3ZETA

Structure of a salmonella typhimurium ygjd-yeaz heterodimer.
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
229
structure length
226
Chain Sequence
MRILAIDTATEACSVALWNNGTINAHFELCPREHTQRILPMVQEILAASGASLNEIDALAFGRGPGSFTGVRIGIGIAQGLALGANLPMIGVSTLATMAQGAWRKTGATRVLAAIDARMGEVYWAEYQRDAQGVWQGEETEAVLKPERVGERLKQLSGEWATVGTGWSAWPDLAGLTLHDGEVSLPAAEDMLPIASQKLAAGETVAVEHAEPVYLRNEVAWKKLPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTATIVE M22 PEPTIDASE YEAZ
publication title Crystal Structure of the Dimer of Two Essential Salmonella Typhimurium Proteins, Ygjd & Yeaz and Calorimetric Evidence for the Formation of a Ternary Ygjd-Yeaz-Yjee Complex.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium str. st4/74
molecule tags Hydrolase
total genus 67
structure length 226
sequence length 229
ec nomenclature
pdb deposition date 2012-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00814 Peptidase_M22 Glycoprotease family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3zetA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3zetA02
5AQPA 2ITMA 4CBXA 5CE3A 1NGHA 2GEMA 3FE1A 2P9PA 3QFPA 2P9UB 5AQFA 4BRGA 4CZMA 4EAHD 3VPZA 1HLUA 3O08A 3ATVA 3A5OC 1C0GA 1Q18A 3VEVA 1IJJA 1HPMA 1TYQA 2ZF5O 4PL7A 1EQYA 2Q36A 3TPQA 4M7YA 4BRPA 3CJAA 1DEJA 3LDNA 5EOYA 1CZAN 2A5XA 2VYPA 3FGUA 3FZHA 2A6AA 2ZGZA 4MO5A 4F9OA 4XH4A 4WQ4A 3VETA 3J8AA 3QICA 3ZETB 4FWMA 1YUWA 2CH6A 1MDUB 3BEXA 1T6CA 3O4WA 4FWQA 3M3ZA 1HKBA 5FPDA 3VEZA 3LDPA 3IDHA 4K25A 3O5BA 3DXKB 2NZTA 4IWVA 1J6ZA 2Q1NA 4CZIA 4BC3A 2D0OA 1QHAA 2CH5A 3A5LC 3EKSA 4FSVA 4HWIA 1NGGA 1NGCA 2FSJA 3ATUA 4IO8A 3EL2A 4CBUA 3C7NB 3MN5A 2FF6A 5BR9A 3ZX0A 5JLHA 1GLEG 2NLXA 4H0PA 3WXJA 3CERA 3DXMB 3QBXA 1ATSA 1G99A 3VESA 2BUPA 4WQ5C 5AQJA 3O80A 3EZWA 3JS6A 2P9UA 3H1VX 2A40A 2NRHA 3UKRA 2P9PB 4KBOA 4RCHA 4BC4A 1T6DA 4BR4A 5AQMA 4BRAA 3QBWA 1U6ZA 2VWBA 4FWOA 2HF3A 3ULEB 3C0BA 4Y0WA 5ELZA 3AY9A 3VOVA 1GLJO 1IG8A 4O8KA 1TYQB 1NWKA 1E4FT 5BREA 5KQDA 3O8MA 3MCPA 4DHYA 2VCPA 3AAPA 3IUCA 4XH1A 3M1FA 3HZ6A 4FWRA 4BG8A 4FWPA 4JHDB 2FF3B 1BOTO 1NGFA 3QFUA 5AQWA 5BRHA 4CZFA 4M63C 3GE1A 5BRFA 1NMDA 2P9LB 3KVGA 1U2VB 4CD1A 3VGLA 1BUPA 3EO3A 5EY4A 3H6EA 3DXKA 5F0XA 1X9JA 2GWKA 3CJBA 2Q31A 2CGJA 2E20A 4FPAA 1GLCG 3U8XA 4CBWA 2P9IB 2ZWHA 4QS7A 3A5MC 3DXMA 3GDQA 3MK6A 1JCEA 5LJWA 3D2EA 3LDOA 2PAVA 2Q97A 1QZ6A 1OKJA 1Y64A 3LM9A 1BA0A 5AQOA 3QMLA 4C23A 4BC2A 3I33A 4BRKA 1RDWX 1NGJA 2FSNA 1BU6O 4JD2B 5ADXA 3MMVA 3UKRB 4H03B 5JMVA 2W40A 3FZKA 3ULEA 1SZ2A 4BRNA 3BUZB 3UB5A 4IXCA 4ISEA 2V7YA 3WQUA 3RSEB 2E2NA 2PBDA 4MLHA 4BRCA 3H45C 4BREA 2GUPA 5I9EB 4AM6A 4JHDA 5EXWA 3HM8A 1BWFO 4MO4A 1ZBSA 3VEXA 5JLFA 1H1VA 1QQMA 2P9LA 1U2VA 2CGKA 1BO5O 3LM2A 2FLOA 5FPEA 1T44A 4Z94A 3SJHA 5AQXA 4H5TA 4NO7A 1DGKN 2FXUA 3A5NC 4RWTA 1RFQA 2V51B 2V7ZA 4H5WA 4FWLA 3LDLA 4B1ZA 4A2AA 1JCGA 2HOEA 3VEWA 2BTFA 1DKGD 2P9IA 5AQYA 1BA1A 4IJAA 1ESVA 3EKUA 4A2BA 3HI0A 1ATRA 3MDQA 4BRFA 3L4IA 3AARA 5BPNA 1KXPA 4H5VA 5AQNA 2KHOA 2QWMA 3CHWA 4AM7A 3D2EB 4BRLA 4CZLA 3CJ9A 5BN8A 2IIRA 3LDQA 1GLFO 3BF1A 3UKUB 4JD2A 4CI6A 4IJNA 3SMSA 1NBWA 2E2PA 3QB0A 5EVZA 4JN4A 5AR0A 3WT0A 2P9KB 5AQQA 5AQGA 4PL8A 2F9WA 2H3GX 2Q0RA 4BVPA 3SMPA 3CETA 4BRDA 3VERA 2W41A 3RSEA 5AQLA 4B1VA 4WYBA 1ZXOA 5AQRA 1YAGA 4BGAA 3FZMA 1X3NA 4H0YB 2E88A 5ADXH 3D2FB 3WXKA 3H3OB 2ZGYA 4XEIA 4BRQA 3MN9A 2HF4A 1XQSC 3R8EA 3ID8A 4EHUA 1C0FA 1P8ZA 3BF3A 1ATNA 1WUAA 2GELA 1NGDA 3CJ1A 3IFRA 3WUHA 3U9ZA 4B1UB 4LC9B 2F9TA 1S3XA 3A8YA 3VF2A 3H3NO 4YDUA 2E2QA 3G25A 4J8FA 1MWMA 2QWRA 4K41A 2GWJA 4B1XB 4CD3A 1HX1A 3VGMA 3FLCO 5AQKA 4RTFD 3CQYA 1NLVA 5KPTA 4M7XA 3DWLA 4WQ5A 4PKIA 2A3ZA 2GTDA 2QWPA 3S41A 5KPRA 2OANA 2CGLA 3R6MA 5BPMA 3GL1A 1TUUA 2YHYA 4ISFA 4CZGA 1KAYA 4A61A 4WQ4C 1NGEA 3OHRA 3UKUA 4CJ7A 2E1YA 1KAZA 5BPLA 4FPBA 2P9KA 5AZIB 5AFUA 3H46O 5BN9A 4O5FA 4FL9A 3HBTA 3GG4A 3H1QA 3O6WA 3VF6A 3EN9A 2D0PA 4CZEA 4BR5A 4BGBA 3GOIA 3M6GA 5LY3A 5AQIA 1QZ5A 2I7NA 3D2FA 4FOEA 4NB4A 4PKGA 3ZEUB 4CZHA 3MN7A 3HSCA 4H0TB 3L0QA 2J4RA 3SLCA 3TU5A 1NM1A 3KZBA 3L6QA 1LOTB 4CZJA 3ENOA 2ASOA 2QWLA 2A41A 3FR0A 1SAZA 4BG9A 4E1JA 3HTVA 3O1BA 5EX5A 1JCFA 2QXLA 3F9MA 1X3MA 2QM1A 4JNEA 4XH5A 3UE5A 1GLDG 1YVNA 1V4SA 1HKCA 3GBTA 1QQNA 3WEEB 4BR2A 2Q2RA 4B1WB 4GY2B 4H5RA 4L3QA 3FZFA 3WQTA 1K8KB 1YXQA 3MN6A 2D4WA 4CZKA 4GNIA 3B8AX 2UYTA 2QWOA 5AQVA 1GLBG 5TKYA 4BQZA 5E26A 2QWNA 2HMPA 2FSKA 3P4IA 3ZX3A 3CIPA 3W3DA 4BQLA 3SK3A 3CI5A 4HTLA 4BRHA 5B8HA 2IVPA 3JXUA 3O1WA 4JAXA 2P9NB 4I6MB 3WXLA 1XC3A 1ZC6A 5AZJB 1Z05A 1MWKA 3VF4A 3CJ7A 1MA9B 5AZIA 3LL3A 2E1ZA 2I7PA 3DAWA 1D4XA 4H5NA 4BC5A 4YDUC 3VGKA 3A0IX 3IMXA 5AQUA 5KPZA 4BR9A 4MLEA 2YHWA 1E4GT 1NGBA 2A42A 2AA4A 5FPMA 4BVOA 4K42A 4ISGA 1GLAG 3ZEUA 4DQ8A 5AFUH 1BG3A 4QS9A 1V4TA 2P9SB 5KQ8A 2ASMA 4FWSA 3BP8A 2YCHA 5FPNA 4FO0A 5E84A 4FWKA 1WOQA 4H0XB 5AQSA 4A62A 1XUPO 1SQKA 4DCHA 1LCUA 3VEYA 2EWSA 2D1KA 1R59O 3VEOA 4H0VB 1NGIA 4B9QA 1Z6RA 3DJCA 3WEEA 1NGAA 4PKHA 3D7EO 4FOIA 4BRIA 2YJFA 1BDGA 3QDKA 1K8KA 2ASPA 3W0LA 2AP1A 2IVNA 4EHTA 4H0OA 4K43A 4BR7A 3U9DA 5JICA 2IVOA 3KHYA 5AQZA 2YJEA 3ZETA 1QQOA 2WUSA 4QS8A 3VENA 3CQXA 5F1XA 5LJVA 2YHXA 1RGIA 3R9PA 4BROA 2Q0UA 1KAXA 2P9NA 5AQTA 3WXIA 4I6MA 1HKGA 4EIAA 5AZJA 3AAQA 4BR0A 2DPNA 1S22A 2E8AA 2QW9A 3U4LA 4B1YB 2V52B 3FFKB 2YI1A 3C7NA 1GLLO 4BRMA 5F2RA 5BRDA 3FZLA 4EFHA 4FWNA 2QWQA 3ZX2A 3I8BA 3ENHA 1TUYA 5AQHA 1HJOA 4IZ9A 4DB3A 1HUXA 2P9SA 2E2OA 3CJCA
chains in the Genus database with same CATH superfamily
5AQPA 3CC7N 1NGHA 2P9PA 3DLKA 4CZMA 3L4QA 4A57A 1W9HA 3HP6A 4KREA 3Q7BA 4DR4K 1C0UA 4C8OA 3ATVA 4M3WA 2GV9A 2Z1IA 3TANA 1NJXA 1S9EA 1TYQA 4PL7A 4E7KA 3AVMA 1Q9XA 4M7YA 1L3SA 3AO1A 3CJAA 1DEJA 4YOVA 1EO1A 2A5XA 3C6HA 5GIPA 3L8BA 2YX6A 4DQQA 3QICA 3OYBA 1VSLA 1MDUB 3BEXA 5CZ1A 4CEDA 2HBMA 1B9DA 1VSHA 3HPOA 2W42A 2GBZA 3IDHA 3NVKA 3OYFA 1TGOA 5GADP 1U47A 4OPKA 5KTQA 4CZIA 4CGHA 4H8KA 5M1NA 3TTFA 4F2SA 3C7NB 1OVYA 2DFEA 4FK2A 4H0PA 4ICLA 4IOCL 4X65K 1TVRA 1HQUA 5C24A 5CYQA 2KZZA 5FRNA 5HLFA 3L2VA 4DQRA 4I9LA 1SL0A 1E3MA 1UOCA 5AQJA 1RILA 3JS6A 2P9UA 4E7IA 1D8YA 3H1VX 3UKRA 3C95A 4IFEA 4OGEA 1LW0A 1N32K 1T6DA 3NGIA 3SAHA 1YTUA 2HF3A 3C0BA 4Y0WA 1BL3A 4DSJA 1GLJO 1ASVA 2ZJQL 3OYAA 1YIJN 4B9LA 1NWKA 1E4FT 3VQ9A 3CXCM 3CCUN 3AAPA 3SV4A 4DFJA 1J5EK 4JHDB 2NRTA 3QFUA 5BRHA 1BI4B 4CZFA 3TI0A 1GOAA 4KH4A 5BRFA 2P9LB 3KVGA 4FW2A 4CJTA 4JKGA 3EO3A 5T7BA 3DXKA 5F0XA 1X9JA 2HVIA 3CJBA 2Q31A 3J7ZO 2E20A 1BHLA 1XNRK 2O8FA 4UQGA 1GLCG 2FC0A 3IS9A 4CBWA 3M8SA 4DU3A 4KHPK 3EE8A 3MK6A 1QSSA 1J9AA 3SV3A 1RT2A 2PAVA 2Q97A 1BA0A 1KVAA 2OPQA 3IRXA 4FK0A 3I33A 3TAMA 3PX6A 4HVJA 5C15A 3I0RA 3HYFA 4KHWA 4JD2B 4KB1A 1QTMA 3J81O 4CJ3A 5ADXA 3V4IA 4PY5A 4H03B 2Y1JA 3PIPL 5JMVA 4CFCA 3PX0A 3CCMN 1KLNA 4FXDA 4RW8A 4NYFA 3WQUA 3ZT3A 3CMAN 1W97L 4IEIA 4DSIA 4CJLA 4OGCA 4MO4A 1ZBSA 3O9RA 1LV5A 2KFZA 4E7HA 5JLFA 4NXNK 2YNHA 4ELVA 3N4PA 3P83D 3CCEN 3LM2A 1REVA 1LAVA 1NKEA 4JI6K 4Z94A 4I9QA 3SJHA 1JXEA 1TAQA 3P38A 4NO7A 4JV5K 1DGKN 3V9UA 1RFQA 1JCGA 3S9HA 3E9OA 2G8FA 4IJAA 3HO1A 4AHUA 4DV4K 3EKUA 3HI0A 4E1NA 1T7PA 1KCFA 4N56A 3MDQA 4CHQA 3OYDA 1NG9A 3L4IA 1KXPA 4H5VA 2QA4N 5LMUK 4AM7A 3MXJA 3CJ9A 4CESA 4CGJA 4KAZA 4BE1A 3BF1A 1RNHA 4OLBA 5C10A 4B3SK 1BCOA 1NBWA 2E2PA 3QB0A 1D9FA 1EXQA 5EVZA 2D5RA 3WT0A 3CC4N 1OH7A 4BVPA 1J53A 4KFBA 3AVNA 3SAFA 2W41A 3TAFA 1ZXOA 5JVHL 3EYZA 2FBYA 3HM9A 1U4BA 4H0YB 3LP0A 1BIZA 4FLZA 3QNOA 1FK9A 2HF4A 1XQSC 1P90A 3ID8A 4A5AA 1C0FA 1P8ZA 4CIGA 2ATQA 4GV9A 4N76A 3VQBA 2GELA 4X66K 3VQEA 1VQMN 3CJ1A 3KLHA 4B1UB 4N5SA 5SZTA 3A8YA 4OLAA 3H3NO 4YDUA 5CYMA 2HB5A 3EEQA 3BGRA 2O8DB 2GWJA 1ZYQA 5AQKA 3AA4A 2B4JA 3OS0A 3AA2A 1WN7A 2YHAA 1HNWK 4CF9A 4DTXA 2KZMA 3CF5L 5KPRA 1K6YA 2OANA 3NHGA 5BPMA 4HTUA 3V1RA 1RT5A 1IBLK 1XWLA 1NK4A 4GV3A 4B9MA 1TKXA 4KHNA 3SBGA 4B9SA 2E1YA 4OO1J 3NGZA 2P9KA 3DRRA 1NJYA 1O13A 2RKIA 