1HYZA

Hiv integrase core domain complexed with a derivative of tetraphenyl arsonium.
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
154
structure length
142
Chain Sequence
SPGIWQLDTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAAWWAGIKQEFGQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGGYSAGERIVDIIATDIQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords INTEGRASE
publication title Identification of a small-molecule binding site at the dimer interface of the HIV integrase catalytic domain.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 51
structure length 142
sequence length 154
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2001-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1hyzA00
1RBTA 4DQIA 1NOZA 2YKNA 2BE2A 5SZTA 3DYAA 4EP5A 1HPZA 1RNHA 4ICLA 1NKBA 4I2PA 3EY1A 4FJ9A 2RF2A 2GV9A 4F3OA 1TK8A 1KVAA 1VSHA 1HMVA 4J2DA 3I0SA 1SUQA 4FLXA 2EHGA 3QLHA 3LWLA 1L3SA 3TABA 2IS3A 1JL1A 4O4GA 4KHUA 2A1SA 1CZ9A 3QEIA 1A5XA 3S3NA 1TKZA 3DRRA 2BDPA 1CLQA 4CGIA 4KHSA 1DTQA 4JS4A 3QETA 3QO9A 2HHQA 2KZZA 1RDBA 1JKHA 1S9GA 4FM1A 3V9WA 4ELVA 4FJIA 1TVRA 2D0AA 3F9KA 1ASWA 4FK4A 3QERA 4FJMA 2QKBA 4CEAA 4OPJA 4AHTA 2KQ2A 3C6UA 1EXQA 3ZCMA 3NH0A 4FLYA 3ZT2A 3S9HA 4FZXC 1WSHA 3OS0A 1L3VA 4B9MA 1QS4A 4CECA 1C6VA 1L3TA 1IKVA 1ZBFA 1S6PA 4N47A 4Z4FA 4OGEA 1G15A 3ZSWA 4BACA 4Q5VA 3IAYA 4CIEA 4DSKA 3HSTB 2HHSA 2HVIA 4BWJA 1IKYA 2OPPA 3LALA 4CESA 4CK2A 3OYFA 1C1CA 3QIPA 4TSXA 1RBVA 1D9DA 1HYSA 4E0DA 1D5AA 3KKSA 2B4JA 2GUIA 3OVNA 2XY6A 3VQEA 4DSIA 3SQ1A 2ZD1A 1JXBA 1S1WA 1VRTA 3MXJA 3HJFA 2OPSA 4CJRA 4LD0A 1VSFA 3F73A 3V9SA 3RMDA 1BIUA 1KSPA 1T7PA 3AVLA 3OYBA 5HBMA 3AA4A 3LAKA 3K5MA 1L3UA 4I9LA 5KGXA 1BI4A 1YTAA 2HNZA 3M8PA 4KV8A 4DTXA 4W5TA 2IGIA 4L8RB 3SQ0A 1TGOA 4E3SA 1RT2A 1WSEA 4NYFA 3S3MA 1A5VA 2QXFA 3SJJA 4FXDA 4OKEA 3T19A 4CJUA 3HT3A 1VSKA 2D0CA 3VQBA 4B9NA 4ELUA 1JLGA 4FZZA 3AO2A 1GOCA 1RTHA 1TAUA 1Q8IA 4PUOA 4R5PA 3AVIA 4KHWA 3WNHA 3TAQA 2E6MA 2DFFA 5KRTA 3RTVA 1QSSA 3U6FA 4CEBA 3V9ZA 4AHVA 1C0UA 1NK5A 3OY9A 2KZMA 2DY4A 4KO0A 3C94A 4LH4A 4W5QA 4C8KA 4FJ5A 2IOCA 3KIOA 1WSFA 4M3UA 3OYIA 2XRIA 3RMBA 3RR8A 4C8LA 3HO1A 3CG7A 4CK3A 3KLEA 3O3GA 3QEPA 4FLWA 1HRHA 4KHQA 1K6YA 4FLUA 5HLFA 3KLIA 3RMCA 4FJ7A 2X6NA 1Z26A 3ULDA 3ALYA 1BI4B 4KI6A 4CIGA 2RN2A 1CXQA 3DMJA 4W5OA 4E7HA 5HROA 4FJXA 2E6LA 3K58A 3KK1A 3O4QA 4FJNA 2Z1IA 3AVJA 4ID5A 2ZQBA 4Y1CA 4DTOA 1XHZA 2HHTA 1B9DA 1LWEA 1KCFA 1RTIA 1SKRA 4KB1A 1VSIA 4FJKA 4OLBA 4AHCA 3M8SA 2P5GA 3T3FA 4IKFA 4KTQA 1TV6A 1JXEA 3L2VA 3V1QA 3NDKA 3AVCA 1C1BA 2F96A 3ZSXA 5HRRA 4FCYA 4FJJA 1WAJA 4DTJA 1XC9A 3RRHA 4CF0A 4B9UA 1LAWA 1XHXA 3OJUA 1U48A 1D8YA 4F2RA 1RDDA 3BDPA 5J1EA 3HP9A 4BDPA 3RRGA 4FJGA 4CEOA 4ZTFA 4CJKA 3E01A 1BQNA 3ASMA 1LWFA 1NJXA 4N41A 3DLHA 4I9QA 4W5RA 3OS1A 1U45A 5CYQA 3LWMA 1ZBLA 3WNEA 4LH5A 4Z4EA 2Z1GA 4JRPA 1KVBA 5J2QA 3BGRA 4DTSA 2F8SA 3CFPA 5E41A 1B9FA 3ZT4A 3OYMA 1X1PA 3ZSOA 4JS5A 1SKSA 2G8KA 3SV4A 4DU4A 3OYHA 3SQ2A 4CJVA 4GVMA 3C6TA 4CGDA 4DSEA 2FBVA 3DLRA 3IRXA 3A2FA 4M3TA 4RW7A 3HPOA 3ZSVA 4CHPA 3MXMA 2E4LA 3VQPA 3OYGA 3DLBA 2KFNA 3IG1A 3VQ8A 4CJTA 3NH1A 2AJQA 4B9LA 1YT3A 2KW4A 2O4GA 1NK7A 3HVTA 3SYZA 1EX4A 3LP3A 3QEWA 4FK2A 4M42A 4OGCA 4CGJA 1XWLA 4CFDA 4NCAA 3HM9A 1X9MA 1SL2A 1WN7A 4PQUA 3AVAA 1S1XA 3FFIA 2QKKA 4NCBA 4HHTA 4DTRA 4DS4A 2ITGA 1EKEA 1I39A 3AVMA 4KFBA 4FLVA 1NKEA 4HTUA 4FJHA 4DQSA 1LAVA 4CERA 4CGHA 3PV8A 3QIOA 3WNGA 1ZBUA 4Z0UA 3U3YA 1YTUA 2B5JA 4OKKA 4CE9A 4C8OA 4DTPA 5KI6A 3OYCA 1LW2A 1TL3A 4CJQA 1Q9XA 1QSLA 2HW3A 3O4NA 3SQ4A 4DQRA 2PYJA 1CXUA 4NCGA 4HVJA 4H8KA 4DFKA 3D45A 3K59A 2HB5A 4CEZA 4E89A 4CCHA 4M3RA 3LANA 4FJLA 3L2RA 1ITGA 4RW6A 4DF8A 1TKDA 5DMRA 2KTQA 4AH9A 2BGGA 5CZ2A 2F8TA 2WOMA 2W42A 3TARA 4DTUA 4M45A 2VG7A 3L8BA 1TAQA 2X6SA 3AVHA 4BDYA 3TAFA 4LY7A 4B08A 1VSJA 1MU2A 3LZIA 1L5UA 3NBPA 2PYLA 4CHOA 3L2WA 1A5WA 2P51A 3DRSA 4KTWA 3NF7A 3WNFA 4CF9A 1RILA 4BE1A 3HPHA 3HXMA 4CJ4A 3EYZA 4NYNA 1N5YA 3T1AA 2P5OA 2FC0A 3L3UA 4CF1A 4DQQA 1NK0A 4CF8A 4CEFA 4MQ3A 3K5NA 4AILC 2KFZA 5K14A 5JS2A 3NF8A 1VRUA 2VWKA 1TKTA 5C24A 5HRSA 5SWMA 3SNNA 1U4BA 3VQ9A 1JLAA 3D0PA 3SV3A 4CGGA 3KD5E 1S1UA 4OLAA 4YNQA 3CFRA 2ETJA 1RT7A 1WAFA 1S6QA 1J54A 1GOBA 3DOKA 3HPGA 4CFBA 4E7LA 3L2UA 5KRSA 5KGWA 1JLQA 4HCCA 1DLOA 3OYNA 3NF6A 3ZSRA 2X78A 3DLGA 1EP4A 3S3OA 4QOZB 3I0RA 3VA3A 5D3GA 1Q9YA 3LP0A 5I42A 4KTZA 4CJLA 5J2MA 3KD1E 3OYDA 3V1OA 1KLNA 3UIQA 2BANA 4Q0BA 3OJSA 1S1TA 4B8AB 3ZT3A 4F4KA 1IKXA 4ZTJA 3G0ZA 2YHAA 4PA1A 1HJRA 3ZSQA 3HL8A 4CEQA 3H08A 4CHZA 3P1GA 4N56A 3CQ8A 3MAQA 4ZHRA 4FZYA 4CHNA 4CIFA 1BIZA 5HP1A 4DSJA 2ZE2A 4I7FA 3B6PA 4KHYA 2NUBA 4DF4A 3VQAA 4E7JA 2HVHA 1XI1A 4K8ZA 2OPQA 3QINA 3VQ5A 1JLBA 4FLZA 4DWIA 1S9EA 4BDZA 4O55A 3SCXA 4LSNA 2EX3A 4WE1A 1NK4A 2XHBA 1TKXA 3DLKA 2HHXA 3DLEA 3SUQA 2DFEA 2OA8A 1GOAA 3P83D 2IAJA 3MEDA 4DU3A 4DQPA 2FBXA 5J2NA 4BE2A 3PO4A 1UA0A 3V1RA 3NGZA 4IG0A 1BCMA 3K5LA 4HUGA 3ZT0A 5EU7A 4BE0A 2YNIA 1REVA 4HUEA 4G1QA 3RR7A 3SUPA 1NK6A 4I2QA 3V4IA 4K8XA 1W9HA 4UQGA 3P5JA 2VG5A 3SZ2A 4DSFA 3L2QA 3MEEA 1HYVA 4RW4A 1SKWA 4GW6A 1VSMA 2HNYA 1UA1A 3TAMA 1FKPA 4KKOA 4BWMA 3NAEA 3MXIA 2OYQA 2O4IA 3JSMA 4DFJA 3PX6A 4KRFA 5T7BA 2QK9A 2D5RA 4KPYA 3VQCA 4CGFA 4DTMA 3KTQA 3LP1A 3IS9A 3SPZA 4FK0A 4PWDA 1KFDA 3PUFA 1J5OA 4J2BA 4E7KA 1U49A 4RW9A 3RMAA 1CZBA 1Y97A 3QEXA 3AVFA 4IDKA 4RW8A 4AHRA 4FM2A 4FW1A 4YFUA 2FBTA 2HMIA 4F2SA 5FRNA 1N6QA 2D0BA 1VSEA 1BHLA 4Z4IA 2Z1JA 2YKMA 4M3XA 1RTJA 3AVBA 4CHQA 3K5OA 2JLEA 4HCBA 4AHSA 3TAEA 1RBSA 1WLJA 4CJSA 4CFAA 3CYMA 3ZSYA 3MECA 1VSDA 3AA3A 1JLEA 1RCHA 1RT6A 4M3ZA 4ELTA 3NGYA 1RBRA 3TR8A 1R0AA 4EZ6A 1ASVA 1Z25A 1NJZA 1QQCA 5C25A 1C0MA 3HVRA 5KTQA 3K2PA 3PO5A 4XIUA 2OZSA 3HK2A 3C95A 3B6OA 3KJVA 3O3HA 2YNFA 3TI0A 3ISNC 3KKRA 3SPYA 4B9SA 4AHUA 1IG9A 1HYZA 3OYEA 3QNOA 5FDLA 3QESA 1DTTA 3M8RA 3QNNA 3AV9A 2IDOA 3KK3A 1RTDA 4FYDA 1FK9A 3DM2A 4FW2A 1RDAA 4IFVA 4B9VA 3NCIA 4DTNA 4C8MA 1TL1A 3VA0A 3SI6A 1KVCA 2JGUA 1KLMA 1U04A 2YHBA 3LPTA 1O1WA 3NH2A 4KAZA 4CJ5A 3OYAA 3RWUA 4DU1A 4CJ3A 4FLTA 3KK2A 2ATQA 4EP4A 1T8EA 4F8RA 3CM5A 1HQEA 2VG6A 1UWBA 3ZT1A 4FVMA 4DLGA 1BGXT 4M41A 3VN5A 3QEVA 4Z4GA 4DLEA 4O0IA 1ZYQA 3SUOA 1C1AA 2B6AA 3ITHA 3VQQA 1ASUA 4DMNA 2G8FA 5I3UA 3TAPA 3O3FA 3KLFA 3AVNA 1SL1A 3LAMA 3V6DA 2A1RA 3OYKA 2LSNA 2HHVA 1QSYA 4O5BA 4MFBA 1BQMA 2XY5A 1RDCA 3CM6A 4IFYA 4OJRA 1NJYA 3AO1A 1X9SA 3AVGA 3TAGA 1WSIA 1S1VA 2X74A 1D9FA 3AO4A 4W5NA 3PX4A 1QHTA 1RT4A 3CFOA 4DFPA 4CHYA 1NJWA 1RBUA 1JL2A 4CJPA 4OPKA 4J2EA 3DOLA 2YNGA 3LP2A 1VK0A 3VQ7A 1TK5A 4B8CA 2HHWA 3ZSZA 1QTMA 4CJWA 2YNHA 3AO3A 1KTQA 5HRNA 3OS2A 4FJ8A 1W0HA 2WONA 4H4MA 3U3GA 3VQDA 1NKCA 4KHNA 3OYLA 5FRMA 3TWHA 2HNDA 4CJEA 4E7IA 1LV5A 3HYFA 3LPUA 3AO5A 4IG3A 4O0JA 2G8HA 5FROA 2G8UA 1C0TA 1NK9A 4OKJA 4DSLA 2XY8A 5HRPA 4F3TA 1KFSA 1HNIA 1VSLA 1NOYA 4RG8A 3NGIA 3V9XA 4N76A 3NHGA 4LSLA 1RT3A 1JLCA 4QAGA 2Y1IA 1SL0A 2PZSA 2FBYA 3K57A 4FM0A 4DFMA 4GMJB 3LDSA 4CF2A 4B3OA 3MEGA 3AVKA 1S5JA 2GBZA 3M8QA 1BL3A 2XY7A 1RT5A 4DG1A 3JYTA 3DRPA 4E1MA 1FKOA 1I3AA 4M3WA 4KREA 2RKIA 3HP6A 1WSJA 2Q3SA 2R7YA 3OYJA 4DS5A 1RT1A 5CZ1A 2I5JA 2G8VA 1B92A 3DI6A 3NFAA 4C8NA 1T05A 3PY8A 1HQUA 4KB0A 1FXXA 3THVA 5C42A 5J2PA 4OVLA 1J53A 4E1NA 4EZ9A 3G10A 4CEEA 4N5SA 2VWJA 3LZJA 1NK8A 1IH7A 1JLFA 3EZ5A 3SUNA 2RPIA 4PY5A 2OZMA 3VQ4A 2PY5A 4HUFA 4CFCA 4E19A 4CK1A 4O44A 4KI4A 3VQ6A 3TANA 3PX0A 2DFHA 2G8IA 2Y1JA 1IO2A 4Y1DA 2G8WA 2XO7A 4J2AA 5JS1A 4H4OA 3L3VA 3NE6A 3V9UA 2DTUA 1UAXA 4JLHA 5CYMA 4JRQA 4CEDA 1J9AA 1HNVA 1F21A 5CY4A 3V81A 1BCOA 1ZBHA 4CJFA 4B9TA 1ZBIA 1WSGA 4Z4HA 1TK0A 2OPRA 1KRPA 4Z4CA 3KLGA 3AA5X 1X9WA 1LW0A 4QCLA 1QE1A 2P1JA 1EETA 4IBNA 1LWCA 1IKWA 1BISA 1WNSA 4M3YA 1YVUA 1SV5A 1U47A 5DK5A 3I8DA 2HHUA 1UOCA 2IC3A 3NF9A 4ID1A 2YV0X 2Z1HA 1T03A 3AA2A 3KLHA
chains in the Genus database with same CATH superfamily
