3AVAA

Crystal structures of novel allosteric peptide inhibitors of hiv integrase in the ledgf binding site
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
154
structure length
150
Chain Sequence
b'SSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title Crystal structures of novel allosteric peptide inhibitors of HIV integrase identify new interactions at the LEDGF binding site.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Recombination/inhibitor
total genus 58
structure length 150
sequence length 154
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3avaA00
1ZBLA 4KPYA 2HW3A 4CFBA 3PX0A 4C8NA 3P1GA 1ASUA 4Z4HA 3LP1A 4OGCA 4CGJA 3K57A 4FJ5A 1BQNA 1JL1A 4DF4A 4FJIA 4KI4A 2HVIA 3SUNA 3NH0A 4OPKA 4KB1A 3QERA 4W5TA 1D5AA 3SUPA 4B9SA 1QS4A 3V1RA 3CQ8A 4KHWA 4JS5A 1NOZA 1EXQA 5J2NA 2QKBA 4PQUA 2YHBA 1BISA 4Z0UA 3TAMA 4DS5A 3IG1A 1XI1A 5KRTA 3PV8A 4M45A 3SPZA 1NK8A 3QIPA 3ZCMA 4FLWA 1BHLA 3DRRA 2HNDA 3AVNA 1QE1A 3DLHA 4Z4EA 3NHGA 1J53A 1KTQA 3MXMA 3PY8A 3KTQA 1B9DA 4M3XA 2FBXA 4AHUA 1NK6A 3U6FA 3RR8A 3QLHA 3LZJA 2HHQA 5K14A 5CYMA 4F3TA 1C0UA 4IG3A 4CFCA 3HPOA 2E6LA 1J9AA 4DQQA 5I42A 2YNHA 4M3TA 3ALYA 3SV3A 1RBUA 2P5GA 5JS1A 5KGXA 1LAVA 4I9QA 3RMBA 1J54A 2WONA 4KRFA 1RBTA 4CHZA 4CHNA 3QO9A 4G1QA 4CF0A 3DI6A 4AHCA 4FK0A 4OKKA 4KHSA 4E3SA 4M3YA 4Q5VA 1WSFA 1D8YA 1DTTA 4CJVA 4W5QA 4FLYA 4ICLA 1GOBA 3TAQA 3CM6A 4CJSA 2RKIA 3K5OA 4FLUA 5E41A 5J2PA 2P51A 4LH5A 4O0JA 4H8KA 3LALA 4B9UA 3QEWA 4F2SA 3HSTB 4O55A 2ATQA 3PO4A 4AH9A 2KQ2A 3V9XA 4CEEA 1YVUA 4CJRA 1BIUA 1HNVA 2FBTA 2Z1IA 3DLEA 3M8QA 3DRSA 3MXIA 2HHXA 2B5JA 4OPJA 2HNYA 1DLOA 4ID5A 3TABA 1RT5A 2Y1JA 1L3SA 3NF7A 2YNIA 3OYAA 2QKKA 1FKPA 2HHWA 1ASVA 4CJQA 4LD0A 4DG1A 1BI4B 3L3UA 1QSYA 3LWMA 1NJWA 1S6PA 5HROA 3L3VA 4ZTJA 4O5BA 5HRRA 3SJJA 3S3NA 2PYJA 4F8RA 2ZE2A 1UA1A 2F96A 1HMVA 1HNIA 5FDLA 3QEIA 3RRHA 1Q9XA 1LW2A 3U3YA 1HQEA 1S5JA 4ZTFA 1D9FA 1SKSA 3CYMA 4M3WA 4I2QA 4CEOA 1VSFA 4CIEA 1QHTA 1HQUA 3KIOA 3RRGA 4E0DA 4C8KA 4AHVA 4CHPA 3SPYA 1RCHA 2FBVA 4LSLA 4HUGA 4WE1A 4DFPA 1ZBHA 4CEBA 1C6VA 1KFSA 4DFMA 1RBRA 3V1QA 4DF8A 3VQ5A 4EZ6A 3WNFA 4BWJA 5HRNA 3NE6A 2X6NA 3NBPA 3OYLA 3SNNA 3AVIA 1JXBA 4OLBA 1RTHA 4FW1A 1RT1A 4JS4A 3HP6A 4CGGA 4NYFA 4DQRA 3HYFA 3MAQA 2XY6A 2YNFA 2AJQA 1U48A 1I3AA 4DSEA 4FYDA 2HHTA 4CHYA 2NUBA 3MEGA 3BDPA 3ITHA 4FCYA 4CJEA 4KTZA 4CESA 3AVFA 4DSLA 1TAUA 1WSJA 3DOLA 1RTDA 4W5OA 2F8TA 1KVAA 2WOMA 1U45A 1A5VA 4W5RA 1TL1A 1T05A 2DFEA 2D5RA 4B8CA 3V9WA 4M42A 1IKVA 2IS3A 4GW6A 1HYSA 3AO3A 4AHSA 1MU2A 3NGZA 3KK3A 4KHUA 3A2FA 2VWKA 3NGIA 3HL8A 5KGWA 2B6AA 3OYDA 1VSJA 4CE9A 3CFPA 3NF8A 1IG9A 4N56A 3WNEA 4C8OA 1CLQA 1RT7A 3AVBA 3P5JA 5HBMA 1C0TA 2GBZA 4BDZA 3OYGA 1NJXA 1S1XA 4RW4A 4HUEA 3TAEA 3LDSA 4DSJA 1VSIA 3OJUA 1SKRA 4NCBA 4KV8A 1WAFA 3OYNA 1SUQA 5EU7A 3RTVA 4FJKA 4DFJA 1U49A 4KTQA 3LP0A 3O4NA 3ZT1A 3KLHA 1Q9YA 2G8VA 1NJZA 3V4IA 5D3GA 3SQ1A 1RTIA 2OPPA 4OJRA 3OYCA 3LZIA 2KW4A 1LWCA 3V9UA 1X1PA 3ZT2A 4CJWA 3V6DA 2W42A 2D0AA 2G8FA 1WN7A 4QCLA 2B4JA 1UAXA 1NJYA 1JLEA 2OPSA 1I39A 1BL3A 1YTAA 1A5XA 1R0AA 2ITGA 1FXXA 2KFZA 4AILC 3B6PA 3KLEA 3EYZA 4KHNA 2O4IA 1RBVA 1L3TA 3LP3A 1NK4A 1RDCA 4DQPA 3O3FA 5FRMA 2OPQA 3RR7A 4CJ5A 1X9WA 3I0SA 3HP9A 3HPGA 4OKEA 1U47A 3OS2A 1CZBA 1TVRA 3AO1A 4KTWA 1XHZA 4AHTA 4BE0A 1NK5A 1KLMA 1L3VA 2G8IA 4Q0BA 4CGIA 2BDPA 4O44A 1XHXA 3VQCA 4DU1A 3L2QA 2XY5A 3HVTA 2D0BA 4MQ3A 3NAEA 3NF9A 4FM1A 3VA3A 2X74A 3TAGA 5FRNA 1WLJA 2E4LA 4CIFA 3SUOA 3HK2A 4DTRA 1QQCA 1XC9A 5SWMA 4BDPA 4OLAA 1A5WA 2EX3A 2YNGA 4H4OA 2YKNA 3C95A 3PX4A 3JYTA 2Q3SA 2RPIA 1VSKA 3WNGA 3HM9A 4DWIA 1UA0A 4RW9A 3ZSQA 3ULDA 4ELVA 2HMIA 3OVNA 4O4GA 1C1CA 4F4KA 4FJXA 4KHYA 1BGXT 4E7JA 1YT3A 2P5OA 2QK9A 1VSHA 4M41A 5KI6A 1JL2A 4CK2A 2IGIA 3NH1A 4I2PA 1EP4A 3FFIA 1Y97A 2EHGA 2G8WA 4OKJA 4LY7A 4CHOA 1U04A 3P83D 4AHRA 4HVJA 1T8EA 4FXDA 1NKCA 3VQDA 4CF8A 1KFDA 1U4BA 4FJ9A 3AO2A 5C24A 4FJJA 3LANA 3ZSRA 3O4QA 5J2MA 3KK2A 4FJLA 4RG8A 3S9HA 3TWHA 2JLEA 4DSIA 3V9ZA 1S9GA 3PX6A 3ZT0A 3O3HA 1JLBA 1JLCA 1S1UA 4CJLA 1L5UA 1VSDA 1NK0A 4CJTA 1QSSA 1LAWA 4BE2A 2VG5A 2HNZA 4CJ3A 4NCAA 2KZMA 4GVMA 4PA1A 3KLIA 1WSGA 4OVLA 3KK1A 4OGEA 4EP4A 3SYZA 2ZD1A 3AO4A 1CZ9A 4DTUA 3IRXA 2F8SA 4CEFA 1UWBA 2XHBA 4BACA 4W5NA 4PY5A 1BI4A 1O1WA 4B9MA 3DLGA 3OYBA 3TANA 3G0ZA 5CZ1A 5J2QA 1TK8A 1ZBIA 3OYHA 1L3UA 4CF2A 4HCBA 4DU4A 4M3UA 1VSMA 3AVJA 2OZSA 4FM2A 4ID1A 4C8MA 3IAYA 4E1MA 4E7KA 4Y1CA 4FJHA 1SV5A 5DMRA 4FZXC 1NOYA 1K6YA 3EZ5A 4DTSA 1S1TA 3RMDA 2D0CA 2PZSA 1RTJA 1BCOA 3OYFA 4Z4IA 3NDKA 1NKEA 1T03A 4CJKA 1VRTA 3D45A 3G10A 4E1NA 3NFAA 4EP5A 4DU3A 1W9HA 1WNSA 1T7PA 3ASMA 3BGRA 4IG0A 4BWMA 3VN5A 3D0PA 2IDOA 4CFDA 4KREA 4N76A 2GV9A 4FLVA 3DLKA 3MXJA 3VQBA 1F21A 3L2VA 4Y1DA 2XY8A 2DFFA 3NCIA 3AO5A 3SQ4A 3K2PA 1IKXA 1C1AA 4ZHRA 3OS0A 1ZYQA 3F9KA 3SV4A 3B6OA 4NYNA 3T3FA 4L8RB 3O3GA 3VQ8A 3C6TA 4IFVA 3QETA 1Z25A 2IAJA 3HVRA 1VSEA 4DSKA 3QINA 2VWJA 4CEQA 3LPTA 3L2WA 4J2BA 1ASWA 3HPHA 1KSPA 1QTMA 4IKFA 5CYQA 5DK5A 1REVA 1RT6A 3I0RA 5C42A 2KFNA 4M3ZA 2X6SA 4CF9A 1W0HA 2OYQA 3M8RA 1HYZA 1S1WA 3DYAA 3KLFA 3QEXA 1X9MA 4NCGA 1ZBUA 1BCMA 1JLQA 1TK5A 3HO1A 4DQSA 2DTUA 2ZQBA 1IH7A 3CM5A 1HYVA 4CHQA 1X9SA 2Z1GA 3K58A 4C8LA 1LWFA 3T19A 1N6QA 4B9LA 3UIQA 4J2AA 4N41A 2Y1IA 3U3GA 3ZSWA 4RW7A 3TI0A 2DY4A 4E7LA 3ZSZA 4DFKA 3RWUA 1HJRA 5FROA 1JLAA 3NH2A 4K8ZA 2BANA 4CERA 3AA3A 1SL0A 1RDDA 4TSXA 4B9VA 1VSLA 4CJPA 1EKEA 2OPRA 1RDAA 2G8UA 3HJFA 4DS4A 1TGOA 4EZ9A 1J5OA 3OYMA 1SL1A 1KLNA 1TV6A 3AVLA 3DLRA 3PUFA 4YNQA 2XO7A 3TARA 3AA5X 5KTQA 4IDKA 4RW6A 3QEVA 4KB0A 1G15A 3AVAA 2ETJA 1VRUA 1RILA 3DMJA 4FLZA 1DTQA 4B08A 2HHVA 1JXEA 2E6MA 4JLHA 4LH4A 4CGFA 3IS9A 3KJVA 4DMNA 3LPUA 2A1RA 2OZMA 1TKTA 4KFBA 4E7IA 1UOCA 3VQ9A 1JKHA 1LV5A 3AVGA 3DOKA 1FK9A 4KAZA 2HB5A 3VQAA 1D9DA 2G8KA 3K59A 4DLEA 2XY7A 1TKZA 4XIUA 1TKDA 4DTPA 4Z4FA 4E19A 3VA0A 2HHUA 1NK7A 4M3RA 1TK0A 1ITGA 3KLGA 4Z4CA 2IC3A 4DSFA 2BGGA 3OYIA 4DTMA 5HLFA 4KKOA 1VK0A 3LAMA 3SI6A 4O0IA 3SCXA 4CJUA 1RDBA 4B3OA 1KVBA 3HT3A 2YKMA 4HTUA 3M8SA 3K5NA 4FM0A 1GOCA 2GUIA 3K5MA 4UQGA 4JRQA 2A1SA 3HXMA 3QNNA 5I3UA 1C0MA 3WNHA 4R5PA 4N5SA 1WSEA 1CXUA 2DFHA 1ZBFA 1LW0A 1NKBA 5HRPA 5HRSA 4QOZB 2HHSA 2KZZA 3CFOA 1TL3A 1RT3A 1WSIA 4DLGA 3SQ2A 4CJ4A 1N5YA 2VG6A 3MEDA 2R7YA 3CG7A 3AA2A 3TR8A 1KCFA 2LSNA 3KKSA 4QAGA 4CEDA 4CK1A 3NGYA 4FJNA 1RNHA 3AVCA 3MECA 3VQQA 4J2DA 3T1AA 4PWDA 1HRHA 4E89A 4KI6A 4CIGA 3F73A 1GOAA 2IOCA 3S3OA 4CECA 3L8BA 4ELUA 1Q8IA 3DM2A 3JSMA 2HVHA 3ZSOA 3OYJA 2OA8A 1JLFA 4CCHA 4H4MA 3OYKA 1B92A 2JGUA 3PO5A 3VQ4A 4Z4GA 1Z26A 4BE1A 1BIZA 1CXQA 3C94A 3QIOA 4IBNA 4MFBA 5T7BA 3C6UA 3RMCA 3L2UA 1SKWA 4HCCA 2P1JA 2G8HA 4I7FA 3SZ2A 3V1OA 1EETA 3ZSXA 4CK3A 3QEPA 1QSLA 5C25A 4KO0A 3OYEA 4FLTA 3AVMA 4F2RA 4FJGA 4DTXA 4ELTA 4PUOA 4RW8A 2RN2A 3V9SA 4CEAA 3QNOA 3L2RA 3QESA 4FJ7A 3VQ7A 1KRPA 4DTOA 4GMJB 3TAFA 3M8PA 2XRIA 1HPZA 1RBSA 3MEEA 4HUFA 1BQMA 1IKWA 5JS2A 3TAPA 2PY5A 4KHQA 3AVHA 3ISNC 3NF6A 5KRSA 5HP1A 1B9FA 3E01A 3OY9A 5CZ2A 4FZZA 4CJFA 2O4GA 4FW2A 3SQ0A 3KD1E 3AVKA 4BDYA 3OS1A 1TAQA 4CF1A 1IO2A 2X78A 2KTQA 4YFUA 4FK4A 1KVCA 5J1EA 1JLGA 4FJMA 3V81A 3LAKA 4DQIA 2FC0A 2Z1JA 3ZSVA 4LSNA 1EX4A 3THVA 5CY4A 4B8AB 1LWEA 1S6QA 4K8XA 3VQPA 4FLXA 2VG7A 3CFRA 1S9EA 3AV9A 4IFYA 1SL2A 3LP2A 4DTNA 3SUQA 5SZTA 2YHAA 3ZSYA 4F3OA 2QXFA 1TKXA 2BE2A 1XWLA 3I8DA 1WAJA 1S1VA 4I9LA 1NK9A 4B9TA 3KKRA 3S3MA 2I5JA 1FKOA 1RT2A 2Z1HA 3RMAA 3KD5E 4N47A 1RT4A 4FZYA 3DLBA 3AA4A 3EY1A 3ZT3A 3VQ6A 2YV0X 1C1BA 4HHTA 4J2EA 3LWLA 4CEZA 4DTJA 4FJ8A 3K5LA 3ZT4A 4CGHA 3OJSA 4B9NA 4FK2A 2RF2A 1WSHA 2PYLA 1YTUA 4CFAA 4E7HA 2FBYA 3VQEA 4CGDA 4FVMA 1IKYA 3DRPA 4JRPA 3H08A
chains in the Genus database with same CATH superfamily
