3ZETA

Structure of a salmonella typhimurium ygjd-yeaz heterodimer.
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
229
structure length
226
Chain Sequence
MRILAIDTATEACSVALWNNGTINAHFELCPREHTQRILPMVQEILAASGASLNEIDALAFGRGPGSFTGVRIGIGIAQGLALGANLPMIGVSTLATMAQGAWRKTGATRVLAAIDARMGEVYWAEYQRDAQGVWQGEETEAVLKPERVGERLKQLSGEWATVGTGWSAWPDLAGLTLHDGEVSLPAAEDMLPIASQKLAAGETVAVEHAEPVYLRNEVAWKKLPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Dimer of Two Essential Salmonella Typhimurium Proteins, Ygjd & Yeaz and Calorimetric Evidence for the Formation of a Ternary Ygjd-Yeaz-Yjee Complex.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium str. st4/74
molecule tags Hydrolase
molecule keywords PUTATIVE M22 PEPTIDASE YEAZ
total genus 67
structure length 226
sequence length 229
ec nomenclature
pdb deposition date 2012-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00814 Peptidase_M22 Glycoprotease family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3zetA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3zetA02
2P9LA 4J8FA 3ENHA 2P9UA 2QWOA 3DXMA 3DXKA 3VEXA 4BQZA 5AQUA 1Y64A 1HLUA 4IJAA 2VYPA 4FWSA 1HX1A 3UB5A 2IVPA 3ZEUA 4M7XA 2CH6A 2CH5A 4IZ9A 4BC2A 5F1XA 1V4SA 5EX5A 3MK6A 4BC4A 4ISGA 3JS6A 3QICA 3VEYA 5AQZA 3D2EB 4EHTA 2YHWA 3UKRA 4GY2B 1GLBG 1ZXOA 2ASPA 2DPNA 2P9IB 2W41A 5KPTA 3L4IA 4MLEA 2E20A 3BUZB 2CGLA 1NM1A 5AQHA 3I8BA 5BN8A 3VEWA 3D2FA 4JN4A 1BA0A 3VESA 4KBOA 4FWNA 3UKRB 2QM1A 3CJBA 4FWKA 1YAGA 2PBDA 3G25A 5AFUA 4WQ4A 1H1VA 4BRFA 1GLCG 3H3OB 1KAYA 4BR2A 5KPZA 1NLVA 3KHYA 4FSVA 3O8MA 1DEJA 2BUPA 5AQNA 2Q0RA 4H0YB 5AQTA 4A2BA 4FPBA 3HZ6A 1J6ZA 4CZKA 3M1FA 2QWQA 3SK3A 3DXMB 2P9UB 2FF6A 3VGLA 2ZF5O 3HM8A 3QFPA 3MMVA 2E2PA 2NRHA 3RSEB 5TKYA 1GLEG 4CZIA 2VWBA 4O5FA 4H0PA 4H5WA 1ATNA 1BWFO 3IFRA 1SZ2A 3U4LA 3QBWA 5BPNA 5KQDA 2A42A 3P4IA 2GWKA 3VEVA 3VF4A 4CI6A 3GOIA 1MWKA 3LDNA 2AP1A 2QW9A 5AR0A 2D4WA 1GLDG 3FZFA 3F9MA 4BG8A 2QWNA 4QS9A 3DXKB 3GBTA 5AQRA 2H3GX 2P9NB 4CBWA 4BC3A 4FO0A 4M63C 3WT0A 5AQFA 4CBUA 3D7EO 4FWPA 1T6CA 2I7NA 4CZHA 5KQ8A 3HSCA 4BRAA 4CD3A 3B8AX 4HTLA 3IDHA 4PL8A 4BRLA 2V7YA 4RTFD 1G99A 3LDLA 2V52B 2Q2RA 3O1WA 2P9SB 2A6AA 5BR9A 4DCHA 4C23A 2HF3A 1D4XA 1QQOA 3ZETB 3CJCA 1QHAA 4BR9A 3KVGA 1T6DA 3SJHA 3A8YA 5AZJB 4BRCA 4CD1A 3W0LA 4IWVA 3FFKB 3BP8A 3VERA 5AZIB 4H0VB 4MO4A 1NGHA 1NGCA 3OHRA 3H3NO 1KXPA 1BOTO 3QB0A 2ITMA 3FZHA 3EKUA 4M7YA 2FXUA 3CHWA 2F9TA 3A5MC 5ADXH 1NGIA 1S3XA 3CJ7A 1DGKN 5KPRA 2FSNA 3WXJA 4WQ5C 2D1KA 1XUPO 2E2QA 1LOTB 2QWLA 3IUCA 1HUXA 1NGAA 4FWOA 4BREA 4FL9A 1BO5O 3ATVA 4H5VA 3MN6A 1NGEA 4JHDA 1BDGA 2E1YA 3AAQA 5AQYA 2GELA 3U9DA 5F2RA 4BC5A 5F0XA 2Q36A 4JD2A 3HI0A 5AQKA 1TYQB 4CZEA 4I6MA 1YUWA 1E4FT 1HJOA 5AZIA 3W3DA 3AAPA 3WEEA 5JMVA 5AFUH 2EWSA 4H5NA 3FR0A 5BRHA 1Z6RA 1NGDA 3CJ9A 4CZJA 5E84A 4XH5A 2QWMA 1NGFA 2WUSA 3R6MA 4K25A 2QWPA 3DWLA 3EO3A 4BQLA 4DB3A 3FGUA 4BRPA 4CBXA 3ZX0A 5BRFA 3ID8A 1NWKA 4GNIA 1OKJA 2IIRA 3VF6A 4IO8A 1P8ZA 3CIPA 3QMLA 1TUYA 3VGMA 3QDKA 4A2AA 5FPDA 2W40A 4WQ5A 3BF1A 3LDOA 2YHYA 3M6GA 4YDUA 4PKIA 2A5XA 4RCHA 3C7NA 4H0TB 5AQXA 4K42A 5BN9A 1KAXA 1TUUA 2F9WA 2YCHA 4JNEA 4FOEA 1GLJO 4FWLA 4ISFA 2NZTA 3VEOA 3LM9A 5EOYA 2GEMA 3O5BA 3MN9A 3MCPA 3R8EA 4HWIA 5AZJA 2P9NA 4QS8A 4CJ7A 1GLLO 2E2OA 5B8HA 1BUPA 1U2VA 1U6ZA 2P9KA 4CZLA 1SQKA 3O6WA 1V4TA 3H1VX 4DHYA 4B9QA 3ZX2A 1DKGD 4BRNA 1IG8A 5AQMA 3GL1A 5FPMA 1LCUA 2HMPA 4EIAA 3LL3A 4AM6A 1JCGA 1K8KB 1NBWA 1ZBSA 2Q31A 4K41A 1RDWX 3ENOA 2ZWHA 4RWTA 3L6QA 4H03B 3QFUA 2FF3B 1HKGA 3D2EA 1X3MA 2Q97A 3O4WA 1NMDA 5ADXA 3ZX3A 2BTFA 2ASOA 3ATUA 1C0FA 4FWMA 4E1JA 3A0IX 3SMSA 1NGBA 4BRQA 1QZ6A 4IXCA 5AQGA 1WUAA 4XH4A 4ISEA 2I7PA 3TPQA 4YDUC 1EQYA 5EXWA 3SMPA 4BGBA 1S22A 1XQSC 3EL2A 5AQWA 4BRGA 3TU5A 4FPAA 3EN9A 3D2FB 5E26A 2VCPA 3O80A 4CZFA 2GWJA 4H0OA 2YJFA 3MN5A 3FZKA 1SAZA 1QQNA 3A5NC 1R59O 1HKBA 3WXKA 4B1XB 2HF4A 1U2VB 2P9KB 3DJCA 4L3QA 2E1ZA 2FSKA 3EZWA 3LDQA 4BG9A 1ATRA 2V7ZA 3BF3A 3CI5A 5AQJA 5AQVA 5I9EB 3ZEUB 2P9LB 3C0BA 2IVOA 4BGAA 1HKCA 4PL7A 3SLCA 5ELZA 3CETA 5JLFA 4BRIA 2J4RA 1MWMA 3GE1A 1K8KA 2QWRA 4MLHA 3MN7A 3ULEA 3H46O 4BVOA 1GLFO 1NGGA 3BEXA 3FZLA 4JHDB 2A3ZA 4BR0A 5BPMA 4K43A 3A5LC 2AA4A 4XH1A 4FWQA 3EKSA 1JCFA 1X3NA 2D0OA 3CQYA 1MDUB 2V51B 4FOIA 3H1QA 4FWRA 1JCEA 3WQUA 4JAXA 5JICA 1CZAN 1KAZA 2GTDA 2IVNA 3IMXA 5AQLA 1ATSA 5BREA 5BPLA 2QXLA 3CQXA 4EFHA 4EAHD 2OANA 3WXLA 3UKUA 5EY4A 1E4GT 1ZC6A 3GG4A 4H5RA 4EHUA 4Z94A 2E2NA 2P9PB 4I6MB 2NLXA 4MO5A 5LJWA 3L0QA 3JXUA 3FLCO 1ESVA 3FE1A 4AM7A 2CGKA 1QQMA 2YHXA 3AARA 1Z05A 5EVZA 4BR5A 3LDPA 4WYBA 3O08A 4BVPA 4F9OA 2ASMA 3H6EA 2E8AA 1YXQA 4B1WB 4H0XB 4NB4A 2FLOA 1Q18A 4CZMA 3WEEB 5JLHA 3UE5A 3VEZA 5AQQA 2KHOA 3HTVA 4B1UB 3U9ZA 2ZGYA 2A41A 1RFQA 4JD2B 3C7NB 5BRDA 5LY3A 3LM2A 3O1BA 3WQTA 5LJVA 4H5TA 1GLAG 2PAVA 2YJEA 2CGJA 3VOVA 3WUHA 3QBXA 2Q0UA 4CZGA 3AY9A 2HOEA 1WOQA 3CJAA 3I33A 4WQ4C 3VGKA 3WXIA 4O8KA 5CE3A 2E88A 2FSJA 4PKHA 4BR7A 4IJNA 2UYTA 5AQOA 4B1YB 3H45C 4QS7A 3U8XA 3GDQA 3DAWA 1HPMA 4A61A 3M3ZA 3KZBA 2Q1NA 1NGJA 4NO7A 3A5OC 4BRMA 1C0GA 5AQSA 4BRHA 1X9JA 1BU6O 4BRKA 1TYQA 4PKGA 4Y0WA 1BA1A 1YVNA 3CJ1A 3VENA 2ZGZA 3VF2A 3S41A 3FZMA 2A40A 5AQIA 3ZETA 5AQPA 2D0PA 3VPZA 4A62A 4B1VA 4BRDA 2GUPA 1XC3A 2YI1A 4LC9B 5FPNA 4BROA 4DQ8A 4BR4A 2P9SA 1BG3A 5FPEA 1T44A 3HBTA 3CERA 4B1ZA 1IJJA 1QZ5A 1RGIA 2P9PA 3MDQA 4XEIA 3J8AA 1MA9B 2P9IA 3RSEA 3R9PA 3VETA 3ULEB 3UKUB
chains in the Genus database with same CATH superfamily
