2ZJQL

Interaction of l7 with l11 induced by microccocin binding to the deinococcus radiodurans 50s subunit
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
104
structure length
104
Chain Sequence
RRKLRTRRKVRTTTAASGRLRLSVYRSSKHIYAQIIDDSRGQTLAAASSAALKSGNKTDTAAAVGKALAAAAAEKGIKQVVFDRGSYKYHGRVKALADAAREGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Translational regulation via L11: molecular switches on the ribosome turned on and off by thiostrepton and micrococcin.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords ribosomal 23S RNA
total genus 17
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2008-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00861 Ribosomal_L18p Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.100 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2zjqL01
3DLLL 3CCEN 3CMEN 1VQ8N 1KC8O 4U67L 5GAEP 5HL7L 3I56N 1Q86O 3CCJN 5DM7L 5JVGL 1VQLN 1W2BM 4WFNL 1VQMN 1VQ9N 1YITN 1VQNN 1JJ2M 1YHQN 3CC2N 3CMAN 3CPWM 3CC7N 4WFAL 3CCVN 3J7ZO 1VQ5N 2OTJN 1VQPN 2QEXN 5GAGP 1YJ9N 1KQSM 5H1SQ 3CCMN 2ZJQL 1NJIO 1K8AO 3CCRN 4WCEL 1Q81O 1K9MO 1S72N 5MLCQ 1YIJN 3CXCM 1YI2N 3CCLN 1ILYA 1QVFM 1VQ6N 1YJWN 2ZJRL 1Q82O 5DM6L 4IOCL 4WFBL 3PIOL 1M1KO 2QA4N 5JVHL 1OVYA 3CCQN 3PIPL 1Q7YO 1VQ4N 1VQKN 3G71N 4IO9L 4IOAL 3CCSN 4UY8O 3OW2M 1QVGM 5GAHP 1K73O 2OTLN 4WF9L 3CD6N 3CCUN 2ZJPL 1KD1O 3G4SN 1VQON 5GADP 1N8RO 1YJNN 3CF5L 3I55N 1M90O 3G6EN 1VQ7N 3CC4N
chains in the Genus database with same CATH superfamily
4BRPA 3W0LA 2V52B 3TAGA 1NMNA 3MDQA 2ASPA 2ITGA 3SPZA 4H5VA 2HNZA 4DB3A 2UXDK 3I8BA 3LP3A 2D0AA 1Q9XA 2FBTA 3K5OA 3TTDA 1LOTB 1RFQA 4WQ4A 4H0VB 3U9DA 4YORA 4Z94A 4HCBA 3P5JA 4DQRA 4Z4GA 1NGGA 3V81A 4LF5K 5TKYA 3I33A 3F5TA 3THVA 5FPMA 4CZMA 4H0XB 5AQXA 4K0KK 3PUFA 1DT9A 3CC7N 5CZ1A 1S1UA 3WQTA 2UUCK 3KHYA 2HHUA 1S6PA 2W6KA 3J7YP 4DV7K 1QQNA 2VWKA 3ZSYA 5AFUH 1HKBA 4DFKA 3C6AA 4B3OA 3M8QA 1SQKA 1XHZA 1NU0A 4CHZA 3V9UA 1RDUA 5BRHA 4JKEA 3L2QA 1B9DA 4B9TA 2KLAA 4DTRA 4CD1A 1BISA 2XY5A 3VQAA 1VQ6N 3RMBA 3NF8A 3OYGA 3UE5A 4LH4A 4EHUA 3OYCA 1YJWN 4KB1A 1Q82O 4IOCL 1RDAA 1BCOA 4JKCA 5JVHL 4CK3A 5M1KA 4CF9A 3CQ8A 1S1WA 4EP4A 2BANA 2HBMA 1YT3A 2B4JA 1SKSA 2HHXA 4IOAL 4CFDA 3JYTA 2AA4A 4BRNA 1NJYA 2Q31A 4X66K 3OYDA 3VQ5A 2FSJA 4JKFA 4DF4A 4CZIA 1Z6RA 4N76A 1T6CA 4DSJA 4OJRA 4QS9A 2NRVA 4H0OA 4KFBA 4CF2A 3AVJA 1KAXA 3THYB 4JKAA 4CGFA 5JLHA 3CF5L 1VSLA 1TKZA 4KI6A 1VSJA 1R59O 3LANA 4FO0A 3VQDA 4BDZA 2CGLA 3EE8A 3N4PA 3OBWA 4J2EA 2D0BA 1IBMK 4E3SA 2BDPA 5C25A 5M1QA 4A59A 4AF1A 3TI0A 2YCHA 2P51A 4FJHA 5F1XA 4C1NK 5FRMA 4H03B 4KHSA 1RT4A 4O8KA 4DCHA 3HZ6A 3MCAB 3WEEA 5FROA 2RHKA 3NF6A 3VGLA 3CJAA 4U7BA 3ZSVA 2IGIA 3H3OB 3J7ZO 3C6UA 2OTJN 1W9HA 2WUSA 3ZT4A 4OKEA 5H1SQ 4E19A 2JLEA 1A5VA 3O9RA 1RTJA 1U47A 3V9WA 2G8FA 4XH1A 5ELZA 2D5RA 4F9OA 2Z1IA 4FOIA 3MEGA 3QFUA 4CIFA 1KSPA 2P9SB 3QO9A 1RTIA 2GEMA 4F3OA 4CEBA 3SUNA 3ISNC 4E7HA 4BRQA 2ETJA 4KHPK 1JKHA 4CI6A 5HRPA 3TSPA 3NGIA 3M8PA 3JXUA 3PIOL 1GOBA 1WAFA 3KJVA 4EP5A 4B08A 4ISEA 4AHUA 1HNIA 4IKFA 4XIUA 5BPMA 4HVJA 4Z4CA 3U4LA 2PAVA 2H3GX 4BRFA 4YOUA 4CJ4A 1SL0A 2OTLN 2KQ2A 2O4GA 3WQUA 3DM2A 1JLBA 4GNIA 4NXMK 1TK8A 3E9PA 4JI7K 1YAGA 1CXUA 2VG6A 2ASMA 3AVCA 2ZJPL 5BPNA 1IG9A 1HYSA 2FXUA 4FJIA 2F9WA 4NO7A 1TKXA 3NGYA 2F8TA 2NUBA 1M90O 5FPEA 3DLEA 2GWKA 1QSSA 1L3SA 2GWJA 4I2QA 4M41A 3CMEN 5SWMA 5KQDA 1IKWA 4CEAA 1DLOA 4DTXA 4KHUA 1C1BA 2D0OA 3ASMA 3O9TA 4FVUA 1BO5O 4FM1A 1W2BM 4IJAA 2KZMA 4IDHA 4B3TK 4GW6A 3G10A 5B8HA 5TKWA 3UB5A 3FGUA 4JV5K 4PA1A 4LF9K 3AA4A 1X3MA 2NRRA 1A5XA 2DFEA 4RW6A 2VQFK 2Z1GA 1IJJA 1HPZA 4O5BA 2HHTA 2O8BA 1X3NA 3LM9A 1S22A 4CJPA 2VWJA 3O1BA 5KTQA 4M63C 1YJ9N 3L4QA 5C24A 4M3WA 4M3ZA 4BACA 1WUAA 3RSEB 3L8BA 4BRKA 4IJNA 3P1GA 3ENHA 4FCYA 2RN2A 3OYEA 2DTUA 2X6NA 5M1PA 3KVGA 5I9EB 4ILGB 3UKUA 4PKGA 5EXWA 2R7YA 1VSHA 4KO0A 3RR8A 4J2AA 5CE3A 3D45A 1WSGA 5E41A 1KAZA 4CZHA 3OYNA 3ZT0A 3RR7A 2PZSA 4DQQA 4H4MA 4YOXA 1XNRK 2E88A 2JWKA 1QQMA 2OPSA 3NH2A 4CGHA 2HNYA 1SAZA 1HJRA 2YI1A 4DQ8A 4CJSA 1ZBIA 1QVGM 3QIOA 2QWNA 3HVTA 4H5RA 3L4IA 3CM6A 1DEJA 1OKJA 1T44A 5E26A 2O8CB 4ELUA 3SZ2A 4JK8A 1I3AA 4WYBA 4BR9A 3K5LA 2HBLA 1XHXA 3P83D 3KK1A 3BZCA 1RT1A 2NRTA 3K2PA 1WAJA 2QWLA 4CGGA 3T1YK 1RBVA 2BH1A 3NDKA 3AO2A 3AA2A 4I6MB 4FLYA 1I39A 5AQMA 3ZT1A 2UXBK 4GV9A 1QQCA 1IV0A 4M3TA 3I8DA 3U9ZA 1VQLN 1LWEA 4FLTA 3QBXA 4CGDA 5JS1A 5F2RA 4BRDA 3PLAA 1CXQA 1XNQK 3SMSA 2F96A 4CJRA 5AZIA 2DFHA 3L6QA 3AVHA 3HT3A 2VG5A 3OS0A 1KVBA 4BWMA 1NK0A 2RF2A 4JNEA 2YHWA 1NM1A 1HJOA 3NE6A 1KQSM 3CCMN 5EY4A 2QWRA 3OYFA 2IVPA 1GLEG 2QTDA 4CVNE 3SPYA 1OH6A 4LFAK 4GMJB 5JMVA 4CE9A 4BDPA 3DXKB 4G9ZA 5FRNA 4CJEA 1X9SA 4X62K 4DS5A 2IOCA 1WSFA 4FWOA 5EU7A 2G8WA 3U8XA 3MN5A 3H1QA 4M3XA 4DUYK 5FDLA 3V9XA 2FBYA 3ZSRA 4FLZA 3H6EA 4H4OA 4MDBA 3QERA 1NOYA 4FJ8A 1YF5L 3IDHA 3ZETB 2X74A 3WNHA 3QMLA 4H0TB 4JKGA 4RCHA 4BC3A 1S5JA 4FJ5A 3O4QA 5AQLA 4F4KA 3QEWA 1A5WA 4FLWA 4WF9L 1YVUA 3ZSOA 4CFAA 4CF8A 4LC9B 3VF2A 3AVFA 4LH5A 5AQGA 1HRHA 2I5JA 4CHQA 3SV4A 3V1QA 4ELVA 1VQON 2VGNA 4BR4A 3TABA 3CETA 1W0HA 4FJJA 2HVIA 4FPAA 4TSXA 4YY3K 4DS4A 1GLFO 5M1NA 4DR7K 1N36K 1RBRA 1JCEA 4BRLA 3F73A 3I56N 3E9OA 1NKBA 3S3MA 3VN5A 5BPLA 4ISGA 3MX5A 1OH8A 4ELTA 3OVNA 2GUPA 1JJ2M 4YOTA 4CJQA 1K8KB 1T03A 4E7LA 3AGKA 3NAEA 2YHYA 1D4XA 2P1JA 2OYQA 4B3SK 4CBWA 2Z1HA 1HNXK 4FM2A 5EOYA 4JN4A 2F8SA 4B1WB 3AVGA 3RRGA 1XMOK 2KTQA 1LCUA 5C2DA 4E0DA 3CHWA 3FZMA 4IFEA 3ZX0A 3MEEA 4CZLA 1LW2A 1MA9B 4CEQA 3ZETA 5MLCQ 1N33K 1VSKA 1N34K 1JLGA 4B8AB 4FWSA 4UQGA 1UOCA 5AQRA 4E7IA 4LFCK 3I0SA 3WXIA 2V7YA 5J2MA 3K0SA 4PL8A 5M1OA 2P9UA 2XY8A 3AARA 1M1KO 3NMUA 2NLXA 4DTOA 3NGZA 3DRSA 1Q9YA 3TU5A 3PIPL 1YVNA 1ATSA 1Q7YO 4FJMA 2YNGA 5BN8A 4MQ3A 2BTFA 5AZIB 3IAYA 1NGHA 3VGMA 4BREA 4BC4A 2A5XA 4CW7B 3A5LC 1KD1O 4DQPA 3DXMB 2HSTA 3VEXA 3HO1A 4M7YA 3OBYA 4JD2B 3IMXA 5DMRA 1Z05A 1W7AA 4CCHA 4YHHK 1T8EA 1K8KA 4ILHA 2G8HA 4OPJA 4DR3K 3J80O 4DSLA 2P9SA 4FL9A 4HWIA 1KC8O 1L3TA 4I7FA 3OJSA 3QB0A 1C0TA 2E2PA 4IEIA 1IBKK 1Q86O 4MO5A 3CCJN 5DM7L 4F2RA 5IT9O 1ZBLA 4XEIA 3O80A 5BREA 1U49A 2J4RA 1G99A 4WFNL 3BY5A 4JKBA 1GLAG 5AR0A 1NGFA 3SJHA 3CJBA 3T1HK 3FZFA 3CJ1A 1KRPA 4BY9C 5K14A 4NLCA 2F7TA 4DSIA 1YHQN 2CGJA 2GELA 4BR7A 3U6FA 3THWA 3B6OA 4KAZA 3VGKA 3G0ZA 1TL1A 1VQPN 1X9JA 2IVNA 1SL1A 3OY9A 4RWTA 4DV6K 1BUPA 3OYIA 2A1SA 4CF1A 4NLBA 3SCXA 2O8DA 4KREA 2HB5A 4DHYA 1Q81O 1KFDA 3KKSA 1S72N 2E2NA 1WN7A 4FJXA 3OYBA 2P9IB 1O1WA 3F2KA 1UWBA 3CM5A 1ILYA 4N56A 4DTNA 1VSEA 3DOLA 5AQZA 3UKRA 4B1YB 5C12A 3L2RA 4KV8A 3QIPA 3S3OA 3DLKA 3MEDA 3C94A 4BRGA 1GOAA 1KFSA 2P9LB 1QTMA 3KD5E 2JWLA 2IC3A 4AH9A 2GUIA 5F0XA 3OHRA 3F9KA 1P90A 4RW8A 3K5NA 