5SWMA

Bacillus halodurans rnase h mutant d132n in complex with 12-mer frna/dna hybrid
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
131
structure length
131
Chain Sequence
IIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSNSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGEIKADY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/rna/dna
molecule keywords Ribonuclease H
publication title Limits of RNA 2'-OH Mimicry by Fluorine: Crystal Structure of Bacillus halodurans RNase H Bound to a 2'-FRNA:DNA Hybrid.
pubmed doi rcsb
source organism Bacillus halodurans
total genus 37
structure length 131
sequence length 131
chains with identical sequence B
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2016-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5swmA00
3LANA 4FJNA 5KTQA 4DTOA 1XHXA 3AVGA 4CEEA 4CJ5A 4M3TA 3WNHA 3T1AA 3NF6A 3L2UA 4FJGA 3MEGA 2E4LA 3NGIA 3CQ8A 1S1UA 4DLEA 2RKIA 3SUNA 3TR8A 4B8AB 4JLHA 4RW4A 4CF8A 3LZJA 3I0RA 1BL3A 3I8DA 3VA0A 1RT1A 2I5JA 1HNVA 4I9LA 3G0ZA 2F96A 4JRQA 4KTZA 2F8SA 3S9HA 4NYNA 5J2NA 1RTDA 2HHWA 4F2SA 3KLHA 3RMCA 4DTJA 3QO9A 4Q5VA 5J2QA 4Y1DA 3ZSXA 1ZBIA 4DU3A 2IS3A 4W5NA 4EP5A 1TK0A 4N41A 1JKHA 1BQNA 5J1EA 3SV4A 4KB0A 1TKTA 3WNGA 5E41A 1A5WA 1RTJA 2HHUA 5HP1A 3T3FA 1TL3A 1L3TA 1KTQA 1D8YA 3T19A 2FBTA 4CEBA 2EX3A 4CGDA 3HPGA 4C8LA 5HRSA 5KRTA 4HUGA 3BDPA 3OVNA 4FW2A 3MECA 3OYBA 3MEEA 4OGCA 4E7LA 1FXXA 3KK2A 3ZSQA 1NK8A 2JGUA 2YNIA 3LP0A 4W5TA 3QETA 1LW0A 1BQMA 4FLYA 3SZ2A 1ASUA 3FFIA 3H08A 5CZ2A 1KCFA 3AVIA 3NGYA 3OYCA 4M3UA 5SWMA 4DTPA 3LPTA 4BDPA 1HYSA 4M3RA 4E19A 4PUOA 3LP1A 5HRRA 3SV3A 4I2PA 2FBXA 4Z4FA 3DRSA 4E7HA 1QHTA 1IH7A 3AVLA 4KPYA 3ZSOA 4CEAA 1RT4A 1RDCA 1UAXA 4B9UA 1RCHA 4CGHA 1QQCA 3CFRA 1T8EA 1Y97A 3F9KA 1RDDA 3V1QA 3SUPA 2OZMA 5FRNA 4CHPA 1L3VA 3ZSRA 1CZBA 3SJJA 3SUOA 3K59A 1B92A 4DFKA 4Z4EA 4FJ5A 1NJWA 4ELTA 3KJVA 2DY4A 4J2DA 4NYFA 4EP4A 2ZE2A 1JLBA 3QIPA 1BCMA 1TV6A 1VRUA 3MXMA 4CHOA 3AVMA 3PX0A 1NK0A 1YT3A 1Z26A 2ETJA 1RTIA 3KK3A 3L2RA 3EYZA 1HJRA 3KTQA 1L5UA 4JS4A 1IKVA 1KLNA 2ITGA 3TABA 1TL1A 1S9EA 3AO1A 3M8QA 1WSFA 2E6LA 5K14A 4MFBA 1KVBA 3VN5A 3JYTA 1KLMA 1WN7A 4B9SA 4J2AA 4EZ9A 3AVJA 3AO4A 1QS4A 5I42A 1DLOA 2A1RA 4BWJA 3AVAA 1S9GA 4O0IA 1VSKA 4FCYA 2HW3A 1UWBA 4BE2A 3VQ8A 4LY7A 3V9SA 1WNSA 3P5JA 3IG1A 3QNOA 4M3XA 2KW4A 2IOCA 4AHSA 1XC9A 3HPHA 3VQAA 4Z4CA 4OJRA 1D9FA 3HP6A 4QAGA 3CYMA 4H8KA 3OYLA 3PX6A 1NK4A 4IFVA 4E1NA 1T7PA 4NCAA 2BGGA 1VSLA 2KFNA 1O1WA 4PA1A 2KZMA 1UOCA 3OYKA 4CE9A 4FM0A 4FJLA 4FLTA 2HHTA 4F3OA 4DSIA 2D0AA 1I39A 3O3FA 3PV8A 4FJJA 3HYFA 2VG5A 3I0SA 4HVJA 3AVFA 3QEPA 1C0UA 1S5JA 2OPSA 4BE1A 3TANA 1NJXA 4W5OA 1N6QA 4IDKA 2PYLA 4KO0A 2YHBA 3LP3A 4UQGA 4DQPA 2RN2A 4CJ4A 1SKRA 2LSNA 3OYNA 4B9NA 3OYGA 4N47A 4IFYA 5KI6A 4CK1A 2P5GA 3G10A 3EY1A 3V1OA 4FJHA 4CJEA 4FZXC 1SL0A 1LW2A 3RRGA 2B4JA 2O4GA 3ISNC 4AHTA 4M41A 1TK8A 1IG9A 2GV9A 2G8IA 2ZD1A 4E89A 1RT2A 4F4KA 4IG3A 4CF9A 1VSFA 3ITHA 3QEIA 4CGGA 4CHQA 3ASMA 2BE2A 4ZHRA 2XHBA 4KFBA 1DTQA 1GOAA 1I3AA 2YKNA 2YNFA 3QINA 1RT7A 4B3OA 4FLXA 3V9UA 2HVHA 3AA5X 4R5PA 4YNQA 2AJQA 3SPZA 1WSIA 3HVTA 1LWEA 2BANA 5FDLA 4HCBA 1RBTA 3L8BA 3K5OA 2P51A 2HHQA 4FLVA 1TK5A 2VG7A 4CJPA 3VQ4A 3OJUA 1KVAA 1N5YA 1C0TA 1RBRA 1RDBA 2D5RA 3ZSVA 3JSMA 4DG1A 2Z1GA 4C8NA 3KKRA 3EZ5A 3THVA 4DF8A 1L3SA 1J5OA 1W9HA 3OYMA 3SQ2A 1ITGA 1KRPA 1W0HA 2HHSA 4DTXA 4RW6A 4I9QA 2HVIA 1EETA 3SI6A 5C25A 1SL1A 5J2MA 3OYIA 4HCCA 3LWMA 2OPRA 3L3VA 1NK7A 4CGFA 2IC3A 4H4OA 2XY7A 1ASWA 4GVMA 1HMVA 3O3HA 3AVKA 4O5BA 1BIUA 3KKSA 1JXBA 1EX4A 2G8FA 3DYAA 3NF9A 3UIQA 5HLFA 4FLZA 4E1MA 3V9ZA 3SQ1A 4FLUA 4F8RA 4PY5A 5DK5A 4E3SA 1RBSA 3VQ6A 1Q8IA 1WAJA 4OKJA 1DTTA 4CJSA 4ELUA 3QEWA 1ZBHA 3TWHA 4N5SA 4DQSA 2BDPA 2G8KA 4DQQA 3AO5A 2X6SA 4DS5A 1D9DA 3M8PA 4ICLA 4XIUA 3HT3A 1VSIA 3AVNA 3V81A 3MXIA 4FM1A 3QESA 4FK0A 3AO3A 5CYQA 1J9AA 4GW6A 2OA8A 4CHZA 4K8XA 4PWDA 4GMJB 1XHZA 3P83D 4B9MA 3DM2A 2DTUA 5I3UA 3ZCMA 1JLEA 3VQCA 3OS1A 3VQPA 4DWIA 3K5LA 3S3MA 3NH2A 2XY8A 1TAUA 4AHCA 4CJUA 3SYZA 3VQ5A 4CHYA 2A1SA 1S6PA 1UA0A 4CJVA 4CEQA 1FKPA 1J53A 4FJ8A 3HJFA 3CG7A 4FW1A 1ZBFA 2G8WA 2PZSA 1RNHA 1NKCA 4KTWA 4FYDA 5EU7A 1EKEA 4Y1CA 3M8SA 4CF2A 1U48A 4B08A 1WSEA 3SNNA 3RRHA 3S3NA 2Z1JA 3KIOA 4ID5A 5FRMA 4KB1A 3RTVA 3WNFA 4DSEA 4OKKA 1EP4A 3KLEA 4KHUA 4IBNA 3IAYA 3QERA 3C6TA 3QEXA 5J2PA 1FK9A 1S6QA 4FLWA 4DFPA 4CIGA 3D45A 4CEZA 3RMDA 2KZZA 3QNNA 1JLCA 4FJXA 2X6NA 3DRRA 4AILC 3D0PA 4J2BA 1IKXA 3ZT1A 4OPJA 1LAVA 4ID1A 4CF1A 3LWLA 3TAFA 1YTUA 3U3GA 1QSYA 3C94A 1NKEA 1FKOA 4DTMA 4YFUA 5JS2A 1REVA 3O4NA 2RF2A 1NJYA 1HQEA 2B6AA 4W5QA 3DMJA 4DU1A 2XY6A 3PY8A 4DQIA 3B6PA 3HPOA 2IAJA 4W5RA 3LAKA 1JL1A 4FJMA 4KHYA 3ZT0A 1U47A 4DFMA 4NCBA 2HNZA 3E01A 3NFAA 1G15A 1TVRA 2Z1HA 3OYEA 4OPKA 3HVRA 2G8VA 1X9WA 2HB5A 4CIFA 2O4IA 3NE6A 4DTSA 3SQ4A 1SKSA 4Q0BA 4CK2A 3RR7A 1QE1A 4CJFA 4KHWA 1HRHA 1HPZA 1LWCA 4Z4GA 1R0AA 4OKEA 1RT5A 2F8TA 3HSTB 4NCGA 4O0JA 2IDOA 4CFAA 3K5NA 3NHGA 1NK5A 4BDYA 3ULDA 4FXDA 2KQ2A 4CFDA 1BGXT 1JLFA 3C95A 4M3WA 1NK9A 2HHVA 3OS0A 3O4QA 4RW7A 3LALA 4CJWA 1EXQA 2EHGA 1BI4B 3VA3A 5FROA 3NF8A 2HMIA 1BI4A 2GUIA 3KD5E 4KI6A 1YVUA 1QSSA 3CM5A 4HUEA 3CM6A 1RT3A 3AA4A 4G1QA 3KK1A 3V9WA 2PY5A 1NK6A 3V6DA 3L3UA 1RDAA 4RG8A 1U04A 4FZZA 3HM9A 1BISA 4EZ6A 3NAEA 4CF0A 3VQQA 3VQ7A 1XI1A 3QEVA 3PO5A 4KHQA 4KAZA 3RMBA 2R7YA 3OYFA 4CJQA 3RR8A 4RW8A 2HNDA 3DOLA 2Y1JA 1RBVA 3OYDA 4CJLA 3OS2A 1CLQA 3DLGA 2YV0X 3AA2A 1KVCA 3L2QA 3HO1A 1GOBA 3K57A 4L8RB 1JXEA 4QOZB 1LAWA 4FM2A 2OZSA 5CY4A 1ZYQA 4DTNA 3LZIA 1UA1A 1NOYA 1C1CA 5C24A 5HRPA 2FBVA 3L2WA 3BGRA 3NGZA 2JLEA 5KGWA 1RBUA 5HROA 4E7JA 2PYJA 4BWMA 4KTQA 4DTUA 1X1PA 4OLAA 4CECA 4DF4A 2D0CA 3P1GA 3ZT2A 3NH0A 1S1WA 4CFBA 4DSKA 2DFEA 2X78A 1D5AA 1HNIA 4RW9A 3ZSYA 1VRTA 1K6YA 3DLBA 3TAQA 4M45A 2QKKA 2OPPA 3AVCA 2XO7A 4CEFA 1TAQA 2WONA 4LH4A 4CGJA 3U3YA 2Y1IA 1L3UA 1Q9XA 1WSGA 4AH9A 1TKXA 1C1BA 3VQ9A 4FJ9A 2VG6A 1WSHA 4ZTFA 4FK2A 3HK2A 3SUQA 1U45A 3K58A 3KLFA 3PO4A 4I2QA 2G8HA 2DFFA 1SL2A 4BDZA 4DSFA 4JRPA 2ZQBA 1XWLA 4DSLA 3DLRA 1HYVA 4FK4A 1A5XA 4Z0UA 1CXQA 4TSXA 2YHAA 1ASVA 4CJKA 2HHXA 2X74A 5KRSA 1VSMA 2GBZA 2D0BA 4IKFA 3RMAA 3S3OA 4KI4A 1BIZA 4ZTJA 2HNYA 4OLBA 3RWUA 1WLJA 3OJSA 3ZT3A 1JLAA 2RPIA 1QSLA 1RTHA 1CXUA 3DLEA 4LSLA 4IG0A 2FBYA 3TAEA 1U49A 4DMNA 3DLKA 4E0DA 5HBMA 2YNHA 4K8ZA 4HHTA 5JS1A 2XY5A 4OGEA 2ATQA 3C6UA 2KFZA 1F21A 1S1VA 1JL2A 2OPQA 3B6OA 3IRXA 1TKDA 3V9XA 4N56A 1VSEA 3MXJA 2E6MA 4O55A 3NCIA 4CESA 4O4GA 2Z1IA 4LH5A 4CGIA 2G8UA 3CFPA 4FJIA 3TARA 1S1TA 4DS4A 2KTQA 1S1XA 4DQRA 4DTRA 3NH1A 1C6VA 3SPYA 4B9LA 4CEDA 1RT6A 2YKMA 3V1RA 4KHNA 4QCLA 3M8RA 3TAMA 4O44A 4CFCA 1X9SA 4M42A 3L2VA 1U4BA 4KHSA 1ZBUA 3VQBA 3VQDA 3PUFA 1C0MA 3DI6A 4CJ3A 4F3TA 3NDKA 3OYHA 4N76A 3U6FA 3ALYA 5HRNA 4CERA 1WAFA 3KD1E 5D3GA 3LDSA 3IS9A 2QK9A 2FC0A 1TGOA 1Q9YA 2QXFA 1YTAA 1KSPA 1VK0A 4PQUA 4CCHA 4AHVA 1IKYA 2VWJA 4LSNA 4FJ7A 4CK3A 3A2FA 1NKBA 3DRPA 3HP9A 3OYAA 3VQEA 3LP2A 5KGXA 4CIEA 2QKBA 3MEDA 2WOMA 3DOKA 3TAGA 1LV5A 1C1AA 1KFSA 3ZSWA 4M3YA 4AHUA 1VSDA 3HL8A 2DFHA 3ZSZA 1B9FA 1TKZA 4M3ZA 1SV5A 1IO2A 3SQ0A 2YNGA 4FJKA 4HUFA 1BCOA 1X9MA 1QTMA 3MAQA 4BACA 1NJZA 2P1JA 4C8MA 4CEOA 5SZTA 4Z4IA 1SUQA 3AVBA 3O3GA 4C8KA 4F2RA 5CYMA 1Z25A 1MU2A 3CFOA 3NF7A 4H4MA 4KKOA 2Q3SA 4KV8A 4B8CA 1J54A 4B9VA 4JS5A 4C8OA 4KREA 3AVHA 1WSJA 1T05A 1JLQA 3WNEA 4Z4HA 4CJTA 3OYJA 3AV9A 5DMRA 3F73A 3TI0A 3QIOA 2VWKA 4CHNA 2IGIA 4KRFA 2B5JA 3KLIA 4ELVA 3V4IA 3K2PA 3TAPA 4FVMA 1VSHA 4B9TA 2W42A 1CZ9A 1LWFA 4AHRA 3ZT4A 5CZ1A 5C42A 1SKWA 3LAMA 4MQ3A 1GOCA 4DLGA 4I7FA 2P5OA 4E7IA 1HYZA 4HTUA 3LPUA 4BE0A 3QLHA 5T7BA 3PX4A 3KLGA 1IKWA 3NBPA 3AO2A 4DU4A 3AA3A 3HXMA 3DLHA 1HQUA 1NOZA 1RILA 1ZBLA 3SCXA 4OVLA 1BHLA 1KFDA 4DFJA 1A5VA 4J2EA 4LD0A 1T03A 3K5MA 4WE1A 2NUBA 4DSJA 4FZYA 1VSJA 4CJRA 1B9DA 2XRIA 2OYQA 1JLGA 3OY9A 4E7KA
chains in the Genus database with same CATH superfamily
