4CJQA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
153
structure length
148
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 56
structure length 148
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cjqA00
3ZCMA 4AHRA 1NJWA 3L8BA 1NK9A 2ITGA 1UWBA 3MEDA 3ZSOA 3V9WA 2RPIA 1JLCA 3LAMA 1O1WA 1WSFA 2IC3A 4F2SA 4DLGA 1LAVA 4W5TA 3KLGA 1UAXA 3OYIA 3NH2A 1U4BA 4B9TA 4CHNA 1Z25A 3QINA 2YNFA 1L3TA 1A5VA 2IGIA 3MAQA 3G0ZA 3HK2A 1UA0A 4M42A 1S6QA 1D8YA 3TAMA 1VRTA 4NCGA 5T7BA 1NKCA 4OJRA 3VQ5A 3ZSYA 5EU7A 4WE1A 3PX6A 3OVNA 2FBYA 3IS9A 1QTMA 1S1TA 4F2RA 1C0MA 1JLFA 3OYLA 3RMAA 1WN7A 4HHTA 4RG8A 4M3XA 4ICLA 3CFRA 2F8TA 4CFDA 2RKIA 5KGWA 4KHNA 4OPKA 3M8SA 2VG5A 1VRUA 4LH4A 3JSMA 4FK0A 2G8KA 1ZBIA 4KI6A 3KK3A 1CZ9A 1ASWA 3KKSA 4FJ5A 3DLBA 4FVMA 1YTAA 1J54A 3B6PA 2XRIA 4IDKA 3U3GA 4E1MA 2PY5A 1RTDA 3QERA 1HPZA 1S1WA 3I0SA 3NFAA 1Q9YA 4ELVA 3EY1A 3VQ6A 4B9LA 4AH9A 4EP4A 3KLFA 3EYZA 1IO2A 1ZBUA 4CK3A 3SUOA 4DQPA 4FJ7A 1C0TA 3AA3A 3DRPA 4FLWA 3C94A 3CM5A 1VSKA 3VQ7A 4UQGA 3SPYA 2G8UA 4LY7A 4DS5A 4BE2A 4E19A 3RRGA 3ISNC 2KZZA 1S5JA 1NJZA 4Z0UA 2IAJA 2YNIA 4O55A 3NH0A 1LAWA 3I8DA 1QSSA 1WLJA 4KHSA 3DRRA 1RT1A 1NJXA 4DQRA 4E7HA 4EZ9A 4FJKA 3ULDA 2RN2A 3VA0A 3V9SA 3OYNA 1Q8IA 4KB1A 4GVMA 3HVRA 2O4IA 4CJKA 4M3RA 4FZYA 4Z4HA 4MQ3A 4CCHA 1QHTA 1NK0A 4LD0A 1FKOA 3VQBA 3TWHA 3HO1A 5SWMA 4CF1A 3ZSXA 2EX3A 3PV8A 4C8LA 2B6AA 4J2EA 4HUFA 2B5JA 1JXBA 4CJSA 4Z4CA 4PY5A 3K5LA 4CEBA 3D45A 4DTPA 1FKPA 4O0IA 1IKXA 3SQ4A 4Y1CA 2HMIA 3C6TA 3RR7A 4OGCA 2GV9A 1GOAA 1RDAA 2IOCA 4I2QA 4B9MA 3DOLA 4YNQA 1BI4A 5CYMA 1TKTA 3CYMA 3LWMA 4M3WA 2HHVA 1RBTA 4O44A 3NAEA 1SL0A 2Z1HA 4DU1A 4DTUA 4K8XA 4FK4A 4QCLA 5E41A 1JLGA 4DU4A 5HBMA 5JS2A 3ZT3A 3OYJA 2B4JA 1Q9XA 4JS5A 5HP1A 2Z1GA 1VSJA 1NK6A 1A5XA 1S9GA 3SJJA 2OZSA 3AO1A 4IKFA 1B9FA 4F3TA 1RT4A 4K8ZA 3TAQA 2YKNA 1XHXA 3TAPA 1SKWA 3IRXA 4KFBA 3K58A 5KGXA 2R7YA 4CGHA 1R0AA 3OYBA 2HVHA 4RW7A 3L2RA 4J2DA 2XO7A 2G8VA 3BGRA 3KKRA 2Y1JA 4PA1A 3TABA 1VSLA 2JLEA 3MXMA 1S1XA 4DLEA 3DOKA 4CJRA 3KLHA 4FJXA 5HLFA 1FXXA 2RF2A 3TAEA 4CGDA 3QNNA 4DSJA 2HHUA 5C25A 3AVLA 3MXJA 4CFAA 1VK0A 1WSIA 3IG1A 4RW8A 3TI0A 1HMVA 3SQ1A 1KFSA 4CHPA 4DSEA 3VQCA 4B9VA 3NF8A 4B08A 4DQIA 4JLHA 4CEOA 3K2PA 3AVHA 4DSLA 2DTUA 3O4QA 4CGGA 5KTQA 3V81A 2EHGA 3KD5E 2P5OA 3AO3A 4KRFA 4CHYA 4PWDA 4KPYA 4NYFA 4CFBA 3DLKA 3ZT4A 2KW4A 1NKEA 2OPQA 4B9NA 1WSHA 4FJHA 4FM1A 4CK1A 1L5UA 1CXQA 2VWJA 3L3UA 1IKVA 3NF6A 4HVJA 3D0PA 4JS4A 2OA8A 1RBSA 5J1EA 1WSEA 2DY4A 1LW2A 3OS2A 1HNVA 3QIPA 5FROA 3OS1A 3AVGA 1K6YA 1VSFA 3SUNA 1LW0A 4CEQA 3QLHA 4CEDA 2D0BA 4KB0A 2BGGA 4BE0A 4LSLA 4FM2A 1QSLA 2GBZA 4ID5A 1S1UA 4W5OA 4CHOA 3O3GA 1TKZA 1VSEA 5CY4A 4BWJA 3JYTA 1BCMA 4E0DA 1ZBHA 1TL1A 3T3FA 1SL1A 1LWFA 1EXQA 3KJVA 3S3MA 1UA1A 5DK5A 4HTUA 3RTVA 1KRPA 5KRSA 4CF0A 1JLEA 4DTSA 2IS3A 3DI6A 4Z4FA 4CEEA 4CF2A 1KTQA 3AA2A 1TAUA 4OLAA 4FLYA 3CFPA 1TKXA 4CK2A 2OPPA 5SZTA 1RCHA 4CJ4A 3SI6A 4O0JA 1RDDA 1L3SA 3V9ZA 3DYAA 1EKEA 1IKWA 1WNSA 5J2QA 4XIUA 1GOBA 4O5BA 3TAFA 3SPZA 4JRPA 3LP0A 1JLQA 4CECA 1X9MA 2FBXA 3V4IA 1T03A 1IG9A 3L2WA 3L2QA 2XY5A 4OVLA 4E7LA 1N5YA 1JL1A 4CJ3A 3PO4A 4E3SA 2AJQA 1HYVA 4KHUA 4CEZA 2FBTA 3ZSZA 4KHYA 1BQMA 3IAYA 3ASMA 1HRHA 1S9EA 2BANA 3ALYA 4TSXA 1RT5A 4QAGA 1CXUA 4HUGA 1ZYQA 5KRTA 1TK5A 1T05A 3PX0A 1NOZA 4ELTA 1WAFA 3OJUA 4FJMA 2HHWA 1BQNA 4R5PA 3KLEA 3V9UA 3C95A 1J5OA 4IFYA 4AHVA 1RTIA 2HNZA 1TK0A 1WAJA 4B8CA 2Z1JA 2HVIA 2IDOA 3T19A 3OYEA 4AHTA 4CEAA 4CFCA 5FRMA 1C0UA 3NBPA 3O3FA 1CLQA 4DFPA 1SKRA 4B8AB 1T8EA 3HYFA 4I9QA 3RMCA 4FM0A 1KSPA 4CJEA 4I7FA 1FK9A 1TVRA 3LAKA 4CF9A 4DFJA 2Q3SA 4FZZA 3QETA 3RRHA 1ITGA 2YV0X 3VQQA 3CQ8A 3HP6A 3QESA 3U3YA 3SCXA 3L2UA 4CHZA 4J2BA 4KHQA 4QOZB 1KVCA 2KFNA 4W5RA 4EP5A 4N56A 4OLBA 2KFZA 4CIEA 3OYMA 1JXEA 1G15A 3B6OA 4FLZA 1NJYA 3H08A 3S3NA 3T1AA 1YT3A 4N76A 3OYDA 5J2PA 2HHSA 2YKMA 4DU3A 5J2MA 4ELUA 5FRNA 1IKYA 1JL2A 1NOYA 2ZD1A 3AVCA 3RR8A 4FW1A 3A2FA 3LP2A 2XHBA 3OY9A 4FJ9A 4ZHRA 3NGIA 3KK2A 3HPGA 4FLVA 1S1VA 1UOCA 4E7IA 2QXFA 1EETA 1TAQA 3ZT1A 2D0AA 3M8PA 3WNGA 3SQ0A 4AHCA 4B3OA 1C6VA 1TK8A 4MFBA 1L3UA 3DM2A 4KTWA 3MXIA 4ZTFA 1KVAA 3QEIA 3V1RA 3U6FA 1NK7A 1U04A 3NHGA 3HXMA 3VQAA 1NK8A 1RDCA 3CM6A 3CG7A 2F8SA 3F73A 2E4LA 4H4OA 3AO2A 4GMJB 1LV5A 4DSFA 1J9AA 1RBVA 2DFHA 4FJIA 3UIQA 1HYZA 1WSGA 3DRSA 1QS4A 3ZT2A 3QO9A 4C8NA 3K59A 1D9FA 1BGXT 3LZIA 1BISA 1SL2A 4Z4IA 1DLOA 3AO5A 4CESA 4CJFA 3TANA 1SUQA 3I0RA 2OPRA 3HSTB 2G8HA 4F3OA 3QEWA 3K5NA 1WSJA 3RWUA 5KI6A 3LPUA 3ZSVA 3PY8A 4L8RB 4OKEA 4CJQA 2P1JA 2QKKA 4BE1A 3HJFA 2QKBA 1XHZA 1BI4B 4HCBA 3LP3A 5C42A 2HNYA 4BDZA 4DTJA 4C8OA 3AVJA 4FJ8A 1W0HA 4LH5A 3S3OA 3G10A 1TKDA 1QSYA 2HW3A 3AVKA 1QQCA 4KO0A 1X1PA 3HP9A 3WNHA 4OKJA 3KTQA 1C1CA 4M3UA 3LANA 4CJTA 4Y1DA 1RNHA 1W9HA 3NF9A 4M3YA 4Q0BA 1HYSA 3E01A 4O4GA 4E89A 4CJVA 3K5MA 2HNDA 4DMNA 5JS1A 3VQ9A 2OPSA 3HM9A 4KAZA 3OYGA 3TR8A 5J2NA 1XWLA 1CZBA 1I3AA 4CEFA 3PO5A 3DLRA 2P51A 1BIUA 2F96A 2X6NA 2XY8A 4FZXC 1REVA 1RT3A 4CIGA 5D3GA 3M8RA 4N41A 3LWLA 4N5SA 3KK1A 4IFVA 4KKOA 4RW9A 3L3VA 5CZ2A 1T7PA 4B9UA 2YHBA 4DTOA 2X74A 2ATQA 3HT3A 1NKBA 1L3VA 2PYJA 3NDKA 4RW4A 3VQEA 4CJWA 5FDLA 2YNGA 3HPOA 2BDPA 3BDPA 3F9KA 4FJJA 3OYHA 3LPTA 2DFFA 3VN5A 4M3TA 4Z4GA 3KIOA 4IG0A 3AVFA 4OKKA 4BDPA 3SQ2A 4FLXA 2G8WA 2OZMA 4AHSA 1HQEA 2DFEA 3OYKA 1U45A 5HRNA 3OS0A 4DQSA 1U49A 1BHLA 3DLHA 1VSDA 4PQUA 3C6UA 3O3HA 1F21A 1S6PA 1XI1A 4IG3A 1LWEA 1RBUA 4Z4EA 4CE9A 1DTQA 1KVBA 4G1QA 4C8MA 4CGFA 1YVUA 1C1AA 4CF8A 3QEVA 1HNIA 4C8KA 1VSHA 4FJLA 1RT7A 1EP4A 4M3ZA 4I9LA 3V1QA 1RT6A 1U47A 4YFUA 4AHUA 3V9XA 2ZQBA 4BWMA 2A1SA 4DQQA 1BIZA 4KREA 3NE6A 4ID1A 3AVBA 3MEEA 2JGUA 2KZMA 1B92A 3ZSRA 2W42A 2WONA 4KTQA 3K5OA 4CJUA 2XY6A 3QIOA 1N6QA 1YTUA 3OJSA 3QEPA 4FLTA 5HRSA 4BACA 5K14A 4CJPA 4KHWA 1SV5A 4CERA 1TL3A 3HVTA 3KLIA 3MEGA 3AO4A 1ASUA 5C24A 3VQPA 4FK2A 5HRRA 2E6MA 3DLGA 3ZT0A 1RTJA 4DTNA 4FLUA 4CHQA 1I39A 1RBRA 4DSKA 2P5GA 3AVAA 3HPHA 1TGOA 4DTRA 3KD1E 1D9DA 1JKHA 1ZBFA 2Z1IA 5HROA 4HCCA 4CGJA 4FXDA 4E7JA 4LSNA 3AVMA 4W5NA 1JLAA 2YHAA 3P83D 1BL3A 1MU2A 4GW6A 5CZ1A 4HUEA 2PYLA 4FYDA 4DFMA 1KCFA 2OYQA 1EX4A 3LP1A 2O4GA 4OGEA 2GUIA 3OYAA 1BCOA 1LWCA 4AILC 4DSIA 1ZBLA 2KTQA 2Y1IA 1C1BA 3FFIA 3VQDA 2X78A 4M41A 2HB5A 3SNNA 5HRPA 1IH7A 1B9DA 1JLBA 4F8RA 3DMJA 3HL8A 1X9SA 1ASVA 4E1NA 3P5JA 1KLMA 1VSMA 4DTMA 1RTHA 3OYFA 4H8KA 3SUQA 1DTTA 1KFDA 2I5JA 2VG6A 3VA3A 4KTZA 3NCIA 4FCYA 3PX4A 2KQ2A 4M45A 1D5AA 4Q5VA 3OYCA 2A1RA 3LZJA 4EZ6A 4E7KA 4NCAA 2VG7A 3LALA 2G8FA 3TARA 2ETJA 2YNHA 4JRQA 3ZSQA 4B9SA 1HJRA 3AA5X 4DS4A 2QK9A 3NH1A 4H4MA 4FJNA 4CJ5A 3PUFA 2FBVA 3VQ8A 4DF4A 1SKSA 1U48A 4DWIA 4J2AA 4RW6A 1NK4A 4KV8A 2D0CA 2PZSA 2D5RA 1VSIA 2HHXA 1RILA 3M8QA 2VWKA 3WNEA 1KLNA 2NUBA 2X6SA 3SV4A 3AVNA 4CGIA 4F4KA 2BE2A 3MECA 4CJLA 1Y97A 5I42A 4N47A 4OPJA 3QEXA 1GOCA 3AV9A 3DLEA 4FW2A 3K57A 3SZ2A 1QE1A 3RMDA 3O4NA 3QNOA 4W5QA 2WOMA 3AA4A 3AVIA 4IBNA 1X9WA 2G8IA 3NF7A 4FJGA 1TV6A 1NK5A 3ZSWA 2E6LA 3V6DA 4NCBA 4I2PA 3TAGA 3EZ5A 3RMBA 3NGZA 3LDSA 5CYQA 2XY7A 1J53A 3VQ4A 4DFKA 3THVA 5I3UA 2HHTA 4ZTJA 3SYZA 3L2VA 3NGYA 4DTXA 1RDBA 2FC0A 3ITHA 5DMRA 3S9HA 4DG1A 4KI4A 2HHQA 3V1OA 1Z26A 2ZE2A 4BDYA 1A5WA 1RT2A 2LSNA 3P1GA 4CIFA 3CFOA 3SUPA 1XC9A 3WNFA 4PUOA 4DF8A 3SV3A 4NYNA 1HQUA
chains in the Genus database with same CATH superfamily
3ZCMA 4AHRA 2I7PA 5AFUA 3G71N 4KH6A 3ZSOA 1O1WA 2HOEA 4NO7A 4F2SA 3R9PA 2KHOA 1A5VA 3EE9A 2IGIA 4M42A 1NMNA 1D8YA 4FWOA 1NKCA 1WBBA 4HTLA 2FXUA 3OVNA 3IS9A 1JCFA 5IWAK 4F2RA 4BR5A 2YHYA 4RG8A 4BVOA 4FO0A 4CFDA 4KHNA 1VRUA 4WF9L 4KI6A 4IJNA 3KWGA 1OVQA 4A2BA 2PY5A 5E26A 4WQ4A 3QERA 5BN9A 3NFAA 3KHYA 4AH9A 1ATRA 1ZBUA 4FJ7A 3O5BA 1NGHA 3DRPA 2OTLN 4FLWA 1HKGA 4UQGA 3SMPA 3SPYA 3RRGA 4H0XB 4DS5A 2KZZA 1I94K 4Z0UA 3W3DA 2YNIA 3NH0A 1LAWA 4KHSA 3DRRA 1NJXA 1V4SA 3ULDA 2NRWA 3FE1A 3V9SA 4XH4A 3HVRA 4KHYA 4Z4HA 1NGCA 4CCHA 3HO1A 3VQBA 2CGLA 3J8AA 5LMNK 2W40A 3ZSXA 2EX3A 4J2EA 2I7NA 1JXBA 4CJSA 3K5LA 2P9LA 3D45A 2P9NB 3KWIA 3M5RA 4JI2K 4O0IA 5C2DA 2HMIA 5M1QA 1GOAA 1RDAA 4BR2A 3VTHA 1RBTA 4O44A 1SL0A 4MO5A 4IEIA 1HJOA 3K9JA 3LDLA 4FK4A 5E41A 4CW7B 1JLGA 3ZT3A 2OZSA 2FF6A 3BP8A 2Q1NA 4B3SK 3TTDA 4J2DA 4YORA 3KKRA 5AQOA 3MXMA 3DOKA 3MK6A 3WQUA 4B3TK 1FXXA 1BO5O 4CGDA 5ADXA 2HHUA 3AVLA 5AZJB 1VK0A 3U9DA 3ZX2A 4DHYA 5GIOA 5BRFA 4CHPA 4BY9C 4GV6A 3NF8A 5AQHA 3AVHA 3P39A 4CGGA 4CZIA 2WBNA 2HMPA 1SAZA 1BUPA 4KPYA 3DLKA 1NKEA 3JAMO 4GY2B 4FJHA 1WSHA 4FM1A 4CK1A 1L5UA 1CXQA 3NF6A 3D0PA 3UKUB 5AQLA 1LW2A 3OS2A 1TYQB 1K6YA 2YX6A 1T6DA 3SUNA 5KQDA 5EX5A 2PAVA 4FM2A 1QSLA 3U8XA 1NGBA 4CHOA 3O3GA 2W41A 1TL1A 3T3FA 4GV9A 3S3MA 1UA1A 3WXIA 4JKHA 4JKBA 2D0PA 2IVOA 4CEEA 1KTQA 1TAUA 4CK2A 1RCHA 2QEXN 4CJ4A 2WUSA 1VQ6N 1L3SA 4M7XA 3DYAA 4XIUA 1SQKA 1GOBA 3KZBA 4CECA 1XNRK 3G6EN 4UY8O 1XNQK 1JL1A 3FZMA 3CMAN 4KHUA 3ZSZA 1KD1O 3VENA 4C1NI 1HNZK 3ID6A 3CETA 3E9PA 2HHQA 2BANA 3ALYA 