2VG7A

Crystal structures of hiv-1 reverse transcriptase complexes with thiocarbamate non-nucleoside inhibitors
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
550
structure length
544
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords REVERSE TRANSCRIPTASE/RIBONUCLEASE H
publication title Crystal Structures of HIV-1 Reverse Transcriptase Complexes with Thiocarbamate Non-Nucleoside Inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 137
structure length 544
sequence length 550
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2007-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2vg7A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2vg7A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2vg7A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2vg7A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2vg7A05
4FXDA 4ECYA 1JXLA 4AH9A 1HYSA 2JLEA 4O55A 2OPSA 2R2SA 2IJNA 4F3OA 3ZSXA 4J9KA 2E6MA 1RTDB 4N47A 4KE5A 4KHMA 2VG5B 4TLRA 1UAXA 1S97A 1NHVA 1I6JA 1JLFA 2ALZA 3AO4A 1J5OA 1OS5A 3ZSVA 1TL3A 1LAWA 4PQUA 5C25A 3AO2A 3ZSRA 2ZD1B 5KFMA 5DLGA 1D0EA 3F73A 1JX4A 4RW4A 4KB0A 1SV5B 1IM4A 2AU0A 3MFHA 5J2MB 5KFSA 3ZSYA 1WSEA 4IFYA 1RDCA 1B9DA 1FK9A 2BGGA 4H4MA 4YR2A 4CE9A 1IKVB 4CFCA 2YKMB 1TKDA 3O4NA 1RT2A 1BQMA 3H98A 4I9QA 2DY4A 2CJQA 5KFFA 3GV5B 4NCGA 3NGZA 3KTQA 1Q9XA 4ZVHA 3GIJA 2ZE2B 4ECUA 5FROA 2XY6A 1L5UA 1JLGA 3T1AA 4BE1A 2PZSA 3HJFA 2HHQA 1S1UA 5DLFA 1TL3B 1CZBA 2V4QA 1RCHA 3PO4A 3RMCA 4JRQA 2QK9A 5C25B 2J6SA 4KPYA 4DL3A 4FVMA 5L1LA 2O4GA 2RPIA 4CGHA 1K1SA 5F9NA 3H4BA 4RW4B 4NLOA 5HLFB 5JS2A 4ED3A 1EX4A 1A5XA 4CESA 1KLNA 1HQUA 4IFYB 4FLUA 3PW5A 3Q8SB 4JRPA 3NBPA 3V6DA 1FK9B 4M94A 4NLWA 5SZTA 3PUFA 4J9NA 3GIIA 3VQBA 4O4GB 4CFDA 4FCYA 3T5JA 4ICLA 4O44A 3NKYA 2B43A 4HCCA 1RT2B 1IKWA 1REVA 2HHSA 1S9EB 5HP1B 4DSLA 3QO9B 4IFVA 1T3NA 4NCGB 4F4WA 3H5XA 3PW7A 4MIAA 3MXIA 4M3RA 3HVTA 3ZCMA 3TABA 3CJ0A 1JLGB 4CJQA 2AGOA 3NDKA 1CXUA 1GOAA 3VQ7A 1X9WA 1C0UB 2FVQA 4Q0BA 3IAYA 2X78A 1BL3A 1LWFB 1YTAA 4JS4A 1HJRA 3C6UA 4M3ZA 3ALYA 2KZZA 3G6XA 3H4DA 1IO2A 3SUOA 5J2QA 3ZSWA 3CQ8A 3TAFA 5F8IA 4DQIA 1D1UA 4Q44A 4OKKA 3KLVA 1XWLA 4E89A 1S1XA 4RNFA 1RDBA 1VSKA 1XR5A 3O3HA 4K4UA 4QWBA 3VQEA 1HNIB 4NZ0A 3JYTB 1TAQA 3VQ8A 4I7FA 4H8KA 4M3WA 4ED8A 5KFCA 2ATLA 1N6QA 1T03A 1X1PA 3AVGA 3MF5A 1QAJA 4TQSA 3K58A 3NMAA 4H4OB 1IKWB 1REVB 4PA1A 2ZQBA 4HUEA 2HNZA 4FLVA 4MQ3A 3QEXA 2FC0A 3G0ZA 4YR3A 4IFVB 5DG9A 3KK3A 1DTTB 1JL1A 4CCHA 5KFOA 4QOZB 4FJIA 3QINA 3TARA 3BQ0A 3V9WA 4CGGA 3P5JA 3H08A 4CJUA 4FBUA 5KFWA 1J54A 1NK8A 4O3NA 3LPUA 2BDPA 2R2UA 3BQ2A 4Q0BB 1HPZB 3DMJB 4W5NA 2Y1IA 2VA3A 1D9DA 4O3QA 1BIZA 3RMBA 4I2QA 5KFXA 3KK1B 4HVJA 5J2QB 3NL0A 4W5QA 1RAJA 4HKQA 2XGQA 2UUWA 1S1XB 3OYLA 4ZP8A 3IRXB 1T7PA 3QYYA 2YHBA 1BI4B 2BE2A 5F8NA 3PX0A 3QIDA 1N6QB 1TV6A 4EP5A 3O3GA 3T5HA 2XWYA 3H5YA 2PYLA 1FKPA 5FRMA 2A1RA 2IAJA 3ZSQA 2HNZB 2QKKA 2W8LA 1ZBUA 5T7BA 3QIOA 3ISNC 3AVIA 1UA1A 4EP4A 1S9FA 3LP2A 5FDLA 4KTQA 3KLIA 3NH1A 3DYAA 2UVVA 4IDKA 3D5MA 3RBDA 2DFHA 1QQCA 3RMAA 4GW6A 1SL1A 2IM1A 2OPRA 1WN7A 4HUFA 1GX5A 4L8RB 4ZP7A 1S1VB 5KFRA 3L8BA 3LP3A 4N76A 3HYFA 4NCBA 1IKXA 3FFIA 3BDPA 3KD5E 1Q9YA 3V1QA 4DTNA 3LPTA 4CHZA 3M8RA 1Q8IA 3VQ6A 3VQPA 2RF2A 2O4IA 1TKZB 1GOBA 2VA2A 2PY5A 1LWCB 3NHGA 3DOLB 2W9AA 1S1TA 4BDYA 4QW8A 4FJHA 3S9HA 2HAIA 4WFXA 5KRTA 1N5YA 3RB4A 4F2SA 3FQLA 2BE2B 3L2UA 1QSLA 3AVMA 3FSIA 4IOBA 3SYZA 2XI3A 4FZXC 4EBDA 1MU2B 4IKAA 1HNVB 4KHRA 1RT6A 2UUTA 3EPGA 3D45A 1QHTA 3LP1A 1ZBFA 2X6NA 3N6LA 2ILYA 4AHTA 1RT3A 2HHWA 2I5JA 4QWEA 4LH5A 3DYAB 1RT1A 2J6TA 4OKEA 3MECA 3PJWA 2OPRB 3NAHA 3DRRB 4WXOA 3Q8RB 3K57A 4FLYA 4DMNA 3SPZA 2YNIA 3PY8A 1RA7A 4LSLA 4CHYA 4IG3A 3V6JA 3OYMA 4F2RA 2RF2B 4CHPA 4CIGA 4DQRA 5KG7A 1S6QA 3CJ3A 3ASMA 2JC0A 1DLOA 4J9PA 4G1QA 3DLEA 4B8CA 3M8PB 2FJVA 5KGWA 3PV8A 3WNGA 4R8UB 4HHTA 4KSEB 4ZP9A 2BR0A 3CWJA 5L1JA 1YVUA 1JXBA 1VSEA 5CYQB 2C2DA 1MMLA 4DLGA 4NLUA 4N41A 1RT6B 1RBRA 3M8SA 3KIOA 2G8KA 3LP1B 2ILZA 4ZP6A 4TYBA 1RT3B 2I5JB 3DM2A 1KVBA 1SKRA 4F4KA 3MEGB 1K6YA 5KG6A 4NYNA 4R0EA 4CF2A 1EETA 4Y1CA 3TAGA 2YNIB 3ZT3A 4KAZA 5J2PA 1JKHB 1SH0A 3DLRA 2QXFA 5KT3A 3SV4A 3H2LA 4RU9A 3NGDA 3QEVA 3SUQA 4RW7A 4CEEA 3MAQA 4F3TA 3LZJA 4DL6A 2HMIA 2IGIA 5KG4A 4Q43A 1DLOB 4QAGA 2W42A 2F96A 4IR9A 1RYSA 4KREA 3OLBA 4RNOA 4JLHA 2P51A 3AO5A 2G8VA 4C8NA 4J2AA 3SI8A 2F8TA 4ID5A 2HHTA 1SH2A 3OL7A 3RRGA 4FBTA 3GIMA 3HVRA 2OPQA 1S6PA 3QGGA 3GV7B 2XY8A 1Z25A 3AA3A 2F8EX 3NAIA 5EDWA 5KFPA 1IG9A 4WFZA 5DK5A 5KFJA 4KKOB 3IGNA 2Z1IA 1JLCA 3OSNA 4EZ6A 2FJWA 3ITHA 4I2PB 4K4TA 1NJXA 2QV6A 3EZ5A 4NLQA 4QPXA 5HROA 2NUBA 4W5OA 3I5CA 4Z4CA 1LAVA 4C8KA 2B6AA 2IC3B 4KI6A 3PW0A 2B4JA 5J2PB 5KT4A 3HKWA 5K14A 4XIUA 3K5NA 4FZYA 3U3GA 3AVHA 1QSYA 4ECSA 3VQQA 4K4XA 4E19A 4AHSA 4B3OA 3CDEA 5L1KA 4CJKA 3GQCA 3OVNA 4DTUA 2KQ2A 4Z4FA 1UWBB 3PX6A 4ED7A 4FK2A 3KLGA 2D41A 1X9MA 3CFOA 2E6LA 4ID1A 3L3UA 4ID5B 4JV2A 2XGPA 4LQ3A 4CJPA 2OPQB 1S6PB 4EO6A 1TKTB 2XCPA 3HP9A 2A1SA 3CG7A 1N48A 2ZD1A 1U47A 2W7PA 1TK5A 4OGCA 5I42B 4CEQA 4QCLA 1KLMA 1JLCB 1SV5A 1VRTA 4M3TA 3ITHB 2V0NA 1TKXB 4O3OA 