5SWMA

Bacillus halodurans rnase h mutant d132n in complex with 12-mer frna/dna hybrid
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
131
structure length
131
Chain Sequence
IIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSNSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGEIKADY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease H
publication title Limits of RNA 2'-OH Mimicry by Fluorine: Crystal Structure of Bacillus halodurans RNase H Bound to a 2'-FRNA:DNA Hybrid.
pubmed doi rcsb
source organism Bacillus halodurans
molecule tags Hydrolase/rna/dna
total genus 37
structure length 131
sequence length 131
chains with identical sequence B
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2016-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5swmA00
1VSEA 4CJEA 2Z1JA 3QEPA 2OZMA 4CF9A 2HHWA 3SI6A 1BISA 5SZTA 3RMDA 3LANA 4CFDA 3HPHA 4W5TA 5FROA 1WSEA 3HP9A 4QAGA 2YHBA 1C6VA 5FRNA 4ID5A 5DMRA 2OPQA 3K59A 1B9FA 4CF0A 1RBUA 2X6NA 4UQGA 4OKKA 4FLZA 3LZJA 1TKTA 3CFOA 1R0AA 4KREA 1BIZA 1BHLA 2BE2A 2X78A 3ZSQA 1CXQA 3ZT0A 4AHTA 3P83D 4I2QA 3OS1A 1X9WA 4OPJA 3T19A 1DTQA 3MEGA 2LSNA 2KFNA 2Y1JA 1ASWA 3OVNA 2KW4A 2XRIA 3RTVA 4FM2A 1S6PA 2QXFA 4M41A 4CEQA 2NUBA 1NK4A 4N41A 2HMIA 3L8BA 4FJLA 3AO3A 4FK2A 1IO2A 1HRHA 4DF8A 3T1AA 4FJ5A 5JS2A 2OPSA 1RDDA 2YNIA 1XHXA 1Y97A 4RW4A 4CHNA 3BGRA 3DOLA 3OYDA 3SQ2A 1RT4A 5HLFA 1GOAA 4B08A 3HVTA 4E1MA 4AHSA 4CF8A 3MECA 4C8KA 4CJPA 3OYJA 1S1UA 1TL1A 2HHUA 4JS4A 3TR8A 1JLEA 3K5MA 3QNNA 4FJXA 2D0BA 2HNDA 4KTWA 2W42A 3MXIA 1HQUA 4LSLA 1JXBA 4R5PA 3NAEA 1IKVA 4YNQA 3AA3A 3M8PA 4DTNA 3VQ9A 4FK4A 3G10A 1NK6A 3V1OA 1HQEA 4MQ3A 4FLVA 3RRGA 4KTQA 2IC3A 2OPRA 4M3WA 2A1RA 4AILC 3TI0A 3LPTA 1C0UA 4KI6A 1LW2A 4CEFA 3ZSXA 3S3NA 1D9DA 4DWIA 4KHWA 4EP4A 4CHYA 2F8SA 2G8VA 2KZZA 4KHUA 1YT3A 1ZBUA 2RN2A 3VQEA 4E7JA 3SUOA 4DFPA 1TAUA 4DFJA 4AH9A 1U48A 3OS2A 1IKXA 1RTJA 4LD0A 4BE1A 1JLAA 3SNNA 5KRSA 2E6MA 3CFPA 2BGGA 4DU3A 3SPYA 3K58A 2Y1IA 1D5AA 1B9DA 2B6AA 2G8IA 4CGIA 2G8HA 4HHTA 4O0IA 2YHAA 3RMCA 4PWDA 2KTQA 2ZD1A 3QIPA 3AO5A 3LALA 4CEDA 3PX4A 1S9EA 5J2NA 1SUQA 1Q9XA 4M3YA 1KTQA 2GBZA 4KV8A 4N47A 3M8QA 2A1SA 3VQ4A 3K5OA 3D0PA 3RMBA 4ZTJA 1BI4B 3QNOA 1RT5A 2FBXA 3LZIA 3S3MA 3L2VA 1ASVA 3VN5A 3CG7A 1UA1A 1FK9A 3PV8A 4CJKA 4DLEA 3SUNA 3ZT2A 3V9UA 4DQQA 4J2BA 1LAWA 1T03A 1LWFA 4FJJA 3QO9A 1C0MA 4GMJB 1UOCA 5CYMA 1J5OA 4IFYA 4QOZB 3SQ4A 1XHZA 1TKDA 4B8AB 1IKYA 1JXEA 2PYLA 5EU7A 3HPOA 3HL8A 1D9FA 1TK0A 4F2SA 4FJNA 4E7HA 1RILA 1ITGA 3PO4A 1VSMA 3S9HA 4H8KA 4CGGA 3PX6A 3TAGA 4DMNA 1BCMA 3M8SA 4CHOA 3AVGA 1VSIA 1JKHA 5K14A 4CHQA 4YFUA 4FJHA 4NCGA 4CJ5A 3RMAA 4Z4EA 5T7BA 2EX3A 3C95A 2ZQBA 4O0JA 2OYQA 1WSGA 3HYFA 3SUQA 2Z1GA 3QESA 5KRTA 5CZ1A 1WAJA 3HM9A 4OLBA 3HVRA 1X9SA 3V9ZA 1ZBIA 4FLTA 5KGWA 3VQQA 4BE0A 1YVUA 2D0AA 3KK2A 5CY4A 3TARA 4RG8A 4O55A 2YNGA 1J9AA 3T3FA 2O4IA 1RBSA 4B9UA 3KD5E 1NK7A 2OZSA 2PZSA 4W5OA 4FVMA 3V9XA 1VSKA 4W5QA 2HVHA 3LWMA 4LH4A 4KHQA 4CECA 1T7PA 1ASUA 3L2RA 3OJUA 3NDKA 1SL0A 3DLKA 3K57A 4DTXA 4CJ3A 3SQ0A 1GOCA 4DU4A 4AHRA 1NOZA 3WNFA 4IG0A 4CHZA 1WNSA 2F8TA 2G8KA 2DY4A 3V1QA 2G8FA 4Z4IA 3VQ6A 1LWCA 4FLWA 3AVNA 3LAKA 5J2PA 5FDLA 3IS9A 3LAMA 4I9LA 4CGHA 1C1BA 3VQCA 3DOKA 4E7KA 4W5NA 2FBVA 4Z4GA 1ZBFA 1UA0A 3SJJA 4M3UA 2XY6A 3NF6A 1VSJA 1O1WA 1UWBA 4E7IA 1C1CA 3TANA 3KD1E 1HJRA 2OA8A 3AVJA 4F2RA 3AVHA 1SV5A 1HYVA 4CFAA 4CGFA 3DI6A 2HVIA 4CF1A 4OGEA 3OYAA 2I5JA 3CYMA 3SUPA 2PYJA 4CEEA 3VA0A 2VG7A 3TWHA 3K5LA 1RDAA 4FJKA 1S5JA 1Z26A 3L2QA 4DQRA 3DLHA 3QEIA 3TAQA 3AVLA 3QERA 4I2PA 3AO1A 2DFHA 4HUFA 4DTUA 3QEXA 4E89A 4DS5A 3CFRA 1D8YA 4B9VA 4CJVA 2E6LA 3PO5A 2EHGA 4C8MA 4CK3A 1KVAA 1KVCA 1VRTA 3KLFA 3RRHA 1T05A 1N6QA 2Z1HA 1WSFA 1TKXA 1Q8IA 2HB5A 3AA4A 4Z0UA 3IAYA 3CQ8A 4DG1A 3JSMA 4DLGA 3EZ5A 5J2MA 4B9LA 1S1VA 4KI4A 1U04A 2AJQA 2FBYA 3V1RA 2P1JA 3DLEA 3KLEA 3QEWA 4EZ6A 2GV9A 3PUFA 4FW1A 4FM1A 4DSIA 1WSJA 4IBNA 2DFEA 2XO7A 1DLOA 3B6PA 4N5SA 4OKEA 1NKBA 3MAQA 1Q9YA 4QCLA 3LWLA 1SL1A 3WNEA 3HO1A 1X9MA 1HYSA 3B6OA 1RT7A 3O4QA 3P1GA 3NH0A 3DRRA 3OYNA 4B9MA 4CJ4A 4J2EA 1C0TA 4HUGA 3ASMA 3DRPA 4B9SA 4KTZA 2VWJA 3NH2A 2P5OA 3AVBA 4F3TA 4BDPA 4CEOA 2YNFA 1BQMA 3NCIA 1XWLA 4K8ZA 3OYLA 3AVMA 4ELVA 4RW9A 1CZ9A 4OGCA 4CERA 4FJMA 4KHSA 2RPIA 1J53A 4W5RA 3ITHA 4DS4A 3AVAA 4DSKA 3KKRA 4CIFA 1NKCA 4ELTA 2HHQA 1WAFA 3KJVA 4CFCA 4M45A 4FLXA 3C6TA 1JLGA 1CZBA 1RT1A 1HPZA 4OJRA 4O44A 3U6FA 1L3SA 4XIUA 5D3GA 4NYNA 3WNHA 3AVFA 1JLQA 1EP4A 5HRPA 5HP1A 1U49A 2HHXA 2OPPA 1QS4A 1HYZA 1RDBA 1GOBA 1RT3A 3FFIA 3SQ1A 4CJFA 3TAMA 4ZTFA 1REVA 1SKRA 1A5XA 4J2DA 3HJFA 3LPUA 3AO2A 4H4OA 3F73A 3L2UA 3HK2A 3HPGA 3DLRA 4M3ZA 2G8WA 4CIGA 1C1AA 2ATQA 2ZE2A 4CJRA 4L8RB 5FRMA 1VSHA 3LP2A 1F21A 4GVMA 4KFBA 2YV0X 4E3SA 3U3GA 1ZYQA 3ZSVA 4F8RA 1S1TA 4JRPA 3KLGA 2QK9A 1RNHA 3KKSA 4E19A 5HRNA 3EY1A 4DSLA 3VQAA 3OYBA 3UIQA 3AV9A 4CJUA 3TAFA 1B92A 1RBTA 3KIOA 1S9GA 1W9HA 1W0HA 2X74A 4TSXA 3NHGA 4DTRA 4I9QA 4M42A 4JS5A 4KO0A 3ISNC 2R7YA 1TKZA 2VG6A 1JLCA 2E4LA 3ZSZA 4Q5VA 3AVKA 4KHYA 1NJWA 4CF2A 3O3HA 1FKPA 5CZ2A 1NOYA 1JLBA 3NBPA 3QINA 1XC9A 1WLJA 3VQ8A 4JRQA 2YKMA 3LP0A 4FLUA 4H4MA 4KRFA 1CXUA 2YNHA 3QETA 3S3OA 3OYIA 4AHVA 1QSYA 1BQNA 4CEAA 1JL1A 4FZYA 4PUOA 1ZBLA 1MU2A 3ZSYA 2B4JA 2HHTA 4HCCA 5DK5A 3ZSWA 4CGJA 1L3UA 4IKFA 2IGIA 4ID1A 3TAPA 4KHNA 3QEVA 3K5NA 1G15A 3MEDA 2D0CA 3ALYA 4KKOA 3VA3A 4DTPA 1S1WA 4C8OA 4E0DA 5I3UA 4BWMA 1L3VA 2P5GA 3V4IA 2QKKA 4DF4A 1BGXT 4AHCA 1UAXA 4AHUA 4DSJA 3QIOA 3SYZA 5J2QA 3AVCA 1KCFA 4LY7A 3HT3A 4B9NA 4E7LA 4OPKA 3SV4A 3PY8A 4Z4FA 1L3TA 3E01A 3MEEA 3V6DA 3DYAA 4Q0BA 3L3VA 3NFAA 4G1QA 3OY9A 3OYMA 1TAQA 2X6SA 4FM0A 5HROA 4FK0A 3NF9A 4DTJA 3NGZA 3V81A 4FYDA 3OS0A 4FXDA 4FJIA 3AO4A 2GUIA 4CJTA 1RTIA 3KK1A 3KTQA 4DFKA 2IS3A 4RW8A 4DSFA 4LSNA 3DLGA 3OYGA 1NJXA 4FJ9A 3NF8A 4B3OA 4Y1CA 2YKNA 3SPZA 1WN7A 1A5WA 2B5JA 1NJYA 4FZXC 4CK1A 4KB0A 3I0RA 1NK5A 1U47A 2G8UA 5C42A 4HTUA 4BDYA 1VSDA 4DQSA 4DTSA 4BE2A 3SCXA 1NJZA 1QSSA 4KB1A 4Z4CA 1TGOA 1SKSA 3EYZA 3HSTB 5C24A 4N56A 2KZMA 1QQCA 2FC0A 3VQDA 3NH1A 1NK0A 3VQBA 1TL3A 4KAZA 3AA2A 2HHVA 1LWEA 4CJQA 4DSEA 3KLIA 3ZSRA 3MXMA 3NF7A 3O4NA 3QLHA 5HBMA 5SWMA 2HNZA 1KRPA 1EXQA 5KI6A 1HNIA 4Y1DA 4N76A 4FJ8A 1VRUA 3C94A 3K2PA 3ZT3A 1RT2A 1RBRA 3OYEA 4JLHA 3LP3A 4BACA 1KLNA 3D45A 1FKOA 1S6QA 2PY5A 3ZT4A 2BANA 4CHPA 4DTOA 4FJ7A 4HCBA 4K8XA 2FBTA 2RF2A 1FXXA 4BDZA 3PX0A 3THVA 1IG9A 4RW6A 2WOMA 2ITGA 2BDPA 3I8DA 4B8CA 3IG1A 4GW6A 1I3AA 3VQ7A 1KLMA 4DFMA 1WSIA 3DM2A 4CEZA 4NCAA 3P5JA 3BDPA 1CLQA 1JLFA 3CM5A 4FLYA 1XI1A 1EETA 3O3FA 3WNGA 1U45A 1SL2A 2HW3A 3L2WA 2IAJA 4B9TA 4DQIA 1BCOA 4M3RA 1WSHA 5C25A 1VK0A 4DU1A 4KPYA 4CJSA 5CYQA 1QHTA 4CJLA 4ZHRA 3OYKA 2XY5A 2KQ2A 4CK2A 3OYCA 1RTHA 3L3UA 1KSPA 4OKJA 1BIUA 4I7FA 4WE1A 4ELUA 1LV5A 2DFFA 2JLEA 1U4BA 3U3YA 1HMVA 3ULDA 1VSFA 2VWKA 1Z25A 2HNYA 4BWJA 4CEBA 1TV6A 2DTUA 2IDOA 1RDCA 1SKWA 3NGYA 4RW7A 1IH7A 3ZSOA 2XY8A 2O4GA 4FJGA 2HHSA 1TVRA 4CE9A 3OJSA 3M8RA 4DQPA 3DMJA 3CM6A 3G0ZA 1RCHA 3MXJA 3ZCMA 1TK8A 4OVLA 4HVJA 2JGUA 4FCYA 4PY5A 3NE6A 3AVIA 4MFBA 3HP6A 3DLBA 4IG3A 4CJWA 3JYTA 1QSLA 4CCHA 2VG5A 1RT6A 2RKIA 1NK9A 4EZ9A 3HXMA 5KGXA 4CFBA 3IRXA 2QKBA 3O3GA 3TAEA 1I39A 4CESA 3VQ5A 2WONA 5HRRA 3RR8A 3LDSA 3I0SA 4IDKA 4J2AA 2ETJA 1LW0A 1J54A 1NK8A 1QTMA 1KVBA 1KFSA 5HRSA 4CGDA 2P51A 3VQPA 4FW2A 3ZT1A 2XHBA 1EKEA 3AA5X 5J1EA 3OYHA 1KFDA 3NGIA 3V9WA 5I42A 3A2FA 1YTAA 3DRSA 1TK5A 3RWUA 2F96A 1A5VA 4CIEA 1K6YA 4EP5A 1ZBHA 2Q3SA 4IFVA 3LP1A 4NYFA 4F4KA 1IKWA 1DTTA 5JS1A 1LAVA 2Z1IA 1BI4A 4DTMA 1YTUA 4PQUA 4FZZA 3V9SA 4Z4HA 2KFZA 3KK3A 2IOCA 4E1NA 3SV3A 1JL2A 1X1PA 4O5BA 1T8EA 1S1XA 4ICLA 4PA1A 4HUEA 1NKEA 5KTQA 4OLAA 5E41A 3H08A 3C6UA 1BL3A 4LH5A 1L5UA 2D5RA 3RR7A 4NCBA 3OYFA 1RTDA 4O4GA 1VSLA 1EX4A 1RBVA 3SZ2A 3TABA 1N5YA 4M3XA 4M3TA 4F3OA 3KLHA 1HNVA 4C8LA 4C8NA 1QE1A 2XY7A 3F9KA
chains in the Genus database with same CATH superfamily