4BG8A 5KTQA 3AVGA 4CJ5A 4LF7K 4B3RK 1DT9A 3THXA 4DLEA 3AGKA 3TR8A 3RSEA 4RW4A 1BL3A 1HNXK 2QTDA 4I9LA 1HNVA 4CZFA 4JRQA 1VQ4N 1HNZK 1DGKN 4NYNA 4EAHD 5J2NA 2HHWA 2HF4A 4CZHA 1X9JA 4EP5A 4H5TA 4EFHA 5E41A 1A5WA 2W41A 5HP1A 1TL3A 2KHOA 3LDNA 3T19A 4CEBA 2EX3A 4CGDA 1DKGD 4C8LA 1EQYA 3A5OC 2P9KB 4OGCA 2YNIA 3LP0A 3QETA 3VGKA 3FFIA 4DV6K 5AQXA 4WFBL 2O8FA 3LP1A 1NGDA 4CW7B 2GTDA 1IH7A 4BVPA 3MMVA 3OBWA 4LFAK 3E9PA 4JI4K 3U8XA 1C0FA 3F9KA 3RVCA 3V1QA 5FRNA 4CHPA 1L3VA 3SJJA 3WEEB 1GLJO 4DFKA 4FJ5A 1IBMK 4ELTA 2FF3B 2DY4A 2ZE2A 2A5XA 3CI5A 1WUAA 1BCMA 3PX0A 1KLNA 1YT3A 3KK3A 3EYZA 3KTQA 3DLLL 1L5UA 1IKVA 3ULEA 2OTJN 2QWQA 3AAPA 5K14A 4FWRA 1KLMA 2P9UB 4CZKA 3AO4A 1QS4A 4DV0K 4GKJK 3AVAA 1S9GA 4O0IA 4FCYA 4BE2A 4K41A 3VQ8A 2O8CB 1WNSA 3QNOA 2KW4A 2HBLA 4OJRA 1QZ5A 4QAGA 3OYLA 1VQ6N 2WBNA 4H03B 1UOCA 3FE1A 3HM8A 2QM1A 3HYFA 4JD2B 3I0SA 3AVFA 5C2FA 2F9TA 2V52B 3QEPA 2NRZA 2PYLA 3TANA 4W5OA 4IDKA 4KO0A 2Q0RA 2RN2A 1SKRA 2LSNA 3OYNA 5KI6A 4CK1A 1OVYA 3T1HK 1BOTO 3EY1A 4FJHA 1SL0A 4L3QA 2O4GA 4JI3K 3ISNC 1IG9A 2GV9A 1VSFA 3ITHA 3QEIA 3ASMA 1GLAG 3KHYA 2YNFA 4CVNE 2UYTA 4FLXA 2NZTA 3FGUA 4YNQA 3PIPL 1LWEA 3L8BA 3C7NA 2QEXN 1KVAA 1RDBA 4C23A 2Z1GA 3VEVA 3KKRA 1K8AO 1L3SA 1J5OA 3ZETB 2HVIA 4RW6A 4I9QA 4QS9A 4A61A 4HCCA 3H3NO 3L3VA 1X3MA 4CGFA 3CCSN 4GVMA 1I94K 4FWSA 5HLFA 2ASMA 3V9ZA 4YY3K 4FLUA 5DK5A 1O13A 1RBSA 1QQNA 3TWHA 4DQSA 3G6EN 2BDPA 3AO5A 2NRRA 3A8YA 1LOTB 2E1YA 3J7AP 1D9DA 3M8PA 4XIUA 3HT3A 4CJ7A 3CC4N 4FM1A 3QESA 5FPMA 4OX9K 4K8XA 2OA8A 3DM2A 3E9OA 1U6ZA 3D2EA 4R79A 4CJUA 3SYZA 3P4IA 4BRDA 1FKPA 5AZJB 3CG7A 3ENBA 3U9ZA 3E1YA 1U2VA 1U48A 4B08A 3SNNA 2NLXA 5FRMA 2Z1JA 4KB1A 3EL2A 2E2QA 4IBNA 3ZX0A 3QERA 1BWFO 3QEXA 5J2PA 5C10A 3D45A 5HL7L 3RMDA 4LFBK 5M1QA 1KXPA 4CBUA 2X6NA 1XNRK 5JVGL 2ZM6K 4DV3K 3U3GA 2WFBA 1QSYA 1NKEA 5ADXH 3O4NA 2B6AA 4W5QA 3B6PA 4KHYA 1JL1A 2F8TA 4CIFA 3L0QA 2ZJRL 5LL6Z 3NE6A 3SQ4A 3F9MA 4CK2A 1QE1A 1HRHA 1LWCA 4OKEA 5DM7L 4A59A 4NCGA 1Q86O 3KWIA 1SZ2A 3EN9A 4M3WA 2QWOA 3ATVA 4CJWA 1EXQA 2EHGA 4ILHA 1BI4B 2GUIA 4KI6A 1YVUA 3LM2A 5AQTA 5C12A 3MCAB 3PIOL 3KK1A 3CF5L 1KAXA 3V6DA 5KPTA 4RG8A 3HM9A 3MWPA 3CQYA 2IVPA 4EZ6A 5FPEA 4NXMK 2CH6A 4RW8A 3R9PA 1NGCA 4IZ9A 4B1VA 3AA2A 1KVCA 1GOBA 3PLAA 3E66A 4IO9L 1RDUA 3LZIA 5GAHP 2FBVA 3H6EA 1YITN 3E9LA 1M1KO 4KTQA 4DTUA 2HBMA 3H1QA 3P1GA 2DFEA 1D5AA 4RW9A 3TSQA 1J5EK 5AQPA 2OPPA 4MDBA 3AVCA 1T44A 4CEFA 4CGJA 4LH4A 3U3YA 3WXJA 2Y1IA 4ISFA 1C1BA 3VQ9A 3HK2A 2VG6A 1WSHA 1NMDA 4NLBA 4X64K 3SUQA 1U45A 3PO4A 2DFFA 4JHDB 4DSFA 4FWNA 4B1YB 2Q2RA 4LF8K 3DLRA 4FK4A 1NBWA 4QS7A 4TSXA 2YHAA 1ASVA 4CJKA 5KRSA 2VCPA 2GBZA 4KI4A 4B1ZA 4JK8A 2VGMA 3NMUA 4DQ8A 3R1XA 4MLEA 5I9EB 2HNYA 3FZMA 3OJSA 3OTOK 1JLAA 4GV6A 2P9KA 3DLEA 4LSLA 2FBYA 4XH1A 3CJ1A 3CIPA 3ZX2A 2YNHA 3CJAA 5H1SQ 4HHTA 3CJBA 5F0XA 2XY5A 3CC2N 4A5AA 4OGEA 2KFZA 4JKFA 1WB9A 2O8EB 1F21A 1NJIO 3IRXA 4N56A 3FFKB 4O55A 4JKHA 4CESA 4O4GA 3P39A 3D6RA 3CFPA 1S1TA 1S1XA 3NH1A 2ZF5O 3SPYA 4A57A 4WQ5A 4UY8O 3T7ZA 4KHNA 4NLCA 4QCLA 4CFCA 4KHSA 1ZBUA 3WEEA 4PKHA 3NDKA 3ALYA 2A3ZA 3KD1E 2GEMA 2A42A 4IFEA 1Q9YA 2QXFA 1VK0A 3QBWA 4AHVA 4CK3A 1NKBA 1K9MO 2GX9A 3DOKA 3TAGA 1LV5A 5CR4A 4AHUA 2DFHA 5AQLA 3ZSZA 5KQDA 2YNGA 1X9MA 2P9UA 3MAQA 1WOQA 4HTLA 4F2RA 5CYMA 4JI8K 3NF7A 3QMLA 2O8CA 2P9NB 3AVHA 2WTUA 2O8BA 4Z4HA 3AV9A 5DMRA 3K9JA 3MX2A 3QIOA 5AQFA 4WFAL 4YORA 4KRFA 2J4RA 1VSHA 1CZ9A 1LWFA 3ZT4A 5CZ1A 5C42A 1KD1O 3WXKA 5CE3A 4DR7K 4JD2A 1QHAA 3FZHA 4IEIA 5FPDA 5T7BA 2RHKA 3NBPA 1NGAA 4FOIA 4DU4A 4JI6K 4OVLA 1BHLA 1NWKA 1A5VA 4I6MB 4WE1A 4DB3A 1E4FT 1VSJA 3IFRA 2HHHK 1JLGA 1BUPA 3OY9A 1OVQA 1XHXA 3WNHA 5AQYA 3L2UA 3NF6A 4RWTA 3SUNA 4NO7A 2UUBK 2RKIA 4B8AB 4DCHA 4CF8A 2D1KA 3I0RA 2CGJA 2I5JA 1NGIA 3G0ZA 4KTZA 1RTDA 3DJCA 3RMCA 4DTJA 1GLCG 3BF3A 5GIOA 5J2QA 4Y1DA 4O5FA 3TTCA 2NRHA 4IJNA 5AQWA 4DU3A 3WXMB 4A2BA 1TK0A 5J1EA 1RTJA 2HHUA 3T3FA 3GBTA 4BRGA 4JKBA 1NGFA 4RCHA 3HPGA 5HRSA 2OANA 3OYBA 3C65A 1FXXA 3CCQN 3ZSQA 4W5TA 3M5RA 5EXWA 1LW0A 3QFUA 1BQMA 5GAGP 3SZ2A 3H08A 5CZ2A 4BC5A 3AVIA 5SWMA 4ISGA 4M3RA 4I2PA 2FBXA 4WQ4A 3DRSA 4LF4K 3VESA 1QHTA 3AVLA 4A2AA 1WBDA 4CEAA 1UAXA 4B9UA 1Y97A 1RDDA 1XMOK 2OZMA 1P8ZA 4BR5A 3SUOA 3K59A 5AZJA 1B92A 3J80O 3ENOA 1NJWA 1M90O 3CHWA 3SK3A 1JLBA 2AA4A 1NK0A 3L2RA 1Z26A 1HJRA 2UUAK 3TABA 1S9EA 3M8QA 4MFBA 4EZ9A 1VSKA 4CI6A 3O9TA 4YOUA 4LY7A 3P5JA 1WBBA 3IG1A 4CZIA 1XC9A 4Z4CA 4FVUA 3HP6A 3KVGA 4H8KA 4IFVA 1T7PA 1NM1A 3OYKA 4AM7A 4DSIA 2D0AA 1I39A 3R6MA 3HRGA 2O8DB 3PV8A 2VG5A 3CCJN 4HVJA 4CZLA 1Q7YO 3NVMA 4BE1A 1NJXA 2OPSA 1N6QA 2YHBA 5AQRA 3PSFA 3THWB 4IFYA 3G10A 4H5NA 3FZLA 3KK7A 4CJEA 3DXKA 4A5BA 3RRGA 4M41A 4K42A 3L4IA 5IT9O 4CF9A 2CGKA 5LJWA 2JWKA 2BE2A 2Q1NA 4ZHRA 1RT7A 3V9UA 2HVHA 3VETA 3AA5X 5AQHA 2PFUA 3W0LA 4BRLA 4E1JA 5FDLA 2EWSA 3K5OA 3VQ4A 2DPNA 3MN6A 3OJUA 2UXDK 2QW9A 3QB0A 1C0TA 2D5RA 3ZSVA 4DG1A 4C8NA 3EZ5A 4LF5K 1W9HA 3OYMA 4JYAK 1KRPA 1W0HA 1VQ9N 2HHSA 1EETA 4B1UB 3J7YP 1SL1A 3OYIA 2QXLA 4JKEA 1NK7A 2XY7A 1ASWA 1HMVA 3O3HA 1BIUA 1JXBA 2G8FA 3UIQA 3NF9A 1XQSC 2V51B 1WAJA 4CJSA 4ELUA 1ZBHA 4JK7A 4N5SA 4JHDA 2HOEA 4BRCA 3FZFA 3AVNA 3MXIA 4FK0A 5CYQA 1J9AA 4GMJB 4B9MA 3AGRA 3ZCMA 3VQPA 4YDUC 3NH2A 1TAUA 4CHYA 2A40A 1EO1A 5GIPA 4FW1A 3O5BA 1RNHA 3M8SA 1IV0A 3RRHA 3KIOA 4ID5A 4DSEA 4KHUA 3IAYA 4A62A 1S6QA 2P9PB 4FWOA 4FLWA 4CEZA 5TKWA 1NNEA 3LL3A 4FJXA 2E2OA 3Q7CA 4NB4A 1IKXA 3LWLA 4H5RA 3MN9A 3TAFA 3SMPA 3VEYA 1FKOA 4OPHA 4OLBA 1REVA 3A0IX 2YJFA 1NJYA 3PY8A 4ILGB 2IAJA 4M7XA 3DAWA 4W5RA 3CPWM 1U47A 4DFMA 4NCBA 4YOXA 3E01A 2HB5A 1GLEG 4DUZK 4Q0BA 1KQSM 1RT5A 3C6AA 1TYQA 3HSTB 4AQYK 1NU0A 1NK5A 1YVNA 3NHGA 4BDYA 3ULDA 2KQ2A 2ZGZA 1K8KB 2HHVA 3OS0A 3VA3A 5FROA 3AY9A 1KAYA 2HBJA 4HUEA 3CM6A 3AA4A 3H45C 2FF6A 4FZZA 3O9SA 2IVNA 4CF0A 3VQQA 3CMEN 3U9DA 4H0OA 3VQ7A 3JAMO 1OH6A 2P9SB 3O9RA 3RMBA 3OYFA 2VQEK 4CJQA 2Y1JA 4BC2A 5EX5A 3LDLA 4CJLA 3OS2A 2YV0X 3L2QA 4BG9A 3Q7BA 4I6MA 4LC9B 4QOZB 1LAWA 4FM2A 1ZYQA 4H0PA 3HOTA 2QWRA 5C24A 3BGRA 3NGZA 5KGWA 3VEOA 3CXCM 1RBUA 1HKBA 4BWMA 3CJ7A 1X1PA 4OLAA 3ZT2A 2E5LK 3NH0A 1P90A 1S1WA 4DSKA 2X78A 4BGBA 1GLFO 1OH7A 1Y64A 1VRTA 1V4SA 5AZIB 3DLBA 1Q9XA 2HSTA 3O8MA 4IXCA 3UKRB 4FJ9A 3CJCA 3KLFA 3K58A 4CZJA 1SL2A 4BDZA 4B1XB 1VQKN 1XWLA 1HYVA 3OHRA 1CXQA 3O9QA 2HHXA 5AFUH 1GLBG 3VENA 1BA0A 1BIZA 3TPQA 4DV7K 4ZTJA 2JWLA 2A6AA 1QSLA 1RTHA 1CXUA 4OPAA 5KPZA 1VQ7N 4H5VA 3SLCA 3U4LA 5JS1A 1ILYA 3VEZA 3TTFA 4C1NK 1JJ2M 4HWIA 1S1VA 1JL2A 1QVFM 2FSJA 1IBLK 2BUPA 4CGIA 3FR0A 2G8UA 4FJIA 3TARA 4DQRA 4DTRA 3F2KA 3G4SN 4B9LA 1RT6A 1W7AA 2YKMA 3M8RA 4M42A 1BG3A 3VQBA 3VQDA 3GE1A 1C0MA 3P31A 4CBXA 4F3TA 2QWPA 4CZGA 4B3SK 1S72N 4CERA 1WAFA 4GKKK 3W3DA 5D3GA 2QK9A 1TGOA 1YTAA 2P9IB 3M3ZA 4CCHA 4JI1K 1IKYA 2E2PA 4FJ7A 3A2FA 3OA9A 3DRPA 3HP9A 4DR5K 3VQEA 3LP2A 3MEDA 4M3YA 3A5MC 5BRDA 1LCUA 3EKUA 4FWPA 4M3ZA 4IOCL 1SV5A 5BPLA 4FJKA 3UE5A 4HUFA 1BCOA 4BACA 5SZTA 4X62K 1SUQA 1Z25A 4H4MA 4BRMA 4KV8A 4B8CA 4C8OA 4JS5A 3CD6N 2E2NA 1JLQA 1TUUA 3OYJA 1VQ8N 2Q0UA 2V7YA 2VWKA 1SS6A 2B5JA 2HBKA 3V4IA 3TAPA 4FVMA 5MLCQ 1N32K 4B9TA 1VQPN 4AHRA 4B3MK 3LAMA 1TUYA 4MQ3A 4DR2K 4BY9C 4BR7A 3G71N 2GWJA 3BF1A 3PX4A 1IKWA 3J8AA 5AQNA 4BC4A 4M7YA 5M1FA 3K5MA 2NUBA 1VQON 4U7BA 3M6GA 2W40A 4K8ZA 5M1PA 4E7KA 4DU1A 1EWRA 1ZBIA 3LANA 4DTOA 1OH8A 3BZCA 3THXB 4JI2K 3CQ8A 3RSEB 5EOYA 4JLHA 1GLDG 3VA0A 2BH1A 4JN4A 5JICA 4BRPA 3CCLN 4GV3A 4B3TK 3L6QA 2ZJPL 2D0PA 4Q5VA 3ZSXA 2IS3A 4V19S 4N41A 1JKHA 2Q31A 4CBWA 3SV4A 2E8AA 1TKTA 3WNGA 1KTQA 5F1XA 2FBTA 3WXLA 3EO3A 3SAFA 5KRTA 4HUGA 3OVNA 2D0OA 4FW2A 5AQOA 3MEEA 4BQLA 1NK8A 2JGUA 5LMNK 1E3MA 4FO0A 1KCFA 3NGYA 3OYCA 3I33A 4IDHA 4KH6A 4DTPA 3LPTA 1HNWK 3THYB 3SV3A 4Z4FA 4PL8A 3VEXA 4E7HA 1K73O 4KPYA 1RT4A 2P9LB 3CERA 1RDCA 1QQCA 1T8EA 1Q82O 4FWKA 1YHQN 2WC9A 2D4WA 4CZEA 1JCGA 5IWAK 3MK6A 3CCUN 3KJVA 4X66K 4EP4A 4NXNK 5LMUK 1VRUA 3MXMA 4CHOA 3AVMA 5ADXA 5LJVA 1RTIA 5AQUA 2P9PA 2Q36A 4WFNL 4JKGB 2ITGA 1TL1A 3AO1A 2E6LA 3JYTA 4J2AA 1KVBA 4B9SA 4B9QA 1WN7A 2HF3A 3QDKA 3AVJA 1DLOA 3G25A 2YI1A 3V9SA 3GL1A 4AHSA 4KBOA 4DV2K 3HPHA 3VQAA 3PX6A 3CYMA 2IVOA 2H3GX 1N36K 2KFNA 4CE9A 4FM0A 3EE8A 1D4XA 2ZWHA 4F3OA 3GOIA 3O3FA 3MX5A 1HKCA 2VYPA 5TKYA 1C0UA 1S5JA 1NGGA 5FLXO 2GWKA 5EVZA 1XUPO 4DQPA 1K8KA 2OCEA 2PAVA 4B9NA 3OYGA 1SQKA 4N47A 3BZKA 4FZXC 1LW2A 2B4JA 4AHTA 4BROA 5F2RA 3OBYA 4JV5K 1RT2A 4F4KA 4MLHA 4KHPK 4IG3A 4GNIA 4CGGA 4JEPA 1DTQA 1GOAA 2YKNA 3QINA 5ELZA 4B3OA 2V7ZA 1QQMA 3SPZA 1MWKA 1WSIA 2QI2A 3HVTA 4HCBA 1RBTA 2HHQA 2P51A 4FLVA 1TK5A 2VG7A 4CJPA 3THVA 4DF8A 5AQZA 3SQ2A 3M1FA 2UXCK 3ZETA 4DTXA 5J2MA 4J8FA 2OPRA 2IC3A 4DKWA 4CD1A 2NRWA 2QWMA 5JLFA 4DV4K 3AVKA 3AARA 3LM9A 3GDQA 3DYAA 4FLZA 4E1MA 3SQ1A 4F8RA 3PSIA 3WQTA 4K43A 4JI7K 4FPBA 1HUXA 3VPZA 3ZYYX 2G8KA 2X6SA 5BREA 3IKMA 4PWDA 4GW6A 3J7ZO 4CHZA 1XHZA 3S41A 2GELA 2DTUA 4DR3K 1JLEA 3VQCA 4X65K 3OS1A 3D2EB 4F9OA 4DWIA 1N8RO 5BN9A 3O9UA 2XY8A 4AHCA 3VTHA 4BRIA 1XMQK 1UA0A 1S6PA 2E88A 2G8WA 5BRHA 1ZBFA 2PZSA 1NKCA 4FYDA 3C6HA 3EEQA 4OO1J 3ZX3A 1EKEA 4Y1CA 4CF2A 1WSEA 2FSNA 3S3NA 3WNFA 4OKKA 1EP4A 1G99A 3KLEA 1W97L 3D2FB 1FK9A 3VGMA 2KZZA 1YJ9N 3CCEN 3QNNA 3D0PA 1SAZA 2OTLN 3O6WA 1YTUA 1LAVA 4CF1A 1RDWX 4DTMA 4YFUA 2RF2A 4DQIA 2XY6A 3R3LA 3DMJA 2E1ZA 1NGHA 5CHIA 3DXMB 3HJFA 5FPNA 3ZT0A 2P9IA 2FXUA 2I7PA 3NFAA 4KH5A 1TVRA 3OYEA 3HVRA 4OPKA 2G8VA 1X9WA 4DTSA 1SKSA 2PBDA 4Z4GA 4CJFA 4KHWA 1HPZA 4QS8A 1HR0K 4BR2A 3R8EA 1Z6RA 4O0JA 4CFAA 3K5NA 4WF9L 4JKDA 1BGXT 3MN5A 1YF5L 1NGBA 5JLHA 2HMIA 4JK9A 1BI4A 3KD5E 3CM5A 1RT3A 3VEWA 3V9WA 2PY5A 3O80A 1NK6A 4BRAA 2I7NA 5AQQA 4KH4A 1ZXOA 4JKAA 5BR9A 1BISA 3PO5A 2R7YA 4MO4A 3RR8A 1RBVA 1YUWA 5AR0A 5LY3A 3DLGA 3D7EO 1MWMA 1XNQK 3K57A 1ATSA 2OZSA 1CZAN 3VMFB 4DTNA 1C1CA 5HRPA 2JLEA 4BR9A 3ZEUB 5JVHL 3LDQA 5AJ3K 3QICA 4CECA 4DUYK 1RFQA 5C15A 3VOVA 2D0CA 3ZSYA 4BRNA 3VF6A 1K6YA 4M45A 3J81O 2QKKA 4BR0A 2XO7A 1L3UA 1WSGA 1TKXA 3IUCA 3CCVN 4FK2A 4JI5K 5GAEP 3QFPA 4LFCK 2ZGYA 1A5XA 4Z0UA 5M1OA 2D0BA 3S3OA 3VF4A 3RWUA 