2HHHK

Crystal structure of kasugamycin bound to the 30s ribosomal subunit
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
119
structure length
119
Chain Sequence
b'KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title The antibiotic kasugamycin mimics mRNA nucleotides to destabilize tRNA binding and inhibit canonical translation initiation.
pubmed doi rcsb
molecule tags Ribosome
total genus 30
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2006-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 2hhhK00
4DV6K 3T1HK 4JI3K 1XNRK 2ZM6K 4B3TK 2F4VK 1J5EK 4YY3K 1N34K 4DR6K 2UU9K 4GKKK 4DR7K 4DUZK 4LF5K 1XMOK 4JI1K 1I94K 1FJGK 4DV1K 4DR4K 4LFCK 1HNXK 4DR5K 4CW7B 4DV5K 5IWAK 4B3RK 1XNQK 4YHHK 4LF9K 4AQYK 4KHPK 1N32K 1IBLK 2VQEK 1HR0K 4LFAK 4OX9K 4CVNE 4LF6K 4B3MK 4JI6K 2VQFK 4X64K 4DR2K 2UUBK 1N36K 2E5LK 5AJ3K 5LL6Z 4LFBK 4JYAK 3OTOK 4NXMK 2UXCK 1N33K 5BR8K 4JI2K 4JI5K 4DV7K 4NXNK 4DV0K 4LF7K 2UUCK 3J81O 4JI4K 5LMUK 4DV2K 4DV4K 3T1YK 4GKJK 3JAMO 4DV3K 4JI0K 4LF8K 5FLXO 4X66K 2UUAK 1IBMK 4DR3K 4V19S 4JI7K 2UXDK 4DUYK 4LF4K 1IBKK 4X62K 4JV5K 5LMNK 1HNWK 4JI8K 4K0KK 4DR1K 1XMQK 5IT9O 3J80O 3J7YP 4B3SK 5A2QO 2HHHK 1HNZK 2UXBK 4X65K 3J7AP
chains in the Genus database with same CATH superfamily
1ASVA 4RW8A 1LOTB 4IFEA 3LPUA 4O0IA 3KJVA 3CCUN 4PWDA 3D7EO 3BEXA 3IFRA 3I55N 3AVNA 4CEZA 3IRXA 1S6QA 1QQOA 4CZFA 2F9WA 4HCCA 1C1BA 3CCQN 4DR6K 3U3YA 4O5FA 4BE2A 3O9TA 4XH4A 4FJLA 3SJHA 5KPZA 4DR4K 4CJTA 2ASOA 3VA3A 1BCMA 4A5AA 2IGIA 2G8IA 3M1FA 3PY8A 3I0RA 1NM1A 3AY9A 3L3UA 3SBGA 3QICA 3ZEUA 3LDPA 4QS8A 3OYBA 4EZ9A 3SPZA 3M6GA 3SV3A 1GLJO 3CM5A 2ZWHA 2F9TA 2O8EA 4MDBA 5FPDA 2X78A 1UA0A 3VQ6A 2NRXA 3KWIA 3A5NC 5BN8A 3DOLA 2DY4A 3O8MA 3VTHA 4IEEA 1EWQA 2NRTA 4AH9A 3WNHA 4FM1A 3CFOA 5FDLA 3A5MC 4BWMA 3CJ7A 5KRSA 4Q0BA 1QTMA 1Z6RA 3THXB 4B1VA 5CY4A 3F73A 1VQ7N 1HKBA 5C15A 3AVCA 1VHXA 5GIOA 4OLAA 5BPLA 2HHUA 2XY5A 1HJOA 1MWMA 3UE5A 1S5JA 3PO4A 4JLHA 4CESA 3WUHA 4UQGA 4C1NK 2ZJQL 4AM6A 4DF8A 3ZSRA 3CCVN 1A5VA 1G15A 4BRIA 1KVAA 3V1RA 3S41A 1WSFA 2WFBA 4ISEA 4B8AB 3PLAA 5AQNA 2W6LA 4ELVA 3NF7A 1QQCA 4CHQA 1WBBA 4GV6A 3UKUB 1TKDA 3EZ5A 1BG3A 3PSFA 4YDUA 3ALYA 4CD3A 1MWKA 4Z4IA 1DGKN 1R59O 3NBPA 4FWQA 4FSVA 5KQDA 5I3UA 1X9SA 3Q7CA 3L3VA 1NK5A 1NK8A 3GE1A 4EP5A 4BR0A 3THWB 4B3OA 4Z4EA 4FK2A 4DR7K 1NGIA 2RPIA 3NDKA 1I94K 4DV1K 3OYAA 5FRMA 4W5OA 1V4TA 4RW4A 3H3NO 5GIPA 3EZWA 4FLYA 3THXA 2WOMA 4BDZA 3K5OA 3KTQA 4NO7A 1N32K 2VQEK 4NLBA 1VQ4N 3GL1A 3QETA 3O9SA 5E26A 2Q97A 4FLXA 4F3OA 4FJMA 1HNIA 4PHTX 4KFBA 4NB4A 3NHGA 2E6LA 5GAEP 4JD2B 3SUQA 4BE1A 4CZJA 3CHWA 3PIOL 4A62A 4E7JA 3AVHA 1VSKA 4J8FA 2VGMA 4OO1J 4BRLA 1NOZA 4FWNA 1J53A 3OBYA 1TAQA 4CJRA 3V1OA 4PKHA 3AARA 2XHBA 2VG5A 1ZC6A 1RTJA 3UKUA 1X9MA 2GV9A 1HYVA 1U49A 4K8ZA 1RBSA 4GNIA 3K59A 2RN2A 2P9KA 3EN9A 2G8UA 3EKUA 5BPNA 5J2PA 2PBDA 3SMPA 1C1AA 5M1NA 4V19S 4HTLA 4JHDB 3QNNA 5HOOA 4NCGA 3HK2A 4LY7A 1RCHA 4CK2A 1SL2A 4CHYA 3SZ2A 3G10A 1X3NA 3THWA 3HSTB 1C6VA 3VTIA 3DM2A 3HL8A 2O8DA 2Q2RA 1T8EA 3HI0A 5AQVA 2GUIA 3FZFA 5AQXA 1ILYA 2ASPA 1HKGA 1E4FT 3O08A 3UIQA 3K5LA 3HJFA 1XI1A 1NK9A 2F7TA 1YI2N 3KLFA 3UKRB 3EY1A 2JWLA 3DLBA 4X65K 1Q7YO 1RT7A 2H3GX 1UAXA 3BF3A 1BQMA 3EYZA 2YNHA 4JD2A 2O8FB 1YF5L 3VEVA 3VQ9A 4B1YB 4CEEA 3CJ1A 4ELTA 1HPMA 5AQTA 2PZSA 1T6CA 1T05A 4Q5VA 4DUZK 3DJCA 4W5RA 3NVKA 2ZJPL 1NGEA 1SKRA 3AVFA 2HF3A 1U2VB 3CCLN 4CW7B 3VEOA 3EE8A 1YT3A 4K43A 1ESVA 1BDGA 1X9WA 1RT2A 3KHYA 4KHPK 4A2BA 4E3SA 3V9UA 3WEEB 1YVNA 1T3VA 4AM7A 3O3FA 3THYB 4CVNE 3E66A 3O4WA 4OPJA 4JHDA 4CJPA 1GLAG 3HT3A 4DFKA 4M7XA 2A40A 1DKGD 3QEWA 1KAXA 3VQ8A 1ZBSA 2UXCK 2Q3SA 2GTDA 3JSMA 4DTSA 2RE2A 1NWKA 1SUQA 2QEXN 2WONA 3F5TA 2D0CA 3FE1A 1X1PA 3R1XA 1NJZA 5JVHL 3UKRA 2FF3B 5AQOA 4OKKA 2HNZA 4O4GA 1DLOA 4O8KA 4E0DA 1NKEA 1T44A 4JK9A 1GOCA 4BR4A 1NLVA 3VQCA 2KW4A 4BDPA 1BCOA 4RCHA 4JI8K 1CZ9A 4BGBA 4FWLA 4JKBA 4KH6A 3O6WA 3PX6A 3KLHA 2I7PA 1U2VA 1QVGM 2J4RA 1WB9A 2G8HA 4M3ZA 3E9OA 4CEFA 4JKEA 3HRGA 1JKHA 1VSMA 3CIPA 3BGRA 5JLHA 1HJRA 4AILC 1HYZA 4O55A 3WEEA 4BQLA 2VGNA 2YNFA 2CH6A 1RDUA 1RILA 3BZCA 4Z94A 3THYA 3HVTA 4FPBA 4IG3A 3M3ZA 4Y1CA 4BR5A 3PO5A 4BR9A 4GVEA 2E2PA 2ZM6K 4KV8A 1ITGA 1LAVA 1BOTO 2CGLA 4DLGA 3OY9A 1U04A 1LWEA 5AQFA 4BRHA 2OPQA 4DSEA 3NMUA 1NMNA 1KFSA 1RDCA 2PY5A 4LFCK 1YJNN 3FLCO 4JS4A 4YOTA 4B3RK 2A42A 4FWMA 3NAEA 3CI5A 3VQEA 3JYTA 1X9JA 4FJXA 4GV3A 4JN4A 4BG8A 1Q8IA 4MO4A 3ZCMA 3Q7BA 4U67L 4JS5A 4CZLA 1WLJA 4RTFD 3MN9A 1RFQA 1C0UA 3VQAA 4IEIA 1IKXA 3RSEB 1NNEA 2UUBK 3TR8A 3VGKA 4RW9A 3TSQA 2E5LK 3V9ZA 4KB1A 1HPZA 1BHLA 1E4GT 4NLCA 1VQLN 5LJVA 3R8EA 1FK9A 2QK9A 1BA0A 4LSNA 2V52B 1KAYA 4CF9A 3SJJA 1GLDG 4HUFA 4DTNA 3H08A 3RR7A 1D9FA 1JJ2M 3KVGA 1J6ZA 4N76A 4C8NA 5HP1A 2JWKA 4FL9A 4LF4K 4H4OA 5JICA 3P38A 3RR8A 3DRPA 2Q0RA 3PSIA 1OKJA 3G71N 3C7NA 4ILHA 3DAWA 1L5UA 2EX3A 4EIAA 3RRHA 4Z0UA 4FJIA 4FM0A 2HHXA 1EETA 2KFNA 3AO1A 1IO2A 4K25A 4HUEA 5AQIA 2BH1A 