1S3XA 1VQ5N 4C23A 4HTLA 2PBDA 3K57A 1Q81O 4FJIA 3PSFA 3NH0A 3WXLA 4KB1A 2YHWA 4JEPA 1W97L 1D5AA 3SUPA 4B1ZA 4KHWA 1NOZA 3N4PA 1E4GT 2YHBA 1BISA 5AQXA 4FOIA 3IG1A 1NK8A 5CE3A 4H5RA 3DLHA 3NHGA 3PY8A 3MXMA 1CZAN 5EY4A 3KTQA 4M3XA 2FBXA 4AHUA 4JKGB 4ILJA 2HHQA 2UXDK 3JXUA 2QI2A 3VEVA 4M3TA 1RBUA 5JS1A 1U2VB 4I9QA 1T44A 1J54A 1QQOA 3NVMA 4G1QA 4IDHA 4FK0A 4OKKA 3CJ9A 3MWPA 3ZX3A 1WSFA 3QBXA 3MX2A 4AM6A 2YJFA 4CJSA 2V7YA 3H1QA 4H8KA 3LALA 5FPNA 3QEWA 4F2SA 3A5OC 3D2FA 4CJRA 2Z1IA 1E3MA 2HHXA 4OPJA 3PIPL 4H0TB 3NF7A 3OA9A 4DV2K 2Q0RA 3GBTA 1ASVA 3ZX2A 4CJQA 5BR8K 1QSYA 3SJJA 2E1ZA 1ZBSA 1Q9XA 3FZMA 3CYMA 3FZLA 3N4QA 3EL2A 1HQUA 3IMXA 2P9UB 5E26A 3RRGA 4AHVA 4CHPA 2FBVA 3WXMB 4BGAA 1Z05A 4HUGA 4BC2A 1ZBHA 1SQKA 4CEBA 1KFSA 2ITMA 3WNFA 4BWJA 5KPZA 2E20A 3I55N 3AVIA 4WQ4A 4K41A 4O8UA 4GV6A 4CGGA 4WFNL 1U48A 2O8EB 1W2BM 1I3AA 4DSEA 2HHTA 4CHYA 2NUBA 3BDPA 3EZWA 5AQPA 3AGKA 3VEYA 1RTDA 4W5OA 2WOMA 1A5VA 4H5VA 3V9WA 1IKVA 3MX5A 5KPRA 5AQWA 3AO3A 4AHSA 1T3VA 1TUYA 3A2FA 3OBWA 3CFPA 3BF1A 4N56A 1RT7A 3AVBA 1S22A 2P9NA 4BRGA 2GBZA 4ILGB 3DXMA 3TAEA 1SKRA 3OJUA 3C65A 3GG4A 4DFJA 1U49A 3O4NA 4FWMA 1NJZA 3V6DA 4BRAA 2ZJQL 4JI7K 3R9PA 1HNXK 1NJYA 4MDAA 1R0AA 4FWPA 1RBVA 1RDCA 4PKGA 2OPQA 3DAWA 1X9WA 2JWKA 4BROA 4B1WB 4DV5K 5MLCQ 4DR5K 3THWB 3HPGA 4JHDB 4OKEA 1XHZA 4NO7A 4CZMA 4AHTA 4BE0A 1ESVA 4JKEA 4IEIA 3E1YA 2BDPA 3HVTA 2D0BA 3CETA 1KAZA 3NF9A 3I33A 1VQ6N 2X74A 4CJ7A 3HK2A 4DTRA 1QQCA 3GL1A 4OLAA 3JYTA 1VSKA 2GWJA 3JS6A 3L4IA 1UA0A 1OKJA 1HLUA 1VQON 1J6ZA 3CQXA 4O4GA 4YHHK 4IJAA 1U2VA 3VPZA 4B3TK 2F9TA 1X3MA 1EP4A 5GIOA 2D0PA 4OKJA 4LY7A 1T8EA 4FXDA 3P83D 4CF8A 4ISEA 3AO2A 5AQYA 3LANA 3ZSRA 4BR7A 1FW6A 3T7ZA 4G9ZA 4CVNE 3TWHA 4FWOA 4CJTA 1QSSA 4X66K 3TSPA 4PA1A 3MCAB 1N34K 2A40A 2ZD1A 3AO4A 3IRXA 2AP1A 1EO1A 5LL6Z 1O1WA 3DLGA 3OYBA 3TANA 4YDUC 3OYHA 1L3UA 4HCBA 1VSMA 4CZGA 2BUPA 3J7YP 4C8MA 3G25A 3RVCA 4Y1CA 3F9MA 5GADP 1C0GA 3EZ5A 4DTSA 1S1TA 2D0CA 3NDKA 1NKEA 5BN8A 4E1NA 1T7PA 1W9HA 4IG0A 3CJ1A 3HM8A 2GV9A 4N76A 3VQBA 3CXCM 5GINA 3LDLA 4CZHA 4A57A 2V51B 1C1AA 3SV4A 4YOYA 3K9JA 4NYNA 2O8EA 2P9IB 4XH4A 2F9WA 2QM1A 4L8RB 5AZJB 3VQ8A 4YY3K 3C6TA 4IFVA 1Z25A 2IAJA 3QINA 3DWLA 2GTDA 2E2NA 1RT6A 3I0RA 4YOWA 2HSTA 3H3OB 2OYQA 4H0XB 3PIOL 1JJ2M 3DYAA 1BWFO 1BCMA 1JLQA 1TK5A 1IH7A 1HYVA 4CHQA 4C8LA 2Z1GA 4N41A 5GAHP 3U3GA 1BUPA 3GOIA 4FPBA 4U67L 3TI0A 4E7LA 1NU0A 4M7YA 5LJVA 4BG9A 4K8ZA 4F9OA 3AA3A 2RHKA 3G71N 4TSXA 1N33K 1EQYA 5CR4A 1VHXA 2OPRA 1RDAA 4DS4A 1S72N 2QA4N 1SL1A 3PUFA 2V52B 1DEJA 4KB0A 5TKWA 1G15A 3THWA 5I9EB 2ETJA 4JI0K 4FWLA 1RILA 3DMJA 3VF4A 2E6MA 3KJVA 4E7IA 2DPNA 5AQUA 3DOKA 4KAZA 2YJEA 1D9DA 3CC2N 2P9LB 3FZHA 4DLEA 3ZETB 1IBKK 2P9PB 4PKHA 4Z4CA 2IC3A 4R79A 4KKOA 1VK0A 3MN7A 3SCXA 2HBMA 1RDBA 3HT3A 3J7ZO 3SBTA 4ISGA 1HUXA 5I3UA 3WNHA 1FJGK 4R5PA 1WSEA 1CXUA 4QOZB 2CGJA 1TL3A 1RT3A 4DLGA 3E66A 5FPDA 1M90O 3MEDA 2LSNA 4QAGA 1RNHA 3AVCA 3VQQA 4PWDA 4KI6A 1DGKN 4CIGA 1K73O 5AQVA 3S3OA 1V4SA 2W40A 3JSMA 2HVHA 3ZSOA 1NMNA 4CCHA 4LFBK 1CXQA 4IBNA 4HCCA 3C6UA 3L2UA 1VQLN 1ZXOA 5M1NA 4DV3K 2W6LA 4CK3A 3QEPA 5C25A 1NGAA 4KO0A 4FLTA 3AVMA 4RW8A 4JK9A 3QESA 2OTLN 3MEEA 4KHQA 3A8YA 3AVHA 5HP1A 5F0XA 3OY9A 5CZ2A 2GEMA 4FZZA 4WQ4C 4CF1A 1IO2A 3ID8A 4FL9A 4YFUA 2CGLA 3O80A 2FF6A 5AQGA 3ZSVA 5ADXH 3OTOK 4DV7K 4YOTA 4FLXA 2KFNA 3AV9A 1SL2A 1YUWA 3SUQA 4F3OA 1XWLA 1S1VA 3KKRA 4CBXA 3KD5E 4N47A 4FZYA 1VQ8N 3DLBA 5AZJA 1T6CA 4DTJA 3ENOA 4FJ8A 3MWTA 4CGHA 1Q7YO 4CZEA 2PYLA 3CD6N 1YTUA 1NGIA 3VQEA 3H08A 1ZBLA 3VGMA 4KPYA 1YHQN 4CFBA 3PX0A 4C8NA 1ASUA 3LP1A 4JNEA 1TUUA 3MCPA 1V4TA 1BQNA 2YX6A 1LCUA 4JKCA 4LF8K 3SBGA 4W5TA 3CQ8A 2E8AA 4JS5A 2QKBA 4DUZK 1VQ9N 1DT9A 2BTFA 4M45A 3SPZA 3QIPA 4FLWA 4QS8A 3DRRA 2E5LK 1GLAG 2P9KB 1QE1A 3QFUA 4MO4A 4Z4EA 1KTQA 4JKBA 1B9DA 3U6FA 3QLHA 5K14A 4DR7K 3O9UA 5ELZA 4CFCA 3HPOA 2Q97A 4NXMK 3ALYA 2P5GA 4CW7B 2E2PA 1LAVA 4NLBA 3VGLA 2QEXN 3S41A 4DHYA 3DI6A 4FWRA 1NGDA 4KHSA 4M3YA 4Q5VA 1D8YA 1DTTA 3WXIA 4CJVA 2VGMA 2P9LA 2YHXA 3ZETA 4H0VB 4CZJA 2NNWA 2P9PA 5E41A 5J2PA 3D6RA 4FWSA 4YOVA 3HSTB 4O55A 2ATQA 3VF6A 3V9XA 4CEEA 1HNVA 3DRSA 3MXIA 4BRNA 2B5JA 3K0SA 5AFUA 4O8KA 4ID5A 1RT5A 1L3SA 2QKKA 1FKPA 2HHWA 4DG1A 3L3UA 3LWMA 5HROA 4YDUA 3D2EB 4IOXA 3QEIA 1HMVA 4CZLA 3U3YA 1HQEA 1S5JA 4ZTFA 1D9FA 4H03B 1H1VA 4BR5A 4M3WA 4CEOA 1NGGA 3HBTA 4JK7A 3KIOA 1SAZA 3R8EA 4E0DA 1XMQK 4KH6A 4LF5K 4RCHA 4LSLA 1NGJA 4FSVA 3V1QA 4DF8A 3QICA 3VQ5A 2HHHK 3OYLA 5FLXO 3KK7A 3LDOA 3HP6A 5IT9O 5JMVA 3HSCA 1HPMA 3MEGA 2WBNA 4CJEA 4KTZA 4B3MK 4CZFA 1TAUA 1WSJA 2RE2A 4FPAA 1HNZK 2JWLA 4W5RA 1TL1A 1T05A 3DXMB 2D5RA 3QMLA 4GW6A 3VEWA 2HF3A 2QXLA 2B6AA 1VSJA 2GX9A 1QQNA 3WNEA 2ZJPL 1YITN 4BY9C 4A62A 1K9MO 3OYGA 1NJXA 2ZWHA 4RW4A 4HUEA 3CJCA 1VSIA 4NCBA 5D3GA 3ZT1A 2QWNA 4OJRA 3V9UA 1D4XA 3LZIA 1X1PA 4CJWA 2G8FA 5TKYA 2B4JA 1YJNN 1YXQA 2OPSA 1WBDA 3IFRA 2A42A 4LF4K 2KFZA 4AILC 2O4IA 3KLEA 3EYZA 5JLHA 1XQSC 4DQPA 3LP3A 4KBOA 4MO5A 1NK4A 3O3FA 5B8HA 3I0SA 1U47A 3M5RA 3OS2A 1TVRA 4KTWA 1NK5A 1K8KB 1L3VA 5M1KA 1GLLO 5AQMA 3L2QA 2XY5A 2NZTA 3MN6A 5BRDA 4MQ3A 1ATRA 1O13A 2P9KA 4FM1A 5FRNA 1WLJA 2WTUA 4BDPA 1NMDA 2EX3A 4DWIA 1NGBA 2Q3SA 3HM9A 4RW9A 3ZSQA 4PHTX 3CMEN 2HMIA 3OVNA 4A61A 1VQMN 2VGNA 4FJXA 4X65K 4E7JA 5BPLA 4DV1K 1JL2A 2ZM6K 3NH1A 4K0KK 1Y97A 2AA4A 1NGFA 2G8WA 2QWPA 4CHOA 1U04A 2QW9A 4AHRA 1KFDA 3O9TA 4FJ9A 4BR2A 4FJJA 4JI3K 5J2MA 3KK2A 5EOYA 3WXJA 1Z6RA 2JLEA 4DSIA 5C15A 3O3HA 1JLBA 3ID6A 1L5UA 1VSDA 1NK0A 5AQLA 1LAWA 4CJ3A 4NCAA 4GVMA 4JK8A 3KK1A 4OGEA 4GY2B 1CZ9A 5E84A 2F8SA 1UWBA 3AY9A 5KQDA 5AQTA 3G0ZA 1ZBIA 3D2EA 2F7TA 3KHYA 2OZSA 4FM2A 2A6AA 3T1YK 1SV5A 5DMRA 1NOYA 3RMDA 1RTJA 1BCOA 4IO8A 4CJKA 5AQHA 3VF2A 3G10A 4DU3A 3NFAA 1Q86O 1ATNA 3BGRA 4H5NA 5AQFA 3VN5A 2QWQA 2IDOA 2D1KA 3F5TA 3DLKA 1F21A 3L2VA 1GLJO 4Y1DA 2XY8A 2DFFA 3TTCA 3K2PA 4LC9B 3OS0A 3F9KA 4JAXA 3EE9A 4I6MA 2NLXA 3T3FA 2A3ZA 3QETA 3O5BA 3SAHA 3AAQA 5C2FA 4NXNK 4XH1A 3WQUA 4J2BA 3CHWA 1KSPA 2NRTA 2QWLA 1QTMA 3U8XA 1REVA 1IBMK 2YI1A 1W0HA 1S1WA 4UY8O 1X9MA 4NCGA 1NGHA 3SMSA 3HO1A 3UE5A 4DR2K 1X9SA 3M1FA 2HMPA 5JLFA 1N6QA 2Y1IA 3ZSWA 1VQ7N 2O8CB 4FVUA 2DY4A 4B9QA 4BRLA 3RWUA 5FROA 4B3SK 3O9SA 4B9VA 4GV9A 1EWQA 4JKAA 1BA1A 3HJFA 5BPMA 4CBUA 3C7NB 3C6AA 1TV6A 3BZCA 1NG9A 3TARA 1XNQK 1YIJN 5KTQA 1LOTB 4FO0A 5AR0A 1IJJA 1DTQA 4QS9A 4JLHA 1K8KA 4LH4A 4CGFA 3HOTA 3LPUA 1TKTA 4KFBA 1UOCA 3AVGA 1YAGA 3VQAA 3K59A 4H0YB 2XY7A 4Z4FA 3KZBA 1QVFM 4M3RA 4DTMA 1OH6A 4CJUA 1KVBA 3P39A 3M8SA 3K5NA 4FM0A 1GOCA 4UQGA 4BVPA 2DFHA 3TSUA 3KWIA 5HRSA 2HHSA 2KZZA 1XC3A 1WSIA 2D4WA 4CJ4A 4NLCA 4A59A 1OVQA 3AA2A 4CEDA 3NGYA 1HRHA 4ELUA 1Q8IA 3DM2A 3QBWA 3OYJA 4H4MA 4WQ5A 4BE1A 5T7BA 2P1JA 3VTHA 4YOUA 2G8HA 1HX1A 2PAVA 4I7FA 2UXBK 3V1OA 1QSLA 3OYEA 3T1HK 4F2RA 4DTXA 4CEAA 3BY5A 4DTOA 4GMJB 2PY5A 1IKWA 3NF6A 3P38A 3PLAA 3SQ0A 1VQNN 3AVKA 4IWVA 4BDYA 1TAQA 3L0QA 5AQKA 3K9KA 2UUBK 5J1EA 2IVNA 3U9DA 2Z1JA 1HKBA 1EX4A 3THVA 5CY4A 1LWEA 2VG7A 4DTNA 2YHAA 3EKSA 2QXFA 3I8DA 1NK9A 4JV5K 4DB3A 4I9LA 1GLBG 1FKOA 4EAHD 2Z1HA 4GV3A 3EY1A 4HHTA 4J2EA 4FWQA 3CPEA 3HZ6A 1YF5L 2RF2A 1GLCG 4CFAA 2FBYA 3DRPA 4JRPA 3ATVA 2I7NA 3IKMA 2HW3A 3T69A 3CCVN 4DR6K 4OGCA 4K43A 4DF4A 4KI4A 3CPWM 4OPKA 2KHOA 3VETA 4B9SA 3QDKA 1SS6A 4DR4K 1EXQA 2O8CA 4PQUA 4Z0UA 4DS5A 5KRTA 1BHLA 3AVNA 4KH4A 1J53A 1M1KO 4CZIA 4QS7A 2ASPA 2UU9K 2E2OA 4F3TA 1C0UA 4IG3A 3C7NA 3VESA 4DKWA 2Q36A 4BRCA 2YNHA 3U9ZA 3JAMO 2Q0UA 4BC4A 3RMBA 2WONA 3OHRA 1RBTA 3QO9A 4CF0A 3CJBA 4BQLA 1YVNA 1BA0A 4E3SA 5LMUK 5ADXA 1VQPN 4FLYA 4W5QA 1GOBA 4IXCA 3CM6A 5C2DA 2RKIA 4LH5A 4B9UA 3ZEUB 3PO4A 4AH9A 2NRWA 1BIUA 2FBTA 3DLEA 3M8QA 1NM1A 2HNYA 1DLOA 2Y1JA 2YNIA 3OYAA 3HTVA 4LD0A 1KD1O 1NJWA 1S6PA 1QZ6A 2NRVA 5AQZA 4ZTJA 2ZE2A 1UA1A 2O8DB 3THYB 1HNIA 3W0LA 3RRHA 2E1YA 1SKSA 3ULEB 4I2QA 1VSFA 1IV0A 3CCJN 3BEXA 4C8KA 2O8FA 1RCHA 4B1UB 4DFPA 1C6VA 1NGEA 4DFMA 1RBRA 4WCEL 3O8MA 2QWRA 3SMPA 5HRNA 2ZJRL 3NBPA 4OLBA 2P9SB 1RT1A 4NB4A 4JS4A 2NRXA 2XY6A 4NYFA 3MAQA 4O5FA 5DM7L 4H0PA 3ITHA 4FCYA 4CESA 3AVFA 4DSLA 3DOLA 1U45A 3SJHA 4B8CA 3B8AX 2IS3A 3FZKA 3O6WA 1HYSA 4J8FA 4C1NK 5EXWA 2VWKA 3NGIA 3HL8A 5KGWA 4JN4A 4CE9A 4JI1K 3O9RA 1IG9A 1CLQA 5HBMA 1WBBA 3FGUA 1C0TA 4IFEA 3J7AP 1S1XA 4OPAA 4DSJA 3RTVA 4GNIA 4FJKA 4DQ8A 3EEQA 3LP0A 4EFHA 2G8VA 3DXKB 3OYCA 2KW4A 1LWCA 3FFKB 5M1QA 4QCLA 2FSJA 2QWOA 3VEOA 1I39A 3UKUB 1BL3A 5EX5A 1FXXA 3B6PA 2NRHA 2W6KA 1BU6O 1L3TA 5FRMA 3RR7A 4CJ5A 2FSKA 4LF6K 1MDUB 1CZBA 3EN9A 1WOQA 3AO1A 4LFAK 5AQQA 2G8IA 4MDBA 4CGIA 4JKHA 4O44A 1XHXA 3VQCA 4XH5A 2HBLA 3VA3A 3TAGA 4WYBA 3H45C 1XC9A 5SWMA 1A5WA 3PX4A 2YKNA 3C95A 2RPIA 3WNGA 3SLCA 3IUCA 3ULDA 4F4KA 5AQOA 1BGXT 1YT3A 1MWKA 2QK9A 5KI6A 1YJWN 2WUSA 4CK2A 1W7AA 2EWSA 2IGIA 4I2PA 3FFIA 3W3DA 2EHGA 5AZIB 3VOVA 1NKCA 3VQDA 5BPNA 1U4BA 5C24A 3O4QA 5BRHA 4AQYK 1P90A 4RG8A 1S9GA 3ZT0A 1S1UA 1Y64A 3ZEUA 3MN9A 4PL7A 4BE2A 2VG5A 2HNZA 2KZMA 1Q82O 3OBYA 3VEZA 3KLIA 1WSGA 4OVLA 4H0OA 4EP4A 1Q18A 4W5NA 2Q1NA 4JI5K 1N32K 5CZ1A 3RSEB 5J2QA 1TK8A 4WQ5C 4DU4A 3R6MA 3AVJA 4M3UA 2FXUA 3AARA 2O8DA 3GDQA 3THYA 4ID1A 4WF9L 3IAYA 4JI2K 4BR0A 4WFBL 3ULEA 3WEEB 2PZSA 1HKCA 2BH1A 4BG8A 1E4FT 4Z4IA 3CQYA 4BC3A 4I6MB 1WNSA 3L4QA 4DUYK 2FSNA 2ASOA 5CHIA 3D0PA 1RDUA 3LL3A 4CFDA 4KREA 4BR4A 3MXJA 2OTJN 1N36K 3NCIA 1JCEA 3AO5A 2P9SA 3Q7BA 1IKXA 4BQZA 3CCRN 4ZHRA 3B6OA 1QQMA 4BRHA 2QWMA 3WT0A 5C12A 3NVKA 3O4WA 3HVRA 1VSEA 3ENBA 3L2WA 3EE8A 3HPHA 3HOSA 2E2QA 2VQEK 4M3ZA 4CF9A 4CD1A 1QZ5A 1HYZA 3QEXA 1YI2N 4DQSA 3CM5A 3FZFA 3FE1A 1LWFA 3T19A 3UIQA 4J2AA 3H6EA 5F2RA 2PFUA 2Q2RA 4DFKA 1HJRA 3NMUA 3DXKA 1T6DA 3MN5A 1RDDA 2H3GX 5LY3A 4X64K 3UKUA 2QTDA 1EKEA 5C0YA 4IEEA 5FPMA 4EZ9A 1J5OA 4M7XA 3OYMA 1KLNA 3AVLA 4IZ9A 4YNQA 3G6EN 1VQ4N 1K8AO 1VRUA 3BP8A 3THXA 4FLZA 4MLHA 4B08A 2HHVA 3IDHA 4LF9K 1XUPO 3IS9A 2O8BB 2OZMA 1LV5A 1FK9A 3C6HA 2HB5A 2G8KA 1TKZA 2WFBA 4XIUA 4B3RK 4DTPA 4HWIA 3VA0A 1TK0A 3KLGA 3ENHA 4DSFA 1BDGA 1BOTO 3LAMA 3SI6A 3TPQA 3CMAN 2YKMA 3LDNA 2YHYA 2GUIA 3K5MA 2A1SA 1C0MA 1KC8O 4V19S 5AZIA 3OW2M 3I8BA 3J81O 5IWAK 2R7YA 3CG7A 3HI0A 1KCFA 4FWKA 3MECA 2GWKA 4J2DA 3CCEN 1BG3A 3BUZB 4E89A 3WXKA 1X9JA 3F73A 3WUHA 4CECA 