2ZJQL

Interaction of l7 with l11 induced by microccocin binding to the deinococcus radiodurans 50s subunit
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
104
structure length
104
Chain Sequence
RRKLRTRRKVRTTTAASGRLRLSVYRSSKHIYAQIIDDSRGQTLAAASSAALKSGNKTDTAAAVGKALAAAAAEKGIKQVVFDRGSYKYHGRVKALADAAREGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords ribosomal 23S RNA
publication title Translational regulation via L11: molecular switches on the ribosome turned on and off by thiostrepton and micrococcin.
pubmed doi rcsb
total genus 17
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2008-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00861 Ribosomal_L18p Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.100 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2zjqL01
1VQON 1QVFM 1N8RO 1VQ7N 3G71N 1M1KO 3CCSN 5GAEP 3CMEN 1YITN 4U67L 3G6EN 5DM7L 1VQ8N 1S72N 1VQLN 1M90O 3CPWM 3CCQN 4UY8O 4WCEL 2ZJPL 5H1SQ 1Q7YO 5JVGL 1KD1O 1VQMN 4WFAL 5HL7L 1YJNN 1YJ9N 3G4SN 1JJ2M 1Q81O 3CD6N 4IOCL 3CC4N 1KQSM 3PIOL 1VQ4N 1ILYA 2OTLN 4IO9L 5GAGP 1YI2N 4WFNL 3CCUN 3CCLN 2ZJRL 3DLLL 4WF9L 3J7ZO 3CCMN 5DM6L 2QEXN 1YHQN 1VQ9N 1VQPN 5GADP 3CCRN 1OVYA 4IOAL 3CC7N 3CCJN 1YIJN 1Q82O 1QVGM 1NJIO 3CF5L 1VQNN 1K73O 1VQ5N 1YJWN 3CMAN 3I55N 2QA4N 5JVHL 3CCEN 1W2BM 1VQ6N 3I56N 3PIPL 1K8AO 1Q86O 3CXCM 1K9MO 5MLCQ 3CCVN 1VQKN 5GAHP 2OTJN 3OW2M 4WFBL 1KC8O 3CC2N 2ZJQL
chains in the Genus database with same CATH superfamily
3CQ8A 1SKWA 4JI5K 5KPTA 4LSNA 4O0IA 4FJ5A 5J1EA 2Q31A 1QQCA 1ZBHA 3CM6A 4OJRA 3TWHA 3E66A 3K5OA 2DFFA 3CJ9A 3SPYA 2G8KA 4F9OA 4CJRA 3O9RA 1C0MA 2IAJA 3JS6A 3ZSXA 4EFHA 5AZJB 3H1QA 3AA3A 3AVGA 3AY9A 4CZMA 2FXUA 4BRIA 3SMSA 3H46O 3SQ1A 4WFNL 3CCLN 3J7AP 3K5MA 1S1XA 1X1PA 3L0QA 1XI1A 2UXCK 4YFUA 4H0YB 1ZYQA 4RW7A 1HPMA 1KFDA 3DM2A 1NGBA 2WUSA 3NHGA 3PY8A 3H3NO 4CGFA 5C12A 2W42A 3AVJA 5AR0A 3SBGA 4CK1A 3RMCA 4H0PA 1I39A 4CJPA 4JAXA 4JKGA 3S3MA 1RT4A 3TI0A 3C7NA 1TL1A 1JLQA 4FOEA 2ZE2A 4FWMA 3VQ6A 2IOCA 3DJCA 2YNIA 1LWFA 1RT6A 1JLGA 3NH1A 2HMPA 4GW6A 3P38A 2P9PB 3DYAA 3K59A 1SS6A 1XMQK 4K43A 3C94A 4EHTA 5AQGA 2NRWA 4A2AA 1C1BA 3PX6A 4RW6A 1W97L 4I6MA 3VN5A 4DV1K 2FBYA 4JI1K 3VQ5A 2Z1GA 3KK3A 1Q86O 3CXCM 1RCHA 3NF8A 4KPYA 4H5VA 4KHPK 3C6UA 2RE2A 3A2FA 3KK2A 1FXXA 1IH7A 1W0HA 4PHTX 2HHUA 2FBVA 4B1ZA 4C8MA 1CZAN 5AQSA 4XH5A 3LDOA 3VOVA 1N8RO 1QE1A 2HBMA 2NLXA 4DQPA 3E01A 3IKMA 1SAZA 1DT9A 1E4FT 3KZBA 4CI6A 2FLOA 3CCQN 3QDKA 4UY8O 2OCEA 2RF2A 3NVMA 4ISFA 4J2BA 3AO2A 5JVGL 5FDLA 2XO7A 2KQ2A 3KD1E 3AVIA 3S3NA 3ID8A 3G4SN 3DI6A 2E5LK 3KLEA 2HBJA 1N32K 4DTUA 3QFUA 4DR4K 4CJUA 2DTUA 1XC9A 3THXA 1C0UA 4JK9A 5AQVA 4JI6K 4CJFA 3CM5A 2IDOA 2A1SA 5JS1A 3CCUN 4KBOA 4GV3A 3THWA 3DMJA 3JYTA 3FGUA 3DLLL 4IJAA 1WSFA 1W9HA 1JLCA 3O3HA 2ASPA 4IO8A 4EIAA 4O8KA 2QEXN 4HUFA 2X78A 4DTSA 3ZT1A 3G25A 2VCPA 4DR7K 1KFSA 5AQOA 3SI6A 1NOZA 3EEQA 1OVYA 3V1OA 3QESA 3DXKB 1JLBA 4V19S 4H5WA 3NMUA 5B8HA 3SUQA 3HYFA 4BR4A 4BRCA 4BROA 3M6GA 4LSLA 3R1XA 2KW4A 1ZBLA 2WONA 2X74A 2QXFA 1VQNN 3M3ZA 4IWVA 4DV4K 5HOOA 3VF6A 3LPTA 1QSYA 1J53A 4B3MK 4AH9A 1QQNA 3ZT0A 3WQUA 4C1NK 3LZJA 1V4TA 3BUZB 3RRHA 1XWLA 4AF1A 2VGNA 3U4LA 1TVRA 1RTIA 3O9TA 1B9FA 4BRAA 5HRPA 1VQKN 3MWTA 3ZETA 4ZTFA 4GKKK 4LH5A 2QI2A 3QFPA 4B1XB 4E3SA 5LJWA 4OX9K 4FLUA 4DFMA 3OBWA 3OYKA 4CJKA 1XHZA 2D0CA 2YCHA 3ZT3A 4FYDA 3V9UA 3DRRA 3ZT2A 4BRLA 2KKZA 4PWDA 1LAVA 3HVRA 2ZM6K 1U47A 4H0OA 1VSDA 4DFJA 3VQDA 3JXUA 5J2QA 2O8CA 2P9KA 3FLCO 3U3GA 3SAHA 4K0KK 3V1RA 2JWLA 4F2RA 1FJGK 1Q81O 3MEEA 4CZGA 3CC4N 4FZXC 1WOQA 3LAMA 4J2AA 1WSGA 1WSHA 2O8FA 2IVOA 4CEBA 1YT3A 3O5BA 4OLAA 3UKRA 4KH4A 5AQZA 4HUEA 5AQXA 4HHTA 1YF5L 4DHYA 3VTHA 3OJUA 3TTFA 4CW7B 4N56A 5HLFA 2ZGZA 2OANA 4CGGA 5AQNA 1VQ9N 3QMLA 1S6QA 3VEYA 4JEPA 1QHAA 2D0AA 1U04A 2Y1JA 4A62A 4M3YA 1YVNA 4Z4CA 1BCMA 3KKRA 1ZBIA 4DSJA 3DLBA 3WXLA 3T1YK 3EY1A 5AQTA 2V7ZA 1EWQA 2W41A 4F4KA 3V9XA 5BRDA 4RTFD 3EZ5A 1JXEA 4R79A 2XY5A 1NJWA 2HHQA 3T1AA 1T3VA 5DK5A 2NRVA 1S9EA 2QWNA 4KTZA 3QEPA 1BO5O 2NNWA 1YTUA 1BGXT 5AFUH 3RSEB 1TKZA 1HQUA 3L2VA 3R3LA 3VESA 3C7NB 3OW2M 1KC8O 1U49A 3CC2N 4FZYA 4G1QA 4KRFA 1RT3A 1M1KO 1BISA 3O3GA 1L5UA 1Q18A 3NGYA 1VSFA 1GLEG 3KIOA 3AA4A 1RTHA 1L3TA 5M1KA 5E41A 5JLHA 3O6WA 3PO4A 4JI8K 3Q7BA 1HKBA 3UKUA 2G8VA 1UWBA 3SPZA 1YXQA 4IEIA 5HRSA 2BUPA 2Q1NA 2W40A 2OPQA 3NCIA 2X6SA 3TPQA 3CD6N 2P9SB 4IOCL 2O8EA 4N47A 2O8BB 4CBWA 1HJRA 1IG9A 2A5XA 3M8QA 2XY7A 2OZSA 1KSPA 4FCYA 4IG3A 3L2WA 2LSNA 1LV5A 5IWAK 5TKYA 3DLKA 3LP3A 3MXIA 4MO4A 1TAQA 2YI1A 4CJSA 2VWBA 3KK1A 1NKBA 3DOLA 3L2RA 3QO9A 2B5JA 4K41A 5DM6L 3TARA 2X6NA 4Z94A 2UYTA 1RBSA 4LF8K 1TKXA 4BWJA 3CIPA 4CJ3A 3OJSA 1NNEA 1Z6RA 3CCRN 2W6LA 4DTPA 1JCEA 4LH4A 4FJKA 4L8RB 4GMJB 1LAWA 3F9MA 2Q97A 3IS9A 3DOKA 3PV8A 2AA4A 3THXB 1NJIO 3HSTB 2IIRA 3DXMA 5J2MA 3PLAA 1CXQA 1YUWA 2QK9A 4CJVA 4NCAA 1VSMA 5KQ8A 5AQIA 2FF3B 3HL8A 5E84A 3BZCA 1W2BM 1TYQA 3AV9A 4BRMA 1C1AA 3HI0A 5CY4A 1X3MA 2P9LB 2E6MA 2QWQA 3OYBA 1LCUA 4DV7K 1C1CA 2E2PA 1S1UA 3CJCA 4NB4A 4B1UB 1J6ZA 1HNWK 1EETA 2ZF5O 3W0LA 4CHOA 3O1WA 5DMRA 4W5QA 3AAQA 1DTTA 5AQRA 3WT0A 2E1ZA 3VMFB 5ADXA 3LDPA 3K9JA 1U2VA 5EVZA 4ID1A 5DM7L 3NGIA 1N36K 1KAZA 2XHBA 1M90O 4FM1A 5AQYA 1GLAG 2ASOA 4H03B 4JI0K 4DR3K 4FJ9A 4M3ZA 1QQMA 2G8UA 3O9UA 4W5TA 1BG3A 2V51B 5FPEA 3RMDA 4YOXA 2D5RA 4MQ3A 2Q3SA 1W7AA 2D0BA 4BRKA 1XQSC 5KTQA 4ID5A 1A5WA 3TAGA 1ILYA 2YNGA 3O8MA 4BR7A 4DMNA 5AQUA 5M1FA 3D0PA 3VEOA 3LDNA 1HR0K 4GV9A 4Q0BA 2FBXA 3QIOA 3H08A 4QS8A 5CE3A 4BE1A 2HHTA 5GINA 4FWPA 4H5NA 4CJ7A 4X64K 2HVIA 4YORA 1MU2A 3OY9A 3ATVA 1NK8A 2O8CB 1WNSA 3LP2A 2F96A 3TTCA 3D2EA 3CC7N 4FVMA 1SL2A 1RNHA 4W5OA 1L3SA 4KTQA 1VSHA 2HBLA 2ZD1A 4WQ5C 3THVA 1WBBA 4X62K 3QETA 1VQ5N 1DGKN 3AGRA 4GVMA 2O8FB 4KHNA 3NH2A 4DU4A 1BDGA 3D45A 2B4JA 3UKRB 4FJMA 2QW9A 4DFKA 3IMXA 1NBWA 4FLZA 1VSIA 2Z1IA 3KLGA 3RTVA 4JI4K 4LF6K 3DRSA 4CERA 3Q7CA 4O8UA 4C8OA 4WQ4A 1OVQA 2E8AA 4CGJA 3CQYA 1N5YA 4KB1A 1VRTA 2P9IA 3PUFA 4O5FA 4CECA 3BDPA 4BC2A 4M3XA 3A5MC 4GVEA 3TAQA 4FJIA 5AQPA 3TAMA 4BY9C 3R9PA 3HXMA 2P9UA 2YNHA 3HBTA 1P8ZA 3E1YA 3VEXA 5H1SQ 4FLVA 3J7YP 4DQ8A 1XHXA 1YJNN 3SZ2A 3NBPA 4DTXA 1EKEA 1BU6O 1EP4A 4B1VA 4Z0UA 5T7BA 4DV0K 4KHWA 3MXMA 1HX1A 4KI6A 4E7IA 2HOEA 5HBMA 3BF1A 1ASWA 4BQZA 3KLHA 4JKFA 4DV5K 1GLJO 3L3VA 3P39A 1BA0A 3QEWA 4FWQA 4FLTA 3C6TA 4BC3A 1D4XA 3MXJA 4FW1A 4W5RA 2EX3A 5LMUK 2G8IA 3EE9A 4B8AB 4DCHA 3TU5A 3VQEA 1KVAA 3IFRA 5FROA 1ATRA 3AO3A 4EP4A 4CHYA 4CIFA 3MX5A 4BDYA 3WXKA 5AQKA 2WOMA 3WEEA 2UXDK 2QKBA 3OS0A 4IFEA 4CZFA 1J5EK 3CETA 3CMAN 2CGLA 3T3FA 2BE2A 1EO1A 4CK2A 3EZWA 3GG4A 1I3AA 3K0SA 4C1NI 4B9TA 3E9OA 1J54A 3KLFA 2HNZA 3SAFA 2VWKA 