2ZJQL

Interaction of l7 with l11 induced by microccocin binding to the deinococcus radiodurans 50s subunit
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
104
structure length
104
Chain Sequence
RRKLRTRRKVRTTTAASGRLRLSVYRSSKHIYAQIIDDSRGQTLAAASSAALKSGNKTDTAAAVGKALAAAAAEKGIKQVVFDRGSYKYHGRVKALADAAREGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Translational regulation via L11: molecular switches on the ribosome turned on and off by thiostrepton and micrococcin.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords ribosomal 23S RNA
total genus 17
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2008-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00861 Ribosomal_L18p Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.100 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2zjqL01
2ZJRL 4WF9L 3CCQN 5HL7L 3CMEN 1VQ5N 5DM7L 1VQPN 3CCEN 3OW2M 1Q81O 1S72N 5MLCQ 4U67L 3CF5L 1KD1O 5GAHP 1ILYA 1M1KO 1QVGM 1YITN 5H1SQ 1JJ2M 3CCLN 1KC8O 1VQNN 1VQ8N 3CCUN 1K73O 2QEXN 3G71N 5GAEP 4IOAL 5GAGP 1VQLN 1VQMN 3CD6N 3I56N 1K8AO 3PIOL 2QA4N 1N8RO 4IOCL 3PIPL 5JVGL 1VQ7N 5GADP 1VQKN 2ZJPL 3CXCM 1YI2N 1Q86O 4WFBL 1NJIO 1VQON 1K9MO 5DM6L 3DLLL 4IO9L 3CCJN 3CC4N 1VQ9N 1OVYA 3CCVN 3CMAN 3I55N 1VQ6N 1Q82O 4WCEL 3G6EN 3CPWM 1YJWN 3CC2N 1KQSM 1M90O 1YHQN 4WFAL 3CCMN 2OTJN 2ZJQL 3CCRN 3CCSN 1YJNN 3G4SN 1YJ9N 4UY8O 1YIJN 2OTLN 3CC7N 5JVHL 1Q7YO 1QVFM 4WFNL 3J7ZO 1VQ4N 1W2BM
chains in the Genus database with same CATH superfamily
4CEEA 1MDUB 4K8XA 4QS9A 4ELTA 2HBMA 3MXIA 3C6HA 5C2DA 3HP9A 1QQNA 1IJJA 4IOXA 2W6KA 4KHYA 1S6PA 4CFDA 1BQMA 5FROA 4DQQA 2YI1A 4FJMA 1HJRA 2G8FA 4IOAL 4R79A 4AM6A 2QWOA 4M63C 1XWLA 4BRMA 4LF4K 3CJBA 3M8PA 5FPNA 5E41A 3VTHA 1C0MA 3FZLA 3A5LC 3LDPA 1IG9A 4FLTA 4K42A 3V9ZA 5JICA 4H4MA 4DQ8A 1SZ2A 4OLBA 3THWA 4B9VA 1GLAG 5HRRA 1ATRA 1JLQA 1U6ZA 1RT3A 4KH4A 1K9MO 2ASMA 4NO7A 1RT7A 1MWKA 3OTOK 3E1YA 1KFSA 1GLLO 3ZX3A 1SL2A 1Z26A 1JXBA 4IFVA 3O9SA 5E26A 3QIOA 3VN5A 1VQ6N 3CM6A 3HOTA 1ATNA 4OJRA 3HVTA 4B3SK 1RGIA 2P1JA 3LM9A 4BRPA 4CGDA 1NGAA 4CZJA 4QOZB 3ZT4A 4DR7K 4BRIA 5HROA 4DSKA 4CZGA 3G4SN 3AGRA 4LFAK 3VQQA 4FWOA 4KB0A 3WEEB 5AQVA 4GV6A 4O5BA 4Y1DA 1CXQA 1N6QA 3QEIA 4EZ6A 3J7ZO 4E1NA 1VSHA 3GBTA 5F2RA 4K8ZA 2RPIA 4X65K 3K57A 1REVA 3AVGA 4WQ4A 2I5JA 3QLHA 3THYA 1A5WA 2IOCA 4K41A 1BA1A 5CR4A 3CI5A 2IGIA 1NMDA 4FJ5A 1X9WA 3D7EO 4IWVA 1R59O 3QEVA 4BR2A 3L6QA 1TVRA 5HOOA 3LPTA 1FKOA 3O9RA 3CJAA 4J2AA 1JJ2M 2YHXA 3MN6A 2HHHK 3V9XA 3ZSWA 1WSFA 2NLXA 3CIPA 3J8AA 3UB5A 1NGIA 1NK8A 3TAEA 3ZX2A 1HNXK 2HNZA 3R1XA 4NB4A 4FLVA 3O4NA 2QA4N 3T7ZA 2W41A 4H8KA 1U48A 5A2QO 4MDBA 3H3NO 3L3UA 3RRGA 1GOAA 4PWDA 1P8ZA 3VTIA 5KPZA 2YJEA 4PA1A 4FK0A 2O8BA 3AVAA 1EQYA 1LWFA 2YNHA 3CPEA 3CFPA 1YVUA 3SMPA 1LAVA 4G1QA 3AO5A 2Q31A 5FLXO 4CJUA 1D9FA 5BREA 2NUBA 3BF3A 4BRNA 2DFHA 3D6RA 1XNRK 1NNEA 2FLOA 4NLBA 1RBUA 5AQLA 3BGRA 4JNEA 3ZETB 4ZTJA 4QS8A 4J2DA 2HBJA 2P9NB 1GLCG 3SI6A 4HVJA 1D4XA 3D2FB 1YJWN 2HBLA 4DKWA 4FSVA 3M8QA 2OA8A 1BO5O 2NNWA 4MDAA 3D2FA 2DFFA 2UXBK 2NRHA 1X3NA 3NGYA 1J53A 4CJQA 4GMJB 4KKOA 1TAUA 1QS4A 4BR5A 4CGHA 3EKSA 1QVFM 3ZSOA 1VQ4N 3AV9A 1VSFA 4FJNA 3AVFA 5CE3A 1TL3A 3PSFA 4FJHA 3WNGA 4FJLA 3ID8A 4PQUA 4ISGA 5M1PA 1RBVA 1NGCA 3NVKA 3CCEN 2FSNA 3J7AP 2D0PA 2FF3B 2P9LA 4GY2B 4BRFA 4NYNA 3RMBA 3O9TA 3KKRA 1X9MA 5I3UA 1GLBG 4CEAA 4WYBA 3EKUA 3ZSZA 3EYZA 2Z1JA 2Y1JA 5SWMA 2ASOA 1K6YA 4EAHD 5AZIB 1NLVA 3C6AA 2O8FA 5KGXA 4MFBA 5FRMA 2D0AA 3U9DA 1KAZA 1QZ5A 1LWEA 3H1VX 5KRSA 1H1VA 2CGKA 1YTUA 2E2OA 3LL3A 3RMAA 3KK1A 4YNQA 3KLFA 3NDKA 3O1BA 4PUOA 4CBUA 4H0TB 4DUYK 4Z94A 3IS9A 2FSKA 4LC9B 2WFBA 3IMXA 1BCMA 3WNHA 2ITGA 3CCJN 2DFEA 3CC4N 3RMDA 1HMVA 4CECA 3MEGA 1HNIA 1LAWA 2G8IA 2HF3A 4DU4A 4O0JA 4BY9C 3MECA 4HTLA 2PY5A 3RSEB 1A5VA 2W42A 4AM7A 1KQSM 4DR3K 2O8CB 4BR7A 5JMVA 3MN9A 4A5BA 4RCHA 4NCBA 1IH7A 2D1KA 3M1FA 4YFUA 5HRSA 4GV3A 3CC7N 4DCHA 3RTVA 1VSEA 3O4QA 3MEEA 1FW6A 3CQ8A 5J1EA 3VQ7A 2Q2RA 3SQ0A 2HVHA 3NF9A 4DMNA 4CF9A 4CZEA 3K9KA 5DK5A 3IFRA 1TUUA 4O44A 4CZKA 1VQPN 3ATUA 4H0YB 1RNHA 3EEQA 2WBNA 1RBSA 4CJ5A 3K5NA 3T1YK 3RVCA 2E6LA 5EY4A 1S1VA 2YCHA 3OY9A 3AO1A 2HW3A 3CETA 2IVNA 1BWFO 4XEIA 3AA2A 3SPYA 4I6MB 1NGFA 1SUQA 4B9UA 3S3MA 4JD2A 4BE2A 1NJYA 1NOYA 4FXDA 4UQGA 2YV0X 1IV0A 3J80O 4CD1A 3HTVA 3QEWA 1HQEA 3O6WA 3KWIA 3VQAA 1Q8IA 3PV8A 3PX4A 3DI6A 4OPAA 4DQPA 1QHAA 2A1SA 3ISNC 2FBTA 2QXFA 2XY8A 3WUHA 2HHWA 2FBYA 4JKCA 4PL8A 1DKGD 3BZKA 3NGZA 5J2MA 2H3GX 3P5JA 5M1QA 4CJRA 1BG3A 3HT3A 5HRPA 4KO0A 3DLKA 2E2QA 3LWLA 3GOIA 3PUFA 2AP1A 3I8DA 1B9FA 3KLIA 1Q86O 3L4IA 2CGLA 3U3GA 3HM8A 3ZYYX 1TK0A 3AVIA 2KFZA 5SZTA 4V19S 4KHUA 3C65A 3OYDA 4FJJA 1KLNA 1UOCA 2Q36A 4DSEA 2HHUA 4CGFA 3FZKA 3F2KA 4M3TA 3SQ2A 2XRIA 4B9QA 4HWIA 4HCCA 1U04A 3CPWM 3H46O 1N33K 3MWTA 2RE2A 2P9UB 4DUZK 3DRRA 2V7YA 1ZBHA 3KZBA 2ZJQL 2ETJA 1SS6A 3THVA 4BR0A 3KJVA 1YTAA 2PBDA 3OHRA 4CBXA 3R9PA 3B6OA 3ZT0A 1DTTA 3DXMB 4CEOA 4IBNA 2UU9K 5C15A 2XY5A 1RTDA 2O8BB 3BP8A 1DEJA 3SV3A 1WSHA 3NFAA 4W5RA 4DHYA 1LOTB 2YJFA 3N4PA 3HRGA 1WAJA 2D0CA 5CHIA 1BQNA 4RW8A 2A6AA 2PZSA 1I3AA 3ZLJA 1ILYA 2VQEK 1XMQK 4Y1CA 3PLAA 3AVBA 2P9NA 4CHOA 2HHXA 3WXKA 5FRNA 3LDNA 1JLAA 3DM2A 3BY5A 2QKKA 1N34K 2OANA 2CH6A 2VYPA 1VQMN 1RDCA 3QBXA 1D5AA 1ITGA 5GIOA 3PIOL 5AQNA 1KLMA 1HPMA 3MWPA 3SBTA 1KAXA 5AQRA 5GADP 1BI4A 1GLEG 3AGKA 4GVMA 4LSLA 4YOWA 4DQSA 1DTQA 4CJPA 5BRDA 4KPYA 1W9HA 1KSPA 3V1QA 4FOEA 1LV5A 3A5NC 1T6DA 3OYFA 4KTWA 1QQMA 3UE5A 1EXQA 3KTQA 2X78A 1C1CA 3M6GA 4DLEA 1VK0A 4LH5A 4JEPA 1JLEA 1RT2A 4BRQA 5BPLA 3P39A 3VF4A 2ZE2A 5CY4A 1NK4A 1J6ZA 5LJWA 4CEFA 2VG5A 4B1WB 4FWPA 1NJXA 4IG3A 2GUIA 1GLDG 4GVEA 3W3DA 4KTQA 3IKMA 3A8YA 4M3XA 3SAFA 3ULDA 3C95A 1HNZK 4DSLA 2IAJA 4NCGA 4OKJA 1G99A 3WXMB 3T1AA 3SQ4A 2F8TA 4DV1K 4M42A 4B3OA 1C0TA 3I0RA 4XIUA 3LDSA 4MLHA 3SUPA 4BRDA 3QEXA 4OPKA 1J9AA 4TSXA 4B8CA 4YOYA 4JHDB 1WBBA 5AZJA 4IJNA 4KH6A 1HR0K 3OW2M 1J54A 4BRLA 1HKCA 1RDBA 2IS3A 1KAYA 2UXDK 3SMSA 3SLCA 4O4GA 1QVGM 4PKIA 1BDGA 1NGDA 3TI0A 4B9SA 3I8BA 3DLBA 4CVNE 4O5FA 3G71N 1FJGK 3ZSRA 4IEEA 4AHCA 4M3YA 2BTFA 1NJWA 2GX9A 3UKRA 3B6PA 3LDQA 4E3SA 1CZAN 4W5NA 2Q1NA 3ZETA 3BDPA 3TABA 4DFPA 4X62K 4E1JA 1K8KB 1FXXA 4IOCL 1DLOA 4C8NA 2NRVA 4BACA 3H1QA 5K14A 2P5GA 3VEVA 3V1OA 4KBOA 2BH1A 4KTZA 3CJ1A 4JI7K 3WXJA 5I42A 4I7FA 3WQTA 1NGJA 2F96A 2HVIA 1HNVA 5C10A 3HPOA 2RN2A 5TKWA 4O0IA 4JV5K 3SV4A 4MO5A 4M3WA 4Z4FA 3C0BA 3S3NA 1RTHA 3D2EB 3AVNA 5FPDA 3ZT1A 3PY8A 4HCBA 4KB1A 4BRHA 4WCEL 5BPNA 3L2UA 3U4LA 2B4JA 5C12A 4CCHA 1Y64A 1YT3A 4JRQA 3G25A 1RDWX 4CK3A 1T05A 3SUNA 1FKPA 4ILGB 1X9SA 4LD0A 1ZBLA 4AQYK 3QETA 4AHTA 2OTLN 3O3GA 1HYSA 2QTDA 1S22A 3VQEA 1OKJA 