2YV0X

Structural and thermodynamic analyses of e. coli ribonuclease hi variant with quintuple thermostabilizing mutations
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
155
structure length
155
Chain Sequence
MLKQVEIFTDGSCLGNPGPGGYAAILRYRGREKTFSAGYTRTTNNRMELMAAIVALEALKEPCEVILSTDSQYLRQGITQWIHNWKKRGWKTADGKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERCHELARAAAMNPTLEDTGYQVEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Ribonuclease HI
publication title Structural and thermodynamic analyses of Escherichia coli RNase HI variant with quintuple thermostabilizing mutations.
pubmed doi rcsb
source organism Escherichia coli
total genus 49
structure length 155
sequence length 155
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2007-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2yv0X00
1LWEA 5J2MA 3HPGA 3AA4A 5HP1A 3V9UA 4PUOA 2PYLA 1HYVA 3VQPA 4FLXA 5FRMA 2P5GA 1NKEA 3SQ1A 4ICLA 4G1QA 3V6DA 3MEEA 1WN7A 3V9XA 2XHBA 3QEVA 3LZIA 3NGZA 2XY5A 1S1XA 4K8XA 4F3TA 3PO5A 4LSLA 3RR8A 4K8ZA 3TWHA 2G8HA 1JLEA 3OYJA 4E0DA 4Z4EA 1XHXA 5KRSA 2E4LA 1VSFA 2YV0X 1EX4A 1QQCA 4CGFA 1HQEA 3T19A 5CY4A 2HW3A 2ITGA 3TANA 1RILA 3VQQA 1NK0A 4DFJA 1C0MA 5C25A 4BE1A 3K58A 5FDLA 4CJLA 2YHAA 1RDDA 4JRPA 3QNNA 4M3ZA 4KKOA 3AVFA 4CJRA 3SYZA 4CEOA 4KB0A 4O4GA 3DLGA 4E1NA 4QAGA 4H8KA 3MXIA 4KI4A 1SUQA 3DOLA 4FJ8A 4HUFA 3PX6A 1WSGA 4CJUA 4KHYA 1TKZA 3AO2A 3ITHA 3IRXA 4DFKA 1SKRA 3WNFA 1A5VA 3AO5A 4CFDA 4CHYA 4FJKA 4LSNA 5CYMA 3VQ8A 4FJIA 3CFOA 1VRTA 2A1SA 4I2QA 4ZHRA 3L2QA 3RTVA 1S1TA 3NE6A 4CJTA 1L3UA 4N56A 4OPKA 4CEEA 3U6FA 4I2PA 1RBVA 2KW4A 1KFDA 5C42A 1LV5A 4LY7A 3NDKA 4PY5A 1DTTA 3V1OA 3DRPA 4HCCA 1JLAA 1REVA 2Z1GA 4M3YA 1Q9XA 1CLQA 2B4JA 4AHSA 3LDSA 1SL0A 1RTDA 4DSLA 5FRNA 4O0IA 4KREA 1JXBA 2PY5A 3HP9A 4CEBA 4FJLA 3OYLA 2DY4A 1S5JA 3HJFA 1CXQA 4W5OA 1RDCA 3DOKA 3V1QA 3ZT0A 1RBSA 2A1RA 3B6PA 3OJSA 4RW4A 2IOCA 3RR7A 4CGGA 2G8WA 2YKNA 4CEFA 5J2PA 3AVGA 4JLHA 4NCBA 2F8TA 3CM5A 4DU3A 2D0BA 1ZBLA 3DMJA 4ELVA 3ZSZA 3MAQA 1FK9A 1YTUA 4JRQA 4CHOA 4CHQA 4CIFA 3L2UA 1TK0A 4KI6A 4KRFA 1KVCA 4M3WA 3DLKA 5I42A 1TL1A 3H08A 1HRHA 3K57A 3ZT1A 2IC3A 1TKXA 1VK0A 4CJ3A 1UOCA 4DQSA 3V9SA 1RNHA 5SWMA 1SKSA 4FZYA 4W5RA 1ZBIA 3CM6A 3S9HA 4FJHA 4CJ5A 4HCBA 3K2PA 3ZT3A 3QIOA 3HO1A 1LWFA 2D5RA 4FW2A 4IBNA 1X1PA 3NF6A 3LWLA 1X9WA 2G8FA 3RMCA 4DQIA 4ZTJA 4FJ7A 1W9HA 1RDBA 1F21A 1C1BA 3KIOA 4YNQA 4FLVA 4DF4A 3SUNA 2KTQA 3JYTA 4CJEA 4DTOA 2XY8A 4CJFA 3SPZA 1NOYA 2BE2A 5E41A 4DS5A 1C0UA 5HRRA 5K14A 4E7JA 4DTRA 2YNIA 1RBUA 1WLJA 3TABA 3RMDA 1QSLA 2BANA 1Z26A 4DTSA 5SZTA 3L3UA 4KTQA 1ASWA 4DFMA 2QKKA 1NKCA 3SUPA 3O4NA 3P5JA 2GV9A 2X78A 5HRPA 2HNDA 2KZMA 4DFPA 1BCOA 1T03A 2FC0A 2B5JA 1TVRA 3AO1A 1U4BA 4Z4FA 4Z4CA 3TI0A 3DM2A 2G8UA 3KKSA 2XRIA 1DLOA 1LAWA 4RW8A 3HVRA 3M8QA 3AVLA 2EHGA 4QCLA 3LPTA 3ZSOA 1SL2A 3C6TA 4M45A 3OYGA 2YNHA 4KO0A 1T8EA 3VQ5A 3VQ6A 3EYZA 2EX3A 4DTPA 3ZSXA 3AA3A 4FYDA 3AVBA 3LAKA 2XY7A 2YNGA 2ZE2A 2VG6A 4DTUA 3AVIA 1BIUA 1VSHA 4OVLA 3B6OA 3K5NA 4B8CA 2HNZA 2O4GA 4OJRA 3NBPA 4MQ3A 3DLHA 4B9LA 2QKBA 3MXMA 2KZZA 4J2DA 3OJUA 1S6QA 4HHTA 3QETA 3LP0A 4CHPA 4DQRA 4KTZA 1TK5A 2VG5A 1TKDA 3HP6A 4J2EA 1TAUA 4ELUA 3FFIA 4M41A 2OPQA 3JSMA 5KRTA 3T3FA 3NH2A 5HLFA 4IFVA 3HXMA 1RT7A 3EZ5A 4Z4IA 1TGOA 2ATQA 4IFYA 4WE1A 1QSSA 4LH5A 3QEXA 4FK2A 4AHRA 3KK3A 4FM2A 1JLCA 3KTQA 3TAMA 4F2SA 1X9MA 5CYQA 4RW9A 3U3GA 1QTMA 3K5MA 1S9GA 2X6NA 2RKIA 4GMJB 5JS2A 4NYFA 1DTQA 1NJWA 3SQ4A 2HHSA 4M42A 2X6SA 4KHNA 1WSFA 1VSJA 3TAGA 4XIUA 2FBVA 2Y1JA 2KFZA 2Y1IA 2DTUA 1WAJA 1LW2A 1JLFA 4O44A 1B92A 4FJMA 1BGXT 4F2RA 3AO4A 4FZZA 3VQ4A 5KTQA 4DLEA 1NJYA 1VSLA 4KB1A 1C1CA 3SZ2A 2HHUA 3RRGA 1C1AA 3V9ZA 1NK8A 3CQ8A 4CJPA 5HRSA 3TAPA 1IG9A 4F3OA 4CFBA 3LZJA 4H4OA 3OVNA 4DF8A 4AHTA 3QEPA 4W5NA 3M8PA 3ZSYA 4GVMA 3S3MA 2P1JA 2FBYA 3LALA 3DLRA 1SV5A 4KPYA 4BWJA 4CEDA 1CZBA 2E6MA 3O3FA 1IKWA 2XO7A 1ASUA 3O3GA 3C94A 4OKJA 1T7PA 3KLHA 4DSIA 3V1RA 2AJQA 1IKXA 5HBMA 4CE9A 4FK0A 4FJ9A 4CIEA 3LPUA 3VQAA 4DTXA 4CGHA 1C6VA 1QS4A 1S6PA 4CJVA 4CF9A 4I7FA 5HRNA 4OPJA 2F8SA 3AO3A 1XC9A 4DTNA 3ZSVA 2HMIA 3K5LA 4I9LA 3SCXA 2F96A 4ID5A 1GOBA 4L8RB 4J2BA 1FXXA 2Q3SA 4FLTA 3HSTB 3RMBA 4CF2A 5I3UA 3RWUA 3OYCA 4DTJA 4NYNA 4B9NA 5T7BA 4FJ5A 4OLBA 1I39A 1JKHA 1D8YA 2HNYA 1WSJA 2W42A 1J53A 1X9SA 4W5QA 4CFCA 2P5OA 1HPZA 2WOMA 4CF8A 4CK2A 3C95A 3KLIA 3OYBA 3G10A 3AVNA 1C0TA 4AILC 1EP4A 1XWLA 1EETA 3I0RA 1L3SA 3S3NA 4BDZA 4B9UA 5DMRA 4BACA 1WNSA 3OS1A 4PQUA 2YNFA 1IH7A 1D9DA 4FM0A 1RCHA 1ZBHA 3KK1A 4BE0A 3HT3A 3L2RA 4BDYA 3HM9A 3QEIA 1NK5A 1D5AA 2HB5A 1UA0A 4W5TA 1KFSA 3DI6A 4KTWA 4KHQA 1VSDA 2KFNA 1YT3A 4DLGA 2WONA 1S9EA 3AVJA 2OA8A 1HJRA 1Q8IA 1RT4A 3VQ9A 2FBTA 3BGRA 2R7YA 1RT2A 3K5OA 4AH9A 4CIGA 3SQ2A 4NCAA 3MEDA 2KQ2A 4KHSA 2QXFA 4FLUA 3O3HA 2RN2A 4Y1DA 3VQDA 3LWMA 3HL8A 3OYAA 1LWCA 1WSEA 3VA3A 3SUQA 4CEQA 4CESA 4E19A 3SJJA 1NJXA 1WSIA 2IDOA 3PX4A 4Q0BA 3VQ7A 2B6AA 1BISA 4C8NA 4HUEA 4CJ4A 4CGIA 4DSKA 4CHZA 4FLZA 1RT5A 4O0JA 4KV8A 3D45A 4CERA 4CEAA 1TKTA 4FVMA 3CFRA 2RPIA 2BDPA 5KGXA 4QOZB 4LD0A 4OGCA 4O55A 4Z4GA 1JXEA 4Y1CA 2PYJA 3V9WA 3IG1A 4RW6A 3VN5A 1RT6A 3AVMA 2X74A 3AVHA 5C24A 1HNIA 4CK1A 4Q5VA 2YHBA 1ITGA 1QHTA 1ZBFA 3KLEA 3U3YA 3I8DA 1CXUA 1ZBUA 4N41A 4KHWA 4FJNA 4M3XA 4GW6A 2VWJA 3NCIA 1NJZA 3QERA 3P1GA 1S1WA 3V81A 4FJGA 3DLEA 1Y97A 4PA1A 2OPSA 2XY6A 4N76A 3NH1A 1WSHA 1EKEA 2D0CA 5KGWA 4FM1A 1S1VA 1J54A 1FKOA 4KAZA 1U48A 1ZYQA 3HK2A 1RTHA 3QNOA 3NH0A 4F8RA 3ZCMA 2IS3A 3M8RA 2G8VA 1ASVA 5J1EA 2D0AA 1VSEA 3L8BA 3HPHA 1TK8A 1HYSA 3OYNA 4EZ6A 4FCYA 2HVIA 2VWKA 4AHCA 4JS5A 1IKVA 5J2NA 1BQMA 2DFHA 4E7IA 2O4IA 1XHZA 2HHVA 2RF2A 3OS2A 1KLNA 3E01A 3RMAA 4Z0UA 1L3TA 3T1AA 1G15A 4B9MA 1JLQA 4B9VA 1TL3A 1RBTA 3KLFA 2Z1JA 1BI4B 3A2FA 3KKRA 3TAQA 3CYMA 3ZT4A 4KFBA 3VQEA 4JS4A 1HQUA 4CJQA 2ETJA 1XI1A 4J2AA 3PO4A 1YVUA 3AVAA 4E3SA 1NOZA 4B8AB 3L2VA 1N6QA 4AHUA 1HYZA 4I9QA 3I0SA 1B9FA 3PY8A 3NAEA 1N5YA 2NUBA 2ZQBA 2G8IA 4DG1A 3NHGA 5KI6A 4E7HA 3DRSA 1UAXA 3O4QA 4C8MA 3KLGA 1FKPA 3TARA 4C8LA 3K59A 5EU7A 4N47A 1BCMA 3C6UA 4E1MA 3NGIA 4FLYA 3WNHA 2G8KA 3DLBA 4DQQA 2HHXA 3KD5E 5JS1A 3OYMA 4DSFA 4CEZA 4N5SA 3SNNA 3WNEA 4PWDA 2OPPA 3M8SA 3LP1A 1BHLA 1RDAA 1VRUA 3THVA 1VSIA 4CF0A 3ZSRA 1WAFA 3PV8A 4DQPA 3BDPA 1KSPA 1UWBA 1JLBA 1W0HA 1RT3A 2OPRA 4DWIA 2JGUA 4M3UA 4Z4HA 2GBZA 5J2QA 4ID1A 3OYDA 3NF7A 1QE1A 1NK7A 1JL2A 1NK4A 2E6LA 1GOAA 1O1WA 4IG0A 4DSEA 3D0PA 1SL1A 4C8KA 1J5OA 4EP4A 4IKFA 3ZSQA 1Z25A 3EY1A 3OYHA 3AA2A 4FW1A 4HUGA 3KD1E 4H4MA 1LW0A 3VQBA 4CCHA 4OGEA 4TSXA 5FROA 4B9TA 1NK6A 4CK3A 2IGIA 3F9KA 4KHUA 1HNVA 2DFEA 1IO2A 1RBRA 4ELTA 4HTUA 3S3OA 1HMVA 2DFFA 4B08A 3TAEA 1QSYA 4LH4A 1IKYA 4OKEA 1S1UA 3OYKA 3QINA 1UA1A 1U47A 1K6YA 4NCGA 3ALYA 3SI6A 4HVJA 1YTAA 3LP3A 4CHNA 4FXDA 2I5JA 3DRRA 3SV4A 3PX0A 1L3VA 4BE2A 3QO9A 1BL3A 4DU1A 1BI4A 3QESA 4E89A 3OYIA 4B9SA 3LP2A 1BQNA 3ASMA 1KVBA 3QIPA 1RTJA 1GOCA 4CJSA 2HHTA 4DTMA 2ZD1A 1L5UA 3SV3A 3QEWA 1D9FA 4FLWA 1A5WA 4M3RA 3NGYA 4CF1A 3CG7A 3RRHA 5HROA 3SQ0A 3TR8A 1J9AA 4DSJA 4B3OA 2OZSA 2P51A 3MEGA 2PZSA 3TAFA 3AVCA 4DMNA 3ULDA 4MFBA 1TAQA 4CGJA 2OZMA 2HHWA 3LAMA 1SKWA 3VA0A 1Q9YA 3OS0A 4M3TA 3G0ZA 4CJWA 3OYEA 4F4KA 4RW7A 5CZ1A 3ZSWA 4UQGA 4CFAA 3HVTA 3WNGA 5D3GA 1KTQA 3KJVA 3L3VA 4FJXA 4EP5A 3OY9A 1MU2A 1EXQA 1U49A 4BDPA 2VG7A 4CGDA 1T05A 3ZT2A 1KLMA 4FZXC 1JLGA 2JLEA 3OYFA 2Z1IA 4CJKA 3HPOA 3MECA 4ZTFA 3IS9A 4RG8A 4IG3A 3IAYA 5DK5A 3PUFA 3V4IA 3DYAA 3HYFA 3F73A 3L2WA 4OKKA 1RT1A 4R5PA 1NKBA 2OYQA 3AV9A 4DU4A 2HHQA 4IDKA 1I3AA 1KVAA 2IAJA 1VSKA 1JL1A 3P83D 4E7KA 1LAVA 4CECA 3KK2A 2YKMA 4O5BA 4BWMA 1BIZA 3UIQA 4FJJA 3NF8A 1B9DA 4C8OA 1NK9A 1A5XA 2QK9A 3NFAA 1KCFA 1RTIA 2HVHA 4FK4A 2GUIA 3LANA 1CZ9A 2BGGA 3MXJA 3QLHA 3AA5X 1U45A 4AHVA 3CFPA 2LSNA 2Z1HA 4YFUA 4E7LA 4DS4A 5CZ2A 4EZ9A 1TV6A 1U04A 3NF9A 3AVKA 1R0AA 4OLAA 1KRPA 1VSMA 3ISNC 3VQCA 3SPYA 2FBXA 3SUOA
chains in the Genus database with same CATH superfamily
