5SWMA

Bacillus halodurans rnase h mutant d132n in complex with 12-mer frna/dna hybrid
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
131
structure length
131
Chain Sequence
IIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSNSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGEIKADY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Limits of RNA 2'-OH Mimicry by Fluorine: Crystal Structure of Bacillus halodurans RNase H Bound to a 2'-FRNA:DNA Hybrid.
pubmed doi rcsb
source organism Bacillus halodurans
molecule tags Hydrolase/rna/dna
molecule keywords Ribonuclease H
total genus 37
structure length 131
sequence length 131
chains with identical sequence B
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2016-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5swmA00
1BIUA 4FLXA 4ZTFA 3RMCA 4CEZA 3S9HA 4G1QA 1BHLA 1JXEA 5DMRA 4BE1A 3SQ1A 3LP2A 3PO5A 3V9UA 4DTOA 1REVA 4PY5A 3CM6A 4KHWA 2DY4A 2B6AA 1X1PA 1KCFA 1LAVA 1SUQA 1MU2A 4BDYA 2HNZA 1TK5A 4DTPA 4CEQA 4F8RA 1HJRA 4FJ8A 4LSLA 1D8YA 3ZSWA 3OJUA 1U04A 2O4IA 1F21A 4AHTA 3DRSA 3CYMA 3KLIA 3HYFA 4FJKA 3OY9A 2GV9A 4CK1A 4FLUA 4C8NA 1ZBFA 4DTXA 2G8WA 3K57A 4EP5A 4E19A 4BWJA 3PV8A 4H4MA 3TAPA 4OKEA 4CGHA 3DRPA 1TGOA 4FLYA 1TKTA 1X9WA 4DU1A 3SQ0A 4F3OA 2KFZA 2D5RA 3P83D 4BE2A 4HUGA 3KIOA 2ZQBA 4B3OA 1TKZA 1CZ9A 4OPJA 2GBZA 2Y1JA 3RMBA 2VWJA 1NK5A 2P5GA 1VSLA 2BGGA 4R5PA 2LSNA 3AO4A 2OA8A 1RILA 1HYSA 1KFDA 1VSDA 4RG8A 3HPOA 2KW4A 3OYGA 4B9UA 2OZSA 3BDPA 3B6OA 1Z25A 3OYLA 1BCOA 2DFEA 4CIGA 3SYZA 1N5YA 1DTTA 3DRRA 3AO2A 5KGXA 4ID5A 1Q9YA 2ZD1A 2GUIA 3IS9A 3NCIA 2G8VA 5KRSA 1NJYA 3TAQA 1JL2A 4DU4A 3AO5A 1TAUA 1C6VA 1R0AA 1DLOA 3V9XA 3IAYA 2DTUA 4CERA 1VSIA 2JGUA 5HRNA 3CQ8A 4M3TA 4WE1A 4KHNA 3ZSZA 5C25A 3OYNA 1U45A 4KHUA 3AA3A 1XHXA 3V9ZA 1RT3A 1WSJA 3U3GA 4JS4A 1HYZA 4XIUA 5SZTA 3TAEA 4Y1DA 1Q9XA 4KPYA 1J53A 4CFCA 5KGWA 3V1RA 1YTUA 1CXQA 1JL1A 1IKWA 3KKSA 4BACA 3OYEA 3VA3A 1QQCA 1RDDA 4CGIA 4DLEA 3U3YA 4NCAA 3V9WA 1EETA 3TARA 3OYFA 3DOLA 1A5XA 1A5VA 3I0SA 3VQ8A 3L2RA 4DTUA 1NKEA 1VSEA 4IDKA 4O4GA 3ZSXA 4CJKA 4J2DA 3IRXA 3ZT4A 4FLZA 3CG7A 4DFJA 1Z26A 1BISA 4O5BA 4DMNA 1L3TA 4HVJA 4DFKA 3V4IA 4E3SA 3E01A 2Z1JA 3M8SA 1NOZA 1YT3A 1ZBLA 1NJZA 3OJSA 4HUFA 4HUEA 4CCHA 2YV0X 4DSKA 4N76A 1KVCA 3ZT0A 5JS1A 1NK7A 4Z4FA 1BIZA 1TKDA 4CEFA 3T3FA 3LWLA 4F4KA 4FJ5A 3VQ7A 3QEVA 4C8MA 4M42A 3ZSRA 2YNFA 3LAMA 3MEDA 3T1AA 3MECA 1NKCA 3RTVA 3VQAA 4KTQA 3KLFA 1NK8A 4NYFA 4QAGA 1IG9A 3QESA 3DYAA 3KLEA 4RW6A 2Z1HA 3I8DA 3PY8A 3C94A 4E7IA 4Q0BA 4I9LA 3VQCA 4AHUA 3TI0A 5CZ2A 1TL1A 3LP0A 5J2MA 1T8EA 5J1EA 4M3UA 4OVLA 4CE9A 4AHVA 1KFSA 4B9NA 4CGDA 2HHSA 3JSMA 3NGIA 1BI4A 2DFFA 4CHYA 3PX4A 2HHTA 4KI4A 4CJ4A 1NK0A 3AVMA 4J2BA 3T19A 3L2VA 1HYVA 3OYJA 3VQEA 4FW1A 1GOAA 2D0BA 4I7FA 3VQPA 5CYQA 2E4LA 3ZT1A 3M8QA 1IH7A 3HM9A 3K59A 3S3MA 3S3NA 1LWEA 4IBNA 4ZTJA 3F9KA 4GVMA 1LW2A 1S1VA 4FM2A 1RBVA 1ASVA 5J2PA 3IG1A 5KTQA 1BQMA 1RT6A 1TK8A 4CGJA 1HMVA 2B5JA 3KLGA 4E7KA 3VQQA 2E6MA 3A2FA 1D5AA 4Y1CA 5HROA 1S5JA 1L3VA 4LH5A 4M3ZA 4FJHA 1Q8IA 1J9AA 4IFVA 3DLHA 3HK2A 4CIEA 2YNIA 4CJWA 4PUOA 2X74A 4OKJA 2HVIA 2F8SA 1C1CA 4CJRA 4CHOA 2RKIA 3NHGA 1UA0A 1U4BA 1U47A 3QINA 1I3AA 4KTWA 2OPRA 4C8LA 4KV8A 4F2RA 2QKBA 3AV9A 1KTQA 2G8FA 3VQ5A 4KHYA 2FBXA 3S3OA 2G8KA 5FRMA 4ELVA 4CEOA 3SNNA 4JLHA 1KVAA 3QNNA 3V6DA 4MFBA 1TK0A 4CESA 4FLTA 1NK6A 4K8XA 4KB1A 1EP4A 1SL2A 3CFPA 4IKFA 1ASUA 3WNEA 1NOYA 3TAMA 1S6QA 2QK9A 3P5JA 3ZSOA 4AHSA 3RMDA 3NF7A 3D0PA 1LW0A 3K5OA 3K5MA 3MXIA 4FM0A 3PX0A 4C8OA 4KB0A 1WAFA 4DTSA 3ZT3A 4N41A 2AJQA 4LSNA 4DTMA 1QSLA 1UWBA 4KRFA 2RF2A 4CF8A 1YTAA 4W5NA 3LP3A 1JLQA 1S6PA 3SI6A 2HNYA 1ZBIA 1LWCA 2KTQA 1C1AA 2HNDA 3SV4A 5SWMA 5HRPA 2WONA 3DLEA 1L5UA 3NF9A 3RR7A 1RDCA 4DSEA 3OYBA 3EZ5A 4E7JA 1S1XA 4LY7A 3O3GA 3HL8A 2PYLA 4ZHRA 3HT3A 1W9HA 3NF6A 5HP1A 5C24A 1SKSA 1WSIA 3ASMA 3LZIA 5CYMA 3VA0A 1HPZA 3RRGA 2YNGA 4CEBA 1SKRA 2A1SA 4OGEA 1LWFA 1JLEA 1WSFA 4PA1A 4AHRA 3EY1A 2I5JA 4FCYA 2XY6A 1RTDA 4Z4GA 2HHQA 1FKPA 4CK3A 3NAEA 3SUPA 2Z1GA 4FJNA 1T05A 2P1JA 5CY4A 3QEIA 3V1OA 3DM2A 1RBTA 3SPZA 3DLKA 4ICLA 2HHVA 2XY8A 4CFBA 3ULDA 4DS4A 2R7YA 4KTZA 4BWMA 3L2QA 4CHNA 3O4QA 1HQEA 3WNGA 4FLVA 1IKYA 1QHTA 3LZJA 3DI6A 3AO3A 1WSEA 2YNHA 1D9FA 1KRPA 2HW3A 4H4OA 4CHQA 3DLRA 3QEPA 1U49A 2KQ2A 3AVCA 3C6UA 5FROA 3HP9A 3QNOA 3HO1A 4UQGA 4I9QA 4F2SA 3AA4A 4DQSA 2G8HA 3K5LA 1JXBA 4F3TA 4DQQA 3ISNC 1A5WA 3NFAA 4FVMA 4JRQA 3RRHA 4I2PA 3QO9A 4J2EA 4FK4A 2OPSA 4B9MA 4OGCA 4DFMA 3AVGA 5E41A 1QTMA 1C1BA 1DTQA 4DF8A 1UOCA 1G15A 4CF1A 2VWKA 1SKWA 4FJLA 3SUNA 1SL1A 3HPHA 4KHQA 4DTJA 4Z4IA 3SUQA 2BDPA 1IKVA 3OVNA 4OJRA 3OYAA 1SL0A 4DG1A 4OPKA 1BL3A 4FZYA 2G8IA 4OKKA 3OYCA 1HNIA 3QETA 3KD1E 3TABA 4GW6A 3VQDA 1NJWA 1QSSA 2ITGA 4CJTA 3M8RA 2QXFA 3C95A 3PUFA 1RBRA 3OYDA 4CJPA 4Z4CA 4FM1A 3AVIA 2W42A 2KZZA 3WNHA 4CJVA 1XHZA 4B8CA 3NGZA 1FKOA 3K58A 4I2QA 3AVJA 4HCCA 4FK2A 3QEWA 4JRPA 2HHWA 1B9DA 2G8UA 4CHPA 1QE1A 3VQ4A 2JLEA 1O1WA 4CFAA 1K6YA 1S9EA 3F73A 2PZSA 1WLJA 1TV6A 4B9TA 1BGXT 3OYHA 4ELTA 1RTHA 4FJGA 4DFPA 4PQUA 2A1RA 2XY7A 1CLQA 4O0JA 5JS2A 4CF9A 1UA1A 2P5OA 4Z4HA 4RW4A 1NKBA 2XRIA 2HMIA 4DSLA 4N5SA 1RDBA 1VRTA 4RW9A 1IKXA 3NDKA 3HJFA 4FK0A 4FXDA 4CJFA 3RR8A 1C0MA 2IC3A 1S1UA 3FFIA 1BCMA 4FLWA 3QIPA 3SPYA 3KD5E 3G10A 1JLFA 5I3UA 2RN2A 3CM5A 4FZZA 5CZ1A 5C42A 1S1TA 1WAJA 3O3FA 2VG6A 3DLGA 3KK1A 3G0ZA 3O4NA 4M41A 2ZE2A 3DMJA 1X9SA 1X9MA 3KKRA 4H8KA 1RT4A 3DLBA 2Y1IA 1WSGA 3HVTA 4FJMA 1VSMA 4ELUA 4CJQA 1FK9A 3NGYA 4DLGA 5HRRA 1B9FA 3AA5X 3ZSYA 2QKKA 4Q5VA 4O55A 3B6PA 3L2UA 4CF0A 3NH1A 2Z1IA 1TKXA 2X6SA 3SV3A 2ETJA 3K2PA 3AVHA 3AA2A 3RWUA 4E1NA 2DFHA 5K14A 4HCBA 1RTJA 1IO2A 4L8RB 5T7BA 4E7HA 3H08A 1VK0A 4J2AA 3V9SA 1RT2A 4RW7A 4KI6A 1TAQA 4FZXC 4FJ7A 3OS0A 3HVRA 1BI4B 2OZMA 4CF2A 3P1GA 3AVAA 3LDSA 3MEGA 4E0DA 1KLMA 3ZT2A 4CJ3A 3WNFA 1JLGA 4TSXA 1VSKA 3MAQA 4HTUA 4C8KA 4N47A 3AVKA 2OPQA 4Z4EA 2RPIA 2F96A 4BDPA 4B9VA 1B92A 4EZ6A 3AVNA 4B9LA 4O0IA 1JLCA 4YNQA 3THVA 2HB5A 4CJLA 3KJVA 5KI6A 3M8PA 1XWLA 3HP6A 4CEDA 4DQRA 1HQUA 4CHZA 3KK2A 1ZBHA 2KZMA 4W5OA 3JYTA 2D0AA 2IAJA 4DSIA 3SJJA 4CIFA 1XI1A 1J54A 1T7PA 2PY5A 1EX4A 1C0UA 2YKNA 4M45A 4NCGA 2ATQA 4CJEA 3VQ6A 4ID1A 5FDLA 4W5TA 3LPTA 2KFNA 4LH4A 1JLBA 1EKEA 4BE0A 2XHBA 3OYMA 5FRNA 4DSJA 3AO1A 3I0RA 3AVLA 3QIOA 3TR8A 3LALA 5HLFA 4NCBA 3OS1A 4PWDA 2BE2A 2PYJA 5HRSA 1XC9A 4MQ3A 3PO4A 4M3XA 2B4JA 2F8TA 1ZBUA 4DTRA 2FBYA 1RNHA 1SV5A 2OPPA 2IOCA 3PX6A 3QEXA 4CECA 3UIQA 2FBVA 1WN7A 1ASWA 3SZ2A 1ZYQA 1I39A 4CFDA 2OYQA 4FJXA 1YVUA 3NBPA 2EHGA 2Q3SA 3SUOA 1T03A 5D3GA 2FC0A 3QLHA 3L2WA 3MXMA 4B8AB 1S1WA 5DK5A 1L3UA 4YFUA 3AVFA 2IS3A 4NYNA 2P51A 1N6QA 3V1QA 4OLBA 2XO7A 2NUBA 4OLAA 1CZBA 3L3UA 1ITGA 1TL3A 3TAFA 2HHXA 1QSYA 4M3YA 4KREA 3VQ9A 3NE6A 4DU3A 3HSTB 4GMJB 3ALYA 1RBSA 1RDAA 4AILC 1HRHA 3AVBA 1JLAA 1RTIA 3V81A 1JKHA 2YHAA 4B08A 3K5NA 2VG7A 4HHTA 4CJ5A 3L3VA 3SQ2A 4KAZA 3L8BA 2VG5A 4IG3A 4IFYA 3ZSQA 1RT5A 3ZSVA 1QS4A 2IDOA 4CJSA 4N56A 1RT7A 3VQBA 3OS2A 3TWHA 3LWMA 1S9GA 3ITHA 4FJ9A 3NF8A 1GOBA 2O4GA 1BQNA 1GOCA 1UAXA 5HBMA 4EP4A 4DF4A 1VSHA 4FJJA 4E89A 3SQ4A 5J2QA 4DQPA 2HVHA 1WSHA 3LP1A 4IG0A 3TAGA 1NK9A 3C6TA 3RMAA 3NH2A 3D45A 4FW2A 4CK2A 4FJIA 1EXQA 1RCHA 3CFOA 3HXMA 4KHSA 1VRUA 4KFBA 4M3WA 4W5RA 3LPUA 4AHCA 3LANA 1VSJA 3OYKA 1L3SA 1KLNA 2EX3A 2IGIA 2YHBA 1VSFA 3MEEA 1NK4A 1LAWA 3DOKA 1RBUA 2X78A 4DQIA 4QOZB 3EYZA 1KVBA 3U6FA 4JS5A 3VN5A 3OYIA 3CFRA 3ZCMA 4CGGA 1LV5A 5I42A 4Z0UA 4LD0A 2BANA 4E1MA 1J5OA 1D9DA 2XY5A 4QCLA 4O44A 4CEAA 1FXXA 1Y97A 3O3HA 2YKMA 4W5QA 4BDZA 3TANA 4CGFA 1U48A 3KTQA 1CXUA 2FBTA 5KRTA 5EU7A 3NH0A 3BGRA 4DWIA 2WOMA 3HPGA 4FYDA 4DS5A 4RW8A 4E7LA 4DTNA 2E6LA 4KO0A 4CJUA 3MXJA 4KKOA 2D0CA 5J2NA 2HHUA 1W0HA 2X6NA 4DSFA 4EZ9A 3LAKA 1RT1A 4AH9A 3KLHA 4K8ZA 1HNVA 1NJXA 1C0TA 3SCXA 4B9SA 3KK3A 3QERA 4M3RA 1TVRA 1KSPA 1WNSA 4CEEA
chains in the Genus database with same CATH superfamily