1WLJA 3ZT3A 3ZLJA 4IG0A 3TAEA 3DLKA 4E0DA 3T1YK 5HBMA 1YAGA 1MDUB 3TTDA 2VGNA 2YCHA 4YOVA 4JI0K 3MDQA 5HOOA 1TKDA 2O8EA 3V9XA 2QA4N 3THYA 3MXJA 3CQXA 2E6MA 2CH5A 1C0GA 3SMSA 3HOSA 2QWNA 2KTQA 1C6VA 2P9LA 4CEDA 3V1RA 1YI2N 1X9SA 4O44A 3L2VA 1U4BA 3DI6A 4CJ3A 4N76A 5HRNA 5A2QO 1T6CA 5AQMA 5BRFA 2FC0A 4K0KK 1DEJA 4PQUA 2VWJA 2ZJQL 3WUHA 4GVEA 4CIEA 2WOMA 1C1AA 4JKGA 1KFSA 1VSDA 3HL8A 3EE9A 1B9FA 1TKZA 3SQ0A 1Z05A 4C1NI 1QTMA 1NJZA 4WCEL 4O8UA 4CEOA 4Z4IA 3AVBA 3O3GA 4C8KA 1MU2A 1QQOA 3CFOA 4KKOA 2O8BB 3CC7N 1J54A 4KREA 2P9NA 4DR4K 3SBGA 4CJTA 3TI0A 2AP1A 4ELVA 3K2PA 2YHXA 1HLUA 1H1VA 4YOTA 1NGJA 2F7TA 1NMNA 3TU5A 4PHTX 1N33K 1GOCA 2ITMA 2P5OA 4E7IA 3IDHA 3LPUA 4BE0A 5AQSA 1VQ5N 4IOAL 3LDPA 3AO2A 4YOYA 3AA3A 3DLHA 1HQUA 1NOZA 1ZBLA 3SCXA 3EKSA 4J2EA 1T03A 4DSJA 4CJRA 1JCFA 3WQUA 2XRIA 2OYQA 4Z94A 4FJNA 4CEEA 4M3TA 4JAXA 3T1AA 4IO8A 4FJGA 3MEGA 2E4LA 3NGIA 1S1UA 3HTVA 4O8KA 3LZJA 3I8DA 1RT1A 3SAGA 3LDOA 2F96A 1OH5A 2F8SA 3S9HA 4YDUA 3UKUB 4ILJA 4F2SA 3KLHA 3C0BA 3QO9A 1FW6A 2W6KA 4W5NA 1T3VA 1BQNA 1BDGA 4KB0A 1YXQA 2FSKA 5AQGA 1L3TA 1D8YA 3HI0A 1T6DA 3BDPA 2UUCK 2YX6A 1NG9A 3MECA 3O1WA 4E7LA 3KK2A 3BP8A 5DM6L 4FLYA 1ASUA 1EWQA 4H0TB 3B8AX 4M3UA 1NGEA 4BDPA 3VGLA 1HYSA 4PUOA 4E19A 5HRRA 3ZSOA 3WT0A 1RCHA 4CGHA 3CFRA 3SUPA 4PKGA 3ZSRA 1CZBA 4Z4EA 3I8BA 1R59O 4J2DA 4NYFA 3QIPA 1TV6A 4BRFA 2KKZA 2ETJA 3UB5A 3ATUA 1HKGA 3D2FA 4H0YB 4JS4A 1KAZA 1N34K 4DHYA 3ENHA 1WSFA 3VN5A 3OW2M 4IKFA 2F4VK 5KPRA 2F9WA 3SJHA 2NRVA 2A1RA 5I42A 4U67L 4BWJA 4FL9A 4FSVA 2HW3A 1UWBA 5AQKA 4M3XA 1IBKK 2IOCA 4GY2B 1D9FA 3DXMA 5B8HA 2BGGA 2E20A 1NK4A 4E1NA 4NCAA 1ATRA 2BTFA 1VSLA 1O1WA 4PA1A 2KZMA 2NNWA 3H1VX 1JCEA 4FJLA 4FLTA 4WQ5C 2HHTA 4DV1K 1FJGK 4FJJA 5C0YA 3KZBA 4H0XB 2O8DA 1Q81O 4FWMA 1YJNN 4H0VB 3LP3A 3HZ6A 4UQGA 4CJ4A 1V4TA 4FOEA 3THWA 3BY5A 2P5GA 3VTIA 3DXKB 3V1OA 3K9KA 1VQMN 4JNEA 1TK8A 2G8IA 2ZD1A 4E89A 3HBTA 1ATNA 4CHQA 2XHBA 4KFBA 1I3AA 4R5PA 1HX1A 2AJQA 2KLAA 2BANA 1YJWN 4FPAA 1BO5O 3P38A 3MCPA 1N5YA 1RBRA 3JSMA 4CZMA 4BVOA 1ITGA 3ZEUA 3JS6A 3SI6A 1MA9B 5C25A 3LWMA 4H4OA 3L4QA 4BQZA 4O5BA 3KKSA 5AFUA 1EX4A 4PY5A 4E3SA 4IOXA 3VQ6A 1VQNN 1Q8IA 5KQ8A 4OKJA 1IJJA 1DTTA 3QEWA 4XH4A 1BU6O 4FWQA 4BREA 4DQQA 1W2BM 2O8FB 4DS5A 3V81A 4ICLA 1VSIA 3AO3A 3WXIA 3P83D 4H5WA 4K25A 1VHXA 4MDAA 5I3UA 5BR8K 2ASPA 3K5LA 3S3MA 3FLCO 1S3XA 3VQ5A 4LF6K 2A1SA 3MWTA 4CJVA 4CEQA 1J53A 4BRKA 4FJ8A 3VF2A 4KTWA 3A5LC 3O08A 5EU7A 4B1WB 2YHYA 4AF1A 3DWLA 3RTVA 1ZC6A 4GV9A 3C6TA 2FLOA 4DFPA 2CGLA 3ULEB 4CIGA 2W6LA 4Y0WA 1GLLO 1JLCA 3DRRA 3AAQA 4AILC 4J2BA 2YHWA 3ZT1A 4OPJA 4ID1A 3C94A 2YJEA 2A41A 3HSCA 1QVGM 5JS2A 1HQEA 5AQIA 4FJMA 4XEIA 4WQ4C 3HPOA 3LAKA 2HNZA 4PL7A 4XH5A 1G15A 2Z1HA 2O4IA 1VQLN 2Q97A 4IWVA 3RR7A 3QBXA 1TYQB 1R0AA 1BA1A 2QWLA 2IDOA 5AQJA 1NLVA 4EHTA 4FXDA 4CFDA 2UXBK 1JLFA 3CCMN 5GINA 5E84A 3C95A 1NK9A 2HMPA 3O4QA 4RW7A 4BGAA 3LALA 3MN7A 3NF8A 1QSSA 4G1QA 2IIRA 2VWBA 3L3UA 2NRTA 1RDAA 4M63C 1OKJA 1U04A 3NAEA 1XI1A 3QEVA 4KHQA 4KAZA 2P9SA 2HNDA 3DOLA 4YHHK 4FWLA 3OYDA 1CLQA 1Q18A 3HO1A 1ZBSA 4ISEA 3C7NB 4L8RB 1JXEA 1S22A 5CY4A 1UA1A 1NOYA 3L2WA 3O1BA 5HROA 4E7JA 2PYJA 3I55N 4DF4A 3K0SA 4CFBA 1HNIA 3VERA 2GUPA 3TAQA 5AZIA 3TSUA 1TAQA 2WONA 4AM6A 4AH9A 4CD3A 4ZTFA 3UKRA 3UKUA 3N4PA 3H46O 3JXUA 4IEEA 1X3NA 4I2QA 4PKIA 2G8HA 5EY4A 3SAHA 3CETA 4JRPA 2ZQBA 4EIAA 3BEXA 4DSLA 5BPNA 2UU9K 4RTFD 1VAZA 2X74A 1VSMA 3TSPA 3ID8A 3BUZB 3RMAA 5GADP 2ASOA 5BN8A 2RPIA 1U49A 3N4QA 4DMNA 5M1NA 1U2VB 2ATQA 3C6UA 4YOWA 2OPQA 3B6OA 1RGIA 1VSEA 2WUSA 3NCIA 2Z1IA 4LH5A 2VQFK 3NVKA 4DS4A 1XC3A 2NRXA 3ID6A 3CCRN 3TAMA 3EZWA 4BR4A 4LF9K 3I56N 3PUFA 4BRQA 3OYHA 3GG4A 3U6FA 3LDSA 3IS9A 5C2DA 1KSPA 4LSNA 3OYAA 5AQVA 3KWGA 5KGXA 1ESVA 5BPMA 2QKBA 3T69A 3ZSWA 3IMXA 4BRHA 1IO2A 3F5TA 4DR6K 2P1JA 3CPEA 4C8MA 1E4GT 4DR1K 3FZKA 2Q3SA 4B9VA 1QZ6A 1WSJA 5JMVA 1T05A 3WNEA 4G9ZA 3CMAN 4JKCA 3F73A 1HPMA 4CHNA 2IGIA 3KLIA 5E26A 3O4WA 1HJOA 2W42A 1IG8A 3CJ9A 1SKWA 4DV5K 4DLGA 4I7FA 4MO5A 1HYZA 4HTUA 1YIJN 3H3OB 3QLHA 4IJAA 3KLGA 3A5NC 3HXMA 1RILA 4WYBA 5M1KA 2RE2A 1KFDA 4DFJA 4LD0A 1J6ZA 4BC3A 4FZYA 4EHUA 1B9DA 1KC8O 3SBTA
chains in the Genus database with same CATH topology
3LANA 4FJNA 5KTQA 4DTOA 1XHXA 3AVGA 4CEEA 4CJ5A 4M3TA 3WNHA 3T1AA 3NF6A 3L2UA 4FJGA 3MEGA 2E4LA 3NGIA 3CQ8A 1S1UA 4DLEA 2RKIA 3SUNA 3TR8A 4B8AB 4JLHA 4RW4A 4CF8A 3LZJA 3I0RA 1BL3A 3I8DA 3VA0A 1RT1A 2I5JA 1HNVA 4I9LA 3G0ZA 2F96A 4JRQA 4KTZA 2F8SA 3S9HA 4NYNA 5J2NA 1RTDA 2HHWA 4F2SA 3KLHA 3RMCA 4DTJA 3QO9A 4Q5VA 5J2QA 4Y1DA 3ZSXA 1ZBIA 4DU3A 2IS3A 4W5NA 4EP5A 1TK0A 4N41A 1JKHA 1BQNA 5J1EA 3SV4A 4KB0A 1TKTA 3WNGA 5E41A 1A5WA 1RTJA 2HHUA 5HP1A 3T3FA 1TL3A 1L3TA 1KTQA 1D8YA 3T19A 2FBTA 4CEBA 2EX3A 4CGDA 3HPGA 4C8LA 5HRSA 5KRTA 4HUGA 3BDPA 3OVNA 4FW2A 3MECA 3OYBA 3MEEA 4OGCA 4E7LA 1FXXA 3KK2A 3ZSQA 1NK8A 2JGUA 2YNIA 3LP0A 4W5TA 3QETA 1LW0A 1BQMA 4FLYA 3SZ2A 1ASUA 3FFIA 3H08A 5CZ2A 1KCFA 3AVIA 3NGYA 3OYCA 4M3UA 5SWMA 4DTPA 3LPTA 4BDPA 1HYSA 4M3RA 4E19A 4PUOA 3LP1A 5HRRA 3SV3A 4I2PA 2FBXA 4Z4FA 3DRSA 4E7HA 1QHTA 1IH7A 3AVLA 4KPYA 3ZSOA 4CEAA 1RT4A 1RDCA 1UAXA 4B9UA 1RCHA 4CGHA 1QQCA 3CFRA 1T8EA 1Y97A 3F9KA 1RDDA 3V1QA 3SUPA 2OZMA 5FRNA 4CHPA 1L3VA 3ZSRA 1CZBA 3SJJA 3SUOA 3K59A 1B92A 4DFKA 4Z4EA 4FJ5A 1NJWA 4ELTA 3KJVA 2DY4A 4J2DA 4NYFA 4EP4A 2ZE2A 1JLBA 3QIPA 1BCMA 1TV6A 1VRUA 3MXMA 4CHOA 3AVMA 3PX0A 1NK0A 1YT3A 1Z26A 2ETJA 1RTIA 3KK3A 3L2RA 3EYZA 1HJRA 3KTQA 1L5UA 4JS4A 1IKVA 1KLNA 2ITGA 3TABA 1TL1A 1S9EA 3AO1A 3M8QA 1WSFA 2E6LA 5K14A 4MFBA 1KVBA 3VN5A 3JYTA 1KLMA 1WN7A 4B9SA 4J2AA 4EZ9A 3AVJA 3AO4A 1QS4A 5I42A 1DLOA 2A1RA 4BWJA 3AVAA 1S9GA 4O0IA 1VSKA 4FCYA 2HW3A 1UWBA 4BE2A 3VQ8A 4LY7A 3V9SA 1WNSA 3P5JA 3IG1A 3QNOA 4M3XA 2KW4A 2IOCA 4AHSA 1XC9A 3HPHA 3VQAA 4Z4CA 4OJRA 1D9FA 3HP6A 4QAGA 3CYMA 4H8KA 3OYLA 3PX6A 1NK4A 4IFVA 4E1NA 1T7PA 4NCAA 2BGGA 1VSLA 2KFNA 1O1WA 4PA1A 2KZMA 1UOCA 3OYKA 4CE9A 4FM0A 4FJLA 4FLTA 2HHTA 4F3OA 4DSIA 2D0AA 1I39A 3O3FA 3PV8A 4FJJA 3HYFA 2VG5A 3I0SA 4HVJA 3AVFA 3QEPA 1C0UA 1S5JA 2OPSA 4BE1A 3TANA 1NJXA 4W5OA 1N6QA 4IDKA 2PYLA 4KO0A 2YHBA 3LP3A 4UQGA 4DQPA 2RN2A 4CJ4A 1SKRA 2LSNA 3OYNA 4B9NA 3OYGA 4N47A 4IFYA 5KI6A 4CK1A 2P5GA 3G10A 3EY1A 3V1OA 4FJHA 4CJEA 4FZXC 1SL0A 1LW2A 3RRGA 2B4JA 2O4GA 3ISNC 4AHTA 4M41A 1TK8A 1IG9A 2GV9A 2G8IA 2ZD1A 4E89A 1RT2A 4F4KA 4IG3A 4CF9A 1VSFA 3ITHA 3QEIA 4CGGA 4CHQA 3ASMA 2BE2A 4ZHRA 2XHBA 4KFBA 1DTQA 1GOAA 1I3AA 2YKNA 2YNFA 3QINA 1RT7A 4B3OA 4FLXA 3V9UA 2HVHA 3AA5X 4R5PA 4YNQA 2AJQA 3SPZA 1WSIA 3HVTA 1LWEA 2BANA 5FDLA 4HCBA 1RBTA 3L8BA 3K5OA 2P51A 2HHQA 4FLVA 1TK5A 2VG7A 4CJPA 3VQ4A 3OJUA 1KVAA 1N5YA 1C0TA 1RBRA 1RDBA 2D5RA 3ZSVA 3JSMA 4DG1A 2Z1GA 4C8NA 3KKRA 3EZ5A 3THVA 4DF8A 1L3SA 1J5OA 1W9HA 3OYMA 3SQ2A 1ITGA 1KRPA 1W0HA 2HHSA 4DTXA 4RW6A 4I9QA 2HVIA 1EETA 3SI6A 5C25A 1SL1A 5J2MA 3OYIA 4HCCA 3LWMA 2OPRA 3L3VA 1NK7A 4CGFA 2IC3A 4H4OA 2XY7A 1ASWA 4GVMA 1HMVA 3O3HA 3AVKA 4O5BA 1BIUA 3KKSA 1JXBA 1EX4A 2G8FA 3DYAA 3NF9A 3UIQA 5HLFA 4FLZA 4E1MA 3V9ZA 3SQ1A 4FLUA 4F8RA 4PY5A 5DK5A 4E3SA 1RBSA 3VQ6A 1Q8IA 1WAJA 4OKJA 1DTTA 4CJSA 4ELUA 3QEWA 1ZBHA 3TWHA 4N5SA 4DQSA 2BDPA 2G8KA 4DQQA 3AO5A 2X6SA 4DS5A 1D9DA 3M8PA 4ICLA 4XIUA 3HT3A 1VSIA 3AVNA 3V81A 3MXIA 4FM1A 3QESA 4FK0A 3AO3A 5CYQA 1J9AA 4GW6A 2OA8A 4CHZA 4K8XA 4PWDA 4GMJB 1XHZA 3P83D 4B9MA 3DM2A 2DTUA 5I3UA 3ZCMA 1JLEA 3VQCA 3OS1A 3VQPA 4DWIA 3K5LA 3S3MA 3NH2A 2XY8A 1TAUA 4AHCA 4CJUA 3SYZA 3VQ5A 4CHYA 2A1SA 1S6PA 1UA0A 4CJVA 4CEQA 1FKPA 1J53A 4FJ8A 3HJFA 3CG7A 4FW1A 1ZBFA 2G8WA 2PZSA 1RNHA 1NKCA 4KTWA 4FYDA 5EU7A 1EKEA 4Y1CA 3M8SA 4CF2A 1U48A 4B08A 1WSEA 3SNNA 3RRHA 3S3NA 2Z1JA 3KIOA 4ID5A 5FRMA 4KB1A 3RTVA 3WNFA 4DSEA 4OKKA 1EP4A 3KLEA 4KHUA 4IBNA 3IAYA 3QERA 3C6TA 3QEXA 5J2PA 1FK9A 1S6QA 4FLWA 4DFPA 4CIGA 3D45A 4CEZA 3RMDA 2KZZA 3QNNA 1JLCA 4FJXA 2X6NA 3DRRA 4AILC 3D0PA 4J2BA 1IKXA 3ZT1A 4OPJA 1LAVA 4ID1A 4CF1A 3LWLA 3TAFA 1YTUA 3U3GA 1QSYA 3C94A 1NKEA 1FKOA 4DTMA 4YFUA 5JS2A 1REVA 3O4NA 2RF2A 1NJYA 1HQEA 2B6AA 4W5QA 3DMJA 4DU1A 2XY6A 3PY8A 4DQIA 3B6PA 3HPOA 2IAJA 4W5RA 3LAKA 1JL1A 4FJMA 4KHYA 3ZT0A 1U47A 4DFMA 4NCBA 2HNZA 3E01A 3NFAA 1G15A 1TVRA 2Z1HA 3OYEA 4OPKA 3HVRA 2G8VA 1X9WA 2HB5A 4CIFA 2O4IA 3NE6A 4DTSA 3SQ4A 1SKSA 4Q0BA 4CK2A 3RR7A 1QE1A 4CJFA 4KHWA 1HRHA 1HPZA 1LWCA 4Z4GA 1R0AA 4OKEA 1RT5A 2F8TA 3HSTB 4NCGA 4O0JA 2IDOA 4CFAA 3K5NA 3NHGA 1NK5A 4BDYA 3ULDA 4FXDA 2KQ2A 4CFDA 1BGXT 1JLFA 3C95A 4M3WA 1NK9A 2HHVA 3OS0A 3O4QA 4RW7A 3LALA 4CJWA 1EXQA 2EHGA 1BI4B 3VA3A 5FROA 3NF8A 2HMIA 1BI4A 2GUIA 3KD5E 4KI6A 1YVUA 1QSSA 3CM5A 4HUEA 3CM6A 1RT3A 3AA4A 4G1QA 3KK1A 3V9WA 2PY5A 1NK6A 3V6DA 3L3UA 1RDAA 4RG8A 1U04A 4FZZA 3HM9A 1BISA 4EZ6A 3NAEA 4CF0A 3VQQA 3VQ7A 1XI1A 3QEVA 3PO5A 4KHQA 4KAZA 3RMBA 2R7YA 3OYFA 4CJQA 3RR8A 4RW8A 2HNDA 3DOLA 2Y1JA 1RBVA 3OYDA 4CJLA 3OS2A 1CLQA 3DLGA 2YV0X 3AA2A 1KVCA 3L2QA 3HO1A 1GOBA 3K57A 4L8RB 1JXEA 4QOZB 1LAWA 4FM2A 2OZSA 5CY4A 1ZYQA 4DTNA 3LZIA 1UA1A 1NOYA 1C1CA 