2A 3V9UA 3HPOA 3KD5E 1L3VA 1S6PB 2W9CA 4PUOA 4ECUA 4Y2CA 1LWCB 3OYDA 1DLOB 4KHMA 3QIPA 4Z4CA 1YTAA 2YNHA 2QV6A 4TQSA 2XRIA 4FK4A 4RUAA 4NYFA 4FJ7A 3KHLA 4IG3B 4KSEB 1RDCA 3TANA 5HP1A 2HHVA 3V81B 4DTXA 3IGVA 4CJKA 2YV0X 3AA2A 2RKIA 4FJIA 1IO2A 5T14A 1IKXA 3Q8PB 1SKSA 3KK1B 3NGYA 3BQ0A 2Z1GA 1SL0A 4E1NA 2YKNA 3KLEB 4E7IA 3CM6A 3LAMA 2GUIA 2YNGB 5I3UA 3HYFA 1VSEA 4DLEA 1TKZA 4IR9A 2IJNA 3NF9A 2VG5A 4U7CA 4ZP7A 4CGGA 4NLRA 4CEEA 2D3UA 3SUPA 4IOBA 5D3GA 4ECXA 4I9LA 4CCHA 4O0JA 4R5PB 1YT3A 4DSIA 2E6MA 4Y3CA 4KHQA 3QO9B 2FLNA 4E7JA 3NMAA 3O3HA 1KLNA 2IS3A 3OYNA 3SZ2A 3ZT0A 3HSTB 3ZSOA 1UOCA 4KHYA 1RBSA 3I5BA 4JRQA 2X6SA 1S9EA 4XIUA 4ECYA 5KG1A 1BQNB 5JS2A 4CGHA 5KFXA 4Y34A 5FDLA 4MKAA 3VN5A 5KFWA 2PZSA 5J2PA 4ZPDA 3RMDA 1RT1B 4CE9A 2IOCA 3KTQA 4ECWA 3KK3A 4E7KA 4F3TA 4ZMMA 1T3NA 4CJPA 4MFBA 1D0EA 1U48A 1T94A 4WXWA 2HWHA 3IRXA 3PR5B 4JV2A 3TAFA 1QSLA 4NRUA 3KHGA 3LP1A 1CSJA 2RPIA 3NFAA 3H08A 4DTRA 2UVWA 5CY4A 1WSJA 3RB0A 4OLBA 1S0OA 1QHTA 1GOAA 4O55A 4AHCA 2E9TA 3WNFA 3CDUA 2BQUA 4Q0BA 1SH3A 3BREA 4DSLA 1JLBA 1KCFA 1RDBA 1JLEA 2HNZA 4QWEA 3K57A 4X2BA 3SV3A 3ASMA 4U6PA 4DSEA 1TKZB 3MXMA 1HJRA 1RT4B 5EU7A 1JLQA 3ZT1A 5KT6A 2ZD1A 3U6FA 5HLFA 1JXLA 1JLFA 4QWBA 1ITGA 3H5XA 4CEQA 2VA2A 1UWBB 2P51A 4FLUA 4FXDA 4B8AB 1JIHA 4ZP6A 4DTOA 2HW3A 4HUGA 4DF4A 4O4GA 4J2BA 5KFIA 1S1VA 1RTJA 3HVRA 1JL1A 1CXUA 4CFAA 1RTHB 2YNFB 3AO3A 2E9RX 3HL8A 2BE2B 3NHGA 3NAEA 3PW4A 3OYCA 4TY9A 4KKOB 2W42A 4OJRA 3VQCA 3PVXA 1Q9XA 2Y1IA 2IM2A 4RG8A 3TABA 4RU9A 3OYIA 3PUFA 5KRSA 4DFKA 2J6SA 3SYZA 5J2NB 3VQ6A 1JLGA 4QW8A 2HMIA 1BGXT 3G10A 1C0TA 4IH6A 4DQSA 2W9BA 4Y1CA 2R8GA 2PYLA 1A5WA 3NF8A 3MR6A 4CEZA 1R0AB 1KLMA 5DLFA 4IRKA 2XWYA 1NOYA 3HT3A 3KLGB 4RNOA 4AHSA 4RW8B 4J9QA 1LWEB 1VSDA 1W0HA 4ZPBA 4GW6A 4FLZA 4YR3A 3DRPA 3RMCA 3DYAB 4C8NA 1SL1A 2XGQA 2Z1HA 3KJVA 4OGCA 4AHVA 3V9XA 3LANA 3S3NA 2HHTA 1VRUA 4I2PA 2X78A 4HCCA 3QESA 3NGZA 4DQQA 2FVQA 3LP0A 3KKRA 5KFTA 2R2SA 3PW2A 2VG7A 1X9SA 2B6AA 5JXSA 3TAMA 4XPEA 3MF5A 5KT2A 4CFDA 4FJ9A 3P83D 3VQAA 3F73A 4EYHB 1NK7A 1X9WA 1HNIA 3RB3A 2BQ3A 1NKCA 1KHWA 1RA7A 4QWDA 3QINA 3QGGA 2FVRA 1D9DA 1RT7A 4QPXA 3PW5A 3H4BA 5DQHA 4KHNA 4PWDA 3NE6A 3OSPA 3RMAA 4CGFA 2AX0A 4CHZA 5KGWA 2R8HA 3L2QA 4FJJA 3ITHA 3G6VA 2C2RA 4J9SA 1T05B 3QEIA 1DTTB 4TN2A 4J2AA 2IC3A 3DDKA 3I0SA 4CEFA 4FLWA 2OPPA 3HVTB 3AVJA 4LQ9A 3HM9A 2AQ4A 3K5OA 1ZBLA 4EBCA 4KO0B 1WN7A 3NAHA 3KMSA 4DL5A 1J9AA 3V1QA 3BGRA 4I2QB 3KLFA 1WSHA 3QEXA 5F8HA 4W5RA 4TY8B 4IR1A 2F8EX 1SUQB 4OL8A 1TP7A 3Q8QB 5KFAA 4CHNA 3MEDB 3DM2A 1T7PA 1QSYA 2WHOA 4CJFA 3MEGA 3OYEA 4EBDA 1WSEA 3S3MA 2VG6A 3FRZA 2WONA 4DL7A 3KMQA 3ZSXA 5KFDA 1J5OB 4CERA 1BQMA 2IMWP 3PZPA 2O4IA 4FLTA 5KFSA 4DLGA 3QEWA 4DMNA 3LP0B 1HNVA 4FBTA 5C5JA 3K58A 1N6QB 2W9AA 5C25B 1K1SA 3UQSA 3T5LA 3ZSRA 4RNFA 4M94A 4URSA 4MIBA 1NHUA 4LD0A 1C0UA 1XHZA 2J6UA 3OS2A 4G1QB 3N6LA 3KLHA 1FKOA 2IAJB 3ULDA 2ZE2B 2UUWA 1HQEB 1NK4A 1HQUB 3LZJA 3EPGA 2ILZA 4F4ZA 3MECB 3O4QA 3KD1E 2OYQA 3TAEA 4JV1A 5DMRA 4F4KA 1HMVB 3DLRA 3MR5A 4ID5B 3OL6A 4TQRA 4CK2A 1JLCB 3NF6A 1EKEA 5KT3A 3LP2A 1BI4A 5J2MB 4NLGA 2AGOA 4KHRA 4YR2A 2RDIA 1VSJA 4LSNA 1RT5A 3VQQA 5KG2A 3CDEA 4J9OA 3CM5A 1C2PA 3M8PA 4DG1B 3HXMA 3L2VA 4BWMA 4I7FB 1IKYB 4FZXC 4RW7B 5HRPA 4FJMA 3RAQA 4ED8A 3ZSQA 1S6PA 5KG3A 1ASVA 3DLBA 4KV8B 1DLOA 3AVMA 2DFEA 3D28A 3NH1A 3VQ4A 1S4FA 3LP3A 3V9SA 4ZVHA 3K2PA 2IGIA 2BGGA 1JKHB 3HKWA 1GOBA 3O3GA 1JXEA 4L8RB 2W8LA 4DL3A 1S6QB 3V81A 3B6PA 5EWEA 1EX4A 1W25A 3V4IB 2V0NA 4DWIA 2B43A 4E89A 4NLWA 3QZ8A 3ICLA 2D7SA 1TQLA 2JC1A 4DFPA 1DTQB 3KK1A 3QETA 3KOAA 3KHRA 1K1QA 3T1AA 5KFZA 1LW0B 3NGIA 3KLEA 1RBUA 3GIIA 3TVKA 4DL6A 1NJXA 3DMJB 3P1GA 3U3YA 5KFYA 3UR0A 1SH2A 4AHTA 1QE1B 4Z4FA 1C1BB 1WSFA 4NCBA 1CZBA 4O3PA 4J9KA 2YNGA 4LSLB 3OLBA 3KLIB 4TYAA 3RMBA 2XCPA 1KVCA 2XI2A 3QIDA 2P5OA 2OZSA 3KK2B 4FZZA 2X74A 4FBUA 1KVAA 3EY1A 3C6UB 3LP2B 4BE1A 2PY5A 4NCAA 3BDPA 2UVRA 4C8KA 4ECZA 3QO9A 1NK0A 1LAWA 4IFYB 1RBVA 4B9NA 4NLQA 1S9FA 3I5AA 3T19A 5KT5A 4NCGB 4ZTFA 2OA8A 3MFHA 1LAVA 3GIJA 1TV6B 5KFEA 2ITGA 3QNNA 1RA6A 3C6TB 4C8MA 5DK5A 1QQCA 1BQNA 2IA6A 4OKJA 3OLAA 3PX6A 3L2WA 4YP3A 3FQLA 4YFUA 1RT1A 1RYSA 2I5JA 3PX0A 4LQ3A 1D9FA 5KRTA 5DQGA 2R8JA 1IM4A 2BR0A 1NNDA 3PO5A 5JS1A 3QLHB 1TKTB 4FM2A 4CHYA 5HRNA 4OPKA 1L5UA 1N4LA 3DLKB 4ED3A 4F4XA 4JS4A 4NLUA 4ZVEA 1VSHA 4CF1A 4KBIA 2XI3A 3ALYA 4Q8EA 3D45A 3HO1A 3FFIB 5KFJA 3D5MA 1VRTA 4DSKA 4RNNA 3T5HA 1IKWB 2KQ2A 1T8EA 1UAXA 1N56A 3IGNA 3PW7A 5FROA 4N5SA 4Z4HA 4CJUA 1RT4A 4G3IA 3OSNA 2B4JA 3BSCA 3ZT3A 4IH7A 1C0MA 5CYMB 2HNDB 2JEGA 1B92A 5F9NA 1RTDB 1UWBA 2AWZA 1WNEA 1BISA 1K6YA 3QYYA 3DRSA 2HB5A 1KTQA 2G8VA 3H4DA 3JSMB 4TYBA 3OYAA 2O4GA 4R8UB 1RTHA 1XWLA 2YNFA 4Z4IA 4URGA 3K59A 1TGOA 1EETB 3TARA 2BE2A 4M3RA 1TVRB 1UA1A 4W5OA 3CYMA 4KKOA 4FYDA 3Q8RB 1ZYQA 3MR2A 3RR8A 2FC0A 5J1EB 