4IWVA 4DV4K 3RMCA 4CEZA 3CI5A 4G1QA 4BE1A 1QHAA 1S72N 1T3VA 2YHWA 5FLXO 4G9ZA 4DTOA 1REVA 3ZLJA 3A5LC 4CBXA 1X1PA 1VQ4N 5HOOA 4IJAA 1BUPA 2HNZA 4QS8A 1HJOA 1M90O 4F8RA 1NGJA 4LSLA 4FSVA 1U04A 3O4WA 2O4IA 1HKBA 3O9RA 3U9ZA 3CYMA 2O8BA 2O8CB 2G8WA 5BPNA 3DRPA 1TKTA 4DU1A 4HUGA 3KIOA 2ZQBA 4A5BA 1N32K 3D6RA 3CMAN 2F9TA 4OPJA 4DV2K 5AQPA 1GLDG 4A62A 2OCEA 2OA8A 1RILA 1VSDA 1XQSC 3KK7A 1N5YA 1NGDA 2DFEA 4CIGA 5AQRA 1WBBA 1DTTA 3DRRA 3AO2A 3O1WA 3NCIA 2QWMA 3TSUA 1NJYA 3TAQA 1JL2A 4DU4A 3AO5A 1ZC6A 3B8AX 1K8KB 2GEMA 1TAUA 4ILJA 3BF3A 1WSJA 1YTUA 5AZJA 4FWNA 3OYEA 2HSTA 4A2BA 3TARA 1EETA 1KQSM 1V4TA 1A5XA 3DXKB 3VQ8A 4DTUA 4O4GA 3G4SN 3IRXA 3ZT4A 4XH1A 1L3TA 1HLUA 4H0XB 2D4WA 4GY2B 1ZBLA 2E1YA 1NJZA 1KXPA 4CCHA 3OA9A 2Q97A 4BROA 5M1OA 4Z4FA 1NG9A 3THYB 2FSKA 2ZM6K 4FJ5A 3QEVA 1D4XA 4C8MA 4DB3A 4M42A 3MEDA 3T1AA 1YITN 4KTQA 3DJCA 4M7XA 3CQYA 3QESA 3JXUA 4Q0BA 5F1XA 1XNRK 4I9LA 3CJBA 4OVLA 4CE9A 1KFSA 1BA0A 4BRQA 3JSMA 3NGIA 3CPEA 1YVNA 3FGUA 3LDPA 3R3LA 1QQNA 3T19A 3L2VA 4BY9C 1HYVA 3TSPA 3ZT1A 3VQPA 2D0BA 4B9LA 5CYQA 3M8QA 4GVMA 1S1VA 4FM2A 1BQMA 2E20A 2B5JA 2W41A 4UY8O 4NXMK 4E7KA 3VQQA 2E6MA 2P9LB 3HK2A 4IZ9A 5FPDA 4PUOA 3SAFA 3J8AA 4BC2A 4QS7A 3NHGA 1JJ2M 3IUCA 1U47A 3VF2A 4KTWA 1RFQA 4KV8A 5AQWA 3AV9A 4Z94A 4QS9A 3ATUA 2A40A 2WUSA 3OHRA 4JKCA 3NVMA 2DPNA 4MFBA 1N36K 1HKGA 4CESA 4K8XA 1SL2A 3ZETA 1Q81O 1NOYA 1S6QA 4PL8A 3NF7A 5CE3A 3ZT3A 2D0OA 2RF2A 3A0IX 1S6PA 4JD2A 1NNEA 3S41A 3SI6A 1VQON 2KTQA 1C1AA 2HNDA 5SWMA 5HRPA 1L5UA 3RR7A 1JCEA 4DSEA 3PIOL 1N34K 2PYLA 3HT3A 1W9HA 1O13A 2W6KA 5CYMA 4JKGB 4DKWA 3RRGA 4AHRA 1NMDA 1LWFA 4JK9A 5C12A 4FCYA 1QSSA 3UKRB 1DGKN 3NAEA 4JI5K 5AZJB 3V1OA 3DM2A 3SPZA 3ZEUB 2CGLA 2HHVA 2GUPA 4CFBA 2R7YA 4KTZA 3O4QA 3QBWA 3QBXA 1T6CA 3SK3A 1E3MA 1QHTA 3DI6A 1QQOA 2UUBK 1U49A 1NGIA 2KQ2A 1GLFO 3HO1A 2E8AA 4UQGA 2F9WA 4I9QA 2FF3B 1I94K 3AA4A 4DQSA 2G8HA 4CZIA 3K5LA 2QI2A 3ISNC 3NFAA 5JVHL 3ID8A 4DFMA 2CH6A 1C1BA 3VEZA 1H1VA 3CCUN 4IOAL 1RDUA 2GELA 1OVYA 3OYCA 3MX2A 1HNIA 2V51B 3TABA 4WQ5A 2ITGA 3QFPA 2QXFA 4PKGA 4YDUA 4YDUC 1RBRA 4CJPA 2GWJA 1RDWX 1FKOA 3T1HK 3AVJA 4YORA 4CVNE 1B9DA 4FWLA 3DXMB 5BRDA 1G99A 1TV6A 4B9TA 1QVGM 1VQKN 5JS2A 4JI1K 4AM6A 4RW4A 2XRIA 4DSLA 1RDBA 4NB4A 3NDKA 2UUCK 4CJFA 4JYAK 2IC3A 4IOCL 1HNZK 4FZZA 2RN2A 2HBKA 5CZ1A 5C42A 1S1TA 1WAJA 3PSIA 4BRPA 3O3FA 3O4NA 4H0PA 1X9MA 1BOTO 1TYQA 4DLGA 2QKKA 4CZGA 4O55A 4B3RK 4OX9K 3NH1A 2Z1IA 1TKXA 3CCLN 5K14A 3AGKA 1IO2A 2HOEA 3UKUA 5T7BA 2UXDK 1MWKA 4J2AA 4KI6A 1TAQA 3CERA 3O80A 4YOUA 3P1GA 3LDSA 3ZT2A 4TSXA 4C8KA 4H5TA 3H46O 1VQNN 4O0IA 4YNQA 3VGMA 4DR5K 2HB5A 4CJLA 5AQIA 3HP6A 3KK2A 1ZBHA 5JICA 2ZGYA 1XI1A 3L6QA 3FZKA 4B3SK 3CCQN 3E9LA 2KFNA 3THWB 4JI3K 2HHHK 3O6WA 4DV1K 3TPQA 3AVLA 3TR8A 1NMNA 3FFKB 3OS1A 4WQ4A 3CC4N 5HRSA 4MQ3A 2B4JA 4DTRA 2YX6A 1VQ5N 2FBYA 3PLAA 4DR3K 5GAHP 3UKRA 3CC2N 4MLEA 5DM6L 4CECA 2OYQA 1WN7A 1ZYQA 3RSEA 3NBPA 4BGAA 2EHGA 2Q3SA 5B8HA 3KWIA 3DXKA 5AZIB 3MXMA 4L3QA 1L3UA 3CCMN 4YFUA 4BG8A 2NRRA 3V1QA 2XO7A 3L3UA 2HHXA 4CZLA 4IEIA 1QSYA 4H5NA 4KREA 3NE6A 4JKFA 3HSTB 1TYQB 3LM9A 5TKYA 3BY5A 2BH1A 4DUZK 4O8KA 3CCSN 1JKHA 3CJ9A 2YHAA 4HHTA 4KBOA 4IG3A 1S22A 1S9GA 4EP4A 3OBWA 3NVKA 4GV3A 5J2QA 2HBJA 5C10A 4EHTA 3LP1A 2PFUA 2P9SA 1GLLO 3JAMO 3NH2A 4CK2A 4FJIA 3HXMA 4YOTA 1XC3A 3GE1A 4A61A 5HL7L 4AHCA 3OTOK 4KH6A 1LAWA 4JKEA 4QOZB 1ATNA 2YJEA 3U6FA 3VN5A 3E1YA 3ZCMA 4CGGA 2I7PA 4Z0UA 2P9IB 4LD0A 1D9DA 4GV9A 4CEAA 1U48A 2YKMA 4OO1J 2AJQA 4CGFA 4ISEA 3HOSA 4NXNK 1EWQA 5J2NA 1W0HA 2X6NA 3BZCA 1RT1A 4K8ZA 1C0TA 5LJVA 5E84A 1WNSA 4CEEA 4FOIA 4ZTFA 4RCHA 3QFUA 1DKGD 1JXEA 4CZHA 1ESVA 3K9KA 1KCFA 1MU2A 1XMQK 4JI2K 4DTPA 3MN9A 1VQ6N 3WEEB 4FJ8A 2P9UB 1D8YA 3OJUA 5BR8K 3DRSA 2GV9A 5GAGP 4C8NA 1ZBFA 4DTXA 3PV8A 2E2NA 4E19A 4BWJA 4EP5A 1OKJA 4OKEA 4CGHA 5FPMA 1X9WA 2KFZA 3SQ0A 4BE2A 1Q18A 4DR6K 5EX5A 2Q0RA 2Y1JA 3WQTA 4FWMA 5BREA 3R6MA 2KW4A 2OZSA 2ZGZA 3GG4A 1S3XA 2ZJPL 3TTFA 3MN6A 5H1SQ 3VPZA 2G8VA 5KRSA 3L4QA 4FPBA 1C6VA 1R0AA 5AR0A 1CZAN 5HRNA 1VSIA 3P38A 3CQ8A 4M3TA 3I8BA 3H1VX 4LF6K 3OYNA 5C25A 4KHNA 4JV5K 1KAZA 3U3GA 3TAEA 1HYZA 1Q9XA 4Y1DA 3V1RA 1YJ9N 3KKSA 4BACA 3VA3A 1RDDA 1E4FT 4CGIA 3DOLA 1Z6RA 4X65K 4WF9L 4BRGA 4IDKA 3ZSXA 4NLBA 3SJHA 5C2DA 4CJKA 4YOXA 3HZ6A 2D0PA 4DFJA 1BISA 4O5BA 4ILGB 3V4IA 4H5WA 4E3SA 2Z1JA 4MLHA 2FXUA 1YT3A 4HUFA 5TKWA 2YV0X 2HMPA 4N76A 4BG9A 4CEFA 2NRVA 4BRIA 1V4SA 3CJ7A 2YNFA 1SS6A 2IVOA 5AJ3K 2ZJRL 4BQLA 3DAWA 2OTJN 1IG9A 4RW6A 3I8DA 3C94A 3CHWA 5CZ2A 1TL1A 3F5TA 2HHSA 2NZTA 1SAZA 2ASMA 1BI4A 2DFFA 4CHYA 4J2BA 4CZMA 3OYJA 3VQEA 3LDOA 4B9NA 1IH7A 3VEVA 3S3NA 3F9KA 1LW2A 5J2PA 3FR0A 5GADP 2H3GX 5KTQA 1HMVA 1S5JA 4BC5A 1J9AA 4IFVA 3R8EA 4CJWA 2HVIA 1C1CA 4BC3A 1UA0A 3QINA 4LFCK 1XMOK 2OPRA 4F2RA 1KTQA 5IT9O 3T69A 2QEXN 2G8KA 4F9OA 4ELVA 3V6DA 2NLXA 4X64K 1EQYA 3MWPA 2A6AA 1Q86O 1NK6A 4KB1A 1EP4A 4IKFA 3DLLL 3TAMA 2QK9A 2KLAA 4H03B 1OVQA 3RMDA 3K5OA 4FM0A 4JKBA 4LSNA 1UWBA 4KRFA 4CF8A 4W5NA 4M63C 1JLQA 3MN5A 1LWCA 3QB0A 2WONA 3DLEA 3NF9A 1J5EK 4E7JA 1S1XA 3O3GA 3HL8A 2E2QA 1VQ7N 4BR7A 1WSIA 3ASMA 3ZYYX 2A1SA 2XY6A 2I5JA 4CZFA 1MDUB 3O8MA 5F2RA 3IFRA 4XEIA 3A5OC 3SUPA 3CCJN 2P1JA 5IWAK 5AQXA 3DLKA 4DS4A 3ULDA 3FZLA 4FLVA 2ITMA 1WSEA 2YNHA 3SMPA 4BRHA 1KRPA 2HW3A 3DLRA 3C6UA 4DR1K 3QNOA 4F2SA 2P9SB 3QO9A 4J2EA 4B9MA 2WFBA 3AVGA 2I7NA 3K0SA 1BO5O 1UOCA 3PIPL 3M5RA 3MCPA 3SUQA 1EO1A 3J7YP 3HSCA 3OVNA 1XUPO 4PHTX 4FZYA 5BRFA 4LF4K 3CJ1A 5KPRA 3KD1E 4GW6A 4CJTA 3OYDA 3ENHA 3MMVA 4JK7A 5E26A 4CBUA 1XHZA 4JAXA 4C1NK 3QEWA 2HHWA 1NGEA 5AQUA 2G8UA 3VQ4A 3CPWM 1O1WA 1HKCA 3VMFB 2PZSA 1WLJA 4U67L 3FLCO 4FJGA 1ZBSA 2IIRA 1IBMK 5BN8A 4N5SA 4FWOA 4RW9A 1IKXA 4AQYK 3ENBA 1C0MA 4CD1A 2FF6A 4XH4A 5AQVA 2QWQA 2QW9A 3KK1A 4M41A 2F4VK 3DMJA 5MLCQ 4H8KA 4B1UB 1WSGA 2ZWHA 3HVTA 2Y1IA 4FJMA 2Q0UA 1N8RO 1B9FA 3L2UA 3B6PA 4CF0A 3A5NC 5KPTA 2ETJA 3AA2A 3O1BA 1RTJA 3IMXA 4J8FA 1VK0A 3V9SA 1WUAA 1RGIA 3HVRA 2OZMA 3MEGA 3VERA 1KLMA 2KKZA 4CJ3A 1JLGA 3MAQA 5AFUH 4H5RA 2UXBK 3I33A 4Z4EA 2RPIA 4GNIA 2O8BB 5KI6A 4CEDA 4DR2K 2NRZA 2KZMA 2OTLN 4JI0K 2D0AA 3THXA 2PY5A 4NCGA 2ATQA 4CJEA 4CZKA 3EE9A 5FPEA 4CZEA 3OYMA 5FRNA 4DSJA 3I0RA 3W0LA 3QIOA 1BDGA 3VF4A 2BE2A 2AP1A 1XC9A 4EAHD 2VCPA 3E66A 3PO4A 5AQNA 2F8TA 1ZBUA 2E88A 1SV5A 2IOCA 3VEYA 3QEXA 1DEJA 3VESA 4H0TB 3SZ2A 1QQMA 4FJXA 3SUOA 4JD2B 1T03A 4A5AA 3EO3A 5D3GA 4YY3K 1WB9A 3DXMA 4C1NI 3JS6A 1ITGA 3TAFA 3HBTA 5M1KA 3MK6A 4FWKA 3HI0A 3ALYA 1VQLN 1RDAA 1NJIO 1HRHA 4B08A 4BRDA 1NGGA 2VG7A 4HWIA 3SQ2A 4KAZA 3ZSVA 3E9PA 4IFYA 4CJSA 2IDOA 3VGKA 3VQBA 4BR9A 3ITHA 4FJ9A 3NF8A 1GOBA 2CH5A 4GKKK 1VQMN 3LL3A 3SQ4A 1NK9A 1EXQA 3CFOA 2ASPA 3ULEB 3O5BA 3LPUA 2YHYA 1L3SA 2IGIA 1VSFA 4FWQA 1RBUA 1HUXA 3C7NA 4LF7K 1VQ8N 1VQPN 3UE5A 1LV5A 1FXXA 1CXUA 5KRTA 3BGRA 4E7LA 4KO0A 1HNXK 4FL9A 2HBLA 4H5VA 3K9JA 4DSFA 1YIJN 4EHUA 4WFNL 4DV3K 4AH9A 3H3NO 1HNVA 4B9SA 3KK3A 4M3RA 1QZ6A 3LM2A 1BIUA 4DUYK 1P8ZA 1IG8A 4FLXA 5GAEP 5DMRA 3V9UA 3C6HA 1EWRA 3CM6A 2B6AA 1LAVA 2GWKA 3SBTA 1SUQA 4ISGA 3EKSA 4B1XB 4CEQA 2O8DB 1HJRA 2P9KB 3CD6N 1F21A 4FJKA 3HYFA 2OANA 5AQJA 2O8EA 2WTUA 4DR7K 3K57A 3DWLA 4YHHK 1TGOA 4F3OA 2D5RA 3P83D 1FW6A 4B3OA 1TKZA 1CZ9A 1MWMA 5AQKA 3KVGA 3RMBA 2E2PA 1VSLA 2BGGA 4V19S 1X3NA 1KFDA 4PKHA 4RG8A 5KPZA 3OYGA 3O9QA 3OYLA 3SYZA 2VWBA 3EZWA 3G25A 4A59A 5KGXA 2GUIA 3O9SA 3AY9A 2DTUA 3WT0A 2JGUA 4WE1A 4KHUA 3AA3A 3EKUA 1XHXA 3V9ZA 4JS4A 5SZTA 3THWA 5AQFA 4KPYA 1VQ9N 4KH4A 3EEQA 1CXQA 5I9EB 4HTLA 1IKWA 4WFAL 1QQCA 3U3YA 1W7AA 3OYFA 1A5VA 3CIPA 3L2RA 3FZFA 1U2VA 3CG7A 1Z26A 3H45C 3VEXA 4HVJA 4DFKA 3THYA 3M8SA 1NOZA 3OJSA 3SBGA 3RSEB 4HUEA 4DSKA 5JS1A 3ZT0A 4LF5K 3LDNA 3VEOA 4OPHA 3VQ7A 3WXLA 1Z05A 3ZSRA 1NKCA 3RTVA 5M1QA 3VQAA 3KLFA 2VYPA 4QAGA 3DYAA 2Z1HA 4B1YB 1HR0K 2A5XA 3VQCA 4AHUA 4B9QA 3AAQA 3LP0A 4IDHA 5J2MA 1T8EA 5C15A 4AHVA 1NGCA 1YXQA 4BREA 4ILHA 3PX4A 3N4PA 1NK0A 3ENOA 4H0VB 4K42A 4FW1A 3HM9A 4I7FA 3S3MA 2E4LA 3K59A 2UU9K 1RBVA 3IG1A 3KZBA 1Q7YO 3I55N 3KLGA 3HRGA 3A2FA 1D5AA 3MN7A 4Y1CA 5HROA 2IVPA 3PSFA 4LH5A 4FJHA 4RTFD 5ADXH 1YUWA 5CHIA 3DLHA 4B1ZA 4U7BA 2CGKA 2YNIA 2AA4A 3CCRN 4OKJA 4JHDA 1SQKA 3WXIA 4BC4A 4CHOA 2RKIA 1C0FA 4BVPA 4ISFA 5BPMA 4BVOA 3MDQA 5C2FA 4R79A 4KHYA 3S3OA 4JK8A 5FRMA 3Q7BA 4CEOA 1TK0A 2A3ZA 2VQEK 1ASUA 3KWGA 3P5JA 4AHSA 4AM7A 4C8OA 4KB0A 1C0GA 3VF6A 4KHPK 1YTAA 4Y0WA 1ZBIA 1ATSA 3WXMB 2W6LA 5AQLA 3D2EB 4BR4A 3OYBA 3EZ5A 4LY7A 1NWKA 3NF6A 1SKSA 3LZIA 3VA0A 1W97L 3CJAA 4O5FA 4JKGA 4CEBA 4OGEA 1WSFA 4PA1A 2P9LA 4Z4GA 4BRMA 2HHQA 1FKPA 4CK3A 3H3OB 4FJNA 3QEIA 2QWPA 3AARA 3QDKA 1RBTA 1HX1A 4MDBA 3A8YA 2VQFK 3WNGA 1IKYA 3LZJA 3AO3A 4DHYA 4DV5K 1D9FA 4CHQA 2E1ZA 3HP9A 1VHXA 1JXBA 4DQQA 1A5WA 4FK4A 3RRHA 4I2PA 2YJFA 2OPSA 5E41A 3J81O 1DTQA 4DF8A 3T1YK 1G15A 3CCEN 1W2BM 3F2KA 1X3MA 2QWRA 2VWKA 4CI6A 4FJLA 3U4LA 3SUNA 1SL1A 3HPHA 4IJNA 2J4RA 4DTJA 4KHQA 1IKVA 4OJRA 3OYAA 4JNEA 1SL0A 3MCAB 4OKKA 4CW7B 1NJWA 4LFBK 3PUFA 3H1QA 4FM1A 4Z4CA 3AVIA 4FWPA 3CQXA 1NGHA 2BUPA 2W42A 2KZZA 1GLEG 2QTDA 1LCUA 1LOTB 2F7TA 5M1NA 3SAHA 1QE1A 2JLEA 5A2QO 4C23A 3F73A 1S9EA 4ELTA 1QZ5A 1BGXT 1E4GT 3D2EA 4CF9A 4IO8A 1GLBG 4O8UA 2P5OA 5JLHA 4FK0A 5AQZA 3SPYA 3KD5E 3QIPA 5AQYA 1JLFA 5I3UA 2HF3A 3WUHA 2VG6A 2NRHA 2ZE2A 1X9SA 1RT4A 3EL2A 4ELUA 3NGYA 2Q31A 5HRRA 3ZSYA 2O8EB 3IDHA 3LDLA 2X6SA 4JKDA 3W3DA 3CJCA 3K2PA 3CXCM 3AVHA 3RWUA 4E1NA 5LY3A 4L8RB 4DQ8A 3TU5A 4E7HA 3UKUB 2QWLA 1RT2A 4FZXC 3OS0A 3C7NB 4AF1A 4CF2A 3AVAA 1GLCG 1KAXA 3WNFA 4HTUA 2W40A 1VSKA 4K41A 4B3TK 3CF5L 4FPAA 3N4QA 4BDPA 4B9VA 3AVNA 3THVA 1OH6A 1HQUA 4IEEA 4W5OA 4DSIA 3TTDA 3WXKA 2YCHA 2CGJA 2YKNA 4ID1A 3LDQA 1JLBA 1EKEA 4WQ5C 4IXCA 3LALA 4LF8K 1OH8A 1QVFM 3PX6A 3A5MC 2V7YA 3SAGA 4H0OA 1YVUA 4LFAK 1IV0A 4KH5A 3QLHA 3L2WA 4B8AB 1S1WA 5DK5A 3ZX0A 3AVFA 2IS3A 1NGAA 2P51A 3D7EO 5CR4A 1CZBA 5GINA 4M3YA 2Q1NA 3VQ9A 4DU3A 2FLOA 4GMJB 3U8XA 3OBYA 4AILC 3AVBA 3QICA 3V81A 2O8CA 4I6MA 3NMUA 1U6ZA 3L3VA 3L8BA 1NGBA 1RT7A 3LWMA 4FO0A 4CZJA 5JLFA 3WEEA 2V52B 