1VSEA 2E8AA 1DT9A 3UKUB 2OZMA 3L4QA 1BU6O 2HHWA 4O8UA 3SI6A 2O8EB 5DM6L 3LANA 4CFDA 4W5TA 4A62A 4BRMA 2YHBA 1C6VA 3VF2A 5FRNA 2QW9A 2OPQA 5AQFA 2WBNA 2E2QA 4FLZA 3CERA 4KREA 2BE2A 3ZSQA 1CXQA 3ZT0A 1Q7YO 3CCJN 3OS1A 4OPJA 3Q7BA 4BR7A 3T19A 3OVNA 3ZEUB 2BTFA 2KW4A 2XRIA 3VF6A 2QXFA 4M41A 4JI5K 5AZIA 4BRGA 3ULEA 3L8BA 4DQ8A 4DF8A 2OPSA 1RDDA 4RW4A 3I56N 4CHNA 3GBTA 4H0XB 4B08A 4C8KA 4CF8A 4B1WB 1T6CA 3N4PA 2HBKA 5AQVA 1EQYA 4LF7K 4JS4A 3TR8A 1JLEA 3K5MA 4OO1J 4FJXA 1HQUA 1JXBA 4YHHK 1IBMK 1R59O 4YNQA 3M8PA 1NK6A 1IBLK 1N34K 4MQ3A 4DV4K 2IC3A 3LPTA 1C0UA 4KI6A 1LW2A 4CEFA 4IO9L 2F8SA 4AF1A 3HI0A 1ZBUA 2RN2A 1G99A 4XEIA 5KRSA 2HMPA 3CFPA 4DU3A 3VPZA 4BREA 3THXB 4BC5A 4C1NI 2KTQA 1YF5L 5M1KA 3PX4A 4CZMA 1ATSA 2P9PA 1SUQA 4M3YA 4H0VB 1KTQA 4ZTJA 3D0PA 4OPHA 3CG7A 3SMSA 3ZT2A 4MDAA 4JI0K 3QICA 4R79A 3O4WA 4FJJA 3MN9A 1C0MA 4GMJB 4FPAA 1J5OA 4IFYA 3H1VX 2RHKA 2YCHA 3SQ4A 5AQJA 3QBWA 2PYLA 2QWNA 1D9FA 1HNXK 3CQXA 4FJNA 4F2SA 3SAGA 1RILA 1ITGA 3S9HA 4H8KA 4CGGA 2QM1A 1BCMA 1VQ5N 3AVGA 3RSEA 4FJHA 5BPNA 5F1XA 4LF6K 5CZ1A 5KGWA 4YOTA 5CY4A 1GLJO 4O55A 1NGIA 4BG9A 3CMAN 4W5OA 5LL6Z 1VSKA 1T7PA 1ATRA 1WBDA 3DAWA 3K57A 1GOCA 5AZIB 3ULEB 1GLAG 2F8TA 4PL8A 5LMNK 4BVOA 1U6ZA 3VQ6A 1LWCA 1H1VA 3IS9A 1O13A 1Q18A 3DXMB 4Z4GA 4M3UA 2XY6A 1VSJA 3KD1E 3VMFB 2A5XA 3WXIA 4F2RA 3AVHA 3AARA 3T7ZA 3ENHA 3JS6A 5AR0A 4OGEA 4CF1A 3MN5A 2PYJA 1RDAA 3CHWA 4XH4A 3QMLA 3TAQA 2UXBK 1WBBA 2DFHA 3CCMN 3CFRA 5JLFA 3JAMO 4CJVA 1D8YA 5JICA 3F9MA 4C8MA 3KLFA 1KVCA 4CBWA 3RRHA 3L0QA 1TKXA 1Q8IA 2NNWA 3AA4A 3T69A 3JSMA 4DLGA 2EWSA 4JKHA 4IZ9A 1TUYA 4KI4A 1U04A 2FBYA 3DLEA 3T1HK 3O1BA 4EZ6A 2VCPA 3PUFA 3P38A 2P9PB 1HKGA 4IBNA 2DFEA 1DLOA 2QWRA 4GV6A 1RT7A 3O4QA 3DRRA 4HUGA 4Z94A 1P8ZA 4DHYA 3AVBA 4CEOA 3NCIA 1BQMA 3OYLA 4ELVA 3UE5A 4OGCA 5M1NA 4FJMA 5ADXH 3ATUA 1WAFA 3KJVA 4CFCA 3C6TA 1JLGA 4OJRA 4O44A 4B1ZA 4XIUA 5D3GA 3CCSN 4NYNA 2A6AA 1GLLO 1JLQA 2OPPA 1EWRA 1QS4A 1QVFM 1GOBA 3BZCA 4KH6A 4CJFA 1REVA 3F5TA 3LPUA 3AO2A 2F4VK 3HJFA 3DLRA 4YOUA 4CIGA 1C1AA 4CJRA 1OH8A 3LP2A 1F21A 4GVMA 3ZSVA 5EXWA 1S1TA 4ILHA 4M63C 4CJUA 1W9HA 3D2FA 4KO0A 3ISNC 4KHYA 4EFHA 1VQ4N 4FOEA 1LCUA 1WLJA 3VQ8A 2YKMA 4JI3K 4FLUA 1YAGA 1CXUA 2CH6A 3S3OA 3O5BA 4AHVA 2D0PA 1BQNA 1JL1A 1VQMN 3ZSYA 4JAXA 3VEZA 4HCCA 1L3UA 4IKFA 3MEDA 3VA3A 4C8OA 1Z05A 4BWMA 2P5GA 1UAXA 5HOOA 3AVCA 1KCFA 3RVCA 5JMVA 4E7LA 3PY8A 1L3TA 3IKMA 4Q0BA 1X3NA 1OVYA 3D2EB 3DYAA 5LMUK 3SJHA 5AQQA 3NFAA 4H5TA 5BRDA 2X6SA 4FM0A 5HROA 4GY2B 4U67L 1XC3A 2PBDA 1C0GA 3TSPA 1N33K 3CD6N 2GUIA 2DPNA 3KTQA 4PKHA 3OYGA 4FJ9A 5M1OA 5AFUA 5AQSA 1WN7A 1NJYA 5ELZA 4CK1A 4KB0A 4FZXC 4BROA 4DV0K 2G8UA 5C42A 4BDYA 1VSDA 4DTSA 4KB1A 4RTFD 4DV3K 3VQDA 3P4IA 4BR4A 3H1QA 3TPQA 2HHVA 3H46O 1TYQA 3MXMA 2ZGZA 1KRPA 1EXQA 3E66A 3G71N 3OYEA 1NGDA 3D45A 1DGKN 4AM7A 4FVUA 2HF4A 5M1PA 4RWTA 3ZT4A 4CHPA 4B3SK 4DR2K 4HCBA 4K8XA 4OX9K 2RF2A 4BDZA 1QZ6A 3ENBA 1IG9A 3I8DA 4B3TK 3NMUA 1NNEA 1NGAA 5KPRA 1CLQA 1XI1A 1SL2A 1BO5O 4M3RA 1WSHA 3D2FB 3OW2M 2ZF5O 1RTHA 4KHPK 1SS6A 1BIUA 4OKJA 5AZJB 4ELUA 1LV5A 2DFFA 3ATVA 5BR8K 3U3YA 5AQGA 4CD3A 2GWKA 4FJGA 2GELA 1BA1A 4CE9A 3M8RA 3CM6A 4PY5A 3HP6A 3SK3A 3SAFA 2CH5A 4CJWA 2QKBA 2NLXA 1I39A 2E2PA 3R3LA 3LDSA 1E4FT 3I0SA 4J2AA 3CMEN 1LW0A 1NK8A 1QTMA 1KVBA 1KFSA 1OVQA 1OH5A 2P9NA 3AA5X 3OYHA 5JVHL 1YJNN 3HOTA 3A2FA 1YTAA 3DRSA 1TK5A 2F96A 1K6YA 3KZBA 4IFVA 4NYFA 5GIOA 3CXCM 1IKWA 4UY8O 1BI4A 1YTUA 4Z4HA 1JL2A 1X1PA 2E1ZA 5EX5A 4JI7K 1Q86O 4DUZK 3Q7CA 1TYQB 3RR7A 4NCBA 3LL3A 2AA4A 3VGLA 4FWRA 4DR3K 1GLCG 3UKRA 1N5YA 4FPBA 5GAGP 4C8NA 3N4QA 5C12A 4CJEA 4CI6A 4MO5A 2UXCK 5SZTA 3RMDA 3VERA 4YORA 4DKWA 3OBWA 4JKBA 4B3MK 3QDKA 1VQON 3K59A 4UQGA 4OKKA 1ILYA 3THWA 1TKTA 1R0AA 1BHLA 4AHTA 4LFBK 1DTQA 3O6WA 3MEGA 5BREA 3H3OB 1YHQN 1Q81O 3MX2A 1S6PA 2HMIA 2NZTA 4FJLA 4FK2A 1IO2A 4H0TB 3J7AP 2O8EA 1XHXA 3DOLA 1OH6A 1GOAA 4BGAA 4E1MA 4Y0WA 3ID6A 3MECA 3OYJA 1S1UA 3QNNA 3MXIA 1HKBA 4R5PA 3NAEA 3AA3A 4LF5K 3VQ9A 4M3WA 3TI0A 3E9LA 3ZSXA 4KHWA 2Q0UA 3MCPA 4ISFA 2NRHA 4DUYK 5FPEA 1YT3A 2QA4N 4E7JA 4FO0A 3W0LA 4DFJA 1TAUA 3CCUN 3OS2A 1IKXA 1B9DA 1QHAA 2B6AA 1VQLN 2G8IA 4HHTA 2YHAA 3QIPA 1DEJA 1NLVA 4CEDA 1S9EA 1BG3A 5J2NA 1Q9XA 4KV8A 4N47A 2A1SA 1BI4B 5AQRA 2FBXA 3O1WA 3LZIA 3L2VA 1KC8O 1GLFO 1FK9A 3PV8A 1K73O 4DLEA 3O9TA 4IOCL 4J2BA 1T03A 1LWFA 3MCAB 1KQSM 5CYMA 4YDUC 2PAVA 1XHZA 1EO1A 4B8AB 1KD1O 1JXEA 5EU7A 3PX6A 3TAGA 1OH7A 4CHOA 1VSIA 1JKHA 5K14A 2PFUA 5IT9O 4Z4EA 2EX3A 3C95A 3P39A 4O0JA 3HYFA 1NG9A 4GVEA 2Z1GA 4OLBA 4QS7A 1WAJA 1YUWA 4BE0A 1YVUA 2D0AA 3ZX3A 3TARA 3EE8A 3THWB 2O4IA 1RBSA 2PZSA 3VESA 2GWJA 4JK9A 1ASUA 3DLKA 4DU4A 1N32K 5AQPA 1NOZA 4H5NA 4WF9L 4CHZA 2G8FA 3LDOA 4FLWA 3AVNA 4I9LA 1XQSC 1ZBFA 3LM2A 3SJJA 1UA0A 3K9JA 1O1WA 1UWBA 5GIPA 4B9QA 4JHDB 4IFEA 5KPZA 3K5LA 2ASMA 1Z26A 3L2QA 3L4IA 3J7YP 3DLHA 4BVPA 4I2PA 2VGNA 4CZLA 4E89A 1ESVA 4B9VA 3VENA 3DXMA 2EHGA 1N6QA 2Z1HA 1WSFA 3CQ8A 4DG1A 4BC4A 1S1VA 3V1RA 3QEWA 2P1JA 3KLEA 2O8DB 4LF9K 2GEMA 4FW1A 4FM1A 3VEXA 3G25A 1S72N 3B6PA 2ZWHA 4QCLA 1HYSA 3FR0A 1X9MA 1NGCA 3P1GA 4B9MA 4J2EA 5LJWA 4ISEA 5AQMA 1U2VB 2YJEA 2VWJA 3NH2A 2FF6A 4CBXA 4F3TA 1XWLA 3CCEN 3AVMA 4IO8A 3C7NA 4W5RA 4ELTA 1SQKA 4FWSA 1S22A 3U8XA 4M7XA 4WQ4C 1HPZA 3A5NC 3U6FA 5HP1A 1EP4A 2YHWA 1HYZA 3FZKA 1VQ7N 1RT3A 3SQ1A 4GV3A 1XNQK 3TAMA 4ZTFA 4DV2K 2QTDA 3GE1A 1A5XA 4J2DA 5GAEP 1HPMA 1JCFA 3HPGA 1YI2N 3E9PA 4M3ZA 3C0BA 2KHOA 1VSHA 3O9QA 4KFBA 2YV0X 4E3SA 3U3GA 1QQNA 4BY9C 3DXKB 4JK8A 4DSLA 3TAFA 3A0IX 3KIOA 4I9QA 4H0YB 4JS5A 2O8CB 2VG6A 2E4LA 4CW7B 5F0XA 3THYA 2E88A 3IDHA 3O3HA 1JLBA 3QINA 4JRQA 3LP0A 3MWPA 4KRFA 4DV6K 1I94K 4CGJA 3CC4N 2IGIA 3WT0A 1VQNN 3QEVA 2HBJA 4DTPA 1S1WA 4WQ5A 3CCQN 1ZC6A 1BGXT 4AHCA 4AHUA 1P90A 3QIOA 4J8FA 2GUPA 3H6EA 4LY7A 4OPKA 3MEEA 3AY9A 3R1XA 3OY9A 1J5EK 4YOVA 5KQ8A 4DTJA 1QQMA 4FXDA 3TTCA 3FGUA 4CJTA 1RTIA 4EHTA 3K9KA 3KK1A 4RW8A 3CCVN 3NF8A 4B3OA 4Y1CA 2W41A 1N8RO 1A5WA 2B5JA 1NK5A 4HTUA 3C65A 3R9PA 4N56A 3PSFA 4BRHA 3D2EA 3VQBA 4K25A 1LWEA 4KH5A 3ZSRA 3O4NA 3C7NB 5SWMA 2HNZA 5M1QA 3DLLL 4H5WA 1VRUA 2P9KB 4DV7K 5M1FA 1E3MA 1S6QA 4BRIA 2HBMA 5EOYA 3WXLA 2YHYA 3WQUA 2FBTA 1VQ9N 3PX0A 1Y64A 3M3ZA 2Q36A 2WOMA 3IG1A 1KLMA 4DFMA 4FWLA 3DM2A 3SBTA 3P5JA 3BDPA 3JXUA 1EETA 3WNGA 1U45A 2IAJA 4B9TA 1IJJA 4A2BA 4RCHA 1QHTA 4CJLA 1XMQK 3AGRA 2XY5A 3THYB 4A5BA 3EEQA 1IBKK 5ADXA 5H1SQ 4DR1K 1VSFA 4BGBA 3CPWM 1TV6A 1RDCA 1SKWA 2D4WA 2HHSA 3HOSA 3DMJA 3G0ZA 1RCHA 3MXJA 4OVLA 3UB5A 4HVJA 3W3DA 4MFBA 3ID8A 3EE9A 4IG3A 3VEWA 2VG5A 2RKIA 4BR5A 4CFBA 3WEEB 2E1YA 3TAEA 3VQ5A 4F9OA 5AZJA 4YDUA 3WXKA 4IDKA 3AAQA 4CGDA 2P51A 1EKEA 5J1EA 5I42A 3CJ1A 3OBYA 4XH1A 3CPEA 4X66K 1A5VA 4EP5A 3R8EA 3OTOK 2Z1IA 2WTUA 4K41A 3KHYA 2W40A 1YVNA 3KK3A 5F2RA 4ICLA 4PA1A 4HUEA 4C23A 5KTQA 3A8YA 3C6UA 4DR5K 4NLBA 4ISGA 5AQZA 1RTDA 1VSLA 3TABA 3QFPA 1HNVA 4C8LA 2XY7A 3O9RA 3F9KA 1GLEG 1NMDA 2Z1JA 2QWOA 4FSVA 5A2QO 1BISA 4JI1K 4JV5K 1RDUA 4CZGA 2I7NA 2F9WA 5FROA 2NRZA 4QAGA 1D4XA 1MWMA 3H3NO 2X6NA 4JD2A 3I8BA 3LZJA 3CFOA 4FWKA 3EKSA 1LOTB 1X9WA 4A61A 4NB4A 3CETA 1ASWA 4FM2A 1NGFA 2E2OA 2FLOA 4JYAK 1NK4A 4NO7A 1HRHA 3OYDA 1RT4A 4BRCA 3HVTA 5E26A 3VEVA 3CQYA 4ILJA 2D0BA 4KTWA 2A40A 2O8BA 3BUZB 1IKVA 2OANA 4YOXA 3QFUA 3G10A 4JN4A 1HJOA 3V1OA 1HQEA 1M1KO 2OPRA 2IVPA 5FLXO 2ZJPL 4EP4A 2G8VA 2KZZA 4KHUA 3TU5A 3VQEA 1GLDG 1U48A 4IJAA 4LD0A 1JLAA 5BRFA 4AM6A 2E6MA 2BGGA 3SPYA 2Y1IA 2NRWA 3TTFA 4CGIA 2G8HA 4PWDA 3AO5A 3LALA 1DKGD 5CR4A 2GBZA 3VQ4A 3M8QA 3VEOA 3K5OA 3FZMA 3TSQA 2FSKA 3QNOA 5FPNA 3VN5A 4XH5A 4QS8A 4CJKA 1YIJN 1HUXA 3MWTA 1LAWA 4JKGB 3QO9A 1QVGM 1CZAN 3BY5A 4JEPA 2Q31A 1UOCA 4QOZB 2O8FB 1TKDA 1IKYA 3HPOA 1IV0A 4DMNA 1X9JA 4YFUA 2QWMA 3VOVA 1BOTO 5T7BA 4DR6K 2P9IA 2OYQA 3HM9A 1X9SA 4JKEA 1GLBG 3O08A 3EKUA 4FWMA 4JD2B 2P9UB 4RG8A 2YNGA 1J9AA 3KD5E 1EWQA 3PSIA 4FVMA 3FE1A 3V9XA 3LWMA 1M90O 4KHQA 3DJCA 1SZ2A 3LDPA 3L2RA 3OJUA 3U4LA 1SL0A 4DTXA 4CJ3A 3SQ0A 3CJ7A 3LDLA 2V52B 1WNSA 2DY4A 3AGKA 1HLUA 4Z4IA 2UYTA 4CZJA 3LAKA 5FDLA 4W5NA 3LAMA 4CGHA 1C1BA 4E7KA 4FL9A 3NF6A 4IOXA 2UUAK 4E7IA 1C1CA 1HJRA 4BRDA 4HWIA 3AVJA 2O8BB 1SV5A 2OTLN 1HYVA 3DI6A 1T6DA 2HVIA 1Q82O 3OYAA 2I5JA 3CYMA 4CEEA 1YJWN 2VG7A 3TWHA 2CGJA 2HSTA 1S5JA 4WFBL 3QEIA 4H5VA 3AVLA 3LDQA 1NGJA 2E2NA 4JI4K 4BRPA 1SAZA 3OHRA 4CK3A 1T05A 1KVAA 5C0YA 3IAYA 3FZFA 2V7ZA 4K43A 4B9LA 2V7YA 4JHDA 4BRLA 2GV9A 2WC9A 3A5OC 1WB9A 1WSJA 4PHTX 2Q97A 1N36K 1Q9YA 3LWLA 3HO1A 4GKKK 3OYNA 4WYBA 3ASMA 4B9SA 4KH4A 2P5OA 1NWKA 4O5FA 4RW9A 3J8AA 4KHSA 5AQOA 3ITHA 3KKRA 1NKCA 1OKJA 3FLCO 3EO3A 2O8DA 4FLXA 4M45A 4LFCK 3H45C 3I33A 5AQTA 4YOWA 4BR2A 3FFKB 2P9IB 3WNHA 2HHXA 1QQOA 4I6MA 3IMXA 1RDBA 4NLCA 2FSJA 1U2VA 4CZHA 2Q2RA 1ATNA 3CIPA 3F73A 3BZKA 2ATQA 2ZE2A 4L8RB 2E20A 4C1NK 4E1JA 3KLGA 2QK9A 3KKSA 5HRNA 3VQAA 5BN9A 4A2AA 1ZBIA 1B92A 1RBTA 2A42A 4TSXA 5C10A 1W0HA 4DTRA 3CI5A 4M42A 2R7YA 4Q5VA 3ZSZA 1JLCA 3AVKA 2P9SA 4CF2A 3A5MC 3O8MA 1XC9A 4CZEA 2ZGYA 5KQDA 3QETA 3OYIA 4A57A 4G9ZA 4CEAA 4FZYA 4PUOA 5MLCQ 3VEYA 1MU2A 2HHTA 3NVKA 2UXDK 3DXKA 4H03B 1C0FA 4BR9A 4ID1A 1G15A 2D0CA 4E0DA 5I3UA 1L3VA 3V4IA 2QKKA 4DF4A 2O8CA 5FPDA 3SYZA 5J2QA 2W6KA 4Z4FA 3CJCA 5BN8A 3E01A 3V6DA 3IUCA 4G1QA 3OYMA 1TAQA 4FK0A 3NF9A 5I9EB 3C6HA 3NGZA 4B1VA 3AO4A 4A5AA 1V4TA 3PIPL 2H3GX 4DFKA 2IS3A 4DSFA 4LSNA 2QWQA 3DLGA 1NJXA 1WUAA 3KWGA 1FW6A 4JI2K 3I0RA 4H0PA 1NMNA 4DQSA 1U47A 2VYPA 4OPAA 4CZFA 1SKSA 1NU0A 2KZMA 2FC0A 3E9OA 1TL3A 3BP8A 4B1XB 3AA2A 5AQUA 3ZETB 4DSEA 1T3VA 4DCHA 3QLHA 4K0KK 1HNIA 2IVNA 4LFAK 4N76A 3C94A 4FJ8A 3J7ZO 1RT2A 1RBRA 5CE3A 3LP3A 3KVGA 1KLNA 1FKOA 4JI8K 2BANA 4I6MB 4DTOA 3HTVA 4FWPA 5AQIA 5EY4A 1FXXA 4RW6A 3AAPA 4JNEA 2BDPA 4B8CA 2OCEA 2I7PA 2Q0RA 4L3QA 4CEZA 1IG8A 5CHIA 4FLYA 1W2BM 2P9KA 3O3FA 5C25A 4KPYA 4CJSA 4ZHRA 1V4SA 4CK2A 4U7BA 1KAZA 3SBGA 3L3UA 2P9SB 4I7FA 1YITN 3VETA 3HRGA 3ULDA 2VWKA 3ZYYX 3ENOA 4CEBA 4B1YB 4NXMK 3NGYA 1IH7A 1JCGA 2KLAA 1TVRA 3OJSA 4DQPA 2YX6A 3ZCMA 5BRHA 1TK8A 2JGUA 3HSCA 4JKCA 3AVIA 