3KWGA 2YCHA 2UXCK 5GAEP 1JLFA 3OYKA 1B92A 2JGUA 5AQSA 3PO5A 4LF7K 5H1SQ 1BIZA 3QIOA 4MFBA 1GLFO 3CCUN 5A2QO 3SZ2A 3ZSXA 2VWBA 4BRKA 5BN9A 4FJGA 3E9OA 2CH5A 3RSEA 4ELTA 3V9SA 2RN2A 3L2RA 1BO5O 5KQ8A 1KRPA 3TAFA 1JCGA 2HOEA 4EHTA 1RBSA 4CZKA 5GAGP 3E01A 3WEEA 4CJFA 2O4GA 4FW2A 2J4RA 4DV0K 2KTQA 3HRGA 4FK4A 2FF3B 4FJMA 3AGRA 4IJNA 2HBKA 3CI5A 4B8AB 1S6QA 5AQNA 4K42A 3CFRA 1S9EA 3FLCO 3E9PA 4JKFA 3ZSYA 5SZTA 4BREA 2BE2A 1WAJA 4IO9L 3H46O 2D0OA 1RT4A 3AA4A 1TYQA 3ZT3A 3VQ6A 2YV0X 1C1BA 2UUCK 3LWLA 4CEZA 4GVEA 3K5LA 3CIPA 4K25A 4BRIA 5BREA 4E7HA 4CGDA 4FVMA 4AM7A 3P1GA 1HJOA 1XNRK 4Z4HA 4CGJA 4FJ5A 4GKKK 1JL1A 1J5EK 3MK6A 3SUNA 3QERA 1ATSA 2KKZA 1QS4A 3LM2A 3V1RA 5J2NA 3VEXA 3TAMA 2FLOA 5FPEA 1XI1A 3PV8A 3ZCMA 2HNDA 3O08A 1R59O 3CC4N 1NK6A 3RR8A 3LZJA 1NLVA 5CYMA 4BR9A 2E6LA 1J9AA 4DQQA 4OPHA 3SV3A 5KGXA 4M63C 3KVGA 4KRFA 3R1XA 4CHZA 1U6ZA 4CHNA 4JKGA 4IOCL 1ILYA 1EWRA 2O8BA 1X3NA 3CERA 4AHCA 2ZGZA 3I56N 3UKRB 3ZYYX 4BGBA 4ICLA 3TAQA 5F1XA 3K5OA 5BR9A 4FLUA 2P51A 4O0JA 4EIAA 2KQ2A 2HBJA 1YVUA 4B1VA 4PKIA 1WUAA 3DJCA 4EHUA 3TABA 2A5XA 4RWTA 1BI4B 3DLLL 1QHAA 3CF5L 3L3VA 1NBWA 4O5BA 2O8FB 5HRRA 3S3NA 2PYJA 4F8RA 2VYPA 3G4SN 2F96A 5FDLA 4KH5A 1LW2A 4Y0WA 1IG8A 4CIEA 1QHTA 3MDQA 5C10A 1OH8A 3SPYA 3MMVA 1KXPA 4WE1A 4BRPA 4EZ6A 3NE6A 3A5NC 4DR1K 2X6NA 3SNNA 1JXBA 4BRFA 3A5MC 4BC5A 1RTHA 4FW1A 4DQRA 2AJQA 2P9UA 3HYFA 4FWNA 2YNFA 4FYDA 3UB5A 4H5TA 1P8ZA 4CI6A 4YOXA 1DKGD 1WB9A 2F8TA 2CGKA 1KVAA 2DFEA 4M42A 5BRFA 1MA9B 4L3QA 1RFQA 1MU2A 4Z94A 3NGZA 3KK3A 2W41A 4KHUA 3FR0A 2ZF5O 3OYDA 3NF8A 4C8OA 3P5JA 2V7ZA 5GIPA 5AQRA 4BDZA 4JI8K 3LDSA 4PL8A 4KV8A 1WAFA 3OYNA 1SUQA 5EU7A 1IBLK 4KTQA 2HVIA 3KLHA 1Q9YA 4JD2B 3V4IA 3SQ1A 1RTIA 2OPPA 3TTDA 3QNNA 4JYAK 3ZT2A 2W42A 2D0AA 1WN7A 1UAXA 1JLEA 2ASMA 4KHPK 3O1WA 5AQJA 3CJAA 1YTAA 1A5XA 2ITGA 1KAYA 3CCQN 4KHNA 1G99A 2IIRA 4BRDA 3H1VX 3LM9A 3HP9A 1KLMA 2OCEA 3VENA 4DU1A 2VCPA 3CCLN 3NAEA 4Q0BA 2E4LA 4CIFA 3SUOA 4CD3A 2YNGA 5I42A 4H4OA 3M6GA 1RGIA 4JHDA 4OO1J 2GELA 4ELVA 4H5WA 5JVGL 1C1CA 4KHYA 4LFCK 2NRRA 2P5OA 1VSHA 4M41A 3L6QA 3BZKA 1SZ2A 4HVJA 4DV6K 4IOAL 3UKRA 4OX9K 4FJLA 1GLEG 3S9HA 4JKDA 2UUAK 3V9ZA 1I94K 3PX6A 1YJ9N 1JLCA 4CJLA 3SK3A 1HKGA 3LDPA 5EVZA 3SYZA 4JI4K 4DTUA 3PSIA 4CEFA 2XHBA 4BACA 4PY5A 1BI4A 4B9MA 5LJWA 1KAXA 4DCHA 2NRZA 4B1XB 5M1OA 4CF2A 3EO3A 3E9LA 4ISFA 4A5BA 3ATUA 1C0FA 5DM6L 4E1MA 4E7KA 4FJHA 3A0IX 4FZXC 1KQSM 1K6YA 4CBWA 3D7EO 3SAFA 3AAPA 3GE1A 3OYFA 5HL7L 3O9QA 1T03A 1VRTA 3D45A 4EP5A 5JVHL 1NGCA 3Q7CA 3ASMA 4BWMA 2GUPA 5AJ3K 3M3ZA 4FLVA 3QFPA 4FOEA 3SQ4A 1ZC6A 4AF1A 1ZYQA 3ZLJA 5LMNK 3CCSN 4A2BA 5M1PA 3O3GA 4RTFD 4BRQA 1NNEA 4DSKA 4JI6K 2F4VK 3VTIA 2VWJA 4CEQA 3LPTA 4WFAL 1VQKN 1ASWA 3CCMN 1OH5A 4IKFA 5CYQA 5DK5A 5C42A 1OH7A 2X6SA 2E88A 2P9IA 1HNWK 1XMOK 3WQTA 3M8RA 3VGKA 3KLFA 1ZBUA 4YORA 2DTUA 3J80O 3BF3A 2ZQBA 3K58A 4B9LA 3P4IA 2VQFK 4RW7A 3ZSZA 1MWMA 4A5AA 4JD2A 1JLAA 3VMFB 3NH2A 2BANA 3H3NO 4CERA 3R3LA 1SL0A 3CC7N 2WC9A 3THXB 1VSLA 1JCFA 4CJPA 2UYTA 1HR0K 2G8UA 1N8RO 1TGOA 1GLDG 5HOOA 2XO7A 3DLRA 3AA5X 5AQIA 4IDKA 4RW6A 3QEVA 4GKJK 1RDWX 3U4LA 2ZGYA 3AVAA 1JXEA 2KLAA 4DMNA 2A1RA 4X62K 2I7PA 3VQ9A 1JKHA 4C1NI 1NWKA 1TKDA 4E19A 1NK7A 1ITGA 2BGGA 3CJ7A 3OYIA 5HLFA 2A41A 4O0IA 3D2FB 4B3OA 3J8AA 3TSQA 4HTUA 4JRQA 3O1BA 3HXMA 3TU5A 2IVPA 4N5SA 1ZBFA 1LW0A 1NKBA 5HRPA 3CFOA 5JICA 3SQ2A 1N5YA 2VG6A 4XEIA 3TR8A 4CK1A 3KKSA 3P31A 4FJNA 2IVOA 3T1AA 1GOAA 4BRMA 2IOCA 3L8BA 1NJIO 2OA8A 3ZX0A 3VQ4A 4Z4GA 1Z26A 3C94A 1SKWA 3RMCA 2HF4A 3A5LC 3VERA 1EETA 4A2AA 3SAGA 3LDQA 3TTFA 1OVYA 2Q31A 4PUOA 4DR3K 3QNOA 4FJ7A 3VQ7A 1QVGM 4ILHA 3M8PA 2XRIA 1HPZA 4HUFA 3TAPA 2HHUA 1BQMA 5JS2A 3ISNC 5KRSA 2OANA 1B9FA 4U7BA 3EKUA 3C0BA 3F2KA 3KD1E 2CH6A 3OS1A 2X78A 4DV4K 1KVCA 1JLGA 3V81A 3LAKA 4BVOA 4DQIA 1TYQB 2FC0A 4LSNA 3QB0A 4K8XA 3VQPA 4IFYA 3LP2A 2P9NB 1TKXA 4E1JA 4MLEA 4B9TA 3S3MA 2I5JA 3RMAA 1RT2A 5M1FA 4B1YB 5AFUH 1VAZA 3ZT4A 5KPTA 4FK2A 3OJSA 4B9NA 1WSHA 1IKYA
chains in the Genus database with same CATH topology
1ZBLA 4KPYA 2HW3A 4CFBA 3PX0A 4C8NA 3P1GA 1ASUA 4Z4HA 3LP1A 4OGCA 4CGJA 3K57A 4FJ5A 1BQNA 1JL1A 4DF4A 4FJIA 4KI4A 2HVIA 3SUNA 3NH0A 4OPKA 4KB1A 3QERA 4W5TA 1D5AA 3SUPA 4B9SA 1QS4A 3V1RA 3CQ8A 4KHWA 4JS5A 1NOZA 1EXQA 5J2NA 2QKBA 4PQUA 2YHBA 1BISA 4Z0UA 3TAMA 4DS5A 3IG1A 1XI1A 5KRTA 3PV8A 4M45A 3SPZA 1NK8A 3QIPA 3ZCMA 4FLWA 1BHLA 3DRRA 2HNDA 3AVNA 1QE1A 3DLHA 4Z4EA 3NHGA 1J53A 1KTQA 3MXMA 3PY8A 3KTQA 1B9DA 4M3XA 2FBXA 4AHUA 1NK6A 3U6FA 3RR8A 3QLHA 3LZJA 2HHQA 5K14A 5CYMA 4F3TA 1C0UA 4IG3A 4CFCA 3HPOA 2E6LA 1J9AA 4DQQA 5I42A 2YNHA 4M3TA 3ALYA 3SV3A 1RBUA 2P5GA 5JS1A 5KGXA 1LAVA 4I9QA 3RMBA 1J54A 2WONA 4KRFA 1RBTA 4CHZA 4CHNA 3QO9A 4G1QA 4CF0A 3DI6A 4AHCA 4FK0A 4OKKA 4KHSA 4E3SA 4M3YA 4Q5VA 1WSFA 1D8YA 1DTTA 4CJVA 4W5QA 4FLYA 4ICLA 1GOBA 3TAQA 3CM6A 4CJSA 2RKIA 3K5OA 4FLUA 5E41A 5J2PA 2P51A 4LH5A 4O0JA 4H8KA 3LALA 4B9UA 3QEWA 4F2SA 3HSTB 4O55A 2ATQA 3PO4A 4AH9A 2KQ2A 3V9XA 4CEEA 1YVUA 4CJRA 1BIUA 1HNVA 2FBTA 2Z1IA 3DLEA 3M8QA 3DRSA 3MXIA 2HHXA 2B5JA 4OPJA 2HNYA 1DLOA 4ID5A 3TABA 1RT5A 2Y1JA 1L3SA 3NF7A 2YNIA 3OYAA 2QKKA 1FKPA 2HHWA 1ASVA 4CJQA 4LD0A 4DG1A 1BI4B 3L3UA 1QSYA 3LWMA 1NJWA 1S6PA 5HROA 3L3VA 4ZTJA 4O5BA 5HRRA 3SJJA 3S3NA 2PYJA 4F8RA 2ZE2A 1UA1A 2F96A 1HMVA 1HNIA 5FDLA 3QEIA 3RRHA 1Q9XA 1LW2A 3U3YA 1HQEA 1S5JA 4ZTFA 1D9FA 1SKSA 3CYMA 4M3WA 4I2QA 4CEOA 1VSFA 4CIEA 1QHTA 1HQUA 3KIOA 3RRGA 4E0DA 4C8KA 4AHVA 4CHPA 3SPYA 1RCHA 2FBVA 4LSLA 4HUGA 4WE1A 4DFPA 1ZBHA 4CEBA 1C6VA 1KFSA 4DFMA 1RBRA 3V1QA 4DF8A 3VQ5A 4EZ6A 3WNFA 4BWJA 5HRNA 3NE6A 2X6NA 3NBPA 3OYLA 3SNNA 3AVIA 1JXBA 4OLBA 1RTHA 4FW1A 1RT1A 4JS4A 3HP6A 4CGGA 4NYFA 4DQRA 3HYFA 3MAQA 2XY6A 2YNFA 2AJQA 1U48A 1I3AA 4DSEA 4FYDA 2HHTA 4CHYA 2NUBA 3MEGA 3BDPA 3ITHA 4FCYA 4CJEA 4KTZA 4CESA 3AVFA 4DSLA 1TAUA 1WSJA 3DOLA 1RTDA 4W5OA 2F8TA 1KVAA 2WOMA 1U45A 1A5VA 4W5RA 1TL1A 1T05A 2DFEA 2D5RA 4B8CA 3V9WA 4M42A 1IKVA 2IS3A 4GW6A 1HYSA 3AO3A 4AHSA 1MU2A 3NGZA 3KK3A 4KHUA 3A2FA 2VWKA 3NGIA 3HL8A 5KGWA 2B6AA 3OYDA 1VSJA 4CE9A 3CFPA 3NF8A 1IG9A 4N56A 3WNEA 4C8OA 1CLQA 1RT7A 3AVBA 3P5JA 5HBMA 1C0TA 2GBZA 4BDZA 3OYGA 1NJXA 1S1XA 4RW4A 4HUEA 3TAEA 3LDSA 4DSJA 1VSIA 3OJUA 1SKRA 4NCBA 4KV8A 1WAFA 3OYNA 1SUQA 5EU7A 3RTVA 4FJKA 4DFJA 1U49A 4KTQA 3LP0A 3O4NA 3ZT1A 3KLHA 1Q9YA 2G8VA 1NJZA 3V4IA 5D3GA 3SQ1A 1RTIA 2OPPA 4OJRA 3OYCA 3LZIA 2KW4A 1LWCA 3V9UA 1X1PA 3ZT2A 4CJWA 3V6DA 2W42A 2D0AA 2G8FA 1WN7A 4QCLA 2B4JA 1UAXA 1NJYA 1JLEA 2OPSA 1I39A 1BL3A 1YTAA 1A5XA 1R0AA 2ITGA 1FXXA 2KFZA 4AILC 3B6PA 3KLEA 3EYZA 4KHNA 2O4IA 1RBVA 1L3TA 3LP3A 1NK4A 1RDCA 4DQPA 3O3FA 5FRMA 2OPQA 3RR7A 4CJ5A 1X9WA 3I0SA 3HP9A 3HPGA 4OKEA 1U47A 3OS2A 1CZBA 1TVRA 3AO1A 4KTWA 1XHZA 4AHTA 4BE0A 1NK5A 1KLMA 1L3VA 2G8IA 4Q0BA 4CGIA 2BDPA 4O44A 1XHXA 3VQCA 4DU1A 3L2QA 2XY5A 3HVTA 2D0BA 4MQ3A 3NAEA 3NF9A 4FM1A 3VA3A 2X74A 3TAGA 5FRNA 1WLJA 2E4LA 4CIFA 3SUOA 3HK2A 4DTRA 1QQCA 1XC9A 5SWMA 4BDPA 4OLAA 1A5WA 2EX3A 2YNGA 4H4OA 2YKNA 3C95A 3PX4A 3JYTA 2Q3SA 2RPIA 1VSKA 3WNGA 3HM9A 4DWIA 1UA0A 4RW9A 3ZSQA 3ULDA 4ELVA 2HMIA 3OVNA 4O4GA 1C1CA 4F4KA 4FJXA 4KHYA 1BGXT 4E7JA 1YT3A 2P5OA 2QK9A 1VSHA 4M41A 5KI6A 1JL2A 4CK2A 2IGIA 3NH1A 4I2PA 1EP4A 3FFIA 1Y97A 2EHGA 2G8WA 4OKJA 4LY7A 4CHOA 1U04A 3P83D 4AHRA 4HVJA 1T8EA 4FXDA 1NKCA 3VQDA 4CF8A 1KFDA 1U4BA 4FJ9A 3AO2A 5C24A 4FJJA 3LANA 3ZSRA 3O4QA 5J2MA 3KK2A 4FJLA 4RG8A 3S9HA 3TWHA 2JLEA 4DSIA 3V9ZA 1S9GA 3PX6A 3ZT0A 3O3HA 1JLBA 1JLCA 1S1UA 4CJLA 1L5UA 1VSDA 1NK0A 4CJTA 1QSSA 1LAWA 4BE2A 2VG5A 2HNZA 4CJ3A 4NCAA 2KZMA 4GVMA 4PA1A 3KLIA 1WSGA 4OVLA 3KK1A 4OGEA 4EP4A 3SYZA 2ZD1A 3AO4A 1CZ9A 4DTUA 3IRXA 2F8SA 4CEFA 1UWBA 2XHBA 4BACA 4W5NA 4PY5A 1BI4A 1O1WA 4B9MA 3DLGA 3OYBA 3TANA 3G0ZA 5CZ1A 5J2QA 1TK8A 1ZBIA 3OYHA 1L3UA 4CF2A 4HCBA 4DU4A 4M3UA 1VSMA 3AVJA 2OZSA 4FM2A 4ID1A 4C8MA 3IAYA 4E1MA 4E7KA 4Y1CA 4FJHA 1SV5A 5DMRA 4FZXC 1NOYA 1K6YA 3EZ5A 4DTSA 1S1TA 3RMDA 2D0CA 2PZSA 1RTJA 1BCOA 3OYFA 4Z4IA 3NDKA 1NKEA 1T03A 4CJKA 1VRTA 3D45A 3G10A 4E1NA 3NFAA 4EP5A 4DU3A 1W9HA 1WNSA 1T7PA 3ASMA 3BGRA 4IG0A 4BWMA 3VN5A 3D0PA 2IDOA 4CFDA 4KREA 4N76A 2GV9A 4FLVA 3DLKA 3MXJA 3VQBA 1F21A 3L2VA 4Y1DA 2XY8A 2DFFA 3NCIA 3AO5A 3SQ4A 3K2PA 1IKXA 1C1AA 4ZHRA 3OS0A 1ZYQA 3F9KA 3SV4A 3B6OA 4NYNA 3T3FA 4L8RB 3O3GA 3VQ8A 3C6TA 4IFVA 3QETA 1Z25A 2IAJA 3HVRA 1VSEA 4DSKA 3QINA 2VWJA 4CEQA 3LPTA 3L2WA 4J2BA 1ASWA 3HPHA 1KSPA 1QTMA 4IKFA 5CYQA 5DK5A 1REVA 1RT6A 3I0RA 5C42A 2KFNA 4M3ZA 2X6SA 4CF9A 1W0HA 2OYQA 3M8RA 1HYZA 1S1WA 3DYAA 3KLFA 3QEXA 1X9MA 4NCGA 1ZBUA 1BCMA 1JLQA 1TK5A 3HO1A 4DQSA 2DTUA 2ZQBA 1IH7A 3CM5A 1HYVA 4CHQA 1X9SA 2Z1GA 3K58A 4C8LA 1LWFA 3T19A 1N6QA 4B9LA 3UIQA 4J2AA 4N41A 2Y1IA 3U3GA 3ZSWA 4RW7A 3TI0A 2DY4A 4E7LA 3ZSZA 4DFKA 3RWUA 1HJRA 5FROA 1JLAA 3NH2A 4K8ZA 2BANA 4CERA 3AA3A 1SL0A 1RDDA 4TSXA 4B9VA 1VSLA 4CJPA 1EKEA 2OPRA 1RDAA 2G8UA 3HJFA 4DS4A 1TGOA 4EZ9A 1J5OA 3OYMA 1SL1A 1KLNA 1TV6A 3AVLA 3DLRA 