2NLXA 3MX5A 3VMFB 3EE9A 4DQIA 3DXMA 3J80O 3O1BA 3DYAA 4LFAK 4ICLA 4I2PA 1V4TA 3JXUA 4RTFD 4FJ9A 2F4VK 2P9SB 4F3OA 1TK8A 4CBXA 4J2DA 3A5NC 3LWLA 1Q7YO 3S3NA 1TKZA 4JKFA 2NNWA 2HHQA 1S9GA 1ASWA 1SAZA 2QKBA 3ULEB 1EXQA 4FLYA 4BQZA 4DHYA 1C6VA 1L3TA 4N47A 4NLBA 1ATRA 4Q5VA 2H3GX 4FWSA 4CZMA 3C6HA 2NRRA 4CK2A 1VQLN 1RBVA 1T44A 1D9DA 1HYSA 3KKSA 3OVNA 4GNIA 1WUAA 3SQ1A 2UXBK 1JXBA 1S1WA 4YDUC 4CJRA 4LD0A 1VSFA 3RMDA 5M1FA 3AVLA 3OYBA 1N34K 4I9LA 1YJ9N 3QFPA 3CMEN 4MDAA 2CH6A 4DV0K 2P9PB 3SJJA 3T19A 4CJUA 4ISEA 1VSKA 3VQBA 1JLGA 3AO2A 1RTHA 1Q8IA 1P90A 4KH4A 5AQNA 1JCFA 4CEBA 3V9ZA 1C0UA 2P9UA 3EE8A 2ZJPL 5M1PA 2IOCA 2ZGZA 3R9PA 3CXCM 4M3UA 4JI6K 4CZKA 3MCAB 3CG7A 3ZYYX 5EY4A 4GV3A 4FLWA 1K6YA 2FF6A 3RMCA 4FJ7A 3D2EB 3T1HK 1GLLO 4KI6A 3ALYA 1HJOA 3GG4A 4FJXA 3K58A 3KK1A 4Y1CA 4DTOA 4DUZK 1B9DA 2HHTA 1LWEA 1KCFA 1RTIA 3U8XA 1SKRA 4BRHA 4OLBA 3CQYA 4AHCA 4BR0A 3L2VA 3J7YP 1X9JA 3CHWA 4JKDA 5HRRA 1XC9A 2Q97A 3O08A 2YCHA 3RRHA 2W6LA 1D8YA 1U48A 3CC7N 3M5RA 5J1EA 4BDPA 3E01A 4K25A 3PSIA 1LWFA 1NJXA 4N41A 3A5OC 2F7TA 3EO3A 3SLCA 4JI2K 5AQZA 4IJAA 4JRPA 1KVBA 5F1XA 3CFPA 5E41A 3ZSOA 3MX2A 4DU4A 3OYHA 1VQ9N 2J4RA 4EAHD 4BY9C 2VQFK 1BU6O 4CGDA 4M3TA 3IRXA 3HPOA 3ZSVA 1YJWN 3EZWA 4R79A 2E4LA 2KFNA 3VQ8A 2AJQA 2O4GA 3WXLA 2HBMA 3LP3A 4X64K 4OGCA 3CCQN 4M42A 1NNEA 1VQ4N 2Q0RA 4CVNE 4BVPA 1X9MA 3SBTA 1SL2A 4JKGA 4HHTA 4DTRA 5AFUA 4DS4A 4FLVA 4KFBA 1NKEA 3ENBA 4CGHA 3PV8A 4PKGA 3U9ZA 2P9PA 1YTUA 4FVUA 2B5JA 3RSEA 3O9QA 3CD6N 4BREA 3BY5A 3OTOK 3PLAA 3O4NA 1CXUA 3TSUA 1BG3A 4H5VA 3VGLA 3L2RA 3ZETB 1ITGA 4RW6A 4H03B 4DR5K 1TKDA 4AH9A 2GTDA 1MWMA 1VQPN 2BTFA 3AVHA 4LY7A 1WBDA 1QQNA 1VSJA 4ISFA 4CHOA 3L2WA 3DRSA 4KTWA 3NF7A 1I94K 1QHAA 4CF9A 5E84A 3CC4N 4IEIA 5KPZA 4NYNA 1HLUA 2KKZA 2FC0A 1NJIO 2JWKA 2IVPA 4MQ3A 2E2QA 3K5NA 4AILC 1P8ZA 5JS2A 1MA9B 5C24A 5HRSA 5SWMA 2VQEK 1NWKA 3IUCA 1RT7A 1S6QA 5BRDA 5FPMA 5KGWA 4A5AA 4C23A 3NF6A 2GEMA 3DLGA 4B3SK 5I42A 1S3XA 4KTZA 5J2MA 5AZJB 4Y0WA 3OJSA 3ZT3A 1IKXA 1XUPO 4ZTJA 1HJRA 3HL8A 1DEJA 4FZYA 3CCRN 3B6PA 4KHYA 4BRMA 1VQ5N 5AFUH 3WQTA 4A5BA 5AQSA 5EVZA 3VQ5A 4FLZA 4WE1A 2EX3A 4WF9L 3E66A 3CJ1A 3DLEA 2A5XA 2DFEA 4IDHA 4DU3A 3PO4A 4IG0A 3K5LA 3ZT0A 5EU7A 3RR7A 4BRLA 1XNQK 1W9HA 5C15A 4UQGA 4WQ4C 3L2QA 1HYVA 1VSMA 2HNYA 4BROA 2V51B 3ZLJA 4B1WB 2OYQA 5JMVA 5HOOA 4H5RA 5AJ3K 1S22A 4L3QA 5EX5A 3LP1A 1KFDA 1J5OA 1O13A 1CZBA 2FF3B 3CPEA 4IDKA 4RW8A 4AHRA 4YFUA 1HKGA 2FBTA 4F2SA 3AVBA 2JLEA 1OH5A 4HCBA 4AHSA 1HR0K 2QWQA 3AA3A 5AQWA 1XMOK 3VF4A 4LF9K 3TR8A 1NJZA 1JCEA 4BVOA 5BRFA 3HVRA 2RHKA 5AQJA 2YNFA 4ILJA 1ZXOA 1IG9A 3OYEA 4B1ZA 3QNOA 4JNEA 3ZEUB 3AV9A 1FK9A 4B9VA 1NM1A 3NVMA 3NCIA 3JS6A 4C8MA 5JICA 1TL1A 2O8FA 3HOTA 3SI6A 1SS6A 3SJHA 3LPTA 1O1WA 4LC9B 4CJ5A 3OYAA 4CJ3A 4EP4A 2V7ZA 4FOEA 1UWBA 3ZT1A 4FVMA 4DLGA 1BGXT 3VN5A 2HF4A 4BR7A 1NGEA 5A2QO 1ZYQA 1IBMK 3HRGA 3SUOA 2G8FA 5I3UA 1FJGK 2A1RA 3KHYA 2ASPA 2LSNA 1KQSM 2GWKA 4MFBA 1BQMA 2ASMA 5JLHA 3AVGA 4F9OA 3WQUA 3TAGA 1S1VA 1D9FA 1EWQA 1RBUA 1JL2A 4CJPA 3DOLA 1QQOA 5GAGP 3T7ZA 4LFBK 4B8CA 4A61A 2HHWA 3OS2A 1KTQA 5HRNA 4HTLA 4H4MA 3VQDA 3OYLA 5FRMA 2P9LB 3TWHA 2HNDA 1LV5A 3C7NB 4KHUA 4DKWA 4IG3A 2D0PA 1C0TA 1NK9A 3H1QA 4OKJA 4DSLA 4EFHA 1LCUA 5HRPA 4AF1A 1NOYA 2E2OA 4N76A 2P9NA 4WFBL 3KK7A 1NGIA 3K57A 4DFMA 1ATNA 2P9KA 4GMJB 1S5JA 4MLEA 1RT5A 2HBJA 2RKIA 1Q81O 3LDOA 5CZ1A 2NRHA 3THYA 4KB0A 3THVA 1J53A 3MK6A 3OBYA 2UXCK 1H1VA 3LZJA 1JLFA 1OH6A 4ILHA 4E19A 2ZWHA 2DFHA 2Y1JA 1IO2A 2G8WA 4J2AA 1N33K 3TSPA 3NE6A 3VF6A 4JRQA 4YY3K 4Z4CA 3FE1A 2A41A 2P1JA 2WC9A 4IBNA 1BISA 3DXKA 1U47A 3LL3A 2HHUA 3CC2N 1T03A 4ID1A 4B3RK 3AA2A 3KLHA 1NGHA 1JJ2M 3O1WA 3VEXA 2YKNA 2BE2A 3W3DA 2DPNA 2RF2A 2GV9A 1HX1A 1VSHA 2W41A 1XC3A 1GLCG 2IS3A 3U4LA 2A1SA 3QEIA 2HMPA 1CLQA 1BWFO 1HUXA 4BC5A 2KZZA 2OANA 4ELVA 4FM1A 3CERA 3F9KA 3QERA 3SAGA 1E4FT 3ZT2A 2P9LA 4BRFA 1L3VA 4JI4K 4CECA 1IKVA 4MO5A 4Z4FA 1G15A 3ZSWA 4OPAA 4BACA 1NGDA 3CCLN 4JK7A 1ZBSA 1W97L 3ENHA 2HHSA 3DXMB 4C1NK 3CCEN 3LALA 3OYFA 3VF2A 4E0DA 4DSIA 1GLJO 2B4JA 4DV6K 4JI8K 2ZD1A 3BEXA 1VRTA 2OPSA 3V9SA 3TTDA 5HBMA 3AA4A 3VTIA 5KGXA 2HNZA 1DKGD 1TGOA 4JHDA 4BRKA 4NYFA 4CD3A 3HT3A 4ELUA 1NGBA 3CCMN 3ZX0A 1GOCA 2YI1A 5TKYA 1NLVA 4CZEA 2F9WA 3RTVA 1QSSA 3U6FA 2E88A 3TSQA 1NK5A 3VETA 5C10A 4KO0A 4LH4A 4W5QA 4C8KA 3KIOA 1WSFA 4AM6A 2GWJA 3OYIA 4C8LA 2VYPA 4CK3A 3L4IA 3O3GA 2UUAK 3H45C 4YOUA 4FLUA 5GIPA 2ZM6K 2HBLA 2X6NA 1XMQK 3GL1A 3QMLA 4W5OA 3OHRA 4FJNA 1VSIA 4FJKA 5GADP 3T3FA 1TV6A 3NDKA 3B8AX 3ZSXA 4FCYA 1WAJA 4DTJA 4B9UA 1IBKK 3RVCA 1LAWA 1XHXA 3OJUA 4F2RA 3BDPA 3HP9A 2YHWA 1OH7A 3RRGA 4CEOA 2P9UB 5AQMA 4DR4K 3OS1A 1U45A 5CYQA 4MO4A 1VQMN 3OYMA 4JS5A 3A0IX 3SV4A 2ZGYA 3SMPA 4GVMA 3WXIA 2IIRA 4RW7A 2F9TA 3NH1A 1NK7A 2NZTA 4CGJA 5H1SQ 4CFDA 4NCAA 2O8EA 1C0FA 1S1XA 1IG8A 4NCBA 4YOXA 1QZ5A 1NGGA 2ITGA 3AVMA 4CERA 1BUPA 2W6KA 3WEEA 4BRNA 4C8OA 4DTPA 5KI6A 3GOIA 3OYCA 1LW2A 3ID8A 4YOTA 1QSLA 2IVOA 4NCGA 3BP8A 4JK9A 3CCSN 4IXCA 4DFKA 3D45A 4BC4A 4E89A 3K59A 3R1XA 5ADXH 4IJNA 4DF8A 2KTQA 3O8MA 5CZ2A 2F8TA 2W42A 4FSVA 3TARA 4BDYA 5AZIA 4B08A 1MU2A 1L5UA 3NBPA 4WCEL 4BE1A 4JKCA 4JKGB 1JCGA 2AA4A 3T1AA 3L3UA 4CF1A 1MDUB 3RSEB 1N32K 1BO5O 2YHXA 3SNNA 3HZ6A 3VQ9A 4YNQA 3K0SA 4H0YB 4H0TB 3DOKA 4E7LA 1KAZA 5KRSA 4HCCA 3ZSRA 2X78A 2GUPA 3I0RA 3LP0A 1W7AA 3R3LA 3OYDA 3V1OA 3CJCA 4F4KA 3EN9A 3CIPA 3G0ZA 2YHAA 1VQKN 3ZSQA 3SK3A 4NLCA 2UU9K 4ZHRA 4JK8A 4FWKA 3O6WA 4YORA 4DB3A 3PIPL 1HKBA 4BRDA 4CJ7A 4DF4A 4E7JA 1XI1A 4I6MA 1K73O 4K8ZA 3D6RA 4H5TA 3QINA 5BREA 1JLBA 4DWIA 4OX9K 3R8EA 2HHHK 2XHBA 1TKXA 2HOEA 2HHXA 2OA8A 3N4PA 2IAJA 5GIOA 3MEDA 4BG8A 4DQPA 4DR3K 1Z6RA 1V4SA 1UA0A 1KC8O 2O8CA 2OTJN 3FZLA 4BE0A 4U67L 4B3MK 1REVA 5AQUA 3SUPA 3GE1A 4B9QA 1NK6A 3FZFA 3H3OB 3MCPA 1RFQA 2GELA 3IDHA 3SZ2A 4DSFA 3H3NO 3S41A 1UA1A 3TAMA 4KKOA 5BR9A 1Q86O 3JSMA 3PX6A 3D2FB 5AQPA 5T7BA 2QK9A 4KPYA 3KTQA 1OH8A 4J2BA 3WXMB 3VEOA 4OO1J 2A42A 3AVFA 4FW1A 2HMIA 3MN9A 1N6QA 1VSEA 3L6QA 4FWLA 3IMXA 3AGKA 1RBSA 1WLJA 4E1JA 4GVEA 3ZSYA 3MECA 3EEQA 4M3ZA 4ELTA 3M6GA 4GV6A 1U6ZA 1QQCA 3K2PA 1WOQA 3GDQA 2E2NA 3TI0A 3O3HA 4A59A 2ZF5O 3QESA 1DTTA 2IDOA 1CZAN 1TYQA 4LF4K 4DV4K 3VA0A 1KVCA 1KLMA 3H6EA 5E26A 2YHBA 4KAZA 3RWUA 4DU1A 4FLTA 3CM5A 4CZLA 2NRTA 5I9EB 4RWTA 4DLEA 4O0IA 1C1AA 1YI2N 5FPNA 4BRQA 3O3FA 3KLFA 1M90O 5AQTA 4IZ9A 3LAMA 3SBGA 1VQ8N 3MN5A 1U2VA 2XY5A 1X9SA 4OJRA 3CM6A 1WSIA 2X74A 4NXNK 1QHTA 1TUUA 3U9DA 4H5NA 4DFPA 3HTVA 4O8UA 4BC3A 4J2EA 3VOVA 3VQ7A 1W2BM 2O8FB 2VWBA 2YJEA 4K42A 1NKCA 5EXWA 3UKUB 1SQKA 2QWPA 3I55N 3SAHA 3D2FA 5BPMA 3AO5A 2G8HA 1BDGA 2P9IA 1HNZK 5BRHA 5CHIA 1VSLA 3V9XA 4BRPA 4X65K 3O9TA 1SL0A 2FBYA 3LDSA 3FLCO 2HBKA 3AVKA 3MEGA 2XY7A 5F2RA 4JI0K 3H1VX 1S72N 4DG1A 3DRPA 1FKOA 1I3AA 4YHHK 2QTDA 3HP6A 4JV5K 1WSJA 2Q3SA 3P31A 1RT1A 1MWKA 3DI6A 1RGIA 3NFAA 1T05A 4PHTX 2QWLA 5C42A 3FZMA 4OVLA 4E1NA 5J2PA 4EZ9A 1YHQN 3VEVA 2ITMA 1IH7A 2RPIA 1KAYA 3VQ4A 2PY5A 5AQHA 1NGAA 2G8IA 5JS1A 3LM9A 2O8DA 4BQLA 1J9AA 2P9NB 3ZX3A 4CJFA 1ZBIA 3FZKA 1WSGA 1BA0A 2P9KB 2VCPA 2A3ZA 3AA5X 3A5LC 1LW0A 1IJJA 1QE1A 1X9WA 4BRAA 1EETA 1WNSA 3MDQA 2I7PA 4BRCA 1UOCA 3K5OA 3NF9A 3QBXA 4CIFA 1ILYA 3THYB 1NOZA 2QWNA 4EP5A 1HPZA 1RNHA 1NKBA 3P4IA 1K8KA 1KVAA 2I7NA 4WQ5A 3I0SA 1SUQA 3C0BA 4FLXA 3QLHA 4O4GA 1JL1A 4XEIA 4JEPA 4B3TK 4YOYA 3CJAA 3DRRA 4CGIA 3CETA 4JS4A 4LFCK 1RDBA 3HSCA 4FJIA 2YJFA 3QB0A 1TVRA 2D0AA 4FK4A 5AQFA 3DJCA 3PIOL 4OPJA 4FJMA 4AHTA 2KQ2A 4B1VA 3UKUA 3ZCMA 3NH0A 1HPMA 4IEEA 3DXKB 1S6PA 3H46O 5BN9A 1VQ7N 2HVIA 2OPPA 3THXB 1C1CA 3LDNA 2GUIA 4DR7K 3VQEA 2BH1A 1LOTB 3E9LA 3F73A 1KSPA 1BIUA 3VTHA 1L3UA 3LAKA 1BI4A 2QWOA 5KPRA 4W5TA 4L8RB 4E3SA 1RT2A 1WSEA 3WUHA 4OKEA 4QS7A 4B9NA 5DM6L 1VQ6N 4PKIA 4PUOA 3AVIA 4KHWA 3TAQA 2E6MA 2DFFA 3JAMO 5KRTA 3VGKA 4AHVA 1GLFO 3HM8A 3OY9A 4DV3K 3UKRA 2DY4A 2O8BA 4DV5K 4FJ5A 2XRIA 3RR8A 4QS8A 3HO1A 4DR1K 3QEPA 1HRHA 5HLFA 1N8RO 2Q2RA 3AY9A 1Z26A 4XH4A 2RN2A 1CXQA 5HROA 2WUSA 3PSFA 2Z1IA 3AVJA 3KWGA 2ZQBA 2QEXN 1XHZA 4JHDB 3I56N 4KB1A 3ATUA 1WB9A 2CH5A 1JXEA 3HOSA 2F96A 4FJJA 2VGMA 4CF0A 3P38A 1RDDA 4FJGA 3VPZA 4Z94A 3CCUN 4BR2A 4CZFA 3DLHA 4I9QA 3LWMA 4BGBA 1ZBLA 3WNEA 2QWRA 2Z1GA 2RE2A 4DTSA 4B9MA 1B9FA 5JVGL 1X1PA 2G8KA 3C6TA 3DLRA 3G6EN 3MXMA 4NO7A 3THXA 2V7YA 4KBOA 4LF8K 4B9LA 1YT3A 2KW4A 4FWOA 3QICA 3EL2A 5M1KA 3QEWA 4FK2A 1XWLA 2HF3A 4JD2A 4PQUA 3AVAA 2E1ZA 2QM1A 3I8BA 3CQXA 4HTUA 3LDQA 4DQSA 1LAVA 4IOXA 3QIOA 3WNGA 1ZBUA 4Z0UA 3U3YA 4CE9A 4J8FA 4YOWA 1TL3A 4CJQA 2HW3A 3O9SA 3SQ4A 4DQRA 4H8KA 3J8AA 3MWTA 4CEZA 4K43A 3LANA 4M3RA 3LDPA 5DMRA 1TAQA 2X6SA 4FO0A 3TAFA 1RDWX 4AQYK 3LZIA 4M7XA 1YJNN 3K9KA 2PYLA 4G9ZA 1A5WA 2P51A 3AAQA 3WNFA 3HPHA 3N4QA 2O8EB 3EYZA 2ZJQL 1QQMA 4CF8A 5BR8K 4CEFA 2ASOA 4CZJA 5AQQA 3NVKA 3WEEB 3EKUA 5K14A 1Q18A 1TKTA 4IWVA 1GLAG 3D0PA 4CGGA 4OLAA 4KH5A 3G71N 2PAVA 2ETJA 3MMVA 1WAFA 3A8YA 1EQYA 2D0OA 3MN7A 1GOBA 3HPGA 1T6DA 3D7EO 4CFBA 4BGAA 3L2UA 1JLQA 3OYNA 4QOZB 3VA3A 1Q9YA 3E1YA 2E20A 3CJBA 4CJLA 3J7AP 3KD1E 5AZIB 2BANA 1S1TA 5ADXA 4PA1A 3E9PA 4CEQA 4CHZA 3H08A 3MAQA 4DSJA 1BIZA 4YDUA 4I7FA 3UB5A 5BPNA 1NMNA 4FPBA 3VQAA 2QA4N 2OPQA 5DM7L 5CE3A 4BDZA 4WFAL 1OVYA 4LSNA 4DCHA 3SCXA 1NK4A 3DLKA 2FSNA 4FWRA 1GOAA 5TKWA 3V1RA 4H5WA 1N36K 1NMDA 1DT9A 4HUEA 4G1QA 3V4IA 3P5JA 2VG5A 4X66K 4GW6A 3DAWA 4H0PA 4CD1A 3MXIA 2O4IA 4B1YB 5EOYA 2D5RA 3BZKA 3VQCA 5AQKA 3SPZA 3PUFA 5AR0A 2OTLN 1U49A 2E1YA 1HNXK 5FPEA 4FM2A 4I6MB 1ESVA 2JWLA 4PKHA 2D0BA 5FRNA 1KXPA 4A2AA 2Z1JA 5C12A 4DV2K 2A40A 4DV1K 4NXMK 4CJSA 3VEYA 4CFAA 4O8KA 4A57A 5LMNK 2O8CB 1J6ZA 3CI5A 1R0AA 3F9MA 1YF5L 1Z25A 5KTQA 3PO5A 3HK2A 3B6OA 4GKJK 3ISNC 3KKRA 3SPYA 4AHUA 5CR4A 1HYZA 3FR0A 1BOTO 3O5BA 3M8RA 1E3MA 2PFUA 2NRWA 3J7ZO 3KK3A 1RTDA 4FYDA 3DM2A 4FW2A 4NB4A 3M1FA 4DTNA 3GBTA 3OW2M 1U04A 4U7BA 3BUZB 4MLHA 3QBWA 2CGJA 2ATQA 4F8RA 1HQEA 3VERA 1C0GA 2VG6A 4YOVA 3QEVA 3VEWA 2B6AA 3VQQA 5M1NA 2YHYA 1ASUA 4DMNA 2AP1A 3AVNA 1SL1A 5F0XA 3V6DA 3OYKA 3WT0A 1SZ2A 1FW6A 2HHVA 1EO1A 1QSYA 4O5BA 4H0XB 2Q0UA 4IFYA 4BC2A 4LF7K 3AO1A 