4AHVA 3ENHA 2P9UA 3DXMA 4RW8A 1OH7A 3B6PA 5AQUA 1NK4A 2IS3A 2ITGA 3NMUA 1S1UA 1NMNA 2IVPA 4KI4A 1JLQA 1X9WA 2CH6A 3G6EN 4BC4A 5AQZA 4G1QA 1RBRA 3UKRA 2O8FA 1ZXOA 5HOOA 1VAZA 3L4IA 4MLEA 4IFEA 1N32K 5CZ1A 4JRPA 3KD5E 4IEIA 5BN8A 2D0CA 3VESA 4DFPA 3LALA 5C42A 3E9PA 4N41A 1YJ9N 1CLQA 3UKRB 4FWNA 4DKWA 1WBBA 2O8FB 4F3TA 3VQCA 1YAGA 3G25A 3QEWA 4WQ4A 1GLCG 2FBVA 2OZMA 4Y1DA 1KAYA 4BR2A 5KPZA 1KLMA 4IFYA 2BUPA 1HYVA 1NJXA 3CFPA 1NK7A 5AQNA 3TARA 2NRRA 4M3XA 4A2BA 2QK9A 1ZYQA 1E3MA 1J6ZA 5M1PA 3ZT1A 4CZKA 4F2SA 3DXMB 2P9UB 3NE6A 3O4QA 3VGLA 4CJ4A 3HM8A 4HCBA 4DU1A 1RBSA 4CEBA 4JI7K 1YJWN 2E2PA 3RSEB 3E9LA 4H0PA 2FBYA 2YKNA 3BY5A 5CYMA 5C2DA 5BPNA 3P4IA 1YTAA 4KTWA 4I9LA 1NK0A 4CI6A 3GOIA 3LDNA 4ELTA 4PHTX 4DF4A 4X64K 5I42A 2P5GA 1Z26A 2O8CB 3Q7BA 2QWNA 3V9SA 4LH4A 4MFBA 1GOCA 4CJSA 4DU3A 2H3GX 4DQIA 2P9NB 2X6SA 4FO0A 4B3SK 3MXJA 4M63C 3VQ6A 1RDCA 3VMFB 5KQ8A 4B3TK 4BRAA 4CECA 4CD3A 4IOCL 4HTLA 3IDHA 1NOYA 3IS9A 4DFJA 1REVA 1G99A 4FLYA 1VQLN 3O1WA 2Q2RA 4DFKA 4CGIA 4DSKA 2O8EA 2A6AA 4JI4K 4C23A 3V1RA 1HYSA 5CR4A 1EWQA 3CCVN 3AGRA 3AVIA 3ZSZA 3KVGA 4FXDA 2G8FA 4CD1A 3ZLJA 4X65K 3VERA 4MO4A 4KTZA 1KXPA 1BI4A 3EKUA 3SV3A 1NGIA 3EZ5A 1HMVA 4DSFA 1DGKN 3CG7A 1YTUA 5KPRA 1L3SA 3ALYA 4DUYK 4CGJA 4WQ5C 1VQON 2D1KA 2G8UA 1J53A 1VSKA 2QWLA 3CYMA 3IUCA 1SUQA 3CCRN 3KLHA 4ZTJA 4E1MA 4FJ8A 1NGAA 4FL9A 1IKVA 4WE1A 2E1YA 1KLNA 5KGXA 5AQKA 3M8SA 1KRPA 3CM6A 4I6MA 3OYIA 3CCJN 1TAQA 4GKJK 1J9AA 4CJUA 3ZT2A 4JI6K 2Z1HA 1WAJA 3AAPA 3P31A 3FR0A 3K9JA 1N5YA 3C65A 1RCHA 3CJ9A 1D8YA 1KFSA 3MXMA 3HO1A 3L2UA 2WUSA 4K25A 3HP9A 3EO3A 4DB3A 4AH9A 3IRXA 1HNXK 1IBKK 4GNIA 1VRUA 2IIRA 3DLEA 3CIPA 3QMLA 3LDSA 3L8BA 1MU2A 4RW4A 1W2BM 3NCIA 4PKIA 4OVLA 3C7NA 4N76A 4LF8K 2KZZA 5BN9A 4GV3A 1KAXA 5MLCQ 2NRVA 4I9QA 1VHXA 5EOYA 4AILC 3MN9A 1JLGA 3HOSA 4CJ7A 1GLLO 2HBKA 4B3OA 2RKIA 1ASWA 2GUIA 3QEXA 1S1WA 1SQKA 3K5NA 3EEQA 3N4QA 1VSJA 2WOMA 2OPQA 4BRNA 1FXXA 1IG8A 3GL1A 1SKRA 2UU9K 3KLFA 3KK3A 1D5AA 5FPMA 4A5BA 3VQEA 4AM6A 2Q31A 1JKHA 1RDWX 3QFUA 1IV0A 3J7AP 1X3MA 2Q97A 4CJWA 1YITN 5ADXA 2F8TA 4MDBA 4OGCA 4FWMA 1IBLK 5M1NA 4XH4A 1M1KO 4BACA 4C8LA 4NLCA 4FM2A 1TK5A 3S3NA 3R1XA 1EQYA 3C6AA 3O9QA 4NYFA 1S22A 5AQWA 3L3UA 4ELVA 3TU5A 4FPAA 3D2FB 4HUEA 3AA5X 2VCPA 3O80A 2DFEA 5EU7A 1WN7A 4H0OA 3SPZA 3MN5A 1LW0A 4NXMK 1B92A 3WXKA 1TKZA 1ASUA 2P9KB 4IO9L 4Z4EA 3SQ0A 2E1ZA 2FSKA 4FW1A 3PSIA 4DQSA 2E6MA 5AQVA 3KTQA 3ZEUB 2P9LB 2IVOA 1HKCA 4KKOA 1JLEA 3SLCA 4MQ3A 3CETA 4KFBA 4WCEL 3KWGA 2J4RA 3VQPA 4YOUA 4FLUA 1VQMN 4JI8K 1C6VA 3AV9A 1W0HA 3NF6A 1GLFO 1CXUA 2A3ZA 2VWJA 5BPMA 3V1OA 4DR5K 1QSSA 3A5LC 1QS4A 1HYZA 4DR1K 4ID1A 1XNRK 2NRTA 2V51B 3NFAA 4DR2K 4I2PA 2XY5A 3AA3A 1J54A 1KAZA 1ZBHA 2VQEK 1HNWK 3PLAA 5BREA 2G8HA 1JLBA 2OANA 1C1BA 3WXLA 3U6FA 1TK8A 2F8SA 3P1GA 3RMBA 2PZSA 1TGOA 4EHUA 4Z94A 1TKDA 1VSEA 2E2NA 4KHSA 4OPAA 4HUFA 3JXUA 3O3GA 3FE1A 1HQEA 2KZMA 1YF5L 1ILYA 2DFFA 3JYTA 5KTQA 3O3FA 4WFNL 3MX5A 3OJSA 3NDKA 2ASMA 1VQKN 4O0JA 2E8AA 3OYMA 1RT1A 2VGMA 4JI3K 4U67L 4I7FA 4E7HA 1EETA 2VG6A 5JLHA 4AHSA 1Q82O 3V4IA 3PUFA 4PQUA 3HTVA 4JK7A 4B1UB 1WSGA 3C6TA 2ZGYA 4WF9L 3OYHA 1LWEA 5LY3A 3O1BA 4NLBA 3ID6A 4CF1A 3VOVA 2Q0UA 4CZGA 1B9FA 3AY9A 5JVGL 1WOQA 3CJAA 4CJLA 5JVHL 3T69A 3VGKA 3WXIA 1OH6A 3F9KA 5SWMA 5CE3A 4BR7A 4FM1A 3LAKA 1FK9A 4CE9A 4KHWA 2UYTA 5AQOA 3LAMA 2YNGA 3H45C 3QERA 4DG1A 4QS7A 3E66A 3U8XA 3K0SA 1HPMA 3WNFA 3AA4A 3AVLA 4LF4K 3TSUA 4JS5A 1D9FA 1DTTA 3H08A 3A5OC 4BRMA 1IKXA 1HJRA 1UA1A 4M42A 4Y0WA 1VQ5N 2QA4N 5C25A 3NBPA 4C8MA 1XC9A 3SCXA 4DR7K 4A62A 4FW2A 1EO1A 2FC0A 5J1EA 5FPNA 3DRSA 3MECA 2YKMA 4DUZK 3HK2A 1RILA 3O3HA 1WSJA 4KHPK 2P9PA 4BDZA 4JK8A 4LF7K 3DM2A 4IFVA 1Z25A 3CM5A 4DWIA 2JLEA 4J8FA 3IKMA 1C0MA 5I3UA 3PV8A 1Y64A 3AVBA 5KI6A 4DTMA 1NNEA 4IJAA 2HVIA 2VYPA 4Y1CA 4A57A 3VQQA 4FLZA 3UB5A 1QSYA 3RMAA 2HB5A 5KRSA 4IZ9A 4BC2A 5F1XA 4DMNA 1V4SA 3MK6A 4ISGA 2HSTA 3JS6A 4FJGA 3VEYA 1S5JA 3D2EB 2YHWA 5FRMA 1GLBG 4CJEA 4FJLA 3M5RA 5KPTA 2B5JA 3S3OA 1BHLA 4E7KA 2E20A 3K5LA 2Z1JA 3DLLL 2OTLN 5C2FA 3VEWA 4NXNK 4CEOA 1SKSA 5M1FA 1RT3A 4OKKA 5AFUA 1H1VA 2HBMA 4BRFA 4FJ9A 1NK8A 3HSTB 4FSVA 4U7BA 3OS2A 1BL3A 3O8MA 1DEJA 3B6OA 3RWUA 4ELUA 1U4BA 3AVKA 3SK3A 5C12A 2FF6A 4DR4K 3EY1A 3V81A 4PWDA 5TKYA 2VWBA 1I94K 4TSXA 1SL1A 4FK2A 1NOZA 5KQDA 1JXEA 3AVGA 3VEVA 3V9WA 3TR8A 2OPSA 3VF4A 2IOCA 5DK5A 1P90A 2WFBA 1IKWA 2IGIA 2QW9A 1RT6A 3J81O 4CVNE 3FZFA 3F9MA 3LPTA 4LSNA 3DXKB 3SAHA 1S9EA 5AQRA 4CBWA 1Q86O 4CEAA 3C94A 3WT0A 5AQFA 3TAEA 5JS2A 4CZHA 4YOTA 2HHTA 4JKEA 3B8AX 2QEXN 5FRNA 4PL8A 3CC2N 4K8ZA 3LDLA 2V52B 2O8BA 4DSJA 4A5AA 5BR9A 3TTDA 2HF3A 4JV5K 4YFUA 3THWA 1LV5A 3SUPA 3SUNA 4BR9A 4ILHA 3SJHA 2HNYA 2PYJA 1BISA 4YOWA 4B9VA 4DV4K 4DQRA 4H0VB 4B3RK 1RTHA 4FLXA 1FW6A 3FZHA 2F9TA 3A5MC 3WXJA 4A59A 5LMNK 4AQYK 2G8KA 1XUPO 4BDYA 3ZSWA 2D5RA 5TKWA 4RW7A 4DTPA 1NGEA 4JHDA 4AHRA 1KVBA 2DFHA 3ZYYX 5AQYA 4CERA 5F2RA 4BC5A 4JD2A 3HI0A 1TYQB 4JKFA 3ZT0A 3DOKA 4CF0A 4LFAK 1LW2A 3WEEA 5JMVA 4EP5A 5AFUH 2EWSA 5A2QO 4CHQA 4DR3K 2UXBK 1Z6RA 2Z1GA 4M3UA 4HTUA 5E84A 2ZQBA 3KKRA 1NGFA 2JGUA 3R6MA 4JKHA 3DWLA 4BQLA 3MEEA 3ZX0A 3VA3A 1VSHA 2WTUA 3ID8A 1NWKA 4CFCA 4IO8A 3NF8A 3VGMA 3ULDA 2W40A 5C0YA 3K5OA 3OBYA 3E01A 1RT7A 1N33K 4DTUA 2QKBA 4BE2A 2F9WA 4CF8A 2YCHA 4JNEA 4N5SA 4FWLA 4ISFA 2QI2A 2WONA 2GEMA 3O5BA 4X62K 4C8KA 4G9ZA 4KHUA 1XWLA 4QS8A 1ZBLA 5B8HA 4H8KA 1U2VA 5KGWA 2NNWA 3AVAA 1V4TA 4JKAA 4B9QA 1DKGD 1NK9A 4GV9A 3OYBA 4DTOA 2O4IA 1LCUA 4JLHA 5CZ2A 5E41A 2B6AA 4CEDA 1NBWA 4Z4FA 4K41A 4KV8A 1CXQA 4E1NA 1C0TA 2OYQA 4IDHA 3D2EA 4JI2K 3O4WA 1NMDA 3P38A 3ZCMA 4BY9C 2ASOA 3PY8A 4E1JA 1HR0K 1KVAA 3SMSA 4FJJA 1NGBA 5AQGA 2Y1IA 1WUAA 4F4KA 4IDKA 3THXA 4LF9K 1VQNN 4ISEA 3TPQA 2UXDK 1VQ9N 4YDUC 3TANA 1KTQA 3NH1A 2WC9A 3AO4A 2LSNA 1IKYA 4M3TA 4DV3K 4CIEA 5C15A 4C8NA 1U48A 5E26A 4GV6A 4CZFA 2GWJA 3CQ8A 2YJFA 3FZKA 2DTUA 1QQNA 1L3VA 4JKGB 5BR8K 1JL1A 2ZJRL 3AVHA 4B9NA 5GAGP 2F4VK 1JJ2M 3EZWA 3LDQA 1C1CA 1ATRA 3BF3A 3CI5A 4BG9A 3HT3A 3IAYA 5I9EB 4FZZA 2ZJQL 1WSFA 3LWLA 4BRIA 