2O4GA 1BQNA 1GOCA 1UAXA 4DF4A 4WFBL 5EXWA 4PKIA 4E89A 4DQPA 1WSHA 4GV6A 3G71N 1IBKK 3C6TA 5LMUK 2ZJQL 4KFBA 4M3WA 4W5RA 3LANA 2YHBA 3MEEA 3FZMA 4MDAA 1NK4A 3J7AP 3DOKA 4B1WB 2E2OA 3EYZA 1KVBA 4JS5A 1K73O 2UXCK 3OYIA 3CFRA 1YF5L 4DV7K 5I42A 2GX9A 2JWLA 1J5OA 5M1FA 4QCLA 3TANA 1Y97A 3O3HA 1VAZA 4BDZA 3VENA 3KTQA 1YHQN 1YJNN 2WOMA 3HPGA 4FYDA 4DS5A 2Q36A 4CJUA 2P9IA 3MXJA 4KKOA 4EZ9A 4WYBA 3SCXA 1YI2N 1BG3A 5C0YA 3HM8A 1JCGA 4JI7K 2FSNA 3S9HA 4JEPA 4PL7A 1K8AO 1T44A 3VOVA 4BRAA 1BHLA 5JMVA 3SQ1A 3ATVA 3LP2A 1TUUA 3PO5A 4PY5A 4KHWA 2E5LK 2DY4A 5AQTA 4BDYA 2ZF5O 1TK5A 1K9MO 3ZSWA 4AHTA 3KLIA 3OY9A 4CK1A 4FLUA 3VGLA 4H4MA 3TAPA 4FLYA 1KD1O 2GBZA 2VWJA 1NK5A 2P5GA 4R5PA 2LSNA 3AO4A 3F9MA 1BU6O 1OH5A 1HYSA 5AQGA 3HPOA 4DCHA 4B9UA 4JI8K 3BDPA 3B6OA 1Z25A 1BCOA 1Q9YA 4ID5A 2ZD1A 3IS9A 4GKJK 3CC7N 1DLOA 3V9XA 3IAYA 1GLAG 2IVNA 4CERA 3J7ZO 3THXB 2HF4A 3ZSZA 1U45A 5EOYA 4K0KK 4BQZA 3AAPA 1RT3A 4CD3A 4XIUA 5GIPA 1J53A 4CFCA 5KGWA 1KC8O 4JI6K 1JL1A 2QA4N 3ULEA 1Q82O 3D2FB 4DLEA 4NCAA 3V9WA 3I0SA 1NKEA 1VSEA 4J2DA 4FLZA 3GBTA 3ZETB 1J6ZA 4DMNA 3E9OA 3E01A 3R9PA 4M7YA 1KVCA 1NK7A 1BIZA 1TKDA 3T3FA 5BN9A 3VETA 3LWLA 4F4KA 2P9NA 3O9UA 3LAMA 3MECA 3O08A 3BP8A 4X66K 1NK8A 4NYFA 3KLEA 3VTHA 3PY8A 4E7IA 2VGMA 3TI0A 4BR2A 4K43A 4M3UA 5AZIA 4WCEL 5J1EA 1Y64A 3WXJA 4CGDA 4JHDB 5KQ8A 2PBDA 1R59O 2HHTA 4KI4A 1SZ2A 4CJ4A 2RE2A 3AVMA 4RWTA 1GOAA 4LF9K 1KAYA 3CMEN 1LWEA 4IBNA 4ZTJA 4IFEA 1ASVA 2NRTA 4YOYA 1RT6A 1TK8A 4CGJA 4EIAA 2NRWA 2A41A 1L3VA 2NRXA 4M3ZA 1Q8IA 3BZKA 4JKHA 4MO5A 4CIEA 1NBWA 2X74A 3EE8A 4CJRA 2F8SA 3SMSA 1U4BA 1I3AA 4C8LA 3C65A 2QKBA 1YJWN 2G8FA 4EFHA 3VQ5A 2O8FA 5ADXA 2FBXA 5AQHA 3L0QA 3RVCA 4DV0K 5AQQA 3SNNA 4JLHA 1KVAA 3QNNA 1BA1A 4FLTA 1TUYA 3WQUA 3CFPA 3P31A 3WNEA 3CETA 3ZSOA 3D0PA 1LW0A 1NU0A 3K5MA 1T6DA 2JWKA 3PX0A 3MXIA 3Q7CA 1WAFA 4DTSA 4N41A 4H0YB 4DTMA 1QSLA 3LP3A 3M6GA 2HNYA 3ID6A 5FPNA 3SV4A 1RDCA 5JVGL 4ZHRA 4BR5A 5AQOA 5HP1A 5C24A 1HPZA 2YNGA 4X62K 1SKRA 1JLEA 2QXLA 3EY1A 1RTDA 3MX5A 1HNWK 4I6MB 1XNQK 2Z1GA 2FSJA 1T05A 5CY4A 2PAVA 4BRFA 4ICLA 1NLVA 2XY8A 3ZX3A 4BWMA 3L2QA 4CHNA 2VGNA 1HQEA 3HOTA 4H4OA 3QEPA 1MA9B 2A42A 5DM7L 3AVCA 5FROA 3U9DA 5EVZA 4F3TA 4FVMA 4JRQA 3VEWA 3IKMA 2QM1A 4OGCA 3TTCA 5LMNK 3GOIA 1QTMA 4OPAA 3H6EA 3SLCA 4CF1A 1SKWA 4Z4IA 2BDPA 5GIOA 2O8FB 4DG1A 4OPKA 1BL3A 2P9PB 4WQ4C 5BRHA 2P9PA 2G8IA 4A57A 3QETA 2WC9A 3VQDA 3M8RA 3C95A 2YI1A 1WOQA 3WNHA 4CJVA 3C0BA 4B8CA 5ELZA 5KQDA 3NGZA 4JI4K 4I2QA 3K58A 4HCCA 4FK2A 1ATRA 4JRPA 1DT9A 3R1XA 4DV6K 2O8DA 3D2FA 3BF1A 4CHPA 2UYTA 1U2VB 4CFAA 1K6YA 2KHOA 3OYHA 2QWNA 1RTHA 4PQUA 4DFPA 2A1RA 2XY7A 1CLQA 4O0JA 1UA1A 4Z4HA 1NKBA 2HMIA 3G6EN 1VRTA 3HJFA 2UUAK 4FXDA 3RR8A 1GLJO 1S1UA 3FFIA 1BCMA 4FLWA 3KHYA 4BRCA 3G10A 4YOVA 3CM5A 5M1PA 3AGRA 3DLGA 3G0ZA 1YAGA 3DLBA 2YHXA 2P9UA 3KKRA 1VSMA 1NM1A 4FOEA 4CJQA 1FK9A 4BRKA 3AA5X 4Q5VA 2QWOA 3C6AA 1IJJA 3SV3A 2GTDA 4HCBA 2EWSA 3QMLA 2DFHA 2P9NB 4BR0A 3HTVA 4GVEA 3VTIA 3H08A 1P90A 4RW7A 1HPMA 4FJ7A 1IBLK 3TSQA 1BI4B 4JN4A 4CBWA 4E0DA 4LC9B 2HBMA 4N47A 3AVKA 2OPQA 2F96A 5F0XA 3GDQA 1B92A 4EZ6A 3P4IA 3O9TA 4K25A 5BPLA 1JLCA 3KJVA 3M8PA 1XWLA 4DQRA 4CHZA 4BRNA 1BWFO 2ASOA 3JYTA 2IAJA 3SJJA 4CIFA 1J54A 1T7PA 1EX4A 1C0UA 4M45A 5LL6Z 3ZX2A 3VQ6A 5FDLA 4W5TA 3LPTA 4LH4A 4FVUA 2BTFA 4BE0A 2XHBA 5BR9A 1FJGK 3AO1A 3MWTA 5AQSA 5HLFA 4PWDA 4NCBA 2PYJA 3P39A 1NGFA 4M3XA 1RNHA 2OPPA 4E1JA 3UIQA 2FBVA 1ASWA 1I39A 4CFDA 1K8KA 4A2AA 4IO9L 1WBDA 2FC0A 3GL1A 5LJWA 4NYNA 1N6QA 1M1KO 4OLBA 2NUBA 4NLCA 4OLAA 3T7ZA 4NO7A 1TL3A 5AQMA 2Q2RA 4BRLA 1JCFA 1RBSA 3CCVN 4DR4K 1JLAA 1RTIA 3OW2M 3K5NA 4CJ5A 4B3MK 4FWSA 3ZSQA 2VG5A 1RT5A 3ZEUA 1QS4A 4N56A 3UB5A 3OS2A 4MO4A 3TWHA 4JKAA 5HBMA 1VSHA 3BUZB 4FJJA 3FE1A 2HVHA 1ILYA 4IG0A 3TAGA 3M1FA 3RMAA 3D45A 4FW2A 4KHSA 1RCHA 2P9KA 2WBNA 1VRUA 4CJ7A 1VSJA 3OYKA 4IOXA 1KLNA 2EX3A 3I56N 2X78A 4DQIA 4B1VA 3FZHA 2RHKA 1OH7A 2BANA 4E1MA 2D1KA 5EY4A 2XY5A 4O44A 4W5QA 4DWIA 2FBTA 4FWRA 5EU7A 3NH0A 4DTNA 4RW8A 4YOWA 4XH5A 3J80O 1X9JA 2E6LA 2NNWA 1ZXOA 2D0CA 3EN9A 5AFUA 2HHUA 3LAKA 3L4IA 3KLHA 3BEXA 2V7ZA 1NJXA 3QERA 3M3ZA 1TVRA 1N33K 1KSPA 4BGBA
chains in the Genus database with same CATH topology
1BIUA 4FLXA 4ZTFA 3RMCA 4CEZA 3S9HA 4G1QA 1BHLA 1JXEA 5DMRA 4BE1A 3SQ1A 3LP2A 3PO5A 3V9UA 4DTOA 1REVA 4PY5A 3CM6A 4KHWA 2DY4A 2B6AA 1X1PA 1KCFA 1LAVA 1SUQA 1MU2A 4BDYA 2HNZA 1TK5A 4DTPA 4CEQA 4F8RA 1HJRA 4FJ8A 4LSLA 1D8YA 3ZSWA 3OJUA 1U04A 2O4IA 1F21A 4AHTA 3DRSA 3CYMA 3KLIA 3HYFA 4FJKA 3OY9A 2GV9A 4CK1A 4FLUA 4C8NA 1ZBFA 4DTXA 2G8WA 3K57A 4EP5A 4E19A 4BWJA 3PV8A 4H4MA 3TAPA 4OKEA 4CGHA 3DRPA 1TGOA 4FLYA 1TKTA 1X9WA 4DU1A 3SQ0A 4F3OA 2KFZA 2D5RA 3P83D 4BE2A 4HUGA 3KIOA 2ZQBA 4B3OA 1TKZA 1CZ9A 4OPJA 2GBZA 2Y1JA 3RMBA 2VWJA 1NK5A 2P5GA 1VSLA 2BGGA 4R5PA 2LSNA 3AO4A 2OA8A 1RILA 1HYSA 1KFDA 1VSDA 4RG8A 3HPOA 2KW4A 3OYGA 4B9UA 2OZSA 3BDPA 3B6OA 1Z25A 3OYLA 1BCOA 2DFEA 4CIGA 3SYZA 1N5YA 1DTTA 3DRRA 3AO2A 5KGXA 4ID5A 1Q9YA 2ZD1A 2GUIA 3IS9A 3NCIA 2G8VA 5KRSA 1NJYA 3TAQA 1JL2A 4DU4A 3AO5A 1TAUA 1C6VA 1R0AA 1DLOA 3V9XA 3IAYA 2DTUA 4CERA 1VSIA 2JGUA 5HRNA 3CQ8A 4M3TA 4WE1A 4KHNA 3ZSZA 5C25A 3OYNA 1U45A 4KHUA 3AA3A 1XHXA 3V9ZA 1RT3A 1WSJA 3U3GA 4JS4A 1HYZA 4XIUA 5SZTA 3TAEA 4Y1DA 1Q9XA 4KPYA 1J53A 4CFCA 5KGWA 3V1RA 1YTUA 1CXQA 1JL1A 1IKWA 3KKSA 4BACA 3OYEA 3VA3A 1QQCA 1RDDA 4CGIA 4DLEA 3U3YA 4NCAA 3V9WA 1EETA 3TARA 3OYFA 3DOLA 1A5XA 1A5VA 3I0SA 3VQ8A 3L2RA 4DTUA 1NKEA 1VSEA 4IDKA 4O4GA 3ZSXA 4CJKA 4J2DA 3IRXA 3ZT4A 4FLZA 3CG7A 4DFJA 1Z26A 1BISA 4O5BA 4DMNA 1L3TA 4HVJA 4DFKA 3V4IA 4E3SA 3E01A 2Z1JA 3M8SA 1NOZA 1YT3A 1ZBLA 1NJZA 3OJSA 4HUFA 4HUEA 4CCHA 2YV0X 4DSKA 4N76A 1KVCA 3ZT0A 5JS1A 1NK7A 4Z4FA 1BIZA 1TKDA 4CEFA 3T3FA 3LWLA 4F4KA 4FJ5A 3VQ7A 3QEVA 4C8MA 4M42A 3ZSRA 2YNFA 3LAMA 3MEDA 3T1AA 3MECA 1NKCA 3RTVA 3VQAA 4KTQA 3KLFA 1NK8A 4NYFA 4QAGA 1IG9A 3QESA 3DYAA 3KLEA 4RW6A 2Z1HA 3I8DA 3PY8A 3C94A 4E7IA 4Q0BA 4I9LA 3VQCA 4AHUA 3TI0A 5CZ2A 1TL1A 3LP0A 5J2MA 1T8EA 5J1EA 4M3UA 4OVLA 4CE9A 4AHVA 1KFSA 4B9NA 4CGDA 2HHSA 3JSMA 3NGIA 1BI4A 2DFFA 4CHYA 3PX4A 2HHTA 4KI4A 4CJ4A 1NK0A 3AVMA 4J2BA 3T19A 3L2VA 1HYVA 3OYJA 3VQEA 4FW1A 1GOAA 2D0BA 4I7FA 3VQPA 5CYQA 2E4LA 3ZT1A 3M8QA 1IH7A 3HM9A 3K59A 3S3MA 3S3NA 1LWEA 4IBNA 4ZTJA 3F9KA 4GVMA 1LW2A 1S1VA 4FM2A 1RBVA 1ASVA 5J2PA 3IG1A 5KTQA 1BQMA 1RT6A 1TK8A 4CGJA 1HMVA 2B5JA 3KLGA 4E7KA 3VQQA 2E6MA 3A2FA 1D5AA 4Y1CA 5HROA 1S5JA 1L3VA 4LH5A 4M3ZA 4FJHA 1Q8IA 1J9AA 4IFVA 3DLHA 3HK2A 4CIEA 2YNIA 4CJWA 4PUOA 2X74A 4OKJA 2HVIA 2F8SA 1C1CA 4CJRA 4CHOA 2RKIA 3NHGA 1UA0A 1U4BA 1U47A 3QINA 1I3AA 4KTWA 2OPRA 4C8LA 4KV8A 4F2RA 2QKBA 3AV9A 1KTQA 2G8FA 3VQ5A 4KHYA 2FBXA 3S3OA 2G8KA 5FRMA 4ELVA 4CEOA 3SNNA 4JLHA 1KVAA 3QNNA 3V6DA 4MFBA 1TK0A 4CESA 4FLTA 1NK6A 4K8XA 4KB1A 1EP4A 1SL2A 3CFPA 4IKFA 1ASUA 3WNEA 1NOYA 3TAMA 1S6QA 2QK9A 3P5JA 3ZSOA 4AHSA 3RMDA 3NF7A 3D0PA 1LW0A 3K5OA 3K5MA 3MXIA 4FM0A 3PX0A 4C8OA 4KB0A 1WAFA 4DTSA 3ZT3A 4N41A 2AJQA 4LSNA 4DTMA 1QSLA 1UWBA 4KRFA 2RF2A 4CF8A 1YTAA 4W5NA 3LP3A 1JLQA 1S6PA 3SI6A 2HNYA 1ZBIA 1LWCA 2KTQA 1C1AA 2HNDA 3SV4A 5SWMA 5HRPA 2WONA 3DLEA 1L5UA 3NF9A 3RR7A 1RDCA 4DSEA 3OYBA 3EZ5A 4E7JA 1S1XA 4LY7A 3O3GA 3HL8A 2PYLA 4ZHRA 3HT3A 1W9HA 3NF6A 5HP1A 5C24A 1SKSA 1WSIA 3ASMA 3LZIA 5CYMA 3VA0A 1HPZA 3RRGA 2YNGA 4CEBA 1SKRA 2A1SA 4OGEA 1LWFA 1JLEA 1WSFA 4PA1A 4AHRA 3EY1A 2I5JA 4FCYA 2XY6A 1RTDA 4Z4GA 2HHQA 1FKPA 4CK3A 3NAEA 3SUPA 2Z1GA 4FJNA 1T05A 2P1JA 5CY4A 3QEIA 3V1OA 3DM2A 1RBTA 3SPZA 3DLKA 4ICLA 2HHVA 2XY8A 4CFBA 3ULDA 4DS4A 2R7YA 4KTZA 4BWMA 3L2QA 4CHNA 3O4QA 1HQEA 3WNGA 4FLVA 1IKYA 1QHTA 3LZJA 3DI6A 3AO3A 1WSEA 2YNHA 1D9FA 1KRPA 2HW3A 4H4OA 4CHQA 3DLRA 3QEPA 1U49A 2KQ2A 3AVCA 3C6UA 5FROA 3HP9A 3QNOA 3HO1A 4UQGA 4I9QA 4F2SA 3AA4A 4DQSA 2G8HA 3K5LA 1JXBA 4F3TA 4DQQA 3ISNC 1A5WA 3NFAA 4FVMA 4JRQA 3RRHA 4I2PA 3QO9A 4J2EA 4FK4A 2OPSA 4B9MA 4OGCA 4DFMA 3AVGA 5E41A 1QTMA 1C1BA 1DTQA 4DF8A 1UOCA 1G15A 4CF1A 2VWKA 1SKWA 4FJLA 3SUNA 1SL1A 3HPHA 4KHQA 4DTJA 4Z4IA 3SUQA 2BDPA 1IKVA 3OVNA 4OJRA 3OYAA 1SL0A 4DG1A 4OPKA 1BL3A 4FZYA 2G8IA 4OKKA 3OYCA 1HNIA 3QETA 3KD1E 3TABA 4GW6A 3VQDA 1NJWA 1QSSA 2ITGA 4CJTA 3M8RA 2QXFA 3C95A 3PUFA 1RBRA 3OYDA 4CJPA 4Z4CA 4FM1A 3AVIA 2W42A 2KZZA 3WNHA 4CJVA 1XHZA 4B8CA 3NGZA 1FKOA 3K58A 4I2QA 3AVJA 4HCCA 4FK2A 3QEWA 4JRPA 2HHWA 1B9DA 2G8UA 4CHPA 1QE1A 3VQ4A 2JLEA 1O1WA 4CFAA 1K6YA 1S9EA 3F73A 2PZSA 1WLJA 1TV6A 4B9TA 1BGXT 3OYHA 4ELTA 1RTHA 4FJGA 4DFPA 4PQUA 2A1RA 2XY7A 1CLQA 4O0JA 5JS2A 4CF9A 1UA1A 2P5OA 4Z4HA 4RW4A 1NKBA 2XRIA 2HMIA 4DSLA 4N5SA 1RDBA 1VRTA 4RW9A 1IKXA 3NDKA 3HJFA 4FK0A 4FXDA 4CJFA 3RR8A 1C0MA 2IC3A 1S1UA 3FFIA 1BCMA 4FLWA 3QIPA 3SPYA 3KD5E 3G10A 1JLFA 5I3UA 2RN2A 3CM5A 4FZZA 5CZ1A 5C42A 1S1TA 1WAJA 3O3FA 2VG6A 3DLGA 3KK1A 3G0ZA 3O4NA 4M41A 2ZE2A 3DMJA 1X9SA 1X9MA 3KKRA 4H8KA 1RT4A 3DLBA 2Y1IA 1WSGA 3HVTA 4FJMA 1VSMA 4ELUA 4CJQA 1FK9A 3NGYA 4DLGA 5HRRA 1B9FA 3AA5X 3ZSYA 2QKKA 4Q5VA 4O55A 3B6PA 3L2UA 4CF0A 