2IVNA 3L0QA 2KLAA 2B4JA 4FWPA 5AZIB 4YOYA 4OJRA 4YFUA 3D0PA 2VYPA 4KHWA 5AQWA 3RSEA 4DFMA 1J5EK 4YY3K 3LAKA 1BIZA 3OHRA 1IKWA 4I9LA 3K0SA 3M8PA 4DR5K 1LW2A 4YHHK 5AQRA 4KTWA 4FM2A 1JCGA 4FXDA 2NRVA 3DRRA 3TABA 1U6ZA 3ID8A 4BRPA 2YV0X 3ULDA 4DS4A 3E9LA 4NCAA 2HBJA 1FW6A 1NK4A 2YKNA 1KVCA 1RTHA 3O4QA 4GMJB 5DK5A 5M1QA 2FSNA 5KTQA 5LL6Z 3L6QA 3H1QA 4JI2K 3G6EN 4CIGA 3ZSQA 4DTXA 3A0IX 2OZMA 2IVOA 3A8YA 2W42A 3KK7A 5F0XA 3SAHA 1K8AO 2WUSA 4JI4K 1Z26A 3ZETB 3RMCA 1UOCA 1VQ8N 3T19A 2JGUA 4KBOA 4I2PA 5AZIA 4NYNA 5KGWA 4CCHA 3QDKA 2VWBA 4JI7K 3RMBA 5FRNA 3CERA 4KPYA 4X62K 4R5PA 1RDBA 4FW1A 1Q18A 5AQHA 4WF9L 1KFDA 4FYDA 2IAJA 3NH0A 2AP1A 3KK2A 3LDOA 3DMJA 4OGEA 1XWLA 1GLLO 1QSYA 1JL2A 3D45A 3AVLA 4H5RA 4RW6A 3KLIA 2V51B 3U3GA 1Q86O 1TK5A 4MLEA 3EO3A 4YDUC 3C6UA 3AO3A 5GAGP 3LWLA 4YOUA 4LD0A 3ZSOA 3O3GA 4DSJA 3LM2A 1TYQB 3VGLA 3HOSA 4BVOA 2P9LB 1ZBHA 4DTOA 1TGOA 4IXCA 5H1SQ 2E2NA 1FJGK 3K5MA 1Z05A 3LDQA 4ZTJA 3HM8A 4OPAA 3QERA 3R3LA 3QEPA 2P51A 4H5NA 3SCXA 1B9DA 4JK8A 4BC3A 3ZETA 4LF9K 4CJEA 3VOVA 3CPWM 1EQYA 1RDAA 3AO5A 3TTDA 1IG8A 1LW0A 3OS2A 3V4IA 1Q9YA 1OH5A 3RWUA 2F96A 4FLTA 3CJCA 5EVZA 4PY5A 4BC4A 3AVJA 2HMIA 2IIRA 3OJUA 4YOVA 4MDAA 4A59A 3ZSVA 3LP2A 1TK8A 2HBLA 5C24A 1JXBA 4NXMK 2KFZA 4BREA 1VSHA 3SK3A 2KTQA 1U4BA 2YX6A 4DV0K 2IS3A 5JS2A 2E6MA 2QM1A 3V9SA 3SMSA 4DV2K 4KHQA 2OANA 5ELZA 4YOWA 4IOAL 3CQYA 3NE6A 5D3GA 3LP0A 4B9NA 3QBWA 4HTUA 3OYEA 1YJ9N 1CZBA 3ZX3A 4FCYA 4YOXA 4M7YA 4H8KA 5M1KA 1NG9A 4ELUA 4FVUA 3VEZA 4B9UA 1TYQA 3L2QA 1QQNA 4MO5A 1LWCA 5C10A 3CYMA 4KHSA 4DR1K 1A5XA 1HMVA 1RNHA 3SLCA 1CZAN 3KKSA 3QFUA 1EX4A 4WQ5C 5GINA 5EU7A 1Q81O 1SS6A 4PL8A 4B3SK 4JNEA 4GV9A 1KAZA 5EXWA 3CCEN 3NH2A 1MU2A 5AQZA 3ATVA 1NGJA 3P5JA 3NGIA 2IC3A 2NRHA 5AQJA 5HBMA 3FFIA 1S9GA 3HBTA 1IV0A 2DPNA 3C6AA 1NGFA 4IWVA 4O8UA 2HVHA 1VQON 2VWKA 2UU9K 2BE2A 1WN7A 3MN7A 4CHNA 2B5JA 2FSJA 4OPHA 5T7BA 4BGAA 1KSPA 3AA4A 3WNFA 4CD1A 1XNQK 1IKYA 2VCPA 2BUPA 1N6QA 4WFBL 3S3MA 2X6SA 1TUUA 1S9EA 1RDDA 1RTDA 1VRUA 4YNQA 3I56N 4O0JA 5AQLA 1OVYA 3D2EB 4Z4HA 4B3MK 2QWLA 5HLFA 2QXLA 3CF5L 1D8YA 1ZXOA 1VRTA 1XUPO 1CXUA 3O1WA 3C6HA 4DQQA 3U9ZA 4M3RA 4JKFA 1TK0A 1T7PA 3ZSXA 3I8BA 1S72N 4FLWA 4DLEA 3J8AA 4DSFA 2D5RA 3OJSA 3VPZA 4IJAA 3SI6A 3AAPA 1HUXA 4CZIA 2GELA 4BRQA 1BU6O 3MN5A 1DTTA 4DV3K 4CF2A 1VQNN 3AVGA 4JI0K 3VQDA 2DTUA 3V1QA 2Y1IA 5MLCQ 3RVCA 4KHNA 2BTFA 1KQSM 3H1VX 1IBMK 3IG1A 4A57A 1KXPA 1WOQA 4DTPA 1KLMA 2HVIA 3O4NA 2P5GA 2YHBA 2QWQA 3DYAA 1SL1A 4CJVA 4FLUA 3MDQA 3BF1A 2ASMA 3M5RA 5AQGA 4E89A 3OYCA 4CHPA 4HHTA 4MQ3A 3WXKA 3SQ2A 1GLBG 4CGGA 3L2UA 3RMAA 3D2EA 5C2FA 3O1BA 5EX5A 1ATNA 3AA3A 4CZEA 2QWNA 3DXKB 2Z1HA 3AVBA 4R79A 2IDOA 4NCBA 4E1NA 3CJ9A 4C1NI 1ZYQA 2HOEA 4JI1K 4CJQA 4WQ5A 2QWMA 4FPAA 3TAFA 4CF8A 1JXEA 3B6OA 3TSUA 1NGDA 3NF8A 4CERA 4F2RA 3VETA 3KWGA 5JLFA 3BY5A 3GOIA 3VEXA 4PL7A 4B08A 2DFFA 4EFHA 3C65A 2QW9A 4GVMA 3O9UA 2YJFA 3TPQA 3AGRA 4CJFA 1NGBA 2NZTA 3MCPA 5J1EA 4HUGA 1CXQA 1RTIA 4A5BA 3DLLL 5AFUH 1C0GA 3NFAA 3VQ5A 4CEAA 1XC3A 2VG6A 1SZ2A 2P9PB 3OTOK 4E1MA 3HP6A 3CQXA 3QO9A 4QS9A 4DQ8A 3H45C 3DLGA 4G9ZA 5C2DA 1RBTA 4FJKA 4CZMA 4FWSA 3WNGA 4XH1A 1SAZA 1IG9A 2VG7A 1SV5A 3ENOA 2YHXA 2QTDA 4KAZA 1ZBFA 3D2FB 1JLFA 1DEJA 3ENHA 3DXKA 2IOCA 4ZTFA 3SQ1A 1TV6A 1IKVA 1MDUB 3VEYA 3OBWA 1O13A 4CGFA 3O5BA 3QBXA 4CHZA 5SZTA 4FJNA 4N41A 4AHVA 4CGDA 4F4KA 1Q82O 1BGXT 4EAHD 1FKPA 1EP4A 1C0MA 1NK0A 3MMVA 4FW2A 2F8TA 3CJBA 3HM9A 1RBVA 3P83D 1BO5O 3EE9A 3MCAB 4EHUA 1W7AA 1Q9XA 2O8FA 3VQQA 2E88A 1FXXA 4IOCL 4CJ5A 4DTMA 5CE3A 2B6AA 2G8FA 2A1SA 5EY4A 4Z4CA 1HYSA 3TTFA 1VAZA 5F1XA 3M8SA 4J2BA 5I42A 3AA5X 3QEVA 1KRPA 4M3YA 2P9PA 5AQMA 3ZT0A 3N4PA 3QFPA 4QS7A 4IFVA 3AGKA 3ISNC 3C6TA 1Z25A 3WXIA 1WBDA 2O4GA 4ZHRA 4K42A 4BROA 3KK1A 4JKHA 2OPSA 2E1ZA 4BRGA 3UB5A 3H46O 4J2DA 3D2FA 3GG4A 1IH7A 3N4QA 5EOYA 4N56A 2Q1NA 4E1JA 1P90A 4XEIA 3LZJA 1N36K 1TKXA 2NRWA 3DOKA 3CG7A 4JYAK 4EP4A 1OH6A 4IJNA 4CK1A 4I7FA 2KKZA 1LV5A 4DTRA 4CJUA 4RG8A 4U7BA 1WSGA 3HSCA 2XRIA 1NKCA 3T1YK 4RW7A 4E7HA 4BACA 1QZ5A 4GKJK 3AV9A 2D1KA 3O3HA 2W41A 5C12A 5KI6A 4IBNA 1K9MO 5E84A 5M1OA 4BRNA 2FBVA 1XHXA 2Y1JA 3K5NA 3ZLJA 4OVLA 1VSLA 3KIOA 3IUCA 5GADP 4H0YB 4KHUA 1JLCA 1UA1A 1K6YA 2GUPA 2AJQA 1JLQA 3LALA 3LANA 2JLEA 2ITMA 3FR0A 4DFJA 3EL2A 5GAHP 1VQMN 4F2SA 3E01A 4CJSA 3TI0A 2WC9A 2UXBK 1YXQA 3KD1E 4CJKA 3DWLA 4FOIA 2QKBA 4FJHA 3F2KA 1J54A 2P1JA 3QIPA 3T69A 4H5TA 4PKIA 2YI1A 4CE9A 5AR0A 2F4VK 3O9QA 4OKEA 1N34K 3KD5E 5K14A 1QVFM 2ZD1A 1WAFA 4KREA 2QXFA 4KH5A 4M41A 4O44A 1ZBLA 4K41A 4G1QA 3L2WA 1C0FA 4ISGA 1OVQA 1BQNA 3E9PA 2O8BB 4LH5A 4EZ6A 1SKWA 4KI6A 2HF4A 1VQ6N 3HPOA 3HOTA 3LAMA 3HYFA 3CFPA 1QHTA 4LF6K 3CC4N 2W6KA 4JI6K 2VQFK 2GWJA 3JXUA 2A1RA 3BDPA 2HW3A 1NKBA 3H6EA 2YHWA 3CETA 3PIPL 5C0YA 1WSJA 2HHTA 1L3UA 2QWRA 4FJGA 1RDWX 3GDQA 4DSIA 5BRDA 4ISFA 3TAGA 4DU3A 4B1UB 3KKRA 1I39A 1D9DA 3KK3A 2GWKA 2OCEA 4QOZB 1I3AA 3J81O 1F21A 4ID5A 3DLEA 4JKGB 4N47A 5BR9A 3NGYA 