4CJQA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
153
structure length
148
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 56
structure length 148
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cjqA00
1VSMA 2YKNA 3ASMA 2IDOA 4CF2A 3KLFA 1NK6A 2ITGA 1BL3A 3T3FA 4KHSA 1BHLA 1RT3A 4N5SA 4KI6A 1SL0A 4EP5A 1QQCA 5J2QA 3RR7A 2P51A 4B9VA 1O1WA 2HHTA 2BE2A 3CM6A 5HRRA 3LZJA 3JSMA 3VQQA 3LDSA 3TAFA 1C0UA 3NHGA 4E3SA 1TAUA 4KKOA 3VQ6A 3SUOA 5EU7A 3O3FA 1TL3A 4F3OA 1ITGA 2NUBA 3QEPA 2O4GA 1UWBA 4CHPA 5D3GA 4FLXA 1WN7A 3RR8A 3NF7A 3QLHA 1IH7A 4M3UA 3SQ4A 3HL8A 3MEEA 4I2PA 3DLRA 1HMVA 2OYQA 3T1AA 3QESA 1Z25A 4OGCA 1U45A 3IRXA 4KTWA 4CK1A 2Y1JA 4FJJA 3SZ2A 3V9WA 2HHUA 4NCGA 4KTZA 1CZBA 1W9HA 4KB0A 3O4QA 2YNIA 5C24A 1TV6A 4CGIA 4DTUA 3THVA 1WSGA 4O5BA 1LWEA 4OKJA 4J2AA 1TK0A 3A2FA 1KTQA 3G0ZA 4FLWA 4GVMA 4YNQA 5KGWA 1HQEA 3ZT1A 3AVIA 1C6VA 4KREA 3KKSA 1EP4A 1B92A 4ZTFA 1SKWA 4HCBA 4QOZB 1JKHA 1YT3A 2XHBA 4B9MA 1KVCA 1JLEA 1JLFA 2XY6A 4W5TA 1KLMA 3K5NA 3TABA 1NOYA 4Q0BA 3MXMA 4E7KA 4FLUA 3K5OA 2X74A 4OJRA 4ICLA 4E7HA 3SPZA 3PUFA 4CEQA 1BQNA 3P1GA 2JGUA 1S6QA 1RT2A 2ZQBA 3WNGA 4CEEA 4HUGA 2GV9A 3I0SA 3VQCA 2BGGA 4FJMA 4FJXA 2DTUA 4CK2A 3U3YA 5CZ1A 4B8CA 4JLHA 1A5WA 4GW6A 3TAMA 4CGGA 4HUEA 3ZCMA 4OLAA 1WSFA 3SI6A 3NH1A 1QSYA 5DMRA 2O4IA 3CFOA 4I7FA 4RW6A 4JS4A 3NGYA 5KRSA 3L2UA 4FZYA 1NJWA 3QEXA 1C1CA 1JXEA 4DTRA 1Q9XA 2RPIA 3VA3A 3U6FA 1KVAA 1LWCA 3OY9A 4OLBA 4CF0A 4CFDA 3LP0A 3KK3A 2HMIA 4F3TA 2D0CA 3AVFA 4IFVA 1TKXA 3QIPA 1SL1A 2F8SA 1KFSA 3QO9A 4ELVA 3O3GA 1NKBA 2D5RA 4IDKA 1R0AA 1X9SA 1RT4A 4ID1A 2X78A 1LW2A 1XHXA 4AH9A 1RTIA 3VQ7A 4B9NA 4PQUA 4E7IA 3QNNA 3BGRA 3CFPA 3ZSRA 3V1RA 3WNFA 3M8PA 4FM2A 3S3OA 2A1RA 4CIEA 3VQBA 3I8DA 3V9SA 1WLJA 4N56A 4DQSA 5SZTA 2XY5A 4DU4A 1MU2A 4LSNA 2LSNA 4BWJA 3VQ5A 3HP9A 4NYFA 5HRSA 4DWIA 2WOMA 2YV0X 3RRHA 1WNSA 1K6YA 2VWKA 4DSFA 3DM2A 3C95A 3AO1A 2Z1GA 3AA3A 4FJLA 5HBMA 4M41A 5J2PA 1J5OA 4FM1A 3VQ4A 3KK1A 1HRHA 4E7JA 3NH0A 5FRMA 3ZSVA 1LWFA 3LALA 3EYZA 2HVHA 3P5JA 1L3VA 2YNFA 1DTQA 3KD1E 4LH4A 3SJJA 2B5JA 3HYFA 3LZIA 1VSKA 3D45A 1VSHA 5I3UA 2OPSA 1RBSA 1ASUA 4IG0A 3VQAA 4R5PA 3HXMA 3SV4A 1VRTA 4RW4A 4LD0A 1RTDA 3AO4A 4FJHA 3L2WA 3LANA 4G1QA 3SUPA 1FXXA 3KIOA 4M3YA 1HYSA 1J53A 4BE0A 3FFIA 4CJQA 1EX4A 3DRRA 2DFFA 2OPRA 4XIUA 4OKKA 5CZ2A 2OPQA 4DTJA 5CYQA 1UA0A 3M8QA 1YTUA 1S1TA 3AVLA 4Y1CA 3VQ8A 4EZ6A 3K5LA 1NK9A 4KHQA 4CEZA 1T8EA 3AVMA 4RW8A 3L2QA 4FJKA 2HNZA 4CJ3A 5HROA 4CJKA 2F8TA 4KTQA 4GMJB 3OYBA 3L8BA 4LH5A 1IKYA 4W5QA 3NAEA 1VSJA 4FM0A 1NJZA 1RDCA 2W42A 1TAQA 4OVLA 4CJUA 3O3HA 1RT6A 4N76A 3HO1A 2IAJA 4I9LA 2B4JA 1S5JA 2OA8A 3MECA 4CJEA 3QETA 1IKVA 3ZSWA 4F2SA 3CFRA 1L5UA 1HPZA 5HP1A 4J2EA 1FKPA 3NBPA 3OVNA 5FDLA 3SPYA 1S1UA 3QIOA 4FVMA 4DU3A 2D0AA 3OYHA 1TVRA 1TKZA 4BDPA 4E0DA 4IBNA 3D0PA 2R7YA 2RKIA 1C0MA 3V9UA 3BDPA 4FK0A 1WSJA 1UOCA 2HHVA 4AHCA 3DLEA 4KO0A 1Q9YA 2WONA 4M3TA 1BIZA 3TANA 3JYTA 3SCXA 4I9QA 5SWMA 2JLEA 1JLBA 1ZBFA 3ZSZA 3NGIA 4Z4HA 4O0IA 3S9HA 4KI4A 4WE1A 4K8XA 2G8IA 1BCOA 4BDYA 1GOCA 4M3WA 4FYDA 1WSEA 2ETJA 3AO3A 3RMAA 3IS9A 4CEOA 3HM9A 3CQ8A 4JS5A 4Q5VA 1C1AA 3MAQA 1GOAA 2G8UA 3LWLA 3AVAA 3KD5E 1IKWA 1RBRA 3DLGA 1F21A 3HPGA 1TL1A 4CHQA 1I3AA 4CIFA 4KHUA 4DLGA 3RMDA 4F4KA 1KFDA 4CGDA 1FK9A 1SV5A 1UAXA 5JS1A 2VG5A 1X9MA 2KZZA 3OYJA 3PV8A 1RDDA 4L8RB 1JLCA 1RBUA 4FJIA 4MQ3A 5KTQA 2DFEA 4PA1A 1BI4B 3VQEA 3OJSA 1BCMA 3ZSYA 1NK8A 1S6PA 4FLTA 1ZYQA 1HYZA 4M3XA 2Z1HA 3OYFA 1SL2A 2QXFA 1VSEA 3T19A 1Y97A 4DQPA 1ZBIA 1KSPA 1I39A 1HQUA 3K5MA 4CGJA 3KTQA 3DI6A 2G8KA 5JS2A 1DLOA 2E6LA 1TKDA 4AILC 4FK4A 2FBYA 2YHBA 4E19A 5HRPA 1G15A 3WNHA 1BIUA 4AHVA 4DS5A 3ZSOA 1BI4A 2KTQA 4OPJA 3TARA 4W5RA 3IG1A 1WSHA 3LWMA 1RT1A 3RTVA 4M3RA 2G8VA 1L3UA 3L2RA 4DQIA 4O44A 4CCHA 4HCCA 2HHXA 4DG1A 3OYKA 1ZBLA 2YNGA 1C0TA 2G8HA 4FJGA 3V1OA 5E41A 4CF1A 1VSLA 3MXIA 3CG7A 4AHTA 2QKBA 1HNIA 1WAFA 3V1QA 4Z4IA 1JLQA 2PYJA 1NK0A 3TR8A 4CHZA 3RRGA 4DTSA 1J54A 2IS3A 3O4NA 2EHGA 2FBVA 1NK7A 4W5OA 2XO7A 4Z4FA 3LP3A 1NKCA 4IKFA 1L3SA 1D8YA 3V81A 1B9FA 4J2BA 2ATQA 2IGIA 3DLBA 4Z4GA 1CLQA 3SV3A 3TWHA 3OYDA 4LY7A 3OYMA 1S1VA 2GBZA 2KQ2A 4CJRA 1T05A 2P1JA 3DOKA 1GOBA 3ALYA 4H4MA 3TAPA 3PX0A 3RMBA 2I5JA 3NF9A 4KHNA 4KB1A 3V6DA 4C8MA 2B6AA 4NCBA 4HUFA 4RG8A 3C6TA 3CYMA 2KZMA 2F96A 1RILA 3E01A 5CYMA 4CJSA 3HSTB 2XY7A 4HHTA 2EX3A 3V9XA 4NYNA 3AA2A 3S3MA 1HNVA 3HP6A 5KRTA 3ZSQA 1SKSA 2HW3A 2KFNA 3DRSA 1C1BA 1SUQA 3V9ZA 1QSSA 1RDBA 2DFHA 2HB5A 4FLYA 2Y1IA 3QEVA 4AHSA 1NK5A 3AVGA 1RTHA 1WAJA 1REVA 1ZBUA 4CJ4A 3ITHA 2YHAA 3SYZA 3L3VA 3QEWA 3DLKA 4E1MA 1TKTA 1B9DA 4FXDA 1S9GA 2Q3SA 2KW4A 4CJTA 1D5AA 1IO2A 1QTMA 4DSKA 4BDZA 1NKEA 3DYAA 1BGXT 2PY5A 4FJNA 4B3OA 3QNOA 2HHWA 4CE9A 4BE1A 2KFZA 3SUNA 4ZTJA 4C8LA 5CY4A 3U3GA 3OYIA 4DF8A 4DTMA 1RCHA 3MEGA 4CFBA 3OYEA 1KVBA 3KLIA 3KLGA 1EXQA 1S1XA 4CJPA 4N41A 4Y1DA 5HLFA 4B9SA 2XY8A 1QE1A 3TAGA 4CGHA 3VA0A 1RDAA 3MXJA 4CFAA 4HTUA 2G8FA 4OPKA 1RBVA 1JLAA 3K57A 3AVBA 2RF2A 2HHQA 4CECA 4CESA 1HJRA 2P5OA 2A1SA 3NE6A 4Z4CA 4DLEA 4CJWA 4KV8A 4B9LA 1DTTA 1FKOA 5FROA 3K59A 1X9WA 4N47A 3HPOA 2GUIA 4FLZA 4DFJA 3ULDA 1LAWA 4PWDA 1VSDA 3LPTA 2AJQA 4IG3A 4CEFA 2E6MA 3AV9A 3SNNA 4FW1A 3OYAA 1QSLA 2QKKA 4EZ9A 3ZT4A 4DQQA 1JLGA 3I0RA 4FW2A 4M42A 3NDKA 3QINA 4F2RA 2HNDA 4CF8A 3NF6A 4CERA 4CJ5A 1S9EA 3H08A 3SQ0A 1LAVA 1D9FA 3SQ2A 3DLHA 3UIQA 4ZHRA 1A5XA 4JRPA 3NGZA 2YNHA 3OJUA 4DQRA 1N5YA 3F73A 3OS2A 3VQ9A 4ID5A 3ZSXA 4DFMA 2X6NA 2VG7A 4M45A 2BANA 4B08A 5J1EA 3TAEA 4FZXC 3KLHA 3DMJA 1EKEA 1NJYA 3IAYA 4C8KA 2E4LA 4QAGA 1CZ9A 4I2QA 1WSIA 4KRFA 4DFPA 3QERA 3L3UA 3M8SA 4O4GA 4EP4A 3HK2A 1EETA 3OYLA 2PYLA 4RW7A 1S1WA 1JL2A 3PX6A 4O55A 3P83D 3NFAA 1T7PA 1KRPA 1U04A 4CHNA 4KFBA 3AVNA 3AVJA 3C94A 4KHYA 4NCAA 4PUOA 1W0HA 4FCYA 4DSEA 4KAZA 4KHWA 1U4BA 2D0BA 5DK5A 4M3ZA 2HVIA 3LPUA 4AHRA 1U48A 1RTJA 2OZSA 4FJ5A 3HJFA 2G8WA 4UQGA 1TGOA 4W5NA 3RMCA 1XC9A 3M8RA 5I42A 3HVTA 3OS1A 3EY1A 3K58A 4B9TA 4Z0UA 4F8RA 1Q8IA 2RN2A 4YFUA 4FLVA 1U49A 3AVCA 3AO5A 3VQDA 4DTNA 1ASVA 1RT5A 1KCFA 1Z26A 3LP2A 3NF8A 4CK3A 4PY5A 4DU1A 4ELUA 4E1NA 2VG6A 3L2VA 2FC0A 3C6UA 4DS4A 3EZ5A 3RWUA 5KI6A 4BACA 2IOCA 4J2DA 4B8AB 1VK0A 3ISNC 5FRNA 2Z1JA 3ZT3A 1YTAA 3OYGA 4DMNA 3QEIA 4DTPA 1LW0A 2HHSA 1J9AA 4DTXA 1N6QA 4CEAA 3KJVA 5J2NA 2XRIA 1XHZA 1UA1A 3AA4A 4BWMA 3SQ1A 1ZBHA 1VRUA 1T03A 1QS4A 1RBTA 4DSLA 3G10A 2ZD1A 5C42A 3KLEA 1KLNA 1CXUA 1XI1A 2BDPA 4DSIA 4QCLA 1VSIA 4OKEA 4TSXA 2YKMA 1JL1A 1A5VA 1NJXA 2IC3A 3LAMA 4OGEA 1TK5A 1L3TA 4C8OA 1HYVA 2DY4A 4DFKA 3PY8A 3KK2A 4H4OA 1NK4A 3SUQA 4DSJA 4FK2A 4IFYA 4H8KA 5J2MA 3KKRA 4CJVA 3ZT0A 5K14A 3NCIA 1CXQA 1IG9A 4MFBA 2HNYA 3AA5X 4AHUA 1D9DA 1BQMA 3ZT2A 3B6PA 4CHYA 3OYCA 3HPHA 3HT3A 4DTOA 2OZMA 4K8ZA 3V4IA 1RT7A 4RW9A 5T7BA 3CM5A 3AVKA 4CJFA 1U47A 2X6SA 1JXBA 4HVJA 3PO4A 1IKXA 2ZE2A 4FJ7A 4E7LA 4CEDA 4Z4EA 3K2PA 3TAQA 4CFCA 4LSLA 2PZSA 2OPPA 3WNEA 3PO5A 4FJ8A 2FBXA 4CHOA 3MEDA 4CJLA 3LP1A 4CIGA 3B6OA 4DF4A 5HRNA 1YVUA 1RNHA 3DOLA 3OYNA 1LV5A 2P5GA 4ELTA 4BE2A 1XWLA 4O0JA 3VN5A 1QHTA 1NOZA 1VSFA 1SKRA 1BISA 3DRPA 3OS0A 3S3NA 2QK9A 4JRQA 4E89A 4KPYA 4CEBA 3F9KA 5KGXA 3AVHA 2FBTA 4FZZA 4C8NA 4CF9A 2VWJA 1TK8A 1X1PA 4CGFA 5C25A 3LAKA 3AO2A 3HVRA 4B9UA 3VQPA 4FJ9A 1ASWA 2Z1IA 3TI0A 3PX4A 3NH2A
chains in the Genus database with same CATH superfamily
1NK6A 1VQLN 1KAZA 4KHSA 1G99A 4N5SA 1H1VA 2P51A 2BE2A 5HRRA 3LZJA 4E3SA 3VQ6A 3SUOA 2O8EA 1ITGA 3O9QA 1QVFM 4O8UA 3OW2M 1UWBA 4CHPA 1WN7A 4M3UA 3TSQA 3HL8A 3IKMA 3MWPA 4X65K 1U45A 3SZ2A 4BY9C 3CD6N 2QW9A 4DKWA 2J4RA 2HHUA 4PL7A 4NCGA 4KTZA 1NBWA 1CZBA 4JI8K 3O4QA 4YOTA 4GV9A 4IFEA 1NGJA 3M5RA 1K8KB 1KTQA 2H3GX 3QICA 4FLWA 4YNQA 5KGWA 3O9RA 3AVIA 1GLFO 1B92A 4ZTFA 2O8CB 4A62A 1JKHA 1YT3A 4OPAA 4A2BA 2XY6A 1KLMA 3TABA 4OJRA 4JKCA 4CEQA 3QFPA 4IDHA 4CEEA 2VQFK 2GV9A 3I0SA 4A59A 3NH1A 1K8KA 3WXIA 4FZYA 1NJWA 1NGIA 1C1CA 3VA3A 4OLBA 3KK3A 2HMIA 2IIRA 3AGKA 2F8SA 1KFSA 3QO9A 1OKJA 3VERA 5M1PA 4RCHA 1QVGM 2P9NA 3QNNA 5KPZA 1YUWA 4CIEA 3V9SA 4DQSA 2LSNA 3BF1A 3E66A 3VQ5A 4NYFA 3JS6A 4IO9L 1WNSA 4DSFA 3C95A 3GG4A 3VOVA 3UKUA 4B1YB 4E7JA 1HRHA 3ZSVA 3EYZA 4DR7K 3MMVA 1VSKA 4B3MK 1X9WA 1T8EA 1VQKN 5AQNA 4RW4A 3L2WA 3LANA 1OVQA 1HYSA 1FXXA 3KIOA 1J53A 4BE0A 4XIUA 1EX4A 2DFFA 5CZ2A 5MLCQ 4DV3K 2D1KA 3CERA 4FWSA 5CYQA 2OCEA 3VQ8A 4BRDA 1NK9A 2QWRA 3AVMA 2HNZA 5HROA 5LL6Z 4KTQA 3L8BA 3CETA 4WQ5C 3NAEA 4LF7K 3L0QA 1NJZA 4CJUA 4OVLA 4H0OA 2IAJA 2OA8A 4F9OA 3MN6A 2E2NA 3CPWM 1FKPA 3NBPA 5AQWA 3FE1A 4JI1K 4DB3A 5ADXA 4FVMA 2CH5A 3VMFB 1Q18A 2A42A 3D0PA 3CCEN 3BDPA 4FK0A 3OHRA 4AHCA 3DLEA 1Q9YA 4BREA 4WYBA 4QS9A 3H1QA 5SWMA 2JLEA 4BVOA 1JLBA 1ZBFA 4HWIA 3S9HA 1BCOA 1GOCA 4M3WA 1SAZA 2ETJA 3AO3A 3RMAA 3HM9A 3M6GA 3MAQA 3LWLA 2VWBA 4B1ZA 4LFBK 4LF4K 1TUUA 4F4KA 4IJNA 5JS1A 2VG5A 2KZZA 3PV8A 2I7PA 2FSKA 5AQRA 5KTQA 3O9TA 3VQEA 4B3TK 2WTUA 1S3XA 4IO8A 4DR3K 2Z1HA 3OYFA 1SL2A 