1HYZA

Hiv integrase core domain complexed with a derivative of tetraphenyl arsonium.
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
154
structure length
142
Chain Sequence
SPGIWQLDTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAAWWAGIKQEFGQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGGYSAGERIVDIIATDIQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Identification of a small-molecule binding site at the dimer interface of the HIV integrase catalytic domain.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 51
structure length 142
sequence length 154
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2001-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1hyzA00
3THVA 1EXQA 4CEOA 4OPKA 4FLVA 5HLFA 1JLGA 4GMJB 3HVTA 1G15A 1RDBA 3DLGA 4OVLA 3OYKA 2IOCA 1S9EA 3DOKA 4DSIA 1QTMA 3AVNA 4DWIA 1DLOA 4KHUA 3T3FA 2Y1JA 1T8EA 3C6UA 4FJIA 1EKEA 3F9KA 4M3TA 4CIGA 4JS5A 3VN5A 4CEBA 3KK2A 2VG5A 3KKRA 4I2QA 4CFCA 1SKSA 1SUQA 2E6LA 3E01A 2IDOA 4O5BA 3V9XA 3CG7A 1L3UA 2PZSA 4EP5A 2XY8A 1TL3A 1J5OA 1BI4B 4KFBA 1U47A 3DLKA 4KAZA 1JLCA 2X74A 1IKXA 4DMNA 4C8KA 3O3HA 2HHVA 3L2WA 1ASWA 3IG1A 3VQ5A 3HYFA 3ZSQA 3OYDA 3K5MA 4CGIA 1RT1A 5EU7A 4DSEA 4DFJA 4FK2A 4B3OA 4ZHRA 5E41A 2YNHA 4CGJA 4CCHA 4B9NA 3AO3A 3ZSRA 3DM2A 3HPHA 4CIFA 4ZTFA 1LW0A 2FBYA 4Z4FA 3VQ6A 3ZSZA 5J2NA 1Q9XA 4M3RA 2XRIA 3LZIA 3OYEA 1UAXA 1U04A 1VRTA 3AVIA 1I39A 4IDKA 1IKWA 1W0HA 3KIOA 4ID5A 1RT6A 4FW1A 4BDYA 1FXXA 3ZSWA 3SZ2A 2XY5A 3NDKA 3S3MA 4DU4A 3ZSOA 3ASMA 3IS9A 3PO5A 3TANA 3ZSVA 4JS4A 3HJFA 4CJKA 5HRPA 1DTQA 4HUEA 1BGXT 3RMAA 3SPZA 2Z1GA 1FK9A 2RPIA 1JLQA 3LDSA 3PX0A 4CEQA 4AHRA 4FZYA 4B9TA 2W42A 4PWDA 3RMDA 1FKOA 4CF0A 1GOBA 5SWMA 4AHSA 1I3AA 2RKIA 2OPQA 3AVGA 3TABA 4C8MA 1BCMA 4CHOA 3KTQA 4DTNA 4M3YA 1LWCA 3NH1A 4YNQA 1C0MA 3K2PA 4CJUA 1ZBFA 4DG1A 4KO0A 4CJSA 2NUBA 4M3XA 1S6PA 2KZMA 3VQ7A 3NGYA 3SUOA 1JLFA 1RDAA 4OGCA 4PQUA 4MQ3A 1BL3A 1D8YA 4HCBA 2OA8A 3VQ8A 3OJSA 3HO1A 1U49A 2X6SA 3DRRA 2HNYA 2G8FA 1NK5A 3ZT4A 1BIUA 3F73A 1D5AA 2B4JA 4DQRA 3QEWA 1B9DA 5FDLA 3OYMA 4HVJA 3NFAA 4IBNA 1U4BA 3QEVA 3BDPA 1BQNA 1IKVA 3ZT0A 5C25A 1NJYA 4Z4IA 4QOZB 5C42A 3EY1A 3IAYA 1BQMA 1KVAA 4BACA 4DQIA 2DTUA 2HNZA 3HL8A 4B9MA 5D3GA 3ZSYA 3QNOA 4DTSA 1RT7A 3WNGA 3MXIA 1U48A 3NCIA 4KHYA 3DLEA 4NYFA 4DFMA 2YV0X 1LAVA 1NKBA 2YKMA 2ZD1A 3O3FA 3VQAA 3P5JA 4CIEA 3D45A 2YHAA 2HHWA 2HHUA 2JLEA 3M8SA 3TAGA 5J1EA 3HPGA 1NK8A 3CFRA 3V9UA 1VK0A 5HRRA 3SQ2A 2EHGA 4DF8A 3QNNA 1KVCA 1UOCA 1XC9A 4OJRA 3KLEA 3ULDA 1SV5A 1C0TA 4HCCA 2Q3SA 3RRHA 1WSGA 4BWMA 4IG0A 1WNSA 2F8SA 4K8ZA 4CJPA 1VSFA 4EP4A 3DLRA 1SL1A 3V1QA 4KTQA 3QEPA 4B9SA 4Z4CA 1VSHA 3HT3A 3TARA 4FLXA 3AVLA 4CJ4A 3G0ZA 1NJWA 4EZ6A 1Z26A 3VQQA 4RW6A 4CFBA 2IS3A 4ELVA 2IC3A 3PUFA 4RW8A 4CFAA 4DSJA 4F2SA 4K8XA 4OLBA 1LV5A 3AA2A 3AVCA 2D0CA 3JYTA 1NOYA 3O3GA 3ZT1A 3AVKA 2XHBA 5JS1A 1TK0A 4Z4HA 4KPYA 2LSNA 4F3OA 3NH0A 1UWBA 3AA4A 4MFBA 3UIQA 1EX4A 1HRHA 4AHTA 4M42A 1L3VA 2YNFA 5J2MA 1IG9A 3AO4A 1KFDA 3CM5A 4KKOA 2RN2A 2VWJA 2HHSA 3LP1A 1Q9YA 3MEEA 3M8RA 1JLBA 4E7IA 2VG7A 4I2PA 3OYIA 5I42A 3SNNA 2PY5A 4OPJA 1RILA 4AH9A 4E1MA 3VA0A 2BANA 1A5VA 1WAFA 3OYLA 3LZJA 3V9ZA 4CEEA 1JKHA 5HBMA 2DFHA 4FM0A 1NJZA 2G8UA 4DF4A 1VSJA 4FJMA 3C94A 2QKKA 1C1BA 4OKJA 2A1SA 4LSNA 4CJEA 3PX4A 5KI6A 3SPYA 3P1GA 3AVBA 3O4NA 1NK4A 4E7HA 3OYFA 1HQEA 4FLTA 2P1JA 1O1WA 1KRPA 4FJHA 4J2EA 4LH4A 3MXMA 4FVMA 4KHWA 4TSXA 3OS1A 3QERA 4N76A 3DRPA 3MEGA 3OYCA 4CF2A 1C0UA 4HUGA 3L3UA 1ZBUA 4CJVA 4GVMA 1ZBHA 4I9LA 3OS2A 3TAEA 1VSKA 5DMRA 3PV8A 3FFIA 1ZBLA 1GOCA 4RW4A 4FJXA 5SZTA 3OYAA 1WSHA 3ALYA 4DU3A 3DOLA 2X78A 2ZE2A 3ZSXA 2VG6A 4CK3A 1UA0A 1SKRA 3AA3A 1QE1A 3WNFA 4CHZA 3NF6A 5HP1A 1SL0A 3U6FA 1NK9A 4FJGA 1MU2A 1S1VA 5KTQA 3KLFA 3HVRA 3SI6A 3AO2A 1KFSA 2ATQA 2FBXA 1CZ9A 2YNGA 4CEFA 4OGEA 4NYNA 4IFYA 4B8AB 5FRMA 1VSLA 2Z1JA 4FJKA 4E7KA 1VRUA 1KLNA 2GUIA 4FK0A 2YKNA 4C8OA 4FJJA 1ASUA 3VQCA 2BGGA 4DTMA 4BE1A 4BDPA 3DMJA 4CF8A 4BE0A 1RCHA 3KD1E 2G8IA 3VA3A 5CYQA 4Q5VA 1HJRA 1YTAA 4I9QA 3S3NA 4CHYA 1XHXA 4E89A 5J2QA 2GBZA 1HYVA 1BCOA 4CHPA 3OYJA 3NGIA 2ETJA 4NCGA 1JXEA 2YNIA 4CJQA 1QSSA 1QSLA 1KCFA 3OY9A 5J2PA 1S5JA 1HQUA 3G10A 1TK8A 4J2DA 1TKDA 4N41A 3C6TA 1NKEA 3L2UA 1EETA 2VWKA 4JLHA 4QAGA 4Z0UA 4M45A 2FC0A 4CJ5A 2Z1IA 4UQGA 2HVHA 4CFDA 1L5UA 1RT4A 3M8QA 1KVBA 1BI4A 5K14A 4N47A 2OPRA 1FKPA 3HSTB 1SL2A 3AO1A 2AJQA 4W5QA 3LP2A 1L3TA 4O0JA 4B08A 3V6DA 4KB1A 5CY4A 1HYZA 4DSLA 1REVA 3RMCA 3K57A 1IKYA 3C95A 4DS4A 3KKSA 3NF8A 4E19A 3NE6A 1J53A 3AVJA 4DLEA 2G8HA 4CEDA 2I5JA 3TWHA 2IAJA 3OYNA 1JLAA 3SV3A 4CJWA 3IRXA 3MEDA 1X9MA 2ZQBA 1SKWA 1KLMA 4CGDA 4XIUA 3NGZA 4W5TA 3K5LA 4E7LA 1RTJA 4OKKA 4LD0A 1RBTA 1WSJA 2O4IA 2KFNA 3SUQA 4KHNA 2O4GA 2G8WA 4Y1CA 1QSYA 4DLGA 4FJ9A 1NOZA 2HMIA 3PO4A 4DSKA 4W5NA 1NKCA 4EZ9A 1HYSA 3HP6A 2HNDA 4CEZA 3KD5E 2X6NA 3SUNA 4B9UA 1TVRA 2WONA 3LP0A 1T03A 3VQEA 4CHQA 4O55A 5CYMA 5C24A 3KLHA 3SUPA 3QIOA 3TI0A 2HHTA 1TKXA 3TAMA 3LAMA 4BDZA 3SV4A 4IKFA 5HRSA 3DLHA 1TL1A 2OZMA 3K58A 3NH2A 1RNHA 2F8TA 4QCLA 4B9LA 4DTPA 4CECA 5KRTA 1S1UA 4DTRA 3B6OA 1S1XA 1JL2A 1ITGA 1KTQA 4W5OA 1J54A 1LWFA 1WSFA 1YVUA 3TAFA 3OVNA 4ID1A 2KZZA 2DY4A 5FROA 4FLZA 2YHBA 1XWLA 3JSMA 4JRQA 4DQSA 2XO7A 3MAQA 1DTTA 3I8DA 4FJ7A 4KRFA 4OLAA 3KLIA 3LWMA 4W5RA 1RDDA 4FJNA 2G8KA 4M3WA 4LH5A 3TR8A 2QXFA 4R5PA 4O0IA 3V9WA 3OYGA 5HROA 3QEIA 3TAPA 1W9HA 1TK5A 3RR8A 3VQBA 1RT5A 3QO9A 4I7FA 1KSPA 1TAUA 2E6MA 4AHVA 2R7YA 3DLBA 3V1OA 4M3ZA 1YT3A 2B5JA 3QLHA 1BIZA 3QEXA 1X1PA 4CE9A 3S9HA 1C1CA 3H08A 4LSLA 3QETA 3OJUA 3HPOA 4FJ5A 1CXUA 4FLYA 4KV8A 2D5RA 3TAQA 4M41A 5KGXA 4FCYA 3T1AA 3LAKA 3K5OA 4ICLA 4KREA 1S9GA 1TKTA 1TKZA 2DFFA 2OPPA 2P51A 1WN7A 3L2VA 4E1NA 2Y1IA 2OPSA 3QESA 4WE1A 4Q0BA 5I3UA 1HPZA 3QIPA 2G8VA 1LWEA 3OYBA 3KK3A 1N5YA 2D0AA 3LANA 2IGIA 4CF9A 1JL1A 3ITHA 4FW2A 3EZ5A 4N5SA 4Z4GA 3NBPA 3LPUA 1VSMA 1C1AA 5CZ1A 3DYAA 3WNHA 2ITGA 4O4GA 2P5OA 4ELUA 3L2QA 1WSIA 3CQ8A 1R0AA 3MECA 1QQCA 4NCAA 1YTUA 4CHNA 1N6QA 4J2BA 1C6VA 1QS4A 3ZT2A 1B9FA 3QINA 3L2RA 4KHSA 4FZZA 2KTQA 2HHXA 2F96A 3RR7A 3HK2A 4KTWA 1BHLA 1B92A 3NHGA 4HTUA 3SCXA 4CJFA 4E0DA 4PY5A 2KQ2A 4BWJA 4FLUA 3AA5X 4G1QA 3KJVA 4DQPA 1VSDA 4KB0A 3B6PA 1CZBA 3HP9A 4AILC 2D0BA 4DS5A 4FM2A 3L8BA 3D0PA 3V9SA 1XHZA 1D9FA 1Z25A 3ISNC 1J9AA 5JS2A 1K6YA 3I0RA 4CGHA 3EYZA 5T7BA 2JGUA 3O4QA 3WNEA 3AVAA 4Z4EA 3I0SA 4AHCA 2BDPA 4YFUA 4B8CA 3PY8A 1S1WA 1Y97A 3OYHA 4KHQA 2KFZA 1WSEA 2FBTA 4CESA 1A5WA 4CF1A 4L8RB 4DQQA 1U45A 1HNVA 1QHTA 4IFVA 4FXDA 3AVFA 2B6AA 2BE2A 4E7JA 2P5GA 1IH7A 1RBRA 4GW6A 4JRPA 2XY6A 4ELTA 3K59A 3SQ0A 4FJ8A 3ZT3A 2HW3A 2KW4A 4BE2A 4ZTJA 2E4LA 1RTIA 5KRSA 1ZYQA 2XY7A 3SQ1A 4CGGA 4F4KA 4E3SA 2WOMA 1ZBIA 1RT3A 4F3TA 1NK6A 3SJJA 3PX6A 3S3OA 4DU1A 3AV9A 3HXMA 5DK5A 1TV6A 3RRGA 2FBVA 4F2RA 3OS0A 4DFPA 4KI4A 4CJLA 4RG8A 3CM6A 5HRNA 4PA1A 4PUOA 3L3VA 1WAJA 2OYQA 4IG3A 3ZCMA 1VSEA 2PYJA 2QK9A 4DTXA 2OZSA 5KGWA 3SQ4A 4FZXC 1HMVA 4J2AA 3HM9A 5FRNA 3V1RA 3CFPA 3LP3A 1UA1A 4CGFA 1S6QA 3NAEA 4CEAA 1XI1A 2HVIA 4Y1DA 3DI6A 4H4MA 3T19A 2HB5A 1JLEA 1S1TA 4RW9A 1T05A 4AHUA 3NF7A 3KK1A 4FYDA 4OKEA 3CFOA 4HHTA 4FK4A 4H4OA 3AVMA 4FM1A 1L3SA 1RBUA 1D9DA 4HUFA 3SYZA 4DTJA 3RWUA 4DTOA 3M8PA 2GV9A 1RBSA 3BGRA 2A1RA 3AVHA 1WLJA 1VSIA 4DSFA 4FJLA 4CK2A 3VQPA 3MXJA 4CERA 4B9VA 2EX3A 4DTUA 1A5XA 4O44A 1RT2A 1TAQA 3DRSA 4FLWA 3RMBA 1CLQA 1Q8IA 4KTZA 1EP4A 1RBVA 3NF9A 4DFKA 3LWLA 1RTDA 1BISA 1GOAA 2RF2A 1F21A 1JXBA 3VQDA 1T7PA 4NCBA 4KI6A 4CJTA 4M3UA 4F8RA 4H8KA 2QKBA 1IO2A 1HNIA 3U3GA 1RDCA 2DFEA 3AO5A 1LW2A 4CK1A 3P83D 1RTHA 3RTVA 4N56A 4CJRA 4RW7A 3A2FA 3K5NA 1X9WA 1LAWA 4C8NA 5CZ2A 3U3YA 2Z1HA 4LY7A 3LALA 3CYMA 3VQ9A 3KLGA 2HHQA 3V4IA 1NJXA 1ASVA 1NK7A 4C8LA 1TGOA 3LPTA 1NK0A 1CXQA 4CJ3A 3VQ4A 1X9SA 3V81A 2PYLA
chains in the Genus database with same CATH superfamily