1LWEA 1WOQA 3V9UA 3TTDA 1HYVA 4JI5K 2P5GA 2W6KA 1T6CA 4G1QA 1WN7A 4F3TA 3M3ZA 5LMNK 1BA1A 3PO5A 4K8ZA 4JK8A 2JWKA 4H0PA 2HMPA 3HRGA 4CGFA 1QQMA 1W2BM 3TANA 3R8EA 5KPRA 2ITMA 5H1SQ 1NGHA 5C25A 2YHAA 3QNNA 4M3ZA 4CEOA 1CZAN 4O4GA 3MXIA 1M90O 2QWNA 3DOLA 1WSGA 3MN6A 1TKZA 3AO2A 1SKRA 2YJFA 4CFDA 4FJKA 5CYMA 4ZHRA 4BRCA 5LY3A 3CERA 3RTVA 3NE6A 4N56A 4CEEA 2P9UB 3CI5A 3DXKA 1X3NA 3LDNA 3DRPA 4LF5K 1JLAA 2B4JA 5FRNA 4O0IA 4YDUA 1YHQN 1WBBA 4RCHA 4JI6K 5B8HA 4B3RK 2E2OA 1DT9A 2O8FB 2FLOA 4W5OA 1RDCA 3DOKA 4BRHA 2IOCA 2YKNA 3DXMB 4JLHA 4NCBA 2F8TA 3CM5A 4DU3A 2D0BA 1ZBLA 4ELVA 1FK9A 3AARA 4CHOA 1Q86O 4CBXA 4KI6A 1KVCA 2NRVA 4M3WA 3DLKA 3CC2N 1HRHA 3K57A 2KLAA 3J80O 3T1YK 2V7ZA 3V9SA 1U2VB 1IBMK 2QWPA 3CM6A 4DV7K 3A5OC 3S9HA 4FJHA 3KWGA 2D5RA 1X1PA 3AGKA 3D7EO 1K9MO 3WXJA 1RDBA 4FLVA 4DF4A 1IV0A 3O9TA 4CJFA 4JN4A 2OANA 1NGAA 5E41A 2E2QA 2E1ZA 2O8DB 3L3UA 3PIPL 4DCHA 1ASWA 2QKKA 3SUPA 3P5JA 2HNDA 4JI4K 4DV3K 1BCOA 1ATNA 2B5JA 3AO1A 3FGUA 3KKSA 3M8QA 2EHGA 2JWLA 4WQ4A 4LFCK 2PAVA 2YNHA 4KO0A 4H5RA 3MN5A 3VQ6A 1OH8A 2EX3A 5BR9A 3AVBA 1JCFA 2ZE2A 1XUPO 3AVIA 4OVLA 3K5NA 3B6OA 4OJRA 4MQ3A 2KZZA 2QKBA 4BRKA 3F5TA 4KTZA 2VG5A 2F9WA 4ELUA 3FFIA 4EIAA 3JSMA 4XEIA 5KRTA 3LM2A 1RT7A 1OVYA 2ATQA 4WE1A 2FSKA 1ESVA 1GLEG 4AHRA 3CCQN 3KTQA 5M1PA 2RKIA 1NJWA 3SQ4A 1WBDA 3HSCA 4XIUA 2FBVA 1JLFA 3CCVN 1BG3A 4BROA 1T6DA 1BGXT 4FWKA 1HPMA 3VQ4A 3CF5L 1K8KA 2YHYA 3V9ZA 1NK8A 3CQ8A 5IWAK 4CFBA 2GUPA 4H4OA 3OVNA 3U4LA 2O8EB 4QS7A 4CBUA 2FBYA 4KPYA 4BWJA 1CZBA 3ENOA 3H45C 4DV0K 1NJIO 3O3GA 3KLHA 2AJQA 4FJ9A 2O8BA 3FR0A 2J4RA 4OPJA 3ATVA 4I7FA 3VPZA 1KC8O 1XC9A 3SCXA 3AAPA 4L8RB 4JD2A 1FXXA 2QWRA 2NRWA 4NYNA 1YITN 5FPNA 5T7BA 4FJ5A 1I39A 3EN9A 3PIOL 1WSJA 1J53A 1X9SA 2FF3B 4W5QA 4CFCA 1HPZA 3ATUA 3C7NB 5AFUA 2P9NB 1C0TA 1EETA 2BUPA 1L3SA 3AY9A 4M7YA 4YHHK 3OS1A 4ILHA 4L3QA 1RCHA 4DR5K 3KK1A 4BQZA 3HT3A 2PBDA 4BDYA 3HM9A 3ZETB 2D0PA 2HB5A 3QFPA 1Q8IA 3K5OA 4CZKA 4H5VA 4C1NI 3W3DA 5F2RA 4I6MB 5AJ3K 3OTOK 3HL8A 3I8BA 3VA3A 2HBMA 3SJJA 3CPWM 2VWBA 4AM7A 1NJXA 1SAZA 2A40A 4H0OA 1BISA 2RHKA 4HUEA 4WFNL 4CHZA 4PKGA 1NGIA 4KV8A 3D45A 4BC3A 3O8MA 3THYB 2V52B 2UU9K 4RW6A 1RT6A 5C24A 4FPAA 3AVHA 4Q5VA 5C2FA 3VEXA 4DHYA 3EO3A 4BR5A 3NCIA 3AAQA 3V81A 5EXWA 1Y97A 4PA1A 2HHHK 2OPSA 2XY6A 2D0CA 4FM1A 1J54A 1U48A 1RTHA 4FVUA 1K73O 4F8RA 3ZCMA 2IS3A 3M8RA 5J1EA 2QWQA 3HPHA 5C0YA 4FCYA 4NLCA 1L3TA 1G15A 1BWFO 5AQVA 3TAQA 3CYMA 2UXDK 1YVUA 3AVAA 1NOZA 3PY8A 2NUBA 1IBKK 4CZMA 5DM6L 1UAXA 2IVOA 3O4QA 4BC5A 3KLGA 4JEPA 4C8LA 1VQ6N 3NGIA 2G8KA 3DLBA 5M1OA 3WNHA 4DQQA 3F2KA 3OYMA 4BRNA 2UUBK 2P9KA 3WNEA 1BHLA 3THVA 4CF0A 3PV8A 4MO5A 4B3SK 1JLBA 2QTDA 4DWIA 2NNWA 4M3UA 3TPQA 4Z4HA 2GBZA 5C12A 4ID1A 5J2QA 3OYDA 2ZGYA 1QE1A 3NF7A 1GOAA 4ILGB 4DSEA 4IKFA 1YVNA 4IO9L 3EY1A 3IMXA 4LFBK 1Q81O 3SAHA 4B9TA 1NK6A 4KHUA 5TKYA 1HMVA 3TAEA 1VQPN 1IKYA 4A57A 4FWLA 5M1FA 3PX0A 2QWMA 4J8FA 4DU1A 3TSPA 3O9SA 3OYIA 2Q97A 3ASMA 1KVBA 1L5UA 4QS9A 3BF3A 3SK3A 4CF1A 3RRHA 5HROA 3TR8A 4B3OA 2E8AA 1P8ZA 1RGIA 2YCHA 4BREA 1Q9YA 3OS0A 2A5XA 2ASMA 3MX2A 1S72N 4F4KA 4ILJA 3HVTA 3KJVA 3EL2A 1MU2A 1EXQA 1BA0A 4CGDA 3ZT2A 4IXCA 3LDLA 4ZTFA 3CCMN 3IS9A 4RG8A 5LJVA 4IWVA 3DYAA 4JKBA 1YF5L 3HYFA 4X65K 3BZKA 4JAXA 1RT1A 4OKKA 4X62K 4H5NA 5KQDA 3I55N 4JKDA 2YKMA 4BWMA 4LF6K 3NF8A 1KQSM 4C8OA 2QM1A 3DXKB 1RTIA 3HI0A 4FK4A 3F9MA 1U45A 1K8AO 5CZ2A 3WQTA 4IEIA 3VGKA 3VQCA 4DFMA 3KVGA 4PUOA 3K9JA 3MEEA 4ISFA 3LM9A 3V9XA 3QEVA 4QOZB 3CCLN 1S1XA 4K8XA 4RTFD 4E0DA 1JLEA 1XHXA 2E4LA 1EX4A 3RSEA 5HOOA 3T19A 2BH1A 1NK0A 3D2FB 1C0MA 3K58A 4CJLA 1RDDA 4JRPA 1Q82O 4KKOA 3AVFA 4CI6A 5AR0A 4CJRA 3FZFA 4E1NA 4FJ8A 4DV1K 4CJUA 4JK7A 3ITHA 2NZTA 3C6AA 1A5VA 3SMPA 4A5BA 4LSNA 3SBTA 3CFOA 1VRTA 4I2QA 5AQJA 5C42A 4LY7A 4JYAK 1Q18A 3HM8A 4PY5A 3E1YA 4GV6A 2Q1NA 1TUYA 1REVA 4BRDA 1SL0A 4DSLA 1XNQK 4DV4K 3HP9A 4KH4A 2DY4A 3O9QA 3HJFA 3V1QA 3ZT0A 2A1RA 3IKMA 4B1UB 4BR7A 1LOTB 3THXA 3UKRB 3TSUA 2EWSA 3AVGA 4KH5A 5KPTA 5BREA 3DMJA 1QVFM 1VQKN 3MAQA 3D2EA 1YTUA 4JK9A 4JRQA 2HF3A 4BR2A 1J6ZA 3P31A 4KRFA 4HTLA 3ZT1A 3NVMA 4DQSA 4CJ3A 1NGDA 5I9EB 5SWMA 1SKSA 2IIRA 4CJ5A 4HCBA 3QIOA 4FL9A 4FW2A 4IBNA 3NF6A 1FW6A 2ZM6K 3D6RA 4BRPA 4B3TK 1K8KB 5HRRA 5K14A 4E7JA 1QSLA 2YNIA 4HCCA 3N4PA 2BANA 3C0BA 4DTSA 3CQYA 1NKCA 3O4WA 3R1XA 3C65A 2GV9A 2X78A 2KZMA 4JV5K 3SAGA 4DFPA 3VESA 2FC0A 3TU5A 1TVRA 1NMNA 4M63C 1X9JA 4OPAA 3MWTA 3AVLA 3LPTA 3ZSOA 3C6TA 4M45A 1T8EA 3EYZA 3HBTA 4FYDA 3LAKA 2O8BB 2YNGA 1WUAA 1NGBA 2HSTA 4B9LA 4CZGA 4BVPA 4HHTA 3K9KA 5IT9O 3QETA 4CHPA 1TK5A 1TKDA 1IG8A 1TAUA 1YUWA 4M41A 2OPQA 4X66K 3VERA 4BR4A 1N8RO 5KQ8A 3O1WA 1QSSA 4LH5A 1VQ4N 2I7NA 3KK3A 1JLCA 5AQOA 4F2SA 4DR6K 2X6NA 5BPNA 5JS2A 1VQ9N 4JNEA 3BY5A 3VGMA 2Y1JA 1NWKA 5GINA 4MO4A 3CC7N 2DTUA 1LW2A 3MDQA 1NGJA 1WB9A 4DUZK 2Q0UA 4DLEA 2D0OA 4KB1A 3E9PA 2HHUA 1C1AA 2F7TA 3VTHA 1N36K 4DF8A 3QEPA 4IOAL 1MDUB 3LALA 4IDHA 4IJNA 4GNIA 2E6MA 1GLAG 3O3FA 5BRDA 1J5EK 2XO7A 4DR4K 1ASUA 3C94A 3V1RA 3THWA 1IKXA 3BF1A 4PHTX 4JI8K 4OO1J 3J8AA 4DTXA 4KHPK 3GOIA 1C6VA 2Q0RA 4CJVA 1HR0K 2F8SA 1GLFO 3K5LA 3O9RA 4I9LA 1GOBA 1S3XA 1OKJA 3HSTB 4CF2A 3ZEUA 4GKKK 4OLBA 5AQSA 1D8YA 3DWLA 2W42A 5AQTA 3WXLA 5BN8A 4CF8A 3VF6A 3OYBA 4CJ7A 1EP4A 1VQMN 3VOVA 4PQUA 3ZX0A 2YNFA 5AZJA 4FM0A 1NNEA 1ZBHA 4A61A 4BRFA 4BVOA 5AQHA 3E9LA 1NK5A 1C0GA 4CZEA 4W5TA 1NMDA 1KFSA 3VTIA 3NMUA 1E3MA 4KHQA 2P9LB 3G71N 2WONA 1RT4A 2P9PA 3VQ9A 2R7YA 4NCAA 4CIGA 4KHSA 3MN9A 3MX5A 5JVHL 5ADXA 3ID8A 5E84A 4BG9A 4PL8A 2E1YA 3SUQA 4CEQA 4CESA 4E19A 2ZJPL 3VQ7A 4C8NA 4CGIA 3KHYA 4FLZA 4CERA 1GLLO 3WQUA 4JHDA 1TKTA 3CFRA 3KWIA 4O55A 3V9WA 4MDAA 3AVMA 3UKUB 4CK1A 2YHBA 4B1ZA 1VHXA 3VEWA 3I8DA 1CXUA 4LF8K 2VWJA 1NJZA 3QERA 3P1GA 4BC4A 3DLEA 3L4QA 1MWKA 4N76A 4GKJK 3NH1A 1WSHA 1EKEA 4DKWA 4K41A 1S1VA 4YOVA 5KPZA 5BRFA 2G8VA 2D0AA 3L8BA 1TK8A 1HKBA 2VQFK 1X3MA 2VWKA 4AHCA 4DV5K 4JS5A 5J2NA 2O4IA 2NRHA 1XHZA 3J7YP 1V4TA 1KLNA 4BGAA 1JCEA 1JLQA 4B9VA 3HOSA 4JKAA 3KLFA 2Z1JA 5BR8K 3ZT4A 4KFBA 3UE5A 1ZXOA 1XI1A 2ZWHA 5JMVA 1H1VA 1BU6O 4B8AB 3HZ6A 1N6QA 2ZQBA 5KI6A 4E7HA 3DRSA 1FKPA 3K59A 5EU7A 3KD5E 4DSFA 3PSIA 3SNNA 3CMEN 3LP1A 1VRUA 2P9IA 2UYTA 4DQPA 5AQYA 1KSPA 1UWBA 2OPRA 4PL7A 2JGUA 4FWPA 3J7ZO 1NK7A 2E6LA 4IJAA 3D0PA 1HNXK 3ZSQA 4A2AA 3OYHA 3WXKA 5FROA 4CK3A 2IGIA 2QI2A 1IO2A 1RBRA 1GLJO 4WFBL 3S3OA 1GLCG 2DFFA 3SLCA 4OKEA 3OYKA 3QINA 1UA1A 1U47A 3SI6A 1VQ7N 1YTAA 2I5JA 1L3VA 4IO8A 1NBWA 2WTUA 1HJOA 4AQYK 1BQNA 4IEEA 5A2QO 3QIPA 1RTJA 2HHTA 4EHTA 4CD3A 3GE1A 5AQQA 3EKUA 4CZHA 3OBWA 4GV9A 2P51A 2PZSA 3TAFA 3AVCA 4DMNA 5AQXA 5JLHA 2UUCK 2OZMA 3H46O 1SKWA 3VA0A 3O08A 4IZ9A 2E2PA 3L3VA 3UB5A 1TYQA 2P9UA 1T05A 1KLMA 2JLEA 3HPOA 4IOXA 4KBOA 4OPHA 3T69A 4RWTA 4IG3A 3IAYA 2W40A 2O8CB 4IOCL 3CQXA 3PLAA 4DU4A 2VGMA 1KVAA 1LAVA 1RFQA 3KK2A 4DV6K 1BIZA 3UIQA 1FJGK 3KZBA 1A5XA 3NFAA 5M1KA 2O8FA 2LSNA 3EE8A 1TV6A 4B1XB 1KRPA 1VSMA 4AHTA 3SPYA 3CCSN 3DXMA 5HP1A 3QBWA 4XH1A 3V6DA 3SMSA 3LZIA 3NGZA 2XY5A 1QQOA 2G8HA 4CZIA 3OYJA 5KRSA 3LL3A 1QQCA 1U2VA 5CY4A 4JKGB 2ITGA 1RILA 4DFJA 4OX9K 1JCGA 4YOWA 3VF4A 4KB0A 5AZIA 4QAGA 4H8KA 4KI4A 4HUFA 1VQNN 5AQNA 4KHYA 3VGLA 3AO5A 4CHYA 4LF7K 5CE3A 3L2QA 2CGLA 1T3VA 1L3UA 4CJTA 4FWSA 1RBVA 2KW4A 4WCEL 1KFDA 2VQEK 1LV5A 1DTTA 3M5RA 3V1OA 5BPMA 2Z1GA 5AQGA 4AHSA 3LDSA 4NO7A 3CPEA 1JXBA 3WEEB 4CEBA 2P9SB 4FJLA 3M1FA 1S5JA 1RBSA 1Q7YO 3B6PA 3OHRA 3OJSA 3GBTA 2OTLN 3RR7A 3CCEN 4YDUC 5CR4A 4ISEA 3I33A 1NU0A 2H3GX 3W0LA 3QICA 4BGBA 3ZSZA 4H0YB 4DR3K 4CIFA 1N32K 5I42A 4O8UA 5FPEA 2IC3A 3ULEA 5C10A 1TKXA 3R6MA 1UOCA 1RNHA 4YOTA 4FZYA 4W5RA 1ZBIA 1VAZA 3JS6A 3ZT3A 3ZX2A 3J7AP 2O8EA 4FWOA 2D4WA 2G8FA 3H3OB 5FLXO 4DQIA 2F4VK 2NLXA 4YNQA 1F21A 4EHUA 3KIOA 4G9ZA 3SUNA 2E2NA 3JYTA 1KD1O 2XY8A 1RDUA 2BE2A 1JJ2M 4DS5A 3RMDA 2AP1A 3EKSA 4KTQA 3G25A 1IJJA 4BRIA 3QFUA 1T03A 4Z4FA 1O13A 4Z4CA 3QB0A 2XRIA 1DLOA 1LAWA 4RW8A 2BTFA 3HVRA 3GDQA 1SL2A 5C15A 3ENHA 4DTPA 3AA3A 1YAGA 4DTUA 3O80A 1BIUA 4K25A 2O4GA 3NBPA 3A5LC 3DLHA 4DR2K 1QZ5A 1S6QA 3OJUA 3C7NA 3LP0A 4NB4A 3J81O 2P9NA 3OA9A 4J2EA 4WQ4C 3Q7BA 3T3FA 5HLFA 3EZ5A 4Z4IA 4IFYA 4FOIA 3AGRA 4FK2A 3MCAB 5JLFA 2NRTA 4FM2A 5CYQA 4RW9A 3U3GA 3VEYA 1QTMA 3ZETA 2QEXN 4NYFA 2HHSA 2X6SA 4NLBA 1VSJA 2Y1IA 1WAJA 4O44A 4B9QA 2OCEA 4F2RA 5KTQA 1VSLA 4BRLA 5FPMA 1C1CA 3RRGA 3TAPA 1VQ5N 1P90A 3LZJA 4JKEA 5F1XA 3MCPA 4W5NA 4JI2K 5F0XA 2WC9A 3S3MA 3FE1A 3DLRA 1EO1A 4CEDA 3U8XA 2GX9A 4H0VB 1T7PA 4OKJA 4DSIA 4C23A 5HBMA 1S22A 4GVEA 3THYA 3VQAA 4FWRA 4CGHA 1QS4A 1S6PA 2RE2A 4DTNA 2F96A 1SZ2A 3RWUA 3OYCA 4DTJA 4IFEA 4B9NA 4JI1K 1JKHA 2GELA 2HNYA 4K43A 3EEQA 2QWOA 3MN7A 4JI3K 2P5OA 5DM7L 4CK2A 3C95A 2E20A 4H5WA 2D1KA 3A5NC 1E4GT 3S3NA 2ZF5O 5EX5A 1WNSA 4U7BA 1ATSA 4QS8A 4BE0A 3L2RA 3QEIA 4YORA 4O5FA 4FWQA 5AQRA 1YJ9N 3DI6A 4KTWA 1VSDA 1YT3A 4DLGA 3AVJA 1RT2A 4AH9A 3B8AX 5EY4A 4CZLA 4FLUA 3O3HA 1OH6A 3SJHA 3CCUN 2VYPA 4Y1DA 3LWMA 1DGKN 3OYAA 1WSEA 2CGKA 4V19S 5ELZA 1WSIA 3PX4A 4BG8A 3FZKA 3RVCA 1LCUA 4BR9A 3WXMB 4FVMA 5KGXA 4DV2K 3L6QA 4LD0A 4Y1CA 2PYJA 3GG4A 3IG1A 1ILYA 2X74A 4B1WB 1QHTA 3U3YA 4JD2B 1QZ6A 3O9UA 4KHWA 4DUYK 2NRZA 4GW6A 4BRMA 4NXNK 2A42A 3EE9A 2W41A 5GIPA 1KAZA 4KAZA 1FKOA 3OBYA 1ZYQA 3HK2A 2YHXA 3BP8A 1ASVA 2Q36A 4DR7K 1HYSA 3OYNA 4EZ6A 4Y0WA 2HVIA 1BQMA 4O8KA 2DFHA 2HHVA 5GAHP 3OS2A 3U9DA 3E01A 4XH5A 4Z0UA 3RMAA 3T1AA 4B9MA 1TL3A 2VCPA 5AQKA 3KKRA 1HX1A 1TUUA 3VQEA 1NGCA 3M6GA 3PO4A 3L2VA 4AHUA 2WFBA 4I9QA 3I0SA 4JI0K 1N5YA 1W97L 4DG1A 3NHGA 3CJBA 3TARA 4PKHA 4E1MA 3C6UA 5JS1A 3MK6A 4N5SA 4Z94A 2KKZA 3M8SA 1RDAA 2A41A 1TYQB 4MLHA 1WAFA 3TSQA 3ZSRA 3BDPA 1W0HA 3N4QA 1JL2A 4IG0A 1O1WA 1SL1A 4C8KA 1J5OA 3KD1E 4HUGA 1LW0A 3VQBA 4OGEA 5GIOA 1GLBG 5MLCQ 1HNVA 3IFRA 4ELTA 4B08A 1QSYA 4LH4A 3T1HK 1K6YA 4NCGA 1D4XA 3ZX3A 2QWLA 5C2DA 3H1QA 3DRRA 4GV3A 4BE2A 3CMAN 3QO9A 1BL3A 4MDBA 1BI4A 3QESA 3LP2A 4FOEA 3D2FA 4CJSA 4WQ5A 4UY8O 1D9FA 1A5WA 3DAWA 3ZYYX 3SQ0A 1J9AA 3CJAA 4DSJA 3P4IA 3ULDA 2GEMA 4MFBA 1TAQA 