4TSXA 1RT5A 5KRTA 1T05A 1J5OA 4IFYA 2NRXA 3E66A 1TK0A 1T44A 2PBDA 2HVIA 3OYEA 4AHTA 4CFCA 5FRMA 1C0UA 4CBXA 3M6GA 1KSPA 4CJEA 4DFJA 3CJCA 2NRTA 1NBWA 5CE3A 1ITGA 2YV0X 3VQQA 3HP6A 4QOZB 4B3RK 4F9OA 1KVCA 4EP5A 4CIEA 1NJYA 3B6OA 1G15A 2VQFK 2O8CB 3GDQA 4ILHA 3KVGA 2HHSA 1YAGA 1HKCA 5J2MA 4ELUA 3H45C 4CBUA 4FPAA 4G9ZA 1V4TA 1U2VB 3A2FA 3WT0A 1IJJA 3OY9A 3VF4A 4FLVA 4I6MA 5JVGL 4OO1J 4E7IA 3THWB 4YOUA 3WNGA 3SQ0A 2P9IA 1C6VA 1L3UA 1GLBG 3V1RA 4BC2A 1NK7A 3HXMA 4GMJB 2DFHA 5BPNA 3C6AA 3EKSA 4C8NA 4BRPA 3H46O 3CCLN 1KAXA 2WC9A 4GKKK 1YITN 3I0RA 3K5NA 3ZSVA 1TUUA 1RDWX 1E4FT 4OKEA 3LP3A 3AVJA 2BUPA 3M3ZA 1X1PA 3HP9A 3KK7A 2HSTA 5AQNA 4WQ5C 3GL1A 4X64K 4M3UA 4Y1DA 1RNHA 4O4GA 4E89A 4IJAA 3T69A 3VQ9A 4KAZA 4CZHA 3OYGA 2GWJA 1K9MO 3DLRA 5M1NA 3LM2A 5TKYA 2X6NA 1REVA 4N41A 4CBWA 3LWLA 3THXA 4BGAA 4N5SA 4KKOA 3O9UA 3L3VA 5CZ2A 4DTOA 2X74A 3ZETB 4BRCA 3HT3A 3FGUA 2UXDK 4RW4A 5BREA 3HPOA 2Q36A 3OYHA 3CCSN 1ZXOA 4BG9A 2OZMA 4IG0A 3AVFA 3W0LA 3SQ2A 5M1OA 4AHSA 1HQEA 3OYKA 3DLHA 5AQUA 4GV3A 1ZBSA 1S6PA 3MN7A 4Z4EA 4CE9A 2E88A 1KVBA 4G1QA 1C1AA 1QQOA 1RT6A 3PLAA 4BREA 4DQQA 3NE6A 3MEEA 1B92A 4O5FA 3ZSRA 2WONA 3K5OA 3OJSA 3QEPA 1NGGA 4PKIA 3IUCA 1TL3A 3AO4A 3MWTA 1GLEG 3C6HA 4ISEA 3ZT0A 1JJ2M 1RBRA 1MA9B 4DSKA 4MO4A 2P5GA 5AQFA 3AVAA 2YI1A 5F2RA 2F9TA 5AFUH 3DXKB 1JKHA 4CGJA 4E7JA 4LSNA 4JV5K 1KAZA 4FYDA 5AQTA 5AQGA 5C15A 4K25A 1ILYA 4DR5K 4YOYA 3P4IA 4DQ8A 1C1BA 3VQDA 3SAGA 2HB5A 5BRHA 2HF4A 3HL8A 2HBJA 3D2EA 1X9SA 1KLMA 1VSMA 2YJEA 4CD3A 3C65A 1K8KB 3SUQA 2QTDA 1DTTA 2VG6A 4FCYA 3OYCA 4MDAA 3LZJA 4XH5A 2G8FA 3TARA 4JRQA 4B9SA 1HJRA 2GEMA 4H4MA 4FJNA 4CJ5A 2FBVA 1M90O 4DF4A 1BG3A 1U48A 4DWIA 4RW6A 1GLFO 3MCPA 4JEPA 3WNEA 1EO1A 3TTFA 3MECA 4N47A 3DLEA 4YOVA 5AQXA 3SZ2A 1BWFO 4W5QA 1VQ9N 3AVIA 1X9WA 4KBOA 3NF7A 4I2PA 2E2PA 4ILJA 3BEXA 3RMBA 2XY7A 3THVA 2HHTA 3SYZA 2Q31A 4DG1A 4IEEA 2ZE2A 3CFOA 3VGKA 4BRIA 3WNFA 4DF8A 5JICA 4K0KK 2ITGA 3MEDA 4DR1K 3V9WA 4K41A 2NRRA 3LAMA 1RFQA 2IC3A 1VHXA 4DLGA 1QVGM 2YHWA 1T3VA 1Z25A 3QINA 2A6AA 4DR4K 2P9PA 5HOOA 4A5AA 5T7BA 4OJRA 3ZSYA 3HTVA 3F2KA 1S1TA 4MLEA 4M3XA 4ICLA 3ZX3A 3CFRA 2F8TA 2GTDA 2A3ZA 4OPKA 4LH4A 3KK3A 3J7YP 1ASWA 1ESVA 2A40A 4JHDB 4JD2A 4FJ5A 3IKMA 3B8AX 5ADXH 1EWQA 1DEJA 1RTDA 5KPZA 4OPAA 4B9LA 4LF6K 4EP4A 1IG8A 4NLBA 4CK3A 4DQPA 4BQLA 4OPHA 3H3NO 1VSKA 4LY7A 3DXMB 4E19A 1X9JA 3R8EA 2IIRA 2VWBA 4JI8K 3I8DA 4QS9A 3T1HK 3J80O 2CGJA 4DQRA 4EZ9A 2RN2A 3QBXA 2ZGYA 1Q8IA 4H0VB 4GVMA 4M3RA 1QVFM 1NK0A 4IOAL 5SWMA 1IBKK 4HUFA 2B5JA 4Z4CA 4BVPA 1Z6RA 5B8HA 1FKPA 3OW2M 3UKRA 3SQ4A 3CERA 2E5LK 4Y1CA 1Q18A 3FZHA 3D2FB 4MDBA 2IOCA 1OH5A 3DOLA 1BI4A 2JWLA 3CYMA 3WXKA 4M3WA 5AZIA 2Z1HA 3SMSA 2B4JA 1NK6A 4F3TA 5JLFA 1A5XA 3SJJA 4JKCA 1U6ZA 3TAQA 1Y64A 2RHKA 3IRXA 3BF3A 3BY5A 5KGXA 1R0AA 4CGHA 5DM7L 3OYBA 4DR2K 3ATVA 4RCHA 2HVHA 3EKUA 5LJVA 2Y1JA 2VGMA 1VSLA 3DJCA 4CJRA 3HM8A 1NG9A 4FJXA 1NGDA 1GLJO 4H5TA 5HLFA 2P9KA 2RF2A 3QNNA 4JI6K 3P31A 5C25A 2Q0UA 3MXJA 2E2OA 1HMVA 3SQ1A 3Q7BA 3Q7CA 4DSEA 5BPLA 4DQIA 4CEOA 2IVPA 3K2PA 3O4QA 2EHGA 3IDHA 2P5OA 3KD5E 4CHYA 1GLDG 4PWDA 1OH8A 4NYFA 4CFBA 3ZT4A 2UU9K 4B9NA 3OBWA 2D4WA 3CJ7A 5KPTA 5J1EA 3QIPA 3IMXA 4CD1A 3AVGA 4C23A 1LOTB 3QDKA 5AQMA 2BGGA 2D0BA 4LSLA 2GBZA 1S1UA 4W5OA 1VSEA 5CY4A 4ISFA 4BWJA 1BCMA 1ZBHA 4FVUA 1LWFA 1SZ2A 1EXQA 5DK5A 4HTUA 3RTVA 5KRSA 5FPDA 1R59O 3I56N 1JLEA 4LF5K 4DTSA 2IS3A 4Z4FA 1HLUA 2OTJN 1XMOK 4FLYA 1T6CA 5SZTA 3VESA 3EEQA 4FWKA 2UUAK 4A61A 2V7ZA 1WNSA 4LF9K 1KAYA 3SPZA 1X9MA 4JRPA 5BRDA 1T03A 1IG9A 3L2WA 4PKHA 1N5YA 1H1VA 4X66K 3TSQA 3IAYA 1YXQA 1S9EA 1TK5A 2P9NA 4QAGA 3PX0A 1CZAN 3KLEA 3V9UA 3C95A 1RTIA 2O8DA 1WAJA 3MX5A 4GVEA 4CEAA 3VERA 3CD6N 5F1XA 4DFPA 1SKRA 4B8AB 1JCEA 2E8AA 1VQMN 3RMCA 3LDOA 4FM0A 4CF9A 3LAKA 3QESA 3SCXA 4CHZA 1YI2N 5F0XA 4YDUA 4CZKA 1VQLN 1JXEA 1GLLO 3T1AA 3SJHA 5J2PA 4DU3A 4FOIA 4YOTA 5FRNA 2QWOA 2P9UA 2ZD1A 5AQSA 3AVCA 5IT9O 3MN5A 4ZHRA 3HPGA 2ASPA 5JLHA 1UOCA 4XH1A 1EETA 4L3QA 4WYBA 2UYTA 1TK8A 4DR3K 4MFBA 4KTWA 1YVNA 4ZTFA 3O6WA 1U04A 3NHGA 3CG7A 3QFPA 5DM6L 3F73A 1LV5A 1J9AA 3DRSA 1QS4A 3QO9A 3K59A 3FR0A 4QS7A 1BISA 4Z4IA 5GAGP 3TANA 3F9MA 1SUQA 3ZEUA 2P9LB 1NGEA 1WSJA 3RWUA 2FF3B 2Q2RA 5KI6A 2NRHA 3LPUA 3O8MA 2FLOA 4Y0WA 4CJQA 4BE1A 1XHZA 4HCBA 2HNYA 3MCAB 4BDZA 1W7AA 3FZKA 4LH5A 1NMDA 3AVKA 1HPMA 2AP1A 3RSEA 4JK8A 1YUWA 3LANA 4CJTA 1W9HA 3NF9A 4M3YA 4GKJK 4CJVA 3K5MA 2CGKA 3AAPA 5JS1A 2OPSA 3TR8A 1XWLA 1I3AA 3PO5A 2P51A 3FFKB 4CIGA 1E4GT 1YJWN 3DLLL 2O8FA 1NGIA 4B9UA 1NKBA 1K73O 4IO8A 3I55N 3NDKA 3VQEA 4WCEL 2BDPA 3VEVA 3J81O 5M1KA 4JKEA 2W6LA 3OTOK 4FLXA 4NLCA 4R79A 1D4XA 5D3GA 3OS0A 4PQUA 1U49A 3I8BA 3ENBA 1F21A 2ZJPL 2P9SA 2ZJQL 1RBUA 3J7ZO 4BRQA 1DTQA 4CGFA 3QEVA 4I9LA 5FLXO 1VQ7N 4BWMA 4KREA 3L4IA 3AVBA 1N6QA 3LDQA 3QIOA 1YTUA 5AQVA 4FLTA 1MWKA 3EL2A 5K14A 1SV5A 3MEGA 4JI5K 3VQPA 3QMLA 4BROA 3VGMA 3KD1E 1D9DA 3MX2A 4HCCA 2DPNA 4E1JA 2ASOA 1JLAA 2YHAA 2HHHK 1BL3A 1NLVA 4GW6A 2UUCK 2PYLA 3EE8A 4YOXA 1EX4A 3LP1A 2O4GA 3VEZA 3OYAA 1BCOA 4JAXA 4K42A 2X78A 3A5NC 4NYNA 3SNNA 1IH7A 1JLBA 4F8RA 2E1YA 3CJAA 3PIPL 4DR6K 1ASVA 3CJ1A 5FPNA 3H1QA 4H8KA 1NGFA 1ATNA 2I5JA 4KTZA 2D1KA 4Q5VA 4M45A 4NCAA 3LALA 3THYA 1VQ5N 3AA5X 2HBKA 3A8YA 1BDGA 2HBMA 4J2AA 2D0CA 2PZSA 2NUBA 3AVNA 4F4KA 2CH6A 4IFEA 1GOCA 5GAEP 4FW2A 3WEEA 2QXLA 3AA4A 2GUPA 1OKJA 4H03B 3L6QA 3ZSWA 2E6LA 4FWRA 1G99A 3ZETA 4DFKA 4B1WB 5C0YA 3O9RA 3L2VA 4I6MB 4WQ5A 3HBTA 1RDBA 5DMRA 3S9HA 3C7NA 4KI4A 3CXCM 4BDYA 2P9IB 1RT2A 2ASMA 4CIFA 3SUPA 4K43A 1BA0A 3SV3A 1NM1A 1NJWA 3L8BA 3DAWA 1NK9A 1E3MA 2RPIA 2EWSA 4JI7K 2Q0RA 2QI2A 5I9EB 3OYIA 3R1XA 4B9TA 3PIOL 4CHNA 2YNFA 1L3TA 3MAQA 3HK2A 2V51B 4WFNL 1S6QA 3TAMA 4NCGA 4AQYK 5EU7A 4WE1A 2FBYA 1QTMA 1JLFA 4H5RA 2E2NA 3CPWM 2RKIA 2QWQA 4JKGA 5KGWA 4BC4A 3M8SA 4FK0A 3JSMA 4H5WA 5AQWA 3DLBA 1YTAA 5AQKA 2XRIA 3MWPA 3JXUA 4IDKA 3U3GA 4E1MA 5KQ8A 3CC4N 4CZGA 1HPZA 3I0SA 4ISGA 3CCUN 1Q9YA 4ELVA 3EY1A 3VQ6A 3P38A 3KLFA 3EYZA 3THXB 3WQTA 3EZWA 3GE1A 3VQ7A 3CM5A 2G8UA 4BE2A 3VF2A 3ISNC 3VOVA 1NJZA 2IAJA 4O55A 1QSSA 1WLJA 1K8KA 4E7HA 4FJKA 3VA0A 4KB1A 2O4IA 2YJFA 4CJKA 2ZGZA 5BR9A 1NJIO 1XC3A 4MQ3A 1QHTA 1FKOA 3TWHA 4LFAK 4CF1A 3TU5A 2ZWHA 2QWRA 4C8LA 1WUAA 4BGBA 1IBMK 3ID8A 3T7ZA 3M1FA 1IKXA 1OH6A 2ITMA 3C6TA 3RR7A 4OGCA 2PFUA 4I2QA 1O13A 1QQMA 2NLXA 4DU4A 3CIPA 3OYJA 1Q9XA 2Z1GA 1VSJA 2VQEK 4IKFA 2O8BA 1B9FA 2YKNA 3TAPA 2FSJA 1SKWA 3O1WA 3HI0A 4KFBA 3K58A 3CCJN 1VQKN 4B3MK 4RW7A 3L2RA 2XO7A 3BGRA 5BPMA 3TTCA 1FW6A 4ILGB 2WTUA 2JLEA 3TABA 1S1XA 3BZCA 3KLHA 2ZJRL 4H0TB 4BRFA 1HNWK 3TAEA 4DSJA 4LC9B 1WSIA 3IG1A 3VPZA 3TI0A 1VQ8N 1KFSA 4LF4K 3RVCA 1IBLK 4DSLA 3D2EB 4B08A 3O9TA 5KTQA 3BF1A 3QBWA 2KKZA 3O4WA 3O9QA 3WXLA 4DUZK 2VWJA 3L3UA 1X3NA 3LM9A 4HVJA 4JS4A 1WSEA 3OS1A 5FROA 1P8ZA 1GLAG 3QLHA 4CEDA 5LMUK 3AAQA 3QFUA 3CMEN 4JNEA 4NXNK 1KRPA 5JMVA 4CF0A 3DI6A 5M1PA 1YJNN 1KC8O 2O8EB 1YF5L 2GX9A 1TKXA 2OPPA 1NNEA 4O0JA 4BRHA 3V9ZA 1EKEA 2GWKA 5J2QA 4O5BA 3ULEA 4CZJA 2XY5A 4OVLA 4E7LA 4CJ3A 3PO4A 4E3SA 1HYVA 4B1YB 3ASMA 4CZLA 4HUGA 1CXUA 1ZYQA 5FPMA 2UXCK 1OVYA 1WAFA 3OJUA 4FJMA 2HHWA 1BQNA 4AHVA 2P9PB 4B8CA 4BC5A 1Q81O 3T19A 1K8AO 2BH1A 4FOEA 1T8EA 3HYFA 2Q3SA 4FZZA 4U7BA 5GIPA 3CQ8A 4KHQA 2HHVA 3U3YA 4J2BA 4JD2B 3HOSA 3OYMA 4FLZA 3S3NA 5EVZA 1YT3A 4N76A 3OYDA 2F9WA 2YKMA 2NZTA 1YJ9N 1JL2A 1NOYA 4BR0A 3RR8A 3LP2A 1M1KO 3NGIA 3KK2A 1S1VA 2J4RA 3ZT1A 1FJGK 4GNIA 4DKWA 4B3OA 3MXIA 4FWNA 3U6FA 1NK8A 3CM6A 1XMQK 2YCHA 2VGNA 4H4OA 4DSFA 1RBVA 1WSGA 1D9FA 1BGXT 1SL2A 1DLOA 3AO5A 4CESA 4CJFA 3H3OB 4FWPA 2G8HA 4F3OA 1NGAA 3UKRB 1SS6A 2QM1A 3PY8A 3LDNA 5KPRA 2QKKA 3FZFA 3CCVN 4IZ9A 1BI4B 4IXCA 5C42A 4DV7K 4FJ8A 5AZIB 3VEOA 5H1SQ 1W0HA 3S3OA 3CC7N 3SBGA 1QSYA 5EY4A 4EHUA 1QQCA 1OH7A 4BC3A 4OKJA 3KTQA 4FWMA 4Q0BA 4BRMA 3E01A 4X65K 2FSKA 4OX9K 1EWRA 2HNDA 1MDUB 2A5XA 4JKAA 1CZBA 3EO3A 3SBTA 3CCQN 1YIJN 3DWLA 4BR4A 1NGJA 2UXBK 4FZXC 1RT3A 3C0BA 3M8RA 2P9KB 3KK1A 2IVNA 1VQNN 5AJ3K 2YHBA 2ATQA 1L3VA 4YY3K 2KLAA 2YNGA 3JS6A 1IV0A 3BDPA 3IFRA 4JKDA 4FJJA 5MLCQ 3VN5A 4M3TA 4Z4GA 3BZKA 3F5TA 4HWIA 4DR7K 3AGKA 2DFEA 4LF8K 4BG8A 4CZFA 4JI0K 4IG3A 3CJ9A 3VMFB 4CZMA 4C8MA 1YVUA 4CF8A 5FPEA 3CCRN 4FJLA 3V1QA 4FPBA 1U47A 3CQXA 4EIAA 3V9XA 2ZQBA 3QB0A 4ID1A 4M63C 4WQ4C 2JGUA 1C0FA 2W42A 2QW9A 4CJUA 2XY6A 5EOYA 4V19S 1VQPN 5HRSA 4BACA 4CJPA 5AQJA 2VCPA 3HVTA 2F7TA 2JWKA 4A2AA 4FK2A 4A59A 4DCHA 2E6MA 1RTJA 1I39A 1Q86O 3D7EO 2ZF5O 3HPHA 1XQSC 2Z1IA 4B1UB 5GADP 3GBTA 4W5NA 5EXWA 4FWQA 1MU2A 5CZ1A 5GINA 4DFMA 3E1YA 2OYQA 2H3GX 1HKBA 1LWCA 4DSIA 1ZBLA 3AARA 5AZJA 2Y1IA 3FFIA 3SAFA 4M41A 4PKGA 5HRPA 3LL3A 1RDUA 1B9DA 4YDUC 4E1NA 4KH4A 3NVKA 2W6KA 5BR8K 2O8DB 1KFDA 3VA3A 3NCIA 4EZ6A 3ZYYX 2VG7A 2ETJA 5CHIA 2YHXA 3NH1A 1WOQA 3PUFA 3HZ6A 3UKUA 3VQ8A 4KV8A 1TYQA 4H0OA 1VSIA 3E9OA 3M8QA 4CGIA 3N4QA 1XUPO 4JYAK 1Y97A 4QS8A 1N32K 3AV9A 2F4VK 3K57A 1QE1A 3RMDA 