3AVAA

Crystal structures of novel allosteric peptide inhibitors of hiv integrase in the ledgf binding site
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
154
structure length
150
Chain Sequence
SSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title Crystal structures of novel allosteric peptide inhibitors of HIV integrase identify new interactions at the LEDGF binding site.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Recombination/inhibitor
total genus 58
structure length 150
sequence length 154
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3avaA00
1C0MA 3QEVA 4K8XA 3OYFA 1I39A 2HNYA 4NCGA 2PYLA 3NGIA 1SUQA 3HP6A 1NK5A 2BANA 3G10A 4KV8A 4OPJA 1TGOA 2XY6A 1HRHA 3T3FA 3L3VA 4F2RA 3OJUA 4KTWA 3D0PA 4Q0BA 1NK7A 5KRSA 3LPTA 4EZ6A 4OVLA 3NF6A 3VQAA 4AHSA 4HHTA 4EZ9A 4FJIA 1VRUA 2YNHA 3L2UA 3LP3A 4OJRA 3MEDA 1U48A 3B6PA 3K57A 3TWHA 1YVUA 3DRPA 5KGXA 2IGIA 2RN2A 5J2PA 1R0AA 2DY4A 1RT5A 4B08A 3DOLA 3HPHA 4Z4CA 1QSSA 3EZ5A 2HMIA 1NJZA 3OY9A 1SKWA 4FXDA 1XHXA 4AHCA 4B9LA 1VK0A 4W5TA 3VN5A 2EHGA 3WNFA 2LSNA 2G8HA 4DQIA 3HT3A 1JLCA 1NKCA 3TAEA 1ITGA 4H4OA 1S6QA 4AHVA 3PO4A 4ZTFA 3VQPA 3PO5A 3M8PA 1BISA 4E0DA 4BACA 4CIGA 1Q8IA 3ZSRA 4DTJA 3TAFA 3NF7A 3OYEA 4CGHA 1S9GA 1VSKA 4XIUA 3KIOA 3RMAA 1REVA 2E6LA 5FDLA 1TL3A 4CFDA 2KW4A 4FM1A 3QEWA 5CZ2A 3SNNA 3ZSVA 1S9EA 3ZT4A 4OPKA 3G0ZA 2ZE2A 4HVJA 4UQGA 4BDPA 4FJGA 3HL8A 5SWMA 1IKWA 4E7LA 3KTQA 3NH0A 4KI6A 1G15A 4I2PA 3AO4A 3LP2A 1XWLA 1ZBLA 4F8RA 2OPRA 1D9DA 4DQSA 3DLHA 3DYAA 3VQQA 4KHQA 3P5JA 4ELTA 1ASUA 3AA2A 4O55A 2W42A 3AVIA 4FCYA 1YTUA 3HK2A 1KCFA 4KTQA 3AVJA 4W5NA 2HNDA 4N76A 4NCAA 4CHNA 3IRXA 1W0HA 3QESA 3AO2A 4ELUA 2HHSA 4RW9A 4AH9A 1B9DA 4CJRA 3AA4A 4CGFA 3HXMA 4O4GA 4CIFA 3SUQA 1N6QA 2YHAA 4DTRA 2XY5A 4B9UA 4M41A 4PQUA 1JXEA 1RBUA 4R5PA 2DFFA 1TK8A 3LZJA 1B9FA 1WSJA 2XY8A 1KVBA 3I0RA 1YTAA 4CJPA 1QS4A 3O3FA 3NDKA 3S3NA 4M3XA 4FZXC 4DS4A 2QXFA 2HHWA 5J1EA 1WNSA 5HBMA 4GVMA 4CGDA 3LAKA 4RW7A 1JLGA 5K14A 3VQCA 3M8RA 1HNIA 1S1UA 1SKSA 2OPQA 1JL2A 1RTJA 2IOCA 3A2FA 4Y1CA 2RPIA 3WNHA 2YNFA 4AHUA 4YFUA 4DU1A 4BWMA 4W5RA 1U4BA 4Z4FA 2HHXA 3E01A 3L3UA 3RR7A 3LALA 2JGUA 3L2VA 1LW0A 4FM2A 4CECA 1L5UA 4DTOA 4HUGA 3HPOA 4E3SA 3NF8A 4C8NA 2OYQA 2DTUA 1NJWA 4LSLA 3SUOA 2E6MA 3LPUA 4IDKA 3DLKA 3HSTB 1TKDA 3AVFA 3PY8A 3K5OA 4DSKA 3MEGA 3RMBA 4OLBA 1QTMA 5DMRA 3V4IA 2OA8A 3OYHA 5HRNA 1IO2A 4O44A 3NE6A 3ULDA 2OZMA 4CF0A 1UWBA 1IKVA 4FLTA 2G8IA 1LW2A 2IAJA 2A1SA 1VSMA 2YHBA 3OYMA 3OYJA 3HP9A 1BIUA 3VQ8A 2DFEA 4W5OA 1TL1A 3HPGA 3KLGA 1HMVA 4DWIA 3HO1A 1FXXA 1LAWA 3M8QA 3SQ4A 4FLYA 1RT7A 4HUFA 4CHPA 1BCMA 3AVCA 2QKKA 4FVMA 1RT6A 4IFVA 1S5JA 1CXUA 4CEBA 1HJRA 4JLHA 1T05A 1T7PA 1WSGA 1RT4A 1U45A 3RR8A 1BI4A 4ID5A 3PX0A 2QKBA 4CF9A 4N41A 4IKFA 2FBVA 2Z1HA 4BE0A 1EKEA 1HPZA 1TV6A 4N5SA 3OS0A 4B9TA 1EX4A 1UA0A 1J9AA 4B9MA 3LDSA 4KHWA 1SV5A 5T7BA 1BIZA 2HB5A 4CJVA 2X74A 4DTUA 2HHVA 3ZSQA 2YKMA 5KRTA 4DSEA 3MEEA 3SUPA 4K8ZA 3OJSA 3KK3A 4CJTA 5I42A 3KKRA 1WSHA 2WOMA 3MXMA 4O5BA 1N5YA 5FRNA 3L2QA 3OYBA 1NKBA 4PY5A 4E7HA 3KKSA 3V1OA 3FFIA 4OGEA 4BDZA 5EU7A 1F21A 2WONA 3PX6A 2F8SA 2HVIA 3AVHA 3HVTA 2YKNA 1ZBFA 4CJLA 4FM0A 1RDCA 4B9NA 4ID1A 1GOCA 5CZ1A 1BGXT 1FK9A 1HYZA 2VWJA 4Z0UA 5KI6A 3QINA 4DTNA 3EYZA 4FYDA 1C0UA 4QCLA 3QIOA 4RW6A 4CJ3A 3OYCA 4CJEA 1JLFA 4CK3A 2Y1IA 3QNOA 1T03A 4RW4A 4Z4EA 3O3GA 4CEFA 1W9HA 2B5JA 3QERA 3LANA 3UIQA 3LWMA 4Z4IA 1KRPA 4DU3A 4F3OA 1KTQA 1RT1A 3K58A 1CLQA 2PZSA 1NK9A 3KLIA 2VG6A 4IG3A 3AO5A 4Z4GA 1VSLA 2Y1JA 4CGGA 4F2SA 1XHZA 1WAJA 3V9ZA 4CHZA 4I9LA 2X6SA 1BHLA 3I0SA 1GOAA 3ZT1A 4Z4HA 4F4KA 3S9HA 5FROA 4H4MA 4C8MA 3V9UA 3ZSYA 4CJ4A 1RDDA 4CEZA 2OZSA 2QK9A 1HNVA 4KB0A 1X9WA 4EP4A 4M45A 3PV8A 1K6YA 1VRTA 5CYQA 4CE9A 1A5XA 1NOZA 2GUIA 3TAMA 2VG5A 4CF8A 4FJMA 3O4QA 5FRMA 4M3ZA 3SQ1A 3WNGA 4DSJA 4E1MA 3CYMA 2P1JA 2Z1JA 2G8UA 4FJNA 3SQ2A 3IS9A 4C8KA 1L3SA 5HLFA 4QOZB 4ICLA 3KK2A 2DFHA 3KLEA 4O0JA 4DQQA 4KI4A 2OPSA 4HTUA 4JRPA 1JLBA 3ZCMA 3F73A 4DFJA 1Q9YA 1I3AA 3ZSZA 4DLGA 1Z25A 1HYVA 4E1NA 2ETJA 4TSXA 3QO9A 4CFAA 1NK8A 4KRFA 1ZBIA 1RNHA 5JS1A 2NUBA 1S1TA 1RTDA 4B3OA 1TKTA 5C25A 5JS2A 1DTQA 2GV9A 3RTVA 4FJ5A 2X78A 3S3MA 3L2WA 1HQUA 4OGCA 5J2QA 4DU4A 1BCOA 3CFOA 1YT3A 4GW6A 2G8KA 3ZSXA 5HRPA 3M8SA 1RCHA 3SQ0A 3PUFA 3TABA 1U47A 1T8EA 2BE2A 1D8YA 1CZ9A 1FKOA 4DTPA 4CF1A 1NOYA 1QSLA 4CK2A 4G1QA 4N47A 4M42A 4KAZA 2Q3SA 3VQEA 3OYAA 3U6FA 1TVRA 2XRIA 3SCXA 1Y97A 1BQNA 3EY1A 3SJJA 1A5VA 2HHUA 4KKOA 1BQMA 3RRHA 3P1GA 4OKEA 3VQ4A 2EX3A 1DLOA 2FC0A 2IC3A 2RF2A 3CQ8A 2VWKA 4CEDA 4FW2A 4DLEA 1L3UA 4CFBA 3BDPA 1EP4A 5KTQA 3KLHA 2P5GA 5CY4A 3ALYA 4FJ7A 4FZYA 3TAGA 4E19A 1KVAA 2XHBA 1JLQA 4DFPA 2KZMA 4WE1A 4Y1DA 3SV4A 3QEIA 1NKEA 1RBTA 2HHTA 3DLBA 5CYMA 4CHQA 3ZT0A 3NCIA 1VSEA 3THVA 1U04A 3VA3A 4JS5A 2YNIA 1RTIA 3ISNC 4NYNA 1EXQA 2OPPA 5HP1A 1SL1A 3IAYA 3OYNA 2HHQA 3HVRA 3K59A 4AHTA 1VSHA 2KFZA 1D5AA 4JRQA 4KHSA 1RTHA 2F96A 4E89A 4KHUA 3HYFA 3K5LA 3CFRA 3LWLA 1S1VA 3L2RA 2Z1GA 1L3VA 4DSLA 3RMDA 3V81A 3DRRA 2GBZA 1X9SA 3MXIA 3KD5E 4L8RB 3KK1A 3TR8A 5HRSA 1SL2A 1CZBA 1QSYA 1HQEA 4NYFA 2FBYA 4C8LA 3QETA 4CEOA 1J54A 3T19A 4CESA 3VQ6A 4DTSA 4ZTJA 1NJXA 3AVBA 4HCBA 4QAGA 2JLEA 3B6OA 4FLUA 4M3WA 3SPZA 1L3TA 1B92A 4FJLA 4LH5A 4FJKA 1KVCA 3QLHA 3C6TA 4FJ8A 5HRRA 1TKZA 4FW1A 4CHOA 1QQCA 4CJKA 3TAQA 5J2NA 4PWDA 4M3UA 3SYZA 2G8WA 4B8AB 3V9XA 4KTZA 2KQ2A 4DF4A 3RWUA 4FZZA 3AVGA 3NBPA 1CXQA 2VG7A 3V1RA 1TAQA 4NCBA 2D0BA 1RILA 3OVNA 4E7IA 3TI0A 4Q5VA 4J2AA 4FLZA 1Z26A 1IG9A 4FJJA 1RBVA 3C6UA 2YNGA 3K5MA 2ZQBA 3MAQA 1SKRA 5SZTA 2X6NA 1A5WA 3DOKA 1C1BA 1KFDA 4HUEA 4FLXA 3V9SA 3K2PA 3ASMA 3V6DA 4OKKA 4DQRA 3ITHA 3NHGA 1RT3A 1LWCA 1LAVA 3F9KA 1IKXA 1KSPA 3HJFA 2FBTA 2P5OA 4PUOA 2P51A 3DMJA 3V1QA 4W5QA 3TARA 4B9VA 1VSJA 2ZD1A 3MXJA 1WN7A 1C1AA 3RMCA 1XC9A 5I3UA 2B6AA 3D45A 1XI1A 1HYSA 2G8VA 3KD1E 3NH1A 4CK1A 4BDYA 2RKIA 4E7KA 1VSIA 4E7JA 1TK0A 3OYKA 1DTTA 3NGZA 4DQPA 5KGWA 2E4LA 3P83D 4ELVA 4OLAA 3ZSOA 1ASVA 1JXBA 1LWEA 3PX4A 2ATQA 4J2BA 2BGGA 4M3YA 4J2EA 4J2DA 4PA1A 4FK4A 4CJQA 3VA0A 1VSDA 3VQ9A 1WSIA 3NFAA 3SI6A 4LSNA 1BL3A 3VQBA 1S1WA 2O4IA 1ASWA 2Z1IA 3VQDA 4CJWA 3NAEA 2R7YA 4DS5A 3QEXA 1JLAA 2B4JA 4KPYA 1O1WA 1WSEA 4LD0A 4N56A 4GMJB 3K5NA 4OKJA 3NF9A 3L8BA 1Q9XA 2D0CA 3DI6A 3U3GA 3AVKA 5J2MA 1KLMA 3U3YA 1SL0A 2YV0X 1QE1A 3C94A 3CG7A 1VSFA 3QIPA 1ZBUA 3LP0A 3LP1A 3AVAA 5C24A 4RG8A 4CJFA 1NJYA 1D9FA 4CHYA 4EP5A 1UA1A 1J5OA 4C8OA 3AV9A 4JS4A 2KZZA 2FBXA 3RRGA 1RBSA 1QHTA 4YNQA 2O4GA 4BE1A 3LAMA 3CFPA 4DF8A 4M3TA 1X1PA 3NGYA 3SPYA 4I9QA 3NH2A 1UOCA 3AA3A 3SV3A 1S6PA 3AVLA 3AVMA 3IG1A 3QEPA 5DK5A 4CJUA 2AJQA 1JL1A 4MFBA 4F3TA 3TAPA 3WNEA 4I2QA 3OYDA 4BE2A 2G8FA 4DG1A 2HW3A 4FK2A 1RDBA 4B8CA 2KTQA 3T1AA 1MU2A 1TAUA 2I5JA 3SUNA 1C6VA 4BWJA 1EETA 3DLGA 1BI4B 3BGRA 3SZ2A 3ZT3A 4AHRA 4CGJA 4DTXA 2A1RA 4CJ5A 4KFBA 3O3HA 1RBRA 3DRSA 2HVHA 3AA5X 2XO7A 2KFNA 4IG0A 4LY7A 4FJXA 3TANA 5D3GA 4DMNA 4DSFA 2HNZA 3DLRA 4LH4A 1WSFA 3I8DA 1U49A 2D0AA 4CFCA 3OYIA 3LZIA 2IS3A 2PYJA 1KFSA 1C0TA 5C42A 1LWFA 3O4NA 1S1XA 3KJVA 4CEAA 4CGIA 4CEQA 4ZHRA 4AILC 5E41A 4FJ9A 1C1CA 1IH7A 3OYLA 4DSIA 1TKXA 3QNNA 4CJSA 3AVNA 1RT2A 4KHNA 2ITGA 4IFYA 4FLVA 1ZYQA 1NK0A 4DTMA 4H8KA 4HCCA 4CF2A 1UAXA 4DFKA 3ZT2A 3JYTA 3OS2A 3KLFA 1FKPA 1LV5A 4CERA 1GOBA 1ZBHA 3HM9A 1IKYA 2PY5A 1WLJA 4KB1A 4FLWA 3ZSWA 2IDOA 4CIEA 4CCHA 3MECA 3VQ5A 1KLNA 4KHYA 4CEEA 3JSMA 1JLEA 5HROA 4IBNA 3DLEA 4KO0A 1J53A 1RDAA 4I7FA 3CM5A 3H08A 4MQ3A 3OYGA 1NK4A 1TK5A 4B9SA 4DFMA 1NK6A 3DM2A 4FJHA 3OS1A 2BDPA 4O0IA 4KREA 3VQ7A 2XY7A 4FK0A 3AO1A 3S3OA 1WAFA 3AO3A 3CM6A 3V9WA 4M3RA 1X9MA 2F8TA 4RW8A 3C95A 2D5RA 1JKHA
chains in the Genus database with same CATH superfamily
