2ZJQL

Interaction of l7 with l11 induced by microccocin binding to the deinococcus radiodurans 50s subunit
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
104
structure length
104
Chain Sequence
RRKLRTRRKVRTTTAASGRLRLSVYRSSKHIYAQIIDDSRGQTLAAASSAALKSGNKTDTAAAVGKALAAAAAEKGIKQVVFDRGSYKYHGRVKALADAAREGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ribosomal 23S RNA
publication title Translational regulation via L11: molecular switches on the ribosome turned on and off by thiostrepton and micrococcin.
pubmed doi rcsb
molecule tags Ribosome
total genus 17
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2008-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00861 Ribosomal_L18p Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.100 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2zjqL01
1VQPN 3CF5L 5DM6L 3CCEN 5MLCQ 4IOCL 3OW2M 1VQKN 4IOAL 1VQ4N 2QA4N 1YJWN 3J7ZO 3DLLL 3CCJN 1Q86O 5GADP 3CCMN 1VQON 1ILYA 3G71N 5JVHL 3I55N 1VQ5N 1YJNN 2OTJN 3CCVN 5JVGL 1M1KO 1VQLN 1K73O 3CCRN 5GAEP 1JJ2M 1N8RO 1Q7YO 5DM7L 1VQ9N 1KQSM 1VQ7N 4U67L 4WCEL 3CCSN 2ZJPL 1VQMN 1W2BM 4UY8O 1YITN 1K9MO 3G4SN 3CC7N 1YJ9N 1YIJN 1S72N 5HL7L 3CMEN 3I56N 1K8AO 4WFNL 3CPWM 1NJIO 5H1SQ 3CCLN 3G6EN 3CCUN 2ZJQL 2OTLN 1M90O 1Q82O 1QVFM 3CD6N 1VQ8N 1QVGM 1YI2N 3PIPL 3CC4N 5GAHP 1VQNN 4WF9L 3CCQN 4WFBL 5GAGP 1OVYA 3CXCM 1VQ6N 1KC8O 1YHQN 2QEXN 3CMAN 4WFAL 1Q81O 3CC2N 3PIOL 2ZJRL 1KD1O 4IO9L
chains in the Genus database with same CATH superfamily
4BRCA 4DTJA 3BUZB 3LAMA 1VQKN 1G99A 3QICA 3NH1A 2A41A 2QA4N 3LALA 2NRVA 1Y97A 1YJWN 4GKJK 3OYLA 3HK2A 5AQOA 3PX0A 4DQ8A 3NHGA 5ADXH 4H5VA 2FLOA 3LM9A 4FOIA 4RW8A 1NU0A 3CCMN 4JK8A 4NB4A 1VQON 4IJNA 4B9NA 2O8BA 4LH4A 3KK7A 3C95A 4CZHA 4ILHA 4PHTX 3HP6A 4FJ5A 4K43A 1BA1A 1YTUA 3SUQA 4J2BA 1QSSA 1SL0A 5EU7A 3EZWA 2IDOA 1WBDA 1Q7YO 4F3TA 3ENHA 5EVZA 4CZKA 4RW7A 3CHWA 1KSPA 4ICLA 2F4VK 3SQ2A 2P9NB 4FWQA 4JRQA 4JEPA 1K9MO 1QZ5A 4FK2A 3VTHA 3O6WA 4FJNA 3SUNA 4FJJA 1S1XA 4B9LA 1HPZA 1UAXA 4AM7A 4GVMA 2HBMA 3FZLA 3Q7CA 1HNWK 1I3AA 4KH4A 3WNHA 2E2QA 2PY5A 4ID1A 5D3GA 3U4LA 2JWKA 1ATSA 3OJUA 3AARA 3WQTA 1HR0K 3OS0A 2B6AA 4JLHA 2D0OA 3QDKA 4LF7K 4B3OA 3O3GA 1XC9A 5F2RA 5GIPA 2IS3A 4QAGA 1O1WA 3VETA 4CJTA 4DTPA 2BTFA 3IMXA 4NLCA 3SYZA 1XI1A 1U6ZA 3SV3A 1U47A 4BGBA 3VESA 5AQPA 2DPNA 3SPYA 1XQSC 3KJVA 1BA0A 4K0KK 1GLFO 3VN5A 1CLQA 1VAZA 3IG1A 4CGDA 3BF3A 4KHWA 2CGKA 3THWA 3ZSWA 4W5TA 2E1ZA 2B5JA 5F0XA 1LWCA 1DLOA 1HRHA 3HM8A 4JS4A 1BI4A 1TKXA 3CJBA 1SS6A 1XMOK 2YHWA 1HX1A 3R6MA 4PKGA 2OPQA 4H0YB 3I0SA 3FGUA 4CHOA 2GBZA 4E1MA 3HM9A 1NK0A 3LP1A 1KAYA 2WC9A 5JS2A 2HB5A 3VOVA 4F3OA 2XY6A 2VG5A 4DFPA 4EZ6A 4FOEA 4AHCA 2P9PB 1JLAA 1NGGA 4MDAA 3AO3A 4LSNA 4IDHA 4DSJA 2P9SB 4CEFA 3OY9A 3J7AP 3U8XA 1XUPO 3K58A 3TSQA 1NGFA 4M63C 4JHDA 3AVMA 3ZT1A 3WEEA 3PY8A 3LANA 4FZXC 4PUOA 2W42A 4BC4A 4CGGA 1L3SA 1U04A 2CH6A 3QETA 3DXMA 1OH5A 1SL1A 1RBVA 3WNGA 2E8AA 5M1QA 4IJAA 1NOYA 3SAGA 2Y1IA 3W3DA 1NNEA 2E88A 3M1FA 1RDBA 1T3VA 3L0QA 1BQNA 5I42A 4L8RB 3VTIA 1ESVA 1EQYA 3ATUA 3SZ2A 4HUEA 3L8BA 4FXDA 4CD3A 2HNYA 3PX4A 4JD2B 2OPPA 3IAYA 2HHVA 4RTFD 3LAKA 1GLLO 5M1KA 4BWJA 2GWKA 2NRXA 4FLUA 3VQDA 4OPJA 1HNVA 1X1PA 1NGEA 2O8DA 4WQ4A 5FPEA 2XHBA 5HRPA 1NBWA 4JI8K 4YHHK 4GV3A 4Z4FA 4WFAL 4X65K 4CJWA 3CERA 4QS8A 2FC0A 3KLGA 5JMVA 1RGIA 4RW4A 2O4IA 4NCAA 1SV5A 4H0OA 3VQ8A 1IKXA 2GUIA 4O55A 3OJSA 4FLWA 1RDWX 4CEQA 4BACA 2HHTA 4FPAA 3MXJA 3BY5A 3J7ZO 2ZGZA 2ASMA 4XEIA 4KTQA 1X3MA 4E0DA 3VQEA 3SI6A 1JKHA 2GELA 2GEMA 4BC5A 5AQFA 2YHYA 3M8PA 3V9SA 5AR0A 3RTVA 2F96A 4FJLA 4B9SA 3OYIA 1JJ2M 2LSNA 1WOQA 3C0BA 4BR9A 3NVMA 3CPEA 1J53A 2KHOA 1Q9XA 1ASWA 2F7TA 4HUGA 4B9TA 3NF9A 4DB3A 2IIRA 3WXKA 4LF6K 1TGOA 4O8KA 4CEOA 2HVIA 3VQPA 1GLDG 3NVKA 3ENBA 1YIJN 4PA1A 1K8KA 1VSDA 3AVBA 3HVRA 3MXMA 1JLEA 4PL8A 4A2AA 1BOTO 3F9KA 3THWB 3A5LC 3CJAA 3THXB 1VRTA 4DFJA 4DSLA 5H1SQ 2RE2A 3L2RA 1BI4B 1A5VA 2D0CA 3CCUN 1TVRA 3LZJA 2ZJQL 4JKFA 1VHXA 3KLIA 5BRHA 3HPOA 1IV0A 1NK9A 3EYZA 3VGMA 4O4GA 1W97L 2Z1IA 4JRPA 3LM2A 4QCLA 3ZSOA 4ISGA 1QTMA 1S1VA 3RMCA 3MN6A 3T69A 4CJKA 3HZ6A 4JS5A 4M42A 1KTQA 1QS4A 1WSGA 1X9JA 2V51B 5LJVA 2B4JA 4HUFA 3AVKA 4O5FA 1NGBA 1ASVA 3LPTA 4BWMA 2BH1A 2OPSA 3K59A 4JKCA 1ZBHA 1S5JA 3CMAN 3O9RA 4JHDB 1C0FA 3O4NA 4MO4A 3WEEB 5HP1A 2RN2A 4DTOA 1L3VA 2CH5A 4DR2K 2QXLA 3R3LA 1NLVA 4DSKA 3SPZA 3VEZA 1J5EK 3DXKA 3MDQA 4ISFA 1IBLK 3Q7BA 1ZXOA 4PKIA 3DXMB 2V7YA 4JKHA 3L3UA 4IO8A 5IT9O 5KPZA 4JI0K 4YOYA 5BN9A 1X9WA 3BF1A 3AVCA 3FLCO 4Z4CA 1WUAA 3H6EA 4J2AA 4FZZA 3P31A 1X3NA 1Q86O 2AA4A 2KFZA 4BRIA 2NRWA 4RCHA 3QIPA 4O8UA 4FVMA 4JAXA 1GOCA 3TAGA 5LL6Z 1T7PA 5BN8A 3QO9A 1SKWA 3DI6A 3EEQA 4E7KA 4EIAA 1TUUA 1MWMA 4DKWA 5AQQA 5KQDA 1EX4A 4FM1A 2F9WA 5KPRA 1UOCA 4L3QA 2ZE2A 4DFMA 1NKCA 2WBNA 2P9KA 4KREA 3JAMO 1SL2A 1DKGD 3N4PA 4FLVA 2Q0RA 1EETA 5EOYA 1HNXK 4CJFA 5KGXA 2O8EB 4DR7K 4DSEA 2A5XA 4YOXA 5FPDA 3SUOA 4X64K 5FRNA 1RBRA 2YNHA 3WNFA 4CVNE 5CYQA 4IFEA 3G6EN 1YVUA 3LP3A 3THVA 1WBBA 5AZIA 1VK0A 3CQXA 3IKMA 4BGAA 1KRPA 4B1ZA 2FBXA 4DUZK 1R59O 1JXEA 3KHYA 4IEEA 3UKRA 1YI2N 1QQNA 3A2FA 3SAHA 5M1FA 1YTAA 2ITMA 3BZKA 3KK1A 3WT0A 2FSNA 3VERA 5C42A 3VQ9A 2JWLA 1Z05A 1RBSA 3C6AA 3OS2A 1Z6RA 1JXBA 4CZIA 1TYQA 4E3SA 3NH0A 1QSYA 4GNIA 3TARA 2FBVA 3ID6A 4CJ5A 3PIOL 1KCFA 3CIPA 1VSIA 4FWMA 3NH2A 2G8HA 1SKSA 5FLXO 4JI3K 3O3FA 3K57A 1QZ6A 3ZSXA 2WTUA 3QESA 4IOXA 5AQYA 3D45A 3ZLJA 3GE1A 3H3OB 2FSKA 3OYMA 1S6PA 1N34K 2P9UA 3O80A 2IAJA 2KZZA 4DQRA 4DQIA 1ZBUA 4KRFA 3QB0A 3S3OA 4CESA 1OH8A 1VQLN 3I33A 4BRDA 1B9FA 1K6YA 4EZ9A 1K73O 3L2UA 2FSJA 2KKZA 4B1WB 3RR7A 3DMJA 5SWMA 2W40A 4ILGB 1ATNA 3SV4A 4KB1A 4BDPA 4YOVA 4F2SA 5BRFA 1LAWA 3EE9A 5AQVA 1VQMN 2OYQA 4PWDA 3P5JA 2ETJA 4JKBA 1JLBA 5JICA 5FPMA 4NXNK 3LWLA 2JGUA 4A5AA 4RW9A 1NGDA 4CIEA 3R8EA 2ASOA 3S41A 5HBMA 1EKEA 4IKFA 3J81O 1NMNA 2NRTA 3A8YA 3D2FB 4K25A 4BRPA 3HP9A 1XMQK 4DMNA 4AH9A 4I6MA 1Q82O 4LF8K 2ATQA 2RPIA 4FL9A 3DJCA 1C1AA 3TPQA 4CGHA 3A0IX 2G8UA 4CZFA 2G8WA 4DHYA 1Q8IA 4CGIA 1RT2A 1NK8A 5GAHP 5IWAK 3LDPA 4Y1CA 5GAGP 1X9MA 1WSFA 1IBMK 1U4BA 3AVIA 3MECA 1N36K 3V1QA 1E4FT 3VQ7A 2RF2A 3MCAB 4H0XB 4CFAA 3TAMA 3HBTA 2HBKA 2YNGA 3H1VX 1KFSA 2VWJA 3ZEUB 3VQCA 1S1TA 2P9KB 3BEXA 4JK9A 3UIQA 1D5AA 5FRMA 5HRNA 4DV5K 4BRLA 4DV1K 1E4GT 3F73A 1RDAA 4FWOA 5I3UA 4LFBK 4I2PA 3THYA 1VQ4N 4I7FA 4OJRA 3EZ5A 2X78A 4B3TK 1EWQA 1WSIA 2RKIA 2ITGA 1TL3A 3IUCA 4WQ5A 4M3TA 2A42A 1LWFA 4LFAK 4CW7B 5AFUA 1VSLA 3LDOA 5AZIB 4IDKA 5F1XA 1NJYA 1YJNN 3PUFA 4NCBA 2A1SA 4KO0A 1A5WA 2Z1HA 4BRAA 3OYAA 5LMUK 4DV3K 4FWNA 2E5LK 1J6ZA 1W0HA 4LFCK 3A5OC 3V1RA 4Q0BA 4FYDA 3SNNA 1P8ZA 4FJ9A 4K8XA 2ASPA 2F9TA 4JI1K 4C23A 3P83D 