3O4NA 3QNOA 2P9UB 4NB4A 4FJGA 1TV6A 1NK5A 3V6DA 4NCBA 3TAGA 3L0QA 3D6RA 1J53A 5CR4A 4ZTJA 1TUYA 4MLHA 3NGYA 4DV6K 3G4SN 4DTXA 2FC0A 2OCEA 1Z26A 2ZM6K 1A5WA 3S41A 3WXJA 1GLCG 1VQ4N 1QQNA 2A42A 1UWBA 5M1FA 1JLCA 3CF5L 1WSFA 3ZLJA 3HOTA 3A5OC 1LAVA 3TSUA 4W5TA 1BOTO 3KLGA 1UAXA 3ZX0A 3NH2A 1U4BA 3ZEUB 3WUHA 4YHHK 3G0ZA 5LY3A 1UA0A 1VRTA 3VQ5A 3T1YK 3PX6A 4BQZA 4X62K 1C0MA 3RMAA 3OYLA 1WN7A 4HHTA 4JI3K 3K0SA 3RSEB 4FL9A 3ENHA 2VG5A 2G8KA 1ZBIA 3VEYA 1CZ9A 3KKSA 4FVMA 2QWPA 1J54A 3B6PA 3O9SA 4PL7A 2O8CA 3PSIA 1S1WA 4DV3K 4A5BA 1U2VA 3MN6A 1IO2A 3SUOA 1C0TA 3AA3A 2O8FB 3C94A 2HBLA 4BRNA 3NMUA 1S5JA 3THWA 4H0PA 2GELA 2E20A 1RT1A 1BU6O 3OYNA 3AGRA 2V52B 4FWLA 2P9SB 4FZYA 4BRAA 1YHQN 4LD0A 1Q7YO 3PV8A 3AY9A 3MDQA 2B6AA 3SLCA 4PY5A 4CEBA 3WXMB 4DTPA 1KXPA 2AA4A 1BA1A 4JK9A 3L4QA 3OA9A 4YOWA 2GV9A 1N8RO 5BN8A 4B9MA 4YNQA 2KFZA 5CYMA 1TKTA 3LWMA 3NAEA 4EAHD 4U67L 5C2FA 4DU1A 4DTUA 2VYPA 2UUBK 4K8XA 5AQRA 4QCLA 3J7AP 5HBMA 5JS2A 4JN4A 4JS5A 5HP1A 4I9QA 1S9GA 4WFAL 3AO1A 4C1NK 4B1VA 1RT4A 4DV2K 4K8ZA 1XHXA 4XEIA 1N34K 2E1ZA 1QHAA 2R7YA 4H0YB 4DV5K 2G8VA 4PA1A 4DLEA 4B1ZA 1WB9A 4DV4K 1JCGA 3TPQA 4H5NA 4CFAA 4RW8A 2A41A 2OANA 3VQCA 4M7YA 4B9VA 2DTUA 4JLHA 3V81A 3AO3A 4IOCL 4KRFA 4B9QA 4O8UA 4BR7A 2KW4A 3THYB 2OPQA 2V7YA 2OA8A 1IKVA 1RBSA 2Q97A 5TKWA 2DY4A 1HNVA 4FWSA 1VSFA 1J6ZA 1LW0A 4CEQA 4KB0A 3BUZB 3CHWA 4BE0A 4ID5A 4IO9L 1TKZA 2NNWA 1N33K 3JYTA 4E0DA 1C0GA 1SL1A 3WEEB 3KJVA 4CF2A 3AA2A 5GAHP 1WBDA 4OLAA 3A0IX 3CFPA 4LF7K 3SI6A 3DXKA 2BTFA 3C7NB 1RDDA 3A5LC 1IKWA 3PSFA 3TAFA 3LP0A 1JLQA 2FBXA 2E2QA 3V4IA 4CZEA 3QICA 3L2QA 4Z94A 2AJQA 1NWKA 4CEZA 2FBTA 3OHRA 1BQMA 4LFBK 1QZ5A 1HRHA 2NRZA 4ELTA 1NOZA 4R5PA 5AQZA 2HNZA 2WFBA 2Z1JA 1W2BM 3SK3A 2IDOA 3ATUA 1HNXK 3SAHA 4IDHA 3NBPA 3FZLA 3O3FA 3VEXA 1CLQA 1RGIA 3ENOA 4I7FA 1FK9A 1TVRA 3QETA 4JKGB 3RRHA 3MMVA 3L2UA 2KFNA 4W5RA 4BR9A 4N56A 4OLBA 4RWTA 5A2QO 4DB3A 3H08A 2HF3A 1HR0K 2CH5A 2D0OA 3UE5A 1IKYA 3HRGA 4FW1A 3CPEA 3O80A 3O08A 2XHBA 4FJ9A 4PHTX 2QXFA 3H1VX 1TAQA 2D0AA 3M8PA 1Z05A 3CCEN 4AHCA 3DM2A 3OBYA 1KVAA 3VF6A 3QEIA 5ELZA 4CJ7A 3VQAA 3CCMN 1RDCA 4IWVA 2F8SA 3O1BA 2E4LA 3U9ZA 2RE2A 3AO2A 4FJIA 3UIQA 1HYZA 1S22A 3ZT2A 3LZIA 4KHPK 2OPRA 3HSTB 3QEWA 3UB5A 4EFHA 4L8RB 2P1JA 4BRDA 3HJFA 2QKBA 4DTJA 1HUXA 4C8OA 5AQQA 3G10A 3TSPA 1TKDA 2HW3A 2O8EA 4KO0A 4KH5A 3CI5A 4A62A 3WNHA 1C1CA 3CJBA 2O8BB 3VGLA 5HL7L 4JHDA 1HYSA 4EHTA 1Q82O 4WFBL 4DMNA 3I33A 2QA4N 4DV1K 3HM9A 5J2NA 4CEFA 1BIUA 2F96A 2XY8A 3LDPA 4DUYK 2QWLA 4IFVA 4RW9A 1T7PA 1DGKN 4B1XB 1QZ6A 5C10A 2PYJA 3DXMA 4H5VA 4CI6A 4CJWA 1NU0A 4O8KA 5AR0A 5FDLA 4A57A 3F9KA 3LPTA 2DFFA 3KIOA 4OKKA 4BDPA 4IOXA 2G8WA 1ZC6A 1U45A 2NRVA 5HRNA 4DQSA 1BHLA 1VSDA 3C6UA 3O3HA 3U4LA 1XI1A 1LWEA 3GG4A 4C8KA 5AQIA 1HNIA 1VSHA 1VQON 1RT7A 1EP4A 4M3ZA 4YFUA 4AHUA 1S3XA 3H6EA 2A1SA 1BIZA 3D2FA 2KZMA 4KTQA 5AQYA 1VAZA 4JKFA 4FSVA 5AQPA 1DKGD 4CVNE 4KHWA 4CERA 3KLIA 1ASUA 4JK7A 5C24A 5HRRA 3DLGA 4DTNA 4AM7A 3VEWA 1EQYA 1X3MA 4CHQA 4FLUA 1N36K 1KQSM 1TGOA 4BRLA 4DTRA 2QWNA 1ZBFA 5HROA 4FXDA 3AVMA 4HUEA 3P83D 5LL6Z 3ULEB 1KCFA 4OGEA 2GUIA 2QWMA 2FSNA 4AILC 5LJWA 2KTQA 1DT9A 3E9LA 5JVHL 3R3LA 3G25A 3R6MA 3DMJA 4J8FA 3P5JA 4DTMA 1RTHA 3OYFA 1ATSA 3GOIA 3MN9A 1P90A 3VETA 3PX4A 2KQ2A 2A1RA 1D5AA 1LCUA 4E7KA 2YNHA 2QK9A 3N4PA 4NXMK 3ZSQA 1S72N 4DS4A 4AF1A 3K9KA 1SKSA 1NK4A 1J5EK 2D5RA 2HHXA 1RILA 2VWKA 1KLNA 4LFCK 3A5MC 2X6SA 3SV4A 2BE2A 4CJLA 5C12A 1HX1A 5I42A 4OPJA 3QEXA 3VTIA 3EN9A 2WOMA 4IBNA 4JI4K 4BRKA 2G8IA 3NVMA 3CC2N 4JI1K 3EZ5A 3NGZA 4BRGA 3LDSA 5CYQA 3VQ4A 5I3UA 1W97L 3CQYA 5E84A 3FLCO 3ITHA 4PL8A 4DV0K 3HSCA 3V1OA 1MWMA 2LSNA 3P1GA 1XC9A 4AM6A 4PUOA 4RTFD 1HQUA
chains in the Genus database with same CATH topology
3ZCMA 4AHRA 1NJWA 3L8BA 1NK9A 2ITGA 1UWBA 3MEDA 3ZSOA 3V9WA 2RPIA 1JLCA 3LAMA 1O1WA 1WSFA 2IC3A 4F2SA 4DLGA 1LAVA 4W5TA 3KLGA 1UAXA 3OYIA 3NH2A 1U4BA 4B9TA 4CHNA 1Z25A 3QINA 2YNFA 1L3TA 1A5VA 2IGIA 3MAQA 3G0ZA 3HK2A 1UA0A 4M42A 1S6QA 1D8YA 3TAMA 1VRTA 4NCGA 5T7BA 1NKCA 4OJRA 3VQ5A 3ZSYA 5EU7A 4WE1A 3PX6A 3OVNA 2FBYA 3IS9A 1QTMA 1S1TA 4F2RA 1C0MA 1JLFA 3OYLA 3RMAA 1WN7A 4HHTA 4RG8A 4M3XA 4ICLA 3CFRA 2F8TA 4CFDA 2RKIA 5KGWA 4KHNA 4OPKA 3M8SA 2VG5A 1VRUA 4LH4A 3JSMA 4FK0A 2G8KA 1ZBIA 4KI6A 3KK3A 1CZ9A 1ASWA 3KKSA 4FJ5A 3DLBA 4FVMA 1YTAA 1J54A 3B6PA 2XRIA 4IDKA 3U3GA 4E1MA 2PY5A 1RTDA 3QERA 1HPZA 1S1WA 3I0SA 3NFAA 1Q9YA 4ELVA 3EY1A 3VQ6A 4B9LA 4AH9A 4EP4A 3KLFA 3EYZA 1IO2A 1ZBUA 4CK3A 3SUOA 4DQPA 4FJ7A 1C0TA 3AA3A 3DRPA 4FLWA 3C94A 3CM5A 1VSKA 3VQ7A 4UQGA 3SPYA 2G8UA 4LY7A 4DS5A 4BE2A 4E19A 3RRGA 3ISNC 2KZZA 1S5JA 1NJZA 4Z0UA 2IAJA 2YNIA 4O55A 3NH0A 1LAWA 3I8DA 1QSSA 1WLJA 4KHSA 3DRRA 1RT1A 1NJXA 4DQRA 4E7HA 4EZ9A 4FJKA 3ULDA 2RN2A 3VA0A 3V9SA 3OYNA 1Q8IA 4KB1A 4GVMA 3HVRA 2O4IA 4CJKA 4M3RA 4FZYA 4Z4HA 4MQ3A 4CCHA 1QHTA 1NK0A 4LD0A 1FKOA 3VQBA 3TWHA 3HO1A 5SWMA 4CF1A 3ZSXA 2EX3A 3PV8A 4C8LA 2B6AA 4J2EA 4HUFA 2B5JA 1JXBA 4CJSA 4Z4CA 4PY5A 3K5LA 4CEBA 3D45A 4DTPA 1FKPA 4O0IA 1IKXA 3SQ4A 4Y1CA 2HMIA 3C6TA 3RR7A 4OGCA 2GV9A 1GOAA 1RDAA 2IOCA 4I2QA 4B9MA 3DOLA 4YNQA 1BI4A 5CYMA 1TKTA 3CYMA 3LWMA 4M3WA 2HHVA 1RBTA 4O44A 3NAEA 1SL0A 2Z1HA 4DU1A 4DTUA 4K8XA 4FK4A 4QCLA 5E41A 1JLGA 4DU4A 5HBMA 5JS2A 3ZT3A 3OYJA 2B4JA 1Q9XA 4JS5A 5HP1A 2Z1GA 1VSJA 1NK6A 1A5XA 1S9GA 3SJJA 2OZSA 3AO1A 4IKFA 1B9FA 4F3TA 1RT4A 4K8ZA 3TAQA 2YKNA 1XHXA 3TAPA 1SKWA 3IRXA 4KFBA 3K58A 5KGXA 2R7YA 4CGHA 1R0AA 3OYBA 2HVHA 4RW7A 3L2RA 4J2DA 2XO7A 2G8VA 3BGRA 3KKRA 2Y1JA 4PA1A 3TABA 1VSLA 2JLEA 3MXMA 1S1XA 4DLEA 3DOKA 4CJRA 3KLHA 4FJXA 5HLFA 1FXXA 2RF2A 3TAEA 4CGDA 3QNNA 4DSJA 2HHUA 5C25A 3AVLA 3MXJA 4CFAA 1VK0A 1WSIA 3IG1A 4RW8A 3TI0A 1HMVA 3SQ1A 1KFSA 4CHPA 4DSEA 3VQCA 4B9VA 3NF8A 4B08A 4DQIA 4JLHA 4CEOA 3K2PA 3AVHA 4DSLA 2DTUA 3O4QA 4CGGA 5KTQA 3V81A 2EHGA 3KD5E 2P5OA 3AO3A 4KRFA 4CHYA 4PWDA 4KPYA 4NYFA 4CFBA 3DLKA 3ZT4A 2KW4A 1NKEA 2OPQA 4B9NA 1WSHA 4FJHA 4FM1A 4CK1A 1L5UA 1CXQA 2VWJA 3L3UA 1IKVA 3NF6A 4HVJA 3D0PA 4JS4A 2OA8A 1RBSA 5J1EA 1WSEA 2DY4A 1LW2A 3OS2A 1HNVA 3QIPA 5FROA 3OS1A 3AVGA 1K6YA 1VSFA 3SUNA 1LW0A 4CEQA 3QLHA 4CEDA 2D0BA 4KB0A 2BGGA 4BE0A 4LSLA 4FM2A 1QSLA 2GBZA 4ID5A 1S1UA 4W5OA 4CHOA 3O3GA 1TKZA 1VSEA 5CY4A 4BWJA 3JYTA 1BCMA 4E0DA 1ZBHA 1TL1A 3T3FA 1SL1A 1LWFA 1EXQA 3KJVA 3S3MA 1UA1A 5DK5A 4HTUA 3RTVA 1KRPA 5KRSA 4CF0A 1JLEA 4DTSA 2IS3A 3DI6A 4Z4FA 4CEEA 4CF2A 1KTQA 3AA2A 1TAUA 4OLAA 4FLYA 3CFPA 1TKXA 4CK2A 2OPPA 5SZTA 1RCHA 4CJ4A 3SI6A 4O0JA 1RDDA 1L3SA 3V9ZA 3DYAA 1EKEA 1IKWA 1WNSA 5J2QA 4XIUA 1GOBA 4O5BA 3TAFA 3SPZA 4JRPA 3LP0A 1JLQA 4CECA 1X9MA 2FBXA 3V4IA 1T03A 1IG9A 3L2WA 3L2QA 2XY5A 4OVLA 4E7LA 1N5YA 1JL1A 4CJ3A 3PO4A 4E3SA 2AJQA 1HYVA 4KHUA 4CEZA 2FBTA 3ZSZA 4KHYA 1BQMA 3IAYA 3ASMA 1HRHA 1S9EA 2BANA 3ALYA 4TSXA 1RT5A 4QAGA 1CXUA 4HUGA 1ZYQA 5KRTA 1TK5A 1T05A 3PX0A 1NOZA 4ELTA 1WAFA 3OJUA 4FJMA 2HHWA 1BQNA 4R5PA 3KLEA 3V9UA 3C95A 1J5OA 4IFYA 4AHVA 1RTIA 2HNZA 1TK0A 1WAJA 4B8CA 2Z1JA 2HVIA 2IDOA 3T19A 3OYEA 4AHTA 4CEAA 4CFCA 5FRMA 1C0UA 3NBPA 3O3FA 1CLQA 4DFPA 1SKRA 4B8AB 1T8EA 3HYFA 4I9QA 3RMCA 4FM0A 1KSPA 4CJEA 4I7FA 1FK9A 1TVRA 3LAKA 4CF9A 4DFJA 2Q3SA 4FZZA 3QETA 3RRHA 1ITGA 2YV0X 3VQQA 3CQ8A 3HP6A 3QESA 3U3YA 3SCXA 3L2UA 4CHZA 4J2BA 4KHQA 4QOZB 1KVCA 2KFNA 4W5RA 4EP5A 4N56A 4OLBA 2KFZA 4CIEA 3OYMA 1JXEA 1G15A 3B6OA 4FLZA 1NJYA 3H08A 3S3NA 3T1AA 1YT3A 4N76A 3OYDA 5J2PA 2HHSA 2YKMA 4DU3A 5J2MA 4ELUA 5FRNA 1IKYA 1JL2A 1NOYA 2ZD1A 3AVCA 3RR8A 4FW1A 3A2FA 3LP2A 2XHBA 3OY9A 4FJ9A 4ZHRA 3NGIA 3KK2A 3HPGA 4FLVA 1S1VA 1UOCA 4E7IA 2QXFA 1EETA 1TAQA 3ZT1A 2D0AA 3M8PA 3WNGA 3SQ0A 4AHCA 4B3OA 1C6VA 1TK8A 4MFBA 1L3UA 3DM2A 4KTWA 3MXIA 4ZTFA 1KVAA 3QEIA 3V1RA 3U6FA 1NK7A 1U04A 3NHGA 3HXMA 3VQAA 1NK8A 1RDCA 3CM6A 3CG7A 2F8SA 3F73A 2E4LA 4H4OA 3AO2A 4GMJB 1LV5A 4DSFA 1J9AA 1RBVA 2DFHA 4FJIA 3UIQA 1HYZA 1WSGA 3DRSA 1QS4A 3ZT2A 3QO9A 4C8NA 3K59A 1D9FA 1BGXT 3LZIA 1BISA 1SL2A 4Z4IA 1DLOA 3AO5A 4CESA 4CJFA 3TANA 1SUQA 3I0RA 2OPRA 3HSTB 2G8HA 4F3OA 3QEWA 3K5NA 1WSJA 3RWUA 5KI6A 3LPUA 3ZSVA 3PY8A 4L8RB 4OKEA 4CJQA 2P1JA 2QKKA 4BE1A 3HJFA 2QKBA 1XHZA 1BI4B 4HCBA 3LP3A 5C42A 2HNYA 4BDZA 4DTJA 4C8OA 3AVJA 4FJ8A 1W0HA 4LH5A 3S3OA 3G10A 1TKDA 1QSYA 2HW3A 3AVKA 1QQCA 4KO0A 1X1PA 3HP9A 3WNHA 4OKJA 3KTQA 1C1CA 4M3UA 3LANA 4CJTA 4Y1DA 1RNHA 1W9HA 3NF9A 4M3YA 4Q0BA 1HYSA 3E01A 4O4GA 4E89A 4CJVA 3K5MA 2HNDA 4DMNA 5JS1A 3VQ9A 2OPSA 3HM9A 4KAZA 3OYGA 3TR8A 5J2NA 1XWLA 1CZBA 1I3AA 4CEFA 3PO5A 3DLRA 2P51A 1BIUA 2F96A 2X6NA 2XY8A 4FZXC 1REVA 1RT3A 4CIGA 5D3GA 3M8RA 4N41A 3LWLA 4N5SA 3KK1A 4IFVA 4KKOA 4RW9A 3L3VA 5CZ2A 1T7PA 4B9UA 2YHBA 4DTOA 2X74A 2ATQA 3HT3A 1NKBA 1L3VA 2PYJA 3NDKA 4RW4A 3VQEA 4CJWA 5FDLA 2YNGA 3HPOA 2BDPA 3BDPA 3F9KA 4FJJA 3OYHA 3LPTA 2DFFA 3VN5A 4M3TA 4Z4GA 3KIOA 4IG0A 3AVFA 4OKKA 4BDPA 3SQ2A 4FLXA 2G8WA 2OZMA 4AHSA 1HQEA 2DFEA 3OYKA 1U45A 5HRNA 3OS0A 4DQSA 1U49A 1BHLA 3DLHA 