3QEVA 1I39A 4IEIA 4NCGA 3VENA 3NGIA 1NK5A 4C1NK 4OPJA 5C15A 2OTJN 1TGOA 3R8EA 4GV3A 3T3FA 4A59A 3CXCM 3ZX3A 3LPTA 2V51B 3NF6A 4BR0A 1FJGK 1VRUA 2YNHA 3L2UA 3LP3A 4OJRA 4BRGA 1YVUA 3DXKA 5J2PA 3DOLA 3OHRA 3I56N 1QSSA 1JJ2M 5TKYA 3VGKA 4FWOA 1XHXA 3DLLL 4DR3K 4B9LA 3VN5A 4C1NI 2LSNA 2Q0UA 4B9QA 3CETA 1XNRK 5DM6L 3I33A 3SAFA 3F5TA 2JWKA 4IEEA 1Q8IA 5BRFA 3OYEA 1REVA 2NRXA 5FDLA 5HOOA 4FM1A 1XNQK 1MWMA 2UYTA 4CBWA 5SWMA 2KLAA 3VMFB 3AO4A 1XWLA 5A2QO 1ZBLA 2OPRA 3DLHA 4DQSA 5C10A 5FPEA 4ELTA 4A5BA 4O55A 3TSQA 3AVIA 4KTQA 1RDUA 1ESVA 4PL8A 3DXMB 3LDQA 3QESA 2H3GX 3EE9A 2HHSA 1NNEA 4RW9A 1B9DA 5H1SQ 3AA4A 1VQPN 4DTRA 2XY5A 4PQUA 4F9OA 2Q0RA 3J7ZO 1YHQN 1YTAA 3O3FA 3NDKA 4M3XA 2QXFA 4GVMA 2E2PA 1S1UA 2OPQA 1JL2A 4Y1CA 4DU1A 4DUZK 3I8BA 3RR7A 3VEYA 3LALA 2UUAK 3FR0A 1L5UA 4HUGA 3HPOA 2OYQA 1T6DA 3HSTB 4DSKA 3RMBA 4WFNL 2ZGYA 4DR1K 3V4IA 2OA8A 3WT0A 3FZFA 3NE6A 3ULDA 4IJAA 4CF0A 2A41A 1IKVA 3ZX2A 2G8IA 4H0XB 3OYJA 5AQGA 4JI1K 1BIUA 3HOSA 3VQ8A 2DFEA 5C2FA 5EXWA 4GNIA 4DWIA 2P9NA 2NRWA 3M8QA 4FLYA 4JKDA 5JVGL 1S5JA 5M1KA 1MWKA 4JLHA 2IVNA 3OW2M 3RVCA 4N41A 4JK9A 4C23A 1EKEA 4N5SA 3OS0A 1UA0A 4KHWA 4B9MA 1SV5A 3C6AA 4CD1A 3AAPA 2X74A 3CCSN 1E4FT 1VQ5N 1WSHA 4O5BA 2ITMA 1NWKA 4LF6K 1XQSC 3L2QA 3V1OA 4OGEA 1F21A 4M7XA 1NGDA 4CJLA 1RDCA 3TU5A 4B9NA 4ID1A 1GOCA 5AQZA 1FK9A 5KI6A 3QINA 4B3MK 2FXUA 4FOEA 3QNOA 4RW4A 5GAGP 2NZTA 1W9HA 2B5JA 3LANA 3LWMA 4CZIA 1KRPA 2ASOA 4WQ4A 1RT1A 1QQOA 1CLQA 2PZSA 2QWOA 2VG6A 4CBUA 3C0BA 1XHZA 4JI3K 5AQJA 4F4KA 5FROA 4H4MA 1VAZA 4CJ4A 1HNVA 2KHOA 3PV8A 1VRTA 3O4QA 4BREA 3WNGA 3CYMA 2P1JA 2Z1JA 2G8UA 2JWLA 4C8KA 5BR8K 3HOTA 2DFHA 3AGKA 4HTUA 3F73A 3M5RA 4DLGA 4OPHA 1S3XA 4E1NA 3AGRA 1ATNA 1RNHA 3O9QA 4B3OA 3RTVA 3D2EA 3THXB 5AZJA 4FOIA 5J2QA 4DU4A 1BCOA 4MDBA 5HRPA 4PKGA 2BE2A 1NOYA 5AFUA 4KAZA 4JEPA 1MDUB 3Q7BA 1Q86O 2XRIA 3SJJA 1HJOA 1BQNA 3EY1A 1NGEA 5F1XA 4JD2A 3H3OB 4YOVA 2FC0A 3CQ8A 3J7YP 3VEOA 2FLOA 4YOUA 3P31A 1L3UA 2OCEA 4E19A 1KVAA 4WE1A 1NKEA 4DV1K 4H5NA 5CYMA 4CHQA 1K8KA 4A62A 3JS6A 2P9UA 5JMVA 2ZWHA 3THVA 3VA3A 4JS5A 1RTIA 3ISNC 2OPPA 4FWNA 2QTDA 3ZYYX 2QW9A 3K59A 3H46O 2E2QA 3HSCA 4E89A 4KHUA 3HYFA 2IVPA 1ATRA 2HHHK 4V19S 5AQNA 4L8RB 3CC2N 1HQEA 3PLAA 2FBYA 2WBNA 3QETA 2NRZA 4H5WA 1J54A 4CESA 4ZTJA 3AVBA 4X65K 2JLEA 2P9IA 4FLUA 4WCEL 2O8FA 4FJLA 4FJ8A 4CJKA 2UUCK 4PWDA 2BTFA 4FZZA 4KTZA 3RWUA 2VCPA 3GOIA 1CXQA 4B3RK 3KWIA 3QFPA 1RILA 1GLLO 4E7IA 4FLZA 2AP1A 4BRFA 3C6UA 4YOYA 3MAQA 3CMAN 3O8MA 1HX1A 2X6NA 1A5WA 1C1BA 1KFDA 4FLXA 1K9MO 5AQXA 4DQRA 1DGKN 4UY8O 1LAVA 3F9KA 3HJFA 2FBTA 2P5OA 4NXNK 3V1QA 3TARA 5LMUK 1J5EK 4JKBA 1WN7A 2GTDA 1XI1A 3NH1A 4BR9A 3LM2A 4JI5K 3UKUA 4DQPA 4Y0WA 4DV2K 2E4LA 4I6MB 4OLAA 3PIOL 3CI5A 1LWEA 4J2BA 2ATQA 4FK4A 3VA0A 3FZKA 3NFAA 4LSNA 3NVMA 3CJ1A 2F8TA 4BR7A 1O1WA 3OBWA 4B1WB 4OKJA 2O8CB 1Q9XA 3WEEB 1K73O 5FPDA 3D2FA 3HZ6A 1QE1A 3QIPA 1QTMA 3LP1A 4CJFA 3GG4A 1UA1A 4JK7A 3CFPA 4DF8A 4M3TA 3C6HA 4BRHA 2E20A 1JL1A 3TAPA 4O8UA 3OYDA 4BE2A 4DG1A 1FW6A 1RDBA 4B8CA 1BA0A 2I5JA 1C6VA 3DLGA 1BI4B 3BGRA 3ZT3A 3WQUA 4AHRA 2NLXA 1TUYA 4KFBA 4K0KK 4IOXA 2A6AA 4FJXA 1Z6RA 3TANA 4DSFA 4LH4A 4FWRA 4A5AA 4QS8A 4B1ZA 3TSPA 3LZIA 2PYJA 2IS3A 1LWFA 3MK6A 2P9LB 1C1CA 1V4SA 4E1JA 3AVNA 3T69A 4IFYA 4FWQA 1HKBA 3GBTA 3CJ9A 4H8KA 1NK0A 4JKFA 4HCCA 4DFKA 3KLFA 5CHIA 3HI0A 2CGKA 3HM9A 2PY5A 4FLWA 3MECA 4KHYA 4CEEA 1D4XA 3NVKA 3OYGA 1J53A 4B9SA 1NK6A 2CGJA 4MO4A 3MDQA 3OS1A 3THYA 2XY7A 4FK0A 4WQ4C 4DR5K 3VQQA 3C95A 3RSEB 4K8XA 4B9UA 4MDAA 2PAVA 4JI2K 1ZXOA 3L3VA 1OVYA 4KTWA 4Q0BA 1NK7A 3CHWA 2P9SB 4FWLA 3VQAA 4AHSA 4CJ7A 4JI8K 3MEDA 3TWHA 3CIPA 2WTUA 1BO5O 5KGXA 2IGIA 4DV7K 2RN2A 2P9PA 5AQQA 3U9DA 1NM1A 4FXDA 2I7PA 2DPNA 1VK0A 3KWGA 2EHGA 4AM6A 1MA9B 2G8HA 3HT3A 4GKJK 4WFBL 1ITGA 3TAEA 4GV9A 1S6QA 1EQYA 3PO4A 4ZTFA 2RHKA 3VQPA 4E0DA 4BACA 4CIGA 1K8AO 3BZCA 3ZSRA 3OBYA 3NF7A 3TAFA 4CGHA 1VSKA 2FF3B 1TL3A 5I9EB 3QEWA 1S9EA 3ZT4A 4HVJA 2ZE2A 2Q1NA 4UQGA 1YIJN 3KTQA 1IKWA 5M1NA 3ZLJA 3SMPA 1RDWX 4LF5K 1ASUA 5BRHA 2W42A 4ILHA 1YTUA 1NMNA 3AVJA 1WB9A 4CHNA 2OTLN 3AO2A 4ELUA 4CZKA 4AH9A 3HXMA 4O4GA 2YHAA 3W3DA 4R5PA 3N4PA 1TK8A 2XY8A 3I0RA 1E3MA 1QS4A 2WFBA 2GX9A 2HHWA 5J1EA 4CGDA 5E26A 3LAKA 3CPWM 3M8RA 1SKSA 2HHXA 2IOCA 3WNHA 4DV4K 2RPIA 2YNFA 4YFUA 4W5RA 3CJ7A 1LCUA 1U2VB 2GEMA 4CECA 3L4QA 4DTOA 4E3SA 3NF8A 4IZ9A 3ZX0A 1YXQA 1TKDA 3AVFA 3H1QA 3K5OA 1VQ8N 5C0YA 3EZWA 5DMRA 1LOTB 4FLTA 1KAZA 2E1ZA 2A1SA 3HP9A 5M1FA 3SBGA 2HBJA 1RT7A 3UKRB 4FWKA 2QKKA 3T7ZA 1T05A 2QM1A 2F7TA 4IKFA 2Z1HA 1T3VA 4BE0A 1X9JA 3VF4A 1NGBA 3MCPA 1O13A 5T7BA 4CW7B 5F2RA 4JKGA 4DTUA 3ZSQA 2YKMA 3FFKB 2ZF5O 4K8ZA 3OJSA 4CJTA 3H3NO 4B1VA 1VQMN 1ZC6A 1JCFA 3KHYA 3FFIA 4BDZA 2P9KB 2HVIA 2F4VK 2YKNA 3QBWA 4BC4A 2IIRA 5AQKA 3BY5A 1HYZA 4IOCL 5JICA 4CZHA 3EKSA 1T03A 4O5FA 5AZIB 1NK9A 3KLIA 4IG3A 3TTFA 4Z4GA 5AQSA 3K9KA 4F2SA 1NLVA 1BHLA 3I0SA 1GOAA 3ZT1A 4Z4HA 5IT9O 3BF3A 3A5LC 4C8MA 3V9UA 1RDDA 1EWRA 2QK9A 5BPLA 5KPRA 1M1KO 5AJ3K 4EP4A 4M45A 1K6YA 1N8RO 3A5MC 4DUYK 3VEVA 1NOZA 2GUIA 4CF8A 5EX5A 3CQXA 3MX5A 3SQ1A 4FJNA 3SQ2A 2ZJQL 2A42A 5JVHL 3KLEA 3L6QA 4KI4A 1JLBA 4BVPA 4OO1J 1Q9YA 1Z25A 4H0VB 2QWQA 2ETJA 4CFAA 1NK8A 1OKJA 4KRFA 3SMSA 4BRMA 5JS1A 3U4LA 1BU6O 5TKWA 4NLBA 3L2WA 4AQYK 4FWPA 1YT3A 4GW6A 2D0OA 3M8SA 1U47A 3PUFA 4CZLA 3TABA 1D8YA 4CZFA 4M42A 4HTLA 3VQEA 5AQMA 1YAGA 3OTOK 1TVRA 3CCMN 1A5VA 1BQMA 3RRHA 3P1GA 3JXUA 4OKEA 2IC3A 2RF2A 3MMVA 2VWKA 5LY3A 5KTQA 3KLHA 1IBKK 3ALYA 4FJ7A 4DV6K 3TAGA 2VYPA 3ATUA 1JLQA 4DFPA 4Y1DA 1V4TA 3SV4A 2HHTA 4BY9C 1VSEA 1N34K 3CJAA 2YNIA 1EXQA 3IAYA 3HVRA 1D5AA 4JRQA 4JAXA 5M1OA 3DXKB 1JCEA 3MN9A 1S1VA 4DSLA 2GBZA 4KH6A 1XMOK 3F9MA 1CZBA 4NB4A 4CEOA 5C2DA 3T19A 4G9ZA 3JAMO 4BGBA 1L3TA 3CC4N 3QLHA 5HRRA 1TKZA 4CHOA 1QQCA 5EVZA 3SAHA 3TAQA 5J2NA 4M3UA 3SYZA 2G8WA 4B8AB 3V9XA 1T44A 4NCBA 1NJIO 4Q5VA 4J2AA 1Z26A 3ID6A 3K5MA 1OH6A 1SKRA 1VQ7N 4IOAL 4HWIA 4MO5A 3V6DA 3ITHA 1HR0K 1KSPA 3WXIA 2ZD1A 1C1AA 3LDNA 5AFUH 3RMCA 1NG9A 1XC9A 1HYSA 2B6AA 3D45A 2G8VA 4CK1A 2RKIA 4E7JA 3BEXA 2GWKA 1QVGM 3O08A 4WQ5A 2UXBK 4J2DA 1ZBSA 4CJQA 3VQ9A 4PHTX 3SI6A 2QWNA 4NLCA 1BL3A 1S1WA 5GADP 2O4IA 1Z05A 4CJWA 2GUPA 4DS5A 3VERA 4K43A 4LD0A 4GMJB 3K5NA 3L8BA 3U3GA 5J2MA 1KLMA 3U3YA 4H0TB 2YV0X 2ZM6K 1SL0A 3IMXA 4H5VA 1NJYA 3LP0A 2E8AA 4CHYA 4EP5A 3WQTA 2KZZA 3T1YK 4U7BA 3ZEUB 2O4GA 4BE1A 3PSIA 3NGYA 3SPYA 3VEWA 1UOCA 3AA3A 2I7NA 3IG1A 2P9NB 4F3TA 3WNEA 4FWMA 4I2QA 2HW3A 2KTQA 3T1AA 4BWJA 1TYQA 4DQ8A 4Z94A 1EETA 5LL6Z 4I6MA 2D0PA 3O3HA 3K9JA 3J80O 1KQSM 2ASPA 3THWA 5D3GA 3DLRA 3MN5A 3M6GA 4BQLA 1YITN 3OYIA 5BN9A 2O8CA 4KBOA 1QVFM 1CZAN 3U9ZA 5E41A 4DR7K 2PBDA 1TKXA 4CJSA 1RT2A 2ITGA 4FLVA 1ZYQA 3P38A 3B8AX 3J81O 3ENHA 4DTMA 4DR6K 4CF2A 1UAXA 1FKPA 4CERA 1WLJA 4KB1A 2V7ZA 1RFQA 4MLHA 4DB3A 1HPMA 3IKMA 5HROA 4KO0A 3A5NC 1VQKN 1RDAA 2F9TA 3CM5A 1NGFA 3H08A 4MQ3A 4DFMA 4FJHA 4BR4A 4O0IA 2BDPA 4KREA 3AO1A 1WAFA 3AO3A 1JXEA 1C0MA 3OYFA 4FJJA 3VGMA 1XC3A 2PYLA 2BANA 3G10A 2Q97A 1QHAA 1NGGA 4F2RA 2O8BA 3CCEN 1P90A 3OA9A 4EZ9A 4FJIA 2P9LA 2FSKA 3P39A 1U48A 3VTHA 3B6PA 3DRPA 1WUAA 1R0AA 2DY4A 2O8DA 2HMIA 1NJZA 3OY9A 3CCRN 1G99A 4JHDA 4W5TA 1Y64A 3WNFA 1JLCA 5AZJB 1NGJA 2FF6A 4H4OA 4AHVA 3M8PA 1M90O 3G4SN 4DTJA 1S9GA 4XIUA 3KIOA 3RMAA 2E6LA 4CFDA 5KPTA 3SNNA 5CZ2A 3ZSVA 1YF5L 4CI6A 4OPKA 4BDPA 4E7LA 4BR5A 1G15A 4I2PA 3LP2A 4F8RA 1HKCA 3DYAA 3P5JA 4X64K 3AA2A 4WF9L 1VQ6N 5E84A 4FCYA 4YY3K 3UB5A 1BG3A 2HNDA 4N76A 4NCAA 3IRXA 1H1VA 1X3NA 1NGIA 4YOTA 1K8KB 3O80A 3N4QA 4CJRA 3D7EO 4CGFA 3SUQA 4CIFA 1HUXA 2CH5A 4M41A 5LJVA 4BRLA 1WSJA 4NO7A 4LF8K 3A5OC 2HBKA 3HM8A 4BGAA 4CJPA 1GLEG 4FZXC 3VESA 1JLGA 5K14A 4DR2K 3MWPA 1HNIA 4XH4A 3VTIA 4YORA 4AHUA 3R6MA 4GY2B 1U4BA 4Z4FA 1OH5A 3E01A 3L3UA 3WXKA 1LW0A 3PSFA 4BR2A 1EO1A 2P9IB 2DTUA 1NJWA 2O8FB 1Q18A 4LSLA 3LPUA 3WXMB 3PY8A 4BROA 1S72N 2VWBA 2YHXA 2OANA 1HNXK 3EO3A 1IO2A 5GINA 1UWBA 1IV0A 2IAJA 1VQNN 3OYMA 4GV6A 2YHYA 2HF3A 1Q81O 2BH1A 4W5OA 3HPGA 3MN7A 5GAEP 1HMVA 3KLGA 3ULEB 3PIPL 1LAWA 2QI2A 3SQ4A 4HUFA 4JKCA 5AQYA 4CHPA 4BRDA 3AVCA 1KC8O 3EL2A 3CCQN 1T7PA 1HJRA 2W6LA 3D6RA 1RT4A 1U45A 1KD1O 4ID5A 2QKBA 4CF9A 2FBVA 4DV0K 1HPZA 3QICA 4B9TA 1EX4A 1J9AA 3P4IA 3LDSA 3VETA 4A57A 2QXLA 1BIZA 4BVOA 4CJVA 3G71N 2W6KA 2WUSA 2HHVA 4FPAA 1U2VA 4M63C 3H6EA 3SUPA 4DHYA 3BUZB 3O9UA 3KK3A 5I42A 3FZMA 2WOMA 1N5YA 4BRCA 5FRNA 1WBBA 4PY5A 4E7HA 1KAXA 3KKSA 3ZETA 4A2AA 3GDQA 2F8SA 3O1BA 3PX6A 4WQ5C 3QB0A 4BG9A 1ZBFA 4FM0A 5CZ1A 1BGXT 3EKUA 4Z0UA 4DV5K 4DTNA 1C0UA 4YDUA 3C7NB 5KQDA 3QIOA 4RW6A 4CJ3A 3OYCA 4CJEA 1JLFA 2Y1IA 4Z4EA 3UKRA 1W7AA 3O3GA 4CEFA 3SLCA 4CBXA 4DU3A 3UE5A 5CR4A 5ADXA 3K58A 3AO5A 4PKIA 3MX2A 3SBTA 4B1YB 4ISGA 4I9LA 2X6SA 4IDHA 3VF2A 1IG8A 5JLFA 1QZ6A 2YHWA 4IO9L 4CEZA 4BRPA 4KB0A 1X9WA 3KK7A 3R1XA 2D4WA 5CYQA 2HMPA 4O8KA 4JKAA 3TAMA 1HNZK 4B3TK 4FJMA 2HSTA 4H0OA 4M3ZA 3KZBA 1YJNN 1L3SA 3CC7N 4WYBA 5EOYA 1SZ2A 3WUHA 4DQQA 1I3AA 1DEJA 1ILYA 4TSXA 3ID8A 3QO9A 4XH1A 1ZBIA 4JN4A 3QFUA 5JS2A 1DTQA 2GV9A 3QMLA 1QZ5A 4FJ5A 1XUPO 3VPZA 4H0YB 3CFOA 1VQ4N 2G8KA 4YOWA 3ZSXA 3SQ0A 4EHUA 1VHXA 1I94K 4CF1A 4CK2A 5AQTA 4N47A 3U6FA 2E2NA 3SCXA 1Y97A 3FLCO 2HHUA 4KKOA 5AQUA 3THYB 3VQ4A 2EX3A 3VEXA 4CEDA 3TPQA 4CFBA 3BDPA 5EY4A 5B8HA 2P5GA 1BDGA 3M1FA 5BPMA 5AQLA 3J8AA 2KZMA 1GLDG 3DXMA 1RBTA 3DLBA 3NCIA 1N33K 3GE1A 4ISEA 5HP1A 3R3LA 2HHQA 1R59O 4AHTA 4KHSA 2F96A 2P9PB 3CFRA 3LWLA 5MLCQ 3E9OA 3DRRA 1X9SA 1C0FA 3TR8A 3U8XA 4FPBA 4BC5A 2HBMA 1NJXA 4M3WA 3SPZA 4LH5A 1KVCA 4BQZA 3C6TA 4H03B 2O8EB 2Q36A 4LFCK 4CD3A 1QQNA 3R9PA 3FE1A 3V1RA 1TAQA 3LL3A 3OVNA 5AR0A 3LDLA 5CE3A 4B1XB 2ZQBA 5SZTA 4EAHD 3DAWA 2QWLA 3ENOA 1RT3A 3AAQA 2Q31A 3M3ZA 1LWCA 1IKXA 1NGCA 5JLHA 4B9VA 1BOTO 3HRGA 4WFAL 1IBMK 3O9RA 5I3UA 3KD1E 5C12A 1VSIA 3DWLA 4M7YA 3IDHA 1DTTA 3OYKA 3HBTA 2F9WA 3P83D 4ELVA 3CF5L 1ASVA 1JXBA 2UU9K 4M3YA 4KH5A 4PA1A 4EFHA 1VSDA 4XH5A 3VQBA 2Z1IA 3VQDA 3NAEA 3QEXA 1JLAA 1WSEA 3NF9A 2D0CA 3FZHA 4LC9B 3CG7A 5FLXO 1VSFA 3AVAA 4RG8A 4H0PA 1D9FA 4C8OA 1J5OA 3AV9A 4JS4A 2FBXA 1RBSA 4YNQA 2KKZA 3O9TA 5AQOA 4LFBK 4BRAA 3IFRA 4I9QA 3SV3A 1S6PA 1W97L 3AVLA 3QEPA 5DK5A 4CJUA 2AJQA 4MFBA 4K25A 2G8FA 