1K8KA 5AJ3K 4KHNA 2VG5A 1RT5A 3AVNA 3MN7A 3EE8A 4BVOA 1NGGA 4JHDB 3FZLA 5M1QA 2OTJN 4JRQA 1QQCA 4B8AB 3KJVA 4KRFA 3TSPA 5CHIA 2YHAA 4Q5VA 2RE2A 2VQFK 1U49A 5FROA 1LAVA 3CMEN 3EKSA 2XRIA 4HUGA 3CCEN 2D0OA 3G10A 3H1QA 4FWRA 1JCEA 3WQUA 4JAXA 3HPHA 1NJIO 2GTDA 4OX9K 3QEVA 3IMXA 4DV7K 3CQXA 3VQAA 4Z4GA 2FBTA 3UKUA 3TAGA 5HRNA 4F3OA 4GVEA 1E4GT 1ZC6A 3ITHA 4CHZA 4M3RA 3GG4A 4H5RA 3CPWM 3DLBA 2P9PB 4I6MB 4HCCA 2NLXA 5LJWA 3C6UA 4AM7A 3MWPA 4ILGB 1BQMA 2CGKA 2EX3A 4OPKA 2YHXA 3AARA 3O9TA 5EVZA 4BR5A 3O08A 4BVPA 3CD6N 2XY6A 4C1NI 3V9ZA 4B1WB 3AVJA 2PYLA 4CIFA 3BDPA 4E7LA 2W6LA 5AQQA 2KHOA 3R3LA 3SAGA 4N56A 5JS1A 1RFQA 5K14A 3L2WA 4JD2B 3IG1A 3OS0A 5BRDA 4CFAA 2ATQA 2W6KA 4H5TA 1DLOA 2PAVA 1J5EK 3PIPL 2YV0X 1KVCA 3I0RA 2IC3A 1S1VA 4KPYA 3PIOL 4BE0A 4JI1K 2E88A 1I3AA 1T8EA 4PKHA 4IG0A 1TV6A 4LF6K 4M41A 3ZSYA 3ISNC 2XY8A 2OA8A 3DAWA 4FJ5A 1Q9YA 1OVYA 2GX9A 3KZBA 4B9LA 4DSEA 5AQSA 5C10A 1BU6O 3SAFA 4DSLA 4W5QA 5CYQA 4CHNA 3AGKA 3VF2A 5CY4A 4KI6A 3P39A 3FZMA 3VTIA 1ZBFA 5AQIA 3THWB 2D0PA 4QAGA 2YI1A 4BROA 1BG3A 1IO2A 3CERA 1IJJA 1FJGK 4RW6A 3OS1A 4EZ6A 1RGIA 4DTRA 2NRZA 2O4GA 4YORA 3SQ1A 4OPJA 3MDQA 4XEIA 3I8DA 3J8AA 1MA9B 1T3VA 3RSEA 5HL7L 3NGZA 3DLKA 1NKEA 3ULEB 3KKSA 4KB0A 1A5WA 1RNHA 3RR7A 5HLFA 3DXKA 4BQZA 2RHKA 2YNHA 4M3ZA 4FWSA 4CCHA 1HX1A 2CH5A 1HPZA 1EKEA 4CJKA 3QICA 2I5JA 3F2KA 4YOVA 3DYAA 1OVQA 4JI5K 4GY2B 4DTJA 2DPNA 2P9IB 4AHTA 3BUZB 3LWMA 5IT9O 1NM1A 5HRSA 1XHXA 3M8QA 4LSLA 1BIUA 1BA0A 4CFDA 4KBOA 1OH8A 3CJBA 2PBDA 3BZCA 1NLVA 1ZBIA 3CCQN 2Q0RA 3LP0A 4H0YB 5AQTA 3HZ6A 1EP4A 4KO0A 3M1FA 2QWQA 1KC8O 4IOXA 3I55N 2ZF5O 3QFPA 2Q3SA 2UUCK 2DY4A 2NRHA 3CXCM 1GLEG 3N4PA 4CZIA 4H5WA 4IEEA 3OJUA 1ATNA 5J2QA 3IFRA 1SZ2A 1HNVA 1RBVA 2A42A 4LFBK 1O13A 3VQ8A 2F7TA 3T19A 1VSDA 1IH7A 1HRHA 4E7IA 3CCUN 3THYB 3MAQA 3OYAA 3K59A 3GBTA 4J2EA 3WNEA 4BC3A 1EX4A 1RTDA 4CGDA 4H4MA 5HRRA 3D7EO 1T6CA 2XHBA 2YNIA 1U04A 1KD1O 4FJHA 4BRLA 2V7YA 3HRGA 4ILJA 3TTFA 5DMRA 3E1YA 3OYKA 4O44A 3SYZA 1BCOA 1NK5A 4DCHA 2P1JA 4DS4A 1YVUA 1QHAA 4WFBL 1NG9A 3SUQA 1YIJN 1IBMK 3OA9A 1N34K 3W0LA 2HMIA 3FFKB 3BP8A 4LH5A 3V6DA 3F73A 4AF1A 2E5LK 4CK3A 2D0AA 3OHRA 1XHZA 3OYJA 3H3NO 1BOTO 3QB0A 5ADXH 2KKZA 3CJ7A 3LP3A 4CIGA 3PX0A 1NU0A 2E2QA 3NH0A 5J2NA 1LOTB 3A2FA 3PX4A 3HVTA 1HUXA 4FYDA 4FWOA 4BREA 4R79A 1BO5O 4CEFA 2OZSA 4H5VA 1BDGA 2GELA 3HVRA 4I2QA 3KLGA 3U9DA 4CJFA 3MEDA 2Q36A 3OY9A 4CZEA 1RDBA 1LWCA 1E4FT 3L3VA 5AZIA 4CESA 4EP4A 1X9MA 5J2PA 5HP1A 3SQ4A 5BRHA 3L4QA 4OLBA 1NGDA 5FDLA 4E7JA 4E89A 4XH5A 2PY5A 1X1PA 3T3FA 1VSFA 2QWPA 1Q7YO 4W5NA 3FGUA 3LP2A 5BRFA 3LPUA 1QHTA 3P83D 1TUYA 2HBLA 4WQ5A 3LDOA 1L3TA 2A5XA 1TVRA 2G8VA 4H0TB 3T1YK 1TUUA 2HBJA 4YOYA 4FOEA 1YHQN 1JL2A 4FJXA 1SL0A 3TAPA 1KQSM 2E2OA 1BUPA 2VGNA 3SBTA 4ID5A 2JWKA 2HHSA 3KLEA 3O6WA 1JLFA 3H1VX 2RPIA 4DHYA 4JKGA 1TKTA 4KB1A 1RTIA 4FJ7A 3K2PA 3LL3A 1JCGA 1ZBSA 3ENOA 2ZWHA 3I56N 4RWTA 3L6QA 3HYFA 4H03B 2RN2A 2QTDA 2FF3B 3SUOA 3EE9A 4DV1K 3LZIA 3VQBA 3AO2A 3ZX3A 4DV6K 3ATUA 2A1RA 3A0IX 3G71N 3THYA 4IXCA 1NKCA 3VQ4A 4JKBA 2QKKA 2E6LA 5EXWA 4DV5K 4LF5K 3D0PA 2VG7A 1JLAA 1S1TA 4BGBA 3MCAB 1TL1A 3EN9A 1NK6A 4LD0A 4EZ9A 2UUAK 3MEGA 3JSMA 4ZTFA 3G0ZA 1BQNA 3SQ2A 3VQDA 3A5NC 1S1XA 2OPRA 3K58A 1R59O 1HKBA 4OGEA 4B1XB 3KD1E 2HF4A 1U2VB 3DJCA 2V7ZA 5AQJA 3C0BA 3ZSQA 4BGAA 4PL7A 4GVMA 4FJIA 4KH5A 5ELZA 3NVKA 2HHXA 3OYGA 4Q0BA 1WB9A 5JLFA 2G8IA 1MWMA 4FLTA 4ICLA 4MLHA 1ASVA 5H1SQ 3BEXA 3M8PA 4DQPA 1TL3A 1Q9XA 3TI0A 2AA4A 4XH1A 4FWQA 1L5UA 4B9UA 1JCFA 3PO4A 3SPYA 3CQYA 5LMUK 3AA2A 1C1AA 4RW9A 3THXB 4FM0A 3RRHA 1VQ6N 1CZAN 2A1SA 3QNOA 3JAMO 1VQPN 1ZBUA 2QXLA 4EFHA 4EAHD 3HM9A 3QNNA 3QINA 3C6HA 5EY4A 3CMAN 4K8XA 3EYZA 2D0BA 4MO5A 4IKFA 3D6RA 3L0QA 3FLCO 3HL8A 3L2RA 4FLWA 1Z05A 3KIOA 3LDPA 4F9OA 3CFOA 2O8EB 2X78A 3KLIA 3V1QA 4X66K 4OO1J 4NB4A 2BH1A 3P5JA 3VQ7A 2O8DB 4DLEA 1Q18A 1TKXA 4CZMA 1TAUA 3OYEA 4CF9A 3VEZA 1NJZA 4FJNA 3U9ZA 1W9HA 1RDUA 3SV4A 5GAHP 5FLXO 3LM2A 2BGGA 5LJVA 2YJEA 1K6YA 2O8CA 3DLGA 5C24A 2HOEA 3U3YA 3I33A 4J2BA 3K5MA 4QCLA 1KFDA 4CJVA 3V9XA 2FSJA 1A5XA 4OKEA 4CJPA 3V9UA 2R7YA 3VTHA 1NJWA 1L3UA 4FZYA 4B08A 2O8BB 2G8WA 3GDQA 3LANA 4A61A 4CK2A 4AHCA 3M3ZA 3AO3A 1NGJA 1QTMA 4BWMA 4FLVA 2WBNA 3FFIA 3D45A 4OLAA 3ZT3A 4BRHA 3T1AA 1VSLA 1X9JA 2P5OA 4FCYA 4BRKA 1TYQA 4YOXA 1S6PA 3ZSVA 1YVNA 3CJ1A 4L8RB 1T03A 3LP1A 4CJTA 4DTSA 3AVFA 4B1VA 2GUPA 1XC3A 4LC9B 4DQ8A 2W42A 4BR4A 4HHTA 2EHGA 2ZJPL 4CEZA 1T05A 1K73O 1FKPA 2YHBA 2P9IA 3R9PA 2QXFA 3VETA 3KK1A 2B4JA 3UIQA 3UKUB 2HHUA 2P9LA 3WXMB 3KK7A 2QWOA 3F5TA 4PA1A 3TSQA 3VEXA 3CFRA 2UXCK 1RDAA 1HLUA 1O1WA 5GAEP 4F8RA 3ZEUA 4M7XA 3CC4N 5EX5A 1GOAA 2HNDA 2BANA 1OH5A 4EHTA 2KTQA 4CJQA 3J7YP 2ASPA 2ZD1A 1EXQA 2P51A 2W41A 5T7BA 1RTJA 4CFBA 3OYCA 3QEPA 2CGLA 5AQHA 3I8BA 1UAXA 1GOBA 1VSIA 4YY3K 3D2FA 1Y97A 4JN4A 3NVMA 1VK0A 2BDPA 1XMOK 1ITGA 2QM1A 4FWKA 1UWBA 4K0KK 1X9SA 3J80O 3DOLA 1S72N 2HVHA 2Y1JA 3H3OB 4CHPA 3KHYA 1XMQK 1XNQK 1WSEA 4R5PA 4DR6K 4B9SA 3BGRA 3ZSXA 3THVA 4FPBA 1C0UA 4B9TA 5D3GA 4O55A 1YI2N 3MMVA 4DTNA 4O5FA 1M90O 1BWFO 2NUBA 3U4LA 3VQ9A 3QBWA 1TK0A 5HRPA 2GWKA 3OVNA 3WNGA 1RT4A 3KWIA 1J5OA 2HHVA 1MWKA 3ZSRA 2KQ2A 3MX2A 4CW7B 3PO5A 2AP1A 4J2DA 5AR0A 2D4WA 1GLDG 3NGYA 4PUOA 3CCMN 4BG8A 4M3YA 4QS9A 1Q8IA 3G4SN 2RF2A 3OYNA 3NHGA 4CBUA 3RMCA 4B3MK 4FWPA 2I7NA 3OYLA 4IOAL 3HSCA 4GMJB 4JYAK 3DLRA 4RTFD 1A5VA 4FZXC 4H4OA 3O9UA 1G15A 4GKKK 2P9SB 4DFMA 2KFNA 1D4XA 1QQOA 3RVCA 3ZETB 3CJCA 4DV0K 1I39A 1BIZA 1W7AA 1T6DA 1JLCA 3A8YA 4NCGA 5AZJB 4BRCA 4IWVA 4DQQA 1LWFA 4CGFA 5HBMA 3LZJA 3M8RA 3RTVA 5AZIB 3NGIA 4JEPA 1NGHA 3K57A 3KK2A 1NGCA 4AHUA 1WAFA 2ITMA 4M7YA 2FBXA 2FXUA 3CHWA 3OBWA 3BZKA 1S3XA 3HPOA 1VRTA 5J2MA 2FSNA 1QE1A 4N47A 1K8AO 3CCLN 4FJMA 2OCEA 3I0SA 2XO7A 1HNIA 3VN5A 3HXMA 