3ZETA

Structure of a salmonella typhimurium ygjd-yeaz heterodimer.
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
229
structure length
226
Chain Sequence
b'MRILAIDTATEACSVALWNNGTINAHFELCPREHTQRILPMVQEILAASGASLNEIDALAFGRGPGSFTGVRIGIGIAQGLALGANLPMIGVSTLATMAQGAWRKTGATRVLAAIDARMGEVYWAEYQRDAQGVWQGEETEAVLKPERVGERLKQLSGEWATVGTGWSAWPDLAGLTLHDGEVSLPAAEDMLPIASQKLAAGETVAVEHAEPVYLRNEVAWKKLPG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTATIVE M22 PEPTIDASE YEAZ
publication title Crystal Structure of the Dimer of Two Essential Salmonella Typhimurium Proteins, Ygjd & Yeaz and Calorimetric Evidence for the Formation of a Ternary Ygjd-Yeaz-Yjee Complex.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium str. st4/74
molecule tags Hydrolase
total genus 67
structure length 226
sequence length 229
ec nomenclature
pdb deposition date 2012-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00814 Peptidase_M22 Glycoprotease family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3zetA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3zetA02
4I6MA 1MWKA 3RSEA 2HF4A 4M7YA 1NGCA 4BG9A 3LDNA 2VYPA 3D2FA 4WQ5C 4FWPA 2A42A 4EFHA 3D7EO 1BOTO 3SMSA 1NGFA 1HX1A 4CZIA 1P8ZA 3JS6A 3VF6A 4B1YB 3SMPA 5AQJA 1G99A 3MK6A 1NGIA 3A0IX 4JAXA 3O08A 2V51B 5AZIB 1CZAN 1NBWA 5E84A 3EO3A 5AQFA 2FF3B 1RDWX 3AY9A 3DJCA 1ZXOA 3LM9A 1DGKN 3TPQA 1BA0A 2P9NB 3IFRA 2E88A 2ZWHA 4BRKA 1SZ2A 2Q31A 1U2VB 2IVNA 3M3ZA 2F9WA 4XH1A 2CGJA 4JN4A 2P9IB 1Q18A 2E8AA 3DAWA 3O5BA 3M1FA 4KBOA 1RGIA 3L0QA 1X3NA 1NM1A 2WUSA 2E2QA 3R9PA 3VGLA 2F9TA 1HJOA 3ID8A 4FWKA 4BRHA 3WUHA 5KPZA 1BWFO 4PKGA 3ATUA 2OANA 3MCPA 4FL9A 4BR5A 4A62A 2NRHA 1K8KA 2D1KA 4BR2A 4CZGA 1ZC6A 2J4RA 3ZX0A 5TKYA 1MA9B 3W3DA 1NGJA 3R8EA 1D4XA 3I33A 4BRQA 1XQSC 3LDQA 3TU5A 1V4TA 4JHDA 5AFUA 1Y64A 1GLEG 4CI6A 1LOTB 4DQ8A 4BRIA 4B9QA 3O4WA 5AQUA 2P9SB 3I8BA 3WEEB 5AQZA 3JXUA 4XH4A 3OHRA 1JCEA 2FLOA 5BR9A 3HTVA 3CQYA 4IWVA 3DXKA 4O8KA 1ATRA 4PL7A 4CZKA 3LDLA 5EOYA 1MWMA 1MDUB 4BRFA 2ASOA 1ZBSA 4PL8A 2UYTA 4K25A 3BUZB 1WUAA 4BQZA 4RWTA 2QWNA 4XEIA 5I9EB 5AQGA 2E2NA 4FWSA 3GDQA 5EX5A 3LDOA 3DXMB 3C7NB 1IG8A 5AZJB 4DCHA 1J6ZA 3UKUB 3H1QA 4ISFA 4H0VB 2ZF5O 3VPZA 1XC3A 3CJCA 2GUPA 4H0YB 2FXUA 4H5RA 3FR0A 4M63C 4BRGA 2IVPA 3FZMA 3KVGA 2I7NA 4GNIA 2ITMA 4E1JA 5KQ8A 2I7PA 4YDUA 5BRHA 5AZIA 4QS7A 4DHYA 2Q36A 4BC3A 1QHAA 2CH5A 4JD2B 4BGAA 4CZEA 1C0FA 2D4WA 2QWOA 3UE5A 4A2BA 3WXLA 5FPDA 5JLHA 3U9DA 1QZ5A 3O6WA 2P9NA 1WOQA 4C23A 2PBDA 5LY3A 5KPRA 2CH6A 2P9PB 3DWLA 1U2VA 4RCHA 2YHYA 3ENOA 5AQOA 1HUXA 2QW9A 4Z94A 3ZEUB 5B8HA 4H0TB 4Y0WA 2P9LB 2HOEA 1GLDG 1TUYA 4AM6A 2HMPA 4MO4A 4O5FA 3ZETB 3FLCO 4MO5A 3QDKA 1LCUA 3FFKB 2BTFA 5AQHA 5AQIA 5LJVA 3CJ7A 4B1VA 2IVOA 3R6MA 2GEMA 1E4GT 4K42A 1SQKA 1GLLO 5FPMA 4LC9B 3VENA 2ASPA 3WXIA 2P9KB 4BRAA 3H6EA 3HM8A 5ADXH 3VGKA 1HKGA 1HKCA 4H5TA 2EWSA 3FE1A 3CQXA 4HWIA 1KXPA 1YVNA 2QWPA 4CZJA 3EKUA 3D2EB 3FZFA 3VESA 2YHXA 3L6QA 5FPEA 5AQLA 3BF3A 1RFQA 3HI0A 4WQ4A 4A61A 4MLEA 4BROA 4FWMA 2A3ZA 4I6MB 5AQRA 1YXQA 1ATNA 1KAYA 1BDGA 1NGHA 2QWMA 4K41A 3U8XA 3O1WA 3D2FB 5CE3A 4MLHA 2QWLA 2QWRA 5F2RA 5EVZA 1R59O 3GE1A 4ISGA 3QBWA 5EXWA 5KQDA 2W41A 2QWQA 4CZLA 1NMDA 1KAXA 3GG4A 2FSNA 2YJFA 3QFPA 4B1WB 2FSJA 2ZGYA 3A5MC 1V4SA 3DXMA 4PKHA 4ISEA 4FWNA 5AQYA 5AZJA 5AQMA 4CBUA 1ESVA 2H3GX 3GBTA 4GY2B 3UKUA 4BRDA 2QM1A 5AR0A 4BR9A 3CI5A 1NGGA 5F1XA 4FWQA 1X9JA 1NGDA 2P9UA 3S41A 2E20A 2BUPA 4FPAA 3UKRA 3FGUA 2YCHA 3IDHA 4H5NA 3QICA 4BRLA 2NZTA 4WQ5A 4JD2A 3MMVA 2GELA 4J8FA 1QZ6A 4H0PA 2A41A 3VEOA 2GWJA 3ZX2A 4BRPA 3VEZA 3VEWA 4CZMA 3CJBA 3H45C 3UB5A 1IJJA 2HF3A 3KHYA 4L3QA 2QXLA 3VGMA 3SJHA 3MN5A 3C0BA 1BA1A 4CZHA 3B8AX 2KHOA 4BRNA 2P9LA 2E2PA 5BN9A 5JICA 4IZ9A 1X3MA 3CJ1A 3QB0A 5AQTA 4B1ZA 1DEJA 2ZGZA 3A5LC 3EN9A 4H5VA 5AQXA 2A6AA 4FO0A 1C0GA 4BR4A 3G25A 2FSKA 3EL2A 1Z6RA 2Q97A 2P9KA 4JHDB 2ASMA 3A5OC 1T6CA 2YJEA 3FZKA 4WYBA 4BR0A 4BVPA 2V7ZA 3H3OB 3AARA 5F0XA 1BU6O 3FZHA 3QFUA 3ULEB 3VEVA 1S3XA 5BREA 2P9IA 3EZWA 5AQNA 1GLCG 5AFUH 4BVOA 3O8MA 3D2EA 1TYQB 2GTDA 4BGBA 3CJ9A 3CHWA 5BN8A 3HSCA 3VEXA 4EAHD 3QMLA 3A5NC 5AQVA 3ZX3A 5AQWA 5AQKA 4QS9A 3WT0A 3GOIA 3LL3A 5KPTA 2YHWA 1E4FT 1NWKA 3F9MA 3VETA 4FWOA 4FWRA 3IMXA 5JLFA 3LM2A 5BPMA 2VWBA 1U6ZA 3VERA 4H0XB 4IJNA 4IJAA 3O1BA 1EQYA 2NLXA 3CIPA 3MN7A 4PKIA 4IXCA 2CGKA 1S22A 2E1ZA 4H0OA 4RTFD 3ENHA 3VF2A 3IUCA 1QQOA 2P9SA 3MN6A 3WXJA 3WEEA 1ATSA 3HZ6A 2AP1A 1T6DA 5AQSA 2D0OA 1H1VA 4BRMA 4FPBA 2E2OA 4YDUC 3RSEB 3A8YA 3VEYA 3U9ZA 2GWKA 3QBXA 1KAZA 3LDPA 3SLCA 1HKBA 1BG3A 3P4IA 4IO8A 4BQLA 1QQNA 5JMVA 2A40A 1GLBG 3CJAA 1JCGA 1T44A 2Q1NA 3C7NA 3J8AA 3BEXA 4B1UB 5BRFA 2VCPA 4BG8A 1SAZA 3M6GA 4CBWA 3WQUA 1NGEA 2Q2RA 2FF6A 3BP8A 2Q0RA 2A5XA 5E26A 3VOVA 1OKJA 5EY4A 4AM7A 3AAPA 2D0PA 4EIAA 4BR7A 3VF4A 3HBTA 3GL1A 4A2AA 2IIRA 2E1YA 3EKSA 1YAGA 4HTLA 4FOIA 4BC2A 4JNEA 3H3NO 1XUPO 3WQTA 2V52B 1NGAA 2CGLA 4NO7A 2P9PA 3ULEA 1BUPA 4CD1A 3ZEUA 4B1XB 4CJ7A 1QQMA 3L4IA 1GLAG 4CBXA 1TYQA 3KZBA 4K43A 3H1VX 3ZETA 5BPNA 2PAVA 3FZLA 5ELZA 4BC4A 5AQQA 1K8KB 2YI1A 5ADXA 3W0LA 4WQ4C 4BREA 5FPNA 3O80A 4F9OA 2Q0UA 1DKGD 4BRCA 1GLJO 3SK3A 4CZFA 1HLUA 2V7YA 1GLFO 1JCFA 1TUUA 3H46O 4FWLA 3U4LA 4BC5A 1YUWA 1HPMA 5BRDA 4M7XA 4NB4A 3CETA 3BF1A 1Z05A 4H5WA 4QS8A 5AQPA 4CD3A 3CERA 3MDQA 4FSVA 4DB3A 3MN9A 2AA4A 1NGBA 2P9UB 4EHUA 2DPNA 4EHTA 4FOEA 3DXKB 5BPLA 3AAQA 3UKRB 3WXKA 5LJWA 4H03B 3ATVA 2W40A 1BO5O 4XH5A 1NLVA
chains in the Genus database with same CATH superfamily
4I6MA 1MWKA 4CGFA 4AILC 4LSLA 1L3TA 4C8OA 1BIUA 2HHSA 4FWPA 1BI4B 3LP1A 3AA2A 1F21A 3SMSA 1HX1A 4LFAK 3ZSOA 2P5GA 1P8ZA 4C8NA 3DLEA 5C0YA 1KVCA 3A0IX 3PX0A 1MU2A 1W2BM 4PQUA 5AZIB 2PY5A 1NBWA 3MX2A 4PHTX 1S9EA 3AY9A 3P83D 3TPQA 2O4IA 4E7JA 5I3UA 4JKAA 3KK1A 3K59A 4O55A 3SUOA 2O8BB 4XH1A 4JI7K 3O5BA 4DFJA 3A2FA 4FCYA 4CGIA 5AJ3K 2WUSA 3M8PA 2F9TA 1HJOA 4FWKA 3SV4A 3HK2A 4BRHA 5KPZA 4KH6A 2VQFK 3SUPA 5HP1A 4OGEA 2OPPA 5TKWA 4YORA 4Z4HA 4CFBA 4BR5A 3VQCA 4BR2A 1VQ6N 4DR4K 3EY1A 2J4RA 2BGGA 4DF8A 5TKYA 4LY7A 1NK0A 3LPTA 3I33A 4J2EA 4CJ5A 5AFUA 1NK4A 4OLBA 1GLEG 2ZJPL 1LOTB 3CC4N 4KH5A 4CIEA 1S1WA 3I8BA 5I42A 3F5TA 4EP5A 3OHRA 3CXCM 3HTVA 4JI5K 4CE9A 3CQYA 4OLAA 4O8KA 3SBGA 2LSNA 4PL7A 3NH1A 2HHHK 5CY4A 1UA1A 3KK2A 4DTXA 1ZBSA 4PL8A 4JI6K 4OJRA 4LFCK 1EWQA 3T1AA 5AQGA 5GAGP 2ZE2A 1RT4A 1RCHA 3OYIA 4B9VA 1C1BA 4BWJA 4M3XA 3DYAA 3KWGA 3EE9A 3K5NA 1LAWA 3CJCA 3OS0A 3OYAA 4E1JA 3FZMA 2ITMA 3S3MA 4YDUA 2XY8A 3LALA 3DOLA 5BRHA 5AZIA 4O4GA 4DHYA 4H4OA 1QHAA 2O8CB 1SKWA 4CZEA 2D4WA 4A2BA 3U9DA 1QZ5A 3SUNA 2ATQA 1WOQA 4BE0A 1WB9A 3MEDA 1L3UA 3DWLA 4RCHA 2O8BA 4ELUA 4DV0K 5B8HA 4CEAA 5GIPA 2P9LB 1TK0A 1TUYA 1ILYA 2HMPA 2O8EB 3DLLL 3FLCO 3R3LA 1VHXA 3QDKA 3THYA 1BQNA 4AHVA 5LJVA 2HHUA 3Q7BA 2FBTA 4CFCA 5CZ1A 1E4GT 1IKWA 1FK9A 1GLLO 1LWEA 4BDZA 2G8UA 4LC9B 1U04A 3QEVA 2ASPA 3WXIA 2P9KB 1IG9A 4BRAA 2OPQA 1S9GA 4DSKA 1WBDA 3U3GA 3CQXA 1VQ4N 1YVNA 4CZJA 3L2RA 3EKUA 1TK8A 4YFUA 3CFRA 4DFKA 3L6QA 4FLYA 4E0DA 2X6SA 5FPEA 3QESA 4KHPK 1RFQA 4WQ4A 4I9QA 4Y1DA 4GV6A 3QETA 2YHAA 4IBNA 2UUCK 1VQ5N 2O8FA 2XO7A 5IT9O 3KK3A 1YXQA 4CJVA 3CCVN 1NGHA 4DFPA 4ELTA 3D2FB 2YHBA 2QWRA 5EVZA 1R59O 1XC9A 4ISGA 5KRSA 3V1OA 4CZLA 1KAXA 4KREA 3C6HA 4CJKA 2YJFA 3HP9A 3JYTA 4DQSA 3VA0A 4C8KA 1VQKN 3PIOL 4ISEA 4LF6K 1JKHA 5AQYA 4CBUA 2D5RA 4CF0A 2H3GX 3GBTA 4GY2B 3V1QA 1IBLK 4KB1A 2VQEK 4M3ZA 2QM1A 4FJ5A 4V19S 4CGHA 2KFZA 2OZSA 5F1XA 1RNHA 3ZT3A 3PIPL 3RTVA 1NGDA 2QXFA 4YOVA 2WBNA 4FPAA 3PY8A 4ICLA 3FGUA 4Z4EA 4H5NA 4WQ5A 3L3UA 3NH2A 2O8CA 4DU1A 3KD1E 3VEWA 4AHSA 3CJBA 3H45C 3NGYA 4L3QA 5T7BA 2DFEA 3KK7A 2IAJA 1J54A 4GW6A 4BRNA 3IG1A 2P9LA 2E2PA 1N33K 4IZ9A 2X74A 1VK0A 1KSPA 1Q9XA 2ZGZA 4GVMA 4LF9K 3TAEA 3Q7CA 4F2SA 1IKYA 3CM5A 3ZT2A 5IWAK 3EL2A 1Z6RA 4F3TA 2Q97A 3QIOA 2P9KA 4JHDB 2IOCA 4NYNA 4DR6K 4TSXA 4G1QA 1HPZA 3QERA 1IBKK 2NRWA 