1OVQA 4CEOA 5HLFA 4GMJB 3HVTA 3CCMN 3DLGA 3O80A 3OYKA 2IOCA 1S9EA 3WUHA 2BTFA 2OTJN 4YORA 4KHUA 4IFEA 2Y1JA 1T8EA 3A5LC 3VN5A 1BG3A 2VG5A 4I2QA 3BUZB 4FYDA 3SAHA 3V9XA 5F1XA 4DR2K 1BI4B 1TUUA 3DLKA 4KAZA 3DAWA 4R79A 1BA0A 1Q7YO 4DMNA 4C8KA 3L2WA 3BEXA 4CI6A 3VQ5A 3K5MA 5EU7A 4DSEA 4B3OA 4ZHRA 4CCHA 3CD6N 4CGJA 3CC4N 4B9NA 3DM2A 3HPHA 4CIFA 1LW0A 3FZHA 4BRPA 3ZETA 1VRTA 4BRHA 2CGKA 4BC4A 1RT6A 1XMOK 4BDYA 1FXXA 5FLXO 4YOYA 2QWNA 3D2FA 3ZSOA 4GKJK 3PO5A 5HRPA 1DTQA 4HUEA 2Z1GA 1FK9A 3KK7A 3QDKA 4FZYA 4PWDA 4JI7K 2ITMA 5SWMA 2RKIA 1NWKA 3A5OC 1EWQA 5IWAK 4JI2K 4YOVA 4CHOA 3LDLA 2V51B 1LWCA 3NH1A 3THWA 4BRCA 1QQNA 4MDBA 2NUBA 4CJSA 4M3XA 2KZMA 3NGYA 1JLFA 4HCBA 2JWKA 1WOQA 2X6SA 1U49A 1B9DA 3NFAA 3QEVA 3BDPA 1MA9B 3ZT0A 4MO4A 5C42A 1V4TA 1GLEG 4BACA 2HNZA 4DKWA 1Y64A 3ZSYA 4DTSA 3WNGA 4KHYA 3DLEA 2ZD1A 4DV0K 3D45A 4BROA 3C7NB 4DR6K 2JLEA 3V9UA 1VK0A 2EHGA 4DF8A 1ZBSA 1KVCA 1UOCA 2WFBA 4MO5A 1SV5A 5TKWA 4HCCA 3P31A 2FSNA 4BWMA 1WNSA 1VSFA 2E8AA 4KTQA 2E2NA 1HJOA 5EY4A 3MWTA 4Z4CA 3TARA 3O1BA 4FLXA 3G0ZA 4OPHA 3VQQA 4RW6A 4DSJA 1D4XA 3MN7A 3OBYA 1LV5A 2D0CA 1CZAN 3AVKA 5JS1A 4JD2B 1BOTO 2QWQA 4AHTA 3CM5A 4KKOA 2WTUA 3LP1A 4WQ4C 1Q9YA 4K43A 4PKHA 4NXMK 1JLBA 3OYIA 5GAEP 3SNNA 4UY8O 4OPJA 4E1MA 4FOIA 1A5VA 3OYLA 3LZJA 3H6EA 4A2BA 4DF4A 1K9MO 5GIOA 3GG4A 2QKKA 4OKJA 4J2DA 3SPYA 3O4NA 1O1WA 3THWB 5BPNA 3C6AA 3OYCA 1C0UA 1ZBUA 4GVMA 4E1JA 3FGUA 2E2QA 2QXLA 4CZFA 3FFIA 4RW4A 4FJXA 3T7ZA 1WSHA 4DU3A 3CC7N 1NBWA 4MLHA 3ZSXA 2VG6A 2UYTA 1QE1A 4J8FA 2V52B 3WNFA 1NGFA 1SL0A 5JLFA 3DWLA 3KHYA 2YNGA 4JKFA 3LDQA 2IVNA 3ENBA 1VRUA 1KLNA 5ADXA 1VQMN 4B1WB 4CZKA 2P9PA 3WEEA 4BDPA 4DV7K 3AAQA 4CF8A 4BE0A 3KD1E 4NLBA 3VF4A 1YIJN 1HJRA 1YTAA 3S3NA 4CHYA 3FZKA 2W6KA 4CZMA 1VQ6N 4IWVA 4CHPA 3VERA 4NCGA 1JXEA 2YNIA 2D0OA 4AM7A 4N41A 1S5JA 1TK8A 3C6TA 1SZ2A 4JLHA 2O8EA 3UKUA 4B1YB 5LJVA 4C1NI 3EZWA 1SL2A 3HSTB 1FKPA 1RDWX 2OPRA 3QBXA 1HKBA 1QQOA 1L3TA 5CY4A 4DSLA 5CE3A 3I8BA 3RMCA 3UB5A 1IKYA 3C95A 4I6MB 3KKSA 3NE6A 3PSFA 1E3MA 4KH6A 3SV3A 2F9TA 1RFQA 4JKBA 2ZM6K 1X9MA 3E9OA 5AQWA 3NGZA 3K5LA 2NRHA 4ISGA 1TYQA 1DKGD 4FJ9A 4CZHA 2UXDK 1YUWA 3HRGA 1YJ9N 4W5NA 2AA4A 3HP6A 4LF9K 2HNDA 4B9UA 2WONA 2P9UA 3TI0A 4O55A 5CYMA 5C24A 3KLHA 3SUPA 3QIOA 2HHTA 3ENHA 3SBGA 3LAMA 4IKFA 5M1OA 3K58A 3O4WA 4CECA 1YI2N 1KTQA 3M5RA 1J54A 2VQEK 3TAFA 3CIPA 3JSMA 4JRQA 1DTTA 4FJ7A 1ZXOA 1QHAA 3IFRA 3OBWA 4O0IA 3V9WA 3RR8A 4WYBA 2GELA 4LF8K 2RE2A 2E6MA 3IDHA 4M3ZA 2E88A 4XH4A 3FLCO 3THXA 2QI2A 1U2VA 4YDUC 4CBWA 1VQ5N 4L3QA 1E4GT 2D5RA 3TAQA 4JK8A 3T1AA 4CZIA 3LAKA 4ICLA 1OH7A 4DB3A 1K8AO 1TKTA 2OPSA 3QESA 3L0QA 3CCRN 4IXCA 2CH5A 2H3GX 2NRRA 1HUXA 2IGIA 2O8EB 3Q7CA 3UKUB 3NMUA 3ITHA 4ILGB 5CZ1A 5AQFA 3L2QA 3O8MA 1R0AA 3MECA 4NCAA 1C6VA 1B9FA 3VETA 3VEOA 3HK2A 1BHLA 4PY5A 2P9IB 3AA5X 4PL8A 3B6PA 3G71N 4DS5A 4FM2A 3V9SA 1D9FA 5A2QO 5AZIA 1Z25A 2NRWA 1TYQB 2PAVA 2JGUA 5AQIA 3O4QA 4Z4EA 5AQJA 2NRTA 3FR0A 1Y97A 2NRXA 2KFZA 2FBTA 4CESA 1A5WA 3VEZA 1OH5A 4L8RB 1HNVA 4IFVA 4E7JA 3R6MA 4FVUA 4GW6A 5CHIA 5AFUH 4FJ8A 4BE2A 2E4LA 4BG8A 1V4SA 1RTIA 2YJEA 1ZYQA 4FOEA 5AZJA 4BVOA 2WOMA 4FWOA 4F3TA 4CJ7A 1OKJA 3LDOA 4BR5A 3HXMA 2FBVA 3OS0A 1ILYA 4KI4A 2UU9K 3CM6A 4K0KK 2PFUA 2QK9A 1QQMA 4M7YA 4DTXA 4FZXC 1HMVA 1K8KA 2NZTA 2WUSA 4CEAA 4JAXA 1XI1A 1I94K 1GLCG 1NNEA 4Y1DA 2HB5A 5LMNK 3SLCA 4RW9A 1T05A 3CFOA 1BA1A 1D9DA 1RBUA 4HUFA 1VQNN 5C10A 1VSIA 4FJLA 3MXJA 1T3VA 4B9VA 3K9JA 1RT2A 4O44A 3DRSA 3RMBA 3AGKA 4KTZA 5JVHL 2IVOA 3LWLA 1JXBA 5AQNA 4KI6A 4M3UA 2WC9A 3U3GA 3AO5A 3P83D 4CJRA 3A2FA 1WBBA 2HHQA 4FWQA 3FZFA 3CYMA 1RDUA 5JVGL 3S41A 3THVA 1EXQA 4FLVA 4NB4A 1JLGA 1G15A 1IG8A 3PIPL 4BRAA 1VQ9N 1VAZA 4DSIA 1BWFO 4JKEA 1DLOA 3EE8A 4H5TA 3GBTA 3CCEN 4WFAL 3CETA 2ASPA 4M3TA 4CIGA 3G4SN 3KK2A 4DV5K 4IO9L 2E6LA 3E01A 2IDOA 2HBLA 2PZSA 5FPEA 5DM6L 2X74A 3RVCA 1NG9A 3VTHA 4A61A 4FK2A 4CGIA 4H03B 3PSIA 2W41A 3AO3A 4RCHA 4ZTFA 4ISFA 4CBUA 4Z4FA 3ZSZA 5J2NA 4M7XA 3CCUN 4QS7A 1VHXA 2EWSA 1IKWA 1W0HA 3VF2A 2XY5A 4JNEA 3SZ2A 3ASMA 3IS9A 3ZSVA 3FE1A 4JS4A 3HJFA 4CJKA 4FWKA 1NGHA 1K8KB 4CBXA 3RMAA 1NM1A 1YJNN 2RPIA 4CEQA 1Z6RA 4B9TA 2W42A 3RMDA 4CF0A 4U7BA 4C8MA 1BCMA 3O9QA 1C0MA 3K2PA 4DG1A 5M1FA 3VQ7A 1RDAA 1D8YA 1QZ5A 2OA8A 3DRRA 4GV9A 1J6ZA 1LOTB 2UXCK 4IBNA 1FJGK 1IKVA 4Z4IA 1MWKA 2KHOA 4DQIA 2DTUA 4WCEL 4X64K 3R9PA 3LDPA 1U48A 1N36K 2YV0X 3O3FA 4CIEA 5BN9A 4BC2A 3ZYYX 5J1EA 3TAGA 3IUCA 3O6WA 3J7YP 3ULDA 1C0TA 1WSGA 2F8SA 4K8ZA 1O13A 3TTCA 2HSTA 3U4LA 1Z26A 3PUFA 3D2EB 5AFUA 3J7ZO 4K8XA 1OH6A 3JYTA 3TTFA 4B3MK 3T69A 3TTDA 3ZT1A 1VQ7N 4KPYA 4YOWA 3NH0A 3UIQA 4MFBA 4M42A 4FWSA 1L3VA 5ADXH 2P9SB 3AO4A 4BRNA 1KFDA 2O8FA 5LL6Z 5BRHA 2GX9A 3MEEA 3M8RA 2HF4A 2VG7A 3CPEA 3L6QA 4I2PA 3J8AA 3SK3A 1Q82O 1RILA 3E66A 2BANA 3THYB 2ZWHA 1VSJA 3CJBA 4FJMA 5AQRA 3JAMO 1W7AA 5KI6A 3P1GA 3AVBA 4E7HA 5M1NA 3OYFA 1QVFM 1HQEA 4FLTA 4FJHA 4LH4A 5EOYA 2O8DB 3QERA 3MEGA 3RSEA 4CF2A 4H0PA 3L3UA 3TU5A 3CERA 3AY9A 1KAXA 3DJCA 4DV3K 3ALYA 3ZX3A 5BRFA 1NU0A 4YHHK 2ZJPL 1SKRA 4DR1K 1UA0A 1KAZA 1S1VA 3AO2A 1KFSA 1ATSA 4IJAA 4OGEA 2E5LK 4IFYA 4JHDA 2HOEA 4EIAA 2GUIA 3MN6A 5TKYA 4C8OA 4FJJA 1ASUA 3D6RA 3OA9A 2BGGA 4DTMA 4JI8K 4BE1A 3TPQA 2G8IA 2YI1A 4X62K 1IV0A 3VEXA 4XEIA 1SS6A 5J2QA 1HYVA 3O1WA 2ZF5O 2ETJA 1HNXK 4CJQA 1QSLA 1KCFA 3G10A 1TKDA 2FSKA 1NKEA 3CMEN 4JI0K 4M45A 2VWKA 4CJ5A 4UQGA 5K14A 4N47A 1KVBA 3A5NC 4ILJA 3CCJN 3CQYA 2HF3A 2VGMA 3K57A 4BVPA 2O8FB 1J53A 2I5JA 3OYNA 1JLAA 3CJ1A 3CJ7A 3R8EA 4CGDA 2ZGZA 4OKKA 3WT0A 1RBTA 1WSJA 3W3DA 3SAFA 3SUQA 3SMPA 3VESA 4DR4K 4CZGA 4EZ9A 5MLCQ 1HYSA 2Q36A 4CEZA 5IT9O 3EL2A 3SUNA 3U9ZA 3HBTA 3RSEB 1TVRA 3LP0A 1T03A 4CHQA 1N8RO 3OHRA 1TKXA 2HBJA 4JKGA 5HRSA 3DLHA 4BRDA 3FZMA 1W2BM 1S1UA 2YJFA 1S1XA 3B6OA 1JL2A 1YVUA 3ZX0A 2ASOA 1WBDA 3OVNA 4ID1A 3ZETB 3F9MA 4H5RA 4OX9K 4GVEA 4BC3A 3D2FB 1EQYA 3KLIA 3LWMA 4B1XB 4LF5K 2E1ZA 2G8KA 4LH5A 4R5PA 2QXFA 5HROA 4H0TB 5AQGA 3VQBA 3QO9A 3QLHA 4KH5A 3QEXA 5JMVA 2VYPA 1C1CA 4LSLA 3QETA 3HPOA 4DV4K 3M3ZA 5AQOA 1S9GA 3L2VA 1P90A 1WN7A 2NNWA 3QIPA 2G8VA 3MX5A 4YOUA 1S72N 4IOAL 5C0YA 2D0AA 4CF9A 4HWIA 2A40A 4OPAA 4FW2A 3EZ5A 2ITGA 4CZLA 3G25A 5AQMA 3WQTA 1N6QA 1QS4A 1GLFO 3ZT2A 3QINA 3EO3A 4EFHA 2HHXA 1Z05A 1ZC6A 2F96A 4H0OA 3NHGA 3SCXA 4BWJA 4FLUA 4G1QA 2UXBK 1VSDA 4KB0A 3HP9A 1XHZA 1NMNA 3ISNC 5M1KA 4K25A 4X65K 1NGIA 4IO8A 3WNEA 3I0SA 5C2FA 3PY8A 4B8CA 1WSEA 3ATVA 4CD3A 3EKUA 1NGCA 4JKDA 1KAYA 4DUZK 3GE1A 3MWPA 1IH7A 2XY6A 1S3XA 3CMAN 4JRPA 1M1KO 2O8BA 2QW9A 3CXCM 4LFBK 3ZT3A 2HW3A 4ZTJA 4WFNL 5M1PA 5KPRA 3SJJA 1X9JA 5DK5A 1TV6A 3T1YK 2CGLA 5AQTA 4CJLA 1XMQK 5HRNA 2FF6A 2PYJA 1OVYA 3WXIA 3CF5L 2E2OA 3HZ6A 3KWIA 5AQUA 4CD1A 4J2AA 3HM9A 1JJ2M 5FRNA 3QMLA 4WQ5C 4CGFA 3VMFB 4H4MA 3T19A 5GIPA 4WQ5A 4CZEA 5FPDA 3KK1A 4HHTA 2A3ZA 4FXDA 3RWUA 4DTJA 3SYZA 3VGLA 4DTOA 2GV9A 3BGRA 4CZJA 1WLJA 2W40A 1ATNA 4DTUA 4K41A 1CLQA 4FLWA 2FSJA 1Q8IA 3I56N 2KLAA 3H46O 4DFKA 1RTDA 1GOAA 3VQDA 4NCBA 1T7PA 4F8RA 4BRKA 1IO2A 1N33K 2UUCK 1LCUA 1HNIA 4CK1A 2DFEA 3RTVA 4RW7A 3K5NA 4BR9A 1X9WA 2P9PB 4C8NA 3WEEB 1LAWA 2NRZA 2Z1HA 4FWNA 3LALA 5CZ2A 3VQ9A 4BRFA 3KLGA 1NJXA 1ASVA 4BGBA 1TGOA 3LPTA 4B9QA 5B8HA 1CXQA 4LF6K 2FF3B 3VQ4A 1R59O 4OPKA 3O5BA 3F5TA 4OVLA 3DOKA 1QTMA 3AVNA 2QA4N 3T3FA 3C6UA 4FJIA 4BQLA 2QM1A 4JS5A 4CEBA 3KKRA 1SKSA 1SUQA 1L3UA 3B8AX 4O5BA 3CG7A 1BDGA 3O9UA 4EP5A 1TL3A 1J5OA 2QWRA 3HM8A 1U47A 3VEWA 2HBKA 3FFKB 1IKXA 5BREA 3O3HA 4A59A 3HYFA 3OYDA 4DFJA 1RT1A 2FBYA 4M3RA 2XRIA 3LZIA 1UAXA 1U04A 3AVIA 1I39A 3H1VX 3KIOA 4ID5A 4FW1A 3ZSWA 3NDKA 1IBMK 4GV6A 3TANA 4DR7K 3WQUA 4WFBL 3SPZA 3ZEUA 3LDSA 5M1QA 2P9UB 1FKOA 1GOBA 3AVGA 5JICA 2OPQA 1S22A 4H5WA 3KTQA 3VPZA 4DTNA 3HI0A 5C12A 4M3YA 4YNQA 4BR2A 4CJUA 1T44A 1S6PA 3QFPA 4OGCA 4MQ3A 3VQ8A 3HO1A 5F2RA 5BRDA 2G8FA 1NK5A 3ZT4A 1BIUA 3F73A 1D5AA 4BREA 3QEWA 5DM7L 3OYMA 4HVJA 4A5BA 1U4BA 1BQNA 3NVMA 3SAGA 4BRIA 1E4FT 4QOZB 1Q18A 1BQMA 1KVAA 3F2KA 3HL8A 1XNRK 4FWMA 3NVKA 5D3GA 1YHQN 3THXB 1U2VB 1RT7A 2F9WA 4NYFA 4DFMA 1NKBA 3Q7BA 2YKMA 3VQAA 3P5JA 4LFCK 2E1YA 2HHUA 3CFRA 3QNNA 1JCFA 1BUPA 3CJ9A 3RRHA 4CJPA 1SL1A 3DLRA 2AP1A 3V1QA 2P9KA 1VSHA 4EZ6A 4QS8A 3AVLA 4CJ4A 4DV1K 2IS3A 4RW8A 5F0XA 4CFAA 1HLUA 3AVCA 4GY2B 3HOTA 1GLAG 2XHBA 4AQYK 5LY3A 4NLCA 5BR9A 3VEYA 5AQKA 2LSNA 4FSVA 4F3OA 4DV2K 1UWBA 3AA4A 2PBDA 3C0BA 1EX4A 1HRHA 1NMDA 3BZKA 4Y0WA 3JS6A 4JV5K 5J2MA 3CJAA 5AZIB 3R3LA 1NGEA 2RN2A 3AAPA 3ATUA 5I42A 3CCSN 3H1QA 4AH9A 3VA0A 1WAFA 4KHPK 4FWLA 1JKHA 4AM6A 4FM0A 2G8UA 5AQXA 3C94A 2A1SA 3PX4A 1NK4A 3H3OB 4LF4K 4J2EA 4ILHA 1HR0K 1XUPO 4TSXA 3OS1A 3DRPA 2VGNA 4PKIA 1ATRA 5GINA 4HUGA 5AZJB 4CJVA 4I9LA 3O08A 3OS2A 3TAEA 5DMRA 3QFUA 3K0SA 1GOCA 5AQZA 1VQ4N 5SZTA 3OYAA 2J4RA 5AR0A 5HL7L 3DOLA 2X78A 4CK3A 3AA3A 4CHZA 5HP1A 3U6FA 4BR7A 4JI3K 4FJGA 5KTQA 3HVRA 3SI6A 1VQ8N 2FBXA 1CZ9A 4DR5K 4MDAA 4CEFA 4NYNA 3VEVA 3ZX2A 5FRMA 4E7KA 4U67L 3DXKA 1WB9A 5ELZA 3VGKA 3DMJA 1RCHA 3VA3A 4JKCA 1M90O 1DGKN 5CYQA 3ULEA 4KBOA 4I9QA 4GKKK 4E89A 1BCOA 3KWGA 2GUPA 3L4IA 4EHUA 3OY9A 5J2PA 4ISEA 1VQLN 3L2UA 1EETA 3O9SA 3JXUA 2KKZA 2HVHA 4JK7A 4CFDA 1RT4A 3M8QA 1BI4A 4BR4A 1T6DA 5AJ3K 1NGDA 4CVNE 3AO1A 1BU6O 3CHWA 2CH6A 4EHTA 4W5QA 3LP2A 4B08A 4KB1A 1HYZA 3MCAB 4DS4A 4LFAK 3AVJA 2G8HA 1VQON 4CJWA 4XIUA 1QVGM 4W5TA 1RTJA 2P9LA 2BUPA 2KFNA 3CI5A 4KHNA 5EVZA 2YHYA 2O4GA 2G8WA 1P8ZA 2HMPA 4C1NK 4Y1CA 1QSYA 3PO4A 4DSKA 4IDHA 2OANA 3KD5E 2X6NA 2I7PA 2YCHA 1FW6A 3DLLL 5EX5A 3EEQA 3SV4A 5LMUK 2IIRA 4JKAA 4OO1J 3NH2A 1RNHA 4DTPA 5AQSA 5KRTA 1C0GA 4JEPA 4DTRA 4W5OA 2V7YA 1LWFA 2KZZA 2DY4A 5FROA 1XWLA 4DQSA 2XO7A 4OLAA 3LM2A 2JWLA 5AQLA 1RDDA 3GDQA 3TAPA 3OYGA 3QEIA 1NGGA 1X3MA 3DXKB 1RT5A 4I7FA 4AHVA 3DLBA 1YT3A 4DCHA 1YF5L 1BIZA 3QICA 3H08A 4PL7A 3OJUA 1CXUA 4KV8A 3I55N 4IOCL 3C7NA 3D7EO 5KGXA 4FCYA 4KREA 3J7AP 4AF1A 1YXQA 2OPPA 2P51A 4E1NA 1XNQK 2BH1A 4WE1A 1J5EK 4Q0BA 3OYBA 4FPBA 3KK3A 4DQ8A 1JL1A 1OH8A 3EN9A 1TUYA 3L4QA 3WXKA 3WNHA 4EAHD 3DXMA 2P5OA 4BY9C 2Q2RA 1WSIA 2V7ZA 3N4PA 4CHNA 1X3NA 4J2BA 2A42A 2HHHK 4FZZA 4DHYA 2I7NA 4JD2A 4KTWA 4H0XB 1SAZA 