1WSJA 3RR8A 2IMWP 5KGXA 1VSHA 1C0TB 4MK8A 1SUQA 1BISA 4KHUA 3BGRB 3KLEA 3C94A 3WNFA 4FW2A 4B3OB 3OYIA 4KV8A 5KFYA 3HPHA 4TQRA 1VSLA 2JC1A 3JSMB 4CJSA 4R5PA 2XY7A 4B9VA 1NKCA 1Y97A 3NF8A 3KLGB 2ZE2A 1KFDA 1JLQB 4DSIA 1QE1B 2W9BB 5KT7A 3ZT2A 1TAUA 2GC8A 3L2QA 4URSA 3LWMA 3CYMA 1ZBIA 3KK2B 5HRRA 5JUMA 2FVSA 4NLRA 5KTQA 2AX1A 3PVXA 4ECVA 2G8IA 2VWJA 3RRHA 4BE0A 1QTMA 4K4ZA 1KLMB 4Z4EA 1VRTB 1TL1B 5HLFA 5EWFA 4B9MA 5C42B 3KD1E 2DPJA 3CJ4A 2B5JB 4NRTA 3Q8QB 2IBKA 3NF6A 3AVFA 5KFGA 1RNHA 1SUQB 3AO3A 1I39A 4AILC 4ZVEA 4O4GA 3DRPA 3KLEB 3SFUA 1RBTA 1TK8A 1NK6A 1EXQA 3B6PA 4AHCA 5DG8A 4KV8B 3M9OB 4O0IA 1S9EA 5HP1A 4FLWA 2BQUA 4CF9A 4R5PB 3QO9A 4Q8EA 3TAQA 4DQSA 1R0AB 4O4RA 3TAMB 1ITGA 2RKIA 3PX4A 2IS3A 2R8KA 3OSPA 1BHLA 4CIEA 1SKSA 2FVCA 1VSDA 3OYGA 4O5BA 1ASVA 4NYZA 3PR4A 3H59A 2HVIA 1C0UA 1SL0A 1LW0A 4KHWA 1LWFA 4CECA 3E51A 2GV9A 3V1OA 3SV3A 1ASUA 4K8XA 4DFMA 4TY8B 3OS0A 3GYNA 4CGFA 5J2NA 5DQIA 2IM2A 3EZUA 4IRDA 4J9OA 3C95A 3C6TB 1KCFA 1HNIA 3JYTA 4CHNA 4URGA 4KB7A 2YHAA 2YV0X 4J9MA 4E7LA 4KRFA 2XI2A 3ZT4A 3DRPB 4M45A 4CJ3A 4J2BA 3T3FA 2WHOA 4H4OA 5F8MA 3AA5X 3MXMA 1DTTA 1HARA 2RKIB 4KO0B 3CM5A 3DRSA 5KFLA 1T94A 5SWMA 3CJ2A 1SH3A 3RAQA 4IQXA 4FJJA 4FJNA 3NF9A 3QESA 1HPZA 4CHOA 1LW0B 4K4VA 1UOCA 3DMJA 1QUVA 4CFAA 2FLPA 5KFAA 3D28A 3KK1A 4CJTA 5HRNA 5KG3A 3SJJA 2PYJA 3OYCA 1NKEA 3BQ1A 4ECZA 3OYKA 1JXEA 5J2NB 3VN5A 3S3OA 3HM9A 4JUZA 4NLPA 4MK9A 1NHUA 1BIUA 4CIFA 1S0MA 3IRXA 3S3NA 4NLDA 4FJ8A 3M9MB 3EYZA 2IDOA 3G10A 4DSEA 4B9TA 3BSOA 4WZMA 5HBMB 1BI4A 4DFKA 3F9KA 4E7IA 3DLHA 2WOMA 3MR2A 5L1IA 3CVKA 3O3FA 3SQ1A 2X74A 4PUOB 3QIPB 1C1BB 3AO1A 4MKBA 4EZ9A 1RTIB 1ZTTA 3PW4A 3DRSB 5I3UA 3CDUA 1XI1A 1L3UA 2E9RX 3VA3A 3PO5A 3AVLA 2VG6B 4O3PA 5DGBA 1S1VA 1WSIA 1JLAB 3KMSA 4K4YA 4OVLA 1RTHA 2C28A 1BQNA 1TGOA 2Z1GA 1C0MA 2D3UA 3QNNA 1TKZA 1LWCA 3BSNA 3DOLA 1I3AA 4HCBA 4LY7A 3KLHB 2G8HA 1RTJB 2KW4A 2XO7A 4ELVA 1RBUA 2WOMB 3AV9A 4Q45A 3KOAA 3SCXA 4PY5A 1RT7A 1MU2A 4CF1A 1HNVA 5KFUA 1TP7A 3HL8A 2DPIA 4HYKA 4DL4A 2XCAA 4KHQA 5DG7A 2QKBA 2UVRA 2FBVA 3TAEA 3RTVA 5I3UB 3DDKA 3V9SA 1IKYB 2LSNA 4MH8A 3DRRA 4YQWA 5J1EB 1YVFA 2BRLA 4QWCA 2E9TA 1RT4B 2G8FA 2KFZA 1U09A 2GIQA 4E1MA 1RTHB 3VQCA 4BDZA 1DTQB 1BQNB 2E4LA 2OYQA 4NLGA 2D3ZA 3RB6A 3IG1B 1QSSA 4CEDA 4N56A 4CJLA 1G15A 3RB0A 4YFUA 4QWDA 4NLXA 4J9SA 4DL2A 3RBEA 3M8PA 3TQ1A 4RNMA 4TXSA 4R8UA 3LZIA 4RNHA 4CGJA 2G8WA 5EU7A 1RT7B 5CYQA 3I5AA 3ZT0A 3VQAA 2HB5A 4IH5A 4M3UA 5F8LA 1N4LA 2JEFA 1S5JA 3SUNA 4EBEA 2VG7A 4OLAA 4DTPA 4DF4A 3WNEA 3DLGB 1T8EA 1RT5B 2IM0A 3NFAA 4FLTA 4FS2A 3QZ7A 3HT3A 1YTUA 3AA4A 3MEGA 4ZVGA 4FK0A 2FLNA 4DSJA 4Y1DA 4GC6A 4CJ5A 3OLAA 3KNAA 1JKHA 3ICLA 4FW1A 4BWJA 1K1QA 3G86A 4B9NA 4WZQA 1U4BA 4RZRA 4C8OA 2O5DA 4O0JA 2OA8A 4PWDB 2HHUA 3NH2A 1S9GB 4CEBA 1IH7A 4DFPA 4DU1A 2R8IA 4ZTFA 2VWKA 4Q5VA 4QW9A 2JEGA 5KG5A 3K5LA 3OL8A 4IRCA 4MK7A 3TI0A 2VG7B 2WONB 4K4SA 3NH0A 1NKBA 3SQ2A 4K50A 1S48A 4KKOA 1KVAA 3V9UA 2HNDA 4KHYA 5CYMA 2AWZA 4I2PA 3SQ0A 2P5OA 1KSPA 4RNNA 2UVWA 4JS5A 2IC3A 1NK0A 3SUPA 1QAIA 3CFRA 3LWLA 4FZZA 5L9XA 4EBCA 3V6KA 4DTJA 3MEDB 4W5TA 4ED2A 4CEFA 1RDDA 4LH4A 3OJUA 1UWBA 5FRNA 3PHEA 2P5GA 1JLEB 1RBVA 4TSXA 5KFIA 1LWEA 4CGIA 1YT3A 5KFEA 4GMJB 4MFBA 3SQ4A 5KG2A 2CKWA 5KFNA 3KHHA 3PJXA 4J2DA 3HSTB 1TKTA 4FLZA 1RILA 3KLFA 4ELTA 3U3YA 4ECRA 5I42A 1U48A 4TY9A 4KI4A 2HNDB 1VK0A 5CYMB 1TKXA 1NK9A 1NJZA 1BCOA 4LD0A 1TK0A 4FJ7A 3BJYA 4IH6A 1C0TA 4Y2CA 2ASJA 3UIQA 3BGRA 1WSFA 3K5MA 3CDWA 5EWGA 1WSHA 1A5VA 5CZ1A 4KB1A 1C6VA 2WRMA 4MKAA 5KRSA 1S0OA 5KG1A 5KFZA 4WE1B 1KFSA 3JSMA 1WLJA 4O3SA 4QWAA 4OJRA 4URQU 2J6UA 3VQ5A 4ED6A 4TN2A 3L2RA 1C2PA 3CO9A 1JLQA 1QE1A 3QERA 2W9BA 4CERA 1LWEB 1HYZA 1U04A 5KFKA 1ZETA 3KK2A 2WB4A 4DTSA 4MFBB 4DTRA 4ZHRB 2KTQA 1RBSA 2IA6A 1C1CA 3QGHA 3KLFB 1J9AA 1EKEA 2W9CA 1TL1A 4FJLA 1GX6A 4CJWA 5C42A 3HK2A 3GV8B 1XHZA 3MR3A 2B5JA 1KRPA 3QGIA 4ECXA 4ZPCA 2W8KA 1D5AA 4KHNA 3V4IB 2YNGB 1JL2A 3HPGA 5HRSA 4I9LA 4DQPA 1WAFA 4NLYA 2DTUA 1RDRA 5KFDA 3MXJA 3IS9B 2HWHA 4E0DA 1KTQA 4M3XA 4CJVA 1L3VA 4CEOA 1R0AA 3TAMA 4RG8A 1CLQA 2RDIA 3T5KA 1D9FA 3QZ8A 4KFBB 3OS2A 2FBTA 3UDLA 3N6NA 3OYFA 4X2BA 2HVHA 4RW8B 3KKSA 5F8JA 3AVBA 4DL5A 4JV1A 1WAJA 2AGQA 1C1CB 4RW6A 2ZKUA 1EP4A 3K59A 5JXSA 3NF7A 3LALA 3MEEB 4TY8A 2W9CB 3RWUA 2C2RA 2DFEA 3OJSA 1TVRA 4U7CA 4DTXA 1J53A 4FJKA 3NAEA 1VRUB 3VQ9A 3C6TA 3HVWA 2HNYA 4MIBA 1HMVA 2JGUA 4YMEA 4ECTA 3LDSA 4GVMA 3OYEA 3G6YA 3I0RB 3L3VA 5C5JA 2QE5A 2DFFA 4XO0A 2BQ3A 1ZBHA 1S4FA 5T14A 3G6VA 4HTUA 3N6MA 1WNEA 2UVUA 4OKJA 4IKFA 2FJXA 1S1WB 4KO0A 4EYIB 1JLBB 5KFQA 4LSNA 2OPPB 2EC0A 1WSGA 3OY9A 1HYSB 2OPSB 3PZPA 2P1JA 4RW6B 4E1NA 1EP4B 2R8HA 4ZTJA 4ZPBA 4Y34A 3OL6A 4OLBA 1JLFB 3ZT1A 2D0AA 3TWHA 3OYJA 1TVRB 4KAIA 1J5OB 4DSFA 4BDPA 4CF0A 4XPEA 1B92A 4RW9A 1C1AA 2GUIA 4PQUB 4W5RA 3ISND 4Z4GA 2HNYB 1VSIA 1HMVB 2BQRA 5HBMA 3OYNA 2WK4A 3QETA 1HQEA 4ED1A 2EX3A 2HWIA 3EPIA 4DG1A 3RMDA 3NCIA 4FM2A 3NGYA 4H4MB 4B9UA 4EEYA 1BGXT 4H54A 4PUOA 3DLKA 3QIPA 1C1BA 3UR0A 1NOZA 4C8MA 2C2EA 5F9LA 3SI6A 3P1GA 3HHKA 1NNDA 3SPYA 1RTIA 4AHUA 4BE2A 4LSNB 3KHGA 4ZVFA 4F8RA 4ELUA 1BQMB 4Z4IA 2Z1HA 5KI6A 4CHQA 