5C24A 5HRPA 2FBVA 3L2WA 3BGRA 3NGZA 2JLEA 5KGWA 1RBUA 5HROA 4E7JA 2PYJA 4BWMA 4KTQA 4DTUA 1X1PA 4OLAA 4CECA 4DF4A 2D0CA 3P1GA 3ZT2A 3NH0A 1S1WA 4CFBA 4DSKA 2DFEA 2X78A 1D5AA 1HNIA 4RW9A 3ZSYA 1VRTA 1K6YA 3DLBA 3TAQA 4M45A 2QKKA 2OPPA 3AVCA 2XO7A 4CEFA 1TAQA 2WONA 4LH4A 4CGJA 3U3YA 2Y1IA 1L3UA 1Q9XA 1WSGA 4AH9A 1TKXA 1C1BA 3VQ9A 4FJ9A 2VG6A 1WSHA 4ZTFA 4FK2A 3HK2A 3SUQA 1U45A 3K58A 3KLFA 3PO4A 4I2QA 2G8HA 2DFFA 1SL2A 4BDZA 4DSFA 4JRPA 2ZQBA 1XWLA 4DSLA 3DLRA 1HYVA 4FK4A 1A5XA 4Z0UA 1CXQA 4TSXA 2YHAA 1ASVA 4CJKA 2HHXA 2X74A 5KRSA 1VSMA 2GBZA 2D0BA 4IKFA 3RMAA 3S3OA 4KI4A 1BIZA 4ZTJA 2HNYA 4OLBA 3RWUA 1WLJA 3OJSA 3ZT3A 1JLAA 2RPIA 1QSLA 1RTHA 1CXUA 3DLEA 4LSLA 4IG0A 2FBYA 3TAEA 1U49A 4DMNA 3DLKA 4E0DA 5HBMA 2YNHA 4K8ZA 4HHTA 5JS1A 2XY5A 4OGEA 2ATQA 3C6UA 2KFZA 1F21A 1S1VA 1JL2A 2OPQA 3B6OA 3IRXA 1TKDA 3V9XA 4N56A 1VSEA 3MXJA 2E6MA 4O55A 3NCIA 4CESA 4O4GA 2Z1IA 4LH5A 4CGIA 2G8UA 3CFPA 4FJIA 3TARA 1S1TA 4DS4A 2KTQA 1S1XA 4DQRA 4DTRA 3NH1A 1C6VA 3SPYA 4B9LA 4CEDA 1RT6A 2YKMA 3V1RA 4KHNA 4QCLA 3M8RA 3TAMA 4O44A 4CFCA 1X9SA 4M42A 3L2VA 1U4BA 4KHSA 1ZBUA 3VQBA 3VQDA 3PUFA 1C0MA 3DI6A 4CJ3A 4F3TA 3NDKA 3OYHA 4N76A 3U6FA 3ALYA 5HRNA 4CERA 1WAFA 3KD1E 5D3GA 3LDSA 3IS9A 2QK9A 2FC0A 1TGOA 1Q9YA 2QXFA 1YTAA 1KSPA 1VK0A 4PQUA 4CCHA 4AHVA 1IKYA 2VWJA 4LSNA 4FJ7A 4CK3A 3A2FA 1NKBA 3DRPA 3HP9A 3OYAA 3VQEA 3LP2A 5KGXA 4CIEA 2QKBA 3MEDA 2WOMA 3DOKA 3TAGA 1LV5A 1C1AA 1KFSA 3ZSWA 4M3YA 4AHUA 1VSDA 3HL8A 2DFHA 3ZSZA 1B9FA 1TKZA 4M3ZA 1SV5A 1IO2A 3SQ0A 2YNGA 4FJKA 4HUFA 1BCOA 1X9MA 1QTMA 3MAQA 4BACA 1NJZA 2P1JA 4C8MA 4CEOA 5SZTA 4Z4IA 1SUQA 3AVBA 3O3GA 4C8KA 4F2RA 5CYMA 1Z25A 1MU2A 3CFOA 3NF7A 4H4MA 4KKOA 2Q3SA 4KV8A 4B8CA 1J54A 4B9VA 4JS5A 4C8OA 4KREA 3AVHA 1WSJA 1T05A 1JLQA 3WNEA 4Z4HA 4CJTA 3OYJA 3AV9A 5DMRA 3F73A 3TI0A 3QIOA 2VWKA 4CHNA 2IGIA 4KRFA 2B5JA 3KLIA 4ELVA 3V4IA 3K2PA 3TAPA 4FVMA 1VSHA 4B9TA 2W42A 1CZ9A 1LWFA 4AHRA 3ZT4A 5CZ1A 5C42A 1SKWA 3LAMA 4MQ3A 1GOCA 4DLGA 4I7FA 2P5OA 4E7IA 1HYZA 4HTUA 3LPUA 4BE0A 3QLHA 5T7BA 3PX4A 3KLGA 1IKWA 3NBPA 3AO2A 4DU4A 3AA3A 3HXMA 3DLHA 1HQUA 1NOZA 1RILA 1ZBLA 3SCXA 4OVLA 1BHLA 1KFDA 4DFJA 1A5VA 4J2EA 4LD0A 1T03A 3K5MA 4WE1A 2NUBA 4DSJA 4FZYA 1VSJA 4CJRA 1B9DA 2XRIA 2OYQA 1JLGA 3OY9A 4E7KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LAN A;  4FJN A;  5KTQ A;  4DTO A;  1XHX A;  3AVG A;  4CEE A;  4CJ5 A;  4M3T A;  3WNH A;  3T1A A;  3NF6 A;  3L2U A;  4FJG A;  3MEG A;  2E4L A;  3NGI A;  3CQ8 A;  1S1U A;  4DLE A;  2RKI A;  3SUN A;  3TR8 A;  4B8A B;  4JLH A;  4RW4 A;  4CF8 A;  3LZJ A;  3I0R A;  1BL3 A;  3I8D A;  3VA0 A;  1RT1 A;  2I5J A;  1HNV A;  4I9L A;  3G0Z A;  2F96 A;  4JRQ A;  4KTZ A;  2F8S A;  3S9H A;  4NYN A;  5J2N A;  1RTD A;  2HHW A;  4F2S A;  3KLH A;  3RMC A;  4DTJ A;  3QO9 A;  4Q5V A;  5J2Q A;  4Y1D A;  3ZSX A;  1ZBI A;  4DU3 A;  2IS3 A;  4W5N A;  4EP5 A;  1TK0 A;  4N41 A;  1JKH A;  1BQN A;  5J1E A;  3SV4 A;  4KB0 A;  1TKT A;  3WNG A;  5E41 A;  1A5W A;  1RTJ A;  2HHU A;  5HP1 A;  3T3F A;  1TL3 A;  1L3T A;  1KTQ A;  1D8Y A;  3T19 A;  2FBT A;  4CEB A;  2EX3 A;  4CGD A;  3HPG A;  4C8L A;  5HRS A;  5KRT A;  4HUG A;  3BDP A;  3OVN A;  4FW2 A;  3MEC A;  3OYB A;  3MEE A;  4OGC A;  4E7L A;  1FXX A;  3KK2 A;  3ZSQ A;  1NK8 A;  2JGU A;  2YNI A;  3LP0 A;  4W5T A;  3QET A;  1LW0 A;  1BQM A;  4FLY A;  3SZ2 A;  1ASU A;  3FFI A;  3H08 A;  5CZ2 A;  1KCF A;  3AVI A;  3NGY A;  3OYC A;  4M3U A;  5SWM A;  4DTP A;  3LPT A;  4BDP A;  1HYS A;  4M3R A;  4E19 A;  4PUO A;  3LP1 A;  5HRR A;  3SV3 A;  4I2P A;  2FBX A;  4Z4F A;  3DRS A;  4E7H A;  1QHT A;  1IH7 A;  3AVL A;  4KPY A;  3ZSO A;  4CEA A;  1RT4 A;  1RDC A;  1UAX A;  4B9U A;  1RCH A;  4CGH A;  1QQC A;  3CFR A;  1T8E A;  1Y97 A;  3F9K A;  1RDD A;  3V1Q A;  3SUP A;  2OZM A;  5FRN A;  4CHP A;  1L3V A;  3ZSR A;  1CZB A;  3SJJ A;  3SUO A;  3K59 A;  1B92 A;  4DFK A;  4Z4E A;  4FJ5 A;  1NJW A;  4ELT A;  3KJV A;  2DY4 A;  4J2D A;  4NYF A;  4EP4 A;  2ZE2 A;  1JLB A;  3QIP A;  1BCM A;  1TV6 A;  1VRU A;  3MXM A;  4CHO A;  3AVM A;  3PX0 A;  1NK0 A;  1YT3 A;  1Z26 A;  2ETJ A;  1RTI A;  3KK3 A;  3L2R A;  3EYZ A;  1HJR A;  3KTQ A;  1L5U A;  4JS4 A;  1IKV A;  1KLN A;  2ITG A;  3TAB A;  1TL1 A;  1S9E A;  3AO1 A;  3M8Q A;  1WSF A;  2E6L A;  5K14 A;  4MFB A;  1KVB A;  3VN5 A;  3JYT A;  1KLM A;  1WN7 A;  4B9S A;  4J2A A;  4EZ9 A;  3AVJ A;  3AO4 A;  1QS4 A;  5I42 A;  1DLO A;  2A1R A;  4BWJ A;  3AVA A;  1S9G A;  4O0I A;  1VSK A;  4FCY A;  2HW3 A;  1UWB A;  4BE2 A;  3VQ8 A;  4LY7 A;  3V9S A;  1WNS A;  3P5J A;  3IG1 A;  3QNO A;  4M3X A;  2KW4 A;  2IOC A;  4AHS A;  1XC9 A;  3HPH A;  3VQA A;  4Z4C A;  4OJR A;  1D9F A;  3HP6 A;  4QAG A;  3CYM A;  4H8K A;  3OYL A;  3PX6 A;  1NK4 A;  4IFV A;  4E1N A;  1T7P A;  4NCA A;  2BGG A;  1VSL A;  2KFN A;  1O1W A;  4PA1 A;  2KZM A;  1UOC A;  3OYK A;  4CE9 A;  4FM0 A;  4FJL A;  4FLT A;  2HHT A;  4F3O A;  4DSI A;  2D0A A;  1I39 A;  3O3F A;  3PV8 A;  4FJJ A;  3HYF A;  2VG5 A;  3I0S A;  4HVJ A;  3AVF A;  3QEP A;  1C0U A;  1S5J A;  2OPS A;  4BE1 A;  3TAN A;  1NJX A;  4W5O A;  1N6Q A;  4IDK A;  2PYL A;  4KO0 A;  2YHB A;  3LP3 A;  4UQG A;  4DQP A;  2RN2 A;  4CJ4 A;  1SKR A;  2LSN A;  3OYN A;  4B9N A;  3OYG A;  4N47 A;  4IFY A;  5KI6 A;  4CK1 A;  2P5G A;  3G10 A;  3EY1 A;  3V1O A;  4FJH A;  4CJE A;  4FZX C;  1SL0 A;  1LW2 A;  3RRG A;  2B4J A;  2O4G A;  3ISN C;  4AHT A;  4M41 A;  1TK8 A;  1IG9 A;  2GV9 A;  2G8I A;  2ZD1 A;  4E89 A;  1RT2 A;  4F4K A;  4IG3 A;  4CF9 A;  1VSF A;  3ITH A;  3QEI A;  4CGG A;  4CHQ A;  3ASM A;  2BE2 A;  4ZHR A;  2XHB A;  4KFB A;  1DTQ A;  1GOA A;  1I3A A;  2YKN A;  2YNF A;  3QIN A;  1RT7 A;  4B3O A;  4FLX A;  3V9U A;  2HVH A;  3AA5 X;  4R5P A;  4YNQ A;  2AJQ A;  3SPZ A;  1WSI A;  3HVT A;  1LWE A;  2BAN A;  5FDL A;  4HCB A;  1RBT A;  3L8B A;  3K5O A;  2P51 A;  2HHQ A;  4FLV A;  1TK5 A;  2VG7 A;  4CJP A;  3VQ4 A;  3OJU A;  1KVA A;  1N5Y A;  1C0T A;  1RBR A;  1RDB A;  2D5R A;  3ZSV A;  3JSM A;  4DG1 A;  2Z1G A;  4C8N A;  3KKR A;  3EZ5 A;  3THV A;  4DF8 A;  1L3S A;  1J5O A;  1W9H A;  3OYM A;  3SQ2 A;  1ITG A;  1KRP A;  1W0H A;  2HHS A;  4DTX A;  4RW6 A;  4I9Q A;  2HVI A;  1EET A;  3SI6 A;  5C25 A;  1SL1 A;  5J2M A;  3OYI A;  4HCC A;  3LWM A;  2OPR A;  3L3V A;  1NK7 A;  4CGF A;  2IC3 A;  4H4O A;  2XY7 A;  1ASW A;  4GVM A;  1HMV A;  3O3H A;  3AVK A;  4O5B A;  1BIU A;  3KKS A;  1JXB A;  1EX4 A;  2G8F A;  3DYA A;  3NF9 A;  3UIQ A;  5HLF A;  4FLZ A;  4E1M A;  3V9Z A;  3SQ1 A;  4FLU A;  4F8R A;  4PY5 A;  5DK5 A;  4E3S A;  1RBS A;  3VQ6 A;  1Q8I A;  1WAJ A;  4OKJ A;  1DTT A;  4CJS A;  4ELU A;  3QEW A;  1ZBH A;  3TWH A;  4N5S A;  4DQS A;  2BDP A;  2G8K A;  4DQQ A;  3AO5 A;  2X6S A;  4DS5 A;  1D9D A;  3M8P A;  4ICL A;  4XIU A;  3HT3 A;  1VSI A;  3AVN A;  3V81 A;  3MXI A;  4FM1 A;  3QES A;  4FK0 A;  3AO3 A;  5CYQ A;  1J9A A;  4GW6 A;  2OA8 A;  4CHZ A;  4K8X A;  4PWD A;  4GMJ B;  1XHZ A;  3P83 D;  4B9M A;  3DM2 A;  2DTU A;  5I3U A;  3ZCM A;  1JLE A;  3VQC A;  3OS1 A;  3VQP A;  4DWI A;  3K5L A;  3S3M A;  3NH2 A;  2XY8 A;  1TAU A;  4AHC A;  4CJU A;  3SYZ A;  3VQ5 A;  4CHY A;  2A1S A;  1S6P A;  1UA0 A;  4CJV A;  4CEQ A;  1FKP A;  1J53 A;  4FJ8 A;  3HJF A;  3CG7 A;  4FW1 A;  1ZBF A;  2G8W A;  2PZS A;  1RNH A;  1NKC A;  4KTW A;  4FYD A;  5EU7 A;  1EKE A;  4Y1C A;  3M8S A;  4CF2 A;  1U48 A;  4B08 A;  1WSE A;  3SNN A;  3RRH A;  3S3N A;  2Z1J A;  3KIO A;  4ID5 A;  5FRM A;  4KB1 A;  3RTV A;  3WNF A;  4DSE A;  4OKK A;  1EP4 A;  3KLE A;  4KHU A;  4IBN A;  3IAY A;  3QER A;  3C6T A;  3QEX A;  5J2P A;  1FK9 A;  1S6Q A;  4FLW A;  4DFP A;  4CIG A;  3D45 A;  4CEZ A;  3RMD A;  2KZZ A;  3QNN A;  1JLC A;  4FJX A;  2X6N A;  3DRR A;  4AIL C;  3D0P A;  4J2B A;  1IKX A;  3ZT1 A;  4OPJ A;  1LAV A;  4ID1 A;  4CF1 A;  3LWL A;  3TAF A;  1YTU A;  3U3G A;  1QSY A;  3C94 A;  1NKE A;  1FKO A;  4DTM A;  4YFU A;  5JS2 A;  1REV A;  3O4N A;  2RF2 A;  1NJY A;  1HQE A;  2B6A A;  4W5Q A;  3DMJ A;  4DU1 A;  2XY6 A;  3PY8 A;  4DQI A;  3B6P A;  3HPO A;  2IAJ A;  4W5R A;  3LAK A;  1JL1 A;  4FJM A;  4KHY A;  3ZT0 A;  1U47 A;  4DFM A;  4NCB A;  2HNZ A;  3E01 A;  3NFA A;  1G15 A;  1TVR A;  2Z1H A;  3OYE A;  4OPK A;  3HVR A;  2G8V A;  1X9W A;  2HB5 A;  4CIF A;  2O4I A;  3NE6 A;  4DTS A;  3SQ4 A;  1SKS A;  4Q0B A;  4CK2 A;  3RR7 A;  1QE1 A;  4CJF A;  4KHW A;  1HRH A;  1HPZ A;  1LWC A;  4Z4G A;  1R0A A;  4OKE A;  1RT5 A;  2F8T A;  3HST B;  4NCG A;  4O0J A;  2IDO A;  4CFA A;  3K5N A;  3NHG A;  1NK5 A;  4BDY A;  3ULD A;  4FXD A;  2KQ2 A;  4CFD A;  1BGX T;  1JLF A;  3C95 A;  4M3W A;  1NK9 A;  2HHV A;  3OS0 A;  3O4Q A;  4RW7 A;  3LAL A;  4CJW A;  1EXQ A;  2EHG A;  1BI4 B;  3VA3 A;  5FRO A;  3NF8 A;  2HMI A;  1BI4 A;  2GUI A;  3KD5 E;  4KI6 A;  1YVU A;  1QSS A;  3CM5 A;  4HUE A;  3CM6 A;  1RT3 A;  3AA4 A;  4G1Q A;  3KK1 A;  3V9W A;  2PY5 A;  1NK6 A;  3V6D A;  3L3U