3PUFA 4YNQA 2XO7A 3TARA 3AA5X 5KTQA 4IDKA 4RW6A 3QEVA 4KB0A 1G15A 3AVAA 2ETJA 1VRUA 1RILA 3DMJA 4FLZA 1DTQA 4B08A 2HHVA 1JXEA 2E6MA 4JLHA 4LH4A 4CGFA 3IS9A 3KJVA 4DMNA 3LPUA 2A1RA 2OZMA 1TKTA 4KFBA 4E7IA 1UOCA 3VQ9A 1JKHA 1LV5A 3AVGA 3DOKA 1FK9A 4KAZA 2HB5A 3VQAA 1D9DA 2G8KA 3K59A 4DLEA 2XY7A 1TKZA 4XIUA 1TKDA 4DTPA 4Z4FA 4E19A 3VA0A 2HHUA 1NK7A 4M3RA 1TK0A 1ITGA 3KLGA 4Z4CA 2IC3A 4DSFA 2BGGA 3OYIA 4DTMA 5HLFA 4KKOA 1VK0A 3LAMA 3SI6A 4O0IA 3SCXA 4CJUA 1RDBA 4B3OA 1KVBA 3HT3A 2YKMA 4HTUA 3M8SA 3K5NA 4FM0A 1GOCA 2GUIA 3K5MA 4UQGA 4JRQA 2A1SA 3HXMA 3QNNA 5I3UA 1C0MA 3WNHA 4R5PA 4N5SA 1WSEA 1CXUA 2DFHA 1ZBFA 1LW0A 1NKBA 5HRPA 5HRSA 4QOZB 2HHSA 2KZZA 3CFOA 1TL3A 1RT3A 1WSIA 4DLGA 3SQ2A 4CJ4A 1N5YA 2VG6A 3MEDA 2R7YA 3CG7A 3AA2A 3TR8A 1KCFA 2LSNA 3KKSA 4QAGA 4CEDA 4CK1A 3NGYA 4FJNA 1RNHA 3AVCA 3MECA 3VQQA 4J2DA 3T1AA 4PWDA 1HRHA 4E89A 4KI6A 4CIGA 3F73A 1GOAA 2IOCA 3S3OA 4CECA 3L8BA 4ELUA 1Q8IA 3DM2A 3JSMA 2HVHA 3ZSOA 3OYJA 2OA8A 1JLFA 4CCHA 4H4MA 3OYKA 1B92A 2JGUA 3PO5A 3VQ4A 4Z4GA 1Z26A 4BE1A 1BIZA 1CXQA 3C94A 3QIOA 4IBNA 4MFBA 5T7BA 3C6UA 3RMCA 3L2UA 1SKWA 4HCCA 2P1JA 2G8HA 4I7FA 3SZ2A 3V1OA 1EETA 3ZSXA 4CK3A 3QEPA 1QSLA 5C25A 4KO0A 3OYEA 4FLTA 3AVMA 4F2RA 4FJGA 4DTXA 4ELTA 4PUOA 4RW8A 2RN2A 3V9SA 4CEAA 3QNOA 3L2RA 3QESA 4FJ7A 3VQ7A 1KRPA 4DTOA 4GMJB 3TAFA 3M8PA 2XRIA 1HPZA 1RBSA 3MEEA 4HUFA 1BQMA 1IKWA 5JS2A 3TAPA 2PY5A 4KHQA 3AVHA 3ISNC 3NF6A 5KRSA 5HP1A 1B9FA 3E01A 3OY9A 5CZ2A 4FZZA 4CJFA 2O4GA 4FW2A 3SQ0A 3KD1E 3AVKA 4BDYA 3OS1A 1TAQA 4CF1A 1IO2A 2X78A 2KTQA 4YFUA 4FK4A 1KVCA 5J1EA 1JLGA 4FJMA 3V81A 3LAKA 4DQIA 2FC0A 2Z1JA 3ZSVA 4LSNA 1EX4A 3THVA 5CY4A 4B8AB 1LWEA 1S6QA 4K8XA 3VQPA 4FLXA 2VG7A 3CFRA 1S9EA 3AV9A 4IFYA 1SL2A 3LP2A 4DTNA 3SUQA 5SZTA 2YHAA 3ZSYA 4F3OA 2QXFA 1TKXA 2BE2A 1XWLA 3I8DA 1WAJA 1S1VA 4I9LA 1NK9A 4B9TA 3KKRA 3S3MA 2I5JA 1FKOA 1RT2A 2Z1HA 3RMAA 3KD5E 4N47A 1RT4A 4FZYA 3DLBA 3AA4A 3EY1A 3ZT3A 3VQ6A 2YV0X 1C1BA 4HHTA 4J2EA 3LWLA 4CEZA 4DTJA 4FJ8A 3K5LA 3ZT4A 4CGHA 3OJSA 4B9NA 4FK2A 2RF2A 1WSHA 2PYLA 1YTUA 4CFAA 4E7HA 2FBYA 3VQEA 4CGDA 4FVMA 1IKYA 3DRPA 4JRPA 3H08A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZBL A;  4KPY A;  2HW3 A;  4CFB A;  3PX0 A;  4C8N A;  3P1G A;  1ASU A;  4Z4H A;  3LP1 A;  4OGC A;  4CGJ A;  3K57 A;  4FJ5 A;  1BQN A;  1JL1 A;  4DF4 A;  4FJI A;  4KI4 A;  2HVI A;  3SUN A;  3NH0 A;  4OPK A;  4KB1 A;  3QER A;  4W5T A;  1D5A A;  3SUP A;  4B9S A;  1QS4 A;  3V1R A;  3CQ8 A;  4KHW A;  4JS5 A;  1NOZ A;  1EXQ A;  5J2N A;  2QKB A;  4PQU A;  2YHB A;  1BIS A;  4Z0U A;  3TAM A;  4DS5 A;  3IG1 A;  1XI1 A;  5KRT A;  3PV8 A;  4M45 A;  3SPZ A;  1NK8 A;  3QIP A;  3ZCM A;  4FLW A;  1BHL A;  3DRR A;  2HND A;  3AVN A;  1QE1 A;  3DLH A;  4Z4E A;  3NHG A;  1J53 A;  1KTQ A;  3MXM A;  3PY8 A;  3KTQ A;  1B9D A;  4M3X A;  2FBX A;  4AHU A;  1NK6 A;  3U6F A;  3RR8 A;  3QLH A;  3LZJ A;  2HHQ A;  5K14 A;  5CYM A;  4F3T A;  1C0U A;  4IG3 A;  4CFC A;  3HPO A;  2E6L A;  1J9A A;  4DQQ A;  5I42 A;  2YNH A;  4M3T A;  3ALY A;  3SV3 A;  1RBU A;  2P5G A;  5JS1 A;  5KGX A;  1LAV A;  4I9Q A;  3RMB A;  1J54 A;  2WON A;  4KRF A;  1RBT A;  4CHZ A;  4CHN A;  3QO9 A;  4G1Q A;  4CF0 A;  3DI6 A;  4AHC A;  4FK0 A;  4OKK A;  4KHS A;  4E3S A;  4M3Y A;  4Q5V A;  1WSF A;  1D8Y A;  1DTT A;  4CJV A;  4W5Q A;  4FLY A;  4ICL A;  1GOB A;  3TAQ A;  3CM6 A;  4CJS A;  2RKI A;  3K5O A;  4FLU A;  5E41 A;  5J2P A;  2P51 A;  4LH5 A;  4O0J A;  4H8K A;  3LAL A;  4B9U A;  3QEW A;  4F2S A;  3HST B;  4O55 A;  2ATQ A;  3PO4 A;  4AH9 A;  2KQ2 A;  3V9X A;  4CEE A;  1YVU A;  4CJR A;  1BIU A;  1HNV A;  2FBT A;  2Z1I A;  3DLE A;  3M8Q A;  3DRS A;  3MXI A;  2HHX A;  2B5J A;  4OPJ A;  2HNY A;  1DLO A;  4ID5 A;  3TAB A;  1RT5 A;  2Y1J A;  1L3S A;  3NF7 A;  2YNI A;  3OYA A;  2QKK A;  1FKP A;  2HHW A;  1ASV A;  4CJQ A;  4LD0 A;  4DG1 A;  1BI4 B;  3L3U A;  1QSY A;  3LWM A;  1NJW A;  1S6P A;  5HRO A;  3L3V A;  4ZTJ A;  4O5B A;  5HRR A;  3SJJ A;  3S3N A;  2PYJ A;  4F8R A;  2ZE2 A;  1UA1 A;  2F96 A;  1HMV A;  1HNI A;  5FDL A;  3QEI A;  3RRH A;  1Q9X A;  1LW2 A;  3U3Y A;  1HQE A;  1S5J A;  4ZTF A;  1D9F A;  1SKS A;  3CYM A;  4M3W A;  4I2Q A;  4CEO A;  1VSF A;  4CIE A;  1QHT A;  1HQU A;  3KIO A;  3RRG A;  4E0D A;  4C8K A;  4AHV A;  4CHP A;  3SPY A;  1RCH A;  2FBV A;  4LSL A;  4HUG A;  4WE1 A;  4DFP A;  1ZBH A;  4CEB A;  1C6V A;  1KFS A;  4DFM A;  1RBR A;  3V1Q A;  4DF8 A;  3VQ5 A;  4EZ6 A;  3WNF A;  4BWJ A;  5HRN A;  3NE6 A;  2X6N A;  3NBP A;  3OYL A;  3SNN A;  3AVI A;  1JXB A;  4OLB A;  1RTH A;  4FW1 A;  1RT1 A;  4JS4 A;  3HP6 A;  4CGG A;  4NYF A;  4DQR A;  3HYF A;  3MAQ A;  2XY6 A;  2YNF A;  2AJQ A;  1U48 A;  1I3A A;  4DSE A;  4FYD A;  2HHT A;  4CHY A;  2NUB A;  3MEG A;  3BDP A;  3ITH A;  4FCY A;  4CJE A;  4KTZ A;  4CES A;  3AVF A;  4DSL A;  1TAU A;  1WSJ A;  3DOL A;  1RTD A;  4W5O A;  2F8T A;  1KVA A;  2WOM A;  1U45 A;  1A5V A;  4W5R A;  1TL1 A;  1T05 A;  2DFE A;  2D5R A;  4B8C A;  3V9W A;  4M42 A;  1IKV A;  2IS3 A;  4GW6 A;  1HYS A;  3AO3 A;  4AHS A;  1MU2 A;  3NGZ A;  3KK3 A;  4KHU A;  3A2F A;  2VWK A;  3NGI A;  3HL8 A;  5KGW A;  2B6A A;  3OYD A;  1VSJ A;  4CE9 A;  3CFP A;  3NF8 A;  1IG9 A;  4N56 A;  3WNE A;  4C8O A;  1CLQ A;  1RT7 A;  3AVB A;  3P5J A;  5HBM A;  1C0T A;  2GBZ A;  4BDZ A;  3OYG A;  1NJX A;  1S1X A;  4RW4 A;  4HUE A;  3TAE A;  3LDS A;  4DSJ A;  1VSI A;  3OJU A;  1SKR A;  4NCB A;  4KV8 A;  1WAF A;  3OYN A;  1SUQ A;  5EU7 A;  3RTV A;  4FJK A;  4DFJ A;  1U49 A;  4KTQ A;  3LP0 A;  3O4N A;  3ZT1 A;  3KLH A;  1Q9Y A;  2G8V A;  1NJZ A;  3V4I A;  5D3G A;  3SQ1 A;  1RTI A;  2OPP A;  4OJR A;  3OYC A;  3LZI A;  2KW4 A;  1LWC A;  3V9U A;  1X1P A;  3ZT2 A;  4CJW A;  3V6D A;  2W42 A;  2D0A A;  2G8F A;  1WN7 A;  4QCL A;  2B4J A;  1UAX A;  1NJY A;  1JLE A;  2OPS A;  1I39 A;  1BL3 A;  1YTA A;  1A5X A;  1R0A A;  2ITG A;  1FXX A;  2KFZ A;  4AIL C;  3B6P A;  3KLE A;  3EYZ A;  4KHN A;  2O4I A;  1RBV A;  1L3T A;  3LP3 A;  1NK4 A;  1RDC A;  4DQP A;  3O3F A;  5FRM A;  2OPQ A;  3RR7 A;  4CJ5 A;  1X9W A;  3I0S A;  3HP9 A;  3HPG A;  4OKE A;  1U47 A;  3OS2 A;  1CZB A;  1TVR A;  3AO1 A;  4KTW A;  1XHZ A;  4AHT A;  4BE0 A;  1NK5 A;  1KLM A;  1L3V A;  2G8I A;  4Q0B A;  4CGI A;  2BDP A;  4O44 A;  1XHX A;  3VQC A;  4DU1 A;  3L2Q A;  2XY5 A;  3HVT A;  2D0B A;  4MQ3 A;  3NAE A;  3NF9 A;  4FM1 A;  3VA3 A;  2X74 A;  3TAG A;  5FRN A;  1WLJ A;  2E4L A;  4CIF A;  3SUO A;  3HK2 A;  4DTR A;  1QQC A;  1XC9 A;  5SWM A;  4BDP A;  4OLA A;  1A5W A;  2EX3 A;  2YNG A;  4H4O A;  2YKN A;  3C95 A;  3PX4 A;  3JYT A;  2Q3S A;  2RPI A;  1VSK A;  3WNG A;  3HM9 A;  4DWI A;  1UA0 A;  4RW9 A;  3ZSQ A;  3ULD A;  4ELV A;  2HMI A;  3OVN A;  4O4G A;  1C1C A;  4F4K A;  4FJX A;  4KHY A;  1BGX T;  4E7J A;  1YT3 A;  2P5O A;  2QK9 A;  1VSH A;  4M41 A;  5KI6 A;  1JL2 A;  4CK2 A;  2IGI A;  3NH1 A;  4I2P A;  1EP4 A;  3FFI A;  1Y97 A;  2EHG A;  2G8W A;  4OKJ A;  4LY7 A;  4CHO A;  1U04 A;  3P83 D;  4AHR A;  4HVJ A;  1T8E A;  4FXD A;  1NKC A;  3VQD A;  4CF8 A;  1KFD A;  1U4B A;  4FJ9 A;  3AO2 A;  5C24 A;  4FJJ A;  3LAN A;  3ZSR A;  3O4Q A;  5J2M A;  3KK2 A;  4FJL A;  4RG8 A;  3S9H A;  3TWH A;  2JLE A;  4DSI A;  3V9Z A;  1S9G A;  3PX6 A;  3ZT0 A;  3O3H A;  1JLB A;  1JLC A;  1S1U A;  4CJL A;  1L5U A;  1VSD A;  1NK0 A;  4CJT A;  1QSS A;  1LAW A;  4BE2 A;  2VG5 A;  2HNZ A;  4CJ3 A;  4NCA A;  2KZM A;  4GVM A;  4PA1 A;  3KLI A;  1WSG A;  4OVL A;  3KK1 A;  4OGE A;  4EP4 A;  3SYZ A;  2ZD1 A;  3AO4 A;  1CZ9 A;  4DTU A;  3IRX A;  2F8S A;  4CEF A;  1UWB A;  2XHB A;  4BAC A;  4W5N A;  4PY5 A;  1BI4 A;  1O1W A;  4B9M A;  3DLG A;  3OYB A;  3TAN A;  3G0Z A;  5CZ1 A;  5J2Q A;  1TK8 A;  1ZBI A;  3OYH A;  1L3U A;  4CF2 A;  4HCB A;  4DU4 A;  4M3U A;  1VSM A;  3AVJ A;  2OZS A;  4FM2 A;  4ID1 A;  4C8M A;  3IAY A;  4E1M A;  4E7K A;  4Y1C A;  4FJH A;  1SV5 A;  5DMR A;  4FZX C;  1NOY A;  1K6Y A;  3EZ5 A;  4DTS A;  1S1T A;  3RMD A;  2D0C A;  2PZS A;  1RTJ A;  1BCO A;  3OYF A;  4Z4I A;  3NDK A;  1NKE A;  1T03 A;  4CJK A;  1VRT A;  3D45 A;  3G10 A;  4E1N A;  3NFA A;  4EP5 A;  4DU3 A;  1W9H A;  1WNS A;  1T7P A;  3ASM A;  3BGR A;  4IG0 A;  4BWM A;  3VN5 A;  3D0P A;  2IDO A;  4CFD A;  4KRE A;  4N76 A;  2GV9 A;  4FLV A;  3DLK A;  3MXJ A;  3VQB A;  1F21 A;  3L2V A;  4Y1D A;  2XY8 A;  2DFF A;  3NCI A;  3AO5 A;  3SQ4 A;  3K2P A;  1IKX A;  1C1A A;  4ZHR A;  3OS0 A;  1ZYQ A;  3F9K A;  3SV4 A;  3B6O A;  4NYN A;  3T3F A;  4L8R B;  3O3G A;  3VQ8 A;  3C6T A;  4IFV A;  3QET A;  1Z25 A;  2IAJ A;  3HVR A;  1VSE A;  4DSK A;  3QIN A;  2VWJ A;  4CEQ A;  3LPT A;  3L2W A;  4J2B A;  1ASW A;  3HPH A;  1KSP A;  1QTM A;  4IKF A;  5CYQ A;  5DK5 A;  1REV A;  1RT6 A;  3I0R A;  5C42 A;  2KFN A;  4M3Z A;  2X6S A;  4CF9 A;  1W0H A;  2OYQ A;  3M8R A;  1HYZ A;  1S1W A;  3DYA A;  3KLF A;  3QEX A;  1X9M A;  4NCG A;  