3NH1A 2Z1IA 1TKXA 2X6SA 3SV3A 2ETJA 3K2PA 3AVHA 3AA2A 3RWUA 4E1NA 2DFHA 5K14A 4HCBA 1RTJA 1IO2A 4L8RB 5T7BA 4E7HA 3H08A 1VK0A 4J2AA 3V9SA 1RT2A 4RW7A 4KI6A 1TAQA 4FZXC 4FJ7A 3OS0A 3HVRA 1BI4B 2OZMA 4CF2A 3P1GA 3AVAA 3LDSA 3MEGA 4E0DA 1KLMA 3ZT2A 4CJ3A 3WNFA 1JLGA 4TSXA 1VSKA 3MAQA 4HTUA 4C8KA 4N47A 3AVKA 2OPQA 4Z4EA 2RPIA 2F96A 4BDPA 4B9VA 1B92A 4EZ6A 3AVNA 4B9LA 4O0IA 1JLCA 4YNQA 3THVA 2HB5A 4CJLA 3KJVA 5KI6A 3M8PA 1XWLA 3HP6A 4CEDA 4DQRA 1HQUA 4CHZA 3KK2A 1ZBHA 2KZMA 4W5OA 3JYTA 2D0AA 2IAJA 4DSIA 3SJJA 4CIFA 1XI1A 1J54A 1T7PA 2PY5A 1EX4A 1C0UA 2YKNA 4M45A 4NCGA 2ATQA 4CJEA 3VQ6A 4ID1A 5FDLA 4W5TA 3LPTA 2KFNA 4LH4A 1JLBA 1EKEA 4BE0A 2XHBA 3OYMA 5FRNA 4DSJA 3AO1A 3I0RA 3AVLA 3QIOA 3TR8A 3LALA 5HLFA 4NCBA 3OS1A 4PWDA 2BE2A 2PYJA 5HRSA 1XC9A 4MQ3A 3PO4A 4M3XA 2B4JA 2F8TA 1ZBUA 4DTRA 2FBYA 1RNHA 1SV5A 2OPPA 2IOCA 3PX6A 3QEXA 4CECA 3UIQA 2FBVA 1WN7A 1ASWA 3SZ2A 1ZYQA 1I39A 4CFDA 2OYQA 4FJXA 1YVUA 3NBPA 2EHGA 2Q3SA 3SUOA 1T03A 5D3GA 2FC0A 3QLHA 3L2WA 3MXMA 4B8AB 1S1WA 5DK5A 1L3UA 4YFUA 3AVFA 2IS3A 4NYNA 2P51A 1N6QA 3V1QA 4OLBA 2XO7A 2NUBA 4OLAA 1CZBA 3L3UA 1ITGA 1TL3A 3TAFA 2HHXA 1QSYA 4M3YA 4KREA 3VQ9A 3NE6A 4DU3A 3HSTB 4GMJB 3ALYA 1RBSA 1RDAA 4AILC 1HRHA 3AVBA 1JLAA 1RTIA 3V81A 1JKHA 2YHAA 4B08A 3K5NA 2VG7A 4HHTA 4CJ5A 3L3VA 3SQ2A 4KAZA 3L8BA 2VG5A 4IG3A 4IFYA 3ZSQA 1RT5A 3ZSVA 1QS4A 2IDOA 4CJSA 4N56A 1RT7A 3VQBA 3OS2A 3TWHA 3LWMA 1S9GA 3ITHA 4FJ9A 3NF8A 1GOBA 2O4GA 1BQNA 1GOCA 1UAXA 5HBMA 4EP4A 4DF4A 1VSHA 4FJJA 4E89A 3SQ4A 5J2QA 4DQPA 2HVHA 1WSHA 3LP1A 4IG0A 3TAGA 1NK9A 3C6TA 3RMAA 3NH2A 3D45A 4FW2A 4CK2A 4FJIA 1EXQA 1RCHA 3CFOA 3HXMA 4KHSA 1VRUA 4KFBA 4M3WA 4W5RA 3LPUA 4AHCA 3LANA 1VSJA 3OYKA 1L3SA 1KLNA 2EX3A 2IGIA 2YHBA 1VSFA 3MEEA 1NK4A 1LAWA 3DOKA 1RBUA 2X78A 4DQIA 4QOZB 3EYZA 1KVBA 3U6FA 4JS5A 3VN5A 3OYIA 3CFRA 3ZCMA 4CGGA 1LV5A 5I42A 4Z0UA 4LD0A 2BANA 4E1MA 1J5OA 1D9DA 2XY5A 4QCLA 4O44A 4CEAA 1FXXA 1Y97A 3O3HA 2YKMA 4W5QA 4BDZA 3TANA 4CGFA 1U48A 3KTQA 1CXUA 2FBTA 5KRTA 5EU7A 3NH0A 3BGRA 4DWIA 2WOMA 3HPGA 4FYDA 4DS5A 4RW8A 4E7LA 4DTNA 2E6LA 4KO0A 4CJUA 3MXJA 4KKOA 2D0CA 5J2NA 2HHUA 1W0HA 2X6NA 4DSFA 4EZ9A 3LAKA 1RT1A 4AH9A 3KLHA 4K8ZA 1HNVA 1NJXA 1C0TA 3SCXA 4B9SA 3KK3A 3QERA 4M3RA 1TVRA 1KSPA 1WNSA 4CEEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BIU A;  4FLX A;  4ZTF A;  3RMC A;  4CEZ A;  3S9H A;  4G1Q A;  1BHL A;  1JXE A;  5DMR A;  4BE1 A;  3SQ1 A;  3LP2 A;  3PO5 A;  3V9U A;  4DTO A;  1REV A;  4PY5 A;  3CM6 A;  4KHW A;  2DY4 A;  2B6A A;  1X1P A;  1KCF A;  1LAV A;  1SUQ A;  1MU2 A;  4BDY A;  2HNZ A;  1TK5 A;  4DTP A;  4CEQ A;  4F8R A;  1HJR A;  4FJ8 A;  4LSL A;  1D8Y A;  3ZSW A;  3OJU A;  1U04 A;  2O4I A;  1F21 A;  4AHT A;  3DRS A;  3CYM A;  3KLI A;  3HYF A;  4FJK A;  3OY9 A;  2GV9 A;  4CK1 A;  4FLU A;  4C8N A;  1ZBF A;  4DTX A;  2G8W A;  3K57 A;  4EP5 A;  4E19 A;  4BWJ A;  3PV8 A;  4H4M A;  3TAP A;  4OKE A;  4CGH A;  3DRP A;  1TGO A;  4FLY A;  1TKT A;  1X9W A;  4DU1 A;  3SQ0 A;  4F3O A;  2KFZ A;  2D5R A;  3P83 D;  4BE2 A;  4HUG A;  3KIO A;  2ZQB A;  4B3O A;  1TKZ A;  1CZ9 A;  4OPJ A;  2GBZ A;  2Y1J A;  3RMB A;  2VWJ A;  1NK5 A;  2P5G A;  1VSL A;  2BGG A;  4R5P A;  2LSN A;  3AO4 A;  2OA8 A;  1RIL A;  1HYS A;  1KFD A;  1VSD A;  4RG8 A;  3HPO A;  2KW4 A;  3OYG A;  4B9U A;  2OZS A;  3BDP A;  3B6O A;  1Z25 A;  3OYL A;  1BCO A;  2DFE A;  4CIG A;  3SYZ A;  1N5Y A;  1DTT A;  3DRR A;  3AO2 A;  5KGX A;  4ID5 A;  1Q9Y A;  2ZD1 A;  2GUI A;  3IS9 A;  3NCI A;  2G8V A;  5KRS A;  1NJY A;  3TAQ A;  1JL2 A;  4DU4 A;  3AO5 A;  1TAU A;  1C6V A;  1R0A A;  1DLO A;  3V9X A;  3IAY A;  2DTU A;  4CER A;  1VSI A;  2JGU A;  5HRN A;  3CQ8 A;  4M3T A;  4WE1 A;  4KHN A;  3ZSZ A;  5C25 A;  3OYN A;  1U45 A;  4KHU A;  3AA3 A;  1XHX A;  3V9Z A;  1RT3 A;  1WSJ A;  3U3G A;  4JS4 A;  1HYZ A;  4XIU A;  5SZT A;  3TAE A;  4Y1D A;  1Q9X A;  4KPY A;  1J53 A;  4CFC A;  5KGW A;  3V1R A;  1YTU A;  1CXQ A;  1JL1 A;  1IKW A;  3KKS A;  4BAC A;  3OYE A;  3VA3 A;  1QQC A;  1RDD A;  4CGI A;  4DLE A;  3U3Y A;  4NCA A;  3V9W A;  1EET A;  3TAR A;  3OYF A;  3DOL A;  1A5X A;  1A5V A;  3I0S A;  3VQ8 A;  3L2R A;  4DTU A;  1NKE A;  1VSE A;  4IDK A;  4O4G A;  3ZSX A;  4CJK A;  4J2D A;  3IRX A;  3ZT4 A;  4FLZ A;  3CG7 A;  4DFJ A;  1Z26 A;  1BIS A;  4O5B A;  4DMN A;  1L3T A;  4HVJ A;  4DFK A;  3V4I A;  4E3S A;  3E01 A;  2Z1J A;  3M8S A;  1NOZ A;  1YT3 A;  1ZBL A;  1NJZ A;  3OJS A;  4HUF A;  4HUE A;  4CCH A;  2YV0 X;  4DSK A;  4N76 A;  1KVC A;  3ZT0 A;  5JS1 A;  1NK7 A;  4Z4F A;  1BIZ A;  1TKD A;  4CEF A;  3T3F A;  3LWL A;  4F4K A;  4FJ5 A;  3VQ7 A;  3QEV A;  4C8M A;  4M42 A;  3ZSR A;  2YNF A;  3LAM A;  3MED A;  3T1A A;  3MEC A;  1NKC A;  3RTV A;  3VQA A;  4KTQ A;  3KLF A;  1NK8 A;  4NYF A;  4QAG A;  1IG9 A;  3QES A;  3DYA A;  3KLE A;  4RW6 A;  2Z1H A;  3I8D A;  3PY8 A;  3C94 A;  4E7I A;  4Q0B A;  4I9L A;  3VQC A;  4AHU A;  3TI0 A;  5CZ2 A;  1TL1 A;  3LP0 A;  5J2M A;  1T8E A;  5J1E A;  4M3U A;  4OVL A;  4CE9 A;  4AHV A;  1KFS A;  4B9N A;  4CGD A;  2HHS A;  3JSM A;  3NGI A;  1BI4 A;  2DFF A;  4CHY A;  3PX4 A;  2HHT A;  4KI4 A;  4CJ4 A;  1NK0 A;  3AVM A;  4J2B A;  3T19 A;  3L2V A;  1HYV A;  3OYJ A;  3VQE A;  4FW1 A;  1GOA A;  2D0B A;  4I7F A;  3VQP A;  5CYQ A;  2E4L A;  3ZT1 A;  3M8Q A;  1IH7 A;  3HM9 A;  3K59 A;  3S3M A;  3S3N A;  1LWE A;  4IBN A;  4ZTJ A;  3F9K A;  4GVM A;  1LW2 A;  1S1V A;  4FM2 A;  1RBV A;  1ASV A;  5J2P A;  3IG1 A;  5KTQ A;  1BQM A;  1RT6 A;  1TK8 A;  4CGJ A;  1HMV A;  2B5J A;  3KLG A;  4E7K A;  3VQQ A;  2E6M A;  3A2F A;  1D5A A;  4Y1C A;  5HRO A;  1S5J A;  1L3V A;  4LH5 A;  4M3Z A;  4FJH A;  1Q8I A;  1J9A A;  4IFV A;  3DLH A;  3HK2 A;  4CIE A;  2YNI A;  4CJW A;  4PUO A;  2X74 A;  4OKJ A;  2HVI A;  2F8S A;  1C1C A;  4CJR A;  4CHO A;  2RKI A;  3NHG A;  1UA0 A;  1U4B A;  1U47 A;  3QIN A;  1I3A A;  4KTW A;  2OPR A;  4C8L A;  4KV8 A;  4F2R A;  2QKB A;  3AV9 A;  1KTQ A;  2G8F A;  3VQ5 A;  4KHY A;  2FBX A;  3S3O A;  2G8K A;  5FRM A;  4ELV A;  4CEO A;  3SNN A;  4JLH A;  1KVA A;  3QNN A;  3V6D A;  4MFB A;  1TK0 A;  4CES A;  4FLT A;  1NK6 A;  4K8X A;  4KB1 A;  1EP4 A;  1SL2 A;  3CFP A;  4IKF A;  1ASU A;  3WNE A;  1NOY A;  3TAM A;  1S6Q A;  2QK9 A;  3P5J A;  3ZSO A;  4AHS A;  3RMD A;  3NF7 A;  3D0P A;  1LW0 A;  3K5O A;  3K5M A;  3MXI A;  4FM0 A;  3PX0 A;  4C8O A;  4KB0 A;  1WAF A;  4DTS A;  3ZT3 A;  4N41 A;  2AJQ A;  4LSN A;  4DTM A;  1QSL A;  1UWB A;  4KRF A;  2RF2 A;  4CF8 A;  1YTA A;  4W5N A;  3LP3 A;  1JLQ A;  1S6P A;  3SI6 A;  2HNY A;  1ZBI A;  1LWC A;  2KTQ A;  1C1A A;  2HND A;  3SV4 A;  5SWM A;  5HRP A;  2WON A;  3DLE A;  1L5U A;  3NF9 A;  3RR7 A;  1RDC A;  4DSE A;  3OYB A;  3EZ5 A;  4E7J A;  1S1X A;  4LY7 A;  3O3G A;  3HL8 A;  2PYL A;  4ZHR A;  3HT3 A;  1W9H A;  3NF6 A;  5HP1 A;  5C24 A;  1SKS A;  1WSI A;  3ASM A;  3LZI A;  5CYM A;  3VA0 A;  1HPZ A;  3RRG A;  2YNG A;  4CEB A;  1SKR A;  2A1S A;  4OGE A;  1LWF A;  1JLE A;  1WSF A;  4PA1 A;  4AHR A;  3EY1 A;  2I5J A;  4FCY A;  2XY6 A;  1RTD A;  4Z4G A;  2HHQ A;  1FKP A;  4CK3 A;  3NAE A;  3SUP A;  2Z1G A;  4FJN A;  1T05 A;  2P1J A;  5CY4 A;  3QEI A;  3V1O A;  3DM2 A;  1RBT A;  3SPZ A;  3DLK A;  4ICL A;  2HHV A;  2XY8 A;  4CFB A;  3ULD A;  4DS4 A;  2R7Y A;  4KTZ A;  4BWM A;  3L2Q A;  4CHN A;  3O4Q A;  1HQE A;  3WNG A;  4FLV A;  1IKY A;  1QHT A;  3LZJ A;  3DI6 A;  3AO3 A;  1WSE A;  2YNH A;  1D9F A;  1KRP A;  2HW3 A;  4H4O A;  4CHQ A;  3DLR A;  3QEP A;  1U49 A;  2KQ2 A;  3AVC A;  3C6U A;  5FRO A;  3HP9 A;  3QNO A;  3HO1 A;  4UQG A;  4I9Q A;  4F2S A;  3AA4 A;  4DQS A;  2G8H A;  3K5L A;  1JXB A;  4F3T A;  4DQQ A;  3ISN C;  1A5W A;  3NFA A;  4FVM A;  4JRQ A;  3RRH A;  4I2P A;  3QO9 A;  4J2E A;  4FK4 A;  2OPS A;  4B9M A;  4OGC A;  4DFM A;  3AVG A;  5E41 A;  1QTM A;  1C1B A;  1DTQ A;  4DF8 A;  1UOC A;  1G15 A;  4CF1 A;  2VWK A;  1SKW A;  4FJL A;  3SUN A;  1SL1 A;  3HPH A;  4KHQ A;  4DTJ A;  4Z4I A;  3SUQ A;  2BDP A;  1IKV A;  3OVN A;  4OJR A;  3OYA A;  1SL0 A;  4DG1 A;  4OPK A;  1BL3 A;  4FZY A;  2G8I A;  4OKK A;  3OYC A;  1HNI A;  3QET A;  3KD1 E;  3TAB A;  4GW6 A;  3VQD A;  1NJW A;  1QSS A;  2ITG A;  4CJT A;  3M8R A;  2QXF A;  3C95 A;  3PUF A;  1RBR A;  3OYD A;  4CJP A;  4Z4C A;  4FM1 A;  3AVI A;  2W42 A;  2KZZ A;  3WNH A;  4CJV A;  1XHZ A;  4B8C A;  3NGZ A;  1FKO A;  3K58 A;  4I2Q A;  3AVJ A;  4HCC A;  4FK2 A;  3QEW A;  4JRP A;  2HHW A;  1B9D A;  2G8U A;  4CHP A;  1QE1 A;  3VQ4 A;  2JLE A;  1O1W A;  4CFA A;  1K6Y A;  1S9E A;  3F73 A;  2PZS A;  1WLJ A;  1TV6 A;  4B9T A;  1BGX T;  3OYH A;  4ELT A;  1RTH A;  4FJG A;  4DFP A;  4PQU A;  2A1R A;  2XY7 A;  1CLQ A;  4O0J A;  5JS2 A;  4CF9 A;  1UA1 A;  2P5O A;  4Z4H A;  4RW4 A;  1NKB A;  2XRI A;  2HMI A;  4DSL A;  4N5S A;  1RDB A;  1VRT A;  4RW9 A;  1IKX A;  3NDK A;  3HJF A;  4FK0 A;  4FXD A;  4CJF A;  3RR8 A;  1C0M A;  2IC3 A;  1S1U