4JI3K 1VSEA 4DQPA 3K5MA 1U2VB 4CGJA 5JS2A 2E6LA 1VQMN 5FPEA 2WFBA 2YHBA 4L3QA 4PKIA 3P39A 1N36K 4MDBA 3VETA 2P9LB 3ZSOA 2IVPA 3MN7A 2P9UA 4M3RA 1ILYA 3THWB 3ZX3A 3MWTA 4BR0A 3OYKA 4CF1A 4AHTA 4JKAA 2QKBA 4ISFA 3V1QA 1JLQA 4CHZA 2QWLA 2A40A 1U2VA 2IS3A 3G4SN 4DQ8A 1NK7A 4Z4FA 1IBLK 1RDUA 3BY5A 2ATQA 4Z4GA 5AFUA 2HSTA 4LY7A 4BR9A 2GBZA 2P1JA 3DOKA 1GOBA 3J81O 3E9PA 2P9LA 3NF9A 4KB1A 5ADXH 4RG8A 3C6TA 5FLXO 4CJSA 3GBTA 2UXBK 4NYNA 3AA2A 5KRTA 1SKSA 3V9ZA 1RDBA 2DFHA 2HB5A 2NLXA 5BR8K 1I94K 3SMPA 3QEVA 4AHSA 1LCUA 3AVGA 3QBXA 4QS7A 3ITHA 3L3VA 4ILGB 5E84A 3CCSN 2D0OA 2KW4A 3VEOA 1QTMA 3FGUA 3DYAA 3CIPA 3N4PA 3QNOA 4BQLA 1VQPN 4DF8A 4CFBA 4Y1DA 2XY8A 1RGIA 1RDAA 2G8FA 3JAMO 1RBVA 2QM1A 3AVBA 1EWRA 3CCRN 1HJRA 3M1FA 1DTTA 4H5TA 2FXUA 5JLFA 4IOCL 2WC9A 4PWDA 5TKYA 5EVZA 4IG3A 1Q7YO 4ILHA 3J7AP 3AV9A 3SNNA 4BRQA 3ZT4A 5LMUK 2AP1A 1JLGA 1D4XA 4F2RA 3PIPL 4OPHA 4CF8A 5JVHL 4V19S 3DLHA 1LAVA 1A5XA 4JRPA 3NGZA 5JMVA 4DQRA 1RFQA 3F73A 3VQ9A 4B1XB 2E88A 5CHIA 5J1EA 3KLHA 3VF6A 2NRXA 1NJYA 1CZ9A 3DXMA 4DFPA 5M1OA 4O4GA 3OYLA 1JL2A 4BRFA 1ATRA 3UKRB 1IBMK 3OBYA 1U04A 3HZ6A 3AVJA 4KHYA 3H3NO 4FCYA 3KZBA 3D2FB 4AHRA 1HR0K 3MCAB 4M7XA 4JKDA 5I42A 2P9IA 2QWPA 4YFUA 4FLVA 3AVCA 3AO5A 4ISEA 1ASVA 1Z26A 3NF8A 5AQMA 4CK3A 3OA9A 1NGGA 3L2VA 3C6UA 1NGDA 3QBWA 3UKRA 1VK0A 3TSUA 4GKJK 3OYGA 4DTPA 1J9AA 1N6QA 3KJVA 5J2NA 1MWKA 1UA1A 2O8BB 1VRUA 5C0YA 3D2FA 1QZ5A 1RBTA 3G10A 5C42A 4DSIA 3THYB 2YKMA 4BC5A 5AQXA 1NJXA 3PX4A 3N4QA 5GIOA 4BVPA 4DSJA 4X66K 1NJIO 1CXQA 4MFBA 3GDQA 2ZJQL 1D9DA 1BQMA 3ZT2A 3OYCA 3HPHA 3V4IA 1RT7A 4RW9A 3ZYYX 5IWAK 5T7BA 1S72N 1JJ2M 3AVKA 4JI5K 3PO4A 1IKXA 3THYA 4EHTA 2FSNA 3R8EA 4FJ8A 1NGCA 4BRIA 3ENHA 2BH1A 5C12A 4CBWA 4DF4A 1RNHA 4JI2K 3OYNA 4ELTA 2E8AA 4BRMA 4NLCA 3BZCA 4H5WA 2V7ZA 3AAQA 2NRVA 4CF9A 5C15A 4ILJA 3AAPA 1X1PA 3AO2A 4IJAA 3W3DA 4FJ9A 2Z1IA 4IZ9A 2YKNA 4CF2A 2IDOA 3KLFA 1GLJO 2Q36A 1IBKK 4I6MB 4EP5A 5J2QA 5AZJA 4B9VA 1O1WA 2HMPA 3JSMA 3LDSA 3TAFA 2GELA 3UE5A 5EU7A 2HF3A 2O4GA 1VQON 2OYQA 3T1AA 4CZGA 1Z25A 4CD1A 3QESA 5GINA 4KTWA 2UUAK 1OVYA 2BTFA 4MLHA 4I6MA 1W9HA 1E4GT 1TV6A 3K9JA 4O5BA 3HBTA 4J2AA 1TK0A 4GVMA 1C6VA 2O8FB 1ATNA 1T6CA 3KKSA 2QWQA 2XHBA 4Q0BA 3MXMA 2X74A 3VEYA 4E7HA 4YDUC 1NWKA 1BQNA 1RT2A 5KQ8A 5HOOA 3VQCA 2BGGA 4FJXA 2RHKA 1XUPO 4B1UB 4B8CA 3TAMA 4CZHA 3HM8A 3I33A 3J8AA 3CMEN 3ZCMA 1WSFA 3SAFA 3EKSA 1QSYA 3NGYA 4C23A 3L4IA 5KRSA 4G9ZA 2O8FA 1JXEA 3U6FA 1LWCA 4CF0A 3LP0A 4DV2K 3QIPA 2UYTA 1NKBA 4H5RA 1VQ4N 4AH9A 4PQUA 5DM7L 1XHXA 5AZIB 3EEQA 3BGRA 3CFPA 3S3OA 5C2FA 5BPNA 3ULEA 4N56A 5SZTA 1N32K 3THXB 3I56N 1C0FA 3VENA 2WOMA 5LY3A 5H1SQ 2Z1GA 3AA3A 2FLOA 4FM1A 3KK1A 5FRMA 3T7ZA 2HVHA 2ZJPL 1VQ5N 3KD1E 3SJJA 3D45A 3CJBA 5I3UA 2OPSA 4WQ5A 5GIPA 1VRTA 1RTDA 5BRFA 4FJHA 4G1QA 3SUPA 4M3YA 2OZSA 1QQOA 1UA0A 3D6RA 1YTUA 3AVLA 4Y1CA 4FWRA 4KHQA 1NMDA 2FSJA 4CEZA 3L2QA 4FJKA 4CJKA 4GMJB 3OYBA 1VQ7N 1IKYA 4W5QA 1VSJA 4FM0A 1RDCA 2W42A 2KLAA 3O3HA 1RT6A 3HO1A 4A5BA 2B4JA 3WEEB 2UXDK 1W97L 3TTCA 4CJEA 5AQFA 2AA4A 4J2EA 5KPRA 1NG9A 4JI4K 4KH5A 3E1YA 3OVNA 3VTIA 3SPYA 3QIOA 1TKZA 4E0DA 3O5BA 1DGKN 2CGLA 2Q97A 3K0SA 2HHVA 3VEWA 1BIZA 3PIOL 3SCXA 2ASOA 4YHHK 4O0IA 3FZKA 5E26A 4K8XA 1HKGA 4H0TB 1WSEA 1NGBA 3HI0A 3IS9A 3CQ8A 4Q5VA 3WEEA 1XNRK 5AJ3K 2UXCK 1F21A 3ZX2A 4KHUA 3ID8A 3RMDA 4CGDA 1FK9A 1UAXA 4BG8A 4L8RB 1RBUA 2DFEA 4PA1A 1BI4B 1MWMA 4A57A 3OJSA 1BCMA 1NK8A 4FLTA 3CHWA 1W2BM 4M63C 4MLEA 2E5LK 1Y97A 1KSPA 1I39A 3DWLA 5C10A 3KTQA 3SAGA 2QTDA 4CI6A 4PHTX 3ID6A 4IEEA 1G15A 3LDOA 1BIUA 3P38A 3LDPA 4K41A 4DS5A 3IUCA 4B9QA 1BI4A 3RTVA 4BR5A 4HCCA 3L2RA 5LMNK 1NLVA 2YHXA 3I8BA 5M1FA 2VQEK 2HHXA 4DG1A 1JCGA 2YNGA 3OTOK 4FJGA 2O8CA 1VSLA 3CG7A 1WAFA 4OO1J 4CZFA 2W6KA 4W5OA 2XO7A 1NKCA 2CH6A 2QEXN 1CLQA 1B9FA 2IGIA 3DLBA 3SV3A 3CXCM 2GWKA 1T05A 5AQIA 3ALYA 3KWIA 4JEPA 3TAPA 1P90A 3MX2A 3V6DA 4FPAA 3CYMA 3O8MA 1RILA 2GTDA 2NRRA 3E01A 3VGMA 3T1HK 1HNXK 2YJFA 3V9XA 4WF9L 3CCQN 4GVEA 5TKWA 2PFUA 2KFNA 3ATUA 3DXKB 2ASPA 1C1BA 2Q1NA 1YJWN 4FLYA 2Y1IA 3CC2N 3QB0A 3QMLA 3CCMN 1RTHA 3H6EA 1ZBUA 4CJ4A 3QEWA 3E9OA 3DLKA 1B9DA 3EE8A 1S9GA 3L6QA 3VGKA 1D5AA 1IO2A 2PY5A 4FJNA 4MDAA 1E3MA 3SUNA 4ZTJA 4C8LA 5EOYA 4DTMA 4BRCA 3MEGA 4DR2K 1EXQA 1S1XA 3CPEA 4N41A 3HSCA 4JN4A 3TAGA 3CF5L 4CGHA 2WBNA 3MXJA 1GLBG 4BGAA 2HHQA 3A8YA 3LL3A 4CESA 1VQ9N 4H0PA 5FPMA 1FKOA 3TTFA 5FROA 1GLAG 4N47A 1LAWA 3QDKA 2AJQA 2F9TA 4AM7A 4CEFA 2E6MA 4DUZK 3EL2A 3VGLA 3OYAA 2WUSA 4EIAA 3MN9A 4FL9A 4BR2A 3F9MA 3UIQA 3H08A 2YI1A 4JI0K 5F1XA 1QQMA 3OS2A 3GL1A 3ZSXA 5AQQA 3TSPA 4FZXC 3TAEA 2E4LA 4QAGA 4I2QA 1WSIA 5ELZA 5AQYA 3M8SA 4EP4A 3HK2A 2PYLA 4RW7A 1OH5A 4O55A 3P83D 1GLLO 3AVNA 4GV6A 4DSEA 4KAZA 3AGRA 4FWLA 1U4BA 1C0GA 4FJ5A 1RTJA 3I55N 1TGOA 5HL7L 1BUPA 2CGKA 3RMCA 4W5NA 3M8RA 1YF5L 1M1KO 1YIJN 1ESVA 3HVTA 3OS1A 3EY1A 3K58A 1FW6A 4B9TA 1VQ6N 1Q8IA 2RN2A 3AARA 4FWOA 1FJGK 4JKEA 3R1XA 4PY5A 2VG6A 3RWUA 2GWJA 5LJWA 2Q0UA 3ISNC 5FRNA 3BP8A 5AR0A 3ZT3A 1TYQB 3QEIA 3VEZA 2VYPA 3L4QA 4H0VB 4QS8A 3A0IX 3FLCO 1T03A 4DSLA 5LJVA 3KLEA 2BDPA 1VSIA 3C6AA 4OKEA 3C7NB 4DHYA 4H5VA 3THWA 1L3TA 3MK6A 3PY8A 4H4OA 4WCEL 4FK2A 4YY3K 3KKRA 3CJCA 1BA0A 4CJVA 3ZT0A 4DV1K 1Z05A 1KC8O 3CQYA 1IG9A 1YJ9N 2HNYA 3AA5X 4AHUA 1TYQA 4CHYA 3O80A 4DTOA 4K8ZA 5CR4A 3CM5A 1U47A 1JXBA 2OTJN 2ZE2A 3C7NA 4CFCA 4LSLA 1EQYA 4CHOA 3WUHA 5AQZA 1IG8A 4CJLA 3LP1A 5HRNA 1XWLA 1VAZA 3R3LA 4O0JA 3VN5A 1VSFA 3CQXA 3S3NA 2QK9A 4BR4A 2QWMA 4DV7K 4E89A 4KPYA 3F9KA 2GUPA 3UB5A 4C1NI 5KGXA 3H45C 3IMXA 4FZZA 4C8NA 1TK8A 2Q0RA 3LAKA 3HVRA 4B9UA 2F7TA 1HJOA 3TI0A 2QKKA 3PO5A 3NH2A 1VSMA 3ASMA 1HKCA 2ITGA 3Q7BA 5BR9A 3T3FA 1BHLA 4HTLA 4KI6A 4B3SK 2A5XA 2HHTA 4JK7A 3VQQA 3F2KA 3JXUA 1C0UA 2FF3B 3NHGA 2OTLN 3P31A 3O3FA 4F3OA 3QEPA 4A5AA 4JAXA 3LM9A 4FLXA 5D3GA 3SQ4A 2QA4N 3MEEA 3DLRA 5AFUH 4DR6K 4OGCA 1KQSM 3IRXA 4FOIA 3HOSA 2Y1JA 4UY8O 3VF2A 2P9KB 3V9WA 4AF1A 2HBKA 3KK7A 2HOEA 4KB0A 2EWSA 2YNIA 5C24A 2ITMA 2ZGZA 4CGIA 4YDUA 3THVA 3O6WA 1LWEA 4OKJA 3G0ZA 1HQEA 3VPZA 5BRDA 2HHHK 1EWQA 1EP4A 4HCBA 1NU0A 4B9MA 1KVCA 3MCPA 1JLFA 4PKHA 3K5NA 4YOWA 1QHAA 4FLUA 3K5OA 4ICLA 4JHDB 5M1NA 2JGUA 1S6QA 2ZQBA 4RTFD 2DTUA 4FJMA 5CZ1A 4JLHA 1A5WA 5M1QA 4HUEA 1WOQA 1N34K 3SI6A 3ATVA 3FZMA 2O4IA 3CFOA 4BROA 4JS4A 4LF9K 2BUPA 4DTRA 2RPIA 1KVAA 1R59O 3OY9A 1BO5O 4CFDA 4F3TA 3AVFA 4O5FA 4ELVA 3OBWA 4GY2B 1YVNA 3EZWA 4IDKA 1X9SA 1RT4A 4ID1A 2X78A 4B9NA 1RTIA 2DPNA 5AQSA 3SMSA 3V1RA 4WFNL 3I8DA 2PBDA 1WLJA 2XY5A 3RVCA 5HRSA 4LSNA 2YV0X 2O8BA 2VWKA 3W0LA 4XH1A 2VGNA 4FJLA 5HBMA 4M41A 1BDGA 3NH0A 4WFAL 1LWFA 3LALA 1L3VA 2YNFA 4LH4A 2B5JA 3LZIA 3VQAA 1ASUA 3HXMA 4LF8K 4LD0A 3AO4A 4B3RK 3FFIA 4CJQA 3DRRA 4DTJA 2OPQA 1YXQA 5JICA 1S1TA 4EZ6A 1NGHA 3A5OC 3K5LA 4RW8A 1KD1O 3DAWA 1QQNA 4C1NK 4RWTA 3O4WA 4H0XB 2PAVA 4IWVA 2IVOA 3MECA 4LFCK 3CFRA 4GKKK 1L5UA 2QWNA 1HPZA 5AQTA 5FDLA 1XMOK 4DU3A 3OYHA 1K9MO 4IBNA 2R7YA 2RKIA 3V9UA 1V4SA 4KO0A 1HLUA 4M3TA 3TANA 2E1ZA 5DM6L 3JYTA 3FZFA 3NGIA 4Z4HA 1JCFA 1HKBA 4FYDA 3IFRA 2E1YA 1C1AA 4DV6K 3AVAA 1RBRA 3HPGA 3DLGA 1NGAA 5AQLA 1TL1A 5KPTA 1I3AA 1KFDA 1SV5A 5KQDA 1RDDA 1NGEA 4MQ3A 3J80O 4FO0A 2RE2A 1DT9A 1X3MA 1S6PA 1ZYQA 2ASMA 2QXFA 4GV3A 4CW7B 1ZBIA 3RSEB 2ZJRL 1HQUA 2G8KA 2UUCK 1DLOA 1TKDA 4BRKA 2FBYA 4R79A 5HRPA 3CJ9A 3ZEUB 3WNHA 4KHPK 4BC4A 3IG1A 2QXLA 1WSHA 3LWMA 1RT1A 2G8VA 1L3UA 4JI6K 3H3OB 1YI2N 4CCHA 2NRWA 1ZBLA 3ZLJA 1C0TA 1VHXA 2G8HA 3G6EN 4FOEA 5E41A 2HBLA 3MXIA 1HNIA 4Z4IA 1NK0A 3TR8A 3RRGA 3O08A 5GAEP 3A5MC 1J54A 3O4NA 4Y0WA 2FBVA 1V4TA 1T44A 2QWOA 4U7BA 4IKFA 1D8YA 1ZBSA 3WT0A 4J2BA 3OYMA 1KAXA 1S1VA 2KQ2A 3Q7CA 4H4MA 1TUYA 4DR5K 5JLHA 4NCBA 2YCHA 4WQ4C 4FVUA 2KZMA 1HNWK 5BRHA 4H03B 1YAGA 1DKGD 2XY7A 3HP6A 2ZGYA 3ZSQA 4DUYK 3DRSA 1SUQA 3CCUN 5AZIA 2P9SB 1NK5A 3R9PA 4Z94A 1WAJA 4YOUA 2YHAA 3THXA 4E1MA 3MN5A 4DCHA 4CJTA 2ZF5O 4BDZA 5AQUA 1BGXT 4XH5A 2HHWA 4CE9A 4BE1A 2KFZA 5CY4A 3OYIA 3KLGA 3MDQA 3CCLN 5HLFA 4B9SA 1QE1A 3J7ZO 1JLAA 3K57A 5BN9A 4CECA 2P5OA 2A1SA 5BPMA 4B9LA 2P9SA 4CZEA 3K59A 3HPOA 2GUIA 4FLZA 4DFJA 1WBBA 2F4VK 3A5LC 3AY9A 1VSDA 3G71N 3LPTA 1QSLA 1P8ZA 4IXCA 3I0RA 4M42A 3NDKA 3QINA 2A6AA 4M7YA 1D9FA 2QI2A 3SQ2A 4ZHRA 2YNHA 3OJUA 1N5YA 4ID5A 5AQGA 4U67L 2NRHA 2VGMA 2VG7A 2BANA 4M45A 4DFMA 4B1WB 1BA1A 4C8KA 2E2OA 3L3UA 4AQYK 3WQTA 1T6DA 4CBXA 4CZIA 4IEIA 3PX6A 1Q86O 2UUBK 4JKHA 5A2QO 4CHNA 3GE1A 4KFBA 4KH6A 3C94A 4YOVA 4NCAA 2GEMA 2D0BA 4BRHA 4M3ZA 3LPUA 4IOXA 3SK3A 4BRLA 4JYAK 1X3NA 4BRPA 3CC4N 3QFUA 3S41A 2W40A 4Z0UA 4JNEA 5GADP 3ZX0A 3VQDA 3KWGA 3LP2A 4ELUA 3O1WA 4E1NA 4DS4A 2P9NB 3EZ5A 5KI6A 2IOCA 1YTAA 3SBGA 4DTXA 3SQ1A 4BWMA 3DLLL 3O9SA 4E1JA 4B1VA 4H0YB 2ZD1A 3UKUB 1XI1A 4QCLA 4BQZA 1JL1A 1A5VA 2IC3A 3LAMA 1TK5A 2D0PA 3BUZB 4DV4K 4DFKA 1SQKA 3DJCA 5F2RA 1NK4A 3SUQA 4IFYA 1EO1A 5K14A 3PLAA 3FFKB 2YX6A 1Y64A 3HT3A 2X6SA 4HVJA 4FJ7A 4Z4EA 5CE3A 3R6MA 2PZSA 2OPPA 3WNEA 