2GV9A 1U45A 3O5BA 5ADXA 1S9GA 3TAMA 3KLHA 2P9NB 3D2FB 3CCUN 4GKKK 4EIAA 2YKMA 3SJJA 3FFIA 1JXBA 4CZEA 4FK0A 1RILA 5LY3A 3CQXA 3GOIA 2E20A 4DG1A 4B3RK 2OPQA 4PL7A 1NK6A 3DWLA 1C0UA 5AQUA 1SL2A 4LSLA 1NBWA 4NCAA 5J2QA 3E1YA 3ATUA 3H08A 4DV1K 3BDPA 5C0YA 3ZX3A 3H45C 3M6GA 1B9FA 1L3VA 2HHVA 4PKIA 2ITMA 2PY5A 4Q0BA 3NVKA 3GDQA 3QNNA 1DKGD 1VQNN 3D6RA 5CZ2A 3CYMA 4KTWA 2A1RA 5AQHA 4BRHA 1CZBA 3VENA 2BE2A 2GBZA 4X64K 1QHAA 4IO8A 3D0PA 3AVKA 5KRSA 2PBDA 3QICA 1RCHA 3L0QA 4OLAA 2W42A 4QS7A 2XY6A 1KTQA 1U6ZA 2Q97A 3ID8A 1K6YA 4DV5K 3VA0A 2D0CA 1NGAA 3T69A 3KKRA 3SLCA 3CCRN 2VGMA 1EP4A 5KRTA 4AM7A 4XH5A 4A62A 1JLEA 3HVRA 5JS2A 2A3ZA 1GLBG 1OH7A 2I7PA 3RRHA 3BUZB 4JKGB 3QBWA 3RTVA 1QHTA 5KPTA 3O08A 3LPUA 1EKEA 4I6MA 4YFUA 3V9ZA 1E3MA 2QWQA 4BRCA 4F3TA 1IKVA 5HRNA 4DTUA 2E5LK 2ZJRL 1NGIA 3BEXA 3M8RA 3K9KA 4DSKA 1ITGA 1EETA 4F2SA 2WTUA 5AZJA 3HSCA 3P39A 1U2VB 4B1UB 4LFBK 2BUPA 3OS1A 1NKEA 4JHDA 1BHLA 1QQOA 2B6AA 2DPNA 2VYPA 4QOZB 5JLFA 3F9MA 3CD6N 3O3HA 3LM2A 3LDOA 3T3FA 3SV3A 4DU1A 4L8RB 2G8VA 3ZSQA 1N8RO 2NRHA 1RT2A 2E1ZA 2YX6A 3A2FA 2O8DB 3L2UA 3LP0A 4KHNA 4BVPA 3FFKB 1BWFO 2EX3A 3DXKA 2ZE2A 4JI3K 1IKXA 3LP1A 3WT0A 5HP1A 4PKHA 1C0GA 3LZJA 1MU2A 2WOMA 4FJ7A 2P9KB 4K8XA 2QW9A 2E6LA 5GIPA 2A42A 2FSNA 1ZBFA 2VG7A 4OX9K 2NRXA 1EWQA 2UU9K 2UYTA 4CJWA 4GVMA 3HTVA 3KK3A 1SKRA 3LWMA 1JCFA 1QZ5A 5BR8K 4WFAL 4H8KA 3MN7A 1CZAN 1VQ5N 1Q18A 1T6DA 2O8CA 1J6ZA 1VSIA 1C1AA 4A5AA 1TV6A 4CZGA 3WXLA 3I0RA 3C6HA 4L3QA 4DR5K 1WSHA 4Z4EA 3O9QA 1T7PA 2KFNA 3VQ4A 3FZLA 2P9NA 1RDCA 1ZYQA 4M45A 1NNEA 1N32K 4CFCA 3LP2A 1QSYA 3CIPA 5LJWA 1ASUA 3AA3A 3TR8A 5I3UA 1LW0A 5GINA 3UIQA 4B1XB 1JL1A 4CEOA 3AO5A 4CJLA 3VESA 5EX5A 4H5TA 3CQYA 3HM9A 4NXNK 1TUYA 1BQNA 3L3UA 5AZJB 2P9PB 4RW7A 4JHDB 4EZ9A 2RPIA 3OYKA 3O3FA 4BWJA 2Y1JA 1E4FT 2YJEA 4GY2B 1V4SA 1NMDA 3DXMA 1J53A 3SAGA 2CGKA 3ULEB 4JS4A 1WNSA 1EWRA 1REVA 3LDNA 1C0FA 2XHBA 3KWIA 3SQ2A 5J1EA 3DLHA 1BIUA 1JLFA 1TK0A 3KLGA 3SQ1A 3G4SN 5DK5A 3PV8A 1U4BA 4A2BA 2WC9A 3VQBA 2IVOA 1QZ6A 5J2PA 1S1VA 4DQSA 3BF1A 4BG9A 4CJ5A 2WONA 5BR9A 2FSKA 3AAPA 1X9MA 4OO1J 1NK5A 5CYMA 2OPPA 5AQVA 4NCGA 3KWGA 5HL7L 3CG7A 3L2VA 2E2QA 1T05A 4Y1CA 3PX6A 4CEDA 2HHQA 3VEVA 1HQUA 1HPMA 1TAQA 4OGEA 4IG0A 2D4WA 4MLEA 4FSVA 3A5MC 2Q1NA 2QM1A 1NWKA 1NJWA 2NRZA 1ZXOA 3VQ9A 4O0IA 2YNIA 1NJIO 2FC0A 4JI6K 4AHTA 3CERA 1KVAA 1ZBHA 4K8ZA 3WEEB 4G1QA 3IS9A 5BRFA 4YOVA 4FW2A 2OA8A 5AQFA 1J5EK 3NH1A 1IH7A 1NK7A 3TSQA 1OVQA 3VTIA 3M3ZA 3CJCA 3KZBA 4FJNA 4KH6A 1S1TA 2O8EA 2YNHA 5JICA 1ZBUA 3VEOA 2PYJA 1FW6A 4B1VA 3M5RA 4DQIA 1KVCA 4BRMA 4WFBL 3D2FA 4CJKA 3AVBA 2XRIA 5AQPA 4CJ3A 4DLGA 3EZ5A 3V9SA 3AO3A 1EO1A 2HBJA 3K59A 3GE1A 4AILC 4ZHRA 1JLQA 3OA9A 3OJUA 3MWPA 1LWCA 2HOEA 3R3LA 1JLAA 1LV5A 2ZD1A 1K73O 3HBTA 4A57A 4CD3A 1NGJA 2A6AA 3VF6A 3AO4A 4LD0A 4FVMA 4O55A 4E1MA 4JI8K 5HRSA 3G25A 1ZBSA 1JCGA 4C8OA 3TWHA 2OZSA 3NCIA 4FLXA 4FWRA 4R5PA 4DV0K 4DTSA 3VQCA 3GL1A 4KPYA 3QEXA 4BE1A 4DFJA 1TL3A 4W5QA 3UKRB 3K9JA 3NHGA 4DTMA 3CFRA 3CC2N 3AA5X 1MWKA 1O13A 3B6PA 3IG1A 2BGGA 3MXJA 3TSUA 4FLUA 3PO4A 3OYLA 3RVCA 4CBUA 2QXLA 4FJGA 1W97L 4DR1K 4IEEA 4EHTA 2RKIA 3EL2A 3EYZA 3SNNA 1D5AA 5CYQA 3AVIA 3SUQA 5AQOA 1LAVA 2O8BB 2VCPA 3KK2A 4BGBA 3SAHA 2FF3B 3WNFA 4Z4IA 2RE2A 1QSLA 1BL3A 4B9QA 3Q7CA 4H5WA 3LWLA 4KHYA 3D2EB 4FW1A 4J2DA 4OKKA 3JSMA 3ENOA 3SYZA 4B9UA 1RT7A 2W6LA 3CFOA 2YHXA 4LF8K 4W5NA 3LZIA 2QKKA 2HMIA 4JYAK 1YXQA 1XC9A 4DTJA 3LL3A 1S9EA 2HF4A 3H46O 3A5OC 1G15A 1VQ4N 1NGDA 4UY8O 3T1AA 1CLQA 1QE1A 4OVLA 4DV4K 3K5MA 4W5OA 4FK4A 2P9UB 1RGIA 3WXJA 1VAZA 3O9UA 3QESA 2P9IA 5GADP 3SUPA 3L2WA 3RMDA 4V19S 3AVAA 3EY1A 3G6EN 3CCEN 4NB4A 3P31A 4DUZK 2G8IA 1CZ9A 4BE0A 4CZKA 4A2AA 3PSIA 4E7KA 4CEEA 5GAEP 3EN9A 4PHTX 5JVGL 4CK2A 3O3GA 4H0PA 4CJUA 3EE9A 1FKPA 1VQMN 1VQ9N 1YITN 3ZT3A 3DMJA 4CGJA 2X78A 3HPOA 1LAWA 2F4VK 3THXB 3HI0A 1Z26A 3SAFA 2NZTA 3BZKA 1BU6O 2A40A 3R1XA 4C8MA 2CH6A 4JRQA 3MMVA 3O4NA 3J81O 1XI1A 2HHHK 3CPWM 3HM8A 3KLFA 3AY9A 2QEXN 1HKGA 1FJGK 2V7ZA 1RBUA 3CJ9A 4JK7A 2Q0UA 4MLHA 4HTLA 2HHSA 4CF0A 4DFPA 3MXIA 1WBBA 1GLDG 1E4GT 2XY7A 4FWPA 4PUOA 2E8AA 3HPHA 2Q3SA 4HHTA 1N5YA 2E1YA 4ISFA 3EO3A 2ZQBA 5AFUA 4ZTJA 1GLLO 3PX4A 3OS2A 2G8KA 4IFVA 4CZFA 3EEQA 3C0BA 3VQEA 4CESA 4IG3A 3V6DA 1TGOA 4NYNA 4W5TA 3LDSA 4DU3A 1IKYA 4H5NA 5KPRA 4CHYA 3V1OA 2AJQA 3SBTA 2Y1IA 3ZSXA 1NLVA 1S6QA 4X65K 3VEWA 1TKDA 4ICLA 4FWNA 1Y97A 1U04A 3LAMA 1HR0K 1YUWA 4Z4HA 2YJFA 1TAUA 1TYQA 4N5SA 3QEVA 3MAQA 3DLGA 3RMCA 3IFRA 1FKOA 3ZEUA 2FLOA 3IUCA 1D9DA 1DTQA 5SZTA 4CHOA 1YTAA 2E6MA 3AVLA 2QWMA 1RDWX 1RDDA 4C1NI 2AP1A 1S3XA 4JI1K 3I55N 3S3NA 3DLLL 1MWMA 5GIOA 1NGEA 1ASVA 1R0AA 2GX9A 3BF3A 5FLXO 4M42A 3ULDA 1BG3A 5IWAK 4U67L 2Q2RA 3NH0A 2NRWA 5A2QO 4FZZA 1U48A 2EWSA 1IO2A 4CHNA 1VSFA 1C6VA 4E1NA 2KHOA 4OKJA 2IDOA 2KW4A 4C23A 5AQJA 1BOTO 1U2VA 1XMQK 1XC3A 5HOOA 4K43A 4C8LA 3H1VX 3JAMO 3A5NC 4NYFA 3OYHA 4BGAA 3CMAN 2IIRA 1HMVA 3HJFA 3U3YA 3VERA 2I7NA 4MFBA 1B92A 4ILJA 1XWLA 4O4GA 4BR5A 5AQNA 4FZYA 3ULEA 4XH4A 2ZJQL 4JD2A 3IRXA 1BCMA 4KBOA 3U3GA 3DLRA 4WCEL 1K9MO 2YHAA 4E7JA 5D3GA 2DY4A 1RT5A 4BQZA 5T7BA 3A8YA 1ASWA 3W3DA 1C0MA 4JK9A 1HX1A 4DMNA 3LDLA 3QFPA 3HSTB 4OGCA 3HP9A 1TVRA 4DR4K 3PO5A 2CH5A 4N41A 3NBPA 1D9FA 2NNWA 3VQ7A 5KQ8A 4RTFD 4H0YB 4FJLA 1TK5A 5LJVA 1HLUA 1HUXA 1TYQB 4KKOA 3RMAA 2QA4N 4J8FA 1RT6A 4CHPA 2QK9A 3TANA 3THWB 5HLFA 2Z1JA 1KXPA 4YOWA 4BC5A 3VQQA 3THYA 1VHXA 3G71N 3LAKA 4ZTFA 2O4IA 4B3MK 4B9LA 3KD1E 2O8FA 3MECA 5GAHP 4FJ9A 3VQPA 4AQYK 1NGCA 3T7ZA 1NGBA 4K41A 4DFMA 3OYJA 1ATRA 2Q36A 3C6TA 4B9NA 5CY4A 1XUPO 4OPKA 4O8UA 3RWUA 3TAQA 1NK4A 4KTQA 2OZMA 2QKBA 2HW3A 3ZCMA 4CBXA 4CIEA 3SK3A 3M1FA 3CFPA 3MN6A 3DI6A 4KI4A 2QI2A 3UKUB 4B1ZA 4FWKA 4DTPA 4A5BA 2E2OA 2ZM6K 3GBTA 3AVMA 4FPBA 4CFBA 1BGXT 2Q0RA 3QINA 4KTZA 1SZ2A 4QAGA 2HMPA 2PFUA 4QS8A 4E1JA 3SQ4A 1S1XA 4K42A 5AQSA 1GOCA 2P9KA 3WNEA 1X9WA 1ATNA 5GAGP 4OPAA 4M3YA 3D2EA 4GV6A 3FE1A 5C42A 3ID6A 4WE1A 3DLBA 5M1FA 1NK8A 2E4LA 3H3NO 1K8AO 4FWMA 3VQ6A 3ATVA 4JI5K 2YKNA 4DKWA 3P4IA 3C7NB 1I94K 2F9TA 4IZ9A 1F21A 4CEZA 1YIJN 5AQTA 4YOYA 4I9QA 1NOZA 3CCLN 2ATQA 2VWBA 4JKHA 1RTDA 1C1CA 1QVFM 1HNVA 2PYLA 1XQSC 2O8FB 5HBMA 2ZGZA 3KTQA 3ZX2A 3ITHA 2KZZA 5AJ3K 3QDKA 4WQ5C 3BP8A 4AHRA 4IO9L 1NJXA 3CCSN 1VQKN 3MCPA 3MWTA 4CK1A 1NKCA 3HP6A 1VK0A 5I42A 1VRTA 3TAPA 4JRPA 3SUOA 3WXKA 3KK7A 3NFAA 4F8RA 3FZKA 4CJTA 4MO4A 3LDPA 4B9VA 3DOKA 4Y0WA 2UUBK 4BR0A 4JKDA 4FLVA 1ESVA 4BE2A 3A0IX 4ID1A 4B8CA 1HKCA 5LMNK 4IXCA 1WBDA 1SKWA 3PX0A 4BDYA 4DLEA 1JLCA 3TAEA 3VMFB 4M7XA 5KGXA 2WFBA 1BA0A 4Y1DA 4O44A 3SI6A 4DWIA 3K57A 3V1RA 3R6MA 1HYZA 3QNOA 3PY8A 1UAXA 4FWLA 4WQ4C 3TTCA 1NJZA 3OYAA 4OLBA 4NCBA 3SQ0A 1Q8IA 4JI2K 3L3VA 4IOXA 