4W5TA 4RG8A 1F21A 3ATVA 3MN6A 1SL2A 3AAQA 5GIPA 3DRRA 2PFUA 1W97L 5F0XA 1YUWA 1HJOA 3W3DA 4CHOA 3U3GA 4H5NA 1U47A 3SZ2A 4KTQA 4KHQA 1FKOA 4KH6A 4CZJA 1HNZK 4Z4IA 3DRPA 2QWMA 1VQ7N 3ASMA 4YHHK 3QLHA 3S3MA 3QIPA 4MDAA 4BRPA 4CBXA 3SBGA 3QESA 1OKJA 3C95A 3VF6A 5M1KA 2HW3A 1P8ZA 3ZSOA 3L2QA 1LAWA 1QVFM 2HHQA 3QDKA 3Q7CA 4A2AA 5FPDA 4E3SA 3BF1A 2YHYA 1IG9A 3M6GA 4YDUA 3CPEA 3O9RA 1RBTA 2ZM6K 4RCHA 4DLGA 4KAZA 4J2AA 5AQXA 3CF5L 4K42A 1JXBA 1NJYA 1GLJO 1RDDA 2NZTA 1EWRA 3VEOA 4LY7A 3VQ5A 3LM9A 3T1HK 3MCPA 3R8EA 4HWIA 5AZJA 2P9NA 4HVJA 4Z0UA 2O8DA 3NF9A 3S9HA 4C1NK 1U6ZA 2P9KA 4CZLA 2AJQA 2OPPA 4B9MA 2YNFA 3ZX2A 5IWAK 5GINA 5AQMA 3TAFA 3AO1A 3O4NA 2HMPA 4EIAA 3TAQA 4W5RA 4ZHRA 1K8KB 1T7PA 2ETJA 3OYDA 4JKDA 2BE2A 2Z1IA 1HKGA 4M3WA 1SV5A 4CGGA 3QO9A 4IBNA 4WFAL 4PY5A 2BTFA 5DM6L 4JKCA 1C0FA 3WNHA 2GBZA 4BRQA 1QZ6A 3T7ZA 3AO5A 4UQGA 4FVMA 3TABA 3HPGA 4FK0A 1XI1A 2I7PA 3K9KA 2F96A 4OJRA 2UUBK 3SMPA 3QETA 4Z4CA 3EL2A 1XQSC 4M45A 4BRGA 4V19S 1WSIA 4DU4A 3TWHA 3DLHA 3AVMA 3HP6A 1WBDA 4JK9A 1VQ8N 4CEQA 1WSHA 4CEEA 1SAZA 4XIUA 4Z4HA 2GV9A 5GIOA 1DTQA 1D9DA 1YJNN 1SS6A 2JWLA 4BE1A 4L3QA 3SI6A 2XY7A 4DV2K 3CCSN 5SZTA 4NCAA 1BCMA 5M1OA 1SKWA 3PSFA 3GE1A 3RRGA 3J7ZO 2QWRA 4O4GA 3ULEA 3H46O 4BR0A 2IDOA 3DMJA 2KFZA 5GADP 2X74A 1BGXT 4K43A 1RBUA 4FVUA 2VWKA 1X3NA 2NRXA 4GW6A 1MDUB 4FOIA 1VQ4N 3RMDA 5JICA 3AVCA 4JI0K 1WLJA 4IG3A 1QVGM 4KH4A 2IVNA 4CGHA 4UY8O 5AQLA 1ATSA 5BPLA 4CJ5A 4CF2A 4O5BA 1Q81O 3OW2M 3MXIA 1U45A 1S9GA 1VSMA 4O0IA 4KREA 3HJFA 3TAMA 1S6QA 4DSIA 1ESVA 1R0AA 4FK4A 3QEIA 4CK1A 5KRTA 1QQMA 2HNZA 4JS4A 4WYBA 4KHYA 3H6EA 4E19A 4C8OA 1YXQA 2E4LA 4H0XB 2IAJA 3TTCA 3DI6A 2FLOA 4BWJA 2ZE2A 3WEEB 4W5OA 3UE5A 3ZT4A 3NH2A 1BI4B 2A41A 4NCBA 3C7NB 3OYFA 4E0DA 3WQTA 1GLAG 4CJ3A 2KLAA 2CGJA 2KW4A 4NYNA 3WUHA 3QBXA 5HROA 1WNSA 1UA0A 4WQ4C 4O8KA 1KCFA 1N36K 2NRWA 4IJNA 4B1YB 3SNNA 1QSLA 3HOTA 4LFCK 3QIOA 1CZ9A 2HHHK 4OKJA 3O9SA 5DM7L 1HQUA 3MWTA 1KSPA 2Q1NA 3CC7N 2YX6A 3L2VA 1RT2A 4YNQA 1K9MO 4NO7A 3RR8A 1C0GA 1CZBA 4PKGA 3NF7A 4CJRA 4FJKA 4CHYA 1BA1A 3ENBA 3SJJA 3VENA 4OPHA 2ZGZA 3S41A 4B8CA 4DF8A 2A40A 4DTXA 3VA0A 3PX6A 3ZETA 1B9DA 5AQPA 3VPZA 4DS5A 4BRDA 4O8UA 3NAEA 2P9SA 1N8RO 5LL6Z 4BDPA 5FPEA 1T44A 3HBTA 4F2RA 4B1ZA 1N6QA 1DT9A 3OTOK 1QZ5A 4QOZB 1UOCA 2X6NA 1YT3A 3E9OA 2HHWA 1NKBA
chains in the Genus database with same CATH topology
2P9LA 4J8FA 3IKMA 3WXMB 3ENHA 2P9UA 2QWOA 3DXMA 3F5TA 3DXKA 3KK7A 3TSQA 3VEXA 4BQZA 5AQUA 1Y64A 1HLUA 2RHKA 3NMUA 4IJAA 2VYPA 4FWSA 4A57A 1HX1A 3UB5A 5GAEP 2IVPA 3ZEUA 4M7XA 2CH6A 2CH5A 4IZ9A 4BC2A 5F1XA 3CC4N 1V4SA 5EX5A 3G6EN 3MK6A 4BC4A 4ISGA 2HSTA 3JS6A 3QICA 3VEYA 5AQZA 3F2KA 3D2EB 4YOVA 4EHTA 2YHWA 3UKRA 4GY2B 1GLBG 1ZXOA 2ASPA 2DPNA 2P9IB 5HOOA 3M5RA 2W41A 5KPTA 1VAZA 3L4IA 4MLEA 4IFEA 2E20A 3BUZB 2CGLA 1NM1A 5AQHA 4IEIA 3I8BA 5BN8A 3DLLL 2OTLN 5C2FA 3VEWA 3D2FA 4JN4A 1BA0A 3VESA 3NVMA 3E9PA 1YJ9N 4KBOA 4FWNA 3UKRB 2QM1A 3CJBA 4FWKA 4DKWA 1YAGA 2PBDA 3G25A 5M1FA 5AFUA 1S72N 4WQ4A 1H1VA 2HBMA 4BRFA 1GLCG 3H3OB 1KAYA 4BR2A 5KPZA 1NLVA 3KHYA 4FSVA 4U7BA 3O8MA 1DEJA 2BUPA 5AQNA 3CCQN 2Q0RA 4H0YB 2NRRA 5AQTA 4A2BA 4FPBA 3HZ6A 1J6ZA 5M1PA 4CZKA 3M1FA 2QWQA 3SK3A 3DXMB 2P9UB 5C12A 1KC8O 2FF6A 3VGLA 4IOXA 3I55N 1YI2N 2ZF5O 3HM8A 3QFPA 3MMVA 1YJWN 2E2PA 2NRHA 3RSEB 5TKYA 3E9LA 3CXCM 1GLEG 3N4PA 2VWBA 4O5FA 4H0PA 4H5WA 4IEEA 4CZIA 1M90O 1ATNA 1BWFO 3IFRA 1SZ2A 3U4LA 3QBWA 5C2DA 5BPNA 5KQDA 2A42A 3P4IA 1O13A 2GWKA 3VEVA 3VF4A 3KWIA 2F7TA 4CI6A 1P90A 2WFBA 3GOIA 1MWKA 3LDNA 3MX2A 2AP1A 4PHTX 2QW9A 5AR0A 2D4WA 3CCUN 1GLDG 3FZFA 3F9MA 3CCMN 3Q7BA 4BG8A 2QWNA 4QS9A 3DXKB 3SAHA 3GBTA 5AQRA 2H3GX 2P9NB 4CBWA 1Q86O 4BC3A 4FO0A 3G4SN 4M63C 3WT0A 5AQFA 4CBUA 3D7EO 4FWPA 1T6CA 2I7NA 4YOTA 3VMFB 4CZHA 5KQ8A 4IOAL 3HSCA 4BRAA 1KD1O 4JKEA 3B8AX 4CD3A 4IOCL 2QEXN 4HTLA 3IDHA 4PL8A 4BRLA 3CC2N 2V7YA 4RTFD 3HRGA 4ILJA 1G99A 3TTFA 1VQLN 3LDLA 2V52B 2Q2RA 3O1WA 3O9UA 2P9SB 3E1YA 2A6AA 4A5AA 4DCHA 3TTDA 4C23A 2HF3A 5BR9A 1D4XA 5CR4A 1QQOA 3CCVN 3RVCA 3ZETB 3AGRA 1QHAA 3CJCA 4WFBL 4BR9A 3KVGA 1T6DA 1YIJN 4ILHA 3SJHA 3A8YA 3OA9A 5AZJB 4BRCA 4CD1A 3W0LA 4IWVA 3FFKB 3BP8A 4YOWA 3VERA 5AZIB 4H0VB 4JEPA 4MO4A 1NGHA 4AF1A 1NGCA 3OHRA 3H3NO 1KXPA 1BOTO 3QB0A 2ITMA 3FZHA 3EKUA 4M7YA 2FXUA 3CHWA 2F9TA 3A5MC 3OBWA 1NGIA 5ADXH 2KKZA 1S3XA 3CJ7A 1DGKN 5KPRA 2FSNA 3WXJA 4A59A 1K8AO 4WQ5C 1VQON 2D1KA 3CCLN 1XUPO 2E2QA 1LOTB 2QWLA 3IUCA 3CCRN 1HUXA 5TKWA 1NGAA 4FWOA 4BREA 4R79A 4FL9A 1BO5O 3ATVA 4H5VA 3MN6A 1NGEA 4JHDA 1BDGA 2E1YA 3AAQA 3ZYYX 5GIPA 5AQYA 2GELA 2PFUA 1W97L 3U9DA 5F2RA 4BC5A 5F0XA 2Q36A 4JD2A 3HI0A 5AQKA 1TYQB 4JKFA 4CZEA 4I6MA 1YUWA 3CCJN 1E4FT 1HJOA 5AZIA 3W3DA 3AAPA 3WEEA 5JMVA 5AFUH 2EWSA 4H5NA 3P31A 3FR0A 3K9JA 5BRHA 3C65A 3L4QA 1Z6RA 1NGDA 4KH6A 3CJ9A 4CZJA 5E84A 4XH5A 2QWMA 1VQ7N 1NGFA 2WUSA 3R6MA 4JKHA 4K25A 2QWPA 3DWLA 3EO3A 4BQLA 4DB3A 3FGUA 1Q7YO 4MDAA 4BRPA 4CBXA 3ZX0A 3SBGA 5BRFA 3ID8A 1NWKA 4GNIA 1OKJA 2IIRA 3VF6A 5M1KA 4IO8A 1P8ZA 3CIPA 3QMLA 1TUYA 3VGMA 1QVFM 3QDKA 3Q7CA 4A2AA 5FPDA 2W40A 2HBLA 4WQ5A 5C0YA 3BF1A 3OBYA 1W2BM 3LDOA 2YHYA 3M6GA 4YDUA 4PKIA 2A5XA 3CPEA 3O9RA 4RCHA 3C7NA 4H0TB 5AQXA 3CF5L 4K42A 5BN9A 4GV3A 1KAXA 1TUUA 2F9WA 5MLCQ 2YCHA 2HBJA 2NRVA 4FOEA 4JNEA 4YOYA 1GLJO 4FWLA 4ISFA 2NZTA 1YHQN 3VEOA 3LM9A 2QI2A 5EOYA 2GEMA 3O5BA 3MN9A 3MCPA 3R8EA 4HWIA 1KQSM 4G9ZA 5AZJA 2P9NA 4QS8A 4CJ7A 3HOSA 1GLLO 2E2OA 2HBKA 5B8HA 1BUPA 2VGNA 3SBTA 2JWKA 4C1NK 1U2VA 1U6ZA 2NNWA 2P9KA 4CZLA 1SQKA 3O6WA 1V4TA 3N4QA 3H1VX 4JKAA 4DHYA 4JKGA 4B9QA 3ZX2A 1DKGD 4BRNA 5GINA 1IG8A 5AQMA 3GL1A 4GV9A 5FPMA 1LCUA 2HMPA 4A5BA 4EIAA 3LL3A 4AM6A 1JCGA 1K8KB 1NBWA 1ZBSA 2Q31A 4K41A 1RDWX 3ENOA 2ZWHA 3I56N 4RWTA 4JKDA 3L6QA 4H03B 3QFUA 2QTDA 2FF3B 