3OYDA 1JLEA 4DQRA 1VQPN 1YAGA 1KD1O 2GBZA 1YIJN 2D0PA 3SAFA 4PKGA 1H1VA 4CZGA 1ATRA 1HX1A 1VK0A 2OTJN 1VQKN 4LC9B 2A5XA 4CJ3A 2FXUA 3HPHA 4FK4A 4KRFA 1S3XA 1QZ6A 2ZGYA 2P9IB 1S1VA 1G99A 1RBRA 1HLUA 4BRFA 1WAJA 4KTQA 3DRSA 3CMEN 1S1TA 3LP3A 2O8BA 1NJWA 4AHUA 4JK7A 2FBTA 2E8AA 2PAVA 3OA9A 4CIFA 5AQPA 1B9FA 3T3FA 4E19A 5DM6L 1GLFO 5AQYA 4B8CA 3AVAA 4H0TB 5TKYA 1GOAA 1NGAA 1YTAA 2UYTA 1ZBUA 1TVRA 1VSJA 3THVA 4FZYA 2WTUA 4BDYA 3CC7N 4GKKK 3ZX2A 3WXLA 3TAPA 2RKIA 4J2EA 4FJ9A 5C42A 1BI4B 4M3XA 4IKFA 5DMRA 4JKAA 1YJWN 5M1PA 2AA4A 1HR0K 3AVIA 1JCFA 3ZEUB 3MWTA 4OX9K 1CLQA 3IMXA 1J5OA 3LDSA 2OPPA 5DM7L 2D4WA 4JKCA 1NJYA 2QA4N 3SUOA 4E7KA 4CEBA 4ILGB 3HP9A 3FZLA 2P9IA 3VN5A 3I8DA 3TAQA 4LFBK 2FLOA 2P5OA 4DV7K 4WFNL 4H4MA 4DQPA 4E7LA 1NJIO 3MXMA 1KCFA 3L4IA 4CZHA 3BUZB 3CFRA 1BIUA 2FC0A 4H5VA 1KLNA 4Z4GA 2XY6A 4GW6A 3OYMA 1FKOA 5FROA 4DR3K 4CECA 4DUYK 4OPKA 1IBKK 4GY2B 2ZF5O 3OYJA 3U8XA 3MX2A 1LWFA 3EEQA 3VF6A 2PYLA 4FZZA 4H0XB 2E2QA 1XMQK 4XH5A 4JAXA 1BI4A 3KLEA 5KQ8A 1BUPA 4Z4FA 1ZBIA 3DLRA 4JKDA 4B1WB 2NRZA 3ZT2A 5J2QA 2ETJA 3SBTA 1HNZK 2DFEA 4DS5A 4B9VA 3IAYA 4KO0A 4W5QA 4ILJA 4DV6K 4H0VB 3TU5A 4JI3K 2P9LA 2RF2A 1ASWA 3WT0A 4BVPA 4B3TK 1S6PA 2HHWA 3CD6N 3HZ6A 3LM9A 3LZIA 3VQ4A 3SYZA 3QIOA 4NYFA 4IFYA 3WXJA 4B9QA 4K8XA 1T03A 1YHQN 1XMOK 3EKSA 2A41A 4L3QA 1B92A 4BRCA 3MXJA 1SKSA 3L8BA 4DTUA 5KRTA 4W5NA 3MEGA 3VENA 3CCSN 1VSFA 3QEIA 1U45A 2DFHA 4TSXA 4BRMA 4CGHA 4CFCA 4EHTA 2ZQBA 4LFAK 1TL1A 3FGUA 3RRGA 4O5BA 3M8QA 1Y64A 5FPEA 4CEOA 1BA1A 4WCEL 3WQUA 1REVA 3TAEA 5HRPA 4DB3A 4DR2K 4JRQA 2HNDA 3CM6A 1OH7A 4M42A 5JS1A 3OYLA 5AJ3K 2HSTA 3V6DA 3B8AX 5SWMA 3ID6A 1WUAA 3TSPA 3QNOA 3PUFA 4DTJA 2YNIA 2FBYA 4DV4K 1U48A 3I0SA 2LSNA 3S3NA 4QCLA 1QQMA 2E1YA 3GBTA 1JLBA 3MECA 3NCIA 1L3TA 2E4LA 4A2AA 4AHSA 1NK7A 5AQUA 2VWJA 4DKWA 2D0BA 4F3TA 1TKTA 2P9KB 4AHCA 4DFPA 1K8KB 4BE0A 5LMNK 1M90O 5AQSA 3AA2A 5ADXH 4KH4A 1OH8A 3J7YP 4B9SA 1TL3A 2HNYA 4C23A 1X3MA 1GLEG 4HVJA 4KKOA 4I2QA 2QKKA 2O8DB 4I6MB 4BC2A 3V9XA 3OYKA 1RT3A 3ASMA 3D6RA 1RBUA 2QWPA 3G25A 3ATUA 1YITN 2ITGA 3MXIA 3ZSYA 4E7IA 4YORA 4KB0A 4CBUA 3ZT4A 1W2BM 4M3UA 3DXMB 5CZ2A 2Z1GA 4Y1DA 4FJ7A 1GOBA 4HCBA 5HRRA 2HBKA 3LP1A 4DCHA 2OZSA 1SQKA 3K2PA 3VQPA 2G8VA 3R9PA 5BREA 4IDHA 4FO0A 1DTQA 2HBMA 2XY8A 4M3TA 3TARA 1V4SA 3CPEA 4CF1A 4CFAA 2I7NA 4DQIA 3OVNA 5C25A 4FWKA 4B9LA 3KLGA 1K73O 5FPNA 2YHAA 1NOYA 2NNWA 5M1FA 2G8KA 3OYHA 3K58A 5AZJB 4WE1A 2ATQA 1K8KA 3VERA 2YKMA 1R0AA 1RT4A 3VMFB 3IKMA 1N33K 5BR8K 3SV4A 3BP8A 2XO7A 1KC8O 2FF6A 3K9JA 4FOEA 3IS9A 1NU0A 1P8ZA 2YHYA 3FZHA 4H03B 4I6MA 1NJXA 1YTUA 3QINA 3TWHA 4C8KA 3W0LA 2GX9A 3NGZA 3JS6A 4PQUA 4BQZA 1O1WA 4M63C 3VF2A 4IDKA 4BG9A 2KHOA 3C95A 2QWOA 5HRNA 4CBXA 3NH1A 2UXDK 5JVGL 3R6MA 4LH4A 2ZE2A 2R7YA 1N8RO 4JV5K 3DXMA 3HO1A 3VEWA 3HXMA 2O8CB 3J7ZO 3A2FA 5E41A 3OS1A 2RHKA 5KGXA 4PUOA 4DSKA 4CEQA 2BGGA 2X6NA 5A2QO 3P4IA 1N5YA 1TUYA 1ASUA 2HHHK 4CJ7A 5KPRA 3AO2A 5LJWA 2YCHA 1RT6A 1LCUA 2CGKA 4PA1A 1TAUA 1QSLA 4MLHA 3ZT1A 5AZJA 5JMVA 4CBWA 3I33A 4KI4A 5HL7L 5FPMA 5CR4A 1L3SA 1VSDA 4CI6A 4BRDA 3LDLA 1S1UA 4DV5K 3P31A 4I9QA 4B1ZA 1QS4A 5ADXA 4DG1A 5BN9A 3MX5A 4A61A 1C0TA 3ULEB 1J9AA 4UY8O 3OYGA 3F9KA 3CQ8A 5F2RA 3L2VA 1IBLK 2QI2A 4CJLA 1T6DA 4CEDA 5CZ1A 4C8LA 4FWRA 2V7YA 2Z1IA 4L8RB 2E2OA 4IG0A 4JEPA 1ATSA 1C1CA 3CJAA 3U6FA 2P9NB 4CK3A 2O8CA 3VGMA 4FLVA 2HMPA 4MFBA 4CHOA 3CMAN 4LF7K 2UUCK 2NLXA 3WNEA 4N5SA 4AF1A 3G4SN 3WXMB 4F8RA 1RT5A 1KTQA 5HRSA 1W0HA 1JLAA 4IO8A 5BRFA 1VQ9N 1BL3A 3HTVA 1WSHA 1W9HA 1IJJA 4FLZA 2UUAK 3CXCM 1EKEA 1UWBA 2A3ZA 1S22A 3AVMA 3ZSZA 4K0KK 3AO4A 1L3VA 2G8WA 3MK6A 1S1WA 2NRRA 1WSIA 2HHSA 4BR7A 4Y0WA 1TKZA 1LAWA 3C7NB 3FZMA 4CGJA 3OYNA 4CJ4A 3ULEA 1BWFO 3V9WA 3O9RA 4FWOA 2V7ZA 4H0OA 3SUPA 3CCMN 1NGGA 1D5AA 4ID1A 4B1XB 2PFUA 3J7AP 3DLKA 3T1HK 3ZT3A 1JCEA 5CHIA 1XNRK 3MWPA 1W97L 3PV8A 3E1YA 4C8OA 2X74A 5AFUA 2P9NA 1NMDA 3O80A 3NF6A 5TKWA 5IWAK 4BWJA 3G0ZA 2ZGZA 4OGCA 3SNNA 3C0BA 5HROA 5AQQA 2KQ2A 3A5LC 4FZXC 1EXQA 4CIEA 2CH5A 2W40A 4WQ4C 1BISA 2Q31A 1EWRA 3MEEA 1NK6A 2D0OA 2PYJA 3LWMA 1VSEA 3U4LA 4X64K 3AVKA 3CC2N 5J2MA 4IO9L 3VQBA 4FJ8A 1QSSA 3A5OC 3RMDA 3T1AA 1M1KO 4NXNK 2GEMA 4BRKA 5KPTA 5BRHA 2IVPA 3OS0A 3BZKA 4KTZA 4WYBA 1HNVA 2P9SB 3VA0A 1HRHA 3VESA 2HHQA 5FLXO 4DHYA 4X66K 1EO1A 5B8HA 5CYQA 2F8SA 3DLHA 4W5TA 4ICLA 3HVRA 4DMNA 1S1XA 2E20A 4AHRA 1HNWK 2P9UB 1KVBA 2FSKA 2Q36A 4DSLA 2KZMA 3SPYA 3AAQA 4DF4A 1JLGA 4BRAA 3J80O 3MAQA 3OYFA 3TTCA 5BPMA 1RT1A 4CF0A 2EHGA 4B9MA 1HQEA 3QLHA 3RTVA 4BY9C 2OPRA 3DI6A 3L4QA 1HKCA 1U47A 1QHAA 1QE1A 3MEDA 5I9EB 2OTLN 4M3WA 4CJWA 3NVMA 4BR2A 1D4XA 3P39A 2XY7A 4BC5A 2NUBA 4CFDA 2Z1JA 2I5JA 2WBNA 3W3DA 1XC9A 2BANA 4WFAL 3LPTA 1WSEA 4LF5K 3WQTA 1HNXK 2YNGA 4B9TA 4JRPA 4H0PA 4J2AA 3F9MA 4HWIA 4FK0A 3T7ZA 4DWIA 1Y97A 2YJEA 2OYQA 3V81A 4AQYK 2P9SA 3OW2M 1XQSC 3QB0A 1DT9A 3L2RA 2HHVA 3QESA 3P1GA 3KZBA 3SQ0A 1HQUA 3U9DA 2FBXA 4RWTA 1WNSA 4H5WA 4LSLA 4CZKA 3H3OB 3B6PA 5CYMA 3QEXA 5AQKA 5J2NA 2Q0UA 3M8RA 2P9UA 3QMLA 2EWSA 3IDHA 1JL1A 2D0AA 3MN6A 4M45A 2A6AA 3ITHA 3LL3A 3ZSWA 4JI5K 3CCJN 4JKGA 3K57A 4OLBA 4DQSA 3ENBA 1NGHA 2KZZA 2BDPA 3TAMA 3K9KA 1VQ5N 3VQ7A 5LMUK 1VSIA 4WQ4A 3JAMO 3ZX0A 1GLCG 1A5WA 4LF8K 4F9OA 4C8MA 2HB5A 3HPGA 3SAGA 1E3MA 2O8EB 4FVMA 2O4IA 3FFKB 4XIUA 1XHZA 3VF4A 2CGJA 4CFBA 4FJJA 4KHYA 1YUWA 3OYIA 4IOXA 1SL0A 1YVUA 3NF9A 1MA9B 4DU1A 3TANA 3S3OA 5LY3A 3CCRN 3FZKA 4QAGA 3LDNA 5IT9O 3S9HA 1RGIA 4AHTA 3C94A 3ZYYX 4CGIA 4FJ5A 3PX4A 3SQ4A 2OA8A 4OKJA 2ZJRL 4DU4A 1NGCA 3SUNA 4IZ9A 3PX0A 1NBWA
