2YV0X

Structural and thermodynamic analyses of e. coli ribonuclease hi variant with quintuple thermostabilizing mutations
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
155
structure length
155
Chain Sequence
MLKQVEIFTDGSCLGNPGPGGYAAILRYRGREKTFSAGYTRTTNNRMELMAAIVALEALKEPCEVILSTDSQYLRQGITQWIHNWKKRGWKTADGKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERCHELARAAAMNPTLEDTGYQVEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease HI
publication title Structural and thermodynamic analyses of Escherichia coli RNase HI variant with quintuple thermostabilizing mutations.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 49
structure length 155
sequence length 155
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2007-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2yv0X00
2FBXA 1ZYQA 4KPYA 1LWFA 2FBYA 3ZSYA 1L3TA 3SJJA 3C6UA 4J2BA 3TAMA 3DLKA 4FJ7A 3QEXA 1JLBA 2X74A 3DOLA 1C0MA 1HPZA 4OLBA 3I0RA 4Z4CA 3AA4A 3S3NA 4EZ9A 3V1RA 3NGIA 5D3GA 1WLJA 3L8BA 1O1WA 4NYNA 4BWJA 2OA8A 3LP1A 4CJEA 3AO2A 4W5RA 1WAFA 4DSLA 2FC0A 2DFFA 2RF2A 2HHUA 1RILA 1TL1A 3AA5X 4M3XA 3S3OA 1RBVA 2DTUA 3LPUA 4JRPA 1B9DA 1DLOA 3KLGA 1LAWA 3CFRA 4CK1A 4M3TA 2GUIA 2FBVA 4Q0BA 4FM0A 5K14A 1IKVA 4HCBA 1Q8IA 1KLMA 2YHBA 4IFYA 3DYAA 1G15A 2D0AA 4CIFA 4N56A 4W5QA 4IKFA 4DQSA 1WNSA 3VQCA 4FK2A 1J53A 4KI4A 3IG1A 2G8FA 4LY7A 3TAEA 1VSHA 3V6DA 4BDPA 1JLCA 3ZSXA 2KTQA 1VSJA 3UIQA 4DU3A 3OJUA 2HW3A 1LV5A 3NF6A 5CZ2A 3L2RA 1X1PA 4CJUA 4B9VA 4CCHA 3ZSQA 4PY5A 3KKSA 3L2QA 4FJ5A 4CFAA 2EHGA 3LP3A 4KO0A 3D45A 1S9GA 3FFIA 3K2PA 1DTTA 4O0JA 3EZ5A 3NE6A 4FLTA 4BE0A 1S1WA 1JXEA 5HRRA 3ZT1A 1RTJA 3SUQA 1C6VA 3SQ0A 2VWKA 3MEGA 3V9UA 3CM5A 3AV9A 1BQMA 1MU2A 3L2UA 3NGYA 1TK0A 1N5YA 4DTOA 1RT7A 3AVGA 4HUGA 3OS1A 5FDLA 1NK6A 4CFCA 1UA1A 3NH0A 1TKTA 4OKEA 1VSEA 2W42A 3L2VA 4DQIA 5C24A 3AVMA 3VQ6A 5KRTA 1U47A 1UAXA 4I2PA 4KI6A 2HHVA 3O3FA 4K8ZA 4KAZA 1RNHA 3OYNA 1QSLA 3BDPA 2OPQA 1JLGA 2XO7A 4L8RB 4CFBA 1YTUA 3DLEA 4FCYA 4N41A 1WSEA 4MFBA 1VSKA 3WNFA 3MXMA 4M3YA 4QCLA 1EP4A 2D5RA 2HHQA 2B5JA 1C1BA 3O4QA 3DLRA 4FZYA 3EYZA 2Y1IA 3TARA 4ELVA 3CFOA 4LH5A 1SKSA 1RCHA 3OVNA 1I3AA 4EP4A 2KW4A 3O3GA 2E4LA 3KIOA 4DMNA 4OKJA 3MAQA 4DF8A 4FZXC 2F8TA 1BGXT 4CF9A 1LWEA 4NYFA 3AVIA 1J54A 3NGZA 3EY1A 1U4BA 1NKEA 4H4MA 1GOAA 4RG8A 1HNVA 3LP2A 5HRPA 5T7BA 1NK7A 3VA3A 4FJGA 1RBUA 4KHYA 5DMRA 1S6PA 3HM9A 2OZMA 4F3OA 3ZCMA 4Z4GA 1TKXA 3RMCA 2O4IA 4C8NA 2ZE2A 2QK9A 1C0UA 3HVTA 4CERA 3O4NA 3V1OA 1YTAA 4CECA 3T3FA 4HTUA 5I42A 1A5WA 1GOCA 2IS3A 3T19A 3VA0A 1S5JA 3V9WA 4AHRA 4CJLA 1Z26A 3K59A 4WE1A 4DTUA 4AILC 3AVLA 3P1GA 2HMIA 2P5OA 4FJNA 4KRFA 3OY9A 4CEZA 3OYEA 5J1EA 1TK8A 4CGHA 4C8OA 3ZT4A 4J2EA 3SQ1A 1BHLA 4PA1A 1LW2A 4FW1A 3AVAA 4AHSA 3ZSRA 3F73A 2IOCA 4FYDA 3NH2A 3M8RA 3RRGA 3DRRA 3LANA 4QOZB 2PY5A 2X78A 3OYHA 4M3RA 3QLHA 1ZBFA 3HP6A 2R7YA 4BDZA 4DSIA 3C95A 4NCAA 4KHQA 1U49A 1VSMA 3V81A 4KREA 3H08A 4DU1A 3F9KA 3RMBA 2HB5A 2G8KA 1KTQA 2HHSA 4ID1A 1Y97A 1NJXA 4NCBA 2BE2A 4KTWA 5EU7A 2E6LA 4JS4A 3SQ4A 4FJMA 1S6QA 4CJWA 3AO5A 3K5MA 3VQPA 4DG1A 4FVMA 1KCFA 3V1QA 1U48A 1W9HA 3T1AA 1CZBA 1HYZA 4OLAA 1A5VA 3TABA 2I5JA 4DLGA 4QAGA 4H8KA 3HP9A 3I8DA 1UWBA 3BGRA 4CEDA 3HT3A 1XI1A 1CZ9A 4Y1DA 3DLBA 5KGXA 4F2RA 4CHQA 3OJSA 4CK3A 1T7PA 1X9SA 1XHXA 4DQRA 1NK8A 2YV0X 4E19A 3V9ZA 4FLYA 3NHGA 4F3TA 5FRNA 5I3UA 1RDCA 3A2FA 4KFBA 4FM2A 2HVHA 2VG5A 4E0DA 2G8IA 2Z1JA 4KKOA 3QNNA 3HK2A 4CGJA 1DTQA 4RW4A 4O0IA 1RBTA 3AO4A 3CM6A 3OYKA 2F8SA 1LWCA 1JLEA 3KLIA 3NFAA 4CE9A 4LD0A 4CFDA 3K5NA 4DFPA 1C0TA 1NKBA 4E1NA 2Y1JA 5J2QA 1D5AA 4YNQA 3LP0A 3OYMA 1SL2A 1KFDA 3ZT0A 4F8RA 3OYAA 4DTNA 1SL1A 4PWDA 3V4IA 2KQ2A 1CXQA 1K6YA 2Z1HA 3NCIA 4M45A 3JYTA 2AJQA 1TL3A 2GV9A 4E7JA 4DQQA 3IAYA 2RN2A 3ITHA 1HQUA 2IAJA 3SV3A 3SNNA 4B9NA 4CEEA 3LWLA 3NF7A 1ZBHA 5KRSA 5HROA 3V9SA 3RRHA 3OYJA 1QTMA 4BE1A 4DF4A 2G8VA 1UA0A 1ZBLA 4B8CA 2PZSA 3HVRA 3TAFA 3PX6A 3M8PA 4N47A 2G8UA 2PYLA 4E7KA 3NF8A 3SCXA 3QETA 4CJ5A 2XY7A 2YHAA 2IC3A 3VQ8A 4DSKA 2KFZA 3HJFA 1L3SA 3V9XA 1XC9A 1J5OA 4FW2A 4NCGA 4O44A 3AVHA 3RR7A 4KHNA 3CG7A 1YVUA 5KGWA 4CF8A 1RDBA 1SV5A 2KZZA 3LZJA 5HRSA 4DTJA 2HVIA 4G1QA 4B8AB 4E1MA 4FZZA 1S1TA 4C8MA 3SI6A 1Q9YA 2YKMA 2JLEA 3VQ4A 4H4OA 3L3VA 3VQ7A 2OZSA 1VSFA 1FXXA 4YFUA 1EX4A 1Z25A 3G10A 2QKBA 3ASMA 3QIPA 1TAQA 1QQCA 1NOZA 1RTIA 3LDSA 3KKRA 2Z1IA 2ZQBA 1SKWA 1QSSA 5FROA 4PUOA 2IGIA 3ALYA 4CJ3A 3ZSOA 1BL3A 3NBPA 3NF9A 4DS5A 2P51A 1TVRA 3ZSWA 1KVBA 3ULDA 3SPZA 4E7IA 4O5BA 4XIUA 3QIOA 3AA3A 1RBRA 1RT5A 3CYMA 4DFJA 3OYGA 4OGEA 3TAQA 1IG9A 1R0AA 3MEEA 4C8LA 4O55A 4B3OA 1WSIA 3DOKA 4CJPA 3OYFA 3OYIA 2QKKA 1KSPA 3L2WA 3SV4A 4FXDA 4Z4HA 4Y1CA 1T05A 2PYJA 4HCCA 2OPRA 2D0CA 2ZD1A 3HPHA 4DLEA 1FKOA 2YNFA 3AVBA 4I7FA 4KHUA 2BANA 1JLQA 3KJVA 3QESA 2VWJA 3QNOA 3SYZA 4ELUA 4HVJA 4N76A 1HYSA 3VQDA 4M42A 1XWLA 3VQ5A 2VG7A 4IFVA 3PO4A 4FJ9A 1ZBIA 2QXFA 1HQEA 3DLGA 2XY5A 4DTMA 2E6MA 2ITGA 4AH9A 5HLFA 4KB0A 4DTRA 4FJLA 4BWMA 4I9LA 2ETJA 3HO1A 1RT6A 3DLHA 4E3SA 1SUQA 2B4JA 4RW6A 5CYQA 4DTPA 3S3MA 4CGFA 1TAUA 3KD5E 4KTQA 3HL8A 2WONA 1QSYA 4W5OA 4PQUA 4OPKA 4CHPA 1IKXA 1KVCA 3QEWA 2HHWA 3LAMA 2KFNA 1HMVA 2DFEA 4KV8A 4DWIA 4OPJA 3TANA 2FBTA 4CK2A 3QINA 2Q3SA 1VSIA 4CEOA 3AO1A 3RWUA 3MEDA 3ZT3A 3VQBA 4B9SA 4Z4FA 2HNYA 2JGUA 4FLZA 4ICLA 4J2DA 3G0ZA 3PX4A 4CEQA 4F4KA 2X6NA 3QEIA 3HPGA 4B08A 1HRHA 3M8QA 3D0PA 4EZ6A 3AVCA 3L3UA 4DU4A 3LALA 4JRQA 1B9FA 3HPOA 4HUFA 4CF0A 1XHZA 3WNEA 4M3ZA 4R5PA 2KZMA 3QERA 4W5TA 1YT3A 2O4GA 4KTZA 4BDYA 4FM1A 3AVNA 1LW0A 1JL2A 2YNIA 3VQQA 1Q9XA 4CHYA 4CGGA 4CHOA 1L3UA 3KLHA 4B9TA 1S1UA 1NJYA 2P1JA 3RMAA 3OS2A 4DSEA 3NH1A 1ASUA 2YKNA 4E7HA 4W5NA 4N5SA 4FLXA 3KK2A 1RT4A 1JXBA 2WOMA 5SWMA 4DS4A 1WSFA 3CFPA 1C1CA 1UOCA 3I0SA 3LWMA 1JLFA 5KI6A 4CF2A 1FK9A 1S9EA 1QHTA 4RW8A 2HNDA 2GBZA 1JLAA 1LAVA 2RPIA 3KK1A 1IH7A 3LAKA 4CF1A 4FLUA 1X9WA 1BIUA 4UQGA 1QE1A 1VSLA 3NAEA 4LH4A 1NOYA 3K57A 4AHVA 1HYVA 1RTHA 3SUNA 3E01A 4LSNA 3MXJA 1KVAA 2X6SA 2NUBA 4BE2A 1HNIA 3C6TA 3DMJA 3VQ9A 3OYBA 3C94A 3OYLA 3AVJA 5DK5A 1RBSA 4OGCA 3HXMA 1HJRA 2ATQA 1L5UA 1ASWA 4GMJB 5C25A 3S9HA 4ID5A 1RTDA 1RT3A 3ISNC 1SL0A 1NK9A 3JSMA 4CJKA 1ZBUA 3K58A 1FKPA 1BCMA 4E7LA 3B6PA 3RTVA 4KHWA 2YNHA 1IKYA 4DTXA 1BQNA 1D8YA 4FJJA 4K8XA 4IDKA 1U04A 3PX0A 1VRTA 1WAJA 4CEAA 3LZIA 3ZSZA 3THVA 3HSTB 1NK4A 4M3UA 3AVKA 1ASVA 4TSXA 3TI0A 4FJHA 4CJFA 4LSLA 1NK5A 4B9LA 3DRSA 1C1AA 4OVLA 1VSDA 1W0HA 2DY4A 3SUPA 3WNGA 3NDKA 2B6AA 2DFHA 3HYFA 4CJTA 3QEVA 3TAGA 4FLVA 1WN7A 2XY8A 4CJQA 3ZSVA 3O3HA 4AHCA 2LSNA 4M41A 4FJIA 3KLEA 1VK0A 4RW7A 1TK5A 3VN5A 4E89A 4AHTA 2G8WA 1BCOA 1VRUA 4FLWA 3OYCA 2XY6A 4CESA 1KFSA 1KLNA 4DFKA 4IG0A 4RW9A 4B9UA 4J2AA 1BISA 3IRXA 3MXIA 1TKDA 3KD1E 4GW6A 3SQ2A 4CIEA 4O4GA 1CLQA 4JLHA 4CJ4A 4DTSA 4DSFA 2YNGA 3B6OA 3TAPA 4Z4EA 2OPSA 5J2NA 4GVMA 1ITGA 1CXUA 4OKKA 3IS9A 3P83D 3WNHA 3AA2A 3U3GA 3KK3A 2RKIA 2OYQA 5CYMA 3RR8A 3QO9A 1WSHA 4FJXA 3CQ8A 5HP1A 4CIGA 4ZHRA 3ZT2A 5HBMA 1RDAA 4Z0UA 1JL1A 4I2QA 3LPTA 1T8EA 1F21A 4CEFA 3KLFA 1RT1A 4F2SA 1TV6A 3U6FA 1X9MA 4DFMA 2Z1GA 5KTQA 4HUEA 1D9FA 4MQ3A 3OS0A 2HHXA 5SZTA 5J2MA 3PV8A 1A5XA 1NJWA 5FRMA 5JS1A 2F96A 2VG6A 4HHTA 3QEPA 1QS4A 3AO3A 1NJZA 4DSJA 1RDDA 3U3YA 4I9QA 3MECA 4CGDA 2OPPA 1BIZA 1EXQA 1I39A 4BACA 2G8HA 2HHTA 1L3VA 1D9DA 4FK0A 3SPYA 3PO5A 1REVA 3DM2A 1U45A 1RT2A 5CY4A 1TKZA 5J2PA 1BI4A 4FK4A 1IO2A 4CHNA 4Q5VA 4IG3A 5CZ1A 1S1XA 3RMDA 3K5OA 4CJRA 4ZTJA 3KTQA 4AHUA 1BI4B 1EKEA 2D0BA 2IDOA 2HNZA 4CEBA 1B92A 4Z4IA 3TR8A 1JKHA 4ELTA 1TGOA 2BDPA 4FJ8A 3DRPA 4KHSA 1IKWA 3SZ2A 1T03A 1WSGA 1EETA 3P5JA 4CJSA 3SUOA 3VQEA 4EP5A 4JS5A 4B9MA 4FJKA 5HRNA 3M8SA 1SKRA 3AVFA 2A1RA 1WSJA 4ZTFA 3VQAA 3OYDA 2P5GA 2A1SA 3PY8A 4CHZA 2XRIA 1J9AA 4KB1A 3K5LA 4DQPA 1NKCA 2BGGA 4CJVA 3PUFA 2XHBA 1GOBA 5JS2A 5C42A 3TWHA 2EX3A 1KRPA 4M3WA 4IBNA 1N6QA 4OJRA 1S1VA 5E41A 1NK0A 4C8KA 3DI6A 4CGIA
chains in the Genus database with same CATH superfamily