1MU2A 3T1HK 2YJFA 3SZ2A 2ZJRL 3GL1A 4CGJA 4CJ5A 1HNWK 1RBRA 2V52B 2HVHA 4A2BA 2YCHA 3AA5X 1N32K 2XO7A 4FL9A 5F0XA 4IG0A 4LY7A 4LFAK 3W0LA 2ASMA 2HNZA 4JKGB 1WSFA 4OPAA 3I8DA 3NMUA 1C0TA 3S41A 5C42A 2RE2A 1S1XA 4CEAA 4AILC 4JK8A 4KH4A 5AQFA 4FJ9A 3EEQA 3THXA 3QNNA 4KHNA 3ZT2A 3ZEUA 3OS2A 3JYTA 4RWTA 1LV5A 2YI1A 2UUBK 1IKYA 3FGUA 2UXCK 2IDOA 2A3ZA 4EIAA 3G6EN 1KLNA 1P8ZA 2GELA 2VGNA 3JSMA 1JLEA 4IBNA 1KAYA 3DLEA 4YDUC 5BRDA 3BF1A 1TK5A 5AQHA 3SAGA 3DM2A 3H45C 1W2BM 3VQ7A 3S3OA 5LMNK 3CM6A 3V9WA 1X9MA 5BR9A 4JI4K 1JKHA 1GLJO 2HNYA 1QQMA 1SUQA 3HP6A 4KV8A 3TSUA 2XY6A 2VGMA 4K41A 1HRHA 3OJUA 3D0PA 3FZLA 2A40A 3MN6A 4RCHA 5KRSA 4EZ6A 4OVLA 4HHTA 3O6WA 5BPNA 3SJHA 3CD6N 3K57A 2E1YA 4R79A 1RT5A 4B08A 5IWAK 3HPHA 4Z4CA 5M1PA 2FSNA 4ISFA 3EZ5A 3CQYA 1SKWA 3HTVA 1TUUA 3K0SA 4GVEA 3CERA 4AHCA 4IJNA 3H1VX 4L3QA 4DQIA 1NKCA 1YUWA 2NRRA 3EE8A 1WBDA 3PO5A 1BISA 1IBLK 3CCVN 2HF4A 2E2OA 3TTDA 1VQON 4X62K 2ZJPL 2KW4A 4FWSA 3G0ZA 4FJGA 1NBWA 3HL8A 4KI6A 3L4IA 3NH0A 3E1YA 1D9DA 2IVOA 4KHQA 1VQ9N 3HK2A 1KCFA 4W5NA 1X3MA 2E88A 1W0HA 4JI0K 4JNEA 2VQEK 3VOVA 2D1KA 1ATSA 1N6QA 1RBUA 2DFFA 3LZJA 1B9FA 3O1WA 2E5LK 1KVBA 4LF4K 3S3NA 4DKWA 4PKHA 4DS4A 2FSJA 4DV3K 1WNSA 5HBMA 4RW7A 3VQCA 5KPZA 3A2FA 1RTJA 4BWMA 4RTFD 2JGUA 3L2VA 4BC2A 2GWJA 4FM2A 1DKGD 4C8NA 2ZGZA 3SUOA 2E6MA 3WEEA 4IDKA 4FVUA 3EN9A 3DLKA 3MEGA 4OLBA 3LDOA 3OYHA 5HRNA 1J6ZA 4O44A 2OZMA 1LW2A 1WOQA 2YHBA 1VSMA 3KVGA 3F2KA 2QWPA 4IWVA 1TL1A 3CCLN 3HO1A 1FXXA 2VQFK 4JYAK 4JV5K 1BCMA 4X66K 1U6ZA 4FVMA 3CJCA 1RT6A 4IFVA 1CXUA 4CEBA 1YJWN 3MCAB 1WSGA 3RR8A 1BI4A 3PX0A 2NRVA 1TV6A 3VGLA 3C65A 5AQRA 1BA1A 2HB5A 1OH7A 5KRTA 4DSEA 3MEEA 3KKRA 4EHTA 5AQWA 3MXMA 4CVNE 3OYBA 4IXCA 5HL7L 1NKBA 3SK3A 2UXDK 1T6CA 3L0QA 2WONA 4FSVA 5EU7A 3VEZA 2QA4N 4DR4K 3AVHA 3HVTA 2NNWA 3DJCA 4MLEA 4BRNA 2VWJA 1S22A 3EYZA 4FYDA 4JI7K 4QCLA 3ULEA 1OVQA 5GIOA 4CK3A 4OX9K 4AF1A 4JKHA 3D2EB 3UIQA 4Z4IA 3QERA 4F3OA 1KTQA 1GLBG 1VSLA 2Y1JA 4CGGA 1WAJA 3V9ZA 1BUPA 4CHZA 4A61A 2W40A 3S9HA 3RSEA 3ZSYA 4BRIA 2OZSA 2HBLA 3E9LA 3O4WA 3ENBA 4K42A 2QWRA 2NRTA 1TYQB 4JD2B 4CE9A 1A5XA 2P9SA 2VG5A 5FRMA 2YJEA 1BWFO 4DSJA 3ATVA 4E1MA 3IS9A 5HLFA 4QOZB 3THWB 3O5BA 4ICLA 3KK2A 4O0JA 2OPSA 4XEIA 4JRPA 3ZCMA 4DFJA 3CCJN 3ZSZA 2P9UB 1RGIA 2PFUA 1HYVA 3C7NA 3Q7CA 2NUBA 1S1TA 1RTDA 1TKTA 3LDPA 5C25A 5BREA 2X78A 4ILJA 3S3MA 1HQUA 4OGCA 2Q2RA 1T8EA 1RCHA 1CZ9A 1FKOA 4DTPA 1QSLA 4G1QA 1NU0A 1OH8A 2Q3SA 4YHHK 3OYAA 1HKGA 1N36K 2WC9A 4LF7K 3E66A 1DLOA 4FW2A 4DLEA 1EP4A 5CY4A 3WXJA 4FZYA 2NRHA 2XHBA 5KQ8A 2CH6A 2V7YA 3BZKA 3ZT0A 1SS6A 3VF6A 5FPMA 2O8BB 1U04A 4NYNA 1SL1A 1KXPA 1YI2N 3OYNA 1VSHA 2KFZA 1RTHA 5ADXH 3K5LA 4JKEA 2O8DB 3L2RA 2Z1GA 1L3VA 3RMDA 3V81A 3AARA 3MXIA 3KD5E 3KK1A 4JHDB 5HRSA 3O9SA 1SL2A 4LF9K 1QSYA 4NYFA 4C8LA 4DTSA 3VQ6A 3UKUB 4HCBA 4QAGA 5AQPA 3CPEA 3B6OA 3QBXA 2QEXN 1IJJA 1B92A 4CZEA 5GAHP 2YX6A 4FJKA 1YJ9N 4FW1A 1NGHA 5DM7L 1GLFO 2KQ2A 3TTCA 4DF4A 1GLAG 2A5XA 2HOEA 3AVGA 3NBPA 2VG7A 4H5RA 1HLUA 2D0BA 3A0IX 3TI0A 1IG9A 1XMQK 1GLCG 1RBVA 2YNGA 3D2FB 1Q7YO 3DOKA 3V9SA 4HUEA 3K2PA 3ASMA 4OKKA 3NHGA 4IFEA 5GIPA 4BG8A 3WXLA 5FPNA 1VQLN 2P51A 4W5QA 4PUOA 3I55N 1VSJA 4AM7A 4H5TA 3MXJA 3LM9A 3CMEN 4J8FA 4BDYA 2J4RA 4E7KA 4CZJA 1TK0A 3NGZA 5KGWA 3ZSOA 4U67L 3CJBA 3PX4A 4KHPK 2BGGA 1NGAA 4J2EA 2O8EA 1WSIA 2P9KA 4PL7A 1JCGA 1ASWA 4B3SK 2R7YA 4KPYA 2B4JA 4N56A 3MWTA 4NXMK 3DI6A 3AVKA 5M1QA 3C94A 5C24A 4BRQA 3QEIA 1ZBUA 1YVNA 5AZIA 3RRGA 1QHTA 4B1UB 4YOXA 1DT9A 3LAMA 1X1PA 1Q82O 4FO0A 3NH2A 3AVMA 3E9PA 3AY9A 4FK2A 2EWSA 1TAUA 3SUNA 3J7AP 4DTXA 4BRKA 2A1RA 3DRSA 1SAZA 1NMDA 3A8YA 5ELZA 2KFNA 2CGLA 4DMNA 3IUCA 2W41A 4QS9A 3CCUN 4IO8A 1U49A 2D0AA 3QDKA 4CFCA 1C0GA 1KFSA 3O4NA 3KJVA 4BC3A 4CGIA 4CEQA 4ZHRA 4GKKK 3G25A 4CZMA 4CZGA 1IH7A 5LJWA 3OYLA 4DSIA 2QWMA 3ZETB 1EWQA 2BUPA 5AQIA 4JI6K 1GOBA 4QS7A 1ZBHA 5BN8A 3ZSWA 4CIEA 4CCHA 3VQ5A 4I7FA 4DCHA 1E4GT 1NK4A 2AA4A 1SQKA 3BP8A 4ILGB 4M3RA 5AQVA 4RW8A 3DMJA 2D5RA
chains in the Genus database with same CATH topology
1C0MA 3QEVA 4K8XA 3OYFA 1I39A 2HNYA 4NCGA 2PYLA 3NGIA 1SUQA 3HP6A 1NK5A 2BANA 3G10A 4KV8A 4OPJA 1TGOA 2XY6A 1HRHA 3T3FA 3L3VA 4F2RA 3OJUA 4KTWA 3D0PA 4Q0BA 1NK7A 5KRSA 3LPTA 4EZ6A 4OVLA 3NF6A 3VQAA 4AHSA 4HHTA 4EZ9A 4FJIA 1VRUA 2YNHA 3L2UA 3LP3A 4OJRA 3MEDA 1U48A 3B6PA 3K57A 3TWHA 1YVUA 3DRPA 5KGXA 2IGIA 2RN2A 5J2PA 1R0AA 2DY4A 1RT5A 4B08A 3DOLA 3HPHA 4Z4CA 1QSSA 3EZ5A 2HMIA 1NJZA 3OY9A 1SKWA 4FXDA 1XHXA 4AHCA 4B9LA 1VK0A 4W5TA 3VN5A 2EHGA 3WNFA 2LSNA 2G8HA 4DQIA 3HT3A 1JLCA 1NKCA 3TAEA 1ITGA 4H4OA 1S6QA 4AHVA 3PO4A 4ZTFA 3VQPA 3PO5A 3M8PA 1BISA 4E0DA 4BACA 4CIGA 1Q8IA 3ZSRA 4DTJA 3TAFA 3NF7A 3OYEA 4CGHA 1S9GA 1VSKA 4XIUA 3KIOA 3RMAA 1REVA 2E6LA 5FDLA 1TL3A 4CFDA 2KW4A 4FM1A 3QEWA 5CZ2A 3SNNA 3ZSVA 1S9EA 3ZT4A 4OPKA 3G0ZA 2ZE2A 4HVJA 4UQGA 4BDPA 4FJGA 3HL8A 5SWMA 1IKWA 4E7LA 3KTQA 3NH0A 4KI6A 1G15A 4I2PA 3AO4A 3LP2A 1XWLA 1ZBLA 4F8RA 2OPRA 1D9DA 4DQSA 3DLHA 3DYAA 3VQQA 4KHQA 3P5JA 4ELTA 1ASUA 3AA2A 4O55A 2W42A 3AVIA 4FCYA 1YTUA 3HK2A 1KCFA 4KTQA 3AVJA 4W5NA 2HNDA 4N76A 4NCAA 4CHNA 3IRXA 1W0HA 3QESA 3AO2A 4ELUA 2HHSA 4RW9A 4AH9A 1B9DA 4CJRA 3AA4A 4CGFA 3HXMA 4O4GA 4CIFA 3SUQA 1N6QA 2YHAA 4DTRA 2XY5A 4B9UA 4M41A 4PQUA 1JXEA 1RBUA 4R5PA 2DFFA 1TK8A 3LZJA 1B9FA 1WSJA 2XY8A 1KVBA 3I0RA 1YTAA 4CJPA 1QS4A 3O3FA 3NDKA 3S3NA 4M3XA 4FZXC 4DS4A 2QXFA 2HHWA 5J1EA 1WNSA 5HBMA 4GVMA 4CGDA 3LAKA 4RW7A 1JLGA 5K14A 3VQCA 3M8RA 1HNIA 1S1UA 1SKSA 2OPQA 1JL2A 1RTJA 2IOCA 3A2FA 4Y1CA 2RPIA 3WNHA 2YNFA 4AHUA 4YFUA 4DU1A 4BWMA 4W5RA 1U4BA 4Z4FA 2HHXA 3E01A 3L3UA 3RR7A 3LALA 2JGUA 3L2VA 1LW0A 4FM2A 4CECA 1L5UA 4DTOA 4HUGA 3HPOA 4E3SA 3NF8A 4C8NA 2OYQA 2DTUA 1NJWA 4LSLA 3SUOA 2E6MA 3LPUA 4IDKA 3DLKA 3HSTB 1TKDA 3AVFA 3PY8A 3K5OA 4DSKA 3MEGA 3RMBA 4OLBA 1QTMA 5DMRA 3V4IA 2OA8A 3OYHA 5HRNA 1IO2A 4O44A 3NE6A 3ULDA 2OZMA 4CF0A 1UWBA 1IKVA 4FLTA 2G8IA 1LW2A 2IAJA 2A1SA 1VSMA 2YHBA 3OYMA 3OYJA 3HP9A 1BIUA 3VQ8A 2DFEA 4W5OA 1TL1A 3HPGA 3KLGA 1HMVA 4DWIA 3HO1A 1FXXA 1LAWA 3M8QA 3SQ4A 4FLYA 1RT7A 4HUFA 4CHPA 1BCMA 3AVCA 2QKKA 4FVMA 1RT6A 4IFVA 1S5JA 1CXUA 4CEBA 1HJRA 4JLHA 1T05A 1T7PA 1WSGA 1RT4A 1U45A 3RR8A 1BI4A 4ID5A 3PX0A 2QKBA 4CF9A 4N41A 4IKFA 2FBVA 2Z1HA 4BE0A 1EKEA 1HPZA 1TV6A 4N5SA 3OS0A 4B9TA 1EX4A 1UA0A 1J9AA 4B9MA 3LDSA 4KHWA 1SV5A 5T7BA 1BIZA 2HB5A 4CJVA 2X74A 4DTUA 2HHVA 3ZSQA 2YKMA 5KRTA 4DSEA 3MEEA 3SUPA 4K8ZA 3OJSA 3KK3A 4CJTA 5I42A 3KKRA 1WSHA 2WOMA 3MXMA 4O5BA 1N5YA 5FRNA 3L2QA 3OYBA 1NKBA 4PY5A 4E7HA 3KKSA 3V1OA 3FFIA 4OGEA 4BDZA 5EU7A 1F21A 2WONA 3PX6A 2F8SA 2HVIA 3AVHA 3HVTA 2YKNA 1ZBFA 4CJLA 4FM0A 1RDCA 4B9NA 4ID1A 1GOCA 5CZ1A 1BGXT 1FK9A 1HYZA 2VWJA 4Z0UA 5KI6A 3QINA 4DTNA 3EYZA 4FYDA 1C0UA 4QCLA 3QIOA 4RW6A 4CJ3A 3OYCA 4CJEA 1JLFA 4CK3A 2Y1IA 3QNOA 1T03A 4RW4A 4Z4EA 3O3GA 4CEFA 1W9HA 2B5JA 3QERA 3LANA 3UIQA 3LWMA 4Z4IA 1KRPA 4DU3A 4F3OA 1KTQA 1RT1A 3K58A 1CLQA 2PZSA 1NK9A 3KLIA 2VG6A 4IG3A 3AO5A 4Z4GA 1VSLA 2Y1JA 4CGGA 4F2SA 1XHZA 1WAJA 3V9ZA 4CHZA 4I9LA 2X6SA 1BHLA 3I0SA 1GOAA 3ZT1A 4Z4HA 4F4KA 3S9HA 5FROA 4H4MA 4C8MA 3V9UA 3ZSYA 4CJ4A 1RDDA 4CEZA 2OZSA 2QK9A 1HNVA 4KB0A 1X9WA 4EP4A 4M45A 3PV8A 1K6YA 1VRTA 5CYQA 4CE9A 1A5XA 1NOZA 2GUIA 3TAMA 2VG5A 4CF8A 4FJMA 3O4QA 5FRMA 4M3ZA 3SQ1A 3WNGA 4DSJA 4E1MA 3CYMA 2P1JA 2Z1JA 2G8UA 4FJNA 3SQ2A 3IS9A 4C8KA 1L3SA 5HLFA 4QOZB 4ICLA 3KK2A 2DFHA 3KLEA 4O0JA 4DQQA 4KI4A 2OPSA 4HTUA 4JRPA 1JLBA 3ZCMA 3F73A 4DFJA 1Q9YA 1I3AA 3ZSZA 4DLGA 1Z25A 1HYVA 4E1NA 2ETJA 4TSXA 3QO9A 4CFAA 1NK8A 4KRFA 1ZBIA 1RNHA 5JS1A 2NUBA 1S1TA 1RTDA 4B3OA 1TKTA 5C25A 5JS2A 1DTQA 2GV9A 3RTVA 4FJ5A 2X78A 3S3MA 3L2WA 1HQUA 4OGCA 5J2QA 4DU4A 1BCOA 3CFOA 1YT3A 4GW6A 2G8KA 3ZSXA 5HRPA 3M8SA 1RCHA 3SQ0A 3PUFA 3TABA 1U47A 1T8EA 2BE2A 1D8YA 1CZ9A 1FKOA 4DTPA 4CF1A 1NOYA 1QSLA 4CK2A 4G1QA 4N47A 4M42A 4KAZA 2Q3SA 3VQEA 3OYAA 3U6FA 1TVRA 2XRIA 3SCXA 1Y97A 1BQNA 3EY1A 3SJJA 1A5VA 2HHUA 4KKOA 1BQMA 3RRHA 3P1GA 4OKEA 3VQ4A 2EX3A 1DLOA 2FC0A 2IC3A 2RF2A 3CQ8A 2VWKA 4CEDA 4FW2A 4DLEA 1L3UA 4CFBA 3BDPA 1EP4A 5KTQA 3KLHA 2P5GA 5CY4A 3ALYA 4FJ7A 4FZYA 3TAGA 4E19A 1KVAA 2XHBA 1JLQA 4DFPA 2KZMA 4WE1A 4Y1DA 3SV4A 3QEIA 1NKEA 1RBTA 2HHTA 3DLBA 5CYMA 4CHQA 3ZT0A 3NCIA 1VSEA 3THVA 1U04A 3VA3A 4JS5A 2YNIA 1RTIA 3ISNC 4NYNA 1EXQA 2OPPA 5HP1A 1SL1A 3IAYA 3OYNA 2HHQA 3HVRA 3K59A 4AHTA 1VSHA 2KFZA 1D5AA 4JRQA 4KHSA 1RTHA 2F96A 4E89A 4KHUA 3HYFA 3K5LA 3CFRA 3LWLA 1S1VA 3L2RA 2Z1GA 1L3VA 4DSLA 3RMDA 3V81A 3DRRA 2GBZA 1X9SA 3MXIA 3KD5E 4L8RB 3KK1A 3TR8A 5HRSA 1SL2A 1CZBA 1QSYA 1HQEA 4NYFA 2FBYA 4C8LA 3QETA 4CEOA 1J54A 3T19A 4CESA 3VQ6A 4DTSA 4ZTJA 1NJXA 3AVBA 4HCBA 4QAGA 2JLEA 3B6OA 4FLUA 4M3WA 3SPZA 1L3TA 1B92A 4FJLA 4LH5A 4FJKA 1KVCA 3QLHA 3C6TA 4FJ8A 5HRRA 1TKZA 4FW1A 4CHOA 1QQCA 4CJKA 3TAQA 5J2NA 4PWDA 4M3UA 3SYZA 2G8WA 4B8AB 3V9XA 4KTZA 2KQ2A 4DF4A 3RWUA 4FZZA 3AVGA 3NBPA 1CXQA 2VG7A 3V1RA 1TAQA 4NCBA 2D0BA 1RILA 3OVNA 4E7IA 3TI0A 4Q5VA 4J2AA 4FLZA 