4JLHA 3VEVA 5SWMA 2P9IA 1HR0K 3EZWA 3OYGA 4GKKK 3C94A 1RT5A 3F9KA 3ID6A 3MXIA 2OZMA 4J2BA 3VEXA 1FJGK 1ASUA 4OPKA 3GOIA 1KRPA 1SKSA 3LP3A 3IMXA 2BE2A 2UU9K 5BPMA 3I0SA 1U6ZA 3NBPA 4H0XB 5J2NA 3O1BA 3TSUA 1EQYA 4IXCA 1XWLA 4AHUA 3QEIA 2E1ZA 3VF2A 3IUCA 1RT1A 5KTQA 2XHBA 2OPRA 3WEEA 3TAPA 2QEXN 2HHQA 5AQSA 1E3MA 4BRMA 2ZJRL 4YDUC 3O4NA 2YNHA 3VEYA 3AVLA 3U9ZA 1QVGM 3SLCA 3MEEA 1NOZA 4CJEA 3OYDA 4IO8A 5C12A 2HW3A 3NMUA 2FC0A 4CJTA 1A5VA 4OVLA 5E41A 4CCHA 2A40A 3HL8A 1IV0A 2YKMA 4JI2K 1QS4A 3J8AA 4IFEA 4N41A 5BRFA 1YT3A 1NJWA 4FK4A 1CLQA 3AVCA 2NRZA 3WQUA 3F73A 3NF7A 2FF6A 2G8HA 4JYAK 4B3SK 1LWFA 3AAPA 3HBTA 5GAEP 3D45A 3KKSA 3EKSA 1JJ2M 4JNEA 3AVJA 3WQTA 4OX9K 1X1PA 1C0TA 3WNGA 3CFOA 4CD1A 4CJ7A 4YNQA 4CBXA 4FLUA 3DLHA 2FBVA 1WSFA 4UY8O 3LWLA 4BC4A 3IAYA 1Z26A 2YI1A 4Z4IA 1TL1A 5K14A 4WQ4C 4KHQA 4QOZB 3VTHA 5D3GA 3O80A 2Q0UA 3WNEA 4DS5A 4E7IA 1TUUA 4IOAL 2HSTA 2QTDA 1VRTA 1TKXA 4I9LA 1SUQA 4CD3A 3CMAN 3NH0A 4B9LA 4DB3A 2P9UB 3O9QA 4CHOA 3AAQA 3LAKA 2HNZA 3HOSA 4OKKA 1YITN 2W40A 4YHHK 3LANA 3NVMA 4HUGA 3CCUN 1N6QA 3VQ5A 1JLQA 1NGCA 1QHTA 4WQ5C 4FJ7A 4CHQA 2NRVA 3D7EO 3IS9A 3DOKA 4O5BA 4CF2A 3VQ6A 3VF6A 4DQRA 1G99A 3CM6A 3MK6A 3HPHA 2F7TA 3SQ1A 2HNYA 2NUBA 2P51A 4KFBA 4AF1A 5C10A 1I94K 1CZAN 5CR4A 1FW6A 4NCGA 1KLNA 4GVEA 4ILHA 4GKJK 3LM9A 4OPAA 1JLFA 3SPZA 3K2PA 3LZJA 3P5JA 3I55N 2IVNA 4X66K 3ZSVA 3TWHA 3AGKA 3RMCA 3DAWA 4IG3A 1C6VA 4IEEA 2A1SA 4O0JA 3L0QA 1X3NA 4M3RA 3P1GA 1NKEA 3ID8A 3WUHA 5GIOA 1RT3A 2Y1IA 1IBMK 2E6LA 1RT2A 3MCPA 4E7LA 1UAXA 1EETA 4B9NA 2IC3A 4WFBL 5J2QA 1ZC6A 3NDKA 3EEQA 3ZX0A 3SJJA 2HBJA 4R79A 4HHTA 2HVIA 1NGJA 4FJ9A 4N47A 1DTTA 1D4XA 1L5UA 4OGCA 2WFBA 2OTLN 4DQQA 3TU5A 4O0IA 4YOWA 4KRFA 5AQUA 3P31A 1HNXK 5HRSA 5JS1A 3AVKA 3JXUA 4KHYA 2FLOA 4ZHRA 4IWVA 1EKEA 1ATRA 4DKWA 1MWMA 2B4JA 4EZ9A 3ZT0A 4DU4A 2P5OA 3TTDA 2UYTA 4MQ3A 1WSHA 4RWTA 4ZTJA 2QWNA 4RW7A 2E2NA 4RW9A 4BDYA 5EX5A 3AA5X 3DXMB 4F2RA 2HHXA 4JI1K 1IG8A 5AZJB 3BDPA 3MWTA 1NMNA 3DLKA 3H1QA 4ISFA 4KPYA 4KI4A 2DTUA 3CQ8A 1XC3A 5HL7L 4DV6K 2QKBA 4H0YB 4M63C 4H5RA 3FR0A 3PSIA 4YOYA 4KKOA 4GNIA 3E9PA 4Q5VA 3LAMA 4X62K 2KZMA 4RW8A 1C0FA 2Y1JA 3S9HA 1NK6A 4JV5K 2RE2A 1LW0A 2PBDA 3CF5L 3ZSWA 1QE1A 5KPRA 2PYJA 4ILJA 4KH4A 2YHYA 3ENOA 3QNOA 2HOEA 4JK7A 3NHGA 4JK9A 3OA9A 4DV1K 4O5FA 1LCUA 2BTFA 5AQHA 3K5MA 4FJMA 3CJ7A 1FKPA 4K42A 1X9SA 3VENA 3M8QA 3PLAA 1N32K 4B3MK 3LP2A 5ADXH 4H5TA 3SZ2A 1JLCA 2QWPA 4CJSA 1NG9A 2A1RA 3D2EB 1KVAA 2YHXA 3VMFB 4FM1A 3ZT4A 5AQLA 1BQMA 3O3HA 4RW6A 1X9WA 4BROA 3LZIA 1HQUA 2NNWA 2QWMA 1KAYA 1TKZA 4OPJA 3OYMA 3AVAA 3U8XA 4WFNL 4CHNA 3R1XA 2QWLA 3HO1A 4YY3K 3NAEA 4B9TA 4FJ8A 3GG4A 1NU0A 4WE1A 3CCMN 2ZGYA 3DXMA 4PKHA 1WAJA 1WN7A 1QSLA 3VQ8A 3ZT1A 3K5LA 4Y1CA 5AZJA 4BRDA 2HHTA 3VN5A 4BR9A 5M1OA 3V4IA 2G8KA 1X9JA 2G8FA 3S41A 2E20A 1T3VA 3IDHA 2NZTA 1ZBUA 4B8CA 2GELA 4H0PA 2ITGA 4CZMA 3SAHA 4WCEL 4JS5A 2QXLA 4AHCA 4B8AB 1VQ8N 4CZHA 3OYEA 1BI4A 4KB0A 1RBVA 2HHVA 2NRRA 4B3OA 4CJQA 5JICA 5AQTA 1DEJA 5DMRA 3C6TA 3LP0A 1XMOK 2YX6A 5HRPA 1G15A 1KQSM 2WC9A 4OKEA 4CECA 1YJNN 2A6AA 4I2PA 5J1EA 2GBZA 3G25A 3KIOA 3T3FA 4CERA 4JKGB 1T6CA 2YJEA 3TABA 4DTRA 2V7ZA 4ID5A 4K8XA 5F0XA 1VQNN 1KLMA 1S3XA 5BREA 5AQNA 4O8UA 4BVOA 3D2EA 4CJLA 3NF9A 3CJ9A 1ZYQA 3NF8A 1NJXA 4NLBA 4DR2K 2DFFA 3T19A 3VQPA 2BDPA 3QMLA 5AQKA 4DQPA 3LL3A 4FZYA 2Z1JA 4UQGA 5JVGL 2YHWA 1U45A 1E4FT 5C15A 4FWRA 3RRGA 1QQCA 3U3YA 4B08A 1YJ9N 4M42A 3VERA 3AVHA 4DV3K 4FLZA 1T05A 3MN7A 4PKIA 4KAZA 2B5JA 4IDHA 1S22A 4RTFD 5C2FA 1XHZA 3MN6A 3VQEA 3WXJA 4CW7B 5FROA 2AP1A 4HUFA 2D0OA 1H1VA 3AV9A 2YKNA 4DTSA 3PO5A 1OH8A 2E2OA 3A8YA 2GWKA 1TVRA 2IGIA 2VG6A 4BE1A 3PX4A 4WFAL 1HKBA 1BG3A 4CGGA 1QQNA 1WNSA 3CCSN 1QTMA 3V9SA 3PV8A 3HP6A 4DMNA 2WOMA 1JCGA 1T44A 5C42A 4KV8A 4FLWA 5MLCQ 1BCMA 1W7AA 1ZBFA 1SAZA 3M6GA 4LF4K 1NGEA 4DR7K 4DWIA 3CCJN 2Q2RA 1DTQA 4I7FA 1VSDA 1HNZK 3L2VA 2D0PA 1BISA 3G4SN 4BR7A 1LAVA 4A2AA 3TANA 5GINA 3JSMA 4JKGA 4XIUA 4DV5K 2VGMA 1S1XA 4FOIA 4BC2A 2XY5A 3I8DA 3H3NO 4KO0A 2JLEA 2V52B 1NGAA 2E4LA 1J9AA 3VQBA 4FLXA 3L4IA 1GLAG 3ISNC 3T1YK 1S72N 4K43A 4JI4K 2O8EA 4NYFA 5AQQA 1Q9YA 3CFPA 3J7AP 4BDPA 4JK8A 4BRCA 1GLJO 3CCQN 4CZFA 1HLUA 4MFBA 1YIJN 1GLFO 1S6QA 3OYBA 3SQ4A 4FWLA 1A5XA 4BC5A 1HPMA 1YI2N 1JXBA 4M7XA 2QA4N 1VQMN 1RT7A 1KFSA 3CETA 3C65A 3RMDA 1SL1A 4H5WA 4QS8A 5AQPA 1XMQK 3CERA 2YV0X 3OYKA 3O3FA 2B6AA 4FSVA 3QIPA 3MN9A 4EHUA 4EHTA 3TAQA 2DPNA 4FOEA 3DXKB 3P38A 3UKRB 3QLHA 3WXKA 1Q8IA 3QNNA 5LJWA 4H03B 4CJPA 1UOCA 3VQQA 1C0MA 1TKTA 3CG7A 1Y97A 3TARA 3RMBA 4CF9A 1SKRA 3LDNA 2VYPA 3V9XA 3D2FA 1QSYA 2A42A 4EFHA 1BOTO 1FKOA 1NGFA 4A5AA 2JWKA 2PFUA 3OBYA 4CZIA 3JS6A 4PWDA 3SMPA 1QVFM 1NGIA 4C1NK 4JAXA 4B9SA 4DTPA 2V51B 3ALYA 4HCBA 5AQFA 5C2DA 2VWJA 3UIQA 4GV3A 3E1YA 2YNIA 1DGKN 1C0UA 1BA0A 2P9NB 3ENBA 2IDOA 1GOAA 2Q31A 4CGJA 3OJUA 1U2VB 4FYDA 1S1UA 2CGJA 4JN4A 2E8AA 3H08A 4MDBA 1VRUA 1HMVA 3HVRA 3ZLJA 4KBOA 2W6LA 1RGIA 3HVTA 2HMIA 1NM1A 4DR5K 3CMEN 3SYZA 3R9PA 2E6MA 3AVGA 3MX5A 4IO9L 3C6AA 3SCXA 1BWFO 3NFAA 4FW2A 3KLHA 3I56N 2O8DB 4DU3A 3AO5A 4GV9A 4A62A 2D1KA 1KC8O 1KFDA 1W0HA 1MA9B 3M5RA 3CCEN 1J53A 4FZZA 3OTOK 2XRIA 3CC7N 4DSFA 1XQSC 1TK5A 1NJYA 4FW1A 2RHKA 4JHDA 4CI6A 4W5TA 4DQ8A 1HYZA 4B9QA 3DM2A 2P9SB 1BGXT 3PO4A 5M1KA 1LWCA 4XH4A 2QKKA 5BR9A 1VSKA 3AO2A 3DXKA 5KI6A 3MXMA 3THWB 3K9JA 3LDLA 1MDUB 1SL2A 2KQ2A 2VWKA 1NNEA 5C24A 1DT9A 1TL3A 4K25A 1ZBLA 1VSMA 1QSSA 3DLBA 2KZZA 3WNHA 5JS2A 3GDQA 3LDOA 1TAUA 4JEPA 3C7NB 4CEQA 4HVJA 4E7HA 1OVQA 4FLVA 1VAZA 1YVUA 4IOCL 2ZF5O 1HRHA 2OPSA 4FVUA 3VQAA 3ZSYA 4DR1K 4BRGA 4LH4A 1T8EA 4DTJA 5KQ8A 3E01A 2I7PA 3EZ5A 2OYQA 4NXNK 2UUBK 1NK8A 3HRGA 2Q36A 4BC3A 4N76A 1BL3A 4BGAA 2QWOA 3UE5A 3P39A 4JRPA 1BCOA 4ID1A 3WXLA 5JLHA 3T1HK 3CD6N 2P9NA 5SZTA 4C23A 5LY3A 3HOTA 4E7KA 2CH6A 1IKXA 2RN2A 2P9PB 1U2VA 2YNFA 5AQOA 1HUXA 2QW9A 3ZEUB 3S3OA 2G8WA 4B9MA 4JRQA 1GLDG 4N5SA 4MO4A 3ZETB 3IRXA 1RDBA 4MO5A 3FFKB 5DM7L 1YTAA 5AQIA 4B1VA 2IVOA 3OBWA 3K57A 3R6MA 3TR8A 5J2MA 3PUFA 2GEMA 4JI0K 1SQKA 5HLFA 5FPMA 2DFHA 4IKFA 4FJJA 1NJIO 3G10A 4N56A 3TTCA 3ZSXA 1HQEA 1HKCA 3OYLA 3DMJA 2EWSA 3KKRA 3QINA 3DLGA 4HWIA 2EX3A 3FFIA 4Z0UA 1RBRA 4CEBA 4IDKA 3SAFA 1W97L 4OPHA 3CPEA 3DLRA 1NJZA 5FLXO 1YF5L 3BF3A 3C6UA 3HI0A 5JVHL 4FWMA 4JKDA 2A3ZA 4I6MB 1L3SA 1ATNA 1BDGA 4DTNA 4K41A 4BY9C 3AVBA 5M1NA 4MLHA 4WF9L 3LPUA 5H1SQ 5F2RA 1RDAA 3GE1A 2UXDK 3QBWA 5EXWA 3V9ZA 2QWQA 2OCEA 3SAGA 3MWPA 2FSNA 3VQ7A 1C1CA 3A5MC 1V4SA 3NGIA 4CEOA 4FWNA 3OYCA 4YOTA 5AQMA 1K8AO 4JI3K 1M90O 4Q0BA 3TSPA 3D6RA 1NGGA 3AO4A 5EU7A 3OYFA 2P9UA 3AO1A 1JLGA 1CXUA 2YCHA 4BRLA 1RTJA 3QEWA 3MMVA 4J8FA 2A41A 3CCLN 2GWJA 3TAMA 3VEZA 4DS4A 1IJJA 2HF3A 1B92A 3KHYA 3V9WA 3QO9A 3VGMA 3MN5A 3B8AX 3ASMA 3HM9A 4DV7K 2P1JA 2KHOA 3AO3A 3S3NA 2ZQBA 3SQ0A 5BN9A 1K73O 3OW2M 1CZBA 2OA8A 2X6NA 3CJ1A 4KHNA 1RDCA 3MAQA 1D9FA 2XY7A 1D9DA 4LFBK 4FK2A 4EP4A 4L8RB 3EN9A 4JKEA 5DK5A 2D0AA 5CZ2A 1Q82O 4FO0A 1VSEA 2HB5A 3E9LA 4DUYK 1J5OA 4BR4A 1IKVA 2FSKA 4IG0A 2Z1HA 3HYFA 1J5EK 3A5OC 3FZKA 2X78A 4WYBA 3RRHA 3HXMA 3QEXA 4O44A 4JI8K 1BU6O 3QFUA 3ULEB 5J2PA 3TAFA 1TAQA 1HYSA 4FLTA 5AFUH 1TYQB 2GTDA 4DF4A 4DTUA 4AHRA 5BN8A 3AVMA 4DV4K 4EAHD 3DRPA 4CFAA 1C1AA 3ZX3A 2O4GA 5AQWA 3WT0A 3SQ2A 1YTUA 2GX9A 3VETA 3SI6A 3ZCMA 1YHQN 1LW2A 1R0AA 4B9UA 1S1VA 3DRSA 1JLAA 4IJNA 5KGXA 4B3TK 3SNNA 3CIPA 1HYVA 3N4PA 4R5PA 4H0OA 5KGWA 4HTUA 4KHSA 4CJRA 3VA3A 5CHIA 4F4KA 4ZTFA 3AVNA 4OKJA 1ATSA 1WBBA 4HUEA 1XNQK 3RSEB 2BH1A 4BWMA 3L3VA 3QBXA 3LDPA 2F8SA 4CJWA 3BZKA 3P4IA 4I2QA 3PSFA 4KTQA 1NKBA 5JMVA 1ZBIA 4FXDA 5HOOA 1RDDA 1GLBG 2Q1NA 3THYB 3T7ZA 3VTIA 1BIZA 3BEXA 4B1UB 3LDSA 2G8IA 3RR8A 2VCPA 4CBWA 4EZ6A 3BP8A 2Q0RA 4M45A 2A5XA 3EYZA 3DI6A 3VOVA 1HNWK 1KTQA 1OKJA 3BGRA 5EY4A 4AM7A 3J80O 2ZJQL 4U7BA 4DFMA 3RR7A 2YNGA 4KTZA 4NXMK 3GL1A 3VF4A 2IIRA 4JS4A 4KHUA 4M3WA 1YAGA 2NRTA 4A57A 4CGDA 4K8ZA 2RKIA 2CGLA 4CHYA 5HRRA 