2ZJQL

Interaction of l7 with l11 induced by microccocin binding to the deinococcus radiodurans 50s subunit
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
104
structure length
104
Chain Sequence
b'RRKLRTRRKVRTTTAASGRLRLSVYRSSKHIYAQIIDDSRGQTLAAASSAALKSGNKTDTAAAVGKALAAAAAEKGIKQVVFDRGSYKYHGRVKALADAAREGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ribosomal 23S RNA
publication title Translational regulation via L11: molecular switches on the ribosome turned on and off by thiostrepton and micrococcin.
pubmed doi rcsb
molecule tags Ribosome
total genus 17
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2008-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00861 Ribosomal_L18p Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.100 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2zjqL01
2ZJRL 5GAGP 1KC8O 1N8RO 1QVFM 5GAHP 5JVGL 1NJIO 5HL7L 1S72N 1JJ2M 1YHQN 1ILYA 1YIJN 1VQ4N 3CD6N 5JVHL 1W2BM 3CC2N 3CCQN 4WFNL 1VQ6N 1QVGM 3CCJN 1VQ9N 3PIOL 1K73O 3CCMN 3I55N 1K9MO 2QEXN 1VQPN 5MLCQ 2OTLN 3CCEN 2ZJQL 3CCSN 4WF9L 4UY8O 3CF5L 1YJWN 1KQSM 5GADP 3CCVN 1VQ7N 5H1SQ 2OTJN 3J7ZO 1K8AO 3CPWM 5GAEP 5DM7L 1Q81O 3DLLL 2ZJPL 3CC4N 3G4SN 3CC7N 1VQKN 3G71N 4WFBL 5DM6L 4IO9L 1Q86O 1KD1O 2QA4N 1YITN 3G6EN 1YJNN 4IOAL 1M90O 1VQ5N 3CMAN 3CMEN 3CCUN 3I56N 4U67L 1YJ9N 1VQMN 1VQNN 1Q82O 3CCLN 3PIPL 1VQON 1OVYA 4WCEL 3OW2M 3CXCM 1M1KO 4WFAL 1Q7YO 1VQLN 3CCRN 1VQ8N 1YI2N 4IOCL
chains in the Genus database with same CATH superfamily
4IEIA 3KVGA 4W5RA 4DSFA 3QNNA 3MEGA 5AQLA 2W40A 3K58A 1S72N 3LM9A 3G25A 3CD6N 4IBNA 5EU7A 4H5TA 4QOZB 4BGAA 4FWMA 4EZ9A 1HYVA 4FZZA 1U47A 3CCJN 1KVCA 1VQ9N 3CFOA 4LF5K 4IFVA 4KTZA 3IRXA 4YOTA 2QWLA 5DMRA 2YNFA 5ELZA 4KTWA 2W42A 4XIUA 4GV3A 5CR4A 4B08A 4FLYA 3WXLA 4BDYA 5GADP 1EQYA 4M3UA 4DU3A 1D4XA 2UU9K 3BY5A 4F2SA 2Q31A 1Q81O 1D9DA 3ZETA 3D7EO 1NKBA 4O44A 4FPBA 4MQ3A 5AQZA 4JKFA 1T03A 1OH7A 1G15A 1GLDG 1E4GT 4OPAA 3VQ6A 4OJRA 3ULDA 5BREA 3LALA 4BRMA 1NGCA 2E1ZA 3I33A 4XH4A 4B3TK 4OPJA 2HNYA 3WXMB 4A2AA 4BREA 4E1JA 3O4WA 3HRGA 1DTTA 4K8ZA 4E7KA 3E9OA 3RTVA 4R79A 5IWAK 3VERA 5M1NA 3NF8A 1NWKA 4YOYA 3I8DA 4BRAA 1VSIA 3CXCM 1WB9A 1M1KO 3DOKA 2ASOA 1NK7A 3TAPA 2YI1A 2IVPA 4B9UA 2QWQA 5KRSA 3MECA 2F9WA 3T19A 4FJXA 2CH5A 2F4VK 2KTQA 4ISGA 5HROA 1C0TA 3TAQA 1HJOA 4DLEA 3C7NA 2WBNA 5AR0A 3LL3A 3LPTA 1U45A 5F2RA 1SKWA 4M42A 4BRQA 3CCQN 2D0BA 5FPEA 4CZEA 3RMDA 1KFDA 1VSLA 3DXMA 1VSDA 1K8KB 3L2VA 5AQSA 1RBSA 3PIOL 1YXQA 1WSEA 4EHTA 4CJVA 3SJHA 2E88A 2EWSA 4CFDA 3ZSRA 3RWUA 1K9MO 3E9PA 1TYQB 4DF8A 4CGGA 3AVGA 4IKFA 1ASWA 4A61A 1SKRA 1BISA 3HK2A 5M1FA 4KPYA 2CH6A 3U3GA 1NGJA 4O5BA 3T1HK 5EX5A 2IGIA 5GINA 3ENOA 1S9GA 3WNFA 1DLOA 2PYLA 4N41A 4OO1J 3MDQA 3IUCA 4A5BA 3C65A 2V52B 3D45A 4Y1CA 2ETJA 3AARA 2DTUA 3MN7A 1VSJA 4E7JA 1TUYA 4QCLA 3ULEB 3TU5A 4DU1A 3OYHA 3L6QA 3CJ9A 4KHYA 1YAGA 4NYFA 3PUFA 3VGMA 3ITHA 1FJGK 3H08A 1IV0A 3ZT0A 1Q82O 3AVNA 4KH6A 1DEJA 4JRQA 3DWLA 1JCFA 3OYJA 1HNIA 1X3NA 2B6AA 3T69A 1SKSA 3GE1A 3VESA 4JD2B 2HVHA 3OYFA 4YDUA 4DCHA 5AQUA 1GLFO 4AHCA 4JAXA 1BQNA 3W3DA 2PFUA 2HF4A 3L8BA 4KFBA 1S1XA 1JLBA 1TK5A 2VQFK 3R9PA 1W0HA 3OYCA 5J2QA 2RPIA 5JS2A 1C1BA 1Y97A 4BVPA 4OGEA 3KKSA 1RT7A 3O9QA 3O3HA 2F8TA 1XUPO 4DR2K 4CJLA 4EP5A 5HBMA 3HP6A 5AQVA 3L2QA 2YHAA 5EVZA 1XMQK 5KRTA 4IG3A 1N5YA 5ADXA 2DFHA 5M1PA 1L3UA 1Q9YA 3K59A 2HB5A 5KGWA 3QBWA 2AA4A 4PA1A 2AJQA 1HNZK 4JI1K 4X62K 2GWKA 2I7PA 1O13A 2YHBA 3WQTA 4J2EA 3RMBA 3ZSVA 3NCIA 3QBXA 2G8FA 4O0JA 3V9WA 1QSYA 3MCAB 1VRUA 3DI6A 4DFPA 3EL2A 3NAEA 1HMVA 2G8KA 1XQSC 4CZIA 3SAFA 1NLVA 4LF4K 1P90A 1VQKN 2VG6A 2ZE2A 4LFCK 3UKRB 2GUIA 4DV4K 3SQ4A 1U49A 1NK5A 4B3SK 3A5MC 1ESVA 3MCPA 1ASVA 3O9TA 4IWVA 4FZXC 4FM1A 4DQ8A 3RR8A 4AM6A 4CF0A 3NBPA 1NNEA 4FWOA 3QIOA 2HSTA 1TAQA 3CCLN 1KAYA 2QWMA 1QHAA 3WXIA 2XO7A 3ZT2A 4QS9A 1NK8A 3OYMA 1XHXA 1N34K 2W6LA 3VTHA 1C1CA 3LAKA 3EYZA 2HBMA 4JS4A 3LDPA 1E3MA 5AQYA 3J81O 4M7YA 1KLMA 3D2FA 4B9MA 1WUAA 2I7NA 5JLFA 4LF6K 3ZX0A 4LF8K 4CEBA 1XHZA 3SLCA 1T05A 4DQQA 1TK0A 4DTRA 2A6AA 1OH6A 3AVMA 3IS9A 1JLQA 4BR9A 3AVCA 4AHTA 1JCGA 2ZGYA 3OYEA 2KLAA 3NF6A 1RCHA 4CK2A 4FVMA 3HO1A 3BF3A 3OHRA 5AFUH 3VETA 1NJWA 1Y64A 2Z1HA 3MN6A 3MEEA 3SQ1A 4XEIA 3P5JA 3VMFB 5H1SQ 3OJUA 4CZKA 3KIOA 4CZFA 2OTJN 2QK9A 2OANA 1SS6A 3EE9A 1RFQA 4OGCA 3ZSOA 2QKBA 2IC3A 2B5JA 5E26A 4Q0BA 1RTDA 3LP1A 1NJXA 4OKEA 1L3SA 3KKRA 3K2PA 2E2QA 2YHYA 4FOIA 3P1GA 5ADXH 2A40A 3H6EA 3N4PA 1WBDA 4CE9A 4C8OA 4EHUA 2G8UA 2P9KB 4WFBL 4OVLA 4DR5K 2FBXA 3G6EN 4HCBA 1KFSA 4FJ7A 2O8DB 3H1VX 3T7ZA 3AO2A 5F0XA 4KB0A 2HBLA 4UQGA 1HNWK 2EX3A 4FJ8A 2IAJA 4WYBA 3Q7CA 5BN8A 3GOIA 4U67L 3M8SA 4F2RA 3W0LA 3CETA 2OZMA 4DR7K 3KK2A 3NVMA 1VQMN 2QI2A 3DRRA 3AVKA 4N5SA 4B1XB 4CJWA 4GVMA 4I9QA 2O8FB 1WAFA 3WEEB 3SBTA 3OYBA 3ATUA 1JL2A 3PO5A 3LP3A 2OPQA 2FBTA 4BRLA 2UUBK 3SMSA 4JKBA 4JK9A 3OS1A 1HKCA 4BR7A 3OTOK 1N8RO 4MO4A 3U6FA 4PL7A 1NMDA 3ZSXA 4CJ3A 5JVGL 4M3XA 1ZBSA 1TV6A 4FJHA 3A5LC 3QLHA 3CC2N 3AA2A 3OY9A 1CZ9A 2W41A 5AQTA 4KHSA 2YV0X 2Z1IA 4CESA 2Z1JA 3VA3A 1X9SA 2HVIA 4W5NA 3FR0A 3CM5A 4K0KK 4AQYK 1HNXK 2NRHA 4BRFA 4UY8O 2D0OA 3NMUA 3NF9A 1BQMA 4CECA 4LD0A 2YKNA 1Q9XA 4H0PA 5CYMA 3FE1A 3JYTA 1XC3A 4A57A 5DM7L 1NGFA 3CM6A 5EXWA 2WFBA 4LC9B 2D0PA 4W5QA 3ZSWA 3AAPA 3G4SN 3O08A 2NZTA 5HRPA 4CF9A 4O8KA 5DM6L 1HR0K 2CGKA 2GX9A 1Z26A 1C6VA 4CHZA 2P9IB 3P4IA 3NDKA 4CCHA 1YJNN 4IZ9A 3KWGA 3O1BA 1RT5A 4AILC 2HHUA 4KHWA 3AVFA 5BPLA 1N36K 2FXUA 1DKGD 4IJAA 3H3NO 3CQYA 4RW7A 1RBVA 3RSEB 4JI8K 5AQMA 5AJ3K 3ZT4A 2ZGZA 3O4NA 3DLHA 1S1TA 4PHTX 4L8RB 1X1PA 5BRHA 1XNQK 2OCEA 2P9NB 3VQBA 1TL3A 2GUPA 5AQIA 1A5XA 2FF6A 4PL8A 3ZSYA 2YJFA 1VQ8N 1BGXT 3LWMA 3TAEA 4B9SA 2O4IA 4U7BA 2VQEK 3VQ9A 5GAGP 2Q0RA 4CEEA 4Z4FA 2NRZA 2A3ZA 4AHUA 5EY4A 4J2DA 1S9EA 1JCEA 5CE3A 1TVRA 1V4SA 3IG1A 3LWLA 4Z4GA 4BROA 3PV8A 3B6PA 1KSPA 2HHVA 3E9LA 2FSNA 1R59O 1IG9A 4H0XB 4OX9K 3B8AX 3LM2A 1BI4B 4CZLA 1K73O 5J1EA 1ZBHA 1N33K 2OTLN 4BVOA 3CCSN 3VEVA 1YVNA 4ILHA 3CF5L 1JXBA 4BRIA 3NGIA 1ASUA 4OPKA 4YY3K 3CERA 3L2UA 4YHHK 3TR8A 1T6DA 3LZIA 4CJTA 1QHTA 3THWB 1F21A 3AV9A 1C0GA 4IDKA 2ZJPL 2A5XA 3TAMA 1KAZA 3A5NC 3HPGA 3O80A 2OA8A 2KFNA 4HTLA 1QE1A 3C0BA 1NK0A 2E20A 1U48A 4Z94A 3RMAA 4MFBA 1Q86O 4IJNA 1MU2A 1SAZA 4BRNA 1GLJO 2ZF5O 4CEFA 3HP9A 3QERA 2GWJA 3WUHA 4M7XA 2VGNA 1BOTO 3CJ1A 4YOXA 3VN5A 1QQMA 4JI0K 2P9UB 2BDPA 2UUCK 1VQNN 1NGGA 4NXNK 2ATQA 4E7LA 1ITGA 3HM8A 1VQON 2A1SA 1VRTA 3LZJA 4G9ZA 3M1FA 4HUFA 5C0YA 4BE2A 5DK5A 3NHGA 2H3GX 4JYAK 4RTFD 4WQ5C 1Z6RA 1JLEA 4FCYA 1YI2N 2F8SA 4FWSA 3R3LA 3TSPA 3ISNC 3NGZA 3SQ0A 3D0PA 3QDKA 4V19S 2UYTA 1VSFA 2OPSA 3CI5A 4LSLA 3K9KA 2OYQA 4JD2A 4M45A 3F73A 3HL8A 