2W6LA 4GKKK 4M3ZA 1BCOA 4OKKA 2YHYA 3V4IA 2HSTA 4GKJK 3ID6A 4JI5K 4W5OA 3CQXA 3LP3A 2B6AA 1D9DA 5KI6A 2P9SB 1HPZA 4CIFA 4KHSA 3JYTA 3R3LA 3ZEUA 3AO4A 2AA4A 1CZBA 4EHUA 5AQHA 1XC9A 3L3VA 4ID5A 3L2WA 3TWHA 4FZXC 3R8EA 1LCUA 1EP4A 5BN9A 1NK9A 3CQYA 4KHWA 4FCYA 4DV5K 3EE9A 1TV6A 3QBWA 4RWTA 2PFUA 3DLRA 4PY5A 2BE2A 5GAEP 1BA0A 4I6MA 2UXCK 4RW7A 4H0OA 5AQUA 3QMLA 3HJFA 5BRFA 1ASWA 4CHQA 4CZIA 5CYMA 1NKBA 3O8MA 3QB0A 3J7YP 1SKSA 5BR8K 1NG9A 2O8EB 1T8EA 3CXCM 3OYEA 3EO3A 4KH5A 2QK9A 4WFBL 4A61A 2PYJA 3ENBA 4FK2A 3QFPA 3K5OA 1VRUA 3OS2A 3HVRA 4JKDA 1NGEA 1NKCA 4FK4A 4JLHA 4ID1A 1VSIA 1Z6RA 4WQ4C 4YOTA 4CF8A 2YHAA 5M1FA 2QI2A 4EHTA 3NGIA 3VGMA 3ZSVA 1DGKN 1QSLA 4Z0UA 4BRGA 4CIGA 1TK8A 4WFAL 3IG1A 3CCMN 1S1UA 4DV2K 3QEPA 3CCSN 4EFHA 1KFDA 2Z1GA 3NMUA 4FWNA 4Q5VA 3OYCA 4BG9A 4EP4A 3HBTA 2J4RA 4LY7A 4CEDA 1QTMA 4H5VA 5EX5A 1SKWA 3WXIA 2KFNA 3U9ZA 4Z4GA 4AHSA 3DWLA 1U45A 4BC4A 1TKTA 3VMFB 4JAXA 3JAMO 2I7NA 5C2FA 4Z4HA 3AA4A 2R7YA 5HL7L 3THXA 1OH6A 2PAVA 5EXWA 5HLFA 4CJKA 3K5MA 3OYJA 3DLHA 1LW0A 1ZBIA 2X6SA 3C7NA 3LZIA 2D0OA 2BGGA 4JI6K 1JLFA 3MDQA 1CZ9A 2F9TA 3E01A 4PHTX 3I33A 3THYB 5AQYA 2A1RA 5KQ8A 3C94A 3PX0A 3DXKB 5HBMA 1BGXT 4H5NA 2KZZA 2QEXN 3M8RA 1BUPA 5AQFA 2GWKA 3P31A 1OH8A 5C25A 5LJVA 4CJ3A 2Q0RA 3QIPA 4DF4A 4NYFA 3VGLA 1BISA 4KHPK 3IDHA 5AQKA 5FPMA 3T69A 5HRNA 1CXUA 2LSNA 3VENA 2ZQBA 3VEYA 2NRZA 2ZJPL 4BRKA 3OJUA 5LMUK 4FJXA 2CGJA 4WQ5C 1TKDA 1TGOA 2QWLA 5EOYA 3OYGA 2WOMA 3QNOA 2P9KB 3TAMA 4DTUA 4IFEA 4DTRA 1QQCA 1IG8A 3VQCA 2NRTA 1TAQA 1C0GA 2P9KA 3VQPA 3AAPA 3DXMA 3OS1A 4AHUA 3AO2A 3AA3A 2YKMA 5KGWA 3DLGA 4FWKA 3KK7A 5M1OA 3V9SA 3L2QA 1VRTA 3TSPA 3RR7A 4I2PA 2VWJA 1VHXA 3OJSA 4BQZA 3DAWA 4AF1A 2HHSA 3DLEA 3HM9A 1NM1A 3OYAA 4IFYA 2QM1A 3F5TA 4M3UA 2KW4A 3HPHA 1RT1A 4DFKA 4A62A 5AZIA 4CGGA 4ISFA 4DV4K 4FLXA 4CD3A 1HKBA 1NK7A 1VSJA 4IO8A 4I9QA 3HOSA 4JKHA 4KV8A 3EZ5A 1BIUA 1VSDA 4E7HA 5BRHA 4FJ8A 1BU6O 1VAZA 4F8RA 3O80A 1EO1A 3H3OB 3TANA 1FK9A 2GELA 3F73A 4QS7A 2KTQA 1BL3A 1ZC6A 3C6UA 4CHZA 3SYZA 1YITN 3ASMA 2GBZA 1L3TA 3W0LA 4KI6A 4OGEA 3AVHA 2HNDA 1HKGA 4CK2A 3OBYA 3KK3A 3O1WA 2XY7A 1BHLA 1LWCA 2OPPA 2P9LB 1OH7A 3LALA 2NRXA 4X66K 1S1TA 1TUYA 2E1YA 3V1RA 3RWUA 2QXLA 4BDPA 2CH5A 1ZBUA 3KIOA 3DOKA 3EE8A 1IKYA 3VQDA 1YI2N 3HL8A 1VSLA 4FM1A 2ITMA 4F9OA 1XI1A 1C6VA 4N41A 2NZTA 4C1NI 4B9NA 2WTUA 1MU2A 4F4KA 1TYQB 4C23A 1YAGA 1A5XA 4DTPA 5F0XA 2OYQA 2HNYA 3SPZA 3LP0A 3M8SA 5JLFA 1Z25A 2ZWHA 3TSUA 1X3MA 4A5AA 3VA3A 3TPQA 2YX6A 1UA0A 4FLYA 4DQIA 4XH1A 3K0SA 3HK2A 1U2VB 4L3QA 5KPTA 3VF2A 2O8DA 3AAQA 4CGIA 1IBLK 3HYFA 2IC3A 1M90O 3ATVA 4JN4A 3EY1A 3JSMA 5AZJB 3HP6A 2E5LK 2JWLA 1HYZA 1TK5A 3OA9A 1YJNN 3L8BA 4JS4A 2O8DB 3E66A 3KK2A 4UY8O 2D0BA 3VETA 3AO3A 4F3OA 3VERA 3H45C 1YIJN 4C8OA 4CJWA 1MWMA 2YNIA 1NKEA 3ZCMA 4FVUA 1Q7YO 4QCLA 3L2RA 4ELVA 1B9DA 2XHBA 2ZD1A 3CERA 2KKZA 2P9IA 4DB3A 1Q18A 2UUBK 1C1AA 3AY9A 1SV5A 5KQDA 2QW9A 1ATSA 1RDUA 2EHGA 5AQWA 3S41A 3PX6A 3CMEN 4C8KA 4FZYA 2UUAK 4A2AA 4BC3A 1C0FA 2P9SA 1XMOK 1TKZA 1XHXA 1V4SA 1S6QA 4DTMA 3UIQA 4F2RA 1M1KO 4LH4A 4EIAA 5H1SQ 4A57A 3AVMA 4FJKA 1NGHA 5AQZA 4CJVA 1L3SA 5AQQA 4Q0BA 3ZSQA 5GAGP 5E84A 1VQLN 1RDAA 3KKSA 2VQFK 4H5RA 4BGAA 3QFUA 3TAGA 4YOXA 4H5WA 4FLWA 4BGBA 4F2SA 1WUAA 4B1YB 4FJIA 2G8HA 2G8UA 3TSQA 5LL6Z 3TTCA 4BROA 1Z05A 3WT0A 5KPRA 4FWMA 4JK8A 3PO5A 4DSJA 3VF6A 2VCPA 1QZ6A 5DM6L 4YDUC 1WNSA 3LP1A 5AQGA 4FWQA 1HJOA 3ENHA 2V7ZA 4H0VB 3MAQA 5BR9A 1GOBA 4DR5K 4XH4A 3BUZB 3VQ4A 3CMAN 4DTNA 3CG7A 4Z4EA 3I55N 4K43A 1L3VA 3QDKA 2NRWA 3LPUA 4BREA 3VPZA 2IDOA 2BUPA 1RFQA 3N4QA 3DXKA 3VESA 4BC5A 3A5OC 1I39A 4AHRA 2OTJN 4FOIA 1ZBFA 4X64K 4FL9A 4FLZA 3VQ5A 4FJ9A 4LF9K 4ELUA 1IKXA 2E6MA 3NVMA 1T44A 4RW6A 2BANA 4DTJA 4JD2B 2YNFA 1HRHA 4M7YA 1OH5A 2ASPA 4DR4K 1W2BM 1C1BA 5I9EB 3SCXA 4DS4A 2ZJRL 4DF8A 4BRAA 3P38A 1LW2A 1S1XA 5DM7L 3SNNA 4CZHA 4Y0WA 2VGNA 5LMNK 3SZ2A 3P4IA 4DSFA 3AVLA 1RCHA 3CFRA 1WSGA 1HQUA 3GL1A 1T7PA 1ZYQA 3D45A 2I7PA 4B1VA 2VG7A 3TAFA 1JKHA 4HUFA 4IXCA 4CEZA 4CJFA 4CJLA 4B3TK 1KC8O 3OBWA 5AQPA 4O8KA 2DY4A 3H08A 3OYNA 3HO1A 3CD6N 3TTFA 3I56N 3WNEA 3WXLA 1U49A 5AQIA 1K8AO 1J5EK 4OO1J 4MLEA 1W0HA 2G8VA 4M45A 4PL7A 4LF6K 5AQOA 2GEMA 3U8XA 4IDKA 2Z1HA 2GTDA 3PIPL 4DR2K 5JVGL 2HMPA 3FZMA 1VQ7N 2QWPA 2E88A 1G15A 5ADXH 3KWGA 3WQUA 4CHYA 2Q97A 1WAFA 4FO0A 1NJIO 3NF7A 4CFCA 3VQ6A 2P51A 3IRXA 4J2EA 1WSJA 3KD1E 4IO9L 1W97L 3A0IX 4PKHA 2GUPA 3U6FA 1BIZA 3VQBA 3K58A 2XY6A 3LAMA 1IKWA 3K9JA 4YHHK 2KLAA 1Q82O 3A2FA 1OVQA 4ICLA 2BDPA 3NBPA 2Z1IA 3EL2A 4OLAA 3CM5A 3HZ6A 3FR0A 2ATQA 4YORA 4E7LA 1RT4A 3ALYA 3BF1A 4O55A 1RILA 5CYQA 3P83D 1EKEA 4C8LA 3LWMA 1Y97A 4W5QA 1JLCA 1JLBA 2P9PA 1Q9YA 4CF0A 1S3XA 2HBKA 1NK0A 1DT9A 4BR4A 4LF7K 2HHTA 4M7XA 3NH1A 4DTSA 2ZGZA 3V9UA 4N56A 4H0XB 1HLUA 3NAEA 4R5PA 4FPBA 3AA5X 4B3MK 2NRRA 2OPQA 4JK7A 2DTUA 4CERA 1VQ5N 4LSNA 4DQRA 4JKGA 3O3FA 3NHGA 4Z4IA 5AR0A 4DR6K 5M1NA 4E1MA 2KZMA 1KTQA 5EVZA 4U67L 4JKGB 2RHKA 1U4BA 4DV0K 1CLQA 3GDQA 5J2QA 1L3UA 3BZCA 3LZJA 4CF1A 2E2NA 4FZZA 1HYVA 3LM2A 1JCGA 4BDZA 2A41A 5KRTA 3VGKA 1VQ8N 1K73O 3JXUA 4CEQA 1R0AA 4OVLA 4H0PA 2IIRA 3J81O 4LFCK 3B8AX 3TTDA 3VEWA 3JS6A 5TKYA 3AVCA 1KXPA 1SAZA 1ASUA 4KAZA 2A5XA 2Q3SA 4CJTA 2KQ2A 2EWSA 1WSIA 3WNFA 2IVOA 2X6NA 1EETA 2ZGYA 4QAGA 2GWJA 1JXEA 2JWKA 3MX2A 1QSSA 1V4TA 4HUEA 2QWNA 2FBVA 4N47A 1NWKA 5EU7A 3S3OA 4RW4A 2EX3A 4A59A 2XO7A 3FE1A 4C8MA 3MX5A 1TYQA 3ZX0A 1ASVA 3EZWA 4KREA 4BRCA 3DOLA 4BWJA 3VEZA 4FWSA 3MXMA 4NCAA 2W40A 4CJEA 1IBMK 2HHQA 1EWQA 1NOZA 1HX1A 4KFBA 2AJQA 4CZMA 5C0YA 3MN7A 4CZFA 4Z4CA 1E4FT 1QHTA 4RW9A 4J2BA 4B1XB 4E89A 3QO9A 4BE1A 5FDLA 4CZLA 5ELZA 1S1WA 3VEOA 4E7JA 1RTJA 2YNGA 1N32K 1Q9XA 4H5TA 4BVPA 4CIEA 5JVHL 4OPJA 4JHDA 3SAGA 1IBKK 4OPHA 1HNWK 2KHOA 5CZ2A 4A2BA 2F4VK 3NE6A 3SUQA 2HOEA 4HHTA 1N5YA 4ZHRA 3KD5E 1T03A 3D0PA 1IO2A 4B1ZA 4HUGA 1U47A 2D5RA 4K0KK 1KCFA 2E1ZA 1JLGA 1JL1A 1RBTA 1TL1A 3NH0A 2WC9A 5MLCQ 4FM0A 1NK6A 3NF8A 2FC0A 1QE1A 3SAHA 2P5OA 3UKRB 4CE9A 2G8KA 4RG8A 5GAHP 4PKGA 2E2PA 4H4OA 4OKEA 3CCLN 2UYTA 1VQNN 3CCUN 2E8AA 4FJ7A 3T1HK 3LANA 2FBXA 3MCPA 5AQTA 1NJZA 3F9MA 3KVGA 3CYMA 4DG1A 5JS2A 3CJCA 5IT9O 2FXUA 1VQKN 4CBWA 5GIPA 1KVBA 2YHWA 3DRPA 4IKFA 1RT5A 4FM2A 2QWRA 3ZSYA 3UKUB 4JKBA 4CESA 3VOVA 1WLJA 1VQON 3PO4A 4CK1A 2RKIA 5CZ1A 3THXB 3RSEA 3FGUA 4B3RK 3PSIA 2UUCK 1OVYA 4MO4A 3TR8A 5AFUH 3M5RA 2DPNA 3KLGA 2P9IB 5M1KA 4BC2A 3GG4A 1I94K 3DRSA 4O8UA 4YOUA 3L4QA 1QSYA 1SL0A 1GLFO 2O4GA 3LP2A 3SJJA 1O1WA 3V9WA 4KRFA 1J5OA 3AARA 4FVMA 3CFOA 1E4GT 5DMRA 2PYLA 3OVNA 4NXMK 2D4WA 1X1PA 1XQSC 1XNQK 1EWRA 1T3VA 1XC3A 2HB5A 3IUCA 3O5BA 3ZEUB 2OZSA 3HSTB 2P9UA 4DU3A 4XH5A 3NF6A 1WOQA 2OPRA 5J2NA 3TAQA 3FFKB 1O13A 2V52B 3QNNA 