4CGIA 1ZETA 1GX6A 2IM1A 4E7HA 4DTSA 4XPCA 2I5JB 5J2NA 3WNHA 4CF9A 4Z4EA 4ZHRB 1RDRA 4ELUA 4RW9B 1IG9A 2O5DA 3AVFA 4URQU 4QWAA 4DEZA 1EP4B 4Y1DA 3SUQA 1R0AA 1TK5A 5KFUA 2E9ZA 4XO0A 1RBTA 4WE1B 3KLGA 3NH2A 1VRTB 4IG0B 4RW8A 1J53A 5CYQB 3LDSA 3RR7A 1LWEA 4K4VA 5HBMB 3QGHA 4DF8A 4DTUA 4KHUA 5EWFA 3DYAA 3AVLA 5KFPA 1QTMA 2QKBA 2R2UA 4KB0A 2BANB 5J2QB 3MXJA 4PY5A 2RF2B 2VWJA 4H4MB 2G8UA 4F3OA 4O3OA 4NLDA 2W8KA 2X6NA 5L1KA 4AHRA 1T03B 5KFOA 2GV9A 4ED1A 3OS0A 1D8YA 3CJ4A 4IRCA 3SQ4A 3MXIA 1OS5A 3KNAA 1FKPB 4K4TA 3DRSB 4BE2A 2OZMA 2BRKA 1IKVB 1I3AA 3MTKA 1RBRA 2KZZA 1S5JA 4RNHA 3SFUA 3N6NA 1U49A 4B3OB 5KT4A 1BHLA 4FLYA 2FVPA 4NLTA 5HRRA 3NKYA 4B08A 1T05A 3M8RA 1DTTA 3T5KA 2RDJA 3SJJA 3HVTA 3VQ8A 3DLGB 4GMJB 2G8WA 1CLQA 3VQPA 2OPQB 4W5QA 2NUBA 4KO0A 3KLVA 4ELTA 5KT7A 2G8KA 4K50A 3S9HA 4I2QA 5K14A 3FQKA 3JYTB 2IJFA 1VSKA 4TY8A 5DG8A 1SUQA 4ECVA 3MEDA 4KHWA 4Q44A 2R2RA 2WK4A 4RUCA 5KG5A 4Q45A 3V9WA 2FVSA 3VQ5A 2J6TA 4ED7A 1HYSB 1S1XB 2XO7A 4NZ0A 4ZVFA 4AILC 2C28A 3C95A 1J5OA 4MIAA 2BRLA 4MK8A 2ALZA 3DOKB 2EC0A 4M41A 4ZPAA 4HKQA 3MR3A 3ZSYA 3DLHA 3BJYA 3KIOA 4CK1A 1N6QA 5C25A 4DTMA 3IS9B 3M8SA 4WYLA 1C6VA 3L8BA 4ZP8A 3NDKA 4OKKA 4N56A 2W7OA 4G1QA 2W7PA 3ZT2A 4UQGA 4E0DA 2IAJA 3RBEA 4N41A 2ASDA 2ZE2A 3UPFA 2P1JA 4BDYA 5I42B 4J9MA 1HQEA 4C8LA 3HHKA 1HQUA 3MECA 3AVNA 3H5UA 1HMVA 3PW0A 4FM1A 1XR7A 3OHAA 1TKDA 4WFYA 4ID5A 4ECRA 1ZTWA 1JLCA 2WOMB 3LWMA 1SKRA 1BCMA 2C2DA 3OYKA 3K5NA 1X9MA 5J2MA 3OYMA 4J9LA 2G8IA 2ILYA 1RTIB 3ZSVA 2R8IA 4O5BA 3NF7A 1UA0A 1JXBA 3G6YA 2E6LA 4DG1A 5KG0A 2KFZA 4I7FA 1IKYA 5K14B 4RW7A 2D0BA 4DS4A 2G8HA 5SWMA 4O44B 3UIQA 3V6JA 4J2EA 2F96A 2FJXA 4ED6A 1HARA 3M8QB 1U45A 4KV8A 3UDLA 1RAJA 3BSNA 1C1AA 5KFFA 5KFHA 4KREA 3VQ7A 3AVBA 4M95A 3CVKA 3D0PA 4CJLA 1RYRA 4NLYA 1RT2B 1JKHA 4KAIA 1Z25A 3EYZA 3DOLB 2OPRB 1S6QA 5L1JA 4ELVA 4M3TA 4RW6B 3AO4A 3WNGA 3V4IA 5CZ2A 1GX5A 4H4OB 3BSOA 3KHHA 1DTQA 1L3UA 4J2DA 4IKFA 1LW0A 3A2FA 4ED2A 4NLXA 1WLJA 4ED0A 3T3FA 1FK9B 3MEEB 3DMJA 3VA3A 3BR9A 1Z26A 1KFDA 4YR0A 4K4UA 1QE1A 2ATQA 5KG4A 1C1BA 4ECSA 1ZBUA 4CFCA 4M3WA 4LSLA 2V9WA 4PQUB 2IM3A 3KLIA 3L2RA 5EUHA 3KK2A 4F4WA 3THVA 2KZMA 3C6UA 4OLAA 1VSFA 1L3TA 5DGAA 4CIGA 3BQ1A 4CGDA 3K5LA 4JLHA 4B9SA 4EP5A 2QK9A 1JLAB 2XY7A 4K8XA 4CHOA 1S49A 2YHAA 4IFYA 4Q43A 4DTPA 4F2RA 3OVNA 1ZTTA 1CXQA 4NCGA 4LH5A 2A1RA 4CEAA 3M9NB 2PYJA 1SKWA 4NLPA 4K4SA 2FBYA 1TV6A 3H98A 4KTWA 4N76A 4CJ3A 3C6TA 3H5SA 4LY7A 2AGPA 2LSNA 2KFNA 5C42B 2I1RA 4QWCA 1VSMA 5C24B 2EX3A 4DSFA 1SL2A 4W5TA 2HAIA 1C1CB 4DL2A 1TL3B 4YNQA 1RCHA 3QLHA 1TKTA 2V4RA 3V6DA 5EWGA 3IN5A 5SZTA 1Y97A 2XY5A 2XHBA 2YNIB 4MKBA 3DLKA 4O3QA 1WSIA 1NOZA 4RW4B 2JEFA 3PJWA 1U4BA 5F9LA 3VQDA 2HHSA 3IG1B 3FFIA 1S1UB 1N5YB 1RT6B 1TL1B 4OGEA 2OPSB 3PJXA 3L3VA 5FRNA 4TXSA 3TQ1A 3QNOA 3DI6B 1YVUA 1IKWA 3LWLA 4FJ5A 1WAJA 5KG7A 1NJWA 1F21A 4CHQA 4FJGA 1RDDA 4CJWA 1QSSA 2C2EA 2UVVA 5CYMA 3OL7A 2HNDA 4F4YA 2HVHA 4HUEA 1LW2A 1S9GA 1RTDA 3B6OA 4N47A 1TK8A 3ZCMA 5KG6A 1RT3A 1A5VA 4IDKB 2FLPA 2XY8A 2Y1JA 1S1TB 1NJZA 3RRGA 4DQIA 2ATLA 5KTQA 1KFSA 2DPJA 2JGUA 4KTZA 3JSMA 4MH8A 1ZBHA 4RZRA 3I0RA 4R8UA 4NLOA 2GBZA 1EETA 3CJ0A 2G8FA 1TVRA 4M3ZA 2F8TA 3AVCA 4KTQA 3E01A 2WCXA 3E51A 3V9ZA 3SQ2A 3AVIA 5J1EA 3HP6A 4OPJA 3SQ0A 2UVUA 4M3XA 3VQSA 4ICLB 3ISND 1NKEA 3L3UA 3DRRA 1S1WB 4ZHRA 4CK3A 1U47A 3MAQA 4RW9A 4CJQA 3NBPB 4JUZA 3V6DB 2AU0A 1S97A 3PX4A 1EP4A 4CF0A 2YKMA 4MK9A 2E4LA 2QXFA 3H5YA 3LPTA 4ID1A 4FS1A 3GV5B 3RWUA 4IFVA 2F8SA 3SI8A 3CFRA 2JC0A 3OJUA 4JRPA 2DTUA 3RTVA 4WE1A 1J54A 2WRMA 4IG0A 4Z0UA 4YMEA 1ZBIA 5CYQA 4KFBB 4CIEA 3AA3A 3V6KA 3VA0A 4IRDA 5HBMA 4AH9A 3PY8A 4FLVA 2D0CA 4TSXA 2BANA 3GYNA 5J2QA 1WSGA 4B9UA 5FRMA 5HROB 2RF2A 4CEDA 4OVLA 4H4MA 2HHWA 2B5JB 1NHVA 3SNNA 1T03A 1MU2B 1LW2B 1S9GB 1SV5B 5DGBA 4FLXA 1RT3B 4H54A 2DY4A 1FKPA 3N6MA 3TWHA 2HNYB 4M45A 3FSIA 4J9NA 3ZSWA 1REVB 1IKVA 3I0RB 1LWFB 3VQ9A 4E7LA 4KPYA 4H8KA 4NYZA 1VSIA 4B9VA 3AA4A 5F8IA 4FCYA 4B3OA 3FDSA 2IBKA 3E01B 3TAPA 2CJQA 3SV4A 4E3SA 4KI4A 4KHSA 3VQBA 4Y2AA 3AO5A 4FJHA 1IH7A 1MMLA 3OYGA 2FJWA 2W9CB 4M42A 4NLSA 4PUOB 3DRRB 3DLGA 2YHBA 3QIPB 2WB4A 2OPQA 2ZQBA 1KRPA 4FJ8A 2YNHB 4C8OA 4QCLA 4HVJA 1A5XA 4KB7A 5KFMA 2IDOA 3SPZA 2YKMB 1QAIA 3OYBA 4I9QA 3CJ2A 4QW9A 4IFVB 3JYTA 3AO2A 1QS4A 2QKKA 3CFOA 5HP1B 5DG7A 4WFXA 4KE5A 1U09A 1HYSA 4B9MA 1S1XA 2RKIB 4EO8A 2FJVA 3H40A 5KFBA 1IKXB 4TLRA 3OY9A 3S3OA 4BE0A 4DL4A 2YKNB 2DPIA 2HVIA 1FXXA 4RNMA 3T5JA 3DOKA 4W5NA 4GC7A 3SUNA 3ZSZA 1BIUA 4BDZA 3AVAA 3RB6A 4K4XA 1KSPA 3IS9A 5I3UB 1XHXA 2JEJA 3ZT4A 4CJRA 3CO9A 2VG5B 4O0IA 1RNHA 3TAGA 4GVMA 1I6JA 5D3GB 1NJYA 3LZIA 5L1LA 1KHVA 1LV5A 3SPYA 3ISNC 5I42A 4B9TA 3OYJA 4CJVA 1RILA 4HYKA 4ECTA 1VSLA 3O4NA 3K5MA 1YVFA 5KFCA 4CECA 1Q8IA 4CGJA 4DU1A 1N48A 4FJLA 3CJ3A 4ZP9A 3AVGA 2WOMA 3C94A 4HCBA 3LALA 1S9EB 4K4ZA 2HHXA 1TK0A 