4GY2B 3HT3A 1GLLO 2D0AA 5CHIA 2GV9A 4FXDA 4A59A 4M41A 1J6ZA 2XY7A 5AQWA 3SAGA 2Q0UA 2HW3A 3EY1A 2NNWA 4JRPA 1RDWX 3H45C 4KHQA 2HNDA 3OS2A 4EP4A 1VQPN 3M3ZA 5JICA 1UWBA 4DTNA 4FJJA 3AVBA 3SV3A 1HYSA 2GTDA 4M3YA 4CVNE 4DTJA 4FZYA 1X3MA 4FWPA 4PKGA 4BDPA 2JLEA 1N6QA 4DV6K 3O8MA 4CD1A 4CF2A 3F5TA 2P9SB 5BR8K 3J7ZO 3T1AA 1QTMA 2O8BB 3QFPA 4JI3K 3M8QA 1NMNA 3UE5A 3CJ7A 4DR1K 3NH2A 1T7PA 4GKJK 3L0QA 1BHLA 1U6ZA 4N76A 3DXKB 3EKSA 5HRRA 3TTDA 4LSNA 3IFRA 4YFUA 4KB1A 3G71N 2KFZA 2P9PA 4DG1A 3IKMA 4BC2A 2QXFA 4BRCA 1RT6A 3ATVA 2WTUA 1TAUA 2PYJA 1WSFA 4CJKA 4I6MA 4L3QA 3KZBA 4DV5K 3LAMA 3QO9A 3CCUN 1GOCA 5AZJB 4ID1A 2Z1GA 3CYMA 3TSQA 1ZBLA 1JL1A 4C1NI 4DV1K 3R6MA 5LJWA 3PIPL 4Y1DA 4AHSA 1NGIA 5E84A 1SL1A 1SL2A 1BA1A 1NGDA 3UKUB 3KLIA 3OYNA 4YOWA 1RT1A 3HI0A 1KVBA 4DTMA 1LAWA 4E1NA 4IOCL 4JI2K 4KAZA 1KCFA 2BE2A 3VQAA 5HOOA 5GAHP 5LL6Z 1NJIO 4CJSA 1JJ2M 3R1XA 5AQQA 3SAHA 5JVHL 5J2PA 2HMIA 2V7YA 4FWQA 3U8XA 1B9FA 2IIRA 1OH5A 3CJCA 2YX6A 4FO0A 3LDQA 1YTAA 1SL0A 2VWJA 4HVJA 4AHVA 4M3TA 1VSEA 3EE8A 3BF1A 3DLRA 1RT4A 2YJEA 2ZJQL 5TKYA 4CBUA 1S6PA 4MDBA 2ASMA 1H1VA 3AVLA 3TWHA 4BDZA 1B92A 4FM2A 3V9SA 3BZKA 1BA0A 3P39A 2Q2RA 4DV3K 3J80O 5FLXO 3KD5E 1GOAA 3CIPA 1J5OA 3P38A 3HVRA 1D8YA 2HF3A 3DLKA 4MLHA 4IO9L 4H03B 1W7AA 3CQ8A 2P5OA 1S1VA 3MAQA 3BUZB 2E2OA 1CLQA 3TAFA 2NRXA 1XI1A 2DPNA 4NCBA 4PKHA 2D5RA 2P9KA 3BZCA 4BGBA 4DUZK 4GKKK 3GG4A 3VEYA 3QNOA 4I7FA 4LF7K 5FDLA 1HPMA 3R8EA 2O8DA 4H4OA 3SUOA 4OLBA 2RN2A 1L3VA 4B9TA 1BIZA 1J5EK 3PO4A 4KHPK 5AQFA 2QM1A 4CFBA 3AGRA 4YDUC 2RF2A 3OW2M 4FWRA 4KTQA 3ID6A 3E1YA 3CPEA 3KD1E 3K5NA 4BRDA 2O8CB 2O8FA 4CEZA 5KPTA 4DQSA 3J8AA 4BY9C 2XY6A 1U4BA 3VOVA 1BL3A 3WEEA 1RTHA 3IAYA 3VQ5A 5K14A 3QEIA 4K43A 1FKOA 1GOBA 2CGLA 3FZLA 3MX2A 5C15A 3QEPA 4CERA 3HZ6A 1JXEA 3RMCA 1KLNA 5FPDA 3S9HA 1ATNA 4FJ5A 3BP8A 3CG7A 1EWRA 1S1WA 3SV4A 1MWKA 3U4LA 3THXB 4BWMA 4I2QA 1WAJA 4B1UB 2P1JA 1QVGM 4BR5A 4MDAA 1HUXA 3A2FA 3I55N 4FJMA 1EP4A 2Q36A 1FW6A 3OBWA 3PSFA 4BACA 1A5WA 4CGDA 3MWTA 1WNSA 4CZHA 2RHKA 2DFFA 4Z4IA 3MMVA 3HM9A 1G99A 5FPNA 4Z4HA 3SZ2A 3B6OA 1LW2A 3TTCA 2QTDA 1K8AO 2O8EA 3VQ7A 2FSKA 3CPWM 4O55A 2HHWA 3F9KA 4DR6K 1DTQA 1WOQA 4DKWA 1UA0A 2OZSA 4CZJA 1QSSA 3NFAA 5BPMA 4KV8A 4EZ6A 4JKGB 4M63C 1KVAA 2JWLA 4KO0A 3SK3A 3QEWA 4RWTA 2V51B 3THYA 3M5RA 4CEQA 4YOVA 2F96A 3ZX2A 4NLBA 3KJVA 1V4TA 3DLGA 3C6UA 5SWMA 5J2NA 5HP1A 4DF4A 1NGBA 2E1YA 2QA4N 3T3FA 1GLBG 4AHRA 3K9JA 3OYKA 4N47A 4IO8A 1ATRA 1RBRA 1T3VA 3VA0A 2NRTA 3VEOA 4GV6A 1HQEA 2GEMA 3TTFA 3QESA 3U9ZA 4F3OA 2WUSA 2P9IA 3EN9A 2E5LK 1NBWA 3OYIA 1I39A 1DGKN 1VSMA 4ZTFA 1K6YA 4HWIA 4CJ5A 1XNRK 4JLHA 2KW4A 2HHTA 5AQGA 3RSEA 4WQ4A 1O1WA 3G10A 5SZTA 1IBLK 1RT2A 1NK6A 5AQNA 3PY8A 3M6GA 4H0YB 1BWFO 1RBUA 1SZ2A 3JS6A 3VTIA 4FYDA 4BR2A 1LV5A 4FM0A 3L4IA 1P8ZA 4B9QA 3WXKA 1QVFM 3I0RA 3CFRA 4BC5A 3V9XA 4E1MA 3JXUA 2VYPA 4KBOA 1YIJN 4H8KA 4O0IA 1IJJA 4JHDB 2BH1A 5BR9A 3SPYA 1KRPA 1IKYA 5C12A 4OKJA 3LPUA 4IXCA 1VQ6N 2WONA 4F9OA 1KAXA 4PKIA 4CJ4A 1TKZA 3MN9A 4CHPA 5J2MA 2UUAK 1VSHA 3FGUA 3VQEA 4K8XA 4GW6A 1RDAA 4B1YB 3F2KA 3S3MA 3QEVA 2GBZA 3P83D 3KLEA 3D2EB 4CJQA 4K42A 4FOEA 4OKKA 5C2FA 1VQ7N 3TABA 3AVHA 4JEPA 3AGKA 4E3SA 4K41A 1QQCA 5M1OA 2I5JA 4ISEA 3AO1A 4DLGA 4KREA 3RRGA 2Y1IA 3QETA 3PLAA 4RW4A 3THWA 3O9UA 4MO5A 4BG8A 5JS1A 2NLXA 4FLWA 2QWNA 3D2FB 3RRHA 1EXQA 3AO3A 1M90O 1NK9A 2Q97A 3VENA 1S6QA 3ZEUB 3VQ8A 1UA1A 2BANA 2E4LA 4FW2A 2KZMA 5HRNA 4DR4K 1IKXA 2YNHA 2QXLA 1WLJA 2PBDA 1NU0A 2DFEA 2J4RA 4NYNA 2P9UA 2HBKA 2W6KA 1T8EA 3OYDA 4KRFA 3CCRN 3LANA 3P31A 1RDDA 4IOXA 1FK9A 3GBTA 4ISFA 2ZJRL 4DSJA 1BIUA 1KC8O 3OYLA 1TL1A 4J8FA 4CZGA 2BTFA 1OH8A 4FL9A 1CXQA 3A8YA 2UXDK 3K0SA 4X65K 3KLHA 4X64K 1JLFA 3V9ZA 2E6MA 4CEDA 2KHOA 3AVIA 3MXMA 2BUPA 4NLCA 4FPAA 1C0MA 3CQXA 3H46O 5AZIB 4Z0UA 4WF9L 1RTIA 3FZMA 3SNNA 2HOEA 4DWIA 2HMPA 3ZLJA 2ZD1A 4H5WA 3AY9A 4LF9K 1EWQA 4KHNA 5A2QO 4FWKA 1LCUA 2G8HA 1U2VB 4M3WA 2OPRA 5KPZA 3O3FA 1OKJA 1TKTA 4JV5K 2YHWA 1IO2A 3K5OA 4QS8A 4ELVA 2YKMA 3CHWA 2P9SA 2F9TA 4OPHA 1NJYA 4H4MA 1OVQA 2G8VA 1K8KA 4Y0WA 5AQJA 3SUPA 3UIQA 1HPZA 4CGJA 4IOAL 4W5OA 1WSGA 4E7IA 2NRVA 3CMEN 5I42A 2JWKA 1TYQA 3SI6A 3V4IA 5JLHA 4JS5A 2HHHK 5FROA 4OLAA 1YJ9N 1U04A 5C42A 4WQ5A 2D0CA 3OA9A 4CFAA 2PY5A 4DU4A 2R7YA 3U9DA 5KQ8A 4CEOA 1IKVA 1HNVA 1J54A 4KH5A 5AZJA 2KKZA 2P5GA 2AP1A 3RVCA 2XRIA 3O4QA 2YCHA 4XH5A 3DMJA 3LDNA 4FLUA 2FBYA 4ELTA 2E6LA 4B1VA 3QEXA 3HOSA 3ZT3A 3UB5A 4DUYK 1IKWA 3KWIA 3ZYYX 4BG9A 3UKUA 4NXMK 4E19A 3TI0A 1HX1A 3ULEA 1CZBA 3WT0A 4LY7A 4BWJA 3S3OA 1XMOK 3NGYA 3JSMA 1TGOA 4CD3A 1Z05A 4PUOA 1LWCA 2YNIA 4CJPA 3HYFA 1QZ5A 3CFPA 4CI6A 5LMUK 5TKWA 4E89A 1HRHA 2YNGA 3FLCO 1I3AA 1HJRA 3PX0A 1YUWA 2DY4A 3LDOA 4CJEA 4X66K 1KQSM 2X78A 3NH1A 3TAGA 4FJIA 3CCVN 1S22A 3EKUA 4W5TA 2QW9A 3TANA 4A5AA 4DSKA 4JI6K 5KTQA 5GAEP 4DV7K 4CHYA 3BEXA 3BGRA 3WNHA 3NE6A 4FWLA 2XHBA 1IBMK 4KHUA 3KTQA 2HHQA 4C23A 4DSEA 3J7YP 5CY4A 4FK2A 3DM2A 1S1UA 3VEZA 4DR3K 3HSCA 5AQRA 3AO5A 3CJBA 3SJJA 1YITN 3LP0A 3HVTA 2IVOA 3AAQA 3L2WA 2P9LB 2ZQBA 3PX6A 1RBTA 1A5VA 4DB3A 4DFMA 4QAGA 4FLVA 1EX4A 4DQIA 1NM1A 3J7AP 5E41A 4B8AB 3VEXA 4YNQA 1IBKK 4JK7A 1LWEA 3HXMA 1LWFA 1SV5A 1SQKA 4CF8A 3ZSZA 4HUEA 2D1KA 4BC4A 3C95A 4HTUA 1JLGA 3TARA 5KI6A 1VQLN 3C6HA 4JN4A 3OBYA 1GLAG 4CIEA 4BR0A 4RG8A 3U3YA 3UKRA 4EFHA 3E01A 3DRPA 4H0OA 2YHXA 2ITMA 4CBWA 4LFAK 5I9EB 5C24A 4IFYA 4M3ZA 4EIAA 2IOCA 1ZYQA 2O8CA 1HKGA 1ZBUA 4GNIA 1VQ4N 1DT9A 2GELA 4B3OA 2WC9A 5AQXA 1C0FA 1J9AA 1RNHA 2QKKA 3VQCA 1NG9A 4F4KA 1RDCA 2HHXA 5B8HA 2Q3SA 3OYAA 1R0AA 5C2DA 2F7TA 3SUQA 3ENHA 1TKXA 3ASMA 1IG8A 4GMJB 4FJKA 4DTSA 3PSIA 4FJNA 1N32K 1LAVA 3EZWA 5JMVA 3THXA 4CGIA 5AQPA 3ZETB 4G1QA 2IVNA 3MXIA 3O9SA 3AO4A 4Z4EA 1ZBFA 3V81A 4MLEA 2VG5A 3ZCMA 1RT3A 3KHYA 1BCMA 4B3RK 4BRHA 3V1OA 4DV2K 5LY3A 3JAMO 1D9FA 4IG0A 3A5OC 3L3UA 4BE0A 4FK0A 3O3GA 1JLCA 4HCCA 2RE2A 4FJ9A 3NVKA 1YF5L 5D3GA 3DJCA 1RILA 1Q18A 1QQOA 3ALYA 3I8BA 2FSJA 1MA9B 1NGHA 3SCXA 5AQKA 1S5JA 1KTQA 4DSIA 2QWPA 2VWBA 5FRMA 3VF6A 2NRWA 1J53A 4WE1A 2ZM6K 4JKGA 1BG3A 4LFBK 1EETA 3OVNA 4KH4A 1RGIA 4FJLA 4LH5A 4J2BA 4B9LA 4AH9A 4E0DA 5AFUA 4JKAA 3O6WA 4CJUA 4B9VA 3I0SA 5HRSA 3RR7A 3ZSQA 3QMLA 1GLEG 3C7NB 3ZX3A 3HOTA 2E2PA 1UOCA 2IDOA 1W9HA 1CZAN 3KLGA 4CIGA 3DXMB 5LJVA 1JLAA 5HL7L 3LP2A 4JK8A 5C25A 1TK8A 2E8AA 4A2BA 5GIPA 2FF3B 3DYAA 3D6RA 3H3OB 1B9DA 3AA3A 4ELUA 1VHXA 1MWMA 2P9PB 1LOTB 3VGKA 3S41A 4BQZA 3CCMN 4F8RA 4JKDA 3K5LA 4YOUA 3KK1A 2QEXN 4JHDA 4I9LA 4FWNA 5MLCQ 2VG7A 3CCEN 3VQQA 4I6MB 1VSKA 4HHTA 1QS4A 4B8CA 5EOYA 4H0TB 2LSNA 3AA5X 3WNGA 1T6CA 4RW6A 5CZ1A 4DHYA 5CZ2A 2D4WA 1YVUA 1L3TA 2O4GA 2JGUA 1IH7A 3IDHA 1SUQA 1BDGA 3KK7A 2A41A 4JI4K 4JKHA 3D2EA 4AM7A 