2HHHK

Crystal structure of kasugamycin bound to the 30s ribosomal subunit
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title The antibiotic kasugamycin mimics mRNA nucleotides to destabilize tRNA binding and inhibit canonical translation initiation.
pubmed doi rcsb
molecule tags Ribosome
total genus 30
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2006-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 2hhhK00
1N34K 4JI5K 4DV0K 4LF9K 4CW7B 4LFAK 5LMNK 2VQEK 1XMQK 4JI0K 4JYAK 4NXMK 4X64K 1HNWK 5A2QO 4GKKK 4B3MK 4YHHK 4CVNE 1XMOK 3J81O 4X62K 4LF4K 1IBKK 1HNXK 4DV3K 4K0KK 4JI2K 4DR5K 2UXBK 5AJ3K 4B3TK 4DR4K 5BR8K 2E5LK 4JI6K 3J7YP 5LMUK 4DUZK 4OX9K 4DR6K 1HR0K 5LL6Z 4DV7K 3OTOK 4B3SK 1J5EK 4DUYK 2UXDK 2UXCK 3J7AP 4KHPK 4LFCK 4B3RK 2ZM6K 4DR7K 4DR2K 1HNZK 1IBLK 2UUBK 3J80O 4JV5K 2F4VK 4LF6K 3T1YK 4JI1K 4JI3K 5FLXO 4DV5K 1N36K 5IT9O 1XNQK 1IBMK 4LFBK 4DR1K 2UUAK 5IWAK 4LF7K 1N33K 4DV6K 3JAMO 4NXNK 1N32K 4V19S 4GKJK 4DV2K 4YY3K 4JI7K 4DV1K 2UU9K 1FJGK 4X66K 1XNRK 4JI8K 4LF5K 4X65K 2VQFK 4DR3K 2UUCK 2HHHK 3T1HK 4LF8K 4DV4K 1I94K 4AQYK 4JI4K
chains in the Genus database with same CATH superfamily
1NOZA 3CJAA 3WNGA 4JI5K 3CJCA 2NRXA 4UY8O 3K57A 2KFNA 3HSTB 3TARA 4QCLA 1BIUA 4ISEA 4KB1A 3VQCA 3WXKA 4L3QA 4FLYA 4JEPA 1UAXA 4E1MA 3VMFB 4B1YB 4CERA 4EIAA 3EL2A 4IJNA 4KI6A 5C42A 4O4GA 4NCAA 3H1VX 4FL9A 3CI5A 2XO7A 4FM0A 5AR0A 4BRKA 4LC9B 4YORA 3TAEA 1D9FA 2BUPA 4B9SA 1S1WA 3JS6A 4DQIA 4B1XB 4B3TK 3WEEB 4H5NA 3LAKA 3KLEA 3TAGA 3HPGA 1BA0A 3CMEN 1NWKA 3QESA 4CEQA 3OYFA 5C0YA 3IKMA 3E01A 4HHTA 4XH1A 4FWNA 4IOXA 4JKGB 4H4MA 4JN4A 2B6AA 4KPYA 1JLQA 4KHWA 2RF2A 4DSIA 4KFBA 1CXUA 1YTAA 2YHYA 3CFPA 4F8RA 4H5RA 1YI2N 1C1BA 3K9KA 4DTSA 1LW2A 4IOAL 1JLBA 1HNZK 3WXIA 3SZ2A 4YOXA 3D0PA 1KLNA 2F8SA 3A5NC 2FF3B 5KQDA 3OYKA 3W3DA 3A2FA 1ATNA 1NK6A 1L5UA 2FSJA 3U8XA 2A42A 1S6PA 1GOCA 4AILC 4IJAA 2GWKA 2ZJQL 5I42A 1YVNA 2PY5A 2QWOA 3L2VA 1TGOA 3TSPA 3OJSA 4CZKA 5AQNA 1KTQA 3HVRA 3RWUA 4A2BA 2P9SB 4PL7A 4CE9A 3FR0A 2F96A 4WQ5C 1TK0A 4AHTA 3VQQA 1NGCA 2R7YA 3DRSA 1GOAA 4FPBA 3CCVN 1RBSA 1IG9A 1CLQA 4X64K 2A41A 2YJFA 3LZIA 4C8MA 5EX5A 2D0PA 3P38A 3QEWA 1T03A 4YHHK 2HBJA 4OKEA 3FZMA 3PO5A 1SL1A 1K8AO 3ASMA 3NGZA 1X3MA 3AVCA 3D2FA 2GWJA 3HTVA 3UIQA 4J2BA 1HNVA 2WFBA 4Y1DA 5AQSA 4DS4A 2ZQBA 3PSIA 1VSHA 1XQSC 3FLCO 2O4GA 3EZ5A 4Q0BA 4OPHA 3CM5A 5ADXA 3HVTA 1UOCA 2VWBA 4FPAA 4FJXA 3MEGA 3ZEUB 4JI6K 4EP5A 4NCBA 3ULEA 2Y1JA 3K5OA 3D2EA 4CEAA 1CZBA 4DCHA 2D0CA 3CQXA 1NKBA 1B9DA 1NOYA 4FJJA 2P9UA 3R9PA 4BWJA 4AHCA 1A5VA 1NLVA 3QFUA 4FYDA 2VG5A 4K8ZA 5HRSA 1VQ9N 2Q31A 2FF6A 3MXJA 3MCAB 3S41A 4CK1A 1L3SA 4CJPA 2NRTA 3KK3A 4O5FA 2XY7A 3L4QA 4CIEA 1VQLN 2ZJPL 4AHSA 3WXLA 4JNEA 2AA4A 2W41A 3TPQA 3ZT1A 2HVIA 1ITGA 1U6ZA 4FLTA 1C0UA 1VSDA 2YKMA 4NXNK 3G71N 5B8HA 2W40A 4B8CA 2A5XA 1LWFA 4FK0A 1VK0A 4W5OA 4FZZA 1YAGA 4I6MA 1XNRK 2VQFK 4CGGA 2D0AA 4DV4K 5I3UA 2NRVA 5M1FA 4CJ5A 2HHSA 1T3VA 3ATVA 2JWLA 5DM7L 2QKKA 4CW7B 3HK2A 3C6UA 1OVYA 2FXUA 4JI0K 4E1JA 3AVGA 4NXMK 1HNWK 3HXMA 1YJ9N 3V9UA 5A2QO 1T6DA 3I8DA 3NE6A 3OYGA 1U49A 1HNXK 4HWIA 3VQDA 3QMLA 5T7BA 2P9LA 4M3ZA 2D5RA 1VHXA 5DK5A 3HL8A 1HJRA 3PV8A 3FZHA 3SMPA 2HBMA 1SQKA 2LSNA 5GAHP 1YIJN 3PIPL 4IDKA 3NGIA 4UQGA 3L2QA 4E1NA 1Q86O 3WQTA 2UXDK 1M90O 3U6FA 4FLVA 3TABA 1NJIO 1GLFO 3LP2A 4H0YB 1S22A 2ETJA 3JXUA 2BTFA 1Z25A 1TKDA 4Z4HA 4FZXC 3B6PA 1VQ5N 3K0SA 3SAHA 4KO0A 3OBWA 3AVBA 1S9GA 2PBDA 3UKRA 4JI1K 1NNEA 3NH0A 1YITN 3AA4A 3CMAN 1JL1A 3V9XA 4B9LA 2GTDA 1IBMK 5KRSA 4IXCA 3JAMO 3LDSA 3IDHA 2YV0X 4YFUA 2I7NA 1EWRA 2EX3A 1NGFA 2QWRA 3BF1A 3VF4A 5DM6L 1S5JA 1KVBA 4FK2A 2HHHK 5BN8A 4LF8K 4A2AA 1VQON 1A5XA 2O8EA 1NMNA 1XWLA 4HCBA 4JI4K 3QBXA 1KSPA 4FJKA 1OH7A 5CY4A 1FW6A 4HTUA 5KGWA 3DXMA 2HW3A 2P51A 3MN7A 4DV0K 1QHTA 4CGJA 3R1XA 4FJNA 3WQUA 3HZ6A 1EO1A 4CECA 3E66A 1NGIA 2YHBA 3WUHA 1Q9XA 1VQ7N 3O5BA 3O4NA 1J54A 5FRNA 4B9NA 3D2EB 1H1VA 1HLUA 1XMOK 4A62A 4CIGA 4C8KA 2P9UB 4K0KK 1TAUA 4CGHA 2F9WA 4DF4A 3NMUA 5TKWA 1ILYA 5BR9A 1ATSA 4CZLA 3SYZA 4CZHA 1QSYA 1BI4A 1DGKN 3MN5A 1SL2A 3J8AA 2Q1NA 1YTUA 5C12A 2A40A 2GV9A 2WBNA 1XC9A 4B9TA 3SNNA 4OPKA 2OZSA 1FK9A 2QM1A 4DS5A 5AQRA 3THXA 4OX9K 4DMNA 5BRFA 2OANA 1BA1A 3OYJA 3E1YA 1VSIA 2Q2RA 3KD1E 2HVHA 3AO4A 3DLRA 4NLCA 4WCEL 4BRMA 2RKIA 3VEXA 4K25A 2VGMA 2CH6A 4DR7K 4WFNL 4ZHRA 1Q82O 3V81A 3O9TA 3DRRA 2UUBK 1VSLA 5KI6A 1LV5A 1GLDG 5CHIA 5J2NA 4CBWA 2HMIA 1HYZA 3MX5A 3DLHA 4BQLA 4CFDA 2Q97A 4LFBK 4B9UA 5M1PA 4HCCA 1NJXA 3T1AA 2VG6A 4E7HA 3V1RA 4DG1A 4B1VA 3VQ8A 1T8EA 3TAFA 4KTWA 4CJ7A 4ELUA 5J1EA 4M42A 1HPMA 1VQ4N 1Y97A 2KTQA 3SQ1A 1JXEA 5TKYA 1ZBLA 4DU4A 3C7NA 2P9LB 1RBRA 1C6VA 4RTFD 2FBXA 4ISGA 1TAQA 3GOIA 3BEXA 1W97L 5EXWA 4LD0A 4IEIA 1UA1A 3TAMA 3F73A 2QK9A 5C15A 3VEYA 4CJEA 1BIZA 1Z26A 4GV9A 3PX6A 1VSKA 1V4TA 2JWKA 1KAZA 3RMDA 4MLEA 3E9OA 1CXQA 3VTIA 2IGIA 4KHUA 3CC2N 1ASUA 4M3RA 3O08A 2QWQA 1TYQB 3EE8A 1SV5A 1L3VA 