1Z26A 1IG9A 4FJJA 1RBVA 3C6UA 2YNGA 3K5MA 2ZQBA 3MAQA 1SKRA 5SZTA 2X6NA 1A5WA 3DOKA 1C1BA 1KFDA 4HUEA 4FLXA 3V9SA 3K2PA 3ASMA 3V6DA 4OKKA 4DQRA 3ITHA 3NHGA 1RT3A 1LWCA 1LAVA 3F9KA 1IKXA 1KSPA 3HJFA 2FBTA 2P5OA 4PUOA 2P51A 3DMJA 3V1QA 4W5QA 3TARA 4B9VA 1VSJA 2ZD1A 3MXJA 1WN7A 1C1AA 3RMCA 1XC9A 5I3UA 2B6AA 3D45A 1XI1A 1HYSA 2G8VA 3KD1E 3NH1A 4CK1A 4BDYA 2RKIA 4E7KA 1VSIA 4E7JA 1TK0A 3OYKA 1DTTA 3NGZA 4DQPA 5KGWA 2E4LA 3P83D 4ELVA 4OLAA 3ZSOA 1ASVA 1JXBA 1LWEA 3PX4A 2ATQA 4J2BA 2BGGA 4M3YA 4J2EA 4J2DA 4PA1A 4FK4A 4CJQA 3VA0A 1VSDA 3VQ9A 1WSIA 3NFAA 3SI6A 4LSNA 1BL3A 3VQBA 1S1WA 2O4IA 1ASWA 2Z1IA 3VQDA 4CJWA 3NAEA 2R7YA 4DS5A 3QEXA 1JLAA 2B4JA 4KPYA 1O1WA 1WSEA 4LD0A 4N56A 4GMJB 3K5NA 4OKJA 3NF9A 3L8BA 1Q9XA 2D0CA 3DI6A 3U3GA 3AVKA 5J2MA 1KLMA 3U3YA 1SL0A 2YV0X 1QE1A 3C94A 3CG7A 1VSFA 3QIPA 1ZBUA 3LP0A 3LP1A 3AVAA 5C24A 4RG8A 4CJFA 1NJYA 1D9FA 4CHYA 4EP5A 1UA1A 1J5OA 4C8OA 3AV9A 4JS4A 2KZZA 2FBXA 3RRGA 1RBSA 1QHTA 4YNQA 2O4GA 4BE1A 3LAMA 3CFPA 4DF8A 4M3TA 1X1PA 3NGYA 3SPYA 4I9QA 3NH2A 1UOCA 3AA3A 3SV3A 1S6PA 3AVLA 3AVMA 3IG1A 3QEPA 5DK5A 4CJUA 2AJQA 1JL1A 4MFBA 4F3TA 3TAPA 3WNEA 4I2QA 3OYDA 4BE2A 2G8FA 4DG1A 2HW3A 4FK2A 1RDBA 4B8CA 2KTQA 3T1AA 1MU2A 1TAUA 2I5JA 3SUNA 1C6VA 4BWJA 1EETA 3DLGA 1BI4B 3BGRA 3SZ2A 3ZT3A 4AHRA 4CGJA 4DTXA 2A1RA 4CJ5A 4KFBA 3O3HA 1RBRA 3DRSA 2HVHA 3AA5X 2XO7A 2KFNA 4IG0A 4LY7A 4FJXA 3TANA 5D3GA 4DMNA 4DSFA 2HNZA 3DLRA 4LH4A 1WSFA 3I8DA 1U49A 2D0AA 4CFCA 3OYIA 3LZIA 2IS3A 2PYJA 1KFSA 1C0TA 5C42A 1LWFA 3O4NA 1S1XA 3KJVA 4CEAA 4CGIA 4CEQA 4ZHRA 4AILC 5E41A 4FJ9A 1C1CA 1IH7A 3OYLA 4DSIA 1TKXA 3QNNA 4CJSA 3AVNA 1RT2A 4KHNA 2ITGA 4IFYA 4FLVA 1ZYQA 1NK0A 4DTMA 4H8KA 4HCCA 4CF2A 1UAXA 4DFKA 3ZT2A 3JYTA 3OS2A 3KLFA 1FKPA 1LV5A 4CERA 1GOBA 1ZBHA 3HM9A 1IKYA 2PY5A 1WLJA 4KB1A 4FLWA 3ZSWA 2IDOA 4CIEA 4CCHA 3MECA 3VQ5A 1KLNA 4KHYA 4CEEA 3JSMA 1JLEA 5HROA 4IBNA 3DLEA 4KO0A 1J53A 1RDAA 4I7FA 3CM5A 3H08A 4MQ3A 3OYGA 1NK4A 1TK5A 4B9SA 4DFMA 1NK6A 3DM2A 4FJHA 3OS1A 2BDPA 4O0IA 4KREA 3VQ7A 2XY7A 4FK0A 3AO1A 3S3OA 1WAFA 3AO3A 3CM6A 3V9WA 4M3RA 1X9MA 2F8TA 4RW8A 3C95A 2D5RA 1JKHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C0M A;  3QEV A;  4K8X A;  3OYF A;  1I39 A;  2HNY A;  4NCG A;  2PYL A;  3NGI A;  1SUQ A;  3HP6 A;  1NK5 A;  2BAN A;  3G10 A;  4KV8 A;  4OPJ A;  1TGO A;  2XY6 A;  1HRH A;  3T3F A;  3L3V A;  4F2R A;  3OJU A;  4KTW A;  3D0P A;  4Q0B A;  1NK7 A;  5KRS A;  3LPT A;  4EZ6 A;  4OVL A;  3NF6 A;  3VQA A;  4AHS A;  4HHT A;  4EZ9 A;  4FJI A;  1VRU A;  2YNH A;  3L2U A;  3LP3 A;  4OJR A;  3MED A;  1U48 A;  3B6P A;  3K57 A;  3TWH A;  1YVU A;  3DRP A;  5KGX A;  2IGI A;  2RN2 A;  5J2P A;  1R0A A;  2DY4 A;  1RT5 A;  4B08 A;  3DOL A;  3HPH A;  4Z4C A;  1QSS A;  3EZ5 A;  2HMI A;  1NJZ A;  3OY9 A;  1SKW A;  4FXD A;  1XHX A;  4AHC A;  4B9L A;  1VK0 A;  4W5T A;  3VN5 A;  2EHG A;  3WNF A;  2LSN A;  2G8H A;  4DQI A;  3HT3 A;  1JLC A;  1NKC A;  3TAE A;  1ITG A;  4H4O A;  1S6Q A;  4AHV A;  3PO4 A;  4ZTF A;  3VQP A;  3PO5 A;  3M8P A;  1BIS A;  4E0D A;  4BAC A;  4CIG A;  1Q8I A;  3ZSR A;  4DTJ A;  3TAF A;  3NF7 A;  3OYE A;  4CGH A;  1S9G A;  1VSK A;  4XIU A;  3KIO A;  3RMA A;  1REV A;  2E6L A;  5FDL A;  1TL3 A;  4CFD A;  2KW4 A;  4FM1 A;  3QEW A;  5CZ2 A;  3SNN A;  3ZSV A;  1S9E A;  3ZT4 A;  4OPK A;  3G0Z A;  2ZE2 A;  4HVJ A;  4UQG A;  4BDP A;  4FJG A;  3HL8 A;  5SWM A;  1IKW A;  4E7L A;  3KTQ A;  3NH0 A;  4KI6 A;  1G15 A;  4I2P A;  3AO4 A;  3LP2 A;  1XWL A;  1ZBL A;  4F8R A;  2OPR A;  1D9D A;  4DQS A;  3DLH A;  3DYA A;  3VQQ A;  4KHQ A;  3P5J A;  4ELT A;  1ASU A;  3AA2 A;  4O55 A;  2W42 A;  3AVI A;  4FCY A;  1YTU A;  3HK2 A;  1KCF A;  4KTQ A;  3AVJ A;  4W5N A;  2HND A;  4N76 A;  4NCA A;  4CHN A;  3IRX A;  1W0H A;  3QES A;  3AO2 A;  4ELU A;  2HHS A;  4RW9 A;  4AH9 A;  1B9D A;  4CJR A;  3AA4 A;  4CGF A;  3HXM A;  4O4G A;  4CIF A;  3SUQ A;  1N6Q A;  2YHA A;  4DTR A;  2XY5 A;  4B9U A;  4M41 A;  4PQU A;  1JXE A;  1RBU A;  4R5P A;  2DFF A;  1TK8 A;  3LZJ A;  1B9F A;  1WSJ A;  2XY8 A;  1KVB A;  3I0R A;  1YTA A;  4CJP A;  1QS4 A;  3O3F A;  3NDK A;  3S3N A;  4M3X A;  4FZX C;  4DS4 A;  2QXF A;  2HHW A;  5J1E A;  1WNS A;  5HBM A;  4GVM A;  4CGD A;  3LAK A;  4RW7 A;  1JLG A;  5K14 A;  3VQC A;  3M8R A;  1HNI A;  1S1U A;  1SKS A;  2OPQ A;  1JL2 A;  1RTJ A;  2IOC A;  3A2F A;  4Y1C A;  2RPI A;  3WNH A;  2YNF A;  4AHU A;  4YFU A;  4DU1 A;  4BWM A;  4W5R A;  1U4B A;  4Z4F A;  2HHX A;  3E01 A;  3L3U A;  3RR7 A;  3LAL A;  2JGU A;  3L2V A;  1LW0 A;  4FM2 A;  4CEC A;  1L5U A;  4DTO A;  4HUG A;  3HPO A;  4E3S A;  3NF8 A;  4C8N A;  2OYQ A;  2DTU A;  1NJW A;  4LSL A;  3SUO A;  2E6M A;  3LPU A;  4IDK A;  3DLK A;  3HST B;  1TKD A;  3AVF A;  3PY8 A;  3K5O A;  4DSK A;  3MEG A;  3RMB A;  4OLB A;  1QTM A;  5DMR A;  3V4I A;  2OA8 A;  3OYH A;  5HRN A;  1IO2 A;  4O44 A;  3NE6 A;  3ULD A;  2OZM A;  4CF0 A;  1UWB A;  1IKV A;  4FLT A;  2G8I A;  1LW2 A;  2IAJ A;  2A1S A;  1VSM A;  2YHB A;  3OYM A;  3OYJ A;  3HP9 A;  1BIU A;  3VQ8 A;  2DFE A;  4W5O A;  1TL1 A;  3HPG A;  3KLG A;  1HMV A;  4DWI A;  3HO1 A;  1FXX A;  1LAW A;  3M8Q A;  3SQ4 A;  4FLY A;  1RT7 A;  4HUF A;  4CHP A;  1BCM A;  3AVC A;  2QKK A;  4FVM A;  1RT6 A;  4IFV A;  1S5J A;  1CXU A;  4CEB A;  1HJR A;  4JLH A;  1T05 A;  1T7P A;  1WSG A;  1RT4 A;  1U45 A;  3RR8 A;  1BI4 A;  4ID5 A;  3PX0 A;  2QKB A;  4CF9 A;  4N41 A;  4IKF A;  2FBV A;  2Z1H A;  4BE0 A;  1EKE A;  1HPZ A;  1TV6 A;  4N5S A;  3OS0 A;  4B9T A;  1EX4 A;  1UA0 A;  1J9A A;  4B9M A;  3LDS A;  4KHW A;  1SV5 A;  5T7B A;  1BIZ A;  2HB5 A;  4CJV A;  2X74 A;  4DTU A;  2HHV A;  3ZSQ A;  2YKM A;  5KRT A;  4DSE A;  3MEE A;  3SUP A;  4K8Z A;  3OJS A;  3KK3 A;  4CJT A;  5I42 A;  3KKR A;  1WSH A;  2WOM A;  3MXM A;  4O5B A;  1N5Y A;  5FRN A;  3L2Q A;  3OYB A;  1NKB A;  4PY5 A;  4E7H A;  3KKS A;  3V1O A;  3FFI A;  4OGE A;  4BDZ A;  5EU7 A;  1F21 A;  2WON A;  3PX6 A;  2F8S A;  2HVI A;  3AVH A;  3HVT A;  2YKN A;  1ZBF A;  4CJL A;  4FM0 A;  1RDC A;  4B9N A;  4ID1 A;  1GOC A;  5CZ1 A;  1BGX T;  1FK9 A;  1HYZ A;  2VWJ A;  4Z0U A;  5KI6 A;  3QIN A;  4DTN A;  3EYZ A;  4FYD A;  1C0U A;  4QCL A;  3QIO A;  4RW6 A;  4CJ3 A;  3OYC A;  4CJE A;  1JLF A;  4CK3 A;  2Y1I A;  3QNO A;  1T03 A;  4RW4 A;  4Z4E A;  3O3G A;  4CEF A;  1W9H A;  2B5J A;  3QER A;  3LAN A;  3UIQ A;  3LWM A;  4Z4I A;  1KRP A;  4DU3 A;  4F3O A;  1KTQ A;  1RT1 A;  3K58 A;  1CLQ A;  2PZS A;  1NK9 A;  3KLI A;  2VG6 A;  4IG3 A;  3AO5 A;  4Z4G A;  1VSL A;  2Y1J A;  4CGG A;  4F2S A;  1XHZ A;  1WAJ A;  3V9Z A;  4CHZ A;  4I9L A;  2X6S A;  1BHL A;  3I0S A;  1GOA A;  3ZT1 A;  4Z4H A;  4F4K A;  3S9H A;  5FRO A;  4H4M A;  4C8M A;  3V9U A;  3ZSY A;  4CJ4 A;  1RDD A;  4CEZ A;  2OZS A;  2QK9 A;  1HNV A;  4KB0 A;  1X9W A;  4EP4 A;  4M45 A;  3PV8 A;  1K6Y A;  1VRT A;  5CYQ A;  4CE9 A;  1A5X A;  1NOZ A;  2GUI A;  3TAM A;  2VG5 A;  4CF8 A;  4FJM A;  3O4Q A;  5FRM A;  4M3Z A;  3SQ1 A;  3WNG A;  4DSJ A;  4E1M A;  3CYM A;  2P1J A;  2Z1J A;  2G8U A;  4FJN A;  3SQ2 A;  3IS9 A;  4C8K A;  1L3S A;  5HLF A;  4QOZ B;  4ICL A;  3KK2 A;  2DFH A;  3KLE A;  4O0J A;  4DQQ A;  4KI4 A;  2OPS A;  4HTU A;  4JRP A;  1JLB A;  3ZCM A;  3F73 A;  4DFJ A;  1Q9Y A;  1I3A A;  3ZSZ A;  4DLG A;  1Z25 A;  1HYV A;  4E1N A;  2ETJ A;  4TSX A;  3QO9 A;  4CFA A;  1NK8 A;  4KRF A;  1ZBI A;  1RNH A;  5JS1 A;  2NUB A;  1S1T A;  1RTD A;  4B3O A;  1TKT A;  5C25 A;  5JS2 A;  1DTQ A;  2GV9 A;  3RTV A;  4FJ5 A;  2X78 A;  3S3M A;  3L2W A;  1HQU A;  4OGC A;  5J2Q A;  4DU4 A;  1BCO A;  3CFO A;  1YT3 A;  4GW6 A;  2G8K A;  3ZSX A;  5HRP A;  3M8S A;  1RCH A;  3SQ0 A;  3PUF A;  3TAB A;  1U47 A;  1T8E A;  2BE2 A;  1D8Y A;  1CZ9 A;  1FKO A;  4DTP A;  4CF1 A;  1NOY A;  1QSL A;  4CK2 A;  4G1Q A;  4N47 A;  4M42 A;  4KAZ A;  2Q3S A;  3VQE A;  3OYA A;  3U6F A;  1TVR A;  2XRI A;  3SCX A;  1Y97 A;  1BQN A;  3EY1 A;  3SJJ A;  1A5V A;  2HHU A;  4KKO A;  1BQM A;  3RRH A;  3P1G A;  4OKE A;  3VQ4 A;  2EX3 A;  1DLO A;  2FC0 A;  2IC3 A;  2RF2 A;  3CQ8 A;  2VWK A;  4CED A;  4FW2 A;  4DLE A;  1L3U A;  4CFB A;  3BDP A;  1EP4 A;  5KTQ A;  3KLH A;  2P5G A;  5CY4 A;  3ALY A;  4FJ7 A;  4FZY A;  3TAG A;  4E19 A;  1KVA A;  2XHB A;  1JLQ A;  4DFP A;  2KZM A;  4WE1 A;  4Y1D A;  3SV4 A;  3QEI A;  1NKE A;  1RBT A;  2HHT A;  3DLB A;  5CYM A;  4CHQ A;  3ZT0 A;  3NCI A;  1VSE A;  3THV A;  1U04 A;  3VA3 A;  4JS5 A;  2YNI A;  1RTI A;  3ISN C;  4NYN A;  1EXQ A;  2OPP A;  5HP1 A;  1SL1 A;  3IAY A;  3OYN A;  2HHQ A;  3HVR A;  3K59 A;  4AHT A;  1VSH A;  2KFZ A;  1D5A A;  4JRQ A;  4KHS A;  1RTH A;  2F96 A;  4E89 A;  4KHU A;  3HYF A;  3K5L A;  3CFR A;  3LWL A;  1S1V A;  3L2R A;  2Z1G A;  1L3V A;  4DSL A;  3RMD A;  3V81 A;  3DRR A;  2GBZ A;  1X9S A;  3MXI A;  3KD5 E;  4L8R B;  3KK1 A;  3TR8 A;  5HRS A;  1SL2 A;  1CZB A;  1QSY A;  1HQE A;  4NYF A;  2FBY