2QW9A 4M3TA 3G0ZA 3U9ZA 3OYEA 4RW7A 3R9PA 2FSJA 4UQGA 4CFAA 3WNGA 1KTQA 4WYBA 4FJXA 5GAEP 3OY9A 1U49A 4BDPA 5AZIB 4FZXC 1JLGA 2Z1IA 4CJKA 5GADP 3MECA 5DK5A 3PUFA 3V4IA 3CXCM 3L2WA 3O5BA 4R5PA 3AV9A 3P83D 1VSKA 1JL1A 2QA4N 4E7KA 2P9KB 4FJJA 5AQMA 5FPDA 1EWRA 3CD6N 1NK9A 1KCFA 3LANA 2BGGA 4AHVA 3CFPA 2Z1HA 4YFUA 3T7ZA 4E7LA 5AQIA 4CZFA 3A8YA 3CJ7A 3IUCA 4J2DA 2FBXA 3SUOA 3UKRA 3K0SA 3HPGA 5J2MA 3AA4A 3OW2M 2E5LK 2PYLA 5E26A 3VQPA 4FLXA 3E9OA 5FRMA 1NKEA 3SQ1A 1XC3A 4ICLA 4CBWA 2VGNA 2XHBA 4LSLA 3RR8A 3TWHA 4Z4EA 2ASOA 4FWNA 2I7PA 3R3LA 1VSFA 2YV0X 3GL1A 2WBNA 1V4SA 5M1NA 1HQEA 1Y64A 2IVPA 2HW3A 4DQ8A 4LC9B 3VQQA 2AA4A 2ZJRL 2CH6A 4BE1A 5FDLA 5ADXH 1U6ZA 1YIJN 4FSVA 2F9TA 3SYZA 3VEZA 4A5AA 5LJWA 3DLGA 4NXMK 1SUQA 1HKGA 3A5MC 3ULEB 3PX6A 4DFKA 3CJ1A 3IRXA 4FPBA 3WNFA 4LFAK 3VF2A 3VQ8A 2NRRA 4FJIA 1OH7A 4BRAA 2A1SA 2GTDA 1S1TA 4OPKA 3U6FA 1BO5O 4I2PA 2V7YA 3Q7CA 3NDKA 4A59A 2HBLA 1HNZK 4EFHA 1G99A 4M3YA 2FSNA 1Q9XA 1CLQA 4XH4A 1RTDA 4KREA 2W6LA 2A6AA 2PY5A 3CJ9A 3CHWA 1M1KO 3WXIA 3OYLA 1R59O 1CXQA 2WUSA 2GWKA 5AQUA 1EWQA 4RW4A 2ZGZA 4WFAL 1NLVA 4CGGA 1RDWX 1XMQK 2G8WA 4CEFA 5J2PA 3S41A 2KHOA 4ISGA 4CHQA 3L2UA 1N34K 1TK0A 3CCJN 1TL1A 3H08A 4BRGA 2NRXA 3O6WA 1VK0A 3RSEB 5CHIA 3LDQA 4A62A 3K2PA 1LWFA 3H1VX 3IDHA 3LWLA 2QXLA 1X9WA 1BOTO 3RMCA 4FJ7A 4ZTJA 4LF9K 1W9HA 2HHQA 1C1BA 2KTQA 4YOUA 2FF6A 1NGGA 4AF1A 4CJEA 2Q2RA 4DTOA 3SPZA 1NOYA 1C0UA 4DTRA 3TABA 1RBUA 1WLJA 4CW7B 2A3ZA 1Z26A 5SZTA 3O4NA 5HRPA 1T44A 4KH6A 1U4BA 3TI0A 3DM2A 2G8UA 3CJCA 5AFUH 5JICA 4R79A 3VMFB 4QCLA 3TTFA 1MWMA 1XNRK 3OYGA 3VQ5A 3ZSXA 1SQKA 2XY7A 2VG6A 1VSHA 5BPLA 4B8CA 2HNZA 1MA9B 3LDPA 3MXMA 3NVKA 2YJEA 4DQRA 3HP6A 1OVQA 3NH2A 1BUPA 2UXCK 4IFVA 3HXMA 1TGOA 3EZWA 3QEXA 3THXB 3TAMA 1X9MA 3K5MA 1S9GA 3QDKA 4GMJB 5AQFA 1DTQA 3FLCO 1Z05A 4M42A 4KHNA 1WSFA 3TAGA 3D2EB 2KFZA 5AQZA 4BRQA 2P9LA 3ENBA 1B92A 4FJMA 4E1JA 4AM6A 3AO4A 4FZZA 1NJYA 1KAXA 3SZ2A 1YJNN 1EQYA 4M7XA 4CJPA 5HRSA 1IG9A 4F3OA 4LF4K 3SAFA 2O8DA 4K42A 3P38A 1NG9A 1VQ8N 3JXUA 3M8PA 3ZSYA 4GVMA 4BR0A 5GAGP 2P1JA 1SV5A 4B3MK 1IKWA 3H6EA 4CE9A 4FK0A 2DPNA 1YJWN 4CIEA 3LPUA 5LL6Z 4MLEA 1VQON 4CF9A 5HRNA 3AO3A 3UKUA 3ZSVA 2HMIA 4ID5A 1DKGD 4CVNE 4FLTA 2Q3SA 4J2BA 3RMBA 5I3UA 5EOYA 2FXUA 1KXPA 3H3NO 1NGFA 5AQWA 5BN9A 2WOMA 3KLIA 3G10A 3AVNA 4AILC 3I0RA 1XWLA 2YX6A 3VEOA 4BDZA 4B9UA 2CGJA 3FFKB 5AQPA 5DMRA 4BACA 1SS6A 1IH7A 1D9DA 3DJCA 1VQLN 4BC2A 1D5AA 1C0FA 1UA0A 2IVNA 1Z6RA 1S9EA 2OA8A 1HJRA 1KAYA 3VENA 2FBTA 3BGRA 3QMLA 4JKHA 3SQ2A 3MEDA 2KQ2A 3BEXA 2QXFA 5EVZA 2RN2A 2E88A 3VQDA 3HOTA 1LWCA 4WQ5C 4DR1K 1OH5A 2PFUA 2IDOA 5TKWA 3CCRN 4Q0BA 2B6AA 4C1NK 4CJ4A 4DSKA 3THWB 1RT5A 4O0JA 1GLDG 4CEAA 2RPIA 4BY9C 1XQSC 3A0IX 2BDPA 4OGCA 4Z4GA 1JXEA 3VN5A 1HNIA 1ITGA 1ZBFA 3KLEA 1HLUA 4BQLA 3QBXA 1ZBUA 4N41A 4FJNA 3ZEUB 4M3XA 1E4FT 1YI2N 2HF4A 1YXQA 1S1WA 1ZBSA 4FJGA 2ASPA 3O1BA 3FZMA 5KGWA 4PKIA 3G4SN 3SBGA 3QNOA 3FZHA 3NH0A 5AQLA 1VSEA 3CETA 4YOYA 2HBJA 2YI1A 1IKVA 5AZJB 4E7IA 2RF2A 1RBTA 5HL7L 3A2FA 1BI4B 1QHAA 4I6MA 4FWMA 4H03B 1DEJA 4JS4A 1HQUA 3L0QA 2ETJA 4CJQA 3DLLL 4J2AA 3VETA 4E3SA 2P9PB 1HYZA 4JKFA 3TTCA 1B9FA 3HTVA 4H5TA 3BUZB 3NAEA 2G8IA 3MWPA 4C8MA 2O8CA 1W7AA 4N47A 1BCMA 4FLYA 4CZJA 2HHXA 4CEZA 1ZC6A 4PWDA 2OPPA 1VSIA 4HWIA 4YY3K 3I56N 2GWJA 1RT3A 1XMOK 4GY2B 1QVGM 4JHDB 4CD1A 1NK4A 3PSFA 4EP4A 1Z25A 3AA2A 4FW1A 4B1VA 4H4MA 4WF9L 4CCHA 4TSXA 4F9OA 4YOXA 3F9KA 3FZLA 2V51B 4EAHD 2DFEA 3WUHA 4HTUA 3G6EN 3KK7A 1ATRA 1S1UA 2OTJN 3JAMO 1IBLK 2YHWA 3ALYA 4HVJA 3LP3A 4CHNA 4X64K 4FXDA 3SV4A 2UUAK 4DB3A 4E89A 4B9SA 2HOEA 4JKGA 3E66A 1GOCA 4JKCA 2ZD1A 4DTMA 3SV3A 3QEWA 4FLWA 1HKCA 4M3RA 3NGYA 2ZJQL 4B1YB 3CG7A 3CC4N 1I94K 2OZSA 3MEGA 1HNWK 4CGJA 2Q31A 2HHWA 1QQNA 1NGEA 3LAMA 4U67L 3C6HA 4CJWA 2HBKA 1BDGA 3MMVA 3WT0A 5CZ1A 3BZCA 3ZSWA 5JVGL 5D3GA 4EP5A 2VG7A 5LMUK 3OYFA 2KFNA 3LDOA 4H0TB 3F73A 2OYQA 5BRHA 1NKBA 4H0XB 4A2BA 4IDKA 1I3AA 2IAJA 3VEVA 2UXBK 3CIPA 4CECA 4JI7K 4O5BA 3WEEA 2P9IB 3ZLJA 1B9DA 2P9SA 3L4IA 2QK9A 2HVHA 2GUIA 1CZ9A 1HUXA 3MXJA 3QLHA 4FO0A 3AA5X 3P39A 2CH5A 5M1QA 4DS4A 1NM1A 4EZ9A 1U04A 3NF9A 3AVKA 1R0AA 1N33K 4OLAA 3ISNC 4K0KK 3ID6A 3HO1A
chains in the Genus database with same CATH topology
1LWEA 5J2MA 3HPGA 3AA4A 5HP1A 3V9UA 4PUOA 2PYLA 1HYVA 3VQPA 4FLXA 5FRMA 2P5GA 1NKEA 3SQ1A 4ICLA 4G1QA 3V6DA 3MEEA 1WN7A 3V9XA 2XHBA 3QEVA 3LZIA 3NGZA 2XY5A 1S1XA 4K8XA 4F3TA 3PO5A 4LSLA 3RR8A 4K8ZA 3TWHA 2G8HA 1JLEA 3OYJA 4E0DA 4Z4EA 1XHXA 5KRSA 2E4LA 1VSFA 2YV0X 1EX4A 1QQCA 4CGFA 1HQEA 3T19A 5CY4A 2HW3A 2ITGA 3TANA 1RILA 3VQQA 1NK0A 4DFJA 1C0MA 5C25A 4BE1A 3K58A 5FDLA 4CJLA 2YHAA 1RDDA 4JRPA 3QNNA 4M3ZA 4KKOA 3AVFA 4CJRA 3SYZA 4CEOA 4KB0A 4O4GA 3DLGA 4E1NA 4QAGA 4H8KA 3MXIA 4KI4A 1SUQA 3DOLA 4FJ8A 4HUFA 3PX6A 1WSGA 4CJUA 4KHYA 1TKZA 3AO2A 3ITHA 3IRXA 4DFKA 1SKRA 3WNFA 1A5VA 3AO5A 4CFDA 4CHYA 4FJKA 4LSNA 5CYMA 3VQ8A 4FJIA 3CFOA 1VRTA 2A1SA 4I2QA 4ZHRA 3L2QA 3RTVA 1S1TA 3NE6A 4CJTA 1L3UA 4N56A 4OPKA 4CEEA 3U6FA 4I2PA 1RBVA 2KW4A 1KFDA 5C42A 1LV5A 4LY7A 3NDKA 4PY5A 1DTTA 3V1OA 3DRPA 4HCCA 1JLAA 1REVA 2Z1GA 4M3YA 1Q9XA 1CLQA 2B4JA 4AHSA 3LDSA 1SL0A 1RTDA 4DSLA 5FRNA 4O0IA 4KREA 1JXBA 2PY5A 3HP9A 4CEBA 4FJLA 3OYLA 2DY4A 1S5JA 3HJFA 1CXQA 4W5OA 1RDCA 3DOKA 3V1QA 3ZT0A 1RBSA 2A1RA 3B6PA 3OJSA 4RW4A 2IOCA 3RR7A 4CGGA 2G8WA 2YKNA 4CEFA 5J2PA 3AVGA 4JLHA 4NCBA 2F8TA 3CM5A 4DU3A 2D0BA 1ZBLA 3DMJA 4ELVA 3ZSZA 3MAQA 1FK9A 1YTUA 4JRQA 4CHOA 4CHQA 4CIFA 3L2UA 1TK0A 4KI6A 4KRFA 1KVCA 4M3WA 3DLKA 5I42A 1TL1A 3H08A 1HRHA 3K57A 3ZT1A 2IC3A 1TKXA 1VK0A 4CJ3A 1UOCA 4DQSA 3V9SA 1RNHA 5SWMA 1SKSA 4FZYA 4W5RA 1ZBIA 3CM6A 3S9HA 4FJHA 4CJ5A 4HCBA 3K2PA 3ZT3A 3QIOA 3HO1A 1LWFA 2D5RA 4FW2A 4IBNA 1X1PA 3NF6A 3LWLA 1X9WA 2G8FA 3RMCA 4DQIA 4ZTJA 4FJ7A 1W9HA 1RDBA 1F21A 1C1BA 3KIOA 4YNQA 4FLVA 4DF4A 3SUNA 2KTQA 3JYTA 4CJEA 4DTOA 2XY8A 4CJFA 3SPZA 1NOYA 2BE2A 5E41A 4DS5A 1C0UA 5HRRA 5K14A 4E7JA 4DTRA 2YNIA 1RBUA 1WLJA 3TABA 3RMDA 1QSLA 2BANA 1Z26A 4DTSA 5SZTA 3L3UA 4KTQA 1ASWA 4DFMA 2QKKA 1NKCA 3SUPA 3O4NA 3P5JA 2GV9A 2X78A 5HRPA 2HNDA 2KZMA 4DFPA 1BCOA 1T03A 2FC0A 2B5JA 1TVRA 3AO1A 1U4BA 4Z4FA 4Z4CA 3TI0A 3DM2A 2G8UA 3KKSA 2XRIA 1DLOA 1LAWA 4RW8A 3HVRA 3M8QA 3AVLA 2EHGA 4QCLA 3LPTA 3ZSOA 1SL2A 3C6TA 4M45A 3OYGA 2YNHA 4KO0A 1T8EA 3VQ5A 3VQ6A 3EYZA 2EX3A 4DTPA 3ZSXA 3AA3A 4FYDA 3AVBA 3LAKA 2XY7A 2YNGA 2ZE2A 2VG6A 4DTUA 3AVIA 1BIUA 1VSHA 4OVLA 3B6OA 3K5NA 4B8CA 2HNZA 2O4GA 4OJRA 3NBPA 4MQ3A 3DLHA 4B9LA 2QKBA 3MXMA 2KZZA 4J2DA 3OJUA 1S6QA 4HHTA 3QETA 3LP0A 4CHPA 4DQRA 4KTZA 1TK5A 2VG5A 1TKDA 3HP6A 4J2EA 1TAUA 4ELUA 3FFIA 4M41A 2OPQA 3JSMA 5KRTA 3T3FA 3NH2A 5HLFA 4IFVA 3HXMA 1RT7A 3EZ5A 4Z4IA 1TGOA 2ATQA 4IFYA 4WE1A 1QSSA 4LH5A 3QEXA 4FK2A 4AHRA 3KK3A 4FM2A 1JLCA 3KTQA 3TAMA 4F2SA 1X9MA 5CYQA 4RW9A 3U3GA 1QTMA 3K5MA 1S9GA 2X6NA 2RKIA 4GMJB 5JS2A 4NYFA 1DTQA 1NJWA 3SQ4A 2HHSA 4M42A 2X6SA 4KHNA 1WSFA 1VSJA 3TAGA 4XIUA 2FBVA 2Y1JA 2KFZA 2Y1IA 2DTUA 1WAJA 1LW2A 1JLFA 4O44A 1B92A 4FJMA 1BGXT 4F2RA 3AO4A 4FZZA 3VQ4A 5KTQA 4DLEA 1NJYA 1VSLA 4KB1A 1C1CA 3SZ2A 2HHUA 3RRGA 1C1AA 3V9ZA 1NK8A 3CQ8A 4CJPA 5HRSA 3TAPA 1IG9A 4F3OA 4CFBA 3LZJA 4H4OA 3OVNA 4DF8A 4AHTA 3QEPA 4W5NA 3M8PA 3ZSYA 4GVMA 3S3MA 2P1JA 2FBYA 3LALA 3DLRA 1SV5A 4KPYA 4BWJA 4CEDA 1CZBA 2E6MA 3O3FA 1IKWA 2XO7A 1ASUA 3O3GA 3C94A 4OKJA 1T7PA 3KLHA 4DSIA 3V1RA 2AJQA 1IKXA 5HBMA 4CE9A 4FK0A 4FJ9A 4CIEA 3LPUA 3VQAA 4DTXA 4CGHA 1C6VA 1QS4A 1S6PA 4CJVA 4CF9A 4I7FA 5HRNA 4OPJA 2F8SA 3AO3A 1XC9A 4DTNA 3ZSVA 2HMIA 3K5LA 4I9LA 3SCXA 2F96A 4ID5A 1GOBA 4L8RB 4J2BA 1FXXA 2Q3SA 4FLTA 3HSTB 3RMBA 4CF2A 5I3UA 3RWUA 3OYCA 4DTJA 4NYNA 4B9NA 5T7BA 4FJ5A 4OLBA 1I39A 1JKHA 1D8YA 2HNYA 1WSJA 2W42A 1J53A 1X9SA 4W5QA 4CFCA 2P5OA 1HPZA 2WOMA 4CF8A 4CK2A 3C95A 3KLIA 3OYBA 3G10A 3AVNA 1C0TA 4AILC 1EP4A 1XWLA 1EETA 3I0RA 1L3SA 3S3NA 4BDZA 4B9UA 5DMRA 4BACA 1WNSA 3OS1A 4PQUA 2YNFA 1IH7A 1D9DA 4FM0A 1RCHA 1ZBHA 3KK1A 4BE0A 3HT3A 3L2RA 4BDYA 3HM9A 3QEIA 1NK5A 1D5AA 2HB5A 1UA0A 4W5TA 1KFSA 3DI6A 4KTWA 4KHQA 1VSDA 2KFNA 1YT3A 4DLGA 2WONA 1S9EA 3AVJA 2OA8A 1HJRA 1Q8IA 1RT4A 3VQ9A 2FBTA 3BGRA 2R7YA 1RT2A 3K5OA 4AH9A 4CIGA 3SQ2A 4NCAA 3MEDA 2KQ2A 4KHSA 2QXFA 4FLUA 3O3HA 2RN2A 4Y1DA 3VQDA 3LWMA 3HL8A 3OYAA 1LWCA 1WSEA 3VA3A 3SUQA 4CEQA 4CESA 4E19A 3SJJA 1NJXA 1WSIA 2IDOA 3PX4A 4Q0BA 3VQ7A 2B6AA 1BISA 4C8NA 4HUEA 4CJ4A 4CGIA 4DSKA 4CHZA 4FLZA 1RT5A 4O0JA 4KV8A 3D45A 4CERA 4CEAA 1TKTA 4FVMA 3CFRA 2RPIA 2BDPA 5KGXA 4QOZB 4LD0A 4OGCA 4O55A 4Z4GA 1JXEA 4Y1CA 2PYJA 3V9WA 3IG1A 4RW6A 3VN5A 1RT6A 3AVMA 2X74A 3AVHA 5C24A 1HNIA 4CK1A 4Q5VA 2YHBA 1ITGA 1QHTA 1ZBFA 3KLEA 3U3YA 3I8DA 1CXUA 1ZBUA 4N41A 4KHWA 4FJNA 4M3XA 4GW6A 2VWJA 3NCIA 1NJZA 3QERA 3P1GA 1S1WA 3V81A 4FJGA 3DLEA 1Y97A 4PA1A 2OPSA 2XY6A 4N76A 3NH1A 1WSHA 1EKEA 2D0CA 5KGWA 4FM1A 1S1VA 1J54A 1FKOA 4KAZA 1U48A 1ZYQA 3HK2A 1RTHA 3QNOA 3NH0A 4F8RA 3ZCMA 2IS3A 3M8RA 2G8VA 1ASVA 5J1EA 2D0AA 1VSEA 3L8BA 3HPHA 1TK8A 1HYSA 3OYNA 4EZ6A 4FCYA 2HVIA 2VWKA 