3SUNA 4F3TA 1UAXA 4H5VA 1NKEA 2VCPA 1NOYA 1TKDA 4AF1A 4E7HA 5AQOA 3AVJA 3EEQA 4FLXA 1X9MA 3M8PA 4C8KA 4TSXA 2E2NA 3SMPA 3TSUA 3OS0A 4NCGA 3V1RA 3MEDA 2CGJA 4CHNA 2A42A 2VWKA 4YORA 2OPPA 4H5RA 4GV9A 4FVUA 3ZT1A 4C8NA 3FZKA 1JKHA 3E66A 5KGXA 4O5FA 3I56N 5KQDA 4I2PA 5BRDA 3QIPA 3VF4A 4CFCA 3TPQA 4DV0K 5I3UA 3ZEUA 3BDPA 5M1QA 4JNEA 4IEEA 3T1YK 3LDSA 3FFIA 1VAZA 3KLFA 1BU6O 1Q7YO 3VQPA 3MXJA 3N4QA 4DFKA 1ZBIA 3SPZA 4BC3A 2ITGA 4DTXA 2QWRA 3HTVA 4CBXA 4BQLA 3K5MA 4FW1A 4DS4A 5KPRA 3NH0A 3QICA 2V7ZA 1WSHA 4DQPA 4NO7A 3VF2A 1NKCA 1GLCG 3AVAA 3L4QA 1YHQN 1QSLA 1HYZA 5BRFA 4CJRA 4JI5K 3S3NA 1REVA 2FLOA 3WNEA 2RKIA 3FZFA 5BPNA 1YTUA 5T7BA 3PX4A 1XC9A 2G8IA 5GIOA 2X74A 4HUGA 4CZMA 2KQ2A 2P9NA 3HBTA 4EAHD 1W97L 3HPHA 4BRKA 3MN5A 3QINA 2PAVA 2EHGA 3EO3A 2UXCK 4NCAA 4H5NA 4CK3A 3ENBA 4C8LA 2Q1NA 3C6TA 1TUUA 5AZIA 3GDQA 5FPMA 5IT9O 1D5AA 3DLLL 3NF7A 3CC4N 4QS7A 4FLZA 4B1ZA 4Q5VA 3LDLA 4PWDA 1NJZA 1WSJA 1BO5O 1U2VA 2WOMA 1I94K 4JI7K 4JKCA 4B1WB 4Z4CA 2ASPA 1KD1O 3DLEA 1WSIA 2QWOA 1BI4A 2BGGA 2FBVA 1QQNA 1ATSA 4CGHA 1VQ5N 4CGFA 4JKEA 5HLFA 3C94A 4XH1A 3L2RA 1NGAA 3O9RA 4K25A 1HKBA 4DTOA 2X6NA 4R5PA 4FK4A 4BR4A 4FSVA 4CJFA 3F9MA 4WQ4C 4RW9A 3WQUA 1XWLA 4CHQA 4RCHA 1NK4A 3HPOA 1ZC6A 4O8UA 1YT3A 2HBJA 2VGMA 3DAWA 3WXJA 3K57A 1OVYA 4M3RA 2PZSA 1RTJA 4WFAL 3GL1A 2P51A 4DTUA 3QFUA 4LH4A 4PQUA 4ZHRA 1RDBA 4ICLA 2O8EB 3ID8A 3FZHA 1VK0A 2IS3A 3C6AA 4C1NK 5M1KA 3L3VA 4IFEA 1WBBA 1RDUA 3Q7BA 1C1AA 3MWPA 1ILYA 1W2BM 1HLUA 3G0ZA 3V9UA 3THYB 4WFNL 2KZZA 2NRRA 4B3MK 1WN7A 4RW8A 3OJSA 1X9JA 4FLTA 3SQ2A 4ZTJA 2XY8A 5LMNK 4GVEA 3VEWA 5C10A 4CHOA 3AA4A 4N56A 1Q8IA 4BRGA 5AQHA 3THVA 2UXBK 1FKPA 1YJWN 1L5UA 3DRSA 3DOLA 1S3XA 3FFKB 4DSLA 4CF1A 2FC0A 1KXPA 4ILJA 4C8MA 1CXUA 4CEAA 4PY5A 4DS5A 1HQUA 4ILGB 3SYZA 3V6DA 4DFJA 1E4FT 3VGLA 3QB0A 2G8WA 4DMNA 2NUBA 1FXXA 4CW7B 4KI4A 1BUPA 3CC7N 5CYQA 4KKOA 1X9WA 4DQRA 1MDUB 3A0IX 3VQ4A 3O1WA 2A1RA 2ZWHA 4KI6A 4BE1A 5F1XA 1Z25A 3HSTB 3O5BA 3M8RA 3MK6A 3CMAN 2HNZA 3CJAA 3SBGA 4ID5A 1T44A 2Y1JA 1BCOA 4BRPA 4A62A 4CK1A 3HJFA 4B9NA 1EO1A 3KK3A 3MX5A 2P9LA 3VQDA 4NB4A 3OYGA 2O8BA 1NGEA 4IDHA 4FJGA 1C0UA 4WCEL 4O4GA 4H0VB 3H1QA 1LW0A 4CIFA 3EZ5A 5FRNA 1NOZA 4J2AA 1ZXOA 1EKEA 5BN9A 2HHSA 4DTPA 3DXKA 2X6SA 3VPZA 3IMXA 1QZ6A 4CJ7A 3V1QA 2XY5A 3DLBA 2B4JA
chains in the Genus database with same CATH topology
3UKRA 3VOVA 3WEEA 4IEIA 4BR7A 3KVGA 4EFHA 1N8RO 4H0OA 4MO4A 5AQLA 4PL7A 2YHXA 1NMDA 5JVGL 2W40A 2ITMA 4CBWA 1ZBSA 4K43A 5I9EB 1S72N 3LM9A 2CGLA 3FZLA 4EIAA 3A5LC 3MX2A 1HKGA 5C15A 3G25A 3HZ6A 1DT9A 4GNIA 1VQ4N 2GELA 3CD6N 3CC2N 2WC9A 5AQXA 5FPDA 1C0FA 1ATNA 4H5TA 3BP8A 1MWKA 3U4LA 4FWMA 4BGAA 4B1UB 5B8HA 1QVGM 4BR5A 4MDAA 5C2DA 3CCJN 1HUXA 2W41A 2F7TA 5AQTA 1VQ9N 3ENHA 1IG8A 3I55N 3FR0A 2Q36A 3OBWA 4YOTA 2QWLA 2NRHA 3EZWA 4BRFA 5JMVA 4UY8O 5ELZA 3MWTA 2D0OA 4CZHA 2RHKA 5AQPA 3NMUA 3ZETB 5CR4A 4GV3A 3MMVA 2IVNA 3WXLA 5GADP 1G99A 1EQYA 5FPNA 3O9SA 4H0PA 1D4XA 4MLEA 3FE1A 3KHYA 3TTCA 2QTDA 1XC3A 1K8AO 4BRHA 2FSKA 3CPWM 5LY3A 2Q31A 4A57A 5DM7L 1Q81O 1NGFA 1WOQA 5EXWA 4DKWA 3A5OC 4CZJA 2WFBA 3ZETA 3D7EO 4LC9B 2D0PA 2RE2A 5BPMA 3AAPA 4FPBA 4JKGB 4M63C 3NVKA 3G4SN 2JWLA 1YF5L 3O08A 3SK3A 2NZTA 5AQZA 2V51B 4RWTA 3DJCA 3M5RA 4JKFA 1Q18A 4YOVA 1QQOA 3ZX2A 1GLDG 4NLBA 3I8BA 4O8KA 1E4GT 1V4TA 5DM6L 2FSJA 1MA9B 1NGHA 2CGKA 2GX9A 1NGBA 4OPAA 5AQKA 5BREA 2E1YA 1NGCA 2QWPA 2VWBA 4BRMA 2P9IB 3P4IA 2E1ZA 3I33A 3VF6A 2QA4N 2NRWA 1GLBG 4XH4A 1YJNN 4IZ9A 3KWGA 1BG3A 3O1BA 4JKGA 3K9JA 4IO8A 5BPLA 1ATRA 1T3VA 2FXUA 1DKGD 2NRTA 4IJAA 3WXMB 3VEOA 3H3NO 4A2AA 2GEMA 3CQYA 4KH4A 1RGIA 3TTFA 3U9ZA 4BREA 3RSEB 2WUSA 2P9IA 3EN9A 4E1JA 3O4WA 3HRGA 5AQMA 1NBWA 5AFUA 2ZGZA 4JKAA 1DGKN 3O6WA 4PHTX 3E9OA 4HWIA 4R79A 5BRHA 3VERA 2P9NB 5M1NA 4YOYA 1NWKA 4BRAA 2GUPA 5AQGA 3RSEA 4WQ4A 3CXCM 5AQIA 1M1KO 2ASOA 2FF6A 5AQNA 4PL8A 3QMLA 1GLEG 2YI1A 2IVPA 3C7NB 3M6GA 4H0YB 2YJFA 1BWFO 3ZX3A 1VQ8N 1SZ2A 3HOTA 2E2PA 2QWQA 3JS6A 3VTIA 4BR2A 4U7BA 2F9WA 1CZAN 3L4IA 1P8ZA 2CH5A 5GAGP 2Q0RA 2NRZA 2A3ZA 3DXMB 3WXKA 4ISGA 4B9QA 5LJVA 1QVFM 5EY4A 4BC5A 1JCEA 5CE3A 1HJOA 5HL7L 1V4SA 3JXUA 3C7NA 4JK8A 4BROA 2VYPA 2WBNA 4KBOA 2E8AA 3LL3A 5AR0A 1YIJN 4A2BA 5GIPA 5F2RA 2FF3B 1IJJA 3D6RA 2BH1A 3H3OB 4JHDB 3E9LA 4BRQA 5BR9A 3CCQN 2FSNA 5C12A 5FPEA 4CZEA 4IXCA 1VQ6N 3DXMA 1MWMA 1R59O 4F9OA 2P9PB 1K8KB 1KAXA 4PKIA 4H0XB 5AQSA 3B8AX 3LM2A 1LOTB 3VGKA 3PIOL 1YXQA 4CZLA 3MN9A 3S41A 4EHTA 1K73O 4BQZA 3CCMN 3SJHA 2E88A 4JKDA 2EWSA 4YOUA 1K9MO 2QEXN 3FGUA 4JHDA 5MLCQ 4FWNA 3E9PA 4B1YB 4BVOA 2OTLN 3CCSN 3F2KA 3VEVA 1YVNA 4I6MB 3CCEN 4ILHA 1TYQB 3CF5L 4BRIA 5EOYA 4H0TB 3CERA 3D2EB 1T6CA 4FOEA 4K42A 5C2FA 1VQ7N 4DHYA 1T6DA 4A61A 4JEPA 2D4WA 3IDHA 1BDGA 5M1FA 3AGKA 2CH6A 3KK7A 1C0GA 1NGJA 2A41A 4K41A 2ZJPL 5EX5A 2A5XA 5M1OA 4JKHA 3D2EA 5GINA 3ENOA 4ISEA 1KAZA 4AM7A 3A5NC 3O80A 4OO1J 3MDQA 3IUCA 4A5BA 3C65A 4HTLA 4H5VA 2V52B 3PLAA 3C0BA 3O9UA 4MO5A 2E20A 2VCPA 4BG8A 4Z94A 2NLXA 3AARA 4AF1A 1Q86O 5AQOA 2QWNA 3MN7A 4IJNA 3D2FB 1SAZA 2E2NA 3SMPA 1GLJO 1TUYA 2ZF5O 3TSUA 4BRNA 3ULEB 1M90O 3TU5A 2Q97A 3VENA 2GWJA 2CGJA 3WUHA 3L6QA 2VGNA 1BOTO 3CJ9A 2A42A 3CJ1A 4M7XA 4YORA 4H5RA 3ZEUB 4YOXA 4GV9A 4FVUA 1YAGA 3FZKA 1QQMA 3E66A 3I56N 4O5FA 3VGMA 5KQDA 2P9UB 5BRDA 3VF4A 1VQNN 3TPQA 1Q82O 1NGGA 4KH6A 1DEJA 3ZEUA 2QXLA 5M1QA 3HM8A 4JNEA 4IEEA 1VQON 3DWLA 2PBDA 4G9ZA 3M1FA 1JCFA 5C0YA 2J4RA 2P9UA 1VAZA 2HBKA 1X3NA 1BU6O 2H3GX 3T69A 3GE1A 1Q7YO 4RTFD 4WQ5C 1Z6RA 3VESA 4JD2B 3N4QA 3CCRN 1YI2N 3P31A 4YDUA 4FWSA 4BC3A 2QWRA 3R3LA 3HTVA 4IOXA 3TSPA 4CBXA 3GBTA 4BQLA 5AQUA 4DCHA 1GLFO 5KPRA 4ISFA 4JAXA 2ZJRL 3QICA 3W3DA 2PFUA 2HF4A 2V7ZA 1KC8O 3QDKA 4NO7A 3VF2A 4J8FA 2UYTA 4CZGA 3CI5A 1GLCG 3R9PA 3K9KA 2BTFA 4JD2A 3L4QA 4FL9A 4BVPA 1YHQN 5BRFA 3A8YA 3O9QA 1XUPO 4GY2B 2FLOA 1GLLO 5CHIA 3FZFA 4A59A 5BPNA 1J6ZA 5AQWA 3SAGA 2Q0UA 5AQVA 2KHOA 2NNWA 5GIOA 2BUPA 5EVZA 1RDWX 4NLCA 4CZMA 4FPAA 3H45C 2P9NA 3HBTA 5ADXA 5M1PA 1W97L 3CQXA 4EAHD 1VQPN 3H46O 5AZIB 3M3ZA 5JICA 4BRKA 3QBWA 4WF9L 2AA4A 3MN5A 2GTDA 3FZMA 2HOEA 2PAVA 2HMPA 1X3MA 4FWPA 4PKGA 3EO3A 2GWKA 4H5WA 2I7PA 3AY9A 4H5NA 1O13A 4FWKA 1LCUA 3ENBA 2Q1NA 3O8MA 3WQTA 4CD1A 1TUUA 1U2VB 2P9SB 3F5TA 3J7ZO 5AZIA 3GDQA 5KPZA 3QFPA 5FPMA 3QBXA 1OKJA 3UE5A 3MCAB 3DLLL 2YHWA 3CJ7A 3CC4N 4QS7A 4QS8A 4B1ZA 3L0QA 3EL2A 3LDLA 1U6ZA 3CHWA 3DXKB 3EKSA 1BO5O 1U2VA 2P9SA 3TTDA 2F9TA 1XQSC 4OPHA 4CZIA 3SAFA 3IFRA 1NLVA 1P90A 1VQKN 3G71N 2P9PA 4JKCA 1K8KA 4B1WB 2ASPA 3UKRB 3IKMA 1KD1O 2QWOA 4BC2A 4Y0WA 5AQJA 4BRCA 3A5MC 1ESVA 1QQNA 1ATSA 4IOAL 3MCPA 3O9TA 3ATVA 4IWVA 1VQ5N 4JKEA 4DQ8A 2NRVA 4XH1A 1NGAA 3CMEN 3O9RA 2JWKA 4I6MA 4K25A 1HKBA 4L3QA 4AM6A 1TYQA 