3AVAA

Crystal structures of novel allosteric peptide inhibitors of hiv integrase in the ledgf binding site
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
154
structure length
150
Chain Sequence
SSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title Crystal structures of novel allosteric peptide inhibitors of HIV integrase identify new interactions at the LEDGF binding site.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Recombination/inhibitor
total genus 58
structure length 150
sequence length 154
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3avaA00
4RW6A 4H8KA 4FLUA 2IOCA 4B8CA 1BI4B 4F3OA 4FJIA 1TL3A 3VQ7A 3KK3A 4KHYA 4RW7A 4KI4A 4FXDA 1ZBHA 2XY8A 1J53A 2O4GA 3L2WA 1RTDA 3PY8A 3OYKA 4Q0BA 4FJ8A 1Z26A 1C1CA 4O5BA 3NAEA 4HUEA 2HHWA 3QINA 4PUOA 3HJFA 5HRSA 4IFVA 4KTWA 3SQ1A 3S3OA 1SL2A 3K59A 4B9VA 4IFYA 1LW0A 2FBVA 2EHGA 4FJJA 3AO3A 4CJRA 3U6FA 3CM5A 5C24A 4E7KA 1BCMA 3L8BA 3PX4A 2VG7A 4OLAA 3HP6A 3B6OA 3S9HA 4W5NA 4CGJA 4DQQA 3TAQA 3DRRA 2G8IA 4DTRA 1XHXA 3SJJA 5FRNA 5FRMA 1SV5A 4FJ9A 3ALYA 4KKOA 1KTQA 3QIPA 3TWHA 1RTHA 3PX6A 1D9DA 1QHTA 3QESA 1RT5A 2X6NA 3KKSA 2IS3A 3CFOA 4OKJA 1VSEA 4CEBA 3OYBA 3RWUA 4CGFA 2QK9A 3OVNA 4B9LA 2HB5A 4PQUA 4M3WA 1S1XA 3DMJA 3KLFA 4Q5VA 4FLWA 1Z25A 1RBTA 5JS2A 1QS4A 3HL8A 5DMRA 3LP3A 3QEXA 2E6LA 1RBRA 3TAEA 1QSLA 1VSLA 4W5TA 2P5GA 2DY4A 1YVUA 3ZSOA 1UAXA 4TSXA 4AHCA 3JYTA 3AA2A 2W42A 4FJMA 3AVCA 3AVLA 3MEGA 5SWMA 2EX3A 3L2UA 4KREA 1VSKA 4FJKA 3MEEA 3DLEA 3SUOA 1BIUA 4C8NA 2BGGA 1ZBUA 4KV8A 4FLZA 4FM1A 3O3GA 3HPGA 3HPOA 4M3TA 1S9EA 3C6TA 4OGEA 1N6QA 2YKMA 3OYCA 1T03A 1ASUA 2G8UA 2D0CA 2P51A 1RT3A 1A5VA 4DTSA 1WN7A 2X78A 5DK5A 4AHRA 3LDSA 3OS2A 1D5AA 1NK9A 4CJKA 1HJRA 4Y1CA 4FW2A 3BGRA 1JL1A 3CM6A 5CZ2A 3ZSWA 3V6DA 3VQAA 2F8SA 1UA1A 1B92A 2IDOA 1L3TA 3HM9A 3VA3A 2AJQA 2B5JA 3PUFA 1LAWA 2WONA 2FBTA 4IDKA 4CF1A 3P1GA 1IKXA 3KK1A 4JS4A 1S1WA 4NCBA 1BIZA 5J2MA 2G8VA 4Z4GA 2KZMA 1CZ9A 4NCGA 3ZT3A 4E89A 3KLIA 3L3VA 4JRPA 4KI6A 2HMIA 3TAMA 1EXQA 4DU1A 1DLOA 1RDCA 3B6PA 3OYEA 4ELVA 4KTZA 3RMAA 4G1QA 3AVJA 4CIEA 4FCYA 3OS0A 3HVTA 1LWEA 3M8RA 4DLGA 4C8KA 4LSNA 5E41A 3NF7A 4FK2A 3VQPA 3D45A 2XY6A 1Q9YA 2Q3SA 2G8WA 3NH0A 1S1TA 1S9GA 1WSIA 3P83D 3V1RA 3DI6A 4O44A 4CJSA 5C42A 1JLEA 3HO1A 3NF6A 3G0ZA 3KJVA 4C8OA 2JLEA 4AHUA 3VA0A 1RILA 4DQSA 3DOLA 4FJXA 3SV3A 1KSPA 3C94A 1T8EA 2QKBA 3QEVA 1TKXA 3RTVA 2HHTA 2DFFA 2ZD1A 1LWFA 4EZ9A 1VSHA 3NCIA 1NOZA 3LWLA 4NCAA 4CEZA 4FJNA 2VWJA 3AVAA 1JLBA 3WNFA 4CJTA 3I0RA 2G8FA 3L3UA 3KIOA 1S1UA 1SL0A 4O4GA 1KVAA 4CHPA 4CCHA 4M3XA 3T3FA 1NKBA 1QSYA 2YNFA 4BACA 5KRTA 3PO5A 1L3UA 3CFPA 4OPKA 1TKZA 2KQ2A 3AA4A 3P5JA 1C1BA 3ISNC 3K57A 1XWLA 2BE2A 3QIOA 1NK0A 2D0AA 4RW4A 4DWIA 4O0IA 1C6VA 1RBVA 4W5OA 4FK4A 5HRPA 2GBZA 4M45A 4I2QA 4JRQA 3S3NA 3VQ4A 2R7YA 1HNVA 4CESA 4FLTA 1EETA 1TGOA 4CJWA 3MXMA 2PZSA 4IG0A 2IAJA 4KHWA 4E7LA 1RBUA 4CJQA 3HPHA 4FJLA 3UIQA 4W5RA 4JS5A 2HHXA 4HCCA 3MAQA 2BANA 4KTQA 2OPQA 4M42A 1JLFA 3AVHA 1JLGA 4W5QA 5HROA 1SL1A 1IKWA 1CZBA 3K2PA 4B9NA 1RDDA 4J2AA 3QEIA 3G10A 1K6YA 4UQGA 1IKVA 2QXFA 3QNOA 4E0DA 2HHUA 4CJUA 1QSSA 1N5YA 4BE0A 1ZBFA 3AVBA 4M3UA 3U3GA 4CK2A 4N47A 4DFJA 2HVIA 1FXXA 3RMDA 4AHTA 1VSMA 5FROA 2GUIA 1RT1A 3VQCA 4KHNA 2X74A 4ID5A 3HK2A 4LH5A 4RG8A 4Z4HA 3RRHA 3ZCMA 2B6AA 3DLBA 1S1VA 3KLGA 2FC0A 3V81A 4Y1DA 1T7PA 3CYMA 2P1JA 2Z1IA 3AA5X 2OPSA 3V9ZA 4M3YA 3LP1A 3O3FA 1KCFA 5SZTA 1KLMA 1WLJA 3SUNA 4Z4FA 3OYDA 2O4IA 3HP9A 1RCHA 2Z1HA 1HYZA 3NDKA 3ZT2A 4DTUA 4KFBA 2QKKA 3DRPA 1I39A 4GMJB 1GOAA 2ZQBA 3OYJA 4DU4A 3RRGA 4CEOA 3K5NA 4DSFA 1KFDA 2NUBA 3LP0A 3WNEA 3CFRA 4IKFA 4ZHRA 4QCLA 1EP4A 4CHNA 4I2PA 4B3OA 1BQMA 4KPYA 4CF9A 4CGGA 4DFKA 4CEQA 2KZZA 4CECA 3QEWA 1NK4A 4CIGA 1ASVA 1W9HA 4FLVA 4DFPA 1LWCA 1NJYA 3ASMA 3V1QA 4FJGA 4O0JA 4DQRA 3L2RA 1RNHA 1NJZA 2PY5A 4M41A 3BDPA 1HQEA 4DTPA 4E1MA 3I0SA 3HXMA 2YHAA 2JGUA 3V9WA 4FZYA 3EZ5A 3OYIA 1NK5A 3KLEA 2RPIA 2E4LA 1NKEA 1ZBLA 4J2DA 3LALA 2KTQA 3ZSYA 1JLCA 3NGIA 3RR8A 5CZ1A 2Z1JA 3AO1A 1J9AA 3C6UA 1Q9XA 1B9FA 1VRTA 3O4QA 3KD1E 3K58A 3CQ8A 3V9SA 1HYVA 1F21A 4O55A 4CFDA 2ITGA 3OYFA 5D3GA 3NE6A 2D0BA 4DS5A 1NJXA 2WOMA 2P5OA 4K8ZA 3VQ9A 3LZIA 3KTQA 4B8AB 4HUFA 4KHSA 1JLAA 4FJHA 3AVIA 1TV6A 4CK1A 3OYHA 3AVFA 4DQIA 4FLYA 4BE2A 4CJ3A 3THVA 1TK0A 3V9XA 3L2VA 4CK3A 3JSMA 1D9FA 4CGIA 2YNIA 4DFMA 3V1OA 5HBMA 3MECA 3VQDA 1RTIA 1Y97A 3ZT0A 3V9UA 1G15A 1A5WA 1FKOA 2IC3A 3OYMA 1EKEA 1GOBA 1IG9A 1LV5A 1R0AA 4DQPA 4E7JA 3NF8A 1J5OA 4F3TA 2HHVA 4DS4A 3RMBA 4R5PA 1S5JA 1WSJA 1NK7A 3TR8A 5CY4A 4H4OA 2E6MA 3I8DA 3AVMA 2XHBA 1SKSA 4I9QA 4HHTA 1L3VA 1DTQA 4KHQA 4E3SA 3QO9A 4DMNA 2VG6A 4PA1A 2XO7A 1RT6A 3DLHA 2OPRA 4L8RB 4Z4EA 3AVKA 3IAYA 3K5OA 2XY5A 1S6QA 4YFUA 4K8XA 1UA0A 4CHYA 1HMVA 3LWMA 5I3UA 4DSKA 4KHUA 4LSLA 2ZE2A 4LH4A 4E19A 4F4KA 4GW6A 4CJPA 2HW3A 3ZT1A 2FBYA 1REVA 3NF9A 4OKKA 3TARA 1X9MA 1ITGA 4ID1A 3IG1A 5KGXA 2DFEA 3DLKA 3M8PA 3DYAA 3TANA 3SUQA 2F96A 3AA3A 4Z4CA 3EY1A 4WE1A 3K5MA 1VSDA 5HRNA 4CF2A 4N76A 1YTAA 1U48A 3M8QA 3ZSRA 2KFZA 3H08A 3HT3A 3LPTA 3OY9A 4ELTA 3IS9A 4CEAA 1T05A 3O4NA 4HCBA 1RDBA 4CHZA 1RTJA 3NFAA 3S3MA 4DSJA 4CHQA 1KRPA 2OA8A 4CE9A 2RN2A 3VQ5A 4ELUA 4FLXA 4BE1A 3OYLA 1X9WA 1SKRA 2XY7A 1U45A 4BWJA 1HRHA 1HPZA 3SQ4A 5C25A 1WNSA 3SQ2A 1L5UA 3LAKA 4FM0A 4B9TA 3HVRA 5I42A 3VQQA 5CYQA 4HUGA 3VQ6A 4DTOA 3ZSZA 1BISA 2Y1JA 4FZXC 4F2SA 4E1NA 2ATQA 1HNIA 2B4JA 3OJUA 4FJ7A 2YHBA 2HNYA 3LANA 1KVBA 3C95A 5KRSA 4ZTJA 4RW8A 4C8MA 2OYQA 3MXJA 1QE1A 3WNGA 4FM2A 1IO2A 1BI4A 1U04A 3DLRA 2ETJA 4CGHA 1NOYA 2RF2A 4N5SA 1TAUA 3T19A 1X1PA 4FYDA 3OYNA 2F8TA 4EP4A 5FDLA 3DLGA 4AHSA 3OYAA 1WSHA 3NBPA 3K5LA 3L2QA 3FFIA 4CEDA 1I3AA 1VK0A 4M3RA 4HVJA 4KB0A 2OZSA 3ZSXA 4CGDA 1RBSA 1RT7A 5KGWA 1BL3A 1CXUA 4EP5A 2OPPA 4OGCA 4CF0A 5KTQA 1QQCA 1HQUA 4DTJA 4FZZA 4CF8A 1C0UA 3QEPA 4AILC 3NHGA 4OPJA 4M3ZA 3O3HA 3OJSA 5J2QA 4IBNA 4CIFA 4DSLA 4FVMA 3VQEA 3DRSA 3QNNA 4LY7A 4CJFA 1TKDA 1XC9A 1WAJA 4PY5A 1JXEA 3E01A 1KFSA 4YNQA 1TAQA 5KI6A 2G8HA 1TKTA 3IRXA 3M8SA 4C8LA 4DLEA 1O1WA 4DTNA 4HTUA 3VN5A 5J2PA 3LAMA 4OLBA 4CFAA 4MQ3A 4CJLA 3WNHA 5T7BA 4DTXA 1WSEA 4B9UA 2VG5A 4CHOA 2PYLA 4B9MA 3AO5A 1HYSA 1VSJA 2GV9A 4QAGA 4DTMA 3RR7A 5EU7A 3TAGA 5HLFA 1TK8A 5HP1A 4DU3A 3NGYA 1TL1A 1CXQA 5J1EA 1X9SA 2X6SA 4CEFA 1NK8A 1XHZA 2DTUA 2D5RA 4B9SA 3ZSQA 1MU2A 1NK6A 3TAPA 3SI6A 4ZTFA 1ZYQA 1JL2A 4QOZB 1SUQA 1RDAA 1VSIA 2IGIA 4KO0A 4CJEA 4DSIA 4KAZA 4J2EA 3F9KA 4B08A 5J2NA 1U47A 1WSFA 4J2BA 3MEDA 4GVMA 1VSFA 2YKNA 4CFBA 3F73A 3SZ2A 1JKHA 3CG7A 4FK0A 1LAVA 1W0HA 3AV9A 3A2FA 3ZT4A 4NYFA 4OKEA 4I9LA 4LD0A 3SCXA 4N56A 3SPYA 3LP2A 4KRFA 4MFBA 4BDPA 4IG3A 1A5XA 3QERA 4AH9A 4Z4IA 4AHVA 1NJWA 2HVHA 2BDPA 4FJ5A 1U4BA 4CEEA 2A1SA 3DOKA 2A1RA 1DTTA 2VWKA 2KW4A 1BGXT 3HSTB 4CJ4A 3AVNA 2HNZA 3AO4A 3ITHA 2I5JA 4DSEA 1XI1A 4OVLA 3LPUA 4BWMA 1BQNA 3RMCA 1RT2A 2Z1GA 2DFHA 1LW2A 3LZJA 4DG1A 5K14A 3DM2A 4BDYA 4I7FA 3SYZA 3TAFA 3KD5E 1S6PA 4H4MA 3SQ0A 3SV4A 3SPZA 1WSGA 1U49A 2HHSA 3AO2A 1BHLA 1Q8IA 3U3YA 2RKIA 3AVGA 1B9DA 3NH2A 3ULDA 4PWDA 3SUPA 1L3SA 1ASWA 3OS1A 1KVCA 3SNNA 1D8YA 3KK2A 1C1AA 3OYGA 5CYMA 1TK5A 1KLNA 3NGZA 4CFCA 3MXIA 2FBXA 2HNDA 3QLHA 1UOCA 3V4IA 1EX4A 4N41A 1IKYA 3T1AA 1FK9A 3PX0A 2YNGA 4FW1A 1IH7A 1BCOA 4CERA 3TABA 3KLHA 4XIUA 4BDZA 1UWBA 4JLHA 2HHQA 1SKWA 1VRUA 3VQBA 3QETA 1C0MA 1JLQA 2G8KA 3HYFA 1QTMA 5HRRA 1TVRA 4RW9A 4CJ5A 3TI0A 4EZ6A 1YTUA 4DF4A 1NKCA 3PV8A 2PYJA 4CJVA 2YV0X 3VQ8A 4KB1A 2KFNA 1WAFA 4OJRA 4DF8A 2OZMA 1GOCA 3ZSVA 2YNHA 4F2RA 3NH1A 1RT4A 1ZBIA 3KKRA 2XRIA 4NYNA 4Z0UA 3D0PA 1CLQA 4E7HA 3PO4A 4F8RA 1J54A 3EYZA 4E7IA 1YT3A 1JXBA 1C0TA 2LSNA 1FKPA 5JS1A 4ICLA 2Y1IA
chains in the Genus database with same CATH superfamily