1ZBU A;  1BCM A;  1JLQ A;  1TK5 A;  3HO1 A;  4DQS A;  2DTU A;  2ZQB A;  1IH7 A;  3CM5 A;  1HYV A;  4CHQ A;  1X9S A;  2Z1G A;  3K58 A;  4C8L A;  1LWF A;  3T19 A;  1N6Q A;  4B9L A;  3UIQ A;  4J2A A;  4N41 A;  2Y1I A;  3U3G A;  3ZSW A;  4RW7 A;  3TI0 A;  2DY4 A;  4E7L A;  3ZSZ A;  4DFK A;  3RWU A;  1HJR A;  5FRO A;  1JLA A;  3NH2 A;  4K8Z A;  2BAN A;  4CER A;  3AA3 A;  1SL0 A;  1RDD A;  4TSX A;  4B9V A;  1VSL A;  4CJP A;  1EKE A;  2OPR A;  1RDA A;  2G8U A;  3HJF A;  4DS4 A;  1TGO A;  4EZ9 A;  1J5O A;  3OYM A;  1SL1 A;  1KLN A;  1TV6 A;  3AVL A;  3DLR A;  3PUF A;  4YNQ A;  2XO7 A;  3TAR A;  3AA5 X;  5KTQ A;  4IDK A;  4RW6 A;  3QEV A;  4KB0 A;  1G15 A;  3AVA A;  2ETJ A;  1VRU A;  1RIL A;  3DMJ A;  4FLZ A;  1DTQ A;  4B08 A;  2HHV A;  1JXE A;  2E6M A;  4JLH A;  4LH4 A;  4CGF A;  3IS9 A;  3KJV A;  4DMN A;  3LPU A;  2A1R A;  2OZM A;  1TKT A;  4KFB A;  4E7I A;  1UOC A;  3VQ9 A;  1JKH A;  1LV5 A;  3AVG A;  3DOK A;  1FK9 A;  4KAZ A;  2HB5 A;  3VQA A;  1D9D A;  2G8K A;  3K59 A;  4DLE A;  2XY7 A;  1TKZ A;  4XIU A;  1TKD A;  4DTP A;  4Z4F A;  4E19 A;  3VA0 A;  2HHU A;  1NK7 A;  4M3R A;  1TK0 A;  1ITG A;  3KLG A;  4Z4C A;  2IC3 A;  4DSF A;  2BGG A;  3OYI A;  4DTM A;  5HLF A;  4KKO A;  1VK0 A;  3LAM A;  3SI6 A;  4O0I A;  3SCX A;  4CJU A;  1RDB A;  4B3O A;  1KVB A;  3HT3 A;  2YKM A;  4HTU A;  3M8S A;  3K5N A;  4FM0 A;  1GOC A;  2GUI A;  3K5M A;  4UQG A;  4JRQ A;  2A1S A;  3HXM A;  3QNN A;  5I3U A;  1C0M A;  3WNH A;  4R5P A;  4N5S A;  1WSE A;  1CXU A;  2DFH A;  1ZBF A;  1LW0 A;  1NKB A;  5HRP A;  5HRS A;  4QOZ B;  2HHS A;  2KZZ A;  3CFO A;  1TL3 A;  1RT3 A;  1WSI A;  4DLG A;  3SQ2 A;  4CJ4 A;  1N5Y A;  2VG6 A;  3MED A;  2R7Y A;  3CG7 A;  3AA2 A;  3TR8 A;  1KCF A;  2LSN A;  3KKS A;  4QAG A;  4CED A;  4CK1 A;  3NGY A;  4FJN A;  1RNH A;  3AVC A;  3MEC A;  3VQQ A;  4J2D A;  3T1A A;  4PWD A;  1HRH A;  4E89 A;  4KI6 A;  4CIG A;  3F73 A;  1GOA A;  2IOC A;  3S3O A;  4CEC A;  3L8B A;  4ELU A;  1Q8I A;  3DM2 A;  3JSM A;  2HVH A;  3ZSO A;  3OYJ A;  2OA8 A;  1JLF A;  4CCH A;  4H4M A;  3OYK A;  1B92 A;  2JGU A;  3PO5 A;  3VQ4 A;  4Z4G A;  1Z26 A;  4BE1 A;  1BIZ A;  1CXQ A;  3C94 A;  3QIO A;  4IBN A;  4MFB A;  5T7B A;  3C6U A;  3RMC A;  3L2U A;  1SKW A;  4HCC A;  2P1J A;  2G8H A;  4I7F A;  3SZ2 A;  3V1O A;  1EET A;  3ZSX A;  4CK3 A;  3QEP A;  1QSL A;  5C25 A;  4KO0 A;  3OYE A;  4FLT A;  3AVM A;  4F2R A;  4FJG A;  4DTX A;  4ELT A;  4PUO A;  4RW8 A;  2RN2 A;  3V9S A;  4CEA A;  3QNO A;  3L2R A;  3QES A;  4FJ7 A;  3VQ7 A;  1KRP A;  4DTO A;  4GMJ B;  3TAF A;  3M8P A;  2XRI A;  1HPZ A;  1RBS A;  3MEE A;  4HUF A;  1BQM A;  1IKW A;  5JS2 A;  3TAP A;  2PY5 A;  4KHQ A;  3AVH A;  3ISN C;  3NF6 A;  5KRS A;  5HP1 A;  1B9F A;  3E01 A;  3OY9 A;  5CZ2 A;  4FZZ A;  4CJF A;  2O4G A;  4FW2 A;  3SQ0 A;  3KD1 E;  3AVK A;  4BDY A;  3OS1 A;  1TAQ A;  4CF1 A;  1IO2 A;  2X78 A;  2KTQ A;  4YFU A;  4FK4 A;  1KVC A;  5J1E A;  1JLG A;  4FJM A;  3V81 A;  3LAK A;  4DQI A;  2FC0 A;  2Z1J A;  3ZSV A;  4LSN A;  1EX4 A;  3THV A;  5CY4 A;  4B8A B;  1LWE A;  1S6Q A;  4K8X A;  3VQP A;  4FLX A;  2VG7 A;  3CFR A;  1S9E A;  3AV9 A;  4IFY A;  1SL2 A;  3LP2 A;  4DTN A;  3SUQ A;  5SZT A;  2YHA A;  3ZSY A;  4F3O A;  2QXF A;  1TKX A;  2BE2 A;  1XWL A;  3I8D A;  1WAJ A;  1S1V A;  4I9L A;  1NK9 A;  4B9T A;  3KKR A;  3S3M A;  2I5J A;  1FKO A;  1RT2 A;  2Z1H A;  3RMA A;  3KD5 E;  4N47 A;  1RT4 A;  4FZY A;  3DLB A;  3AA4 A;  3EY1 A;  3ZT3 A;  3VQ6 A;  2YV0 X;  1C1B A;  4HHT A;  4J2E A;  3LWL A;  4CEZ A;  4DTJ A;  4FJ8 A;  3K5L A;  3ZT4 A;  4CGH A;  3OJS A;  4B9N A;  4FK2 A;  2RF2 A;  1WSH A;  2PYL A;  1YTU A;  4CFA A;  4E7H A;  2FBY A;  3VQE A;  4CGD A;  4FVM A;  1IKY A;  3DRP A;  4JRP A;  3H08 A; 
#chains in the Genus database with same CATH topology
 1S3X A;  1VQ5 N;  4C23 A;  4HTL A;  2PBD A;  3K57 A;  1Q81 O;  4FJI A;  3PSF A;  3NH0 A;  3WXL A;  4KB1 A;  2YHW A;  4JEP A;  1W97 L;  1D5A A;  3SUP A;  4B1Z A;  4KHW A;  1NOZ A;  3N4P A;  1E4G T;  2YHB A;  1BIS A;  5AQX A;  4FOI A;  3IG1 A;  1NK8 A;  5CE3 A;  4H5R A;  3DLH A;  3NHG A;  3PY8 A;  3MXM A;  1CZA N;  5EY4 A;  3KTQ A;  4M3X A;  2FBX A;  4AHU A;  4JKG B;  4ILJ A;  2HHQ A;  2UXD K;  3JXU A;  2QI2 A;  3VEV A;  4M3T A;  1RBU A;  5JS1 A;  1U2V B;  4I9Q A;  1T44 A;  1J54 A;  1QQO A;  3NVM A;  4G1Q A;  4IDH A;  4FK0 A;  4OKK A;  3CJ9 A;  3MWP A;  3ZX3 A;  1WSF A;  3QBX A;  3MX2 A;  4AM6 A;  2YJF A;  4CJS A;  2V7Y A;  3H1Q A;  4H8K A;  3LAL A;  5FPN A;  3QEW A;  4F2S A;  3A5O C;  3D2F A;  4CJR A;  2Z1I A;  1E3M A;  2HHX A;  4OPJ A;  3PIP L;  4H0T B;  3NF7 A;  3OA9 A;  4DV2 K;  2Q0R A;  3GBT A;  1ASV A;  3ZX2 A;  4CJQ A;  5BR8 K;  1QSY A;  3SJJ A;  2E1Z A;  1ZBS A;  1Q9X A;  3FZM A;  3CYM A;  3FZL A;  3N4Q A;  3EL2 A;  1HQU A;  3IMX A;  2P9U B;  5E26 A;  3RRG A;  4AHV A;  4CHP A;  2FBV A;  3WXM B;  4BGA A;  1Z05 A;  4HUG A;  4BC2 A;  1ZBH A;  1SQK A;  4CEB A;  1KFS A;  2ITM A;  3WNF A;  4BWJ A;  5KPZ A;  2E20 A;  3I55 N;  3AVI A;  4WQ4 A;  4K41 A;  4O8U A;  4GV6 A;  4CGG A;  4WFN L;  1U48 A;  2O8E B;  1W2B M;  1I3A A;  4DSE A;  2HHT A;  4CHY A;  2NUB A;  3BDP A;  3EZW A;  5AQP A;  3AGK A;  3VEY A;  1RTD A;  4W5O A;  2WOM A;  1A5V A;  4H5V A;  3V9W A;  1IKV A;  3MX5 A;  5KPR A;  5AQW A;  3AO3 A;  4AHS A;  1T3V A;  1TUY A;  3A2F A;  3OBW A;  3CFP A;  3BF1 A;  4N56 A;  1RT7 A;  3AVB A;  1S22 A;  2P9N A;  4BRG A;  2GBZ A;  4ILG B;  3DXM A;  3TAE A;  1SKR A;  3OJU A;  3C65 A;  3GG4 A;  4DFJ A;  1U49 A;  3O4N A;  4FWM A;  1NJZ A;  3V6D A;  4BRA A;  2ZJQ L;  4JI7 K;  3R9P A;  1HNX K;  1NJY A;  4MDA A;  1R0A A;  4FWP A;  1RBV A;  1RDC A;  4PKG A;  2OPQ A;  3DAW A;  1X9W A;  2JWK A;  4BRO A;  4B1W B;  4DV5 K;  5MLC Q;  4DR5 K;  3THW B;  3HPG A;  4JHD B;  4OKE A;  1XHZ A;  4NO7 A;  4CZM A;  4AHT A;  4BE0 A;  1ESV A;  4JKE A;  4IEI A;  3E1Y A;  2BDP A;  3HVT A;  2D0B A;  3CET A;  1KAZ A;  3NF9 A;  3I33 A;  1VQ6 N;  2X74 A;  4CJ7 A;  3HK2 A;  4DTR A;  1QQC A;  3GL1 A;  4OLA A;  3JYT A;  1VSK A;  2GWJ A;  3JS6 A;  3L4I A;  1UA0 A;  1OKJ A;  1HLU A;  1VQO N;  1J6Z A;  3CQX A;  4O4G A;  4YHH K;  4IJA A;  1U2V A;  3VPZ A;  4B3T K;  2F9T A;  1X3M A;  1EP4 A;  5GIO A;  2D0P A;  4OKJ A;  4LY7 A;  1T8E A;  4FXD A;  3P83 D;  4CF8 A;  4ISE A;  3AO2 A;  5AQY A;  3LAN A;  3ZSR A;  4BR7 A;  1FW6 A;  3T7Z A;  4G9Z A;  4CVN E;  3TWH A;  4FWO A;  4CJT A;  1QSS A;  4X66 K;  3TSP A;  4PA1 A;  3MCA B;  1N34 K;  2A40 A;  2ZD1 A;  3AO4 A;  3IRX A;  2AP1 A;  1EO1 A;  5LL6 Z;  1O1W A;  3DLG A;  3OYB A;  3TAN A;  4YDU C;  3OYH A;  1L3U A;  4HCB A;  1VSM A;  4CZG A;  2BUP A;  3J7Y P;  4C8M A;  3G25 A;  3RVC A;  4Y1C A;  3F9M A;  5GAD P;  1C0G A;  3EZ5 A;  4DTS A;  1S1T A;  2D0C A;  3NDK A;  1NKE A;  5BN8 A;  4E1N A;  1T7P A;  1W9H A;  4IG0 A;  3CJ1 A;  3HM8 A;  2GV9 A;  4N76 A;  3VQB A;  3CXC M;  5GIN A;  3LDL A;  4CZH A;  4A57 A;  2V51 B;  1C1A A;  3SV4 A;  4YOY A;  3K9J A;  4NYN A;  2O8E A;  2P9I B;  4XH4 A;  2F9W A;  2QM1 A;  4L8R B;  5AZJ B;  3VQ8 A;  4YY3 K;  3C6T A;  4IFV A;  1Z25 A;  2IAJ A;  3QIN A;  3DWL A;  2GTD A;  2E2N A;  1RT6 A;  3I0R A;  4YOW A;  2HST A;  3H3O B;  2OYQ A;  4H0X B;  3PIO L;  1JJ2 M;  3DYA A;  1BWF O;  1BCM A;  1JLQ A;  1TK5 A;  1IH7 A;  1HYV A;  4CHQ A;  4C8L A;  2Z1G A;  4N41 A;  5GAH P;  3U3G A;  1BUP A;  3GOI A;  4FPB A;  4U67 L;  3TI0 A;  4E7L A;  1NU0 A;  4M7Y A;  5LJV A;  4BG9 A;  4K8Z A;  4F9O A;  3AA3 A;  2RHK A;  3G71 N;  4TSX A;  1N33 K;  1EQY A;  5CR4 A;  1VHX A;  2OPR A;  1RDA A;  4DS4 A;  1S72 N;  2QA4 N;  1SL1 A;  3PUF A;  2V52 B;  1DEJ A;  4KB0 A;  5TKW A;  1G15 A;  3THW A;  5I9E B;  2ETJ A;  4JI0 K;  4FWL A;  1RIL A;  3DMJ A;  3VF4 A;  2E6M A;  3KJV A;  4E7I A;  2DPN A;  5AQU A;  3DOK A;  4KAZ A;  2YJE A;  1D9D A;  3CC2 N;  2P9L B;  3FZH A;  4DLE A;  3ZET B;  1IBK K;  2P9P B;  4PKH A;  4Z4C A;  2IC3 A;  4R79 A;  4KKO A;  1VK0 A;  3MN7 A;  3SCX A;  2HBM A;  1RDB A;  3HT3 A;  3J7Z O;  3SBT A;  4ISG A;  1HUX A;  5I3U A;  3WNH A;  1FJG K;  4R5P A;  1WSE A;  1CXU A;  4QOZ B;  2CGJ A;  1TL3 A;  1RT3 A;  4DLG A;  3E66 A;  5FPD A;  1M90 O;  3MED A;  2LSN A;  4QAG A;  1RNH A;  3AVC A;  3VQQ A;  4PWD A;  4KI6 A;  1DGK N;  4CIG A;  1K73 O;  5AQV A;  3S3O A;  1V4S A;  2W40 A;  3JSM A;  2HVH A;  3ZSO A;  1NMN A;  4CCH A;  4LFB K;  1CXQ A;  4IBN A;  4HCC A;  3C6U A;  3L2U A;  1VQL N;  1ZXO A;  5M1N A;  4DV3 K;  2W6L A;  4CK3 A;  3QEP A;  5C25 A;  1NGA A;  4KO0 A;  4FLT A;  3AVM A;  4RW8 A;  4JK9 A;  3QES A;  2OTL N;  3MEE A;  4KHQ A;  3A8Y A;  3AVH A;  5HP1 A;  5F0X A;  3OY9 A;  5CZ2 A;  2GEM A;  4FZZ A;  4WQ4 C;  4CF1 A;  1IO2 A;  3ID8 A;  4FL9 A;  4YFU A;  2CGL A;  3O80 A;  2FF6 A;  5AQG A;  3ZSV A;  5ADX H;  3OTO K;  4DV7 K;  4YOT A;  4FLX A;  2KFN A;  3AV9 A;  1SL2 A;  1YUW A;  3SUQ A;  4F3O A;  