2HHHK

Crystal structure of kasugamycin bound to the 30s ribosomal subunit
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
publication title The antibiotic kasugamycin mimics mRNA nucleotides to destabilize tRNA binding and inhibit canonical translation initiation.
pubmed doi rcsb
total genus 30
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2006-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 2hhhK00
4LFAK 1XMOK 4DV0K 4NXNK 3J7AP 4NXMK 1J5EK 4DR1K 3J7YP 4DUZK 4OX9K 2UUBK 1N36K 3J81O 2ZM6K 5LL6Z 4DR5K 3J80O 4GKKK 5BR8K 4X65K 4DV4K 4LF4K 2UXBK 1HNZK 4LF7K 4B3RK 4JI2K 5LMNK 4DV5K 4DV1K 4DV7K 2HHHK 4KHPK 4B3MK 4JI5K 1XNRK 1IBMK 4JI0K 2VQEK 5A2QO 1HNXK 4DR7K 4CVNE 4DV3K 4LFBK 4GKJK 4X62K 4K0KK 4JI8K 4DR6K 4V19S 4YHHK 4X66K 1XMQK 5LMUK 2E5LK 2VQFK 4DR4K 4DV6K 1HR0K 4JI4K 4B3TK 1HNWK 4LF6K 5IT9O 4DV2K 2UUAK 2F4VK 1XNQK 4JI3K 5AJ3K 1N33K 4CW7B 2UUCK 1I94K 4LF5K 4YY3K 3T1YK 4JI1K 2UXDK 4LFCK 1IBKK 3OTOK 4B3SK 2UXCK 4X64K 3T1HK 5FLXO 4JI7K 4DUYK 1FJGK 1N34K 1IBLK 4JYAK 5IWAK 4AQYK 4JV5K 4LF8K 3JAMO 1N32K 4LF9K 4JI6K 4DR2K 4DR3K 2UU9K
chains in the Genus database with same CATH superfamily
3V1QA 3HK2A 1DKGD 4W5OA 3DXKB 3QO9A 1KFDA 3TABA 3ZT0A 3VEVA 5JMVA 4Z4GA 1J5EK 3JXUA 3BUZB 3KLGA 1L3SA 4Y0WA 3TR8A 1KAXA 1RDBA 4PUOA 1TL3A 3WXJA 3SPZA 2XY7A 3R6MA 4DV4K 2R7YA 2UXBK 2W42A 1ZYQA 3C6UA 3RMDA 4EFHA 3MAQA 3TSUA 4Z4EA 4FXDA 4NLCA 4YOWA 3RWUA 3FFKB 1LV5A 4B3MK 3QBWA 4N47A 4RWTA 1Y64A 5SWMA 3RRHA 4JI0K 4KTZA 4DR7K 5JVHL 5HROA 1WBBA 3VA0A 3AARA 4EIAA 4DQQA 1NGJA 4GV6A 3CM6A 2XY6A 3IUCA 2A42A 4IFEA 4CZFA 5AQYA 5C2FA 2HHWA 3AO3A 1NMNA 4WE1A 3QDKA 3MXMA 5AZIB 5F1XA 2O8EB 3V9ZA 4B3OA 3KLIA 4RW9A 1KAZA 2PZSA 1HYVA 5IT9O 2KZZA 3K9JA 3HXMA 1GOAA 4FWLA 4B9UA 1ITGA 4K42A 4CF1A 5AJ3K 4IO9L 4WFNL 1HPZA 2PAVA 4HTLA 3K5MA 4YY3K 1X3NA 4ID1A 3AO2A 4QOZB 1KSPA 2KKZA 3V1RA 4CJUA 3M8QA 4CEEA 3M8RA 1KVAA 1N32K 5EU7A 3ZSVA 4CD3A 3OJUA 4JEPA 1DEJA 1HMVA 2O8DB 3N4PA 4LFAK 1GLEG 2UYTA 4MO5A 2V51B 4RW6A 5KQ8A 2WONA 3DLKA 2G8KA 2Q2RA 1VQKN 2FBTA 4XH4A 3SPYA 1K9MO 1JLAA 3U3YA 3BY5A 3HPOA 2FSNA 2OPRA 5AQGA 3SQ2A 4HCCA 5BRDA 1N8RO 1NGHA 1U45A 1B9FA 3HYFA 3SAHA 4H0YB 2GX9A 3V9SA 1OH6A 2HBMA 3HRGA 3Q7BA 1NWKA 2FBXA 4EHTA 4DV5K 4DFKA 3VF4A 1GLLO 3I0RA 3EN9A 3NF6A 2HHSA 4B9QA 5GAHP 1IH7A 4QS7A 1IO2A 3RR8A 1H1VA 3MN6A 2VYPA 1C1BA 1RTDA 1RTJA 3CCVN 4FWMA 5FRMA 1Z25A 3J7ZO 4KB0A 4CZHA 4H8KA 1TYQA 3AV9A 3E1YA 4BR0A 4YNQA 5AQSA 1T3VA 3Q7CA 3JYTA 2O8CB 3OW2M 3EKSA 1NGIA 4N56A 4K25A 1WSJA 4JI4K 4O5FA 3P38A 1MWMA 5BPLA 3LDOA 3ZETB 4B1UB 1LWFA 3DLRA 3KVGA 3HO1A 3KKSA 3LDLA 3ZX0A 4CIGA 2QXLA 1OVQA 1U47A 4PWDA 1G99A 3CCJN 2D4WA 4K8XA 1I94K 2FSKA 1XHZA 2YKNA 2VG7A 4I2PA 5C15A 3TAMA 1L3UA 4FOIA 3BF3A 4J8FA 5ADXA 1X9JA 4BE1A 3SBTA 4LF9K 4H5WA 4FJHA 2ASPA 5KI6A 1ZC6A 2IGIA 2AA4A 1XMOK 3E9OA 4NXNK 4NCAA 3IAYA 3OYCA 4DUZK 1RDCA 1IKXA 1YAGA 3WXKA 2X78A 3BF1A 2QKKA 4NCGA 4IZ9A 2OYQA 4X65K 3CF5L 3CD6N 1DT9A 3C7NB 4J2DA 2HB5A 4FLUA 3CCEN 5GINA 3AA4A 1RFQA 3V4IA 1P8ZA 3CI5A 3EE8A 3KLEA 4F2SA 3CM5A 4BDYA 3JS6A 5GAEP 3OYGA 3QIOA 2I7NA 4DU3A 3OYMA 2QXFA 2ZGYA 3ZSQA 3K58A 3OYEA 1P90A 5BN8A 5DM7L 2E2QA 3HBTA 4FK0A 3ATUA 3WXLA 4FW1A 4CJVA 2Q31A 1S9GA 1D5AA 1BI4B 2ZGZA 2ASMA 5F2RA 3SMSA 4F9OA 1NK7A 1JLEA 1KLMA 4W5RA 5KGXA 3TU5A 4HVJA 1OKJA 4CF2A 2I7PA 2E88A 3KHYA 5JLFA 1S6QA 4DFPA 2GELA 4CFAA 4BR2A 4W5QA 4EP5A 3VEOA 2DFEA 3SJHA 3K59A 2UXCK 3SCXA 1T05A 2QWRA 4DTJA 1VSHA 1N5YA 1VQ8N 3K57A 3VQDA 5AZIA 1NJIO 2NRHA 4AH9A 2O8EA 4Z4CA 4GV9A 4U67L 2RHKA 1RNHA 4NYFA 1Y97A 1TKTA 2NZTA 1S22A 4JK8A 5AQIA 2ITMA 4RW7A 2FBVA 2YNIA 3WUHA 4KAZA 3O3HA 1U04A 3CC4N 3CG7A 4FM2A 3HTVA 2HHQA 4RW8A 1D8YA 4BE2A 4O5BA 5BR8K 3VQEA 2D0BA 5HRNA 3TPQA 4JKDA 1C0TA 1WUAA 1ATRA 3DM2A 1SS6A 4OVLA 4FLYA 4BREA 4DF4A 1HRHA 4DV7K 3PX6A 2HNZA 5FPNA 1T6DA 3EL2A 2Z1JA 4AM7A 3O3FA 4BRAA 4OKKA 2ZJRL 5AQNA 1M1KO 3TTDA 4GVEA 3L2VA 2XO7A 1NMDA 1ZBFA 3RTVA 4C8OA 4K43A 1C0MA 4BQZA 3SYZA 2PYLA 1XC9A 4FZYA 3ZSOA 3NH2A 4FM1A 3VF2A 4RTFD 1VQMN 3KJVA 1UWBA 1NGFA 2P9SA 1HR0K 3OVNA 5C24A 4A61A 3MCPA 5M1NA 4DTSA 2HNDA 3LWLA 1JKHA 3QETA 4DV2K 3SNNA 3QLHA 3FGUA 3CMEN 1RT3A 1BA0A 1WOQA 4NLBA 4FLZA 1TKDA 3W3DA 4YOVA 3CC2N 5JVGL 4JI3K 3FZKA 5I42A 4JKEA 4EZ6A 5DK5A 1NK6A 4LF5K 2ASOA 3LZIA 2DFHA 4JI1K 3H3NO 1VAZA 4BC3A 3M6GA 1RT1A 2BGGA 4CEAA 4JS4A 4CHNA 4FJJA 4BRLA 4OPHA 4FLVA 3HP9A 1VSDA 3DLEA 1U6ZA 1BDGA 4ILJA 2BUPA 3AO5A 1QQOA 4DR3K 1XHXA 3FZLA 3ZETA 5EXWA 4CCHA 2A6AA 3OHRA 4DR1K 4FJ9A 3HT3A 2QI2A 3MEGA 1X1PA 1TV6A 4EP4A 2D0PA 2WFBA 4O55A 3VN5A 4KREA 1V4SA 1SZ2A 3ZSWA 3FFIA 4DR5K 4CJ4A 3L4IA 3F9MA 4B8AB 1S6PA 2A5XA 1HJRA 3L2WA 4LF4K 5CYMA 3T3FA 4QS8A 4GW6A 4NB4A 1DTTA 1T7PA 3UE5A 3C6AA 3DRSA 2HBLA 3VQ7A 3EE9A 3CERA 2YNGA 3HSCA 1LCUA 1TVRA 2BE2A 3LP2A 1ZBLA 1RT6A 4ELUA 1IV0A 4FZXC 4IEIA 4BRIA 5KTQA 2HHXA 4A2AA 1BIUA 2IS3A 1NK8A 4WYBA 1VQ7N 3O08A 3SUOA 1ZBIA 1O13A 5I9EB 4M3XA 2P9LB 4X66K 1GLJO 