1QZ6A 4U7BA 4CESA 4YOYA 2QWMA 4YOTA 4NO7A 5LY3A 4F2SA 4LC9B 2UUBK 4RG8A 2GWKA 1TUYA 3CJAA 3FZKA 1KXPA 2HHXA 2PFUA 1NK9A 3FZMA 3RVCA 2RPIA 3AGKA 4B9VA 1U4BA 3LAKA 1YITN 3DAWA 4FJ7A 4BE0A 4XEIA 2VQFK 4BGAA 1IKXA 1N33K 3TTDA 2Q0UA 2HF4A 4CJQA 4A5AA 4I2PA 3U6FA 1GLFO 5BR9A 4M3WA 3SV3A 4WE1A 3SMPA 1KD1O 3M8RA 3WUHA 2OPSA 5K14A 4DTMA 1ASVA 2EHGA 3DWLA 3RMAA 3TSUA 1F21A 5KRSA 4YNQA 1WSJA 2D0OA 1JLFA 4BDPA 3WNFA 1SKSA 4LF5K 3U9DA 2HB5A 1L3VA 5JLFA 4PUOA 1RDUA 1IKWA 1HKCA 4FLWA 3CPEA 3LDQA 4NCGA 1NU0A 1U2VB 3L3UA 4XIUA 4CF8A 3HZ6A 1HNXK 1I94K 1BA1A 3QLHA 4ILHA 3VGLA 4JK8A 2E2NA 3VTIA 4DF4A 2E20A 1S22A 2IVNA 4FW2A 3O4QA 2I7NA 2QWPA 4CEZA 1CXUA 1RT1A 1NGHA 4FWRA 4BG9A 3K57A 5FLXO 4FWOA 2IGIA 3SQ4A 4J8FA 3T1HK 3TABA 4JS5A 3ALYA 3B6PA 4ELTA 2E1YA 4DSIA 2PAVA 2KZMA 2HF3A 2A42A 1T6DA 5HP1A 2PBDA 5LL6Z 3QEVA 4Y0WA 2B6AA 3VGKA 4MO5A 4CD3A 3FE1A 4JKDA 4Z4FA 3CCEN 1VRUA 3UE5A 4ISEA 2YHBA 4OPHA 3VQAA 4F8RA 3MCAB 4CZJA 5MLCQ 4H0VB 4PL7A 3TAEA 4Z4GA 2Z1HA 5LMNK 2RN2A 3O80A 4FJNA 3EO3A 1E3MA 1IBLK 4DQQA 3TAPA 1G99A 4MDAA 4JD2A 1ZBUA 3THYA 4CBXA 4CFCA 4FM2A 1XNRK 1RDDA 2A1RA 3NF9A 3OYGA 4A59A 3B6OA 5FRMA 4OGEA 4HVJA 3VQBA 5BRFA 1IV0A 1UAXA 4FVUA 4JS4A 2HMIA 3CJBA 4E7JA 1YTAA 3EKSA 2D1KA 2YKNA 1KQSM 3SK3A 5I42A 4PA1A 1X9MA 1S5JA 4IO9L 3IUCA 5AQHA 3SAGA 3LANA 1QSSA 3M8PA 3WQTA 4QOZB 4FPAA 1RTJA 1JCFA 4FWNA 4NYFA 1NJXA 1RFQA 4JNEA 3F9KA 2FSKA 3KVGA 4N41A 3WNHA 4CJEA 4NXMK 3P1GA 4PKHA 4BVOA 5C25A 3CCMN 3SUNA 2P9UB 3MN5A 3ULDA 4K25A 3BF3A 3ZT4A 4PQUA 2GELA 1NMNA 4KFBA 4LD0A 4DQIA 4DS4A 1NJZA 5C2DA 4CZEA 4BACA 3LZIA 3K58A 1H1VA 3KLIA 4KHQA 3C65A 2F8SA 4CJ4A 4IKFA 3ZSZA 1RBRA 4CZLA 4BGBA 5F0XA 1TK5A 1CZBA 4CIGA 4JI3K 5FPDA 1EX4A 3ENHA 2GUPA 4FZZA 4JHDA 3IDHA 1BI4A 4B9QA 2NZTA 3O4NA 3U3YA 3VGMA 2WBNA 1KCFA 1S1TA 4CZIA 4CIEA 4GKJK 5KI6A 3ZCMA 2ATQA 3L4QA 3E9PA 2IC3A 1RT2A 3P4IA 4QS7A 4L3QA 4JK7A 3VEWA 4Z4IA 2E88A 3AO1A 1C0GA 4CK3A 4WYBA 3SUOA 3CMEN 5IT9O 5AQMA 3G6EN 4OGCA 3GOIA 1NMDA 3L8BA 3ULEA 4EZ6A 2F7TA 3GDQA 3AO5A 4NCBA 4M41A 4JKGB 4BDZA 1YJ9N 1BCOA 3SQ2A 3VQPA 5BPNA 4W5NA 5LJVA 5KQDA 2UUCK 4DR1K 1VAZA 4A5BA 3DLHA 4JYAK 4YOVA 1OH7A 3A5OC 1QZ5A 3I0SA 5KPZA 1TK0A 2VQEK 1O1WA 3LDSA 3W3DA 2OPRA 2E6LA 4DR6K 4H4OA 4RW8A 3K5NA 3RWUA 3HM9A 1P90A 1Y97A 4IDKA 1VSEA 3OYJA 3D6RA 4B9LA 4I6MB 1IBKK 1UA0A 1HQEA 4B3TK 5C15A 1CZ9A 3AVLA 3I8BA 1D5AA 4FJGA 3D2FA 2HW3A 3N4PA 3AVKA 3ISNC 1T8EA 2PZSA 3SJJA 4IOAL 4DF8A 3MK6A 5TKWA 1RBTA 4GY2B 2RKIA 1LWEA 3CFOA 4LFBK 4CJLA 3TAFA 3TSQA 4DWIA 1ATNA 5C24A 3NH0A 4CD1A 1NJYA 2QA4N 1ZBSA 1VK0A 2G8HA 2KFZA 4EHUA 1EXQA 1HUXA 3N4QA 2HBKA 1Q9XA 3KWIA 4RCHA 1VSLA 4ILJA 4DFPA 3OS2A 1E4GT 3HP9A 3MECA 3A5LC 1RT7A 5JS2A 3HVTA 4DB3A 4CFBA 4O0JA 1NGDA 1T05A 1QVFM 3M5RA 3G0ZA 3CI5A 3THWB 4JI7K 3VETA 2P9PA 4U67L 1XC3A 3A8YA 4H8KA 4E19A 2YNFA 4BRFA 3OYFA 3CFRA 1NGJA 3NE6A 4MFBA 3QB0A 1DKGD 2DFHA 1JJ2M 3MN7A 4YOWA 4OO1J 3VQ8A 1JLAA 3CQXA 4PL8A 2GX9A 5CYMA 3MEDA 3O08A 3DRPA 3EKUA 1IG8A 3M1FA 5KGWA 2GUIA 3BGRA 3VF4A 1XMOK 4M45A 2BANA 4BC4A 1DEJA 1JL2A 3MDQA 1D9DA 4DSKA 1Z05A 1N34K 4BR5A 3AA2A 4OKKA 5M1PA 4JD2B 5GIOA 3SLCA 4IG0A 2CH6A 3T19A 3THYB 1S1WA 1YHQN 2HHHK 4CEAA 1GOCA 4DQRA 1T7PA 2P1JA 3I33A 3I8DA 4JLHA 2G8WA 3ZETB 2QTDA 3DLEA 4Q5VA 2BDPA 4AHVA 4J2EA 1RDWX 5AQFA 5CHIA 2ZWHA 3HPGA 3WNEA 5F1XA 5AZIA 4FPBA 2NUBA 3NF7A 3QINA 2BGGA 2Q36A 4B9UA 1K73O 4FJLA 3MN6A 1RDAA 1XNQK 4CGDA 3J80O 3LDLA 2FSNA 2NRXA 4E0DA 4YDUA 4CF9A 4M63C 3KWGA 4DV3K 5AJ3K 4IFYA 2P9KB 4I7FA 4X66K 4DUZK 3GBTA 2EWSA 1FW6A 1OH8A 1VHXA 3QEXA 4GNIA 3OYMA 4CEOA 4ILGB 2UUAK 4N5SA 3HP6A 1OKJA 2F9TA 4X65K 3VA3A 2ZJQL 4OPAA 1VQON 1SUQA 2KHOA 2BTFA 3AO4A 3OYIA 3IAYA 4AM6A 1VQ8N 1VQLN 2F4VK 3SV4A 4EZ9A 4KHSA 1EWRA 3K9KA 1ZBFA 4CHNA 3WNGA 3O4WA 4CZHA 4YHHK 3L2UA 2BH1A 2VWJA 3V6DA 4JV5K 5KGXA 3CG7A 1BI4B 3QBXA 4F3OA 4I9QA 2ITGA 4WQ4C 1MA9B 1V4SA 3KHYA 4JRQA 4HUGA 1YI2N 3SUPA 4LFAK 4IXCA 3HO1A 3LALA 3K5LA 4Z4HA 3LWLA 3MWPA 4DSLA 3F73A 1EQYA 5ELZA 3UIQA 3EN9A 3HM8A 4IJNA 3J7ZO 3FZFA 5EX5A 2P9NA 1LOTB 1VSJA 1SQKA 2OPPA 1QS4A 2HNYA 4CBUA 5GADP 1BWFO 1B9DA 4AHCA 5FPNA 1SKRA 4EP5A 3AVNA 4OPKA 5EU7A 4C8NA 4B8CA 3OHRA 1QVGM 2KZZA 1ITGA 1Y64A 4FK0A 4A61A 4AHSA 4DV6K 4FK4A 2VG6A 5J2PA 1C6VA 1TL3A 3MCPA 4QCLA 2PY5A 3RRGA 1D8YA 1VQ6N 3UKUB 4B1WB 3L6QA 2OA8A 3CJ7A 5EXWA 3V1QA 4C8LA 2O8EB 1LWCA 5JMVA 3VENA 2QXLA 3SQ0A 3D2FB 2E2OA 4HCCA 5SZTA 3VQCA 1HNIA 4DV2K 2YV0X 3NDKA 4B3SK 5EOYA 1C0TA 4DLEA 3TR8A 3G71N 3ZX0A 2NRRA 4ELUA 3CJ1A 2YHXA 4FJXA 4FM0A 3MMVA 3EL2A 2IS3A 4M7XA 3OYHA 3JSMA 1DLOA 3PSIA 1G15A 4H0XB 2ZJPL 4BQLA 1BOTO 2DFEA 4LF7K 4CEDA 1BL3A 3CERA 5HL7L 5CR4A 5C10A 1LW0A 1RILA 3SNNA 1FK9A 3RSEA 1RTDA 3ZEUA 3PX0A 4TSXA 3PIOL 4ZTJA 3HT3A 2CGJA 5AFUA 2YJFA 4DTNA 3KTQA 1MDUB 3DXMB 4CJ5A 3B8AX 3VERA 2ZJRL 4JRPA 3OTOK 2P5OA 1CLQA 4CZKA 1OH5A 5J2NA 3BP8A 4HTUA 2KLAA 2D4WA 4AHRA 2KFNA 4FJ8A 3HSCA 1IJJA 4IZ9A 1TYQB 1U48A 1NK6A 1KAYA 4BRDA 1BUPA 2XY8A 2ZGYA 3KJVA 4DU3A 3OYAA 5ADXH 3OYEA 3RMBA 2P9SA 1QHTA 3LL3A 4E7LA 3GL1A 2O8BA 4O4GA 1S9GA 1NWKA 4CCHA 4A57A 3AARA 1Q82O 4M42A 3AVFA 2UXBK 4OKJA 3I0RA 1NGGA 1YVUA 5AQQA 4DG1A 1TUUA 4PY5A 3ITHA 2XRIA 4HCBA 2J4RA 1GLCG 1HRHA 1X9WA 1J9AA 4YY3K 2YJEA 4CEEA 1TKDA 1JXBA 5SWMA 4ELVA 1RGIA 4B9SA 2I7PA 4YOUA 5HRRA 2Q2RA 3ENBA 4DTOA 1IKVA 4K42A 3AA5X 1REVA 1K8AO 2QWRA 3BZKA 3IRXA 1JL1A 1A5VA 3LM2A 3D7EO 4HWIA 3S9HA 5GAHP 1WAJA 2UU9K 4CGIA 3MEGA 2OTJN 3SYZA 1UOCA 4LF4K 1GOBA 4RW9A 3ZX2A 1R0AA 1BQNA 2HHVA 4CFAA 5GAEP 1HNVA 3OA9A 5AZIB 3H1VX 4XH1A 3QBWA 5AQJA 3LPUA 5C42A 2R7YA 3CFPA 4G9ZA 1TAUA 1ATSA 1ZXOA 2F8TA 3IG1A 4WCEL 4JKEA 4NYNA 4AM7A 4KHYA 1X3NA 4WFAL 2P9LA 4R5PA 1K8KA 2ETJA 3MAQA 4JKCA 2W6KA 1B92A 2O4IA 3D2EB 4K8ZA 4KTWA 1IBMK 4BR9A 3KKSA 4FO0A 2O4GA 2PYJA 3ZLJA 1VSKA 3F2KA 1D9FA 4B3OA 2FBTA 4DTRA 4KH6A 3CHWA 2QWLA 2HHWA 4CE9A 1Z25A 2GWJA 4GV6A 2Q0RA 3P5JA 4KKOA 3SBTA 4CHZA 2D0PA 4OKEA 3FZHA 4MLEA 1ESVA 3OYDA 4KAZA 2OYQA 3UB5A 1NGAA 3ASMA 3VEVA 1K6YA 3LM9A 2RHKA 3C0BA 4DTJA 3CCJN 4I2QA 1HNZK 5CZ1A 1YIJN 2P9IB 2YX6A 3L4IA 4H4MA 4KH5A 4JI2K 2YHYA 4E89A 1TV6A 2FSJA 4BR2A 1QTMA 1BIZA 2V7YA 1Q8IA 1XUPO 2VG7A 1KVCA 4H5TA 3A5NC 1QSLA 1YJWN 4B9NA 3BY5A 3OYNA 1MWKA 3I55N 5JVHL 3S41A 4C23A 1YAGA 1WUAA 4BRGA 4CF0A 4BWMA 2H3GX 3O3FA 4O5BA 2A40A 2P9NB 1NLVA 1BIUA 3HPHA 4RWTA 3NAEA 5M1OA 4B1YB 1WB9A 3KD5E 1HJOA 3P31A 3BEXA 4IDHA 3R8EA 4CJTA 4E1NA 3R6MA 1NM1A 4CF1A 3LWMA 1S3XA 2HHSA 3S3OA 3QNOA 3DLGA 3M8SA 2DY4A 4Y1DA 1HMVA 3ENOA 4RW4A 1S72N 3OYLA 2NRZA 4AQYK 4BC5A 3SJHA 4KI4A 3RR8A 4XH4A 3HK2A 1T6CA 3AVMA 3HRGA 2O8DA 1HLUA 3ZSYA 1SV5A 4FXDA 4CEQA 3NGZA 2E2QA 2GV9A 2QM1A 1WSIA 4F3TA 1RBVA 3HPOA 3ZX3A 4AILC 4CHPA 4ZHRA 1NKEA 1VQ4N 3WEEB 