2X6SA 4IFYA 4DF8A 2P5OA 5EVZA 3NF7A 1BDGA 1KAYA 1RDBA 3VTHA 2HNDA 3MX2A 3M8SA 4HCCA 1RNHA 3LALA 3WNGA 4BRAA 3ZT2A 4B9MA 3OTOK 3NF9A 4FM0A 1WLJA 4OPHA 4BG8A 3LDQA 2QXFA 3CPEA 1T3VA 4IBNA 2GTDA 5KI6A 4R79A 4PWDA 2IS3A 3ZLJA 3VEZA 4AM6A 3OYMA 4HUGA 4KH5A 4KRFA 1WSIA 2W40A 1D8YA 4EZ6A 1NK9A 3Q7BA 2QWPA 3QETA 3QEPA 4RW4A 4EFHA 3E66A 2ZWHA 3V4IA 4M3RA 3VEYA 1VRUA 5LMUK 3O9SA 3MN9A 3S41A 3SBGA 1EXQA 1RBSA 3AGRA 4WQ5A 2IAJA 4DV3K 1J9AA 4FOEA 3FLCO 2YV0X 2HF3A 5FPNA 3RSEA 4HTUA 5CHIA 1VQ7N 3J7AP 3C7NA 1WOQA 1OH5A 2P9PA 3AVNA 4DR6K 3CJ7A 3TARA 3B8AX 4CGIA 4HUFA 1VSMA 1DTTA 2D0PA 3WUHA 1V4TA 2QWOA 2HHWA 1GLJO 5E84A 4W5RA 1JL2A 1UA1A 4DSFA 1WSJA 4HUEA 5C10A 3EZWA 1ZC6A 2HBKA 4LF4K 3TAFA 1L3UA 3O4WA 4JAXA 1SV5A 3CCVN 2ZGYA 1BI4B 3KLIA 4LF7K 1L5UA 3VQ8A 5KPZA 2YNFA 4JEPA 1TUUA 3VF4A 1HYVA 3ZEUB 4DV2K 1YTUA 3D7EO 4YDUA 4EAHD 3HK2A 3NVMA 4ID5A 1J5OA 4I9LA 4KB0A 3SMPA 4N47A 3VA3A 1N6QA 5BN9A 5C2FA 4CEFA 4M3UA 2OCEA 4PQUA 1Z25A 1RT3A 3HPGA 2DFFA 3C95A 1RTHA 5DM6L 2YHBA 3ENBA 3DAWA 3MXMA 4CERA 3AAQA 4RG8A 3EKSA 5AQQA 2LSNA 4GV3A 3E9LA 3TTFA 3MK6A 4BROA 4CECA 3HXMA 3HOSA 5KGWA 1HNWK 3R9PA 4MDAA 4Z0UA 4KHWA 4BC2A 2EHGA 5ADXH 4AHCA 4BQLA 3OW2M 1EX4A 1J54A 3BGRA 5AQWA 5AQIA 3LPTA 4JI0K 3FZHA 1FXXA 4B9SA 1KCFA 3S9HA 2OPRA 5C15A 4FJKA 4K25A 3QLHA 3GG4A 3DYAA 3PSFA 4C8NA 5AQKA 3HRGA 1WB9A 4FZXC 4Q5VA 4LSNA 4A61A 2D1KA 4BRIA 1DGKN 1MDUB 1SS6A 2KFZA 1HQEA 3O8MA 3KIOA 1QS4A 4YDUC 1VQ8N 4LF6K 2A41A 3DJCA 3DRPA 3QEIA 4JS5A 2G8UA 3AO1A 5HROA 4IDKA 3VPZA 3TPQA 4DU4A 3HOTA 1IBLK 2V51B 4O0JA 3HYFA 3ALYA 3AV9A 4C8KA 1VSDA 5HRRA 4CJ7A 4KHQA 3KLEA 1EQYA 3R8EA 1KLNA 4PY5A 4FYDA 2FBXA 2P9LA 2VQEK 4IWVA 4O5FA 1IG8A 1GLCG 2FBVA 2UXCK 4FXDA 5AQYA 5CR4A 3THXA 4CJVA 3DRRA 3N4QA 2JGUA 1H1VA 1BQMA 4GKJK 3J8AA 3VETA 2WBNA 1Y64A 1LWFA 3IKMA 3CXCM 1HNZK 5BRDA 1YI2N 3O1WA 3O6WA 3JS6A 3P38A 4GVEA 3ZSWA 3ZYYX 4J2BA 3C65A 1UA0A 2B5JA 4KH4A 4Z4FA 4FWQA 4RW9A 3VOVA 1OVYA 3FR0A 3K58A 2ASOA 3HL8A 3CCQN 3T19A 1P8ZA 4DR2K 4QCLA 4FK2A 4I2PA 4JLHA 4JI4K 1FK9A 4BR2A 2O8EB 1RBTA 5LL6Z 3ZSZA 1TKTA 2W41A 4CIGA 3E01A 2UUAK 1WSEA 2KKZA 3CI5A 5J2NA 1SUQA 2HVHA 1BIZA 4CZJA 1KLMA 1BI4A 2OANA 4CJFA 1X1PA 2FF6A 3WXMB 4DSEA 1NG9A 2XO7A 4E89A 2ZF5O 4AHSA 4AHVA 3EKUA 1YJNN 1BA1A 5FPDA 4BVOA 4YNQA 4LY7A 2P5GA 1JXEA 3CC4N
chains in the Genus database with same CATH topology
4BRPA 3W0LA 1QZ6A 4CBXA 2V52B 3SK3A 3M1FA 3MDQA 1GLFO 3BF1A 4BG9A 2ASPA 3MN6A 5BR9A 2QI2A 5M1NA 3UKUB 4H5VA 2FSKA 3AAPA 4FWKA 4B1ZA 4DB3A 4OO1J 1JCEA 4BRLA 4A5BA 3I8BA 2E2OA 5AQVA 3GBTA 4FPBA 3KWGA 5HL7L 3I56N 3TTDA 3E9OA 1LOTB 1RFQA 2E2QA 2Q0RA 4WQ4A 4H0VB 3U9DA 4YORA 4Z94A 5BPLA 4ISGA 3MX5A 1NGGA 3VEVA 1SZ2A 2GUPA 5TKYA 1HPMA 1JJ2M 4YOTA 2HMPA 2PFUA 4QS8A 4E1JA 1K8KB 3I33A 3F5TA 3AGKA 5FPMA 2YHYA 4CZMA 1D4XA 4H0XB 2D4WA 4CBWA 4MLEA 5AQXA 3CC7N 1DT9A 4FSVA 5EOYA 4K42A 5AQSA 4JN4A 2P9KA 3A5MC 4B1WB 3WQTA 1ATNA 5GAGP 2Q1NA 2QM1A 3KHYA 1NWKA 4OPAA 2NRZA 3D2EA 1ZXOA 1LCUA 3FE1A 5C2DA 4GV6A 3ID6A 5M1FA 1NJIO 1QQNA 3H3NO 3CHWA 1K8AO 5AFUH 4FWMA 1HKBA 3CERA 3FZMA 4IFEA 3ATVA 3ZX0A 3WEEB 4CZLA 5BRFA 4DKWA 4YOVA 1MA9B 3ZETA 3C6AA 3P4IA 3C7NB 5AQFA 5MLCQ 1SQKA 2F9TA 4IZ9A 1YIJN 4FWSA 1RDUA 5BRHA 5AQTA 4YOYA 3TSQA 4JKEA 3VTIA 3M3ZA 5AQRA 3CJCA 3KZBA 2KLAA 3WXIA 3CCLN 4KH6A 2VWBA 4JKHA 2V7YA 4CD1A 5JICA 1QVFM 1VQ6N 1XQSC 3VEOA 4PL8A 5M1OA 4B1VA 3UE5A 4EHUA 2P9UA 3M5RA 1YJWN 1Q82O 2ZGZA 4IOCL 4BRMA 3AARA 4WFBL 3D2FA 1M1KO 3ZX2A 4JKCA 5AQPA 3NMUA 2NLXA 5JVHL 3TU5A 5M1KA 3PIPL 1EO1A 1YVNA 2HBJA 1ATSA 2HBMA 3QDKA 1Q7YO 3GE1A 4WQ5C 3BP8A 1VQKN 4IO9L 4IOAL 3CCSN 3MCPA 3OA9A 5BN8A 2AA4A 4BRNA 3MWPA 2HOEA 2BTFA 3R3LA 5AZIB 3MWTA 1NGHA 2Q31A 3VGMA 1K73O 3HBTA 4A57A 4BREA 4BC4A 2A5XA 4CD3A 2FSJA 4JKFA 1NGJA 4CZIA 2A6AA 3VF6A 1Z6RA 3WXKA 3A5LC 3KK7A 1KD1O 1T6CA 3DXMB 4QS9A 2HSTA 3VEXA 2NRVA 4H0OA 4M7YA 1KAXA 3FZKA 4JKAA 5JLHA 3G25A 3CF5L 3OBYA 4JD2B 3IMXA 1ZBSA 1JCGA 4MO4A 3LDPA 1Z05A 4Y0WA 1R59O 4BR0A 4JKDA 4FO0A 1ESVA 1K8KA 4ILHA 3A0IX 1HKCA 2CGLA 2P9SA 3EE8A 4FWRA 4IXCA 4FL9A 4HWIA 3N4PA 3OBWA 1KC8O 3QB0A 4IEIA 2E2PA 1Q86O 4MO5A 3CCJN 5DM7L 4XEIA 3GL1A 3O80A 3VMFB 5M1QA 4A59A 2J4RA 1G99A 2YCHA 4AF1A 4M7XA 5BREA 2WFBA 4WFNL 1BA0A 5F1XA 4C1NK 4JKBA 1GLAG 5AR0A 1NGFA 3R6MA 3UKRB 4H03B 3K9JA 3CJBA 3SJHA 4O8KA 4DCHA 3FZFA 3CJ1A 3HZ6A 4FWLA 4WQ4C 3TTCA 3MCAB 4BY9C 3WEEA 2RHKA 4NLCA 2F7TA 1YHQN 3CC2N 3VGLA 2CGJA 2GELA 4BR7A 3CJAA 1MWKA 4U7BA 1O13A 3VGKA 3H3OB 3J7ZO 2OTJN 3TSUA 1VQPN 2WUSA 1X9JA 2IVNA 4IOXA 5H1SQ 4RWTA 3RVCA 1BUPA 4CBUA 5EVZA 2QXLA 3O9RA 1BDGA 1W97L 4NLBA 4IEEA 4EHTA 1KAYA 3EL2A 4XH1A 5ELZA 5AQOA 3VTHA 4DHYA 1Q81O 1S72N 4F9OA 4FOIA 2E2NA 3MX2A 3QFUA 4BRAA 2VCPA 2P9SB 2P9IB 4BGBA 3SAHA 2FF3B 2RE2A 4OPHA 3F2KA 4B9QA 3Q7CA 4H5WA 3D2EB 4BG8A 3LDQA 2GEMA 3ENOA 3CPEA 1T3VA 1ILYA 2GTDA 4BRQA 2YHXA 4R79A 4CI6A 5AQZA 3UKRA 3VEZA 4B1YB 3TSPA 4AM6A 3JXUA 5C12A 3PIOL 4KH5A 1YXQA 3LL3A 4ISEA 2W40A 4BRGA 2HF4A 3H46O 3A5OC 2P9LB 5BPMA 3Q7BA 2JWLA 1VQ4N 2QWPA 3U4LA 1NGDA 3E66A 4EFHA 4UY8O 5F0XA 3OHRA 2PAVA 2H3GX 1P90A 2ZWHA 3VEYA 4BRFA 4YOUA 3O5BA 3O9SA 5ADXA 2OTLN 3MN9A 2P9UB 3S41A 3WQUA 3SBGA 2P9NB 4GNIA 1RGIA 3D2FB 3AGRA 4WQ5A 3CCUN 3E9PA 1VAZA 1YAGA 3WXJA 2ASMA 4FOEA 4EIAA 5BPNA 2ZJPL 3O9UA 2FXUA 3FLCO 2F9WA 4CZEA 4NO7A 2P9IA 5GADP 2HF3A 5FPNA 5LY3A 3RSEA 3CQXA 3GOIA 2E20A 1M90O 3G6EN 5CHIA 5FPEA 4PL7A 1VQ7N 2GWKA 3DWLA 3CCEN 4NB4A 3P31A 5AQUA 3C7NA 1WOQA 2GWJA 3CMEN 5KQDA 2P9PA 1NBWA 3CJ7A 3E1YA 4A2AA 4CZKA 3ATUA 2D0OA 5GAEP 3EN9A 3B8AX 4PHTX 5C0YA 3O9TA 3H45C 3ZX3A 5JVGL 3M6GA 4FVUA 1BO5O 2D0PA 4PKIA 1V4TA 2QWOA 4H0PA 2ITMA 4IJAA 3EE9A 3WUHA 1W2BM 1VQMN 4IDHA 3NVKA 1GLJO 1VQ9N 5E84A 5B8HA 3GDQA 1YITN 5TKWA 1DKGD 1VQNN 3UB5A 3D6RA 3FGUA 1X3MA 3HI0A 3SAFA 2NRRA 5AQHA 2NZTA 4BRHA 1BU6O 5C10A 3EZWA 2A40A 1ZC6A 2HBKA 2CH6A 3R1XA 3MMVA 3VENA 3CPWM 1IJJA 3HM8A 1QHAA 3O4WA 4IO8A 4JAXA 3CCVN 1X3NA 2ZGYA 3AY9A 3LM9A 1S22A 2PBDA 3O1BA 2QEXN 1HKGA 3QICA 4M63C 2V7ZA 3L0QA 1YJ9N 3CJ9A 3L4QA 4JK7A 2Q0UA 4MLHA 4QS7A 1U6ZA 2Q97A 3ID8A 4HTLA 1WUAA 3RSEB 1GLDG 1NGAA 3T69A 3SLCA 3CCRN 4BRKA 4IJNA 5KPZA 1E4GT 2VGMA 3ENHA 4JEPA 1TUUA 3VF4A 4FWPA 2E8AA 5M1PA 3ZEUB 4AM7A 4XH5A 3KVGA 4A62A 5I9EB 3D7EO 4ILGB 4YDUA 3UKUA 2A3ZA 2E1YA 1GLBG 4ISFA 4EAHD 4PKGA 2I7PA 3EO3A 3NVMA 3BUZB 5EXWA 4JKGB 3QBWA 5AFUA 5KPTA 1GLLO 3SMPA 3O08A 5CE3A 5BN9A 5C2FA 4I6MA 4CZFA 1KAZA 3C0BA 2QWQA 4BRCA 4CZHA 2ZJRL 1NGIA 3BEXA 5DM6L 3ENBA 4H5NA 3K9KA 3DAWA 5KPRA 4YOXA 3AAQA 2E88A 3EKSA 2JWKA 1QQMA 5AQQA 4GV3A 3E9LA 3SBTA 3TTFA 1NLVA 3MK6A 4BROA 1SAZA 5AZJA 3HOSA 3VEWA 3HSCA 3P39A 4FWNA 2YI1A 3R9PA 4MDAA 4DQ8A 1U2VB 4B1UB 1YUWA 2BUPA 4BC2A 5ADXH 4BQLA 3OW2M 1QVGM 