4Z0UA 4CHZA 3TTDA 4H0PA 4JKDA 4MO5A 3DLKA 3R3LA 3UE5A 3K9JA 4M3YA 5LY3A 4JK7A 4MDBA 2P1JA 4FWKA 1S9EA 3FGUA 4H5VA 4DFJA 2IAJA 2HNZA 4RCHA 3VQ7A 1WSIA 4H03B 4KHSA 3HJFA 2QI2A 3O3GA 1BGXT 5JVGL 1G15A 2D0BA 3ZT2A 2YX6A 2A6AA 4NLBA 5D3GA 2ASOA 1EETA 4IFVA 2Z1GA 2QWLA 2DFFA 3ATUA 2ASMA 4XIUA 3DAWA 3L2RA 2F4VK 5HP1A 2OCEA 4WF9L 3CFOA 3O9QA 1WUAA 1I39A 4HUFA 2ITMA 2GEMA 4CF0A 2QKBA 4DR1K 4AM7A 3DXMB 4BRFA 3CM6A 4PQUA 4DTMA 5M1KA 3UKUA 1N32K 3AO3A 3TR8A 2ASPA 3M6GA 3LP0A 4AHRA 5ADXH 3F9MA 4G1QA 3HO1A 2E2NA 2BDPA 2ITGA 4DHYA 1JCFA 5E26A 4WYBA 4FOEA 5AQOA 2VWJA 3EEQA 5F0XA 1SZ2A 2O4IA 2Z1IA 4M7YA 1ZBHA 1C1AA 5AQPA 4GV6A 1I3AA 1BI4B 3RR8A 3MK6A 4H5WA 1BCOA 3KWGA 3VGLA 3GG4A 4W5NA 5JLFA 5K14A 5ELZA 5JMVA 4FSVA 3THXB 4GNIA 4B3MK 1D4XA 5M1OA 4N76A 3THYA 3EKSA 3ENBA 5AQHA 3ZCMA 3TSQA 4DFPA 3MMVA 3QFPA 4J2EA 4BQZA 3DXKA 3QICA 2YJEA 3ENOA 4DTJA 1JKHA 4IBNA 4KHQA 5AZJA 2YNIA 4WQ4C 4K43A 2CGKA 3MN6A 4BR5A 2YI1A 3SUNA 3HP9A 3AGRA 3RTVA 4R79A 4RW4A 2NRHA 4LY7A 4BDYA 4PY5A 4CHYA 1TKXA 3OTOK 4B3SK 4DUYK 4U67L 4GVMA 3N4QA 3ENHA 3RVCA 1RFQA 2UXCK 3IMXA 1KVCA 4XH4A 3M8RA 2E6MA 1FKOA 3ISNC 4J8FA 1NJYA 4ILGB 4IO8A 4DFKA 2IIRA 3AV9A 1T7PA 3IRXA 4DTOA 4IG0A 4DR2K 1NMDA 3OYHA 3LWLA 4CJLA 1C0TA 4Q5VA 1HYSA 2HHXA 3EE9A 4CF1A 1QQNA 5FRMA 4PA1A 1YUWA 2A3ZA 1XNQK 3C7NB 1GLLO 2UUAK 2YHWA 3V4IA 2V7YA 4K42A 4HVJA 3MAQA 3CCRN 1YF5L 2G8WA 1NKEA 4AHUA 4BRAA 4C1NK 1JL2A 4BG9A 1KC8O 2X74A 3O9RA 1J9AA 2VG7A 4FWQA 3TI0A 1M1KO 4Z94A 4DSLA 1X9WA 2X6SA 3KKRA 3VQBA 2DY4A 3SBTA 3ZT4A 3PLAA 2W6KA 4DTNA 4HUEA 4FOIA 3AA3A 3VETA 1RCHA 4NYNA 2EHGA 4RW7A 4CK3A 4CZEA 1TL3A 4BY9C 2V51B 2OPQA 2IDOA 3O3FA 3NBPA 3J81O 4JKCA 3L3VA 4F9OA 4OJRA 2PYLA 2ZJRL 3G10A 3ZLJA 1ZXOA 3G6EN 1S3XA 3F2KA 3C6TA 1WNSA 2HF4A 2IVPA 1NK0A 1IKYA 3MWPA 1YT3A 3OHRA 1NK5A 4QOZB 1WSJA 1LWCA 4GMJB 2P9KA 1EXQA 3KHYA 3NF7A 1CZAN 4M41A 3FZLA 1QE1A 3MX2A 3CXCM 3CPWM 5AQIA 3RRGA 4DWIA 5BN9A 1QVFM 4Z4EA 4PKGA 3ID6A 1NK4A 1HPZA 4E19A 3UKUB 3ZX2A 3ZT3A 5KTQA 2ZM6K 3OVNA 3O6WA 3TANA 2B4JA 2Q36A 4Y0WA 4AH9A 2CGLA 4CEBA 1IBLK 1KRPA 5LJWA 3HYFA 4DTPA 2F9TA 1OVQA 3H3NO 4BRLA 4CHOA 3CYMA 4BR7A 1LAVA 1Z05A 2OPPA 2ATQA 1RTIA 3HBTA 4DV6K 2G8KA 4V19S 5FPDA 4B3OA 2W6LA 4FJMA 4X66K 4FJGA 2KZMA 2QXFA 2A1SA 3PSFA 4FJ8A 1KLMA 1RILA 3THYB 4MQ3A 1OH6A 1NGBA 3ZSQA 3PX0A 1RT3A 2IC3A 4MLHA 2XY6A 3OYIA 4PHTX 4FO0A 4DQ8A 3J7ZO 1GLJO 1S1TA 3DXKB 3ZSOA 3M8PA 2DFHA 4RG8A 1DEJA 5AZJB 3O4WA 4R5PA 4LFAK 4NYFA 1C0MA 3IFRA 3KK7A 2ZGZA 1VQNN 3CC7N 1BQNA 3VEOA 3KZBA 4GKKK 1L3UA 4N47A 3AVIA 3O9SA 3ID8A 1OH8A 1NGHA 4F2RA 4K41A 3NDKA 1SL0A 3IS9A 4I2PA 4DR5K 3SQ0A 3ZYYX 4EFHA 3D45A 4CZFA 2QW9A 5KPZA 1VQKN 3CERA 2QA4N 5AQUA 1X9JA 2BGGA 5AQLA 4NCGA 4FCYA 5AQGA 3SV3A 5HBMA 1RDDA 1RT7A 2FBYA 4DQQA 3OS1A 1E4FT 2QEXN 2RPIA 3OYNA 2FSKA 4DF8A 5BRHA 4CD3A 2P9NA 1HKCA 5J2QA 4CJVA 2BH1A 1JLFA 5FROA 1IKXA 5JICA 3B6OA 4KHPK 1LWEA 5AQTA 4E7KA 3PX4A 3BZKA 3SLCA 4NO7A 1F21A 1EQYA 2YCHA 1RDUA 3QLHA 4BRHA 3SK3A 4KHYA 3T1YK 2OTLN 3I56N 3IG1A 1RDCA 3CCSN 4CF9A 1X3NA 1YHQN 1KXPA 4L8RB 4FJHA 4I9LA 4H0XB 4DQPA 5FPMA 4FVUA 1JCGA 1N5YA 3ITHA 2VGNA 1QZ5A 4DV1K 4JKAA 4HUGA 4LF5K 3LDOA 2F7TA 2HHUA 4DR3K 4FWSA 2UUCK 4H8KA 3LM9A 4DSFA 5KQ8A 3TAQA 3C95A 2G8HA 3WXJA 3VESA 3J80O 1J6ZA 2HMPA 1XUPO 2V7ZA 4E7LA 1Q81O 4M7XA 1GLBG 4H0VB 3RMCA 1ATRA 4HTLA 4CHNA 4FM1A 1NK7A 4BGBA 4W5RA 4BC3A 2P9KB 4FLUA 3O8MA 3DYAA 2W42A 5F2RA 3KTQA 1J5OA 4H0OA 3KLHA 3OYMA 4BC4A 3SMSA 4EHTA 5JS2A 3CC4N 1Q9YA 4O55A 1V4SA 3U9DA 4Z4GA 3S9HA 1WAJA 4CJFA 4ILJA 4Z4FA 3D2FB 4BE0A 3NVMA 4LH5A 2AJQA 1YVUA 2IVNA 4IWVA 5BR8K 5AQVA 3CCLN 4KH4A 2E8AA 3NF8A 3K59A 3H1QA 3VF6A 2WUSA 3ULEB 3S3NA 4CGIA 1BHLA 3K2PA 3FZFA 2A1RA 1J5EK 1ESVA 1MA9B 1Q7YO 3KLIA 3CCQN 3AAQA 5FPNA 5AQQA 1GLAG 2D1KA 1X9MA 1HKBA 4A61A 4FWOA 4WFAL 1EP4A 1KCFA 3L8BA 1HQEA 2EWSA 1RT4A 4JK9A 3PUFA 4C8OA 2IS3A 1BOTO 2P9PA 3LDPA 4BGAA 5HOOA 1B92A 3K58A 4FVMA 1JLAA 3MWTA 5H1SQ 1N6QA 3I0SA 5IWAK 4BREA 4EZ6A 4CHQA 4PKHA 4CEEA 3NVKA 1BU6O 1NG9A 4YDUC 4BDZA 2AP1A 5GINA 4YY3K 4BDPA 1JLGA 1FKPA 3SUOA 4X65K 1IV0A 4I6MB 3VEZA 1GOBA 3JSMA 4KI4A 3T69A 1VQ8N 1KAYA 2KHOA 3HI0A 5AFUA 5C10A 3VGKA 1TKTA 4JKHA 2GX9A 4CI6A 4FLZA 1S1VA 1WSHA 4N5SA 3KKSA 1RNHA 2X78A 1JLEA 1OKJA 3THVA 5I9EB 1IJJA 2HBKA 3DI6A 4YOWA 4EZ9A 2G8FA 1ZBSA 4WE1A 3M8QA 5AQFA 3E9LA 5HROA 1LW0A 3V1OA 4CJRA 5CE3A 3CCJN 1LCUA 4CVNE 2G8UA 2P9NB 1U4BA 4QAGA 3PO4A 1XI1A 2B5JA 3TWHA 4WQ4A 2P5GA 1NGGA 2UXBK 3TSUA 3M3ZA 4MDAA 2HNYA 4FJIA 3G25A 4CBUA 3GL1A 1HRHA 2O8BA 1U04A 2G8IA 3S3OA 4JHDA 1QVGM 1TVRA 2E88A 1RBVA 3BY5A 4EAHD 4JKBA 1QHAA 4O8KA 4BRIA 3AA2A 4CK2A 5AQKA 3NFAA 2BANA 3T19A 3KIOA 4CHPA 3VA3A 3CCEN 3CHWA 3E9PA 1U47A 3CJBA 2ZGYA 1QQMA 4AF1A 3UKRB 1N36K 2HHQA 4Z4IA 5IT9O 4OKKA 4ILHA 4YOTA 4FZYA 4FW1A 3OS2A 3F9KA 4CFCA 3NF6A 2YHXA 4LF7K 3LANA 5JLHA 4IG3A 3ZT0A 4DU1A 4A59A 4E0DA 3LP1A 5EOYA 1UA0A 4BWMA 3DRPA 3OYLA 4RW6A 2QTDA 2GUIA 3KJVA 1QZ6A 3G0ZA 1VSEA 2UU9K 