2FBXA 4CZKA 3MEDA 5BPLA 4O8KA 1LV5A 1YVUA 2P5GA 3NMUA 4LC9B 4BRGA 4BE2A 1IJJA 1QHTA 1GLDG 4YOXA 1NOZA 3DXKA 3DRPA 2VCPA 5EXWA 5AQPA 1YITN 3CC7N 1YHQN 3TPQA 5AQKA 3SAHA 3AVHA 2FF6A 3WXKA 3NVKA 4FSVA 1MA9B 5C25A 1KXPA 3VQPA 5F0XA 1CZAN 4DV0K 1BL3A 4EAHD 2ZM6K 2A3ZA 1RT3A 1SL0A 5AQHA 2V7YA 1QQCA 3RR7A 3CM6A 1HPMA 4IOAL 1NMNA 2E2QA 1TAUA 4KKOA 2A41A 1DEJA 3P4IA 1TL3A 3U4LA 2NUBA 4DR1K 1Q81O 3RR8A 3NF7A 3QLHA 1IH7A 2NZTA 3D7EO 4I2PA 3K9KA 1HMVA 1W7AA 5BN8A 4BC2A 3LDLA 3EN9A 3HRGA 5BREA 4CK1A 4FJJA 4FWPA 1OH7A 1BG3A 4CZMA 1WUAA 1XMQK 4DTUA 1WSGA 2V52B 3A2FA 2KKZA 2P9UB 3ZT1A 4K25A 4KREA 3U9ZA 1SKWA 4QOZB 4CVNE 3C0BA 1JLEA 2E20A 1NOYA 4W5TA 4FWMA 4E7KA 4JV5K 3SPZA 3PUFA 2E2PA 3P1GA 1U6ZA 3WNGA 4HUGA 3C6HA 4CK2A 3U3YA 4GW6A 1O13A 4CGGA 3FZHA 4OLAA 4NB4A 5DMRA 5AQVA 2I7NA 1VQNN 4I7FA 4RW6A 4XEIA 4KBOA 3L2UA 3QEXA 1Q9XA 1OH6A 2D0CA 1SL1A 4IFVA 1TKXA 3O3GA 4DR4K 2D5RA 1J5EK 3CJ1A 1R0AA 1LW2A 3VQ7A 3ENOA 4E7IA 2KHOA 3ZSRA 3WNFA 4FM2A 3M8PA 2A1RA 3VQBA 4FPBA 1SZ2A 3TU5A 1MU2A 4DU4A 4BWJA 4BG9A 3HP9A 4DWIA 3RRHA 4K42A 1K6YA 3DM2A 3AO1A 5J2PA 1J5OA 3VQ4A 5C2DA 4JKFA 1JCEA 1K8AO 4PL8A 3P5JA 1DTQA 3WQUA 4CZJA 3HYFA 3WXMB 3WXLA 1VSHA 1RBSA 3SV4A 4IG0A 4R5PA 3CCJN 4JK8A 3NVMA 2OPRA 3CJ7A 2OANA 3M3ZA 4OKKA 2W41A 2NNWA 3M8QA 4NLBA 3SLCA 2F8TA 4CJ3A 5AQJA 4LH5A 1TAQA 4N76A 3VESA 4I9LA 1S5JA 4EHUA 3QETA 1IKVA 3ZSWA 4F2SA 1N33K 3PSIA 1XC3A 1IV0A 5HP1A 1T3VA 1S1UA 4BDPA 2D0AA 1TVRA 1C0MA 3T69A 1WSJA 1UOCA 4XH4A 2WONA 3F5TA 4DV5K 3DXMB 4I9QA 3VTHA 4CJ7A 3ZSZA 4KI4A 3ZETB 2G8IA 5FPNA 4WE1A 5EY4A 1QZ6A 1ZC6A 4BDYA 3J7YP 4CEOA 2JWKA 4PKGA 4JS5A 4JI7K 1GOAA 2G8UA 1XNQK 4BC3A 3KD5E 1IKWA 4CHQA 4CIFA 4DLGA 3U9DA 4LFAK 3LDNA 1X9MA 3OYJA 1JLCA 1NNEA 4FJIA 2P9IB 3ZSYA 1HYZA 2YHWA 4M3XA 2IVNA 3KVGA 1M90O 3ZETA 3T19A 5M1KA 2F9WA 4OX9K 3H1VX 3DI6A 2HBJA 2P9KA 1NGFA 3BF3A 4AILC 2CGJA 5EX5A 3SBTA 4FK4A 4E19A 3B8AX 1BWFO 3GOIA 2V51B 4AHVA 1N8RO 3HOTA 2KTQA 4OPJA 3TARA 4W5RA 1ZXOA 4JKGB 4DQIA 4O44A 3FR0A 3V1OA 1LOTB 3G25A 1NM1A 1X9JA 2D4WA 4WQ4A 2PYJA 4CZLA 4DTSA 2EHGA 4JHDA 1RDWX 3LP3A 1L3SA 3V81A 3TWHA 3OYDA 4CJRA 3O9UA 3U8XA 4FWKA 4ISGA 3PX0A 3RMBA 2I5JA 4KHNA 2P9PB 2B6AA 4C8MA 4HUFA 4JKGA 3WXJA 2F96A 5CYMA 3HSTB 4HHTA 3E9LA 2EX3A 3S3MA 1HNVA 4K0KK 3CI5A 2HW3A 3LDQA 4YORA 4NXNK 1QSSA 2HBMA 5B8HA 2Q2RA 1REVA 4GNIA 3SYZA 1TKTA 4FXDA 1WB9A 3TTDA 2Q3SA 2NRZA 2P9PA 4DSKA 3EKUA 5I9EB 1NKEA 4B3OA 2O8DB 2ZWHA 4NO7A 3U3GA 4JK9A 1RCHA 3OYEA 2Q31A 1SS6A 1KVBA 3KLIA 3BEXA 4KH4A 4CJPA 5AZJB 3VA0A 1GLEG 4CFAA 4HTUA 4OPKA 3IDHA 4J8FA 2RF2A 4BRAA 3NE6A 4Z4CA 4DLEA 4CJWA 4KV8A 4CBUA 1VQ8N 4JKBA 4LF5K 3ULDA 3EO3A 5GAGP 3VEVA 3LM2A 4FW1A 4EZ9A 4DQQA 4EFHA 2O8DA 3SJHA 4FW2A 1KAYA 3T1YK 2HNDA 3NF6A 4CERA 4CJ5A 4X62K 1MDUB 3VEXA 1S9EA 3SQ0A 1BU6O 3A5NC 5GAHP 2X6NA 4B08A 5JVGL 3DMJA 1EKEA 3IAYA 4NXMK 4K43A 4KRFA 1Q82O 3QERA 1EETA 1S1WA 4JD2B 1WBDA 3NFAA 1T7PA 1KRPA 4LF6K 3D2EB 4PUOA 3EE9A 1W0HA 4MO4A 3CCVN 4KHWA 3ENBA 5DK5A 2HVIA 1ATSA 1U48A 2W6LA 3HJFA 2G8WA 4UQGA 1XC9A 4F8RA 1J6ZA 1U49A 3FZLA 1K73O 3C65A 4DTNA 1RT5A 1KCFA 4DU1A 2FC0A 4BGBA 3RSEA 4JD2A 4BACA 4J2DA 4B8AB 4FWQA 1HX1A 2Z1JA 3CJAA 3ULEB 3D2EA 4AM6A 4DMNA 2HHSA 1LW0A 4BR7A 3MX5A 4CEAA 2XRIA 4A2AA 2JWLA 3AA4A 1XHZA 1ZBHA 1QS4A 3ZEUA 1KLNA 1CXUA 1XQSC 4TSXA 2HF4A 4OGEA 4C8OA 1HYVA 2DY4A 1BOTO 3O1BA 3PSFA 3KK2A 5IT9O 4H8KA 5J2MA 2NRTA 3NCIA 4BRNA 1HUXA 3B6PA 2OZMA 4FWNA 4CJFA 1GLCG 1HNZK 4E7LA 4CEDA 3K2PA 2UU9K 3TAQA 3CMAN 4CIGA 3B6OA 4X64K 3DOLA 4A61A 4MO5A 5AQOA 1SKRA 3VF4A 1E4FT 2GX9A 2YHYA 1BISA 3OS0A 4WFBL 1Z6RA 4JRQA 1OH8A 3H46O 4CEBA 2O8EB 4CD3A 1YJNN 4H5NA 3HTVA 2FBTA 2VWJA 4YOYA 4CGFA 3KHYA 5FPDA 3BZKA 1ASWA 2YJEA 1S22A
chains in the Genus database with same CATH topology
1VSMA 2YKNA 3ASMA 2IDOA 4CF2A 3KLFA 1NK6A 2ITGA 1BL3A 3T3FA 4KHSA 1BHLA 1RT3A 4N5SA 4KI6A 1SL0A 4EP5A 1QQCA 5J2QA 3RR7A 2P51A 4B9VA 1O1WA 2HHTA 2BE2A 3CM6A 5HRRA 3LZJA 3JSMA 3VQQA 3LDSA 3TAFA 1C0UA 3NHGA 4E3SA 1TAUA 4KKOA 3VQ6A 3SUOA 5EU7A 3O3FA 1TL3A 4F3OA 1ITGA 2NUBA 3QEPA 2O4GA 1UWBA 4CHPA 5D3GA 4FLXA 1WN7A 3RR8A 3NF7A 3QLHA 1IH7A 4M3UA 3SQ4A 3HL8A 3MEEA 4I2PA 3DLRA 1HMVA 2OYQA 3T1AA 3QESA 1Z25A 4OGCA 1U45A 3IRXA 4KTWA 4CK1A 2Y1JA 4FJJA 3SZ2A 3V9WA 2HHUA 4NCGA 4KTZA 1CZBA 1W9HA 4KB0A 3O4QA 2YNIA 5C24A 1TV6A 4CGIA 4DTUA 3THVA 1WSGA 4O5BA 1LWEA 4OKJA 4J2AA 1TK0A 3A2FA 1KTQA 3G0ZA 4FLWA 4GVMA 4YNQA 5KGWA 1HQEA 3ZT1A 3AVIA 1C6VA 4KREA 3KKSA 1EP4A 1B92A 4ZTFA 1SKWA 4HCBA 4QOZB 1JKHA 1YT3A 2XHBA 4B9MA 1KVCA 1JLEA 1JLFA 2XY6A 4W5TA 1KLMA 3K5NA 3TABA 1NOYA 4Q0BA 3MXMA 4E7KA 4FLUA 3K5OA 2X74A 4OJRA 4ICLA 4E7HA 3SPZA 3PUFA 4CEQA 1BQNA 3P1GA 2JGUA 1S6QA 1RT2A 2ZQBA 3WNGA 4CEEA 4HUGA 2GV9A 3I0SA 3VQCA 2BGGA 4FJMA 4FJXA 2DTUA 4CK2A 3U3YA 5CZ1A 4B8CA 4JLHA 1A5WA 4GW6A 3TAMA 4CGGA 4HUEA 3ZCMA 4OLAA 1WSFA 3SI6A 3NH1A 1QSYA 5DMRA 2O4IA 3CFOA 4I7FA 4RW6A 4JS4A 3NGYA 5KRSA 3L2UA 4FZYA 1NJWA 3QEXA 1C1CA 1JXEA 4DTRA 1Q9XA 2RPIA 3VA3A 3U6FA 1KVAA 1LWCA 3OY9A 4OLBA 4CF0A 4CFDA 3LP0A 3KK3A 2HMIA 4F3TA 2D0CA 3AVFA 4IFVA 1TKXA 3QIPA 1SL1A 2F8SA 1KFSA 3QO9A 4ELVA 3O3GA 1NKBA 2D5RA 4IDKA 1R0AA 1X9SA 1RT4A 4ID1A 2X78A 1LW2A 1XHXA 4AH9A 1RTIA 3VQ7A 4B9NA 4PQUA 4E7IA 3QNNA 3BGRA 3CFPA 3ZSRA 3V1RA 3WNFA 3M8PA 4FM2A 3S3OA 2A1RA 4CIEA 3VQBA 3I8DA 3V9SA 1WLJA 4N56A 4DQSA 5SZTA 2XY5A 4DU4A 1MU2A 4LSNA 2LSNA 4BWJA 3VQ5A 3HP9A 4NYFA 5HRSA 4DWIA 2WOMA 2YV0X 3RRHA 1WNSA 1K6YA 2VWKA 4DSFA 3DM2A 3C95A 3AO1A 2Z1GA 3AA3A 4FJLA 5HBMA 4M41A 5J2PA 1J5OA 4FM1A 3VQ4A 3KK1A 1HRHA 4E7JA 3NH0A 5FRMA 3ZSVA 1LWFA 3LALA 3EYZA 2HVHA 3P5JA 1L3VA 2YNFA 1DTQA 3KD1E 4LH4A 3SJJA 2B5JA 3HYFA 3LZIA 1VSKA 3D45A 1VSHA 5I3UA 2OPSA 1RBSA 1ASUA 4IG0A 3VQAA 4R5PA 3HXMA 3SV4A 1VRTA 4RW4A 4LD0A 1RTDA 3AO4A 4FJHA 3L2WA 3LANA 4G1QA 3SUPA 1FXXA 3KIOA 4M3YA 1HYSA 1J53A 4BE0A 3FFIA 4CJQA 1EX4A 3DRRA 2DFFA 2OPRA 4XIUA 4OKKA 5CZ2A 2OPQA 4DTJA 5CYQA 1UA0A 3M8QA 1YTUA 1S1TA 3AVLA 4Y1CA 3VQ8A 4EZ6A 3K5LA 1NK9A 4KHQA 4CEZA 1T8EA 3AVMA 4RW8A 3L2QA 4FJKA 2HNZA 4CJ3A 5HROA 4CJKA 2F8TA 4KTQA 4GMJB 3OYBA 3L8BA 4LH5A 1IKYA 4W5QA 3NAEA 1VSJA 4FM0A 1NJZA 1RDCA 2W42A 1TAQA 4OVLA 4CJUA 3O3HA 1RT6A 4N76A 3HO1A 2IAJA 4I9LA 2B4JA 1S5JA 2OA8A 3MECA 4CJEA 3QETA 1IKVA 3ZSWA 4F2SA 3CFRA 1L5UA 1HPZA 5HP1A 4J2EA 1FKPA 3NBPA 3OVNA 5FDLA 3SPYA 1S1UA 3QIOA 4FVMA 4DU3A 2D0AA 3OYHA 1TVRA 1TKZA 4BDPA 4E0DA 4IBNA 3D0PA 2R7YA 2RKIA 1C0MA 3V9UA 3BDPA 4FK0A 1WSJA 1UOCA 2HHVA 4AHCA 3DLEA 4KO0A 1Q9YA 2WONA 4M3TA 1BIZA 3TANA 3JYTA 3SCXA 4I9QA 5SWMA 2JLEA 1JLBA 1ZBFA 3ZSZA 3NGIA 4Z4HA 4O0IA 3S9HA 4KI4A 4WE1A 4K8XA 2G8IA 1BCOA 4BDYA 1GOCA 4M3WA 4FYDA 1WSEA 2ETJA 3AO3A 3RMAA 3IS9A 4CEOA 3HM9A 3CQ8A 4JS5A 4Q5VA 1C1AA 3MAQA 1GOAA 2G8UA 3LWLA 3AVAA 3KD5E 1IKWA 1RBRA 3DLGA 1F21A 3HPGA 1TL1A 4CHQA 1I3AA 4CIFA 4KHUA 4DLGA 3RMDA 4F4KA 1KFDA 4CGDA 1FK9A 1SV5A 1UAXA 5JS1A 2VG5A 1X9MA 2KZZA 3OYJA 3PV8A 1RDDA 4L8RB 1JLCA 1RBUA 4FJIA 4MQ3A 5KTQA 2DFEA 4PA1A 1BI4B 3VQEA 3OJSA 1BCMA 3ZSYA 1NK8A 1S6PA 4FLTA 1ZYQA 1HYZA 4M3XA 2Z1HA 3OYFA 1SL2A 2QXFA 1VSEA 3T19A 1Y97A 4DQPA 1ZBIA 1KSPA 1I39A 1HQUA 3K5MA 4CGJA 3KTQA 3DI6A 2G8KA 5JS2A 1DLOA 2E6LA 1TKDA 4AILC 4FK4A 2FBYA 2YHBA 4E19A 5HRPA 1G15A 3WNHA 1BIUA 4AHVA 4DS5A 3ZSOA 1BI4A 2KTQA 4OPJA 3TARA 4W5RA 3IG1A 1WSHA 3LWMA 1RT1A 3RTVA 4M3RA 2G8VA 1L3UA 3L2RA 4DQIA 4O44A 4CCHA 4HCCA 2HHXA 4DG1A 3OYKA 1ZBLA 2YNGA 1C0TA 2G8HA 4FJGA 3V1OA 5E41A 4CF1A 1VSLA 3MXIA 3CG7A 4AHTA 2QKBA 1HNIA 1WAFA 3V1QA 4Z4IA 1JLQA 2PYJA 1NK0A 3TR8A 4CHZA 3RRGA 4DTSA 1J54A 2IS3A 3O4NA 2EHGA 2FBVA 1NK7A 4W5OA 2XO7A 4Z4FA 3LP3A 1NKCA 4IKFA 1L3SA 1D8YA 3V81A 1B9FA 4J2BA 2ATQA 2IGIA 3DLBA 4Z4GA 1CLQA 3SV3A 3TWHA 3OYDA 4LY7A 3OYMA 1S1VA 2GBZA 2KQ2A 4CJRA 1T05A 2P1JA 3DOKA 1GOBA 3ALYA 4H4MA 3TAPA 3PX0A 3RMBA 2I5JA 3NF9A 4KHNA 4KB1A 3V6DA 4C8MA 2B6AA 4NCBA 4HUFA 4RG8A 3C6TA 3CYMA 2KZMA 2F96A 1RILA 3E01A 5CYMA 4CJSA 3HSTB 2XY7A 4HHTA 2EX3A 3V9XA 4NYNA 3AA2A 3S3MA 1HNVA 3HP6A 5KRTA 3ZSQA 1SKSA 2HW3A 2KFNA 3DRSA 1C1BA 1SUQA 3V9ZA 1QSSA 1RDBA 2DFHA 2HB5A 4FLYA 2Y1IA 3QEVA 4AHSA 1NK5A 3AVGA 1RTHA 1WAJA 1REVA 1ZBUA 4CJ4A 3ITHA 2YHAA 3SYZA 3L3VA 3QEWA 3DLKA 4E1MA 1TKTA 1B9DA 4FXDA 1S9GA 2Q3SA 2KW4A 4CJTA 1D5AA 1IO2A 1QTMA 4DSKA 4BDZA 1NKEA 3DYAA 1BGXT 2PY5A 4FJNA 4B3OA 3QNOA 2HHWA 4CE9A 4BE1A 2KFZA 3SUNA 4ZTJA 4C8LA 5CY4A 3U3GA 3OYIA 4DF8A 4DTMA 1RCHA 3MEGA 4CFBA 3OYEA 1KVBA 3KLIA 3KLGA 1EXQA 1S1XA 4CJPA 4N41A 4Y1DA 5HLFA 4B9SA 2XY8A 1QE1A 3TAGA 4CGHA 3VA0A 1RDAA 3MXJA 4CFAA 4HTUA 2G8FA 4OPKA 1RBVA 1JLAA 3K57A 3AVBA 2RF2A 2HHQA 4CECA 4CESA 1HJRA 2P5OA 2A1SA 3NE6A 4Z4CA 4DLEA 4CJWA 4KV8A 4B9LA 1DTTA 1FKOA 5FROA 3K59A 1X9WA 4N47A 3HPOA 2GUIA 4FLZA 4DFJA 3ULDA 1LAWA 4PWDA 1VSDA 3LPTA 2AJQA 4IG3A 4CEFA 2E6MA 3AV9A 3SNNA 4FW1A 3OYAA 1QSLA 2QKKA 4EZ9A 3ZT4A 4DQQA 1JLGA 3I0RA 4FW2A 4M42A 3NDKA 3QINA 4F2RA 2HNDA 4CF8A 3NF6A 4CERA 4CJ5A 1S9EA 3H08A 3SQ0A 1LAVA 1D9FA 3SQ2A 3DLHA 