3TU5A 3O9RA 2UYTA 4W5NA 3AO4A 5C2DA 4DR2K 4CHYA 1X3MA 4PL7A 1TYQB 2YNGA 3CCVN 1YUWA 3ZSZA 4CJWA 3AO3A 4FJ8A 3U3GA 4KHNA 3BF3A 3HBTA 5HL7L 4CJEA 3HYFA 3O9UA 5FROA 2G8UA 4F3TA 1KFSA 4M7YA 1HNIA 2BUPA 3NGIA 3NHGA 4QAGA 2Y1IA 1NG9A 4JKBA 2GBZA 3M8QA 1BL3A 3JYTA 4A62A 5IT9O 3P39A 1U2VB 3K9JA 4KREA 2PBDA 2R7YA 3OYJA 4DS5A 1NGCA 2I5JA 3QDKA 3PY8A 4DV7K 1ATSA 3G10A 4CEEA 2VWJA 2P9SA 2NRXA 1OKJA 1NK8A 4K0KK 4PY5A 2OZMA 5M1OA 2A6AA 4WFNL 4BR9A 4KI4A 5AQOA 3VQ6A 3PX0A 2P9IB 2DTUA 1UAXA 4JLHA 4JKHA 3ULEA 1HNVA 2Q31A 5CY4A 3DLLL 1BCOA 2HSTA 4B9TA 3F5TA 2OPRA 1LWCA 1IKWA 1SV5A 5DK5A 1YXQA 2QW9A 4C1NI 3S9HA 3R6MA 1RBTA 1IBLK 5SZTA 4CBUA 3EY1A 3OA9A 3ID6A 1TUYA 1KAXA 1HMVA 5KQDA 5KPTA 2EHGA 1L3SA 3TTCA 3TABA 4WQ4A 1CZ9A 1A5XA 2BDPA 5FLXO 4KHSA 3CMAN 4JKAA 1DTQA 3QETA 3QO9A 1JKHA 3V9WA 2O8DB 3BZCA 4CEAA 4DR6K 3C6UA 4FZXC 1WSHA 3OS0A 1QS4A 4FWPA 4MDBA 1ZBFA 4OGEA 1X3NA 3IAYA 1NGJA 4CIEA 4DSKA 5IWAK 1QVGM 2E5LK 3HSTB 5GINA 3G4SN 4IO9L 4BWJA 1IKYA 5C2FA 4CESA 4JN4A 4TSXA 3QIPA 4XH1A 1K8KB 1D5AA 2XY6A 3O4WA 3MXJA 3HJFA 4BRIA 3D2EA 1T7PA 1VQNN 3K5MA 1YTAA 3C65A 4HWIA 1Y64A 3M8PA 4KV8A 4DTXA 2IGIA 3SQ0A 3S3MA 4JYAK 1A5VA 2QXFA 4GV9A 4FXDA 2D0CA 4FZZA 3DWLA 5LJVA 2IVNA 1TAUA 3SAFA 4R5PA 3WNHA 5BPLA 3MWPA 4AM7A 4BR5A 2KZMA 3C94A 3RMBA 1XNRK 4LF6K 3KLEA 1E4GT 3EKSA 2V52B 4KHQA 3KLIA 3F2KA 4WYBA 4EIAA 3ULDA 1BI4B 4CIGA 4FOIA 3DMJA 4E7HA 2E6LA 5GAEP 3O4QA 1YVNA 4ID5A 1OVQA 2QXLA 4DQ8A 3VESA 2FSKA 3M8SA 2P5GA 4KTQA 4IKFA 3V1QA 3AVCA 1C1BA 4BG9A 1YAGA 1YIJN 3FGUA 3UKRB 4BRGA 4CJKA 3CCJN 1BQNA 3ASMA 4ZTFA 2O8BB 4W5RA 4RCHA 4EHTA 4LH5A 4Z4EA 4ILGB 3T69A 5J2QA 3BGRA 2F8SA 4JI3K 3ZT4A 1SKSA 3KVGA 3W0LA 3SQ2A 3ZETA 2FLOA 4CJVA 4KH6A 4DSEA 2FBVA 1YITN 3A2FA 4GY2B 4CHPA 3VQPA 3OYGA 3DLBA 3IG1A 4CJTA 4FL9A 3HVTA 3SYZA 1EX4A 4QS9A 3Q7BA 3HM9A 1WN7A 3FFIA 2QKKA 1EKEA 1I39A 3AGRA 3ZX2A 4FJHA 5LMUK 4KHPK 5LJWA 1BA1A 2KLAA 4OKKA 5M1QA 1GLEG 4JAXA 1Q9XA 3L0QA 2PYJA 2W40A 3VGMA 2CGKA 4HVJA 2HB5A 4CCHA 4FJLA 2E2PA 5B8HA 4ISGA 1ZC6A 2BGGA 2NRVA 4IFEA 2WOMA 4DTUA 4M45A 2VG7A 3L8BA 3CF5L 1R59O 3AARA 2VGNA 5KQ8A 2GX9A 5AZJA 3Q7CA 4JD2B 1RILA 3HXMA 4EHUA 4CJ4A 1M1KO 2FSJA 1N5YA 2P5OA 4DQQA 1NK0A 1D4XA 3WXKA 2KFZA 1J5EK 3NF8A 1VRUA 2VWKA 1U4BA 5AQXA 1DGKN 1JLAA 1GLBG 3LM2A 3TPQA 3SV3A 3KD5E 1S1UA 4BR4A 3CFRA 5JLFA 2EWSA 1J54A 4JI5K 1QZ6A 1DLOA 1EWRA 4IOAL 3S3OA 1EP4A 5D3GA 1XQSC 3ENOA 2QWMA 4JI7K 3FFKB 1KLNA 3UIQA 4Q0BA 4B8AB 5GAHP 4FPAA 3P1GA 4N56A 3CQ8A 4CHNA 5HP1A 2ZE2A 2NUBA 2FXUA 3SMSA 2HVHA 3J81O 3A5MC 1S9EA 4O55A 4K41A 1Q82O 5BN8A 4JI1K 5AQLA 3SUQA 3P83D 3QFUA 2NRZA 2FBXA 5J2NA 4BE2A 3NGZA 1BCMA 4HUGA 1K9MO 2YNIA 2WTUA 4WQ5C 2ZJRL 3MN6A 4I2QA 4CZHA 3L4QA 4K8XA 2CGLA 1SKWA 3MEEA 4RW4A 1FKPA 4BWMA 3NAEA 4LF5K 1HNWK 5LL6Z 4M63C 4DFJA 4KRFA 3ZEUA 5FPDA 4IOCL 4CGFA 4DTMA 4FK0A 4FWQA 3IS9A 4PWDA 3IFRA 2Q1NA 3HI0A 2UXDK 4E7KA 3ATVA 4RW9A 4CZIA 2KHOA 3RMAA 1Y97A 3QEXA 3NMUA 1BHLA 1K8AO 4M3XA 2YKMA 4Z4IA 3TTFA 1RTJA 4CHQA 4UY8O 3TAEA 3VEZA 1KD1O 1T6CA 3M3ZA 3VENA 3CYMA 3LDLA 1G99A 5LY3A 1VSDA 5AQVA 1JLEA 1RCHA 1RT6A 1WBBA 2Q36A 3NGYA 1RBRA 4EZ6A 1HKCA 1ASVA 1VQON 5C25A 1C0MA 4V19S 3THWB 1QVFM 4XIUA 2OZSA 3C95A 3KJVA 4A2BA 4B9SA 1T3VA 1VHXA 4H0VB 5FDLA 3QNNA 4FWNA 4IFVA 1RDAA 4X62K 3T1YK 3WXJA 2JGUA 4OPHA 3CJ9A 4CI6A 3KZBA 3NH2A 4JKEA 3C7NA 3KK2A 1T8EA 5C0YA 3FZHA 4M41A 4Z4GA 3C6AA 4B1UB 2UUBK 5AQYA 2WFBA 3ITHA 3TAPA 4GKKK 1RDCA 1NJYA 4IO8A 2E8AA 3O80A 4H0OA 3PX4A 1NGFA 1RT4A 3CJ7A 3CFOA 4DUYK 3OBWA 1NJWA 3CPWM 4OPKA 2UUCK 3LP2A 1VK0A 4XH5A 3I33A 5AQRA 5AQGA 5JVHL 1TK5A 3BF1A 1QTMA 2YNHA 1W0HA 2WONA 2QI2A 3AAPA 4E7IA 2D4WA 1NBWA 3E9OA 3LPUA 4O0JA 2XY8A 1NU0A 4RG8A 4FWMA 4LSLA 1RT3A 1JLCA 2PZSA 3UE5A 4FM0A 4B3OA 1IV0A 4CF2A 5MLCQ 1VAZA 4E1MA 4M3WA 1GLDG 3G25A 2G8VA 1B92A 4C8NA 1HQUA 1FXXA 3THWA 2YX6A 4N5SA 4CBWA 2WBNA 5ELZA 2D1KA 3KWIA 3EZ5A 3SUNA 4PL8A 4HUFA 4CFCA 3IKMA 4CW7B 4CK1A 4O44A 3TANA 4B1XB 4Y1DA 2XO7A 4H4OA 3L3VA 3V9UA 5CYMA 5AQIA 4CEDA 3V81A 1F21A 1ZBHA 1Z05A 4Z4HA 1TK0A 1KRPA 3KLGA 1RDUA 4QCLA 4O5FA 4M3YA 1YVUA 2OCEA 3I8DA 2IC3A 4CZGA 2YV0X 2Z1HA
chains in the Genus database with same CATH topology
1RBTA 4DQIA 1NOZA 2YKNA 2BE2A 5SZTA 3DYAA 4EP5A 1HPZA 1RNHA 4ICLA 1NKBA 4I2PA 3EY1A 4FJ9A 2RF2A 2GV9A 4F3OA 1TK8A 1KVAA 1VSHA 1HMVA 4J2DA 3I0SA 1SUQA 4FLXA 2EHGA 3QLHA 3LWLA 1L3SA 3TABA 2IS3A 1JL1A 4O4GA 4KHUA 2A1SA 1CZ9A 3QEIA 1A5XA 3S3NA 1TKZA 3DRRA 2BDPA 1CLQA 4CGIA 4KHSA 1DTQA 4JS4A 3QETA 3QO9A 2HHQA 2KZZA 1RDBA 1JKHA 1S9GA 4FM1A 3V9WA 4ELVA 4FJIA 1TVRA 2D0AA 3F9KA 1ASWA 4FK4A 3QERA 4FJMA 2QKBA 4CEAA 4OPJA 4AHTA 2KQ2A 3C6UA 1EXQA 3ZCMA 3NH0A 4FLYA 3ZT2A 3S9HA 4FZXC 1WSHA 3OS0A 1L3VA 4B9MA 1QS4A 4CECA 1C6VA 1L3TA 1IKVA 1ZBFA 1S6PA 4N47A 4Z4FA 4OGEA 1G15A 3ZSWA 4BACA 4Q5VA 3IAYA 4CIEA 4DSKA 3HSTB 2HHSA 2HVIA 4BWJA 1IKYA 2OPPA 3LALA 4CESA 4CK2A 3OYFA 1C1CA 3QIPA 4TSXA 1RBVA 1D9DA 1HYSA 4E0DA 1D5AA 3KKSA 2B4JA 2GUIA 3OVNA 2XY6A 3VQEA 4DSIA 3SQ1A 2ZD1A 1JXBA 1S1WA 1VRTA 3MXJA 3HJFA 2OPSA 4CJRA 4LD0A 1VSFA 3F73A 3V9SA 3RMDA 1BIUA 1KSPA 1T7PA 3AVLA 3OYBA 5HBMA 3AA4A 3LAKA 3K5MA 1L3UA 4I9LA 5KGXA 1BI4A 1YTAA 2HNZA 3M8PA 4KV8A 4DTXA 4W5TA 2IGIA 4L8RB 3SQ0A 1TGOA 4E3SA 1RT2A 1WSEA 4NYFA 3S3MA 1A5VA 2QXFA 3SJJA 4FXDA 4OKEA 3T19A 4CJUA 3HT3A 1VSKA 2D0CA 3VQBA 4B9NA 4ELUA 1JLGA 4FZZA 3AO2A 1GOCA 1RTHA 1TAUA 1Q8IA 4PUOA 4R5PA 3AVIA 4KHWA 3WNHA 3TAQA 2E6MA 2DFFA 5KRTA 3RTVA 1QSSA 3U6FA 4CEBA 3V9ZA 4AHVA 1C0UA 1NK5A 3OY9A 2KZMA 2DY4A 4KO0A 3C94A 4LH4A 4W5QA 4C8KA 4FJ5A 2IOCA 3KIOA 1WSFA 4M3UA 3OYIA 2XRIA 3RMBA 3RR8A 4C8LA 3HO1A 3CG7A 4CK3A 3KLEA 3O3GA 3QEPA 4FLWA 1HRHA 4KHQA 1K6YA 4FLUA 5HLFA 3KLIA 3RMCA 4FJ7A 2X6NA 1Z26A 3ULDA 3ALYA 1BI4B 4KI6A 4CIGA 2RN2A 1CXQA 3DMJA 4W5OA 4E7HA 5HROA 4FJXA 2E6LA 3K58A 3KK1A 3O4QA 4FJNA 2Z1IA 3AVJA 4ID5A 2ZQBA 4Y1CA 4DTOA 1XHZA 2HHTA 1B9DA 1LWEA 1KCFA 1RTIA 1SKRA 4KB1A 1VSIA 4FJKA 4OLBA 4AHCA 3M8SA 2P5GA 3T3FA 4IKFA 4KTQA 1TV6A 1JXEA 3L2VA 3V1QA 3NDKA 3AVCA 1C1BA 2F96A 3ZSXA 5HRRA 4FCYA 4FJJA 1WAJA 4DTJA 1XC9A 3RRHA 4CF0A 4B9UA 1LAWA 1XHXA 3OJUA 1U48A 1D8YA 4F2RA 1RDDA 3BDPA 5J1EA 3HP9A 4BDPA 3RRGA 4FJGA 4CEOA 4ZTFA 4CJKA 3E01A 1BQNA 3ASMA 1LWFA 1NJXA 4N41A 3DLHA 4I9QA 4W5RA 3OS1A 1U45A 5CYQA 3LWMA 1ZBLA 3WNEA 4LH5A 4Z4EA 2Z1GA 4JRPA 1KVBA 5J2QA 3BGRA 4DTSA 2F8SA 3CFPA 5E41A 1B9FA 3ZT4A 3OYMA 1X1PA 3ZSOA 4JS5A 1SKSA 2G8KA 3SV4A 4DU4A 3OYHA 3SQ2A 4CJVA 4GVMA 3C6TA 4CGDA 4DSEA 2FBVA 3DLRA 3IRXA 3A2FA 4M3TA 4RW7A 3HPOA 3ZSVA 4CHPA 3MXMA 2E4LA 3VQPA 3OYGA 3DLBA 2KFNA 3IG1A 3VQ8A 4CJTA 3NH1A 2AJQA 4B9LA 1YT3A 2KW4A 2O4GA 1NK7A 3HVTA 3SYZA 1EX4A 3LP3A 3QEWA 4FK2A 4M42A 4OGCA 4CGJA 1XWLA 4CFDA 4NCAA 3HM9A 1X9MA 1SL2A 1WN7A 4PQUA 3AVAA 1S1XA 3FFIA 2QKKA 4NCBA 4HHTA 4DTRA 4DS4A 2ITGA 1EKEA 1I39A 3AVMA 4KFBA 4FLVA 1NKEA 4HTUA 4FJHA 4DQSA 1LAVA 4CERA 4CGHA 3PV8A 3QIOA 3WNGA 1ZBUA 4Z0UA 3U3YA 1YTUA 2B5JA 4OKKA 4CE9A 4C8OA 4DTPA 5KI6A 3OYCA 1LW2A 1TL3A 4CJQA 1Q9XA 1QSLA 2HW3A 3O4NA 3SQ4A 4DQRA 2PYJA 1CXUA 4NCGA 4HVJA 4H8KA 4DFKA 3D45A 3K59A 2HB5A 4CEZA 4E89A 4CCHA 4M3RA 3LANA 4FJLA 3L2RA 1ITGA 4RW6A 4DF8A 1TKDA 5DMRA 2KTQA 4AH9A 2BGGA 5CZ2A 2F8TA 2WOMA 2W42A 3TARA 4DTUA 4M45A 2VG7A 3L8BA 1TAQA 2X6SA 3AVHA 4BDYA 3TAFA 4LY7A 4B08A 1VSJA 1MU2A 3LZIA 1L5UA 3NBPA 2PYLA 4CHOA 3L2WA 1A5WA 2P51A 3DRSA 4KTWA 3NF7A 3WNFA 4CF9A 1RILA 4BE1A 3HPHA 3HXMA 4CJ4A 3EYZA 4NYNA 1N5YA 3T1AA 2P5OA 2FC0A 3L3UA 4CF1A 4DQQA 1NK0A 4CF8A 4CEFA 4MQ3A 3K5NA 4AILC 2KFZA 5K14A 5JS2A 3NF8A 1VRUA 2VWKA 1TKTA 5C24A 5HRSA 5SWMA 3SNNA 1U4BA 3VQ9A 1JLAA 3D0PA 3SV3A 4CGGA 3KD5E 1S1UA 4OLAA 4YNQA 3CFRA 2ETJA 1RT7A 1WAFA 1S6QA 1J54A 1GOBA 3DOKA 3HPGA 4CFBA 4E7LA 3L2UA 5KRSA 5KGWA 1JLQA 4HCCA 1DLOA 3OYNA 3NF6A 3ZSRA 2X78A 3DLGA 1EP4A 3S3OA 4QOZB 3I0RA 3VA3A 5D3GA 1Q9YA 3LP0A 5I42A 4KTZA 4CJLA 5J2MA 3KD1E 3OYDA 3V1OA 1KLNA 3UIQA 2BANA 4Q0BA 3OJSA 1S1TA 4B8AB 3ZT3A 4F4KA 1IKXA 4ZTJA 3G0ZA 2YHAA 4PA1A 1HJRA 3ZSQA 3HL8A 4CEQA 3H08A 4CHZA 3P1GA 4N56A 3CQ8A 3MAQA 4ZHRA 4FZYA 4CHNA 4CIFA 1BIZA 5HP1A 4DSJA 2ZE2A 4I7FA 3B6PA 4KHYA 2NUBA 4DF4A 3VQAA 4E7JA 2HVHA 1XI1A 4K8ZA 2OPQA 3QINA 3VQ5A 1JLBA 4FLZA 4DWIA 1S9EA 4BDZA 4O55A 3SCXA 4LSNA 2EX3A 4WE1A 1NK4A 2XHBA 1TKXA 3DLKA 2HHXA 3DLEA 3SUQA 2DFEA 2OA8A 1GOAA 3P83D 2IAJA 3MEDA 4DU3A 4DQPA 2FBXA 5J2NA 4BE2A 3PO4A 1UA0A 3V1RA 3NGZA 4IG0A 1BCMA 3K5LA 4HUGA 3ZT0A 5EU7A 4BE0A 2YNIA 1REVA 4HUEA 4G1QA 3RR7A 3SUPA 1NK6A 4I2QA 3V4IA 4K8XA 1W9HA 4UQGA 3P5JA 2VG5A 3SZ2A 4DSFA 3L2QA 3MEEA 1HYVA 4RW4A 1SKWA 4GW6A 1VSMA 2HNYA 1UA1A 3TAMA 1FKPA 4KKOA 4BWMA 3NAEA 3MXIA 2OYQA 2O4IA 3JSMA 4DFJA 3PX6A 4KRFA 5T7BA 2QK9A 2D5RA 4KPYA 3VQCA 4CGFA 4DTMA 3KTQA 3LP1A 3IS9A 3SPZA 4FK0A 4PWDA 1KFDA 3PUFA 1J5OA 4J2BA 4E7KA 1U49A 4RW9A 3RMAA 1CZBA 1Y97A 3QEXA 3AVFA 4IDKA 4RW8A 4AHRA 4FM2A 4FW1A 4YFUA 2FBTA 2HMIA 4F2SA 5FRNA 1N6QA 2D0BA 1VSEA 1BHLA 4Z4IA 2Z1JA 2YKMA 4M3XA 1RTJA 3AVBA 4CHQA 3K5OA 2JLEA 4HCBA 4AHSA 3TAEA 1RBSA 1WLJA 4CJSA 4CFAA 3CYMA 