1XWL A;  1S1V A;  3KKR A;  4CBX A;  3KD5 E;  4N47 A;  4FZY A;  1VQ8 N;  3DLB A;  5AZJ A;  1T6C A;  4DTJ A;  3ENO A;  4FJ8 A;  3MWT A;  4CGH A;  1Q7Y O;  4CZE A;  2PYL A;  3CD6 N;  1YTU A;  1NGI A;  3VQE A;  3H08 A;  1ZBL A;  3VGM A;  4KPY A;  1YHQ N;  4CFB A;  3PX0 A;  4C8N A;  1ASU A;  3LP1 A;  4JNE A;  1TUU A;  3MCP A;  1V4T A;  1BQN A;  2YX6 A;  1LCU A;  4JKC A;  4LF8 K;  3SBG A;  4W5T A;  3CQ8 A;  2E8A A;  4JS5 A;  2QKB A;  4DUZ K;  1VQ9 N;  1DT9 A;  2BTF A;  4M45 A;  3SPZ A;  3QIP A;  4FLW A;  4QS8 A;  3DRR A;  2E5L K;  1GLA G;  2P9K B;  1QE1 A;  3QFU A;  4MO4 A;  4Z4E A;  1KTQ A;  4JKB A;  1B9D A;  3U6F A;  3QLH A;  5K14 A;  4DR7 K;  3O9U A;  5ELZ A;  4CFC A;  3HPO A;  2Q97 A;  4NXM K;  3ALY A;  2P5G A;  4CW7 B;  2E2P A;  1LAV A;  4NLB A;  3VGL A;  2QEX N;  3S41 A;  4DHY A;  3DI6 A;  4FWR A;  1NGD A;  4KHS A;  4M3Y A;  4Q5V A;  1D8Y A;  1DTT A;  3WXI A;  4CJV A;  2VGM A;  2P9L A;  2YHX A;  3ZET A;  4H0V B;  4CZJ A;  2NNW A;  2P9P A;  5E41 A;  5J2P A;  3D6R A;  4FWS A;  4YOV A;  3HST B;  4O55 A;  2ATQ A;  3VF6 A;  3V9X A;  4CEE A;  1HNV A;  3DRS A;  3MXI A;  4BRN A;  2B5J A;  3K0S A;  5AFU A;  4O8K A;  4ID5 A;  1RT5 A;  1L3S A;  2QKK A;  1FKP A;  2HHW A;  4DG1 A;  3L3U A;  3LWM A;  5HRO A;  4YDU A;  3D2E B;  4IOX A;  3QEI A;  1HMV A;  4CZL A;  3U3Y A;  1HQE A;  1S5J A;  4ZTF A;  1D9F A;  4H03 B;  1H1V A;  4BR5 A;  4M3W A;  4CEO A;  1NGG A;  3HBT A;  4JK7 A;  3KIO A;  1SAZ A;  3R8E A;  4E0D A;  1XMQ K;  4KH6 A;  4LF5 K;  4RCH A;  4LSL A;  1NGJ A;  4FSV A;  3V1Q A;  4DF8 A;  3QIC A;  3VQ5 A;  2HHH K;  3OYL A;  5FLX O;  3KK7 A;  3LDO A;  3HP6 A;  5IT9 O;  5JMV A;  3HSC A;  1HPM A;  3MEG A;  2WBN A;  4CJE A;  4KTZ A;  4B3M K;  4CZF A;  1TAU A;  1WSJ A;  2RE2 A;  4FPA A;  1HNZ K;  2JWL A;  4W5R A;  1TL1 A;  1T05 A;  3DXM B;  2D5R A;  3QML A;  4GW6 A;  3VEW A;  2HF3 A;  2QXL A;  2B6A A;  1VSJ A;  2GX9 A;  1QQN A;  3WNE A;  2ZJP L;  1YIT N;  4BY9 C;  4A62 A;  1K9M O;  3OYG A;  1NJX A;  2ZWH A;  4RW4 A;  4HUE A;  3CJC A;  1VSI A;  4NCB A;  5D3G A;  3ZT1 A;  2QWN A;  4OJR A;  3V9U A;  1D4X A;  3LZI A;  1X1P A;  4CJW A;  2G8F A;  5TKY A;  2B4J A;  1YJN N;  1YXQ A;  2OPS A;  1WBD A;  3IFR A;  2A42 A;  4LF4 K;  2KFZ A;  4AIL C;  2O4I A;  3KLE A;  3EYZ A;  5JLH A;  1XQS C;  4DQP A;  3LP3 A;  4KBO A;  4MO5 A;  1NK4 A;  3O3F A;  5B8H A;  3I0S A;  1U47 A;  3M5R A;  3OS2 A;  1TVR A;  4KTW A;  1NK5 A;  1K8K B;  1L3V A;  5M1K A;  1GLL O;  5AQM A;  3L2Q A;  2XY5 A;  2NZT A;  3MN6 A;  5BRD A;  4MQ3 A;  1ATR A;  1O13 A;  2P9K A;  4FM1 A;  5FRN A;  1WLJ A;  2WTU A;  4BDP A;  1NMD A;  2EX3 A;  4DWI A;  1NGB A;  2Q3S A;  3HM9 A;  4RW9 A;  3ZSQ A;  4PHT X;  3CME N;  2HMI A;  3OVN A;  4A61 A;  1VQM N;  2VGN A;  4FJX A;  4X65 K;  4E7J A;  5BPL A;  4DV1 K;  1JL2 A;  2ZM6 K;  3NH1 A;  4K0K K;  1Y97 A;  2AA4 A;  1NGF A;  2G8W A;  2QWP A;  4CHO A;  1U04 A;  2QW9 A;  4AHR A;  1KFD A;  3O9T A;  4FJ9 A;  4BR2 A;  4FJJ A;  4JI3 K;  5J2M A;  3KK2 A;  5EOY A;  3WXJ A;  1Z6R A;  2JLE A;  4DSI A;  5C15 A;  3O3H A;  1JLB A;  3ID6 A;  1L5U A;  1VSD A;  1NK0 A;  5AQL A;  1LAW A;  4CJ3 A;  4NCA A;  4GVM A;  4JK8 A;  3KK1 A;  4OGE A;  4GY2 B;  1CZ9 A;  5E84 A;  2F8S A;  1UWB A;  3AY9 A;  5KQD A;  5AQT A;  3G0Z A;  1ZBI A;  3D2E A;  2F7T A;  3KHY A;  2OZS A;  4FM2 A;  2A6A A;  3T1Y K;  1SV5 A;  5DMR A;  1NOY A;  3RMD A;  1RTJ A;  1BCO A;  4IO8 A;  4CJK A;  5AQH A;  3VF2 A;  3G10 A;  4DU3 A;  3NFA A;  1Q86 O;  1ATN A;  3BGR A;  4H5N A;  5AQF A;  3VN5 A;  2QWQ A;  2IDO A;  2D1K A;  3F5T A;  3DLK A;  1F21 A;  3L2V A;  1GLJ O;  4Y1D A;  2XY8 A;  2DFF A;  3TTC A;  3K2P A;  4LC9 B;  3OS0 A;  3F9K A;  4JAX A;  3EE9 A;  4I6M A;  2NLX A;  3T3F A;  2A3Z A;  3QET A;  3O5B A;  3SAH A;  3AAQ A;  5C2F A;  4NXN K;  4XH1 A;  3WQU A;  4J2B A;  3CHW A;  1KSP A;  2NRT A;  2QWL A;  1QTM A;  3U8X A;  1REV A;  1IBM K;  2YI1 A;  1W0H A;  1S1W A;  4UY8 O;  1X9M A;  4NCG A;  1NGH A;  3SMS A;  3HO1 A;  3UE5 A;  4DR2 K;  1X9S A;  3M1F A;  2HMP A;  5JLF A;  1N6Q A;  2Y1I A;  3ZSW A;  1VQ7 N;  2O8C B;  4FVU A;  2DY4 A;  4B9Q A;  4BRL A;  3RWU A;  5FRO A;  4B3S K;  3O9S A;  4B9V A;  4GV9 A;  1EWQ A;  4JKA A;  1BA1 A;  3HJF A;  5BPM A;  4CBU A;  3C7N B;  3C6A A;  1TV6 A;  3BZC A;  1NG9 A;  3TAR A;  1XNQ K;  1YIJ N;  5KTQ A;  1LOT B;  4FO0 A;  5AR0 A;  1IJJ A;  1DTQ A;  4QS9 A;  4JLH A;  1K8K A;  4LH4 A;  4CGF A;  3HOT A;  3LPU A;  1TKT A;  4KFB A;  1UOC A;  3AVG A;  1YAG A;  3VQA A;  3K59 A;  4H0Y B;  2XY7 A;  4Z4F A;  3KZB A;  1QVF M;  4M3R A;  4DTM A;  1OH6 A;  4CJU A;  1KVB A;  3P39 A;  3M8S A;  3K5N A;  4FM0 A;  1GOC A;  4UQG A;  4BVP A;  2DFH A;  3TSU A;  3KWI A;  5HRS A;  2HHS A;  2KZZ A;  1XC3 A;  1WSI A;  2D4W A;  4CJ4 A;  4NLC A;  4A59 A;  1OVQ A;  3AA2 A;  4CED A;  3NGY A;  1HRH A;  4ELU A;  1Q8I A;  3DM2 A;  3QBW A;  3OYJ A;  4H4M A;  4WQ5 A;  4BE1 A;  5T7B A;  2P1J A;  3VTH A;  4YOU A;  2G8H A;  1HX1 A;  2PAV A;  4I7F A;  2UXB K;  3V1O A;  1QSL A;  3OYE A;  3T1H K;  4F2R A;  4DTX A;  4CEA A;  3BY5 A;  4DTO A;  4GMJ B;  2PY5 A;  1IKW A;  3NF6 A;  3P38 A;  3PLA A;  3SQ0 A;  1VQN N;  3AVK A;  4IWV A;  4BDY A;  1TAQ A;  3L0Q A;  5AQK A;  3K9K A;  2UUB K;  5J1E A;  2IVN A;  3U9D A;  2Z1J A;  1HKB A;  1EX4 A;  3THV A;  5CY4 A;  1LWE A;  2VG7 A;  4DTN A;  2YHA A;  3EKS A;  2QXF A;  3I8D A;  1NK9 A;  4JV5 K;  4DB3 A;  4I9L A;  1GLB G;  1FKO A;  4EAH D;  2Z1H A;  4GV3 A;  3EY1 A;  4HHT A;  4J2E A;  4FWQ A;  3CPE A;  3HZ6 A;  1YF5 L;  2RF2 A;  1GLC G;  4CFA A;  2FBY A;  3DRP A;  4JRP A;  3ATV A;  2I7N A;  3IKM A;  2HW3 A;  3T69 A;  3CCV N;  4DR6 K;  4OGC A;  4K43 A;  4DF4 A;  4KI4 A;  3CPW M;  4OPK A;  2KHO A;  3VET A;  4B9S A;  3QDK A;  1SS6 A;  4DR4 K;  1EXQ A;  2O8C A;  4PQU A;  4Z0U A;  4DS5 A;  5KRT A;  1BHL A;  3AVN A;  4KH4 A;  1J53 A;  1M1K O;  4CZI A;  4QS7 A;  2ASP A;  2UU9 K;  2E2O A;  4F3T A;  1C0U A;  4IG3 A;  3C7N A;  3VES A;  4DKW A;  2Q36 A;  4BRC A;  2YNH A;  3U9Z A;  3JAM O;  2Q0U A;  4BC4 A;  3RMB A;  2WON A;  3OHR A;  1RBT A;  3QO9 A;  4CF0 A;  3CJB A;  4BQL A;  1YVN A;  1BA0 A;  4E3S A;  5LMU K;  5ADX A;  1VQP N;  4FLY A;  4W5Q A;  1GOB A;  4IXC A;  3CM6 A;  5C2D A;  2RKI A;  4LH5 A;  4B9U A;  3ZEU B;  3PO4 A;  4AH9 A;  2NRW A;  1BIU A;  2FBT A;  3DLE A;  3M8Q A;  1NM1 A;  2HNY A;  1DLO A;  2Y1J A;  2YNI A;  3OYA A;  3HTV A;  4LD0 A;  1KD1 O;  1NJW A;  1S6P A;  1QZ6 A;  2NRV A;  5AQZ A;  4ZTJ A;  2ZE2 A;  1UA1 A;  2O8D B;  3THY B;  1HNI A;  3W0L A;  3RRH A;  2E1Y A;  1SKS A;  3ULE B;  4I2Q A;  1VSF A;  1IV0 A;  3CCJ N;  3BEX A;  4C8K A;  2O8F A;  1RCH A;  4B1U B;  4DFP A;  1C6V A;  1NGE A;  4DFM A;  1RBR A;  4WCE L;  3O8M A;  2QWR A;  3SMP A;  5HRN A;  2ZJR L;  3NBP A;  4OLB A;  2P9S B;  1RT1 A;  4NB4 A;  4JS4 A;  2NRX A;  2XY6 A;  4NYF A;  3MAQ A;  4O5F A;  5DM7 L;  4H0P A;  3ITH A;  4FCY A;  4CES A;  3AVF A;  4DSL A;  3DOL A;  1U45 A;  3SJH A;  4B8C A;  3B8A X;  2IS3 A;  3FZK A;  3O6W A;  1HYS A;  4J8F A;  4C1N K;  5EXW A;  2VWK A;  3NGI A;  3HL8 A;  5KGW A;  4JN4 A;  4CE9 A;  4JI1 K;  3O9R A;  1IG9 A;  1CLQ A;  5HBM A;  1WBB A;  3FGU A;  1C0T A;  4IFE A;  3J7A P;  1S1X A;  4OPA A;  4DSJ A;  3RTV A;  4GNI A;  4FJK A;  4DQ8 A;  3EEQ A;  3LP0 A;  4EFH A;  2G8V A;  3DXK B;  3OYC A;  2KW4 A;  1LWC A;  3FFK B;  5M1Q A;  4QCL A;  2FSJ A;  2QWO A;  3VEO A;  1I39 A;  3UKU B;  1BL3 A;  5EX5 A;  1FXX A;  3B6P A;  2NRH A;  2W6K A;  1BU6 O;  1L3T A;  5FRM A;  3RR7 A;  4CJ5 A;  2FSK A;  4LF6 K;  1MDU B;  1CZB A;  3EN9 A;  1WOQ A;  3AO1 A;  4LFA K;  5AQQ A;  2G8I A;  4MDB A;  4CGI A;  4JKH A;  4O44 A;  1XHX A;  3VQC A;  4XH5 A;  2HBL A;  3VA3 A;  3TAG A;  4WYB A;  3H45 C;  1XC9 A;  5SWM A;  1A5W A;  3PX4 A;  2YKN A;  3C95 A;  2RPI A;  3WNG A;  3SLC A;  3IUC A;  3ULD A;  4F4K A;  5AQO A;  1BGX T;  1YT3 A;  1MWK A;  2QK9 A;  5KI6 A;  1YJW N;  2WUS A;  4CK2 A;  1W7A A;  2EWS A;  2IGI A;  4I2P A;  3FFI A;  3W3D A;  2EHG A;  5AZI B;  3VOV A;  1NKC A;  3VQD A;  5BPN A;  1U4B A;  5C24 A;  3O4Q A;  5BRH A;  4AQY K;  1P90 A;  4RG8 A;  1S9G A;  3ZT0 A;  1S1U A;  1Y64 A;  3ZEU A;  3MN9 A;  4PL7 A;  4BE2 A;  2VG5 A;  2HNZ A;  2KZM A;  1Q82 O;  3OBY A;  3VEZ A;  3KLI A;  1WSG A;  4OVL A;  4H0O A;  4EP4 A;  1Q18 A;  4W5N A;  2Q1N A;  4JI5 K;  1N32 K;  5CZ1 A;  3RSE B;  5J2Q A;  1TK8 A;  4WQ5 C;  4DU4 A;  3R6M A;  3AVJ A;  4M3U A;  2FXU A;  3AAR A;  2O8D A;  3GDQ A;  3THY A;  4ID1 A;  4WF9 L;  3IAY A;  4JI2 K;  4BR0 A;  4WFB L;  3ULE A;  3WEE B;  2PZS A;  1HKC A;  2BH1 A;  4BG8 A;  1E4F T;  4Z4I A;  3CQY A;  4BC3 A;  4I6M B;  1WNS A;  3L4Q A;  4DUY K;  2FSN A;  2ASO A;  5CHI A;  3D0P A;  1RDU A;  3LL3 A;  4CFD A;  4KRE A;  4BR4 A;  3MXJ A;  2OTJ N;  1N36 K;  3NCI A;  1JCE A;  3AO5 A;  2P9S A;  3Q7B A;  1IKX A;  4BQZ A;  3CCR N;  4ZHR A;  