4IFYA 4O5FA 3OYJA 3HBTA 3H1QA 4C8LA 3O6WA 3OYCA 3ZSYA 2ZE2A 2GX9A 4CZEA 3VQ7A 4KB0A 2IDOA 4BGBA 3D2FA 1TAUA 1WNSA 3ZEUB 3HSCA 4HCCA 3L0QA 4EZ6A 3HPHA 3OBYA 5GIOA 3ENOA 1ZBUA 4CK1A 1SAZA 3QERA 4FJ9A 3HTVA 5I42A 4FJ7A 2NRXA 3O1BA 3F9MA 4ID1A 3UE5A 1QQCA 3AVAA 1GLDG 3K9JA 1V4SA 3HK2A 4JKDA 1HKCA 1SS6A 3K5NA 4JI5K 4GY2B 4H5RA 1BGXT 4DV3K 5FRMA 4E1MA 3AGRA 1YXQA 4IBNA 3MN6A 1SL2A 4AQYK 1UAXA 1C1CA 4PQUA 1IKVA 4BQZA 3LDSA 4R79A 2QWNA 2FBVA 1VK0A 4CGDA 1JLBA 3M8PA 3CIPA 1Z26A 1N5YA 3SK3A 4BRHA 3C6AA 3O1WA 1BQMA 1XNQK 3NCIA 3HVRA 3ZSOA 4W5NA 2P9NB 3KLGA 1ZC6A 3QLHA 3AVBA 4FLUA 3CJ7A 1MA9B 1EWRA 3LL3A 3CM6A 1D4XA 1EP4A 3OS1A 3VGKA 1Q8IA 3IMXA 3OJUA 5FPMA 2A42A 4DV7K 4N47A 1QSLA 2BANA 4ISGA 1S1TA 5KQ8A 4M3YA 3SQ0A 2YCHA 4K8ZA 4FO0A 5E84A 4H0XB 4R5PA 1VHXA 1XUPO 3QEWA 3LZIA 4LD0A 5C2DA 4IO9L 2D1KA 2G8HA 3O9QA 3CPWM 4JLHA 4B8AB 1Z6RA 1QVFM 4EP4A 4PKHA 1IG9A 2HHHK 4FOIA 1BDGA 1K8KA 4ILHA 3DLLL 4CIEA 3THYB 4BR7A 4CJ4A 3KHYA 5AQZA 3OA9A 4I7FA 2YJEA 5AJ3K 1QQOA 2HHQA 3CCLN 1IV0A 3IKMA 1JLEA 1RGIA 1HRHA 2Q0UA 5HP1A 1L3TA 1KAXA 3WXIA 3NMUA 3SQ2A 5AZJA 1NK9A 4YOTA 3SUQA 3QIOA 4CHOA 2QW9A 4GW6A 4O0JA 2V52B 3KJVA 4BDZA 3C7NA 3S3OA 3FZLA 3ISNC 3QEIA 2YKNA 4OKKA 3NH2A 1TKDA 1TUYA 5AQHA 4DB3A 1U04A 3JSMA 2QKKA 3I56N 4KI4A 2GEMA 1I3AA 5AQFA 3PLAA 4BRGA 3AVGA 3VPZA 1HLUA 3NBPA 3SQ4A 3L3VA 4LH4A 3A5OC 1IKWA 1Q18A 3VEVA 1ZBLA 4E89A 1HPMA 2ZF5O 1EQYA 2QTDA 2F7TA 2OTLN 1KLMA 4KH5A 3LDNA 5EOYA 2HSTA 3K9KA 4CJRA 3VTHA 3AVIA 1CZAN 2NUBA 2OPRA 2P5GA 3BDPA 1UWBA 2VG6A 4CCHA 1M1KO 4W5TA 3WNFA 4XH4A 3VETA 4KHYA 4HUEA 1HJRA 1XC9A 3RRGA 1VQ9N 1OH8A 3M3ZA 2HMIA 4K25A 4IFVA 4ID5A 3THWB 4NCBA 1K8AO 2NZTA 4DR2K 4FJXA 2Q1NA 2CH5A 2FSJA 3F2KA 4QCLA 3I55N 3ZX0A 4DV1K 3HSTB 1F21A 3QBXA 4ELTA 3CCJN 5DMRA 1VAZA 4EZ9A 1HPZA 2F8TA 4WQ5C 3O80A 3NE6A 4CEBA 4BC4A 2O8CB 5AQMA 1WSFA 4C8NA 3QBWA 2Y1IA 4JS4A 3ULEB 4O0IA 3KLEA 3RR8A 2W6LA 3KKSA 1IG8A 1C1AA 3MEGA 3KK7A 4JK8A 1RT7A 2I5JA 1X9SA 4CJEA 3THXA 1VRUA 2A1SA 1S6PA 3V1QA 1NK6A 5J2PA 3M1FA 4RW9A 4O4GA 1BOTO 4AHRA 4M63C 3ZSRA 4BE0A 3CFOA 1NMDA 3SAGA 3L2UA 1U2VB 4M3TA 1WSJA 1BUPA 5EY4A 5DM6L 2GWKA 1TL3A 1JLCA 3T1AA 2CGJA 3E1YA 3AGKA 4FPAA 3E01A 4U7BA 2P9IB 2ZWHA 4AF1A 4DTPA 4QS7A 3A5MC 3TARA 3DXMA 5CR4A 3ZT1A 3TAPA 4DF4A 1X9MA 5LJWA 1Y97A 1QZ6A 4CEOA 1VSEA 4CK2A 3QMLA 4C23A 1RTIA 1VSFA 1ZBFA 1SKWA 3TTCA 4Z0UA 4BY9C 1T03A 4M42A 2FSNA 4CECA 4YOXA 4CF1A 3MMVA 4V19S 4JI3K 4JEPA 2NNWA 1VQLN 2PY5A 3I8DA 4DFKA 3FZKA 4KTWA 1SZ2A 4FW1A 5GAGP 2PFUA 1C6VA 1RDAA 4IXCA 5FDLA 3UB5A 4OPJA 2QK9A 2E2NA 2PBDA 2KLAA 3U6FA 1HNZK 2HNZA 4BREA 1NOZA 1X9WA 5I9EB 4AM6A 1YVUA 3HM8A 1SKSA 4BDYA 4DR5K 3MECA 4LF7K 5MLCQ 3DRSA 1XMOK 1T44A 1WSGA 1QSYA 4M3UA 3OYMA 4OX9K 5J1EA 4W5OA 2FXUA 4DTJA 1N8RO 3QIPA 2HNDA 2V51B 4FWLA 4B1ZA 2HOEA 1RBSA 2BTFA 1DKGD 1BA1A 4E3SA 4UY8O 3FFIA 3T3FA 3AARA 5BPNA 1CLQA 4CHZA 3AVHA 1RTJA 1NMNA 2IIRA 1HR0K 3VQQA 3UKUB 1VQKN 4CI6A 3PV8A 4IJNA 5AQGA 4PL8A 2F9WA 4BRDA 1Q86O 3RSEA 3SQ1A 4CE9A 4FLVA 5AQRA 2JGUA 3SBTA 1X3NA 4CJKA 1YITN 2E88A 2DY4A 4IOXA 2ZGYA 4BRQA 3OJSA 1TV6A 3THVA 2A1RA 4EHUA 3DLHA 3BY5A 1NK8A 1LWFA 3QNNA 2GUIA 3N4QA 3P31A 4DSKA 4IOAL 2E2QA 3G25A 4YFUA 3ULDA 4JRPA 4YY3K 1HX1A 5J2QA 5C2FA 3CQYA 1NLVA 3DWLA 3M8RA 4PKIA 2A3ZA 4ZHRA 2GTDA 4DUZK 4AHSA 2CGLA 3R6MA 4CFDA 4W5QA 4O55A 3OBWA 1JKHA 3GL1A 1TUUA 2YHYA 4A61A 4WQ4C 3OHRA 4CJSA 2XHBA 3U3YA 1YHQN 2O8BB 3VQCA 2KTQA 3QO9A 5AZIB 5BN9A 4CFBA 4CVNE 4FL9A 4JS5A 4LFBK 1HYSA 3GG4A 1RDUA 4WCEL 2D0PA 3BZCA 2D0CA 1LWCA 4BR5A 4CEEA 4FOEA 3R3LA 4PKGA 3CYMA 4FM2A 3J7YP 1C0MA 4WF9L 3MN7A 1B92A 3ALYA 1NM1A 3KZBA 4CZJA 3FR0A 1NU0A 5EX5A 3A2FA 3MWPA 1XHZA 1X3MA 4PUOA 4KO0A 1FXXA 3MXMA 3WEEB 4BR2A 4L3QA 3WQTA 4KPYA 2D4WA 1JJ2M 4KH6A 3B8AX 2UYTA 5AQVA 3RMBA 3D45A 3KIOA 4DSFA 1NJZA 4AH9A 3NDKA 3ZX3A 3VQDA 1B9FA 4BQLA 4CGIA 3JXUA 3VA0A 2IS3A 4I6MB 1T3VA 4LY7A 3IG1A 3WXLA 2KW4A 1MWKA 5KGWA 4M45A 4DSLA 3MEEA 5FLXO 2I7PA 4OKEA 4YDUC 3ZSVA 5KPZA 3OYHA 3HL8A 3OYGA 1DLOA 2YHWA 1VQ4N 4BVOA 4PWDA 4K42A 1HNIA 2OYQA 5CHIA 1S1UA 3T7ZA 3MXIA 2P9SB 4FJNA 4FWSA 3KTQA 4DTOA 1RCHA 4JK9A 1WOQA 3E66A 5AQSA 4DCHA 1LCUA 3VEYA 1R59O 3VEOA 2YNFA 1MU2A 2YJFA 3QDKA 3W0LA 4DR1K 4K43A 2IVOA 3ZT0A 4WFAL 4FJHA 4LF9K 1QVGM 1LWEA 4DU1A 3UIQA 3SJJA 4MFBA 1YJNN 1CXQA 4BE2A 1A5VA 3VTIA 2WUSA 3VENA 1XI1A 3CQXA 1N33K 4BROA 4DU4A 4DLEA 2D0AA 2G8UA 4LF6K 1LW2A 4KHUA 4YOYA 1HKGA 4E0DA 3ZSZA 5GAHP 2KFNA 3LP1A 5EU7A 3PO4A 2F4VK 3V9SA 3PSIA 4B1YB 3JAMO 4B9NA 5A2QO 4BRMA 3CPEA 5IT9O 1NK7A 3LPUA 4FWNA 4FJIA 2QWQA 3I8BA 1WB9A 2WBNA 3JYTA 1IO2A 1HJOA 4ILGB 2YHBA 3P1GA 4LH5A 1NKBA 4FK4A 4Z4FA 2ITMA 3FE1A 3RR7A 2P9UB 4HUGA 1W7AA 2O8CA 3VQ6A 3O08A 4GVMA 2OTJN 1IJJA 1KD1O 1VQ5N 3NGYA 3C6UA 2HHTA 2YNIA 4BRPA 4I2QA 1SL1A 1BISA 4FM0A 3CFPA 3C65A 2VWJA 2VYPA 1KFSA 1S1WA 2XY6A 2RN2A 3FGUA 2HHVA 2A6AA 2ZGZA 2BH1A 4F9OA 3J8AA 4DR7K 3ZT2A 1YUWA 4FWQA 1HKBA 3VEZA 3LDPA 3T69A 3KWGA 3MWTA 3O5BA 4JKGB 1RT1A 4CJWA 2OZSA 3DXKB 4Z4EA 4JKAA 1J6ZA 4FSVA 3NAEA 3EKSA 3A5LC 4KKOA 3IAYA 2O8FB 4A59A 1NGCA 3ATUA 3PUFA 1G15A 4IO8A 3LANA 3MN5A 2HHUA 4M41A 3VQ4A 2NLXA 4E19A 3CERA 3G0ZA 4JK7A 1G99A 3C94A 5LL6Z 3HOTA 3S3NA 2O8EB 3B6PA 2UXDK 1UA0A 4BR4A 3KLFA 3MEDA 1U6ZA 3O9UA 2VWBA 4YNQA 5ELZA 2O4GA 3VOVA 3O4QA 1HNXK 4Z4GA 3PX4A 2W6KA 5DK5A 2WFBA 3BZKA 5KQDA 3SPZA 4B3TK 5HRNA 3O8MA 4DHYA 4F3OA 3IUCA 4XH1A 3KD1E 4BG8A 4Y1DA 2FF3B 5AQWA 1NJWA 4BWJA 4A5BA 5GINA 3GE1A 4DV2K 3CCRN 1J54A 4JI1K 4CD1A 3AO2A 3VGLA 4GKJK 3H6EA 2NRVA 3O3GA 1NJIO 3TAQA 3V9WA 5TKWA 4DTSA 3WNHA 4IDKA 1Z25A 4CJFA 3V9ZA 3U8XA 2PZSA 3H08A 3J7AP 3TAEA 4FVUA 4MDBA 4LFAK 3GDQA 4DQPA 2E5LK 1SUQA 1S6QA 1Y64A 3LM9A 5AQOA 5M1QA 3NH0A 4BC2A 4E7JA 1KFDA 3D6RA 1YT3A 1Q82O 1NGJA 3ZSWA 1BU6O 3OYKA 5CZ2A 4AILC 4JKCA 4BRNA 3LZJA 3CCQN 4L8RB 4DWIA 3BUZB 5J2MA 3HP9A 2V7YA 4IEEA 4CHNA 4MLHA 3TTDA 3RRHA 3SZ2A 2ITGA 3QINA 3AA5X 2UUCK 5SWMA 1T8EA 5HBMA 4NLCA 4JHDA 2B5JA 4CFAA 5EXWA 5M1PA 1QE1A 1BI4A 1ASWA 1EX4A 3T19A 3AVCA 4G1QA 1ZBIA 4H4OA 1QQMA 2P9LA 2VQEK 3G10A 4JRQA 2O4IA 3EE9A 1BO5O 3DMJA 5FPEA 4DUYK 1L3UA 4FJLA 1EKEA 3A5NC 4RWTA 3KK3A 4CEAA 2ZM6K 4H5WA 2BDPA 4FJ5A 2WC9A 4A2AA 4FVMA 5AQYA 2G8IA 3K0SA 4K0KK 4K8XA 4A2BA 4NCGA 2DFHA 3V1OA 1ATRA 1DTQA 4AHTA 5AQNA 1KC8O 2KHOA 3TWHA 2HBJA 4DV6K 3D2EB 4BRLA 3ITHA 4LFCK 5BN8A 4E7LA 1HQEA 2HBLA 1TK0A 2B6AA 4JD2A 2RF2A 3HPGA 2HHWA 1U48A 2UU9K 3T1YK 2P51A 4JN4A 2P9KB 1YJ9N 4B9UA 2Q0RA 3SMPA 3CETA 3VERA 1GOBA 5D3GA 4B1VA 4AHVA 4WYBA 3C6TA 1YAGA 4BGAA 3FZMA 4KI6A 4M3ZA 3CQ8A 5JVGL 3D2FB 3WXKA 4CJ5A 4DV0K 3F73A 5I3UA 3K5LA 3ZLJA 4KTQA 2XY8A 2G8VA 1ATNA 2NRWA 3CG7A 1TKTA 3PY8A 3CM5A 3E9PA 4CF0A 1HYZA 1KVBA 4LC9B 4YORA 4F8RA 3ZYYX 3VF2A 3ZSXA 4JI7K 4J8FA 1MWMA 3TAGA 3S3MA 1RBUA 2QWRA 5DM7L 1YI2N 3OYIA 4CD3A 3MX5A 2G8WA 3O9TA 3K57A 5KPTA 4M7XA 3D0PA 2ZQBA 1R0AA 4WQ5A 3L3UA 1OVQA 4YHHK 4FLXA 2QWPA 2JWKA 3LWMA 2OCEA 3QEPA 3S41A 5KI6A 3NFAA 2RPIA 4ISFA 1RDCA 1C0TA 1KAYA 4PA1A 4CZGA 1NGEA 4FZYA 2PYLA 4CJ7A 5C0YA 1C1BA 1JL1A 4B3MK 3H46O 3VMFB 3RMDA 2VGMA 2Z1JA 5HRSA 3NH1A 3EN9A 3V81A 4CEFA 2YNGA 5LY3A 3GOIA 2WOMA 2I7NA 3I0SA 4NB4A 1SV5A 4CERA 1KSPA 4CZHA 4H0TB 4AHCA 3SLCA 1VSIA 2XY7A 3TU5A 3L6QA 4Y1CA 3VQ8A 3ASMA 2ASOA 3P5JA 2QWLA 4BG9A 4DKWA 4ZTJA 1NNEA 1I39A 5M1KA 4DF8A 4Q0BA 4JNEA 4KRFA 1QQNA 2Q2RA 2O8DA 3LAMA 1IBMK 3VQPA 3VQAA 2XO7A 3FZFA 4JI4K 1TK5A 1K8KB 1RDBA 5JS2A 3AO3A 2XY5A 4CZKA 2BGGA 4GNIA 1GLBG 4I2PA 3TR8A 2VWKA 5E26A 1KTQA 4ILJA 2HMPA 2FSKA 3P4IA 3DLEA 3W3DA 4DQSA 4DFMA 1TK8A 2NRRA 4HTLA 3K5OA 1W2BM 2IVPA 3K2PA 4JAXA 3ID6A 5HRRA 4NLBA 2P1JA 1XC3A 1WLJA 5AZJB 4EP5A 3VF4A 3TSQA 2VG7A 2QEXN 4F4KA 4FJGA 3DAWA 4BC5A 4IKFA 4YOUA 3A0IX 4X62K 4KHQA 5AQUA 1X1PA 3ENBA 4BR9A 1A5XA 4B8CA 4YOWA 1E4GT 1NGBA 3HVTA 1A5WA 1Q7YO 1VQ7N 3LP2A 3ZEUA 5AFUH 1BG3A 1V4TA 3EZ5A 3SUPA 5BR8K 1KQSM 4DFPA 5FPNA 2IAJA 1OH5A 4FWKA 5C12A 2VQFK 1IH7A 4IG0A 5HRPA 4JKHA 3VA3A 