4IZ9A 3MEDA 5M1NA 4RW9A 4CFBA 4O44A 2IOCA 1EKEA 1SUQA 5C2FA 4FLWA 4BRDA 1BL3A 4OLBA 4CJWA 1I94K 3HOTA 2O8EB 2NUBA 3I0RA 3AVNA 3AA5X 3M5RA 3Q7CA 4FWLA 2BE2A 3SCXA 3QBWA 3A8YA 5AQZA 4OGCA 4DSKA 3SAGA 3LP3A 4RWTA 4JD2A 4KH5A 1EWQA 3HPOA 4KAZA 3ZSZA 2YKNA 1DKGD 1KQSM 2PZSA 2FBTA 4PL8A 4GY2B 1VAZA 4KB0A 1RTDA 1HJOA 1BQMA 3M1FA 5CR4A 3OYBA 1A5WA 1SAZA 3NHGA 4O5BA 3O80A 4C8NA 1NKCA 2YNHA 3OYEA 3EYZA 3WNHA 4DB3A 4MO4A 2Q0RA 1WBBA 5GAEP 3J7YP 3VQEA 2P9PB 1P90A 1CZ9A 3VTHA 4OVLA 4DR6K 3MN9A 3P1GA 1KFDA 5F1XA 3I55N 4F3OA 2CH5A 1LAWA 1Z6RA 3LM2A 4FJ5A 4CJUA 3ZSWA 5SZTA 1C0GA 3H6EA 4E7IA 4LFCK 4ELVA 4E89A 4BROA 4I7FA 3CETA 1QSLA 2DPNA 2FSNA 4YOUA 1O1WA 4KREA 2E2PA 4XH5A 4FK4A 3VOVA 3TTCA 1TK5A 2NRZA 4IFEA 4ISFA 5FLXO 1OH5A 5CZ1A 5HRPA 4IOCL 3ULDA 2NNWA 3IAYA 4BRGA 5GADP 3CCUN 3L3UA 4Z4CA 4B1WB 2O8FA 1ZYQA 1N33K 1B9FA 2I5JA 3H46O 3FFKB 3LPUA 3VQ9A 1C1CA 1BISA 3AVKA 5AQMA 3BDPA 3A5LC 3DLEA 3SQ4A 3RMAA 1QS4A 3NH2A 1T05A 4JI8K 1FJGK 2F8TA 3MCPA 3GDQA 3QEXA 4LSNA 1DTTA 4AQYK 2GELA 1BCMA 3CG7A 4IDHA 1QSSA 1MU2A 4J2AA 1KAXA 3ZX3A 2I7PA 4GW6A 4N41A 3CJ9A 3P5JA 3P39A 1U2VA 3P83D 1ZBUA 5BPMA 4CZMA 1RT1A 1W0HA 3G4SN 4OO1J 4RW8A 2O8BB 4FWRA 4DSJA 4JHDB 4BVOA 5EVZA 1Y64A 2HHWA 2OTJN 1BG3A 3C94A 1S6QA 4OGEA 4N56A 4KTQA 4FJ7A 5GIPA 4JI2K 1K73O 3CIPA 2P9IA 1UWBA 5AJ3K 3CD6N 1TV6A 3HT3A 4ICLA 4DR4K 4CGFA 2NRRA 4AHVA 3H3OB 1RDAA 2OPRA 3RRHA 1SKRA 5AQWA 2XY8A 3W0LA 5GAGP 4A5AA 5LL6Z 1EX4A 2J4RA 4DKWA 2YNFA 3EO3A 2OPSA 4BR9A 3CJ7A 4CF8A 4U7BA 4CJQA 4H4OA 3I8BA 2XHBA 1NGAA 1RT2A 3FZKA 4CJ4A 3U3YA 3CQ8A 1SS6A 2FC0A 3VN5A 2Q3SA 1NU0A 5FDLA 3VGMA 4A57A 5KPRA 3HOSA 1X1PA 4AM6A 3VEWA 1HX1A 5C24A 3HM9A 1GLCG 4ELTA 1ZBFA 1HQUA 4CJTA 1HMVA 3QEPA 2NZTA 4DV5K 3A0IX 1LOTB 3SPYA 2HNDA 4M3UA 3OW2M 1TKZA 1E4GT 5C2DA 1TUUA 2HOEA 3CQYA 3WT0A 2V52B 4CF2A 5AQJA 2FLOA 4I2QA 4JD2B 2ZF5O 3VF2A 1RBUA 2DFEA 3H08A 4GV3A 5JVHL 4BVPA 4JRQA 3WNFA 1WOQA 2PAVA 3NGYA 4M63C 4O8UA 3VA0A 4ZTFA 3CCMN 5LJVA 1RT6A 3SUPA 1QQCA 3P4IA 2HSTA 1JJ2M 1RDBA 1MDUB 5C25A 4QS7A 1BDGA 3O1BA 4CZJA 4PUOA 4KTZA 3VERA 4O0IA 3L4IA 3AO1A 4DTUA 5MLCQ 4W5TA 4JS5A 4LF4K 2PYJA 1IBKK 3NAEA 5JS1A 1TL1A 3KWIA 4JLHA 4M3TA 4DFMA 3L2UA 4M3XA 4BR4A 3RSEA 2O8CA 5CYQA 1BUPA 3BP8A 3OA9A 1BO5O 4A5BA 3NCIA 3HSCA 2DTUA 3ZSXA 4H0TB 1WN7A 2YHAA 4W5QA 2Q0UA 5E84A 4CJSA 3KVGA 4QS8A 1HNIA 3QEVA 1D8YA 1O13A 4BRCA 4CCHA 3HP6A 2O8DA 3AVHA 3DM2A 4H5TA 3HM8A 5AFUH 3J7AP 1P8ZA 3ZETA 3BGRA 1ZBIA 2O8FB 3KK1A 4YNQA 4B3RK 4MFBA 4LSLA 3Q7BA 4CESA 3QNNA 3IUCA 2KZZA 4BG8A 4BE1A 1W2BM 4CFAA 1K6YA 4NB4A 1YXQA 3LDLA 1S1XA 1XC3A 4BE2A 3QETA 4LH4A 4LF6K 3QINA 3AVAA 2RN2A 1ZC6A 1S1UA 4F2SA 3VQPA 4E7JA 1U48A 3OBYA 4KRFA 4JK8A 3QNOA 4YDUA 3AGKA 1YJNN 3D7EO 4GKJK 1VRTA 1U2VB 4DV2K 4BR0A 1KD1O 4CD1A 4F3TA 4ID1A 5KRTA 4JI7K 2QWPA 2QWNA 1NJWA 3MDQA 4B9MA 4FJLA 2KKZA 3C0BA 3O3HA 3LZJA 3WXMB 1K8KA 3L2WA 1RTJA 1T44A 1N34K 5SWMA 1DTQA 3C6HA 2P9IB 2QWMA 2CGJA 3K5LA 3ZSRA 3VQ4A 4J2DA 2HHTA 3V1QA 1ASVA 5LMNK 4JS4A 3MEEA 3EZWA 4IEEA 3LL3A 2OZMA 4C23A 4C1NI 2FBVA 3R6MA 3QIOA 2GBZA 2RE2A 3T7ZA 3KD5E 2E20A 3K5NA 3LWMA 3SAFA 3I33A 1DLOA 3ALYA 2HB5A 1TYQA 1E3MA 3AO2A 3C6AA 3LALA 4DU3A 1Q8IA 4BACA 1WLJA 4TSXA 3CF5L 5LMUK 4DUZK 3LDNA 3EKUA 1HR0K 5BPNA 1NGJA 3O4QA 1KFSA 4CEOA 1G99A 4B9QA 4BRPA 3VEVA 3P31A 4M45A 5EY4A 2P5OA 1JCEA 4JKEA 3F5TA 3U9ZA 2OYQA 3QB0A 4B9VA 3DWLA 1WAFA 3QERA 1NJZA 2Z1HA 3O1WA 1WSFA 2VYPA 3TAPA 4BRQA 1TUYA 5AZIA 3CJ1A 3VPZA 3PIOL 4CIFA 1XHXA 4CJKA 3OYAA 4M3WA 3AVJA 2E1ZA 4BR2A 3AVFA 4CGDA 2UYTA 3QDKA 3ZSYA 1RT5A 3SI6A 4DLGA 1WSGA 4KBOA 3RMBA 2E6LA 3DLLL 4B8AB 2E2QA 3VQ6A 3PY8A 3SJJA 1VRUA 3AARA 3N4PA 4IKFA 4CEFA 1NM1A 1REVA 4QS9A 4BC2A 3T1HK 4EP4A 1R0AA 2RHKA 4E3SA 4PWDA 2IVOA 4YOVA 4K8XA 2ZWHA 4KH6A 3K5MA 5HLFA 3GBTA 3T3FA 4WFBL 2KQ2A 3RSEB 4DLEA 5E41A 2O8CB 2E4LA 1T6CA 3SV4A 3AVLA 1WBDA 2D0OA 2VQEK 1XMQK 1N8RO 1W7AA 5KPTA 4JYAK 4CEZA 3CPEA 5J2MA 2QXLA 3VENA 4KV8A 4O0JA 3TU5A 2VCPA 3THWA 2O8DB 4DV3K 2NLXA 1WSEA 3FFIA 3MXMA 4G9ZA 3ZETB 3R8EA 3H45C 1D9DA 1D5AA 2E5LK 4XEIA 4B08A 3MECA 3M8SA 3V9ZA 1QQOA 4JKFA 4CBXA 1IKVA 4BC5A 1DT9A 5AQYA 4JAXA 3AAPA 2WTUA 1U45A 2YNGA 4CEDA 3HRGA 1RGIA 1WB9A 1W9HA 5BREA 3WEEA 1VQMN 4PKIA 1MWMA 2OA8A 1R59O 2E2OA 3V6DA 1VQ6N 4CJ3A 4FXDA 4BRNA 5CZ2A 2HBLA 2ZE2A 5DMRA 4I9QA 2JLEA 3SPZA 1NK8A 1IO2A 3QO9A 5BRDA 3SQ2A 1HYVA 4DTXA 4B1UB 4JI3K 1K8KB 4JKGA 5AQXA 2D4WA 1J53A 4FM2A 3DLBA 2KFZA 3OS0A 1RDWX 2WONA 4KKOA 4FW2A 1NGDA 1NBWA 1HUXA 3OY9A 3L0QA 2KW4A 5GIOA 3DMJA 4IO9L 3AVMA 3LPTA 3WNEA 3QEIA 3BUZB 4B1ZA 3L6QA 3NF9A 1JLCA 3D6RA 3SJHA 3V9SA 4FJ9A 3RR7A 5KGXA 3LAMA 2VWKA 1SKWA 2G8VA 3U4LA 3DLGA 4LF9K 2WC9A 3SBGA 4CZGA 2WOMA 4C8LA 5CYMA 4FLXA 3LDQA 1VQPN 1XHZA 3KK2A 3KLGA 3A5MC 1X9SA 2XRIA 1VSFA 3TTFA 1K9MO 4FWPA 4EHUA 4X62K 4CZIA 2P9SA 3ZSVA 1IH7A 5HRNA 3OYDA 3EY1A 3MXIA 2E1YA 2JGUA 3S3MA 2HHVA 3HPHA 2HF3A 3AO5A 3VQ5A 4YOYA 3OJUA 1Q18A 4JRPA 3JYTA 3UB5A 1VSJA 4DSEA 1L3TA 1ASWA 3ZX0A 3DJCA 4ZTJA 5HRRA 2GUPA 3B8AX 1S72N 5AZIB 4GVEA 2X6NA 4FWMA 3VQAA 4F4KA 4DV7K 3GE1A 1NK9A 1VSMA 2KLAA 1QTMA 3A5OC 1HKGA 2H3GX 1NGEA 4Y1CA 4OPAA 2XY5A 4OPJA 4KHNA 3KLFA 3DOLA 1C0FA 1SKSA 3O9UA 3QIPA 3AY9A 3ZEUA 3SUQA 1IKWA 4WQ5A 2ZD1A 4JV5K 2NRWA 2Y1IA 5EU7A 3C65A 3OYCA 3V9WA 4IFYA 4DQRA 1RTHA 1YJWN 3CFRA 3FE1A 1KVAA 3EN9A 2PFUA 5FPEA 3BF3A 5BPLA 2Z1JA 1MWKA 3U3GA 1BWFO 1FXXA 1GLEG 1JXBA 5M1QA 4OKJA 1RBTA 5J2PA 4DTRA 4OLAA 4DQSA 1TK8A 3DOKA 1IG8A 5HL7L 3BZCA 4ID5A 3NH1A 3THWB
