3AVAA

Crystal structures of novel allosteric peptide inhibitors of hiv integrase in the ledgf binding site
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
154
structure length
150
Chain Sequence
SSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Recombination/inhibitor
molecule keywords Integrase
publication title Crystal structures of novel allosteric peptide inhibitors of HIV integrase identify new interactions at the LEDGF binding site.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
total genus 58
structure length 150
sequence length 154
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3avaA00
1SUQA 3VQAA 4PA1A 3OYFA 4B9NA 1IKYA 1O1WA 1TAQA 3NF8A 5C42A 4M41A 1S1WA 3KD5E 1RTJA 2PYLA 3KTQA 4CHYA 1X9MA 1VSHA 3ZT0A 4FJ5A 3ALYA 1Z26A 3RTVA 1HQUA 3NDKA 1VSEA 1HJRA 1IG9A 3CG7A 1ZBFA 3DMJA 4IG3A 3LAKA 3QNNA 3NCIA 4HUFA 1W0HA 3CM5A 3VQBA 1T03A 1D9DA 1NKCA 4L8RB 4CFDA 3TWHA 4O0IA 1EX4A 1Q8IA 1RT6A 5E41A 3S9HA 4B08A 1NJWA 3HPGA 3P5JA 1K6YA 3TAPA 3JYTA 3LP1A 3AA5X 3SPZA 1D5AA 1SV5A 4LH4A 4W5OA 3SCXA 1C1BA 5CYQA 1L3VA 3AVHA 1EKEA 1U45A 2Z1JA 4DF4A 1D8YA 1TAUA 4HTUA 1QE1A 4CJLA 1TKZA 1J5OA 3MXIA 3B6PA 4C8MA 1B9DA 1N5YA 3C6TA 3UIQA 2BE2A 3TAMA 2BGGA 1JLBA 3OYHA 3L3UA 1BI4A 3A2FA 1ASWA 4OKKA 3T19A 4BE1A 5CY4A 3TAQA 4W5NA 3KKRA 3AVNA 4JRPA 1VSKA 4FJ7A 3DRRA 4CECA 5SZTA 1KRPA 1RDCA 3LAMA 2VWKA 1BQNA 4CK3A 1S1UA 3VN5A 4CJFA 1TKXA 2WONA 4FM2A 4CCHA 1JLQA 4DQPA 3BGRA 4E89A 3M8QA 4CGGA 4HUEA 3ZSXA 4E1MA 5JS2A 4F2RA 1LWCA 3AVJA 1U49A 2E4LA 3O4NA 3ASMA 5CZ1A 3QEWA 5DK5A 2YNHA 3DLEA 3O3GA 4J2AA 2HVIA 4CERA 1L3TA 1TL3A 1VRTA 4NYFA 2OZSA 4YFUA 4BE0A 4FZXC 3QEIA 3OVNA 4KI6A 2AJQA 2Q3SA 4NCGA 3V9ZA 4DFKA 1WLJA 3OYKA 3IG1A 4CJWA 3SNNA 2BANA 5HLFA 4LD0A 2HHTA 3QLHA 4AHVA 1BGXT 3HL8A 2VWJA 4IKFA 4E7JA 4HCCA 4KHUA 2HHQA 2KW4A 3AVBA 1RT1A 3DLRA 3ZSOA 3L2WA 3QNOA 4EP5A 1WSIA 2VG5A 3C94A 4FM1A 1A5VA 1IH7A 1RDDA 5HROA 1REVA 4HCBA 3AO1A 2OZMA 4CEDA 4JS5A 3TABA 2GV9A 1YT3A 1TVRA 1NK4A 4CF2A 3LPTA 2KFNA 1JLFA 4FK0A 1XC9A 1S9GA 4BDZA 1C1CA 3FFIA 2ITGA 1RT3A 4H4OA 3MAQA 4ID1A 3I8DA 4EZ9A 2LSNA 2A1SA 3K5OA 2XY5A 4DU3A 5FDLA 3DOLA 1HYZA 2HHSA 4RW6A 2F8TA 4F4KA 4AILC 1NK0A 1F21A 3L8BA 3C95A 3SQ2A 3VA0A 2G8IA 4Z4CA 4DF8A 2P1JA 3MECA 1KLMA 5CZ2A 4CJ5A 3AVFA 3KK3A 1N6QA 4KV8A 3HP6A 1L5UA 4M3TA 3ZT2A 1LWEA 1B9FA 4CJUA 4DTOA 2DFHA 5J2NA 1ASVA 2KZZA 4DLEA 4N41A 3MEDA 4KREA 3V6DA 1IKXA 1RT2A 3DRSA 1ITGA 5FROA 2YHAA 1RTIA 4CHOA 1U04A 1BISA 5SWMA 4DTRA 4JLHA 4Y1DA 2ATQA 3HYFA 3NFAA 3ZCMA 4W5TA 5J2MA 4B9UA 4Y1CA 4CEZA 2HHWA 3M8SA 3KD1E 4BACA 4DFJA 3K59A 4QAGA 3D0PA 4DTNA 3SUNA 3HPOA 3RMBA 1QTMA 2OPQA 4BWJA 2D0CA 3DLHA 1XHXA 4M3UA 4FLVA 2BDPA 4LY7A 2XY8A 4E0DA 4OLBA 4DTSA 5J2QA 4DS5A 1GOBA 4CK1A 3SJJA 2RF2A 1QS4A 3VQEA 3V9SA 1NK8A 1NK6A 3KJVA 4CJQA 3OYGA 4C8KA 1SL2A 1Y97A 3ZSZA 4RW4A 1BI4B 3SYZA 1QSSA 4B3OA 4FYDA 4FVMA 2HB5A 3OYAA 3V1OA 3DYAA 3VQ7A 1RCHA 2EX3A 4M42A 2IS3A 5HBMA 1ZYQA 4KHNA 3VQ9A 1VSLA 4Z4FA 4O55A 1S1XA 4TSXA 4O0JA 4OGEA 3U6FA 3HPHA 4CIGA 4FLXA 3VQDA 3LP2A 2E6MA 3PUFA 3K5LA 3LZIA 4CF0A 4M3XA 1RT4A 3V4IA 4M3ZA 4KB1A 2XRIA 4FLTA 4CFCA 4CEOA 1X9SA 3WNGA 4FJ8A 3TR8A 1JL2A 1UA1A 1QSLA 4PQUA 2HW3A 2VG6A 4CESA 4KFBA 1LW0A 3I0SA 1W9HA 3F9KA 1VK0A 1LW2A 4DFPA 3ZSWA 1KFDA 2HNYA 4Z0UA 2G8FA 3SV3A 3D45A 3VQQA 3IS9A 4AHTA 4CJ4A 2Z1HA 2HHXA 1BCMA 3LDSA 3O3HA 1VSIA 1WSGA 3H08A 4CGJA 4DU4A 1QQCA 3HK2A 1HYSA 2DFFA 2X78A 3OJUA 1SL1A 4CF9A 2D5RA 4J2EA 3SUQA 3IRXA 5D3GA 5FRMA 1L3UA 1FXXA 1G15A 5T7BA 3RMCA 2NUBA 4KHSA 4QOZB 3K57A 4RW8A 5KTQA 4LSNA 4HVJA 2PY5A 4FJJA 4ZTJA 3V1QA 4FJNA 4OJRA 4AHRA 3DLBA 4PY5A 1RDAA 1WSFA 1YTAA 2ETJA 4NCBA 3K5NA 4Z4IA 2RKIA 2OPPA 4CJKA 4OKEA 3NH1A 3AVIA 3VA3A 4O44A 1C0TA 3KLGA 4GW6A 1HQEA 1Z25A 1BQMA 3SQ4A 4GVMA 4OVLA 3U3YA 3RWUA 1FKOA 1LAVA 3DRPA 3SPYA 4RW9A 1B92A 5HP1A 1Q9YA 5HRSA 4XIUA 2OYQA 4LH5A 3NHGA 4FK4A 3RR7A 3HVTA 2EHGA 4PUOA 2YKMA 2X74A 5KGXA 3DLGA 3PX0A 4I9QA 1IKWA 1TK8A 3KKSA 3CQ8A 2RPIA 1ASUA 3RRHA 4BE2A 3VQ5A 1XHZA 1SKSA 1L3SA 4DWIA 2KTQA 1D9FA 1A5XA 4FZZA 3HP9A 2G8KA 3QEVA 2Y1IA 3THVA 4RG8A 1NK9A 2G8VA 2KZMA 1XI1A 3S3OA 4DQRA 3MXJA 4KTZA 3I0RA 1WSHA 3DOKA 2YV0X 1X1PA 4F3TA 1T7PA 2HHVA 1HYVA 1TKTA 2DTUA 2XHBA 4KPYA 4PWDA 3WNFA 5FRNA 4IBNA 1WAJA 2X6SA 3ZSQA 3AVMA 2I5JA 3AVKA 2HNDA 2HMIA 4CHQA 4ICLA 3OYCA 1WSJA 4CGFA 4ZHRA 3LWLA 3AA2A 3DLKA 3ZT1A 4CK2A 3OYEA 3B6OA 2ZE2A 3G10A 1IO2A 3KLEA 3V9UA 3T3FA 5CYMA 4B9MA 1TV6A 4CHZA 3CFPA 4DQQA 4N5SA 3TAEA 4CHPA 1UOCA 3CM6A 2G8WA 1QHTA 4CFBA 3V81A 1JLAA 1JXEA 1RBSA 4KHYA 4Z4GA 4OPJA 2HHUA 1S1VA 3K2PA 3IAYA 3ZSRA 1RBTA 4C8OA 4FW2A 3QESA 3KLIA 4FJXA 3VQ8A 3QETA 3TAGA 2A1RA 4CJEA 3OYBA 4K8XA 4LSLA 2FBTA 3V9WA 3P83D 1S9EA 4B8CA 4KHWA 3TANA 4ELTA 3QO9A 2B6AA 3NE6A 4W5RA 5EU7A 4FJLA 2IDOA 4CEBA 2Y1JA 5KI6A 1KVCA 1MU2A 4GMJB 3HVRA 1ZBLA 4FLUA 3P1GA 4IFYA 4FLWA 1T05A 2G8UA 2QKBA 5J2PA 1LWFA 4KO0A 1BIUA 3HO1A 2JLEA 1KVAA 2D0AA 1I3AA 4I2QA 3AV9A 4KKOA 4CHNA 3M8RA 4CIFA 4KHQA 4B9LA 5KRTA 1RT7A 2VG7A 3DI6A 4FM0A 5JS1A 1SKWA 1VSMA 3ISNC 3OYLA 2DY4A 3KK1A 3HM9A 2OA8A 3QIPA 1HNIA 3SQ1A 3AO5A 3TI0A 4FJIA 2IC3A 4DLGA 1TK5A 3SV4A 4HHTA 4E7IA 3QEPA 1TKDA 3LP0A 4G1QA 3WNEA 1ZBIA 3AA3A 1RBUA 4OKJA 4OGCA 4CF8A 4CIEA 3K58A 4AHSA 1EETA 3LP3A 1S6PA 4DQSA 3QEXA 1CZ9A 1WN7A 1JL1A 3OS1A 3DM2A 2XY6A 3TARA 4QCLA 4H8KA 3OYIA 1S6QA 3G0ZA 4JRQA 3L2UA 3SUPA 3NGIA 5J1EA 3L3VA 2PZSA 1WNSA 3T1AA 1EP4A 2D0BA 4FLYA 4CJVA 1SKRA 2P5OA 1YTUA 4Q0BA 1I39A 4CJTA 1C0MA 4CE9A 4FJGA 4CJPA 3V9XA 1WSEA 2RN2A 1U48A 4FZYA 1NJYA 3OYDA 1FKPA 3CFRA 4F2SA 1CXQA 3ZSVA 4DSLA 1BCOA 4R5PA 1BL3A 3NAEA 1TK0A 4ELUA 1BHLA 1DTTA 3TAFA 2YNIA 1HMVA 4DTUA 2ZD1A 1VSJA 3KIOA 1LAWA 1KVBA 4Q5VA 4DMNA 3EZ5A 4AH9A 5HRPA 1UWBA 3NGZA 3PO4A 3ULDA 3OYJA 4DSEA 3HJFA 3LALA 1RILA 2FBXA 4FJMA 1CZBA 3MEGA 3NF7A 2YHBA 1VSDA 1TL1A 3HSTB 4F3OA 4KAZA 4KI4A 4M45A 3L2QA 3L2VA 2Z1IA 3LPUA 1RT5A 2FBVA 3OY9A 4FJHA 4FXDA 3LZJA 4C8NA 4KRFA 3NH2A 3HXMA 4Z4EA 2R7YA 3QINA 1YVUA 4W5QA 5HRRA 4E19A 1C6VA 4C8LA 3M8PA 1S5JA 4NYNA 3PV8A 3U3GA 1RTDA 1RDBA 2WOMA 2OPRA 4DTXA 1CLQA 3AA4A 4B9SA 1RTHA 2KFZA 4HUGA 1BIZA 3AVLA 1NKBA 4MQ3A 2B5JA 3BDPA 2QK9A 4B8AB 4I9LA 3AVCA 1KCFA 3SI6A 3HT3A 1KLNA 3S3MA 3SZ2A 4BDYA 4Z4HA 3RMAA 4AHUA 1UA0A 2G8HA 4E7KA 4FCYA 2JGUA 5HRNA 3ZT3A 4ZTFA 4J2DA 4ID5A 2XY7A 4CJ3A 1IKVA 3NF6A 3OS2A 1X9WA 1RNHA 3V1RA 4ELVA 4K8ZA 1HNVA 2P51A 4OPKA 4O4GA 2GBZA 3AVAA 4B9TA 1JLGA 3CFOA 4N56A 4DS4A 1U4BA 1NK7A 3RR8A 4DSJA 4DSKA 2E6LA 4CJRA 4IG0A 4E7LA 4CGDA 3E01A 4M3YA 3KK2A 4IDKA 1JXBA 1UAXA 2X6NA 2FBYA 4KTWA 3VQ6A 4CEAA 1SL0A 1QSYA 1KFSA 2O4IA 2QXFA 4I2PA 2QKKA 1TGOA 2XO7A 4CFAA 4CJSA 1WAFA 3S3NA 1NKEA 1XWLA 3QERA 4DTPA 3AO3A 3MEEA 3VQPA 4YNQA 2YKNA 1VRUA 5I42A 2OPSA 1J9AA 3AVGA 4I7FA 4CEEA 5C25A 4DU1A 3CYMA 1ZBUA 3PX6A 4FLZA 4MFBA 2ZQBA 2DFEA 3WNHA 2F96A 2O4GA 3NBPA 3ZSYA 4CGIA 1C0UA 4EP4A 3MXMA 1NJZA 2IAJA 4CEQA 4O5BA 3JSMA 1KSPA 1HRHA 1ZBHA 2W42A 3K5MA 1LV5A 3OYMA 2YNGA 2IOCA 3EYZA 1NOYA 3L2RA 3NH0A 4FJ9A 3ZT4A 1CXUA 5KRSA 2HNZA 1JLEA 1GOAA 5DMRA 3PO5A 4B9VA 4DQIA 2F8SA 5C24A 3OYNA 2FC0A 3SUOA 4BDPA 4DTJA 2KQ2A 1RBRA 1FK9A 4H4MA 4M3RA 2YNFA 3KLHA 4M3WA 5KGWA 3O4QA 1DLOA 3PX4A 4CF1A 3LANA 4DG1A 4E7HA 3RRGA 4N47A 3NGYA 5K14A 3VQ4A 4KB0A 2IGIA 1KTQA 2PYJA 1S1TA 4DSIA 2HVHA 3KLFA 3EY1A 4CEFA 4BWMA 3LWMA 1VSFA 4UQGA 1HPZA 1J53A 4J2BA 3NF9A 3F73A 4DSFA 1NK5A 2GUIA 4DFMA 1EXQA 1JKHA 4CGHA 1C1AA 4JS4A 3ITHA 4NCAA 3C6UA 3OJSA 1GOCA 4F8RA 5I3UA 4AHCA 1JLCA 1DTQA 3RMDA 4N76A 1J54A 3VQCA 4IFVA 1U47A 3PY8A 4KTQA 1NJXA 4EZ6A 3QIOA 2B4JA 1Q9XA 4FK2A 1NOZA 4FJKA 4E3SA 3O3FA 2P5GA 1A5WA 4OLAA 4FW1A 1RBVA 3OS0A 1R0AA 4WE1A 1T8EA 4RW7A 2Z1GA 3AO2A 3AO4A 3SQ0A 4DTMA 4E1NA
chains in the Genus database with same CATH superfamily