1HKGA 4IDHA 3EE9A 3D2EA 1X3MA 2Q97A 3O4WA 1YITN 1NMDA 5ADXA 4WFAL 3P38A 3ZX3A 2BTFA 4BY9C 5DM6L 4JKCA 4MDBA 2ASOA 3ATUA 1C0FA 4FWMA 4E1JA 3A0IX 3G71N 3SMSA 1NGBA 4BRQA 1QZ6A 4IXCA 5AQGA 3T7ZA 1WUAA 5M1NA 4XH4A 1M1KO 4NLCA 1VQNN 4ISEA 4JKBA 2I7PA 3TPQA 3K9KA 4YDUC 1VQ9N 3R1XA 1EQYA 5EXWA 2WC9A 3SMPA 5C15A 3C6AA 3O9QA 3MCAB 4BGBA 1S22A 1XQSC 3EL2A 5AQWA 4BRGA 3TU5A 4FPAA 3EN9A 3D2FB 5E26A 4GV6A 2VCPA 3O80A 4CZFA 2GWJA 4H0OA 2YJFA 3MN5A 4JK9A 1VQ8N 3FZKA 1SAZA 1QQNA 3A5NC 4JKGB 2ZJRL 1R59O 1HKBA 3WXKA 4B1XB 5GIOA 5GAGP 2HF4A 1YJNN 1SS6A 1U2VB 2P9KB 3DJCA 2JWLA 4IO9L 1JJ2M 4L3QA 2E1ZA 2FSKA 3EZWA 3LDQA 4BG9A 1ATRA 2V7ZA 3BF3A 3CI5A 5AQJA 5AQVA 3CCSN 5I9EB 3ZEUB 2P9LB 3C0BA 2IVOA 4BGAA 1HKCA 4PL7A 3SLCA 3NVKA 4KH5A 5ELZA 5M1OA 3CETA 4WCEL 2ZJQL 3KWGA 5JLFA 4BRIA 2J4RA 1MWMA 3GE1A 4YOUA 1VQMN 3J7ZO 1K8KA 2QWRA 4MLHA 3MN7A 3EE8A 3H46O 3ULEA 5H1SQ 4BVOA 1GLFO 1NGGA 3BEXA 3FZLA 4JHDB 5M1QA 2OTJN 2A3ZA 4BR0A 5BPMA 5GADP 3TSPA 5CHIA 2RE2A 4K43A 3A5LC 2AA4A 4XH1A 3CMEN 4FWQA 4FVUA 3EKSA 1JCFA 1X3NA 3CCEN 2D0OA 3CQYA 2NRXA 2NRTA 1MDUB 2V51B 4FOIA 3H1QA 4FWRA 1JCEA 1VQ4N 3WQUA 4JAXA 5JICA 1VQ6N 1CZAN 1NJIO 1KAZA 2GTDA 3PLAA 1QVGM 4KH4A 2IVNA 3IMXA 4UY8O 5AQLA 1ATSA 5BREA 1VQPN 5BPLA 2QXLA 3CQXA 4EFHA 4EAHD 2OANA 3WXLA 3C6HA 3UKUA 1Q81O 5EY4A 3CMAN 4GVEA 1E4GT 1ZC6A 3GG4A 3OW2M 4H5RA 4EHUA 4Z94A 2E2NA 3CPWM 2P9PB 4I6MB 2NLXA 4MO5A 5LJWA 4OPAA 3D6RA 3L0QA 3JXUA 3FLCO 1ESVA 3FE1A 4AM7A 3MWPA 4ILGB 1YF5L 1ILYA 2CGKA 1QQMA 2YHXA 3AARA 1Z05A 3O9TA 5EVZA 4BR5A 3MX5A 3LDPA 4WYBA 3O08A 4BVPA 4WFNL 3CD6N 4C1NI 4F9OA 2ASMA 1VQKN 3H6EA 2E8AA 1YXQA 4B1WB 2VGMA 4OO1J 4H0XB 2BH1A 4NB4A 3TTCA 4U67L 2FLOA 1Q18A 4CZMA 3WEEB 5JLHA 3UE5A 3VEZA 1Q82O 5AQQA 2KHOA 3HTVA 3R3LA 4JK7A 3U9ZA 4B1UB 2ZGYA 4WF9L 3SAGA 2A41A 1RDUA 1RFQA 4JD2B 3C7NB 5BRDA 5LY3A 5GAHP 3LM2A 3O1BA 3WQTA 5LJVA 4H5TA 1GLAG 2PAVA 2YJEA 4NLBA 2KLAA 2CGJA 3ID6A 3PIPL 3VOVA 3WUHA 3QBXA 2Q0UA 4CZGA 3AY9A 5JVGL 2HOEA 1WOQA 3CJAA 3I33A 4WQ4C 5JVHL 3T69A 3VGKA 3WXIA 4O8KA 3PIOL 5CE3A 2E88A 2FSJA 4PKHA 4BR7A 2NRWA 4IJNA 2UYTA 5AQOA 4B1YB 3VTHA 3H45C 4QS7A 3E66A 3U8XA 3HOTA 3GDQA 3DAWA 1HPMA 3O9SA 4A61A 5DM7L 3MWTA 3M3ZA 1OVYA 2GX9A 1NGJA 2Q1NA 3KZBA 2YX6A 3CC7N 3TSUA 2WBNA 4NO7A 1K9MO 3A5OC 4BRMA 1C0GA 5AQSA 4BRHA 1X9JA 5C10A 1BU6O 4BRKA 1TYQA 4PKGA 3SAFA 4YOXA 4Y0WA 1VQ5N 2QA4N 1BA1A 1YVNA 3CJ1A 3ENBA 3VENA 4OPHA 2ZGZA 3AGKA 3S41A 3VF2A 3P39A 3FZMA 3VTIA 2A40A 5AQIA 3ZETA 5AQPA 2D0PA 3VPZA 4A62A 1EO1A 4B1VA 4BRDA 2GUPA 1XC3A 2YI1A 4LC9B 4O8UA 5FPNA 4BROA 4DQ8A 4BR4A 2P9SA 1BG3A 1N8RO 5FPEA 2ZJPL 1T44A 3HBTA 3CERA 4B1ZA 1IJJA 1DT9A 1QZ5A 1K73O 1RGIA 2NRZA 2P9PA 4YORA 4JK8A 3E9OA 3MDQA 4XEIA 3J8AA 1MA9B 1T3VA 2P9IA 3RSEA 5HL7L 3R9PA 3VETA 3ULEB 3UKUB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P9L A;  4J8F A;  3ENH A;  2P9U A;  2QWO A;  3DXM A;  3DXK A;  3VEX A;  4BQZ A;  5AQU A;  1Y64 A;  1HLU A;  4IJA A;  2VYP A;  4FWS A;  1HX1 A;  3UB5 A;  2IVP A;  3ZEU A;  4M7X A;  2CH6 A;  2CH5 A;  4IZ9 A;  4BC2 A;  5F1X A;  1V4S A;  5EX5 A;  3MK6 A;  4BC4 A;  4ISG A;  3JS6 A;  3QIC A;  3VEY A;  5AQZ A;  3D2E B;  4EHT A;  2YHW A;  3UKR A;  4GY2 B;  1GLB G;  1ZXO A;  2ASP A;  2DPN A;  2P9I B;  2W41 A;  5KPT A;  3L4I A;  4MLE A;  2E20 A;  3BUZ B;  2CGL A;  1NM1 A;  5AQH A;  3I8B A;  5BN8 A;  3VEW A;  3D2F A;  4JN4 A;  1BA0 A;  3VES A;  4KBO A;  4FWN A;  3UKR B;  2QM1 A;  3CJB A;  4FWK A;  1YAG A;  2PBD A;  3G25 A;  5AFU A;  4WQ4 A;  1H1V A;  4BRF A;  1GLC G;  3H3O B;  1KAY A;  4BR2 A;  5KPZ A;  1NLV A;  3KHY A;  4FSV A;  3O8M A;  1DEJ A;  2BUP A;  5AQN A;  2Q0R A;  4H0Y B;  5AQT A;  4A2B A;  4FPB A;  3HZ6 A;  1J6Z A;  4CZK A;  3M1F A;  2QWQ A;  3SK3 A;  3DXM B;  2P9U B;  2FF6 A;  3VGL A;  2ZF5 O;  3HM8 A;  3QFP A;  3MMV A;  2E2P A;  2NRH A;  3RSE B;  5TKY A;  1GLE G;  4CZI A;  2VWB A;  4O5F A;  4H0P A;  4H5W A;  1ATN A;  1BWF O;  3IFR A;  1SZ2 A;  3U4L A;  3QBW A;  5BPN A;  5KQD A;  2A42 A;  3P4I A;  2GWK A;  3VEV A;  3VF4 A;  4CI6 A;  3GOI A;  1MWK A;  3LDN A;  2AP1 A;  2QW9 A;  5AR0 A;  2D4W A;  1GLD G;  3FZF A;  3F9M A;  4BG8 A;  2QWN A;  4QS9 A;  3DXK B;  3GBT A;  5AQR A;  2H3G X;  2P9N B;  4CBW A;  4BC3 A;  4FO0 A;  4M63 C;  3WT0 A;  5AQF A;  4CBU A;  3D7E O;  4FWP A;  1T6C A;  2I7N A;  4CZH A;  5KQ8 A;  3HSC A;  4BRA A;  4CD3 A;  3B8A X;  4HTL A;  3IDH A;  4PL8 A;  4BRL A;  2V7Y A;  4RTF D;  1G99 A;  3LDL A;  2V52 B;  2Q2R A;  3O1W A;  2P9S B;  2A6A A;  5BR9 A;  4DCH A;  4C23 A;  2HF3 A;  1D4X A;  1QQO A;  3ZET B;  3CJC A;  1QHA A;  4BR9 A;  3KVG A;  1T6D A;  3SJH A;  3A8Y A;  5AZJ B;  4BRC A;  4CD1 A;  3W0L A;  4IWV A;  3FFK B;  3BP8 A;  3VER A;  5AZI B;  4H0V B;  4MO4 A;  1NGH A;  1NGC A;  3OHR A;  3H3N O;  1KXP A;  1BOT O;  3QB0 A;  2ITM A;  3FZH A;  3EKU A;  4M7Y A;  2FXU A;  3CHW A;  2F9T A;  3A5M C;  5ADX H;  1NGI A;  1S3X A;  3CJ7 A;  1DGK N;  5KPR A;  2FSN A;  3WXJ A;  4WQ5 C;  2D1K A;  1XUP O;  2E2Q A;  1LOT B;  2QWL A;  3IUC A;  1HUX A;  1NGA A;  4FWO A;  4BRE A;  4FL9 A;  1BO5 O;  3ATV A;  4H5V A;  3MN6 A;  1NGE A;  4JHD A;  1BDG A;  2E1Y A;  3AAQ A;  5AQY A;  2GEL A;  3U9D A;  5F2R A;  4BC5 A;  5F0X A;  2Q36 A;  4JD2 A;  3HI0 A;  5AQK A;  1TYQ B;  4CZE A;  4I6M A;  1YUW A;  1E4F T;  1HJO A;  5AZI A;  3W3D A;  3AAP A;  3WEE A;  5JMV A;  5AFU H;  2EWS A;  4H5N A;  3FR0 A;  5BRH A;  1Z6R A;  1NGD A;  3CJ9 A;  4CZJ A;  5E84 A;  4XH5 A;  2QWM A;  1NGF A;  2WUS A;  3R6M A;  4K25 A;  2QWP A;  3DWL A;  3EO3 A;  4BQL A;  4DB3 A;  3FGU A;  4BRP A;  4CBX A;  3ZX0 A;  5BRF A;  3ID8 A;  1NWK A;  4GNI A;  1OKJ A;  2IIR A;  3VF6 A;  4IO8 A;  1P8Z A;  3CIP A;  3QML A;  1TUY A;  3VGM A;  3QDK A;  4A2A A;  5FPD A;  2W40 