4H8KA 4BR9A 4FLUA 1VQ9N 2F4VK 3VQ7A 1WB9A 4KHYA 2GUPA 2UUBK 5C12A 1ZBHA 1QZ5A 2O4GA 1NNEA 3O9SA 5C2DA 5GIOA 5HRSA 3TSPA 2FBVA 3DLLL 3AO3A 3U6FA 1FW6A 3CCEN 5FPDA 3HP6A 5BPNA 4QS9A 3FZFA 4DTRA 5FRNA 5FRMA 4KKOA 1RTHA 1D9DA 4CZKA 4FOIA 2X6NA 4BRFA 4CEBA 2NLXA 4CGFA 1S72N 2FLOA 4V19S 5AZJB 4FWRA 2QTDA 4M3WA 3DMJA 3KLFA 4FLWA 1RBTA 5JS2A 2WBNA 3NMUA 3TAEA 1EO1A 3MN9A 3QBXA 2P5GA 2DY4A 4CI6A 3JYTA 3CJ1A 2W42A 3AVCA 3AVLA 1V4SA 4BC2A 3DLEA 1BIUA 4KV8A 3VEVA 1KAXA 3O3GA 3HPGA 3OYCA 4CD1A 1ASUA 2G8UA 2D0CA 4KHPK 1RT3A 4YOTA 1ZBSA 2X78A 4AHRA 1K9MO 4CJKA 3V6DA 2NZTA 5GADP 4G9ZA 2B5JA 2WONA 3P1GA 1NMDA 1IKXA 4IJNA 3TU5A 4NCGA 3L3VA 3A5MC 3TAMA 4ELVA 4LFCK 3AVJA 3CCLN 1LWEA 5BR9A 4LSNA 5E41A 3VEWA 4JI0K 3ZEUB 5C42A 4O44A 3C7NA 4DKWA 2JLEA 4AHUA 3VA0A 3D2EA 1RILA 3DOLA 4FJXA 3BZKA 2QWNA 2QKBA 1TKXA 2QWPA 4IDHA 5KPTA 4EZ9A 2E88A 3MN6A 4IXCA 5AR0A 3WNFA 2HBLA 3L3UA 4O4GA 4CCHA 4K42A 2YNFA 3WXMB 5KRTA 3PO5A 4A61A 1TKZA 3AA4A 1C1BA 4GV6A 4RW4A 4XH5A 1HKGA 2HMPA 4W5OA 3S3NA 4YOXA 4FLTA 1TGOA 3NVKA 2IIRA 3HPHA 4FJLA 3HOTA 3UIQA 4M42A 3S41A 1SL1A 2VGNA 1CZBA 3K2PA 1QHAA 3TTDA 3G10A 4UQGA 3QNOA 4E0DA 1V4TA 2HHUA 5KPRA 3C65A 2HVIA 1FXXA 3RMDA 2Q0RA 5FROA 3MMVA 5EY4A 4RG8A 3J8AA 2YI1A 2GTDA 1DKGD 4BR0A 4JHDB 3V81A 2GELA 3JAMO 1T7PA 4FO0A 4C23A 1X3NA 3SUNA 2D1KA 2Z1HA 1HYZA 2I7PA 3CJAA 3G4SN 1GLJO 4KFBA 3T69A 1GOAA 4GKKK 3LP0A 3CCMN 2YHXA 1NGBA 4CGGA 3VOVA 4DR5K 3L4QA 4CEQA 2KZZA 3TTFA 3SAHA 3A0IX 2YJEA 4FJGA 4X62K 1RNHA 4M41A 3I0SA 4XEIA 3VF4A 2JGUA 2P9KA 2E4LA 3LALA 3ENBA 3TSQA 3RR8A 1ZXOA 1NGDA 2Z1JA 3DWLA 3AO1A 1J9AA 3J81O 3W0LA 3K58A 4O55A 4CFDA 2D0BA 2P5OA 3E66A 3QMLA 3KTQA 4IWVA 3CC2N 3AVIA 4CK1A 3C7NB 3ENOA 4FLYA 4DQ8A 3DXMB 4CGIA 2V7YA 1A5WA 1FKOA 2W6LA 1IG9A 1LV5A 5BPMA 3RMBA 1NK7A 3WXIA 3MN5A 5CY4A 3CCUN 3I8DA 1DEJA 4I9QA 1NG9A 5JICA 1ILYA 4E3SA 1C0FA 4PA1A 4DMNA 4Z4EA 2OPRA 3AVKA 5BPLA 2XY5A 1HMVA 3LWMA 4DSKA 4CZIA 4DHYA 4FPBA 5AFUA 5AQWA 3SK3A 4NO7A 1ITGA 3TARA 4ID1A 1X9MA 1YVNA 3AARA 5M1KA 2FSNA 5MLCQ 3K5MA 3FLCO 4FOEA 3OY9A 1OKJA 4ELTA 4CBUA 3O4NA 3P38A 4H5RA 3NFAA 4CHQA 1OVQA 2EWSA 4FLXA 4PHTX 4B3MK 1X9WA 4CZHA 1SKRA 5AZIA 3WQUA 1RGIA 3QB0A 4K43A 1S22A 4K41A 1YHQN 3LAKA 1L5UA 1VQON 4FPAA 4HUGA 4ISGA 3VQ6A 5B8HA 1HJOA 1BISA 5AFUH 3WEEA 4F2SA 4E1NA 4DR3K 4JK9A 2HNYA 4CZEA 2OYQA 5KRSA 4RW8A 4C8MA 5AQNA 1QE1A 3GL1A 1IO2A 4GVEA 4CGHA 1VQ8N 1TAUA 4N5SA 3T19A 1BOTO 2O8EB 4FYDA 3OYNA 1WSHA 3NBPA 4KB0A 1I3AA 5KQDA 3WXJA 2OZSA 4CGDA 3RVCA 5KGWA 5HL7L 2P9PB 4CF0A 5KTQA 1QQCA 1HQUA 3E9PA 4DTJA 1RDWX 3NHGA 4ILGB 4M3ZA 3OJSA 3H46O 4YHHK 3J7ZO 3PIOL 4DLEA 1O1WA 3VGLA 4LFBK 2ASPA 3WNHA 4DTXA 3WT0A 4B9UA 2VG5A 3AO5A 4LF8K 1VSJA 4QAGA 4QS8A 1TK8A 3NGYA 1CXQA 1X9SA 2X6SA 2D5RA 4JKGB 3SI6A 1JL2A 4QOZB 1VSIA 1RDAA 2BH1A 4CJEA 4KAZA 3F9KA 4B08A 2QWMA 5J2NA 4KI4A 4O8KA 4CFBA 3AV9A 3ZT4A 4I9LA 4N56A 3LP2A 1S3XA 4MFBA 4BRGA 1A5XA 3H1VX 2CGKA 4Z4IA 2BDPA 3VGKA 4IEEA 1OH7A 3HI0A 4CEEA 2A1SA 3DOKA 4BRKA 1DTTA 3CXCM 2HNZA 1XI1A 3ITHA 2I5JA 1BQNA 2GWKA 3LZJA 1NGIA 2HOEA 4BDYA 2O8BB 3E9OA 3KD5E 1OVYA 1S6PA 4YORA 3MCPA 4CBXA 4GNIA 3I56N 3U3YA 2HHTA 4ILJA 1D8YA 4BR5A 1HKBA 3SAGA 3KK2A 1YITN 3ID6A 1WBDA 1KLNA 1Q18A 1NGFA 4CFCA 3NGZA 3MXIA 2VWBA 3QLHA 1BCOA 3M3ZA 4BC5A 2HHQA 1VRUA 3VF2A 3HYFA 1QTMA 4CJ5A 4RW9A 3TI0A 3UE5A 5I9EB 3EKUA 3PV8A 3VQ8A 4KB1A 1MA9B 1GOCA 2YNHA 4I6MB 2O8CB 4XH4A 1IBKK 1RT4A 4NYNA 3D0PA 4E7HA 4E7IA 1YT3A 5JS1A 1C0TA 5ADXA 3D2FA 2IOCA 4F3OA 5DM6L 1TL3A 3KK3A 2XY8A 1J53A 3L2WA 2E20A 3PY8A 3VEYA 4HUEA 3NAEA 4PUOA 3A5NC 4AQYK 4IFVA 3S3OA 3SQ1A 3FE1A 3ENHA 1VQMN 4B9VA 4IFYA 4FJJA 2EHGA 3DXKB 3CM5A 5C24A 4E7KA 2ZGZA 2VG7A 3U4LA 3B6OA 3S9HA 3K9KA 4DQQA 4O5FA 3UKUB 1KTQA 3TWHA 1QHTA 3QESA 1RT5A 4CD3A 2IS3A 4OKJA 5ADXH 4BRMA 3IMXA 4FWMA 4FWSA 4B9LA 3KZBA 4PQUA 2ZJPL 4Q5VA 3CD6N 3K0SA 5DMRA 5ELZA 2E6LA 1QSLA 4W5TA 1D4XA 1SZ2A 3AA2A 3MEGA 3CCQN 3SUOA 1ZBUA 1SQKA 2UYTA 4IFEA 1NGHA 3J7AP 2UU9K 3THYB 3C6TA 4OGEA 2KLAA 3ZX3A 3A5LC 1VQ7N 4A5BA 4DTSA 3LDLA 1N34K 5DK5A 3LDSA 1HJRA 3ZSWA 3BGRA 3ZETB 5TKWA 1UA1A 1B92A 3FZKA 4B1WB 5JLHA 3VA3A 1KQSM 4Z4GA 2KZMA 3ZT3A 3H3NO 4E89A 4MLHA 4JRPA 4KI6A 3FFKB 4NB4A 4CJ7A 3O9TA 2HMIA 4DU1A 3EKSA 4JYAK 4KTZA 1RDUA 4G1QA 2HBKA 4FCYA 1CZAN 4IOAL 3HVTA 3M8RA 4MDBA 4DLGA 1TYQA 3NF7A 4FK2A 2XY6A 4JI7K 5FLXO 2WC9A 2Q3SA 2G8WA 4B9QA 4ISEA 3V1RA 3R8EA 1BA0A 4H03B 1BDGA 3HSCA 3KJVA 3G0ZA 3BY5A 2P9LA 3SV3A 3WXLA 3C94A 3TTCA 3RTVA 4H5TA 2DFFA 2YX6A 2ZD1A 4A62A 1VSHA 2VQEK 3NCIA 3LWLA 4BY9C 3AVAA 1JLBA 4CJTA 3I0RA 5AQJA 1GLLO 1S1UA 1SL0A 4B1YB 4M3XA 2VGMA 3T3FA 1NKBA 3THXB 3CFPA 3L6QA 3P5JA 2KQ2A 3K57A 3QIOA 4EHTA 3G71N 3A5OC 4O0IA 4IO8A 5M1NA 1C6VA 3O8MA 1RBVA 4PL7A 2GBZA 2ZWHA 2BUPA 1KXPA 4IO9L 1LCUA 2R7YA 1HNVA 4CESA 4LF7K 4CJWA 4FL9A 4FWKA 4KHWA 3NVMA 4E7LA 1RBUA 4HCCA 1C0GA 3MAQA 1EQYA 2OPQA 4KTQA 1JLFA 1JLGA 5HROA 1QVGM 5AQXA 1K6YA 1XC3A 4CK2A 4N47A 5LJWA 4FWOA 3HOSA 2FSJA 5AQRA 4ID5A 3KHYA 3HK2A 3PSIA 3GDQA 4DV6K 1S1VA 5BR8K 4YOVA 2Z1IA 3LP1A 3VETA 1KCFA 5SZTA 4X64K 1KLMA 4BR2A 2VCPA 4YOYA 1RCHA 5C10A 2F9WA 5AQKA 3OYJA 3RRGA 1Q86O 4DSFA 2NUBA 4IKFA 4QCLA 4CHNA 4B3OA 2OANA 3U9ZA 3WUHA 3UKRB 3R3LA 1YF5L 4DFPA 1WUAA 4B1UB 1YJWN 5FPEA 3OW2M 4BRHA 4DQRA 2PY5A 3BF1A 3BDPA 5CE3A 1IBMK 2YHAA 4WQ4A 1NKEA 4J2DA 4JD2A 3ZSYA 4H0VB 3EE9A 1YUWA 3C6UA 1Q9XA 1B9FA 3CQ8A 4DV0K 5D3GA 3NE6A 1NJXA 4DS5A 3VQ9A 4IZ9A 3LZIA 1JLAA 3CF5L 1TV6A 1ZC6A 1K8KA 2D0PA 4DQIA 3H1QA 3EZWA 3L2VA 2P9LB 1D9FA 3VEOA 3V1OA 4KH6A 5HBMA 3ZT0A 2W6KA 4BQZA 3O08A 3OYMA 5GIPA 1EKEA 2A41A 2E2OA 4WFAL 1OH6A 2HHVA 3MWTA 3TPQA 3O4WA 3TSUA 3LDOA 1SKSA 2V51B 2YHYA 3QO9A 3DLHA 1RT6A 3IAYA 3I8BA 1Q7YO 1XQSC 2HW3A 4A59A 3GOIA 1N32K 3T7ZA 5KGXA 2OTJN 1U2VA 3M8PA 3RSEA 2ASMA 2IVOA 3EL2A 3EY1A 4H0TB 1U48A 3M8QA 3LDQA 3VF6A 3EE8A 1JCGA 4CEAA 1T05A 1RDBA 1J6ZA 2RN2A 3VQ5A 1VHXA 3OYLA 4WF9L 4FVUA 1U45A 4BWJA 1HPZA 1WNSA 3SQ2A 3THWA 5FPNA 4FM0A 3HVRA 4DTOA 1T6DA 5LY3A 3AGRA 5C2FA 2YJFA 3OJUA 4FJ7A 2YHBA 2J4RA 2P9UA 3ID8A 3LANA 4ZTJA 3DLRA 3R6MA 3O9RA 5FDLA 3DLGA 4NLCA 3FFIA 4CEDA 4FWQA 3ZSXA 1IV0A 4J8FA 1ATNA 1BG3A 4CZJA 2ITMA 4CIFA 5AQIA 3N4PA 4FVMA 4WYBA 3CC7N 3QNNA 4LY7A 4CJFA 5AQFA 4JK7A 4PY5A 1JXEA 4YNQA 3M8SA 4H5NA 2NRHA 2GX9A 4MQ3A 5T7BA 1XNQK 2O8DA 1WSEA 2CGLA 2GV9A 4DTMA 1YJ9N 1Q81O 4ILHA 4DU3A 1TL1A 4LF4K 2UXCK 1MWMA 1NK8A 2DTUA 4KH4A 3TAPA 4ZTFA 2IGIA 4DSIA 2YCHA 4J2EA 1BO5O 2A6AA 1FJGK 1HUXA 3SZ2A 1W97L 5AQVA 4NYFA 4OKEA 3SPYA 1OH5A 3IKMA 1GLFO 4BDPA 3D2EB 4IG3A 3QERA 2BTFA 3AAQA 4MO4A 1BGXT 1XNRK 4KRFA 4DSEA 5GAGP 3G25A 4JKDA 4LFAK 5K14A 1OH8A 5AQLA 1U2VB 4I7FA 3SYZA 1DGKN 1T6CA 4O8UA 5C15A 3SPZA 5EOYA 4LC9B 4BRPA 2HHSA 2HF4A 1J5EK 2RKIA 3NH2A 1Q82O 1L3SA 3SNNA 3OS1A 1KVCA 3OYGA 2NRXA 3CHWA 3V4IA 4N41A 1IKYA 1IH7A 4CERA 3TABA 4XIUA 2G8KA 1JLQA 4MO5A 1TVRA 4EZ6A 4IOXA 1YTUA 4DF4A 1NKCA 2QEXN 2PYJA 4CJVA 2YV0X 1WAFA 4OJRA 1I94K 1E3MA 1HLUA 3LDPA 4F2RA 1TUUA 1J54A 3EYZA 3ULEA 3T1HK 1NGEA 1FKPA 4EAHD 3O3FA 2Y1IA 4B8CA 4LF9K 3JXUA 1M1KO 4RW7A 3VGMA 4Z94A 4FJ8A 2E1ZA 1Z26A 3GG4A 2P9SA 4O5BA 2O8FA 2HHWA 3QINA 4AM7A 2Q1NA 4DV1K 4KTWA 2D0OA 3CJBA 2V7ZA 1EWQA 3ZX0A 5AQZA 3L8BA 3C0BA 4OLAA 1NBWA 5TKYA 2E5LK 3SJJA 2OCEA 4GV3A 2O8DB 1X3MA 1VSEA 2RHKA 4DUYK 4JKHA 1X9JA 2P9KB 2F7TA 2HB5A 3UB5A 2A42A 3FZHA 1QS4A 3HL8A 1HX1A 1RBRA 1YVUA 4KBOA 4Y0WA 3ZSOA 1UAXA 2NRRA 4AHCA 4FJMA 5SWMA 4KREA 2PBDA 3A8YA 3P39A 2BGGA 4U7BA 3QICA 3BF3A 4DV5K 4FLZA 3K9JA 4BGAA 3HPOA 1N6QA 2YKMA 1BU6O 3CETA 1A5VA 1WN7A 4ISFA 3OS2A 4BRCA 1D5AA 2HSTA 4Y1CA 4NXNK 4FW2A 5CZ2A 3CM6A 4CVNE 3VQAA 2IDOA 3HM9A 3PUFA 1NGCA 2FBTA 2GWJA 4IDKA 2PAVA 4PKIA 4CF1A 5KPZA 3KK1A 4NCBA 1BIZA 5J2MA 1WBBA 4CZGA 5M1PA 4UY8O 4GY2B 1EXQA 3B6PA 2JWLA 2CH6A 3HM8A 3OYEA 3Q7CA 3RMAA 1NGJA 1WOQA 1QQNA 4H0YB 3O6WA 3CPWM 2VYPA 5HOOA 2P9IA 3NH0A 1S1TA 1S9GA 1WSIA 1JLEA 3HO1A 2FF6A 4WFBL 3CJ9A 4DQSA 5AZIB 1T8EA 4JK8A 3HTVA 3LM9A 3QEVA 1NOZA 3E9LA 4WQ4C 4CEZA 3KIOA 3WEEB 1KVAA 2P9NA 5F2RA 1QSYA 3VPZA 2WFBA 2KHOA 4OPKA 3ISNC 1ATRA 1XWLA 2BE2A 2D0AA 5AQGA 5HRPA 4YY3K 4I2QA 4AF1A 1P90A 3R1XA 1EETA 3MXMA 2PZSA 4CJQA 4HWIA 1ATSA 3IDHA 4W5RA 2HHXA 2ASOA 2I7NA 2Q31A 1IKWA 3MK6A 3DJCA 3SLCA 1ESVA 4B9NA 1RDDA 4J2AA 3QEIA 2E2NA 1IKVA 3DAWA 1QSSA 4BR4A 1ZBFA 3AVBA 4M3UA 3CCVN 4DFJA 1QQMA 4AHTA 5GAEP 1VSMA 4LF6K 4CZMA 2GUIA 1RT1A 3EN9A 4LH5A 3J7YP 3ZCMA 1Z6RA 1T3VA 4MDAA 2W41A 3CMAN 4JI5K 3CYMA 3V9ZA 4M3YA 5M1FA 3CI5A 3OYDA 2O4IA 3DRPA 4GMJB 2Q2RA 2ZQBA 3CJ7A 4YDUC 4CEOA 3K5NA 1KFDA 1YI2N 4I2PA 4KPYA 4B1XB 1H1VA 5JVHL 2H3GX 4DFKA 3AAPA 3O80A 4CECA 3QEWA 1ASVA 1W9HA 5IWAK 4FLVA 1LWCA 3C6HA 3MDQA 3ASMA 1NJYA 1VQLN 3EO3A 1Y64A 3FR0A 4DTPA 3L0QA 4E1MA 3HXMA 3QDKA 3V9WA 5AZJA 1NK5A 3KLEA 3KWGA 2UUCK 5C0YA 3O4QA 2QWQA 3KD1E 2ZJRL 4K8ZA 4RCHA 2CH5A 4HUFA 4OPHA 4FJHA 3EEQA 4BREA 5AQMA 3AVFA 4BE2A 4CJ3A 3THVA 3V9XA 4CK3A 2YNIA 4DFMA 3VQDA 1RTIA 3B8AX 1G15A 3OBYA 5EX5A 4DQPA 3O1BA 4E7JA 3D7EO 4F3TA 4H4OA 2E6MA 3KVGA 3QFPA 3AVMA 5F0XA 2Q97A 4KHQA 3D2FB 4L8RB 2XO7A 2G8IA 3BEXA 2AA4A 1E4FT 3K5OA 1S6QA 3ZLJA 4K8XA 4KHUA 4CHYA 5I3UA 5LL6Z 3OBWA 4A57A 4JNEA 4B1ZA 1NJIO 4CJPA 2FBYA 2FF3B 3IG1A 3R9PA 2DFEA 1W7AA 2FXUA 3DLKA 4BRNA 1SS6A 3SUQA 2F96A 3AA3A 4Z4CA 5F1XA 3O9QA 5HRNA 4CF2A 4N76A 1YTAA 3LDNA 4XH1A 3ZSRA 2KFZA 2RE2A 1EWRA 3ZEUA 5GINA 3IS9A 3KK7A 4B3TK 4BQLA 4CHZA 3S3MA 1KRPA 2OA8A 4CE9A 4ELUA 4BE1A 3IFRA 2XY7A 1GLCG 1JCEA 1G99A 2JWKA 5M1QA 1HNWK 5I42A 3VQQA 4FWNA 5CYQA 3ZSZA 2Y1JA 4YOWA 3MN7A 2IVNA 1HNIA 2B4JA 5JMVA 4BG8A 1KVBA 3HZ6A 3WNGA 4FM2A 1BI4A 4CZFA 2RF2A 4H0OA 4BROA 3GBTA 2QA4N 1VQPN 4AHSA 4FWPA 3OYAA 2F9TA 5BN8A 1VK0A 3F5TA 4M3RA 4HVJA 1N33K 3SMPA 1IJJA 4IJAA 1BL3A 4BRIA 3ATVA 1C0UA 3QEPA 3CCRN 4OPJA 5AQQA 3O3HA 5J2QA 4IBNA 5JVGL 4IOCL 4DSLA 3KWIA 5LMUK 1TKDA 1WAJA 2G8HA 1TKTA 4C8LA 2V52B 4DTNA 2E8AA 4C1NK 5J2PA 4OLBA 3LAMA 4CJLA 1HYSA 2PYLA 4U67L 3RR7A 5EU7A 3TAGA 5HP1A 3LL3A 1XHZA 4JHDA 3SBGA 4B9SA 4JI4K 3OTOK 1TYQB 4DV4K 2OTLN 2GEMA 4J2BA 1U47A 4FJ9A 5E26A 4GVMA 3F73A 1VSFA 4FK0A 4BRLA 1LAVA 1W0HA 3A2FA 4F9OA 1RFQA 2HVHA 4AHVA 1NJWA 1U4BA 2NRZA 2A1RA 2KW4A 3HSTB 4CJ4A 3AVNA 4OVLA 3LPUA 1YAGA 4RWTA 3PSFA 4BWMA 4L3QA 3RMCA 1IBLK 4A2BA 