1HPMA 4B9VA 3FZFA 2GBZA 5AFUA 3WNFA 1C1CA 4IO8A 1BISA 1DTQA 3CIPA 3HJFA 3AVBA 3C7NA 5KQDA 4OJRA 1RT5A 1HKCA 4YOXA 2FC0A 2NRXA 3LP3A 4CD1A 1XNQK 1WSIA 1A5WA 3I8DA 3GBTA 1W2BM 4KH5A 2H3GX 1TGOA 1W97L 3R9PA 1MU2A 3QNNA 1N33K 1KAYA 3UKRB 1S1UA 3VQCA 3L3VA 3O9RA 3AY9A 1QS4A 1HKBA 3CQ8A 1BI4A 1WAFA 4CGGA 4FVMA 1N34K 1BQMA 1NGBA 2P51A 3VEWA 1JCFA 4WQ4C 4AQYK 1NGAA 4FLTA 4LF8K 1VQ4N 5BPMA 1YF5L 2NLXA 2IC3A 3THXB 3QEPA 1QZ6A 3A2FA 4HCBA 2YKMA 4E1JA 4DSKA 3KK1A 1O1WA 1NK4A 3T7ZA 3ZSYA 4BRFA 1NJWA 2KFZA 3O5BA 3C0BA 5EX5A 1T6CA 3TTFA 3V9UA 1NNEA 3OYDA 3WQUA 1YITN 1N36K 3QFPA 3SJJA 1HQEA 4FJKA 3HVTA 1S72N 4GV3A 3RMBA 1C1AA 3DLGA 1X9WA 1QVFM 3KTQA 2OTJN 2VWKA 4DTRA 3T69A 3A5OC 3SZ2A 1YHQN 4LF7K 1JLBA 4CGHA 2KQ2A 4FJIA 3GDQA 3VGKA 3SAFA 4JK9A 4KV8A 4M7XA 3MEEA 4CEBA 2DTUA 1YIJN 4Z4FA 4YOTA 5KPRA 4FJ7A 2P9NB 4AM6A 4DV3K 2F9TA 2PFUA 3HPGA 1U4BA 4JNEA 4X62K 2IOCA 1BGXT 2Z1GA 5CE3A 3RRGA 2O8BA 2Q36A 3VENA 1NJYA 4I7FA 3ITHA 3RMCA 3O9QA 1NGGA 4I2QA 1NBWA 1NM1A 4BRCA 4DSLA 1QSYA 1RTHA 4B3TK 1BCMA 1OH7A 4M7YA 4DQPA 2RPIA 3A5MC 1JL1A 4QCLA 1NJZA 1R59O 4HWIA 2ZE2A 1IG8A 4IFVA 4FWSA 3FLCO 1IJJA 2EX3A 3ID8A 3P31A 4JLHA 3E66A 3N4QA 1TAUA 1BO5O 4FLXA 2HHVA 4BRKA 2E2OA 2UXDK 1GLFO 4LFCK 2YX6A 3EO3A 3H46O 1GLDG 2E2PA 4KH4A 4BRGA 1KLNA 2D5RA 2AJQA 1LWEA 4FWOA 1QVGM 5AQHA 3T19A 4FYDA 3VEXA 3A5NC 3KWIA 3OYNA 4E1NA 4JAXA 2ZWHA 4BGBA 3R3LA 4JRPA 3BEXA 2BTFA 4ILGB 4FM0A 2YNHA 4BWJA 1Q82O 4OPAA 2OZMA 1MA9B 1E4FT 4DQ8A 4CEFA 4DQRA 2VG6A 2E4LA 1ATNA 4CJLA 4BC2A 3WXIA 1QHTA 4M42A 2A1SA 2ZM6K 4CZMA 2B5JA 2FBYA 1BG3A 5DM6L 4M41A 2ZQBA 4IJNA 1HLUA 3I55N 2Q3SA 3LZJA 4CGIA 5KGWA 3VQ9A 2QWQA 2D0OA 4M3RA 3VESA 1TK0A 4BC5A 3MN7A 4CESA 4B9NA 2VCPA 1KFSA 3F73A 4KRFA 3TI0A 4PKGA 2D0AA 3G4SN 1ASWA 4CK2A 5AZJA 4BGAA 1Q9YA 4OGEA 2E20A 2DPNA 2RF2A 4H0VB 1HNXK 1NKCA 4CJTA 3M8SA 1JXBA 2P9SB 4GKJK 2CGKA 4YHHK 2ZF5O 3TANA 3CJCA 1VSFA 1RT4A 2GUPA 4KH6A 3THYA 3L8BA 2OZSA 3V81A 3O9TA 3QESA 4XEIA 3WEEA 1QQNA 1QQCA 4AHVA 3MEDA 3C6HA 5C2DA 3SUNA 3KK7A 1JCEA 1D9FA 3ZLJA 3AVKA 3JSMA 3MWPA 3O1WA 1NK9A 3I33A 3VTHA 3HI0A 4IDHA 5HOOA 3OYKA 1LWCA 3BZKA 4CJQA 3U3GA 3LAKA 1WLJA 3O80A 1ESVA 4NCBA 3ENOA 3CXCM 2O4GA 4Z94A 4X64K 2GEMA 3ZSRA 5FLXO 3T1HK 1S1TA 3NH0A 1IBLK 5KRSA 2OPSA 3NVMA 2P9LA 3AVJA 3QB0A 1JLGA 3VQBA 3CHWA 3DI6A 3MN5A 1NGEA 4CZEA 3QMLA 1VSEA 3K5OA 1NG9A 2OTLN 2V52B 4CHPA 3HOSA 1GLCG 4LY7A 3IKMA 1TAQA 3K2PA 4LH5A 4ZTJA 5CR4A 4L3QA 1RILA 3LANA 4BQLA 5AQWA 1YJ9N 1SAZA 3K0SA 3UKUA 1S1VA 4BY9C 2XHBA 1X9SA 4JKCA 1YVNA 4I6MB 4ZTFA 1XI1A 3DYAA 3UKRA 4KHNA 1ATSA 5J2NA 4H5NA 3PV8A 4LH4A 1RBUA 2V7YA 3ENBA 1XUPO 1BL3A 2P9IB 2ZD1A 4DFJA 1C0UA 2HHHK 1TKXA 2QWLA 4BDPA 3ISNC 2OANA 1GLAG 1JLCA 5C25A 3THXA 2D1KA 2CH5A 1BU6O 3EZWA 3VGMA 4B9SA 4J2AA 1RT7A 3SQ0A 1T8EA 3OYLA 4CFBA 1KCFA 5A2QO 4RCHA 2O4IA 3AA3A 5K14A 2F8TA 1BA1A 2ITGA 3RSEB 4AHSA 1UOCA 3DRRA 1CZBA 2FLOA 4GNIA 2JWKA 2HF4A 4CECA 2QWOA 3MX5A 5GAGP 3FZHA 4E3SA 3B6PA 3VEZA 4HUEA 3O9UA 2QK9A 5ELZA 1K8AO 2F9WA 2F96A 3ZX3A 1K73O 5C42A 3M3ZA 4EHUA 5M1OA 3W0LA 1B92A 2HHUA 1RBVA 4CJ5A 2Z1HA 4DSJA 4L8RB 2YI1A 1WAJA 2IVNA 4YFUA 3J8AA 3LPTA 3IDHA 3OS2A 2P9NA 1JXEA 1SL0A 4DTXA 4BROA 1U2VA 4CF9A 1FXXA 1D4XA 5H1SQ 2O8FB 4ISFA 2Y1JA 1NOZA 3MWTA 1QZ5A 3LP0A 4DMNA 1NJXA 2J4RA 2ZJQL 3I56N 5AQLA 4JKHA 1VQLN 2X74A 4C8KA 1Z26A 3B8AX 2WTUA 3NF7A 5CZ1A 3LPUA 4DLGA 4A5AA 4WQ5A 4MFBA 1T03A 3NAEA 5J2MA 3ZX2A 3P5JA 4KI6A 2CGLA 3J81O 1EO1A 4KFBA 3J80O 3D0PA 4BG8A 2P5OA 4PQUA 3G25A 3C6TA 1HYZA 2YHAA 3L2UA 2GV9A 4BRDA 4FWKA 4JHDA 4K8ZA 4CGDA 4AHTA 4FVUA 4E7KA 2HHTA 3CCUN 1VQ5N 3MDQA 3OY9A 3K5NA 4JKFA 4IXCA 1CLQA 4H4MA 3S41A 3S9HA 1JLFA 4YOYA 4BVOA 5B8HA 1KD1O 4Q0BA 3WT0A 5AQFA 3I0SA 3VOVA 4KHUA 2O8BB 1FKOA 4KBOA 3CC7N 4PKHA 3G10A 5FDLA 3PIPL 2WUSA 1G15A 1Z05A 4PL7A 3U9ZA 3A8YA 2FXUA 2P9PB 1W7AA 3AAPA 3CETA 4V19S 4R5PA 3AVFA 1YTAA 1RDWX 1YVUA 1EX4A 3LL3A 2RN2A 1GLBG 1QTMA 3CJBA 3IS9A 5E41A 2A3ZA 2VQFK 3TSPA 1HNWK 1FK9A 4LF6K 3OYFA 4FPBA 3LAMA 4C23A 3AVIA 2FF3B 2ETJA 4F2RA 1IG9A 2FF6A 3HM9A 3ALYA 3H6EA 3OS0A 3SUPA 1OH5A 5ADXH 4DTOA 4C8MA 4C8LA 4E0DA 3DLBA 4CZLA 1N6QA 3VTIA 2QTDA 3CMAN 3ZT3A 3ZT4A 1BCOA 4WQ5C 3LDQA 4JKGA 2F8SA 1S9EA 4B8CA 3OBWA 1IKYA 2W41A 4IG3A 4RW4A 4KPYA 1YXQA 2AP1A 3NHGA 2P1JA 1K6YA 1NLVA 5BRFA 5M1FA 3OYHA 4OO1J 4J2BA 2KFNA 3AGKA 5BREA 4IOAL 3LDSA 4H0PA 3J7YP 3IRXA 4BVPA 3CYMA 3VQAA 3AVLA 2ZJPL 2WOMA 5JS2A 1RBRA 3KD1E 3CFOA 1A5VA 1W0HA 3SUQA 1C6VA 2KHOA 3D7EO 4AHRA 5LJVA 4LC9B 4CEDA 4IKFA 2ATQA 4YDUA 4FJLA 3IFRA 1EWQA 5AQXA 3NGYA 1UA1A 5FPMA 4JI2K 5AZJB 4WF9L 5BR9A 4MQ3A 5SZTA 4DV1K 2YV0X 4OGCA 4G9ZA 3FZMA 3PX4A 1VSLA 4ELTA 3SMPA 4WQ4A 5AQMA 3P83D 4LFBK 2HW3A 3VEYA 1NK5A 3THYB 1FW6A 1WSFA 1KQSM 3PSIA 4BG9A 5HLFA 3WEEB 4Y1CA 4I6MA 1J53A 4QAGA 1SKSA 3D45A 3L2QA 2OPQA 5BRHA 1WSHA 1VQON 1SKWA 5KPZA 1WB9A 2HBJA 2IVOA 2P9IA 2WBNA 3PUFA 4O8UA 3V9XA 4CZKA 3TAEA 1U48A 2VWBA 3DXMA 1RT2A 1S5JA 3NF9A 3TAQA 3G6EN 1KVBA 