3DLBA 4ILGB 3JYTA 3OA9A 4YOYA 2QEXN 2QI2A 1NK9A 4EZ9A 3HXMA 4FOIA 4EIAA 3O3GA 4IXCA 4CESA 3RR8A 2WONA 2ETJA 1MA9B 1J54A 5HRSA 3G4SN 5AQYA 3S41A 3VQPA 1XNRK 4FW2A 3NGIA 4KBOA 3RWUA 3EZWA 3NVMA 4A59A 1ZBHA 3LP1A 4F4KA 4DTMA 3ZLJA 4PQUA 3V9SA 1JCEA 4E1NA 1T8EA 4IEEA 2WFBA 5IWAK 1S1XA 1NKEA 3WEEA 4DR7K 3TTDA 3WXMB 1BL3A 4LH5A 5AQNA 4BC2A 5AQKA 3OYFA 4O4GA 1EX4A 2D0OA 2QXLA 4EAHD 4M3TA 3KLHA 2QWLA 3T1YK 4FZZA 1QE1A 4V19S 3QEPA 4CF9A 4DR4K 4X65K 2ASOA 3HPHA 1WSEA 3HP9A 4FWOA 5AQXA 4FWQA 4ID5A 5DMRA 1B9FA 4CF0A 1RBUA 4GNIA 5E84A 1BIZA 2X78A 1HKCA 3CJAA 4BC3A 1HR0K 3FZLA 3U9ZA 3P83D 2YJFA 4I2QA 4MO4A 3HZ6A 3LM9A 2LSNA 2KFNA 2Y1JA 2F7TA 2FXUA 1FJGK 1VQPN 1NGBA 3RTVA 4CEQA 5KPTA 4H5RA 2NUBA 4HTLA 4N41A 3AO3A 4FJ5A 3T1AA 5JS2A 3BF3A 3P31A 2YNIA 1Y97A 5HLFA 3SQ2A 3BGRA 3BEXA 3WQTA 3R6MA 4CD1A 4AHSA 5LJVA 4CJPA 3PLAA 3HM8A 1VQKN 1TL1A 2HHUA 3VTHA 2HNDA 2W42A 1Z6RA 4LSLA 3D7EO 2NRTA 2UUBK 4DTNA 4FK4A 5GAHP 3ZX0A 4FLVA 3L6QA 2A3ZA 3RRGA 4KTQA 2A1RA 4AILC 4WFNL 2HF3A 1T44A 3DWLA 4DWIA 3S3NA 1D9DA 4CHYA 5BPMA 4BRAA 3CJ9A 2GTDA 3SUOA 2J4RA 4DFPA 4QS9A 3WUHA 1BA0A 4AH9A 1RTJA 3SNNA 4BE1A 1ZBSA 3MMVA 3K58A 1D5AA 1K8KA 4NXNK 3RMCA 4O0IA 2ZD1A 3GG4A 4MLHA 3PIOL 3RSEB 2WUSA 4IEIA 3RMBA 2D1KA 3IFRA 1RT5A 3S3MA 1ASVA 1UA1A 3SUNA 4O8KA 3V9UA 4DQQA 4LF8K 4GKJK 3CF5L 3WXJA 1KAYA 3HL8A 1TK0A 4E7HA 3PO4A 2FF3B 1VSMA 4IWVA 5GINA 3M8SA 4CHQA 4IJNA 3MX5A 4NCGA 4CJ5A 3RMAA 2Q1NA 2ZQBA 2HOEA 1WSGA 5TKYA 3SUQA 3QESA 5KRTA 3HVRA 3V9ZA 4FLTA 2P9LA 3VQQA 2BUPA 3KK2A 4JKGA 3T3FA 1VQ8N 2V51B 4B9UA 1NK7A 2OZSA 2O8FA 3CJBA 4W5QA 2HVHA 4LH4A 4CECA 3LDNA 3NDKA 4PKGA 2VWBA 4JKAA 3C6AA 4AHRA 3WNFA 4IG0A 4B3RK 2G8KA 2JWKA 3K0SA 1QZ5A 3V1QA 1RFQA 5AFUH 3CCRN 5J2PA 3CC2N 3VQCA 3GOIA 3DOKA 2FBVA 2P9UA 3ZX2A 3M1FA 4DV1K 3TANA 3SLCA 2OA8A 4CBUA 3J81O 4CFAA 2FSNA 1NGEA 4CGFA 1NJIO 3SUPA 4PL7A 3VA0A 5JLHA 1VAZA 4FJKA 3G6EN 4DQRA 1WOQA 1YXQA 3QERA 3MN7A 4FWNA 3AO1A 4HUFA 4DTUA 3QEXA 4DS5A 1HNZK 1K9MO 1S3XA 4WCEL 2E6LA 3PO5A 2KKZA 2E5LK 2UUCK 1VRTA 2HB5A 4Z0UA 1K8KB 3EZ5A 5J2MA 2OTJN 2AJQA 3SMPA 2JWLA 5C2FA 2IVOA 1W97L 4DSIA 2XO7A 4N5SA 1NGHA 4OKEA 1NKBA 3MAQA 1SL1A 3WNEA 3B6OA 3QB0A 3NH0A 4CJ4A 1C0TA 3DRPA 4KTZA 3VGKA 4BRNA 4BDPA 2YNFA 4BR0A 4K8ZA 4GV9A 1CZ9A 4CERA 2RPIA 1J53A 4DS4A 3AVAA 4DSKA 2IIRA 4CIFA 4BRFA 2HHQA 4WQ4A 3J80O 1HX1A 1CZBA 1RT1A 1L3SA 2NRXA 4PKIA 3CCLN 3AVFA 1U49A 5HRPA 3I55N 5GADP 1JJ2M 2ZJQL 3FFIA 2P9LB 5BPLA 2GX9A 1SKRA 4CZIA 3BF1A 4H4OA 1KAXA 1W7AA 3L2UA 3HK2A 5AJ3K 3B8AX 2G8WA 5FRMA 4OLAA 1ZYQA 4F8RA 4JRPA 4EHUA 1RNHA 4E19A 5C2DA 3EY1A 3OYBA 3UIQA 3AV9A 2YI1A 3NHGA 1S9GA 2X74A 4JKFA 1TKZA 4LC9B 2HBLA 1YJ9N 1NJWA 2UU9K 1FKPA 5CZ2A 1NOYA 3NBPA 4H4MA 1TUUA 2YNHA 3O9UA 1QSYA 4JKDA 4K42A 1ZBLA 3E1YA 2B4JA 5DK5A 3ZSWA 4KHNA 2NRRA 3K5NA 3ALYA 4KKOA 4BQZA 4WQ5C 4DSJA 2YHXA 3HT3A 4B9NA 3SV4A 5HL7L 3GL1A 2AP1A 3L3VA 4BRKA 3V81A 4FYDA 3OS0A 4FJIA 4WFAL 4X62K 1MWKA 4IOAL 2YKNA 3SPZA 4MDBA 1J6ZA 3MN6A 3SCXA 1NJZA 4BE2A 1QSSA 4Z4CA 1TGOA 3EYZA 3HSTB 1BWFO 5C24A 2ASPA 4B1UB 1QQCA 3NH1A 1NK0A 1VHXA 5FPMA 4KAZA 4CJQA 1BDGA 2CGLA 3EN9A 3KLIA 1E4GT 5DM7L 3NF7A 5HBMA 2ZM6K 3HBTA 1NM1A 3VGMA 5KI6A 4Y1DA 3K2PA 3ZT3A 4JLHA 3UKUA 3F2KA 4BACA 5EVZA 4X64K 3EL2A 4JK7A 1NGGA 2PY5A 3MK6A 4FJ7A 2RE2A 5JVGL 4CJ7A 3THVA 5LY3A 3GDQA 2ITGA 1VQ6N 3ZETA 4GW6A 5BR9A 1I3AA 1XUPO 3VQ7A 3D6RA 1WSIA 3KK7A 3M5RA 4NCAA 3ZEUA 1JLFA 3CM5A 5C15A 2HW3A 4BG8A 3L2WA 2QWPA 4DQIA 1BCOA 3A5LC 4DU1A 1VK0A 5CYQA 1ZXOA 3QBXA 3OYKA 3O9SA 4AQYK 2KQ2A 1HNWK 1X3MA 3OYCA 4JI6K 4YY3K 1KSPA 4WE1A 2JLEA 2W6LA 1U4BA 4CVNE 4LF4K 4DB3A 1HMVA 1BUPA 1Z25A 2HNYA 4BWJA 2DTUA 1NBWA 2IDOA 5AQHA 4RW7A 3ZSOA 2P9NB 2XY8A 2O4GA 3U9DA 3VF4A 2VQEK 5TKWA 5AQLA 4FCYA 4H0OA 3NE6A 1K8AO 1QSLA 4CCHA 3O80A 1RT6A 5KGXA 3IRXA 4M7YA 5HRRA 2VQFK 3VTIA 4BRQA 2A41A 3THXA 4CZKA 3ZT1A 2F9TA 2XHBA 4DV5K 1KFDA 3V9WA 3UKRB 3KWIA 2BH1A 4CIEA 3MDQA 2Q3SA 1DTTA 5JS1A 1RGIA 1LAVA 3CC7N 2CGKA 4BQLA 2ZJRL 2HHHK 2KFZA 1MDUB 2IOCA 3SV3A 4O5BA 1KXPA 5E41A 3H08A 3SAHA 1L5UA 2NRVA 2D5RA 1XMOK 2VGMA 1RDWX 1RBVA 3FZHA 3SZ2A 4IDHA 4M3XA 4MLEA 3TSUA 5B8HA 4F3OA 2ITMA 3M6GA 5AQWA 3TAPA
chains in the Genus database with same CATH topology
1VSEA 4CJEA 2Z1JA 3QEPA 2OZMA 4CF9A 2HHWA 3SI6A 1BISA 5SZTA 3RMDA 3LANA 4CFDA 3HPHA 4W5TA 5FROA 1WSEA 3HP9A 4QAGA 2YHBA 1C6VA 5FRNA 4ID5A 5DMRA 2OPQA 3K59A 1B9FA 4CF0A 1RBUA 2X6NA 4UQGA 4OKKA 4FLZA 3LZJA 1TKTA 3CFOA 1R0AA 4KREA 1BIZA 1BHLA 2BE2A 2X78A 3ZSQA 1CXQA 3ZT0A 4AHTA 3P83D 4I2QA 3OS1A 1X9WA 4OPJA 3T19A 1DTQA 3MEGA 2LSNA 2KFNA 2Y1JA 1ASWA 3OVNA 2KW4A 2XRIA 3RTVA 4FM2A 1S6PA 2QXFA 4M41A 4CEQA 2NUBA 1NK4A 4N41A 2HMIA 3L8BA 4FJLA 3AO3A 4FK2A 1IO2A 1HRHA 4DF8A 3T1AA 4FJ5A 5JS2A 2OPSA 1RDDA 2YNIA 1XHXA 1Y97A 4RW4A 4CHNA 3BGRA 3DOLA 3OYDA 3SQ2A 1RT4A 5HLFA 1GOAA 4B08A 3HVTA 4E1MA 4AHSA 4CF8A 3MECA 4C8KA 4CJPA 3OYJA 1S1UA 1TL1A 2HHUA 4JS4A 3TR8A 1JLEA 3K5MA 3QNNA 4FJXA 2D0BA 2HNDA 4KTWA 2W42A 3MXIA 1HQUA 4LSLA 1JXBA 4R5PA 3NAEA 1IKVA 4YNQA 3AA3A 3M8PA 4DTNA 3VQ9A 4FK4A 3G10A 1NK6A 3V1OA 1HQEA 4MQ3A 4FLVA 3RRGA 4KTQA 2IC3A 2OPRA 4M3WA 2A1RA 4AILC 3TI0A 3LPTA 1C0UA 4KI6A 1LW2A 4CEFA 3ZSXA 3S3NA 1D9DA 4DWIA 4KHWA 4EP4A 4CHYA 2F8SA 2G8VA 2KZZA 4KHUA 1YT3A 1ZBUA 2RN2A 3VQEA 4E7JA 3SUOA 4DFPA 1TAUA 4DFJA 4AH9A 1U48A 3OS2A 1IKXA 1RTJA 4LD0A 4BE1A 1JLAA 3SNNA 5KRSA 2E6MA 3CFPA 2BGGA 4DU3A 3SPYA 3K58A 2Y1IA 1D5AA 1B9DA 2B6AA 2G8IA 4CGIA 2G8HA 4HHTA 4O0IA 2YHAA 3RMCA 4PWDA 2KTQA 2ZD1A 3QIPA 3AO5A 3LALA 4CEDA 3PX4A 1S9EA 5J2NA 1SUQA 1Q9XA 4M3YA 1KTQA 2GBZA 4KV8A 4N47A 3M8QA 2A1SA 3VQ4A 3K5OA 3D0PA 3RMBA 4ZTJA 1BI4B 3QNOA 1RT5A 2FBXA 3LZIA 3S3MA 3L2VA 1ASVA 3VN5A 3CG7A 1UA1A 1FK9A 3PV8A 4CJKA 4DLEA 3SUNA 3ZT2A 3V9UA 4DQQA 4J2BA 1LAWA 1T03A 1LWFA 4FJJA 3QO9A 1C0MA 4GMJB 1UOCA 5CYMA 1J5OA 4IFYA 4QOZB 3SQ4A 1XHZA 1TKDA 4B8AB 1IKYA 1JXEA 2PYLA 5EU7A 3HPOA 3HL8A 1D9FA 1TK0A 4F2SA 4FJNA 4E7HA 1RILA 1ITGA 3PO4A 1VSMA 3S9HA 4H8KA 4CGGA 3PX6A 3TAGA 4DMNA 1BCMA 3M8SA 4CHOA 3AVGA 1VSIA 1JKHA 5K14A 4CHQA 4YFUA 4FJHA 4NCGA 4CJ5A 3RMAA 4Z4EA 5T7BA 2EX3A 3C95A 2ZQBA 4O0JA 2OYQA 1WSGA 3HYFA 3SUQA 2Z1GA 3QESA 5KRTA 5CZ1A 1WAJA 3HM9A 4OLBA 3HVRA 1X9SA 3V9ZA 1ZBIA 4FLTA 5KGWA 3VQQA 4BE0A 1YVUA 2D0AA 3KK2A 5CY4A 3TARA 4RG8A 4O55A 2YNGA 1J9AA 3T3FA 2O4IA 1RBSA 4B9UA 3KD5E 1NK7A 2OZSA 2PZSA 4W5OA 4FVMA 3V9XA 1VSKA 4W5QA 2HVHA 3LWMA 4LH4A 4KHQA 4CECA 1T7PA 1ASUA 3L2RA 3OJUA 3NDKA 1SL0A 3DLKA 3K57A 4DTXA 4CJ3A 3SQ0A 1GOCA 4DU4A 4AHRA 1NOZA 3WNFA 4IG0A 4CHZA 1WNSA 2F8TA 2G8KA 2DY4A 3V1QA 2G8FA 4Z4IA 3VQ6A 1LWCA 4FLWA 3AVNA 3LAKA 5J2PA 5FDLA 3IS9A 3LAMA 4I9LA 4CGHA 1C1BA 3VQCA 3DOKA 4E7KA 4W5NA 2FBVA 4Z4GA 1ZBFA 1UA0A 3SJJA 4M3UA 2XY6A 3NF6A 1VSJA 1O1WA 1UWBA 4E7IA 1C1CA 3TANA 3KD1E 1HJRA 2OA8A 3AVJA 4F2RA 3AVHA 1SV5A 1HYVA 4CFAA 4CGFA 3DI6A 2HVIA 4CF1A 4OGEA 3OYAA 2I5JA 3CYMA 3SUPA 2PYJA 4CEEA 3VA0A 2VG7A 3TWHA 3K5LA 1RDAA 4FJKA 1S5JA 1Z26A 3L2QA 4DQRA 3DLHA 3QEIA 3TAQA 3AVLA 3QERA 4I2PA 3AO1A 2DFHA 4HUFA 4DTUA 3QEXA 4E89A 4DS5A 3CFRA 1D8YA 4B9VA 4CJVA 2E6LA 3PO5A 2EHGA 4C8MA 4CK3A 1KVAA 1KVCA 1VRTA 3KLFA 3RRHA 1T05A 1N6QA 2Z1HA 1WSFA 1TKXA 1Q8IA 2HB5A 3AA4A 4Z0UA 3IAYA 3CQ8A 4DG1A 3JSMA 4DLGA 3EZ5A 5J2MA 4B9LA 1S1VA 4KI4A 1U04A 2AJQA 2FBYA 3V1RA 2P1JA 3DLEA 3KLEA 3QEWA 4EZ6A 2GV9A 3PUFA 4FW1A 4FM1A 4DSIA 1WSJA 4IBNA 2DFEA 2XO7A 1DLOA 3B6PA 4N5SA 4OKEA 1NKBA 3MAQA 1Q9YA 4QCLA 3LWLA 1SL1A 3WNEA 3HO1A 1X9MA 1HYSA 3B6OA 1RT7A 3O4QA 3P1GA 3NH0A 3DRRA 3OYNA 4B9MA 4CJ4A 4J2EA 1C0TA 4HUGA 3ASMA 3DRPA 4B9SA 4KTZA 2VWJA 3NH2A 2P5OA 3AVBA 4F3TA 4BDPA 4CEOA 2YNFA 1BQMA 3NCIA 1XWLA 4K8ZA 3OYLA 3AVMA 4ELVA 4RW9A 1CZ9A 4OGCA 4CERA 4FJMA 4KHSA 2RPIA 1J53A 4W5RA 3ITHA 4DS4A 3AVAA 4DSKA 3KKRA 4CIFA 1NKCA 4ELTA 2HHQA 1WAFA 3KJVA 4CFCA 4M45A 4FLXA 3C6TA 1JLGA 1CZBA 1RT1A 1HPZA 4OJRA 4O44A 3U6FA 1L3SA 4XIUA 5D3GA 4NYNA 3WNHA 3AVFA 1JLQA 1EP4A 5HRPA 5HP1A 1U49A 2HHXA 2OPPA 1QS4A 1HYZA 1RDBA 1GOBA 1RT3A 3FFIA 3SQ1A 4CJFA 3TAMA 4ZTFA 1REVA 1SKRA 1A5XA 4J2DA 3HJFA 3LPUA 3AO2A 4H4OA 3F73A 3L2UA 3HK2A 3HPGA 3DLRA 4M3ZA 2G8WA 4CIGA 1C1AA 2ATQA 2ZE2A 4CJRA 4L8RB 5FRMA 1VSHA 3LP2A 1F21A 4GVMA 4KFBA 2YV0X 4E3SA 3U3GA 1ZYQA 3ZSVA 4F8RA 1S1TA 4JRPA 3KLGA 2QK9A 1RNHA 3KKSA 4E19A 5HRNA 3EY1A 4DSLA 3VQAA 3OYBA 3UIQA 3AV9A 4CJUA 3TAFA 1B92A 1RBTA 3KIOA 1S9GA 1W9HA 1W0HA 2X74A 4TSXA 3NHGA 4DTRA 4I9QA 4M42A 4JS5A 4KO0A 3ISNC 2R7YA 1TKZA 2VG6A 1JLCA 2E4LA 3ZSZA 4Q5VA 3AVKA 4KHYA 1NJWA 4CF2A 3O3HA 1FKPA 5CZ2A 1NOYA 1JLBA 3NBPA 3QINA 1XC9A 1WLJA 3VQ8A 4JRQA 2YKMA 3LP0A 4FLUA 4H4MA 4KRFA 1CXUA 2YNHA 3QETA 3S3OA 3OYIA 4AHVA 1QSYA 1BQNA 4CEAA 1JL1A 4FZYA 4PUOA 1ZBLA 1MU2A 3ZSYA 2B4JA 2HHTA 4HCCA 5DK5A 3ZSWA 4CGJA 1L3UA 4IKFA 2IGIA 4ID1A 3TAPA 4KHNA 3QEVA 3K5NA 1G15A 3MEDA 2D0CA 3ALYA 4KKOA 3VA3A 4DTPA 1S1WA 4C8OA 4E0DA 5I3UA 4BWMA 1L3VA 2P5GA 3V4IA 2QKKA 4DF4A 1BGXT 4AHCA 1UAXA 4AHUA 4DSJA 3QIOA 3SYZA 5J2QA 3AVCA 1KCFA 4LY7A 3HT3A 4B9NA 4E7LA 4OPKA 3SV4A 3PY8A 4Z4FA 1L3TA 3E01A 