5GAGP 1BHLA 3EE8A 2G8FA 2HVHA 1KVBA 2WC9A 3J81O 4LY7A 2HNDA 3H45C 5F2RA 3QERA 1GLDG 3A0IX 1GOAA 3ZSQA 5C0YA 3H6EA 3EYZA 4FJJA 2I5JA 3WXMB 4BRHA 4A2BA 4E1JA 2WFBA 2ZQBA 4B08A 3FZLA 1JKHA 1J5OA 3H3OB 4DSEA 3V4IA 4HTLA 5CYQA 4DKWA 3NFAA 5BN8A 4PKIA 2GTDA 4DS5A 1HYZA 3P83D 3VQQA 3OYCA 2NRTA 4O44A 3C6AA 4DLGA 3ZEUB 2KTQA 1A5XA 4MDBA 4CJWA 4M7YA 1KLNA 3KK7A 4CF2A 4N76A 3VQ9A 4FWKA 5FRNA 1S6PA 4M3TA 4CEFA 2DPNA 5M1NA 4J2DA 3VEZA 5AZJA 1RBUA 1TKTA 4OPJA 1K9MO 3ID6A 3OBYA 1WBDA 2VYPA 3TSPA 3G10A 3FR0A 3E9LA 3TANA 5BR8K 4BRNA 4WFBL 3V9WA 5AQLA 2QWOA 4PKGA 3AVHA 1IO2A 4NLBA 5JICA 4JKAA 4KO0A 3CCSN 3HTVA 2P51A 1NK5A 1NK7A 5D3GA 3CPWM 5A2QO 4B3RK 4E7HA 1Z26A 4BG8A 1O13A 5BREA 1T03A 4Y1CA 3T7ZA 2XY6A 1HPZA 1RT5A 4DQSA 1FKPA 3C6HA 3FFIA 4CHQA 1KRPA 2JGUA 3CYMA 4CGHA 3V9SA 1ASUA 1TK8A 3ZSWA 4BRQA 2GBZA 1NGCA 3HJFA 3VF2A 1SL0A 3JAMO 3AVAA 1X9JA 1WLJA 2F9WA 2A41A 1T44A 2OZMA 4Z4EA 1JLEA 4JKHA 4FWLA 3OS1A 1N6QA 4EAHD 4BE2A 4IBNA 4AHUA 4H0TB 3ZSRA 5HROA 4BVPA 1TGOA 3SCXA 5KPRA 3J8AA 1K8KB 2V52B 1Q9YA 4KB0A 1U6ZA 4H5RA 2P5GA 3O9QA 2VGMA 1C0FA 4DUYK 5E26A 4FL9A 1U45A 4IOXA 4ICLA 1R59O 4M3RA 3HOTA 2AP1A 4C8KA 2GEMA 2PYLA 1KAXA 3LP1A 3I56N 3GE1A 4M3UA 5I9EB 3PIPL 4FLYA 3U9ZA 1QQOA 4FWSA 4B9MA 3MN9A 3WXJA 3CCVN 4FK2A 4IFVA 1GLBG 3DLRA 4UQGA 4FOIA 4DU1A 1LW2A 3LP0A 3VA0A 4BR0A 5EY4A 1NOYA 1WAFA 1MWMA 4MLHA 3L2QA 2IVPA 1SZ2A 2E4LA 1VQ7N 3PSFA 5BN9A 2YHAA 3MX2A 1NK4A 4CVNE 1FKOA 3VPZA 4E7KA 3VQ7A 2YHWA 3C95A 5AQWA 5KRTA 4YDUC 4AHTA 4LF9K 3V81A 1NGEA 3V9ZA 1Q7YO 4K8XA 1VQMN 3DXKA 3ZSVA 5BRHA 4KHUA 1GLLO 2CH5A 5BPLA 2Y1IA 3QEIA 3AVCA 4E1MA 4QS9A 5HRNA 2WTUA 4QAGA 4WQ5A 1WN7A 2OTLN 4NXNK 1BQMA 1X9SA 2JLEA 3T69A 2QKKA 1HYVA 2JWKA 4KV8A 3QICA 1IKYA 2A6AA 3NVKA 1RDBA 3QNNA 4WF9L 4LFCK 4DR2K 4OLBA 3AVBA 4BRPA 1NGIA 4JHDB 3VQ4A 1SL1A 4IEEA 1HYSA 1KTQA 3O1BA 2NRHA 3HOSA 1RDCA 4DSFA 4JN4A 1VQPN 1L3UA 2O8DB 5FPMA 1ZC6A 4JKBA 3ATUA 2VG5A 2FF6A 1KLMA 2ASMA 2AJQA 2HSTA 5M1QA 1S1VA 1HKGA 3WXIA 3PX4A 3QIPA 3RR7A 3CF5L 2A3ZA 5GIPA 1WSEA 4FSVA 4DR5K 4OVLA 3ZSOA 1NKCA 1DTQA 5CZ2A 4FLXA 2ITMA 4FJHA 3ULEB 3U8XA 3O9SA 1NG9A 3PO5A 4ISGA 4BREA 2Z1JA 1UA1A 3AAPA 3ZYYX 2CGKA 1NK0A 5I3UA 4KREA 1OH6A 3OVNA 4CFDA 4NLCA 3NF6A 3FFKB 5C2FA 4O55A 1NGFA 3K2PA 3F5TA 5BPMA 1JCGA 4I9LA 2FC0A 2YKMA
chains in the Genus database with same CATH topology
4QS7A 4L3QA 4JK7A 3VEWA 5KPTA 2E88A 3K9JA 1U2VA 1C0GA 5EVZA 4WYBA 5GAEP 3CMEN 3OA9A 5AQMA 2Q31A 5AZIB 3G6EN 3H1VX 5DM7L 1KAZA 4XH1A 3QBWA 5AQJA 1M90O 3GOIA 1NMDA 5AQYA 3ULEA 1GLAG 4G9ZA 1ATSA 2ASOA 3E66A 1ZXOA 4H03B 4WCEL 4JKEA 4AM7A 2F7TA 3GDQA 1QQMA 3CJ9A 1X3NA 4F9OA 3O9UA 1BG3A 4WFAL 2P9LA 4JKGB 3O9RA 1K8KA 1YJ9N 2V51B 5FPEA 5BPNA 4JKCA 5LJVA 5KQDA 4YOXA 1VAZA 3JS6A 4A5BA 3D2EB 4YOVA 4EFHA 3A5OC 5AZJB 4BR9A 3H1QA 1QZ5A 1XQSC 4BRKA 4FO0A 3AY9A 5KPZA 4CZMA 1ILYA 2FXUA 4BRIA 3O8MA 3SMSA 4BR7A 3H46O 3F2KA 5AQUA 5M1FA 4KH6A 4WFNL 3CCLN 3CHWA 3VEOA 3LDNA 3W3DA 3L0QA 4GV9A 2QWLA 4H0YB 2GWJA 1HPMA 4GV6A 2Q0RA 3SBTA 4QS8A 1NGBA 2WUSA 1P90A 5CE3A 3H3NO 5GINA 4FWPA 3D6RA 4H5NA 2D0PA 4I6MB 3FZHA 4MLEA 1ESVA 5AR0A 4CJ7A 3SBGA 5C12A 4H0PA 3UB5A 4YORA 5C15A 4JAXA 4JKGA 3I8BA 1NGAA 3ATVA 3D2FA 3VEVA 3C7NA 3LM9A 2RHKA 3N4PA 3TTCA 4IOAL 3C0BA 3D2EA 4FOEA 3CC7N 3MK6A 5TKWA 3CCJN 2HBLA 4FWMA 4WQ5C 4GY2B 1YIJN 2P9IB 2YX6A 3L4IA 3DJCA 4KH5A 2YHYA 2FSJA 2HMPA 4BR2A 3TSQA 2V7YA 1XUPO 3P38A 2P9PB 4H5TA 3A5NC 1DGKN 1ATNA 3AGRA 1VQ5N 1SS6A 1YJWN 1BDGA 4K43A 4CD1A 4EHTA 5AQGA 1MWKA 2NRWA 4A2AA 3I55N 2QA4N 5JVHL 3S41A 1ZBSA 1YAGA 3UKRB 4C23A 1WUAA 4BRGA 4EHUA 1HUXA 1W97L 3N4QA 2QW9A 2HBKA 4I6MA 3IMXA 3KWIA 1NBWA 2H3GX 4RCHA 1Q86O 4ILJA 2A40A 3CXCM 1E4GT 2P9NB 1NLVA 3Q7CA 4H5VA 3A5LC 2RE2A 4RWTA 5M1OA 4B1YB 4O8UA 4WQ4A 4PHTX 1HJOA 3P31A 3BEXA 2E8AA 4DB3A 4IDHA 3R8EA 4B1ZA 3CQYA 1CZAN 2P9IA 5AQSA 3R6MA 1NGDA 1NM1A 4O5FA 4XH5A 1QVFM 3LDOA 3VOVA 1N8RO 3M5RA 4BC2A 2HBMA 2NLXA 1S3XA 3CI5A 3IKMA 3VETA 1SAZA 2P9PA 1DT9A 3A5MC 1XC3A 3A8YA 4GVEA 4U67L 1E4FT 3ENOA 5AQPA 1S72N 4BY9C 2NRZA 3KZBA 3R9PA 4CI6A 4BC5A 2FLOA 3SJHA 3QDKA 4BRFA 3CCQN 2P9UA 4UY8O 3NVMA 3HBTA 1P8ZA 3E1YA 4ISFA 3VEXA 4XH4A 5H1SQ 1NGJA 1T6CA 3HRGA 4DQ8A 1HLUA 5JVGL 3QB0A 1DKGD 1YJNN 3ID8A 3G4SN 1JJ2M 3MN7A 4YOWA 2E2QA 4OO1J 1BU6O 2HBJA 2QM1A 4B1VA 3QFUA 3CQXA 4PL8A 2GX9A 1HX1A 3ZX3A 3O08A 2HOEA 3BF1A 4JK9A 5AQVA 4BQZA 3EKUA 1VQ4N 1IG8A 4JKFA 3WEEB 5GAGP 3M1FA 3EE8A 1GLJO 3CCUN 3VF4A 3P39A 4KBOA 4GV3A 4BC4A 1BA0A 2WC9A 1DEJA 3MDQA 4FWQA 3FGUA 1Z05A 4BC3A 1D4XA 3H45C 5F2RA 1GLDG 3A0IX 3DLLL 4IJAA 5C0YA 4BR5A 3H6EA 5M1PA 4JD2B 5GIOA 3SLCA 3WXMB 2CH6A 4BRHA 2ASPA 4IO8A 4A2BA 4EIAA 4E1JA 2WFBA 4O8KA 2QEXN 1YHQN 3FZLA 3EE9A 4DCHA 3H3OB 3TU5A 3G25A 4HTLA 4DKWA 2VCPA 5AQOA 3I33A 3IFRA 3ZETB 5BN8A 2QTDA 1OVYA 4PKIA 3DXKB 1ATRA 2GTDA 4H5WA 3MX5A 5B8HA 3NMUA 1RDWX 5AQFA 4BR4A 2ZWHA 4BROA 4BRCA 5CHIA 3WXKA 5AQKA 3M6GA 2NRTA 3WEEA 5AZIA 5F1XA 4FPBA 3R1XA 3C6AA 3P4IA 3ZEUB 4IFEA 4CZFA 4MDBA 2Q36A 1VQNN 1K73O 4M7YA 3M3ZA 3MN6A 4IWVA 3KK7A 3CETA 3CMAN 2CGLA 3LDLA 5HOOA 1EO1A 2FSNA 2NRXA 3VF6A 4FWKA 4YDUA 3EZWA 3GG4A 1QQNA 4C1NK 3WQUA 4C1NI 2DPNA 4M63C 3KWGA 5M1NA 1V4TA 3BUZB 3VEZA 3E9OA 2P9KB 4AF1A 2VGNA 3U4LA 5AZJA 3SAFA 1K9MO 3GBTA 2EWSA 3O9TA 1QZ6A 3ID6A 3OBYA 4GNIA 4BRAA 2VYPA 4U7BA 3TSPA 3MWTA 3ZETA 1VQKN 4YOYA 2QWMA 2QI2A 3QFPA 4ILGB 4YOTA 3FR0A 4B1XB 4NO7A 5LY3A 4LC9B 1OKJA 3E9LA 2F9TA 2GWKA 5LJWA 1TUYA 3CJAA 3FZKA 1KXPA 4BRNA 4WFBL 5AQLA 2QWOA 2ZJQL 4PKGA 4OPAA 1VQON 3OBWA 2PFUA 2YCHA 4NLBA 5JICA 3FZMA 3RVCA 4JKAA 2KHOA 2BTFA 3AGKA 3CCSN 3HTVA 1YITN 3DAWA 4AM6A 4XEIA 4BRLA 4BGAA 1VQ8N 1VQLN 2KKZA 3CPWM 3TTDA 2Q0UA 2HF4A 4H0OA 4A5AA 1GLFO 5BR9A 3K9KA 3JXUA 3SMPA 3O4WA 4BG8A 1O13A 4CZHA 5BREA 3T7ZA 1KD1O 2P9KA 3FLCO 3SAHA 3WUHA 2BH1A 2JWLA 3C6HA 3DWLA 1Q81O 3QBXA 3TSUA 4CZGA 3CC4N 1WOQA 2D0OA 4WQ4C 1MA9B 1V4SA 3KHYA 3U9DA 5JLFA 1YI2N 2IVOA 4IXCA 4BRQA 1RDUA 3O5BA 1HKCA 1NGCA 3VF2A 3MWPA 3UKRA 3CPEA 4KH4A 3LDQA 1EQYA 5AQZA 1X9JA 1U2VB 5ELZA 2F9WA 2A41A 3EN9A 1T44A 3HM8A 3HZ6A 4IJNA 3J7ZO 3FZFA 4JKHA 4FWLA 5AQXA 1BA1A 1YF5L 4DHYA 4ILHA 5EX5A 3VGLA 3VTHA 4JK8A 2E2NA 3VTIA 4EAHD 2P9NA 3TTFA 1LOTB 2E20A 4H0TB 2ZGZA 1S22A 2OANA 1SQKA 5AQNA 2IVNA 1VQ9N 3QMLA 2I7NA 2QWPA 3VEYA 4BVPA 4CBUA 1NGHA 5KPRA 4FWRA 4BG9A 5GADP 3J8AA 1BWFO 1QHAA 4JEPA 4FWOA 1K8KB 2V52B 5FPNA 4J8FA 4A62A 1U6ZA 4H5RA 3O9QA 2VGMA 1C0FA 1YVNA 2E1YA 1QVGM 3OHRA 2PAVA 1Y64A 4FL9A 2HF3A 5E26A 2A42A 1T6DA 4IOXA 3WXLA 4A61A 2PBDA 4Y0WA 5AQTA 1R59O 3VGKA 4MO5A 2V7ZA 3FE1A 4CD3A 3HOTA 4JKDA 2W41A 2AP1A 3MCPA 5BRDA 4RTFD 2GEMA 3CCEN 1VQ6N 4R79A 1KAXA 3UE5A 3UKUB 4B1WB 1T3VA 4ISEA 4OPHA 3GE1A 2NRVA 3L6QA 3I56N 2QWNA 5I9EB 3PIPL 