1LV5A 2KKZA 3ULEA 1ZBHA 4LH5A 1BUPA 1Q81O 4KI6A 3U6FA 1QQMA 2EHGA 4K0KK 2KTQA 1CXQA 2O8FB 1TYQA 1WAFA 3KLFA 3KZBA 1EXQA 2PAVA 3FZLA 5ELZA 1K8KB 2KLAA 3OJSA 5ADXA 4FJXA 4F9OA 3ZSQA 3NGZA 3SK3A 3CPWM 4U67L 2V7YA 3SV3A 4DQIA 3U4LA 1YUWA 5BRDA 3O4QA 4NB4A 4FVMA 4X65K 4E89A 3NE6A 3NCIA 4CEFA 3G6EN 4HCCA 1VQ9N 1S6PA 1SV5A 3I0RA 5BPLA 5A2QO 1RBSA 1VSIA 1RILA 3T69A 3RWUA 1O13A 3ATVA 1EWRA 1BO5O 4M3UA 4H8KA 3RSEA 3B6OA 5GAHP 2HF4A 4M7YA 3TTFA 4BG9A 4DLGA 4E1NA 4DUZK 3SPYA 1K6YA 4J2DA 3G71N 3OYHA 4B1YB 4CIFA 1VSLA 3MEGA 1IH7A 4QAGA 5AQJA 4CK3A 3ZYYX 2HBLA 2WONA 3O08A 3DRRA 3OVNA 4QCLA 3KLGA 4FJGA 5E84A 3EO3A 2FF3B 1HJRA 1RDWX 3DJCA 1ZXOA 2QI2A 1M1KO 3IFRA 2E88A 2ZWHA 4BRKA 2F4VK 1SZ2A 3M8SA 2HBKA 3N4QA 4BE2A 3M3ZA 2F9WA 4AQYK 2P9IB 1Q18A 1S5JA 2KFNA 3M1FA 4Z4CA 1U49A 1D5AA 3ZSZA 2E2QA 3VGLA 2BANA 3WNFA 3AVIA 1A5WA 4PKGA 4BACA 2WTUA 1JXEA 4C1NI 3ATUA 4A59A 4PUOA 4Z4FA 2OANA 1W9HA 1WSIA 4FL9A 3K5OA 2NRHA 1K8KA 3KJVA 4CZGA 3KWIA 1WSEA 3W3DA 4DTMA 2PZSA 3R8EA 1T7PA 4BRQA 5KRTA 3LDQA 1V4TA 1EX4A 3CCRN 1Y64A 3L2UA 3EE8A 4CFDA 4M3YA 4BRIA 3O4WA 3WEEB 1KCFA 4IEIA 2E5LK 5AQZA 1JCEA 4RW4A 4DR3K 2F8TA 4DLEA 3D0PA 2ZD1A 4CZKA 3V6DA 5EOYA 4BRFA 2ASOA 3G0ZA 3KD5E 1NOYA 4AH9A 3BUZB 1WUAA 3MCAB 4BQZA 4XEIA 5I9EB 4FWSA 4H4MA 1GOCA 1REVA 1K9MO 3RVCA 4DCHA 1J6ZA 4RG8A 3UKUB 1U47A 4H0VB 2XY6A 3VPZA 3QEPA 2R7YA 2GUPA 1RBTA 2FXUA 2IVPA 4IOXA 3KVGA 2I7NA 3BZCA 4CHPA 1UWBA 3J7ZO 1KD1O 4QS7A 3V81A 1FXXA 4JD2B 2CH5A 3MECA 2HHWA 3MXJA 5FPDA 3KTQA 3O6WA 3C95A 4CJFA 5FRNA 2D0CA 3HPGA 5C25A 4FJKA 4LF5K 4IFVA 3PX6A 4Z94A 4H0TB 4Y0WA 1O1WA 3O9RA 4AM6A 3J7YP 4GMJB 3O9UA 1CZ9A 5M1FA 1VSJA 1ASWA 1GOBA 1XHXA 4FZXC 2UUAK 2ETJA 2FBXA 3SBTA 4E1MA 4LD0A 4CJ4A 4F8RA 3H6EA 3HM8A 3M8RA 3VGKA 1JLBA 1HKGA 4DG1A 1Q86O 4JKFA 3FE1A 1DLOA 3HPOA 1XI1A 2HNDA 5FDLA 5CYMA 1KXPA 3AVFA 1OH5A 5HROA 3FZFA 3VESA 3THXB 3K58A 2GUIA 4CEZA 1JL1A 4A61A 3V1RA 4MLEA 1XNRK 3L8BA 2UXBK 1B9FA 3KLIA 1TKDA 5AQRA 4CF1A 1YJWN 4FM0A 3O1WA 5CE3A 1RTHA 1N8RO 2QK9A 2JWLA 5KQDA 2W41A 3IKMA 1NMDA 4FJLA 5M1QA 3QFPA 4DSEA 4B1WB 2FSJA 1N34K 1ESVA 3V9UA 4JKHA 3UKUA 2AJQA 4CVNE 4DSLA 3THVA 5AR0A 3CI5A 1RT6A 3HSTB 4FWQA 3K9KA 2BUPA 2G8VA 3UKRA 4NCBA 4Z4GA 3QICA 1S1TA 4JD2A 3L2WA 1VSFA 1QZ6A 2I5JA 1U48A 3VEOA 4CJ3A 3ZX2A 4BRPA 2NRXA 3UB5A 1KVBA 3BY5A 1T03A 4W5NA 3SJHA 3LWMA 3K0SA 4B3RK 3C0BA 1BA1A 1RTIA 3HJFA 1X3MA 3QB0A 4B1ZA 2OTJN 2RPIA 3A5LC 1JL2A 4H5VA 1VQ7N 4JKCA 4W5QA 5AQXA 1RDUA 2VG5A 4CEEA 4YOXA 3L2QA 1C0GA 1I3AA 1VQPN 3TSQA 1IO2A 2ZM6K 1OH6A 2ASMA 1SL0A 4CK2A 3TI0A 3VQ4A 4BR0A 4BVPA 5FRMA 3H3OB 3O9SA 3AARA 2D0BA 3FZHA 1RTDA 1GLCG 4DSJA 3O8MA 3SUQA 4E19A 2GV9A 3THXA 4BGBA 4DV2K 4OO1J 3CHWA 1ITGA 3HSCA 2DY4A 4LSNA 3KLEA 1NKCA 3A5NC 5AQVA 2O8DA 4QS9A 2IS3A 5KPTA 3JAMO 3WXMB 1NWKA 3O9TA 3AA4A 3F9MA 4FWOA 2HVHA 3L4QA 4CHZA 2FBYA 5JLFA 2VG7A 3LM2A 5CYQA 2VWBA 5LMNK 4IJAA 2UXCK 2NLXA 2CGKA 3F2KA 1SS6A 1I39A 3ENHA 5LL6Z 1QQOA 3OS2A 2P9SA 3OYNA 3VQ9A 4E3SA 3HZ6A 3NVKA 1B9DA 1T6DA 1EP4A 4ILGB 5HRNA 1BHLA 4C8MA 4CESA 5HBMA 4FPBA 5BR8K 1N36K 4FK0A 3THWA 1KAZA 3CC2N 2F96A 2KW4A 2W42A 4BQLA 1VQON 4CF8A 1P90A 4LF8K 1VSHA 4NCAA 3CJAA 4DSIA 3TAGA 1D8YA 1TV6A 3C7NA 4W5OA 4KTWA 4AHTA 2Z1GA 1TGOA 4BG8A 2JGUA 4DTOA 4LF7K 3OS1A 3HT3A 3O3GA 5E26A 4FJIA 1WSJA 3VQDA 3AA3A 1HNIA 4EIAA 4X64K 4M41A 2E1YA 4HTLA 5M1PA 1XUPO 5LMUK 4M3TA 3B6PA 4ELVA 1Z25A 1Q7YO 1HNVA 4NO7A 1OH7A 2P9PA 2Q3SA 4MDAA 2RF2A 1U4BA 3AGRA 3ZEUA 4B1XB 4JKBA 3CYMA 4KHWA 4G9ZA 3NF6A 4PY5A 2W6KA 2PYLA 4J2AA 3H1VX 3ZETA 5BPNA 1NK9A 5DM6L 1NK7A 3E66A 4PA1A 2VGNA 2Z1IA 3W0LA 3J81O 1RBUA 2HBMA 4BREA 5FPNA 1DKGD 4W5RA 3RMAA 3H46O 1JCFA 4FJNA 4F3OA 3OY9A 3OYJA 1WSGA 3E9OA 4C8LA 1OVYA 4FM2A 3BF1A 4CIGA 1Z05A 4IFYA 4A5BA 3ULDA 1L3VA 4NLCA 4CJUA 4YOUA 1JLEA 1NK5A 3ITHA 1VQLN 3MDQA 1N5YA 1WLJA 2AA4A 1NGBA 5GADP 4CEDA 1EO1A 4FJHA 1UA0A 1X9MA 3ZSRA 1ASVA 4XH5A 4CK1A 1NLVA
chains in the Genus database with same CATH topology
4I6MA 1MWKA 3RSEA 5GAHP 2HF4A 4M7YA 3TTFA 1NGCA 4BG9A 3LDNA 2VYPA 3D2FA 4WQ5C 4FWPA 2A42A 2NRVA 4EFHA 3D7EO 1BOTO 3G71N 3SMSA 1NGFA 1HX1A 2JWKA 2PFUA 4A5AA 3OBYA 4CZIA 1P8ZA 3JS6A 3VF6A 4B1YB 5C0YA 3SMPA 5AQJA 1QVFM 1G99A 3MK6A 1NGIA 2F7TA 3A0IX 4JAXA 4C1NK 3ZYYX 2HBLA 1W2BM 3O08A 4AF1A 5C10A 2V51B 5AZIB 1CZAN 1NBWA 5E84A 5CR4A 3EO3A 3MX2A 5AQFA 4PHTX 5C2DA 2FF3B 4GV3A 1RDWX 3AY9A 3E1YA 4GVEA 4ILHA 3DJCA 1ZXOA 2QI2A 3LM9A 4OPAA 1DGKN 3TPQA 1BA0A 1M1KO 2P9NB 3IFRA 2E88A 2ZWHA 3ENBA 4JKAA 4BRKA 1SZ2A 2HBKA 3N4QA 2Q31A 3I55N 1U2VB 2IVNA 3M3ZA 2F9WA 4XH1A 2CGJA 4JN4A 2P9IB 3AGKA 1Q18A 2E8AA 3DAWA 3O5BA 4MDBA 3M1FA 4IEEA 4KBOA 1RGIA 3L0QA 1X3NA 1NM1A 3CMEN 2WUSA 2E2QA 3R9PA 3VGLA 2F9TA 1HJOA 3ID8A 3MX5A 4FWKA 4IO9L 4BRHA 3C6AA 3WUHA 5KPZA 1BWFO 4KH6A 5GIOA 4PKGA 3I56N 5TKWA 3ATUA 4YORA 4A59A 4C1NI 2OANA 3MCPA 4GV9A 4FL9A 4BR5A 4A62A 2NRHA 1K8KA 2D1KA 4BR2A 4WFBL 4CZGA 1ZC6A 1VQ6N 2J4RA 3KWIA 3ZX0A 5TKYA 1KC8O 2HBJA 4R79A 1MA9B 3M5RA 3CCEN 3W3DA 1NGJA 3R8EA 3CC7N 1D4XA 2OTLN 2WFBA 3I33A 4BRQA 1XQSC 3LDQA 3TU5A 1V4TA 2RHKA 4JHDA 3CCRN 5AFUA 1Y64A 1GLEG 3EE8A 1LOTB 4CI6A 2ZJPL 3CC4N 4KH5A 4DQ8A 4BRIA 4B9QA 4YOWA 3O4WA 5AQUA 2P9SB 3P31A 3I8BA 3WEEB 4IEIA 5M1KA 3F5TA 5AQZA 3JXUA 4XH4A 3OHRA 3CXCM 1JCEA 2FLOA 5BR9A 3HTVA 3CQYA 4IWVA 3DXKA 4O8KA 1ATRA 4DKWA 3SBGA 4PL7A 4CZKA 3K9JA 3LDLA 5EOYA 1MWMA 1MDUB 4BRFA 2ASOA 1ZBSA 3TTDA 1DT9A 4PL8A 2UYTA 4K25A 3BUZB 1WUAA 3MCAB 4BQZA 4RWTA 2QWNA 4XEIA 5I9EB 5AQGA 5GAGP 2E2NA 4FWSA 3GDQA 5EX5A 3LDOA 3DXMB 4JEPA 3C7NB 1K9MO 1IG8A 5AZJB 3MWTA 3RVCA 1VAZA 4DCHA 1J6ZA 3CCUN 3UKUB 3H1QA 4ISFA 4H0VB 4IOCL 2ZF5O 3KWGA 3EE9A 3VPZA 1XC3A 4FVUA 3CJCA 5HL7L 2GUPA 4H0YB 2FXUA 4H5RA 3FR0A 4M63C 4BRGA 4YOYA 2IVPA 3FZMA 3KVGA 2I7NA 4GNIA 4IOXA 2ITMA 4E1JA 2I7PA 5KQ8A 4YDUA 3E9PA 5BRHA 5AZIA 3J7ZO 1KD1O 3HRGA 4QS7A 4DHYA 2Q36A 4BC3A 1QHAA 2CH5A 4JD2B 4BGAA 4CZEA 1C0FA 2D4WA 2QWOA 3UE5A 3P39A 4A2BA 3WXLA 5FPDA 5JLHA 3U9DA 1QZ5A 3O6WA 3CD6N 2P9NA 1WOQA 4C23A 2RE2A 2PBDA 5LY3A 3CF5L 5KPRA 3HOTA 4ILJA 2CH6A 2P9PB 3DWLA 1U2VA 4RCHA 4KH4A 2YHYA 3ENOA 5AQOA 1HUXA 2QW9A 4Z94A 3ZEUB 5B8HA 4H0TB 4Y0WA 5GIPA 2P9LB 2HOEA 4JK7A 1GLDG 3O9RA 1TUYA 4AM6A 1ILYA 4JK9A 2HMPA 3OA9A 4MO4A 3O9UA 4O5FA 3ZETB 5M1FA 3DLLL 3FLCO 4MO5A 3R3LA 3QDKA 1LCUA 3FFKB 5DM7L 2BTFA 5AQHA 5AQIA 5LJVA 3CJ7A 4B1VA 2IVOA 3OBWA 3R6MA 3Q7BA 2GEMA 1E4GT 4K42A 1SQKA 3SBTA 1GLLO 5FPMA 4LC9B 3VENA 2ASPA 3WXIA 2P9KB 1NJIO 4BRAA 3H6EA 3PLAA 3HM8A 3TTCA 5ADXH 3VGKA 1HKGA 1HKCA 4H5TA 1Q86O 4JKFA 2EWSA 3FE1A 3CQXA 1VQ4N 4HWIA 1KXPA 1YVNA 2QWPA 4CZJA 3EKUA 3SAFA 1W97L 4OPHA 3D2EB 3FZFA 3CPEA 3VESA 2YHXA 3L6QA 3VMFB 5FPEA 5AQLA 1YF5L 3BF3A 1RFQA 3HI0A 4WQ4A 4A61A 5JVHL 4MLEA 4BROA 4GV6A 4FWMA 1VQ5N 4JKDA 2A3ZA 4I6MB 5AQRA 2NNWA 3CCVN 1YXQA 1ATNA 1KAYA 1BDGA 1NGHA 2QWMA 4K41A 1YJWN 3U8XA 4WFNL 4BY9C 3O1WA 3D2FB 5CE3A 5M1NA 3R1XA 4MLHA 4WF9L 1N8RO 2QWLA 2QWRA 5F2RA 5EVZA 1R59O 5H1SQ 3GE1A 2JWLA 3QBWA 4ISGA 5EXWA 5KQDA 2W41A 2QWQA 3IKMA 4CZLA 1NMDA 3SAGA 1KAXA 3GG4A 5M1QA 3C6HA 3MWPA 2FSNA 2YJFA 3QFPA 4B1WB 3CCMN 2FSJA 2ZGYA 3A5MC 1V4SA 3DXMA 4PKHA 1VQKN 3PIOL 4ISEA 4FWNA 5AQYA 4YOTA 5AZJA 5AQMA 1K8AO 4CBUA 1ESVA 2H3GX 3GBTA 4GY2B 4JKHA 3UKUA 1M90O 4BRDA 3TSPA 3D6RA 2QM1A 5AR0A 4BR9A 3CI5A 1NGGA 5M1OA 5F1XA 4FWQA 1X9JA 3K9KA 3PIPL 1NGDA 2P9UA 3S41A 2E20A 2BUPA 4YOVA 1T3VA 2WBNA 4FPAA 3UKRA 3FGUA 2YCHA 3IDHA 4H5NA 3QICA 4BRLA 2NZTA 4WQ5A 4JD2A 3MMVA 2GELA 4J8FA 1QZ6A 4H0PA 2A41A 3VEOA 2GWJA 3ZX2A 4BRPA 3VEZA 3VEWA 4CZMA 3SAHA 3CCLN 3CJBA 2NRXA 3H45C 1IJJA 2HF3A 3KHYA 3UB5A 4L3QA 4WCEL 2QXLA 3VGMA 3SJHA 3MN5A 3KK7A 3C0BA 1BA1A 1VQ8N 4CZHA 3B8AX 2KHOA 4BRNA 2P9LA 2E2PA 5BN9A 1K73O 3OW2M 2NRRA 5JICA 4IZ9A 1X3MA 3CJ1A 3QB0A 5AQTA 4B1ZA 1DEJA 2OTJN 2YX6A 2ZGZA 3A5LC 1KQSM 3EN9A 4H5VA 2WC9A 4JKCA 4JKEA 1VQ7N 5AQXA 1RDUA 1YJNN 1Q82O 2A6AA 3E9LA 4FO0A 3Q7CA 4YOXA 1C0GA 1VQPN 4BR4A 