1JCFA 5C24A 3MEDA 3MMVA 4E7IA 3VQ9A 5JS1A 2JLEA 4GNIA 3O3HA 2VG6A 4JKFA 4CF2A 4DTXA 4DFMA 3ULEB 3QERA 3SBGA 3RR8A 4BR9A 3OYKA 4DR1K 2HMIA 4BG8A 1KD1O 3E9LA 5F1XA 4DTOA 4GV9A 3TARA 5IWAK 4ILJA 3O08A 4LFBK 1P90A 3FLCO 2FSJA 4IZ9A 5T7BA 1MA9B 3C7NB 4JI8K 3GE1A 2VGMA 1BOTO 1N36K 3O4WA 1WN7A 1L5UA 1ZBSA 1WSEA 4MQ3A 4YY3K 3OYLA 4WE1A 3LAKA 3E9PA 3THWB 2VWKA 3AVJA 3HPGA 1S5JA 1S9EA 3K59A 4BWMA 2X74A 2WUSA 3O9UA 1HUXA 2Q0UA 4LF8K 4IEIA 1B92A 4B1UB 4U7BA 4CJSA 3CJ9A 5C42A 3K2PA 4B9TA 2E4LA 1BI4B 3HXMA 4E0DA 4E19A 3ENOA 4ZTFA 2RF2A 4N5SA 4KI4A 3NH2A 3ZT3A 3SQ1A 3QESA 3G6EN 4JS5A 3SUOA 2QWQA 3LDOA 3CJ7A 3CC2N 1ESVA 4GW6A 1YHQN 4JI2K 3DJCA 4B08A 3WEEA 4CGJA 5D3GA 2HF4A 3SJHA 1WB9A 4AILC 5ADXA 1XUPO 4JI4K 3V81A 1WBDA 4JK9A 4DV7K 1VSMA 1VSKA 2IVPA 3CHWA 2P9PB 3VA0A 2O4IA 1NGBA 5BPMA 3A5MC 4DU1A 3C6TA 3CCQN 1NMNA 4WQ5A 4B9LA 4F3TA 5AQMA 5B8HA 4CFBA 3O9QA 2FF6A 1KVCA 3Q7BA 4ILHA 4FLUA 2A40A 4BVOA 1S72N 4FWRA 4YDUA 3CF5L 3HSCA 4YOVA 4I2QA 1RTIA 4I9LA 4DWIA 4K25A 4OGCA 1RT6A 3MXJA 2QWMA 1YUWA 4L8RB 2GV9A 2E20A 3OYBA 1YXQA 1YVNA 4AHVA 1XHZA 5LY3A 3L2VA 4DLGA 2Y1IA 1NU0A 1JCEA 4IG0A 1SL1A 4FW1A 5AQSA 3K5LA 3VQ8A 3KLHA 1N8RO 1X9JA 3I0SA 5AFUA 1UA1A 3ITHA 3AVKA 5AJ3K 3R6MA 4DS5A 3OYIA 2HHVA 3MK6A 3VEXA 4BE0A 3DLLL 1E3MA 4BDYA 1VQ9N 3CCVN 1UWBA 4CHNA 2O8FB 4RTFD 4CJ7A 4NLCA 4CHPA 4G9ZA 4FPAA 3OS0A 3FZHA 5AQJA 4DFJA 4FJGA 1F21A 3CCRN 3TAPA 4ISEA 3ZSXA 1YJ9N 1RBRA 3MN5A 3P1GA 4C1NK 2YKNA 4JKEA 1U2VA 1NK5A 1S9GA 3FFIA 4H03B 3MCAB 3S9HA 5GINA 2OZMA 4WFNL 3RRHA 3Q7CA 2F9WA 4CJ4A 3T3FA 3TU5A 4AH9A 3D2EA 3LDLA 4JI1K 4DV3K 1ZXOA 4WF9L 3DMJA 4W5TA 3M3ZA 1RDDA 3UKUA 3NCIA 4NXNK 5J2PA 1NGGA 1UAXA 3V6DA 1Q81O 3EN9A 3BEXA 4JRPA 2VWBA 4KHQA 1C0UA 4KHNA 1D8YA 2B5JA 2G8WA 1T6CA 2WONA 2F7TA 5HP1A 1SQKA 1K8KA 3G10A 4JI0K 4JI3K 3L0QA 1KRPA 4FWLA 3KHYA 5BN8A 4JYAK 3HI0A 4M3RA 3U3YA 1EX4A 4JKAA 3KLEA 1JL2A 3OYHA 3SK3A 1NBWA 4DV6K 5AQXA 4CI6A 4FW2A 1TKXA 3QINA 3G0ZA 3DYAA 2OCEA 3FZFA 3RMCA 4B8AB 4CFAA 2JGUA 2O8EA 2OPSA 3ULEA 4BQLA 2V51B 1W7AA 2ZF5O 4E7KA 4J8FA 1IKVA 4IJAA 4CEBA 5JLHA 5KTQA 2YHBA 1GOCA 2O8CA 4FYDA 1KVAA 3H6EA 4DSIA 1QQOA 4CW7B 4LF5K 3T19A 4EP5A 3F9KA 2F8SA 1GLJO 1SKRA 2QKBA 3E9OA 2A42A 4HTUA 5FPEA 2A3ZA 4M41A 3OYMA 2ZM6K 4N76A 1YF5L 3QICA 3ZT2A 4IDHA 4B9MA 3IAYA 4EZ9A 4OX9K
chains in the Genus database with same CATH topology
5C15A 3BP8A 1MDUB 1DEJA 4B1ZA 5BRHA 4QS9A 4DHYA 1LOTB 2YJFA 3N4PA 3HRGA 2E1ZA 5CHIA 2HBMA 1BU6O 1VAZA 1EO1A 3O80A 2A6AA 3H3OB 3C6HA 2WC9A 5MLCQ 5C2DA 2GELA 1QQNA 1IJJA 4QS7A 3SAHA 4IOXA 3UKRB 1ZC6A 5GAHP 1ILYA 4PKGA 3PLAA 2P9NA 1YITN 2E2PA 2YI1A 3WXKA 3W0LA 3LDNA 3CCLN 2UYTA 1VQNN 3CCUN 1HKGA 2E8AA 2OANA 3OBYA 3O1WA 2CH6A 4IOAL 2P9LB 4R79A 4AM6A 2QWOA 4M63C 2VYPA 4BRMA 1VQMN 3MCPA 3QBXA 3CJBA 5AQTA 5FPNA 5GIOA 3PIOL 2NRXA 3F9MA 2E1YA 1TUYA 3KVGA 5AQNA 3VTHA 3FZLA 3A5LC 3LDPA 2QXLA 2CH5A 4K42A 1HPMA 3MWPA 5JICA 3SBTA 3CJCA 1KAXA 5AQRA 2FXUA 4DQ8A 4CBWA 1SZ2A 5GIPA 5GADP 1VQKN 3EE8A 1GLEG 3AGKA 1GLAG 2YHWA 1ATRA 4YOWA 1YI2N 2QWRA 3UKUB 2ITMA 4JKBA 4F9OA 5BRDA 3VOVA 2NZTA 1U6ZA 4C1NI 1VQON 4KH4A 1K9MO 2ASMA 4NO7A 1TYQB 4FOEA 1MWKA 3RSEA 3E1YA 1YAGA 3FGUA 3A5NC 4C23A 1GLLO 1T6DA 3ZX3A 5F0XA 1OVYA 1QQMA 4MO4A 3UE5A 3O9SA 5E26A 5AFUH 3M5RA 5JLFA 2DPNA 2ZWHA 3TSUA 1X3MA 2P9IB 4A5AA 5M1KA 4BC2A 1VQ6N 3TPQA 3M6GA 2YX6A 3GG4A 3HOTA 4O8UA 1ATNA 1RGIA 4JEPA 4YOUA 4XH1A 3LM9A 4BRQA 4BRPA 1U2VB 3L4QA 4L3QA 5KPTA 3VF2A 1GLFO 1NGAA 3AAQA 4CZJA 5BPLA 3P39A 1M90O 3ATVA 4JN4A 3VF4A 3AARA 5AZJB 4BRIA 2JWLA 1E4GT 1J6ZA 5LJWA 3OA9A 1YJNN 2D4WA 3E66A 4B1WB 4FWPA 4CZGA 3G4SN 1XQSC 3AGRA 4UY8O 3VETA 4FWOA 3VERA 3H45C 3WEEB 5AQVA 1YIJN 4GV6A 1GLDG 1T3VA 1XC3A 4GVEA 3W3DA 1MWMA 3IUCA 3A8YA 3IKMA 3O5BA 3ZEUB 2P9UA 3SAFA 4XH5A 1Q7YO 4FVUA 1WOQA 1G99A 3WXMB 1K8AO 3CERA 3J7ZO 2KKZA 3FFKB 1O13A 3GBTA 2P9IA 2V52B 4DB3A 1JCFA 5F2RA 1Q18A 4MLHA 3AY9A 4BRDA 5KQDA 4WQ4A 3MMVA 2QW9A 1ATSA 1RDUA 4GNIA 4JKFA 5AQWA 3S41A 3CMEN 4YOYA 4JHDB 4K41A 1BA1A 5CR4A 4IJNA 4A2AA 5AZJA 3ULEB 4BC3A 3CI5A 4KH6A 3OW2M 1C0FA 2P9SA 3SBGA 1NMDA 4BRLA 1HKCA 4BR9A 1V4SA 3D7EO 4IWVA 1R59O 1KAYA 4BG8A 4BR2A 1KD1O 3E9LA 3L6QA 3SMSA 5F1XA 4GV9A 5HOOA 3O9RA 1M1KO 3SLCA 1QVGM 4ILJA 3O08A 4PKIA 3CJAA 1BDGA 4EIAA 5H1SQ 1NGDA 1JJ2M 4A57A 5GAGP 2YHXA 1P90A 3MN6A 3I8BA 3FLCO 2FSJA 1NGHA 4IZ9A 4O5FA 5AQZA 3G71N 5AQQA 1MA9B 2NLXA 3C7NB 3CIPA 3J8AA 1NGIA 2VGMA 2BTFA 3GE1A 4IEEA 5E84A 2GX9A 1BOTO 3UB5A 3UKRA 1VQLN 4H5RA 4BGAA 3ZX2A 3O4WA 3QFUA 3LDQA 1CZAN 2Q1NA 3R1XA 4NB4A 4H5WA 1ZBSA 3ZETA 4YOXA 2QA4N 4BGBA 3T7ZA 2W41A 1WUAA 4B1YB 3E9PA 4MDBA 3H3NO 3TSQA 1K8KB 4E1JA 4IOCL 3TTCA 2NRVA 3H1QA 1P8ZA 3VTIA 5KPZA 3VEVA 2YJEA 4KBOA 4BROA 2BH1A 2WUSA 1Z05A 3CJ1A 3WT0A 5KPRA 4FWMA 3O9UA 3WXJA 1EQYA 1HUXA 4JK8A 3CPEA 3VF6A 2VCPA 2Q0UA 3SMPA 3WQTA 1NGJA 2Q31A 1QZ6A 4IEIA 5DM6L 4YDUC 4B1UB 5AQGA 4U7BA 5C10A 4FWQA 3CJ9A 1HJOA 3ENHA 5BREA 2V7ZA 3BF3A 4BRNA 4H0VB 3D6RA 5TKWA 5BR9A 4XH4A 3ENOA 3BUZB 2FLOA 4MO5A 4NLBA 3CMAN 5AQLA 3C0BA 4JNEA 3ZETB 4QS8A 3I55N 2HBJA 2P9NB 4K43A 3QDKA 3D2EB 2NRWA 5FPDA 1GLCG 4BREA 3VPZA 1D4XA 3D2FB 2BUPA 4BRHA 1RFQA 4WCEL 5BPNA 3G6EN 1YJWN 3N4QA 3DXKA 3U4LA 2QWQA 3LDOA 2HBLA 3CJ7A 4FSVA 4DKWA 1ESVA 5C12A 3VESA 3CC2N 4BC5A 3A5OC 1YHQN 1Y64A 1BO5O 2NNWA 4MDAA 3DJCA 3G25A 3D2FA 3WEEA 2OTJN 1RDWX 4FOIA 4ILGB 2NRHA 1X3NA 4FL9A 2HF4A 3SJHA 2OTLN 3NVMA 1XUPO 5ADXA 1T44A 2QTDA 1S22A 1OKJA 4BR5A 3EKSA 4JK9A 1QVFM 3CHWA 2IVPA 4JD2B 4M7YA 2P9PB 1VQ4N 2ASPA 2YHYA 2HSTA 1W2BM 1NGBA 5CE3A 3ID6A 5I9EB 5BPMA 3CQXA 3A5MC 2ZJRL 3CCQN 4BRAA 3P38A 4WQ5A 2P9SB 3ID8A 3R3LA 3ZEUA 5AQMA 2AA4A 5B8HA 5DM7L 4ISGA 5M1PA 3O9QA 2FF6A 5AQHA 4CZHA 4Y0WA 4EHUA 1NGCA 2VGNA 3Q7BA 4ILHA 3CCEN 2FSNA 3NVKA 2A40A 3P4IA 4BVOA 1S72N 3R8EA 2D0PA 4FWRA 1LCUA 2FF3B 2P9LA 4GY2B 4YDUA 4BRFA 3CF5L 3HSCA 3GL1A 5BN9A 2I7PA 4YOVA 4B1VA 3CQYA 3O9TA 4K25A 1GLBG 4IXCA 4WYBA 3EE9A 2QWMA 1YUWA 1KC8O 3OBWA 2E20A 3QBWA 4RWTA 2PFUA 5AQPA 4O8KA 3EKUA 1YXQA 1YVNA 5GAEP 1BA0A 5LY3A 4I6MA 1JCEA 2ASOA 3CD6N 5AQSA 3TTFA 3WXLA 4EAHD 3I56N 4H0OA 5AQIA 1NLVA 5AQUA 5AZIB 3C6AA 3QMLA 4MLEA 4OO1J 5BRFA 4PL7A 4CZIA 5AQOA 3U9DA 2GEMA 3U8XA 1KAZA 1QZ5A 3O8MA 3QB0A 3H1VX 1N8RO 1H1VA 2CGKA 1X9JA 2GTDA 3PIPL 5JVGL 2E2OA 5AFUA 3LL3A 2HMPA 3FZMA 1VQ7N 2QWPA 2E88A 3CXCM 5ADXH 3O1BA 3KWGA 3WQUA 3EO3A 4KH5A 2Q97A 4H0TB 4CBUA 3R6MA 4FO0A 4Z94A 4A61A 4WFBL 1NJIO 3ENBA 3QFPA 2FSKA 4LC9B 3MK6A 3VEXA 2WFBA 3IMXA 3DLLL 4IO9L 1W97L 3A0IX 3CCJN 4PKHA 2GUPA 3CC4N 4JKDA 1VQ9N 1NGEA 3CCVN 3K9JA 2KLAA 1Q82O 4RTFD 1Z6RA 2HF3A 4WQ4C 4YOTA 4CJ7A 4NLCA 4BY9C 5M1FA 2QI2A 4G9ZA 4EHTA 4HTLA 4FPAA 3EL2A 3RSEB 3VGMA 1DGKN 4AM7A 4BRGA 1KQSM 3FZHA 3HZ6A 5AQJA 3FR0A 4WFAL 4BR7A 4YORA 3CCMN 5JMVA 3CCRN 3BF1A 3CCSN 4EFHA 4ISEA 3MN9A 4A5BA 4FWNA 4RCHA 1YJ9N 3MN5A 3NMUA 4C1NK 4BG9A 3HBTA 2D1KA 3M1FA 2J4RA 2P9PA 4GV3A 4JKEA 1U2VA 4H5VA 5EX5A 1S3XA 3CC7N 4DCHA 2HBKA 4H03B 3MCAB 3WXIA 1DT9A 5GINA 3U9ZA 4BR4A 4WFNL 3DWLA 4BC4A 3Q7CA 2F9WA 3VMFB 4M7XA 4JAXA 2ZGZA 2Q2RA 4H0XB 3TU5A 1HLUA 3D2EA 3LDLA 2I7NA 5C2FA 4FPBA 1ZXOA 4WF9L 4CZEA 2NRRA 4JK7A 3M3ZA 5HL7L 3K9KA 3IFRA 1TUUA 3UKUA 1VQ5N 4JKGA 2PAVA 4CZKA 5AR0A 1NGGA 3ATUA 4H0YB 5EXWA 5M1NA 1VQPN 1Q81O 3EN9A 2WBNA 3BEXA 5EVZA 4U67L 2VWBA 3C7NA 2D0OA 4JKGB 2RHKA 3MDQA 3RVCA 2F9TA 3GDQA 5EY4A 4PHTX 2YCHA 3I33A 3CETA 2E2NA 2IVNA 5AQYA 1BWFO 1T6CA 3LM2A 4XEIA 1JCGA 5KQ8A 2F7TA 3DXKB 4I6MB 1NGFA 2A41A 4JD2A 3VGKA 1VQ8N 1K73O 1SQKA 3JXUA 1K8KA 4H5NA 2QEXN 4H0PA 1BUPA 2IIRA 3L0QA 5AQFA 2GWKA 3P31A 3B8AX 3TTDA 4CD1A 3HTVA 4FWLA 3JS6A 3VEWA 5LJVA 3KHYA 5TKYA 3O6WA 1KXPA 3KWIA 1SAZA 2Q0RA 5BN8A 3VGLA 4OPAA 3HI0A 1QHAA 2A5XA 3IDHA 3WUHA 5AQKA 4JKCA 4PL8A 5FPMA 3T69A 1DKGD 2EWSA 4JKAA 3VENA 2H3GX 5M1QA 2IVOA 3VEYA 1BG3A 2NRZA 2ZJPL 3SK3A 1NBWA 4BRKA 2E2QA 3GOIA 2AP1A 5AQXA 2ZGYA 1Q86O 3L4IA 2CGJA 2CGLA 2GWJA 4WQ5C 4CI6A 3HM8A 2JWKA 2QWLA 5EOYA 3MX2A 3ZYYX 1V4TA 2P9KB 2QWNA 4IFEA 1NWKA 3FZFA 4A59A 3C65A 1IG8A 3FE1A 2NRTA 3ULEA 1C0GA 2P9KA 4BQLA 2Q36A 2V51B 3MX5A 2ZF5O 3FZKA 3F2KA 1TYQA 3AAPA 3ZX0A 3DXMA 4J8FA 3EZWA 4IJAA 5JLHA 4BRCA 4FWKA 3KK7A 5M1OA 4FWSA 4HWIA 3TSPA 2W40A 3VEZA 3H6EA 4B9QA 1QQOA 3CPWM 4BQZA 3DAWA 3H46O 3MWTA 4AF1A 2RE2A 1HX1A 2P9UB 1GLJO 4CZMA 2V7YA 5C0YA 1NM1A 3MN7A 4CZFA 1E4FT 3E9OA 3KZBA 4B1XB 2ZJQL 2QM1A 3F5TA 4CZLA 2A42A 5ELZA 3VEOA 1SS6A 4A62A 5AZIA 5FPEA 4ISFA 4BR0A 2PBDA 4H5TA 2A3ZA 3OHRA 4BVPA 5JVHL 4CD3A 4JHDA 4CBXA 3R9PA 1HKBA 4OPHA 3SAGA 2KHOA 4A2BA 1YF5L 3QICA 4IO8A 4IDHA 3DXMB 3HOSA 2HOEA 4JKHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZJR L;  4WF9 L;  3CCQ N;  5HL7 L;  3CME N;  1VQ5 N;  5DM7 L;  1VQP N;  3CCE N;  3OW2 M;  1Q81 O;  1S72 N;  5MLC Q;  4U67 L;  3CF5 L;  1KD1 O;  5GAH P;  1ILY A;  1M1K O;  1QVG M;  1YIT N;  5H1S Q;  1JJ2 M;  3CCL N;  1KC8 O;  1VQN N;  1VQ8 N;  3CCU N;  1K73 O;  2QEX N;  3G71 N;  5GAE P;  4IOA L;  5GAG P;  1VQL N;  1VQM N;  3CD6 N;  3I56 N;  1K8A O;  3PIO L;  2QA4 N;  1N8R O;  4IOC L;  3PIP L;  5JVG L;  1VQ7 N;  5GAD P;  1VQK N;  2ZJP L;  3CXC M;  1YI2 N;  1Q86 O;  4WFB L;  1NJI O;  1VQO N;  1K9M O;  5DM6 L;  3DLL L;  4IO9 L;  3CCJ N;  3CC4 N;  1VQ9 N;  1OVY A;  3CCV N;  3CMA N;  3I55 N;  1VQ6 N;  1Q82 O;  4WCE L;  3G6E N;  3CPW M;  1YJW N;  3CC2 N;  1KQS M;  1M90 O;  1YHQ N;  4WFA L;  3CCM N;  2OTJ N;  2ZJQ L;  3CCR N;  3CCS N;  1YJN N;  3G4S N;  1YJ9 N;  4UY8 O;  1YIJ N;  2OTL N;  3CC7 N;  5JVH L;  1Q7Y O;  1QVF M;  4WFN L;  3J7Z O;  1VQ4 N;  1W2B M; 
#chains in the Genus database with same CATH topology
 4CEE A;  1MDU B;  4K8X A;  4QS9 A;  4ELT A;  2HBM A;  3MXI A;  3C6H A;  5C2D A;  3HP9 A;  1QQN A;  1IJJ A;  4IOX A;  2W6K A;  4KHY A;  1S6P A;  4CFD A;  1BQM A;  5FRO A;  4DQQ A;  2YI1 A;  4FJM A;  1HJR A;  2G8F A;  4IOA L;  4R79 A;  4AM6 A;  2QWO A;  4M63 C;  1XWL A;  4BRM A;  4LF4 K;  3CJB A;  3M8P A;  5FPN A;  5E41 A;  3VTH A;  1C0M A;  3FZL A;  3A5L C;  3LDP A;  1IG9 A;  4FLT A;  4K42 A;  3V9Z A;  5JIC A;  4H4M A;  4DQ8 A;  1SZ2 A;  4OLB A;  3THW A;  4B9V A;  1GLA G;  5HRR A;  1ATR A;  1JLQ A;  1U6Z A;  1RT3 A;  4KH4 A;  1K9M O;  2ASM A;  4NO7 A;  1RT7 A;  1MWK A;  3OTO K;  3E1Y A;  1KFS A;  1GLL O;  3ZX3 A;  1SL2 A;  1Z26 A;  1JXB A;  4IFV A;  3O9S A;  5E26 A;  3QIO A;  3VN5 A;  1VQ6 N;  3CM6 A;  3HOT A;  1ATN A;  4OJR A;  3HVT A;  4B3S K;  1RGI A;  2P1J A;  3LM9 A;  4BRP A;  4CGD A;  1NGA A;  4CZJ A;  4QOZ B;  3ZT4 A;  4DR7 K;  4BRI A;  5HRO A;  4DSK A;  4CZG A;  3G4S N;  3AGR A;  4LFA K;  3VQQ A;  4FWO A;  4KB0 A;  3WEE B;  5AQV A;  4GV6 A;  4O5B A;  4Y1D A;  1CXQ A;  1N6Q A;  3QEI A;  4EZ6 A;  3J7Z O;  4E1N A;  1VSH A;  3GBT A;  5F2R A;  4K8Z A;  2RPI A;  4X65 K;  3K57 A;  1REV A;  3AVG A;  4WQ4 A;  2I5J A;  3QLH A;  3THY A;  1A5W A;  2IOC A;  4K41 A;  1BA1 A;  5CR4 A;  3CI5 A;  2IGI A;  1NMD A;  4FJ5 A;  1X9W A;  3D7E O;  4IWV A;  1R59 O;  3QEV A;  4BR2 A;  3L6Q A;  1TVR A;  5HOO A;  3LPT A;  1FKO A;  3O9R A;  3CJA A;  4J2A A;  1JJ2 M;  2YHX A;  3MN6 A;  2HHH K;  3V9X A;  3ZSW A;  1WSF A;  2NLX A;  3CIP A;  3J8A A;  3UB5 A;  1NGI A;  1NK8 A;  3TAE A;  3ZX2 A;  1HNX K;  2HNZ A;  3R1X A;  4NB4 A;  4FLV A;  3O4N A;  2QA4 N;  3T7Z A;  2W41 A;  4H8K A;  1U48 A;  5A2Q O;  4MDB A;  3H3N O;  3L3U A;  3RRG A;  1GOA A;  4PWD A;  1P8Z A;  3VTI A;  5KPZ A;  2YJE A;  4PA1 A;  4FK0 A;  2O8B A;  3AVA A;  1EQY A;  1LWF A;  2YNH A;  3CPE A;  3CFP A;  1YVU A;  3SMP A;  1LAV A;  4G1Q A;  3AO5 A;  2Q31 A;  5FLX O;  4CJU A;  1D9F A;  5BRE A;  2NUB A;  3BF3 A;  4BRN A;  2DFH A;  3D6R A;  1XNR K;  1NNE A;  2FLO A;  4NLB A;  1RBU A;  5AQL A;  3BGR A;  4JNE A;  3ZET B;  4ZTJ A;  4QS8 A;  4J2D A;  2HBJ A;  2P9N B;  1GLC G;  3SI6 A;  4HVJ A;  1D4X A;  3D2F B;  1YJW N;  2HBL A;  4DKW A;  4FSV A;  3M8Q A;  2OA8 A;  1BO5 O;  2NNW A;  4MDA A;  3D2F A;  2DFF A;  2UXB K;  2NRH A;  1X3N A;  3NGY A;  1J53 A;  4CJQ A;  4GMJ B;  4KKO A;  1TAU A;  1QS4 A;  4BR5 A;  4CGH A;  3EKS A;  1QVF M;  3ZSO A;  1VQ4 N;  3AV9 A;  1VSF A;  4FJN A;  3AVF A;  5CE3 A;  1TL3 A;  3PSF A;  4FJH A;  3WNG A;  4FJL A;  3ID8 A;  4PQU A;  4ISG A;  5M1P A;  1RBV A;  1NGC A;  3NVK A;  3CCE N;  2FSN A;  3J7A P;  2D0P A;  2FF3 B;  2P9L A;  4GY2 B;  4BRF A;  4NYN A;  3RMB A;  3O9T A;  3KKR A;  1X9M A;  5I3U A;  1GLB G;  4CEA A;  4WYB A;  3EKU A;  3ZSZ A;  3EYZ A;  2Z1J A;  2Y1J A;  5SWM A;  2ASO A;  1K6Y A;  4EAH D;  5AZI B;  1NLV A;  3C6A A;  2O8F A;  5KGX A;  4MFB A;  5FRM A;  2D0A A;  3U9D A;  1KAZ A;  1QZ5 A;  1LWE A;  3H1V X;  5KRS A;  1H1V A;  2CGK A;  1YTU A;  2E2O A;  3LL3 A;  3RMA A;  3KK1 A;  4YNQ A;  3KLF A;  3NDK A;  3O1B A;  4PUO A;  4CBU A;  4H0T B;  4DUY K;  4Z94 A;  3IS9 A;  2FSK A;  4LC9 B;  2WFB A;  3IMX A;  1BCM A;  3WNH A;  2ITG A;  3CCJ N;  2DFE A;  3CC4 N;  3RMD A;  1HMV A;  4CEC A;  3MEG A;  1HNI A;  1LAW A;  2G8I A;  2HF3 A;  4DU4 A;  4O0J A;  4BY9 C;  3MEC A;  4HTL A;  2PY5 A;  3RSE B;  1A5V A;  2W42 A;  4AM7 A;  1KQS M;  4DR3 K;  2O8C B;  4BR7 A;  5JMV A;  3MN9 A;  4A5B A;  4RCH A;  4NCB A;  1IH7 A;  2D1K A;  3M1F A;  4YFU A;  5HRS A;  4GV3 A;  3CC7 N;  4DCH A;  3RTV A;  1VSE A;  3O4Q A;  3MEE A;  1FW6 A;  3CQ8 A;  5J1E A;  3VQ7 A;  2Q2R A;  3SQ0 A;  2HVH A;  3NF9 A;  4DMN A;  4CF9 A;  4CZE A;  3K9K A;  5DK5 A;  3IFR A;  1TUU A;  4O44 A;  4CZK A;  1VQP N;  3ATU A;  4H0Y