4JHDA 1QQOA 2DPNA 2QWNA 5AQWA 5AQIA 2VYPA 5JLFA 2YJFA 3FZHA 1TYQA 4H5RA 3F9MA 3L4IA 3CD6N 3IFRA 3LM2A 1DEJA 1OKJA 3LDOA 1T44A 5E26A 5C15A 3ZEUA 2FLOA 4K25A 3IUCA 4JK8A 4WYBA 4BR9A 3GG4A 2HBLA 5AQKA 3HRGA 1N8RO 2QWMA 2NRHA 1RDWX 2NRTA 4A61A 2D1KA 2AP1A 2YX6A 1S3XA 2E1ZA 1DGKN 1MDUB 2QWLA 1SS6A 4BRIA 4C1NI 3I55N 2BH1A 3DLLL 3O8MA 1MWMA 4I6MB 4BVPA 5GIOA 3FFKB 1BWFO 1NGEA 3DXKA 5AQMA 4YDUC 2GX9A 1VQ8N 3BF3A 2A41A 4GV9A 3WT0A 4PKHA 1BG3A 1C0GA 3DJCA 2Q2RA 4U67L 2NRWA 3U9ZA 1VQLN 2EWSA 2P9KB 3TPQA 2QW9A 3VPZA 3HOTA 3QBXA 5GIPA 2A42A 2KHOA 2FSNA 2V51B 5F2RA 4BRDA 4C23A 3PLAA 2NRXA 5AQJA 1BOTO 1U2VA 3SMSA 1XC3A 2UYTA 5HOOA 3HTVA 4K43A 5AZIA 3H1VX 3A5NC 4CJ7A 3L6QA 3CMAN 4BGAA 1JCFA 1QZ5A 1EQYA 3R8EA 4WFAL 2IIRA 3MN7A 1CZAN 1VQ5N 2P9LA 1Q18A 1T6DA 3VERA 4JNEA 1J6ZA 2I7NA 2YHWA 4IWVA 1NM1A 1HJOA 4O5FA 1IG8A 4A5AA 1GLCG 4CZGA 3WXLA 3CCMN 5EY4A 3C6HA 4ILJA 4L3QA 4BR5A 5AQNA 2QWRA 3ULEA 4XH4A 2ZJQL 2IVPA 1GLEG 2QTDA 3O9QA 5CR4A 5AQYA 4JD2A 3FZLA 2P9NA 4KBOA 3N4QA 1H1VA 4WCEL 1K9MO 3CIPA 5JMVA 3J8AA 3VETA 5LJWA 2WBNA 1Y64A 3DXKB 3IKMA 4BQZA 5GINA 4G9ZA 3CXCM 3A8YA 5BRDA 4B1XB 3O1WA 3W3DA 1YI2N 4JK9A 1HX1A 4H5TA 3O6WA 3LDLA 3CQYA 3QFPA 4FWOA 5EX5A 3VESA 1TUYA 5AZJB 3JS6A 3U8XA 2CH5A 3H1QA 3MN5A 3P38A 4GVEA 2NNWA 5KQ8A 4RTFD 2P9PB 4H0YB 3H6EA 4MDBA 4JHDB 1YF5L 3IDHA 5LJVA 3ZYYX 3ZETB 1HLUA 1HUXA 3C65A 1TYQB 4KH4A 3QMLA 2QA4N 4H0TB 4J8FA 4FWQA 3VOVA 1OVYA 1E4FT 3FR0A 4JKGA 2ASOA 2YJEA 4GY2B 4RCHA 1P8ZA 3CCQN 1V4SA 1NMDA 3DXMA 4BC3A 1KXPA 4YOWA 4BC5A 5AQLA 4BR2A 3G71N 3SAGA 2CGKA 3ULEB 5GAHP 1KQSM 2W41A 1NGCA 4WF9L 2KKZA 3CI5A 3LDNA 1C0FA 3T7ZA 1NGBA 4CZJA 4K41A 3KWIA 2OANA 2Q36A 1ATRA 2FF6A 4LC9B 3VF2A 3WXMB 1XUPO 5AQGA 4O8UA 3G4SN 1VQON 2ZF5O 2VGNA 3EKUA 4BR4A 4A2BA 2WC9A 1YJNN 3CETA 1BA1A 5FPDA 4BVOA 2IVOA 4FPAA 3CC4N
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DLL L;  3CCE N;  3CME N;  1VQ8 N;  1KC8 O;  4U67 L;  5GAE P;  5HL7 L;  3I56 N;  1Q86 O;  3CCJ N;  5DM7 L;  5JVG L;  1VQL N;  1W2B M;  4WFN L;  1VQM N;  1VQ9 N;  1YIT N;  1VQN N;  1JJ2 M;  1YHQ N;  3CC2 N;  3CMA N;  3CPW M;  3CC7 N;  4WFA L;  3CCV N;  3J7Z O;  1VQ5 N;  2OTJ N;  1VQP N;  2QEX N;  5GAG P;  1YJ9 N;  1KQS M;  5H1S Q;  3CCM N;  2ZJQ L;  1NJI O;  1K8A O;  3CCR N;  4WCE L;  1Q81 O;  1K9M O;  1S72 N;  5MLC Q;  1YIJ N;  3CXC M;  1YI2 N;  3CCL N;  1ILY A;  1QVF M;  1VQ6 N;  1YJW N;  2ZJR L;  1Q82 O;  5DM6 L;  4IOC L;  4WFB L;  3PIO L;  1M1K O;  2QA4 N;  5JVH L;  1OVY A;  3CCQ N;  3PIP L;  1Q7Y O;  1VQ4 N;  1VQK N;  3G71 N;  4IO9 L;  4IOA L;  3CCS N;  4UY8 O;  3OW2 M;  1QVG M;  5GAH P;  1K73 O;  2OTL N;  4WF9 L;  3CD6 N;  3CCU N;  2ZJP L;  1KD1 O;  3G4S N;  1VQO N;  5GAD P;  1N8R O;  1YJN N;  3CF5 L;  3I55 N;  1M90 O;  3G6E N;  1VQ7 N;  3CC4 N; 
#chains in the Genus database with same CATH topology
 4BRP A;  3W0L A;  2V52 B;  3TAG A;  1NMN A;  3MDQ A;  2ASP A;  2ITG A;  3SPZ A;  4H5V A;  2HNZ A;  4DB3 A;  2UXD K;  3I8B A;  3LP3 A;  2D0A A;  1Q9X A;  2FBT A;  3K5O A;  3TTD A;  1LOT B;  1RFQ A;  4WQ4 A;  4H0V B;  3U9D A;  4YOR A;  4Z94 A;  4HCB A;  3P5J A;  4DQR A;  4Z4G A;  1NGG A;  3V81 A;  4LF5 K;  5TKY A;  3I33 A;  3F5T A;  3THV A;  5FPM A;  4CZM A;  4H0X B;  5AQX A;  4K0K K;  3PUF A;  1DT9 A;  3CC7 N;  5CZ1 A;  1S1U A;  3WQT A;  2UUC K;  3KHY A;  2HHU A;  1S6P A;  2W6K A;  3J7Y P;  4DV7 K;  1QQN A;  2VWK A;  3ZSY A;  5AFU H;  1HKB A;  4DFK A;  3C6A A;  4B3O A;  3M8Q A;  1SQK A;  1XHZ A;  1NU0 A;  4CHZ A;  3V9U A;  1RDU A;  5BRH A;  4JKE A;  3L2Q A;  1B9D A;  4B9T A;  2KLA A;  4DTR A;  4CD1 A;  1BIS A;  2XY5 A;  3VQA A;  1VQ6 N;  3RMB A;  3NF8 A;  3OYG A;  3UE5 A;  4LH4 A;  4EHU A;  3OYC A;  1YJW N;  4KB1 A;  1Q82 O;  4IOC L;  1RDA A;  1BCO A;  4JKC A;  5JVH L;  4CK3 A;  5M1K A;  4CF9 A;  3CQ8 A;  1S1W A;  4EP4 A;  2BAN A;  2HBM A;  1YT3 A;  2B4J A;  1SKS A;  2HHX A;  4IOA L;  4CFD A;  3JYT A;  2AA4 A;  4BRN A;  1NJY A;  2Q31 A;  4X66 K;  3OYD A;  3VQ5 A;  2FSJ A;  4JKF A;  4DF4 A;  4CZI A;  1Z6R A;  4N76 A;  1T6C A;  4DSJ A;  4OJR A;  4QS9 A;  2NRV A;  4H0O A;  4KFB A;  4CF2 A;  3AVJ A;  1KAX A;  3THY B;  4JKA A;  4CGF A;  5JLH A;  3CF5 L;  1VSL A;  1TKZ A;  4KI6 A;  1VSJ A;  1R59 O;  3LAN A;  4FO0 A;  3VQD A;  4BDZ A;  2CGL A;  3EE8 A;  3N4P A;  3OBW A;  4J2E A;  2D0B A;  1IBM K;  4E3S A;  2BDP A;  5C25 A;  5M1Q A;  4A59 A;  4AF1 A;  3TI0 A;  2YCH A;  2P51 A;  4FJH A;  5F1X A;  4C1N K;  5FRM A;  4H03 B;  4KHS A;  1RT4 A;  4O8K A;  4DCH A;  3HZ6 A;  3MCA B;  3WEE A;  5FRO A;  2RHK A;  3NF6 A;  3VGL A;  3CJA A;  4U7B A;  3ZSV A;  2IGI A;  3H3O B;  3J7Z O;  3C6U A;  2OTJ N;  1W9H A;  2WUS A;  3ZT4 A;  4OKE A;  5H1S Q;  4E19 A;  2JLE A;  1A5V A;  3O9R A;  1RTJ A;  1U47 A;  3V9W A;  2G8F A;  4XH1 A;  5ELZ A;  2D5R A;  4F9O A;  2Z1I A;  4FOI A;  3MEG A;  3QFU A;  4CIF A;  1KSP A;  2P9S B;  3QO9 A;  1RTI A;  2GEM A;  4F3O A;  4CEB A;  3SUN A;  3ISN C;  4E7H A;  4BRQ A;  2ETJ A;  4KHP K;  1JKH A;  4CI6 A;  5HRP A;  3TSP A;  3NGI A;  3M8P A;  3JXU A;  3PIO L;  1GOB A;  1WAF A;  3KJV A;  4EP5 A;  4B08 A;  4ISE A;  4AHU A;  1HNI A;  4IKF A;  4XIU A;  5BPM A;  4HVJ A;  4Z4C A;  3U4L A;  2PAV A;  2H3G X;  4BRF A;  4YOU A;  4CJ4 A;  1SL0 A;  2OTL N;  2KQ2 A;  2O4G A;  3WQU A;  3DM2 A;  1JLB A;  4GNI A;  4NXM K;  1TK8 A;  3E9P A;  4JI7 K;  1YAG A;  1CXU A;  2VG6 A;  2ASM A;  3AVC A;  2ZJP L;  5BPN A;  1IG9 A;  1HYS A;  2FXU A;  4FJI A;  2F9W A;  4NO7 A;  1TKX A;  3NGY A;  2F8T A;  2NUB A;  1M90 O;  5FPE A;  3DLE A;  2GWK A;  1QSS A;  1L3S A;  2GWJ A;  4I2Q A;  4M41 A;  3CME N;  5SWM A;  5KQD A;  1IKW A;  4CEA A;  1DLO A;  4DTX A;  4KHU A;  1C1B A;  2D0O A;  3ASM A;  3O9T A;  4FVU A;  1BO5 O;  4FM1 A;  1W2B M;  4IJA A;  2KZM A;  4IDH A;  4B3T K;  4GW6 A;  3G10 A;  5B8H A;  5TKW A;  3UB5 A;  3FGU A;  4JV5 K;  4PA1 A;  4LF9 K;  3AA4 A;  1X3M A;  2NRR A;  1A5X A;  2DFE A;  4RW6 A;  2VQF K;  2Z1G A;  1IJJ A;  1HPZ A;  4O5B A;  2HHT A;  2O8B A;  1X3N A;  3LM9 A;  1S22 A;  4CJP A;  2VWJ A;  3O1B A;  5KTQ A;  4M63 C;  1YJ9 N;  3L4Q A;  5C24 A;  4M3W A;  4M3Z A;  4BAC A;  1WUA A;  3RSE B;  3L8B A;  4BRK A;  4IJN A;  3P1G A;  3ENH A;  4FCY A;  2RN2 A;  3OYE A;  2DTU A;  2X6N A;  5M1P A;  3KVG A;  5I9E B;  4ILG B;  3UKU A;  4PKG A;  5EXW A;  2R7Y A;  1VSH A;  4KO0 A;  3RR8 A;  4J2A A;  5CE3 A;  3D45 A;  1WSG A;  5E41 A;  1KAZ A;  4CZH A;  3OYN A;  3ZT0 A;  3RR7 A;  2PZS A;  4DQQ A;  4H4M A;  4YOX A;  1XNR K;  2E88 A;  2JWK A;  1QQM A;  2OPS A;  3NH2 A;  4CGH A;  2HNY A;  1SAZ A;  1HJR A;  2YI1 A;  4DQ8 A;  4CJS A;  1ZBI A;  1QVG M;  3QIO A;  2QWN A;  3HVT