A;  4C8L A;  3QET A;  4CEO A;  1J54 A;  3T19 A;  4CES A;  3VQ6 A;  4DTS A;  4ZTJ A;  1NJX A;  3AVB A;  4HCB A;  4QAG A;  2JLE A;  3B6O A;  4FLU A;  4M3W A;  3SPZ A;  1L3T A;  1B92 A;  4FJL A;  4LH5 A;  4FJK A;  1KVC A;  3QLH A;  3C6T A;  4FJ8 A;  5HRR A;  1TKZ A;  4FW1 A;  4CHO A;  1QQC A;  4CJK A;  3TAQ A;  5J2N A;  4PWD A;  4M3U A;  3SYZ A;  2G8W A;  4B8A B;  3V9X A;  4KTZ A;  2KQ2 A;  4DF4 A;  3RWU A;  4FZZ A;  3AVG A;  3NBP A;  1CXQ A;  2VG7 A;  3V1R A;  1TAQ A;  4NCB A;  2D0B A;  1RIL A;  3OVN A;  4E7I A;  3TI0 A;  4Q5V A;  4J2A A;  4FLZ A;  1Z26 A;  1IG9 A;  4FJJ A;  1RBV A;  3C6U A;  2YNG A;  3K5M A;  2ZQB A;  3MAQ A;  1SKR A;  5SZT A;  2X6N A;  1A5W A;  3DOK A;  1C1B A;  1KFD A;  4HUE A;  4FLX A;  3V9S A;  3K2P A;  3ASM A;  3V6D A;  4OKK A;  4DQR A;  3ITH A;  3NHG A;  1RT3 A;  1LWC A;  1LAV A;  3F9K A;  1IKX A;  1KSP A;  3HJF A;  2FBT A;  2P5O A;  4PUO A;  2P51 A;  3DMJ A;  3V1Q A;  4W5Q A;  3TAR A;  4B9V A;  1VSJ A;  2ZD1 A;  3MXJ A;  1WN7 A;  1C1A A;  3RMC A;  1XC9 A;  5I3U A;  2B6A A;  3D45 A;  1XI1 A;  1HYS A;  2G8V A;  3KD1 E;  3NH1 A;  4CK1 A;  4BDY A;  2RKI A;  4E7K A;  1VSI A;  4E7J A;  1TK0 A;  3OYK A;  1DTT A;  3NGZ A;  4DQP A;  5KGW A;  2E4L A;  3P83 D;  4ELV A;  4OLA A;  3ZSO A;  1ASV A;  1JXB A;  1LWE A;  3PX4 A;  2ATQ A;  4J2B A;  2BGG A;  4M3Y A;  4J2E A;  4J2D A;  4PA1 A;  4FK4 A;  4CJQ A;  3VA0 A;  1VSD A;  3VQ9 A;  1WSI A;  3NFA A;  3SI6 A;  4LSN A;  1BL3 A;  3VQB A;  1S1W A;  2O4I A;  1ASW A;  2Z1I A;  3VQD A;  4CJW A;  3NAE A;  2R7Y A;  4DS5 A;  3QEX A;  1JLA A;  2B4J A;  4KPY A;  1O1W A;  1WSE A;  4LD0 A;  4N56 A;  4GMJ B;  3K5N A;  4OKJ A;  3NF9 A;  3L8B A;  1Q9X A;  2D0C A;  3DI6 A;  3U3G A;  3AVK A;  5J2M A;  1KLM A;  3U3Y A;  1SL0 A;  2YV0 X;  1QE1 A;  3C94 A;  3CG7 A;  1VSF A;  3QIP A;  1ZBU A;  3LP0 A;  3LP1 A;  3AVA A;  5C24 A;  4RG8 A;  4CJF A;  1NJY A;  1D9F A;  4CHY A;  4EP5 A;  1UA1 A;  1J5O A;  4C8O A;  3AV9 A;  4JS4 A;  2KZZ A;  2FBX A;  3RRG A;  1RBS A;  1QHT A;  4YNQ A;  2O4G A;  4BE1 A;  3LAM A;  3CFP A;  4DF8 A;  4M3T A;  1X1P A;  3NGY A;  3SPY A;  4I9Q A;  3NH2 A;  1UOC A;  3AA3 A;  3SV3 A;  1S6P A;  3AVL A;  3AVM A;  3IG1 A;  3QEP A;  5DK5 A;  4CJU A;  2AJQ A;  1JL1 A;  4MFB A;  4F3T A;  3TAP A;  3WNE A;  4I2Q A;  3OYD A;  4BE2 A;  2G8F A;  4DG1 A;  2HW3 A;  4FK2 A;  1RDB A;  4B8C A;  2KTQ A;  3T1A A;  1MU2 A;  1TAU A;  2I5J A;  3SUN A;  1C6V A;  4BWJ A;  1EET A;  3DLG A;  1BI4 B;  3BGR A;  3SZ2 A;  3ZT3 A;  4AHR A;  4CGJ A;  4DTX A;  2A1R A;  4CJ5 A;  4KFB A;  3O3H A;  1RBR A;  3DRS A;  2HVH A;  3AA5 X;  2XO7 A;  2KFN A;  4IG0 A;  4LY7 A;  4FJX A;  3TAN A;  5D3G A;  4DMN A;  4DSF A;  2HNZ A;  3DLR A;  4LH4 A;  1WSF A;  3I8D A;  1U49 A;  2D0A A;  4CFC A;  3OYI A;  3LZI A;  2IS3 A;  2PYJ A;  1KFS A;  1C0T A;  5C42 A;  1LWF A;  3O4N A;  1S1X A;  3KJV A;  4CEA A;  4CGI A;  4CEQ A;  4ZHR A;  4AIL C;  5E41 A;  4FJ9 A;  1C1C A;  1IH7 A;  3OYL A;  4DSI A;  1TKX A;  3QNN A;  4CJS A;  3AVN A;  1RT2 A;  4KHN A;  2ITG A;  4IFY A;  4FLV A;  1ZYQ A;  1NK0 A;  4DTM A;  4H8K A;  4HCC A;  4CF2 A;  1UAX A;  4DFK A;  3ZT2 A;  3JYT A;  3OS2 A;  3KLF A;  1FKP A;  1LV5 A;  4CER A;  1GOB A;  1ZBH A;  3HM9 A;  1IKY A;  2PY5 A;  1WLJ A;  4KB1 A;  4FLW A;  3ZSW A;  2IDO A;  4CIE A;  4CCH A;  3MEC A;  3VQ5 A;  1KLN A;  4KHY A;  4CEE A;  3JSM A;  1JLE A;  5HRO A;  4IBN A;  3DLE A;  4KO0 A;  1J53 A;  1RDA A;  4I7F A;  3CM5 A;  3H08 A;  4MQ3 A;  3OYG A;  1NK4 A;  1TK5 A;  4B9S A;  4DFM A;  1NK6 A;  3DM2 A;  4FJH A;  3OS1 A;  2BDP A;  4O0I A;  4KRE A;  3VQ7 A;  2XY7 A;  4FK0 A;  3AO1 A;  3S3O A;  1WAF A;  3AO3 A;  3CM6 A;  3V9W A;  4M3R A;  1X9M A;  2F8T A;  4RW8 A;  3C95 A;  2D5R A;  1JKH A; 
#chains in the Genus database with same CATH topology
 3QEV A;  1I39 A;  4IEI A;  4NCG A;  3VEN A;  3NGI A;  1NK5 A;  4C1N K;  4OPJ A;  5C15 A;  2OTJ N;  1TGO A;  3R8E A;  4GV3 A;  3T3F A;  4A59 A;  3CXC M;  3ZX3 A;  3LPT A;  2V51 B;  3NF6 A;  4BR0 A;  1FJG K;  1VRU A;  2YNH A;  3L2U A;  3LP3 A;  4OJR A;  4BRG A;  1YVU A;  3DXK A;  5J2P A;  3DOL A;  3OHR A;  3I56 N;  1QSS A;  1JJ2 M;  5TKY A;  3VGK A;  4FWO A;  1XHX A;  3DLL L;  4DR3 K;  4B9L A;  3VN5 A;  4C1N I;  2LSN A;  2Q0U A;  4B9Q A;  3CET A;  1XNR K;  5DM6 L;  3I33 A;  3SAF A;  3F5T A;  2JWK A;  4IEE A;  1Q8I A;  5BRF A;  3OYE A;  1REV A;  2NRX A;  5FDL A;  5HOO A;  4FM1 A;  1XNQ K;  1MWM A;  2UYT A;  4CBW A;  5SWM A;  2KLA A;  3VMF B;  3AO4 A;  1XWL A;  5A2Q O;  1ZBL A;  2OPR A;  3DLH A;  4DQS A;  5C10 A;  5FPE A;  4ELT A;  4A5B A;  4O55 A;  3TSQ A;  3AVI A;  4KTQ A;  1RDU A;  1ESV A;  4PL8 A;  3DXM B;  3LDQ A;  3QES A;  2H3G X;  3EE9 A;  2HHS A;  1NNE A;  4RW9 A;  1B9D A;  5H1S Q;  3AA4 A;  1VQP N;  4DTR A;  2XY5 A;  4PQU A;  4F9O A;  2Q0R A;  3J7Z O;  1YHQ N;  1YTA A;  3O3F A;  3NDK A;  4M3X A;  2QXF A;  4GVM A;  2E2P A;  1S1U A;  2OPQ A;  1JL2 A;  4Y1C A;  4DU1 A;  4DUZ K;  3I8B A;  3RR7 A;  3VEY A;  3LAL A;  2UUA K;  3FR0 A;  1L5U A;  4HUG A;  3HPO A;  2OYQ A;  1T6D A;  3HST B;  4DSK A;  3RMB A;  4WFN L;  2ZGY A;  4DR1 K;  3V4I A;  2OA8 A;  3WT0 A;  3FZF A;  3NE6 A;  3ULD A;  4IJA A;  4CF0 A;  2A41 A;  1IKV A;  3ZX2 A;  2G8I A;  4H0X B;  3OYJ A;  5AQG A;  4JI1 K;  1BIU A;  3HOS A;  3VQ8 A;  2DFE A;  5C2F A;  5EXW A;  4GNI A;  4DWI A;  2P9N A;  2NRW A;  3M8Q A;  4FLY A;  4JKD A;  5JVG L;  1S5J A;  5M1K A;  1MWK A;  4JLH A;  2IVN A;  3OW2 M;  3RVC A;  4N41 A;  4JK9 A;  4C23 A;  1EKE A;  4N5S A;  3OS0 A;  1UA0 A;  4KHW A;  4B9M A;  1SV5 A;  3C6A A;  4CD1 A;  3AAP A;  2X74 A;  3CCS N;  1E4F T;  1VQ5 N;  1WSH A;  4O5B A;  2ITM A;  1NWK A;  4LF6 K;  1XQS C;  3L2Q A;  3V1O A;  4OGE A;  1F21 A;  4M7X A;  1NGD A;  4CJL A;  1RDC A;  3TU5 A;  4B9N A;  4ID1 A;  1GOC A;  5AQZ A;  1FK9 A;  5KI6 A;  3QIN A;  4B3M K;  2FXU A;  4FOE A;  3QNO A;  4RW4 A;  5GAG P;  2NZT A;  1W9H A;  2B5J A;  3LAN A;  3LWM A;  4CZI A;  1KRP A;  2ASO A;  4WQ4 A;  1RT1 A;  1QQO A;  1CLQ A;  2PZS A;  2QWO A;  2VG6 A;  4CBU A;  3C0B A;  1XHZ A;  4JI3 K;  5AQJ A;  4F4K A;  5FRO A;  4H4M A;  1VAZ A;  4CJ4 A;  1HNV A;  2KHO A;  3PV8 A;  1VRT A;  3O4Q A;  4BRE A;  3WNG A;  3CYM A;  2P1J A;  2Z1J A;  2G8U A;  2JWL A;  4C8K A;  5BR8 K;  3HOT A;  2DFH A;  3AGK A;  4HTU A;  3F73 A;  3M5R A;  4DLG A;  4OPH A;  1S3X A;  4E1N A;  3AGR A;  1ATN A;  1RNH A;  3O9Q A;  4B3O A;  3RTV A;  3D2E A;  3THX B;  5AZJ A;  4FOI A;  5J2Q A;  4DU4 A;  1BCO A;  4MDB A;  5HRP A;  4PKG A;  2BE2 A;  1NOY A;  5AFU A;  4KAZ A;  4JEP A;  1MDU B;  3Q7B A;  1Q86 O;  2XRI A;  3SJJ A;  1HJO A;  1BQN A;  3EY1 A;  1NGE A;  5F1X A;  4JD2 A;  3H3O B;  4YOV A;  2FC0 A;  3CQ8 A;  3J7Y P;  3VEO A;  2FLO A;  4YOU A;  3P31 A;  1L3U A;  2OCE A;  4E19 A;  1KVA A;  4WE1 A;  1NKE A;  4DV1 K;  4H5N A;  5CYM A;  4CHQ A;  1K8K A;  4A62 A;  3JS6 A;  2P9U A;  5JMV A;  2ZWH A;  3THV A;  3VA3 A;  4JS5 A;  1RTI A;  3ISN C;  2OPP A;  4FWN A;  2QTD A;  3ZYY X;  2QW9 A;  3K59 A;  3H46 O;  2E2Q A;  3HSC A;  4E89 A;  4KHU A;  3HYF A;  2IVP A;  1ATR A;  2HHH K;  4V19 S;  5AQN A;  4L8R B;  3CC2 N;  1HQE A;  3PLA A;  2FBY A;  2WBN A;  3QET A;  2NRZ A;  4H5W A;  1J54 A;  4CES A;  4ZTJ A;  3AVB A;  4X65 K;  2JLE A;  2P9I A;  4FLU A;  4WCE L;  2O8F A;  4FJL A;  4FJ8 A;  4CJK A;  2UUC K;  4PWD A;  2BTF A;  4FZZ A;  4KTZ A;  3RWU A;  2VCP A;  3GOI A;  1CXQ A;  4B3R K;  3KWI A;  3QFP A;  1RIL A;  1GLL O;  4E7I A;  4FLZ A;  2AP1 A;  4BRF A;  3C6U A;  4YOY A;  3MAQ A;  3CMA N;  3O8M A;  1HX1 A;  2X6N A;  1A5W A;  1C1B A;  1KFD A;  4FLX A;  1K9M O;  5AQX A;  4DQR A;  1DGK N;  4UY8 O;  1LAV A;  3F9K A;  3HJF A;  2FBT A;  2P5O A;  4NXN K;  3V1Q A;  3TAR A;  5LMU K;  1J5E K;  4JKB A;  1WN7 A;  2GTD A;  1XI1 A;  3NH1 A;  4BR9 A;  3LM2 A;  4JI5 K;  3UKU A;  4DQP A;  4Y0W A;  4DV2 K;  2E4L A;  4I6M B;  4OLA A;  3PIO L;  3CI5 A;  1LWE A;  4J2B A;  2ATQ A;  4FK4 A;  3VA0 A;  3FZK A;  3NFA A;  4LSN A;  3NVM A;  3CJ1 A;  2F8T A;  4BR7 A;  1O1W A;  3OBW A;  4B1W B;  4OKJ A;  2O8C B;  1Q9X A;  3WEE B;  1K73 O;  5FPD A;  3D2F A;  3HZ6 A;  1QE1 A;  3QIP A;  1QTM A;  3LP1 A;  4CJF A;  3GG4 A;  1UA1 A;  4JK7 A;  3CFP A;  4DF8 A;  4M3T A;  3C6H A;  4BRH A;  2E20 A;  1JL1 A;  3TAP A;  4O8U A;  3OYD A;  4BE2 A;  4DG1 A;  1FW6 A;  1RDB A;  4B8C A;  1BA0 A;  2I5J A;  1C6V A;  3DLG A;  1BI4 B;  3BGR A;  3ZT3 A;  3WQU A;  4AHR A;  2NLX A;  1TUY A;  4KFB A;  4K0K K;  4IOX A;  2A6A A;  4FJX A;  1Z6R A;  3TAN A;  4DSF A;  4LH4 A;  4FWR A;  4A5A A;  4QS8 A;  4B1Z A;  3TSP A;  3LZI A;  2PYJ A;  2IS3 A;  1LWF A;  3MK6 A;  2P9L B;  1C1C A;  1V4S A;  4E1J A;  3AVN A;  3T69 A;  4IFY A;  4FWQ A;  1HKB A;  3GBT A;  3CJ9 A;  4H8K A;  1NK0 A;  4JKF A;  4HCC A;  4DFK A;  3KLF A;  5CHI A;  3HI0 A;  2CGK A;  3HM9 A;  2PY5 A;  4FLW A;  3MEC A;  