2VG6A 1U49A 2EHGA 1JLAA 4J9LA 1S10A 2KZMA 4CK2A 2I1RA 4CJFA 4DFJA 2AJQA 3U6FA 3IN5A 4FJ9A 4CEAA 1S1UB 2ASDA 3I0SA 3OL9A 3AA2A 2Y1JA 3HPOA 3LAMA 4RW9B 4IH7A 3ZSOA 3KLHA 5KFHA 1RTJA 1VSJA 4IRKA 1HQEB 4F50A 2V9WA 1HQUB 3OS1A 4DU3A 4DG1B 5EWEA 4IBNA 2ETJA 2KFNA 2X6SA 4N5SA 3NBPB 3V6DB 2WCXA 3DLKB 4FYDA 2F8SA 2HHVA 5KFTA 2FLLA 2R8GA 4ICLB 4O44B 5EUHA 5DQGA 4DWIA 1XR6A 3UPFA 1IKYA 1U45A 2GIRA 3BSCA 3RR7A 3AVAA 2OZMA 3VA0A 4E7KA 4NLTA 5J1EA 3KMQA 4BACA 1ZYQA 2XC9A 1S49A 4J9RA 1BCMA 4E7HA 3BSAA 1RT4A 3RB3A 3HVTB 4FLXA 1DTQA 5C24A 5F8GA 4CK1A 3WNHA 3V81A 2JEIA 1JIHA 3QEPA 3IG1A 3I0SB 4CEZA 1A5WA 1RA6A 2FVRA 2JEJA 4CJRA 3VQ4A 4NCAA 1XC9A 4C8LA 2BRKA 4M42A 3C6UB 4DF8A 3GILA 3I5BA 3QNOA 1SKWA 2YNHA 3THVA 3MR5A 3KHRA 4KTZA 3CJ5A 5DMRA 3VQDA 5E41A 4F4YA 1KVCA 4EYHB 4WXWA 4DS4A 2WTFA 3HP6A 3KHLA 3KJVA 2FBXA 1N56A 4I7FB 5KG0A 1VSMA 3K5OA 2V4RA 1T03B 4GC7A 2R7YA 1FKOA 5F8HA 3DLGA 1L3TA 1RT5A 2D7SA 3ZSZA 3OYBA 3OHAA 3EY1A 4ECWA 3KK3B 4DEZA 3NE6A 4CGDA 3T19A 3SZ2A 3TANA 4NLVA 2BANA 1D8YA 1NK4A 4RUAA 4NYFA 1NJYA 3I8DA 5C24B 1HRHA 3V81B 5JS1A 3HVAA 1L3SA 4FJGA 1SL2A 3IGVA 3LP0A 4KHSA 4F4ZA 2D0BA 4B8AB 4PWDA 4I2QB 5KFVA 2YNHB 1ZBLA 1S9GA 4CJEA 4AHRA 2ATQA 3V6HA 4ED0A 3L2WA 4DLEA 4FM1A 1FXXA 3AVCA 3A2FA 4M95A 4Y3CA 4Z0UA 4WYWA 3T5LA 4YR0A 3KJVB 4JV0A 2WONA 1W0HA 4Z4HA 1UA0A 1X9SA 1TV6B 1FKPB 3FDSA 1FKOB 4Q8FA 3OYHA 1RYRA 5KT5A 1LW2A 2IAJB 4HUGA 4E3SA 3OYDA 3RAXA 1CZ9A 3VQSA 1T05A 2BANB 3LP2B 1VSFA 5FDLB 2R2TA 3KLIB 3HXMA 2E9ZA 3S3MA 4F4XA 3MTKA 4IDKB 3KKRA 4KTWA 3LAKA 4B9SA 3MEDA 4DSKA 3TR8A 3LP0B 3LANA 3M9NB 4K8ZA 2D5RA 3CFPA 3MR6A 5HRPA 3QEWA 1IKXB 3FFIB 1KHWA 3BR9A 5CZ2A 4OL8A 5KFBA 1JLEA 3FQKA 2OH2A 2XY5A 2HW3A 1S1TB 4B08A 4OPJA 4DU4A 1N5YB 4EO8A 3PW2A 2R8JA 4K4WA 4NLSA 3E01A 4UQGA 4NRUA 3CM6A 3QLHA 4XPCA 4CJ4A 1LW2B 2ITGA 3M8QA 1Z4UA 4ZPDA 1T05B 2R2RA 5CY4A 4DS5A 1NK7A 3DLBA 1W25A 1ASWA 4WYLA 2IJFA 1B9FA 1NJWA 4FK4A 3SFGA 3TAPA 1RT1B 1CSJA 3MECB 4ZMMA 4E7JA 1Z26A 4WE1A 1TQLA 4OPKA 3AVKA 4IG0A 4DL7A 2Z1JA 4LSLB 4IG3B 1S6QB 4ZHRA 4M41A 2YNFA 4G1QB 3DLEB 1ZTWA 3V9ZA 2IOCA 3H5UA 3E01B 4ECQA 2G8UA 3QLHB 4AHVA 3B6OA 2OZSA 1W9HA 2FBYA 5KT6A 4J2EA 4U6PA 1O1WA 3M8QB 2XRIA 3DOKA 4FJXA 2AX0A 4BWMA 3DI6A 3ULDA 3TVKA 3V4IA 2YNGA 2D0CA 2AGPA 5DQHA 3DM2B 3BREA 3PR5B 1HYVA 5D3GA 3H40A 3IS9A 5KT2A 4DTMA 2YKNA 2IM3A 1KHVA 4RUCA 1LV5A 3AVNA 3NGIA 3Q8PB 1EETB 4IG0B 1F21A 3O4QA 2C22A 3OHBA 2W7OA 2HHXA 4WFYA 4OGEA 1XHXA 2FVPA 4FS1A 4M3YA 4KFBA 4TYAA 4J9QA 4RW7B 4LQ9A 3OYAA 3SNNA 4CFBA 4RW8A 4DTOA 4IR1A 2HMIB 2YNFB 3AVJA 4CF8A 3D0PA 2RN2A 1RTDA 3H5SA 3K2PA 3CIZA 1NK5A 2VG5A 3MEEA 4YNQA 3L2VA 3QEIA 3V9XA 4B9LA 4FJ5A 3HO1A 3UQSA 3DOKB 1XR7A 1VRUA 3DI6B 1RDAA 3MFIA 2Q3SA 2RDJA 4Y2AA 2AQ4A 4FJMA 1QS4A 5DGAA 5D3GB 2GBZA 2ASLA 3I0RA 5J2MA 2YKNB 3V1RA 1S0NA 1GOCA 5HROB 3FRZA 2B6AB 3GIKA 1CXQA 1WNSA 4YP3A 3P83D 1IKVA 1NOYA 4KBIA 4DQQA 1S1WA 2YKMA 5K14B 4ZPAA 4O3RA 2XHBA 4FM0A 1JLBA 2OPPA 4G3IA 4CK3A
chains in the Genus database with same CATH superfamily
2Y0BB 4ZVQB 3IRWP 2KHOA 3FZFA 4F04B 1WHVA 4QR2A 4J9KA 1RTDB 3PEHA 4UW2A 3C15A 4KHMA 4GVBB 2VG5B 1O6XA 3FZ2A 3L9ZA 3B82A 4L73A 1UFKA 1M5SA 1VQNS 2ALZA 3MDQA 3G8SA 1GH8A 1YJWN 4PQUA 3AO2A 3H1QA 4CZCA 5DLGA 1D0EA 2CJXB 1CJKA 4KB0A 1SV5B 3MFHA 2RJZA 2DVIA 1UFWA 4IFEA 2BM0A 4WTYA 4YR2A 1H3DA 1IKVB 1VK3A 2HIYA 4I6YA 2YKMB 3QAEA 3HMJG 1Z1ZA 3HLUA 1OSCA 4DR5K 4FF2A 2XBPA 1RT2A 1RCXB 4WQ4C 3C19A 3CUNA 2DNGA 3UVJB 4I9QA 3U02A 2CJQA 1K44A 6AT1B 1K8AO 2J0XA 5CYJA 4ZVHA 3GIJA 2E5GA 1NZ8A 1SAZA 5FROA 1JLGA 4BE1A 1WKJA 1IBLF 1CZBA 2V4QA 3PO4A 1H73A 3WT0A 1RWWB 2J6SA 1FXDA 4C1NK 2RPIA 4N8OA 2O8CA 5F9NA 2MQ8A 3H4BA 2UUCF 1EQYA 2CNNB 3D2EA 3PIOL 4RCHA 1EX4A 4IFYB 4FLUA 3WX8A 1FK9B 4NLWA 3ENAA 1GK8A 2QA4G 3Q89A 4CFDA 3Q7BA 5DDOC 4P2SA 4O44A 3NKYA 1RAHB 4HCCA 2FTRA 1X60A 1IKWA 2MPUA 2V63A 4JKGA 2BW7A 2KJWA 3HI0A 4H5VA 4K0KJ 4MIAA 4LC9B 3CJ0A 4CJQA 4A8SA 2PIIA 2FF3B 1GOAA 3VQ7A 2RAQA 3EDQB 2CH5A 1BL3A 1LWFB 2YQ0A 3POTA 4JS4A 2O8DB 4M3ZA 3ALYA 1S7IA 4DV1K 3G6XA 3H4DA 1IO2A 4ERDA 3ZSWA 4DQIA 5F8IA 3Q22A 4LBHA 1IJFB 2FHMA 1FNOA 3OTEA 1S1XA 3O3HA 3A8IA 3KDOA 1HNIB 4I7FA 1F1BB 2POKA 1G1XA 1GT8A 2IYIA 2NLWA 3AVGA 2WSCC 1NGCA 3K58A 3QMLA 4BC7A 2ZUAA 4FLVA 4MQ3A 1FXRA 1NH7A 3B78A 2BBEA 3PLAA 1JL1A 4CCHA 4IOAL 1WUUA 1VQ6N 4KHPK 1ZM9A 4CJUA 4FBUA 3LDOA 4CP5A 4O3NA 2BDPA 3LPUA 4DDFA 2R7VA 1D9DA 2VA3A 4O3QA 3JQMA 1U2RA 2HHHJ 3JAMO 5KFXA 4EU0A 4IEEA 2U1AA 4X64J 4P52A 1AFJA 2C1EB 2CYYA 2UUWA 4KGMA 4B1VA 3EDRB 4OPAA 1JJHA 4ZP8A 3GPAA 3QIDA 1N6QB 3UCZP 4P7VA 2ZEJA 3T5HA 2K8GA 3H5YA 5FRMA 4WP3A 3J8AA 4WF9L 4JI2K 1KAXA 5T7BA 2KB2A 5H1SQ 2JNJA 1S9FA 3LP2A 5FDLA 3NH1A 3OR2B 3DYAA 3TA1A 2UVVA 3KHYA 4IDKA 2D4WA 1QQCA 3D7SB 1SL1A 3CC4S 3MPVA 5BPLA 1YJTA 1FRJA 2EFPA 4ZP7A 1FXLA 4Y65A 3F44A 5GMEA 1Q9YA 2DO0A 3M8RA 3FKBA 5M1NA 4ISEA 3VAIA 4KJIA 3HULA 2VA2A 5AQHA 2AJ0A 2B8PA 1LWCB 4ZKAA 3NHGA 5LY3A 4PYDA 4D3HA 1RFQA 1FKAF 1FNMA 4A46A 2HAIA 4JI1K 1N5YA 3RB4A 1WSVA 2QA4S 2BE2B 3L2UA 3NCPA 1F3FA 4H5RA 4CLYA 3JTNA 5AQYA 4EBDA 2LDYA 1MU2B 1G3OA 4BVOA 1HNVB 3EPGA 5T7LB 1B64A 2VV5A 3I56N 2KHCA 4C23A 