A;  1RDA A;  4RG8 A;  1U04 A;  4FZZ A;  3HM9 A;  1BIS A;  4EZ6 A;  3NAE A;  4CF0 A;  3VQQ A;  3VQ7 A;  1XI1 A;  3QEV A;  3PO5 A;  4KHQ A;  4KAZ A;  3RMB A;  2R7Y A;  3OYF A;  4CJQ A;  3RR8 A;  4RW8 A;  2HND A;  3DOL A;  2Y1J A;  1RBV A;  3OYD A;  4CJL A;  3OS2 A;  1CLQ A;  3DLG A;  2YV0 X;  3AA2 A;  1KVC A;  3L2Q A;  3HO1 A;  1GOB A;  3K57 A;  4L8R B;  1JXE A;  4QOZ B;  1LAW A;  4FM2 A;  2OZS A;  5CY4 A;  1ZYQ A;  4DTN A;  3LZI A;  1UA1 A;  1NOY A;  1C1C A;  5C24 A;  5HRP A;  2FBV A;  3L2W A;  3BGR A;  3NGZ A;  2JLE A;  5KGW A;  1RBU A;  5HRO A;  4E7J A;  2PYJ A;  4BWM A;  4KTQ A;  4DTU A;  1X1P A;  4OLA A;  4CEC A;  4DF4 A;  2D0C A;  3P1G A;  3ZT2 A;  3NH0 A;  1S1W A;  4CFB A;  4DSK A;  2DFE A;  2X78 A;  1D5A A;  1HNI A;  4RW9 A;  3ZSY A;  1VRT A;  1K6Y A;  3DLB A;  3TAQ A;  4M45 A;  2QKK A;  2OPP A;  3AVC A;  2XO7 A;  4CEF A;  1TAQ A;  2WON A;  4LH4 A;  4CGJ A;  3U3Y A;  2Y1I A;  1L3U A;  1Q9X A;  1WSG A;  4AH9 A;  1TKX A;  1C1B A;  3VQ9 A;  4FJ9 A;  2VG6 A;  1WSH A;  4ZTF A;  4FK2 A;  3HK2 A;  3SUQ A;  1U45 A;  3K58 A;  3KLF A;  3PO4 A;  4I2Q A;  2G8H A;  2DFF A;  1SL2 A;  4BDZ A;  4DSF A;  4JRP A;  2ZQB A;  1XWL A;  4DSL A;  3DLR A;  1HYV A;  4FK4 A;  1A5X A;  4Z0U A;  1CXQ A;  4TSX A;  2YHA A;  1ASV A;  4CJK A;  2HHX A;  2X74 A;  5KRS A;  1VSM A;  2GBZ A;  2D0B A;  4IKF A;  3RMA A;  3S3O A;  4KI4 A;  1BIZ A;  4ZTJ A;  2HNY A;  4OLB A;  3RWU A;  1WLJ A;  3OJS A;  3ZT3 A;  1JLA A;  2RPI A;  1QSL A;  1RTH A;  1CXU A;  3DLE A;  4LSL A;  4IG0 A;  2FBY A;  3TAE A;  1U49 A;  4DMN A;  3DLK A;  4E0D A;  5HBM A;  2YNH A;  4K8Z A;  4HHT A;  5JS1 A;  2XY5 A;  4OGE A;  2ATQ A;  3C6U A;  2KFZ A;  1F21 A;  1S1V A;  1JL2 A;  2OPQ A;  3B6O A;  3IRX A;  1TKD A;  3V9X A;  4N56 A;  1VSE A;  3MXJ A;  2E6M A;  4O55 A;  3NCI A;  4CES A;  4O4G A;  2Z1I A;  4LH5 A;  4CGI A;  2G8U A;  3CFP A;  4FJI A;  3TAR A;  1S1T A;  4DS4 A;  2KTQ A;  1S1X A;  4DQR A;  4DTR A;  3NH1 A;  1C6V A;  3SPY A;  4B9L A;  4CED A;  1RT6 A;  2YKM A;  3V1R A;  4KHN A;  4QCL A;  3M8R A;  3TAM A;  4O44 A;  4CFC A;  1X9S A;  4M42 A;  3L2V A;  1U4B A;  4KHS A;  1ZBU A;  3VQB A;  3VQD A;  3PUF A;  1C0M A;  3DI6 A;  4CJ3 A;  4F3T A;  3NDK A;  3OYH A;  4N76 A;  3U6F A;  3ALY A;  5HRN A;  4CER A;  1WAF A;  3KD1 E;  5D3G A;  3LDS A;  3IS9 A;  2QK9 A;  2FC0 A;  1TGO A;  1Q9Y A;  2QXF A;  1YTA A;  1KSP A;  1VK0 A;  4PQU A;  4CCH A;  4AHV A;  1IKY A;  2VWJ A;  4LSN A;  4FJ7 A;  4CK3 A;  3A2F A;  1NKB A;  3DRP A;  3HP9 A;  3OYA A;  3VQE A;  3LP2 A;  5KGX A;  4CIE A;  2QKB A;  3MED A;  2WOM A;  3DOK A;  3TAG A;  1LV5 A;  1C1A A;  1KFS A;  3ZSW A;  4M3Y A;  4AHU A;  1VSD A;  3HL8 A;  2DFH A;  3ZSZ A;  1B9F A;  1TKZ A;  4M3Z A;  1SV5 A;  1IO2 A;  3SQ0 A;  2YNG A;  4FJK A;  4HUF A;  1BCO A;  1X9M A;  1QTM A;  3MAQ A;  4BAC A;  1NJZ A;  2P1J A;  4C8M A;  4CEO A;  5SZT A;  4Z4I A;  1SUQ A;  3AVB A;  3O3G A;  4C8K A;  4F2R A;  5CYM A;  1Z25 A;  1MU2 A;  3CFO A;  3NF7 A;  4H4M A;  4KKO A;  2Q3S A;  4KV8 A;  4B8C A;  1J54 A;  4B9V A;  4JS5 A;  4C8O A;  4KRE A;  3AVH A;  1WSJ A;  1T05 A;  1JLQ A;  3WNE A;  4Z4H A;  4CJT A;  3OYJ A;  3AV9 A;  5DMR A;  3F73 A;  3TI0 A;  3QIO A;  2VWK A;  4CHN A;  2IGI A;  4KRF A;  2B5J A;  3KLI A;  4ELV A;  3V4I A;  3K2P A;  3TAP A;  4FVM A;  1VSH A;  4B9T A;  2W42 A;  1CZ9 A;  1LWF A;  4AHR A;  3ZT4 A;  5CZ1 A;  5C42 A;  1SKW A;  3LAM A;  4MQ3 A;  1GOC A;  4DLG A;  4I7F A;  2P5O A;  4E7I A;  1HYZ A;  4HTU A;  3LPU A;  4BE0 A;  3QLH A;  5T7B A;  3PX4 A;  3KLG A;  1IKW A;  3NBP A;  3AO2 A;  4DU4 A;  3AA3 A;  3HXM A;  3DLH A;  1HQU A;  1NOZ A;  1RIL A;  1ZBL A;  3SCX A;  4OVL A;  1BHL A;  1KFD A;  4DFJ A;  1A5V A;  4J2E A;  4LD0 A;  1T03 A;  3K5M A;  4WE1 A;  2NUB A;  4DSJ A;  4FZY A;  1VSJ A;  4CJR A;  1B9D A;  2XRI A;  2OYQ A;  1JLG A;  3OY9 A;  4E7K A; 
#chains in the Genus database with same CATH topology
 4BG8 A;  5KTQ A;  3AVG A;  4CJ5 A;  4LF7 K;  4B3R K;  1DT9 A;  3THX A;  4DLE A;  3AGK A;  3TR8 A;  3RSE A;  4RW4 A;  1BL3 A;  1HNX K;  2QTD A;  4I9L A;  1HNV A;  4CZF A;  4JRQ A;  1VQ4 N;  1HNZ K;  1DGK N;  4NYN A;  4EAH D;  5J2N A;  2HHW A;  2HF4 A;  4CZH A;  1X9J A;  4EP5 A;  4H5T A;  4EFH A;  5E41 A;  1A5W A;  2W41 A;  5HP1 A;  1TL3 A;  2KHO A;  3LDN A;  3T19 A;  4CEB A;  2EX3 A;  4CGD A;  1DKG D;  4C8L A;  1EQY A;  3A5O C;  2P9K B;  4OGC A;  2YNI A;  3LP0 A;  3QET A;  3VGK A;  3FFI A;  4DV6 K;  5AQX A;  4WFB L;  2O8F A;  3LP1 A;  1NGD A;  4CW7 B;  2GTD A;  1IH7 A;  4BVP A;  3MMV A;  3OBW A;  4LFA K;  3E9P A;  4JI4 K;  3U8X A;  1C0F A;  3F9K A;  3RVC A;  3V1Q A;  5FRN A;  4CHP A;  1L3V A;  3SJJ A;  3WEE B;  1GLJ O;  4DFK A;  4FJ5 A;  1IBM K;  4ELT A;  2FF3 B;  2DY4 A;  2ZE2 A;  2A5X A;  3CI5 A;  1WUA A;  1BCM A;  3PX0 A;  1KLN A;  1YT3 A;  3KK3 A;  3EYZ A;  3KTQ A;  3DLL L;  1L5U A;  1IKV A;  3ULE A;  2OTJ N;  2QWQ A;  3AAP A;  5K14 A;  4FWR A;  1KLM A;  2P9U B;  4CZK A;  3AO4 A;  1QS4 A;  4DV0 K;  4GKJ K;  3AVA A;  1S9G A;  4O0I A;  4FCY A;  4BE2 A;  4K41 A;  3VQ8 A;  2O8C B;  1WNS A;  3QNO A;  2KW4 A;  2HBL A;  4OJR A;  1QZ5 A;  4QAG A;  3OYL A;  1VQ6 N;  2WBN A;  4H03 B;  1UOC A;  3FE1 A;  3HM8 A;  2QM1 A;  3HYF A;  4JD2 B;  3I0S A;  3AVF A;  5C2F A;  2F9T A;  2V52 B;  3QEP A;  2NRZ A;  2PYL A;  3TAN A;  4W5O A;  4IDK A;  4KO0 A;  2Q0R A;  2RN2 A;  1SKR A;  2LSN A;  3OYN A;  5KI6 A;  4CK1 A;  1OVY A;  3T1H K;  1BOT O;  3EY1 A;  4FJH A;  1SL0 A;  4L3Q A;  2O4G A;  4JI3 K;  3ISN C;  1IG9 A;  2GV9 A;  1VSF A;  3ITH A;  3QEI A;  3ASM A;  1GLA G;  3KHY A;  2YNF A;  4CVN E;  2UYT A;  4FLX A;  2NZT A;  3FGU A;  4YNQ A;  3PIP L;  1LWE A;  3L8B A;  3C7N A;  2QEX N;  1KVA A;  1RDB A;  4C23 A;  2Z1G A;  3VEV A;  3KKR A;  1K8A O;  1L3S A;  1J5O A;  3ZET B;  2HVI A;  4RW6 A;  4I9Q A;  4QS9 A;  4A61 A;  4HCC A;  3H3N O;  3L3V A;  1X3M A;  4CGF A;  3CCS N;  4GVM A;  1I94 K;  4FWS A;  5HLF A;  2ASM A;  3V9Z A;  4YY3 K;  4FLU A;  5DK5 A;  1O13 A;  1RBS A;  1QQN A;  3TWH A;  4DQS A;  3G6E N;  2BDP A;  3AO5 A;  2NRR A;  3A8Y A;  1LOT B;  2E1Y A;  3J7A P;  1D9D A;  3M8P A;  4XIU A;  3HT3 A;  4CJ7 A;  3CC4 N;  4FM1 A;  3QES A;  5FPM A;  4OX9 K;  4K8X A;  2OA8 A;  3DM2 A;  3E9O A;  1U6Z A;  3D2E A;  4R79 A;  4CJU A;  3SYZ A;  3P4I A;  4BRD A;  1FKP A;  5AZJ B;  3CG7 A;  3ENB A;  3U9Z A;  3E1Y A;  1U2V A;  1U48 A;  4B08 A;  3SNN A;  2NLX A;  5FRM A;  2Z1J A;  4KB1 A;  3EL2 A;  2E2Q A;  4IBN A;  3ZX0 A;  3QER A;  1BWF O;  3QEX A;  5J2P A;  5C10 A;  3D45 A;  5HL7 L;  3RMD A;  4LFB K;  5M1Q A;  1KXP A;  4CBU A;  2X6N A;  1XNR K;  5JVG L;  2ZM6 K;  4DV3 K;  3U3G A;  2WFB A;  1QSY A;  1NKE A;  5ADX H;  3O4N A;  2B6A A;  4W5Q A;  3B6P A;  4KHY A;  1JL1 A;  2F8T A;  4CIF A;  3L0Q A;  2ZJR L;  5LL6 Z;  3NE6 A;  3SQ4 A;  3F9M A;  4CK2 A;  1QE1 A;  1HRH A;  1LWC A;  4OKE A;  5DM7 L;  4A59 A;  4NCG A;  1Q86 O;  3KWI A;  1SZ2 A;  3EN9 A;  4M3W A;  2QWO A;  3ATV A;  4CJW A;  1EXQ A;  2EHG A;  4ILH A;  1BI4 B;  2GUI A;  4KI6 A;  1YVU A;  3LM2 A;  5AQT A;  5C12 A;  3MCA B;  3PIO L;  3KK1 A;  3CF5 L;  1KAX A;  3V6D A;  5KPT A;  4RG8 A;  3HM9 A;  3MWP A;  3CQY A;  2IVP A;  4EZ6 A;  5FPE A;  4NXM K;  2CH6 A;  4RW8 A;  3R9P A;  1NGC A;  4IZ9 A;  4B1V A;  3AA2 A;  1KVC A;  1GOB A;  3PLA A;  3E66 A;  4IO9 L;  1RDU A;  3LZI A;  5GAH P;  2FBV A;  3H6E A;  1YIT N;  3E9L A;  1M1K O;  4KTQ A;  4DTU A;  2HBM A;  3H1Q A;  3P1G A;  2DFE A;  1D5A A;  4RW9 A;  3TSQ A;  1J5E K;  5AQP A;  2OPP A;  4MDB A;  3AVC A;  1T44 A;  4CEF A;  4CGJ A;  4LH4 A;  3U3Y A;  3WXJ A;  2Y1I A;  4ISF A;  1C1B A;  3VQ9 A;  3HK2 A;  2VG6 A;  1WSH A;  1NMD A;  4NLB A;  4X64 K;  3SUQ A;  1U45 A;  3PO4 A;  2DFF A;  4JHD B;  4DSF A;  4FWN A;  4B1Y B;  2Q2R A;  4LF8 K;  3DLR A;  4FK4 A;  1NBW A;  4QS7 A;  4TSX A;  2YHA A;  1ASV A;  4CJK A;  5KRS A;  2VCP A;  2GBZ A;  4KI4 A;  4B1Z A;  4JK8 A;  2VGM A;  3NMU A;  4DQ8 A;  3R1X A;  4MLE A;  5I9E B;  2HNY A;  3FZM A;  3OJS A;  3OTO K;  1JLA A;  4GV6 A;  2P9K A;  3DLE A;  4LSL A;  2FBY A;  4XH1 A;  3CJ1 A;  3CIP A;  3ZX2 A;  2YNH A;  3CJA A;  5H1S Q;  4HHT A;  3CJB A;  5F0X A;  2XY5 A;  3CC2 N;  4A5A A;  4OGE A;  2KFZ A;  4JKF A;  1WB9 A;  2O8E B;  1F21 A;  1NJI O;  3IRX A;  4N56 A;  3FFK B;  4O55 A;  4JKH A;  4CES A;  4O4G A;  3P39 A;  3D6R A;  3CFP A;  1S1T A;  1S1X A;  3NH1 A;  2ZF5 O;  3SPY A;  4A57 A;  4WQ5 A;  4UY8 O;  3T7Z A;  4KHN A;  4NLC A;  4QCL A;  4CFC A;  4KHS A;  1ZBU A;  3WEE A;  4PKH A;  3NDK A;  3ALY A;  2A3Z A;  3KD1 E;  2GEM A;  2A42 A;  4IFE A;  1Q9Y A;  2QXF A;  1VK0 A;  3QBW A;  4AHV A;  4CK3 A;  1NKB A;  1K9M O;  2GX9 A;  3DOK A;  3TAG A;  1LV5 A;  5CR4 A;  4AHU A;  2DFH A;  5AQL A;  3ZSZ A;  5KQD A;  2YNG A;  1X9M A;  2P9U A;  3MAQ A;  1WOQ A;  4HTL A;  4F2R A;  5CYM A;  4JI8 K;  3NF7 A;  3QML A;  2O8C A;  2P9N B;  3AVH A;  2WTU