3ZSYA 3MECA 1VSDA 3AA3A 1JLEA 1RCHA 1RT6A 4M3ZA 4ELTA 3NGYA 1RBRA 3TR8A 1R0AA 4EZ6A 1ASVA 1Z25A 1NJZA 1QQCA 5C25A 1C0MA 3HVRA 5KTQA 3K2PA 3PO5A 4XIUA 2OZSA 3HK2A 3C95A 3B6OA 3KJVA 3O3HA 2YNFA 3TI0A 3ISNC 3KKRA 3SPYA 4B9SA 4AHUA 1IG9A 1HYZA 3OYEA 3QNOA 5FDLA 3QESA 1DTTA 3M8RA 3QNNA 3AV9A 2IDOA 3KK3A 1RTDA 4FYDA 1FK9A 3DM2A 4FW2A 1RDAA 4IFVA 4B9VA 3NCIA 4DTNA 4C8MA 1TL1A 3VA0A 3SI6A 1KVCA 2JGUA 1KLMA 1U04A 2YHBA 3LPTA 1O1WA 3NH2A 4KAZA 4CJ5A 3OYAA 3RWUA 4DU1A 4CJ3A 4FLTA 3KK2A 2ATQA 4EP4A 1T8EA 4F8RA 3CM5A 1HQEA 2VG6A 1UWBA 3ZT1A 4FVMA 4DLGA 1BGXT 4M41A 3VN5A 3QEVA 4Z4GA 4DLEA 4O0IA 1ZYQA 3SUOA 1C1AA 2B6AA 3ITHA 3VQQA 1ASUA 4DMNA 2G8FA 5I3UA 3TAPA 3O3FA 3KLFA 3AVNA 1SL1A 3LAMA 3V6DA 2A1RA 3OYKA 2LSNA 2HHVA 1QSYA 4O5BA 4MFBA 1BQMA 2XY5A 1RDCA 3CM6A 4IFYA 4OJRA 1NJYA 3AO1A 1X9SA 3AVGA 3TAGA 1WSIA 1S1VA 2X74A 1D9FA 3AO4A 4W5NA 3PX4A 1QHTA 1RT4A 3CFOA 4DFPA 4CHYA 1NJWA 1RBUA 1JL2A 4CJPA 4OPKA 4J2EA 3DOLA 2YNGA 3LP2A 1VK0A 3VQ7A 1TK5A 4B8CA 2HHWA 3ZSZA 1QTMA 4CJWA 2YNHA 3AO3A 1KTQA 5HRNA 3OS2A 4FJ8A 1W0HA 2WONA 4H4MA 3U3GA 3VQDA 1NKCA 4KHNA 3OYLA 5FRMA 3TWHA 2HNDA 4CJEA 4E7IA 1LV5A 3HYFA 3LPUA 3AO5A 4IG3A 4O0JA 2G8HA 5FROA 2G8UA 1C0TA 1NK9A 4OKJA 4DSLA 2XY8A 5HRPA 4F3TA 1KFSA 1HNIA 1VSLA 1NOYA 4RG8A 3NGIA 3V9XA 4N76A 3NHGA 4LSLA 1RT3A 1JLCA 4QAGA 2Y1IA 1SL0A 2PZSA 2FBYA 3K57A 4FM0A 4DFMA 4GMJB 3LDSA 4CF2A 4B3OA 3MEGA 3AVKA 1S5JA 2GBZA 3M8QA 1BL3A 2XY7A 1RT5A 4DG1A 3JYTA 3DRPA 4E1MA 1FKOA 1I3AA 4M3WA 4KREA 2RKIA 3HP6A 1WSJA 2Q3SA 2R7YA 3OYJA 4DS5A 1RT1A 5CZ1A 2I5JA 2G8VA 1B92A 3DI6A 3NFAA 4C8NA 1T05A 3PY8A 1HQUA 4KB0A 1FXXA 3THVA 5C42A 5J2PA 4OVLA 1J53A 4E1NA 4EZ9A 3G10A 4CEEA 4N5SA 2VWJA 3LZJA 1NK8A 1IH7A 1JLFA 3EZ5A 3SUNA 2RPIA 4PY5A 2OZMA 3VQ4A 2PY5A 4HUFA 4CFCA 4E19A 4CK1A 4O44A 4KI4A 3VQ6A 3TANA 3PX0A 2DFHA 2G8IA 2Y1JA 1IO2A 4Y1DA 2G8WA 2XO7A 4J2AA 5JS1A 4H4OA 3L3VA 3NE6A 3V9UA 2DTUA 1UAXA 4JLHA 5CYMA 4JRQA 4CEDA 1J9AA 1HNVA 1F21A 5CY4A 3V81A 1BCOA 1ZBHA 4CJFA 4B9TA 1ZBIA 1WSGA 4Z4HA 1TK0A 2OPRA 1KRPA 4Z4CA 3KLGA 3AA5X 1X9WA 1LW0A 4QCLA 1QE1A 2P1JA 1EETA 4IBNA 1LWCA 1IKWA 1BISA 1WNSA 4M3YA 1YVUA 1SV5A 1U47A 5DK5A 3I8DA 2HHUA 1UOCA 2IC3A 3NF9A 4ID1A 2YV0X 2Z1HA 1T03A 3AA2A 3KLHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RBT A;  4DQI A;  1NOZ A;  2YKN A;  2BE2 A;  5SZT A;  3DYA A;  4EP5 A;  1HPZ A;  1RNH A;  4ICL A;  1NKB A;  4I2P A;  3EY1 A;  4FJ9 A;  2RF2 A;  2GV9 A;  4F3O A;  1TK8 A;  1KVA A;  1VSH A;  1HMV A;  4J2D A;  3I0S A;  1SUQ A;  4FLX A;  2EHG A;  3QLH A;  3LWL A;  1L3S A;  3TAB A;  2IS3 A;  1JL1 A;  4O4G A;  4KHU A;  2A1S A;  1CZ9 A;  3QEI A;  1A5X A;  3S3N A;  1TKZ A;  3DRR A;  2BDP A;  1CLQ A;  4CGI A;  4KHS A;  1DTQ A;  4JS4 A;  3QET A;  3QO9 A;  2HHQ A;  2KZZ A;  1RDB A;  1JKH A;  1S9G A;  4FM1 A;  3V9W A;  4ELV A;  4FJI A;  1TVR A;  2D0A A;  3F9K A;  1ASW A;  4FK4 A;  3QER A;  4FJM A;  2QKB A;  4CEA A;  4OPJ A;  4AHT A;  2KQ2 A;  3C6U A;  1EXQ A;  3ZCM A;  3NH0 A;  4FLY A;  3ZT2 A;  3S9H A;  4FZX C;  1WSH A;  3OS0 A;  1L3V A;  4B9M A;  1QS4 A;  4CEC A;  1C6V A;  1L3T A;  1IKV A;  1ZBF A;  1S6P A;  4N47 A;  4Z4F A;  4OGE A;  1G15 A;  3ZSW A;  4BAC A;  4Q5V A;  3IAY A;  4CIE A;  4DSK A;  3HST B;  2HHS A;  2HVI A;  4BWJ A;  1IKY A;  2OPP A;  3LAL A;  4CES A;  4CK2 A;  3OYF A;  1C1C A;  3QIP A;  4TSX A;  1RBV A;  1D9D A;  1HYS A;  4E0D A;  1D5A A;  3KKS A;  2B4J A;  2GUI A;  3OVN A;  2XY6 A;  3VQE A;  4DSI A;  3SQ1 A;  2ZD1 A;  1JXB A;  1S1W A;  1VRT A;  3MXJ A;  3HJF A;  2OPS A;  4CJR A;  4LD0 A;  1VSF A;  3F73 A;  3V9S A;  3RMD A;  1BIU A;  1KSP A;  1T7P A;  3AVL A;  3OYB A;  5HBM A;  3AA4 A;  3LAK A;  3K5M A;  1L3U A;  4I9L A;  5KGX A;  1BI4 A;  1YTA A;  2HNZ A;  3M8P A;  4KV8 A;  4DTX A;  4W5T A;  2IGI A;  4L8R B;  3SQ0 A;  1TGO A;  4E3S A;  1RT2 A;  1WSE A;  4NYF A;  3S3M A;  1A5V A;  2QXF A;  3SJJ A;  4FXD A;  4OKE A;  3T19 A;  4CJU A;  3HT3 A;  1VSK A;  2D0C A;  3VQB A;  4B9N A;  4ELU A;  1JLG A;  4FZZ A;  3AO2 A;  1GOC A;  1RTH A;  1TAU A;  1Q8I A;  4PUO A;  4R5P A;  3AVI A;  4KHW A;  3WNH A;  3TAQ A;  2E6M A;  2DFF A;  5KRT A;  3RTV A;  1QSS A;  3U6F A;  4CEB A;  3V9Z A;  4AHV A;  1C0U A;  1NK5 A;  3OY9 A;  2KZM A;  2DY4 A;  4KO0 A;  3C94 A;  4LH4 A;  4W5Q A;  4C8K A;  4FJ5 A;  2IOC A;  3KIO A;  1WSF A;  4M3U A;  3OYI A;  2XRI A;  3RMB A;  3RR8 A;  4C8L A;  3HO1 A;  3CG7 A;  4CK3 A;  3KLE A;  3O3G A;  3QEP A;  4FLW A;  1HRH A;  4KHQ A;  1K6Y A;  4FLU A;  5HLF A;  3KLI A;  3RMC A;  4FJ7 A;  2X6N A;  1Z26 A;  3ULD A;  3ALY A;  1BI4 B;  4KI6 A;  4CIG A;  2RN2 A;  1CXQ A;  3DMJ A;  4W5O A;  4E7H A;  5HRO A;  4FJX A;  2E6L A;  3K58 A;  3KK1 A;  3O4Q A;  4FJN A;  2Z1I A;  3AVJ A;  4ID5 A;  2ZQB A;  4Y1C A;  4DTO A;  1XHZ A;  2HHT A;  1B9D A;  1LWE A;  1KCF A;  1RTI A;  1SKR A;  4KB1 A;  1VSI A;  4FJK A;  4OLB A;  4AHC A;  3M8S A;  2P5G A;  3T3F A;  4IKF A;  4KTQ A;  1TV6 A;  1JXE A;  3L2V A;  3V1Q A;  3NDK A;  3AVC A;  1C1B A;  2F96 A;  3ZSX A;  5HRR A;  4FCY A;  4FJJ A;  1WAJ A;  4DTJ A;  1XC9 A;  3RRH A;  4CF0 A;  4B9U A;  1LAW A;  1XHX A;  3OJU A;  1U48 A;  1D8Y A;  4F2R A;  1RDD A;  3BDP A;  5J1E A;  3HP9 A;  4BDP A;  3RRG A;  4FJG A;  4CEO A;  4ZTF A;  4CJK A;  3E01 A;  1BQN A;  3ASM A;  1LWF A;  1NJX A;  4N41 A;  3DLH A;  4I9Q A;  4W5R A;  3OS1 A;  1U45 A;  5CYQ A;  3LWM A;  1ZBL A;  3WNE A;  4LH5 A;  4Z4E A;  2Z1G A;  4JRP A;  1KVB A;  5J2Q A;  3BGR A;  4DTS A;  2F8S A;  3CFP A;  5E41 A;  1B9F A;  3ZT4 A;  3OYM A;  1X1P A;  3ZSO A;  4JS5 A;  1SKS A;  2G8K A;  3SV4 A;  4DU4 A;  3OYH A;  3SQ2 A;  4CJV A;  4GVM A;  3C6T A;  4CGD A;  4DSE A;  2FBV A;  3DLR A;  3IRX A;  3A2F A;  4M3T A;  4RW7 A;  3HPO A;  3ZSV A;  4CHP A;  3MXM A;  2E4L A;  3VQP A;  3OYG A;  3DLB A;  2KFN A;  3IG1 A;  3VQ8 A;  4CJT A;  3NH1 A;  2AJQ A;  4B9L A;  1YT3 A;  2KW4 A;  2O4G A;  1NK7 A;  3HVT A;  3SYZ A;  1EX4 A;  3LP3 A;  3QEW A;  4FK2 A;  4M42 A;  4OGC A;  4CGJ A;  1XWL A;  4CFD A;  4NCA A;  3HM9 A;  1X9M A;  1SL2 A;  1WN7 A;  4PQU A;  3AVA A;  1S1X A;  3FFI A;  2QKK A;  4NCB A;  4HHT A;  4DTR A;  4DS4 A;  2ITG A;  1EKE A;  1I39 A;  3AVM A;  4KFB A;  4FLV A;  1NKE A;  4HTU A;  4FJH A;  4DQS A;  1LAV A;  4CER A;  4CGH A;  3PV8 A;  3QIO A;  3WNG A;  1ZBU A;  4Z0U A;  3U3Y A;  1YTU A;  2B5J A;  4OKK A;  4CE9 A;  4C8O A;  4DTP A;  5KI6 A;  3OYC A;  1LW2 A;  1TL3 A;  4CJQ A;  1Q9X A;  1QSL A;  2HW3 A;  3O4N A;  3SQ4 A;  4DQR A;  2PYJ A;  1CXU A;  4NCG A;  4HVJ A;  4H8K A;  4DFK A;  3D45 A;  3K59 A;  2HB5 A;  4CEZ A;  4E89 A;  4CCH A;  4M3R A;  3LAN A;  4FJL A;  3L2R A;  1ITG A;  4RW6 A;  4DF8 A;  1TKD A;  5DMR A;  2KTQ A;  4AH9 A;  2BGG A;  5CZ2 A;  2F8T A;  2WOM A;  2W42 A;  3TAR A;  4DTU A;  4M45 A;  2VG7 A;  3L8B A;  1TAQ A;  2X6S A;  3AVH A;  4BDY A;  3TAF A;  4LY7 A;  4B08 A;  1VSJ A;  1MU2 A;  3LZI A;  1L5U A;  3NBP A;  2PYL A;  4CHO A;  3L2W A;  1A5W A;  2P51 A;  3DRS A;  4KTW A;  3NF7 A;  3WNF A;  4CF9 A;  1RIL A;  4BE1 A;  3HPH A;  3HXM A;  4CJ4 A;  3EYZ A;  4NYN A;  1N5Y A;  3T1A A;  2P5O A;  2FC0 A;  3L3U A;  4CF1 A;  4DQQ A;  1NK0 A;  4CF8 A;  4CEF A;  4MQ3 A;  3K5N A;  4AIL C;  2KFZ A;  5K14 A;  5JS2 A;  3NF8 A;  1VRU A;  2VWK A;  1TKT A;  5C24 A;  5HRS A;  5SWM A;  3SNN A;  1U4B A;  3VQ9 A;  1JLA A;  3D0P A;  3SV3 A;  4CGG A;  3KD5 E;  1S1U A;  4OLA A;  4YNQ A;  3CFR A;  2ETJ A;  1RT7 A;  1WAF A;  1S6Q A;  1J54 A;  1GOB A;  3DOK A;  3HPG A;  4CFB A;  4E7L A;  3L2U A;  5KRS A;  5KGW A;  1JLQ A;  4HCC A;  1DLO A;  3OYN A;  3NF6 A;  3ZSR A;  2X78 A;  3DLG A;  1EP4 A;  3S3O A;  4QOZ B;  3I0R A;  3VA3 A;  5D3G A;  1Q9Y A;  3LP0 A;  5I42 A;  4KTZ A;  4CJL A;  5J2M A;  3KD1 E;  3OYD A;  3V1O A;  1KLN A;  3UIQ A;  2BAN A;  4Q0B A;  3OJS A;  1S1T A;  4B8A B;  3ZT3 A;  4F4K A;  1IKX A;  4ZTJ A;  3G0Z A;  2YHA A;  4PA1 A;  1HJR A;  3ZSQ A;  3HL8 A;  4CEQ A;  3H08 A;  4CHZ A;  3P1G A;  4N56 A;  3CQ8 A;  3MAQ A;  4ZHR A;  4FZY A;  4CHN A;  4CIF A;  1BIZ A;  5HP1 A;  4DSJ A;  2ZE2 A;  4I7F A;  3B6P A;  4KHY A;  2NUB A;  4DF4 A;  3VQA A;  4E7J A;  2HVH A;  1XI1 A;  4K8Z A;  2OPQ A;  3QIN A;  3VQ5 A;  1JLB A;  4FLZ A;  4DWI A;  1S9E A;  4BDZ A;  4O55 A;  3SCX A;  4LSN A;  2EX3 A;  4WE1 A;  1NK4 A;  2XHB A;  1TKX A;  3DLK A;  2HHX A;  3DLE A;  3SUQ A;  2DFE A;  2OA8 A;  1GOA A;  3P83 D;  2IAJ A;  3MED A;  4DU3 A;  4DQP A;  2FBX A;  5J2N A;  4BE2 A;  3PO4 A;  1UA0 A;  3V1R A;  3NGZ A;  4IG0 A;  1BCM A;  3K5L A;  4HUG A;  3ZT0 A;  5EU7 A;  4BE0 A;  2YNI A;  1REV A;  4HUE A;  4G1Q A;  3RR7 A;  3SUP A;  1NK6 A;  4I2Q A;  3V4I A;  4K8X A;  1W9H A;  4UQG A;  3P5J A;  2VG5 A;  3SZ2 A;  4DSF A;  3L2Q A;  3MEE A;  1HYV A;  4RW4 A;  1SKW A;  4GW6 A;  1VSM A;  2HNY A;  1UA1 A;  3TAM A;  1FKP A;  4KKO A;  4BWM A;  3NAE A;  3MXI A;  2OYQ A;  2O4I A;  3JSM A;  4DFJ A;  3PX6 A;  4KRF A;  5T7B A;  2QK9 