3MEEA 3V6DA 3DYAA 4Q0BA 3L3VA 3NFAA 4G1QA 3OY9A 3OYMA 1TAQA 2X6SA 4FM0A 5HROA 4FK0A 3NF9A 4DTJA 3NGZA 3V81A 4FYDA 3OS0A 4FXDA 4FJIA 3AO4A 2GUIA 4CJTA 1RTIA 3KK1A 3KTQA 4DFKA 2IS3A 4RW8A 4DSFA 4LSNA 3DLGA 3OYGA 1NJXA 4FJ9A 3NF8A 4B3OA 4Y1CA 2YKNA 3SPZA 1WN7A 1A5WA 2B5JA 1NJYA 4FZXC 4CK1A 4KB0A 3I0RA 1NK5A 1U47A 2G8UA 5C42A 4HTUA 4BDYA 1VSDA 4DQSA 4DTSA 4BE2A 3SCXA 1NJZA 1QSSA 4KB1A 4Z4CA 1TGOA 1SKSA 3EYZA 3HSTB 5C24A 4N56A 2KZMA 1QQCA 2FC0A 3VQDA 3NH1A 1NK0A 3VQBA 1TL3A 4KAZA 3AA2A 2HHVA 1LWEA 4CJQA 4DSEA 3KLIA 3ZSRA 3MXMA 3NF7A 3O4NA 3QLHA 5HBMA 5SWMA 2HNZA 1KRPA 1EXQA 5KI6A 1HNIA 4Y1DA 4N76A 4FJ8A 1VRUA 3C94A 3K2PA 3ZT3A 1RT2A 1RBRA 3OYEA 4JLHA 3LP3A 4BACA 1KLNA 3D45A 1FKOA 1S6QA 2PY5A 3ZT4A 2BANA 4CHPA 4DTOA 4FJ7A 4HCBA 4K8XA 2FBTA 2RF2A 1FXXA 4BDZA 3PX0A 3THVA 1IG9A 4RW6A 2WOMA 2ITGA 2BDPA 3I8DA 4B8CA 3IG1A 4GW6A 1I3AA 3VQ7A 1KLMA 4DFMA 1WSIA 3DM2A 4CEZA 4NCAA 3P5JA 3BDPA 1CLQA 1JLFA 3CM5A 4FLYA 1XI1A 1EETA 3O3FA 3WNGA 1U45A 1SL2A 2HW3A 3L2WA 2IAJA 4B9TA 4DQIA 1BCOA 4M3RA 1WSHA 5C25A 1VK0A 4DU1A 4KPYA 4CJSA 5CYQA 1QHTA 4CJLA 4ZHRA 3OYKA 2XY5A 2KQ2A 4CK2A 3OYCA 1RTHA 3L3UA 1KSPA 4OKJA 1BIUA 4I7FA 4WE1A 4ELUA 1LV5A 2DFFA 2JLEA 1U4BA 3U3YA 1HMVA 3ULDA 1VSFA 2VWKA 1Z25A 2HNYA 4BWJA 4CEBA 1TV6A 2DTUA 2IDOA 1RDCA 1SKWA 3NGYA 4RW7A 1IH7A 3ZSOA 2XY8A 2O4GA 4FJGA 2HHSA 1TVRA 4CE9A 3OJSA 3M8RA 4DQPA 3DMJA 3CM6A 3G0ZA 1RCHA 3MXJA 3ZCMA 1TK8A 4OVLA 4HVJA 2JGUA 4FCYA 4PY5A 3NE6A 3AVIA 4MFBA 3HP6A 3DLBA 4IG3A 4CJWA 3JYTA 1QSLA 4CCHA 2VG5A 1RT6A 2RKIA 1NK9A 4EZ9A 3HXMA 5KGXA 4CFBA 3IRXA 2QKBA 3O3GA 3TAEA 1I39A 4CESA 3VQ5A 2WONA 5HRRA 3RR8A 3LDSA 3I0SA 4IDKA 4J2AA 2ETJA 1LW0A 1J54A 1NK8A 1QTMA 1KVBA 1KFSA 5HRSA 4CGDA 2P51A 3VQPA 4FW2A 3ZT1A 2XHBA 1EKEA 3AA5X 5J1EA 3OYHA 1KFDA 3NGIA 3V9WA 5I42A 3A2FA 1YTAA 3DRSA 1TK5A 3RWUA 2F96A 1A5VA 4CIEA 1K6YA 4EP5A 1ZBHA 2Q3SA 4IFVA 3LP1A 4NYFA 4F4KA 1IKWA 1DTTA 5JS1A 1LAVA 2Z1IA 1BI4A 4DTMA 1YTUA 4PQUA 4FZZA 3V9SA 4Z4HA 2KFZA 3KK3A 2IOCA 4E1NA 3SV3A 1JL2A 1X1PA 4O5BA 1T8EA 1S1XA 4ICLA 4PA1A 4HUEA 1NKEA 5KTQA 4OLAA 5E41A 3H08A 3C6UA 1BL3A 4LH5A 1L5UA 2D5RA 3RR7A 4NCBA 3OYFA 1RTDA 4O4GA 1VSLA 1EX4A 1RBVA 3SZ2A 3TABA 1N5YA 4M3XA 4M3TA 4F3OA 3KLHA 1HNVA 4C8LA 4C8NA 1QE1A 2XY7A 3F9KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VSE A;  4CJE A;  2Z1J A;  3QEP A;  2OZM A;  4CF9 A;  2HHW A;  3SI6 A;  1BIS A;  5SZT A;  3RMD A;  3LAN A;  4CFD A;  3HPH A;  4W5T A;  5FRO A;  1WSE A;  3HP9 A;  4QAG A;  2YHB A;  1C6V A;  5FRN A;  4ID5 A;  5DMR A;  2OPQ A;  3K59 A;  1B9F A;  4CF0 A;  1RBU A;  2X6N A;  4UQG A;  4OKK A;  4FLZ A;  3LZJ A;  1TKT A;  3CFO A;  1R0A A;  4KRE A;  1BIZ A;  1BHL A;  2BE2 A;  2X78 A;  3ZSQ A;  1CXQ A;  3ZT0 A;  4AHT A;  3P83 D;  4I2Q A;  3OS1 A;  1X9W A;  4OPJ A;  3T19 A;  1DTQ A;  3MEG A;  2LSN A;  2KFN A;  2Y1J A;  1ASW A;  3OVN A;  2KW4 A;  2XRI A;  3RTV A;  4FM2 A;  1S6P A;  2QXF A;  4M41 A;  4CEQ A;  2NUB A;  1NK4 A;  4N41 A;  2HMI A;  3L8B A;  4FJL A;  3AO3 A;  4FK2 A;  1IO2 A;  1HRH A;  4DF8 A;  3T1A A;  4FJ5 A;  5JS2 A;  2OPS A;  1RDD A;  2YNI A;  1XHX A;  1Y97 A;  4RW4 A;  4CHN A;  3BGR A;  3DOL A;  3OYD A;  3SQ2 A;  1RT4 A;  5HLF A;  1GOA A;  4B08 A;  3HVT A;  4E1M A;  4AHS A;  4CF8 A;  3MEC A;  4C8K A;  4CJP A;  3OYJ A;  1S1U A;  1TL1 A;  2HHU A;  4JS4 A;  3TR8 A;  1JLE A;  3K5M A;  3QNN A;  4FJX A;  2D0B A;  2HND A;  4KTW A;  2W42 A;  3MXI A;  1HQU A;  4LSL A;  1JXB A;  4R5P A;  3NAE A;  1IKV A;  4YNQ A;  3AA3 A;  3M8P A;  4DTN A;  3VQ9 A;  4FK4 A;  3G10 A;  1NK6 A;  3V1O A;  1HQE A;  4MQ3 A;  4FLV A;  3RRG A;  4KTQ A;  2IC3 A;  2OPR A;  4M3W A;  2A1R A;  4AIL C;  3TI0 A;  3LPT A;  1C0U A;  4KI6 A;  1LW2 A;  4CEF A;  3ZSX A;  3S3N A;  1D9D A;  4DWI A;  4KHW A;  4EP4 A;  4CHY A;  2F8S A;  2G8V A;  2KZZ A;  4KHU A;  1YT3 A;  1ZBU A;  2RN2 A;  3VQE A;  4E7J A;  3SUO A;  4DFP A;  1TAU A;  4DFJ A;  4AH9 A;  1U48 A;  3OS2 A;  1IKX A;  1RTJ A;  4LD0 A;  4BE1 A;  1JLA A;  3SNN A;  5KRS A;  2E6M A;  3CFP A;  2BGG A;  4DU3 A;  3SPY A;  3K58 A;  2Y1I A;  1D5A A;  1B9D A;  2B6A A;  2G8I A;  4CGI A;  2G8H A;  4HHT A;  4O0I A;  2YHA A;  3RMC A;  4PWD A;  2KTQ A;  2ZD1 A;  3QIP A;  3AO5 A;  3LAL A;  4CED A;  3PX4 A;  1S9E A;  5J2N A;  1SUQ A;  1Q9X A;  4M3Y A;  1KTQ A;  2GBZ A;  4KV8 A;  4N47 A;  3M8Q A;  2A1S A;  3VQ4 A;  3K5O A;  3D0P A;  3RMB A;  4ZTJ A;  1BI4 B;  3QNO A;  1RT5 A;  2FBX A;  3LZI A;  3S3M A;  3L2V A;  1ASV A;  3VN5 A;  3CG7 A;  1UA1 A;  1FK9 A;  3PV8 A;  4CJK A;  4DLE A;  3SUN A;  3ZT2 A;  3V9U A;  4DQQ A;  4J2B A;  1LAW A;  1T03 A;  1LWF A;  4FJJ A;  3QO9 A;  1C0M A;  4GMJ B;  1UOC A;  5CYM A;  1J5O A;  4IFY A;  4QOZ B;  3SQ4 A;  1XHZ A;  1TKD A;  4B8A B;  1IKY A;  1JXE A;  2PYL A;  5EU7 A;  3HPO A;  3HL8 A;  1D9F A;  1TK0 A;  4F2S A;  4FJN A;  4E7H A;  1RIL A;  1ITG A;  3PO4 A;  1VSM A;  3S9H A;  4H8K A;  4CGG A;  3PX6 A;  3TAG A;  4DMN A;  1BCM A;  3M8S A;  4CHO A;  3AVG A;  1VSI A;  1JKH A;  5K14 A;  4CHQ A;  4YFU A;  4FJH A;  4NCG A;  4CJ5 A;  3RMA A;  4Z4E A;  5T7B A;  2EX3 A;  3C95 A;  2ZQB A;  4O0J A;  2OYQ A;  1WSG A;  3HYF A;  3SUQ A;  2Z1G A;  3QES A;  5KRT A;  5CZ1 A;  1WAJ A;  3HM9 A;  4OLB A;  3HVR A;  1X9S A;  3V9Z A;  1ZBI A;  4FLT A;  5KGW A;  3VQQ A;  4BE0 A;  1YVU A;  2D0A A;  3KK2 A;  5CY4 A;  3TAR A;  4RG8 A;  4O55 A;  2YNG A;  1J9A A;  3T3F A;  2O4I A;  1RBS A;  4B9U A;  3KD5 E;  1NK7 A;  2OZS A;  2PZS A;  4W5O A;  4FVM A;  3V9X A;  1VSK A;  4W5Q A;  2HVH A;  3LWM A;  4LH4 A;  4KHQ A;  4CEC A;  1T7P A;  1ASU A;  3L2R A;  3OJU A;  3NDK A;  1SL0 A;  3DLK A;  3K57 A;  4DTX A;  4CJ3 A;  3SQ0 A;  1GOC A;  4DU4 A;  4AHR A;  1NOZ A;  3WNF A;  4IG0 A;  4CHZ A;  1WNS A;  2F8T A;  2G8K A;  2DY4 A;  3V1Q A;  2G8F A;  4Z4I A;  3VQ6 A;  1LWC A;  4FLW A;  3AVN A;  3LAK A;  5J2P A;  5FDL A;  3IS9 A;  3LAM A;  4I9L A;  4CGH A;  1C1B A;  3VQC A;  3DOK A;  4E7K A;  4W5N A;  2FBV A;  4Z4G A;  1ZBF A;  1UA0 A;  3SJJ A;  4M3U A;  2XY6 A;  3NF6 A;  1VSJ A;  1O1W A;  1UWB A;  4E7I A;  1C1C A;  3TAN A;  3KD1 E;  1HJR A;  2OA8 A;  3AVJ A;  4F2R A;  3AVH A;  1SV5 A;  1HYV A;  4CFA A;  4CGF A;  3DI6 A;  2HVI A;  4CF1 A;  4OGE A;  3OYA A;  2I5J A;  3CYM A;  3SUP A;  2PYJ A;  4CEE A;  3VA0 A;  2VG7 A;  3TWH A;  3K5L A;  1RDA A;  4FJK A;  1S5J A;  1Z26 A;  3L2Q A;  4DQR A;  3DLH A;  3QEI A;  3TAQ A;  3AVL A;  3QER A;  4I2P A;  3AO1 A;  2DFH A;  4HUF A;  4DTU A;  3QEX A;  4E89 A;  4DS5 A;  3CFR A;  1D8Y A;  4B9V A;  4CJV A;  2E6L A;  3PO5 A;  2EHG A;  4C8M A;  4CK3 A;  1KVA A;  1KVC A;  1VRT A;  3KLF A;  3RRH A;  1T05 A;  1N6Q A;  2Z1H A;  1WSF A;  1TKX A;  1Q8I A;  2HB5 A;  3AA4 A;  4Z0U A;  3IAY A;  3CQ8 A;  4DG1 A;  3JSM A;  4DLG A;  3EZ5 A;  5J2M A;  4B9L A;  1S1V A;  4KI4 A;  1U04 A;  2AJQ A;  2FBY A;  3V1R A;  2P1J A;  3DLE A;  3KLE A;  3QEW A;  4EZ6 A;  2GV9 A;  3PUF A;  4FW1 A;  4FM1 A;  4DSI A;  1WSJ A;  4IBN A;  2DFE A;  2XO7 A;  1DLO A;  3B6P A;  4N5S A;  4OKE A;  1NKB A;  3MAQ A;  1Q9Y A;  4QCL A;  3LWL A;  1SL1 A;  3WNE A;  3HO1 A;  1X9M A;  1HYS A;  3B6O A;  1RT7 A;  3O4Q A;  3P1G A;  3NH0 A;  3DRR A;  3OYN A;  4B9M A;  4CJ4 A;  4J2E A;  1C0T A;  4HUG A;  3ASM A;  3DRP A;  4B9S A;  4KTZ A;  2VWJ A;  3NH2 A;  2P5O A;  3AVB A;  4F3T A;  4BDP A;  4CEO A;  2YNF A;  1BQM A;  3NCI A;  1XWL A;  4K8Z A;  3OYL A;  3AVM A;  4ELV A;  4RW9 A;  1CZ9 A;  4OGC A;  4CER A;  4FJM A;  4KHS A;  2RPI A;  1J53 A;  4W5R A;  3ITH A;  4DS4 A;  3AVA A;  4DSK A;  3KKR A;  4CIF A;  1NKC A;  4ELT A;  2HHQ A;  1WAF A;  3KJV A;  4CFC A;  4M45 A;  4FLX A;  3C6T A;  1JLG A;  1CZB A;  1RT1 A;  1HPZ A;  4OJR A;  4O44 A;  3U6F A;  1L3S A;  4XIU A;  5D3G A;  4NYN A;  3WNH A;  3AVF A;  1JLQ A;  1EP4 A;  5HRP A;  5HP1 A;  1U49 A;  2HHX A;  2OPP A;  1QS4 A;  1HYZ A;  1RDB A;  1GOB A;  1RT3 A;  3FFI A;  3SQ1 A;  4CJF A;  3TAM A;  4ZTF A;  1REV A;  1SKR A;  1A5X A;  4J2D A;  3HJF A;  3LPU A;  3AO2 A;  4H4O A;  3F73 A;  3L2U A;  3HK2 A;  3HPG A;  3DLR A;  4M3Z A;  2G8W A;  4CIG A;  1C1A A;  2ATQ A;  2ZE2 A;  4CJR A;  4L8R B;  5FRM A;  1VSH A;  3LP2 A;  1F21 A;  4GVM A;  4KFB A;  2YV0 X;  4E3S A;  3U3G A;  1ZYQ A;  3ZSV A;  4F8R A;  1S1T A;  4JRP A;  3KLG A;  2QK9 A;  1RNH A;  3KKS A;  4E19 A;  5HRN A;  3EY1 A;  4DSL A;  3VQA A;  3OYB A;  3UIQ A;  3AV9 A;  4CJU A;  3TAF A;  1B92 A;  1RBT A;  3KIO A;  1S9G A;  1W9H A;  1W0H A;  2X74 A;  4TSX A;  3NHG A;  4DTR A;  4I9Q A;  4M42 A;  4JS5 A;  4KO0 A;  3ISN C;  2R7Y A;  1TKZ A;  2VG6 A;  1JLC A;  2E4L A;  3ZSZ A;  4Q5V A;  3AVK A;  4KHY A;  1NJW A;  4CF2 A;  3O3H A;  1FKP A;  5CZ2 A;  1NOY A;  1JLB A;  3NBP A;  3QIN A;  1XC9 A;  1WLJ A;  3VQ8 A;  4JRQ A;  2YKM A;  3LP0 A;  4FLU A;  4H4M A;  4KRF A;  1CXU A;  2YNH A;  3QET A;  3S3O A;  3OYI A;  4AHV A;  1QSY A;  1BQN A;  4CEA A;  1JL1 A;  4FZY A;  4PUO A;  1ZBL A;  1MU2 A;  