3WQUA 4FJ7A 3CCJN 3NGIA 4B3TK 5C0YA 1WLJA 4BWJA 3AO2A 4BR2A 3HM8A 3QFUA 3ID6A 4AF1A 3S3OA 1RBVA 3CF5L 1LAWA 3CFRA 4LFBK 4CK1A 3O8MA 2FBVA 1Q8IA 1KLMA 1ATNA 2P9IB 2YHBA 5C10A 4W5QA 3HOSA 3SBTA 4DQSA 2YCHA 1J53A 4KI4A 3IG1A 1QQOA 3U9DA 3LDQA 3K0SA 4BDPA 4DU3A 3AY9A 4DV0K 1VQNN 2HW3A 1NM1A 3CQYA 5CR4A 4PY5A 1KAZA 4CZIA 3L2QA 3A5MC 4KO0A 4O0JA 3CCMN 4NXMK 4FWKA 1C6VA 2P9UB 3CM5A 3CETA 3NGYA 4A5BA 4A57A 1RT7A 4LFAK 3FR0A 2IVOA 3QMLA 4OKEA 4CW7B 3O6WA 2EWSA 1KC8O 3AVMA 1HNZK 4H5WA 1QSLA 3WEEB 3OYNA 3BDPA 4CFBA 1IV0A 5M1KA 1VSKA 4QCLA 1RFQA 2D5RA 3PSIA 1C1BA 3THYA 3P4IA 3TARA 4ELVA 3CFOA 4LH5A 3GBTA 1DGKN 3OVNA 2PAVA 4EP4A 2KW4A 1NNEA 1TYQA 3MAQA 3QDKA 1E4FT 4NYFA 5AQWA 2FSNA 1U4BA 4JAXA 2DPNA 4RG8A 1HNVA 3CCEN 5HRPA 1RBUA 1S6PA 4H0TB 3RMCA 3ENHA 3OW2M 3V1OA 1GLJO 1YTAA 4HTUA 3THWA 2IS3A 5AZIA 2YJEA 3AVLA 2QWPA 4KRFA 3OY9A 4WFAL 2VQFK 4PA1A 2A5XA 4AHSA 4FYDA 3O5BA 3LANA 2VWBA 4X62K 3OYHA 3QLHA 4BDZA 1NU0A 5BN8A 4BRLA 1EQYA 2PBDA 3F9KA 3RMBA 1YXQA 5AQZA 2HHSA 5EY4A 4ID1A 5CHIA 3TPQA 4YHHK 3VQPA 3V1QA 1U48A 4NB4A 1BA1A 2I5JA 3AAQA 2E2PA 3RSEA 3I8DA 3HT3A 1CZ9A 4CK3A 1T7PA 5GIPA 1X3NA 4CVNE 5AQFA 3NHGA 4LF5K 3H1VX 5AQPA 4FM2A 3VMFB 4PL8A 4KKOA 3QNNA 1DTQA 1NGJA 4RW4A 2NRVA 4PL7A 1JLEA 4CE9A 3PO5A 4B9NA 4DSIA 5J2QA 3OYMA 4H03B 1X3MA 1KFDA 3HSCA 3OYAA 3V4IA 1OKJA 2WC9A 1K6YA 2AJQA 4M45A 3JYTA 2KKZA 2RN2A 4I6MB 3SV3A 4JI4K 3SNNA 4CEEA 3LWLA 3NF7A 3WQTA 5KRSA 3V9SA 4BVPA 4CZHA 3MN5A 4DF4A 4GY2B 1UA0A 1ZBLA 3PX6A 4FVUA 4N47A 3VF2A 1O13A 4CJ5A 3VQ8A 3QICA 3DLLL 2KFZA 4QS7A 1L3SA 3HJFA 4FW2A 4JV5K 2YHYA 3CG7A 4CF8A 2KZZA 1GLDG 2Q31A 3B8AX 5F2RA 4JKHA 5BPNA 4BC5A 3VQ7A 1FXXA 1TAQA 1NOZA 1QSSA 2GTDA 5FROA 3SBGA 1KQSM 4IJAA 3ALYA 3ZSOA 2GUPA 1OH6A 4DS5A 4RTFD 5AQQA 4GV6A 3AA3A 3D2FA 1R0AA 4O55A 3OYFA 3OYIA 4BY9C 2BUPA 3P38A 4FXDA 4GVEA 4C1NI 3HPHA 3AVBA 4WQ4C 2BANA 1M90O 2BH1A 3Q7CA 2YJFA 4HVJA 4M42A 3VQ5A 3CHWA 4MO5A 2W41A 3PO4A 4FJ9A 3HTVA 4PKGA 4DHYA 5BPLA 4JHDB 5JICA 5HLFA 3MWPA 1JCGA 1BA0A 1VQ5N 5CYQA 3HL8A 3GDQA 4BRQA 5GAHP 2F9WA 4JK7A 3QEWA 2KFNA 3VOVA 4GV3A 2O8BB 2Q3SA 4CEOA 4B9SA 4B3RK 3VQBA 4J2DA 2X6NA 2WUSA 1MWMA 4B08A 1NGCA 3L3UA 4EIAA 4DU4A 4HUFA 3FLCO 4FM1A 4BRAA 2YNIA 1QHAA 4JKBA 1L3UA 1NJYA 3RMAA 4OPHA 1ZBSA 1XNQK 4N5SA 5SWMA 3P39A 3E9LA 1WSFA 1W7AA 1JLFA 1I94K 1S9EA 2GBZA 3CJCA 3KK1A 1IH7A 1NBWA 4CF1A 4PKHA 1VSLA 3VTIA 3NAEA 1NOYA 3SUNA 4LSNA 2X6SA 1NGHA 3BUZB 3DMJA 3E9PA 3VQ9A 3C94A 2HBJA 3HXMA 5FPEA 1HJOA 4FL9A 3S9HA 3U8XA 4BGAA 2CH6A 1BCMA 2YNHA 4DTXA 3SK3A 3IKMA 1WAJA 4FPAA 4DV6K 4M3UA 3AVKA 1ASVA 2VGNA 2AA4A 4OVLA 5AQKA 2YX6A 4BRMA 4JKCA 3WNGA 3TAGA 4CJTA 1T3VA 1WN7A 3ZSVA 4FJIA 1VK0A 4FWOA 3JAMO 5KQ8A 2G8WA 3SAGA 4IO8A 4FLWA 1C0FA 3SMSA 4B9UA 3KD1E 4GW6A 4X66K 1HNWK 2O8DB 4DSFA 4Z4EA 2OPSA 5J2NA 1CXUA 3C7NB 3P83D 3WNHA 3VEOA 2OYQA 1WSHA 2RHKA 5HP1A 4ZHRA 1HNXK 4CEFA 5C15A 2GX9A 1TV6A 1X9MA 3CQXA 1NG9A 3THYB 3CC2N 3KZBA 3T69A 2VG6A 4DR2K 4HHTA 3QEPA 4LC9B 1NJZA 3CC7N 4AM7A 3NMUA 3KVGA 2UU9K 3M6GA 4BACA 1L3VA 1D9DA 1REVA 1U45A 1QVFM 3VEWA 3EEQA 4Q5VA 3CPWM 1U2VA 2YHXA 4ZTJA 3TR8A 4CZMA 4H5VA 4KHSA 5JMVA 3IMXA 4RWTA 4YOWA 4AQYK 1ESVA 5BN9A 4Z94A 3EE9A 3EN9A 1WSJA 4IFEA 2XRIA 3CMAN 3K5LA 1XMQK 4BQLA 2XHBA 2EX3A 4FOEA 5GAEP 1N6QA 4OJRA 1S1VA 5E41A 1Z6RA 3HOTA 2F4VK 5CE3A 4WFBL 4CGIA 3C6HA 4KPYA 1LWFA 2ITMA 3BY5A 3DOLA 1C0MA 4OLBA 5LY3A 3I0RA 4BC4A 5LMNK 3S3NA 3V1RA 5D3GA 4NYNA 1T6CA 3D2EB 3CCSN 2OA8A 2FC0A 3QFPA 4M3XA 4JI6K 3CJ7A 1HLUA 4JRPA 5K14A 4CZLA 3O1BA 4HCBA 4BQZA 4IFYA 1G15A 4N56A 2D4WA 2GELA 2ZGZA 4IKFA 4F9OA 3MMVA 2G8FA 3TAEA 4WQ4A 1VSHA 3ZSXA 2KTQA 3UIQA 4DR5K 3OJUA 3IFRA 5AZJB 3N4PA 4B9VA 2P9SB 2P9LA 1DTTA 2ZM6K 3EZ5A 4FLTA 2P9KA 1R59O 3J7ZO 1JXEA 5HRRA 2A3ZA 4RCHA 1RTJA 1Q81O 3SQ0A 2VWKA 3AV9A 1BQMA 1MU2A 3L2UA 4DTOA 3AVGA 5M1OA 4HUGA 1NK6A 1UA1A 3NH0A 1TKTA 5AQTA 2W42A 3S41A 4DQIA 3H6EA 3VQ6A 1U47A 4KI6A 1HKGA 1RNHA 1OH5A 4NXNK 3ATVA 1YTUA 3ZX3A 4MFBA 1EO1A 3WNFA 1EP4A 2W40A 3EYZA 1SKSA 5FPDA 1BG3A 4OKJA 3THXB 1LOTB 3EKUA 3R3LA 1LWEA 5GIOA 1NKEA 1GOAA 2JWLA 3LP2A 3ZEUB 5T7BA 1NK7A 3D2FB 3IUCA 3Q7BA 3H1QA 1E3MA 4UY8O 5AJ3K 4U67L 4C8NA 1YF5L 4DV2K 1C0UA 4CECA 3O4NA 5JVHL 3VA0A 4CJLA 2OTLN 3K59A 2V51B 2P5OA 3P1GA 4FSVA 3L0QA 3MDQA 1YHQN 3VGLA 3M5RA 1V4SA 3JXUA 4FW1A 2QW9A 3F73A 2GWJA 3M8RA 2UXCK 4M3RA 3CJAA 3HP6A 1VQ7N 3C95A 4DQ8A 2QWRA 1U49A 2G8KA 4M7XA 1EWRA 2NRHA 3R9PA 1NJXA 4DUZK 5EU7A 2E6LA 4BREA 4FWNA 3K5MA 1KCFA 3T1YK 1CZBA 2QWNA 3UKRB 1A5VA 4OLAA 3TSQA 4QAGA 4F2RA 3AARA 3BGRA 5M1QA 1EWQA 4Y1DA 3T1HK 1X9SA 4DQRA 3NVMA 3V9ZA 3ULEB 4JD2A 3C6AA 4YOYA 3OTOK 3I33A 1K8KA 3FFKB 2VG5A 4E0DA 2G8IA 3HK2A 1J6ZA 3A5OC 2NRXA 4O0IA 3AO4A 2F8SA 3NFAA 3K5NA 1C0TA 5JLHA 1SL2A 2WBNA 4DTNA 4PWDA 5E84A 3NCIA 2W6KA 2D0OA 1BOTO 3CI5A 4DV7K 3RRHA 1IJJA 3OYJA 2CH5A 2P9PB 2Q0UA 4B8CA 3TAFA 1N36K 3C65A 4LF8K 2G8UA 3SCXA 1U6ZA 1MWKA 3V9XA 3L4IA 1J5OA 4O44A 4CD3A 3GE1A 4KHNA 1YVUA 1RDBA 1NGGA 1GLFO 4O8KA 5AQMA 5HRSA 4DTJA 2HVIA 2E2QA 4FZZA 1S1TA 1VQON 2YKMA 4GKJK 3VQ4A 4H4OA 4B1ZA 1EX4A 1BU6O 4ISGA 2Z1IA 4OO1J 3W0LA 1XC3A 1YIJN 3NBPA 3NF9A 5EXWA 3ULDA 3FZHA 4E7IA 1RBRA 1RT5A 4C8LA 3TAQA 1IG9A 4B3OA 3DOKA 1NGBA 3DXKB 4XH1A 5I9EB 1QQMA 3I55N 2PYJA 2OPRA 2ZD1A 5DM7L 4KHUA 1XNRK 4FWRA 3R1XA 3J81O 4XEIA 2VWJA 4ELUA 3BF3A 4R79A 2FSJA 4EHUA 4FWQA 2OTJN 2XY5A 2BTFA 3ZX2A 2E6MA 2ITGA 4CJ7A 2NRWA 2O8FA 4I9LA 3HO1A 2QWQA 1RT6A 1SUQA 2B4JA 3ZETB 1TAUA 4KTQA 1QSYA 4PQUA 2QTDA 5JVGL 3ZLJA 2HHWA 5C2DA 1HMVA 1ZXOA 5AQLA 3TANA 3GOIA 3QINA 1VSIA 3RWUA 4JKAA 2JGUA 2H3GX 4ICLA 3PX4A 4O8UA 4ISFA 3QEIA 3CMEN 3ENBA 1HRHA 1RDUA 3LALA 1B9FA 4M3ZA 4R5PA 2KZMA 1YT3A 2O4GA 4NLBA 4BDYA 1TUYA 4HWIA 1LW0A 3CIPA 1Q9XA 3SLCA 2P9NB 4ILHA 4B9TA 2P1JA 2O8EB 1M1KO 2YKNA 4KBOA 4FLXA 1RT4A 1JXBA 2WOMA 4A5AA 3CFPA 4JI1K 1UOCA 2VQEK 4CF2A 1QHTA 4RW8A 2HNDA 4XH5A 1JLAA 4BROA 3LAKA 4FLUA 1QE1A 3MN6A 4YOTA 4LH4A 2E1ZA 1HYVA 3E01A 2NUBA 1HNIA 3U9ZA 2VGMA 4G9ZA 3VEXA 3AVJA 5DK5A 3UKUB 4ID5A 3ISNC 1SL0A 1FKPA 1SQKA 1QVGM 3PX0A 3QBXA 5ADXA 3LZIA 3ZSZA 3HSTB 4TSXA 4CJFA 4LSLA 4B9LA 4DCHA 1C1AA 3DXMA 2UUCK 2OCEA 1W0HA 2HBKA 5LMUK 3SUPA 2DFHA 3HYFA 1H1VA 1XMOK 1G99A 4M41A 3KLEA 2I7NA 3ENOA 3T7ZA 4CZEA 3CJ9A 2GWKA 1VRUA 3CJ1A 2A40A 3OYCA 4CESA 3AAPA 3O9TA 5M1PA 4O4GA 1CLQA 4CJ4A 2F7TA 5C12A 4ILGB 4GVMA 4OKKA 2QM1A 5HOOA 2J4RA 2RKIA 5CYMA 3RR8A 3QO9A 1DEJA 2QWMA 4CIGA 2O8CA 2IVPA 2WFBA 1JL1A 4K25A 3KLFA 5KPZA 4DFMA 2Z1GA 4JKGB 3OBYA 1DKGD 4MQ3A 1S22A 4BR7A 4CBUA 1W97L 3AO3A 4ISEA 1QQNA 1Q7YO 1RDDA 3U3YA 1MDUB 5BR9A 1I39A 1VHXA 2HHTA 3VF6A 1RT2A 5AR0A 5J2PA 4BRFA 4ILJA 5CZ1A 1S1XA 3TTCA 4BR5A 3WXKA 4CJRA 3KTQA 1BI4B 3SJHA 1JKHA 4ELTA 1TGOA 4FJ8A 3SZ2A 1WSGA 1EETA 3P5JA 4EP5A 4FJKA 3EE8A 2V7ZA 3EZWA 4ZTFA 2P5GA 3PUFA 3OA9A 1GOBA 1YI2N 1KRPA 4IWVA 2UYTA 3L4QA 4K43A 1NK0A 3DI6A 2PY5A 2RE2A 2OANA 2FBYA 5ELZA 3ZSYA 4J2BA 3TAMA 3DLKA 1NGEA 1HPZA 3AA4A 3VPZA 1C0GA 3VTHA 1FW6A 4B1YB 3SAHA 1ILYA 3L8BA 1O1WA 3LP1A 4DSLA 2HHUA 2RF2A 4BRIA 1TL1A 1NWKA 4MO4A 1BWFO 2P9IA 2DTUA 1IBMK 3KLGA 1YITN 3VEVA 4Q0BA 4FM0A 2D0AA 4CIFA 3MX2A 4BR9A 4LF4K 4FK2A 4EFHA 2VYPA 4LY7A 3V6DA 1VSJA 1N33K 3LDLA 1LV5A 1X1PA 3WXIA 3ZSQA 4C1NK 4FJ5A 3FE1A 2EHGA 2HOEA 2E5LK 3D45A 3FFIA 2I7PA 3BEXA 4H5NA 2P9UA 2V7YA 3I56N 5TKYA 3ZYYX 4U7BA 3BP8A 1VQ8N 3V9UA 4FWLA 1TK0A 1N5YA 5FDLA 3LDPA 1KAYA 4DR1K 5AQVA 2UUBK 1XUPO 3WEEA 3L2VA 4CBWA 3C0BA 2HHVA 4K8ZA 1FJGK 4KAZA 4X65K 2OPQA 1JLGA 4H0XB 2XO7A 3VGKA 3DLEA 4N41A 1WSEA 4M3YA 3MXMA 4JEPA 4QS9A 3O4QA 4IEEA 3PIPL 2E4LA 4FZXC 2F8TA 2QI2A 5FPNA 1YJWN 3F5TA 1TYQB 1J54A 3AVIA 3NGZA 4H4MA 4H0PA 3A5LC 3MK6A 5DMRA 1ATRA 1OVQA 3HM9A 3E9OA 2ZE2A 5EOYA 2QK9A 3HVTA 4CERA 4A2AA 5I42A 3T19A 1NK8A 1X9JA 4KH5A 4AILC 3CERA 4AHRA 2VCPA 2HMIA 4WE1A 4CEZA 3CCRN 3THWB 4IEIA 5AZIB 5J1EA 4CGHA 4JYAK 3PIOL 3VENA 3ZT4A 4J2EA 3SQ1A 4LF6K 3AVAA 4CZJA 3NH2A 3RRGA 4JI5K 4QOZB 5GADP 4YDUC 1Z05A 2R7YA 3KK7A 4NCAA 1RGIA 1K9MO 3H08A 4GNIA 4WCEL 3CCQN 2BE2A 4KTWA 4QS8A 1S6QA 1HKCA 4CJWA 3T1AA 3KHYA 1HYZA 4DLGA 4H8KA 3HP9A 1UWBA 4CEDA 3WXMB 4H0OA 1P90A 1WBDA 2YV0X 3RSEB 4WQ5C 4IO9L 4MLEA 2KHOA 4F3TA 3WXJA 5FRNA 5I3UA 3A2FA 1KAXA 4KFBA 4BG8A 4JI8K 5TKWA 1RBTA 3OYKA 4DFPA 1NGFA 3KLIA 1NKBA 4LD0A 4E1NA 2Y1JA 4F8RA 3ZT0A 1YVNA 4CD1A 1SL1A 1S72N 2KQ2A 1CXQA 4I6MA 3CD6N 1TL3A 2GV9A 4DQQA 2FXUA 1J5EK 4B3MK 3GG4A 1HQUA 2IAJA 3PLAA 4BRHA 2A41A 5AFUA 5HROA 4WFNL 1QTMA 2G8VA 4IOCL 3HVRA 4CZKA 4DSKA 2HF4A 1XC9A 3RR7A 4JI7K 3I8BA 5KGWA 1WBBA 4G1QA 3SAFA 4Y0WA 4JNEA 2ASPA 1Q9YA 5AQHA 3D6RA 4YFUA 3ASMA 3QIPA 1QQCA 1RTIA 1SKWA 2ZQBA 5EVZA 4CJ3A 5LJWA 1OH7A 1TVRA 3ZSWA 1NGAA 4O5BA 3QIOA 3CYMA 1BUPA 4OGEA 3G4SN 1WSIA 2NRRA 2D0PA 3SV4A 4BR4A 4Y1CA 1S3XA 4DLEA 2F9TA 4B1VA 3TU5A 5FLXO 1NMNA 2A42A 3J8AA 3MX5A 5M1FA 4JHDA 2VG7A 4H0YB 4IFVA 1NGIA 3HZ6A 4DTMA 2ASMA 4AH9A 2ETJA 3VEZA 5AQGA 4E3SA 2V52B 4DTPA 3DWLA 1T44A 3L6QA 2WONA 3CJBA 2O8BA 1V4TA 4DV4K 4CHPA 4DR3K 3LAMA 4MDAA 1N34K 4OPJA 2FBTA 5ADXH 3MEDA 3ZT3A 3HBTA 2NRTA 3JS6A 3O80A 4JKDA 4CEQA 4JK9A 4F4KA 4KHPK 3HPGA 2FF6A 3M8QA 3D0PA 4BG9A 3ZX0A 4CF0A 1XHZA 3WNEA 4W5TA 4K0KK 3GL1A 3AVNA 3H3NO 3K9KA 3O1WA 3VQQA 4BRCA 4CGGA 4CHOA 3KLHA 5C2FA 4JKFA 3OS2A 4DSEA 4C23A 3NH1A 1ASUA 5KPRA 4E7HA 4W5NA 2WTUA 4OX9K 3I0SA 1D4XA 4WF9L 3LWMA 1SAZA 2QWLA 3HI0A 1FK9A 2HBLA 1LAVA 2RPIA 2YI1A 3NVKA 1BIUA 4UQGA 1N8RO 4BC2A 4CI6A 3K57A 4AHVA 1KVAA 3C6TA 3OYLA 1RBSA 4OGCA 4JK8A 2ATQA 1ASWA 4GMJB 3TTFA 1HUXA 5C25A 1RT3A 3KWIA 1NK9A 1JCFA 1SZ2A 3JSMA 4CJKA 1ZBUA 3K58A 1YJNN 2PFUA 4KHWA 4IOAL 3DLBA 4A62A 1NK4A 4CEAA 2HMPA 3TI0A 3AGKA 1VSDA 4EAHD 4FLVA 4AHCA 4CBXA 3F9MA 4YDUA 4AHTA 1BCOA 2XY6A 2O8DA 4FWMA 1KLNA 4J2AA 1BISA 3MXIA 2CGLA 3C7NA 3SQ2A 4KH4A 2HSTA 2E1YA 4DTSA 4JKEA 4K41A 4EHTA 1ITGA 3AA2A 3U3GA 3KK3A 3M3ZA 4FJXA 3CQ8A 3UB5A 3OHRA 3ZT2A 1RDAA 4Z0UA 4I2QA 3LPTA 3E1YA 4B1WB 4WQ5A 1W2BM 1P8ZA 5KTQA 4DV1K 4HUEA 1IBKK 1VQ4N 5SZTA 5J2MA 3PV8A 1NJWA 5JS1A 5IT9O 1ATSA 2Q1NA 3G71N 3CCUN 4JN4A 1QS4A 3LDOA 4FPBA 5BREA 4DSJA 