3UIQA 4ZHRA 1A5XA 4JRPA 3NGZA 2YNHA 3OJUA 4DQRA 1N5YA 3F73A 3OS2A 3VQ9A 4ID5A 3ZSXA 4DFMA 2X6NA 2VG7A 4M45A 2BANA 4B08A 5J1EA 3TAEA 4FZXC 3KLHA 3DMJA 1EKEA 1NJYA 3IAYA 4C8KA 2E4LA 4QAGA 1CZ9A 4I2QA 1WSIA 4KRFA 4DFPA 3QERA 3L3UA 3M8SA 4O4GA 4EP4A 3HK2A 1EETA 3OYLA 2PYLA 4RW7A 1S1WA 1JL2A 3PX6A 4O55A 3P83D 3NFAA 1T7PA 1KRPA 1U04A 4CHNA 4KFBA 3AVNA 3AVJA 3C94A 4KHYA 4NCAA 4PUOA 1W0HA 4FCYA 4DSEA 4KAZA 4KHWA 1U4BA 2D0BA 5DK5A 4M3ZA 2HVIA 3LPUA 4AHRA 1U48A 1RTJA 2OZSA 4FJ5A 3HJFA 2G8WA 4UQGA 1TGOA 4W5NA 3RMCA 1XC9A 3M8RA 5I42A 3HVTA 3OS1A 3EY1A 3K58A 4B9TA 4Z0UA 4F8RA 1Q8IA 2RN2A 4YFUA 4FLVA 1U49A 3AVCA 3AO5A 3VQDA 4DTNA 1ASVA 1RT5A 1KCFA 1Z26A 3LP2A 3NF8A 4CK3A 4PY5A 4DU1A 4ELUA 4E1NA 2VG6A 3L2VA 2FC0A 3C6UA 4DS4A 3EZ5A 3RWUA 5KI6A 4BACA 2IOCA 4J2DA 4B8AB 1VK0A 3ISNC 5FRNA 2Z1JA 3ZT3A 1YTAA 3OYGA 4DMNA 3QEIA 4DTPA 1LW0A 2HHSA 1J9AA 4DTXA 1N6QA 4CEAA 3KJVA 5J2NA 2XRIA 1XHZA 1UA1A 3AA4A 4BWMA 3SQ1A 1ZBHA 1VRUA 1T03A 1QS4A 1RBTA 4DSLA 3G10A 2ZD1A 5C42A 3KLEA 1KLNA 1CXUA 1XI1A 2BDPA 4DSIA 4QCLA 1VSIA 4OKEA 4TSXA 2YKMA 1JL1A 1A5VA 1NJXA 2IC3A 3LAMA 4OGEA 1TK5A 1L3TA 4C8OA 1HYVA 2DY4A 4DFKA 3PY8A 3KK2A 4H4OA 1NK4A 3SUQA 4DSJA 4FK2A 4IFYA 4H8KA 5J2MA 3KKRA 4CJVA 3ZT0A 5K14A 3NCIA 1CXQA 1IG9A 4MFBA 2HNYA 3AA5X 4AHUA 1D9DA 1BQMA 3ZT2A 3B6PA 4CHYA 3OYCA 3HPHA 3HT3A 4DTOA 2OZMA 4K8ZA 3V4IA 1RT7A 4RW9A 5T7BA 3CM5A 3AVKA 4CJFA 1U47A 2X6SA 1JXBA 4HVJA 3PO4A 1IKXA 2ZE2A 4FJ7A 4E7LA 4CEDA 4Z4EA 3K2PA 3TAQA 4CFCA 4LSLA 2PZSA 2OPPA 3WNEA 3PO5A 4FJ8A 2FBXA 4CHOA 3MEDA 4CJLA 3LP1A 4CIGA 3B6OA 4DF4A 5HRNA 1YVUA 1RNHA 3DOLA 3OYNA 1LV5A 2P5GA 4ELTA 4BE2A 1XWLA 4O0JA 3VN5A 1QHTA 1NOZA 1VSFA 1SKRA 1BISA 3DRPA 3OS0A 3S3NA 2QK9A 4JRQA 4E89A 4KPYA 4CEBA 3F9KA 5KGXA 3AVHA 2FBTA 4FZZA 4C8NA 4CF9A 2VWJA 1TK8A 1X1PA 4CGFA 5C25A 3LAKA 3AO2A 3HVRA 4B9UA 3VQPA 4FJ9A 1ASWA 2Z1IA 3TI0A 3PX4A 3NH2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VSM A;  2YKN A;  3ASM A;  2IDO A;  4CF2 A;  3KLF A;  1NK6 A;  2ITG A;  1BL3 A;  3T3F A;  4KHS A;  1BHL A;  1RT3 A;  4N5S A;  4KI6 A;  1SL0 A;  4EP5 A;  1QQC A;  5J2Q A;  3RR7 A;  2P51 A;  4B9V A;  1O1W A;  2HHT A;  2BE2 A;  3CM6 A;  5HRR A;  3LZJ A;  3JSM A;  3VQQ A;  3LDS A;  3TAF A;  1C0U A;  3NHG A;  4E3S A;  1TAU A;  4KKO A;  3VQ6 A;  3SUO A;  5EU7 A;  3O3F A;  1TL3 A;  4F3O A;  1ITG A;  2NUB A;  3QEP A;  2O4G A;  1UWB A;  4CHP A;  5D3G A;  4FLX A;  1WN7 A;  3RR8 A;  3NF7 A;  3QLH A;  1IH7 A;  4M3U A;  3SQ4 A;  3HL8 A;  3MEE A;  4I2P A;  3DLR A;  1HMV A;  2OYQ A;  3T1A A;  3QES A;  1Z25 A;  4OGC A;  1U45 A;  3IRX A;  4KTW A;  4CK1 A;  2Y1J A;  4FJJ A;  3SZ2 A;  3V9W A;  2HHU A;  4NCG A;  4KTZ A;  1CZB A;  1W9H A;  4KB0 A;  3O4Q A;  2YNI A;  5C24 A;  1TV6 A;  4CGI A;  4DTU A;  3THV A;  1WSG A;  4O5B A;  1LWE A;  4OKJ A;  4J2A A;  1TK0 A;  3A2F A;  1KTQ A;  3G0Z A;  4FLW A;  4GVM A;  4YNQ A;  5KGW A;  1HQE A;  3ZT1 A;  3AVI A;  1C6V A;  4KRE A;  3KKS A;  1EP4 A;  1B92 A;  4ZTF A;  1SKW A;  4HCB A;  4QOZ B;  1JKH A;  1YT3 A;  2XHB A;  4B9M A;  1KVC A;  1JLE A;  1JLF A;  2XY6 A;  4W5T A;  1KLM A;  3K5N A;  3TAB A;  1NOY A;  4Q0B A;  3MXM A;  4E7K A;  4FLU A;  3K5O A;  2X74 A;  4OJR A;  4ICL A;  4E7H A;  3SPZ A;  3PUF A;  4CEQ A;  1BQN A;  3P1G A;  2JGU A;  1S6Q A;  1RT2 A;  2ZQB A;  3WNG A;  4CEE A;  4HUG A;  2GV9 A;  3I0S A;  3VQC A;  2BGG A;  4FJM A;  4FJX A;  2DTU A;  4CK2 A;  3U3Y A;  5CZ1 A;  4B8C A;  4JLH A;  1A5W A;  4GW6 A;  3TAM A;  4CGG A;  4HUE A;  3ZCM A;  4OLA A;  1WSF A;  3SI6 A;  3NH1 A;  1QSY A;  5DMR A;  2O4I A;  3CFO A;  4I7F A;  4RW6 A;  4JS4 A;  3NGY A;  5KRS A;  3L2U A;  4FZY A;  1NJW A;  3QEX A;  1C1C A;  1JXE A;  4DTR A;  1Q9X A;  2RPI A;  3VA3 A;  3U6F A;  1KVA A;  1LWC A;  3OY9 A;  4OLB A;  4CF0 A;  4CFD A;  3LP0 A;  3KK3 A;  2HMI A;  4F3T A;  2D0C A;  3AVF A;  4IFV A;  1TKX A;  3QIP A;  1SL1 A;  2F8S A;  1KFS A;  3QO9 A;  4ELV A;  3O3G A;  1NKB A;  2D5R A;  4IDK A;  1R0A A;  1X9S A;  1RT4 A;  4ID1 A;  2X78 A;  1LW2 A;  1XHX A;  4AH9 A;  1RTI A;  3VQ7 A;  4B9N A;  4PQU A;  4E7I A;  3QNN A;  3BGR A;  3CFP A;  3ZSR A;  3V1R A;  3WNF A;  3M8P A;  4FM2 A;  3S3O A;  2A1R A;  4CIE A;  3VQB A;  3I8D A;  3V9S A;  1WLJ A;  4N56 A;  4DQS A;  5SZT A;  2XY5 A;  4DU4 A;  1MU2 A;  4LSN A;  2LSN A;  4BWJ A;  3VQ5 A;  3HP9 A;  4NYF A;  5HRS A;  4DWI A;  2WOM A;  2YV0 X;  3RRH A;  1WNS A;  1K6Y A;  2VWK A;  4DSF A;  3DM2 A;  3C95 A;  3AO1 A;  2Z1G A;  3AA3 A;  4FJL A;  5HBM A;  4M41 A;  5J2P A;  1J5O A;  4FM1 A;  3VQ4 A;  3KK1 A;  1HRH A;  4E7J A;  3NH0 A;  5FRM A;  3ZSV A;  1LWF A;  3LAL A;  3EYZ A;  2HVH A;  3P5J A;  1L3V A;  2YNF A;  1DTQ A;  3KD1 E;  4LH4 A;  3SJJ A;  2B5J A;  3HYF A;  3LZI A;  1VSK A;  3D45 A;  1VSH A;  5I3U A;  2OPS A;  1RBS A;  1ASU A;  4IG0 A;  3VQA A;  4R5P A;  3HXM A;  3SV4 A;  1VRT A;  4RW4 A;  4LD0 A;  1RTD A;  3AO4 A;  4FJH A;  3L2W A;  3LAN A;  4G1Q A;  3SUP A;  1FXX A;  3KIO A;  4M3Y A;  1HYS A;  1J53 A;  4BE0 A;  3FFI A;  4CJQ A;  1EX4 A;  3DRR A;  2DFF A;  2OPR A;  4XIU A;  4OKK A;  5CZ2 A;  2OPQ A;  4DTJ A;  5CYQ A;  1UA0 A;  3M8Q A;  1YTU A;  1S1T A;  3AVL A;  4Y1C A;  3VQ8 A;  4EZ6 A;  3K5L A;  1NK9 A;  4KHQ A;  4CEZ A;  1T8E A;  3AVM A;  4RW8 A;  3L2Q A;  4FJK A;  2HNZ A;  4CJ3 A;  5HRO A;  4CJK A;  2F8T A;  4KTQ A;  4GMJ B;  3OYB A;  3L8B A;  4LH5 A;  1IKY A;  4W5Q A;  3NAE A;  1VSJ A;  4FM0 A;  1NJZ A;  1RDC A;  2W42 A;  1TAQ A;  4OVL A;  4CJU A;  3O3H A;  1RT6 A;  4N76 A;  3HO1 A;  2IAJ A;  4I9L A;  2B4J A;  1S5J A;  2OA8 A;  3MEC A;  4CJE A;  3QET A;  1IKV A;  3ZSW A;  4F2S A;  3CFR A;  1L5U A;  1HPZ A;  5HP1 A;  4J2E A;  1FKP A;  3NBP A;  3OVN A;  5FDL A;  3SPY A;  1S1U A;  3QIO A;  4FVM A;  4DU3 A;  2D0A A;  3OYH A;  1TVR A;  1TKZ A;  4BDP A;  4E0D A;  4IBN A;  3D0P A;  2R7Y A;  2RKI A;  1C0M A;  3V9U A;  3BDP A;  4FK0 A;  1WSJ A;  1UOC A;  2HHV A;  4AHC A;  3DLE A;  4KO0 A;  1Q9Y A;  2WON A;  4M3T A;  1BIZ A;  3TAN A;  3JYT A;  3SCX A;  4I9Q A;  5SWM A;  2JLE A;  1JLB A;  1ZBF A;  3ZSZ A;  3NGI A;  4Z4H A;  4O0I A;  3S9H A;  4KI4 A;  4WE1 A;  4K8X A;  2G8I A;  1BCO A;  4BDY A;  1GOC A;  4M3W A;  4FYD A;  1WSE A;  2ETJ A;  3AO3 A;  3RMA A;  3IS9 A;  4CEO A;  3HM9 A;  3CQ8 A;  4JS5 A;  4Q5V A;  1C1A A;  3MAQ A;  1GOA A;  2G8U A;  3LWL A;  3AVA A;  3KD5 E;  1IKW A;  1RBR A;  3DLG A;  1F21 A;  3HPG A;  1TL1 A;  4CHQ A;  1I3A A;  4CIF A;  4KHU A;  4DLG A;  3RMD A;  4F4K A;  1KFD A;  4CGD A;  1FK9 A;  1SV5 A;  1UAX A;  5JS1 A;  2VG5 A;  1X9M A;  2KZZ A;  3OYJ A;  3PV8 A;  1RDD A;  4L8R B;  1JLC A;  1RBU A;  4FJI A;  4MQ3 A;  5KTQ A;  2DFE A;  4PA1 A;  1BI4 B;  3VQE A;  3OJS A;  1BCM A;  3ZSY A;  1NK8 A;  1S6P A;  4FLT A;  1ZYQ A;  1HYZ A;  4M3X A;  2Z1H A;  3OYF A;  1SL2 A;  2QXF A;  1VSE A;  3T19 A;  1Y97 A;  4DQP A;  1ZBI A;  1KSP A;  1I39 A;  1HQU A;  3K5M A;  4CGJ A;  3KTQ A;  3DI6 A;  2G8K A;  5JS2 A;  1DLO A;  2E6L A;  1TKD A;  4AIL C;  4FK4 A;  2FBY A;  2YHB A;  4E19 A;  5HRP A;  1G15 A;  3WNH A;  1BIU A;  4AHV A;  4DS5 A;  3ZSO A;  1BI4 A;  2KTQ A;  4OPJ A;  3TAR A;  4W5R A;  3IG1 A;  1WSH A;  3LWM A;  1RT1 A;  3RTV A;  4M3R A;  2G8V A;  1L3U A;  3L2R A;  4DQI A;  4O44 A;  4CCH A;  4HCC A;  2HHX A;  4DG1 A;  3OYK A;  1ZBL A;  2YNG A;  1C0T A;  2G8H A;  4FJG A;  3V1O A;  5E41 A;  4CF1 A;  1VSL A;  3MXI A;  3CG7 A;  4AHT A;  2QKB A;  1HNI A;  1WAF A;  3V1Q A;  4Z4I A;  1JLQ A;  2PYJ A;  1NK0 A;  3TR8 A;  4CHZ A;  3RRG A;  4DTS A;  1J54 A;  2IS3 A;  3O4N A;  2EHG A;  2FBV A;  1NK7 A;  4W5O A;  2XO7 A;  4Z4F A;  3LP3 A;  1NKC A;  4IKF A;  1L3S A;  1D8Y A;  3V81 A;  1B9F A;  4J2B A;  2ATQ A;  2IGI A;  3DLB A;  4Z4G A;  1CLQ A;  3SV3 A;  3TWH A;  3OYD A;  4LY7 A;  3OYM A;  1S1V A;  2GBZ A;  2KQ2 A;  4CJR A;  1T05 A;  2P1J A;  3DOK A;  1GOB A;  3ALY A;  4H4M A;  3TAP A;  3PX0 A;  3RMB A;  2I5J A;  3NF9 A;  4KHN A;  4KB1 A;  3V6D A;  4C8M A;  2B6A A;  4NCB A;  4HUF A;  4RG8 A;  3C6T A;  3CYM A;  2KZM A;  2F96 A;  1RIL A;  3E01 A;  5CYM A;  4CJS A;  3HST B;  2XY7 A;  4HHT A;  2EX3 A;  3V9X A;  4NYN A;  3AA2 A;  3S3M A;  1HNV A;  3HP6 A;  5KRT A;  3ZSQ A;  1SKS A;  2HW3 A;  2KFN A;  3DRS A;  1C1B A;  1SUQ A;  3V9Z A;  1QSS A;  1RDB A;  2DFH A;  2HB5 A;  4FLY A;  2Y1I A;  3QEV A;  4AHS A;  1NK5 A;  3AVG A;  1RTH A;  1WAJ A;  1REV A;  1ZBU A;  4CJ4 A;  3ITH A;  2YHA A;  3SYZ A;  3L3V A;  3QEW A;  3DLK A;  4E1M A;  1TKT A;  1B9D A;  4FXD A;  1S9G A;  2Q3S A;  2KW4 A;  4CJT A;  1D5A A;  1IO2 A;  1QTM A;  4DSK A;  4BDZ A;  1NKE A;  3DYA A;  1BGX T;  2PY5 A;  4FJN A;  4B3O A;  3QNO A;  2HHW A;  4CE9 A;  4BE1 A;  2KFZ A;  3SUN A;  4ZTJ A;  4C8L A;  5CY4 A;  3U3G A;  3OYI A;  4DF8 A;  4DTM A;  1RCH A;  3MEG A;  4CFB A;  3OYE A;  1KVB A;  3KLI A;  3KLG A;  1EXQ A;  1S1X A;  4CJP