A;  4H5R A;  3L4I A;  3CM6 A;  1DEJ A;  1OKJ A;  1T44 A;  5E26 A;  2O8C B;  4ELU A;  3SZ2 A;  4JK8 A;  1I3A A;  4WYB A;  4BR9 A;  3K5L A;  2HBL A;  1XHX A;  3P83 D;  3KK1 A;  3BZC A;  1RT1 A;  2NRT A;  3K2P A;  1WAJ A;  2QWL A;  4CGG A;  3T1Y K;  1RBV A;  2BH1 A;  3NDK A;  3AO2 A;  3AA2 A;  4I6M B;  4FLY A;  1I39 A;  5AQM A;  3ZT1 A;  2UXB K;  4GV9 A;  1QQC A;  1IV0 A;  4M3T A;  3I8D A;  3U9Z A;  1VQL N;  1LWE A;  4FLT A;  3QBX A;  4CGD A;  5JS1 A;  5F2R A;  4BRD A;  3PLA A;  1CXQ A;  1XNQ K;  3SMS A;  2F96 A;  4CJR A;  5AZI A;  2DFH A;  3L6Q A;  3AVH A;  3HT3 A;  2VG5 A;  3OS0 A;  1KVB A;  4BWM A;  1NK0 A;  2RF2 A;  4JNE A;  2YHW A;  1NM1 A;  1HJO A;  3NE6 A;  1KQS M;  3CCM N;  5EY4 A;  2QWR A;  3OYF A;  2IVP A;  1GLE G;  2QTD A;  4CVN E;  3SPY A;  1OH6 A;  4LFA K;  4GMJ B;  5JMV A;  4CE9 A;  4BDP A;  3DXK B;  4G9Z A;  5FRN A;  4CJE A;  1X9S A;  4X62 K;  4DS5 A;  2IOC A;  1WSF A;  4FWO A;  5EU7 A;  2G8W A;  3U8X A;  3MN5 A;  3H1Q A;  4M3X A;  4DUY K;  5FDL A;  3V9X A;  2FBY A;  3ZSR A;  4FLZ A;  3H6E A;  4H4O A;  4MDB A;  3QER A;  1NOY A;  4FJ8 A;  1YF5 L;  3IDH A;  3ZET B;  2X74 A;  3WNH A;  3QML A;  4H0T B;  4JKG A;  4RCH A;  4BC3 A;  1S5J A;  4FJ5 A;  3O4Q A;  5AQL A;  4F4K A;  3QEW A;  1A5W A;  4FLW A;  4WF9 L;  1YVU A;  3ZSO A;  4CFA A;  4CF8 A;  4LC9 B;  3VF2 A;  3AVF A;  4LH5 A;  5AQG A;  1HRH A;  2I5J A;  4CHQ A;  3SV4 A;  3V1Q A;  4ELV A;  1VQO N;  2VGN A;  4BR4 A;  3TAB A;  3CET A;  1W0H A;  4FJJ A;  2HVI A;  4FPA A;  4TSX A;  4YY3 K;  4DS4 A;  1GLF O;  5M1N A;  4DR7 K;  1N36 K;  1RBR A;  1JCE A;  4BRL A;  3F73 A;  3I56 N;  3E9O A;  1NKB A;  3S3M A;  3VN5 A;  5BPL A;  4ISG A;  3MX5 A;  1OH8 A;  4ELT A;  3OVN A;  2GUP A;  1JJ2 M;  4YOT A;  4CJQ A;  1K8K B;  1T03 A;  4E7L A;  3AGK A;  3NAE A;  2YHY A;  1D4X A;  2P1J A;  2OYQ A;  4B3S K;  4CBW A;  2Z1H A;  1HNX K;  4FM2 A;  5EOY A;  4JN4 A;  2F8S A;  4B1W B;  3AVG A;  3RRG A;  1XMO K;  2KTQ A;  1LCU A;  5C2D A;  4E0D A;  3CHW A;  3FZM A;  4IFE A;  3ZX0 A;  3MEE A;  4CZL A;  1LW2 A;  1MA9 B;  4CEQ A;  3ZET A;  5MLC Q;  1N33 K;  1VSK A;  1N34 K;  1JLG A;  4B8A B;  4FWS A;  4UQG A;  1UOC A;  5AQR A;  4E7I A;  4LFC K;  3I0S A;  3WXI A;  2V7Y A;  5J2M A;  3K0S A;  4PL8 A;  5M1O A;  2P9U A;  2XY8 A;  3AAR A;  1M1K O;  3NMU A;  2NLX A;  4DTO A;  3NGZ A;  3DRS A;  1Q9Y A;  3TU5 A;  3PIP L;  1YVN A;  1ATS A;  1Q7Y O;  4FJM A;  2YNG A;  5BN8 A;  4MQ3 A;  2BTF A;  5AZI B;  3IAY A;  1NGH A;  3VGM A;  4BRE A;  4BC4 A;  2A5X A;  4CW7 B;  3A5L C;  1KD1 O;  4DQP A;  3DXM B;  2HST A;  3VEX A;  3HO1 A;  4M7Y A;  3OBY A;  4JD2 B;  3IMX A;  5DMR A;  1Z05 A;  1W7A A;  4CCH A;  4YHH K;  1T8E A;  1K8K A;  4ILH A;  2G8H A;  4OPJ A;  4DR3 K;  3J80 O;  4DSL A;  2P9S A;  4FL9 A;  4HWI A;  1KC8 O;  1L3T A;  4I7F A;  3OJS A;  3QB0 A;  1C0T A;  2E2P A;  4IEI A;  1IBK K;  1Q86 O;  4MO5 A;  3CCJ N;  5DM7 L;  4F2R A;  5IT9 O;  1ZBL A;  4XEI A;  3O80 A;  5BRE A;  1U49 A;  2J4R A;  1G99 A;  4WFN L;  3BY5 A;  4JKB A;  1GLA G;  5AR0 A;  1NGF A;  3SJH A;  3CJB A;  3T1H K;  3FZF A;  3CJ1 A;  1KRP A;  4BY9 C;  5K14 A;  4NLC A;  2F7T A;  4DSI A;  1YHQ N;  2CGJ A;  2GEL A;  4BR7 A;  3U6F A;  3THW A;  3B6O A;  4KAZ A;  3VGK A;  3G0Z A;  1TL1 A;  1VQP N;  1X9J A;  2IVN A;  1SL1 A;  3OY9 A;  4RWT A;  4DV6 K;  1BUP A;  3OYI A;  2A1S A;  4CF1 A;  4NLB A;  3SCX A;  2O8D A;  4KRE A;  2HB5 A;  4DHY A;  1Q81 O;  1KFD A;  3KKS A;  1S72 N;  2E2N A;  1WN7 A;  4FJX A;  3OYB A;  2P9I B;  1O1W A;  3F2K A;  1UWB A;  3CM5 A;  1ILY A;  4N56 A;  4DTN A;  1VSE A;  3DOL A;  5AQZ A;  3UKR A;  4B1Y B;  5C12 A;  3L2R A;  4KV8 A;  3QIP A;  3S3O A;  3DLK A;  3MED A;  3C94 A;  4BRG A;  1GOA A;  1KFS A;  2P9L B;  1QTM A;  3KD5 E;  2JWL A;  2IC3 A;  4AH9 A;  2GUI A;  5F0X A;  3OHR A;  3F9K A;  1P90 A;  4RW8 A;  3K5N A;  2GV9 A;  1U45 A;  3O5B A;  5ADX A;  1S9G A;  3TAM A;  3KLH A;  2P9N B;  3D2F B;  3CCU N;  4GKK K;  4EIA A;  2YKM A;  3SJJ A;  3FFI A;  1JXB A;  4CZE A;  4FK0 A;  1RIL A;  5LY3 A;  3CQX A;  3GOI A;  2E20 A;  4DG1 A;  4B3R K;  2OPQ A;  4PL7 A;  1NK6 A;  3DWL A;  1C0U A;  5AQU A;  1SL2 A;  4LSL A;  1NBW A;  4NCA A;  5J2Q A;  3E1Y A;  3ATU A;  3H08 A;  4DV1 K;  3BDP A;  5C0Y A;  3ZX3 A;  3H45 C;  3M6G A;  1B9F A;  1L3V A;  2HHV A;  4PKI A;  2ITM A;  2PY5 A;  4Q0B A;  3NVK A;  3GDQ A;  3QNN A;  1DKG D;  1VQN N;  3D6R A;  5CZ2 A;  3CYM A;  4KTW A;  2A1R A;  5AQH A;  4BRH A;  1CZB A;  3VEN A;  2BE2 A;  2GBZ A;  4X64 K;  1QHA A;  4IO8 A;  3D0P A;  3AVK A;  5KRS A;  2PBD A;  3QIC A;  1RCH A;  3L0Q A;  4OLA A;  2W42 A;  4QS7 A;  2XY6 A;  1KTQ A;  1U6Z A;  2Q97 A;  3ID8 A;  1K6Y A;  4DV5 K;  3VA0 A;  2D0C A;  1NGA A;  3T69 A;  3KKR A;  3SLC A;  3CCR N;  2VGM A;  1EP4 A;  5KRT A;  4AM7 A;  4XH5 A;  4A62 A;  1JLE A;  3HVR A;  5JS2 A;  2A3Z A;  1GLB G;  1OH7 A;  2I7P A;  3RRH A;  3BUZ B;  4JKG B;  3QBW A;  3RTV A;  1QHT A;  5KPT A;  3O08 A;  3LPU A;  1EKE A;  4I6M A;  4YFU A;  3V9Z A;  1E3M A;  2QWQ A;  4BRC A;  4F3T A;  1IKV A;  5HRN A;  4DTU A;  2E5L K;  2ZJR L;  1NGI A;  3BEX A;  3M8R A;  3K9K A;  4DSK A;  1ITG A;  1EET A;  4F2S A;  2WTU A;  5AZJ A;  3HSC A;  3P39 A;  1U2V B;  4B1U B;  4LFB K;  2BUP A;  3OS1 A;  1NKE A;  4JHD A;  1BHL A;  1QQO A;  2B6A A;  2DPN A;  2VYP A;  4QOZ B;  5JLF A;  3F9M A;  3CD6 N;  3O3H A;  3LM2 A;  3LDO A;  3T3F A;  3SV3 A;  4DU1 A;  4L8R B;  2G8V A;  3ZSQ A;  1N8R O;  2NRH A;  1RT2 A;  2E1Z A;  2YX6 A;  3A2F A;  2O8D B;  3L2U A;  3LP0 A;  4KHN A;  4BVP A;  3FFK B;  1BWF O;  2EX3 A;  3DXK A;  2ZE2 A;  4JI3 K;  1IKX A;  3LP1 A;  3WT0 A;  5HP1 A;  4PKH A;  1C0G A;  3LZJ A;  1MU2 A;  2WOM A;  4FJ7 A;  2P9K B;  4K8X A;  2QW9 A;  2E6L A;  5GIP A;  2A42 A;  2FSN A;  1ZBF A;  2VG7 A;  4OX9 K;  2NRX A;  1EWQ A;  2UU9 K;  2UYT A;  4CJW A;  4GVM A;  3HTV A;  3KK3 A;  1SKR A;  3LWM A;  1JCF A;  1QZ5 A;  5BR8 K;  4WFA L;  4H8K A;  3MN7 A;  1CZA N;  1VQ5 N;  1Q18 A;  1T6D A;  2O8C A;  1J6Z A;  1VSI A;  1C1A A;  4A5A A;  1TV6 A;  4CZG A;  3WXL A;  3I0R A;  3C6H A;  4L3Q A;  4DR5 K;  1WSH A;  4Z4E A;  3O9Q A;  1T7P A;  2KFN A;  3VQ4 A;  3FZL A;  2P9N A;  1RDC A;  1ZYQ A;  4M45 A;  1NNE A;  1N32 K;  4CFC A;  3LP2 A;  1QSY A;  3CIP A;  5LJW A;  1ASU A;  3AA3 A;  3TR8 A;  5I3U A;  1LW0 A;  5GIN A;  3UIQ A;  4B1X B;  1JL1 A;  4CEO A;  3AO5 A;  4CJL A;  3VES A;  5EX5 A;  4H5T A;  3CQY A;  3HM9 A;  4NXN K;  1TUY A;  1BQN A;  3L3U A;  5AZJ B;  2P9P B;  4RW7 A;  4JHD B;  4EZ9 A;  2RPI A;  3OYK A;  3O3F A;  4BWJ A;  2Y1J A;  1E4F T;  2YJE A;  4GY2 B;  1V4S A;  1NMD A;  3DXM A;  1J53 A;  