4O4RA 3GV8B 3OHBA 2P5GA 3GIMA 1RTIA 3AA5X 3AVKA 4DU4A 5FDLB 3GQCA 2BDPA 3IAYA 2HHUA 2JLEA 2HWIA 5J2PB 3G86A 5HRSA 3U3GA 4ZTJA 2FBVA 4F8RA 2ASJA 1U04A 3KK3B 1TAUA 4K4YA 3G0ZA 3RRHA 1XC9A 4B9LA 4FZYA 4MK7A 4KRFA 4CEBA 4MFBB 4FJKA 4O44A 4FW2A 4CJSA 3IRXB 3M8QA 3HVAA 1TAQA 4JS5A 3V1OA 2D3ZA 4EZ9A 3LP1B 4HTUA 3GILA 4GC6A 2GC8A 2XC9A 3EZ5A 1RT2A 3DOLA 2OPRA 3GIKA 4CJ5A 4Q0BB 3HK2A 1JLBB 3Q8SB 4RW6A 1Z4UA 4IQXA 1JLEB 5KI6A 4LH4A 2HNZB 4F2SA 3SCXA 4H4OA 4CF8A 2RN2A 3QIOA 3NL0A 3CG7A 1JLQB 4QAGA 2ZD1B 5HLFB 4B8CA 1JLFB 1FK9A 3V6HA 4JV0A 4O3RA 5F8JA 4FW1A 3MEEA 5JUMA 3OL9A 1TKXA 3AVHA 4CF2A 3LAKA 2FVCA 1QUVA 1HYZA 1W9HA 3CJ5A 3SI6A 3HPGA 4DTJA 3QZ7A 4KB1A 2D41A 2DFHA 3RBDA 4PQUA 4MQ3A 3I8DA 1I39A 4O4GB 4CHPA 1S1VB 1RTJB 3TI0A 3QEVA 5F8GA 2QE5A 5L9XA 4Q5VA 3H59A 4EBEA 4CEOA 3I5CA 5KFRA 2R7YA 2VA3A 3CWJA 4BACA 3PO4A 4EYIB 1XR6A 3L2UA 1JLAA 4EO6A 2A1SA 4EZ6A 4EP4A 5DG9A 1BL3A 2IM0A 2UUTA 2CKWA 1B9DA 1JLGB 1CZ9A 2ZKUA 2HMIB 2EHGA 2C22A 1C0TB 1B9FA 4FS2A 5C42A 5DLGA 2W9BB 3M9OB 1NK6A 5C24A 3PHEA 4PA1A 4M3YA 4K4WA 1KLMB 4WYWA 5KFVA 3NH0A 5KFQA 3CDWA 2Q3SA 4J9RA 1KVBA 1C1CA 3EZUA 1WNSA 1TL3A 2VWKA 4NLVA 1EXQA 1Q9YA 1NK9A 5EDWA
chains in the Genus database with same CATH superfamily
2JNJA 1UAWA 1XI1A 3VAKA 4ZPCA 1HPZA 1IG8A 1GOCA 3CQXA 3MMJA 4NRTA 3MM6A 5IT9U 2XMJA 3IG1A 4I2PB 4P7TA 5AE2A 5HANA 3AO1A 3B4DA 1S0NA 3VF6A 1Y0HA 3K17A 3VQEA 1S12A 2RUSA 4LR7A 3DI6A 2RJZA 2E44A 8AT1B 4Y2IA 5HK4A 2O8CB 4YN3B 3R3LA 1T9WA 4A47A 3CULA 5DQIA 5BJRA 1BA1A 3TUJC 2AJQA 3T1HJ 5AQKA 3LGNA 2DNKA 1DFDA 2DRAA 4IDKA 4Q2MA 3H7HB 5LM7E 5E2QA 4WZMA 2VDHA 5T7BA 4H0PA 3J80Y 3GL1A 3NCIA 4KR0B 3I0SB 1RBAA 3QRPA 4DTNA 4KI6A 2VQFJ 1GTEA 1NBEB 3W3SA 4ALZA 4M63C 1YJWN 2G13A 2XCAA 4UZBA 2V4QA 3FGVA 5F8LA 2KW4A 4FN5A 3AV9A 3BGRB 2QWOA 4UT4A 3ZNUA 3NAIA 3PR4A 2DGSA 3V1RA 3DM2B 2WTFA 4CJ4A 1S1WA 5IWAJ 2YQ1A 1G4CA 1D9AA 3NBPA 2UXDF 4L6V3 1F6TA 2YWWA 1Q5YA 3CCLS 1S10A 4C2MA 1YQHA 1OQ6A 2QX0A 2LU1A 1MN9A 4WZQA 4OKEA 1X1PA 1HNVB 2OEKA 2VBYA 2OELA 5M2UA 1NK8A 4DR7K 4ER8A 3NGSA 3HVWA 1XMOJ 1KQFB 5B0DA 4M63A 3HBTA 2QRRA 4NA3A 3DGVA 4ZVGA 2VQFK 3OYFA 4JKGB 2YJEA 3NNAA 1RWPB 2G2ZA 1JX4A 4WF9Q 2B9WA 1D1UA 3DKDA 1P8GA 3OJSA 2JEIA 1SV5A 1O1WA 3W9JA 4CFBA 4ILGB 4B1WB 4L3NA 4EAHD 2HNYA 3WUHA 1BU6O 1G15A 4F0KA 1DHMA 3OL8A 2EFQA 2FLLA 1REVA 2CQPA 2FF3B 5KFGA 1BIZA 5JVGQ 2D0AA 2LDYA 4AXJA 3FLCO 3C8YA 1NAQA 1OY9A 3K0SA 2ZBCA 3DNCA 4QIGA 3T1HF 4FK0A 2V4JB 1BDGA 3DLEB 3HPOA 4Y2CA 2VQFF 4KHMA 3QIPA 4ZVPB 2YNHA 4CTAA 3WX8A 2RRAA 3ID8A 3OT9A 2ZWHA 4FJ7A 4IG3B 4DPOA 3TANA 3C46A 2XZTB 5B8HA 1OSCA 2PFDA 1FE0A 3A8EA 3V81B 1NPRA 3IGVA 4PL7A 3CCLN 5KQ8A 3AA2A 4JKFA 5IWAF 1JJ4A 1IO2A 2PA8D 2NXNA 1IKXA 5A6WA 3NGYA 4H0OA 1SL0A 4E1NA 4CBUA 1YJUA 4B3TK 3WXMB 1XQIA 1VC5A 3LAMA 1ZOTA 4BR9A 3OW2R 2YNGB 5I3UA 2GUIA 3Q89A 4DLEA 5J1PA 2K3IA 1XMOF 1M1KO 3NF9A 1RABB 4CEEA 5F3ZA 5LMNK 3SUPA 2MHNA 5D3GA 4CCHA 2FUG9 4R5PB 3Q22A 1EIYB 5A0YB 1SJ4P 3C14A 5C2DA 3T9ZA 3NVMA 3W65A 3VAFA 4CLUA 1N5VA 2ASPA 4ES2A 4DUYK 4LF7K 3O3HA 2ZH6A 2IS3A 1ZZNA 3I5BA 2F9JA 1QVFM 2EK1A 4XIUA 2H48B 4ITSA 1BQNB 3DU6A 4DV4K 5FDLA 1U2RA 3MHYA 2GUPA 4MDBA 1YBTA 3P5TL 2NXJA 3IUCA 5J2PA 2CA9A 1MSWD 3RMDA 4CE9A 1T9TA 3RW6A 4F3TA 1YJ9S 2DYAA 1RFQA 1D0EA 4CO4A 3BKTA 1T94A 3FBFA 2HWHA 4LFBK 3PR5B 4JV2A 2NYHA 2DISA 2BM0A 1X3MA 3EUNA 3TAFA 1KKHA 3IWLA 4HDHA 2QWLA 4F36A 4RUHA 5GIOA 4M5KA 1U1RA 1QHTA 3WNFA 3CDUA 4Q0BA 5L38A 1KCFA 2C3YA 2RHSB 4ATNA 4JP8A 3NCRA 1BY9A 1ILYA 1RT4B 1JJ2M 4A8XA 3ILIA 1KS2A 5KT6A 2ZD1A 4CIOA 1PJ6A 1ITGA 3H5XA 4CEQA 3HSJA 3T1YK 3OVSA 3NS6A 1KTVA 1QAXA 1UWBB 3BN7A 1M5HA 4FXDA 3AD7C 4FLUA 4B8AB 1JIHA 4HR2A 3EKSA 4ZP6A 2JRSA 2GEMA 2UUCK 1NSPA 4DTOA 4USHA 4HUGA 4N8NA 5KFIA 1X4AA 4DCHA 5GAHP 2IRXA 4JD2B 5AQPA 2HHHK 4DKWA 4DCOB 3PW4A 3ENBA 3VQCA 2Z2LA 4I64A 4RG8A 5E33A 4WF9L 1J5EJ 3SYZA 5J2NB 4CH7A 2QYCA 1M5KC 5K8OA 1JMTA 1C0TA 4YDUC 1Q81O 1YJ9N 4Y1CA 2ATCB 4A8MP 2R8GA 2M8HA 5K9FA 4PG6A 3NF8A 3MR6A 3JAMO 2A0FB 1R0AB 2JWNA 1KLMA 2BMBA 1YKWA 1Q8KA 1UJ4A 2GFFA 3TWZA 4IO8A 2IVYA 5HMXA 2P2CB 1NJIO 2V7YA 4FLZA 3U4LA 2M3DA 4YR3A 3CCQN 3DYAB 1SL1A 2NXCA 5KOWA 1S59A 4K41A 4AHVA 3LANA 2W2MP 5D8HB 3ETOA 4I2PA 1MROB 4R79A 1JCGA 4DQQA 5KFTA 2R2SA 3BF3A 1BC6A 2Z2YB 3MF5A 5KT2A 4FJ9A 1Q79A 2HLTA 2H5JB 2MZSA 3F73A 5LXRA 4EYHB 2QXLA 3VPZA 1J5EK 1OO0B 3A1YG 1RA7A 4QWDA 4ISGA 2O8CA 3GG4A 2FVRA 4YDUA 5RUBA 1D9DA 2M7SA 4JV5J 1N33K 3ET6A 3VAMA 5AQHA 4DUTA 4PHTX 3C6AA 4CHZA 4FYXB 1ELOA 3D2FB 2R8HA 3EGZA 3ATVA 3DRYA 5B08A 3QEIA 5E3AA 5F0WA 1HNZK 2MEWA 3I0SA 3TTCA 4LQ9A 4JI3J 5LJ5Y 1UFWA 4F04B 4DXLA 3KHYA 3CXCM 2PDAA 1FJGJ 4PAAA 3KMSA 4NMXA 3V1QA 3BGRA 4I2QB 3RW7A 1UJ6A 4BRCA 5F8HA 2ZH9A 4TY8B 2F8EX 1X0PA 2DHXA 4CHNA 3MEDB 3DM2A 1HI8A 2C3MA 1T02A 2KT2A 2WHOA 2LDIA 3CCSS 4CJFA 2KFYA 4EBDA 4XK8C 3S3MA 2BJ1A 2NSBA 