4B9QA 1VQNN 1NGAA 4LF5K 1QS4A 2RE2A 2Z1HA 4CEQA 2AP1A 3KKRA 1ILYA 4H0OA 4QOZB 4FJKA 3U9DA 4BWMA 5JICA 3DI6A 1CZ9A 4TSXA 4RG8A 1FW6A 1WAFA 4LF4K 4M3RA 5F1XA 2YHXA 3DYAA 3P39A 2P9NA 5JS1A 3AAQA 5GAEP 4BR0A 2DPNA 1S22A 3AV9A 3U4LA 4NXMK 3FFKB 2DTUA 3SYZA 5C42A 2YI1A 1VSJA 3WNGA 1GLLO 2ZD1A 5BRDA 4DTNA 3CMEN 4EFHA 3OTOK 4C1NK 1Q9YA 3ZX2A 2QI2A 2EX3A 3G71N 4CIFA 3ENHA 5M1OA 3AO4A 4IZ9A 3AA3A 3O4NA 1HUXA 5KRTA 4DV5K 1RBRA 4DQIA 2O8EA 1WBBA 4CBXA 5CE3A 2ZJRL 3QFPA 4EAHD 2IGIA 4CJPA 3V6DA 1JLGA 1FKOA 1C0GA 3PIOL 2UXBK 4HCBA 1LAWA 3AVJA 3VN5A 2Q36A 3TPQA 1VQPN 2OPPA 3KWIA 1U49A 3THYA 2DFFA 1HNVA 2PYJA 3THXB 3FZHA 1HMVA 4DTRA 4XIUA 1JLFA 5LMNK 4MO5A 1D9DA 4WQ4A 4WFNL 4IDHA 3ZETB 4FWMA 2CH6A 1D5AA 1WSHA 1T6CA 3NF6A 3O4WA 1J5OA 5FPDA 1VSDA 4RW7A 2LSNA 4IWVA 3CCSN 3DOLA 2R7YA 4KHSA 3WNEA 1IKYA 1QHAA 2D0OA 4HWIA 4BC3A 3RWUA 3HXMA 1NGGA 4RW4A 5CY4A 3LPTA 3SNNA 3EL2A 4CBUA 4CJQA 2FF6A 5BR9A 5JLHA 1GLEG 3WXJA 3DXMB 4CHPA 3HT3A 5E41A 3KK1A 1ATSA 3VESA 2BUPA 2OPSA 1EWQA 3EZWA 3LWLA 3NF9A 2A40A 2NRHA 3CD6N 2P9PB 4KBOA 4RCHA 1S1VA 5HOOA 4OKJA 4Z4HA 4BRAA 1N6QA 1RT6A 4FWOA 3OS2A 4CW7B 3CCVN 1TKZA 3AY9A 5HL7L 1VQ6N 3Q7CA 4DR3K 4O8KA 1TYQB 4U67L 2X6NA 4IG3A 5BREA 2UUBK 4GVEA 3OYNA 4F3TA 3MCPA 1VSMA 2VCPA 5M1FA 3RMCA 3CC2N 1RTHA 2QKBA 1L5UA 3HZ6A 4FWRA 3OYLA 4FWPA 4BACA 1NGFA 4GKKK 3HRGA 3SUOA 3NF8A 3THWA 4J2EA 1N34K 2HNYA 4QAGA 1S72N 3L2RA 1ASUA 4G9ZA 2FBXA 2JLEA 4NCAA 5C25A 2UUAK 4JKEA 4CF8A 1JCEA 3RMAA 1JXBA 3QEVA 3D2EA 3AVFA 3LDOA 1VQON 4CGGA 1NKCA 1OH6A 1OKJA 1DTTA 4Z4CA 3PO5A 4JKBA 4BRKA 2QXFA 1RDWX 4GV6A 4N41A 4FCYA 1U45A 1BIUA 1JLAA 3UKRB 3KK2A 2OA8A 1IBKK 2HBKA 3RTVA 3QETA 3TABA 2W40A 3ULEA 1BQNA 4ISEA 3RSEB 2OZMA 4BRCA 3H45C 3LALA 4CGFA 2GUPA 1FJGK 1QHTA 4FJMA 1BWFO 3F9KA 3K5MA 4BDPA 3VEXA 3O3FA 1H1VA 1U2VA 2CGKA 4KTZA 1VSKA 1M90O 1NK0A 1WSIA 3J80O 1XMQK 2FLOA 3AVLA 1K9MO 3DLGA 2Z1GA 3O9SA 5AQXA 4H5TA 4PHTX 1IKXA 4B3RK 4WE1A 4W5RA 2V7ZA 4CJUA 2KQ2A 1NK5A 3LDLA 3R1XA 3VEWA 1FKPA 2P9IA 4LSLA 2X78A 4Z4IA 1ESVA 1W0HA 3MX2A 2E4LA 2X6SA 4BRFA 3CFRA 4DSEA 2IC3A 3DRPA 2QWMA 3CHWA 2NRZA 4CZLA 3B6OA 3LDQA 4O8UA 1GLFO 1RT4A 1EETA 4CJVA 2YKMA 3SMSA 4CF2A 5AR0A 5AQQA 1KRPA 4CEZA 2HHXA 2H3GX 1I94K 4KV8A 3O3HA 5AQLA 4OVLA 5IWAK 5ADXH 2Q3SA 2YV0X 3H3OB 4CK3A 4XEIA 3MN9A 1K73O 3MAQA 3R8EA 4DLGA 3BF3A 3WXMB 4JI8K 1WUAA 2E6LA 1GOCA 1NGDA 2WONA 3IFRA 4JKFA 4MDAA 3TSUA 3U9ZA 3WUHA 5J2NA 2UXCK 3LP3A 2F9TA 3DOKA 1S3XA 3DLRA 2F96A 1Q81O 4GMJB 3K59A 4C8KA 4K41A 4FZZA 4B1XB 4J2DA 3VGMA 3FLCO 4LF8K 4RTFD 2FBTA 4C1NI 3M8QA 4DS5A 2P5OA 1VQ8N 4HHTA 3OYEA 1O1WA 3UKUA 4DMNA 1YTAA 1KAZA 5BPLA 4FPBA 5AFUA 2HW3A 4DTMA 1BCMA 4H4MA 5H1SQ 3VF6A 3SI6A 3RVCA 2BE2A 3M6GA 5AQIA 1QZ5A 3DM2A 3EY1A 3SUNA 3OY9A 4FJ8A 2AJQA 2J4RA 1DT9A 3SCXA 1LOTB 4OPHA 4ZTFA 3QEXA 1UA1A 1RBTA 2A41A 3LAKA 1TL1A 1RTDA 4FJJA 1HYVA 4E1JA 1CZBA 1JCFA 2QXLA 3M5RA 5K14A 2QM1A 4XH5A 1YVNA 3GBTA 4MQ3A 3AVKA 4C8MA 3ZSQA 2KKZA 4B1WB 1CXUA 3L2QA 4B9VA 4HUFA 3ZCMA 5KGXA 2QWOA 5TKYA 2X74A 3OW2M 2VGNA 1S9GA 2F8SA 1YF5L 1S1XA 3CI5A 1WAJA 5B8HA 4DTUA 4F2RA 2XRIA 4FZXC 2E6MA 4JYAK 2O8BA 4M3XA 1ITGA 2EHGA 3ZT4A 1Z05A 4O5BA 5AZIA 1VRTA 1JLQA 2VG5A 4J2BA 2E1ZA 4H5NA 1WBDA 2WTUA 3PSFA 4DR6K 2ZJPL 4MLEA 4DG1A 4FM1A 2AA4A 2G8KA 4FYDA 4OPAA 4X64K 1GLAG 1RDDA 4DQ8A 4QS9A 2ASMA 4WFBL 1WSEA 3BP8A 3AO5A 3DLBA 4A62A 1SQKA 3G4SN 3K58A 4ELUA 2EWSA 5FROA 3L2WA 4RW6A 3F5TA 4H0VB 1NGIA 3DJCA 4JI2K 3WEEA 3KD5E 4NYNA 3D7EO 4BRIA 2ASPA 2IVNA 4EHTA 1N36K 5KRSA 3T1HK 5HROA 3KLIA 4FLWA 3HOSA 4DS4A 3OVNA 3ZETA 2RHKA 4FLYA 4CHYA 4QS8A 3G6EN 5LJVA 3E9LA 4B3OA 4OJRA 3R9PA 4FLTA 4O44A 1JL2A 3V9XA 2D0BA 2ETJA 1RT3A 4LSNA 3MCAB 3NVMA 4I6MA 5AQTA 4EIAA 3NF7A 4B9TA 4JI0K 3QESA 2E8AA 2HVHA 1YJWN 3TSPA 1KVCA 1SKRA 1T05A 2HHSA 5F2RA 1S5JA 1RBVA 3VQ5A 4J2AA 1L3VA 1XHXA 2IOCA 3U3GA 1NOYA 4B08A 3HJFA 2JWLA 2P9SA 2E2OA 4Q5VA 3CJCA 1ZBHA 3SPYA
chains in the Genus database with same CATH topology
5AQPA 2ITMA 4CBXA 3CC7N 5CE3A 1NGHA 2GEMA 3FE1A 2P9PA 2ZJRL 3QFPA 2P9UB 5AQFA 4BRGA 4CZMA 4EAHD 3PLAA 3L4QA 4A57A 3VPZA 1HLUA 3Q7BA 3O08A 3ATVA 3A5OC 1C0GA 1Q18A 3VEVA 3PIOL 2OTJN 1IJJA 1HPMA 1TYQA 2ZF5O 4PL7A 1KD1O 1VQ5N 1EQYA 2QTDA 2Q36A 2F7TA 3TPQA 4M7YA 4BRPA 1VQPN 2OTLN 3KWIA 3CJAA 4KH5A 1DEJA 3LDNA 5EOYA 2HSTA 3K9KA 4YOVA 1EO1A 3VTHA 3C65A 1CZAN 2A5XA 2VYPA 3C6HA 5GIPA 3FGUA 3FZHA 2A6AA 2ZGZA 2YX6A 1M1KO 2BH1A 4MO5A 4F9OA 4XH4A 4WQ4A 3VETA 4WFNL 3J8AA 4IDHA 3QICA 3ZETB 1VQ9N 4FWMA 1YUWA 2CH6A 1MDUB 3BEXA 1T6CA 2HBMA 3O4WA 4FWQA 3M3ZA 1HKBA 5FPDA 3VEZA 3LDPA 3IDHA 4K25A 3T69A 3KWGA 3NVKA 3MWTA 3O5BA 4JKGB 3DXKB 5GADP 1K8AO 2NZTA 4IWVA 4JKAA 3CCSN 1J6ZA 2Q1NA 4CZIA 4BC3A 2D0OA 1QHAA 2CH5A 3A5LC 3EKSA 4FSVA 4HWIA 1NGGA 5M1NA 4A59A 1NGCA 2FSJA 3ATUA 4IO8A 3TTFA 3F2KA 3EL2A 4CBUA 3C7NB 3MN5A 1OVYA 3I55N 2FF6A 5BR9A 3ZX0A 5JLHA 1GLEG 2NLXA 4H0PA 3WXJA 3CERA 4IOCL 3DXMB 3QBXA 4JK7A 3CCJN 1ATSA 1G99A 1VAZA 3VESA 2BUPA 4WQ5C 5AQJA 3O80A 3HOTA 3EZWA 3JS6A 2P9UA 3H1VX 2A40A 2NRHA 3UKRA 3CD6N 2P9PB 4IFEA 4KBOA 4RCHA 4BC4A 5HOOA 1T6DA 4BR4A 5AQMA 4BRAA 3SAHA 3QBWA 1U6ZA 3O9UA 2VWBA 4FWOA 2HF3A 3CCVN 3ULEB 3C0BA 4Y0WA 5ELZA 3AY9A 3VOVA 5HL7L 1GLJO 1VQ6N 3Q7CA 2ZJQL 1IG8A 4O8KA 1TYQB 4U67L 1NWKA 1YIJN 3KK7A 4JK8A 1E4FT 5BREA 2WFBA 5KQDA 3CXCM 3CCUN 4GVEA 3O8MA 3MCPA 4DHYA 2VCPA 3AAPA 3IUCA 4XH1A 5M1FA 3M1FA 3CC2N 3HZ6A 4FWRA 4BG8A 4FWPA 4JHDB 2FF3B 2NRTA 1BOTO 1NGFA 3QFUA 5AQWA 5BRHA 4A5BA 4CZFA 4M63C 5GINA 3HRGA 3GE1A 4KH4A 3CCRN 5BRFA 1NMDA 2P9LB 3KVGA 1U2VB 4CD1A 3SAGA 3VGLA 4JKGA 1BUPA 3EO3A 5EY4A 3H6EA 5DM6L 3DXKA 5F0XA 1X9JA 2GWKA 1S72N 3CJBA 2NRVA 2Q31A 3J7ZO 1NJIO 2CGJA 3E1YA 2E20A 3AGKA 4FPAA 5TKWA 4G9ZA 4U7BA 1GLCG 3U8XA 4CBWA 4FVUA 2P9IB 2ZWHA 4MDBA 4AF1A 4QS7A 3A5MC 3EE8A 4JKEA 3DXMA 3GDQA 3MK6A 5CR4A 1JCEA 5LJWA 3D2EA 3LDOA 1VQON 2PAVA 2Q97A 1QZ6A 1OKJA 1Y64A 3LM9A 1BA0A 5AQOA 3QMLA 5M1QA 4JKBA 4C23A 4BC2A 3I33A 4BRKA 5C15A 3D6RA 3TTCA 1RDWX 4BY9C 1Q82O 4GV6A 1NGJA 2FSNA 1BU6O 4JD2B 4YOXA 5ADXA 3MMVA 3UKRB 4JEPA 2NNWA 2HBKA 4H03B 1VQLN 3PIPL 5JMVA 2W40A 3FZKA 4JKCA 1SZ2A 3ULEA 4BRNA 3CCQN 3CCMN 5GAGP 3BUZB 2PFUA 3UB5A 4IXCA 4ISEA 2V7YA 3WQUA 3RSEB 2E2NA 2PBDA 2KLAA 4IEEA 4MLHA 3TTDA 4BRCA 3H45C 3CMAN 4BREA 2GUPA 1W97L 4IEIA 5I9EB 4AM6A 4NLCA 4JHDA 5EXWA 5M1PA 3HM8A 1BWFO 4MO4A 1ZBSA 3O9RA 3VEXA 5JLFA 1H1VA 1QQMA 2P9LA 1U2VA 2CGKA 5MLCQ 3N4PA 1M90O 3CCEN 3EE9A 1BO5O 3LM2A 2FLOA 1K9MO 5FPEA 1T44A 4Z94A 3O9SA 5AQXA 3SJHA 3P38A 4H5TA 4NO7A 1DGKN 2FXUA 3A5NC 4RWTA 1N8RO 4PHTX 1RFQA 2V51B 2V7ZA 4H5WA 4FWLA 3LDLA 4B1ZA 2WC9A 4A2AA 1JCGA 2HOEA 3R1XA 3VEWA 2BTFA 1DKGD 2P9IA 3E9OA 1BA1A 5AQYA 4IJAA 1ESVA 3EKUA 4A2BA 3HI0A 3MX2A 4UY8O 1ATRA 3MDQA 4BRFA 3L4IA 3AARA 5BPNA 1KXPA 4H5VA 5AQNA 2KHOA 2QWMA 2QA4N 2HBJA 3CHWA 1KC8O 4AM7A 2NRZA 3D2EB 4BRLA 4CZLA 3CJ9A 5BN8A 2IIRA 3LDQA 4O8UA 1GLFO 3BF1A 2HBLA 3UKUB 4JD2A 1VQKN 4CI6A 5C10A 4IJNA 3SMSA 1NBWA 2E2PA 3QB0A 5EVZA 4JN4A 5AR0A 3WT0A 2P9KB 5AQQA 1YJ9N 5AQGA 3CC4N 4PL8A 2F9WA 2H3GX 2Q0RA 4BVPA 3SMPA 3SAFA 3CETA 4BRDA 3VERA 1Q86O 2W41A 3RSEA 5AQLA 4B1VA 4WYBA 1ZXOA 5JVHL 5AQRA 1YAGA 4BGAA 3FZMA 3SBTA 1X3NA 1YITN 4H0YB 2E88A 5ADXH 5JVGL 3D2FB 3WXKA 3H3OB 2ZGYA 4IOXA 4XEIA 4BRQA 3MN9A 2HF4A 1K73O 1XQSC 1P90A 3R8EA 3ID8A 4A5AA 4EHUA 1C0FA 1P8ZA 3BF3A 4GV9A 1ATNA 3WXMB 1WUAA 2NRWA 2GELA 1VQMN 1NGDA 3CJ1A 3IFRA 4JKFA 4MDAA 3TSUA 3U9ZA 3WUHA 4B1UB 3E9PA 4YORA 4LC9B 2F9TA 3N4QA 3P31A 3ZYYX 1S3XA 3A8YA 3VF2A 3H3NO 4YDUA 4IOAL 2E2QA 3G25A 4J8FA 1MWMA 1Q81O 2QWRA 5DM7L 4K41A 1YI2N 2GWJA 4B1XB 4CD3A 3MX5A 1HX1A 3VGMA 3FLCO 5AQKA 3O9TA 5C2FA 4RTFD 3CQYA 1NLVA 5KPTA 4M7XA 3DWLA 4WQ5A 4C1NI 4PKIA 2A3ZA 3CF5L 2GTDA 2QWPA 2JWKA 3S41A 5KPRA 2OANA 2CGLA 3R6MA 5BPMA 3OBWA 1VQ8N 3GL1A 1TUUA 2YHYA 4GV3A 4ISFA 4CZGA 1KAYA 4A61A 4WQ4C 1NGEA 3OHRA 3UKUA 3SBGA 4CJ7A 2E1YA 1YHQN 4OO1J 5C0YA 1KAZA 5BPLA 4FPBA 2P9KA 5AZIB 