A;  4N41 A;  4Y1D A;  5HLF A;  4B9S A;  2XY8 A;  1QE1 A;  3TAG A;  4CGH A;  3VA0 A;  1RDA A;  3MXJ A;  4CFA A;  4HTU A;  2G8F A;  4OPK A;  1RBV A;  1JLA A;  3K57 A;  3AVB A;  2RF2 A;  2HHQ A;  4CEC A;  4CES A;  1HJR A;  2P5O A;  2A1S A;  3NE6 A;  4Z4C A;  4DLE A;  4CJW A;  4KV8 A;  4B9L A;  1DTT A;  1FKO A;  5FRO A;  3K59 A;  1X9W A;  4N47 A;  3HPO A;  2GUI A;  4FLZ A;  4DFJ A;  3ULD A;  1LAW A;  4PWD A;  1VSD A;  3LPT A;  2AJQ A;  4IG3 A;  4CEF A;  2E6M A;  3AV9 A;  3SNN A;  4FW1 A;  3OYA A;  1QSL A;  2QKK A;  4EZ9 A;  3ZT4 A;  4DQQ A;  1JLG A;  3I0R A;  4FW2 A;  4M42 A;  3NDK A;  3QIN A;  4F2R A;  2HND A;  4CF8 A;  3NF6 A;  4CER A;  4CJ5 A;  1S9E A;  3H08 A;  3SQ0 A;  1LAV A;  1D9F A;  3SQ2 A;  3DLH A;  3UIQ A;  4ZHR A;  1A5X A;  4JRP A;  3NGZ A;  2YNH A;  3OJU A;  4DQR A;  1N5Y A;  3F73 A;  3OS2 A;  3VQ9 A;  4ID5 A;  3ZSX A;  4DFM A;  2X6N A;  2VG7 A;  4M45 A;  2BAN A;  4B08 A;  5J1E A;  3TAE A;  4FZX C;  3KLH A;  3DMJ A;  1EKE A;  1NJY A;  3IAY A;  4C8K A;  2E4L A;  4QAG A;  1CZ9 A;  4I2Q A;  1WSI A;  4KRF A;  4DFP A;  3QER A;  3L3U A;  3M8S A;  4O4G A;  4EP4 A;  3HK2 A;  1EET A;  3OYL A;  2PYL A;  4RW7 A;  1S1W A;  1JL2 A;  3PX6 A;  4O55 A;  3P83 D;  3NFA A;  1T7P A;  1KRP A;  1U04 A;  4CHN A;  4KFB A;  3AVN A;  3AVJ A;  3C94 A;  4KHY A;  4NCA A;  4PUO A;  1W0H A;  4FCY A;  4DSE A;  4KAZ A;  4KHW A;  1U4B A;  2D0B A;  5DK5 A;  4M3Z A;  2HVI A;  3LPU A;  4AHR A;  1U48 A;  1RTJ A;  2OZS A;  4FJ5 A;  3HJF A;  2G8W A;  4UQG A;  1TGO A;  4W5N A;  3RMC A;  1XC9 A;  3M8R A;  5I42 A;  3HVT A;  3OS1 A;  3EY1 A;  3K58 A;  4B9T A;  4Z0U A;  4F8R A;  1Q8I A;  2RN2 A;  4YFU A;  4FLV A;  1U49 A;  3AVC A;  3AO5 A;  3VQD A;  4DTN A;  1ASV A;  1RT5 A;  1KCF A;  1Z26 A;  3LP2 A;  3NF8 A;  4CK3 A;  4PY5 A;  4DU1 A;  4ELU A;  4E1N A;  2VG6 A;  3L2V A;  2FC0 A;  3C6U A;  4DS4 A;  3EZ5 A;  3RWU A;  5KI6 A;  4BAC A;  2IOC A;  4J2D A;  4B8A B;  1VK0 A;  3ISN C;  5FRN A;  2Z1J A;  3ZT3 A;  1YTA A;  3OYG A;  4DMN A;  3QEI A;  4DTP A;  1LW0 A;  2HHS A;  1J9A A;  4DTX A;  1N6Q A;  4CEA A;  3KJV A;  5J2N A;  2XRI A;  1XHZ A;  1UA1 A;  3AA4 A;  4BWM A;  3SQ1 A;  1ZBH A;  1VRU A;  1T03 A;  1QS4 A;  1RBT A;  4DSL A;  3G10 A;  2ZD1 A;  5C42 A;  3KLE A;  1KLN A;  1CXU A;  1XI1 A;  2BDP A;  4DSI A;  4QCL A;  1VSI A;  4OKE A;  4TSX A;  2YKM A;  1JL1 A;  1A5V A;  1NJX A;  2IC3 A;  3LAM A;  4OGE A;  1TK5 A;  1L3T A;  4C8O A;  1HYV A;  2DY4 A;  4DFK A;  3PY8 A;  3KK2 A;  4H4O A;  1NK4 A;  3SUQ A;  4DSJ A;  4FK2 A;  4IFY A;  4H8K A;  5J2M A;  3KKR A;  4CJV A;  3ZT0 A;  5K14 A;  3NCI A;  1CXQ A;  1IG9 A;  4MFB A;  2HNY A;  3AA5 X;  4AHU A;  1D9D A;  1BQM A;  3ZT2 A;  3B6P A;  4CHY A;  3OYC A;  3HPH A;  3HT3 A;  4DTO A;  2OZM A;  4K8Z A;  3V4I A;  1RT7 A;  4RW9 A;  5T7B A;  3CM5 A;  3AVK A;  4CJF A;  1U47 A;  2X6S A;  1JXB A;  4HVJ A;  3PO4 A;  1IKX A;  2ZE2 A;  4FJ7 A;  4E7L A;  4CED A;  4Z4E A;  3K2P A;  3TAQ A;  4CFC A;  4LSL A;  2PZS A;  2OPP A;  3WNE A;  3PO5 A;  4FJ8 A;  2FBX A;  4CHO A;  3MED A;  4CJL A;  3LP1 A;  4CIG A;  3B6O A;  4DF4 A;  5HRN A;  1YVU A;  1RNH A;  3DOL A;  3OYN A;  1LV5 A;  2P5G A;  4ELT A;  4BE2 A;  1XWL A;  4O0J A;  3VN5 A;  1QHT A;  1NOZ A;  1VSF A;  1SKR A;  1BIS A;  3DRP A;  3OS0 A;  3S3N A;  2QK9 A;  4JRQ A;  4E89 A;  4KPY A;  4CEB A;  3F9K A;  5KGX A;  3AVH A;  2FBT A;  4FZZ A;  4C8N A;  4CF9 A;  2VWJ A;  1TK8 A;  1X1P A;  4CGF A;  5C25 A;  3LAK A;  3AO2 A;  3HVR A;  4B9U A;  3VQP A;  4FJ9 A;  1ASW A;  2Z1I A;  3TI0 A;  3PX4 A;  3NH2 A; 
#chains in the Genus database with same CATH topology
 1NK6 A;  1VQL N;  1KAZ A;  4KHS A;  1G99 A;  4N5S A;  1H1V A;  2P51 A;  2BE2 A;  5HRR A;  3LZJ A;  4E3S A;  3VQ6 A;  3SUO A;  2O8E A;  1ITG A;  3O9Q A;  1QVF M;  4O8U A;  3OW2 M;  1UWB A;  4CHP A;  1WN7 A;  4M3U A;  3TSQ A;  3HL8 A;  3IKM A;  3MWP A;  4X65 K;  1U45 A;  3SZ2 A;  4BY9 C;  3CD6 N;  2QW9 A;  4DKW A;  2J4R A;  2HHU A;  4PL7 A;  4NCG A;  4KTZ A;  1NBW A;  1CZB A;  4JI8 K;  3O4Q A;  4YOT A;  4GV9 A;  4IFE A;  1NGJ A;  3M5R A;  1K8K B;  1KTQ A;  2H3G X;  3QIC A;  4FLW A;  4YNQ A;  5KGW A;  3O9R A;  3AVI A;  1GLF O;  1B92 A;  4ZTF A;  2O8C B;  4A62 A;  1JKH A;  1YT3 A;  4OPA A;  4A2B A;  2XY6 A;  1KLM A;  3TAB A;  4OJR A;  4JKC A;  4CEQ A;  3QFP A;  4IDH A;  4CEE A;  2VQF K;  2GV9 A;  3I0S A;  4A59 A;  3NH1 A;  1K8K A;  3WXI A;  4FZY A;  1NJW A;  1NGI A;  1C1C A;  3VA3 A;  4OLB A;  3KK3 A;  2HMI A;  2IIR A;  3AGK A;  2F8S A;  1KFS A;  3QO9 A;  1OKJ A;  3VER A;  5M1P A;  4RCH A;  1QVG M;  2P9N A;  3QNN A;  5KPZ A;  1YUW A;  4CIE A;  3V9S A;  4DQS A;  2LSN A;  3BF1 A;  3E66 A;  3VQ5 A;  4NYF A;  3JS6 A;  4IO9 L;  1WNS A;  4DSF A;  3C95 A;  3GG4 A;  3VOV A;  3UKU A;  4B1Y B;  4E7J A;  1HRH A;  3ZSV A;  3EYZ A;  4DR7 K;  3MMV A;  1VSK A;  4B3M K;  1X9W A;  1T8E A;  1VQK N;  5AQN A;  4RW4 A;  3L2W A;  3LAN A;  1OVQ A;  1HYS A;  1FXX A;  3KIO A;  1J53 A;  4BE0 A;  4XIU A;  1EX4 A;  2DFF A;  5CZ2 A;  5MLC Q;  4DV3 K;  2D1K A;  3CER A;  4FWS A;  5CYQ A;  2OCE A;  3VQ8 A;  4BRD A;  1NK9 A;  2QWR A;  3AVM A;  2HNZ A;  5HRO A;  5LL6 Z;  4KTQ A;  3L8B A;  3CET A;  4WQ5 C;  3NAE A;  4LF7 K;  3L0Q A;  1NJZ A;  4CJU A;  4OVL A;  4H0O A;  2IAJ A;  2OA8 A;  4F9O A;  3MN6 A;  2E2N A;  3CPW M;  1FKP A;  3NBP A;  5AQW A;  3FE1 A;  4JI1 K;  4DB3 A;  5ADX A;  4FVM A;  2CH5 A;  3VMF B;  1Q18 A;  2A42 A;  3D0P A;  3CCE N;  3BDP A;  4FK0 A;  3OHR A;  4AHC A;  3DLE A;  1Q9Y A;  4BRE A;  4WYB A;  4QS9 A;  3H1Q A;  5SWM A;  2JLE A;  4BVO A;  1JLB A;  1ZBF A;  4HWI A;  3S9H A;  1BCO A;  1GOC A;  4M3W A;  1SAZ A;  2ETJ A;  3AO3 A;  3RMA A;  3HM9 A;  3M6G A;  3MAQ A;  3LWL A;  2VWB A;  4B1Z A;  4LFB K;  4LF4 K;  1TUU A;  4F4K A;  4IJN A;  5JS1 A;  2VG5 A;  2KZZ A;  3PV8 A;  2I7P A;  2FSK A;  5AQR A;  5KTQ A;  3O9T A;  3VQE A;  4B3T K;  2WTU A;  1S3X A;  4IO8 A;  4DR3 K;  2Z1H A;  3OYF A;  1SL2 A;  4JI3 K;  1VSE A;  4DQP A;  3K5M A;  1U2V B;  4CGJ A;  5JS2 A;  2E6L A;  1VQM N;  5FPE A;  2WFB A;  2YHB A;  4L3Q A;  4PKI A;  3P39 A;  1N36 K;  4MDB A;  3VET A;  2P9L B;  3ZSO A;  2IVP A;  3MN7 A;  2P9U A;  4M3R A;  1ILY A;  3THW B;  3ZX3 A;  3MWT A;  4BR0 A;  3OYK A;  4CF1 A;  4AHT A;  4JKA A;  2QKB A;  4ISF A;  3V1Q A;  1JLQ A;  4CHZ A;  2QWL A;  2A40 A;  1U2V A;  2IS3 A;  3G4S N;  4DQ8 A;  1NK7 A;  4Z4F A;  1IBL K;  1RDU A;  3BY5 A;  2ATQ A;  4Z4G A;  5AFU A;  2HST A;  4LY7 A;  4BR9 A;  2GBZ A;  2P1J A;  3DOK A;  1GOB A;  3J81 O;  3E9P A;  2P9L A;  3NF9 A;  4KB1 A;  5ADX H;  4RG8 A;  3C6T A;  5FLX O;  4CJS A;  3GBT A;  2UXB K;  4NYN A;  3AA2 A;  5KRT A;  1SKS A;  3V9Z A;  1RDB A;  2DFH A;  2HB5 A;  2NLX A;  5BR8 K;  1I94 K;  3SMP A;  3QEV A;  4AHS A;  1LCU A;  3AVG A;  3QBX A;  4QS7 A;  3ITH A;  3L3V A;  4ILG B;  5E84 A;  3CCS N;  2D0O A;  2KW4 A;  3VEO A;  1QTM A;  3FGU A;  3DYA A;  3CIP A;  3N4P A;  3QNO A;  4BQL A;  1VQP N;  4DF8 A;  4CFB A;  4Y1D A;  2XY8 A;  1RGI A;  1RDA A;  2G8F A;  3JAM O;  1RBV A;  2QM1 A;  3AVB A;  1EWR A;  3CCR N;  1HJR A;  3M1F A;  1DTT A;  4H5T A;  2FXU A;  5JLF A;  4IOC L;  2WC9 A;  4PWD A;  5TKY A;  5EVZ A;  4IG3 A;  1Q7Y O;  4ILH A;  3J7A P;  3AV9 A;  3SNN A;  4BRQ A;  3ZT4 A;  5LMU K;  2AP1 A;  1JLG A;  1D4X A;  4F2R A;  3PIP L;  4OPH A;  4CF8 A;  5JVH L;  4V19 S;  3DLH A;  1LAV A;  1A5X A;  4JRP A;  3NGZ A;  5JMV A;  4DQR A;  1RFQ A;  3F73 A;  3VQ9 A;  4B1X B;  2E88 A;  5CHI A;  5J1E A;  3KLH A;  3VF6 A;  2NRX A;  1NJY A;  1CZ9 A;  3DXM A;  4DFP A;  5M1O A;  4O4G A;  3OYL A;  1JL2 A;  4BRF A;  1ATR A;  3UKR B;  1IBM K;  3OBY A;  1U04 A;  3HZ6 A;  3AVJ A;  4KHY A;  3H3N O;  4FCY A;  3KZB A;  3D2F B;  4AHR A;  1HR0 K;  3MCA B;  4M7X A;  4JKD A;  5I42 A;  2P9I A;  2QWP A;  4YFU A;  4FLV A;  3AVC A;  3AO5 A;  4ISE A;  1ASV A;  1Z26 A;  3NF8 A;  5AQM A;  4CK3 A;  3OA9 A;  1NGG A;  3L2V A;  3C6U A;  1NGD A;  3QBW A;  3UKR A;  1VK0 A;  3TSU A;  4GKJ K;  3OYG A;  4DTP A;  1J9A A;  1N6Q A;  3KJV A;  5J2N A;  1MWK A;  1UA1 A;  2O8B B;  1VRU A;  5C0Y A;  3D2F A;  1QZ5 A;  1RBT A;  3G10 A;  5C42 A;  4DSI A;  3THY B;  2YKM A;  4BC5 A;  5AQX A;  1NJX A;  3PX4 A;  3N4Q A;  5GIO A;  4BVP A;  4DSJ A;  4X66 K;  1NJI O;  1CXQ A;  4MFB A;  3GDQ A;  2ZJQ L;  1D9D A;  1BQM A;  3ZT2 A;  3OYC A;  3HPH A;  3V4I A;  1RT7 A;  4RW9 A;  3ZYY X;  5IWA K;  5T7B A;  1S72 N;  1JJ2 M;  3AVK A;  4JI5 K;  3PO4 A;  1IKX A;  3THY A;  4EHT A;  2FSN A;  3R8E A;  4FJ8 A;  1NGC A;  4BRI A;  3ENH A;  2BH1 A;  5C12 A;  4CBW A;  4DF4 A;  1RNH A;  4JI2 K;  3OYN A;  4ELT A;  2E8A A;  4BRM A;  4NLC A;  3BZC A;  4H5W A;  2V7Z A;  3AAQ A;  2NRV A;  4CF9 A;  5C15 A;  4ILJ A;  3AAP A;  1X1P A;  3AO2 A;  4IJA A;  3W3D A;  4FJ9 A;  2Z1I A;  4IZ9 A;  2YKN A;  4CF2 A;  2IDO A;  