B;  1RNH A;  3EEQ A;  2WBN A;  1RBS A;  4CJ5 A;  3K5N A;  3T1Y K;  3RVC A;  2E6L A;  5EY4 A;  1S1V A;  2YCH A;  3OY9 A;  3AO1 A;  2HW3 A;  3CET A;  2IVN A;  1BWF O;  4XEI A;  3AA2 A;  3SPY A;  4I6M B;  1NGF A;  1SUQ A;  4B9U A;  3S3M A;  4JD2 A;  4BE2 A;  1NJY A;  1NOY A;  4FXD A;  4UQG A;  2YV0 X;  1IV0 A;  3J80 O;  4CD1 A;  3HTV A;  3QEW A;  1HQE A;  3O6W A;  3KWI A;  3VQA A;  1Q8I A;  3PV8 A;  3PX4 A;  3DI6 A;  4OPA A;  4DQP A;  1QHA A;  2A1S A;  3ISN C;  2FBT A;  2QXF A;  2XY8 A;  3WUH A;  2HHW A;  2FBY A;  4JKC A;  4PL8 A;  1DKG D;  3BZK A;  3NGZ A;  5J2M A;  2H3G X;  3P5J A;  5M1Q A;  4CJR A;  1BG3 A;  3HT3 A;  5HRP A;  4KO0 A;  3DLK A;  2E2Q A;  3LWL A;  3GOI A;  3PUF A;  2AP1 A;  3I8D A;  1B9F A;  3KLI A;  1Q86 O;  3L4I A;  2CGL A;  3U3G A;  3HM8 A;  3ZYY X;  1TK0 A;  3AVI A;  2KFZ A;  5SZT A;  4V19 S;  4KHU A;  3C65 A;  3OYD A;  4FJJ A;  1KLN A;  1UOC A;  2Q36 A;  4DSE A;  2HHU A;  4CGF A;  3FZK A;  3F2K A;  4M3T A;  3SQ2 A;  2XRI A;  4B9Q A;  4HWI A;  4HCC A;  1U04 A;  3CPW M;  3H46 O;  1N33 K;  3MWT A;  2RE2 A;  2P9U B;  4DUZ K;  3DRR A;  2V7Y A;  1ZBH A;  3KZB A;  2ZJQ L;  2ETJ A;  1SS6 A;  3THV A;  4BR0 A;  3KJV A;  1YTA A;  2PBD A;  3OHR A;  4CBX A;  3R9P A;  3B6O A;  3ZT0 A;  1DTT A;  3DXM B;  4CEO A;  4IBN A;  2UU9 K;  5C15 A;  2XY5 A;  1RTD A;  2O8B B;  3BP8 A;  1DEJ A;  3SV3 A;  1WSH A;  3NFA A;  4W5R A;  4DHY A;  1LOT B;  2YJF A;  3N4P A;  3HRG A;  1WAJ A;  2D0C A;  5CHI A;  1BQN A;  4RW8 A;  2A6A A;  2PZS A;  1I3A A;  3ZLJ A;  1ILY A;  2VQE K;  1XMQ K;  4Y1C A;  3PLA A;  3AVB A;  2P9N A;  4CHO A;  2HHX A;  3WXK A;  5FRN A;  3LDN A;  1JLA A;  3DM2 A;  3BY5 A;  2QKK A;  1N34 K;  2OAN A;  2CH6 A;  2VYP A;  1VQM N;  1RDC A;  3QBX A;  1D5A A;  1ITG A;  5GIO A;  3PIO L;  5AQN A;  1KLM A;  1HPM A;  3MWP A;  3SBT A;  1KAX A;  5AQR A;  5GAD P;  1BI4 A;  1GLE G;  3AGK A;  4GVM A;  4LSL A;  4YOW A;  4DQS A;  1DTQ A;  4CJP A;  5BRD A;  4KPY A;  1W9H A;  1KSP A;  3V1Q A;  4FOE A;  1LV5 A;  3A5N C;  1T6D A;  3OYF A;  4KTW A;  1QQM A;  3UE5 A;  1EXQ A;  3KTQ A;  2X78 A;  1C1C A;  3M6G A;  4DLE A;  1VK0 A;  4LH5 A;  4JEP A;  1JLE A;  1RT2 A;  4BRQ A;  5BPL A;  3P39 A;  3VF4 A;  2ZE2 A;  5CY4 A;  1NK4 A;  1J6Z A;  5LJW A;  4CEF A;  2VG5 A;  4B1W B;  4FWP A;  1NJX A;  4IG3 A;  2GUI A;  1GLD G;  4GVE A;  3W3D A;  4KTQ A;  3IKM A;  3A8Y A;  4M3X A;  3SAF A;  3ULD A;  3C95 A;  1HNZ K;  4DSL A;  2IAJ A;  4NCG A;  4OKJ A;  1G99 A;  3WXM B;  3T1A A;  3SQ4 A;  2F8T A;  4DV1 K;  4M42 A;  4B3O A;  1C0T A;  3I0R A;  4XIU A;  3LDS A;  4MLH A;  3SUP A;  4BRD A;  3QEX A;  4OPK A;  1J9A A;  4TSX A;  4B8C A;  4YOY A;  4JHD B;  1WBB A;  5AZJ A;  4IJN A;  4KH6 A;  1HR0 K;  3OW2 M;  1J54 A;  4BRL A;  1HKC A;  1RDB A;  2IS3 A;  1KAY A;  2UXD K;  3SMS A;  3SLC A;  4O4G A;  1QVG M;  4PKI A;  1BDG A;  1NGD A;  3TI0 A;  4B9S A;  3I8B A;  3DLB A;  4CVN E;  4O5F A;  3G71 N;  1FJG K;  3ZSR A;  4IEE A;  4AHC A;  4M3Y A;  2BTF A;  1NJW A;  2GX9 A;  3UKR A;  3B6P A;  3LDQ A;  4E3S A;  1CZA N;  4W5N A;  2Q1N A;  3ZET A;  3BDP A;  3TAB A;  4DFP A;  4X62 K;  4E1J A;  1K8K B;  1FXX A;  4IOC L;  1DLO A;  4C8N A;  2NRV A;  4BAC A;  3H1Q A;  5K14 A;  2P5G A;  3VEV A;  3V1O A;  4KBO A;  2BH1 A;  4KTZ A;  3CJ1 A;  4JI7 K;  3WXJ A;  5I42 A;  4I7F A;  3WQT A;  1NGJ A;  2F96 A;  2HVI A;  1HNV A;  5C10 A;  3HPO A;  2RN2 A;  5TKW A;  4O0I A;  4JV5 K;  3SV4 A;  4MO5 A;  4M3W A;  4Z4F A;  3C0B A;  3S3N A;  1RTH A;  3D2E B;  3AVN A;  5FPD A;  3ZT1 A;  3PY8 A;  4HCB A;  4KB1 A;  4BRH A;  4WCE L;  5BPN A;  3L2U A;  3U4L A;  2B4J A;  5C12 A;  4CCH A;  1Y64 A;  1YT3 A;  4JRQ A;  3G25 A;  1RDW X;  4CK3 A;  1T05 A;  3SUN A;  1FKP A;  4ILG B;  1X9S A;  4LD0 A;  1ZBL A;  4AQY K;  3QET A;  4AHT A;  2OTL N;  3O3G A;  1HYS A;  2QTD A;  1S22 A;  3VQE A;  1OKJ A;  2W6L A;  4GKK K;  4M3Z A;  1BCO A;  4OKK A;  2YHY A;  3V4I A;  2HST A;  4GKJ K;  3ID6 A;  4JI5 K;  4W5O A;  3CQX A;  3LP3 A;  2B6A A;  1D9D A;  5KI6 A;  2P9S B;  1HPZ A;  4CIF A;  4KHS A;  3JYT A;  3R3L A;  3ZEU A;  3AO4 A;  2AA4 A;  1CZB A;  4EHU A;  5AQH A;  1XC9 A;  3L3V A;  4ID5 A;  3L2W A;  3TWH A;  4FZX C;  3R8E A;  1LCU A;  1EP4 A;  5BN9 A;  1NK9 A;  3CQY A;  4KHW A;  4FCY A;  4DV5 K;  3EE9 A;  1TV6 A;  3QBW A;  4RWT A;  2PFU A;  3DLR A;  4PY5 A;  2BE2 A;  5GAE P;  1BA0 A;  4I6M A;  2UXC K;  4RW7 A;  4H0O A;  5AQU A;  3QML A;  3HJF A;  5BRF A;  1ASW A;  4CHQ A;  4CZI A;  5CYM A;  1NKB A;  3O8M A;  3QB0 A;  3J7Y P;  1SKS A;  5BR8 K;  1NG9 A;  2O8E B;  1T8E A;  3CXC M;  3OYE A;  3EO3 A;  4KH5 A;  2QK9 A;  4WFB L;  4A61 A;  2PYJ A;  3ENB A;  4FK2 A;  3QFP A;  3K5O A;  1VRU A;  3OS2 A;  3HVR A;  4JKD A;  1NGE A;  1NKC A;  4FK4 A;  4JLH A;  4ID1 A;  1VSI A;  1Z6R A;  4WQ4 C;  4YOT A;  4CF8 A;  2YHA A;  5M1F A;  2QI2 A;  4EHT A;  3NGI A;  3VGM A;  3ZSV A;  1DGK N;  1QSL A;  4Z0U A;  4BRG A;  4CIG A;  1TK8 A;  4WFA L;  3IG1 A;  3CCM N;  1S1U A;  4DV2 K;  3QEP A;  3CCS N;  4EFH A;  1KFD A;  2Z1G A;  3NMU A;  4FWN A;  4Q5V A;  3OYC A;  4BG9 A;  4EP4 A;  3HBT A;  2J4R A;  4LY7 A;  4CED A;  1QTM A;  4H5V A;  5EX5 A;  1SKW A;  3WXI A;  2KFN A;  3U9Z A;  4Z4G A;  4AHS A;  3DWL A;  1U45 A;  4BC4 A;  1TKT A;  3VMF B;  4JAX A;  3JAM O;  2I7N A;  5C2F A;  4Z4H A;  3AA4 A;  2R7Y A;  5HL7 L;  3THX A;  1OH6 A;  2PAV A;  5EXW A;  5HLF A;  4CJK A;  3K5M A;  3OYJ A;  3DLH A;  1LW0 A;  1ZBI A;  2X6S A;  3C7N A;  3LZI A;  2D0O A;  2BGG A;  4JI6 K;  1JLF A;  3MDQ A;  1CZ9 A;  2F9T A;  3E01 A;  4PHT X;  3I33 A;  3THY B;  5AQY A;  2A1R A;  5KQ8 A;  3C94 A;  3PX0 A;  3DXK B;  5HBM A;  1BGX T;  4H5N A;  2KZZ A;  2QEX N;  3M8R A;  1BUP A;  5AQF A;  2GWK A;  3P31 A;  1OH8 A;  5C25 A;  5LJV A;  4CJ3 A;  2Q0R A;  3QIP A;  4DF4 A;  4NYF A;  3VGL A;  1BIS A;  4KHP K;  3IDH A;  5AQK A;  5FPM A;  3T69 A;  5HRN A;  1CXU A;  2LSN A;  3VEN A;  2ZQB A;  3VEY A;  2NRZ A;  2ZJP L;  4BRK A;  3OJU A;  5LMU K;  4FJX A;  2CGJ A;  4WQ5 C;  1TKD A;  1TGO A;  2QWL A;  5EOY A;  3OYG A;  2WOM A;  3QNO A;  2P9K B;  3TAM A;  4DTU A;  4IFE A;  4DTR A;  1QQC A;  1IG8 A;  3VQC A;  2NRT A;  1TAQ A;  1C0G A;  2P9K A;  3VQP A;  3AAP A;  3DXM A;  3OS1 A;  4AHU A;  3AO2 A;  3AA3 A;  2YKM A;  5KGW A;  3DLG A;  4FWK A;  3KK7 A;  5M1O A;  3V9S A;  3L2Q A;  1VRT A;  3TSP A;  3RR7 A;  4I2P A;  2VWJ A;  1VHX A;  3OJS A;  4BQZ A;  3DAW A;  4AF1 A;  2HHS A;  3DLE A;  3HM9 A;  1NM1 A;  3OYA A;  4IFY A;  2QM1 A;  3F5T A;  4M3U A;  2KW4 A;  3HPH A;  1RT1 A;  4DFK A;  4A62 A;  5AZI A;  4CGG A;  4ISF A;  4DV4 K;  4FLX A;  4CD3 A;  1HKB A;  1NK7 A;  