5AFUA 3H46O 1O13A 5BN9A 4O5FA 4FL9A 3VMFB 3HBTA 5H1SQ 3GG4A 2VGMA 3H1QA 1RDUA 4WCEL 3O6WA 3VF6A 2GX9A 3EN9A 2D0PA 3RVCA 4CZEA 4BR5A 4BGBA 3GOIA 3M6GA 5LY3A 5AQIA 1QZ5A 2I7NA 3D2FA 4FOEA 3R3LA 4NB4A 4PKGA 3ZEUB 4WF9L 4CZHA 3MN7A 3HSCA 4H0TB 3L0QA 2J4RA 3SLCA 3TU5A 1DT9A 1NM1A 3KZBA 3L6QA 1LOTB 3OBYA 4OPHA 4CZJA 5GIOA 3ENOA 2ASOA 2QWLA 2A41A 3FR0A 1SAZA 4BG9A 4DKWA 4E1JA 3HTVA 5M1KA 2NRXA 3O1BA 5EX5A 1JCFA 3MWPA 2QXLA 3F9MA 3M5RA 1X3MA 2QM1A 4JNEA 4XH5A 3UE5A 1GLDG 3K9JA 1YVNA 1V4SA 4JKDA 1HKCA 3GBTA 1QQNA 1SS6A 3WEEB 4BR2A 2Q2RA 2KKZA 4B1WB 4GY2B 4H5RA 4L3QA 3FZFA 3WQTA 1K8KB 3AGRA 1YXQA 3MN6A 2D4WA 1JJ2M 4KH6A 4CZKA 4GNIA 3B8AX 2UYTA 2QWOA 5AQVA 1GLBG 5TKYA 4BQZA 5E26A 4R79A 2QWNA 2HMPA 4ILJA 3OW2M 2FSKA 2VGNA 3P4IA 1YF5L 3ZX3A 3CIPA 3W3DA 4BQLA 3SK3A 3CI5A 2NRRA 4HTLA 3C6AA 4BRHA 2IVPA 3JXUA 3O1WA 5B8HA 1W2BM 4JAXA 3ID6A 2P9NB 4I6MB 1T3VA 4NLBA 3WXLA 1XC3A 1ZC6A 5AZJB 1Z05A 1MWKA 3TSQA 3VF4A 2QEXN 3CJ7A 1MA9B 5AZIA 3LL3A 2E1ZA 2I7PA 3DAWA 1D4XA 4H5NA 4BC5A 4YDUC 3VGKA 4YOUA 3A0IX 3IMXA 5AQUA 5KPZA 3ENBA 4BR9A 2ZJPL 4YOWA 4MLEA 2YHWA 1E4GT 1NGBA 2A42A 2AA4A 5FPMA 4BVOA 4OPAA 1VQ4N 4K42A 4ISGA 5CHIA 1Q7YO 1GLAG 1VQ7N 3T7ZA 3ZEUA 4DQ8A 5AFUH 1BG3A 4QS9A 1V4TA 2P9SB 5KQ8A 2ASMA 4WFBL 4FWSA 1KQSM 3BP8A 2YCHA 5FPNA 4FO0A 5E84A 4FWKA 3E66A 1WOQA 4H0XB 4JK9A 5AQSA 1XUPO 1SQKA 4A62A 4DCHA 5C12A 3G4SN 1LCUA 5C2DA 4JKHA 3VEYA 2EWSA 2D1KA 4IO9L 1R59O 3VEOA 3F5TA 3O9QA 3CPWM 4H0VB 1NGIA 4B9QA 1Z6RA 3DJCA 1VQNN 1QVFM 3WEEA 1NGAA 4PKHA 3D7EO 4FOIA 4BRIA 2YJFA 1BDGA 2RE2A 1K8KA 3QDKA 2ASPA 3W0LA 2AP1A 2IVNA 4ILHA 4EHTA 3DLLL 1ILYA 4H0OA 4K43A 4BR7A 3U9DA 5JICA 2IVOA 4WFAL 3KHYA 5AQZA 3OA9A 1QVGM 2YJEA 3HOSA 1YJNN 3ZETA 1QQOA 2RHKA 3VTIA 2WUSA 4QS8A 3CCLN 3VENA 3CQXA 3G6EN 5F1XA 3IKMA 5LJVA 3E9LA 2YHXA 1RGIA 3R9PA 4BROA 2Q0UA 3P39A 1KAXA 2P9NA 5AQTA 3MCAB 3NVMA 4I6MA 3WXIA 1HKGA 4YOYA 4EIAA 3NMUA 5GAHP 5AZJA 4YOTA 3AAQA 5GAEP 4BR0A 2DPNA 1S22A 2E8AA 2QW9A 3U4LA 1YJWN 3TSPA 4B1YB 2V52B 3FFKB 2YI1A 3C7NA 1GLLO 4BRMA 5F2RA 3CPEA 5BRDA 3CMEN 3FZLA 4EFHA 4C1NK 4FWNA 2QWQA 3ZX2A 2QI2A 3I8BA 3G71N 2WBNA 3ENHA 5M1OA 1TUYA 5AQHA 1HJOA 4ILGB 4IZ9A 4DB3A 1HUXA 2JWLA 2P9SA 2E2OA 3CJCA 3I56N
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AQP A;  2ITM A;  4CBX A;  5CE3 A;  1NGH A;  2GEM A;  3FE1 A;  2P9P A;  3QFP A;  2P9U B;  5AQF A;  4BRG A;  4CZM A;  4EAH D;  3VPZ A;  1HLU A;  3O08 A;  3ATV A;  3A5O C;  1C0G A;  1Q18 A;  3VEV A;  1IJJ A;  1HPM A;  1TYQ A;  2ZF5 O;  4PL7 A;  1EQY A;  2Q36 A;  3TPQ A;  4M7Y A;  4BRP A;  3CJA A;  1DEJ A;  3LDN A;  5EOY A;  1CZA N;  2A5X A;  2VYP A;  3FGU A;  3FZH A;  2A6A A;  2ZGZ A;  4MO5 A;  4F9O A;  4XH4 A;  4WQ4 A;  3VET A;  3J8A A;  3QIC A;  3ZET B;  4FWM A;  1YUW A;  2CH6 A;  1MDU B;  3BEX A;  1T6C A;  3O4W A;  4FWQ A;  3M3Z A;  1HKB A;  5FPD A;  3VEZ A;  3LDP A;  3IDH A;  4K25 A;  3O5B A;  3DXK B;  2NZT A;  4IWV A;  1J6Z A;  2Q1N A;  4CZI A;  4BC3 A;  2D0O A;  1QHA A;  2CH5 A;  3A5L C;  3EKS A;  4FSV A;  4HWI A;  1NGG A;  1NGC A;  2FSJ A;  3ATU A;  4IO8 A;  3EL2 A;  4CBU A;  3C7N B;  3MN5 A;  2FF6 A;  5BR9 A;  3ZX0 A;  5JLH A;  1GLE G;  2NLX A;  4H0P A;  3WXJ A;  3CER A;  3DXM B;  3QBX A;  1ATS A;  1G99 A;  3VES A;  2BUP A;  4WQ5 C;  5AQJ A;  3O80 A;  3EZW A;  3JS6 A;  2P9U A;  3H1V X;  2A40 A;  2NRH A;  3UKR A;  2P9P B;  4KBO A;  4RCH A;  4BC4 A;  1T6D A;  4BR4 A;  5AQM A;  4BRA A;  3QBW A;  1U6Z A;  2VWB A;  4FWO A;  2HF3 A;  3ULE B;  3C0B A;  4Y0W A;  5ELZ A;  3AY9 A;  3VOV A;  1GLJ O;  1IG8 A;  4O8K A;  1TYQ B;  1NWK A;  1E4F T;  5BRE A;  5KQD A;  3O8M A;  3MCP A;  4DHY A;  2VCP A;  3AAP A;  3IUC A;  4XH1 A;  3M1F A;  3HZ6 A;  4FWR A;  4BG8 A;  4FWP A;  4JHD B;  2FF3 B;  1BOT O;  1NGF A;  3QFU A;  5AQW A;  5BRH A;  4CZF A;  4M63 C;  3GE1 A;  5BRF A;  1NMD A;  2P9L B;  3KVG A;  1U2V B;  4CD1 A;  3VGL A;  1BUP A;  3EO3 A;  5EY4 A;  3H6E A;  3DXK A;  5F0X A;  1X9J A;  2GWK A;  3CJB A;  2Q31 A;  2CGJ A;  2E20 A;  4FPA A;  1GLC G;  3U8X A;  4CBW A;  2P9I B;  2ZWH A;  4QS7 A;  3A5M C;  3DXM A;  3GDQ A;  3MK6 A;  1JCE A;  5LJW A;  3D2E A;  3LDO A;  2PAV A;  2Q97 A;  1QZ6 A;  1OKJ A;  1Y64 A;  3LM9 A;  1BA0 A;  5AQO A;  3QML A;  4C23 A;  4BC2 A;  3I33 A;  4BRK A;  1RDW X;  1NGJ A;  2FSN A;  1BU6 O;  4JD2 B;  5ADX A;  3MMV A;  3UKR B;  4H03 B;  5JMV A;  2W40 A;  3FZK A;  3ULE A;  1SZ2 A;  4BRN A;  3BUZ B;  3UB5 A;  4IXC A;  4ISE A;  2V7Y A;  3WQU A;  3RSE B;  2E2N A;  2PBD A;  4MLH A;  4BRC A;  3H45 C;  4BRE A;  2GUP A;  5I9E B;  4AM6 A;  4JHD A;  5EXW A;  3HM8 A;  1BWF O;  4MO4 A;  1ZBS A;  3VEX A;  5JLF A;  1H1V A;  1QQM A;  2P9L A;  1U2V A;  2CGK A;  1BO5 O;  3LM2 A;  2FLO A;  5FPE A;  1T44 A;  4Z94 A;  3SJH A;  5AQX A;  4H5T A;  4NO7 A;  1DGK N;  2FXU A;  3A5N C;  4RWT A;  1RFQ A;  2V51 B;  2V7Z A;  4H5W A;  4FWL A;  3LDL A;  4B1Z A;  4A2A A;  1JCG A;  2HOE A;  3VEW A;  2BTF A;  1DKG D;  2P9I A;  5AQY A;  1BA1 A;  4IJA A;  1ESV A;  3EKU A;  4A2B A;  3HI0 A;  1ATR A;  3MDQ A;  4BRF A;  3L4I A;  3AAR A;  5BPN A;  1KXP A;  4H5V A;  5AQN A;  2KHO A;  2QWM A;  3CHW A;  4AM7 A;  3D2E B;  4BRL A;  4CZL A;  3CJ9 A;  5BN8 A;  2IIR A;  3LDQ A;  1GLF O;  3BF1 A;  3UKU B;  4JD2 A;  4CI6 A;  4IJN A;  3SMS A;  1NBW A;  2E2P A;  3QB0 A;  5EVZ A;  4JN4 A;  5AR0 A;  3WT0 A;  2P9K B;  5AQQ A;  5AQG A;  4PL8 A;  2F9W A;  2H3G X;  2Q0R A;  4BVP A;  3SMP A;  3CET A;  4BRD A;  3VER A;  2W41 A;  3RSE A;  5AQL A;  4B1V A;  4WYB A;  1ZXO A;  5AQR A;  1YAG A;  4BGA A;  3FZM A;  1X3N A;  4H0Y B;  2E88 A;  5ADX H;  3D2F B;  3WXK A;  3H3O B;  2ZGY A;  4XEI A;  4BRQ A;  3MN9 A;  2HF4 A;  1XQS C;  3R8E A;  3ID8 A;  4EHU A;  1C0F A;  1P8Z A;  3BF3 A;  1ATN A;  1WUA A;  2GEL A;  1NGD A;  3CJ1 A;  3IFR A;  3WUH A;  3U9Z A;  4B1U B;  4LC9 B;  2F9T A;  1S3X A;  3A8Y A;  3VF2 A;  3H3N O;  4YDU A;  2E2Q A;  3G25 A;  4J8F A;  1MWM A;  2QWR A;  4K41 A;  2GWJ A;  4B1X B;  4CD3 A;  1HX1 A;  3VGM A;  3FLC O;  5AQK A;  4RTF D;  3CQY A;  1NLV A;  5KPT A;  4M7X A;  3DWL A;  4WQ5 A;  4PKI A;  2A3Z A;  2GTD A;  2QWP A;  3S41 A;  5KPR A;  2OAN A;  2CGL A;  3R6M A;  5BPM A;  3GL1 A;  1TUU A;  2YHY A;  4ISF A;  4CZG A;  1KAY A;  4A61 A;  4WQ4 C;  1NGE A;  3OHR A;  3UKU A;  4CJ7 A;  2E1Y A;  1KAZ A;  5BPL A;  4FPB A;  2P9K A;  5AZI B;  5AFU A;  3H46 O;  5BN9 A;  4O5F A;  4FL9 A;  3HBT A;  3GG4 A;  3H1Q A;  3O6W A;  3VF6 A;  3EN9 A;  2D0P A;  4CZE A;  4BR5 A;  4BGB A;  3GOI A;  3M6G A;  5LY3 A;  5AQI A;  1QZ5 A;  2I7N A;  3D2F A;  4FOE A;  4NB4 A;  4PKG A;  3ZEU B;  4CZH A;  3MN7 A;  3HSC A;  4H0T B;  3L0Q A;  2J4R A;  3SLC A;  3TU5 A;  1NM1 A;  3KZB A;  3L6Q A;  1LOT B;  4CZJ A;  3ENO A;  2ASO A;  2QWL A;  2A41 A;  3FR0 A;  1SAZ A;  4BG9 A;  4E1J A;  3HTV A;  3O1B A;  5EX5 A;  1JCF A;  2QXL A;  3F9M A;  1X3M A;  2QM1 A;  4JNE A;  4XH5 A;  3UE5 A;  1GLD G;  1YVN A;  1V4S A;  1HKC A;  3GBT A;  1QQN A;  3WEE B;  4BR2 A;  2Q2R A;  4B1W B;  4GY2 B;  4H5R A;  4L3Q A;  3FZF A;  3WQT A;  1K8K B;  1YXQ A;  3MN6 A;  2D4W A;  4CZK A;  4GNI A;  3B8A X;  2UYT A;  2QWO A;  5AQV A;  1GLB G;  5TKY A;  4BQZ A;  5E26 A;  2QWN A;  2HMP A;  2FSK A;  3P4I A;  3ZX3 A;  3CIP A;  3W3D A;  4BQL A;  3SK3 A;  3CI5 A;  4HTL A;  4BRH A;  5B8H A;  2IVP A;  3JXU A;  3O1W A;  4JAX A;  2P9N B;  4I6M B;  3WXL A;  1XC3 A;  1ZC6 A;  5AZJ B;  1Z05 A;  1MWK A;  3VF4 A;  3CJ7 A;  1MA9 B;  5AZI A;  3LL3 A;  2E1Z A;  2I7P A;  3DAW A;  1D4X A;  4H5N A;  4BC5 A;  4YDU C;  3VGK A;  3A0I X;  3IMX A;  5AQU A;  5KPZ A;  4BR9 A;  4MLE A;  2YHW A;  1E4G T;  1NGB A;  2A42 A;  2AA4 A;  5FPM A;  4BVO A;  4K42 A;  4ISG A;  1GLA G;  3ZEU A;  4DQ8 A;  5AFU H;  1BG3 A;  4QS9 A;  1V4T A;  2P9S B;  5KQ8 A;  2ASM A;  4FWS A;  3BP8 A;  2YCH A;  5FPN A;  4FO0 A;  5E84 A;  4FWK A;  1WOQ A;  4H0X B;  5AQS A;  4A62 A;  1XUP O;  1SQK A;  4DCH A;  1LCU A;  3VEY A;  2EWS A;  2D1K A;  1R59 O;  3VEO A;  4H0V B;  1NGI A;  4B9Q A;  1Z6R A;  3DJC A;  3WEE A;  1NGA A;  4PKH A;  3D7E O;  4FOI A;  4BRI A;  2YJF A;  1BDG A;  3QDK A;  1K8K A;  2ASP A;  3W0L A;  2AP1 A;  2IVN A;  4EHT A;  4H0O A;  4K43 A;  4BR7 A;  3U9D A;  5JIC A;  2IVO A;  3KHY A;  5AQZ A;  2YJE A;  3ZET A;  1QQO A;  2WUS A;  4QS8 A;  3VEN A;  3CQX A;  5F1X A;  5LJV A;  2YHX A;  1RGI A;  3R9P A;  4BRO A;  2Q0U A;  1KAX A;  2P9N A;  5AQT A;  3WXI A;  4I6M A;  1HKG A;  4EIA A;  5AZJ A;  3AAQ A;  4BR0 A;  2DPN A;  1S22 A;  2E8A A;  2QW9 A;  3U4L A;  4B1Y B;  2V52 B;  3FFK B;  2YI1 A;  3C7N A;  1GLL O;  4BRM A;  5F2R A;  5BRD A;  3FZL A;  4EFH A;  4FWN A;  2QWQ A;  3ZX2 A;  3I8B A;  3ENH A;  1TUY A;  5AQH A;  1HJO A;  4IZ9 A;  4DB3 A;  1HUX A;  2P9S A;  2E2O A;  3CJC A; 