4BR7A 1ZXOA 2CGJA 4JRQA 1VQ9N 4E7IA 1SL2A 5HBMA 3OTOK 3RSEA 3DOLA 3TAFA 5AQZA 4FWPA 3VF6A 3V6DA 1BQNA 3ZEUA 1RCHA 5GADP 5IWAK 4E7HA 1ZBSA 3DOKA 4OPKA 4B9MA 5AQVA 3D2EA 4O0IA 4Y1DA 3R8EA 3NF8A 2HSTA 3ULEB 2JLEA 4H4OA 2EHGA 4PKIA 1MWKA 4YDUC 4B1XB 3F2KA 3C65A 3UKUB 5HRPA 3J7AP 1OVYA 4CJWA 4JKBA 4DKWA 3QNOA 2G8VA 5D3GA 4M3TA 3ATVA 2HVIA 4F8RA 5M1KA 1JCGA 3LDNA 5GIOA 5LL6Z 4DTMA 5HRSA 4M3UA 2QEXN 3NGZA 4JD2B 4WFBL 3SQ4A 3E01A 2OCEA 3H1VX 2GWKA 3RMAA 4H0TB 3BGRA 4CHYA 3HL8A 4FLWA 3NFAA 3OYAA 1SL1A 2O8FA 3PO5A 1T44A 2Y1IA 1SKRA 5CZ2A 1ILYA 1VQNN 4CJKA 4OLBA 2W6LA 4CFCA 1HX1A 1CXQA 1IKVA 1YT3A 4ISGA 3MK6A 2G8WA 3O8MA 1DLOA 5C0YA 3AA5X 2E8AA 4CHOA 3K9KA 3U9DA 5CY4A 2Z1IA 3AVCA 4DU4A 3TARA 3T1AA 4M63C 2HOEA 4M3WA 3O4NA 4I9LA 3CJ7A 1YJWN 4PY5A 3H08A 3B6OA 3FR0A 4DB3A 5LMUK 3CJ1A 3TSQA 4DV6K 3S3NA 1VK0A 1W9HA 4J2EA 3NH1A 3SV3A 2G8HA 2E2NA 5HP1A 5C10A 4CFDA 2YJFA 1U2VB 3KZBA 4C1NI 1TL1A 3QFUA 4IEEA 1WBDA 4A59A 3WNHA 2VG5A 1KRPA 5E84A 1D9DA 1UAXA 1IBKK 4E1MA 3WXMB 2LSNA 3CJAA 1YJNN 1IKWA 2P9PA 4M45A 1YUWA 2DFFA 1REVA 2NRTA 1BWFO 2IDOA 2KTQA 3CCLN 1HKGA 2YHBA 4Z4HA 1HYSA 4IG0A 5EVZA 1FKPA 2UU9K 4U7BA 1Q18A 4KTWA 4CF8A 4OKJA 3NGIA 4O4GA 3SLCA 1TUUA 1GOCA 4FJMA 2YHYA 2P9UB 1EXQA 1BUPA 3OS1A 4IBNA 2BANA 2F7TA 3KWGA 1SV5A 3H1QA 5I3UA 3D2FB 2E1YA 2RE2A 4H0XB 1EP4A 4BRNA 3KLFA 4JHDB 1NU0A 3FE1A 5AQRA 1BIZA 3M5RA 3QINA 2Q0RA 4KI4A 5GIPA 1Z6RA 3P1GA 3KK2A 5AQPA 5KRTA 1J9AA 3MX2A 1VHXA 4CBWA 4E7LA 3O6WA 4UQGA 4E7JA 2A40A 1B9DA 1XC3A 4KHPK 2GTDA 4GY2B 2G8FA 4JI5K 4DQSA 4B1ZA 4DFMA 5EOYA 4IJAA 5AR0A 1QSLA 5AFUH 1IBMK 1LAVA 3CJ9A 3TAPA 2XY8A 2YJEA 2VWJA 3AVMA 4OKEA 3L6QA 1C0FA 1NKBA 3SBGA 3CCMN 2IVPA 4H03B 1J5OA 3THVA 4DCHA 4PHTX 3O4WA 3PSFA 1K8KA 4O44A 1S1WA 3QEXA 3WQTA 3NVKA 3ZT2A 3GG4A 4CHZA 4F3OA 4ILHA 4W5NA 3ASMA 2UUAK 5FPEA 4HUGA 4O8KA 2PYJA 5JICA 3HPHA 3ID6A 1C0GA 1HQUA 4BRMA 3P4IA 2QWMA 4JKGB 3C95A 1XWLA 3E9LA 4FO0A 3LM2A 4ZHRA 3T1YK 3EY1A 3MCAB 4B3SK 1NOYA 4JI7K 3VGLA 3EEQA 4BWMA 4FJXA 4CERA 5AQQA 4FWNA 1ZBHA 3TWHA 1J54A 3CQYA 4B08A 1KC8O 3C94A 2KLAA 2JWLA 3GL1A 3SQ1A 4A2BA 2V7ZA 3NBPA 4FSVA 3OA9A 4KHQA 2X6SA 3AA2A 1BHLA 4DV0K 2NRRA 4NXMK 2GWJA 5JLHA 2BH1A 4ISEA 3VQ4A 4B1VA 3VA3A 3O4QA 1RBSA 3HP6A 1VSJA 1CZ9A 4DS4A 3PO4A 1I39A 3MXJA 4K41A 1KXPA 4ELVA 5J2QA 3PLAA 4A62A 1JL2A 3BDPA 5LMNK 4FJ8A 4CIFA 1HNIA 2BDPA 1EETA 3TTCA 3ZSXA 4Q5VA 4DWIA 3H45C 3ULEA 1S1XA 1XNRK 1VSMA 3WNEA 5AQKA 2NRZA 1NGDA 4C8NA 3A5LC 4LSNA 4DG1A 3PY8A 5BN9A 2EWSA 1V4TA 4WFAL 3KD5E 3MMVA 3BZCA 3NCIA 4KHWA 2Q97A 3MECA 2A41A 4WCEL 4JD2A 4CK1A 1JJ2M 3OYIA 5TKWA 5FPDA 1TK8A 1KVCA 4OLAA 3DXMB 1Q9XA 5F0XA 3AO1A 4N76A 4CZJA 3KKRA 2B6AA 5T7BA 1RGIA 4RG8A 3L2RA 1LW0A 4CZGA 2P9KA 2NNWA 4BR4A 3ZEUB 2WC9A 1WSGA 5AQTA 4FWQA 1I3AA 3PIOL 3L4QA 3MXIA 4CJ3A 3THWA 3CCRN 5AQJA 3D2EB 4CJRA 4BE0A 2IIRA 4H5RA 4H5TA 4B1YB 3CCSN 1FJGK 3VQ5A 4QS9A 3ENHA 2QWNA 2G8UA 4FCYA 1QE1A 4FW2A 4A57A 4FK4A 3QERA 1ASVA 2KZMA 3IG1A 3UB5A 4ICLA 1NGCA 4IOCL 3ZT1A 4YORA 3VQQA 2JGUA 4DSIA 4OX9K 2HF3A 2FSJA 3DXKA 1U49A 2VGNA 4UY8O 4XIUA 1VSIA 3HOTA 4CF0A 5TKYA 1VSKA 3KIOA 4KHYA 3ZSZA 1RDUA 1E4GT 4EZ9A 3EYZA 1GOBA 2VGMA 3H3OB 2XRIA 1F21A 4CJFA 4FZZA 2E6MA 5BPNA 4AF1A 3OYBA 4IWVA 3U4LA 4BC4A 3V9WA 4B9TA 4CZIA 1RTIA 5AQOA 2E1ZA 3NMUA 4FJNA 5E26A 2P9UA 4CVNE 3V1OA 4DHYA 4FL9A 3D2FA 5CYQA 3R1XA 4FOEA 1SQKA 3AGRA 3LP1A 2W40A 1RDAA 1XMQK 3DLLL 1BOTO 2OA8A 2QM1A 4DTNA 4PA1A 2P5GA 4CGFA 1L3VA 3CCQN 3EZ5A 2RKIA 4LSLA 1R0AA 1HJOA 1HUXA 3DJCA 4AHCA 4N5SA 2F4VK 1MDUB 1TK5A 5AQUA 5C12A 4KKOA 1VRUA 2IAJA 3IMXA 1LOTB 4CGJA 2GUIA 3L3UA 1S3XA 4CW7B 4BR9A 3NE6A 4BDZA 3S3MA 1OH8A 5M1PA 3F5TA 1X9MA 4NYNA 1M90O 2YHWA 3CPEA 1Q8IA 2HMPA 5HL7L 3DWLA 3HZ6A 4W5TA 3QIPA 3O3GA 4DR2K 3DAWA 4DQIA 4DSFA 3GOIA 3LM9A 4CJEA 5M1QA 4KHSA 1E3MA 4CIEA 3DMJA 3M1FA 1L5UA 2NRWA 3VETA 4CHQA 3SK3A 2O8DA 4KB1A 1EWRA 2G8IA 5LY3A 4G1QA 4CJ7A 4FJ5A 2X6NA 4XH1A 1XQSC 5FROA 1Q81O 5J1EA 4CJPA 4MDBA 3BP8A 5KPTA 1A5XA 4ID5A 5JS1A 1HNZK 4MLEA 4B3RK 4E19A 4MDAA 3TAGA 4MLHA 1RBTA 4AILC 4CBXA 3WNGA 3QEIA 3P39A 5EY4A 2B4JA 2YNFA 4KTQA 3OJSA 1L3TA 1SUQA 1Q86O 3U6FA 2HVHA 2QW9A 1VQ6N 4JKAA 2VQEK 1QSSA 1K8KB 4HUFA 4JK7A 2W6KA 4HTUA 1LW2A 2XY5A 5HRRA 1QHAA 4BACA 4E89A 2YCHA 3QEWA 2YHXA 3MN9A 4LD0A 4CEOA 3VERA 4GMJB 2A1RA 5DMRA 3A0IX 3SI6A 4FJGA 5MLCQ 4Z4IA 3PX0A 4FPAA 5LJWA 4B1WB 2I5JA 1ASUA 3LWMA 3VPZA 1NK0A 2O8CA 1WNSA 3LALA 4M3YA 3QEVA 4HHTA 4DLEA 2UUCK 4MO4A 4O0JA 1UA0A 2PY5A 3QICA 3UIQA 1VQPN 2CH6A 2HBKA 4TSXA 3AAQA 3CPWM 4CK3A 3CQXA 2Q0UA 4Z0UA 4F3TA 3AVAA 4JYAK 4KO0A 3O9SA 3SAGA 4JV5K 2D0CA 3ZYYX 4CBUA 4R79A 4F4KA 3RVCA 4AHUA 4BR5A 3AO4A 2OPPA 2QA4N 1EQYA 1KTQA 3OBYA 4CE9A 4DTPA 3ULDA 2NRVA 3QBXA 2UUBK 3VMFB 3G0ZA 4DS5A 3AVHA 1X3MA 1TYQB 3O1BA 3G71N 3CFPA 3LDPA 4GKKK 4XH5A 4N41A 4DU1A 3KK3A 1J6ZA 3EKUA 4IOXA 4H5VA 4BRQA 4PL8A 3VQ6A 4YOUA 2NUBA 4BRPA 3VQPA 3HVRA 3E9PA 4DTUA 3S3OA 4FWRA 2QWPA 3NDKA 4CJSA 4I9QA 4B9LA 1DGKN 1CZAN 4EAHD 4CEQA 2DY4A 4IFYA 1YTUA 3M8PA 1VRTA 2QKBA 5FRNA 1TUYA 1HNVA 5J2PA 1JLQA 5CHIA 3F9KA 2HMIA 1QQMA 4K0KK 4JI8K 4DR6K 2Q1NA 4GVMA 3SV4A 3CFRA 3HM8A 1NKEA 2E5LK 1ZBUA 4DR4K 4A5BA 1RDDA 3RR7A 1Q7YO 2P9KB 3L0QA 3HSTB 4C1NK 3AVNA 1EKEA 4JS5A 4IDKA 4DSEA 4M3ZA 3THWB 3AVGA 3ZCMA 3U8XA 2HNYA 2PBDA 3OYJA 1CXUA 1YI2N 4JN4A 4H0OA 4DF8A 3VQ8A 3KLHA 4CEZA 4OPJA 1LAWA 4FK2A 2KW4A 4DUYK 4BRHA 3DRPA 3D6RA 4NO7A 3DLHA 3K5LA 2E6LA 3GE1A 4CI6A 3JAMO 1TKZA 1WN7A 4JI6K 3I8BA 1WSEA