2I7PA 1YITN 3KLHA 1TYQB 1T8EA 1QSLA 2OA8A 3PO5A 4BVPA 4A61A 3NE6A 2Q0UA 3L6QA 2CGLA 3NF7A 4FM2A 4IWVA 3CCLN 1WNSA 3HVTA 4BRFA 4DF8A 5J2QA 5BR9A 3ULEA 3HYFA 3W0LA 4DWIA 2WUSA 2VQEK 3OBYA 1HJOA 2P9UB 2W41A 1ZBFA 4F2RA 5C2DA 1SUQA 2IGIA 1OH7A 4YORA 4GW6A 1UA1A 4KHYA 1OVYA 4O0JA 2A40A 1T6DA 3JS6A 2NRHA 3ZETA 1VQ6N 1F21A 3M6GA 1NWKA 4OGCA 1S3XA 1JLQA 5BPNA 3ZX3A 4OPAA 5AQUA 4H03B 3L2VA 1G15A 3CM6A 4IO9L 3VPZA 3K0SA 3HSTB 1RT3A 4DUYK 3M3ZA 3M5RA 5CE3A 3CFOA 5AQIA 4A57A 3ZT4A 3AO5A 5FPNA 3WQUA 2OANA 3ZSZA 2E6MA 4DQSA 3N4QA 5KRSA 3MN5A 4B1YB 3G71N 4H4OA 2FBTA 3I55N 4I6MB 4DCHA 1B9DA 2KLAA 4BR5A 1TK8A 1RTJA 5JVGL 1BCOA 1SQKA 1ZBSA 3MK6A 5GINA 4EP4A 1RT5A 4BRKA 3D0PA 1HPMA 3HSCA 1EP4A 1KQSM 1NGCA 4U67L 4FK4A 4W5OA 3RRGA 4XH5A 2YHXA 4YDUC 4B9QA 4DV0K 3E01A 4CF2A 1YJ9N 3HTVA 4CEBA 4KV8A 4NXMK 3CMEN 3O4WA 3S9HA 3U3YA 1QE1A 4MDBA 1EO1A 1MU2A 5C24A 4JI7K 5CHIA 2Q97A 4DV4K 4H8KA 4B8AB 3KTQA 1R0AA 4EAHD 3H08A 3FFIA 1M90O 3WXJA 4JKGA 4Z0UA 1YAGA 1ZC6A 4E7IA 2HMIA 3QERA 1VQ8N 4RG8A 3FE1A 3EY1A 1XHZA 3SBTA 2VYPA 1HYZA 1VQNN 4KPYA 2E20A 3V9WA 4C8OA 3P1GA 5EY4A 5TKWA 2ZM6K 4JV5K 2QWPA 1RCHA 3BGRA 4CZJA 2UYTA 3H3NO 4ZTFA 3JSMA 3NF8A 2YCHA 1XHXA 3KK2A 2EWSA 3E9OA 1IG9A 4Y0WA 2O8BB 2FXUA 5J2NA 4IOCL 3HO1A 1JLFA 4DFKA 3C94A 1RDUA 4G1QA 3SLCA 1JL1A 4FW2A 4KHPK 4CEEA 4OPKA 1TAQA 3QIOA 3CCJN 2Y1JA 3ULEB 3CJ9A 3KZBA 4IBNA 4AHSA 4KB0A 3B8AX 3KWIA 2F8SA 2XRIA 1VSMA 3T3FA 3O1BA 2IC3A 4FJ8A 3OVNA 4C1NI 2UU9K 2HHUA 1TKTA 1REVA 3LDNA 2W6KA 3AA2A 3MAQA 4F4KA 2BGGA 1W7AA 3ZETB 4CECA 3C6HA 4EFHA 1CZBA 2PBDA 2D0AA 1LAVA 4E19A 5CZ1A 2P51A 2QWMA 4XH4A 3B6OA 4KHQA 2FBYA 1B92A 4B9MA 4MQ3A 4KH6A 5C0YA 4CJRA 2P9IA 4FWSA 2YHAA 4KBOA 3SMSA 5KTQA 2YNIA 1NJIO 4PY5A 3K5NA 4BR4A 4ZHRA 2Z1GA 4B3MK 4N76A 4W5QA 4FLYA 3RMDA 3L4QA 3G25A 3DM2A 4BR7A 3O9TA 2NZTA 4BRQA 1D8YA 4CJ4A 1E3MA 3ZYYX 4CHYA 3H45C 3VQ4A 2VCPA 2IOCA 4M3WA 4WFBL 2O8CA 4CFBA 4GKKK 4KTWA 5ELZA 2DFEA 4M45A 5I9EB 2EX3A 2E4LA 3O9SA 4BG9A 1YHQN 4JI4K 2Z1JA 5FROA 4BE0A 4HTUA 3KVGA 3TI0A 2HMPA 4DSFA 4J2EA 5SZTA 2YHBA 2BANA 5DM6L 3TAEA 1C1CA 3OYNA 5KPTA 1LV5A 4IEIA 4A5BA 1KVCA 1IJJA 1JCGA 4CHZA 4QOZB 1U49A 3NGZA 4ELTA 1YUWA 3CYMA 3TSUA 3AO2A 1LWEA 1KVAA 5JVHL 1FW6A 3DLHA 3J8AA 1TK0A 4FJIA 2H3GX 3CCVN 4LF4K 3HL8A 4B9UA 1W9HA 2WOMA 3ITHA 4CFDA 3GL1A 3T1HK 4HCCA 5C10A 5DM7L 2UUAK 1T03A 3SUPA 4C8NA 3MCPA 1XNRK 5AQSA 4BE2A 3AO4A 5K14A 3HXMA 4OO1J 1BG3A 1NK6A 3RWUA 1NGAA 3HT3A 4DG1A 4WCEL 2AJQA 4JKEA 2XY8A 5AQMA 4FVUA 5AQZA 3TAQA 2DFHA 3SQ0A 4E7LA 4B9VA 3FFKB 4FPBA 3CQ8A 4DU3A 3EKSA 1ZYQA 1BDGA 4CE9A 3C65A 4CHNA 4KKOA 5AFUH 3PV8A 4CJQA 3MX2A 1UWBA 3S3NA 2UUCK 3WXIA 4F8RA 2O8DB 2UUBK 4M7XA 3S3MA 2P5OA 3WUHA 4EP5A 3CC4N 3KD1E 4WE1A 1J9AA 3I0RA 4I9QA 1KAZA 4Z4GA 4H5NA 2Q31A 4LF5K 1OVQA 4RW6A 4QS7A 3KKRA 2Q1NA 2QWQA 1NK7A 3U9ZA 3O9QA 3WXMB 1HYSA 2NUBA 5C15A 2HHSA 4DU4A 3ZSQA 5KI6A 2A6AA 4JKDA 3AVAA 4FWRA 5MLCQ 3DLBA 3AAQA 3H46O 3QNNA 1TV6A 4CK1A 4CK2A 4CBWA 2P9IB 3RMBA 1CZ9A 1C0MA 4O5BA 3GG4A 2D5RA 4J2DA 1O13A 3FZFA 2YKMA 1GLJO 4AHUA 1ILYA 4UQGA 2IVPA 3M8RA 1S1UA 1HQUA 2KZMA 3AVLA 3MEDA 4CJPA 3QEIA 2O8FA 4WYBA 4A2BA 1J5OA 3HOTA 1K8KB 3U6FA 3NAEA 2VGMA 3KKSA 2G8VA 1YVNA 3VQAA 3HI0A 5M1OA 3NCIA 3BDPA 1KVBA 1RBTA 3ZX0A 4E1JA 3OYEA 3E66A 2VG7A 1XC3A 2GTDA 4CZEA 2IVOA 4M41A 1U2VA 1ZBLA 3TTCA 3V9UA 4CF1A 1HMVA 3T1AA 1ZBIA 2G8IA 1N33K 5KQ8A 1ITGA 3CPWM 3O8MA 1HKCA 1S9EA 3AA5X 1WSHA 1XNQK 2KW4A 4BREA 4R5PA 2QM1A 1TKZA 3DRRA 4DTUA 3TTFA 4FJMA 2QI2A 4YOUA 4BQLA 4CIFA 1QQMA 3QMLA 3JYTA 3CD6N 4DTNA 1NJZA 2R7YA 3MEGA 2QWLA 3OBWA 2BUPA 1LW2A 3QFUA 2HHXA 5JS1A 3DXKB 4CZLA 4O0IA 2P5GA 3DLKA 3PSFA 3AVGA 3R1XA 4IFYA 2QEXN 4FJHA 3VF2A 3OYBA 3O08A 3CJ7A 1Q81O 1KLMA 1NK4A 4XH1A 3NMUA 3QEWA 3SQ1A 3HPHA 2A3ZA 4IOAL 3DOLA 3HOSA 4E7JA 1BO5O 3AVJA 4DR5K 4GV9A 5T7BA 3V4IA 2J4RA 3UB5A 1NM1A 3DLEA 1RT7A 3EN9A 3SK3A 1MDUB 1YXQA 3IDHA 4Q5VA 3OYGA 4FK0A 3F2KA 3CI5A 2YI1A 3VEXA 4BVOA 4CF9A 4DTRA 3QNOA 2BE2A 3NF6A 3OYHA 2OTJN 2A1RA 1M1KO 3J7YP 4HTLA 1BUPA 4CJUA 4LH5A 4MLEA 1RT1A 3FZKA 4H5WA 3CCRN 2UXCK 1BGXT 4JI5K 1HNZK 3SJHA 3KIOA 3T19A 4H4MA 4DTMA 3VF6A 2D4WA 4DQPA 4BR2A 4CF0A 1DTTA 1VRUA 4CJ3A 3DYAA 4MFBA 2XO7A 4ELUA 1S72N 3ASMA 1FKOA 2CGJA 5EX5A 3UKUA 4CJEA 4CHPA 3K9KA 3O4QA 4QS9A 3UKRB 1FJGK 1T05A 1RNHA 4OGEA 2D0BA 3ZSVA 3EO3A 1VSFA 4FJXA 3VF4A 1D9DA 1VSHA 5FDLA 4HVJA 3C6TA 4B3SK 3PO4A 1FXXA 3VEYA 3TAFA 4NCGA 3HRGA 1JCFA 5AQWA 3VMFB 5HROA 4TSXA 4CEAA 3F9MA 1JL2A 5DK5A 4B1UB 2QKKA 1C0TA 3V1OA 2O8FB 1Q18A 4GMJB 2FF6A 1TKDA 1S22A 3WNEA 4A62A 4IZ9A 4DF4A 2ZD1A 4JYAK 1QHTA 4JN4A 4JD2A 3I8DA 3T7ZA 3MWTA 4MO5A 1GLBG 1BU6O 3ATVA 4DS5A 3L4IA 1U2VB 2HF4A 3ZT2A 5KRTA 3KK3A 4B1XB 1NKEA 1DEJA 4LSLA 4BRGA 1V4SA 3U9DA 1IH7A 3AA4A 2GWJA 3C6UA 3NDKA 1NGHA 2P1JA 4CJVA 4KHUA 1HQEA 2F8TA 5BPMA 3V6DA 3AGKA 3KWGA 4PL7A 3LL3A 5GAEP 2YNFA 3M8SA 4E1NA 1VQ7N 3MWPA 4CF8A 1U45A 3TANA 4NO7A 1FK9A 3MX5A 3E9PA 2ZJPL 1BISA 1RDCA 1QQOA 2Q36A 5AQRA 1KLNA 5C12A 2X6NA 1BHLA 1TUYA 1SZ2A 4YFUA 2E6LA 3EE8A 5AQHA 4DTXA 3ZT3A 3RMAA 1GLCG 4WQ4C 1RDDA 3OYKA 2P9LA 3VGKA 1JLCA 2E1YA 5AQJA 2HSTA 1P90A 2ZWHA 4KTZA 4W5NA 1NGJA 1QVFM 3AVFA 4CEZA 4CJ7A 4HHTA 2V7ZA 4BG8A 2QXFA 1J54A 3THXA 3SJJA 2ZF5O 3TTDA 4FO0A 4WF9L 2DFFA 3CCQN 2ZQBA 4DTSA 3ZSRA 2GV9A 3GBTA 3O1WA 4B8CA 4DV6K 2YKNA 3D2EA 5HOOA 2W6LA 1XWLA 1GLEG 3THYB 2QWOA 1HLUA 1Z25A 4GY2B 1NJWA 3MMVA 4RWTA 3V9ZA 4BE1A 2RHKA 3VQBA 3HPGA 2ZJRL 1KD1O 5HRSA 5AQNA 4DV7K 1QHAA 4DR6K 4M3UA 1C1BA 2OZSA 4CJSA 3UKUB 3DOKA 3OYFA 5BRDA 2XY5A 1EXQA 4C8LA 3OS1A 4Z4IA 3QBWA 3PLAA 4ILJA 3O9UA 1KFDA 2FF3B 3FZHA 1MWKA 2HVHA 4H5RA 1VQ5N 2WFBA 3F5TA 2VQFK 3EKUA 4IFVA 4N47A 2NNWA 4CGFA 3L2QA 4DLGA 3SCXA 5AZJA 5DMRA 4NYFA 3G10A 3K5LA 3MN9A 3VA3A 4CCHA 3TSPA 4E7HA 2NRRA 1L3UA 4B08A 1HUXA 4M3YA 4GV6A 4BRNA 3AY9A 3OYDA 1NKBA 1VSKA 3ALYA 1BL3A 1S1WA 2GUPA 2XY7A 1GLAG 2QKBA 4LY7A 1Q9YA 4AQYK 1GOAA 4CGJA 1K8AO 4CJLA 4R79A 4BC2A 4FLXA 2DTUA 4CBUA 1HKBA 3LDQA 1S9GA 3CFPA 4IG0A 5AQTA 3D6RA 4EHTA 4DU1A 2D0PA 3CETA 2GX9A 2UXBK 1N5YA 4OVLA 3NGYA 5ADXA 2ZGYA 1WSEA 4KFBA 2O8EA 4LC9B 1LCUA 3L2WA 5AQXA 4DR3K 5J2MA 4YDUA 1QVGM 1IKVA 4OKJA 1FKPA 3SMPA 5LJWA 3A5MC 4JK7A 3VQ6A 1S6QA 4YOTA 5TKYA 3A5NC 3CXCM 1RTDA 2PYLA 3QFPA 3WXLA 4CZGA 4KH5A 4JI6K 4OLAA 3OYCA 3RSEA 3VA0A 2KQ2A 4OX9K 1U48A 1D4XA 4KI6A 3VEOA 3ZX2A 3BP8A 3CC2N 1WB9A 4AILC 1NG9A 2JLEA 4FJ7A 4BROA 1A5XA 3AO1A 5M1NA 1VQPN 3C7NA 3VQQA 4HCBA 3VQ5A 3CCEN 1RILA 2I5JA 3AVNA 4FLZA 5J2PA 1NJXA 5HRRA 1C0UA 4BDYA 2P9LB 3IFRA 4M7YA 3VGLA 1I94K 1CZAN 4AM6A 1HKGA 5CZ2A 4BC3A 5CR4A 2UXDK 1SAZA 1IG8A 3LP2A 3V81A 3J80O 5C2FA 4NYNA 1MA9B 4FWKA 4J8FA 4FCYA 1KXPA 1VQ9N 1RT4A 1JLGA 1L3TA 3KD5E 3D2EB 4M3XA 3CCSN 4OKEA 