3KLF A;  1GLJ O;  2Q36 A;  1IBK K;  4I6M B;  4EP5 A;  5J2Q A;  5AZJ A;  4B9V A;  1O1W A;  2HMP A;  3JSM A;  3LDS A;  3TAF A;  2GEL A;  3UE5 A;  5EU7 A;  2HF3 A;  2O4G A;  1VQO N;  2OYQ A;  3T1A A;  4CZG A;  1Z25 A;  4CD1 A;  3QES A;  5GIN A;  4KTW A;  2UUA K;  1OVY A;  2BTF A;  4MLH A;  4I6M A;  1W9H A;  1E4G T;  1TV6 A;  3K9J A;  4O5B A;  3HBT A;  4J2A A;  1TK0 A;  4GVM A;  1C6V A;  2O8F B;  1ATN A;  1T6C A;  3KKS A;  2QWQ A;  2XHB A;  4Q0B A;  3MXM A;  2X74 A;  3VEY A;  4E7H A;  4YDU C;  1NWK A;  1BQN A;  1RT2 A;  5KQ8 A;  5HOO A;  3VQC A;  2BGG A;  4FJX A;  2RHK A;  1XUP O;  4B1U B;  4B8C A;  3TAM A;  4CZH A;  3HM8 A;  3I33 A;  3J8A A;  3CME N;  3ZCM A;  1WSF A;  3SAF A;  3EKS A;  1QSY A;  3NGY A;  4C23 A;  3L4I A;  5KRS A;  4G9Z A;  2O8F A;  1JXE A;  3U6F A;  1LWC A;  4CF0 A;  3LP0 A;  4DV2 K;  3QIP A;  2UYT A;  1NKB A;  4H5R A;  1VQ4 N;  4AH9 A;  4PQU A;  5DM7 L;  1XHX A;  5AZI B;  3EEQ A;  3BGR A;  3CFP A;  3S3O A;  5C2F A;  5BPN A;  3ULE A;  4N56 A;  5SZT A;  1N32 K;  3THX B;  3I56 N;  1C0F A;  3VEN A;  2WOM A;  5LY3 A;  5H1S Q;  2Z1G A;  3AA3 A;  2FLO A;  4FM1 A;  3KK1 A;  5FRM A;  3T7Z A;  2HVH A;  2ZJP L;  1VQ5 N;  3KD1 E;  3SJJ A;  3D45 A;  3CJB A;  5I3U A;  2OPS A;  4WQ5 A;  5GIP A;  1VRT A;  1RTD A;  5BRF A;  4FJH A;  4G1Q A;  3SUP A;  4M3Y A;  2OZS A;  1QQO A;  1UA0 A;  3D6R A;  1YTU A;  3AVL A;  4Y1C A;  4FWR A;  4KHQ A;  1NMD A;  2FSJ A;  4CEZ A;  3L2Q A;  4FJK A;  4CJK A;  4GMJ B;  3OYB A;  1VQ7 N;  1IKY A;  4W5Q A;  1VSJ A;  4FM0 A;  1RDC A;  2W42 A;  2KLA A;  3O3H A;  1RT6 A;  3HO1 A;  4A5B A;  2B4J A;  3WEE B;  2UXD K;  1W97 L;  3TTC A;  4CJE A;  5AQF A;  2AA4 A;  4J2E A;  5KPR A;  1NG9 A;  4JI4 K;  4KH5 A;  3E1Y A;  3OVN A;  3VTI A;  3SPY A;  3QIO A;  1TKZ A;  4E0D A;  3O5B A;  1DGK N;  2CGL A;  2Q97 A;  3K0S A;  2HHV A;  3VEW A;  1BIZ A;  3PIO L;  3SCX A;  2ASO A;  4YHH K;  4O0I A;  3FZK A;  5E26 A;  4K8X A;  1HKG A;  4H0T B;  1WSE A;  1NGB A;  3HI0 A;  3IS9 A;  3CQ8 A;  4Q5V A;  3WEE A;  1XNR K;  5AJ3 K;  2UXC K;  1F21 A;  3ZX2 A;  4KHU A;  3ID8 A;  3RMD A;  4CGD A;  1FK9 A;  1UAX A;  4BG8 A;  4L8R B;  1RBU A;  2DFE A;  4PA1 A;  1BI4 B;  1MWM A;  4A57 A;  3OJS A;  1BCM A;  1NK8 A;  4FLT A;  3CHW A;  1W2B M;  4M63 C;  4MLE A;  2E5L K;  1Y97 A;  1KSP A;  1I39 A;  3DWL A;  5C10 A;  3KTQ A;  3SAG A;  2QTD A;  4CI6 A;  4PHT X;  3ID6 A;  4IEE A;  1G15 A;  3LDO A;  1BIU A;  3P38 A;  3LDP A;  4K41 A;  4DS5 A;  3IUC A;  4B9Q A;  1BI4 A;  3RTV A;  4BR5 A;  4HCC A;  3L2R A;  5LMN K;  1NLV A;  2YHX A;  3I8B A;  5M1F A;  2VQE K;  2HHX A;  4DG1 A;  1JCG A;  2YNG A;  3OTO K;  4FJG A;  2O8C A;  1VSL A;  3CG7 A;  1WAF A;  4OO1 J;  4CZF A;  2W6K A;  4W5O A;  2XO7 A;  1NKC A;  2CH6 A;  2QEX N;  1CLQ A;  1B9F A;  2IGI A;  3DLB A;  3SV3 A;  3CXC M;  2GWK A;  1T05 A;  5AQI A;  3ALY A;  3KWI A;  4JEP A;  3TAP A;  1P90 A;  3MX2 A;  3V6D A;  4FPA A;  3CYM A;  3O8M A;  1RIL A;  2GTD A;  2NRR A;  3E01 A;  3VGM A;  3T1H K;  1HNX K;  2YJF A;  3V9X A;  4WF9 L;  3CCQ N;  4GVE A;  5TKW A;  2PFU A;  2KFN A;  3ATU A;  3DXK B;  2ASP A;  1C1B A;  2Q1N A;  1YJW N;  4FLY A;  2Y1I A;  3CC2 N;  3QB0 A;  3QML A;  3CCM N;  1RTH A;  3H6E A;  1ZBU A;  4CJ4 A;  3QEW A;  3E9O A;  3DLK A;  1B9D A;  3EE8 A;  1S9G A;  3L6Q A;  3VGK A;  1D5A A;  1IO2 A;  2PY5 A;  4FJN A;  4MDA A;  1E3M A;  3SUN A;  4ZTJ A;  4C8L A;  5EOY A;  4DTM A;  4BRC A;  3MEG A;  4DR2 K;  1EXQ A;  1S1X A;  3CPE A;  4N41 A;  3HSC A;  4JN4 A;  3TAG A;  3CF5 L;  4CGH A;  2WBN A;  3MXJ A;  1GLB G;  4BGA A;  2HHQ A;  3A8Y A;  3LL3 A;  4CES A;  1VQ9 N;  4H0P A;  5FPM A;  1FKO A;  3TTF A;  5FRO A;  1GLA G;  4N47 A;  1LAW A;  3QDK A;  2AJQ A;  2F9T A;  4AM7 A;  4CEF A;  2E6M A;  4DUZ K;  3EL2 A;  3VGL A;  3OYA A;  2WUS A;  4EIA A;  3MN9 A;  4FL9 A;  4BR2 A;  3F9M A;  3UIQ A;  3H08 A;  2YI1 A;  4JI0 K;  5F1X A;  1QQM A;  3OS2 A;  3GL1 A;  3ZSX A;  5AQQ A;  3TSP A;  4FZX C;  3TAE A;  2E4L A;  4QAG A;  4I2Q A;  1WSI A;  5ELZ A;  5AQY A;  3M8S A;  4EP4 A;  3HK2 A;  2PYL A;  4RW7 A;  1OH5 A;  4O55 A;  3P83 D;  1GLL O;  3AVN A;  4GV6 A;  4DSE A;  4KAZ A;  3AGR A;  4FWL A;  1U4B A;  1C0G A;  4FJ5 A;  1RTJ A;  3I55 N;  1TGO A;  5HL7 L;  1BUP A;  2CGK A;  3RMC A;  4W5N A;  3M8R A;  1YF5 L;  1M1K O;  1YIJ N;  1ESV A;  3HVT A;  3OS1 A;  3EY1 A;  3K58 A;  1FW6 A;  4B9T A;  1VQ6 N;  1Q8I A;  2RN2 A;  3AAR A;  4FWO A;  1FJG K;  4JKE A;  3R1X A;  4PY5 A;  2VG6 A;  3RWU A;  2GWJ A;  5LJW A;  2Q0U A;  3ISN C;  5FRN A;  3BP8 A;  5AR0 A;  3ZT3 A;  1TYQ B;  3QEI A;  3VEZ A;  2VYP A;  3L4Q A;  4H0V B;  4QS8 A;  3A0I X;  3FLC O;  1T03 A;  4DSL A;  5LJV A;  3KLE A;  2BDP A;  1VSI A;  3C6A A;  4OKE A;  3C7N B;  4DHY A;  4H5V A;  3THW A;  1L3T A;  3MK6 A;  3PY8 A;  4H4O A;  4WCE L;  4FK2 A;  4YY3 K;  3KKR A;  3CJC A;  1BA0 A;  4CJV A;  3ZT0 A;  4DV1 K;  1Z05 A;  1KC8 O;  3CQY A;  1IG9 A;  1YJ9 N;  2HNY A;  3AA5 X;  4AHU A;  1TYQ A;  4CHY A;  3O80 A;  4DTO A;  4K8Z A;  5CR4 A;  3CM5 A;  1U47 A;  1JXB A;  2OTJ N;  2ZE2 A;  3C7N A;  4CFC A;  4LSL A;  1EQY A;  4CHO A;  3WUH A;  5AQZ A;  1IG8 A;  4CJL A;  3LP1 A;  5HRN A;  1XWL A;  1VAZ A;  3R3L A;  4O0J A;  3VN5 A;  1VSF A;  3CQX A;  3S3N A;  2QK9 A;  4BR4 A;  2QWM A;  4DV7 K;  4E89 A;  4KPY A;  3F9K A;  2GUP A;  3UB5 A;  4C1N I;  5KGX A;  3H45 C;  3IMX A;  4FZZ A;  4C8N A;  1TK8 A;  2Q0R A;  3LAK A;  3HVR A;  4B9U A;  2F7T A;  1HJO A;  3TI0 A;  2QKK A;  3PO5 A;  3NH2 A;  1VSM A;  3ASM A;  1HKC A;  2ITG A;  3Q7B A;  5BR9 A;  3T3F A;  1BHL A;  4HTL A;  4KI6 A;  4B3S K;  2A5X A;  2HHT A;  4JK7 A;  3VQQ A;  3F2K A;  3JXU A;  1C0U A;  2FF3 B;  3NHG A;  2OTL N;  3P31 A;  3O3F A;  4F3O A;  3QEP A;  4A5A A;  4JAX A;  3LM9 A;  4FLX A;  5D3G A;  3SQ4 A;  2QA4 N;  3MEE A;  3DLR A;  5AFU H;  4DR6 K;  4OGC A;  1KQS M;  3IRX A;  4FOI A;  3HOS A;  2Y1J A;  4UY8 O;  3VF2 A;  2P9K B;  3V9W A;  4AF1 A;  2HBK A;  3KK7 A;  2HOE A;  4KB0 A;  2EWS A;  2YNI A;  5C24 A;  2ITM A;  2ZGZ A;  4CGI A;  4YDU A;  3THV A;  3O6W A;  1LWE A;  4OKJ A;  3G0Z A;  1HQE A;  3VPZ A;  5BRD A;  2HHH K;  1EWQ A;  1EP4 A;  4HCB A;  1NU0 A;  4B9M A;  1KVC A;  3MCP A;  1JLF A;  4PKH A;  3K5N A;  4YOW A;  1QHA A;  4FLU A;  3K5O A;  4ICL A;  4JHD B;  5M1N A;  2JGU A;  1S6Q A;  2ZQB A;  4RTF D;  2DTU A;  4FJM A;  5CZ1 A;  4JLH A;  1A5W A;  5M1Q A;  4HUE A;  1WOQ A;  1N34 K;  3SI6 A;  3ATV A;  3FZM A;  2O4I A;  3CFO A;  4BRO A;  4JS4 A;  4LF9 K;  2BUP A;  4DTR A;  2RPI A;  1KVA A;  1R59 O;  3OY9 A;  1BO5 O;  4CFD A;  4F3T A;  3AVF A;  4O5F A;  4ELV A;  3OBW A;  4GY2 B;  1YVN A;  3EZW A;  4IDK A;  1X9S A;  1RT4 A;  4ID1 A;  2X78 A;  4B9N A;  1RTI A;  2DPN A;  5AQS A;  3SMS A;  3V1R A;  4WFN L;  3I8D A;  2PBD A;  1WLJ A;  2XY5 A;  3RVC A;  5HRS A;  4LSN A;  2YV0 X;  2O8B A;  2VWK A;  3W0L A;  4XH1 A;  2VGN A;  4FJL A;  5HBM A;  4M41 A;  1BDG A;  3NH0 A;  4WFA L;  1LWF A;  3LAL A;  1L3V A;  2YNF A;  4LH4 A;  2B5J A;  3LZI A;  3VQA A;  1ASU A;  3HXM A;  4LF8 K;  4LD0 A;  3AO4 A;  4B3R K;  3FFI A;  4CJQ A;  3DRR A;  4DTJ A;  2OPQ A;  1YXQ A;  5JIC A;  1S1T A;  4EZ6 A;  1NGH A;  3A5O C;  3K5L A;  4RW8 A;  1KD1 O;  3DAW A;  1QQN A;  4C1N K;  4RWT A;  3O4W A;  4H0X B;  2PAV A;  4IWV A;  2IVO A;  3MEC A;  4LFC K;  3CFR A;  4GKK K;  1L5U A;  2QWN A;  1HPZ A;  5AQT A;  5FDL A;  1XMO K;  4DU3 A;  3OYH A;  1K9M O;  4IBN A;  2R7Y A;  2RKI A;  3V9U A;  1V4S A;  4KO0 A;  1HLU A;  4M3T A;  3TAN A;  2E1Z A;  5DM6 L;  3JYT A;  3FZF A;  3NGI A;  4Z4H A;  1JCF A;  1HKB A;  4FYD A;  3IFR A;  2E1Y A;  1C1A A;  4DV6 K;  3AVA A;  1RBR A;  3HPG A;  3DLG A;  1NGA A;  5AQL A;  1TL1 A;  5KPT A;  1I3A A;  1KFD A;  1SV5 A;  5KQD A;  1RDD A;  1NGE A;  4MQ3 A;  3J80 O;  4FO0 A;  2RE2 A;  1DT9 A;  1X3M A;  1S6P A;  1ZYQ A;  2ASM A;  2QXF A;  4GV3 A;  4CW7 B;  1ZBI A;  3RSE B;  2ZJR L;  1HQU A;  2G8K A;  2UUC K;  1DLO A;  1TKD A;  4BRK A;  2FBY A;  4R79 A;  5HRP A;  3CJ9 A;  3ZEU B;  3WNH A;  4KHP K;  4BC4 A;  3IG1 A;  2QXL A;  1WSH A;  3LWM A;  1RT1 A;  2G8V A;  1L3U A;  4JI6 K;  3H3O B;  1YI2 N;  4CCH A;  2NRW A;  1ZBL A;  3ZLJ A;  1C0T A;  1VHX A;  2G8H A;  3G6E N;  4FOE A;  5E41 A;  2HBL A;  3MXI A;  1HNI A;  4Z4I A;  1NK0 A;  3TR8 A;  3RRG A;  3O08 A;  5GAE P;  3A5M C;  1J54 A;  3O4N A;  4Y0W A;  2FBV A;  1V4T A;  1T44 A;  2QWO A;  4U7B A;  4IKF A;  1D8Y A;  1ZBS A;  3WT0 A;  4J2B A;  3OYM A;  1KAX A;  1S1V A;  2KQ2 A;  3Q7C A;  4H4M A;  1TUY A;  4DR5 K;  5JLH A;  4NCB A;  2YCH A;  4WQ4 C;  4FVU A;  2KZM A;  1HNW K;  5BRH A;  4H03 B;  1YAG A;  1DKG D;  2XY7 A;  3HP6 A;  2ZGY A;  3ZSQ A;  4DUY K;  3DRS A;  1SUQ A;  3CCU N;  5AZI A;  2P9S B;  1NK5 A;  3R9P A;  4Z94 A;  1WAJ A;  4YOU A;  2YHA A;  3THX A;  4E1M A;  3MN5 A;  4DCH A;  4CJT A;  