1N8RO 4DG1A 4BGBA 3DM2A 3FZLA 2KKZA 3TAFA 4JI3K 5LJVA 1GLDG 1Q8IA 1B9DA 3ULDA 4DR2K 3JS6A 1TK5A 3D6RA 2FBXA 1UOCA 3T1AA 1FK9A 2QWRA 4FW1A 3KLHA 1UWBA 1SKWA 2A5XA 3DXMA 2W40A 5BN9A 1MWKA 5HRRA 3P4IA 4AM6A 2WTUA 4DV2K 3CCSN 3CC4N 2KFNA 2OZMA 4YDUA 2XRIA 5H1SQ 4Z0UA 4BVPA 3W3DA 1CLQA 4F8RA 1HKCA 1JXBA 2LSNA 4RW6A 3AGKA 1BI4B 4FJIA 5EVZA 4M7XA 3VESA 3I55N 4FXDA 3U8XA 4HTLA 1RTDA 3VEXA 3OYKA 4Q0BA 4FWLA 5IT9O 1C1CA 1VQ4N 3HJFA 2HBJA 3F2KA 1N36K 1SL2A 3K59A 1LW0A 4DV3K 3L4IA 4CJRA 5JLFA 1JJ2M 1LOTB 1BCMA 3PX4A 3J80O 1VQNN 1QZ6A 4W5NA 2E2PA 4E1JA 4CGJA 3TAQA 2E2QA 3DRRA 4PKGA 3CCJN 1XHXA 1SV5A 1YIJN 2NNWA 3ALYA 3PX6A 3QIPA 1IG8A 2IVPA 3KKSA 3RWUA 3CFOA 3OYBA 3FGUA 4BC3A 2QK9A 3I33A 3OVNA 4CW7B 2QM1A 3M1FA 4JD2B 1S1XA 3F9MA 4JI1K 1Z25A 2E1YA 3ZX2A 5AQSA 3LP3A 3QEXA 1VSLA 3AY9A 3G6EN 1QQOA 4TSXA 2ZGYA 1K8KB 3HRGA 2EX3A 4JKCA 5BRFA 3L2UA 1VSKA 4FJKA 2O8EA 3MEEA 3IUCA 4C8NA 5CHIA 4FM1A 4B1VA 4EIAA 1MDUB 4M3TA 1S9EA 4A5AA 2ZJQL 2P9PA 4H5VA 4M7YA 1T03A 2P51A 2AP1A 3CPEA 1NK9A 1JL1A 2F8SA 1BUPA 5KQ8A 1QVFM 1L3TA 2AJQA 1LAWA 4JS4A 1S1WA 1NMNA 1Z05A 2G8VA 1CZ9A 1KD1O 3KLIA 1KC8O 2UXDK 3RSEB 1DLOA 1RDCA 2A3ZA 4CIEA 3VTHA 2NRVA 3OS0A 4JKGA 3PIPL 5BRDA 4C8KA 5AQHA 3M5RA 2YHWA 3VQPA 3D45A 1Q9YA 3SBTA 1YJNN 3P83D 3BUZB 3DI6A 4CJSA 1GLBG 2QWLA 3NF6A 4C8OA 3QBWA 1KSPA 2ZF5O 1LWFA 3THWB 4H0XB 4B3RK 4NCAA 4WQ5C 1BA1A 1VQKN 5AJ3K 4FJNA 2VWJA 2G8FA 4BRAA 4H5WA 2A40A 1VQ5N 4CHPA 3OA9A 2O8BA 2P9UB 4K0KK 4BACA 4JKEA 1L3UA 4OX9K 5AQPA 4BR7A 1NK0A 1YXQA 4DWIA 3PLAA 4FK4A 4M45A 4JRQA 3FZMA 3VQ4A 1T44A 4RTFD 4IG0A 2IAJA 4JKFA 5AQOA 4JS5A 2BANA 3CMEN 3AVHA 4W5QA 1W2BM 4MLEA 3CIPA 2QXFA 4I6MA 2O8CA 4CJUA 1N5YA 4JI6K 4BE0A 1SAZA 5AQUA 3ZYYX 4QS7A 3U3GA 3SMSA 2HHHK 4GV9A 4JN4A 4FSVA 3VQCA 4KHNA 2X74A 3H45C 3VMFB 4DR7K 4Z4HA 3RRHA 2B6AA 3DLBA 3KLGA 2FC0A 4Y1DA 2P1JA 3AA5X 2OPSA 4NXMK 3N4QA 1WLJA 4DB3A 4Z4FA 2PFUA 3HP9A 4EHUA 3NDKA 3CERA 1HR0K 3ZT2A 4DTUA 2UUAK 2QKKA 4A2AA 1I39A 2WUSA 4NLBA 3SJHA 4DU4A 3DXKA 3WNEA 3CFRA 1JCFA 4ZHRA 1EP4A 3O1WA 1BQMA 2QI2A 3HBTA 4B3SK 4CF9A 5AQTA 3H3OB 3C6AA 4OPAA 5GAHP 1NK4A 4CIGA 4GKJK 3UKUA 3V1QA 1E4GT 4BVOA 4O0JA 3L2RA 4BRDA 1NJZA 1HQEA 3LM2A 1NGGA 4KH5A 1K73O 4FZYA 3EZ5A 3OYIA 4LF5K 5E84A 2RPIA 4BG9A 2KTQA 1ZBLA 3OHRA 3NGIA 1JLCA 5CZ1A 3GE1A 1VRTA 3V9SA 1P8ZA 1HYVA 1F21A 1R59O 2ITGA 3OYFA 2WOMA 4M63C 4B8AB 4KHSA 1NU0A 2Q36A 3WXKA 3OYHA 1DT9A 1TK0A 3P31A 3JSMA 2NRWA 4DR6K 2VQFK 3MECA 3V9UA 1Y97A 1GLEG 2IC3A 3QFUA 3THYA 1GOBA 1R0AA 3NF8A 1J5OA 4DS4A 4R5PA 1S5JA 1WSJA 4JKBA 3TR8A 1HNZK 3ULEB 1KAZA 2XHBA 4HHTA 3E1YA 1L3VA 1DTQA 2CGJA 2VG6A 2DPNA 4WFNL 3ZETA 4JEPA 4R79A 4YFUA 4PL8A 1UA0A 4JI8K 1VQ6N 4LSLA 2ZE2A 4LH4A 4E19A 4F4KA 4GW6A 2HF3A 2P9SB 1BWFO 3ZT1A 1REVA 3NF9A 2O8FB 4OKKA 3BZCA 3TANA 3DYAA 4BRQA 4WE1A 4EFHA 1VSDA 4WCEL 3H08A 3HT3A 3LPTA 1HPMA 1XUPO 3U9DA 4HCBA 1O13A 4DV7K 1RTJA 3O9UA 4DSJA 2D4WA 1HRHA 3SQ4A 5C25A 4JI2K 4B9TA 3MCAB 3CQXA 5BREA 4FZXC 2ATQA 1NM1A 4CZLA 3C95A 3M6GA 3THXA 4DR1K 3MXJA 1NOYA 1U04A 2ETJA 3VEZA 1XMQK 1X1PA 2F8TA 4EP4A 1KAYA 3BP8A 3K5LA 3L2QA 1K8AO 1RBSA 1RT7A 2QWOA 1CXUA 4EP5A 2OPPA 4OGCA 1NWKA 4FZZA 4CF8A 4AILC 2FSKA 3T1YK 2UXBK 3VQEA 3DRSA 1HNXK 4IEIA 1XC9A 4X66K 3E01A 1M90O 4JAXA 1KFSA 1TAQA 5KI6A 4DUZK 3IRXA 2Q0UA 4HTUA 3VN5A 4CFAA 2ZM6K 3O5BA 4CHOA 4B9MA 4YOUA 5HLFA 1GLAG 4WQ5A 3H6EA 5J1EA 4CEFA 5DM7L 5BRHA 4CBWA 3ZSQA 1MU2A 1NK6A 1ZYQA 1SUQA 4KO0A 2NRTA 1WSFA 3MEDA 4PKHA 2YKNA 5M1OA 1JKHA 3CG7A 2P9IB 4JKAA 3Q7BA 4X65K 1TUYA 3SCXA 4LD0A 3ATUA 3MX2A 4AH9A 4K25A 5CR4A 3UKRA 4FJ5A 2VWKA 3AO4A 5LMNK 4C1NI 1RT2A 2Z1GA 2DFHA 2P9NB 1LW2A 4DR4K 3SAFA 1VAZA 3VENA 4H4MA 3SQ0A 5EXWA 3SV4A 3CQYA 5AQYA 1WSGA 1U49A 1NLVA 3AO2A 1BHLA 1XMOK 3AVGA 4PWDA 3SUPA 1ASWA 5FPMA 2HBMA 1C1AA 5CYMA 2HNDA 1NGAA 1EX4A 3VTIA 3PX0A 2YNGA 4OO1J 4BDZA 4JLHA 3VQBA 3QETA 1C0MA 4DCHA 3CJCA 3MWPA 5A2QO 4JV5K 3WQTA 4DF8A 4BC4A 2QXLA 3ZSVA 3MX5A 2QW9A 3NH1A 1ZBIA 3KKRA 3VERA 4H0PA 3PO4A 1U6ZA 4ICLA
chains in the Genus database with same CATH topology
4RW6A 4H8KA 4FLUA 2IOCA 4B8CA 1BI4B 4F3OA 4FJIA 1TL3A 3VQ7A 3KK3A 4KHYA 4RW7A 4KI4A 4FXDA 1ZBHA 2XY8A 1J53A 2O4GA 3L2WA 1RTDA 3PY8A 3OYKA 4Q0BA 4FJ8A 1Z26A 1C1CA 4O5BA 3NAEA 4HUEA 2HHWA 3QINA 4PUOA 3HJFA 5HRSA 4IFVA 4KTWA 3SQ1A 3S3OA 1SL2A 3K59A 4B9VA 4IFYA 1LW0A 2FBVA 2EHGA 4FJJA 3AO3A 4CJRA 3U6FA 3CM5A 5C24A 4E7KA 1BCMA 3L8BA 3PX4A 2VG7A 4OLAA 3HP6A 3B6OA 3S9HA 4W5NA 4CGJA 4DQQA 3TAQA 3DRRA 2G8IA 4DTRA 1XHXA 3SJJA 5FRNA 5FRMA 1SV5A 4FJ9A 3ALYA 4KKOA 1KTQA 3QIPA 3TWHA 1RTHA 3PX6A 1D9DA 1QHTA 3QESA 1RT5A 2X6NA 3KKSA 2IS3A 3CFOA 4OKJA 1VSEA 4CEBA 3OYBA 3RWUA 4CGFA 2QK9A 3OVNA 4B9LA 2HB5A 4PQUA 4M3WA 1S1XA 3DMJA 3KLFA 4Q5VA 4FLWA 1Z25A 1RBTA 5JS2A 1QS4A 3HL8A 5DMRA 3LP3A 3QEXA 2E6LA 1RBRA 3TAEA 1QSLA 1VSLA 4W5TA 2P5GA 2DY4A 1YVUA 3ZSOA 1UAXA 4TSXA 4AHCA 3JYTA 3AA2A 2W42A 4FJMA 3AVCA 3AVLA 3MEGA 5SWMA 2EX3A 3L2UA 4KREA 1VSKA 4FJKA 3MEEA 3DLEA 3SUOA 1BIUA 4C8NA 2BGGA 1ZBUA 4KV8A 4FLZA 4FM1A 3O3GA 3HPGA 3HPOA 4M3TA 1S9EA 3C6TA 4OGEA 1N6QA 2YKMA 3OYCA 1T03A 1ASUA 2G8UA 2D0CA 2P51A 1RT3A 1A5VA 4DTSA 1WN7A 2X78A 5DK5A 4AHRA 3LDSA 3OS2A 1D5AA 1NK9A 4CJKA 1HJRA 4Y1CA 4FW2A 3BGRA 1JL1A 3CM6A 5CZ2A 3ZSWA 3V6DA 3VQAA 2F8SA 1UA1A 1B92A 2IDOA 1L3TA 3HM9A 3VA3A 2AJQA 2B5JA 3PUFA 1LAWA 2WONA 2FBTA 4IDKA 4CF1A 3P1GA 1IKXA 3KK1A 4JS4A 1S1WA 4NCBA 1BIZA 5J2MA 2G8VA 4Z4GA 2KZMA 1CZ9A 4NCGA 3ZT3A 4E89A 3KLIA 3L3VA 4JRPA 4KI6A 2HMIA 3TAMA 1EXQA 4DU1A 1DLOA 1RDCA 3B6PA 3OYEA 4ELVA 4KTZA 3RMAA 4G1QA 3AVJA 4CIEA 4FCYA 3OS0A 3HVTA 1LWEA 3M8RA 4DLGA 4C8KA 4LSNA 5E41A 3NF7A 4FK2A 3VQPA 3D45A 2XY6A 1Q9YA 2Q3SA 2G8WA 3NH0A 1S1TA 1S9GA 1WSIA 3P83D 3V1RA 3DI6A 4O44A 4CJSA 5C42A 1JLEA 3HO1A 3NF6A 3G0ZA 3KJVA 4C8OA 2JLEA 4AHUA 3VA0A 1RILA 4DQSA 3DOLA 4FJXA 3SV3A 1KSPA 3C94A 1T8EA 2QKBA 3QEVA 1TKXA 3RTVA 2HHTA 2DFFA 2ZD1A 1LWFA 4EZ9A 1VSHA 3NCIA 1NOZA 3LWLA 4NCAA 4CEZA 4FJNA 2VWJA 3AVAA 1JLBA 3WNFA 4CJTA 3I0RA 2G8FA 3L3UA 3KIOA 1S1UA 1SL0A 4O4GA 1KVAA 4CHPA 4CCHA 4M3XA 3T3FA 1NKBA 1QSYA 2YNFA 4BACA 5KRTA 3PO5A 1L3UA 3CFPA 4OPKA 1TKZA 2KQ2A 3AA4A 3P5JA 1C1BA 3ISNC 3K57A 1XWLA 2BE2A 3QIOA 1NK0A 2D0AA 4RW4A 4DWIA 4O0IA 1C6VA 1RBVA 4W5OA 4FK4A 5HRPA 2GBZA 4M45A 4I2QA 4JRQA 3S3NA 3VQ4A 2R7YA 1HNVA 4CESA 4FLTA 1EETA 1TGOA 4CJWA 3MXMA 2PZSA 4IG0A 2IAJA 4KHWA 4E7LA 1RBUA 4CJQA 3HPHA 4FJLA 3UIQA 4W5RA 4JS5A 2HHXA 4HCCA 3MAQA 2BANA 4KTQA 2OPQA 4M42A 1JLFA 3AVHA 1JLGA 4W5QA 5HROA 1SL1A 1IKWA 1CZBA 3K2PA 4B9NA 1RDDA 4J2AA 3QEIA 3G10A 1K6YA 4UQGA 1IKVA 2QXFA 3QNOA 4E0DA 2HHUA 4CJUA 1QSSA 1N5YA 4BE0A 1ZBFA 3AVBA 4M3UA 3U3GA 4CK2A 4N47A 4DFJA 2HVIA 1FXXA 3RMDA 4AHTA 1VSMA 5FROA 2GUIA 1RT1A 3VQCA 4KHNA 2X74A 4ID5A 3HK2A 4LH5A 4RG8A 4Z4HA 3RRHA 3ZCMA 2B6AA 3DLBA 1S1VA 3KLGA 2FC0A 3V81A 4Y1DA 1T7PA 3CYMA 2P1JA 2Z1IA 3AA5X 2OPSA 3V9ZA 4M3YA 3LP1A 3O3FA 1KCFA 5SZTA 1KLMA 1WLJA 3SUNA 4Z4FA 3OYDA 2O4IA 3HP9A 1RCHA 2Z1HA 1HYZA 3NDKA 3ZT2A 4DTUA 4KFBA 2QKKA 3DRPA 1I39A 4GMJB 1GOAA 2ZQBA 3OYJA 4DU4A 3RRGA 4CEOA 3K5NA 4DSFA 1KFDA 2NUBA 3LP0A 3WNEA 3CFRA 4IKFA 4ZHRA 4QCLA 1EP4A 4CHNA 4I2PA 4B3OA 1BQMA 4KPYA 4CF9A 4CGGA 4DFKA 4CEQA 2KZZA 4CECA 3QEWA 1NK4A 4CIGA 1ASVA 1W9HA 4FLVA 4DFPA 1LWCA 1NJYA 3ASMA 3V1QA 4FJGA 4O0JA 4DQRA 3L2RA 1RNHA 1NJZA 2PY5A 4M41A 3BDPA 1HQEA 4DTPA 4E1MA 3I0SA 3HXMA 2YHAA 2JGUA 3V9WA 4FZYA 3EZ5A 3OYIA 1NK5A 3KLEA 2RPIA 2E4LA 1NKEA 1ZBLA 4J2DA 3LALA 2KTQA 3ZSYA 1JLCA 3NGIA 3RR8A 5CZ1A 2Z1JA 3AO1A 1J9AA 3C6UA 1Q9XA 1B9FA 1VRTA 3O4QA 3KD1E 3K58A 3CQ8A 3V9SA 1HYVA 1F21A 4O55A 4CFDA 2ITGA 3OYFA 5D3GA 3NE6A 2D0BA 4DS5A 1NJXA 2WOMA 2P5OA 4K8ZA 3VQ9A 3LZIA 3KTQA 4B8AB 4HUFA 4KHSA 1JLAA 4FJHA 3AVIA 1TV6A 4CK1A 3OYHA 3AVFA 4DQIA 4FLYA 4BE2A 4CJ3A 3THVA 1TK0A 3V9XA 3L2VA 4CK3A 3JSMA 1D9FA 4CGIA 2YNIA 4DFMA 3V1OA 5HBMA 3MECA 3VQDA 1RTIA 1Y97A 3ZT0A 3V9UA 1G15A 1A5WA 1FKOA 2IC3A 3OYMA 1EKEA 1GOBA 1IG9A 1LV5A 1R0AA 4DQPA 4E7JA 3NF8A 1J5OA 4F3TA 2HHVA 4DS4A 3RMBA 4R5PA 1S5JA 1WSJA 1NK7A 3TR8A 5CY4A 4H4OA 2E6MA 3I8DA 3AVMA 2XHBA 1SKSA 4I9QA 4HHTA 1L3VA 1DTQA 4KHQA 4E3SA 3QO9A 4DMNA 2VG6A 4PA1A 2XO7A 1RT6A 3DLHA 2OPRA 4L8RB 4Z4EA 3AVKA 3IAYA 3K5OA 2XY5A 1S6QA 4YFUA 4K8XA 1UA0A 4CHYA 1HMVA 3LWMA 5I3UA 4DSKA 4KHUA 4LSLA 2ZE2A 4LH4A 4E19A 4F4KA 4GW6A 4CJPA 2HW3A 3ZT1A 2FBYA 1REVA 3NF9A 4OKKA 3TARA 1X9MA 1ITGA 4ID1A 3IG1A 5KGXA 2DFEA 3DLKA 3M8PA 3DYAA 3TANA 3SUQA 2F96A 3AA3A 4Z4CA 3EY1A 4WE1A 3K5MA 1VSDA 5HRNA 4CF2A 4N76A 1YTAA 1U48A 3M8QA 3ZSRA 2KFZA 3H08A 3HT3A 3LPTA 3OY9A 4ELTA 3IS9A 4CEAA 1T05A 3O4NA 4HCBA 1RDBA 4CHZA 1RTJA 3NFAA 3S3MA 4DSJA 4CHQA 1KRPA 2OA8A 4CE9A 2RN2A 3VQ5A 4ELUA 4FLXA 4BE1A 3OYLA 1X9WA 1SKRA 2XY7A 1U45A 4BWJA 1HRHA 1HPZA 3SQ4A 5C25A 1WNSA 3SQ2A 1L5UA 3LAKA 4FM0A 4B9TA 3HVRA 5I42A 3VQQA 5CYQA 4HUGA 3VQ6A 4DTOA 3ZSZA 1BISA 2Y1JA 4FZXC 4F2SA 4E1NA 2ATQA 1HNIA 2B4JA 3OJUA 4FJ7A 2YHBA 2HNYA 3LANA 1KVBA 3C95A 5KRSA 4ZTJA 4RW8A 4C8MA 2OYQA 3MXJA 1QE1A 3WNGA 4FM2A 