chains in the Genus database with same CATH topology
4DV6K 3T1HK 4JI3K 1XNRK 2ZM6K 4B3TK 2F4VK 1J5EK 4YY3K 1N34K 4DR6K 2UU9K 4GKKK 4DR7K 4DUZK 4LF5K 1XMOK 4JI1K 1I94K 1FJGK 4DV1K 4DR4K 4LFCK 1HNXK 4DR5K 4CW7B 4DV5K 5IWAK 4B3RK 1XNQK 4YHHK 4LF9K 4AQYK 4KHPK 1N32K 1IBLK 2VQEK 1HR0K 4LFAK 4OX9K 4CVNE 4LF6K 4B3MK 4JI6K 2VQFK 4X64K 4DR2K 2UUBK 1N36K 2E5LK 5AJ3K 5LL6Z 4LFBK 4JYAK 3OTOK 4NXMK 2UXCK 1N33K 5BR8K 4JI2K 4JI5K 4DV7K 4NXNK 4DV0K 4LF7K 2UUCK 3J81O 4JI4K 5LMUK 4DV2K 4DV4K 3T1YK 4GKJK 3JAMO 4DV3K 4JI0K 4LF8K 5FLXO 4X66K 2UUAK 1IBMK 4DR3K 4V19S 4JI7K 2UXDK 4DUYK 4LF4K 1IBKK 4X62K 4JV5K 5LMNK 1HNWK 4JI8K 4K0KK 4DR1K 1XMQK 5IT9O 3J80O 3J7YP 4B3SK 5A2QO 2HHHK 1HNZK 2UXBK 4X65K 3J7AP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV6 K;  3T1H K;  4JI3 K;  1XNR K;  2ZM6 K;  4B3T K;  2F4V K;  1J5E K;  4YY3 K;  1N34 K;  4DR6 K;  2UU9 K;  4GKK K;  4DR7 K;  4DUZ K;  4LF5 K;  1XMO K;  4JI1 K;  1I94 K;  1FJG K;  4DV1 K;  4DR4 K;  4LFC K;  1HNX K;  4DR5 K;  4CW7 B;  4DV5 K;  5IWA K;  4B3R K;  1XNQ K;  4YHH K;  4LF9 K;  4AQY K;  4KHP K;  1N32 K;  1IBL K;  2VQE K;  1HR0 K;  4LFA K;  4OX9 K;  4CVN E;  4LF6 K;  4B3M K;  4JI6 K;  2VQF K;  4X64 K;  4DR2 K;  2UUB K;  1N36 K;  2E5L K;  5AJ3 K;  5LL6 Z;  4LFB K;  4JYA K;  3OTO K;  4NXM K;  2UXC K;  1N33 K;  5BR8 K;  4JI2 K;  4JI5 K;  4DV7 K;  4NXN K;  4DV0 K;  4LF7 K;  2UUC K;  3J81 O;  4JI4 K;  5LMU K;  4DV2 K;  4DV4 K;  3T1Y K;  4GKJ K;  3JAM O;  4DV3 K;  4JI0 K;  4LF8 K;  5FLX O;  4X66 K;  2UUA K;  1IBM K;  4DR3 K;  4V19 S;  4JI7 K;  2UXD K;  4DUY K;  4LF4 K;  1IBK K;  4X62 K;  4JV5 K;  5LMN K;  1HNW K;  4JI8 K;  4K0K K;  4DR1 K;  1XMQ K;  5IT9 O;  3J80 O;  3J7Y P;  4B3S K;  5A2Q O;  2HHH K;  1HNZ K;  2UXB K;  4X65 K;  3J7A P; 
#chains in the Genus database with same CATH topology
 1ASV A;  4RW8 A;  1LOT B;  4IFE A;  3LPU A;  4O0I A;  3KJV A;  3CCU N;  4PWD A;  3D7E O;  3BEX A;  3IFR A;  3I55 N;  3AVN A;  4CEZ A;  3IRX A;  1S6Q A;  1QQO A;  4CZF A;  2F9W A;  4HCC A;  1C1B A;  3CCQ N;  4DR6 K;  3U3Y A;  4O5F A;  4BE2 A;  3O9T A;  4XH4 A;  4FJL A;  3SJH A;  5KPZ A;  4DR4 K;  4CJT A;  2ASO A;  3VA3 A;  1BCM A;  4A5A A;  2IGI A;  2G8I A;  3M1F A;  3PY8 A;  3I0R A;  1NM1 A;  3AY9 A;  3L3U A;  3SBG A;  3QIC A;  3ZEU A;  3LDP A;  4QS8 A;  3OYB A;  4EZ9 A;  3SPZ A;  3M6G A;  3SV3 A;  1GLJ O;  3CM5 A;  2ZWH A;  2F9T A;  2O8E A;  4MDB A;  5FPD A;  2X78 A;  1UA0 A;  3VQ6 A;  2NRX A;  3KWI A;  3A5N C;  5BN8 A;  3DOL A;  2DY4 A;  3O8M A;  3VTH A;  4IEE A;  1EWQ A;  2NRT A;  4AH9 A;  3WNH A;  4FM1 A;  3CFO A;  5FDL A;  3A5M C;  4BWM A;  3CJ7 A;  5KRS A;  4Q0B A;  1QTM A;  1Z6R A;  3THX B;  4B1V A;  5CY4 A;  3F73 A;  1VQ7 N;  1HKB A;  5C15 A;  3AVC A;  1VHX A;  5GIO A;  4OLA A;  5BPL A;  2HHU A;  2XY5 A;  1HJO A;  1MWM A;  3UE5 A;  1S5J A;  3PO4 A;  4JLH A;  4CES A;  3WUH A;  4UQG A;  4C1N K;  2ZJQ L;  4AM6 A;  4DF8 A;  3ZSR A;  3CCV N;  1A5V A;  1G15 A;  4BRI A;  1KVA A;  3V1R A;  3S41 A;  1WSF A;  2WFB A;  4ISE A;  4B8A B;  3PLA A;  5AQN A;  2W6L A;  4ELV A;  3NF7 A;  1QQC A;  4CHQ A;  1WBB A;  4GV6 A;  3UKU B;  1TKD A;  3EZ5 A;  1BG3 A;  3PSF A;  4YDU A;  3ALY A;  4CD3 A;  1MWK A;  4Z4I A;  1DGK N;  1R59 O;  3NBP A;  4FWQ A;  4FSV A;  5KQD A;  5I3U A;  1X9S A;  3Q7C A;  3L3V A;  1NK5 A;  1NK8 A;  3GE1 A;  4EP5 A;  4BR0 A;  3THW B;  4B3O A;  4Z4E A;  4FK2 A;  4DR7 K;  1NGI A;  2RPI A;  3NDK A;  1I94 K;  4DV1 K;  3OYA A;  5FRM A;  4W5O A;  1V4T A;  4RW4 A;  3H3N O;  5GIP A;  3EZW A;  4FLY A;  3THX A;  2WOM A;  4BDZ A;  3K5O A;  3KTQ A;  4NO7 A;  1N32 K;  2VQE K;  4NLB A;  1VQ4 N;  3GL1 A;  3QET A;  3O9S A;  5E26 A;  2Q97 A;  4FLX A;  4F3O A;  4FJM A;  1HNI A;  4PHT X;  4KFB A;  4NB4 A;  3NHG A;  2E6L A;  5GAE P;  4JD2 B;  3SUQ A;  4BE1 A;  4CZJ A;  3CHW A;  3PIO L;  4A62 A;  4E7J A;  3AVH A;  1VSK A;  4J8F A;  2VGM A;  4OO1 J;  4BRL A;  1NOZ A;  4FWN A;  1J53 A;  3OBY A;  1TAQ A;  4CJR A;  3V1O A;  4PKH A;  3AAR A;  2XHB A;  2VG5 A;  1ZC6 A;  1RTJ A;  3UKU A;  1X9M A;  2GV9 A;  1HYV A;  1U49 A;  4K8Z A;  1RBS A;  4GNI A;  3K59 A;  2RN2 A;  2P9K A;  3EN9 A;  2G8U A;  3EKU A;  5BPN A;  5J2P A;  2PBD A;  3SMP A;  1C1A A;  5M1N A;  4V19 S;  4HTL A;  4JHD B;  3QNN A;  5HOO A;  4NCG A;  3HK2 A;  4LY7 A;  1RCH A;  4CK2 A;  1SL2 A;  4CHY