5KPZA 1T95A 1OIAA 1URRA 2WSCC 2I7PA 2PEBA 2KDOA 1NU4A 2KJVA 1U6BA 4YB7A 3I4HX 5H1SV 1HNVA 3FZHA 5CABA 2W9AA 2V52B 3T5LA 3ZSRA 1WC4A 5ETSA 3UNYA 4RNFA 4URSA 1NHUA 4LD0A 1OJ4A 2Q0UA 1FTRA 3N6LA 4JI3K 2DIUA 4JKGA 2J7WA 4DV7F 1RE1B 1HQUB 3I9V9 4GKKK 4IFEA 1A0OB 3CJ1A 4DUZF 4CH0S 5GADI 6FDRA 3MR5A 3OL6A 2ZH3A 4JV5F 3R5GA 2JFDA 2BA9A 2J9DA 2AGOA 1NGAA 1HBUB 4I6AA 3NXZA 3VQQA 3CDEA 5H1SQ 1C2PA 4UW2A 5BYSA 4QIWD 2V4JA 1CVJA 2YX7A 2CGLA 1IKYB 4RW7B 1WG5A 3RAQA 3CD7A 3QGPA 4MKYA 1GNKA 5KG3A 2R9LA 4DX5A 1KOOA 2DFEA 3NH1A 5ADZA 1UP1A 3VQ4A 3O80A 1S4FA 3V9SA 3CCSN 1FJGF 4ZVHA 1RQ0A 2XMKA 2DB1A 2EEYA 5D4PA 1G6BA 3SSRA 4DR3K 3OFHA 4CZGA 1GOBA 4JNEA 4BVPA 3O3GA 4L8RB 1GAOA 1RTZA 1UW9A 1VQ5S 1X60A 3WXIA 3V81A 5EWEA 5D0HA 2MKCA 1W25A 4LFAK 1QVGR 3V4IB 2V0NA 4LBIA 3ENVA 2B43A 4NLWA 2RU9A 3MM5B 3UCZP 4FPAA 5BN8A 2RNEA 2YH1A 1RBUA 3GIIA 1NJXA 1FXLA 4CI6A 2MMYA 3U3YA 2P9GA 3RBZA 1YIJS 2WBMA 4JI2J 1RAGB 1FVQA 3M2UB 1CZBA 4HWIA 2YNGA 2DNOA 3CE8A 3OLBA 4PKGA 5L9NA 4GVBB 4TYAA 1V9OA 2GVDB 3H8YA 4M5NA 5BXIA 4FZZA 4PCQA 4FBUA 3HFVA 3L7UA 4HH0A 2JDJA 4K0KK 2QLJB 1YVNA 4NCAA 5A0YA 2ZHAA 2J7KA 3SSSA 4C8KA 4EK2A 1FNMA 1N0VC 2OIHA 4HT5A 1AROP 4IFYB 2QLFB 3LF0A 5HVFA 2HS3A 3AOBA 4NCGB 3O3LA 4H03B 1TV6B 1RA6A 2GIFA 3IFEA 5DK5A 3FEXB 1BQNA 3GZ7A 1K44A 3N5FA 3CDBA 1NB7A 4YP3A 4XH5A 1SQEA 3FQLA 4YOUA 3EXYA 4RJVA 1M1KT 4ZLNA 4JI2K 5GIPA 2WB1D 2DR6A 2FZCB 1E3MA 4BCAA 4NE9C 1PC5A 4IEIA 2O1PA 5HRNA 2QJ3A 4OPHA 1WC1A 2R3VA 1VQMS 3Q8VA 1VSHA 3J7A1 2QWNA 1ZPVA 4RNNA 3LW5C 3EVOA 5CH7B 1IKWB 4DV3F 3V5RA 3SXLA 1GH8A 1N56A 3IGNA 3GB0A 3PW7A 4Z4HA 5F3TA 1RT4A 2B4JA 2HBMA 4KC5A 4HI1A 4C48A 1C0MA 5CYMB 2HNDB 4Y2MA 2YX4A 5I9EB 1UVMA 4P6QA 4LF5J 1UWBA 1DKGD 3R1XA 4LF2A 3I4PA 2IJRA 2LQ8A 5DZ6A 3NMRA 3LL3A 2G8VA 2MYFA 2POKA 3H4DA 3OYAA 2QWMA 1XWLA 3EL2A 4JD2A 3BZCA 2R7RA 4A61A 1TVRB 2ZUGA 5EGYA 3IWXA 1UA1A 3US5A 2UUAJ 1ZXOA 4NLBA 2XMAA 1WI8A 5C2CA 3MR2A 2FC0A 5MLCV 4FWMA 4M5HA 2MKJA 2IM1A 5GMDA 3J81U 5J2NA 3SBGA 4Z4EA 1WSRA 1RDRA 4ELUA 1H73A 1U1NA 1IG9A 3JSRA 4URQU 2KKZA 3SMZA 2ZH5A 4DEZA 2DNLA 5T7LB 1V5VA 1NGHA 3OUYB 2IMOA 4RLEA 3R27A 1OH8A 1R0AA 2H4WB 1KC8O 2U1AA 4NO7A 2MZ1A 3PHTA 4XO0A 4FF4A 1VQMN 1Y00A 1J53A 5LJVA 5CYQB 3LDSA 4K4VA 2O8EB 4MDAA 3BS9A 3F44A 3DYAA 3WXLA 3M6GA 3PFOA 1CC7A 2BANB 3AAPA 4H4MB 2G8UA 4NLDA 2W8KA 1MROA 1VJWA 5AQUA 4LR8A 1PJ7A 2ZBQA 1T03B 3O9QA 2DHHA 5KFOA 2FHOB 4ED1A 2DR7A 4IRCA 3RJMB 2ZJQQ 3DRSB 2A41A 1Q81T 4FXVA 3S1TA 2BRKA 4FF1A 4C3MA 2V8PA 4BR0A 3VAIA 2ADCA 3C65A 1UMJA 2QG9B 4LF5F 3D2FA 3DHXA 2CGJA 2L48A 1NJIT 4FLYA 2FVPA 3BV8A 4NLTA 1TUUA 3NKYA 3NWGA 2AJ4A 1U1QA 3IAM9 2X51A 4EHUA 2KHCA 1KOHA 3SJJA 1KQSM 3DLGB 4IDHA 2KG1A 3VQPA 2BH1A 2CGKA 3D1OA 2UUAF 3CJ9A 3S9HA 4I2QA 3PSIA 3FQKA 2QTWA 2DHSA 1VSKA 4TY8A 5LY3A 3KWMA 3MEDA 3A3OB 2R2RA 3OXFA 3EGVA 5KG5A 2I0XA 5FLXU 4Q45A 3V9WA 3VQ5A 4V19J 1KQGB 1S1XB 4P9SA 3D67A 4EWTA 3A5OC 4Y0FA 4ZVFA 4V19X 2C28A 3PM9A 2CAJA 3W62A 4MK8A 4BC5A 1M5PC 3SSQA 3HHDA 4QZVB 4RPFA 4EIAA 4M41A 4HKQA 3DLHA 1NMNA 3BJYA 5G0RB 3KIOA 3IS9B 2QMWA 3TZXA 5DRKA 4HDGA 2PA3A 3BGFA 1GLAG 4N56A 3O8MA 2CPJA 4CBWA 1LWXA 5AZJB 4QR1A 9RUBA 4OHZA 4RBVA 2YWFA 2KXNB 3MM8B 5AFUH 1HQUA 2HQDA 5IOLA 3AVNA 2B56A 4U67Q 4CLTA 2V6AA 1YJVA 2ITMA 4U7BA 4FM1A 4J8FA 1TKDA 3UN3A 1FD8A 5BR9A 1BA0A 2WOMB 1O8BA 3K5NA 2DH8A 2ILYA 1RTIB 1HBUA 2D0OA 3IMQJ 3N0VA 3D6FB 2FC9A 4ILLA 2B9XA 3G25A 1DARA 5KG0A 2O01C 1I1GA 1IKYA 5K14B 3MPYA 4RW7A 4DS4A 1YJNS 1RAAB 2ACMA 3V6JA 4UZCA 2R7WA 2F96A 3P45B 1HARA 3BH6B 3LM9A 3G2XA 1SCJB 3UDLA 4DCJB 5KFFA 4KREA 3R7NB 3FEZA 3BO4A 3AVBA 4M95A 4I1TA 4RCHA 3D0PA 3D2WA 3TR5A 1EHWA 1GXUA 3JQJA 1S99A 1Q7YT 2YCHA 3EYZA 3SEOA 5L1JA 1KXPA 4ELVA 1MDUB 4BREA 3HMJG 1NSQA 4LF4J 2ZBIA 4FYVB 1WEZA 4RL1A 4Z7CA 1OWXA 3WNGA 1XNRK 3V4IA 1GX5A 1EQMA 4CM2A 1RB0A 3MM5A 4E98A 3NOGA 3BSOA 2C2KB 2CQ4A 4GV6A 5AQVA 4J2DA 1VQ9S 4IKFA 3IC1A 2J5AA 1WLJA 3SMPA 1NSAA 3VEZA 3EM1A 1HD0A 3WQUA 1VQLS 4K4UA 2ALYB 2ATQA 2ZDPA 5KG4A 3M2UA 3Q8UA 1ZBUA 4IWVA 1YUWA 3E3XA 1HBOA 4GVBA 3MPVA 1VK8A 2OSQA 2UU9K 2GVDA 5EUHA 2Z57B 3TA1A 2ZZMA 4UOHA 1S6UA 4F4WA 5A8WB 2KZMA 5AQGA 1HWKA 4CLLA 1O0PA 1VI7A 4H5WA 1L3TA 1YJ7A 4OV1A 4CIGA 4MO4A 4FF2A 1JLAB 2Q66A 2XY7A 4L76A 4IFYA 2P9KB 4LIWA 5DDPC 2QA4G 2Q43A 4LF4K 1ZTTA 1CXQA 4NCGA 4LH5A 4DR4K 1B0VA 4CEAA 5GAHU 4FKXA 4NLPA 5AQLA 1TV6A 5CE3A 4N76A 3P4IA 3H5SA 2AGPA 2ZJQL 5LJWA 2LSNA 3HI9A 1VSMA 5C24B 1F3VA 5GMKa 2K06A 4W5TA 2DXEA 1TL3B 3C15B 3OXGA 3SMSA 3CO0P 5F1XA 4OMFG 2B8PA 5EWGA 1N34K 2XY5A 2JLFA 4W4MA 1SAZA 3CD0A 4DV5J 4RW4B 2JEFA 5F9LA 1HNWF 3QWPA 1N5YB 5HMWA 1TL1B 1U25A 5AQZA 2RAQA 3PJXA 4P10A 3L3VA 4J37A 1VQ9N 3PIOL 1IKWA 3LWLA 3V4MA 1RWMB 5IXUA 2FLOA 1VQLN 2FDNA 4FJGA 3LDNA 2QTDA 4K8RA 4CJWA 3KK7A 2UVVA 5CYMA 2HNDA 4HUEA 1X4BA 4N47A 1IQTA 3ZCMA 1RADB 2F8HA 1A5VA 5LSOA 2XY8A 2Y1JA 