1IO2A 1BI4A 1U04A 3DLRA 2ETJA 4CGHA 1NOYA 2RF2A 4N5SA 1TAUA 3T19A 1X1PA 4FYDA 3OYNA 2F8TA 4EP4A 5FDLA 3DLGA 4AHSA 3OYAA 1WSHA 3NBPA 3K5LA 3L2QA 3FFIA 4CEDA 1I3AA 1VK0A 4M3RA 4HVJA 4KB0A 2OZSA 3ZSXA 4CGDA 1RBSA 1RT7A 5KGWA 1BL3A 1CXUA 4EP5A 2OPPA 4OGCA 4CF0A 5KTQA 1QQCA 1HQUA 4DTJA 4FZZA 4CF8A 1C0UA 3QEPA 4AILC 3NHGA 4OPJA 4M3ZA 3O3HA 3OJSA 5J2QA 4IBNA 4CIFA 4DSLA 4FVMA 3VQEA 3DRSA 3QNNA 4LY7A 4CJFA 1TKDA 1XC9A 1WAJA 4PY5A 1JXEA 3E01A 1KFSA 4YNQA 1TAQA 5KI6A 2G8HA 1TKTA 3IRXA 3M8SA 4C8LA 4DLEA 1O1WA 4DTNA 4HTUA 3VN5A 5J2PA 3LAMA 4OLBA 4CFAA 4MQ3A 4CJLA 3WNHA 5T7BA 4DTXA 1WSEA 4B9UA 2VG5A 4CHOA 2PYLA 4B9MA 3AO5A 1HYSA 1VSJA 2GV9A 4QAGA 4DTMA 3RR7A 5EU7A 3TAGA 5HLFA 1TK8A 5HP1A 4DU3A 3NGYA 1TL1A 1CXQA 5J1EA 1X9SA 2X6SA 4CEFA 1NK8A 1XHZA 2DTUA 2D5RA 4B9SA 3ZSQA 1MU2A 1NK6A 3TAPA 3SI6A 4ZTFA 1ZYQA 1JL2A 4QOZB 1SUQA 1RDAA 1VSIA 2IGIA 4KO0A 4CJEA 4DSIA 4KAZA 4J2EA 3F9KA 4B08A 5J2NA 1U47A 1WSFA 4J2BA 3MEDA 4GVMA 1VSFA 2YKNA 4CFBA 3F73A 3SZ2A 1JKHA 3CG7A 4FK0A 1LAVA 1W0HA 3AV9A 3A2FA 3ZT4A 4NYFA 4OKEA 4I9LA 4LD0A 3SCXA 4N56A 3SPYA 3LP2A 4KRFA 4MFBA 4BDPA 4IG3A 1A5XA 3QERA 4AH9A 4Z4IA 4AHVA 1NJWA 2HVHA 2BDPA 4FJ5A 1U4BA 4CEEA 2A1SA 3DOKA 2A1RA 1DTTA 2VWKA 2KW4A 1BGXT 3HSTB 4CJ4A 3AVNA 2HNZA 3AO4A 3ITHA 2I5JA 4DSEA 1XI1A 4OVLA 3LPUA 4BWMA 1BQNA 3RMCA 1RT2A 2Z1GA 2DFHA 1LW2A 3LZJA 4DG1A 5K14A 3DM2A 4BDYA 4I7FA 3SYZA 3TAFA 3KD5E 1S6PA 4H4MA 3SQ0A 3SV4A 3SPZA 1WSGA 1U49A 2HHSA 3AO2A 1BHLA 1Q8IA 3U3YA 2RKIA 3AVGA 1B9DA 3NH2A 3ULDA 4PWDA 3SUPA 1L3SA 1ASWA 3OS1A 1KVCA 3SNNA 1D8YA 3KK2A 1C1AA 3OYGA 5CYMA 1TK5A 1KLNA 3NGZA 4CFCA 3MXIA 2FBXA 2HNDA 3QLHA 1UOCA 3V4IA 1EX4A 4N41A 1IKYA 3T1AA 1FK9A 3PX0A 2YNGA 4FW1A 1IH7A 1BCOA 4CERA 3TABA 3KLHA 4XIUA 4BDZA 1UWBA 4JLHA 2HHQA 1SKWA 1VRUA 3VQBA 3QETA 1C0MA 1JLQA 2G8KA 3HYFA 1QTMA 5HRRA 1TVRA 4RW9A 4CJ5A 3TI0A 4EZ6A 1YTUA 4DF4A 1NKCA 3PV8A 2PYJA 4CJVA 2YV0X 3VQ8A 4KB1A 2KFNA 1WAFA 4OJRA 4DF8A 2OZMA 1GOCA 3ZSVA 2YNHA 4F2RA 3NH1A 1RT4A 1ZBIA 3KKRA 2XRIA 4NYNA 4Z0UA 3D0PA 1CLQA 4E7HA 3PO4A 4F8RA 1J54A 3EYZA 4E7IA 1YT3A 1JXBA 1C0TA 2LSNA 1FKPA 5JS1A 4ICLA 2Y1IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RW6 A;  4H8K A;  4FLU A;  2IOC A;  4B8C A;  1BI4 B;  4F3O A;  4FJI A;  1TL3 A;  3VQ7 A;  3KK3 A;  4KHY A;  4RW7 A;  4KI4 A;  4FXD A;  1ZBH A;  2XY8 A;  1J53 A;  2O4G A;  3L2W A;  1RTD A;  3PY8 A;  3OYK A;  4Q0B A;  4FJ8 A;  1Z26 A;  1C1C A;  4O5B A;  3NAE A;  4HUE A;  2HHW A;  3QIN A;  4PUO A;  3HJF A;  5HRS A;  4IFV A;  4KTW A;  3SQ1 A;  3S3O A;  1SL2 A;  3K59 A;  4B9V A;  4IFY A;  1LW0 A;  2FBV A;  2EHG A;  4FJJ A;  3AO3 A;  4CJR A;  3U6F A;  3CM5 A;  5C24 A;  4E7K A;  1BCM A;  3L8B A;  3PX4 A;  2VG7 A;  4OLA A;  3HP6 A;  3B6O A;  3S9H A;  4W5N A;  4CGJ A;  4DQQ A;  3TAQ A;  3DRR A;  2G8I A;  4DTR A;  1XHX A;  3SJJ A;  5FRN A;  5FRM A;  1SV5 A;  4FJ9 A;  3ALY A;  4KKO A;  1KTQ A;  3QIP A;  3TWH A;  1RTH A;  3PX6 A;  1D9D A;  1QHT A;  3QES A;  1RT5 A;  2X6N A;  3KKS A;  2IS3 A;  3CFO A;  4OKJ A;  1VSE A;  4CEB A;  3OYB A;  3RWU A;  4CGF A;  2QK9 A;  3OVN A;  4B9L A;  2HB5 A;  4PQU A;  4M3W A;  1S1X A;  3DMJ A;  3KLF A;  4Q5V A;  4FLW A;  1Z25 A;  1RBT A;  5JS2 A;  1QS4 A;  3HL8 A;  5DMR A;  3LP3 A;  3QEX A;  2E6L A;  1RBR A;  3TAE A;  1QSL A;  1VSL A;  4W5T A;  2P5G A;  2DY4 A;  1YVU A;  3ZSO A;  1UAX A;  4TSX A;  4AHC A;  3JYT A;  3AA2 A;  2W42 A;  4FJM A;  3AVC A;  3AVL A;  3MEG A;  5SWM A;  2EX3 A;  3L2U A;  4KRE A;  1VSK A;  4FJK A;  3MEE A;  3DLE A;  3SUO A;  1BIU A;  4C8N A;  2BGG A;  1ZBU A;  4KV8 A;  4FLZ A;  4FM1 A;  3O3G A;  3HPG A;  3HPO A;  4M3T A;  1S9E A;  3C6T A;  4OGE A;  1N6Q A;  2YKM A;  3OYC A;  1T03 A;  1ASU A;  2G8U A;  2D0C A;  2P51 A;  1RT3 A;  1A5V A;  4DTS A;  1WN7 A;  2X78 A;  5DK5 A;  4AHR A;  3LDS A;  3OS2 A;  1D5A A;  1NK9 A;  4CJK A;  1HJR A;  4Y1C A;  4FW2 A;  3BGR A;  1JL1 A;  3CM6 A;  5CZ2 A;  3ZSW A;  3V6D A;  3VQA A;  2F8S A;  1UA1 A;  1B92 A;  2IDO A;  1L3T A;  3HM9 A;  3VA3 A;  2AJQ A;  2B5J A;  3PUF A;  1LAW A;  2WON A;  2FBT A;  4IDK A;  4CF1 A;  3P1G A;  1IKX A;  3KK1 A;  4JS4 A;  1S1W A;  4NCB A;  1BIZ A;  5J2M A;  2G8V A;  4Z4G A;  2KZM A;  1CZ9 A;  4NCG A;  3ZT3 A;  4E89 A;  3KLI A;  3L3V A;  4JRP A;  4KI6 A;  2HMI A;  3TAM A;  1EXQ A;  4DU1 A;  1DLO A;  1RDC A;  3B6P A;  3OYE A;  4ELV A;  4KTZ A;  3RMA A;  4G1Q A;  3AVJ A;  4CIE A;  4FCY A;  3OS0 A;  3HVT A;  1LWE A;  3M8R A;  4DLG A;  4C8K A;  4LSN A;  5E41 A;  3NF7 A;  4FK2 A;  3VQP A;  3D45 A;  2XY6 A;  1Q9Y A;  2Q3S A;  2G8W A;  3NH0 A;  1S1T A;  1S9G A;  1WSI A;  3P83 D;  3V1R A;  3DI6 A;  4O44 A;  4CJS A;  5C42 A;  1JLE A;  3HO1 A;  3NF6 A;  3G0Z A;  3KJV A;  4C8O A;  2JLE A;  4AHU A;  3VA0 A;  1RIL A;  4DQS A;  3DOL A;  4FJX A;  3SV3 A;  1KSP A;  3C94 A;  1T8E A;  2QKB A;  3QEV A;  1TKX A;  3RTV A;  2HHT A;  2DFF A;  2ZD1 A;  1LWF A;  4EZ9 A;  1VSH A;  3NCI A;  1NOZ A;  3LWL A;  4NCA A;  4CEZ A;  4FJN A;  2VWJ A;  3AVA A;  1JLB A;  3WNF A;  4CJT A;  3I0R A;  2G8F A;  3L3U A;  3KIO A;  1S1U A;  1SL0 A;  4O4G A;  1KVA A;  4CHP A;  4CCH A;  4M3X A;  3T3F A;  1NKB A;  1QSY A;  2YNF A;  4BAC A;  5KRT A;  3PO5 A;  1L3U A;  3CFP A;  4OPK A;  1TKZ A;  2KQ2 A;  3AA4 A;  3P5J A;  1C1B A;  3ISN C;  3K57 A;  1XWL A;  2BE2 A;  3QIO A;  1NK0 A;  2D0A A;  4RW4 A;  4DWI A;  4O0I A;  1C6V A;  1RBV A;  4W5O A;  4FK4 A;  5HRP A;  2GBZ A;  4M45 A;  4I2Q A;  4JRQ A;  3S3N A;  3VQ4 A;  2R7Y A;  1HNV A;  4CES A;  4FLT A;  1EET A;  1TGO A;  4CJW A;  3MXM A;  2PZS A;  4IG0 A;  2IAJ A;  4KHW A;  4E7L A;  1RBU A;  4CJQ A;  3HPH A;  4FJL A;  3UIQ A;  4W5R A;  4JS5 A;  2HHX A;  4HCC A;  3MAQ A;  2BAN A;  4KTQ A;  2OPQ A;  4M42 A;  1JLF A;  3AVH A;  1JLG A;  4W5Q A;  5HRO A;  1SL1 A;  1IKW A;  1CZB A;  3K2P A;  4B9N A;  1RDD A;  4J2A A;  3QEI A;  3G10 A;  1K6Y A;  4UQG A;  1IKV A;  2QXF A;  3QNO A;  4E0D A;  2HHU A;  4CJU A;  1QSS A;  1N5Y A;  4BE0 A;  1ZBF A;  3AVB A;  4M3U A;  3U3G A;  4CK2 A;  4N47 A;  4DFJ A;  2HVI A;  1FXX A;  3RMD A;  4AHT A;  1VSM A;  5FRO A;  2GUI A;  1RT1 A;  3VQC A;  4KHN A;  2X74 A;  4ID5 A;  3HK2 A;  4LH5 A;  4RG8 A;  4Z4H A;  3RRH A;  3ZCM A;  2B6A A;  3DLB A;  1S1V A;  3KLG A;  2FC0 A;  3V81 A;  4Y1D A;  1T7P A;  3CYM A;  2P1J A;  2Z1I A;  3AA5 X;  2OPS A;  3V9Z A;  4M3Y A;  3LP1 A;  3O3F A;  1KCF A;  5SZT A;  1KLM A;  1WLJ A;  3SUN A;  4Z4F A;  3OYD A;  2O4I A;  3HP9 A;  1RCH A;  2Z1H A;  1HYZ A;  3NDK A;  3ZT2 A;  4DTU A;  4KFB A;  2QKK A;  3DRP A;  1I39 A;  4GMJ B;  1GOA A;  2ZQB A;  3OYJ A;  4DU4 A;  3RRG A;  4CEO A;  3K5N A;  4DSF A;  1KFD A;  2NUB A;  3LP0 A;  3WNE A;  3CFR A;  4IKF A;  4ZHR A;  4QCL A;  1EP4 A;  4CHN A;  4I2P A;  4B3O A;  1BQM A;  4KPY A;  4CF9 A;  4CGG A;  4DFK A;  4CEQ A;  2KZZ A;  4CEC A;  3QEW A;  1NK4 A;  4CIG A;  1ASV A;  1W9H A;  4FLV A;  4DFP A;  1LWC A;  1NJY A;  3ASM A;  3V1Q A;  4FJG A;  4O0J A;  4DQR A;  3L2R A;  1RNH A;  1NJZ A;  2PY5 A;  4M41 A;  3BDP A;  1HQE A;  4DTP A;  4E1M A;  3I0S A;  3HXM A;  2YHA A;  2JGU A;  3V9W A;  4FZY A;  3EZ5 A;  3OYI A;  1NK5 A;  3KLE A;  2RPI A;  2E4L A;  1NKE A;  1ZBL A;  4J2D A;  3LAL A;  2KTQ A;  3ZSY A;  1JLC A;  3NGI A;  3RR8 A;  5CZ1 A;  2Z1J A;  3AO1 A;  1J9A A;  3C6U A;  1Q9X A;  1B9F A;  1VRT A;  3O4Q A;  3KD1 E;  3K58 A;  3CQ8 A;  3V9S A;  1HYV A;  1F21 A;  4O55 A;  4CFD A;  2ITG A;  3OYF A;  5D3G A;  3NE6 A;  2D0B A;  4DS5 A;  1NJX A;  2WOM A;  2P5O A;  4K8Z A;  3VQ9 A;  3LZI A;  3KTQ A;  4B8A B;  4HUF A;  4KHS A;  1JLA A;  4FJH A;  3AVI A;  1TV6 A;  4CK1 A;  3OYH A;  3AVF A;  4DQI A;  4FLY A;  4BE2 A;  4CJ3 A;  3THV A;  1TK0 A;  3V9X A;  3L2V A;  4CK3 A;  3JSM A;  1D9F A;  4CGI A;  2YNI A;  4DFM A;  3V1O A;  5HBM A;  3MEC A;  3VQD A;  1RTI A;  1Y97 A;  3ZT0 A;  3V9U A;  1G15 A;  1A5W A;  1FKO A;  2IC3 A;  3OYM A;  1EKE A;  1GOB A;  1IG9 A;  1LV5 A;  1R0A A;  4DQP A;  4E7J A;  3NF8 A;  1J5O A;  4F3T A;  2HHV A;  4DS4 A;  3RMB A;  4R5P A;  1S5J A;  1WSJ A;  1NK7 A;  3TR8 A;  5CY4 A;  4H4O A;  2E6M A;  3I8D A;  3AVM A;  2XHB A;  1SKS A;  4I9Q A;  4HHT A;  1L3V A;  1DTQ A;  4KHQ A;  4E3S A;  3QO9 A;  4DMN A;  2VG6 A;  4PA1 A;  2XO7 A;  1RT6 A;  3DLH A;  2OPR A;  4L8R B;  4Z4E A;  3AVK A;  3IAY A;  3K5O A;  2XY5 A;  1S6Q A;  4YFU A;  4K8X A;  1UA0 A;  4CHY A;  1HMV A;  3LWM A;  5I3U A;  4DSK A;  4KHU A;  4LSL A;  2ZE2 A;  4LH4 A;  4E19 A;  4F4K A;  4GW6 A;  4CJP A;  2HW3 A;  3ZT1 A;  2FBY A;  1REV A;  3NF9 A;  4OKK A;  3TAR A;  1X9M A;  1ITG A;  4ID1 A;  3IG1 A;  5KGX A;  2DFE A;  3DLK A;  3M8P A;  3DYA A;  3TAN A;  3SUQ A;  2F96 A;  3AA3 A;  4Z4C A;  3EY1 A;  4WE1 A;  3K5M A;  1VSD A;  5HRN A;  4CF2 A;  4N76 A;  1YTA A;  1U48 A;  3M8Q A;  3ZSR A;  2KFZ A;  3H08 A;  3HT3 A;  3LPT A;  3OY9 A;  4ELT A;  3IS9 A;  4CEA A;  1T05 A;  3O4N A;  4HCB A;  1RDB A;  4CHZ A;  1RTJ A;  3NFA A;  3S3M A;  4DSJ A;  4CHQ A;  1KRP A;  2OA8 A;  4CE9 A;  2RN2 A;  3VQ5 A;  4ELU A;  4FLX A;  4BE1 A;  3OYL A;  1X9W A;  1SKR A;  2XY7 A;  1U45 A;  4BWJ A;  1HRH A;  1HPZ A;  3SQ4 A;  5C25 A;  1WNS A;  3SQ2 A;  1L5U A;  3LAK A;  4FM0 A;  4B9T A;  3HVR A;  5I42 A;  3VQQ A;  5CYQ A;  4HUG A;  3VQ6 A;  4DTO A;  3ZSZ A;  1BIS A;  2Y1J A;  4FZX C;  4F2S A;  4E1N A;  2ATQ A;  1HNI A;  2B4J A;  3OJU A;  4FJ7 A;  2YHB A;  2HNY A;  3LAN A;  1KVB A;  3C95 A;  5KRS A;  4ZTJ A;  4RW8 A;  4C8M A;  2OYQ A;  3MXJ A;  1QE1 A;  3WNG A;  4FM2 A;  1IO2 A;  1BI4 A;  1U04 A;  3DLR A;  2ETJ A;  4CGH A;  1NOY A;  2RF2 A;  4N5S A;  1TAU A;  3T19 A;  1X1P A;  4FYD A;  3OYN A;  2F8T A;  4EP4 A;  5FDL A;  3DLG A;  4AHS A;  3OYA A;  1WSH A;  3NBP A;  3K5L A;  3L2Q A;  3FFI A;  4CED A;  1I3A A;  1VK0 A;  4M3R A;  4HVJ A;  4KB0 A;  2OZS A;  3ZSX A;  4CGD A;  1RBS A;  1RT7 A;  5KGW A;  1BL3 A;  1CXU A;  4EP5 A;  2OPP A;  4OGC A;  4CF0 A;  5KTQ A;  1QQC A;  1HQU A;  4DTJ A;  4FZZ A;  4CF8 A;  1C0U A;  3QEP A;  4AIL C;  3NHG A;  4OPJ A;  4M3Z A;  3O3H A;  3OJS A;  5J2Q A;  4IBN A;  4CIF A;  4DSL A;  4FVM A;  3VQE A;  3DRS A;  3QNN A;  4LY7 A;  4CJF A;  1TKD A;  1XC9 A;  1WAJ A;  4PY5 A;  1JXE A;  3E01 A;  1KFS A;  4YNQ A;  1TAQ A;  5KI6 A;  2G8H A;  1TKT A;  3IRX A;  3M8S A;  4C8L A;  4DLE A;  1O1W A;  4DTN A;  4HTU A;  3VN5 A;  5J2P A;  3LAM A;  4OLB A;  4CFA A;  4MQ3 A;  4CJL A;  3WNH A;  5T7B A;  4DTX A;  1WSE A;  4B9U A;  2VG5 A;  4CHO A;  2PYL A;  4B9M A;  3AO5 A;  1HYS A;  1VSJ A;  2GV9 A;  4QAG A;  4DTM A;  3RR7 A;  5EU7 A;  3TAG A;  5HLF A;  1TK8 A;  5HP1 A;  4DU3 A;  3NGY A;  1TL1 A;  1CXQ A;  5J1E A;  1X9S A;  2X6S A;  4CEF A;  1NK8 A;  1XHZ A;  2DTU A;  2D5R A;  4B9S A;  3ZSQ A;  1MU2 A;  1NK6 A;  3TAP A;  3SI6 A;  4ZTF A;  1ZYQ A;  1JL2 A;  4QOZ B;  1SUQ A;  1RDA A;  1VSI A;  2IGI A;  4KO0 A;  4CJE A;  4DSI A;  4KAZ A;  4J2E A;  3F9K A;  4B08 A;  5J2N A;  1U47 A;  1WSF A;  4J2B A;  3MED A;  4GVM A;  1VSF A;  2YKN A;  4CFB A;  3F73 A;  3SZ2 A;  1JKH A;  3CG7 A;  4FK0 A;  1LAV A;  1W0H A;  3AV9 A;  3A2F A;  3ZT4 A;  4NYF A;  4OKE A;  4I9L A;  4LD0 A;  3SCX A;  4N56 A;  3SPY A;  3LP2 A;  4KRF A;  4MFB A;  4BDP A;  4IG3 A;  1A5X A;  3QER A;  4AH9 A;  4Z4I A;  4AHV A;  1NJW A;  2HVH A;  2BDP A;  4FJ5 A;  1U4B A;  4CEE A;  2A1S A;  3DOK A;  2A1R A;  1DTT A;  2VWK A;  2KW4 A;  1BGX T;  3HST B;  4CJ4 A;  3AVN A;  2HNZ A;  3AO4 A;  3ITH A;  2I5J A;  4DSE A;  1XI1 A;  4OVL A;  3LPU A;  4BWM A;  1BQN A;  3RMC A;  1RT2 A;  2Z1G A;  2DFH A;  1LW2 A;  3LZJ A;  4DG1 A;  5K14 A;  3DM2 A;  4BDY A;  4I7F A;  3SYZ A;  3TAF A;  3KD5 E;  1S6P A;  4H4M A;  3SQ0 A;  3SV4 A;  3SPZ A;  1WSG A;  1U49 A;  2HHS A;  3AO2 A;  1BHL A;  1Q8I A;  3U3Y A;  2RKI A;  3AVG A;  1B9D A;  3NH2 A;  3ULD A;  4PWD A;  3SUP A;  1L3S A;  1ASW A;  3OS1 A;  1KVC A;  3SNN A;  1D8Y A;  3KK2 A;  1C1A A;  3OYG A;  5CYM A;  1TK5 A;  1KLN A;  3NGZ A;  4CFC A;  3MXI A;  2FBX A;  2HND A;  3QLH A;  1UOC A;  3V4I A;  1EX4 A;  4N41 A;  1IKY A;  3T1A A;  1FK9 A;  3PX0 A;  2YNG A;  4FW1 A;  1IH7 A;  1BCO A;  4CER A;  3TAB A;  3KLH A;  4XIU A;  4BDZ A;  1UWB A;  4JLH A;  2HHQ A;  1SKW A;  1VRU A;  3VQB A;  3QET A;  1C0M A;  1JLQ A;  2G8K A;  3HYF A;  1QTM A;  5HRR A;  1TVR A;  4RW9 A;  4CJ5 A;  3TI0 A;  4EZ6 A;  1YTU A;  4DF4 A;  1NKC A;  3PV8 A;  2PYJ A;  4CJV A;  2YV0 X;  3VQ8 A;  4KB1 A;  2KFN A;  1WAF A;  4OJR A;  4DF8 A;  2OZM A;  1GOC A;  3ZSV A;  2YNH A;  4F2R A;  3NH1 A;  1RT4 A;  1ZBI A;  3KKR A;  2XRI A;  4NYN A;  4Z0U A;  3D0P A;  1CLQ A;  4E7H A;  3PO4 A;  4F8R A;  1J54 A;  3EYZ A;  4E7I A;  1YT3 A;  1JXB A;  1C0T A;  2LSN A;  1FKP A;  5JS1 A;  4ICL A;  2Y1I A; 
#chains in the Genus database with same CATH topology
 4H8K A;  4BR9 A;  4FLU A;  1VQ9 N;  2F4V K;  3VQ7 A;  1WB9 A;  4KHY A;  2GUP A;  2UUB K;  5C12 A;  1ZBH A;  1QZ5 A;  2O4G A;  1NNE A;  3O9S A;  5C2D A;  5GIO A;  5HRS A;  3TSP A;  2FBV A;  3DLL L;  3AO3 A;  3U6F A;  1FW6 A;  3CCE N;  5FPD A;  3HP6 A;  5BPN A;  4QS9 A;  3FZF A;  4DTR A;  5FRN A;  5FRM A;  4KKO A;  1RTH A;  1D9D A;  4CZK A;  4FOI A;  2X6N A;  4BRF A;  4CEB A;  2NLX A;  4CGF A;  1S72 N;  2FLO A;  4V19 S;  5AZJ B;  4FWR A;  2QTD A;  4M3W A;  3DMJ A;  3KLF A;  4FLW A;  1RBT A;  5JS2 A;  2WBN A;  3NMU A;  3TAE A;  1EO1 A;  3MN9 A;  3QBX A;  2P5G A;  2DY4 A;  4CI6 A;  3JYT A;  3CJ1 A;  2W42 A;  3AVC A;  3AVL A;  1V4S A;  4BC2 A;  3DLE A;  1BIU A;  4KV8 A;  3VEV A;  1KAX A;  3O3G A;  3HPG A;  3OYC A;  4CD1 A;  1ASU A;  2G8U A;  2D0C A;  4KHP K;  1RT3 A;  4YOT A;  1ZBS A;  2X78 A;  4AHR A;  1K9M O;  4CJK A;  3V6D A;  2NZT A;  5GAD P;  4G9Z A;  2B5J A;  2WON A;  3P1G A;  1NMD A;  1IKX A;  4IJN A;  3TU5 A;  4NCG A;  3L3V A;  3A5M C;  3TAM A;  4ELV A;  4LFC K;  3AVJ A;  3CCL N;  1LWE A;  5BR9 A;  4LSN A;  5E41 A;  3VEW A;  4JI0 K;  3ZEU B;  5C42 A;  4O44 A;  3C7N A;  4DKW A;  2JLE A;  4AHU A;  3VA0 A;  3D2E A;  1RIL A;  3DOL A;  4FJX A;  3BZK A;  2QWN A;  2QKB A;  1TKX A;  2QWP A;  4IDH A;  5KPT A;  4EZ9 A;  2E88 A;  3MN6 A;  4IXC A;  5AR0 A;  3WNF A;  2HBL A;  3L3U A;  4O4G A;  4CCH A;  4K42 A;  2YNF A;  3WXM B;  5KRT A;  3PO5 A;  4A61 A;  1TKZ A;  3AA4 A;  1C1B A;  4GV6 A;  4RW4 A;  4XH5 A;  1HKG A;  2HMP A;  4W5O A;  3S3N A;  4YOX A;  4FLT A;  1TGO A;  3NVK A;  2IIR A;  3HPH A;  4FJL A;  3HOT A;  3UIQ A;  4M42 A;  3S41 A;  1SL1 A;  2VGN A;  1CZB A;  3K2P A;  1QHA A;  3TTD A;  3G10 A;  4UQG A;  3QNO A;  4E0D A;  1V4T A;  2HHU A;  5KPR A;  3C65 A;  2HVI A;  1FXX A;  3RMD A;  2Q0R A;  5FRO A;  3MMV A;  5EY4 A;  4RG8 A;  3J8A A;  2YI1 A;  2GTD A;  1DKG D;  4BR0 A;  4JHD B;  3V81 A;  2GEL A;  3JAM O;  1T7P A;  4FO0 A;  4C23 A;  1X3N A;  3SUN A;  2D1K A;  2Z1H A;  1HYZ A;  2I7P A;  3CJA A;  3G4S N;  1GLJ O;  4KFB A;  3T69 A;  1GOA A;  4GKK K;  3LP0 A;  3CCM N;  2YHX A;  1NGB A;  4CGG A;  3VOV A;  4DR5 K;  3L4Q A;  4CEQ A;  2KZZ A;  3TTF A;  3SAH A;  3A0I X;  2YJE A;  4FJG A;  4X62 K;  1RNH A;  4M41 A;  3I0S A;  4XEI A;  3VF4 A;  2JGU A;  2P9K A;  2E4L A;  3LAL A;  3ENB A;  3TSQ A;  3RR8 A;  1ZXO A;  1NGD A;  2Z1J A;  3DWL A;  3AO1 A;  1J9A A;  3J81 O;  3W0L A;  3K58 A;  4O55 A;  4CFD A;  2D0B A;  2P5O A;  3E66 A;  3QML A;  3KTQ A;  4IWV A;  3CC2 N;  3AVI A;  4CK1 A;  3C7N B;  3ENO A;  4FLY A;  4DQ8 A;  3DXM B;  4CGI A;  2V7Y A;  1A5W A;  1FKO A;  2W6L A;  1IG9 A;  1LV5 A;  5BPM A;  3RMB A;  1NK7 A;  3WXI A;  3MN5 A;  5CY4 A;  3CCU N;  3I8D A;  1DEJ A;  4I9Q A;  1NG9 A;  5JIC A;  1ILY A;  4E3S A;  1C0F A;  4PA1 A;  4DMN A;  4Z4E A;  2OPR A;  3AVK A;  5BPL A;  2XY5 A;  1HMV A;  3LWM A;  4DSK A;  4CZI A;  4DHY A;  4FPB A;  5AFU A;  5AQW A;  3SK3 A;  4NO7 A;  1ITG A;  3TAR A;  4ID1 A;  1X9M A;  1YVN A;  3AAR A;  5M1K A;  2FSN A;  5MLC Q;  3K5M A;  3FLC O;  4FOE A;  3OY9 A;  1OKJ A;  4ELT A;  4CBU A;  3O4N A;  3P38 A;  4H5R A;  3NFA A;  4CHQ A;  1OVQ A;  2EWS A;  4FLX A;  4PHT X;  4B3M K;  1X9W A;  4CZH A;  1SKR A;  5AZI A;  3WQU A;  1RGI A;  3QB0 A;  4K43 A;  1S22 A;  4K41 A;  1YHQ N;  3LAK A;  1L5U A;  1VQO N;  4FPA A;  4HUG A;  4ISG A;  3VQ6 A;  5B8H A;  1HJO A;  1BIS A;  5AFU H;  3WEE A;  4F2S A;  4E1N A;  4DR3 K;  4JK9 A;  2HNY A;  4CZE A;  2OYQ A;  5KRS A;  4RW8 A;  4C8M A;  5AQN A;  1QE1 A;  3GL1 A;  1IO2 A;  4GVE A;  4CGH A;  1VQ8 N;  1TAU A;  4N5S A;  3T19 A;  1BOT O;  2O8E B;  4FYD A;  3OYN A;  1WSH A;  3NBP A;  4KB0 A;  1I3A A;  5KQD A;  3WXJ A;  2OZS A;  4CGD A;  3RVC A;  5KGW A;  5HL7 L;  2P9P B;  4CF0 A;  5KTQ A;  1QQC A;  1HQU A;  3E9P A;  4DTJ A;  1RDW X;  3NHG A;  4ILG B;  4M3Z A;  3OJS A;  3H46 O;  4YHH K;  3J7Z O;  3PIO L;  4DLE A;  1O1W A;  3VGL A;  4LFB K;  2ASP A;  3WNH A;  4DTX A;  3WT0 A;  4B9U A;  2VG5 A;  3AO5 A;  4LF8 K;  1VSJ A;  4QAG A;  4QS8 A;  1TK8 A;  3NGY A;  1CXQ A;  1X9S A;  2X6S A;  2D5R A;  4JKG B;  3SI6 A;  1JL2 A;  4QOZ B;  1VSI A;  1RDA A;  2BH1 A;  4CJE A;  4KAZ A;  3F9K A;  4B08 A;  2QWM A;  5J2N A;  4KI4 A;  4O8K A;  4CFB A;  3AV9 A;  3ZT4 A;  4I9L A;  4N56 A;  3LP2 A;  1S3X A;  4MFB A;  4BRG A;  1A5X A;  3H1V X;  2CGK A;  4Z4I A;  2BDP A;  3VGK A;  4IEE A;  1OH7 A;  3HI0 A;  4CEE A;  2A1S A;  3DOK A;  4BRK A;  1DTT A;  3CXC M;  2HNZ A;  1XI1 A;  3ITH A;  2I5J A;  1BQN A;  2GWK A;  3LZJ A;  1NGI A;  2HOE A;  4BDY A;  2O8B B;  3E9O A;  3KD5 E;  1OVY A;  1S6P A;  4YOR A;  3MCP A;  4CBX A;  4GNI A;  3I56 N;  3U3Y A;  2HHT A;  4ILJ A;  1D8Y A;  4BR5 A;  1HKB A;  3SAG A;  3KK2 A;  1YIT N;  3ID6 A;  1WBD A;  1KLN A;  1Q18 A;  1NGF A;  4CFC A;  3NGZ A;  3MXI A;  2VWB A;  3QLH A;  1BCO A;  3M3Z A;  4BC5 A;  2HHQ A;  1VRU A;  3VF2 A;  3HYF A;  1QTM A;  4CJ5 A;  4RW9 A;  3TI0 A;  3UE5 A;  5I9E B;  3EKU A;  3PV8 A;  3VQ8 A;  4KB1 A;  1MA9 B;  1GOC A;  2YNH A;  4I6M B;  