3G25A 3TSQA 2FSKA 3EL2A 1Z6RA 2Q97A 4JKGB 2P9KA 4JHDB 2ASMA 3A5OC 1T6CA 2YJEA 3FZKA 4WYBA 4BR0A 4BVPA 2V7ZA 3H3OB 3O9SA 3AARA 5F0XA 1VQNN 1BU6O 2NRWA 3FZHA 3QFUA 3ULEB 3VEVA 1S3XA 5BREA 2P9IA 3EZWA 5AQNA 1GLCG 4O8UA 5AFUH 4BVOA 3O8MA 3D2EA 1TYQB 2GTDA 3ID6A 4BGBA 3CJ9A 4OO1J 3CHWA 5BN8A 3HSCA 4NLBA 3VEXA 4EAHD 3QMLA 3A5NC 5AQVA 3ZX3A 5AQWA 5AQKA 4QS9A 3WT0A 3GOIA 3LL3A 5KPTA 2GX9A 5JVGL 2YHWA 3WXMB 1E4FT 1NWKA 3O9TA 3F9MA 3VETA 4FWOA 4FWRA 5C15A 1YHQN 3L4QA 3IMXA 5JLFA 3LM2A 5BPMA 1YJ9N 2VWBA 1U6ZA 3VERA 4H0XB 4IJNA 4IJAA 3O1BA 3TSUA 1EQYA 2NLXA 3CIPA 3MN7A 4PKIA 4IXCA 2CGKA 4IDHA 3F2KA 3N4PA 1SS6A 1S22A 2E1ZA 4H0OA 4RTFD 3ENHA 5C2FA 3VF2A 3IUCA 5CHIA 1QQOA 2P9SA 3MN6A 3WXJA 3WEEA 2QEXN 1ATSA 3HZ6A 3NVKA 2AP1A 1T6DA 4ILGB 5AQSA 2D0OA 1H1VA 4BRMA 2ZJRL 4FPBA 2E2OA 4YDUC 3RSEB 3A8YA 2BH1A 3VEYA 3U9ZA 2GWKA 3QBXA 1KAZA 1QVGM 3LDPA 3SLCA 3CC2N 4WFAL 1HKBA 1BG3A 3P4IA 4IO8A 4BQLA 5C12A 1VQON 1QQNA 3NMUA 5JMVA 1P90A 3CCSN 5HOOA 2A40A 1GLBG 3CJAA 1JCGA 1T44A 2Q1NA 3T7ZA 5MLCQ 3C7NA 3VTIA 3J8AA 4IFEA 3BEXA 4B1UB 5BRFA 2VCPA 2NRZA 4BG8A 1SAZA 3M6GA 4CBWA 3WQUA 1NGEA 3CCJN 2Q2RA 2FF6A 3BP8A 2Q0RA 2A5XA 5E26A 3VOVA 1OKJA 5EY4A 4AM7A 2ZJQL 3AAPA 4U7BA 2D0PA 3G4SN 4EIAA 4BR7A 3VF4A 3HBTA 3GL1A 4A2AA 5GAEP 5GINA 2IIRA 2E1YA 4JKGA 3EKSA 1YAGA 2NRTA 2VGMA 4HTLA 4FOIA 4A57A 4BC2A 4JNEA 5M1PA 1JJ2M 3H3NO 1XUPO 3WQTA 2V52B 1NGAA 1Q7YO 2CGLA 4NO7A 2P9PA 2KKZA 4MDAA 3ULEA 1BUPA 3AGRA 3ZEUA 4B1XB 4CD1A 1Q81O 4CJ7A 1QQMA 4JKBA 3L4IA 1GLAG 4CBXA 1TYQA 4G9ZA 1S72N 3KZBA 4K43A 4UY8O 3H1VX 3ZETA 5BPNA 2PAVA 3FZLA 5ELZA 5DM6L 4BC4A 5AQQA 1K8KB 2KLAA 2YI1A 3E66A 5ADXA 2VGNA 3W0LA 4WQ4C 2HBMA 3VTHA 4BREA 4JK8A 5FPNA 3O80A 4F9OA 2Q0UA 1DKGD 4BRCA 1GLJO 3CCQN 3SK3A 3CPWM 4CZFA 1HLUA 1YIJN 4U67L 2V7YA 1GLFO 1JCFA 1TUUA 3H46O 4FWLA 3U4LA 4BC5A 1YUWA 1HPMA 1YI2N 2HSTA 3E9OA 5BRDA 4IOAL 1OVYA 4M7XA 2QA4N 1VQMN 4NB4A 2QTDA 3CETA 3BF1A 3C65A 1Z05A 4H5WA 4QS8A 5AQPA 4A5BA 4CD3A 3CMAN 3G6EN 3CERA 4NLCA 4YOUA 1VQLN 3MDQA 4FSVA 4DB3A 1VQ9N 3MN9A 2AA4A 1NGBA 2P9UB 4EHUA 2DPNA 3O9QA 4FOEA 3DXKB 4EHTA 3P38A 5BPLA 5GADP 3AAQA 3UKRB 1EO1A 3WXKA 5LJWA 3HOSA 4H03B 3T69A 1O13A 3ATVA 1YITN 2W40A 1BO5O 3NVMA 4XH5A 1NLVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I6M A;  1MWK A;  3RSE A;  2HF4 A;  4M7Y A;  1NGC A;  4BG9 A;  3LDN A;  2VYP A;  3D2F A;  4WQ5 C;  4FWP A;  2A42 A;  4EFH A;  3D7E O;  1BOT O;  3SMS A;  1NGF A;  1HX1 A;  4CZI A;  1P8Z A;  3JS6 A;  3VF6 A;  4B1Y B;  3SMP A;  5AQJ A;  1G99 A;  3MK6 A;  1NGI A;  3A0I X;  4JAX A;  3O08 A;  2V51 B;  5AZI B;  1CZA N;  1NBW A;  5E84 A;  3EO3 A;  5AQF A;  2FF3 B;  1RDW X;  3AY9 A;  3DJC A;  1ZXO A;  3LM9 A;  1DGK N;  3TPQ A;  1BA0 A;  2P9N B;  3IFR A;  2E88 A;  2ZWH A;  4BRK A;  1SZ2 A;  2Q31 A;  1U2V B;  2IVN A;  3M3Z A;  2F9W A;  4XH1 A;  2CGJ A;  4JN4 A;  2P9I B;  1Q18 A;  2E8A A;  3DAW A;  3O5B A;  3M1F A;  4KBO A;  1RGI A;  3L0Q A;  1X3N A;  1NM1 A;  2WUS A;  2E2Q A;  3R9P A;  3VGL A;  2F9T A;  1HJO A;  3ID8 A;  4FWK A;  4BRH A;  3WUH A;  5KPZ A;  1BWF O;  4PKG A;  3ATU A;  2OAN A;  3MCP A;  4FL9 A;  4BR5 A;  4A62 A;  2NRH A;  1K8K A;  2D1K A;  4BR2 A;  4CZG A;  1ZC6 A;  2J4R A;  3ZX0 A;  5TKY A;  1MA9 B;  3W3D A;  1NGJ A;  3R8E A;  1D4X A;  3I33 A;  4BRQ A;  1XQS C;  3LDQ A;  3TU5 A;  1V4T A;  4JHD A;  5AFU A;  1Y64 A;  1GLE G;  4CI6 A;  1LOT B;  4DQ8 A;  4BRI A;  4B9Q A;  3O4W A;  5AQU A;  2P9S B;  3I8B A;  3WEE B;  5AQZ A;  3JXU A;  4XH4 A;  3OHR A;  1JCE A;  2FLO A;  5BR9 A;  3HTV A;  3CQY A;  4IWV A;  3DXK A;  4O8K A;  1ATR A;  4PL7 A;  4CZK A;  3LDL A;  5EOY A;  1MWM A;  1MDU B;  4BRF A;  2ASO A;  1ZBS A;  4PL8 A;  2UYT A;  4K25 A;  3BUZ B;  1WUA A;  4BQZ A;  4RWT A;  2QWN A;  4XEI A;  5I9E B;  5AQG A;  2E2N A;  4FWS A;  3GDQ A;  5EX5 A;  3LDO A;  3DXM B;  3C7N B;  1IG8 A;  5AZJ B;  4DCH A;  1J6Z A;  3UKU B;  3H1Q A;  4ISF A;  4H0V B;  2ZF5 O;  3VPZ A;  1XC3 A;  3CJC A;  2GUP A;  4H0Y B;  2FXU A;  4H5R A;  3FR0 A;  4M63 C;  4BRG A;  2IVP A;  3FZM A;  3KVG A;  2I7N A;  4GNI A;  2ITM A;  4E1J A;  5KQ8 A;  2I7P A;  4YDU A;  5BRH A;  5AZI A;  4QS7 A;  4DHY A;  2Q36 A;  4BC3 A;  1QHA A;  2CH5 A;  4JD2 B;  4BGA A;  4CZE A;  1C0F A;  2D4W A;  2QWO A;  3UE5 A;  4A2B A;  3WXL A;  5FPD A;  5JLH A;  3U9D A;  1QZ5 A;  3O6W A;  2P9N A;  1WOQ A;  4C23 A;  2PBD A;  5LY3 A;  5KPR A;  2CH6 A;  2P9P B;  3DWL A;  1U2V A;  4RCH A;  2YHY A;  3ENO A;  5AQO A;  1HUX A;  2QW9 A;  4Z94 A;  3ZEU B;  5B8H A;  4H0T B;  4Y0W A;  2P9L B;  2HOE A;  1GLD G;  1TUY A;  4AM6 A;  2HMP A;  4MO4 A;  4O5F A;  3ZET B;  3FLC O;  4MO5 A;  3QDK A;  1LCU A;  3FFK B;  2BTF A;  5AQH A;  5AQI A;  5LJV A;  3CJ7 A;  4B1V A;  2IVO A;  3R6M A;  2GEM A;  1E4G T;  4K42 A;  1SQK A;  1GLL O;  5FPM A;  4LC9 B;  3VEN A;  2ASP A;  3WXI A;  2P9K B;  4BRA A;  3H6E A;  3HM8 A;  5ADX H;  3VGK A;  1HKG A;  1HKC A;  4H5T A;  2EWS A;  3FE1 A;  3CQX A;  4HWI A;  1KXP A;  1YVN A;  2QWP A;  4CZJ A;  3EKU A;  3D2E B;  3FZF A;  3VES A;  2YHX A;  3L6Q A;  5FPE A;  5AQL A;  3BF3 A;  1RFQ A;  3HI0 A;  4WQ4 A;  4A61 A;  4MLE A;  4BRO A;  4FWM A;  2A3Z A;  4I6M B;  5AQR A;  1YXQ A;  1ATN A;  1KAY A;  1BDG A;  1NGH A;  2QWM A;  4K41 A;  3U8X A;  3O1W A;  3D2F B;  5CE3 A;  4MLH A;  2QWL A;  2QWR A;  5F2R A;  5EVZ A;  1R59 O;  3GE1 A;  4ISG A;  3QBW A;  5EXW A;  5KQD A;  2W41 A;  2QWQ A;  4CZL A;  1NMD A;  1KAX A;  3GG4 A;  2FSN A;  2YJF A;  3QFP A;  4B1W B;  2FSJ A;  2ZGY A;  3A5M C;  1V4S A;  3DXM A;  4PKH A;  4ISE A;  4FWN A;  5AQY A;  5AZJ A;  5AQM A;  4CBU A;  1ESV A;  2H3G X;  3GBT A;  4GY2 B;  3UKU A;  4BRD A;  2QM1 A;  5AR0 A;  4BR9 A;  3CI5 A;  1NGG A;  5F1X A;  4FWQ A;  1X9J A;  1NGD A;  2P9U A;  3S41 A;  2E20 A;  2BUP A;  4FPA A;  3UKR A;  3FGU A;  2YCH A;  3IDH A;  4H5N A;  3QIC A;  4BRL A;  2NZT A;  4WQ5 A;  4JD2 A;  3MMV A;  2GEL A;  4J8F A;  1QZ6 A;  4H0P A;  2A41 A;  3VEO A;  2GWJ A;  3ZX2 A;  4BRP A;  3VEZ A;  3VEW A;  4CZM A;  3CJB A;  3H45 C;  3UB5 A;  1IJJ A;  2HF3 A;  3KHY A;  4L3Q A;  2QXL A;  3VGM A;  3SJH A;  3MN5 A;  3C0B A;  1BA1 A;  4CZH A;  3B8A X;  2KHO A;  4BRN A;  2P9L A;  2E2P A;  5BN9 A;  5JIC A;  4IZ9 A;  1X3M A;  3CJ1 A;  3QB0 A;  5AQT A;  4B1Z A;  1DEJ A;  2ZGZ A;  3A5L C;  3EN9 A;  4H5V A;  5AQX A;  2A6A A;  4FO0 A;  1C0G A;  4BR4 A;  3G25 A;  2FSK A;  3EL2 A;  1Z6R A;  2Q97 A;  2P9K A;  4JHD B;  2ASM A;  3A5O C;  1T6C A;  2YJE A;  3FZK A;  4WYB A;  4BR0 A;  4BVP A;  2V7Z A;  3H3O B;  3AAR A;  5F0X A;  1BU6 O;  3FZH A;  3QFU A;  3ULE B;  3VEV A;  1S3X A;  5BRE A;  2P9I A;  3EZW A;  5AQN A;  1GLC G;  5AFU H;  4BVO A;  3O8M A;  3D2E A;  1TYQ B;  2GTD A;  4BGB A;  3CJ9 A;  3CHW A;  5BN8 A;  3HSC A;  3VEX A;  4EAH D;  3QML A;  3A5N C;  5AQV A;  3ZX3 A;  5AQW A;  5AQK A;  4QS9 A;  3WT0 A;  3GOI A;  3LL3 A;  5KPT A;  2YHW A;  1E4F T;  1NWK A;  3F9M A;  3VET A;  4FWO A;  4FWR A;  3IMX A;  5JLF A;  3LM2 A;  5BPM A;  2VWB A;  1U6Z A;  3VER A;  4H0X B;  4IJN A;  4IJA A;  3O1B A;  1EQY A;  2NLX A;  3CIP A;  3MN7 A;  4PKI A;  4IXC A;  2CGK A;  1S22 A;  2E1Z A;  4H0O A;  4RTF D;  3ENH A;  3VF2 A;  3IUC A;  1QQO A;  2P9S A;  3MN6 A;  3WXJ A;  3WEE A;  1ATS A;  3HZ6 A;  2AP1 A;  1T6D A;  5AQS A;  2D0O A;  1H1V A;  4BRM A;  4FPB A;  2E2O A;  4YDU C;  3RSE B;  3A8Y A;  3VEY A;  3U9Z A;  2GWK A;  3QBX A;  1KAZ A;  3LDP A;  3SLC A;  1HKB A;  1BG3 A;  3P4I A;  4IO8 A;  4BQL A;  1QQN A;  5JMV A;  2A40 A;  1GLB G;  3CJA A;  1JCG A;  1T44 A;  2Q1N A;  3C7N A;  3J8A A;  3BEX A;  4B1U B;  5BRF A;  2VCP A;  4BG8 A;  1SAZ A;  3M6G A;  4CBW A;  3WQU A;  1NGE A;  2Q2R A;  2FF6 A;  3BP8 A;  2Q0R A;  2A5X A;  5E26 A;  3VOV A;  1OKJ A;  5EY4 A;  4AM7 A;  3AAP A;  2D0P A;  4EIA A;  4BR7 A;  3VF4 A;  3HBT A;  3GL1 A;  4A2A A;  2IIR A;  2E1Y A;  3EKS A;  1YAG A;  4HTL A;  4FOI A;  4BC2 A;  4JNE A;  3H3N O;  1XUP O;  3WQT A;  2V52 B;  1NGA A;  2CGL A;  4NO7 A;  2P9P A;  3ULE A;  1BUP A;  4CD1 A;  3ZEU A;  4B1X B;  4CJ7 A;  1QQM A;  3L4I A;  1GLA G;  4CBX A;  1TYQ A;  3KZB A;  4K43 A;  3H1V X;  3ZET A;  5BPN A;  2PAV A;  3FZL A;  5ELZ A;  4BC4 A;  5AQQ A;  1K8K B;  2YI1 A;  5ADX A;  3W0L A;  4WQ4 C;  4BRE A;  5FPN A;  3O80 A;  4F9O A;  2Q0U A;  1DKG D;  4BRC A;  1GLJ O;  3SK3 A;  4CZF A;  1HLU A;  2V7Y A;  1GLF O;  1JCF A;  1TUU A;  3H46 O;  4FWL A;  3U4L A;  4BC5 A;  1YUW A;  1HPM A;  5BRD A;  4M7X A;  4NB4 A;  3CET A;  3BF1 A;  1Z05 A;  4H5W A;  4QS8 A;  5AQP A;  4CD3 A;  3CER A;  3MDQ A;  4FSV A;  4DB3 A;  3MN9 A;  2AA4 A;  1NGB A;  2P9U B;  4EHU A;  2DPN A;  4EHT A;  4FOE A;  3DXK B;  5BPL A;  3AAQ A;  3UKR B;  3WXK A;  5LJW A;  4H03 B;  3ATV A;  2W40 A;  1BO5 O;  4XH5 A;  1NLV A; 