2QWPA 4CJFA 4E0DA 1KXPA 3MCPA 1ESVA 4FWRA 2D0BA 4AILC 4JI1K 3L8BA 3D0PA 1MWMA 4JYAK 2P9LB 4HTLA 4B1VA 4PHTX 5AQYA 3GOIA 3EYZA 5T7BA 3VOVA 3AVAA 5KQ8A 4AHCA 3E9LA 3OYHA 1HNZK 4DR3K 4CF1A 1U45A 4H5NA 1QHTA 2B6AA 3QB0A 2P5GA 1RBRA 1U6ZA 4MLEA 1WUAA 2F7TA 4RTFD 4XH1A 3A0IX 2XY7A 1XQSC 4F4KA 2Q1NA 4E3SA 1ZBIA 1RT3A 2QTDA 4DU1A 3AV9A 3UKRA 4DFPA 4RG8A 1QZ6A 4XH5A 3A5MC 1WAJA 1YJWN 1VSEA 4F9OA 2D4WA 5KGWA 3SQ4A 3V1RA 1KQSM 3ZLJA 2NRVA 3LP3A 1UA1A 1NLVA 3NAEA 2HVIA 5HOOA 2QWLA 1NGAA 3E1YA 3G6EN 1JLEA 3NF7A 4FK4A 5C15A 4H4OA 1GLBG 1L3SA 3N4QA 2A1RA 1RBSA 3CCVN 4BRGA 4DSFA 3VQPA 4CERA 2EX3A 5JLHA 1A5XA 1TAQA 3DXMB 1EP4A 3WXJA 1C0FA 4JHDB 4CJTA 4H8KA 3AARA 1YAGA 2IVPA 1RTHA 4N56A 3IKMA 3MK6A 4NO7A 4LY7A 3V4IA 2D1KA 1NK7A 4I6MA 1NK0A 3M6GA 1X9SA 5GAGP 3V81A 2PYLA 1W97L 4BGAA 5BPMA 1RDBA 4DWIA 4WQ4A 1EKEA 3F9KA 3FZLA 3WXLA 4CFCA 3ID8A 1NGBA 3PIOL 2XY8A 4KFBA 3MN9A 5KQDA 1JLCA 3MX2A 3CQXA 2VQFK 2HHVA 1ASWA 3IG1A 3O9TA 3ZSQA 5E41A 3UKRB 2YNHA 4C23A 3ZSRA 3U8XA 5H1SQ 2UUAK 1EWRA 3VQ6A 1Q9XA 3OYEA 4IDKA 3P38A 1T6CA 3S3MA 2A41A 4RWTA 4DU4A 1BGXT 2O8CA 4A5AA 3PX0A 1JLQA 4AHRA 5LJWA 1RGIA 4AHSA 1I3AA 1IBLK 4KH4A 3TABA 4YY3K 4JKGB 1G99A 1ZBFA 3GL1A 4KO0A 1BO5O 4LC9B 5E26A 3SUOA 4PQUA 1BL3A 3OW2M 3OJSA 4FPAA 2HNYA 5CR4A 2B4JA 4DQRA 5FDLA 2QWOA 3WXMB 3EE9A 5C25A 3SJHA 1NJYA 3EY1A 3IAYA 4B9MA 2YHWA 3QNOA 3CJCA 3MXIA 1GLLO 3NCIA 1LAVA 2YHAA 4H0YB 2HHWA 4FL9A 2P9IA 1NK8A 3M8SA 3HPGA 2VCPA 5HRRA 3SQ2A 2FLOA 4BQZA 4OJRA 4BR0A 3KLEA 2GTDA 2Q3SA 4IG0A 4GNIA 4EP4A 2QEXN 3QEPA 3TSUA 4JI4K 4B9SA 1HNWK 3HT3A 1NJWA 4IOXA 3J81O 2Q0UA 4CFBA 4ELVA 2IC3A 4F2SA 4GV3A 4OLBA 3AA2A 4H0VB 1NOYA 2Q97A 3O3GA 1KD1O 1TK0A 4Z4HA 1YITN 3CC2N 2YNFA 5BN8A 3I33A 4IEEA 1IG9A 2VWJA 1K73O 3A8YA 2HHSA 3CCQN 3OTOK 2WBNA 4E7IA 4YOXA 2PY5A 3V9ZA 4B1ZA 4CEEA 3TSQA 2O8CB 5HBMA 2DFHA 4A2AA 1NJZA 1KC8O 3LM9A 1C1BA 4CJEA 4LSNA 1N34K 3K9KA 2ASMA 2Q0RA 2P1JA 3QBWA 2O8BB 1KRPA 3MXMA 4FVMA 4KHWA 4N76A 4JKHA 4CW7B 1GLJO 3UE5A 4YDUA 3SMSA 3VGMA 1ZBHA 1VSKA 3PV8A 4A62A 1ZBLA 3H45C 2ZE2A 1Q86O 1DEJA 3NF6A 4JI5K 4IJNA 1NK9A 1EO1A 1MU2A 2P9NA 3KLFA 2ATQA 2ZGYA 4B8AB 1VSLA 2Z1JA 4O8UA 4FJKA 3MN5A 3O9RA 4FK0A 2YKNA 1GLDG 3KVGA 3VQCA 5C2DA 1MDUB 5I9EB 3VF6A 1VQPN 3E9PA 5FPMA 4Q5VA 5AQHA 5BR8K 3LDNA 3J80O 3IMXA 1IBKK 1H1VA 3MMVA 1XHXA 3BF3A 4BRMA 2GBZA 3OYJA 3NGIA 1QSSA 4JN4A 1HQUA 4QAGA 3CPWM 4Z0UA 3T1HK 2FC0A 2Z1IA 3HTVA 1L5UA 3BZCA 5KPZA 2RHKA 2DPNA 2AJQA 3M1FA 4X66K 2HBMA 4O0JA 3V6DA 1DT9A 1REVA 5E84A 3NF8A 4E19A 4DLEA 4CEDA 3TWHA 2IAJA 3IRXA 3MEDA 1SKWA 2ZQBA 1VQKN 1KLMA 3C6HA 4E7LA 5KPTA 2GEMA 4LD0A 2O4IA 1SQKA 4JK9A 2NLXA 4DLGA 3ID6A 1NOZA 2HMIA 5BPLA 1NKCA 3BY5A 3VQEA 4YOTA 5AQPA 3TAMA 3VTIA 4BDZA 1TL1A 2OZMA 4BG9A 4M63C 2F8TA 4QCLA 4B9LA 2Q31A 1ITGA 1WSFA 2OTLN 2P9NB 4H5VA 4FLZA 2YHBA 4DUYK 3MAQA 3I8DA 4B3RK 4KRFA 4NXNK 4W5RA 2OCEA 4FJNA 2A6AA 4M3WA 1XC9A 3TR8A 4BRLA 4G9ZA 1TK5A 1W9HA 3ZEUB 3KZBA 1TAUA 1KSPA 2R7YA 3V1OA 1NGJA 2B5JA 1X1PA 4CE9A 3S9HA 4A57A 2YHXA 4FJ5A 1JCGA 4FLYA 3AGRA 4M41A 3W0LA 2ZJRL 4IEIA 3K5OA 1TKZA 2DFFA 1HX1A 2Y1IA 5I3UA 1HPZA 4QS9A 1LWEA 1N5YA 3LANA 2GWJA 2VWBA 4Z4GA 4BRQA 4N5SA 3NBPA 3LPUA 1VSMA 1C1AA 4IZ9A 3DYAA 4O4GA 4ELUA 3CQ8A 4Z94A 3D2EA 1QQCA 1YTUA 4BC5A 2F4VK 3L2RA 4KHSA 2KTQA 3CCLN 5AQQA 3RR7A 2A5XA 4PKGA 3P4IA 1B92A 4HTUA 4DV6K 2KQ2A 4JI6K 3KJVA 4DQPA 1JCEA 1CZBA 2E20A 2GWKA 2P9SA 2ZJQL 3TSPA 1J9AA 3LL3A 5JS2A 1K6YA 3PLAA 3I0RA 4CGHA 3HOSA 2P9KB 2BDPA 4YFUA 1S1WA 4KHQA 3THYA 5EXWA 4DQQA 1HKCA 1HPMA 3AVFA 2BE2A 4ELTA 4O8KA 1Q81O 3K59A 3ENOA 3SQ0A 2KW4A 2O8DA 3VENA 3R1XA 5GADP 5KRSA 3SQ1A 5GAHP 1YVNA 4B3TK 4CGGA 1NK6A 3PX6A 3S3OA 3H3NO 3RRGA 4F2RA 4O5FA 4PA1A 4PUOA 3L3VA 2OYQA 4IG3A 3ZCMA 2CGJA 4FWPA 2OZSA 4K42A 3MDQA 1HKGA 4V19S 3BP8A 3CFPA 1N32K 1S6QA 1XC3A 4FO0A 3U9DA 4LF7K 3DI6A 5AQVA 3BF1A 1S1TA 2D0PA 4AHUA 4OKEA 3AVMA 4FM1A 2E2PA 2FXUA 3M8PA 1NJIO 3AVHA 4CK2A 4WF9L 1RBVA 3NF9A 4B1UB 1BISA 2RF2A 1F21A 3SBTA 2YX6A 2QKBA 2QWMA 4B3SK 2W6LA 2UUBK 1IJJA 1RDCA 1LW2A 3HSCA 3C65A 3EKSA 3U3YA 4C8LA 3P39A 4CJ3A 5FPNA 3ULEB
chains in the Genus database with same CATH topology
3THVA 1EXQA 4CEOA 4OPKA 4FLVA 5HLFA 1JLGA 4GMJB 3HVTA 1G15A 1RDBA 3DLGA 4OVLA 3OYKA 2IOCA 1S9EA 3DOKA 4DSIA 1QTMA 3AVNA 4DWIA 1DLOA 4KHUA 3T3FA 2Y1JA 1T8EA 3C6UA 4FJIA 1EKEA 3F9KA 4M3TA 4CIGA 4JS5A 3VN5A 4CEBA 3KK2A 2VG5A 3KKRA 4I2QA 4CFCA 1SKSA 1SUQA 2E6LA 3E01A 2IDOA 4O5BA 3V9XA 3CG7A 1L3UA 2PZSA 4EP5A 2XY8A 1TL3A 1J5OA 1BI4B 4KFBA 1U47A 3DLKA 4KAZA 1JLCA 2X74A 1IKXA 4DMNA 4C8KA 3O3HA 2HHVA 3L2WA 1ASWA 3IG1A 3VQ5A 3HYFA 3ZSQA 3OYDA 3K5MA 4CGIA 1RT1A 5EU7A 4DSEA 4DFJA 4FK2A 4B3OA 4ZHRA 5E41A 2YNHA 4CGJA 4CCHA 4B9NA 3AO3A 3ZSRA 3DM2A 3HPHA 4CIFA 4ZTFA 1LW0A 2FBYA 4Z4FA 3VQ6A 3ZSZA 5J2NA 1Q9XA 4M3RA 2XRIA 3LZIA 3OYEA 1UAXA 1U04A 1VRTA 3AVIA 1I39A 4IDKA 1IKWA 1W0HA 3KIOA 4ID5A 1RT6A 4FW1A 4BDYA 1FXXA 3ZSWA 3SZ2A 2XY5A 3NDKA 3S3MA 4DU4A 3ZSOA 3ASMA 3IS9A 3PO5A 3TANA 3ZSVA 4JS4A 3HJFA 4CJKA 5HRPA 1DTQA 4HUEA 1BGXT 3RMAA 3SPZA 2Z1GA 1FK9A 2RPIA 1JLQA 3LDSA 3PX0A 4CEQA 4AHRA 4FZYA 4B9TA 2W42A 4PWDA 3RMDA 1FKOA 4CF0A 1GOBA 5SWMA 4AHSA 1I3AA 2RKIA 2OPQA 3AVGA 3TABA 4C8MA 1BCMA 4CHOA 3KTQA 4DTNA 4M3YA 1LWCA 3NH1A 4YNQA 1C0MA 3K2PA 4CJUA 1ZBFA 4DG1A 4KO0A 4CJSA 2NUBA 4M3XA 1S6PA 2KZMA 3VQ7A 3NGYA 3SUOA 1JLFA 1RDAA 4OGCA 4PQUA 4MQ3A 1BL3A 1D8YA 4HCBA 2OA8A 3VQ8A 3OJSA 3HO1A 1U49A 2X6SA 3DRRA 2HNYA 2G8FA 1NK5A 3ZT4A 1BIUA 3F73A 1D5AA 2B4JA 4DQRA 3QEWA 1B9DA 5FDLA 3OYMA 4HVJA 3NFAA 4IBNA 1U4BA 3QEVA 3BDPA 1BQNA 1IKVA 3ZT0A 5C25A 1NJYA 4Z4IA 4QOZB 5C42A 3EY1A 3IAYA 1BQMA 1KVAA 4BACA 4DQIA 2DTUA 2HNZA 3HL8A 4B9MA 5D3GA 3ZSYA 3QNOA 4DTSA 1RT7A 3WNGA 3MXIA 1U48A 3NCIA 4KHYA 3DLEA 4NYFA 4DFMA 2YV0X 1LAVA 1NKBA 2YKMA 2ZD1A 3O3FA 3VQAA 3P5JA 4CIEA 3D45A 2YHAA 2HHWA 2HHUA 2JLEA 3M8SA 3TAGA 5J1EA 3HPGA 1NK8A 3CFRA 3V9UA 1VK0A 5HRRA 3SQ2A 2EHGA 4DF8A 3QNNA 1KVCA 1UOCA 1XC9A 4OJRA 3KLEA 3ULDA 1SV5A 1C0TA 4HCCA 2Q3SA 3RRHA 1WSGA 4BWMA 4IG0A 1WNSA 2F8SA 4K8ZA 4CJPA 1VSFA 4EP4A 3DLRA 1SL1A 3V1QA 4KTQA 3QEPA 4B9SA 4Z4CA 1VSHA 3HT3A 3TARA 4FLXA 3AVLA 4CJ4A 3G0ZA 1NJWA 4EZ6A 1Z26A 3VQQA 4RW6A 4CFBA 2IS3A 4ELVA 2IC3A 3PUFA 4RW8A 4CFAA 4DSJA 4F2SA 4K8XA 4OLBA 1LV5A 3AA2A 3AVCA 2D0CA 3JYTA 1NOYA 3O3GA 3ZT1A 3AVKA 2XHBA 5JS1A 1TK0A 4Z4HA 4KPYA 2LSNA 4F3OA 3NH0A 1UWBA 3AA4A 4MFBA 3UIQA 1EX4A 1HRHA 4AHTA 4M42A 1L3VA 2YNFA 5J2MA 1IG9A 3AO4A 1KFDA 3CM5A 4KKOA 2RN2A 2VWJA 2HHSA 3LP1A 1Q9YA 3MEEA 3M8RA 1JLBA 4E7IA 2VG7A 4I2PA 3OYIA 5I42A 3SNNA 2PY5A 4OPJA 1RILA 4AH9A 4E1MA 3VA0A 2BANA 1A5VA 1WAFA 3OYLA 3LZJA 3V9ZA 4CEEA 1JKHA 5HBMA 2DFHA 4FM0A 1NJZA 2G8UA 4DF4A 1VSJA 4FJMA 3C94A 2QKKA 1C1BA 4OKJA 2A1SA 4LSNA 4CJEA 3PX4A 5KI6A 3SPYA 3P1GA 3AVBA 3O4NA 1NK4A 4E7HA 3OYFA 1HQEA 4FLTA 2P1JA 1O1WA 1KRPA 4FJHA 4J2EA 4LH4A 3MXMA 4FVMA 4KHWA 4TSXA 3OS1A 3QERA 4N76A 3DRPA 3MEGA 3OYCA 4CF2A 1C0UA 4HUGA 3L3UA 1ZBUA 4CJVA 4GVMA 1ZBHA 4I9LA 3OS2A 3TAEA 1VSKA 5DMRA 3PV8A 3FFIA 1ZBLA 1GOCA 4RW4A 4FJXA 5SZTA 3OYAA 1WSHA 3ALYA 4DU3A 3DOLA 2X78A 2ZE2A 3ZSXA 2VG6A 4CK3A 1UA0A 1SKRA 3AA3A 1QE1A 3WNFA 4CHZA 3NF6A 5HP1A 1SL0A 3U6FA 1NK9A 4FJGA 1MU2A 1S1VA 5KTQA 3KLFA 3HVRA 3SI6A 3AO2A 1KFSA 2ATQA 2FBXA 1CZ9A 2YNGA 4CEFA 4OGEA 4NYNA 4IFYA 4B8AB 5FRMA 1VSLA 2Z1JA 4FJKA 4E7KA 1VRUA 1KLNA 2GUIA 4FK0A 2YKNA 4C8OA 4FJJA 1ASUA 3VQCA 2BGGA 4DTMA 4BE1A 4BDPA 3DMJA 4CF8A 4BE0A 1RCHA 3KD1E 2G8IA 3VA3A 5CYQA 4Q5VA 1HJRA 1YTAA 4I9QA 3S3NA 4CHYA 1XHXA 4E89A 5J2QA 2GBZA 1HYVA 1BCOA 4CHPA 3OYJA 3NGIA 2ETJA 4NCGA 1JXEA 2YNIA 4CJQA 1QSSA 1QSLA 1KCFA 3OY9A 5J2PA 1S5JA 1HQUA 3G10A 1TK8A 4J2DA 1TKDA 4N41A 3C6TA 1NKEA 3L2UA 1EETA 2VWKA 4JLHA 4QAGA 4Z0UA 4M45A 2FC0A 4CJ5A 2Z1IA 4UQGA 2HVHA 4CFDA 1L5UA 1RT4A 3M8QA 1KVBA 1BI4A 5K14A 4N47A 2OPRA 1FKPA 3HSTB 1SL2A 3AO1A 2AJQA 4W5QA 3LP2A 1L3TA 4O0JA 4B08A 3V6DA 4KB1A 5CY4A 1HYZA 4DSLA 1REVA 3RMCA 3K57A 1IKYA 3C95A 4DS4A 3KKSA 3NF8A 4E19A 3NE6A 1J53A 3AVJA 4DLEA 2G8HA 4CEDA 2I5JA 3TWHA 2IAJA 3OYNA 1JLAA 3SV3A 4CJWA 3IRXA 3MEDA 1X9MA 2ZQBA 1SKWA 1KLMA 4CGDA 4XIUA 3NGZA 4W5TA 3K5LA 4E7LA 1RTJA 4OKKA 4LD0A 1RBTA 1WSJA 2O4IA 2KFNA 3SUQA 4KHNA 2O4GA 2G8WA 4Y1CA 1QSYA 4DLGA 4FJ9A 1NOZA 2HMIA 3PO4A 4DSKA 4W5NA 1NKCA 4EZ9A 1HYSA 3HP6A 2HNDA 4CEZA 3KD5E 2X6NA 3SUNA 4B9UA 1TVRA 2WONA 3LP0A 1T03A 3VQEA 4CHQA 4O55A 5CYMA 5C24A 3KLHA 3SUPA 3QIOA 3TI0A 2HHTA 1TKXA 3TAMA 3LAMA 4BDZA 3SV4A 4IKFA 5HRSA 3DLHA 1TL1A 2OZMA 3K58A 3NH2A 1RNHA 2F8TA 4QCLA 4B9LA 4DTPA 4CECA 5KRTA 1S1UA 4DTRA 3B6OA 1S1XA 1JL2A 1ITGA 1KTQA 4W5OA 1J54A 1LWFA 1WSFA 1YVUA 3TAFA 3OVNA 4ID1A 2KZZA 2DY4A 5FROA 4FLZA 2YHBA 1XWLA 3JSMA 4JRQA 4DQSA 2XO7A 3MAQA 1DTTA 3I8DA 4FJ7A 4KRFA 4OLAA 3KLIA 3LWMA 4W5RA 1RDDA 4FJNA 2G8KA 4M3WA 4LH5A 3TR8A 2QXFA 4R5PA 4O0IA 3V9WA 3OYGA 5HROA 3QEIA 3TAPA 1W9HA 1TK5A 3RR8A 3VQBA 1RT5A 3QO9A 4I7FA 1KSPA 1TAUA 2E6MA 4AHVA 2R7YA 3DLBA 3V1OA 4M3ZA 1YT3A 2B5JA 3QLHA 1BIZA 3QEXA 1X1PA 4CE9A 3S9HA 1C1CA 3H08A 