1BIZA 1VQPN 2G8HA 3O9UA 4B3SK 1GLLO 3SPYA 3DM2A 4GKKK 3CCVN 2ZF5O 5AQUA 1TKZA 4IG3A 3RMDA 3WT0A 4AHUA 2IDOA 1EKEA 2D0BA 2HNZA 1B92A 3MN9A 1U2VB 1IBLK 3HRGA 3DRPA 2ASOA 4MDBA 3SUOA 3VQEA 4B9MA 3CCLN 1SKRA 3OYDA 3PY8A 2BGGA 4DR6K 1J9AA 4CJVA 3CPEA 3TWHA 5JS2A 5C42A 4B1XB 1YAGA 4C8KA 3ID8A 4BR0A 5BRFA 2FBXA 1ZYQA 3E66A 1L3TA 4OPAA 3C6UA 3SJJA 4IXCA 1GLBG 3QEXA 1JLBA 2X74A 3G25A 3D2EA 4Z4CA 5A2QO 2NLXA 3U4LA 4CJEA 4W5RA 1WAFA 2DFFA 1RILA 1XQSC 3AA5X 3R6MA 3LPUA 1B9DA 1DLOA 4M3TA 2GUIA 1IKVA 3A8YA 3DYAA 1Q18A 4LF7K 2E2NA 3SMPA 1WNSA 3VQCA 2ZJRL 3UE5A 5AZJA 5AQSA 5AQXA 1JLCA 2P9SA 5AQOA 4B9QA 4BGBA 3NF6A 5CZ2A 3L2RA 1VQKN 4CJUA 4CCHA 3KKSA 4CFAA 3LP3A 3NE6A 3K2PA 1S9GA 2QA4N 4BE0A 2NZTA 1S1WA 2P9LB 3ZT1A 3RVCA 3SUQA 2P9KB 3MEGA 4BRKA 3LM9A 3IDHA 3A0IX 3TTDA 1HPMA 3OS1A 4CFCA 1Y64A 4FWSA 1VSEA 5AQJA 3H45C 5C24A 4M63C 5KRTA 1UAXA 4I2PA 3O3FA 1Q86O 1KD1O 4L8RB 1GLAG 1SS6A 3M1FA 4FCYA 1GLCG 3LM2A 1E4GT 1VQ6N 2HHQA 2B5JA 3DLRA 4FZYA 3THXA 2Y1IA 5LL6Z 1RCHA 3AGRA 1I3AA 1IG8A 3WXLA 3O3GA 2E2OA 3KIOA 4DMNA 4DF8A 4A2BA 1BGXT 5AQRA 4CF9A 4V19S 3J80O 3ZEUA 3EY1A 2UXDK 2QXLA 2CGKA 3VEYA 3VA3A 4FJGA 4H5RA 1OVYA 4KHYA 3TSPA 4F3OA 2OZMA 2O4IA 3ZCMA 4Z4GA 1TKXA 4YOVA 4BRNA 4KH6A 4YOUA 4IOXA 3T3FA 1A5WA 1GOCA 4KB1A 3V9WA 4DTUA 1S5JA 4EZ9A 1Z26A 4FJNA 3EO3A 3EL2A 3OYEA 1TK8A 4YY3K 4C8OA 3BF1A 4A59A 1BHLA 2FLOA 1LW2A 5GAGP 3ZSRA 2IOCA 5AFUH 3F2KA 3DRRA 3A5NC 2X78A 5FPMA 1ZBFA 4DV3K 4DUYK 4KHQA 4KREA 1VSMA 3V81A 2FF3B 4DU1A 4H0VB 2HB5A 4LFCK 4BRGA 1KTQA 3FZKA 1Y97A 3J7AP 4NCBA 4JS4A 3SQ4A 2HBMA 4FJMA 3UKRA 1KXPA 5H1SQ 3AO5A 2FSKA 4DG1A 4FVMA 4GV9A 1W9HA 3MCPA 5AQYA 3TABA 4XH4A 3ULEA 1XI1A 4HTLA 1HX1A 5KGXA 4CHQA 3OJSA 2E20A 1XHXA 4E19A 4FLYA 5BRDA 2AP1A 3MN7A 2HVHA 3O9SA 1RDCA 2Z1JA 4JD2B 4CGJA 3CM6A 3VETA 4BVOA 1QZ5A 1K8KB 1LWCA 4CFDA 1YUWA 4WYBA 1D5AA 4YNQA 3LP0A 1NMDA 5DM6L 2ZWHA 2UXBK 2Z1HA 4E7JA 3IAYA 3VERA 3ITHA 2ZJQL 5AQIA 2P9PA 1ZBHA 2NRZA 4CZGA 1NJIO 4BE1A 5GINA 2PZSA 3M8PA 2HHHK 2PYLA 5IWAK 4E7KA 2UUAK 3NF8A 3QETA 2XY7A 2YHAA 2IC3A 5EX5A 1CZAN 4DKWA 4NCGA 1NGDA 3AVHA 1SV5A 3PSFA 3LZJA 4B8AB 4E1MA 4C8MA 2Q97A 3ATUA 3SI6A 3BZKA 1Q82O 2JLEA 3OBWA 3DJCA 3L3VA 2OZSA 1VSFA 3O08A 2QKBA 1Z25A 3G10A 3LDSA 3KKRA 5KPTA 4PUOA 2IGIA 3TSUA 4A61A 1BL3A 4MLHA 1NLVA 2P51A 1YJ9N 1KVBA 2JWKA 3SPZA 2GEMA 4XIUA 3DXKA 4DFJA 3OYGA 3MEEA 2D1KA 4FO0A 4CJPA 4FOIA 2E8AA 1VQMN 2QKKA 1KSPA 3L2WA 2QWOA 4Z4HA 1T05A 4HCCA 5B8HA 2D0CA 4DR4K 1FKOA 2YNFA 3QBWA 4I7FA 1JLQA 3KJVA 2W6LA 3QESA 3QNOA 1TUUA 4JI0K 3SYZA 4N76A 1HYSA 3VQDA 1XWLA 4B1UB 1GLEG 1ZBIA 2QXFA 1HQEA 3DLGA 4X64K 5LJVA 3MCAB 3O9RA 4KB0A 4DTRA 5M1NA 4FJLA 4BWMA 3ZETA 3W3DA 3DLHA 4NLCA 4RW6A 5KQDA 1VQ9N 3N4QA 3S3MA 2O8FB 4CGFA 2E88A 5E26A 3KD5E 4W5OA 4OPKA 1IKXA 1KVCA 4KV8A 2DFEA 5HL7L 4JI2K 2ZJPL 4IJNA 4DWIA 4JI3K 4CK2A 1WB9A 3AO1A 4DB3A 4Z4FA 2HNYA 4FLZA 1VAZA 3G0ZA 2IVNA 4EZ6A 3EKSA 3AVCA 4JRQA 4PHTX 3HPOA 3WUHA 3QERA 4KTZA 2P9NA 1JL2A 4H5TA 2O8EA 4CHYA 1S1UA 2Q2RA 3KK2A 4DS4A 3G6EN 1C1CA 4L3QA 5KI6A 2KLAA 3CXCM 4LF9K 3VGMA 1X9WA 2IIRA 4NO7A 3FZLA 1RTHA 3MXJA 5MLCQ 3LL3A 3KWGA 3UKUA 4BE2A 3OYBA 1DT9A 1HJRA 1L5UA 1HR0K 1RTDA 2A6AA 4FWPA 4IDHA 4E7LA 3FZMA 3B6PA 3RTVA 4DV5K 4BRDA 1IKYA 1D8YA 1BQNA 4K8XA 4FJJA 4IDKA 1U04A 3THVA 1VRTA 1OH8A 3BZCA 4FJHA 1NK5A 3DRSA 4DR7K 2DY4A 3NDKA 2ZGYA 2B6AA 4PKIA 3QEVA 3DXMB 2XY8A 4CJQA 1BO5O 3K9JA 3O3HA 2LSNA 4J8FA 4RW7A 5F0XA 4IZ9A 1TK5A 1ZC6A 4E1JA 3VN5A 4E89A 1KFSA 5BRHA 4DFKA 4IG0A 4RW9A 2HF3A 3IRXA 1TKDA 4CIEA 4JLHA 5BR8K 2YNGA 3B6OA 3TAPA 1K73O 4YORA 5BPMA 3D7EO 3IS9A 1WOQA 1RDWX 4CZFA 4JKGA 5HBMA 4K42A 1WUAA 4M7YA 3O9QA 1T8EA 1F21A 2NNWA 4F2SA 1RT1A 3MWTA 2O8CB 3U6FA 3J7YP 1D9FA 3OS0A 2HHXA 3FGUA 1A5XA 5FRMA 1K8AO 2F96A 5JLFA 1JJ2M 3VF4A 1LCUA 2Q36A 4BRPA 4BC3A 1N32K 5F1XA 3MECA 4I9QA 4CGDA 2OPPA 1EXQA 3VESA 4FK0A 3R8EA 1VQLN 3LDNA 3H3OB 3P31A 5CY4A 1MA9B 1BI4A 3FZFA 1IO2A 4CHNA 3CC4N 4FK4A 3H46O 3K5OA 3O4WA 4Z4IA 2Q0RA 4CEBA 2YHWA 2CGJA 4AM6A 4O5FA 2BDPA 3QB0A 1IKWA 1T03A 5AQNA 4CJSA 3DAWA 4JS5A 2QEXN 5HRNA 4YOXA 3M8SA 3AVFA 2A1RA 3VQAA 2A1SA 4CHZA 1T6DA 4DQPA 1NKCA 1BDGA 4M3WA 1QZ6A 1JCEA 1HKBA 4IBNA
chains in the Genus database with same CATH topology
2FBXA 1ZYQA 4KPYA 1LWFA 2FBYA 3ZSYA 1L3TA 3SJJA 3C6UA 4J2BA 3TAMA 3DLKA 4FJ7A 3QEXA 1JLBA 2X74A 3DOLA 1C0MA 1HPZA 4OLBA 3I0RA 4Z4CA 3AA4A 3S3NA 4EZ9A 3V1RA 3NGIA 5D3GA 1WLJA 3L8BA 1O1WA 4NYNA 4BWJA 2OA8A 3LP1A 4CJEA 3AO2A 4W5RA 1WAFA 4DSLA 2FC0A 2DFFA 2RF2A 2HHUA 1RILA 1TL1A 3AA5X 4M3XA 3S3OA 1RBVA 2DTUA 3LPUA 4JRPA 1B9DA 1DLOA 3KLGA 1LAWA 3CFRA 4CK1A 4M3TA 2GUIA 2FBVA 4Q0BA 4FM0A 5K14A 1IKVA 4HCBA 1Q8IA 1KLMA 2YHBA 4IFYA 3DYAA 1G15A 2D0AA 4CIFA 4N56A 4W5QA 4IKFA 4DQSA 1WNSA 3VQCA 4FK2A 1J53A 4KI4A 3IG1A 2G8FA 4LY7A 3TAEA 1VSHA 3V6DA 4BDPA 1JLCA 3ZSXA 2KTQA 1VSJA 3UIQA 4DU3A 3OJUA 2HW3A 1LV5A 3NF6A 5CZ2A 3L2RA 1X1PA 4CJUA 4B9VA 4CCHA 3ZSQA 4PY5A 3KKSA 3L2QA 4FJ5A 4CFAA 2EHGA 3LP3A 4KO0A 3D45A 1S9GA 3FFIA 3K2PA 1DTTA 4O0JA 3EZ5A 3NE6A 4FLTA 4BE0A 1S1WA 1JXEA 5HRRA 3ZT1A 1RTJA 3SUQA 1C6VA 3SQ0A 2VWKA 3MEGA 3V9UA 3CM5A 3AV9A 1BQMA 1MU2A 3L2UA 3NGYA 1TK0A 1N5YA 4DTOA 1RT7A 3AVGA 4HUGA 3OS1A 5FDLA 1NK6A 4CFCA 1UA1A 3NH0A 1TKTA 4OKEA 1VSEA 2W42A 3L2VA 4DQIA 5C24A 3AVMA 3VQ6A 5KRTA 1U47A 1UAXA 4I2PA 4KI6A 2HHVA 3O3FA 4K8ZA 4KAZA 1RNHA 3OYNA 1QSLA 3BDPA 2OPQA 1JLGA 2XO7A 4L8RB 4CFBA 1YTUA 3DLEA 4FCYA 4N41A 1WSEA 4MFBA 1VSKA 3WNFA 3MXMA 4M3YA 4QCLA 1EP4A 2D5RA 2HHQA 2B5JA 1C1BA 3O4QA 3DLRA 4FZYA 3EYZA 2Y1IA 3TARA 4ELVA 3CFOA 4LH5A 1SKSA 1RCHA 3OVNA 1I3AA 4EP4A 2KW4A 3O3GA 2E4LA 3KIOA 4DMNA 4OKJA 3MAQA 4DF8A 4FZXC 2F8TA 1BGXT 4CF9A 1LWEA 4NYFA 3AVIA 1J54A 3NGZA 3EY1A 1U4BA 1NKEA 4H4MA 1GOAA 4RG8A 1HNVA 3LP2A 5HRPA 5T7BA 1NK7A 3VA3A 4FJGA 1RBUA 4KHYA 5DMRA 1S6PA 3HM9A 2OZMA 4F3OA 3ZCMA 4Z4GA 1TKXA 3RMCA 2O4IA 4C8NA 2ZE2A 2QK9A 1C0UA 3HVTA 4CERA 3O4NA 3V1OA 1YTAA 4CECA 3T3FA 4HTUA 5I42A 1A5WA 1GOCA 2IS3A 3T19A 3VA0A 1S5JA 3V9WA 4AHRA 4CJLA 1Z26A 3K59A 4WE1A 4DTUA 4AILC 3AVLA 3P1GA 2HMIA 2P5OA 4FJNA 4KRFA 3OY9A 4CEZA 3OYEA 5J1EA 1TK8A 4CGHA 4C8OA 3ZT4A 4J2EA 3SQ1A 1BHLA 4PA1A 1LW2A 4FW1A 3AVAA 4AHSA 3ZSRA 3F73A 2IOCA 4FYDA 3NH2A 3M8RA 3RRGA 3DRRA 3LANA 4QOZB 2PY5A 2X78A 3OYHA 4M3RA 3QLHA 1ZBFA 3HP6A 2R7YA 4BDZA 4DSIA 3C95A 4NCAA 4KHQA 1U49A 1VSMA 3V81A 4KREA 3H08A 4DU1A 3F9KA 3RMBA 2HB5A 2G8KA 1KTQA 2HHSA 4ID1A 1Y97A 1NJXA 4NCBA 2BE2A 4KTWA 5EU7A 2E6LA 4JS4A 3SQ4A 4FJMA 1S6QA 4CJWA 3AO5A 3K5MA 3VQPA 4DG1A 4FVMA 1KCFA 3V1QA 1U48A 1W9HA 3T1AA 1CZBA 1HYZA 4OLAA 1A5VA 3TABA 2I5JA 4DLGA 4QAGA 4H8KA 3HP9A 3I8DA 1UWBA 3BGRA 4CEDA 3HT3A 1XI1A 1CZ9A 4Y1DA 3DLBA 5KGXA 4F2RA 4CHQA 3OJSA 4CK3A 1T7PA 1X9SA 1XHXA 4DQRA 1NK8A 2YV0X 4E19A 3V9ZA 4FLYA 3NHGA 4F3TA 5FRNA 5I3UA 1RDCA 3A2FA 4KFBA 4FM2A 2HVHA 2VG5A 4E0DA 2G8IA 2Z1JA 4KKOA 3QNNA 3HK2A 4CGJA 1DTQA 4RW4A 4O0IA 1RBTA 3AO4A 3CM6A 3OYKA 2F8SA 1LWCA 1JLEA 3KLIA 3NFAA 4CE9A 4LD0A 4CFDA 3K5NA 4DFPA 1C0TA 1NKBA 4E1NA 2Y1JA 5J2QA 1D5AA 4YNQA 3LP0A 3OYMA 1SL2A 1KFDA 3ZT0A 4F8RA 3OYAA 4DTNA 1SL1A 4PWDA 3V4IA 2KQ2A 1CXQA 1K6YA 2Z1HA 3NCIA 4M45A 3JYTA 2AJQA 1TL3A 2GV9A 4E7JA 4DQQA 3IAYA 2RN2A 3ITHA 1HQUA 2IAJA 3SV3A 3SNNA 4B9NA 4CEEA 3LWLA 3NF7A 1ZBHA 5KRSA 5HROA 3V9SA 3RRHA 3OYJA 1QTMA 4BE1A 4DF4A 2G8VA 1UA0A 1ZBLA 4B8CA 2PZSA 3HVRA 3TAFA 3PX6A 3M8PA 4N47A 2G8UA 2PYLA 4E7KA 3NF8A 3SCXA 3QETA 4CJ5A 2XY7A 2YHAA 2IC3A 3VQ8A 4DSKA 2KFZA 3HJFA 1L3SA 3V9XA 1XC9A 1J5OA 4FW2A 4NCGA 4O44A 3AVHA 3RR7A 4KHNA 3CG7A 1YVUA 5KGWA 4CF8A 1RDBA 1SV5A 2KZZA 3LZJA 5HRSA 4DTJA 2HVIA 4G1QA 4B8AB 4E1MA 4FZZA 1S1TA 4C8MA 3SI6A 1Q9YA 2YKMA 2JLEA 3VQ4A 4H4OA 3L3VA 3VQ7A 2OZSA 1VSFA 1FXXA 4YFUA 1EX4A 1Z25A 3G10A 2QKBA 3ASMA 3QIPA 1TAQA 1QQCA 1NOZA 1RTIA 3LDSA 3KKRA 2Z1IA 2ZQBA 1SKWA 1QSSA 5FROA 4PUOA 2IGIA 3ALYA 4CJ3A 3ZSOA 1BL3A 3NBPA 3NF9A 4DS5A 2P51A 1TVRA 3ZSWA 1KVBA 3ULDA 3SPZA 4E7IA 4O5BA 4XIUA 3QIOA 3AA3A 1RBRA 1RT5A 3CYMA 4DFJA 3OYGA 4OGEA 3TAQA 1IG9A 1R0AA 3MEEA 4C8LA 4O55A 4B3OA 1WSIA 3DOKA 4CJPA 3OYFA 3OYIA 2QKKA 1KSPA 3L2WA 3SV4A 4FXDA 4Z4HA 4Y1CA 1T05A 2PYJA 4HCCA 2OPRA 2D0CA 2ZD1A 3HPHA 4DLEA 1FKOA 2YNFA 3AVBA 4I7FA 4KHUA 2BANA 1JLQA 3KJVA 3QESA 2VWJA 3QNOA 3SYZA 4ELUA 4HVJA 4N76A 1HYSA 3VQDA 4M42A 1XWLA 3VQ5A 2VG7A 4IFVA 3PO4A 4FJ9A 1ZBIA 2QXFA 1HQEA 3DLGA 2XY5A 4DTMA 2E6MA 2ITGA 4AH9A 5HLFA 4KB0A 4DTRA 4FJLA 4BWMA 4I9LA 2ETJA 3HO1A 1RT6A 3DLHA 4E3SA 1SUQA 2B4JA 4RW6A 5CYQA 4DTPA 3S3MA 4CGFA 1TAUA 3KD5E 4KTQA 3HL8A 2WONA 1QSYA 4W5OA 4PQUA 4OPKA 4CHPA 1IKXA 1KVCA 3QEWA 2HHWA 3LAMA 2KFNA 1HMVA 2DFEA 4KV8A 4DWIA 4OPJA 3TANA 2FBTA 4CK2A 3QINA 2Q3SA 1VSIA 4CEOA 3AO1A 3RWUA 3MEDA 3ZT3A 3VQBA 4B9SA 4Z4FA 2HNYA 2JGUA 4FLZA 4ICLA 4J2DA 3G0ZA 3PX4A 4CEQA 4F4KA 2X6NA 3QEIA 3HPGA 4B08A 1HRHA 3M8QA 3D0PA 4EZ6A 3AVCA 3L3UA 4DU4A 3LALA 4JRQA 1B9FA 3HPOA 4HUFA 4CF0A 1XHZA 3WNEA 4M3ZA 4R5PA 2KZMA 3QERA 4W5TA 1YT3A 2O4GA 4KTZA 4BDYA 4FM1A 3AVNA 1LW0A 1JL2A 2YNIA 3VQQA 1Q9XA 4CHYA 4CGGA 4CHOA 1L3UA 