#chains in the Genus database with same CATH topology
 4I6M A;  1MWK A;  4CGF A;  4AIL C;  4LSL A;  1L3T A;  4C8O A;  1BIU A;  2HHS A;  4FWP A;  1BI4 B;  3LP1 A;  3AA2 A;  1F21 A;  3SMS A;  1HX1 A;  4LFA K;  3ZSO A;  2P5G A;  1P8Z A;  4C8N A;  3DLE A;  5C0Y A;  1KVC A;  3A0I X;  3PX0 A;  1MU2 A;  1W2B M;  4PQU A;  5AZI B;  2PY5 A;  1NBW A;  3MX2 A;  4PHT X;  1S9E A;  3AY9 A;  3P83 D;  3TPQ A;  2O4I A;  4E7J A;  5I3U A;  4JKA A;  3KK1 A;  3K59 A;  4O55 A;  3SUO A;  2O8B B;  4XH1 A;  4JI7 K;  3O5B A;  4DFJ A;  3A2F A;  4FCY A;  4CGI A;  5AJ3 K;  2WUS A;  3M8P A;  2F9T A;  1HJO A;  4FWK A;  3SV4 A;  3HK2 A;  4BRH A;  5KPZ A;  4KH6 A;  2VQF K;  3SUP A;  5HP1 A;  4OGE A;  2OPP A;  5TKW A;  4YOR A;  4Z4H A;  4CFB A;  4BR5 A;  3VQC A;  4BR2 A;  1VQ6 N;  4DR4 K;  3EY1 A;  2J4R A;  2BGG A;  4DF8 A;  5TKY A;  4LY7 A;  1NK0 A;  3LPT A;  3I33 A;  4J2E A;  4CJ5 A;  5AFU A;  1NK4 A;  4OLB A;  1GLE G;  2ZJP L;  1LOT B;  3CC4 N;  4KH5 A;  4CIE A;  1S1W A;  3I8B A;  5I42 A;  3F5T A;  4EP5 A;  3OHR A;  3CXC M;  3HTV A;  4JI5 K;  4CE9 A;  3CQY A;  4OLA A;  4O8K A;  3SBG A;  2LSN A;  4PL7 A;  3NH1 A;  2HHH K;  5CY4 A;  1UA1 A;  3KK2 A;  4DTX A;  1ZBS A;  4PL8 A;  4JI6 K;  4OJR A;  4LFC K;  1EWQ A;  3T1A A;  5AQG A;  5GAG P;  2ZE2 A;  1RT4 A;  1RCH A;  3OYI A;  4B9V A;  1C1B A;  4BWJ A;  4M3X A;  3DYA A;  3KWG A;  3EE9 A;  3K5N A;  1LAW A;  3CJC A;  3OS0 A;  3OYA A;  4E1J A;  3FZM A;  2ITM A;  3S3M A;  4YDU A;  2XY8 A;  3LAL A;  3DOL A;  5BRH A;  5AZI A;  4O4G A;  4DHY A;  4H4O A;  1QHA A;  2O8C B;  1SKW A;  4CZE A;  2D4W A;  4A2B A;  3U9D A;  1QZ5 A;  3SUN A;  2ATQ A;  1WOQ A;  4BE0 A;  1WB9 A;  3MED A;  1L3U A;  3DWL A;  4RCH A;  2O8B A;  4ELU A;  4DV0 K;  5B8H A;  4CEA A;  5GIP A;  2P9L B;  1TK0 A;  1TUY A;  1ILY A;  2HMP A;  2O8E B;  3DLL L;  3FLC O;  3R3L A;  1VHX A;  3QDK A;  3THY A;  1BQN A;  4AHV A;  5LJV A;  2HHU A;  3Q7B A;  2FBT A;  4CFC A;  5CZ1 A;  1E4G T;  1IKW A;  1FK9 A;  1GLL O;  1LWE A;  4BDZ A;  2G8U A;  4LC9 B;  1U04 A;  3QEV A;  2ASP A;  3WXI A;  2P9K B;  1IG9 A;  4BRA A;  2OPQ A;  1S9G A;  4DSK A;  1WBD A;  3U3G A;  3CQX A;  1VQ4 N;  1YVN A;  4CZJ A;  3L2R A;  3EKU A;  1TK8 A;  4YFU A;  3CFR A;  4DFK A;  3L6Q A;  4FLY A;  4E0D A;  2X6S A;  5FPE A;  3QES A;  4KHP K;  1RFQ A;  4WQ4 A;  4I9Q A;  4Y1D A;  4GV6 A;  3QET A;  2YHA A;  4IBN A;  2UUC K;  1VQ5 N;  2O8F A;  2XO7 A;  5IT9 O;  3KK3 A;  1YXQ A;  4CJV A;  3CCV N;  1NGH A;  4DFP A;  4ELT A;  3D2F B;  2YHB A;  2QWR A;  5EVZ A;  1R59 O;  1XC9 A;  4ISG A;  5KRS A;  3V1O A;  4CZL A;  1KAX A;  4KRE A;  3C6H A;  4CJK A;  2YJF A;  3HP9 A;  3JYT A;  4DQS A;  3VA0 A;  4C8K A;  1VQK N;  3PIO L;  4ISE A;  4LF6 K;  1JKH A;  5AQY A;  4CBU A;  2D5R A;  4CF0 A;  2H3G X;  3GBT A;  4GY2 B;  3V1Q A;  1IBL K;  4KB1 A;  2VQE K;  4M3Z A;  2QM1 A;  4FJ5 A;  4V19 S;  4CGH A;  2KFZ A;  2OZS A;  5F1X A;  1RNH A;  3ZT3 A;  3PIP L;  3RTV A;  1NGD A;  2QXF A;  4YOV A;  2WBN A;  4FPA A;  3PY8 A;  4ICL A;  3FGU A;  4Z4E A;  4H5N A;  4WQ5 A;  3L3U A;  3NH2 A;  2O8C A;  4DU1 A;  3KD1 E;  3VEW A;  4AHS A;  3CJB A;  3H45 C;  3NGY A;  4L3Q A;  5T7B A;  2DFE A;  3KK7 A;  2IAJ A;  1J54 A;  4GW6 A;  4BRN A;  3IG1 A;  2P9L A;  2E2P A;  1N33 K;  4IZ9 A;  2X74 A;  1VK0 A;  1KSP A;  1Q9X A;  2ZGZ A;  4GVM A;  4LF9 K;  3TAE A;  3Q7C A;  4F2S A;  1IKY A;  3CM5 A;  3ZT2 A;  5IWA K;  3EL2 A;  1Z6R A;  4F3T A;  2Q97 A;  3QIO A;  2P9K A;  4JHD B;  2IOC A;  4NYN A;  4DR6 K;  4TSX A;  4G1Q A;  1HPZ A;  3QER A;  1IBK K;  2NRW A;  4JLH A;  3VEV A;  5SWM A;  2P9I A;  1HR0 K;  3EZW A;  3OYG A;  4GKK K;  3C94 A;  1RT5 A;  3F9K A;  3ID6 A;  3MXI A;  2OZM A;  4J2B A;  3VEX A;  1FJG K;  1ASU A;  4OPK A;  3GOI A;  1KRP A;  1SKS A;  3LP3 A;  3IMX A;  2BE2 A;  2UU9 K;  5BPM A;  3I0S A;  1U6Z A;  3NBP A;  4H0X B;  5J2N A;  3O1B A;  3TSU A;  1EQY A;  4IXC A;  1XWL A;  4AHU A;  3QEI A;  2E1Z A;  3VF2 A;  3IUC A;  1RT1 A;  5KTQ A;  2XHB A;  2OPR A;  3WEE A;  3TAP A;  2QEX N;  2HHQ A;  5AQS A;  1E3M A;  4BRM A;  2ZJR L;  4YDU C;  3O4N A;  2YNH A;  3VEY A;  3AVL A;  3U9Z A;  1QVG M;  3SLC A;  3MEE A;  1NOZ A;  4CJE A;  3OYD A;  4IO8 A;  5C12 A;  2HW3 A;  3NMU A;  2FC0 A;  4CJT A;  1A5V A;  4OVL A;  5E41 A;  4CCH A;  2A40 A;  3HL8 A;  1IV0 A;  2YKM A;  4JI2 K;  1QS4 A;  3J8A A;  4IFE A;  4N41 A;  5BRF A;  1YT3 A;  1NJW A;  4FK4 A;  1CLQ A;  3AVC A;  2NRZ A;  3WQU A;  3F73 A;  3NF7 A;  2FF6 A;  2G8H A;  4JYA K;  4B3S K;  1LWF A;  3AAP A;  3HBT A;  5GAE P;  3D45 A;  3KKS A;  3EKS A;  1JJ2 M;  4JNE A;  3AVJ A;  3WQT A;  4OX9 K;  1X1P A;  1C0T A;  3WNG A;  3CFO A;  4CD1 A;  4CJ7 A;  4YNQ A;  4CBX A;  4FLU A;  3DLH A;  2FBV A;  1WSF A;  4UY8 O;  3LWL A;  4BC4 A;  3IAY A;  1Z26 A;  2YI1 A;  4Z4I A;  1TL1 A;  5K14 A;  4WQ4 C;  4KHQ A;  4QOZ B;  3VTH A;  5D3G A;  3O80 A;  2Q0U A;  3WNE A;  4DS5 A;  4E7I A;  1TUU A;  4IOA L;  2HST A;  2QTD A;  1VRT A;  1TKX A;  4I9L A;  1SUQ A;  4CD3 A;  3CMA N;  3NH0 A;  4B9L A;  4DB3 A;  2P9U B;  3O9Q A;  4CHO A;  3AAQ A;  3LAK A;  2HNZ A;  3HOS A;  4OKK A;  1YIT N;  2W40 A;  4YHH K;  3LAN A;  3NVM A;  4HUG A;  3CCU N;  1N6Q A;  3VQ5 A;  1JLQ A;  1NGC A;  1QHT A;  4WQ5 C;  4FJ7 A;  4CHQ A;  2NRV A;  3D7E O;  3IS9 A;  3DOK A;  4O5B A;  4CF2 A;  3VQ6 A;  3VF6 A;  4DQR A;  1G99 A;  3CM6 A;  3MK6 A;  3HPH A;  2F7T A;  3SQ1 A;  2HNY A;  2NUB A;  2P51 A;  4KFB A;  4AF1 A;  5C10 A;  1I94 K;  1CZA N;  5CR4 A;  1FW6 A;  4NCG A;  1KLN A;  4GVE A;  4ILH A;  4GKJ K;  3LM9 A;  4OPA A;  1JLF A;  3SPZ A;  3K2P A;  3LZJ A;  3P5J A;  3I55 N;  2IVN A;  4X66 K;  3ZSV A;  3TWH A;  3AGK A;  3RMC A;  3DAW A;  4IG3 A;  1C6V A;  4IEE A;  2A1S A;  4O0J A;  3L0Q A;  1X3N A;  4M3R A;  3P1G A;  1NKE A;  3ID8 A;  3WUH A;  5GIO A;  1RT3 A;  2Y1I A;  1IBM K;  2E6L A;  1RT2 A;  3MCP A;  4E7L A;  1UAX A;  1EET A;  4B9N A;  2IC3 A;  4WFB L;  5J2Q A;  1ZC6 A;  3NDK A;  3EEQ A;  3ZX0 A;  3SJJ A;  2HBJ A;  4R79 A;  4HHT A;  2HVI A;  1NGJ A;  4FJ9 A;  4N47 A;  1DTT A;  1D4X A;  1L5U A;  4OGC A;  2WFB A;  2OTL N;  4DQQ A;  3TU5 A;  4O0I A;  4YOW A;  4KRF A;  5AQU A;  3P31 A;  1HNX K;  5HRS A;  5JS1 A;  3AVK A;  3JXU A;  4KHY A;  2FLO A;  4ZHR A;  4IWV A;  1EKE A;  1ATR A;  4DKW A;  1MWM A;  2B4J A;  4EZ9 A;  3ZT0 A;  4DU4 A;  2P5O A;  3TTD A;  2UYT A;  4MQ3 A;  1WSH A;  4RWT A;  4ZTJ A;  2QWN A;  4RW7 A;  2E2N A;  4RW9 A;  4BDY A;  5EX5 A;  3AA5 X;  3DXM B;  4F2R A;  2HHX A;  4JI1 K;  1IG8 A;  5AZJ B;  3BDP A;  3MWT A;  1NMN A;  3DLK A;  3H1Q A;  4ISF A;  4KPY A;  4KI4 A;  2DTU A;  3CQ8 A;  1XC3 A;  5HL7 L;  4DV6 K;  2QKB A;  4H0Y B;  4M63 C;  4H5R A;  3FR0 A;  3PSI A;  4YOY A;  4KKO A;  4GNI A;  3E9P A;  4Q5V A;  3LAM A;  4X62 K;  2KZM A;  4RW8 A;  1C0F A;  2Y1J A;  3S9H A;  1NK6 A;  4JV5 K;  2RE2 A;  1LW0 A;  2PBD A;  3CF5 L;  3ZSW A;  1QE1 A;  5KPR A;  2PYJ A;  4ILJ A;  4KH4 A;  