2FC8A 1EQ0A 2KLAA 4KGVB 3EX7B 3ILLA 4NEZA 1RT1A 3PJWA 2F3JA 2OPRB 3UKUA 1NGBA 3Q8RB 4RTFD 4DPOA 3IFEA 2HOEA 4IXCA 3SPZA 1EZZB 1J5EF 1S77D 3O8MA 3V6JA 3OYMA 3GWCA 3JXOA 3FR0A 1N8RT 4CIGA 2EFGA 1LOUA 5KG7A 2LU2A 3CJ3A 3ASMA 4U7UK 1P8ZA 4WFNL 2Z30B 3DLEA 3KFWX 3KJFB 4B8CA 1ILYA 3ZO7A 3WNGA 1LK5A 4R8UB 4ILJA 2DNYA 4KSEB 5D15A 2NYHA 4MDBA 5CYQB 4FWRA 3K89A 1M5KC 3OFHA 3UWTA 4TYBA 4LF2A 2I5JB 3DM2A 1KVBA 1FE4A 3CCZA 4DV6F 3MWTA 1GMVA 2MXYA 2WBNA 4NYNA 4R0EA 2ZH2A 5JVHQ 3D6MB 5BN9A 4OIXA 3H2LA 4EFAC 3BEXA 4LIRA 1H2UX 4HTLA 3MAQA 1VLYA 4OX9F 2HMIA 3OVSA 2ZH6A 2LLZA 4IR9A 4LF9J 4RNOA 4JLHA 5ADXH 3S41A 4ER8A 5L39A 2F8TA 1VLOA 3HFKA 4FPIA 3OL7A 2NR0A 4YOEA 2OPQA 3QGGA 3THWB 2XY8A 2D3O1 4DR7F 3N4QA 1Y64A 5CCMA 5DK5A 4FKYA 2QWRA 4UUWA 4NLQA 2YY3A 4QPXA 1YI2S 2ASMA 5D4PA 2OP5A 5DZ6A 4QYRA 3W5YA 2MZ1A 4XIUA 2N4DA 3AVHA 4PXEA 4DR3J 3BKTA 3VQQA 4DV5J 5L1KA 4JI0F 3GQCA 1I5OB 4DTUA 2IHR1 3IKMA 2MQMA 4IEIA 2AJFE 3EICA 5F3ZA 3PX6A 4GVBA 2HVEA 2X1AA 1CQNA 4HHJA 3SSSA 5E5NA 3MPUB 3L3UA 3M6XA 1HNWK 4DV3F 3FRYA 4CJPA 1S6PB 3TUIC 2XCPA 3HP9A 1S5ZA 3CG7A 4PABA 1U47A 4PXBA 1FDAA 2W7PA 4A8XA 2CH6A 4QCLA 1KLMA 4WBFA 1SV5A 1VRTA 1U1OA 4O3OA 2ZUGA 2G9OA 4P2MA 2XMJA 1RWVB 2CJBA 5KGXA 4MK8A 3Q0AA 2H9ZA 1K8KB 1XNQF 2HQ3A 5G4DA 4B3OB 3OYIA 4BS2A 1WWHA 4CZGA 1NGAA 2CXEA 3UVJA 1OY8A 1VSLA 3JSMB 4CVNE 5GMKa 2KDOA 3M8ZA 3PYDA 3I9ZA 1S3XA 3P5TL 1QE1B 1NM1A 1NDPA 1WD6A 2RU9A 1DEJA 3KK2B 1XIQA 1MN7A 1YJNN 2GHPA 3QATA 4ECVA 2VGMA 2J5AA 4HHHA 1XMOK 3RRHA 1QTMA 4CZMA 4K4ZA 1TL1B 4B9MA 2VQFK 2H65B 3KD1E 2DPJA 2XYHB 3R1HA 2RHSB 3OT9A 5LMUK 3FVYA 5KFGA 2UXDK 5HVHA 4EUVA 3U9ZA 4K25A 3DRPA 1SJQA 1UW9A 2WTUA 4NA3A 3NCQA 1TK8A 3B6PA 4AHCA 4KV8B 1HIYA 3C65A 4R5PB 3NXZA 3TAQA 4Q8EA 3A13A 2CGKA 3OUYB 2IS3A 1BHLA 2W2OP 3OSPA 4O5BA 1ASVA 3PR4A 2HVIA 2AMCB 1LW0A 2ZWPA 4KHWA 1LWFA 2Q0UA 3M8YA 1U0HB 3E51A 1YAGA 1VS3A 4P71A 3CCLN 1W26A 4USMA 3V1OA 2V6AA 3VF4A 2MLZA 3OS0A 1VCTA 3GYNA 1QQNA 5K8PA 2COLA 4JD2A 3EZUA 4TNOA 3O6WA 1NRKA 1HNIA 4URGA 1H7WA 1MDUB 1HWKA 4E7LA 4KRFA 4CBXA 1UFLA 4A61A 3BR8A 4M45A 1VQKS 1JMTA 4A4JA 4G1PA 3T3FA 2WHOA 1F2HA 4BRIA 3EJMA 2ZDPA 1AZSB 3MXMA 1HX1A 3BZCA 1DT9A 3GG4A 3H0PA 4CLSA 2XSFA 4QIGA 3D1OA 1RWPB 5KFLA 3CJ2A 3PCOB 1SH3A 4IQXA 4DV4J 4X66K 4CHOA 3Q8VA 1WKLA 5KG3A 4L3NA 3ZX0A 4EAHD 1NKEA 4ECZA 3T7ZA 5J2NB 2CJ9A 3TZYA 1J6ZA 4JUZA 4MK9A 1NHUA 1TELA 1S0MA 3S3NA 4NLDA 3M9MB 4B9TA 1KAZA 1U02A 2CZ9A 4DV7F 3OA9A 2UZAA 5L1IA 3O3FA 1BWFO 2X74A 3QIPB 2P9KB 4MKBA 4EZ9A 2VQEK 1R8BA 1HWLA 3OR2A 3O9SA 3CDUA 2QTWA 4CI6A 4U7UD 2VG6B 5DGBA 2ACMA 1LFWA 5K9FA 1HA1A 3OPKA 4WFBQ 2J4RA 2G1HA 4K4YA 1NLVA 2CPHA 3VV2B 4UOHA 2Z1GA 3QNNA 1T9TA 1LWCA 1HWUA 2NRHA 1QTNB 4HCBA 4YOTA 2DNMA 2EI5A 3G87A 4ELVA 2QWPA 1QM9A 2WOMB 4Q45A 4PY5A 3FK4A 1FEEA 1RT7A 2GJIA 1MU2A 1CJVB 1YLXA 3GG1A 3C14B 2V8HA 2D0OA 1HNVA 1TP7A 3HL8A 2DPIA 2FUG9 3HHEA 4YDDB 4P6QA 1N36K 4QQBA 3TAEA 4P74A 3QNWB 3MN5A 4BHQA 4IWVA 1PBUA 2VFTA 2LSNA 1VMBA 5HN0A 3N4WA 1DZ5A 3KG0A 3OTOK 4O0NA 1Y3JA 4QWCA 2BJ9A 2LEBA 2G8FA 4JYAF 4OX7A 3OFGA 1BQNB 4RU2A 1ATSA 3LO3A 1M1KO 3IG1B 2ZHAA 4YFUA 4QWDA 1LQ9A 3FZBA 1PCAA 1VBXA 4TVAB 1H98A 4C0BA 4R8UA 4C48A 3BY5A 3LZIA 3AODA 2G8WA 5EU7A 2P9IB 5CYQA 3KWMA 2NXNA 3H2VE 3UDEA 1NEEA 1KOOA 2VG7A 3KWGA 4DTPA 2FSNA 1QAYA 4UZCA 1IXKA 3EUNA 3QZ7A 3HT3A 3AA4A 4FK0A 2A5XA 3VAGA 4A8FA 3GBTA 4CJ5A 2GZOA 1WEXA 3OLAA 1C4CA 2LMIA 3MUTP 3Q8YA 3K8WA 2HF4A 1K1QA 4B9NA 4K5SA 2V2KA 4B1XB 1E4GT 2CQGA 4H4KA 2HLTA 4O0JA 1OH7A 2OA8A 1H1VA 4DFPA 2V2QA 2VU5A 2VWKA 4X65J 2NRZA 4QW9A 4ES1A 1HWIA 4JKBA 1WC1A 3W3DA 5AQUA 1T9UA 4IRCA 1UVJA 3HZ6A 1IR0A 5BR8J 2PDAA 5JVHL 3THWA 1QVFR 3SQ2A 5BYSA 4UY85 2HEKA 4K50A 1KVJA 3V9UA 4K7QA 2HNDA 2KVIA 3SQ0A 3DN9A 2BJDA 1QVGR 1K0TA 3GJSB 5AE1A 4DPXA 1QAIA 1V4TA 2I38A 3C16A 4ZCLA 5ETQA 2Q1NA 3CPEA 1MW7A 5L9XA 4H0VB 1Q8BA 2RD5C 3L6QA 2MLYA 4JKHA 1UEVA 1BOTO 3O3LA 2UXCK 4DX8H 3OJUA 2MZQA 3TO8A 5FRNA 3BV8A 2OSQA 1HL6A 2FZCB 3TUPA 3I55S 4TSXA 4MFBA 2V52B 2ZF5O 2DNNA 2AT1B 3K8VA 5KFNA 3PJXA 5F0XA 4B1UB 3MPWA 3HSTB 2EBEA 3NGKA 4ZPTR 1RILA 2NSBA 4KI4A 1EWRA 1S57A 2OUGA 1WC0A 1UJ5A 1NJZA 4NYOA 3CC7S 4LD0A 1KKHA 5IQQA 4F7VA 2DD8S 1MA9B 1P27B 2BJ1A 3RSEA 2RNEA 4LF4J 3WDOA 2DHXA 1I94J 1KD1T 1N34K 3K5MA 1WSFA 1CEZA 3NS5A 4WK3A 1WSHA 3CJRA 2ALYB 1YK9A 4ZCKA 2H5JB 1IBMJ 3SLCA 1EWQA 2KJVA 2QL7B 3AQOA 1WF0A 3CJKB 3W64A 4P73A 3JSMA 2IIHA 4OJRA 2OFHX 3VQ5A 3R5GA 4ED6A 2CVIA 1C2PA 3CO9A 1QE1A 1LWEB 1HYZA 2CIMA 1B0PA 4ZA1A 3CO0P 3KK2A 3K9JA 2NRRA 4EFHA 2D1KA 2A0FB 2FJDB 4ILLA 2AEJA 3RVCA 3R7NB 3MM5A 4BC3A 3WEEB 3BYPA 1C1CA 4J9VA 3VTHA 2FPHX 3BKFA 4BRKA 1VQLS 2GMHA 4OYBA 3CCMN 3KLFB 4K0KK 1TL1A 4FJLA 4CJWA 3CEDA 3OTBA 1XHZA 3C7NA 1XTZA 4ZPCA 2B9XA 1IUJA 1D5AA 2ZJPQ 3QBCA 5EVZA 4I9LA 2L9WA 1WDDA 3H25A 4RL1A 1RDRA 4LR8A 2EW9A 3IS9B 4V19X 1RDUA 4IO8A 4CJVA 2MY8A 1L3VA 3KVGA 4G65A 4WQ4A 2MLXA 2DGOA 2YQ3A 1K8AT 2ZNZA 4RG8A 4JK8A 2RDIA 2DGWA 2XS7A 2O8BB 3QZ8A 4DR4J 3K17A 1ATRA 2HFZA 1Z6RA 4OZ2A 4JI7K 3AVBA 4E8UA 3Q83A 2D0PA 1U0HA 1LOTB 2WSEC 3L09A 2JWNA 3NF7A 3IWXA 3SMPA 3LALA 2W9CB 2C2RA 2DGQA 3OJSA 3A4TA 3GR0A 4YOWA 2Q36A 2KG0A 