#chains in the Genus database with same CATH topology
 5AQP A;  3CC7 N;  1NGH A;  2P9P A;  3DLK A;  4CZM A;  3L4Q A;  4A57 A;  1W9H A;  3HP6 A;  4KRE A;  3Q7B A;  4DR4 K;  1C0U A;  4C8O A;  3ATV A;  4M3W A;  2GV9 A;  2Z1I A;  3TAN A;  1NJX A;  1S9E A;  1TYQ A;  4PL7 A;  4E7K A;  3AVM A;  1Q9X A;  4M7Y A;  1L3S A;  3AO1 A;  3CJA A;  1DEJ A;  4YOV A;  1EO1 A;  2A5X A;  3C6H A;  5GIP A;  3L8B A;  2YX6 A;  4DQQ A;  3QIC A;  3OYB A;  1VSL A;  1MDU B;  3BEX A;  5CZ1 A;  4CED A;  2HBM A;  1B9D A;  1VSH A;  3HPO A;  2W42 A;  2GBZ A;  3IDH A;  3NVK A;  3OYF A;  1TGO A;  5GAD P;  1U47 A;  4OPK A;  5KTQ A;  4CZI A;  4CGH A;  4H8K A;  5M1N A;  3TTF A;  4F2S A;  3C7N B;  1OVY A;  2DFE A;  4FK2 A;  4H0P A;  4ICL A;  4IOC L;  4X65 K;  1TVR A;  1HQU A;  5C24 A;  5CYQ A;  2KZZ A;  5FRN A;  5HLF A;  3L2V A;  4DQR A;  4I9L A;  1SL0 A;  1E3M A;  1UOC A;  5AQJ A;  1RIL A;  3JS6 A;  2P9U A;  4E7I A;  1D8Y A;  3H1V X;  3UKR A;  3C95 A;  4IFE A;  4OGE A;  1LW0 A;  1N32 K;  1T6D A;  3NGI A;  3SAH A;  1YTU A;  2HF3 A;  3C0B A;  4Y0W A;  1BL3 A;  4DSJ A;  1GLJ O;  1ASV A;  2ZJQ L;  3OYA A;  1YIJ N;  4B9L A;  1NWK A;  1E4F T;  3VQ9 A;  3CXC M;  3CCU N;  3AAP A;  3SV4 A;  4DFJ A;  1J5E K;  4JHD B;  2NRT A;  3QFU A;  5BRH A;  1BI4 B;  4CZF A;  3TI0 A;  1GOA A;  4KH4 A;  5BRF A;  2P9L B;  3KVG A;  4FW2 A;  4CJT A;  4JKG A;  3EO3 A;  5T7B A;  3DXK A;  5F0X A;  1X9J A;  2HVI A;  3CJB A;  2Q31 A;  3J7Z O;  2E20 A;  1BHL A;  1XNR K;  2O8F A;  4UQG A;  1GLC G;  2FC0 A;  3IS9 A;  4CBW A;  3M8S A;  4DU3 A;  4KHP K;  3EE8 A;  3MK6 A;  1QSS A;  1J9A A;  3SV3 A;  1RT2 A;  2PAV A;  2Q97 A;  1BA0 A;  1KVA A;  2OPQ A;  3IRX A;  4FK0 A;  3I33 A;  3TAM A;  3PX6 A;  4HVJ A;  5C15 A;  3I0R A;  3HYF A;  4KHW A;  4JD2 B;  4KB1 A;  1QTM A;  3J81 O;  4CJ3 A;  5ADX A;  3V4I A;  4PY5 A;  4H03 B;  2Y1J A;  3PIP L;  5JMV A;  4CFC A;  3PX0 A;  3CCM N;  1KLN A;  4FXD A;  4RW8 A;  4NYF A;  3WQU A;  3ZT3 A;  3CMA N;  1W97 L;  4IEI A;  4DSI A;  4CJL A;  4OGC A;  4MO4 A;  1ZBS A;  3O9R A;  1LV5 A;  2KFZ A;  4E7H A;  5JLF A;  4NXN K;  2YNH A;  4ELV A;  3N4P A;  3P83 D;  3CCE N;  3LM2 A;  1REV A;  1LAV A;  1NKE A;  4JI6 K;  4Z94 A;  4I9Q A;  3SJH A;  1JXE A;  1TAQ A;  3P38 A;  4NO7 A;  4JV5 K;  1DGK N;  3V9U A;  1RFQ A;  1JCG A;  3S9H A;  3E9O A;  2G8F A;  4IJA A;  3HO1 A;  4AHU A;  4DV4 K;  3EKU A;  3HI0 A;  4E1N A;  1T7P A;  1KCF A;  4N56 A;  3MDQ A;  4CHQ A;  3OYD A;  1NG9 A;  3L4I A;  1KXP A;  4H5V A;  2QA4 N;  5LMU K;  4AM7 A;  3MXJ A;  3CJ9 A;  4CES A;  4CGJ A;  4KAZ A;  4BE1 A;  3BF1 A;  1RNH A;  4OLB A;  5C10 A;  4B3S K;  1BCO A;  1NBW A;  2E2P A;  3QB0 A;  1D9F A;  1EXQ A;  5EVZ A;  2D5R A;  3WT0 A;  3CC4 N;  1OH7 A;  4BVP A;  1J53 A;  4KFB A;  3AVN A;  3SAF A;  2W41 A;  3TAF A;  1ZXO A;  5JVH L;  3EYZ A;  2FBY A;  3HM9 A;  1U4B A;  4H0Y B;  3LP0 A;  1BIZ A;  4FLZ A;  3QNO A;  1FK9 A;  2HF4 A;  1XQS C;  1P90 A;  3ID8 A;  4A5A A;  1C0F A;  1P8Z A;  4CIG A;  2ATQ A;  4GV9 A;  4N76 A;  3VQB A;  2GEL A;  4X66 K;  3VQE A;  1VQM N;  3CJ1 A;  3KLH A;  4B1U B;  4N5S A;  5SZT A;  3A8Y A;  4OLA A;  3H3N O;  4YDU A;  5CYM A;  2HB5 A;  3EEQ A;  3BGR A;  2O8D B;  2GWJ A;  1ZYQ A;  5AQK A;  3AA4 A;  2B4J A;  3OS0 A;  3AA2 A;  1WN7 A;  2YHA A;  1HNW K;  4CF9 A;  4DTX A;  2KZM A;  3CF5 L;  5KPR A;  1K6Y A;  2OAN A;  3NHG A;  5BPM A;  4HTU A;  3V1R A;  1RT5 A;  1IBL K;  1XWL A;  1NK4 A;  4GV3 A;  4B9M A;  1TKX A;  4KHN A;  3SBG A;  4B9S A;  2E1Y A;  4OO1 J;  3NGZ A;  2P9K A;  3DRR A;  1NJY A;  1O13 A;  2RKI A;  4IFY A;  4O5F A;  3OYJ A;  3HBT A;  3H1Q A;  4C8L A;  3O6W A;  3OYC A;  3ZSY A;  2ZE2 A;  2GX9 A;  4CZE A;  3VQ7 A;  4KB0 A;  2IDO A;  4BGB A;  3D2F A;  1TAU A;  1WNS A;  3ZEU B;  3HSC A;  4HCC A;  3L0Q A;  4EZ6 A;  3HPH A;  3OBY A;  5GIO A;  3ENO A;  1ZBU A;  4CK1 A;  1SAZ A;  3QER A;  4FJ9 A;  3HTV A;  5I42 A;  4FJ7 A;  2NRX A;  3O1B A;  3F9M A;  4ID1 A;  3UE5 A;  1QQC A;  3AVA A;  1GLD G;  3K9J A;  1V4S A;  3HK2 A;  4JKD A;  1HKC A;  1SS6 A;  3K5N A;  4JI5 K;  4GY2 B;  4H5R A;  1BGX T;  4DV3 K;  5FRM A;  4E1M A;  3AGR A;  1YXQ A;  4IBN A;  3MN6 A;  1SL2 A;  4AQY K;  1UAX A;  1C1C A;  4PQU A;  1IKV A;  4BQZ A;  3LDS A;  4R79 A;  2QWN A;  2FBV A;  1VK0 A;  4CGD A;  1JLB A;  3M8P A;  3CIP A;  1Z26 A;  1N5Y A;  3SK3 A;  4BRH A;  3C6A A;  3O1W A;  1BQM A;  1XNQ K;  3NCI A;  3HVR A;  3ZSO A;  4W5N A;  2P9N B;  3KLG A;  1ZC6 A;  3QLH A;  3AVB A;  4FLU A;  3CJ7 A;  1MA9 B;  1EWR A;  3LL3 A;  3CM6 A;  1D4X A;  1EP4 A;  3OS1 A;  3VGK A;  1Q8I A;  3IMX A;  3OJU A;  5FPM A;  2A42 A;  4DV7 K;  4N47 A;  1QSL A;  2BAN A;  4ISG A;  1S1T A;  5KQ8 A;  4M3Y A;  3SQ0 A;  2YCH A;  4K8Z A;  4FO0 A;  5E84 A;  4H0X B;  4R5P A;  1VHX A;  1XUP O;  3QEW A;  3LZI A;  4LD0 A;  5C2D A;  4IO9 L;  2D1K A;  2G8H A;  3O9Q A;  3CPW M;  4JLH A;  4B8A B;  1Z6R A;  1QVF M;  4EP4 A;  4PKH A;  1IG9 A;  2HHH K;  4FOI A;  1BDG A;  1K8K A;  4ILH A;  3DLL L;  4CIE A;  3THY B;  4BR7 A;  4CJ4 A;  3KHY A;  5AQZ A;  3OA9 A;  4I7F A;  2YJE A;  5AJ3 K;  1QQO A;  2HHQ A;  3CCL N;  1IV0 A;  3IKM A;  1JLE A;  1RGI A;  1HRH A;  2Q0U A;  5HP1 A;  1L3T A;  1KAX A;  3WXI A;  3NMU A;  3SQ2 A;  5AZJ A;  1NK9 A;  4YOT A;  3SUQ A;  3QIO A;  4CHO A;  2QW9 A;  4GW6 A;  4O0J A;  2V52 B;  3KJV A;  4BDZ A;  3C7N A;  3S3O A;  3FZL A;  3ISN C;  3QEI A;  2YKN A;  4OKK A;  3NH2 A;  1TKD A;  1TUY A;  5AQH A;  4DB3 A;  1U04 A;  3JSM A;  2QKK A;  3I56 N;  4KI4 A;  2GEM A;  1I3A A;  5AQF A;  3PLA A;  4BRG A;  3AVG A;  3VPZ A;  1HLU A;  3NBP A;  3SQ4 A;  3L3V A;  4LH4 A;  3A5O C;  1IKW A;  1Q18 A;  3VEV A;  1ZBL A;  4E89 A;  1HPM A;  2ZF5 O;  1EQY A;  2QTD A;  2F7T A;  2OTL N;  1KLM A;  4KH5 A;  3LDN A;  5EOY A;  2HST A;  3K9K A;  4CJR A;  3VTH A;  3AVI A;  1CZA N;  2NUB A;  2OPR A;  2P5G A;  3BDP A;  1UWB A;  2VG6 A;  4CCH A;  1M1K O;  4W5T A;  3WNF A;  4XH4 A;  3VET A;  4KHY A;  4HUE A;  1HJR A;  1XC9 A;  3RRG A;  1VQ9 N;  1OH8 A;  3M3Z A;  2HMI A;  4K25 A;  4IFV A;  4ID5 A;  3THW B;  4NCB A;  1K8A O;  2NZT A;  4DR2 K;  4FJX A;  2Q1N A;  2CH5 A;  2FSJ A;  3F2K A;  4QCL A;  3I55 N;  3ZX0 A;  4DV1 K;  3HST B;  1F21 A;  3QBX A;  4ELT A;  3CCJ N;  5DMR A;  1VAZ A;  4EZ9 A;  1HPZ A;  2F8T A;  4WQ5 C;  3O80 A;  3NE6 A;  4CEB A;  4BC4 A;  2O8C B;  5AQM A;  1WSF A;  4C8N A;  3QBW A;  2Y1I A;  4JS4 A;  3ULE B;  4O0I A;  3KLE A;  3RR8 A;  2W6L A;  3KKS A;  1IG8 A;  1C1A A;  3MEG A;  3KK7 A;  4JK8 A;  1RT7 A;  2I5J A;  1X9S A;  4CJE A;  3THX A;  1VRU A;  2A1S A;  1S6P A;  3V1Q A;  1NK6 A;  5J2P A;  3M1F A;  4RW9 A;  4O4G A;  1BOT O;  4AHR A;  4M63 C;  3ZSR A;  4BE0 A;  3CFO A;  1NMD A;  3SAG A;  3L2U A;  1U2V B;  4M3T A;  1WSJ A;  1BUP A;  5EY4 A;  5DM6 L;  2GWK A;  1TL3 A;  1JLC A;  3T1A A;  2CGJ A;  3E1Y A;  3AGK A;  4FPA A;  3E01 A;  4U7B A;  2P9I B;  2ZWH A;  4AF1 A;  4DTP A;  4QS7 A;  3A5M C;  3TAR