chains in the Genus database with same CATH topology
4LFAK 1XMOK 4DV0K 4NXNK 3J7AP 4NXMK 1J5EK 4DR1K 3J7YP 4DUZK 4OX9K 2UUBK 1N36K 3J81O 2ZM6K 5LL6Z 4DR5K 3J80O 4GKKK 5BR8K 4X65K 4DV4K 4LF4K 2UXBK 1HNZK 4LF7K 4B3RK 4JI2K 5LMNK 4DV5K 4DV1K 4DV7K 2HHHK 4KHPK 4B3MK 4JI5K 1XNRK 1IBMK 4JI0K 2VQEK 5A2QO 1HNXK 4DR7K 4CVNE 4DV3K 4LFBK 4GKJK 4X62K 4K0KK 4JI8K 4DR6K 4V19S 4YHHK 4X66K 1XMQK 5LMUK 2E5LK 2VQFK 4DR4K 4DV6K 1HR0K 4JI4K 4B3TK 1HNWK 4LF6K 5IT9O 4DV2K 2UUAK 2F4VK 1XNQK 4JI3K 5AJ3K 1N33K 4CW7B 2UUCK 1I94K 4LF5K 4YY3K 3T1YK 4JI1K 2UXDK 4LFCK 1IBKK 3OTOK 4B3SK 2UXCK 4X64K 3T1HK 5FLXO 4JI7K 4DUYK 1FJGK 1N34K 1IBLK 4JYAK 5IWAK 4AQYK 4JV5K 4LF8K 3JAMO 1N32K 4LF9K 4JI6K 4DR2K 4DR3K 2UU9K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LFA K;  1XMO K;  4DV0 K;  4NXN K;  3J7A P;  4NXM K;  1J5E K;  4DR1 K;  3J7Y P;  4DUZ K;  4OX9 K;  2UUB K;  1N36 K;  3J81 O;  2ZM6 K;  5LL6 Z;  4DR5 K;  3J80 O;  4GKK K;  5BR8 K;  4X65 K;  4DV4 K;  4LF4 K;  2UXB K;  1HNZ K;  4LF7 K;  4B3R K;  4JI2 K;  5LMN K;  4DV5 K;  4DV1 K;  4DV7 K;  2HHH K;  4KHP K;  4B3M K;  4JI5 K;  1XNR K;  1IBM K;  4JI0 K;  2VQE K;  5A2Q O;  1HNX K;  4DR7 K;  4CVN E;  4DV3 K;  4LFB K;  4GKJ K;  4X62 K;  4K0K K;  4JI8 K;  4DR6 K;  4V19 S;  4YHH K;  4X66 K;  1XMQ K;  5LMU K;  2E5L K;  2VQF K;  4DR4 K;  4DV6 K;  1HR0 K;  4JI4 K;  4B3T K;  1HNW K;  4LF6 K;  5IT9 O;  4DV2 K;  2UUA K;  2F4V K;  1XNQ K;  4JI3 K;  5AJ3 K;  1N33 K;  4CW7 B;  2UUC K;  1I94 K;  4LF5 K;  4YY3 K;  3T1Y K;  4JI1 K;  2UXD K;  4LFC K;  1IBK K;  3OTO K;  4B3S K;  2UXC K;  4X64 K;  3T1H K;  5FLX O;  4JI7 K;  4DUY K;  1FJG K;  1N34 K;  1IBL K;  4JYA K;  5IWA K;  4AQY K;  4JV5 K;  4LF8 K;  3JAM O;  1N32 K;  4LF9 K;  4JI6 K;  4DR2 K;  4DR3 K;  2UU9 K; 
#chains in the Genus database with same CATH topology
 3V1Q A;  3HK2 A;  1DKG D;  4W5O A;  3DXK B;  3QO9 A;  1KFD A;  3TAB A;  3ZT0 A;  3VEV A;  5JMV A;  4Z4G A;  1J5E K;  3JXU A;  3BUZ B;  3KLG A;  1L3S A;  4Y0W A;  3TR8 A;  1KAX A;  1RDB A;  4PUO A;  1TL3 A;  3WXJ A;  3SPZ A;  2XY7 A;  3R6M A;  4DV4 K;  2R7Y A;  2UXB K;  2W42 A;  1ZYQ A;  3C6U A;  3RMD A;  4EFH A;  3MAQ A;  3TSU A;  4Z4E A;  4FXD A;  4NLC A;  4YOW A;  3RWU A;  3FFK B;  1LV5 A;  4B3M K;  3QBW A;  4N47 A;  4RWT A;  1Y64 A;  5SWM A;  3RRH A;  4JI0 K;  4KTZ A;  4DR7 K;  5JVH L;  5HRO A;  1WBB A;  3VA0 A;  3AAR A;  4EIA A;  4DQQ A;  1NGJ A;  4GV6 A;  3CM6 A;  2XY6 A;  3IUC A;  2A42 A;  4IFE A;  4CZF A;  5AQY A;  5C2F A;  2HHW A;  3AO3 A;  1NMN A;  4WE1 A;  3QDK A;  3MXM A;  5AZI B;  5F1X A;  2O8E B;  3V9Z A;  4B3O A;  3KLI A;  4RW9 A;  1KAZ A;  2PZS A;  1HYV A;  5IT9 O;  2KZZ A;  3K9J A;  3HXM A;  1GOA A;  4FWL A;  4B9U A;  1ITG A;  4K42 A;  4CF1 A;  5AJ3 K;  4IO9 L;  4WFN L;  1HPZ A;  2PAV A;  4HTL A;  3K5M A;  4YY3 K;  1X3N A;  4ID1 A;  3AO2 A;  4QOZ B;  1KSP A;  2KKZ A;  3V1R A;  4CJU A;  3M8Q A;  4CEE A;  3M8R A;  1KVA A;  1N32 K;  5EU7 A;  3ZSV A;  4CD3 A;  3OJU A;  4JEP A;  1DEJ A;  1HMV A;  2O8D B;  3N4P A;  4LFA K;  1GLE G;  2UYT A;  4MO5 A;  2V51 B;  4RW6 A;  5KQ8 A;  2WON A;  3DLK A;  2G8K A;  2Q2R A;  1VQK N;  2FBT A;  4XH4 A;  3SPY A;  1K9M O;  1JLA A;  3U3Y A;  3BY5 A;  3HPO A;  2FSN A;  2OPR A;  5AQG A;  3SQ2 A;  4HCC A;  5BRD A;  1N8R O;  1NGH A;  1U45 A;  1B9F A;  3HYF A;  3SAH A;  4H0Y B;  2GX9 A;  3V9S A;  1OH6 A;  2HBM A;  3HRG A;  3Q7B A;  1NWK A;  2FBX A;  4EHT A;  4DV5 K;  4DFK A;  3VF4 A;  1GLL O;  3I0R A;  3EN9 A;  3NF6 A;  2HHS A;  4B9Q A;  5GAH P;  1IH7 A;  4QS7 A;  1IO2 A;  3RR8 A;  1H1V A;  3MN6 A;  2VYP A;  1C1B A;  1RTD A;  1RTJ A;  3CCV N;  4FWM A;  5FRM A;  1Z25 A;  3J7Z O;  4KB0 A;  4CZH A;  4H8K A;  1TYQ A;  3AV9 A;  3E1Y A;  4BR0 A;  4YNQ A;  5AQS A;  1T3V A;  3Q7C A;  3JYT A;  2O8C B;  3OW2 M;  3EKS A;  1NGI A;  4N56 A;  4K25 A;  1WSJ A;  4JI4 K;  4O5F A;  3P38 A;  1MWM A;  5BPL A;  3LDO A;  3ZET B;  4B1U B;  1LWF A;  3DLR A;  3KVG A;  3HO1 A;  3KKS A;  3LDL A;  3ZX0 A;  4CIG A;  2QXL A;  1OVQ A;  1U47 A;  4PWD A;  1G99 A;  3CCJ N;  2D4W A;  4K8X A;  1I94 K;  2FSK A;  1XHZ A;  2YKN A;  2VG7 A;  4I2P A;  5C15 A;  3TAM A;  1L3U A;  4FOI A;  3BF3 A;  4J8F A;  5ADX A;  1X9J A;  4BE1 A;  3SBT A;  4LF9 K;  4H5W A;  4FJH A;  2ASP A;  5KI6 A;  1ZC6 A;  2IGI A;  2AA4 A;  1XMO K;  3E9O A;  4NXN K;  4NCA A;  3IAY A;  3OYC A;  4DUZ K;  1RDC A;  1IKX A;  1YAG