1YF5L 4OKKA 3QINA 3IS9A 5AQKA 3T1YK 1EWRA 4JKAA 3FR0A 3TAPA 5HL7L 3K9JA 4JKGB 3DRPA 1DTQA 3LDLA 3P4IA 1NOZA 2YJFA 1DGKN 3IRXA 3OYJA 3D7EO 2VWBA 5M1PA 4LD0A 3DAWA 5KGWA 2NRZA 3AA3A 1HNIA 3E9LA 1WN7A 4AHTA 5J1EA 4LF9K 1LW0A 4M3RA 4FZYA 3RVCA 3KLFA 3CJ1A 2OZMA 2QTDA 4ELVA 2E2OA 3UE5A 1VSEA 3PIPL 1IBKK 2OCEA 1T44A 1OKJA 3D2FA 4N41A 4JI2K 3R9PA 3K5MA 4BRMA 1JCEA 4H0VB 4BRHA 3AVHA 4EHUA 5AZJB 1SKRA 4ISEA 1BIUA 3TU5A 1WSJA 3L3VA 2KFNA 4I2QA 2PYJA 2HNDA 3DRSA 3TWHA 1HYVA 4H0PA 3SAFA 2QK9A 2VG6A 4PQUA 2HNZA 3CF5L 4FLTA 4XIUA 4F9OA 3CJCA 4O44A 4CZMA 1RBUA 2QWNA 4IXCA 3G0ZA 4A59A 2NLXA 2Q2RA 1WLJA 4CEDA 4FWLA 3DLLL 4CIGA 4Y1DA 3ZEUA 4BDZA 5GADP 1RFQA 4HWIA 4AHVA 4C8KA 3O5BA 1V4TA 2PFUA 3LP0A 2HW3A 5JLFA 5HLFA 4Z4EA 3MXIA 3I8BA 4YY3K 1Y64A 3AAPA 4B3RK 1N8RO 3QEVA 1C6VA 1N32K 5A2QO 1RTHA 1NMDA 5CYMA 4C1NK 3LWMA 2VWKA 5AJ3K 3DWLA 3VEVA 3RSEB 4AHRA 1W2BM 4FM0A 3CQYA 3G4SN 1N6QA 2HHQA 3ULDA 3CC7N 3TABA 4KI4A 4H5TA 2AP1A 4FJKA 4WFNL 3K5OA 3QBXA 4AF1A 3EL2A 1TAUA 1CXQA 3C7NB 4OPHA 3NBPA 4MLHA 2G8FA 4OLBA 3PSIA 5LY3A 2O8CB 2OTLN 1C0GA 1Z26A 3BZCA 3GDQA 5B8HA 1NK5A 3OTOK 5C25A 5BREA 1IKYA 4CFCA 1L5UA 4CERA 2HOEA 4DLEA 4BR0A 3V9XA 3SBGA 1TL1A 1YT3A 4H0TB 4Z94A 4E89A 4WQ5C 4N56A 3MEEA 1BWFO 2D1KA 2I7NA 1ATRA 2P9NA 2X6SA 4CK3A 2IVNA 1I39A 4V19S 3MN7A 4K42A 3P39A 2HHHK 3E1YA 5BPLA 2YJEA 4ZTJA 4BQZA 4G9ZA 3RRHA 3JXUA 3AV9A 5AQLA 4IG3A 3VENA 2HF3A 1IO2A 2V52B 4M3ZA 4U7BA 3ENOA 5CY4A 3OW2M 2PAVA 3P38A 3KLEA 4DQQA 1D9FA 4YOWA 2HBJA 4I9LA 3PX6A 5JLHA 3ISNC 4FSVA 5E84A 3O3HA 3ID8A 3NFAA 3H1QA 2DY4A 3AGRA 1OH6A 3OA9A 5BR8K 3VEWA 4C8MA 1BCMA 2E2PA 4KHSA 1RTIA 1DT9A 5EXWA 2YX6A 5E26A 3SQ4A 3QLHA 1X9SA 1HJRA 3TR8A 2OPRA 4X66K 3QEPA 5GIOA 1BQMA 4B1VA 4N5SA 4BY9C 2G8KA 1KAXA 4DSIA 3LZIA 4UY8O 2WONA 4PKHA 1NGIA 3K2PA 1LOTB 4KHNA 2KTQA 4DR4K 4X62K 3I56N 4DR1K 4JNEA 4NLBA 1T6CA 1UA0A 4KAZA 1VSJA 2O4GA 3CG7A 2PZSA 1GOBA 1WAFA 3ZCMA 4FWPA 4FJGA 5LMNK 1WAJA 1TK5A 1BIZA 4CD1A 5E41A 3FZMA 3CM5A 3NGIA 3RR8A 3B6PA 4ID5A 4Z4HA 2YV0X 1QQCA 2P9PA 3DLGA 4GVEA 2QWRA 4DS4A 2BDPA 3M8QA 2E2NA 2P9SA 4CHQA 4YNQA 2EHGA 3DLRA 3GOIA 4K8ZA 3ZT0A 1CXUA 3LPUA 2HHWA 5AQGA 2X74A 1KC8O 4CI6A 2HBLA 3ZSYA 4W5RA 4DV2K 4FW1A 4CBXA 2Q3SA 3QEXA 3CFRA 2QW9A 1H1VA 1IKWA 1RT6A 3LDSA 3OHRA 2VGNA 4K41A 1ASUA 3U3GA 3HJFA
chains in the Genus database with same CATH topology
4BRCA 5AQNA 4FWMA 1QHAA 3BUZB 5DM6L 1VQKN 1G99A 3QICA 2A41A 5KPTA 2QA4N 3UKUB 2NRVA 1QZ6A 1YJWN 5BRDA 4IEIA 4A5BA 1IJJA 4IOXA 5AQYA 1JCGA 5AQOA 3GE1A 4DQ8A 3QBWA 5ADXH 3H3OB 3PLAA 4H5VA 2FLOA 3LM9A 4FOIA 2FSKA 3O9UA 4ILJA 1YUWA 3CCMN 2FF3B 2P9UA 3FZHA 1MWKA 3O80A 4IJNA 4JK8A 4NB4A 3TSUA 1VQON 5JVHL 4H5RA 3KK7A 1VQ5N 4CZHA 4ILHA 4PHTX 3J8AA 2H3GX 2WFBA 3F5TA 4K43A 3QB0A 1BA1A 3EKUA 3CCVN 2NNWA 3I33A 1VQLN 4BRDA 5AZJA 1K73O 3EZWA 2FSJA 3GL1A 2KKZA 5C10A 5DM7L 1Q7YO 4B1WB 3MCPA 3MN9A 5AQSA 2W40A 4OO1J 4ILGB 1ATNA 3TSPA 1BG3A 3ENHA 5EVZA 2NRRA 4CZKA 1NGAA 1HUXA 5BRFA 4YOVA 3CHWA 4WCEL 4GV6A 3EE9A 5AQVA 1VQMN 2P9NB 4FWQA 4BRNA 3AY9A 4JKBA 4JEPA 4JKEA 1K9MO 5AQMA 1QZ5A 5JICA 5FPMA 3O6WA 3VTHA 5AQZA 2GUPA 1GLAG 4A5AA 1NGDA 3R8EA 2ASOA 3S41A 3FFKB 4FPBA 1K8AO 4R79A 4BC2A 4AM7A 2HBMA 3EKSA 2NRTA 3A8YA 1BDGA 4CBUA 3FZLA 1HKBA 3LDQA 3Q7CA 3D2FB 3C65A 4K25A 4KH4A 5AFUH 5AQTA 4EHTA 2E2QA 3D6RA 2D0PA 4BRPA 3CETA 3MX2A 3U4LA 2JWKA 1ATSA 2GX9A 3AARA 4I6MA 1Q82O 4FL9A 3WQTA 3TPQA 3DJCA 3WXIA 3A0IX 5ADXA 4CZFA 2D0OA 2ZGYA 3QDKA 4M7XA 4LC9B 4DHYA 1LCUA 5F2RA 3WUHA 5AQXA 5GIPA 1QVGM 4YDUA 3CC4N 3VETA 5GAHP 3SMPA 5LJWA 3LDPA 3A5MC 2BTFA 4JK7A 5GAGP 1KAZA 3IMXA 4NLCA 4YOTA 3A5NC 5TKYA 3CXCM 3QFPA 4H5NA 3WXLA 4CZGA 4KH5A 1U6ZA 2Q31A 3RSEA 4BGBA 3VESA 1E4FT 1D4XA 5AQPA 3MCAB 4H0XB 2DPNA 4QS7A 1XQSC 3HBTA 3VEOA 2Q1NA 1BA0A 2HBKA 2QWQA 3H1VX 3ZX2A 3BP8A 3CC2N 1GLFO 3ZEUB 3U9ZA 1VAZA 2P9KB 3BEXA 3O9QA 3WXMB 3BF3A 2CGKA 4JK9A 5C15A 4BROA 1VQPN 5M1NA 3C7NA 4BRLA 2A6AA 1E4GT 4JKDA 2E1ZA 4FWRA 4FWOA 5F0XA 5MLCQ 3CCEN 3AAQA 3H46O 1VQ4N 3HM8A 3IUCA 3CJBA 4WQ5A 1SS6A 2P9IB 4CBWA 2A42A 2YHWA 1HX1A 3R6MA 4PKGA 3GG4A 4H0YB 5AFUA 1O13A 3FGUA 2P9LB 3FZFA 3IFRA 1GLJO 4M7YA 3LDOA 5AZIB 3VGLA 1ILYA 2IVPA 5F1XA 1KAYA 2WC9A 1CZAN 3VOVA 1HKGA 4AM6A 4BC3A 5CR4A 1YJNN 1SAZA 4BRAA 1IG8A 4FOEA 2P9PB 4FWNA 4WYBA 1NGGA 4A2BA 4MDAA 1J6ZA 5C2FA 3HOTA 1K8KB 1MA9B 4FWKA 4J8FA 3A5OC 1KXPA 4IDHA 2P9SB 1VQ9N 3U8XA 1XUPO 3TSQA 1NGFA 1P8ZA 2VGMA 4M63C 4JHDA 3WEEA 3D2EB 1YVNA 2ASPA 2F9TA 3HI0A 4C23A 3CCSN 5M1OA 1YF5L 4BC4A 3ZX0A 5AQKA 4E1JA 2I7PA 3E66A 1YITN 1XC3A 1TYQB 2GTDA 4JKAA 3FR0A 4CZEA 2IVOA 4BVPA 2CH6A 5HL7L 1U2VA 3K9JA 4JKGB 3TTCA 4A61A 3DXMA 5KQ8A 3CPWM 3O8MA 2Q0UA 1HKCA 2CGLA 3L6QA 2E8AA 5M1QA 4IJAA 3LDLA 3P4IA 4IWVA 3SAGA 3W3DA 3CCLN 2YJFA 1DGKN 2E88A 4BREA 2QM1A 3M1FA 4BRFA 1T3VA 3D7EO 3L0QA 2VWBA 3TTFA 2QI2A 5M1PA 4YOUA 3DAWA 5BR9A 3ULEA 3VTIA 4BQLA 2NRZA 1ESVA 3E9LA 1EQYA 3ATUA 3W0LA 1QQMA 3QMLA 3CD6N 2WUSA 3RVCA 3OBYA 3CJ1A 4CD3A 1HJOA 2W41A 2P9UB 2QTDA 2E2OA 2QWLA 3UE5A 3PIPL 5C2DA 1T44A 1OKJA 3D2FA 4JD2B 4YORA 3OBWA 2BUPA 3R9PA 4BRMA 1JCEA 4H0VB 3QFUA 4RTFD 1OVYA 4BRHA 1GLLO 5M1KA 3DXKB 4EHUA 2GWKA 2NRXA 2A40A 1T6DA 3JS6A 2NRHA 3ZETA 5AZJB 4CZLA 1VQ6N 4ISEA 1NGEA 4WQ4A 3R1XA 3M6GA 5FPEA 2QEXN 3TU5A 1NBWA 1NWKA 4GV3A 3VF2A 4WFAL 3O08A 3CJ7A 3CERA 1S3XA 4QS8A 5BPNA 3ZX3A 1Q81O 4H0PA 3SAFA 5JMVA 4OPAA 1RGIA 5AQUA 4H03B 4IO9L 4XH1A 3NMUA 3VPZA 3CF5L 2A3ZA 4H0OA 3M3ZA 3CJCA 4F9OA 4IOAL 3HOSA 3M5RA 4CZMA 1BO5O 2QWNA 4IXCA 5CE3A 5AQIA 4GV9A 1RDWX 2J4RA 3UB5A 2NLXA 4A59A 2Q2RA 4A57A 1NM1A 5FPNA 4FPAA 3WQUA 2OANA 4FWLA 3EN9A 3SK3A 3J7ZO 3DLLL 2ZGZA 1MDUB 1YXQA 3IDHA 3ZEUA 2ASMA 4XEIA 5GADP 3F2KA 1RFQA 1X3MA 3CI5A 3N4QA 4HWIA 2YI1A 3O5BA 3MN5A 3VEXA 4B1YB 4BVOA 3G71N 3I55N 2GELA 2GEMA 1V4TA 4I6MB 4BC5A 4DCHA 5AQFA 2YHYA 2KLAA 2PFUA 4BR5A 2OTJN 1M1KO 5JLFA 5JVGL 4HTLA 1SQKA 3I8BA 5AR0A 1BUPA 1Y64A 1ZBSA 3AAPA 3MK6A 5GINA 4MLEA 3FZKA 4H5WA 3CCRN 1JJ2M 4BRKA 1WOQA 3C0BA 4BR9A 1N8RO 3NVMA 1HPMA 3CPEA 3HSCA 3SJHA 2KHOA 1KQSM 2F7TA 1NGCA 1NMDA 4U67L 4C1NK 4DB3A 2IIRA 3DWLA 3VF6A 4XH5A 3VEVA 2D4WA 4O8KA 3RSEB 3WXKA 1W2BM 4BR2A 2YHXA 3CQYA 3G4SN 4YDUC 4B9QA 1GLDG 3CC7N 3NVKA 1YJ9N 3ENBA 3HTVA 1YIJN 1S72N 1K8KA 3O4WA 4H5TA 3CMEN 2AP1A 2CGJA 5EX5A 3UKUA 4MDBA 4WFNL 1EO1A 3K9KA 3QBXA 4QS9A 4AF1A 4PL8A 4A2AA 1BOTO 3UKRB 3A5LC 3EL2A 3C7NB 3CJAA 4OPHA 4MLHA 5H1SQ 5CHIA 2Q97A 2RE2A 5LY3A 4EAHD 3CCUN 3EO3A 2ZJQL 2OTLN 4JKFA 1C0GA 3VF4A 5BRHA 3GDQA 1M90O 3WXJA 5B8HA 3VGMA 1W97L 4JKGA 1YAGA 1ZC6A 5BREA 3LM2A 3VEYA 3HRGA 2HOEA 1VQ8N 4ISGA 4BR0A 3FE1A 1JCFA 5AQWA 3MN6A 3SBTA 2VYPA 3VMFB 3SBGA 3T69A 1VQNN 3HZ6A 2E20A 1X9JA 2V51B 4H0TB 3F9MA 4Z94A 5LJVA 4WQ5C 4B1UB 