3KLHA 4B9TA 1S1UA 1NJYA 2P1JA 3RMAA 3OS2A 4DSEA 3NH1A 1ASUA 2YKNA 4E7HA 4W5NA 4N5SA 4FLXA 3KK2A 1RT4A 1JXBA 2WOMA 5SWMA 4DS4A 1WSFA 3CFPA 1C1CA 1UOCA 3I0SA 3LWMA 1JLFA 5KI6A 4CF2A 1FK9A 1S9EA 1QHTA 4RW8A 2HNDA 2GBZA 1JLAA 1LAVA 2RPIA 3KK1A 1IH7A 3LAKA 4CF1A 4FLUA 1X9WA 1BIUA 4UQGA 1QE1A 1VSLA 3NAEA 4LH4A 1NOYA 3K57A 4AHVA 1HYVA 1RTHA 3SUNA 3E01A 4LSNA 3MXJA 1KVAA 2X6SA 2NUBA 4BE2A 1HNIA 3C6TA 3DMJA 3VQ9A 3OYBA 3C94A 3OYLA 3AVJA 5DK5A 1RBSA 4OGCA 3HXMA 1HJRA 2ATQA 1L5UA 1ASWA 4GMJB 5C25A 3S9HA 4ID5A 1RTDA 1RT3A 3ISNC 1SL0A 1NK9A 3JSMA 4CJKA 1ZBUA 3K58A 1FKPA 1BCMA 4E7LA 3B6PA 3RTVA 4KHWA 2YNHA 1IKYA 4DTXA 1BQNA 1D8YA 4FJJA 4K8XA 4IDKA 1U04A 3PX0A 1VRTA 1WAJA 4CEAA 3LZIA 3ZSZA 3THVA 3HSTB 1NK4A 4M3UA 3AVKA 1ASVA 4TSXA 3TI0A 4FJHA 4CJFA 4LSLA 1NK5A 4B9LA 3DRSA 1C1AA 4OVLA 1VSDA 1W0HA 2DY4A 3SUPA 3WNGA 3NDKA 2B6AA 2DFHA 3HYFA 4CJTA 3QEVA 3TAGA 4FLVA 1WN7A 2XY8A 4CJQA 3ZSVA 3O3HA 4AHCA 2LSNA 4M41A 4FJIA 3KLEA 1VK0A 4RW7A 1TK5A 3VN5A 4E89A 4AHTA 2G8WA 1BCOA 1VRUA 4FLWA 3OYCA 2XY6A 4CESA 1KFSA 1KLNA 4DFKA 4IG0A 4RW9A 4B9UA 4J2AA 1BISA 3IRXA 3MXIA 1TKDA 3KD1E 4GW6A 3SQ2A 4CIEA 4O4GA 1CLQA 4JLHA 4CJ4A 4DTSA 4DSFA 2YNGA 3B6OA 3TAPA 4Z4EA 2OPSA 5J2NA 4GVMA 1ITGA 1CXUA 4OKKA 3IS9A 3P83D 3WNHA 3AA2A 3U3GA 3KK3A 2RKIA 2OYQA 5CYMA 3RR8A 3QO9A 1WSHA 4FJXA 3CQ8A 5HP1A 4CIGA 4ZHRA 3ZT2A 5HBMA 1RDAA 4Z0UA 1JL1A 4I2QA 3LPTA 1T8EA 1F21A 4CEFA 3KLFA 1RT1A 4F2SA 1TV6A 3U6FA 1X9MA 4DFMA 2Z1GA 5KTQA 4HUEA 1D9FA 4MQ3A 3OS0A 2HHXA 5SZTA 5J2MA 3PV8A 1A5XA 1NJWA 5FRMA 5JS1A 2F96A 2VG6A 4HHTA 3QEPA 1QS4A 3AO3A 1NJZA 4DSJA 1RDDA 3U3YA 4I9QA 3MECA 4CGDA 2OPPA 1BIZA 1EXQA 1I39A 4BACA 2G8HA 2HHTA 1L3VA 1D9DA 4FK0A 3SPYA 3PO5A 1REVA 3DM2A 1U45A 1RT2A 5CY4A 1TKZA 5J2PA 1BI4A 4FK4A 1IO2A 4CHNA 4Q5VA 4IG3A 5CZ1A 1S1XA 3RMDA 3K5OA 4CJRA 4ZTJA 3KTQA 4AHUA 1BI4B 1EKEA 2D0BA 2IDOA 2HNZA 4CEBA 1B92A 4Z4IA 3TR8A 1JKHA 4ELTA 1TGOA 2BDPA 4FJ8A 3DRPA 4KHSA 1IKWA 3SZ2A 1T03A 1WSGA 1EETA 3P5JA 4CJSA 3SUOA 3VQEA 4EP5A 4JS5A 4B9MA 4FJKA 5HRNA 3M8SA 1SKRA 3AVFA 2A1RA 1WSJA 4ZTFA 3VQAA 3OYDA 2P5GA 2A1SA 3PY8A 4CHZA 2XRIA 1J9AA 4KB1A 3K5LA 4DQPA 1NKCA 2BGGA 4CJVA 3PUFA 2XHBA 1GOBA 5JS2A 5C42A 3TWHA 2EX3A 1KRPA 4M3WA 4IBNA 1N6QA 4OJRA 1S1VA 5E41A 1NK0A 4C8KA 3DI6A 4CGIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FBX A;  1ZYQ A;  4KPY A;  1LWF A;  2FBY A;  3ZSY A;  1L3T A;  3SJJ A;  3C6U A;  4J2B A;  3TAM A;  3DLK A;  4FJ7 A;  3QEX A;  1JLB A;  2X74 A;  3DOL A;  1C0M A;  1HPZ A;  4OLB A;  3I0R A;  4Z4C A;  3AA4 A;  3S3N A;  4EZ9 A;  3V1R A;  3NGI A;  5D3G A;  1WLJ A;  3L8B A;  1O1W A;  4NYN A;  4BWJ A;  2OA8 A;  3LP1 A;  4CJE A;  3AO2 A;  4W5R A;  1WAF A;  4DSL A;  2FC0 A;  2DFF A;  2RF2 A;  2HHU A;  1RIL A;  1TL1 A;  3AA5 X;  4M3X A;  3S3O A;  1RBV A;  2DTU A;  3LPU A;  4JRP A;  1B9D A;  1DLO A;  3KLG A;  1LAW A;  3CFR A;  4CK1 A;  4M3T A;  2GUI A;  2FBV A;  4Q0B A;  4FM0 A;  5K14 A;  1IKV A;  4HCB A;  1Q8I A;  1KLM A;  2YHB A;  4IFY A;  3DYA A;  1G15 A;  2D0A A;  4CIF A;  4N56 A;  4W5Q A;  4IKF A;  4DQS A;  1WNS A;  3VQC A;  4FK2 A;  1J53 A;  4KI4 A;  3IG1 A;  2G8F A;  4LY7 A;  3TAE A;  1VSH A;  3V6D A;  4BDP A;  1JLC A;  3ZSX A;  2KTQ A;  1VSJ A;  3UIQ A;  4DU3 A;  3OJU A;  2HW3 A;  1LV5 A;  3NF6 A;  5CZ2 A;  3L2R A;  1X1P A;  4CJU A;  4B9V A;  4CCH A;  3ZSQ A;  4PY5 A;  3KKS A;  3L2Q A;  4FJ5 A;  4CFA A;  2EHG A;  3LP3 A;  4KO0 A;  3D45 A;  1S9G A;  3FFI A;  3K2P A;  1DTT A;  4O0J A;  3EZ5 A;  3NE6 A;  4FLT A;  4BE0 A;  1S1W A;  1JXE A;  5HRR A;  3ZT1 A;  1RTJ A;  3SUQ A;  1C6V A;  3SQ0 A;  2VWK A;  3MEG A;  3V9U A;  3CM5 A;  3AV9 A;  1BQM A;  1MU2 A;  3L2U A;  3NGY A;  1TK0 A;  1N5Y A;  4DTO A;  1RT7 A;  3AVG A;  4HUG A;  3OS1 A;  5FDL A;  1NK6 A;  4CFC A;  1UA1 A;  3NH0 A;  1TKT A;  4OKE A;  1VSE A;  2W42 A;  3L2V A;  4DQI A;  5C24 A;  3AVM A;  3VQ6 A;  5KRT A;  1U47 A;  1UAX A;  4I2P A;  4KI6 A;  2HHV A;  3O3F A;  4K8Z A;  4KAZ A;  1RNH A;  3OYN A;  1QSL A;  3BDP A;  2OPQ A;  1JLG A;  2XO7 A;  4L8R B;  4CFB A;  1YTU A;  3DLE A;  4FCY A;  4N41 A;  1WSE A;  4MFB A;  1VSK A;  3WNF A;  3MXM A;  4M3Y A;  4QCL A;  1EP4 A;  2D5R A;  2HHQ A;  2B5J A;  1C1B A;  3O4Q A;  3DLR A;  4FZY A;  3EYZ A;  2Y1I A;  3TAR A;  4ELV A;  3CFO A;  4LH5 A;  1SKS A;  1RCH A;  3OVN A;  1I3A A;  4EP4 A;  2KW4 A;  3O3G A;  2E4L A;  3KIO A;  4DMN A;  4OKJ A;  3MAQ A;  4DF8 A;  4FZX C;  2F8T A;  1BGX T;  4CF9 A;  1LWE A;  4NYF A;  3AVI A;  1J54 A;  3NGZ A;  3EY1 A;  1U4B A;  1NKE A;  4H4M A;  1GOA A;  4RG8 A;  1HNV A;  3LP2 A;  5HRP A;  5T7B A;  1NK7 A;  3VA3 A;  4FJG A;  1RBU A;  4KHY A;  5DMR A;  1S6P A;  3HM9 A;  2OZM A;  4F3O A;  3ZCM A;  4Z4G A;  1TKX A;  3RMC A;  2O4I A;  4C8N A;  2ZE2 A;  2QK9 A;  1C0U A;  3HVT A;  4CER A;  3O4N A;  3V1O A;  1YTA A;  4CEC A;  3T3F A;  4HTU A;  5I42 A;  1A5W A;  1GOC A;  2IS3 A;  3T19 A;  3VA0 A;  1S5J A;  3V9W A;  4AHR A;  4CJL A;  1Z26 A;  3K59 A;  4WE1 A;  4DTU A;  4AIL C;  3AVL A;  3P1G A;  2HMI A;  2P5O A;  4FJN A;  4KRF A;  3OY9 A;  4CEZ A;  3OYE A;  5J1E A;  1TK8 A;  4CGH A;  4C8O A;  3ZT4 A;  4J2E A;  3SQ1 A;  1BHL A;  4PA1 A;  1LW2 A;  4FW1 A;  3AVA A;  4AHS A;  3ZSR A;  3F73 A;  2IOC A;  4FYD A;  3NH2 A;  3M8R A;  3RRG A;  3DRR A;  3LAN A;  4QOZ B;  2PY5 A;  2X78 A;  3OYH A;  4M3R A;  3QLH A;  1ZBF A;  3HP6 A;  2R7Y A;  4BDZ A;  4DSI A;  3C95 A;  4NCA A;  4KHQ A;  1U49 A;  1VSM A;  3V81 A;  4KRE A;  3H08 A;  4DU1 A;  3F9K A;  3RMB A;  2HB5 A;  2G8K A;  1KTQ A;  2HHS A;  4ID1 A;  1Y97 A;  1NJX A;  4NCB A;  2BE2 A;  4KTW A;  5EU7 A;  2E6L A;  4JS4 A;  3SQ4 A;  4FJM A;  1S6Q A;  4CJW A;  3AO5 A;  3K5M A;  3VQP A;  4DG1 A;  4FVM A;  1KCF A;  3V1Q A;  1U48 A;  1W9H A;  3T1A A;  1CZB A;  1HYZ A;  4OLA A;  1A5V A;  3TAB A;  2I5J A;  4DLG A;  4QAG A;  4H8K A;  3HP9 A;  3I8D A;  1UWB A;  3BGR A;  4CED A;  3HT3 A;  1XI1 A;  1CZ9 A;  4Y1D A;  3DLB A;  5KGX A;  4F2R A;  4CHQ A;  3OJS A;  4CK3 A;  1T7P A;  1X9S A;  1XHX A;  4DQR A;  1NK8 A;  2YV0 X;  4E19 A;  3V9Z A;  4FLY A;  3NHG A;  4F3T A;  5FRN A;  5I3U A;  1RDC A;  3A2F A;  4KFB A;  4FM2 A;  2HVH A;  2VG5 A;  4E0D A;  2G8I A;  2Z1J A;  4KKO A;  3QNN A;  3HK2 A;  4CGJ A;  1DTQ A;  4RW4 A;  4O0I A;  1RBT A;  3AO4 A;  3CM6 A;  3OYK A;  2F8S A;  1LWC A;  1JLE A;  3KLI A;  3NFA A;  4CE9 A;  4LD0 A;  4CFD A;  3K5N A;  4DFP A;  1C0T A;  1NKB A;  4E1N A;  2Y1J A;  5J2Q A;  1D5A A;  4YNQ A;  3LP0 A;  3OYM A;  1SL2 A;  1KFD A;  3ZT0 A;  4F8R A;  3OYA A;  4DTN A;  1SL1 A;  4PWD A;  3V4I A;  2KQ2 A;  1CXQ A;  1K6Y A;  2Z1H A;  3NCI A;  4M45 A;  3JYT A;  2AJQ A;  1TL3 A;  2GV9 A;  4E7J A;  4DQQ A;  3IAY A;  2RN2 A;  3ITH A;  1HQU A;  2IAJ A;  3SV3 A;  3SNN A;  4B9N A;  4CEE A;  3LWL A;  3NF7 A;  1ZBH A;  5KRS A;  5HRO A;  3V9S A;  3RRH A;  3OYJ A;  1QTM A;  4BE1 A;  4DF4 A;  2G8V A;  1UA0 A;  1ZBL A;  4B8C A;  2PZS A;  3HVR A;  3TAF A;  3PX6 A;  3M8P A;  4N47 A;  2G8U A;  2PYL A;  4E7K A;  3NF8 A;  3SCX A;  3QET A;  4CJ5 A;  2XY7 A;  2YHA A;  2IC3 A;  3VQ8 A;  4DSK A;  2KFZ A;  3HJF A;  1L3S A;  3V9X A;  1XC9 A;  1J5O A;  4FW2 A;  4NCG A;  4O44 A;  3AVH A;  3RR7 A;  4KHN A;  3CG7 A;  1YVU A;  5KGW A;  4CF8 A;  1RDB A;  1SV5 A;  2KZZ A;  3LZJ A;  5HRS A;  4DTJ A;  2HVI A;  4G1Q A;  4B8A B;  4E1M A;  4FZZ A;  1S1T A;  4C8M A;  3SI6 A;  1Q9Y A;  2YKM A;  2JLE A;  3VQ4 A;  4H4O A;  3L3V A;  3VQ7 A;  2OZS A;  1VSF A;  1FXX A;  4YFU A;  1EX4 A;  1Z25 A;  3G10 A;  2QKB A;  3ASM A;  3QIP A;  1TAQ A;  1QQC A;  1NOZ A;  1RTI A;  3LDS A;  3KKR A;  2Z1I A;  2ZQB A;  1SKW A;  1QSS A;  5FRO A;  4PUO A;  2IGI A;  3ALY A;  4CJ3 A;  3ZSO A;  1BL3 A;  3NBP A;  3NF9 A;  4DS5 A;  2P51 A;  1TVR A;  3ZSW A;  1KVB A;  3ULD A;  3SPZ A;  4E7I A;  4O5B A;  4XIU A;  3QIO A;  3AA3 A;  1RBR A;  1RT5 A;  3CYM A;  4DFJ A;  3OYG A;  4OGE A;  3TAQ A;  1IG9 A;  1R0A A;  3MEE A;  4C8L A;  4O55 A;  4B3O A;  1WSI A;  3DOK A;  4CJP A;  3OYF A;  3OYI A;  2QKK A;  1KSP A;  3L2W A;  3SV4 A;  4FXD A;  4Z4H A;  4Y1C A;  1T05 A;  2PYJ A;  4HCC A;  2OPR A;  2D0C A;  2ZD1 A;  3HPH A;  4DLE A;  1FKO A;  2YNF A;  3AVB A;  4I7F A;  4KHU A;  2BAN A;  1JLQ A;  3KJV A;  3QES A;  2VWJ A;  3QNO A;  3SYZ A;  4ELU A;  4HVJ A;  4N76 A;  1HYS A;  3VQD A;  4M42 A;  1XWL A;  3VQ5 A;  2VG7 A;  4IFV A;  3PO4 A;  4FJ9 A;  1ZBI A;  2QXF A;  1HQE A;  3DLG A;  2XY5 A;  4DTM A;  2E6M A;  2ITG A;  4AH9 A;  5HLF A;  4KB0 A;  4DTR A;  4FJL A;  4BWM A;  4I9L A;  2ETJ A;  3HO1 A;  1RT6 A;  3DLH A;  4E3S A;  1SUQ A;  2B4J A;  4RW6 A;  5CYQ A;  4DTP A;  3S3M A;  4CGF A;  1TAU A;  3KD5 E;  4KTQ A;  3HL8 A;  2WON A;  1QSY A;  4W5O A;  4PQU A;  4OPK A;  4CHP A;  1IKX A;  1KVC A;  3QEW A;  2HHW A;  3LAM A;  2KFN A;  1HMV A;  2DFE A;  4KV8 A;  4DWI A;  4OPJ A;  3TAN A;  2FBT A;  4CK2 A;  3QIN A;  2Q3S A;  1VSI A;  4CEO A;  3AO1 A;  3RWU A;  3MED A;  3ZT3 A;  