chains in the Genus database with same CATH topology
1N34K 4JI5K 4DV0K 4LF9K 4CW7B 4LFAK 5LMNK 2VQEK 1XMQK 4JI0K 4JYAK 4NXMK 4X64K 1HNWK 5A2QO 4GKKK 4B3MK 4YHHK 4CVNE 1XMOK 3J81O 4X62K 4LF4K 1IBKK 1HNXK 4DV3K 4K0KK 4JI2K 4DR5K 2UXBK 5AJ3K 4B3TK 4DR4K 5BR8K 2E5LK 4JI6K 3J7YP 5LMUK 4DUZK 4OX9K 4DR6K 1HR0K 5LL6Z 4DV7K 3OTOK 4B3SK 1J5EK 4DUYK 2UXDK 2UXCK 3J7AP 4KHPK 4LFCK 4B3RK 2ZM6K 4DR7K 4DR2K 1HNZK 1IBLK 2UUBK 3J80O 4JV5K 2F4VK 4LF6K 3T1YK 4JI1K 4JI3K 5FLXO 4DV5K 1N36K 5IT9O 1XNQK 1IBMK 4LFBK 4DR1K 2UUAK 5IWAK 4LF7K 1N33K 4DV6K 3JAMO 4NXNK 1N32K 4V19S 4GKJK 4DV2K 4YY3K 4JI7K 4DV1K 2UU9K 1FJGK 4X66K 1XNRK 4JI8K 4LF5K 4X65K 2VQFK 4DR3K 2UUCK 2HHHK 3T1HK 4LF8K 4DV4K 1I94K 4AQYK 4JI4K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N34 K;  4JI5 K;  4DV0 K;  4LF9 K;  4CW7 B;  4LFA K;  5LMN K;  2VQE K;  1XMQ K;  4JI0 K;  4JYA K;  4NXM K;  4X64 K;  1HNW K;  5A2Q O;  4GKK K;  4B3M K;  4YHH K;  4CVN E;  1XMO K;  3J81 O;  4X62 K;  4LF4 K;  1IBK K;  1HNX K;  4DV3 K;  4K0K K;  4JI2 K;  4DR5 K;  2UXB K;  5AJ3 K;  4B3T K;  4DR4 K;  5BR8 K;  2E5L K;  4JI6 K;  3J7Y P;  5LMU K;  4DUZ K;  4OX9 K;  4DR6 K;  1HR0 K;  5LL6 Z;  4DV7 K;  3OTO K;  4B3S K;  1J5E K;  4DUY K;  2UXD K;  2UXC K;  3J7A P;  4KHP K;  4LFC K;  4B3R K;  2ZM6 K;  4DR7 K;  4DR2 K;  1HNZ K;  1IBL K;  2UUB K;  3J80 O;  4JV5 K;  2F4V K;  4LF6 K;  3T1Y K;  4JI1 K;  4JI3 K;  5FLX O;  4DV5 K;  1N36 K;  5IT9 O;  1XNQ K;  1IBM K;  4LFB K;  4DR1 K;  2UUA K;  5IWA K;  4LF7 K;  1N33 K;  4DV6 K;  3JAM O;  4NXN K;  1N32 K;  4V19 S;  4GKJ K;  4DV2 K;  4YY3 K;  4JI7 K;  4DV1 K;  2UU9 K;  1FJG K;  4X66 K;  1XNR K;  4JI8 K;  4LF5 K;  4X65 K;  2VQF K;  4DR3 K;  2UUC K;  2HHH K;  3T1H K;  4LF8 K;  4DV4 K;  1I94 K;  4AQY K;  4JI4 K; 
#chains in the Genus database with same CATH topology
 1NOZ A;  3CJA A;  3WNG A;  4JI5 K;  3CJC A;  2NRX A;  4UY8 O;  3K57 A;  2KFN A;  3HST B;  3TAR A;  4QCL A;  1BIU A;  4ISE A;  4KB1 A;  3VQC A;  3WXK A;  4L3Q A;  4FLY A;  4JEP A;  1UAX A;  4E1M A;  3VMF B;  4B1Y B;  4CER A;  4EIA A;  3EL2 A;  4IJN A;  4KI6 A;  5C42 A;  4O4G A;  4NCA A;  3H1V X;  4FL9 A;  3CI5 A;  2XO7 A;  4FM0 A;  5AR0 A;  4BRK A;  4LC9 B;  4YOR A;  3TAE A;  1D9F A;  2BUP A;  4B9S A;  1S1W A;  3JS6 A;  4DQI A;  4B1X B;  4B3T K;  3WEE B;  4H5N A;  3LAK A;  3KLE A;  3TAG A;  3HPG A;  1BA0 A;  3CME N;  1NWK A;  3QES A;  4CEQ A;  3OYF A;  5C0Y A;  3IKM A;  3E01 A;  4HHT A;  4XH1 A;  4FWN A;  4IOX A;  4JKG B;  4H4M A;  4JN4 A;  2B6A A;  4KPY A;  1JLQ A;  4KHW A;  2RF2 A;  4DSI A;  4KFB A;  1CXU A;  1YTA A;  2YHY A;  3CFP A;  4F8R A;  4H5R A;  1YI2 N;  1C1B A;  3K9K A;  4DTS A;  1LW2 A;  4IOA L;  1JLB A;  1HNZ K;  3WXI A;  3SZ2 A;  4YOX A;  3D0P A;  1KLN A;  2F8S A;  3A5N C;  2FF3 B;  5KQD A;  3OYK A;  3W3D A;  3A2F A;  1ATN A;  1NK6 A;  1L5U A;  2FSJ A;  3U8X A;  2A42 A;  1S6P A;  1GOC A;  4AIL C;  4IJA A;  2GWK A;  2ZJQ L;  5I42 A;  1YVN A;  2PY5 A;  2QWO A;  3L2V A;  1TGO A;  3TSP A;  3OJS A;  4CZK A;  5AQN A;  1KTQ A;  3HVR A;  3RWU A;  4A2B A;  2P9S B;  4PL7 A;  4CE9 A;  3FR0 A;  2F96 A;  4WQ5 C;  1TK0 A;  4AHT A;  3VQQ A;  1NGC A;  2R7Y A;  3DRS A;  1GOA A;  4FPB A;  3CCV N;  1RBS A;  1IG9 A;  1CLQ A;  4X64 K;  2A41 A;  2YJF A;  3LZI A;  4C8M A;  5EX5 A;  2D0P A;  3P38 A;  3QEW A;  1T03 A;  4YHH K;  2HBJ A;  4OKE A;  3FZM A;  3PO5 A;  1SL1 A;  1K8A O;  3ASM A;  3NGZ A;  1X3M A;  3AVC A;  3D2F A;  2GWJ A;  3HTV A;  3UIQ A;  4J2B A;  1HNV A;  2WFB A;  4Y1D A;  5AQS A;  4DS4 A;  2ZQB A;  3PSI A;  1VSH A;  1XQS C;  3FLC O;  2O4G A;  3EZ5 A;  4Q0B A;  4OPH A;  3CM5 A;  5ADX A;  3HVT A;  1UOC A;  2VWB A;  4FPA A;  4FJX A;  3MEG A;  3ZEU B;  4JI6 K;  4EP5 A;  4NCB A;  3ULE A;  2Y1J A;  3K5O A;  3D2E A;  4CEA A;  1CZB A;  4DCH A;  2D0C A;  3CQX A;  1NKB A;  1B9D A;  1NOY A;  4FJJ A;  2P9U A;  3R9P A;  4BWJ A;  4AHC A;  1A5V A;  1NLV A;  3QFU A;  4FYD A;  2VG5 A;  4K8Z A;  5HRS A;  1VQ9 N;  2Q31 A;  2FF6 A;  3MXJ A;  3MCA B;  3S41 A;  4CK1 A;  1L3S A;  4CJP A;  2NRT A;  3KK3 A;  4O5F A;  2XY7 A;  3L4Q A;  4CIE A;  1VQL N;  2ZJP L;  4AHS A;  3WXL A;  4JNE A;  2AA4 A;  2W41 A;  3TPQ A;  3ZT1 A;  2HVI A;  1ITG A;  1U6Z A;  4FLT A;  1C0U A;  1VSD A;  2YKM A;  4NXN K;  3G71 N;  5B8H A;  2W40 A;  4B8C A;  2A5X A;  1LWF A;  4FK0 A;  1VK0 A;  4W5O A;  4FZZ A;  1YAG A;  4I6M A;  1XNR K;  