4O5FA 1NGBA 1BWFO 5EY4A 2D1KA 2I7NA 2BH1A 5TKWA 1Q18A 4JKCA 2FF6A 1ATRA 2P9NA 1S22A 2QWPA 2IVNA 4A62A 4IZ9A 4CZJA 2UYTA 3H3NO 3MN7A 3CMAN 4K42A 3O9RA 4JHDB 1C0FA 4MO4A 2YCHA 3P39A 4JN4A 3WEEB 3E1YA 5BPLA 2YJEA 4JD2A 2CH5A 2QXLA 4BQZA 2EWSA 3T7ZA 3E9OA 3MWTA 3R3LA 4G9ZA 3JXUA 1NLVA 4MO5A 1GLBG 4Y0WA 5AQLA 3VENA 3VEZA 1BU6O 2HF3A 3DXKA 3MDQA 2V52B 2FXUA 3ATVA 4U7BA 3ENOA 3L4IA 4IOCL 3OW2M 2PAVA 3P38A 1U2VB 4ISFA 2HF4A 3Q7BA 1ZXOA 4YOWA 2HBJA 4PKIA 1RDUA 3DXMB 2V7YA 3SLCA 4JKHA 5JLHA 4B1XB 4IO8A 1DEJA 4FSVA 5KPZA 4BRGA 4YOYA 1V4SA 5BN9A 3BF1A 3FLCO 5E84A 3U9DA 2GWJA 1WUAA 3H6EA 3ID8A 3P31A 1X3NA 3CCJN 1Q86O 1NGHA 3H1QA 2AA4A 3AGRA 4BRIA 2NRWA 4RCHA 3ULEB 4O8UA 3OA9A 3CJ9A 3KZBA 4JAXA 3B8AX 3KWIA 3VEWA 5BPMA 2E2PA 5BN8A 3AGKA 3O1BA 1DT9A 3KWGA 5EXWA 3LL3A 2YX6A 5E26A 4EIAA 5GAEP 4PL7A 1TUUA 4C1NI 1MWMA 4DKWA 5AQQA 5KQDA 2F9WA 3LDNA 5KPRA 1VQ7N 4L3QA 3MWPA 5GIOA 3ZETB 2WBNA 4NO7A 3C6HA 4B1VA 4BY9C 3MX5A 3E9PA 2ZJPL 2P9KA 4EFHA 1KAXA 2PBDA 4UY8O 1QQOA 2Q36A 4PKHA 5AQRA 1NGIA 5C12A 1DKGD 2QWMA 3N4PA 1LOTB 4XH4A 2Q0RA 5EOYA 4KH6A 1TUYA 1SZ2A 3I56N 5C0YA 4JNEA 4NLBA 1T6CA 3EE8A 2P9IA 5AQHA 2A5XA 4FWSA 4KBOA 1GLCG 4YOXA 5FPDA 3SMSA 1NJIO 4WQ4C 4IFEA 3G6EN 2P9LA 3VGKA 4BR4A 2E1YA 4FWPA 5AZIA 5AQJA 3CQXA 3IKMA 2HSTA 4BGAA 4CD1A 1P90A 3FZMA 3L4QA 2ZWHA 3G25A 4B1ZA 1NGJA 4BR7A 3O9TA 2NZTA 4BRQA 1QVFM 1R59O 3ZYYX 3KHYA 4IEEA 4CJ7A 3H45C 3UKRA 2P9PA 4GVEA 2QWRA 2V7ZA 1YI2N 4BG8A 1QQNA 2ZF5O 3TTDA 4FO0A 4WF9L 2E2NA 2P9SA 2VCPA 3SAHA 3CCQN 5M1FA 4WFBL 2ITMA 3GBTA 3GOIA 3O1WA 2FSNA 3VERA 3WT0A 2JWLA 5ELZA 1Z05A 3D2EA 5HOOA 3C6AA 5I9EB 1Z6RA 1GLEG 5AQGA 1KC8O 3O9SA 4BG9A 4CI6A 2HBLA 4CBXA 2QWOA 1YHQN 1HLUA 4CZIA 1TYQA 4GY2B 3MMVA 4RWTA 4GNIA 2QW9A 1H1VA 2RHKA 3OHRA 3KVGA 2VGNA 3ID6A 4K41A 3PIOL 2ZJRL 2HMPA 1KD1O 4FVUA 3CIPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQP N;  3CF5 L;  5DM6 L;  3CCE N;  5MLC Q;  4IOC L;  3OW2 M;  1VQK N;  4IOA L;  1VQ4 N;  2QA4 N;  1YJW N;  3J7Z O;  3DLL L;  3CCJ N;  1Q86 O;  5GAD P;  3CCM N;  1VQO N;  1ILY A;  3G71 N;  5JVH L;  3I55 N;  1VQ5 N;  1YJN N;  2OTJ N;  3CCV N;  5JVG L;  1M1K O;  1VQL N;  1K73 O;  3CCR N;  5GAE P;  1JJ2 M;  1N8R O;  1Q7Y O;  5DM7 L;  1VQ9 N;  1KQS M;  1VQ7 N;  4U67 L;  4WCE L;  3CCS N;  2ZJP L;  1VQM N;  1W2B M;  4UY8 O;  1YIT N;  1K9M O;  3G4S N;  3CC7 N;  1YJ9 N;  1YIJ N;  1S72 N;  5HL7 L;  3CME N;  3I56 N;  1K8A O;  4WFN L;  3CPW M;  1NJI O;  5H1S Q;  3CCL N;  3G6E N;  3CCU N;  2ZJQ L;  2OTL N;  1M90 O;  1Q82 O;  1QVF M;  3CD6 N;  1VQ8 N;  1QVG M;  1YI2 N;  3PIP L;  3CC4 N;  5GAH P;  1VQN N;  4WF9 L;  3CCQ N;  4WFB L;  5GAG P;  1OVY A;  3CXC M;  1VQ6 N;  1KC8 O;  1YHQ N;  2QEX N;  3CMA N;  4WFA L;  1Q81 O;  3CC2 N;  3PIO L;  2ZJR L;  1KD1 O;  4IO9 L; 
#chains in the Genus database with same CATH topology
 4BRC A;  4DTJ A;  3BUZ B;  3LAM A;  1VQK N;  1G99 A;  3QIC A;  3NH1 A;  2A41 A;  2QA4 N;  3LAL A;  2NRV A;  1Y97 A;  1YJW N;  4GKJ K;  3OYL A;  3HK2 A;  5AQO A;  3PX0 A;  4DQ8 A;  3NHG A;  5ADX H;  4H5V A;  2FLO A;  3LM9 A;  4FOI A;  4RW8 A;  1NU0 A;  3CCM N;  4JK8 A;  4NB4 A;  1VQO N;  4IJN A;  4B9N A;  2O8B A;  4LH4 A;  3KK7 A;  3C95 A;  4CZH A;  4ILH A;  4PHT X;  3HP6 A;  4FJ5 A;  4K43 A;  1BA1 A;  1YTU A;  3SUQ A;  4J2B A;  1QSS A;  1SL0 A;  5EU7 A;  3EZW A;  2IDO A;  1WBD A;  1Q7Y O;  4F3T A;  3ENH A;  5EVZ A;  4CZK A;  4RW7 A;  3CHW A;  1KSP A;  4ICL A;  2F4V K;  3SQ2 A;  2P9N B;  4FWQ A;  4JRQ A;  4JEP A;  1K9M O;  1QZ5 A;  4FK2 A;  3VTH A;  3O6W A;  4FJN A;  3SUN A;  4FJJ A;  1S1X A;  4B9L A;  1HPZ A;  1UAX A;  4AM7 A;  4GVM A;  2HBM A;  3FZL A;  3Q7C A;  1HNW K;  1I3A A;  4KH4 A;  3WNH A;  2E2Q A;  2PY5 A;  4ID1 A;  5D3G A;  3U4L A;  2JWK A;  1ATS A;  3OJU A;  3AAR A;  3WQT A;  1HR0 K;  3OS0 A;  2B6A A;  4JLH A;  2D0O A;  3QDK A;  4LF7 K;  4B3O A;  3O3G A;  1XC9 A;  5F2R A;  5GIP A;  2IS3 A;  4QAG A;  1O1W A;  3VET A;  4CJT A;  4DTP A;  2BTF A;  3IMX A;  4NLC A;  3SYZ A;  1XI1 A;  1U6Z A;  3SV3 A;  1U47 A;  4BGB A;  3VES A;  5AQP A;  2DPN A;  3SPY A;  1XQS C;  3KJV A;  1BA0 A;  4K0K K;  1GLF O;  3VN5 A;  1CLQ A;  1VAZ A;  3IG1 A;  4CGD A;  3BF3 A;  4KHW A;  2CGK A;  3THW A;  3ZSW A;  4W5T A;  2E1Z A;  2B5J A;  5F0X A;  1LWC A;  1DLO A;  1HRH A;  3HM8 A;  4JS4 A;  1BI4 A;  1TKX A;  3CJB A;  1SS6 A;  1XMO K;  2YHW A;  1HX1 A;  3R6M A;  4PKG A;  2OPQ A;  4H0Y B;  3I0S A;  3FGU A;  4CHO A;  2GBZ A;  4E1M A;  3HM9 A;  1NK0 A;  3LP1 A;  1KAY A;  2WC9 A;  5JS2 A;  2HB5 A;  3VOV A;  4F3O A;  2XY6 A;  2VG5 A;  4DFP A;  4EZ6 A;  4FOE A;  4AHC A;  2P9P B;  1JLA A;  1NGG A;  4MDA A;  3AO3 A;  4LSN A;  4IDH A;  4DSJ A;  2P9S B;  4CEF A;  3OY9 A;  3J7A P;  3U8X A;  1XUP O;  3K58 A;  3TSQ A;  1NGF A;  4M63 C;  4JHD A;  3AVM A;  3ZT1 A;  3WEE A;  3PY8 A;  3LAN A;  4FZX C;  4PUO A;  2W42 A;  4BC4 A;  4CGG A;  1L3S A;  1U04 A;  2CH6 A;  3QET A;  3DXM A;  1OH5 A;  1SL1 A;  1RBV A;  3WNG A;  2E8A A;  5M1Q A;  4IJA A;  1NOY A;  3SAG A;  2Y1I A;  3W3D A;  1NNE A;  2E88 A;  3M1F A;  1RDB A;  1T3V A;  3L0Q A;  1BQN A;  5I42 A;  4L8R B;  3VTI A;  1ESV A;  1EQY A;  3ATU A;  3SZ2 A;  4HUE A;  3L8B A;  4FXD A;  4CD3 A;  2HNY A;  3PX4 A;  4JD2 B;  2OPP A;  3IAY A;  2HHV A;  4RTF D;  3LAK A;  1GLL O;  5M1K A;  4BWJ A;  2GWK A;  2NRX A;  4FLU A;  3VQD A;  4OPJ A;  1HNV A;  1X1P A;  1NGE A;  2O8D A;  4WQ4 A;  5FPE A;  2XHB A;  5HRP A;  1NBW A;  4JI8 K;  4YHH K;  4GV3 A;  4Z4F A;  4WFA L;  4X65 K;  4CJW A;  3CER A;  4QS8 A;  2FC0 A;  3KLG A;  5JMV A;  1RGI A;  4RW4 A;  2O4I A;  4NCA A;  1SV5 A;  4H0O A;  3VQ8 A;  1IKX A;  2GUI A;  4O55 A;  3OJS A;  4FLW A;  1RDW X;  4CEQ A;  4BAC A;  2HHT A;  4FPA A;  3MXJ A;  3BY5 A;  3J7Z O;  2ZGZ A;  2ASM A;  4XEI A;  4KTQ A;  1X3M A;  4E0D A;  3VQE A;  3SI6 A;  1JKH A;  2GEL A;  2GEM A;  4BC5 A;  5AQF A;  2YHY A;  3M8P A;  3V9S A;  5AR0 A;  3RTV A;  2F96 A;  4FJL A;  4B9S A;  3OYI A;  1JJ2 M;  2LSN A;  1WOQ A;  3C0B A;  4BR9 A;  3NVM A;  3CPE A;  1J53 A;  2KHO A;  1Q9X A;  1ASW A;  2F7T A;  4HUG A;  4B9T A;  3NF9 A;  4DB3 A;  2IIR A;  3WXK A;  4LF6 K;  1TGO A;  4O8K A;  4CEO A;  2HVI A;  3VQP A;  1GLD G;  3NVK A;  3ENB A;  1YIJ N;  4PA1 A;  1K8K A;  1VSD A;  3AVB A;  3HVR A;  3MXM A;  1JLE A;  4PL8 A;  4A2A A;  1BOT O;  3F9K A;  3THW B;  3A5L C;  3CJA A;  3THX B;  1VRT A;  4DFJ A;  4DSL A;  5H1S Q;  2RE2 A;  3L2R A;  1BI4 B;  1A5V A;  2D0C A;  3CCU N;  1TVR A;  3LZJ A;  2ZJQ L;  4JKF A;  1VHX A;  3KLI A;  5BRH A;  3HPO A;  1IV0 A;  1NK9 A;  3EYZ A;  3VGM A;  4O4G A;  1W97 L;  2Z1I A;  4JRP A;  3LM2 A;  4QCL A;  3ZSO A;  4ISG