A;  3SZ2 A;  3G10 A;  1X3N A;  3THW A;  3HST B;  1C6V A;  3VTI A;  3DM2 A;  3HL8 A;  2O8D A;  2Q2R A;  1T8E A;  3HI0 A;  5AQV A;  2GUI A;  3FZF A;  5AQX A;  1ILY A;  2ASP A;  1HKG A;  1E4F T;  3O08 A;  3UIQ A;  3K5L A;  3HJF A;  1XI1 A;  1NK9 A;  2F7T A;  1YI2 N;  3KLF A;  3UKR B;  3EY1 A;  2JWL A;  3DLB A;  4X65 K;  1Q7Y O;  1RT7 A;  2H3G X;  1UAX A;  3BF3 A;  1BQM A;  3EYZ A;  2YNH A;  4JD2 A;  2O8F B;  1YF5 L;  3VEV A;  3VQ9 A;  4B1Y B;  4CEE A;  3CJ1 A;  4ELT A;  1HPM A;  5AQT A;  2PZS A;  1T6C A;  1T05 A;  4Q5V A;  4DUZ K;  3DJC A;  4W5R A;  3NVK A;  2ZJP L;  1NGE A;  1SKR A;  3AVF A;  2HF3 A;  1U2V B;  3CCL N;  4CW7 B;  3VEO A;  3EE8 A;  1YT3 A;  4K43 A;  1ESV A;  1BDG A;  1X9W A;  1RT2 A;  3KHY A;  4KHP K;  4A2B A;  4E3S A;  3V9U A;  3WEE B;  1YVN A;  1T3V A;  4AM7 A;  3O3F A;  3THY B;  4CVN E;  3E66 A;  3O4W A;  4OPJ A;  4JHD A;  4CJP A;  1GLA G;  3HT3 A;  4DFK A;  4M7X A;  2A40 A;  1DKG D;  3QEW A;  1KAX A;  3VQ8 A;  1ZBS A;  2UXC K;  2Q3S A;  2GTD A;  3JSM A;  4DTS A;  2RE2 A;  1NWK A;  1SUQ A;  2QEX N;  2WON A;  3F5T A;  2D0C A;  3FE1 A;  1X1P A;  3R1X A;  1NJZ A;  5JVH L;  3UKR A;  2FF3 B;  5AQO A;  4OKK A;  2HNZ A;  4O4G A;  1DLO A;  4O8K A;  4E0D A;  1NKE A;  1T44 A;  4JK9 A;  1GOC A;  4BR4 A;  1NLV A;  3VQC A;  2KW4 A;  4BDP A;  1BCO A;  4RCH A;  4JI8 K;  1CZ9 A;  4BGB A;  4FWL A;  4JKB A;  4KH6 A;  3O6W A;  3PX6 A;  3KLH A;  2I7P A;  1U2V A;  1QVG M;  2J4R A;  1WB9 A;  2G8H A;  4M3Z A;  3E9O A;  4CEF A;  4JKE A;  3HRG A;  1JKH A;  1VSM A;  3CIP A;  3BGR A;  5JLH A;  1HJR A;  4AIL C;  1HYZ A;  4O55 A;  3WEE A;  4BQL A;  2VGN A;  2YNF A;  2CH6 A;  1RDU A;  1RIL A;  3BZC A;  4Z94 A;  3THY A;  3HVT A;  4FPB A;  4IG3 A;  3M3Z A;  4Y1C A;  4BR5 A;  3PO5 A;  4BR9 A;  4GVE A;  2E2P A;  2ZM6 K;  4KV8 A;  1ITG A;  1LAV A;  1BOT O;  2CGL A;  4DLG A;  3OY9 A;  1U04 A;  1LWE A;  5AQF A;  4BRH A;  2OPQ A;  4DSE A;  3NMU A;  1NMN A;  1KFS A;  1RDC A;  2PY5 A;  4LFC K;  1YJN N;  3FLC O;  4JS4 A;  4YOT A;  4B3R K;  2A42 A;  4FWM A;  3NAE A;  3CI5 A;  3VQE A;  3JYT A;  1X9J A;  4FJX A;  4GV3 A;  4JN4 A;  4BG8 A;  1Q8I A;  4MO4 A;  3ZCM A;  3Q7B A;  4U67 L;  4JS5 A;  4CZL A;  1WLJ A;  4RTF D;  3MN9 A;  1RFQ A;  1C0U A;  3VQA A;  4IEI A;  1IKX A;  3RSE B;  1NNE A;  2UUB K;  3TR8 A;  3VGK A;  4RW9 A;  3TSQ A;  2E5L K;  3V9Z A;  4KB1 A;  1HPZ A;  1BHL A;  1E4G T;  4NLC A;  1VQL N;  5LJV A;  3R8E A;  1FK9 A;  2QK9 A;  1BA0 A;  4LSN A;  2V52 B;  1KAY A;  4CF9 A;  3SJJ A;  1GLD G;  4HUF A;  4DTN A;  3H08 A;  3RR7 A;  1D9F A;  1JJ2 M;  3KVG A;  1J6Z A;  4N76 A;  4C8N A;  5HP1 A;  2JWK A;  4FL9 A;  4LF4 K;  4H4O A;  5JIC A;  3P38 A;  3RR8 A;  3DRP A;  2Q0R A;  3PSI A;  1OKJ A;  3G71 N;  3C7N A;  4ILH A;  3DAW A;  1L5U A;  2EX3 A;  4EIA A;  3RRH A;  4Z0U A;  4FJI A;  4FM0 A;  2HHX A;  1EET A;  2KFN A;  3AO1 A;  1IO2 A;  4K25 A;  4HUE A;  5AQI A;  2BH1 A;  2IVN A;  3L0Q A;  2KLA A;  2B4J A;  4FWP A;  5AZI B;  4YOY A;  4OJR A;  4YFU A;  3D0P A;  2VYP A;  4KHW A;  5AQW A;  3RSE A;  4DFM A;  1J5E K;  4YY3 K;  3LAK A;  1BIZ A;  3OHR A;  1IKW A;  4I9L A;  3K0S A;  3M8P A;  4DR5 K;  1LW2 A;  4YHH K;  5AQR A;  4KTW A;  4FM2 A;  1JCG A;  4FXD A;  2NRV A;  3DRR A;  3TAB A;  1U6Z A;  3ID8 A;  4BRP A;  2YV0 X;  3ULD A;  4DS4 A;  3E9L A;  4NCA A;  2HBJ A;  1FW6 A;  1NK4 A;  2YKN A;  1KVC A;  1RTH A;  3O4Q A;  4GMJ B;  5DK5 A;  5M1Q A;  2FSN A;  5KTQ A;  5LL6 Z;  3L6Q A;  3H1Q A;  4JI2 K;  3G6E N;  4CIG A;  3ZSQ A;  4DTX A;  3A0I X;  2OZM A;  2IVO A;  3A8Y A;  2W42 A;  3KK7 A;  5F0X A;  3SAH A;  1K8A O;  2WUS A;  4JI4 K;  1Z26 A;  3ZET B;  3RMC A;  1UOC A;  1VQ8 N;  3T19 A;  2JGU A;  4KBO A;  4I2P A;  5AZI A;  4NYN A;  5KGW A;  4CCH A;  3QDK A;  2VWB A;  4JI7 K;  3RMB A;  5FRN A;  3CER A;  4KPY A;  4X62 K;  4R5P A;  1RDB A;  4FW1 A;  1Q18 A;  5AQH A;  4WF9 L;  1KFD A;  4FYD A;  2IAJ A;  3NH0 A;  2AP1 A;  3KK2 A;  3LDO A;  3DMJ A;  4OGE A;  1XWL A;  1GLL O;  1QSY A;  1JL2 A;  3D45 A;  3AVL A;  4H5R A;  4RW6 A;  3KLI A;  2V51 B;  3U3G A;  1Q86 O;  1TK5 A;  4MLE A;  3EO3 A;  4YDU C;  3C6U A;  3AO3 A;  5GAG P;  3LWL A;  4YOU A;  4LD0 A;  3ZSO A;  3O3G A;  4DSJ A;  3LM2 A;  1TYQ B;  3VGL A;  3HOS A;  4BVO A;  2P9L B;  1ZBH A;  4DTO A;  1TGO A;  4IXC A;  5H1S Q;  2E2N A;  1FJG K;  3K5M A;  1Z05 A;  3LDQ A;  4ZTJ A;  3HM8 A;  4OPA A;  3QER A;  3R3L A;  3QEP A;  2P51 A;  4H5N A;  3SCX A;  1B9D A;  4JK8 A;  4BC3 A;  3ZET A;  4LF9 K;  4CJE A;  3VOV A;  3CPW M;  1EQY A;  1RDA A;  3AO5 A;  3TTD A;  1IG8 A;  1LW0 A;  3OS2 A;  3V4I A;  1Q9Y A;  1OH5 A;  3RWU A;  2F96 A;  4FLT A;  3CJC A;  5EVZ A;  4PY5 A;  4BC4 A;  3AVJ A;  2HMI A;  2IIR A;  3OJU A;  4YOV A;  4MDA A;  4A59 A;  3ZSV A;  3LP2 A;  1TK8 A;  2HBL A;  5C24 A;  1JXB A;  4NXM K;  2KFZ A;  4BRE A;  1VSH A;  3SK3 A;  2KTQ A;  1U4B A;  2YX6 A;  4DV0 K;  2IS3 A;  5JS2 A;  