3KZBA 5JLHA 3CCUN 4BR4A 5AZJB 4FWOA 1YJ9N 4FSVA 3TSQA 4WQ5A 2HSTA 3OA9A 3F9MA 4WQ4C 4C1NI 3R6MA 5LJWA 3WQUA 3CCLN 3PIPL 4RCHA 1KAYA 2QWMA 1ZC6A 3U9DA 5KQ8A 4O8UA 1NGIA 1QHAA 2HBJA 2VGMA 3DAWA 5E84A 3WXJA 3WXIA 1OVYA 1BA1A 1NGDA 4GV6A 4QS9A 3UKUB 4KH5A 5AZJA 2KKZA 2AP1A 3RVCA 4WFAL 3GL1A 2YCHA 4XH5A 4YOWA 3VTHA 3QFUA 3LDNA 2HBMA 3HI0A 4B1VA 3HOSA 4IOCL 3UB5A 3LDPA 5AQYA 3ID8A 3KWIA 4M7YA 3D2FA 3FZHA 3ZYYX 3UKUA 4BG9A 1WUAA 2I7NA 3C6AA 4C1NK 5M1KA 5HOOA 5GAHP 5JLFA 1HX1A 3ULEA 3WT0A 4IFEA 1NJIO 1RDUA 3Q7BA 3ZX0A 3MWPA 4CD3A 1JJ2M 1ILYA 1Z05A 3R1XA 5AQQA 3SAHA 5JVHL 2V7YA 4FWQA 1HLUA 1W2BM 3U8XA 2IIRA 3SLCA 3CJCA 2YX6A 4FO0A 4WFNL 3LDQA 1QZ5A 2A6AA 2NRRA 4CI6A 1X9JA 4BR9A 4GVEA 5TKWA 3VEWA 3EE8A 5C10A 3BF1A 1JCGA 2ZGYA 4BRGA 5AQHA 3FLCO 2KLAA 2YJEA 2ZJQL 5TKYA 4CBUA 3BF3A 1YUWA 3OHRA 5AFUH 4MDBA 3LDOA 1YJWN 2ASMA 1H1VA 3VETA 1KQSM 1Y64A 3MN6A 3CCVN 1S3XA 3FFKB 1S22A 3EKUA 4XEIA 3VMFB 5H1SQ 1KXPA 1BA0A 4ILJA 4CZKA 2QW9A 4CZFA 2OTJN 3P39A 2OANA 1SS6A 2Q2RA 3EE9A 4A5AA 1RFQA 5GAEP 3BEXA 4FWLA 5E26A 4ILGB 4C23A 2E2QA 1E4FT 2YHYA 4FOIA 3VGLA 3QB0A 3CIPA 5ADXH 2A40A 3H6EA 3VEZA 3P38A 3N4PA 3HSCA 5AQRA 4EHUA 1BUPA 3CC7N 2HF3A 2P9KB 4MLHA 4WFBL 4IO9L 4H03B 3CJBA 1MDUB 3A0IX 3BUZB 2E2OA 3O1WA 2ZWHA 1YITN 3G6EN 2NRXA 2DPNA 3H1VX 3T7ZA 5F1XA 5F0XA 2IVOA 3O5BA 3AAQA 2HBLA 2P9LB 3MK6A 3CMAN 4DB3A 3CJAA 4PKHA 3SBGA 2P9KA 1T44A 4BGBA 4WYBA 1NM1A 3GG4A 3Q7CA 3GOIA 4BRPA 4A62A 4U67L 3W0LA 3CETA 3VEYA 5BN8A 3NVMA 1HPMA 3R8EA 3VEXA 1VQMN 2QI2A 4JK7A 1EO1A 3MX5A 4B1XB 2P9LA 4NB4A 5AQFA 1NGEA 2QM1A 1SQKA 4IDHA 3AGRA 4YDUC 3WEEB 4WCEL 3SBTA 4H0VB 3H1QA 2D1KA 4FWRA 4BC4A 3OW2M 3ID6A 3E1YA 3ATUA 1ZXOA 5BN9A 3CPEA 4BRLA 3DXKA 3SMSA 4BRDA 1VQLN 3C6HA 4JKBA 3OBYA 4JN4A 1GLAG 3VPZA 3IMXA 1QZ6A 4JK9A 3J8AA 4CJ7A 5KPTA 4BY9C 4BR0A 1HKCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZJR L;  5GAG P;  1KC8 O;  1N8R O;  1QVF M;  5GAH P;  5JVG L;  1NJI O;  5HL7 L;  1S72 N;  1JJ2 M;  1YHQ N;  1ILY A;  1YIJ N;  1VQ4 N;  3CD6 N;  5JVH L;  1W2B M;  3CC2 N;  3CCQ N;  4WFN L;  1VQ6 N;  1QVG M;  3CCJ N;  1VQ9 N;  3PIO L;  1K73 O;  3CCM N;  3I55 N;  1K9M O;  2QEX N;  1VQP N;  5MLC Q;  2OTL N;  3CCE N;  2ZJQ L;  3CCS N;  4WF9 L;  4UY8 O;  3CF5 L;  1YJW N;  1KQS M;  5GAD P;  3CCV N;  1VQ7 N;  5H1S Q;  2OTJ N;  3J7Z O;  1K8A O;  3CPW M;  5GAE P;  5DM7 L;  1Q81 O;  3DLL L;  2ZJP L;  3CC4 N;  3G4S N;  3CC7 N;  1VQK N;  3G71 N;  4WFB L;  5DM6 L;  4IO9 L;  1Q86 O;  1KD1 O;  2QA4 N;  1YIT N;  3G6E N;  1YJN N;  4IOA L;  1M90 O;  1VQ5 N;  3CMA N;  3CME N;  3CCU N;  3I56 N;  4U67 L;  1YJ9 N;  1VQM N;  1VQN N;  1Q82 O;  3CCL N;  3PIP L;  1VQO N;  1OVY A;  4WCE L;  3OW2 M;  3CXC M;  1M1K O;  4WFA L;  1Q7Y O;  1VQL N;  3CCR N;  1VQ8 N;  1YI2 N;  4IOC L; 
#chains in the Genus database with same CATH topology
 4IEI A;  3KVG A;  4W5R A;  4DSF A;  3QNN A;  3MEG A;  5AQL A;  2W40 A;  3K58 A;  1S72 N;  3LM9 A;  3G25 A;  3CD6 N;  4IBN A;  5EU7 A;  4H5T A;  4QOZ B;  4BGA A;  4FWM A;  4EZ9 A;  1HYV A;  4FZZ A;  1U47 A;  3CCJ N;  1KVC A;  1VQ9 N;  3CFO A;  4LF5 K;  4IFV A;  4KTZ A;  3IRX A;  4YOT A;  2QWL A;  5DMR A;  2YNF A;  5ELZ A;  4KTW A;  2W42 A;  4XIU A;  4GV3 A;  5CR4 A;  4B08 A;  4FLY A;  3WXL A;  4BDY A;  5GAD P;  1EQY A;  4M3U A;  4DU3 A;  1D4X A;  2UU9 K;  3BY5 A;  4F2S A;  2Q31 A;  1Q81 O;  1D9D A;  3ZET A;  3D7E O;  1NKB A;  4O44 A;  4FPB A;  4MQ3 A;  5AQZ A;  4JKF A;  1T03 A;  1OH7 A;  1G15 A;  1GLD G;  1E4G T;  4OPA A;  3VQ6 A;  4OJR A;  3ULD A;  5BRE A;  3LAL A;  4BRM A;  1NGC A;  2E1Z A;  3I33 A;  4XH4 A;  4B3T K;  4OPJ A;  2HNY A;  3WXM B;  4A2A A;  4BRE A;  4E1J A;  3O4W A;  3HRG A;  1DTT A;  4K8Z A;  4E7K A;  3E9O A;  3RTV A;  4R79 A;  5IWA K;  3VER A;  5M1N A;  3NF8 A;  1NWK A;  4YOY A;  3I8D A;  4BRA A;  1VSI A;  3CXC M;  1WB9 A;  1M1K O;  3DOK A;  2ASO A;  1NK7 A;  3TAP A;  2YI1 A;  2IVP A;  4B9U A;  2QWQ A;  5KRS A;  3MEC A;  2F9W A;  3T19 A;  4FJX A;  2CH5 A;  2F4V K;  2KTQ A;  4ISG A;  5HRO A;  1C0T A;  3TAQ A;  1HJO A;  4DLE A;  3C7N A;  2WBN A;  5AR0 A;  3LL3 A;  3LPT A;  1U45 A;  5F2R A;  1SKW A;  4M42 A;  4BRQ A;  3CCQ N;  2D0B A;  5FPE A;  4CZE A;  3RMD A;  1KFD A;  1VSL A;  3DXM A;  1VSD A;  1K8K B;  3L2V A;  5AQS A;  1RBS A;  3PIO L;  1YXQ A;  1WSE A;  4EHT A;  4CJV A;  3SJH A;  2E88 A;  2EWS A;  4CFD A;  3ZSR A;  3RWU A;  1K9M O;  3E9P A;  1TYQ B;  4DF8 A;  4CGG A;  3AVG A;  4IKF A;  1ASW A;  4A61 A;  1SKR A;  1BIS A;  3HK2 A;  5M1F A;  4KPY A;  2CH6 A;  3U3G A;  1NGJ A;  4O5B A;  3T1H K;  5EX5 A;  2IGI A;  5GIN A;  3ENO A;  1S9G A;  3WNF A;  1DLO A;  2PYL A;  4N41 A;  4OO1 J;  3MDQ A;  3IUC A;  4A5B A;  3C65 A;  2V52 B;  3D45 A;  4Y1C A;  2ETJ A;  3AAR A;  2DTU A;  3MN7 A;  1VSJ A;  4E7J A;  1TUY A;  4QCL A;  3ULE B;  3TU5 A;  4DU1 A;  3OYH A;  3L6Q A;  3CJ9 A;  4KHY A;  1YAG A;  4NYF A;  3PUF A;  3VGM A;  3ITH A;  1FJG K;  3H08 A;  1IV0 A;  3ZT0 A;  1Q82 O;  3AVN A;  4KH6 A;  1DEJ A;  4JRQ A;  3DWL A;  1JCF A;  3OYJ A;  1HNI A;  1X3N A;  2B6A A;  3T69 A;  1SKS A;  3GE1 A;  3VES A;  4JD2 B;  2HVH A;  3OYF A;  4YDU A;  4DCH A;  5AQU A;  1GLF O;  4AHC A;  4JAX A;  1BQN A;  3W3D A;  2PFU A;  2HF4 A;  3L8B A;  4KFB A;  1S1X A;  1JLB A;  1TK5 A;  2VQF K;  3R9P A;  1W0H A;  3OYC A;  5J2Q A;  2RPI A;  5JS2 A;  1C1B A;  1Y97 A;  4BVP A;  4OGE A;  3KKS A;  1RT7 A;  3O9Q A;  3O3H A;  2F8T A;  1XUP O;  4DR2 K;  4CJL A;  4EP5 A;  5HBM A;  3HP6 A;  5AQV A;  3L2Q A;  2YHA A;  5EVZ A;  1XMQ K;  5KRT A;  4IG3 A;  1N5Y A;  5ADX A;  2DFH A;  5M1P A;  1L3U A;  1Q9Y A;  3K59 A;  2HB5 A;  5KGW A;  3QBW A;  2AA4 A;  4PA1 A;  2AJQ A;  1HNZ K;  4JI1 K;  4X62 K;  2GWK A;  2I7P A;  1O13 A;  2YHB A;  3WQT A;  4J2E A;  3RMB A;  3ZSV A;  3NCI A;  3QBX A;  2G8F A;  4O0J A;  3V9W A;  1QSY A;  3MCA B;  1VRU A;  3DI6 A;  4DFP A;  3EL2 A;  3NAE A;  1HMV A;  2G8K A;  1XQS C;  4CZI A;  3SAF A;  1NLV A;  4LF4 K;  1P90 A;  1VQK N;  2VG6 A;  2ZE2 A;  4LFC K;  3UKR B;  2GUI A;  4DV4 K;  3SQ4 A;  1U49 A;  1NK5 A;  4B3S K;  3A5M C;  1ESV A;  3MCP A;  1ASV A;  3O9T A;  4IWV A;  4FZX C;  4FM1 A;  4DQ8 A;  3RR8 A;  4AM6 A;  4CF0 A;  3NBP A;  1NNE A;  4FWO A;  3QIO A;  2HST A;  1TAQ A;  3CCL N;  1KAY A;  2QWM A;  1QHA A;  3WXI A;  2XO7 A;  3ZT2 A;  4QS9 A;  1NK8 A;  3OYM A;  1XHX A;  1N34 K;  2W6L A;  3VTH A;  1C1C A;  3LAK A;  3EYZ A;  2HBM A;  4JS4 A;  3LDP A;  1E3M A;  5AQY A;  3J81 O;  4M7Y A;  1KLM A;  3D2F A;  4B9M A;  1WUA A;  2I7N A;  5JLF A;  4LF6 K;  3ZX0 A;  4LF8 K;  4CEB A;  1XHZ A;  3SLC A;  1T05 A;  4DQQ A;  1TK0 A;  4DTR A;  2A6A A;  1OH6 A;  