A;  3WXK A;  2X78 A;  3BF1 A;  2QKK A;  4NCG A;  4IZ9 A;  2OYQ A;  4X65 K;  3CF5 L;  3CD6 N;  1DT9 A;  3C7N B;  4J2D A;  2HB5 A;  4FLU A;  3CCE N;  5GIN A;  3AA4 A;  1RFQ A;  3V4I A;  1P8Z A;  3CI5 A;  3EE8 A;  3KLE A;  4F2S A;  3CM5 A;  4BDY A;  3JS6 A;  5GAE P;  3OYG A;  3QIO A;  2I7N A;  4DU3 A;  3OYM A;  2QXF A;  2ZGY A;  3ZSQ A;  3K58 A;  3OYE A;  1P90 A;  5BN8 A;  5DM7 L;  2E2Q A;  3HBT A;  4FK0 A;  3ATU A;  3WXL A;  4FW1 A;  4CJV A;  2Q31 A;  1S9G A;  1D5A A;  1BI4 B;  2ZGZ A;  2ASM A;  5F2R A;  3SMS A;  4F9O A;  1NK7 A;  1JLE A;  1KLM A;  4W5R A;  5KGX A;  3TU5 A;  4HVJ A;  1OKJ A;  4CF2 A;  2I7P A;  2E88 A;  3KHY A;  5JLF A;  1S6Q A;  4DFP A;  2GEL A;  4CFA A;  4BR2 A;  4W5Q A;  4EP5 A;  3VEO A;  2DFE A;  3SJH A;  3K59 A;  2UXC K;  3SCX A;  1T05 A;  2QWR A;  4DTJ A;  1VSH A;  1N5Y A;  1VQ8 N;  3K57 A;  3VQD A;  5AZI A;  1NJI O;  2NRH A;  4AH9 A;  2O8E A;  4Z4C A;  4GV9 A;  4U67 L;  2RHK A;  1RNH A;  4NYF A;  1Y97 A;  1TKT A;  2NZT A;  1S22 A;  4JK8 A;  5AQI A;  2ITM A;  4RW7 A;  2FBV A;  2YNI A;  3WUH A;  4KAZ A;  3O3H A;  1U04 A;  3CC4 N;  3CG7 A;  4FM2 A;  3HTV A;  2HHQ A;  4RW8 A;  1D8Y A;  4BE2 A;  4O5B A;  5BR8 K;  3VQE A;  2D0B A;  5HRN A;  3TPQ A;  4JKD A;  1C0T A;  1WUA A;  1ATR A;  3DM2 A;  1SS6 A;  4OVL A;  4FLY A;  4BRE A;  4DF4 A;  1HRH A;  4DV7 K;  3PX6 A;  2HNZ A;  5FPN A;  1T6D A;  3EL2 A;  2Z1J A;  4AM7 A;  3O3F A;  4BRA A;  4OKK A;  2ZJR L;  5AQN A;  1M1K O;  3TTD A;  4GVE A;  3L2V A;  2XO7 A;  1NMD A;  1ZBF A;  3RTV A;  4C8O A;  4K43 A;  1C0M A;  4BQZ A;  3SYZ A;  2PYL A;  1XC9 A;  4FZY A;  3ZSO A;  3NH2 A;  4FM1 A;  3VF2 A;  4RTF D;  1VQM N;  3KJV A;  1UWB A;  1NGF A;  2P9S A;  1HR0 K;  3OVN A;  5C24 A;  4A61 A;  3MCP A;  5M1N A;  4DTS A;  2HND A;  3LWL A;  1JKH A;  3QET A;  4DV2 K;  3SNN A;  3QLH A;  3FGU A;  3CME N;  1RT3 A;  1BA0 A;  1WOQ A;  4NLB A;  4FLZ A;  1TKD A;  3W3D A;  4YOV A;  3CC2 N;  5JVG L;  4JI3 K;  3FZK A;  5I42 A;  4JKE A;  4EZ6 A;  5DK5 A;  1NK6 A;  4LF5 K;  2ASO A;  3LZI A;  2DFH A;  4JI1 K;  3H3N O;  1VAZ A;  4BC3 A;  3M6G A;  1RT1 A;  2BGG A;  4CEA A;  4JS4 A;  4CHN A;  4FJJ A;  4BRL A;  4OPH A;  4FLV A;  3HP9 A;  1VSD A;  3DLE A;  1U6Z A;  1BDG A;  4ILJ A;  2BUP A;  3AO5 A;  1QQO A;  4DR3 K;  1XHX A;  3FZL A;  3ZET A;  5EXW A;  4CCH A;  2A6A A;  3OHR A;  4DR1 K;  4FJ9 A;  3HT3 A;  2QI2 A;  3MEG A;  1X1P A;  1TV6 A;  4EP4 A;  2D0P A;  2WFB A;  4O55 A;  3VN5 A;  4KRE A;  1V4S A;  1SZ2 A;  3ZSW A;  3FFI A;  4DR5 K;  4CJ4 A;  3L4I A;  3F9M A;  4B8A B;  1S6P A;  2A5X A;  1HJR A;  3L2W A;  4LF4 K;  5CYM A;  3T3F A;  4QS8 A;  4GW6 A;  4NB4 A;  1DTT A;  1T7P A;  3UE5 A;  3C6A A;  3DRS A;  2HBL A;  3VQ7 A;  3EE9 A;  3CER A;  2YNG A;  3HSC A;  1LCU A;  1TVR A;  2BE2 A;  3LP2 A;  1ZBL A;  1RT6 A;  4ELU A;  1IV0 A;  4FZX C;  4IEI A;  4BRI A;  5KTQ A;  2HHX A;  4A2A A;  1BIU A;  2IS3 A;  1NK8 A;  4WYB A;  1VQ7 N;  3O08 A;  3SUO A;  1ZBI A;  1O13 A;  5I9E B;  4M3X A;  2P9L B;  4X66 K;  1GLJ O;  1HPM A;  4B9V A;  3FZF A;  2GBZ A;  5AFU A;  3WNF A;  1C1C A;  4IO8 A;  1BIS A;  1DTQ A;  3CIP A;  3HJF A;  3AVB A;  3C7N A;  5KQD A;  4OJR A;  1RT5 A;  1HKC A;  4YOX A;  2FC0 A;  2NRX A;  3LP3 A;  4CD1 A;  1XNQ K;  1WSI A;  1A5W A;  3I8D A;  3GBT A;  1W2B M;  4KH5 A;  2H3G X;  1TGO A;  1W97 L;  3R9P A;  1MU2 A;  3QNN A;  1N33 K;  1KAY A;  3UKR B;  1S1U A;  3VQC A;  3L3V A;  3O9R A;  3AY9 A;  1QS4 A;  1HKB A;  3CQ8 A;  1BI4 A;  1WAF A;  4CGG A;  4FVM A;  1N34 K;  1BQM A;  1NGB A;  2P51 A;  3VEW A;  1JCF A;  4WQ4 C;  4AQY K;  1NGA A;  4FLT A;  4LF8 K;  1VQ4 N;  5BPM A;  1YF5 L;  2NLX A;  2IC3 A;  3THX B;  3QEP A;  1QZ6 A;  3A2F A;  4HCB A;  2YKM A;  4E1J A;  4DSK A;  3KK1 A;  1O1W A;  1NK4 A;  3T7Z A;  3ZSY A;  4BRF A;  1NJW A;  2KFZ A;  3O5B A;  3C0B A;  5EX5 A;  1T6C A;  3TTF A;  3V9U A;  1NNE A;  3OYD A;  3WQU A;  1YIT N;  1N36 K;  3QFP A;  3SJJ A;  1HQE A;  4FJK A;  3HVT A;  1S72 N;  4GV3 A;  3RMB A;  1C1A A;  3DLG A;  1X9W A;  1QVF M;  3KTQ A;  2OTJ N;  2VWK A;  4DTR A;  3T69 A;  3A5O C;  3SZ2 A;  1YHQ N;  4LF7 K;  1JLB A;  4CGH A;  2KQ2 A;  4FJI A;  3GDQ A;  3VGK A;  3SAF A;  4JK9 A;  4KV8 A;  4M7X A;  3MEE A;  4CEB A;  2DTU A;  1YIJ N;  4Z4F A;  4YOT A;  5KPR A;  4FJ7 A;  2P9N B;  4AM6 A;  4DV3 K;  2F9T A;  2PFU A;  3HPG A;  1U4B A;  4JNE A;  4X62 K;  2IOC A;  1BGX T;  2Z1G A;  5CE3 A;  3RRG A;  2O8B A;  2Q36 A;  3VEN A;  1NJY A;  4I7F A;  3ITH A;  3RMC A;  3O9Q A;  1NGG A;  4I2Q A;  1NBW A;  1NM1 A;  4BRC A;  4DSL A;  1QSY A;  1RTH A;  4B3T K;  1BCM A;  1OH7 A;  4M7Y A;  4DQP A;  2RPI A;  3A5M C;  1JL1 A;  4QCL A;  1NJZ A;  1R59 O;  4HWI A;  2ZE2 A;  1IG8 A;  4IFV A;  4FWS A;  3FLC O;  1IJJ A;  2EX3 A;  3ID8 A;  3P31 A;  4JLH A;  3E66 A;  3N4Q A;  1TAU A;  1BO5 O;  4FLX A;  2HHV A;  4BRK A;  2E2O A;  2UXD K;  1GLF O;  4LFC K;  2YX6 A;  3EO3 