4KHY A;  4CEE A;  1D4X A;  3NVK A;  3OYG A;  1J53 A;  4B9S A;  1NK6 A;  2CGJ A;  4MO4 A;  3MDQ A;  3OS1 A;  3THY A;  2XY7 A;  4FK0 A;  4WQ4 C;  4DR5 K;  3VQQ A;  3C95 A;  3RSE B;  4K8X A;  4B9U A;  4MDA A;  2PAV A;  4JI2 K;  1ZXO A;  3L3V A;  1OVY A;  4KTW A;  4Q0B A;  1NK7 A;  3CHW A;  2P9S B;  4FWL A;  3VQA A;  4AHS A;  4CJ7 A;  4JI8 K;  3MED A;  3TWH A;  3CIP A;  2WTU A;  1BO5 O;  5KGX A;  2IGI A;  4DV7 K;  2RN2 A;  2P9P A;  5AQQ A;  3U9D A;  1NM1 A;  4FXD A;  2I7P A;  2DPN A;  1VK0 A;  3KWG A;  2EHG A;  4AM6 A;  1MA9 B;  2G8H A;  3HT3 A;  4GKJ K;  4WFB L;  1ITG A;  3TAE A;  4GV9 A;  1S6Q A;  1EQY A;  3PO4 A;  4ZTF A;  2RHK A;  3VQP A;  4E0D A;  4BAC A;  4CIG A;  1K8A O;  3BZC A;  3ZSR A;  3OBY A;  3NF7 A;  3TAF A;  4CGH A;  1VSK A;  2FF3 B;  1TL3 A;  5I9E B;  3QEW A;  1S9E A;  3ZT4 A;  4HVJ A;  2ZE2 A;  2Q1N A;  4UQG A;  1YIJ N;  3KTQ A;  1IKW A;  5M1N A;  3ZLJ A;  3SMP A;  1RDW X;  4LF5 K;  1ASU A;  5BRH A;  2W42 A;  4ILH A;  1YTU A;  1NMN A;  3AVJ A;  1WB9 A;  4CHN A;  2OTL N;  3AO2 A;  4ELU A;  4CZK A;  4AH9 A;  3HXM A;  4O4G A;  2YHA A;  3W3D A;  4R5P A;  3N4P A;  1TK8 A;  2XY8 A;  3I0R A;  1E3M A;  1QS4 A;  2WFB A;  2GX9 A;  2HHW A;  5J1E A;  4CGD A;  5E26 A;  3LAK A;  3CPW M;  3M8R A;  1SKS A;  2HHX A;  2IOC A;  3WNH A;  4DV4 K;  2RPI A;  2YNF A;  4YFU A;  4W5R A;  3CJ7 A;  1LCU A;  1U2V B;  2GEM A;  4CEC A;  3L4Q A;  4DTO A;  4E3S A;  3NF8 A;  4IZ9 A;  3ZX0 A;  1YXQ A;  1TKD A;  3AVF A;  3H1Q A;  3K5O A;  1VQ8 N;  5C0Y A;  3EZW A;  5DMR A;  1LOT B;  4FLT A;  1KAZ A;  2E1Z A;  2A1S A;  3HP9 A;  5M1F A;  3SBG A;  2HBJ A;  1RT7 A;  3UKR B;  4FWK A;  2QKK A;  3T7Z A;  1T05 A;  2QM1 A;  2F7T A;  4IKF A;  2Z1H A;  1T3V A;  4BE0 A;  1X9J A;  3VF4 A;  1NGB A;  3MCP A;  1O13 A;  5T7B A;  4CW7 B;  5F2R A;  4JKG A;  4DTU A;  3ZSQ A;  2YKM A;  3FFK B;  2ZF5 O;  4K8Z A;  3OJS A;  4CJT A;  3H3N O;  4B1V A;  1VQM N;  1ZC6 A;  1JCF A;  3KHY A;  3FFI A;  4BDZ A;  2P9K B;  2HVI A;  2F4V K;  2YKN A;  3QBW A;  4BC4 A;  2IIR A;  5AQK A;  3BY5 A;  1HYZ A;  4IOC L;  5JIC A;  4CZH A;  3EKS A;  1T03 A;  4O5F A;  5AZI B;  1NK9 A;  3KLI A;  4IG3 A;  3TTF A;  4Z4G A;  5AQS A;  3K9K A;  4F2S A;  1NLV A;  1BHL A;  3I0S A;  1GOA A;  3ZT1 A;  4Z4H A;  5IT9 O;  3BF3 A;  3A5L C;  4C8M A;  3V9U A;  1RDD A;  1EWR A;  2QK9 A;  5BPL A;  5KPR A;  1M1K O;  5AJ3 K;  4EP4 A;  4M45 A;  1K6Y A;  1N8R O;  3A5M C;  4DUY K;  3VEV A;  1NOZ A;  2GUI A;  4CF8 A;  5EX5 A;  3CQX A;  3MX5 A;  3SQ1 A;  4FJN A;  3SQ2 A;  2ZJQ L;  2A42 A;  5JVH L;  3KLE A;  3L6Q A;  4KI4 A;  1JLB A;  4BVP A;  4OO1 J;  1Q9Y A;  1Z25 A;  4H0V B;  2QWQ A;  2ETJ A;  4CFA A;  1NK8 A;  1OKJ A;  4KRF A;  3SMS A;  4BRM A;  5JS1 A;  3U4L A;  1BU6 O;  5TKW A;  4NLB A;  3L2W A;  4AQY K;  4FWP A;  1YT3 A;  4GW6 A;  2D0O A;  3M8S A;  1U47 A;  3PUF A;  4CZL A;  3TAB A;  1D8Y A;  4CZF A;  4M42 A;  4HTL A;  3VQE A;  5AQM A;  1YAG A;  3OTO K;  1TVR A;  3CCM N;  1A5V A;  1BQM A;  3RRH A;  3P1G A;  3JXU A;  4OKE A;  2IC3 A;  2RF2 A;  3MMV A;  2VWK A;  5LY3 A;  5KTQ A;  3KLH A;  1IBK K;  3ALY A;  4FJ7 A;  4DV6 K;  3TAG A;  2VYP A;  3ATU A;  1JLQ A;  4DFP A;  4Y1D A;  1V4T A;  3SV4 A;  2HHT A;  4BY9 C;  1VSE A;  1N34 K;  3CJA A;  2YNI A;  1EXQ A;  3IAY A;  3HVR A;  1D5A A;  4JRQ A;  4JAX A;  5M1O A;  3DXK B;  1JCE A;  3MN9 A;  1S1V A;  4DSL A;  2GBZ A;  4KH6 A;  1XMO K;  3F9M A;  1CZB A;  4NB4 A;  4CEO A;  5C2D A;  3T19 A;  4G9Z A;  3JAM O;  4BGB A;  1L3T A;  3CC4 N;  3QLH A;  5HRR A;  1TKZ A;  4CHO A;  1QQC A;  5EVZ A;  3SAH A;  3TAQ A;  5J2N A;  4M3U A;  3SYZ A;  2G8W A;  4B8A B;  3V9X A;  1T44 A;  4NCB A;  1NJI O;  4Q5V A;  4J2A A;  1Z26 A;  3ID6 A;  3K5M A;  1OH6 A;  1SKR A;  1VQ7 N;  4IOA L;  4HWI A;  4MO5 A;  3V6D A;  3ITH A;  1HR0 K;  1KSP A;  3WXI A;  2ZD1 A;  1C1A A;  3LDN A;  5AFU H;  3RMC A;  1NG9 A;  1XC9 A;  1HYS A;  2B6A A;  3D45 A;  2G8V A;  4CK1 A;  2RKI A;  4E7J A;  3BEX A;  2GWK A;  1QVG M;  3O08 A;  4WQ5 A;  2UXB K;  4J2D A;  1ZBS A;  4CJQ A;  3VQ9 A;  4PHT X;  3SI6 A;  2QWN A;  4NLC A;  1BL3 A;  1S1W A;  5GAD P;  2O4I A;  1Z05 A;  4CJW A;  2GUP A;  4DS5 A;  3VER A;  4K43 A;  4LD0 A;  4GMJ B;  3K5N A;  3L8B A;  3U3G A;  5J2M A;  1KLM A;  3U3Y A;  4H0T B;  2YV0 X;  2ZM6 K;  1SL0 A;  3IMX A;  4H5V A;  1NJY A;  3LP0 A;  2E8A A;  4CHY A;  4EP5 A;  3WQT A;  2KZZ A;  3T1Y K;  4U7B A;  3ZEU B;  2O4G A;  4BE1 A;  3PSI A;  3NGY A;  3SPY A;  3VEW A;  1UOC A;  3AA3 A;  2I7N A;  3IG1 A;  2P9N B;  4F3T A;  3WNE A;  4FWM A;  4I2Q A;  2HW3 A;  2KTQ A;  3T1A A;  4BWJ A;  1TYQ A;  4DQ8 A;  4Z94 A;  1EET A;  5LL6 Z;  4I6M A;  2D0P A;  3O3H A;  3K9J A;  3J80 O;  1KQS M;  2ASP A;  3THW A;  5D3G A;  3DLR A;  3MN5 A;  3M6G A;  4BQL A;  1YIT N;  3OYI A;  5BN9 A;  2O8C A;  4KBO A;  1QVF M;  1CZA N;  3U9Z A;  5E41 A;  4DR7 K;  2PBD A;  1TKX A;  4CJS A;  1RT2 A;  2ITG A;  4FLV A;  1ZYQ A;  3P38 A;  3B8A X;  3J81 O;  3ENH A;  4DTM A;  4DR6 K;  4CF2 A;  1UAX A;  1FKP A;  4CER A;  1WLJ A;  4KB1 A;  2V7Z A;  1RFQ A;  4MLH A;  4DB3 A;  1HPM A;  3IKM A;  5HRO A;  4KO0 A;  3A5N C;  1VQK N;  1RDA A;  2F9T A;  3CM5 A;  1NGF A;  3H08 A;  4MQ3 A;  4DFM A;  4FJH A;  4BR4 A;  4O0I A;  2BDP A;  4KRE A;  3AO1 A;  1WAF A;  3AO3 A;  1JXE A;  1C0M A;  3OYF A;  4FJJ A;  3VGM A;  1XC3 A;  2PYL A;  2BAN A;  3G10 A;  2Q97 A;  1QHA A;  1NGG A;  4F2R A;  2O8B A;  3CCE N;  1P90 A;  3OA9 A;  4EZ9 A;  4FJI A;  2P9L A;  2FSK A;  3P39 A;  1U48 A;  3VTH A;  3B6P A;  3DRP A;  1WUA A;  1R0A A;  2DY4 A;  2O8D A;  2HMI A;  1NJZ A;  3OY9 A;  3CCR N;  1G99 A;  4JHD A;  4W5T A;  1Y64 A;  3WNF A;  1JLC A;  5AZJ B;  1NGJ A;  2FF6 A;  4H4O A;  4AHV A;  3M8P A;  1M90 O;  3G4S N;  4DTJ A;  1S9G A;  4XIU A;  3KIO A;  3RMA A;  2E6L A;  4CFD A;  5KPT A;  3SNN A;  5CZ2 A;  3ZSV A;  1YF5 L;  4CI6 A;  4OPK A;  4BDP A;  4E7L A;  4BR5 A;  1G15 A;  4I2P A;  3LP2 A;  4F8R A;  1HKC A;  3DYA A;  3P5J A;  4X64 K;  3AA2 A;  4WF9 L;  1VQ6 N;  5E84 A;  4FCY A;  4YY3 K;  3UB5 A;  1BG3 A;  2HND A;  4N76 A;  4NCA A;  3IRX A;  1H1V A;  1X3N A;  1NGI A;  4YOT A;  1K8K B;  3O80 A;  3N4Q A;  4CJR A;  3D7E O;  4CGF A;  3SUQ A;  4CIF A;  1HUX A;  2CH5 A;  4M41 A;  5LJV A;  4BRL A;  1WSJ A;  4NO7 A;  4LF8 K;  3A5O C;  2HBK A;  3HM8 A;  4BGA A;  4CJP A;  1GLE G;  4FZX C;  3VES A;  1JLG A;  5K14 A;  4DR2 K;  3MWP A;  1HNI A;  4XH4 A;  3VTI A;  4YOR A;  4AHU A;  3R6M A;  4GY2 B;  1U4B A;  4Z4F A;  1OH5 A;  3E01 A;  3L3U A;  3WXK A;  1LW0 A;  3PSF A;  4BR2 A;  1EO1 A;  2P9I B;  2DTU A;  1NJW A;  2O8F B;  1Q18 A;  4LSL A;  3LPU A;  3WXM B;  3PY8 A;  4BRO A;  1S72 N;  2VWB A;  2YHX A;  2OAN A;  1HNX K;  3EO3 A;  1IO2 A;  5GIN A;  1UWB A;  1IV0 A;  2IAJ A;  1VQN N;  3OYM A;  4GV6 A;  2YHY A;  2HF3 A;  1Q81 O;  2BH1 A;  4W5O A;  3HPG A;  3MN7 A;  5GAE P;  1HMV A;  3KLG A;  3ULE B;  3PIP L;  1LAW A;  2QI2 A;  3SQ4 A;  4HUF A;  4JKC A;  5AQY A;  4CHP A;  4BRD A;  3AVC A;  1KC8 O;  3EL2 A;  3CCQ N;  1T7P A;  1HJR A;  2W6L A;  3D6R A;  1RT4 A;  1U45 A;  1KD1 O;  4ID5 A;  2QKB A;  4CF9 A;  2FBV A;  4DV0 K;  1HPZ A;  3QIC A;  4B9T A;  1EX4 A;  1J9A A;  3P4I A;  3LDS A;  3VET A;  4A57 A;  2QXL A;  1BIZ A;  4BVO A;  4CJV A;  3G71 N;  2W6K A;  2WUS A;  2HHV A;  4FPA A;  1U2V A;  4M63 C;  3H6E A;  3SUP A;  4DHY A;  3BUZ B;  3O9U A;  3KK3 A;  5I42 A;  3FZM A;  2WOM A;  1N5Y A;  4BRC A;  5FRN A;  1WBB A;  4PY5 A;  4E7H A;  1KAX A;  3KKS A;  3ZET A;  4A2A A;  3GDQ A;  2F8S A;  3O1B A;  3PX6 A;  4WQ5 C;  3QB0 A;  4BG9 A;  1ZBF A;  4FM0 A;  5CZ1 A;  1BGX T;  3EKU A;  4Z0U A;  4DV5 K;  4DTN A;  1C0U A;  4YDU A;  3C7N B;  5KQD A;  3QIO A;  4RW6 A;  4CJ3 A;  3OYC A;  4CJE A;  1JLF A;  2Y1I A;  4Z4E A;  3UKR A;  1W7A A;  3O3G A;  4CEF A;  3SLC A;  4CBX A;  4DU3 A;  3UE5 A;  5CR4 A;  5ADX A;  3K58 A;  3AO5 A;  4PKI A;  3MX2 A;  3SBT A;  4B1Y B;  4ISG A;  4I9L A;  2X6S A;  4IDH A;  3VF2 A;  1IG8 A;  5JLF A;  1QZ6 A;  2YHW A;  4IO9 L;  4CEZ A;  4BRP A;  4KB0 A;  1X9W A;  3KK7 A;  3R1X A;  2D4W A;  5CYQ A;  2HMP A;  4O8K A;  4JKA A;  3TAM A;  1HNZ K;  4B3T K;  4FJM A;  2HST A;  4H0O A;  4M3Z A;  3KZB A;  1YJN N;  1L3S A;  3CC7 N;  4WYB A;  5EOY A;  1SZ2 A;  3WUH A;  4DQQ A;  1I3A A;  1DEJ A;  1ILY A;  4TSX A;  3ID8 A;  3QO9 A;  4XH1 A;  1ZBI A;  4JN4 A;  3QFU A;  5JS2 A;  1DTQ A;  2GV9 A;  3QML A;  1QZ5 A;  4FJ5 A;  1XUP O;  3VPZ A;  4H0Y B;  3CFO A;  1VQ4 N;  2G8K A;  4YOW A;  3ZSX A;  3SQ0 A;  4EHU A;  1VHX A;  1I94 K;  4CF1 A;  4CK2 A;  5AQT A;  4N47 A;  3U6F A;  2E2N A;  3SCX A;  1Y97 A;  3FLC O;  2HHU A;  4KKO A;  5AQU A;  3THY B;  3VQ4 A;  2EX3 A;  3VEX A;  4CED A;  3TPQ A;  4CFB A;  3BDP A;  5EY4 A;  5B8H A;  2P5G A;  1BDG A;  3M1F A;  5BPM A;  5AQL A;  3J8A A;  2KZM A;  1GLD G;  3DXM A;  1RBT A;  3DLB A;  3NCI A;  1N33 K;  3GE1 A;  4ISE A;  