2ZF5 O;  4BDZ A;  5AQU A;  1BGX T;  4XH5 A;  2HHW A;  4CE9 A;  4BE1 A;  2KFZ A;  5CY4 A;  3OYI A;  3KLG A;  3MDQ A;  3CCL N;  5HLF A;  4B9S A;  1QE1 A;  3J7Z O;  1JLA A;  3K57 A;  5BN9 A;  4CEC A;  2P5O A;  2A1S A;  5BPM A;  4B9L A;  2P9S A;  4CZE A;  3K59 A;  3HPO A;  2GUI A;  4FLZ A;  4DFJ A;  1WBB A;  2F4V K;  3A5L C;  3AY9 A;  1VSD A;  3G71 N;  3LPT A;  1QSL A;  1P8Z A;  4IXC A;  3I0R A;  4M42 A;  3NDK A;  3QIN A;  2A6A A;  4M7Y A;  1D9F A;  2QI2 A;  3SQ2 A;  4ZHR A;  2YNH A;  3OJU A;  1N5Y A;  4ID5 A;  5AQG A;  4U67 L;  2NRH A;  2VGM A;  2VG7 A;  2BAN A;  4M45 A;  4DFM A;  4B1W B;  1BA1 A;  4C8K A;  2E2O A;  3L3U A;  4AQY K;  3WQT A;  1T6D A;  4CBX A;  4CZI A;  4IEI A;  3PX6 A;  1Q86 O;  2UUB K;  4JKH A;  5A2Q O;  4CHN A;  3GE1 A;  4KFB A;  4KH6 A;  3C94 A;  4YOV A;  4NCA A;  2GEM A;  2D0B A;  4BRH A;  4M3Z A;  3LPU A;  4IOX A;  3SK3 A;  4BRL A;  4JYA K;  1X3N A;  4BRP A;  3CC4 N;  3QFU A;  3S41 A;  2W40 A;  4Z0U A;  4JNE A;  5GAD P;  3ZX0 A;  3VQD A;  3KWG A;  3LP2 A;  4ELU A;  3O1W A;  4E1N A;  4DS4 A;  2P9N B;  3EZ5 A;  5KI6 A;  2IOC A;  1YTA A;  3SBG A;  4DTX A;  3SQ1 A;  4BWM A;  3DLL L;  3O9S A;  4E1J A;  4B1V A;  4H0Y B;  2ZD1 A;  3UKU B;  1XI1 A;  4QCL A;  4BQZ A;  1JL1 A;  1A5V A;  2IC3 A;  3LAM A;  1TK5 A;  2D0P A;  3BUZ B;  4DV4 K;  4DFK A;  1SQK A;  3DJC A;  5F2R A;  1NK4 A;  3SUQ A;  4IFY A;  1EO1 A;  5K14 A;  3PLA A;  3FFK B;  2YX6 A;  1Y64 A;  3HT3 A;  2X6S A;  4HVJ A;  4FJ7 A;  4Z4E A;  5CE3 A;  3R6M A;  2PZS A;  2OPP A;  3WNE A;  2FBX A;  4CZK A;  3MED A;  5BPL A;  4O8K A;  1LV5 A;  1YVU A;  2P5G A;  3NMU A;  4LC9 B;  4BRG A;  4BE2 A;  1IJJ A;  1QHT A;  1GLD G;  4YOX A;  1NOZ A;  3DXK A;  3DRP A;  2VCP A;  5EXW A;  5AQP A;  1YIT N;  3CC7 N;  1YHQ N;  3TPQ A;  5AQK A;  3SAH A;  3AVH A;  2FF6 A;  3WXK A;  3NVK A;  4FSV A;  1MA9 B;  5C25 A;  1KXP A;  3VQP A;  5F0X A;  1CZA N;  4DV0 K;  1BL3 A;  4EAH D;  2ZM6 K;  2A3Z A;  1RT3 A;  1SL0 A;  5AQH A;  2V7Y A;  1QQC A;  3RR7 A;  3CM6 A;  1HPM A;  4IOA L;  1NMN A;  2E2Q A;  1TAU A;  4KKO A;  2A41 A;  1DEJ A;  3P4I A;  1TL3 A;  3U4L A;  2NUB A;  4DR1 K;  1Q81 O;  3RR8 A;  3NF7 A;  3QLH A;  1IH7 A;  2NZT A;  3D7E O;  4I2P A;  3K9K A;  1HMV A;  1W7A A;  5BN8 A;  4BC2 A;  3LDL A;  3EN9 A;  3HRG A;  5BRE A;  4CK1 A;  4FJJ A;  4FWP A;  1OH7 A;  1BG3 A;  4CZM A;  1WUA A;  1XMQ K;  4DTU A;  1WSG A;  2V52 B;  3A2F A;  2KKZ A;  2P9U B;  3ZT1 A;  4K25 A;  4KRE A;  3U9Z A;  1SKW A;  4QOZ B;  4CVN E;  3C0B A;  1JLE A;  2E20 A;  1NOY A;  4W5T A;  4FWM A;  4E7K A;  4JV5 K;  3SPZ A;  3PUF A;  2E2P A;  3P1G A;  1U6Z A;  3WNG A;  4HUG A;  3C6H A;  4CK2 A;  3U3Y A;  4GW6 A;  1O13 A;  4CGG A;  3FZH A;  4OLA A;  4NB4 A;  5DMR A;  5AQV A;  2I7N A;  1VQN N;  4I7F A;  4RW6 A;  4XEI A;  4KBO A;  3L2U A;  3QEX A;  1Q9X A;  1OH6 A;  2D0C A;  1SL1 A;  4IFV A;  1TKX A;  3O3G A;  4DR4 K;  2D5R A;  1J5E K;  3CJ1 A;  1R0A A;  1LW2 A;  3VQ7 A;  3ENO A;  4E7I A;  2KHO A;  3ZSR A;  3WNF A;  4FM2 A;  3M8P A;  2A1R A;  3VQB A;  4FPB A;  1SZ2 A;  3TU5 A;  1MU2 A;  4DU4 A;  4BWJ A;  4BG9 A;  3HP9 A;  4DWI A;  3RRH A;  4K42 A;  1K6Y A;  3DM2 A;  3AO1 A;  5J2P A;  1J5O A;  3VQ4 A;  5C2D A;  4JKF A;  1JCE A;  1K8A O;  4PL8 A;  3P5J A;  1DTQ A;  3WQU A;  4CZJ A;  3HYF A;  3WXM B;  3WXL A;  1VSH A;  1RBS A;  3SV4 A;  4IG0 A;  4R5P A;  3CCJ N;  4JK8 A;  3NVM A;  2OPR A;  3CJ7 A;  2OAN A;  3M3Z A;  4OKK A;  2W41 A;  2NNW A;  3M8Q A;  4NLB A;  3SLC A;  2F8T A;  4CJ3 A;  5AQJ A;  4LH5 A;  1TAQ A;  4N76 A;  3VES A;  4I9L A;  1S5J A;  4EHU A;  3QET A;  1IKV A;  3ZSW A;  4F2S A;  1N33 K;  3PSI A;  1XC3 A;  1IV0 A;  5HP1 A;  1T3V A;  1S1U A;  4BDP A;  2D0A A;  1TVR A;  1C0M A;  3T69 A;  1WSJ A;  1UOC A;  4XH4 A;  2WON A;  3F5T A;  4DV5 K;  3DXM B;  4I9Q A;  3VTH A;  4CJ7 A;  3ZSZ A;  4KI4 A;  3ZET B;  2G8I A;  5FPN A;  4WE1 A;  5EY4 A;  1QZ6 A;  1ZC6 A;  4BDY A;  3J7Y P;  4CEO A;  2JWK A;  4PKG A;  4JS5 A;  4JI7 K;  1GOA A;  2G8U A;  1XNQ K;  4BC3 A;  3KD5 E;  1IKW A;  4CHQ A;  4CIF A;  4DLG A;  3U9D A;  4LFA K;  3LDN A;  1X9M A;  3OYJ A;  1JLC A;  1NNE A;  4FJI A;  2P9I B;  3ZSY A;  1HYZ A;  2YHW A;  4M3X A;  2IVN A;  3KVG A;  1M90 O;  3ZET A;  3T19 A;  5M1K A;  2F9W A;  4OX9 K;  3H1V X;  3DI6 A;  2HBJ A;  2P9K A;  1NGF A;  3BF3 A;  4AIL C;  2CGJ A;  5EX5 A;  3SBT A;  4FK4 A;  4E19 A;  3B8A X;  1BWF O;  3GOI A;  2V51 B;  4AHV A;  1N8R O;  3HOT A;  2KTQ A;  4OPJ A;  3TAR A;  4W5R A;  1ZXO A;  4JKG B;  4DQI A;  4O44 A;  3FR0 A;  3V1O A;  1LOT B;  3G25 A;  1NM1 A;  1X9J A;  2D4W A;  4WQ4 A;  2PYJ A;  4CZL A;  4DTS A;  2EHG A;  4JHD A;  1RDW X;  3LP3 A;  1L3S A;  3V81 A;  3TWH A;  3OYD A;  4CJR A;  3O9U A;  3U8X A;  4FWK A;  4ISG A;  3PX0 A;  3RMB A;  2I5J A;  4KHN A;  2P9P B;  2B6A A;  4C8M A;  4HUF A;  4JKG A;  3WXJ A;  2F96 A;  5CYM A;  3HST B;  4HHT A;  3E9L A;  2EX3 A;  3S3M A;  1HNV A;  4K0K K;  3CI5 A;  2HW3 A;  3LDQ A;  4YOR A;  4NXN K;  1QSS A;  2HBM A;  5B8H A;  2Q2R A;  1REV A;  4GNI A;  3SYZ A;  1TKT A;  4FXD A;  1WB9 A;  3TTD A;  2Q3S A;  2NRZ A;  2P9P A;  4DSK A;  3EKU A;  5I9E B;  1NKE A;  4B3O A;  2O8D B;  2ZWH A;  4NO7 A;  3U3G A;  4JK9 A;  1RCH A;  3OYE A;  2Q31 A;  1SS6 A;  1KVB A;  3KLI A;  3BEX A;  4KH4 A;  4CJP A;  5AZJ B;  3VA0 A;  1GLE G;  4CFA A;  4HTU A;  4OPK A;  3IDH A;  4J8F A;  2RF2 A;  4BRA A;  3NE6 A;  4Z4C A;  4DLE A;  4CJW A;  4KV8 A;  4CBU A;  1VQ8 N;  4JKB A;  4LF5 K;  3ULD A;  3EO3 A;  5GAG P;  3VEV A;  3LM2 A;  4FW1 A;  4EZ9 A;  4DQQ A;  4EFH A;  2O8D A;  3SJH A;  4FW2 A;  1KAY A;  3T1Y K;  2HND A;  3NF6 A;  4CER A;  4CJ5 A;  4X62 K;  1MDU B;  3VEX A;  1S9E A;  3SQ0 A;  1BU6 O;  3A5N C;  5GAH P;  2X6N A;  4B08 A;  5JVG L;  3DMJ A;  1EKE A;  3IAY A;  4NXM K;  4K43 A;  4KRF A;  1Q82 O;  3QER A;  1EET A;  1S1W A;  4JD2 B;  1WBD A;  3NFA A;  1T7P A;  1KRP A;  4LF6 K;  3D2E B;  4PUO A;  3EE9 A;  1W0H A;  4MO4 A;  3CCV N;  4KHW A;  3ENB A;  5DK5 A;  2HVI A;  1ATS A;  1U48 A;  2W6L A;  3HJF A;  2G8W A;  4UQG A;  1XC9 A;  4F8R A;  1J6Z A;  1U49 A;  3FZL A;  1K73 O;  3C65 A;  4DTN A;  1RT5 A;  1KCF A;  4DU1 A;  2FC0 A;  4BGB A;  3RSE A;  4JD2 A;  4BAC A;  4J2D A;  4B8A B;  4FWQ A;  1HX1 A;  2Z1J A;  3CJA A;  3ULE B;  3D2E A;  4AM6 A;  4DMN A;  2HHS A;  1LW0 A;  4BR7 A;  3MX5 A;  4CEA A;  2XRI A;  4A2A A;  2JWL A;  3AA4 A;  1XHZ A;  1ZBH A;  1QS4 A;  3ZEU A;  1KLN A;  1CXU A;  1XQS C;  4TSX A;  2HF4 A;  4OGE A;  4C8O A;  1HYV A;  2DY4 A;  1BOT O;  3O1B A;  3PSF A;  3KK2 A;  5IT9 O;  4H8K A;  5J2M A;  2NRT A;  3NCI A;  4BRN A;  1HUX A;  3B6P A;  2OZM A;  4FWN A;  4CJF A;  1GLC G;  1HNZ K;  4E7L A;  4CED A;  3K2P A;  2UU9 K;  3TAQ A;  3CMA N;  4CIG A;  3B6O A;  4X64 K;  3DOL A;  4A61 A;  4MO5 A;  5AQO A;  1SKR A;  3VF4 A;  1E4F T;  2GX9 A;  2YHY A;  1BIS A;  3OS0 A;  4WFB L;  1Z6R A;  4JRQ A;  1OH8 A;  3H46 O;  4CEB A;  2O8E B;  4CD3 A;  1YJN N;  4H5N A;  3HTV A;  2FBT A;  2VWJ A;  4YOY A;  4CGF A;  3KHY A;  5FPD A;  3BZK A;  1ASW A;  2YJE A;  1S22 A; 
#chains in the Genus database with same CATH homology
 1VSM A;  2YKN A;  3ASM A;  2IDO A;  4CF2 A;  3KLF A;  1NK6 A;  2ITG A;  1BL3 A;  3T3F A;  4KHS A;  1BHL A;  1RT3 A;  4N5S A;  4KI6 A;  1SL0 A;  4EP5 A;  1QQC A;  5J2Q A;  3RR7 A;  2P51 A;  4B9V A;  1O1W A;  2HHT A;  2BE2 A;  3CM6 A;  5HRR A;  3LZJ A;  3JSM A;  3VQQ A;  3LDS A;  3TAF A;  1C0U A;  3NHG A;  4E3S A;  1TAU A;  4KKO A;  3VQ6 A;  3SUO A;  5EU7 A;  3O3F A;  1TL3 A;  4F3O A;  1ITG A;  2NUB A;  3QEP A;  2O4G A;  1UWB A;  4CHP A;  5D3G A;  4FLX A;  1WN7 A;  3RR8 A;  3NF7 A;  3QLH A;  1IH7 A;  4M3U A;  3SQ4 A;  3HL8 A;  3MEE A;  4I2P A;  3DLR A;  1HMV A;  2OYQ A;  3T1A A;  3QES A;  1Z25 A;  4OGC A;  1U45 A;  3IRX A;  4KTW A;  4CK1 A;  2Y1J A;  4FJJ A;  3SZ2 A;  3V9W A;  2HHU A;  4NCG A;  4KTZ A;  1CZB A;  1W9H A;  4KB0 A;  3O4Q A;  2YNI A;  5C24 A;  1TV6 A;  4CGI A;  4DTU A;  3THV A;  1WSG A;  4O5B A;  1LWE A;  4OKJ A;  4J2A A;  1TK0 A;  3A2F A;  1KTQ A;  3G0Z A;  4FLW A;  4GVM A;  4YNQ A;  5KGW A;  1HQE A;  3ZT1 A;  3AVI A;  1C6V A;  4KRE A;  3KKS A;  1EP4 A;  1B92 A;  4ZTF A;  1SKW A;  4HCB A;  4QOZ B;  1JKH A;  1YT3 A;  2XHB A;  4B9M A;  1KVC A;  1JLE A;  1JLF A;  2XY6 A;  4W5T A;  1KLM A;  3K5N A;  3TAB A;  1NOY A;  4Q0B A;  3MXM A;  4E7K A;  4FLU A;  3K5O A;  2X74 A;  4OJR A;  4ICL A;  4E7H A;  3SPZ A;  3PUF A;  4CEQ A;  1BQN A;  3P1G A;  2JGU A;  1S6Q A;  1RT2 A;  2ZQB A;  3WNG A;  4CEE A;  4HUG A;  2GV9 A;  3I0S A;  3VQC A;  2BGG A;  4FJM A;  4FJX A;  2DTU A;  4CK2 A;  3U3Y A;  5CZ1 A;  4B8C A;  4JLH A;  1A5W A;  4GW6 A;  3TAM A;  4CGG A;  4HUE A;  3ZCM A;  4OLA A;  1WSF A;  3SI6 A;  3NH1 A;  1QSY A;  5DMR A;  2O4I A;  3CFO A;  4I7F A;  4RW6 A;  4JS4 A;  3NGY A;  5KRS A;  