A;  3FFI A;  1BCM A;  4FLW A;  3QIP A;  3SPY A;  3KD5 E;  3G10 A;  1JLF A;  5I3U A;  2RN2 A;  3CM5 A;  4FZZ A;  5CZ1 A;  5C42 A;  1S1T A;  1WAJ A;  3O3F A;  2VG6 A;  3DLG A;  3KK1 A;  3G0Z A;  3O4N A;  4M41 A;  2ZE2 A;  3DMJ A;  1X9S A;  1X9M A;  3KKR A;  4H8K A;  1RT4 A;  3DLB A;  2Y1I A;  1WSG A;  3HVT A;  4FJM A;  1VSM A;  4ELU A;  4CJQ A;  1FK9 A;  3NGY A;  4DLG A;  5HRR A;  1B9F A;  3AA5 X;  3ZSY A;  2QKK A;  4Q5V A;  4O55 A;  3B6P A;  3L2U A;  4CF0 A;  3NH1 A;  2Z1I A;  1TKX A;  2X6S A;  3SV3 A;  2ETJ A;  3K2P A;  3AVH A;  3AA2 A;  3RWU A;  4E1N A;  2DFH A;  5K14 A;  4HCB A;  1RTJ A;  1IO2 A;  4L8R B;  5T7B A;  4E7H A;  3H08 A;  1VK0 A;  4J2A A;  3V9S A;  1RT2 A;  4RW7 A;  4KI6 A;  1TAQ A;  4FZX C;  4FJ7 A;  3OS0 A;  3HVR A;  1BI4 B;  2OZM A;  4CF2 A;  3P1G A;  3AVA A;  3LDS A;  3MEG A;  4E0D A;  1KLM A;  3ZT2 A;  4CJ3 A;  3WNF A;  1JLG A;  4TSX A;  1VSK A;  3MAQ A;  4HTU A;  4C8K A;  4N47 A;  3AVK A;  2OPQ A;  4Z4E A;  2RPI A;  2F96 A;  4BDP A;  4B9V A;  1B92 A;  4EZ6 A;  3AVN A;  4B9L A;  4O0I A;  1JLC A;  4YNQ A;  3THV A;  2HB5 A;  4CJL A;  3KJV A;  5KI6 A;  3M8P A;  1XWL A;  3HP6 A;  4CED A;  4DQR A;  1HQU A;  4CHZ A;  3KK2 A;  1ZBH A;  2KZM A;  4W5O A;  3JYT A;  2D0A A;  2IAJ A;  4DSI A;  3SJJ A;  4CIF A;  1XI1 A;  1J54 A;  1T7P A;  2PY5 A;  1EX4 A;  1C0U A;  2YKN A;  4M45 A;  4NCG A;  2ATQ A;  4CJE A;  3VQ6 A;  4ID1 A;  5FDL A;  4W5T A;  3LPT A;  2KFN A;  4LH4 A;  1JLB A;  1EKE A;  4BE0 A;  2XHB A;  3OYM A;  5FRN A;  4DSJ A;  3AO1 A;  3I0R A;  3AVL A;  3QIO A;  3TR8 A;  3LAL A;  5HLF A;  4NCB A;  3OS1 A;  4PWD A;  2BE2 A;  2PYJ A;  5HRS A;  1XC9 A;  4MQ3 A;  3PO4 A;  4M3X A;  2B4J A;  2F8T A;  1ZBU A;  4DTR A;  2FBY A;  1RNH A;  1SV5 A;  2OPP A;  2IOC A;  3PX6 A;  3QEX A;  4CEC A;  3UIQ A;  2FBV A;  1WN7 A;  1ASW A;  3SZ2 A;  1ZYQ A;  1I39 A;  4CFD A;  2OYQ A;  4FJX A;  1YVU A;  3NBP A;  2EHG A;  2Q3S A;  3SUO A;  1T03 A;  5D3G A;  2FC0 A;  3QLH A;  3L2W A;  3MXM A;  4B8A B;  1S1W A;  5DK5 A;  1L3U A;  4YFU A;  3AVF A;  2IS3 A;  4NYN A;  2P51 A;  1N6Q A;  3V1Q A;  4OLB A;  2XO7 A;  2NUB A;  4OLA A;  1CZB A;  3L3U A;  1ITG A;  1TL3 A;  3TAF A;  2HHX A;  1QSY A;  4M3Y A;  4KRE A;  3VQ9 A;  3NE6 A;  4DU3 A;  3HST B;  4GMJ B;  3ALY A;  1RBS A;  1RDA A;  4AIL C;  1HRH A;  3AVB A;  1JLA A;  1RTI A;  3V81 A;  1JKH A;  2YHA A;  4B08 A;  3K5N A;  2VG7 A;  4HHT A;  4CJ5 A;  3L3V A;  3SQ2 A;  4KAZ A;  3L8B A;  2VG5 A;  4IG3 A;  4IFY A;  3ZSQ A;  1RT5 A;  3ZSV A;  1QS4 A;  2IDO A;  4CJS A;  4N56 A;  1RT7 A;  3VQB A;  3OS2 A;  3TWH A;  3LWM A;  1S9G A;  3ITH A;  4FJ9 A;  3NF8 A;  1GOB A;  2O4G A;  1BQN A;  1GOC A;  1UAX A;  5HBM A;  4EP4 A;  4DF4 A;  1VSH A;  4FJJ A;  4E89 A;  3SQ4 A;  5J2Q A;  4DQP A;  2HVH A;  1WSH A;  3LP1 A;  4IG0 A;  3TAG A;  1NK9 A;  3C6T A;  3RMA A;  3NH2 A;  3D45 A;  4FW2 A;  4CK2 A;  4FJI A;  1EXQ A;  1RCH A;  3CFO A;  3HXM A;  4KHS A;  1VRU A;  4KFB A;  4M3W A;  4W5R A;  3LPU A;  4AHC A;  3LAN A;  1VSJ A;  3OYK A;  1L3S A;  1KLN A;  2EX3 A;  2IGI A;  2YHB A;  1VSF A;  3MEE A;  1NK4 A;  1LAW A;  3DOK A;  1RBU A;  2X78 A;  4DQI A;  4QOZ B;  3EYZ A;  1KVB A;  3U6F A;  4JS5 A;  3VN5 A;  3OYI A;  3CFR A;  3ZCM A;  4CGG A;  1LV5 A;  5I42 A;  4Z0U A;  4LD0 A;  2BAN A;  4E1M A;  1J5O A;  1D9D A;  2XY5 A;  4QCL A;  4O44 A;  4CEA A;  1FXX A;  1Y97 A;  3O3H A;  2YKM A;  4W5Q A;  4BDZ A;  3TAN A;  4CGF A;  1U48 A;  3KTQ A;  1CXU A;  2FBT A;  5KRT A;  5EU7 A;  3NH0 A;  3BGR A;  4DWI A;  2WOM A;  3HPG A;  4FYD A;  4DS5 A;  4RW8 A;  4E7L A;  4DTN A;  2E6L A;  4KO0 A;  4CJU A;  3MXJ A;  4KKO A;  2D0C A;  5J2N A;  2HHU A;  1W0H A;  2X6N A;  4DSF A;  4EZ9 A;  3LAK A;  1RT1 A;  4AH9 A;  3KLH A;  4K8Z A;  1HNV A;  1NJX A;  1C0T A;  3SCX A;  4B9S A;  3KK3 A;  3QER A;  4M3R A;  1TVR A;  1KSP A;  1WNS A;  4CEE A; 
#chains in the Genus database with same CATH topology
 4IWV A;  4DV4 K;  3RMC A;  4CEZ A;  3CI5 A;  4G1Q A;  4BE1 A;  1QHA A;  1S72 N;  1T3V A;  2YHW A;  5FLX O;  4G9Z A;  4DTO A;  1REV A;  3ZLJ A;  3A5L C;  4CBX A;  1X1P A;  1VQ4 N;  5HOO A;  4IJA A;  1BUP A;  2HNZ A;  4QS8 A;  1HJO A;  1M90 O;  4F8R A;  1NGJ A;  4LSL A;  4FSV A;  1U04 A;  3O4W A;  2O4I A;  1HKB A;  3O9R A;  3U9Z A;  3CYM A;  2O8B A;  2O8C B;  2G8W A;  5BPN A;  3DRP A;  1TKT A;  4DU1 A;  4HUG A;  3KIO A;  2ZQB A;  4A5B A;  1N32 K;  3D6R A;  3CMA N;  2F9T A;  4OPJ A;  4DV2 K;  5AQP A;  1GLD G;  4A62 A;  2OCE A;  2OA8 A;  1RIL A;  1VSD A;  1XQS C;  3KK7 A;  1N5Y A;  1NGD A;  2DFE A;  4CIG A;  5AQR A;  1WBB A;  1DTT A;  3DRR A;  3AO2 A;  3O1W A;  3NCI A;  2QWM A;  3TSU A;  1NJY A;  3TAQ A;  1JL2 A;  4DU4 A;  3AO5 A;  1ZC6 A;  3B8A X;  1K8K B;  2GEM A;  1TAU A;  4ILJ A;  3BF3 A;  1WSJ A;  1YTU A;  5AZJ A;  4FWN A;  3OYE A;  2HST A;  4A2B A;  3TAR A;  1EET A;  1KQS M;  1V4T A;  1A5X A;  3DXK B;  3VQ8 A;  4DTU A;  4O4G A;  3G4S N;  3IRX A;  3ZT4 A;  4XH1 A;  1L3T A;  1HLU A;  4H0X B;  2D4W A;  4GY2 B;  1ZBL A;  2E1Y A;  1NJZ A;  1KXP A;  4CCH A;  3OA9 A;  2Q97 A;  4BRO A;  5M1O A;  4Z4F A;  1NG9 A;  3THY B;  2FSK A;  2ZM6 K;  4FJ5 A;  3QEV A;  1D4X A;  4C8M A;  4DB3 A;  4M42 A;  3MED A;  3T1A A;  1YIT N;  4KTQ A;  3DJC A;  4M7X A;  3CQY A;  3QES A;  3JXU A;  4Q0B A;  5F1X A;  1XNR K;  4I9L A;  3CJB A;  4OVL A;  4CE9 A;  1KFS A;  1BA0 A;  4BRQ A;  3JSM A;  3NGI A;  3CPE A;  1YVN A;  3FGU A;  3LDP A;  3R3L A;  1QQN A;  3T19 A;  3L2V A;  4BY9 C;  1HYV A;  3TSP A;  3ZT1 A;  3VQP A;  2D0B A;  4B9L A;  5CYQ A;  3M8Q A;  4GVM A;  1S1V A;  4FM2 A;  1BQM A;  2E20 A;  2B5J A;  2W41 A;  4UY8 O;  4NXM K;  4E7K A;  3VQQ A;  2E6M A;  2P9L B;  3HK2 A;  4IZ9 A;  5FPD A;  4PUO A;  3SAF A;  3J8A A;  4BC2 A;  4QS7 A;  3NHG A;  1JJ2 M;  3IUC A;  1U47 A;  3VF2 A;  4KTW A;  1RFQ A;  4KV8 A;  5AQW A;  3AV9 A;  4Z94 A;  4QS9 A;  3ATU A;  2A40 A;  2WUS A;  3OHR A;  4JKC A;  3NVM A;  2DPN A;  4MFB A;  1N36 K;  1HKG A;  4CES A;  4K8X A;  1SL2 A;  3ZET A;  1Q81 O;  1NOY A;  1S6Q A;  4PL8 A;  3NF7 A;  5CE3 A;  3ZT3 A;  2D0O A;  2RF2 A;  3A0I X;  1S6P A;  4JD2 A;  1NNE A;  3S41 A;  3SI6 A;  1VQO N;  2KTQ A;  1C1A A;  2HND A;  5SWM A;  5HRP A;  1L5U A;  3RR7 A;  1JCE A;  4DSE A;  3PIO L;  1N34 K;  2PYL A;  3HT3 A;  1W9H A;  1O13 A;  2W6K A;  5CYM A;  4JKG B;  4DKW A;  3RRG A;  4AHR A;  1NMD A;  1LWF A;  4JK9 A;  5C12 A;  4FCY A;  1QSS A;  3UKR B;  1DGK N;  3NAE A;  4JI5 K;  5AZJ B;  3V1O A;  3DM2 A;  3SPZ A;  3ZEU B;  2CGL A;  2HHV A;  2GUP A;  4CFB A;  2R7Y A;  4KTZ A;  3O4Q A;  3QBW A;  3QBX A;  1T6C A;  3SK3 A;  1E3M A;  1QHT A;  3DI6 A;  1QQO A;  2UUB K;  1U49 A;  1NGI A;  2KQ2 A;  1GLF O;  3HO1 A;  2E8A A;  4UQG A;  2F9W A;  4I9Q A;  2FF3 B;  1I94 K;  3AA4 A;  4DQS A;  2G8H A;  4CZI A;  3K5L A;  2QI2 A;  3ISN C;  3NFA A;  5JVH L;  3ID8 A;  4DFM A;  2CH6 A;  1C1B A;  3VEZ A;  1H1V A;  3CCU N;  4IOA L;  1RDU A;  2GEL A;  1OVY A;  3OYC A;  3MX2 A;  1HNI A;  2V51 B;  3TAB A;  4WQ5 A;  2ITG A;  3QFP A;  2QXF A;  4PKG A;  4YDU A;  4YDU C;  1RBR A;  4CJP A;  2GWJ A;  1RDW X;  1FKO A;  3T1H K;  3AVJ A;  4YOR A;  4CVN E;  1B9D A;  4FWL A;  3DXM B;  5BRD A;  1G99 A;  1TV6 A;  4B9T A;  1QVG M;  1VQK N;  5JS2 A;  4JI1 K;  4AM6 A;  4RW4 A;  2XRI A;  4DSL A;  1RDB A;  4NB4 A;  3NDK A;  2UUC K;  4CJF A;  4JYA K;  2IC3 A;  4IOC L;  1HNZ K;  4FZZ A;  2RN2 A;  2HBK A;  5CZ1 A;  5C42 A;  1S1T A;  1WAJ A;  3PSI A;  4BRP A;  3O3F A;  3O4N A;  4H0P A;  1X9M A;  1BOT O;  1TYQ A;  4DLG A;  2QKK A;  4CZG A;  4O55 A;  4B3R K;  4OX9 K;  3NH1 A;  2Z1I A;  1TKX A;  3CCL N;  5K14 A;  3AGK A;  1IO2 A;  2HOE A;  3UKU A;  5T7B A;  2UXD K;  1MWK A;  4J2A A;  4KI6 A;  1TAQ A;  3CER A;  3O80 A;  4YOU A;  3P1G A;  3LDS A;  3ZT2 A;  4TSX A;  4C8K A;  4H5T A;  3H46 O;  1VQN N;  4O0I A;  4YNQ A;  3VGM A;  4DR5 K;  2HB5 A;  4CJL A;  5AQI A;  3HP6 A;  3KK2 A;  1ZBH A;  5JIC A;  2ZGY A;  1XI1 A;  3L6Q A;  3FZK A;  4B3S K;  3CCQ N;  3E9L A;  2KFN A;  3THW B;  4JI3 K;  2HHH K;  3O6W A;  4DV1 K;  3TPQ A;  3AVL A;  3TR8 A;  1NMN A;  3FFK B;  3OS1 A;  4WQ4 A;  3CC4 N;  5HRS A;  4MQ3 A;  2B4J A;  4DTR A;  2YX6 A;  1VQ5 N;  2FBY A;  3PLA A;  4DR3 K;  5GAH P;  3UKR A;  3CC2 N;  4MLE A;  5DM6 L;  4CEC A;  2OYQ A;  1WN7 A;  1ZYQ A;  3RSE A;  3NBP A;  4BGA A;  2EHG A;  2Q3S A;  5B8H A;  3KWI A;  3DXK A;  5AZI B;  3MXM A;  4L3Q A;  1L3U A;  3CCM N;  4YFU A;  4BG8 A;  2NRR A;  3V1Q A;  2XO7 A;  3L3U A;  2HHX A;  4CZL A;  4IEI A;  1QSY A;  4H5N A;  4KRE A;  3NE6 A;  4JKF A;  3HST B;  1TYQ B;  3LM9 A;  5TKY A;  3BY5 A;  2BH1 A;  4DUZ K;  4O8K A;  3CCS N;  1JKH A;  3CJ9 A;  2YHA A;  4HHT A;  4KBO A;  4IG3 A;  1S22 A;  1S9G A;  4EP4 A;  3OBW A;  3NVK A;  4GV3 A;  5J2Q A;  2HBJ A;  5C10 A;  4EHT A;  3LP1 A;  2PFU A;  2P9S A;  1GLL O;  3JAM O;  3NH2 A;  4CK2 A;  4FJI A;  3HXM A;  4YOT A;  1XC3 A;  