2YHY A;  3ENO A;  3QNO A;  2HOE A;  4JK7 A;  3NHG A;  4JK9 A;  3OA9 A;  4DV1 K;  4O5F A;  1LCU A;  2BTF A;  5AQH A;  3K5M A;  4FJM A;  3CJ7 A;  1FKP A;  4K42 A;  1X9S A;  3VEN A;  3M8Q A;  3PLA A;  1N32 K;  4B3M K;  3LP2 A;  5ADX H;  4H5T A;  3SZ2 A;  1JLC A;  2QWP A;  4CJS A;  1NG9 A;  2A1R A;  3D2E B;  1KVA A;  2YHX A;  3VMF B;  4FM1 A;  3ZT4 A;  5AQL A;  1BQM A;  3O3H A;  4RW6 A;  1X9W A;  4BRO A;  3LZI A;  1HQU A;  2NNW A;  2QWM A;  1KAY A;  1TKZ A;  4OPJ A;  3OYM A;  3AVA A;  3U8X A;  4WFN L;  4CHN A;  3R1X A;  2QWL A;  3HO1 A;  4YY3 K;  3NAE A;  4B9T A;  4FJ8 A;  3GG4 A;  1NU0 A;  4WE1 A;  3CCM N;  2ZGY A;  3DXM A;  4PKH A;  1WAJ A;  1WN7 A;  1QSL A;  3VQ8 A;  3ZT1 A;  3K5L A;  4Y1C A;  5AZJ A;  4BRD A;  2HHT A;  3VN5 A;  4BR9 A;  5M1O A;  3V4I A;  2G8K A;  1X9J A;  2G8F A;  3S41 A;  2E20 A;  1T3V A;  3IDH A;  2NZT A;  1ZBU A;  4B8C A;  2GEL A;  4H0P A;  2ITG A;  4CZM A;  3SAH A;  4WCE L;  4JS5 A;  2QXL A;  4AHC A;  4B8A B;  1VQ8 N;  4CZH A;  3OYE A;  1BI4 A;  4KB0 A;  1RBV A;  2HHV A;  2NRR A;  4B3O A;  4CJQ A;  5JIC A;  5AQT A;  1DEJ A;  5DMR A;  3C6T A;  3LP0 A;  1XMO K;  2YX6 A;  5HRP A;  1G15 A;  1KQS M;  2WC9 A;  4OKE A;  4CEC A;  1YJN N;  2A6A A;  4I2P A;  5J1E A;  2GBZ A;  3G25 A;  3KIO A;  3T3F A;  4CER A;  4JKG B;  1T6C A;  2YJE A;  3TAB A;  4DTR A;  2V7Z A;  4ID5 A;  4K8X A;  5F0X A;  1VQN N;  1KLM A;  1S3X A;  5BRE A;  5AQN A;  4O8U A;  4BVO A;  3D2E A;  4CJL A;  3NF9 A;  3CJ9 A;  1ZYQ A;  3NF8 A;  1NJX A;  4NLB A;  4DR2 K;  2DFF A;  3T19 A;  3VQP A;  2BDP A;  3QML A;  5AQK A;  4DQP A;  3LL3 A;  4FZY A;  2Z1J A;  4UQG A;  5JVG L;  2YHW A;  1U45 A;  1E4F T;  5C15 A;  4FWR A;  3RRG A;  1QQC A;  3U3Y A;  4B08 A;  1YJ9 N;  4M42 A;  3VER A;  3AVH A;  4DV3 K;  4FLZ A;  1T05 A;  3MN7 A;  4PKI A;  4KAZ A;  2B5J A;  4IDH A;  1S22 A;  4RTF D;  5C2F A;  1XHZ A;  3MN6 A;  3VQE A;  3WXJ A;  4CW7 B;  5FRO A;  2AP1 A;  4HUF A;  2D0O A;  1H1V A;  3AV9 A;  2YKN A;  4DTS A;  3PO5 A;  1OH8 A;  2E2O A;  3A8Y A;  2GWK A;  1TVR A;  2IGI A;  2VG6 A;  4BE1 A;  3PX4 A;  4WFA L;  1HKB A;  1BG3 A;  4CGG A;  1QQN A;  1WNS A;  3CCS N;  1QTM A;  3V9S A;  3PV8 A;  3HP6 A;  4DMN A;  2WOM A;  1JCG A;  1T44 A;  5C42 A;  4KV8 A;  4FLW A;  5MLC Q;  1BCM A;  1W7A A;  1ZBF A;  1SAZ A;  3M6G A;  4LF4 K;  1NGE A;  4DR7 K;  4DWI A;  3CCJ N;  2Q2R A;  1DTQ A;  4I7F A;  1VSD A;  1HNZ K;  3L2V A;  2D0P A;  1BIS A;  3G4S N;  4BR7 A;  1LAV A;  4A2A A;  3TAN A;  5GIN A;  3JSM A;  4JKG A;  4XIU A;  4DV5 K;  2VGM A;  1S1X A;  4FOI A;  4BC2 A;  2XY5 A;  3I8D A;  3H3N O;  4KO0 A;  2JLE A;  2V52 B;  1NGA A;  2E4L A;  1J9A A;  3VQB A;  4FLX A;  3L4I A;  1GLA G;  3ISN C;  3T1Y K;  1S72 N;  4K43 A;  4JI4 K;  2O8E A;  4NYF A;  5AQQ A;  1Q9Y A;  3CFP A;  3J7A P;  4BDP A;  4JK8 A;  4BRC A;  1GLJ O;  3CCQ N;  4CZF A;  1HLU A;  4MFB A;  1YIJ N;  1GLF O;  1S6Q A;  3OYB A;  3SQ4 A;  4FWL A;  1A5X A;  4BC5 A;  1HPM A;  1YI2 N;  1JXB A;  4M7X A;  2QA4 N;  1VQM N;  1RT7 A;  1KFS A;  3CET A;  3C65 A;  3RMD A;  1SL1 A;  4H5W A;  4QS8 A;  5AQP A;  1XMQ K;  3CER A;  2YV0 X;  3OYK A;  3O3F A;  2B6A A;  4FSV A;  3QIP A;  3MN9 A;  4EHU A;  4EHT A;  3TAQ A;  2DPN A;  4FOE A;  3DXK B;  3P38 A;  3UKR B;  3QLH A;  3WXK A;  1Q8I A;  3QNN A;  5LJW A;  4H03 B;  4CJP A;  1UOC A;  3VQQ A;  1C0M A;  1TKT A;  3CG7 A;  1Y97 A;  3TAR A;  3RMB A;  4CF9 A;  1SKR A;  3LDN A;  2VYP A;  3V9X A;  3D2F A;  1QSY A;  2A42 A;  4EFH A;  1BOT O;  1FKO A;  1NGF A;  4A5A A;  2JWK A;  2PFU A;  3OBY A;  4CZI A;  3JS6 A;  4PWD A;  3SMP A;  1QVF M;  1NGI A;  4C1N K;  4JAX A;  4B9S A;  4DTP A;  2V51 B;  3ALY A;  4HCB A;  5AQF A;  5C2D A;  2VWJ A;  3UIQ A;  4GV3 A;  3E1Y A;  2YNI A;  1DGK N;  1C0U A;  1BA0 A;  2P9N B;  3ENB A;  2IDO A;  1GOA A;  2Q31 A;  4CGJ A;  3OJU A;  1U2V B;  4FYD A;  1S1U A;  2CGJ A;  4JN4 A;  2E8A A;  3H08 A;  4MDB A;  1VRU A;  1HMV A;  3HVR A;  3ZLJ A;  4KBO A;  2W6L A;  1RGI A;  3HVT A;  2HMI A;  1NM1 A;  4DR5 K;  3CME N;  3SYZ A;  3R9P A;  2E6M A;  3AVG A;  3MX5 A;  4IO9 L;  3C6A A;  3SCX A;  1BWF O;  3NFA A;  4FW2 A;  3KLH A;  3I56 N;  2O8D B;  4DU3 A;  3AO5 A;  4GV9 A;  4A62 A;  2D1K A;  1KC8 O;  1KFD A;  1W0H A;  1MA9 B;  3M5R A;  3CCE N;  1J53 A;  4FZZ A;  3OTO K;  2XRI A;  3CC7 N;  4DSF A;  1XQS C;  1TK5 A;  1NJY A;  4FW1 A;  2RHK A;  4JHD A;  4CI6 A;  4W5T A;  4DQ8 A;  1HYZ A;  4B9Q A;  3DM2 A;  2P9S B;  1BGX T;  3PO4 A;  5M1K A;  1LWC A;  4XH4 A;  2QKK A;  5BR9 A;  1VSK A;  3AO2 A;  3DXK A;  5KI6 A;  3MXM A;  3THW B;  3K9J A;  3LDL A;  1MDU B;  1SL2 A;  2KQ2 A;  2VWK A;  1NNE A;  5C24 A;  1DT9 A;  1TL3 A;  4K25 A;  1ZBL A;  1VSM A;  1QSS A;  3DLB A;  2KZZ A;  3WNH A;  5JS2 A;  3GDQ A;  3LDO A;  1TAU A;  4JEP A;  3C7N B;  4CEQ A;  4HVJ A;  4E7H A;  1OVQ A;  4FLV A;  1VAZ A;  1YVU A;  4IOC L;  2ZF5 O;  1HRH A;  2OPS A;  4FVU A;  3VQA A;  3ZSY A;  4DR1 K;  4BRG A;  4LH4 A;  1T8E A;  4DTJ A;  5KQ8 A;  3E01 A;  2I7P A;  3EZ5 A;  2OYQ A;  4NXN K;  2UUB K;  1NK8 A;  3HRG A;  2Q36 A;  4BC3 A;  4N76 A;  1BL3 A;  4BGA A;  2QWO A;  3UE5 A;  3P39 A;  4JRP A;  1BCO A;  4ID1 A;  3WXL A;  5JLH A;  3T1H K;  3CD6 N;  2P9N A;  5SZT A;  4C23 A;  5LY3 A;  3HOT A;  4E7K A;  2CH6 A;  1IKX A;  2RN2 A;  2P9P B;  1U2V A;  2YNF A;  5AQO A;  1HUX A;  2QW9 A;  3ZEU B;  3S3O A;  2G8W A;  4B9M A;  4JRQ A;  1GLD G;  4N5S A;  4MO4 A;  3ZET B;  3IRX A;  1RDB A;  4MO5 A;  3FFK B;  5DM7 L;  1YTA A;  5AQI A;  4B1V A;  2IVO A;  3OBW A;  3K57 A;  3R6M A;  3TR8 A;  5J2M A;  3PUF A;  2GEM A;  4JI0 K;  1SQK A;  5HLF A;  5FPM A;  2DFH A;  4IKF A;  4FJJ A;  1NJI O;  3G10 A;  4N56 A;  3TTC A;  3ZSX A;  1HQE A;  1HKC A;  3OYL A;  3DMJ A;  2EWS A;  3KKR A;  3QIN A;  3DLG A;  4HWI A;  2EX3 A;  3FFI A;  4Z0U A;  1RBR A;  4CEB A;  4IDK A;  3SAF A;  1W97 L;  4OPH A;  3CPE A;  3DLR A;  1NJZ A;  5FLX O;  1YF5 L;  3BF3 A;  3C6U A;  3HI0 A;  5JVH L;  4FWM A;  4JKD A;  2A3Z A;  4I6M B;  1L3S A;  1ATN A;  1BDG A;  4DTN A;  4K41 A;  4BY9 C;  3AVB A;  5M1N A;  4MLH A;  4WF9 L;  3LPU A;  5H1S Q;  5F2R A;  1RDA A;  3GE1 A;  2UXD K;  3QBW A;  5EXW A;  3V9Z A;  2QWQ A;  2OCE A;  3SAG A;  3MWP A;  2FSN A;  3VQ7 A;  1C1C A;  3A5M C;  1V4S A;  3NGI A;  4CEO A;  4FWN A;  3OYC A;  4YOT A;  5AQM A;  1K8A O;  4JI3 K;  1M90 O;  4Q0B A;  3TSP A;  3D6R A;  1NGG A;  3AO4 A;  5EU7 A;  3OYF A;  2P9U A;  3AO1 A;  1JLG A;  1CXU A;  2YCH A;  4BRL A;  1RTJ A;  3QEW A;  3MMV A;  4J8F A;  2A41 A;  3CCL N;  2GWJ A;  3TAM A;  3VEZ A;  4DS4 A;  1IJJ A;  2HF3 A;  1B92 A;  3KHY A;  3V9W A;  3QO9 A;  3VGM A;  3MN5 A;  3B8A X;  3ASM A;  3HM9 A;  4DV7 K;  2P1J A;  2KHO A;  3AO3 A;  3S3N A;  2ZQB A;  3SQ0 A;  5BN9 A;  1K73 O;  3OW2 M;  1CZB A;  2OA8 A;  2X6N A;  3CJ1 A;  4KHN A;  1RDC A;  3MAQ A;  1D9F A;  2XY7 A;  1D9D A;  4LFB K;  4FK2 A;  4EP4 A;  4L8R B;  3EN9 A;  4JKE A;  5DK5 A;  2D0A A;  5CZ2 A;  1Q82 O;  4FO0 A;  1VSE A;  2HB5 A;  3E9L A;  4DUY K;  1J5O A;  4BR4 A;  1IKV A;  2FSK A;  4IG0 A;  2Z1H A;  3HYF A;  1J5E K;  3A5O C;  3FZK A;  2X78 A;  4WYB A;  3RRH A;  3HXM A;  3QEX A;  4O44 A;  4JI8 K;  1BU6 O;  3QFU A;  3ULE B;  5J2P A;  3TAF A;  1TAQ A;  1HYS A;  4FLT A;  5AFU H;  1TYQ B;  2GTD A;  4DF4 A;  4DTU A;  4AHR A;  5BN8 A;  3AVM A;  4DV4 K;  4EAH D;  3DRP A;  4CFA A;  1C1A A;  3ZX3 A;  2O4G A;  5AQW A;  3WT0 A;  3SQ2 A;  1YTU A;  2GX9 A;  3VET A;  3SI6 A;  3ZCM A;  1YHQ N;  1LW2 A;  1R0A A;  4B9U A;  1S1V A;  3DRS A;  1JLA A;  4IJN A;  5KGX A;  4B3T K;  3SNN A;  3CIP A;  1HYV A;  3N4P A;  4R5P A;  4H0O A;  5KGW A;  4HTU A;  4KHS A;  4CJR A;  3VA3 A;  5CHI A;  4F4K A;  4ZTF A;  3AVN A;  4OKJ A;  1ATS A;  1WBB A;  4HUE A;  1XNQ K;  3RSE B;  2BH1 A;  4BWM A;  3L3V A;  3QBX A;  3LDP A;  2F8S A;  4CJW A;  3BZK A;  3P4I A;  