3ZSY A;  2B4J A;  2HHT A;  4HCC A;  5DK5 A;  3ZSW A;  4CGJ A;  1L3U A;  4IKF A;  2IGI A;  4ID1 A;  3TAP A;  4KHN A;  3QEV A;  3K5N A;  1G15 A;  3MED A;  2D0C A;  3ALY A;  4KKO A;  3VA3 A;  4DTP A;  1S1W A;  4C8O A;  4E0D A;  5I3U A;  4BWM A;  1L3V A;  2P5G A;  3V4I A;  2QKK A;  4DF4 A;  1BGX T;  4AHC A;  1UAX A;  4AHU A;  4DSJ A;  3QIO A;  3SYZ A;  5J2Q A;  3AVC A;  1KCF A;  4LY7 A;  3HT3 A;  4B9N A;  4E7L A;  4OPK A;  3SV4 A;  3PY8 A;  4Z4F A;  1L3T A;  3E01 A;  3MEE A;  3V6D A;  3DYA A;  4Q0B A;  3L3V A;  3NFA A;  4G1Q A;  3OY9 A;  3OYM A;  1TAQ A;  2X6S A;  4FM0 A;  5HRO A;  4FK0 A;  3NF9 A;  4DTJ A;  3NGZ A;  3V81 A;  4FYD A;  3OS0 A;  4FXD A;  4FJI A;  3AO4 A;  2GUI A;  4CJT A;  1RTI A;  3KK1 A;  3KTQ A;  4DFK A;  2IS3 A;  4RW8 A;  4DSF A;  4LSN A;  3DLG A;  3OYG A;  1NJX A;  4FJ9 A;  3NF8 A;  4B3O A;  4Y1C A;  2YKN A;  3SPZ A;  1WN7 A;  1A5W A;  2B5J A;  1NJY A;  4FZX C;  4CK1 A;  4KB0 A;  3I0R A;  1NK5 A;  1U47 A;  2G8U A;  5C42 A;  4HTU A;  4BDY A;  1VSD A;  4DQS A;  4DTS A;  4BE2 A;  3SCX A;  1NJZ A;  1QSS A;  4KB1 A;  4Z4C A;  1TGO A;  1SKS A;  3EYZ A;  3HST B;  5C24 A;  4N56 A;  2KZM A;  1QQC A;  2FC0 A;  3VQD A;  3NH1 A;  1NK0 A;  3VQB A;  1TL3 A;  4KAZ A;  3AA2 A;  2HHV A;  1LWE A;  4CJQ A;  4DSE A;  3KLI A;  3ZSR A;  3MXM A;  3NF7 A;  3O4N A;  3QLH A;  5HBM A;  5SWM A;  2HNZ A;  1KRP A;  1EXQ A;  5KI6 A;  1HNI A;  4Y1D A;  4N76 A;  4FJ8 A;  1VRU A;  3C94 A;  3K2P A;  3ZT3 A;  1RT2 A;  1RBR A;  3OYE A;  4JLH A;  3LP3 A;  4BAC A;  1KLN A;  3D45 A;  1FKO A;  1S6Q A;  2PY5 A;  3ZT4 A;  2BAN A;  4CHP A;  4DTO A;  4FJ7 A;  4HCB A;  4K8X A;  2FBT A;  2RF2 A;  1FXX A;  4BDZ A;  3PX0 A;  3THV A;  1IG9 A;  4RW6 A;  2WOM A;  2ITG A;  2BDP A;  3I8D A;  4B8C A;  3IG1 A;  4GW6 A;  1I3A A;  3VQ7 A;  1KLM A;  4DFM A;  1WSI A;  3DM2 A;  4CEZ A;  4NCA A;  3P5J A;  3BDP A;  1CLQ A;  1JLF A;  3CM5 A;  4FLY A;  1XI1 A;  1EET A;  3O3F A;  3WNG A;  1U45 A;  1SL2 A;  2HW3 A;  3L2W A;  2IAJ A;  4B9T A;  4DQI A;  1BCO A;  4M3R A;  1WSH A;  5C25 A;  1VK0 A;  4DU1 A;  4KPY A;  4CJS A;  5CYQ A;  1QHT A;  4CJL A;  4ZHR A;  3OYK A;  2XY5 A;  2KQ2 A;  4CK2 A;  3OYC A;  1RTH A;  3L3U A;  1KSP A;  4OKJ A;  1BIU A;  4I7F A;  4WE1 A;  4ELU A;  1LV5 A;  2DFF A;  2JLE A;  1U4B A;  3U3Y A;  1HMV A;  3ULD A;  1VSF A;  2VWK A;  1Z25 A;  2HNY A;  4BWJ A;  4CEB A;  1TV6 A;  2DTU A;  2IDO A;  1RDC A;  1SKW A;  3NGY A;  4RW7 A;  1IH7 A;  3ZSO A;  2XY8 A;  2O4G A;  4FJG A;  2HHS A;  1TVR A;  4CE9 A;  3OJS A;  3M8R A;  4DQP A;  3DMJ A;  3CM6 A;  3G0Z A;  1RCH A;  3MXJ A;  3ZCM A;  1TK8 A;  4OVL A;  4HVJ A;  2JGU A;  4FCY A;  4PY5 A;  3NE6 A;  3AVI A;  4MFB A;  3HP6 A;  3DLB A;  4IG3 A;  4CJW A;  3JYT A;  1QSL A;  4CCH A;  2VG5 A;  1RT6 A;  2RKI A;  1NK9 A;  4EZ9 A;  3HXM A;  5KGX A;  4CFB A;  3IRX A;  2QKB A;  3O3G A;  3TAE A;  1I39 A;  4CES A;  3VQ5 A;  2WON A;  5HRR A;  3RR8 A;  3LDS A;  3I0S A;  4IDK A;  4J2A A;  2ETJ A;  1LW0 A;  1J54 A;  1NK8 A;  1QTM A;  1KVB A;  1KFS A;  5HRS A;  4CGD A;  2P51 A;  3VQP A;  4FW2 A;  3ZT1 A;  2XHB A;  1EKE A;  3AA5 X;  5J1E A;  3OYH A;  1KFD A;  3NGI A;  3V9W A;  5I42 A;  3A2F A;  1YTA A;  3DRS A;  1TK5 A;  3RWU A;  2F96 A;  1A5V A;  4CIE A;  1K6Y A;  4EP5 A;  1ZBH A;  2Q3S A;  4IFV A;  3LP1 A;  4NYF A;  4F4K A;  1IKW A;  1DTT A;  5JS1 A;  1LAV A;  2Z1I A;  1BI4 A;  4DTM A;  1YTU A;  4PQU A;  4FZZ A;  3V9S A;  4Z4H A;  2KFZ A;  3KK3 A;  2IOC A;  4E1N A;  3SV3 A;  1JL2 A;  1X1P A;  4O5B A;  1T8E A;  1S1X A;  4ICL A;  4PA1 A;  4HUE A;  1NKE A;  5KTQ A;  4OLA A;  5E41 A;  3H08 A;  3C6U A;  1BL3 A;  4LH5 A;  1L5U A;  2D5R A;  3RR7 A;  4NCB A;  3OYF A;  1RTD A;  4O4G A;  1VSL A;  1EX4 A;  1RBV A;  3SZ2 A;  3TAB A;  1N5Y A;  4M3X A;  4M3T A;  4F3O A;  3KLH A;  1HNV A;  4C8L A;  4C8N A;  1QE1 A;  2XY7 A;  3F9K A; 
#chains in the Genus database with same CATH topology
 1VSE A;  2E8A A;  1DT9 A;  3UKU B;  2OZM A;  3L4Q A;  1BU6 O;  2HHW A;  4O8U A;  3SI6 A;  2O8E B;  5DM6 L;  3LAN A;  4CFD A;  4W5T A;  4A62 A;  4BRM A;  2YHB A;  1C6V A;  3VF2 A;  5FRN A;  2QW9 A;  2OPQ A;  5AQF A;  2WBN A;  2E2Q A;  4FLZ A;  3CER A;  4KRE A;  2BE2 A;  3ZSQ A;  1CXQ A;  3ZT0 A;  1Q7Y O;  3CCJ N;  3OS1 A;  4OPJ A;  3Q7B A;  4BR7 A;  3T19 A;  3OVN A;  3ZEU B;  2BTF A;  2KW4 A;  2XRI A;  3VF6 A;  2QXF A;  4M41 A;  4JI5 K;  5AZI A;  4BRG A;  3ULE A;  3L8B A;  4DQ8 A;  4DF8 A;  2OPS A;  1RDD A;  4RW4 A;  3I56 N;  4CHN A;  3GBT A;  4H0X B;  4B08 A;  4C8K A;  4CF8 A;  4B1W B;  1T6C A;  3N4P A;  2HBK A;  5AQV A;  1EQY A;  4LF7 K;  4JS4 A;  3TR8 A;  1JLE A;  3K5M A;  4OO1 J;  4FJX A;  1HQU A;  1JXB A;  4YHH K;  1IBM K;  1R59 O;  4YNQ A;  3M8P A;  1NK6 A;  1IBL K;  1N34 K;  4MQ3 A;  4DV4 K;  2IC3 A;  3LPT A;  1C0U A;  4KI6 A;  1LW2 A;  4CEF A;  4IO9 L;  2F8S A;  4AF1 A;  3HI0 A;  1ZBU A;  2RN2 A;  1G99 A;  4XEI A;  5KRS A;  2HMP A;  3CFP A;  4DU3 A;  3VPZ A;  4BRE A;  3THX B;  4BC5 A;  4C1N I;  2KTQ A;  1YF5 L;  5M1K A;  3PX4 A;  4CZM A;  1ATS A;  2P9P A;  1SUQ A;  4M3Y A;  4H0V B;  1KTQ A;  4ZTJ A;  3D0P A;  4OPH A;  3CG7 A;  3SMS A;  3ZT2 A;  4MDA A;  4JI0 K;  3QIC A;  4R79 A;  3O4W A;  4FJJ A;  3MN9 A;  1C0M A;  4GMJ B;  4FPA A;  1J5O A;  4IFY A;  3H1V X;  2RHK A;  2YCH A;  3SQ4 A;  5AQJ A;  3QBW A;  2PYL A;  2QWN A;  1D9F A;  1HNX K;  3CQX A;  4FJN A;  4F2S A;  3SAG A;  1RIL A;  1ITG A;  3S9H A;  4H8K A;  4CGG A;  2QM1 A;  1BCM A;  1VQ5 N;  3AVG A;  3RSE A;  4FJH A;  5BPN A;  5F1X A;  4LF6 K;  5CZ1 A;  5KGW A;  4YOT A;  5CY4 A;  1GLJ O;  4O55 A;  1NGI A;  4BG9 A;  3CMA N;  4W5O A;  5LL6 Z;  1VSK A;  1T7P A;  1ATR A;  1WBD A;  3DAW A;  3K57 A;  1GOC A;  5AZI B;  3ULE B;  1GLA G;  2F8T A;  4PL8 A;  5LMN K;  4BVO A;  1U6Z A;  3VQ6 A;  1LWC A;  1H1V A;  3IS9 A;  1O13 A;  1Q18 A;  3DXM B;  4Z4G A;  4M3U A;  2XY6 A;  1VSJ A;  3KD1 E;  3VMF B;  2A5X A;  3WXI A;  4F2R A;  3AVH A;  3AAR A;  3T7Z A;  3ENH A;  3JS6 A;  5AR0 A;  4OGE A;  4CF1 A;  3MN5 A;  2PYJ A;  1RDA A;  3CHW A;  4XH4 A;  3QML A;  3TAQ A;  2UXB K;  1WBB A;  2DFH A;  3CCM N;  3CFR A;  5JLF A;  3JAM O;  4CJV A;  1D8Y A;  5JIC A;  3F9M A;  4C8M A;  3KLF A;  1KVC A;  4CBW A;  3RRH A;  3L0Q A;  1TKX A;  1Q8I A;  2NNW A;  3AA4 A;  3T69 A;  3JSM A;  4DLG A;  2EWS A;  4JKH A;  4IZ9 A;  1TUY A;  4KI4 A;  1U04 A;  2FBY A;  3DLE A;  3T1H K;  3O1B A;  4EZ6 A;  2VCP A;  3PUF A;  3P38 A;  2P9P B;  1HKG A;  4IBN A;  2DFE A;  1DLO A;  2QWR A;  4GV6 A;  1RT7 A;  3O4Q A;  3DRR A;  4HUG A;  4Z94 A;  1P8Z A;  4DHY A;  3AVB A;  4CEO A;  3NCI A;  1BQM A;  3OYL A;  4ELV A;  3UE5 A;  4OGC A;  5M1N A;  4FJM A;  5ADX H;  3ATU A;  1WAF A;  3KJV A;  4CFC A;  3C6T A;  1JLG A;  4OJR A;  4O44 A;  4B1Z A;  4XIU A;  5D3G A;  3CCS N;  4NYN A;  2A6A A;  1GLL O;  1JLQ A;  2OPP A;  1EWR A;  1QS4 A;  1QVF M;  1GOB A;  3BZC A;  4KH6 A;  4CJF A;  1REV A;  3F5T A;  3LPU A;  3AO2 A;  2F4V K;  3HJF A;  3DLR A;  4YOU A;  4CIG A;  1C1A A;  4CJR A;  1OH8 A;  3LP2 A;  1F21 A;  4GVM A;  3ZSV A;  5EXW A;  1S1T A;  4ILH A;  4M63 C;  4CJU A;  1W9H A;  3D2F A;  4KO0 A;  3ISN C;  4KHY A;  4EFH A;  1VQ4 N;  4FOE A;  1LCU A;  1WLJ A;  3VQ8 A;  2YKM A;  4JI3 K;  4FLU A;  1YAG A;  1CXU A;  2CH6 A;  3S3O A;  3O5B A;  4AHV A;  2D0P A;  1BQN A;  1JL1 A;  1VQM N;  3ZSY A;  4JAX A;  3VEZ A;  4HCC A;  1L3U A;  4IKF A;  3MED A;  3VA3 A;  4C8O A;  1Z05 A;  4BWM A;  2P5G A;  1UAX A;  5HOO A;  3AVC A;  1KCF A;  3RVC A;  5JMV A;  4E7L A;  3PY8 A;  1L3T A;  3IKM A;  4Q0B A;  1X3N A;  1OVY A;  3D2E B;  3DYA A;  5LMU K;  3SJH A;  5AQQ A;  3NFA A;  4H5T A;  5BRD A;  2X6S A;  4FM0 A;  5HRO A;  4GY2 B;  4U67 L;  1XC3 A;  2PBD A;  1C0G A;  3TSP A;  1N33 K;  3CD6 N;  2GUI A;  2DPN A;  3KTQ A;  4PKH A;  3OYG A;  4FJ9 A;  5M1O A;  5AFU A;  5AQS A;  1WN7 A;  1NJY A;  5ELZ A;  4CK1 A;  4KB0 A;  4FZX C;  4BRO A;  4DV0 K;  2G8U A;  5C42 A;  4BDY A;  1VSD A;  4DTS A;  4KB1 A;  4RTF D;  4DV3 K;  3VQD A;  3P4I A;  4BR4 A;  3H1Q A;  3TPQ A;  2HHV A;  3H46 O;  1TYQ A;  3MXM A;  2ZGZ A;  1KRP A;  1EXQ A;  3E66 A;  3G71 N;  3OYE A;  1NGD A;  3D45 A;  1DGK N;  4AM7 A;  4FVU A;  2HF4 A;  5M1P A;  4RWT A;  3ZT4 A;  4CHP A;  4B3S K;  4DR2 K;  4HCB A;  4K8X A;  4OX9 K;  2RF2 A;  4BDZ A;  1QZ6 A;  3ENB A;  1IG9 A;  3I8D A;  4B3T K;  3NMU A;  1NNE A;  1NGA A;  5KPR A;  1CLQ A;  1XI1 A;  1SL2 A;  1BO5 O;  4M3R A;  1WSH A;  3D2F B;  3OW2 M;  2ZF5 O;  1RTH A;  4KHP K;  1SS6 A;  1BIU A;  4OKJ A;  5AZJ B;  4ELU A;  1LV5 A;  2DFF A;  3ATV A;  5BR8 K;  3U3Y A;  5AQG A;  4CD3 A;  2GWK A;  4FJG A;  2GEL A;  1BA1 A;  4CE9 A;  3M8R A;  3CM6 A;  4PY5 A;  3HP6 A;  3SK3 A;  3SAF A;  2CH5 A;  4CJW A;  2QKB A;  2NLX A;  1I39 A;  2E2P A;  3R3L A;  3LDS A;  1E4F T;  3I0S A;  4J2A A;  3CME N;  1LW0 A;  1NK8 A;  1QTM A;  1KVB A;  1KFS A;  1OVQ A;  1OH5 A;  2P9N A;  3AA5 