3AVM A;  3IS9 A;  1JLQ A;  4BR9 A;  3AVC A;  4AHT A;  1JCG A;  2ZGY A;  3OYE A;  2KLA A;  3NF6 A;  1RCH A;  4CK2 A;  4FVM A;  3HO1 A;  3BF3 A;  3OHR A;  5AFU H;  3VET A;  1NJW A;  1Y64 A;  2Z1H A;  3MN6 A;  3MEE A;  3SQ1 A;  4XEI A;  3P5J A;  3VMF B;  5H1S Q;  3OJU A;  4CZK A;  3KIO A;  4CZF A;  2OTJ N;  2QK9 A;  2OAN A;  1SS6 A;  3EE9 A;  1RFQ A;  4OGC A;  3ZSO A;  2QKB A;  2IC3 A;  2B5J A;  5E26 A;  4Q0B A;  1RTD A;  3LP1 A;  1NJX A;  4OKE A;  1L3S A;  3KKR A;  3K2P A;  2E2Q A;  2YHY A;  4FOI A;  3P1G A;  5ADX H;  2A40 A;  3H6E A;  3N4P A;  1WBD A;  4CE9 A;  4C8O A;  4EHU A;  2G8U A;  2P9K B;  4WFB L;  4OVL A;  4DR5 K;  2FBX A;  3G6E N;  4HCB A;  1KFS A;  4FJ7 A;  2O8D B;  3H1V X;  3T7Z A;  3AO2 A;  5F0X A;  4KB0 A;  2HBL A;  4UQG A;  1HNW K;  2EX3 A;  4FJ8 A;  2IAJ A;  4WYB A;  3Q7C A;  5BN8 A;  3GOI A;  4U67 L;  3M8S A;  4F2R A;  3W0L A;  3CET A;  2OZM A;  4DR7 K;  3KK2 A;  3NVM A;  1VQM N;  2QI2 A;  3DRR A;  3AVK A;  4N5S A;  4B1X B;  4CJW A;  4GVM A;  4I9Q A;  2O8F B;  1WAF A;  3WEE B;  3SBT A;  3OYB A;  3ATU A;  1JL2 A;  3PO5 A;  3LP3 A;  2OPQ A;  2FBT A;  4BRL A;  2UUB K;  3SMS A;  4JKB A;  4JK9 A;  3OS1 A;  1HKC A;  4BR7 A;  3OTO K;  1N8R O;  4MO4 A;  3U6F A;  4PL7 A;  1NMD A;  3ZSX A;  4CJ3 A;  5JVG L;  4M3X A;  1ZBS A;  1TV6 A;  4FJH A;  3A5L C;  3QLH A;  3CC2 N;  3AA2 A;  3OY9 A;  1CZ9 A;  2W41 A;  5AQT A;  4KHS A;  2YV0 X;  2Z1I A;  4CES A;  2Z1J A;  3VA3 A;  1X9S A;  2HVI A;  4W5N A;  3FR0 A;  3CM5 A;  4K0K K;  4AQY K;  1HNX K;  2NRH A;  4BRF A;  4UY8 O;  2D0O A;  3NMU A;  3NF9 A;  1BQM A;  4CEC A;  4LD0 A;  2YKN A;  1Q9X A;  4H0P A;  5CYM A;  3FE1 A;  3JYT A;  1XC3 A;  4A57 A;  5DM7 L;  1NGF A;  3CM6 A;  5EXW A;  2WFB A;  4LC9 B;  2D0P A;  4W5Q A;  3ZSW A;  3AAP A;  3G4S N;  3O08 A;  2NZT A;  5HRP A;  4CF9 A;  4O8K A;  5DM6 L;  1HR0 K;  2CGK A;  2GX9 A;  1Z26 A;  1C6V A;  4CHZ A;  2P9I B;  3P4I A;  3NDK A;  4CCH A;  1YJN N;  4IZ9 A;  3KWG A;  3O1B A;  1RT5 A;  4AIL C;  2HHU A;  4KHW A;  3AVF A;  5BPL A;  1N36 K;  2FXU A;  1DKG D;  4IJA A;  3H3N O;  3CQY A;  4RW7 A;  1RBV A;  3RSE B;  4JI8 K;  5AQM A;  5AJ3 K;  3ZT4 A;  2ZGZ A;  3O4N A;  3DLH A;  1S1T A;  4PHT X;  4L8R B;  1X1P A;  5BRH A;  1XNQ K;  2OCE A;  2P9N B;  3VQB A;  1TL3 A;  2GUP A;  5AQI A;  1A5X A;  2FF6 A;  4PL8 A;  3ZSY A;  2YJF A;  1VQ8 N;  1BGX T;  3LWM A;  3TAE A;  4B9S A;  2O4I A;  4U7B A;  2VQE K;  3VQ9 A;  5GAG P;  2Q0R A;  4CEE A;  4Z4F A;  2NRZ A;  2A3Z A;  4AHU A;  5EY4 A;  4J2D A;  1S9E A;  1JCE A;  5CE3 A;  1TVR A;  1V4S A;  3IG1 A;  3LWL A;  4Z4G A;  4BRO A;  3PV8 A;  3B6P A;  1KSP A;  2HHV A;  3E9L A;  2FSN A;  1R59 O;  1IG9 A;  4H0X B;  4OX9 K;  3B8A X;  3LM2 A;  1BI4 B;  4CZL A;  1K73 O;  5J1E A;  1ZBH A;  1N33 K;  2OTL N;  4BVO A;  3CCS N;  3VEV A;  1YVN A;  4ILH A;  3CF5 L;  1JXB A;  4BRI A;  3NGI A;  1ASU A;  4OPK A;  4YY3 K;  3CER A;  3L2U A;  4YHH K;  3TR8 A;  1T6D A;  3LZI A;  4CJT A;  1QHT A;  3THW B;  1F21 A;  3AV9 A;  1C0G A;  4IDK A;  2ZJP L;  2A5X A;  3TAM A;  1KAZ A;  3A5N C;  3HPG A;  3O80 A;  2OA8 A;  2KFN A;  4HTL A;  1QE1 A;  3C0B A;  1NK0 A;  2E20 A;  1U48 A;  4Z94 A;  3RMA A;  4MFB A;  1Q86 O;  4IJN A;  1MU2 A;  1SAZ A;  4BRN A;  1GLJ O;  2ZF5 O;  4CEF A;  3HP9 A;  3QER A;  2GWJ A;  3WUH A;  4M7X A;  2VGN A;  1BOT O;  3CJ1 A;  4YOX A;  3VN5 A;  1QQM A;  4JI0 K;  2P9U B;  2BDP A;  2UUC K;  1VQN N;  1NGG A;  4NXN K;  2ATQ A;  4E7L A;  1ITG A;  3HM8 A;  1VQO N;  2A1S A;  1VRT A;  3LZJ A;  4G9Z A;  3M1F A;  4HUF A;  5C0Y A;  4BE2 A;  5DK5 A;  3NHG A;  2H3G X;  4JYA K;  4RTF D;  4WQ5 C;  1Z6R A;  1JLE A;  4FCY A;  1YI2 N;  2F8S A;  4FWS A;  3R3L A;  3TSP A;  3ISN C;  3NGZ A;  3SQ0 A;  3D0P A;  3QDK A;  4V19 S;  2UYT A;  1VSF A;  2OPS A;  3CI5 A;  4LSL A;  3K9K A;  2OYQ A;  4JD2 A;  4M45 A;  3F73 A;  3HL8 A;  4GY2 B;  3HT3 A;  1GLL O;  2D0A A;  5CHI A;  2GV9 A;  4FXD A;  4A59 A;  4M41 A;  1J6Z A;  2XY7 A;  5AQW A;  3SAG A;  2Q0U A;  2HW3 A;  3EY1 A;  2NNW A;  4JRP A;  1RDW X;  3H45 C;  4KHQ A;  2HND A;  3OS2 A;  4EP4 A;  1VQP N;  3M3Z A;  5JIC A;  1UWB A;  4DTN A;  4FJJ A;  3AVB A;  3SV3 A;  1HYS A;  2GTD A;  4M3Y A;  4CVN E;  4DTJ A;  4FZY A;  1X3M A;  4FWP A;  4PKG A;  4BDP A;  2JLE A;  1N6Q A;  4DV6 K;  3O8M A;  4CD1 A;  4CF2 A;  3F5T A;  2P9S B;  5BR8 K;  3J7Z O;  3T1A A;  1QTM A;  2O8B B;  3QFP A;  4JI3 K;  3M8Q A;  1NMN A;  3UE5 A;  3CJ7 A;  4DR1 K;  3NH2 A;  1T7P A;  4GKJ K;  3L0Q A;  1BHL A;  1U6Z A;  4N76 A;  3DXK B;  3EKS A;  5HRR A;  3TTD A;  4LSN A;  3IFR A;  4YFU A;  4KB1 A;  3G71 N;  2KFZ A;  2P9P A;  4DG1 A;  3IKM A;  4BC2 A;  2QXF A;  4BRC A;  1RT6 A;  3ATV A;  2WTU A;  1TAU A;  2PYJ A;  1WSF A;  4CJK A;  4I6M A;  4L3Q A;  3KZB A;  4DV5 K;  3LAM A;  3QO9 A;  3CCU N;  1GOC A;  5AZJ B;  4ID1 A;  2Z1G A;  3CYM A;  3TSQ A;  1ZBL A;  1JL1 A;  4C1N I;  4DV1 K;  3R6M A;  5LJW A;  3PIP L;  4Y1D A;  4AHS A;  1NGI A;  5E84 A;  1SL1 A;  1SL2 A;  1BA1 A;  1NGD A;  3UKU B;  3KLI A;  3OYN A;  4YOW A;  1RT1 A;  3HI0 A;  1KVB A;  4DTM A;  1LAW A;  4E1N A;  4IOC L;  4JI2 K;  4KAZ A;  1KCF A;  2BE2 A;  3VQA A;  5HOO A;  5GAH P;  5LL6 Z;  1NJI O;  4CJS A;  1JJ2 M;  3R1X A;  5AQQ A;  3SAH A;  5JVH L;  5J2P A;  2HMI A;  2V7Y A;  4FWQ A;  3U8X A;  1B9F A;  2IIR A;  1OH5 A;  3CJC A;  2YX6 A;  4FO0 A;  3LDQ A;  1YTA A;  1SL0 A;  2VWJ A;  4HVJ A;  4AHV A;  4M3T A;  1VSE A;  3EE8 A;  3BF1 A;  3DLR A;  1RT4 A;  2YJE A;  2ZJQ L;  5TKY A;  4CBU A;  1S6P A;  4MDB A;  2ASM A;  1H1V A;  3AVL A;  3TWH A;  4BDZ A;  1B92 A;  4FM2 A;  3V9S A;  3BZK A;  1BA0 A;  3P39 A;  2Q2R A;  4DV3 K;  3J80 O;  5FLX O;  3KD5 E;  1GOA A;  3CIP A;  1J5O A;  3P38 A;  3HVR A;  1D8Y A;  2HF3 A;  3DLK A;  4MLH A;  4IO9 L;  4H03 B;  1W7A A;  3CQ8 A;  2P5O A;  1S1V A;  3MAQ A;  3BUZ B;  2E2O A;  1CLQ A;  3TAF A;  2NRX A;  1XI1 A;  2DPN A;  4NCB A;  4PKH A;  2D5R A;  2P9K A;  3BZC A;  4BGB A;  4DUZ K;  4GKK K;  3GG4 A;  3VEY A;  3QNO A;  4I7F A;  4LF7 K;  5FDL A;  1HPM A;  3R8E A;  2O8D A;  4H4O A;  3SUO A;  4OLB A;  2RN2 A;  1L3V A;  4B9T A;  1BIZ A;  1J5E K;  3PO4 A;  4KHP K;  5AQF A;  2QM1 A;  4CFB A;  3AGR A;  4YDU C;  2RF2 A;  3OW2 M;  4FWR A;  4KTQ A;  3ID6 A;  3E1Y A;  3CPE A;  3KD1 E;  3K5N A;  4BRD A;  2O8C B;  2O8F A;  4CEZ A;  5KPT A;  4DQS A;  3J8A A;  4BY9 C;  2XY6 A;  1U4B A;  3VOV A;  1BL3 A;  3WEE A;  1RTH A;  3IAY A;  3VQ5 A;  5K14 A;  3QEI A;  4K43 A;  1FKO A;  1GOB A;  2CGL A;  3FZL A;  3MX2 A;  5C15 A;  3QEP A;  4CER A;  3HZ6 A;  1JXE A;  3RMC A;  1KLN A;  5FPD A;  3S9H A;  1ATN A;  4FJ5 A;  3BP8 A;  3CG7 A;  