A;  2D5R A;  4KPY A;  3VQC A;  4CGF A;  4DTM A;  3KTQ A;  3LP1 A;  3IS9 A;  3SPZ A;  4FK0 A;  4PWD A;  1KFD A;  3PUF A;  1J5O A;  4J2B A;  4E7K A;  1U49 A;  4RW9 A;  3RMA A;  1CZB A;  1Y97 A;  3QEX A;  3AVF A;  4IDK A;  4RW8 A;  4AHR A;  4FM2 A;  4FW1 A;  4YFU A;  2FBT A;  2HMI A;  4F2S A;  5FRN A;  1N6Q A;  2D0B A;  1VSE A;  1BHL A;  4Z4I A;  2Z1J A;  2YKM A;  4M3X A;  1RTJ A;  3AVB A;  4CHQ A;  3K5O A;  2JLE A;  4HCB A;  4AHS A;  3TAE A;  1RBS A;  1WLJ A;  4CJS A;  4CFA A;  3CYM A;  3ZSY A;  3MEC A;  1VSD A;  3AA3 A;  1JLE A;  1RCH A;  1RT6 A;  4M3Z A;  4ELT A;  3NGY A;  1RBR A;  3TR8 A;  1R0A A;  4EZ6 A;  1ASV A;  1Z25 A;  1NJZ A;  1QQC A;  5C25 A;  1C0M A;  3HVR A;  5KTQ A;  3K2P A;  3PO5 A;  4XIU A;  2OZS A;  3HK2 A;  3C95 A;  3B6O A;  3KJV A;  3O3H A;  2YNF A;  3TI0 A;  3ISN C;  3KKR A;  3SPY A;  4B9S A;  4AHU A;  1IG9 A;  1HYZ A;  3OYE A;  3QNO A;  5FDL A;  3QES A;  1DTT A;  3M8R A;  3QNN A;  3AV9 A;  2IDO A;  3KK3 A;  1RTD A;  4FYD A;  1FK9 A;  3DM2 A;  4FW2 A;  1RDA A;  4IFV A;  4B9V A;  3NCI A;  4DTN A;  4C8M A;  1TL1 A;  3VA0 A;  3SI6 A;  1KVC A;  2JGU A;  1KLM A;  1U04 A;  2YHB A;  3LPT A;  1O1W A;  3NH2 A;  4KAZ A;  4CJ5 A;  3OYA A;  3RWU A;  4DU1 A;  4CJ3 A;  4FLT A;  3KK2 A;  2ATQ A;  4EP4 A;  1T8E A;  4F8R A;  3CM5 A;  1HQE A;  2VG6 A;  1UWB A;  3ZT1 A;  4FVM A;  4DLG A;  1BGX T;  4M41 A;  3VN5 A;  3QEV A;  4Z4G A;  4DLE A;  4O0I A;  1ZYQ A;  3SUO A;  1C1A A;  2B6A A;  3ITH A;  3VQQ A;  1ASU A;  4DMN A;  2G8F A;  5I3U A;  3TAP A;  3O3F A;  3KLF A;  3AVN A;  1SL1 A;  3LAM A;  3V6D A;  2A1R A;  3OYK A;  2LSN A;  2HHV A;  1QSY A;  4O5B A;  4MFB A;  1BQM A;  2XY5 A;  1RDC A;  3CM6 A;  4IFY A;  4OJR A;  1NJY A;  3AO1 A;  1X9S A;  3AVG A;  3TAG A;  1WSI A;  1S1V A;  2X74 A;  1D9F A;  3AO4 A;  4W5N A;  3PX4 A;  1QHT A;  1RT4 A;  3CFO A;  4DFP A;  4CHY A;  1NJW A;  1RBU A;  1JL2 A;  4CJP A;  4OPK A;  4J2E A;  3DOL A;  2YNG A;  3LP2 A;  1VK0 A;  3VQ7 A;  1TK5 A;  4B8C A;  2HHW A;  3ZSZ A;  1QTM A;  4CJW A;  2YNH A;  3AO3 A;  1KTQ A;  5HRN A;  3OS2 A;  4FJ8 A;  1W0H A;  2WON A;  4H4M A;  3U3G A;  3VQD A;  1NKC A;  4KHN A;  3OYL A;  5FRM A;  3TWH A;  2HND A;  4CJE A;  4E7I A;  1LV5 A;  3HYF A;  3LPU A;  3AO5 A;  4IG3 A;  4O0J A;  2G8H A;  5FRO A;  2G8U A;  1C0T A;  1NK9 A;  4OKJ A;  4DSL A;  2XY8 A;  5HRP A;  4F3T A;  1KFS A;  1HNI A;  1VSL A;  1NOY A;  4RG8 A;  3NGI A;  3V9X A;  4N76 A;  3NHG A;  4LSL A;  1RT3 A;  1JLC A;  4QAG A;  2Y1I A;  1SL0 A;  2PZS A;  2FBY A;  3K57 A;  4FM0 A;  4DFM A;  4GMJ B;  3LDS A;  4CF2 A;  4B3O A;  3MEG A;  3AVK A;  1S5J A;  2GBZ A;  3M8Q A;  1BL3 A;  2XY7 A;  1RT5 A;  4DG1 A;  3JYT A;  3DRP A;  4E1M A;  1FKO A;  1I3A A;  4M3W A;  4KRE A;  2RKI A;  3HP6 A;  1WSJ A;  2Q3S A;  2R7Y A;  3OYJ A;  4DS5 A;  1RT1 A;  5CZ1 A;  2I5J A;  2G8V A;  1B92 A;  3DI6 A;  3NFA A;  4C8N A;  1T05 A;  3PY8 A;  1HQU A;  4KB0 A;  1FXX A;  3THV A;  5C42 A;  5J2P A;  4OVL A;  1J53 A;  4E1N A;  4EZ9 A;  3G10 A;  4CEE A;  4N5S A;  2VWJ A;  3LZJ A;  1NK8 A;  1IH7 A;  1JLF A;  3EZ5 A;  3SUN A;  2RPI A;  4PY5 A;  2OZM A;  3VQ4 A;  2PY5 A;  4HUF A;  4CFC A;  4E19 A;  4CK1 A;  4O44 A;  4KI4 A;  3VQ6 A;  3TAN A;  3PX0 A;  2DFH A;  2G8I A;  2Y1J A;  1IO2 A;  4Y1D A;  2G8W A;  2XO7 A;  4J2A A;  5JS1 A;  4H4O A;  3L3V A;  3NE6 A;  3V9U A;  2DTU A;  1UAX A;  4JLH A;  5CYM A;  4JRQ A;  4CED A;  1J9A A;  1HNV A;  1F21 A;  5CY4 A;  3V81 A;  1BCO A;  1ZBH A;  4CJF A;  4B9T A;  1ZBI A;  1WSG A;  4Z4H A;  1TK0 A;  2OPR A;  1KRP A;  4Z4C A;  3KLG A;  3AA5 X;  1X9W A;  1LW0 A;  4QCL A;  1QE1 A;  2P1J A;  1EET A;  4IBN A;  1LWC A;  1IKW A;  1BIS A;  1WNS A;  4M3Y A;  1YVU A;  1SV5 A;  1U47 A;  5DK5 A;  3I8D A;  2HHU A;  1UOC A;  2IC3 A;  3NF9 A;  4ID1 A;  2YV0 X;  2Z1H A;  1T03 A;  3AA2 A;  3KLH A; 
#chains in the Genus database with same CATH topology
 2NLX A;  3MX5 A;  3VMF B;  3EE9 A;  4DQI A;  3DXM A;  3J80 O;  3O1B A;  3DYA A;  4LFA K;  4ICL A;  4I2P A;  1V4T A;  3JXU A;  4RTF D;  4FJ9 A;  2F4V K;  2P9S B;  4F3O A;  1TK8 A;  4CBX A;  4J2D A;  3A5N C;  3LWL A;  1Q7Y O;  3S3N A;  1TKZ A;  4JKF A;  2NNW A;  2HHQ A;  1S9G A;  1ASW A;  1SAZ A;  2QKB A;  3ULE B;  1EXQ A;  4FLY A;  4BQZ A;  4DHY A;  1C6V A;  1L3T A;  4N47 A;  4NLB A;  1ATR A;  4Q5V A;  2H3G X;  4FWS A;  4CZM A;  3C6H A;  2NRR A;  4CK2 A;  1VQL N;  1RBV A;  1T44 A;  1D9D A;  1HYS A;  3KKS A;  3OVN A;  4GNI A;  1WUA A;  3SQ1 A;  2UXB K;  1JXB A;  1S1W A;  4YDU C;  4CJR A;  4LD0 A;  1VSF A;  3RMD A;  5M1F A;  3AVL A;  3OYB A;  1N34 K;  4I9L A;  1YJ9 N;  3QFP A;  3CME N;  4MDA A;  2CH6 A;  4DV0 K;  2P9P B;  3SJJ A;  3T19 A;  4CJU A;  4ISE A;  1VSK A;  3VQB A;  1JLG A;  3AO2 A;  1RTH A;  1Q8I A;  1P90 A;  4KH4 A;  5AQN A;  1JCF A;  4CEB A;  3V9Z A;  1C0U A;  2P9U A;  3EE8 A;  2ZJP L;  5M1P A;  2IOC A;  2ZGZ A;  3R9P A;  3CXC M;  4M3U A;  4JI6 K;  4CZK A;  3MCA B;  3CG7 A;  3ZYY X;  5EY4 A;  4GV3 A;  4FLW A;  1K6Y A;  2FF6 A;  3RMC A;  4FJ7 A;  3D2E B;  3T1H K;  1GLL O;  4KI6 A;  3ALY A;  1HJO A;  3GG4 A;  4FJX A;  3K58 A;  3KK1 A;  4Y1C A;  4DTO A;  4DUZ K;  1B9D A;  2HHT A;  1LWE A;  1KCF A;  1RTI A;  3U8X A;  1SKR A;  4BRH A;  4OLB A;  3CQY A;  4AHC A;  4BR0 A;  3L2V A;  3J7Y P;  1X9J A;  3CHW A;  4JKD A;  5HRR A;  1XC9 A;  2Q97 A;  3O08 A;  2YCH A;  3RRH A;  2W6L A;  1D8Y A;  1U48 A;  3CC7 N;  3M5R A;  5J1E A;  4BDP A;  3E01 A;  4K25 A;  3PSI A;  1LWF A;  1NJX A;  4N41 A;  3A5O C;  2F7T A;  3EO3 A;  3SLC A;  4JI2 K;  5AQZ A;  4IJA A;  4JRP A;  1KVB A;  5F1X A;  3CFP A;  5E41 A;  3ZSO A;  3MX2 A;  4DU4 A;  3OYH A;  1VQ9 N;  2J4R A;  4EAH D;  4BY9 C;  2VQF K;  1BU6 O;  4CGD A;  4M3T A;  3IRX A;  3HPO A;  3ZSV A;  1YJW N;  3EZW A;  4R79 A;  2E4L A;  2KFN A;  3VQ8 A;  2AJQ A;  2O4G A;  3WXL A;  2HBM A;  3LP3 A;  4X64 K;  4OGC A;  3CCQ N;  4M42 A;  1NNE A;  1VQ4 N;  2Q0R A;  4CVN E;  4BVP A;  1X9M A;  3SBT A;  1SL2 A;  4JKG A;  4HHT A;  4DTR A;  5AFU A;  4DS4 A;  4FLV A;  4KFB A;  1NKE A;  3ENB A;  4CGH A;  3PV8 A;  4PKG A;  3U9Z A;  2P9P A;  1YTU A;  4FVU A;  2B5J A;  3RSE A;  3O9Q A;  3CD6 N;  4BRE A;  3BY5 A;  3OTO K;  3PLA A;  3O4N A;  1CXU A;  3TSU A;  1BG3 A;  4H5V A;  3VGL A;  3L2R A;  3ZET B;  1ITG A;  4RW6 A;  4H03 B;  4DR5 K;  1TKD A;  4AH9 A;  2GTD A;  1MWM A;  1VQP N;  2BTF A;  3AVH A;  4LY7 A;  1WBD A;  1QQN A;  1VSJ A;  4ISF A;  4CHO A;  3L2W A;  3DRS A;  4KTW A;  3NF7 A;  1I94 K;  1QHA A;  4CF9 A;  5E84 A;  3CC4 N;  4IEI A;  5KPZ A;  4NYN A;  1HLU A;  2KKZ A;  2FC0 A;  1NJI O;  2JWK A;  2IVP A;  4MQ3 A;  2E2Q A;  3K5N A;  4AIL C;  1P8Z A;  5JS2 A;  1MA9 B;  5C24 A;  5HRS A;  5SWM A;  2VQE K;  1NWK A;  3IUC A;  1RT7 A;  1S6Q A;  5BRD A;  5FPM A;  5KGW A;  4A5A A;  4C23 A;  3NF6 A;  2GEM A;  3DLG A;  4B3S K;  5I42 A;  1S3X A;  4KTZ A;  5J2M A;  5AZJ B;  4Y0W A;  3OJS A;  3ZT3 A;  1IKX A;  1XUP O;  4ZTJ A;  1HJR A;  3HL8 A;  1DEJ A;  4FZY A;  3CCR N;  3B6P A;  4KHY A;  4BRM A;  1VQ5 N;  5AFU H;  3WQT A;  4A5B A;  5AQS A;  5EVZ A;  3VQ5 A;  4FLZ A;  4WE1 A;  2EX3 A;  4WF9 L;  3E66 A;  3CJ1 A;  3DLE A;  2A5X A;  2DFE A;  4IDH A;  4DU3 A;  3PO4 A;  4IG0 A;  3K5L A;  3ZT0 A;  5EU7 A;  3RR7 A;  4BRL A;  1XNQ K;  1W9H A;  5C15 A;  4UQG A;  4WQ4 C;  3L2Q A;  1HYV A;  1VSM A;  2HNY A;  4BRO A;  2V51 B;  3ZLJ A;  4B1W B;  2OYQ A;  5JMV A;  5HOO A;  4H5R A;  5AJ3 K;  1S22 A;  4L3Q A;  5EX5 A;  3LP1 A;  1KFD A;  1J5O A;  1O13 A;  1CZB A;  2FF3 B;  3CPE A;  4IDK A;  4RW8 A;  4AHR A;  4YFU A;  1HKG A;  2FBT A;  4F2S A;  3AVB A;  2JLE A;  1OH5 A;  4HCB A;  4AHS A;  1HR0 K;  2QWQ A;  3AA3 A;  5AQW A;  1XMO K;  3VF4 A;  4LF9 K;  3TR8 A;  1NJZ A;  1JCE A;  4BVO A;  5BRF A;  3HVR A;  2RHK A;  5AQJ A;  2YNF A;  4ILJ A;  1ZXO A;  1IG9 A;  3OYE A;  4B1Z A;  3QNO A;  4JNE A;  3ZEU B;  3AV9 A;  1FK9 A;  4B9V A;  1NM1 A;  3NVM A;  3NCI A;  3JS6 A;  4C8M A;  5JIC A;  1TL1 A;  2O8F A;  3HOT A;  3SI6 A;  1SS6 A;  3SJH A;  3LPT A;  1O1W A;  4LC9 B;  4CJ5 A;  3OYA A;  4CJ3 A;  4EP4 A;  2V7Z A;  4FOE A;  1UWB A;  3ZT1 A;  4FVM A;  4DLG A;  1BGX T;  3VN5 A;  2HF4 A;  4BR7 A;  1NGE A;  5A2Q O;  1ZYQ A;  1IBM K;  3HRG A;  3SUO A;  2G8F A;  5I3U A;  1FJG K;  2A1R A;  3KHY A;  2ASP A;  2LSN A;  1KQS M;  2GWK A;  4MFB A;  1BQM A;  2ASM A;  5JLH A;  3AVG A;  4F9O A;  3WQU A;  3TAG A;  1S1V A;  1D9F A;  1EWQ A;  1RBU A;  1JL2 A;  4CJP A;  3DOL A;  1QQO A;  5GAG P;  3T7Z A;  4LFB K;  4B8C A;  4A61 A;  2HHW A;  3OS2 A;  1KTQ A;  5HRN A;  4HTL A;  4H4M A;  3VQD A;  3OYL A;  5FRM A;  2P9L B;  3TWH A;  2HND A;  1LV5 A;  3C7N B;  4KHU A;  4DKW A;  4IG3 A;  2D0P A;  1C0T A;  1NK9 A;  3H1Q A;  4OKJ A;  4DSL A;  4EFH A;  1LCU A;  5HRP A;  4AF1 A;  1NOY A;  2E2O A;  4N76 A;  2P9N A;  4WFB L;  3KK7 A;  1NGI A;  3K57 A;  4DFM A;  1ATN A;  2P9K A;  4GMJ B;  1S5J A;  4MLE