1VSJ A;  4IO8 A;  4I9Q A;  3HOS A;  4JKH A;  4KV8 A;  3EZ5 A;  1BIU A;  1VSD A;  4E7H A;  5BRH A;  4FJ8 A;  1BU6 O;  1VAZ A;  4F8R A;  3O80 A;  1EO1 A;  3H3O B;  3TAN A;  1FK9 A;  2GEL A;  3F73 A;  4QS7 A;  2KTQ A;  1BL3 A;  1ZC6 A;  3C6U A;  4CHZ A;  3SYZ A;  1YIT N;  3ASM A;  2GBZ A;  1L3T A;  3W0L A;  4KI6 A;  4OGE A;  3AVH A;  2HND A;  1HKG A;  4CK2 A;  3OBY A;  3KK3 A;  3O1W A;  2XY7 A;  1BHL A;  1LWC A;  2OPP A;  2P9L B;  1OH7 A;  3LAL A;  2NRX A;  4X66 K;  1S1T A;  1TUY A;  2E1Y A;  3V1R A;  3RWU A;  2QXL A;  4BDP A;  2CH5 A;  1ZBU A;  3KIO A;  3DOK A;  3EE8 A;  1IKY A;  3VQD A;  1YI2 N;  3HL8 A;  1VSL A;  4FM1 A;  2ITM A;  4F9O A;  1XI1 A;  1C6V A;  4N41 A;  2NZT A;  4C1N I;  4B9N A;  2WTU A;  1MU2 A;  4F4K A;  1TYQ B;  4C23 A;  1YAG A;  1A5X A;  4DTP A;  5F0X A;  2OYQ A;  2HNY A;  3SPZ A;  3LP0 A;  3M8S A;  5JLF A;  1Z25 A;  2ZWH A;  3TSU A;  1X3M A;  4A5A A;  3VA3 A;  3TPQ A;  2YX6 A;  1UA0 A;  4FLY A;  4DQI A;  4XH1 A;  3K0S A;  3HK2 A;  1U2V B;  4L3Q A;  5KPT A;  3VF2 A;  2O8D A;  3AAQ A;  4CGI A;  1IBL K;  3HYF A;  2IC3 A;  1M90 O;  3ATV A;  4JN4 A;  3EY1 A;  3JSM A;  5AZJ B;  3HP6 A;  2E5L K;  2JWL A;  1HYZ A;  1TK5 A;  3OA9 A;  1YJN N;  3L8B A;  4JS4 A;  2O8D B;  3E66 A;  3KK2 A;  4UY8 O;  2D0B A;  3VET A;  3AO3 A;  4F3O A;  3VER A;  3H45 C;  1YIJ N;  4C8O A;  4CJW A;  1MWM A;  2YNI A;  1NKE A;  3ZCM A;  4FVU A;  1Q7Y O;  4QCL A;  3L2R A;  4ELV A;  1B9D A;  2XHB A;  2ZD1 A;  3CER A;  2KKZ A;  2P9I A;  4DB3 A;  1Q18 A;  2UUB K;  1C1A A;  3AY9 A;  1SV5 A;  5KQD A;  2QW9 A;  1ATS A;  1RDU A;  2EHG A;  5AQW A;  3S41 A;  3PX6 A;  3CME N;  4C8K A;  4FZY A;  2UUA K;  4A2A A;  4BC3 A;  1C0F A;  2P9S A;  1XMO K;  1TKZ A;  1XHX A;  1V4S A;  1S6Q A;  4DTM A;  3UIQ A;  4F2R A;  1M1K O;  4LH4 A;  4EIA A;  5H1S Q;  4A57 A;  3AVM A;  4FJK A;  1NGH A;  5AQZ A;  4CJV A;  1L3S A;  5AQQ A;  4Q0B A;  3ZSQ A;  5GAG P;  5E84 A;  1VQL N;  1RDA A;  3KKS A;  2VQF K;  4H5R A;  4BGA A;  3QFU A;  3TAG A;  4YOX A;  4H5W A;  4FLW A;  4BGB A;  4F2S A;  1WUA A;  4B1Y B;  4FJI A;  2G8H A;  2G8U A;  3TSQ A;  5LL6 Z;  3TTC A;  4BRO A;  1Z05 A;  3WT0 A;  5KPR A;  4FWM A;  4JK8 A;  3PO5 A;  4DSJ A;  3VF6 A;  2VCP A;  1QZ6 A;  5DM6 L;  4YDU C;  1WNS A;  3LP1 A;  5AQG A;  4FWQ A;  1HJO A;  3ENH A;  2V7Z A;  4H0V B;  3MAQ A;  5BR9 A;  1GOB A;  4DR5 K;  4XH4 A;  3BUZ B;  3VQ4 A;  3CMA N;  4DTN A;  3CG7 A;  4Z4E A;  3I55 N;  4K43 A;  1L3V A;  3QDK A;  2NRW A;  3LPU A;  4BRE A;  3VPZ A;  2IDO A;  2BUP A;  1RFQ A;  3N4Q A;  3DXK A;  3VES A;  4BC5 A;  3A5O C;  1I39 A;  4AHR A;  2OTJ N;  4FOI A;  1ZBF A;  4X64 K;  4FL9 A;  4FLZ A;  3VQ5 A;  4FJ9 A;  4LF9 K;  4ELU A;  1IKX A;  2E6M A;  3NVM A;  1T44 A;  4RW6 A;  2BAN A;  4DTJ A;  4JD2 B;  2YNF A;  1HRH A;  4M7Y A;  1OH5 A;  2ASP A;  4DR4 K;  1W2B M;  1C1B A;  5I9E B;  3SCX A;  4DS4 A;  2ZJR L;  4DF8 A;  4BRA A;  3P38 A;  1LW2 A;  1S1X A;  5DM7 L;  3SNN A;  4CZH A;  4Y0W A;  2VGN A;  5LMN K;  3SZ2 A;  3P4I A;  4DSF A;  3AVL A;  1RCH A;  3CFR A;  1WSG A;  1HQU A;  3GL1 A;  1T7P A;  1ZYQ A;  3D45 A;  2I7P A;  4B1V A;  2VG7 A;  3TAF A;  1JKH A;  4HUF A;  4IXC A;  4CEZ A;  4CJF A;  4CJL A;  4B3T K;  1KC8 O;  3OBW A;  5AQP A;  4O8K A;  2DY4 A;  3H08 A;  3OYN A;  3HO1 A;  3CD6 N;  3TTF A;  3I56 N;  3WNE A;  3WXL A;  1U49 A;  5AQI A;  1K8A O;  1J5E K;  4OO1 J;  4MLE A;  1W0H A;  2G8V A;  4M45 A;  4PL7 A;  4LF6 K;  5AQO A;  2GEM A;  3U8X A;  4IDK A;  2Z1H A;  2GTD A;  3PIP L;  4DR2 K;  5JVG L;  2HMP A;  3FZM A;  1VQ7 N;  2QWP A;  2E88 A;  1G15 A;  5ADX H;  3KWG A;  3WQU A;  4CHY A;  2Q97 A;  1WAF A;  4FO0 A;  1NJI O;  3NF7 A;  4CFC A;  3VQ6 A;  2P51 A;  3IRX A;  4J2E A;  1WSJ A;  3KD1 E;  4IO9 L;  1W97 L;  3A0I X;  4PKH A;  2GUP A;  3U6F A;  1BIZ A;  3VQB A;  3K58 A;  2XY6 A;  3LAM A;  1IKW A;  3K9J A;  4YHH K;  2KLA A;  1Q82 O;  3A2F A;  1OVQ A;  4ICL A;  2BDP A;  3NBP A;  2Z1I A;  3EL2 A;  4OLA A;  3CM5 A;  3HZ6 A;  3FR0 A;  2ATQ A;  4YOR A;  4E7L A;  1RT4 A;  3ALY A;  3BF1 A;  4O55 A;  1RIL A;  5CYQ A;  3P83 D;  1EKE A;  4C8L A;  3LWM A;  1Y97 A;  4W5Q A;  1JLC A;  1JLB A;  2P9P A;  1Q9Y A;  4CF0 A;  1S3X A;  2HBK A;  1NK0 A;  1DT9 A;  4BR4 A;  4LF7 K;  2HHT A;  4M7X A;  3NH1 A;  4DTS A;  2ZGZ A;  3V9U A;  4N56 A;  4H0X B;  1HLU A;  3NAE A;  4R5P A;  4FPB A;  3AA5 X;  4B3M K;  2NRR A;  2OPQ A;  4JK7 A;  2DTU A;  4CER A;  1VQ5 N;  4LSN A;  4DQR A;  4JKG A;  3O3F A;  3NHG A;  4Z4I A;  5AR0 A;  4DR6 K;  5M1N A;  4E1M A;  2KZM A;  1KTQ A;  5EVZ A;  4U67 L;  4JKG B;  2RHK A;  1U4B A;  4DV0 K;  1CLQ A;  3GDQ A;  5J2Q A;  1L3U A;  3BZC A;  3LZJ A;  4CF1 A;  2E2N A;  4FZZ A;  1HYV A;  3LM2 A;  1JCG A;  4BDZ A;  2A41 A;  5KRT A;  3VGK A;  1VQ8 N;  1K73 O;  3JXU A;  4CEQ A;  1R0A A;  4OVL A;  4H0P A;  2IIR A;  3J81 O;  4LFC K;  3B8A X;  3TTD A;  3VEW A;  3JS6 A;  5TKY A;  3AVC A;  1KXP A;  1SAZ A;  1ASU A;  4KAZ A;  2A5X A;  2Q3S A;  4CJT A;  2KQ2 A;  2EWS A;  1WSI A;  3WNF A;  2IVO A;  2X6N A;  1EET A;  2ZGY A;  4QAG A;  2GWJ A;  1JXE A;  2JWK A;  3MX2 A;  1QSS A;  1V4T A;  4HUE A;  2QWN A;  2FBV A;  4N47 A;  1NWK A;  5EU7 A;  3S3O A;  4RW4 A;  2EX3 A;  4A59 A;  2XO7 A;  3FE1 A;  4C8M A;  3MX5 A;  1TYQ A;  3ZX0 A;  1ASV A;  3EZW A;  4KRE A;  4BRC A;  3DOL A;  4BWJ A;  3VEZ A;  4FWS A;  3MXM A;  4NCA A;  2W40 A;  4CJE A;  1IBM K;  2HHQ A;  1EWQ A;  1NOZ A;  1HX1 A;  4KFB A;  2AJQ A;  4CZM A;  5C0Y A;  3MN7 A;  4CZF A;  4Z4C A;  1E4F T;  1QHT A;  4RW9 A;  4J2B A;  4B1X B;  4E89 A;  3QO9 A;  4BE1 A;  5FDL A;  4CZL A;  5ELZ A;  1S1W A;  3VEO A;  4E7J A;  1RTJ A;  2YNG A;  1N32 K;  1Q9X A;  4H5T A;  4BVP A;  4CIE A;  5JVH L;  4OPJ A;  4JHD A;  3SAG A;  1IBK K;  4OPH A;  1HNW K;  2KHO A;  5CZ2 A;  4A2B A;  2F4V K;  3NE6 A;  3SUQ A;  2HOE A;  4HHT A;  1N5Y A;  4ZHR A;  3KD5 E;  1T03 A;  3D0P A;  1IO2 A;  4B1Z A;  4HUG A;  1U47 A;  2D5R A;  4K0K K;  1KCF A;  2E1Z A;  1JLG A;  1JL1 A;  1RBT A;  1TL1 A;  3NH0 A;  2WC9 A;  5MLC Q;  4FM0 A;  1NK6 A;  3NF8 A;  2FC0 A;  1QE1 A;  3SAH A;  2P5O A;  3UKR B;  4CE9 A;  2G8K A;  4RG8 A;  5GAH P;  4PKG A;  2E2P A;  4H4O A;  4OKE A;  3CCL N;  2UYT A;  1VQN N;  3CCU N;  2E8A A;  4FJ7 A;  3T1H K;  3LAN A;  2FBX A;  3MCP A;  5AQT A;  1NJZ A;  3F9M A;  3KVG A;  3CYM A;  4DG1 A;  5JS2 A;  3CJC A;  5IT9 O;  2FXU A;  1VQK N;  4CBW A;  5GIP A;  1KVB A;  2YHW A;  3DRP A;  4IKF A;  1RT5 A;  4FM2 A;  2QWR A;  3ZSY A;  3UKU B;  4JKB A;  4CES A;  3VOV A;  1WLJ A;  1VQO N;  3PO4 A;  4CK1 A;  2RKI A;  5CZ1 A;  3THX B;  3RSE A;  3FGU A;  4B3R K;  3PSI A;  2UUC K;  1OVY