2VQF K;  4CGG A;  2D0A A;  4DV4 K;  5I3U A;  2NRV A;  5M1F A;  4CJ5 A;  2HHS A;  1T3V A;  3ATV A;  2JWL A;  5DM7 L;  2QKK A;  4CW7 B;  3HK2 A;  3C6U A;  1OVY A;  2FXU A;  4JI0 K;  4E1J A;  3AVG A;  4NXM K;  1HNW K;  3HXM A;  1YJ9 N;  3V9U A;  5A2Q O;  1T6D A;  3I8D A;  3NE6 A;  3OYG A;  1U49 A;  1HNX K;  4HWI A;  3VQD A;  3QML A;  5T7B A;  2P9L A;  4M3Z A;  2D5R A;  1VHX A;  5DK5 A;  3HL8 A;  1HJR A;  3PV8 A;  3FZH A;  3SMP A;  2HBM A;  1SQK A;  2LSN A;  5GAH P;  1YIJ N;  3PIP L;  4IDK A;  3NGI A;  4UQG A;  3L2Q A;  4E1N A;  1Q86 O;  3WQT A;  2UXD K;  1M90 O;  3U6F A;  4FLV A;  3TAB A;  1NJI O;  1GLF O;  3LP2 A;  4H0Y B;  1S22 A;  2ETJ A;  3JXU A;  2BTF A;  1Z25 A;  1TKD A;  4Z4H A;  4FZX C;  3B6P A;  1VQ5 N;  3K0S A;  3SAH A;  4KO0 A;  3OBW A;  3AVB A;  1S9G A;  2PBD A;  3UKR A;  4JI1 K;  1NNE A;  3NH0 A;  1YIT N;  3AA4 A;  3CMA N;  1JL1 A;  3V9X A;  4B9L A;  2GTD A;  1IBM K;  5KRS A;  4IXC A;  3JAM O;  3LDS A;  3IDH A;  2YV0 X;  4YFU A;  2I7N A;  1EWR A;  2EX3 A;  1NGF A;  2QWR A;  3BF1 A;  3VF4 A;  5DM6 L;  1S5J A;  1KVB A;  4FK2 A;  2HHH K;  5BN8 A;  4LF8 K;  4A2A A;  1VQO N;  1A5X A;  2O8E A;  1NMN A;  1XWL A;  4HCB A;  4JI4 K;  3QBX A;  1KSP A;  4FJK A;  1OH7 A;  5CY4 A;  1FW6 A;  4HTU A;  5KGW A;  3DXM A;  2HW3 A;  2P51 A;  3MN7 A;  4DV0 K;  1QHT A;  4CGJ A;  3R1X A;  4FJN A;  3WQU A;  3HZ6 A;  1EO1 A;  4CEC A;  3E66 A;  1NGI A;  2YHB A;  3WUH A;  1Q9X A;  1VQ7 N;  3O5B A;  3O4N A;  1J54 A;  5FRN A;  4B9N A;  3D2E B;  1H1V A;  1HLU A;  1XMO K;  4A62 A;  4CIG A;  4C8K A;  2P9U B;  4K0K K;  1TAU A;  4CGH A;  2F9W A;  4DF4 A;  3NMU A;  5TKW A;  1ILY A;  5BR9 A;  1ATS A;  4CZL A;  3SYZ A;  4CZH A;  1QSY A;  1BI4 A;  1DGK N;  3MN5 A;  1SL2 A;  3J8A A;  2Q1N A;  1YTU A;  5C12 A;  2A40 A;  2GV9 A;  2WBN A;  1XC9 A;  4B9T A;  3SNN A;  4OPK A;  2OZS A;  1FK9 A;  2QM1 A;  4DS5 A;  5AQR A;  3THX A;  4OX9 K;  4DMN A;  5BRF A;  2OAN A;  1BA1 A;  3OYJ A;  3E1Y A;  1VSI A;  2Q2R A;  3KD1 E;  2HVH A;  3AO4 A;  3DLR A;  4NLC A;  4WCE L;  4BRM A;  2RKI A;  3VEX A;  4K25 A;  2VGM A;  2CH6 A;  4DR7 K;  4WFN L;  4ZHR A;  1Q82 O;  3V81 A;  3O9T A;  3DRR A;  2UUB K;  1VSL A;  5KI6 A;  1LV5 A;  1GLD G;  5CHI A;  5J2N A;  4CBW A;  2HMI A;  1HYZ A;  3MX5 A;  3DLH A;  4BQL A;  4CFD A;  2Q97 A;  4LFB K;  4B9U A;  5M1P A;  4HCC A;  1NJX A;  3T1A A;  2VG6 A;  4E7H A;  3V1R A;  4DG1 A;  4B1V A;  3VQ8 A;  1T8E A;  3TAF A;  4KTW A;  4CJ7 A;  4ELU A;  5J1E A;  4M42 A;  1HPM A;  1VQ4 N;  1Y97 A;  2KTQ A;  3SQ1 A;  1JXE A;  5TKY A;  1ZBL A;  4DU4 A;  3C7N A;  2P9L B;  1RBR A;  1C6V A;  4RTF D;  2FBX A;  4ISG A;  1TAQ A;  3GOI A;  3BEX A;  1W97 L;  5EXW A;  4LD0 A;  4IEI A;  1UA1 A;  3TAM A;  3F73 A;  2QK9 A;  5C15 A;  3VEY A;  4CJE A;  1BIZ A;  1Z26 A;  4GV9 A;  3PX6 A;  1VSK A;  1V4T A;  2JWK A;  1KAZ A;  3RMD A;  4MLE A;  3E9O A;  1CXQ A;  3VTI A;  2IGI A;  4KHU A;  3CC2 N;  1ASU A;  4M3R A;  3O08 A;  2QWQ A;  1TYQ B;  3EE8 A;  1SV5 A;  1L3V A;  4Z0U A;  4CHZ A;  3TTD A;  4H0P A;  4JKD A;  4MO5 A;  3DLK A;  3R3L A;  3UE5 A;  3K9J A;  4M3Y A;  5LY3 A;  4JK7 A;  4MDB A;  2P1J A;  4FWK A;  1S9E A;  3FGU A;  4H5V A;  4DFJ A;  2IAJ A;  2HNZ A;  4RCH A;  3VQ7 A;  1WSI A;  4H03 B;  4KHS A;  3HJF A;  2QI2 A;  3O3G A;  1BGX T;  5JVG L;  1G15 A;  2D0B A;  3ZT2 A;  2YX6 A;  2A6A A;  4NLB A;  5D3G A;  2ASO A;  1EET A;  4IFV A;  2Z1G A;  2QWL A;  2DFF A;  3ATU A;  2ASM A;  4XIU A;  3DAW A;  3L2R A;  2F4V K;  5HP1 A;  2OCE A;  4WF9 L;  3CFO A;  3O9Q A;  1WUA A;  1I39 A;  4HUF A;  2ITM A;  2GEM A;  4CF0 A;  2QKB A;  4DR1 K;  4AM7 A;  3DXM B;  4BRF A;  3CM6 A;  4PQU A;  4DTM A;  5M1K A;  3UKU A;  1N32 K;  3AO3 A;  3TR8 A;  2ASP A;  3M6G A;  3LP0 A;  4AHR A;  5ADX H;  3F9M A;  4G1Q A;  3HO1 A;  2E2N A;  2BDP A;  2ITG A;  4DHY A;  1JCF A;  5E26 A;  4WYB A;  4FOE A;  5AQO A;  2VWJ A;  3EEQ A;  5F0X A;  1SZ2 A;  2O4I A;  2Z1I A;  4M7Y A;  1ZBH A;  1C1A A;  5AQP A;  4GV6 A;  1I3A A;  1BI4 B;  3RR8 A;  3MK6 A;  4H5W A;  1BCO A;  3KWG A;  3VGL A;  3GG4 A;  4W5N A;  5JLF A;  5K14 A;  5ELZ A;  5JMV A;  4FSV A;  3THX B;  4GNI A;  4B3M K;  1D4X A;  5M1O A;  4N76 A;  3THY A;  3EKS A;  3ENB A;  5AQH A;  3ZCM A;  3TSQ A;  4DFP A;  3MMV A;  3QFP A;  4J2E A;  4BQZ A;  3DXK A;  3QIC A;  2YJE A;  3ENO A;  4DTJ A;  1JKH A;  4IBN A;  4KHQ A;  5AZJ A;  2YNI A;  4WQ4 C;  4K43 A;  2CGK A;  3MN6 A;  4BR5 A;  2YI1 A;  3SUN A;  3HP9 A;  3AGR A;  3RTV A;  4R79 A;  4RW4 A;  2NRH A;  4LY7 A;  4BDY A;  4PY5 A;  4CHY A;  1TKX A;  3OTO K;  4B3S K;  4DUY K;  4U67 L;  4GVM A;  3N4Q A;  3ENH A;  3RVC A;  1RFQ A;  2UXC K;  3IMX A;  1KVC A;  4XH4 A;  3M8R A;  2E6M A;  1FKO A;  3ISN C;  4J8F A;  1NJY A;  4ILG B;  4IO8 A;  4DFK A;  2IIR A;  3AV9 A;  1T7P A;  3IRX A;  4DTO A;  4IG0 A;  4DR2 K;  1NMD A;  3OYH A;  3LWL A;  4CJL A;  1C0T A;  4Q5V A;  1HYS A;  