1VSDA 4PQUA 3C6UA 3O3HA 1F21A 1S6PA 1XI1A 4IG3A 1LWEA 1RBUA 4Z4EA 4CE9A 1DTQA 1KVBA 4G1QA 4C8MA 4CGFA 1YVUA 1C1AA 4CF8A 3QEVA 1HNIA 4C8KA 1VSHA 4FJLA 1RT7A 1EP4A 4M3ZA 4I9LA 3V1QA 1RT6A 1U47A 4YFUA 4AHUA 3V9XA 2ZQBA 4BWMA 2A1SA 4DQQA 1BIZA 4KREA 3NE6A 4ID1A 3AVBA 3MEEA 2JGUA 2KZMA 1B92A 3ZSRA 2W42A 2WONA 4KTQA 3K5OA 4CJUA 2XY6A 3QIOA 1N6QA 1YTUA 3OJSA 3QEPA 4FLTA 5HRSA 4BACA 5K14A 4CJPA 4KHWA 1SV5A 4CERA 1TL3A 3HVTA 3KLIA 3MEGA 3AO4A 1ASUA 5C24A 3VQPA 4FK2A 5HRRA 2E6MA 3DLGA 3ZT0A 1RTJA 4DTNA 4FLUA 4CHQA 1I39A 1RBRA 4DSKA 2P5GA 3AVAA 3HPHA 1TGOA 4DTRA 3KD1E 1D9DA 1JKHA 1ZBFA 2Z1IA 5HROA 4HCCA 4CGJA 4FXDA 4E7JA 4LSNA 3AVMA 4W5NA 1JLAA 2YHAA 3P83D 1BL3A 1MU2A 4GW6A 5CZ1A 4HUEA 2PYLA 4FYDA 4DFMA 1KCFA 2OYQA 1EX4A 3LP1A 2O4GA 4OGEA 2GUIA 3OYAA 1BCOA 1LWCA 4AILC 4DSIA 1ZBLA 2KTQA 2Y1IA 1C1BA 3FFIA 3VQDA 2X78A 4M41A 2HB5A 3SNNA 5HRPA 1IH7A 1B9DA 1JLBA 4F8RA 3DMJA 3HL8A 1X9SA 1ASVA 4E1NA 3P5JA 1KLMA 1VSMA 4DTMA 1RTHA 3OYFA 4H8KA 3SUQA 1DTTA 1KFDA 2I5JA 2VG6A 3VA3A 4KTZA 3NCIA 4FCYA 3PX4A 2KQ2A 4M45A 1D5AA 4Q5VA 3OYCA 2A1RA 3LZJA 4EZ6A 4E7KA 4NCAA 2VG7A 3LALA 2G8FA 3TARA 2ETJA 2YNHA 4JRQA 3ZSQA 4B9SA 1HJRA 3AA5X 4DS4A 2QK9A 3NH1A 4H4MA 4FJNA 4CJ5A 3PUFA 2FBVA 3VQ8A 4DF4A 1SKSA 1U48A 4DWIA 4J2AA 4RW6A 1NK4A 4KV8A 2D0CA 2PZSA 2D5RA 1VSIA 2HHXA 1RILA 3M8QA 2VWKA 3WNEA 1KLNA 2NUBA 2X6SA 3SV4A 3AVNA 4CGIA 4F4KA 2BE2A 3MECA 4CJLA 1Y97A 5I42A 4N47A 4OPJA 3QEXA 1GOCA 3AV9A 3DLEA 4FW2A 3K57A 3SZ2A 1QE1A 3RMDA 3O4NA 3QNOA 4W5QA 2WOMA 3AA4A 3AVIA 4IBNA 1X9WA 2G8IA 3NF7A 4FJGA 1TV6A 1NK5A 3ZSWA 2E6LA 3V6DA 4NCBA 4I2PA 3TAGA 3EZ5A 3RMBA 3NGZA 3LDSA 5CYQA 2XY7A 1J53A 3VQ4A 4DFKA 3THVA 5I3UA 2HHTA 4ZTJA 3SYZA 3L2VA 3NGYA 4DTXA 1RDBA 2FC0A 3ITHA 5DMRA 3S9HA 4DG1A 4KI4A 2HHQA 3V1OA 1Z26A 2ZE2A 4BDYA 1A5WA 1RT2A 2LSNA 3P1GA 4CIFA 3CFOA 3SUPA 1XC9A 3WNFA 4PUOA 4DF8A 3SV3A 4NYNA 1HQUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZCM A;  4AHR A;  1NJW A;  3L8B A;  1NK9 A;  2ITG A;  1UWB A;  3MED A;  3ZSO A;  3V9W A;  2RPI A;  1JLC A;  3LAM A;  1O1W A;  1WSF A;  2IC3 A;  4F2S A;  4DLG A;  1LAV A;  4W5T A;  3KLG A;  1UAX A;  3OYI A;  3NH2 A;  1U4B A;  4B9T A;  4CHN A;  1Z25 A;  3QIN A;  2YNF A;  1L3T A;  1A5V A;  2IGI A;  3MAQ A;  3G0Z A;  3HK2 A;  1UA0 A;  4M42 A;  1S6Q A;  1D8Y A;  3TAM A;  1VRT A;  4NCG A;  5T7B A;  1NKC A;  4OJR A;  3VQ5 A;  3ZSY A;  5EU7 A;  4WE1 A;  3PX6 A;  3OVN A;  2FBY A;  3IS9 A;  1QTM A;  1S1T A;  4F2R A;  1C0M A;  1JLF A;  3OYL A;  3RMA A;  1WN7 A;  4HHT A;  4RG8 A;  4M3X A;  4ICL A;  3CFR A;  2F8T A;  4CFD A;  2RKI A;  5KGW A;  4KHN A;  4OPK A;  3M8S A;  2VG5 A;  1VRU A;  4LH4 A;  3JSM A;  4FK0 A;  2G8K A;  1ZBI A;  4KI6 A;  3KK3 A;  1CZ9 A;  1ASW A;  3KKS A;  4FJ5 A;  3DLB A;  4FVM A;  1YTA A;  1J54 A;  3B6P A;  2XRI A;  4IDK A;  3U3G A;  4E1M A;  2PY5 A;  1RTD A;  3QER A;  1HPZ A;  1S1W A;  3I0S A;  3NFA A;  1Q9Y A;  4ELV A;  3EY1 A;  3VQ6 A;  4B9L A;  4AH9 A;  4EP4 A;  3KLF A;  3EYZ A;  1IO2 A;  1ZBU A;  4CK3 A;  3SUO A;  4DQP A;  4FJ7 A;  1C0T A;  3AA3 A;  3DRP A;  4FLW A;  3C94 A;  3CM5 A;  1VSK A;  3VQ7 A;  4UQG A;  3SPY A;  2G8U A;  4LY7 A;  4DS5 A;  4BE2 A;  4E19 A;  3RRG A;  3ISN C;  2KZZ A;  1S5J A;  1NJZ A;  4Z0U A;  2IAJ A;  2YNI A;  4O55 A;  3NH0 A;  1LAW A;  3I8D A;  1QSS A;  1WLJ A;  4KHS A;  3DRR A;  1RT1 A;  1NJX A;  4DQR A;  4E7H A;  4EZ9 A;  4FJK A;  3ULD A;  2RN2 A;  3VA0 A;  3V9S A;  3OYN A;  1Q8I A;  4KB1 A;  4GVM A;  3HVR A;  2O4I A;  4CJK A;  4M3R A;  4FZY A;  4Z4H A;  4MQ3 A;  4CCH A;  1QHT A;  1NK0 A;  4LD0 A;  1FKO A;  3VQB A;  3TWH A;  3HO1 A;  5SWM A;  4CF1 A;  3ZSX A;  2EX3 A;  3PV8 A;  4C8L A;  2B6A A;  4J2E A;  4HUF A;  2B5J A;  1JXB A;  4CJS A;  4Z4C A;  4PY5 A;  3K5L A;  4CEB A;  3D45 A;  4DTP A;  1FKP A;  4O0I A;  1IKX A;  3SQ4 A;  4Y1C A;  2HMI A;  3C6T A;  3RR7 A;  4OGC A;  2GV9 A;  1GOA A;  1RDA A;  2IOC A;  4I2Q A;  4B9M A;  3DOL A;  4YNQ A;  1BI4 A;  5CYM A;  1TKT A;  3CYM A;  3LWM A;  4M3W A;  2HHV A;  1RBT A;  4O44 A;  3NAE A;  1SL0 A;  2Z1H A;  4DU1 A;  4DTU A;  4K8X A;  4FK4 A;  4QCL A;  5E41 A;  1JLG A;  4DU4 A;  5HBM A;  5JS2 A;  3ZT3 A;  3OYJ A;  2B4J A;  1Q9X A;  4JS5 A;  5HP1 A;  2Z1G A;  1VSJ A;  1NK6 A;  1A5X A;  1S9G A;  3SJJ A;  2OZS A;  3AO1 A;  4IKF A;  1B9F A;  4F3T A;  1RT4 A;  4K8Z A;  3TAQ A;  2YKN A;  1XHX A;  3TAP A;  1SKW A;  3IRX A;  4KFB A;  3K58 A;  5KGX A;  2R7Y A;  4CGH A;  1R0A A;  3OYB A;  2HVH A;  4RW7 A;  3L2R A;  4J2D A;  2XO7 A;  2G8V A;  3BGR A;  3KKR A;  2Y1J A;  4PA1 A;  3TAB A;  1VSL A;  2JLE A;  3MXM A;  1S1X A;  4DLE A;  3DOK A;  4CJR A;  3KLH A;  4FJX A;  5HLF A;  1FXX A;  2RF2 A;  3TAE A;  4CGD A;  3QNN A;  4DSJ A;  2HHU A;  5C25 A;  3AVL A;  3MXJ A;  4CFA A;  1VK0 A;  1WSI A;  3IG1 A;  4RW8 A;  3TI0 A;  1HMV A;  3SQ1 A;  1KFS A;  4CHP A;  4DSE A;  3VQC A;  4B9V A;  3NF8 A;  4B08 A;  4DQI A;  4JLH A;  4CEO A;  3K2P A;  3AVH A;  4DSL A;  2DTU A;  3O4Q A;  4CGG A;  5KTQ A;  3V81 A;  2EHG A;  3KD5 E;  2P5O A;  3AO3 A;  4KRF A;  4CHY A;  4PWD A;  4KPY A;  4NYF A;  4CFB A;  3DLK A;  3ZT4 A;  2KW4 A;  1NKE A;  2OPQ A;  4B9N A;  1WSH A;  4FJH A;  4FM1 A;  4CK1 A;  1L5U A;  1CXQ A;  2VWJ A;  3L3U A;  1IKV A;  3NF6 A;  4HVJ A;  3D0P A;  4JS4 A;  2OA8 A;  1RBS A;  5J1E A;  1WSE A;  2DY4 A;  1LW2 A;  3OS2 A;  1HNV A;  3QIP A;  5FRO A;  3OS1 A;  3AVG A;  1K6Y A;  1VSF A;  3SUN A;  1LW0 A;  4CEQ A;  3QLH A;  4CED A;  2D0B A;  4KB0 A;  2BGG A;  4BE0 A;  4LSL A;  4FM2 A;  1QSL A;  2GBZ A;  4ID5 A;  1S1U A;  4W5O A;  4CHO A;  3O3G A;  1TKZ A;  1VSE A;  5CY4 A;  4BWJ A;  3JYT A;  1BCM A;  4E0D A;  1ZBH A;  1TL1 A;  3T3F A;  1SL1 A;  1LWF A;  1EXQ A;  3KJV A;  3S3M A;  1UA1 A;  5DK5 A;  4HTU A;  3RTV A;  1KRP A;  5KRS A;  4CF0 A;  1JLE A;  4DTS A;  2IS3 A;  3DI6 A;  4Z4F A;  4CEE A;  4CF2 A;  1KTQ A;  3AA2 A;  1TAU A;  4OLA A;  4FLY A;  3CFP A;  1TKX A;  4CK2 A;  2OPP A;  5SZT A;  1RCH A;  4CJ4 A;  3SI6 A;  4O0J A;  1RDD A;  1L3S A;  3V9Z A;  3DYA A;  1EKE A;  1IKW A;  1WNS A;  5J2Q A;  4XIU A;  1GOB A;  4O5B A;  3TAF A;  3SPZ A;  4JRP A;  3LP0 A;  1JLQ A;  4CEC A;  1X9M A;  2FBX A;  3V4I A;  1T03 A;  1IG9 A;  3L2W A;  3L2Q A;  2XY5 A;  4OVL A;  4E7L A;  1N5Y A;  1JL1 A;  4CJ3 A;  3PO4 A;  4E3S A;  2AJQ A;  1HYV A;  4KHU A;  4CEZ A;  2FBT A;  3ZSZ A;  4KHY A;  1BQM A;  3IAY A;  3ASM A;  1HRH A;  1S9E A;  2BAN A;  3ALY A;  4TSX A;  1RT5 A;  4QAG A;  1CXU A;  4HUG A;  1ZYQ A;  5KRT A;  1TK5 A;  1T05 A;  3PX0 A;  1NOZ A;  4ELT A;  1WAF A;  3OJU A;  4FJM A;  2HHW A;  1BQN A;  4R5P A;  3KLE A;  3V9U A;  3C95 A;  1J5O A;  4IFY A;  4AHV A;  1RTI A;  2HNZ A;  1TK0 A;  1WAJ A;  4B8C A;  2Z1J A;  2HVI A;  2IDO A;  3T19 A;  3OYE A;  4AHT A;  4CEA A;  4CFC A;  5FRM A;  1C0U A;  3NBP A;  3O3F A;  1CLQ A;  4DFP A;  1SKR A;  4B8A B;  1T8E A;  3HYF A;  4I9Q A;  3RMC A;  4FM0 A;  1KSP A;  4CJE A;  4I7F A;  1FK9 A;  1TVR A;  3LAK A;  4CF9 A;  4DFJ A;  2Q3S A;  4FZZ A;  3QET A;  3RRH A;  1ITG A;  2YV0 X;  3VQQ A;  3CQ8 A;  3HP6 A;  3QES A;  3U3Y A;  3SCX A;  3L2U A;  4CHZ A;  4J2B A;  4KHQ A;  4QOZ B;  1KVC A;  2KFN A;  4W5R A;  4EP5 A;  4N56 A;  4OLB A;  2KFZ A;  4CIE A;  3OYM A;  1JXE A;  1G15 A;  3B6O A;  4FLZ A;  1NJY A;  3H08 A;  3S3N A;  3T1A A;  1YT3 A;  4N76 A;  3OYD A;  5J2P A;  2HHS A;  2YKM A;  4DU3 A;  5J2M A;  4ELU A;  5FRN A;  1IKY A;  1JL2 A;  1NOY A;  2ZD1 A;  3AVC A;  3RR8 A;  4FW1 A;  3A2F A;  3LP2 A;  2XHB A;  3OY9 A;  4FJ9 A;  4ZHR A;  3NGI A;  3KK2 A;  3HPG A;  4FLV A;  1S1V A;  1UOC A;  4E7I A;  2QXF A;  1EET A;  1TAQ A;  3ZT1 A;  2D0A A;  3M8P A;  3WNG A;  3SQ0 A;  4AHC A;  4B3O A;  1C6V A;  1TK8 A;  4MFB A;  1L3U A;  3DM2 A;  4KTW A;  3MXI A;  4ZTF A;  1KVA A;  3QEI A;  3V1R A;  3U6F A;  1NK7 A;  1U04 A;  3NHG A;  3HXM A;  3VQA A;  1NK8 A;  1RDC A;  3CM6 A;  3CG7 A;  2F8S A;  3F73 A;  2E4L A;  4H4O A;  3AO2 A;  4GMJ B;  1LV5 A;  4DSF A;  1J9A A;  1RBV A;  2DFH A;  4FJI A;  3UIQ A;  1HYZ A;  1WSG A;  3DRS A;  1QS4 A;  3ZT2 A;  3QO9 A;  4C8N A;  3K59 A;  1D9F A;  1BGX T;  3LZI A;  1BIS A;  1SL2 A;  4Z4I A;  1DLO A;  3AO5 A;  4CES A;  4CJF A;  3TAN A;  1SUQ A;  3I0R A;  2OPR A;  3HST B;  2G8H A;  4F3O A;  3QEW A;  3K5N A;  1WSJ A;  3RWU A;  5KI6 A;  3LPU A;  3ZSV A;  3PY8 A;  4L8R B;  4OKE A;  4CJQ A;  2P1J A;  2QKK A;  4BE1 A;  3HJF A;  2QKB A;  1XHZ A;  1BI4 B;  4HCB A;  3LP3 A;  5C42 A;  2HNY A;  4BDZ A;  4DTJ A;  4C8O A;  3AVJ A;  4FJ8 A;  1W0H A;  4LH5 A;  3S3O A;  3G10 A;  1TKD A;  1QSY A;  2HW3 A;  3AVK A;  1QQC A;  4KO0 A;  1X1P A;  3HP9 A;  3WNH A;  4OKJ A;  3KTQ A;  1C1C A;  4M3U A;  3LAN A;  4CJT A;  4Y1D A;  1RNH A;  1W9H A;  3NF9 A;  4M3Y A;  4Q0B A;  1HYS A;  3E01 A;  4O4G A;  4E89 A;  4CJV A;  3K5M A;  2HND A;  4DMN A;  5JS1 A;  3VQ9 