A;  3H46 O;  1GLD G;  2E2P A;  4KH4 A;  4BRG A;  1KLN A;  2D5R A;  2AJQ A;  1LWE A;  4FWO A;  1QVG M;  5AQH A;  3T19 A;  4FYD A;  3VEX A;  3A5N C;  3KWI A;  3OYN A;  4E1N A;  4JAX A;  2ZWH A;  4BGB A;  3R3L A;  4JRP A;  3BEX A;  2BTF A;  4ILG B;  4FM0 A;  2YNH A;  4BWJ A;  1Q82 O;  4OPA A;  2OZM A;  1MA9 B;  1E4F T;  4DQ8 A;  4CEF A;  4DQR A;  2VG6 A;  2E4L A;  1ATN A;  4CJL A;  4BC2 A;  3WXI A;  1QHT A;  4M42 A;  2A1S A;  2ZM6 K;  4CZM A;  2B5J A;  2FBY A;  1BG3 A;  5DM6 L;  4M41 A;  2ZQB A;  4IJN A;  1HLU A;  3I55 N;  2Q3S A;  3LZJ A;  4CGI A;  5KGW A;  3VQ9 A;  2QWQ A;  2D0O A;  4M3R A;  3VES A;  1TK0 A;  4BC5 A;  3MN7 A;  4CES A;  4B9N A;  2VCP A;  1KFS A;  3F73 A;  4KRF A;  3TI0 A;  4PKG A;  2D0A A;  3G4S N;  1ASW A;  4CK2 A;  5AZJ A;  4BGA A;  1Q9Y A;  4OGE A;  2E20 A;  2DPN A;  2RF2 A;  4H0V B;  1HNX K;  1NKC A;  4CJT A;  3M8S A;  1JXB A;  2P9S B;  4GKJ K;  2CGK A;  4YHH K;  2ZF5 O;  3TAN A;  3CJC A;  1VSF A;  1RT4 A;  2GUP A;  4KH6 A;  3THY A;  3L8B A;  2OZS A;  3V81 A;  3O9T A;  3QES A;  4XEI A;  3WEE A;  1QQN A;  1QQC A;  4AHV A;  3MED A;  3C6H A;  5C2D A;  3SUN A;  3KK7 A;  1JCE A;  1D9F A;  3ZLJ A;  3AVK A;  3JSM A;  3MWP A;  3O1W A;  1NK9 A;  3I33 A;  3VTH A;  3HI0 A;  4IDH A;  5HOO A;  3OYK A;  1LWC A;  3BZK A;  4CJQ A;  3U3G A;  3LAK A;  1WLJ A;  3O80 A;  1ESV A;  4NCB A;  3ENO A;  3CXC M;  2O4G A;  4Z94 A;  4X64 K;  2GEM A;  3ZSR A;  5FLX O;  3T1H K;  1S1T A;  3NH0 A;  1IBL K;  5KRS A;  2OPS A;  3NVM A;  2P9L A;  3AVJ A;  3QB0 A;  1JLG A;  3VQB A;  3CHW A;  3DI6 A;  3MN5 A;  1NGE A;  4CZE A;  3QML A;  1VSE A;  3K5O A;  1NG9 A;  2OTL N;  2V52 B;  4CHP A;  3HOS A;  1GLC G;  4LY7 A;  3IKM A;  1TAQ A;  3K2P A;  4LH5 A;  4ZTJ A;  5CR4 A;  4L3Q A;  1RIL A;  3LAN A;  4BQL A;  5AQW A;  1YJ9 N;  1SAZ A;  3K0S A;  3UKU A;  1S1V A;  4BY9 C;  2XHB A;  1X9S A;  4JKC A;  1YVN A;  4I6M B;  4ZTF A;  1XI1 A;  3DYA A;  3UKR A;  4KHN A;  1ATS A;  5J2N A;  4H5N A;  3PV8 A;  4LH4 A;  1RBU A;  2V7Y A;  3ENB A;  1XUP O;  1BL3 A;  2P9I B;  2ZD1 A;  4DFJ A;  1C0U A;  2HHH K;  1TKX A;  2QWL A;  4BDP A;  3ISN C;  2OAN A;  1GLA G;  1JLC A;  5C25 A;  3THX A;  2D1K A;  2CH5 A;  1BU6 O;  3EZW A;  3VGM A;  4B9S A;  4J2A A;  1RT7 A;  3SQ0 A;  1T8E A;  3OYL A;  4CFB A;  1KCF A;  5A2Q O;  4RCH A;  2O4I A;  3AA3 A;  5K14 A;  2F8T A;  1BA1 A;  2ITG A;  3RSE B;  4AHS A;  1UOC A;  3DRR A;  1CZB A;  2FLO A;  4GNI A;  2JWK A;  2HF4 A;  4CEC A;  2QWO A;  3MX5 A;  5GAG P;  3FZH A;  4E3S A;  3B6P A;  3VEZ A;  4HUE A;  3O9U A;  2QK9 A;  5ELZ A;  1K8A O;  2F9W A;  2F96 A;  3ZX3 A;  1K73 O;  5C42 A;  3M3Z A;  4EHU A;  5M1O A;  3W0L A;  1B92 A;  2HHU A;  1RBV A;  4CJ5 A;  2Z1H A;  4DSJ A;  4L8R B;  2YI1 A;  1WAJ A;  2IVN A;  4YFU A;  3J8A A;  3LPT A;  3IDH A;  3OS2 A;  2P9N A;  1JXE A;  1SL0 A;  4DTX A;  4BRO A;  1U2V A;  4CF9 A;  1FXX A;  1D4X A;  5H1S Q;  2O8F B;  4ISF A;  2Y1J A;  1NOZ A;  3MWT A;  1QZ5 A;  3LP0 A;  4DMN A;  1NJX A;  2J4R A;  2ZJQ L;  3I56 N;  5AQL A;  4JKH A;  1VQL N;  2X74 A;  4C8K A;  1Z26 A;  3B8A X;  2WTU A;  3NF7 A;  5CZ1 A;  3LPU A;  4DLG A;  4A5A A;  4WQ5 A;  4MFB A;  1T03 A;  3NAE A;  5J2M A;  3ZX2 A;  3P5J A;  4KI6 A;  2CGL A;  3J81 O;  1EO1 A;  4KFB A;  3J80 O;  3D0P A;  4BG8 A;  2P5O A;  4PQU A;  3G25 A;  3C6T A;  1HYZ A;  2YHA A;  3L2U A;  2GV9 A;  4BRD A;  4FWK A;  4JHD A;  4K8Z A;  4CGD A;  4AHT A;  4FVU A;  4E7K A;  2HHT A;  3CCU N;  1VQ5 N;  3MDQ A;  3OY9 A;  3K5N A;  4JKF A;  4IXC A;  1CLQ A;  4H4M A;  3S41 A;  3S9H A;  1JLF A;  4YOY A;  4BVO A;  5B8H A;  1KD1 O;  4Q0B A;  3WT0 A;  5AQF A;  3I0S A;  3VOV A;  4KHU A;  2O8B B;  1FKO A;  4KBO A;  3CC7 N;  4PKH A;  3G10 A;  5FDL A;  3PIP L;  2WUS A;  1G15 A;  1Z05 A;  4PL7 A;  3U9Z A;  3A8Y A;  2FXU A;  2P9P B;  1W7A A;  3AAP A;  3CET A;  4V19 S;  4R5P A;  3AVF A;  1YTA A;  1RDW X;  1YVU A;  1EX4 A;  3LL3 A;  2RN2 A;  1GLB G;  1QTM A;  3CJB A;  3IS9 A;  5E41 A;  2A3Z A;  2VQF K;  3TSP A;  1HNW K;  1FK9 A;  4LF6 K;  3OYF A;  4FPB A;  3LAM A;  4C23 A;  3AVI A;  2FF3 B;  2ETJ A;  4F2R A;  1IG9 A;  2FF6 A;  3HM9 A;  3ALY A;  3H6E A;  3OS0 A;  3SUP A;  1OH5 A;  5ADX H;  4DTO A;  4C8M A;  4C8L A;  4E0D A;  3DLB A;  4CZL A;  1N6Q A;  3VTI A;  2QTD A;  3CMA N;  3ZT3 A;  3ZT4 A;  1BCO A;  4WQ5 C;  3LDQ A;  4JKG A;  2F8S A;  1S9E A;  4B8C A;  3OBW A;  1IKY A;  2W41 A;  4IG3 A;  4RW4 A;  4KPY A;  1YXQ A;  2AP1 A;  3NHG A;  2P1J A;  1K6Y A;  1NLV A;  5BRF A;  5M1F A;  3OYH A;  4OO1 J;  4J2B A;  2KFN A;  3AGK A;  5BRE A;  4IOA L;  3LDS A;  4H0P A;  3J7Y P;  3IRX A;  4BVP A;  3CYM A;  3VQA A;  3AVL A;  2ZJP L;  2WOM A;  5JS2 A;  1RBR A;  3KD1 E;  3CFO A;  1A5V A;  1W0H A;  3SUQ A;  1C6V A;  2KHO A;  3D7E O;  4AHR A;  5LJV A;  4LC9 B;  4CED A;  4IKF A;  2ATQ A;  4YDU A;  4FJL A;  3IFR A;  1EWQ A;  5AQX A;  3NGY A;  1UA1 A;  5FPM A;  