1SUQA 1NGEA 3A0IX 4GY2B 1IKYA 1O1WA 1RTJA 1X9MA 4FJ5A 2E8AA 5BPNA 4CZJA 3DMJA 2QA4N 1H1VA 4HUFA 1FJGK 4CFDA 3TU5A 1NLVA 4B08A 3P5JA 2P9LA 4BG8A 3HBTA 1SV5A 3AVHA 4QS8A 2Q2RA 4CJLA 3C7NB 3MXIA 4CZKA 5JLFA 1HR0K 2NRRA 2BE2A 2UUCK 5AQZA 1QVFM 3WXLA 1NGBA 3OYHA 3SMPA 3KWGA 1BI4A 2BGGA 1ASWA 1RFQA 4W5NA 5AQSA 2I7NA 1NGCA 2GUPA 3DRRA 4CECA 1KRPA 3LAMA 3MDQA 2VWKA 4IFEA 1BQNA 1J6ZA 4CJ7A 4CK3A 1S1UA 4CJFA 1TKXA 4FM2A 4MO4A 3THYB 1NGJA 4DQPA 3BGRA 3C6HA 4BR9A 4E89A 2VYPA 4JD2B 4X66K 4WFNL 2YNHA 4X65K 1TL3A 3GL1A 1YVNA 1GLLO 1NGFA 4CJWA 3SNNA 3EL2A 3MX5A 1QQOA 4LD0A 5GIPA 5HLFA 5AQKA 2HHTA 4X64K 1BGXT 3HL8A 3THXA 4E7JA 4IKFA 5FPDA 2KW4A 1RT1A 3DLRA 4K42A 4JN4A 3VETA 4M7YA 4HCBA 3AO1A 4JS5A 3TABA 2GV9A 2HMPA 2WUSA 3LPTA 4CBXA 2KFNA 1XC9A 4BDZA 1C1CA 3MAQA 3NVMA 3TTFA 4EZ9A 4FOEA 2A1SA 2VQFK 5FDLA 3J8AA 4GNIA 4JEPA 4K41A 1F21A 3L8BA 3C95A 3RVCA 5AQHA 4FSVA 2QEXN 1MWMA 2OTJN 1IG8A 4M3TA 1C0FA 3KVGA 1LWEA 4KBOA 1ASVA 4N41A 3L6QA 1IKXA 4F9OA 3CMAN 2OCEA 3O5BA 1YJWN 5CE3A 1RTIA 4CHOA 1HKGA 1BISA 5SWMA 4GV3A 3ENHA 4CD3A 2O8EB 5J2MA 4B9UA 4JV5K 3OTOK 2HHWA 4QAGA 2YI1A 3RMBA 2XY8A 4E0DA 5J2QA 1GOBA 2RF2A 1NK6A 1NNEA 3OYGA 3ZEUB 3ZSZA 3OYAA 3V1OA 3VQ7A 5M1FA 5HOOA 2V7YA 4WQ5C 4M42A 1VSLA 4Z4FA 4O55A 1S1XA 3DJCA 3HPHA 4CIGA 4M3XA 2ZJQL 4JKFA 4JHDB 4KB1A 4DR7K 2XRIA 3G25A 4GVEA 4CEOA 1WBBA 5HL7L 1P8ZA 2NRZA 3I33A 1VK0A 3SLCA 4Z0UA 3SV3A 4CJ4A 2Z1HA 1BCMA 5M1NA 3ZETB 5BR8K 4CGJA 1QQCA 4J2EA 4K43A 3F5TA 4YDUA 4LFAK 4OX9K 4CVNE 1WOQA 3V1QA 4AHRA 4ZTJA 3DLBA 5KPZA 1KAYA 1VAZA 1Q82O 4CW7B 2RKIA 2OPPA 3LDOA 1M90O 3AVIA 1TUUA 3SQ4A 4DV5K 1FKOA 4YOYA 5BN8A 4RW9A 5C12A 3LDNA 5HRSA 3RR7A 5KGXA 3PX0A 3CJBA 4MLEA 1D9FA 2E2QA 3K0SA 2Y1IA 3THVA 4BR4A 1X9JA 3MN6A 1TKTA 2XHBA 3MWTA 3PIPL 4PWDA 2X6SA 5AQNA 4YOWA 2I5JA 4CHQA 4ICLA 4M7XA 1GLFO 3LWLA 2ITMA 3DLKA 5B8HA 4CK2A 2ZE2A 3G10A 1IO2A 5C15A 2QI2A 5CYMA 2VGNA 2KKZA 3WQTA 4N5SA 4DQQA 3R3LA 3CM6A 1QHTA 4A2AA 3V81A 4GV9A 1JLAA 1RBSA 4KHYA 5ADXA 2HHUA 3IAYA 4C8OA 4I6MA 3ZX0A 1VQPN 3VQ8A 3QETA 4K8XA 3VGMA 3P83D 4BC3A 3TANA 4G9ZA 3H45C 2QKBA 3P1GA 5EXWA 3OHRA 2G8UA 3WXJA 4CHNA 4KKOA 3AV9A 3MN5A 3M8RA 4KHQA 2VG7A 3ZX3A 5JS1A 1SKWA 2DY4A 3ISNC 3OYLA 3KK1A 3C6AA 3HM9A 1TYQA 2NRTA 5AQWA 2IC3A 1OH8A 5AZIB 4YHHK 4G1QA 1TKDA 1GLJO 1ZBIA 3QFUA 3KK7A 4H5RA 2O8CA 3G0ZA 3L2UA 4BY9C 5GAHP 3JS6A 3NGIA 2PZSA 3VTHA 3PSIA 3T1AA 1SKRA 1ATRA 5AQYA 4RWTA 1I39A 2GEMA 4CE9A 3UKUB 1U48A 1NJYA 5AQIA 1FKPA 3ZSVA 2O8BB 3AARA 2YX6A 3M1FA 1TK0A 4ELUA 3LDQA 1HMVA 4DR1K 3PO4A 3NGZA 1UWBA 2KHOA 1W7AA 5GINA 4H03B 2CGLA 1CZBA 1M1KO 4F3OA 1VSDA 3HSTB 4BR0A 2VQEK 4KI4A 4FWNA 3L2VA 1SAZA 3LPUA 4FXDA 2P9SA 2E1ZA 4C8NA 3NH2A 2R7YA 3QINA 4W5QA 1C6VA 3M8PA 3PV8A 2ZWHA 1RTDA 3D6RA 2WOMA 2P9PA 1WUAA 1BIZA 3AVLA 4A2BA 2GTDA 4MQ3A 1NKBA 5AQPA 1KCFA 1NGAA 3HT3A 3RMAA 1TUYA 4DB3A 4FCYA 4JHDA 2RE2A 3ZT3A 4J8FA 2XY7A 5CR4A 4ELVA 3NVKA 2F7TA 2P51A 1VQMN 4O4GA 3CFOA 4N56A 3FZMA 4E7LA 4IG0A 4CGDA 3D2EB 5CHIA 1QSYA 4CEAA 3QFPA 2O4IA 4EIAA 3BUZB 2QXFA 2QKKA 1TGOA 4JI5K 3ZETA 1NKEA 1WAFA 3O80A 4IDHA 1KFSA 5I42A 4I7FA 3DWLA 3E1YA 3PX6A 4MFBA 3ZSYA 2DFEA 2O4GA 3DXMA 4CGIA 4CEQA 2YNGA 3EYZA 3L2RA 3VGLA 3E9PA 3ID8A 3KHYA 1JLEA 1GOAA 2HBMA 2AA4A 3SUOA 3AAQA 3BZKA 2YNFA 4UY8O 1K8KA 3KLHA 4M3WA 1DLOA 4FWOA 1S1TA 3TTDA 3O9TA 2HVHA 3O9QA 3LWMA 4BWMA 1J53A 4J2BA 4YOTA 1NK5A 4DFMA 3U8XA 2WFBA 1JLCA 2Q0RA 3D7EO 3MX2A 3QBWA 3G6EN 4BRIA 5MLCQ 3QIOA 5AFUH 3O3FA 4O8KA 3OS0A 4H0PA 4RW7A 1JCFA 1T8EA 5JMVA 1QQMA 4IEEA 4E1NA 5JICA 3OYFA 4BREA 1TAQA 3NF8A 5C42A 4YOUA 2PYLA 1VSHA 5AZJA 4GV6A 1HQUA 2UUAK 4NO7A 1VSEA 1HJRA 1BWFO 3NCIA 1W0HA 3CM5A 2P9KB 2ASOA 1Q8IA 4O0IA 3S9HA 1NJWA 1WB9A 3MCAB 4NLCA 3MMVA 3JYTA 3LP1A 1D5AA 3CQYA 5CYQA 2D4WA 3A5LC 3BZCA 1CZAN 4HTUA 4JNEA 1N5YA 3B6PA 3MCPA 1HKBA 5AJ3K 3TAMA 2KLAA 2ZM6K 4OKKA 5AQQA 3KKRA 3AVNA 4JRPA 5BREA 1JLQA 3ZSXA 4U7BA 5A2QO 1U49A 3O4NA 5CZ1A 5DK5A 5KPTA 3UKUA 2HVIA 3AAPA 4CERA 1VQLN 3J81O 4XH4A 1VRTA 3CJ7A 4YFUA 3DAWA 3OVNA 2AJQA 1YHQN 3IG1A 2BANA 4BRAA 3QLHA 4AHVA 4HCCA 3PSFA 1W97L 3ZSOA 5IWAK 4BQLA 4EP5A 3C94A 1IH7A 1RDDA 5HROA 2D1KA 2OZMA 4FK0A 3CJ9A 1S9GA 3EZWA 3FFIA 4H4OA 1XC3A 3I8DA 2WTUA 1Z05A 3K5OA 2IIRA 3H46O 1HYZA 2HHSA 4IOXA 5KQ8A 4AILC 1G99A 1LOTB 2J4RA 3VA0A 4Z4CA 3KWIA 3M6GA 4CJ5A 1N6QA 2P9NA 2NRWA 4QS9A 1ILYA 3EE9A 4BG9A 2KZZA 1P90A 3F2KA 2F4VK 3J80O 5LJWA 3MK6A 1NBWA 5JVGL 4DTRA 3CC7N 3D2EA 3EN9A 4Y1DA 1MWKA 4JI7K 4IXCA 4Y1CA 3H1VX 3M8SA 2QWMA 1N34K 3SUNA 4DTNA 2O8FB 3HM8A 1QTMA 2OPQA 1IBKK 2ZF5O 4FLVA 3CPWM 3A8YA 4DTSA 4DS5A 1FW6A 1NJIO 4BC4A 3SJJA 3VQEA 1LCUA 1T3VA 3KJVA 3G71N 4C8KA 1BA0A 3SYZA 4B3OA 4FYDA 2HB5A 3WXMB 1ZYQA 4JK7A 4TSXA 3CD6N 4DQ8A 3VQDA 3LP2A 3K5LA 2OANA 4CF0A 1RT4A 3V4IA 4FJ8A 3GG4A 3TR8A 2HW3A 2YHWA 5C0YA 4CESA 1LW0A 3I0SA 5M1QA 1W9HA 3F9KA 1LW2A 4BVPA 1KFDA 4FL9A 2G8FA 3D45A 3QBXA 5LY3A 3O3HA 4DV7K 4B1YB 1HYSA 2X78A 3UB5A 1SL1A 2D5RA 2P9IB 2QWNA 3A5MC 3IRXA 4GKJK 1FXXA 5T7BA 3RMCA 4KHSA 2ASMA 2NUBA 4QOZB 3K57A 5KTQA 1W2BM 4FJJA 3P38A 2A3ZA 1WSFA 3VF6A 1YTAA 2ETJA 4DV6K 4Z4IA 2FLOA 3NH1A 4O44A 4GW6A 3CQXA 1HQEA 1Z25A 3ATVA 1NGHA 1SZ2A 4BRNA 3DRPA 1YXQA 4XIUA 4CZHA 1YAGA 4FK4A 4DR2K 4JKDA 2RPIA 2V51B 5M1OA 1SKSA 1L3SA 4DWIA 3H1QA 1A5XA 3HP9A 2G8KA 1XQSC 4KH5A 4RG8A 1NK9A 2KZMA 3O9SA 1NMNA 3S3OA 4BGAA 4BROA 1T7PA 2HHVA 1HYVA 1VQKN 3D2FA 3IFRA 4KPYA 5FRNA 3VGKA 3AVMA 2HNDA 4FWQA 1WSJA 3AY9A 3AA2A 3ZT1A 3HI0A 3T3FA 2PAVA 3TAEA 1MDUB 1UOCA 4BRKA 4JKBA 4RCHA 2G8WA 4CFBA 5BRDA 3R8EA 4H5WA 1EWRA 3K2PA 3ZSRA 5AQJA 4FWSA 1J5EK 3TAGA 1NGGA 3O08A 3L4QA 4KHWA 4ELTA 3QO9A 3NE6A 5EU7A 1JCGA 4A62A 3BY5A 2Y1JA 1R0AA 4FVUA 4GMJB 3HVRA 2IVPA 1LWFA 2PBDA 3HO1A 4R79A 4JKCA 3QMLA 4B9LA 2ASPA 4ILJA 3JAMO 5H1SQ 3BF1A 1N32K 3SQ1A 4E7IA 3LP0A 1BDGA 1RBUA 4CF8A 3K58A 3QEXA 1EETA 3T1YK 1S6PA 2XY6A 3TARA 1MA9B 1WN7A 3OS1A 3EE8A 4H8KA 4FLYA 1EP4A 2D0BA 3J7ZO 3BF3A 3H3OB 4CJTA 1C0MA 2ZGZA 1GLAG 3V9XA 3OYDA 1T6CA 4F2SA 1CXQA 4DSLA 3HOTA 1BL3A 3NAEA 5AFUA 1DTTA 3TAFA 2YNIA 3KIOA 1KVBA 3ZX2A 5HRPA 3K9JA 1ATSA 3HJFA 3ENOA 4FJMA 2YJEA 3NF7A 2YHBA 1S22A 2NLXA 3L2QA 1IBLK 4FJHA 1Q86O 3LZJA 1YVUA 1VQ5N 3L0QA 3U3GA 4DTXA 1RTHA 2KFZA 2B5JA 2UU9K 3BDPA 2QK9A 3AVCA 1KLNA 1S3XA 4BDYA 2JWKA 1UA0A 1ZC6A 5HRNA 3N4QA 4ID5A 1IKVA 3NF6A 4K8ZA 5GAEP 2FF6A 4WYBA 4B9TA 1U4BA 3RR8A 1NK7A 4DSJA 4DKWA 4FWRA 4CJRA 3E01A 4M3YA 4IDKA 3LM2A 3CIPA 3C7NA 4EHTA 2XO7A 3DXKB 3S3NA 2GWJA 4DTPA 3VQPA 1VRUA 2OPSA 4CEEA 3CYMA 1K9MO 3IKMA 4Y0WA 1Q81O 3NBPA 3TSUA 3THYA 1KSPA 1C0UA 4DQIA 2IAJA 2YJFA 3JSMA 4DUYK 4K0KK 2W42A 1LV5A 1NOYA 4JD2A 3ZT4A 1HLUA 3PO5A 3CMEN 1EO1A 2F8SA 5C24A 5AQOA 5BRFA 2FC0A 3OYNA 2E2OA 4PKGA 4DTJA 2IVOA 4OPHA 1FK9A 4FWMA 2Q31A 4M3RA 2YCHA 5F0XA 5KGWA 2V52B 4DG1A 3LANA 3RRGA 3KLFA 3EY1A 4CEFA 2HHHK 1VSFA 1HPZA 3E9LA 2NZTA 4B1UB 4DSFA 1Y64A 1EXQA 4CGHA 4CZEA 4JS4A 4JI0K 4NCAA 3C6UA 1DGKN 5I3UA 2D0PA 2BUPA 3HSCA 3KZBA 4N76A 4IFVA 3VF4A 4EZ6A 3HOSA 1NOZA 3UKRB 3FGUA 5DM6L 2QWRA 4OLAA 4FW1A 4CD1A 1RBVA 1HNZK 4WE1A 1OH5A 4FJNA 5FPEA 3VQAA 2ZJPL 3CPEA 4KH4A 1S1WA 4DHYA 3KD5E 3KTQA 3EKSA 2IVNA 3ZT0A 4YY3K 3CCQN 3ALYA 3RTVA 3NDKA 1IBMK 1ZBFA 1QQNA 4XEIA 4L8RB 1D9DA 3W0LA 5E41A 4PKIA 2O8EA 4BR7A 3HPGA 1K6YA 3TAPA 1KAXA 1SQKA 3O9UA 5DM7L 4LH4A 1C1BA 2QM1A 1L3VA 1U45A 2Z1JA 1ATNA 1D8YA 1TAUA 3VERA 5FPNA 3VF2A 1J5OA 2P9UB 3ZEUA 1JLBA 3L3UA 3T19A 3HTVA 4BE1A 5M1KA 4FJ7A 1VSKA 5SZTA 4LF7K 1HUXA 4IJNA 2BTFA 4CCHA 2E88A 2Q0UA 3M8QA 4HUEA 3AVJA 4DV4K 2EWSA 3ASMA 3QEWA 3O3GA 4B3TK 2NRVA 2OZSA 2QWPA 4BE0A 3CCLN 3QEIA 4KI6A 5GAGP 2E1YA 3V9ZA 1DKGD 1WLJA 1HPMA 5AQTA 5KPRA 1E3MA 2VWJA 2VCPA 1NWKA 3DLLL 2AP1A 3CCRN 3AVBA 4ISEA 3L2WA 1HNXK 3QNOA 1WSIA 2VG5A 4FM1A 4LFCK 5C2DA 5GADP 1VQ7N 5FLXO 1U2VB 1TVRA 1NK4A 4MLHA 1JLFA 2NRHA 3THWB 5JVHL 3Q7CA 2ITGA 4CBWA 3FZLA 1O13A 2LSNA 4XH5A 4DV2K 3TTCA 4DU3A 5KQDA 4RW6A 4F4KA 3FLCO 3EEQA 4YDUC 2Q97A 3T7ZA 2G8IA 3I8BA 5AQFA 2P1JA 3MECA 1KLMA 5CZ2A 3AVFA 1L5UA 5GIOA 1B9FA 2DFHA 3L4IA 3MEDA 4MDBA 3V6DA 1RT2A 3DRSA 2YHAA 1U04A 2FSNA 5BR9A 4JLHA 4LC9B 4O5FA 3NFAA 1YF5L 3ZCMA 2Q1NA 4W5TA 3PIOL 2P9LB 4CEZA 4JKAA 4DFJA 3D0PA 3HPOA 1Q7YO 2D0CA 1HKCA 2BDPA 1IJJA 4CK1A 1QS4A 3V9SA 1NK8A 1BO5O 4CJQA 1Y97A 4RW4A 1BI4B 4FVMA 2W6KA 1DT9A 1RCHA 2IS3A 3T69A 4JKGB 2CGKA 4O0JA 3LZIA 1D4XA 1XNQK 1XMOK 4FLTA 4CFCA 1X9SA 1NM1A 4PQUA 4YORA 1JL2A 1UA1A 1OH6A 3EO3A 2VG6A 4KFBA 4ISGA 2NRXA 3IMXA 4DFPA 2HNYA 4BC5A 2HHXA 3LDSA 4X62K 4H5NA 1WSGA 3THXB 3HK2A 5AZIA 2QWLA 2BH1A 1L3UA 5FRMA 3SAGA 1QZ6A 4PY5A 5C10A 3TSQA 4C23A 4YOXA 3CCEN 3K5NA 4CJKA 4IEIA 4QS7A 4OKEA 3IUCA 3VA3A 1YJ9N 4CZFA 3N4PA 4GVMA 2O8BA 1KAZA 3FR0A 1B92A 3FZHA 3NHGA 5JLHA 3HVTA 3TSPA 2YKMA 2X74A 1IKWA 1TK8A 3CQ8A 1BUPA 1ASUA 4BC2A 4BE2A 3VQ5A 2KTQA 3OBWA 3QEVA 2A6AA 2G8VA 1XI1A 2UXBK 3MXJA 4KTZA 1WSHA 1OH7A 1X1PA 3H3NO 3ID6A 5ADXH 1WAJA 2P9UA 2HMIA 4Z94A 4WQ5A 3CJ1A 3OYCA 3O1BA 4JK9A 4PL8A 3J7AP 3OYEA 3KLEA 3V9UA 3B6OA 1HJOA 3VOVA 4B9MA 3J7YP 3VEXA 4JAXA 5ELZA 4CHPA 3P39A 1JXEA 2OTLN 4OPJA 2F9WA 1R59O 1RBTA 4FW2A 3QESA 2YHXA 4JI8K 3KLIA 1KQSM 4FJXA 2A1RA 4PHTX 4CJEA 3GOIA 4BR2A 4LSLA 2FBTA 4EAHD 3OYBA 3V9WA 4IOAL 4LF4K 2B6AA 4FJLA 2IDOA 4CEBA 3CCSN 4DR5K 1ZBLA 5J2PA 3LL3A 2JLEA 1KVAA 2D0AA 1I3AA 4I2QA 4CIFA 3DI6A 3SBGA 4FM0A 1VSMA 3SBTA 4LF8K 4FWPA 2A42A 2OA8A 3QIPA 1I94K 4DLGA 1TK5A 2E2PA 3LM9A 3QEPA 3WNEA 3SMSA 4BRPA 3MN7A 4RTFD 1NU0A 5BRHA 4OGCA 4CIEA 3OA9A 4DQSA 4AHSA 3PX4A 4WF9L 4QCLA 1T6DA 2FXUA 1N36K 1S6QA 3BEXA 1WNSA 4Q0BA 4CJVA 4CZLA 3U9ZA 4JI1K 4FJGA 4CJPA 2A41A 2RN2A 1K8AO 1DEJA 1BCOA 4R5PA 4BR5A 1BHLA 5EY4A 2H3GX 3HZ6A 4DTUA 1VSJA 4Q5VA 4AH9A 3CCUN 4FPAA 3ULDA 4DSEA 1RILA 1XNRK 3MEGA 2WC9A 1BOTO 3WQUA 1TL1A 1KXPA 1T44A 2NNWA 3WT0A 4M45A 4CZMA 2Z1IA 4K25A 2FBVA 4PL7A 4NXMK 4WQ4C 2VWBA 4H5VA 3HXMA 3F9MA 5HRRA 4DV3K 4C8LA 4IJAA 3R9PA 1K73O 2OPRA 1CLQA 4XH1A 3AA4A 4B9SA 3I55N 2QTDA 3GDQA 5FPMA 1EQYA 1KD1O 4JKGA 4I9LA 3S3MA 1E4GT 2P9KA 1GLDG 4AHUA 3ATUA 2UUBK 2JGUA 3U9DA 3OS2A 1X9WA 3V1RA 2QW9A 3BP8A 4I6MB 2GBZA 3AVAA 1JLGA 4DS4A 5E26A 5AQGA 3CI5A 1VQ6N 1SL0A 1UAXA 2X6NA 2FBYA 4KTWA 4H0OA 4O8UA 1QZ5A 3FFKB 4I2PA 4AQYK 3VTIA 4DCHA 