1EWR A;  1S1W A;  3SV4 A;  1MWK A;  3U4L A;  3THX B;  4BWM A;  4I2Q A;  1WAJ A;  4B1U B;  2P1J A;  1QVG M;  4BR5 A;  4MDA A;  1HUX A;  3A2F A;  3I55 N;  4FJM A;  1EP4 A;  2Q36 A;  1FW6 A;  3OBW A;  3PSF A;  4BAC A;  1A5W A;  4CGD A;  3MWT A;  1WNS A;  4CZH A;  2RHK A;  2DFF A;  4Z4I A;  3MMV A;  3HM9 A;  1G99 A;  5FPN A;  4Z4H A;  3SZ2 A;  3B6O A;  1LW2 A;  3TTC A;  2QTD A;  1K8A O;  2O8E A;  3VQ7 A;  2FSK A;  3CPW M;  4O55 A;  2HHW A;  3F9K A;  4DR6 K;  1DTQ A;  1WOQ A;  4DKW A;  1UA0 A;  2OZS A;  4CZJ A;  1QSS A;  3NFA A;  5BPM A;  4KV8 A;  4EZ6 A;  4JKG B;  4M63 C;  1KVA A;  2JWL A;  4KO0 A;  3SK3 A;  3QEW A;  4RWT A;  2V51 B;  3THY A;  3M5R A;  4CEQ A;  4YOV A;  2F96 A;  3ZX2 A;  4NLB A;  3KJV A;  1V4T A;  3DLG A;  3C6U A;  5SWM A;  5J2N A;  5HP1 A;  4DF4 A;  1NGB A;  2E1Y A;  2QA4 N;  3T3F A;  1GLB G;  4AHR A;  3K9J A;  3OYK A;  4N47 A;  4IO8 A;  1ATR A;  1RBR A;  1T3V A;  3VA0 A;  2NRT A;  3VEO A;  4GV6 A;  1HQE A;  2GEM A;  3TTF A;  3QES A;  3U9Z A;  4F3O A;  2WUS A;  2P9I A;  3EN9 A;  2E5L K;  1NBW A;  3OYI A;  1I39 A;  1DGK N;  1VSM A;  4ZTF A;  1K6Y A;  4HWI A;  4CJ5 A;  1XNR K;  4JLH A;  2KW4 A;  2HHT A;  5AQG A;  3RSE A;  4WQ4 A;  1O1W A;  3G10 A;  5SZT A;  1IBL K;  1RT2 A;  1NK6 A;  5AQN A;  3PY8 A;  3M6G A;  4H0Y B;  1BWF O;  1RBU A;  1SZ2 A;  3JS6 A;  3VTI A;  4FYD A;  4BR2 A;  1LV5 A;  4FM0 A;  3L4I A;  1P8Z A;  4B9Q A;  3WXK A;  1QVF M;  3I0R A;  3CFR A;  4BC5 A;  3V9X A;  4E1M A;  3JXU A;  2VYP A;  4KBO A;  1YIJ N;  4H8K A;  4O0I A;  1IJJ A;  4JHD B;  2BH1 A;  5BR9 A;  3SPY A;  1KRP A;  1IKY A;  5C12 A;  4OKJ A;  3LPU A;  4IXC A;  1VQ6 N;  2WON A;  4F9O A;  1KAX A;  4PKI A;  4CJ4 A;  1TKZ A;  3MN9 A;  4CHP A;  5J2M A;  2UUA K;  1VSH A;  3FGU A;  3VQE A;  4K8X A;  4GW6 A;  1RDA A;  4B1Y B;  3F2K A;  3S3M A;  3QEV A;  2GBZ A;  3P83 D;  3KLE A;  3D2E B;  4CJQ A;  4K42 A;  4FOE A;  4OKK A;  5C2F A;  1VQ7 N;  3TAB A;  3AVH A;  4JEP A;  3AGK A;  4E3S A;  4K41 A;  1QQC A;  5M1O A;  2I5J A;  4ISE A;  3AO1 A;  4DLG A;  4KRE A;  3RRG A;  2Y1I A;  3QET A;  3PLA A;  4RW4 A;  3THW A;  3O9U A;  4MO5 A;  4BG8 A;  5JS1 A;  2NLX A;  4FLW A;  2QWN A;  3D2F B;  3RRH A;  1EXQ A;  3AO3 A;  1M90 O;  1NK9 A;  2Q97 A;  3VEN A;  1S6Q A;  3ZEU B;  3VQ8 A;  1UA1 A;  2BAN A;  2E4L A;  4FW2 A;  2KZM A;  5HRN A;  4DR4 K;  1IKX A;  2YNH A;  2QXL A;  1WLJ A;  2PBD A;  1NU0 A;  2DFE A;  2J4R A;  4NYN A;  2P9U A;  2HBK A;  2W6K A;  1T8E A;  3OYD A;  4KRF A;  3CCR N;  3LAN A;  3P31 A;  1RDD A;  4IOX A;  1FK9 A;  3GBT A;  4ISF A;  2ZJR L;  4DSJ A;  1BIU A;  1KC8 O;  3OYL A;  1TL1 A;  4J8F A;  4CZG A;  2BTF A;  1OH8 A;  4FL9 A;  1CXQ A;  3A8Y A;  2UXD K;  3K0S A;  4X65 K;  3KLH A;  4X64 K;  1JLF A;  3V9Z A;  2E6M A;  4CED A;  2KHO A;  3AVI A;  3MXM A;  2BUP A;  4NLC A;  4FPA A;  1C0M A;  3CQX A;  3H46 O;  5AZI B;  4Z0U A;  4WF9 L;  1RTI A;  3FZM A;  3SNN A;  2HOE A;  4DWI A;  2HMP A;  3ZLJ A;  2ZD1 A;  4H5W A;  3AY9 A;  4LF9 K;  1EWQ A;  4KHN A;  5A2Q O;  4FWK A;  1LCU A;  2G8H A;  1U2V B;  4M3W A;  2OPR A;  5KPZ A;  3O3F A;  1OKJ A;  1TKT A;  4JV5 K;  2YHW A;  1IO2 A;  3K5O A;  4QS8 A;  4ELV A;  2YKM A;  3CHW A;  2P9S A;  2F9T A;  4OPH A;  1NJY A;  4H4M A;  1OVQ A;  2G8V A;  1K8K A;  4Y0W A;  5AQJ A;  3SUP A;  3UIQ A;  1HPZ A;  4CGJ A;  4IOA L;  4W5O A;  1WSG A;  4E7I A;  2NRV A;  3CME N;  5I42 A;  2JWK A;  1TYQ A;  3SI6 A;  3V4I A;  5JLH A;  4JS5 A;  2HHH K;  5FRO A;  4OLA A;  1YJ9 N;  1U04 A;  5C42 A;  4WQ5 A;  2D0C A;  3OA9 A;  4CFA A;  2PY5 A;  4DU4 A;  2R7Y A;  3U9D A;  5KQ8 A;  4CEO A;  1IKV A;  1HNV A;  1J54 A;  4KH5 A;  5AZJ A;  2KKZ A;  2P5G A;  2AP1 A;  3RVC A;  2XRI A;  3O4Q A;  2YCH A;  4XH5 A;  3DMJ A;  3LDN A;  4FLU A;  2FBY A;  4ELT A;  2E6L A;  4B1V A;  3QEX A;  3HOS A;  3ZT3 A;  3UB5 A;  4DUY K;  1IKW A;  3KWI A;  3ZYY X;  4BG9 A;  3UKU A;  4NXM K;  4E19 A;  3TI0 A;  1HX1 A;  3ULE A;  1CZB A;  3WT0 A;  4LY7 A;  4BWJ A;  3S3O A;  1XMO K;  3NGY A;  3JSM A;  1TGO A;  4CD3 A;  1Z05 A;  4PUO A;  1LWC A;  2YNI A;  4CJP A;  3HYF A;  1QZ5 A;  3CFP A;  4CI6 A;  5LMU K;  5TKW A;  4E89 A;  1HRH A;  2YNG A;  3FLC O;  1I3A A;  1HJR A;  3PX0 A;  1YUW A;  2DY4 A;  3LDO A;  4CJE A;  4X66 K;  1KQS M;  2X78 A;  3NH1 A;  3TAG A;  4FJI A;  3CCV N;  1S22 A;  3EKU A;  4W5T A;  2QW9 A;  3TAN A;  4A5A A;  4DSK A;  4JI6 K;  5KTQ A;  5GAE P;  4DV7 K;  4CHY A;  3BEX A;  3BGR A;  3WNH A;  3NE6 A;  4FWL A;  2XHB A;  1IBM K;  4KHU A;  3KTQ A;  2HHQ A;  4C23 A;  4DSE A;  3J7Y P;  5CY4 A;  4FK2 A;  3DM2 A;  1S1U A;  3VEZ A;  4DR3 K;  3HSC A;  5AQR A;  3AO5 A;  3CJB A;  3SJJ A;  1YIT N;  3LP0 A;  3HVT A;  2IVO A;  3AAQ A;  3L2W A;  2P9L B;  2ZQB A;  3PX6 A;  1RBT A;  1A5V A;  4DB3 A;  4DFM A;  4QAG A;  4FLV A;  1EX4 A;  4DQI A;  1NM1 A;  3J7A P;  5E41 A;  4B8A B;  3VEX A;  4YNQ A;  1IBK K;  4JK7 A;  1LWE A;  3HXM A;  1LWF A;  1SV5 A;  1SQK A;  4CF8 A;  3ZSZ A;  4HUE A;  2D1K A;  4BC4 A;  3C95 A;  4HTU A;  1JLG A;  3TAR A;  5KI6 A;  1VQL N;  3C6H A;  4JN4 A;  3OBY A;  1GLA G;  4CIE A;  4BR0 A;  4RG8 A;  3U3Y A;  3UKR A;  4EFH A;  3E01 A;  3DRP A;  4H0O A;  2YHX A;  2ITM A;  4CBW A;  4LFA K;  5I9E B;  5C24 A;  4IFY A;  4M3Z A;  4EIA A;  2IOC A;  1ZYQ A;  2O8C A;  1HKG A;  1ZBU A;  4GNI A;  1VQ4 N;  1DT9 A;  2GEL A;  4B3O A;  2WC9 A;  5AQX A;  1C0F A;  1J9A A;  1RNH A;  2QKK A;  3VQC A;  1NG9 A;  4F4K A;  1RDC A;  2HHX A;  5B8H A;  2Q3S A;  3OYA A;  1R0A A;  5C2D A;  2F7T A;  3SUQ A;  3ENH A;  1TKX A;  3ASM A;  1IG8 A;  4GMJ B;  4FJK A;  4DTS A;  3PSI A;  4FJN A;  1N32 K;  1LAV A;  3EZW A;  5JMV A;  3THX A;  4CGI A;  5AQP A;  3ZET B;  4G1Q A;  2IVN A;  3MXI A;  3O9S A;  3AO4 A;  4Z4E A;  1ZBF A;  3V81 A;  4MLE A;  2VG5 A;  3ZCM A;  1RT3 A;  3KHY A;  1BCM A;  4B3R K;  4BRH A;  3V1O A;  4DV2 K;  5LY3 A;  3JAM O;  1D9F A;  4IG0 A;  3A5O C;  3L3U A;  4BE0 A;  4FK0 A;  3O3G A;  1JLC A;  4HCC A;  2RE2 A;  4FJ9 A;  3NVK A;  1YF5 L;  5D3G A;  3DJC A;  1RIL A;  1Q18 A;  1QQO A;  3ALY A;  3I8B A;  2FSJ A;  1MA9 B;  1NGH A;  3SCX A;  5AQK A;  1S5J A;  1KTQ A;  4DSI A;  2QWP A;  2VWB A;  5FRM A;  3VF6 A;  2NRW A;  1J53 A;  4WE1 A;  2ZM6 K;  4JKG A;  1BG3 A;  4LFB K;  1EET A;  3OVN A;  4KH4 A;  1RGI A;  4FJL A;  4LH5 A;  4J2B A;  4B9L A;  4AH9 A;  4E0D A;  5AFU A;  4JKA A;  3O6W A;  4CJU A;  4B9V A;  3I0S A;  5HRS A;  3RR7 A;  3ZSQ A;  3QML A;  1GLE G;  3C7N B;  3ZX3 A;  3HOT A;  2E2P A;  1UOC A;  2IDO A;  1W9H A;  1CZA N;  3KLG A;  4CIG A;  3DXM B;  5LJV A;  1JLA A;  5HL7 L;  3LP2 A;  4JK8 A;  5C25 A;  1TK8 A;  2E8A A;  4A2B A;  5GIP