5HP1 A;  3R3L A;  2HHQ A;  1R59 O;  4AHT A;  4KHS A;  2F96 A;  2P9P B;  3CFR A;  3LWL A;  5MLC Q;  3E9O A;  3DRR A;  1X9S A;  1C0F A;  3TR8 A;  3U8X A;  4FPB A;  4BC5 A;  2HBM A;  1NJX A;  4M3W A;  3SPZ A;  4LH5 A;  1KVC A;  4BQZ A;  3C6T A;  4H03 B;  2O8E B;  2Q36 A;  4LFC K;  4CD3 A;  1QQN A;  3R9P A;  3FE1 A;  3V1R A;  1TAQ A;  3LL3 A;  3OVN A;  5AR0 A;  3LDL A;  5CE3 A;  4B1X B;  2ZQB A;  5SZT A;  4EAH D;  3DAW A;  2QWL A;  3ENO A;  1RT3 A;  3AAQ A;  2Q31 A;  3M3Z A;  1LWC A;  1IKX A;  1NGC A;  5JLH A;  4B9V A;  1BOT O;  3HRG A;  4WFA L;  1IBM K;  3O9R A;  5I3U A;  3KD1 E;  5C12 A;  1VSI A;  3DWL A;  4M7Y A;  3IDH A;  1DTT A;  3OYK A;  3HBT A;  2F9W A;  3P83 D;  4ELV A;  3CF5 L;  1ASV A;  1JXB A;  2UU9 K;  4M3Y A;  4KH5 A;  4PA1 A;  4EFH A;  1VSD A;  4XH5 A;  3VQB A;  2Z1I A;  3VQD A;  3NAE A;  3QEX A;  1JLA A;  1WSE A;  3NF9 A;  2D0C A;  3FZH A;  4LC9 B;  3CG7 A;  5FLX O;  1VSF A;  3AVA A;  4RG8 A;  4H0P A;  1D9F A;  4C8O A;  1J5O A;  3AV9 A;  4JS4 A;  2FBX A;  1RBS A;  4YNQ A;  2KKZ A;  3O9T A;  5AQO A;  4LFB K;  4BRA A;  3IFR A;  4I9Q A;  3SV3 A;  1S6P A;  1W97 L;  3AVL A;  3QEP A;  5DK5 A;  4CJU A;  2AJQ A;  4MFB A;  4K25 A;  2G8F A;  1MU2 A;  3T1H K;  2YJF A;  3SZ2 A;  2ZJR L;  3GL1 A;  4CGJ A;  4CJ5 A;  1HNW K;  1RBR A;  2V52 B;  2HVH A;  4A2B A;  2YCH A;  3AA5 X;  1N32 K;  2XO7 A;  4FL9 A;  5F0X A;  4IG0 A;  4LY7 A;  4LFA K;  3W0L A;  2ASM A;  2HNZ A;  4JKG B;  1WSF A;  4OPA A;  3I8D A;  3NMU A;  1C0T A;  3S41 A;  5C42 A;  2RE2 A;  1S1X A;  4CEA A;  4AIL C;  4JK8 A;  4KH4 A;  5AQF A;  4FJ9 A;  3EEQ A;  3THX A;  3QNN A;  4KHN A;  3ZT2 A;  3ZEU A;  3OS2 A;  3JYT A;  4RWT A;  1LV5 A;  2YI1 A;  2UUB K;  1IKY A;  3FGU A;  2UXC K;  2IDO A;  2A3Z A;  4EIA A;  3G6E N;  1KLN A;  1P8Z A;  2GEL A;  2VGN A;  3JSM A;  1JLE A;  4IBN A;  1KAY A;  3DLE A;  4YDU C;  5BRD A;  3BF1 A;  1TK5 A;  5AQH A;  3SAG A;  3DM2 A;  3H45 C;  1W2B M;  3VQ7 A;  3S3O A;  5LMN K;  3CM6 A;  3V9W A;  1X9M A;  5BR9 A;  4JI4 K;  1JKH A;  1GLJ O;  2HNY A;  1QQM A;  1SUQ A;  3HP6 A;  4KV8 A;  3TSU A;  2XY6 A;  2VGM A;  4K41 A;  1HRH A;  3OJU A;  3D0P A;  3FZL A;  2A40 A;  3MN6 A;  4RCH A;  5KRS A;  4EZ6 A;  4OVL A;  4HHT A;  3O6W A;  5BPN A;  3SJH A;  3CD6 N;  3K57 A;  2E1Y A;  4R79 A;  1RT5 A;  4B08 A;  5IWA K;  3HPH A;  4Z4C A;  5M1P A;  2FSN A;  4ISF A;  3EZ5 A;  3CQY A;  1SKW A;  3HTV A;  1TUU A;  3K0S A;  4GVE A;  3CER A;  4AHC A;  4IJN A;  3H1V X;  4L3Q A;  4DQI A;  1NKC A;  1YUW A;  2NRR A;  3EE8 A;  1WBD A;  3PO5 A;  1BIS A;  1IBL K;  3CCV N;  2HF4 A;  2E2O A;  3TTD A;  1VQO N;  4X62 K;  2ZJP L;  2KW4 A;  4FWS A;  3G0Z A;  4FJG A;  1NBW A;  3HL8 A;  4KI6 A;  3L4I A;  3NH0 A;  3E1Y A;  1D9D A;  2IVO A;  4KHQ A;  1VQ9 N;  3HK2 A;  1KCF A;  4W5N A;  1X3M A;  2E88 A;  1W0H A;  4JI0 K;  4JNE A;  2VQE K;  3VOV A;  2D1K A;  1ATS A;  1N6Q A;  1RBU A;  2DFF A;  3LZJ A;  1B9F A;  3O1W A;  2E5L K;  1KVB A;  4LF4 K;  3S3N A;  4DKW A;  4PKH A;  4DS4 A;  2FSJ A;  4DV3 K;  1WNS A;  5HBM A;  4RW7 A;  3VQC A;  5KPZ A;  3A2F A;  1RTJ A;  4BWM A;  4RTF D;  2JGU A;  3L2V A;  4BC2 A;  2GWJ A;  4FM2 A;  1DKG D;  4C8N A;  2ZGZ A;  3SUO A;  2E6M A;  3WEE A;  4IDK A;  4FVU A;  3EN9 A;  3DLK A;  3MEG A;  4OLB A;  3LDO A;  3OYH A;  5HRN A;  1J6Z A;  4O44 A;  2OZM A;  1LW2 A;  1WOQ A;  2YHB A;  1VSM A;  3KVG A;  3F2K A;  2QWP A;  4IWV A;  1TL1 A;  3CCL N;  3HO1 A;  1FXX A;  2VQF K;  4JYA K;  4JV5 K;  1BCM A;  4X66 K;  1U6Z A;  4FVM A;  3CJC A;  1RT6 A;  4IFV A;  1CXU A;  4CEB A;  1YJW N;  3MCA B;  1WSG A;  3RR8 A;  1BI4 A;  3PX0 A;  2NRV A;  1TV6 A;  3VGL A;  3C65 A;  5AQR A;  1BA1 A;  2HB5 A;  1OH7 A;  5KRT A;  4DSE A;  3MEE A;  3KKR A;  4EHT A;  5AQW A;  3MXM A;  4CVN E;  3OYB A;  4IXC A;  5HL7 L;  1NKB A;  3SK3 A;  2UXD K;  1T6C A;  3L0Q A;  2WON A;  4FSV A;  5EU7 A;  3VEZ A;  2QA4 N;  4DR4 K;  3AVH A;  3HVT A;  2NNW A;  3DJC A;  4MLE A;  4BRN A;  2VWJ A;  1S22 A;  3EYZ A;  4FYD A;  4JI7 K;  4QCL A;  3ULE A;  1OVQ A;  5GIO A;  4CK3 A;  4OX9 K;  4AF1 A;  4JKH A;  3D2E B;  3UIQ A;  4Z4I A;  3QER A;  4F3O A;  1KTQ A;  1GLB G;  1VSL A;  2Y1J A;  4CGG A;  1WAJ A;  3V9Z A;  1BUP A;  4CHZ A;  4A61 A;  2W40 A;  3S9H A;  3RSE A;  3ZSY A;  4BRI A;  2OZS A;  2HBL A;  3E9L A;  3O4W A;  3ENB A;  4K42 A;  2QWR A;  2NRT A;  1TYQ B;  4JD2 B;  4CE9 A;  1A5X A;  2P9S A;  2VG5 A;  5FRM A;  2YJE A;  1BWF O;  4DSJ A;  3ATV A;  4E1M A;  3IS9 A;  5HLF A;  4QOZ B;  3THW B;  3O5B A;  4ICL A;  3KK2 A;  4O0J A;  2OPS A;  4XEI A;  4JRP A;  3ZCM A;  4DFJ A;  3CCJ N;  3ZSZ A;  2P9U B;  1RGI A;  2PFU A;  1HYV A;  3C7N A;  3Q7C A;  2NUB A;  1S1T A;  1RTD A;  1TKT A;  3LDP A;  5C25 A;  5BRE A;  2X78 A;  4ILJ A;  3S3M A;  1HQU A;  4OGC A;  2Q2R A;  1T8E A;  1RCH A;  1CZ9 A;  1FKO A;  4DTP A;  1QSL A;  4G1Q A;  1NU0 A;  1OH8 A;  2Q3S A;  4YHH K;  3OYA A;  1HKG A;  1N36 K;  2WC9 A;  4LF7 K;  3E66 A;  1DLO A;  4FW2 A;  4DLE A;  1EP4 A;  5CY4 A;  3WXJ A;  4FZY A;  2NRH A;  2XHB A;  5KQ8 A;  2CH6 A;  2V7Y A;  3BZK A;  3ZT0 A;  1SS6 A;  3VF6 A;  5FPM A;  2O8B B;  1U04 A;  4NYN A;  1SL1 A;  1KXP A;  1YI2 N;  3OYN A;  1VSH A;  2KFZ A;  1RTH A;  5ADX H;  3K5L A;  4JKE A;  2O8D B;  3L2R A;  2Z1G A;  1L3V A;  3RMD A;  3V81 A;  3AAR A;  3MXI A;  3KD5 E;  3KK1 A;  4JHD B;  5HRS A;  3O9S A;  1SL2 A;  4LF9 K;  1QSY A;  4NYF A;  4C8L A;  4DTS A;  3VQ6 A;  3UKU B;  4HCB A;  4QAG A;  5AQP A;  3CPE A;  3B6O A;  3QBX A;  2QEX N;  1IJJ A;  1B92 A;  4CZE A;  5GAH P;  2YX6 A;  4FJK A;  1YJ9 N;  4FW1 A;  1NGH A;  5DM7 L;  1GLF O;  2KQ2 A;  3TTC A;  4DF4 A;  1GLA G;  2A5X A;  2HOE A;  3AVG A;  3NBP A;  2VG7 A;  4H5R A;  1HLU A;  2D0B A;  3A0I X;  3TI0 A;  1IG9 A;  1XMQ K;  1GLC G;  1RBV A;  2YNG A;  3D2F B;  1Q7Y O;  3DOK A;  3V9S A;  4HUE A;  3K2P A;  3ASM A;  4OKK A;  3NHG A;  4IFE A;  5GIP A;  4BG8 A;  3WXL A;  5FPN A;  1VQL N;  2P51 A;  4W5Q A;  4PUO A;  3I55 N;  1VSJ A;  4AM7 A;  4H5T A;  3MXJ A;  3LM9 A;  3CME N;  4J8F A;  4BDY A;  2J4R A;  4E7K A;  4CZJ A;  1TK0 A;  3NGZ A;  5KGW A;  3ZSO A;  4U67 L;  3CJB A;  3PX4 A;  4KHP K;  2BGG A;  1NGA A;  4J2E A;  2O8E A;  1WSI A;  2P9K A;  4PL7 A;  1JCG A;  1ASW A;  4B3S K;  2R7Y A;  4KPY A;  2B4J A;  4N56 A;  3MWT A;  4NXM K;  3DI6 A;  3AVK A;  5M1Q A;  3C94 A;  5C24 A;  4BRQ A;  3QEI A;  1ZBU A;  1YVN A;  5AZI A;  3RRG A;  1QHT A;  4B1U B;  4YOX A;  1DT9 A;  3LAM A;  1X1P A;  1Q82 O;  4FO0 A;  3NH2 A;  3AVM A;  3E9P A;  3AY9 A;  4FK2 A;  2EWS A;  1TAU A;  3SUN A;  3J7A P;  4DTX A;  4BRK A;  2A1R A;  3DRS A;  1SAZ A;  1NMD A;  3A8Y A;  5ELZ A;  2KFN A;  2CGL A;  4DMN A;  3IUC A;  2W41 A;  4QS9 A;  3CCU N;  4IO8 A;  1U49 A;  2D0A A;  3QDK A;  4CFC A;  1C0G A;  1KFS A;  3O4N A;  3KJV A;  4BC3 A;  4CGI A;  4CEQ A;  4ZHR A;  4GKK K;  3G25 A;  4CZM A;  4CZG A;  1IH7 A;  5LJW A;  3OYL A;  4DSI A;  2QWM A;  3ZET B;  1EWQ A;  2BUP A;  5AQI A;  4JI6 K;  1GOB A;  4QS7 A;  1ZBH A;  5BN8 A;  3ZSW A;  4CIE A;  4CCH A;  3VQ5 A;  4I7F A;  4DCH A;  1E4G T;  1NK4 A;  2AA4 A;  1SQK A;  3BP8 A;  4ILG B;  4M3R A;  5AQV A;  4RW8 A;  3DMJ A;  2D5R A; 
#chains in the Genus database with same CATH homology
 1C0M A;  3QEV A;  4K8X A;  3OYF A;  1I39 A;  2HNY A;  4NCG A;  2PYL A;  3NGI A;  1SUQ A;  3HP6 A;  1NK5 A;  2BAN A;  3G10 A;  4KV8 A;  4OPJ A;  1TGO A;  2XY6 A;  1HRH A;  3T3F A;  3L3V A;  4F2R A;  3OJU A;  4KTW A;  3D0P A;  4Q0B A;  1NK7 A;  5KRS A;  3LPT A;  4EZ6 A;  4OVL A;  3NF6 A;  3VQA A;  4AHS A;  4HHT A;  4EZ9 A;  4FJI A;  1VRU A;  2YNH A;  3L2U A;  3LP3 A;  4OJR A;  3MED A;  1U48 A;  3B6P A;  3K57 A;  3TWH A;  1YVU A;  3DRP A;  5KGX A;  2IGI A;  2RN2 A;  5J2P A;  1R0A A;  2DY4 A;  1RT5 A;  4B08 A;  3DOL A;  3HPH A;  4Z4C A;  1QSS A;  3EZ5 A;  2HMI A;  1NJZ A;  3OY9 A;  1SKW A;  4FXD A;  1XHX A;  4AHC A;  4B9L A;  1VK0 A;  4W5T A;  3VN5 A;  2EHG A;  3WNF A;  2LSN A;  2G8H A;  4DQI A;  3HT3 A;  1JLC A;  1NKC A;  3TAE A;  1ITG A;  4H4O A;  1S6Q A;  4AHV A;  3PO4 A;  4ZTF A;  3VQP A;  3PO5 A;  3M8P A;  1BIS A;  4E0D A;  4BAC A;  4CIG A;  1Q8I A;  3ZSR A;  4DTJ A;  3TAF A;  3NF7 A;  3OYE A;  4CGH A;  1S9G A;  1VSK A;  4XIU A;  3KIO A;  3RMA A;  1REV A;  2E6L A;  5FDL A;  1TL3 A;  4CFD A;  2KW4 A;  4FM1 A;  3QEW A;  5CZ2 A;  3SNN A;  3ZSV A;  1S9E A;  3ZT4 A;  4OPK A;  3G0Z A;  2ZE2 A;  4HVJ A;  4UQG A;  4BDP A;  4FJG A;  3HL8 A;  5SWM A;  1IKW A;  4E7L A;  3KTQ A;  3NH0 A;  4KI6 A;  1G15 A;  4I2P A;  3AO4 A;  3LP2 A;  1XWL A;  1ZBL A;  4F8R A;  2OPR A;  1D9D A;  4DQS A;  3DLH A;  3DYA A;  3VQQ A;  4KHQ A;  3P5J A;  4ELT A;  1ASU A;  3AA2 A;  4O55 A;  2W42 A;  3AVI A;  4FCY A;  1YTU A;  3HK2 A;  1KCF A;  4KTQ A;  3AVJ A;  4W5N A;  2HND A;  4N76 A;  4NCA A;  4CHN A;  3IRX A;  1W0H A;  3QES A;  3AO2 A;  4ELU A;  2HHS A;  4RW9 A;  4AH9 