4CJSA 1YIJN 1XWLA 1ZBSA 3MEEA 4B1XB 2WBNA 3VENA 3CETA 4WCEL 4NXNK 4DU1A 1ZBUA 3H6EA 5AQUA 1V4TA 4FLZA 3WNHA 4BGBA 2F96A 1NJZA 1TYQB 3K5MA 3O9RA 1NG9A 3OYMA 3CC2N 2IOCA 1X3NA 4FJ9A 5AQLA 2YHYA 1CXUA 2I7PA 4HWIA 5KRSA 1N8RO 2HNZA 5DMRA 4B9VA 2ZJRL 3O6WA 2O8CB 4BDPA 4DV0K 1VQON 2KQ2A 3WXKA 4E7HA 2HF3A 4N47A 2UXDK 4KB0A 2F9TA 1KTQA 4KHPK 4IOCL 1VQ4N 1YI2N 3NF9A 3F73A 4A61A 4B3MK 3OJSA 4F8RA 1V4SA 3VMFB 1J54A 4KTQA 1U47A 3PY8A 3JXUA 4IZ9A 5IT9O 3ZYYX 4DR3K 2B4JA 2QXLA 4CBUA 1Q9XA 4FK2A 3SAFA 4E3SA 1A5WA 3SQ0A 3AO2A 3AO4A 2P9SB 4FZYA 4DTMA 1C0GA 4JI2K 4PA1A 4B9NA 4ISFA 5AQVA 4M41A 3A5NC 4CHYA 2V7ZA 2P9PB 4CI6A 1Z26A 2A40A 4AF1A 1IG9A 3SK3A 3CG7A 4NLBA 5TKYA 4IG3A 1WBDA 3LAKA 3QNNA 4OPAA 1U6ZA 1T03A 3VQBA 1NKCA 3TWHA 1EX4A 1RT6A 3VEWA 3AA5X 3SPZA 1RGIA 4W5OA 3SCXA 4C1NI 1VQ9N 2O8FA 1EKEA 1RDWX 4DF4A 1QE1A 1TKZA 4HTLA 4C8MA 4AM6A 1B9DA 3IDHA 3C6TA 3UIQA 2CH6A 1YUWA 1GLCG 3A2FA 3CCJN 5CY4A 3TAQA 1RDCA 3TPQA 3VN5A 4M63C 2GX9A 2WONA 5AR0A 4BRGA 3DXMB 3QICA 2D0OA 3CJAA 4JI6K 4CGGA 4E1MA 4FO0A 5JS2A 4F2RA 1LWCA 1XUPO 1IV0A 2E4LA 4ILHA 1ZXOA 3DLEA 4J2AA 1L3TA 4NYFA 3VEZA 4H0XB 4FZXC 2Q3SA 1OVQA 4NCGA 4DFKA 4CZIA 3OYKA 1K8KB 4DR4K 1Z6RA 4BRDA 2GWKA 4KHUA 2HHQA 4PKHA 3RSEB 4B3SK 2P9IA 2HBJA 1A5VA 1REVA 2PFUA 3QDKA 4CEDA 1OKJA 1YT3A 5BPMA 4CF2A 1RT3A 2RHKA 5EX5A 4ID1A 2FSKA 2CGJA 2XY5A 2HSTA 3DOLA 3SAHA 2F8TA 2W6LA 1NK0A 4A57A 5LMUK 3SQ2A 4DF8A 3EKUA 3KK3A 4KV8A 3HP6A 3ZT2A 4CJUA 5AZJB 4DTOA 5J2NA 4BRHA 4DLEA 4KREA 4BRQA 1ITGA 5FROA 4A59A 3E66A 4IWVA 1YITN 2ATQA 3HYFA 4B1ZA 3KD1E 2HF4A 4BACA 3K59A 1X3MA 4BWJA 1QHAA 3DLHA 1XHXA 4M3UA 5I9EB 3ZLJA 4LY7A 4OLBA 3OW2M 2HBLA 1KC8O 4H5TA 4B1WB 1SL2A 4FPBA 1QSSA 1BA1A 3DYAA 2EX3A 3NMUA 5HBMA 4KHNA 3VQ9A 3B8AX 3VEOA 4OGEA 3VEYA 3U6FA 4FLXA 2E6MA 3PUFA 4M3ZA 2JWLA 3WNGA 1QSLA 1VQNN 4H0TB 1OVYA 3ZSWA 4WFBL 3VEVA 3VQQA 3A5OC 3IS9A 4AHTA 3FZKA 3GBTA 5LL6Z 1VSIA 3H08A 4DU4A 3O8MA 2DFFA 3OJUA 4CF9A 3SUQA 3MN9A 5D3GA 1G15A 3FE1A 1HNWK 3CCMN 4RW8A 4LSNA 4HVJA 2PY5A 5LMNK 4OJRA 1RDAA 4B9QA 4NCBA 1C0TA 3KLGA 3CXCM 1BQMA 4OVLA 3ULEB 3U3YA 3RWUA 1LAVA 2W41A 3SPYA 1GLBG 5HP1A 1Q9YA 1VQ8N 1XMQK 1N33K 2OYQA 4LH5A 3LDPA 5BPLA 2EHGA 3Q7BA 4PUOA 3DLGA 3S41A 4I9QA 3KKSA 2P9NB 3CJCA 5TKWA 3RRHA 1XHZA 3R6MA 4FZZA 5C2FA 4DQRA 2O8DB 3C65A 3I0RA 3DOKA 2YV0X 4F3TA 2DTUA 3WNFA 4IBNA 4DV1K 3ZSQA 3AVKA 5AQRA 4C1NK 1HX1A 4JKHA 2HOEA 4CGFA 4ZHRA 3WEEB 1TV6A 4CHZA 3CFPA 3GE1A 4Z4GA 4A5BA 3VESA 4FOIA 4H0YB 1S1VA 1RDUA 4JI4K 1E4FT 3AGKA 2CH5A 1ESVA 2W40A 3CERA 1S9EA 4E1JA 1NGDA 4ILGB 4B8CA 4W5RA 3VPZA 5KI6A 1KVCA 1MU2A 3DXKA 1T05A 4EHUA 3I56N 4BQZA 4IFYA 4FLWA 4FLUA 4KO0A 1BIUA 3ENBA 5AQMA 3RSEA 5EOYA 1RT7A 5KRTA 1JCEA 1VHXA 4WQ4A 3OBYA 1JJ2M 1HNIA 3AO5A 3TI0A 2VGMA 4FJIA 3SV4A 4HHTA 5M1PA 4A5AA 3FZFA 2FF3B 3AA3A 4DSIA 4OKJA 2A5XA 3LP3A 4BVOA 1CZ9A 3O1WA 1JL1A 3DM2A 3WUHA 2QWOA 3O4WA 3OYIA 4JRQA 3SUPA 5J1EA 3L3VA 3M3ZA 2P5OA 3K9KA 1YTUA 4H0VB 4BRMA 1WSEA 4JK8A 4MO5A 5F2RA 3CFRA 4WFAL 1EWQA 4IO9L 2ZD1A 1LAWA 3EZ5A 4DMNA 2UXCK 3OYJA 1BU6O 4KH6A 3LALA 2E20A 2FBXA 4BRCA 4LF6K 2E5LK 3UKRA 4KAZA 5LJVA 2HBKA 1RT5A 4BRFA 3OY9A 1NMDA 3HRGA 3SJHA 4KRFA 3T1HK 4Z4EA 2FSJA 3D2FB 4E19A 3MWPA 3CCVN 1S5JA 4NYNA 3CF5L 1QVGM 4FWKA 1RDBA 1Q18A 3C0BA 4HUGA 1BG3A 3U4LA 4IO8A 4LF5K 5AQXA 4B8AB 3SI6A 3SZ2A 4Z4HA 1SS6A 4E7KA 4EFHA 2G8HA 4ZTFA 4J2DA 4BRLA 4CJ3A 3P31A 1RNHA 1HNVA 3QB0A 3W3DA 4OPKA 3LDLA 5E84A 4DSKA 1S72N 2E6LA 3CHWA 3KK2A 1JXBA 3VQ6A 3P4IA 2GELA 4CFAA 4YOVA 3UE5A 4LFBK 3QERA 4GKKK 3AO3A 3M5RA 4YNQA 2E2NA 2YKNA 4FWLA 5C25A 1J9AA 3AVGA 4CZGA 2ZQBA 4EP4A 3MXMA 4U67L 4O5BA 1HRHA 1ZBHA 4L3QA 4V19S 3NH0A 5EVZA 4JYAK 4NB4A 4B3RK 3G4SN 3ULEA 4DR6K 1RBRA 4H4MA 4JKEA 3WXIA 2QWQA 3O4QA 4CF1A 5F1XA 3NGYA 2Q36A 5K14A 3VQ4A 2IGIA 2PYJA 4DUZK 4UQGA 2DPNA 4LF9K 1NGIA 3R1XA 2GUIA 4MDAA 4JI3K 1JKHA 1U2VA 1C1AA 3ITHA 2O8DA 4OO1J 1GOCA 3E9OA 4AHCA 1YJNN 1DTQA 2UYTA 3RMDA 4B1VA 3THWA 3VQCA 4AM7A 1NJXA 4FJKA 3PLAA 3AGRA 2P5GA 3CC4N 2ZGYA 5BN9A 1GLEG 2Z1GA 3WEEA
chains in the Genus database with same CATH topology
1SUQA 3VQAA 4PA1A 3OYFA 4B9NA 1IKYA 1O1WA 1TAQA 3NF8A 5C42A 4M41A 1S1WA 3KD5E 1RTJA 2PYLA 3KTQA 4CHYA 1X9MA 1VSHA 3ZT0A 4FJ5A 3ALYA 1Z26A 3RTVA 1HQUA 3NDKA 1VSEA 1HJRA 1IG9A 3CG7A 1ZBFA 3DMJA 4IG3A 3LAKA 3QNNA 3NCIA 4HUFA 1W0HA 3CM5A 3VQBA 1T03A 1D9DA 1NKCA 4L8RB 4CFDA 3TWHA 4O0IA 1EX4A 1Q8IA 1RT6A 5E41A 3S9HA 4B08A 1NJWA 3HPGA 3P5JA 1K6YA 3TAPA 3JYTA 3LP1A 3AA5X 3SPZA 1D5AA 1SV5A 4LH4A 4W5OA 3SCXA 1C1BA 5CYQA 1L3VA 3AVHA 1EKEA 1U45A 2Z1JA 4DF4A 1D8YA 1TAUA 4HTUA 1QE1A 4CJLA 1TKZA 1J5OA 3MXIA 3B6PA 4C8MA 1B9DA 1N5YA 3C6TA 3UIQA 2BE2A 3TAMA 2BGGA 1JLBA 3OYHA 3L3UA 1BI4A 3A2FA 1ASWA 4OKKA 3T19A 4BE1A 5CY4A 3TAQA 4W5NA 3KKRA 3AVNA 4JRPA 1VSKA 4FJ7A 3DRRA 4CECA 5SZTA 1KRPA 1RDCA 3LAMA 2VWKA 1BQNA 4CK3A 1S1UA 3VN5A 4CJFA 1TKXA 2WONA 4FM2A 4CCHA 1JLQA 4DQPA 3BGRA 4E89A 3M8QA 4CGGA 4HUEA 3ZSXA 4E1MA 5JS2A 4F2RA 1LWCA 3AVJA 1U49A 2E4LA 3O4NA 3ASMA 5CZ1A 3QEWA 5DK5A 2YNHA 3DLEA 3O3GA 4J2AA 2HVIA 4CERA 1L3TA 1TL3A 1VRTA 4NYFA 2OZSA 4YFUA 4BE0A 4FZXC 3QEIA 3OVNA 4KI6A 2AJQA 2Q3SA 4NCGA 3V9ZA 4DFKA 1WLJA 3OYKA 3IG1A 4CJWA 3SNNA 2BANA 5HLFA 4LD0A 2HHTA 3QLHA 4AHVA 1BGXT 3HL8A 2VWJA 4IKFA 4E7JA 4HCCA 4KHUA 2HHQA 2KW4A 3AVBA 1RT1A 3DLRA 3ZSOA 3L2WA 3QNOA 4EP5A 1WSIA 2VG5A 3C94A 4FM1A 1A5VA 1IH7A 1RDDA 5HROA 1REVA 4HCBA 3AO1A 2OZMA 4CEDA 4JS5A 3TABA 2GV9A 1YT3A 1TVRA 1NK4A 4CF2A 3LPTA 2KFNA 1JLFA 4FK0A 1XC9A 1S9GA 4BDZA 1C1CA 3FFIA 2ITGA 1RT3A 4H4OA 3MAQA 4ID1A 3I8DA 4EZ9A 2LSNA 2A1SA 3K5OA 2XY5A 4DU3A 5FDLA 3DOLA 1HYZA 2HHSA 4RW6A 2F8TA 4F4KA 4AILC 1NK0A 1F21A 3L8BA 3C95A 3SQ2A 3VA0A 2G8IA 4Z4CA 4DF8A 2P1JA 3MECA 1KLMA 5CZ2A 4CJ5A 3AVFA 3KK3A 1N6QA 4KV8A 3HP6A 1L5UA 4M3TA 3ZT2A 1LWEA 1B9FA 4CJUA 4DTOA 2DFHA 5J2NA 1ASVA 2KZZA 4DLEA 4N41A 3MEDA 4KREA 3V6DA 1IKXA 1RT2A 3DRSA 1ITGA 5FROA 2YHAA 1RTIA 4CHOA 1U04A 1BISA 5SWMA 4DTRA 4JLHA 4Y1DA 2ATQA 3HYFA 3NFAA 3ZCMA 4W5TA 5J2MA 4B9UA 4Y1CA 4CEZA 2HHWA 3M8SA 3KD1E 4BACA 4DFJA 3K59A 4QAGA 3D0PA 4DTNA 3SUNA 3HPOA 3RMBA 1QTMA 2OPQA 4BWJA 2D0CA 3DLHA 1XHXA 4M3UA 4FLVA 2BDPA 4LY7A 2XY8A 4E0DA 4OLBA 4DTSA 5J2QA 4DS5A 1GOBA 4CK1A 3SJJA 2RF2A 1QS4A 3VQEA 3V9SA 1NK8A 1NK6A 3KJVA 4CJQA 3OYGA 4C8KA 1SL2A 1Y97A 3ZSZA 4RW4A 1BI4B 3SYZA 1QSSA 4B3OA 4FYDA 4FVMA 2HB5A 3OYAA 3V1OA 3DYAA 3VQ7A 1RCHA 2EX3A 4M42A 2IS3A 5HBMA 1ZYQA 4KHNA 3VQ9A 1VSLA 4Z4FA 4O55A 1S1XA 4TSXA 4O0JA 4OGEA 3U6FA 3HPHA 4CIGA 4FLXA 3VQDA 3LP2A 2E6MA 3PUFA 3K5LA 3LZIA 4CF0A 4M3XA 1RT4A 3V4IA 4M3ZA 4KB1A 2XRIA 4FLTA 4CFCA 4CEOA 1X9SA 3WNGA 4FJ8A 3TR8A 1JL2A 1UA1A 1QSLA 4PQUA 2HW3A 2VG6A 4CESA 4KFBA 1LW0A 3I0SA 1W9HA 3F9KA 1VK0A 1LW2A 4DFPA 3ZSWA 1KFDA 2HNYA 4Z0UA 2G8FA 3SV3A 3D45A 3VQQA 3IS9A 4AHTA 4CJ4A 2Z1HA 2HHXA 1BCMA 3LDSA 3O3HA 1VSIA 1WSGA 3H08A 4CGJA 4DU4A 1QQCA 3HK2A 1HYSA 2DFFA 2X78A 3OJUA 1SL1A 4CF9A 2D5RA 4J2EA 3SUQA 3IRXA 5D3GA 5FRMA 1L3UA 1FXXA 1G15A 5T7BA 3RMCA 2NUBA 4KHSA 4QOZB 3K57A 4RW8A 5KTQA 4LSNA 4HVJA 2PY5A 4FJJA 4ZTJA 3V1QA 4FJNA 4OJRA 4AHRA 3DLBA 4PY5A 1RDAA 1WSFA 1YTAA 2ETJA 4NCBA 3K5NA 4Z4IA 2RKIA 2OPPA 4CJKA 4OKEA 3NH1A 3AVIA 3VA3A 4O44A 1C0TA 3KLGA 4GW6A 1HQEA 1Z25A 1BQMA 3SQ4A 4GVMA 4OVLA 3U3YA 3RWUA 1FKOA 1LAVA 3DRPA 3SPYA 4RW9A 1B92A 5HP1A 1Q9YA 5HRSA 4XIUA 2OYQA 4LH5A 3NHGA 4FK4A 3RR7A 3HVTA 2EHGA 4PUOA 2YKMA 2X74A 5KGXA 3DLGA 3PX0A 4I9QA 1IKWA 1TK8A 3KKSA 3CQ8A 2RPIA 1ASUA 3RRHA 4BE2A 3VQ5A 1XHZA 1SKSA 1L3SA 4DWIA 2KTQA 1D9FA 1A5XA 4FZZA 3HP9A 2G8KA 3QEVA 2Y1IA 3THVA 4RG8A 1NK9A 2G8VA 2KZMA 1XI1A 3S3OA 4DQRA 3MXJA 4KTZA 3I0RA 1WSHA 3DOKA 2YV0X 1X1PA 4F3TA 1T7PA 2HHVA 1HYVA 1TKTA 2DTUA 2XHBA 4KPYA 4PWDA 3WNFA 5FRNA 4IBNA 1WAJA 2X6SA 3ZSQA 3AVMA 2I5JA 3AVKA 2HNDA 2HMIA 4CHQA 4ICLA 3OYCA 1WSJA 4CGFA 4ZHRA 3LWLA 3AA2A 3DLKA 3ZT1A 4CK2A 3OYEA 3B6OA 2ZE2A 3G10A 1IO2A 3KLEA 3V9UA 3T3FA 5CYMA 4B9MA 1TV6A 4CHZA 3CFPA 4DQQA 4N5SA 3TAEA 4CHPA 1UOCA 3CM6A 2G8WA 1QHTA 4CFBA 3V81A 1JLAA 1JXEA 1RBSA 4KHYA 4Z4GA 4OPJA 2HHUA 1S1VA 3K2PA 3IAYA 3ZSRA 1RBTA 4C8OA 4FW2A 3QESA 3KLIA 4FJXA 3VQ8A 3QETA 3TAGA 2A1RA 4CJEA 3OYBA 4K8XA 4LSLA 2FBTA 3V9WA 3P83D 1S9EA 4B8CA 4KHWA 3TANA 4ELTA 3QO9A 2B6AA 3NE6A 4W5RA 5EU7A 4FJLA 2IDOA 4CEBA 2Y1JA 5KI6A 1KVCA 1MU2A 4GMJB 3HVRA 1ZBLA 4FLUA 3P1GA 4IFYA 4FLWA 1T05A 2G8UA 2QKBA 5J2PA 1LWFA 4KO0A 1BIUA 3HO1A 2JLEA 1KVAA 2D0AA 1I3AA 4I2QA 3AV9A 4KKOA 4CHNA 3M8RA 4CIFA 4KHQA 4B9LA 5KRTA 1RT7A 2VG7A 3DI6A 4FM0A 5JS1A 1SKWA 1VSMA 3ISNC 3OYLA 2DY4A 3KK1A 3HM9A 2OA8A 3QIPA 1HNIA 3SQ1A 3AO5A 3TI0A 4FJIA 2IC3A 4DLGA 1TK5A 3SV4A 4HHTA 4E7IA 3QEPA 1TKDA 3LP0A 4G1QA 3WNEA 1ZBIA 3AA3A 1RBUA 4OKJA 4OGCA 4CF8A 4CIEA 3K58A 4AHSA 1EETA 3LP3A 1S6PA 4DQSA 3QEXA 1CZ9A 1WN7A 1JL1A 3OS1A 3DM2A 2XY6A 3TARA 4QCLA 4H8KA 3OYIA 1S6QA 3G0ZA 4JRQA 3L2UA 3SUPA 3NGIA 5J1EA 3L3VA 2PZSA 1WNSA 3T1AA 1EP4A 2D0BA 4FLYA 4CJVA 1SKRA 2P5OA 1YTUA 4Q0BA 1I39A 4CJTA 1C0MA 4CE9A 4FJGA 4CJPA 3V9XA 1WSEA 2RN2A 1U48A 