A;  2O8B A;  4Z4H A;  3AV9 A;  5DMR A;  3K9J A;  3MX2 A;  3QIO A;  5AQF A;  4WFA L;  4YOR A;  4KRF A;  2J4R A;  1VSH A;  1CZ9 A;  1LWF A;  3ZT4 A;  5CZ1 A;  5C42 A;  1KD1 O;  3WXK A;  5CE3 A;  4DR7 K;  4JD2 A;  1QHA A;  3FZH A;  4IEI A;  5FPD A;  5T7B A;  2RHK A;  3NBP A;  1NGA A;  4FOI A;  4DU4 A;  4JI6 K;  4OVL A;  1BHL A;  1NWK A;  1A5V A;  4I6M B;  4WE1 A;  4DB3 A;  1E4F T;  1VSJ A;  3IFR A;  2HHH K;  1JLG A;  1BUP A;  3OY9 A;  1OVQ A;  1XHX A;  3WNH A;  5AQY A;  3L2U A;  3NF6 A;  4RWT A;  3SUN A;  4NO7 A;  2UUB K;  2RKI A;  4B8A B;  4DCH A;  4CF8 A;  2D1K A;  3I0R A;  2CGJ A;  2I5J A;  1NGI A;  3G0Z A;  4KTZ A;  1RTD A;  3DJC A;  3RMC A;  4DTJ A;  1GLC G;  3BF3 A;  5GIO A;  5J2Q A;  4Y1D A;  4O5F A;  3TTC A;  2NRH A;  4IJN A;  5AQW A;  4DU3 A;  3WXM B;  4A2B A;  1TK0 A;  5J1E A;  1RTJ A;  2HHU A;  3T3F A;  3GBT A;  4BRG A;  4JKB A;  1NGF A;  4RCH A;  3HPG A;  5HRS A;  2OAN A;  3OYB A;  3C65 A;  1FXX A;  3CCQ N;  3ZSQ A;  4W5T A;  3M5R A;  5EXW A;  1LW0 A;  3QFU A;  1BQM A;  5GAG P;  3SZ2 A;  3H08 A;  5CZ2 A;  4BC5 A;  3AVI A;  5SWM A;  4ISG A;  4M3R A;  4I2P A;  2FBX A;  4WQ4 A;  3DRS A;  4LF4 K;  3VES A;  1QHT A;  3AVL A;  4A2A A;  1WBD A;  4CEA A;  1UAX A;  4B9U A;  1Y97 A;  1RDD A;  1XMO K;  2OZM A;  1P8Z A;  4BR5 A;  3SUO A;  3K59 A;  5AZJ A;  1B92 A;  3J80 O;  3ENO A;  1NJW A;  1M90 O;  3CHW A;  3SK3 A;  1JLB A;  2AA4 A;  1NK0 A;  3L2R A;  1Z26 A;  1HJR A;  2UUA K;  3TAB A;  1S9E A;  3M8Q A;  4MFB A;  4EZ9 A;  1VSK A;  4CI6 A;  3O9T A;  4YOU A;  4LY7 A;  3P5J A;  1WBB A;  3IG1 A;  4CZI A;  1XC9 A;  4Z4C A;  4FVU A;  3HP6 A;  3KVG A;  4H8K A;  4IFV A;  1T7P A;  1NM1 A;  3OYK A;  4AM7 A;  4DSI A;  2D0A A;  1I39 A;  3R6M A;  3HRG A;  2O8D B;  3PV8 A;  2VG5 A;  3CCJ N;  4HVJ A;  4CZL A;  1Q7Y O;  3NVM A;  4BE1 A;  1NJX A;  2OPS A;  1N6Q A;  2YHB A;  5AQR A;  3PSF A;  3THW B;  4IFY A;  3G10 A;  4H5N A;  3FZL A;  3KK7 A;  4CJE A;  3DXK A;  4A5B A;  3RRG A;  4M41 A;  4K42 A;  3L4I A;  5IT9 O;  4CF9 A;  2CGK A;  5LJW A;  2JWK A;  2BE2 A;  2Q1N A;  4ZHR A;  1RT7 A;  3V9U A;  2HVH A;  3VET A;  3AA5 X;  5AQH A;  2PFU A;  3W0L A;  4BRL A;  4E1J A;  5FDL A;  2EWS A;  3K5O A;  3VQ4 A;  2DPN A;  3MN6 A;  3OJU A;  2UXD K;  2QW9 A;  3QB0 A;  1C0T A;  2D5R A;  3ZSV A;  4DG1 A;  4C8N A;  3EZ5 A;  4LF5 K;  1W9H A;  3OYM A;  4JYA K;  1KRP A;  1W0H A;  1VQ9 N;  2HHS A;  1EET A;  4B1U B;  3J7Y P;  1SL1 A;  3OYI A;  2QXL A;  4JKE A;  1NK7 A;  2XY7 A;  1ASW A;  1HMV A;  3O3H A;  1BIU A;  1JXB A;  2G8F A;  3UIQ A;  3NF9 A;  1XQS C;  2V51 B;  1WAJ A;  4CJS A;  4ELU A;  1ZBH A;  4JK7 A;  4N5S A;  4JHD A;  2HOE A;  4BRC A;  3FZF A;  3AVN A;  3MXI A;  4FK0 A;  5CYQ A;  1J9A A;  4GMJ B;  4B9M A;  3AGR A;  3ZCM A;  3VQP A;  4YDU C;  3NH2 A;  1TAU A;  4CHY A;  2A40 A;  1EO1 A;  5GIP A;  4FW1 A;  3O5B A;  1RNH A;  3M8S A;  1IV0 A;  3RRH A;  3KIO A;  4ID5 A;  4DSE A;  4KHU A;  3IAY A;  4A62 A;  1S6Q A;  2P9P B;  4FWO A;  4FLW A;  4CEZ A;  5TKW A;  1NNE A;  3LL3 A;  4FJX A;  2E2O A;  3Q7C A;  4NB4 A;  1IKX A;  3LWL A;  4H5R A;  3MN9 A;  3TAF A;  3SMP A;  3VEY A;  1FKO A;  4OPH A;  4OLB A;  1REV A;  3A0I X;  2YJF A;  1NJY A;  3PY8 A;  4ILG B;  2IAJ A;  4M7X A;  3DAW A;  4W5R A;  3CPW M;  1U47 A;  4DFM A;  4NCB A;  4YOX A;  3E01 A;  2HB5 A;  1GLE G;  4DUZ K;  4Q0B A;  1KQS M;  1RT5 A;  3C6A A;  1TYQ A;  3HST B;  4AQY K;  1NU0 A;  1NK5 A;  1YVN A;  3NHG A;  4BDY A;  3ULD A;  2KQ2 A;  2ZGZ A;  1K8K B;  2HHV A;  3OS0 A;  3VA3 A;  5FRO A;  3AY9 A;  1KAY A;  2HBJ A;  4HUE A;  3CM6 A;  3AA4 A;  3H45 C;  2FF6 A;  4FZZ A;  3O9S A;  2IVN A;  4CF0 A;  3VQQ A;  3CME N;  3U9D A;  4H0O A;  3VQ7 A;  3JAM O;  1OH6 A;  2P9S B;  3O9R A;  3RMB A;  3OYF A;  2VQE K;  4CJQ A;  2Y1J A;  4BC2 A;  5EX5 A;  3LDL A;  4CJL A;  3OS2 A;  2YV0 X;  3L2Q A;  4BG9 A;  3Q7B A;  4I6M A;  4LC9 B;  4QOZ B;  1LAW A;  4FM2 A;  1ZYQ A;  4H0P A;  3HOT A;  2QWR A;  5C24 A;  3BGR A;  3NGZ A;  5KGW A;  3VEO A;  3CXC M;  1RBU A;  1HKB A;  4BWM A;  3CJ7 A;  1X1P A;  4OLA A;  3ZT2 A;  2E5L K;  3NH0 A;  1P90 A;  1S1W A;  4DSK A;  2X78 A;  4BGB A;  1GLF O;  1OH7 A;  1Y64 A;  1VRT A;  1V4S A;  5AZI B;  3DLB A;  1Q9X A;  2HST A;  3O8M A;  4IXC A;  3UKR B;  4FJ9 A;  3CJC A;  3KLF A;  3K58 A;  4CZJ A;  1SL2 A;  4BDZ A;  4B1X B;  1VQK N;  1XWL A;  1HYV A;  3OHR A;  1CXQ A;  3O9Q A;  2HHX A;  5AFU H;  1GLB G;  3VEN A;  1BA0 A;  1BIZ A;  3TPQ A;  4DV7 K;  4ZTJ A;  2JWL A;  2A6A A;  1QSL A;  1RTH A;  1CXU A;  4OPA A;  5KPZ A;  1VQ7 N;  4H5V A;  3SLC A;  3U4L A;  5JS1 A;  1ILY A;  3VEZ A;  3TTF A;  4C1N K;  1JJ2 M;  4HWI A;  1S1V A;  1JL2 A;  1QVF M;  2FSJ A;  1IBL K;  2BUP A;  4CGI A;  3FR0 A;  2G8U A;  4FJI A;  3TAR A;  4DQR A;  4DTR A;  3F2K A;  3G4S N;  4B9L A;  1RT6 A;  1W7A A;  2YKM A;  3M8R A;  4M42 A;  1BG3 A;  3VQB A;  3VQD A;  3GE1 A;  1C0M A;  3P31 A;  4CBX A;  4F3T A;  2QWP A;  4CZG A;  4B3S K;  1S72 N;  4CER A;  1WAF A;  4GKK K;  3W3D A;  5D3G A;  2QK9 A;  1TGO A;  1YTA A;  2P9I B;  3M3Z A;  4CCH A;  4JI1 K;  1IKY A;  2E2P A;  4FJ7 A;  3A2F A;  3OA9 A;  3DRP A;  3HP9 A;  4DR5 K;  3VQE A;  3LP2 A;  3MED A;  4M3Y A;  3A5M C;  5BRD A;  1LCU A;  3EKU A;  4FWP A;  4M3Z A;  4IOC L;  1SV5 A;  5BPL A;  4FJK A;  3UE5 A;  4HUF A;  1BCO A;  4BAC A;  5SZT A;  4X62 K;  1SUQ A;  1Z25 A;  4H4M A;  4BRM A;  4KV8 A;  4B8C A;  4C8O A;  4JS5 A;  3CD6 N;  2E2N A;  1JLQ A;  1TUU A;  3OYJ A;  1VQ8 N;  2Q0U A;  2V7Y A;  2VWK A;  1SS6 A;  2B5J A;  2HBK A;  3V4I A;  3TAP A;  4FVM A;  5MLC Q;  1N32 K;  4B9T A;  1VQP N;  4AHR A;  4B3M K;  3LAM A;  1TUY A;  4MQ3 A;  4DR2 K;  4BY9 C;  4BR7 A;  3G71 N;  2GWJ A;  3BF1 A;  3PX4 A;  1IKW A;  3J8A A;  5AQN A;  4BC4 A;  4M7Y A;  5M1F A;  3K5M A;  2NUB A;  1VQO N;  4U7B A;  3M6G A;  2W40 A;  4K8Z A;  5M1P A;  4E7K A;  4DU1 A;  1EWR A;  1ZBI A;  3LAN A;  4DTO A;  1OH8 A;  3BZC A;  3THX B;  4JI2 K;  3CQ8 A;  3RSE B;  5EOY A;  4JLH A;  1GLD G;  3VA0 A;  2BH1 A;  4JN4 A;  5JIC A;  4BRP A;  3CCL N;  4GV3 A;  4B3T K;  3L6Q A;  2ZJP L;  2D0P A;  4Q5V A;  3ZSX A;  2IS3 A;  4V19 S;  4N41 A;  1JKH A;  2Q31 A;  4CBW A;  3SV4 A;  2E8A A;  1TKT A;  3WNG A;  1KTQ A;  5F1X A;  2FBT A;  3WXL A;  3EO3 A;  3SAF A;  5KRT A;  4HUG A;  3OVN A;  2D0O A;  4FW2 A;  5AQO A;  3MEE A;  4BQL A;  1NK8 A;  2JGU A;  5LMN K;  1E3M A;  4FO0 A;  1KCF A;  3NGY A;  3OYC A;  3I33 A;  4IDH A;  4KH6 A;  4DTP A;  3LPT A;  1HNW K;  3THY B;  3SV3 A;  4Z4F A;  4PL8 A;  3VEX A;  4E7H A;  1K73 O;  4KPY A;  1RT4 A;  2P9L B;  3CER A;  1RDC A;  1QQC A;  1T8E A;  1Q82 O;  4FWK A;  1YHQ N;  2WC9 A;  2D4W A;  4CZE A;  1JCG A;  5IWA K;  3MK6 A;  3CCU N;  3KJV A;  4X66 K;  4EP4 A;  4NXN K;  5LMU K;  1VRU A;  3MXM A;  4CHO A;  3AVM A;  5ADX A;  5LJV A;  1RTI A;  5AQU A;  2P9P A;  2Q36 A;  4WFN L;  4JKG B;  2ITG A;  1TL1 A;  3AO1 A;  2E6L A;  3JYT A;  4J2A A;  1KVB A;  4B9S A;  4B9Q A;  1WN7 A;  2HF3 A;  3QDK A;  3AVJ A;  1DLO A;  3G25 A;  2YI1 A;  3V9S A;  3GL1 A;  4AHS A;  4KBO A;  4DV2 K;  3HPH A;  3VQA A;  3PX6 A;  3CYM A;  2IVO A;  2H3G X;  1N36 K;  2KFN A;  4CE9 A;  4FM0 A;  3EE8 A;  1D4X A;  2ZWH A;  4F3O A;  3GOI A;  3O3F A;  3MX5 A;  1HKC A;  2VYP A;  5TKY A;  1C0U A;  1S5J A;  1NGG A;  5FLX O;  2GWK A;  5EVZ A;  1XUP O;  4DQP A;  1K8K A;  2OCE A;  2PAV A;  4B9N A;  3OYG A;  1SQK A;  4N47 A;  3BZK A;  4FZX C;  1LW2 A;  2B4J A;  4AHT A;  4BRO A;  5F2R A;  3OBY A;  4JV5 K;  1RT2 A;  4F4K A;  4MLH A;  4KHP K;  4IG3 A;  4GNI A;  4CGG A;  4JEP A;  1DTQ A;  1GOA A;  2YKN A;  3QIN A;  5ELZ A;  4B3O A;  2V7Z A;  1QQM A;  3SPZ A;  1MWK A;  1WSI A;  2QI2 A;  3HVT A;  4HCB A;  1RBT A;  2HHQ A;  2P51 A;  4FLV A;  1TK5 A;  2VG7 A;  4CJP A;  3THV A;  4DF8 A;  5AQZ A;  3SQ2 A;  3M1F A;  2UXC K;  3ZET A;  4DTX A;  5J2M A;  4J8F A;  2OPR A;  2IC3 A;  4DKW A;  4CD1 A;  2NRW A;  2QWM A;  5JLF A;  4DV4 K;  3AVK A;  3AAR A;  3LM9 A;  3GDQ A;  3DYA A;  4FLZ A;  4E1M A;  3SQ1 A;  4F8R A;  3PSI A;  3WQT A;  4K43 A;  4JI7 K;  4FPB A;  1HUX A;  3VPZ A;  3ZYY X;  2G8K A;  2X6S A;  5BRE A;  3IKM A;  4PWD A;  4GW6 A;  3J7Z O;  4CHZ A;  1XHZ A;  3S41 A;  2GEL A;  2DTU A;  4DR3 K;  1JLE A;  3VQC A;  4X65 K;  3OS1 A;  3D2E B;  4F9O A;  4DWI A;  1N8R O;  5BN9 A;  3O9U A;  2XY8 A;  4AHC A;  3VTH A;  4BRI A;  1XMQ K;  1UA0 A;  1S6P A;  2E88 A;  2G8W A;  5BRH A;  1ZBF A;  2PZS A;  1NKC A;  4FYD A;  3C6H A;  3EEQ A;  4OO1 J;  3ZX3 A;  1EKE A;  4Y1C A;  4CF2 A;  1WSE A;  2FSN A;  3S3N A;  3WNF A;  4OKK A;  1EP4 A;  1G99 A;  3KLE A;  1W97 L;  3D2F B;  1FK9 A;  3VGM A;  2KZZ A;  1YJ9 N;  3CCE N;  3QNN A;  3D0P A;  1SAZ A;  2OTL N;  3O6W A;  1YTU A;  1LAV A;  4CF1 A;  1RDW X;  4DTM A;  4YFU A;  2RF2 A;  4DQI A;  2XY6 A;  3R3L A;  3DMJ A;  2E1Z A;  1NGH A;  5CHI A;  3DXM B;  3HJF A;  5FPN A;  3ZT0 A;  2P9I A;  2FXU A;  2I7P A;  