3B6O A;  1QQM A;  4BRH A;  2QWM A;  3WT0 A;  5C12 A;  3NVK A;  3O4W A;  3HVR A;  1VSE A;  3ENB A;  3L2W A;  3EE8 A;  3HPH A;  3HOS A;  2E2Q A;  2VQE K;  4M3Z A;  4CF9 A;  4CD1 A;  1QZ5 A;  1HYZ A;  3QEX A;  1YI2 N;  4DQS A;  3CM5 A;  3FZF A;  3FE1 A;  1LWF A;  3T19 A;  3UIQ A;  4J2A A;  3H6E A;  5F2R A;  2PFU A;  2Q2R A;  4DFK A;  1HJR A;  3NMU A;  3DXK A;  1T6D A;  3MN5 A;  1RDD A;  2H3G X;  5LY3 A;  4X64 K;  3UKU A;  2QTD A;  1EKE A;  5C0Y A;  4IEE A;  5FPM A;  4EZ9 A;  1J5O A;  4M7X A;  3OYM A;  1KLN A;  3AVL A;  4IZ9 A;  4YNQ A;  3G6E N;  1VQ4 N;  1K8A O;  1VRU A;  3BP8 A;  3THX A;  4FLZ A;  4MLH A;  4B08 A;  2HHV A;  3IDH A;  4LF9 K;  1XUP O;  3IS9 A;  2O8B B;  2OZM A;  1LV5 A;  1FK9 A;  3C6H A;  2HB5 A;  2G8K A;  1TKZ A;  2WFB A;  4XIU A;  4B3R K;  4DTP A;  4HWI A;  3VA0 A;  1TK0 A;  3KLG A;  3ENH A;  4DSF A;  1BDG A;  1BOT O;  3LAM A;  3SI6 A;  3TPQ A;  3CMA N;  2YKM A;  3LDN A;  2YHY A;  2GUI A;  3K5M A;  2A1S A;  1C0M A;  1KC8 O;  4V19 S;  5AZI A;  3OW2 M;  3I8B A;  3J81 O;  5IWA K;  2R7Y A;  3CG7 A;  3HI0 A;  1KCF A;  4FWK A;  3MEC A;  2GWK A;  4J2D A;  3CCE N;  1BG3 A;  3BUZ B;  4E89 A;  3WXK A;  1X9J A;  3F73 A;  3WUH A;  4CEC A;  3KWG A;  2YCH A;  2UXC K;  5GAE P;  1JLF A;  3OYK A;  1B92 A;  2JGU A;  5AQS A;  3PO5 A;  4LF7 K;  5H1S Q;  1BIZ A;  3QIO A;  4MFB A;  1GLF O;  3CCU N;  5A2Q O;  3SZ2 A;  3ZSX A;  2VWB A;  4BRK A;  5BN9 A;  4FJG A;  3E9O A;  2CH5 A;  3RSE A;  4ELT A;  3V9S A;  2RN2 A;  3L2R A;  1BO5 O;  5KQ8 A;  1KRP A;  3TAF A;  1JCG A;  2HOE A;  4EHT A;  1RBS A;  4CZK A;  5GAG P;  3E01 A;  3WEE A;  4CJF A;  2O4G A;  4FW2 A;  2J4R A;  4DV0 K;  2KTQ A;  3HRG A;  4FK4 A;  2FF3 B;  4FJM A;  3AGR A;  4IJN A;  2HBK A;  3CI5 A;  4B8A B;  1S6Q A;  5AQN A;  4K42 A;  3CFR A;  1S9E A;  3FLC O;  3E9P A;  4JKF A;  3ZSY A;  5SZT A;  4BRE A;  2BE2 A;  1WAJ A;  4IO9 L;  3H46 O;  2D0O A;  1RT4 A;  3AA4 A;  1TYQ A;  3ZT3 A;  3VQ6 A;  2YV0 X;  1C1B A;  2UUC K;  3LWL A;  4CEZ A;  4GVE A;  3K5L A;  3CIP A;  4K25 A;  4BRI A;  5BRE A;  4E7H A;  4CGD A;  4FVM A;  4AM7 A;  3P1G A;  1HJO A;  1XNR K;  4Z4H A;  4CGJ A;  4FJ5 A;  4GKK K;  1JL1 A;  1J5E K;  3MK6 A;  3SUN A;  3QER A;  1ATS A;  2KKZ A;  1QS4 A;  3LM2 A;  3V1R A;  5J2N A;  3VEX A;  3TAM A;  2FLO A;  5FPE A;  1XI1 A;  3PV8 A;  3ZCM A;  2HND A;  3O08 A;  1R59 O;  3CC4 N;  1NK6 A;  3RR8 A;  3LZJ A;  1NLV A;  5CYM A;  4BR9 A;  2E6L A;  1J9A A;  4DQQ A;  4OPH A;  3SV3 A;  5KGX A;  4M63 C;  3KVG A;  4KRF A;  3R1X A;  4CHZ A;  1U6Z A;  4CHN A;  4JKG A;  4IOC L;  1ILY A;  1EWR A;  2O8B A;  1X3N A;  3CER A;  4AHC A;  2ZGZ A;  3I56 N;  3UKR B;  3ZYY X;  4BGB A;  4ICL A;  3TAQ A;  5F1X A;  3K5O A;  5BR9 A;  4FLU A;  2P51 A;  4O0J A;  4EIA A;  2KQ2 A;  2HBJ A;  1YVU A;  4B1V A;  4PKI A;  1WUA A;  3DJC A;  4EHU A;  3TAB A;  2A5X A;  4RWT A;  1BI4 B;  3DLL L;  1QHA A;  3CF5 L;  3L3V A;  1NBW A;  4O5B A;  2O8F B;  5HRR A;  3S3N A;  2PYJ A;  4F8R A;  2VYP A;  3G4S N;  2F96 A;  5FDL A;  4KH5 A;  1LW2 A;  4Y0W A;  1IG8 A;  4CIE A;  1QHT A;  3MDQ A;  5C10 A;  1OH8 A;  3SPY A;  3MMV A;  1KXP A;  4WE1 A;  4BRP A;  4EZ6 A;  3NE6 A;  3A5N C;  4DR1 K;  2X6N A;  3SNN A;  1JXB A;  4BRF A;  3A5M C;  4BC5 A;  1RTH A;  4FW1 A;  4DQR A;  2AJQ A;  2P9U A;  3HYF A;  4FWN A;  2YNF A;  4FYD A;  3UB5 A;  4H5T A;  1P8Z A;  4CI6 A;  4YOX A;  1DKG D;  1WB9 A;  2F8T A;  2CGK A;  1KVA A;  2DFE A;  4M42 A;  5BRF A;  1MA9 B;  4L3Q A;  1RFQ A;  1MU2 A;  4Z94 A;  3NGZ A;  3KK3 A;  2W41 A;  4KHU A;  3FR0 A;  2ZF5 O;  3OYD A;  3NF8 A;  4C8O A;  3P5J A;  2V7Z A;  5GIP A;  5AQR A;  4BDZ A;  4JI8 K;  3LDS A;  4PL8 A;  4KV8 A;  1WAF A;  3OYN A;  1SUQ A;  5EU7 A;  1IBL K;  4KTQ A;  2HVI A;  3KLH A;  1Q9Y A;  4JD2 B;  3V4I A;  3SQ1 A;  1RTI A;  2OPP A;  3TTD A;  3QNN A;  4JYA K;  3ZT2 A;  2W42 A;  2D0A A;  1WN7 A;  1UAX A;  1JLE A;  2ASM A;  4KHP K;  3O1W A;  5AQJ A;  3CJA A;  1YTA A;  1A5X A;  2ITG A;  1KAY A;  3CCQ N;  4KHN A;  1G99 A;  2IIR A;  4BRD A;  3H1V X;  3LM9 A;  3HP9 A;  1KLM A;  2OCE A;  3VEN A;  4DU1 A;  2VCP A;  3CCL N;  3NAE A;  4Q0B A;  2E4L A;  4CIF A;  3SUO A;  4CD3 A;  2YNG A;  5I42 A;  4H4O A;  3M6G A;  1RGI A;  4JHD A;  4OO1 J;  2GEL A;  4ELV A;  4H5W A;  5JVG L;  1C1C A;  4KHY A;  4LFC K;  2NRR A;  2P5O A;  1VSH A;  4M41 A;  3L6Q A;  3BZK A;  1SZ2 A;  4HVJ A;  4DV6 K;  4IOA L;  3UKR A;  4OX9 K;  4FJL A;  1GLE G;  3S9H A;  4JKD A;  2UUA K;  3V9Z A;  1I94 K;  3PX6 A;  1YJ9 N;  1JLC A;  4CJL A;  3SK3 A;  1HKG A;  3LDP A;  5EVZ A;  3SYZ A;  4JI4 K;  4DTU A;  3PSI A;  4CEF A;  2XHB A;  4BAC A;  4PY5 A;  1BI4 A;  4B9M A;  5LJW A;  1KAX A;  4DCH A;  2NRZ A;  4B1X B;  5M1O A;  4CF2 A;  3EO3 A;  3E9L A;  4ISF A;  4A5B A;  3ATU A;  1C0F A;  5DM6 L;  4E1M A;  4E7K A;  4FJH A;  3A0I X;  4FZX C;  1KQS M;  1K6Y A;  4CBW A;  3D7E O;  3SAF A;  3AAP A;  3GE1 A;  3OYF A;  5HL7 L;  3O9Q A;  1T03 A;  1VRT A;  3D45 A;  4EP5 A;  5JVH L;  1NGC A;  3Q7C A;  3ASM A;  4BWM A;  2GUP A;  5AJ3 K;  3M3Z A;  4FLV A;  3QFP A;  4FOE A;  3SQ4 A;  1ZC6 A;  4AF1 A;  1ZYQ A;  3ZLJ A;  5LMN K;  3CCS N;  4A2B A;  5M1P A;  3O3G A;  4RTF D;  4BRQ A;  1NNE A;  4DSK A;  4JI6 K;  2F4V K;  3VTI A;  2VWJ A;  4CEQ A;  3LPT A;  4WFA L;  1VQK N;  1ASW A;  3CCM N;  1OH5 A;  4IKF A;  5CYQ A;  5DK5 A;  5C42 A;  1OH7 A;  2X6S A;  2E88 A;  2P9I A;  1HNW K;  1XMO K;  3WQT A;  3M8R A;  3VGK A;  3KLF A;  1ZBU A;  4YOR A;  2DTU A;  3J80 O;  3BF3 A;  2ZQB A;  3K58 A;  4B9L A;  3P4I A;  2VQF K;  4RW7 A;  3ZSZ A;  1MWM A;  4A5A A;  4JD2 A;  1JLA A;  3VMF B;  3NH2 A;  2BAN A;  3H3N O;  4CER A;  3R3L A;  1SL0 A;  3CC7 N;  2WC9 A;  3THX B;  1VSL A;  1JCF A;  4CJP A;  2UYT A;  1HR0 K;  2G8U A;  1N8R O;  1TGO A;  1GLD G;  5HOO A;  2XO7 A;  3DLR A;  3AA5 X;  5AQI A;  4IDK A;  4RW6 A;  3QEV A;  4GKJ K;  1RDW X;  3U4L A;  2ZGY A;  3AVA A;  1JXE A;  2KLA A;  4DMN A;  2A1R A;  4X62 K;  2I7P A;  3VQ9 A;  1JKH A;  4C1N I;  1NWK A;  1TKD A;  4E19 A;  1NK7 A;  1ITG A;  2BGG A;  3CJ7 A;  3OYI A;  5HLF A;  2A41 A;  4O0I A;  3D2F B;  4B3O A;  3J8A A;  3TSQ A;  4HTU A;  4JRQ A;  3O1B A;  3HXM A;  3TU5 A;  2IVP A;  4N5S A;  1ZBF A;  1LW0 A;  1NKB A;  5HRP A;  3CFO A;  5JIC A;  3SQ2 A;  1N5Y A;  2VG6 A;  4XEI A;  3TR8 A;  4CK1 A;  3KKS A;  3P31 A;  4FJN A;  2IVO A;  3T1A A;  1GOA A;  4BRM A;  2IOC A;  3L8B A;  1NJI O;  2OA8 A;  3ZX0 A;  3VQ4 A;  4Z4G A;  1Z26 A;  3C94 A;  1SKW A;  3RMC A;  2HF4 A;  3A5L C;  3VER A;  1EET A;  4A2A A;  3SAG A;  3LDQ A;  3TTF A;  1OVY A;  2Q31 A;  4PUO A;  4DR3 K;  3QNO A;  4FJ7 A;  3VQ7 A;  1QVG M;  4ILH A;  3M8P A;  2XRI A;  1HPZ A;  4HUF A;  3TAP A;  2HHU A;  1BQM A;  5JS2 A;  3ISN C;  5KRS A;  2OAN A;  1B9F A;  4U7B A;  3EKU A;  3C0B A;  3F2K A;  3KD1 E;  2CH6 A;  3OS1 A;  2X78 A;  4DV4 K;  1KVC A;  1JLG A;  3V81 A;  3LAK A;  4BVO A;  4DQI A;  1TYQ B;  2FC0 A;  4LSN A;  3QB0 A;  4K8X A;  3VQP A;  4IFY A;  3LP2 A;  2P9N B;  1TKX A;  4E1J A;  4MLE A;  4B9T A;  3S3M A;  2I5J A;  3RMA A;  1RT2 A;  5M1F A;  4B1Y B;  5AFU H;  1VAZ A;  3ZT4 A;  5KPT A;  4FK2 A;  3OJS A;  4B9N A;  1WSH A;  1IKY A; 
#chains in the Genus database with same CATH homology
 1ZBL A;  4KPY A;  2HW3 A;  4CFB A;  3PX0 A;  4C8N A;  3P1G A;  1ASU A;  4Z4H A;  3LP1 A;  4OGC A;  4CGJ A;  3K57 A;  4FJ5 A;  1BQN A;  1JL1 A;  4DF4 A;  4FJI A;  4KI4 A;  2HVI A;  3SUN A;  3NH0 A;  4OPK A;  4KB1 A;  3QER A;  4W5T A;  1D5A A;  3SUP A;  4B9S A;  1QS4 A;  3V1R A;  3CQ8 A;  4KHW A;  4JS5 A;  1NOZ A;  1EXQ A;  5J2N A;  2QKB A;  4PQU A;  2YHB A;  1BIS A;  4Z0U A;  3TAM A;  4DS5 A;  3IG1 A;  1XI1 A;  5KRT A;  3PV8 A;  4M45 A;  3SPZ A;  1NK8 A;  3QIP A;  3ZCM A;  4FLW A;  1BHL A;  3DRR A;  2HND A;  3AVN A;  1QE1 A;  3DLH A;  4Z4E A;  3NHG A;  1J53 A;  1KTQ A;  3MXM A;  3PY8 A;  3KTQ A;  1B9D A;  4M3X A;  2FBX A;  4AHU A;  1NK6 A;  3U6F A;  3RR8 A;  3QLH A;  3LZJ A;  2HHQ A;  5K14 A;  5CYM A;  4F3T A;  1C0U A;  4IG3 A;  4CFC A;  3HPO A;  2E6L A;  1J9A A;  4DQQ A;  5I42 A;  2YNH A;  4M3T A;  3ALY A;  3SV3 A;  1RBU A;  2P5G A;  5JS1 A;  5KGX A;  1LAV A;  4I9Q A;  3RMB A;  1J54 A;  2WON A;  4KRF A;  1RBT A;  4CHZ A;  4CHN A;  3QO9 A;  4G1Q A;  4CF0 A;  3DI6 A;  4AHC A;  4FK0 A;  4OKK A;  4KHS A;  4E3S A;  4M3Y A;  4Q5V A;  1WSF A;  1D8Y A;  1DTT A;  4CJV A;  4W5Q A;  4FLY A;  4ICL A;  1GOB A;  3TAQ A;  3CM6 A;  4CJS A;  2RKI A;  3K5O A;  4FLU A;  5E41 A;  5J2P A;  2P51 A;  4LH5 A;  4O0J A;  4H8K A;  3LAL A;  4B9U A;  3QEW A;  4F2S A;  3HST B;  4O55 A;  2ATQ A;  3PO4 A;  4AH9 A;  2KQ2 A;  3V9X A;  4CEE A;  1YVU A;  4CJR A;  1BIU A;  1HNV A;  2FBT A;  2Z1I A;  3DLE A;  3M8Q A;  3DRS A;  3MXI A;  2HHX A;  2B5J A;  4OPJ A;  2HNY A;  1DLO A;  4ID5 A;  3TAB A;  1RT5 A;  2Y1J A;  1L3S A;  3NF7 A;  2YNI A;  3OYA A;  2QKK A;  1FKP A;  2HHW A;  