4LSLA 3QETA 3OJUA 3HPOA 4FJ5A 1CXUA 4FLYA 4KV8A 2D5RA 3TAQA 4M41A 5KGXA 4FCYA 3T1AA 3LAKA 3K5OA 4ICLA 4KREA 1S9GA 1TKTA 1TKZA 2DFFA 2OPPA 2P51A 1WN7A 3L2VA 4E1NA 2Y1IA 2OPSA 3QESA 4WE1A 4Q0BA 5I3UA 1HPZA 3QIPA 2G8VA 1LWEA 3OYBA 3KK3A 1N5YA 2D0AA 3LANA 2IGIA 4CF9A 1JL1A 3ITHA 4FW2A 3EZ5A 4N5SA 4Z4GA 3NBPA 3LPUA 1VSMA 1C1AA 5CZ1A 3DYAA 3WNHA 2ITGA 4O4GA 2P5OA 4ELUA 3L2QA 1WSIA 3CQ8A 1R0AA 3MECA 1QQCA 4NCAA 1YTUA 4CHNA 1N6QA 4J2BA 1C6VA 1QS4A 3ZT2A 1B9FA 3QINA 3L2RA 4KHSA 4FZZA 2KTQA 2HHXA 2F96A 3RR7A 3HK2A 4KTWA 1BHLA 1B92A 3NHGA 4HTUA 3SCXA 4CJFA 4E0DA 4PY5A 2KQ2A 4BWJA 4FLUA 3AA5X 4G1QA 3KJVA 4DQPA 1VSDA 4KB0A 3B6PA 1CZBA 3HP9A 4AILC 2D0BA 4DS5A 4FM2A 3L8BA 3D0PA 3V9SA 1XHZA 1D9FA 1Z25A 3ISNC 1J9AA 5JS2A 1K6YA 3I0RA 4CGHA 3EYZA 5T7BA 2JGUA 3O4QA 3WNEA 3AVAA 4Z4EA 3I0SA 4AHCA 2BDPA 4YFUA 4B8CA 3PY8A 1S1WA 1Y97A 3OYHA 4KHQA 2KFZA 1WSEA 2FBTA 4CESA 1A5WA 4CF1A 4L8RB 4DQQA 1U45A 1HNVA 1QHTA 4IFVA 4FXDA 3AVFA 2B6AA 2BE2A 4E7JA 2P5GA 1IH7A 1RBRA 4GW6A 4JRPA 2XY6A 4ELTA 3K59A 3SQ0A 4FJ8A 3ZT3A 2HW3A 2KW4A 4BE2A 4ZTJA 2E4LA 1RTIA 5KRSA 1ZYQA 2XY7A 3SQ1A 4CGGA 4F4KA 4E3SA 2WOMA 1ZBIA 1RT3A 4F3TA 1NK6A 3SJJA 3PX6A 3S3OA 4DU1A 3AV9A 3HXMA 5DK5A 1TV6A 3RRGA 2FBVA 4F2RA 3OS0A 4DFPA 4KI4A 4CJLA 4RG8A 3CM6A 5HRNA 4PA1A 4PUOA 3L3VA 1WAJA 2OYQA 4IG3A 3ZCMA 1VSEA 2PYJA 2QK9A 4DTXA 2OZSA 5KGWA 3SQ4A 4FZXC 1HMVA 4J2AA 3HM9A 5FRNA 3V1RA 3CFPA 3LP3A 1UA1A 4CGFA 1S6QA 3NAEA 4CEAA 1XI1A 2HVIA 4Y1DA 3DI6A 4H4MA 3T19A 2HB5A 1JLEA 1S1TA 4RW9A 1T05A 4AHUA 3NF7A 3KK1A 4FYDA 4OKEA 3CFOA 4HHTA 4FK4A 4H4OA 3AVMA 4FM1A 1L3SA 1RBUA 1D9DA 4HUFA 3SYZA 4DTJA 3RWUA 4DTOA 3M8PA 2GV9A 1RBSA 3BGRA 2A1RA 3AVHA 1WLJA 1VSIA 4DSFA 4FJLA 4CK2A 3VQPA 3MXJA 4CERA 4B9VA 2EX3A 4DTUA 1A5XA 4O44A 1RT2A 1TAQA 3DRSA 4FLWA 3RMBA 1CLQA 1Q8IA 4KTZA 1EP4A 1RBVA 3NF9A 4DFKA 3LWLA 1RTDA 1BISA 1GOAA 2RF2A 1F21A 1JXBA 3VQDA 1T7PA 4NCBA 4KI6A 4CJTA 4M3UA 4F8RA 4H8KA 2QKBA 1IO2A 1HNIA 3U3GA 1RDCA 2DFEA 3AO5A 1LW2A 4CK1A 3P83D 1RTHA 3RTVA 4N56A 4CJRA 4RW7A 3A2FA 3K5NA 1X9WA 1LAWA 4C8NA 5CZ2A 3U3YA 2Z1HA 4LY7A 3LALA 3CYMA 3VQ9A 3KLGA 2HHQA 3V4IA 1NJXA 1ASVA 1NK7A 4C8LA 1TGOA 3LPTA 1NK0A 1CXQA 4CJ3A 3VQ4A 1X9SA 3V81A 2PYLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3THV A;  1EXQ A;  4CEO A;  4OPK A;  4FLV A;  5HLF A;  1JLG A;  4GMJ B;  3HVT A;  1G15 A;  1RDB A;  3DLG A;  4OVL A;  3OYK A;  2IOC A;  1S9E A;  3DOK A;  4DSI A;  1QTM A;  3AVN A;  4DWI A;  1DLO A;  4KHU A;  3T3F A;  2Y1J A;  1T8E A;  3C6U A;  4FJI A;  1EKE A;  3F9K A;  4M3T A;  4CIG A;  4JS5 A;  3VN5 A;  4CEB A;  3KK2 A;  2VG5 A;  3KKR A;  4I2Q A;  4CFC A;  1SKS A;  1SUQ A;  2E6L A;  3E01 A;  2IDO A;  4O5B A;  3V9X A;  3CG7 A;  1L3U A;  2PZS A;  4EP5 A;  2XY8 A;  1TL3 A;  1J5O A;  1BI4 B;  4KFB A;  1U47 A;  3DLK A;  4KAZ A;  1JLC A;  2X74 A;  1IKX A;  4DMN A;  4C8K A;  3O3H A;  2HHV A;  3L2W A;  1ASW A;  3IG1 A;  3VQ5 A;  3HYF A;  3ZSQ A;  3OYD A;  3K5M A;  4CGI A;  1RT1 A;  5EU7 A;  4DSE A;  4DFJ A;  4FK2 A;  4B3O A;  4ZHR A;  5E41 A;  2YNH A;  4CGJ A;  4CCH A;  4B9N A;  3AO3 A;  3ZSR A;  3DM2 A;  3HPH A;  4CIF A;  4ZTF A;  1LW0 A;  2FBY A;  4Z4F A;  3VQ6 A;  3ZSZ A;  5J2N A;  1Q9X A;  4M3R A;  2XRI A;  3LZI A;  3OYE A;  1UAX A;  1U04 A;  1VRT A;  3AVI A;  1I39 A;  4IDK A;  1IKW A;  1W0H A;  3KIO A;  4ID5 A;  1RT6 A;  4FW1 A;  4BDY A;  1FXX A;  3ZSW A;  3SZ2 A;  2XY5 A;  3NDK A;  3S3M A;  4DU4 A;  3ZSO A;  3ASM A;  3IS9 A;  3PO5 A;  3TAN A;  3ZSV A;  4JS4 A;  3HJF A;  4CJK A;  5HRP A;  1DTQ A;  4HUE A;  1BGX T;  3RMA A;  3SPZ A;  2Z1G A;  1FK9 A;  2RPI A;  1JLQ A;  3LDS A;  3PX0 A;  4CEQ A;  4AHR A;  4FZY A;  4B9T A;  2W42 A;  4PWD A;  3RMD A;  1FKO A;  4CF0 A;  1GOB A;  5SWM A;  4AHS A;  1I3A A;  2RKI A;  2OPQ A;  3AVG A;  3TAB A;  4C8M A;  1BCM A;  4CHO A;  3KTQ A;  4DTN A;  4M3Y A;  1LWC A;  3NH1 A;  4YNQ A;  1C0M A;  3K2P A;  4CJU A;  1ZBF A;  4DG1 A;  4KO0 A;  4CJS A;  2NUB A;  4M3X A;  1S6P A;  2KZM A;  3VQ7 A;  3NGY A;  3SUO A;  1JLF A;  1RDA A;  4OGC A;  4PQU A;  4MQ3 A;  1BL3 A;  1D8Y A;  4HCB A;  2OA8 A;  3VQ8 A;  3OJS A;  3HO1 A;  1U49 A;  2X6S A;  3DRR A;  2HNY A;  2G8F A;  1NK5 A;  3ZT4 A;  1BIU A;  3F73 A;  1D5A A;  2B4J A;  4DQR A;  3QEW A;  1B9D A;  5FDL A;  3OYM A;  4HVJ A;  3NFA A;  4IBN A;  1U4B A;  3QEV A;  3BDP A;  1BQN A;  1IKV A;  3ZT0 A;  5C25 A;  1NJY A;  4Z4I A;  4QOZ B;  5C42 A;  3EY1 A;  3IAY A;  1BQM A;  1KVA A;  4BAC A;  4DQI A;  2DTU A;  2HNZ A;  3HL8 A;  4B9M A;  5D3G A;  3ZSY A;  3QNO A;  4DTS A;  1RT7 A;  3WNG A;  3MXI A;  1U48 A;  3NCI A;  4KHY A;  3DLE A;  4NYF A;  4DFM A;  2YV0 X;  1LAV A;  1NKB A;  2YKM A;  2ZD1 A;  3O3F A;  3VQA A;  3P5J A;  4CIE A;  3D45 A;  2YHA A;  2HHW A;  2HHU A;  2JLE A;  3M8S A;  3TAG A;  5J1E A;  3HPG A;  1NK8 A;  3CFR A;  3V9U A;  1VK0 A;  5HRR A;  3SQ2 A;  2EHG A;  4DF8 A;  3QNN A;  1KVC A;  1UOC A;  1XC9 A;  4OJR A;  3KLE A;  3ULD A;  1SV5 A;  1C0T A;  4HCC A;  2Q3S A;  3RRH A;  1WSG A;  4BWM A;  4IG0 A;  1WNS A;  2F8S A;  4K8Z A;  4CJP A;  1VSF A;  4EP4 A;  3DLR A;  1SL1 A;  3V1Q A;  4KTQ A;  3QEP A;  4B9S A;  4Z4C A;  1VSH A;  3HT3 A;  3TAR A;  4FLX A;  3AVL A;  4CJ4 A;  3G0Z A;  1NJW A;  4EZ6 A;  1Z26 A;  3VQQ A;  4RW6 A;  4CFB A;  2IS3 A;  4ELV A;  2IC3 A;  3PUF A;  4RW8 A;  4CFA A;  4DSJ A;  4F2S A;  4K8X A;  4OLB A;  1LV5 A;  3AA2 A;  3AVC A;  2D0C A;  3JYT A;  1NOY A;  3O3G A;  3ZT1 A;  3AVK A;  2XHB A;  5JS1 A;  1TK0 A;  4Z4H A;  4KPY A;  2LSN A;  4F3O A;  3NH0 A;  1UWB A;  3AA4 A;  4MFB A;  3UIQ A;  1EX4 A;  1HRH A;  4AHT A;  4M42 A;  1L3V A;  2YNF A;  5J2M A;  1IG9 A;  3AO4 A;  1KFD A;  3CM5 A;  4KKO A;  2RN2 A;  2VWJ A;  2HHS A;  3LP1 A;  1Q9Y A;  3MEE A;  3M8R A;  1JLB A;  4E7I A;  2VG7 A;  4I2P A;  3OYI A;  5I42 A;  3SNN A;  2PY5 A;  4OPJ A;  1RIL A;  4AH9 A;  4E1M A;  3VA0 A;  2BAN A;  1A5V A;  1WAF A;  3OYL A;  3LZJ A;  3V9Z A;  4CEE A;  1JKH A;  5HBM A;  2DFH A;  4FM0 A;  1NJZ A;  2G8U A;  4DF4 A;  1VSJ A;  4FJM A;  3C94 A;  2QKK A;  1C1B A;  4OKJ A;  2A1S A;  4LSN A;  4CJE A;  3PX4 A;  5KI6 A;  3SPY A;  3P1G A;  3AVB A;  3O4N A;  1NK4 A;  4E7H A;  3OYF A;  1HQE A;  4FLT A;  2P1J A;  1O1W A;  1KRP A;  4FJH A;  4J2E A;  4LH4 A;  3MXM A;  4FVM A;  4KHW A;  4TSX A;  3OS1 A;  3QER A;  4N76 A;  3DRP A;  3MEG A;  3OYC A;  4CF2 A;  1C0U A;  4HUG A;  3L3U A;  1ZBU A;  4CJV A;  4GVM A;  1ZBH A;  4I9L A;  3OS2 A;  3TAE A;  1VSK A;  5DMR A;  3PV8 A;  3FFI A;  1ZBL A;  1GOC A;  4RW4 A;  4FJX A;  5SZT A;  3OYA A;  1WSH A;  3ALY A;  4DU3 A;  3DOL A;  2X78 A;  2ZE2 A;  3ZSX A;  2VG6 A;  4CK3 A;  1UA0 A;  1SKR A;  3AA3 A;  1QE1 A;  3WNF A;  4CHZ A;  3NF6 A;  5HP1 A;  1SL0 A;  3U6F A;  1NK9 A;  4FJG A;  1MU2 A;  1S1V A;  5KTQ A;  3KLF A;  3HVR A;  3SI6 A;  3AO2 A;  1KFS A;  2ATQ A;  2FBX A;  1CZ9 A;  2YNG A;  4CEF A;  4OGE A;  4NYN A;  4IFY A;  4B8A B;  5FRM A;  1VSL A;  2Z1J A;  4FJK A;  4E7K A;  1VRU A;  1KLN A;  2GUI A;  4FK0 A;  2YKN A;  4C8O A;  4FJJ A;  1ASU A;  3VQC A;  2BGG A;  4DTM A;  4BE1 A;  4BDP A;  3DMJ A;  4CF8 A;  4BE0 A;  1RCH A;  3KD1 E;  2G8I A;  3VA3 A;  5CYQ A;  4Q5V A;  1HJR A;  1YTA A;  4I9Q A;  3S3N A;  4CHY A;  1XHX A;  4E89 A;  5J2Q A;  2GBZ A;  1HYV A;  1BCO A;  4CHP A;  3OYJ A;  3NGI A;  2ETJ A;  4NCG A;  1JXE A;  2YNI A;  4CJQ A;  1QSS A;  1QSL A;  1KCF A;  3OY9 A;  5J2P A;  1S5J A;  1HQU A;  3G10 A;  1TK8 A;  4J2D A;  1TKD A;  4N41 A;  3C6T A;  1NKE A;  3L2U A;  1EET A;  2VWK A;  4JLH A;  4QAG A;  4Z0U A;  4M45 A;  2FC0 A;  4CJ5 A;  2Z1I A;  4UQG A;  2HVH A;  4CFD A;  1L5U A;  1RT4 A;  3M8Q A;  1KVB A;  1BI4 A;  5K14 A;  4N47 A;  2OPR A;  1FKP A;  3HST B;  1SL2 A;  3AO1 A;  2AJQ A;  4W5Q A;  3LP2 A;  1L3T A;  4O0J A;  4B08 A;  3V6D A;  4KB1 A;  5CY4 A;  1HYZ A;  4DSL A;  1REV A;  3RMC A;  3K57 A;  1IKY A;  3C95 A;  4DS4 A;  3KKS A;  3NF8 A;  4E19 A;  3NE6 A;  1J53 A;  3AVJ A;  4DLE A;  2G8H A;  4CED A;  2I5J A;  3TWH A;  2IAJ A;  3OYN A;  1JLA A;  3SV3 A;  4CJW A;  3IRX A;  3MED A;  1X9M A;  2ZQB A;  1SKW A;  1KLM A;  4CGD A;  4XIU A;  3NGZ A;  4W5T A;  3K5L A;  4E7L A;  1RTJ A;  4OKK A;  4LD0 A;  1RBT A;  1WSJ A;  2O4I A;  2KFN A;  3SUQ A;  4KHN A;  2O4G A;  2G8W A;  4Y1C A;  1QSY A;  4DLG A;  4FJ9 A;  1NOZ A;  2HMI A;  3PO4 A;  4DSK A;  4W5N A;  1NKC A;  4EZ9 A;  1HYS A;  3HP6 A;  2HND A;  4CEZ A;  3KD5 E;  2X6N A;  3SUN A;  4B9U A;  1TVR A;  2WON A;  3LP0 A;  1T03 A;  3VQE A;  4CHQ A;  4O55 A;  5CYM A;  5C24 A;  3KLH A;  3SUP A;  3QIO A;  3TI0 A;  2HHT A;  1TKX A;  3TAM A;  3LAM A;  4BDZ A;  3SV4 A;  4IKF A;  5HRS A;  3DLH A;  1TL1 A;  2OZM A;  3K58 A;  3NH2 A;  1RNH A;  2F8T A;  4QCL A;  4B9L A;  4DTP A;  4CEC A;  5KRT A;  1S1U A;  4DTR A;  3B6O A;  1S1X A;  1JL2 A;  1ITG A;  1KTQ A;  4W5O A;  1J54 A;  1LWF A;  1WSF A;  1YVU A;  3TAF A;  3OVN A;  4ID1 A;  2KZZ A;  2DY4 A;  5FRO