2E6M A;  2QM1 A;  3V9S A;  3SMS A;  4DV2 K;  4KHQ A;  2OAN A;  5ELZ A;  4YOW A;  4IOA L;  3CQY A;  3NE6 A;  5D3G A;  3LP0 A;  4B9N A;  3QBW A;  4HTU A;  3OYE A;  1YJ9 N;  1CZB A;  3ZX3 A;  4FCY A;  4YOX A;  4M7Y A;  4H8K A;  5M1K A;  1NG9 A;  4ELU A;  4FVU A;  3VEZ A;  4B9U A;  1TYQ A;  3L2Q A;  1QQN A;  4MO5 A;  1LWC A;  5C10 A;  3CYM A;  4KHS A;  4DR1 K;  1A5X A;  1HMV A;  1RNH A;  3SLC A;  1CZA N;  3KKS A;  3QFU A;  1EX4 A;  4WQ5 C;  5GIN A;  5EU7 A;  1Q81 O;  1SS6 A;  4PL8 A;  4B3S K;  4JNE A;  4GV9 A;  1KAZ A;  5EXW A;  3CCE N;  3NH2 A;  1MU2 A;  5AQZ A;  3ATV A;  1NGJ A;  3P5J A;  3NGI A;  2IC3 A;  2NRH A;  5AQJ A;  5HBM A;  3FFI A;  1S9G A;  3HBT A;  1IV0 A;  2DPN A;  3C6A A;  1NGF A;  4IWV A;  4O8U A;  2HVH A;  1VQO N;  2VWK A;  2UU9 K;  2BE2 A;  1WN7 A;  3MN7 A;  4CHN A;  2B5J A;  2FSJ A;  4OPH A;  5T7B A;  4BGA A;  1KSP A;  3AA4 A;  3WNF A;  4CD1 A;  1XNQ K;  1IKY A;  2VCP A;  2BUP A;  1N6Q A;  4WFB L;  3S3M A;  2X6S A;  1TUU A;  1S9E A;  1RDD A;  1RTD A;  1VRU A;  4YNQ A;  3I56 N;  4O0J A;  5AQL A;  1OVY A;  3D2E B;  4Z4H A;  4B3M K;  2QWL A;  5HLF A;  2QXL A;  3CF5 L;  1D8Y A;  1ZXO A;  1VRT A;  1XUP O;  1CXU A;  3O1W A;  3C6H A;  4DQQ A;  3U9Z A;  4M3R A;  4JKF A;  1TK0 A;  1T7P A;  3ZSX A;  3I8B A;  1S72 N;  4FLW A;  4DLE A;  3J8A A;  4DSF A;  2D5R A;  3OJS A;  3VPZ A;  4IJA A;  3SI6 A;  3AAP A;  1HUX A;  4CZI A;  2GEL A;  4BRQ A;  1BU6 O;  3MN5 A;  1DTT A;  4DV3 K;  4CF2 A;  1VQN N;  3AVG A;  4JI0 K;  3VQD A;  2DTU A;  3V1Q A;  2Y1I A;  5MLC Q;  3RVC A;  4KHN A;  2BTF A;  1KQS M;  3H1V X;  1IBM K;  3IG1 A;  4A57 A;  1KXP A;  1WOQ A;  4DTP A;  1KLM A;  2HVI A;  3O4N A;  2P5G A;  2YHB A;  2QWQ A;  3DYA A;  1SL1 A;  4CJV A;  4FLU A;  3MDQ A;  3BF1 A;  2ASM A;  3M5R A;  5AQG A;  4E89 A;  3OYC A;  4CHP A;  4HHT A;  4MQ3 A;  3WXK A;  3SQ2 A;  1GLB G;  4CGG A;  3L2U A;  3RMA A;  3D2E A;  5C2F A;  3O1B A;  5EX5 A;  1ATN A;  3AA3 A;  4CZE A;  2QWN A;  3DXK B;  2Z1H A;  3AVB A;  4R79 A;  2IDO A;  4NCB A;  4E1N A;  3CJ9 A;  4C1N I;  1ZYQ A;  2HOE A;  4JI1 K;  4CJQ A;  4WQ5 A;  2QWM A;  4FPA A;  3TAF A;  4CF8 A;  1JXE A;  3B6O A;  3TSU A;  1NGD A;  3NF8 A;  4CER A;  4F2R A;  3VET A;  3KWG A;  5JLF A;  3BY5 A;  3GOI A;  3VEX A;  4PL7 A;  4B08 A;  2DFF A;  4EFH A;  3C65 A;  2QW9 A;  4GVM A;  3O9U A;  2YJF A;  3TPQ A;  3AGR A;  4CJF A;  1NGB A;  2NZT A;  3MCP A;  5J1E A;  4HUG A;  1CXQ A;  1RTI A;  4A5B A;  3DLL L;  5AFU H;  1C0G A;  3NFA A;  3VQ5 A;  4CEA A;  1XC3 A;  2VG6 A;  1SZ2 A;  2P9P B;  3OTO K;  4E1M A;  3HP6 A;  3CQX A;  3QO9 A;  4QS9 A;  4DQ8 A;  3H45 C;  3DLG A;  4G9Z A;  5C2D A;  1RBT A;  4FJK A;  4CZM A;  4FWS A;  3WNG A;  4XH1 A;  1SAZ A;  1IG9 A;  2VG7 A;  1SV5 A;  3ENO A;  2YHX A;  2QTD A;  4KAZ A;  1ZBF A;  3D2F B;  1JLF A;  1DEJ A;  3ENH A;  3DXK A;  2IOC A;  4ZTF A;  3SQ1 A;  1TV6 A;  1IKV A;  1MDU B;  3VEY A;  3OBW A;  1O13 A;  4CGF A;  3O5B A;  3QBX A;  4CHZ A;  5SZT A;  4FJN A;  4N41 A;  4AHV A;  4CGD A;  4F4K A;  1Q82 O;  1BGX T;  4EAH D;  1FKP A;  1EP4 A;  1C0M A;  1NK0 A;  3MMV A;  4FW2 A;  2F8T A;  3CJB A;  3HM9 A;  1RBV A;  3P83 D;  1BO5 O;  3EE9 A;  3MCA B;  4EHU A;  1W7A A;  1Q9X A;  2O8F A;  3VQQ A;  2E88 A;  1FXX A;  4IOC L;  4CJ5 A;  4DTM A;  5CE3 A;  2B6A A;  2G8F A;  2A1S A;  5EY4 A;  4Z4C A;  1HYS A;  3TTF A;  1VAZ A;  5F1X A;  3M8S A;  4J2B A;  5I42 A;  3AA5 X;  3QEV A;  1KRP A;  4M3Y A;  2P9P A;  5AQM A;  3ZT0 A;  3N4P A;  3QFP A;  4QS7 A;  4IFV A;  3AGK A;  3ISN C;  3C6T A;  1Z25 A;  3WXI A;  1WBD A;  2O4G A;  4ZHR A;  4K42 A;  4BRO A;  3KK1 A;  4JKH A;  2OPS A;  2E1Z A;  4BRG A;  3UB5 A;  3H46 O;  4J2D A;  3D2F A;  3GG4 A;  1IH7 A;  3N4Q A;  5EOY A;  4N56 A;  2Q1N A;  4E1J A;  1P90 A;  4XEI A;  3LZJ A;  1N36 K;  1TKX A;  2NRW A;  3DOK A;  3CG7 A;  4JYA K;  4EP4 A;  1OH6 A;  4IJN A;  4CK1 A;  4I7F A;  2KKZ A;  1LV5 A;  4DTR A;  4CJU A;  4RG8 A;  4U7B A;  1WSG A;  3HSC A;  2XRI A;  1NKC A;  3T1Y K;  4RW7 A;  4E7H A;  4BAC A;  1QZ5 A;  4GKJ K;  3AV9 A;  2D1K A;  3O3H A;  2W41 A;  5C12 A;  5KI6 A;  4IBN A;  1K9M O;  5E84 A;  5M1O A;  4BRN A;  2FBV A;  1XHX A;  2Y1J A;  3K5N A;  3ZLJ A;  4OVL A;  1VSL A;  3KIO A;  3IUC A;  5GAD P;  4H0Y B;  4KHU A;  1JLC A;  1UA1 A;  1K6Y A;  2GUP A;  2AJQ A;  1JLQ A;  3LAL A;  3LAN A;  2JLE A;  2ITM A;  3FR0 A;  4DFJ A;  3EL2 A;  5GAH P;  1VQM N;  4F2S A;  3E01 A;  4CJS A;  3TI0 A;  2WC9 A;  2UXB K;  1YXQ A;  3KD1 E;  4CJK A;  3DWL A;  4FOI A;  2QKB A;  4FJH A;  3F2K A;  1J54 A;  2P1J A;  3QIP A;  3T69 A;  4H5T A;  4PKI A;  2YI1 A;  4CE9 A;  5AR0 A;  2F4V K;  3O9Q A;  4OKE A;  1N34 K;  3KD5 E;  5K14 A;  1QVF M;  2ZD1 A;  1WAF A;  4KRE A;  2QXF A;  4KH5 A;  4M41 A;  4O44 A;  1ZBL A;  4K41 A;  4G1Q A;  3L2W A;  1C0F A;  4ISG A;  1OVQ A;  1BQN A;  3E9P A;  2O8B B;  4LH5 A;  4EZ6 A;  1SKW A;  4KI6 A;  2HF4 A;  1VQ6 N;  3HPO