2O8C B;  4XH4 A;  1IBK K;  1RT4 A;  4NYN A;  3D0P A;  4E7H A;  4E7I A;  1YT3 A;  5JS1 A;  1C0T A;  5ADX A;  3D2F A;  2IOC A;  4F3O A;  5DM6 L;  1TL3 A;  3KK3 A;  2XY8 A;  1J53 A;  3L2W A;  2E20 A;  3PY8 A;  3VEY A;  4HUE A;  3NAE A;  4PUO A;  3A5N C;  4AQY K;  4IFV A;  3S3O A;  3SQ1 A;  3FE1 A;  3ENH A;  1VQM N;  4B9V A;  4IFY A;  4FJJ A;  2EHG A;  3DXK B;  3CM5 A;  5C24 A;  4E7K A;  2ZGZ A;  2VG7 A;  3U4L A;  3B6O A;  3S9H A;  3K9K A;  4DQQ A;  4O5F A;  3UKU B;  1KTQ A;  3TWH A;  1QHT A;  3QES A;  1RT5 A;  4CD3 A;  2IS3 A;  4OKJ A;  5ADX H;  4BRM A;  3IMX A;  4FWM A;  4FWS A;  4B9L A;  3KZB A;  4PQU A;  2ZJP L;  4Q5V A;  3CD6 N;  3K0S A;  5DMR A;  5ELZ A;  2E6L A;  1QSL A;  4W5T A;  1D4X A;  1SZ2 A;  3AA2 A;  3MEG A;  3CCQ N;  3SUO A;  1ZBU A;  1SQK A;  2UYT A;  4IFE A;  1NGH A;  3J7A P;  2UU9 K;  3THY B;  3C6T A;  4OGE A;  2KLA A;  3ZX3 A;  3A5L C;  1VQ7 N;  4A5B A;  4DTS A;  3LDL A;  1N34 K;  5DK5 A;  3LDS A;  1HJR A;  3ZSW A;  3BGR A;  3ZET B;  5TKW A;  1UA1 A;  1B92 A;  3FZK A;  4B1W B;  5JLH A;  3VA3 A;  1KQS M;  4Z4G A;  2KZM A;  3ZT3 A;  3H3N O;  4E89 A;  4MLH A;  4JRP A;  4KI6 A;  3FFK B;  4NB4 A;  4CJ7 A;  3O9T A;  2HMI A;  4DU1 A;  3EKS A;  4JYA K;  4KTZ A;  1RDU A;  4G1Q A;  2HBK A;  4FCY A;  1CZA N;  4IOA L;  3HVT A;  3M8R A;  4MDB A;  4DLG A;  1TYQ A;  3NF7 A;  4FK2 A;  2XY6 A;  4JI7 K;  5FLX O;  2WC9 A;  2Q3S A;  2G8W A;  4B9Q A;  4ISE A;  3V1R A;  3R8E A;  1BA0 A;  4H03 B;  1BDG A;  3HSC A;  3KJV A;  3G0Z A;  3BY5 A;  2P9L A;  3SV3 A;  3WXL A;  3C94 A;  3TTC A;  3RTV A;  4H5T A;  2DFF A;  2YX6 A;  2ZD1 A;  4A62 A;  1VSH A;  2VQE K;  3NCI A;  3LWL A;  4BY9 C;  3AVA A;  1JLB A;  4CJT A;  3I0R A;  5AQJ A;  1GLL O;  1S1U A;  1SL0 A;  4B1Y B;  4M3X A;  2VGM A;  3T3F A;  1NKB A;  3THX B;  3CFP A;  3L6Q A;  3P5J A;  2KQ2 A;  3K57 A;  3QIO A;  4EHT A;  3G71 N;  3A5O C;  4O0I A;  4IO8 A;  5M1N A;  1C6V A;  3O8M A;  1RBV A;  4PL7 A;  2GBZ A;  2ZWH A;  2BUP A;  1KXP A;  4IO9 L;  1LCU A;  2R7Y A;  1HNV A;  4CES A;  4LF7 K;  4CJW A;  4FL9 A;  4FWK A;  4KHW A;  3NVM A;  4E7L A;  1RBU A;  4HCC A;  1C0G A;  3MAQ A;  1EQY A;  2OPQ A;  4KTQ A;  1JLF A;  1JLG A;  5HRO A;  1QVG M;  5AQX A;  1K6Y A;  1XC3 A;  4CK2 A;  4N47 A;  5LJW A;  4FWO A;  3HOS A;  2FSJ A;  5AQR A;  4ID5 A;  3KHY A;  3HK2 A;  3PSI A;  3GDQ A;  4DV6 K;  1S1V A;  5BR8 K;  4YOV A;  2Z1I A;  3LP1 A;  3VET A;  1KCF A;  5SZT A;  4X64 K;  1KLM A;  4BR2 A;  2VCP A;  4YOY A;  1RCH A;  5C10 A;  2F9W A;  5AQK A;  3OYJ A;  3RRG A;  1Q86 O;  4DSF A;  2NUB A;  4IKF A;  4QCL A;  4CHN A;  4B3O A;  2OAN A;  3U9Z A;  3WUH A;  3UKR B;  3R3L A;  1YF5 L;  4DFP A;  1WUA A;  4B1U B;  1YJW N;  5FPE A;  3OW2 M;  4BRH A;  4DQR A;  2PY5 A;  3BF1 A;  3BDP A;  5CE3 A;  1IBM K;  2YHA A;  4WQ4 A;  1NKE A;  4J2D A;  4JD2 A;  3ZSY A;  4H0V B;  3EE9 A;  1YUW A;  3C6U A;  1Q9X A;  1B9F A;  3CQ8 A;  4DV0 K;  5D3G A;  3NE6 A;  1NJX A;  4DS5 A;  3VQ9 A;  4IZ9 A;  3LZI A;  1JLA A;  3CF5 L;  1TV6 A;  1ZC6 A;  1K8K A;  2D0P A;  4DQI A;  3H1Q A;  3EZW A;  3L2V A;  2P9L B;  1D9F A;  3VEO A;  3V1O A;  4KH6 A;  5HBM A;  3ZT0 A;  2W6K A;  4BQZ A;  3O08 A;  3OYM A;  5GIP A;  1EKE A;  2A41 A;  2E2O A;  4WFA L;  1OH6 A;  2HHV A;  3MWT A;  3TPQ A;  3O4W A;  3TSU A;  3LDO A;  1SKS A;  2V51 B;  2YHY A;  3QO9 A;  3DLH A;  1RT6 A;  3IAY A;  3I8B A;  1Q7Y O;  1XQS C;  2HW3 A;  4A59 A;  3GOI A;  1N32 K;  3T7Z A;  5KGX A;  2OTJ N;  1U2V A;  3M8P A;  3RSE A;  2ASM A;  2IVO A;  3EL2 A;  3EY1 A;  4H0T B;  1U48 A;  3M8Q A;  3LDQ A;  3VF6 A;  3EE8 A;  1JCG A;  4CEA A;  1T05 A;  1RDB A;  1J6Z A;  2RN2 A;  3VQ5 A;  1VHX A;  3OYL A;  4WF9 L;  4FVU A;  1U45 A;  4BWJ A;  1HPZ A;  1WNS A;  3SQ2 A;  3THW A;  5FPN A;  4FM0 A;  3HVR A;  4DTO A;  1T6D A;  5LY3 A;  3AGR A;  5C2F A;  2YJF A;  3OJU A;  4FJ7 A;  2YHB A;  2J4R A;  2P9U A;  3ID8 A;  3LAN A;  4ZTJ A;  3DLR A;  3R6M A;  3O9R A;  5FDL A;  3DLG A;  4NLC A;  3FFI A;  4CED A;  4FWQ A;  3ZSX A;  1IV0 A;  4J8F A;  1ATN A;  1BG3 A;  4CZJ A;  2ITM A;  4CIF A;  5AQI A;  3N4P A;  4FVM A;  4WYB A;  3CC7 N;  3QNN A;  4LY7 A;  4CJF A;  5AQF A;  4JK7 A;  4PY5 A;  1JXE A;  4YNQ A;  3M8S A;  4H5N A;  2NRH A;  2GX9 A;  4MQ3 A;  5T7B A;  1XNQ K;  2O8D A;  1WSE A;  2CGL A;  2GV9 A;  4DTM A;  1YJ9 N;  1Q81 O;  4ILH A;  4DU3 A;  1TL1 A;  4LF4 K;  2UXC K;  1MWM A;  1NK8 A;  2DTU A;  4KH4 A;  3TAP A;  4ZTF A;  2IGI A;  4DSI A;  2YCH A;  4J2E A;  1BO5 O;  2A6A A;  1FJG K;  1HUX A;  3SZ2 A;  1W97 L;  5AQV A;  4NYF A;  4OKE A;  3SPY A;  1OH5 A;  3IKM A;  1GLF O;  4BDP A;  3D2E B;  4IG3 A;  3QER A;  2BTF A;  3AAQ A;  4MO4 A;  1BGX T;  1XNR K;  4KRF A;  4DSE A;  5GAG P;  3G25 A;  4JKD A;  4LFA K;  5K14 A;  1OH8 A;  5AQL A;  1U2V B;  4I7F A;  3SYZ A;  1DGK N;  1T6C A;  4O8U A;  5C15 A;  3SPZ A;  5EOY A;  4LC9 B;  4BRP A;  2HHS A;  2HF4 A;  1J5E K;  2RKI A;  3NH2 A;  1Q82 O;  1L3S A;  3SNN A;  3OS1 A;  1KVC A;  3OYG A;  2NRX A;  3CHW A;  3V4I A;  4N41 A;  1IKY A;  1IH7 A;  4CER A;  3TAB A;  4XIU A;  2G8K A;  1JLQ A;  4MO5 A;  1TVR A;  4EZ6 A;  4IOX A;  1YTU A;  4DF4 A;  1NKC A;  2QEX N;  2PYJ A;  4CJV A;  2YV0 X;  1WAF A;  4OJR A;  1I94 K;  1E3M A;  1HLU A;  3LDP A;  4F2R A;  1TUU A;  1J54 A;  3EYZ A;  3ULE A;  3T1H K;  1NGE A;  1FKP A;  4EAH D;  3O3F A;  2Y1I A;  4B8C A;  4LF9 K;  3JXU A;  1M1K O;  4RW7 A;  3VGM A;  4Z94 A;  4FJ8 A;  2E1Z A;  1Z26 A;  3GG4 A;  2P9S A;  4O5B A;  2O8F A;  2HHW A;  3QIN A;  4AM7 A;  2Q1N A;  4DV1 K;  4KTW A;  2D0O A;  3CJB A;  2V7Z A;  1EWQ A;  3ZX0 A;  5AQZ A;  3L8B A;  3C0B A;  4OLA A;  1NBW A;  5TKY A;  2E5L K;  3SJJ A;  2OCE A;  4GV3 A;  2O8D B;  1X3M A;  1VSE A;  2RHK A;  4DUY K;  4JKH A;  1X9J A;  2P9K B;  2F7T A;  2HB5 A;  3UB5 A;  2A42 A;  3FZH A;  1QS4 A;  3HL8 A;  1HX1 A;  1RBR A;  1YVU A;  4KBO A;  4Y0W A;  3ZSO A;  1UAX A;  2NRR A;  4AHC A;  4FJM A;  5SWM A;  4KRE A;  2PBD A;  3A8Y A;  3P39 A;  2BGG A;  4U7B A;  3QIC A;  3BF3 A;  4DV5 K;  4FLZ A;  3K9J A;  4BGA A;  3HPO A;  1N6Q A;  2YKM A;  1BU6 O;  3CET A;  1A5V A;  1WN7 A;  4ISF A;  3OS2 A;  4BRC A;  1D5A A;  2HST A;  4Y1C A;  4NXN K;  4FW2 A;  5CZ2 A;  3CM6 A;  4CVN E;  3VQA A;  2IDO A;  3HM9 A;  3PUF A;  1NGC A;  2FBT A;  2GWJ A;  4IDK A;  2PAV A;  4PKI A;  4CF1 A;  5KPZ A;  3KK1 A;  4NCB A;  1BIZ A;  5J2M A;  1WBB A;  4CZG A;  5M1P A;  4UY8 O;  4GY2 B;  1EXQ A;  3B6P A;  2JWL A;  2CH6 A;  3HM8 A;  3OYE A;  3Q7C A;  3RMA A;  1NGJ A;  1WOQ A;  1QQN A;  4H0Y B;  3O6W A;  3CPW M;  2VYP A;  5HOO A;  2P9I A;  3NH0 A;  1S1T A;  1S9G A;  1WSI A;  1JLE A;  3HO1 A;  2FF6 A;  4WFB L;  3CJ9 A;  4DQS A;  5AZI B;  1T8E A;  4JK8 A;  3HTV A;  3LM9 A;  3QEV A;  1NOZ A;  3E9L A;  4WQ4 C;  4CEZ A;  3KIO A;  3WEE B;  1KVA A;  2P9N A;  5F2R A;  1QSY A;  3VPZ A;  2WFB A;  2KHO A;  4OPK A;  3ISN C;  1ATR A;  1XWL A;  2BE2 A;  2D0A A;  5AQG A;  5HRP A;  4YY3 K;  4I2Q A;  4AF1 A;  1P90 A;  3R1X A;  1EET A;  3MXM A;  2PZS A;  4CJQ A;  4HWI A;  1ATS A;  3IDH A;  4W5R A;  2HHX A;  2ASO A;  2I7N A;  2Q31 A;  1IKW A;  3MK6 A;  3DJC A;  3SLC A;  1ESV A;  4B9N A;  1RDD A;  4J2A A;  3QEI A;  2E2N A;  1IKV A;  3DAW A;  1QSS A;  4BR4 A;  1ZBF A;  3AVB A;  4M3U A;  3CCV N;  4DFJ A;  1QQM A;  4AHT A;  5GAE P;  1VSM A;  4LF6 K;  4CZM A;  2GUI A;  1RT1 A;  3EN9 A;  4LH5 A;  3J7Y P;  3ZCM A;  1Z6R A;  1T3V A;  4MDA A;  2W41 A;  3CMA N;  4JI5 K;  3CYM A;  3V9Z A;  4M3Y A;  5M1F A;  3CI5 A;  3OYD A;  2O4I A;  3DRP A;  4GMJ B;  2Q2R A;  2ZQB A;  3CJ7 A;  4YDU C;  4CEO A;  3K5N A;  1KFD A;  1YI2 N;  4I2P A;  4KPY A;  4B1X B;  1H1V A;  5JVH L;  2H3G X;  4DFK A;  3AAP A;  3O80 A;  4CEC A;  3QEW A;  1ASV A;  1W9H A;  5IWA K;  4FLV A;  1LWC A;  3C6H A;  3MDQ A;  3ASM A;  1NJY A;  1VQL N;  3EO3 A;  1Y64 A;  3FR0 A;  4DTP A;  3L0Q A;  4E1M A;  3HXM A;  3QDK A;  3V9W A;  5AZJ A;  1NK5 A;  3KLE A;  3KWG A;  2UUC K;  5C0Y A;  3O4Q A;  2QWQ A;  3KD1 E;  2ZJR L;  4K8Z A;  4RCH A;  2CH5 A;  4HUF A;  4OPH A;  4FJH A;  3EEQ A;  4BRE A;  5AQM A;  3AVF A;  4BE2 A;  4CJ3 A;  3THV A;  3V9X A;  4CK3 A;  2YNI A;  4DFM A;  3VQD A;  1RTI A;  3B8A X;  1G15 A;  3OBY A;  5EX5 A;  4DQP A;  3O1B A;  4E7J A;  3D7E O;  4F3T A;  4H4O A;  2E6M A;  3KVG A;  3QFP A;  3AVM A;  5F0X A;  2Q97 A;  4KHQ A;  3D2F B;  4L8R B;  2XO7 A;  2G8I A;  3BEX A;  2AA4 A;  1E4F T;  3K5O A;  1S6Q A;  3ZLJ A;  4K8X A;  4KHU A;  4CHY A;  5I3U A;  5LL6 Z;  3OBW A;  4A57 A;  4JNE A;  4B1Z A;  1NJI O;  4CJP A;  2FBY A;  2FF3 B;  3IG1 A;  3R9P A;  2DFE A;  1W7A A;  2FXU A;  3DLK A;  4BRN A;  1SS6 A;  3SUQ A;  2F96 A;  3AA3 A;  4Z4C A;  5F1X A;  3O9Q A;  5HRN A;  4CF2 A;  4N76 A;  1YTA A;  3LDN A;  4XH1 A;  3ZSR A;  2KFZ A;  2RE2 A;  1EWR A;  3ZEU A;  5GIN A;  3IS9 A;  3KK7 A;  4B3T K;  4BQL A;  4CHZ A;  3S3M A;  1KRP A;  2OA8 A;  4CE9 A;  