3NFA A;  4KH5 A;  1TVR A;  3OYE A;  3HVR A;  4OPK A;  2G8V A;  1X9W A;  4DTS A;  1SKS A;  2PBD A;  4Z4G A;  4CJF A;  4KHW A;  1HPZ A;  4QS8 A;  1HR0 K;  4BR2 A;  3R8E A;  1Z6R A;  4O0J A;  4CFA A;  3K5N A;  4WF9 L;  4JKD A;  1BGX T;  3MN5 A;  1YF5 L;  1NGB A;  5JLH A;  2HMI A;  4JK9 A;  1BI4 A;  3KD5 E;  3CM5 A;  1RT3 A;  3VEW A;  3V9W A;  2PY5 A;  3O80 A;  1NK6 A;  4BRA A;  2I7N A;  5AQQ A;  4KH4 A;  1ZXO A;  4JKA A;  5BR9 A;  1BIS A;  3PO5 A;  2R7Y A;  4MO4 A;  3RR8 A;  1RBV A;  1YUW A;  5AR0 A;  5LY3 A;  3DLG A;  3D7E O;  1MWM A;  1XNQ K;  3K57 A;  1ATS A;  2OZS A;  1CZA N;  3VMF B;  4DTN A;  1C1C A;  5HRP A;  2JLE A;  4BR9 A;  3ZEU B;  5JVH L;  3LDQ A;  5AJ3 K;  3QIC A;  4CEC A;  4DUY K;  1RFQ A;  5C15 A;  3VOV A;  2D0C A;  3ZSY A;  4BRN A;  3VF6 A;  1K6Y A;  4M45 A;  3J81 O;  2QKK A;  4BR0 A;  2XO7 A;  1L3U A;  1WSG A;  1TKX A;  3IUC A;  3CCV N;  4FK2 A;  4JI5 K;  5GAE P;  3QFP A;  4LFC K;  2ZGY A;  1A5X A;  4Z0U A;  5M1O A;  2D0B A;  3S3O A;  3VF4 A;  3RWU A;  1WLJ A;  3ZT3 A;  3ZLJ A;  4IG0 A;  3TAE A;  3DLK A;  4E0D A;  3T1Y K;  5HBM A;  1YAG A;  1MDU B;  3TTD A;  2VGN A;  2YCH A;  4YOV A;  4JI0 K;  3MDQ A;  5HOO A;  1TKD A;  2O8E A;  3V9X A;  2QA4 N;  3THY A;  3MXJ A;  3CQX A;  2E6M A;  2CH5 A;  1C0G A;  3SMS A;  3HOS A;  2QWN A;  2KTQ A;  1C6V A;  2P9L A;  4CED A;  3V1R A;  1YI2 N;  1X9S A;  4O44 A;  3L2V A;  1U4B A;  3DI6 A;  4CJ3 A;  4N76 A;  5HRN A;  5A2Q O;  1T6C A;  5AQM A;  5BRF A;  2FC0 A;  4K0K K;  1DEJ A;  4PQU A;  2VWJ A;  2ZJQ L;  3WUH A;  4GVE A;  4CIE A;  2WOM A;  1C1A A;  4JKG A;  1KFS A;  1VSD A;  3HL8 A;  3EE9 A;  1B9F A;  1TKZ A;  3SQ0 A;  1Z05 A;  4C1N I;  1QTM A;  1NJZ A;  4WCE L;  4O8U A;  4CEO A;  4Z4I A;  3AVB A;  3O3G A;  4C8K A;  1MU2 A;  1QQO A;  3CFO A;  4KKO A;  2O8B B;  3CC7 N;  1J54 A;  4KRE A;  2P9N A;  4DR4 K;  3SBG A;  4CJT A;  3TI0 A;  2AP1 A;  4ELV A;  3K2P A;  2YHX A;  1HLU A;  1H1V A;  4YOT A;  1NGJ A;  2F7T A;  1NMN A;  3TU5 A;  4PHT X;  1N33 K;  1GOC A;  2ITM A;  2P5O A;  4E7I A;  3IDH A;  3LPU A;  4BE0 A;  5AQS A;  1VQ5 N;  4IOA L;  3LDP A;  3AO2 A;  4YOY A;  3AA3 A;  3DLH A;  1HQU A;  1NOZ A;  1ZBL A;  3SCX A;  3EKS A;  4J2E A;  1T03 A;  4DSJ A;  4CJR A;  1JCF A;  3WQU A;  2XRI A;  2OYQ A;  4Z94 A;  4FJN A;  4CEE A;  4M3T A;  4JAX A;  3T1A A;  4IO8 A;  4FJG A;  3MEG A;  2E4L A;  3NGI A;  1S1U A;  3HTV A;  4O8K A;  3LZJ A;  3I8D A;  1RT1 A;  3SAG A;  3LDO A;  2F96 A;  1OH5 A;  2F8S A;  3S9H A;  4YDU A;  3UKU B;  4ILJ A;  4F2S A;  3KLH A;  3C0B A;  3QO9 A;  1FW6 A;  2W6K A;  4W5N A;  1T3V A;  1BQN A;  1BDG A;  4KB0 A;  1YXQ A;  2FSK A;  5AQG A;  1L3T A;  1D8Y A;  3HI0 A;  1T6D A;  3BDP A;  2UUC K;  2YX6 A;  1NG9 A;  3MEC A;  3O1W A;  4E7L A;  3KK2 A;  3BP8 A;  5DM6 L;  4FLY A;  1ASU A;  1EWQ A;  4H0T B;  3B8A X;  4M3U A;  1NGE A;  4BDP A;  3VGL A;  1HYS A;  4PUO A;  4E19 A;  5HRR A;  3ZSO A;  3WT0 A;  1RCH A;  4CGH A;  3CFR A;  3SUP A;  4PKG A;  3ZSR A;  1CZB A;  4Z4E A;  3I8B A;  1R59 O;  4J2D A;  4NYF A;  3QIP A;  1TV6 A;  4BRF A;  2KKZ A;  2ETJ A;  3UB5 A;  3ATU A;  1HKG A;  3D2F A;  4H0Y B;  4JS4 A;  1KAZ A;  1N34 K;  4DHY A;  3ENH A;  1WSF A;  3VN5 A;  3OW2 M;  4IKF A;  2F4V K;  5KPR A;  2F9W A;  3SJH A;  2NRV A;  2A1R A;  5I42 A;  4U67 L;  4BWJ A;  4FL9 A;  4FSV A;  2HW3 A;  1UWB A;  5AQK A;  4M3X A;  1IBK K;  2IOC A;  4GY2 B;  1D9F A;  3DXM A;  5B8H A;  2BGG A;  2E20 A;  1NK4 A;  4E1N A;  4NCA A;  1ATR A;  2BTF A;  1VSL A;  1O1W A;  4PA1 A;  2KZM A;  2NNW A;  3H1V X;  1JCE A;  4FJL A;  4FLT A;  4WQ5 C;  2HHT A;  4DV1 K;  1FJG K;  4FJJ A;  5C0Y A;  3KZB A;  4H0X B;  2O8D A;  1Q81 O;  4FWM A;  1YJN N;  4H0V B;  3LP3 A;  3HZ6 A;  4UQG A;  4CJ4 A;  1V4T A;  4FOE A;  3THW A;  3BY5 A;  2P5G A;  3VTI A;  3DXK B;  3V1O A;  3K9K A;  1VQM N;  4JNE A;  1TK8 A;  2G8I A;  2ZD1 A;  4E89 A;  3HBT A;  1ATN A;  4CHQ A;  2XHB A;  4KFB A;  1I3A A;  4R5P A;  1HX1 A;  2AJQ A;  2KLA A;  2BAN A;  1YJW N;  4FPA A;  1BO5 O;  3P38 A;  3MCP A;  1N5Y A;  1RBR A;  3JSM A;  4CZM A;  4BVO A;  1ITG A;  3ZEU A;  3JS6 A;  3SI6 A;  1MA9 B;  5C25 A;  3LWM A;  4H4O A;  3L4Q A;  4BQZ A;  4O5B A;  3KKS A;  5AFU A;  1EX4 A;  4PY5 A;  4E3S A;  4IOX A;  3VQ6 A;  1VQN N;  1Q8I A;  5KQ8 A;  4OKJ A;  1IJJ A;  1DTT A;  3QEW A;  4XH4 A;  1BU6 O;  4FWQ A;  4BRE A;  4DQQ A;  1W2B M;  2O8F B;  4DS5 A;  3V81 A;  4ICL A;  1VSI A;  3AO3 A;  3WXI A;  3P83 D;  4H5W A;  4K25 A;  1VHX A;  4MDA A;  5I3U A;  5BR8 K;  2ASP A;  3K5L A;  3S3M A;  3FLC O;  1S3X A;  3VQ5 A;  4LF6 K;  2A1S A;  3MWT A;  4CJV A;  4CEQ A;  1J53 A;  4BRK A;  4FJ8 A;  3VF2 A;  4KTW A;  3A5L C;  3O08 A;  5EU7 A;  4B1W B;  2YHY A;  4AF1 A;  3DWL A;  3RTV A;  1ZC6 A;  4GV9 A;  3C6T A;  2FLO A;  4DFP A;  2CGL A;  3ULE B;  4CIG A;  2W6L A;  4Y0W A;  1GLL O;  1JLC A;  3DRR A;  3AAQ A;  4AIL C;  4J2B A;  2YHW A;  3ZT1 A;  4OPJ A;  4ID1 A;  3C94 A;  2YJE A;  2A41 A;  3HSC A;  1QVG M;  5JS2 A;  1HQE A;  5AQI A;  4FJM A;  4XEI A;  4WQ4 C;  3HPO A;  3LAK A;  2HNZ A;  4PL7 A;  4XH5 A;  1G15 A;  2Z1H A;  2O4I A;  1VQL N;  2Q97 A;  4IWV A;  3RR7 A;  3QBX A;  1TYQ B;  1R0A A;  1BA1 A;  2QWL A;  2IDO A;  5AQJ A;  1NLV A;  4EHT A;  4FXD A;  4CFD A;  2UXB K;  1JLF A;  3CCM N;  5GIN A;  5E84 A;  3C95 A;  1NK9 A;  2HMP A;  3O4Q A;  4RW7 A;  4BGA A;  3LAL A;  3MN7 A;  3NF8 A;  1QSS A;  4G1Q A;  2IIR A;  2VWB A;  3L3U A;  2NRT A;  1RDA A;  4M63 C;  1OKJ A;  1U04 A;  3NAE A;  1XI1 A;  3QEV A;  4KHQ A;  4KAZ A;  2P9S A;  2HND A;  3DOL A;  4YHH K;  4FWL A;  3OYD A;  1CLQ A;  1Q18 A;  3HO1 A;  1ZBS A;  4ISE A;  3C7N B;  4L8R B;  1JXE A;  1S22 A;  5CY4 A;  1UA1 A;  1NOY A;  3L2W A;  3O1B A;  5HRO A;  4E7J A;  2PYJ A;  3I55 N;  4DF4 A;  3K0S A;  4CFB A;  1HNI A;  3VER A;  2GUP A;  3TAQ A;  5AZI A;  3TSU A;  1TAQ A;  2WON A;  4AM6 A;  4AH9 A;  4CD3 A;  4ZTF A;  3UKR A;  3UKU A;  3N4P A;  3H46 O;  3JXU A;  4IEE A;  1X3N A;  4I2Q A;  4PKI A;  2G8H A;  5EY4 A;  3SAH A;  3CET A;  4JRP A;  2ZQB A;  4EIA A;  3BEX A;  4DSL A;  5BPN A;  2UU9 K;  4RTF D;  1VAZ A;  2X74 A;  1VSM A;  3TSP A;  3ID8 A;  3BUZ B;  3RMA A;  5GAD P;  2ASO A;  5BN8 A;  2RPI A;  1U49 A;  3N4Q A;  4DMN A;  5M1N A;  1U2V B;  2ATQ A;  3C6U A;  4YOW A;  2OPQ A;  3B6O A;  1RGI A;  1VSE A;  2WUS A;  3NCI A;  2Z1I A;  4LH5 A;  2VQF K;  3NVK A;  4DS4 A;  1XC3 A;  2NRX A;  3ID6 A;  3CCR N;  3TAM A;  3EZW A;  4BR4 A;  4LF9 K;  3I56 N;  3PUF A;  4BRQ A;  3OYH A;  3GG4 A;  3U6F A;  3LDS A;  3IS9 A;  5C2D A;  1KSP A;  4LSN A;  3OYA A;  5AQV A;  3KWG A;  5KGX A;  1ESV A;  5BPM A;  2QKB A;  3T69 A;  3ZSW A;  3IMX A;  4BRH A;  1IO2 A;  3F5T A;  4DR6 K;  2P1J A;  3CPE A;  4C8M A;  1E4G T;  4DR1 K;  3FZK A;  2Q3S A;  4B9V A;  1QZ6 A;  1WSJ A;  5JMV A;  1T05 A;  3WNE A;  4G9Z A;  3CMA N;  4JKC A;  3F73 A;  1HPM A;  4CHN A;  2IGI A;  3KLI A;  5E26 A;  3O4W A;  1HJO A;  2W42 A;  1IG8 A;  3CJ9 A;  1SKW A;  4DV5 K;  4DLG A;  4I7F A;  4MO5 A;  1HYZ A;  4HTU A;  1YIJ N;  3H3O B;  3QLH A;  4IJA A;  3KLG A;  3A5N C;  3HXM A;  1RIL A;  4WYB A;  5M1K A;  2RE2 A;  1KFD A;  4DFJ A;  4LD0 A;  1J6Z A;  4BC3 A;  4FZY A;  4EHU A;  1B9D A;  1KC8 O;  3SBT A; 
#chains in the Genus database with same CATH homology
 3LAN A;  4FJN A;  5KTQ A;  4DTO A;  1XHX A;  3AVG A;  4CEE A;  4CJ5 A;  4M3T A;  3WNH A;  3T1A A;  3NF6 A;  3L2U A;  4FJG A;  3MEG A;  2E4L A;  3NGI A;  3CQ8 A;  1S1U A;  4DLE A;  2RKI A;  3SUN A;  3TR8 A;  4B8A B;  4JLH A;  4RW4 A;  4CF8 A;  3LZJ A;  3I0R A;  1BL3 A;  3I8D A;  3VA0 A;  1RT1 A;  2I5J A;  1HNV A;  4I9L A;  3G0Z A;  2F96 A;  4JRQ A;  4KTZ A;  2F8S A;  3S9H A;  4NYN A;  5J2N A;  1RTD A;  2HHW A;  4F2S A;  3KLH A;  3RMC A;  4DTJ A;  3QO9 A;  4Q5V A;  5J2Q A;  4Y1D A;  3ZSX A;  1ZBI A;  4DU3 A;  2IS3 A;  4W5N A;  4EP5 A;  1TK0 A;  4N41 A;  1JKH A;  1BQN A;  5J1E A;  3SV4 A;  4KB0 A;  1TKT A;  3WNG A;  5E41 A;  1A5W A;  1RTJ A;  2HHU A;  5HP1 A;  3T3F A;  1TL3 A;  1L3T A;  1KTQ A;  1D8Y A;  3T19 A;  2FBT A;  4CEB A;  2EX3 A;  4CGD A;  3HPG A;  4C8L A;  5HRS A;  5KRT A;  4HUG A;  3BDP A;  3OVN A;  4FW2 A;  3MEC A;  3OYB A;  3MEE A;  4OGC A;  4E7L A;  1FXX A;  3KK2 A;  3ZSQ A;  1NK8 A;  2JGU A;  2YNI A;  3LP0 A;  4W5T A;  3QET A;  1LW0 A;  1BQM A;  4FLY A;  3SZ2 A;  1ASU A;  3FFI A;  3H08 A;  5CZ2 A;  1KCF A;  3AVI A;  3NGY A;  3OYC A;  4M3U A;  5SWM A;  4DTP A;  3LPT A;  4BDP A;  1HYS A;  4M3R A;  4E19 A;  4PUO A;  3LP1 A;  5HRR A;  3SV3 A;  4I2P A;  2FBX A;  4Z4F A;  3DRS A;  4E7H A;  1QHT A;  1IH7 A;  3AVL A;  4KPY A;  3ZSO A;  4CEA A;  1RT4 A;  1RDC A;  1UAX A;  4B9U A;  1RCH A;  4CGH A;  1QQC A;  3CFR A;  1T8E A;  1Y97 A;  3F9K A;  1RDD A;  3V1Q A;  3SUP A;  2OZM A;  5FRN A;  4CHP A;  1L3V A;  3ZSR A;  1CZB A;  3SJJ A;  3SUO A;  3K59 A;  1B92 A;  4DFK A;  4Z4E A;  4FJ5 A;  1NJW A;  4ELT A;  3KJV A;  