1S1TB 4DQIA 4P72A 2JGUA 3F0NA 1ZBHA 2FJAB 4NXMJ 5AQTA 1RU2A 3UFCX 4RBUA 3CJ0A 2B9YA 4M7XA 2MZRA 1TVRA 4DV5K 4M3ZA 3E51A 4JI0J 1N8RO 3AVIA 2J0SD 4ILHA 5CD4A 3BBBA 5GAEP 2GHWA 4EI2A 4DPYA 3DRRA 4Z37A 4ZN3A 1U47A 3L6QA 4CJQA 3VWSA 1WTFA 1HBMB 5T7LA 4KHPJ 3OUYA 2YQ3A 4CF0A 3LPTA 3RWUA 2F8SA 2JC0A 2DTUA 2RH3A 4YMEA 5CYQA 5IT0A 2O8EA 3RG6A 2G0JA 1IBKK 4AH9A 3TSQA 3R7BB 2D0CA 3RRKA 3M6WA 2BANA 5ITHA 1WSGA 4FF3A 4NXMK 1U1LA 4H4MA 1CLFA 3EDRB 3OBWA 4DV5F 2RHQB 2ADBA 5CCMA 1T03A 1HD1A 3U02A 3OW2M 5K5MA 1MU2B 3VGLA 4FWSA 2LECA 4JKBA 2HK3A 3ILLA 2ZM6J 3LGHA 4FOEA 2DY4A 3L4IA 2VPXB 2GW8A 4B1XB 2YI1A 3KUGA 3ZSWA 1Y5IB 1B4SA 1KC8T 4KPYA 1IBMJ 2LEBA 2NQPA 2CQ0A 5HL7Q 2BE7D 4ZVQB 2WSFC 1HLUA 5E0OA 4IEEA 2CJQA 2XLKA 3GFZA 4KI4A 2NRRA 4QR0A 4DV0J 5IQQA 1NGJA 1IH7A 2W9CB 1PYOB 4NLSA 4M42A 5ETTA 3DLGA 2YHBA 2QSFA 1ZAXA 1OQ3A 4OX9K 4HVJA 5BRFA 2IDOA 2V50A 2YKMB 1QAIA 3OYBA 4I9QA 2OTJS 4JI0F 5GINA 3Q0AA 2XHCA 3CFOA 2PFUA 1S1XA 4ZVTB 2LFVA 4PWWA 3JQKA 2FJVA 5EOYA 2XYGB 5EX5A 5KFBA 1YRXA 1XERA 4KHPF 4MLEA 2RILA 4TLRA 4BE0A 1YBAA 2YKNB 2HVIA 1RWXB 4BRHA 1FA0A 4CZEA 2FF6A 4HL9A 3AVAA 2CPEA 3FK4A 2OMLA 1KSPA 3IS9A 3KZBA 4DV0K 2NREA 1QHAA 3ZT4A 3CO9A 2VG5B 3TAGA 4WIIA 5AZJA 2IVOA 1FJEB 4JOUA 5D6GA 2BTFA 3R1LA 2QL7B 4DX8H 3MM8A 2ASOA 2V8HA 4U95A 1A9NB 4OYOA 4ECTA 1VSLA 4GRSA 4F7VA 1Z05A 1UCNA 2ZM6F 2QW9A 5KFCA 4FKYA 4W90B 1VQSA 3AQPA 1N48A 4ZP9A 2WOMA 2HHXA 4K4ZA 1TK0A 1UL3A 2IDEA 1RTIA 3AA5X 4DU4A 2BDPA 1IBMF 4IJNA 4DPXA 2AP6A 4DBQA 2MKIA 2VU5A 3TZZA 3GE9A 2LP4A 4ZTJA 1RSCA 1FNOA 5H9FJ 2ASJA 3KK3B 5I3PA 3AJ2A 4A4JA 3G0ZA 3RRHA 4DV0F 5M1FA 2OTJN 3G82B 1TAQA 3V1OA 4HTLA 4EZ9A 2FSJA 2W1BA 3GILA 3QT7A 4CI0B 2EKNA 1KAZA 4KH4A 4CJ5A 4C4WA 1KNZA 3SDEB 2F9TA 4A59A 2OEJA 3L09A 2HNZB 3SCXA 1WDDA 3AARA 2RN2A 3QIOA 4DZDA 4JYAJ 4WCEQ 4BRPA 1JLFB 1VHIA 5AJ3K 3SCKE 4FW1A 3A13A 3OL9A 5JVHQ 1TKXA 3AVHA 3LAKA 3GCWP 4OHXA 1MLAA 3ZZPA 3BN4A 1ACMB 2PE8A 3G96A 2HYIB 5H9FK 3QZ7A 2D41A 3RBDA 4RX6A 3J81Y 1I39A 2N3LA 1F2GA 2ZEJA 5A8WA 3H59A 3I5CA 3HJVA 5KFRA 2R7YA 2XTJP 2VA3A 4OX8A 1N32J 3HD1A 5FPDA 3BPDA 2DNNA 2J8SA 3BKFA 3L2UA 1JLAA 2VHGA 3I87A 4EO6A 5K8MA 4EZ6A 4EP4A 4PR6A 4HTIA 2JFKA 4EHTA 2CKWA 1RACB 5AT1B 1WHWA 4ERDA 1VGYA 3BZKA 2AEFA 1XUPO 2N4CA 2EHGA 3A5MC 2C22A 2OEMA 1B9FA 4FS2A 2RHKA 2N7YA 5ETRA 2B4OA 3M9OB 2A2DA 3ENHA 5C24A 2AT1B 4DR6J 1S3XA 4J90A 4WYWA 5DDOC 1U1MA 3NH0A 3G4SS 4K5RA 2JJ4D 1TL3A 3C15A 2VWKA 1YZ6A 1T11A 1EXQA 1Q9YA 1B7FA 4JN4A 2GA7A 3DRPB 3EPIA 1FDNA 2F9DA 2FY1A 3H25A 1WG1A 3FSXA 3KJVB 3CIZA 4RW4A 2DH9A 3DXBA 4KGZB 2YWKA 2WW8A 3N4WA 1N5YA 1TL1A 3ADAC 2PI4A 2D74B 2B6AB 5ETQA 4BWJA 4B1VA 4X4SA 3TX8A 3I8BA 3GV7B 3QERA 4P2XA 1HNIB 2JZ5A 1Z1ZA 1VK0A 3BP8A 3MX5A 1NLKL 1G2EA 1RT7B 1DQ8A 3HPHA 3VGMA 4DQRA 1UVNA 4M3UA 4JYAF 3BH7B 1WI6A 4J9PA 5E3PA 3HI0A 2DXDA 5B0EA 4NOHA 3DDNA 4YQWA 3CQYA 4WXOA 3ITHB 2XY6A 3LA0A 1S1TA 3WNEA 3CJTA 4QOZB 4EGLA 1EKRA 2R4FA 2BQRA 3WEEB 5FLXY 1HRHA 2KXHA 3FVYA 4KGKA 1FRXA 2EK6A 1N32F 3FC9A 2DGQA 2HF3A 3H20A 2HS4A 4P2FA 1EZZB 4IBNA 1FEHA 4ES1A 1VBXA 2KVQE 2R7XA 1YTUA 3NS5A 3LPUA 1HBMA 4A48A 3G4SN 4LF1A 1XMQJ 2E88A 1BQMB 5M1OA 1T9YA 2V2VA 4FVMA 5L1IA 4DR6F 2KHOA 3W2WB 1QVGM 4G1IA 3G6XA 3SQ1A 4IOCQ 1WC6A 2R8KA 2Y1LB 4Q8FA 3VETA 3QAUA 2MY8A 2CPXA 4TVAB 3H90A 3Q23A 3GPAA 3BR8A 4FXWA 2UXCK 2DGXA 1C0UB 4NX9A 4J7CA 4NYNA 1N8RT 2DY9A 3WT0A 4QOTA 3O3FA 2F5GA 1NGFA 2Z1JA 1KAXA 1SC6A 1MU2A 3O9UA 4GKJJ 3TJ9A 3QEPA 4H5NA 1D5AA 1WAFA 4F0MA 1ZBFA 2P5VA 1S0MA 2EC2A 2E1ZA 1VHXA 5M1NA 2VKZG 3CMAS 1CJVB 2Z1IA 4LT6A 4DQPA 1XMQK 1PJ5A 1IBLK 2HHQA 3CPEA 1ASWA 1RT5B 2P9UB 1BCOA 4K59A 4ZLPA 4WCEL 2C1EB 1FJCA 1NDLA 3HKZD 1L3VA 2W9CA 2R42A 5KPTA 3W0LA 3AD9C 1WKJA 1LWCB 2HKEA 1HFEL 4WP9A 2MZJA 2QV6A 4TQSA 4QIEA 3J7YP 2ZITA 1VDHA 3VHQA 4RUAA 4L3QA 5CA5A 3KHLA 3D7SB 1RDCA 2MLYA 3AH6A 1FDBA 4GKJK 2E1RA 2HHVA 4DTXA 1B70B 1ZM9A 1OKJA 3J8AA 3E9LA 2WZ1A 1XMQF 4WP3A 3KK1B 4M5JA 3E66A 4BRNA 2Z1GA 2YKNA 1F5BA 3KLEB 3CM6A 3E9OA 1FRJA 3SQOP 1NDPA 3CF5L 2GCFA 4IOAQ 2ZWOA 1EJ7L 2QFIA 1VSEA 4WTOB 4IR9A 2IJNA 2VG5A 3FMWA 4U7CA 2MKSA 2G0CA 2AV5A 2D3UA 4IOBA 4O0JA 4L73A 2E6MA 3DAWA 2YTCA 3CMAN 4GKJF 1Q0NA 4E7JA 3NMAA 4A8YA 4X4PA 3SZ2A 3ZT0A 3LPEA 3ZSOA 9ATCB 2ERRA 2V67A 2GWKA 3JB9k 4DR1K 1YX2A 3UR3C 2LA6A 1GXTA 5JS2A 3H45C 1VYAA 4MKAA 4MYTA 2L41A 2N82B 2BZ2A 5KFWA 1HNXK 3W64A 2IDLA 2IOCA 4ECWA 3KK3A 4USVA 2I8EA 3OBIA 1T3NA 3M6UA 3TQEA 4FOIA 4H5RA 4LFCF 3G82A 3R2CJ 3DHWC 2HURA 1YTYA 3KHGA 1E4GT 3CC7S 1YF5L 4DTRA 1KONA 1Y4ZB 2Z58B 1S0OA 1S5ZA 3AAQA 4O55A 2E9TA 2KM8B 1TYQB 2BQUA 2U2FA 1SH3A 3BREA 3SDEA 2G2OA 1YI2S 1FJ7A 4CZFA 1RDBA 3CNQP 2HNZA 4QWEA 3MI7X 4X2BA 2W7AA 3SV3A 4PXBA 2ZVSA 4U6PA 1TFWA 3ASMA 2P6TA 1M1HA 3QBCA 1TKZB 1DAXA 2H3EB 2FGCA 4UUXA 1JXLA 1JLFA 4QWBA 1HKBA 1T9VA 5D78A 4G65A 3HDSA 1IWAA 3GONA 3ULEB 3KYLA 1FO1A 2V51B 