3U9ZA 1QQOA 1BO5O 3MCAB 4CZJA 4FWSA 2NNWA 5MLCQ 4H0VB 3MN9A 3WXJA 3CCVN 3CJ7A 5EXWA 4PL7A 1GLBG 5AFUH 5JMVA 4FOIA 3O80A 3RSEB 2QXLA 3VENA 3D2FB 3EO3A 3R3LA 2E2OA 3VESA 3C7NB 4BR0A 3OW2M 5EY4A 1KC8O 3CC2N 1MWMA 4MLHA 2IVPA 1G99A 5EOYA 1SZ2A 4MDAA 1VQ7N 3G71N 3ZX0A 4JD2A 2NRRA 5BN9A 1M1KO 3CJ1A 3MX2A 1Q18A 2YHXA 1GLEG 5ADXA 5M1KA 3MMVA 3EL2A 3VPZA 5JLHA 3O6WA 4M7XA 4CBXA 2YHWA 5AQWA 3Q7BA 4YDUC 4H0XB 2ZJPL 1HKBA 4BQLA 1NGEA 3UKUA 1BOTO 1Q7YO 3CERA 1VQMN 3DXKA 5HL7L 4A59A 5BRHA 1YXQA 4IEIA 1GLLO 5CR4A 5BRFA 2CH5A 2BUPA 2Q1NA 2W40A 5BPLA 4FVUA 3TPQA 5C10A 2P9SB 3CJBA 4IOCL 3CD6N 4QS9A 3EKSA 2D1KA 3RSEA 4CBWA 1KQSM 3SK3A 3ZEUA 3PIOL 4WQ5A 2A5XA 2OTLN 4IO9L 2CGJA 3IUCA 5AFUA 2YJFA 5AQHA 3SAGA 5TKYA 1MDUB 3WQTA 3DXMB 3T69A 3B8AX 4FPAA 3VERA 2ZJRL 4MO4A 1JCFA 4FWNA 1RFQA 2JWKA 2YI1A 3QICA 4CZKA 2A6AA 4JNEA 3NVKA 2FSKA 3KVGA 3BP8A 2VWBA 2KLAA 4WF9L 2D4WA 3HSCA 4PKHA 4BVOA 1IJJA 4IZ9A 3CCMN 4BRPA 1NGIA 1TYQB 4K41A 5DM6L 4Z94A 4JHDB 2UYTA 1KAYA 4BRDA 4IEEA 3O1BA 1BUPA 2NRHA 2P9UB 3MN5A 4K25A 2ZGYA 3HOSA 3BF3A 3CIPA 1VQPN 4JN4A 1Z6RA 5FPMA 1ZC6A 2GELA 3ATUA 4JKBA 5ADXH 3CCRN 1JCEA 2P9SA 2FF6A 3LL3A 2ASMA 3GL1A 2HSTA 3F9MA 5M1QA 1NWKA 5C2DA 4CZEA 1HKGA 3WXIA 2Q97A 4A57A 3AARA 1H1VA 1Q82O 3C65A 2AA4A 1NJIO 2IIRA 3CF5L 1NGGA 5AQQA 3DXMA 1TUUA 2A3ZA 5GIPA 3PLAA 1YUWA 2J4RA 4FSVA 1GLCG 4CZLA 2ITMA 4BGBA 5F0XA 2YJEA 3ULEB 3U8XA 3O9SA 5AQIA 5KQ8A 2FF3B 1RGIA 5E84A 5FPDA 4ISGA 1TYQA 3ENHA 4BREA 1W2BM 2I7PA 2GUPA 2CGKA 3AAPA 4JHDA 4YOUA 2Q2RA 3ENBA 3ZYYX 3IDHA 4BRMA 3HI0A 4K42A 4B9QA 2NZTA 1X3MA 2P9LB 2QWQA 3VGMA 1K8AO 1LCUA 2QWRA 2WBNA 4NLCA 2E2PA 3CJCA 4NB4A 3FFKB 4B1UB 4CZIA 3LM2A 5C2FA 1J6ZA 3D7EO 4HWIA 5GAHP 2ZF5O 1NGFA 3W0LA 3O1WA 2OTJN 3AAQA 3F5TA 3L4QA 5AQRA 3WT0A 5BPMA 1JCGA 3E9PA 2E1ZA 3VMFB 3LDPA 3ZX2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQO N;  1QVF M;  1N8R O;  1VQ7 N;  3G71 N;  1M1K O;  3CCS N;  5GAE P;  3CME N;  1YIT N;  4U67 L;  3G6E N;  5DM7 L;  1VQ8 N;  1S72 N;  1VQL N;  1M90 O;  3CPW M;  3CCQ N;  4UY8 O;  4WCE L;  2ZJP L;  5H1S Q;  1Q7Y O;  5JVG L;  1KD1 O;  1VQM N;  4WFA L;  5HL7 L;  1YJN N;  1YJ9 N;  3G4S N;  1JJ2 M;  1Q81 O;  3CD6 N;  4IOC L;  3CC4 N;  1KQS M;  3PIO L;  1VQ4 N;  1ILY A;  2OTL N;  4IO9 L;  5GAG P;  1YI2 N;  4WFN L;  3CCU N;  3CCL N;  2ZJR L;  3DLL L;  4WF9 L;  3J7Z O;  3CCM N;  5DM6 L;  2QEX N;  1YHQ N;  1VQ9 N;  1VQP N;  5GAD P;  3CCR N;  1OVY A;  4IOA L;  3CC7 N;  3CCJ N;  1YIJ N;  1Q82 O;  1QVG M;  1NJI O;  3CF5 L;  1VQN N;  1K73 O;  1VQ5 N;  1YJW N;  3CMA N;  3I55 N;  2QA4 N;  5JVH L;  3CCE N;  1W2B M;  1VQ6 N;  3I56 N;  3PIP L;  1K8A O;  1Q86 O;  3CXC M;  1K9M O;  5MLC Q;  3CCV N;  1VQK N;  5GAH P;  2OTJ N;  3OW2 M;  4WFB L;  1KC8 O;  3CC2 N;  2ZJQ L; 
#chains in the Genus database with same CATH topology
 3CQ8 A;  1SKW A;  4JI5 K;  5KPT A;  4LSN A;  4O0I A;  4FJ5 A;  5J1E A;  2Q31 A;  1QQC A;  1ZBH A;  3CM6 A;  4OJR A;  3TWH A;  3E66 A;  3K5O A;  2DFF A;  3CJ9 A;  3SPY A;  2G8K A;  4F9O A;  4CJR A;  3O9R A;  1C0M A;  2IAJ A;  3JS6 A;  3ZSX A;  4EFH A;  5AZJ B;  3H1Q A;  3AA3 A;  3AVG A;  3AY9 A;  4CZM A;  2FXU A;  4BRI A;  3SMS A;  3H46 O;  3SQ1 A;  4WFN L;  3CCL N;  3J7A P;  3K5M A;  1S1X A;  1X1P A;  3L0Q A;  1XI1 A;  2UXC K;  4YFU A;  4H0Y B;  1ZYQ A;  4RW7 A;  1HPM A;  1KFD A;  3DM2 A;  1NGB A;  2WUS A;  3NHG A;  3PY8 A;  3H3N O;  4CGF A;  5C12 A;  2W42 A;  3AVJ A;  5AR0 A;  3SBG A;  4CK1 A;  3RMC A;  4H0P A;  1I39 A;  4CJP A;  4JAX A;  4JKG A;  3S3M A;  1RT4 A;  3TI0 A;  3C7N A;  1TL1 A;  1JLQ A;  4FOE A;  2ZE2 A;  4FWM A;  3VQ6 A;  2IOC A;  3DJC A;  2YNI A;  1LWF A;  1RT6 A;  1JLG A;  3NH1 A;  2HMP A;  4GW6 A;  3P38 A;  2P9P B;  3DYA A;  3K59 A;  1SS6 A;  1XMQ K;  4K43 A;  3C94 A;  4EHT A;  5AQG A;  2NRW A;  4A2A A;  1C1B A;  3PX6 A;  4RW6 A;  1W97 L;  4I6M A;  3VN5 A;  4DV1 K;  2FBY A;  4JI1 K;  3VQ5 A;  2Z1G A;  3KK3 A;  1Q86 O;  3CXC M;  1RCH A;  3NF8 A;  4KPY A;  4H5V A;  4KHP K;  3C6U A;  2RE2 A;  3A2F A;  3KK2 A;  1FXX A;  1IH7 A;  1W0H A;  4PHT X;  2HHU A;  2FBV A;  4B1Z A;  4C8M A;  1CZA N;  5AQS A;  4XH5 A;  3LDO A;  3VOV A;  1N8R O;  1QE1 A;  2HBM A;  2NLX A;  4DQP A;  3E01 A;  3IKM A;  1SAZ A;  1DT9 A;  1E4F T;  3KZB A;  4CI6 A;  2FLO A;  3CCQ N;  3QDK A;  4UY8 O;  2OCE A;  2RF2 A;  3NVM A;  4ISF A;  4J2B A;  3AO2 A;  5JVG L;  5FDL A;  2XO7 A;  2KQ2 A;  3KD1 E;  3AVI A;  3S3N A;  3ID8 A;  3G4S N;  3DI6 A;  2E5L K;  3KLE A;  2HBJ A;  1N32 K;  4DTU A;  3QFU A;  4DR4 K;  4CJU A;  2DTU A;  1XC9 A;  3THX A;  1C0U A;  4JK9 A;  5AQV A;  4JI6 K;  4CJF A;  3CM5 A;  2IDO A;  2A1S A;  5JS1 A;  3CCU N;  4KBO A;  4GV3 A;  3THW A;  3DMJ A;  3JYT A;  3FGU A;  3DLL L;  4IJA A;  1WSF A;  1W9H A;  1JLC A;  3O3H A;  2ASP A;  4IO8 A;  4EIA A;  4O8K A;  2QEX N;  4HUF A;  2X78 A;  4DTS A;  3ZT1 A;  3G25 A;  2VCP A;  4DR7 K;  1KFS A;  5AQO A;  3SI6 A;  1NOZ A;  3EEQ A;  1OVY A;  3V1O A;  3QES A;  3DXK B;  1JLB A;  4V19 S;  4H5W A;  3NMU A;  5B8H A;  3SUQ A;  3HYF A;  4BR4 A;  4BRC A;  4BRO A;  3M6G A;  4LSL A;  3R1X A;  2KW4 A;  1ZBL A;  2WON A;  2X74 A;  2QXF A;  1VQN N;  3M3Z A;  4IWV A;  4DV4 K;  5HOO A;  3VF6 A;  3LPT A;  1QSY A;  1J53 A;  4B3M K;  4AH9 A;  1QQN A;  3ZT0 A;  3WQU A;  4C1N K;  3LZJ A;  1V4T A;  3BUZ B;  3RRH A;  1XWL A;  4AF1 A;  2VGN A;  3U4L A;  1TVR A;  1RTI A;  3O9T A;  1B9F A;  4BRA A;  5HRP A;  1VQK N;  3MWT A;  3ZET A;  4ZTF A;  4GKK K;  4LH5 A;  2QI2 A;  3QFP A;  4B1X B;  4E3S A;  5LJW A;  4OX9 K;  4FLU A;  4DFM A;  3OBW A;  3OYK A;  4CJK A;  1XHZ A;  2D0C A;  2YCH A;  3ZT3 A;  4FYD A;  3V9U A;  3DRR A;  3ZT2 A;  4BRL A;  2KKZ A;  4PWD A;  1LAV A;  3HVR A;  2ZM6 K;  1U47 A;  4H0O A;  1VSD A;  4DFJ A;  3VQD A;  3JXU A;  5J2Q A;  2O8C A;  2P9K A;  3FLC O;  3U3G A;  3SAH A;  4K0K K;  3V1R A;  2JWL A;  4F2R A;  1FJG K;  1Q81 O;  3MEE A;  4CZG A;  3CC4 N;  4FZX C;  1WOQ A;  3LAM A;  4J2A A;  1WSG A;  1WSH A;  2O8F A;  2IVO A;  4CEB A;  1YT3 A;  3O5B A;  4OLA A;  3UKR A;  4KH4 A;  5AQZ A;  4HUE A;  5AQX A;  4HHT A;  1YF5 L;  4DHY A;  3VTH A;  3OJU A;  3TTF A;  4CW7 B;  4N56 A;  5HLF A;  2ZGZ A;  2OAN A;  4CGG A;  5AQN A;  1VQ9 N;  3QML A;  1S6Q A;  3VEY A;  4JEP A;  1QHA A;  2D0A A;  1U04 A;  2Y1J A;  4A62 A;  4M3Y A;  1YVN A;  4Z4C A;  1BCM A;  3KKR A;  1ZBI A;  4DSJ A;  3DLB A;  3WXL A;  3T1Y K;  3EY1 A;  5AQT A;  2V7Z A;  1EWQ A;  2W41 A;  4F4K A;  3V9X A;  5BRD A;  4RTF D;  3EZ5 A;  1JXE A;  4R79 A;  2XY5 A;  1NJW A;  2HHQ A;  3T1A A;  1T3V A;  5DK5 A;  2NRV A;  1S9E A;  2QWN A;  4KTZ A;  3QEP A;  1BO5 O;  2NNW A;  1YTU A;  1BGX T;  5AFU H;  3RSE B;  1TKZ A;  1HQU A;  3L2V A;  3R3L A;  3VES A;  3C7N B;  3OW2 M;  1KC8 O;  1U49 A;  3CC2 N;  4FZY A;  4G1Q A;  4KRF A;  1RT3 A;  1M1K O;  1BIS A;  3O3G A;  1L5U A;  1Q18 A;  3NGY A;  1VSF A;  1GLE G;  3KIO A;  3AA4 A;  1RTH A;  1L3T A;  5M1K A;  5E41 A;  5JLH A;  3O6W A;  3PO4 A;  4JI8 K;  3Q7B A;  1HKB A;  3UKU A;  2G8V A;  1UWB A;  3SPZ A;  1YXQ A;  4IEI A;  5HRS A;  2BUP A;  2Q1N A;  2W40 A;  2OPQ A;  3NCI A;  2X6S A;  3TPQ A;  3CD6 N;  2P9S B;  4IOC L;  2O8E A;  4N47 A;  2O8B B;  4CBW A;  1HJR A;  1IG9 A;  2A5X A;  3M8Q A;  2XY7 A;  2OZS A;  1KSP A;  4FCY A;  4IG3 A;  3L2W A;  2LSN A;  1LV5 A;  5IWA K;  5TKY A;  3DLK A;  3LP3 A;  3MXI A;  4MO4 A;  1TAQ A;  2YI1 A;  4CJS A;  2VWB A;  3KK1 A;  1NKB A;  3DOL A;  3L2R A;  3QO9 A;  2B5J A;  4K41 A;  5DM6 L;  3TAR A;  2X6N A;  4Z94 A;  2UYT A;  1RBS A;  4LF8 K;  1TKX A;  4BWJ A;  3CIP A;  4CJ3 A;  3OJS A;  1NNE A;  1Z6R A;  3CCR N;  2W6L A;  4DTP A;  1JCE A;  4LH4 A;  4FJK A;  4L8R B;  4GMJ B;  1LAW A;  3F9M A;  2Q97 A;  3IS9 A;  3DOK A;  3PV8 A;  2AA4 A;  3THX B;  1NJI O;  3HST B;  2IIR A;  3DXM A;  5J2M A;  3PLA A;  1CXQ A;  1YUW A;  2QK9 A;  4CJV A;  4NCA A;  1VSM A;  5KQ8 A;  5AQI A;  2FF3 B;  3HL8 A;  5E84 A;  3BZC A;  1W2B M;  1TYQ A;  3AV9 A;  4BRM A;  1C1A A;  3HI0 A;  5CY4 A;  1X3M A;  2P9L B;  2E6M A;  2QWQ A;  3OYB A;  1LCU A;  4DV7 K;  1C1C A;  2E2P A;  1S1U A;  3CJC A;  4NB4 A;  4B1U B;  1J6Z A;  1HNW K;  1EET A;  2ZF5 O;  3W0L A;  4CHO A;  3O1W A;  5DMR A;  4W5Q A;  3AAQ A;  1DTT A;  5AQR A;  3WT0 A;  2E1Z A;  3VMF B;  5ADX A;  3LDP A;  3K9J A;  1U2V A;  5EVZ A;  4ID1 A;  5DM7 L;  3NGI A;  1N36 K;  1KAZ A;  2XHB A;  1M90 O;  4FM1 A;  5AQY A;  1GLA G;  2ASO A;  4H03 B;  4JI0 K;  4DR3 K;  4FJ9 A;  4M3Z A;  1QQM A;  2G8U A;  3O9U A;  4W5T A;  1BG3 A;  2V51 B;  5FPE A;  3RMD A;  4YOX A;  2D5R A;  4MQ3 A;  2Q3S A;  1W7A A;  2D0B A;  4BRK A;  1XQS C;  5KTQ A;  4ID5 A;  1A5W A;  3TAG A;  1ILY A;  2YNG A;  3O8M A;  4BR7 A;  4DMN A;  5AQU A;  5M1F A;  3D0P A;  3VEO A;  3LDN A;  1HR0 K;  4GV9 A;  4Q0B A;  2FBX A;  3QIO A;  3H08 A;  4QS8 A;  5CE3 A;  4BE1 A;  2HHT A;  5GIN A;  4FWP A;  4H5N A;  4CJ7 A;  4X64 K;  2HVI A;  4YOR A;  1MU2 A;  3OY9 A;  3ATV A;  1NK8 A;  2O8C B;  1WNS A;  3LP2 A;  2F96 A;  3TTC A;  3D2E A;  3CC7 N;  4FVM A;  1SL2 A;  1RNH A;  4W5O A;  1L3S A;  4KTQ A;  1VSH A;  2HBL A;  2ZD1 A;  4WQ5 C;  3THV A;  1WBB A;  4X62 K;  3QET A;  1VQ5 N;  1DGK N;  3AGR A;  4GVM A;  2O8F B;  4KHN A;  3NH2 A;  4DU4 A;  1BDG A;  3D45 A;  2B4J A;  3UKR B;  4FJM A;  2QW9 A;  4DFK A;  3IMX A;  1NBW A;  4FLZ A;  1VSI A;  2Z1I A;  3KLG A;  3RTV A;  4JI4 K;  4LF6 K;  3DRS A;  4CER A;  3Q7C A;  4O8U A;  4C8O A;  4WQ4 A;  1OVQ A;  2E8A A;  4CGJ A;  3CQY A;  1N5Y A;  4KB1 A;  1VRT A;  2P9I A;  3PUF A;  4O5F A;  4CEC A;  3BDP A;  4BC2 A;  4M3X A;  3A5M C;  4GVE A;  3TAQ A;  4FJI A;  5AQP A;  3TAM A;  4BY9 C;  3R9P A;  3HXM A;  2P9U A;  2YNH A;  3HBT A;  1P8Z A;  3E1Y A;  3VEX A;  5H1S Q;  4FLV A;  3J7Y P;  4DQ8 A;  1XHX A;  1YJN N;  3SZ2 A;  3NBP A;  4DTX A;  1EKE A;  1BU6 O;  1EP4 A;  4B1V A;  4Z0U A;  5T7B A;  4DV0 K;  4KHW A;  3MXM A;  1HX1 A;  4KI6 A;  4E7I A;  2HOE A;  5HBM A;  3BF1 A;  1ASW A;  4BQZ A;  3KLH A;  4JKF A;  4DV5 K;  1GLJ O;  3L3V A;  3P39 A;  1BA0 A;  3QEW A;  4FWQ A;  4FLT A;  3C6T A;  4BC3 A;  1D4X A;  3MXJ A;  4FW1 A;  4W5R A;  2EX3 A;  5LMU K;  2G8I A;  3EE9 A;  4B8A B;  4DCH A;  3TU5 A;  3VQE A;  1KVA A;  3IFR A;  5FRO A;  1ATR A;  3AO3 A;  4EP4 A;  4CHY A;  4CIF A;  3MX5 A;  4BDY A;  3WXK A;  5AQK A;  2WOM A;  3WEE A;  2UXD K;  2QKB A;  3OS0 A;  4IFE A;  4CZF A;  1J5E K;  3CET A;  3CMA N;  2CGL A;  3T3F A;  2BE2 A;  1EO1 A;  4CK2 A;  3EZW A;  3GG4 A;  1I3A A;  3K0S A;  4C1N I;  4B9T A;  3E9O A;  1J54 A;  3KLF A;  2HNZ A;  3SAF A;  2VWK A;  1QZ6 A;  4U7B A;  4CES A;  4YOY A;  2QWM A;  4YOT A;  4NO7 A;  5LY3 A;  4F2S A;  4LC9 B;  2UUB K;  4RG8 A;  2GWK A;  1TUY A;  3CJA A;  3FZK A;  1KXP A;  2HHX A;  2PFU A;  1NK9 A;  3FZM A;  3RVC A;  2RPI A;  3AGK A;  4B9V A;  1U4B A;  3LAK A;  1YIT N;  3DAW A;  4FJ7 A;  4BE0 A;  4XEI A;  2VQF K;  4BGA A;  1IKX A;  1N33 K;  3TTD A;  2Q0U A;  2HF4 A;  4CJQ A;  4A5A A;  4I2P A;  3U6F A;  1GLF O;  5BR9 A;  4M3W A;  3SV3 A;  4WE1 A;  3SMP A;  1KD1 O;  3M8R A;  3WUH A;  2OPS A;  5K14 A;  4DTM A;  1ASV A;  2EHG A;  3DWL A;  3RMA A;  3TSU A;  1F21 A;  5KRS A;  4YNQ A;  1WSJ A;  2D0O A;  1JLF A;  4BDP A;  3WNF A;  1SKS A;  4LF5 K;  3U9D A;  2HB5 A;  1L3V A;  5JLF A;  4PUO A;  1RDU A;  1IKW A;  1HKC A;  4FLW A;  3CPE A;  3LDQ A;  4NCG A;  1NU0 A;  1U2V B;  3L3U A;  4XIU A;  4CF8 A;  3HZ6 A;  1HNX K;  1I94 K;  1BA1 A;  3QLH A;  4ILH A;  3VGL A;  4JK8 A;  2E2N A;  3VTI A;  4DF4 A;  2E20 A;  1S22 A;  2IVN A;  4FW2 A;  3O4Q A;  2I7N A;  2QWP A;  4CEZ A;  1CXU A;  1RT1 A;  1NGH A;  4FWR A;  4BG9 A;  3K57 A;  5FLX O;  4FWO A;  2IGI A;  3SQ4 A;  4J8F A;  3T1H K;  3TAB A;  4JS5 A;  3ALY A;  3B6P A;  4ELT A;  2E1Y A;  4DSI A;  2PAV A;  2KZM A;  2HF3 A;  2A42 A;  1T6D A;  5HP1 A;  2PBD A;  5LL6 Z;  3QEV A;  4Y0W A;  2B6A A;  3VGK A;  4MO5 A;  4CD3 A;  3FE1 A;  4JKD A;  4Z4F A;  3CCE N;  1VRU A;  3UE5 A;  4ISE A;  2YHB A;  4OPH A;  3VQA A;  4F8R A;  3MCA B;  4CZJ A;  5MLC Q;  4H0V B;  4PL7 A;  3TAE A;  4Z4G A;  2Z1H A;  5LMN K;  2RN2 A;  3O80 A;  4FJN A;  3EO3 A;  1E3M A;  1IBL K;  4DQQ A;  3TAP A;  1G99 A;  4MDA A;  4JD2 A;  1ZBU A;  3THY A;  4CBX A;  4CFC A;  4FM2 A;  1XNR K;  1RDD A;  2A1R A;  3NF9 A;  3OYG A;  4A59 A;  3B6O A;  5FRM A;  4OGE A;  4HVJ A;  3VQB A;  5BRF A;  1IV0 A;  1UAX A;  4FVU A;  4JS4 A;  2HMI A;  3CJB A;  4E7J A;  1YTA A;  3EKS A;  2D1K A;  2YKN A;  1KQS M;  3SK3 A;  5I42 A;  4PA1 A;  1X9M A;  1S5J A;  4IO9 L;  3IUC A;  5AQH A;  3SAG A;  3LAN A;  1QSS A;  3M8P A;  3WQT A;  4QOZ B;  4FPA A;  1RTJ A;  1JCF A;  4FWN A;  4NYF A;  1NJX A;  1RFQ A;  4JNE A;  3F9K A;  2FSK A;  3KVG A;  4N41 A;  3WNH A;  4CJE A;  4NXM K;  3P1G A;  4PKH A;  4BVO A;  5C25 A;  3CCM N;  3SUN A;  2P9U B;  3MN5 A;  3ULD A;  4K25 A;  3BF3 A;  3ZT4 A;  4PQU A;  2GEL A;  1NMN A;  4KFB A;  4LD0 A;  4DQI A;  4DS4 A;  1NJZ A;  5C2D A;  4CZE A;  4BAC A;  3LZI A;  3K58 A;  1H1V A;  3KLI A;  4KHQ A;  3C65 A;  2F8S A;  4CJ4 A;  4IKF A;  3ZSZ A;  1RBR A;  4CZL A;  4BGB A;  5F0X A;  1TK5 A;  1CZB A;  4CIG A;  4JI3 K;  5FPD A;  1EX4 A;  3ENH A;  2GUP A;  4FZZ A;  4JHD A;  3IDH A;  1BI4 A;  4B9Q A;  2NZT A;  3O4N A;  3U3Y A;  3VGM A;  2WBN A;  1KCF A;  1S1T A;  4CZI A;  4CIE A;  4GKJ K;  5KI6 A;  3ZCM