3SAG A;  2CGK A;  3ULE B;  4JS4 A;  1WNS A;  1EWR A;  1REV A;  3LDN A;  1C0F A;  2XHB A;  3KWI A;  3SQ2 A;  5J1E A;  3DLH A;  1BIU A;  1JLF A;  1TK0 A;  3KLG A;  3SQ1 A;  3G4S N;  5DK5 A;  3PV8 A;  1U4B A;  4A2B A;  2WC9 A;  3VQB A;  2IVO A;  1QZ6 A;  5J2P A;  1S1V A;  4DQS A;  3BF1 A;  4BG9 A;  4CJ5 A;  2WON A;  5BR9 A;  2FSK A;  3AAP A;  1X9M A;  4OO1 J;  1NK5 A;  5CYM A;  2OPP A;  5AQV A;  4NCG A;  3KWG A;  5HL7 L;  3CG7 A;  3L2V A;  2E2Q A;  1T05 A;  4Y1C A;  3PX6 A;  4CED A;  2HHQ A;  3VEV A;  1HQU A;  1HPM A;  1TAQ A;  4OGE A;  4IG0 A;  2D4W A;  4MLE A;  4FSV A;  3A5M C;  2Q1N A;  2QM1 A;  1NWK A;  1NJW A;  2NRZ A;  1ZXO A;  3VQ9 A;  4O0I A;  2YNI A;  1NJI O;  2FC0 A;  4JI6 K;  4AHT A;  3CER A;  1KVA A;  1ZBH A;  4K8Z A;  3WEE B;  4G1Q A;  3IS9 A;  5BRF A;  4YOV A;  4FW2 A;  2OA8 A;  5AQF A;  1J5E K;  3NH1 A;  1IH7 A;  1NK7 A;  3TSQ A;  1OVQ A;  3VTI A;  3M3Z A;  3CJC A;  3KZB A;  4FJN A;  4KH6 A;  1S1T A;  2O8E A;  2YNH A;  5JIC A;  1ZBU A;  3VEO A;  2PYJ A;  1FW6 A;  4B1V A;  3M5R A;  4DQI A;  1KVC A;  4BRM A;  4WFB L;  3D2F A;  4CJK A;  3AVB A;  2XRI A;  5AQP A;  4CJ3 A;  4DLG A;  3EZ5 A;  3V9S A;  3AO3 A;  1EO1 A;  2HBJ A;  3K59 A;  3GE1 A;  4AIL C;  4ZHR A;  1JLQ A;  3OA9 A;  3OJU A;  3MWP A;  1LWC A;  2HOE A;  3R3L A;  1JLA A;  1LV5 A;  2ZD1 A;  1K73 O;  3HBT A;  4A57 A;  4CD3 A;  1NGJ A;  2A6A A;  3VF6 A;  3AO4 A;  4LD0 A;  4FVM A;  4O55 A;  4E1M A;  4JI8 K;  5HRS A;  3G25 A;  1ZBS A;  1JCG A;  4C8O A;  3TWH A;  2OZS A;  3NCI A;  4FLX A;  4FWR A;  4R5P A;  4DV0 K;  4DTS A;  3VQC A;  3GL1 A;  4KPY A;  3QEX A;  4BE1 A;  4DFJ A;  1TL3 A;  4W5Q A;  3UKR B;  3K9J A;  3NHG A;  4DTM A;  3CFR A;  3CC2 N;  3AA5 X;  1MWK A;  1O13 A;  3B6P A;  3IG1 A;  2BGG A;  3MXJ A;  3TSU A;  4FLU A;  3PO4 A;  3OYL A;  3RVC A;  4CBU A;  2QXL A;  4FJG A;  1W97 L;  4DR1 K;  4IEE A;  4EHT A;  2RKI A;  3EL2 A;  3EYZ A;  3SNN A;  1D5A A;  5CYQ A;  3AVI A;  3SUQ A;  5AQO A;  1LAV A;  2O8B B;  2VCP A;  3KK2 A;  4BGB A;  3SAH A;  2FF3 B;  3WNF A;  4Z4I A;  2RE2 A;  1QSL A;  1BL3 A;  4B9Q A;  3Q7C A;  4H5W A;  3LWL A;  4KHY A;  3D2E B;  4FW1 A;  4J2D A;  4OKK A;  3JSM A;  3ENO A;  3SYZ A;  4B9U A;  1RT7 A;  2W6L A;  3CFO A;  2YHX A;  4LF8 K;  4W5N A;  3LZI A;  2QKK A;  2HMI A;  4JYA K;  1YXQ A;  1XC9 A;  4DTJ A;  3LL3 A;  1S9E A;  2HF4 A;  3H46 O;  3A5O C;  1G15 A;  1VQ4 N;  1NGD A;  4UY8 O;  3T1A A;  1CLQ A;  1QE1 A;  4OVL A;  4DV4 K;  3K5M A;  4W5O A;  4FK4 A;  2P9U B;  1RGI A;  3WXJ A;  1VAZ A;  3O9U A;  3QES A;  2P9I A;  5GAD P;  3SUP A;  3L2W A;  3RMD A;  4V19 S;  3AVA A;  3EY1 A;  3G6E N;  3CCE N;  4NB4 A;  3P31 A;  4DUZ K;  2G8I A;  1CZ9 A;  4BE0 A;  4CZK A;  4A2A A;  3PSI A;  4E7K A;  4CEE A;  5GAE P;  3EN9 A;  4PHT X;  5JVG L;  4CK2 A;  3O3G A;  4H0P A;  4CJU A;  3EE9 A;  1FKP A;  1VQM N;  1VQ9 N;  1YIT N;  3ZT3 A;  3DMJ A;  4CGJ A;  2X78 A;  3HPO A;  1LAW A;  2F4V K;  3THX B;  3HI0 A;  1Z26 A;  3SAF A;  2NZT A;  3BZK A;  1BU6 O;  2A40 A;  3R1X A;  4C8M A;  2CH6 A;  4JRQ A;  3MMV A;  3O4N A;  3J81 O;  1XI1 A;  2HHH K;  3CPW M;  3HM8 A;  3KLF A;  3AY9 A;  2QEX N;  1HKG A;  1FJG K;  2V7Z A;  1RBU A;  3CJ9 A;  4JK7 A;  2Q0U A;  4MLH A;  4HTL A;  2HHS A;  4CF0 A;  4DFP A;  3MXI A;  1WBB A;  1GLD G;  1E4G T;  2XY7 A;  4FWP A;  4PUO A;  2E8A A;  3HPH A;  2Q3S A;  4HHT A;  1N5Y A;  2E1Y A;  4ISF A;  3EO3 A;  2ZQB A;  5AFU A;  4ZTJ A;  1GLL O;  3PX4 A;  3OS2 A;  2G8K A;  4IFV A;  4CZF A;  3EEQ A;  3C0B A;  3VQE A;  4CES A;  4IG3 A;  3V6D A;  1TGO A;  4NYN A;  4W5T A;  3LDS A;  4DU3 A;  1IKY A;  4H5N A;  5KPR A;  4CHY A;  3V1O A;  2AJQ A;  3SBT A;  2Y1I A;  3ZSX A;  1NLV A;  1S6Q A;  4X65 K;  3VEW A;  1TKD A;  4ICL A;  4FWN A;  1Y97 A;  1U04 A;  3LAM A;  1HR0 K;  1YUW A;  4Z4H A;  2YJF A;  1TAU A;  1TYQ A;  4N5S A;  3QEV A;  3MAQ A;  3DLG A;  3RMC A;  3IFR A;  1FKO A;  3ZEU A;  2FLO A;  3IUC A;  1D9D A;  1DTQ A;  5SZT A;  4CHO A;  1YTA A;  2E6M A;  3AVL A;  2QWM A;  1RDW X;  1RDD A;  4C1N I;  2AP1 A;  1S3X A;  4JI1 K;  3I55 N;  3S3N A;  3DLL L;  1MWM A;  5GIO A;  1NGE A;  1ASV A;  1R0A A;  2GX9 A;  3BF3 A;  5FLX O;  4M42 A;  3ULD A;  1BG3 A;  5IWA K;  4U67 L;  2Q2R A;  3NH0 A;  2NRW A;  5A2Q O;  4FZZ A;  1U48 A;  2EWS A;  1IO2 A;  4CHN A;  1VSF A;  1C6V A;  4E1N A;  2KHO A;  4OKJ A;  2IDO A;  2KW4 A;  4C23 A;  5AQJ A;  1BOT O;  1U2V A;  1XMQ K;  1XC3 A;  5HOO A;  4K43 A;  4C8L A;  3H1V X;  3JAM O;  3A5N C;  4NYF A;  3OYH A;  4BGA A;  3CMA N;  2IIR A;  1HMV A;  3HJF A;  3U3Y A;  3VER A;  2I7N A;  4MFB A;  1B92 A;  4ILJ A;  1XWL A;  4O4G A;  4BR5 A;  5AQN A;  4FZY A;  3ULE A;  4XH4 A;  2ZJQ L;  4JD2 A;  3IRX A;  1BCM A;  4KBO A;  3U3G A;  3DLR A;  4WCE L;  1K9M O;  2YHA A;  4E7J A;  5D3G A;  2DY4 A;  1RT5 A;  4BQZ A;  5T7B A;  3A8Y A;  1ASW A;  3W3D A;  1C0M A;  4JK9 A;  1HX1 A;  4DMN A;  3LDL A;  3QFP A;  3HST B;  4OGC A;  3HP9 A;  1TVR A;  4DR4 K;  3PO5 A;  2CH5 A;  4N41 A;  3NBP A;  1D9F A;  2NNW A;  3VQ7 A;  5KQ8 A;  4RTF D;  4H0Y B;  4FJL A;  1TK5 A;  5LJV A;  1HLU A;  1HUX A;  1TYQ B;  4KKO A;  3RMA A;  2QA4 N;  4J8F A;  1RT6 A;  4CHP A;  2QK9 A;  3TAN A;  3THW B;  5HLF A;  2Z1J A;  1KXP A;  4YOW A;  4BC5 A;  3VQQ A;  3THY A;  1VHX A;  3G71 N;  3LAK A;  4ZTF A;  2O4I A;  4B3M K;  4B9L A;  3KD1 E;  2O8F A;  3MEC A;  5GAH P;  4FJ9 A;  3VQP A;  4AQY K;  1NGC A;  3T7Z A;  1NGB A;  4K41 A;  4DFM A;  3OYJ A;  1ATR A;  2Q36 A;  3C6T A;  4B9N A;  5CY4 A;  1XUP O;  4OPK A;  4O8U A;  3RWU A;  3TAQ A;  1NK4 A;  4KTQ A;  2OZM A;  2QKB A;  2HW3 A;  3ZCM A;  4CBX A;  4CIE A;  3SK3 A;  3M1F A;  3CFP A;  3MN6 A;  3DI6 A;  4KI4 A;  2QI2 A;  3UKU B;  4B1Z A;  4FWK A;  4DTP A;  4A5B A;  2E2O A;  2ZM6 K;  3GBT A;  3AVM A;  4FPB A;  4CFB A;  1BGX T;  2Q0R A;  3QIN A;  4KTZ A;  1SZ2 A;  4QAG A;  2HMP A;  2PFU A;  4QS8 A;  4E1J A;  3SQ4 A;  1S1X A;  4K42 A;  5AQS A;  1GOC A;  2P9K A;  3WNE A;  1X9W A;  1ATN A;  5GAG P;  4OPA A;  4M3Y A;  3D2E A;  4GV6 A;  3FE1 A;  5C42 A;  3ID6 A;  4WE1 A;  3DLB A;  5M1F A;  1NK8 A;  2E4L A;  3H3N O;  1K8A O;  4FWM A;  3VQ6 A;  3ATV A;  4JI5 K;  2YKN A;  4DKW A;  3P4I A;  3C7N B;  1I94 K;  2F9T A;  4IZ9 A;  1F21 A;  4CEZ A;  1YIJ N;  5AQT A;  4YOY A;  4I9Q A;  1NOZ A;  3CCL N;  2ATQ A;  2VWB A;  4JKH A;  1RTD A;  1C1C A;  1QVF M;  1HNV A;  2PYL A;  1XQS C;  2O8F B;  5HBM A;  2ZGZ A;  3KTQ A;  3ZX2 A;  3ITH A;  2KZZ A;  5AJ3 K;  3QDK A;  4WQ5 C;  3BP8 A;  4AHR A;  4IO9 L;  1NJX A;  3CCS N;  1VQK N;  3MCP A;  3MWT A;  4CK1 A;  1NKC A;  3HP6 A;  1VK0 A;  5I42 A;  1VRT A;  3TAP A;  4JRP A;  3SUO