4AHCA 4JS5A 1IKVA 5J2NA 1BQMA 2DFHA 4E7IA 2O4IA 1XHZA 2HHVA 2RF2A 3OS2A 1KLNA 3E01A 3RMAA 4Z0UA 1L3TA 3T1AA 1G15A 4B9MA 1JLQA 4B9VA 1TL3A 1RBTA 3KLFA 2Z1JA 1BI4B 3A2FA 3KKRA 3TAQA 3CYMA 3ZT4A 4KFBA 3VQEA 4JS4A 1HQUA 4CJQA 2ETJA 1XI1A 4J2AA 3PO4A 1YVUA 3AVAA 4E3SA 1NOZA 4B8AB 3L2VA 1N6QA 4AHUA 1HYZA 4I9QA 3I0SA 1B9FA 3PY8A 3NAEA 1N5YA 2NUBA 2ZQBA 2G8IA 4DG1A 3NHGA 5KI6A 4E7HA 3DRSA 1UAXA 3O4QA 4C8MA 3KLGA 1FKPA 3TARA 4C8LA 3K59A 5EU7A 4N47A 1BCMA 3C6UA 4E1MA 3NGIA 4FLYA 3WNHA 2G8KA 3DLBA 4DQQA 2HHXA 3KD5E 5JS1A 3OYMA 4DSFA 4CEZA 4N5SA 3SNNA 3WNEA 4PWDA 2OPPA 3M8SA 3LP1A 1BHLA 1RDAA 1VRUA 3THVA 1VSIA 4CF0A 3ZSRA 1WAFA 3PV8A 4DQPA 3BDPA 1KSPA 1UWBA 1JLBA 1W0HA 1RT3A 2OPRA 4DWIA 2JGUA 4M3UA 4Z4HA 2GBZA 5J2QA 4ID1A 3OYDA 3NF7A 1QE1A 1NK7A 1JL2A 1NK4A 2E6LA 1GOAA 1O1WA 4IG0A 4DSEA 3D0PA 1SL1A 4C8KA 1J5OA 4EP4A 4IKFA 3ZSQA 1Z25A 3EY1A 3OYHA 3AA2A 4FW1A 4HUGA 3KD1E 4H4MA 1LW0A 3VQBA 4CCHA 4OGEA 4TSXA 5FROA 4B9TA 1NK6A 4CK3A 2IGIA 3F9KA 4KHUA 1HNVA 2DFEA 1IO2A 1RBRA 4ELTA 4HTUA 3S3OA 1HMVA 2DFFA 4B08A 3TAEA 1QSYA 4LH4A 1IKYA 4OKEA 1S1UA 3OYKA 3QINA 1UA1A 1U47A 1K6YA 4NCGA 3ALYA 3SI6A 4HVJA 1YTAA 3LP3A 4CHNA 4FXDA 2I5JA 3DRRA 3SV4A 3PX0A 1L3VA 4BE2A 3QO9A 1BL3A 4DU1A 1BI4A 3QESA 4E89A 3OYIA 4B9SA 3LP2A 1BQNA 3ASMA 1KVBA 3QIPA 1RTJA 1GOCA 4CJSA 2HHTA 4DTMA 2ZD1A 1L5UA 3SV3A 3QEWA 1D9FA 4FLWA 1A5WA 4M3RA 3NGYA 4CF1A 3CG7A 3RRHA 5HROA 3SQ0A 3TR8A 1J9AA 4DSJA 4B3OA 2OZSA 2P51A 3MEGA 2PZSA 3TAFA 3AVCA 4DMNA 3ULDA 4MFBA 1TAQA 4CGJA 2OZMA 2HHWA 3LAMA 1SKWA 3VA0A 1Q9YA 3OS0A 4M3TA 3G0ZA 4CJWA 3OYEA 4F4KA 4RW7A 5CZ1A 3ZSWA 4UQGA 4CFAA 3HVTA 3WNGA 5D3GA 1KTQA 3KJVA 3L3VA 4FJXA 4EP5A 3OY9A 1MU2A 1EXQA 1U49A 4BDPA 2VG7A 4CGDA 1T05A 3ZT2A 1KLMA 4FZXC 1JLGA 2JLEA 3OYFA 2Z1IA 4CJKA 3HPOA 3MECA 4ZTFA 3IS9A 4RG8A 4IG3A 3IAYA 5DK5A 3PUFA 3V4IA 3DYAA 3HYFA 3F73A 3L2WA 4OKKA 1RT1A 4R5PA 1NKBA 2OYQA 3AV9A 4DU4A 2HHQA 4IDKA 1I3AA 1KVAA 2IAJA 1VSKA 1JL1A 3P83D 4E7KA 1LAVA 4CECA 3KK2A 2YKMA 4O5BA 4BWMA 1BIZA 3UIQA 4FJJA 3NF8A 1B9DA 4C8OA 1NK9A 1A5XA 2QK9A 3NFAA 1KCFA 1RTIA 2HVHA 4FK4A 2GUIA 3LANA 1CZ9A 2BGGA 3MXJA 3QLHA 3AA5X 1U45A 4AHVA 3CFPA 2LSNA 2Z1HA 4YFUA 4E7LA 4DS4A 5CZ2A 4EZ9A 1TV6A 1U04A 3NF9A 3AVKA 1R0AA 4OLAA 1KRPA 1VSMA 3ISNC 3VQCA 3SPYA 2FBXA 3SUOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LWE A;  5J2M A;  3HPG A;  3AA4 A;  5HP1 A;  3V9U A;  4PUO A;  2PYL A;  1HYV A;  3VQP A;  4FLX A;  5FRM A;  2P5G A;  1NKE A;  3SQ1 A;  4ICL A;  4G1Q A;  3V6D A;  3MEE A;  1WN7 A;  3V9X A;  2XHB A;  3QEV A;  3LZI A;  3NGZ A;  2XY5 A;  1S1X A;  4K8X A;  4F3T A;  3PO5 A;  4LSL A;  3RR8 A;  4K8Z A;  3TWH A;  2G8H A;  1JLE A;  3OYJ A;  4E0D A;  4Z4E A;  1XHX A;  5KRS A;  2E4L A;  1VSF A;  2YV0 X;  1EX4 A;  1QQC A;  4CGF A;  1HQE A;  3T19 A;  5CY4 A;  2HW3 A;  2ITG A;  3TAN A;  1RIL A;  3VQQ A;  1NK0 A;  4DFJ A;  1C0M A;  5C25 A;  4BE1 A;  3K58 A;  5FDL A;  4CJL A;  2YHA A;  1RDD A;  4JRP A;  3QNN A;  4M3Z A;  4KKO A;  3AVF A;  4CJR A;  3SYZ A;  4CEO A;  4KB0 A;  4O4G A;  3DLG A;  4E1N A;  4QAG A;  4H8K A;  3MXI A;  4KI4 A;  1SUQ A;  3DOL A;  4FJ8 A;  4HUF A;  3PX6 A;  1WSG A;  4CJU A;  4KHY A;  1TKZ A;  3AO2 A;  3ITH A;  3IRX A;  4DFK A;  1SKR A;  3WNF A;  1A5V A;  3AO5 A;  4CFD A;  4CHY A;  4FJK A;  4LSN A;  5CYM A;  3VQ8 A;  4FJI A;  3CFO A;  1VRT A;  2A1S A;  4I2Q A;  4ZHR A;  3L2Q A;  3RTV A;  1S1T A;  3NE6 A;  4CJT A;  1L3U A;  4N56 A;  4OPK A;  4CEE A;  3U6F A;  4I2P A;  1RBV A;  2KW4 A;  1KFD A;  5C42 A;  1LV5 A;  4LY7 A;  3NDK A;  4PY5 A;  1DTT A;  3V1O A;  3DRP A;  4HCC A;  1JLA A;  1REV A;  2Z1G A;  4M3Y A;  1Q9X A;  1CLQ A;  2B4J A;  4AHS A;  3LDS A;  1SL0 A;  1RTD A;  4DSL A;  5FRN A;  4O0I A;  4KRE A;  1JXB A;  2PY5 A;  3HP9 A;  4CEB A;  4FJL A;  3OYL A;  2DY4 A;  1S5J A;  3HJF A;  1CXQ A;  4W5O A;  1RDC A;  3DOK A;  3V1Q A;  3ZT0 A;  1RBS A;  2A1R A;  3B6P A;  3OJS A;  4RW4 A;  2IOC A;  3RR7 A;  4CGG A;  2G8W A;  2YKN A;  4CEF A;  5J2P A;  3AVG A;  4JLH A;  4NCB A;  2F8T A;  3CM5 A;  4DU3 A;  2D0B A;  1ZBL A;  3DMJ A;  4ELV A;  3ZSZ A;  3MAQ A;  1FK9 A;  1YTU A;  4JRQ A;  4CHO A;  4CHQ A;  4CIF A;  3L2U A;  1TK0 A;  4KI6 A;  4KRF A;  1KVC A;  4M3W A;  3DLK A;  5I42 A;  1TL1 A;  3H08 A;  1HRH A;  3K57 A;  3ZT1 A;  2IC3 A;  1TKX A;  1VK0 A;  4CJ3 A;  1UOC A;  4DQS A;  3V9S A;  1RNH A;  5SWM A;  1SKS A;  4FZY A;  4W5R A;  1ZBI A;  3CM6 A;  3S9H A;  4FJH A;  4CJ5 A;  4HCB A;  3K2P A;  3ZT3 A;  3QIO A;  3HO1 A;  1LWF A;  2D5R A;  4FW2 A;  4IBN A;  1X1P A;  3NF6 A;  3LWL A;  1X9W A;  2G8F A;  3RMC A;  4DQI A;  4ZTJ A;  4FJ7 A;  1W9H A;  1RDB A;  1F21 A;  1C1B A;  3KIO A;  4YNQ A;  4FLV A;  4DF4 A;  3SUN A;  2KTQ A;  3JYT A;  4CJE A;  4DTO A;  2XY8 A;  4CJF A;  3SPZ A;  1NOY A;  2BE2 A;  5E41 A;  4DS5 A;  1C0U A;  5HRR A;  5K14 A;  4E7J A;  4DTR A;  2YNI A;  1RBU A;  1WLJ A;  3TAB A;  3RMD A;  1QSL A;  2BAN A;  1Z26 A;  4DTS A;  5SZT A;  3L3U A;  4KTQ A;  1ASW A;  4DFM A;  2QKK A;  1NKC A;  3SUP A;  3O4N A;  3P5J A;  2GV9 A;  2X78 A;  5HRP A;  2HND A;  2KZM A;  4DFP A;  1BCO A;  1T03 A;  2FC0 A;  2B5J A;  1TVR A;  3AO1 A;  1U4B A;  4Z4F A;  4Z4C A;  3TI0 A;  3DM2 A;  2G8U A;  3KKS A;  2XRI A;  1DLO A;  1LAW A;  4RW8 A;  3HVR A;  3M8Q A;  3AVL A;  2EHG A;  4QCL A;  3LPT A;  3ZSO A;  1SL2 A;  3C6T A;  4M45 A;  3OYG A;  2YNH A;  4KO0 A;  1T8E A;  3VQ5 A;  3VQ6 A;  3EYZ A;  2EX3 A;  4DTP A;  3ZSX A;  3AA3 A;  4FYD A;  3AVB A;  3LAK A;  2XY7 A;  2YNG A;  2ZE2 A;  2VG6 A;  4DTU A;  3AVI A;  1BIU A;  1VSH A;  4OVL A;  3B6O A;  3K5N A;  4B8C A;  2HNZ A;  2O4G A;  4OJR A;  3NBP A;  4MQ3 A;  3DLH A;  4B9L A;  2QKB A;  3MXM A;  2KZZ A;  4J2D A;  3OJU A;  1S6Q A;  4HHT A;  3QET A;  3LP0 A;  4CHP A;  4DQR A;  4KTZ A;  1TK5 A;  2VG5 A;  1TKD A;  3HP6 A;  4J2E A;  1TAU A;  4ELU A;  3FFI A;  4M41 A;  2OPQ A;  3JSM A;  5KRT A;  3T3F A;  3NH2 A;  5HLF A;  4IFV A;  3HXM A;  1RT7 A;  3EZ5 A;  4Z4I A;  1TGO A;  2ATQ A;  4IFY A;  4WE1 A;  1QSS A;  4LH5 A;  3QEX A;  4FK2 A;  4AHR A;  3KK3 A;  4FM2 A;  1JLC A;  3KTQ A;  3TAM A;  4F2S A;  1X9M A;  5CYQ A;  4RW9 A;  3U3G A;  1QTM A;  3K5M A;  1S9G A;  2X6N A;  2RKI A;  4GMJ B;  5JS2 A;  4NYF A;  1DTQ A;  1NJW A;  3SQ4 A;  2HHS A;  4M42 A;  2X6S A;  4KHN A;  1WSF A;  1VSJ A;  3TAG A;  4XIU A;  2FBV A;  2Y1J A;  2KFZ A;  2Y1I A;  2DTU A;  1WAJ A;  1LW2 A;  1JLF A;  4O44 A;  1B92 A;  4FJM A;  1BGX T;  4F2R A;  3AO4 A;  4FZZ A;  3VQ4 A;  5KTQ A;  4DLE A;  1NJY A;  1VSL A;  4KB1 A;  1C1C A;  3SZ2 A;  2HHU A;  3RRG A;  1C1A A;  3V9Z A;  1NK8 A;  3CQ8 A;  4CJP A;  5HRS A;  3TAP A;  1IG9 A;  4F3O A;  4CFB A;  3LZJ A;  4H4O A;  3OVN A;  4DF8 A;  4AHT A;  3QEP A;  4W5N A;  3M8P A;  3ZSY A;  4GVM A;  3S3M A;  2P1J A;  2FBY A;  3LAL A;  3DLR A;  1SV5 A;  4KPY A;  4BWJ A;  4CED A;  1CZB A;  2E6M A;  3O3F A;  1IKW A;  2XO7 A;  1ASU A;  3O3G A;  3C94 A;  4OKJ A;  1T7P A;  3KLH A;  4DSI A;  3V1R A;  2AJQ A;  1IKX A;  5HBM A;  4CE9 A;  4FK0 A;  4FJ9 A;  4CIE A;  3LPU A;  3VQA A;  4DTX A;  4CGH A;  1C6V A;  1QS4 A;  1S6P A;  4CJV A;  4CF9 A;  4I7F A;  5HRN A;  4OPJ A;  2F8S A;  3AO3 A;  1XC9 A;  4DTN A;  3ZSV A;  2HMI A;  3K5L A;  4I9L A;  3SCX A;  2F96 A;  4ID5 A;  1GOB A;  4L8R B;  4J2B A;  1FXX A;  2Q3S A;  4FLT A;  3HST B;  3RMB A;  4CF2 A;  5I3U A;  3RWU A;  3OYC A;  4DTJ A;  4NYN A;  4B9N A;  5T7B A;  4FJ5 A;  4OLB A;  1I39 A;  1JKH A;  1D8Y A;  2HNY A;  1WSJ A;  2W42 A;  1J53 A;  1X9S A;  4W5Q A;  4CFC A;  2P5O A;  1HPZ A;  2WOM A;  4CF8 A;  4CK2 A;  3C95 A;  3KLI A;  3OYB A;  3G10 A;  3AVN A;  1C0T A;  4AIL C;  1EP4 A;  1XWL A;  1EET A;  3I0R A;  1L3S A;  3S3N A;  4BDZ A;  4B9U A;  5DMR A;  4BAC A;  1WNS A;  3OS1 A;  4PQU A;  2YNF A;  1IH7 A;  1D9D A;  4FM0 A;  1RCH A;  1ZBH A;  3KK1 A;  4BE0 A;  3HT3 A;  3L2R A;  4BDY A;  3HM9 A;  3QEI A;  1NK5 A;  1D5A A;  2HB5 A;  1UA0 A;  4W5T A;  1KFS A;  3DI6 A;  4KTW A;  4KHQ A;  1VSD A;  2KFN A;  1YT3 A;  4DLG A;  2WON A;  1S9E A;  3AVJ A;  2OA8 A;  1HJR A;  1Q8I A;  1RT4 A;  3VQ9 A;  2FBT A;  3BGR A;  2R7Y A;  1RT2 A;  3K5O A;  4AH9 A;  4CIG A;  3SQ2 A;  4NCA A;  3MED A;  2KQ2 A;  4KHS A;  2QXF A;  4FLU A;  3O3H A;  2RN2 A;  4Y1D A;  3VQD A;  3LWM A;  3HL8 A;  3OYA A;  1LWC A;  1WSE A;  3VA3 A;  3SUQ A;  4CEQ A;  4CES A;  4E19 A;  3SJJ A;  1NJX A;  1WSI A;  2IDO A;  3PX4 A;  4Q0B A;  3VQ7 A;  2B6A A;  1BIS A;  4C8N A;  4HUE A;  4CJ4 A;  4CGI A;  4DSK A;  4CHZ A;  4FLZ A;  1RT5 A;  4O0J A;  4KV8 A;  3D45 A;  4CER A;  4CEA A;  1TKT A;  4FVM A;  3CFR A;  2RPI A;  2BDP A;  5KGX A;  4QOZ B;  4LD0 A;  4OGC A;  4O55 A;  4Z4G A;  1JXE A;  4Y1C A;  2PYJ A;  3V9W A;  3IG1 A;  4RW6 A;  3VN5 A;  1RT6 A;  3AVM A;  2X74 A;  3AVH A;  5C24 A;  1HNI A;  4CK1 A;  4Q5V A;  2YHB A;  1ITG A;  1QHT A;  1ZBF A;  3KLE A;  3U3Y A;  3I8D A;  1CXU A;  1ZBU A;  4N41 A;  4KHW A;  4FJN A;  