A;  2ATQ A;  3L4Q A;  3E9P A;  2IC3 A;  1RT2 A;  3P4I A;  4QS7 A;  4L3Q A;  4JK7 A;  3VEW A;  4Z4I A;  2E88 A;  3AO1 A;  1C0G A;  4CK3 A;  4WYB A;  3SUO A;  3CME N;  5IT9 O;  5AQM A;  3G6E N;  4OGC A;  3GOI A;  1NMD A;  3L8B A;  3ULE A;  4EZ6 A;  2F7T A;  3GDQ A;  3AO5 A;  4NCB A;  4M41 A;  4JKG B;  4BDZ A;  1YJ9 N;  1BCO A;  3SQ2 A;  3VQP A;  5BPN A;  4W5N A;  5LJV A;  5KQD A;  2UUC K;  4DR1 K;  1VAZ A;  4A5B A;  3DLH A;  4JYA K;  4YOV A;  1OH7 A;  3A5O C;  1QZ5 A;  3I0S A;  5KPZ A;  1TK0 A;  2VQE K;  1O1W A;  3LDS A;  3W3D A;  2OPR A;  2E6L A;  4DR6 K;  4H4O A;  4RW8 A;  3K5N A;  3RWU A;  3HM9 A;  1P90 A;  1Y97 A;  4IDK A;  1VSE A;  3OYJ A;  3D6R A;  4B9L A;  4I6M B;  1IBK K;  1UA0 A;  1HQE A;  4B3T K;  5C15 A;  1CZ9 A;  3AVL A;  3I8B A;  1D5A A;  4FJG A;  3D2F A;  2HW3 A;  3N4P A;  3AVK A;  3ISN C;  1T8E A;  2PZS A;  3SJJ A;  4IOA L;  4DF8 A;  3MK6 A;  5TKW A;  1RBT A;  4GY2 B;  2RKI A;  1LWE A;  3CFO A;  4LFB K;  4CJL A;  3TAF A;  3TSQ A;  4DWI A;  1ATN A;  5C24 A;  3NH0 A;  4CD1 A;  1NJY A;  2QA4 N;  1ZBS A;  1VK0 A;  2G8H A;  2KFZ A;  4EHU A;  1EXQ A;  1HUX A;  3N4Q A;  2HBK A;  1Q9X A;  3KWI A;  4RCH A;  1VSL A;  4ILJ A;  4DFP A;  3OS2 A;  1E4G T;  3HP9 A;  3MEC A;  3A5L C;  1RT7 A;  5JS2 A;  3HVT A;  4DB3 A;  4CFB A;  4O0J A;  1NGD A;  1T05 A;  1QVF M;  3M5R A;  3G0Z A;  3CI5 A;  3THW B;  4JI7 K;  3VET A;  2P9P A;  4U67 L;  1XC3 A;  3A8Y A;  4H8K A;  4E19 A;  2YNF A;  4BRF A;  3OYF A;  3CFR A;  1NGJ A;  3NE6 A;  4MFB A;  3QB0 A;  1DKG D;  2DFH A;  1JJ2 M;  3MN7 A;  4YOW A;  4OO1 J;  3VQ8 A;  1JLA A;  3CQX A;  4PL8 A;  2GX9 A;  5CYM A;  3MED A;  3O08 A;  3DRP A;  3EKU A;  1IG8 A;  3M1F A;  5KGW A;  2GUI A;  3BGR A;  3VF4 A;  1XMO K;  4M45 A;  2BAN A;  4BC4 A;  1DEJ A;  1JL2 A;  3MDQ A;  1D9D A;  4DSK A;  1Z05 A;  1N34 K;  4BR5 A;  3AA2 A;  4OKK A;  5M1P A;  4JD2 B;  5GIO A;  3SLC A;  4IG0 A;  2CH6 A;  3T19 A;  3THY B;  1S1W A;  1YHQ N;  2HHH K;  4CEA A;  1GOC A;  4DQR A;  1T7P A;  2P1J A;  3I33 A;  3I8D A;  4JLH A;  2G8W A;  3ZET B;  2QTD A;  3DLE A;  4Q5V A;  2BDP A;  4AHV A;  4J2E A;  1RDW X;  5AQF A;  5CHI A;  2ZWH A;  3HPG A;  3WNE A;  5F1X A;  5AZI A;  4FPB A;  2NUB A;  3NF7 A;  3QIN A;  2BGG A;  2Q36 A;  4B9U A;  1K73 O;  4FJL A;  3MN6 A;  1RDA A;  1XNQ K;  4CGD A;  3J80 O;  3LDL A;  2FSN A;  2NRX A;  4E0D A;  4YDU A;  4CF9 A;  4M63 C;  3KWG A;  4DV3 K;  5AJ3 K;  4IFY A;  2P9K B;  4I7F A;  4X66 K;  4DUZ K;  3GBT A;  2EWS A;  1FW6 A;  1OH8 A;  1VHX A;  3QEX A;  4GNI A;  3OYM A;  4CEO A;  4ILG B;  2UUA K;  4N5S A;  3HP6 A;  1OKJ A;  2F9T A;  4X65 K;  3VA3 A;  2ZJQ L;  4OPA A;  1VQO N;  1SUQ A;  2KHO A;  2BTF A;  3AO4 A;  3OYI A;  3IAY A;  4AM6 A;  1VQ8 N;  1VQL N;  2F4V K;  3SV4 A;  4EZ9 A;  4KHS A;  1EWR A;  3K9K A;  1ZBF A;  4CHN A;  3WNG A;  3O4W A;  4CZH A;  4YHH K;  3L2U A;  2BH1 A;  2VWJ A;  3V6D A;  4JV5 K;  5KGX A;  3CG7 A;  1BI4 B;  3QBX A;  4F3O A;  4I9Q A;  2ITG A;  4WQ4 C;  1MA9 B;  1V4S A;  3KHY A;  4JRQ A;  4HUG A;  1YI2 N;  3SUP A;  4LFA K;  4IXC A;  3HO1 A;  3LAL A;  3K5L A;  4Z4H A;  3LWL A;  3MWP A;  4DSL A;  3F73 A;  1EQY A;  5ELZ A;  3UIQ A;  3EN9 A;  3HM8 A;  4IJN A;  3J7Z O;  3FZF A;  5EX5 A;  2P9N A;  1LOT B;  1VSJ A;  1SQK A;  2OPP A;  1QS4 A;  2HNY A;  4CBU A;  5GAD P;  1BWF O;  1B9D A;  4AHC A;  5FPN A;  1SKR A;  4EP5 A;  3AVN A;  4OPK A;  5EU7 A;  4C8N A;  4B8C A;  3OHR A;  1QVG M;  2KZZ A;  1ITG A;  1Y64 A;  4FK0 A;  4A61 A;  4AHS A;  4DV6 K;  4FK4 A;  2VG6 A;  5J2P A;  1C6V A;  1TL3 A;  3MCP A;  4QCL A;  2PY5 A;  3RRG A;  1D8Y A;  1VQ6 N;  3UKU B;  4B1W B;  3L6Q A;  2OA8 A;  3CJ7 A;  5EXW A;  3V1Q A;  4C8L A;  2O8E B;  1LWC A;  5JMV A;  3VEN A;  2QXL A;  3SQ0 A;  3D2F B;  2E2O A;  4HCC A;  5SZT A;  3VQC A;  1HNI A;  4DV2 K;  2YV0 X;  3NDK A;  4B3S K;  5EOY A;  1C0T A;  4DLE A;  3TR8 A;  3G71 N;  3ZX0 A;  2NRR A;  4ELU A;  3CJ1 A;  2YHX A;  4FJX A;  4FM0 A;  3MMV A;  3EL2 A;  2IS3 A;  4M7X A;  3OYH A;  3JSM A;  1DLO A;  3PSI A;  1G15 A;  4H0X B;  2ZJP L;  4BQL A;  1BOT O;  2DFE A;  4LF7 K;  4CED A;  1BL3 A;  3CER A;  5HL7 L;  5CR4 A;  5C10 A;  1LW0 A;  1RIL A;  3SNN A;  1FK9 A;  3RSE A;  1RTD A;  3ZEU A;  3PX0 A;  4TSX A;  3PIO L;  4ZTJ A;  3HT3 A;  2CGJ A;  5AFU A;  2YJF A;  4DTN A;  3KTQ A;  1MDU B;  3DXM B;  4CJ5 A;  3B8A X;  3VER A;  2ZJR L;  4JRP A;  3OTO K;  2P5O A;  1CLQ A;  4CZK A;  1OH5 A;  5J2N A;  3BP8 A;  4HTU A;  2KLA A;  2D4W A;  4AHR A;  2KFN A;  4FJ8 A;  3HSC A;  1IJJ A;  4IZ9 A;  1TYQ B;  1U48 A;  1NK6 A;  1KAY A;  4BRD A;  1BUP A;  2XY8 A;  2ZGY A;  3KJV A;  4DU3 A;  3OYA A;  5ADX H;  3OYE A;  3RMB A;  2P9S A;  1QHT A;  3LL3 A;  4E7L A;  3GL1 A;  2O8B A;  4O4G A;  1S9G A;  1NWK A;  4CCH A;  4A57 A;  3AAR A;  1Q82 O;  4M42 A;  3AVF A;  2UXB K;  4OKJ A;  3I0R A;  1NGG A;  1YVU A;  5AQQ A;  4DG1 A;  1TUU A;  4PY5 A;  3ITH A;  2XRI A;  4HCB A;  2J4R A;  1GLC G;  1HRH A;  1X9W A;  1J9A A;  4YY3 K;  2YJE A;  4CEE A;  1TKD A;  1JXB A;  5SWM A;  4ELV A;  1RGI A;  4B9S A;  2I7P A;  4YOU A;  5HRR A;  2Q2R A;  3ENB A;  4DTO A;  1IKV A;  4K42 A;  3AA5 X;  1REV A;  1K8A O;  2QWR A;  3BZK A;  3IRX A;  1JL1 A;  1A5V A;  3LM2 A;  3D7E O;  4HWI A;  3S9H A;  5GAH P;  1WAJ A;  2UU9 K;  4CGI A;  3MEG A;  2OTJ N;  3SYZ A;  1UOC A;  4LF4 K;  1GOB A;  4RW9 A;  3ZX2 A;  1R0A A;  1BQN A;  2HHV A;  4CFA A;  5GAE P;  1HNV A;  3OA9 A;  5AZI B;  3H1V X;  4XH1 A;  3QBW A;  5AQJ A;  3LPU A;  5C42 A;  2R7Y A;  3CFP A;  4G9Z A;  1TAU A;  1ATS A;  1ZXO A;  2F8T A;  3IG1 A;  4WCE L;  4JKE A;  4NYN A;  4AM7 A;  4KHY A;  1X3N A;  4WFA L;  2P9L A;  4R5P A;  1K8K A;  2ETJ A;  3MAQ A;  4JKC A;  2W6K A;  1B92 A;  2O4I A;  3D2E B;  4K8Z A;  4KTW A;  1IBM K;  4BR9 A;  3KKS A;  4FO0 A;  2O4G A;  2PYJ A;  3ZLJ A;  1VSK A;  3F2K A;  1D9F A;  4B3O A;  2FBT A;  4DTR A;  4KH6 A;  3CHW A;  2QWL A;  2HHW A;  4CE9 A;  1Z25 A;  2GWJ A;  4GV6 A;  2Q0R A;  3P5J A;  4KKO A;  3SBT A;  4CHZ A;  2D0P A;  4OKE A;  3FZH A;  4MLE A;  1ESV A;  3OYD A;  4KAZ A;  2OYQ A;  3UB5 A;  1NGA A;  3ASM A;  3VEV A;  1K6Y A;  3LM9 A;  2RHK A;  3C0B A;  4DTJ A;  3CCJ N;  4I2Q A;  1HNZ K;  5CZ1 A;  1YIJ N;  2P9I B;  2YX6 A;  3L4I A;  4H4M A;  4KH5 A;  4JI2 K;  2YHY A;  4E89 A;  1TV6 A;  2FSJ A;  4BR2 A;  1QTM A;  1BIZ A;  2V7Y A;  1Q8I A;  1XUP O;  2VG7 A;  1KVC A;  4H5T A;  3A5N C;  1QSL A;  1YJW N;  4B9N A;  3BY5 A;  3OYN A;  1MWK A;  3I55 N;  5JVH L;  3S41 A;  4C23 A;  1YAG A;  1WUA A;  4BRG A;  4CF0 A;  4BWM A;  2H3G X;  3O3F A;  4O5B A;  2A40 A;  2P9N B;  1NLV A;  1BIU A;  3HPH A;  4RWT A;  3NAE A;  