3GE1 A;  4A61 A;  5HL7 L;  4AHC A;  3OTO K;  4KH6 A;  1LAW A;  4JKE A;  4QOZ B;  1ATN A;  2YJE A;  3U6F A;  3VN5 A;  3E1Y A;  3ZCM A;  4CGG A;  2I7P A;  4Z0U A;  2P9I B;  4LD0 A;  1D9D A;  4GV9 A;  4CEA A;  1U48 A;  2YKM A;  4OO1 J;  2AJQ A;  4CGF A;  4ISE A;  3HOS A;  4NXN K;  1EWQ A;  5J2N A;  1W0H A;  2X6N A;  3BZC A;  1RT1 A;  4K8Z A;  1C0T A;  5LJV A;  5E84 A;  1WNS A;  4CEE A;  4FOI A;  4ZTF A;  4RCH A;  3QFU A;  1DKG D;  1JXE A;  4CZH A;  1ESV A;  3K9K A;  1KCF A;  1MU2 A;  1XMQ K;  4JI2 K;  4DTP A;  3MN9 A;  1VQ6 N;  3WEE B;  4FJ8 A;  2P9U B;  1D8Y A;  3OJU A;  5BR8 K;  3DRS A;  2GV9 A;  5GAG P;  4C8N A;  1ZBF A;  4DTX A;  3PV8 A;  2E2N A;  4E19 A;  4BWJ A;  4EP5 A;  1OKJ A;  4OKE A;  4CGH A;  5FPM A;  1X9W A;  2KFZ A;  3SQ0 A;  4BE2 A;  1Q18 A;  4DR6 K;  5EX5 A;  2Q0R A;  2Y1J A;  3WQT A;  4FWM A;  5BRE A;  3R6M A;  2KW4 A;  2OZS A;  2ZGZ A;  3GG4 A;  1S3X A;  2ZJP L;  3TTF A;  3MN6 A;  5H1S Q;  3VPZ A;  2G8V A;  5KRS A;  3L4Q A;  4FPB A;  1C6V A;  1R0A A;  5AR0 A;  1CZA N;  5HRN A;  1VSI A;  3P38 A;  3CQ8 A;  4M3T A;  3I8B A;  3H1V X;  4LF6 K;  3OYN A;  5C25 A;  4KHN A;  4JV5 K;  1KAZ A;  3U3G A;  3TAE A;  1HYZ A;  1Q9X A;  4Y1D A;  3V1R A;  1YJ9 N;  3KKS A;  4BAC A;  3VA3 A;  1RDD A;  1E4F T;  4CGI A;  3DOL A;  1Z6R A;  4X65 K;  4WF9 L;  4BRG A;  4IDK A;  3ZSX A;  4NLB A;  3SJH A;  5C2D A;  4CJK A;  4YOX A;  3HZ6 A;  2D0P A;  4DFJ A;  1BIS A;  4O5B A;  4ILG B;  3V4I A;  4H5W A;  4E3S A;  2Z1J A;  4MLH A;  2FXU A;  1YT3 A;  4HUF A;  5TKW A;  2YV0 X;  2HMP A;  4N76 A;  4BG9 A;  4CEF A;  2NRV A;  4BRI A;  1V4S A;  3CJ7 A;  2YNF A;  1SS6 A;  2IVO A;  5AJ3 K;  2ZJR L;  4BQL A;  3DAW A;  2OTJ N;  1IG9 A;  4RW6 A;  3I8D A;  3C94 A;  3CHW A;  5CZ2 A;  1TL1 A;  3F5T A;  2HHS A;  2NZT A;  1SAZ A;  2ASM A;  1BI4 A;  2DFF A;  4CHY A;  4J2B A;  4CZM A;  3OYJ A;  3VQE A;  3LDO A;  4B9N A;  1IH7 A;  3VEV A;  3S3N A;  3F9K A;  1LW2 A;  5J2P A;  3FR0 A;  5GAD P;  2H3G X;  5KTQ A;  1HMV A;  1S5J A;  4BC5 A;  1J9A A;  4IFV A;  3R8E A;  4CJW A;  2HVI A;  1C1C A;  4BC3 A;  1UA0 A;  3QIN A;  4LFC K;  1XMO K;  2OPR A;  4F2R A;  1KTQ A;  5IT9 O;  3T69 A;  2QEX N;  2G8K A;  4F9O A;  4ELV A;  3V6D A;  2NLX A;  4X64 K;  1EQY A;  3MWP A;  2A6A A;  1Q86 O;  1NK6 A;  4KB1 A;  1EP4 A;  4IKF A;  3DLL L;  3TAM A;  2QK9 A;  2KLA A;  4H03 B;  1OVQ A;  3RMD A;  3K5O A;  4FM0 A;  4JKB A;  4LSN A;  1UWB A;  4KRF A;  4CF8 A;  4W5N A;  4M63 C;  1JLQ A;  3MN5 A;  1LWC A;  3QB0 A;  2WON A;  3DLE A;  3NF9 A;  1J5E K;  4E7J A;  1S1X A;  3O3G A;  3HL8 A;  2E2Q A;  1VQ7 N;  4BR7 A;  1WSI A;  3ASM A;  3ZYY X;  2A1S A;  2XY6 A;  2I5J A;  4CZF A;  1MDU B;  3O8M A;  5F2R A;  3IFR A;  4XEI A;  3A5O C;  3SUP A;  3CCJ N;  2P1J A;  5IWA K;  5AQX A;  3DLK A;  4DS4 A;  3ULD A;  3FZL A;  4FLV A;  2ITM A;  1WSE A;  2YNH A;  3SMP A;  4BRH A;  1KRP A;  2HW3 A;  3DLR A;  3C6U A;  4DR1 K;  3QNO A;  4F2S A;  2P9S B;  3QO9 A;  4J2E A;  4B9M A;  2WFB A;  3AVG A;  2I7N A;  3K0S A;  1BO5 O;  1UOC A;  3PIP L;  3M5R A;  3MCP A;  3SUQ A;  1EO1 A;  3J7Y P;  3HSC A;  3OVN A;  1XUP O;  4PHT X;  4FZY A;  5BRF A;  4LF4 K;  3CJ1 A;  5KPR A;  3KD1 E;  4GW6 A;  4CJT A;  3OYD A;  3ENH A;  3MMV A;  4JK7 A;  5E26 A;  4CBU A;  1XHZ A;  4JAX A;  4C1N K;  3QEW A;  2HHW A;  1NGE A;  5AQU A;  2G8U A;  3VQ4 A;  3CPW M;  1O1W A;  1HKC A;  3VMF B;  2PZS A;  1WLJ A;  4U67 L;  3FLC O;  4FJG A;  1ZBS A;  2IIR A;  1IBM K;  5BN8 A;  4N5S A;  4FWO A;  4RW9 A;  1IKX A;  4AQY K;  3ENB A;  1C0M A;  4CD1 A;  2FF6 A;  4XH4 A;  5AQV A;  2QWQ A;  2QW9 A;  3KK1 A;  4M41 A;  2F4V K;  3DMJ A;  5MLC Q;  4H8K A;  4B1U B;  1WSG A;  2ZWH A;  3HVT A;  2Y1I A;  4FJM A;  2Q0U A;  1N8R O;  1B9F A;  3L2U A;  3B6P A;  4CF0 A;  3A5N C;  5KPT A;  2ETJ A;  3AA2 A;  3O1B A;  1RTJ A;  3IMX A;  4J8F A;  1VK0 A;  3V9S A;  1WUA A;  1RGI A;  3HVR A;  2OZM A;  3MEG A;  3VER A;  1KLM A;  2KKZ A;  4CJ3 A;  1JLG A;  3MAQ A;  5AFU H;  4H5R A;  2UXB K;  3I33 A;  4Z4E A;  2RPI A;  4GNI A;  2O8B B;  5KI6 A;  4CED A;  4DR2 K;  2NRZ A;  2KZM A;  2OTL N;  4JI0 K;  2D0A A;  3THX A;  2PY5 A;  4NCG A;  2ATQ A;  4CJE A;  4CZK A;  3EE9 A;  5FPE A;  4CZE A;  3OYM A;  5FRN A;  4DSJ A;  3I0R A;  3W0L A;  3QIO A;  1BDG A;  3VF4 A;  2BE2 A;  2AP1 A;  1XC9 A;  4EAH D;  2VCP A;  3E66 A;  3PO4 A;  5AQN A;  2F8T A;  1ZBU A;  2E88 A;  1SV5 A;  2IOC A;  3VEY A;  3QEX A;  1DEJ A;  3VES A;  4H0T B;  3SZ2 A;  1QQM A;  4FJX A;  3SUO A;  4JD2 B;  1T03 A;  4A5A A;  3EO3 A;  5D3G A;  4YY3 K;  1WB9 A;  3DXM A;  4C1N I;  3JS6 A;  1ITG A;  3TAF A;  3HBT A;  5M1K A;  3MK6 A;  4FWK A;  3HI0 A;  3ALY A;  1VQL N;  1RDA A;  1NJI O;  1HRH A;  4B08 A;  4BRD A;  1NGG A;  2VG7 A;  4HWI A;  3SQ2 A;  4KAZ A;  3ZSV A;  3E9P A;  4IFY A;  4CJS A;  2IDO A;  3VGK A;  3VQB A;  4BR9 A;  3ITH A;  4FJ9 A;  3NF8 A;  1GOB A;  2CH5 A;  4GKK K;  1VQM N;  3LL3 A;  3SQ4 A;  1NK9 A;  1EXQ A;  3CFO A;  2ASP A;  3ULE B;  3O5B A;  3LPU A;  2YHY A;  1L3S A;  2IGI A;  1VSF A;  4FWQ A;  1RBU A;  1HUX A;  3C7N A;  4LF7 K;  1VQ8 N;  1VQP N;  3UE5 A;  1LV5 A;  1FXX A;  1CXU A;  5KRT A;  3BGR A;  4E7L A;  4KO0 A;  1HNX K;  4FL9 A;  2HBL A;  4H5V A;  3K9J A;  4DSF A;  1YIJ N;  4EHU A;  4WFN L;  4DV3 K;  4AH9 A;  3H3N O;  1HNV A;  4B9S A;  3KK3 A;  4M3R A;  1QZ6 A;  3LM2 A;  1BIU A;  4DUY K;  1P8Z A;  1IG8 A;  4FLX A;  5GAE P;  5DMR A;  3V9U A;  3C6H A;  1EWR A;  3CM6 A;  2B6A A;  1LAV A;  2GWK A;  3SBT A;  1SUQ A;  4ISG A;  3EKS A;  4B1X B;  4CEQ A;  2O8D B;  1HJR A;  2P9K B;  3CD6 N;  1F21 A;  4FJK A;  3HYF A;  2OAN A;  5AQJ A;  2O8E A;  2WTU A;  4DR7 K;  3K57 A;  3DWL A;  4YHH K;  1TGO A;  4F3O A;  2D5R A;  3P83 D;  1FW6 A;  4B3O A;  1TKZ A;  1CZ9 A;  1MWM A;  5AQK A;  3KVG A;  3RMB A;  2E2P A;  1VSL A;  2BGG A;  4V19 S;  1X3N A;  1KFD A;  4PKH A;  4RG8 A;  5KPZ A;  3OYG A;  3O9Q A;  3OYL A;  3SYZ A;  2VWB A;  3EZW A;  3G25 A;  4A59 A;  5KGX A;  2GUI A;  3O9S A;  3AY9 A;  2DTU A;  3WT0 A;  2JGU A;  4WE1 A;  4KHU A;  3AA3 A;  3EKU A;  1XHX A;  3V9Z A;  4JS4 A;  5SZT A;  3THW A;  5AQF A;  4KPY A;  1VQ9 N;  4KH4 A;  3EEQ A;  1CXQ A;  5I9E B;  4HTL A;  1IKW A;  4WFA L;  1QQC A;  3U3Y A;  1W7A A;  3OYF A;  1A5V A;  3CIP A;  3L2R A;  3FZF A;  1U2V A;  3CG7 A;  1Z26 A;  3H45 C;  3VEX A;  4HVJ A;  4DFK A;  3THY A;  3M8S A;  1NOZ A;  3OJS A;  3SBG A;  3RSE B;  4HUE A;  4DSK A;  5JS1 A;  3ZT0 A;  4LF5 K;  3LDN A;  3VEO A;  4OPH A;  3VQ7 A;  3WXL A;  1Z05 A;  3ZSR A;  1NKC A;  3RTV A;  5M1Q A;  3VQA A;  3KLF A;  2VYP A;  4QAG A;  3DYA A;  2Z1H A;  4B1Y B;  1HR0 K;  2A5X A;  3VQC A;  4AHU A;  4B9Q A;  3AAQ A;  3LP0 A;  4IDH A;  5J2M A;  1T8E A;  5C15 A;  4AHV A;  1NGC A;  1YXQ A;  4BRE A;  4ILH A;  3PX4 A;  3N4P A;  1NK0 A;  3ENO A;  4H0V B;  4K42 A;  4FW1 A;  3HM9 A;  4I7F A;  3S3M A;  2E4L A;  3K59 A;  2UU9 K;  1RBV A;  3IG1 A;  3KZB A;  1Q7Y O;  3I55 N;  3KLG A;  3HRG A;  3A2F A;  1D5A A;  3MN7 A;  4Y1C A;  5HRO A;  2IVP A;  3PSF A;  4LH5 A;  4FJH A;  4RTF D;  5ADX H;  1YUW A;  5CHI A;  3DLH A;  4B1Z A;  4U7B A;  2CGK A;  2YNI A;  2AA4 A;  3CCR N;  4OKJ A;  4JHD A;  1SQK A;  3WXI A;  4BC4 A;  4CHO A;  2RKI A;  1C0F A;  4BVP A;  4ISF A;  5BPM A;  4BVO A;  3MDQ A;  5C2F A;  4R79 A;  4KHY A;  3S3O A;  4JK8 A;  5FRM A;  3Q7B A;  4CEO A;  1TK0 A;  2A3Z A;  2VQE K;  1ASU A;  3KWG A;  3P5J A;  4AHS A;  4AM7 A;  4C8O A;  4KB0 A;  1C0G A;  3VF6 A;  4KHP K;  1YTA A;  4Y0W A;  1ZBI A;  1ATS A;  3WXM B;  2W6L A;  5AQL A;  3D2E B;  4BR4 A;  3OYB A;  3EZ5 A;  4LY7 A;  1NWK A;  3NF6 A;  1SKS A;  3LZI A;  3VA0 A;  1W97 L;  3CJA A;  4O5F A;  4JKG A;  4CEB A;  4OGE A;  1WSF A;  4PA1 A;  2P9L A;  4Z4G A;  4BRM A;  2HHQ A;  1FKP A;  4CK3 A;  3H3O B;  4FJN A;  3QEI A;  2QWP A;  3AAR A;  3QDK A;  1RBT A;  1HX1 A;  4MDB A;  3A8Y A;  2VQF K;  3WNG A;  1IKY A;  3LZJ A;  3AO3 A;  4DHY A;  4DV5 K;  1D9F A;  4CHQ A;  2E1Z A;  3HP9 A;  1VHX A;  1JXB A;  4DQQ A;  1A5W A;  4FK4 A;  3RRH A;  4I2P A;  2YJF A;  2OPS A;  5E41 A;  3J81 O;  1DTQ A;  4DF8 A;  3T1Y K;  1G15 A;  3CCE N;  1W2B M;  3F2K A;  1X3M A;  2QWR A;  2VWK A;  4CI6 A;  4FJL A;  3U4L A;  3SUN A;  1SL1 A;  3HPH A;  4IJN A;  2J4R A;  4DTJ A;  4KHQ A;  1IKV A;  4OJR A;  3OYA A;  4JNE A;  1SL0 A;  3MCA B;  4OKK A;  4CW7 B;  1NJW A;  4LFB K;  3PUF A;  3H1Q A;  4FM1 A;  4Z4C A;  3AVI A;  4FWP A;  3CQX A;  1NGH A;  2BUP A;  2W42 A;  2KZZ A;  1GLE G;  2QTD A;  1LCU A;  1LOT B;  2F7T A;  5M1N A;  3SAH A;  1QE1 A;  2JLE A;  5A2Q O;  4C23 A;  3F73 A;  1S9E A;  4ELT A;  1QZ5 A;  1BGX T;  1E4G T;  3D2E A;  4CF9 A;  4IO8 A;  1GLB G;  4O8U A;  2P5O A;  5JLH A;  4FK0 A;  5AQZ A;  3SPY A;  3KD5 E;  3QIP A;  5AQY A;  1JLF A;  5I3U A;  2HF3 A;  3WUH A;  2VG6 A;  2NRH A;  2ZE2 A;  1X9S A;  1RT4 A;  3EL2 A;  4ELU A;  3NGY A;  2Q31 A;  5HRR A;  3ZSY A;  2O8E B;  3IDH A;  