A;  4FLZ A;  2YHB A;  1XWL A;  3JSM A;  4JRQ A;  4DQS A;  2XO7 A;  3MAQ A;  1DTT A;  3I8D A;  4FJ7 A;  4KRF A;  4OLA A;  3KLI A;  3LWM A;  4W5R A;  1RDD A;  4FJN A;  2G8K A;  4M3W A;  4LH5 A;  3TR8 A;  2QXF A;  4R5P A;  4O0I A;  3V9W A;  3OYG A;  5HRO A;  3QEI A;  3TAP A;  1W9H A;  1TK5 A;  3RR8 A;  3VQB A;  1RT5 A;  3QO9 A;  4I7F A;  1KSP A;  1TAU A;  2E6M A;  4AHV A;  2R7Y A;  3DLB A;  3V1O A;  4M3Z A;  1YT3 A;  2B5J A;  3QLH A;  1BIZ A;  3QEX A;  1X1P A;  4CE9 A;  3S9H A;  1C1C A;  3H08 A;  4LSL A;  3QET A;  3OJU A;  3HPO A;  4FJ5 A;  1CXU A;  4FLY A;  4KV8 A;  2D5R A;  3TAQ A;  4M41 A;  5KGX A;  4FCY A;  3T1A A;  3LAK A;  3K5O A;  4ICL A;  4KRE A;  1S9G A;  1TKT A;  1TKZ A;  2DFF A;  2OPP A;  2P51 A;  1WN7 A;  3L2V A;  4E1N A;  2Y1I A;  2OPS A;  3QES A;  4WE1 A;  4Q0B A;  5I3U A;  1HPZ A;  3QIP A;  2G8V A;  1LWE A;  3OYB A;  3KK3 A;  1N5Y A;  2D0A A;  3LAN A;  2IGI A;  4CF9 A;  1JL1 A;  3ITH A;  4FW2 A;  3EZ5 A;  4N5S A;  4Z4G A;  3NBP A;  3LPU A;  1VSM A;  1C1A A;  5CZ1 A;  3DYA A;  3WNH A;  2ITG A;  4O4G A;  2P5O A;  4ELU A;  3L2Q A;  1WSI A;  3CQ8 A;  1R0A A;  3MEC A;  1QQC A;  4NCA A;  1YTU A;  4CHN A;  1N6Q A;  4J2B A;  1C6V A;  1QS4 A;  3ZT2 A;  1B9F A;  3QIN A;  3L2R A;  4KHS A;  4FZZ A;  2KTQ A;  2HHX A;  2F96 A;  3RR7 A;  3HK2 A;  4KTW A;  1BHL A;  1B92 A;  3NHG A;  4HTU A;  3SCX A;  4CJF A;  4E0D A;  4PY5 A;  2KQ2 A;  4BWJ A;  4FLU A;  3AA5 X;  4G1Q A;  3KJV A;  4DQP A;  1VSD A;  4KB0 A;  3B6P A;  1CZB A;  3HP9 A;  4AIL C;  2D0B A;  4DS5 A;  4FM2 A;  3L8B A;  3D0P A;  3V9S A;  1XHZ A;  1D9F A;  1Z25 A;  3ISN C;  1J9A A;  5JS2 A;  1K6Y A;  3I0R A;  4CGH A;  3EYZ A;  5T7B A;  2JGU A;  3O4Q A;  3WNE A;  3AVA A;  4Z4E A;  3I0S A;  4AHC A;  2BDP A;  4YFU A;  4B8C A;  3PY8 A;  1S1W A;  1Y97 A;  3OYH A;  4KHQ A;  2KFZ A;  1WSE A;  2FBT A;  4CES A;  1A5W A;  4CF1 A;  4L8R B;  4DQQ A;  1U45 A;  1HNV A;  1QHT A;  4IFV A;  4FXD A;  3AVF A;  2B6A A;  2BE2 A;  4E7J A;  2P5G A;  1IH7 A;  1RBR A;  4GW6 A;  4JRP A;  2XY6 A;  4ELT A;  3K59 A;  3SQ0 A;  4FJ8 A;  3ZT3 A;  2HW3 A;  2KW4 A;  4BE2 A;  4ZTJ A;  2E4L A;  1RTI A;  5KRS A;  1ZYQ A;  2XY7 A;  3SQ1 A;  4CGG A;  4F4K A;  4E3S A;  2WOM A;  1ZBI A;  1RT3 A;  4F3T A;  1NK6 A;  3SJJ A;  3PX6 A;  3S3O A;  4DU1 A;  3AV9 A;  3HXM A;  5DK5 A;  1TV6 A;  3RRG A;  2FBV A;  4F2R A;  3OS0 A;  4DFP A;  4KI4 A;  4CJL A;  4RG8 A;  3CM6 A;  5HRN A;  4PA1 A;  4PUO A;  3L3V A;  1WAJ A;  2OYQ A;  4IG3 A;  3ZCM A;  1VSE A;  2PYJ A;  2QK9 A;  4DTX A;  2OZS A;  5KGW A;  3SQ4 A;  4FZX C;  1HMV A;  4J2A A;  3HM9 A;  5FRN A;  3V1R A;  3CFP A;  3LP3 A;  1UA1 A;  4CGF A;  1S6Q A;  3NAE A;  4CEA A;  1XI1 A;  2HVI A;  4Y1D A;  3DI6 A;  4H4M A;  3T19 A;  2HB5 A;  1JLE A;  1S1T A;  4RW9 A;  1T05 A;  4AHU A;  3NF7 A;  3KK1 A;  4FYD A;  4OKE A;  3CFO A;  4HHT A;  4FK4 A;  4H4O A;  3AVM A;  4FM1 A;  1L3S A;  1RBU A;  1D9D A;  4HUF A;  3SYZ A;  4DTJ A;  3RWU A;  4DTO A;  3M8P A;  2GV9 A;  1RBS A;  3BGR A;  2A1R A;  3AVH A;  1WLJ A;  1VSI A;  4DSF A;  4FJL A;  4CK2 A;  3VQP A;  3MXJ A;  4CER A;  4B9V A;  2EX3 A;  4DTU A;  1A5X A;  4O44 A;  1RT2 A;  1TAQ A;  3DRS A;  4FLW A;  3RMB A;  1CLQ A;  1Q8I A;  4KTZ A;  1EP4 A;  1RBV A;  3NF9 A;  4DFK A;  3LWL A;  1RTD A;  1BIS A;  1GOA A;  2RF2 A;  1F21 A;  1JXB A;  3VQD A;  1T7P A;  4NCB A;  4KI6 A;  4CJT A;  4M3U A;  4F8R A;  4H8K A;  2QKB A;  1IO2 A;  1HNI A;  3U3G A;  1RDC A;  2DFE A;  3AO5 A;  1LW2 A;  4CK1 A;  3P83 D;  1RTH A;  3RTV A;  4N56 A;  4CJR A;  4RW7 A;  3A2F A;  3K5N A;  1X9W A;  1LAW A;  4C8N A;  5CZ2 A;  3U3Y A;  2Z1H A;  4LY7 A;  3LAL A;  3CYM A;  3VQ9 A;  3KLG A;  2HHQ A;  3V4I A;  1NJX A;  1ASV A;  1NK7 A;  4C8L A;  1TGO A;  3LPT A;  1NK0 A;  1CXQ A;  4CJ3 A;  3VQ4 A;  1X9S A;  3V81 A;  2PYL A; 
#chains in the Genus database with same CATH topology
 1OVQ A;  4CEO A;  5HLF A;  4GMJ B;  3HVT A;  3CCM N;  3DLG A;  3O80 A;  3OYK A;  2IOC A;  1S9E A;  3WUH A;  2BTF A;  2OTJ N;  4YOR A;  4KHU A;  4IFE A;  2Y1J A;  1T8E A;  3A5L C;  3VN5 A;  1BG3 A;  2VG5 A;  4I2Q A;  3BUZ B;  4FYD A;  3SAH A;  3V9X A;  5F1X A;  4DR2 K;  1BI4 B;  1TUU A;  3DLK A;  4KAZ A;  3DAW A;  4R79 A;  1BA0 A;  1Q7Y O;  4DMN A;  4C8K A;  3L2W A;  3BEX A;  4CI6 A;  3VQ5 A;  3K5M A;  5EU7 A;  4DSE A;  4B3O A;  4ZHR A;  4CCH A;  3CD6 N;  4CGJ A;  3CC4 N;  4B9N A;  3DM2 A;  3HPH A;  4CIF A;  1LW0 A;  3FZH A;  4BRP A;  3ZET A;  1VRT A;  4BRH A;  2CGK A;  4BC4 A;  1RT6 A;  1XMO K;  4BDY A;  1FXX A;  5FLX O;  4YOY A;  2QWN A;  3D2F A;  3ZSO A;  4GKJ K;  3PO5 A;  5HRP A;  1DTQ A;  4HUE A;  2Z1G A;  1FK9 A;  3KK7 A;  3QDK A;  4FZY A;  4PWD A;  4JI7 K;  2ITM A;  5SWM A;  2RKI A;  1NWK A;  3A5O C;  1EWQ A;  5IWA K;  4JI2 K;  4YOV A;  4CHO A;  3LDL A;  2V51 B;  1LWC A;  3NH1 A;  3THW A;  4BRC A;  1QQN A;  4MDB A;  2NUB A;  4CJS A;  4M3X A;  2KZM A;  3NGY A;  1JLF A;  4HCB A;  2JWK A;  1WOQ A;  2X6S A;  1U49 A;  1B9D A;  3NFA A;  3QEV A;  3BDP A;  1MA9 B;  3ZT0 A;  4MO4 A;  5C42 A;  1V4T A;  1GLE G;  4BAC A;  2HNZ A;  4DKW A;  1Y64 A;  3ZSY A;  4DTS A;  3WNG A;  4KHY A;  3DLE A;  2ZD1 A;  4DV0 K;  3D45 A;  4BRO A;  3C7N B;  4DR6 K;  2JLE A;  3V9U A;  1VK0 A;  2EHG A;  4DF8 A;  1ZBS A;  1KVC A;  1UOC A;  2WFB A;  4MO5 A;  1SV5 A;  5TKW A;  4HCC A;  3P31 A;  2FSN A;  4BWM A;  1WNS A;  1VSF A;  2E8A A;  4KTQ A;  2E2N A;  1HJO A;  5EY4 A;  3MWT A;  4Z4C A;  3TAR A;  3O1B A;  4FLX A;  3G0Z A;  4OPH A;  3VQQ A;  4RW6 A;  4DSJ A;  1D4X A;  3MN7 A;  3OBY A;  1LV5 A;  2D0C A;  1CZA N;  3AVK A;  5JS1 A;  4JD2 B;  1BOT O;  2QWQ A;  4AHT A;  3CM5 A;  4KKO A;  2WTU A;  3LP1 A;  4WQ4 C;  1Q9Y A;  4K43 A;  4PKH A;  4NXM K;  1JLB A;  3OYI A;  5GAE P;  3SNN A;  4UY8 O;  4OPJ A;  4E1M A;  4FOI A;  1A5V A;  3OYL A;  3LZJ A;  3H6E A;  4A2B A;  4DF4 A;  1K9M O;  5GIO A;  3GG4 A;  2QKK A;  4OKJ A;  4J2D A;  3SPY A;  3O4N A;  1O1W A;  3THW B;  5BPN A;  3C6A A;  3OYC A;  1C0U A;  1ZBU A;  4GVM A;  4E1J A;  3FGU A;  2E2Q A;  2QXL A;  4CZF A;  3FFI A;  4RW4 A;  4FJX A;  3T7Z A;  1WSH A;  4DU3 A;  3CC7 N;  1NBW A;  4MLH A;  3ZSX A;  2VG6 A;  2UYT A;  1QE1 A;  4J8F A;  2V52 B;  3WNF A;  1NGF A;  1SL0 A;  5JLF A;  3DWL A;  3KHY A;  2YNG A;  4JKF A;  3LDQ A;  2IVN A;  3ENB A;  1VRU A;  1KLN A;  5ADX A;  1VQM N;  4B1W B;  4CZK A;  2P9P A;  3WEE A;  4BDP A;  4DV7 K;  3AAQ A;  4CF8 A;  4BE0 A;  3KD1 E;  4NLB A;  3VF4 A;  1YIJ N;  1HJR A;  1YTA A;  3S3N A;  4CHY A;  3FZK A;  2W6K A;  4CZM A;  1VQ6 N;  4IWV A;  4CHP A;  3VER A;  4NCG A;  1JXE A;  2YNI A;  2D0O A;  4AM7 A;  4N41 A;  1S5J A;  1TK8 A;  3C6T A;  1SZ2 A;  4JLH A;  2O8E A;  3UKU A;  4B1Y B;  5LJV A;  4C1N I;  3EZW A;  1SL2 A;  3HST B;  1FKP A;  1RDW X;  2OPR A;  3QBX A;  1HKB A;  1QQO A;  1L3T A;  5CY4 A;  4DSL A;  5CE3 A;  3I8B A;  3RMC A;  3UB5 A;  1IKY A;  3C95 A;  4I6M B;  3KKS A;  3NE6 A;  3PSF A;  1E3M A;  4KH6 A;  3SV3 A;  2F9T A;  1RFQ A;  4JKB A;  2ZM6 K;  1X9M A;  3E9O A;  5AQW A;  3NGZ A;  3K5L A;  2NRH A;  4ISG A;  1TYQ A;  1DKG D;  4FJ9 A;  4CZH A;  2UXD K;  1YUW A;  3HRG A;  1YJ9 N;  4W5N A;  2AA4 A;  3HP6 A;  4LF9 K;  2HND A;  4B9U A;  2WON A;  2P9U A;  3TI0 A;  4O55 A;  5CYM A;  5C24 A;  3KLH A;  3SUP A;  3QIO A;  2HHT A;  3ENH A;  3SBG A;  3LAM A;  4IKF A;  5M1O A;  3K58 A;  3O4W A;  4CEC A;  1YI2 N;  1KTQ A;  3M5R A;  1J54 A;  2VQE K;  3TAF A;  3CIP A;  3JSM A;  4JRQ A;  1DTT A;  4FJ7 A;  1ZXO A;  1QHA A;  3IFR A;  3OBW A;  4O0I A;  3V9W A;  3RR8 A;  4WYB A;  2GEL A;  4LF8 K;  2RE2 A;  2E6M A;  3IDH A;  4M3Z A;  2E88 A;  4XH4 A;  3FLC O;  3THX A;  2QI2 A;  1U2V A;  4YDU C;  4CBW A;  1VQ5 N;  4L3Q A;  1E4G T;  2D5R A;  3TAQ A;  4JK8 A;  3T1A A;  4CZI A;  3LAK A;  4ICL A;  1OH7 A;  4DB3 A;  1K8A O;  1TKT A;  2OPS A;  3QES A;  3L0Q A;  3CCR N;  4IXC A;  2CH5 A;  2H3G X;  2NRR A;  1HUX A;  2IGI A;  2O8E B;  3Q7C A;  3UKU B;  3NMU A;  3ITH A;  4ILG B;  5CZ1 A;  5AQF A;  3L2Q A;  3O8M A;  1R0A A;  3MEC A;  4NCA A;  1C6V A;  1B9F A;  3VET A;  3VEO A;  3HK2 A;  1BHL A;  4PY5 A;  2P9I B;  3AA5 X;  4PL8 A;  3B6P A;  3G71 N;  4DS5 A;  4FM2 A;  3V9S A;  1D9F A;  5A2Q O;  5AZI A;  1Z25 A;  2NRW A;  1TYQ B;  2PAV A;  2JGU A;  5AQI A;  3O4Q A;  4Z4E A;  5AQJ A;  2NRT A;  3FR0 A;  1Y97 A;  2NRX A;  2KFZ A;  2FBT A;  4CES A;  1A5W A;  3VEZ A;  1OH5 A;  4L8R B;  1HNV A;  4IFV A;  4E7J A;  3R6M A;  4FVU A;  4GW6 A;  5CHI A;  5AFU H;  4FJ8 A;  4BE2 A;  2E4L A;  4BG8 A;  1V4S A;  1RTI A;  2YJE A;  1ZYQ A;  4FOE A;  5AZJ A;  4BVO A;  2WOM A;  4FWO A;  4F3T A;  4CJ7 A;  1OKJ A;  3LDO A;  4BR5 A;  3HXM A;  2FBV A;  3OS0 A;  1ILY A;  4KI4 A;  2UU9 K;  3CM6 A;  4K0K K;  2PFU A;  2QK9 A;  1QQM A;  4M7Y A;  4DTX A;  4FZX C;  1HMV A;  1K8K A;  2NZT A;  2WUS A;  4CEA A;  4JAX A;  1XI1 A;  1I94 K;  1GLC G;  1NNE A;  4Y1D A;  2HB5 A;  