X;  3OYH A;  5JVH L;  1YJN N;  3HOT A;  3A2F A;  1YTA A;  3DRS A;  1TK5 A;  2F96 A;  1K6Y A;  3KZB A;  4IFV A;  4NYF A;  5GIO A;  3CXC M;  1IKW A;  4UY8 O;  1BI4 A;  1YTU A;  4Z4H A;  1JL2 A;  1X1P A;  2E1Z A;  5EX5 A;  4JI7 K;  1Q86 O;  4DUZ K;  3Q7C A;  1TYQ B;  3RR7 A;  4NCB A;  3LL3 A;  2AA4 A;  3VGL A;  4FWR A;  4DR3 K;  1GLC G;  3UKR A;  1N5Y A;  4FPB A;  5GAG P;  4C8N A;  3N4Q A;  5C12 A;  4CJE A;  4CI6 A;  4MO5 A;  2UXC K;  5SZT A;  3RMD A;  3VER A;  4YOR A;  4DKW A;  3OBW A;  4JKB A;  4B3M K;  3QDK A;  1VQO N;  3K59 A;  4UQG A;  4OKK A;  1ILY A;  3THW A;  1TKT A;  1R0A A;  1BHL A;  4AHT A;  4LFB K;  1DTQ A;  3O6W A;  3MEG A;  5BRE A;  3H3O B;  1YHQ N;  1Q81 O;  3MX2 A;  1S6P A;  2HMI A;  2NZT A;  4FJL A;  4FK2 A;  1IO2 A;  4H0T B;  3J7A P;  2O8E A;  1XHX A;  3DOL A;  1OH6 A;  1GOA A;  4BGA A;  4E1M A;  4Y0W A;  3ID6 A;  3MEC A;  3OYJ A;  1S1U A;  3QNN A;  3MXI A;  1HKB A;  4R5P A;  3NAE A;  3AA3 A;  4LF5 K;  3VQ9 A;  4M3W A;  3TI0 A;  3E9L A;  3ZSX A;  4KHW A;  2Q0U A;  3MCP A;  4ISF A;  2NRH A;  4DUY K;  5FPE A;  1YT3 A;  2QA4 N;  4E7J A;  4FO0 A;  3W0L A;  4DFJ A;  1TAU A;  3CCU N;  3OS2 A;  1IKX A;  1B9D A;  1QHA A;  2B6A A;  1VQL N;  2G8I A;  4HHT A;  2YHA A;  3QIP A;  1DEJ A;  1NLV A;  4CED A;  1S9E A;  1BG3 A;  5J2N A;  1Q9X A;  4KV8 A;  4N47 A;  2A1S A;  1BI4 B;  5AQR A;  2FBX A;  3O1W A;  3LZI A;  3L2V A;  1KC8 O;  1GLF O;  1FK9 A;  3PV8 A;  1K73 O;  4DLE A;  3O9T A;  4IOC L;  4J2B A;  1T03 A;  1LWF A;  3MCA B;  1KQS M;  5CYM A;  4YDU C;  2PAV A;  1XHZ A;  1EO1 A;  4B8A B;  1KD1 O;  1JXE A;  5EU7 A;  3PX6 A;  3TAG A;  1OH7 A;  4CHO A;  1VSI A;  1JKH A;  5K14 A;  2PFU A;  5IT9 O;  4Z4E A;  2EX3 A;  3C95 A;  3P39 A;  4O0J A;  3HYF A;  1NG9 A;  4GVE A;  2Z1G A;  4OLB A;  4QS7 A;  1WAJ A;  1YUW A;  4BE0 A;  1YVU A;  2D0A A;  3ZX3 A;  3TAR A;  3EE8 A;  3THW B;  2O4I A;  1RBS A;  2PZS A;  3VES A;  2GWJ A;  4JK9 A;  1ASU A;  3DLK A;  4DU4 A;  1N32 K;  5AQP A;  1NOZ A;  4H5N A;  4WF9 L;  4CHZ A;  2G8F A;  3LDO A;  4FLW A;  3AVN A;  4I9L A;  1XQS C;  1ZBF A;  3LM2 A;  3SJJ A;  1UA0 A;  3K9J A;  1O1W A;  1UWB A;  5GIP A;  4B9Q A;  4JHD B;  4IFE A;  5KPZ A;  3K5L A;  2ASM A;  1Z26 A;  3L2Q A;  3L4I A;  3J7Y P;  3DLH A;  4BVP A;  4I2P A;  2VGN A;  4CZL A;  4E89 A;  1ESV A;  4B9V A;  3VEN A;  3DXM A;  2EHG A;  1N6Q A;  2Z1H A;  1WSF A;  3CQ8 A;  4DG1 A;  4BC4 A;  1S1V A;  3V1R A;  3QEW A;  2P1J A;  3KLE A;  2O8D B;  4LF9 K;  2GEM A;  4FW1 A;  4FM1 A;  3VEX A;  3G25 A;  1S72 N;  3B6P A;  2ZWH A;  4QCL A;  1HYS A;  3FR0 A;  1X9M A;  1NGC A;  3P1G A;  4B9M A;  4J2E A;  5LJW A;  4ISE A;  5AQM A;  1U2V B;  2YJE A;  2VWJ A;  3NH2 A;  2FF6 A;  4CBX A;  4F3T A;  1XWL A;  3CCE N;  3AVM A;  4IO8 A;  3C7N A;  4W5R A;  4ELT A;  1SQK A;  4FWS A;  1S22 A;  3U8X A;  4M7X A;  4WQ4 C;  1HPZ A;  3A5N C;  3U6F A;  5HP1 A;  1EP4 A;  2YHW A;  1HYZ A;  3FZK A;  1VQ7 N;  1RT3 A;  3SQ1 A;  4GV3 A;  1XNQ K;  3TAM A;  4ZTF A;  4DV2 K;  2QTD A;  3GE1 A;  1A5X A;  4J2D A;  5GAE P;  1HPM A;  1JCF A;  3HPG A;  1YI2 N;  3E9P A;  4M3Z A;  3C0B A;  2KHO A;  1VSH A;  3O9Q A;  4KFB A;  2YV0 X;  4E3S A;  3U3G A;  1QQN A;  4BY9 C;  3DXK B;  4JK8 A;  4DSL A;  3TAF A;  3A0I X;  3KIO A;  4I9Q A;  4H0Y B;  4JS5 A;  2O8C B;  2VG6 A;  2E4L A;  4CW7 B;  5F0X A;  3THY A;  2E88 A;  3IDH A;  3O3H A;  1JLB A;  3QIN A;  4JRQ A;  3LP0 A;  3MWP A;  4KRF A;  4DV6 K;  1I94 K;  4CGJ A;  3CC4 N;  2IGI A;  3WT0 A;  1VQN N;  3QEV A;  2HBJ A;  4DTP A;  1S1W A;  4WQ5 A;  3CCQ N;  1ZC6 A;  1BGX T;  4AHC A;  4AHU A;  1P90 A;  3QIO A;  4J8F A;  2GUP A;  3H6E A;  4LY7 A;  4OPK A;  3MEE A;  3AY9 A;  3R1X A;  3OY9 A;  1J5E K;  4YOV A;  5KQ8 A;  4DTJ A;  1QQM A;  4FXD A;  3TTC A;  3FGU A;  4CJT A;  1RTI A;  4EHT A;  3K9K A;  3KK1 A;  4RW8 A;  3CCV N;  3NF8 A;  4B3O A;  4Y1C A;  2W41 A;  1N8R O;  1A5W A;  2B5J A;  1NK5 A;  4HTU A;  3C65 A;  3R9P A;  4N56 A;  3PSF A;  4BRH A;  3D2E A;  3VQB A;  4K25 A;  1LWE A;  4KH5 A;  3ZSR A;  3O4N A;  3C7N B;  5SWM A;  2HNZ A;  5M1Q A;  3DLL L;  4H5W A;  1VRU A;  2P9K B;  4DV7 K;  5M1F A;  1E3M A;  1S6Q A;  4BRI A;  2HBM A;  5EOY A;  3WXL A;  2YHY A;  3WQU A;  2FBT A;  1VQ9 N;  3PX0 A;  1Y64 A;  3M3Z A;  2Q36 A;  2WOM A;  3IG1 A;  1KLM A;  4DFM A;  4FWL A;  3DM2 A;  3SBT A;  3P5J A;  3BDP A;  3JXU A;  1EET A;  3WNG A;  1U45 A;  2IAJ A;  4B9T A;  1IJJ A;  4A2B A;  4RCH A;  1QHT A;  4CJL A;  1XMQ K;  3AGR A;  2XY5 A;  3THY B;  4A5B A;  3EEQ A;  1IBK K;  5ADX A;  5H1S Q;  4DR1 K;  1VSF A;  4BGB A;  3CPW M;  1TV6 A;  1RDC A;  1SKW A;  2D4W A;  2HHS A;  3HOS A;  3DMJ A;  3G0Z A;  1RCH A;  3MXJ A;  4OVL A;  3UB5 A;  4HVJ A;  3W3D A;  4MFB A;  3ID8 A;  3EE9 A;  4IG3 A;  3VEW A;  2VG5 A;  2RKI A;  4BR5 A;  4CFB A;  3WEE B;  2E1Y A;  3TAE A;  3VQ5 A;  4F9O A;  5AZJ A;  4YDU A;  3WXK A;  4IDK A;  3AAQ A;  4CGD A;  2P51 A;  1EKE A;  5J1E A;  5I42 A;  3CJ1 A;  3OBY A;  4XH1 A;  3CPE A;  4X66 K;  1A5V A;  4EP5 A;  3R8E A;  3OTO K;  2Z1I A;  2WTU A;  4K41 A;  3KHY A;  2W40 A;  1YVN A;  3KK3 A;  5F2R A;  4ICL A;  4PA1 A;  4HUE A;  4C23 A;  5KTQ A;  3A8Y A;  3C6U A;  4DR5 K;  4NLB A;  4ISG A;  5AQZ A;  1RTD A;  1VSL A;  3TAB A;  3QFP A;  1HNV A;  4C8L A;  2XY7 A;  3O9R A;  3F9K A;  1GLE G;  1NMD A;  2Z1J A;  2QWO A;  4FSV A;  5A2Q O;  1BIS A;  4JI1 K;  4JV5 K;  1RDU A;  4CZG A;  2I7N A;  2F9W A;  5FRO A;  2NRZ A;  4QAG A;  1D4X A;  1MWM A;  3H3N O;  2X6N A;  4JD2 A;  3I8B A;  3LZJ A;  3CFO A;  4FWK A;  3EKS A;  1LOT B;  1X9W A;  4A61 A;  4NB4 A;  3CET A;  1ASW A;  4FM2 A;  1NGF A;  2E2O A;  2FLO A;  4JYA K;  1NK4 A;  4NO7 A;  1HRH A;  3OYD A;  1RT4 A;  4BRC A;  3HVT A;  5E26 A;  3VEV A;  3CQY A;  4ILJ A;  2D0B A;  4KTW A;  2A40 A;  2O8B A;  3BUZ B;  1IKV A;  2OAN A;  4YOX A;  3QFU A;  3G10 A;  4JN4 A;  1HJO A;  3V1O A;  1HQE A;  1M1K O;  2OPR A;  2IVP A;  5FLX O;  2ZJP L;  4EP4 A;  2G8V A;  2KZZ A;  4KHU A;  3TU5 A;  3VQE A;  1GLD G;  1U48 A;  4IJA A;  4LD0 A;  1JLA A;  5BRF A;  4AM6 A;  2E6M A;  2BGG A;  3SPY A;  2Y1I A;  2NRW A;  3TTF A;  4CGI A;  2G8H A;  4PWD A;  3AO5 A;  3LAL A;  1DKG D;  5CR4 A;  2GBZ A;  3VQ4 A;  3M8Q A;  3VEO A;  3K5O A;  3FZM A;  3TSQ A;  2FSK A;  3QNO A;  5FPN A;  3VN5 A;  4XH5 A;  4QS8 A;  4CJK A;  1YIJ N;  1HUX A;  3MWT A;  1LAW A;  4JKG B;  3QO9 A;  1QVG M;  1CZA N;  3BY5 A;  4JEP A;  2Q31 A;  1UOC A;  4QOZ B;  2O8F B;  1TKD A;  1IKY A;  3HPO A;  1IV0 A;  4DMN A;  1X9J A;  4YFU A;  2QWM A;  3VOV A;  1BOT O;  5T7B A;  4DR6 K;  2P9I A;  2OYQ A;  3HM9 A;  1X9S A;  4JKE A;  1GLB G;  3O08 A;  3EKU A;  4FWM A;  4JD2 B;  2P9U B;  4RG8 A;  2YNG A;  1J9A A;  3KD5 E;  1EWQ A;  3PSI A;  4FVM A;  3FE1 A;  3V9X A;  3LWM A;  1M90 O;  4KHQ A;  3DJC A;  1SZ2 A;  3LDP A;  3L2R A;  3OJU A;  3U4L A;  1SL0 A;  4DTX A;  4CJ3 A;  3SQ0 A;  3CJ7 A;  3LDL A;  2V52 B;  1WNS A;  2DY4 A;  3AGK A;  1HLU A;  4Z4I A;  2UYT A;  4CZJ A;  3LAK A;  5FDL A;  4W5N A;  3LAM A;  4CGH A;  1C1B A;  4E7K A;  4FL9 A;  3NF6 A;  4IOX A;  2UUA K;  4E7I A;  1C1C A;  1HJR A;  4BRD A;  4HWI A;  3AVJ A;  2O8B B;  1SV5 A;  2OTL N;  1HYV A;  3DI6 A;  1T6D A;  2HVI A;  1Q82 O;  3OYA A;  2I5J A;  3CYM A;  4CEE A;  1YJW N;  2VG7 A;  3TWH A;  2CGJ A;  2HST A;  1S5J A;  4WFB L;  3QEI A;  4H5V A;  3AVL A;  3LDQ A;  1NGJ A;  2E2N A;  4JI4 K;  4BRP A;  1SAZ A;  3OHR A;  4CK3 A;  1T05 A;  1KVA A;  5C0Y A;  3IAY A;  3FZF A;  2V7Z A;  4K43 A;  4B9L A;  2V7Y A;  4JHD A;  4BRL A;  2GV9 A;  2WC9 A;  3A5O C;  1WB9 A;  1WSJ A;  4PHT X;  2Q97 A;  1N36 K;  1Q9Y A;  3LWL A;  3HO1 A;  4GKK K;  3OYN A;  4WYB A;  3ASM A;  4B9S A;  4KH4 A;  2P5O A;  1NWK A;  4O5F A;  4RW9 A;  3J8A A;  4KHS A;  5AQO A;  3ITH A;  3KKR A;  1NKC A;  1OKJ A;  3FLC O;  3EO3 A;  2O8D A;  4FLX A;  4M45 A;  4LFC K;  3H45 C;  3I33 A;  5AQT A;  4YOW A;  4BR2 A;  3FFK B;  2P9I B;  3WNH A;  2HHX A;  1QQO A;  4I6M A;  3IMX A;  1RDB A;  4NLC A;  2FSJ A;  1U2V A;  4CZH A;  2Q2R A;  1ATN A;  3CIP A;  3F73 A;  3BZK A;  2ATQ A;  2ZE2 A;  4L8R B;  2E20 A;  4C1N K;  4E1J A;  3KLG A;  2QK9 A;  3KKS A;  5HRN A;  3VQA A;  5BN9 A;  4A2A A;  1ZBI A;  1B92 A;  1RBT A;  2A42 A;  4TSX A;  5C10 A;  1W0H A;  4DTR A;  3CI5 A;  4M42 A;  2R7Y A;  4Q5V A;  3ZSZ A;  1JLC A;  3AVK A;  2P9S A;  4CF2 A;  3A5M C;  3O8M A;  1XC9 A;  4CZE A;  2ZGY A;  5KQD A;  3QET A;  3OYI A;  4A57 A;  4G9Z A;  4CEA A;  4FZY A;  4PUO A;  5MLC Q;  3VEY A;  1MU2 A;  2HHT A;  3NVK A;  2UXD K;  3DXK A;  4H03 B;  1C0F A;  4BR9 A;  4ID1 A;  1G15 A;  2D0C A;  4E0D A;  5I3U A;  1L3V A;  3V4I A;  2QKK A;  4DF4 A;  2O8C A;  5FPD A;  3SYZ A;  5J2Q A;  2W6K A;  4Z4F A;  3CJC A;  5BN8 A;  3E01 A;  3V6D A;  3IUC A;  4G1Q A;  3OYM A;  1TAQ A;  4FK0 A;  3NF9 A;  5I9E B;  3C6H A;  3NGZ A;  4B1V A;  3AO4 A;  4A5A A;  1V4T A;  3PIP L;  2H3G X;  4DFK A;  2IS3 A;  