3VQB A;  4B9S A;  4Z4F A;  2HNY A;  2JGU A;  4FLZ A;  4ICL A;  4J2D A;  3G0Z A;  3PX4 A;  4CEQ A;  4F4K A;  2X6N A;  3QEI A;  3HPG A;  4B08 A;  1HRH A;  3M8Q A;  3D0P A;  4EZ6 A;  3AVC A;  3L3U A;  4DU4 A;  3LAL A;  4JRQ A;  1B9F A;  3HPO A;  4HUF A;  4CF0 A;  1XHZ A;  3WNE A;  4M3Z A;  4R5P A;  2KZM A;  3QER A;  4W5T A;  1YT3 A;  2O4G A;  4KTZ A;  4BDY A;  4FM1 A;  3AVN A;  1LW0 A;  1JL2 A;  2YNI A;  3VQQ A;  1Q9X A;  4CHY A;  4CGG A;  4CHO A;  1L3U A;  3KLH A;  4B9T A;  1S1U A;  1NJY A;  2P1J A;  3RMA A;  3OS2 A;  4DSE A;  3NH1 A;  1ASU A;  2YKN A;  4E7H A;  4W5N A;  4N5S A;  4FLX A;  3KK2 A;  1RT4 A;  1JXB A;  2WOM A;  5SWM A;  4DS4 A;  1WSF A;  3CFP A;  1C1C A;  1UOC A;  3I0S A;  3LWM A;  1JLF A;  5KI6 A;  4CF2 A;  1FK9 A;  1S9E A;  1QHT A;  4RW8 A;  2HND A;  2GBZ A;  1JLA A;  1LAV A;  2RPI A;  3KK1 A;  1IH7 A;  3LAK A;  4CF1 A;  4FLU A;  1X9W A;  1BIU A;  4UQG A;  1QE1 A;  1VSL A;  3NAE A;  4LH4 A;  1NOY A;  3K57 A;  4AHV A;  1HYV A;  1RTH A;  3SUN A;  3E01 A;  4LSN A;  3MXJ A;  1KVA A;  2X6S A;  2NUB A;  4BE2 A;  1HNI A;  3C6T A;  3DMJ A;  3VQ9 A;  3OYB A;  3C94 A;  3OYL A;  3AVJ A;  5DK5 A;  1RBS A;  4OGC A;  3HXM A;  1HJR A;  2ATQ A;  1L5U A;  1ASW A;  4GMJ B;  5C25 A;  3S9H A;  4ID5 A;  1RTD A;  1RT3 A;  3ISN C;  1SL0 A;  1NK9 A;  3JSM A;  4CJK A;  1ZBU A;  3K58 A;  1FKP A;  1BCM A;  4E7L A;  3B6P A;  3RTV A;  4KHW A;  2YNH A;  1IKY A;  4DTX A;  1BQN A;  1D8Y A;  4FJJ A;  4K8X A;  4IDK A;  1U04 A;  3PX0 A;  1VRT A;  1WAJ A;  4CEA A;  3LZI A;  3ZSZ A;  3THV A;  3HST B;  1NK4 A;  4M3U A;  3AVK A;  1ASV A;  4TSX A;  3TI0 A;  4FJH A;  4CJF A;  4LSL A;  1NK5 A;  4B9L A;  3DRS A;  1C1A A;  4OVL A;  1VSD A;  1W0H A;  2DY4 A;  3SUP A;  3WNG A;  3NDK A;  2B6A A;  2DFH A;  3HYF A;  4CJT A;  3QEV A;  3TAG A;  4FLV A;  1WN7 A;  2XY8 A;  4CJQ A;  3ZSV A;  3O3H A;  4AHC A;  2LSN A;  4M41 A;  4FJI A;  3KLE A;  1VK0 A;  4RW7 A;  1TK5 A;  3VN5 A;  4E89 A;  4AHT A;  2G8W A;  1BCO A;  1VRU A;  4FLW A;  3OYC A;  2XY6 A;  4CES A;  1KFS A;  1KLN A;  4DFK A;  4IG0 A;  4RW9 A;  4B9U A;  4J2A A;  1BIS A;  3IRX A;  3MXI A;  1TKD A;  3KD1 E;  4GW6 A;  3SQ2 A;  4CIE A;  4O4G A;  1CLQ A;  4JLH A;  4CJ4 A;  4DTS A;  4DSF A;  2YNG A;  3B6O A;  3TAP A;  4Z4E A;  2OPS A;  5J2N A;  4GVM A;  1ITG A;  1CXU A;  4OKK A;  3IS9 A;  3P83 D;  3WNH A;  3AA2 A;  3U3G A;  3KK3 A;  2RKI A;  2OYQ A;  5CYM A;  3RR8 A;  3QO9 A;  1WSH A;  4FJX A;  3CQ8 A;  5HP1 A;  4CIG A;  4ZHR A;  3ZT2 A;  5HBM A;  1RDA A;  4Z0U A;  1JL1 A;  4I2Q A;  3LPT A;  1T8E A;  1F21 A;  4CEF A;  3KLF A;  1RT1 A;  4F2S A;  1TV6 A;  3U6F A;  1X9M A;  4DFM A;  2Z1G A;  5KTQ A;  4HUE A;  1D9F A;  4MQ3 A;  3OS0 A;  2HHX A;  5SZT A;  5J2M A;  3PV8 A;  1A5X A;  1NJW A;  5FRM A;  5JS1 A;  2F96 A;  2VG6 A;  4HHT A;  3QEP A;  1QS4 A;  3AO3 A;  1NJZ A;  4DSJ A;  1RDD A;  3U3Y A;  4I9Q A;  3MEC A;  4CGD A;  2OPP A;  1BIZ A;  1EXQ A;  1I39 A;  4BAC A;  2G8H A;  2HHT A;  1L3V A;  1D9D A;  4FK0 A;  3SPY A;  3PO5 A;  1REV A;  3DM2 A;  1U45 A;  1RT2 A;  5CY4 A;  1TKZ A;  5J2P A;  1BI4 A;  4FK4 A;  1IO2 A;  4CHN A;  4Q5V A;  4IG3 A;  5CZ1 A;  1S1X A;  3RMD A;  3K5O A;  4CJR A;  4ZTJ A;  3KTQ A;  4AHU A;  1BI4 B;  1EKE A;  2D0B A;  2IDO A;  2HNZ A;  4CEB A;  1B92 A;  4Z4I A;  3TR8 A;  1JKH A;  4ELT A;  1TGO A;  2BDP A;  4FJ8 A;  3DRP A;  4KHS A;  1IKW A;  3SZ2 A;  1T03 A;  1WSG A;  1EET A;  3P5J A;  4CJS A;  3SUO A;  3VQE A;  4EP5 A;  4JS5 A;  4B9M A;  4FJK A;  5HRN A;  3M8S A;  1SKR A;  3AVF A;  2A1R A;  1WSJ A;  4ZTF A;  3VQA A;  3OYD A;  2P5G A;  2A1S A;  3PY8 A;  4CHZ A;  2XRI A;  1J9A A;  4KB1 A;  3K5L A;  4DQP A;  1NKC A;  2BGG A;  4CJV A;  3PUF A;  2XHB A;  1GOB A;  5JS2 A;  5C42 A;  3TWH A;  2EX3 A;  1KRP A;  4M3W A;  4IBN A;  1N6Q A;  4OJR A;  1S1V A;  5E41 A;  1NK0 A;  4C8K A;  3DI6 A;  4CGI A; 
#chains in the Genus database with same CATH topology
 3WQU A;  4FJ7 A;  3CCJ N;  3NGI A;  4B3T K;  5C0Y A;  1WLJ A;  4BWJ A;  3AO2 A;  4BR2 A;  3HM8 A;  3QFU A;  3ID6 A;  4AF1 A;  3S3O A;  1RBV A;  3CF5 L;  1LAW A;  3CFR A;  4LFB K;  4CK1 A;  3O8M A;  2FBV A;  1Q8I A;  1KLM A;  1ATN A;  2P9I B;  2YHB A;  5C10 A;  4W5Q A;  3HOS A;  3SBT A;  4DQS A;  2YCH A;  1J53 A;  4KI4 A;  3IG1 A;  1QQO A;  3U9D A;  3LDQ A;  3K0S A;  4BDP A;  4DU3 A;  3AY9 A;  4DV0 K;  1VQN N;  2HW3 A;  1NM1 A;  3CQY A;  5CR4 A;  4PY5 A;  1KAZ A;  4CZI A;  3L2Q A;  3A5M C;  4KO0 A;  4O0J A;  3CCM N;  4NXM K;  4FWK A;  1C6V A;  2P9U B;  3CM5 A;  3CET A;  3NGY A;  4A5B A;  4A57 A;  1RT7 A;  4LFA K;  3FR0 A;  2IVO A;  3QML A;  4OKE A;  4CW7 B;  3O6W A;  2EWS A;  1KC8 O;  3AVM A;  1HNZ K;  4H5W A;  1QSL A;  3WEE B;  3OYN A;  3BDP A;  4CFB A;  1IV0 A;  5M1K A;  1VSK A;  4QCL A;  1RFQ A;  2D5R A;  3PSI A;  1C1B A;  3THY A;  3P4I A;  3TAR A;  4ELV A;  3CFO A;  4LH5 A;  3GBT A;  1DGK N;  3OVN A;  2PAV A;  4EP4 A;  2KW4 A;  1NNE A;  1TYQ A;  3MAQ A;  3QDK A;  1E4F T;  4NYF A;  5AQW A;  2FSN A;  1U4B A;  4JAX A;  2DPN A;  4RG8 A;  1HNV A;  3CCE N;  5HRP A;  1RBU A;  1S6P A;  4H0T B;  3RMC A;  3ENH A;  3OW2 M;  3V1O A;  1GLJ O;  1YTA A;  4HTU A;  3THW A;  2IS3 A;  5AZI A;  2YJE A;  3AVL A;  2QWP A;  4KRF A;  3OY9 A;  4WFA L;  2VQF K;  4PA1 A;  2A5X A;  4AHS A;  4FYD A;  3O5B A;  3LAN A;  2VWB A;  4X62 K;  3OYH A;  3QLH A;  4BDZ A;  1NU0 A;  5BN8 A;  4BRL A;  1EQY A;  2PBD A;  3F9K A;  3RMB A;  1YXQ A;  5AQZ A;  2HHS A;  5EY4 A;  4ID1 A;  5CHI A;  3TPQ A;  4YHH K;  3VQP A;  3V1Q A;  1U48 A;  4NB4 A;  1BA1 A;  2I5J A;  3AAQ A;  2E2P A;  3RSE A;  3I8D A;  3HT3 A;  1CZ9 A;  4CK3 A;  1T7P A;  5GIP A;  1X3N A;  4CVN E;  5AQF A;  3NHG A;  4LF5 K;  3H1V X;  5AQP A;  4FM2 A;  3VMF B;  4PL8 A;  4KKO A;  3QNN A;  1DTQ A;  1NGJ A;  4RW4 A;  2NRV A;  4PL7 A;  1JLE A;  4CE9 A;  3PO5 A;  4B9N A;  4DSI A;  5J2Q A;  3OYM A;  4H03 B;  1X3M A;  1KFD A;  3HSC A;  3OYA A;  3V4I A;  1OKJ A;  2WC9 A;  1K6Y A;  2AJQ A;  4M45 A;  3JYT A;  2KKZ A;  2RN2 A;  4I6M B;  3SV3 A;  4JI4 K;  3SNN A;  4CEE A;  3LWL A;  3NF7 A;  3WQT A;  5KRS A;  3V9S A;  4BVP A;  4CZH A;  3MN5 A;  4DF4 A;  4GY2 B;  1UA0 A;  1ZBL A;  3PX6 A;  4FVU A;  4N47 A;  3VF2 A;  1O13 A;  4CJ5 A;  3VQ8 A;  3QIC A;  3DLL L;  2KFZ A;  4QS7 A;  1L3S A;  3HJF A;  4FW2 A;  4JV5 K;  2YHY A;  3CG7 A;  4CF8 A;  2KZZ A;  1GLD G;  2Q31 A;  3B8A X;  5F2R A;  4JKH A;  5BPN A;  4BC5 A;  3VQ7 A;  1FXX A;  1TAQ A;  1NOZ A;  1QSS A;  2GTD A;  5FRO A;  3SBG A;  1KQS M;  4IJA A;  3ALY A;  3ZSO A;  2GUP A;  1OH6 A;  4DS5 A;  4RTF D;  5AQQ A;  4GV6 A;  3AA3 A;  3D2F A;  1R0A A;  4O55 A;  3OYF A;  3OYI A;  4BY9 C;  2BUP A;  3P38 A;  4FXD A;  4GVE A;  4C1N I;  3HPH A;  3AVB A;  4WQ4 C;  2BAN A;  1M90 O;  2BH1 A;  3Q7C A;  2YJF A;  4HVJ A;  4M42 A;  3VQ5 A;  3CHW A;  4MO5 A;  2W41 A;  3PO4 A;  4FJ9 A;  3HTV A;  4PKG A;  4DHY A;  5BPL A;  4JHD B;  5JIC A;  5HLF A;  3MWP A;  1JCG A;  1BA0 A;  1VQ5 N;  5CYQ A;  3HL8 A;  3GDQ A;  4BRQ A;  5GAH P;  2F9W A;  4JK7 A;  3QEW A;  2KFN A;  3VOV A;  4GV3 A;  2O8B B;  2Q3S A;  4CEO A;  4B9S A;  4B3R K;  3VQB A;  4J2D A;  2X6N A;  2WUS A;  1MWM A;  4B08 A;  1NGC A;  3L3U A;  4EIA A;  4DU4 A;  4HUF A;  3FLC O;  4FM1 A;  4BRA A;  2YNI A;  1QHA A;  4JKB A;  1L3U A;  1NJY A;  3RMA A;  4OPH A;  1ZBS A;  1XNQ K;  4N5S A;  5SWM A;  3P39 A;  3E9L A;  1WSF A;  1W7A A;  1JLF A;  1I94 K;  1S9E A;  2GBZ A;  3CJC A;  3KK1 A;  1IH7 A;  1NBW A;  4CF1 A;  4PKH A;  1VSL A;  3VTI A;  3NAE A;  1NOY A;  3SUN A;  4LSN A;  2X6S A;  1NGH A;  3BUZ B;  3DMJ A;  3E9P A;  3VQ9 A;  3C94 A;  2HBJ A;  3HXM A;  5FPE A;  1HJO A;  4FL9 A;  3S9H A;  3U8X A;  4BGA A;  2CH6 A;  1BCM A;  2YNH A;  4DTX A;  3SK3 A;  3IKM A;  1WAJ A;  4FPA A;  4DV6 K;  4M3U A;  3AVK A;  1ASV A;  2VGN A;  2AA4 A;  4OVL A;  5AQK A;  2YX6 A;  4BRM A;  4JKC A;  3WNG A;  3TAG A;  4CJT A;  1T3V A;  1WN7 A;  3ZSV A;  4FJI A;  1VK0 A;  4FWO A;  3JAM O;  5KQ8 A;  2G8W A;  3SAG A;  4IO8 A;  4FLW A;  1C0F A;  3SMS A;  4B9U A;  3KD1 E;  4GW6 A;  4X66 K;  1HNW K;  2O8D B;  4DSF A;  4Z4E A;  2OPS A;  5J2N A;  1CXU A;  3C7N B;  3P83 D;  3WNH A;  3VEO A;  2OYQ A;  1WSH A;  2RHK A;  5HP1 A;  4ZHR A;  1HNX K;  4CEF A;  5C15 A;  2GX9 A;  1TV6 A;  1X9M A;  3CQX A;  1NG9 A;  3THY B;  3CC2 N;  3KZB A;  3T69 A;  2VG6 A;  4DR2 K;  4HHT A;  3QEP A;  4LC9 B;  1NJZ A;  3CC7 N;  4AM7 A;  3NMU A;  3KVG A;  2UU9 K;  3M6G A;  4BAC A;  1L3V A;  1D9D A;  1REV A;  1U45 A;  1QVF M;  3VEW A;  3EEQ A;  4Q5V A;  3CPW M;  1U2V A;  2YHX A;  4ZTJ A;  3TR8 A;  4CZM A;  4H5V A;  4KHS A;  5JMV A;  3IMX A;  4RWT A;  4YOW A;  4AQY K;  1ESV A;  5BN9 A;  4Z94 A;  3EE9 A;  3EN9 A;  1WSJ A;  4IFE A;  2XRI A;  3CMA N;  3K5L A;  1XMQ K;  4BQL A;  2XHB A;  2EX3 A;  4FOE A;  5GAE P;  1N6Q A;  4OJR A;  1S1V A;  5E41 A;  1Z6R A;  3HOT A;  2F4V K;  5CE3 A;  4WFB L;  4CGI A;  