5LMN K;  3SLC A;  4RW9 A;  1T05 A;  3CFO A;  1BA1 A;  1D9D A;  1RBU A;  4HUF A;  1VQN N;  5C10 A;  1VSI A;  4FJL A;  3MXJ A;  1T3V A;  4B9V A;  3K9J A;  1RT2 A;  4O44 A;  3DRS A;  3RMB A;  3AGK A;  4KTZ A;  5JVH L;  2IVO A;  3LWL A;  1JXB A;  5AQN A;  4KI6 A;  4M3U A;  2WC9 A;  3U3G A;  3AO5 A;  3P83 D;  4CJR A;  3A2F A;  1WBB A;  2HHQ A;  4FWQ A;  3FZF A;  3CYM A;  1RDU A;  5JVG L;  3S41 A;  3THV A;  1EXQ A;  4FLV A;  4NB4 A;  1JLG A;  1G15 A;  1IG8 A;  3PIP L;  4BRA A;  1VQ9 N;  1VAZ A;  4DSI A;  1BWF O;  4JKE A;  1DLO A;  3EE8 A;  4H5T A;  3GBT A;  3CCE N;  4WFA L;  3CET A;  2ASP A;  4M3T A;  4CIG A;  3G4S N;  3KK2 A;  4DV5 K;  4IO9 L;  2E6L A;  3E01 A;  2IDO A;  2HBL A;  2PZS A;  5FPE A;  5DM6 L;  2X74 A;  3RVC A;  1NG9 A;  3VTH A;  4A61 A;  4FK2 A;  4CGI A;  4H03 B;  3PSI A;  2W41 A;  3AO3 A;  4RCH A;  4ZTF A;  4ISF A;  4CBU A;  4Z4F A;  3ZSZ A;  5J2N A;  4M7X A;  3CCU N;  4QS7 A;  1VHX A;  2EWS A;  1IKW A;  1W0H A;  3VF2 A;  2XY5 A;  4JNE A;  3SZ2 A;  3ASM A;  3IS9 A;  3ZSV A;  3FE1 A;  4JS4 A;  3HJF A;  4CJK A;  4FWK A;  1NGH A;  1K8K B;  4CBX A;  3RMA A;  1NM1 A;  1YJN N;  2RPI A;  4CEQ A;  1Z6R A;  4B9T A;  2W42 A;  3RMD A;  4CF0 A;  4U7B A;  4C8M A;  1BCM A;  3O9Q A;  1C0M A;  3K2P A;  4DG1 A;  5M1F A;  3VQ7 A;  1RDA A;  1D8Y A;  1QZ5 A;  2OA8 A;  3DRR A;  4GV9 A;  1J6Z A;  1LOT B;  2UXC K;  4IBN A;  1FJG K;  1IKV A;  4Z4I A;  1MWK A;  2KHO A;  4DQI A;  2DTU A;  4WCE L;  4X64 K;  3R9P A;  3LDP A;  1U48 A;  1N36 K;  2YV0 X;  3O3F A;  4CIE A;  5BN9 A;  4BC2 A;  3ZYY X;  5J1E A;  3TAG A;  3IUC A;  3O6W A;  3J7Y P;  3ULD A;  1C0T A;  1WSG A;  2F8S A;  4K8Z A;  1O13 A;  3TTC A;  2HST A;  3U4L A;  1Z26 A;  3PUF A;  3D2E B;  5AFU A;  3J7Z O;  4K8X A;  1OH6 A;  3JYT A;  3TTF A;  4B3M K;  3T69 A;  3TTD A;  3ZT1 A;  1VQ7 N;  4KPY A;  4YOW A;  3NH0 A;  3UIQ A;  4MFB A;  4M42 A;  4FWS A;  1L3V A;  5ADX H;  2P9S B;  3AO4 A;  4BRN A;  1KFD A;  2O8F A;  5LL6 Z;  5BRH A;  2GX9 A;  3MEE A;  3M8R A;  2HF4 A;  2VG7 A;  3CPE A;  3L6Q A;  4I2P A;  3J8A A;  3SK3 A;  1Q82 O;  1RIL A;  3E66 A;  2BAN A;  3THY B;  2ZWH A;  1VSJ A;  3CJB A;  4FJM A;  5AQR A;  3JAM O;  1W7A A;  5KI6 A;  3P1G A;  3AVB A;  4E7H A;  5M1N A;  3OYF A;  1QVF M;  1HQE A;  4FLT A;  4FJH A;  4LH4 A;  5EOY A;  2O8D B;  3QER A;  3MEG A;  3RSE A;  4CF2 A;  4H0P A;  3L3U A;  3TU5 A;  3CER A;  3AY9 A;  1KAX A;  3DJC A;  4DV3 K;  3ALY A;  3ZX3 A;  5BRF A;  1NU0 A;  4YHH K;  2ZJP L;  1SKR A;  4DR1 K;  1UA0 A;  1KAZ A;  1S1V A;  3AO2 A;  1KFS A;  1ATS A;  4IJA A;  4OGE A;  2E5L K;  4IFY A;  4JHD A;  2HOE A;  4EIA A;  2GUI A;  3MN6 A;  5TKY A;  4C8O A;  4FJJ A;  1ASU A;  3D6R A;  3OA9 A;  2BGG A;  4DTM A;  4JI8 K;  4BE1 A;  3TPQ A;  2G8I A;  2YI1 A;  4X62 K;  1IV0 A;  3VEX A;  4XEI A;  1SS6 A;  5J2Q A;  1HYV A;  3O1W A;  2ZF5 O;  2ETJ A;  1HNX K;  4CJQ A;  1QSL A;  1KCF A;  3G10 A;  1TKD A;  2FSK A;  1NKE A;  3CME N;  4JI0 K;  4M45 A;  2VWK A;  4CJ5 A;  4UQG A;  5K14 A;  4N47 A;  1KVB A;  3A5N C;  4ILJ A;  3CCJ N;  3CQY A;  2HF3 A;  2VGM A;  3K57 A;  4BVP A;  2O8F B;  1J53 A;  2I5J A;  3OYN A;  1JLA A;  3CJ1 A;  3CJ7 A;  3R8E A;  4CGD A;  2ZGZ A;  4OKK A;  3WT0 A;  1RBT A;  1WSJ A;  3W3D A;  3SAF A;  3SUQ A;  3SMP A;  3VES A;  4DR4 K;  4CZG A;  4EZ9 A;  5MLC Q;  1HYS A;  2Q36 A;  4CEZ A;  5IT9 O;  3EL2 A;  3SUN A;  3U9Z A;  3HBT A;  3RSE B;  1TVR A;  3LP0 A;  1T03 A;  4CHQ A;  1N8R O;  3OHR A;  1TKX A;  2HBJ A;  4JKG A;  5HRS A;  3DLH A;  4BRD A;  3FZM A;  1W2B M;  1S1U A;  2YJF A;  1S1X A;  3B6O A;  1JL2 A;  1YVU A;  3ZX0 A;  2ASO A;  1WBD A;  3OVN A;  4ID1 A;  3ZET B;  3F9M A;  4H5R A;  4OX9 K;  4GVE A;  4BC3 A;  3D2F B;  1EQY A;  3KLI A;  3LWM A;  4B1X B;  4LF5 K;  2E1Z A;  2G8K A;  4LH5 A;  4R5P A;  2QXF A;  5HRO A;  4H0T B;  5AQG A;  3VQB A;  3QO9 A;  3QLH A;  4KH5 A;  3QEX A;  5JMV A;  2VYP A;  1C1C A;  4LSL A;  3QET A;  3HPO A;  4DV4 K;  3M3Z A;  5AQO A;  1S9G A;  3L2V A;  1P90 A;  1WN7 A;  2NNW A;  3QIP A;  2G8V A;  3MX5 A;  4YOU A;  1S72 N;  4IOA L;  5C0Y A;  2D0A A;  4CF9 A;  4HWI A;  2A40 A;  4OPA A;  4FW2 A;  3EZ5 A;  2ITG A;  4CZL A;  3G25 A;  5AQM A;  3WQT A;  1N6Q A;  1QS4 A;  1GLF O;  3ZT2 A;  3QIN A;  3EO3 A;  4EFH A;  2HHX A;  1Z05 A;  1ZC6 A;  2F96 A;  4H0O A;  3NHG A;  3SCX A;  4BWJ A;  4FLU A;  4G1Q A;  2UXB K;  1VSD A;  4KB0 A;  3HP9 A;  1XHZ A;  1NMN A;  3ISN C;  5M1K A;  4K25 A;  4X65 K;  1NGI A;  4IO8 A;  3WNE A;  3I0S A;  5C2F A;  3PY8 A;  4B8C A;  1WSE A;  3ATV A;  4CD3 A;  3EKU A;  1NGC A;  4JKD A;  1KAY A;  4DUZ K;  3GE1 A;  3MWP A;  1IH7 A;  2XY6 A;  1S3X A;  3CMA N;  4JRP A;  1M1K O;  2O8B A;  2QW9 A;  3CXC M;  4LFB K;  3ZT3 A;  2HW3 A;  4ZTJ A;  4WFN L;  5M1P A;  5KPR A;  3SJJ A;  1X9J A;  5DK5 A;  1TV6 A;  3T1Y K;  2CGL A;  5AQT A;  4CJL A;  1XMQ K;  5HRN A;  2FF6 A;  2PYJ A;  1OVY A;  3WXI A;  3CF5 L;  2E2O A;  3HZ6 A;  3KWI A;  5AQU A;  4CD1 A;  4J2A A;  3HM9 A;  1JJ2 M;  5FRN A;  3QML A;  4WQ5 C;  4CGF A;  3VMF B;  4H4M A;  3T19 A;  5GIP A;  4WQ5 A;  4CZE A;  5FPD A;  3KK1 A;  4HHT A;  2A3Z A;  4FXD A;  3RWU A;  4DTJ A;  3SYZ A;  3VGL A;  4DTO A;  2GV9 A;  3BGR A;  4CZJ A;  1WLJ A;  2W40 A;  1ATN A;  4DTU A;  4K41 A;  1CLQ A;  4FLW A;  2FSJ A;  1Q8I A;  3I56 N;  2KLA A;  3H46 O;  4DFK A;  1RTD A;  1GOA A;  3VQD A;  4NCB A;  1T7P A;  4F8R A;  4BRK A;  1IO2 A;  1N33 K;  2UUC K;  1LCU A;  1HNI A;  4CK1 A;  2DFE A;  3RTV A;  4RW7 A;  3K5N A;  4BR9 A;  1X9W A;  2P9P B;  4C8N A;  3WEE B;  1LAW A;  2NRZ A;  2Z1H A;  4FWN A;  3LAL A;  5CZ2 A;  3VQ9 A;  4BRF A;  3KLG A;  1NJX A;  1ASV A;  4BGB A;  1TGO A;  3LPT A;  4B9Q A;  5B8H A;  1CXQ A;  4LF6 K;  2FF3 B;  3VQ4 A;  1R59 O;  4OPK A;  3O5B A;  3F5T A;  4OVL A;  3DOK A;  1QTM A;  3AVN A;  2QA4 N;  3T3F A;  3C6U A;  4FJI A;  4BQL A;  2QM1 A;  4JS5 A;  4CEB A;  3KKR A;  1SKS A;  1SUQ A;  1L3U A;  3B8A X;  4O5B A;  3CG7 A;  1BDG A;  3O9U A;  4EP5 A;  1TL3 A;  1J5O A;  2QWR A;  3HM8 A;  1U47 A;  3VEW A;  2HBK A;  3FFK B;  1IKX A;  5BRE A;  3O3H A;  4A59 A;  3HYF A;  3OYD A;  4DFJ A;  1RT1 A;  2FBY A;  4M3R A;  2XRI A;  3LZI A;  1UAX A;  1U04 A;  3AVI A;  1I39 A;  3H1V X;  3KIO A;  4ID5 A;  4FW1 A;  3ZSW A;  3NDK A;  1IBM K;  4GV6 A;  3TAN A;  4DR7 K;  3WQU A;  4WFB L;  3SPZ A;  3ZEU A;  3LDS A;  5M1Q A;  2P9U B;  1FKO A;  1GOB A;  3AVG A;  5JIC A;  2OPQ A;  1S22 A;  4H5W A;  3KTQ A;  3VPZ A;  4DTN A;  3HI0 A;  5C12 A;  4M3Y A;  4YNQ A;  4BR2 A;  4CJU A;  1T44 A;  1S6P A;  3QFP A;  4OGC A;  4MQ3 A;  3VQ8 A;  3HO1 A;  5F2R A;  5BRD A;  2G8F A;  1NK5 A;  3ZT4 A;  1BIU A;  3F73 A;  1D5A A;  4BRE A;  3QEW A;  5DM7 L;  3OYM A;  4HVJ A;  4A5B A;  1U4B A;  1BQN A;  3NVM A;  3SAG A;  4BRI A;  1E4F T;  4QOZ B;  1Q18 A;  1BQM A;  1KVA A;  3F2K A;  3HL8 A;  1XNR K;  4FWM A;  3NVK A;  5D3G A;  1YHQ N;  3THX B;  1U2V B;  1RT7 A;  2F9W A;  4NYF A;  4DFM A;  1NKB A;  3Q7B A;  2YKM A;  3VQA A;  3P5J A;  4LFC K;  2E1Y A;  2HHU A;  3CFR A;  3QNN A;  1JCF A;  1BUP A;  3CJ9 A;  3RRH A;  4CJP A;  1SL1 A;  3DLR A;  2AP1 A;  3V1Q A;  2P9K A;  1VSH A;  4EZ6 A;  4QS8 A;  3AVL A;  4CJ4 A;  4DV1 K;  2IS3 A;  4RW8 A;  5F0X A;  4CFA A;  1HLU A;  3AVC A;  4GY2 B;  3HOT A;  1GLA G;  2XHB A;  4AQY K;  5LY3 A;  4NLC A;  5BR9 A;  3VEY A;  5AQK A;  2LSN A;  4FSV A;  4F3O A;  4DV2 K;  1UWB A;  3AA4 A;  2PBD A;  3C0B A;  1EX4 A;  1HRH A;  1NMD A;  3BZK A;  4Y0W A;  3JS6 A;  4JV5 K;  5J2M A;  3CJA A;  5AZI B;  3R3L A;  1NGE A;  2RN2 A;  3AAP A;  3ATU A;  5I42 A;  3CCS N;  3H1Q A;  4AH9 A;  3VA0 A;  1WAF A;  4KHP K;  4FWL A;  1JKH A;  4AM6 A;  4FM0 A;  2G8U A;  5AQX A;  3C94 A;  2A1S A;  3PX4 A;  1NK4 A;  3H3O B;  4LF4 K;  4J2E A;  4ILH A;  1HR0 K;  1XUP O;  4TSX A;  3OS1 A;  3DRP A;  2VGN A;  4PKI A;  1ATR A;  5GIN A;  4HUG A;  5AZJ B;  4CJV A;  4I9L A;  3O08 A;  3OS2 A;  3TAE A;  5DMR A;  3QFU A;  3K0S A;  1GOC A;  5AQZ A;  1VQ4 N;  5SZT A;  3OYA A;  2J4R A;  5AR0 A;  5HL7 L;  3DOL A;  2X78 A;  4CK3 A;  3AA3 A;  4CHZ A;  5HP1 A;  3U6F A;  4BR7 A;  4JI3 K;  4FJG A;  5KTQ A;  3HVR A;  3SI6 A;  1VQ8 N;  2FBX A;  1CZ9 A;  4DR5 K;  4MDA A;  4CEF A;  4NYN A;  3VEV A;  3ZX2 A;  5FRM A;  4E7K A;  4U67 L;  3DXK A;  1WB9 A;  5ELZ A;  3VGK A;  3DMJ A;  1RCH A;  3VA3 A;  4JKC A;  1M90 O;  1DGK N;  5CYQ A;  3ULE A;  4KBO A;  4I9Q A;  4GKK K;  4E89 A;  1BCO A;  3KWG A;  2GUP A;  3L4I A;  4EHU A;  3OY9 A;  5J2P A;  4ISE A;  1VQL N;  3L2U A;  1EET A;  3O9S A;  3JXU A;  2KKZ A;  2HVH A;  4JK7 A;  4CFD A;  1RT4 A;  3M8Q A;  1BI4 A;  4BR4 A;  1T6D A;  5AJ3 K;  1NGD A;  4CVN E;  3AO1 A;  1BU6 O;  3CHW A;  2CH6 A;  4EHT A;  4W5Q A;  3LP2 A;  4B08 A;  4KB1 A;  1HYZ A;  3MCA B;  4DS4 A;  4LFA K;  3AVJ A;  2G8H A;  1VQO N;  4CJW A;  4XIU A;  1QVG M;  4W5T A;  1RTJ A;  2P9L A;  2BUP A;  2KFN A;  3CI5 A;  4KHN A;  5EVZ A;  2YHY A;  2O4G A;  2G8W A;  1P8Z A;  2HMP A;  4C1N K;  4Y1C A;  1QSY A;  3PO4 A;  4DSK A;  4IDH A;  2OAN A;  3KD5 E;  2X6N A;  2I7P A;  2YCH A;  1FW6 A;  3DLL L;  5EX5 A;  3EEQ A;  3SV4 A;  5LMU K;  2IIR A;  4JKA A;  4OO1 J;  3NH2 A;  1RNH A;  4DTP A;  5AQS A;  5KRT A;  1C0G A;  4JEP A;  4DTR A;  4W5O A;  2V7Y A;  1LWF A;  2KZZ A;  2DY4 A;  5FRO A;  1XWL A;  4DQS A;  2XO7 A;  4OLA A;  3LM2 A;  2JWL A;  5AQL A;  1RDD A;  3GDQ A;  3TAP A;  3OYG A;  3QEI A;  1NGG A;  1X3M A;  3DXK B;  1RT5 A;  4I7F A;  4AHV A;  3DLB A;  1YT3 A;  4DCH A;  1YF5 L;  1BIZ A;  3QIC A;  3H08 A;  4PL7 A;  3OJU A;  1CXU A;  4KV8 A;  3I55 N;  4IOC L;  3C7N A;  3D7E O;  5KGX A;  4FCY A;  4KRE A;  3J7A P;  4AF1 A;  1YXQ A;  2OPP A;  2P51 A;  4E1N A;  1XNQ K;  2BH1 A;  4WE1 A;  1J5E K;  4Q0B A;  3OYB A;  4FPB A;  3KK3 A;  4DQ8 A;  1JL1 A;  1OH8 A;  3EN9 A;  1TUY A;  3L4Q A;  3WXK A;  3WNH A;  4EAH D;  3DXM A;  2P5O A;  4BY9 C;  2Q2R A;  1WSI A;  2V7Z A;  3N4P A;  4CHN A;  1X3N A;  4J2B A;  2A42 A;  2HHH K;  4FZZ A;  4DHY A;  2I7N A;  4JD2 A;  4KTW A;  4H0X B;  1SAZ A;  2QWP A;  4CJF A;  4E0D A;  1KXP A;  3MCP A;  1ESV A;  4FWR A;  2D0B A;  4AIL C;  4JI1 K;  3L8B A;  3D0P A;  1MWM A;  4JYA K;  2P9L B;  4HTL A;  4B1V A;  4PHT X;  5AQY A;  3GOI A;  3EYZ A;  5T7B A;  3VOV A;  3AVA A;  5KQ8 A;  4AHC A;  3E9L A;  3OYH A;  1HNZ K;  4DR3 K;  4CF1 A;  1U45 A;  4H5N A;  1QHT A;  2B6A A;  3QB0 A;  2P5G A;  1RBR A;  1U6Z A;  4MLE A;  1WUA A;  2F7T A;  4RTF D;  4XH1 A;  3A0I X;  2XY7 A;  1XQS C;  4F4K A;  2Q1N A;  4E3S A;  1ZBI A;  1RT3 A;  2QTD A;  4DU1 A;  3AV9 A;  3UKR A;  4DFP A;  4RG8 A;  1QZ6 A;  4XH5 A;  3A5M C;  1WAJ A;  1YJW N;  1VSE A;  4F9O A;  2D4W A;  5KGW A;  3SQ4 A;  3V1R A;  1KQS M;  3ZLJ A;  2NRV A;  3LP3 A;  1UA1 A;  1NLV A;  3NAE A;  2HVI A;  5HOO A;  2QWL A;  1NGA A;  3E1Y A;  3G6E N;  1JLE A;  3NF7 A;  4FK4 A;  5C15 A;  4H4O A;  1GLB G;  1L3S A;  3N4Q A;  2A1R A;  1RBS A;  3CCV N;  4BRG A;  4DSF A;  3VQP A;  4CER A;  2EX3 A;  5JLH A;  1A5X A;  1TAQ A;  3DXM B;  1EP4 A;  3WXJ A;  1C0F A;  4JHD B;  4CJT A;  4H8K A;  3AAR A;  1YAG A;  2IVP A;  1RTH A;  4N56 A;  3IKM A;  3MK6 A;  4NO7 A;  4LY7 A;  3V4I A;  2D1K A;  1NK7 A;  4I6M A;  1NK0 A;  3M6G A;  1X9S A;  5GAG P;  3V81 A;  2PYL A;  1W97 L;  4BGA A;  5BPM A;  1RDB A;  4DWI A;  4WQ4 A;  1EKE A;  3F9K A;  3FZL A;  3WXL A;  4CFC A;  3ID8 A;  1NGB A;  3PIO L;  2XY8 A;  4KFB A;  3MN9 A;  5KQD A;  1JLC A;  3MX2 A;  3CQX A;  2VQF K;  2HHV A;  1ASW A;  3IG1 A;  3O9T A;  3ZSQ A;  5E41 A;  3UKR B;  2YNH A;  4C23 A;  3ZSR A;  3U8X A;  5H1S Q;  2UUA K;  1EWR A;  3VQ6 A;  1Q9X A;  3OYE A;  4IDK A;  3P38 A;  1T6C A;  3S3M A;  2A41 A;  4RWT A;  4DU4 A;  1BGX T;  2O8C A;  4A5A A;  3PX0 A;  1JLQ A;  4AHR A;  5LJW A;  1RGI A;  4AHS A;  1I3A A;  1IBL K;  4KH4 A;  3TAB A;  4YY3 K;  4JKG B;  1G99 A;  1ZBF A;  3GL1 A;  4KO0 A;  1BO5 O;  4LC9 B;  5E26 A;  3SUO A;  4PQU A;  1BL3 A;  3OW2 M;  3OJS A;  4FPA A;  2HNY A;  5CR4 A;  2B4J A;  4DQR A;  5FDL A;  2QWO A;  3WXM B;  3EE9 A;  5C25 A;  3SJH A;  1NJY A;  3EY1 A;  3IAY A;  4B9M A;  2YHW A;  3QNO A;  3CJC A;  3MXI A;  1GLL O;  3NCI A;  1LAV A;  2YHA A;  4H0Y B;  2HHW A;  4FL9 A;  2P9I A;  1NK8 A;  3M8S A;  3HPG A;  2VCP A;  5HRR A;  3SQ2 A;  2FLO A;  4BQZ A;  4OJR A;  4BR0 A;  3KLE A;  2GTD A;  2Q3S A;  4IG0 A;  4GNI A;  4EP4 A;  2QEX N;  3QEP A;  3TSU A;  4JI4 K;  4B9S A;  1HNW K;  3HT3 A;  1NJW A;  4IOX A;  3J81 O;  2Q0U A;  4CFB A;  4ELV A;  2IC3 A;  4F2S A;  4GV3 A;  4OLB A;  3AA2 A;  4H0V B;  1NOY A;  2Q97 A;  3O3G A;  1KD1 O;  1TK0 A;  4Z4H A;  1YIT N;  3CC2 N;  2YNF A;  5BN8 A;  3I33 A;  4IEE A;  1IG9 A;  2VWJ A;  1K73 O;  3A8Y A;  2HHS A;  3CCQ N;  3OTO K;  2WBN A;  4E7I A;  4YOX A;  2PY5 A;  3V9Z A;  4B1Z A;  4CEE A;  3TSQ A;  2O8C B;  5HBM A;  2DFH A;  4A2A A;  1NJZ A;  1KC8 O;  3LM9 A;  1C1B A;  4CJE A;  4LSN A;  1N34 K;  3K9K A;  2ASM A;  2Q0R A;  2P1J A;  3QBW A;  2O8B B;  1KRP A;  3MXM A;  4FVM A;  4KHW A;  4N76 A;  4JKH A;  4CW7 B;  1GLJ O;  3UE5 A;  4YDU A;  3SMS A;  3VGM A;  1ZBH A;  1VSK A;  3PV8 A;  4A62 A;  1ZBL A;  3H45 C;  2ZE2 A;  1Q86 O;  1DEJ A;  3NF6 A;  4JI5 K;  4IJN A;  1NK9 A;  1EO1 A;  1MU2 A;  2P9N A;  3KLF A;  2ATQ A;  2ZGY A;  4B8A B;  1VSL A;  2Z1J A;  4O8U A;  4FJK A;  3MN5 A;  3O9R A;  4FK0 A;  2YKN A;  1GLD G;  3KVG A;  3VQC A;  5C2D A;  1MDU B;  5I9E B;  3VF6 A;  1VQP N;  3E9P A;  5FPM A;  4Q5V A;  5AQH A;  5BR8 K;  3LDN A;  3J80 O;  3IMX A;  1IBK K;  1H1V A;  3MMV A;  1XHX A;  3BF3 A;  4BRM A;  2GBZ A;  3OYJ A;  3NGI A;  1QSS A;  4JN4 A;  1HQU A;  4QAG A;  3CPW M;  4Z0U A;  3T1H K;  2FC0 A;  2Z1I A;  3HTV A;  1L5U A;  3BZC A;  5KPZ A;  2RHK A;  2DPN A;  2AJQ A;  3M1F A;  4X66 K;  2HBM A;  4O0J A;  3V6D A;  1DT9 A;  1REV A;  5E84 A;  3NF8 A;  4E19 A;  4DLE A;  4CED A;  3TWH A;  2IAJ A;  3IRX A;  3MED A;  1SKW A;  2ZQB A;  1VQK N;  1KLM A;  3C6H A;  4E7L A;  5KPT A;  2GEM A;  4LD0 A;  2O4I A;  1SQK A;  4JK9 A;  2NLX A;  4DLG A;  3ID6 A;  1NOZ A;  2HMI A;  5BPL A;  1NKC A;  3BY5 A;  3VQE A;  4YOT A;  5AQP A;  3TAM A;  3VTI A;  4BDZ A;  1TL1 A;  2OZM A;  4BG9 A;  4M63 C;  2F8T A;  4QCL A;  4B9L A;  2Q31 A;  1ITG A;  1WSF A;  2OTL N;  2P9N B;  4H5V A;  4FLZ A;  2YHB A;  4DUY K;  3MAQ A;  3I8D A;  4B3R K;  4KRF A;  4NXN K;  4W5R A;  2OCE A;  4FJN A;  2A6A A;  4M3W A;  1XC9 A;  3TR8 A;  4BRL A;  4G9Z A;  1TK5 A;  1W9H A;  3ZEU B;  3KZB A;  1TAU A;  1KSP A;  2R7Y A;  3V1O A;  1NGJ A;  2B5J A;  1X1P A;  4CE9 A;  3S9H A;  4A57 A;  2YHX A;  4FJ5 A;  1JCG A;  4FLY A;  3AGR A;  4M41 A;  3W0L A;  2ZJR L;  4IEI A;  3K5O A;  1TKZ A;  2DFF A;  1HX1 A;  2Y1I A;  5I3U A;  1HPZ A;  4QS9 A;  1LWE A;  1N5Y A;  3LAN A;  2GWJ A;  2VWB A;  4Z4G A;  4BRQ A;  4N5S A;  3NBP A;  3LPU A;  1VSM A;  1C1A A;  4IZ9 A;  3DYA A;  4O4G A;  4ELU A;  3CQ8 A;  4Z94 A;  3D2E A;  1QQC A;  1YTU A;  4BC5 A;  2F4V K;  3L2R A;  4KHS A;  2KTQ A;  3CCL N;  5AQQ A;  3RR7 A;  2A5X A;  4PKG A;  3P4I A;  1B92 A;  4HTU A;  4DV6 K;  2KQ2 A;  4JI6 K;  3KJV A;  4DQP A;  1JCE A;  1CZB A;  2E20 A;  2GWK A;  2P9S A;  2ZJQ L;  3TSP A;  1J9A A;  3LL3 A;  5JS2 A;  1K6Y A;  3PLA A;  3I0R A;  4CGH A;  3HOS A;  2P9K B;  2BDP A;  4YFU A;  1S1W A;  4KHQ A;  3THY A;  5EXW A;  4DQQ A;  1HKC A;  1HPM A;  3AVF A;  2BE2 A;  4ELT A;  4O8K A;  1Q81 O;  3K59 A;  3ENO A;  3SQ0 A;  2KW4 A;  2O8D A;  3VEN A;  3R1X A;  5GAD P;  5KRS A;  3SQ1 A;  5GAH P;  1YVN A;  4B3T K;  4CGG A;  1NK6 A;  3PX6 A;  3S3O A;  3H3N O;  3RRG A;  4F2R A;  4O5F A;  4PA1 A;  4PUO A;  3L3V A;  2OYQ A;  4IG3 A;  3ZCM A;  2CGJ A;  4FWP A;  2OZS A;  4K42 A;  3MDQ A;  1HKG A;  4V19 S;  3BP8 A;  3CFP A;  1N32 K;  1S6Q A;  1XC3 A;  4FO0 A;  3U9D A;  4LF7 K;  3DI6 A;  5AQV A;  3BF1 A;  1S1T A;  2D0P A;  4AHU A;  4OKE A;  3AVM A;  4FM1 A;  2E2P A;  2FXU A;  3M8P A;  1NJI O;  3AVH A;  4CK2 A;  4WF9 L;  1RBV A;  3NF9 A;  4B1U B;  1BIS A;  2RF2 A;  1F21 A;  3SBT A;  2YX6 A;  2QKB A;  2QWM A;  4B3S K;  2W6L A;  2UUB K;  1IJJ A;  1RDC A;  1LW2 A;  3HSC A;  3C65 A;  3EKS A;  3U3Y A;  4C8L A;  3P39 A;  4CJ3 A;  5FPN A;  3ULE B; 
#chains in the Genus database with same CATH homology
 3THV A;  1EXQ A;  4CEO A;  4OPK A;  4FLV A;  5HLF A;  1JLG A;  4GMJ B;  3HVT A;  1G15 A;  1RDB A;  3DLG A;  4OVL A;  3OYK A;  2IOC A;  1S9E A;  3DOK A;  4DSI A;  1QTM A;  3AVN A;  4DWI A;  1DLO A;  4KHU A;  3T3F A;  2Y1J A;  1T8E A;  3C6U A;  4FJI A;  1EKE A;  3F9K A;  4M3T A;  4CIG A;  4JS5 A;  3VN5 A;  4CEB A;  3KK2 A;  2VG5 A;  3KKR A;  4I2Q A;  4CFC A;  1SKS A;  1SUQ A;  2E6L A;  3E01 A;  2IDO A;  4O5B A;  3V9X A;  3CG7 A;  1L3U A;  2PZS A;  4EP5 A;  2XY8 A;  1TL3 A;  1J5O A;  1BI4 B;  4KFB A;  1U47 A;  3DLK A;  4KAZ A;  1JLC A;  2X74 A;  1IKX A;  4DMN A;  4C8K A;  3O3H A;  2HHV A;  3L2W A;  1ASW A;  3IG1 A;  3VQ5 A;  3HYF A;  3ZSQ A;  3OYD A;  3K5M A;  4CGI A;  1RT1 A;  5EU7 A;  4DSE A;  4DFJ A;  4FK2 A;  4B3O A;  4ZHR A;  5E41 A;  2YNH A;  4CGJ A;  4CCH A;  4B9N A;  3AO3 A;  3ZSR A;  3DM2 A;  3HPH A;  4CIF A;  4ZTF A;  1LW0 A;  2FBY A;  4Z4F A;  3VQ6 A;  3ZSZ A;  5J2N A;  1Q9X A;  4M3R A;  2XRI A;  3LZI A;  3OYE A;  1UAX A;  1U04 A;  1VRT A;  3AVI A;  1I39 A;  4IDK A;  1IKW A;  1W0H A;  3KIO A;  4ID5 A;  1RT6 A;  4FW1 A;  4BDY A;  1FXX A;  3ZSW A;  3SZ2 A;  2XY5 A;  3NDK A;  3S3M A;  4DU4 A;  3ZSO A;  3ASM A;  3IS9 A;  3PO5 A;  3TAN A;  3ZSV A;  4JS4 A;  3HJF A;  4CJK A;  5HRP A;  1DTQ A;  4HUE A;  1BGX T;  3RMA A;  3SPZ A;  2Z1G A;  1FK9 A;  2RPI A;  1JLQ A;  3LDS A;  3PX0 A;  4CEQ A;  4AHR A;  4FZY A;  4B9T A;  2W42 A;  4PWD A;  3RMD A;  1FKO A;  4CF0 A;  1GOB A;  5SWM A;  4AHS A;  1I3A A;  2RKI A;  2OPQ A;  3AVG A;  3TAB A;  4C8M A;  1BCM A;  4CHO A;  3KTQ A;  4DTN A;  4M3Y A;  1LWC A;  3NH1 A;  4YNQ A;  1C0M A;  