A;  2OPS A;  3HM9 A;  4KAZ A;  3OYG A;  3TR8 A;  5J2N A;  1XWL A;  1CZB A;  1I3A A;  4CEF A;  3PO5 A;  3DLR A;  2P51 A;  1BIU A;  2F96 A;  2X6N A;  2XY8 A;  4FZX C;  1REV A;  1RT3 A;  4CIG A;  5D3G A;  3M8R A;  4N41 A;  3LWL A;  4N5S A;  3KK1 A;  4IFV A;  4KKO A;  4RW9 A;  3L3V A;  5CZ2 A;  1T7P A;  4B9U A;  2YHB A;  4DTO A;  2X74 A;  2ATQ A;  3HT3 A;  1NKB A;  1L3V A;  2PYJ A;  3NDK A;  4RW4 A;  3VQE A;  4CJW A;  5FDL A;  2YNG A;  3HPO A;  2BDP A;  3BDP A;  3F9K A;  4FJJ A;  3OYH A;  3LPT A;  2DFF A;  3VN5 A;  4M3T A;  4Z4G A;  3KIO A;  4IG0 A;  3AVF A;  4OKK A;  4BDP A;  3SQ2 A;  4FLX A;  2G8W A;  2OZM A;  4AHS A;  1HQE A;  2DFE A;  3OYK A;  1U45 A;  5HRN A;  3OS0 A;  4DQS A;  1U49 A;  1BHL A;  3DLH A;  1VSD A;  4PQU A;  3C6U A;  3O3H A;  1F21 A;  1S6P A;  1XI1 A;  4IG3 A;  1LWE A;  1RBU A;  4Z4E A;  4CE9 A;  1DTQ A;  1KVB A;  4G1Q A;  4C8M A;  4CGF A;  1YVU A;  1C1A A;  4CF8 A;  3QEV A;  1HNI A;  4C8K A;  1VSH A;  4FJL A;  1RT7 A;  1EP4 A;  4M3Z A;  4I9L A;  3V1Q A;  1RT6 A;  1U47 A;  4YFU A;  4AHU A;  3V9X A;  2ZQB A;  4BWM A;  2A1S A;  4DQQ A;  1BIZ A;  4KRE A;  3NE6 A;  4ID1 A;  3AVB A;  3MEE A;  2JGU A;  2KZM A;  1B92 A;  3ZSR A;  2W42 A;  2WON A;  4KTQ A;  3K5O A;  4CJU A;  2XY6 A;  3QIO A;  1N6Q A;  1YTU A;  3OJS A;  3QEP A;  4FLT A;  5HRS A;  4BAC A;  5K14 A;  4CJP A;  4KHW A;  1SV5 A;  4CER A;  1TL3 A;  3HVT A;  3KLI A;  3MEG A;  3AO4 A;  1ASU A;  5C24 A;  3VQP A;  4FK2 A;  5HRR A;  2E6M A;  3DLG A;  3ZT0 A;  1RTJ A;  4DTN A;  4FLU A;  4CHQ A;  1I39 A;  1RBR A;  4DSK A;  2P5G A;  3AVA A;  3HPH A;  1TGO A;  4DTR A;  3KD1 E;  1D9D A;  1JKH A;  1ZBF A;  2Z1I A;  5HRO A;  4HCC A;  4CGJ A;  4FXD A;  4E7J A;  4LSN A;  3AVM A;  4W5N A;  1JLA A;  2YHA A;  3P83 D;  1BL3 A;  1MU2 A;  4GW6 A;  5CZ1 A;  4HUE A;  2PYL A;  4FYD A;  4DFM A;  1KCF A;  2OYQ A;  1EX4 A;  3LP1 A;  2O4G A;  4OGE A;  2GUI A;  3OYA A;  1BCO A;  1LWC A;  4AIL C;  4DSI A;  1ZBL A;  2KTQ A;  2Y1I A;  1C1B A;  3FFI A;  3VQD A;  2X78 A;  4M41 A;  2HB5 A;  3SNN A;  5HRP A;  1IH7 A;  1B9D A;  1JLB A;  4F8R A;  3DMJ A;  3HL8 A;  1X9S A;  1ASV A;  4E1N A;  3P5J A;  1KLM A;  1VSM A;  4DTM A;  1RTH A;  3OYF A;  4H8K A;  3SUQ A;  1DTT A;  1KFD A;  2I5J A;  2VG6 A;  3VA3 A;  4KTZ A;  3NCI A;  4FCY A;  3PX4 A;  2KQ2 A;  4M45 A;  1D5A A;  4Q5V A;  3OYC A;  2A1R A;  3LZJ A;  4EZ6 A;  4E7K A;  4NCA A;  2VG7 A;  3LAL A;  2G8F A;  3TAR A;  2ETJ A;  2YNH A;  4JRQ A;  3ZSQ A;  4B9S A;  1HJR A;  3AA5 X;  4DS4 A;  2QK9 A;  3NH1 A;  4H4M A;  4FJN A;  4CJ5 A;  3PUF A;  2FBV A;  3VQ8 A;  4DF4 A;  1SKS A;  1U48 A;  4DWI A;  4J2A A;  4RW6 A;  1NK4 A;  4KV8 A;  2D0C A;  2PZS A;  2D5R A;  1VSI A;  2HHX A;  1RIL A;  3M8Q A;  2VWK A;  3WNE A;  1KLN A;  2NUB A;  2X6S A;  3SV4 A;  3AVN A;  4CGI A;  4F4K A;  2BE2 A;  3MEC A;  4CJL A;  1Y97 A;  5I42 A;  4N47 A;  4OPJ A;  3QEX A;  1GOC A;  3AV9 A;  3DLE A;  4FW2 A;  3K57 A;  3SZ2 A;  1QE1 A;  3RMD A;  3O4N A;  3QNO A;  4W5Q A;  2WOM A;  3AA4 A;  3AVI A;  4IBN A;  1X9W A;  2G8I A;  3NF7 A;  4FJG A;  1TV6 A;  1NK5 A;  3ZSW A;  2E6L A;  3V6D A;  4NCB A;  4I2P A;  3TAG A;  3EZ5 A;  3RMB A;  3NGZ A;  3LDS A;  5CYQ A;  2XY7 A;  1J53 A;  3VQ4 A;  4DFK A;  3THV A;  5I3U A;  2HHT A;  4ZTJ A;  3SYZ A;  3L2V A;  3NGY A;  4DTX A;  1RDB A;  2FC0 A;  3ITH A;  5DMR A;  3S9H A;  4DG1 A;  4KI4 A;  2HHQ A;  3V1O A;  1Z26 A;  2ZE2 A;  4BDY A;  1A5W A;  1RT2 A;  2LSN A;  3P1G A;  4CIF A;  3CFO A;  3SUP A;  1XC9 A;  3WNF A;  4PUO A;  4DF8 A;  3SV3 A;  4NYN A;  1HQU A; 
#chains in the Genus database with same CATH topology
 3ZCM A;  4AHR A;  2I7P A;  5AFU A;  3G71 N;  4KH6 A;  3ZSO A;  1O1W A;  2HOE A;  4NO7 A;  4F2S A;  3R9P A;  2KHO A;  1A5V A;  3EE9 A;  2IGI A;  4M42 A;  1NMN A;  1D8Y A;  4FWO A;  1NKC A;  1WBB A;  4HTL A;  2FXU A;  3OVN A;  3IS9 A;  1JCF A;  5IWA K;  4F2R A;  4BR5 A;  2YHY A;  4RG8 A;  4BVO A;  4FO0 A;  4CFD A;  4KHN A;  1VRU A;  4WF9 L;  4KI6 A;  4IJN A;  3KWG A;  1OVQ A;  4A2B A;  2PY5 A;  5E26 A;  4WQ4 A;  3QER A;  5BN9 A;  3NFA A;  3KHY A;  4AH9 A;  1ATR A;  1ZBU A;  4FJ7 A;  3O5B A;  1NGH A;  3DRP A;  2OTL N;  4FLW A;  1HKG A;  4UQG A;  3SMP A;  3SPY A;  3RRG A;  4H0X B;  4DS5 A;  2KZZ A;  1I94 K;  4Z0U A;  3W3D A;  2YNI A;  3NH0 A;  1LAW A;  4KHS A;  3DRR A;  1NJX A;  1V4S A;  3ULD A;  2NRW A;  3FE1 A;  3V9S A;  4XH4 A;  3HVR A;  4KHY A;  4Z4H A;  1NGC A;  4CCH A;  3HO1 A;  3VQB A;  2CGL A;  3J8A A;  5LMN K;  2W40 A;  3ZSX A;  2EX3 A;  4J2E A;  2I7N A;  1JXB A;  4CJS A;  3K5L A;  2P9L A;  3D45 A;  2P9N B;  3KWI A;  3M5R A;  4JI2 K;  4O0I A;  5C2D A;  2HMI A;  5M1Q A;  1GOA A;  1RDA A;  4BR2 A;  3VTH A;  1RBT A;  4O44 A;  1SL0 A;  4MO5 A;  4IEI A;  1HJO A;  3K9J A;  3LDL A;  4FK4 A;  5E41 A;  4CW7 B;  1JLG A;  3ZT3 A;  2OZS A;  2FF6 A;  3BP8 A;  2Q1N A;  4B3S K;  3TTD A;  4J2D A;  4YOR A;  3KKR A;  5AQO A;  3MXM A;  3DOK A;  3MK6 A;  3WQU A;  4B3T K;  1FXX A;  1BO5 O;  4CGD A;  5ADX A;  2HHU A;  3AVL A;  5AZJ B;  1VK0 A;  3U9D A;  3ZX2 A;  4DHY A;  5GIO A;  5BRF A;  4CHP A;  4BY9 C;  4GV6 A;  3NF8 A;  5AQH A;  3AVH A;  3P39 A;  4CGG A;  4CZI A;  2WBN A;  2HMP A;  1SAZ A;  1BUP A;  4KPY A;  3DLK A;  1NKE A;  3JAM O;  4GY2 B;  4FJH A;  1WSH A;  4FM1 A;  4CK1 A;  1L5U A;  1CXQ A;  3NF6 A;  3D0P A;  3UKU B;  5AQL A;  1LW2 A;  3OS2 A;  1TYQ B;  1K6Y A;  2YX6 A;  1T6D A;  3SUN A;  5KQD A;  5EX5 A;  2PAV A;  4FM2 A;  1QSL A;  3U8X A;  1NGB A;  4CHO A;  3O3G A;  2W41 A;  1TL1 A;  3T3F A;  4GV9 A;  3S3M A;  1UA1 A;  3WXI A;  4JKH A;  4JKB A;  2D0P A;  2IVO A;  4CEE A;  1KTQ A;  1TAU A;  4CK2 A;  1RCH A;  2QEX N;  4CJ4 A;  2WUS A;  1VQ6 N;  1L3S A;  4M7X A;  3DYA A;  4XIU A;  1SQK A;  1GOB A;  3KZB A;  4CEC A;  1XNR K;  3G6E N;  4UY8 O;  1XNQ K;  1JL1 A;  3FZM A;  3CMA N;  4KHU A;  3ZSZ A;  1KD1 O;  3VEN A;  4C1N I;  1HNZ K;  3ID6 A;  3CET A;  3E9P A;  2HHQ A;  2BAN A;  3ALY A;  4TSX A;  1RT5 A;  5KRT A;  1T05 A;  1J5O A;  4IFY A;  2NRX A;  3E66 A;  1TK0 A;  1T44 A;  2PBD A;  2HVI A;  3OYE A;  4AHT A;  4CFC A;  5FRM A;  1C0U A;  4CBX A;  3M6G A;  1KSP A;  4CJE A;  4DFJ A;  3CJC A;  2NRT A;  1NBW A;  5CE3 A;  1ITG A;  2YV0 X;  3VQQ A;  3HP6 A;  4QOZ B;  4B3R K;  4F9O A;  1KVC A;  4EP5 A;  4CIE A;  1NJY A;  3B6O A;  1G15 A;  2VQF K;  2O8C B;  3GDQ A;  4ILH A;  3KVG A;  2HHS A;  1YAG A;  1HKC A;  5J2M A;  4ELU A;  3H45 C;  4CBU A;  4FPA A;  4G9Z A;  1V4T A;  1U2V B;  3A2F A;  3WT0 A;  1IJJ A;  3OY9 A;  3VF4 A;  4FLV A;  4I6M A;  5JVG L;  4OO1 J;  4E7I A;  3THW B;  4YOU A;  3WNG A;  3SQ0 A;  2P9I A;  1C6V A;  1L3U A;  1GLB G;  3V1R A;  4BC2 A;  1NK7 A;  3HXM A;  4GMJ B;  2DFH A;  5BPN A;  3C6A A;  3EKS A;  4C8N A;  4BRP A;  3H46 O;  3CCL N;  1KAX A;  2WC9 A;  4GKK K;  1YIT N;  3I0R A;  3K5N A;  3ZSV A;  1TUU A;  1RDW X;  1E4F T;  4OKE A;  3LP3 A;  3AVJ A;  2BUP A;  3M3Z A;  1X1P A;  3HP9 A;  3KK7 A;  2HST A;  5AQN A;  4WQ5 C;  3GL1 A;  4X64 K;  4M3U A;  4Y1D A;  1RNH A;  4O4G A;  4E89 A;  4IJA A;  3T69 A;  3VQ9 A;  4KAZ A;  4CZH A;  3OYG A;  2GWJ A;  1K9M O;  3DLR A;  5M1N A;  3LM2 A;  5TKY A;  2X6N A;  1REV A;  4N41 A;  4CBW A;  3LWL A;  3THX A;  4BGA A;  4N5S A;  4KKO A;  3O9U A;  3L3V A;  5CZ2 A;  4DTO A;  2X74 A;  3ZET B;  4BRC A;  3HT3 A;  3FGU A;  2UXD K;  4RW4 A;  5BRE A;  3HPO A;  2Q36 A;  3OYH A;  3CCS N;  1ZXO A;  4BG9 A;  2OZM A;  4IG0 A;  3AVF A;  3W0L A;  3SQ2 A;  5M1O A;  4AHS A;  1HQE A;  3OYK A;  3DLH A;  5AQU A;  4GV3 A;  1ZBS A;  1S6P A;  3MN7 A;  4Z4E A;  4CE9 A;  2E88 A;  1KVB A;  4G1Q A;  1C1A A;  1QQO A;  1RT6 A;  3PLA A;  4BRE A;  4DQQ A;  3NE6 A;  3MEE A;  1B92 A;  4O5F A;  3ZSR A;  2WON A;  3K5O A;  3OJS A;  3QEP A;  1NGG A;  4PKI A;  3IUC A;  1TL3 A;  3AO4 A;  3MWT A;  1GLE G;  3C6H A;  4ISE A;  3ZT0 A;  1JJ2 M;  1RBR A;  1MA9 B;  4DSK A;  4MO4 A;  2P5G A;  5AQF A;  3AVA A;  2YI1 A;  5F2R A;  2F9T A;  5AFU H;  3DXK B;  1JKH A;  4CGJ A;  4E7J A;  4LSN A;  4JV5 K;  1KAZ A;  4FYD A;  5AQT A;  5AQG A;  5C15 A;  4K25 A;  1ILY A;  4DR5 K;  4YOY A;  3P4I A;  4DQ8 A;  1C1B A;  3VQD A;  3SAG A;  2HB5 A;  5BRH A;  2HF4 A;  3HL8 A;  2HBJ A;  3D2E A;  1X9S A;  1KLM A;  1VSM A;  2YJE A;  4CD3 A;  3C65 A;  1K8K B;  3SUQ A;  2QTD A;  1DTT A;  2VG6 A;  4FCY A;  3OYC A;  4MDA A;  3LZJ A;  4XH5 A;  2G8F A;  3TAR A;  4JRQ A;  4B9S A;  1HJR A;  2GEM A;  4H4M A;  4FJN A;  4CJ5 A;  2FBV A;  1M90 O;  4DF4 A;  1BG3 A;  1U48 A;  4DWI A;  4RW6 A;  1GLF O;  3MCP A;  4JEP A;  3WNE A;  1EO1 A;  3TTF A;  3MEC A;  4N47 A;  3DLE A;  4YOV A;  5AQX A;  3SZ2 A;  1BWF O;  4W5Q A;  1VQ9 N;  3AVI A;  1X9W A;  4KBO A;  3NF7 A;  4I2P A;  2E2P A;  4ILJ A;  3BEX A;  3RMB A;  2XY7 A;  3THV A;  2HHT A;  3SYZ A;  2Q31 A;  4DG1 A;  4IEE A;  2ZE2 A;  3CFO A;  