2DY4 A;  4J2D A;  4NYF A;  4EP4 A;  2ZE2 A;  1JLB A;  3QIP A;  1BCM A;  1TV6 A;  1VRU A;  3MXM A;  4CHO A;  3AVM A;  3PX0 A;  1NK0 A;  1YT3 A;  1Z26 A;  2ETJ A;  1RTI A;  3KK3 A;  3L2R A;  3EYZ A;  1HJR A;  3KTQ A;  1L5U A;  4JS4 A;  1IKV A;  1KLN A;  2ITG A;  3TAB A;  1TL1 A;  1S9E A;  3AO1 A;  3M8Q A;  1WSF A;  2E6L A;  5K14 A;  4MFB A;  1KVB A;  3VN5 A;  3JYT A;  1KLM A;  1WN7 A;  4B9S A;  4J2A A;  4EZ9 A;  3AVJ A;  3AO4 A;  1QS4 A;  5I42 A;  1DLO A;  2A1R A;  4BWJ A;  3AVA A;  1S9G A;  4O0I A;  1VSK A;  4FCY A;  2HW3 A;  1UWB A;  4BE2 A;  3VQ8 A;  4LY7 A;  3V9S A;  1WNS A;  3P5J A;  3IG1 A;  3QNO A;  4M3X A;  2KW4 A;  2IOC A;  4AHS A;  1XC9 A;  3HPH A;  3VQA A;  4Z4C A;  4OJR A;  1D9F A;  3HP6 A;  4QAG A;  3CYM A;  4H8K A;  3OYL A;  3PX6 A;  1NK4 A;  4IFV A;  4E1N A;  1T7P A;  4NCA A;  2BGG A;  1VSL A;  2KFN A;  1O1W A;  4PA1 A;  2KZM A;  1UOC A;  3OYK A;  4CE9 A;  4FM0 A;  4FJL A;  4FLT A;  2HHT A;  4F3O A;  4DSI A;  2D0A A;  1I39 A;  3O3F A;  3PV8 A;  4FJJ A;  3HYF A;  2VG5 A;  3I0S A;  4HVJ A;  3AVF A;  3QEP A;  1C0U A;  1S5J A;  2OPS A;  4BE1 A;  3TAN A;  1NJX A;  4W5O A;  1N6Q A;  4IDK A;  2PYL A;  4KO0 A;  2YHB A;  3LP3 A;  4UQG A;  4DQP A;  2RN2 A;  4CJ4 A;  1SKR A;  2LSN A;  3OYN A;  4B9N A;  3OYG A;  4N47 A;  4IFY A;  5KI6 A;  4CK1 A;  2P5G A;  3G10 A;  3EY1 A;  3V1O A;  4FJH A;  4CJE A;  4FZX C;  1SL0 A;  1LW2 A;  3RRG A;  2B4J A;  2O4G A;  3ISN C;  4AHT A;  4M41 A;  1TK8 A;  1IG9 A;  2GV9 A;  2G8I A;  2ZD1 A;  4E89 A;  1RT2 A;  4F4K A;  4IG3 A;  4CF9 A;  1VSF A;  3ITH A;  3QEI A;  4CGG A;  4CHQ A;  3ASM A;  2BE2 A;  4ZHR A;  2XHB A;  4KFB A;  1DTQ A;  1GOA A;  1I3A A;  2YKN A;  2YNF A;  3QIN A;  1RT7 A;  4B3O A;  4FLX A;  3V9U A;  2HVH A;  3AA5 X;  4R5P A;  4YNQ A;  2AJQ A;  3SPZ A;  1WSI A;  3HVT A;  1LWE A;  2BAN A;  5FDL A;  4HCB A;  1RBT A;  3L8B A;  3K5O A;  2P51 A;  2HHQ A;  4FLV A;  1TK5 A;  2VG7 A;  4CJP A;  3VQ4 A;  3OJU A;  1KVA A;  1N5Y A;  1C0T A;  1RBR A;  1RDB A;  2D5R A;  3ZSV A;  3JSM A;  4DG1 A;  2Z1G A;  4C8N A;  3KKR A;  3EZ5 A;  3THV A;  4DF8 A;  1L3S A;  1J5O A;  1W9H A;  3OYM A;  3SQ2 A;  1ITG A;  1KRP A;  1W0H A;  2HHS A;  4DTX A;  4RW6 A;  4I9Q A;  2HVI A;  1EET A;  3SI6 A;  5C25 A;  1SL1 A;  5J2M A;  3OYI A;  4HCC A;  3LWM A;  2OPR A;  3L3V A;  1NK7 A;  4CGF A;  2IC3 A;  4H4O A;  2XY7 A;  1ASW A;  4GVM A;  1HMV A;  3O3H A;  3AVK A;  4O5B A;  1BIU A;  3KKS A;  1JXB A;  1EX4 A;  2G8F A;  3DYA A;  3NF9 A;  3UIQ A;  5HLF A;  4FLZ A;  4E1M A;  3V9Z A;  3SQ1 A;  4FLU A;  4F8R A;  4PY5 A;  5DK5 A;  4E3S A;  1RBS A;  3VQ6 A;  1Q8I A;  1WAJ A;  4OKJ A;  1DTT A;  4CJS A;  4ELU A;  3QEW A;  1ZBH A;  3TWH A;  4N5S A;  4DQS A;  2BDP A;  2G8K A;  4DQQ A;  3AO5 A;  2X6S A;  4DS5 A;  1D9D A;  3M8P A;  4ICL A;  4XIU A;  3HT3 A;  1VSI A;  3AVN A;  3V81 A;  3MXI A;  4FM1 A;  3QES A;  4FK0 A;  3AO3 A;  5CYQ A;  1J9A A;  4GW6 A;  2OA8 A;  4CHZ A;  4K8X A;  4PWD A;  4GMJ B;  1XHZ A;  3P83 D;  4B9M A;  3DM2 A;  2DTU A;  5I3U A;  3ZCM A;  1JLE A;  3VQC A;  3OS1 A;  3VQP A;  4DWI A;  3K5L A;  3S3M A;  3NH2 A;  2XY8 A;  1TAU A;  4AHC A;  4CJU A;  3SYZ A;  3VQ5 A;  4CHY A;  2A1S A;  1S6P A;  1UA0 A;  4CJV A;  4CEQ A;  1FKP A;  1J53 A;  4FJ8 A;  3HJF A;  3CG7 A;  4FW1 A;  1ZBF A;  2G8W A;  2PZS A;  1RNH A;  1NKC A;  4KTW A;  4FYD A;  5EU7 A;  1EKE A;  4Y1C A;  3M8S A;  4CF2 A;  1U48 A;  4B08 A;  1WSE A;  3SNN A;  3RRH A;  3S3N A;  2Z1J A;  3KIO A;  4ID5 A;  5FRM A;  4KB1 A;  3RTV A;  3WNF A;  4DSE A;  4OKK A;  1EP4 A;  3KLE A;  4KHU A;  4IBN A;  3IAY A;  3QER A;  3C6T A;  3QEX A;  5J2P A;  1FK9 A;  1S6Q A;  4FLW A;  4DFP A;  4CIG A;  3D45 A;  4CEZ A;  3RMD A;  2KZZ A;  3QNN A;  1JLC A;  4FJX A;  2X6N A;  3DRR A;  4AIL C;  3D0P A;  4J2B A;  1IKX A;  3ZT1 A;  4OPJ A;  1LAV A;  4ID1 A;  4CF1 A;  3LWL A;  3TAF A;  1YTU A;  3U3G A;  1QSY A;  3C94 A;  1NKE A;  1FKO A;  4DTM A;  4YFU A;  5JS2 A;  1REV A;  3O4N A;  2RF2 A;  1NJY A;  1HQE A;  2B6A A;  4W5Q A;  3DMJ A;  4DU1 A;  2XY6 A;  3PY8 A;  4DQI A;  3B6P A;  3HPO A;  2IAJ A;  4W5R A;  3LAK A;  1JL1 A;  4FJM A;  4KHY A;  3ZT0 A;  1U47 A;  4DFM A;  4NCB A;  2HNZ A;  3E01 A;  3NFA A;  1G15 A;  1TVR A;  2Z1H A;  3OYE A;  4OPK A;  3HVR A;  2G8V A;  1X9W A;  2HB5 A;  4CIF A;  2O4I A;  3NE6 A;  4DTS A;  3SQ4 A;  1SKS A;  4Q0B A;  4CK2 A;  3RR7 A;  1QE1 A;  4CJF A;  4KHW A;  1HRH A;  1HPZ A;  1LWC A;  4Z4G A;  1R0A A;  4OKE A;  1RT5 A;  2F8T A;  3HST B;  4NCG A;  4O0J A;  2IDO A;  4CFA A;  3K5N A;  3NHG A;  1NK5 A;  4BDY A;  3ULD A;  4FXD A;  2KQ2 A;  4CFD A;  1BGX T;  1JLF A;  3C95 A;  4M3W A;  1NK9 A;  2HHV A;  3OS0 A;  3O4Q A;  4RW7 A;  3LAL A;  4CJW A;  1EXQ A;  2EHG A;  1BI4 B;  3VA3 A;  5FRO A;  3NF8 A;  2HMI A;  1BI4 A;  2GUI A;  3KD5 E;  4KI6 A;  1YVU A;  1QSS A;  3CM5 A;  4HUE A;  3CM6 A;  1RT3 A;  3AA4 A;  4G1Q A;  3KK1 A;  3V9W A;  2PY5 A;  1NK6 A;  3V6D A;  3L3U A;  1RDA A;  4RG8 A;  1U04 A;  4FZZ A;  3HM9 A;  1BIS A;  4EZ6 A;  3NAE A;  4CF0 A;  3VQQ A;  3VQ7 A;  1XI1 A;  3QEV A;  3PO5 A;  4KHQ A;  4KAZ A;  3RMB A;  2R7Y A;  3OYF A;  4CJQ A;  3RR8 A;  4RW8 A;  2HND A;  3DOL A;  2Y1J A;  1RBV A;  3OYD A;  4CJL A;  3OS2 A;  1CLQ A;  3DLG A;  2YV0 X;  3AA2 A;  1KVC A;  3L2Q A;  3HO1 A;  1GOB A;  3K57 A;  4L8R B;  1JXE A;  4QOZ B;  1LAW A;  4FM2 A;  2OZS A;  5CY4 A;  1ZYQ A;  4DTN A;  3LZI A;  1UA1 A;  1NOY A;  1C1C A;  5C24 A;  5HRP A;  2FBV A;  3L2W A;  3BGR A;  3NGZ A;  2JLE A;  5KGW A;  1RBU A;  5HRO A;  4E7J A;  2PYJ A;  4BWM A;  4KTQ A;  4DTU A;  1X1P A;  4OLA A;  4CEC A;  4DF4 A;  2D0C A;  3P1G A;  3ZT2 A;  3NH0 A;  1S1W A;  4CFB A;  4DSK A;  2DFE A;  2X78 A;  1D5A A;  1HNI A;  4RW9 A;  3ZSY A;  1VRT A;  1K6Y A;  3DLB A;  3TAQ A;  4M45 A;  2QKK A;  2OPP A;  3AVC A;  2XO7 A;  4CEF A;  1TAQ A;  2WON A;  4LH4 A;  4CGJ A;  3U3Y A;  2Y1I A;  1L3U A;  1Q9X A;  1WSG A;  4AH9 A;  1TKX A;  1C1B A;  3VQ9 A;  4FJ9 A;  2VG6 A;  1WSH A;  4ZTF A;  4FK2 A;  3HK2 A;  3SUQ A;  1U45 A;  3K58 A;  3KLF A;  3PO4 A;  4I2Q A;  2G8H A;  2DFF A;  1SL2 A;  4BDZ A;  4DSF A;  4JRP A;  2ZQB A;  1XWL A;  4DSL A;  3DLR A;  1HYV A;  4FK4 A;  1A5X A;  4Z0U A;  1CXQ A;  4TSX A;  2YHA A;  1ASV A;  4CJK A;  2HHX A;  2X74 A;  5KRS A;  1VSM A;  2GBZ A;  2D0B A;  4IKF A;  3RMA A;  3S3O A;  4KI4 A;  1BIZ A;  4ZTJ A;  2HNY A;  4OLB A;  3RWU A;  1WLJ A;  3OJS A;  3ZT3 A;  1JLA A;  2RPI A;  1QSL A;  1RTH A;  1CXU A;  3DLE A;  4LSL A;  4IG0 A;  2FBY A;  3TAE A;  1U49 A;  4DMN A;  3DLK A;  4E0D A;  5HBM A;  2YNH A;  4K8Z A;  4HHT A;  5JS1 A;  2XY5 A;  4OGE A;  2ATQ A;  3C6U A;  2KFZ A;  1F21 A;  1S1V A;  1JL2 A;  2OPQ A;  3B6O A;  3IRX A;  1TKD A;  3V9X A;  4N56 A;  1VSE A;  3MXJ A;  2E6M A;  4O55 A;  3NCI A;  4CES A;  4O4G A;  2Z1I A;  4LH5 A;  4CGI A;  2G8U A;  3CFP A;  4FJI A;  3TAR A;  1S1T A;  4DS4 A;  2KTQ A;  1S1X A;  4DQR A;  4DTR A;  3NH1 A;  1C6V A;  3SPY A;  4B9L A;  4CED A;  1RT6 A;  2YKM A;  3V1R A;  4KHN A;  4QCL A;  3M8R A;  3TAM A;  4O44 A;  4CFC A;  1X9S A;  4M42 A;  3L2V A;  1U4B A;  4KHS A;  1ZBU A;  3VQB A;  3VQD A;  3PUF A;  1C0M A;  3DI6 A;  4CJ3 A;  4F3T A;  3NDK A;  3OYH A;  4N76 A;  3U6F A;  3ALY A;  5HRN A;  4CER A;  1WAF A;  3KD1 E;  5D3G A;  3LDS A;  3IS9 A;  2QK9 A;  2FC0 A;  1TGO A;  1Q9Y A;  2QXF A;  1YTA A;  1KSP A;  1VK0 A;  4PQU A;  4CCH A;  4AHV A;  1IKY A;  2VWJ A;  4LSN A;  4FJ7 A;  4CK3 A;  3A2F A;  1NKB A;  3DRP A;  3HP9 A;  3OYA A;  3VQE A;  3LP2 A;  5KGX A;  4CIE A;  2QKB A;  3MED A;  2WOM A;  3DOK A;  3TAG A;  1LV5 A;  1C1A A;  1KFS A;  3ZSW A;  4M3Y A;  4AHU A;  1VSD A;  3HL8 A;  2DFH A;  3ZSZ A;  1B9F A;  1TKZ A;  4M3Z A;  1SV5 A;  1IO2 A;  3SQ0 A;  2YNG A;  4FJK A;  4HUF A;  1BCO A;  1X9M A;  1QTM A;  3MAQ A;  4BAC A;  1NJZ A;  2P1J A;  4C8M A;  4CEO A;  5SZT A;  4Z4I A;  1SUQ A;  3AVB A;  3O3G A;  4C8K A;  4F2R A;  5CYM A;  1Z25 A;  1MU2 A;  3CFO A;  3NF7 A;  4H4M A;  4KKO A;  2Q3S A;  4KV8 A;  4B8C A;  1J54 A;  4B9V A;  4JS5 A;  4C8O A;  4KRE A;  3AVH A;  1WSJ A;  1T05 A;  1JLQ A;  3WNE A;  4Z4H A;  4CJT A;  3OYJ A;  3AV9 A;  5DMR A;  3F73 A;  3TI0 A;  3QIO A;  2VWK A;  4CHN A;  2IGI A;  4KRF A;  2B5J A;  3KLI A;  4ELV A;  3V4I A;  3K2P A;  3TAP A;  4FVM A;  1VSH A;  4B9T A;  2W42 A;  1CZ9 A;  1LWF A;  4AHR A;  3ZT4 A;  5CZ1 A;  5C42 A;  1SKW A;  3LAM A;  4MQ3 A;  1GOC A;  4DLG A;  4I7F A;  2P5O A;  4E7I A;  1HYZ A;  4HTU A;  3LPU A;  4BE0 A;  3QLH A;  5T7B A;  3PX4 A;  3KLG A;  1IKW A;  3NBP A;  3AO2 A;  4DU4 A;  3AA3 A;  3HXM A;  3DLH A;  1HQU A;  1NOZ A;  1RIL A;  1ZBL A;  3SCX A;  4OVL A;  1BHL A;  1KFD A;  4DFJ A;  1A5V A;  4J2E A;  4LD0 A;  1T03 A;  3K5M A;  4WE1 A;  2NUB A;  4DSJ A;  4FZY A;  1VSJ A;  4CJR A;  1B9D A;  2XRI A;  2OYQ A;  1JLG A;  3OY9 A;  4E7K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...