A;  3HOT A;  3LAM A;  3HYF A;  3CFP A;  1QHT A;  4LF6 K;  3CC4 N;  2W6K A;  4JI6 K;  2VQF K;  2GWJ A;  3JXU A;  2A1R A;  3BDP A;  2HW3 A;  1NKB A;  3H6E A;  2YHW A;  3CET A;  3PIP L;  5C0Y A;  1WSJ A;  2HHT A;  1L3U A;  2QWR A;  4FJG A;  1RDW X;  3GDQ A;  4DSI A;  5BRD A;  4ISF A;  3TAG A;  4DU3 A;  4B1U B;  3KKR A;  1I39 A;  1D9D A;  3KK3 A;  2GWK A;  2OCE A;  4QOZ B;  1I3A A;  3J81 O;  1F21 A;  4ID5 A;  3DLE A;  4JKG B;  4N47 A;  5BR9 A;  3NGY A;  3OYD A;  1JLE A;  4DQR A;  1VQP N;  1YAG A;  1KD1 O;  2GBZ A;  1YIJ N;  2D0P A;  3SAF A;  4PKG A;  1H1V A;  4CZG A;  1ATR A;  1HX1 A;  1VK0 A;  2OTJ N;  1VQK N;  4LC9 B;  2A5X A;  4CJ3 A;  2FXU A;  3HPH A;  4FK4 A;  4KRF A;  1S3X A;  1QZ6 A;  2ZGY A;  2P9I B;  1S1V A;  1G99 A;  1RBR A;  1HLU A;  4BRF A;  1WAJ A;  4KTQ A;  3DRS A;  3CME N;  1S1T A;  3LP3 A;  2O8B A;  1NJW A;  4AHU A;  4JK7 A;  2FBT A;  2E8A A;  2PAV A;  3OA9 A;  4CIF A;  5AQP A;  1B9F A;  3T3F A;  4E19 A;  5DM6 L;  1GLF O;  5AQY A;  4B8C A;  3AVA A;  4H0T B;  5TKY A;  1GOA A;  1NGA A;  1YTA A;  2UYT A;  1ZBU A;  1TVR A;  1VSJ A;  3THV A;  4FZY A;  2WTU A;  4BDY A;  3CC7 N;  4GKK K;  3ZX2 A;  3WXL A;  3TAP A;  2RKI A;  4J2E A;  4FJ9 A;  5C42 A;  1BI4 B;  4M3X A;  4IKF A;  5DMR A;  4JKA A;  1YJW N;  5M1P A;  2AA4 A;  1HR0 K;  3AVI A;  1JCF A;  3ZEU B;  3MWT A;  4OX9 K;  1CLQ A;  3IMX A;  1J5O A;  3LDS A;  2OPP A;  5DM7 L;  2D4W A;  4JKC A;  1NJY A;  2QA4 N;  3SUO A;  4E7K A;  4CEB A;  4ILG B;  3HP9 A;  3FZL A;  2P9I A;  3VN5 A;  3I8D A;  3TAQ A;  4LFB K;  2FLO A;  2P5O A;  4DV7 K;  4WFN L;  4H4M A;  4DQP A;  4E7L A;  1NJI O;  3MXM A;  1KCF A;  3L4I A;  4CZH A;  3BUZ B;  3CFR A;  1BIU A;  2FC0 A;  4H5V A;  1KLN A;  4Z4G A;  2XY6 A;  4GW6 A;  3OYM A;  1FKO A;  5FRO A;  4DR3 K;  4CEC A;  4DUY K;  4OPK A;  1IBK K;  4GY2 B;  2ZF5 O;  3OYJ A;  3U8X A;  3MX2 A;  1LWF A;  3EEQ A;  3VF6 A;  2PYL A;  4FZZ A;  4H0X B;  2E2Q A;  1XMQ K;  4XH5 A;  4JAX A;  1BI4 A;  3KLE A;  5KQ8 A;  1BUP A;  4Z4F A;  1ZBI A;  3DLR A;  4JKD A;  4B1W B;  2NRZ A;  3ZT2 A;  5J2Q A;  2ETJ A;  3SBT A;  1HNZ K;  2DFE A;  4DS5 A;  4B9V A;  3IAY A;  4KO0 A;  4W5Q A;  4ILJ A;  4DV6 K;  4H0V B;  3TU5 A;  4JI3 K;  2P9L A;  2RF2 A;  1ASW A;  3WT0 A;  4BVP A;  4B3T K;  1S6P A;  2HHW A;  3CD6 N;  3HZ6 A;  3LM9 A;  3LZI A;  3VQ4 A;  3SYZ A;  3QIO A;  4NYF A;  4IFY A;  3WXJ A;  4B9Q A;  4K8X A;  1T03 A;  1YHQ N;  1XMO K;  3EKS A;  2A41 A;  4L3Q A;  1B92 A;  4BRC A;  3MXJ A;  1SKS A;  3L8B A;  4DTU A;  5KRT A;  4W5N A;  3MEG A;  3VEN A;  3CCS N;  1VSF A;  3QEI A;  1U45 A;  2DFH A;  4TSX A;  4BRM A;  4CGH A;  4CFC A;  4EHT A;  2ZQB A;  4LFA K;  1TL1 A;  3FGU A;  3RRG A;  4O5B A;  3M8Q A;  1Y64 A;  5FPE A;  4CEO A;  1BA1 A;  4WCE L;  3WQU A;  1REV A;  3TAE A;  5HRP A;  4DB3 A;  4DR2 K;  4JRQ A;  2HND A;  3CM6 A;  1OH7 A;  4M42 A;  5JS1 A;  3OYL A;  5AJ3 K;  2HST A;  3V6D A;  3B8A X;  5SWM A;  3ID6 A;  1WUA A;  3TSP A;  3QNO A;  3PUF A;  4DTJ A;  2YNI A;  2FBY A;  4DV4 K;  1U48 A;  3I0S A;  2LSN A;  3S3N A;  4QCL A;  1QQM A;  2E1Y A;  3GBT A;  1JLB A;  3MEC A;  3NCI A;  1L3T A;  2E4L A;  4A2A A;  4AHS A;  1NK7 A;  5AQU A;  2VWJ A;  4DKW A;  2D0B A;  4F3T A;  1TKT A;  2P9K B;  4AHC A;  4DFP A;  1K8K B;  4BE0 A;  5LMN K;  1M90 O;  5AQS A;  3AA2 A;  5ADX H;  4KH4 A;  1OH8 A;  3J7Y P;  4B9S A;  1TL3 A;  2HNY A;  4C23 A;  1X3M A;  1GLE G;  4HVJ A;  4KKO A;  4I2Q A;  2QKK A;  2O8D B;  4I6M B;  4BC2 A;  3V9X A;  3OYK A;  1RT3 A;  3ASM A;  3D6R A;  1RBU A;  2QWP A;  3G25 A;  3ATU A;  1YIT N;  2ITG A;  3MXI A;  3ZSY A;  4E7I A;  4YOR A;  4KB0 A;  4CBU A;  3ZT4 A;  1W2B M;  4M3U A;  3DXM B;  5CZ2 A;  2Z1G A;  4Y1D A;  4FJ7 A;  1GOB A;  4HCB A;  5HRR A;  2HBK A;  3LP1 A;  4DCH A;  2OZS A;  1SQK A;  3K2P A;  3VQP A;  2G8V A;  3R9P A;  5BRE A;  4IDH A;  4FO0 A;  1DTQ A;  2HBM A;  2XY8 A;  4M3T A;  3TAR A;  1V4S A;  3CPE A;  4CF1 A;  4CFA A;  2I7N A;  4DQI A;  3OVN A;  5C25 A;  4FWK A;  4B9L A;  3KLG A;  1K73 O;  5FPN A;  2YHA A;  1NOY A;  2NNW A;  5M1F A;  2G8K A;  3OYH A;  3K58 A;  5AZJ B;  4WE1 A;  2ATQ A;  1K8K A;  3VER A;  2YKM A;  1R0A A;  1RT4 A;  3VMF B;  3IKM A;  1N33 K;  5BR8 K;  3SV4 A;  3BP8 A;  2XO7 A;  1KC8 O;  2FF6 A;  3K9J A;  4FOE A;  3IS9 A;  1NU0 A;  1P8Z A;  2YHY A;  3FZH A;  4H03 B;  4I6M A;  1NJX A;  1YTU A;  3QIN A;  3TWH A;  4C8K A;  3W0L A;  2GX9 A;  3NGZ A;  3JS6 A;  4PQU A;  4BQZ A;  1O1W A;  4M63 C;  3VF2 A;  4IDK A;  4BG9 A;  2KHO A;  3C95 A;  2QWO A;  5HRN A;  4CBX A;  3NH1 A;  2UXD K;  5JVG L;  3R6M A;  4LH4 A;  2ZE2 A;  2R7Y A;  1N8R O;  4JV5 K;  3DXM A;  3HO1 A;  3VEW A;  3HXM A;  2O8C B;  3J7Z O;  3A2F A;  5E41 A;  3OS1 A;  2RHK A;  5KGX A;  4PUO A;  4DSK A;  4CEQ A;  2BGG A;  2X6N A;  5A2Q O;  3P4I A;  1N5Y A;  1TUY A;  1ASU A;  2HHH K;  4CJ7 A;  5KPR A;  3AO2 A;  5LJW A;  2YCH A;  1RT6 A;  1LCU A;  2CGK