A;  3WXK A;  3KK7 A;  3NFA A;  4F8R A;  3FZK A;  4CJT A;  4MO4 A;  3LDP A;  4B9V A;  3DOK A;  4Y0W A;  2UUB K;  4BR0 A;  4JKD A;  4FLV A;  1ESV A;  4BE2 A;  3A0I X;  4ID1 A;  4B8C A;  1HKC A;  5LMN K;  4IXC A;  1WBD A;  1SKW A;  3PX0 A;  4BDY A;  4DLE A;  1JLC A;  3TAE A;  3VMF B;  4M7X A;  5KGX A;  2WFB A;  1BA0 A;  4Y1D A;  4O44 A;  3SI6 A;  4DWI A;  3K57 A;  3V1R A;  3R6M A;  1HYZ A;  3QNO A;  3PY8 A;  1UAX A;  4FWL A;  4WQ4 C;  3TTC A;  1NJZ A;  3OYA A;  4OLB A;  4NCB A;  3SQ0 A;  1Q8I A;  4JI2 K;  3L3V A;  4IOX A;  2X6S A;  4IFY A;  4DF8 A;  2P5O A;  5EVZ A;  3NF7 A;  1BDG A;  1KAY A;  1RDB A;  3VTH A;  2HND A;  3MX2 A;  3M8S A;  4HCC A;  1RNH A;  3LAL A;  3WNG A;  4BRA A;  3ZT2 A;  4B9M A;  3OTO K;  3NF9 A;  4FM0 A;  1WLJ A;  4OPH A;  4BG8 A;  3LDQ A;  2QXF A;  3CPE A;  1T3V A;  4IBN A;  2GTD A;  5KI6 A;  4R79 A;  4PWD A;  2IS3 A;  3ZLJ A;  3VEZ A;  4AM6 A;  3OYM A;  4HUG A;  4KH5 A;  4KRF A;  1WSI A;  2W40 A;  1D8Y A;  4EZ6 A;  1NK9 A;  3Q7B A;  2QWP A;  3QET A;  3QEP A;  4RW4 A;  4EFH A;  3E66 A;  2ZWH A;  3V4I A;  4M3R A;  3VEY A;  1VRU A;  5LMU K;  3O9S A;  3MN9 A;  3S41 A;  3SBG A;  1EXQ A;  1RBS A;  3AGR A;  4WQ5 A;  2IAJ A;  4DV3 K;  1J9A A;  4FOE A;  3FLC O;  2YV0 X;  2HF3 A;  5FPN A;  3RSE A;  4HTU A;  5CHI A;  1VQ7 N;  3J7A P;  3C7N A;  1WOQ A;  1OH5 A;  2P9P A;  3AVN A;  4DR6 K;  3CJ7 A;  3TAR A;  3B8A X;  4CGI A;  4HUF A;  1VSM A;  1DTT A;  2D0P A;  3WUH A;  1V4T A;  2QWO A;  2HHW A;  1GLJ O;  5E84 A;  4W5R A;  1JL2 A;  1UA1 A;  4DSF A;  1WSJ A;  4HUE A;  5C10 A;  3EZW A;  1ZC6 A;  2HBK A;  4LF4 K;  3TAF A;  1L3U A;  3O4W A;  4JAX A;  1SV5 A;  3CCV N;  2ZGY A;  1BI4 B;  3KLI A;  4LF7 K;  1L5U A;  3VQ8 A;  5KPZ A;  2YNF A;  4JEP A;  1TUU A;  3VF4 A;  1HYV A;  3ZEU B;  4DV2 K;  1YTU A;  3D7E O;  4YDU A;  4EAH D;  3HK2 A;  3NVM A;  4ID5 A;  1J5O A;  4I9L A;  4KB0 A;  3SMP A;  4N47 A;  3VA3 A;  1N6Q A;  5BN9 A;  5C2F A;  4CEF A;  4M3U A;  2OCE A;  4PQU A;  1Z25 A;  1RT3 A;  3HPG A;  2DFF A;  3C95 A;  1RTH A;  5DM6 L;  2YHB A;  3ENB A;  3DAW A;  3MXM A;  4CER A;  3AAQ A;  4RG8 A;  3EKS A;  5AQQ A;  2LSN A;  4GV3 A;  3E9L A;  3TTF A;  3MK6 A;  4BRO A;  4CEC A;  3HXM A;  3HOS A;  5KGW A;  1HNW K;  3R9P A;  4MDA A;  4Z0U A;  4KHW A;  4BC2 A;  2EHG A;  5ADX H;  4AHC A;  4BQL A;  3OW2 M;  1EX4 A;  1J54 A;  3BGR A;  5AQW A;  5AQI A;  3LPT A;  4JI0 K;  3FZH A;  1FXX A;  4B9S A;  1KCF A;  3S9H A;  2OPR A;  5C15 A;  4FJK A;  4K25 A;  3QLH A;  3GG4 A;  3DYA A;  3PSF A;  4C8N A;  5AQK A;  3HRG A;  1WB9 A;  4FZX C;  4Q5V A;  4LSN A;  4A61 A;  2D1K A;  4BRI A;  1DGK N;  1MDU B;  1SS6 A;  2KFZ A;  1HQE A;  3O8M A;  3KIO A;  1QS4 A;  4YDU C;  1VQ8 N;  4LF6 K;  2A41 A;  3DJC A;  3DRP A;  3QEI A;  4JS5 A;  2G8U A;  3AO1 A;  5HRO A;  4IDK A;  3VPZ A;  3TPQ A;  4DU4 A;  3HOT A;  1IBL K;  2V51 B;  4O0J A;  3HYF A;  3ALY A;  3AV9 A;  4C8K A;  1VSD A;  5HRR A;  4CJ7 A;  4KHQ A;  3KLE A;  1EQY A;  3R8E A;  1KLN A;  4PY5 A;  4FYD A;  2FBX A;  2P9L A;  2VQE K;  4IWV A;  4O5F A;  1IG8 A;  1GLC G;  2FBV A;  2UXC K;  4FXD A;  5AQY A;  5CR4 A;  3THX A;  4CJV A;  3DRR A;  3N4Q A;  2JGU A;  1H1V A;  1BQM A;  4GKJ K;  3J8A A;  3VET A;  2WBN A;  1Y64 A;  1LWF A;  3IKM A;  3CXC M;  1HNZ K;  5BRD A;  1YI2 N;  3O1W A;  3O6W A;  3JS6 A;  3P38 A;  4GVE A;  3ZSW A;  3ZYY X;  4J2B A;  3C65 A;  1UA0 A;  2B5J A;  4KH4 A;  4Z4F A;  4FWQ A;  4RW9 A;  3VOV A;  1OVY A;  3FR0 A;  3K58 A;  2ASO A;  3HL8 A;  3CCQ N;  3T19 A;  1P8Z A;  4DR2 K;  4QCL A;  4FK2 A;  4I2P A;  4JLH A;  4JI4 K;  1FK9 A;  4BR2 A;  2O8E B;  1RBT A;  5LL6 Z;  3ZSZ A;  1TKT A;  2W41 A;  4CIG A;  3E01 A;  2UUA K;  1WSE A;  2KKZ A;  3CI5 A;  5J2N A;  1SUQ A;  2HVH A;  1BIZ A;  4CZJ A;  1KLM A;  1BI4 A;  2OAN A;  4CJF A;  1X1P A;  2FF6 A;  3WXM B;  4DSE A;  1NG9 A;  2XO7 A;  4E89 A;  2ZF5 O;  4AHS A;  4AHV A;  3EKU A;  1YJN N;  1BA1 A;  5FPD A;  4BVO A;  4YNQ A;  4LY7 A;  2P5G A;  1JXE A;  3CC4 N; 
#chains in the Genus database with same CATH homology
 4BRP A;  3W0L A;  1QZ6 A;  4CBX A;  2V52 B;  3SK3 A;  3M1F A;  3MDQ A;  1GLF O;  3BF1 A;  4BG9 A;  2ASP A;  3MN6 A;  5BR9 A;  2QI2 A;  5M1N A;  3UKU B;  4H5V A;  2FSK A;  3AAP A;  4FWK A;  4B1Z A;  4DB3 A;  4OO1 J;  1JCE A;  4BRL A;  4A5B A;  3I8B A;  2E2O A;  5AQV A;  3GBT A;  4FPB A;  3KWG A;  5HL7 L;  3I56 N;  3TTD A;  3E9O A;  1LOT B;  1RFQ A;  2E2Q A;  2Q0R A;  4WQ4 A;  4H0V B;  3U9D A;  4YOR A;  4Z94 A;  5BPL A;  4ISG A;  3MX5 A;  1NGG A;  3VEV A;  1SZ2 A;  2GUP A;  5TKY A;  1HPM A;  1JJ2 M;  4YOT A;  2HMP A;  2PFU A;  4QS8 A;  4E1J A;  1K8K B;  3I33 A;  3F5T A;  3AGK A;  5FPM A;  2YHY A;  4CZM A;  1D4X A;  4H0X B;  2D4W A;  4CBW A;  4MLE A;  5AQX A;  3CC7 N;  1DT9 A;  4FSV A;  5EOY A;  4K42 A;  5AQS A;  4JN4 A;  2P9K A;  3A5M C;  4B1W B;  3WQT A;  1ATN A;  5GAG P;  2Q1N A;  2QM1 A;  3KHY A;  1NWK A;  4OPA A;  2NRZ A;  3D2E A;  1ZXO A;  1LCU A;  3FE1 A;  5C2D A;  4GV6 A;  3ID6 A;  5M1F A;  1NJI O;  1QQN A;  3H3N O;  3CHW A;  1K8A O;  5AFU H;  4FWM A;  1HKB A;  3CER A;  3FZM A;  4IFE A;  3ATV A;  3ZX0 A;  3WEE B;  4CZL A;  5BRF A;  4DKW A;  4YOV A;  1MA9 B;  3ZET A;  3C6A A;  3P4I A;  3C7N B;  5AQF A;  5MLC Q;  1SQK A;  2F9T A;  4IZ9 A;  1YIJ N;  4FWS A;  1RDU A;  5BRH A;  5AQT A;  4YOY A;  3TSQ A;  4JKE A;  3VTI A;  3M3Z A;  5AQR A;  3CJC A;  3KZB A;  2KLA A;  3WXI A;  3CCL N;  4KH6 A;  2VWB A;  4JKH A;  2V7Y A;  4CD1 A;  5JIC A;  1QVF M;  1VQ6 N;  1XQS C;  3VEO A;  4PL8 A;  5M1O A;  4B1V A;  3UE5 A;  4EHU A;  2P9U A;  3M5R A;  1YJW N;  1Q82 O;  2ZGZ A;  4IOC L;  4BRM A;  3AAR A;  4WFB L;  3D2F A;  1M1K O;  3ZX2 A;  4JKC A;  5AQP A;  3NMU A;  2NLX A;  5JVH L;  3TU5 A;  5M1K A;  3PIP L;  1EO1 A;  1YVN A;  2HBJ A;  1ATS A;  2HBM A;  3QDK A;  1Q7Y O;  3GE1 A;  4WQ5 C;  3BP8 A;  1VQK N;  4IO9 L;  4IOA L;  3CCS N;  3MCP A;  3OA9 A;  5BN8 A;  2AA4 A;  4BRN A;  3MWP A;  2HOE A;  2BTF A;  3R3L A;  5AZI B;  3MWT A;  1NGH A;  2Q31 A;  3VGM A;  1K73 O;  3HBT A;  4A57 A;  4BRE A;  4BC4 A;  2A5X A;  4CD3 A;  2FSJ A;  4JKF A;  1NGJ A;  4CZI A;  2A6A A;  3VF6 A;  1Z6R A;  3WXK A;  3A5L C;  3KK7 A;  1KD1 O;  1T6C A;  3DXM B;  4QS9 A;  2HST A;  3VEX A;  2NRV A;  4H0O A;  4M7Y A;  1KAX A;  3FZK A;  4JKA A;  5JLH A;  3G25 A;  3CF5 L;  3OBY A;  4JD2 B;  3IMX A;  1ZBS A;  1JCG A;  4MO4 A;  3LDP A;  1Z05 A;  4Y0W A;  1R59 O;  4BR0 A;  4JKD A;  4FO0 A;  1ESV A;  1K8K A;  4ILH A;  3A0I X;  1HKC A;  2CGL A;  2P9S A;  3EE8 A;  4FWR A;  4IXC A;  4FL9 A;  4HWI A;  3N4P A;  3OBW A;  1KC8 O;  3QB0 A;  4IEI A;  2E2P A;  1Q86 O;  4MO5 