A;  4MO4 A;  3TR8 A;  5AFU H;  3M5R A;  2DPN A;  3KLG A;  2P9I B;  5M1K A;  4BC2 A;  3GG4 A;  1I94 K;  3DRS A;  4O8U A;  4YOU A;  3L4Q A;  1QSY A;  1SL0 A;  1GLF O;  2O4G A;  3LP2 A;  3SJJ A;  1O1W A;  3V9W A;  4KRF A;  1J5O A;  3AAR A;  4FVM A;  3CFO A;  1E4G T;  5DMR A;  2PYL A;  3OVN A;  4NXM K;  2D4W A;  1X1P A;  1XQS C;  1XNQ K;  1EWR A;  1T3V A;  1XC3 A;  2HB5 A;  3IUC A;  3O5B A;  3ZEU B;  2OZS A;  3HST B;  2P9U A;  4DU3 A;  4XH5 A;  3NF6 A;  1WOQ A;  2OPR A;  5J2N A;  3TAQ A;  3FFK B;  1O13 A;  2V52 B;  3QNN A;  1JCF A;  5C24 A;  3MED A;  3MMV A;  4E7I A;  3VQ9 A;  5JS1 A;  2JLE A;  4GNI A;  3O3H A;  2VG6 A;  4JKF A;  4CF2 A;  4DTX A;  4DFM A;  3ULE B;  3QER A;  3SBG A;  3RR8 A;  4BR9 A;  3OYK A;  4DR1 K;  2HMI A;  4BG8 A;  1KD1 O;  3E9L A;  5F1X A;  4DTO A;  4GV9 A;  3TAR A;  5IWA K;  4ILJ A;  3O08 A;  4LFB K;  1P90 A;  3FLC O;  2FSJ A;  4IZ9 A;  5T7B A;  1MA9 B;  3C7N B;  4JI8 K;  3GE1 A;  2VGM A;  1BOT O;  1N36 K;  3O4W A;  1WN7 A;  1L5U A;  1ZBS A;  1WSE A;  4MQ3 A;  4YY3 K;  3OYL A;  4WE1 A;  3LAK A;  3E9P A;  3THW B;  2VWK A;  3AVJ A;  3HPG A;  1S5J A;  1S9E A;  3K59 A;  4BWM A;  2X74 A;  2WUS A;  3O9U A;  1HUX A;  2Q0U A;  4LF8 K;  4IEI A;  1B92 A;  4B1U B;  4U7B A;  4CJS A;  3CJ9 A;  5C42 A;  3K2P A;  4B9T A;  2E4L A;  1BI4 B;  3HXM A;  4E0D A;  4E19 A;  3ENO A;  4ZTF A;  2RF2 A;  4N5S A;  4KI4 A;  3NH2 A;  3ZT3 A;  3SQ1 A;  3QES A;  3G6E N;  4JS5 A;  3SUO A;  2QWQ A;  3LDO A;  3CJ7 A;  3CC2 N;  1ESV A;  4GW6 A;  1YHQ N;  4JI2 K;  3DJC A;  4B08 A;  3WEE A;  4CGJ A;  5D3G A;  2HF4 A;  3SJH A;  1WB9 A;  4AIL C;  5ADX A;  1XUP O;  4JI4 K;  3V81 A;  1WBD A;  4JK9 A;  4DV7 K;  1VSM A;  1VSK A;  2IVP A;  3CHW A;  2P9P B;  3VA0 A;  2O4I A;  1NGB A;  5BPM A;  3A5M C;  4DU1 A;  3C6T A;  3CCQ N;  1NMN A;  4WQ5 A;  4B9L A;  4F3T A;  5AQM A;  5B8H A;  4CFB A;  3O9Q A;  2FF6 A;  1KVC A;  3Q7B A;  4ILH A;  4FLU A;  2A40 A;  4BVO A;  1S72 N;  4FWR A;  4YDU A;  3CF5 L;  3HSC A;  4YOV A;  4I2Q A;  1RTI A;  4I9L A;  4DWI A;  4K25 A;  4OGC A;  1RT6 A;  3MXJ A;  2QWM A;  1YUW A;  4L8R B;  2GV9 A;  2E20 A;  3OYB A;  1YXQ A;  1YVN A;  4AHV A;  1XHZ A;  5LY3 A;  3L2V A;  4DLG A;  2Y1I A;  1NU0 A;  1JCE A;  4IG0 A;  1SL1 A;  4FW1 A;  5AQS A;  3K5L A;  3VQ8 A;  3KLH A;  1N8R O;  1X9J A;  3I0S A;  5AFU A;  1UA1 A;  3ITH A;  3AVK A;  5AJ3 K;  3R6M A;  4DS5 A;  3OYI A;  2HHV A;  3MK6 A;  3VEX A;  4BE0 A;  3DLL L;  1E3M A;  4BDY A;  1VQ9 N;  3CCV N;  1UWB A;  4CHN A;  2O8F B;  4RTF D;  4CJ7 A;  4NLC A;  4CHP A;  4G9Z A;  4FPA A;  3OS0 A;  3FZH A;  5AQJ A;  4DFJ A;  4FJG A;  1F21 A;  3CCR N;  3TAP A;  4ISE A;  3ZSX A;  1YJ9 N;  1RBR A;  3MN5 A;  3P1G A;  4C1N K;  2YKN A;  4JKE A;  1U2V A;  1NK5 A;  1S9G A;  3FFI A;  4H03 B;  3MCA B;  3S9H A;  5GIN A;  2OZM A;  4WFN L;  3RRH A;  3Q7C A;  2F9W A;  4CJ4 A;  3T3F A;  3TU5 A;  4AH9 A;  3D2E A;  3LDL A;  4JI1 K;  4DV3 K;  1ZXO A;  4WF9 L;  3DMJ A;  4W5T A;  3M3Z A;  1RDD A;  3UKU A;  3NCI A;  4NXN K;  5J2P A;  1NGG A;  1UAX A;  3V6D A;  1Q81 O;  3EN9 A;  3BEX A;  4JRP A;  2VWB A;  4KHQ A;  1C0U A;  4KHN A;  1D8Y A;  2B5J A;  2G8W A;  1T6C A;  2WON A;  2F7T A;  5HP1 A;  1SQK A;  1K8K A;  3G10 A;  4JI0 K;  4JI3 K;  3L0Q A;  1KRP A;  4FWL A;  3KHY A;  5BN8 A;  4JYA K;  3HI0 A;  4M3R A;  3U3Y A;  1EX4 A;  4JKA A;  3KLE A;  1JL2 A;  3OYH A;  3SK3 A;  1NBW A;  4DV6 K;  5AQX A;  4CI6 A;  4FW2 A;  1TKX A;  3QIN A;  3G0Z A;  3DYA A;  2OCE A;  3FZF A;  3RMC A;  4B8A B;  4CFA A;  2JGU A;  2O8E A;  2OPS A;  3ULE A;  4BQL A;  2V51 B;  1W7A A;  2ZF5 O;  4E7K A;  4J8F A;  1IKV A;  4IJA A;  4CEB A;  5JLH A;  5KTQ A;  2YHB A;  1GOC A;  2O8C A;  4FYD A;  1KVA A;  3H6E A;  4DSI A;  1QQO A;  4CW7 B;  4LF5 K;  3T19 A;  4EP5 A;  3F9K A;  2F8S A;  1GLJ O;  1SKR A;  2QKB A;  3E9O A;  2A42 A;  4HTU A;  5FPE A;  2A3Z A;  4M41 A;  3OYM A;  2ZM6 K;  4N76 A;  1YF5 L;  3QIC A;  3ZT2 A;  4IDH A;  4B9M A;  3IAY A;  4EZ9 A;  4OX9 K; 
#chains in the Genus database with same CATH homology
 5C15 A;  3BP8 A;  1MDU B;  1DEJ A;  4B1Z A;  5BRH A;  4QS9 A;  4DHY A;  1LOT B;  2YJF A;  3N4P A;  3HRG A;  2E1Z A;  5CHI A;  2HBM A;  1BU6 O;  1VAZ A;  1EO1 A;  3O80 A;  2A6A A;  3H3O B;  3C6H A;  2WC9 A;  5MLC Q;  5C2D A;  2GEL A;  1QQN A;  1IJJ A;  4QS7 A;  3SAH A;  4IOX A;  3UKR B;  1ZC6 A;  5GAH P;  1ILY A;  4PKG A;  3PLA A;  2P9N A;  1YIT N;  2E2P A;  2YI1 A;  3WXK A;  3W0L A;  3LDN A;  3CCL N;  2UYT A;  1VQN N;  3CCU N;  1HKG A;  2E8A A;  2OAN A;  3OBY A;  3O1W A;  2CH6 A;  4IOA L;  2P9L B;  4R79 A;  4AM6 A;  2QWO A;  4M63 C;  2VYP A;  4BRM A;  1VQM N;  3MCP A;  3QBX A;  3CJB A;  5AQT A;  5FPN A;  5GIO A;  3PIO L;  2NRX A;  3F9M A;  2E1Y A;  1TUY A;  3KVG A;  5AQN A;  3VTH A;  3FZL A;  3A5L C;  3LDP A;  2QXL A;  2CH5 A;  4K42 A;  1HPM A;  3MWP A;  5JIC A;  3SBT A;  3CJC A;  1KAX A;  5AQR A;  2FXU A;  4DQ8 A;  4CBW A;  1SZ2 A;  5GIP A;  5GAD P;  1VQK N;  3EE8 A;  1GLE G;  3AGK A;  1GLA G;  2YHW A;  1ATR A;  4YOW A;  1YI2 N;  2QWR A;  3UKU B;  2ITM A;  4JKB A;  4F9O A;  5BRD A;  3VOV A;  2NZT A;  1U6Z A;  4C1N I;  1VQO N;  4KH4 A;  1K9M O;  2ASM A;  4NO7 A;  1TYQ B;  4FOE A;  1MWK A;  3RSE A;  3E1Y A;  1YAG A;  3FGU A;  3A5N C;  4C23 A;  1GLL O;  1T6D A;  3ZX3 A;  5F0X A;  1OVY A;  1QQM A;  4MO4 A;  3UE5 A;  3O9S A;  5E26 A;  5AFU H;  3M5R A;  5JLF A;  2DPN A;  2ZWH A;  3TSU A;  1X3M A;  2P9I B;  4A5A A;  5M1K A;  4BC2 A;  1VQ6 N;  3TPQ A;  3M6G A;  2YX6 A;  3GG4 A;  3HOT A;  4O8U A;  1ATN A;  1RGI A;  4JEP A;  4YOU A;  4XH1 A;  3LM9 A;  4BRQ A;  4BRP A;  1U2V B;  3L4Q A;  4L3Q A;  5KPT A;  3VF2 A;  1GLF O;  1NGA A;  3AAQ A;  4CZJ A;  5BPL A;  3P39 A;  1M90 O;  3ATV A;  4JN4 A;  3VF4 A;  3AAR A;  5AZJ B;  4BRI A;  2JWL A;  1E4G T;  1J6Z A;  5LJW A;  3OA9 A;  1YJN N;  2D4W A;  3E66 A;  4B1W B;  4FWP A;  4CZG A;  3G4S N;  1XQS C;  3AGR A;  4UY8 O;  3VET A;  4FWO A;  3VER A;  3H45 C;  3WEE B;  5AQV A;  1YIJ N;  4GV6 A;  1GLD G;  1T3V A;  1XC3 A;  4GVE A;  3W3D A;  1MWM A;  3IUC A;  3A8Y A;  3IKM A;  3O5B A;  3ZEU B;  2P9U A;  3SAF A;  4XH5 A;  1Q7Y O;  4FVU A;  1WOQ A;  1G99 A;  3WXM B;  1K8A O;  3CER A;  3J7Z O;  2KKZ A;  3FFK B;  1O13 A;  3GBT A;  2P9I A;  2V52 B;  4DB3 A;  1JCF A;  5F2R A;  1Q18 A;  4MLH A;  3AY9 A;  4BRD A;  5KQD A;  4WQ4 A;  3MMV A;  2QW9 A;  1ATS A;  1RDU A;  4GNI A;  4JKF A;  5AQW A;  3S41 A;  3CME N;  4YOY A;  4JHD B;  4K41 A;  1BA1 A;  5CR4 A;  4IJN A;  4A2A A;  5AZJ A;  3ULE B;  4BC3 A;  3CI5 A;  4KH6 A;  3OW2 M;  1C0F A;  2P9S A;  3SBG A;  1NMD A;  4BRL A;  1HKC A;  4BR9 A;  