A;  4WQ5 A;  3BF1 A;  3LDO A;  2YHY A;  3M6G A;  4YDU A;  4PKI A;  2A5X A;  4RCH A;  3C7N A;  4H0T B;  5AQX A;  4K42 A;  5BN9 A;  1KAX A;  1TUU A;  2F9W A;  2YCH A;  4JNE A;  4FOE A;  1GLJ O;  4FWL A;  4ISF A;  2NZT A;  3VEO A;  3LM9 A;  5EOY A;  2GEM A;  3O5B A;  3MN9 A;  3MCP A;  3R8E A;  4HWI A;  5AZJ A;  2P9N A;  4QS8 A;  4CJ7 A;  1GLL O;  2E2O A;  5B8H A;  1BUP A;  1U2V A;  1U6Z A;  2P9K A;  4CZL A;  1SQK A;  3O6W A;  1V4T A;  3H1V X;  4DHY A;  4B9Q A;  3ZX2 A;  1DKG D;  4BRN A;  1IG8 A;  5AQM A;  3GL1 A;  5FPM A;  1LCU A;  2HMP A;  4EIA A;  3LL3 A;  4AM6 A;  1JCG A;  1K8K B;  1NBW A;  1ZBS A;  2Q31 A;  4K41 A;  1RDW X;  3ENO A;  2ZWH A;  4RWT A;  3L6Q A;  4H03 B;  3QFU A;  2FF3 B;  1HKG A;  3D2E A;  1X3M A;  2Q97 A;  3O4W A;  1NMD A;  5ADX A;  3ZX3 A;  2BTF A;  2ASO A;  3ATU A;  1C0F A;  4FWM A;  4E1J A;  3A0I X;  3SMS A;  1NGB A;  4BRQ A;  1QZ6 A;  4IXC A;  5AQG A;  1WUA A;  4XH4 A;  4ISE A;  2I7P A;  3TPQ A;  4YDU C;  1EQY A;  5EXW A;  3SMP A;  4BGB A;  1S22 A;  1XQS C;  3EL2 A;  5AQW A;  4BRG A;  3TU5 A;  4FPA A;  3EN9 A;  3D2F B;  5E26 A;  2VCP A;  3O80 A;  4CZF A;  2GWJ A;  4H0O A;  2YJF A;  3MN5 A;  3FZK A;  1SAZ A;  1QQN A;  3A5N C;  1R59 O;  1HKB A;  3WXK A;  4B1X B;  2HF4 A;  1U2V B;  2P9K B;  3DJC A;  4L3Q A;  2E1Z A;  2FSK A;  3EZW A;  3LDQ A;  4BG9 A;  1ATR A;  2V7Z A;  3BF3 A;  3CI5 A;  5AQJ A;  5AQV A;  5I9E B;  3ZEU B;  2P9L B;  3C0B A;  2IVO A;  4BGA A;  1HKC A;  4PL7 A;  3SLC A;  5ELZ A;  3CET A;  5JLF A;  4BRI A;  2J4R A;  1MWM A;  3GE1 A;  1K8K A;  2QWR A;  4MLH A;  3MN7 A;  3ULE A;  3H46 O;  4BVO A;  1GLF O;  1NGG A;  3BEX A;  3FZL A;  4JHD B;  2A3Z A;  4BR0 A;  5BPM A;  4K43 A;  3A5L C;  2AA4 A;  4XH1 A;  4FWQ A;  3EKS A;  1JCF A;  1X3N A;  2D0O A;  3CQY A;  1MDU B;  2V51 B;  4FOI A;  3H1Q A;  4FWR A;  1JCE A;  3WQU A;  4JAX A;  5JIC A;  1CZA N;  1KAZ A;  2GTD A;  2IVN A;  3IMX A;  5AQL A;  1ATS A;  5BRE A;  5BPL A;  2QXL A;  3CQX A;  4EFH A;  4EAH D;  2OAN A;  3WXL A;  3UKU A;  5EY4 A;  1E4G T;  1ZC6 A;  3GG4 A;  4H5R A;  4EHU A;  4Z94 A;  2E2N A;  2P9P B;  4I6M B;  2NLX A;  4MO5 A;  5LJW A;  3L0Q A;  3JXU A;  3FLC O;  1ESV A;  3FE1 A;  4AM7 A;  2CGK A;  1QQM A;  2YHX A;  3AAR A;  1Z05 A;  5EVZ A;  4BR5 A;  3LDP A;  4WYB A;  3O08 A;  4BVP A;  4F9O A;  2ASM A;  3H6E A;  2E8A A;  1YXQ A;  4B1W B;  4H0X B;  4NB4 A;  2FLO A;  1Q18 A;  4CZM A;  3WEE B;  5JLH A;  3UE5 A;  3VEZ A;  5AQQ A;  2KHO A;  3HTV A;  4B1U B;  3U9Z A;  2ZGY A;  2A41 A;  1RFQ A;  4JD2 B;  3C7N B;  5BRD A;  5LY3 A;  3LM2 A;  3O1B A;  3WQT A;  5LJV A;  4H5T A;  1GLA G;  2PAV A;  2YJE A;  2CGJ A;  3VOV A;  3WUH A;  3QBX A;  2Q0U A;  4CZG A;  3AY9 A;  2HOE A;  1WOQ A;  3CJA A;  3I33 A;  4WQ4 C;  3VGK A;  3WXI A;  4O8K A;  5CE3 A;  2E88 A;  2FSJ A;  4PKH A;  4BR7 A;  4IJN A;  2UYT A;  5AQO A;  4B1Y B;  3H45 C;  4QS7 A;  3U8X A;  3GDQ A;  3DAW A;  1HPM A;  4A61 A;  3M3Z A;  3KZB A;  2Q1N A;  1NGJ A;  4NO7 A;  3A5O C;  4BRM A;  1C0G A;  5AQS A;  4BRH A;  1X9J A;  1BU6 O;  4BRK A;  1TYQ A;  4PKG A;  4Y0W A;  1BA1 A;  1YVN A;  3CJ1 A;  3VEN A;  2ZGZ A;  3VF2 A;  3S41 A;  3FZM A;  2A40 A;  5AQI A;  3ZET A;  5AQP A;  2D0P A;  3VPZ A;  4A62 A;  4B1V A;  4BRD A;  2GUP A;  1XC3 A;  2YI1 A;  4LC9 B;  5FPN A;  4BRO A;  4DQ8 A;  4BR4 A;  2P9S A;  1BG3 A;  5FPE A;  1T44 A;  3HBT A;  3CER A;  4B1Z A;  1IJJ A;  1QZ5 A;  1RGI A;  2P9P A;  3MDQ A;  4XEI A;  3J8A A;  1MA9 B;  2P9I A;  3RSE A;  3R9P A;  3VET A;  3ULE B;  3UKU B; 
#chains in the Genus database with same CATH topology
 4AHV A;  3ENH A;  2P9U A;  3DXM A;  4RW8 A;  1OH7 A;  3B6P A;  5AQU A;  1NK4 A;  2IS3 A;  2ITG A;  3NMU A;  1S1U A;  1NMN A;  2IVP A;  4KI4 A;  1JLQ A;  1X9W A;  2CH6 A;  3G6E N;  4BC4 A;  5AQZ A;  4G1Q A;  1RBR A;  3UKR A;  2O8F A;  1ZXO A;  5HOO A;  1VAZ A;  3L4I A;  4MLE A;  4IFE A;  1N32 K;  5CZ1 A;  4JRP A;  3KD5 E;  4IEI A;  5BN8 A;  2D0C A;  3VES A;  4DFP A;  3LAL A;  5C42 A;  3E9P A;  4N41 A;  1YJ9 N;  1CLQ A;  3UKR B;  4FWN A;  4DKW A;  1WBB A;  2O8F B;  4F3T A;  3VQC A;  1YAG A;  3G25 A;  3QEW A;  4WQ4 A;  1GLC G;  2FBV A;  2OZM A;  4Y1D A;  1KAY A;  4BR2 A;  5KPZ A;  1KLM A;  4IFY A;  2BUP A;  1HYV A;  1NJX A;  3CFP A;  1NK7 A;  5AQN A;  3TAR A;  2NRR A;  4M3X A;  4A2B A;  2QK9 A;  1ZYQ A;  1E3M A;  1J6Z A;  5M1P A;  3ZT1 A;  4CZK A;  4F2S A;  3DXM B;  2P9U B;  3NE6 A;  3O4Q A;  3VGL A;  4CJ4 A;  3HM8 A;  4HCB A;  4DU1 A;  1RBS A;  4CEB A;  4JI7 K;  1YJW N;  2E2P A;  3RSE B;  3E9L A;  4H0P A;  2FBY A;  2YKN A;  3BY5 A;  5CYM A;  5C2D A;  5BPN A;  3P4I A;  1YTA A;  4KTW A;  4I9L A;  1NK0 A;  4CI6 A;  3GOI A;  3LDN A;  4ELT A;  4PHT X;  4DF4 A;  4X64 K;  5I42 A;  2P5G A;  1Z26 A;  2O8C B;  3Q7B A;  2QWN A;  3V9S A;  4LH4 A;  4MFB A;  1GOC A;  4CJS A;  4DU3 A;  2H3G X;  4DQI A;  2P9N B;  2X6S A;  4FO0 A;  4B3S K;  3MXJ A;  4M63 C;  3VQ6 A;  1RDC A;  3VMF B;  5KQ8 A;  4B3T K;  4BRA A;  4CEC A;  4CD3 A;  4IOC L;  4HTL A;  3IDH A;  1NOY A;  3IS9 A;  4DFJ A;  1REV A;  1G99 A;  4FLY A;  1VQL N;  3O1W A;  2Q2R A;  4DFK A;  4CGI A;  4DSK A;  2O8E A;  2A6A A;  4JI4 K;  4C23 A;  3V1R A;  1HYS A;  5CR4 A;  1EWQ A;  3CCV N;  3AGR A;  3AVI A;  3ZSZ A;  3KVG A;  4FXD A;  2G8F A;  4CD1 A;  3ZLJ A;  4X65 K;  3VER A;  4MO4 A;  4KTZ A;  1KXP A;  1BI4 A;  3EKU A;  3SV3 A;  1NGI A;  3EZ5 A;  1HMV A;  4DSF A;  1DGK N;  3CG7 A;  1YTU A;  5KPR A;  1L3S A;  3ALY A;  4DUY K;  4CGJ A;  4WQ5 C;  1VQO N;  2D1K A;  2G8U A;  1J53 A;  1VSK A;  2QWL A;  3CYM A;  3IUC A;  1SUQ A;  3CCR N;  3KLH A;  4ZTJ A;  4E1M A;  4FJ8 A;  1NGA A;  4FL9 A;  1IKV A;  4WE1 A;  2E1Y A;  1KLN A;  5KGX A;  5AQK A;  3M8S A;  1KRP