3C6H A;  4KPY A;  1LWF A;  2ITM A;  3BY5 A;  3DOL A;  1C0M A;  4OLB A;  5LY3 A;  3I0R A;  4BC4 A;  5LMN K;  3S3N A;  3V1R A;  5D3G A;  4NYN A;  1T6C A;  3D2E B;  3CCS N;  2OA8 A;  2FC0 A;  3QFP A;  4M3X A;  4JI6 K;  3CJ7 A;  1HLU A;  4JRP A;  5K14 A;  4CZL A;  3O1B A;  4HCB A;  4BQZ A;  4IFY A;  1G15 A;  4N56 A;  2D4W A;  2GEL A;  2ZGZ A;  4IKF A;  4F9O A;  3MMV A;  2G8F A;  3TAE A;  4WQ4 A;  1VSH A;  3ZSX A;  2KTQ A;  3UIQ A;  4DR5 K;  3OJU A;  3IFR A;  5AZJ B;  3N4P A;  4B9V A;  2P9S B;  2P9L A;  1DTT A;  2ZM6 K;  3EZ5 A;  4FLT A;  2P9K A;  1R59 O;  3J7Z O;  1JXE A;  5HRR A;  2A3Z A;  4RCH A;  1RTJ A;  1Q81 O;  3SQ0 A;  2VWK A;  3AV9 A;  1BQM A;  1MU2 A;  3L2U A;  4DTO A;  3AVG A;  5M1O A;  4HUG A;  1NK6 A;  1UA1 A;  3NH0 A;  1TKT A;  5AQT A;  2W42 A;  3S41 A;  4DQI A;  3H6E A;  3VQ6 A;  1U47 A;  4KI6 A;  1HKG A;  1RNH A;  1OH5 A;  4NXN K;  3ATV A;  1YTU A;  3ZX3 A;  4MFB A;  1EO1 A;  3WNF A;  1EP4 A;  2W40 A;  3EYZ A;  1SKS A;  5FPD A;  1BG3 A;  4OKJ A;  3THX B;  1LOT B;  3EKU A;  3R3L A;  1LWE A;  5GIO A;  1NKE A;  1GOA A;  2JWL A;  3LP2 A;  3ZEU B;  5T7B A;  1NK7 A;  3D2F B;  3IUC A;  3Q7B A;  3H1Q A;  1E3M A;  4UY8 O;  5AJ3 K;  4U67 L;  4C8N A;  1YF5 L;  4DV2 K;  1C0U A;  4CEC A;  3O4N A;  5JVH L;  3VA0 A;  4CJL A;  2OTL N;  3K59 A;  2V51 B;  2P5O A;  3P1G A;  4FSV A;  3L0Q A;  3MDQ A;  1YHQ N;  3VGL A;  3M5R A;  1V4S A;  3JXU A;  4FW1 A;  2QW9 A;  3F73 A;  2GWJ A;  3M8R A;  2UXC K;  4M3R A;  3CJA A;  3HP6 A;  1VQ7 N;  3C95 A;  4DQ8 A;  2QWR A;  1U49 A;  2G8K A;  4M7X A;  1EWR A;  2NRH A;  3R9P A;  1NJX A;  4DUZ K;  5EU7 A;  2E6L A;  4BRE A;  4FWN A;  3K5M A;  1KCF A;  3T1Y K;  1CZB A;  2QWN A;  3UKR B;  1A5V A;  4OLA A;  3TSQ A;  4QAG A;  4F2R A;  3AAR A;  3BGR A;  5M1Q A;  1EWQ A;  4Y1D A;  3T1H K;  1X9S A;  4DQR A;  3NVM A;  3V9Z A;  3ULE B;  4JD2 A;  3C6A A;  4YOY A;  3OTO K;  3I33 A;  1K8K A;  3FFK B;  2VG5 A;  4E0D A;  2G8I A;  3HK2 A;  1J6Z A;  3A5O C;  2NRX A;  4O0I A;  3AO4 A;  2F8S A;  3NFA A;  3K5N A;  1C0T A;  5JLH A;  1SL2 A;  2WBN A;  4DTN A;  4PWD A;  5E84 A;  3NCI A;  2W6K A;  2D0O A;  1BOT O;  3CI5 A;  4DV7 K;  3RRH A;  1IJJ A;  3OYJ A;  2CH5 A;  2P9P B;  2Q0U A;  4B8C A;  3TAF A;  1N36 K;  3C65 A;  4LF8 K;  2G8U A;  3SCX A;  1U6Z A;  1MWK A;  3V9X A;  3L4I A;  1J5O A;  4O44 A;  4CD3 A;  3GE1 A;  4KHN A;  1YVU A;  1RDB A;  1NGG A;  1GLF O;  4O8K A;  5AQM A;  5HRS A;  4DTJ A;  2HVI A;  2E2Q A;  4FZZ A;  1S1T A;  1VQO N;  2YKM A;  4GKJ K;  3VQ4 A;  4H4O A;  4B1Z A;  1EX4 A;  1BU6 O;  4ISG A;  2Z1I A;  4OO1 J;  3W0L A;  1XC3 A;  1YIJ N;  3NBP A;  3NF9 A;  5EXW A;  3ULD A;  3FZH A;  4E7I A;  1RBR A;  1RT5 A;  4C8L A;  3TAQ A;  1IG9 A;  4B3O A;  3DOK A;  1NGB A;  3DXK B;  4XH1 A;  5I9E B;  1QQM A;  3I55 N;  2PYJ A;  2OPR A;  2ZD1 A;  5DM7 L;  4KHU A;  1XNR K;  4FWR A;  3R1X A;  3J81 O;  4XEI A;  2VWJ A;  4ELU A;  3BF3 A;  4R79 A;  2FSJ A;  4EHU A;  4FWQ A;  2OTJ N;  2XY5 A;  2BTF A;  3ZX2 A;  2E6M A;  2ITG A;  4CJ7 A;  2NRW A;  2O8F A;  4I9L A;  3HO1 A;  2QWQ A;  1RT6 A;  1SUQ A;  2B4J A;  3ZET B;  1TAU A;  4KTQ A;  1QSY A;  4PQU A;  2QTD A;  5JVG L;  3ZLJ A;  2HHW A;  5C2D A;  1HMV A;  1ZXO A;  5AQL A;  3TAN A;  3GOI A;  3QIN A;  1VSI A;  3RWU A;  4JKA A;  2JGU A;  2H3G X;  4ICL A;  3PX4 A;  4O8U A;  4ISF A;  3QEI A;  3CME N;  3ENB A;  1HRH A;  1RDU A;  3LAL A;  1B9F A;  4M3Z A;  4R5P A;  2KZM A;  1YT3 A;  2O4G A;  4NLB A;  4BDY A;  1TUY A;  4HWI A;  1LW0 A;  3CIP A;  1Q9X A;  3SLC A;  2P9N B;  4ILH A;  4B9T A;  2P1J A;  2O8E B;  1M1K O;  2YKN A;  4KBO A;  4FLX A;  1RT4 A;  1JXB A;  2WOM A;  4A5A A;  3CFP A;  4JI1 K;  1UOC A;  2VQE K;  4CF2 A;  1QHT A;  4RW8 A;  2HND A;  4XH5 A;  1JLA A;  4BRO A;  3LAK A;  4FLU A;  1QE1 A;  3MN6 A;  4YOT A;  4LH4 A;  2E1Z A;  1HYV A;  3E01 A;  2NUB A;  1HNI A;  3U9Z A;  2VGM A;  4G9Z A;  3VEX A;  3AVJ A;  5DK5 A;  3UKU B;  4ID5 A;  3ISN C;  1SL0 A;  1FKP A;  1SQK A;  1QVG M;  3PX0 A;  3QBX A;  5ADX A;  3LZI A;  3ZSZ A;  3HST B;  4TSX A;  4CJF A;  4LSL A;  4B9L A;  4DCH A;  1C1A A;  3DXM A;  2UUC K;  2OCE A;  1W0H A;  2HBK A;  5LMU K;  3SUP A;  2DFH A;  3HYF A;  1H1V A;  1XMO K;  1G99 A;  4M41 A;  3KLE A;  2I7N A;  3ENO A;  3T7Z A;  4CZE A;  3CJ9 A;  2GWK A;  1VRU A;  3CJ1 A;  2A40 A;  3OYC A;  4CES A;  3AAP A;  3O9T A;  5M1P A;  4O4G A;  1CLQ A;  4CJ4 A;  2F7T A;  5C12 A;  4ILG B;  4GVM A;  4OKK A;  2QM1 A;  5HOO A;  2J4R A;  2RKI A;  5CYM A;  3RR8 A;  3QO9 A;  1DEJ A;  2QWM A;  4CIG A;  2O8C A;  2IVP A;  2WFB A;  1JL1 A;  4K25 A;  3KLF A;  5KPZ A;  4DFM A;  2Z1G A;  4JKG B;  3OBY A;  1DKG D;  4MQ3 A;  1S22 A;  4BR7 A;  4CBU A;  1W97 L;  3AO3 A;  4ISE A;  1QQN A;  1Q7Y O;  1RDD A;  3U3Y A;  1MDU B;  5BR9 A;  1I39 A;  1VHX A;  2HHT A;  3VF6 A;  1RT2 A;  5AR0 A;  5J2P A;  4BRF A;  4ILJ A;  5CZ1 A;  1S1X A;  3TTC A;  4BR5 A;  3WXK A;  4CJR A;  3KTQ A;  1BI4 B;  3SJH A;  1JKH A;  4ELT A;  1TGO A;  4FJ8 A;  3SZ2 A;  1WSG A;  1EET A;  3P5J A;  4EP5 A;  4FJK A;  3EE8 A;  2V7Z A;  3EZW A;  4ZTF A;  2P5G A;  3PUF A;  3OA9 A;  1GOB A;  1YI2 N;  1KRP A;  4IWV A;  2UYT A;  3L4Q A;  4K43 A;  1NK0 A;  3DI6 A;  2PY5 A;  2RE2 A;  2OAN A;  2FBY A;  5ELZ A;  3ZSY A;  4J2B A;  3TAM A;  3DLK A;  1NGE A;  1HPZ A;  3AA4 A;  3VPZ A;  1C0G A;  3VTH A;  1FW6 A;  4B1Y B;  3SAH A;  1ILY A;  3L8B A;  1O1W A;  3LP1 A;  4DSL A;  2HHU A;  2RF2 A;  4BRI A;  1TL1 A;  1NWK A;  4MO4 A;  1BWF O;  2P9I A;  2DTU A;  1IBM K;  3KLG A;  1YIT N;  3VEV A;  4Q0B A;  4FM0 A;  2D0A A;  4CIF A;  3MX2 A;  4BR9 A;  4LF4 K;  4FK2 A;  4EFH A;  2VYP A;  4LY7 A;  3V6D A;  1VSJ A;  1N33 K;  3LDL A;  1LV5 A;  1X1P A;  3WXI A;  3ZSQ A;  4C1N K;  4FJ5 A;  3FE1 A;  2EHG A;  2HOE A;  2E5L K;  3D45 A;  3FFI A;  2I7P A;  3BEX A;  4H5N A;  2P9U A;  2V7Y A;  3I56 N;  5TKY A;  3ZYY X;  4U7B A;  3BP8 A;  1VQ8 N;  3V9U A;  4FWL A;  1TK0 A;  1N5Y A;  5FDL A;  3LDP A;  1KAY A;  4DR1 K;  5AQV A;  2UUB K;  1XUP O;  3WEE A;  3L2V A;  4CBW A;  3C0B A;  2HHV A;  4K8Z A;  1FJG K;  4KAZ A;  4X65 K;  2OPQ A;  1JLG A;  4H0X B;  2XO7 A;  3VGK A;  3DLE A;  4N41 A;  1WSE A;  4M3Y A;  3MXM A;  4JEP A;  4QS9 A;  3O4Q A;  4IEE A;  3PIP L;  2E4L A;  4FZX C;  2F8T A;  2QI2 A;  5FPN A;  1YJW N;  3F5T A;  1TYQ B;  1J54 A;  3AVI A;  3NGZ A;  4H4M A;  4H0P A;  3A5L C;  3MK6 A;  5DMR A;  1ATR A;  1OVQ A;  3HM9 A;  3E9O A;  2ZE2 A;  5EOY A;  2QK9 A;  3HVT A;  4CER A;  4A2A A;  5I42 A;  3T19 A;  1NK8 A;  1X9J A;  4KH5 A;  4AIL C;  3CER A;  4AHR A;  2VCP A;  2HMI A;  4WE1 A;  4CEZ A;  3CCR N;  3THW B;  4IEI A;  5AZI B;  5J1E A;  4CGH A;  4JYA K;  3PIO L;  3VEN A;  3ZT4 A;  4J2E A;  3SQ1 A;  4LF6 K;  3AVA A;  4CZJ A;  3NH2 A;  3RRG A;  4JI5 K;  4QOZ B;  5GAD P;  4YDU C;  1Z05 A;  2R7Y A;  3KK7 A;  4NCA A;  1RGI A;  1K9M O;  3H08 A;  4GNI A;  4WCE L;  3CCQ N;  2BE2 A;  4KTW A;  4QS8 A;  1S6Q A;  1HKC A;  4CJW A;  3T1A A;  3KHY A;  1HYZ A;  4DLG A;  4H8K A;  3HP9 A;  1UWB A;  4CED A;  3WXM B;  4H0O A;  1P90 A;  1WBD A;  2YV0 X;  3RSE B;  4WQ5 C;  4IO9 L;  4MLE A;  2KHO A;  4F3T A;  3WXJ A;  5FRN A;  5I3U A;  3A2F A;  1KAX A;  4KFB A;  4BG8 A;  4JI8 K;  5TKW A;  1RBT A;  3OYK A;  4DFP A;  1NGF A;  3KLI A;  1NKB A;  4LD0 A;  4E1N A;  2Y1J A;  4F8R A;  3ZT0 A;  1YVN A;  4CD1 A;  1SL1 A;  1S72 N;  2KQ2 A;  1CXQ A;  4I6M A;  3CD6 N;  1TL3 A;  2GV9 A;  4DQQ A;  2FXU A;  1J5E K;  4B3M K;  3GG4 A;  1HQU A;  2IAJ A;  3PLA A;  4BRH A;  2A41 A;  5AFU A;  5HRO A;  4WFN L;  1QTM A;  2G8V A;  4IOC L;  3HVR A;  4CZK A;  4DSK A;  2HF4 A;  1XC9 A;  3RR7 A;  4JI7 K;  3I8B A;  5KGW A;  1WBB A;  4G1Q A;  3SAF A;  4Y0W A;  4JNE A;  2ASP A;  1Q9Y A;  5AQH A;  3D6R A;  4YFU A;  3ASM A;  3QIP A;  1QQC A;  1RTI A;  1SKW A;  2ZQB A;  5EVZ A;  4CJ3 A;  5LJW A;  1OH7 A;  1TVR A;  3ZSW A;  1NGA A;  4O5B A;  3QIO A;  3CYM A;  1BUP A;  4OGE A;  3G4S N;  1WSI A;  2NRR A;  2D0P A;  3SV4 A;  4BR4 A;  4Y1C A;  1S3X A;  4DLE A;  2F9T A;  4B1V A;  3TU5 A;  5FLX O;  1NMN A;  2A42 A;  3J8A A;  3MX5 A;  5M1F A;  4JHD A;  2VG7 A;  4H0Y B;  4IFV A;  1NGI A;  3HZ6 A;  4DTM A;  2ASM A;  4AH9 A;  2ETJ A;  3VEZ A;  5AQG A;  4E3S A;  2V52 B;  4DTP A;  3DWL A;  1T44 A;  3L6Q A;  2WON A;  3CJB A;  2O8B A;  1V4T A;  4DV4 K;  4CHP A;  4DR3 K;  3LAM A;  4MDA A;  1N34 K;  4OPJ A;  2FBT A;  5ADX H;  3MED A;  3ZT3 A;  3HBT A;  2NRT A;  3JS6 A;  3O80 A;  4JKD A;  4CEQ A;  4JK9 A;  4F4K A;  4KHP K;  3HPG A;  2FF6 A;  3M8Q A;  3D0P A;  4BG9 A;  3ZX0 A;  4CF0 A;  1XHZ A;  3WNE A;  4W5T A;  4K0K K;  3GL1 A;  3AVN A;  3H3N O;  3K9K A;  3O1W A;  3VQQ A;  4BRC A;  4CGG A;  4CHO A;  3KLH A;  5C2F A;  4JKF A;  3OS2 A;  4DSE A;  4C23 A;  3NH1 A;  1ASU A;  5KPR A;  4E7H A;  4W5N A;  2WTU A;  4OX9 K;  3I0S A;  1D4X A;  4WF9 L;  3LWM A;  1SAZ A;  2QWL A;  3HI0 A;  1FK9 A;  2HBL A;  1LAV A;  2RPI A;  