A;  1RT5 A;  2HBJ A;  2RKI A;  1Q81 O;  3LDO A;  5CZ1 A;  2NRH A;  3THY A;  4KB0 A;  3THV A;  1J53 A;  3MK6 A;  3OBY A;  2UXC K;  1H1V A;  3LZJ A;  1JLF A;  1OH6 A;  4ILH A;  4E19 A;  2ZWH A;  2DFH A;  2Y1J A;  1IO2 A;  2G8W A;  4J2A A;  1N33 K;  3TSP A;  3NE6 A;  3VF6 A;  4JRQ A;  4YY3 K;  4Z4C A;  3FE1 A;  2A41 A;  2P1J A;  2WC9 A;  4IBN A;  1BIS A;  3DXK A;  1U47 A;  3LL3 A;  2HHU A;  3CC2 N;  1T03 A;  4ID1 A;  4B3R K;  3AA2 A;  3KLH A;  1NGH A;  1JJ2 M;  3O1W A;  3VEX A;  2YKN A;  2BE2 A;  3W3D A;  2DPN A;  2RF2 A;  2GV9 A;  1HX1 A;  1VSH A;  2W41 A;  1XC3 A;  1GLC G;  2IS3 A;  3U4L A;  2A1S A;  3QEI A;  2HMP A;  1CLQ A;  1BWF O;  1HUX A;  4BC5 A;  2KZZ A;  2OAN A;  4ELV A;  4FM1 A;  3CER A;  3F9K A;  3QER A;  3SAG A;  1E4F T;  3ZT2 A;  2P9L A;  4BRF A;  1L3V A;  4JI4 K;  4CEC A;  1IKV A;  4MO5 A;  4Z4F A;  1G15 A;  3ZSW A;  4OPA A;  4BAC A;  1NGD A;  3CCL N;  4JK7 A;  1ZBS A;  1W97 L;  3ENH A;  2HHS A;  3DXM B;  4C1N K;  3CCE N;  3LAL A;  3OYF A;  3VF2 A;  4E0D A;  4DSI A;  1GLJ O;  2B4J A;  4DV6 K;  4JI8 K;  2ZD1 A;  3BEX A;  1VRT A;  2OPS A;  3V9S A;  3TTD A;  5HBM A;  3AA4 A;  3VTI A;  5KGX A;  2HNZ A;  1DKG D;  1TGO A;  4JHD A;  4BRK A;  4NYF A;  4CD3 A;  3HT3 A;  4ELU A;  1NGB A;  3CCM N;  3ZX0 A;  1GOC A;  2YI1 A;  5TKY A;  1NLV A;  4CZE A;  2F9W A;  3RTV A;  1QSS A;  3U6F A;  2E88 A;  3TSQ A;  1NK5 A;  3VET A;  5C10 A;  4KO0 A;  4LH4 A;  4W5Q A;  4C8K A;  3KIO A;  1WSF A;  4AM6 A;  2GWJ A;  3OYI A;  4C8L A;  2VYP A;  4CK3 A;  3L4I A;  3O3G A;  2UUA K;  3H45 C;  4YOU A;  4FLU A;  5GIP A;  2ZM6 K;  2HBL A;  2X6N A;  1XMQ K;  3GL1 A;  3QML A;  4W5O A;  3OHR A;  4FJN A;  1VSI A;  4FJK A;  5GAD P;  3T3F A;  1TV6 A;  3NDK A;  3B8A X;  3ZSX A;  4FCY A;  1WAJ A;  4DTJ A;  4B9U A;  1IBK K;  3RVC A;  1LAW A;  1XHX A;  3OJU A;  4F2R A;  3BDP A;  3HP9 A;  2YHW A;  1OH7 A;  3RRG A;  4CEO A;  2P9U B;  5AQM A;  4DR4 K;  3OS1 A;  1U45 A;  5CYQ A;  4MO4 A;  1VQM N;  3OYM A;  4JS5 A;  3A0I X;  3SV4 A;  2ZGY A;  3SMP A;  4GVM A;  3WXI A;  2IIR A;  4RW7 A;  2F9T A;  3NH1 A;  1NK7 A;  2NZT A;  4CGJ A;  5H1S Q;  4CFD A;  4NCA A;  2O8E A;  1C0F A;  1S1X A;  1IG8 A;  4NCB A;  4YOX A;  1QZ5 A;  1NGG A;  2ITG A;  3AVM A;  4CER A;  1BUP A;  2W6K A;  3WEE A;  4BRN A;  4C8O A;  4DTP A;  5KI6 A;  3GOI A;  3OYC A;  1LW2 A;  3ID8 A;  4YOT A;  1QSL A;  2IVO A;  4NCG A;  3BP8 A;  4JK9 A;  3CCS N;  4IXC A;  4DFK A;  3D45 A;  4BC4 A;  4E89 A;  3K59 A;  3R1X A;  5ADX H;  4IJN A;  4DF8 A;  2KTQ A;  3O8M A;  5CZ2 A;  2F8T A;  2W42 A;  4FSV A;  3TAR A;  4BDY A;  5AZI A;  4B08 A;  1MU2 A;  1L5U A;  3NBP A;  4WCE L;  4BE1 A;  4JKC A;  4JKG B;  1JCG A;  2AA4 A;  3T1A A;  3L3U A;  4CF1 A;  1MDU B;  3RSE B;  1N32 K;  1BO5 O;  2YHX A;  3SNN A;  3HZ6 A;  3VQ9 A;  4YNQ A;  3K0S A;  4H0Y B;  4H0T B;  3DOK A;  4E7L A;  1KAZ A;  5KRS A;  4HCC A;  3ZSR A;  2X78 A;  2GUP A;  3I0R A;  3LP0 A;  1W7A A;  3R3L A;  3OYD A;  3V1O A;  3CJC A;  4F4K A;  3EN9 A;  3CIP A;  3G0Z A;  2YHA A;  1VQK N;  3ZSQ A;  3SK3 A;  4NLC A;  2UU9 K;  4ZHR A;  4JK8 A;  4FWK A;  3O6W A;  4YOR A;  4DB3 A;  3PIP L;  1HKB A;  4BRD A;  4CJ7 A;  4DF4 A;  4E7J A;  1XI1 A;  4I6M A;  1K73 O;  4K8Z A;  3D6R A;  4H5T A;  3QIN A;  5BRE A;  1JLB A;  4DWI A;  4OX9 K;  3R8E A;  2HHH K;  2XHB A;  1TKX A;  2HOE A;  2HHX A;  2OA8 A;  3N4P A;  2IAJ A;  5GIO A;  3MED A;  4BG8 A;  4DQP A;  4DR3 K;  1Z6R A;  1V4S A;  1UA0 A;  1KC8 O;  2O8C A;  2OTJ N;  3FZL A;  4BE0 A;  4U67 L;  4B3M K;  1REV A;  5AQU A;  3SUP A;  3GE1 A;  4B9Q A;  1NK6 A;  3FZF A;  3H3O B;  3MCP A;  1RFQ A;  2GEL A;  3IDH A;  3SZ2 A;  4DSF A;  3H3N O;  3S41 A;  1UA1 A;  3TAM A;  4KKO A;  5BR9 A;  1Q86 O;  3JSM A;  3PX6 A;  3D2F B;  5AQP A;  5T7B A;  2QK9 A;  4KPY A;  3KTQ A;  1OH8 A;  4J2B A;  3WXM B;  3VEO A;  4OO1 J;  2A42 A;  3AVF A;  4FW1 A;  2HMI A;  3MN9 A;  1N6Q A;  1VSE A;  3L6Q A;  4FWL A;  3IMX A;  3AGK A;  1RBS A;  1WLJ A;  4E1J A;  4GVE A;  3ZSY A;  3MEC A;  3EEQ A;  4M3Z A;  4ELT A;  3M6G A;  4GV6 A;  1U6Z A;  1QQC A;  3K2P A;  1WOQ A;  3GDQ A;  2E2N A;  3TI0 A;  3O3H A;  4A59 A;  2ZF5 O;  3QES A;  1DTT A;  2IDO A;  1CZA N;  1TYQ A;  4LF4 K;  4DV4 K;  3VA0 A;  1KVC A;  1KLM A;  3H6E A;  5E26 A;  2YHB A;  4KAZ A;  3RWU A;  4DU1 A;  4FLT A;  3CM5 A;  4CZL A;  2NRT A;  5I9E B;  4RWT A;  4DLE A;  4O0I A;  1C1A A;  1YI2 N;  5FPN A;  4BRQ A;  3O3F A;  3KLF A;  1M90 O;  5AQT A;  4IZ9 A;  3LAM A;  3SBG A;  1VQ8 N;  3MN5 A;  1U2V A;  2XY5 A;  1X9S A;  4OJR A;  3CM6 A;  1WSI A;  2X74 A;  4NXN K;  1QHT A;  1TUU A;  3U9D A;  4H5N A;  4DFP A;  3HTV A;  4O8U A;  4BC3 A;  4J2E A;  3VOV A;  3VQ7 A;  1W2B M;  2O8F B;  2VWB A;  2YJE A;  4K42 A;  1NKC A;  5EXW A;  3UKU B;  1SQK A;  2QWP A;  3I55 N;  3SAH A;  3D2F A;  5BPM A;  3AO5 A;  2G8H A;  1BDG A;  2P9I A;  1HNZ K;  5BRH A;  5CHI A;  1VSL A;  3V9X A;  4BRP A;  4X65 K;  3O9T A;  1SL0 A;  2FBY A;  3LDS A;  3FLC O;  2HBK A;  3AVK A;  3MEG A;  2XY7 A;  5F2R A;  4JI0 K;  3H1V X;  1S72 N;  4DG1 A;  3DRP A;  1FKO A;  1I3A A;  4YHH K;  2QTD A;  3HP6 A;  4JV5 K;  1WSJ A;  2Q3S A;  3P31 A;  1RT1 A;  1MWK A;  3DI6 A;  1RGI A;  3NFA A;  1T05 A;  4PHT X;  2QWL A;  5C42 A;  3FZM A;  4OVL A;  4E1N A;  5J2P A;  4EZ9 A;  1YHQ N;  3VEV A;  2ITM A;  1IH7 A;  2RPI A;  1KAY A;  3VQ4 A;  2PY5 A;  5AQH A;  1NGA A;  2G8I A;  5JS1 A;  3LM9 A;  2O8D A;  4BQL A;  1J9A A;  2P9N B;  3ZX3 A;  4CJF A;  1ZBI A;  3FZK A;  1WSG A;  1BA0 A;  2P9K B;  2VCP A;  2A3Z A;  3AA5 X;  3A5L C;  1LW0 A;  1IJJ A;  1QE1 A;  1X9W A;  4BRA A;  1EET A;  1WNS A;  3MDQ A;  2I7P A;  4BRC A;  1UOC A;  3K5O A;  3NF9 A;  3QBX A;  4CIF A;  1ILY A;  3THY B;  1NOZ A;  2QWN A;  4EP5 A;  1HPZ A;  1RNH A;  1NKB A;  3P4I A;  1K8K A;  1KVA A;  2I7N A;  4WQ5 A;  3I0S A;  1SUQ A;  3C0B A;  4FLX A;  3QLH A;  4O4G A;  1JL1 A;  4XEI A;  4JEP A;  4B3T K;  4YOY A;  3CJA A;  3DRR A;  4CGI A;  3CET A;  4JS4 A;  4LFC K;  1RDB A;  3HSC A;  4FJI A;  2YJF A;  3QB0 A;  1TVR A;  2D0A A;  4FK4 A;  5AQF A;  3DJC A;  3PIO L;  4OPJ A;  4FJM A;  4AHT A;  2KQ2 A;  4B1V A;  3UKU A;  3ZCM A;  3NH0 A;  1HPM A;  4IEE A;  3DXK B;  1S6P A;  3H46 O;  5BN9 A;  1VQ7 N;  2HVI A;  2OPP A;  3THX B;  1C1C A;  3LDN A;  2GUI A;  4DR7 K;  3VQE A;  2BH1 A;  1LOT B;  3E9L A;  3F73 A;  1KSP A;  1BIU A;  3VTH A;  1L3U A;  3LAK A;  1BI4 A;  2QWO A;  5KPR A;  4W5T A;  4L8R B;  4E3S A;  1RT2 A;  1WSE A;  3WUH A;  4OKE A;  4QS7 A;  4B9N A;  5DM6 L;  1VQ6 N;  4PKI A;  4PUO A;  3AVI A;  4KHW A;  3TAQ A;  2E6M A;  2DFF A;  3JAM O;  5KRT A;  3VGK A;  4AHV A;  1GLF O;  3HM8 A;  3OY9 A;  4DV3 K;  3UKR A;  2DY4 A;  2O8B A;  4DV5 K;  4FJ5 A;  2XRI A;  3RR8 A;  4QS8 A;  3HO1 A;  4DR1 K;  3QEP A;  1HRH A;  5HLF A;  1N8R O;  2Q2R A;  3AY9 A;  1Z26 A;  4XH4 A;  2RN2 A;  1CXQ A;  5HRO A;  2WUS A;  3PSF A;  2Z1I A;  3AVJ A;  3KWG A;  2ZQB A;  2QEX N;  1XHZ A;  4JHD B;  3I56 N;  4KB1 A;  3ATU A;  1WB9 A;  2CH5 A;  1JXE A;  3HOS A;  2F96 A;  4FJJ A;  2VGM A;  4CF0 A;  3P38 A;  1RDD A;  4FJG A;  3VPZ A;  4Z94 A;  3CCU N;  4BR2 A;  4CZF A;  3DLH A;  4I9Q A;  3LWM A;  4BGB A;  1ZBL A;  3WNE A;  2QWR A;  2Z1G A;  2RE2 A;  4DTS A;  4B9M A;  1B9F A;  5JVG L;  1X1P A;  2G8K A;  3C6T A;  3DLR A;  3G6E N;  3MXM A;  4NO7 A;  3THX A;  2V7Y A;  4KBO A;  4LF8 K;  4B9L A;  1YT3 A;  2KW4 A;  4FWO A;  3QIC A;  3EL2 A;  5M1K A;  3QEW A;  4FK2 A;  1XWL A;  2HF3 A;  4JD2 A;  4PQU A;  3AVA A;  2E1Z A;  2QM1 A;  3I8B A;  3CQX A;  4HTU A;  3LDQ A;  4DQS A;  1LAV A;  4IOX A;  3QIO A;  3WNG A;  1ZBU A;  4Z0U A;  3U3Y A;  4CE9 A;  4J8F A;  4YOW A;  1TL3 A;  4CJQ A;  2HW3 A;  3O9S A;  3SQ4 A;  4DQR A;  4H8K A;  3J8A A;  3MWT A;  4CEZ A;  4K43 A;  3LAN A;  4M3R A;  3LDP A;  5DMR A;  1TAQ A;  2X6S A;  4FO0 A;  3TAF A;  1RDW X;  4AQY K;  3LZI A;  4M7X A;  1YJN N;  3K9K A;  2PYL A;  4G9Z A;  1A5W A;  2P51 A;  3AAQ A;  3WNF A;  3HPH A;  3N4Q A;  2O8E B;  3EYZ A;  2ZJQ L;  1QQM A;  4CF8 A;  5BR8 K;  4CEF A;  2ASO A;  4CZJ A;  5AQQ A;  3NVK A;  3WEE B;  3EKU A;  5K14 A;  1Q18 A;  1TKT A;  4IWV A;  1GLA G;  3D0P A;  4CGG A;  4OLA A;  4KH5 A;  3G71 N;  2PAV A;  2ETJ A;  3MMV A;  1WAF A;  3A8Y A;  1EQY A;  2D0O A;  3MN7 A;  1GOB A;  3HPG A;  1T6D A;  3D7E O;  4CFB A;  4BGA A;  3L2U A;  1JLQ A;  3OYN A;  4QOZ B;  3VA3 A;  1Q9Y A;  3E1Y A;  2E20 A;  3CJB A;  4CJL A;  3J7A P;  3KD1 E;  5AZI B;  2BAN A;  1S1T A;  5ADX A;  4PA1 A;  3E9P A;  4CEQ A;  4CHZ A;  3H08 A;  3MAQ A;  4DSJ A;  1BIZ A;  4YDU A;  4I7F A;  3UB5 A;  5BPN A;  1NMN A;  4FPB A;  3VQA A;  2QA4 N;  2OPQ A;  5DM7 L;  5CE3 A;  4BDZ A;  4WFA L;  1OVY A;  4LSN A;  4DCH A;  3SCX A;  1NK4 A;  3DLK A;  2FSN A;  4FWR A;  1GOA A;  5TKW A;  3V1R A;  4H5W A;  1N36 K;  1NMD A;  1DT9 A;  4HUE A;  4G1Q A;  3V4I A;  3P5J A;  2VG5 A;  4X66 K;  4GW6 A;  3DAW A;  4H0P