1ASV A;  4CJQ A;  4LD0 A;  4DG1 A;  1BI4 B;  3L3U A;  1QSY A;  3LWM A;  1NJW A;  1S6P A;  5HRO A;  3L3V A;  4ZTJ A;  4O5B A;  5HRR A;  3SJJ A;  3S3N A;  2PYJ A;  4F8R A;  2ZE2 A;  1UA1 A;  2F96 A;  1HMV A;  1HNI A;  5FDL A;  3QEI A;  3RRH A;  1Q9X A;  1LW2 A;  3U3Y A;  1HQE A;  1S5J A;  4ZTF A;  1D9F A;  1SKS A;  3CYM A;  4M3W A;  4I2Q A;  4CEO A;  1VSF A;  4CIE A;  1QHT A;  1HQU A;  3KIO A;  3RRG A;  4E0D A;  4C8K A;  4AHV A;  4CHP A;  3SPY A;  1RCH A;  2FBV A;  4LSL A;  4HUG A;  4WE1 A;  4DFP A;  1ZBH A;  4CEB A;  1C6V A;  1KFS A;  4DFM A;  1RBR A;  3V1Q A;  4DF8 A;  3VQ5 A;  4EZ6 A;  3WNF A;  4BWJ A;  5HRN A;  3NE6 A;  2X6N A;  3NBP A;  3OYL A;  3SNN A;  3AVI A;  1JXB A;  4OLB A;  1RTH A;  4FW1 A;  1RT1 A;  4JS4 A;  3HP6 A;  4CGG A;  4NYF A;  4DQR A;  3HYF A;  3MAQ A;  2XY6 A;  2YNF A;  2AJQ A;  1U48 A;  1I3A A;  4DSE A;  4FYD A;  2HHT A;  4CHY A;  2NUB A;  3MEG A;  3BDP A;  3ITH A;  4FCY A;  4CJE A;  4KTZ A;  4CES A;  3AVF A;  4DSL A;  1TAU A;  1WSJ A;  3DOL A;  1RTD A;  4W5O A;  2F8T A;  1KVA A;  2WOM A;  1U45 A;  1A5V A;  4W5R A;  1TL1 A;  1T05 A;  2DFE A;  2D5R A;  4B8C A;  3V9W A;  4M42 A;  1IKV A;  2IS3 A;  4GW6 A;  1HYS A;  3AO3 A;  4AHS A;  1MU2 A;  3NGZ A;  3KK3 A;  4KHU A;  3A2F A;  2VWK A;  3NGI A;  3HL8 A;  5KGW A;  2B6A A;  3OYD A;  1VSJ A;  4CE9 A;  3CFP A;  3NF8 A;  1IG9 A;  4N56 A;  3WNE A;  4C8O A;  1CLQ A;  1RT7 A;  3AVB A;  3P5J A;  5HBM A;  1C0T A;  2GBZ A;  4BDZ A;  3OYG A;  1NJX A;  1S1X A;  4RW4 A;  4HUE A;  3TAE A;  3LDS A;  4DSJ A;  1VSI A;  3OJU A;  1SKR A;  4NCB A;  4KV8 A;  1WAF A;  3OYN A;  1SUQ A;  5EU7 A;  3RTV A;  4FJK A;  4DFJ A;  1U49 A;  4KTQ A;  3LP0 A;  3O4N A;  3ZT1 A;  3KLH A;  1Q9Y A;  2G8V A;  1NJZ A;  3V4I A;  5D3G A;  3SQ1 A;  1RTI A;  2OPP A;  4OJR A;  3OYC A;  3LZI A;  2KW4 A;  1LWC A;  3V9U A;  1X1P A;  3ZT2 A;  4CJW A;  3V6D A;  2W42 A;  2D0A A;  2G8F A;  1WN7 A;  4QCL A;  2B4J A;  1UAX A;  1NJY A;  1JLE A;  2OPS A;  1I39 A;  1BL3 A;  1YTA A;  1A5X A;  1R0A A;  2ITG A;  1FXX A;  2KFZ A;  4AIL C;  3B6P A;  3KLE A;  3EYZ A;  4KHN A;  2O4I A;  1RBV A;  1L3T A;  3LP3 A;  1NK4 A;  1RDC A;  4DQP A;  3O3F A;  5FRM A;  2OPQ A;  3RR7 A;  4CJ5 A;  1X9W A;  3I0S A;  3HP9 A;  3HPG A;  4OKE A;  1U47 A;  3OS2 A;  1CZB A;  1TVR A;  3AO1 A;  4KTW A;  1XHZ A;  4AHT A;  4BE0 A;  1NK5 A;  1KLM A;  1L3V A;  2G8I A;  4Q0B A;  4CGI A;  2BDP A;  4O44 A;  1XHX A;  3VQC A;  4DU1 A;  3L2Q A;  2XY5 A;  3HVT A;  2D0B A;  4MQ3 A;  3NAE A;  3NF9 A;  4FM1 A;  3VA3 A;  2X74 A;  3TAG A;  5FRN A;  1WLJ A;  2E4L A;  4CIF A;  3SUO A;  3HK2 A;  4DTR A;  1QQC A;  1XC9 A;  5SWM A;  4BDP A;  4OLA A;  1A5W A;  2EX3 A;  2YNG A;  4H4O A;  2YKN A;  3C95 A;  3PX4 A;  3JYT A;  2Q3S A;  2RPI A;  1VSK A;  3WNG A;  3HM9 A;  4DWI A;  1UA0 A;  4RW9 A;  3ZSQ A;  3ULD A;  4ELV A;  2HMI A;  3OVN A;  4O4G A;  1C1C A;  4F4K A;  4FJX A;  4KHY A;  1BGX T;  4E7J A;  1YT3 A;  2P5O A;  2QK9 A;  1VSH A;  4M41 A;  5KI6 A;  1JL2 A;  4CK2 A;  2IGI A;  3NH1 A;  4I2P A;  1EP4 A;  3FFI A;  1Y97 A;  2EHG A;  2G8W A;  4OKJ A;  4LY7 A;  4CHO A;  1U04 A;  3P83 D;  4AHR A;  4HVJ A;  1T8E A;  4FXD A;  1NKC A;  3VQD A;  4CF8 A;  1KFD A;  1U4B A;  4FJ9 A;  3AO2 A;  5C24 A;  4FJJ A;  3LAN A;  3ZSR A;  3O4Q A;  5J2M A;  3KK2 A;  4FJL A;  4RG8 A;  3S9H A;  3TWH A;  2JLE A;  4DSI A;  3V9Z A;  1S9G A;  3PX6 A;  3ZT0 A;  3O3H A;  1JLB A;  1JLC A;  1S1U A;  4CJL A;  1L5U A;  1VSD A;  1NK0 A;  4CJT A;  1QSS A;  1LAW A;  4BE2 A;  2VG5 A;  2HNZ A;  4CJ3 A;  4NCA A;  2KZM A;  4GVM A;  4PA1 A;  3KLI A;  1WSG A;  4OVL A;  3KK1 A;  4OGE A;  4EP4 A;  3SYZ A;  2ZD1 A;  3AO4 A;  1CZ9 A;  4DTU A;  3IRX A;  2F8S A;  4CEF A;  1UWB A;  2XHB A;  4BAC A;  4W5N A;  4PY5 A;  1BI4 A;  1O1W A;  4B9M A;  3DLG A;  3OYB A;  3TAN A;  3G0Z A;  5CZ1 A;  5J2Q A;  1TK8 A;  1ZBI A;  3OYH A;  1L3U A;  4CF2 A;  4HCB A;  4DU4 A;  4M3U A;  1VSM A;  3AVJ A;  2OZS A;  4FM2 A;  4ID1 A;  4C8M A;  3IAY A;  4E1M A;  4E7K A;  4Y1C A;  4FJH A;  1SV5 A;  5DMR A;  4FZX C;  1NOY A;  1K6Y A;  3EZ5 A;  4DTS A;  1S1T A;  3RMD A;  2D0C A;  2PZS A;  1RTJ A;  1BCO A;  3OYF A;  4Z4I A;  3NDK A;  1NKE A;  1T03 A;  4CJK A;  1VRT A;  3D45 A;  3G10 A;  4E1N A;  3NFA A;  4EP5 A;  4DU3 A;  1W9H A;  1WNS A;  1T7P A;  3ASM A;  3BGR A;  4IG0 A;  4BWM A;  3VN5 A;  3D0P A;  2IDO A;  4CFD A;  4KRE A;  4N76 A;  2GV9 A;  4FLV A;  3DLK A;  3MXJ A;  3VQB A;  1F21 A;  3L2V A;  4Y1D A;  2XY8 A;  2DFF A;  3NCI A;  3AO5 A;  3SQ4 A;  3K2P A;  1IKX A;  1C1A A;  4ZHR A;  3OS0 A;  1ZYQ A;  3F9K A;  3SV4 A;  3B6O A;  4NYN A;  3T3F A;  4L8R B;  3O3G A;  3VQ8 A;  3C6T A;  4IFV A;  3QET A;  1Z25 A;  2IAJ A;  3HVR A;  1VSE A;  4DSK A;  3QIN A;  2VWJ A;  4CEQ A;  3LPT A;  3L2W A;  4J2B A;  1ASW A;  3HPH A;  1KSP A;  1QTM A;  4IKF A;  5CYQ A;  5DK5 A;  1REV A;  1RT6 A;  3I0R A;  5C42 A;  2KFN A;  4M3Z A;  2X6S A;  4CF9 A;  1W0H A;  2OYQ A;  3M8R A;  1HYZ A;  1S1W A;  3DYA A;  3KLF A;  3QEX A;  1X9M A;  4NCG A;  1ZBU A;  1BCM A;  1JLQ A;  1TK5 A;  3HO1 A;  4DQS A;  2DTU A;  2ZQB A;  1IH7 A;  3CM5 A;  1HYV A;  4CHQ A;  1X9S A;  2Z1G A;  3K58 A;  4C8L A;  1LWF A;  3T19 A;  1N6Q A;  4B9L A;  3UIQ A;  4J2A A;  4N41 A;  2Y1I A;  3U3G A;  3ZSW A;  4RW7 A;  3TI0 A;  2DY4 A;  4E7L A;  3ZSZ A;  4DFK A;  3RWU A;  1HJR A;  5FRO A;  1JLA A;  3NH2 A;  4K8Z A;  2BAN A;  4CER A;  3AA3 A;  1SL0 A;  1RDD A;  4TSX A;  4B9V A;  1VSL A;  4CJP A;  1EKE A;  2OPR A;  1RDA A;  2G8U A;  3HJF A;  4DS4 A;  1TGO A;  4EZ9 A;  1J5O A;  3OYM A;  1SL1 A;  1KLN A;  1TV6 A;  3AVL A;  3DLR A;  3PUF A;  4YNQ A;  2XO7 A;  3TAR A;  3AA5 X;  5KTQ A;  4IDK A;  4RW6 A;  3QEV A;  4KB0 A;  1G15 A;  3AVA A;  2ETJ A;  1VRU A;  1RIL A;  3DMJ A;  4FLZ A;  1DTQ A;  4B08 A;  2HHV A;  1JXE A;  2E6M A;  4JLH A;  4LH4 A;  4CGF A;  3IS9 A;  3KJV A;  4DMN A;  3LPU A;  2A1R A;  2OZM A;  1TKT A;  4KFB A;  4E7I A;  1UOC A;  3VQ9 A;  1JKH A;  1LV5 A;  3AVG A;  3DOK A;  1FK9 A;  4KAZ A;  2HB5 A;  3VQA A;  1D9D A;  2G8K A;  3K59 A;  4DLE A;  2XY7 A;  1TKZ A;  4XIU A;  1TKD A;  4DTP A;  4Z4F A;  4E19 A;  3VA0 A;  2HHU A;  1NK7 A;  4M3R A;  1TK0 A;  1ITG A;  3KLG A;  4Z4C A;  2IC3 A;  4DSF A;  2BGG A;  3OYI A;  4DTM A;  5HLF A;  4KKO A;  1VK0 A;  3LAM A;  3SI6 A;  4O0I A;  3SCX A;  4CJU A;  1RDB A;  4B3O A;  1KVB A;  3HT3 A;  2YKM A;  4HTU A;  3M8S A;  3K5N A;  4FM0 A;  1GOC A;  2GUI A;  3K5M A;  4UQG A;  4JRQ A;  2A1S A;  3HXM A;  3QNN A;  5I3U A;  1C0M A;  3WNH A;  4R5P A;  4N5S A;  1WSE A;  1CXU A;  2DFH A;  1ZBF A;  1LW0 A;  1NKB A;  5HRP A;  5HRS A;  4QOZ B;  2HHS A;  2KZZ A;  3CFO A;  1TL3 A;  1RT3 A;  1WSI A;  4DLG A;  3SQ2 A;  4CJ4 A;  1N5Y A;  2VG6 A;  3MED A;  2R7Y A;  3CG7 A;  3AA2 A;  3TR8 A;  1KCF A;  2LSN A;  3KKS A;  4QAG A;  4CED A;  4CK1 A;  3NGY A;  4FJN A;  1RNH A;  3AVC A;  3MEC A;  3VQQ A;  4J2D A;  3T1A A;  4PWD A;  1HRH A;  4E89 A;  4KI6 A;  4CIG A;  3F73 A;  1GOA A;  2IOC A;  3S3O A;  4CEC A;  3L8B A;  4ELU A;  1Q8I A;  3DM2 A;  3JSM A;  2HVH A;  3ZSO A;  3OYJ A;  2OA8 A;  1JLF A;  4CCH A;  4H4M A;  3OYK A;  1B92 A;  2JGU A;  3PO5 A;  3VQ4 A;  4Z4G A;  1Z26 A;  4BE1 A;  1BIZ A;  1CXQ A;  3C94 A;  3QIO A;  4IBN A;  4MFB A;  5T7B A;  3C6U A;  3RMC A;  3L2U A;  1SKW A;  4HCC A;  2P1J A;  2G8H A;  4I7F A;  3SZ2 A;  3V1O A;  1EET A;  3ZSX A;  4CK3 A;  3QEP A;  1QSL A;  5C25 A;  4KO0 A;  3OYE A;  4FLT A;  3AVM A;  4F2R A;  4FJG A;  4DTX A;  4ELT A;  4PUO A;  4RW8 A;  2RN2 A;  3V9S A;  4CEA A;  3QNO A;  3L2R A;  3QES A;  4FJ7 A;  3VQ7 A;  1KRP A;  4DTO A;  4GMJ B;  3TAF A;  3M8P A;  2XRI A;  1HPZ A;  1RBS A;  3MEE A;  4HUF A;  1BQM A;  1IKW A;  5JS2 A;  3TAP A;  2PY5 A;  4KHQ A;  3AVH A;  3ISN C;  3NF6 A;  5KRS A;  5HP1 A;  1B9F A;  3E01 A;  3OY9 A;  5CZ2 A;  4FZZ A;  4CJF A;  2O4G A;  4FW2 A;  3SQ0 A;  3KD1 E;  3AVK A;  4BDY A;  3OS1 A;  1TAQ A;  4CF1 A;  1IO2 A;  2X78 A;  2KTQ A;  4YFU A;  4FK4 A;  1KVC A;  5J1E A;  1JLG A;  4FJM A;  3V81 A;  3LAK A;  4DQI A;  2FC0 A;  2Z1J A;  3ZSV A;  4LSN A;  1EX4 A;  3THV A;  5CY4 A;  4B8A B;  1LWE A;  1S6Q A;  4K8X A;  3VQP A;  4FLX A;  2VG7 A;  3CFR A;  1S9E A;  3AV9 A;  4IFY A;  1SL2 A;  3LP2 A;  4DTN A;  3SUQ A;  5SZT A;  2YHA A;  3ZSY A;  4F3O A;  2QXF A;  1TKX A;  2BE2 A;  1XWL A;  3I8D A;  1WAJ A;  1S1V A;  4I9L A;  1NK9 A;  4B9T A;  3KKR A;  3S3M A;  2I5J A;  1FKO A;  1RT2 A;  2Z1H A;  3RMA A;  3KD5 E;  4N47 A;  1RT4 A;  4FZY A;  3DLB A;  3AA4 A;  3EY1 A;  3ZT3 A;  3VQ6 A;  2YV0 X;  1C1B A;  4HHT A;  4J2E A;  3LWL A;  4CEZ A;  4DTJ A;  4FJ8 A;  3K5L A;  3ZT4 A;  4CGH A;  3OJS A;  4B9N A;  4FK2 A;  2RF2 A;  1WSH A;  2PYL A;  1YTU A;  4CFA A;  4E7H A;  2FBY A;  3VQE A;  4CGD A;  4FVM A;  1IKY A;  3DRP A;  4JRP A;  3H08 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...