4FZYA 1NJYA 3OYDA 1FKPA 3CFRA 4F2SA 1CXQA 3ZSVA 4DSLA 1BCOA 4R5PA 1BL3A 3NAEA 1TK0A 4ELUA 1BHLA 1DTTA 3TAFA 2YNIA 1HMVA 4DTUA 2ZD1A 1VSJA 3KIOA 1LAWA 1KVBA 4Q5VA 4DMNA 3EZ5A 4AH9A 5HRPA 1UWBA 3NGZA 3PO4A 3ULDA 3OYJA 4DSEA 3HJFA 3LALA 1RILA 2FBXA 4FJMA 1CZBA 3MEGA 3NF7A 2YHBA 1VSDA 1TL1A 3HSTB 4F3OA 4KAZA 4KI4A 4M45A 3L2QA 3L2VA 2Z1IA 3LPUA 1RT5A 2FBVA 3OY9A 4FJHA 4FXDA 3LZJA 4C8NA 4KRFA 3NH2A 3HXMA 4Z4EA 2R7YA 3QINA 1YVUA 4W5QA 5HRRA 4E19A 1C6VA 4C8LA 3M8PA 1S5JA 4NYNA 3PV8A 3U3GA 1RTDA 1RDBA 2WOMA 2OPRA 4DTXA 1CLQA 3AA4A 4B9SA 1RTHA 2KFZA 4HUGA 1BIZA 3AVLA 1NKBA 4MQ3A 2B5JA 3BDPA 2QK9A 4B8AB 4I9LA 3AVCA 1KCFA 3SI6A 3HT3A 1KLNA 3S3MA 3SZ2A 4BDYA 4Z4HA 3RMAA 4AHUA 1UA0A 2G8HA 4E7KA 4FCYA 2JGUA 5HRNA 3ZT3A 4ZTFA 4J2DA 4ID5A 2XY7A 4CJ3A 1IKVA 3NF6A 3OS2A 1X9WA 1RNHA 3V1RA 4ELVA 4K8ZA 1HNVA 2P51A 4OPKA 4O4GA 2GBZA 3AVAA 4B9TA 1JLGA 3CFOA 4N56A 4DS4A 1U4BA 1NK7A 3RR8A 4DSJA 4DSKA 2E6LA 4CJRA 4IG0A 4E7LA 4CGDA 3E01A 4M3YA 3KK2A 4IDKA 1JXBA 1UAXA 2X6NA 2FBYA 4KTWA 3VQ6A 4CEAA 1SL0A 1QSYA 1KFSA 2O4IA 2QXFA 4I2PA 2QKKA 1TGOA 2XO7A 4CFAA 4CJSA 1WAFA 3S3NA 1NKEA 1XWLA 3QERA 4DTPA 3AO3A 3MEEA 3VQPA 4YNQA 2YKNA 1VRUA 5I42A 2OPSA 1J9AA 3AVGA 4I7FA 4CEEA 5C25A 4DU1A 3CYMA 1ZBUA 3PX6A 4FLZA 4MFBA 2ZQBA 2DFEA 3WNHA 2F96A 2O4GA 3NBPA 3ZSYA 4CGIA 1C0UA 4EP4A 3MXMA 1NJZA 2IAJA 4CEQA 4O5BA 3JSMA 1KSPA 1HRHA 1ZBHA 2W42A 3K5MA 1LV5A 3OYMA 2YNGA 2IOCA 3EYZA 1NOYA 3L2RA 3NH0A 4FJ9A 3ZT4A 1CXUA 5KRSA 2HNZA 1JLEA 1GOAA 5DMRA 3PO5A 4B9VA 4DQIA 2F8SA 5C24A 3OYNA 2FC0A 3SUOA 4BDPA 4DTJA 2KQ2A 1RBRA 1FK9A 4H4MA 4M3RA 2YNFA 3KLHA 4M3WA 5KGWA 3O4QA 1DLOA 3PX4A 4CF1A 3LANA 4DG1A 4E7HA 3RRGA 4N47A 3NGYA 5K14A 3VQ4A 4KB0A 2IGIA 1KTQA 2PYJA 1S1TA 4DSIA 2HVHA 3KLFA 3EY1A 4CEFA 4BWMA 3LWMA 1VSFA 4UQGA 1HPZA 1J53A 4J2BA 3NF9A 3F73A 4DSFA 1NK5A 2GUIA 4DFMA 1EXQA 1JKHA 4CGHA 1C1AA 4JS4A 3ITHA 4NCAA 3C6UA 3OJSA 1GOCA 4F8RA 5I3UA 4AHCA 1JLCA 1DTQA 3RMDA 4N76A 1J54A 3VQCA 4IFVA 1U47A 3PY8A 4KTQA 1NJXA 4EZ6A 3QIOA 2B4JA 1Q9XA 4FK2A 1NOZA 4FJKA 4E3SA 3O3FA 2P5GA 1A5WA 4OLAA 4FW1A 1RBVA 3OS0A 1R0AA 4WE1A 1T8EA 4RW7A 2Z1GA 3AO2A 3AO4A 3SQ0A 4DTMA 4E1NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SUQ A;  3VQA A;  4PA1 A;  3OYF A;  4B9N A;  1IKY A;  1O1W A;  1TAQ A;  3NF8 A;  5C42 A;  4M41 A;  1S1W A;  3KD5 E;  1RTJ A;  2PYL A;  3KTQ A;  4CHY A;  1X9M A;  1VSH A;  3ZT0 A;  4FJ5 A;  3ALY A;  1Z26 A;  3RTV A;  1HQU A;  3NDK A;  1VSE A;  1HJR A;  1IG9 A;  3CG7 A;  1ZBF A;  3DMJ A;  4IG3 A;  3LAK A;  3QNN A;  3NCI A;  4HUF A;  1W0H A;  3CM5 A;  3VQB A;  1T03 A;  1D9D A;  1NKC A;  4L8R B;  4CFD A;  3TWH A;  4O0I A;  1EX4 A;  1Q8I A;  1RT6 A;  5E41 A;  3S9H A;  4B08 A;  1NJW A;  3HPG A;  3P5J A;  1K6Y A;  3TAP A;  3JYT A;  3LP1 A;  3AA5 X;  3SPZ A;  1D5A A;  1SV5 A;  4LH4 A;  4W5O A;  3SCX A;  1C1B A;  5CYQ A;  1L3V A;  3AVH A;  1EKE A;  1U45 A;  2Z1J A;  4DF4 A;  1D8Y A;  1TAU A;  4HTU A;  1QE1 A;  4CJL A;  1TKZ A;  1J5O A;  3MXI A;  3B6P A;  4C8M A;  1B9D A;  1N5Y A;  3C6T A;  3UIQ A;  2BE2 A;  3TAM A;  2BGG A;  1JLB A;  3OYH A;  3L3U A;  1BI4 A;  3A2F A;  1ASW A;  4OKK A;  3T19 A;  4BE1 A;  5CY4 A;  3TAQ A;  4W5N A;  3KKR A;  3AVN A;  4JRP A;  1VSK A;  4FJ7 A;  3DRR A;  4CEC A;  5SZT A;  1KRP A;  1RDC A;  3LAM A;  2VWK A;  1BQN A;  4CK3 A;  1S1U A;  3VN5 A;  4CJF A;  1TKX A;  2WON A;  4FM2 A;  4CCH A;  1JLQ A;  4DQP A;  3BGR A;  4E89 A;  3M8Q A;  4CGG A;  4HUE A;  3ZSX A;  4E1M A;  5JS2 A;  4F2R A;  1LWC A;  3AVJ A;  1U49 A;  2E4L A;  3O4N A;  3ASM A;  5CZ1 A;  3QEW A;  5DK5 A;  2YNH A;  3DLE A;  3O3G A;  4J2A A;  2HVI A;  4CER A;  1L3T A;  1TL3 A;  1VRT A;  4NYF A;  2OZS A;  4YFU A;  4BE0 A;  4FZX C;  3QEI A;  3OVN A;  4KI6 A;  2AJQ A;  2Q3S A;  4NCG A;  3V9Z A;  4DFK A;  1WLJ A;  3OYK A;  3IG1 A;  4CJW A;  3SNN A;  2BAN A;  5HLF A;  4LD0 A;  2HHT A;  3QLH A;  4AHV A;  1BGX T;  3HL8 A;  2VWJ A;  4IKF A;  4E7J A;  4HCC A;  4KHU A;  2HHQ A;  2KW4 A;  3AVB A;  1RT1 A;  3DLR A;  3ZSO A;  3L2W A;  3QNO A;  4EP5 A;  1WSI A;  2VG5 A;  3C94 A;  4FM1 A;  1A5V A;  1IH7 A;  1RDD A;  5HRO A;  1REV A;  4HCB A;  3AO1 A;  2OZM A;  4CED A;  4JS5 A;  3TAB A;  2GV9 A;  1YT3 A;  1TVR A;  1NK4 A;  4CF2 A;  3LPT A;  2KFN A;  1JLF A;  4FK0 A;  1XC9 A;  1S9G A;  4BDZ A;  1C1C A;  3FFI A;  2ITG A;  1RT3 A;  4H4O A;  3MAQ A;  4ID1 A;  3I8D A;  4EZ9 A;  2LSN A;  2A1S A;  3K5O A;  2XY5 A;  4DU3 A;  5FDL A;  3DOL A;  1HYZ A;  2HHS A;  4RW6 A;  2F8T A;  4F4K A;  4AIL C;  1NK0 A;  1F21 A;  3L8B A;  3C95 A;  3SQ2 A;  3VA0 A;  2G8I A;  4Z4C A;  4DF8 A;  2P1J A;  3MEC A;  1KLM A;  5CZ2 A;  4CJ5 A;  3AVF A;  3KK3 A;  1N6Q A;  4KV8 A;  3HP6 A;  1L5U A;  4M3T A;  3ZT2 A;  1LWE A;  1B9F A;  4CJU A;  4DTO A;  2DFH A;  5J2N A;  1ASV A;  2KZZ A;  4DLE A;  4N41 A;  3MED A;  4KRE A;  3V6D A;  1IKX A;  1RT2 A;  3DRS A;  1ITG A;  5FRO A;  2YHA A;  1RTI A;  4CHO A;  1U04 A;  1BIS A;  5SWM A;  4DTR A;  4JLH A;  4Y1D A;  2ATQ A;  3HYF A;  3NFA A;  3ZCM A;  4W5T A;  5J2M A;  4B9U A;  4Y1C A;  4CEZ A;  2HHW A;  3M8S A;  3KD1 E;  4BAC A;  4DFJ A;  3K59 A;  4QAG A;  3D0P A;  4DTN A;  3SUN A;  3HPO A;  3RMB A;  1QTM A;  2OPQ A;  4BWJ A;  2D0C A;  3DLH A;  1XHX A;  4M3U A;  4FLV A;  2BDP A;  4LY7 A;  2XY8 A;  4E0D A;  4OLB A;  4DTS A;  5J2Q A;  4DS5 A;  1GOB A;  4CK1 A;  3SJJ A;  2RF2 A;  1QS4 A;  3VQE A;  3V9S A;  1NK8 A;  1NK6 A;  3KJV A;  4CJQ A;  3OYG A;  4C8K A;  1SL2 A;  1Y97 A;  3ZSZ A;  4RW4 A;  1BI4 B;  3SYZ A;  1QSS A;  4B3O A;  4FYD A;  4FVM A;  2HB5 A;  3OYA A;  3V1O A;  3DYA A;  3VQ7 A;  1RCH A;  2EX3 A;  4M42 A;  2IS3 A;  5HBM A;  1ZYQ A;  4KHN A;  3VQ9 A;  1VSL A;  4Z4F A;  4O55 A;  1S1X A;  4TSX A;  4O0J A;  4OGE A;  3U6F A;  3HPH A;  4CIG A;  4FLX A;  3VQD A;  3LP2 A;  2E6M A;  3PUF A;  3K5L A;  3LZI A;  4CF0 A;  4M3X A;  1RT4 A;  3V4I A;  4M3Z A;  4KB1 A;  2XRI A;  4FLT A;  4CFC A;  4CEO A;  1X9S A;  3WNG A;  4FJ8 A;  3TR8 A;  1JL2 A;  1UA1 A;  1QSL A;  4PQU A;  2HW3 A;  2VG6 A;  4CES A;  4KFB A;  1LW0 A;  3I0S A;  1W9H A;  3F9K A;  1VK0 A;  1LW2 A;  4DFP A;  3ZSW A;  1KFD A;  2HNY A;  4Z0U A;  2G8F A;  3SV3 A;  3D45 A;  3VQQ A;  3IS9 A;  4AHT A;  4CJ4 A;  2Z1H A;  2HHX A;  1BCM A;  3LDS A;  3O3H A;  1VSI A;  1WSG A;  3H08 A;  4CGJ A;  4DU4 A;  1QQC A;  3HK2 A;  1HYS A;  2DFF A;  2X78 A;  3OJU A;  1SL1 A;  4CF9 A;  2D5R A;  4J2E A;  3SUQ A;  3IRX A;  5D3G A;  5FRM A;  1L3U A;  1FXX A;  1G15 A;  5T7B A;  3RMC A;  2NUB A;  4KHS A;  4QOZ B;  3K57 A;  4RW8 A;  5KTQ A;  4LSN A;  4HVJ A;  2PY5 A;  4FJJ A;  4ZTJ A;  3V1Q A;  4FJN A;  4OJR A;  4AHR A;  3DLB A;  4PY5 A;  1RDA A;  1WSF A;  1YTA A;  2ETJ A;  4NCB A;  3K5N A;  4Z4I A;  2RKI A;  2OPP A;  4CJK A;  4OKE A;  3NH1 A;  3AVI A;  3VA3 A;  4O44 A;  1C0T A;  3KLG A;  4GW6 A;  1HQE A;  1Z25 A;  1BQM A;  3SQ4 A;  4GVM A;  4OVL A;  3U3Y A;  3RWU A;  1FKO A;  1LAV A;  3DRP A;  3SPY A;  4RW9 A;  1B92 A;  5HP1 A;  1Q9Y A;  5HRS A;  4XIU A;  2OYQ A;  4LH5 A;  3NHG A;  4FK4 A;  3RR7 A;  3HVT A;  2EHG A;  4PUO A;  2YKM A;  2X74 A;  5KGX A;  3DLG A;  3PX0 A;  4I9Q A;  1IKW A;  1TK8 A;  3KKS A;  3CQ8 A;  2RPI A;  1ASU A;  3RRH A;  4BE2 A;  3VQ5 A;  1XHZ A;  1SKS A;  1L3S A;  4DWI A;  2KTQ A;  1D9F A;  1A5X A;  4FZZ A;  3HP9 A;  2G8K A;  3QEV A;  2Y1I A;  3THV A;  4RG8 A;  1NK9 A;  2G8V A;  2KZM A;  1XI1 A;  3S3O A;  4DQR A;  3MXJ A;  4KTZ A;  3I0R A;  1WSH A;  3DOK A;  2YV0 X;  1X1P A;  4F3T A;  1T7P A;  2HHV A;  1HYV A;  1TKT A;  2DTU A;  2XHB A;  4KPY A;  4PWD A;  3WNF A;  5FRN A;  4IBN A;  1WAJ A;  2X6S A;  3ZSQ A;  3AVM A;  2I5J A;  3AVK A;  2HND A;  2HMI A;  4CHQ A;  4ICL A;  3OYC A;  1WSJ A;  4CGF A;  4ZHR A;  3LWL A;  3AA2 A;  3DLK A;  3ZT1 A;  4CK2 A;  3OYE A;  3B6O A;  2ZE2 A;  3G10 A;  1IO2 A;  3KLE A;  3V9U A;  3T3F A;  5CYM A;  4B9M A;  1TV6 A;  4CHZ A;  3CFP A;  4DQQ A;  4N5S A;  3TAE A;  4CHP A;  1UOC A;  3CM6 A;  2G8W A;  1QHT A;  4CFB A;  3V81 A;  1JLA A;  1JXE A;  1RBS A;  4KHY A;  4Z4G A;  4OPJ A;  2HHU A;  1S1V A;  3K2P A;  3IAY A;  3ZSR A;  1RBT A;  4C8O A;  4FW2 A;  3QES A;  3KLI A;  4FJX A;  3VQ8 A;  3QET A;  3TAG A;  2A1R A;  4CJE A;  3OYB A;  4K8X A;  4LSL A;  2FBT A;  3V9W A;  3P83 D;  1S9E A;  4B8C A;  4KHW A;  3TAN A;  4ELT A;  3QO9 A;  2B6A A;  3NE6 A;  4W5R A;  5EU7 A;  4FJL A;  2IDO A;  4CEB A;  2Y1J A;  5KI6 A;  1KVC A;  1MU2 A;  4GMJ B;  3HVR A;  1ZBL A;  4FLU A;  3P1G A;  4IFY A;  4FLW A;  1T05 A;  2G8U A;  2QKB A;  5J2P A;  1LWF A;  4KO0 A;  1BIU A;  3HO1 A;  2JLE A;  1KVA A;  2D0A A;  1I3A A;  4I2Q A;  3AV9 A;  4KKO A;  4CHN A;  3M8R A;  4CIF A;  4KHQ A;  4B9L A;  5KRT A;  1RT7 A;  2VG7 A;  3DI6 A;  4FM0 A;  5JS1 A;  1SKW A;  1VSM A;  3ISN C;  3OYL A;  2DY4 A;  3KK1 A;  3HM9 A;  2OA8 A;  3QIP A;  1HNI A;  3SQ1 A;  3AO5 A;  3TI0 A;  4FJI A;  2IC3 A;  4DLG A;  1TK5 A;  3SV4 A;  