4DSF A;  4LSN A;  2QWQ A;  3DLG A;  1NJX A;  1WUA A;  3KWG A;  1FW6 A;  4JI2 K;  3I0R A;  4H0P A;  1NMN A;  4DQS A;  1U47 A;  2VYP A;  4OPA A;  4CZF A;  1SKS A;  1NU0 A;  2KZM A;  2FC0 A;  3E9O A;  1TL3 A;  3BP8 A;  4B1X B;  3AA2 A;  5AQU A;  3ZET B;  4DSE A;  1T3V A;  4DCH A;  3QLH A;  4K0K K;  1HNI A;  2IVN A;  4LFA K;  4N76 A;  3C94 A;  4FJ8 A;  3J7Z O;  1RT2 A;  1RBR A;  5CE3 A;  3LP3 A;  3KVG A;  1KLN A;  1FKO A;  4JI8 K;  2BAN A;  4I6M B;  4DTO A;  3HTV A;  4FWP A;  5AQI A;  5EY4 A;  1FXX A;  4RW6 A;  3AAP A;  4JNE A;  2BDP A;  4B8C A;  2OCE A;  2I7P A;  2Q0R A;  4L3Q A;  4CEZ A;  1IG8 A;  5CHI A;  4FLY A;  1W2B M;  2P9K A;  3O3F A;  5C25 A;  4KPY A;  4CJS A;  4ZHR A;  1V4S A;  4CK2 A;  4U7B A;  1KAZ A;  3SBG A;  3L3U A;  2P9S B;  4I7F A;  1YIT N;  3VET A;  3HRG A;  3ULD A;  2VWK A;  3ZYY X;  3ENO A;  4CEB A;  4B1Y B;  4NXM K;  3NGY A;  1IH7 A;  1JCG A;  2KLA A;  1TVR A;  3OJS A;  4DQP A;  2YX6 A;  3ZCM A;  5BRH A;  1TK8 A;  2JGU A;  3HSC A;  4JKC A;  3AVI A;  3DLB A;  4ILG B;  3JYT A;  3OA9 A;  4YOY A;  2QEX N;  2QI2 A;  1NK9 A;  4EZ9 A;  3HXM A;  4FOI A;  4EIA A;  3O3G A;  4IXC A;  4CES A;  3RR8 A;  2WON A;  2ETJ A;  1MA9 B;  1J54 A;  5HRS A;  3G4S N;  5AQY A;  3S41 A;  3VQP A;  1XNR K;  4FW2 A;  3NGI A;  4KBO A;  3RWU A;  3EZW A;  3NVM A;  4A59 A;  1ZBH A;  3LP1 A;  4F4K A;  4DTM A;  3ZLJ A;  4PQU A;  3V9S A;  1JCE A;  4E1N A;  1T8E A;  4IEE A;  2WFB A;  5IWA K;  1S1X A;  1NKE A;  3WEE A;  4DR7 K;  3TTD A;  3WXM B;  1BL3 A;  4LH5 A;  5AQN A;  4BC2 A;  5AQK A;  3OYF A;  4O4G A;  1EX4 A;  2D0O A;  2QXL A;  4EAH D;  4M3T A;  3KLH A;  2QWL A;  3T1Y K;  4FZZ A;  1QE1 A;  4V19 S;  3QEP A;  4CF9 A;  4DR4 K;  4X65 K;  2ASO A;  3HPH A;  1WSE A;  3HP9 A;  4FWO A;  5AQX A;  4FWQ A;  4ID5 A;  5DMR A;  1B9F A;  4CF0 A;  1RBU A;  4GNI A;  5E84 A;  1BIZ A;  2X78 A;  1HKC A;  3CJA A;  4BC3 A;  1HR0 K;  3FZL A;  3U9Z A;  3P83 D;  2YJF A;  4I2Q A;  4MO4 A;  3HZ6 A;  3LM9 A;  2LSN A;  2KFN A;  2Y1J A;  2F7T A;  2FXU A;  1FJG K;  1VQP N;  1NGB A;  3RTV A;  4CEQ A;  5KPT A;  4H5R A;  2NUB A;  4HTL A;  4N41 A;  3AO3 A;  4FJ5 A;  3T1A A;  5JS2 A;  3BF3 A;  3P31 A;  2YNI A;  1Y97 A;  5HLF A;  3SQ2 A;  3BGR A;  3BEX A;  3WQT A;  3R6M A;  4CD1 A;  4AHS A;  5LJV A;  4CJP A;  3PLA A;  3HM8 A;  1VQK N;  1TL1 A;  2HHU A;  3VTH A;  2HND A;  2W42 A;  1Z6R A;  4LSL A;  3D7E O;  2NRT A;  2UUB K;  4DTN A;  4FK4 A;  5GAH P;  3ZX0 A;  4FLV A;  3L6Q A;  2A3Z A;  3RRG A;  4KTQ A;  2A1R A;  4AIL C;  4WFN L;  2HF3 A;  1T44 A;  3DWL A;  4DWI A;  3S3N A;  1D9D A;  4CHY A;  5BPM A;  4BRA A;  3CJ9 A;  2GTD A;  3SUO A;  2J4R A;  4DFP A;  4QS9 A;  3WUH A;  1BA0 A;  4AH9 A;  1RTJ A;  3SNN A;  4BE1 A;  1ZBS A;  3MMV A;  3K58 A;  1D5A A;  1K8K A;  4NXN K;  3RMC A;  4O0I A;  2ZD1 A;  3GG4 A;  4MLH A;  3PIO L;  3RSE B;  2WUS A;  4IEI A;  3RMB A;  2D1K A;  3IFR A;  1RT5 A;  3S3M A;  1ASV A;  1UA1 A;  3SUN A;  4O8K A;  3V9U A;  4DQQ A;  4LF8 K;  4GKJ K;  3CF5 L;  3WXJ A;  1KAY A;  3HL8 A;  1TK0 A;  4E7H A;  3PO4 A;  2FF3 B;  1VSM A;  4IWV A;  5GIN A;  3M8S A;  4CHQ A;  4IJN A;  3MX5 A;  4NCG A;  4CJ5 A;  3RMA A;  2Q1N A;  2ZQB A;  2HOE A;  1WSG A;  5TKY A;  3SUQ A;  3QES A;  5KRT A;  3HVR A;  3V9Z A;  4FLT A;  2P9L A;  3VQQ A;  2BUP A;  3KK2 A;  4JKG A;  3T3F A;  1VQ8 N;  2V51 B;  4B9U A;  1NK7 A;  2OZS A;  2O8F A;  3CJB A;  4W5Q A;  2HVH A;  4LH4 A;  4CEC A;  3LDN A;  3NDK A;  4PKG A;  2VWB A;  4JKA A;  3C6A A;  4AHR A;  3WNF A;  4IG0 A;  4B3R K;  2G8K A;  2JWK A;  3K0S A;  1QZ5 A;  3V1Q A;  1RFQ A;  5AFU H;  3CCR N;  5J2P A;  3CC2 N;  3VQC A;  3GOI A;  3DOK A;  2FBV A;  2P9U A;  3ZX2 A;  3M1F A;  4DV1 K;  3TAN A;  3SLC A;  2OA8 A;  4CBU A;  3J81 O;  4CFA A;  2FSN A;  1NGE A;  4CGF A;  1NJI O;  3SUP A;  4PL7 A;  3VA0 A;  5JLH A;  1VAZ A;  4FJK A;  3G6E N;  4DQR A;  1WOQ A;  1YXQ A;  3QER A;  3MN7 A;  4FWN A;  3AO1 A;  4HUF A;  4DTU A;  3QEX A;  4DS5 A;  1HNZ K;  1K9M O;  1S3X A;  4WCE L;  2E6L A;  3PO5 A;  2KKZ A;  2E5L K;  2UUC K;  1VRT A;  2HB5 A;  4Z0U A;  1K8K B;  3EZ5 A;  5J2M A;  2OTJ N;  2AJQ A;  3SMP A;  2JWL A;  5C2F A;  2IVO A;  1W97 L;  4DSI A;  2XO7 A;  4N5S A;  1NGH A;  4OKE A;  1NKB A;  3MAQ A;  1SL1 A;  3WNE A;  3B6O A;  3QB0 A;  3NH0 A;  4CJ4 A;  1C0T A;  3DRP A;  4KTZ A;  3VGK A;  4BRN A;  4BDP A;  2YNF A;  4BR0 A;  4K8Z A;  4GV9 A;  1CZ9 A;  4CER A;  2RPI A;  1J53 A;  4DS4 A;  3AVA A;  4DSK A;  2IIR A;  4CIF A;  4BRF A;  2HHQ A;  4WQ4 A;  3J80 O;  1HX1 A;  1CZB A;  1RT1 A;  1L3S A;  2NRX A;  4PKI A;  3CCL N;  3AVF A;  1U49 A;  5HRP A;  3I55 N;  5GAD P;  1JJ2 M;  2ZJQ L;  3FFI A;  2P9L B;  5BPL A;  2GX9 A;  1SKR A;  4CZI A;  3BF1 A;  4H4O A;  1KAX A;  1W7A A;  3L2U A;  3HK2 A;  5AJ3 K;  3B8A X;  2G8W A;  5FRM A;  4OLA A;  1ZYQ A;  4F8R A;  4JRP A;  4EHU A;  1RNH A;  4E19 A;  5C2D A;  3EY1 A;  3OYB A;  3UIQ A;  3AV9 A;  2YI1 A;  3NHG A;  1S9G A;  2X74 A;  4JKF A;  1TKZ A;  4LC9 B;  2HBL A;  1YJ9 N;  1NJW A;  2UU9 K;  1FKP A;  5CZ2 A;  1NOY A;  3NBP A;  4H4M A;  1TUU A;  2YNH A;  3O9U A;  1QSY A;  4JKD A;  4K42 A;  1ZBL A;  3E1Y A;  2B4J A;  5DK5 A;  3ZSW A;  4KHN A;  2NRR A;  3K5N A;  3ALY A;  4KKO A;  4BQZ A;  4WQ5 C;  4DSJ A;  2YHX A;  3HT3 A;  4B9N A;  3SV4 A;  5HL7 L;  3GL1 A;  2AP1 A;  3L3V A;  4BRK A;  3V81 A;  4FYD A;  3OS0 A;  4FJI A;  4WFA L;  4X62 K;  1MWK A;  4IOA L;  2YKN A;  3SPZ A;  4MDB A;  1J6Z A;  3MN6 A;  3SCX A;  1NJZ A;  4BE2 A;  1QSS A;  4Z4C A;  1TGO A;  3EYZ A;  3HST B;  1BWF O;  5C24 A;  2ASP A;  4B1U B;  1QQC A;  3NH1 A;  1NK0 A;  1VHX A;  5FPM A;  4KAZ A;  4CJQ A;  1BDG A;  2CGL A;  3EN9 A;  3KLI A;  1E4G T;  5DM7 L;  3NF7 A;  5HBM A;  2ZM6 K;  3HBT A;  1NM1 A;  3VGM A;  5KI6 A;  4Y1D A;  3K2P A;  3ZT3 A;  4JLH A;  3UKU A;  3F2K A;  4BAC A;  5EVZ A;  4X64 K;  3EL2 A;  4JK7 A;  1NGG A;  2PY5 A;  3MK6 A;  4FJ7 A;  2RE2 A;  5JVG L;  4CJ7 A;  3THV A;  5LY3 A;  3GDQ A;  2ITG A;  1VQ6 N;  3ZET A;  4GW6 A;  5BR9 A;  1I3A A;  1XUP O;  3VQ7 A;  3D6R A;  1WSI A;  3KK7 A;  3M5R A;  4NCA A;  3ZEU A;  1JLF A;  3CM5 A;  5C15 A;  2HW3 A;  4BG8 A;  3L2W A;  2QWP A;  4DQI A;  1BCO A;  3A5L C;  4DU1 A;  1VK0 A;  5CYQ A;  1ZXO A;  3QBX A;  3OYK A;  3O9S A;  4AQY K;  2KQ2 A;  1HNW K;  1X3M A;  3OYC A;  4JI6 K;  4YY3 K;  1KSP A;  4WE1 A;  2JLE A;  2W6L A;  1U4B A;  4CVN E;  4LF4 K;  4DB3 A;  1HMV A;  1BUP A;  1Z25 A;  2HNY A;  4BWJ A;  2DTU A;  1NBW A;  2IDO A;  5AQH A;  4RW7 A;  3ZSO A;  2P9N B;  2XY8 A;  2O4G A;  3U9D A;  3VF4 A;  2VQE K;  5TKW A;  5AQL A;  4FCY A;  4H0O A;  3NE6 A;  1K8A O;  1QSL A;  4CCH A;  3O80 A;  1RT6 A;  5KGX A;  3IRX A;  4M7Y A;  5HRR A;  2VQF K;  3VTI A;  4BRQ A;  2A41 A;  3THX A;  4CZK A;  3ZT1 A;  2F9T A;  2XHB A;  4DV5 K;  1KFD A;  3V9W A;  3UKR B;  3KWI A;  2BH1 A;  4CIE A;  3MDQ A;  2Q3S A;  1DTT A;  5JS1 A;  1RGI A;  1LAV A;  3CC7 N;  2CGK A;  4BQL A;  2ZJR L;  2HHH K;  2KFZ A;  1MDU B;  2IOC A;  3SV3 A;  4O5B A;  1KXP A;  5E41 A;  3H08 A;  3SAH A;  1L5U A;  2NRV A;  2D5R A;  1XMO K;  2VGM A;  1RDW X;  1RBV A;  3FZH A;  3SZ2 A;  4IDH A;  4M3X A;  4MLE A;  3TSU A;  5B8H A;  4F3O A;  2ITM A;  3M6G A;  5AQW A;  3TAP A; 
#chains in the Genus database with same CATH homology
 1VSE A;  4CJE A;  2Z1J A;  3QEP A;  2OZM A;  4CF9 A;  2HHW A;  3SI6 A;  1BIS A;  5SZT A;  3RMD A;  3LAN A;  4CFD A;  3HPH A;  4W5T A;  5FRO A;  1WSE A;  3HP9 A;  4QAG A;  2YHB A;  1C6V A;  5FRN A;  4ID5 A;  5DMR A;  2OPQ A;  3K59 A;  1B9F A;  4CF0 A;  1RBU A;  2X6N A;  4UQG A;  4OKK A;  4FLZ A;  3LZJ A;  1TKT A;  3CFO A;  1R0A A;  4KRE A;  1BIZ A;  1BHL A;  2BE2 A;  2X78 A;  3ZSQ A;  1CXQ A;  3ZT0 A;  4AHT A;  3P83 D;  4I2Q A;  3OS1 A;  1X9W A;  4OPJ A;  3T19 A;  1DTQ A;  3MEG A;  2LSN A;  2KFN A;  2Y1J A;  1ASW A;  3OVN A;  2KW4 A;  2XRI A;  3RTV A;  4FM2 A;  1S6P A;  2QXF A;  4M41 A;  4CEQ A;  2NUB A;  1NK4 A;  4N41 A;  2HMI A;  3L8B A;  4FJL A;  3AO3 A;  4FK2 A;  1IO2 A;  1HRH A;  4DF8 A;  3T1A A;  4FJ5 A;  5JS2 A;  2OPS A;  1RDD A;  2YNI A;  1XHX A;  1Y97 A;  4RW4 A;  4CHN A;  3BGR A;  3DOL A;  3OYD A;  3SQ2 A;  1RT4 A;  5HLF A;  1GOA A;  4B08 A;  3HVT A;  4E1M A;  4AHS A;  4CF8 A;  3MEC A;  4C8K A;  4CJP A;  3OYJ A;  1S1U A;  1TL1 A;  2HHU A;  4JS4 A;  3TR8 A;  1JLE A;  3K5M A;  3QNN A;  4FJX A;  2D0B A;  2HND A;  4KTW A;  2W42 A;  3MXI A;  1HQU A;  4LSL A;  1JXB A;  4R5P A;  3NAE A;  1IKV A;  4YNQ A;  3AA3 A;  3M8P A;  4DTN A;  3VQ9 A;  4FK4 A;  3G10 A;  1NK6 A;  3V1O A;  1HQE A;  4MQ3 A;  4FLV A;  3RRG A;  4KTQ A;  2IC3 A;  2OPR A;  4M3W A;  2A1R A;  4AIL C;  3TI0 A;  3LPT A;  1C0U A;  4KI6 A;  1LW2 A;  4CEF A;  3ZSX A;  3S3N A;  1D9D A;  4DWI A;  4KHW A;  4EP4 A;  4CHY A;  2F8S A;  2G8V A;  2KZZ A;  4KHU A;  1YT3 A;  1ZBU A;  2RN2 A;  3VQE A;  4E7J A;  3SUO A;  4DFP A;  1TAU A;  4DFJ A;  4AH9 A;  1U48 A;  