4I2Q A;  3PSF A;  4KTQ A;  1NKB A;  5JMV A;  1ZBI A;  4FXD A;  5HOO A;  1RDD A;  1GLB G;  2Q1N A;  3THY B;  3T7Z A;  3VTI A;  1BIZ A;  3BEX A;  4B1U B;  3LDS A;  2G8I A;  3RR8 A;  2VCP A;  4CBW A;  4EZ6 A;  3BP8 A;  2Q0R A;  4M45 A;  2A5X A;  3EYZ A;  3DI6 A;  3VOV A;  1HNW K;  1KTQ A;  1OKJ A;  3BGR A;  5EY4 A;  4AM7 A;  3J80 O;  2ZJQ L;  4U7B A;  4DFM A;  3RR7 A;  2YNG A;  4KTZ A;  4NXM K;  3GL1 A;  3VF4 A;  2IIR A;  4JS4 A;  4KHU A;  4M3W A;  1YAG A;  2NRT A;  4A57 A;  4CGD A;  4K8Z A;  2RKI A;  2CGL A;  4CHY A;  5HRR A;  1LV5 A;  2KKZ A;  3ULE A;  1ZBH A;  4LH5 A;  1BUP A;  1Q81 O;  4KI6 A;  3U6F A;  1QQM A;  2EHG A;  4K0K K;  2KTQ A;  1CXQ A;  2O8F B;  1TYQ A;  1WAF A;  3KLF A;  3KZB A;  1EXQ A;  2PAV A;  3FZL A;  5ELZ A;  1K8K B;  2KLA A;  3OJS A;  5ADX A;  4FJX A;  4F9O A;  3ZSQ A;  3NGZ A;  3SK3 A;  3CPW M;  4U67 L;  2V7Y A;  3SV3 A;  4DQI A;  3U4L A;  1YUW A;  5BRD A;  3O4Q A;  4NB4 A;  4FVM A;  4X65 K;  4E89 A;  3NE6 A;  3NCI A;  4CEF A;  3G6E N;  4HCC A;  1VQ9 N;  1S6P A;  1SV5 A;  3I0R A;  5BPL A;  5A2Q O;  1RBS A;  1VSI A;  1RIL A;  3T69 A;  3RWU A;  1O13 A;  3ATV A;  1EWR A;  1BO5 O;  4M3U A;  4H8K A;  3RSE A;  3B6O A;  5GAH P;  2HF4 A;  4M7Y A;  3TTF A;  4BG9 A;  4DLG A;  4E1N A;  4DUZ K;  3SPY A;  1K6Y A;  4J2D A;  3G71 N;  3OYH A;  4B1Y B;  4CIF A;  1VSL A;  3MEG A;  1IH7 A;  4QAG A;  5AQJ A;  4CK3 A;  3ZYY X;  2HBL A;  2WON A;  3O08 A;  3DRR A;  3OVN A;  4QCL A;  3KLG A;  4FJG A;  5E84 A;  3EO3 A;  2FF3 B;  1HJR A;  1RDW X;  3DJC A;  1ZXO A;  2QI2 A;  1M1K O;  3IFR A;  2E88 A;  2ZWH A;  4BRK A;  2F4V K;  1SZ2 A;  3M8S A;  2HBK A;  3N4Q A;  4BE2 A;  3M3Z A;  2F9W A;  4AQY K;  2P9I B;  1Q18 A;  1S5J A;  2KFN A;  3M1F A;  4Z4C A;  1U49 A;  1D5A A;  3ZSZ A;  2E2Q A;  3VGL A;  2BAN A;  3WNF A;  3AVI A;  1A5W A;  4PKG A;  4BAC A;  2WTU A;  1JXE A;  4C1N I;  3ATU A;  4A59 A;  4PUO A;  4Z4F A;  2OAN A;  1W9H A;  1WSI A;  4FL9 A;  3K5O A;  2NRH A;  1K8K A;  3KJV A;  4CZG A;  3KWI A;  1WSE A;  3W3D A;  4DTM A;  2PZS A;  3R8E A;  1T7P A;  4BRQ A;  5KRT A;  3LDQ A;  1V4T A;  1EX4 A;  3CCR N;  1Y64 A;  3L2U A;  3EE8 A;  4CFD A;  4M3Y A;  4BRI A;  3O4W A;  3WEE B;  1KCF A;  4IEI A;  2E5L K;  5AQZ A;  1JCE A;  4RW4 A;  4DR3 K;  2F8T A;  4DLE A;  3D0P A;  2ZD1 A;  4CZK A;  3V6D A;  5EOY A;  4BRF A;  2ASO A;  3G0Z A;  3KD5 E;  1NOY A;  4AH9 A;  3BUZ B;  1WUA A;  3MCA B;  4BQZ A;  4XEI A;  5I9E B;  4FWS A;  4H4M A;  1GOC A;  1REV A;  1K9M O;  3RVC A;  4DCH A;  1J6Z A;  4RG8 A;  3UKU B;  1U47 A;  4H0V B;  2XY6 A;  3VPZ A;  3QEP A;  2R7Y A;  2GUP A;  1RBT A;  2FXU A;  2IVP A;  4IOX A;  3KVG A;  2I7N A;  3BZC A;  4CHP A;  1UWB A;  3J7Z O;  1KD1 O;  4QS7 A;  3V81 A;  1FXX A;  4JD2 B;  2CH5 A;  3MEC A;  2HHW A;  3MXJ A;  5FPD A;  3KTQ A;  3O6W A;  3C95 A;  4CJF A;  5FRN A;  2D0C A;  3HPG A;  5C25 A;  4FJK A;  4LF5 K;  4IFV A;  3PX6 A;  4Z94 A;  4H0T B;  4Y0W A;  1O1W A;  3O9R A;  4AM6 A;  3J7Y P;  4GMJ B;  3O9U A;  1CZ9 A;  5M1F A;  1VSJ A;  1ASW A;  1GOB A;  1XHX A;  4FZX C;  2UUA K;  2ETJ A;  2FBX A;  3SBT A;  4E1M A;  4LD0 A;  4CJ4 A;  4F8R A;  3H6E A;  3HM8 A;  3M8R A;  3VGK A;  1JLB A;  1HKG A;  4DG1 A;  1Q86 O;  4JKF A;  3FE1 A;  1DLO A;  3HPO A;  1XI1 A;  2HND A;  5FDL A;  5CYM A;  1KXP A;  3AVF A;  1OH5 A;  5HRO A;  3FZF A;  3VES A;  3THX B;  3K58 A;  2GUI A;  4CEZ A;  1JL1 A;  4A61 A;  3V1R A;  4MLE A;  1XNR K;  3L8B A;  2UXB K;  1B9F A;  3KLI A;  1TKD A;  5AQR A;  4CF1 A;  1YJW N;  4FM0 A;  3O1W A;  5CE3 A;  1RTH A;  1N8R O;  2QK9 A;  2JWL A;  5KQD A;  2W41 A;  3IKM A;  1NMD A;  4FJL A;  5M1Q A;  3QFP A;  4DSE A;  4B1W B;  2FSJ A;  1N34 K;  1ESV A;  3V9U A;  4JKH A;  3UKU A;  2AJQ A;  4CVN E;  4DSL A;  3THV A;  5AR0 A;  3CI5 A;  1RT6 A;  3HST B;  4FWQ A;  3K9K A;  2BUP A;  2G8V A;  3UKR A;  4NCB A;  4Z4G A;  3QIC A;  1S1T A;  4JD2 A;  3L2W A;  1VSF A;  1QZ6 A;  2I5J A;  1U48 A;  3VEO A;  4CJ3 A;  3ZX2 A;  4BRP A;  2NRX A;  3UB5 A;  1KVB A;  3BY5 A;  1T03 A;  4W5N A;  3SJH A;  3LWM A;  3K0S A;  4B3R K;  3C0B A;  1BA1 A;  1RTI A;  3HJF A;  1X3M A;  3QB0 A;  4B1Z A;  2OTJ N;  2RPI A;  3A5L C;  1JL2 A;  4H5V A;  1VQ7 N;  4JKC A;  4W5Q A;  5AQX A;  1RDU A;  2VG5 A;  4CEE A;  4YOX A;  3L2Q A;  1C0G A;  1I3A A;  1VQP N;  3TSQ A;  1IO2 A;  2ZM6 K;  1OH6 A;  2ASM A;  1SL0 A;  4CK2 A;  3TI0 A;  3VQ4 A;  4BR0 A;  4BVP A;  5FRM A;  3H3O B;  3O9S A;  3AAR A;  2D0B A;  3FZH A;  1RTD A;  1GLC G;  4DSJ A;  3O8M A;  3SUQ A;  4E19 A;  2GV9 A;  3THX A;  4BGB A;  4DV2 K;  4OO1 J;  3CHW A;  1ITG A;  3HSC A;  2DY4 A;  4LSN A;  3KLE A;  1NKC A;  3A5N C;  5AQV A;  2O8D A;  4QS9 A;  2IS3 A;  5KPT A;  3JAM O;  3WXM B;  1NWK A;  3O9T A;  3AA4 A;  3F9M A;  4FWO A;  2HVH A;  3L4Q A;  4CHZ A;  2FBY A;  5JLF A;  2VG7 A;  3LM2 A;  5CYQ A;  2VWB A;  5LMN K;  4IJA A;  2UXC K;  2NLX A;  2CGK A;  3F2K A;  1SS6 A;  1I39 A;  3ENH A;  5LL6 Z;  1QQO A;  3OS2 A;  2P9S A;  3OYN A;  3VQ9 A;  4E3S A;  3HZ6 A;  3NVK A;  1B9D A;  1T6D A;  1EP4 A;  4ILG B;  5HRN A;  1BHL A;  4C8M A;  4CES A;  5HBM A;  4FPB A;  5BR8 K;  1N36 K;  4FK0 A;  3THW A;  1KAZ A;  3CC2 N;  2F96 A;  2KW4 A;  2W42 A;  4BQL A;  1VQO N;  4CF8 A;  1P90 A;  4LF8 K;  1VSH A;  4NCA A;  3CJA A;  4DSI A;  3TAG A;  1D8Y A;  1TV6 A;  3C7N A;  4W5O A;  4KTW A;  4AHT A;  2Z1G A;  1TGO A;  4BG8 A;  2JGU A;  4DTO A;  4LF7 K;  3OS1 A;  3HT3 A;  3O3G A;  5E26 A;  4FJI A;  1WSJ A;  3VQD A;  3AA3 A;  1HNI A;  4EIA A;  4X64 K;  4M41 A;  2E1Y A;  4HTL A;  5M1P A;  1XUP O;  5LMU K;  4M3T A;  3B6P A;  4ELV A;  1Z25 A;  1Q7Y O;  1HNV A;  4NO7 A;  1OH7 A;  2P9P A;  2Q3S A;  4MDA A;  2RF2 A;  1U4B A;  3AGR A;  3ZEU A;  4B1X B;  4JKB A;  3CYM A;  4KHW A;  4G9Z A;  3NF6 A;  4PY5 A;  2W6K A;  2PYL A;  4J2A A;  3H1V X;  3ZET A;  5BPN A;  1NK9 A;  5DM6 L;  1NK7 A;  3E66 A;  4PA1 A;  2VGN A;  2Z1I A;  3W0L A;  3J81 O;  1RBU A;  2HBM A;  4BRE A;  5FPN A;  1DKG D;  4W5R A;  3RMA A;  3H46 O;  1JCF A;  4FJN A;  4F3O A;  3OY9 A;  3OYJ A;  1WSG A;  3E9O A;  4C8L A;  1OVY A;  4FM2 A;  3BF1 A;  4CIG A;  1Z05 A;  4IFY A;  4A5B A;  3ULD A;  1L3V A;  4NLC A;  4CJU A;  4YOU A;  1JLE A;  1NK5 A;  3ITH A;  1VQL N;  3MDQ A;  1N5Y A;  1WLJ A;  2AA4 A;  1NGB A;  5GAD P;  4CED A;  1EO1 A;  4FJH A;  1UA0 A;  1X9M A;  3ZSR A;  1ASV A;  4XH5 A;  4CK1 A;  1NLV A; 
#chains in the Genus database with same CATH homology
 4I6M A;  1MWK A;  3RSE A;  5GAH P;  2HF4 A;  4M7Y A;  3TTF A;  1NGC A;  4BG9 A;  3LDN A;  2VYP A;  3D2F A;  4WQ5 C;  4FWP A;  2A42 A;  2NRV A;  4EFH A;  3D7E O;  1BOT O;  3G71 N;  3SMS A;  1NGF A;  1HX1 A;  2JWK A;  2PFU A;  4A5A A;  3OBY A;  4CZI A;  1P8Z A;  3JS6 A;  3VF6 A;  4B1Y B;  5C0Y A;  3SMP A;  5AQJ A;  1QVF M;  1G99 A;  3MK6 A;  1NGI A;  2F7T A;  3A0I X;  4JAX A;  4C1N K;  3ZYY X;  2HBL A;  1W2B M;  3O08 A;  4AF1 A;  5C10 A;  2V51 B;  5AZI B;  1CZA N;  1NBW A;  5E84 A;  5CR4 A;  3EO3 A;  3MX2 A;  5AQF A;  4PHT X;  5C2D A;  2FF3 B;  4GV3 A;  1RDW X;  3AY9 A;  3E1Y A;  4GVE A;  4ILH A;  3DJC A;  1ZXO A;  2QI2 A;  3LM9 A;  4OPA A;  1DGK N;  3TPQ A;  1BA0 A;  1M1K O;  2P9N B;  3IFR A;  2E88 A;  2ZWH A;  3ENB A;  4JKA A;  4BRK A;  1SZ2 A;  2HBK A;  3N4Q A;  2Q31 A;  3I55 N;  1U2V B;  2IVN A;  3M3Z A;  2F9W A;  4XH1 A;  2CGJ A;  4JN4 A;  2P9I B;  3AGK A;  1Q18 A;  2E8A A;  3DAW A;  3O5B A;  4MDB A;  3M1F A;  4IEE A;  4KBO A;  1RGI A;  3L0Q A;  1X3N A;  1NM1 A;  3CME N;  2WUS A;  2E2Q A;  3R9P A;  3VGL A;  2F9T A;  1HJO A;  3ID8 A;  3MX5 A;  4FWK A;  4IO9 L;  4BRH A;  3C6A A;  3WUH A;  5KPZ A;  1BWF O;  4KH6 A;  5GIO A;  4PKG A;  3I56 N;  5TKW A;  3ATU A;  4YOR A;  4A59 A;  4C1N I;  2OAN A;  3MCP A;  4GV9 A;  4FL9 A;  4BR5 A;  4A62 A;  2NRH A;  1K8K A;  2D1K A;  4BR2 A;  4WFB L;  4CZG A;  1ZC6 A;  