4ELU A;  4BE1 A;  3IFR A;  2XY7 A;  1GLC G;  1JCE A;  1G99 A;  2JWK A;  5M1Q A;  1HNW K;  5I42 A;  3VQQ A;  4FWN A;  5CYQ A;  3ZSZ A;  2Y1J A;  4YOW A;  3MN7 A;  2IVN A;  1HNI A;  2B4J A;  5JMV A;  4BG8 A;  1KVB A;  3HZ6 A;  3WNG A;  4FM2 A;  1BI4 A;  4CZF A;  2RF2 A;  4H0O A;  4BRO A;  3GBT A;  2QA4 N;  1VQP N;  4AHS A;  4FWP A;  3OYA A;  2F9T A;  5BN8 A;  1VK0 A;  3F5T A;  4M3R A;  4HVJ A;  1N33 K;  3SMP A;  1IJJ A;  4IJA A;  1BL3 A;  4BRI A;  3ATV A;  1C0U A;  3QEP A;  3CCR N;  4OPJ A;  5AQQ A;  3O3H A;  5J2Q A;  4IBN A;  5JVG L;  4IOC L;  4DSL A;  3KWI A;  5LMU K;  1TKD A;  1WAJ A;  2G8H A;  1TKT A;  4C8L A;  2V52 B;  4DTN A;  2E8A A;  4C1N K;  5J2P A;  4OLB A;  3LAM A;  4CJL A;  1HYS A;  2PYL A;  4U67 L;  3RR7 A;  5EU7 A;  3TAG A;  5HP1 A;  3LL3 A;  1XHZ A;  4JHD A;  3SBG A;  4B9S A;  4JI4 K;  3OTO K;  1TYQ B;  4DV4 K;  2OTL N;  2GEM A;  4J2B A;  1U47 A;  4FJ9 A;  5E26 A;  4GVM A;  3F73 A;  1VSF A;  4FK0 A;  4BRL A;  1LAV A;  1W0H A;  3A2F A;  4F9O A;  1RFQ A;  2HVH A;  4AHV A;  1NJW A;  1U4B A;  2NRZ A;  2A1R A;  2KW4 A;  3HST B;  4CJ4 A;  3AVN A;  4OVL A;  3LPU A;  1YAG A;  4RWT A;  3PSF A;  4BWM A;  4L3Q A;  3RMC A;  1IBL K;  4A2B A;  1N8R O;  4DG1 A;  4BGB A;  3DM2 A;  3FZL A;  2KKZ A;  3TAF A;  4JI3 K;  5LJV A;  1GLD G;  1Q8I A;  1B9D A;  3ULD A;  4DR2 K;  3JS6 A;  1TK5 A;  3D6R A;  2FBX A;  1UOC A;  3T1A A;  1FK9 A;  2QWR A;  4FW1 A;  3KLH A;  1UWB A;  1SKW A;  2A5X A;  3DXM A;  2W40 A;  5BN9 A;  1MWK A;  5HRR A;  3P4I A;  4AM6 A;  2WTU A;  4DV2 K;  3CCS N;  3CC4 N;  2KFN A;  2OZM A;  4YDU A;  2XRI A;  5H1S Q;  4Z0U A;  4BVP A;  3W3D A;  1CLQ A;  4F8R A;  1HKC A;  1JXB A;  2LSN A;  4RW6 A;  3AGK A;  1BI4 B;  4FJI A;  5EVZ A;  4M7X A;  3VES A;  3I55 N;  4FXD A;  3U8X A;  4HTL A;  1RTD A;  3VEX A;  3OYK A;  4Q0B A;  4FWL A;  5IT9 O;  1C1C A;  1VQ4 N;  3HJF A;  2HBJ A;  3F2K A;  1N36 K;  1SL2 A;  3K59 A;  1LW0 A;  4DV3 K;  3L4I A;  4CJR A;  5JLF A;  1JJ2 M;  1LOT B;  1BCM A;  3PX4 A;  3J80 O;  1VQN N;  1QZ6 A;  4W5N A;  2E2P A;  4E1J A;  4CGJ A;  3TAQ A;  2E2Q A;  3DRR A;  4PKG A;  3CCJ N;  1XHX A;  1SV5 A;  1YIJ N;  2NNW A;  3ALY A;  3PX6 A;  3QIP A;  1IG8 A;  2IVP A;  3KKS A;  3RWU A;  3CFO A;  3OYB A;  3FGU A;  4BC3 A;  2QK9 A;  3I33 A;  3OVN A;  4CW7 B;  2QM1 A;  3M1F A;  4JD2 B;  1S1X A;  3F9M A;  4JI1 K;  1Z25 A;  2E1Y A;  3ZX2 A;  5AQS A;  3LP3 A;  3QEX A;  1VSL A;  3AY9 A;  3G6E N;  1QQO A;  4TSX A;  2ZGY A;  1K8K B;  3HRG A;  2EX3 A;  4JKC A;  5BRF A;  3L2U A;  1VSK A;  4FJK A;  2O8E A;  3MEE A;  3IUC A;  4C8N A;  5CHI A;  4FM1 A;  4B1V A;  4EIA A;  1MDU B;  4M3T A;  1S9E A;  4A5A A;  2ZJQ L;  2P9P A;  4H5V A;  4M7Y A;  1T03 A;  2P51 A;  2AP1 A;  3CPE A;  1NK9 A;  1JL1 A;  2F8S A;  1BUP A;  5KQ8 A;  1QVF M;  1L3T A;  2AJQ A;  1LAW A;  4JS4 A;  1S1W A;  1NMN A;  1Z05 A;  2G8V A;  1CZ9 A;  1KD1 O;  3KLI A;  1KC8 O;  2UXD K;  3RSE B;  1DLO A;  1RDC A;  2A3Z A;  4CIE A;  3VTH A;  2NRV A;  3OS0 A;  4JKG A;  3PIP L;  5BRD A;  4C8K A;  5AQH A;  3M5R A;  2YHW A;  3VQP A;  3D45 A;  1Q9Y A;  3SBT A;  1YJN N;  3P83 D;  3BUZ B;  3DI6 A;  4CJS A;  1GLB G;  2QWL A;  3NF6 A;  4C8O A;  3QBW A;  1KSP A;  2ZF5 O;  1LWF A;  3THW B;  4H0X B;  4B3R K;  4NCA A;  4WQ5 C;  1BA1 A;  1VQK N;  5AJ3 K;  4FJN A;  2VWJ A;  2G8F A;  4BRA A;  4H5W A;  2A40 A;  1VQ5 N;  4CHP A;  3OA9 A;  2O8B A;  2P9U B;  4K0K K;  4BAC A;  4JKE A;  1L3U A;  4OX9 K;  5AQP A;  4BR7 A;  1NK0 A;  1YXQ A;  4DWI A;  3PLA A;  4FK4 A;  4M45 A;  4JRQ A;  3FZM A;  3VQ4 A;  1T44 A;  4RTF D;  4IG0 A;  2IAJ A;  4JKF A;  5AQO A;  4JS5 A;  2BAN A;  3CME N;  3AVH A;  4W5Q A;  1W2B M;  4MLE A;  3CIP A;  2QXF A;  4I6M A;  2O8C A;  4CJU A;  1N5Y A;  4JI6 K;  4BE0 A;  1SAZ A;  5AQU A;  3ZYY X;  4QS7 A;  3U3G A;  3SMS A;  2HHH K;  4GV9 A;  4JN4 A;  4FSV A;  3VQC A;  4KHN A;  2X74 A;  3H45 C;  3VMF B;  4DR7 K;  4Z4H A;  3RRH A;  2B6A A;  3DLB A;  3KLG A;  2FC0 A;  4Y1D A;  2P1J A;  3AA5 X;  2OPS A;  4NXM K;  3N4Q A;  1WLJ A;  4DB3 A;  4Z4F A;  2PFU A;  3HP9 A;  4EHU A;  3NDK A;  3CER A;  1HR0 K;  3ZT2 A;  4DTU A;  2UUA K;  2QKK A;  4A2A A;  1I39 A;  2WUS A;  4NLB A;  3SJH A;  4DU4 A;  3DXK A;  3WNE A;  3CFR A;  1JCF A;  4ZHR A;  1EP4 A;  3O1W A;  1BQM A;  2QI2 A;  3HBT A;  4B3S K;  4CF9 A;  5AQT A;  3H3O B;  3C6A A;  4OPA A;  5GAH P;  1NK4 A;  4CIG A;  4GKJ K;  3UKU A;  3V1Q A;  1E4G T;  4BVO A;  4O0J A;  3L2R A;  4BRD A;  1NJZ A;  1HQE A;  3LM2 A;  1NGG A;  4KH5 A;  1K73 O;  4FZY A;  3EZ5 A;  3OYI A;  4LF5 K;  5E84 A;  2RPI A;  4BG9 A;  2KTQ A;  1ZBL A;  3OHR A;  3NGI A;  1JLC A;  5CZ1 A;  3GE1 A;  1VRT A;  3V9S A;  1P8Z A;  1HYV A;  1F21 A;  1R59 O;  2ITG A;  3OYF A;  2WOM A;  4M63 C;  4B8A B;  4KHS A;  1NU0 A;  2Q36 A;  3WXK A;  3OYH A;  1DT9 A;  1TK0 A;  3P31 A;  3JSM A;  2NRW A;  4DR6 K;  2VQF K;  3MEC A;  3V9U A;  1Y97 A;  1GLE G;  2IC3 A;  3QFU A;  3THY A;  1GOB A;  1R0A A;  3NF8 A;  1J5O A;  4DS4 A;  4R5P A;  1S5J A;  1WSJ A;  4JKB A;  3TR8 A;  1HNZ K;  3ULE B;  1KAZ A;  2XHB A;  4HHT A;  3E1Y A;  1L3V A;  1DTQ A;  2CGJ A;  2VG6 A;  2DPN A;  4WFN L;  3ZET A;  4JEP A;  4R79 A;  4YFU A;  4PL8 A;  1UA0 A;  4JI8 K;  1VQ6 N;  4LSL A;  2ZE2 A;  4LH4 A;  4E19 A;  4F4K A;  4GW6 A;  2HF3 A;  2P9S B;  1BWF O;  3ZT1 A;  1REV A;  3NF9 A;  2O8F B;  4OKK A;  3BZC A;  3TAN A;  3DYA A;  4BRQ A;  4WE1 A;  4EFH A;  1VSD A;  4WCE L;  3H08 A;  3HT3 A;  3LPT A;  1HPM A;  1XUP O;  3U9D A;  4HCB A;  1O13 A;  4DV7 K;  1RTJ A;  3O9U A;  4DSJ A;  2D4W A;  1HRH A;  3SQ4 A;  5C25 A;  4JI2 K;  4B9T A;  3MCA B;  3CQX A;  5BRE A;  4FZX C;  2ATQ A;  1NM1 A;  4CZL A;  3C95 A;  3M6G A;  3THX A;  4DR1 K;  3MXJ A;  1NOY A;  1U04 A;  2ETJ A;  3VEZ A;  1XMQ K;  1X1P A;  2F8T A;  4EP4 A;  1KAY A;  3BP8 A;  3K5L A;  3L2Q A;  1K8A O;  1RBS A;  1RT7 A;  2QWO A;  1CXU A;  4EP5 A;  2OPP A;  4OGC A;  1NWK A;  4FZZ A;  4CF8 A;  4AIL C;  2FSK A;  3T1Y K;  2UXB K;  3VQE A;  3DRS A;  1HNX K;  4IEI A;  1XC9 A;  4X66 K;  3E01 A;  1M90 O;  4JAX A;  1KFS A;  1TAQ A;  5KI6 A;  4DUZ K;  3IRX A;  2Q0U A;  4HTU A;  3VN5 A;  4CFA A;  2ZM6 K;  3O5B A;  4CHO A;  4B9M A;  4YOU A;  5HLF A;  1GLA G;  4WQ5 A;  3H6E A;  5J1E A;  4CEF A;  5DM7 L;  5BRH A;  4CBW A;  3ZSQ A;  1MU2 A;  1NK6 A;  1ZYQ A;  1SUQ A;  4KO0 A;  2NRT A;  1WSF A;  3MED A;  4PKH A;  2YKN A;  5M1O A;  1JKH A;  3CG7 A;  2P9I B;  4JKA A;  3Q7B A;  4X65 K;  1TUY A;  3SCX A;  4LD0 A;  3ATU A;  3MX2 A;  4AH9 A;  4K25 A;  5CR4 A;  3UKR A;  4FJ5 A;  2VWK A;  3AO4 A;  5LMN K;  4C1N I;  1RT2 A;  2Z1G A;  2DFH A;  2P9N B;  1LW2 A;  4DR4 K;  3SAF A;  1VAZ A;  3VEN A;  4H4M A;  3SQ0 A;  5EXW A;  3SV4 A;  3CQY A;  5AQY A;  1WSG A;  1U49 A;  1NLV A;  3AO2 A;  1BHL A;  1XMO K;  3AVG A;  4PWD A;  3SUP A;  1ASW A;  5FPM A;  2HBM A;  1C1A A;  5CYM A;  2HND A;  1NGA A;  1EX4 A;  3VTI A;  3PX0 A;  2YNG A;  4OO1 J;  4BDZ A;  4JLH A;  3VQB A;  3QET A;  1C0M A;  4DCH A;  3CJC A;  3MWP A;  5A2Q O;  4JV5 K;  3WQT A;  4DF8 A;  4BC4 A;  2QXL A;  3ZSV A;  3MX5 A;  2QW9 A;  3NH1 A;  1ZBI A;  3KKR A;  3VER A;  4H0P A;  3PO4 A;  1U6Z A;  4ICL A; 
#chains in the Genus database with same CATH homology
 4RW6 A;  4H8K A;  4FLU A;  2IOC A;  4B8C A;  1BI4 B;  4F3O A;  4FJI A;  1TL3 A;  3VQ7 A;  3KK3 A;  4KHY A;  4RW7 A;  4KI4 A;  4FXD A;  1ZBH A;  2XY8 A;  1J53 A;  2O4G A;  3L2W A;  1RTD A;  3PY8 A;  3OYK A;  4Q0B A;  4FJ8 A;  1Z26 A;  1C1C A;  4O5B A;  3NAE A;  4HUE A;  2HHW A;  3QIN A;  4PUO A;  3HJF A;  5HRS A;  4IFV A;  4KTW A;  3SQ1 A;  3S3O A;  1SL2 A;  3K59 A;  4B9V A;  4IFY A;  1LW0 A;  2FBV A;  2EHG A;  4FJJ A;  3AO3 A;  4CJR A;  3U6F A;  3CM5 A;  5C24 A;  4E7K A;  1BCM A;  3L8B A;  3PX4 A;  2VG7 A;  4OLA A;  3HP6 A;  3B6O A;  3S9H A;  4W5N A;  4CGJ A;  4DQQ A;  3TAQ A;  3DRR A;  2G8I A;  4DTR A;  1XHX A;  3SJJ A;  5FRN A;  5FRM A;  1SV5 A;  4FJ9 A;  3ALY A;  4KKO A;  1KTQ A;  3QIP A;  3TWH A;  1RTH A;  3PX6 A;  1D9D A;  1QHT A;  3QES A;  1RT5 A;  2X6N A;  3KKS A;  2IS3 A;  3CFO A;  4OKJ A;  1VSE A;  4CEB A;  3OYB A;  3RWU A;  4CGF A;  2QK9 A;  3OVN A;  4B9L A;  2HB5 A;  4PQU A;  4M3W A;  1S1X A;  3DMJ A;  3KLF A;  4Q5V A;  4FLW A;  1Z25 A;  1RBT A;  5JS2 A;  1QS4 A;  3HL8 A;  5DMR A;  3LP3 A;  3QEX A;  2E6L A;  1RBR A;  3TAE A;  1QSL A;  1VSL A;  4W5T A;  2P5G A;  2DY4 A;  1YVU A;  3ZSO A;  1UAX A;  4TSX A;  4AHC A;  3JYT A;  3AA2 A;  2W42 A;  4FJM A;  3AVC A;  3AVL A;  3MEG A;  5SWM A;  2EX3 A;  3L2U A;  4KRE A;  1VSK A;  4FJK A;  3MEE A;  3DLE A;  3SUO A;  1BIU A;  4C8N A;  2BGG A;  1ZBU A;  4KV8 A;  4FLZ A;  4FM1 A;  3O3G A;  3HPG A;  3HPO A;  4M3T A;  1S9E A;  3C6T A;  4OGE A;  1N6Q A;  2YKM A;  3OYC A;  1T03 A;  1ASU A;  2G8U A;  2D0C A;  2P51 A;  1RT3 A;  1A5V A;  4DTS A;  1WN7 A;  2X78 A;  5DK5 A;  4AHR A;  3LDS A;  3OS2 