1N36J 2FPHX 3CJQA 2CYYA 3BBCA 2J9DE 1CXUA 1RTHB 2YNFB 4YHHK 3AO3A 3NAEA 3P39A 2ZKTA 3HHEA 4OYBA 4TY9A 4OJRA 2W4PA 3TABA 1RWKB 3M6VA 3QBWA 2J6SA 1WC0A 2W41A 3ZZ0A 3TU5A 1K0VA 2F9WA 3TYTA 4IH6A 4RKUC 4C97A 4USWA 2PYLA 1A5WA 4FZVA 4RUBA 2KYXA 4LRDA 1MMNA 1TUYA 4IRKA 4I67A 2RDDA 2XWYA 5GAEU 4RW8B 3CC7N 1LWEB 3DXKB 1VSDA 3LDLA 1S76D 4GW6A 3QFWA 3IAS9 3KUEA 3DRPA 4O5FA 3VGTA 2XGQA 2IFXA 4JI1K 2Z1HA 2OFGX 3KJVA 4BC9A 1S4EA 4WQ5C 4OZ0A 3EDQB 1YI2N 3V9XA 4RWTA 2GS8A 2X78A 1YJTA 1NEEA 3LP0A 1NCLA 3AODA 3THXB 3PW2A 5EVZA 2B6AA 2DITA 2AZ1A 4FWNA 3P83D 4XH4A 3VQAA 3TO8A 1Q18A 1HNIA 3LTOA 4G1PA 2BQ3A 1NKCA 1EQ0A 5IT9O 1IQZA 2E1MC 4YDDB 3N5BA 2VJVA 2ZFHA 3EGWB 1TMMA 3M32B 1VCTA 3RSEB 1RT7A 4QPXA 1VQOS 5DQHA 2DGOA 3OSPA 3UNGC 2GELA 2BUPA 2WAQD 3CPWR 2DY1A 3NGUA 4H4KC 3L2QA 4FJJA 2XWXA 3ITHA 2CFXA 2P8IA 5F41A 1N36F 2E29A 1DTTB 4K7QA 4TN2A 1EQYA 4J2AA 4CEFA 3WEEA 1H3DA 3HVTB 3AVJA 4WQ5A 1R3NA 2QI2A 4B3SJ 3D6MB 3HM9A 1V4TA 3TNVA 2JVOA 1NMEB 1K8KB 1IR1A 3LQVA 4B3RJ 4OL8A 1TP7A 2APOA 5KFAA 3G9CA 1MA9B 3SBMA 1QSYA 2NRZA 1NM1A 1RHJB 3OYEA 4WBFA 4BRMA 1MG7A 2VFVA 1AUSL 1K73O 4DL7A 5BREA 4WFBL 4UTGA 3ZSXA 3L95X 1BQMA 1XJWB 2NSCA 2MGZB 4BR4A 2IMWP 2H54B 2HSEB 4H4KA 3MMCB 3UE5A 2O4IA 3OPKA 3CIPA 4BS2A 1N6QB 5C25B 1K1SA 2ZNYA 4OJGA 3UQSA 2E2QA 1F0XA 2OGUA 3SLCA 1RCOB 1Q86O 2R7SA 4M94A 2DNQA 4MIBA 3FR0A 1C0UA 2H9ZA 4G1QB 3I56S 3SK3A 4B3SK 4JI7J 2ZE2B 2G1HA 3V2UC 1WJ9A 1T9UA 4OJHA 2JLGA 1O5JA 4K25A 2YXLA 1NK4A 3BF4A 3LZJA 3EPGA 1VQON 3D6HB 1OVQA 1RDUA 2JWKA 2OCEA 2ASYA 3CJKB 4ILMA 2IVNA 4QIFA 4CNYA 1CJVA 3FZLA 4TQRA 4OI0A 5GAHI 5J2MB 4JI8K 2VOPA 2DNRA 2RDIA 1BO5O 2QGFB 2LKZA 4DPUA 4C8YA 1RT5A 5KG2A 2P9UA 2QA2A 3HXMA 4I7FB 4I6WA 3ZX3A 4FZXC 5HRPA 5FPNA 3OQ2A 2AJ1A 4NEZA 4ED8A 1ASVA 4ZVRB 4L75A 5BR8J 4KV8B 4PRFA 1FD2A 3AJ1A 3D28A 4NASA 4B3SF 4F9OA 2W25A 1N5SA 2F8MA 3D6RA 2M70A 3OFEA 1R27B 3O44A 1YBUA 3QFPA 2E66A 3L7PA 3ZO7A 2W8LA 2CH6A 2A18A 4B3RF 5L46A 3NWRA 3DFEA 4KPCA 1H2VZ 3QZ8A 2L9NA 3ICLA 1VQKN 1TQLA 4DFPA 3KK1A 2X7IA 3KOAA 1K1QA 3T1AA 5KFZA 3KLEA 4N7TA 4C11B 3P1GA 5E5NA 5KFYA 3UR0A 3K9JA 3U9ZA 3I56N 1WSFA 1VJQA 4O3PA 3GBTA 4RO0A 5CZVA 3P8BB 3BUZB 3KLIB 2PSZA 3C2PA 3RMBA 2VZ9A 2X1FA 3A8JA 5LMUK 2HQCA 3QIDA 2DR9A 3OFGA 2ZJRQ 4C23A 4LRFA 4DX6A 2X74A 3UCUP 2V8DA 3C6UB 3LP2B 3RU0A 1PG5B 2IIHA 4JI7F 2PY5A 3BDPA 4CM0A 4G9ZA 3IKMA 1NK0A 3EX7B 4NEYA 4B9NA 3VVTA 1S9FA 1GMVA 2YWEA 4OJ1A 4I6MB 2XMTA 4A8OA 4X65J 4DR5F 4CYUB 1K9MO 4RTFD 1JWWA 1SQKA 1RWVB 3QNNA 5BN9A 4C8MA 1QQCA 2IA6A 3WHIA 3PX6A 1KP6A 3L2WA 1VMBA 5DM7Q 5AQSA 1RAOA 1LKZA 5CQGA 1SXLA 3PX0A 4LQ3A 5KRTA 5TKYA 1I94J 4NLCA 2BR0A 1UZDA 3PDNA 4NXNK 1TKTB 4A8KA 4OPKA 5BR8F 1N4LA 3DLKB 1I5OB 4F4XA 4JS4A 4FDFA 4LF8K 4LRBA 4KBIA 3ALYA 5KFJA 4ILJA 7FD1A 2J4RA 2AD9A 1VRTA 1VIOA 4DSKA 1TYQA 2ZHOA 3ISZA 4IO9Q 1RK8A 2LCWA 1T8EA 2KQ2A 3EXCX 1UAXA 5FROA 1R43A 4CJUA 3DGPB 2B7CB 2ZF5O 4YDXA 5HJXA 4IH7A 3EN9A 5AXLA 1B92A 3WC0A 5F9NA 2UZAA 2QA1A 4ANDA 4DV1J 1T44A 2AWZA 3ULEA 1TL4A 1WNEA 1BISA 4BRKA 3M2RB 3MAHA 3IBWA 1IM6A 2HB5A 2BXJA 1I94K 3JSMB 4TYBA 3VF2A 2O4GA 2PD1A 1QQMA 1RTHA 2YNFA 4Z4IA 3K59A 1G7CB 4WKRA 3TARA 4A8FA 4NL5A 3FFKB 3CYMA 3NGTA 1ZYQA 3RR8A 3EICA 5J1EB 2E5LK 4JI5K 3QMQA 4E7HA 4DTSA 2EBEA 3CMES 2I5JB 3WNHA 5IC4B 2E2OA 3VAGA 2O8BB 1Y10A 4X65F 2O5DA 1B3TA 4QIVA 3FMBA 4OIXA 3UWTA 1EP4B 2CQ1A 4B3MJ 2QM1A 4DV1K 1RBTA 1Z6RA 2VYPA 4RW8A 3RR7A 3M05A 2DTJA 1LWEA 4HLBA 3WXKA 5EWFA 5KFPA 1SQGA 2JH3A 2R2UA 2NRXA 5J2QB 2RF2B 2X6NA 5EX3A 5L1KA 2Q6CA 2FY8A 4USTA 2GV9A 3KUHA 3CJ4A 3SQ4A 3MXIA 5GADP 1WOSA 5ELZA 4AQYF 2Y3YA 4BE2A 2ZNZA 3CCES 5H9EJ 2GHVC 3S8SA 1H1VA 1AA1B 3HSZA 3M32A 2ASMA 1IKVB 2G1DA 2KZZA 1S5JA 4RNHA 3ETMA 1F1BB 1KQKA 2KB2A 4B3OB 5KT4A 1Q82T 1BHLA 5HRRA 2KVIA 4B08A 2YWHA 4OZ2A 4DMZA 2YHYA 1DTTA 1M90T 3HVTA 2ROGA 3C66A 3D2EA 1TL7B 3CMEN 2LVWA 3KLVA 5BPLA 5KT7A 3MN6A 1IBCB 1SKUB 3S6EA 5C12A 1K8KA 3CJBA 4NMLA 3MWTA 4CLZA 1CQNA 5DG8A 2LA4A 4ECVA 4Q44A 1MWKA 1F9EB 1V6HA 5JMVA 2Y1RI 2FVSA 2V7ZA 1DRZA 1QTNB 1RAIB 1S79A 4NZ0A 8ATCB 3EJMA 1FRKA 1OYEA 1YLXA 3J7YU 4MIWA 1YZ7A 1IR2A 2DGVA 3MMCA 2HRTA 4YOXA 2ALZA 2W40A 2VASA 4B3MF 4ZPAA 3ZSYA 3EE3A 3VZIA 2FHMA 5CCLA 2F63A 3DLJA 1N6QA 2DK2A 5C25A 4X62J 4DTMA 3TZWA 1AB8A 3TTFA 3L8BA 2UXBJ 5GAGP 1RLCL 4ZP8A 3NDKA 2VPZB 4G1QA 4HHHA 4UQGA 3RBEA 4DPTA 2ZE2A 4J9MA 3K7RA 2XSFA 3AA8A 3J81j 4K42A 1W97L 1JK9B 1S0VA 1K73T 3CJKA 4LF6J 3P38A 2BYCA 3O6QA 1XR7A 3OHAA 1U26A 5D4NA 1PC4A 4WFYA 3UVJB 5B7WA 4ECRA 3N4QA 3DXSX 4Y28C 3LWMA 3RGIA 5LT5A 1BCMA 1X9MA 5J2MA 3MUMP 2Q1LA 3K8VA 8RUCA 3CSKA 3CJ8A 4ZVUB 2OLWA 3TUZC 5HAOA 1JQGA 1FT8A 3BGUA 3G6YA 3WXJA 2E6LA 2FJBB 1FXRA 3IA0A 2A2CA 1BMQB 4I7FA 2GMJA 1Q86T 5L39A 4LRCA 4MT1A 3U7JA 2EWSA 1H74A 2G8HA 5SWMA 4J2EA 4YB1P 3GLJA 4ED6A 3M8QB 1U45A 4KV8A 2NYIA 1RAJA 4QQBA 3BSNA 2LEAA 5KFHA 3VQ7A 4ZIWA 