2YI1 A;  3NVK A;  1BIU A;  4UQG A;  1N8R O;  4BC2 A;  4CI6 A;  3K57 A;  4AHV A;  1KVA A;  3C6T A;  3OYL A;  1RBS A;  4OGC A;  4JK8 A;  2ATQ A;  1ASW A;  4GMJ B;  3TTF A;  1HUX A;  5C25 A;  1RT3 A;  3KWI A;  1NK9 A;  1JCF A;  1SZ2 A;  3JSM A;  4CJK A;  1ZBU A;  3K58 A;  1YJN N;  2PFU A;  4KHW A;  4IOA L;  3DLB A;  4A62 A;  1NK4 A;  4CEA A;  2HMP A;  3TI0 A;  3AGK A;  1VSD A;  4EAH D;  4FLV A;  4AHC A;  4CBX A;  3F9M A;  4YDU A;  4AHT A;  1BCO A;  2XY6 A;  2O8D A;  4FWM A;  1KLN A;  4J2A A;  1BIS A;  3MXI A;  2CGL A;  3C7N A;  3SQ2 A;  4KH4 A;  2HST A;  2E1Y A;  4DTS A;  4JKE A;  4K41 A;  4EHT A;  1ITG A;  3AA2 A;  3U3G A;  3KK3 A;  3M3Z A;  4FJX A;  3CQ8 A;  3UB5 A;  3OHR A;  3ZT2 A;  1RDA A;  4Z0U A;  4I2Q A;  3LPT A;  3E1Y A;  4B1W B;  4WQ5 A;  1W2B M;  1P8Z A;  5KTQ A;  4DV1 K;  4HUE A;  1IBK K;  1VQ4 N;  5SZT A;  5J2M A;  3PV8 A;  1NJW A;  5JS1 A;  5IT9 O;  1ATS A;  2Q1N A;  3G71 N;  3CCU N;  4JN4 A;  1QS4 A;  3LDO A;  4FPB A;  5BRE A;  4DSJ A;  1BIZ A;  1VQP N;  2G8H A;  3O9U A;  4B3S K;  1GLL O;  3SPY A;  3DM2 A;  4GKK K;  3CCV N;  2ZF5 O;  5AQU A;  1TKZ A;  4IG3 A;  3RMD A;  3WT0 A;  4AHU A;  2IDO A;  1EKE A;  2D0B A;  2HNZ A;  1B92 A;  3MN9 A;  1U2V B;  1IBL K;  3HRG A;  3DRP A;  2ASO A;  4MDB A;  3SUO A;  3VQE A;  4B9M A;  3CCL N;  1SKR A;  3OYD A;  3PY8 A;  2BGG A;  4DR6 K;  1J9A A;  4CJV A;  3CPE A;  3TWH A;  5JS2 A;  5C42 A;  4B1X B;  1YAG A;  4C8K A;  3ID8 A;  4BR0 A;  5BRF A;  2FBX A;  1ZYQ A;  3E66 A;  1L3T A;  4OPA A;  3C6U A;  3SJJ A;  4IXC A;  1GLB G;  3QEX A;  1JLB A;  2X74 A;  3G25 A;  3D2E A;  4Z4C A;  5A2Q O;  2NLX A;  3U4L A;  4CJE A;  4W5R A;  1WAF A;  2DFF A;  1RIL A;  1XQS C;  3AA5 X;  3R6M A;  3LPU A;  1B9D A;  1DLO A;  4M3T A;  2GUI A;  1IKV A;  3A8Y A;  3DYA A;  1Q18 A;  4LF7 K;  2E2N A;  3SMP A;  1WNS A;  3VQC A;  2ZJR L;  3UE5 A;  5AZJ A;  5AQS A;  5AQX A;  1JLC A;  2P9S A;  5AQO A;  4B9Q A;  4BGB A;  3NF6 A;  5CZ2 A;  3L2R A;  1VQK N;  4CJU A;  4CCH A;  3KKS A;  4CFA A;  3LP3 A;  3NE6 A;  3K2P A;  1S9G A;  2QA4 N;  4BE0 A;  2NZT A;  1S1W A;  2P9L B;  3ZT1 A;  3RVC A;  3SUQ A;  2P9K B;  3MEG A;  4BRK A;  3LM9 A;  3IDH A;  3A0I X;  3TTD A;  1HPM A;  3OS1 A;  4CFC A;  1Y64 A;  4FWS A;  1VSE A;  5AQJ A;  3H45 C;  5C24 A;  4M63 C;  5KRT A;  1UAX A;  4I2P A;  3O3F A;  1Q86 O;  1KD1 O;  4L8R B;  1GLA G;  1SS6 A;  3M1F A;  4FCY A;  1GLC G;  3LM2 A;  1E4G T;  1VQ6 N;  2HHQ A;  2B5J A;  3DLR A;  4FZY A;  3THX A;  2Y1I A;  5LL6 Z;  1RCH A;  3AGR A;  1I3A A;  1IG8 A;  3WXL A;  3O3G A;  2E2O A;  3KIO A;  4DMN A;  4DF8 A;  4A2B A;  1BGX T;  5AQR A;  4CF9 A;  4V19 S;  3J80 O;  3ZEU A;  3EY1 A;  2UXD K;  2QXL A;  2CGK A;  3VEY A;  3VA3 A;  4FJG A;  4H5R A;  1OVY A;  4KHY A;  3TSP A;  4F3O A;  2OZM A;  2O4I A;  3ZCM A;  4Z4G A;  1TKX A;  4YOV A;  4BRN A;  4KH6 A;  4YOU A;  4IOX A;  3T3F A;  1A5W A;  1GOC A;  4KB1 A;  3V9W A;  4DTU A;  1S5J A;  4EZ9 A;  1Z26 A;  4FJN A;  3EO3 A;  3EL2 A;  3OYE A;  1TK8 A;  4YY3 K;  4C8O A;  3BF1 A;  4A59 A;  1BHL A;  2FLO A;  1LW2 A;  5GAG P;  3ZSR A;  2IOC A;  5AFU H;  3F2K A;  3DRR A;  3A5N C;  2X78 A;  5FPM A;  1ZBF A;  4DV3 K;  4DUY K;  4KHQ A;  4KRE A;  1VSM A;  3V81 A;  2FF3 B;  4DU1 A;  4H0V B;  2HB5 A;  4LFC K;  4BRG A;  1KTQ A;  3FZK A;  1Y97 A;  3J7A P;  4NCB A;  4JS4 A;  3SQ4 A;  2HBM A;  4FJM A;  3UKR A;  1KXP A;  5H1S Q;  3AO5 A;  2FSK A;  4DG1 A;  4FVM A;  4GV9 A;  1W9H A;  3MCP A;  5AQY A;  3TAB A;  4XH4 A;  3ULE A;  1XI1 A;  4HTL A;  1HX1 A;  5KGX A;  4CHQ A;  3OJS A;  2E20 A;  1XHX A;  4E19 A;  4FLY A;  5BRD A;  2AP1 A;  3MN7 A;  2HVH A;  3O9S A;  1RDC A;  2Z1J A;  4JD2 B;  4CGJ A;  3CM6 A;  3VET A;  4BVO A;  1QZ5 A;  1K8K B;  1LWC A;  4CFD A;  1YUW A;  4WYB A;  1D5A A;  4YNQ A;  3LP0 A;  1NMD A;  5DM6 L;  2ZWH A;  2UXB K;  2Z1H A;  4E7J A;  3IAY A;  3VER A;  3ITH A;  2ZJQ L;  5AQI A;  2P9P A;  1ZBH A;  2NRZ A;  4CZG A;  1NJI O;  4BE1 A;  5GIN A;  2PZS A;  3M8P A;  2HHH K;  2PYL A;  5IWA K;  4E7K A;  2UUA K;  3NF8 A;  3QET A;  2XY7 A;  2YHA A;  2IC3 A;  5EX5 A;  1CZA N;  4DKW A;  4NCG A;  1NGD A;  3AVH A;  1SV5 A;  3PSF A;  3LZJ A;  4B8A B;  4E1M A;  4C8M A;  2Q97 A;  3ATU A;  3SI6 A;  3BZK A;  1Q82 O;  2JLE A;  3OBW A;  3DJC A;  3L3V A;  2OZS A;  1VSF A;  3O08 A;  2QKB A;  1Z25 A;  3G10 A;  3LDS A;  3KKR A;  5KPT A;  4PUO A;  2IGI A;  3TSU A;  4A61 A;  1BL3 A;  4MLH A;  1NLV A;  2P51 A;  1YJ9 N;  1KVB A;  2JWK A;  3SPZ A;  2GEM A;  4XIU A;  3DXK A;  4DFJ A;  3OYG A;  3MEE A;  2D1K A;  4FO0 A;  4CJP A;  4FOI A;  2E8A A;  1VQM N;  2QKK A;  1KSP A;  3L2W A;  2QWO A;  4Z4H A;  1T05 A;  4HCC A;  5B8H A;  2D0C A;  4DR4 K;  1FKO A;  2YNF A;  3QBW A;  4I7F A;  1JLQ A;  3KJV A;  2W6L A;  3QES A;  3QNO A;  1TUU A;  4JI0 K;  3SYZ A;  4N76 A;  1HYS A;  3VQD A;  1XWL A;  4B1U B;  1GLE G;  1ZBI A;  2QXF A;  1HQE A;  3DLG A;  4X64 K;  5LJV A;  3MCA B;  3O9R A;  4KB0 A;  4DTR A;  5M1N A;  4FJL A;  4BWM A;  3ZET A;  3W3D A;  3DLH A;  4NLC A;  4RW6 A;  5KQD A;  1VQ9 N;  3N4Q A;  3S3M A;  2O8F B;  4CGF A;  2E88 A;  5E26 A;  3KD5 E;  4W5O A;  4OPK A;  1IKX A;  1KVC A;  4KV8 A;  2DFE A;  5HL7 L;  4JI2 K;  2ZJP L;  4IJN A;  4DWI A;  4JI3 K;  4CK2 A;  1WB9 A;  3AO1 A;  4DB3 A;  4Z4F A;  2HNY A;  4FLZ A;  1VAZ A;  3G0Z A;  2IVN A;  4EZ6 A;  3EKS A;  3AVC A;  4JRQ A;  4PHT X;  3HPO A;  3WUH A;  3QER A;  4KTZ A;  2P9N A;  1JL2 A;  4H5T A;  2O8E A;  4CHY A;  1S1U A;  2Q2R A;  3KK2 A;  4DS4 A;  3G6E N;  1C1C A;  4L3Q A;  5KI6 A;  2KLA A;  3CXC M;  4LF9 K;  3VGM A;  1X9W A;  2IIR A;  4NO7 A;  3FZL A;  1RTH A;  3MXJ A;  5MLC Q;  3LL3 A;  3KWG A;  3UKU A;  4BE2 A;  3OYB A;  1DT9 A;  1HJR A;  1L5U A;  1HR0 K;  1RTD A;  2A6A A;  4FWP A;  4IDH A;  4E7L A;  3FZM A;  3B6P A;  3RTV A;  4DV5 K;  4BRD A;  1IKY A;  1D8Y A;  1BQN A;  4K8X A;  4FJJ A;  4IDK A;  1U04 A;  3THV A;  1VRT A;  1OH8 A;  3BZC A;  4FJH A;  1NK5 A;  3DRS A;  4DR7 K;  2DY4 A;  3NDK A;  2ZGY A;  2B6A A;  4PKI A;  3QEV A;  3DXM B;  2XY8 A;  4CJQ A;  1BO5 O;  3K9J A;  3O3H A;  2LSN A;  4J8F A;  4RW7 A;  5F0X A;  4IZ9 A;  1TK5 A;  1ZC6 A;  4E1J A;  3VN5 A;  4E89 A;  1KFS A;  5BRH A;  4DFK A;  4IG0 A;  4RW9 A;  2HF3 A;  3IRX A;  1TKD A;  4CIE A;  4JLH A;  5BR8 K;  2YNG A;  3B6O A;  3TAP A;  1K73 O;  4YOR A;  5BPM A;  3D7E O;  3IS9 A;  1WOQ A;  1RDW X;  4CZF A;  4JKG A;  5HBM A;  4K42 A;  1WUA A;  4M7Y A;  3O9Q A;  1T8E A;  1F21 A;  2NNW A;  4F2S A;  1RT1 A;  3MWT A;  2O8C B;  3U6F A;  3J7Y P;  1D9F A;  3OS0 A;  2HHX A;  3FGU A;  1A5X A;  5FRM A;  1K8A O;  2F96 A;  5JLF A;  1JJ2 M;  3VF4 A;  1LCU A;  2Q36 A;  4BRP A;  4BC3 A;  1N32 K;  5F1X A;  3MEC A;  4I9Q A;  4CGD A;  2OPP A;  1EXQ A;  3VES A;  4FK0 A;  3R8E A;  1VQL N;  3LDN A;  3H3O B;  3P31 A;  5CY4 A;  1MA9 B;  1BI4 A;  3FZF A;  1IO2 A;  4CHN A;  3CC4 N;  4FK4 A;  3H46 O;  3K5O A;  3O4W A;  4Z4I A;  2Q0R A;  4CEB A;  2YHW A;  2CGJ A;  4AM6 A;  4O5F A;  2BDP A;  3QB0 A;  1IKW A;  1T03 A;  5AQN A;  4CJS A;  3DAW A;  4JS5 A;  2QEX N;  5HRN A;  4YOX A;  3M8S A;  3AVF A;  2A1R A;  3VQA A;  2A1S A;  4CHZ A;  1T6D A;  4DQP A;  1NKC A;  1BDG A;  4M3W A;  1QZ6 A;  1JCE A;  1HKB A;  4IBN A; 
#chains in the Genus database with same CATH homology
 2FBX A;  1ZYQ A;  4KPY A;  1LWF A;  2FBY A;  3ZSY A;  1L3T A;  3SJJ A;  3C6U A;  4J2B A;  3TAM A;  3DLK A;  4FJ7 A;  3QEX A;  1JLB A;  2X74 A;  3DOL A;  1C0M A;  1HPZ A;  4OLB A;  3I0R A;  4Z4C A;  3AA4 A;  3S3N A;  4EZ9 A;  3V1R A;  3NGI A;  5D3G A;  1WLJ A;  3L8B A;  1O1W A;  4NYN A;  4BWJ A;  2OA8 A;  3LP1 A;  4CJE A;  3AO2 A;  4W5R A;  1WAF A;  4DSL A;  2FC0 A;  2DFF A;  2RF2 A;  2HHU A;  1RIL A;  1TL1 A;  3AA5 X;  4M3X A;  3S3O A;  1RBV A;  2DTU A;  3LPU A;  4JRP A;  1B9D A;  1DLO A;  3KLG A;  1LAW A;  3CFR A;  4CK1 A;  4M3T A;  2GUI A;  2FBV A;  4Q0B A;  4FM0 A;  5K14 A;  1IKV A;  4HCB A;  1Q8I A;  1KLM A;  2YHB A;  4IFY A;  3DYA A;  1G15 A;  2D0A A;  4CIF A;  4N56 A;  4W5Q A;  4IKF A;  4DQS A;  1WNS A;  3VQC A;  4FK2 A;  1J53 A;  4KI4 A;  3IG1 A;  2G8F A;  4LY7 A;  3TAE A;  1VSH A;  3V6D A;  4BDP A;  1JLC A;  3ZSX A;  2KTQ A;  1VSJ A;  3UIQ A;  4DU3 A;  3OJU A;  2HW3 A;  1LV5 A;  3NF6 A;  5CZ2 A;  3L2R A;  1X1P A;  4CJU A;  4B9V A;  4CCH A;  3ZSQ A;  4PY5 A;  3KKS A;  3L2Q A;  4FJ5 A;  4CFA A;  2EHG A;  3LP3 A;  4KO0 A;  3D45 A;  1S9G A;  3FFI A;  3K2P A;  1DTT A;  4O0J A;  3EZ5 A;  3NE6 A;  4FLT A;  4BE0 A;  1S1W A;  1JXE A;  5HRR A;  3ZT1 A;  1RTJ A;  3SUQ A;  1C6V A;  3SQ0 A;  2VWK A;  3MEG A;  3V9U A;  3CM5 A;  3AV9 A;  1BQM A;  1MU2 A;  3L2U A;  3NGY A;  1TK0 A;  1N5Y A;  4DTO A;  1RT7 A;  3AVG A;  4HUG A;  3OS1 A;  5FDL A;  1NK6 A;  4CFC A;  1UA1 A;  3NH0 A;  1TKT A;  4OKE A;  1VSE A;  2W42 A;  3L2V A;  4DQI A;  5C24 A;  3AVM A;  3VQ6 A;  5KRT A;  1U47 A;  1UAX A;  4I2P A;  4KI6 A;  2HHV A;  3O3F