A;  1QTM A;  1S1V A;  3RMC A;  3MN6 A;  3T69 A;  4CJK A;  3HZ6 A;  4JS5 A;  4M42 A;  1KTQ A;  1QS4 A;  1WSG A;  1X9J A;  2V51 B;  5LJV A;  2B4J A;  4HUF A;  3AVK A;  4O5F A;  1NGB A;  1ASV A;  3LPT A;  4BWM A;  2BH1 A;  2OPS A;  3K59 A;  4JKC A;  1ZBH A;  1S5J A;  3CMA N;  3O9R A;  4JHD B;  1C0F A;  3O4N A;  4MO4 A;  3WEE B;  5HP1 A;  2RN2 A;  4DTO A;  1L3V A;  2CH5 A;  4DR2 K;  2QXL A;  3R3L A;  1NLV A;  4DSK A;  3SPZ A;  3VEZ A;  1J5E K;  3DXK A;  3MDQ A;  4ISF A;  1IBL K;  3Q7B A;  1ZXO A;  4PKI A;  3DXM B;  2V7Y A;  4JKH A;  3L3U A;  4IO8 A;  5IT9 O;  5KPZ A;  4JI0 K;  4YOY A;  5BN9 A;  1X9W A;  3BF1 A;  3AVC A;  3FLC O;  4Z4C A;  1WUA A;  3H6E A;  4J2A A;  4FZZ A;  3P31 A;  1X3N A;  1Q86 O;  2AA4 A;  2KFZ A;  4BRI A;  2NRW A;  4RCH A;  3QIP A;  4O8U A;  4FVM A;  4JAX A;  1GOC A;  3TAG A;  5LL6 Z;  1T7P A;  5BN8 A;  3QO9 A;  1SKW A;  3DI6 A;  3EEQ A;  4E7K A;  4EIA A;  1TUU A;  1MWM A;  4DKW A;  5AQQ A;  5KQD A;  1EX4 A;  4FM1 A;  2F9W A;  5KPR A;  1UOC A;  4L3Q A;  2ZE2 A;  4DFM A;  1NKC A;  2WBN A;  2P9K A;  4KRE A;  3JAM O;  1SL2 A;  1DKG D;  3N4P A;  4FLV A;  2Q0R A;  1EET A;  5EOY A;  1HNX K;  4CJF A;  5KGX A;  2O8E B;  4DR7 K;  4DSE A;  2A5X A;  4YOX A;  5FPD A;  3SUO A;  4X64 K;  5FRN A;  1RBR A;  2YNH A;  3WNF A;  4CVN E;  5CYQ A;  4IFE A;  3G6E N;  1YVU A;  3LP3 A;  3THV A;  1WBB A;  5AZI A;  1VK0 A;  3CQX A;  3IKM A;  4BGA A;  1KRP A;  4B1Z A;  2FBX A;  4DUZ K;  1R59 O;  1JXE A;  3KHY A;  4IEE A;  3UKR A;  1YI2 N;  1QQN A;  3A2F A;  3SAH A;  5M1F A;  1YTA A;  2ITM A;  3BZK A;  3KK1 A;  3WT0 A;  2FSN A;  3VER A;  5C42 A;  3VQ9 A;  2JWL A;  1Z05 A;  1RBS A;  3C6A A;  3OS2 A;  1Z6R A;  1JXB A;  4CZI A;  1TYQ A;  4E3S A;  3NH0 A;  1QSY A;  4GNI A;  3TAR A;  2FBV A;  3ID6 A;  4CJ5 A;  3PIO L;  1KCF A;  3CIP A;  1VSI A;  4FWM A;  3NH2 A;  2G8H A;  1SKS A;  5FLX O;  4JI3 K;  3O3F A;  3K57 A;  1QZ6 A;  3ZSX A;  2WTU A;  3QES A;  4IOX A;  5AQY A;  3D45 A;  3ZLJ A;  3GE1 A;  3H3O B;  2FSK A;  3OYM A;  1S6P A;  1N34 K;  2P9U A;  3O80 A;  2IAJ A;  2KZZ A;  4DQR A;  4DQI A;  1ZBU A;  4KRF A;  3QB0 A;  3S3O A;  4CES A;  1OH8 A;  1VQL N;  3I33 A;  4BRD A;  1B9F A;  1K6Y A;  4EZ9 A;  1K73 O;  3L2U A;  2FSJ A;  2KKZ A;  4B1W B;  3RR7 A;  3DMJ A;  5SWM A;  2W40 A;  4ILG B;  1ATN A;  3SV4 A;  4KB1 A;  4BDP A;  4YOV A;  4F2S A;  5BRF A;  1LAW A;  3EE9 A;  5AQV A;  1VQM N;  2OYQ A;  4PWD A;  3P5J A;  2ETJ A;  4JKB A;  1JLB A;  5JIC A;  5FPM A;  4NXN K;  3LWL A;  2JGU A;  4A5A A;  4RW9 A;  1NGD A;  4CIE A;  3R8E A;  2ASO A;  3S41 A;  5HBM A;  1EKE A;  4IKF A;  3J81 O;  1NMN A;  2NRT A;  3A8Y A;  3D2F B;  4K25 A;  4BRP A;  3HP9 A;  1XMQ K;  4DMN A;  4AH9 A;  4I6M A;  1Q82 O;  4LF8 K;  2ATQ A;  2RPI A;  4FL9 A;  3DJC A;  1C1A A;  3TPQ A;  4CGH A;  3A0I X;  2G8U A;  4CZF A;  2G8W A;  4DHY A;  1Q8I A;  4CGI A;  1RT2 A;  1NK8 A;  5GAH P;  5IWA K;  3LDP A;  4Y1C A;  5GAG P;  1X9M A;  1WSF A;  1IBM K;  1U4B A;  3AVI A;  3MEC A;  1N36 K;  3V1Q A;  1E4F T;  3VQ7 A;  2RF2 A;  3MCA B;  4H0X B;  4CFA A;  3TAM A;  3HBT A;  2HBK A;  2YNG A;  3H1V X;  1KFS A;  2VWJ A;  3ZEU B;  3VQC A;  1S1T A;  2P9K B;  3BEX A;  4JK9 A;  3UIQ A;  1D5A A;  5FRM A;  5HRN A;  4DV5 K;  4BRL A;  4DV1 K;  1E4G T;  3F73 A;  1RDA A;  4FWO A;  5I3U A;  4LFB K;  4I2P A;  3THY A;  1VQ4 N;  4I7F A;  4OJR A;  3EZ5 A;  2X78 A;  4B3T K;  1EWQ A;  1WSI A;  2RKI A;  2ITG A;  1TL3 A;  3IUC A;  4WQ5 A;  4M3T A;  2A42 A;  1LWF A;  4LFA K;  4CW7 B;  5AFU A;  1VSL A;  3LDO A;  5AZI B;  4IDK A;  5F1X A;  1NJY A;  1YJN N;  3PUF A;  4NCB A;  2A1S A;  4KO0 A;  1A5W A;  2Z1H A;  4BRA A;  3OYA A;  5LMU K;  4DV3 K;  4FWN A;  2E5L K;  1J6Z A;  1W0H A;  4LFC K;  3A5O C;  3V1R A;  4Q0B A;  4FYD A;  3SNN A;  1P8Z A;  4FJ9 A;  4K8X A;  2ASP A;  2F9T A;  4JI1 K;  4C23 A;  3P83 D;  2I7P A;  1YIT N;  3KLH A;  1TYQ B;  1T8E A;  1QSL A;  2OA8 A;  3PO5 A;  4BVP A;  4A61 A;  3NE6 A;  2Q0U A;  3L6Q A;  2CGL A;  3NF7 A;  4FM2 A;  4IWV A;  3CCL N;  1WNS A;  3HVT A;  4BRF A;  4DF8 A;  5J2Q A;  5BR9 A;  3ULE A;  3HYF A;  3W0L A;  4DWI A;  2WUS A;  2VQE K;  3OBY A;  1HJO A;  2P9U B;  2W41 A;  1ZBF A;  4F2R A;  5C2D A;  1SUQ A;  2IGI A;  1OH7 A;  4YOR A;  4GW6 A;  1UA1 A;  4KHY A;  1OVY A;  4O0J A;  2A40 A;  1T6D A;  3JS6 A;  2NRH A;  3ZET A;  1VQ6 N;  1F21 A;  3M6G A;  1NWK A;  4OGC A;  1S3X A;  1JLQ A;  5BPN A;  3ZX3 A;  4OPA A;  5AQU A;  4H03 B;  3L2V A;  1G15 A;  3CM6 A;  4IO9 L;  3VPZ A;  3K0S A;  3HST B;  1RT3 A;  4DUY K;  3M3Z A;  3M5R A;  5CE3 A;  3CFO A;  5AQI A;  4A57 A;  3ZT4 A;  3AO5 A;  5FPN A;  3WQU A;  2OAN A;  3ZSZ A;  2E6M A;  4DQS A;  3N4Q A;  5KRS A;  3MN5 A;  4B1Y B;  3G71 N;  4H4O A;  2FBT A;  3I55 N;  4I6M B;  4DCH A;  1B9D A;  2KLA A;  4BR5 A;  1TK8 A;  1RTJ A;  5JVG L;  1BCO A;  1SQK A;  1ZBS A;  3MK6 A;  5GIN A;  4EP4 A;  1RT5 A;  4BRK A;  3D0P A;  1HPM A;  3HSC A;  1EP4 A;  1KQS M;  1NGC A;  4U67 L;  4FK4 A;  4W5O A;  3RRG A;  4XH5 A;  2YHX A;  4YDU C;  4B9Q A;  4DV0 K;  3E01 A;  4CF2 A;  1YJ9 N;  3HTV A;  4CEB A;  4KV8 A;  4NXM K;  3CME N;  3O4W A;  3S9H A;  3U3Y A;  1QE1 A;  4MDB A;  1EO1 A;  1MU2 A;  5C24 A;  4JI7 K;  5CHI A;  2Q97 A;  4DV4 K;  4H8K A;  4B8A B;  3KTQ A;  1R0A A;  4EAH D;  3H08 A;  3FFI A;  1M90 O;  3WXJ A;  4JKG A;  4Z0U A;  1YAG A;  1ZC6 A;  4E7I A;  2HMI A;  3QER A;  1VQ8 N;  4RG8 A;  3FE1 A;  3EY1 A;  1XHZ A;  3SBT A;  2VYP A;  1HYZ A;  1VQN N;  4KPY A;  2E20 A;  3V9W A;  4C8O A;  3P1G A;  5EY4 A;  5TKW A;  2ZM6 K;  4JV5 K;  2QWP A;  1RCH A;  3BGR A;  4CZJ A;  2UYT A;  3H3N O;  4ZTF A;  3JSM A;  3NF8 A;  2YCH A;  1XHX A;  3KK2 A;  2EWS A;  3E9O A;  1IG9 A;  4Y0W A;  2O8B B;  2FXU A;  5J2N A;  4IOC L;  3HO1 A;  1JLF A;  4DFK A;  3C94 A;  1RDU A;  4G1Q A;  3SLC A;  1JL1 A;  4FW2 A;  4KHP K;  4CEE A;  4OPK A;  1TAQ A;  3QIO A;  3CCJ N;  2Y1J A;  3ULE B;  3CJ9 A;  3KZB A;  4IBN A;  4AHS A;  4KB0 A;  3B8A X;  3KWI A;  2F8S A;  2XRI A;  1VSM A;  3T3F A;  3O1B A;  2IC3 A;  4FJ8 A;  3OVN A;  4C1N I;  2UU9 K;  2HHU A;  1TKT A;  1REV A;  3LDN A;  2W6K A;  3AA2 A;  3MAQ A;  4F4K A;  2BGG A;  1W7A A;  3ZET B;  4CEC A;  3C6H A;  4EFH A;  1CZB A;  2PBD A;  2D0A A;  1LAV A;  4E19 A;  5CZ1 A;  2P51 A;  2QWM A;  4XH4 A;  3B6O A;  4KHQ A;  2FBY A;  1B92 A;  4B9M A;  4MQ3 A;  4KH6 A;  5C0Y A;  4CJR A;  2P9I A;  4FWS A;  2YHA A;  4KBO A;  3SMS A;  5KTQ A;  2YNI A;  1NJI O;  4PY5 A;  3K5N A;  4BR4 A;  4ZHR A;  2Z1G A;  4B3M K;  4N76 A;  4W5Q A;  4FLY A;  3RMD A;  3L4Q A;  3G25 A;  3DM2 A;  4BR7 A;  3O9T A;  2NZT A;  4BRQ A;  1D8Y A;  4CJ4 A;  