A;  1B9D A;  4CJR A;  3AA4 A;  4CGF A;  3HXM A;  4O4G A;  4CIF A;  3SUQ A;  1N6Q A;  2YHA A;  4DTR A;  2XY5 A;  4B9U A;  4M41 A;  4PQU A;  1JXE A;  1RBU A;  4R5P A;  2DFF A;  1TK8 A;  3LZJ A;  1B9F A;  1WSJ A;  2XY8 A;  1KVB A;  3I0R A;  1YTA A;  4CJP A;  1QS4 A;  3O3F A;  3NDK A;  3S3N A;  4M3X A;  4FZX C;  4DS4 A;  2QXF A;  2HHW A;  5J1E A;  1WNS A;  5HBM A;  4GVM A;  4CGD A;  3LAK A;  4RW7 A;  1JLG A;  5K14 A;  3VQC A;  3M8R A;  1HNI A;  1S1U A;  1SKS A;  2OPQ A;  1JL2 A;  1RTJ A;  2IOC A;  3A2F A;  4Y1C A;  2RPI A;  3WNH A;  2YNF A;  4AHU A;  4YFU A;  4DU1 A;  4BWM A;  4W5R A;  1U4B A;  4Z4F A;  2HHX A;  3E01 A;  3L3U A;  3RR7 A;  3LAL A;  2JGU A;  3L2V A;  1LW0 A;  4FM2 A;  4CEC A;  1L5U A;  4DTO A;  4HUG A;  3HPO A;  4E3S A;  3NF8 A;  4C8N A;  2OYQ A;  2DTU A;  1NJW A;  4LSL A;  3SUO A;  2E6M A;  3LPU A;  4IDK A;  3DLK A;  3HST B;  1TKD A;  3AVF A;  3PY8 A;  3K5O A;  4DSK A;  3MEG A;  3RMB A;  4OLB A;  1QTM A;  5DMR A;  3V4I A;  2OA8 A;  3OYH A;  5HRN A;  1IO2 A;  4O44 A;  3NE6 A;  3ULD A;  2OZM A;  4CF0 A;  1UWB A;  1IKV A;  4FLT A;  2G8I A;  1LW2 A;  2IAJ A;  2A1S A;  1VSM A;  2YHB A;  3OYM A;  3OYJ A;  3HP9 A;  1BIU A;  3VQ8 A;  2DFE A;  4W5O A;  1TL1 A;  3HPG A;  3KLG A;  1HMV A;  4DWI A;  3HO1 A;  1FXX A;  1LAW A;  3M8Q A;  3SQ4 A;  4FLY A;  1RT7 A;  4HUF A;  4CHP A;  1BCM A;  3AVC A;  2QKK A;  4FVM A;  1RT6 A;  4IFV A;  1S5J A;  1CXU A;  4CEB A;  1HJR A;  4JLH A;  1T05 A;  1T7P A;  1WSG A;  1RT4 A;  1U45 A;  3RR8 A;  1BI4 A;  4ID5 A;  3PX0 A;  2QKB A;  4CF9 A;  4N41 A;  4IKF A;  2FBV A;  2Z1H A;  4BE0 A;  1EKE A;  1HPZ A;  1TV6 A;  4N5S A;  3OS0 A;  4B9T A;  1EX4 A;  1UA0 A;  1J9A A;  4B9M A;  3LDS A;  4KHW A;  1SV5 A;  5T7B A;  1BIZ A;  2HB5 A;  4CJV A;  2X74 A;  4DTU A;  2HHV A;  3ZSQ A;  2YKM A;  5KRT A;  4DSE A;  3MEE A;  3SUP A;  4K8Z A;  3OJS A;  3KK3 A;  4CJT A;  5I42 A;  3KKR A;  1WSH A;  2WOM A;  3MXM A;  4O5B A;  1N5Y A;  5FRN A;  3L2Q A;  3OYB A;  1NKB A;  4PY5 A;  4E7H A;  3KKS A;  3V1O A;  3FFI A;  4OGE A;  4BDZ A;  5EU7 A;  1F21 A;  2WON A;  3PX6 A;  2F8S A;  2HVI A;  3AVH A;  3HVT A;  2YKN A;  1ZBF A;  4CJL A;  4FM0 A;  1RDC A;  4B9N A;  4ID1 A;  1GOC A;  5CZ1 A;  1BGX T;  1FK9 A;  1HYZ A;  2VWJ A;  4Z0U A;  5KI6 A;  3QIN A;  4DTN A;  3EYZ A;  4FYD A;  1C0U A;  4QCL A;  3QIO A;  4RW6 A;  4CJ3 A;  3OYC A;  4CJE A;  1JLF A;  4CK3 A;  2Y1I A;  3QNO A;  1T03 A;  4RW4 A;  4Z4E A;  3O3G A;  4CEF A;  1W9H A;  2B5J A;  3QER A;  3LAN A;  3UIQ A;  3LWM A;  4Z4I A;  1KRP A;  4DU3 A;  4F3O A;  1KTQ A;  1RT1 A;  3K58 A;  1CLQ A;  2PZS A;  1NK9 A;  3KLI A;  2VG6 A;  4IG3 A;  3AO5 A;  4Z4G A;  1VSL A;  2Y1J A;  4CGG A;  4F2S A;  1XHZ A;  1WAJ A;  3V9Z A;  4CHZ A;  4I9L A;  2X6S A;  1BHL A;  3I0S A;  1GOA A;  3ZT1 A;  4Z4H A;  4F4K A;  3S9H A;  5FRO A;  4H4M A;  4C8M A;  3V9U A;  3ZSY A;  4CJ4 A;  1RDD A;  4CEZ A;  2OZS A;  2QK9 A;  1HNV A;  4KB0 A;  1X9W A;  4EP4 A;  4M45 A;  3PV8 A;  1K6Y A;  1VRT A;  5CYQ A;  4CE9 A;  1A5X A;  1NOZ A;  2GUI A;  3TAM A;  2VG5 A;  4CF8 A;  4FJM A;  3O4Q A;  5FRM A;  4M3Z A;  3SQ1 A;  3WNG A;  4DSJ A;  4E1M A;  3CYM A;  2P1J A;  2Z1J A;  2G8U A;  4FJN A;  3SQ2 A;  3IS9 A;  4C8K A;  1L3S A;  5HLF A;  4QOZ B;  4ICL A;  3KK2 A;  2DFH A;  3KLE A;  4O0J A;  4DQQ A;  4KI4 A;  2OPS A;  4HTU A;  4JRP A;  1JLB A;  3ZCM A;  3F73 A;  4DFJ A;  1Q9Y A;  1I3A A;  3ZSZ A;  4DLG A;  1Z25 A;  1HYV A;  4E1N A;  2ETJ A;  4TSX A;  3QO9 A;  4CFA A;  1NK8 A;  4KRF A;  1ZBI A;  1RNH A;  5JS1 A;  2NUB A;  1S1T A;  1RTD A;  4B3O A;  1TKT A;  5C25 A;  5JS2 A;  1DTQ A;  2GV9 A;  3RTV A;  4FJ5 A;  2X78 A;  3S3M A;  3L2W A;  1HQU A;  4OGC A;  5J2Q A;  4DU4 A;  1BCO A;  3CFO A;  1YT3 A;  4GW6 A;  2G8K A;  3ZSX A;  5HRP A;  3M8S A;  1RCH A;  3SQ0 A;  3PUF A;  3TAB A;  1U47 A;  1T8E A;  2BE2 A;  1D8Y A;  1CZ9 A;  1FKO A;  4DTP A;  4CF1 A;  1NOY A;  1QSL A;  4CK2 A;  4G1Q A;  4N47 A;  4M42 A;  4KAZ A;  2Q3S A;  3VQE A;  3OYA A;  3U6F A;  1TVR A;  2XRI A;  3SCX A;  1Y97 A;  1BQN A;  3EY1 A;  3SJJ A;  1A5V A;  2HHU A;  4KKO A;  1BQM A;  3RRH A;  3P1G A;  4OKE A;  3VQ4 A;  2EX3 A;  1DLO A;  2FC0 A;  2IC3 A;  2RF2 A;  3CQ8 A;  2VWK A;  4CED A;  4FW2 A;  4DLE A;  1L3U A;  4CFB A;  3BDP A;  1EP4 A;  5KTQ A;  3KLH A;  2P5G A;  5CY4 A;  3ALY A;  4FJ7 A;  4FZY A;  3TAG A;  4E19 A;  1KVA A;  2XHB A;  1JLQ A;  4DFP A;  2KZM A;  4WE1 A;  4Y1D A;  3SV4 A;  3QEI A;  1NKE A;  1RBT A;  2HHT A;  3DLB A;  5CYM A;  4CHQ A;  3ZT0 A;  3NCI A;  1VSE A;  3THV A;  1U04 A;  3VA3 A;  4JS5 A;  2YNI A;  1RTI A;  3ISN C;  4NYN A;  1EXQ A;  2OPP A;  5HP1 A;  1SL1 A;  3IAY A;  3OYN A;  2HHQ A;  3HVR A;  3K59 A;  4AHT A;  1VSH A;  2KFZ A;  1D5A A;  4JRQ A;  4KHS A;  1RTH A;  2F96 A;  4E89 A;  4KHU A;  3HYF A;  3K5L A;  3CFR A;  3LWL A;  1S1V A;  3L2R A;  2Z1G A;  1L3V A;  4DSL A;  3RMD A;  3V81 A;  3DRR A;  2GBZ A;  1X9S A;  3MXI A;  3KD5 E;  4L8R B;  3KK1 A;  3TR8 A;  5HRS A;  1SL2 A;  1CZB A;  1QSY A;  1HQE A;  4NYF A;  2FBY A;  4C8L A;  3QET A;  4CEO A;  1J54 A;  3T19 A;  4CES A;  3VQ6 A;  4DTS A;  4ZTJ A;  1NJX A;  3AVB A;  4HCB A;  4QAG A;  2JLE A;  3B6O A;  4FLU A;  4M3W A;  3SPZ A;  1L3T A;  1B92 A;  4FJL A;  4LH5 A;  4FJK A;  1KVC A;  3QLH A;  3C6T A;  4FJ8 A;  5HRR A;  1TKZ A;  4FW1 A;  4CHO A;  1QQC A;  4CJK A;  3TAQ A;  5J2N A;  4PWD A;  4M3U A;  3SYZ A;  2G8W A;  4B8A B;  3V9X A;  4KTZ A;  2KQ2 A;  4DF4 A;  3RWU A;  4FZZ A;  3AVG A;  3NBP A;  1CXQ A;  2VG7 A;  3V1R A;  1TAQ A;  4NCB A;  2D0B A;  1RIL A;  3OVN A;  4E7I A;  3TI0 A;  4Q5V A;  4J2A A;  4FLZ A;  1Z26 A;  1IG9 A;  4FJJ A;  1RBV A;  3C6U A;  2YNG A;  3K5M A;  2ZQB A;  3MAQ A;  1SKR A;  5SZT A;  2X6N A;  1A5W A;  3DOK A;  1C1B A;  1KFD A;  4HUE A;  4FLX A;  3V9S A;  3K2P A;  3ASM A;  3V6D A;  4OKK A;  4DQR A;  3ITH A;  3NHG A;  1RT3 A;  1LWC A;  1LAV A;  3F9K A;  1IKX A;  1KSP A;  3HJF A;  2FBT A;  2P5O A;  4PUO A;  2P51 A;  3DMJ A;  3V1Q A;  4W5Q A;  3TAR A;  4B9V A;  1VSJ A;  2ZD1 A;  3MXJ A;  1WN7 A;  1C1A A;  3RMC A;  1XC9 A;  5I3U A;  2B6A A;  3D45 A;  1XI1 A;  1HYS A;  2G8V A;  3KD1 E;  3NH1 A;  4CK1 A;  4BDY A;  2RKI A;  4E7K A;  1VSI A;  4E7J A;  1TK0 A;  3OYK A;  1DTT A;  3NGZ A;  4DQP A;  5KGW A;  2E4L A;  3P83 D;  4ELV A;  4OLA A;  3ZSO A;  1ASV A;  1JXB A;  1LWE A;  3PX4 A;  2ATQ A;  4J2B A;  2BGG A;  4M3Y A;  4J2E A;  4J2D A;  4PA1 A;  4FK4 A;  4CJQ A;  3VA0 A;  1VSD A;  3VQ9 A;  1WSI A;  3NFA A;  3SI6 A;  4LSN A;  1BL3 A;  3VQB A;  1S1W A;  2O4I A;  1ASW A;  2Z1I A;  3VQD A;  4CJW A;  3NAE A;  2R7Y A;  4DS5 A;  3QEX A;  1JLA A;  2B4J A;  4KPY A;  1O1W A;  1WSE A;  4LD0 A;  4N56 A;  4GMJ B;  3K5N A;  4OKJ A;  3NF9 A;  3L8B A;  1Q9X A;  2D0C A;  3DI6 A;  3U3G A;  3AVK A;  5J2M A;  1KLM A;  3U3Y A;  1SL0 A;  2YV0 X;  1QE1 A;  3C94 A;  3CG7 A;  1VSF A;  3QIP A;  1ZBU A;  3LP0 A;  3LP1 A;  3AVA A;  5C24 A;  4RG8 A;  4CJF A;  1NJY A;  1D9F A;  4CHY A;  4EP5 A;  1UA1 A;  1J5O A;  4C8O A;  3AV9 A;  4JS4 A;  2KZZ A;  2FBX A;  3RRG A;  1RBS A;  1QHT A;  4YNQ A;  2O4G A;  4BE1 A;  3LAM A;  3CFP A;  4DF8 A;  4M3T A;  1X1P A;  3NGY A;  3SPY A;  4I9Q A;  3NH2 A;  1UOC A;  3AA3 A;  3SV3 A;  1S6P A;  3AVL A;  3AVM A;  3IG1 A;  3QEP A;  5DK5 A;  4CJU A;  2AJQ A;  1JL1 A;  4MFB A;  4F3T A;  3TAP A;  3WNE A;  4I2Q A;  3OYD A;  4BE2 A;  2G8F A;  4DG1 A;  2HW3 A;  4FK2 A;  1RDB A;  4B8C A;  2KTQ A;  3T1A A;  1MU2 A;  1TAU A;  2I5J A;  3SUN A;  1C6V A;  4BWJ A;  1EET A;  3DLG A;  1BI4 B;  3BGR A;  3SZ2 A;  3ZT3 A;  4AHR A;  4CGJ A;  4DTX A;  2A1R A;  4CJ5 A;  4KFB A;  3O3H A;  1RBR A;  3DRS A;  2HVH A;  3AA5 X;  2XO7 A;  2KFN A;  4IG0 A;  4LY7 A;  4FJX A;  3TAN A;  5D3G A;  4DMN A;  4DSF A;  2HNZ A;  3DLR A;  4LH4 A;  1WSF A;  3I8D A;  1U49 A;  2D0A A;  4CFC A;  3OYI A;  3LZI A;  2IS3 A;  2PYJ A;  1KFS A;  1C0T A;  5C42 A;  1LWF A;  3O4N A;  1S1X A;  3KJV A;  4CEA A;  4CGI A;  4CEQ A;  4ZHR A;  4AIL C;  5E41 A;  4FJ9 A;  1C1C A;  1IH7 A;  3OYL A;  4DSI A;  1TKX A;  3QNN A;  4CJS A;  3AVN A;  1RT2 A;  4KHN A;  2ITG A;  4IFY A;  4FLV A;  1ZYQ A;  1NK0 A;  4DTM A;  4H8K A;  4HCC A;  4CF2 A;  1UAX A;  4DFK A;  3ZT2 A;  3JYT A;  3OS2 A;  3KLF A;  1FKP A;  1LV5 A;  4CER A;  1GOB A;  1ZBH A;  3HM9 A;  1IKY A;  2PY5 A;  1WLJ A;  4KB1 A;  4FLW A;  3ZSW A;  2IDO A;  4CIE A;  4CCH A;  3MEC A;  3VQ5 A;  1KLN A;  4KHY A;  4CEE A;  3JSM A;  1JLE A;  5HRO A;  4IBN A;  3DLE A;  4KO0 A;  1J53 A;  1RDA A;  4I7F A;  3CM5 A;  3H08 A;  4MQ3 A;  3OYG A;  1NK4 A;  1TK5 A;  4B9S A;  4DFM A;  1NK6 A;  3DM2 A;  4FJH A;  3OS1 A;  2BDP A;  4O0I A;  4KRE A;  3VQ7 A;  2XY7 A;  4FK0 A;  3AO1 A;  3S3O A;  1WAF A;  3AO3 A;  3CM6 A;  3V9W A;  4M3R A;  1X9M A;  2F8T A;  4RW8 A;  3C95 A;  2D5R A;  1JKH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...