A;  3DXM A;  5CR4 A;  3ZT1 A;  3TAP A;  4DF4 A;  1X9M A;  5LJW A;  1Y97 A;  1QZ6 A;  4CEO A;  1VSE A;  4CK2 A;  3QML A;  4C23 A;  1RTI A;  1VSF A;  1ZBF A;  1SKW A;  3TTC A;  4Z0U A;  4BY9 C;  1T03 A;  4M42 A;  2FSN A;  4CEC A;  4YOX A;  4CF1 A;  3MMV A;  4V19 S;  4JI3 K;  4JEP A;  2NNW A;  1VQL N;  2PY5 A;  3I8D A;  4DFK A;  3FZK A;  4KTW A;  1SZ2 A;  4FW1 A;  5GAG P;  2PFU A;  1C6V A;  1RDA A;  4IXC A;  5FDL A;  3UB5 A;  4OPJ A;  2QK9 A;  2E2N A;  2PBD A;  2KLA A;  3U6F A;  1HNZ K;  2HNZ A;  4BRE A;  1NOZ A;  1X9W A;  5I9E B;  4AM6 A;  1YVU A;  3HM8 A;  1SKS A;  4BDY A;  4DR5 K;  3MEC A;  4LF7 K;  5MLC Q;  3DRS A;  1XMO K;  1T44 A;  1WSG A;  1QSY A;  4M3U A;  3OYM A;  4OX9 K;  5J1E A;  4W5O A;  2FXU A;  4DTJ A;  1N8R O;  3QIP A;  2HND A;  2V51 B;  4FWL A;  4B1Z A;  2HOE A;  1RBS A;  2BTF A;  1DKG D;  1BA1 A;  4E3S A;  4UY8 O;  3FFI A;  3T3F A;  3AAR A;  5BPN A;  1CLQ A;  4CHZ A;  3AVH A;  1RTJ A;  1NMN A;  2IIR A;  1HR0 K;  3VQQ A;  3UKU B;  1VQK N;  4CI6 A;  3PV8 A;  4IJN A;  5AQG A;  4PL8 A;  2F9W A;  4BRD A;  1Q86 O;  3RSE A;  3SQ1 A;  4CE9 A;  4FLV A;  5AQR A;  2JGU A;  3SBT A;  1X3N A;  4CJK A;  1YIT N;  2E88 A;  2DY4 A;  4IOX A;  2ZGY A;  4BRQ A;  3OJS A;  1TV6 A;  3THV A;  2A1R A;  4EHU A;  3DLH A;  3BY5 A;  1NK8 A;  1LWF A;  3QNN A;  2GUI A;  3N4Q A;  3P31 A;  4DSK A;  4IOA L;  2E2Q A;  3G25 A;  4YFU A;  3ULD A;  4JRP A;  4YY3 K;  1HX1 A;  5J2Q A;  5C2F A;  3CQY A;  1NLV A;  3DWL A;  3M8R A;  4PKI A;  2A3Z A;  4ZHR A;  2GTD A;  4DUZ K;  4AHS A;  2CGL A;  3R6M A;  4CFD A;  4W5Q A;  4O55 A;  3OBW A;  1JKH A;  3GL1 A;  1TUU A;  2YHY A;  4A61 A;  4WQ4 C;  3OHR A;  4CJS A;  2XHB A;  3U3Y A;  1YHQ N;  2O8B B;  3VQC A;  2KTQ A;  3QO9 A;  5AZI B;  5BN9 A;  4CFB A;  4CVN E;  4FL9 A;  4JS5 A;  4LFB K;  1HYS A;  3GG4 A;  1RDU A;  4WCE L;  2D0P A;  3BZC A;  2D0C A;  1LWC A;  4BR5 A;  4CEE A;  4FOE A;  3R3L A;  4PKG A;  3CYM A;  4FM2 A;  3J7Y P;  1C0M A;  4WF9 L;  3MN7 A;  1B92 A;  3ALY A;  1NM1 A;  3KZB A;  4CZJ A;  3FR0 A;  1NU0 A;  5EX5 A;  3A2F A;  3MWP A;  1XHZ A;  1X3M A;  4PUO A;  4KO0 A;  1FXX A;  3MXM A;  3WEE B;  4BR2 A;  4L3Q A;  3WQT A;  4KPY A;  2D4W A;  1JJ2 M;  4KH6 A;  3B8A X;  2UYT A;  5AQV A;  3RMB A;  3D45 A;  3KIO A;  4DSF A;  1NJZ A;  4AH9 A;  3NDK A;  3ZX3 A;  3VQD A;  1B9F A;  4BQL A;  4CGI A;  3JXU A;  3VA0 A;  2IS3 A;  4I6M B;  1T3V A;  4LY7 A;  3IG1 A;  3WXL A;  2KW4 A;  1MWK A;  5KGW A;  4M45 A;  4DSL A;  3MEE A;  5FLX O;  2I7P A;  4OKE A;  4YDU C;  3ZSV A;  5KPZ A;  3OYH A;  3HL8 A;  3OYG A;  1DLO A;  2YHW A;  1VQ4 N;  4BVO A;  4PWD A;  4K42 A;  1HNI A;  2OYQ A;  5CHI A;  1S1U A;  3T7Z A;  3MXI A;  2P9S B;  4FJN A;  4FWS A;  3KTQ A;  4DTO A;  1RCH A;  4JK9 A;  1WOQ A;  3E66 A;  5AQS A;  4DCH A;  1LCU A;  3VEY A;  1R59 O;  3VEO A;  2YNF A;  1MU2 A;  2YJF A;  3QDK A;  3W0L A;  4DR1 K;  4K43 A;  2IVO A;  3ZT0 A;  4WFA L;  4FJH A;  4LF9 K;  1QVG M;  1LWE A;  4DU1 A;  3UIQ A;  3SJJ A;  4MFB A;  1YJN N;  1CXQ A;  4BE2 A;  1A5V A;  3VTI A;  2WUS A;  3VEN A;  1XI1 A;  3CQX A;  1N33 K;  4BRO A;  4DU4 A;  4DLE A;  2D0A A;  2G8U A;  4LF6 K;  1LW2 A;  4KHU A;  4YOY A;  1HKG A;  4E0D A;  3ZSZ A;  5GAH P;  2KFN A;  3LP1 A;  5EU7 A;  3PO4 A;  2F4V K;  3V9S A;  3PSI A;  4B1Y B;  3JAM O;  4B9N A;  5A2Q O;  4BRM A;  3CPE A;  5IT9 O;  1NK7 A;  3LPU A;  4FWN A;  4FJI A;  2QWQ A;  3I8B A;  1WB9 A;  2WBN A;  3JYT A;  1IO2 A;  1HJO A;  4ILG B;  2YHB A;  3P1G A;  4LH5 A;  1NKB A;  4FK4 A;  4Z4F A;  2ITM A;  3FE1 A;  3RR7 A;  2P9U B;  4HUG A;  1W7A A;  2O8C A;  3VQ6 A;  3O08 A;  4GVM A;  2OTJ N;  1IJJ A;  1KD1 O;  1VQ5 N;  3NGY A;  3C6U A;  2HHT A;  2YNI A;  4BRP A;  4I2Q A;  1SL1 A;  1BIS A;  4FM0 A;  3CFP A;  3C65 A;  2VWJ A;  2VYP A;  1KFS A;  1S1W A;  2XY6 A;  2RN2 A;  3FGU A;  2HHV A;  2A6A A;  2ZGZ A;  2BH1 A;  4F9O A;  3J8A A;  4DR7 K;  3ZT2 A;  1YUW A;  4FWQ A;  1HKB A;  3VEZ A;  3LDP A;  3T69 A;  3KWG A;  3MWT A;  3O5B A;  4JKG B;  1RT1 A;  4CJW A;  2OZS A;  3DXK B;  4Z4E A;  4JKA A;  1J6Z A;  4FSV A;  3NAE A;  3EKS A;  3A5L C;  4KKO A;  3IAY A;  2O8F B;  4A59 A;  1NGC A;  3ATU A;  3PUF A;  1G15 A;  4IO8 A;  3LAN A;  3MN5 A;  2HHU A;  4M41 A;  3VQ4 A;  2NLX A;  4E19 A;  3CER A;  3G0Z A;  4JK7 A;  1G99 A;  3C94 A;  5LL6 Z;  3HOT A;  3S3N A;  2O8E B;  3B6P A;  2UXD K;  1UA0 A;  4BR4 A;  3KLF A;  3MED A;  1U6Z A;  3O9U A;  2VWB A;  4YNQ A;  5ELZ A;  2O4G A;  3VOV A;  3O4Q A;  1HNX K;  4Z4G A;  3PX4 A;  2W6K A;  5DK5 A;  2WFB A;  3BZK A;  5KQD A;  3SPZ A;  4B3T K;  5HRN A;  3O8M A;  4DHY A;  4F3O A;  3IUC A;  4XH1 A;  3KD1 E;  4BG8 A;  4Y1D A;  2FF3 B;  5AQW A;  1NJW A;  4BWJ A;  4A5B A;  5GIN A;  3GE1 A;  4DV2 K;  3CCR N;  1J54 A;  4JI1 K;  4CD1 A;  3AO2 A;  3VGL A;  4GKJ K;  3H6E A;  2NRV A;  3O3G A;  1NJI O;  3TAQ A;  3V9W A;  5TKW A;  4DTS A;  3WNH A;  4IDK A;  1Z25 A;  4CJF A;  3V9Z A;  3U8X A;  2PZS A;  3H08 A;  3J7A P;  3TAE A;  4FVU A;  4MDB A;  4LFA K;  3GDQ A;  4DQP A;  2E5L K;  1SUQ A;  1S6Q A;  1Y64 A;  3LM9 A;  5AQO A;  5M1Q A;  3NH0 A;  4BC2 A;  4E7J A;  1KFD A;  3D6R A;  1YT3 A;  1Q82 O;  1NGJ A;  3ZSW A;  1BU6 O;  3OYK A;  5CZ2 A;  4AIL C;  4JKC A;  4BRN A;  3LZJ A;  3CCQ N;  4L8R B;  4DWI A;  3BUZ B;  5J2M A;  3HP9 A;  2V7Y A;  4IEE A;  4CHN A;  4MLH A;  3TTD A;  3RRH A;  3SZ2 A;  2ITG A;  3QIN A;  3AA5 X;  2UUC K;  5SWM A;  1T8E A;  5HBM A;  4NLC A;  4JHD A;  2B5J A;  4CFA A;  5EXW A;  5M1P A;  1QE1 A;  1BI4 A;  1ASW A;  1EX4 A;  3T19 A;  3AVC A;  4G1Q A;  1ZBI A;  4H4O A;  1QQM A;  2P9L A;  2VQE K;  3G10 A;  4JRQ A;  2O4I A;  3EE9 A;  1BO5 O;  3DMJ A;  5FPE A;  4DUY K;  1L3U A;  4FJL A;  1EKE A;  3A5N C;  4RWT A;  3KK3 A;  4CEA A;  2ZM6 K;  4H5W A;  2BDP A;  4FJ5 A;  2WC9 A;  4A2A A;  4FVM A;  5AQY A;  2G8I A;  3K0S A;  4K0K K;  4K8X A;  4A2B A;  4NCG A;  2DFH A;  3V1O A;  1ATR A;  1DTQ A;  4AHT A;  5AQN A;  1KC8 O;  2KHO A;  3TWH A;  2HBJ A;  4DV6 K;  3D2E B;  4BRL A;  3ITH A;  4LFC K;  5BN8 A;  4E7L A;  1HQE A;  2HBL A;  1TK0 A;  2B6A A;  4JD2 A;  2RF2 A;  3HPG A;  2HHW A;  1U48 A;  2UU9 K;  3T1Y K;  2P51 A;  4JN4 A;  2P9K B;  1YJ9 N;  4B9U A;  2Q0R A;  3SMP A;  3CET A;  3VER A;  1GOB A;  5D3G A;  4B1V A;  4AHV A;  4WYB A;  3C6T A;  1YAG A;  4BGA A;  3FZM A;  4KI6 A;  4M3Z A;  3CQ8 A;  5JVG L;  3D2F B;  3WXK A;  4CJ5 A;  4DV0 K;  3F73 A;  5I3U A;  3K5L A;  3ZLJ A;  4KTQ A;  2XY8 A;  2G8V A;  1ATN A;  2NRW A;  3CG7 A;  1TKT A;  3PY8 A;  3CM5 A;  3E9P A;  4CF0 A;  1HYZ A;  1KVB A;  4LC9 B;  4YOR A;  4F8R A;  3ZYY X;  3VF2 A;  3ZSX A;  4JI7 K;  4J8F A;  1MWM A;  3TAG A;  3S3M A;  1RBU A;  2QWR A;  5DM7 L;  1YI2 N;  3OYI A;  4CD3 A;  3MX5 A;  2G8W A;  3O9T A;  3K57 A;  5KPT A;  4M7X A;  3D0P A;  2ZQB A;  1R0A A;  4WQ5 A;  3L3U A;  1OVQ A;  4YHH K;  4FLX A;  2QWP A;  2JWK A;  3LWM A;  2OCE A;  3QEP A;  3S41 A;  5KI6 A;  3NFA A;  2RPI A;  4ISF A;  1RDC A;  1C0T A;  1KAY A;  4PA1 A;  4CZG A;  1NGE A;  4FZY A;  2PYL A;  4CJ7 A;  5C0Y A;  1C1B A;  1JL1 A;  4B3M K;  3H46 O;  3VMF B;  3RMD A;  2VGM A;  2Z1J A;  5HRS A;  3NH1 A;  3EN9 A;  3V81 A;  4CEF A;  2YNG A;  5LY3 A;  3GOI A;  2WOM A;  2I7N A;  3I0S A;  4NB4 A;  1SV5 A;  4CER A;  1KSP A;  4CZH A;  4H0T B;  4AHC A;  3SLC A;  1VSI A;  2XY7 A;  3TU5 A;  3L6Q A;  4Y1C A;  3VQ8 A;  3ASM A;  2ASO A;  3P5J A;  2QWL A;  4BG9 A;  4DKW A;  4ZTJ A;  1NNE A;  1I39 A;  5M1K A;  4DF8 A;  4Q0B A;  4JNE A;  4KRF A;  1QQN A;  2Q2R A;  2O8D A;  3LAM A;  1IBM K;  3VQP A;  3VQA A;  2XO7 A;  3FZF A;  4JI4 K;  1TK5 A;  1K8K B;  1RDB A;  5JS2 A;  3AO3 A;  2XY5 A;  4CZK A;  2BGG A;  4GNI A;  1GLB G;  4I2P A;  3TR8 A;  2VWK A;  5E26 A;  1KTQ A;  4ILJ A;  2HMP A;  2FSK A;  3P4I A;  3DLE A;  3W3D A;  4DQS A;  4DFM A;  1TK8 A;  2NRR A;  4HTL A;  3K5O