4M3X A;  4GW6 A;  2VWJ A;  3NCI A;  1NJZ A;  3QER A;  3P1G A;  1S1W A;  3V81 A;  4FJG A;  3DLE A;  1Y97 A;  4PA1 A;  2OPS A;  2XY6 A;  4N76 A;  3NH1 A;  1WSH A;  1EKE A;  2D0C A;  5KGW A;  4FM1 A;  1S1V A;  1J54 A;  1FKO A;  4KAZ A;  1U48 A;  1ZYQ A;  3HK2 A;  1RTH A;  3QNO A;  3NH0 A;  4F8R A;  3ZCM A;  2IS3 A;  3M8R A;  2G8V A;  1ASV A;  5J1E A;  2D0A A;  1VSE A;  3L8B A;  3HPH A;  1TK8 A;  1HYS A;  3OYN A;  4EZ6 A;  4FCY A;  2HVI A;  2VWK A;  4AHC A;  4JS5 A;  1IKV A;  5J2N A;  1BQM A;  2DFH A;  4E7I A;  2O4I A;  1XHZ A;  2HHV A;  2RF2 A;  3OS2 A;  1KLN A;  3E01 A;  3RMA A;  4Z0U A;  1L3T A;  3T1A A;  1G15 A;  4B9M A;  1JLQ A;  4B9V A;  1TL3 A;  1RBT A;  3KLF A;  2Z1J A;  1BI4 B;  3A2F A;  3KKR A;  3TAQ A;  3CYM A;  3ZT4 A;  4KFB A;  3VQE A;  4JS4 A;  1HQU A;  4CJQ A;  2ETJ A;  1XI1 A;  4J2A A;  3PO4 A;  1YVU A;  3AVA A;  4E3S A;  1NOZ A;  4B8A B;  3L2V A;  1N6Q A;  4AHU A;  1HYZ A;  4I9Q A;  3I0S A;  1B9F A;  3PY8 A;  3NAE A;  1N5Y A;  2NUB A;  2ZQB A;  2G8I A;  4DG1 A;  3NHG A;  5KI6 A;  4E7H A;  3DRS A;  1UAX A;  3O4Q A;  4C8M A;  3KLG A;  1FKP A;  3TAR A;  4C8L A;  3K59 A;  5EU7 A;  4N47 A;  1BCM A;  3C6U A;  4E1M A;  3NGI A;  4FLY A;  3WNH A;  2G8K A;  3DLB A;  4DQQ A;  2HHX A;  3KD5 E;  5JS1 A;  3OYM A;  4DSF A;  4CEZ A;  4N5S A;  3SNN A;  3WNE A;  4PWD A;  2OPP A;  3M8S A;  3LP1 A;  1BHL A;  1RDA A;  1VRU A;  3THV A;  1VSI A;  4CF0 A;  3ZSR A;  1WAF A;  3PV8 A;  4DQP A;  3BDP A;  1KSP A;  1UWB A;  1JLB A;  1W0H A;  1RT3 A;  2OPR A;  4DWI A;  2JGU A;  4M3U A;  4Z4H A;  2GBZ A;  5J2Q A;  4ID1 A;  3OYD A;  3NF7 A;  1QE1 A;  1NK7 A;  1JL2 A;  1NK4 A;  2E6L A;  1GOA A;  1O1W A;  4IG0 A;  4DSE A;  3D0P A;  1SL1 A;  4C8K A;  1J5O A;  4EP4 A;  4IKF A;  3ZSQ A;  1Z25 A;  3EY1 A;  3OYH A;  3AA2 A;  4FW1 A;  4HUG A;  3KD1 E;  4H4M A;  1LW0 A;  3VQB A;  4CCH A;  4OGE A;  4TSX A;  5FRO A;  4B9T A;  1NK6 A;  4CK3 A;  2IGI A;  3F9K A;  4KHU A;  1HNV A;  2DFE A;  1IO2 A;  1RBR A;  4ELT A;  4HTU A;  3S3O A;  1HMV A;  2DFF A;  4B08 A;  3TAE A;  1QSY A;  4LH4 A;  1IKY A;  4OKE A;  1S1U A;  3OYK A;  3QIN A;  1UA1 A;  1U47 A;  1K6Y A;  4NCG A;  3ALY A;  3SI6 A;  4HVJ A;  1YTA A;  3LP3 A;  4CHN A;  4FXD A;  2I5J A;  3DRR A;  3SV4 A;  3PX0 A;  1L3V A;  4BE2 A;  3QO9 A;  1BL3 A;  4DU1 A;  1BI4 A;  3QES A;  4E89 A;  3OYI A;  4B9S A;  3LP2 A;  1BQN A;  3ASM A;  1KVB A;  3QIP A;  1RTJ A;  1GOC A;  4CJS A;  2HHT A;  4DTM A;  2ZD1 A;  1L5U A;  3SV3 A;  3QEW A;  1D9F A;  4FLW A;  1A5W A;  4M3R A;  3NGY A;  4CF1 A;  3CG7 A;  3RRH A;  5HRO A;  3SQ0 A;  3TR8 A;  1J9A A;  4DSJ A;  4B3O A;  2OZS A;  2P51 A;  3MEG A;  2PZS A;  3TAF A;  3AVC A;  4DMN A;  3ULD A;  4MFB A;  1TAQ A;  4CGJ A;  2OZM A;  2HHW A;  3LAM A;  1SKW A;  3VA0 A;  1Q9Y A;  3OS0 A;  4M3T A;  3G0Z A;  4CJW A;  3OYE A;  4F4K A;  4RW7 A;  5CZ1 A;  3ZSW A;  4UQG A;  4CFA A;  3HVT A;  3WNG A;  5D3G A;  1KTQ A;  3KJV A;  3L3V A;  4FJX A;  4EP5 A;  3OY9 A;  1MU2 A;  1EXQ A;  1U49 A;  4BDP A;  2VG7 A;  4CGD A;  1T05 A;  3ZT2 A;  1KLM A;  4FZX C;  1JLG A;  2JLE A;  3OYF A;  2Z1I A;  4CJK A;  3HPO A;  3MEC A;  4ZTF A;  3IS9 A;  4RG8 A;  4IG3 A;  3IAY A;  5DK5 A;  3PUF A;  3V4I A;  3DYA A;  3HYF A;  3F73 A;  3L2W A;  4OKK A;  1RT1 A;  4R5P A;  1NKB A;  2OYQ A;  3AV9 A;  4DU4 A;  2HHQ A;  4IDK A;  1I3A A;  1KVA A;  2IAJ A;  1VSK A;  1JL1 A;  3P83 D;  4E7K A;  1LAV A;  4CEC A;  3KK2 A;  2YKM A;  4O5B A;  4BWM A;  1BIZ A;  3UIQ A;  4FJJ A;  3NF8 A;  1B9D A;  4C8O A;  1NK9 A;  1A5X A;  2QK9 A;  3NFA A;  1KCF A;  1RTI A;  2HVH A;  4FK4 A;  2GUI A;  3LAN A;  1CZ9 A;  2BGG A;  3MXJ A;  3QLH A;  3AA5 X;  1U45 A;  4AHV A;  3CFP A;  2LSN A;  2Z1H A;  4YFU A;  4E7L A;  4DS4 A;  5CZ2 A;  4EZ9 A;  1TV6 A;  1U04 A;  3NF9 A;  3AVK A;  1R0A A;  4OLA A;  1KRP A;  1VSM A;  3ISN C;  3VQC A;  3SPY A;  2FBX A;  3SUO A; 
#chains in the Genus database with same CATH topology
 1LWE A;  1WOQ A;  3V9U A;  3TTD A;  1HYV A;  4JI5 K;  2P5G A;  2W6K A;  1T6C A;  4G1Q A;  1WN7 A;  4F3T A;  3M3Z A;  5LMN K;  1BA1 A;  3PO5 A;  4K8Z A;  4JK8 A;  2JWK A;  4H0P A;  2HMP A;  3HRG A;  4CGF A;  1QQM A;  1W2B M;  3TAN A;  3R8E A;  5KPR A;  2ITM A;  5H1S Q;  1NGH A;  5C25 A;  2YHA A;  3QNN A;  4M3Z A;  4CEO A;  1CZA N;  4O4G A;  3MXI A;  1M90 O;  2QWN A;  3DOL A;  1WSG A;  3MN6 A;  1TKZ A;  3AO2 A;  1SKR A;  2YJF A;  4CFD A;  4FJK A;  5CYM A;  4ZHR A;  4BRC A;  5LY3 A;  3CER A;  3RTV A;  3NE6 A;  4N56 A;  4CEE A;  2P9U B;  3CI5 A;  3DXK A;  1X3N A;  3LDN A;  3DRP A;  4LF5 K;  1JLA A;  2B4J A;  5FRN A;  4O0I A;  4YDU A;  1YHQ N;  1WBB A;  4RCH A;  4JI6 K;  5B8H A;  4B3R K;  2E2O A;  1DT9 A;  2O8F B;  2FLO A;  4W5O A;  1RDC A;  3DOK A;  4BRH A;  2IOC A;  2YKN A;  3DXM B;  4JLH A;  4NCB A;  2F8T A;  3CM5 A;  4DU3 A;  2D0B A;  1ZBL A;  4ELV A;  1FK9 A;  3AAR A;  4CHO A;  1Q86 O;  4CBX A;  4KI6 A;  1KVC A;  2NRV A;  4M3W A;  3DLK A;  3CC2 N;  1HRH A;  3K57 A;  2KLA A;  3J80 O;  3T1Y K;  2V7Z A;  3V9S A;  1U2V B;  1IBM K;  2QWP A;  3CM6 A;  4DV7 K;  3A5O C;  3S9H A;  4FJH A;  3KWG A;  2D5R A;  1X1P A;  3AGK A;  3D7E O;  1K9M O;  3WXJ A;  1RDB A;  4FLV A;  4DF4 A;  1IV0 A;  3O9T A;  4CJF A;  4JN4 A;  2OAN A;  1NGA A;  5E41 A;  2E2Q A;  2E1Z A;  2O8D B;  3L3U A;  3PIP L;  4DCH A;  1ASW A;  2QKK A;  3SUP A;  3P5J A;  2HND A;  4JI4 K;  4DV3 K;  1BCO A;  1ATN A;  2B5J A;  3AO1 A;  3FGU A;  3KKS A;  3M8Q A;  2EHG A;  2JWL A;  4WQ4 A;  4LFC K;  2PAV A;  2YNH A;  4KO0 A;  4H5R A;  3MN5 A;  3VQ6 A;  1OH8 A;  2EX3 A;  5BR9 A;  3AVB A;  1JCF A;  2ZE2 A;  1XUP O;  3AVI A;  4OVL A;  3K5N A;  3B6O A;  4OJR A;  4MQ3 A;  2KZZ A;  2QKB A;  4BRK A;  3F5T A;  4KTZ A;  2VG5 A;  2F9W A;  4ELU A;  3FFI A;  4EIA A;  3JSM A;  4XEI A;  5KRT A;  3LM2 A;  1RT7 A;  1OVY A;  2ATQ A;  4WE1 A;  2FSK A;  1ESV A;  1GLE G;  4AHR A;  3CCQ N;  3KTQ A;  5M1P A;  2RKI A;  1NJW A;  3SQ4 A;  1WBD A;  3HSC A;  4XIU A;  2FBV A;  1JLF A;  3CCV N;  1BG3 A;  4BRO A;  1T6D A;  1BGX T;  4FWK A;  1HPM A;  3VQ4 A;  3CF5 L;  1K8K A;  2YHY A;  3V9Z A;  1NK8 A;  3CQ8 A;  5IWA K;  4CFB A;  2GUP A;  4H4O A;  3OVN A;  3U4L A;  2O8E B;  4QS7 A;  4CBU A;  2FBY A;  4KPY A;  4BWJ A;  1CZB A;  3ENO A;  3H45 C;  4DV0 K;  1NJI O;  3O3G A;  3KLH A;  2AJQ A;  4FJ9 A;  2O8B A;  3FR0 A;  2J4R A;  4OPJ A;  3ATV A;  4I7F A;  3VPZ A;  1KC8 O;  1XC9 A;  3SCX A;  3AAP A;  4L8R B;  4JD2 A;  1FXX A;  2QWR A;  2NRW A;  4NYN A;  1YIT N;  5FPN A;  5T7B A;  4FJ5 A;  1I39 A;  3EN9 A;  3PIO L;  1WSJ A;  1J53 A;  1X9S A;  2FF3 B;  4W5Q A;  4CFC A;  1HPZ A;  3ATU A;  3C7N B;  5AFU A;  2P9N B;  1C0T A;  1EET A;  2BUP A;  1L3S A;  3AY9 A;  4M7Y A;  4YHH K;  3OS1 A;  4ILH A;  4L3Q A;  1RCH A;  4DR5 K;  3KK1 A;  4BQZ A;  3HT3 A;  2PBD A;  4BDY A;  3HM9 A;  3ZET B;  2D0P A;  2HB5 A;  3QFP A;  1Q8I A;  3K5O A;  4CZK A;  4H5V A;  4C1N I;  3W3D A;  5F2R A;  4I6M B;  5AJ3 K;  3OTO K;  3HL8 A;  3I8B A;  3VA3 A;  2HBM A;  3SJJ A;  3CPW M;  2VWB A;  4AM7 A;  1NJX A;  1SAZ A;  2A40 A;  4H0O A;  1BIS A;  2RHK A;  4HUE A;  4WFN L;  4CHZ A;  4PKG A;  1NGI A;  4KV8 A;  3D45 A;  4BC3 A;  3O8M A;  3THY B;  2V52 B;  2UU9 K;  4RW6 A;  1RT6 A;  5C24 A;  4FPA A;  3AVH A;  4Q5V A;  5C2F A;  3VEX A;  4DHY A;  3EO3 A;  4BR5 A;  3NCI A;  3AAQ A;  3V81 A;  5EXW A;  1Y97 A;  4PA1 A;  2HHH K;  2OPS A;  2XY6 A;  2D0C A;  4FM1 A;  1J54 A;  1U48 A;  1RTH A;  4FVU A;  1K73 O;  4F8R A;  3ZCM A;  2IS3 A;  3M8R A;  5J1E A;  2QWQ A;  3HPH A;  5C0Y A;  4FCY A;  4NLC A;  1L3T A;  1G15 A;  1BWF O;  5AQV A;  3TAQ A;  3CYM A;  2UXD K;  1YVU A;  3AVA A;  1NOZ A;  3PY8 A;  2NUB A;  1IBK K;  4CZM A;  5DM6 L;  1UAX A;  2IVO A;  3O4Q A;  4BC5 A;  3KLG A;  4JEP A;  4C8L A;  1VQ6 N;  3NGI A;  2G8K A;  3DLB A;  5M1O A;  3WNH A;  4DQQ A;  3F2K A;  3OYM A;  4BRN A;  2UUB K;  2P9K A;  3WNE A;  1BHL A;  3THV A;  4CF0 A;  3PV8 A;  4MO5 A;  4B3S K;  1JLB A;  2QTD A;  4DWI A;  2NNW A;  4M3U A;  3TPQ A;  4Z4H A;  2GBZ A;  5C12 A;  4ID1 A;  5J2Q A;  3OYD A;  2ZGY A;  1QE1 A;  3NF7 A;  1GOA A;  4ILG B;  4DSE A;  4IKF A;  1YVN A;  4IO9 L;  3EY1 A;  3IMX A;  4LFB K;  1Q81 O;  3SAH A;  4B9T A;  1NK6 A;  4KHU A;  5TKY A;  1HMV A;  3TAE A;  1VQP N;  1IKY A;  4A57 A;  4FWL A;  5M1F A;  3PX0 A;  2QWM A;  4J8F A;  4DU1 A;  3TSP A;  3O9S A;  3OYI A;  2Q97 A;  3ASM A;  1KVB A;  1L5U A;  4QS9 A;  3BF3 A;  3SK3 A;  4CF1 A;  3RRH A;  5HRO A;  3TR8 A;  4B3O A;  2E8A A;  1P8Z A;  1RGI A;  2YCH A;  4BRE A;  1Q9Y A;  3OS0 A;  2A5X A;  2ASM A;  3MX2 A;  1S72 N;  4F4K A;  4ILJ A;  3HVT A;  3KJV A;  3EL2 A;  1MU2 A;  1EXQ A;  1BA0 A;  4CGD A;  3ZT2 A;  4IXC A;  3LDL A;  4ZTF A;  3CCM N;  3IS9 A;  4RG8 A;  5LJV A;  4IWV A;  3DYA A;  4JKB A;  1YF5 L;  3HYF A;  4X65 K;  3BZK A;  4JAX A;  1RT1 A;  4OKK A;  4X62 K;  4H5N A;  5KQD A;  3I55 N;  4JKD A;  2YKM A;  4BWM A;  