3LDL A;  2X6S A;  4JKD A;  3W3D A;  3CJC A;  3K2P A;  3CXC M;  3AVH A;  3RWU A;  4E1N A;  5LY3 A;  4L8R B;  4DQ8 A;  3TU5 A;  4E7H A;  3UKU B;  2QWL A;  1RT2 A;  4FZX C;  3OS0 A;  3C7N B;  4AF1 A;  4CF2 A;  3AVA A;  1GLC G;  1KAX A;  3WNF A;  4HTU A;  2W40 A;  1VSK A;  4K41 A;  4B3T K;  3CF5 L;  4FPA A;  3N4Q A;  4BDP A;  4B9V A;  3AVN A;  3THV A;  1OH6 A;  1HQU A;  4IEE A;  4W5O A;  4DSI A;  3TTD A;  3WXK A;  2YCH A;  2CGJ A;  2YKN A;  4ID1 A;  3LDQ A;  1JLB A;  1EKE A;  4WQ5 C;  4IXC A;  3LAL A;  4LF8 K;  1OH8 A;  1QVF M;  3PX6 A;  3A5M C;  2V7Y A;  3SAG A;  4H0O A;  1YVU A;  4LFA K;  1IV0 A;  4KH5 A;  3QLH A;  3L2W A;  4B8A B;  1S1W A;  5DK5 A;  3ZX0 A;  3AVF A;  2IS3 A;  1NGA A;  2P51 A;  3D7E O;  5CR4 A;  1CZB A;  5GIN A;  4M3Y A;  2Q1N A;  3VQ9 A;  4DU3 A;  2FLO A;  4GMJ B;  3U8X A;  3OBY A;  4AIL C;  3AVB A;  3QIC A;  3V81 A;  2O8C A;  4I6M A;  3NMU A;  1U6Z A;  3L3V A;  3L8B A;  1NGB A;  1RT7 A;  3LWM A;  4FO0 A;  4CZJ A;  5JLF A;  3WEE A;  2V52 B;  2O4G A;  1BQN A;  1GOC A;  1UAX A;  4DF4 A;  4WFB L;  5EXW A;  4PKI A;  4E89 A;  4DQP A;  1WSH A;  4GV6 A;  3G71 N;  1IBK K;  3C6T A;  5LMU K;  2ZJQ L;  4KFB A;  4M3W A;  4W5R A;  3LAN A;  2YHB A;  3MEE A;  3FZM A;  4MDA A;  1NK4 A;  3J7A P;  3DOK A;  4B1W B;  2E2O A;  3EYZ A;  1KVB A;  4JS5 A;  1K73 O;  2UXC K;  3OYI A;  3CFR A;  1YF5 L;  4DV7 K;  5I42 A;  2GX9 A;  2JWL A;  1J5O A;  5M1F A;  4QCL A;  3TAN A;  1Y97 A;  3O3H A;  1VAZ A;  4BDZ A;  3VEN A;  3KTQ A;  1YHQ N;  1YJN N;  2WOM A;  3HPG A;  4FYD A;  4DS5 A;  2Q36 A;  4CJU A;  2P9I A;  3MXJ A;  4KKO A;  4EZ9 A;  4WYB A;  3SCX A;  1YI2 N;  1BG3 A;  5C0Y A;  3HM8 A;  1JCG A;  4JI7 K;  2FSN A;  3S9H A;  4JEP A;  4PL7 A;  1K8A O;  1T44 A;  3VOV A;  4BRA A;  1BHL A;  5JMV A;  3SQ1 A;  3ATV A;  3LP2 A;  1TUU A;  3PO5 A;  4PY5 A;  4KHW A;  2E5L K;  2DY4 A;  5AQT A;  4BDY A;  2ZF5 O;  1TK5 A;  1K9M O;  3ZSW A;  4AHT A;  3KLI A;  3OY9 A;  4CK1 A;  4FLU A;  3VGL A;  4H4M A;  3TAP A;  4FLY A;  1KD1 O;  2GBZ A;  2VWJ A;  1NK5 A;  2P5G A;  4R5P A;  2LSN A;  3AO4 A;  3F9M A;  1BU6 O;  1OH5 A;  1HYS A;  5AQG A;  3HPO A;  4DCH A;  4B9U A;  4JI8 K;  3BDP A;  3B6O A;  1Z25 A;  1BCO A;  1Q9Y A;  4ID5 A;  2ZD1 A;  3IS9 A;  4GKJ K;  3CC7 N;  1DLO A;  3V9X A;  3IAY A;  1GLA G;  2IVN A;  4CER A;  3J7Z O;  3THX B;  2HF4 A;  3ZSZ A;  1U45 A;  5EOY A;  4K0K K;  4BQZ A;  3AAP A;  1RT3 A;  4CD3 A;  4XIU A;  5GIP A;  1J53 A;  4CFC A;  5KGW A;  1KC8 O;  4JI6 K;  1JL1 A;  2QA4 N;  3ULE A;  1Q82 O;  3D2F B;  4DLE A;  4NCA A;  3V9W A;  3I0S A;  1NKE A;  1VSE A;  4J2D A;  4FLZ A;  3GBT A;  3ZET B;  1J6Z A;  4DMN A;  3E9O A;  3E01 A;  3R9P A;  4M7Y A;  1KVC A;  1NK7 A;  1BIZ A;  1TKD A;  3T3F A;  5BN9 A;  3VET A;  3LWL A;  4F4K A;  2P9N A;  3O9U A;  3LAM A;  3MEC A;  3O08 A;  3BP8 A;  4X66 K;  1NK8 A;  4NYF A;  3KLE A;  3VTH A;  3PY8 A;  4E7I A;  2VGM A;  3TI0 A;  4BR2 A;  4K43 A;  4M3U A;  5AZI A;  4WCE L;  5J1E A;  1Y64 A;  3WXJ A;  4CGD A;  4JHD B;  5KQ8 A;  2PBD A;  1R59 O;  2HHT A;  4KI4 A;  1SZ2 A;  4CJ4 A;  2RE2 A;  3AVM A;  4RWT A;  1GOA A;  4LF9 K;  1KAY A;  3CME N;  1LWE A;  4IBN A;  4ZTJ A;  4IFE A;  1ASV A;  2NRT A;  4YOY A;  1RT6 A;  1TK8 A;  4CGJ A;  4EIA A;  2NRW A;  2A41 A;  1L3V A;  2NRX A;  4M3Z A;  1Q8I A;  3BZK A;  4JKH A;  4MO5 A;  4CIE A;  1NBW A;  2X74 A;  3EE8 A;  4CJR A;  2F8S A;  3SMS A;  1U4B A;  1I3A A;  4C8L A;  3C65 A;  2QKB A;  1YJW N;  2G8F A;  4EFH A;  3VQ5 A;  2O8F A;  5ADX A;  2FBX A;  5AQH A;  3L0Q A;  3RVC A;  4DV0 K;  5AQQ A;  3SNN A;  4JLH A;  1KVA A;  3QNN A;  1BA1 A;  4FLT A;  1TUY A;  3WQU A;  3CFP A;  3P31 A;  3WNE A;  3CET A;  3ZSO A;  3D0P A;  1LW0 A;  1NU0 A;  3K5M A;  1T6D A;  2JWK A;  3PX0 A;  3MXI A;  3Q7C A;  1WAF A;  4DTS A;  4N41 A;  4H0Y B;  4DTM A;  1QSL A;  3LP3 A;  3M6G A;  2HNY A;  3ID6 A;  5FPN A;  3SV4 A;  1RDC A;  5JVG L;  4ZHR A;  4BR5 A;  5AQO A;  5HP1 A;  5C24 A;  1HPZ A;  2YNG A;  4X62 K;  1SKR A;  1JLE A;  2QXL A;  3EY1 A;  1RTD A;  3MX5 A;  1HNW K;  4I6M B;  1XNQ K;  2Z1G A;  2FSJ A;  1T05 A;  5CY4 A;  2PAV A;  4BRF A;  4ICL A;  1NLV A;  2XY8 A;  3ZX3 A;  4BWM A;  3L2Q A;  4CHN A;  2VGN A;  1HQE A;  3HOT A;  4H4O A;  3QEP A;  1MA9 B;  2A42 A;  5DM7 L;  3AVC A;  5FRO A;  3U9D A;  5EVZ A;  4F3T A;  4FVM A;  4JRQ A;  3VEW A;  3IKM A;  2QM1 A;  4OGC A;  3TTC A;  5LMN K;  3GOI A;  1QTM A;  4OPA A;  3H6E A;  3SLC A;  4CF1 A;  1SKW A;  4Z4I A;  2BDP A;  5GIO A;  2O8F B;  4DG1 A;  4OPK A;  1BL3 A;  2P9P B;  4WQ4 C;  5BRH A;  2P9P A;  2G8I A;  4A57 A;  3QET A;  2WC9 A;  3VQD A;  3M8R A;  3C95 A;  2YI1 A;  1WOQ A;  3WNH A;  4CJV A;  3C0B A;  4B8C A;  5ELZ A;  5KQD A;  3NGZ A;  4JI4 K;  4I2Q A;  3K58 A;  4HCC A;  4FK2 A;  1ATR A;  4JRP A;  1DT9 A;  3R1X A;  4DV6 K;  2O8D A;  3D2F A;  3BF1 A;  4CHP A;  2UYT A;  1U2V B;  4CFA A;  1K6Y A;  2KHO A;  3OYH A;  2QWN A;  1RTH A;  4PQU A;  4DFP A;  2A1R A;  2XY7 A;  1CLQ A;  4O0J A;  1UA1 A;  4Z4H A;  1NKB A;  2HMI A;  3G6E N;  1VRT A;  3HJF A;  2UUA K;  4FXD A;  3RR8 A;  1GLJ O;  1S1U A;  3FFI A;  1BCM A;  4FLW A;  3KHY A;  4BRC A;  3G10 A;  4YOV A;  3CM5 A;  5M1P A;  3AGR A;  3DLG A;  3G0Z A;  1YAG A;  3DLB A;  2YHX A;  2P9U A;  3KKR A;  1VSM A;  1NM1 A;  4FOE A;  4CJQ A;  1FK9 A;  4BRK A;  3AA5 X;  4Q5V A;  2QWO A;  3C6A A;  1IJJ A;  3SV3 A;  2GTD A;  4HCB A;  2EWS A;  3QML A;  2DFH A;  2P9N B;  4BR0 A;  3HTV A;  4GVE A;  3VTI A;  3H08 A;  1P90 A;  4RW7 A;  1HPM A;  4FJ7 A;  1IBL K;  3TSQ A;  1BI4 B;  4JN4 A;  4CBW A;  4E0D A;  4LC9 B;  2HBM A;  4N47 A;  3AVK A;  2OPQ A;  2F96 A;  5F0X A;  3GDQ A;  1B92 A;  4EZ6 A;  3P4I A;  3O9T A;  4K25 A;  5BPL A;  1JLC A;  3KJV A;  3M8P A;  1XWL A;  4DQR A;  4CHZ A;  4BRN A;  1BWF O;  2ASO A;  3JYT A;  2IAJ A;  3SJJ A;  4CIF A;  1J54 A;  1T7P A;  1EX4 A;  1C0U A;  4M45 A;  5LL6 Z;  3ZX2 A;  3VQ6 A;  5FDL A;  4W5T A;  3LPT A;  4LH4 A;  4FVU A;  2BTF A;  4BE0 A;  2XHB A;  5BR9 A;  1FJG K;  3AO1 A;  3MWT A;  5AQS A;  5HLF A;  4PWD A;  4NCB A;  2PYJ A;  3P39 A;  1NGF A;  4M3X A;  1RNH A;  2OPP A;  4E1J A;  3UIQ A;  2FBV A;  1ASW A;  1I39 A;  4CFD A;  1K8K A;  4A2A A;  4IO9 L;  1WBD A;  2FC0 A;  3GL1 A;  5LJW A;  4NYN A;  1N6Q A;  1M1K O;  4OLB A;  2NUB A;  4NLC A;  4OLA A;  3T7Z A;  4NO7 A;  1TL3 A;  5AQM A;  2Q2R A;  4BRL A;  1JCF A;  1RBS A;  3CCV N;  4DR4 K;  1JLA A;  1RTI A;  3OW2 M;  3K5N A;  4CJ5 A;  4B3M K;  4FWS A;  3ZSQ A;  2VG5 A;  1RT5 A;  3ZEU A;  1QS4 A;  4N56 A;  3UB5 A;  3OS2 A;  4MO4 A;  3TWH A;  4JKA A;  5HBM A;  1VSH A;  3BUZ B;  4FJJ A;  3FE1 A;  2HVH A;  1ILY A;  4IG0 A;  3TAG A;  3M1F A;  3RMA A;  3D45 A;  4FW2 A;  4KHS A;  1RCH A;  2P9K A;  2WBN A;  1VRU A;  4CJ7 A;  1VSJ A;  3OYK A;  4IOX A;  1KLN A;  2EX3 A;  3I56 N;  2X78 A;  4DQI A;  4B1V A;  3FZH A;  2RHK A;  1OH7 A;  2BAN A;  4E1M A;  2D1K A;  5EY4 A;  2XY5 A;  4O44 A;  4W5Q A;  4DWI A;  2FBT A;  4FWR A;  5EU7 A;  3NH0 A;  4DTN A;  4RW8 A;  4YOW A;  4XH5 A;  3J80 O;  1X9J A;  2E6L A;  2NNW A;  1ZXO A;  2D0C A;  3EN9 A;  5AFU A;  2HHU A;  3LAK A;  3L4I A;  3KLH A;  3BEX A;  2V7Z A;  1NJX A;  3QER A;  3M3Z A;  1TVR A;  1N33 K;  1KSP A;  4BGB A; 
#chains in the Genus database with same CATH homology
 1BIU A;  4FLX A;  4ZTF A;  3RMC A;  4CEZ A;  3S9H A;  4G1Q A;  1BHL A;  1JXE A;  5DMR A;  4BE1 A;  3SQ1 A;  3LP2 A;  3PO5 A;  3V9U A;  4DTO A;  1REV A;  4PY5 A;  3CM6 A;  4KHW A;  2DY4 A;  2B6A A;  1X1P A;  1KCF A;  1LAV A;  1SUQ A;  1MU2 A;  4BDY A;  2HNZ A;  1TK5 A;  4DTP A;  4CEQ A;  4F8R A;  1HJR A;  4FJ8 A;  4LSL A;  1D8Y A;  3ZSW A;  3OJU A;  1U04 A;  2O4I A;  1F21 A;  4AHT A;  3DRS A;  3CYM A;  3KLI A;  3HYF A;  4FJK A;  3OY9 A;  2GV9 A;  4CK1 A;  4FLU A;  4C8N A;  1ZBF A;  4DTX A;  2G8W A;  3K57 A;  4EP5 A;  4E19 A;  4BWJ A;  3PV8 A;  4H4M A;  3TAP A;  4OKE A;  4CGH A;  3DRP A;  1TGO A;  4FLY A;  1TKT A;  1X9W A;  4DU1 A;  3SQ0 A;  4F3O A;  2KFZ A;  2D5R A;  3P83 D;  4BE2 A;  4HUG A;  3KIO A;  2ZQB A;  4B3O A;  1TKZ A;  1CZ9 A;  4OPJ A;  2GBZ A;  2Y1J A;  3RMB A;  2VWJ A;  1NK5 A;  2P5G A;  1VSL A;  2BGG A;  4R5P A;  2LSN A;  3AO4 A;  2OA8 A;  1RIL A;  1HYS A;  1KFD A;  1VSD A;  4RG8 A;  3HPO A;  2KW4 A;  3OYG A;  4B9U A;  2OZS A;  3BDP A;  3B6O A;  1Z25 A;  3OYL A;  1BCO A;  2DFE A;  4CIG A;  3SYZ A;  1N5Y A;  1DTT A;  3DRR A;  3AO2 A;  5KGX A;  4ID5 A;  1Q9Y A;  2ZD1 A;  2GUI A;  3IS9 A;  3NCI A;  2G8V A;  5KRS A;  1NJY A;  3TAQ A;  1JL2 A;  4DU4 A;  3AO5 A;  1TAU A;  1C6V A;  1R0A A;  1DLO A;  3V9X A;  3IAY A;  2DTU A;  4CER A;  1VSI A;  2JGU A;  5HRN A;  3CQ8 A;  4M3T A;  4WE1 A;  4KHN A;  3ZSZ A;  5C25 A;  3OYN A;  1U45 A;  4KHU A;  3AA3 A;  1XHX A;  3V9Z A;  1RT3 A;  1WSJ A;  3U3G A;  4JS4 A;  1HYZ A;  4XIU A;  5SZT A;  3TAE A;  4Y1D A;  1Q9X A;  4KPY A;  1J53 A;  4CFC A;  5KGW A;  3V1R A;  1YTU A;  