A;  1W2B M;  2IVP A;  3K2P A;  4JAX A;  3ID6 A;  5HRR A;  4NLB A;  2P1J A;  1XC3 A;  1WLJ A;  5AZJ B;  4EP5 A;  3VF4 A;  3TSQ A;  2VG7 A;  2QEX N;  4F4K A;  4FJG A;  3DAW A;  4BC5 A;  4IKF A;  4YOU A;  3A0I X;  4X62 K;  4KHQ A;  5AQU A;  1X1P A;  3ENB A;  4BR9 A;  1A5X A;  4B8C A;  4YOW A;  1E4G T;  1NGB A;  3HVT A;  1A5W A;  1Q7Y O;  1VQ7 N;  3LP2 A;  3ZEU A;  5AFU H;  1BG3 A;  1V4T A;  3EZ5 A;  3SUP A;  5BR8 K;  1KQS M;  4DFP A;  5FPN A;  2IAJ A;  1OH5 A;  4FWK A;  5C12 A;  2VQF K;  1IH7 A;  4IG0 A;  5HRP A;  4JKH A;  3VA3 A;  4B9Q A;  1VQN N;  1NGA A;  4LF5 K;  1QS4 A;  2RE2 A;  2Z1H A;  4CEQ A;  2AP1 A;  3KKR A;  1ILY A;  4H0O A;  4QOZ B;  4FJK A;  3U9D A;  4BWM A;  5JIC A;  3DI6 A;  1CZ9 A;  4TSX A;  4RG8 A;  1FW6 A;  1WAF A;  4LF4 K;  4M3R A;  5F1X A;  2YHX A;  3DYA A;  3P39 A;  2P9N A;  5JS1 A;  3AAQ A;  5GAE P;  4BR0 A;  2DPN A;  1S22 A;  3AV9 A;  3U4L A;  4NXM K;  3FFK B;  2DTU A;  3SYZ A;  5C42 A;  2YI1 A;  1VSJ A;  3WNG A;  1GLL O;  2ZD1 A;  5BRD A;  4DTN A;  3CME N;  4EFH A;  3OTO K;  4C1N K;  1Q9Y A;  3ZX2 A;  2QI2 A;  2EX3 A;  3G71 N;  4CIF A;  3ENH A;  5M1O A;  3AO4 A;  4IZ9 A;  3AA3 A;  3O4N A;  1HUX A;  5KRT A;  4DV5 K;  1RBR A;  4DQI A;  2O8E A;  1WBB A;  4CBX A;  5CE3 A;  2ZJR L;  3QFP A;  4EAH D;  2IGI A;  4CJP A;  3V6D A;  1JLG A;  1FKO A;  1C0G A;  3PIO L;  2UXB K;  4HCB A;  1LAW A;  3AVJ A;  3VN5 A;  2Q36 A;  3TPQ A;  1VQP N;  2OPP A;  3KWI A;  1U49 A;  3THY A;  2DFF A;  1HNV A;  2PYJ A;  3THX B;  3FZH A;  1HMV A;  4DTR A;  4XIU A;  1JLF A;  5LMN K;  4MO5 A;  1D9D A;  4WQ4 A;  4WFN L;  4IDH A;  3ZET B;  4FWM A;  2CH6 A;  1D5A A;  1WSH A;  1T6C A;  3NF6 A;  3O4W A;  1J5O A;  5FPD A;  1VSD A;  4RW7 A;  2LSN A;  4IWV A;  3CCS N;  3DOL A;  2R7Y A;  4KHS A;  3WNE A;  1IKY A;  1QHA A;  2D0O A;  4HWI A;  4BC3 A;  3RWU A;  3HXM A;  1NGG A;  4RW4 A;  5CY4 A;  3LPT A;  3SNN A;  3EL2 A;  4CBU A;  4CJQ A;  2FF6 A;  5BR9 A;  5JLH A;  1GLE G;  3WXJ A;  3DXM B;  4CHP A;  3HT3 A;  5E41 A;  3KK1 A;  1ATS A;  3VES A;  2BUP A;  2OPS A;  1EWQ A;  3EZW A;  3LWL A;  3NF9 A;  2A40 A;  2NRH A;  3CD6 N;  2P9P B;  4KBO A;  4RCH A;  1S1V A;  5HOO A;  4OKJ A;  4Z4H A;  4BRA A;  1N6Q A;  1RT6 A;  4FWO A;  3OS2 A;  4CW7 B;  3CCV N;  1TKZ A;  3AY9 A;  5HL7 L;  1VQ6 N;  3Q7C A;  4DR3 K;  4O8K A;  1TYQ B;  4U67 L;  2X6N A;  4IG3 A;  5BRE A;  2UUB K;  4GVE A;  3OYN A;  4F3T A;  3MCP A;  1VSM A;  2VCP A;  5M1F A;  3RMC A;  3CC2 N;  1RTH A;  2QKB A;  1L5U A;  3HZ6 A;  4FWR A;  3OYL A;  4FWP A;  4BAC A;  1NGF A;  4GKK K;  3HRG A;  3SUO A;  3NF8 A;  3THW A;  4J2E A;  1N34 K;  2HNY A;  4QAG A;  1S72 N;  3L2R A;  1ASU A;  4G9Z A;  2FBX A;  2JLE A;  4NCA A;  5C25 A;  2UUA K;  4JKE A;  4CF8 A;  1JCE A;  3RMA A;  1JXB A;  3QEV A;  3D2E A;  3AVF A;  3LDO A;  1VQO N;  4CGG A;  1NKC A;  1OH6 A;  1OKJ A;  1DTT A;  4Z4C A;  3PO5 A;  4JKB A;  4BRK A;  2QXF A;  1RDW X;  4GV6 A;  4N41 A;  4FCY A;  1U45 A;  1BIU A;  1JLA A;  3UKR B;  3KK2 A;  2OA8 A;  1IBK K;  2HBK A;  3RTV A;  3QET A;  3TAB A;  2W40 A;  3ULE A;  1BQN A;  4ISE A;  3RSE B;  2OZM A;  4BRC A;  3H45 C;  3LAL A;  4CGF A;  2GUP A;  1FJG K;  1QHT A;  4FJM A;  1BWF O;  3F9K A;  3K5M A;  4BDP A;  3VEX A;  3O3F A;  1H1V A;  1U2V A;  2CGK A;  4KTZ A;  1VSK A;  1M90 O;  1NK0 A;  1WSI A;  3J80 O;  1XMQ K;  2FLO A;  3AVL A;  1K9M O;  3DLG A;  2Z1G A;  3O9S A;  5AQX A;  4H5T A;  4PHT X;  1IKX A;  4B3R K;  4WE1 A;  4W5R A;  2V7Z A;  4CJU A;  2KQ2 A;  1NK5 A;  3LDL A;  3R1X A;  3VEW A;  1FKP A;  2P9I A;  4LSL A;  2X78 A;  4Z4I A;  1ESV A;  1W0H A;  3MX2 A;  2E4L A;  2X6S A;  4BRF A;  3CFR A;  4DSE A;  2IC3 A;  3DRP A;  2QWM A;  3CHW A;  2NRZ A;  4CZL A;  3B6O A;  3LDQ A;  4O8U A;  1GLF O;  1RT4 A;  1EET A;  4CJV A;  2YKM A;  3SMS A;  4CF2 A;  5AR0 A;  5AQQ A;  1KRP A;  4CEZ A;  2HHX A;  2H3G X;  1I94 K;  4KV8 A;  3O3H A;  5AQL A;  4OVL A;  5IWA K;  5ADX H;  2Q3S A;  2YV0 X;  3H3O B;  4CK3 A;  4XEI A;  3MN9 A;  1K73 O;  3MAQ A;  3R8E A;  4DLG A;  3BF3 A;  3WXM B;  4JI8 K;  1WUA A;  2E6L A;  1GOC A;  1NGD A;  2WON A;  3IFR A;  4JKF A;  4MDA A;  3TSU A;  3U9Z A;  3WUH A;  5J2N A;  2UXC K;  3LP3 A;  2F9T A;  3DOK A;  1S3X A;  3DLR A;  2F96 A;  1Q81 O;  4GMJ B;  3K59 A;  4C8K A;  4K41 A;  4FZZ A;  4B1X B;  4J2D A;  3VGM A;  3FLC O;  4LF8 K;  4RTF D;  2FBT A;  4C1N I;  3M8Q A;  4DS5 A;  2P5O A;  1VQ8 N;  4HHT A;  3OYE A;  1O1W A;  3UKU A;  4DMN A;  1YTA A;  1KAZ A;  5BPL A;  4FPB A;  5AFU A;  2HW3 A;  4DTM A;  1BCM A;  4H4M A;  5H1S Q;  3VF6 A;  3SI6 A;  3RVC A;  2BE2 A;  3M6G A;  5AQI A;  1QZ5 A;  3DM2 A;  3EY1 A;  3SUN A;  3OY9 A;  4FJ8 A;  2AJQ A;  2J4R A;  1DT9 A;  3SCX A;  1LOT B;  4OPH A;  4ZTF A;  3QEX A;  1UA1 A;  1RBT A;  2A41 A;  3LAK A;  1TL1 A;  1RTD A;  4FJJ A;  1HYV A;  4E1J A;  1CZB A;  1JCF A;  2QXL A;  3M5R A;  5K14 A;  2QM1 A;  4XH5 A;  1YVN A;  3GBT A;  4MQ3 A;  3AVK A;  4C8M A;  3ZSQ A;  2KKZ A;  4B1W B;  1CXU A;  3L2Q A;  4B9V A;  4HUF A;  3ZCM A;  5KGX A;  2QWO A;  5TKY A;  2X74 A;  3OW2 M;  2VGN A;  1S9G A;  2F8S A;  1YF5 L;  1S1X A;  3CI5 A;  1WAJ A;  5B8H A;  4DTU A;  4F2R A;  2XRI A;  4FZX C;  2E6M A;  4JYA K;  2O8B A;  4M3X A;  1ITG A;  2EHG A;  3ZT4 A;  1Z05 A;  4O5B A;  5AZI A;  1VRT A;  1JLQ A;  2VG5 A;  4J2B A;  2E1Z A;  4H5N A;  1WBD A;  2WTU A;  3PSF A;  4DR6 K;  2ZJP L;  4MLE A;  4DG1 A;  4FM1 A;  2AA4 A;  2G8K A;  4FYD A;  4OPA A;  4X64 K;  1GLA G;  1RDD A;  4DQ8 A;  4QS9 A;  2ASM A;  4WFB L;  1WSE A;  3BP8 A;  3AO5 A;  3DLB A;  4A62 A;  1SQK A;  3G4S N;  3K58 A;  4ELU A;  2EWS A;  5FRO A;  3L2W A;  4RW6 A;  3F5T A;  4H0V B;  1NGI A;  3DJC A;  4JI2 K;  3WEE A;  3KD5 E;  4NYN A;  3D7E O;  4BRI A;  2ASP A;  2IVN A;  4EHT A;  1N36 K;  5KRS A;  3T1H K;  5HRO A;  3KLI A;  4FLW A;  3HOS A;  4DS4 A;  3OVN A;  3ZET A;  2RHK A;  4FLY A;  4CHY A;  4QS8 A;  3G6E N;  5LJV A;  3E9L A;  4B3O A;  4OJR A;  3R9P A;  4FLT A;  4O44 A;  1JL2 A;  3V9X A;  2D0B A;  2ETJ A;  1RT3 A;  4LSN A;  3MCA B;  3NVM A;  4I6M A;  5AQT A;  4EIA A;  3NF7 A;  4B9T A;  4JI0 K;  3QES A;  2E8A A;  2HVH A;  1YJW N;  3TSP A;  1KVC A;  1SKR A;  1T05 A;  2HHS A;  5F2R A;  1S5J A;  1RBV A;  3VQ5 A;  4J2A A;  1L3V A;  1XHX A;  2IOC A;  3U3G A;  1NOY A;  4B08 A;  3HJF A;  2JWL A;  2P9S A;  2E2O A;  4Q5V A;  3CJC A;  1ZBH A;  3SPY A; 
#chains in the Genus database with same CATH homology
 5AQP A;  2ITM A;  4CBX A;  3CC7 N;  5CE3 A;  1NGH A;  2GEM A;  3FE1 A;  2P9P A;  2ZJR L;  3QFP A;  2P9U B;  5AQF A;  4BRG A;  4CZM A;  4EAH D;  3PLA A;  3L4Q A;  4A57 A;  3VPZ A;  1HLU A;  3Q7B A;  3O08 A;  3ATV A;  3A5O C;  1C0G A;  1Q18 A;  3VEV A;  3PIO L;  2OTJ N;  1IJJ A;  1HPM A;  1TYQ A;  2ZF5 O;  4PL7 A;  1KD1 O;  1VQ5 N;  1EQY A;  2QTD A;  2Q36 A;  2F7T A;  3TPQ A;  4M7Y A;  4BRP A;  1VQP N;  2OTL N;  3KWI A;  3CJA A;  4KH5 A;  1DEJ A;  3LDN A;  5EOY A;  2HST A;  3K9K A;  4YOV A;  1EO1 A;  3VTH A;  3C65 A;  1CZA N;  2A5X A;  2VYP A;  3C6H A;  5GIP A;  3FGU A;  3FZH A;  2A6A A;  2ZGZ A;  2YX6 A;  1M1K O;  2BH1 A;  4MO5 A;  4F9O A;  4XH4 A;  4WQ4 A;  3VET A;  4WFN L;  3J8A A;  4IDH A;  3QIC A;  3ZET B;  1VQ9 N;  4FWM A;  1YUW A;  2CH6 A;  1MDU B;  3BEX A;  1T6C A;  2HBM A;  3O4W A;  4FWQ A;  3M3Z A;  1HKB A;  5FPD A;  3VEZ A;  3LDP A;  3IDH A;  4K25 A;  3T69 A;  3KWG A;  3NVK A;  3MWT A;  3O5B A;  4JKG B;  3DXK B;  5GAD P;  1K8A O;  2NZT A;  4IWV A;  4JKA A;  3CCS N;  1J6Z A;  2Q1N A;  4CZI A;  4BC3 A;  2D0O A;  1QHA A;  2CH5 A;  3A5L C;  3EKS A;  4FSV A;  4HWI A;  1NGG A;  5M1N A;  4A59 A;  1NGC A;  2FSJ A;  3ATU A;  4IO8 A;  3TTF A;  3F2K A;  3EL2 A;  4CBU A;  3C7N B;  3MN5 A;  1OVY A;  3I55 N;  2FF6 A;  5BR9 A;  3ZX0 A;  5JLH A;  1GLE G;  2NLX A;  4H0P A;  3WXJ A;  3CER A;  4IOC L;  3DXM B;  