4HHT A;  4E7I A;  3QEP A;  1TKD A;  3LP0 A;  4G1Q A;  3WNE A;  1ZBI A;  3AA3 A;  1RBU A;  4OKJ A;  4OGC A;  4CF8 A;  4CIE A;  3K58 A;  4AHS A;  1EET A;  3LP3 A;  1S6P A;  4DQS A;  3QEX A;  1CZ9 A;  1WN7 A;  1JL1 A;  3OS1 A;  3DM2 A;  2XY6 A;  3TAR A;  4QCL A;  4H8K A;  3OYI A;  1S6Q A;  3G0Z A;  4JRQ A;  3L2U A;  3SUP A;  3NGI A;  5J1E A;  3L3V A;  2PZS A;  1WNS A;  3T1A A;  1EP4 A;  2D0B A;  4FLY A;  4CJV A;  1SKR A;  2P5O A;  1YTU A;  4Q0B A;  1I39 A;  4CJT A;  1C0M A;  4CE9 A;  4FJG A;  4CJP A;  3V9X A;  1WSE A;  2RN2 A;  1U48 A;  4FZY A;  1NJY A;  3OYD A;  1FKP A;  3CFR A;  4F2S A;  1CXQ A;  3ZSV A;  4DSL A;  1BCO A;  4R5P A;  1BL3 A;  3NAE A;  1TK0 A;  4ELU A;  1BHL A;  1DTT A;  3TAF A;  2YNI A;  1HMV A;  4DTU A;  2ZD1 A;  1VSJ A;  3KIO A;  1LAW A;  1KVB A;  4Q5V A;  4DMN A;  3EZ5 A;  4AH9 A;  5HRP A;  1UWB A;  3NGZ A;  3PO4 A;  3ULD A;  3OYJ A;  4DSE A;  3HJF A;  3LAL A;  1RIL A;  2FBX A;  4FJM A;  1CZB A;  3MEG A;  3NF7 A;  2YHB A;  1VSD A;  1TL1 A;  3HST B;  4F3O A;  4KAZ A;  4KI4 A;  4M45 A;  3L2Q A;  3L2V A;  2Z1I A;  3LPU A;  1RT5 A;  2FBV A;  3OY9 A;  4FJH A;  4FXD A;  3LZJ A;  4C8N A;  4KRF A;  3NH2 A;  3HXM A;  4Z4E A;  2R7Y A;  3QIN A;  1YVU A;  4W5Q A;  5HRR A;  4E19 A;  1C6V A;  4C8L A;  3M8P A;  1S5J A;  4NYN A;  3PV8 A;  3U3G A;  1RTD A;  1RDB A;  2WOM A;  2OPR A;  4DTX A;  1CLQ A;  3AA4 A;  4B9S A;  1RTH A;  2KFZ A;  4HUG A;  1BIZ A;  3AVL A;  1NKB A;  4MQ3 A;  2B5J A;  3BDP A;  2QK9 A;  4B8A B;  4I9L A;  3AVC A;  1KCF A;  3SI6 A;  3HT3 A;  1KLN A;  3S3M A;  3SZ2 A;  4BDY A;  4Z4H A;  3RMA A;  4AHU A;  1UA0 A;  2G8H A;  4E7K A;  4FCY A;  2JGU A;  5HRN A;  3ZT3 A;  4ZTF A;  4J2D A;  4ID5 A;  2XY7 A;  4CJ3 A;  1IKV A;  3NF6 A;  3OS2 A;  1X9W A;  1RNH A;  3V1R A;  4ELV A;  4K8Z A;  1HNV A;  2P51 A;  4OPK A;  4O4G A;  2GBZ A;  3AVA A;  4B9T A;  1JLG A;  3CFO A;  4N56 A;  4DS4 A;  1U4B A;  1NK7 A;  3RR8 A;  4DSJ A;  4DSK A;  2E6L A;  4CJR A;  4IG0 A;  4E7L A;  4CGD A;  3E01 A;  4M3Y A;  3KK2 A;  4IDK A;  1JXB A;  1UAX A;  2X6N A;  2FBY A;  4KTW A;  3VQ6 A;  4CEA A;  1SL0 A;  1QSY A;  1KFS A;  2O4I A;  2QXF A;  4I2P A;  2QKK A;  1TGO A;  2XO7 A;  4CFA A;  4CJS A;  1WAF A;  3S3N A;  1NKE A;  1XWL A;  3QER A;  4DTP A;  3AO3 A;  3MEE A;  3VQP A;  4YNQ A;  2YKN A;  1VRU A;  5I42 A;  2OPS A;  1J9A A;  3AVG A;  4I7F A;  4CEE A;  5C25 A;  4DU1 A;  3CYM A;  1ZBU A;  3PX6 A;  4FLZ A;  4MFB A;  2ZQB A;  2DFE A;  3WNH A;  2F96 A;  2O4G A;  3NBP A;  3ZSY A;  4CGI A;  1C0U A;  4EP4 A;  3MXM A;  1NJZ A;  2IAJ A;  4CEQ A;  4O5B A;  3JSM A;  1KSP A;  1HRH A;  1ZBH A;  2W42 A;  3K5M A;  1LV5 A;  3OYM A;  2YNG A;  2IOC A;  3EYZ A;  1NOY A;  3L2R A;  3NH0 A;  4FJ9 A;  3ZT4 A;  1CXU A;  5KRS A;  2HNZ A;  1JLE A;  1GOA A;  5DMR A;  3PO5 A;  4B9V A;  4DQI A;  2F8S A;  5C24 A;  3OYN A;  2FC0 A;  3SUO A;  4BDP A;  4DTJ A;  2KQ2 A;  1RBR A;  1FK9 A;  4H4M A;  4M3R A;  2YNF A;  3KLH A;  4M3W A;  5KGW A;  3O4Q A;  1DLO A;  3PX4 A;  4CF1 A;  3LAN A;  4DG1 A;  4E7H A;  3RRG A;  4N47 A;  3NGY A;  5K14 A;  3VQ4 A;  4KB0 A;  2IGI A;  1KTQ A;  2PYJ A;  1S1T A;  4DSI A;  2HVH A;  3KLF A;  3EY1 A;  4CEF A;  4BWM A;  3LWM A;  1VSF A;  4UQG A;  1HPZ A;  1J53 A;  4J2B A;  3NF9 A;  3F73 A;  4DSF A;  1NK5 A;  2GUI A;  4DFM A;  1EXQ A;  1JKH A;  4CGH A;  1C1A A;  4JS4 A;  3ITH A;  4NCA A;  3C6U A;  3OJS A;  1GOC A;  4F8R A;  5I3U A;  4AHC A;  1JLC A;  1DTQ A;  3RMD A;  4N76 A;  1J54 A;  3VQC A;  4IFV A;  1U47 A;  3PY8 A;  4KTQ A;  1NJX A;  4EZ6 A;  3QIO A;  2B4J A;  1Q9X A;  4FK2 A;  1NOZ A;  4FJK A;  4E3S A;  3O3F A;  2P5G A;  1A5W A;  4OLA A;  4FW1 A;  1RBV A;  3OS0 A;  1R0A A;  4WE1 A;  1T8E A;  4RW7 A;  2Z1G A;  3AO2 A;  3AO4 A;  3SQ0 A;  4DTM A;  4E1N A; 
#chains in the Genus database with same CATH topology
 1SUQ A;  1NGE A;  3A0I X;  4GY2 B;  1IKY A;  1O1W A;  1RTJ A;  1X9M A;  4FJ5 A;  2E8A A;  5BPN A;  4CZJ A;  3DMJ A;  2QA4 N;  1H1V A;  4HUF A;  1FJG K;  4CFD A;  3TU5 A;  1NLV A;  4B08 A;  3P5J A;  2P9L A;  4BG8 A;  3HBT A;  1SV5 A;  3AVH A;  4QS8 A;  2Q2R A;  4CJL A;  3C7N B;  3MXI A;  4CZK A;  5JLF A;  1HR0 K;  2NRR A;  2BE2 A;  2UUC K;  5AQZ A;  1QVF M;  3WXL A;  1NGB A;  3OYH A;  3SMP A;  3KWG A;  1BI4 A;  2BGG A;  1ASW A;  1RFQ A;  4W5N A;  5AQS A;  2I7N A;  1NGC A;  2GUP A;  3DRR A;  4CEC A;  1KRP A;  3LAM A;  3MDQ A;  2VWK A;  4IFE A;  1BQN A;  1J6Z A;  4CJ7 A;  4CK3 A;  1S1U A;  4CJF A;  1TKX A;  4FM2 A;  4MO4 A;  3THY B;  1NGJ A;  4DQP A;  3BGR A;  3C6H A;  4BR9 A;  4E89 A;  2VYP A;  4JD2 B;  4X66 K;  4WFN L;  2YNH A;  4X65 K;  1TL3 A;  3GL1 A;  1YVN A;  1GLL O;  1NGF A;  4CJW A;  3SNN A;  3EL2 A;  3MX5 A;  1QQO A;  4LD0 A;  5GIP A;  5HLF A;  5AQK A;  2HHT A;  4X64 K;  1BGX T;  3HL8 A;  3THX A;  4E7J A;  4IKF A;  5FPD A;  2KW4 A;  1RT1 A;  3DLR A;  4K42 A;  4JN4 A;  3VET A;  4M7Y A;  4HCB A;  3AO1 A;  4JS5 A;  3TAB A;  2GV9 A;  2HMP A;  2WUS A;  3LPT A;  4CBX A;  2KFN A;  1XC9 A;  4BDZ A;  1C1C A;  3MAQ A;  3NVM A;  3TTF A;  4EZ9 A;  4FOE A;  2A1S A;  2VQF K;  5FDL A;  3J8A A;  4GNI A;  4JEP A;  4K41 A;  1F21 A;  3L8B A;  3C95 A;  3RVC A;  5AQH A;  4FSV A;  2QEX N;  1MWM A;  2OTJ N;  1IG8 A;  4M3T A;  1C0F A;  3KVG A;  1LWE A;  4KBO A;  1ASV A;  4N41 A;  3L6Q A;  1IKX A;  4F9O A;  3CMA N;  2OCE A;  3O5B A;  1YJW N;  5CE3 A;  1RTI A;  4CHO A;  1HKG A;  1BIS A;  5SWM A;  4GV3 A;  3ENH A;  4CD3 A;  2O8E B;  5J2M A;  4B9U A;  4JV5 K;  3OTO K;  2HHW A;  4QAG A;  2YI1 A;  3RMB A;  2XY8 A;  4E0D A;  5J2Q A;  1GOB A;  2RF2 A;  1NK6 A;  1NNE A;  3OYG A;  3ZEU B;  3ZSZ A;  3OYA A;  3V1O A;  3VQ7 A;  5M1F A;  5HOO A;  2V7Y A;  4WQ5 C;  4M42 A;  1VSL A;  4Z4F A;  4O55 A;  1S1X A;  3DJC A;  3HPH A;  4CIG A;  4M3X A;  2ZJQ L;  4JKF A;  4JHD B;  4KB1 A;  4DR7 K;  2XRI A;  3G25 A;  4GVE A;  4CEO A;  1WBB A;  5HL7 L;  1P8Z A;  2NRZ A;  3I33 A;  1VK0 A;  3SLC A;  4Z0U A;  3SV3 A;  4CJ4 A;  2Z1H A;  1BCM A;  5M1N A;  3ZET B;  5BR8 K;  4CGJ A;  1QQC A;  4J2E A;  4K43 A;  3F5T A;  4YDU A;  4LFA K;  4OX9 K;  4CVN E;  1WOQ A;  3V1Q A;  4AHR A;  4ZTJ A;  3DLB A;  5KPZ A;  1KAY A;  1VAZ A;  1Q82 O;  4CW7 B;  2RKI A;  2OPP A;  3LDO A;  1M90 O;  3AVI A;  1TUU A;  3SQ4 A;  4DV5 K;  1FKO A;  4YOY A;  5BN8 A;  4RW9 A;  5C12 A;  3LDN A;  5HRS A;  3RR7 A;  5KGX A;  3PX0 A;  3CJB A;  4MLE A;  1D9F A;  2E2Q A;  3K0S A;  2Y1I A;  3THV A;  4BR4 A;  1X9J A;  3MN6 A;  1TKT A;  2XHB A;  3MWT A;  3PIP L;  4PWD A;  2X6S A;  5AQN A;  4YOW A;  2I5J A;  4CHQ A;  4ICL A;  4M7X A;  1GLF O;  3LWL A;  2ITM A;  3DLK A;  5B8H A;  4CK2 A;  2ZE2 A;  3G10 A;  1IO2 A;  5C15 A;  2QI2 A;  5CYM A;  2VGN A;  2KKZ A;  3WQT A;  4N5S A;  4DQQ A;  3R3L A;  3CM6 A;  1QHT A;  4A2A A;  3V81 A;  4GV9 A;  1JLA A;  1RBS A;  4KHY A;  5ADX A;  2HHU A;  3IAY A;  4C8O A;  4I6M A;  3ZX0 A;  1VQP N;  3VQ8 A;  3QET A;  4K8X A;  3VGM A;  3P83 D;  4BC3 A;  3TAN A;  4G9Z A;  3H45 C;  2QKB A;  3P1G A;  5EXW A;  3OHR A;  2G8U A;  3WXJ A;  4CHN A;  4KKO A;  3AV9 A;  3MN5 A;  3M8R A;  4KHQ A;  2VG7 A;  3ZX3 A;  5JS1 A;  1SKW A;  2DY4 A;  3ISN C;  3OYL A;  3KK1 A;  3C6A A;  3HM9 A;  1TYQ A;  2NRT A;  5AQW A;  2IC3 A;  1OH8 A;  5AZI B;  4YHH K;  4G1Q A;  1TKD A;  1GLJ O;  1ZBI A;  3QFU A;  3KK7 A;  4H5R A;  2O8C A;  3G0Z A;  3L2U A;  4BY9 C;  5GAH P;  3JS6 A;  3NGI A;  2PZS A;  3VTH A;  3PSI A;  3T1A A;  1SKR A;  1ATR A;  5AQY A;  4RWT A;  1I39 A;  2GEM A;  4CE9 A;  3UKU B;  1U48 A;  1NJY A;  5AQI A;  1FKP A;  3ZSV A;  2O8B B;  3AAR A;  2YX6 A;  3M1F A;  1TK0 A;  4ELU A;  3LDQ A;  1HMV A;  4DR1 K;  3PO4 A;  3NGZ A;  1UWB A;  2KHO A;  1W7A A;  5GIN A;  4H03 B;  2CGL A;  1CZB A;  1M1K O;  4F3O A;  1VSD A;  3HST B;  4BR0 A;  2VQE K;  4KI4 A;  4FWN A;  3L2V A;  1SAZ A;  3LPU A;  4FXD A;  2P9S A;  2E1Z A;  4C8N A;  3NH2 A;  2R7Y A;  3QIN A;  4W5Q A;  1C6V A;  3M8P A;  3PV8 A;  2ZWH A;  1RTD A;  3D6R A;  2WOM A;  2P9P A;  1WUA A;  1BIZ A;  3AVL A;  4A2B A;  2GTD A;  4MQ3 A;  1NKB A;  5AQP A;  1KCF A;  1NGA A;  3HT3 A;  3RMA A;  1TUY A;  4DB3 A;  4FCY A;  4JHD A;  2RE2 A;  3ZT3 A;  4J8F A;  2XY7 A;  5CR4 A;  4ELV A;  3NVK A;  2F7T A;  2P51 A;  1VQM N;  4O4G A;  3CFO A;  4N56 A;  3FZM A;  4E7L A;  4IG0 A;  4CGD A;  3D2E B;  5CHI A;  1QSY A;  4CEA A;  3QFP A;  2O4I A;  4EIA A;  3BUZ B;  2QXF A;  2QKK A;  1TGO A;  4JI5 K;  3ZET A;  1NKE A;  1WAF A;  3O80 A;  4IDH A;  1KFS A;  5I42 A;  4I7F A;  3DWL A;  3E1Y A;  3PX6 A;  4MFB A;  3ZSY A;  2DFE A;  2O4G A;  3DXM A;  4CGI A;  4CEQ A;  2YNG A;  3EYZ A;  3L2R A;  3VGL A;  3E9P A;  3ID8 A;  3KHY A;  1JLE A;  1GOA A;  2HBM A;  2AA4 A;  3SUO A;  3AAQ A;  3BZK A;  2YNF A;  4UY8 O;  1K8K A;  3KLH A;  4M3W A;  1DLO A;  4FWO A;  1S1T A;  3TTD A;  3O9T A;  2HVH A;  3O9Q A;  3LWM A;  4BWM A;  1J53 A;  4J2B A;  4YOT A;  1NK5 A;  4DFM