2OELA 3I96A 2HNYA 2Y3YA 2DRDA 4GKJJ 1HMVA 3PKMA 4YMEA 4FF1A 2EK6A 3OYEA 2UUBF 2E44A 2VWBA 1P1LA 3L3VA 1NHKL 5C5JA 4AFFA 1GLFO 1RWOB 1AZSA 4X64K 1ZBHA 5C2GA 1AXQA 2EXUA 2B4OA 4NZ7A 2N3OA 4NLCA 3ISZA 5FJ4A 4LSNA 1YTYA 5A2QU 5D77A 5KQDA 3QFUA 2EC0A 3MAAB 4M5IA 1HYSB 2OPSB 1N5QA 4F02A 4RW6B 2P1JA 4QS7A 2DNRA 4E1NA 2DNKA 1EP4B 7FD1A 3RGIA 2MKJA 1U1PA 2CQ3A 3ILIA 2ZH7A 2VICA 3E8OA 3PG9A 4OHZA 4W5RA 4ZVPB 1S59A 2BQRA 5IZHA 1YXQA 4OJHA 3FZLA 4W98A 2EX3A 2HWIA 4XK8C 3EPIA 3RMDA 3NCIA 4C3LA 2UV8A 1V3RA 4H4MB 4EEYA 4Y00A 1XMOF 2VUGA 3QGPA 3QIPA 4W4MA 1VQ4S 2P9KA 1SIZA 1NDCA 3SI6A 3P1GA 4BE2A 3CCQN 1BQMB 5ETRA 2Z1HA 2UXDF 1TU0B 2VG6A 2GMJA 1M1GA 3IR6B 2KXHA 1KS2A 3BN7A 4CJFA 2MQQA 3U6FA 7AT1B 2XSJB 4F0HA 5HI7A 4NMLA 2ASDA 3I0SA 1S72N 2PSZA 2RRBA 4JB8B 1OVYA 3HPOA 3NG8A 5KFHA 2DY1A 5IOLA 5FLXY 3MEKA 2R7RA 1FRKA 5K20B 2OFGX 4DU3A 1IBLJ 5EWEA 4IBNA 1CJVA 3C14A 3NBPB 3V6DB 5K5MA 1H0HB 3QFPA 4FYDA 3OXLA 4LIWA 1RDWX 4NO7A 2FLLA 1TZ0A 2UUCJ 2R8GA 4ICLB 4L6V3 5DQGA 2ROGA 2EK1A 2VCPA 2ZNYA 3BSCA 1X4FA 3X1LB 3SCKE 2OZMA 4LT6A 3VA0A 1T11A 3JS9A 4BACA 1T0TV 1GLBG 1BCMA 1M5PC 3R5CA 5H9FJ 4RBVA 3RB3A 4CK1A 1NNEA 5FPMA 3IG1A 3TOQA 1A5WA 3VQ4A 4NCAA 4C8LA 2DBBA 2VYPA 3C6UB 1D9AA 2LFVA 1WHXA 3EGVA 3THVA 1IJEB 2NLXA 3CJ5A 4KTZA 5DDQC 3VQDA 4DN9A 5E41A 1X7VA 1KVCA 1HD1A 2P9IA 3DXMB 4WXWA 4FL9A 3KHLA 2MZJA 1N56A 4JOUA 3UW1A 3D6TB 5L38A 4LF9K 4PG8A 2D7SA 1K47A 1R6VA 3EVWA 3WX4A 2AHOB 3OYBA 5JLFA 2NZ4A 1NGEA 3SZ2A 3NE6A 3PNIA 2BANA 1KQSM 1UEUA 1NK4A 4Y0WA 2UUAF 4HTJA 4OFZA 2CG4A 1VIXA 2QWLA 4I2QB 4L3KA 4BRDA 2F1FA 2OD4A 4C11B 2ATQA 4AHRA 3HZEA 4OJ1A 3HZGA 5KPZA 1K73O 3UB5A 5HOOA 4FOEA 1BA0A 2PMHA 3W2WA 3HHLC 3HSZA 4Z4HA 1UA0A 3Q86A 1TV6B 2DH7A 2V2VA 3FDSA 2A6OA 4Q8FA 2XS2A 5AJ3F 4E3SA 4CWBA 3EE8A 1T05A 4JI4F 2VONA 1VOMA 3MURP 2E9ZA 3NVKA 3MTKA 3AT1B 2BV3A 4KTWA 4B9SA 4DSKA 4I1TA 2I7PA 1IWGA 4IYQA 3M9NB 4K8ZA 2ZITA 3TZXA 5HRPA 1KHWA 4DL0C 2JZ5A 4CO3A 1FT8A 2OAUA 5CZ2A 4OLPA 2Y0SD 5A0YB 1R59O 3PSFA 4LFBF 1WEYA 3OTOF 1CQMA 4QYZJ 1QY7A 2QIFA 4OYWA 1U2VA 4OPJA 1RHRB 4M5NA 2ERRA 2ZHOA 2GS8A 2BTFA 3PIPQ 4K4WA 4NLSA 5IFMA 4NRUA 3ZX3A 5JMVA 4CJ4A 4NZ6A 3M8QA 5BYQA 2R2RA 4X4UA 5CY4A 3DLBA 5I4MA 2EFVA 4I69A 1ASWA 2IJFA 1JQGA 1KQFB 2KO1A 3TAPA 4AM6A 3MECB 4X4PA 1HWJA 4USTA 4E7JA 1Z26A 3ZZZA 3CJKA 2PGCA 2R7QA 2I8EA 5GAGP 2HIQA 2PEBA 2XLKA 1UEKA 2PC6A 3S8SA 4USIA 1S6UA 1VHIA 3ATVA 1URRA 5AT1B 3UNYA 3NNCA 3DHWC 2F5GA 2ZJQQ 2NRWA 2YNFA 2AEMA 3BP8A 4DR2F 4G1QB 4NLBA 2QSWA 2RT3A 1G4CA 4FWNA 2GIFA 3HFVA 3D1QA 4USWA 3ZTPA 3QLHB 1Q53A 2CNLB 4BRAA 4F67A 1A6LA 3DOKA 3ADAC 1BE4A 1WUAA 4G6VB 2XZWA 3TVKA 2WVBA 2QG9B 1CBKA 4FYYB 3DWLA 3VF0B 1QHAA 3QBWA 1NGFA 2ZBIA 1HYVA 5D3GA 3IS9A 4RUCA 1LV5A 4NA1A 3Q8PB 1EETB 5AXKA 4ZVSB 2FGCA 1X5SA 3VGUA 2W7OA 1X4AA 1BLUA 2JSXA 2WW8A 5JMNA 4JI6J 2O8BA 2B9YA 5DRKA 4J9QA 4RW7B 1Q5YA 1XMQK 5B7WA 1YHQN 2HURA 3FEZA 4DTOA 1OQ6A 1DGKN 3O1BA 2VOPA 3AVJA 4KT0C 1F6TA 1KWMA 5IV4A 4AXJA 1UVLA 2VODA 4B9LA 2QMUB 3UQSA 3DI6B 1H2VZ 3MFIA 4FP9A 2GMLA 1Q81O 5E3PA 2RDJA 2Q3SA 4Y2AA 2AQ4A 5GAGU 3GG0A 1P90A 1U6BA 5KAKA 2ASLA 3CE8A 1VHFA 3V1RA 2QFIA 1CC7A 2C2MB 4ITSA 5AQZA 3GIKA 1CXQA 1O13A 4DHYA 4KBIA 4DMZA 1OJ4A 4O3RA 4FM0A 3KG4A 3IM9A 4BQZA 4H5TA 4K41A 3AGRA 1WACA 1HYSA 2JLEA 2OPSA 2DCLA 2R2SA 5HVGA 5CD4A 3DKDA 4F3OA 2VZ9A 2DNZA 4M63A 5AXMA 1X4BA 4KE5A 2CG8A 3MD1A 4A5AA 2JOQA 2R7TA 1I6JA 1GMUA 4LJMA 4JI0J 3ZSVA 1TL3A 2NSCA 4QIEA 3LM9A 3CCWA 2F9WA 1LAWA 1S4EA 1ZPWX 1ZM2A 5IWAF 4DUTA 3F73A 2B7CB 5J2MB 5CHIA 2ROEA 3ZSYA 4J8FA 4I64A 1VQON 3CMQA 4DV3J 2BGGA 4H4MA 4RX6A 3TSUA 3V2UC 5L9NA 1C4AA 1BQMA 2NRTA 2UV8G 3H98A 5BPNA 4AL5A 5KFFA 1B0VA 3K2YA 4JV5F 4NCGA 4C8YA 1SI9A 2ZE2B 3W66A 1XNQJ 2XY6A 3VGVA 3EL2A 1L5UA 3T1AA 1AA1B 2XSJA 5DLFA 2J76E 4XDDA 4U96A 1FX4A 5EX0A 2QZ8A 2YHXA 2LQJA 3HT0A 3RG6A 4J9UE 5C25B 2WVFA 5M1PA 5ITHA 2GJ2A 4CGHA 3ZTQA 4RW4B 1T9YA 5HLFB 2DNQA 3BGLA 4ED3A 4S0MA 4A2AA 1KLNA 1V6HA 2M2BA 3PW5A 3NBPA 3V6DA 3PUFA 4J9NA 3GIIA 4O4GB 4FCYA 3T5JA 8ATCB 2ZZTA 4ICLA 4DN0A 1UETA 1V3ZA 3Q24A 3SAHA 4CW7B 1S9EB 4PWWA 2QL9B 3E9OA 2E2QA 1Z2ZA 1WB9A 4RWXA 3TQEA 2HHHF 3H5XA 3PW7A 4OI6A 2D9OA 4GVLA 1APSA 3AH6A 4GV6A 3TABA 2XWXA 1X9WA 4ED5A 2C3PA 3ZZRA 2FVQA 4Q0BA 3IAYA 1OO0B 1MWQA 1AROP 1AW0A 3C6HA 2GX9A 5AXNA 3C6UA 2Q1LA 5SUHA 4DPUA 3CQ8A 3TAFA 2GVDB 3FBEA 2F65A 2OTLN 3DXMA 4JP8A 3J81Y 2CPFA 3KLVA 1VQMS 4RNFA 3T1YF 4ES3A 2OO4A 4N7TA 3VQEA 1TAQA 3JYTB 4NZ0A 3VQ8A 2XNRA 4CLTA 3OFEA 3CB4A 4TQSA 1QAJA 3LOUA 1REVB 2RS2A 4PA1A 3QEXA 3G0ZA 4IFVB 5EX3A 2PA8D 4FJIA 1PGZA 1VQ9S 2JJ4D 3H08A 5KFWA 1J54A 2LEPA 5HQLA 4FF4A 3THPA 1M1KT 3J7Z5 3PYGA 3BQ2A 1ZC6A 3DMJB 3HHNB 2BM1A 1BIZA 3RMBA 4YB7A 4I2QA 3KK1B 2RE1A 2IVYA 4B3RJ 4QPTA 4OLOA 5J2QB 2AYGA 3NL0A 1OY6A 3H42A 4CTAB 2Q79A 4O5FA 3WHIA 2HVZA 3I4PA 3UDCA 3TZWA 2VIHA 1T7PA 3QYYA 4H03B 2YHBA 2DY9A 4L72B 4EP5A 1TV6A 5LJWA 2XWYA 4OZNA 2PYLA 1RKIA 2CGLA 3CCUN 1S76D 5CXTA 2HNZB 3UN3A 5GAEP 1ZBUA 1F9HA 2YHYA 3CCEN 3ISNC 1HNZF 2BACA 3AVIA 3D0GE 4ZLPA 1T9VA 4EHTA 3JB9k 1PAUB 4B3SJ 3AFGA 2O8EA 3RBDA 4ISGA 1DAXA 1J27A 5K8MA 1FRIA 4ZN1A 2IM1A 1WN7A 4DV7J 4LFAJ 4TU8A 2XS5A 