5HN0A 2CQ3A 4CJLA 1H2UX 1RYRA 3F9MA 2W2PP 4NLYA 3R8YA 2D1CA 4KAIA 2D3O1 1Z25A 3I96A 3GYXB 1C0FA 1PKUA 3MN9A 2QC3A 4M3TA 4RW6B 2HK2A 4ZCLA 5CZ2A 3C3LA 2H51B 2QIFA 3KG1A 3DLLQ 3Q7CA 4H4OB 1LK7A 4K43A 3A2FA 1SJQA 4NLXA 3FGUA 4C11A 2CQDA 3MEEB 1Z26A 2AYGA 1UTAA 4BC4A 3P96A 5I4MA 4X62F 3KLIA 2MZTA 2UXBF 2UXDK 4A46A 3C7NA 1UEVA 4KH6A 5T41A 2M9KA 3MMAB 3THVA 3C6UA 5DGAA 5A8RA 3K5LA 1QY7A 2E1PA 4DX7A 1RAEB 4JLHA 2GMHA 2QK9A 2M0GB 3POTB 3TEGA 2E2NA 2ZGYA 4NYOA 4UOGA 4K2XA 4DTPA 3CJSA 2CQHA 2H5IB 4I6MA 4LF6F 3CJCA 3OVNA 3L7OA 4CYUA 2PYJA 1HW8A 2FBYA 2F4VJ 3H98A 2IIRA 4CJ3A 4CZLA 5DM6Q 2I1RA 2XZDB 1RGVA 4IUFA 2PT0A 3X1LB 2NPFA 4DSFA 1R59O 4FO0A 3MN7A 2XEXA 3HZ6A 2HAIA 1S7IA 1C1CB 3GTYX 4CZMA 2YHXA 1RCHA 2OMOA 1TKTA 1YK9A 1WF1A 3AB2B 5SZTA 2GNKA 2YNIB 2VD3A 2W6KA 3DLKA 3MCOA 3JS6A 5AQNA 1NOZA 1YITS 4OQJA 1U4BA 4HI2A 4ZPTR 5BPMA 3T1HK 5LXYA 3NNHA 2OPSB 1K9MT 3PEJA 3THWB 3TQ1A 1O13A 1ZAVA 3GJQB 2EWHA 2V5HG 1NJWA 3PSFA 1F21A 2PGCA 3JAMY 1RDDA 3UN2A 3DGPA 2M8DB 1QSSA 2GQQA 2F4VK 2C2EA 2CQBA 3KWIA 2QLXA 4AFFA 3BZQA 3VF0B 1Y3JA 1NDCA 3OL7A 1R8AA 3BGOP 1LW2A 4TU8A 3OBYA 3N9UC 5KG6A 3BPSP 1U0SA 1RT3A 3M2RA 2FLPA 3H0PA 4MYUA 2EW9A 2ATLA 4V1Ak 4C8ZA 4DZ6A 2B8QA 1KFSA 2DPJA 2BEFA 5IWAK 1MMDA 3JSMA 3D66A 1WF2A 4NLOA 5E26A 3I33A 1WD6A 4DV2J 1RHUB 3B8HA 2RB7A 3IRWP 3TJ8A 2F8TA 3V9ZA 4OLPA 3LDOA 5D0GA 5J1EA 5DETA 3HP6A 4OPJA 1SJ3P 2UVUA 4USUA 1XNQJ 4LUBA 4TU7A 3L3UA 4KH0B 1XMOK 2O8BA 2C3PA 1G3OA 3P4UB 1CEZA 4JUZA 3V6DB 2F4VF 3NVKA 1S97A 3PX4A 3MOJB 1EP4A 3VF4A 1J27A 4MK9A 2E4LA 4ID1A 4FS1A 3F41A 4HHUA 2NR0A 3SI8A 3OJUA 3OTEA 4JI6J 2FZKB 2WRMA 4Z0UA 1RWNB 1G99A 1ZBIA 2XMVA 3BM7A 4KFBB 2VBXA 1YITN 2OSRA 4IRDA 1LFWA 5HATA 3IBFB 3NRBA 5J2QA 5FRMA 2RF2A 2DH7A 2HHWA 4JI4J 4AF1A 4AM7A 1RHRB 2MJNA 2YVSA 3SNNA 2NS1B 3KKFA 4JBCA 3BY5A 1S9GB 3PYGA 4UF4A 4IQMA 1TUVA 1XEZA 3TWHA 3MUVP 4M45A 1URNA 4BGAA 1OY6A 2I7NA 1IKVA 4CLFA 3I0RB 5B0AA 1R8CA 1UZHA 1VSIA 4CLKA 5K8PA 3AA4A 5F8IA 4FCYA 4B3OA 4ZPWR 4NA1A 1SI9A 3E01B 3MEKA 3TAPA 3SV4A 3ENWA 3VQBA 2CRLA 2K8GA 3AO5A 1LNQA 4UUWA 1MMLA 3OYGA 3HM8A 4WFAQ 3VEWA 2LMIA 5IM0B 1HKGA 2WB4A 2ZQBA 1TL7A 4C8OA 2DNMA 3S01A 4DV2F 1A5XA 2CQGA 4LF9F 3CJ2A 3MD3A 3QRRA 2VC0A 5HMYA 4IFVB 2XYPB 2K7KA 3SBTA 3AO2A 3BDEA 3M1FA 4WFXA 2IRUA 1REGX 3D3BJ 3TTDA 1XNQF 3B54A 1IR0A 1U09A 2GV1A 2B3TB 2VF3A 4U8YA 4F67A 2GO9A 2ZH7A 4MO5A 3CCQS 5M1QA 2IA0A 3T5JA 4W5NA 4GC7A 3SUNA 1WC5A 4Q7AA 2AHOB 4JI6F 2Z2ZA 3QSIA 1WOQA 1BIUA 3HF5A 2BKPA 5E7OB 2QSWA 3ZXWA 1XHXA 4UOFA 3AT1B 2JEJA 4CJRA 3GIRA 2LEPA 1H98A 2V94A 4GVMA 3BF1A 4BROA 2ZUAA 4M5LA 1NJYA 5L1LA 2A5XA 1KHVA 4JI4F 2B0GA 2KT5A 5ETPA 4B9TA 1RZMA 4CJVA 2PEHA 1P8ZA 1ZBTA 3D0GE 2ZZNA 2GVZA 3K5MA 2CPDA 5BYRA 4CECA 3UVJA 4EU0A 4DU1A 3DJCA 3VR1A 4FJLA 1Q5VA 3AVGA 4V19S 1GLFO 3C94A 4HCBA 1S9EB 3GV8B 2P5GA 1JNRB 3GIMA 2OD6A 3AJDA 3IAYA 4CH1A 1U7LA 3QRQA 3U3GA 2BOAA 1IVZA 2GJIA 4CO1A 3PFEA 2M2BA 3O8WA 4FZYA 4MK7A 2CWXA 2DGTA 1CQMA 4FW2A 3VOVA 5GAEI 3IRXB 3M8QA 2V63A 4FWRA 5DDRC 2D3ZA 3I9ZA 3ENQA 2HAFA 4KQZA 4GC6A 4Q2LA 1GTHA 3EZ5A 3R5CA 5JVGL 3OXLA 3GIKA 1Q1KA 3KDOA 5C2FA 3HK2A 1CULB 3QT6A 1HUXA 3Q8SB 1FRHA 4RW6A 5AZIB 1NGGA 5C7PA 1BWVA 4IQXA 1JLEB 2JOQA 2YPZA 3CCRS 4JK7A 3C19A 4HACB 4H4OA 3EE8A 4CF8A 2HIYA 3E2EA 3A3PB 1RHQB 2OD4A 3CG7A 3MWBA 5HOOA 2ZH8A 3W1YC 3GYGA 1G1XA 2DO4A 3QWUA 2EFVA 4DV7J 4DV6F 4O3RA 3V6HA 5F8JA 1VQNN 3MEEA 4XEIA 1HYZA 4DUZJ 2KRRA 3TOQA 3RYLA 4CZKA 5ADXH 1O51A 3CJ7A 4YOEA 4MQ3A 4ANCA 3I8DA 1FCAA 4O4GB 3CJAA 4CHPA 1RTJB 2MQLA 3CPWM 3MTJA 2QE5A 3MMAA 4EBEA 3Q24A 3CWJA 3E9PA 3POTA 4WU3A 1IJJA 5C15A 3DU5A 4EMDA 2UUTA 3UCGA 4CNZA 1B9DA 1CZ9A 2HMIB 2HPUA 3FE1A 2W9BB 2QN6B 2IBOA 3HHNB 4K4WA 2FQQB 4DV7K 5KFVA 1B0TA 1C1CA 4DUZK 1RKIA 3EZUA 2YKQA 2AF6A 4NLVA 2V2KA 3MCSA 1Y9OA 5JLFA 4OZ5A 2XMWA 1PIEA 1IWGA 2YNIA 4JV5K 4Z4GA 5BRDA 1DQAA 1RBOB 4HUFA 1VQPN 2G0IA 3FBEA 3CCRN 4LSZB 2HLUA 3AGKA 2VG7B 1P1LA 2OPSA 1AT1B 3THWA 1HYVA 4FPIA 2A10A 1M1GA 1NB2A 2QYGA 1M5SA 5D0EA 4F50A 3SUOA 2AGQA 2WBRA 5KFNA 2JSXA 2VJUA 3M9MB 4PWDB 4X4OA 4FPBA 3PTWA 4O3NA 1FJGK 3MZIA 1N0UA 4KT0C 3PXGa 3VQTA 3FZMA 4KH5A 3R8EA 1DEJA 3R5DA 1Q7YO 1NKBA 1R31A 3DOMB 2IC3B 4LREA 2W2NP 5SUHA 3CTRA 4BDPA 2MTLA 1N88A 3KKSA 4WYBA 3QGIA 2P9IB 5HJYA 4K8ZA 2BW7A 1CZAN 1UFLA 2FBTA 3UN5A 4B02A 2HBRB 2NZ4A 4DFMA 4XH1A 3MGJA 3DLEA 4YUDA 2MLZA 1S48A 2C2OB 1X5PA 2Y0BB 2IY5B 1ITPA 3T41A 5KOXA 1FNXH 1A6LA 1UVJA 5C2GA 2QT7A 4O8KA 2WONB 2IYIA 2EFGA 1BWFO 3BSAA 4FJXA 3CQ8A 1WOOA 1HPZB 2PN6A 4IG3A 4DS5A 2PFFB 3NGDA 4ED4A 5KFLA 3WIVA 3F9KA 3GSIA 1R7IA 4OI4A 2W6LA 4DV3J 4BHQA 4KFBA 2UUBJ 2HEKA 1OSDA 2PMHA 1ASUA 3R9LA 1W26A 2KO1A 5AQIA 4CLYA 2DO0A 2F1FA 4AD6A 1KVKA 3EO3A 3KLHB 4CIFA 1FKOB 3PRDA 2QZ8A 4I4BA 1E4FT 2R2TA 1U8SA 5E41A 3SCLE 3MXHP 2ZHBA 4IH5A 2K7JA 2GIRA 1VLYA 3CUNA 2VWBA 3CJRA 3OYLA 2GIQA 5IFMA 