A;  3U8X A;  2WFB A;  1JLC A;  2Q0R A;  3D7E O;  3MX2 A;  3QBW A;  3G6E N;  4BRI A;  5MLC Q;  3QIO A;  5AFU H;  3O3F A;  4O8K A;  3OS0 A;  4H0P A;  4RW7 A;  1JCF A;  1T8E A;  5JMV A;  1QQM A;  4IEE A;  4E1N A;  5JIC A;  3OYF A;  4BRE A;  1TAQ A;  3NF8 A;  5C42 A;  4YOU A;  2PYL A;  1VSH A;  5AZJ A;  4GV6 A;  1HQU A;  2UUA K;  4NO7 A;  1VSE A;  1HJR A;  1BWF O;  3NCI A;  1W0H A;  3CM5 A;  2P9K B;  2ASO A;  1Q8I A;  4O0I A;  3S9H A;  1NJW A;  1WB9 A;  3MCA B;  4NLC A;  3MMV A;  3JYT A;  3LP1 A;  1D5A A;  3CQY A;  5CYQ A;  2D4W A;  3A5L C;  3BZC A;  1CZA N;  4HTU A;  4JNE A;  1N5Y A;  3B6P A;  3MCP A;  1HKB A;  5AJ3 K;  3TAM A;  2KLA A;  2ZM6 K;  4OKK A;  5AQQ A;  3KKR A;  3AVN A;  4JRP A;  5BRE A;  1JLQ A;  3ZSX A;  4U7B A;  5A2Q O;  1U49 A;  3O4N A;  5CZ1 A;  5DK5 A;  5KPT A;  3UKU A;  2HVI A;  3AAP A;  4CER A;  1VQL N;  3J81 O;  4XH4 A;  1VRT A;  3CJ7 A;  4YFU A;  3DAW A;  3OVN A;  2AJQ A;  1YHQ N;  3IG1 A;  2BAN A;  4BRA A;  3QLH A;  4AHV A;  4HCC A;  3PSF A;  1W97 L;  3ZSO A;  5IWA K;  4BQL A;  4EP5 A;  3C94 A;  1IH7 A;  1RDD A;  5HRO A;  2D1K A;  2OZM A;  4FK0 A;  3CJ9 A;  1S9G A;  3EZW A;  3FFI A;  4H4O A;  1XC3 A;  3I8D A;  2WTU A;  1Z05 A;  3K5O A;  2IIR A;  3H46 O;  1HYZ A;  2HHS A;  4IOX A;  5KQ8 A;  4AIL C;  1G99 A;  1LOT B;  2J4R A;  3VA0 A;  4Z4C A;  3KWI A;  3M6G A;  4CJ5 A;  1N6Q A;  2P9N A;  2NRW A;  4QS9 A;  1ILY A;  3EE9 A;  4BG9 A;  2KZZ A;  1P90 A;  3F2K A;  2F4V K;  3J80 O;  5LJW A;  3MK6 A;  1NBW A;  5JVG L;  4DTR A;  3CC7 N;  3D2E A;  3EN9 A;  4Y1D A;  1MWK A;  4JI7 K;  4IXC A;  4Y1C A;  3H1V X;  3M8S A;  2QWM A;  1N34 K;  3SUN A;  4DTN A;  2O8F B;  3HM8 A;  1QTM A;  2OPQ A;  1IBK K;  2ZF5 O;  4FLV A;  3CPW M;  3A8Y A;  4DTS A;  4DS5 A;  1FW6 A;  1NJI O;  4BC4 A;  3SJJ A;  3VQE A;  1LCU A;  1T3V A;  3KJV A;  3G71 N;  4C8K A;  1BA0 A;  3SYZ A;  4B3O A;  4FYD A;  2HB5 A;  3WXM B;  1ZYQ A;  4JK7 A;  4TSX A;  3CD6 N;  4DQ8 A;  3VQD A;  3LP2 A;  3K5L A;  2OAN A;  4CF0 A;  1RT4 A;  3V4I A;  4FJ8 A;  3GG4 A;  3TR8 A;  2HW3 A;  2YHW A;  5C0Y A;  4CES A;  1LW0 A;  3I0S A;  5M1Q A;  1W9H A;  3F9K A;  1LW2 A;  4BVP A;  1KFD A;  4FL9 A;  2G8F A;  3D45 A;  3QBX A;  5LY3 A;  3O3H A;  4DV7 K;  4B1Y B;  1HYS A;  2X78 A;  3UB5 A;  1SL1 A;  2D5R A;  2P9I B;  2QWN A;  3A5M C;  3IRX A;  4GKJ K;  1FXX A;  5T7B A;  3RMC A;  4KHS A;  2ASM A;  2NUB A;  4QOZ B;  3K57 A;  5KTQ A;  1W2B M;  4FJJ A;  3P38 A;  2A3Z A;  1WSF A;  3VF6 A;  1YTA A;  2ETJ A;  4DV6 K;  4Z4I A;  2FLO A;  3NH1 A;  4O44 A;  4GW6 A;  3CQX A;  1HQE A;  1Z25 A;  3ATV A;  1NGH A;  1SZ2 A;  4BRN A;  3DRP A;  1YXQ A;  4XIU A;  4CZH A;  1YAG A;  4FK4 A;  4DR2 K;  4JKD A;  2RPI A;  2V51 B;  5M1O A;  1SKS A;  1L3S A;  4DWI A;  3H1Q A;  1A5X A;  3HP9 A;  2G8K A;  1XQS C;  4KH5 A;  4RG8 A;  1NK9 A;  2KZM A;  3O9S A;  1NMN A;  3S3O A;  4BGA A;  4BRO A;  1T7P A;  2HHV A;  1HYV A;  1VQK N;  3D2F A;  3IFR A;  4KPY A;  5FRN A;  3VGK A;  3AVM A;  2HND A;  4FWQ A;  1WSJ A;  3AY9 A;  3AA2 A;  3ZT1 A;  3HI0 A;  3T3F A;  2PAV A;  3TAE A;  1MDU B;  1UOC A;  4BRK A;  4JKB A;  4RCH A;  2G8W A;  4CFB A;  5BRD A;  3R8E A;  4H5W A;  1EWR A;  3K2P A;  3ZSR A;  5AQJ A;  4FWS A;  1J5E K;  3TAG A;  1NGG A;  3O08 A;  3L4Q A;  4KHW A;  4ELT A;  3QO9 A;  3NE6 A;  5EU7 A;  1JCG A;  4A62 A;  3BY5 A;  2Y1J A;  1R0A A;  4FVU A;  4GMJ B;  3HVR A;  2IVP A;  1LWF A;  2PBD A;  3HO1 A;  4R79 A;  4JKC A;  3QML A;  4B9L A;  2ASP A;  4ILJ A;  3JAM O;  5H1S Q;  3BF1 A;  1N32 K;  3SQ1 A;  4E7I A;  3LP0 A;  1BDG A;  1RBU A;  4CF8 A;  3K58 A;  3QEX A;  1EET A;  3T1Y K;  1S6P A;  2XY6 A;  3TAR A;  1MA9 B;  1WN7 A;  3OS1 A;  3EE8 A;  4H8K A;  4FLY A;  1EP4 A;  2D0B A;  3J7Z O;  3BF3 A;  3H3O B;  4CJT A;  1C0M A;  2ZGZ A;  1GLA G;  3V9X A;  3OYD A;  1T6C A;  4F2S A;  1CXQ A;  4DSL A;  3HOT A;  1BL3 A;  3NAE A;  5AFU A;  1DTT A;  3TAF A;  2YNI A;  3KIO A;  1KVB A;  3ZX2 A;  5HRP A;  3K9J A;  1ATS A;  3HJF A;  3ENO A;  4FJM A;  2YJE A;  3NF7 A;  2YHB A;  1S22 A;  2NLX A;  3L2Q A;  1IBL K;  4FJH A;  1Q86 O;  3LZJ A;  1YVU A;  1VQ5 N;  3L0Q A;  3U3G A;  4DTX A;  1RTH A;  2KFZ A;  2B5J A;  2UU9 K;  3BDP A;  2QK9 A;  3AVC A;  1KLN A;  1S3X A;  4BDY A;  2JWK A;  1UA0 A;  1ZC6 A;  5HRN A;  3N4Q A;  4ID5 A;  1IKV A;  3NF6 A;  4K8Z A;  5GAE P;  2FF6 A;  4WYB A;  4B9T A;  1U4B A;  3RR8 A;  1NK7 A;  4DSJ A;  4DKW A;  4FWR A;  4CJR A;  3E01 A;  4M3Y A;  4IDK A;  3LM2 A;  3CIP A;  3C7N A;  4EHT A;  2XO7 A;  3DXK B;  3S3N A;  2GWJ A;  4DTP A;  3VQP A;  1VRU A;  2OPS A;  4CEE A;  3CYM A;  1K9M O;  3IKM A;  4Y0W A;  1Q81 O;  3NBP A;  3TSU A;  3THY A;  1KSP A;  1C0U A;  4DQI A;  2IAJ A;  2YJF A;  3JSM A;  4DUY K;  4K0K K;  2W42 A;  1LV5 A;  1NOY A;  4JD2 A;  3ZT4 A;  1HLU A;  3PO5 A;  3CME N;  1EO1 A;  2F8S A;  5C24 A;  5AQO A;  5BRF A;  2FC0 A;  3OYN A;  2E2O A;  4PKG A;  4DTJ A;  2IVO A;  4OPH A;  1FK9 A;  4FWM A;  2Q31 A;  4M3R A;  2YCH A;  5F0X A;  5KGW A;  2V52 B;  4DG1 A;  3LAN A;  3RRG A;  3KLF A;  3EY1 A;  4CEF A;  2HHH K;  1VSF A;  1HPZ A;  3E9L A;  2NZT A;  4B1U B;  4DSF A;  1Y64 A;  1EXQ A;  4CGH A;  4CZE A;  4JS4 A;  4JI0 K;  4NCA A;  3C6U A;  1DGK N;  5I3U A;  2D0P A;  2BUP A;  3HSC A;  3KZB A;  4N76 A;  4IFV A;  3VF4 A;  4EZ6 A;  3HOS A;  1NOZ A;  3UKR B;  3FGU A;  5DM6 L;  2QWR A;  4OLA A;  4FW1 A;  4CD1 A;  1RBV A;  1HNZ K;  4WE1 A;  1OH5 A;  4FJN A;  5FPE A;  3VQA A;  2ZJP L;  3CPE A;  4KH4 A;  1S1W A;  4DHY A;  3KD5 E;  3KTQ A;  3EKS A;  2IVN A;  3ZT0 A;  4YY3 K;  3CCQ N;  3ALY A;  3RTV A;  3NDK A;  1IBM K;  1ZBF A;  1QQN A;  4XEI A;  4L8R B;  1D9D A;  3W0L A;  5E41 A;  4PKI A;  2O8E A;  4BR7 A;  3HPG A;  1K6Y A;  3TAP A;  1KAX A;  1SQK A;  3O9U A;  5DM7 L;  4LH4 A;  1C1B A;  2QM1 A;  1L3V A;  1U45 A;  2Z1J A;  1ATN A;  1D8Y A;  1TAU A;  3VER A;  5FPN A;  3VF2 A;  1J5O A;  2P9U B;  3ZEU A;  1JLB A;  3L3U A;  3T19 A;  3HTV A;  4BE1 A;  5M1K A;  4FJ7 A;  1VSK A;  5SZT A;  4LF7 K;  1HUX A;  4IJN A;  2BTF A;  4CCH A;  2E88 A;  2Q0U A;  3M8Q A;  4HUE A;  3AVJ A;  4DV4 K;  2EWS A;  3ASM A;  3QEW A;  3O3G A;  4B3T K;  2NRV A;  2OZS A;  2QWP A;  4BE0 A;  3CCL N;  3QEI A;  4KI6 A;  5GAG P;  2E1Y A;  3V9Z A;  1DKG D;  1WLJ A;  1HPM A;  5AQT A;  5KPR A;  1E3M A;  2VWJ A;  2VCP A;  1NWK A;  3DLL L;  2AP1 A;  3CCR N;  3AVB A;  4ISE A;  3L2W A;  1HNX K;  3QNO A;  1WSI A;  2VG5 A;  4FM1 A;  4LFC K;  5C2D A;  5GAD P;  1VQ7 N;  5FLX O;  1U2V B;  1TVR A;  1NK4 A;  4MLH A;  1JLF A;  2NRH A;  3THW B;  5JVH L;  3Q7C A;  2ITG A;  4CBW A;  3FZL A;  1O13 A;  2LSN A;  4XH5 A;  4DV2 K;  3TTC A;  4DU3 A;  5KQD A;  4RW6 A;  4F4K A;  3FLC O;  3EEQ A;  4YDU C;  2Q97 A;  3T7Z A;  2G8I A;  3I8B A;  5AQF A;  2P1J A;  3MEC A;  1KLM A;  5CZ2 A;  3AVF A;  1L5U A;  5GIO A;  1B9F A;  2DFH A;  3L4I A;  3MED A;  4MDB A;  3V6D A;  1RT2 A;  3DRS A;  2YHA A;  1U04 A;  2FSN A;  5BR9 A;  4JLH A;  4LC9 B;  4O5F A;  3NFA A;  1YF5 L;  3ZCM A;  2Q1N A;  4W5T A;  3PIO L;  2P9L B;  4CEZ A;  4JKA A;  4DFJ A;  3D0P A;  3HPO A;  1Q7Y O;  2D0C A;  1HKC A;  2BDP A;  1IJJ A;  4CK1 A;  1QS4 A;  3V9S A;  1NK8 A;  1BO5 O;  4CJQ A;  1Y97 A;  4RW4 A;  1BI4 B;  4FVM A;  2W6K A;  1DT9 A;  1RCH A;  2IS3 A;  3T69 A;  4JKG B;  2CGK A;  4O0J A;  3LZI A;  1D4X A;  1XNQ K;  1XMO K;  4FLT A;  4CFC A;  1X9S A;  1NM1 A;  4PQU A;  4YOR A;  1JL2 A;  1UA1 A;  1OH6 A;  3EO3 A;  2VG6 A;  4KFB A;  4ISG A;  2NRX A;  3IMX A;  4DFP A;  2HNY A;  4BC5 A;  2HHX A;  3LDS A;  4X62 K;  4H5N A;  1WSG A;  3THX B;  3HK2 A;  5AZI A;  2QWL A;  2BH1 A;  1L3U A;  5FRM A;  3SAG A;  1QZ6 A;  4PY5 A;  5C10 A;  3TSQ A;  4C23 A;  4YOX A;  3CCE N;  3K5N A;  4CJK A;  4IEI A;  4QS7 A;  4OKE A;  3IUC A;  3VA3 A;  1YJ9 N;  4CZF A;  3N4P A;  4GVM A;  2O8B A;  1KAZ A;  3FR0 A;  1B92 A;  3FZH A;  3NHG A;  5JLH A;  3HVT A;  3TSP A;  2YKM A;  2X74 A;  1IKW A;  1TK8 A;  3CQ8 A;  1BUP A;  1ASU A;  4BC2 A;  4BE2 A;  3VQ5 A;  2KTQ A;  3OBW A;  3QEV A;  2A6A A;  2G8V A;  1XI1 A;  2UXB K;  3MXJ A;  4KTZ A;  1WSH A;  1OH7 A;  1X1P A;  3H3N O;  3ID6 A;  5ADX H;  1WAJ A;  2P9U A;  2HMI A;  4Z94 A;  4WQ5 A;  3CJ1 A;  3OYC A;  3O1B A;  4JK9 A;  4PL8 A;  3J7A P;  3OYE A;  3KLE A;  3V9U A;  3B6O A;  1HJO A;  3VOV A;  4B9M A;  3J7Y P;  3VEX A;  4JAX A;  5ELZ A;  4CHP A;  3P39 A;  1JXE A;  2OTL N;  4OPJ A;  2F9W A;  1R59 O;  1RBT A;  4FW2 A;  3QES A;  2YHX A;  4JI8 K;  3KLI A;  1KQS M;  4FJX A;  2A1R A;  4PHT X;  4CJE A;  3GOI A;  4BR2 A;  4LSL A;  2FBT A;  4EAH D;  3OYB A;  3V9W A;  4IOA L;  4LF4 K;  2B6A A;  4FJL A;  2IDO A;  4CEB A;  3CCS N;  4DR5 K;  1ZBL A;  5J2P A;  3LL3 A;  2JLE A;  1KVA A;  2D0A A;  1I3A A;  4I2Q A;  4CIF A;  3DI6 A;  3SBG A;  4FM0 A;  1VSM A;  3SBT A;  4LF8 K;  4FWP A;  2A42 A;  2OA8 A;  3QIP A;  1I94 K;  4DLG A;  1TK5 A;  2E2P A;  3LM9 A;  3QEP A;  