2W6LA 2CQHA 4DI6A 1Q18A 1S1VB 5KFRA 5A8KB 2QXLA 2W40A 1Q7YO 3M32B 4H5WA 1U24A 1X4HA 1SQGA 4ALZA 5IT9Y 5A0YA 4CHZA 5BRDA 2ZM6F 4NEYA 1VJWA 3VQPA 2GA7A 1I94K 1FJEB 3F41A 3DOLB 4BC5A 4BDYA 1UMJA 2FJAB 4FJHA 1IBMK 5HMWA 4RKUC 1MLAA 1GAOA 4M5JA 4F2SA 3FQLA 1U25A 2DGSA 4TU9A 3SYZA 3U1LA 1N88A 3I4HX 4FZXC 3HHLB 3G96A 4IKAA 5ETNA 2HFOA 2L9DA 1RT6A 2UUTA 3ATUA 3D45A 3LP1A 2R7UA 1ZBFA 2X6NA 1U1NA 2CQBA 3CJAA 5J1PA 3N6LA 2AZ1A 4BC2A 1Y5IB 3H90A 2HHWA 4LH5A 2G0IA 1SC4B 4OKEA 3MECA 3PEJA 5BPMA 3M6VA 5B0DA 1TYQB 2YKPA 3NNAA 2HBJA 1H7XA 2HAFA 4CYUB 3M5RA 3PIPL 3L4BC 3S7RA 5BRFA 4LF9F 2VPZB 4ETXA 4ANEA 3VAFA 2RF2B 4NI2B 2FHJA 2JC0A 4A8KA 1WHWA 4OV6A 1PIEA 4AQYJ 4G1QA 1GNKA 3CJ7A 4JYAJ 5KGWA 4OI3A 3PV8A 5A8WA 3OVBA 2BR0A 1PC5A 1YVUA 4DR4K 1JXBA 1VSEA 5BR9A 1FD8A 1RBRA 2DH9A 3M8SA 3CSKA 5JLHA 3KIOA 2ILZA 3IUCA 3DGPB 1U6ZA 1RT3B 2YKOA 3O80A 3O4WA 2KN4A 3ETOA 2MGZA 4DR3F 3DLLQ 1FFSB 5AXLA 1YJWS 4DV5F 3HOTA 3NVMA 3R2DJ 5GMDA 3PACA 4CF2A 1EETA 4Y1CA 1ZH5A 2YNIB 2CQIA 3UE5A 2DEJA 2QXFA 3RBXA 5KT3A 4RU9A 3Q7CA 4DX5A 1Q0NA 4OI2A 1BQXA 2HZAA 4BRFA 2RHQB 3NGDA 4DU7A 4YY3J 4RW7A 3CMAN 5M2UA 4F3TA 3LZJA 1WG1A 2IGIA 5KG4A 4Q43A 1DLOB 4QAGA 2HG4A 2HRUA 2UU9K 3OLBA 2P51A 3FLCO 2G8VA 3SI8A 4ID5A 2FHOB 4LVNP 2HHTA 2ZBQA 4JHDB 3RRGA 1CJTB 3HVRA 1CJUB 3GV7B 5HSPA 2F8EX 5KFPA 5KFJA 3ITHA 2LXUA 1NZAA 2YPYA 2RUSA 3TUZC 3MMVA 2NUBA 4DR1J 4C8KA 4ZOSA 4KH4A 2IC3B 4NXMJ 4J91A 3D4JA 4IOCQ 1X8DA 5J2PB 2J9DE 5KT4A 3Q2SC 4U8YA 4FZYA 1QSYA 4ECSA 2K1RB 2BH1A 1YJRA 4K4XA 2ZH5A 4YN3B 3KUGA 4E19A 4OO1J 1OY9A 3VEOA 1V4SA 4CJKA 1XUPO 3H6EA 3OVNA 1FJGJ 4QJVA 2DR8A 3H20A 4ED7A 4FK2A 2D41A 2AW0A 3WC2A 1QJHA 1Q82O 4CM2A 4M5LA 2QWOA 1LKZA 5B0BA 3RBZA 2XGPA 3J7YP 4LQ3A 1WOSA 1HJOA 1RGIA 1PKUA 3P31A 2A1SA 1MN9A 1XN9A 1W7AA 1TK5A 5I42B 1JLCB 4X4VA 2V0NA 1NBWA 4XEIA 4NX9A 2IMWP 3W63A 2KU7A 3F5TA 2QGFB 1VSHA 1C0TB 1BISA 4KHUA 1OPIA 1Q8LA 5IM0B 3C94A 3EGZA 3CD5A 2DRAA 3WNFA 1R31A 4FW2A 5GIOA 2BABA 2CQDA 3GJQB 5KFYA 3BYRA 1VIOA 4CNZA 2JC1A 4TQRA 1TFWA 1IBLK 3ILJA 4Y28C 2XY7A 3D0IE 3MCNA 3MN6A 3KLGB 2ZE2A 2IY5B 4FYVB 1BHNA 2W9BB 5KT7A 5LSOA 2GC8A 3VERA 3WQTA 2PFFB 2LXIA 2UUCK 3FUYA 2F9DA 3OFFA 4WWSA 5CH7B 3W2VB 5JUMA 1VQ6S 3QSIA 2IMOA 2MSTA 4PKHA 3BF3A 2V4JB 3PFEA 5H9FK 5HLFA 5EWFA 4GY2B 4HACB 3CJ4A 4NRTA 2RE2A 2DXFA 3TP2A 5F3TA 4C3KA 1SUQB 3AO3A 4AILC 4ZVEA 4O4GA 2VOOA 2VGNA 3KLEB 4KGXB 1RBTA 3H1VX 3J7YU 4UUXA 2R3VA 5DG8A 5B09A 4DV4F 4O0IA 3M9OB 2MZTA 3DNCA 1S9EA 5D4LA 4FLWA 2BQUA 4CF9A 3FNNA 1VQ7S 3AARA 1RK8A 4FPRA 5D0RA 1E6VB 1YJ7A 4CZIA 4O4RA 3EKSA 2RKIA 3PX4A 2R8KA 1SKSA 2IVMA 3OYGA 2H3EB 2ASYA 2DXDA 4NYZA 3H59A 1MWZA 2FD2A 1WBDA 4CECA 5IT4A 1BXNA 4A59A 3SV3A 4K8XA 2NXUA 4CGFA 5M1KA 1WOPA 4ZPWR 5DQIA 4FWKA 3TVZA 1R0CB 1R8CA 3C95A 3MCAB 3C6TB 3JYTA 6FDRA 2W2MP 5H1SV 3BF1A 2IVFB 4HWIA 4J9MA 1TFYA 2XI2A 1IWAA 4HR2A 2JL9A 2A1BA 4DXLA 2YX6A 4J2BA 5THWA 4DUYF 2MKCA 4PG5A 2A10A 1Q4RA 3T6BA 2DNPA 2HLUA 1TMMA 3IXQA 2YHWA 1YITN 4NL5A 4EWTA 4MAKA 2UUBJ 3PIOQ 3OD2A 2CJAA 3RJMB 3U1NA 4DV0J 3GL1A 3QESA 2OCEA 3DMJA 3I56S 3ENVA 3QFWA 3DDIA 1YBAA 4PEOA 5G0RB 3KK1A 2RSQA 3SJJA 3MN7A 2HBZB 4EI2A 3CPWM 3BQ1A 3DFEA 5HMZA 2W25A 2CRLA 2Q0RA 2QYGA 4CTAA 1SVDA 3P38A 4CBWA 4M8LA 4OI1A 3AD8C 1U8SA 3TTDA 3RW7A 3J80Y 4WZMA 4DFKA 4E7IA 1YJUA 2VFUA 3NGRA 3DLHA 3CQYA 1T9WA 3MR2A 3CVKA 4CO0A 4QYZK 3SQ1A 3GU0A 3CERA 4PUOB 4BG8A 1C1BB 1BUPA 3AO1A 4WCEQ 1ZTTA 3PW4A 3DRSB 3TYTA 4RUHA 3A8YA 1L3UA 3VA3A 2ADBA 1HNXJ 3R1XA 3PO5A 1S1VA 1FRMA 2LYVA 3UN2A 3ZZ0A 1ITPA 3M32A 4Z7CA 3C46A 2E2OA 4C3MA 2C28A 3FSXA 1FVQA 4QS8A 1MMNA 3BSNA 3DOLA 1K73T 4DOZA 1FHTA 3U9DA 3KLHB 3G2XA 4IOAQ 1RTJB 2KW4A 2XO7A 1VQPN 1JCEA 1B7YB 2HF3A 1GLCG 1YKWA 1TL7B 3VZIA 3ZZPA 1VC0A 3KOAA 3SCXA 4EHUA 3HHLA 4HYKA 3ZC4A 4R79A 3AOAA 2QKBA 2UVRA 2OD6A 5AQPA 5AZIB 1YG0A 2V69A 3EVMA 5I3UB 2MTLA 4RWWA 2NPFA 1IKYB 3UFCX 2R7WA 3V9SA 4MH8A 5E2QA 1W97L 3MCMA 4DHVA 1TYQA 1FWPA 1YVFA 1FO1A 2E9TA 4JI5F 2Y1LB 3MM8B 2XO6A 3VEYA 1S79A 1XBWA 2DCUB 3NCRA 2GIQA 4E1MA 1RTHB 4P10A 4X65F 3DAWA 1F60B 2IVOA 5K8OA 3DU5A 3QJJA 5A2QO 1QSSA 4CEDA 4CT8A 4CJLA 5BR8F 1FFGB 2DO4A 3TQ1A 5FPNA 4RNMA 3OXGA 5K8NA 4IQMA 4RNHA 4CGJA 4JI6K 2R7SA 2W2QP 2HB5A 4IH5A 4M3UA 4DV6K 3D3CJ 1DY3A 3SUNA 2E88A 4CJ7A 3DJCA 4DF4A 1MMDA 2G13A 3AJDA 2J7UA 4RO0A 2E5HA 4LRBA 3QJLA 2ZGZA 1RT5B 1GMWA 1FESA 4FS2A 4JK7A 3VOVA 1YTUA 4CIOA 2BZ2A 1VQYA 3T69A 2FLOA 3KNAA 3MMBB 1FJCA 1NGGA 2PO4A 1RWXB 3TTFA 4YOYA 4YORA 1R89A 3ZZOA 4PWDB 3DRXA 1S9GB 4CEBA 4DR7K 3FBFA 3DLLL 1GXLA 3LA0A 4Q5VA 1H38A 2JEGA 4B3TJ 4JHDA 4LRAA 1U1RA 4ZLJA 3P45B 3HJVA 3NOCA 1CJUA 3O9RA 4MK7A 4LF4F 2WC9A 3I32A 3US5A 1I94F 1S48A 2PFDA 4F0MA 3M1VA 3FZKA 4KHYA 3MN9A 1IBMF 3CJTA 4PPDA 5ETLA 1YJNS 2UVWA 4X4NA 1XC3A 2IC3A 4JI0K 1BWEA 4X62J 4UZBA 3LWLA 4FZZA 1Y5NB 5AJ3J 4EBCA 2B51A 3MEDB 1HHQA 1HBUA 4U7BA 3TRGA 4CEFA 4JI4J 1RDDA 3THXA 4DV3K 2K2PA 1F5AA 5DDPC 1JLEB 2KYZA 4KGZB 3DOMA 5A8RA 2L3MA 5HL7L 3M4XA 2XZDB 1VBZA 5KG2A 1NU4A 3OBIA 2BXJA 2CKWA 4FNHA 3QPIA 1Q81T 1YBTA 4NPOA 5ADXA 1FDBA 2GFFA 3J7ZO 1R8HA 3U3YA 3S01A 5I42A 4LFBJ 5B0AA 1VK0A 5CYMB 2AV5A 1XNQK 3G82B 3CCLS 3MAHA 3LDLA 