4LF6 K;  3NF8 A;  1KQS M;  4C8O A;  2QM1 A;  3DXK B;  1RTI A;  3HI0 A;  4FK4 A;  3F9M A;  1U45 A;  1K8A O;  5CZ2 A;  3WQT A;  4IEI A;  3VGK A;  3VQC A;  4DFM A;  3KVG A;  4PUO A;  3K9J A;  3MEE A;  4ISF A;  3LM9 A;  3V9X A;  3QEV A;  4QOZ B;  3CCL N;  1S1X A;  4K8X A;  4RTF D;  4E0D A;  1JLE A;  1XHX A;  2E4L A;  1EX4 A;  3RSE A;  5HOO A;  3T19 A;  2BH1 A;  1NK0 A;  3D2F B;  1C0M A;  3K58 A;  4CJL A;  1RDD A;  4JRP A;  1Q82 O;  4KKO A;  3AVF A;  4CI6 A;  5AR0 A;  4CJR A;  3FZF A;  4E1N A;  4FJ8 A;  4DV1 K;  4CJU A;  4JK7 A;  3ITH A;  2NZT A;  3C6A A;  1A5V A;  3SMP A;  4A5B A;  4LSN A;  3SBT A;  3CFO A;  1VRT A;  4I2Q A;  5AQJ A;  5C42 A;  4LY7 A;  4JYA K;  1Q18 A;  3HM8 A;  4PY5 A;  3E1Y A;  4GV6 A;  2Q1N A;  1TUY A;  1REV A;  4BRD A;  1SL0 A;  4DSL A;  1XNQ K;  4DV4 K;  3HP9 A;  4KH4 A;  2DY4 A;  3O9Q A;  3HJF A;  3V1Q A;  3ZT0 A;  2A1R A;  3IKM A;  4B1U B;  4BR7 A;  1LOT B;  3THX A;  3UKR B;  3TSU A;  2EWS A;  3AVG A;  4KH5 A;  5KPT A;  5BRE A;  3DMJ A;  1QVF M;  1VQK N;  3MAQ A;  3D2E A;  1YTU A;  4JK9 A;  4JRQ A;  2HF3 A;  4BR2 A;  1J6Z A;  3P31 A;  4KRF A;  4HTL A;  3ZT1 A;  3NVM A;  4DQS A;  4CJ3 A;  1NGD A;  5I9E B;  5SWM A;  1SKS A;  2IIR A;  4CJ5 A;  4HCB A;  3QIO A;  4FL9 A;  4FW2 A;  4IBN A;  3NF6 A;  1FW6 A;  2ZM6 K;  3D6R A;  4BRP A;  4B3T K;  1K8K B;  5HRR A;  5K14 A;  4E7J A;  1QSL A;  2YNI A;  4HCC A;  3N4P A;  2BAN A;  3C0B A;  4DTS A;  3CQY A;  1NKC A;  3O4W A;  3R1X A;  3C65 A;  2GV9 A;  2X78 A;  2KZM A;  4JV5 K;  3SAG A;  4DFP A;  3VES A;  2FC0 A;  3TU5 A;  1TVR A;  1NMN A;  4M63 C;  1X9J A;  4OPA A;  3MWT A;  3AVL A;  3LPT A;  3ZSO A;  3C6T A;  4M45 A;  1T8E A;  3EYZ A;  3HBT A;  4FYD A;  3LAK A;  2O8B B;  2YNG A;  1WUA A;  1NGB A;  2HST A;  4B9L A;  4CZG A;  4BVP A;  4HHT A;  3K9K A;  5IT9 O;  3QET A;  4CHP A;  1TK5 A;  1TKD A;  1IG8 A;  1TAU A;  1YUW A;  4M41 A;  2OPQ A;  4X66 K;  3VER A;  4BR4 A;  1N8R O;  5KQ8 A;  3O1W A;  1QSS A;  4LH5 A;  1VQ4 N;  2I7N A;  3KK3 A;  1JLC A;  5AQO A;  4F2S A;  4DR6 K;  2X6N A;  5BPN A;  5JS2 A;  1VQ9 N;  4JNE A;  3BY5 A;  3VGM A;  2Y1J A;  1NWK A;  5GIN A;  4MO4 A;  3CC7 N;  2DTU A;  1LW2 A;  3MDQ A;  1NGJ A;  1WB9 A;  4DUZ K;  2Q0U A;  4DLE A;  2D0O A;  4KB1 A;  3E9P A;  2HHU A;  1C1A A;  2F7T A;  3VTH A;  1N36 K;  4DF8 A;  3QEP A;  4IOA L;  1MDU B;  3LAL A;  4IDH A;  4IJN A;  4GNI A;  2E6M A;  1GLA G;  3O3F A;  5BRD A;  1J5E K;  2XO7 A;  4DR4 K;  1ASU A;  3C94 A;  3V1R A;  3THW A;  1IKX A;  3BF1 A;  4PHT X;  4JI8 K;  4OO1 J;  3J8A A;  4DTX A;  4KHP K;  3GOI A;  1C6V A;  2Q0R A;  4CJV A;  1HR0 K;  2F8S A;  1GLF O;  3K5L A;  3O9R A;  4I9L A;  1GOB A;  1S3X A;  1OKJ A;  3HST B;  4CF2 A;  3ZEU A;  4GKK K;  4OLB A;  5AQS A;  1D8Y A;  3DWL A;  2W42 A;  5AQT A;  3WXL A;  5BN8 A;  4CF8 A;  3VF6 A;  3OYB A;  4CJ7 A;  1EP4 A;  1VQM N;  3VOV A;  4PQU A;  3ZX0 A;  2YNF A;  5AZJ A;  4FM0 A;  1NNE A;  1ZBH A;  4A61 A;  4BRF A;  4BVO A;  5AQH A;  3E9L A;  1NK5 A;  1C0G A;  4CZE A;  4W5T A;  1NMD A;  1KFS A;  3VTI A;  3NMU A;  1E3M A;  4KHQ A;  2P9L B;  3G71 N;  2WON A;  1RT4 A;  2P9P A;  3VQ9 A;  2R7Y A;  4NCA A;  4CIG A;  4KHS A;  3MN9 A;  3MX5 A;  5JVH L;  5ADX A;  3ID8 A;  5E84 A;  4BG9 A;  4PL8 A;  2E1Y A;  3SUQ A;  4CEQ A;  4CES A;  4E19 A;  2ZJP L;  3VQ7 A;  4C8N A;  4CGI A;  3KHY A;  4FLZ A;  4CER A;  1GLL O;  3WQU A;  4JHD A;  1TKT A;  3CFR A;  3KWI A;  4O55 A;  3V9W A;  4MDA A;  3AVM A;  3UKU B;  4CK1 A;  2YHB A;  4B1Z A;  1VHX A;  3VEW A;  3I8D A;  1CXU A;  4LF8 K;  2VWJ A;  1NJZ A;  3QER A;  3P1G A;  4BC4 A;  3DLE A;  3L4Q A;  1MWK A;  4N76 A;  4GKJ K;  3NH1 A;  1WSH A;  1EKE A;  4DKW A;  4K41 A;  1S1V A;  4YOV A;  5KPZ A;  5BRF A;  2G8V A;  2D0A A;  3L8B A;  1TK8 A;  1HKB A;  2VQF K;  1X3M A;  2VWK A;  4AHC A;  4DV5 K;  4JS5 A;  5J2N A;  2O4I A;  2NRH A;  1XHZ A;  3J7Y P;  1V4T A;  1KLN A;  4BGA A;  1JCE A;  1JLQ A;  4B9V A;  3HOS A;  4JKA A;  3KLF A;  2Z1J A;  5BR8 K;  3ZT4 A;  4KFB A;  3UE5 A;  1ZXO A;  1XI1 A;  2ZWH A;  5JMV A;  1H1V A;  1BU6 O;  4B8A B;  3HZ6 A;  1N6Q A;  2ZQB A;  5KI6 A;  4E7H A;  3DRS A;  1FKP A;  3K59 A;  5EU7 A;  3KD5 E;  4DSF A;  3PSI A;  3SNN A;  3CME N;  3LP1 A;  1VRU A;  2P9I A;  2UYT A;  4DQP A;  5AQY A;  1KSP A;  1UWB A;  2OPR A;  4PL7 A;  2JGU A;  4FWP A;  3J7Z O;  1NK7 A;  2E6L A;  4IJA A;  3D0P A;  1HNX K;  3ZSQ A;  4A2A A;  3OYH A;  3WXK A;  5FRO A;  4CK3 A;  2IGI A;  2QI2 A;  1IO2 A;  1RBR A;  1GLJ O;  4WFB L;  3S3O A;  1GLC G;  2DFF A;  3SLC A;  4OKE A;  3OYK A;  3QIN A;  1UA1 A;  1U47 A;  3SI6 A;  1VQ7 N;  1YTA A;  2I5J A;  1L3V A;  4IO8 A;  1NBW A;  2WTU A;  1HJO A;  4AQY K;  1BQN A;  4IEE A;  5A2Q O;  3QIP A;  1RTJ A;  2HHT A;  4EHT A;  4CD3 A;  3GE1 A;  5AQQ A;  3EKU A;  4CZH A;  3OBW A;  4GV9 A;  2P51 A;  2PZS A;  3TAF A;  3AVC A;  4DMN A;  5AQX A;  5JLH A;  2UUC K;  2OZM A;  3H46 O;  1SKW A;  3VA0 A;  3O08 A;  4IZ9 A;  2E2P A;  3L3V A;  3UB5 A;  1TYQ A;  2P9U A;  1T05 A;  1KLM A;  2JLE A;  3HPO A;  4IOX A;  4KBO A;  4OPH A;  3T69 A;  4RWT A;  4IG3 A;  3IAY A;  2W40 A;  2O8C B;  4IOC L;  3CQX A;  3PLA A;  4DU4 A;  2VGM A;  1KVA A;  1LAV A;  1RFQ A;  3KK2 A;  4DV6 K;  1BIZ A;  3UIQ A;  1FJG K;  3KZB A;  1A5X A;  3NFA A;  5M1K A;  2O8F A;  2LSN A;  3EE8 A;  1TV6 A;  4B1X B;  1KRP A;  1VSM A;  4AHT A;  3SPY A;  3CCS N;  3DXM A;  5HP1 A;  3QBW A;  4XH1 A;  3V6D A;  3SMS A;  3LZI A;  3NGZ A;  2XY5 A;  1QQO A;  2G8H A;  4CZI A;  3OYJ A;  5KRS A;  3LL3 A;  1QQC A;  1U2V A;  5CY4 A;  4JKG B;  2ITG A;  1RIL A;  4DFJ A;  4OX9 K;  1JCG A;  4YOW A;  3VF4 A;  4KB0 A;  5AZI A;  4QAG A;  4H8K A;  4KI4 A;  4HUF A;  1VQN N;  5AQN A;  4KHY A;  3VGL A;  3AO5 A;  4CHY A;  4LF7 K;  5CE3 A;  3L2Q A;  2CGL A;  1T3V A;  1L3U A;  4CJT A;  4FWS A;  1RBV A;  2KW4 A;  4WCE L;  1KFD A;  2VQE K;  1LV5 A;  1DTT A;  3M5R A;  3V1O A;  5BPM A;  2Z1G A;  5AQG A;  4AHS A;  3LDS A;  4NO7 A;  3CPE A;  1JXB A;  3WEE B;  4CEB A;  2P9S B;  4FJL A;  3M1F A;  1S5J A;  1RBS A;  1Q7Y O;  3B6P A;  3OHR A;  3OJS A;  3GBT A;  2OTL N;  3RR7 A;  3CCE N;  4YDU C;  5CR4 A;  4ISE A;  3I33 A;  1NU0 A;  2H3G X;  3W0L A;  3QIC A;  4BGB A;  3ZSZ A;  4H0Y B;  4DR3 K;  4CIF A;  1N32 K;  5I42 A;  4O8U A;  5FPE A;  2IC3 A;  3ULE A;  5C10 A;  1TKX A;  3R6M A;  1UOC A;  1RNH A;  4YOT A;  4FZY A;  4W5R A;  1ZBI A;  1VAZ A;  3JS6 A;  3ZT3 A;  3ZX2 A;  3J7A P;  2O8E A;  4FWO A;  2D4W A;  2G8F A;  3H3O B;  5FLX O;  4DQI A;  2F4V K;  2NLX A;  4YNQ A;  1F21 A;  4EHU A;  3KIO A;  4G9Z A;  3SUN A;  2E2N A;  3JYT A;  1KD1 O;  2XY8 A;  1RDU A;  2BE2 A;  1JJ2 M;  4DS5 A;  3RMD A;  2AP1 A;  3EKS A;  4KTQ A;  3G25 A;  1IJJ A;  4BRI A;  3QFU A;  1T03 A;  4Z4F A;  1O13 A;  4Z4C A;  3QB0 A;  2XRI A;  1DLO A;  1LAW A;  4RW8 A;  2BTF A;  3HVR A;  3GDQ A;  1SL2 A;  5C15 A;  3ENH A;  4DTP A;  3AA3 A;  1YAG A;  4DTU A;  3O80 A;  1BIU A;  4K25 A;  2O4G A;  3NBP A;  3A5L C;  3DLH A;  4DR2 K;  1QZ5 A;  1S6Q A;  3OJU A;  3C7N A;  3LP0 A;  4NB4 A;  3J81 O;  2P9N A;  3OA9 A;  4J2E A;  4WQ4 C;  3Q7B A;  3T3F A;  5HLF A;  3EZ5 A;  4Z4I A;  4IFY A;  4FOI A;  3AGR A;  4FK2 A;  3MCA B;  5JLF A;  2NRT A;  4FM2 A;  5CYQ A;  4RW9 A;  3U3G A;  3VEY A;  1QTM A;  3ZET A;  2QEX N;  4NYF A;  2HHS A;  2X6S A;  4NLB A;  1VSJ A;  2Y1I A;  1WAJ A;  4O44 A;  4B9Q A;  2OCE A;  4F2R A;  5KTQ A;  1VSL A;  4BRL A;  5FPM A;  1C1C A;  3RRG A;  3TAP A;  1VQ5 N;  1P90 A;  3LZJ A;  4JKE A;  5F1X A;  3MCP A;  4W5N A;  4JI2 K;  5F0X A;  2WC9 A;  3S3M A;  3FE1 A;  3DLR A;  1EO1 A;  4CED A;  3U8X A;  2GX9 A;  4H0V B;  1T7P A;  4OKJ A;  4DSI A;  4C23 A;  5HBM A;  1S22 A;  4GVE A;  3THY A;  3VQA A;  4FWR A;  4CGH A;  1QS4 A;  1S6P A;  2RE2 A;  4DTN A;  2F96 A;  1SZ2 A;  3RWU A;  3OYC A;  4DTJ A;  4IFE A;  4B9N A;  4JI1 K;  1JKH A;  2GEL A;  2HNY A;  4K43 A;  3EEQ A;  2QWO A;  3MN7 A;  4JI3 K;  2P5O A;  5DM7 L;  4CK2 A;  3C95 A;  2E20 A;  4H5W A;  2D1K A;  3A5N C;  1E4G T;  3S3N A;  2ZF5 O;  5EX5 A;  1WNS A;  4U7B A;  1ATS A;  4QS8 A;  4BE0 A;  3L2R A;  3QEI A;  4YOR A;  4O5F A;  4FWQ A;  5AQR A;  1YJ9 N;  3DI6 A;  4KTW A;  1VSD A;  1YT3 A;  4DLG A;  3AVJ A;  1RT2 A;  4AH9 A;  3B8A X;  5EY4 A;  4CZL A;  4FLU A;  3O3H A;  1OH6 A;  3SJH A;  3CCU N;  2VYP A;  4Y1D A;  3LWM A;  1DGK N;  3OYA A;  1WSE A;  2CGK A;  4V19 S;  5ELZ A;  1WSI A;  3PX4 A;  4BG8 A;  3FZK A;  3RVC A;  1LCU A;  4BR9 A;  3WXM B;  4FVM A;  5KGX A;  4DV2 K;  3L6Q A;  4LD0 A;  4Y1C A;  2PYJ A;  3GG4 A;  3IG1 A;  1ILY A;  2X74 A;  4B1W B;  1QHT A;  3U3Y A;  4JD2 B;  1QZ6 A;  3O9U A;  4KHW A;  4DUY K;  2NRZ A;  4GW6 A;  4BRM A;  4NXN K;  2A42 A;  3EE9 A;  2W41 A;  5GIP A;  1KAZ A;  4KAZ A;  1FKO A;  3OBY A;  1ZYQ A;  3HK2 A;  2YHX A;  3BP8 A;  1ASV A;  2Q36 A;  4DR7 K;  1HYS A;  3OYN A;  4EZ6 A;  4Y0W A;  2HVI A;  1BQM A;  4O8K A;  2DFH A;  2HHV A;  5GAH