3L2U A;  4FZY A;  1NJW A;  3QEX A;  1C1C A;  1JXE A;  4DTR A;  1Q9X A;  2RPI A;  3VA3 A;  3U6F A;  1KVA A;  1LWC A;  3OY9 A;  4OLB A;  4CF0 A;  4CFD A;  3LP0 A;  3KK3 A;  2HMI A;  4F3T A;  2D0C A;  3AVF A;  4IFV A;  1TKX A;  3QIP A;  1SL1 A;  2F8S A;  1KFS A;  3QO9 A;  4ELV A;  3O3G A;  1NKB A;  2D5R A;  4IDK A;  1R0A A;  1X9S A;  1RT4 A;  4ID1 A;  2X78 A;  1LW2 A;  1XHX A;  4AH9 A;  1RTI A;  3VQ7 A;  4B9N A;  4PQU A;  4E7I A;  3QNN A;  3BGR A;  3CFP A;  3ZSR A;  3V1R A;  3WNF A;  3M8P A;  4FM2 A;  3S3O A;  2A1R A;  4CIE A;  3VQB A;  3I8D A;  3V9S A;  1WLJ A;  4N56 A;  4DQS A;  5SZT A;  2XY5 A;  4DU4 A;  1MU2 A;  4LSN A;  2LSN A;  4BWJ A;  3VQ5 A;  3HP9 A;  4NYF A;  5HRS A;  4DWI A;  2WOM A;  2YV0 X;  3RRH A;  1WNS A;  1K6Y A;  2VWK A;  4DSF A;  3DM2 A;  3C95 A;  3AO1 A;  2Z1G A;  3AA3 A;  4FJL A;  5HBM A;  4M41 A;  5J2P A;  1J5O A;  4FM1 A;  3VQ4 A;  3KK1 A;  1HRH A;  4E7J A;  3NH0 A;  5FRM A;  3ZSV A;  1LWF A;  3LAL A;  3EYZ A;  2HVH A;  3P5J A;  1L3V A;  2YNF A;  1DTQ A;  3KD1 E;  4LH4 A;  3SJJ A;  2B5J A;  3HYF A;  3LZI A;  1VSK A;  3D45 A;  1VSH A;  5I3U A;  2OPS A;  1RBS A;  1ASU A;  4IG0 A;  3VQA A;  4R5P A;  3HXM A;  3SV4 A;  1VRT A;  4RW4 A;  4LD0 A;  1RTD A;  3AO4 A;  4FJH A;  3L2W A;  3LAN A;  4G1Q A;  3SUP A;  1FXX A;  3KIO A;  4M3Y A;  1HYS A;  1J53 A;  4BE0 A;  3FFI A;  4CJQ A;  1EX4 A;  3DRR A;  2DFF A;  2OPR A;  4XIU A;  4OKK A;  5CZ2 A;  2OPQ A;  4DTJ A;  5CYQ A;  1UA0 A;  3M8Q A;  1YTU A;  1S1T A;  3AVL A;  4Y1C A;  3VQ8 A;  4EZ6 A;  3K5L A;  1NK9 A;  4KHQ A;  4CEZ A;  1T8E A;  3AVM A;  4RW8 A;  3L2Q A;  4FJK A;  2HNZ A;  4CJ3 A;  5HRO A;  4CJK A;  2F8T A;  4KTQ A;  4GMJ B;  3OYB A;  3L8B A;  4LH5 A;  1IKY A;  4W5Q A;  3NAE A;  1VSJ A;  4FM0 A;  1NJZ A;  1RDC A;  2W42 A;  1TAQ A;  4OVL A;  4CJU A;  3O3H A;  1RT6 A;  4N76 A;  3HO1 A;  2IAJ A;  4I9L A;  2B4J A;  1S5J A;  2OA8 A;  3MEC A;  4CJE A;  3QET A;  1IKV A;  3ZSW A;  4F2S A;  3CFR A;  1L5U A;  1HPZ A;  5HP1 A;  4J2E A;  1FKP A;  3NBP A;  3OVN A;  5FDL A;  3SPY A;  1S1U A;  3QIO A;  4FVM A;  4DU3 A;  2D0A A;  3OYH A;  1TVR A;  1TKZ A;  4BDP A;  4E0D A;  4IBN A;  3D0P A;  2R7Y A;  2RKI A;  1C0M A;  3V9U A;  3BDP A;  4FK0 A;  1WSJ A;  1UOC A;  2HHV A;  4AHC A;  3DLE A;  4KO0 A;  1Q9Y A;  2WON A;  4M3T A;  1BIZ A;  3TAN A;  3JYT A;  3SCX A;  4I9Q A;  5SWM A;  2JLE A;  1JLB A;  1ZBF A;  3ZSZ A;  3NGI A;  4Z4H A;  4O0I A;  3S9H A;  4KI4 A;  4WE1 A;  4K8X A;  2G8I A;  1BCO A;  4BDY A;  1GOC A;  4M3W A;  4FYD A;  1WSE A;  2ETJ A;  3AO3 A;  3RMA A;  3IS9 A;  4CEO A;  3HM9 A;  3CQ8 A;  4JS5 A;  4Q5V A;  1C1A A;  3MAQ A;  1GOA A;  2G8U A;  3LWL A;  3AVA A;  3KD5 E;  1IKW A;  1RBR A;  3DLG A;  1F21 A;  3HPG A;  1TL1 A;  4CHQ A;  1I3A A;  4CIF A;  4KHU A;  4DLG A;  3RMD A;  4F4K A;  1KFD A;  4CGD A;  1FK9 A;  1SV5 A;  1UAX A;  5JS1 A;  2VG5 A;  1X9M A;  2KZZ A;  3OYJ A;  3PV8 A;  1RDD A;  4L8R B;  1JLC A;  1RBU A;  4FJI A;  4MQ3 A;  5KTQ A;  2DFE A;  4PA1 A;  1BI4 B;  3VQE A;  3OJS A;  1BCM A;  3ZSY A;  1NK8 A;  1S6P A;  4FLT A;  1ZYQ A;  1HYZ A;  4M3X A;  2Z1H A;  3OYF A;  1SL2 A;  2QXF A;  1VSE A;  3T19 A;  1Y97 A;  4DQP A;  1ZBI A;  1KSP A;  1I39 A;  1HQU A;  3K5M A;  4CGJ A;  3KTQ A;  3DI6 A;  2G8K A;  5JS2 A;  1DLO A;  2E6L A;  1TKD A;  4AIL C;  4FK4 A;  2FBY A;  2YHB A;  4E19 A;  5HRP A;  1G15 A;  3WNH A;  1BIU A;  4AHV A;  4DS5 A;  3ZSO A;  1BI4 A;  2KTQ A;  4OPJ A;  3TAR A;  4W5R A;  3IG1 A;  1WSH A;  3LWM A;  1RT1 A;  3RTV A;  4M3R A;  2G8V A;  1L3U A;  3L2R A;  4DQI A;  4O44 A;  4CCH A;  4HCC A;  2HHX A;  4DG1 A;  3OYK A;  1ZBL A;  2YNG A;  1C0T A;  2G8H A;  4FJG A;  3V1O A;  5E41 A;  4CF1 A;  1VSL A;  3MXI A;  3CG7 A;  4AHT A;  2QKB A;  1HNI A;  1WAF A;  3V1Q A;  4Z4I A;  1JLQ A;  2PYJ A;  1NK0 A;  3TR8 A;  4CHZ A;  3RRG A;  4DTS A;  1J54 A;  2IS3 A;  3O4N A;  2EHG A;  2FBV A;  1NK7 A;  4W5O A;  2XO7 A;  4Z4F A;  3LP3 A;  1NKC A;  4IKF A;  1L3S A;  1D8Y A;  3V81 A;  1B9F A;  4J2B A;  2ATQ A;  2IGI A;  3DLB A;  4Z4G A;  1CLQ A;  3SV3 A;  3TWH A;  3OYD A;  4LY7 A;  3OYM A;  1S1V A;  2GBZ A;  2KQ2 A;  4CJR A;  1T05 A;  2P1J A;  3DOK A;  1GOB A;  3ALY A;  4H4M A;  3TAP A;  3PX0 A;  3RMB A;  2I5J A;  3NF9 A;  4KHN A;  4KB1 A;  3V6D A;  4C8M A;  2B6A A;  4NCB A;  4HUF A;  4RG8 A;  3C6T A;  3CYM A;  2KZM A;  2F96 A;  1RIL A;  3E01 A;  5CYM A;  4CJS A;  3HST B;  2XY7 A;  4HHT A;  2EX3 A;  3V9X A;  4NYN A;  3AA2 A;  3S3M A;  1HNV A;  3HP6 A;  5KRT A;  3ZSQ A;  1SKS A;  2HW3 A;  2KFN A;  3DRS A;  1C1B A;  1SUQ A;  3V9Z A;  1QSS A;  1RDB A;  2DFH A;  2HB5 A;  4FLY A;  2Y1I A;  3QEV A;  4AHS A;  1NK5 A;  3AVG A;  1RTH A;  1WAJ A;  1REV A;  1ZBU A;  4CJ4 A;  3ITH A;  2YHA A;  3SYZ A;  3L3V A;  3QEW A;  3DLK A;  4E1M A;  1TKT A;  1B9D A;  4FXD A;  1S9G A;  2Q3S A;  2KW4 A;  4CJT A;  1D5A A;  1IO2 A;  1QTM A;  4DSK A;  4BDZ A;  1NKE A;  3DYA A;  1BGX T;  2PY5 A;  4FJN A;  4B3O A;  3QNO A;  2HHW A;  4CE9 A;  4BE1 A;  2KFZ A;  3SUN A;  4ZTJ A;  4C8L A;  5CY4 A;  3U3G A;  3OYI A;  4DF8 A;  4DTM A;  1RCH A;  3MEG A;  4CFB A;  3OYE A;  1KVB A;  3KLI A;  3KLG A;  1EXQ A;  1S1X A;  4CJP A;  4N41 A;  4Y1D A;  5HLF A;  4B9S A;  2XY8 A;  1QE1 A;  3TAG A;  4CGH A;  3VA0 A;  1RDA A;  3MXJ A;  4CFA A;  4HTU A;  2G8F A;  4OPK A;  1RBV A;  1JLA A;  3K57 A;  3AVB A;  2RF2 A;  2HHQ A;  4CEC A;  4CES A;  1HJR A;  2P5O A;  2A1S A;  3NE6 A;  4Z4C A;  4DLE A;  4CJW A;  4KV8 A;  4B9L A;  1DTT A;  1FKO A;  5FRO A;  3K59 A;  1X9W A;  4N47 A;  3HPO A;  2GUI A;  4FLZ A;  4DFJ A;  3ULD A;  1LAW A;  4PWD A;  1VSD A;  3LPT A;  2AJQ A;  4IG3 A;  4CEF A;  2E6M A;  3AV9 A;  3SNN A;  4FW1 A;  3OYA A;  1QSL A;  2QKK A;  4EZ9 A;  3ZT4 A;  4DQQ A;  1JLG A;  3I0R A;  4FW2 A;  4M42 A;  3NDK A;  3QIN A;  4F2R A;  2HND A;  4CF8 A;  3NF6 A;  4CER A;  4CJ5 A;  1S9E A;  3H08 A;  3SQ0 A;  1LAV A;  1D9F A;  3SQ2 A;  3DLH A;  3UIQ A;  4ZHR A;  1A5X A;  4JRP A;  3NGZ A;  2YNH A;  3OJU A;  4DQR A;  1N5Y A;  3F73 A;  3OS2 A;  3VQ9 A;  4ID5 A;  3ZSX A;  4DFM A;  2X6N A;  2VG7 A;  4M45 A;  2BAN A;  4B08 A;  5J1E A;  3TAE A;  4FZX C;  3KLH A;  3DMJ A;  1EKE A;  1NJY A;  3IAY A;  4C8K A;  2E4L A;  4QAG A;  1CZ9 A;  4I2Q A;  1WSI A;  4KRF A;  4DFP A;  3QER A;  3L3U A;  3M8S A;  4O4G A;  4EP4 A;  3HK2 A;  1EET A;  3OYL A;  2PYL A;  4RW7 A;  1S1W A;  1JL2 A;  3PX6 A;  4O55 A;  3P83 D;  3NFA A;  1T7P A;  1KRP A;  1U04 A;  4CHN A;  4KFB A;  3AVN A;  3AVJ A;  3C94 A;  4KHY A;  4NCA A;  4PUO A;  1W0H A;  4FCY A;  4DSE A;  4KAZ A;  4KHW A;  1U4B A;  2D0B A;  5DK5 A;  4M3Z A;  2HVI A;  3LPU A;  4AHR A;  1U48 A;  1RTJ A;  2OZS A;  4FJ5 A;  3HJF A;  2G8W A;  4UQG A;  1TGO A;  4W5N A;  3RMC A;  1XC9 A;  3M8R A;  5I42 A;  3HVT A;  3OS1 A;  3EY1 A;  3K58 A;  4B9T A;  4Z0U A;  4F8R A;  1Q8I A;  2RN2 A;  4YFU A;  4FLV A;  1U49 A;  3AVC A;  3AO5 A;  3VQD A;  4DTN A;  1ASV A;  1RT5 A;  1KCF A;  1Z26 A;  3LP2 A;  3NF8 A;  4CK3 A;  4PY5 A;  4DU1 A;  4ELU A;  4E1N A;  2VG6 A;  3L2V A;  2FC0 A;  3C6U A;  4DS4 A;  3EZ5 A;  3RWU A;  5KI6 A;  4BAC A;  2IOC A;  4J2D A;  4B8A B;  1VK0 A;  3ISN C;  5FRN A;  2Z1J A;  3ZT3 A;  1YTA A;  3OYG A;  4DMN A;  3QEI A;  4DTP A;  1LW0 A;  2HHS A;  1J9A A;  4DTX A;  1N6Q A;  4CEA A;  3KJV A;  5J2N A;  2XRI A;  1XHZ A;  1UA1 A;  3AA4 A;  4BWM A;  3SQ1 A;  1ZBH A;  1VRU A;  1T03 A;  1QS4 A;  1RBT A;  4DSL A;  3G10 A;  2ZD1 A;  5C42 A;  3KLE A;  1KLN A;  1CXU A;  1XI1 A;  2BDP A;  4DSI A;  4QCL A;  1VSI A;  4OKE A;  4TSX A;  2YKM A;  1JL1 A;  1A5V A;  1NJX A;  2IC3 A;  3LAM A;  4OGE A;  1TK5 A;  1L3T A;  4C8O A;  1HYV A;  2DY4 A;  4DFK A;  3PY8 A;  3KK2 A;  4H4O A;  1NK4 A;  3SUQ A;  4DSJ A;  4FK2 A;  4IFY A;  4H8K A;  5J2M A;  3KKR A;  4CJV A;  3ZT0 A;  5K14 A;  3NCI A;  1CXQ A;  1IG9 A;  4MFB A;  2HNY A;  3AA5 X;  4AHU A;  1D9D A;  1BQM A;  3ZT2 A;  3B6P A;  4CHY A;  3OYC A;  3HPH A;  3HT3 A;  4DTO A;  2OZM A;  4K8Z A;  3V4I A;  1RT7 A;  4RW9 A;  5T7B A;  3CM5 A;  3AVK A;  4CJF A;  1U47 A;  2X6S A;  1JXB A;  4HVJ A;  3PO4 A;  1IKX A;  2ZE2 A;  4FJ7 A;  4E7L A;  4CED A;  4Z4E A;  3K2P A;  3TAQ A;  4CFC A;  4LSL A;  2PZS A;  2OPP A;  3WNE A;  3PO5 A;  4FJ8 A;  2FBX A;  4CHO A;  3MED A;  4CJL A;  3LP1 A;  4CIG A;  3B6O A;  4DF4 A;  5HRN A;  1YVU A;  1RNH A;  3DOL A;  3OYN A;  1LV5 A;  2P5G A;  4ELT A;  4BE2 A;  1XWL A;  4O0J A;  3VN5 A;  1QHT A;  1NOZ A;  1VSF A;  1SKR A;  1BIS A;  3DRP A;  3OS0 A;  3S3N A;  2QK9 A;  4JRQ A;  4E89 A;  4KPY A;  4CEB A;  3F9K A;  5KGX A;  3AVH A;  2FBT A;  4FZZ A;  4C8N A;  4CF9 A;  2VWJ A;  1TK8 A;  1X1P A;  4CGF A;  5C25 A;  3LAK A;  3AO2 A;  3HVR A;  4B9U A;  3VQP A;  4FJ9 A;  1ASW A;  2Z1I A;  3TI0 A;  3PX4 A;  3NH2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...