4K2XA 3KZBA 4IH6A 1C0TA 4K2JA 4ID8A 3P6YC 1TL4A 3CDWA 3MM6B 4C6AA 2DH8A 1NGDA 4KPCA 1B4SA 5KRSA 2CA9A 1S0OA 2Z57B 3ZEUB 2DHSA 3L95X 3GB0A 5AQRA 1TUGB 4URQU 4XAKA 1NM2A 3L2RA 3QERA 2W9BA 1O0PA 3SBGA 4YHHJ 4K42A 2WB4A 3GSIA 3ENBA 3W2VA 2VFSA 3EN9A 2YWKA 2IVPA 2HK3A 2BJ7A 1IQZA 4GKJF 2V4JA 4KC5A 4GO7X 1EARA 2GHVC 4FWPA 1GX6A 3MR3A 4U67L 1NBEB 1RWMB 3U4LA 3M30A 3V4IB 2YNGB 5ETMA 1JL2A 1N5TA 5HRSA 4JI3F 1WAFA 1F5CA 1M5HA 4MO5A 3OV7A 5ETPA 1X0FA 2P9UB 2JLGA 2C3MA 2HWHA 4YDUC 3JAMU 1LXNA 3M2VB 4CEOA 3MD3A 5FLXU 3SMZA 3AJ2A 4NXNJ 3UDLA 4YUDA 3OYFA 1YF5L 3RYLA 3KKSA 2ZZMA 3UO0A 1IN0A 4MYTA 3NS7B 1B70B 2ZKUA 4FKXA 2FZKB 5JXSA 3WXMB 3VCDA 3MEEB 1H6KX 3RWUA 2DFEA 1TVRA 2FHKA 1WG5A 2YXLA 1DRZA 3WQPA 4XDCA 1VQ8N 2RVJA 3NAEA 2MKSA 4IDHA 3C6TA 2L48A 3ULEA 4GVMA 3GE9A 3HCXA 3I0RB 1ZAXA 4DBQA 3CJ8A 2BQ3A 4ANCA 1S4FA 4ZVRB 3ID8A 2YX7A 2UVUA 2RRAA 1S1WB 1DJ0A 9RUBA 1X4DA 3MX2A 2UXBJ 2JFDA 3EXCX 1NSAA 3R2CJ 2QM1A 1SKUB 1RHKB 2BVZA 3PZPA 3L4QA 1SQFA 2LDIA 4Z7YA 5G0RA 2R8HA 2B3TB 4ZTJA 4ZPBA 3OL6A 4OLBA 4ATNA 3TWHA 3OYJA 2QA2A 3ZTSA 4B3SK 2MQOA 4OYAA 3O9UA 2NPIA 1J5OB 2BUNA 2BE9B 2M8DB 4CF0A 1SQKA 1ICEB 1C1AA 4DV7K 3NEKA 1VQ5N 4GVEA 4WFAQ 2OIHA 3G9CA 2WK4A 4D3GA 1YUWA 1HQEA 3C66A 4ED1A 3O5BA 4DG1A 3EEQA 1IR1A 3OW2R 4FM2A 4M5HA 4P75A 3NGYA 3VWSA 4PUOA 5IWAJ 3DLKA 1C1BA 4OV1A 1NOZA 4C8MA 3D2WA 2C2EA 4C0OC 4DR6F 3VR1A 3HHKA 1X5PA 4AHUA 3KHGA 1NB7A 4FDFA 5RUBA 1HBMB 4Z4IA 1OQ3A 5GAEI 2M7SA 4RBUA 3GDQA 1U49A 4MLEA 3CCRN 1DURA 3DC2A 4JN4A 1N5VA 4OYPA 1P9QC 3L7PA 2P9GA 2W1BA 2I1RA 2DNLA 4DFJA 3PTWA 2IRUA 2AJQA 1BA1A 3IBFB 4C1NI 4DCHA 3AHPA 3B4MA 3OL9A 3AA2A 4RW9B 4IH7A 5AQMA 4JV5J 3ZSOA 3KLHA 4WCEL 1RTJA 1TR0A 2GAHC 4H0YB 3SAGA 3AY0A 2MKYA 1TL7A 1PAEX 1HBOB 5E0OA 3OS1A 1JXVA 4N5SA 2LVWA 4BC9A 1QZ5A 2YWHA 4B1WB 2F8SA 2ZBRA 4PKIA 2OSRA 4AQYK 5AZIA 2MDAA 1D4XA 3CGIA 1IKYA 3R97A 4IO9Q 1U45A 2DR9A 4A5BA 3AY9A 4JYAK 2GIRA 3PFOA 1UVNA 4E7KA 3VAMA 3TWZA 1ZYQA 3AOCA 2XC9A 2QT7A 1Q7YT 4J9RA 3MM8A 3M2RB 4E7HA 3VHQA 3KKFA 3P96A 3R3TA 3HVTB 1SIWB 1GLAG 2X1BA 5F8GA 3WNHA 2ZHBA 3FBCA 1JIHA 3EO3A 2P9CA 1WEZA 3O2IA 2NYIA 3GLJA 4DF8A 3M3ZA 1MWMA 1OH8A 4AE5A 2YNHA 3EMTA 4Y0FA 2KL8A 4E98A 3MR5A 4ILMA 1FD2A 4DUZF 2J0SD 4YY3K 3KJVA 3KUEA 3M7VA 2FBXA 3K5OA 3GFZA 1T03B 4W92B 3MM9B 1RT5A 2BE7D 3X3UA 4BLGA 3A5NC 3ZSZA 3OHAA 2E1MC 2Q43A 3EY1A 3T1YJ 4L75A 3KK3B 2Q31A 3TANA 4CGDA 1SJRA 4Z94A 2BJEA 4X4QA 3MMBA 3OHRA 3I8DA 2WBMA 4HTIA 5C24B 3W62A 3MTJA 3V81B 3HVAA 2RQMA 4FJGA 2VDHA 1RWUA 1O8BA 2D0BA 4B8AB 4PWDA 3JTPA 2V9KA 1S9GA 3IO1A 1OH6A 4CJEA 2HRYA 4FM1A 1FXXA 5LJ3Y 4M95A 1FRLA 3GYGA 4JV0A 1NMEB 2BEFA 1W0HA 2BA9A 1X9SA 1FJGK 2LCWA 1FKPB 1KC8O 1FKOB 2G1DA 1RYRA 5KT5A 4K8RA 1KVKA 4J5OA 4DV1J 3MWBA 3VQSA 2DIUA 3CCMS 1M5VC 1RP5A 3F2KA 1VSFA 2R2TA 2DPNA 4M5MA 3KKRA 3LAKA 2FQQB 2OJ3A 1RAFB 3MEDA 3TR8A 2AP1A 1UCNA 1ZAVA 3LP0B 1HNZJ 2RQCA 1IKXB 3FFIB 3R5JB 3D7EO 1JLEA 3A0IX 3WXLA 2OH2A 2DGUA 3AQPA 2P9PA 3CCSN 1ESVA 3LM2A 2HW3A 4B08A 2CZ4A 2OEKA 4P9SA 4EO8A 3PW2A 1HI0P 2RQ4A 3NNHA 4WU2A 4MLHA 2ZM6J 4UQGA 2DNOA 3J7YI 3QWPA 4MTPA 4XPCA 3PRDA 1LW2B 2O01C 2C2ZB 5CZXA 2V67A 5BJRA 3JXUA 4C0HA 4U9RA 1BC6A 4CZFA 4JI6F 4EMDA 3MM6A 2H54B 1CSJA 4BR7A 1NDLA 3ZLJA 2OEJA 3AVKA 2QN6B 5M2PA 5J1NA 4DL7A 3OR1B 3K9KA 5E3CA 3GJTB 1Y9OA 4L74A 1Q82T 3GFHA 4JI2J 4DCPB 1QDUB 3A8EA 1KTVA 2ASPA 4M5DB 3FZHA 2IOCA 1PBAA 1KR4A 3E01B 4ECQA 2G8UA 2Z4PA 1HD0A 3WQUA 3B6OA 1W9HA 4U6PA 2DIVA 3HSJA 3MMCB 1O1WA 4FJXA 2AX0A 2PEHA 4LF8J 4CZEA 4C2MA 1A7GE 3ULDA 2ASOA 3V4IA 2YNGA 4OI4A 1N33F 2D0CA 1VBYA 2N82B 5DQHA 3PR5B 1LEOA 4F4AA 2MYFA 4FYWB 4DTMA 2Z58B 2P9UA 2I2YA 2YKNA 4JI1J 3R7SB 2H51B 4IG0B 2O66A 1M90O 3O4QA 2XULA 4OYIA 3CDAA 3CJBA 2FVPA 4TYAA 5C15A 3WC0A 4LQ9A 2WB1D 5M1OA 4IR1A 2M8HA 2HFSA 1HBNB 3D0PA 2YCHA 1RTDA 3H5SA 4A8WA 3CCQS 1UWAA 2VG5A 4CLKA 2NZCA 3MEEA 3PKYA 3QEIA 2NS1B 1WORA 2UUBK 4CLZA 3HO1A 1RWKB 3EKUA 1XR7A 4FJMA 4KBOA 3R7BB 2ZGYA 5DGAA 2GBZA 3I0RA 1S72S 5D6GA 5HROB 3FCHA 3FRZA 2B6AB 1Z05A 1QD1A 1IKVA 1NOYA 1YX2A 4WU3A 1S1WA 2YKMA 5K14B 2XHBA 1FDNA 1JWWA 2HQCA 3OVAA 2V7YA 4G3IA 3J81U 3T1HF 4FXDA 4ECYA 2VBWA 4AH9A 2CPJA 3A1YG 4O55A 5MAOA 1VAZA 3ZSXA 4A57A 1AUSL 3QT7A 1Q86O 2KI2A 4WIIA 3AO4A 4Q7AA 2M88A 1J5OA 1OS5A 4LFCJ 4JI8J 1JJ2R 1Z2LA 4CZKA 3GZ7A 2H48B 3CF5L 2ZD1B 4HLBA 1JX4A 4X4TA 1IM4A 2CNOB 3AD7C 2R9LA 3JSBA 1N32F 4IFYA 1WSEA 1B9DA 5M1QA 1Q1KA 2XMVA 5AQJA 1FK9A 3GP9A 3ZNJ1 4CE9A 4OZJA 2XMKA 2E5LF 1UPMB 1TKDA 3W7BA 4ZLNA 5CAAA 4Y2KA 1HBMA 5CQGA 4C97A 2MHNA 2PN6A 1ROFA 1VYAA 3AB2B 3ZX2A 2DY4A 3U8XA 5E84A 3GV5B 4WQ5C 2SXLA 2JX2A 4C4WA 4WFAL 3F9MA 2BX6A 1WBBA 4USJC 2PZSA 1F5BA 3HJFA 2HHQA 1RCHA 3DCAA 3WIUA 2HBMA 2O8DA 2QK9A 1GEHA 3VVTA 4KPYA 4FVMA 2C2NA 5L1LA 2O4GA 3O6QA 1CJKB 4NLOA 5JS2A 4MO4A 3SSRA 1A5XA 1HBOA 2FC9A 3MR7A 2MKIA 1EQMA 4JRPA 3JSYA 1L3KA 4M94A 2JVOA 5SZTA 2X1FA 1NO8A 5IT9U 3HF5A 3VQBA 3R8YA 1HNWJ 1RT2B 4UT4A 3CJSA 2VPXB 2HHSA 5HP1B 2VHGA 2VC0A 3QO9B 3ENQA 1FJ7A 4A2BA 4F4WA 3M2RA 3MXIA 4M3RA 4B3RF 1M1HA 4OYZA 3HVTA 3CCJS 3ZCMA 3S1TA 5LT5A 1JLGB 1UVKA 5DS7A 4FPAA 4AD6A 1YTAA 1HJRA 1WTBA 3FC9A 3NWRA 2KZZA 1RU1A 2O8CB 