3OS1A 1S7HA 4WFZA 1MWMA 4HHTA 5GAGU 4RR5A 4S0MA 2B4PA 4R5PA 3UDCA 3O5BA 2MSSA 4X4UA 3TR8A 4XDCA 5A8KB 1GLBG 4O3SA 4EEYA 4PYDA 2E2PA 4E2FB 1SQFA 2BJ9A 2FBXA 1IN0A 1NUEA 4DSJA 3V9UA 4DV3K 1WBDA 4A57A 2E7XA 3QQCD 4ECUA 3GJRB 3DN9A 3OYDA 5IM0A 3L4BC 1YTAA 4DU7A 1W2BR 1C4AA 1Y7PA 2CNKB 4OO1J 4NYFA 1HPMA 1D8ZA 1WUUA 2CPZA 1FFGB 2VGMA 3VAHA 3EGNA 4CJKA 3IM9A 3OV7A 2HBKA 3PRBA 1HA1A 3M2VB 5T14A 3CD6S 5ETVA 1FVSA 3Q8PB 3R3TA 2XMMA 3OVAA 2HF4A 1ZM3A 1CS4B 3O1BA 3HSGA 1WHYA 2UUBF 1VQYA 4HT7A 1IJEB 5JLHA 3HYFA 5D0RA 4BY9C 2FD2A 2PAVA 1F5AA 4NLRA 1GMWD 3M8ZA 4OZ3A 4JKDA 4ECXA 1NRKA 2Q97A 3MPWA 1KN6A 3CB4A 1ZAWA 1YT3A 4Y3CA 4CP5A 3IWNC 4BRAA 4PXDA 4KHQA 3QO9B 2FLNA 4P7VA 1KLNA 2YKOA 4Y65A 4KHYA 4N8OA 3W66A 1UOCA 1KBRA 1W2IA 4JRQA 4YY3J 1S9EA 2VFSA 2HZCA 4ECYA 5KG1A 1NO8A 4CGHA 5KFXA 1WDTA 3WIUA 4OYIA 2PZSA 1BE4A 4DQ8A 3QB0A 3KTQA 3ELHA 4E7KA 4C3KA 2C2ZB 3ZTSA 2GAGC 4ZOSA 5E3QA 3IR5B 1ZA2B 5U47A 2C2NA 3TEHB 3IRXA 4AXIA 4YORA 1X7VA 2GJFA 1PSDA 2RPIA 3NFAA 2Y9HA 3H08A 1TR0A 2UVWA 5CY4A 1WSJA 3RB0A 4OLBA 2P9SB 4LF5K 1GOAA 2LQ5A 3Q86A 4AHCA 3CDAA 4X4NA 3CD6N 1CULA 5HVGA 1WWHA 5AZIA 3B78A 3I55S 1JLEA 2CDQA 2P9CA 4HACA 5CHIA 3H1QA 1HJRA 3CCZA 5EU7A 1GFWB 3B8AX 3U6FA 1VHFA 2UUAK 1Y5LB 4NZ7A 4BBYA 4LIRA 3BEGB 2P51A 1GMUA 3CETA 3CCUS 3KG0A 3G6ES 3WC2A 1P1TA 4DF4A 4O4GA 4J2BA 1RTJA 3KVGA 1JL1A 4CFAA 1MWQA 1NMDA 2E9RX 1EX8A 3Q8YA 2BE2B 3HL8A 3NHGA 2EVZA 3OYCA 2W42A 3TUIC 2B4VA 5AQMA 1B64A 4C6AA 1SB6A 1F9FA 4ZJLA 1Y3KA 4RU9A 2FJEB 3OYIA 4Y2KA 5LSLA 1VC0A 4ENOA 4ZLLA 4GO5X 2YBVA 2HMIA 1BGXT 2G4BA 4KJIA 3G10A 4LRAA 1U0HB 4YY3F 4X66J 3T9NA 2W9BA 1PBAA 1FX2A 4P74A 4BC7A 5AQOA 3J7YI 5F2RA 3HT3A 3KLGB 1X4FA 4RNOA 3FZ2A 3TX0A 3L3CA 4A62A 4ZPBA 3RMCA 3EKUA 4OGCA 3S3NA 3GFHA 3OA9A 3I55N 3P3DA 3NGZA 2FVQA 3KKRA 1RJJA 2VG7A 1UVKA 4D3HA 3OR1B 4I0WA 4XPEA 3KDNA 4CFDA 2AA4A 1PGZA 1UETA 1NK7A 1X9WA 1WOPA 3QINA 5K20B 2JL9A 3IR6B 3H1VX 4KHNA 4PWDA 3NE6A 1NDKA 3CCUN 1UVIA 3G6EN 4CGFA 2NPIA 2AX0A 3C6HA 2V2ZA 2MXYA 2IHR1 1ULRA 5KGWA 2E5HA 2CPIA 5IC6B 3G6VA 4C98A 1T05B 1F2HA 1BUPA 1PILA 4BQLA 2IC3A 3DDKA 2XB2D 4FLWA 3UI3A 1WHXA 5I3QA 1B0PA 1NHKL 2P9IA 3VMFB 1ZBLA 2DJWA 4A8QA 2F40A 4DL5A 1J9AA 2J0WA 1WSHA 4IR1A 4AL5A 4JEPA 1SUQB 1T7PA 1T6CA 2BX6A 3Q7BA 3NCPA 2CJKA 1JCFA 2WONA 2L3MA 2VCPA 1RCXB 4X66F 2ZC3A 5KFDA 1HNWJ 1J5OB 4CERA 4F26A 2HFVA 3R6GB 3W63A 5KFSA 4BGBA 1FE4A 4ZCMA 5C5JA 3K58A 2K1RB 1Q8BA 2Q3PA 1RISA 5D77A 1X3NA 4EUVA 3R5BA 4XAKA 2J6UA 2LQBA 3KLHA 1FKOA 2JVRA 3ET6B 1BHNA 1UJ5A 1FRLA 1U2CA 2YY3A 4F02A 4YB5A 2UUWA 1HQEB 3VZHA 1NGDA 2ILZA 4F4ZA 4OI3A 3O4QA 5KPRA 3KD1E 2WVDA 3TAEA 4JV1A 4MKVA 4F4KA 3VEXA 1HMVB 1JJHA 4DR7J 4IOXA 3PYEA 4A8SA 3M5RA 2CJ9A 4HVZA 3ZTQA 3NF6A 3AXKA 3TUPA 5AFUA 4NLGA 4KHRA 5A8KA 1VSJA 1HNWK 2CPFA 2BV3A 4NB4A 4QBUA 4J9OA 3A0IX 4DG1B 2LLZA 2GJ2A 3M8YA 2Z56B 4DB3A 2G2YA 1YHQS 4BWMA 4FJMA 3SAFA 4CT9A 3QDKA 4CD3A 3ZSQA 3NS7B 3DLBA 4UOCA 4P71A 4WWSA 3AVMA 4K5SA 2GTDA 2NCKL 4DHVA 5A2QU 1FRIA 1R0CB 5HQLA 1U1PA 2XLIA 3LP3A 4PQAA 5E3CA 1U6FA 1X4CA 3BB5A 3D7EO 4LVOP 3TA2A 3B6PA 1EX4A 4PKDB 1HJOA 1R8BA 2FB0A 1VFJA 4E89A 4F3QA 1JCEA 2DXFA 2JC1A 4X84A 3M2VA 1DTQB 5CHCB 3QETA 3KHRA 4QS9A 3NGIA 3UKUB 2E1YA 3DMJB 3B82A 3PKYA 1SH2A 1QE1B 4CDIA 3MMBB 1CS4A 4NCBA 2C3OA 4FWOA 2CUYA 2A1BA 4J9KA 4LSLB 2ACYA 2XI2A 4A2BA 2P5OA 2OZSA 3KK2B 2A40A 1KVAA 3EY1A 4FP9A 4BE1A 2VC1A 1FFWB 2UVRA 4B3TJ 1YG0A 1FFSB 4ECZA 3QO9A 1LAWA 1ATNA 4NLQA 3MM9B 3I5AA 3T19A 4OYPA 4DR7F 4M7YA 2CXEA 4ZTFA 2OA8A 1LAVA 3GIJA 5LL6d 4DL0C 3GFYA 2ITGA 1YHQN 5LMNJ 3C6TB 4P52A 3OLAA 4ZK7M 4G6VB 3FRYA 1YAGA 4YFUA 3CCVS 3HSDA 5DJBA 3AAWB 4DUYJ 4LF7J 5DQGA 2WVCA 3D4JA 2R8JA 1WBBA 2C2MB 3PO5A 4U67L 3DXMB 4CHYA 1OPZA 4NPOA 2KXFA 4DV4J 4NLUA 4ZVEA 3O9SA 4CF1A 4BR7A 2UV8G 1U8WA 2P9SA 4GNIA 3D45A 3D5MA 2QWQA 2KT3A 4GMKA 2IRYA 3T5HA 4OZLA 2D9PA 3VCDA 3OVBA 4LFBJ 2UYTA 4N5SA 1Q53A 4U7UK 4G3IA 2SXLA 3O9TA 3BSCA 3ZTPA 3LM2A 3ZC4A 3ZT3A 5AR0A 2JEGA 3DCAA 4JI0K 1QQNA 3HTVA 4M5MA 3GE1A 2GMLA 3QYYA 3DRSA 2GAHC 1FWLA 2PO4A 4IXCA 2J0QD 3NLCA 2KG0A 3D1HA 3MPUB 3FJ2A 1NGBA 2AYEA 4R8UB 1QAYA 3E8OA 3MPDA 4URGA 4KHPK 2BE2A 4QU7A 4M3RA 4FYDA 3T1YJ 4B3TF 2E1AA 3KJFB 2BKNA 5DO2A 1X4HA 3ZX0A 4PL8A 2UUCJ 4XPCA 1TMJA 4X4TA 5E84A 5LL6Z 4CF9A 4ZHRB 4YOWA 5IV3A 3CCVN 1U0HA 4H0YB 1U2VB 5LMNF 4Y1DA 2EBGA 2HHHJ 1IUJA 4B17A 1TK5A 1W7WA 1X5TA 2R7TA 4OX6A 4YOTA 5KFUA 3SJHA 3KLGA 4D3GA 4DUYF 4LF7F 5EHHA 2ZM6K 4BG9A 4L3KA 5HBMB 4DF8A 2CDRB 4KHUA 3AVLA 1QTMA 1Y64A 4FWPA 2YKAA 2V68A 4PPZA 1DJ0A 4X4RA 4PY5A 3J80O 4DV4F 3KWGA 1RAHB 1IBMK 4F3OA 4O3OA 3ENAA 1VQ6S 3MWPA 5G0RA 3OS0A 2VGNA 2NZCA 3OR1A 1PAUB 4NYPA 2HFZA 5D4LA 1FKPB 2XBPA 4Y00A 1GLDG 2AEJA 3OTOJ 3IMXA 2QMXA 1S22A 2DGUA 4LFBF 4O8UA 1OY8A 4U8VA 1I3AA 2K2PA 3THPA 1H7XA 4LJMA 3JQMA 2HOEA 1U49A 5K8NA 2JX2A 2Q1NA 1NU0A 3QSYB 1T05A 4BG8