A;  2FF3 B;  3DYA A;  3D6R A;  3H3O B;  1B9D A;  3AA3 A;  4ELU A;  1VHX A;  1MWM A;  2P9P B;  1LOT B;  3VGK A;  3S41 A;  4BQZ A;  3CCM N;  4F8R A;  4JKD A;  3K5L A;  4YOU A;  3KK1 A;  2QEX N;  4JHD A;  4I9L A;  4FWN A;  5MLC Q;  2VG7 A;  3CCE N;  3VQQ A;  4I6M B;  1VSK A;  4HHT A;  1QS4 A;  4B8C A;  5EOY A;  4H0T B;  2LSN A;  3AA5 X;  3WNG A;  1T6C A;  4RW6 A;  5CZ1 A;  4DHY A;  5CZ2 A;  2D4W A;  1YVU A;  1L3T A;  2O4G A;  2JGU A;  1IH7 A;  3IDH A;  1SUQ A;  1BDG A;  3KK7 A;  2A41 A;  4JI4 K;  4JKH A;  3D2E A;  4AM7 A;  3SUN A;  4F3T A;  1UAX A;  4H5V A;  1NKE A;  2VCP A;  1NOY A;  1TKD A;  4AF1 A;  4E7H A;  5AQO A;  3AVJ A;  3EEQ A;  4FLX A;  1X9M A;  3M8P A;  4C8K A;  4TSX A;  2E2N A;  3SMP A;  3TSU A;  3OS0 A;  4NCG A;  3V1R A;  3MED A;  2CGJ A;  4CHN A;  2A42 A;  2VWK A;  4YOR A;  2OPP A;  4H5R A;  4GV9 A;  4FVU A;  3ZT1 A;  4C8N A;  3FZK A;  1JKH A;  3E66 A;  5KGX A;  4O5F A;  3I56 N;  5KQD A;  4I2P A;  5BRD A;  3QIP A;  3VF4 A;  4CFC A;  3TPQ A;  4DV0 K;  5I3U A;  3ZEU A;  3BDP A;  5M1Q A;  4JNE A;  4IEE A;  3T1Y K;  3LDS A;  3FFI A;  1VAZ A;  3KLF A;  1BU6 O;  1Q7Y O;  3VQP A;  3MXJ A;  3N4Q A;  4DFK A;  1ZBI A;  3SPZ A;  4BC3 A;  2ITG A;  4DTX A;  2QWR A;  3HTV A;  4CBX A;  4BQL A;  3K5M A;  4FW1 A;  4DS4 A;  5KPR A;  3NH0 A;  3QIC A;  2V7Z A;  1WSH A;  4DQP A;  4NO7 A;  3VF2 A;  1NKC A;  1GLC G;  3AVA A;  3L4Q A;  1YHQ N;  1QSL A;  1HYZ A;  5BRF A;  4CJR A;  4JI5 K;  3S3N A;  1REV A;  2FLO A;  3WNE A;  2RKI A;  3FZF A;  5BPN A;  1YTU A;  5T7B A;  3PX4 A;  1XC9 A;  2G8I A;  5GIO A;  2X74 A;  4HUG A;  4CZM A;  2KQ2 A;  2P9N A;  3HBT A;  4EAH D;  1W97 L;  3HPH A;  4BRK A;  3MN5 A;  3QIN A;  2PAV A;  2EHG A;  3EO3 A;  2UXC K;  4NCA A;  4H5N A;  4CK3 A;  3ENB A;  4C8L A;  2Q1N A;  3C6T A;  1TUU A;  5AZI A;  3GDQ A;  5FPM A;  5IT9 O;  1D5A A;  3DLL L;  3NF7 A;  3CC4 N;  4QS7 A;  4FLZ A;  4B1Z A;  4Q5V A;  3LDL A;  4PWD A;  1NJZ A;  1WSJ A;  1BO5 O;  1U2V A;  2WOM A;  1I94 K;  4JI7 K;  4JKC A;  4B1W B;  4Z4C A;  2ASP A;  1KD1 O;  3DLE A;  1WSI A;  2QWO A;  1BI4 A;  2BGG A;  2FBV A;  1QQN A;  1ATS A;  4CGH A;  1VQ5 N;  4CGF A;  4JKE A;  5HLF A;  3C94 A;  4XH1 A;  3L2R A;  1NGA A;  3O9R A;  4K25 A;  1HKB A;  4DTO A;  2X6N A;  4R5P A;  4FK4 A;  4BR4 A;  4FSV A;  4CJF A;  3F9M A;  4WQ4 C;  4RW9 A;  3WQU A;  1XWL A;  4CHQ A;  4RCH A;  1NK4 A;  3HPO A;  1ZC6 A;  4O8U A;  1YT3 A;  2HBJ A;  2VGM A;  3DAW A;  3WXJ A;  3K57 A;  1OVY A;  4M3R A;  2PZS A;  1RTJ A;  4WFA L;  3GL1 A;  2P51 A;  4DTU A;  3QFU A;  4LH4 A;  4PQU A;  4ZHR A;  1RDB A;  4ICL A;  2O8E B;  3ID8 A;  3FZH A;  1VK0 A;  2IS3 A;  3C6A A;  4C1N K;  5M1K A;  3L3V A;  4IFE A;  1WBB A;  1RDU A;  3Q7B A;  1C1A A;  3MWP A;  1ILY A;  1W2B M;  1HLU A;  3G0Z A;  3V9U A;  3THY B;  4WFN L;  2KZZ A;  2NRR A;  4B3M K;  1WN7 A;  4RW8 A;  3OJS A;  1X9J A;  4FLT A;  3SQ2 A;  4ZTJ A;  2XY8 A;  5LMN K;  4GVE A;  3VEW A;  5C10 A;  4CHO A;  3AA4 A;  4N56 A;  1Q8I A;  4BRG A;  5AQH A;  3THV A;  2UXB K;  1FKP A;  1YJW N;  1L5U A;  3DRS A;  3DOL A;  1S3X A;  3FFK B;  4DSL A;  4CF1 A;  2FC0 A;  1KXP A;  4ILJ A;  4C8M A;  1CXU A;  4CEA A;  4PY5 A;  4DS5 A;  1HQU A;  4ILG B;  3SYZ A;  3V6D A;  4DFJ A;  1E4F T;  3VGL A;  3QB0 A;  2G8W A;  4DMN A;  2NUB A;  1FXX A;  4CW7 B;  4KI4 A;  1BUP A;  3CC7 N;  5CYQ A;  4KKO A;  1X9W A;  4DQR A;  1MDU B;  3A0I X;  3VQ4 A;  3O1W A;  2A1R A;  2ZWH A;  4KI6 A;  4BE1 A;  5F1X A;  1Z25 A;  3HST B;  3O5B A;  3M8R A;  3MK6 A;  3CMA N;  2HNZ A;  3CJA A;  3SBG A;  4ID5 A;  1T44 A;  2Y1J A;  1BCO A;  4BRP A;  4A62 A;  4CK1 A;  3HJF A;  4B9N A;  1EO1 A;  3KK3 A;  3MX5 A;  2P9L A;  3VQD A;  4NB4 A;  3OYG A;  2O8B A;  1NGE A;  4IDH A;  4FJG A;  1C0U A;  4WCE L;  4O4G A;  4H0V B;  3H1Q A;  1LW0 A;  4CIF A;  3EZ5 A;  5FRN A;  1NOZ A;  4J2A A;  1ZXO A;  1EKE A;  5BN9 A;  2HHS A;  4DTP A;  3DXK A;  2X6S A;  3VPZ A;  3IMX A;  1QZ6 A;  4CJ7 A;  3V1Q A;  2XY5 A;  3DLB A;  2B4J A; 
#chains in the Genus database with same CATH homology
 3UKR A;  3VOV A;  3WEE A;  4IEI A;  4BR7 A;  3KVG A;  4EFH A;  1N8R O;  4H0O A;  4MO4 A;  5AQL A;  4PL7 A;  2YHX A;  1NMD A;  5JVG L;  2W40 A;  2ITM A;  4CBW A;  1ZBS A;  4K43 A;  5I9E B;  1S72 N;  3LM9 A;  2CGL A;  3FZL A;  4EIA A;  3A5L C;  3MX2 A;  1HKG A;  5C15 A;  3G25 A;  3HZ6 A;  1DT9 A;  4GNI A;  1VQ4 N;  2GEL A;  3CD6 N;  3CC2 N;  2WC9 A;  5AQX A;  5FPD A;  1C0F A;  1ATN A;  4H5T A;  3BP8 A;  1MWK A;  3U4L A;  4FWM A;  4BGA A;  4B1U B;  5B8H A;  1QVG M;  4BR5 A;  4MDA A;  5C2D A;  3CCJ N;  1HUX A;  2W41 A;  2F7T A;  5AQT A;  1VQ9 N;  3ENH A;  1IG8 A;  3I55 N;  3FR0 A;  2Q36 A;  3OBW A;  4YOT A;  2QWL A;  2NRH A;  3EZW A;  4BRF A;  5JMV A;  4UY8 O;  5ELZ A;  3MWT A;  2D0O A;  4CZH A;  2RHK A;  5AQP A;  3NMU A;  3ZET B;  5CR4 A;  4GV3 A;  3MMV A;  2IVN A;  3WXL A;  5GAD P;  1G99 A;  1EQY A;  5FPN A;  3O9S A;  4H0P A;  1D4X A;  4MLE A;  3FE1 A;  3KHY A;  3TTC A;  2QTD A;  1XC3 A;  1K8A O;  4BRH A;  2FSK A;  3CPW M;  5LY3 A;  2Q31 A;  4A57 A;  5DM7 L;  1Q81 O;  1NGF A;  1WOQ A;  5EXW A;  4DKW A;  3A5O C;  4CZJ A;  2WFB A;  3ZET A;  3D7E O;  4LC9 B;  2D0P A;  2RE2 A;  5BPM A;  3AAP A;  4FPB A;  4JKG B;  4M63 C;  3NVK A;  3G4S N;  2JWL A;  1YF5 L;  3O08 A;  3SK3 A;  2NZT A;  5AQZ A;  2V51 B;  4RWT A;  3DJC A;  3M5R A;  4JKF A;  1Q18 A;  4YOV A;  1QQO A;  3ZX2 A;  1GLD G;  4NLB A;  3I8B A;  4O8K A;  1E4G T;  1V4T A;  5DM6 L;  2FSJ A;  1MA9 B;  1NGH A;  2CGK A;  2GX9 A;  1NGB A;  4OPA A;  5AQK A;  5BRE A;  2E1Y A;  1NGC A;  2QWP A;  2VWB A;  4BRM A;  2P9I B;  3P4I A;  2E1Z A;  3I33 A;  3VF6 A;  2QA4 N;  2NRW A;  1GLB G;  4XH4 A;  1YJN N;  4IZ9 A;  3KWG A;  1BG3 A;  3O1B A;  4JKG A;  3K9J A;  4IO8 A;  5BPL A;  1ATR A;  1T3V A;  2FXU A;  1DKG D;  2NRT A;  4IJA A;  3WXM B;  3VEO A;  3H3N O;  4A2A A;  2GEM A;  3CQY A;  4KH4 A;  1RGI A;  3TTF A;  3U9Z A;  4BRE A;  3RSE B;  2WUS A;  2P9I A;  3EN9 A;  4E1J A;  3O4W A;  3HRG A;  5AQM A;  1NBW A;  5AFU A;  2ZGZ A;  4JKA A;  1DGK N;  3O6W A;  4PHT X;  3E9O A;  4HWI A;  4R79 A;  5BRH A;  3VER A;  2P9N B;  5M1N A;  4YOY A;  1NWK A;  4BRA A;  2GUP A;  5AQG A;  3RSE A;  4WQ4 A;  3CXC M;  5AQI A;  1M1K O;  2ASO A;  2FF6 A;  5AQN A;  4PL8 A;  3QML A;  1GLE G;  2YI1 A;  2IVP A;  3C7N B;  3M6G A;  4H0Y B;  2YJF A;  1BWF O;  3ZX3 A;  1VQ8 N;  1SZ2 A;  3HOT A;  2E2P A;  2QWQ A;  3JS6 A;  3VTI A;  4BR2 A;  4U7B A;  2F9W A;  1CZA N;  3L4I A;  1P8Z A;  2CH5 A;  5GAG P;  2Q0R A;  2NRZ A;  2A3Z A;  3DXM B;  3WXK A;  4ISG A;  4B9Q A;  5LJV A;  1QVF M;  5EY4 A;  4BC5 A;  1JCE A;  