3WNE A;  3SMS A;  4BRP A;  3MN7 A;  4RTF D;  1NU0 A;  5BRH A;  4OGC A;  4CIE A;  3OA9 A;  4DQS A;  4AHS A;  3PX4 A;  4WF9 L;  4QCL A;  1T6D A;  2FXU A;  1N36 K;  1S6Q A;  3BEX A;  1WNS A;  4Q0B A;  4CJV A;  4CZL A;  3U9Z A;  4JI1 K;  4FJG A;  4CJP A;  2A41 A;  2RN2 A;  1K8A O;  1DEJ A;  1BCO A;  4R5P A;  4BR5 A;  1BHL A;  5EY4 A;  2H3G X;  3HZ6 A;  4DTU A;  1VSJ A;  4Q5V A;  4AH9 A;  3CCU N;  4FPA A;  3ULD A;  4DSE A;  1RIL A;  1XNR K;  3MEG A;  2WC9 A;  1BOT O;  3WQU A;  1TL1 A;  1KXP A;  1T44 A;  2NNW A;  3WT0 A;  4M45 A;  4CZM A;  2Z1I A;  4K25 A;  2FBV A;  4PL7 A;  4NXM K;  4WQ4 C;  2VWB A;  4H5V A;  3HXM A;  3F9M A;  5HRR A;  4DV3 K;  4C8L A;  4IJA A;  3R9P A;  1K73 O;  2OPR A;  1CLQ A;  4XH1 A;  3AA4 A;  4B9S A;  3I55 N;  2QTD A;  3GDQ A;  5FPM A;  1EQY A;  1KD1 O;  4JKG A;  4I9L A;  3S3M A;  1E4G T;  2P9K A;  1GLD G;  4AHU A;  3ATU A;  2UUB K;  2JGU A;  3U9D A;  3OS2 A;  1X9W A;  3V1R A;  2QW9 A;  3BP8 A;  4I6M B;  2GBZ A;  3AVA A;  1JLG A;  4DS4 A;  5E26 A;  5AQG A;  3CI5 A;  1VQ6 N;  1SL0 A;  1UAX A;  2X6N A;  2FBY A;  4KTW A;  4H0O A;  4O8U A;  1QZ5 A;  3FFK B;  4I2P A;  4AQY K;  3VTI A;  4DCH A;  4CJS A;  1YIJ N;  1XWL A;  1ZBS A;  3MEE A;  4B1X B;  2WBN A;  3VEN A;  3CET A;  4WCE L;  4NXN K;  4DU1 A;  1ZBU A;  3H6E A;  5AQU A;  1V4T A;  4FLZ A;  3WNH A;  4BGB A;  2F96 A;  1NJZ A;  1TYQ B;  3K5M A;  3O9R A;  1NG9 A;  3OYM A;  3CC2 N;  2IOC A;  1X3N A;  4FJ9 A;  5AQL A;  2YHY A;  1CXU A;  2I7P A;  4HWI A;  5KRS A;  1N8R O;  2HNZ A;  5DMR A;  4B9V A;  2ZJR L;  3O6W A;  2O8C B;  4BDP A;  4DV0 K;  1VQO N;  2KQ2 A;  3WXK A;  4E7H A;  2HF3 A;  4N47 A;  2UXD K;  4KB0 A;  2F9T A;  1KTQ A;  4KHP K;  4IOC L;  1VQ4 N;  1YI2 N;  3NF9 A;  3F73 A;  4A61 A;  4B3M K;  3OJS A;  4F8R A;  1V4S A;  3VMF B;  1J54 A;  4KTQ A;  1U47 A;  3PY8 A;  3JXU A;  4IZ9 A;  5IT9 O;  3ZYY X;  4DR3 K;  2B4J A;  2QXL A;  4CBU A;  1Q9X A;  4FK2 A;  3SAF A;  4E3S A;  1A5W A;  3SQ0 A;  3AO2 A;  3AO4 A;  2P9S B;  4FZY A;  4DTM A;  1C0G A;  4JI2 K;  4PA1 A;  4B9N A;  4ISF A;  5AQV A;  4M41 A;  3A5N C;  4CHY A;  2V7Z A;  2P9P B;  4CI6 A;  1Z26 A;  2A40 A;  4AF1 A;  1IG9 A;  3SK3 A;  3CG7 A;  4NLB A;  5TKY A;  4IG3 A;  1WBD A;  3LAK A;  3QNN A;  4OPA A;  1U6Z A;  1T03 A;  3VQB A;  1NKC A;  3TWH A;  1EX4 A;  1RT6 A;  3VEW A;  3AA5 X;  3SPZ A;  1RGI A;  4W5O A;  3SCX A;  4C1N I;  1VQ9 N;  2O8F A;  1EKE A;  1RDW X;  4DF4 A;  1QE1 A;  1TKZ A;  4HTL A;  4C8M A;  4AM6 A;  1B9D A;  3IDH A;  3C6T A;  3UIQ A;  2CH6 A;  1YUW A;  1GLC G;  3A2F A;  3CCJ N;  5CY4 A;  3TAQ A;  1RDC A;  3TPQ A;  3VN5 A;  4M63 C;  2GX9 A;  2WON A;  5AR0 A;  4BRG A;  3DXM B;  3QIC A;  2D0O A;  3CJA A;  4JI6 K;  4CGG A;  4E1M A;  4FO0 A;  5JS2 A;  4F2R A;  1LWC A;  1XUP O;  1IV0 A;  2E4L A;  4ILH A;  1ZXO A;  3DLE A;  4J2A A;  1L3T A;  4NYF A;  3VEZ A;  4H0X B;  4FZX C;  2Q3S A;  1OVQ A;  4NCG A;  4DFK A;  4CZI A;  3OYK A;  1K8K B;  4DR4 K;  1Z6R A;  4BRD A;  2GWK A;  4KHU A;  2HHQ A;  4PKH A;  3RSE B;  4B3S K;  2P9I A;  2HBJ A;  1A5V A;  1REV A;  2PFU A;  3QDK A;  4CED A;  1OKJ A;  1YT3 A;  5BPM A;  4CF2 A;  1RT3 A;  2RHK A;  5EX5 A;  4ID1 A;  2FSK A;  2CGJ A;  2XY5 A;  2HST A;  3DOL A;  3SAH A;  2F8T A;  2W6L A;  1NK0 A;  4A57 A;  5LMU K;  3SQ2 A;  4DF8 A;  3EKU A;  3KK3 A;  4KV8 A;  3HP6 A;  3ZT2 A;  4CJU A;  5AZJ B;  4DTO A;  5J2N A;  4BRH A;  4DLE A;  4KRE A;  4BRQ A;  1ITG A;  5FRO A;  4A59 A;  3E66 A;  4IWV A;  1YIT N;  2ATQ A;  3HYF A;  4B1Z A;  3KD1 E;  2HF4 A;  4BAC A;  3K59 A;  1X3M A;  4BWJ A;  1QHA A;  3DLH A;  1XHX A;  4M3U A;  5I9E B;  3ZLJ A;  4LY7 A;  4OLB A;  3OW2 M;  2HBL A;  1KC8 O;  4H5T A;  4B1W B;  1SL2 A;  4FPB A;  1QSS A;  1BA1 A;  3DYA A;  2EX3 A;  3NMU A;  5HBM A;  4KHN A;  3VQ9 A;  3B8A X;  3VEO A;  4OGE A;  3VEY A;  3U6F A;  4FLX A;  2E6M A;  3PUF A;  4M3Z A;  2JWL A;  3WNG A;  1QSL A;  1VQN N;  4H0T B;  1OVY A;  3ZSW A;  4WFB L;  3VEV A;  3VQQ A;  3A5O C;  3IS9 A;  4AHT A;  3FZK A;  3GBT A;  5LL6 Z;  1VSI A;  3H08 A;  4DU4 A;  3O8M A;  2DFF A;  3OJU A;  4CF9 A;  3SUQ A;  3MN9 A;  5D3G A;  1G15 A;  3FE1 A;  1HNW K;  3CCM N;  4RW8 A;  4LSN A;  4HVJ A;  2PY5 A;  5LMN K;  4OJR A;  1RDA A;  4B9Q A;  4NCB A;  1C0T A;  3KLG A;  3CXC M;  1BQM A;  4OVL A;  3ULE B;  3U3Y A;  3RWU A;  1LAV A;  2W41 A;  3SPY A;  1GLB G;  5HP1 A;  1Q9Y A;  1VQ8 N;  1XMQ K;  1N33 K;  2OYQ A;  4LH5 A;  3LDP A;  5BPL A;  2EHG A;  3Q7B A;  4PUO A;  3DLG A;  3S41 A;  4I9Q A;  3KKS A;  2P9N B;  3CJC A;  5TKW A;  3RRH A;  1XHZ A;  3R6M A;  4FZZ A;  5C2F A;  4DQR A;  2O8D B;  3C65 A;  3I0R A;  3DOK A;  2YV0 X;  4F3T A;  2DTU A;  3WNF A;  4IBN A;  4DV1 K;  3ZSQ A;  3AVK A;  5AQR A;  4C1N K;  1HX1 A;  4JKH A;  2HOE A;  4CGF A;  4ZHR A;  3WEE B;  1TV6 A;  4CHZ A;  3CFP A;  3GE1 A;  4Z4G A;  4A5B A;  3VES A;  4FOI A;  4H0Y B;  1S1V A;  1RDU A;  4JI4 K;  1E4F T;  3AGK A;  2CH5 A;  1ESV A;  2W40 A;  3CER A;  1S9E A;  4E1J A;  1NGD A;  4ILG B;  4B8C A;  4W5R A;  3VPZ A;  5KI6 A;  1KVC A;  1MU2 A;  3DXK A;  1T05 A;  4EHU A;  3I56 N;  4BQZ A;  4IFY A;  4FLW A;  4FLU A;  4KO0 A;  1BIU A;  3ENB A;  5AQM A;  3RSE A;  5EOY A;  1RT7 A;  5KRT A;  1JCE A;  1VHX A;  4WQ4 A;  3OBY A;  1JJ2 M;  1HNI A;  3AO5 A;  3TI0 A;  2VGM A;  4FJI A;  3SV4 A;  4HHT A;  5M1P A;  4A5A A;  3FZF A;  2FF3 B;  3AA3 A;  4DSI A;  4OKJ A;  2A5X A;  3LP3 A;  4BVO A;  1CZ9 A;  3O1W A;  1JL1 A;  3DM2 A;  3WUH A;  2QWO A;  3O4W A;  3OYI A;  4JRQ A;  3SUP A;  5J1E A;  3L3V A;  3M3Z A;  2P5O A;  3K9K A;  1YTU A;  4H0V B;  4BRM A;  1WSE A;  4JK8 A;  4MO5 A;  5F2R A;  3CFR A;  4WFA L;  1EWQ A;  4IO9 L;  2ZD1 A;  1LAW A;  3EZ5 A;  4DMN A;  2UXC K;  3OYJ A;  1BU6 O;  4KH6 A;  3LAL A;  2E20 A;  2FBX A;  4BRC A;  4LF6 K;  2E5L K;  3UKR A;  4KAZ A;  5LJV A;  2HBK A;  1RT5 A;  4BRF A;  3OY9 A;  1NMD A;  3HRG A;  3SJH A;  4KRF A;  3T1H K;  4Z4E A;  2FSJ A;  3D2F B;  4E19 A;  3MWP A;  3CCV N;  1S5J A;  4NYN A;  3CF5 L;  1QVG M;  4FWK A;  1RDB A;  1Q18 A;  3C0B A;  4HUG A;  1BG3 A;  3U4L A;  4IO8 A;  4LF5 K;  5AQX A;  4B8A B;  3SI6 A;  3SZ2 A;  4Z4H A;  1SS6 A;  4E7K A;  4EFH A;  2G8H A;  4ZTF A;  4J2D A;  4BRL A;  4CJ3 A;  3P31 A;  1RNH A;  1HNV A;  3QB0 A;  3W3D A;  4OPK A;  3LDL A;  5E84 A;  4DSK A;  1S72 N;  2E6L A;  3CHW A;  3KK2 A;  1JXB A;  3VQ6 A;  3P4I A;  2GEL A;  4CFA A;  4YOV A;  3UE5 A;  4LFB K;  3QER A;  4GKK K;  3AO3 A;  3M5R A;  4YNQ A;  2E2N A;  2YKN A;  4FWL A;  5C25 A;  1J9A A;  3AVG A;  4CZG A;  2ZQB A;  4EP4 A;  3MXM A;  4U67 L;  4O5B A;  1HRH A;  1ZBH A;  4L3Q A;  4V19 S;  3NH0 A;  5EVZ A;  4JYA K;  4NB4 A;  4B3R K;  3G4S N;  3ULE A;  4DR6 K;  1RBR A;  4H4M A;  4JKE A;  3WXI A;  2QWQ A;  3O4Q A;  4CF1 A;  5F1X A;  3NGY A;  2Q36 A;  5K14 A;  3VQ4 A;  2IGI A;  2PYJ A;  4DUZ K;  4UQG A;  2DPN A;  4LF9 K;  1NGI A;  3R1X A;  2GUI A;  4MDA A;  4JI3 K;  1JKH A;  1U2V A;  1C1A A;  3ITH A;  2O8D A;  4OO1 J;  1GOC A;  3E9O A;  4AHC A;  1YJN N;  1DTQ A;  2UYT A;  3RMD A;  4B1V A;  3THW A;  3VQC A;  4AM7 A;  1NJX A;  4FJK A;  3PLA A;  3AGR A;  2P5G A;  3CC4 N;  2ZGY A;  5BN9 A;  1GLE G;  2Z1G A;  3WEE A; 
#chains in the Genus database with same CATH homology
 1SUQ A;  3VQA A;  4PA1 A;  3OYF A;  4B9N A;  1IKY A;  1O1W A;  1TAQ A;  3NF8 A;  5C42 A;  4M41 A;  1S1W A;  3KD5 E;  1RTJ A;  2PYL A;  3KTQ A;  4CHY A;  1X9M A;  1VSH A;  3ZT0 A;  4FJ5 A;  3ALY A;  1Z26 A;  3RTV A;  1HQU A;  3NDK A;  1VSE A;  1HJR A;  1IG9 A;  3CG7 A;  1ZBF A;  3DMJ A;  4IG3 A;  3LAK A;  3QNN A;  3NCI A;  4HUF A;  1W0H A;  3CM5 A;  3VQB A;  1T03 A;  1D9D A;  1NKC A;  4L8R B;  4CFD A;  3TWH A;  4O0I A;  1EX4 A;  1Q8I A;  1RT6 A;  5E41 A;  3S9H A;  4B08 A;  1NJW A;  3HPG A;  3P5J A;  1K6Y A;  3TAP A;  3JYT A;  3LP1 A;  3AA5 X;  3SPZ A;  1D5A A;  1SV5 A;  4LH4 A;  4W5O A;  3SCX A;  1C1B A;  5CYQ A;  1L3V A;  3AVH A;  1EKE A;  1U45 A;  2Z1J A;  4DF4 A;  1D8Y A;  1TAU A;  4HTU A;  1QE1 A;  4CJL A;  1TKZ A;  1J5O A;  3MXI A;  3B6P A;  4C8M A;  1B9D A;  1N5Y A;  3C6T A;  3UIQ A;  2BE2 A;  3TAM A;  2BGG A;  1JLB A;  3OYH A;  3L3U A;  1BI4 A;  3A2F A;  1ASW A;  4OKK A;  3T19 A;  4BE1 A;  5CY4 A;  3TAQ A;  4W5N A;  3KKR A;  3AVN A;  4JRP A;  1VSK A;  4FJ7 A;  3DRR A;  4CEC A;  5SZT A;  1KRP A;  1RDC A;  3LAM A;  2VWK A;  1BQN A;  4CK3 A;  1S1U A;  3VN5 A;  4CJF A;  1TKX A;  2WON A;  4FM2 A;  4CCH A;  1JLQ A;  4DQP A;  3BGR A;  4E89 A;  3M8Q A;  4CGG A;  4HUE A;  3ZSX A;  4E1M A;  5JS2 A;  4F2R A;  1LWC A;  3AVJ A;  1U49 A;  2E4L A;  3O4N A;  3ASM A;  5CZ1 A;  3QEW A;  5DK5 A;  2YNH A;  3DLE A;  3O3G A;  4J2A A;  2HVI A;  4CER A;  1L3T A;  1TL3 A;  1VRT A;  4NYF A;  2OZS A;  4YFU A;  4BE0 A;  4FZX C;  3QEI A;  3OVN A;  4KI6 A;  2AJQ A;  2Q3S A;  4NCG A;  3V9Z A;  4DFK A;  1WLJ A;  3OYK A;  3IG1 A;  4CJW A;  3SNN A;  2BAN A;  