1VQ6 N;  2J4R A;  3KWI A;  3ZX0 A;  5TKY A;  1KC8 O;  2HBJ A;  4R79 A;  1MA9 B;  3M5R A;  3CCE N;  3W3D A;  1NGJ A;  3R8E A;  3CC7 N;  1D4X A;  2OTL N;  2WFB A;  3I33 A;  4BRQ A;  1XQS C;  3LDQ A;  3TU5 A;  1V4T A;  2RHK A;  4JHD A;  3CCR N;  5AFU A;  1Y64 A;  1GLE G;  3EE8 A;  1LOT B;  4CI6 A;  2ZJP L;  3CC4 N;  4KH5 A;  4DQ8 A;  4BRI A;  4B9Q A;  4YOW A;  3O4W A;  5AQU A;  2P9S B;  3P31 A;  3I8B A;  3WEE B;  4IEI A;  5M1K A;  3F5T A;  5AQZ A;  3JXU A;  4XH4 A;  3OHR A;  3CXC M;  1JCE A;  2FLO A;  5BR9 A;  3HTV A;  3CQY A;  4IWV A;  3DXK A;  4O8K A;  1ATR A;  4DKW A;  3SBG A;  4PL7 A;  4CZK A;  3K9J A;  3LDL A;  5EOY A;  1MWM A;  1MDU B;  4BRF A;  2ASO A;  1ZBS A;  3TTD A;  1DT9 A;  4PL8 A;  2UYT A;  4K25 A;  3BUZ B;  1WUA A;  3MCA B;  4BQZ A;  4RWT A;  2QWN A;  4XEI A;  5I9E B;  5AQG A;  5GAG P;  2E2N A;  4FWS A;  3GDQ A;  5EX5 A;  3LDO A;  3DXM B;  4JEP A;  3C7N B;  1K9M O;  1IG8 A;  5AZJ B;  3MWT A;  3RVC A;  1VAZ A;  4DCH A;  1J6Z A;  3CCU N;  3UKU B;  3H1Q A;  4ISF A;  4H0V B;  4IOC L;  2ZF5 O;  3KWG A;  3EE9 A;  3VPZ A;  1XC3 A;  4FVU A;  3CJC A;  5HL7 L;  2GUP A;  4H0Y B;  2FXU A;  4H5R A;  3FR0 A;  4M63 C;  4BRG A;  4YOY A;  2IVP A;  3FZM A;  3KVG A;  2I7N A;  4GNI A;  4IOX A;  2ITM A;  4E1J A;  2I7P A;  5KQ8 A;  4YDU A;  3E9P A;  5BRH A;  5AZI A;  3J7Z O;  1KD1 O;  3HRG A;  4QS7 A;  4DHY A;  2Q36 A;  4BC3 A;  1QHA A;  2CH5 A;  4JD2 B;  4BGA A;  4CZE A;  1C0F A;  2D4W A;  2QWO A;  3UE5 A;  3P39 A;  4A2B A;  3WXL A;  5FPD A;  5JLH A;  3U9D A;  1QZ5 A;  3O6W A;  3CD6 N;  2P9N A;  1WOQ A;  4C23 A;  2RE2 A;  2PBD A;  5LY3 A;  3CF5 L;  5KPR A;  3HOT A;  4ILJ A;  2CH6 A;  2P9P B;  3DWL A;  1U2V A;  4RCH A;  4KH4 A;  2YHY A;  3ENO A;  5AQO A;  1HUX A;  2QW9 A;  4Z94 A;  3ZEU B;  5B8H A;  4H0T B;  4Y0W A;  5GIP A;  2P9L B;  2HOE A;  4JK7 A;  1GLD G;  3O9R A;  1TUY A;  4AM6 A;  1ILY A;  4JK9 A;  2HMP A;  3OA9 A;  4MO4 A;  3O9U A;  4O5F A;  3ZET B;  5M1F A;  3DLL L;  3FLC O;  4MO5 A;  3R3L A;  3QDK A;  1LCU A;  3FFK B;  5DM7 L;  2BTF A;  5AQH A;  5AQI A;  5LJV A;  3CJ7 A;  4B1V A;  2IVO A;  3OBW A;  3R6M A;  3Q7B A;  2GEM A;  1E4G T;  4K42 A;  1SQK A;  3SBT A;  1GLL O;  5FPM A;  4LC9 B;  3VEN A;  2ASP A;  3WXI A;  2P9K B;  1NJI O;  4BRA A;  3H6E A;  3PLA A;  3HM8 A;  3TTC A;  5ADX H;  3VGK A;  1HKG A;  1HKC A;  4H5T A;  1Q86 O;  4JKF A;  2EWS A;  3FE1 A;  3CQX A;  1VQ4 N;  4HWI A;  1KXP A;  1YVN A;  2QWP A;  4CZJ A;  3EKU A;  3SAF A;  1W97 L;  4OPH A;  3D2E B;  3FZF A;  3CPE A;  3VES A;  2YHX A;  3L6Q A;  3VMF B;  5FPE A;  5AQL A;  1YF5 L;  3BF3 A;  1RFQ A;  3HI0 A;  4WQ4 A;  4A61 A;  5JVH L;  4MLE A;  4BRO A;  4GV6 A;  4FWM A;  1VQ5 N;  4JKD A;  2A3Z A;  4I6M B;  5AQR A;  2NNW A;  3CCV N;  1YXQ A;  1ATN A;  1KAY A;  1BDG A;  1NGH A;  2QWM A;  4K41 A;  1YJW N;  3U8X A;  4WFN L;  4BY9 C;  3O1W A;  3D2F B;  5CE3 A;  5M1N A;  3R1X A;  4MLH A;  4WF9 L;  1N8R O;  2QWL A;  2QWR A;  5F2R A;  5EVZ A;  1R59 O;  5H1S Q;  3GE1 A;  2JWL A;  3QBW A;  4ISG A;  5EXW A;  5KQD A;  2W41 A;  2QWQ A;  3IKM A;  4CZL A;  1NMD A;  3SAG A;  1KAX A;  3GG4 A;  5M1Q A;  3C6H A;  3MWP A;  2FSN A;  2YJF A;  3QFP A;  4B1W B;  3CCM N;  2FSJ A;  2ZGY A;  3A5M C;  1V4S A;  3DXM A;  4PKH A;  1VQK N;  3PIO L;  4ISE A;  4FWN A;  5AQY A;  4YOT A;  5AZJ A;  5AQM A;  1K8A O;  4CBU A;  1ESV A;  2H3G X;  3GBT A;  4GY2 B;  4JKH A;  3UKU A;  1M90 O;  4BRD A;  3TSP A;  3D6R A;  2QM1 A;  5AR0 A;  4BR9 A;  3CI5 A;  1NGG A;  5M1O A;  5F1X A;  4FWQ A;  1X9J A;  3K9K A;  3PIP L;  1NGD A;  2P9U A;  3S41 A;  2E20 A;  2BUP A;  4YOV A;  1T3V A;  2WBN A;  4FPA A;  3UKR A;  3FGU A;  2YCH A;  3IDH A;  4H5N A;  3QIC A;  4BRL A;  2NZT A;  4WQ5 A;  4JD2 A;  3MMV A;  2GEL A;  4J8F A;  1QZ6 A;  4H0P A;  2A41 A;  3VEO A;  2GWJ A;  3ZX2 A;  4BRP A;  3VEZ A;  3VEW A;  4CZM A;  3SAH A;  3CCL N;  3CJB A;  2NRX A;  3H45 C;  1IJJ A;  2HF3 A;  3KHY A;  3UB5 A;  4L3Q A;  4WCE L;  2QXL A;  3VGM A;  3SJH A;  3MN5 A;  3KK7 A;  3C0B A;  1BA1 A;  1VQ8 N;  4CZH A;  3B8A X;  2KHO A;  4BRN A;  2P9L A;  2E2P A;  5BN9 A;  1K73 O;  3OW2 M;  2NRR A;  5JIC A;  4IZ9 A;  1X3M A;  3CJ1 A;  3QB0 A;  5AQT A;  4B1Z A;  1DEJ A;  2OTJ N;  2YX6 A;  2ZGZ A;  3A5L C;  1KQS M;  3EN9 A;  4H5V A;  2WC9 A;  4JKC A;  4JKE A;  1VQ7 N;  5AQX A;  1RDU A;  1YJN N;  1Q82 O;  2A6A A;  3E9L A;  4FO0 A;  3Q7C A;  4YOX A;  1C0G A;  1VQP N;  4BR4 A;  3G25 A;  3TSQ A;  2FSK A;  3EL2 A;  1Z6R A;  2Q97 A;  4JKG B;  2P9K A;  4JHD B;  2ASM A;  3A5O C;  1T6C A;  2YJE A;  3FZK A;  4WYB A;  4BR0 A;  4BVP A;  2V7Z A;  3H3O B;  3O9S A;  3AAR A;  5F0X A;  1VQN N;  1BU6 O;  2NRW A;  3FZH A;  3QFU A;  3ULE B;  3VEV A;  1S3X A;  5BRE A;  2P9I A;  3EZW A;  5AQN A;  1GLC G;  4O8U A;  5AFU H;  4BVO A;  3O8M A;  3D2E A;  1TYQ B;  2GTD A;  3ID6 A;  4BGB A;  3CJ9 A;  4OO1 J;  3CHW A;  5BN8 A;  3HSC A;  4NLB A;  3VEX A;  4EAH D;  3QML A;  3A5N C;  5AQV A;  3ZX3 A;  5AQW A;  5AQK A;  4QS9 A;  3WT0 A;  3GOI A;  3LL3 A;  5KPT A;  2GX9 A;  5JVG L;  2YHW A;  3WXM B;  1E4F T;  1NWK A;  3O9T A;  3F9M A;  3VET A;  4FWO A;  4FWR A;  5C15 A;  1YHQ N;  3L4Q A;  3IMX A;  5JLF A;  3LM2 A;  5BPM A;  1YJ9 N;  2VWB A;  1U6Z A;  3VER A;  4H0X B;  4IJN A;  4IJA A;  3O1B A;  3TSU A;  1EQY A;  2NLX A;  3CIP A;  3MN7 A;  4PKI A;  4IXC A;  2CGK A;  4IDH A;  3F2K A;  3N4P A;  1SS6 A;  1S22 A;  2E1Z A;  4H0O A;  4RTF D;  3ENH A;  5C2F A;  3VF2 A;  3IUC A;  5CHI A;  1QQO A;  2P9S A;  3MN6 A;  3WXJ A;  3WEE A;  2QEX N;  1ATS A;  3HZ6 A;  3NVK A;  2AP1 A;  1T6D A;  4ILG B;  5AQS A;  2D0O A;  1H1V A;  4BRM A;  2ZJR L;  4FPB A;  2E2O A;  4YDU C;  3RSE B;  3A8Y A;  2BH1 A;  3VEY A;  3U9Z A;  2GWK A;  3QBX A;  1KAZ A;  1QVG M;  3LDP A;  3SLC A;  3CC2 N;  4WFA L;  1HKB A;  1BG3 A;  3P4I A;  4IO8 A;  4BQL A;  5C12 A;  1VQO N;  1QQN A;  3NMU A;  5JMV A;  1P90 A;  3CCS N;  5HOO A;  2A40 A;  1GLB G;  3CJA A;  1JCG A;  1T44 A;  2Q1N A;  3T7Z A;  5MLC Q;  3C7N A;  3VTI A;  3J8A A;  4IFE A;  3BEX A;  4B1U B;  5BRF A;  2VCP A;  2NRZ A;  4BG8 A;  1SAZ A;  3M6G A;  4CBW A;  3WQU A;  1NGE A;  3CCJ N;  2Q2R A;  2FF6 A;  3BP8 A;  2Q0R A;  2A5X A;  5E26 A;  3VOV A;  1OKJ A;  5EY4 A;  4AM7 A;  2ZJQ L;  3AAP A;  4U7B A;  2D0P A;  3G4S N;  4EIA A;  4BR7 A;  3VF4 A;  3HBT A;  3GL1 A;  4A2A A;  5GAE P;  5GIN A;  2IIR A;  2E1Y A;  4JKG A;  3EKS A;  1YAG A;  2NRT A;  2VGM A;  4HTL A;  4FOI A;  4A57 A;  4BC2 A;  4JNE A;  5M1P A;  1JJ2 M;  3H3N O;  1XUP O;  3WQT A;  2V52 B;  1NGA A;  1Q7Y O;  2CGL A;  4NO7 A;  2P9P A;  2KKZ A;  4MDA A;  3ULE A;  1BUP A;  3AGR A;  3ZEU A;  4B1X B;  4CD1 A;  1Q81 O;  4CJ7 A;  1QQM A;  4JKB A;  3L4I A;  1GLA G;  4CBX A;  1TYQ A;  4G9Z A;  1S72 N;  3KZB A;  4K43 A;  4UY8 O;  3H1V X;  3ZET A;  5BPN A;  2PAV A;  3FZL A;  5ELZ A;  5DM6 L;  4BC4 A;  5AQQ A;  1K8K B;  2KLA A;  2YI1 A;  3E66 A;  5ADX A;  2VGN A;  3W0L A;  4WQ4 C;  2HBM A;  3VTH A;  4BRE A;  4JK8 A;  5FPN A;  3O80 A;  4F9O A;  2Q0U A;  1DKG D;  4BRC A;  1GLJ O;  3CCQ N;  3SK3 A;  3CPW M;  4CZF A;  1HLU A;  1YIJ N;  4U67 L;  2V7Y A;  1GLF O;  1JCF A;  1TUU A;  3H46 O;  4FWL A;  3U4L A;  4BC5 A;  1YUW A;  1HPM A;  1YI2 N;  2HST A;  3E9O A;  5BRD A;  4IOA L;  1OVY A;  4M7X A;  2QA4 N;  1VQM N;  4NB4 A;  2QTD A;  3CET A;  3BF1 A;  3C65 A;  1Z05 A;  4H5W A;  4QS8 A;  5AQP A;  4A5B A;  4CD3 A;  3CMA N;  3G6E N;  3CER A;  4NLC A;  4YOU A;  1VQL N;  3MDQ A;  4FSV A;  4DB3 A;  1VQ9 N;  3MN9 A;  2AA4 A;  1NGB A;  2P9U B;  4EHU A;  2DPN A;  3O9Q A;  4FOE A;  3DXK B;  4EHT A;  3P38 A;  5BPL A;  5GAD P;  3AAQ A;  3UKR B;  1EO1 A;  3WXK A;  5LJW A;  3HOS A;  4H03 B;  3T69 A;  1O13 A;  3ATV A;  1YIT N;  2W40 A;  1BO5 O;  3NVM A;  4XH5 A;  1NLV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...