P;  3OS2 A;  3U9D A;  3E01 A;  4XH5 A;  4Z0U A;  3RMA A;  3T1A A;  4B9M A;  1TL3 A;  2VCP A;  5AQK A;  3KKR A;  1HX1 A;  1TUU A;  3VQE A;  1NGC A;  3M6G A;  3PO4 A;  3L2V A;  4AHU A;  2WFB A;  4I9Q A;  3I0S A;  4JI0 K;  1N5Y A;  1W97 L;  4DG1 A;  3NHG A;  3CJB A;  3TAR A;  4PKH A;  4E1M A;  3C6U A;  5JS1 A;  3MK6 A;  4N5S A;  4Z94 A;  2KKZ A;  3M8S A;  1RDA A;  2A41 A;  1TYQ B;  4MLH A;  1WAF A;  3TSQ A;  3ZSR A;  3BDP A;  1W0H A;  3N4Q A;  1JL2 A;  4IG0 A;  1O1W A;  1SL1 A;  4C8K A;  1J5O A;  3KD1 E;  4HUG A;  1LW0 A;  3VQB A;  4OGE A;  5GIO A;  1GLB G;  5MLC Q;  1HNV A;  3IFR A;  4ELT A;  4B08 A;  1QSY A;  4LH4 A;  3T1H K;  1K6Y A;  4NCG A;  1D4X A;  3ZX3 A;  2QWL A;  5C2D A;  3H1Q A;  3DRR A;  4GV3 A;  4BE2 A;  3CMA N;  3QO9 A;  1BL3 A;  4MDB A;  1BI4 A;  3QES A;  3LP2 A;  4FOE A;  3D2F A;  4CJS A;  4WQ5 A;  4UY8 O;  1D9F A;  1A5W A;  3DAW A;  3ZYY X;  3SQ0 A;  1J9A A;  3CJA A;  4DSJ A;  3P4I A;  3ULD A;  2GEM A;  4MFB A;  1TAQ A;  2QW9 A;  4M3T A;  3G0Z A;  3U9Z A;  3OYE A;  4RW7 A;  3R9P A;  2FSJ A;  4UQG A;  4CFA A;  3WNG A;  1KTQ A;  4WYB A;  4FJX A;  5GAE P;  3OY9 A;  1U49 A;  4BDP A;  5AZI B;  4FZX C;  1JLG A;  2Z1I A;  4CJK A;  5GAD P;  3MEC A;  5DK5 A;  3PUF A;  3V4I A;  3CXC M;  3L2W A;  3O5B A;  4R5P A;  3AV9 A;  3P83 D;  1VSK A;  1JL1 A;  2QA4 N;  4E7K A;  2P9K B;  4FJJ A;  5AQM A;  5FPD A;  1EWR A;  3CD6 N;  1NK9 A;  1KCF A;  3LAN A;  2BGG A;  4AHV A;  3CFP A;  2Z1H A;  4YFU A;  3T7Z A;  4E7L A;  5AQI A;  4CZF A;  3A8Y A;  3CJ7 A;  3IUC A;  4J2D A;  2FBX A;  3SUO A;  3UKR A;  3K0S A;  3HPG A;  5J2M A;  3AA4 A;  3OW2 M;  2E5L K;  2PYL A;  5E26 A;  3VQP A;  4FLX A;  3E9O A;  5FRM A;  1NKE A;  3SQ1 A;  1XC3 A;  4ICL A;  4CBW A;  2VGN A;  2XHB A;  4LSL A;  3RR8 A;  3TWH A;  4Z4E A;  2ASO A;  4FWN A;  2I7P A;  3R3L A;  1VSF A;  2YV0 X;  3GL1 A;  2WBN A;  1V4S A;  5M1N A;  1HQE A;  1Y64 A;  2IVP A;  2HW3 A;  4DQ8 A;  4LC9 B;  3VQQ A;  2AA4 A;  2ZJR L;  2CH6 A;  4BE1 A;  5FDL A;  5ADX H;  1U6Z A;  1YIJ N;  4FSV A;  2F9T A;  3SYZ A;  3VEZ A;  4A5A A;  5LJW A;  3DLG A;  4NXM K;  1SUQ A;  1HKG A;  3A5M C;  3ULE B;  3PX6 A;  4DFK A;  3CJ1 A;  3IRX A;  4FPB A;  3WNF A;  4LFA K;  3VF2 A;  3VQ8 A;  2NRR A;  4FJI A;  1OH7 A;  4BRA A;  2A1S A;  2GTD A;  1S1T A;  4OPK A;  3U6F A;  1BO5 O;  4I2P A;  2V7Y A;  3Q7C A;  3NDK A;  4A59 A;  2HBL A;  1HNZ K;  4EFH A;  1G99 A;  4M3Y A;  2FSN A;  1Q9X A;  1CLQ A;  4XH4 A;  1RTD A;  4KRE A;  2W6L A;  2A6A A;  2PY5 A;  3CJ9 A;  3CHW A;  1M1K O;  3WXI A;  3OYL A;  1R59 O;  1CXQ A;  2WUS A;  2GWK A;  5AQU A;  1EWQ A;  4RW4 A;  2ZGZ A;  4WFA L;  1NLV A;  4CGG A;  1RDW X;  1XMQ K;  2G8W A;  4CEF A;  5J2P A;  3S41 A;  2KHO A;  4ISG A;  4CHQ A;  3L2U A;  1N34 K;  1TK0 A;  3CCJ N;  1TL1 A;  3H08 A;  4BRG A;  2NRX A;  3O6W A;  1VK0 A;  3RSE B;  5CHI A;  3LDQ A;  4A62 A;  3K2P A;  1LWF A;  3H1V X;  3IDH A;  3LWL A;  2QXL A;  1X9W A;  1BOT O;  3RMC A;  4FJ7 A;  4ZTJ A;  4LF9 K;  1W9H A;  2HHQ A;  1C1B A;  2KTQ A;  4YOU A;  2FF6 A;  1NGG A;  4AF1 A;  4CJE A;  2Q2R A;  4DTO A;  3SPZ A;  1NOY A;  1C0U A;  4DTR A;  3TAB A;  1RBU A;  1WLJ A;  4CW7 B;  2A3Z A;  1Z26 A;  5SZT A;  3O4N A;  5HRP A;  1T44 A;  4KH6 A;  1U4B A;  3TI0 A;  3DM2 A;  2G8U A;  3CJC A;  5AFU H;  5JIC A;  4R79 A;  3VMF B;  4QCL A;  3TTF A;  1MWM A;  1XNR K;  3OYG A;  3VQ5 A;  3ZSX A;  1SQK A;  2XY7 A;  2VG6 A;  1VSH A;  5BPL A;  4B8C A;  2HNZ A;  1MA9 B;  3LDP A;  3MXM A;  3NVK A;  2YJE A;  4DQR A;  3HP6 A;  1OVQ A;  3NH2 A;  1BUP A;  2UXC K;  4IFV A;  3HXM A;  1TGO A;  3EZW A;  3QEX A;  3THX B;  3TAM A;  1X9M A;  3K5M A;  1S9G A;  3QDK A;  4GMJ B;  5AQF A;  1DTQ A;  3FLC O;  1Z05 A;  4M42 A;  4KHN A;  1WSF A;  3TAG A;  3D2E B;  2KFZ A;  5AQZ A;  4BRQ A;  2P9L A;  3ENB A;  1B92 A;  4FJM A;  4E1J A;  4AM6 A;  3AO4 A;  4FZZ A;  1NJY A;  1KAX A;  3SZ2 A;  1YJN N;  1EQY A;  4M7X A;  4CJP A;  5HRS A;  1IG9 A;  4F3O A;  4LF4 K;  3SAF A;  2O8D A;  4K42 A;  3P38 A;  1NG9 A;  1VQ8 N;  3JXU A;  3M8P A;  3ZSY A;  4GVM A;  4BR0 A;  5GAG P;  2P1J A;  1SV5 A;  4B3M K;  1IKW A;  3H6E A;  4CE9 A;  4FK0 A;  2DPN A;  1YJW N;  4CIE A;  3LPU A;  5LL6 Z;  4MLE A;  1VQO N;  4CF9 A;  5HRN A;  3AO3 A;  3UKU A;  3ZSV A;  2HMI A;  4ID5 A;  1DKG D;  4CVN E;  4FLT A;  2Q3S A;  4J2B A;  3RMB A;  5I3U A;  5EOY A;  2FXU A;  1KXP A;  3H3N O;  1NGF A;  5AQW A;  5BN9 A;  2WOM A;  3KLI A;  3G10 A;  3AVN A;  4AIL C;  3I0R A;  1XWL A;  2YX6 A;  3VEO A;  4BDZ A;  4B9U A;  2CGJ A;  3FFK B;  5AQP A;  5DMR A;  4BAC A;  1SS6 A;  1IH7 A;  1D9D A;  3DJC A;  1VQL N;  4BC2 A;  1D5A A;  1C0F A;  1UA0 A;  2IVN A;  1Z6R A;  1S9E A;  2OA8 A;  1HJR A;  1KAY A;  3VEN A;  2FBT A;  3BGR A;  3QML A;  4JKH A;  3SQ2 A;  3MED A;  2KQ2 A;  3BEX A;  2QXF A;  5EVZ A;  2RN2 A;  2E88 A;  3VQD A;  3HOT A;  1LWC A;  4WQ5 C;  4DR1 K;  1OH5 A;  2PFU A;  2IDO A;  5TKW A;  3CCR N;  4Q0B A;  2B6A A;  4C1N K;  4CJ4 A;  4DSK A;  3THW B;  1RT5 A;  4O0J A;  1GLD G;  4CEA A;  2RPI A;  4BY9 C;  1XQS C;  3A0I X;  2BDP A;  4OGC A;  4Z4G A;  1JXE A;  3VN5 A;  1HNI A;  1ITG A;  1ZBF A;  3KLE A;  1HLU A;  4BQL A;  3QBX A;  1ZBU A;  4N41 A;  4FJN A;  3ZEU B;  4M3X A;  1E4F T;  1YI2 N;  2HF4 A;  1YXQ A;  1S1W A;  1ZBS A;  4FJG A;  2ASP A;  3O1B A;  3FZM A;  5KGW A;  4PKI A;  3G4S N;  3SBG A;  3QNO A;  3FZH A;  3NH0 A;  5AQL A;  1VSE A;  3CET A;  4YOY A;  2HBJ A;  2YI1 A;  1IKV A;  5AZJ B;  4E7I A;  2RF2 A;  1RBT A;  5HL7 L;  3A2F A;  1BI4 B;  1QHA A;  4I6M A;  4FWM A;  4H03 B;  1DEJ A;  4JS4 A;  1HQU A;  3L0Q A;  2ETJ A;  4CJQ A;  3DLL L;  4J2A A;  3VET A;  4E3S A;  2P9P B;  1HYZ A;  4JKF A;  3TTC A;  1B9F A;  3HTV A;  4H5T A;  3BUZ B;  3NAE A;  2G8I A;  3MWP A;  4C8M A;  2O8C A;  1W7A A;  4N47 A;  1BCM A;  4FLY A;  4CZJ A;  2HHX A;  4CEZ A;  1ZC6 A;  4PWD A;  2OPP A;  1VSI A;  4HWI A;  4YY3 K;  3I56 N;  2GWJ A;  1RT3 A;  1XMO K;  4GY2 B;  1QVG M;  4JHD B;  4CD1 A;  1NK4 A;  3PSF A;  4EP4 A;  1Z25 A;  3AA2 A;  4FW1 A;  4B1V A;  4H4M A;  4WF9 L;  4CCH A;  4TSX A;  4F9O A;  4YOX A;  3F9K A;  3FZL A;  2V51 B;  4EAH D;  2DFE A;  3WUH A;  4HTU A;  3G6E N;  3KK7 A;  1ATR A;  1S1U A;  2OTJ N;  3JAM O;  1IBL K;  2YHW A;  3ALY A;  4HVJ A;  3LP3 A;  4CHN A;  4X64 K;  4FXD A;  3SV4 A;  2UUA K;  4DB3 A;  4E89 A;  4B9S A;  2HOE A;  4JKG A;  3E66 A;  1GOC A;  4JKC A;  2ZD1 A;  4DTM A;  3SV3 A;  3QEW A;  4FLW A;  1HKC A;  4M3R A;  3NGY A;  2ZJQ L;  4B1Y B;  3CG7 A;  3CC4 N;  1I94 K;  2OZS A;  3MEG A;  1HNW K;  4CGJ A;  2Q31 A;  2HHW A;  1QQN A;  1NGE A;  3LAM A;  4U67 L;  3C6H A;  4CJW A;  2HBK A;  1BDG A;  3MMV A;  3WT0 A;  5CZ1 A;  3BZC A;  3ZSW A;  5JVG L;  5D3G A;  4EP5 A;  2VG7 A;  5LMU K;  3OYF A;  2KFN A;  3LDO A;  4H0T B;  3F73 A;  2OYQ A;  5BRH A;  1NKB A;  4H0X B;  4A2B A;  4IDK A;  1I3A A;  2IAJ A;  3VEV A;  2UXB K;  3CIP A;  4CEC A;  4JI7 K;  4O5B A;  3WEE A;  2P9I B;  3ZLJ A;  1B9D A;  2P9S A;  3L4I A;  2QK9 A;  2HVH A;  2GUI A;  1CZ9 A;  1HUX A;  3MXJ A;  3QLH A;  4FO0 A;  3AA5 X;  3P39 A;  2CH5 A;  5M1Q A;  4DS4 A;  1NM1 A;  4EZ9 A;  1U04 A;  3NF9 A;  3AVK A;  1R0A A;  1N33 K;  4OLA A;  3ISN C;  4K0K K;  3ID6 A;  3HO1 A; 
#chains in the Genus database with same CATH homology
 1LWE A;  5J2M A;  3HPG A;  3AA4 A;  5HP1 A;  3V9U A;  4PUO A;  2PYL A;  1HYV A;  3VQP A;  4FLX A;  5FRM A;  2P5G A;  1NKE A;  3SQ1 A;  4ICL A;  4G1Q A;  3V6D A;  3MEE A;  1WN7 A;  3V9X A;  2XHB A;  3QEV A;  3LZI A;  3NGZ A;  2XY5 A;  1S1X A;  4K8X A;  4F3T A;  3PO5 A;  4LSL A;  3RR8 A;  4K8Z A;  3TWH A;  2G8H A;  1JLE A;  3OYJ A;  4E0D A;  4Z4E A;  1XHX A;  5KRS A;  2E4L A;  1VSF A;  2YV0 X;  1EX4 A;  1QQC A;  4CGF A;  1HQE A;  3T19 A;  5CY4 A;  2HW3 A;  2ITG A;  3TAN A;  1RIL A;  3VQQ A;  1NK0 A;  4DFJ A;  1C0M A;  5C25 A;  4BE1 A;  3K58 A;  5FDL A;  4CJL A;  2YHA A;  1RDD A;  4JRP A;  3QNN A;  4M3Z A;  4KKO A;  3AVF A;  4CJR A;  3SYZ A;  4CEO A;  4KB0 A;  4O4G A;  3DLG A;  4E1N A;  4QAG A;  4H8K A;  3MXI A;  4KI4 A;  1SUQ A;  3DOL A;  4FJ8 A;  4HUF A;  3PX6 A;  1WSG A;  4CJU A;  4KHY A;  1TKZ A;  3AO2 A;  3ITH A;  3IRX A;  4DFK A;  1SKR A;  3WNF A;  1A5V A;  3AO5 A;  4CFD A;  4CHY A;  4FJK A;  4LSN A;  5CYM A;  3VQ8 A;  4FJI A;  3CFO A;  1VRT A;  2A1S A;  4I2Q A;  4ZHR A;  3L2Q A;  3RTV A;  1S1T A;  3NE6 A;  4CJT A;  1L3U A;  4N56 A;  4OPK A;  4CEE A;  3U6F A;  4I2P A;  1RBV A;  2KW4 A;  1KFD A;  5C42 A;  1LV5 A;  4LY7 A;  3NDK A;  4PY5 A;  1DTT A;  3V1O A;  3DRP A;  4HCC A;  1JLA A;  1REV A;  2Z1G A;  4M3Y A;  1Q9X A;  1CLQ A;  2B4J A;  4AHS A;  3LDS A;  1SL0 A;  1RTD A;  4DSL A;  5FRN A;  4O0I A;  4KRE A;  1JXB A;  2PY5 A;  3HP9 A;  4CEB A;  4FJL A;  3OYL A;  2DY4 A;  1S5J A;  3HJF A;  1CXQ A;  4W5O A;  1RDC A;  3DOK A;  3V1Q A;  3ZT0 A;  1RBS A;  2A1R A;  3B6P A;  3OJS A;  4RW4 A;  2IOC A;  3RR7 A;  4CGG