5CE3 A;  1HJO A;  5HL7 L;  1V4S A;  3JXU A;  3C7N A;  4JK8 A;  4BRO A;  2VYP A;  2WBN A;  4KBO A;  2E8A A;  3LL3 A;  5AR0 A;  1YIJ N;  4A2B A;  5GIP A;  5F2R A;  2FF3 B;  1IJJ A;  3D6R A;  2BH1 A;  3H3O B;  4JHD B;  3E9L A;  4BRQ A;  5BR9 A;  3CCQ N;  2FSN A;  5C12 A;  5FPE A;  4CZE A;  4IXC A;  1VQ6 N;  3DXM A;  1MWM A;  1R59 O;  4F9O A;  2P9P B;  1K8K B;  1KAX A;  4PKI A;  4H0X B;  5AQS A;  3B8A X;  3LM2 A;  1LOT B;  3VGK A;  3PIO L;  1YXQ A;  4CZL A;  3MN9 A;  3S41 A;  4EHT A;  1K73 O;  4BQZ A;  3CCM N;  3SJH A;  2E88 A;  4JKD A;  2EWS A;  4YOU A;  1K9M O;  2QEX N;  3FGU A;  4JHD A;  5MLC Q;  4FWN A;  3E9P A;  4B1Y B;  4BVO A;  2OTL N;  3CCS N;  3F2K A;  3VEV A;  1YVN A;  4I6M B;  3CCE N;  4ILH A;  1TYQ B;  3CF5 L;  4BRI A;  5EOY A;  4H0T B;  3CER A;  3D2E B;  1T6C A;  4FOE A;  4K42 A;  5C2F A;  1VQ7 N;  4DHY A;  1T6D A;  4A61 A;  4JEP A;  2D4W A;  3IDH A;  1BDG A;  5M1F A;  3AGK A;  2CH6 A;  3KK7 A;  1C0G A;  1NGJ A;  2A41 A;  4K41 A;  2ZJP L;  5EX5 A;  2A5X A;  5M1O A;  4JKH A;  3D2E A;  5GIN A;  3ENO A;  4ISE A;  1KAZ A;  4AM7 A;  3A5N C;  3O80 A;  4OO1 J;  3MDQ A;  3IUC A;  4A5B A;  3C65 A;  4HTL A;  4H5V A;  2V52 B;  3PLA A;  3C0B A;  3O9U A;  4MO5 A;  2E20 A;  2VCP A;  4BG8 A;  4Z94 A;  2NLX A;  3AAR A;  4AF1 A;  1Q86 O;  5AQO A;  2QWN A;  3MN7 A;  4IJN A;  3D2F B;  1SAZ A;  2E2N A;  3SMP A;  1GLJ O;  1TUY A;  2ZF5 O;  3TSU A;  4BRN A;  3ULE B;  1M90 O;  3TU5 A;  2Q97 A;  3VEN A;  2GWJ A;  2CGJ A;  3WUH A;  3L6Q A;  2VGN A;  1BOT O;  3CJ9 A;  2A42 A;  3CJ1 A;  4M7X A;  4YOR A;  4H5R A;  3ZEU B;  4YOX A;  4GV9 A;  4FVU A;  1YAG A;  3FZK A;  1QQM A;  3E66 A;  3I56 N;  4O5F A;  3VGM A;  5KQD A;  2P9U B;  5BRD A;  3VF4 A;  1VQN N;  3TPQ A;  1Q82 O;  1NGG A;  4KH6 A;  1DEJ A;  3ZEU A;  2QXL A;  5M1Q A;  3HM8 A;  4JNE A;  4IEE A;  1VQO N;  3DWL A;  2PBD A;  4G9Z A;  3M1F A;  1JCF A;  5C0Y A;  2J4R A;  2P9U A;  1VAZ A;  2HBK A;  1X3N A;  1BU6 O;  2H3G X;  3T69 A;  3GE1 A;  1Q7Y O;  4RTF D;  4WQ5 C;  1Z6R A;  3VES A;  4JD2 B;  3N4Q A;  3CCR N;  1YI2 N;  3P31 A;  4YDU A;  4FWS A;  4BC3 A;  2QWR A;  3R3L A;  3HTV A;  4IOX A;  3TSP A;  4CBX A;  3GBT A;  4BQL A;  5AQU A;  4DCH A;  1GLF O;  5KPR A;  4ISF A;  4JAX A;  2ZJR L;  3QIC A;  3W3D A;  2PFU A;  2HF4 A;  2V7Z A;  1KC8 O;  3QDK A;  4NO7 A;  3VF2 A;  4J8F A;  2UYT A;  4CZG A;  3CI5 A;  1GLC G;  3R9P A;  3K9K A;  2BTF A;  4JD2 A;  3L4Q A;  4FL9 A;  4BVP A;  1YHQ N;  5BRF A;  3A8Y A;  3O9Q A;  1XUP O;  4GY2 B;  2FLO A;  1GLL O;  5CHI A;  3FZF A;  4A59 A;  5BPN A;  1J6Z A;  5AQW A;  3SAG A;  2Q0U A;  5AQV A;  2KHO A;  2NNW A;  5GIO A;  2BUP A;  5EVZ A;  1RDW X;  4NLC A;  4CZM A;  4FPA A;  3H45 C;  2P9N A;  3HBT A;  5ADX A;  5M1P A;  1W97 L;  3CQX A;  4EAH D;  1VQP N;  3H46 O;  5AZI B;  3M3Z A;  5JIC A;  4BRK A;  3QBW A;  4WF9 L;  2AA4 A;  3MN5 A;  2GTD A;  3FZM A;  2HOE A;  2PAV A;  2HMP A;  1X3M A;  4FWP A;  4PKG A;  3EO3 A;  2GWK A;  4H5W A;  2I7P A;  3AY9 A;  4H5N A;  1O13 A;  4FWK A;  1LCU A;  3ENB A;  2Q1N A;  3O8M A;  3WQT A;  4CD1 A;  1TUU A;  1U2V B;  2P9S B;  3F5T A;  3J7Z O;  5AZI A;  3GDQ A;  5KPZ A;  3QFP A;  5FPM A;  3QBX A;  1OKJ A;  3UE5 A;  3MCA B;  3DLL L;  2YHW A;  3CJ7 A;  3CC4 N;  4QS7 A;  4QS8 A;  4B1Z A;  3L0Q A;  3EL2 A;  3LDL A;  1U6Z A;  3CHW A;  3DXK B;  3EKS A;  1BO5 O;  1U2V A;  2P9S A;  3TTD A;  2F9T A;  1XQS C;  4OPH A;  4CZI A;  3SAF A;  3IFR A;  1NLV A;  1P90 A;  1VQK N;  3G71 N;  2P9P A;  4JKC A;  1K8K A;  4B1W B;  2ASP A;  3UKR B;  3IKM A;  1KD1 O;  2QWO A;  4BC2 A;  4Y0W A;  5AQJ A;  4BRC A;  3A5M C;  1ESV A;  1QQN A;  1ATS A;  4IOA L;  3MCP A;  3O9T A;  3ATV A;  4IWV A;  1VQ5 N;  4JKE A;  4DQ8 A;  2NRV A;  4XH1 A;  1NGA A;  3CME N;  3O9R A;  2JWK A;  4I6M A;  4K25 A;  1HKB A;  4L3Q A;  4AM6 A;  1TYQ A;  3KZB A;  5JLH A;  3CCU N;  4BR4 A;  5AZJ B;  4FWO A;  1YJ9 N;  4FSV A;  3TSQ A;  4WQ5 A;  2HST A;  3OA9 A;  3F9M A;  4WQ4 C;  4C1N I;  3R6M A;  5LJW A;  3WQU A;  3CCL N;  3PIP L;  4RCH A;  1KAY A;  2QWM A;  1ZC6 A;  3U9D A;  5KQ8 A;  4O8U A;  1NGI A;  1QHA A;  2HBJ A;  2VGM A;  3DAW A;  5E84 A;  3WXJ A;  3WXI A;  1OVY A;  1BA1 A;  1NGD A;  4GV6 A;  4QS9 A;  3UKU B;  4KH5 A;  5AZJ A;  2KKZ A;  2AP1 A;  3RVC A;  4WFA L;  3GL1 A;  2YCH A;  4XH5 A;  4YOW A;  3VTH A;  3QFU A;  3LDN A;  2HBM A;  3HI0 A;  4B1V A;  3HOS A;  4IOC L;  3UB5 A;  3LDP A;  5AQY A;  3ID8 A;  3KWI A;  4M7Y A;  3D2F A;  3FZH A;  3ZYY X;  3UKU A;  4BG9 A;  1WUA A;  2I7N A;  3C6A A;  4C1N K;  5M1K A;  5HOO A;  5GAH P;  5JLF A;  1HX1 A;  3ULE A;  3WT0 A;  4IFE A;  1NJI O;  1RDU A;  3Q7B A;  3ZX0 A;  3MWP A;  4CD3 A;  1JJ2 M;  1ILY A;  1Z05 A;  3R1X A;  5AQQ A;  3SAH A;  5JVH L;  2V7Y A;  4FWQ A;  1HLU A;  1W2B M;  3U8X A;  2IIR A;  3SLC A;  3CJC A;  2YX6 A;  4FO0 A;  4WFN L;  3LDQ A;  1QZ5 A;  2A6A A;  2NRR A;  4CI6 A;  1X9J A;  4BR9 A;  4GVE A;  5TKW A;  3VEW A;  3EE8 A;  5C10 A;  3BF1 A;  1JCG A;  2ZGY A;  4BRG A;  5AQH A;  3FLC O;  2KLA A;  2YJE A;  2ZJQ L;  5TKY A;  4CBU A;  3BF3 A;  1YUW A;  3OHR A;  5AFU H;  4MDB A;  3LDO A;  1YJW N;  2ASM A;  1H1V A;  3VET A;  1KQS M;  1Y64 A;  3MN6 A;  3CCV N;  1S3X A;  3FFK B;  1S22 A;  3EKU A;  4XEI A;  3VMF B;  5H1S Q;  1KXP A;  1BA0 A;  4ILJ A;  4CZK A;  2QW9 A;  4CZF A;  2OTJ N;  3P39 A;  2OAN A;  1SS6 A;  2Q2R A;  3EE9 A;  4A5A A;  1RFQ A;  5GAE P;  3BEX A;  4FWL A;  5E26 A;  4ILG B;  4C23 A;  2E2Q A;  1E4F T;  2YHY A;  4FOI A;  3VGL A;  3QB0 A;  3CIP A;  5ADX H;  2A40 A;  3H6E A;  3VEZ A;  3P38 A;  3N4P A;  3HSC A;  5AQR A;  4EHU A;  1BUP A;  3CC7 N;  2HF3 A;  2P9K B;  4MLH A;  4WFB L;  4IO9 L;  4H03 B;  3CJB A;  1MDU B;  3A0I X;  3BUZ B;  2E2O A;  3O1W A;  2ZWH A;  1YIT N;  3G6E N;  2NRX A;  2DPN A;  3H1V X;  3T7Z A;  5F1X A;  5F0X A;  2IVO A;  3O5B A;  3AAQ A;  2HBL A;  2P9L B;  3MK6 A;  3CMA N;  4DB3 A;  3CJA A;  4PKH A;  3SBG A;  2P9K A;  1T44 A;  4BGB A;  4WYB A;  1NM1 A;  3GG4 A;  3Q7C A;  3GOI A;  4BRP A;  4A62 A;  4U67 L;  3W0L A;  3CET A;  3VEY A;  5BN8 A;  3NVM A;  1HPM A;  3R8E A;  3VEX A;  1VQM N;  2QI2 A;  4JK7 A;  1EO1 A;  3MX5 A;  4B1X B;  2P9L A;  4NB4 A;  5AQF A;  1NGE A;  2QM1 A;  1SQK A;  4IDH A;  3AGR A;  4YDU C;  3WEE B;  4WCE L;  3SBT A;  4H0V B;  3H1Q A;  2D1K A;  4FWR A;  4BC4 A;  3OW2 M;  3ID6 A;  3E1Y A;  3ATU A;  1ZXO A;  5BN9 A;  3CPE A;  4BRL A;  3DXK A;  3SMS A;  4BRD A;  1VQL N;  3C6H A;  4JKB A;  3OBY A;  4JN4 A;  1GLA G;  3VPZ A;  3IMX A;  1QZ6 A;  4JK9 A;  3J8A A;  4CJ7 A;  5KPT A;  4BY9 C;  4BR0 A;  1HKC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...