A;  3CCJ N;  5DM7 L;  4XEI A;  3GL1 A;  3O80 A;  3VMF B;  5M1Q A;  4A59 A;  2J4R A;  1G99 A;  2YCH A;  4AF1 A;  4M7X A;  5BRE A;  2WFB A;  4WFN L;  1BA0 A;  5F1X A;  4C1N K;  4JKB A;  1GLA G;  5AR0 A;  1NGF A;  3R6M A;  3UKR B;  4H03 B;  3K9J A;  3CJB A;  3SJH A;  4O8K A;  4DCH A;  3FZF A;  3CJ1 A;  3HZ6 A;  4FWL A;  4WQ4 C;  3TTC A;  3MCA B;  4BY9 C;  3WEE A;  2RHK A;  4NLC A;  2F7T A;  1YHQ N;  3CC2 N;  3VGL A;  2CGJ A;  2GEL A;  4BR7 A;  3CJA A;  1MWK A;  4U7B A;  1O13 A;  3VGK A;  3H3O B;  3J7Z O;  2OTJ N;  3TSU A;  1VQP N;  2WUS A;  1X9J A;  2IVN A;  4IOX A;  5H1S Q;  4RWT A;  3RVC A;  1BUP A;  4CBU A;  5EVZ A;  2QXL A;  3O9R A;  1BDG A;  1W97 L;  4NLB A;  4IEE A;  4EHT A;  1KAY A;  3EL2 A;  4XH1 A;  5ELZ A;  5AQO A;  3VTH A;  4DHY A;  1Q81 O;  1S72 N;  4F9O A;  4FOI A;  2E2N A;  3MX2 A;  3QFU A;  4BRA A;  2VCP A;  2P9S B;  2P9I B;  4BGB A;  3SAH A;  2FF3 B;  2RE2 A;  4OPH A;  3F2K A;  4B9Q A;  3Q7C A;  4H5W A;  3D2E B;  4BG8 A;  3LDQ A;  2GEM A;  3ENO A;  3CPE A;  1T3V A;  1ILY A;  2GTD A;  4BRQ A;  2YHX A;  4R79 A;  4CI6 A;  5AQZ A;  3UKR A;  3VEZ A;  4B1Y B;  3TSP A;  4AM6 A;  3JXU A;  5C12 A;  3PIO L;  4KH5 A;  1YXQ A;  3LL3 A;  4ISE A;  2W40 A;  4BRG A;  2HF4 A;  3H46 O;  3A5O C;  2P9L B;  5BPM A;  3Q7B A;  2JWL A;  1VQ4 N;  2QWP A;  3U4L A;  1NGD A;  3E66 A;  4EFH A;  4UY8 O;  5F0X A;  3OHR A;  2PAV A;  2H3G X;  1P90 A;  2ZWH A;  3VEY A;  4BRF A;  4YOU A;  3O5B A;  3O9S A;  5ADX A;  2OTL N;  3MN9 A;  2P9U B;  3S41 A;  3WQU A;  3SBG A;  2P9N B;  4GNI A;  1RGI A;  3D2F B;  3AGR A;  4WQ5 A;  3CCU N;  3E9P A;  1VAZ A;  1YAG A;  3WXJ A;  2ASM A;  4FOE A;  4EIA A;  5BPN A;  2ZJP L;  3O9U A;  2FXU A;  3FLC O;  2F9W A;  4CZE A;  4NO7 A;  2P9I A;  5GAD P;  2HF3 A;  5FPN A;  5LY3 A;  3RSE A;  3CQX A;  3GOI A;  2E20 A;  1M90 O;  3G6E N;  5CHI A;  5FPE A;  4PL7 A;  1VQ7 N;  2GWK A;  3DWL A;  3CCE N;  4NB4 A;  3P31 A;  5AQU A;  3C7N A;  1WOQ A;  2GWJ A;  3CME N;  5KQD A;  2P9P A;  1NBW A;  3CJ7 A;  3E1Y A;  4A2A A;  4CZK A;  3ATU A;  2D0O A;  5GAE P;  3EN9 A;  3B8A X;  4PHT X;  5C0Y A;  3O9T A;  3H45 C;  3ZX3 A;  5JVG L;  3M6G A;  4FVU A;  1BO5 O;  2D0P A;  4PKI A;  1V4T A;  2QWO A;  4H0P A;  2ITM A;  4IJA A;  3EE9 A;  3WUH A;  1W2B M;  1VQM N;  4IDH A;  3NVK A;  1GLJ O;  1VQ9 N;  5E84 A;  5B8H A;  3GDQ A;  1YIT N;  5TKW A;  1DKG D;  1VQN N;  3UB5 A;  3D6R A;  3FGU A;  1X3M A;  3HI0 A;  3SAF A;  2NRR A;  5AQH A;  2NZT A;  4BRH A;  1BU6 O;  5C10 A;  3EZW A;  2A40 A;  1ZC6 A;  2HBK A;  2CH6 A;  3R1X A;  3MMV A;  3VEN A;  3CPW M;  1IJJ A;  3HM8 A;  1QHA A;  3O4W A;  4IO8 A;  4JAX A;  3CCV N;  1X3N A;  2ZGY A;  3AY9 A;  3LM9 A;  1S22 A;  2PBD A;  3O1B A;  2QEX N;  1HKG A;  3QIC A;  4M63 C;  2V7Z A;  3L0Q A;  1YJ9 N;  3CJ9 A;  3L4Q A;  4JK7 A;  2Q0U A;  4MLH A;  4QS7 A;  1U6Z A;  2Q97 A;  3ID8 A;  4HTL A;  1WUA A;  3RSE B;  1GLD G;  1NGA A;  3T69 A;  3SLC A;  3CCR N;  4BRK A;  4IJN A;  5KPZ A;  1E4G T;  2VGM A;  3ENH A;  4JEP A;  1TUU A;  3VF4 A;  4FWP A;  2E8A A;  5M1P A;  3ZEU B;  4AM7 A;  4XH5 A;  3KVG A;  4A62 A;  5I9E B;  3D7E O;  4ILG B;  4YDU A;  3UKU A;  2A3Z A;  2E1Y A;  1GLB G;  4ISF A;  4EAH D;  4PKG A;  2I7P A;  3EO3 A;  3NVM A;  3BUZ B;  5EXW A;  4JKG B;  3QBW A;  5AFU A;  5KPT A;  1GLL O;  3SMP A;  3O08 A;  5CE3 A;  5BN9 A;  5C2F A;  4I6M A;  4CZF A;  1KAZ A;  3C0B A;  2QWQ A;  4BRC A;  4CZH A;  2ZJR L;  1NGI A;  3BEX A;  5DM6 L;  3ENB A;  4H5N A;  3K9K A;  3DAW A;  5KPR A;  4YOX A;  3AAQ A;  2E88 A;  3EKS A;  2JWK A;  1QQM A;  5AQQ A;  4GV3 A;  3E9L A;  3SBT A;  3TTF A;  1NLV A;  3MK6 A;  4BRO A;  1SAZ A;  5AZJ A;  3HOS A;  3VEW A;  3HSC A;  3P39 A;  4FWN A;  2YI1 A;  3R9P A;  4MDA A;  4DQ8 A;  1U2V B;  4B1U B;  1YUW A;  2BUP A;  4BC2 A;  5ADX H;  4BQL A;  3OW2 M;  1QVG M;  4JHD A;  1QQO A;  2DPN A;  2QWN A;  5AQW A;  5AQI A;  2VYP A;  5JLF A;  2YJF A;  3FZH A;  1TYQ A;  4H5R A;  3F9M A;  3L4I A;  3CD6 N;  3IFR A;  3LM2 A;  1DEJ A;  1OKJ A;  3LDO A;  1T44 A;  5E26 A;  5C15 A;  3ZEU A;  2FLO A;  4K25 A;  3IUC A;  4JK8 A;  4WYB A;  4BR9 A;  3GG4 A;  2HBL A;  5AQK A;  3HRG A;  1N8R O;  2QWM A;  2NRH A;  1RDW X;  2NRT A;  4A61 A;  2D1K A;  2AP1 A;  2YX6 A;  1S3X A;  2E1Z A;  1DGK N;  1MDU B;  2QWL A;  1SS6 A;  4BRI A;  4C1N I;  3I55 N;  2BH1 A;  3DLL L;  3O8M A;  1MWM A;  4I6M B;  4BVP A;  5GIO A;  3FFK B;  1BWF O;  1NGE A;  3DXK A;  5AQM A;  4YDU C;  2GX9 A;  1VQ8 N;  3BF3 A;  2A41 A;  4GV9 A;  3WT0 A;  4PKH A;  1BG3 A;  1C0G A;  3DJC A;  2Q2R A;  4U67 L;  2NRW A;  3U9Z A;  1VQL N;  2EWS A;  2P9K B;  3TPQ A;  2QW9 A;  3VPZ A;  3HOT A;  3QBX A;  5GIP A;  2A42 A;  2KHO A;  2FSN A;  2V51 B;  5F2R A;  4BRD A;  4C23 A;  3PLA A;  2NRX A;  5AQJ A;  1BOT O;  1U2V A;  3SMS A;  1XC3 A;  2UYT A;  5HOO A;  3HTV A;  4K43 A;  5AZI A;  3H1V X;  3A5N C;  4CJ7 A;  3L6Q A;  3CMA N;  4BGA A;  1JCF A;  1QZ5 A;  1EQY A;  3R8E A;  4WFA L;  2IIR A;  3MN7 A;  1CZA N;  1VQ5 N;  2P9L A;  1Q18 A;  1T6D A;  3VER A;  4JNE A;  1J6Z A;  2I7N A;  2YHW A;  4IWV A;  1NM1 A;  1HJO A;  4O5F A;  1IG8 A;  4A5A A;  1GLC G;  4CZG A;  3WXL A;  3CCM N;  5EY4 A;  3C6H A;  4ILJ A;  4L3Q A;  4BR5 A;  5AQN A;  2QWR A;  3ULE A;  4XH4 A;  2ZJQ L;  2IVP A;  1GLE G;  2QTD A;  3O9Q A;  5CR4 A;  5AQY A;  4JD2 A;  3FZL A;  2P9N A;  4KBO A;  3N4Q A;  1H1V A;  4WCE L;  1K9M O;  3CIP A;  5JMV A;  3J8A A;  3VET A;  5LJW A;  2WBN A;  1Y64 A;  3DXK B;  3IKM A;  4BQZ A;  5GIN A;  4G9Z A;  3CXC M;  3A8Y A;  5BRD A;  4B1X B;  3O1W A;  3W3D A;  1YI2 N;  4JK9 A;  1HX1 A;  4H5T A;  3O6W A;  3LDL A;  3CQY A;  3QFP A;  4FWO A;  5EX5 A;  3VES A;  1TUY A;  5AZJ B;  3JS6 A;  3U8X A;  2CH5 A;  3H1Q A;  3MN5 A;  3P38 A;  4GVE A;  2NNW A;  5KQ8 A;  4RTF D;  2P9P B;  4H0Y B;  3H6E A;  4MDB A;  4JHD B;  1YF5 L;  3IDH A;  5LJV A;  3ZYY X;  3ZET B;  1HLU A;  1HUX A;  3C65 A;  1TYQ B;  4KH4 A;  3QML A;  2QA4 N;  4H0T B;  4J8F A;  4FWQ A;  3VOV A;  1OVY A;  1E4F T;  3FR0 A;  4JKG A;  2ASO A;  2YJE A;  4GY2 B;  4RCH A;  1P8Z A;  3CCQ N;  1V4S A;  1NMD A;  3DXM A;  4BC3 A;  1KXP A;  4YOW A;  4BC5 A;  5AQL A;  4BR2 A;  3G71 N;  3SAG A;  2CGK A;  3ULE B;  5GAH P;  1KQS M;  2W41 A;  1NGC A;  4WF9 L;  2KKZ A;  3CI5 A;  3LDN A;  1C0F A;  3T7Z A;  1NGB A;  4CZJ A;  4K41 A;  3KWI A;  2OAN A;  2Q36 A;  1ATR A;  2FF6 A;  4LC9 B;  3VF2 A;  3WXM B;  1XUP O;  5AQG A;  4O8U A;  3G4S N;  1VQO N;  2ZF5 O;  2VGN A;  3EKU A;  4BR4 A;  4A2B A;  2WC9 A;  1YJN N;  3CET A;  1BA1 A;  5FPD A;  4BVO A;  2IVO A;  4FPA A;  3CC4 N; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...