A;  2G8W A;  2YKN A;  4CEF A;  5J2P A;  3AVG A;  4JLH A;  4NCB A;  2F8T A;  3CM5 A;  4DU3 A;  2D0B A;  1ZBL A;  3DMJ A;  4ELV A;  3ZSZ A;  3MAQ A;  1FK9 A;  1YTU A;  4JRQ A;  4CHO A;  4CHQ A;  4CIF A;  3L2U A;  1TK0 A;  4KI6 A;  4KRF A;  1KVC A;  4M3W A;  3DLK A;  5I42 A;  1TL1 A;  3H08 A;  1HRH A;  3K57 A;  3ZT1 A;  2IC3 A;  1TKX A;  1VK0 A;  4CJ3 A;  1UOC A;  4DQS A;  3V9S A;  1RNH A;  5SWM A;  1SKS A;  4FZY A;  4W5R A;  1ZBI A;  3CM6 A;  3S9H A;  4FJH A;  4CJ5 A;  4HCB A;  3K2P A;  3ZT3 A;  3QIO A;  3HO1 A;  1LWF A;  2D5R A;  4FW2 A;  4IBN A;  1X1P A;  3NF6 A;  3LWL A;  1X9W A;  2G8F A;  3RMC A;  4DQI A;  4ZTJ A;  4FJ7 A;  1W9H A;  1RDB A;  1F21 A;  1C1B A;  3KIO A;  4YNQ A;  4FLV A;  4DF4 A;  3SUN A;  2KTQ A;  3JYT A;  4CJE A;  4DTO A;  2XY8 A;  4CJF A;  3SPZ A;  1NOY A;  2BE2 A;  5E41 A;  4DS5 A;  1C0U A;  5HRR A;  5K14 A;  4E7J A;  4DTR A;  2YNI A;  1RBU A;  1WLJ A;  3TAB A;  3RMD A;  1QSL A;  2BAN A;  1Z26 A;  4DTS A;  5SZT A;  3L3U A;  4KTQ A;  1ASW A;  4DFM A;  2QKK A;  1NKC A;  3SUP A;  3O4N A;  3P5J A;  2GV9 A;  2X78 A;  5HRP A;  2HND A;  2KZM A;  4DFP A;  1BCO A;  1T03 A;  2FC0 A;  2B5J A;  1TVR A;  3AO1 A;  1U4B A;  4Z4F A;  4Z4C A;  3TI0 A;  3DM2 A;  2G8U A;  3KKS A;  2XRI A;  1DLO A;  1LAW A;  4RW8 A;  3HVR A;  3M8Q A;  3AVL A;  2EHG A;  4QCL A;  3LPT A;  3ZSO A;  1SL2 A;  3C6T A;  4M45 A;  3OYG A;  2YNH A;  4KO0 A;  1T8E A;  3VQ5 A;  3VQ6 A;  3EYZ A;  2EX3 A;  4DTP A;  3ZSX A;  3AA3 A;  4FYD A;  3AVB A;  3LAK A;  2XY7 A;  2YNG A;  2ZE2 A;  2VG6 A;  4DTU A;  3AVI A;  1BIU A;  1VSH A;  4OVL A;  3B6O A;  3K5N A;  4B8C A;  2HNZ A;  2O4G A;  4OJR A;  3NBP A;  4MQ3 A;  3DLH A;  4B9L A;  2QKB A;  3MXM A;  2KZZ A;  4J2D A;  3OJU A;  1S6Q A;  4HHT A;  3QET A;  3LP0 A;  4CHP A;  4DQR A;  4KTZ A;  1TK5 A;  2VG5 A;  1TKD A;  3HP6 A;  4J2E A;  1TAU A;  4ELU A;  3FFI A;  4M41 A;  2OPQ A;  3JSM A;  5KRT A;  3T3F A;  3NH2 A;  5HLF A;  4IFV A;  3HXM A;  1RT7 A;  3EZ5 A;  4Z4I A;  1TGO A;  2ATQ A;  4IFY A;  4WE1 A;  1QSS A;  4LH5 A;  3QEX A;  4FK2 A;  4AHR A;  3KK3 A;  4FM2 A;  1JLC A;  3KTQ A;  3TAM A;  4F2S A;  1X9M A;  5CYQ A;  4RW9 A;  3U3G A;  1QTM A;  3K5M A;  1S9G A;  2X6N A;  2RKI A;  4GMJ B;  5JS2 A;  4NYF A;  1DTQ A;  1NJW A;  3SQ4 A;  2HHS A;  4M42 A;  2X6S A;  4KHN A;  1WSF A;  1VSJ A;  3TAG A;  4XIU A;  2FBV A;  2Y1J A;  2KFZ A;  2Y1I A;  2DTU A;  1WAJ A;  1LW2 A;  1JLF A;  4O44 A;  1B92 A;  4FJM A;  1BGX T;  4F2R A;  3AO4 A;  4FZZ A;  3VQ4 A;  5KTQ A;  4DLE A;  1NJY A;  1VSL A;  4KB1 A;  1C1C A;  3SZ2 A;  2HHU A;  3RRG A;  1C1A A;  3V9Z A;  1NK8 A;  3CQ8 A;  4CJP A;  5HRS A;  3TAP A;  1IG9 A;  4F3O A;  4CFB A;  3LZJ A;  4H4O A;  3OVN A;  4DF8 A;  4AHT A;  3QEP A;  4W5N A;  3M8P A;  3ZSY A;  4GVM A;  3S3M A;  2P1J A;  2FBY A;  3LAL A;  3DLR A;  1SV5 A;  4KPY A;  4BWJ A;  4CED A;  1CZB A;  2E6M A;  3O3F A;  1IKW A;  2XO7 A;  1ASU A;  3O3G A;  3C94 A;  4OKJ A;  1T7P A;  3KLH A;  4DSI A;  3V1R A;  2AJQ A;  1IKX A;  5HBM A;  4CE9 A;  4FK0 A;  4FJ9 A;  4CIE A;  3LPU A;  3VQA A;  4DTX A;  4CGH A;  1C6V A;  1QS4 A;  1S6P A;  4CJV A;  4CF9 A;  4I7F A;  5HRN A;  4OPJ A;  2F8S A;  3AO3 A;  1XC9 A;  4DTN A;  3ZSV A;  2HMI A;  3K5L A;  4I9L A;  3SCX A;  2F96 A;  4ID5 A;  1GOB A;  4L8R B;  4J2B A;  1FXX A;  2Q3S A;  4FLT A;  3HST B;  3RMB A;  4CF2 A;  5I3U A;  3RWU A;  3OYC A;  4DTJ A;  4NYN A;  4B9N A;  5T7B A;  4FJ5 A;  4OLB A;  1I39 A;  1JKH A;  1D8Y A;  2HNY A;  1WSJ A;  2W42 A;  1J53 A;  1X9S A;  4W5Q A;  4CFC A;  2P5O A;  1HPZ A;  2WOM A;  4CF8 A;  4CK2 A;  3C95 A;  3KLI A;  3OYB A;  3G10 A;  3AVN A;  1C0T A;  4AIL C;  1EP4 A;  1XWL A;  1EET A;  3I0R A;  1L3S A;  3S3N A;  4BDZ A;  4B9U A;  5DMR A;  4BAC A;  1WNS A;  3OS1 A;  4PQU A;  2YNF A;  1IH7 A;  1D9D A;  4FM0 A;  1RCH A;  1ZBH A;  3KK1 A;  4BE0 A;  3HT3 A;  3L2R A;  4BDY A;  3HM9 A;  3QEI A;  1NK5 A;  1D5A A;  2HB5 A;  1UA0 A;  4W5T A;  1KFS A;  3DI6 A;  4KTW A;  4KHQ A;  1VSD A;  2KFN A;  1YT3 A;  4DLG A;  2WON A;  1S9E A;  3AVJ A;  2OA8 A;  1HJR A;  1Q8I A;  1RT4 A;  3VQ9 A;  2FBT A;  3BGR A;  2R7Y A;  1RT2 A;  3K5O A;  4AH9 A;  4CIG A;  3SQ2 A;  4NCA A;  3MED A;  2KQ2 A;  4KHS A;  2QXF A;  4FLU A;  3O3H A;  2RN2 A;  4Y1D A;  3VQD A;  3LWM A;  3HL8 A;  3OYA A;  1LWC A;  1WSE A;  3VA3 A;  3SUQ A;  4CEQ A;  4CES A;  4E19 A;  3SJJ A;  1NJX A;  1WSI A;  2IDO A;  3PX4 A;  4Q0B A;  3VQ7 A;  2B6A A;  1BIS A;  4C8N A;  4HUE A;  4CJ4 A;  4CGI A;  4DSK A;  4CHZ A;  4FLZ A;  1RT5 A;  4O0J A;  4KV8 A;  3D45 A;  4CER A;  4CEA A;  1TKT A;  4FVM A;  3CFR A;  2RPI A;  2BDP A;  5KGX A;  4QOZ B;  4LD0 A;  4OGC A;  4O55 A;  4Z4G A;  1JXE A;  4Y1C A;  2PYJ A;  3V9W A;  3IG1 A;  4RW6 A;  3VN5 A;  1RT6 A;  3AVM A;  2X74 A;  3AVH A;  5C24 A;  1HNI A;  4CK1 A;  4Q5V A;  2YHB A;  1ITG A;  1QHT A;  1ZBF A;  3KLE A;  3U3Y A;  3I8D A;  1CXU A;  1ZBU A;  4N41 A;  4KHW A;  4FJN A;  4M3X A;  4GW6 A;  2VWJ A;  3NCI A;  1NJZ A;  3QER A;  3P1G A;  1S1W A;  3V81 A;  4FJG A;  3DLE A;  1Y97 A;  4PA1 A;  2OPS A;  2XY6 A;  4N76 A;  3NH1 A;  1WSH A;  1EKE A;  2D0C A;  5KGW A;  4FM1 A;  1S1V A;  1J54 A;  1FKO A;  4KAZ A;  1U48 A;  1ZYQ A;  3HK2 A;  1RTH A;  3QNO A;  3NH0 A;  4F8R A;  3ZCM A;  2IS3 A;  3M8R A;  2G8V A;  1ASV A;  5J1E A;  2D0A A;  1VSE A;  3L8B A;  3HPH A;  1TK8 A;  1HYS A;  3OYN A;  4EZ6 A;  4FCY A;  2HVI A;  2VWK A;  4AHC A;  4JS5 A;  1IKV A;  5J2N A;  1BQM A;  2DFH A;  4E7I A;  2O4I A;  1XHZ A;  2HHV A;  2RF2 A;  3OS2 A;  1KLN A;  3E01 A;  3RMA A;  4Z0U A;  1L3T A;  3T1A A;  1G15 A;  4B9M A;  1JLQ A;  4B9V A;  1TL3 A;  1RBT A;  3KLF A;  2Z1J A;  1BI4 B;  3A2F A;  3KKR A;  3TAQ A;  3CYM A;  3ZT4 A;  4KFB A;  3VQE A;  4JS4 A;  1HQU A;  4CJQ A;  2ETJ A;  1XI1 A;  4J2A A;  3PO4 A;  1YVU A;  3AVA A;  4E3S A;  1NOZ A;  4B8A B;  3L2V A;  1N6Q A;  4AHU A;  1HYZ A;  4I9Q A;  3I0S A;  1B9F A;  3PY8 A;  3NAE A;  1N5Y A;  2NUB A;  2ZQB A;  2G8I A;  4DG1 A;  3NHG A;  5KI6 A;  4E7H A;  3DRS A;  1UAX A;  3O4Q A;  4C8M A;  3KLG A;  1FKP A;  3TAR A;  4C8L A;  3K59 A;  5EU7 A;  4N47 A;  1BCM A;  3C6U A;  4E1M A;  3NGI A;  4FLY A;  3WNH A;  2G8K A;  3DLB A;  4DQQ A;  2HHX A;  3KD5 E;  5JS1 A;  3OYM A;  4DSF A;  4CEZ A;  4N5S A;  3SNN A;  3WNE A;  4PWD A;  2OPP A;  3M8S A;  3LP1 A;  1BHL A;  1RDA A;  1VRU A;  3THV A;  1VSI A;  4CF0 A;  3ZSR A;  1WAF A;  3PV8 A;  4DQP A;  3BDP A;  1KSP A;  1UWB A;  1JLB A;  1W0H A;  1RT3 A;  2OPR A;  4DWI A;  2JGU A;  4M3U A;  4Z4H A;  2GBZ A;  5J2Q A;  4ID1 A;  3OYD A;  3NF7 A;  1QE1 A;  1NK7 A;  1JL2 A;  1NK4 A;  2E6L A;  1GOA A;  1O1W A;  4IG0 A;  4DSE A;  3D0P A;  1SL1 A;  4C8K A;  1J5O A;  4EP4 A;  4IKF A;  3ZSQ A;  1Z25 A;  3EY1 A;  3OYH A;  3AA2 A;  4FW1 A;  4HUG A;  3KD1 E;  4H4M A;  1LW0 A;  3VQB A;  4CCH A;  4OGE A;  4TSX A;  5FRO A;  4B9T A;  1NK6 A;  4CK3 A;  2IGI A;  3F9K A;  4KHU A;  1HNV A;  2DFE A;  1IO2 A;  1RBR A;  4ELT A;  4HTU A;  3S3O A;  1HMV A;  2DFF A;  4B08 A;  3TAE A;  1QSY A;  4LH4 A;  1IKY A;  4OKE A;  1S1U A;  3OYK A;  3QIN A;  1UA1 A;  1U47 A;  1K6Y A;  4NCG A;  3ALY A;  3SI6 A;  4HVJ A;  1YTA A;  3LP3 A;  4CHN A;  4FXD A;  2I5J A;  3DRR A;  3SV4 A;  3PX0 A;  1L3V A;  4BE2 A;  3QO9 A;  1BL3 A;  4DU1 A;  1BI4 A;  3QES A;  4E89 A;  3OYI A;  4B9S A;  3LP2 A;  1BQN A;  3ASM A;  1KVB A;  3QIP A;  1RTJ A;  1GOC A;  4CJS A;  2HHT A;  4DTM A;  2ZD1 A;  1L5U A;  3SV3 A;  3QEW A;  1D9F A;  4FLW A;  1A5W A;  4M3R A;  3NGY A;  4CF1 A;  3CG7 A;  3RRH A;  5HRO A;  3SQ0 A;  3TR8 A;  1J9A A;  4DSJ A;  4B3O A;  2OZS A;  2P51 A;  3MEG A;  2PZS A;  3TAF A;  3AVC A;  4DMN A;  3ULD A;  4MFB A;  1TAQ A;  4CGJ A;  2OZM A;  2HHW A;  3LAM A;  1SKW A;  3VA0 A;  1Q9Y A;  3OS0 A;  4M3T A;  3G0Z A;  4CJW A;  3OYE A;  4F4K A;  4RW7 A;  5CZ1 A;  3ZSW A;  4UQG A;  4CFA A;  3HVT A;  3WNG A;  5D3G A;  1KTQ A;  3KJV A;  3L3V A;  4FJX A;  4EP5 A;  3OY9 A;  1MU2 A;  1EXQ A;  1U49 A;  4BDP A;  2VG7 A;  4CGD A;  1T05 A;  3ZT2 A;  1KLM A;  4FZX C;  1JLG A;  2JLE A;  3OYF A;  2Z1I A;  4CJK A;  3HPO A;  3MEC A;  4ZTF A;  3IS9 A;  4RG8 A;  4IG3 A;  3IAY A;  5DK5 A;  3PUF A;  3V4I A;  3DYA A;  3HYF A;  3F73 A;  3L2W A;  4OKK A;  1RT1 A;  4R5P A;  1NKB A;  2OYQ A;  3AV9 A;  4DU4 A;  2HHQ A;  4IDK A;  1I3A A;  1KVA A;  2IAJ A;  1VSK A;  1JL1 A;  3P83 D;  4E7K A;  1LAV A;  4CEC A;  3KK2 A;  2YKM A;  4O5B A;  4BWM A;  1BIZ A;  3UIQ A;  4FJJ A;  3NF8 A;  1B9D A;  4C8O A;  1NK9 A;  1A5X A;  2QK9 A;  3NFA A;  1KCF A;  1RTI A;  2HVH A;  4FK4 A;  2GUI A;  3LAN A;  1CZ9 A;  2BGG A;  3MXJ A;  3QLH A;  3AA5 X;  1U45 A;  4AHV A;  3CFP A;  2LSN A;  2Z1H A;  4YFU A;  4E7L A;  4DS4 A;  5CZ2 A;  4EZ9 A;  1TV6 A;  1U04 A;  3NF9 A;  3AVK A;  1R0A A;  4OLA A;  1KRP A;  1VSM A;  3ISN C;  3VQC A;  3SPY A;  2FBX A;  3SUO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...