5HLF A;  4LD0 A;  2HHT A;  3QLH A;  4AHV A;  1BGX T;  3HL8 A;  2VWJ A;  4IKF A;  4E7J A;  4HCC A;  4KHU A;  2HHQ A;  2KW4 A;  3AVB A;  1RT1 A;  3DLR A;  3ZSO A;  3L2W A;  3QNO A;  4EP5 A;  1WSI A;  2VG5 A;  3C94 A;  4FM1 A;  1A5V A;  1IH7 A;  1RDD A;  5HRO A;  1REV A;  4HCB A;  3AO1 A;  2OZM A;  4CED A;  4JS5 A;  3TAB A;  2GV9 A;  1YT3 A;  1TVR A;  1NK4 A;  4CF2 A;  3LPT A;  2KFN A;  1JLF A;  4FK0 A;  1XC9 A;  1S9G A;  4BDZ A;  1C1C A;  3FFI A;  2ITG A;  1RT3 A;  4H4O A;  3MAQ A;  4ID1 A;  3I8D A;  4EZ9 A;  2LSN A;  2A1S A;  3K5O A;  2XY5 A;  4DU3 A;  5FDL A;  3DOL A;  1HYZ A;  2HHS A;  4RW6 A;  2F8T A;  4F4K A;  4AIL C;  1NK0 A;  1F21 A;  3L8B A;  3C95 A;  3SQ2 A;  3VA0 A;  2G8I A;  4Z4C A;  4DF8 A;  2P1J A;  3MEC A;  1KLM A;  5CZ2 A;  4CJ5 A;  3AVF A;  3KK3 A;  1N6Q A;  4KV8 A;  3HP6 A;  1L5U A;  4M3T A;  3ZT2 A;  1LWE A;  1B9F A;  4CJU A;  4DTO A;  2DFH A;  5J2N A;  1ASV A;  2KZZ A;  4DLE A;  4N41 A;  3MED A;  4KRE A;  3V6D A;  1IKX A;  1RT2 A;  3DRS A;  1ITG A;  5FRO A;  2YHA A;  1RTI A;  4CHO A;  1U04 A;  1BIS A;  5SWM A;  4DTR A;  4JLH A;  4Y1D A;  2ATQ A;  3HYF A;  3NFA A;  3ZCM A;  4W5T A;  5J2M A;  4B9U A;  4Y1C A;  4CEZ A;  2HHW A;  3M8S A;  3KD1 E;  4BAC A;  4DFJ A;  3K59 A;  4QAG A;  3D0P A;  4DTN A;  3SUN A;  3HPO A;  3RMB A;  1QTM A;  2OPQ A;  4BWJ A;  2D0C A;  3DLH A;  1XHX A;  4M3U A;  4FLV A;  2BDP A;  4LY7 A;  2XY8 A;  4E0D A;  4OLB A;  4DTS A;  5J2Q A;  4DS5 A;  1GOB A;  4CK1 A;  3SJJ A;  2RF2 A;  1QS4 A;  3VQE A;  3V9S A;  1NK8 A;  1NK6 A;  3KJV A;  4CJQ A;  3OYG A;  4C8K A;  1SL2 A;  1Y97 A;  3ZSZ A;  4RW4 A;  1BI4 B;  3SYZ A;  1QSS A;  4B3O A;  4FYD A;  4FVM A;  2HB5 A;  3OYA A;  3V1O A;  3DYA A;  3VQ7 A;  1RCH A;  2EX3 A;  4M42 A;  2IS3 A;  5HBM A;  1ZYQ A;  4KHN A;  3VQ9 A;  1VSL A;  4Z4F A;  4O55 A;  1S1X A;  4TSX A;  4O0J A;  4OGE A;  3U6F A;  3HPH A;  4CIG A;  4FLX A;  3VQD A;  3LP2 A;  2E6M A;  3PUF A;  3K5L A;  3LZI A;  4CF0 A;  4M3X A;  1RT4 A;  3V4I A;  4M3Z A;  4KB1 A;  2XRI A;  4FLT A;  4CFC A;  4CEO A;  1X9S A;  3WNG A;  4FJ8 A;  3TR8 A;  1JL2 A;  1UA1 A;  1QSL A;  4PQU A;  2HW3 A;  2VG6 A;  4CES A;  4KFB A;  1LW0 A;  3I0S A;  1W9H A;  3F9K A;  1VK0 A;  1LW2 A;  4DFP A;  3ZSW A;  1KFD A;  2HNY A;  4Z0U A;  2G8F A;  3SV3 A;  3D45 A;  3VQQ A;  3IS9 A;  4AHT A;  4CJ4 A;  2Z1H A;  2HHX A;  1BCM A;  3LDS A;  3O3H A;  1VSI A;  1WSG A;  3H08 A;  4CGJ A;  4DU4 A;  1QQC A;  3HK2 A;  1HYS A;  2DFF A;  2X78 A;  3OJU A;  1SL1 A;  4CF9 A;  2D5R A;  4J2E A;  3SUQ A;  3IRX A;  5D3G A;  5FRM A;  1L3U A;  1FXX A;  1G15 A;  5T7B A;  3RMC A;  2NUB A;  4KHS A;  4QOZ B;  3K57 A;  4RW8 A;  5KTQ A;  4LSN A;  4HVJ A;  2PY5 A;  4FJJ A;  4ZTJ A;  3V1Q A;  4FJN A;  4OJR A;  4AHR A;  3DLB A;  4PY5 A;  1RDA A;  1WSF A;  1YTA A;  2ETJ A;  4NCB A;  3K5N A;  4Z4I A;  2RKI A;  2OPP A;  4CJK A;  4OKE A;  3NH1 A;  3AVI A;  3VA3 A;  4O44 A;  1C0T A;  3KLG A;  4GW6 A;  1HQE A;  1Z25 A;  1BQM A;  3SQ4 A;  4GVM A;  4OVL A;  3U3Y A;  3RWU A;  1FKO A;  1LAV A;  3DRP A;  3SPY A;  4RW9 A;  1B92 A;  5HP1 A;  1Q9Y A;  5HRS A;  4XIU A;  2OYQ A;  4LH5 A;  3NHG A;  4FK4 A;  3RR7 A;  3HVT A;  2EHG A;  4PUO A;  2YKM A;  2X74 A;  5KGX A;  3DLG A;  3PX0 A;  4I9Q A;  1IKW A;  1TK8 A;  3KKS A;  3CQ8 A;  2RPI A;  1ASU A;  3RRH A;  4BE2 A;  3VQ5 A;  1XHZ A;  1SKS A;  1L3S A;  4DWI A;  2KTQ A;  1D9F A;  1A5X A;  4FZZ A;  3HP9 A;  2G8K A;  3QEV A;  2Y1I A;  3THV A;  4RG8 A;  1NK9 A;  2G8V A;  2KZM A;  1XI1 A;  3S3O A;  4DQR A;  3MXJ A;  4KTZ A;  3I0R A;  1WSH A;  3DOK A;  2YV0 X;  1X1P A;  4F3T A;  1T7P A;  2HHV A;  1HYV A;  1TKT A;  2DTU A;  2XHB A;  4KPY A;  4PWD A;  3WNF A;  5FRN A;  4IBN A;  1WAJ A;  2X6S A;  3ZSQ A;  3AVM A;  2I5J A;  3AVK A;  2HND A;  2HMI A;  4CHQ A;  4ICL A;  3OYC A;  1WSJ A;  4CGF A;  4ZHR A;  3LWL A;  3AA2 A;  3DLK A;  3ZT1 A;  4CK2 A;  3OYE A;  3B6O A;  2ZE2 A;  3G10 A;  1IO2 A;  3KLE A;  3V9U A;  3T3F A;  5CYM A;  4B9M A;  1TV6 A;  4CHZ A;  3CFP A;  4DQQ A;  4N5S A;  3TAE A;  4CHP A;  1UOC A;  3CM6 A;  2G8W A;  1QHT A;  4CFB A;  3V81 A;  1JLA A;  1JXE A;  1RBS A;  4KHY A;  4Z4G A;  4OPJ A;  2HHU A;  1S1V A;  3K2P A;  3IAY A;  3ZSR A;  1RBT A;  4C8O A;  4FW2 A;  3QES A;  3KLI A;  4FJX A;  3VQ8 A;  3QET A;  3TAG A;  2A1R A;  4CJE A;  3OYB A;  4K8X A;  4LSL A;  2FBT A;  3V9W A;  3P83 D;  1S9E A;  4B8C A;  4KHW A;  3TAN A;  4ELT A;  3QO9 A;  2B6A A;  3NE6 A;  4W5R A;  5EU7 A;  4FJL A;  2IDO A;  4CEB A;  2Y1J A;  5KI6 A;  1KVC A;  1MU2 A;  4GMJ B;  3HVR A;  1ZBL A;  4FLU A;  3P1G A;  4IFY A;  4FLW A;  1T05 A;  2G8U A;  2QKB A;  5J2P A;  1LWF A;  4KO0 A;  1BIU A;  3HO1 A;  2JLE A;  1KVA A;  2D0A A;  1I3A A;  4I2Q A;  3AV9 A;  4KKO A;  4CHN A;  3M8R A;  4CIF A;  4KHQ A;  4B9L A;  5KRT A;  1RT7 A;  2VG7 A;  3DI6 A;  4FM0 A;  5JS1 A;  1SKW A;  1VSM A;  3ISN C;  3OYL A;  2DY4 A;  3KK1 A;  3HM9 A;  2OA8 A;  3QIP A;  1HNI A;  3SQ1 A;  3AO5 A;  3TI0 A;  4FJI A;  2IC3 A;  4DLG A;  1TK5 A;  3SV4 A;  4HHT A;  4E7I A;  3QEP A;  1TKD A;  3LP0 A;  4G1Q A;  3WNE A;  1ZBI A;  3AA3 A;  1RBU A;  4OKJ A;  4OGC A;  4CF8 A;  4CIE A;  3K58 A;  4AHS A;  1EET A;  3LP3 A;  1S6P A;  4DQS A;  3QEX A;  1CZ9 A;  1WN7 A;  1JL1 A;  3OS1 A;  3DM2 A;  2XY6 A;  3TAR A;  4QCL A;  4H8K A;  3OYI A;  1S6Q A;  3G0Z A;  4JRQ A;  3L2U A;  3SUP A;  3NGI A;  5J1E A;  3L3V A;  2PZS A;  1WNS A;  3T1A A;  1EP4 A;  2D0B A;  4FLY A;  4CJV A;  1SKR A;  2P5O A;  1YTU A;  4Q0B A;  1I39 A;  4CJT A;  1C0M A;  4CE9 A;  4FJG A;  4CJP A;  3V9X A;  1WSE A;  2RN2 A;  1U48 A;  4FZY A;  1NJY A;  3OYD A;  1FKP A;  3CFR A;  4F2S A;  1CXQ A;  3ZSV A;  4DSL A;  1BCO A;  4R5P A;  1BL3 A;  3NAE A;  1TK0 A;  4ELU A;  1BHL A;  1DTT A;  3TAF A;  2YNI A;  1HMV A;  4DTU A;  2ZD1 A;  1VSJ A;  3KIO A;  1LAW A;  1KVB A;  4Q5V A;  4DMN A;  3EZ5 A;  4AH9 A;  5HRP A;  1UWB A;  3NGZ A;  3PO4 A;  3ULD A;  3OYJ A;  4DSE A;  3HJF A;  3LAL A;  1RIL A;  2FBX A;  4FJM A;  1CZB A;  3MEG A;  3NF7 A;  2YHB A;  1VSD A;  1TL1 A;  3HST B;  4F3O A;  4KAZ A;  4KI4 A;  4M45 A;  3L2Q A;  3L2V A;  2Z1I A;  3LPU A;  1RT5 A;  2FBV A;  3OY9 A;  4FJH A;  4FXD A;  3LZJ A;  4C8N A;  4KRF A;  3NH2 A;  3HXM A;  4Z4E A;  2R7Y A;  3QIN A;  1YVU A;  4W5Q A;  5HRR A;  4E19 A;  1C6V A;  4C8L A;  3M8P A;  1S5J A;  4NYN A;  3PV8 A;  3U3G A;  1RTD A;  1RDB A;  2WOM A;  2OPR A;  4DTX A;  1CLQ A;  3AA4 A;  4B9S A;  1RTH A;  2KFZ A;  4HUG A;  1BIZ A;  3AVL A;  1NKB A;  4MQ3 A;  2B5J A;  3BDP A;  2QK9 A;  4B8A B;  4I9L A;  3AVC A;  1KCF A;  3SI6 A;  3HT3 A;  1KLN A;  3S3M A;  3SZ2 A;  4BDY A;  4Z4H A;  3RMA A;  4AHU A;  1UA0 A;  2G8H A;  4E7K A;  4FCY A;  2JGU A;  5HRN A;  3ZT3 A;  4ZTF A;  4J2D A;  4ID5 A;  2XY7 A;  4CJ3 A;  1IKV A;  3NF6 A;  3OS2 A;  1X9W A;  1RNH A;  3V1R A;  4ELV A;  4K8Z A;  1HNV A;  2P51 A;  4OPK A;  4O4G A;  2GBZ A;  3AVA A;  4B9T A;  1JLG A;  3CFO A;  4N56 A;  4DS4 A;  1U4B A;  1NK7 A;  3RR8 A;  4DSJ A;  4DSK A;  2E6L A;  4CJR A;  4IG0 A;  4E7L A;  4CGD A;  3E01 A;  4M3Y A;  3KK2 A;  4IDK A;  1JXB A;  1UAX A;  2X6N A;  2FBY A;  4KTW A;  3VQ6 A;  4CEA A;  1SL0 A;  1QSY A;  1KFS A;  2O4I A;  2QXF A;  4I2P A;  2QKK A;  1TGO A;  2XO7 A;  4CFA A;  4CJS A;  1WAF A;  3S3N A;  1NKE A;  1XWL A;  3QER A;  4DTP A;  3AO3 A;  3MEE A;  3VQP A;  4YNQ A;  2YKN A;  1VRU A;  5I42 A;  2OPS A;  1J9A A;  3AVG A;  4I7F A;  4CEE A;  5C25 A;  4DU1 A;  3CYM A;  1ZBU A;  3PX6 A;  4FLZ A;  4MFB A;  2ZQB A;  2DFE A;  3WNH A;  2F96 A;  2O4G A;  3NBP A;  3ZSY A;  4CGI A;  1C0U A;  4EP4 A;  3MXM A;  1NJZ A;  2IAJ A;  4CEQ A;  4O5B A;  3JSM A;  1KSP A;  1HRH A;  1ZBH A;  2W42 A;  3K5M A;  1LV5 A;  3OYM A;  2YNG A;  2IOC A;  3EYZ A;  1NOY A;  3L2R A;  3NH0 A;  4FJ9 A;  3ZT4 A;  1CXU A;  5KRS A;  2HNZ A;  1JLE A;  1GOA A;  5DMR A;  3PO5 A;  4B9V A;  4DQI A;  2F8S A;  5C24 A;  3OYN A;  2FC0 A;  3SUO A;  4BDP A;  4DTJ A;  2KQ2 A;  1RBR A;  1FK9 A;  4H4M A;  4M3R A;  2YNF A;  3KLH A;  4M3W A;  5KGW A;  3O4Q A;  1DLO A;  3PX4 A;  4CF1 A;  3LAN A;  4DG1 A;  4E7H A;  3RRG A;  4N47 A;  3NGY A;  5K14 A;  3VQ4 A;  4KB0 A;  2IGI A;  1KTQ A;  2PYJ A;  1S1T A;  4DSI A;  2HVH A;  3KLF A;  3EY1 A;  4CEF A;  4BWM A;  3LWM A;  1VSF A;  4UQG A;  1HPZ A;  1J53 A;  4J2B A;  3NF9 A;  3F73 A;  4DSF A;  1NK5 A;  2GUI A;  4DFM A;  1EXQ A;  1JKH A;  4CGH A;  1C1A A;  4JS4 A;  3ITH A;  4NCA A;  3C6U A;  3OJS A;  1GOC A;  4F8R A;  5I3U A;  4AHC A;  1JLC A;  1DTQ A;  3RMD A;  4N76 A;  1J54 A;  3VQC A;  4IFV A;  1U47 A;  3PY8 A;  4KTQ A;  1NJX A;  4EZ6 A;  3QIO A;  2B4J A;  1Q9X A;  4FK2 A;  1NOZ A;  4FJK A;  4E3S A;  3O3F A;  2P5G A;  1A5W A;  4OLA A;  4FW1 A;  1RBV A;  3OS0 A;  1R0A A;  4WE1 A;  1T8E A;  4RW7 A;  2Z1G A;  3AO2 A;  3AO4 A;  3SQ0 A;  4DTM A;  4E1N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...