A;  3CM6 A;  4I6M A;  3OYI A;  3CCJ N;  1TAQ A;  4GKJ K;  1J9A A;  4CJU A;  3ZT2 A;  4JI6 K;  2Z1H A;  1WAJ A;  3AAP A;  3P31 A;  3FR0 A;  3K9J A;  1N5Y A;  3C65 A;  1RCH A;  3CJ9 A;  1D8Y A;  1KFS A;  3MXM A;  3HO1 A;  3L2U A;  2WUS A;  4K25 A;  3HP9 A;  3EO3 A;  4DB3 A;  4AH9 A;  3IRX A;  1HNX K;  1IBK K;  4GNI A;  1VRU A;  2IIR A;  3DLE A;  3CIP A;  3QML A;  3LDS A;  3L8B A;  1MU2 A;  4RW4 A;  1W2B M;  3NCI A;  4PKI A;  4OVL A;  3C7N A;  4N76 A;  4LF8 K;  2KZZ A;  5BN9 A;  4GV3 A;  1KAX A;  5MLC Q;  2NRV A;  4I9Q A;  1VHX A;  5EOY A;  4AIL C;  3MN9 A;  1JLG A;  3HOS A;  4CJ7 A;  1GLL O;  2HBK A;  4B3O A;  2RKI A;  1ASW A;  2GUI A;  3QEX A;  1S1W A;  1SQK A;  3K5N A;  3EEQ A;  3N4Q A;  1VSJ A;  2WOM A;  2OPQ A;  4BRN A;  1FXX A;  1IG8 A;  3GL1 A;  1SKR A;  2UU9 K;  3KLF A;  3KK3 A;  1D5A A;  5FPM A;  4A5B A;  3VQE A;  4AM6 A;  2Q31 A;  1JKH A;  1RDW X;  3QFU A;  1IV0 A;  3J7A P;  1X3M A;  2Q97 A;  4CJW A;  1YIT N;  5ADX A;  2F8T A;  4MDB A;  4OGC A;  4FWM A;  1IBL K;  5M1N A;  4XH4 A;  1M1K O;  4BAC A;  4C8L A;  4NLC A;  4FM2 A;  1TK5 A;  3S3N A;  3R1X A;  1EQY A;  3C6A A;  3O9Q A;  4NYF A;  1S22 A;  5AQW A;  3L3U A;  4ELV A;  3TU5 A;  4FPA A;  3D2F B;  4HUE A;  3AA5 X;  2VCP A;  3O80 A;  2DFE A;  5EU7 A;  1WN7 A;  4H0O A;  3SPZ A;  3MN5 A;  1LW0 A;  4NXM K;  1B92 A;  3WXK A;  1TKZ A;  1ASU A;  2P9K B;  4IO9 L;  4Z4E A;  3SQ0 A;  2E1Z A;  2FSK A;  4FW1 A;  3PSI A;  4DQS A;  2E6M A;  5AQV A;  3KTQ A;  3ZEU B;  2P9L B;  2IVO A;  1HKC A;  4KKO A;  1JLE A;  3SLC A;  4MQ3 A;  3CET A;  4KFB A;  4WCE L;  3KWG A;  2J4R A;  3VQP A;  4YOU A;  4FLU A;  1VQM N;  4JI8 K;  1C6V A;  3AV9 A;  1W0H A;  3NF6 A;  1GLF O;  1CXU A;  2A3Z A;  2VWJ A;  5BPM A;  3V1O A;  4DR5 K;  1QSS A;  3A5L C;  1QS4 A;  1HYZ A;  4DR1 K;  4ID1 A;  1XNR K;  2NRT A;  2V51 B;  3NFA A;  4DR2 K;  4I2P A;  2XY5 A;  3AA3 A;  1J54 A;  1KAZ A;  1ZBH A;  2VQE K;  1HNW K;  3PLA A;  5BRE A;  2G8H A;  1JLB A;  2OAN A;  1C1B A;  3WXL A;  3U6F A;  1TK8 A;  2F8S A;  3P1G A;  3RMB A;  2PZS A;  1TGO A;  4EHU A;  4Z94 A;  1TKD A;  1VSE A;  2E2N A;  4KHS A;  4OPA A;  4HUF A;  3JXU A;  3O3G A;  3FE1 A;  1HQE A;  2KZM A;  1YF5 L;  1ILY A;  2DFF A;  3JYT A;  5KTQ A;  3O3F A;  4WFN L;  3MX5 A;  3OJS A;  3NDK A;  2ASM A;  1VQK N;  4O0J A;  2E8A A;  3OYM A;  1RT1 A;  2VGM A;  4JI3 K;  4U67 L;  4I7F A;  4E7H A;  1EET A;  2VG6 A;  5JLH A;  4AHS A;  1Q82 O;  3V4I A;  3PUF A;  4PQU A;  3HTV A;  4JK7 A;  4B1U B;  1WSG A;  3C6T A;  2ZGY A;  4WF9 L;  3OYH A;  1LWE A;  5LY3 A;  3O1B A;  4NLB A;  3ID6 A;  4CF1 A;  3VOV A;  2Q0U A;  4CZG A;  1B9F A;  3AY9 A;  5JVG L;  1WOQ A;  3CJA A;  4CJL A;  5JVH L;  3T69 A;  3VGK A;  3WXI A;  1OH6 A;  3F9K A;  5SWM A;  5CE3 A;  4BR7 A;  4FM1 A;  3LAK A;  1FK9 A;  4CE9 A;  4KHW A;  2UYT A;  5AQO A;  3LAM A;  2YNG A;  3H45 C;  3QER A;  4DG1 A;  4QS7 A;  3E66 A;  3U8X A;  3K0S A;  1HPM A;  3WNF A;  3AA4 A;  3AVL A;  4LF4 K;  3TSU A;  4JS5 A;  1D9F A;  1DTT A;  3H08 A;  3A5O C;  4BRM A;  1IKX A;  1HJR A;  1UA1 A;  4M42 A;  4Y0W A;  1VQ5 N;  2QA4 N;  5C25 A;  3NBP A;  4C8M A;  1XC9 A;  3SCX A;  4DR7 K;  4A62 A;  4FW2 A;  1EO1 A;  2FC0 A;  5J1E A;  5FPN A;  3DRS A;  3MEC A;  2YKM A;  4DUZ K;  3HK2 A;  1RIL A;  3O3H A;  1WSJ A;  4KHP K;  2P9P A;  4BDZ A;  4JK8 A;  4LF7 K;  3DM2 A;  4IFV A;  1Z25 A;  3CM5 A;  4DWI A;  2JLE A;  4J8F A;  3IKM A;  1C0M A;  5I3U A;  3PV8 A;  1Y64 A;  3AVB A;  5KI6 A;  4DTM A;  1NNE A;  4IJA A;  2HVI A;  2VYP A;  4Y1C A;  4A57 A;  3VQQ A;  4FLZ A;  3UB5 A;  1QSY A;  3RMA A;  2HB5 A;  5KRS A;  4IZ9 A;  4BC2 A;  5F1X A;  4DMN A;  1V4S A;  3MK6 A;  4ISG A;  2HST A;  3JS6 A;  4FJG A;  3VEY A;  1S5J A;  3D2E B;  2YHW A;  5FRM A;  1GLB G;  4CJE A;  4FJL A;  3M5R A;  5KPT A;  2B5J A;  3S3O A;  1BHL A;  4E7K A;  2E20 A;  3K5L A;  2Z1J A;  3DLL L;  2OTL N;  5C2F A;  3VEW A;  4NXN K;  4CEO A;  1SKS A;  5M1F A;  1RT3 A;  4OKK A;  5AFU A;  1H1V A;  2HBM A;  4BRF A;  4FJ9 A;  1NK8 A;  3HST B;  4FSV A;  4U7B A;  3OS2 A;  1BL3 A;  3O8M A;  1DEJ A;  3B6O A;  3RWU A;  4ELU A;  1U4B A;  3AVK A;  3SK3 A;  5C12 A;  2FF6 A;  4DR4 K;  3EY1 A;  3V81 A;  4PWD A;  5TKY A;  2VWB A;  1I94 K;  4TSX A;  1SL1 A;  4FK2 A;  1NOZ A;  5KQD A;  1JXE A;  3AVG A;  3VEV A;  3V9W A;  3TR8 A;  2OPS A;  3VF4 A;  2IOC A;  5DK5 A;  1P90 A;  2WFB A;  1IKW A;  2IGI A;  2QW9 A;  1RT6 A;  3J81 O;  4CVN E;  3FZF A;  3F9M A;  3LPT A;  4LSN A;  3DXK B;  3SAH A;  1S9E A;  5AQR A;  4CBW A;  1Q86 O;  4CEA A;  3C94 A;  3WT0 A;  5AQF A;  3TAE A;  5JS2 A;  4CZH A;  4YOT A;  2HHT A;  4JKE A;  3B8A X;  2QEX N;  5FRN A;  4PL8 A;  3CC2 N;  4K8Z A;  3LDL A;  2V52 B;  2O8B A;  4DSJ A;  4A5A A;  5BR9 A;  3TTD A;  2HF3 A;  4JV5 K;  4YFU A;  3THW A;  1LV5 A;  3SUP A;  3SUN A;  4BR9 A;  4ILH A;  3SJH A;  2HNY A;  2PYJ A;  1BIS A;  4YOW A;  4B9V A;  4DV4 K;  4DQR A;  4H0V B;  4B3R K;  1RTH A;  4FLX A;  1FW6 A;  3FZH A;  2F9T A;  3A5M C;  3WXJ A;  4A59 A;  5LMN K;  4AQY K;  2G8K A;  1XUP O;  4BDY A;  3ZSW A;  2D5R A;  5TKW A;  4RW7 A;  4DTP A;  1NGE A;  4JHD A;  4AHR A;  1KVB A;  2DFH A;  3ZYY X;  5AQY A;  4CER A;  5F2R A;  4BC5 A;  4JD2 A;  3HI0 A;  1TYQ B;  4JKF A;  3ZT0 A;  3DOK A;  4CF0 A;  4LFA K;  1LW2 A;  3WEE A;  5JMV A;  4EP5 A;  5AFU H;  2EWS A;  5A2Q O;  4CHQ A;  4DR3 K;  2UXB K;  1Z6R A;  2Z1G A;  4M3U A;  4HTU A;  5E84 A;  2ZQB A;  3KKR A;  1NGF A;  2JGU A;  3R6M A;  4JKH A;  3DWL A;  4BQL A;  3MEE A;  3ZX0 A;  3VA3 A;  1VSH A;  2WTU A;  3ID8 A;  1NWK A;  4CFC A;  4IO8 A;  3NF8 A;  3VGM A;  3ULD A;  2W40 A;  5C0Y A;  3K5O A;  3OBY A;  3E01 A;  1RT7 A;  1N33 K;  4DTU A;  2QKB A;  4BE2 A;  2F9W A;  4CF8 A;  