2HHX A;  3EE9 A;  4CF1 A;  1QQN A;  5FRM A;  4PA1 A;  1YUW A;  2A3Z A;  1XNQ K;  3C7N B;  1GLL O;  2UUA K;  2YHW A;  3V4I A;  2V7Y A;  4K42 A;  4HVJ A;  3MAQ A;  3CCR N;  1YF5 L;  2G8W A;  1NKE A;  4AHU A;  4BRA A;  4C1N K;  1JL2 A;  4BG9 A;  1KC8 O;  2X74 A;  3O9R A;  1J9A A;  2VG7 A;  4FWQ A;  3TI0 A;  1M1K O;  4Z94 A;  4DSL A;  1X9W A;  2X6S A;  3KKR A;  3VQB A;  2DY4 A;  3SBT A;  3ZT4 A;  3PLA A;  2W6K A;  4DTN A;  4HUE A;  4FOI A;  3AA3 A;  3VET A;  1RCH A;  4NYN A;  2EHG A;  4RW7 A;  4CK3 A;  4CZE A;  1TL3 A;  4BY9 C;  2V51 B;  2OPQ A;  2IDO A;  3O3F A;  3NBP A;  3J81 O;  4JKC A;  3L3V A;  4F9O A;  4OJR A;  2PYL A;  2ZJR L;  3G10 A;  3ZLJ A;  1ZXO A;  3G6E N;  1S3X A;  3F2K A;  3C6T A;  1WNS A;  2HF4 A;  2IVP A;  1NK0 A;  1IKY A;  3MWP A;  1YT3 A;  3OHR A;  1NK5 A;  4QOZ B;  1WSJ A;  1LWC A;  4GMJ B;  2P9K A;  1EXQ A;  3KHY A;  3NF7 A;  1CZA N;  4M41 A;  3FZL A;  1QE1 A;  3MX2 A;  3CXC M;  3CPW M;  5AQI A;  3RRG A;  4DWI A;  5BN9 A;  1QVF M;  4Z4E A;  4PKG A;  3ID6 A;  1NK4 A;  1HPZ A;  4E19 A;  3UKU B;  3ZX2 A;  3ZT3 A;  5KTQ A;  2ZM6 K;  3OVN A;  3O6W A;  3TAN A;  2B4J A;  2Q36 A;  4Y0W A;  4AH9 A;  2CGL A;  4CEB A;  1IBL K;  1KRP A;  5LJW A;  3HYF A;  4DTP A;  2F9T A;  1OVQ A;  3H3N O;  4BRL A;  4CHO A;  3CYM A;  4BR7 A;  1LAV A;  1Z05 A;  2OPP A;  2ATQ A;  1RTI A;  3HBT A;  4DV6 K;  2G8K A;  4V19 S;  5FPD A;  4B3O A;  2W6L A;  4FJM A;  4X66 K;  4FJG A;  2KZM A;  2QXF A;  2A1S A;  3PSF A;  4FJ8 A;  1KLM A;  1RIL A;  3THY B;  4MQ3 A;  1OH6 A;  1NGB A;  3ZSQ A;  3PX0 A;  1RT3 A;  2IC3 A;  4MLH A;  2XY6 A;  3OYI A;  4PHT X;  4FO0 A;  4DQ8 A;  3J7Z O;  1GLJ O;  1S1T A;  3DXK B;  3ZSO A;  3M8P A;  2DFH A;  4RG8 A;  1DEJ A;  5AZJ B;  3O4W A;  4R5P A;  4LFA K;  4NYF A;  1C0M A;  3IFR A;  3KK7 A;  2ZGZ A;  1VQN N;  3CC7 N;  1BQN A;  3VEO A;  3KZB A;  4GKK K;  1L3U A;  4N47 A;  3AVI A;  3O9S A;  3ID8 A;  1OH8 A;  1NGH A;  4F2R A;  4K41 A;  3NDK A;  1SL0 A;  3IS9 A;  4I2P A;  4DR5 K;  3SQ0 A;  3ZYY X;  4EFH A;  3D45 A;  4CZF A;  2QW9 A;  5KPZ A;  1VQK N;  3CER A;  2QA4 N;  5AQU A;  1X9J A;  2BGG A;  5AQL A;  4NCG A;  4FCY A;  5AQG A;  3SV3 A;  5HBM A;  1RDD A;  1RT7 A;  2FBY A;  4DQQ A;  3OS1 A;  1E4F T;  2QEX N;  2RPI A;  3OYN A;  2FSK A;  4DF8 A;  5BRH A;  4CD3 A;  2P9N A;  1HKC A;  5J2Q A;  4CJV A;  2BH1 A;  1JLF A;  5FRO A;  1IKX A;  5JIC A;  3B6O A;  4KHP K;  1LWE A;  5AQT A;  4E7K A;  3PX4 A;  3BZK A;  3SLC A;  4NO7 A;  1F21 A;  1EQY A;  2YCH A;  1RDU A;  3QLH A;  4BRH A;  3SK3 A;  4KHY A;  3T1Y K;  2OTL N;  3I56 N;  3IG1 A;  1RDC A;  3CCS N;  4CF9 A;  1X3N A;  1YHQ N;  1KXP A;  4L8R B;  4FJH A;  4I9L A;  4H0X B;  4DQP A;  5FPM A;  4FVU A;  1JCG A;  1N5Y A;  3ITH A;  2VGN A;  1QZ5 A;  4DV1 K;  4JKA A;  4HUG A;  4LF5 K;  3LDO A;  2F7T A;  2HHU A;  4DR3 K;  4FWS A;  2UUC K;  4H8K A;  3LM9 A;  4DSF A;  5KQ8 A;  3TAQ A;  3C95 A;  2G8H A;  3WXJ A;  3VES A;  3J80 O;  1J6Z A;  2HMP A;  1XUP O;  2V7Z A;  4E7L A;  1Q81 O;  4M7X A;  1GLB G;  4H0V B;  3RMC A;  1ATR A;  4HTL A;  4CHN A;  4FM1 A;  1NK7 A;  4BGB A;  4W5R A;  4BC3 A;  2P9K B;  4FLU A;  3O8M A;  3DYA A;  2W42 A;  5F2R A;  3KTQ A;  1J5O A;  4H0O A;  3KLH A;  3OYM A;  4BC4 A;  3SMS A;  4EHT A;  5JS2 A;  3CC4 N;  1Q9Y A;  4O55 A;  1V4S A;  3U9D A;  4Z4G A;  3S9H A;  1WAJ A;  4CJF A;  4ILJ A;  4Z4F A;  3D2F B;  4BE0 A;  3NVM A;  4LH5 A;  2AJQ A;  1YVU A;  2IVN A;  4IWV A;  5BR8 K;  5AQV A;  3CCL N;  4KH4 A;  2E8A A;  3NF8 A;  3K59 A;  3H1Q A;  3VF6 A;  2WUS A;  3ULE B;  3S3N A;  4CGI A;  1BHL A;  3K2P A;  3FZF A;  2A1R A;  1J5E K;  1ESV A;  1MA9 B;  1Q7Y O;  3KLI A;  3CCQ N;  3AAQ A;  5FPN A;  5AQQ A;  1GLA G;  2D1K A;  1X9M A;  1HKB A;  4A61 A;  4FWO A;  4WFA L;  1EP4 A;  1KCF A;  3L8B A;  1HQE A;  2EWS A;  1RT4 A;  4JK9 A;  3PUF A;  4C8O A;  2IS3 A;  1BOT O;  2P9P A;  3LDP A;  4BGA A;  5HOO A;  1B92 A;  3K58 A;  4FVM A;  1JLA A;  3MWT A;  5H1S Q;  1N6Q A;  3I0S A;  5IWA K;  4BRE A;  4EZ6 A;  4CHQ A;  4PKH A;  4CEE A;  3NVK A;  1BU6 O;  1NG9 A;  4YDU C;  4BDZ A;  2AP1 A;  5GIN A;  4YY3 K;  4BDP A;  1JLG A;  1FKP A;  3SUO A;  4X65 K;  1IV0 A;  4I6M B;  3VEZ A;  1GOB A;  3JSM A;  4KI4 A;  3T69 A;  1VQ8 N;  1KAY A;  2KHO A;  3HI0 A;  5AFU A;  5C10 A;  3VGK A;  1TKT A;  4JKH A;  2GX9 A;  4CI6 A;  4FLZ A;  1S1V A;  1WSH A;  4N5S A;  3KKS A;  1RNH A;  2X78 A;  1JLE A;  1OKJ A;  3THV A;  5I9E B;  1IJJ A;  2HBK A;  3DI6 A;  4YOW A;  4EZ9 A;  2G8F A;  1ZBS A;  4WE1 A;  3M8Q A;  5AQF A;  3E9L A;  5HRO A;  1LW0 A;  3V1O A;  4CJR A;  5CE3 A;  3CCJ N;  1LCU A;  4CVN E;  2G8U A;  2P9N B;  1U4B A;  4QAG A;  3PO4 A;  1XI1 A;  2B5J A;  3TWH A;  4WQ4 A;  2P5G A;  1NGG A;  2UXB K;  3TSU A;  3M3Z A;  4MDA A;  2HNY A;  4FJI A;  3G25 A;  4CBU A;  3GL1 A;  1HRH A;  2O8B A;  1U04 A;  2G8I A;  3S3O A;  4JHD A;  1QVG M;  1TVR A;  2E88 A;  1RBV A;  