3KK7A 1D1UA 4IO9L 5TKYA 4E89A 3H3NO 3R1LA 1NMNA 1RDBA 1VSKA 1XR5A 4K4UA 5D78A 4QWBA 3UDVA 3ET6B 4M3WA 2CPXA 2ATLA 1VR6A 1N6QA 4B3SF 1T03A 1X1PA 5D0HA 3MF5A 1I3OB 3MM9A 4PG7A 4YDXA 1N0VC 2PMWA 3NMAA 4H4OB 1IKWB 2MQNA 1SB6A 4JKGB 4LFAF 4LMZA 2FC0A 4YR3A 5DG9A 3KK3A 1VRQC 4B3TK 2UUAK 4RLEA 5KFOA 2FSJA 1ZM4A 4X4OA 3QINA 3BQ0A 2M52A 3ELHA 3W8GA 2E29A 1EKSA 4CGGA 3P5JA 1MG7A 3SBMA 4DUYJ 2R2UA 4W5NA 2G0JA 1D8ZA 2E20A 4R25A 3I9V9 4LR9A 5EHHA 2KKZA 2HGLA 2KRBA 2DYAA 5HMYA 4OZ3A 4B02A 1HW9A 5AJ3K 1S1XB 1UAWA 2C42A 3I6PA 2D3OR 5C7PA 4X84A 5AE2A 3RU0A 2BE2A 3PRBA 4JI4K 3JQKA 3O3GA 1O5JA 4P2XA 1WF2A 1FKPA 2UP1A 3ZSQA 2IVNA 5GAHI 4PZVA 4FWMA 1PILA 4CO5A 5T7LA 4FF3A 2CQ2A 3QIOA 3W0LA 1UA1A 4EP4A 4C7QA 1QZ6A 1RSCA 3V5RA 2CPYA 3TJ8A 2ZJRQ 3D5MA 3D6FB 3RMAA 1RHUB 2V5HG 1XNRJ 2N3LA 2OPRA 4LFBK 4HUFA 1GX5A 2NRVA 3TR5A 3L8BA 4XH4A 4LF5F 4AQYF 3HYFA 4NCBA 1IKXA 3FFIA 1SC6A 3BO2A 5C12A 3C0BA 2XLIA 2VH7A 2O4IA 1GOBA 5AQLA 2GW8A 2W9AA 4BRMA 1Q7LB 1WJ9A 3S9HA 2QTDA 3TX8A 4DV2F 2VC1A 4WFXA 5KRTA 5LMNF 3E2EA 3QFHA 3DXKB 4IOBA 1GXUA 1WC5A 4X66J 4U95A 1H72C 1YHQS 2XI3A 2FYXA 1SJFA 1Q79A 1RACB 3TZZA 2E8AA 4KHRA 5ETVA 1QHTA 3Q8UA 4IO1A 2DXEA 5AQIA 1YZ6A 5ADZA 3BS9A 4JBCA 2I5JA 4QWEA 4WP9A 3DYAB 1IJJA 2LA4A 2J6TA 4YY3F 1G7CB 3NAHA 3DRRB 1HR0F 3K57A 4DMNA 4C98A 3OR1A 4QR1A 1GLDG 4HL9A 1FTCA 1GTHA 4DR2K 4CHYA 1HUXA 4CH7A 2V8VA 5D4OA 4CHPA 4PL7A 3CW2C 3VGTA 4I68A 3SIPB 2D9PA 5E3AA 2VQEJ 3CHWA 1WTFA 2DT9A 3LF0A 3L4IA 4J9PA 4JI5J 4MJKA 2CQ1A 2HFVA 3M8PB 5ETOA 3J7ZT 4A47A 3OTDA 4AL7A 4ZP9A 3UI3A 4ZVUB 4BREA 2ITMA 2C2DA 4NLUA 4N41A 3IDHA 3GYXB 4DR1F 4ZP6A 4NXMF 2E2PA 3VEVA 2QLBB 2AKWB 4Q2MA 1FEHA 3DGVA 1SKRA 2JHEA 1YJ9N 2BUPA 3IWNC 2R4FA 2R7XA 3MEGB 1K6YA 5KG6A 2ZC4A 3TAGA 3A12A 1FJGF 4KAZA 2P9SB 1JKHB 1SH0A 3VENA 3DLRA 2FDNA 1VQOS 4C9DA 4CEEA 2E2NA 5DZ7A 3LH2S 1HBNA 3IAS9 2KKHA 1K9MO 3PRVA 2W42A 2F96A 2YX1A 1ULRA 2RDDA 3AO5A 3MUVP 1BO5O 4DPTA 4BBYA 4J2AA 2F4VJ 2OMLA 2AYEA 1SH2A 1QQOA 2UXBK 4A8OA 1S6PA 1Z25A 3AA3A 3A5LC 4CO2A 1IG9A 4WFZA 3IGNA 2D74B 2Z2YB 2Z1IA 2QEXN 4EZ6A 5E7OB 2FJWA 2K7JA 5A76A 4I2PB 4K4TA 5EX5A 3CCVN 2QV6A 3EZ5A 2IBOA 5HROA 2B8QA 4KH6A 4W5OA 4Z4CA 4FO0A 2B6AA 3MZIA 3E9LA 3KXDA 4KI6A 1Q16B 2CWXA 3PW0A 2B4JA 3D68A 5K14A 4YDUA 3K5NA 3D54A 4GV3A 2B9WA 1K8KA 3UCGA 4CZJA 4AHSA 4B3OA 2HFUA 1CS4B 2KQ2A 6FD1A 1UWBB 3ZXWA 1WELA 5HANA 1CVJA 5IWAK 5EN1A 2CUYA 1TTHB 1X9MA 3SEOA 3OTCA 4JKEA 4ID1A 2CGJA 4JV2A 3BO3A 2OPQB 4CD3A 3AAPA 4EO6A 2GQ2A 1TKTB 5AQFA 1FF2A 2ZD1A 4A8YA 4OGCA 3ILOA 2YWEA 3VGKA 4M3TA 2PI5A 2CAJA 1TKXB 2EC2A 3FEYB 2G2YA 2XEXA 1IG8A 4KIAA 4JV5K 2OTLS 3BGRB 4RJVA 1PYSB 1IBKF 1RU2A 3IBCB 4WTOB 4KV8A 1EAYC 2MZRA 4F0KA 3EGNA 4R5PA 3J80U 4B9VA 2GO9A 2EFOA 3OUYA 1JLQB 3IMXA 2L41A 4K59A 3QWUA 2VBZA 4FZVA 3CYMA 1ZBIA 1UTAA 5AQSA 3R5AA 5HRRA 5DETA 2WAQD 2AX1A 3PVXA 2G8IA 1MROB 1NGJA 3ZYYX 2QLFB 4BE0A 1LXJA 1RBAA 1KLMB 1VRTB 5C42B 2P9NB 1PO6A 2UXCJ 2B5JB 1P8GA 3Q8QB 2IBKA 2PFUA 3KYLA 2P6TA 3QICA 4BGAA 3F56A 1JK9B 3CC2N 2HHHK 2NREA 2D1CA 5JICA 1KONA 1EXQA 1SJ1A 4DV0F 3DU6A 2BKOA 5HP1A 3KG1A 3QO9A 3K7RA 4DQSA 4CO4A 3TAMB 3AAWB 2HBKA 3C3LA 3J7A1 4JI3J 3CCUS 3JSRA 1FRHA 2B4PA 3L0QA 2E1ZA 2CDRB 3CCES 4ZPVR 3I8BA 4JKDA 5CR4A 1N34J 3T1YK 2GV9A 5DM6L 1AUDA 4DFMA 2Y8YA 3TSQA 4GV9A 3TA0A 5J2NA 3M6WA 3SJHA 4PKGA 1CC8A 2DR7A 2IM2A 2CPZA 2ZH9A 2G2ZA 3ET6A 3AAQA 2YHAA 3CMEN 2YV0X 3DRPB 3SAFA 4TKTA 1YIJN 4CJ3A 4H4OA 4AXIA 4GKKJ 1HNXF 1NLKL 3TJ9A 3AA5X 3T9ZA 5IXUA 4FYXB 2LEAA 1LFPA 3CM5A 3TW0A 2NNWA 3DDNA 5SWMA 1U1LA 4I6AA 2YVSA 3RAQA 4FJJA 4FJNA 3NF9A 1LW0B 4K4VA 1UOCA 2BKPA 4LF6F 4ZVTB 4CFAA 4ZIWA 4O8KA 1VC5A 4CJTA 4DCOB 4ZJOA 2Z0GA 3OYCA 1JXEA 3S3OA 3HM9A 4JD2B 3HI9A 4NLPA 5HK4A 2BMBA 2W4DA 3B6BA 4USKA 3JAMY 1KXPA 2V7ZA 5EOYA 1RADB 3EYZA 3G10A 5HBMB 1HNZK 2I0XA 3F9KA 1EX8A 4JI7J 1C0GA 2WOMA 5LL6d 3CD6S 2IFXA 2P5VA 3A8JA 2F8HA 3AA9A 2LP4A 2E5JA 1X3NA 1UW4A 3QRPA 4N77A 1RTIB 5AQQA 1FE0A 1U6FA 2EKNA 1OYEA 2E9RX 2ZM6K 3IAM9 3G6EN 5HJYA 1WSIA 1T44A 4B1ZA 3J7AP 4DR6J 1UL3A 3VPZA 2H4YB 1UP1A 5FLXO 1BQNA 1C0MA 3OQ2A 1HI1A 3LGNA 4O8UA 3D1HA 1I3AA 5LL6Z 1B7FA 1F0XA 4LY7A 2G8HA 1ACMB 1PYTA 1VQ7N 1G6BA 2HVDA 3CMAS 3DXKA 1YDLA 2ZJRL 1KC8T 2JDJA 1RBUA 1Y0HA 2X7IA 4QU6A 2WZ1A 4CF1A 4J37A 4ENOA 1I51B 4DL4A 2H3GX 1VI7A 1D3WA 2CDQA 3BB5A 1SCJB 3RTVA 2QX0A 3FFKB 5CA5A 4YEAA 1U2FA 2QWNA 3WZ0A 1CPZA 3DRRA 3U27A 2DB1A 4CZHA 4LF7J 2BRLA 4UF4A 3MCSA 4LF8K 2KFZA 3VQCA 4BDZA 1DTQB 2E4LA 3W9JA 1CLFA 3AB4B 2OYQA 2PT0A 3PSIA 4NLGA 5AQXA 3I31A 1NCLA 3RB6A 2CQ0A 4B3TF 3SXLA 1RGVA 2Y8WA 4ILRA 4BROA 3N28A 3M8PA 4B3MJ 2EWHA 2K06A 1RQ0A 1NWKA 1RT7B 4M7YA 3I5AA 2C3YA 2AYMA 2N7YA 1MWKA 2PAVA 3HBTA 4DR3K 4ZN3A 2JEFA 4DV5K 2NXEA 3NMRA 5BREA 1W2BR 4X62F 3CETA 1PJ7A 3WNEA 1R6YA 2IM0A 3NFAA 1XQSC 1GLLO 4DUZJ 3MEGA 4ZVGA 1WSRA 2FLNA 4AL6A 3CD0A 2E7XA 2NXCA 2ATCB 3DXSX 2OANA 1JKHA 2GEMA 2P9SA 5JVGL 3CD7A 3O9QA 3HD1A 4P72A 1EIYB 1RWNB 3D66A 2EBGA 1MNEA 4H0TB 1TUYA 3G86A 4WZQA 1U4BA 3SBTA 1WC3A 3TJAA 4KH5A 5ELZA 4WYBA 3QAUA 3VAKA 1IH7A 1TUVA 2I9SA 4M5KA 4DU1A 4ZTFA 5KQ8A 5KG5A 1M5OC 3TI0A 2VG7B 3VAHA 5CCLA 1NKBA 3BZKA 3ONQA 1U7LA 3DRYA