A;  4CD1 A;  3MXI A;  2O4I A;  4B1Y B;  5EOY A;  2D5R A;  3BZK A;  3VQC A;  5AQK A;  3SPZ A;  3PUF A;  5AR0 A;  2OTL N;  1U49 A;  2E1Y A;  1HNX K;  5FPE A;  4FM2 A;  4I6M B;  1ESV A;  2JWL A;  4PKH A;  2D0B A;  5FRN A;  1KXP A;  4A2A A;  2Z1J A;  5C12 A;  4DV2 K;  2A40 A;  4DV1 K;  4NXM K;  4CJS A;  3VEY A;  4CFA A;  4O8K A;  4A57 A;  5LMN K;  2O8C B;  1J6Z A;  3CI5 A;  1R0A A;  3F9M A;  1YF5 L;  1Z25 A;  5KTQ A;  3PO5 A;  3HK2 A;  3B6O A;  4GKJ K;  3ISN C;  3KKR A;  3SPY A;  4AHU A;  5CR4 A;  1HYZ A;  3FR0 A;  1BOT O;  3O5B A;  3M8R A;  1E3M A;  2PFU A;  2NRW A;  3J7Z O;  3KK3 A;  1RTD A;  4FYD A;  3DM2 A;  4FW2 A;  4NB4 A;  3M1F A;  4DTN A;  3GBT A;  3OW2 M;  1U04 A;  4U7B A;  3BUZ B;  4MLH A;  3QBW A;  2CGJ A;  2ATQ A;  4F8R A;  1HQE A;  3VER A;  1C0G A;  2VG6 A;  4YOV A;  3QEV A;  3VEW A;  2B6A A;  3VQQ A;  5M1N A;  2YHY A;  1ASU A;  4DMN A;  2AP1 A;  3AVN A;  1SL1 A;  5F0X A;  3V6D A;  3OYK A;  3WT0 A;  1SZ2 A;  1FW6 A;  2HHV A;  1EO1 A;  1QSY A;  4O5B A;  4H0X B;  2Q0U A;  4IFY A;  4BC2 A;  4LF7 K;  3AO1 A;  3TU5 A;  3O9R A;  2UYT A;  4W5N A;  3AO4 A;  5C2D A;  4DR2 K;  4CHY A;  1X3M A;  4PL7 A;  1TYQ B;  2YNG A;  3CCV N;  1YUW A;  3ZSZ A;  4CJW A;  3AO3 A;  4FJ8 A;  3U3G A;  4KHN A;  3BF3 A;  3HBT A;  5HL7 L;  4CJE A;  3HYF A;  3O9U A;  5FRO A;  2G8U A;  4F3T A;  1KFS A;  4M7Y A;  1HNI A;  2BUP A;  3NGI A;  3NHG A;  4QAG A;  2Y1I A;  1NG9 A;  4JKB A;  2GBZ A;  3M8Q A;  1BL3 A;  3JYT A;  4A62 A;  5IT9 O;  3P39 A;  1U2V B;  3K9J A;  4KRE A;  2PBD A;  2R7Y A;  3OYJ A;  4DS5 A;  1NGC A;  2I5J A;  3QDK A;  3PY8 A;  4DV7 K;  1ATS A;  3G10 A;  4CEE A;  2VWJ A;  2P9S A;  2NRX A;  1OKJ A;  1NK8 A;  4K0K K;  4PY5 A;  2OZM A;  5M1O A;  2A6A A;  4WFN L;  4BR9 A;  4KI4 A;  5AQO A;  3VQ6 A;  3PX0 A;  2P9I B;  2DTU A;  1UAX A;  4JLH A;  4JKH A;  3ULE A;  1HNV A;  2Q31 A;  5CY4 A;  3DLL L;  1BCO A;  2HST A;  4B9T A;  3F5T A;  2OPR A;  1LWC A;  1IKW A;  1SV5 A;  5DK5 A;  1YXQ A;  2QW9 A;  4C1N I;  3S9H A;  3R6M A;  1RBT A;  1IBL K;  5SZT A;  4CBU A;  3EY1 A;  3OA9 A;  3ID6 A;  1TUY A;  1KAX A;  1HMV A;  5KQD A;  5KPT A;  2EHG A;  1L3S A;  3TTC A;  3TAB A;  4WQ4 A;  1CZ9 A;  1A5X A;  2BDP A;  5FLX O;  4KHS A;  3CMA N;  4JKA A;  1DTQ A;  3QET A;  3QO9 A;  1JKH A;  3V9W A;  2O8D B;  3BZC A;  4CEA A;  4DR6 K;  3C6U A;  4FZX C;  1WSH A;  3OS0 A;  1QS4 A;  4FWP A;  4MDB A;  1ZBF A;  4OGE A;  1X3N A;  3IAY A;  1NGJ A;  4CIE A;  4DSK A;  5IWA K;  1QVG M;  2E5L K;  3HST B;  5GIN A;  3G4S N;  4IO9 L;  4BWJ A;  1IKY A;  5C2F A;  4CES A;  4JN4 A;  4TSX A;  3QIP A;  4XH1 A;  1K8K B;  1D5A A;  2XY6 A;  3O4W A;  3MXJ A;  3HJF A;  4BRI A;  3D2E A;  1T7P A;  1VQN N;  3K5M A;  1YTA A;  3C65 A;  4HWI A;  1Y64 A;  3M8P A;  4KV8 A;  4DTX A;  2IGI A;  3SQ0 A;  3S3M A;  4JYA K;  1A5V A;  2QXF A;  4GV9 A;  4FXD A;  2D0C A;  4FZZ A;  3DWL A;  5LJV A;  2IVN A;  1TAU A;  3SAF A;  4R5P A;  3WNH A;  5BPL A;  3MWP A;  4AM7 A;  4BR5 A;  2KZM A;  3C94 A;  3RMB A;  1XNR K;  4LF6 K;  3KLE A;  1E4G T;  3EKS A;  2V52 B;  4KHQ A;  3KLI A;  3F2K A;  4WYB A;  4EIA A;  3ULD A;  1BI4 B;  4CIG A;  4FOI A;  3DMJ A;  4E7H A;  2E6L A;  5GAE P;  3O4Q A;  1YVN A;  4ID5 A;  1OVQ A;  2QXL A;  4DQ8 A;  3VES A;  2FSK A;  3M8S A;  2P5G A;  4KTQ A;  4IKF A;  3V1Q A;  3AVC A;  1C1B A;  4BG9 A;  1YAG A;  1YIJ N;  3FGU A;  3UKR B;  4BRG A;  4CJK A;  3CCJ N;  1BQN A;  3ASM A;  4ZTF A;  2O8B B;  4W5R A;  4RCH A;  4EHT A;  4LH5 A;  4Z4E A;  4ILG B;  3T69 A;  5J2Q A;  3BGR A;  2F8S A;  4JI3 K;  3ZT4 A;  1SKS A;  3KVG A;  3W0L A;  3SQ2 A;  3ZET A;  2FLO A;  4CJV A;  4KH6 A;  4DSE A;  2FBV A;  1YIT N;  3A2F A;  4GY2 B;  4CHP A;  3VQP A;  3OYG A;  3DLB A;  3IG1 A;  4CJT A;  4FL9 A;  3HVT A;  3SYZ A;  1EX4 A;  4QS9 A;  3Q7B A;  3HM9 A;  1WN7 A;  3FFI A;  2QKK A;  1EKE A;  1I39 A;  3AGR A;  3ZX2 A;  4FJH A;  5LMU K;  4KHP K;  5LJW A;  1BA1 A;  2KLA A;  4OKK A;  5M1Q A;  1GLE G;  4JAX A;  1Q9X A;  3L0Q A;  2PYJ A;  2W40 A;  3VGM A;  2CGK A;  4HVJ A;  2HB5 A;  4CCH A;  4FJL A;  2E2P A;  5B8H A;  4ISG A;  1ZC6 A;  2BGG A;  2NRV A;  4IFE A;  2WOM A;  4DTU A;  4M45 A;  2VG7 A;  3L8B A;  3CF5 L;  1R59 O;  3AAR A;  2VGN A;  5KQ8 A;  2GX9 A;  5AZJ A;  3Q7C A;  4JD2 B;  1RIL A;  3HXM A;  4EHU A;  4CJ4 A;  1M1K O;  2FSJ A;  1N5Y A;  2P5O A;  4DQQ A;  1NK0 A;  1D4X A;  3WXK A;  2KFZ A;  1J5E K;  3NF8 A;  1VRU A;  2VWK A;  1U4B A;  5AQX A;  1DGK N;  1JLA A;  1GLB G;  3LM2 A;  3TPQ A;  3SV3 A;  3KD5 E;  1S1U A;  4BR4 A;  3CFR A;  5JLF A;  2EWS A;  1J54 A;  4JI5 K;  1QZ6 A;  1DLO A;  1EWR A;  4IOA L;  3S3O A;  1EP4 A;  5D3G A;  1XQS C;  3ENO A;  2QWM A;  4JI7 K;  3FFK B;  1KLN A;  3UIQ A;  4Q0B A;  4B8A B;  5GAH P;  4FPA A;  3P1G A;  4N56 A;  3CQ8 A;  4CHN A;  5HP1 A;  2ZE2 A;  2NUB A;  2FXU A;  3SMS A;  2HVH A;  3J81 O;  3A5M C;  1S9E A;  4O55 A;  4K41 A;  1Q82 O;  5BN8 A;  4JI1 K;  5AQL A;  3SUQ A;  3P83 D;  3QFU A;  2NRZ A;  2FBX A;  5J2N A;  4BE2 A;  3NGZ A;  1BCM A;  4HUG A;  1K9M O;  2YNI A;  2WTU A;  4WQ5 C;  2ZJR L;  3MN6 A;  4I2Q A;  4CZH A;  3L4Q A;  4K8X A;  2CGL A;  1SKW A;  3MEE A;  4RW4 A;  1FKP A;  4BWM A;  3NAE A;  4LF5 K;  1HNW K;  5LL6 Z;  4M63 C;  4DFJ A;  4KRF A;  3ZEU A;  5FPD A;  4IOC L;  4CGF A;  4DTM A;  4FK0 A;  4FWQ A;  3IS9 A;  4PWD A;  3IFR A;  2Q1N A;  3HI0 A;  2UXD K;  4E7K A;  3ATV A;  4RW9 A;  4CZI A;  2KHO A;  3RMA A;  1Y97 A;  3QEX A;  3NMU A;  1BHL A;  1K8A O;  4M3X A;  2YKM A;  4Z4I A;  3TTF A;  1RTJ A;  4CHQ A;  4UY8 O;  3TAE A;  3VEZ A;  1KD1 O;  1T6C A;  3M3Z A;  3VEN A;  3CYM A;  3LDL A;  1G99 A;  5LY3 A;  1VSD A;  5AQV A;  1JLE A;  1RCH A;  1RT6 A;  1WBB A;  2Q36 A;  3NGY A;  1RBR A;  4EZ6 A;  1HKC A;  1ASV A;  1VQO N;  5C25 A;  1C0M A;  4V19 S;  3THW B;  1QVF M;  4XIU A;  2OZS A;  3C95 A;  3KJV A;  4A2B A;  4B9S A;  1T3V A;  1VHX A;  4H0V B;  5FDL A;  3QNN A;  4FWN A;  4IFV A;  1RDA A;  4X62 K;  3T1Y K;  3WXJ A;  2JGU A;  4OPH A;  3CJ9 A;  4CI6 A;  3KZB A;  3NH2 A;  4JKE A;  3C7N A;  3KK2 A;  1T8E A;  5C0Y A;  3FZH A;  4M41 A;  4Z4G A;  3C6A A;  4B1U B;  2UUB K;  5AQY A;  2WFB A;  3ITH A;  3TAP A;  4GKK K;  1RDC A;  1NJY A;  4IO8 A;  2E8A A;  3O80 A;  4H0O A;  3PX4 A;  1NGF A;  1RT4 A;  3CJ7 A;  3CFO A;  4DUY K;  3OBW A;  1NJW A;  3CPW M;  4OPK A;  2UUC K;  3LP2 A;  1VK0 A;  4XH5 A;  3I33 A;  5AQR A;  5AQG A;  5JVH L;  1TK5 A;  3BF1 A;  1QTM A;  2YNH A;  1W0H A;  2WON A;  2QI2 A;  3AAP A;  4E7I A;  2D4W A;  1NBW A;  3E9O A;  3LPU A;  4O0J A;  2XY8 A;  1NU0 A;  4RG8 A;  4FWM A;  4LSL A;  1RT3 A;  1JLC A;  2PZS A;  3UE5 A;  4FM0 A;  4B3O A;  1IV0 A;  4CF2 A;  5MLC Q;  1VAZ A;  4E1M A;  4M3W A;  1GLD G;  3G25 A;  2G8V A;  1B92 A;  4C8N A;  1HQU A;  1FXX A;  3THW A;  2YX6 A;  4N5S A;  4CBW A;  2WBN A;  5ELZ A;  2D1K A;  3KWI A;  3EZ5 A;  3SUN A;  4PL8 A;  4HUF A;  4CFC A;  3IKM A;  4CW7 B;  4CK1 A;  4O44 A;  3TAN A;  4B1X B;  4Y1D A;  2XO7 A;  4H4O A;  3L3V A;  3V9U A;  5CYM A;  5AQI A;  4CED A;  3V81 A;  1F21 A;  1ZBH A;  1Z05 A;  4Z4H A;  1TK0 A;  1KRP A;  3KLG A;  1RDU A;  4QCL A;  4O5F A;  4M3Y A;  1YVU A;  2OCE A;  3I8D A;  2IC3 A;  4CZG A;  2YV0 X;  2Z1H A; 
#chains in the Genus database with same CATH homology
 1RBT A;  4DQI A;  1NOZ A;  2YKN A;  2BE2 A;  5SZT A;  3DYA A;  4EP5 A;  1HPZ A;  1RNH A;  4ICL A;  1NKB A;  4I2P A;  3EY1 A;  4FJ9 A;  2RF2 A;  2GV9 A;  4F3O A;  1TK8 A;  1KVA A;  1VSH A;  1HMV A;  4J2D A;  3I0S A;  1SUQ A;  4FLX A;  2EHG A;  3QLH A;  3LWL A;  1L3S A;  3TAB A;  2IS3 A;  1JL1 A;  4O4G A;  4KHU A;  2A1S A;  1CZ9 A;  3QEI A;  1A5X A;  3S3N A;  1TKZ A;  3DRR A;  2BDP A;  1CLQ A;  4CGI A;  4KHS A;  1DTQ A;  4JS4 A;  3QET A;  3QO9 A;  2HHQ A;  2KZZ A;  1RDB A;  1JKH A;  1S9G A;  4FM1 A;  3V9W A;  4ELV A;  4FJI A;  1TVR A;  2D0A A;  3F9K A;  1ASW A;  4FK4 A;  3QER A;  4FJM A;  2QKB A;  4CEA A;  4OPJ A;  4AHT A;  2KQ2 A;  3C6U A;  1EXQ A;  3ZCM A;  3NH0 A;  4FLY A;  3ZT2 A;  3S9H A;  4FZX C;  1WSH A;  3OS0 A;  1L3V A;  4B9M A;  1QS4 A;  4CEC A;  1C6V A;  1L3T A;  1IKV A;  1ZBF A;  1S6P A;  4N47 A;  4Z4F A;  4OGE A;  1G15 A;  3ZSW A;  4BAC A;  4Q5V A;  3IAY A;  4CIE A;  4DSK A;  3HST B;  2HHS A;  2HVI A;  4BWJ A;  1IKY A;  2OPP A;  3LAL A;  4CES A;  4CK2 A;  3OYF A;  1C1C A;  3QIP A;  4TSX A;  1RBV A;  1D9D A;  1HYS A;  4E0D A;  1D5A A;  3KKS A;  2B4J A;  2GUI A;  3OVN A;  2XY6 A;  3VQE A;  4DSI A;  3SQ1 A;  2ZD1 A;  1JXB A;  1S1W A;  1VRT A;  3MXJ A;  3HJF A;  2OPS A;  4CJR A;  4LD0 A;  1VSF A;  3F73 A;  3V9S A;  3RMD A;  1BIU A;  1KSP A;  1T7P A;  3AVL A;  3OYB A;  5HBM A;  3AA4 A;  3LAK A;  3K5M A;  1L3U A;  4I9L A;  5KGX A;  1BI4 A;  1YTA A;  2HNZ A;  3M8P A;  4KV8 A;  4DTX A;  4W5T A;  2IGI A;  4L8R B;  3SQ0 A;  1TGO A;  4E3S A;  1RT2 A;  1WSE A;  4NYF A;  3S3M A;  1A5V A;  2QXF A;  3SJJ A;  4FXD A;  4OKE