1CXQ A;  1JL1 A;  1IKW A;  3KKS A;  4BAC A;  3OYE A;  3VA3 A;  1QQC A;  1RDD A;  4CGI A;  4DLE A;  3U3Y A;  4NCA A;  3V9W A;  1EET A;  3TAR A;  3OYF A;  3DOL A;  1A5X A;  1A5V A;  3I0S A;  3VQ8 A;  3L2R A;  4DTU A;  1NKE A;  1VSE A;  4IDK A;  4O4G A;  3ZSX A;  4CJK A;  4J2D A;  3IRX A;  3ZT4 A;  4FLZ A;  3CG7 A;  4DFJ A;  1Z26 A;  1BIS A;  4O5B A;  4DMN A;  1L3T A;  4HVJ A;  4DFK A;  3V4I A;  4E3S A;  3E01 A;  2Z1J A;  3M8S A;  1NOZ A;  1YT3 A;  1ZBL A;  1NJZ A;  3OJS A;  4HUF A;  4HUE A;  4CCH A;  2YV0 X;  4DSK A;  4N76 A;  1KVC A;  3ZT0 A;  5JS1 A;  1NK7 A;  4Z4F A;  1BIZ A;  1TKD A;  4CEF A;  3T3F A;  3LWL A;  4F4K A;  4FJ5 A;  3VQ7 A;  3QEV A;  4C8M A;  4M42 A;  3ZSR A;  2YNF A;  3LAM A;  3MED A;  3T1A A;  3MEC A;  1NKC A;  3RTV A;  3VQA A;  4KTQ A;  3KLF A;  1NK8 A;  4NYF A;  4QAG A;  1IG9 A;  3QES A;  3DYA A;  3KLE A;  4RW6 A;  2Z1H A;  3I8D A;  3PY8 A;  3C94 A;  4E7I A;  4Q0B A;  4I9L A;  3VQC A;  4AHU A;  3TI0 A;  5CZ2 A;  1TL1 A;  3LP0 A;  5J2M A;  1T8E A;  5J1E A;  4M3U A;  4OVL A;  4CE9 A;  4AHV A;  1KFS A;  4B9N A;  4CGD A;  2HHS A;  3JSM A;  3NGI A;  1BI4 A;  2DFF A;  4CHY A;  3PX4 A;  2HHT A;  4KI4 A;  4CJ4 A;  1NK0 A;  3AVM A;  4J2B A;  3T19 A;  3L2V A;  1HYV A;  3OYJ A;  3VQE A;  4FW1 A;  1GOA A;  2D0B A;  4I7F A;  3VQP A;  5CYQ A;  2E4L A;  3ZT1 A;  3M8Q A;  1IH7 A;  3HM9 A;  3K59 A;  3S3M A;  3S3N A;  1LWE A;  4IBN A;  4ZTJ A;  3F9K A;  4GVM A;  1LW2 A;  1S1V A;  4FM2 A;  1RBV A;  1ASV A;  5J2P A;  3IG1 A;  5KTQ A;  1BQM A;  1RT6 A;  1TK8 A;  4CGJ A;  1HMV A;  2B5J A;  3KLG A;  4E7K A;  3VQQ A;  2E6M A;  3A2F A;  1D5A A;  4Y1C A;  5HRO A;  1S5J A;  1L3V A;  4LH5 A;  4M3Z A;  4FJH A;  1Q8I A;  1J9A A;  4IFV A;  3DLH A;  3HK2 A;  4CIE A;  2YNI A;  4CJW A;  4PUO A;  2X74 A;  4OKJ A;  2HVI A;  2F8S A;  1C1C A;  4CJR A;  4CHO A;  2RKI A;  3NHG A;  1UA0 A;  1U4B A;  1U47 A;  3QIN A;  1I3A A;  4KTW A;  2OPR A;  4C8L A;  4KV8 A;  4F2R A;  2QKB A;  3AV9 A;  1KTQ A;  2G8F A;  3VQ5 A;  4KHY A;  2FBX A;  3S3O A;  2G8K A;  5FRM A;  4ELV A;  4CEO A;  3SNN A;  4JLH A;  1KVA A;  3QNN A;  3V6D A;  4MFB A;  1TK0 A;  4CES A;  4FLT A;  1NK6 A;  4K8X A;  4KB1 A;  1EP4 A;  1SL2 A;  3CFP A;  4IKF A;  1ASU A;  3WNE A;  1NOY A;  3TAM A;  1S6Q A;  2QK9 A;  3P5J A;  3ZSO A;  4AHS A;  3RMD A;  3NF7 A;  3D0P A;  1LW0 A;  3K5O A;  3K5M A;  3MXI A;  4FM0 A;  3PX0 A;  4C8O A;  4KB0 A;  1WAF A;  4DTS A;  3ZT3 A;  4N41 A;  2AJQ A;  4LSN A;  4DTM A;  1QSL A;  1UWB A;  4KRF A;  2RF2 A;  4CF8 A;  1YTA A;  4W5N A;  3LP3 A;  1JLQ A;  1S6P A;  3SI6 A;  2HNY A;  1ZBI A;  1LWC A;  2KTQ A;  1C1A A;  2HND A;  3SV4 A;  5SWM A;  5HRP A;  2WON A;  3DLE A;  1L5U A;  3NF9 A;  3RR7 A;  1RDC A;  4DSE A;  3OYB A;  3EZ5 A;  4E7J A;  1S1X A;  4LY7 A;  3O3G A;  3HL8 A;  2PYL A;  4ZHR A;  3HT3 A;  1W9H A;  3NF6 A;  5HP1 A;  5C24 A;  1SKS A;  1WSI A;  3ASM A;  3LZI A;  5CYM A;  3VA0 A;  1HPZ A;  3RRG A;  2YNG A;  4CEB A;  1SKR A;  2A1S A;  4OGE A;  1LWF A;  1JLE A;  1WSF A;  4PA1 A;  4AHR A;  3EY1 A;  2I5J A;  4FCY A;  2XY6 A;  1RTD A;  4Z4G A;  2HHQ A;  1FKP A;  4CK3 A;  3NAE A;  3SUP A;  2Z1G A;  4FJN A;  1T05 A;  2P1J A;  5CY4 A;  3QEI A;  3V1O A;  3DM2 A;  1RBT A;  3SPZ A;  3DLK A;  4ICL A;  2HHV A;  2XY8 A;  4CFB A;  3ULD A;  4DS4 A;  2R7Y A;  4KTZ A;  4BWM A;  3L2Q A;  4CHN A;  3O4Q A;  1HQE A;  3WNG A;  4FLV A;  1IKY A;  1QHT A;  3LZJ A;  3DI6 A;  3AO3 A;  1WSE A;  2YNH A;  1D9F A;  1KRP A;  2HW3 A;  4H4O A;  4CHQ A;  3DLR A;  3QEP A;  1U49 A;  2KQ2 A;  3AVC A;  3C6U A;  5FRO A;  3HP9 A;  3QNO A;  3HO1 A;  4UQG A;  4I9Q A;  4F2S A;  3AA4 A;  4DQS A;  2G8H A;  3K5L A;  1JXB A;  4F3T A;  4DQQ A;  3ISN C;  1A5W A;  3NFA A;  4FVM A;  4JRQ A;  3RRH A;  4I2P A;  3QO9 A;  4J2E A;  4FK4 A;  2OPS A;  4B9M A;  4OGC A;  4DFM A;  3AVG A;  5E41 A;  1QTM A;  1C1B A;  1DTQ A;  4DF8 A;  1UOC A;  1G15 A;  4CF1 A;  2VWK A;  1SKW A;  4FJL A;  3SUN A;  1SL1 A;  3HPH A;  4KHQ A;  4DTJ A;  4Z4I A;  3SUQ A;  2BDP A;  1IKV A;  3OVN A;  4OJR A;  3OYA A;  1SL0 A;  4DG1 A;  4OPK A;  1BL3 A;  4FZY A;  2G8I A;  4OKK A;  3OYC A;  1HNI A;  3QET A;  3KD1 E;  3TAB A;  4GW6 A;  3VQD A;  1NJW A;  1QSS A;  2ITG A;  4CJT A;  3M8R A;  2QXF A;  3C95 A;  3PUF A;  1RBR A;  3OYD A;  4CJP A;  4Z4C A;  4FM1 A;  3AVI A;  2W42 A;  2KZZ A;  3WNH A;  4CJV A;  1XHZ A;  4B8C A;  3NGZ A;  1FKO A;  3K58 A;  4I2Q A;  3AVJ A;  4HCC A;  4FK2 A;  3QEW A;  4JRP A;  2HHW A;  1B9D A;  2G8U A;  4CHP A;  1QE1 A;  3VQ4 A;  2JLE A;  1O1W A;  4CFA A;  1K6Y A;  1S9E A;  3F73 A;  2PZS A;  1WLJ A;  1TV6 A;  4B9T A;  1BGX T;  3OYH A;  4ELT A;  1RTH A;  4FJG A;  4DFP A;  4PQU A;  2A1R A;  2XY7 A;  1CLQ A;  4O0J A;  5JS2 A;  4CF9 A;  1UA1 A;  2P5O A;  4Z4H A;  4RW4 A;  1NKB A;  2XRI A;  2HMI A;  4DSL A;  4N5S A;  1RDB A;  1VRT A;  4RW9 A;  1IKX A;  3NDK A;  3HJF A;  4FK0 A;  4FXD A;  4CJF A;  3RR8 A;  1C0M A;  2IC3 A;  1S1U A;  3FFI A;  1BCM A;  4FLW A;  3QIP A;  3SPY A;  3KD5 E;  3G10 A;  1JLF A;  5I3U A;  2RN2 A;  3CM5 A;  4FZZ A;  5CZ1 A;  5C42 A;  1S1T A;  1WAJ A;  3O3F A;  2VG6 A;  3DLG A;  3KK1 A;  3G0Z A;  3O4N A;  4M41 A;  2ZE2 A;  3DMJ A;  1X9S A;  1X9M A;  3KKR A;  4H8K A;  1RT4 A;  3DLB A;  2Y1I A;  1WSG A;  3HVT A;  4FJM A;  1VSM A;  4ELU A;  4CJQ A;  1FK9 A;  3NGY A;  4DLG A;  5HRR A;  1B9F A;  3AA5 X;  3ZSY A;  2QKK A;  4Q5V A;  4O55 A;  3B6P A;  3L2U A;  4CF0 A;  3NH1 A;  2Z1I A;  1TKX A;  2X6S A;  3SV3 A;  2ETJ A;  3K2P A;  3AVH A;  3AA2 A;  3RWU A;  4E1N A;  2DFH A;  5K14 A;  4HCB A;  1RTJ A;  1IO2 A;  4L8R B;  5T7B A;  4E7H A;  3H08 A;  1VK0 A;  4J2A A;  3V9S A;  1RT2 A;  4RW7 A;  4KI6 A;  1TAQ A;  4FZX C;  4FJ7 A;  3OS0 A;  3HVR A;  1BI4 B;  2OZM A;  4CF2 A;  3P1G A;  3AVA A;  3LDS A;  3MEG A;  4E0D A;  1KLM A;  3ZT2 A;  4CJ3 A;  3WNF A;  1JLG A;  4TSX A;  1VSK A;  3MAQ A;  4HTU A;  4C8K A;  4N47 A;  3AVK A;  2OPQ A;  4Z4E A;  2RPI A;  2F96 A;  4BDP A;  4B9V A;  1B92 A;  4EZ6 A;  3AVN A;  4B9L A;  4O0I A;  1JLC A;  4YNQ A;  3THV A;  2HB5 A;  4CJL A;  3KJV A;  5KI6 A;  3M8P A;  1XWL A;  3HP6 A;  4CED A;  4DQR A;  1HQU A;  4CHZ A;  3KK2 A;  1ZBH A;  2KZM A;  4W5O A;  3JYT A;  2D0A A;  2IAJ A;  4DSI A;  3SJJ A;  4CIF A;  1XI1 A;  1J54 A;  1T7P A;  2PY5 A;  1EX4 A;  1C0U A;  2YKN A;  4M45 A;  4NCG A;  2ATQ A;  4CJE A;  3VQ6 A;  4ID1 A;  5FDL A;  4W5T A;  3LPT A;  2KFN A;  4LH4 A;  1JLB A;  1EKE A;  4BE0 A;  2XHB A;  3OYM A;  5FRN A;  4DSJ A;  3AO1 A;  3I0R A;  3AVL A;  3QIO A;  3TR8 A;  3LAL A;  5HLF A;  4NCB A;  3OS1 A;  4PWD A;  2BE2 A;  2PYJ A;  5HRS A;  1XC9 A;  4MQ3 A;  3PO4 A;  4M3X A;  2B4J A;  2F8T A;  1ZBU A;  4DTR A;  2FBY A;  1RNH A;  1SV5 A;  2OPP A;  2IOC A;  3PX6 A;  3QEX A;  4CEC A;  3UIQ A;  2FBV A;  1WN7 A;  1ASW A;  3SZ2 A;  1ZYQ A;  1I39 A;  4CFD A;  2OYQ A;  4FJX A;  1YVU A;  3NBP A;  2EHG A;  2Q3S A;  3SUO A;  1T03 A;  5D3G A;  2FC0 A;  3QLH A;  3L2W A;  3MXM A;  4B8A B;  1S1W A;  5DK5 A;  1L3U A;  4YFU A;  3AVF A;  2IS3 A;  4NYN A;  2P51 A;  1N6Q A;  3V1Q A;  4OLB A;  2XO7 A;  2NUB A;  4OLA A;  1CZB A;  3L3U A;  1ITG A;  1TL3 A;  3TAF A;  2HHX A;  1QSY A;  4M3Y A;  4KRE A;  3VQ9 A;  3NE6 A;  4DU3 A;  3HST B;  4GMJ B;  3ALY A;  1RBS A;  1RDA A;  4AIL C;  1HRH A;  3AVB A;  1JLA A;  1RTI A;  3V81 A;  1JKH A;  2YHA A;  4B08 A;  3K5N A;  2VG7 A;  4HHT A;  4CJ5 A;  3L3V A;  3SQ2 A;  4KAZ A;  3L8B A;  2VG5 A;  4IG3 A;  4IFY A;  3ZSQ A;  1RT5 A;  3ZSV A;  1QS4 A;  2IDO A;  4CJS A;  4N56 A;  1RT7 A;  3VQB A;  3OS2 A;  3TWH A;  3LWM A;  1S9G A;  3ITH A;  4FJ9 A;  3NF8 A;  1GOB A;  2O4G A;  1BQN A;  1GOC A;  1UAX A;  5HBM A;  4EP4 A;  4DF4 A;  1VSH A;  4FJJ A;  4E89 A;  3SQ4 A;  5J2Q A;  4DQP A;  2HVH A;  1WSH A;  3LP1 A;  4IG0 A;  3TAG A;  1NK9 A;  3C6T A;  3RMA A;  3NH2 A;  3D45 A;  4FW2 A;  4CK2 A;  4FJI A;  1EXQ A;  1RCH A;  3CFO A;  3HXM A;  4KHS A;  1VRU A;  4KFB A;  4M3W A;  4W5R A;  3LPU A;  4AHC A;  3LAN A;  1VSJ A;  3OYK A;  1L3S A;  1KLN A;  2EX3 A;  2IGI A;  2YHB A;  1VSF A;  3MEE A;  1NK4 A;  1LAW A;  3DOK A;  1RBU A;  2X78 A;  4DQI A;  4QOZ B;  3EYZ A;  1KVB A;  3U6F A;  4JS5 A;  3VN5 A;  3OYI A;  3CFR A;  3ZCM A;  4CGG A;  1LV5 A;  5I42 A;  4Z0U A;  4LD0 A;  2BAN A;  4E1M A;  1J5O A;  1D9D A;  2XY5 A;  4QCL A;  4O44 A;  4CEA A;  1FXX A;  1Y97 A;  3O3H A;  2YKM A;  4W5Q A;  4BDZ A;  3TAN A;  4CGF A;  1U48 A;  3KTQ A;  1CXU A;  2FBT A;  5KRT A;  5EU7 A;  3NH0 A;  3BGR A;  4DWI A;  2WOM A;  3HPG A;  4FYD A;  4DS5 A;  4RW8 A;  4E7L A;  4DTN A;  2E6L A;  4KO0 A;  4CJU A;  3MXJ A;  4KKO A;  2D0C A;  5J2N A;  2HHU A;  1W0H A;  2X6N A;  4DSF A;  4EZ9 A;  3LAK A;  1RT1 A;  4AH9 A;  3KLH A;  4K8Z A;  1HNV A;  1NJX A;  1C0T A;  3SCX A;  4B9S A;  3KK3 A;  3QER A;  4M3R A;  1TVR A;  1KSP A;  1WNS A;  4CEE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...