3VGK A;  4BRI A;  3WNF A;  4DF8 A;  5JIC A;  4K0K K;  2ITG A;  3MED A;  4DR1 K;  3V9W A;  4K41 A;  2NRR A;  3LAM A;  1RFQ A;  2IC3 A;  1VHX A;  4DLG A;  1QVG M;  2YHW A;  1T3V A;  1Z25 A;  3QIN A;  2A6A A;  4DR4 K;  2P9P A;  5HOO A;  4A5A A;  5T7B A;  4OJR A;  3ZSY A;  3HTV A;  3F2K A;  1S1T A;  4MLE A;  4M3X A;  4ICL A;  3ZX3 A;  3CFR A;  2F8T A;  2GTD A;  2A3Z A;  4OPK A;  4LH4 A;  3KK3 A;  3J7Y P;  1ASW A;  1ESV A;  2A40 A;  4JHD B;  4JD2 A;  4FJ5 A;  3IKM A;  3B8A X;  5ADX H;  1EWQ A;  1DEJ A;  1RTD A;  5KPZ A;  4OPA A;  4B9L A;  4LF6 K;  4EP4 A;  1IG8 A;  4NLB A;  4CK3 A;  4DQP A;  4BQL A;  4OPH A;  3H3N O;  1VSK A;  4LY7 A;  3DXM B;  4E19 A;  1X9J A;  3R8E A;  2IIR A;  2VWB A;  4JI8 K;  3I8D A;  4QS9 A;  3T1H K;  3J80 O;  2CGJ A;  4DQR A;  4EZ9 A;  2RN2 A;  3QBX A;  2ZGY A;  1Q8I A;  4H0V B;  4GVM A;  4M3R A;  1QVF M;  1NK0 A;  4IOA L;  5SWM A;  1IBK K;  4HUF A;  2B5J A;  4Z4C A;  4BVP A;  1Z6R A;  5B8H A;  1FKP A;  3OW2 M;  3UKR A;  3SQ4 A;  3CER A;  2E5L K;  4Y1C A;  1Q18 A;  3FZH A;  3D2F B;  4MDB A;  2IOC A;  1OH5 A;  3DOL A;  1BI4 A;  2JWL A;  3CYM A;  3WXK A;  4M3W A;  5AZI A;  2Z1H A;  3SMS A;  2B4J A;  1NK6 A;  4F3T A;  5JLF A;  1A5X A;  3SJJ A;  4JKC A;  1U6Z A;  3TAQ A;  1Y64 A;  2RHK A;  3IRX A;  3BF3 A;  3BY5 A;  5KGX A;  1R0A A;  4CGH A;  5DM7 L;  3OYB A;  4DR2 K;  3ATV A;  4RCH A;  2HVH A;  3EKU A;  5LJV A;  2Y1J A;  2VGM A;  1VSL A;  3DJC A;  4CJR A;  3HM8 A;  1NG9 A;  4FJX A;  1NGD A;  1GLJ O;  4H5T A;  5HLF A;  2P9K A;  2RF2 A;  3QNN A;  4JI6 K;  3P31 A;  5C25 A;  2Q0U A;  3MXJ A;  2E2O A;  1HMV A;  3SQ1 A;  3Q7B A;  3Q7C A;  4DSE A;  5BPL A;  4DQI A;  4CEO A;  2IVP A;  3K2P A;  3O4Q A;  2EHG A;  3IDH A;  2P5O A;  3KD5 E;  4CHY A;  1GLD G;  4PWD A;  1OH8 A;  4NYF A;  4CFB A;  3ZT4 A;  2UU9 K;  4B9N A;  3OBW A;  2D4W A;  3CJ7 A;  5KPT A;  5J1E A;  3QIP A;  3IMX A;  4CD1 A;  3AVG A;  4C23 A;  1LOT B;  3QDK A;  5AQM A;  2BGG A;  2D0B A;  4LSL A;  2GBZ A;  1S1U A;  4W5O A;  1VSE A;  5CY4 A;  4ISF A;  4BWJ A;  1BCM A;  1ZBH A;  4FVU A;  1LWF A;  1SZ2 A;  1EXQ A;  5DK5 A;  4HTU A;  3RTV A;  5KRS A;  5FPD A;  1R59 O;  3I56 N;  1JLE A;  4LF5 K;  4DTS A;  2IS3 A;  4Z4F A;  1HLU A;  2OTJ N;  1XMO K;  4FLY A;  1T6C A;  5SZT A;  3VES A;  3EEQ A;  4FWK A;  2UUA K;  4A61 A;  2V7Z A;  1WNS A;  4LF9 K;  1KAY A;  3SPZ A;  1X9M A;  4JRP A;  5BRD A;  1T03 A;  1IG9 A;  3L2W A;  4PKH A;  1N5Y A;  1H1V A;  4X66 K;  3TSQ A;  3IAY A;  1YXQ A;  1S9E A;  1TK5 A;  2P9N A;  4QAG A;  3PX0 A;  1CZA N;  3KLE A;  3V9U A;  3C95 A;  1RTI A;  2O8D A;  1WAJ A;  3MX5 A;  4GVE A;  4CEA A;  3VER A;  3CD6 N;  5F1X A;  4DFP A;  1SKR A;  4B8A B;  1JCE A;  2E8A A;  1VQM N;  3RMC A;  3LDO A;  4FM0 A;  4CF9 A;  3LAK A;  3QES A;  3SCX A;  4CHZ A;  1YI2 N;  5F0X A;  4YDU A;  4CZK A;  1VQL N;  1JXE A;  1GLL O;  3T1A A;  3SJH A;  5J2P A;  4DU3 A;  4FOI A;  4YOT A;  5FRN A;  2QWO A;  2P9U A;  2ZD1 A;  5AQS A;  3AVC A;  5IT9 O;  3MN5 A;  4ZHR A;  3HPG A;  2ASP A;  5JLH A;  1UOC A;  4XH1 A;  1EET A;  4L3Q A;  4WYB A;  2UYT A;  1TK8 A;  4DR3 K;  4MFB A;  4KTW A;  1YVN A;  4ZTF A;  3O6W A;  1U04 A;  3NHG A;  3CG7 A;  3QFP A;  5DM6 L;  3F73 A;  1LV5 A;  1J9A A;  3DRS A;  1QS4 A;  3QO9 A;  3K59 A;  3FR0 A;  4QS7 A;  1BIS A;  4Z4I A;  5GAG P;  3TAN A;  3F9M A;  1SUQ A;  3ZEU A;  2P9L B;  1NGE A;  1WSJ A;  3RWU A;  2FF3 B;  2Q2R A;  5KI6 A;  2NRH A;  3LPU A;  3O8M A;  2FLO A;  4Y0W A;  4CJQ A;  4BE1 A;  1XHZ A;  4HCB A;  2HNY A;  3MCA B;  4BDZ A;  1W7A A;  3FZK A;  4LH5 A;  1NMD A;  3AVK A;  1HPM A;  2AP1 A;  3RSE A;  4JK8 A;  1YUW A;  3LAN A;  4CJT A;  1W9H A;  3NF9 A;  4M3Y A;  4GKJ K;  4CJV A;  3K5M A;  2CGK A;  3AAP A;  5JS1 A;  2OPS A;  3TR8 A;  1XWL A;  1I3A A;  3PO5 A;  2P51 A;  3FFK B;  4CIG A;  1E4G T;  1YJW N;  3DLL L;  2O8F A;  1NGI A;  4B9U A;  1NKB A;  1K73 O;  4IO8 A;  3I55 N;  3NDK A;  3VQE A;  4WCE L;  2BDP A;  3VEV A;  3J81 O;  5M1K A;  4JKE A;  2W6L A;  3OTO K;  4FLX A;  4NLC A;  4R79 A;  1D4X A;  5D3G A;  3OS0 A;  4PQU A;  1U49 A;  3I8B A;  3ENB A;  1F21 A;  2ZJP L;  2P9S A;  2ZJQ L;  1RBU A;  3J7Z O;  4BRQ A;  1DTQ A;  4CGF A;  3QEV A;  4I9L A;  5FLX O;  1VQ7 N;  4BWM A;  4KRE A;  3L4I A;  3AVB A;  1N6Q A;  3LDQ A;  3QIO A;  1YTU A;  5AQV A;  4FLT A;  1MWK A;  3EL2 A;  5K14 A;  1SV5 A;  3MEG A;  4JI5 K;  3VQP A;  3QML A;  4BRO A;  3VGM A;  3KD1 E;  1D9D A;  3MX2 A;  4HCC A;  2DPN A;  4E1J A;  2ASO A;  1JLA A;  2YHA A;  2HHH K;  1BL3 A;  1NLV A;  4GW6 A;  2UUC K;  2PYL A;  3EE8 A;  4YOX A;  1EX4 A;  3LP1 A;  2O4G A;  3VEZ A;  3OYA A;  1BCO A;  4JAX A;  4K42 A;  2X78 A;  3A5N C;  4NYN A;  3SNN A;  1IH7 A;  1JLB A;  4F8R A;  2E1Y A;  3CJA A;  3PIP L;  4DR6 K;  1ASV A;  3CJ1 A;  5FPN A;  3H1Q A;  4H8K A;  1NGF A;  1ATN A;  2I5J A;  4KTZ A;  2D1K A;  4Q5V A;  4M45 A;  4NCA A;  3LAL A;  3THY A;  1VQ5 N;  3AA5 X;  2HBK A;  3A8Y A;  1BDG A;  2HBM A;  4J2A A;  2D0C A;  2PZS A;  2NUB A;  3AVN A;  4F4K A;  2CH6 A;  4IFE A;  1GOC A;  5GAE P;  4FW2 A;  3WEE A;  2QXL A;  3AA4 A;  2GUP A;  1OKJ A;  4H03 B;  3L6Q A;  3ZSW A;  2E6L A;  4FWR A;  1G99 A;  3ZET A;  4DFK A;  4B1W B;  5C0Y A;  3O9R A;  3L2V A;  4I6M B;  4WQ5 A;  3HBT A;  1RDB A;  5DMR A;  3S9H A;  3C7N A;  4KI4 A;  3CXC M;  4BDY A;  2P9I B;  1RT2 A;  2ASM A;  4CIF A;  3SUP A;  4K43 A;  1BA0 A;  3SV3 A;  1NM1 A;  1NJW A;  3L8B A;  3DAW A;  1NK9 A;  1E3M A;  2RPI A;  2EWS A;  4JI7 K;  2Q0R A;  2QI2 A;  5I9E B;  3OYI A;  3R1X A;  4B9T A;  3PIO L;  4CHN A;  2YNF A;  1L3T A;  3MAQ A;  3HK2 A;  2V51 B;  4WFN L;  1S6Q A;  3TAM A;  4NCG A;  4AQY K;  5EU7 A;  4WE1 A;  2FBY A;  1QTM A;  1JLF A;  4H5R A;  2E2N A;  3CPW M;  2RKI A;  2QWQ A;  4JKG A;  5KGW A;  4BC4 A;  3M8S A;  4FK0 A;  3JSM A;  4H5W A;  5AQW A;  3DLB A;  1YTA A;  5AQK A;  2XRI A;  3MWP A;  3JXU A;  4IDK A;  3U3G A;  4E1M A;  5KQ8 A;  3CC4 N;  4CZG A;  1HPZ A;  3I0S A;  4ISG A;  3CCU N;  1Q9Y A;  4ELV A;  3EY1 A;  3VQ6 A;  3P38 A;  3KLF A;  3EYZ A;  3THX B;  3WQT A;  3EZW A;  3GE1 A;  3VQ7 A;  3CM5 A;  2G8U A;  4BE2 A;  3VF2 A;  3ISN C;  3VOV A;  1NJZ A;  2IAJ A;  4O55 A;  1QSS A;  1WLJ A;  1K8K A;  4E7H A;  4FJK A;  3VA0 A;  4KB1 A;  2O4I A;  2YJF A;  4CJK A;  2ZGZ A;  5BR9 A;  1NJI O;  1XC3 A;  4MQ3 A;  1QHT A;  1FKO A;  3TWH A;  4LFA K;  4CF1 A;  3TU5 A;  2ZWH A;  2QWR A;  4C8L A;  1WUA A;  4BGB A;  1IBM K;  3ID8 A;  3T7Z A;  3M1F A;  1IKX A;  1OH6 A;  2ITM A;  3C6T A;  3RR7 A;  4OGC A;  2PFU A;  4I2Q A;  1O13 A;  1QQM A;  2NLX A;  4DU4 A;  3CIP A;  3OYJ A;  1Q9X A;  2Z1G A;  1VSJ A;  2VQE K;  4IKF A;  2O8B A;  1B9F A;  2YKN A;  3TAP A;  2FSJ A;  1SKW A;  3O1W A;  3HI0 A;  4KFB A;  3K58 A;  3CCJ N;  1VQK N;  4B3M K;  4RW7 A;  3L2R A;  2XO7 A;  3BGR A;  5BPM A;  3TTC A;  1FW6 A;  4ILG B;  2WTU A;  2JLE A;  3TAB A;  1S1X A;  3BZC A;  3KLH A;  2ZJR L;  4H0T B;  4BRF A;  1HNW K;  3TAE A;  4DSJ A;  4LC9 B;  1WSI A;  3IG1 A;  3VPZ A;  3TI0 A;  1VQ8 N;  1KFS A;  4LF4 K;  3RVC A;  1IBL K;  4DSL A;  3D2E B;  4B08 A;  3O9T A;  5KTQ A;  3BF1 A;  3QBW A;  2KKZ A;  3O4W A;  3O9Q A;  3WXL A;  4DUZ K;  2VWJ A;  3L3U A;  1X3N A;  3LM9 A;  4HVJ A;  4JS4 A;  1WSE A;  3OS1 A;  5FRO A;  1P8Z A;  1GLA G;  3QLH A;  4CED A;  5LMU K;  3AAQ A;  3QFU A;  3CME N;  4JNE A;  4NXN K;  1KRP A;  5JMV A;  4CF0 A;  3DI6 A;  5M1P A;  1YJN N;  1KC8 O;  2O8E B;  1YF5 L;  2GX9 A;  1TKX A;  2OPP A;  1NNE A;  4O0J A;  4BRH A;  3V9Z A;  1EKE A;  2GWK A;  5J2Q A;  4O5B A;  3ULE A;  4CZJ A;  2XY5 A;  4OVL A;  4E7L A;  4CJ3 A;  3PO4 A;  4E3S A;  1HYV A;  4B1Y B;  3ASM A;  4CZL A;  4HUG A;  1CXU A;  1ZYQ A;  5FPM A;  2UXC K;  1OVY A;  1WAF A;  3OJU A;  4FJM A;  2HHW A;  1BQN A;  4AHV A;  2P9P B;  4B8C A;  4BC5 A;  1Q81 O;  3T19 A;  1K8A O;  2BH1 A;  4FOE A;  1T8E A;  3HYF A;  2Q3S A;  4FZZ A;  4U7B A;  5GIP A;  3CQ8 A;  4KHQ A;  2HHV A;  3U3Y A;  4J2B A;  4JD2 B;  3HOS A;  3OYM A;  4FLZ A;  3S3N A;  5EVZ A;  1YT3 A;  4N76 A;  3OYD A;  2F9W A;  2YKM A;  2NZT A;  1YJ9 N;  1JL2 A;  1NOY A;  4BR0 A;  3RR8 A;  3LP2 A;  1M1K O;  3NGI A;  3KK2 A;  1S1V A;  2J4R A;  3ZT1 A;  1FJG K;  4GNI A;  4DKW A;  4B3O A;  3MXI A;  4FWN A;  3U6F A;  1NK8 A;  3CM6 A;  1XMQ K;  2YCH A;  2VGN A;  4H4O A;  4DSF A;  1RBV A;  1WSG A;  1D9F A;  1BGX T;  1SL2 A;  1DLO A;  3AO5 A;  4CES A;  4CJF A;  3H3O B;  4FWP A;  2G8H A;  4F3O A;  1NGA A;  3UKR B;  1SS6 A;  2QM1 A;  3PY8 A;  3LDN A;  5KPR A;  2QKK A;  3FZF A;  3CCV N;  4IZ9 A;  1BI4 B;  4IXC A;  5C42 A;  4DV7 K;  4FJ8 A;  5AZI B;  3VEO A;  5H1S Q;  1W0H A;  3S3O A;  3CC7 N;  3SBG A;  1QSY A;  5EY4 A;  4EHU A;  1QQC A;  1OH7 A;  4BC3 A;  4OKJ A;  3KTQ A;  4FWM A;  4Q0B A;  4BRM A;  3E01 A;  4X65 K;  2FSK A;  4OX9 K;  1EWR A;  2HND A;  1MDU B;  2A5X A;  