1E3M A;  3ZYY X;  4CHY A;  3H45 C;  3VQ4 A;  2VCP A;  2IOC A;  4M3W A;  4WFB L;  2O8C A;  4CFB A;  4GKK K;  4KTW A;  5ELZ A;  2DFE A;  4M45 A;  5I9E B;  2EX3 A;  2E4L A;  3O9S A;  4BG9 A;  1YHQ N;  4JI4 K;  2Z1J A;  5FRO A;  4BE0 A;  4HTU A;  3KVG A;  3TI0 A;  2HMP A;  4DSF A;  4J2E A;  5SZT A;  2YHB A;  2BAN A;  5DM6 L;  3TAE A;  1C1C A;  3OYN A;  5KPT A;  1LV5 A;  4IEI A;  4A5B A;  1KVC A;  1IJJ A;  1JCG A;  4CHZ A;  4QOZ B;  1U49 A;  3NGZ A;  4ELT A;  1YUW A;  3CYM A;  3TSU A;  3AO2 A;  1LWE A;  1KVA A;  5JVH L;  1FW6 A;  3DLH A;  3J8A A;  1TK0 A;  4FJI A;  2H3G X;  3CCV N;  4LF4 K;  3HL8 A;  4B9U A;  1W9H A;  2WOM A;  3ITH A;  4CFD A;  3GL1 A;  3T1H K;  4HCC A;  5C10 A;  5DM7 L;  2UUA K;  1T03 A;  3SUP A;  4C8N A;  3MCP A;  1XNR K;  5AQS A;  4BE2 A;  3AO4 A;  5K14 A;  3HXM A;  4OO1 J;  1BG3 A;  1NK6 A;  3RWU A;  1NGA A;  3HT3 A;  4DG1 A;  4WCE L;  2AJQ A;  4JKE A;  2XY8 A;  5AQM A;  4FVU A;  5AQZ A;  3TAQ A;  2DFH A;  3SQ0 A;  4E7L A;  4B9V A;  3FFK B;  4FPB A;  3CQ8 A;  4DU3 A;  3EKS A;  1ZYQ A;  1BDG A;  4CE9 A;  3C65 A;  4CHN A;  4KKO A;  5AFU H;  3PV8 A;  4CJQ A;  3MX2 A;  1UWB A;  3S3N A;  2UUC K;  3WXI A;  4F8R A;  2O8D B;  2UUB K;  4M7X A;  3S3M A;  2P5O A;  3WUH A;  4EP5 A;  3CC4 N;  3KD1 E;  4WE1 A;  1J9A A;  3I0R A;  4I9Q A;  1KAZ A;  4Z4G A;  4H5N A;  2Q31 A;  4LF5 K;  1OVQ A;  4RW6 A;  4QS7 A;  3KKR A;  2Q1N A;  2QWQ A;  1NK7 A;  3U9Z A;  3O9Q A;  3WXM B;  1HYS A;  2NUB A;  5C15 A;  2HHS A;  4DU4 A;  3ZSQ A;  5KI6 A;  2A6A A;  4JKD A;  3AVA A;  4FWR A;  5MLC Q;  3DLB A;  3AAQ A;  3H46 O;  3QNN A;  1TV6 A;  4CK1 A;  4CK2 A;  4CBW A;  2P9I B;  3RMB A;  1CZ9 A;  1C0M A;  4O5B A;  3GG4 A;  2D5R A;  4J2D A;  1O13 A;  3FZF A;  2YKM A;  1GLJ O;  4AHU A;  1ILY A;  4UQG A;  2IVP A;  3M8R A;  1S1U A;  1HQU A;  2KZM A;  3AVL A;  3MED A;  4CJP A;  3QEI A;  2O8F A;  4WYB A;  4A2B A;  1J5O A;  3HOT A;  1K8K B;  3U6F A;  3NAE A;  2VGM A;  3KKS A;  2G8V A;  1YVN A;  3VQA A;  3HI0 A;  5M1O A;  3NCI A;  3BDP A;  1KVB A;  1RBT A;  3ZX0 A;  4E1J A;  3OYE A;  3E66 A;  2VG7 A;  1XC3 A;  2GTD A;  4CZE A;  2IVO A;  4M41 A;  1U2V A;  1ZBL A;  3TTC A;  3V9U A;  4CF1 A;  1HMV A;  3T1A A;  1ZBI A;  2G8I A;  1N33 K;  5KQ8 A;  1ITG A;  3CPW M;  3O8M A;  1HKC A;  1S9E A;  3AA5 X;  1WSH A;  1XNQ K;  2KW4 A;  4BRE A;  4R5P A;  2QM1 A;  1TKZ A;  3DRR A;  4DTU A;  3TTF A;  4FJM A;  2QI2 A;  4YOU A;  4BQL A;  4CIF A;  1QQM A;  3QML A;  3JYT A;  3CD6 N;  4DTN A;  1NJZ A;  2R7Y A;  3MEG A;  2QWL A;  3OBW A;  2BUP A;  1LW2 A;  3QFU A;  2HHX A;  5JS1 A;  3DXK B;  4CZL A;  4O0I A;  2P5G A;  3DLK A;  3PSF A;  3AVG A;  3R1X A;  4IFY A;  2QEX N;  4FJH A;  3VF2 A;  3OYB A;  3O08 A;  3CJ7 A;  1Q81 O;  1KLM A;  1NK4 A;  4XH1 A;  3NMU A;  3QEW A;  3SQ1 A;  3HPH A;  2A3Z A;  4IOA L;  3DOL A;  3HOS A;  4E7J A;  1BO5 O;  3AVJ A;  4DR5 K;  4GV9 A;  5T7B A;  3V4I A;  2J4R A;  3UB5 A;  1NM1 A;  3DLE A;  1RT7 A;  3EN9 A;  3SK3 A;  1MDU B;  1YXQ A;  3IDH A;  4Q5V A;  3OYG A;  4FK0 A;  3F2K A;  3CI5 A;  2YI1 A;  3VEX A;  4BVO A;  4CF9 A;  4DTR A;  3QNO A;  2BE2 A;  3NF6 A;  3OYH A;  2OTJ N;  2A1R A;  1M1K O;  3J7Y P;  4HTL A;  1BUP A;  4CJU A;  4LH5 A;  4MLE A;  1RT1 A;  3FZK A;  4H5W A;  3CCR N;  2UXC K;  1BGX T;  4JI5 K;  1HNZ K;  3SJH A;  3KIO A;  3T19 A;  4H4M A;  4DTM A;  3VF6 A;  2D4W A;  4DQP A;  4BR2 A;  4CF0 A;  1DTT A;  1VRU A;  4CJ3 A;  3DYA A;  4MFB A;  2XO7 A;  4ELU A;  1S72 N;  3ASM A;  1FKO A;  2CGJ A;  5EX5 A;  3UKU A;  4CJE A;  4CHP A;  3K9K A;  3O4Q A;  4QS9 A;  3UKR B;  1FJG K;  1T05 A;  1RNH A;  4OGE A;  2D0B A;  3ZSV A;  3EO3 A;  1VSF A;  4FJX A;  3VF4 A;  1D9D A;  1VSH A;  5FDL A;  4HVJ A;  3C6T A;  4B3S K;  3PO4 A;  1FXX A;  3VEY A;  3TAF A;  4NCG A;  3HRG A;  1JCF A;  5AQW A;  3VMF B;  5HRO A;  4TSX A;  4CEA A;  3F9M A;  1JL2 A;  5DK5 A;  4B1U B;  2QKK A;  1C0T A;  3V1O A;  2O8F B;  1Q18 A;  4GMJ B;  2FF6 A;  1TKD A;  1S22 A;  3WNE A;  4A62 A;  4IZ9 A;  4DF4 A;  2ZD1 A;  4JYA K;  1QHT A;  4JN4 A;  4JD2 A;  3I8D A;  3T7Z A;  3MWT A;  4MO5 A;  1GLB G;  1BU6 O;  3ATV A;  4DS5 A;  3L4I A;  1U2V B;  2HF4 A;  3ZT2 A;  5KRT A;  3KK3 A;  4B1X B;  1NKE A;  1DEJ A;  4LSL A;  4BRG A;  1V4S A;  3U9D A;  1IH7 A;  3AA4 A;  2GWJ A;  3C6U A;  3NDK A;  1NGH A;  2P1J A;  4CJV A;  4KHU A;  1HQE A;  2F8T A;  5BPM A;  3V6D A;  3AGK A;  3KWG A;  4PL7 A;  3LL3 A;  5GAE P;  2YNF A;  3M8S A;  4E1N A;  1VQ7 N;  3MWP A;  4CF8 A;  1U45 A;  3TAN A;  4NO7 A;  1FK9 A;  3MX5 A;  3E9P A;  2ZJP L;  1BIS A;  1RDC A;  1QQO A;  2Q36 A;  5AQR A;  1KLN A;  5C12 A;  2X6N A;  1BHL A;  1TUY A;  1SZ2 A;  4YFU A;  2E6L A;  3EE8 A;  5AQH A;  4DTX A;  3ZT3 A;  3RMA A;  1GLC G;  4WQ4 C;  1RDD A;  3OYK A;  2P9L A;  3VGK A;  1JLC A;  2E1Y A;  5AQJ A;  2HST A;  1P90 A;  2ZWH A;  4KTZ A;  4W5N A;  1NGJ A;  1QVF M;  3AVF A;  4CEZ A;  4CJ7 A;  4HHT A;  2V7Z A;  4BG8 A;  2QXF A;  1J54 A;  3THX A;  3SJJ A;  2ZF5 O;  3TTD A;  4FO0 A;  4WF9 L;  2DFF A;  3CCQ N;  2ZQB A;  4DTS A;  3ZSR A;  2GV9 A;  3GBT A;  3O1W A;  4B8C A;  4DV6 K;  2YKN A;  3D2E A;  5HOO A;  2W6L A;  1XWL A;  1GLE G;  3THY B;  2QWO A;  1HLU A;  1Z25 A;  4GY2 B;  1NJW A;  3MMV A;  4RWT A;  3V9Z A;  4BE1 A;  2RHK A;  3VQB A;  3HPG A;  2ZJR L;  1KD1 O;  5HRS A;  5AQN A;  4DV7 K;  1QHA A;  4DR6 K;  4M3U A;  1C1B A;  2OZS A;  4CJS A;  3UKU B;  3DOK A;  3OYF A;  5BRD A;  2XY5 A;  1EXQ A;  4C8L A;  3OS1 A;  4Z4I A;  3QBW A;  3PLA A;  4ILJ A;  3O9U A;  1KFD A;  2FF3 B;  3FZH A;  1MWK A;  2HVH A;  4H5R A;  1VQ5 N;  2WFB A;  3F5T A;  2VQF K;  3EKU A;  4IFV A;  4N47 A;  2NNW A;  4CGF A;  3L2Q A;  4DLG A;  3SCX A;  5AZJ A;  5DMR A;  4NYF A;  3G10 A;  3K5L A;  3MN9 A;  3VA3 A;  4CCH A;  3TSP A;  4E7H A;  2NRR A;  1L3U A;  4B08 A;  1HUX A;  4M3Y A;  4GV6 A;  4BRN A;  3AY9 A;  3OYD A;  1NKB A;  1VSK A;  3ALY A;  1BL3 A;  1S1W A;  2GUP A;  2XY7 A;  1GLA G;  2QKB A;  4LY7 A;  1Q9Y A;  4AQY K;  1GOA A;  4CGJ A;  1K8A O;  4CJL A;  4R79 A;  4BC2 A;  4FLX A;  2DTU A;  4CBU A;  1HKB A;  3LDQ A;  1S9G A;  3CFP A;  4IG0 A;  5AQT A;  3D6R A;  4EHT A;  4DU1 A;  2D0P A;  3CET A;  2GX9 A;  2UXB K;  1N5Y A;  4OVL A;  3NGY A;  5ADX A;  2ZGY A;  1WSE A;  4KFB A;  2O8E A;  4LC9 B;  1LCU A;  3L2W A;  5AQX A;  4DR3 K;  5J2M A;  4YDU A;  1QVG M;  1IKV A;  4OKJ A;  1FKP A;  3SMP A;  5LJW A;  3A5M C;  4JK7 A;  3VQ6 A;  1S6Q A;  4YOT A;  5TKY A;  3A5N C;  3CXC M;  1RTD A;  2PYL A;  3QFP A;  3WXL A;  4CZG A;  4KH5 A;  4JI6 K;  4OLA A;  3OYC A;  3RSE A;  3VA0 A;  2KQ2 A;  4OX9 K;  1U48 A;  1D4X A;  4KI6 A;  3VEO A;  3ZX2 A;  3BP8 