A;  1D5A A;  1NK9 A;  4CJK A;  1HJR A;  4Y1C A;  4FW2 A;  3BGR A;  1JL1 A;  3CM6 A;  5CZ2 A;  3ZSW A;  3V6D A;  3VQA A;  2F8S A;  1UA1 A;  1B92 A;  2IDO A;  1L3T A;  3HM9 A;  3VA3 A;  2AJQ A;  2B5J A;  3PUF A;  1LAW A;  2WON A;  2FBT A;  4IDK A;  4CF1 A;  3P1G A;  1IKX A;  3KK1 A;  4JS4 A;  1S1W A;  4NCB A;  1BIZ A;  5J2M A;  2G8V A;  4Z4G A;  2KZM A;  1CZ9 A;  4NCG A;  3ZT3 A;  4E89 A;  3KLI A;  3L3V A;  4JRP A;  4KI6 A;  2HMI A;  3TAM A;  1EXQ A;  4DU1 A;  1DLO A;  1RDC A;  3B6P A;  3OYE A;  4ELV A;  4KTZ A;  3RMA A;  4G1Q A;  3AVJ A;  4CIE A;  4FCY A;  3OS0 A;  3HVT A;  1LWE A;  3M8R A;  4DLG A;  4C8K A;  4LSN A;  5E41 A;  3NF7 A;  4FK2 A;  3VQP A;  3D45 A;  2XY6 A;  1Q9Y A;  2Q3S A;  2G8W A;  3NH0 A;  1S1T A;  1S9G A;  1WSI A;  3P83 D;  3V1R A;  3DI6 A;  4O44 A;  4CJS A;  5C42 A;  1JLE A;  3HO1 A;  3NF6 A;  3G0Z A;  3KJV A;  4C8O A;  2JLE A;  4AHU A;  3VA0 A;  1RIL A;  4DQS A;  3DOL A;  4FJX A;  3SV3 A;  1KSP A;  3C94 A;  1T8E A;  2QKB A;  3QEV A;  1TKX A;  3RTV A;  2HHT A;  2DFF A;  2ZD1 A;  1LWF A;  4EZ9 A;  1VSH A;  3NCI A;  1NOZ A;  3LWL A;  4NCA A;  4CEZ A;  4FJN A;  2VWJ A;  3AVA A;  1JLB A;  3WNF A;  4CJT A;  3I0R A;  2G8F A;  3L3U A;  3KIO A;  1S1U A;  1SL0 A;  4O4G A;  1KVA A;  4CHP A;  4CCH A;  4M3X A;  3T3F A;  1NKB A;  1QSY A;  2YNF A;  4BAC A;  5KRT A;  3PO5 A;  1L3U A;  3CFP A;  4OPK A;  1TKZ A;  2KQ2 A;  3AA4 A;  3P5J A;  1C1B A;  3ISN C;  3K57 A;  1XWL A;  2BE2 A;  3QIO A;  1NK0 A;  2D0A A;  4RW4 A;  4DWI A;  4O0I A;  1C6V A;  1RBV A;  4W5O A;  4FK4 A;  5HRP A;  2GBZ A;  4M45 A;  4I2Q A;  4JRQ A;  3S3N A;  3VQ4 A;  2R7Y A;  1HNV A;  4CES A;  4FLT A;  1EET A;  1TGO A;  4CJW A;  3MXM A;  2PZS A;  4IG0 A;  2IAJ A;  4KHW A;  4E7L A;  1RBU A;  4CJQ A;  3HPH A;  4FJL A;  3UIQ A;  4W5R A;  4JS5 A;  2HHX A;  4HCC A;  3MAQ A;  2BAN A;  4KTQ A;  2OPQ A;  4M42 A;  1JLF A;  3AVH A;  1JLG A;  4W5Q A;  5HRO A;  1SL1 A;  1IKW A;  1CZB A;  3K2P A;  4B9N A;  1RDD A;  4J2A A;  3QEI A;  3G10 A;  1K6Y A;  4UQG A;  1IKV A;  2QXF A;  3QNO A;  4E0D A;  2HHU A;  4CJU A;  1QSS A;  1N5Y A;  4BE0 A;  1ZBF A;  3AVB A;  4M3U A;  3U3G A;  4CK2 A;  4N47 A;  4DFJ A;  2HVI A;  1FXX A;  3RMD A;  4AHT A;  1VSM A;  5FRO A;  2GUI A;  1RT1 A;  3VQC A;  4KHN A;  2X74 A;  4ID5 A;  3HK2 A;  4LH5 A;  4RG8 A;  4Z4H A;  3RRH A;  3ZCM A;  2B6A A;  3DLB A;  1S1V A;  3KLG A;  2FC0 A;  3V81 A;  4Y1D A;  1T7P A;  3CYM A;  2P1J A;  2Z1I A;  3AA5 X;  2OPS A;  3V9Z A;  4M3Y A;  3LP1 A;  3O3F A;  1KCF A;  5SZT A;  1KLM A;  1WLJ A;  3SUN A;  4Z4F A;  3OYD A;  2O4I A;  3HP9 A;  1RCH A;  2Z1H A;  1HYZ A;  3NDK A;  3ZT2 A;  4DTU A;  4KFB A;  2QKK A;  3DRP A;  1I39 A;  4GMJ B;  1GOA A;  2ZQB A;  3OYJ A;  4DU4 A;  3RRG A;  4CEO A;  3K5N A;  4DSF A;  1KFD A;  2NUB A;  3LP0 A;  3WNE A;  3CFR A;  4IKF A;  4ZHR A;  4QCL A;  1EP4 A;  4CHN A;  4I2P A;  4B3O A;  1BQM A;  4KPY A;  4CF9 A;  4CGG A;  4DFK A;  4CEQ A;  2KZZ A;  4CEC A;  3QEW A;  1NK4 A;  4CIG A;  1ASV A;  1W9H A;  4FLV A;  4DFP A;  1LWC A;  1NJY A;  3ASM A;  3V1Q A;  4FJG A;  4O0J A;  4DQR A;  3L2R A;  1RNH A;  1NJZ A;  2PY5 A;  4M41 A;  3BDP A;  1HQE A;  4DTP A;  4E1M A;  3I0S A;  3HXM A;  2YHA A;  2JGU A;  3V9W A;  4FZY A;  3EZ5 A;  3OYI A;  1NK5 A;  3KLE A;  2RPI A;  2E4L A;  1NKE A;  1ZBL A;  4J2D A;  3LAL A;  2KTQ A;  3ZSY A;  1JLC A;  3NGI A;  3RR8 A;  5CZ1 A;  2Z1J A;  3AO1 A;  1J9A A;  3C6U A;  1Q9X A;  1B9F A;  1VRT A;  3O4Q A;  3KD1 E;  3K58 A;  3CQ8 A;  3V9S A;  1HYV A;  1F21 A;  4O55 A;  4CFD A;  2ITG A;  3OYF A;  5D3G A;  3NE6 A;  2D0B A;  4DS5 A;  1NJX A;  2WOM A;  2P5O A;  4K8Z A;  3VQ9 A;  3LZI A;  3KTQ A;  4B8A B;  4HUF A;  4KHS A;  1JLA A;  4FJH A;  3AVI A;  1TV6 A;  4CK1 A;  3OYH A;  3AVF A;  4DQI A;  4FLY A;  4BE2 A;  4CJ3 A;  3THV A;  1TK0 A;  3V9X A;  3L2V A;  4CK3 A;  3JSM A;  1D9F A;  4CGI A;  2YNI A;  4DFM A;  3V1O A;  5HBM A;  3MEC A;  3VQD A;  1RTI A;  1Y97 A;  3ZT0 A;  3V9U A;  1G15 A;  1A5W A;  1FKO A;  2IC3 A;  3OYM A;  1EKE A;  1GOB A;  1IG9 A;  1LV5 A;  1R0A A;  4DQP A;  4E7J A;  3NF8 A;  1J5O A;  4F3T A;  2HHV A;  4DS4 A;  3RMB A;  4R5P A;  1S5J A;  1WSJ A;  1NK7 A;  3TR8 A;  5CY4 A;  4H4O A;  2E6M A;  3I8D A;  3AVM A;  2XHB A;  1SKS A;  4I9Q A;  4HHT A;  1L3V A;  1DTQ A;  4KHQ A;  4E3S A;  3QO9 A;  4DMN A;  2VG6 A;  4PA1 A;  2XO7 A;  1RT6 A;  3DLH A;  2OPR A;  4L8R B;  4Z4E A;  3AVK A;  3IAY A;  3K5O A;  2XY5 A;  1S6Q A;  4YFU A;  4K8X A;  1UA0 A;  4CHY A;  1HMV A;  3LWM A;  5I3U A;  4DSK A;  4KHU A;  4LSL A;  2ZE2 A;  4LH4 A;  4E19 A;  4F4K A;  4GW6 A;  4CJP A;  2HW3 A;  3ZT1 A;  2FBY A;  1REV A;  3NF9 A;  4OKK A;  3TAR A;  1X9M A;  1ITG A;  4ID1 A;  3IG1 A;  5KGX A;  2DFE A;  3DLK A;  3M8P A;  3DYA A;  3TAN A;  3SUQ A;  2F96 A;  3AA3 A;  4Z4C A;  3EY1 A;  4WE1 A;  3K5M A;  1VSD A;  5HRN A;  4CF2 A;  4N76 A;  1YTA A;  1U48 A;  3M8Q A;  3ZSR A;  2KFZ A;  3H08 A;  3HT3 A;  3LPT A;  3OY9 A;  4ELT A;  3IS9 A;  4CEA A;  1T05 A;  3O4N A;  4HCB A;  1RDB A;  4CHZ A;  1RTJ A;  3NFA A;  3S3M A;  4DSJ A;  4CHQ A;  1KRP A;  2OA8 A;  4CE9 A;  2RN2 A;  3VQ5 A;  4ELU A;  4FLX A;  4BE1 A;  3OYL A;  1X9W A;  1SKR A;  2XY7 A;  1U45 A;  4BWJ A;  1HRH A;  1HPZ A;  3SQ4 A;  5C25 A;  1WNS A;  3SQ2 A;  1L5U A;  3LAK A;  4FM0 A;  4B9T A;  3HVR A;  5I42 A;  3VQQ A;  5CYQ A;  4HUG A;  3VQ6 A;  4DTO A;  3ZSZ A;  1BIS A;  2Y1J A;  4FZX C;  4F2S A;  4E1N A;  2ATQ A;  1HNI A;  2B4J A;  3OJU A;  4FJ7 A;  2YHB A;  2HNY A;  3LAN A;  1KVB A;  3C95 A;  5KRS A;  4ZTJ A;  4RW8 A;  4C8M A;  2OYQ A;  3MXJ A;  1QE1 A;  3WNG A;  4FM2 A;  1IO2 A;  1BI4 A;  1U04 A;  3DLR A;  2ETJ A;  4CGH A;  1NOY A;  2RF2 A;  4N5S A;  1TAU A;  3T19 A;  1X1P A;  4FYD A;  3OYN A;  2F8T A;  4EP4 A;  5FDL A;  3DLG A;  4AHS A;  3OYA A;  1WSH A;  3NBP A;  3K5L A;  3L2Q A;  3FFI A;  4CED A;  1I3A A;  1VK0 A;  4M3R A;  4HVJ A;  4KB0 A;  2OZS A;  3ZSX A;  4CGD A;  1RBS A;  1RT7 A;  5KGW A;  1BL3 A;  1CXU A;  4EP5 A;  2OPP A;  4OGC A;  4CF0 A;  5KTQ A;  1QQC A;  1HQU A;  4DTJ A;  4FZZ A;  4CF8 A;  1C0U A;  3QEP A;  4AIL C;  3NHG A;  4OPJ A;  4M3Z A;  3O3H A;  3OJS A;  5J2Q A;  4IBN A;  4CIF A;  4DSL A;  4FVM A;  3VQE A;  3DRS A;  3QNN A;  4LY7 A;  4CJF A;  1TKD A;  1XC9 A;  1WAJ A;  4PY5 A;  1JXE A;  3E01 A;  1KFS A;  4YNQ A;  1TAQ A;  5KI6 A;  2G8H A;  1TKT A;  3IRX A;  3M8S A;  4C8L A;  4DLE A;  1O1W A;  4DTN A;  4HTU A;  3VN5 A;  5J2P A;  3LAM A;  4OLB A;  4CFA A;  4MQ3 A;  4CJL A;  3WNH A;  5T7B A;  4DTX A;  1WSE A;  4B9U A;  2VG5 A;  4CHO A;  2PYL A;  4B9M A;  3AO5 A;  1HYS A;  1VSJ A;  2GV9 A;  4QAG A;  4DTM A;  3RR7 A;  5EU7 A;  3TAG A;  5HLF A;  1TK8 A;  5HP1 A;  4DU3 A;  3NGY A;  1TL1 A;  1CXQ A;  5J1E A;  1X9S A;  2X6S A;  4CEF A;  1NK8 A;  1XHZ A;  2DTU A;  2D5R A;  4B9S A;  3ZSQ A;  1MU2 A;  1NK6 A;  3TAP A;  3SI6 A;  4ZTF A;  1ZYQ A;  1JL2 A;  4QOZ B;  1SUQ A;  1RDA A;  1VSI A;  2IGI A;  4KO0 A;  4CJE A;  4DSI A;  4KAZ A;  4J2E A;  3F9K A;  4B08 A;  5J2N A;  1U47 A;  1WSF A;  4J2B A;  3MED A;  4GVM A;  1VSF A;  2YKN A;  4CFB A;  3F73 A;  3SZ2 A;  1JKH A;  3CG7 A;  4FK0 A;  1LAV A;  1W0H A;  3AV9 A;  3A2F A;  3ZT4 A;  4NYF A;  4OKE A;  4I9L A;  4LD0 A;  3SCX A;  4N56 A;  3SPY A;  3LP2 A;  4KRF A;  4MFB A;  4BDP A;  4IG3 A;  1A5X A;  3QER A;  4AH9 A;  4Z4I A;  4AHV A;  1NJW A;  2HVH A;  2BDP A;  4FJ5 A;  1U4B A;  4CEE A;  2A1S A;  3DOK A;  2A1R A;  1DTT A;  2VWK A;  2KW4 A;  1BGX T;  3HST B;  4CJ4 A;  3AVN A;  2HNZ A;  3AO4 A;  3ITH A;  2I5J A;  4DSE A;  1XI1 A;  4OVL A;  3LPU A;  4BWM A;  1BQN A;  3RMC A;  1RT2 A;  2Z1G A;  2DFH A;  1LW2 A;  3LZJ A;  4DG1 A;  5K14 A;  3DM2 A;  4BDY A;  4I7F A;  3SYZ A;  3TAF A;  3KD5 E;  1S6P A;  4H4M A;  3SQ0 A;  3SV4 A;  3SPZ A;  1WSG A;  1U49 A;  2HHS A;  3AO2 A;  1BHL A;  1Q8I A;  3U3Y A;  2RKI A;  3AVG A;  1B9D A;  3NH2 A;  3ULD A;  4PWD A;  3SUP A;  1L3S A;  1ASW A;  3OS1 A;  1KVC A;  3SNN A;  1D8Y A;  3KK2 A;  1C1A A;  3OYG A;  5CYM A;  1TK5 A;  1KLN A;  3NGZ A;  4CFC A;  3MXI A;  2FBX A;  2HND A;  3QLH A;  1UOC A;  3V4I A;  1EX4 A;  4N41 A;  1IKY A;  3T1A A;  1FK9 A;  3PX0 A;  2YNG A;  4FW1 A;  1IH7 A;  1BCO A;  4CER A;  3TAB A;  3KLH A;  4XIU A;  4BDZ A;  1UWB A;  4JLH A;  2HHQ A;  1SKW A;  1VRU A;  3VQB A;  3QET A;  1C0M A;  1JLQ A;  2G8K A;  3HYF A;  1QTM A;  5HRR A;  1TVR A;  4RW9 A;  4CJ5 A;  3TI0 A;  4EZ6 A;  1YTU A;  4DF4 A;  1NKC A;  3PV8 A;  2PYJ A;  4CJV A;  2YV0 X;  3VQ8 A;  4KB1 A;  2KFN A;  1WAF A;  4OJR A;  4DF8 A;  2OZM A;  1GOC A;  3ZSV A;  2YNH A;  4F2R A;  3NH1 A;  1RT4 A;  1ZBI A;  3KKR A;  2XRI A;  4NYN A;  4Z0U A;  3D0P A;  1CLQ A;  4E7H A;  3PO4 A;  4F8R A;  1J54 A;  3EYZ A;  4E7I A;  1YT3 A;  1JXB A;  1C0T A;  2LSN A;  1FKP A;  5JS1 A;  4ICL A;  2Y1I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...