1V4S A;  3D7E O;  4IWV A;  1R59 O;  1KAY A;  4BG8 A;  4BR2 A;  1KD1 O;  3E9L A;  3L6Q A;  3SMS A;  5F1X A;  4GV9 A;  5HOO A;  3O9R A;  1M1K O;  3SLC A;  1QVG M;  4ILJ A;  3O08 A;  4PKI A;  3CJA A;  1BDG A;  4EIA A;  5H1S Q;  1NGD A;  1JJ2 M;  4A57 A;  5GAG P;  2YHX A;  1P90 A;  3MN6 A;  3I8B A;  3FLC O;  2FSJ A;  1NGH A;  4IZ9 A;  4O5F A;  5AQZ A;  3G71 N;  5AQQ A;  1MA9 B;  2NLX A;  3C7N B;  3CIP A;  3J8A A;  1NGI A;  2VGM A;  2BTF A;  3GE1 A;  4IEE A;  5E84 A;  2GX9 A;  1BOT O;  3UB5 A;  3UKR A;  1VQL N;  4H5R A;  4BGA A;  3ZX2 A;  3O4W A;  3QFU A;  3LDQ A;  1CZA N;  2Q1N A;  3R1X A;  4NB4 A;  4H5W A;  1ZBS A;  3ZET A;  4YOX A;  2QA4 N;  4BGB A;  3T7Z A;  2W41 A;  1WUA A;  4B1Y B;  3E9P A;  4MDB A;  3H3N O;  3TSQ A;  1K8K B;  4E1J A;  4IOC L;  3TTC A;  2NRV A;  3H1Q A;  1P8Z A;  3VTI A;  5KPZ A;  3VEV A;  2YJE A;  4KBO A;  4BRO A;  2BH1 A;  2WUS A;  1Z05 A;  3CJ1 A;  3WT0 A;  5KPR A;  4FWM A;  3O9U A;  3WXJ A;  1EQY A;  1HUX A;  4JK8 A;  3CPE A;  3VF6 A;  2VCP A;  2Q0U A;  3SMP A;  3WQT A;  1NGJ A;  2Q31 A;  1QZ6 A;  4IEI A;  5DM6 L;  4YDU C;  4B1U B;  5AQG A;  4U7B A;  5C10 A;  4FWQ A;  3CJ9 A;  1HJO A;  3ENH A;  5BRE A;  2V7Z A;  3BF3 A;  4BRN A;  4H0V B;  3D6R A;  5TKW A;  5BR9 A;  4XH4 A;  3ENO A;  3BUZ B;  2FLO A;  4MO5 A;  4NLB A;  3CMA N;  5AQL A;  3C0B A;  4JNE A;  3ZET B;  4QS8 A;  3I55 N;  2HBJ A;  2P9N B;  4K43 A;  3QDK A;  3D2E B;  2NRW A;  5FPD A;  1GLC G;  4BRE A;  3VPZ A;  1D4X A;  3D2F B;  2BUP A;  4BRH A;  1RFQ A;  4WCE L;  5BPN A;  3G6E N;  1YJW N;  3N4Q A;  3DXK A;  3U4L A;  2QWQ A;  3LDO A;  2HBL A;  3CJ7 A;  4FSV A;  4DKW A;  1ESV A;  5C12 A;  3VES A;  3CC2 N;  4BC5 A;  3A5O C;  1YHQ N;  1Y64 A;  1BO5 O;  2NNW A;  4MDA A;  3DJC A;  3G25 A;  3D2F A;  3WEE A;  2OTJ N;  1RDW X;  4FOI A;  4ILG B;  2NRH A;  1X3N A;  4FL9 A;  2HF4 A;  3SJH A;  2OTL N;  3NVM A;  1XUP O;  5ADX A;  1T44 A;  2QTD A;  1S22 A;  1OKJ A;  4BR5 A;  3EKS A;  4JK9 A;  1QVF M;  3CHW A;  2IVP A;  4JD2 B;  4M7Y A;  2P9P B;  1VQ4 N;  2ASP A;  2YHY A;  2HST A;  1W2B M;  1NGB A;  5CE3 A;  3ID6 A;  5I9E B;  5BPM A;  3CQX A;  3A5M C;  2ZJR L;  3CCQ N;  4BRA A;  3P38 A;  4WQ5 A;  2P9S B;  3ID8 A;  3R3L A;  3ZEU A;  5AQM A;  2AA4 A;  5B8H A;  5DM7 L;  4ISG A;  5M1P A;  3O9Q A;  2FF6 A;  5AQH A;  4CZH A;  4Y0W A;  4EHU A;  1NGC A;  2VGN A;  3Q7B A;  4ILH A;  3CCE N;  2FSN A;  3NVK A;  2A40 A;  3P4I A;  4BVO A;  1S72 N;  3R8E A;  2D0P A;  4FWR A;  1LCU A;  2FF3 B;  2P9L A;  4GY2 B;  4YDU A;  4BRF A;  3CF5 L;  3HSC A;  3GL1 A;  5BN9 A;  2I7P A;  4YOV A;  4B1V A;  3CQY A;  3O9T A;  4K25 A;  1GLB G;  4IXC A;  4WYB A;  3EE9 A;  2QWM A;  1YUW A;  1KC8 O;  3OBW A;  2E20 A;  3QBW A;  4RWT A;  2PFU A;  5AQP A;  4O8K A;  3EKU A;  1YXQ A;  1YVN A;  5GAE P;  1BA0 A;  5LY3 A;  4I6M A;  1JCE A;  2ASO A;  3CD6 N;  5AQS A;  3TTF A;  3WXL A;  4EAH D;  3I56 N;  4H0O A;  5AQI A;  1NLV A;  5AQU A;  5AZI B;  3C6A A;  3QML A;  4MLE A;  4OO1 J;  5BRF A;  4PL7 A;  4CZI A;  5AQO A;  3U9D A;  2GEM A;  3U8X A;  1KAZ A;  1QZ5 A;  3O8M A;  3QB0 A;  3H1V X;  1N8R O;  1H1V A;  2CGK A;  1X9J A;  2GTD A;  3PIP L;  5JVG L;  2E2O A;  5AFU A;  3LL3 A;  2HMP A;  3FZM A;  1VQ7 N;  2QWP A;  2E88 A;  3CXC M;  5ADX H;  3O1B A;  3KWG A;  3WQU A;  3EO3 A;  4KH5 A;  2Q97 A;  4H0T B;  4CBU A;  3R6M A;  4FO0 A;  4Z94 A;  4A61 A;  4WFB L;  1NJI O;  3ENB A;  3QFP A;  2FSK A;  4LC9 B;  3MK6 A;  3VEX A;  2WFB A;  3IMX A;  3DLL L;  4IO9 L;  1W97 L;  3A0I X;  3CCJ N;  4PKH A;  2GUP A;  3CC4 N;  4JKD A;  1VQ9 N;  1NGE A;  3CCV N;  3K9J A;  2KLA A;  1Q82 O;  4RTF D;  1Z6R A;  2HF3 A;  4WQ4 C;  4YOT A;  4CJ7 A;  4NLC A;  4BY9 C;  5M1F A;  2QI2 A;  4G9Z A;  4EHT A;  4HTL A;  4FPA A;  3EL2 A;  3RSE B;  3VGM A;  1DGK N;  4AM7 A;  4BRG A;  1KQS M;  3FZH A;  3HZ6 A;  5AQJ A;  3FR0 A;  4WFA L;  4BR7 A;  4YOR A;  3CCM N;  5JMV A;  3CCR N;  3BF1 A;  3CCS N;  4EFH A;  4ISE A;  3MN9 A;  4A5B A;  4FWN A;  4RCH A;  1YJ9 N;  3MN5 A;  3NMU A;  4C1N K;  4BG9 A;  3HBT A;  2D1K A;  3M1F A;  2J4R A;  2P9P A;  4GV3 A;  4JKE A;  1U2V A;  4H5V A;  5EX5 A;  1S3X A;  3CC7 N;  4DCH A;  2HBK A;  4H03 B;  3MCA B;  3WXI A;  1DT9 A;  5GIN A;  3U9Z A;  4BR4 A;  4WFN L;  3DWL A;  4BC4 A;  3Q7C A;  2F9W A;  3VMF B;  4M7X A;  4JAX A;  2ZGZ A;  2Q2R A;  4H0X B;  3TU5 A;  1HLU A;  3D2E A;  3LDL A;  2I7N A;  5C2F A;  4FPB A;  1ZXO A;  4WF9 L;  4CZE A;  2NRR A;  4JK7 A;  3M3Z A;  5HL7 L;  3K9K A;  3IFR A;  1TUU A;  3UKU A;  1VQ5 N;  4JKG A;  2PAV A;  4CZK A;  5AR0 A;  1NGG A;  3ATU A;  4H0Y B;  5EXW A;  5M1N A;  1VQP N;  1Q81 O;  3EN9 A;  2WBN A;  3BEX A;  5EVZ A;  4U67 L;  2VWB A;  3C7N A;  2D0O A;  4JKG B;  2RHK A;  3MDQ A;  3RVC A;  2F9T A;  3GDQ A;  5EY4 A;  4PHT X;  2YCH A;  3I33 A;  3CET A;  2E2N A;  2IVN A;  5AQY A;  1BWF O;  1T6C A;  3LM2 A;  4XEI A;  1JCG A;  5KQ8 A;  2F7T A;  3DXK B;  4I6M B;  1NGF A;  2A41 A;  4JD2 A;  3VGK A;  1VQ8 N;  1K73 O;  1SQK A;  3JXU A;  1K8K A;  4H5N A;  2QEX N;  4H0P A;  1BUP A;  2IIR A;  3L0Q A;  5AQF A;  2GWK A;  3P31 A;  3B8A X;  3TTD A;  4CD1 A;  3HTV A;  4FWL A;  3JS6 A;  3VEW A;  5LJV A;  3KHY A;  5TKY A;  3O6W A;  1KXP A;  3KWI A;  1SAZ A;  2Q0R A;  5BN8 A;  3VGL A;  4OPA A;  3HI0 A;  1QHA A;  2A5X A;  3IDH A;  3WUH A;  5AQK A;  4JKC A;  4PL8 A;  5FPM A;  3T69 A;  1DKG D;  2EWS A;  4JKA A;  3VEN A;  2H3G X;  5M1Q A;  2IVO A;  3VEY A;  1BG3 A;  2NRZ A;  2ZJP L;  3SK3 A;  1NBW A;  4BRK A;  2E2Q A;  3GOI A;  2AP1 A;  5AQX A;  2ZGY A;  1Q86 O;  3L4I A;  2CGJ A;  2CGL A;  2GWJ A;  4WQ5 C;  4CI6 A;  3HM8 A;  2JWK A;  2QWL A;  5EOY A;  3MX2 A;  3ZYY X;  1V4T A;  2P9K B;  2QWN A;  4IFE A;  1NWK A;  3FZF A;  4A59 A;  3C65 A;  1IG8 A;  3FE1 A;  2NRT A;  3ULE A;  1C0G A;  2P9K A;  4BQL A;  2Q36 A;  2V51 B;  3MX5 A;  2ZF5 O;  3FZK A;  3F2K A;  1TYQ A;  3AAP A;  3ZX0 A;  3DXM A;  4J8F A;  3EZW A;  4IJA A;  5JLH A;  4BRC A;  4FWK A;  3KK7 A;  5M1O A;  4FWS A;  4HWI A;  3TSP A;  2W40 A;  3VEZ A;  3H6E A;  4B9Q A;  1QQO A;  3CPW M;  4BQZ A;  3DAW A;  3H46 O;  3MWT A;  4AF1 A;  2RE2 A;  1HX1 A;  2P9U B;  1GLJ O;  4CZM A;  2V7Y A;  5C0Y A;  1NM1 A;  3MN7 A;  4CZF A;  1E4F T;  3E9O A;  3KZB A;  4B1X B;  2ZJQ L;  2QM1 A;  3F5T A;  4CZL A;  2A42 A;  5ELZ A;  3VEO A;  1SS6 A;  4A62 A;  5AZI A;  5FPE A;  4ISF A;  4BR0 A;  2PBD A;  4H5T A;  2A3Z A;  3OHR A;  4BVP A;  5JVH L;  4CD3 A;  4JHD A;  4CBX A;  3R9P A;  1HKB A;  4OPH A;  3SAG A;  2KHO A;  4A2B A;  1YF5 L;  3QIC A;  4IO8 A;  4IDH A;  3DXM B;  3HOS A;  2HOE A;  4JKH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...