A;  3CC2 N;  1WB9 A;  4AIL C;  1NG9 A;  2JLE A;  4FJ7 A;  4BRO A;  1A5X A;  3AO1 A;  5M1N A;  1VQP N;  3C7N A;  3VQQ A;  4HCB A;  3VQ5 A;  3CCE N;  1RIL A;  2I5J A;  3AVN A;  4FLZ A;  5J2P A;  1NJX A;  5HRR A;  1C0U A;  4BDY A;  2P9L B;  3IFR A;  4M7Y A;  3VGL A;  1I94 K;  1CZA N;  4AM6 A;  1HKG A;  5CZ2 A;  4BC3 A;  5CR4 A;  2UXD K;  1SAZ A;  1IG8 A;  3LP2 A;  3V81 A;  3J80 O;  5C2F A;  4NYN A;  1MA9 B;  4FWK A;  4J8F A;  4FCY A;  1KXP A;  1VQ9 N;  1RT4 A;  1JLG A;  1L3T A;  3KD5 E;  3D2E B;  4M3X A;  3CCS N;  4OKE A;  1YF5 L;  4OKK A;  3QIN A;  3IS9 A;  5AQK A;  3T1Y K;  1EWR A;  4JKA A;  3FR0 A;  3TAP A;  5HL7 L;  3K9J A;  4JKG B;  3DRP A;  1DTQ A;  3LDL A;  3P4I A;  1NOZ A;  2YJF A;  1DGK N;  3IRX A;  3OYJ A;  3D7E O;  2VWB A;  5M1P A;  4LD0 A;  3DAW A;  5KGW A;  2NRZ A;  3AA3 A;  1HNI A;  3E9L A;  1WN7 A;  4AHT A;  5J1E A;  4LF9 K;  1LW0 A;  4M3R A;  4FZY A;  3RVC A;  3KLF A;  3CJ1 A;  2OZM A;  2QTD A;  4ELV A;  2E2O A;  3UE5 A;  1VSE A;  3PIP L;  1IBK K;  2OCE A;  1T44 A;  1OKJ A;  3D2F A;  4N41 A;  4JI2 K;  3R9P A;  3K5M A;  4BRM A;  1JCE A;  4H0V B;  4BRH A;  3AVH A;  4EHU A;  5AZJ B;  1SKR A;  4ISE A;  1BIU A;  3TU5 A;  1WSJ A;  3L3V A;  2KFN A;  4I2Q A;  2PYJ A;  2HND A;  3DRS A;  3TWH A;  1HYV A;  4H0P A;  3SAF A;  2QK9 A;  2VG6 A;  4PQU A;  2HNZ A;  3CF5 L;  4FLT A;  4XIU A;  4F9O A;  3CJC A;  4O44 A;  4CZM A;  1RBU A;  2QWN A;  4IXC A;  3G0Z A;  4A59 A;  2NLX A;  2Q2R A;  1WLJ A;  4CED A;  4FWL A;  3DLL L;  4CIG A;  4Y1D A;  3ZEU A;  4BDZ A;  5GAD P;  1RFQ A;  4HWI A;  4AHV A;  4C8K A;  3O5B A;  1V4T A;  2PFU A;  3LP0 A;  2HW3 A;  5JLF A;  5HLF A;  4Z4E A;  3MXI A;  3I8B A;  4YY3 K;  1Y64 A;  3AAP A;  4B3R K;  1N8R O;  3QEV A;  1C6V A;  1N32 K;  5A2Q O;  1RTH A;  1NMD A;  5CYM A;  4C1N K;  3LWM A;  2VWK A;  5AJ3 K;  3DWL A;  3VEV A;  3RSE B;  4AHR A;  1W2B M;  4FM0 A;  3CQY A;  3G4S N;  1N6Q A;  2HHQ A;  3ULD A;  3CC7 N;  3TAB A;  4KI4 A;  4H5T A;  2AP1 A;  4FJK A;  4WFN L;  3K5O A;  3QBX A;  4AF1 A;  3EL2 A;  1TAU A;  1CXQ A;  3C7N B;  4OPH A;  3NBP A;  4MLH A;  2G8F A;  4OLB A;  3PSI A;  5LY3 A;  2O8C B;  2OTL N;  1C0G A;  1Z26 A;  3BZC A;  3GDQ A;  5B8H A;  1NK5 A;  3OTO K;  5C25 A;  5BRE A;  1IKY A;  4CFC A;  1L5U A;  4CER A;  2HOE A;  4DLE A;  4BR0 A;  3V9X A;  3SBG A;  1TL1 A;  1YT3 A;  4H0T B;  4Z94 A;  4E89 A;  4WQ5 C;  4N56 A;  3MEE A;  1BWF O;  2D1K A;  2I7N A;  1ATR A;  2P9N A;  2X6S A;  4CK3 A;  2IVN A;  1I39 A;  4V19 S;  3MN7 A;  4K42 A;  3P39 A;  2HHH K;  3E1Y A;  5BPL A;  2YJE A;  4ZTJ A;  4BQZ A;  4G9Z A;  3RRH A;  3JXU A;  3AV9 A;  5AQL A;  4IG3 A;  3VEN A;  2HF3 A;  1IO2 A;  2V52 B;  4M3Z A;  4U7B A;  3ENO A;  5CY4 A;  3OW2 M;  2PAV A;  3P38 A;  3KLE A;  4DQQ A;  1D9F A;  4YOW A;  2HBJ A;  4I9L A;  3PX6 A;  5JLH A;  3ISN C;  4FSV A;  5E84 A;  3O3H A;  3ID8 A;  3NFA A;  3H1Q A;  2DY4 A;  3AGR A;  1OH6 A;  3OA9 A;  5BR8 K;  3VEW A;  4C8M A;  1BCM A;  2E2P A;  4KHS A;  1RTI A;  1DT9 A;  5EXW A;  2YX6 A;  5E26 A;  3SQ4 A;  3QLH A;  1X9S A;  1HJR A;  3TR8 A;  2OPR A;  4X66 K;  3QEP A;  5GIO A;  1BQM A;  4B1V A;  4N5S A;  4BY9 C;  2G8K A;  1KAX A;  4DSI A;  3LZI A;  4UY8 O;  2WON A;  4PKH A;  1NGI A;  3K2P A;  1LOT B;  4KHN A;  2KTQ A;  4DR4 K;  4X62 K;  3I56 N;  4DR1 K;  4JNE A;  4NLB A;  1T6C A;  1UA0 A;  4KAZ A;  1VSJ A;  2O4G A;  3CG7 A;  2PZS A;  1GOB A;  1WAF A;  3ZCM A;  4FWP A;  4FJG A;  5LMN K;  1WAJ A;  1TK5 A;  1BIZ A;  4CD1 A;  5E41 A;  3FZM A;  3CM5 A;  3NGI A;  3RR8 A;  3B6P A;  4ID5 A;  4Z4H A;  2YV0 X;  1QQC A;  2P9P A;  3DLG A;  4GVE A;  2QWR A;  4DS4 A;  2BDP A;  3M8Q A;  2E2N A;  2P9S A;  4CHQ A;  4YNQ A;  2EHG A;  3DLR A;  3GOI A;  4K8Z A;  3ZT0 A;  1CXU A;  3LPU A;  2HHW A;  5AQG A;  2X74 A;  1KC8 O;  4CI6 A;  2HBL A;  3ZSY A;  4W5R A;  4DV2 K;  4FW1 A;  4CBX A;  2Q3S A;  3QEX A;  3CFR A;  2QW9 A;  1H1V A;  1IKW A;  1RT6 A;  3LDS A;  3OHR A;  2VGN A;  4K41 A;  1ASU A;  3U3G A;  3HJF A; 
#chains in the Genus database with same CATH homology
 4BRC A;  5AQN A;  4FWM A;  1QHA A;  3BUZ B;  5DM6 L;  1VQK N;  1G99 A;  3QIC A;  2A41 A;  5KPT A;  2QA4 N;  3UKU B;  2NRV A;  1QZ6 A;  1YJW N;  5BRD A;  4IEI A;  4A5B A;  1IJJ A;  4IOX A;  5AQY A;  1JCG A;  5AQO A;  3GE1 A;  4DQ8 A;  3QBW A;  5ADX H;  3H3O B;  3PLA A;  4H5V A;  2FLO A;  3LM9 A;  4FOI A;  2FSK A;  3O9U A;  4ILJ A;  1YUW A;  3CCM N;  2FF3 B;  2P9U A;  3FZH A;  1MWK A;  3O80 A;  4IJN A;  4JK8 A;  4NB4 A;  3TSU A;  1VQO N;  5JVH L;  4H5R A;  3KK7 A;  1VQ5 N;  4CZH A;  4ILH A;  4PHT X;  3J8A A;  2H3G X;  2WFB A;  3F5T A;  4K43 A;  3QB0 A;  1BA1 A;  3EKU A;  3CCV N;  2NNW A;  3I33 A;  1VQL N;  4BRD A;  5AZJ A;  1K73 O;  3EZW A;  2FSJ A;  3GL1 A;  2KKZ A;  5C10 A;  5DM7 L;  1Q7Y O;  4B1W B;  3MCP A;  3MN9 A;  5AQS A;  2W40 A;  4OO1 J;  4ILG B;  1ATN A;  3TSP A;  1BG3 A;  3ENH A;  5EVZ A;  2NRR A;  4CZK A;  1NGA A;  1HUX A;  5BRF A;  4YOV A;  3CHW A;  4WCE L;  4GV6 A;  3EE9 A;  5AQV A;  1VQM N;  2P9N B;  4FWQ A;  4BRN A;  3AY9 A;  4JKB A;  4JEP A;  4JKE A;  1K9M O;  5AQM A;  1QZ5 A;  5JIC A;  5FPM A;  3O6W A;  3VTH A;  5AQZ A;  2GUP A;  1GLA G;  4A5A A;  1NGD A;  3R8E A;  2ASO A;  3S41 A;  3FFK B;  4FPB A;  1K8A O;  4R79 A;  4BC2 A;  4AM7 A;  2HBM A;  3EKS A;  2NRT A;  3A8Y A;  1BDG A;  4CBU A;  3FZL A;  1HKB A;  3LDQ A;  3Q7C A;  3D2F B;  3C65 A;  4K25 A;  4KH4 A;  5AFU H;  5AQT A;  4EHT A;  2E2Q A;  3D6R A;  2D0P A;  4BRP A;  3CET A;  3MX2 A;  3U4L A;  2JWK A;  1ATS A;  2GX9 A;  3AAR A;  4I6M A;  1Q82 O;  4FL9 A;  3WQT A;  3TPQ A;  3DJC A;  3WXI A;  3A0I X;  5ADX A;  4CZF A;  2D0O A;  2ZGY A;  3QDK A;  4M7X A;  4LC9 B;  4DHY A;  1LCU A;  5F2R A;  3WUH A;  5AQX A;  5GIP A;  1QVG M;  4YDU A;  3CC4 N;  3VET A;  5GAH P;  3SMP A;  5LJW A;  3LDP A;  3A5M C;  2BTF A;  4JK7 A;  5GAG P;  1KAZ A;  3IMX A;  4NLC A;  4YOT A;  3A5N C;  5TKY A;  3CXC M;  3QFP A;  4H5N A;  3WXL A;  4CZG A;  4KH5 A;  1U6Z A;  2Q31 A;  3RSE A;  4BGB A;  3VES A;  1E4F T;  1D4X A;  5AQP A;  3MCA B;  4H0X B;  2DPN A;  4QS7 A;  1XQS C;  3HBT A;  3VEO A;  2Q1N A;  1BA0 A;  2HBK A;  2QWQ A;  3H1V X;  3ZX2 A;  3BP8 A;  3CC2 N;  1GLF O;  3ZEU B;  3U9Z A;  1VAZ A;  2P9K B;  3BEX A;  3O9Q A;  3WXM B;  3BF3 A;  2CGK A;  4JK9 A;  5C15 A;  4BRO A;  1VQP N;  5M1N A;  3C7N A;  4BRL A;  2A6A A;  1E4G T;  4JKD A;  2E1Z A;  4FWR A;  4FWO A;  5F0X A;  5MLC Q;  3CCE N;  3AAQ A;  3H46 O;  1VQ4 N;  3HM8 A;  3IUC A;  3CJB A;  4WQ5 A;  1SS6 A;  2P9I B;  4CBW A;  2A42 A;  2YHW A;  1HX1 A;  3R6M A;  4PKG A;  3GG4 A;  4H0Y B;  5AFU A;  1O13 A;  3FGU A;  