4JI2 K;  5AZJ B;  4WF9 L;  5BR9 A;  4MQ3 A;  5SZT A;  4DV1 K;  2YV0 X;  4OGC A;  4G9Z A;  3FZM A;  3PX4 A;  1VSL A;  4ELT A;  3SMP A;  4WQ4 A;  5AQM A;  3P83 D;  4LFB K;  2HW3 A;  3VEY A;  1NK5 A;  3THY B;  1FW6 A;  1WSF A;  1KQS M;  3PSI A;  4BG9 A;  5HLF A;  3WEE B;  4Y1C A;  4I6M A;  1J53 A;  4QAG A;  1SKS A;  3D45 A;  3L2Q A;  2OPQ A;  5BRH A;  1WSH A;  1VQO N;  1SKW A;  5KPZ A;  1WB9 A;  2HBJ A;  2IVO A;  2P9I A;  2WBN A;  3PUF A;  4O8U A;  3V9X A;  4CZK A;  3TAE A;  1U48 A;  2VWB A;  3DXM A;  1RT2 A;  1S5J A;  3NF9 A;  3TAQ A;  3G6E N;  1KVB A;  4BR7 A;  1ZXO A;  2CGJ A;  4JRQ A;  1VQ9 N;  4E7I A;  1SL2 A;  5HBM A;  3OTO K;  3RSE A;  3DOL A;  3TAF A;  5AQZ A;  4FWP A;  3VF6 A;  3V6D A;  1BQN A;  3ZEU A;  1RCH A;  5GAD P;  5IWA K;  4E7H A;  1ZBS A;  3DOK A;  4OPK A;  4B9M A;  5AQV A;  3D2E A;  4O0I A;  4Y1D A;  3R8E A;  3NF8 A;  2HST A;  3ULE B;  2JLE A;  4H4O A;  2EHG A;  4PKI A;  1MWK A;  4YDU C;  4B1X B;  3F2K A;  3C65 A;  3UKU B;  5HRP A;  3J7A P;  1OVY A;  4CJW A;  4JKB A;  4DKW A;  3QNO A;  2G8V A;  5D3G A;  4M3T A;  3ATV A;  2HVI A;  4F8R A;  5M1K A;  1JCG A;  3LDN A;  5GIO A;  5LL6 Z;  4DTM A;  5HRS A;  4M3U A;  2QEX N;  3NGZ A;  4JD2 B;  4WFB L;  3SQ4 A;  3E01 A;  2OCE A;  3H1V X;  2GWK A;  3RMA A;  4H0T B;  3BGR A;  4CHY A;  3HL8 A;  4FLW A;  3NFA A;  3OYA A;  1SL1 A;  2O8F A;  3PO5 A;  1T44 A;  2Y1I A;  1SKR A;  5CZ2 A;  1ILY A;  1VQN N;  4CJK A;  4OLB A;  2W6L A;  4CFC A;  1HX1 A;  1CXQ A;  1IKV A;  1YT3 A;  4ISG A;  3MK6 A;  2G8W A;  3O8M A;  1DLO A;  5C0Y A;  3AA5 X;  2E8A A;  4CHO A;  3K9K A;  3U9D A;  5CY4 A;  2Z1I A;  3AVC A;  4DU4 A;  3TAR A;  3T1A A;  4M63 C;  2HOE A;  4M3W A;  3O4N A;  4I9L A;  3CJ7 A;  1YJW N;  4PY5 A;  3H08 A;  3B6O A;  3FR0 A;  4DB3 A;  5LMU K;  3CJ1 A;  3TSQ A;  4DV6 K;  3S3N A;  1VK0 A;  1W9H A;  4J2E A;  3NH1 A;  3SV3 A;  2G8H A;  2E2N A;  5HP1 A;  5C10 A;  4CFD A;  2YJF A;  1U2V B;  3KZB A;  4C1N I;  1TL1 A;  3QFU A;  4IEE A;  1WBD A;  4A59 A;  3WNH A;  2VG5 A;  1KRP A;  5E84 A;  1D9D A;  1UAX A;  1IBK K;  4E1M A;  3WXM B;  2LSN A;  3CJA A;  1YJN N;  1IKW A;  2P9P A;  4M45 A;  1YUW A;  2DFF A;  1REV A;  2NRT A;  1BWF O;  2IDO A;  2KTQ A;  3CCL N;  1HKG A;  2YHB A;  4Z4H A;  1HYS A;  4IG0 A;  5EVZ A;  1FKP A;  2UU9 K;  4U7B A;  1Q18 A;  4KTW A;  4CF8 A;  4OKJ A;  3NGI A;  4O4G A;  3SLC A;  1TUU A;  1GOC A;  4FJM A;  2YHY A;  2P9U B;  1EXQ A;  1BUP A;  3OS1 A;  4IBN A;  2BAN A;  2F7T A;  3KWG A;  1SV5 A;  3H1Q A;  5I3U A;  3D2F B;  2E1Y A;  2RE2 A;  4H0X B;  1EP4 A;  4BRN A;  3KLF A;  4JHD B;  1NU0 A;  3FE1 A;  5AQR A;  1BIZ A;  3M5R A;  3QIN A;  2Q0R A;  4KI4 A;  5GIP A;  1Z6R A;  3P1G A;  3KK2 A;  5AQP A;  5KRT A;  1J9A A;  3MX2 A;  1VHX A;  4CBW A;  4E7L A;  3O6W A;  4UQG A;  4E7J A;  2A40 A;  1B9D A;  1XC3 A;  4KHP K;  2GTD A;  4GY2 B;  2G8F A;  4JI5 K;  4DQS A;  4B1Z A;  4DFM A;  5EOY A;  4IJA A;  5AR0 A;  1QSL A;  5AFU H;  1IBM K;  1LAV A;  3CJ9 A;  3TAP A;  2XY8 A;  2YJE A;  2VWJ A;  3AVM A;  4OKE A;  3L6Q A;  1C0F A;  1NKB A;  3SBG A;  3CCM N;  2IVP A;  4H03 B;  1J5O A;  3THV A;  4DCH A;  4PHT X;  3O4W A;  3PSF A;  1K8K A;  4O44 A;  1S1W A;  3QEX A;  3WQT A;  3NVK A;  3ZT2 A;  3GG4 A;  4CHZ A;  4F3O A;  4ILH A;  4W5N A;  3ASM A;  2UUA K;  5FPE A;  4HUG A;  4O8K A;  2PYJ A;  5JIC A;  3HPH A;  3ID6 A;  1C0G A;  1HQU A;  4BRM A;  3P4I A;  2QWM A;  4JKG B;  3C95 A;  1XWL A;  3E9L A;  4FO0 A;  3LM2 A;  4ZHR A;  3T1Y K;  3EY1 A;  3MCA B;  4B3S K;  1NOY A;  4JI7 K;  3VGL A;  3EEQ A;  4BWM A;  4FJX A;  4CER A;  5AQQ A;  4FWN A;  1ZBH A;  3TWH A;  1J54 A;  3CQY A;  4B08 A;  1KC8 O;  3C94 A;  2KLA A;  2JWL A;  3GL1 A;  3SQ1 A;  4A2B A;  2V7Z A;  3NBP A;  4FSV A;  3OA9 A;  4KHQ A;  2X6S A;  3AA2 A;  1BHL A;  4DV0 K;  2NRR A;  4NXM K;  2GWJ A;  5JLH A;  2BH1 A;  4ISE A;  3VQ4 A;  4B1V A;  3VA3 A;  3O4Q A;  1RBS A;  3HP6 A;  1VSJ A;  1CZ9 A;  4DS4 A;  3PO4 A;  1I39 A;  3MXJ A;  4K41 A;  1KXP A;  4ELV A;  5J2Q A;  3PLA A;  4A62 A;  1JL2 A;  3BDP A;  5LMN K;  4FJ8 A;  4CIF A;  1HNI A;  2BDP A;  1EET A;  3TTC A;  3ZSX A;  4Q5V A;  4DWI A;  3H45 C;  3ULE A;  1S1X A;  1XNR K;  1VSM A;  3WNE A;  5AQK A;  2NRZ A;  1NGD A;  4C8N A;  3A5L C;  4LSN A;  4DG1 A;  3PY8 A;  5BN9 A;  2EWS A;  1V4T A;  4WFA L;  3KD5 E;  3MMV A;  3BZC A;  3NCI A;  4KHW A;  2Q97 A;  3MEC A;  2A41 A;  4WCE L;  4JD2 A;  4CK1 A;  1JJ2 M;  3OYI A;  5TKW A;  5FPD A;  1TK8 A;  1KVC A;  4OLA A;  3DXM B;  1Q9X A;  5F0X A;  3AO1 A;  4N76 A;  4CZJ A;  3KKR A;  2B6A A;  5T7B A;  1RGI A;  4RG8 A;  3L2R A;  1LW0 A;  4CZG A;  2P9K A;  2NNW A;  4BR4 A;  3ZEU B;  2WC9 A;  1WSG A;  5AQT A;  4FWQ A;  1I3A A;  3PIO L;  3L4Q A;  3MXI A;  4CJ3 A;  3THW A;  3CCR N;  5AQJ A;  3D2E B;  4CJR A;  4BE0 A;  2IIR A;  4H5R A;  4H5T A;  4B1Y B;  3CCS N;  1FJG K;  3VQ5 A;  4QS9 A;  3ENH A;  2QWN A;  