4JKA A;  1CZB A;  3EO3 A;  3SBT A;  3CCQ N;  1YIJ N;  3DWL A;  4BR4 A;  1NGJ A;  2UXB K;  4FZX C;  1RT3 A;  3C0B A;  3M8R A;  2P9K B;  3KK1 A;  2IVN A;  1VQN N;  5AJ3 K;  2YHB A;  2ATQ A;  1L3V A;  4YY3 K;  2KLA A;  2YNG A;  3JS6 A;  1IV0 A;  3BDP A;  3IFR A;  4JKD A;  4FJJ A;  5MLC Q;  3VN5 A;  4M3T A;  4Z4G A;  3BZK A;  3F5T A;  4HWI A;  4DR7 K;  3AGK A;  2DFE A;  4LF8 K;  4BG8 A;  4CZF A;  4JI0 K;  4IG3 A;  3CJ9 A;  3VMF B;  4CZM A;  4C8M A;  1YVU A;  4CF8 A;  5FPE A;  3CCR N;  4FJL A;  3V1Q A;  4FPB A;  1U47 A;  3CQX A;  4EIA A;  3V9X A;  2ZQB A;  3QB0 A;  4ID1 A;  4M63 C;  4WQ4 C;  2JGU A;  1C0F A;  2W42 A;  2QW9 A;  4CJU A;  2XY6 A;  5EOY A;  4V19 S;  1VQP N;  5HRS A;  4BAC A;  4CJP A;  5AQJ A;  2VCP A;  3HVT A;  2F7T A;  2JWK A;  4A2A A;  4FK2 A;  4A59 A;  4DCH A;  2E6M A;  1RTJ A;  1I39 A;  1Q86 O;  3D7E O;  2ZF5 O;  3HPH A;  1XQS C;  2Z1I A;  4B1U B;  5GAD P;  3GBT A;  4W5N A;  5EXW A;  4FWQ A;  1MU2 A;  5CZ1 A;  5GIN A;  4DFM A;  3E1Y A;  2OYQ A;  2H3G X;  1HKB A;  1LWC A;  4DSI A;  1ZBL A;  3AAR A;  5AZJ A;  2Y1I A;  3FFI A;  3SAF A;  4M41 A;  4PKG A;  5HRP A;  3LL3 A;  1RDU A;  1B9D A;  4YDU C;  4E1N A;  4KH4 A;  3NVK A;  2W6K A;  5BR8 K;  2O8D B;  1KFD A;  3VA3 A;  3NCI A;  4EZ6 A;  3ZYY X;  2VG7 A;  2ETJ A;  5CHI A;  2YHX A;  3NH1 A;  1WOQ A;  3PUF A;  3HZ6 A;  3UKU A;  3VQ8 A;  4KV8 A;  1TYQ A;  4H0O A;  1VSI A;  3E9O A;  3M8Q A;  4CGI A;  3N4Q A;  1XUP O;  4JYA K;  1Y97 A;  4QS8 A;  1N32 K;  3AV9 A;  2F4V K;  3K57 A;  1QE1 A;  3RMD A;  3O4N A;  3QNO A;  2P9U B;  4NB4 A;  4FJG A;  1TV6 A;  1NK5 A;  3V6D A;  4NCB A;  3TAG A;  3L0Q A;  3D6R A;  1J53 A;  5CR4 A;  4ZTJ A;  1TUY A;  4MLH A;  3NGY A;  4DV6 K;  3G4S N;  4DTX A;  2FC0 A;  2OCE A;  1Z26 A;  2ZM6 K;  1A5W A;  3S41 A;  3WXJ A;  1GLC G;  1VQ4 N;  1QQN A;  2A42 A;  1UWB A;  5M1F A;  1JLC A;  3CF5 L;  1WSF A;  3ZLJ A;  3HOT A;  3A5O C;  1LAV A;  3TSU A;  4W5T A;  1BOT O;  3KLG A;  1UAX A;  3ZX0 A;  3NH2 A;  1U4B A;  3ZEU B;  3WUH A;  4YHH K;  3G0Z A;  5LY3 A;  1UA0 A;  1VRT A;  3VQ5 A;  3T1Y K;  3PX6 A;  4BQZ A;  4X62 K;  1C0M A;  3RMA A;  3OYL A;  1WN7 A;  4HHT A;  4JI3 K;  3K0S A;  3RSE B;  4FL9 A;  3ENH A;  2VG5 A;  2G8K A;  1ZBI A;  3VEY A;  1CZ9 A;  3KKS A;  4FVM A;  2QWP A;  1J54 A;  3B6P A;  3O9S A;  4PL7 A;  2O8C A;  3PSI A;  1S1W A;  4DV3 K;  4A5B A;  1U2V A;  3MN6 A;  1IO2 A;  3SUO A;  1C0T A;  3AA3 A;  2O8F B;  3C94 A;  2HBL A;  4BRN A;  3NMU A;  1S5J A;  3THW A;  4H0P A;  2GEL A;  2E20 A;  1RT1 A;  1BU6 O;  3OYN A;  3AGR A;  2V52 B;  4FWL A;  2P9S B;  4FZY A;  4BRA A;  1YHQ N;  4LD0 A;  1Q7Y O;  3PV8 A;  3AY9 A;  3MDQ A;  2B6A A;  3SLC A;  4PY5 A;  4CEB A;  3WXM B;  4DTP A;  1KXP A;  2AA4 A;  1BA1 A;  4JK9 A;  3L4Q A;  3OA9 A;  4YOW A;  2GV9 A;  1N8R O;  5BN8 A;  4B9M A;  4YNQ A;  2KFZ A;  5CYM A;  1TKT A;  3LWM A;  3NAE A;  4EAH D;  4U67 L;  5C2F A;  4DU1 A;  4DTU A;  2VYP A;  2UUB K;  4K8X A;  5AQR A;  4QCL A;  3J7A P;  5HBM A;  5JS2 A;  4JN4 A;  4JS5 A;  5HP1 A;  4I9Q A;  1S9G A;  4WFA L;  3AO1 A;  4C1N K;  4B1V A;  1RT4 A;  4DV2 K;  4K8Z A;  1XHX A;  4XEI A;  1N34 K;  2E1Z A;  1QHA A;  2R7Y A;  4H0Y B;  4DV5 K;  2G8V A;  4PA1 A;  4DLE A;  4B1Z A;  1WB9 A;  4DV4 K;  1JCG A;  3TPQ A;  4H5N A;  4CFA A;  4RW8 A;  2A41 A;  2OAN A;  3VQC A;  4M7Y A;  4B9V A;  2DTU A;  4JLH A;  3V81 A;  3AO3 A;  4IOC L;  4KRF A;  4B9Q A;  4O8U A;  4BR7 A;  2KW4 A;  3THY B;  2OPQ A;  2V7Y A;  2OA8 A;  1IKV A;  1RBS A;  2Q97 A;  5TKW A;  2DY4 A;  1HNV A;  4FWS A;  1VSF A;  1J6Z A;  1LW0 A;  4CEQ A;  4KB0 A;  3BUZ B;  3CHW A;  4BE0 A;  4ID5 A;  4IO9 L;  1TKZ A;  2NNW A;  1N33 K;  3JYT A;  4E0D A;  1C0G A;  1SL1 A;  3WEE B;  3KJV A;  4CF2 A;  3AA2 A;  5GAH P;  1WBD A;  4OLA A;  3A0I X;  3CFP A;  4LF7 K;  3SI6 A;  3DXK A;  2BTF A;  3C7N B;  1RDD A;  3A5L C;  1IKW A;  3PSF A;  3TAF A;  3LP0 A;  1JLQ A;  2FBX A;  2E2Q A;  3V4I A;  4CZE A;  3QIC A;  3L2Q A;  4Z94 A;  2AJQ A;  1NWK A;  4CEZ A;  2FBT A;  3OHR A;  1BQM A;  4LFB K;  1QZ5 A;  1HRH A;  2NRZ A;  4ELT A;  1NOZ A;  4R5P A;  5AQZ A;  2HNZ A;  2WFB A;  2Z1J A;  1W2B M;  3SK3 A;  2IDO A;  3ATU A;  1HNX K;  3SAH A;  4IDH A;  3NBP A;  3FZL A;  3O3F A;  3VEX A;  1CLQ A;  1RGI A;  3ENO A;  4I7F A;  1FK9 A;  1TVR A;  3QET A;  4JKG B;  3RRH A;  3MMV A;  3L2U A;  2KFN A;  4W5R A;  4BR9 A;  4N56 A;  4OLB A;  4RWT A;  5A2Q O;  4DB3 A;  3H08 A;  2HF3 A;  1HR0 K;  2CH5 A;  2D0O A;  3UE5 A;  1IKY A;  3HRG A;  4FW1 A;  3CPE A;  3O80 A;  3O08 A;  2XHB A;  4FJ9 A;  4PHT X;  2QXF A;  3H1V X;  1TAQ A;  2D0A A;  3M8P A;  1Z05 A;  3CCE N;  4AHC A;  3DM2 A;  3OBY A;  1KVA A;  3VF6 A;  3QEI A;  5ELZ A;  4CJ7 A;  3VQA A;  3CCM N;  1RDC A;  4IWV A;  2F8S A;  3O1B A;  2E4L A;  3U9Z A;  2RE2 A;  3AO2 A;  4FJI A;  3UIQ A;  1HYZ A;  1S22 A;  3ZT2 A;  3LZI A;  4KHP K;  2OPR A;  3HST B;  3QEW A;  3UB5 A;  4EFH A;  4L8R B;  2P1J A;  4BRD A;  3HJF A;  2QKB A;  4DTJ A;  1HUX A;  4C8O A;  5AQQ A;  3G10 A;  3TSP A;  1TKD A;  2HW3 A;  2O8E A;  4KO0 A;  4KH5 A;  3CI5 A;  4A62 A;  3WNH A;  1C1C A;  3CJB A;  2O8B B;  3VGL A;  5HL7 L;  4JHD A;  1HYS A;  4EHT A;  1Q82 O;  4WFB L;  4DMN A;  3I33 A;  2QA4 N;  4DV1 K;  3HM9 A;  5J2N A;  4CEF A;  1BIU A;  2F96 A;  2XY8 A;  3LDP A;  4DUY K;  2QWL A;  4IFV A;  4RW9 A;  1T7P A;  1DGK N;  4B1X B;  1QZ6 A;  5C10 A;  2PYJ A;  3DXM A;  4H5V A;  4CI6 A;  4CJW A;  1NU0 A;  4O8K A;  5AR0 A;  5FDL A;  4A57 A;  3F9K A;  3LPT A;  2DFF A;  3KIO A;  4OKK A;  4BDP A;  4IOX A;  2G8W A;  1ZC6 A;  1U45 A;  2NRV A;  5HRN A;  4DQS A;  1BHL A;  1VSD A;  3C6U A;  3O3H A;  3U4L A;  1XI1 A;  1LWE A;  3GG4 A;  4C8K A;  5AQI A;  1HNI A;  1VSH A;  1VQO N;  1RT7 A;  1EP4 A;  4M3Z A;  4YFU A;  4AHU A;  1S3X A;  3H6E A;  2A1S A;  1BIZ A;  3D2F A;  2KZM A;  4KTQ A;  5AQY A;  1VAZ A;  4JKF A;  4FSV A;  5AQP A;  1DKG D;  4CVN E;  4KHW A;  4CER A;  3KLI A;  1ASU A;  4JK7 A;  5C24 A;  5HRR A;  3DLG A;  4DTN A;  4AM7 A;  3VEW A;  1EQY A;  1X3M A;  4CHQ A;  4FLU A;  1N36 K;  1KQS M;  1TGO A;  4BRL A;  4DTR A;  2QWN A;  1ZBF A;  5HRO A;  4FXD A;  3AVM A;  4HUE A;  3P83 D;  5LL6 Z;  3ULE B;  1KCF A;  4OGE A;  2GUI A;  2QWM A;  2FSN A;  4AIL C;  5LJW A;  2KTQ A;  1DT9 A;  3E9L A;  5JVH L;  3R3L A;  3G25 A;  3R6M A;  3DMJ A;  4J8F A;  3P5J A;  4DTM A;  1RTH A;  3OYF A;  1ATS A;  3GOI A;  3MN9 A;  1P90 A;  3VET A;  3PX4 A;  2KQ2 A;  2A1R A;  1D5A A;  1LCU A;  4E7K A;  2YNH A;  2QK9 A;  3N4P A;  4NXM K;  3ZSQ A;  1S72 N;  4DS4 A;  4AF1 A;  3K9K A;  1SKS A;  1NK4 A;  1J5E K;  2D5R A;  2HHX A;  1RIL A;  2VWK A;  1KLN A;  4LFC K;  3A5M C;  2X6S A;  3SV4 A;  2BE2 A;  4CJL A;  5C12 A;  1HX1 A;  5I42 A;  4OPJ A;  3QEX A;  3VTI A;  3EN9 A;  2WOM A;  4IBN A;  4JI4 K;  4BRK A;  2G8I A;  3NVM A;  3CC2 N;  4JI1 K;  3EZ5 A;  3NGZ A;  4BRG A;  3LDS A;  5CYQ A;  3VQ4 A;  5I3U A;  1W97 L;  3CQY A;  5E84 A;  3FLC O;  3ITH A;  4PL8 A;  4DV0 K;  3HSC A;  3V1O A;  1MWM A;  2LSN A;  3P1G A;  1XC9 A;  4AM6 A;  4PUO A;  4RTF D;  1HQU A; 
#chains in the Genus database with same CATH homology
 3ZCM A;  4AHR A;  1NJW A;  3L8B A;  1NK9 A;  2ITG A;  1UWB A;  3MED A;  3ZSO A;  3V9W A;  2RPI A;  1JLC A;  3LAM A;  1O1W A;  1WSF A;  2IC3 A;  4F2S A;  4DLG A;  1LAV A;  4W5T A;  3KLG A;  1UAX A;  3OYI A;  3NH2 A;  1U4B A;  4B9T A;  4CHN A;  1Z25 A;  3QIN A;  2YNF A;  1L3T A;  1A5V A;  2IGI A;  3MAQ A;  3G0Z A;  3HK2 A;  1UA0 A;  4M42 A;  1S6Q A;  1D8Y A;  3TAM A;  1VRT A;  4NCG A;  5T7B A;  1NKC A;  4OJR A;  3VQ5 A;  3ZSY A;  5EU7 A;  4WE1 A;  3PX6 A;  3OVN A;  2FBY A;  3IS9 A;  1QTM A;  1S1T A;  4F2R A;  1C0M A;  1JLF A;  3OYL A;  3RMA A;  1WN7 A;  4HHT A;  4RG8 A;  4M3X A;  4ICL A;  3CFR A;  2F8T A;  4CFD A;  2RKI A;  5KGW A;  4KHN A;  4OPK A;  3M8S A;  2VG5 A;  1VRU A;  4LH4 A;  3JSM A;  4FK0 A;  2G8K A;  1ZBI A;  4KI6 A;  3KK3 A;  1CZ9 A;  1ASW A;  3KKS A;  4FJ5 A;  3DLB A;  4FVM A;  1YTA A;  1J54 A;  3B6P A;  2XRI A;  4IDK A;  3U3G A;  4E1M A;  2PY5 A;  1RTD A;  3QER A;  1HPZ A;  1S1W A;  3I0S A;  3NFA A;  1Q9Y A;  4ELV A;  3EY1 A;  3VQ6 A;  4B9L A;  4AH9 A;  4EP4 A;  3KLF A;  3EYZ A;  1IO2 A;  1ZBU A;  4CK3 A;  3SUO A;  4DQP A;  4FJ7 A;  1C0T A;  3AA3 A;  3DRP A;  4FLW A;  3C94 A;  3CM5 A;  1VSK A;  3VQ7 A;  4UQG A;  3SPY A;  2G8U A;  4LY7 A;  4DS5 A;  4BE2 A;  4E19 A;  3RRG A;  3ISN C;  2KZZ A;  1S5J A;  1NJZ A;  4Z0U A;  2IAJ A;  2YNI A;  4O55 A;  3NH0 A;  1LAW A;  3I8D A;  1QSS A;  1WLJ A;  4KHS A;  3DRR A;  1RT1 A;  1NJX A;  4DQR A;  4E7H A;  4EZ9 A;  4FJK A;  3ULD A;  2RN2 A;  3VA0 A;  3V9S A;  3OYN A;  1Q8I A;  4KB1 A;  4GVM A;  3HVR A;  2O4I A;  4CJK A;  4M3R A;  4FZY A;  4Z4H A;  4MQ3 A;  4CCH A;  1QHT A;  1NK0 A;  4LD0 A;  1FKO A;  3VQB A;  3TWH A;  3HO1 A;  5SWM A;  