5M1O A;  4B1Y B;  1WB9 A;  3KD5 E;  1HJO A;  3P31 A;  3BEX A;  4IDH A;  3R8E A;  4CJT A;  4E1N A;  3R6M A;  1NM1 A;  4CF1 A;  3LWM A;  1S3X A;  2HHS A;  3S3O A;  3QNO A;  3DLG A;  3M8S A;  2DY4 A;  4Y1D A;  1HMV A;  3ENO A;  4RW4 A;  1S72 N;  3OYL A;  2NRZ A;  4AQY K;  4BC5 A;  3SJH A;  4KI4 A;  3RR8 A;  4XH4 A;  3HK2 A;  1T6C A;  3AVM A;  3HRG A;  2O8D A;  1HLU A;  3ZSY A;  1SV5 A;  4FXD A;  4CEQ A;  3NGZ A;  2E2Q A;  2GV9 A;  2QM1 A;  1WSI A;  4F3T A;  1RBV A;  3HPO A;  3ZX3 A;  4AIL C;  4CHP A;  4ZHR A;  1NKE A;  1VQ4 N;  3WEE B;  5GAG P;  1BHL A;  3EE8 A;  2G8F A;  2HVH A;  1KVB A;  2WC9 A;  3J81 O;  4LY7 A;  2HND A;  3H45 C;  5F2R A;  3QER A;  1GLD G;  3A0I X;  1GOA A;  3ZSQ A;  5C0Y A;  3H6E A;  3EYZ A;  4FJJ A;  2I5J A;  3WXM B;  4BRH A;  4A2B A;  4E1J A;  2WFB A;  2ZQB A;  4B08 A;  3FZL A;  1JKH A;  1J5O A;  3H3O B;  4DSE A;  3V4I A;  4HTL A;  5CYQ A;  4DKW A;  3NFA A;  5BN8 A;  4PKI A;  2GTD A;  4DS5 A;  1HYZ A;  3P83 D;  3VQQ A;  3OYC A;  2NRT A;  4O44 A;  3C6A A;  4DLG A;  3ZEU B;  2KTQ A;  1A5X A;  4MDB A;  4CJW A;  4M7Y A;  1KLN A;  3KK7 A;  4CF2 A;  4N76 A;  3VQ9 A;  4FWK A;  5FRN A;  1S6P A;  4M3T A;  4CEF A;  2DPN A;  5M1N A;  4J2D A;  3VEZ A;  5AZJ A;  1RBU A;  1TKT A;  4OPJ A;  1K9M O;  3ID6 A;  3OBY A;  1WBD A;  2VYP A;  3TSP A;  3G10 A;  3FR0 A;  3E9L A;  3TAN A;  5BR8 K;  4BRN A;  4WFB L;  3V9W A;  5AQL A;  2QWO A;  4PKG A;  3AVH A;  1IO2 A;  4NLB A;  5JIC A;  4JKA A;  4KO0 A;  3CCS N;  3HTV A;  2P51 A;  1NK5 A;  1NK7 A;  5D3G A;  3CPW M;  5A2Q O;  4B3R K;  4E7H A;  1Z26 A;  4BG8 A;  1O13 A;  5BRE A;  1T03 A;  4Y1C A;  3T7Z A;  2XY6 A;  1HPZ A;  1RT5 A;  4DQS A;  1FKP A;  3C6H A;  3FFI A;  4CHQ A;  1KRP A;  2JGU A;  3CYM A;  4CGH A;  3V9S A;  1ASU A;  1TK8 A;  3ZSW A;  4BRQ A;  2GBZ A;  1NGC A;  3HJF A;  3VF2 A;  1SL0 A;  3JAM O;  3AVA A;  1X9J A;  1WLJ A;  2F9W A;  2A41 A;  1T44 A;  2OZM A;  4Z4E A;  1JLE A;  4JKH A;  4FWL A;  3OS1 A;  1N6Q A;  4EAH D;  4BE2 A;  4IBN A;  4AHU A;  4H0T B;  3ZSR A;  5HRO A;  4BVP A;  1TGO A;  3SCX A;  5KPR A;  3J8A A;  1K8K B;  2V52 B;  1Q9Y A;  4KB0 A;  1U6Z A;  4H5R A;  2P5G A;  3O9Q A;  2VGM A;  1C0F A;  4DUY K;  5E26 A;  4FL9 A;  1U45 A;  4IOX A;  4ICL A;  1R59 O;  4M3R A;  3HOT A;  2AP1 A;  4C8K A;  2GEM A;  2PYL A;  1KAX A;  3LP1 A;  3I56 N;  3GE1 A;  4M3U A;  5I9E B;  3PIP L;  4FLY A;  3U9Z A;  1QQO A;  4FWS A;  4B9M A;  3MN9 A;  3WXJ A;  3CCV N;  4FK2 A;  4IFV A;  1GLB G;  3DLR A;  4UQG A;  4FOI A;  4DU1 A;  1LW2 A;  3LP0 A;  3VA0 A;  4BR0 A;  5EY4 A;  1NOY A;  1WAF A;  1MWM A;  4MLH A;  3L2Q A;  2IVP A;  1SZ2 A;  2E4L A;  1VQ7 N;  3PSF A;  5BN9 A;  2YHA A;  3MX2 A;  1NK4 A;  4CVN E;  1FKO A;  3VPZ A;  4E7K A;  3VQ7 A;  2YHW A;  3C95 A;  5AQW A;  5KRT A;  4YDU C;  4AHT A;  4LF9 K;  3V81 A;  1NGE A;  3V9Z A;  1Q7Y O;  4K8X A;  1VQM N;  3DXK A;  3ZSV A;  5BRH A;  4KHU A;  1GLL O;  2CH5 A;  5BPL A;  2Y1I A;  3QEI A;  3AVC A;  4E1M A;  4QS9 A;  5HRN A;  2WTU A;  4QAG A;  4WQ5 A;  1WN7 A;  2OTL N;  4NXN K;  1BQM A;  1X9S A;  2JLE A;  3T69 A;  2QKK A;  1HYV A;  2JWK A;  4KV8 A;  3QIC A;  1IKY A;  2A6A A;  3NVK A;  1RDB A;  3QNN A;  4WF9 L;  4LFC K;  4DR2 K;  4OLB A;  3AVB A;  4BRP A;  1NGI A;  4JHD B;  3VQ4 A;  1SL1 A;  4IEE A;  1HYS A;  1KTQ A;  3O1B A;  2NRH A;  3HOS A;  1RDC A;  4DSF A;  4JN4 A;  1VQP N;  1L3U A;  2O8D B;  5FPM A;  1ZC6 A;  4JKB A;  3ATU A;  2VG5 A;  2FF6 A;  1KLM A;  2ASM A;  2AJQ A;  2HST A;  5M1Q A;  1S1V A;  1HKG A;  3WXI A;  3PX4 A;  3QIP A;  3RR7 A;  3CF5 L;  2A3Z A;  5GIP A;  1WSE A;  4FSV A;  4DR5 K;  4OVL A;  3ZSO A;  1NKC A;  1DTQ A;  5CZ2 A;  4FLX A;  2ITM A;  4FJH A;  3ULE B;  3U8X A;  3O9S A;  1NG9 A;  3PO5 A;  4ISG A;  4BRE A;  2Z1J A;  1UA1 A;  3AAP A;  3ZYY X;  2CGK A;  1NK0 A;  5I3U A;  4KRE A;  1OH6 A;  3OVN A;  4CFD A;  4NLC A;  3NF6 A;  3FFK B;  5C2F A;  4O55 A;  1NGF A;  3K2P A;  3F5T A;  5BPM A;  1JCG A;  4I9L A;  2FC0 A;  2YKM A; 
#chains in the Genus database with same CATH homology
 4QS7 A;  4L3Q A;  4JK7 A;  3VEW A;  5KPT A;  2E88 A;  3K9J A;  1U2V A;  1C0G A;  5EVZ A;  4WYB A;  5GAE P;  3CME N;  3OA9 A;  5AQM A;  2Q31 A;  5AZI B;  3G6E N;  3H1V X;  5DM7 L;  1KAZ A;  4XH1 A;  3QBW A;  5AQJ A;  1M90 O;  3GOI A;  1NMD A;  5AQY A;  3ULE A;  1GLA G;  4G9Z A;  1ATS A;  2ASO A;  3E66 A;  1ZXO A;  4H03 B;  4WCE L;  4JKE A;  4AM7 A;  2F7T A;  3GDQ A;  1QQM A;  3CJ9 A;  1X3N A;  4F9O A;  3O9U A;  1BG3 A;  4WFA L;  2P9L A;  4JKG B;  3O9R A;  1K8K A;  1YJ9 N;  2V51 B;  5FPE A;  5BPN A;  4JKC A;  5LJV A;  5KQD A;  4YOX A;  1VAZ A;  3JS6 A;  4A5B A;  3D2E B;  4YOV A;  4EFH A;  3A5O C;  5AZJ B;  4BR9 A;  3H1Q A;  1QZ5 A;  1XQS C;  4BRK A;  4FO0 A;  3AY9 A;  5KPZ A;  4CZM A;  1ILY A;  2FXU A;  4BRI A;  3O8M A;  3SMS A;  4BR7 A;  3H46 O;  3F2K A;  5AQU A;  5M1F A;  4KH6 A;  4WFN L;  3CCL N;  3CHW A;  3VEO A;  3LDN A;  3W3D A;  3L0Q A;  4GV9 A;  2QWL A;  4H0Y B;  2GWJ A;  1HPM A;  4GV6 A;  2Q0R A;  3SBT A;  4QS8 A;  1NGB A;  2WUS A;  1P90 A;  5CE3 A;  3H3N O;  5GIN A;  4FWP A;  3D6R A;  4H5N A;  2D0P A;  4I6M B;  3FZH A;  4MLE A;  1ESV A;  5AR0 A;  4CJ7 A;  3SBG A;  5C12 A;  4H0P A;  3UB5 A;  4YOR A;  5C15 A;  4JAX A;  4JKG A;  3I8B A;  1NGA A;  3ATV A;  3D2F A;  3VEV A;  3C7N A;  3LM9 A;  2RHK A;  3N4P A;  3TTC A;  4IOA L;  3C0B A;  3D2E A;  4FOE A;  3CC7 N;  3MK6 A;  5TKW A;  3CCJ N;  2HBL A;  4FWM A;  4WQ5 C;  4GY2 B;  1YIJ N;  2P9I B;  2YX6 A;  3L4I A;  3DJC A;  4KH5 A;  2YHY A;  2FSJ A;  2HMP A;  4BR2 A;  3TSQ A;  2V7Y A;  1XUP O;  3P38 A;  2P9P B;  4H5T A;  3A5N C;  1DGK N;  1ATN A;  3AGR A;  1VQ5 N;  1SS6 A;  1YJW N;  1BDG A;  4K43 A;  4CD1 A;  4EHT A;  5AQG A;  1MWK A;  2NRW A;  4A2A A;  3I55 N;  2QA4 N;  5JVH L;  3S41 A;  1ZBS A;  1YAG A;  3UKR B;  4C23 A;  1WUA A;  4BRG A;  4EHU A;  1HUX A;  1W97 L;  3N4Q A;  2QW9 A;  2HBK A;  4I6M A;  3IMX A;  3KWI A;  1NBW A;  2H3G X;  4RCH A;  1Q86 O;  4ILJ A;  2A40 A;  3CXC M;  1E4G T;  2P9N B;  1NLV A;  3Q7C A;  4H5V A;  3A5L C;  2RE2 A;  4RWT A;  5M1O A;  4B1Y B;  4O8U A;  4WQ4 A;  4PHT X;  1HJO A;  3P31 A;  3BEX A;  2E8A A;  4DB3 A;  4IDH A;  3R8E A;  4B1Z A;  3CQY A;  1CZA N;  2P9I A;  5AQS A;  3R6M A;  1NGD A;  1NM1 A;  4O5F A;  4XH5 A;  1QVF M;  3LDO A;  3VOV A;  1N8R O;  3M5R A;  4BC2 A;  2HBM A;  2NLX A;  1S3X A;  3CI5 A;  3IKM A;  3VET A;  1SAZ A;  2P9P A;  1DT9 A;  3A5M C;  1XC3 A;  3A8Y A;  4GVE A;  4U67 L;  1E4F T;  3ENO A;  5AQP A;  1S72 N;  4BY9 C;  2NRZ A;  3KZB A;  3R9P A;  4CI6 A;  4BC5 A;  2FLO A;  3SJH A;  3QDK A;  4BRF A;  3CCQ N;  2P9U