A;  4PA1 A;  1TAU A;  1QSL A;  4MLH A;  3ZT1 A;  5AZJ A;  5JMV A;  4CBW A;  3I33 A;  4KI4 A;  5HL7 L;  5FPM A;  5CR4 A;  1L3S A;  1VSD A;  4CI6 A;  4BRD A;  3LDL A;  1S1U A;  4DV5 K;  3P31 A;  4I9Q A;  4B1Z A;  1QS4 A;  5ADX A;  4DG1 A;  5BN9 A;  3MX5 A;  4A61 A;  1C0T A;  3ULE B;  1J9A A;  4UY8 O;  3OYG A;  3F9K A;  3CQ8 A;  5F2R A;  3L2V A;  1IBL K;  2QI2 A;  4CJL A;  1T6D A;  4CED A;  5CZ1 A;  4C8L A;  4FWR A;  2V7Y A;  2Z1I A;  4L8R B;  2E2O A;  4IG0 A;  4JEP A;  1ATS A;  1C1C A;  3CJA A;  3U6F A;  2P9N B;  4CK3 A;  2O8C A;  3VGM A;  4FLV A;  2HMP A;  4MFB A;  4CHO A;  3CMA N;  4LF7 K;  2UUC K;  2NLX A;  3WNE A;  4N5S A;  4AF1 A;  3G4S N;  3WXM B;  4F8R A;  1RT5 A;  1KTQ A;  5HRS A;  1W0H A;  1JLA A;  4IO8 A;  5BRF A;  1VQ9 N;  1BL3 A;  3HTV A;  1WSH A;  1W9H A;  1IJJ A;  4FLZ A;  2UUA K;  3CXC M;  1EKE A;  1UWB A;  2A3Z A;  1S22 A;  3AVM A;  3ZSZ A;  4K0K K;  3AO4 A;  1L3V A;  2G8W A;  3MK6 A;  1S1W A;  2NRR A;  1WSI A;  2HHS A;  4BR7 A;  4Y0W A;  1TKZ A;  1LAW A;  3C7N B;  3FZM A;  4CGJ A;  3OYN A;  4CJ4 A;  3ULE A;  1BWF O;  3V9W A;  3O9R A;  4FWO A;  2V7Z A;  4H0O A;  3SUP A;  3CCM N;  1NGG A;  1D5A A;  4ID1 A;  4B1X B;  2PFU A;  3J7A P;  3DLK A;  3T1H K;  3ZT3 A;  1JCE A;  5CHI A;  1XNR K;  3MWP A;  1W97 L;  3PV8 A;  3E1Y A;  4C8O A;  2X74 A;  5AFU A;  2P9N A;  1NMD A;  3O80 A;  3NF6 A;  5TKW A;  5IWA K;  4BWJ A;  3G0Z A;  2ZGZ A;  4OGC A;  3SNN A;  3C0B A;  5HRO A;  5AQQ A;  2KQ2 A;  3A5L C;  4FZX C;  1EXQ A;  4CIE A;  2CH5 A;  2W40 A;  4WQ4 C;  1BIS A;  2Q31 A;  1EWR A;  3MEE A;  1NK6 A;  2D0O A;  2PYJ A;  3LWM A;  1VSE A;  3U4L A;  4X64 K;  3AVK A;  3CC2 N;  5J2M A;  4IO9 L;  3VQB A;  4FJ8 A;  1QSS A;  3A5O C;  3RMD A;  3T1A A;  1M1K O;  4NXN K;  2GEM A;  4BRK A;  5KPT A;  5BRH A;  2IVP A;  3OS0 A;  3BZK A;  4KTZ A;  4WYB A;  1HNV A;  2P9S B;  3VA0 A;  1HRH A;  3VES A;  2HHQ A;  5FLX O;  4DHY A;  4X66 K;  1EO1 A;  5B8H A;  5CYQ A;  2F8S A;  3DLH A;  4W5T A;  4ICL A;  3HVR A;  4DMN A;  1S1X A;  2E20 A;  4AHR A;  1HNW K;  2P9U B;  1KVB A;  2FSK A;  2Q36 A;  4DSL A;  2KZM A;  3SPY A;  3AAQ A;  4DF4 A;  1JLG A;  4BRA A;  3J80 O;  3MAQ A;  3OYF A;  3TTC A;  5BPM A;  1RT1 A;  4CF0 A;  2EHG A;  4B9M A;  1HQE A;  3QLH A;  3RTV A;  4BY9 C;  2OPR A;  3DI6 A;  3L4Q A;  1HKC A;  1U47 A;  1QHA A;  1QE1 A;  3MED A;  5I9E B;  2OTL N;  4M3W A;  4CJW A;  3NVM A;  4BR2 A;  1D4X A;  3P39 A;  2XY7 A;  4BC5 A;  2NUB A;  4CFD A;  2Z1J A;  2I5J A;  2WBN A;  3W3D A;  1XC9 A;  2BAN A;  4WFA L;  3LPT A;  1WSE A;  4LF5 K;  3WQT A;  1HNX K;  2YNG A;  4B9T A;  4JRP A;  4H0P A;  4J2A A;  3F9M A;  4HWI A;  4FK0 A;  3T7Z A;  4DWI A;  1Y97 A;  2YJE A;  2OYQ A;  3V81 A;  4AQY K;  2P9S A;  3OW2 M;  1XQS C;  3QB0 A;  1DT9 A;  3L2R A;  2HHV A;  3QES A;  3P1G A;  3KZB A;  3SQ0 A;  1HQU A;  3U9D A;  2FBX A;  4RWT A;  1WNS A;  4H5W A;  4LSL A;  4CZK A;  3H3O B;  3B6P A;  5CYM A;  3QEX A;  5AQK A;  5J2N A;  2Q0U A;  3M8R A;  2P9U A;  3QML A;  2EWS A;  3IDH A;  1JL1 A;  2D0A A;  3MN6 A;  4M45 A;  2A6A A;  3ITH A;  3LL3 A;  3ZSW A;  4JI5 K;  3CCJ N;  4JKG A;  3K57 A;  4OLB A;  4DQS A;  3ENB A;  1NGH A;  2KZZ A;  2BDP A;  3TAM A;  3K9K A;  1VQ5 N;  3VQ7 A;  5LMU K;  1VSI A;  4WQ4 A;  3JAM O;  3ZX0 A;  1GLC G;  1A5W A;  4LF8 K;  4F9O A;  4C8M A;  2HB5 A;  3HPG A;  3SAG A;  1E3M A;  2O8E B;  4FVM A;  2O4I A;  3FFK B;  4XIU A;  1XHZ A;  3VF4 A;  2CGJ A;  4CFB A;  4FJJ A;  4KHY A;  1YUW A;  3OYI A;  4IOX A;  1SL0 A;  1YVU A;  3NF9 A;  1MA9 B;  4DU1 A;  3TAN A;  3S3O A;  5LY3 A;  3CCR N;  3FZK A;  4QAG A;  3LDN A;  5IT9 O;  3S9H A;  1RGI A;  4AHT A;  3C94 A;  3ZYY X;  4CGI A;  4FJ5 A;  3PX4 A;  3SQ4 A;  2OA8 A;  4OKJ A;  2ZJR L;  4DU4 A;  1NGC A;  3SUN A;  4IZ9 A;  3PX0 A;  1NBW A; 
#chains in the Genus database with same CATH homology
 4DV6 K;  3T1H K;  4JI3 K;  1XNR K;  2ZM6 K;  4B3T K;  2F4V K;  1J5E K;  4YY3 K;  1N34 K;  4DR6 K;  2UU9 K;  4GKK K;  4DR7 K;  4DUZ K;  4LF5 K;  1XMO K;  4JI1 K;  1I94 K;  1FJG K;  4DV1 K;  4DR4 K;  4LFC K;  1HNX K;  4DR5 K;  4CW7 B;  4DV5 K;  5IWA K;  4B3R K;  1XNQ K;  4YHH K;  4LF9 K;  4AQY K;  4KHP K;  1N32 K;  1IBL K;  2VQE K;  1HR0 K;  4LFA K;  4OX9 K;  4CVN E;  4LF6 K;  4B3M K;  4JI6 K;  2VQF K;  4X64 K;  4DR2 K;  2UUB K;  1N36 K;  2E5L K;  5AJ3 K;  5LL6 Z;  4LFB K;  4JYA K;  3OTO K;  4NXM K;  2UXC K;  1N33 K;  5BR8 K;  4JI2 K;  4JI5 K;  4DV7 K;  4NXN K;  4DV0 K;  4LF7 K;  2UUC K;  3J81 O;  4JI4 K;  5LMU K;  4DV2 K;  4DV4 K;  3T1Y K;  4GKJ K;  3JAM O;  4DV3 K;  4JI0 K;  4LF8 K;  5FLX O;  4X66 K;  2UUA K;  1IBM K;  4DR3 K;  4V19 S;  4JI7 K;  2UXD K;  4DUY K;  4LF4 K;  1IBK K;  4X62 K;  4JV5 K;  5LMN K;  1HNW K;  4JI8 K;  4K0K K;  4DR1 K;  1XMQ K;  5IT9 O;  3J80 O;  3J7Y P;  4B3S K;  5A2Q O;  2HHH K;  1HNZ K;  2UXB K;  4X65 K;  3J7A P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...