4CF1 A;  3ZSX A;  2EX3 A;  3PV8 A;  4C8L A;  2B6A A;  4J2E A;  4HUF A;  2B5J A;  1JXB A;  4CJS A;  4Z4C A;  4PY5 A;  3K5L A;  4CEB A;  3D45 A;  4DTP A;  1FKP A;  4O0I A;  1IKX A;  3SQ4 A;  4Y1C A;  2HMI A;  3C6T A;  3RR7 A;  4OGC A;  2GV9 A;  1GOA A;  1RDA A;  2IOC A;  4I2Q A;  4B9M A;  3DOL A;  4YNQ A;  1BI4 A;  5CYM A;  1TKT A;  3CYM A;  3LWM A;  4M3W A;  2HHV A;  1RBT A;  4O44 A;  3NAE A;  1SL0 A;  2Z1H A;  4DU1 A;  4DTU A;  4K8X A;  4FK4 A;  4QCL A;  5E41 A;  1JLG A;  4DU4 A;  5HBM A;  5JS2 A;  3ZT3 A;  3OYJ A;  2B4J A;  1Q9X A;  4JS5 A;  5HP1 A;  2Z1G A;  1VSJ A;  1NK6 A;  1A5X A;  1S9G A;  3SJJ A;  2OZS A;  3AO1 A;  4IKF A;  1B9F A;  4F3T A;  1RT4 A;  4K8Z A;  3TAQ A;  2YKN A;  1XHX A;  3TAP A;  1SKW A;  3IRX A;  4KFB A;  3K58 A;  5KGX A;  2R7Y A;  4CGH A;  1R0A A;  3OYB A;  2HVH A;  4RW7 A;  3L2R A;  4J2D A;  2XO7 A;  2G8V A;  3BGR A;  3KKR A;  2Y1J A;  4PA1 A;  3TAB A;  1VSL A;  2JLE A;  3MXM A;  1S1X A;  4DLE A;  3DOK A;  4CJR A;  3KLH A;  4FJX A;  5HLF A;  1FXX A;  2RF2 A;  3TAE A;  4CGD A;  3QNN A;  4DSJ A;  2HHU A;  5C25 A;  3AVL A;  3MXJ A;  4CFA A;  1VK0 A;  1WSI A;  3IG1 A;  4RW8 A;  3TI0 A;  1HMV A;  3SQ1 A;  1KFS A;  4CHP A;  4DSE A;  3VQC A;  4B9V A;  3NF8 A;  4B08 A;  4DQI A;  4JLH A;  4CEO A;  3K2P A;  3AVH A;  4DSL A;  2DTU A;  3O4Q A;  4CGG A;  5KTQ A;  3V81 A;  2EHG A;  3KD5 E;  2P5O A;  3AO3 A;  4KRF A;  4CHY A;  4PWD A;  4KPY A;  4NYF A;  4CFB A;  3DLK A;  3ZT4 A;  2KW4 A;  1NKE A;  2OPQ A;  4B9N A;  1WSH A;  4FJH A;  4FM1 A;  4CK1 A;  1L5U A;  1CXQ A;  2VWJ A;  3L3U A;  1IKV A;  3NF6 A;  4HVJ A;  3D0P A;  4JS4 A;  2OA8 A;  1RBS A;  5J1E A;  1WSE A;  2DY4 A;  1LW2 A;  3OS2 A;  1HNV A;  3QIP A;  5FRO A;  3OS1 A;  3AVG A;  1K6Y A;  1VSF A;  3SUN A;  1LW0 A;  4CEQ A;  3QLH A;  4CED A;  2D0B A;  4KB0 A;  2BGG A;  4BE0 A;  4LSL A;  4FM2 A;  1QSL A;  2GBZ A;  4ID5 A;  1S1U A;  4W5O A;  4CHO A;  3O3G A;  1TKZ A;  1VSE A;  5CY4 A;  4BWJ A;  3JYT A;  1BCM A;  4E0D A;  1ZBH A;  1TL1 A;  3T3F A;  1SL1 A;  1LWF A;  1EXQ A;  3KJV A;  3S3M A;  1UA1 A;  5DK5 A;  4HTU A;  3RTV A;  1KRP A;  5KRS A;  4CF0 A;  1JLE A;  4DTS A;  2IS3 A;  3DI6 A;  4Z4F A;  4CEE A;  4CF2 A;  1KTQ A;  3AA2 A;  1TAU A;  4OLA A;  4FLY A;  3CFP A;  1TKX A;  4CK2 A;  2OPP A;  5SZT A;  1RCH A;  4CJ4 A;  3SI6 A;  4O0J A;  1RDD A;  1L3S A;  3V9Z A;  3DYA A;  1EKE A;  1IKW A;  1WNS A;  5J2Q A;  4XIU A;  1GOB A;  4O5B A;  3TAF A;  3SPZ A;  4JRP A;  3LP0 A;  1JLQ A;  4CEC A;  1X9M A;  2FBX A;  3V4I A;  1T03 A;  1IG9 A;  3L2W A;  3L2Q A;  2XY5 A;  4OVL A;  4E7L A;  1N5Y A;  1JL1 A;  4CJ3 A;  3PO4 A;  4E3S A;  2AJQ A;  1HYV A;  4KHU A;  4CEZ A;  2FBT A;  3ZSZ A;  4KHY A;  1BQM A;  3IAY A;  3ASM A;  1HRH A;  1S9E A;  2BAN A;  3ALY A;  4TSX A;  1RT5 A;  4QAG A;  1CXU A;  4HUG A;  1ZYQ A;  5KRT A;  1TK5 A;  1T05 A;  3PX0 A;  1NOZ A;  4ELT A;  1WAF A;  3OJU A;  4FJM A;  2HHW A;  1BQN A;  4R5P A;  3KLE A;  3V9U A;  3C95 A;  1J5O A;  4IFY A;  4AHV A;  1RTI A;  2HNZ A;  1TK0 A;  1WAJ A;  4B8C A;  2Z1J A;  2HVI A;  2IDO A;  3T19 A;  3OYE A;  4AHT A;  4CEA A;  4CFC A;  5FRM A;  1C0U A;  3NBP A;  3O3F A;  1CLQ A;  4DFP A;  1SKR A;  4B8A B;  1T8E A;  3HYF A;  4I9Q A;  3RMC A;  4FM0 A;  1KSP A;  4CJE A;  4I7F A;  1FK9 A;  1TVR A;  3LAK A;  4CF9 A;  4DFJ A;  2Q3S A;  4FZZ A;  3QET A;  3RRH A;  1ITG A;  2YV0 X;  3VQQ A;  3CQ8 A;  3HP6 A;  3QES A;  3U3Y A;  3SCX A;  3L2U A;  4CHZ A;  4J2B A;  4KHQ A;  4QOZ B;  1KVC A;  2KFN A;  4W5R A;  4EP5 A;  4N56 A;  4OLB A;  2KFZ A;  4CIE A;  3OYM A;  1JXE A;  1G15 A;  3B6O A;  4FLZ A;  1NJY A;  3H08 A;  3S3N A;  3T1A A;  1YT3 A;  4N76 A;  3OYD A;  5J2P A;  2HHS A;  2YKM A;  4DU3 A;  5J2M A;  4ELU A;  5FRN A;  1IKY A;  1JL2 A;  1NOY A;  2ZD1 A;  3AVC A;  3RR8 A;  4FW1 A;  3A2F A;  3LP2 A;  2XHB A;  3OY9 A;  4FJ9 A;  4ZHR A;  3NGI A;  3KK2 A;  3HPG A;  4FLV A;  1S1V A;  1UOC A;  4E7I A;  2QXF A;  1EET A;  1TAQ A;  3ZT1 A;  2D0A A;  3M8P A;  3WNG A;  3SQ0 A;  4AHC A;  4B3O A;  1C6V A;  1TK8 A;  4MFB A;  1L3U A;  3DM2 A;  4KTW A;  3MXI A;  4ZTF A;  1KVA A;  3QEI A;  3V1R A;  3U6F A;  1NK7 A;  1U04 A;  3NHG A;  3HXM A;  3VQA A;  1NK8 A;  1RDC A;  3CM6 A;  3CG7 A;  2F8S A;  3F73 A;  2E4L A;  4H4O A;  3AO2 A;  4GMJ B;  1LV5 A;  4DSF A;  1J9A A;  1RBV A;  2DFH A;  4FJI A;  3UIQ A;  1HYZ A;  1WSG A;  3DRS A;  1QS4 A;  3ZT2 A;  3QO9 A;  4C8N A;  3K59 A;  1D9F A;  1BGX T;  3LZI A;  1BIS A;  1SL2 A;  4Z4I A;  1DLO A;  3AO5 A;  4CES A;  4CJF A;  3TAN A;  1SUQ A;  3I0R A;  2OPR A;  3HST B;  2G8H A;  4F3O A;  3QEW A;  3K5N A;  1WSJ A;  3RWU A;  5KI6 A;  3LPU A;  3ZSV A;  3PY8 A;  4L8R B;  4OKE A;  4CJQ A;  2P1J A;  2QKK A;  4BE1 A;  3HJF A;  2QKB A;  1XHZ A;  1BI4 B;  4HCB A;  3LP3 A;  5C42 A;  2HNY A;  4BDZ A;  4DTJ A;  4C8O A;  3AVJ A;  4FJ8 A;  1W0H A;  4LH5 A;  3S3O A;  3G10 A;  1TKD A;  1QSY A;  2HW3 A;  3AVK A;  1QQC A;  4KO0 A;  1X1P A;  3HP9 A;  3WNH A;  4OKJ A;  3KTQ A;  1C1C A;  4M3U A;  3LAN A;  4CJT A;  4Y1D A;  1RNH A;  1W9H A;  3NF9 A;  4M3Y A;  4Q0B A;  1HYS A;  3E01 A;  4O4G A;  4E89 A;  4CJV A;  3K5M A;  2HND A;  4DMN A;  5JS1 A;  3VQ9 A;  2OPS A;  3HM9 A;  4KAZ A;  3OYG A;  3TR8 A;  5J2N A;  1XWL A;  1CZB A;  1I3A A;  4CEF A;  3PO5 A;  3DLR A;  2P51 A;  1BIU A;  2F96 A;  2X6N A;  2XY8 A;  4FZX C;  1REV A;  1RT3 A;  4CIG A;  5D3G A;  3M8R A;  4N41 A;  3LWL A;  4N5S A;  3KK1 A;  4IFV A;  4KKO A;  4RW9 A;  3L3V A;  5CZ2 A;  1T7P A;  4B9U A;  2YHB A;  4DTO A;  2X74 A;  2ATQ A;  3HT3 A;  1NKB A;  1L3V A;  2PYJ A;  3NDK A;  4RW4 A;  3VQE A;  4CJW A;  5FDL A;  2YNG A;  3HPO A;  2BDP A;  3BDP A;  3F9K A;  4FJJ A;  3OYH A;  3LPT A;  2DFF A;  3VN5 A;  4M3T A;  4Z4G A;  3KIO A;  4IG0 A;  3AVF A;  4OKK A;  4BDP A;  3SQ2 A;  4FLX A;  2G8W A;  2OZM A;  4AHS A;  1HQE A;  2DFE A;  3OYK A;  1U45 A;  5HRN A;  3OS0 A;  4DQS A;  1U49 A;  1BHL A;  3DLH A;  1VSD A;  4PQU A;  3C6U A;  3O3H A;  1F21 A;  1S6P A;  1XI1 A;  4IG3 A;  1LWE A;  1RBU A;  4Z4E A;  4CE9 A;  1DTQ A;  1KVB A;  4G1Q A;  4C8M A;  4CGF A;  1YVU A;  1C1A A;  4CF8 A;  3QEV A;  1HNI A;  4C8K A;  1VSH A;  4FJL A;  1RT7 A;  1EP4 A;  4M3Z A;  4I9L A;  3V1Q A;  1RT6 A;  1U47 A;  4YFU A;  4AHU A;  3V9X A;  2ZQB A;  4BWM A;  2A1S A;  4DQQ A;  1BIZ A;  4KRE A;  3NE6 A;  4ID1 A;  3AVB A;  3MEE A;  2JGU A;  2KZM A;  1B92 A;  3ZSR A;  2W42 A;  2WON A;  4KTQ A;  3K5O A;  4CJU A;  2XY6 A;  3QIO A;  1N6Q A;  1YTU A;  3OJS A;  3QEP A;  4FLT A;  5HRS A;  4BAC A;  5K14 A;  4CJP A;  4KHW A;  1SV5 A;  4CER A;  1TL3 A;  3HVT A;  3KLI A;  3MEG A;  3AO4 A;  1ASU A;  5C24 A;  3VQP A;  4FK2 A;  5HRR A;  2E6M A;  3DLG A;  3ZT0 A;  1RTJ A;  4DTN A;  4FLU A;  4CHQ A;  1I39 A;  1RBR A;  4DSK A;  2P5G A;  3AVA A;  3HPH A;  1TGO A;  4DTR A;  3KD1 E;  1D9D A;  1JKH A;  1ZBF A;  2Z1I A;  5HRO A;  4HCC A;  4CGJ A;  4FXD A;  4E7J A;  4LSN A;  3AVM A;  4W5N A;  1JLA A;  2YHA A;  3P83 D;  1BL3 A;  1MU2 A;  4GW6 A;  5CZ1 A;  4HUE A;  2PYL A;  4FYD A;  4DFM A;  1KCF A;  2OYQ A;  1EX4 A;  3LP1 A;  2O4G A;  4OGE A;  2GUI A;  3OYA A;  1BCO A;  1LWC A;  4AIL C;  4DSI A;  1ZBL A;  2KTQ A;  2Y1I A;  1C1B A;  3FFI A;  3VQD A;  2X78 A;  4M41 A;  2HB5 A;  3SNN A;  5HRP A;  1IH7 A;  1B9D A;  1JLB A;  4F8R A;  3DMJ A;  3HL8 A;  1X9S A;  1ASV A;  4E1N A;  3P5J A;  1KLM A;  1VSM A;  4DTM A;  1RTH A;  3OYF A;  4H8K A;  3SUQ A;  1DTT A;  1KFD A;  2I5J A;  2VG6 A;  3VA3 A;  4KTZ A;  3NCI A;  4FCY A;  3PX4 A;  2KQ2 A;  4M45 A;  1D5A A;  4Q5V A;  3OYC A;  2A1R A;  3LZJ A;  4EZ6 A;  4E7K A;  4NCA A;  2VG7 A;  3LAL A;  2G8F A;  3TAR A;  2ETJ A;  2YNH A;  4JRQ A;  3ZSQ A;  4B9S A;  1HJR A;  3AA5 X;  4DS4 A;  2QK9 A;  3NH1 A;  4H4M A;  4FJN A;  4CJ5 A;  3PUF A;  2FBV A;  3VQ8 A;  4DF4 A;  1SKS A;  1U48 A;  4DWI A;  4J2A A;  4RW6 A;  1NK4 A;  4KV8 A;  2D0C A;  2PZS A;  2D5R A;  1VSI A;  2HHX A;  1RIL A;  3M8Q A;  2VWK A;  3WNE A;  1KLN A;  2NUB A;  2X6S A;  3SV4 A;  3AVN A;  4CGI A;  4F4K A;  2BE2 A;  3MEC A;  4CJL A;  1Y97 A;  5I42 A;  4N47 A;  4OPJ A;  3QEX A;  1GOC A;  3AV9 A;  3DLE A;  4FW2 A;  3K57 A;  3SZ2 A;  1QE1 A;  3RMD A;  3O4N A;  3QNO A;  4W5Q A;  2WOM A;  3AA4 A;  3AVI A;  4IBN A;  1X9W A;  2G8I A;  3NF7 A;  4FJG A;  1TV6 A;  1NK5 A;  3ZSW A;  2E6L A;  3V6D A;  4NCB A;  4I2P A;  3TAG A;  3EZ5 A;  3RMB A;  3NGZ A;  3LDS A;  5CYQ A;  2XY7 A;  1J53 A;  3VQ4 A;  4DFK A;  3THV A;  5I3U A;  2HHT A;  4ZTJ A;  3SYZ A;  3L2V A;  3NGY A;  4DTX A;  1RDB A;  2FC0 A;  3ITH A;  5DMR A;  3S9H A;  4DG1 A;  4KI4 A;  2HHQ A;  3V1O A;  1Z26 A;  2ZE2 A;  4BDY A;  1A5W A;  1RT2 A;  2LSN A;  3P1G A;  4CIF A;  3CFO A;  3SUP A;  1XC9 A;  3WNF A;  4PUO A;  4DF8 A;  3SV3 A;  4NYN A;  1HQU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...