3BY5 A;  4EAH D;  4JKB A;  1QHA A;  4O8K A;  4BRI A;  3AA2 A;  4CK2 A;  5AQK A;  3NFA A;  2BAN A;  3T19 A;  3KIO A;  4CHP A;  3VA3 A;  3CCE N;  3CHW A;  3E9P A;  1U47 A;  3CJB A;  2ZGY A;  1QQM A;  4AF1 A;  3UKR B;  1N36 K;  2HHQ A;  4Z4I A;  5IT9 O;  4OKK A;  4ILH A;  4YOT A;  4FZY A;  4FW1 A;  3OS2 A;  3F9K A;  4CFC A;  3NF6 A;  2YHX A;  4LF7 K;  3LAN A;  5JLH A;  4IG3 A;  3ZT0 A;  4DU1 A;  4A59 A;  4E0D A;  3LP1 A;  5EOY A;  1UA0 A;  4BWM A;  3DRP A;  3OYL A;  4RW6 A;  2QTD A;  2GUI A;  3KJV A;  1QZ6 A;  3G0Z A;  1VSE A;  2UU9 K;  4IZ9 A;  3MED A;  5M1N A;  4RW9 A;  4CFB A;  4O44 A;  2IOC A;  1EKE A;  1SUQ A;  5C2F A;  4FLW A;  4BRD A;  1BL3 A;  4OLB A;  4CJW A;  1I94 K;  3HOT A;  2O8E B;  2NUB A;  3I0R A;  3AVN A;  3AA5 X;  3M5R A;  3Q7C A;  4FWL A;  2BE2 A;  3SCX A;  3QBW A;  3A8Y A;  5AQZ A;  4OGC A;  4DSK A;  3SAG A;  3LP3 A;  4RWT A;  4JD2 A;  4KH5 A;  1EWQ A;  3HPO A;  4KAZ A;  3ZSZ A;  2YKN A;  1DKG D;  1KQS M;  2PZS A;  2FBT A;  4PL8 A;  4GY2 B;  1VAZ A;  4KB0 A;  1RTD A;  1HJO A;  1BQM A;  3M1F A;  5CR4 A;  3OYB A;  1A5W A;  1SAZ A;  3NHG A;  4O5B A;  3O80 A;  4C8N A;  1NKC A;  2YNH A;  3OYE A;  3EYZ A;  3WNH A;  4DB3 A;  4MO4 A;  2Q0R A;  1WBB A;  5GAE P;  3J7Y P;  3VQE A;  2P9P B;  1P90 A;  1CZ9 A;  3VTH A;  4OVL A;  4DR6 K;  3MN9 A;  3P1G A;  1KFD A;  5F1X A;  3I55 N;  4F3O A;  2CH5 A;  1LAW A;  1Z6R A;  3LM2 A;  4FJ5 A;  4CJU A;  3ZSW A;  5SZT A;  1C0G A;  3H6E A;  4E7I A;  4LFC K;  4ELV A;  4E89 A;  4BRO A;  4I7F A;  3CET A;  1QSL A;  2DPN A;  2FSN A;  4YOU A;  1O1W A;  4KRE A;  2E2P A;  4XH5 A;  4FK4 A;  3VOV A;  3TTC A;  1TK5 A;  2NRZ A;  4IFE A;  4ISF A;  5FLX O;  1OH5 A;  5CZ1 A;  5HRP A;  4IOC L;  3ULD A;  2NNW A;  3IAY A;  4BRG A;  5GAD P;  3CCU N;  3L3U A;  4Z4C A;  4B1W B;  2O8F A;  1ZYQ A;  1N33 K;  1B9F A;  2I5J A;  3H46 O;  3FFK B;  3LPU A;  3VQ9 A;  1C1C A;  1BIS A;  3AVK A;  5AQM A;  3BDP A;  3A5L C;  3DLE A;  3SQ4 A;  3RMA A;  1QS4 A;  3NH2 A;  1T05 A;  4JI8 K;  1FJG K;  2F8T A;  3MCP A;  3GDQ A;  3QEX A;  4LSN A;  1DTT A;  4AQY K;  2GEL A;  1BCM A;  3CG7 A;  4IDH A;  1QSS A;  1MU2 A;  4J2A A;  1KAX A;  3ZX3 A;  2I7P A;  4GW6 A;  4N41 A;  3CJ9 A;  3P5J A;  3P39 A;  1U2V A;  3P83 D;  1ZBU A;  5BPM A;  4CZM A;  1RT1 A;  1W0H A;  3G4S N;  4OO1 J;  4RW8 A;  2O8B B;  4FWR A;  4DSJ A;  4JHD B;  4BVO A;  5EVZ A;  1Y64 A;  2HHW A;  2OTJ N;  1BG3 A;  3C94 A;  1S6Q A;  4OGE A;  4N56 A;  4KTQ A;  4FJ7 A;  5GIP A;  4JI2 K;  1K73 O;  3CIP A;  2P9I A;  1UWB A;  5AJ3 K;  3CD6 N;  1TV6 A;  3HT3 A;  4ICL A;  4DR4 K;  4CGF A;  2NRR A;  4AHV A;  3H3O B;  1RDA A;  2OPR A;  3RRH A;  1SKR A;  5AQW A;  2XY8 A;  3W0L A;  5GAG P;  4A5A A;  5LL6 Z;  1EX4 A;  2J4R A;  4DKW A;  2YNF A;  3EO3 A;  2OPS A;  4BR9 A;  3CJ7 A;  4CF8 A;  4U7B A;  4CJQ A;  4H4O A;  3I8B A;  2XHB A;  1NGA A;  1RT2 A;  3FZK A;  4CJ4 A;  3U3Y A;  3CQ8 A;  1SS6 A;  2FC0 A;  3VN5 A;  2Q3S A;  1NU0 A;  5FDL A;  3VGM A;  4A57 A;  5KPR A;  3HOS A;  1X1P A;  4AM6 A;  3VEW A;  1HX1 A;  5C24 A;  3HM9 A;  1GLC G;  4ELT A;  1ZBF A;  1HQU A;  4CJT A;  1HMV A;  3QEP A;  2NZT A;  4DV5 K;  3A0I X;  1LOT B;  3SPY A;  2HND A;  4M3U A;  3OW2 M;  1TKZ A;  1E4G T;  5C2D A;  1TUU A;  2HOE A;  3CQY A;  3WT0 A;  2V52 B;  4CF2 A;  5AQJ A;  2FLO A;  4I2Q A;  4JD2 B;  2ZF5 O;  3VF2 A;  1RBU A;  2DFE A;  3H08 A;  4GV3 A;  5JVH L;  4BVP A;  4JRQ A;  3WNF A;  1WOQ A;  2PAV A;  3NGY A;  4M63 C;  4O8U A;  3VA0 A;  4ZTF A;  3CCM N;  5LJV A;  1RT6 A;  3SUP A;  1QQC A;  3P4I A;  2HST A;  1JJ2 M;  1RDB A;  1MDU B;  5C25 A;  4QS7 A;  1BDG A;  3O1B A;  4CZJ A;  4PUO A;  4KTZ A;  3VER A;  4O0I A;  3L4I A;  3AO1 A;  4DTU A;  5MLC Q;  4W5T A;  4JS5 A;  4LF4 K;  2PYJ A;  1IBK K;  3NAE A;  5JS1 A;  1TL1 A;  3KWI A;  4JLH A;  4M3T A;  4DFM A;  3L2U A;  4M3X A;  4BR4 A;  3RSE A;  2O8C A;  5CYQ A;  1BUP A;  3BP8 A;  3OA9 A;  1BO5 O;  4A5B A;  3NCI A;  3HSC A;  2DTU A;  3ZSX A;  4H0T B;  1WN7 A;  2YHA A;  4W5Q A;  2Q0U A;  5E84 A;  4CJS A;  3KVG A;  4QS8 A;  1HNI A;  3QEV A;  1D8Y A;  1O13 A;  4BRC A;  4CCH A;  3HP6 A;  2O8D A;  3AVH A;  3DM2 A;  4H5T A;  3HM8 A;  5AFU H;  3J7A P;  1P8Z A;  3ZET A;  3BGR A;  1ZBI A;  2O8F B;  3KK1 A;  4YNQ A;  4B3R K;  4MFB A;  4LSL A;  3Q7B A;  4CES A;  3QNN A;  3IUC A;  2KZZ A;  4BG8 A;  4BE1 A;  1W2B M;  4CFA A;  1K6Y A;  4NB4 A;  1YXQ A;  3LDL A;  1S1X A;  1XC3 A;  4BE2 A;  3QET A;  4LH4 A;  4LF6 K;  3QIN A;  3AVA A;  2RN2 A;  1ZC6 A;  1S1U A;  4F2S A;  3VQP A;  4E7J A;  1U48 A;  3OBY A;  4KRF A;  4JK8 A;  3QNO A;  4YDU A;  3AGK A;  1YJN N;  3D7E O;  4GKJ K;  1VRT A;  1U2V B;  4DV2 K;  4BR0 A;  1KD1 O;  4CD1 A;  4F3T A;  4ID1 A;  5KRT A;  4JI7 K;  2QWP A;  2QWN A;  1NJW A;  3MDQ A;  4B9M A;  4FJL A;  2KKZ A;  3C0B A;  3O3H A;  3LZJ A;  3WXM B;  1K8K A;  3L2W A;  1RTJ A;  1T44 A;  1N34 K;  5SWM A;  1DTQ A;  