3QBX A;  4JK7 A;  3CCJ N;  1ATS A;  1G99 A;  1VAZ A;  3VES A;  2BUP A;  4WQ5 C;  5AQJ A;  3O80 A;  3HOT A;  3EZW A;  3JS6 A;  2P9U A;  3H1V X;  2A40 A;  2NRH A;  3UKR A;  3CD6 N;  2P9P B;  4IFE A;  4KBO A;  4RCH A;  4BC4 A;  5HOO A;  1T6D A;  4BR4 A;  5AQM A;  4BRA A;  3SAH A;  3QBW A;  1U6Z A;  3O9U A;  2VWB A;  4FWO A;  2HF3 A;  3CCV N;  3ULE B;  3C0B A;  4Y0W A;  5ELZ A;  3AY9 A;  3VOV A;  5HL7 L;  1GLJ O;  1VQ6 N;  3Q7C A;  2ZJQ L;  1IG8 A;  4O8K A;  1TYQ B;  4U67 L;  1NWK A;  1YIJ N;  3KK7 A;  4JK8 A;  1E4F T;  5BRE A;  2WFB A;  5KQD A;  3CXC M;  3CCU N;  4GVE A;  3O8M A;  3MCP A;  4DHY A;  2VCP A;  3AAP A;  3IUC A;  4XH1 A;  5M1F A;  3M1F A;  3CC2 N;  3HZ6 A;  4FWR A;  4BG8 A;  4FWP A;  4JHD B;  2FF3 B;  2NRT A;  1BOT O;  1NGF A;  3QFU A;  5AQW A;  5BRH A;  4A5B A;  4CZF A;  4M63 C;  5GIN A;  3HRG A;  3GE1 A;  4KH4 A;  3CCR N;  5BRF A;  1NMD A;  2P9L B;  3KVG A;  1U2V B;  4CD1 A;  3SAG A;  3VGL A;  4JKG A;  1BUP A;  3EO3 A;  5EY4 A;  3H6E A;  5DM6 L;  3DXK A;  5F0X A;  1X9J A;  2GWK A;  1S72 N;  3CJB A;  2NRV A;  2Q31 A;  3J7Z O;  1NJI O;  2CGJ A;  3E1Y A;  2E20 A;  3AGK A;  4FPA A;  5TKW A;  4G9Z A;  4U7B A;  1GLC G;  3U8X A;  4CBW A;  4FVU A;  2P9I B;  2ZWH A;  4MDB A;  4AF1 A;  4QS7 A;  3A5M C;  3EE8 A;  4JKE A;  3DXM A;  3GDQ A;  3MK6 A;  5CR4 A;  1JCE A;  5LJW A;  3D2E A;  3LDO A;  1VQO N;  2PAV A;  2Q97 A;  1QZ6 A;  1OKJ A;  1Y64 A;  3LM9 A;  1BA0 A;  5AQO A;  3QML A;  5M1Q A;  4JKB A;  4C23 A;  4BC2 A;  3I33 A;  4BRK A;  5C15 A;  3D6R A;  3TTC A;  1RDW X;  4BY9 C;  1Q82 O;  4GV6 A;  1NGJ A;  2FSN A;  1BU6 O;  4JD2 B;  4YOX A;  5ADX A;  3MMV A;  3UKR B;  4JEP A;  2NNW A;  2HBK A;  4H03 B;  1VQL N;  3PIP L;  5JMV A;  2W40 A;  3FZK A;  4JKC A;  1SZ2 A;  3ULE A;  4BRN A;  3CCQ N;  3CCM N;  5GAG P;  3BUZ B;  2PFU A;  3UB5 A;  4IXC A;  4ISE A;  2V7Y A;  3WQU A;  3RSE B;  2E2N A;  2PBD A;  2KLA A;  4IEE A;  4MLH A;  3TTD A;  4BRC A;  3H45 C;  3CMA N;  4BRE A;  2GUP A;  1W97 L;  4IEI A;  5I9E B;  4AM6 A;  4NLC A;  4JHD A;  5EXW A;  5M1P A;  3HM8 A;  1BWF O;  4MO4 A;  1ZBS A;  3O9R A;  3VEX A;  5JLF A;  1H1V A;  1QQM A;  2P9L A;  1U2V A;  2CGK A;  5MLC Q;  3N4P A;  1M90 O;  3CCE N;  3EE9 A;  1BO5 O;  3LM2 A;  2FLO A;  1K9M O;  5FPE A;  1T44 A;  4Z94 A;  3O9S A;  5AQX A;  3SJH A;  3P38 A;  4H5T A;  4NO7 A;  1DGK N;  2FXU A;  3A5N C;  4RWT A;  1N8R O;  4PHT X;  1RFQ A;  2V51 B;  2V7Z A;  4H5W A;  4FWL A;  3LDL A;  4B1Z A;  2WC9 A;  4A2A A;  1JCG A;  2HOE A;  3R1X A;  3VEW A;  2BTF A;  1DKG D;  2P9I A;  3E9O A;  1BA1 A;  5AQY A;  4IJA A;  1ESV A;  3EKU A;  4A2B A;  3HI0 A;  3MX2 A;  4UY8 O;  1ATR A;  3MDQ A;  4BRF A;  3L4I A;  3AAR A;  5BPN A;  1KXP A;  4H5V A;  5AQN A;  2KHO A;  2QWM A;  2QA4 N;  2HBJ A;  3CHW A;  1KC8 O;  4AM7 A;  2NRZ A;  3D2E B;  4BRL A;  4CZL A;  3CJ9 A;  5BN8 A;  2IIR A;  3LDQ A;  4O8U A;  1GLF O;  3BF1 A;  2HBL A;  3UKU B;  4JD2 A;  1VQK N;  4CI6 A;  5C10 A;  4IJN A;  3SMS A;  1NBW A;  2E2P A;  3QB0 A;  5EVZ A;  4JN4 A;  5AR0 A;  3WT0 A;  2P9K B;  5AQQ A;  1YJ9 N;  5AQG A;  3CC4 N;  4PL8 A;  2F9W A;  2H3G X;  2Q0R A;  4BVP A;  3SMP A;  3SAF A;  3CET A;  4BRD A;  3VER A;  1Q86 O;  2W41 A;  3RSE A;  5AQL A;  4B1V A;  4WYB A;  1ZXO A;  5JVH L;  5AQR A;  1YAG A;  4BGA A;  3FZM A;  3SBT A;  1X3N A;  1YIT N;  4H0Y B;  2E88 A;  5ADX H;  5JVG L;  3D2F B;  3WXK A;  3H3O B;  2ZGY A;  4IOX A;  4XEI A;  4BRQ A;  3MN9 A;  2HF4 A;  1K73 O;  1XQS C;  1P90 A;  3R8E A;  3ID8 A;  4A5A A;  4EHU A;  1C0F A;  1P8Z A;  3BF3 A;  4GV9 A;  1ATN A;  3WXM B;  1WUA A;  2NRW A;  2GEL A;  1VQM N;  1NGD A;  3CJ1 A;  3IFR A;  4JKF A;  4MDA A;  3TSU A;  3U9Z A;  3WUH A;  4B1U B;  3E9P A;  4YOR A;  4LC9 B;  2F9T A;  3N4Q A;  3P31 A;  3ZYY X;  1S3X A;  3A8Y A;  3VF2 A;  3H3N O;  4YDU A;  4IOA L;  2E2Q A;  3G25 A;  4J8F A;  1MWM A;  1Q81 O;  2QWR A;  5DM7 L;  4K41 A;  1YI2 N;  2GWJ A;  4B1X B;  4CD3 A;  3MX5 A;  1HX1 A;  3VGM A;  3FLC O;  5AQK A;  3O9T A;  5C2F A;  4RTF D;  3CQY A;  1NLV A;  5KPT A;  4M7X A;  3DWL A;  4WQ5 A;  4C1N I;  4PKI A;  2A3Z A;  3CF5 L;  2GTD A;  2QWP A;  2JWK A;  3S41 A;  5KPR A;  2OAN A;  2CGL A;  3R6M A;  5BPM A;  3OBW A;  1VQ8 N;  3GL1 A;  1TUU A;  2YHY A;  4GV3 A;  4ISF A;  4CZG A;  1KAY A;  4A61 A;  4WQ4 C;  1NGE A;  3OHR A;  3UKU A;  3SBG A;  4CJ7 A;  2E1Y A;  1YHQ N;  4OO1 J;  5C0Y A;  1KAZ A;  5BPL A;  4FPB A;  2P9K A;  5AZI B;  5AFU A;  3H46 O;  1O13 A;  5BN9 A;  4O5F A;  4FL9 A;  3VMF B;  3HBT A;  5H1S Q;  3GG4 A;  2VGM A;  3H1Q A;  1RDU A;  4WCE L;  3O6W A;  3VF6 A;  2GX9 A;  3EN9 A;  2D0P A;  3RVC A;  4CZE A;  4BR5 A;  4BGB A;  3GOI A;  3M6G A;  5LY3 A;  5AQI A;  1QZ5 A;  2I7N A;  3D2F A;  4FOE A;  3R3L A;  4NB4 A;  4PKG A;  3ZEU B;  4WF9 L;  4CZH A;  3MN7 A;  3HSC A;  4H0T B;  3L0Q A;  2J4R A;  3SLC A;  3TU5 A;  1DT9 A;  1NM1 A;  3KZB A;  3L6Q A;  1LOT B;  3OBY A;  4OPH A;  4CZJ A;  5GIO A;  3ENO A;  2ASO A;  2QWL A;  2A41 A;  3FR0 A;  1SAZ A;  4BG9 A;  4DKW A;  4E1J A;  3HTV A;  5M1K A;  2NRX A;  3O1B A;  5EX5 A;  1JCF A;  3MWP A;  2QXL A;  3F9M A;  3M5R A;  1X3M A;  2QM1 A;  4JNE A;  4XH5 A;  3UE5 A;  1GLD G;  3K9J A;  1YVN A;  1V4S A;  4JKD A;  1HKC A;  3GBT A;  1QQN A;  1SS6 A;  3WEE B;  4BR2 A;  2Q2R A;  2KKZ A;  4B1W B;  4GY2 B;  4H5R A;  4L3Q A;  3FZF A;  3WQT A;  1K8K B;  3AGR A;  1YXQ A;  3MN6 A;  2D4W A;  1JJ2 M;  4KH6 A;  4CZK A;  4GNI A;  3B8A X;  2UYT A;  2QWO A;  5AQV A;  1GLB G;  5TKY A;  4BQZ A;  5E26 A;  4R79 A;  2QWN A;  2HMP A;  4ILJ A;  3OW2 M;  2FSK A;  2VGN A;  3P4I A;  1YF5 L;  3ZX3 A;  3CIP A;  3W3D A;  4BQL A;  3SK3 A;  3CI5 A;  2NRR A;  4HTL A;  3C6A A;  4BRH A;  2IVP A;  3JXU A;  3O1W A;  5B8H A;  1W2B M;  4JAX A;  3ID6 A;  2P9N B;  4I6M B;  1T3V A;  4NLB A;  3WXL A;  1XC3 A;  1ZC6 A;  5AZJ B;  1Z05 A;  1MWK A;  3TSQ A;  3VF4 A;  2QEX N;  3CJ7 A;  1MA9 B;  5AZI A;  3LL3 A;  2E1Z A;  2I7P A;  3DAW A;  1D4X A;  4H5N A;  4BC5 A;  4YDU C;  3VGK A;  4YOU A;  3A0I X;  3IMX A;  5AQU A;  5KPZ A;  3ENB A;  4BR9 A;  2ZJP L;  4YOW A;  4MLE A;  2YHW A;  1E4G T;  1NGB A;  2A42 A;  2AA4 A;  5FPM A;  4BVO A;  4OPA A;  1VQ4 N;  4K42 A;  4ISG A;  5CHI A;  1Q7Y O;  1GLA G;  1VQ7 N;  3T7Z A;  3ZEU A;  4DQ8 A;  5AFU H;  1BG3 A;  4QS9 A;  1V4T A;  2P9S B;  5KQ8 A;  2ASM A;  4WFB L;  4FWS A;  1KQS M;  3BP8 A;  2YCH A;  5FPN A;  4FO0 A;  5E84 A;  4FWK A;  3E66 A;  1WOQ A;  4H0X B;  4JK9 A;  5AQS A;  1XUP O;  1SQK A;  4A62 A;  4DCH A;  5C12 A;  3G4S N;  1LCU A;  5C2D A;  4JKH A;  3VEY A;  2EWS A;  2D1K A;  4IO9 L;  1R59 O;  3VEO A;  3F5T A;  3O9Q A;  3CPW M;  4H0V B;  1NGI A;  4B9Q A;  1Z6R A;  3DJC A;  1VQN N;  1QVF M;  3WEE A;  1NGA A;  4PKH A;  3D7E O;  4FOI A;  4BRI A;  2YJF A;  1BDG A;  2RE2 A;  1K8K A;  3QDK A;  2ASP A;  3W0L A;  2AP1 A;  2IVN A;  4ILH A;  4EHT A;  3DLL L;  1ILY A;  4H0O A;  4K43 A;  4BR7 A;  3U9D A;  5JIC A;  2IVO A;  4WFA L;  3KHY A;  5AQZ A;  3OA9 A;  1QVG M;  2YJE A;  3HOS A;  1YJN N;  3ZET A;  1QQO A;  2RHK A;  3VTI A;  2WUS A;  4QS8 A;  3CCL N;  3VEN A;  3CQX A;  3G6E N;  5F1X A;  3IKM A;  5LJV A;  3E9L A;  2YHX A;  1RGI A;  3R9P A;  4BRO A;  2Q0U A;  3P39 A;  1KAX A;  2P9N A;  5AQT A;  3MCA B;  3NVM A;  4I6M A;  3WXI A;  1HKG A;  4YOY A;  4EIA A;  3NMU A;  5GAH P;  5AZJ A;  4YOT A;  3AAQ A;  5GAE P;  4BR0 A;  2DPN A;  1S22 A;  2E8A A;  2QW9 A;  3U4L A;  1YJW N;  3TSP A;  4B1Y B;  2V52 B;  3FFK B;  2YI1 A;  3C7N A;  1GLL O;  4BRM A;  5F2R A;  3CPE A;  5BRD A;  3CME N;  3FZL A;  4EFH A;  4C1N K;  4FWN A;  2QWQ A;  3ZX2 A;  2QI2 A;  3I8B A;  3G71 N;  2WBN A;  3ENH A;  5M1O A;  1TUY A;  5AQH A;  1HJO A;  4ILG B;  4IZ9 A;  4DB3 A;  1HUX A;  2JWL A;  2P9S A;  2E2O A;  3CJC A;  3I56 N; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...