A;  4UY8 O;  3NVM A;  3HBT A;  1P8Z A;  3E1Y A;  4ISF A;  3VEX A;  4XH4 A;  5H1S Q;  1NGJ A;  1T6C A;  3HRG A;  4DQ8 A;  1HLU A;  5JVG L;  3QB0 A;  1DKG D;  1YJN N;  3ID8 A;  3G4S N;  1JJ2 M;  3MN7 A;  4YOW A;  2E2Q A;  4OO1 J;  1BU6 O;  2HBJ A;  2QM1 A;  4B1V A;  3QFU A;  3CQX A;  4PL8 A;  2GX9 A;  1HX1 A;  3ZX3 A;  3O08 A;  2HOE A;  3BF1 A;  4JK9 A;  5AQV A;  4BQZ A;  3EKU A;  1VQ4 N;  1IG8 A;  4JKF A;  3WEE B;  5GAG P;  3M1F A;  3EE8 A;  1GLJ O;  3CCU N;  3VF4 A;  3P39 A;  4KBO A;  4GV3 A;  4BC4 A;  1BA0 A;  2WC9 A;  1DEJ A;  3MDQ A;  4FWQ A;  3FGU A;  1Z05 A;  4BC3 A;  1D4X A;  3H45 C;  5F2R A;  1GLD G;  3A0I X;  3DLL L;  4IJA A;  5C0Y A;  4BR5 A;  3H6E A;  5M1P A;  4JD2 B;  5GIO A;  3SLC A;  3WXM B;  2CH6 A;  4BRH A;  2ASP A;  4IO8 A;  4A2B A;  4EIA A;  4E1J A;  2WFB A;  4O8K A;  2QEX N;  1YHQ N;  3FZL A;  3EE9 A;  4DCH A;  3H3O B;  3TU5 A;  3G25 A;  4HTL A;  4DKW A;  2VCP A;  5AQO A;  3I33 A;  3IFR A;  3ZET B;  5BN8 A;  2QTD A;  1OVY A;  4PKI A;  3DXK B;  1ATR A;  2GTD A;  4H5W A;  3MX5 A;  5B8H A;  3NMU A;  1RDW X;  5AQF A;  4BR4 A;  2ZWH A;  4BRO A;  4BRC A;  5CHI A;  3WXK A;  5AQK A;  3M6G A;  2NRT A;  3WEE A;  5AZI A;  5F1X A;  4FPB A;  3R1X A;  3C6A A;  3P4I A;  3ZEU B;  4IFE A;  4CZF A;  4MDB A;  2Q36 A;  1VQN N;  1K73 O;  4M7Y A;  3M3Z A;  3MN6 A;  4IWV A;  3KK7 A;  3CET A;  3CMA N;  2CGL A;  3LDL A;  5HOO A;  1EO1 A;  2FSN A;  2NRX A;  3VF6 A;  4FWK A;  4YDU A;  3EZW A;  3GG4 A;  1QQN A;  4C1N K;  3WQU A;  4C1N I;  2DPN A;  4M63 C;  3KWG A;  5M1N A;  1V4T A;  3BUZ B;  3VEZ A;  3E9O A;  2P9K B;  4AF1 A;  2VGN A;  3U4L A;  5AZJ A;  3SAF A;  1K9M O;  3GBT A;  2EWS A;  3O9T A;  1QZ6 A;  3ID6 A;  3OBY A;  4GNI A;  4BRA A;  2VYP A;  4U7B A;  3TSP A;  3MWT A;  3ZET A;  1VQK N;  4YOY A;  2QWM A;  2QI2 A;  3QFP A;  4ILG B;  4YOT A;  3FR0 A;  4B1X B;  4NO7 A;  5LY3 A;  4LC9 B;  1OKJ A;  3E9L A;  2F9T A;  2GWK A;  5LJW A;  1TUY A;  3CJA A;  3FZK A;  1KXP A;  4BRN A;  4WFB L;  5AQL A;  2QWO A;  2ZJQ L;  4PKG A;  4OPA A;  1VQO N;  3OBW A;  2PFU A;  2YCH A;  4NLB A;  5JIC A;  3FZM A;  3RVC A;  4JKA A;  2KHO A;  2BTF A;  3AGK A;  3CCS N;  3HTV A;  1YIT N;  3DAW A;  4AM6 A;  4XEI A;  4BRL A;  4BGA A;  1VQ8 N;  1VQL N;  2KKZ A;  3CPW M;  3TTD A;  2Q0U A;  2HF4 A;  4H0O A;  4A5A A;  1GLF O;  5BR9 A;  3K9K A;  3JXU A;  3SMP A;  3O4W A;  4BG8 A;  1O13 A;  4CZH A;  5BRE A;  3T7Z A;  1KD1 O;  2P9K A;  3FLC O;  3SAH A;  3WUH A;  2BH1 A;  2JWL A;  3C6H A;  3DWL A;  1Q81 O;  3QBX A;  3TSU A;  4CZG A;  3CC4 N;  1WOQ A;  2D0O A;  4WQ4 C;  1MA9 B;  1V4S A;  3KHY A;  3U9D A;  5JLF A;  1YI2 N;  2IVO A;  4IXC A;  4BRQ A;  1RDU A;  3O5B A;  1HKC A;  1NGC A;  3VF2 A;  3MWP A;  3UKR A;  3CPE A;  4KH4 A;  3LDQ A;  1EQY A;  5AQZ A;  1X9J A;  1U2V B;  5ELZ A;  2F9W A;  2A41 A;  3EN9 A;  1T44 A;  3HM8 A;  3HZ6 A;  4IJN A;  3J7Z O;  3FZF A;  4JKH A;  4FWL A;  5AQX A;  1BA1 A;  1YF5 L;  4DHY A;  4ILH A;  5EX5 A;  3VGL A;  3VTH A;  4JK8 A;  2E2N A;  3VTI A;  4EAH D;  2P9N A;  3TTF A;  1LOT B;  2E20 A;  4H0T B;  2ZGZ A;  1S22 A;  2OAN A;  1SQK A;  5AQN A;  2IVN A;  1VQ9 N;  3QML A;  2I7N A;  2QWP A;  3VEY A;  4BVP A;  4CBU A;  1NGH A;  5KPR A;  4FWR A;  4BG9 A;  5GAD P;  3J8A A;  1BWF O;  1QHA A;  4JEP A;  4FWO A;  1K8K B;  2V52 B;  5FPN A;  4J8F A;  4A62 A;  1U6Z A;  4H5R A;  3O9Q A;  2VGM A;  1C0F A;  1YVN A;  2E1Y A;  1QVG M;  3OHR A;  2PAV A;  1Y64 A;  4FL9 A;  2HF3 A;  5E26 A;  2A42 A;  1T6D A;  4IOX A;  3WXL A;  4A61 A;  2PBD A;  4Y0W A;  5AQT A;  1R59 O;  3VGK A;  4MO5 A;  2V7Z A;  3FE1 A;  4CD3 A;  3HOT A;  4JKD A;  2W41 A;  2AP1 A;  3MCP A;  5BRD A;  4RTF D;  2GEM A;  3CCE N;  1VQ6 N;  4R79 A;  1KAX A;  3UE5 A;  3UKU B;  4B1W B;  1T3V A;  4ISE A;  4OPH A;  3GE1 A;  2NRV A;  3L6Q A;  3I56 N;  2QWN A;  5I9E B;  3PIP L;  3U9Z A;  1QQO A;  1BO5 O;  3MCA B;  4CZJ A;  4FWS A;  2NNW A;  5MLC Q;  4H0V B;  3MN9 A;  3WXJ A;  3CCV N;  3CJ7 A;  5EXW A;  4PL7 A;  1GLB G;  5AFU H;  5JMV A;  4FOI A;  3O80 A;  3RSE B;  2QXL A;  3VEN A;  3D2F B;  3EO3 A;  3R3L A;  2E2O A;  3VES A;  3C7N B;  4BR0 A;  3OW2 M;  5EY4 A;  1KC8 O;  3CC2 N;  1MWM A;  4MLH A;  2IVP A;  1G99 A;  5EOY A;  1SZ2 A;  4MDA A;  1VQ7 N;  3G71 N;  3ZX0 A;  4JD2 A;  2NRR A;  5BN9 A;  1M1K O;  3CJ1 A;  3MX2 A;  1Q18 A;  2YHX A;  1GLE G;  5ADX A;  5M1K A;  3MMV A;  3EL2 A;  3VPZ A;  5JLH A;  3O6W A;  4M7X A;  4CBX A;  2YHW A;  5AQW A;  3Q7B A;  4YDU C;  4H0X B;  2ZJP L;  1HKB A;  4BQL A;  1NGE A;  3UKU A;  1BOT O;  1Q7Y O;  3CER A;  1VQM N;  3DXK A;  5HL7 L;  4A59 A;  5BRH A;  1YXQ A;  4IEI A;  1GLL O;  5CR4 A;  5BRF A;  2CH5 A;  2BUP A;  2Q1N A;  2W40 A;  5BPL A;  4FVU A;  3TPQ A;  5C10 A;  2P9S B;  3CJB A;  4IOC L;  3CD6 N;  4QS9 A;  3EKS A;  2D1K A;  3RSE A;  4CBW A;  1KQS M;  3SK3 A;  3ZEU A;  3PIO L;  4WQ5 A;  2A5X A;  2OTL N;  4IO9 L;  2CGJ A;  3IUC A;  5AFU A;  2YJF A;  5AQH A;  3SAG A;  5TKY A;  1MDU B;  3WQT A;  3DXM B;  3T69 A;  3B8A X;  4FPA A;  3VER A;  2ZJR L;  4MO4 A;  1JCF A;  4FWN A;  1RFQ A;  2JWK A;  2YI1 A;  3QIC A;  4CZK A;  2A6A A;  4JNE A;  3NVK A;  2FSK A;  3KVG A;  3BP8 A;  2VWB A;  2KLA A;  4WF9 L;  2D4W A;  3HSC A;  4PKH A;  4BVO A;  1IJJ A;  4IZ9 A;  3CCM N;  4BRP A;  1NGI A;  1TYQ B;  4K41 A;  5DM6 L;  4Z94 A;  4JHD B;  2UYT A;  1KAY A;  4BRD A;  4IEE A;  3O1B A;  1BUP A;  2NRH A;  2P9U B;  3MN5 A;  4K25 A;  2ZGY A;  3HOS A;  3BF3 A;  3CIP A;  1VQP N;  4JN4 A;  1Z6R A;  5FPM A;  1ZC6 A;  2GEL A;  3ATU A;  4JKB A;  5ADX H;  3CCR N;  1JCE A;  2P9S A;  2FF6 A;  3LL3 A;  2ASM A;  3GL1 A;  2HST A;  3F9M A;  5M1Q A;  1NWK A;  5C2D A;  4CZE A;  1HKG A;  3WXI A;  2Q97 A;  4A57 A;  3AAR A;  1H1V A;  1Q82 O;  3C65 A;  2AA4 A;  1NJI O;  2IIR A;  3CF5 L;  1NGG A;  5AQQ A;  3DXM A;  1TUU A;  2A3Z A;  5GIP A;  3PLA A;  1YUW A;  2J4R A;  4FSV A;  1GLC G;  4CZL A;  2ITM A;  4BGB A;  5F0X A;  2YJE A;  3ULE B;  3U8X A;  3O9S A;  5AQI A;  5KQ8 A;  2FF3 B;  1RGI A;  5E84 A;  5FPD A;  4ISG A;  1TYQ A;  3ENH A;  4BRE A;  1W2B M;  2I7P A;  2GUP A;  2CGK A;  3AAP A;  4JHD A;  4YOU A;  2Q2R A;  3ENB A;  3ZYY X;  3IDH A;  4BRM A;  3HI0 A;  4K42 A;  4B9Q A;  2NZT A;  1X3M A;  2P9L B;  2QWQ A;  3VGM A;  1K8A O;  1LCU A;  2QWR A;  2WBN A;  4NLC A;  2E2P A;  3CJC A;  4NB4 A;  3FFK B;  4B1U B;  4CZI A;  3LM2 A;  5C2F A;  1J6Z A;  3D7E O;  4HWI A;  5GAH P;  2ZF5 O;  1NGF A;  3W0L A;  3O1W A;  2OTJ N;  3AAQ A;  3F5T A;  3L4Q A;  5AQR A;  3WT0 A;  5BPM A;  1JCG A;  3E9P A;  2E1Z A;  3VMF B;  3LDP A;  3ZX2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...