3C6H A;  2P9I B;  2QWM A;  2CGJ A;  3K5L A;  3ZSR A;  3VQ4 A;  4J2D A;  2HHT A;  3V1Q A;  1ASV A;  5LMN K;  4JS4 A;  3MEE A;  3EZW A;  4IEE A;  3LL3 A;  2OZM A;  4C23 A;  4C1N I;  2FBV A;  3R6M A;  3QIO A;  2GBZ A;  2RE2 A;  3T7Z A;  3KD5 E;  2E20 A;  3K5N A;  3LWM A;  3SAF A;  3I33 A;  1DLO A;  3ALY A;  2HB5 A;  1TYQ A;  1E3M A;  3AO2 A;  3C6A A;  3LAL A;  4DU3 A;  1Q8I A;  4BAC A;  1WLJ A;  4TSX A;  3CF5 L;  5LMU K;  4DUZ K;  3LDN A;  3EKU A;  1HR0 K;  5BPN A;  1NGJ A;  3O4Q A;  1KFS A;  4CEO A;  1G99 A;  4B9Q A;  4BRP A;  3VEV A;  3P31 A;  4M45 A;  5EY4 A;  2P5O A;  1JCE A;  4JKE A;  3F5T A;  3U9Z A;  2OYQ A;  3QB0 A;  4B9V A;  3DWL A;  1WAF A;  3QER A;  1NJZ A;  2Z1H A;  3O1W A;  1WSF A;  2VYP A;  3TAP A;  4BRQ A;  1TUY A;  5AZI A;  3CJ1 A;  3VPZ A;  3PIO L;  4CIF A;  1XHX A;  4CJK A;  3OYA A;  4M3W A;  3AVJ A;  2E1Z A;  4BR2 A;  3AVF A;  4CGD A;  2UYT A;  3QDK A;  3ZSY A;  1RT5 A;  3SI6 A;  4DLG A;  1WSG A;  4KBO A;  3RMB A;  2E6L A;  3DLL L;  4B8A B;  2E2Q A;  3VQ6 A;  3PY8 A;  3SJJ A;  1VRU A;  3AAR A;  3N4P A;  4IKF A;  4CEF A;  1NM1 A;  1REV A;  4QS9 A;  4BC2 A;  3T1H K;  4EP4 A;  1R0A A;  2RHK A;  4E3S A;  4PWD A;  2IVO A;  4YOV A;  4K8X A;  2ZWH A;  4KH6 A;  3K5M A;  5HLF A;  3GBT A;  3T3F A;  4WFB L;  2KQ2 A;  3RSE B;  4DLE A;  5E41 A;  2O8C B;  2E4L A;  1T6C A;  3SV4 A;  3AVL A;  1WBD A;  2D0O A;  2VQE K;  1XMQ K;  1N8R O;  1W7A A;  5KPT A;  4JYA K;  4CEZ A;  3CPE A;  5J2M A;  2QXL A;  3VEN A;  4KV8 A;  4O0J A;  3TU5 A;  2VCP A;  3THW A;  2O8D B;  4DV3 K;  2NLX A;  1WSE A;  3FFI A;  3MXM A;  4G9Z A;  3ZET B;  3R8E A;  3H45 C;  1D9D A;  1D5A A;  2E5L K;  4XEI A;  4B08 A;  3MEC A;  3M8S A;  3V9Z A;  1QQO A;  4JKF A;  4CBX A;  1IKV A;  4BC5 A;  1DT9 A;  5AQY A;  4JAX A;  3AAP A;  2WTU A;  1U45 A;  2YNG A;  4CED A;  3HRG A;  1RGI A;  1WB9 A;  1W9H A;  5BRE A;  3WEE A;  1VQM N;  4PKI A;  1MWM A;  2OA8 A;  1R59 O;  2E2O A;  3V6D A;  1VQ6 N;  4CJ3 A;  4FXD A;  4BRN A;  5CZ2 A;  2HBL A;  2ZE2 A;  5DMR A;  4I9Q A;  2JLE A;  3SPZ A;  1NK8 A;  1IO2 A;  3QO9 A;  5BRD A;  3SQ2 A;  1HYV A;  4DTX A;  4B1U B;  4JI3 K;  1K8K B;  4JKG A;  5AQX A;  2D4W A;  1J53 A;  4FM2 A;  3DLB A;  2KFZ A;  3OS0 A;  1RDW X;  2WON A;  4KKO A;  4FW2 A;  1NGD A;  1NBW A;  1HUX A;  3OY9 A;  3L0Q A;  2KW4 A;  5GIO A;  3DMJ A;  4IO9 L;  3AVM A;  3LPT A;  3WNE A;  3QEI A;  3BUZ B;  4B1Z A;  3L6Q A;  3NF9 A;  1JLC A;  3D6R A;  3SJH A;  3V9S A;  4FJ9 A;  3RR7 A;  5KGX A;  3LAM A;  2VWK A;  1SKW A;  2G8V A;  3U4L A;  3DLG A;  4LF9 K;  2WC9 A;  3SBG A;  4CZG A;  2WOM A;  4C8L A;  5CYM A;  4FLX A;  3LDQ A;  1VQP N;  1XHZ A;  3KK2 A;  3KLG A;  3A5M C;  1X9S A;  2XRI A;  1VSF A;  3TTF A;  1K9M O;  4FWP A;  4EHU A;  4X62 K;  4CZI A;  2P9S A;  3ZSV A;  1IH7 A;  5HRN A;  3OYD A;  3EY1 A;  3MXI A;  2E1Y A;  2JGU A;  3S3M A;  2HHV A;  3HPH A;  2HF3 A;  3AO5 A;  3VQ5 A;  4YOY A;  3OJU A;  1Q18 A;  4JRP A;  3JYT A;  3UB5 A;  1VSJ A;  4DSE A;  1L3T A;  1ASW A;  3ZX0 A;  3DJC A;  4ZTJ A;  5HRR A;  2GUP A;  3B8A X;  1S72 N;  5AZI B;  4GVE A;  2X6N A;  4FWM A;  3VQA A;  4F4K A;  4DV7 K;  3GE1 A;  1NK9 A;  1VSM A;  2KLA A;  1QTM A;  3A5O C;  1HKG A;  2H3G X;  1NGE A;  4Y1C A;  4OPA A;  2XY5 A;  4OPJ A;  4KHN A;  3KLF A;  3DOL A;  1C0F A;  1SKS A;  3O9U A;  3QIP A;  3AY9 A;  3ZEU A;  3SUQ A;  1IKW A;  4WQ5 A;  2ZD1 A;  4JV5 K;  2NRW A;  2Y1I A;  5EU7 A;  3C65 A;  3OYC A;  3V9W A;  4IFY A;  4DQR A;  1RTH A;  1YJW N;  3CFR A;  3FE1 A;  1KVA A;  3EN9 A;  2PFU A;  5FPE A;  3BF3 A;  5BPL A;  2Z1J A;  1MWK A;  3U3G A;  1BWF O;  1FXX A;  1GLE G;  1JXB A;  5M1Q A;  4OKJ A;  1RBT A;  5J2P A;  4DTR A;  4OLA A;  4DQS A;  1TK8 A;  3DOK A;  1IG8 A;  5HL7 L;  3BZC A;  4ID5 A;  3NH1 A;  3THW B; 
#chains in the Genus database with same CATH homology
 1N34 K;  4JI5 K;  4DV0 K;  4LF9 K;  4CW7 B;  4LFA K;  5LMN K;  2VQE K;  1XMQ K;  4JI0 K;  4JYA K;  4NXM K;  4X64 K;  1HNW K;  5A2Q O;  4GKK K;  4B3M K;  4YHH K;  4CVN E;  1XMO K;  3J81 O;  4X62 K;  4LF4 K;  1IBK K;  1HNX K;  4DV3 K;  4K0K K;  4JI2 K;  4DR5 K;  2UXB K;  5AJ3 K;  4B3T K;  4DR4 K;  5BR8 K;  2E5L K;  4JI6 K;  3J7Y P;  5LMU K;  4DUZ K;  4OX9 K;  4DR6 K;  1HR0 K;  5LL6 Z;  4DV7 K;  3OTO K;  4B3S K;  1J5E K;  4DUY K;  2UXD K;  2UXC K;  3J7A P;  4KHP K;  4LFC K;  4B3R K;  2ZM6 K;  4DR7 K;  4DR2 K;  1HNZ K;  1IBL K;  2UUB K;  3J80 O;  4JV5 K;  2F4V K;  4LF6 K;  3T1Y K;  4JI1 K;  4JI3 K;  5FLX O;  4DV5 K;  1N36 K;  5IT9 O;  1XNQ K;  1IBM K;  4LFB K;  4DR1 K;  2UUA K;  5IWA K;  4LF7 K;  1N33 K;  4DV6 K;  3JAM O;  4NXN K;  1N32 K;  4V19 S;  4GKJ K;  4DV2 K;  4YY3 K;  4JI7 K;  4DV1 K;  2UU9 K;  1FJG K;  4X66 K;  1XNR K;  4JI8 K;  4LF5 K;  4X65 K;  2VQF K;  4DR3 K;  2UUC K;  2HHH K;  3T1H K;  4LF8 K;  4DV4 K;  1I94 K;  4AQY K;  4JI4 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...