3K2P A;  4CJU A;  1ZBF A;  4DG1 A;  4KO0 A;  4CJS A;  2NUB A;  4M3X A;  1S6P A;  2KZM A;  3VQ7 A;  3NGY A;  3SUO A;  1JLF A;  1RDA A;  4OGC A;  4PQU A;  4MQ3 A;  1BL3 A;  1D8Y A;  4HCB A;  2OA8 A;  3VQ8 A;  3OJS A;  3HO1 A;  1U49 A;  2X6S A;  3DRR A;  2HNY A;  2G8F A;  1NK5 A;  3ZT4 A;  1BIU A;  3F73 A;  1D5A A;  2B4J A;  4DQR A;  3QEW A;  1B9D A;  5FDL A;  3OYM A;  4HVJ A;  3NFA A;  4IBN A;  1U4B A;  3QEV A;  3BDP A;  1BQN A;  1IKV A;  3ZT0 A;  5C25 A;  1NJY A;  4Z4I A;  4QOZ B;  5C42 A;  3EY1 A;  3IAY A;  1BQM A;  1KVA A;  4BAC A;  4DQI A;  2DTU A;  2HNZ A;  3HL8 A;  4B9M A;  5D3G A;  3ZSY A;  3QNO A;  4DTS A;  1RT7 A;  3WNG A;  3MXI A;  1U48 A;  3NCI A;  4KHY A;  3DLE A;  4NYF A;  4DFM A;  2YV0 X;  1LAV A;  1NKB A;  2YKM A;  2ZD1 A;  3O3F A;  3VQA A;  3P5J A;  4CIE A;  3D45 A;  2YHA A;  2HHW A;  2HHU A;  2JLE A;  3M8S A;  3TAG A;  5J1E A;  3HPG A;  1NK8 A;  3CFR A;  3V9U A;  1VK0 A;  5HRR A;  3SQ2 A;  2EHG A;  4DF8 A;  3QNN A;  1KVC A;  1UOC A;  1XC9 A;  4OJR A;  3KLE A;  3ULD A;  1SV5 A;  1C0T A;  4HCC A;  2Q3S A;  3RRH A;  1WSG A;  4BWM A;  4IG0 A;  1WNS A;  2F8S A;  4K8Z A;  4CJP A;  1VSF A;  4EP4 A;  3DLR A;  1SL1 A;  3V1Q A;  4KTQ A;  3QEP A;  4B9S A;  4Z4C A;  1VSH A;  3HT3 A;  3TAR A;  4FLX A;  3AVL A;  4CJ4 A;  3G0Z A;  1NJW A;  4EZ6 A;  1Z26 A;  3VQQ A;  4RW6 A;  4CFB A;  2IS3 A;  4ELV A;  2IC3 A;  3PUF A;  4RW8 A;  4CFA A;  4DSJ A;  4F2S A;  4K8X A;  4OLB A;  1LV5 A;  3AA2 A;  3AVC A;  2D0C A;  3JYT A;  1NOY A;  3O3G A;  3ZT1 A;  3AVK A;  2XHB A;  5JS1 A;  1TK0 A;  4Z4H A;  4KPY A;  2LSN A;  4F3O A;  3NH0 A;  1UWB A;  3AA4 A;  4MFB A;  3UIQ A;  1EX4 A;  1HRH A;  4AHT A;  4M42 A;  1L3V A;  2YNF A;  5J2M A;  1IG9 A;  3AO4 A;  1KFD A;  3CM5 A;  4KKO A;  2RN2 A;  2VWJ A;  2HHS A;  3LP1 A;  1Q9Y A;  3MEE A;  3M8R A;  1JLB A;  4E7I A;  2VG7 A;  4I2P A;  3OYI A;  5I42 A;  3SNN A;  2PY5 A;  4OPJ A;  1RIL A;  4AH9 A;  4E1M A;  3VA0 A;  2BAN A;  1A5V A;  1WAF A;  3OYL A;  3LZJ A;  3V9Z A;  4CEE A;  1JKH A;  5HBM A;  2DFH A;  4FM0 A;  1NJZ A;  2G8U A;  4DF4 A;  1VSJ A;  4FJM A;  3C94 A;  2QKK A;  1C1B A;  4OKJ A;  2A1S A;  4LSN A;  4CJE A;  3PX4 A;  5KI6 A;  3SPY A;  3P1G A;  3AVB A;  3O4N A;  1NK4 A;  4E7H A;  3OYF A;  1HQE A;  4FLT A;  2P1J A;  1O1W A;  1KRP A;  4FJH A;  4J2E A;  4LH4 A;  3MXM A;  4FVM A;  4KHW A;  4TSX A;  3OS1 A;  3QER A;  4N76 A;  3DRP A;  3MEG A;  3OYC A;  4CF2 A;  1C0U A;  4HUG A;  3L3U A;  1ZBU A;  4CJV A;  4GVM A;  1ZBH A;  4I9L A;  3OS2 A;  3TAE A;  1VSK A;  5DMR A;  3PV8 A;  3FFI A;  1ZBL A;  1GOC A;  4RW4 A;  4FJX A;  5SZT A;  3OYA A;  1WSH A;  3ALY A;  4DU3 A;  3DOL A;  2X78 A;  2ZE2 A;  3ZSX A;  2VG6 A;  4CK3 A;  1UA0 A;  1SKR A;  3AA3 A;  1QE1 A;  3WNF A;  4CHZ A;  3NF6 A;  5HP1 A;  1SL0 A;  3U6F A;  1NK9 A;  4FJG A;  1MU2 A;  1S1V A;  5KTQ A;  3KLF A;  3HVR A;  3SI6 A;  3AO2 A;  1KFS A;  2ATQ A;  2FBX A;  1CZ9 A;  2YNG A;  4CEF A;  4OGE A;  4NYN A;  4IFY A;  4B8A B;  5FRM A;  1VSL A;  2Z1J A;  4FJK A;  4E7K A;  1VRU A;  1KLN A;  2GUI A;  4FK0 A;  2YKN A;  4C8O A;  4FJJ A;  1ASU A;  3VQC A;  2BGG A;  4DTM A;  4BE1 A;  4BDP A;  3DMJ A;  4CF8 A;  4BE0 A;  1RCH A;  3KD1 E;  2G8I A;  3VA3 A;  5CYQ A;  4Q5V A;  1HJR A;  1YTA A;  4I9Q A;  3S3N A;  4CHY A;  1XHX A;  4E89 A;  5J2Q A;  2GBZ A;  1HYV A;  1BCO A;  4CHP A;  3OYJ A;  3NGI A;  2ETJ A;  4NCG A;  1JXE A;  2YNI A;  4CJQ A;  1QSS A;  1QSL A;  1KCF A;  3OY9 A;  5J2P A;  1S5J A;  1HQU A;  3G10 A;  1TK8 A;  4J2D A;  1TKD A;  4N41 A;  3C6T A;  1NKE A;  3L2U A;  1EET A;  2VWK A;  4JLH A;  4QAG A;  4Z0U A;  4M45 A;  2FC0 A;  4CJ5 A;  2Z1I A;  4UQG A;  2HVH A;  4CFD A;  1L5U A;  1RT4 A;  3M8Q A;  1KVB A;  1BI4 A;  5K14 A;  4N47 A;  2OPR A;  1FKP A;  3HST B;  1SL2 A;  3AO1 A;  2AJQ A;  4W5Q A;  3LP2 A;  1L3T A;  4O0J A;  4B08 A;  3V6D A;  4KB1 A;  5CY4 A;  1HYZ A;  4DSL A;  1REV A;  3RMC A;  3K57 A;  1IKY A;  3C95 A;  4DS4 A;  3KKS A;  3NF8 A;  4E19 A;  3NE6 A;  1J53 A;  3AVJ A;  4DLE A;  2G8H A;  4CED A;  2I5J A;  3TWH A;  2IAJ A;  3OYN A;  1JLA A;  3SV3 A;  4CJW A;  3IRX A;  3MED A;  1X9M A;  2ZQB A;  1SKW A;  1KLM A;  4CGD A;  4XIU A;  3NGZ A;  4W5T A;  3K5L A;  4E7L A;  1RTJ A;  4OKK A;  4LD0 A;  1RBT A;  1WSJ A;  2O4I A;  2KFN A;  3SUQ A;  4KHN A;  2O4G A;  2G8W A;  4Y1C A;  1QSY A;  4DLG A;  4FJ9 A;  1NOZ A;  2HMI A;  3PO4 A;  4DSK A;  4W5N A;  1NKC A;  4EZ9 A;  1HYS A;  3HP6 A;  2HND A;  4CEZ A;  3KD5 E;  2X6N A;  3SUN A;  4B9U A;  1TVR A;  2WON A;  3LP0 A;  1T03 A;  3VQE A;  4CHQ A;  4O55 A;  5CYM A;  5C24 A;  3KLH A;  3SUP A;  3QIO A;  3TI0 A;  2HHT A;  1TKX A;  3TAM A;  3LAM A;  4BDZ A;  3SV4 A;  4IKF A;  5HRS A;  3DLH A;  1TL1 A;  2OZM A;  3K58 A;  3NH2 A;  1RNH A;  2F8T A;  4QCL A;  4B9L A;  4DTP A;  4CEC A;  5KRT A;  1S1U A;  4DTR A;  3B6O A;  1S1X A;  1JL2 A;  1ITG A;  1KTQ A;  4W5O A;  1J54 A;  1LWF A;  1WSF A;  1YVU A;  3TAF A;  3OVN A;  4ID1 A;  2KZZ A;  2DY4 A;  5FRO A;  4FLZ A;  2YHB A;  1XWL A;  3JSM A;  4JRQ A;  4DQS A;  2XO7 A;  3MAQ A;  1DTT A;  3I8D A;  4FJ7 A;  4KRF A;  4OLA A;  3KLI A;  3LWM A;  4W5R A;  1RDD A;  4FJN A;  2G8K A;  4M3W A;  4LH5 A;  3TR8 A;  2QXF A;  4R5P A;  4O0I A;  3V9W A;  3OYG A;  5HRO A;  3QEI A;  3TAP A;  1W9H A;  1TK5 A;  3RR8 A;  3VQB A;  1RT5 A;  3QO9 A;  4I7F A;  1KSP A;  1TAU A;  2E6M A;  4AHV A;  2R7Y A;  3DLB A;  3V1O A;  4M3Z A;  1YT3 A;  2B5J A;  3QLH A;  1BIZ A;  3QEX A;  1X1P A;  4CE9 A;  3S9H A;  1C1C A;  3H08 A;  4LSL A;  3QET A;  3OJU A;  3HPO A;  4FJ5 A;  1CXU A;  4FLY A;  4KV8 A;  2D5R A;  3TAQ A;  4M41 A;  5KGX A;  4FCY A;  3T1A A;  3LAK A;  3K5O A;  4ICL A;  4KRE A;  1S9G A;  1TKT A;  1TKZ A;  2DFF A;  2OPP A;  2P51 A;  1WN7 A;  3L2V A;  4E1N A;  2Y1I A;  2OPS A;  3QES A;  4WE1 A;  4Q0B A;  5I3U A;  1HPZ A;  3QIP A;  2G8V A;  1LWE A;  3OYB A;  3KK3 A;  1N5Y A;  2D0A A;  3LAN A;  2IGI A;  4CF9 A;  1JL1 A;  3ITH A;  4FW2 A;  3EZ5 A;  4N5S A;  4Z4G A;  3NBP A;  3LPU A;  1VSM A;  1C1A A;  5CZ1 A;  3DYA A;  3WNH A;  2ITG A;  4O4G A;  2P5O A;  4ELU A;  3L2Q A;  1WSI A;  3CQ8 A;  1R0A A;  3MEC A;  1QQC A;  4NCA A;  1YTU A;  4CHN A;  1N6Q A;  4J2B A;  1C6V A;  1QS4 A;  3ZT2 A;  1B9F A;  3QIN A;  3L2R A;  4KHS A;  4FZZ A;  2KTQ A;  2HHX A;  2F96 A;  3RR7 A;  3HK2 A;  4KTW A;  1BHL A;  1B92 A;  3NHG A;  4HTU A;  3SCX A;  4CJF A;  4E0D A;  4PY5 A;  2KQ2 A;  4BWJ A;  4FLU A;  3AA5 X;  4G1Q A;  3KJV A;  4DQP A;  1VSD A;  4KB0 A;  3B6P A;  1CZB A;  3HP9 A;  4AIL C;  2D0B A;  4DS5 A;  4FM2 A;  3L8B A;  3D0P A;  3V9S A;  1XHZ A;  1D9F A;  1Z25 A;  3ISN C;  1J9A A;  5JS2 A;  1K6Y A;  3I0R A;  4CGH A;  3EYZ A;  5T7B A;  2JGU A;  3O4Q A;  3WNE A;  3AVA A;  4Z4E A;  3I0S A;  4AHC A;  2BDP A;  4YFU A;  4B8C A;  3PY8 A;  1S1W A;  1Y97 A;  3OYH A;  4KHQ A;  2KFZ A;  1WSE A;  2FBT A;  4CES A;  1A5W A;  4CF1 A;  4L8R B;  4DQQ A;  1U45 A;  1HNV A;  1QHT A;  4IFV A;  4FXD A;  3AVF A;  2B6A A;  2BE2 A;  4E7J A;  2P5G A;  1IH7 A;  1RBR A;  4GW6 A;  4JRP A;  2XY6 A;  4ELT A;  3K59 A;  3SQ0 A;  4FJ8 A;  3ZT3 A;  2HW3 A;  2KW4 A;  4BE2 A;  4ZTJ A;  2E4L A;  1RTI A;  5KRS A;  1ZYQ A;  2XY7 A;  3SQ1 A;  4CGG A;  4F4K A;  4E3S A;  2WOM A;  1ZBI A;  1RT3 A;  4F3T A;  1NK6 A;  3SJJ A;  3PX6 A;  3S3O A;  4DU1 A;  3AV9 A;  3HXM A;  5DK5 A;  1TV6 A;  3RRG A;  2FBV A;  4F2R A;  3OS0 A;  4DFP A;  4KI4 A;  4CJL A;  4RG8 A;  3CM6 A;  5HRN A;  4PA1 A;  4PUO A;  3L3V A;  1WAJ A;  2OYQ A;  4IG3 A;  3ZCM A;  1VSE A;  2PYJ A;  2QK9 A;  4DTX A;  2OZS A;  5KGW A;  3SQ4 A;  4FZX C;  1HMV A;  4J2A A;  3HM9 A;  5FRN A;  3V1R A;  3CFP A;  3LP3 A;  1UA1 A;  4CGF A;  1S6Q A;  3NAE A;  4CEA A;  1XI1 A;  2HVI A;  4Y1D A;  3DI6 A;  4H4M A;  3T19 A;  2HB5 A;  1JLE A;  1S1T A;  4RW9 A;  1T05 A;  4AHU A;  3NF7 A;  3KK1 A;  4FYD A;  4OKE A;  3CFO A;  4HHT A;  4FK4 A;  4H4O A;  3AVM A;  4FM1 A;  1L3S A;  1RBU A;  1D9D A;  4HUF A;  3SYZ A;  4DTJ A;  3RWU A;  4DTO A;  3M8P A;  2GV9 A;  1RBS A;  3BGR A;  2A1R A;  3AVH A;  1WLJ A;  1VSI A;  4DSF A;  4FJL A;  4CK2 A;  3VQP A;  3MXJ A;  4CER A;  4B9V A;  2EX3 A;  4DTU A;  1A5X A;  4O44 A;  1RT2 A;  1TAQ A;  3DRS A;  4FLW A;  3RMB A;  1CLQ A;  1Q8I A;  4KTZ A;  1EP4 A;  1RBV A;  3NF9 A;  4DFK A;  3LWL A;  1RTD A;  1BIS A;  1GOA A;  2RF2 A;  1F21 A;  1JXB A;  3VQD A;  1T7P A;  4NCB A;  4KI6 A;  4CJT A;  4M3U A;  4F8R A;  4H8K A;  2QKB A;  1IO2 A;  1HNI A;  3U3G A;  1RDC A;  2DFE A;  3AO5 A;  1LW2 A;  4CK1 A;  3P83 D;  1RTH A;  3RTV A;  4N56 A;  4CJR A;  4RW7 A;  3A2F A;  3K5N A;  1X9W A;  1LAW A;  4C8N A;  5CZ2 A;  3U3Y A;  2Z1H A;  4LY7 A;  3LAL A;  3CYM A;  3VQ9 A;  3KLG A;  2HHQ A;  3V4I A;  1NJX A;  1ASV A;  1NK7 A;  4C8L A;  1TGO A;  3LPT A;  1NK0 A;  1CXQ A;  4CJ3 A;  3VQ4 A;  1X9S A;  3V81 A;  2PYL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...