2G8U A;  4FCY A;  1QE1 A;  4FW2 A;  4A57 A;  4FK4 A;  3QER A;  1ASV A;  2KZM A;  3IG1 A;  3UB5 A;  4ICL A;  1NGC A;  4IOC L;  3ZT1 A;  4YOR A;  3VQQ A;  2JGU A;  4DSI A;  4OX9 K;  2HF3 A;  2FSJ A;  3DXK A;  1U49 A;  2VGN A;  4UY8 O;  4XIU A;  1VSI A;  3HOT A;  4CF0 A;  5TKY A;  1VSK A;  3KIO A;  4KHY A;  3ZSZ A;  1RDU A;  1E4G T;  4EZ9 A;  3EYZ A;  1GOB A;  2VGM A;  3H3O B;  2XRI A;  1F21 A;  4CJF A;  4FZZ A;  2E6M A;  5BPN A;  4AF1 A;  3OYB A;  4IWV A;  3U4L A;  4BC4 A;  3V9W A;  4B9T A;  4CZI A;  1RTI A;  5AQO A;  2E1Z A;  3NMU A;  4FJN A;  5E26 A;  2P9U A;  4CVN E;  3V1O A;  4DHY A;  4FL9 A;  3D2F A;  5CYQ A;  3R1X A;  4FOE A;  1SQK A;  3AGR A;  3LP1 A;  2W40 A;  1RDA A;  1XMQ K;  3DLL L;  1BOT O;  2OA8 A;  2QM1 A;  4DTN A;  4PA1 A;  2P5G A;  4CGF A;  1L3V A;  3CCQ N;  3EZ5 A;  2RKI A;  4LSL A;  1R0A A;  1HJO A;  1HUX A;  3DJC A;  4AHC A;  4N5S A;  2F4V K;  1MDU B;  1TK5 A;  5AQU A;  5C12 A;  4KKO A;  1VRU A;  2IAJ A;  3IMX A;  1LOT B;  4CGJ A;  2GUI A;  3L3U A;  1S3X A;  4CW7 B;  4BR9 A;  3NE6 A;  4BDZ A;  3S3M A;  1OH8 A;  5M1P A;  3F5T A;  1X9M A;  4NYN A;  1M90 O;  2YHW A;  3CPE A;  1Q8I A;  2HMP A;  5HL7 L;  3DWL A;  3HZ6 A;  4W5T A;  3QIP A;  3O3G A;  4DR2 K;  3DAW A;  4DQI A;  4DSF A;  3GOI A;  3LM9 A;  4CJE A;  5M1Q A;  4KHS A;  1E3M A;  4CIE A;  3DMJ A;  3M1F A;  1L5U A;  2NRW A;  3VET A;  4CHQ A;  3SK3 A;  2O8D A;  4KB1 A;  1EWR A;  2G8I A;  5LY3 A;  4G1Q A;  4CJ7 A;  4FJ5 A;  2X6N A;  4XH1 A;  1XQS C;  5FRO A;  1Q81 O;  5J1E A;  4CJP A;  4MDB A;  3BP8 A;  5KPT A;  1A5X A;  4ID5 A;  5JS1 A;  1HNZ K;  4MLE A;  4B3R K;  4E19 A;  4MDA A;  3TAG A;  4MLH A;  1RBT A;  4AIL C;  4CBX A;  3WNG A;  3QEI A;  3P39 A;  5EY4 A;  2B4J A;  2YNF A;  4KTQ A;  3OJS A;  1L3T A;  1SUQ A;  1Q86 O;  3U6F A;  2HVH A;  2QW9 A;  1VQ6 N;  4JKA A;  2VQE K;  1QSS A;  1K8K B;  4HUF A;  4JK7 A;  2W6K A;  4HTU A;  1LW2 A;  2XY5 A;  5HRR A;  1QHA A;  4BAC A;  4E89 A;  2YCH A;  3QEW A;  2YHX A;  3MN9 A;  4LD0 A;  4CEO A;  3VER A;  4GMJ B;  2A1R A;  5DMR A;  3A0I X;  3SI6 A;  4FJG A;  5MLC Q;  4Z4I A;  3PX0 A;  4FPA A;  5LJW A;  4B1W B;  2I5J A;  1ASU A;  3LWM A;  3VPZ A;  1NK0 A;  2O8C A;  1WNS A;  3LAL A;  4M3Y A;  3QEV A;  4HHT A;  4DLE A;  2UUC K;  4MO4 A;  4O0J A;  1UA0 A;  2PY5 A;  3QIC A;  3UIQ A;  1VQP N;  2CH6 A;  2HBK A;  4TSX A;  3AAQ A;  3CPW M;  4CK3 A;  3CQX A;  2Q0U A;  4Z0U A;  4F3T A;  3AVA A;  4JYA K;  4KO0 A;  3O9S A;  3SAG A;  4JV5 K;  2D0C A;  3ZYY X;  4CBU A;  4R79 A;  4F4K A;  3RVC A;  4AHU A;  4BR5 A;  3AO4 A;  2OPP A;  2QA4 N;  1EQY A;  1KTQ A;  3OBY A;  4CE9 A;  4DTP A;  3ULD A;  2NRV A;  3QBX A;  2UUB K;  3VMF B;  3G0Z A;  4DS5 A;  3AVH A;  1X3M A;  1TYQ B;  3O1B A;  3G71 N;  3CFP A;  3LDP A;  4GKK K;  4XH5 A;  4N41 A;  4DU1 A;  3KK3 A;  1J6Z A;  3EKU A;  4IOX A;  4H5V A;  4BRQ A;  4PL8 A;  3VQ6 A;  4YOU A;  2NUB A;  4BRP A;  3VQP A;  3HVR A;  3E9P A;  4DTU A;  3S3O A;  4FWR A;  2QWP A;  3NDK A;  4CJS A;  4I9Q A;  4B9L A;  1DGK N;  1CZA N;  4EAH D;  4CEQ A;  2DY4 A;  4IFY A;  1YTU A;  3M8P A;  1VRT A;  2QKB A;  5FRN A;  1TUY A;  1HNV A;  5J2P A;  1JLQ A;  5CHI A;  3F9K A;  2HMI A;  1QQM A;  4K0K K;  4JI8 K;  4DR6 K;  2Q1N A;  4GVM A;  3SV4 A;  3CFR A;  3HM8 A;  1NKE A;  2E5L K;  1ZBU A;  4DR4 K;  4A5B A;  1RDD A;  3RR7 A;  1Q7Y O;  2P9K B;  3L0Q A;  3HST B;  4C1N K;  3AVN A;  1EKE A;  4JS5 A;  4IDK A;  4DSE A;  4M3Z A;  3THW B;  3AVG A;  3ZCM A;  3U8X A;  2HNY A;  2PBD A;  3OYJ A;  1CXU A;  1YI2 N;  4JN4 A;  4H0O A;  4DF8 A;  3VQ8 A;  3KLH A;  4CEZ A;  4OPJ A;  1LAW A;  4FK2 A;  2KW4 A;  4DUY K;  4BRH A;  3DRP A;  3D6R A;  4NO7 A;  3DLH A;  3K5L A;  2E6L A;  3GE1 A;  4CI6 A;  3JAM O;  1TKZ A;  1WN7 A;  4JI6 K;  3I8B A;  1WSE A; 
#chains in the Genus database with same CATH homology
 4LFA K;  1XMO K;  4DV0 K;  4NXN K;  3J7A P;  4NXM K;  1J5E K;  4DR1 K;  3J7Y P;  4DUZ K;  4OX9 K;  2UUB K;  1N36 K;  3J81 O;  2ZM6 K;  5LL6 Z;  4DR5 K;  3J80 O;  4GKK K;  5BR8 K;  4X65 K;  4DV4 K;  4LF4 K;  2UXB K;  1HNZ K;  4LF7 K;  4B3R K;  4JI2 K;  5LMN K;  4DV5 K;  4DV1 K;  4DV7 K;  2HHH K;  4KHP K;  4B3M K;  4JI5 K;  1XNR K;  1IBM K;  4JI0 K;  2VQE K;  5A2Q O;  1HNX K;  4DR7 K;  4CVN E;  4DV3 K;  4LFB K;  4GKJ K;  4X62 K;  4K0K K;  4JI8 K;  4DR6 K;  4V19 S;  4YHH K;  4X66 K;  1XMQ K;  5LMU K;  2E5L K;  2VQF K;  4DR4 K;  4DV6 K;  1HR0 K;  4JI4 K;  4B3T K;  1HNW K;  4LF6 K;  5IT9 O;  4DV2 K;  2UUA K;  2F4V K;  1XNQ K;  4JI3 K;  5AJ3 K;  1N33 K;  4CW7 B;  2UUC K;  1I94 K;  4LF5 K;  4YY3 K;  3T1Y K;  4JI1 K;  2UXD K;  4LFC K;  1IBK K;  3OTO K;  4B3S K;  2UXC K;  4X64 K;  3T1H K;  5FLX O;  4JI7 K;  4DUY K;  1FJG K;  1N34 K;  1IBL K;  4JYA K;  5IWA K;  4AQY K;  4JV5 K;  4LF8 K;  3JAM O;  1N32 K;  4LF9 K;  4JI6 K;  4DR2 K;  4DR3 K;  2UU9 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...