3OS2 A;  1IKX A;  1RTJ A;  4LD0 A;  4BE1 A;  1JLA A;  3SNN A;  5KRS A;  2E6M A;  3CFP A;  2BGG A;  4DU3 A;  3SPY A;  3K58 A;  2Y1I A;  1D5A A;  1B9D A;  2B6A A;  2G8I A;  4CGI A;  2G8H A;  4HHT A;  4O0I A;  2YHA A;  3RMC A;  4PWD A;  2KTQ A;  2ZD1 A;  3QIP A;  3AO5 A;  3LAL A;  4CED A;  3PX4 A;  1S9E A;  5J2N A;  1SUQ A;  1Q9X A;  4M3Y A;  1KTQ A;  2GBZ A;  4KV8 A;  4N47 A;  3M8Q A;  2A1S A;  3VQ4 A;  3K5O A;  3D0P A;  3RMB A;  4ZTJ A;  1BI4 B;  3QNO A;  1RT5 A;  2FBX A;  3LZI A;  3S3M A;  3L2V A;  1ASV A;  3VN5 A;  3CG7 A;  1UA1 A;  1FK9 A;  3PV8 A;  4CJK A;  4DLE A;  3SUN A;  3ZT2 A;  3V9U A;  4DQQ A;  4J2B A;  1LAW A;  1T03 A;  1LWF A;  4FJJ A;  3QO9 A;  1C0M A;  4GMJ B;  1UOC A;  5CYM A;  1J5O A;  4IFY A;  4QOZ B;  3SQ4 A;  1XHZ A;  1TKD A;  4B8A B;  1IKY A;  1JXE A;  2PYL A;  5EU7 A;  3HPO A;  3HL8 A;  1D9F A;  1TK0 A;  4F2S A;  4FJN A;  4E7H A;  1RIL A;  1ITG A;  3PO4 A;  1VSM A;  3S9H A;  4H8K A;  4CGG A;  3PX6 A;  3TAG A;  4DMN A;  1BCM A;  3M8S A;  4CHO A;  3AVG A;  1VSI A;  1JKH A;  5K14 A;  4CHQ A;  4YFU A;  4FJH A;  4NCG A;  4CJ5 A;  3RMA A;  4Z4E A;  5T7B A;  2EX3 A;  3C95 A;  2ZQB A;  4O0J A;  2OYQ A;  1WSG A;  3HYF A;  3SUQ A;  2Z1G A;  3QES A;  5KRT A;  5CZ1 A;  1WAJ A;  3HM9 A;  4OLB A;  3HVR A;  1X9S A;  3V9Z A;  1ZBI A;  4FLT A;  5KGW A;  3VQQ A;  4BE0 A;  1YVU A;  2D0A A;  3KK2 A;  5CY4 A;  3TAR A;  4RG8 A;  4O55 A;  2YNG A;  1J9A A;  3T3F A;  2O4I A;  1RBS A;  4B9U A;  3KD5 E;  1NK7 A;  2OZS A;  2PZS A;  4W5O A;  4FVM A;  3V9X A;  1VSK A;  4W5Q A;  2HVH A;  3LWM A;  4LH4 A;  4KHQ A;  4CEC A;  1T7P A;  1ASU A;  3L2R A;  3OJU A;  3NDK A;  1SL0 A;  3DLK A;  3K57 A;  4DTX A;  4CJ3 A;  3SQ0 A;  1GOC A;  4DU4 A;  4AHR A;  1NOZ A;  3WNF A;  4IG0 A;  4CHZ A;  1WNS A;  2F8T A;  2G8K A;  2DY4 A;  3V1Q A;  2G8F A;  4Z4I A;  3VQ6 A;  1LWC A;  4FLW A;  3AVN A;  3LAK A;  5J2P A;  5FDL A;  3IS9 A;  3LAM A;  4I9L A;  4CGH A;  1C1B A;  3VQC A;  3DOK A;  4E7K A;  4W5N A;  2FBV A;  4Z4G A;  1ZBF A;  1UA0 A;  3SJJ A;  4M3U A;  2XY6 A;  3NF6 A;  1VSJ A;  1O1W A;  1UWB A;  4E7I A;  1C1C A;  3TAN A;  3KD1 E;  1HJR A;  2OA8 A;  3AVJ A;  4F2R A;  3AVH A;  1SV5 A;  1HYV A;  4CFA A;  4CGF A;  3DI6 A;  2HVI A;  4CF1 A;  4OGE A;  3OYA A;  2I5J A;  3CYM A;  3SUP A;  2PYJ A;  4CEE A;  3VA0 A;  2VG7 A;  3TWH A;  3K5L A;  1RDA A;  4FJK A;  1S5J A;  1Z26 A;  3L2Q A;  4DQR A;  3DLH A;  3QEI A;  3TAQ A;  3AVL A;  3QER A;  4I2P A;  3AO1 A;  2DFH A;  4HUF A;  4DTU A;  3QEX A;  4E89 A;  4DS5 A;  3CFR A;  1D8Y A;  4B9V A;  4CJV A;  2E6L A;  3PO5 A;  2EHG A;  4C8M A;  4CK3 A;  1KVA A;  1KVC A;  1VRT A;  3KLF A;  3RRH A;  1T05 A;  1N6Q A;  2Z1H A;  1WSF A;  1TKX A;  1Q8I A;  2HB5 A;  3AA4 A;  4Z0U A;  3IAY A;  3CQ8 A;  4DG1 A;  3JSM A;  4DLG A;  3EZ5 A;  5J2M A;  4B9L A;  1S1V A;  4KI4 A;  1U04 A;  2AJQ A;  2FBY A;  3V1R A;  2P1J A;  3DLE A;  3KLE A;  3QEW A;  4EZ6 A;  2GV9 A;  3PUF A;  4FW1 A;  4FM1 A;  4DSI A;  1WSJ A;  4IBN A;  2DFE A;  2XO7 A;  1DLO A;  3B6P A;  4N5S A;  4OKE A;  1NKB A;  3MAQ A;  1Q9Y A;  4QCL A;  3LWL A;  1SL1 A;  3WNE A;  3HO1 A;  1X9M A;  1HYS A;  3B6O A;  1RT7 A;  3O4Q A;  3P1G A;  3NH0 A;  3DRR A;  3OYN A;  4B9M A;  4CJ4 A;  4J2E A;  1C0T A;  4HUG A;  3ASM A;  3DRP A;  4B9S A;  4KTZ A;  2VWJ A;  3NH2 A;  2P5O A;  3AVB A;  4F3T A;  4BDP A;  4CEO A;  2YNF A;  1BQM A;  3NCI A;  1XWL A;  4K8Z A;  3OYL A;  3AVM A;  4ELV A;  4RW9 A;  1CZ9 A;  4OGC A;  4CER A;  4FJM A;  4KHS A;  2RPI A;  1J53 A;  4W5R A;  3ITH A;  4DS4 A;  3AVA A;  4DSK A;  3KKR A;  4CIF A;  1NKC A;  4ELT A;  2HHQ A;  1WAF A;  3KJV A;  4CFC A;  4M45 A;  4FLX A;  3C6T A;  1JLG A;  1CZB A;  1RT1 A;  1HPZ A;  4OJR A;  4O44 A;  3U6F A;  1L3S A;  4XIU A;  5D3G A;  4NYN A;  3WNH A;  3AVF A;  1JLQ A;  1EP4 A;  5HRP A;  5HP1 A;  1U49 A;  2HHX A;  2OPP A;  1QS4 A;  1HYZ A;  1RDB A;  1GOB A;  1RT3 A;  3FFI A;  3SQ1 A;  4CJF A;  3TAM A;  4ZTF A;  1REV A;  1SKR A;  1A5X A;  4J2D A;  3HJF A;  3LPU A;  3AO2 A;  4H4O A;  3F73 A;  3L2U A;  3HK2 A;  3HPG A;  3DLR A;  4M3Z A;  2G8W A;  4CIG A;  1C1A A;  2ATQ A;  2ZE2 A;  4CJR A;  4L8R B;  5FRM A;  1VSH A;  3LP2 A;  1F21 A;  4GVM A;  4KFB A;  2YV0 X;  4E3S A;  3U3G A;  1ZYQ A;  3ZSV A;  4F8R A;  1S1T A;  4JRP A;  3KLG A;  2QK9 A;  1RNH A;  3KKS A;  4E19 A;  5HRN A;  3EY1 A;  4DSL A;  3VQA A;  3OYB A;  3UIQ A;  3AV9 A;  4CJU A;  3TAF A;  1B92 A;  1RBT A;  3KIO A;  1S9G A;  1W9H A;  1W0H A;  2X74 A;  4TSX A;  3NHG A;  4DTR A;  4I9Q A;  4M42 A;  4JS5 A;  4KO0 A;  3ISN C;  2R7Y A;  1TKZ A;  2VG6 A;  1JLC A;  2E4L A;  3ZSZ A;  4Q5V A;  3AVK A;  4KHY A;  1NJW A;  4CF2 A;  3O3H A;  1FKP A;  5CZ2 A;  1NOY A;  1JLB A;  3NBP A;  3QIN A;  1XC9 A;  1WLJ A;  3VQ8 A;  4JRQ A;  2YKM A;  3LP0 A;  4FLU A;  4H4M A;  4KRF A;  1CXU A;  2YNH A;  3QET A;  3S3O A;  3OYI A;  4AHV A;  1QSY A;  1BQN A;  4CEA A;  1JL1 A;  4FZY A;  4PUO A;  1ZBL A;  1MU2 A;  3ZSY A;  2B4J A;  2HHT A;  4HCC A;  5DK5 A;  3ZSW A;  4CGJ A;  1L3U A;  4IKF A;  2IGI A;  4ID1 A;  3TAP A;  4KHN A;  3QEV A;  3K5N A;  1G15 A;  3MED A;  2D0C A;  3ALY A;  4KKO A;  3VA3 A;  4DTP A;  1S1W A;  4C8O A;  4E0D A;  5I3U A;  4BWM A;  1L3V A;  2P5G A;  3V4I A;  2QKK A;  4DF4 A;  1BGX T;  4AHC A;  1UAX A;  4AHU A;  4DSJ A;  3QIO A;  3SYZ A;  5J2Q A;  3AVC A;  1KCF A;  4LY7 A;  3HT3 A;  4B9N A;  4E7L A;  4OPK A;  3SV4 A;  3PY8 A;  4Z4F A;  1L3T A;  3E01 A;  3MEE A;  3V6D A;  3DYA A;  4Q0B A;  3L3V A;  3NFA A;  4G1Q A;  3OY9 A;  3OYM A;  1TAQ A;  2X6S A;  4FM0 A;  5HRO A;  4FK0 A;  3NF9 A;  4DTJ A;  3NGZ A;  3V81 A;  4FYD A;  3OS0 A;  4FXD A;  4FJI A;  3AO4 A;  2GUI A;  4CJT A;  1RTI A;  3KK1 A;  3KTQ A;  4DFK A;  2IS3 A;  4RW8 A;  4DSF A;  4LSN A;  3DLG A;  3OYG A;  1NJX A;  4FJ9 A;  3NF8 A;  4B3O A;  4Y1C A;  2YKN A;  3SPZ A;  1WN7 A;  1A5W A;  2B5J A;  1NJY A;  4FZX C;  4CK1 A;  4KB0 A;  3I0R A;  1NK5 A;  1U47 A;  2G8U A;  5C42 A;  4HTU A;  4BDY A;  1VSD A;  4DQS A;  4DTS A;  4BE2 A;  3SCX A;  1NJZ A;  1QSS A;  4KB1 A;  4Z4C A;  1TGO A;  1SKS A;  3EYZ A;  3HST B;  5C24 A;  4N56 A;  2KZM A;  1QQC A;  2FC0 A;  3VQD A;  3NH1 A;  1NK0 A;  3VQB A;  1TL3 A;  4KAZ A;  3AA2 A;  2HHV A;  1LWE A;  4CJQ A;  4DSE A;  3KLI A;  3ZSR A;  3MXM A;  3NF7 A;  3O4N A;  3QLH A;  5HBM A;  5SWM A;  2HNZ A;  1KRP A;  1EXQ A;  5KI6 A;  1HNI A;  4Y1D A;  4N76 A;  4FJ8 A;  1VRU A;  3C94 A;  3K2P A;  3ZT3 A;  1RT2 A;  1RBR A;  3OYE A;  4JLH A;  3LP3 A;  4BAC A;  1KLN A;  3D45 A;  1FKO A;  1S6Q A;  2PY5 A;  3ZT4 A;  2BAN A;  4CHP A;  4DTO A;  4FJ7 A;  4HCB A;  4K8X A;  2FBT A;  2RF2 A;  1FXX A;  4BDZ A;  3PX0 A;  3THV A;  1IG9 A;  4RW6 A;  2WOM A;  2ITG A;  2BDP A;  3I8D A;  4B8C A;  3IG1 A;  4GW6 A;  1I3A A;  3VQ7 A;  1KLM A;  4DFM A;  1WSI A;  3DM2 A;  4CEZ A;  4NCA A;  3P5J A;  3BDP A;  1CLQ A;  1JLF A;  3CM5 A;  4FLY A;  1XI1 A;  1EET A;  3O3F A;  3WNG A;  1U45 A;  1SL2 A;  2HW3 A;  3L2W A;  2IAJ A;  4B9T A;  4DQI A;  1BCO A;  4M3R A;  1WSH A;  5C25 A;  1VK0 A;  4DU1 A;  4KPY A;  4CJS A;  5CYQ A;  1QHT A;  4CJL A;  4ZHR A;  3OYK A;  2XY5 A;  2KQ2 A;  4CK2 A;  3OYC A;  1RTH A;  3L3U A;  1KSP A;  4OKJ A;  1BIU A;  4I7F A;  4WE1 A;  4ELU A;  1LV5 A;  2DFF A;  2JLE A;  1U4B A;  3U3Y A;  1HMV A;  3ULD A;  1VSF A;  2VWK A;  1Z25 A;  2HNY A;  4BWJ A;  4CEB A;  1TV6 A;  2DTU A;  2IDO A;  1RDC A;  1SKW A;  3NGY A;  4RW7 A;  1IH7 A;  3ZSO A;  2XY8 A;  2O4G A;  4FJG A;  2HHS A;  1TVR A;  4CE9 A;  3OJS A;  3M8R A;  4DQP A;  3DMJ A;  3CM6 A;  3G0Z A;  1RCH A;  3MXJ A;  3ZCM A;  1TK8 A;  4OVL A;  4HVJ A;  2JGU A;  4FCY A;  4PY5 A;  3NE6 A;  3AVI A;  4MFB A;  3HP6 A;  3DLB A;  4IG3 A;  4CJW A;  3JYT A;  1QSL A;  4CCH A;  2VG5 A;  1RT6 A;  2RKI A;  1NK9 A;  4EZ9 A;  3HXM A;  5KGX A;  4CFB A;  3IRX A;  2QKB A;  3O3G A;  3TAE A;  1I39 A;  4CES A;  3VQ5 A;  2WON A;  5HRR A;  3RR8 A;  3LDS A;  3I0S A;  4IDK A;  4J2A A;  2ETJ A;  1LW0 A;  1J54 A;  1NK8 A;  1QTM A;  1KVB A;  1KFS A;  5HRS A;  4CGD A;  2P51 A;  3VQP A;  4FW2 A;  3ZT1 A;  2XHB A;  1EKE A;  3AA5 X;  5J1E A;  3OYH A;  1KFD A;  3NGI A;  3V9W A;  5I42 A;  3A2F A;  1YTA A;  3DRS A;  1TK5 A;  3RWU A;  2F96 A;  1A5V A;  4CIE A;  1K6Y A;  4EP5 A;  1ZBH A;  2Q3S A;  4IFV A;  3LP1 A;  4NYF A;  4F4K A;  1IKW A;  1DTT A;  5JS1 A;  1LAV A;  2Z1I A;  1BI4 A;  4DTM A;  1YTU A;  4PQU A;  4FZZ A;  3V9S A;  4Z4H A;  2KFZ A;  3KK3 A;  2IOC A;  4E1N A;  3SV3 A;  1JL2 A;  1X1P A;  4O5B A;  1T8E A;  1S1X A;  4ICL A;  4PA1 A;  4HUE A;  1NKE A;  5KTQ A;  4OLA A;  5E41 A;  3H08 A;  3C6U A;  1BL3 A;  4LH5 A;  1L5U A;  2D5R A;  3RR7 A;  4NCB A;  3OYF A;  1RTD A;  4O4G A;  1VSL A;  1EX4 A;  1RBV A;  3SZ2 A;  3TAB A;  1N5Y A;  4M3X A;  4M3T A;  4F3O A;  3KLH A;  1HNV A;  4C8L A;  4C8N A;  1QE1 A;  2XY7 A;  3F9K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...