A;  3T19 A;  4CJU A;  3HT3 A;  1VSK A;  2D0C A;  3VQB A;  4B9N A;  4ELU A;  1JLG A;  4FZZ A;  3AO2 A;  1GOC A;  1RTH A;  1TAU A;  1Q8I A;  4PUO A;  4R5P A;  3AVI A;  4KHW A;  3WNH A;  3TAQ A;  2E6M A;  2DFF A;  5KRT A;  3RTV A;  1QSS A;  3U6F A;  4CEB A;  3V9Z A;  4AHV A;  1C0U A;  1NK5 A;  3OY9 A;  2KZM A;  2DY4 A;  4KO0 A;  3C94 A;  4LH4 A;  4W5Q A;  4C8K A;  4FJ5 A;  2IOC A;  3KIO A;  1WSF A;  4M3U A;  3OYI A;  2XRI A;  3RMB A;  3RR8 A;  4C8L A;  3HO1 A;  3CG7 A;  4CK3 A;  3KLE A;  3O3G A;  3QEP A;  4FLW A;  1HRH A;  4KHQ A;  1K6Y A;  4FLU A;  5HLF A;  3KLI A;  3RMC A;  4FJ7 A;  2X6N A;  1Z26 A;  3ULD A;  3ALY A;  1BI4 B;  4KI6 A;  4CIG A;  2RN2 A;  1CXQ A;  3DMJ A;  4W5O A;  4E7H A;  5HRO A;  4FJX A;  2E6L A;  3K58 A;  3KK1 A;  3O4Q A;  4FJN A;  2Z1I A;  3AVJ A;  4ID5 A;  2ZQB A;  4Y1C A;  4DTO A;  1XHZ A;  2HHT A;  1B9D A;  1LWE A;  1KCF A;  1RTI A;  1SKR A;  4KB1 A;  1VSI A;  4FJK A;  4OLB A;  4AHC A;  3M8S A;  2P5G A;  3T3F A;  4IKF A;  4KTQ A;  1TV6 A;  1JXE A;  3L2V A;  3V1Q A;  3NDK A;  3AVC A;  1C1B A;  2F96 A;  3ZSX A;  5HRR A;  4FCY A;  4FJJ A;  1WAJ A;  4DTJ A;  1XC9 A;  3RRH A;  4CF0 A;  4B9U A;  1LAW A;  1XHX A;  3OJU A;  1U48 A;  1D8Y A;  4F2R A;  1RDD A;  3BDP A;  5J1E A;  3HP9 A;  4BDP A;  3RRG A;  4FJG A;  4CEO A;  4ZTF A;  4CJK A;  3E01 A;  1BQN A;  3ASM A;  1LWF A;  1NJX A;  4N41 A;  3DLH A;  4I9Q A;  4W5R A;  3OS1 A;  1U45 A;  5CYQ A;  3LWM A;  1ZBL A;  3WNE A;  4LH5 A;  4Z4E A;  2Z1G A;  4JRP A;  1KVB A;  5J2Q A;  3BGR A;  4DTS A;  2F8S A;  3CFP A;  5E41 A;  1B9F A;  3ZT4 A;  3OYM A;  1X1P A;  3ZSO A;  4JS5 A;  1SKS A;  2G8K A;  3SV4 A;  4DU4 A;  3OYH A;  3SQ2 A;  4CJV A;  4GVM A;  3C6T A;  4CGD A;  4DSE A;  2FBV A;  3DLR A;  3IRX A;  3A2F A;  4M3T A;  4RW7 A;  3HPO A;  3ZSV A;  4CHP A;  3MXM A;  2E4L A;  3VQP A;  3OYG A;  3DLB A;  2KFN A;  3IG1 A;  3VQ8 A;  4CJT A;  3NH1 A;  2AJQ A;  4B9L A;  1YT3 A;  2KW4 A;  2O4G A;  1NK7 A;  3HVT A;  3SYZ A;  1EX4 A;  3LP3 A;  3QEW A;  4FK2 A;  4M42 A;  4OGC A;  4CGJ A;  1XWL A;  4CFD A;  4NCA A;  3HM9 A;  1X9M A;  1SL2 A;  1WN7 A;  4PQU A;  3AVA A;  1S1X A;  3FFI A;  2QKK A;  4NCB A;  4HHT A;  4DTR A;  4DS4 A;  2ITG A;  1EKE A;  1I39 A;  3AVM A;  4KFB A;  4FLV A;  1NKE A;  4HTU A;  4FJH A;  4DQS A;  1LAV A;  4CER A;  4CGH A;  3PV8 A;  3QIO A;  3WNG A;  1ZBU A;  4Z0U A;  3U3Y A;  1YTU A;  2B5J A;  4OKK A;  4CE9 A;  4C8O A;  4DTP A;  5KI6 A;  3OYC A;  1LW2 A;  1TL3 A;  4CJQ A;  1Q9X A;  1QSL A;  2HW3 A;  3O4N A;  3SQ4 A;  4DQR A;  2PYJ A;  1CXU A;  4NCG A;  4HVJ A;  4H8K A;  4DFK A;  3D45 A;  3K59 A;  2HB5 A;  4CEZ A;  4E89 A;  4CCH A;  4M3R A;  3LAN A;  4FJL A;  3L2R A;  1ITG A;  4RW6 A;  4DF8 A;  1TKD A;  5DMR A;  2KTQ A;  4AH9 A;  2BGG A;  5CZ2 A;  2F8T A;  2WOM A;  2W42 A;  3TAR A;  4DTU A;  4M45 A;  2VG7 A;  3L8B A;  1TAQ A;  2X6S A;  3AVH A;  4BDY A;  3TAF A;  4LY7 A;  4B08 A;  1VSJ A;  1MU2 A;  3LZI A;  1L5U A;  3NBP A;  2PYL A;  4CHO A;  3L2W A;  1A5W A;  2P51 A;  3DRS A;  4KTW A;  3NF7 A;  3WNF A;  4CF9 A;  1RIL A;  4BE1 A;  3HPH A;  3HXM A;  4CJ4 A;  3EYZ A;  4NYN A;  1N5Y A;  3T1A A;  2P5O A;  2FC0 A;  3L3U A;  4CF1 A;  4DQQ A;  1NK0 A;  4CF8 A;  4CEF A;  4MQ3 A;  3K5N A;  4AIL C;  2KFZ A;  5K14 A;  5JS2 A;  3NF8 A;  1VRU A;  2VWK A;  1TKT A;  5C24 A;  5HRS A;  5SWM A;  3SNN A;  1U4B A;  3VQ9 A;  1JLA A;  3D0P A;  3SV3 A;  4CGG A;  3KD5 E;  1S1U A;  4OLA A;  4YNQ A;  3CFR A;  2ETJ A;  1RT7 A;  1WAF A;  1S6Q A;  1J54 A;  1GOB A;  3DOK A;  3HPG A;  4CFB A;  4E7L A;  3L2U A;  5KRS A;  5KGW A;  1JLQ A;  4HCC A;  1DLO A;  3OYN A;  3NF6 A;  3ZSR A;  2X78 A;  3DLG A;  1EP4 A;  3S3O A;  4QOZ B;  3I0R A;  3VA3 A;  5D3G A;  1Q9Y A;  3LP0 A;  5I42 A;  4KTZ A;  4CJL A;  5J2M A;  3KD1 E;  3OYD A;  3V1O A;  1KLN A;  3UIQ A;  2BAN A;  4Q0B A;  3OJS A;  1S1T A;  4B8A B;  3ZT3 A;  4F4K A;  1IKX A;  4ZTJ A;  3G0Z A;  2YHA A;  4PA1 A;  1HJR A;  3ZSQ A;  3HL8 A;  4CEQ A;  3H08 A;  4CHZ A;  3P1G A;  4N56 A;  3CQ8 A;  3MAQ A;  4ZHR A;  4FZY A;  4CHN A;  4CIF A;  1BIZ A;  5HP1 A;  4DSJ A;  2ZE2 A;  4I7F A;  3B6P A;  4KHY A;  2NUB A;  4DF4 A;  3VQA A;  4E7J A;  2HVH A;  1XI1 A;  4K8Z A;  2OPQ A;  3QIN A;  3VQ5 A;  1JLB A;  4FLZ A;  4DWI A;  1S9E A;  4BDZ A;  4O55 A;  3SCX A;  4LSN A;  2EX3 A;  4WE1 A;  1NK4 A;  2XHB A;  1TKX A;  3DLK A;  2HHX A;  3DLE A;  3SUQ A;  2DFE A;  2OA8 A;  1GOA A;  3P83 D;  2IAJ A;  3MED A;  4DU3 A;  4DQP A;  2FBX A;  5J2N A;  4BE2 A;  3PO4 A;  1UA0 A;  3V1R A;  3NGZ A;  4IG0 A;  1BCM A;  3K5L A;  4HUG A;  3ZT0 A;  5EU7 A;  4BE0 A;  2YNI A;  1REV A;  4HUE A;  4G1Q A;  3RR7 A;  3SUP A;  1NK6 A;  4I2Q A;  3V4I A;  4K8X A;  1W9H A;  4UQG A;  3P5J A;  2VG5 A;  3SZ2 A;  4DSF A;  3L2Q A;  3MEE A;  1HYV A;  4RW4 A;  1SKW A;  4GW6 A;  1VSM A;  2HNY A;  1UA1 A;  3TAM A;  1FKP A;  4KKO A;  4BWM A;  3NAE A;  3MXI A;  2OYQ A;  2O4I A;  3JSM A;  4DFJ A;  3PX6 A;  4KRF A;  5T7B A;  2QK9 A;  2D5R A;  4KPY A;  3VQC A;  4CGF A;  4DTM A;  3KTQ A;  3LP1 A;  3IS9 A;  3SPZ A;  4FK0 A;  4PWD A;  1KFD A;  3PUF A;  1J5O A;  4J2B A;  4E7K A;  1U49 A;  4RW9 A;  3RMA A;  1CZB A;  1Y97 A;  3QEX A;  3AVF A;  4IDK A;  4RW8 A;  4AHR A;  4FM2 A;  4FW1 A;  4YFU A;  2FBT A;  2HMI A;  4F2S A;  5FRN A;  1N6Q A;  2D0B A;  1VSE A;  1BHL A;  4Z4I A;  2Z1J A;  2YKM A;  4M3X A;  1RTJ A;  3AVB A;  4CHQ A;  3K5O A;  2JLE A;  4HCB A;  4AHS A;  3TAE A;  1RBS A;  1WLJ A;  4CJS A;  4CFA A;  3CYM A;  3ZSY A;  3MEC A;  1VSD A;  3AA3 A;  1JLE A;  1RCH A;  1RT6 A;  4M3Z A;  4ELT A;  3NGY A;  1RBR A;  3TR8 A;  1R0A A;  4EZ6 A;  1ASV A;  1Z25 A;  1NJZ A;  1QQC A;  5C25 A;  1C0M A;  3HVR A;  5KTQ A;  3K2P A;  3PO5 A;  4XIU A;  2OZS A;  3HK2 A;  3C95 A;  3B6O A;  3KJV A;  3O3H A;  2YNF A;  3TI0 A;  3ISN C;  3KKR A;  3SPY A;  4B9S A;  4AHU A;  1IG9 A;  1HYZ A;  3OYE A;  3QNO A;  5FDL A;  3QES A;  1DTT A;  3M8R A;  3QNN A;  3AV9 A;  2IDO A;  3KK3 A;  1RTD A;  4FYD A;  1FK9 A;  3DM2 A;  4FW2 A;  1RDA A;  4IFV A;  4B9V A;  3NCI A;  4DTN A;  4C8M A;  1TL1 A;  3VA0 A;  3SI6 A;  1KVC A;  2JGU A;  1KLM A;  1U04 A;  2YHB A;  3LPT A;  1O1W A;  3NH2 A;  4KAZ A;  4CJ5 A;  3OYA A;  3RWU A;  4DU1 A;  4CJ3 A;  4FLT A;  3KK2 A;  2ATQ A;  4EP4 A;  1T8E A;  4F8R A;  3CM5 A;  1HQE A;  2VG6 A;  1UWB A;  3ZT1 A;  4FVM A;  4DLG A;  1BGX T;  4M41 A;  3VN5 A;  3QEV A;  4Z4G A;  4DLE A;  4O0I A;  1ZYQ A;  3SUO A;  1C1A A;  2B6A A;  3ITH A;  3VQQ A;  1ASU A;  4DMN A;  2G8F A;  5I3U A;  3TAP A;  3O3F A;  3KLF A;  3AVN A;  1SL1 A;  3LAM A;  3V6D A;  2A1R A;  3OYK A;  2LSN A;  2HHV A;  1QSY A;  4O5B A;  4MFB A;  1BQM A;  2XY5 A;  1RDC A;  3CM6 A;  4IFY A;  4OJR A;  1NJY A;  3AO1 A;  1X9S A;  3AVG A;  3TAG A;  1WSI A;  1S1V A;  2X74 A;  1D9F A;  3AO4 A;  4W5N A;  3PX4 A;  1QHT A;  1RT4 A;  3CFO A;  4DFP A;  4CHY A;  1NJW A;  1RBU A;  1JL2 A;  4CJP A;  4OPK A;  4J2E A;  3DOL A;  2YNG A;  3LP2 A;  1VK0 A;  3VQ7 A;  1TK5 A;  4B8C A;  2HHW A;  3ZSZ A;  1QTM A;  4CJW A;  2YNH A;  3AO3 A;  1KTQ A;  5HRN A;  3OS2 A;  4FJ8 A;  1W0H A;  2WON A;  4H4M A;  3U3G A;  3VQD A;  1NKC A;  4KHN A;  3OYL A;  5FRM A;  3TWH A;  2HND A;  4CJE A;  4E7I A;  1LV5 A;  3HYF A;  3LPU A;  3AO5 A;  4IG3 A;  4O0J A;  2G8H A;  5FRO A;  2G8U A;  1C0T A;  1NK9 A;  4OKJ A;  4DSL A;  2XY8 A;  5HRP A;  4F3T A;  1KFS A;  1HNI A;  1VSL A;  1NOY A;  4RG8 A;  3NGI A;  3V9X A;  4N76 A;  3NHG A;  4LSL A;  1RT3 A;  1JLC A;  4QAG A;  2Y1I A;  1SL0 A;  2PZS A;  2FBY A;  3K57 A;  4FM0 A;  4DFM A;  4GMJ B;  3LDS A;  4CF2 A;  4B3O A;  3MEG A;  3AVK A;  1S5J A;  2GBZ A;  3M8Q A;  1BL3 A;  2XY7 A;  1RT5 A;  4DG1 A;  3JYT A;  3DRP A;  4E1M A;  1FKO A;  1I3A A;  4M3W A;  4KRE A;  2RKI A;  3HP6 A;  1WSJ A;  2Q3S A;  2R7Y A;  3OYJ A;  4DS5 A;  1RT1 A;  5CZ1 A;  2I5J A;  2G8V A;  1B92 A;  3DI6 A;  3NFA A;  4C8N A;  1T05 A;  3PY8 A;  1HQU A;  4KB0 A;  1FXX A;  3THV A;  5C42 A;  5J2P A;  4OVL A;  1J53 A;  4E1N A;  4EZ9 A;  3G10 A;  4CEE A;  4N5S A;  2VWJ A;  3LZJ A;  1NK8 A;  1IH7 A;  1JLF A;  3EZ5 A;  3SUN A;  2RPI A;  4PY5 A;  2OZM A;  3VQ4 A;  2PY5 A;  4HUF A;  4CFC A;  4E19 A;  4CK1 A;  4O44 A;  4KI4 A;  3VQ6 A;  3TAN A;  3PX0 A;  2DFH A;  2G8I A;  2Y1J A;  1IO2 A;  4Y1D A;  2G8W A;  2XO7 A;  4J2A A;  5JS1 A;  4H4O A;  3L3V A;  3NE6 A;  3V9U A;  2DTU A;  1UAX A;  4JLH A;  5CYM A;  4JRQ A;  4CED A;  1J9A A;  1HNV A;  1F21 A;  5CY4 A;  3V81 A;  1BCO A;  1ZBH A;  4CJF A;  4B9T A;  1ZBI A;  1WSG A;  4Z4H A;  1TK0 A;  2OPR A;  1KRP A;  4Z4C A;  3KLG A;  3AA5 X;  1X9W A;  1LW0 A;  4QCL A;  1QE1 A;  2P1J A;  1EET A;  4IBN A;  1LWC A;  1IKW A;  1BIS A;  1WNS A;  4M3Y A;  1YVU A;  1SV5 A;  1U47 A;  5DK5 A;  3I8D A;  2HHU A;  1UOC A;  2IC3 A;  3NF9 A;  4ID1 A;  2YV0 X;  2Z1H A;  1T03 A;  3AA2 A;  3KLH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...