A;  4K8Z A;  4KAZ A;  1RNH A;  3OYN A;  1QSL A;  3BDP A;  2OPQ A;  1JLG A;  2XO7 A;  4L8R B;  4CFB A;  1YTU A;  3DLE A;  4FCY A;  4N41 A;  1WSE A;  4MFB A;  1VSK A;  3WNF A;  3MXM A;  4M3Y A;  4QCL A;  1EP4 A;  2D5R A;  2HHQ A;  2B5J A;  1C1B A;  3O4Q A;  3DLR A;  4FZY A;  3EYZ A;  2Y1I A;  3TAR A;  4ELV A;  3CFO A;  4LH5 A;  1SKS A;  1RCH A;  3OVN A;  1I3A A;  4EP4 A;  2KW4 A;  3O3G A;  2E4L A;  3KIO A;  4DMN A;  4OKJ A;  3MAQ A;  4DF8 A;  4FZX C;  2F8T A;  1BGX T;  4CF9 A;  1LWE A;  4NYF A;  3AVI A;  1J54 A;  3NGZ A;  3EY1 A;  1U4B A;  1NKE A;  4H4M A;  1GOA A;  4RG8 A;  1HNV A;  3LP2 A;  5HRP A;  5T7B A;  1NK7 A;  3VA3 A;  4FJG A;  1RBU A;  4KHY A;  5DMR A;  1S6P A;  3HM9 A;  2OZM A;  4F3O A;  3ZCM A;  4Z4G A;  1TKX A;  3RMC A;  2O4I A;  4C8N A;  2ZE2 A;  2QK9 A;  1C0U A;  3HVT A;  4CER A;  3O4N A;  3V1O A;  1YTA A;  4CEC A;  3T3F A;  4HTU A;  5I42 A;  1A5W A;  1GOC A;  2IS3 A;  3T19 A;  3VA0 A;  1S5J A;  3V9W A;  4AHR A;  4CJL A;  1Z26 A;  3K59 A;  4WE1 A;  4DTU A;  4AIL C;  3AVL A;  3P1G A;  2HMI A;  2P5O A;  4FJN A;  4KRF A;  3OY9 A;  4CEZ A;  3OYE A;  5J1E A;  1TK8 A;  4CGH A;  4C8O A;  3ZT4 A;  4J2E A;  3SQ1 A;  1BHL A;  4PA1 A;  1LW2 A;  4FW1 A;  3AVA A;  4AHS A;  3ZSR A;  3F73 A;  2IOC A;  4FYD A;  3NH2 A;  3M8R A;  3RRG A;  3DRR A;  3LAN A;  4QOZ B;  2PY5 A;  2X78 A;  3OYH A;  4M3R A;  3QLH A;  1ZBF A;  3HP6 A;  2R7Y A;  4BDZ A;  4DSI A;  3C95 A;  4NCA A;  4KHQ A;  1U49 A;  1VSM A;  3V81 A;  4KRE A;  3H08 A;  4DU1 A;  3F9K A;  3RMB A;  2HB5 A;  2G8K A;  1KTQ A;  2HHS A;  4ID1 A;  1Y97 A;  1NJX A;  4NCB A;  2BE2 A;  4KTW A;  5EU7 A;  2E6L A;  4JS4 A;  3SQ4 A;  4FJM A;  1S6Q A;  4CJW A;  3AO5 A;  3K5M A;  3VQP A;  4DG1 A;  4FVM A;  1KCF A;  3V1Q A;  1U48 A;  1W9H A;  3T1A A;  1CZB A;  1HYZ A;  4OLA A;  1A5V A;  3TAB A;  2I5J A;  4DLG A;  4QAG A;  4H8K A;  3HP9 A;  3I8D A;  1UWB A;  3BGR A;  4CED A;  3HT3 A;  1XI1 A;  1CZ9 A;  4Y1D A;  3DLB A;  5KGX A;  4F2R A;  4CHQ A;  3OJS A;  4CK3 A;  1T7P A;  1X9S A;  1XHX A;  4DQR A;  1NK8 A;  2YV0 X;  4E19 A;  3V9Z A;  4FLY A;  3NHG A;  4F3T A;  5FRN A;  5I3U A;  1RDC A;  3A2F A;  4KFB A;  4FM2 A;  2HVH A;  2VG5 A;  4E0D A;  2G8I A;  2Z1J A;  4KKO A;  3QNN A;  3HK2 A;  4CGJ A;  1DTQ A;  4RW4 A;  4O0I A;  1RBT A;  3AO4 A;  3CM6 A;  3OYK A;  2F8S A;  1LWC A;  1JLE A;  3KLI A;  3NFA A;  4CE9 A;  4LD0 A;  4CFD A;  3K5N A;  4DFP A;  1C0T A;  1NKB A;  4E1N A;  2Y1J A;  5J2Q A;  1D5A A;  4YNQ A;  3LP0 A;  3OYM A;  1SL2 A;  1KFD A;  3ZT0 A;  4F8R A;  3OYA A;  4DTN A;  1SL1 A;  4PWD A;  3V4I A;  2KQ2 A;  1CXQ A;  1K6Y A;  2Z1H A;  3NCI A;  4M45 A;  3JYT A;  2AJQ A;  1TL3 A;  2GV9 A;  4E7J A;  4DQQ A;  3IAY A;  2RN2 A;  3ITH A;  1HQU A;  2IAJ A;  3SV3 A;  3SNN A;  4B9N A;  4CEE A;  3LWL A;  3NF7 A;  1ZBH A;  5KRS A;  5HRO A;  3V9S A;  3RRH A;  3OYJ A;  1QTM A;  4BE1 A;  4DF4 A;  2G8V A;  1UA0 A;  1ZBL A;  4B8C A;  2PZS A;  3HVR A;  3TAF A;  3PX6 A;  3M8P A;  4N47 A;  2G8U A;  2PYL A;  4E7K A;  3NF8 A;  3SCX A;  3QET A;  4CJ5 A;  2XY7 A;  2YHA A;  2IC3 A;  3VQ8 A;  4DSK A;  2KFZ A;  3HJF A;  1L3S A;  3V9X A;  1XC9 A;  1J5O A;  4FW2 A;  4NCG A;  4O44 A;  3AVH A;  3RR7 A;  4KHN A;  3CG7 A;  1YVU A;  5KGW A;  4CF8 A;  1RDB A;  1SV5 A;  2KZZ A;  3LZJ A;  5HRS A;  4DTJ A;  2HVI A;  4G1Q A;  4B8A B;  4E1M A;  4FZZ A;  1S1T A;  4C8M A;  3SI6 A;  1Q9Y A;  2YKM A;  2JLE A;  3VQ4 A;  4H4O A;  3L3V A;  3VQ7 A;  2OZS A;  1VSF A;  1FXX A;  4YFU A;  1EX4 A;  1Z25 A;  3G10 A;  2QKB A;  3ASM A;  3QIP A;  1TAQ A;  1QQC A;  1NOZ A;  1RTI A;  3LDS A;  3KKR A;  2Z1I A;  2ZQB A;  1SKW A;  1QSS A;  5FRO A;  4PUO A;  2IGI A;  3ALY A;  4CJ3 A;  3ZSO A;  1BL3 A;  3NBP A;  3NF9 A;  4DS5 A;  2P51 A;  1TVR A;  3ZSW A;  1KVB A;  3ULD A;  3SPZ A;  4E7I A;  4O5B A;  4XIU A;  3QIO A;  3AA3 A;  1RBR A;  1RT5 A;  3CYM A;  4DFJ A;  3OYG A;  4OGE A;  3TAQ A;  1IG9 A;  1R0A A;  3MEE A;  4C8L A;  4O55 A;  4B3O A;  1WSI A;  3DOK A;  4CJP A;  3OYF A;  3OYI A;  2QKK A;  1KSP A;  3L2W A;  3SV4 A;  4FXD A;  4Z4H A;  4Y1C A;  1T05 A;  2PYJ A;  4HCC A;  2OPR A;  2D0C A;  2ZD1 A;  3HPH A;  4DLE A;  1FKO A;  2YNF A;  3AVB A;  4I7F A;  4KHU A;  2BAN A;  1JLQ A;  3KJV A;  3QES A;  2VWJ A;  3QNO A;  3SYZ A;  4ELU A;  4HVJ A;  4N76 A;  1HYS A;  3VQD A;  4M42 A;  1XWL A;  3VQ5 A;  2VG7 A;  4IFV A;  3PO4 A;  4FJ9 A;  1ZBI A;  2QXF A;  1HQE A;  3DLG A;  2XY5 A;  4DTM A;  2E6M A;  2ITG A;  4AH9 A;  5HLF A;  4KB0 A;  4DTR A;  4FJL A;  4BWM A;  4I9L A;  2ETJ A;  3HO1 A;  1RT6 A;  3DLH A;  4E3S A;  1SUQ A;  2B4J A;  4RW6 A;  5CYQ A;  4DTP A;  3S3M A;  4CGF A;  1TAU A;  3KD5 E;  4KTQ A;  3HL8 A;  2WON A;  1QSY A;  4W5O A;  4PQU A;  4OPK A;  4CHP A;  1IKX A;  1KVC A;  3QEW A;  2HHW A;  3LAM A;  2KFN A;  1HMV A;  2DFE A;  4KV8 A;  4DWI A;  4OPJ A;  3TAN A;  2FBT A;  4CK2 A;  3QIN A;  2Q3S A;  1VSI A;  4CEO A;  3AO1 A;  3RWU A;  3MED A;  3ZT3 A;  3VQB A;  4B9S A;  4Z4F A;  2HNY A;  2JGU A;  4FLZ A;  4ICL A;  4J2D A;  3G0Z A;  3PX4 A;  4CEQ A;  4F4K A;  2X6N A;  3QEI A;  3HPG A;  4B08 A;  1HRH A;  3M8Q A;  3D0P A;  4EZ6 A;  3AVC A;  3L3U A;  4DU4 A;  3LAL A;  4JRQ A;  1B9F A;  3HPO A;  4HUF A;  4CF0 A;  1XHZ A;  3WNE A;  4M3Z A;  4R5P A;  2KZM A;  3QER A;  4W5T A;  1YT3 A;  2O4G A;  4KTZ A;  4BDY A;  4FM1 A;  3AVN A;  1LW0 A;  1JL2 A;  2YNI A;  3VQQ A;  1Q9X A;  4CHY A;  4CGG A;  4CHO A;  1L3U A;  3KLH A;  4B9T A;  1S1U A;  1NJY A;  2P1J A;  3RMA A;  3OS2 A;  4DSE A;  3NH1 A;  1ASU A;  2YKN A;  4E7H A;  4W5N A;  4N5S A;  4FLX A;  3KK2 A;  1RT4 A;  1JXB A;  2WOM A;  5SWM A;  4DS4 A;  1WSF A;  3CFP A;  1C1C A;  1UOC A;  3I0S A;  3LWM A;  1JLF A;  5KI6 A;  4CF2 A;  1FK9 A;  1S9E A;  1QHT A;  4RW8 A;  2HND A;  2GBZ A;  1JLA A;  1LAV A;  2RPI A;  3KK1 A;  1IH7 A;  3LAK A;  4CF1 A;  4FLU A;  1X9W A;  1BIU A;  4UQG A;  1QE1 A;  1VSL A;  3NAE A;  4LH4 A;  1NOY A;  3K57 A;  4AHV A;  1HYV A;  1RTH A;  3SUN A;  3E01 A;  4LSN A;  3MXJ A;  1KVA A;  2X6S A;  2NUB A;  4BE2 A;  1HNI A;  3C6T A;  3DMJ A;  3VQ9 A;  3OYB A;  3C94 A;  3OYL A;  3AVJ A;  5DK5 A;  1RBS A;  4OGC A;  3HXM A;  1HJR A;  2ATQ A;  1L5U A;  1ASW A;  4GMJ B;  5C25 A;  3S9H A;  4ID5 A;  1RTD A;  1RT3 A;  3ISN C;  1SL0 A;  1NK9 A;  3JSM A;  4CJK A;  1ZBU A;  3K58 A;  1FKP A;  1BCM A;  4E7L A;  3B6P A;  3RTV A;  4KHW A;  2YNH A;  1IKY A;  4DTX A;  1BQN A;  1D8Y A;  4FJJ A;  4K8X A;  4IDK A;  1U04 A;  3PX0 A;  1VRT A;  1WAJ A;  4CEA A;  3LZI A;  3ZSZ A;  3THV A;  3HST B;  1NK4 A;  4M3U A;  3AVK A;  1ASV A;  4TSX A;  3TI0 A;  4FJH A;  4CJF A;  4LSL A;  1NK5 A;  4B9L A;  3DRS A;  1C1A A;  4OVL A;  1VSD A;  1W0H A;  2DY4 A;  3SUP A;  3WNG A;  3NDK A;  2B6A A;  2DFH A;  3HYF A;  4CJT A;  3QEV A;  3TAG A;  4FLV A;  1WN7 A;  2XY8 A;  4CJQ A;  3ZSV A;  3O3H A;  4AHC A;  2LSN A;  4M41 A;  4FJI A;  3KLE A;  1VK0 A;  4RW7 A;  1TK5 A;  3VN5 A;  4E89 A;  4AHT A;  2G8W A;  1BCO A;  1VRU A;  4FLW A;  3OYC A;  2XY6 A;  4CES A;  1KFS A;  1KLN A;  4DFK A;  4IG0 A;  4RW9 A;  4B9U A;  4J2A A;  1BIS A;  3IRX A;  3MXI A;  1TKD A;  3KD1 E;  4GW6 A;  3SQ2 A;  4CIE A;  4O4G A;  1CLQ A;  4JLH A;  4CJ4 A;  4DTS A;  4DSF A;  2YNG A;  3B6O A;  3TAP A;  4Z4E A;  2OPS A;  5J2N A;  4GVM A;  1ITG A;  1CXU A;  4OKK A;  3IS9 A;  3P83 D;  3WNH A;  3AA2 A;  3U3G A;  3KK3 A;  2RKI A;  2OYQ A;  5CYM A;  3RR8 A;  3QO9 A;  1WSH A;  4FJX A;  3CQ8 A;  5HP1 A;  4CIG A;  4ZHR A;  3ZT2 A;  5HBM A;  1RDA A;  4Z0U A;  1JL1 A;  4I2Q A;  3LPT A;  1T8E A;  1F21 A;  4CEF A;  3KLF A;  1RT1 A;  4F2S A;  1TV6 A;  3U6F A;  1X9M A;  4DFM A;  2Z1G A;  5KTQ A;  4HUE A;  1D9F A;  4MQ3 A;  3OS0 A;  2HHX A;  5SZT A;  5J2M A;  3PV8 A;  1A5X A;  1NJW A;  5FRM A;  5JS1 A;  2F96 A;  2VG6 A;  4HHT A;  3QEP A;  1QS4 A;  3AO3 A;  1NJZ A;  4DSJ A;  1RDD A;  3U3Y A;  4I9Q A;  3MEC A;  4CGD A;  2OPP A;  1BIZ A;  1EXQ A;  1I39 A;  4BAC A;  2G8H A;  2HHT A;  1L3V A;  1D9D A;  4FK0 A;  3SPY A;  3PO5 A;  1REV A;  3DM2 A;  1U45 A;  1RT2 A;  5CY4 A;  1TKZ A;  5J2P A;  1BI4 A;  4FK4 A;  1IO2 A;  4CHN A;  4Q5V A;  4IG3 A;  5CZ1 A;  1S1X A;  3RMD A;  3K5O A;  4CJR A;  4ZTJ A;  3KTQ A;  4AHU A;  1BI4 B;  1EKE A;  2D0B A;  2IDO A;  2HNZ A;  4CEB A;  1B92 A;  4Z4I A;  3TR8 A;  1JKH A;  4ELT A;  1TGO A;  2BDP A;  4FJ8 A;  3DRP A;  4KHS A;  1IKW A;  3SZ2 A;  1T03 A;  1WSG A;  1EET A;  3P5J A;  4CJS A;  3SUO A;  3VQE A;  4EP5 A;  4JS5 A;  4B9M A;  4FJK A;  5HRN A;  3M8S A;  1SKR A;  3AVF A;  2A1R A;  1WSJ A;  4ZTF A;  3VQA A;  3OYD A;  2P5G A;  2A1S A;  3PY8 A;  4CHZ A;  2XRI A;  1J9A A;  4KB1 A;  3K5L A;  4DQP A;  1NKC A;  2BGG A;  4CJV A;  3PUF A;  2XHB A;  1GOB A;  5JS2 A;  5C42 A;  3TWH A;  2EX3 A;  1KRP A;  4M3W A;  4IBN A;  1N6Q A;  4OJR A;  1S1V A;  5E41 A;  1NK0 A;  4C8K A;  3DI6 A;  4CGI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...