2P9L B;  3FZF A;  3IFR A;  1GLJ O;  4M7Y A;  3LDO A;  5AZI B;  3VGL A;  1ILY A;  2IVP A;  5F1X A;  1KAY A;  2WC9 A;  1CZA N;  3VOV A;  1HKG A;  4AM6 A;  4BC3 A;  5CR4 A;  1YJN N;  1SAZ A;  4BRA A;  1IG8 A;  4FOE A;  2P9P B;  4FWN A;  4WYB A;  1NGG A;  4A2B A;  4MDA A;  1J6Z A;  5C2F A;  3HOT A;  1K8K B;  1MA9 B;  4FWK A;  4J8F A;  3A5O C;  1KXP A;  4IDH A;  2P9S B;  1VQ9 N;  3U8X A;  1XUP O;  3TSQ A;  1NGF A;  1P8Z A;  2VGM A;  4M63 C;  4JHD A;  3WEE A;  3D2E B;  1YVN A;  2ASP A;  2F9T A;  3HI0 A;  4C23 A;  3CCS N;  5M1O A;  1YF5 L;  4BC4 A;  3ZX0 A;  5AQK A;  4E1J A;  2I7P A;  3E66 A;  1YIT N;  1XC3 A;  1TYQ B;  2GTD A;  4JKA A;  3FR0 A;  4CZE A;  2IVO A;  4BVP A;  2CH6 A;  5HL7 L;  1U2V A;  3K9J A;  4JKG B;  3TTC A;  4A61 A;  3DXM A;  5KQ8 A;  3CPW M;  3O8M A;  2Q0U A;  1HKC A;  2CGL A;  3L6Q A;  2E8A A;  5M1Q A;  4IJA A;  3LDL A;  3P4I A;  4IWV A;  3SAG A;  3W3D A;  3CCL N;  2YJF A;  1DGK N;  2E88 A;  4BRE A;  2QM1 A;  3M1F A;  4BRF A;  1T3V A;  3D7E O;  3L0Q A;  2VWB A;  3TTF A;  2QI2 A;  5M1P A;  4YOU A;  3DAW A;  5BR9 A;  3ULE A;  3VTI A;  4BQL A;  2NRZ A;  1ESV A;  3E9L A;  1EQY A;  3ATU A;  3W0L A;  1QQM A;  3QML A;  3CD6 N;  2WUS A;  3RVC A;  3OBY A;  3CJ1 A;  4CD3 A;  1HJO A;  2W41 A;  2P9U B;  2QTD A;  2E2O A;  2QWL A;  3UE5 A;  3PIP L;  5C2D A;  1T44 A;  1OKJ A;  3D2F A;  4JD2 B;  4YOR A;  3OBW A;  2BUP A;  3R9P A;  4BRM A;  1JCE A;  4H0V B;  3QFU A;  4RTF D;  1OVY A;  4BRH A;  1GLL O;  5M1K A;  3DXK B;  4EHU A;  2GWK A;  2NRX A;  2A40 A;  1T6D A;  3JS6 A;  2NRH A;  3ZET A;  5AZJ B;  4CZL A;  1VQ6 N;  4ISE A;  1NGE A;  4WQ4 A;  3R1X A;  3M6G A;  5FPE A;  2QEX N;  3TU5 A;  1NBW A;  1NWK A;  4GV3 A;  3VF2 A;  4WFA L;  3O08 A;  3CJ7 A;  3CER A;  1S3X A;  4QS8 A;  5BPN A;  3ZX3 A;  1Q81 O;  4H0P A;  3SAF A;  5JMV A;  4OPA A;  1RGI A;  5AQU A;  4H03 B;  4IO9 L;  4XH1 A;  3NMU A;  3VPZ A;  3CF5 L;  2A3Z A;  4H0O A;  3M3Z A;  3CJC A;  4F9O A;  4IOA L;  3HOS A;  3M5R A;  4CZM A;  1BO5 O;  2QWN A;  4IXC A;  5CE3 A;  5AQI A;  4GV9 A;  1RDW X;  2J4R A;  3UB5 A;  2NLX A;  4A59 A;  2Q2R A;  4A57 A;  1NM1 A;  5FPN A;  4FPA A;  3WQU A;  2OAN A;  4FWL A;  3EN9 A;  3SK3 A;  3J7Z O;  3DLL L;  2ZGZ A;  1MDU B;  1YXQ A;  3IDH A;  3ZEU A;  2ASM A;  4XEI A;  5GAD P;  3F2K A;  1RFQ A;  1X3M A;  3CI5 A;  3N4Q A;  4HWI A;  2YI1 A;  3O5B A;  3MN5 A;  3VEX A;  4B1Y B;  4BVO A;  3G71 N;  3I55 N;  2GEL A;  2GEM A;  1V4T A;  4I6M B;  4BC5 A;  4DCH A;  5AQF A;  2YHY A;  2KLA A;  2PFU A;  4BR5 A;  2OTJ N;  1M1K O;  5JLF A;  5JVG L;  4HTL A;  1SQK A;  3I8B A;  5AR0 A;  1BUP A;  1Y64 A;  1ZBS A;  3AAP A;  3MK6 A;  5GIN A;  4MLE A;  3FZK A;  4H5W A;  3CCR N;  1JJ2 M;  4BRK A;  1WOQ A;  3C0B A;  4BR9 A;  1N8R O;  3NVM A;  1HPM A;  3CPE A;  3HSC A;  3SJH A;  2KHO A;  1KQS M;  2F7T A;  1NGC A;  1NMD A;  4U67 L;  4C1N K;  4DB3 A;  2IIR A;  3DWL A;  3VF6 A;  4XH5 A;  3VEV A;  2D4W A;  4O8K A;  3RSE B;  3WXK A;  1W2B M;  4BR2 A;  2YHX A;  3CQY A;  3G4S N;  4YDU C;  4B9Q A;  1GLD G;  3CC7 N;  3NVK A;  1YJ9 N;  3ENB A;  3HTV A;  1YIJ N;  1S72 N;  1K8K A;  3O4W A;  4H5T A;  3CME N;  2AP1 A;  2CGJ A;  5EX5 A;  3UKU A;  4MDB A;  4WFN L;  1EO1 A;  3K9K A;  3QBX A;  4QS9 A;  4AF1 A;  4PL8 A;  4A2A A;  1BOT O;  3UKR B;  3A5L C;  3EL2 A;  3C7N B;  3CJA A;  4OPH A;  4MLH A;  5H1S Q;  5CHI A;  2Q97 A;  2RE2 A;  5LY3 A;  4EAH D;  3CCU N;  3EO3 A;  2ZJQ L;  2OTL N;  4JKF A;  1C0G A;  3VF4 A;  5BRH A;  3GDQ A;  1M90 O;  3WXJ A;  5B8H A;  3VGM A;  1W97 L;  4JKG A;  1YAG A;  1ZC6 A;  5BRE A;  3LM2 A;  3VEY A;  3HRG A;  2HOE A;  1VQ8 N;  4ISG A;  4BR0 A;  3FE1 A;  1JCF A;  5AQW A;  3MN6 A;  3SBT A;  2VYP A;  3VMF B;  3SBG A;  3T69 A;  1VQN N;  3HZ6 A;  2E20 A;  1X9J A;  2V51 B;  4H0T B;  3F9M A;  4Z94 A;  5LJV A;  4WQ5 C;  4B1U B;  4O5F A;  1NGB A;  1BWF O;  5EY4 A;  2D1K A;  2I7N A;  2BH1 A;  5TKW A;  1Q18 A;  4JKC A;  2FF6 A;  1ATR A;  2P9N A;  1S22 A;  2QWP A;  2IVN A;  4A62 A;  4IZ9 A;  4CZJ A;  2UYT A;  3H3N O;  3MN7 A;  3CMA N;  4K42 A;  3O9R A;  4JHD B;  1C0F A;  4MO4 A;  2YCH A;  3P39 A;  4JN4 A;  3WEE B;  3E1Y A;  5BPL A;  2YJE A;  4JD2 A;  2CH5 A;  2QXL A;  4BQZ A;  2EWS A;  3T7Z A;  3E9O A;  3MWT A;  3R3L A;  4G9Z A;  3JXU A;  1NLV A;  4MO5 A;  1GLB G;  4Y0W A;  5AQL A;  3VEN A;  3VEZ A;  1BU6 O;  2HF3 A;  3DXK A;  3MDQ A;  2V52 B;  2FXU A;  3ATV A;  4U7B A;  3ENO A;  3L4I A;  4IOC L;  3OW2 M;  2PAV A;  3P38 A;  1U2V B;  4ISF A;  2HF4 A;  3Q7B A;  1ZXO A;  4YOW A;  2HBJ A;  4PKI A;  1RDU A;  3DXM B;  2V7Y A;  3SLC A;  4JKH A;  5JLH A;  4B1X B;  4IO8 A;  1DEJ A;  4FSV A;  5KPZ A;  4BRG A;  4YOY A;  1V4S A;  5BN9 A;  3BF1 A;  3FLC O;  5E84 A;  3U9D A;  2GWJ A;  1WUA A;  3H6E A;  3ID8 A;  3P31 A;  1X3N A;  3CCJ N;  1Q86 O;  1NGH A;  3H1Q A;  2AA4 A;  3AGR A;  4BRI A;  2NRW A;  4RCH A;  3ULE B;  4O8U A;  3OA9 A;  3CJ9 A;  3KZB A;  4JAX A;  3B8A X;  3KWI A;  3VEW A;  5BPM A;  2E2P A;  5BN8 A;  3AGK A;  3O1B A;  1DT9 A;  3KWG A;  5EXW A;  3LL3 A;  2YX6 A;  5E26 A;  4EIA A;  5GAE P;  4PL7 A;  1TUU A;  4C1N I;  1MWM A;  4DKW A;  5AQQ A;  5KQD A;  2F9W A;  3LDN A;  5KPR A;  1VQ7 N;  4L3Q A;  3MWP A;  5GIO A;  3ZET B;  2WBN A;  4NO7 A;  3C6H A;  4B1V A;  4BY9 C;  3MX5 A;  3E9P A;  2ZJP L;  2P9K A;  4EFH A;  1KAX A;  2PBD A;  4UY8 O;  1QQO A;  2Q36 A;  4PKH A;  5AQR A;  1NGI A;  5C12 A;  1DKG D;  2QWM A;  3N4P A;  1LOT B;  4XH4 A;  2Q0R A;  5EOY A;  4KH6 A;  1TUY A;  1SZ2 A;  3I56 N;  5C0Y A;  4JNE A;  4NLB A;  1T6C A;  3EE8 A;  2P9I A;  5AQH A;  2A5X A;  4FWS A;  4KBO A;  1GLC G;  4YOX A;  5FPD A;  3SMS A;  1NJI O;  4WQ4 C;  4IFE A;  3G6E N;  2P9L A;  3VGK A;  4BR4 A;  2E1Y A;  4FWP A;  5AZI A;  5AQJ A;  3CQX A;  3IKM A;  2HST A;  4BGA A;  4CD1 A;  1P90 A;  3FZM A;  3L4Q A;  2ZWH A;  3G25 A;  4B1Z A;  1NGJ A;  4BR7 A;  3O9T A;  2NZT A;  4BRQ A;  1QVF M;  1R59 O;  3ZYY X;  3KHY A;  4IEE A;  4CJ7 A;  3H45 C;  3UKR A;  2P9P A;  4GVE A;  2QWR A;  2V7Z A;  1YI2 N;  4BG8 A;  1QQN A;  2ZF5 O;  3TTD A;  4FO0 A;  4WF9 L;  2E2N A;  2P9S A;  2VCP A;  3SAH A;  3CCQ N;  5M1F A;  4WFB L;  2ITM A;  3GBT A;  3GOI A;  3O1W A;  2FSN A;  3VER A;  3WT0 A;  2JWL A;  5ELZ A;  1Z05 A;  3D2E A;  5HOO A;  3C6A A;  5I9E B;  1Z6R A;  1GLE G;  5AQG A;  1KC8 O;  3O9S A;  4BG9 A;  4CI6 A;  2HBL A;  4CBX A;  2QWO A;  1YHQ N;  1HLU A;  4CZI A;  1TYQ A;  4GY2 B;  3MMV A;  4RWT A;  4GNI A;  2QW9 A;  1H1V A;  2RHK A;  3OHR A;  3KVG A;  2VGN A;  3ID6 A;  4K41 A;  3PIO L;  2ZJR L;  2HMP A;  1KD1 O;  4FVU A;  3CIP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...