2YCH A;  4JNE A;  4N5S A;  4FWL A;  4ISF A;  2QI2 A;  2WON A;  2GEM A;  3O5B A;  4X62 K;  4C8K A;  4G9Z A;  4KHU A;  1XWL A;  4QS8 A;  1ZBL A;  5B8H A;  4H8K A;  1U2V A;  5KGW A;  2NNW A;  3AVA A;  1V4T A;  4JKA A;  4B9Q A;  1DKG D;  1NK9 A;  4GV9 A;  3OYB A;  4DTO A;  2O4I A;  1LCU A;  4JLH A;  5CZ2 A;  5E41 A;  2B6A A;  4CED A;  1NBW A;  4Z4F A;  4K41 A;  4KV8 A;  1CXQ A;  4E1N A;  1C0T A;  2OYQ A;  4IDH A;  3D2E A;  4JI2 K;  3O4W A;  1NMD A;  3P38 A;  3ZCM A;  4BY9 C;  2ASO A;  3PY8 A;  4E1J A;  1HR0 K;  1KVA A;  3SMS A;  4FJJ A;  1NGB A;  5AQG A;  2Y1I A;  1WUA A;  4F4K A;  4IDK A;  3THX A;  4LF9 K;  1VQN N;  4ISE A;  3TPQ A;  2UXD K;  1VQ9 N;  4YDU C;  3TAN A;  1KTQ A;  3NH1 A;  2WC9 A;  3AO4 A;  2LSN A;  1IKY A;  4M3T A;  4DV3 K;  4CIE A;  5C15 A;  4C8N A;  1U48 A;  5E26 A;  4GV6 A;  4CZF A;  2GWJ A;  3CQ8 A;  2YJF A;  3FZK A;  2DTU A;  1QQN A;  1L3V A;  4JKG B;  5BR8 K;  1JL1 A;  2ZJR L;  3AVH A;  4B9N A;  5GAG P;  2F4V K;  1JJ2 M;  3EZW A;  3LDQ A;  1C1C A;  1ATR A;  3BF3 A;  3CI5 A;  4BG9 A;  3HT3 A;  3IAY A;  5I9E B;  4FZZ A;  2ZJQ L;  1WSF A;  3LWL A;  4BRI A;  1K8K A;  5AJ3 K;  4KHN A;  2VG5 A;  1RT5 A;  3AVN A;  3MN7 A;  3EE8 A;  4BVO A;  1NGG A;  4JHD B;  3FZL A;  5M1Q A;  2OTJ N;  4JRQ A;  1QQC A;  4B8A B;  3KJV A;  4KRF A;  3TSP A;  5CHI A;  2YHA A;  4Q5V A;  2RE2 A;  2VQF K;  1U49 A;  5FRO A;  1LAV A;  3CME N;  3EKS A;  2XRI A;  4HUG A;  3CCE N;  2D0O A;  3G10 A;  3H1Q A;  4FWR A;  1JCE A;  3WQU A;  4JAX A;  3HPH A;  1NJI O;  2GTD A;  4OX9 K;  3QEV A;  3IMX A;  4DV7 K;  3CQX A;  3VQA A;  4Z4G A;  2FBT A;  3UKU A;  3TAG A;  5HRN A;  4F3O A;  4GVE A;  1E4G T;  1ZC6 A;  3ITH A;  4CHZ A;  4M3R A;  3GG4 A;  4H5R A;  3CPW M;  3DLB A;  2P9P B;  4I6M B;  4HCC A;  2NLX A;  5LJW A;  3C6U A;  4AM7 A;  3MWP A;  4ILG B;  1BQM A;  2CGK A;  2EX3 A;  4OPK A;  2YHX A;  3AAR A;  3O9T A;  5EVZ A;  4BR5 A;  3O08 A;  4BVP A;  3CD6 N;  2XY6 A;  4C1N I;  3V9Z A;  4B1W B;  3AVJ A;  2PYL A;  4CIF A;  3BDP A;  4E7L A;  2W6L A;  5AQQ A;  2KHO A;  3R3L A;  3SAG A;  4N56 A;  5JS1 A;  1RFQ A;  5K14 A;  3L2W A;  4JD2 B;  3IG1 A;  3OS0 A;  5BRD A;  4CFA A;  2ATQ A;  2W6K A;  4H5T A;  1DLO A;  2PAV A;  1J5E K;  3PIP L;  2YV0 X;  1KVC A;  3I0R A;  2IC3 A;  1S1V A;  4KPY A;  3PIO L;  4BE0 A;  4JI1 K;  2E88 A;  1I3A A;  1T8E A;  4PKH A;  4IG0 A;  1TV6 A;  4LF6 K;  4M41 A;  3ZSY A;  3ISN C;  2XY8 A;  2OA8 A;  3DAW A;  4FJ5 A;  1Q9Y A;  1OVY A;  2GX9 A;  3KZB A;  4B9L A;  4DSE A;  5AQS A;  5C10 A;  1BU6 O;  3SAF A;  4DSL A;  4W5Q A;  5CYQ A;  4CHN A;  3AGK A;  3VF2 A;  5CY4 A;  4KI6 A;  3P39 A;  3FZM A;  3VTI A;  1ZBF A;  5AQI A;  3THW B;  2D0P A;  4QAG A;  2YI1 A;  4BRO A;  1BG3 A;  1IO2 A;  3CER A;  1IJJ A;  1FJG K;  4RW6 A;  3OS1 A;  4EZ6 A;  1RGI A;  4DTR A;  2NRZ A;  2O4G A;  4YOR A;  3SQ1 A;  4OPJ A;  3MDQ A;  4XEI A;  3I8D A;  3J8A A;  1MA9 B;  1T3V A;  3RSE A;  5HL7 L;  3NGZ A;  3DLK A;  1NKE A;  3ULE B;  3KKS A;  4KB0 A;  1A5W A;  1RNH A;  3RR7 A;  5HLF A;  3DXK A;  4BQZ A;  2RHK A;  2YNH A;  4M3Z A;  4FWS A;  4CCH A;  1HX1 A;  2CH5 A;  1HPZ A;  1EKE A;  4CJK A;  3QIC A;  2I5J A;  3F2K A;  4YOV A;  3DYA A;  1OVQ A;  4JI5 K;  4GY2 B;  4DTJ A;  2DPN A;  2P9I B;  4AHT A;  3BUZ B;  3LWM A;  5IT9 O;  1NM1 A;  5HRS A;  1XHX A;  3M8Q A;  4LSL A;  1BIU A;  1BA0 A;  4CFD A;  4KBO A;  1OH8 A;  3CJB A;  2PBD A;  3BZC A;  1NLV A;  1ZBI A;  3CCQ N;  2Q0R A;  3LP0 A;  4H0Y B;  5AQT A;  3HZ6 A;  1EP4 A;  4KO0 A;  3M1F A;  2QWQ A;  1KC8 O;  4IOX A;  3I55 N;  2ZF5 O;  3QFP A;  2Q3S A;  2UUC K;  2DY4 A;  2NRH A;  3CXC M;  1GLE G;  3N4P A;  4CZI A;  4H5W A;  4IEE A;  3OJU A;  1ATN A;  5J2Q A;  3IFR A;  1SZ2 A;  1HNV A;  1RBV A;  2A42 A;  4LFB K;  1O13 A;  3VQ8 A;  2F7T A;  3T19 A;  1VSD A;  1IH7 A;  1HRH A;  4E7I A;  3CCU N;  3THY B;  3MAQ A;  3OYA A;  3K59 A;  3GBT A;  4J2E A;  3WNE A;  4BC3 A;  1EX4 A;  1RTD A;  4CGD A;  4H4M A;  5HRR A;  3D7E O;  1T6C A;  2XHB A;  2YNI A;  1U04 A;  1KD1 O;  4FJH A;  4BRL A;  2V7Y A;  3HRG A;  4ILJ A;  3TTF A;  5DMR A;  3E1Y A;  3OYK A;  4O44 A;  3SYZ A;  1BCO A;  1NK5 A;  4DCH A;  2P1J A;  4DS4 A;  1YVU A;  1QHA A;  4WFB L;  1NG9 A;  3SUQ A;  1YIJ N;  1IBM K;  3OA9 A;  1N34 K;  3W0L A;  2HMI A;  3FFK B;  3BP8 A;  4LH5 A;  3V6D A;  3F73 A;  4AF1 A;  2E5L K;  4CK3 A;  2D0A A;  3OHR A;  1XHZ A;  3OYJ A;  3H3N O;  1BOT O;  3QB0 A;  5ADX H;  2KKZ A;  3CJ7 A;  3LP3 A;  4CIG A;  3PX0 A;  1NU0 A;  2E2Q A;  3NH0 A;  5J2N A;  1LOT B;  3A2F A;  3PX4 A;  3HVT A;  1HUX A;  4FYD A;  4FWO A;  4BRE A;  4R79 A;  1BO5 O;  4CEF A;  2OZS A;  4H5V A;  1BDG A;  2GEL A;  3HVR A;  4I2Q A;  3KLG A;  3U9D A;  4CJF A;  3MED A;  2Q36 A;  3OY9 A;  4CZE A;  1RDB A;  1LWC A;  1E4F T;  3L3V A;  5AZI A;  4CES A;  4EP4 A;  1X9M A;  5J2P A;  5HP1 A;  3SQ4 A;  5BRH A;  3L4Q A;  4OLB A;  1NGD A;  5FDL A;  4E7J A;  4E89 A;  4XH5 A;  2PY5 A;  1X1P A;  3T3F A;  1VSF A;  2QWP A;  1Q7Y O;  4W5N A;  3FGU A;  3LP2 A;  5BRF A;  3LPU A;  1QHT A;  3P83 D;  1TUY A;  2HBL A;  4WQ5 A;  3LDO A;  1L3T A;  2A5X A;  1TVR A;  2G8V A;  4H0T B;  3T1Y K;  1TUU A;  2HBJ A;  4YOY A;  4FOE A;  1YHQ N;  1JL2 A;  4FJX A;  1SL0 A;  3TAP A;  1KQS M;  2E2O A;  1BUP A;  2VGN A;  3SBT A;  4ID5 A;  2JWK A;  2HHS A;  3KLE A;  3O6W A;  1JLF A;  3H1V X;  2RPI A;  4DHY A;  4JKG A;  1TKT A;  4KB1 A;  1RTI A;  4FJ7 A;  3K2P A;  3LL3 A;  1JCG A;  1ZBS A;  3ENO A;  2ZWH A;  3I56 N;  4RWT A;  3L6Q A;  3HYF A;  4H03 B;  2RN2 A;  2QTD A;  2FF3 B;  3SUO A;  3EE9 A;  4DV1 K;  3LZI A;  3VQB A;  3AO2 A;  3ZX3 A;  4DV6 K;  3ATU A;  2A1R A;  3A0I X;  3G71 N;  3THY A;  4IXC A;  1NKC A;  3VQ4 A;  4JKB A;  2QKK A;  2E6L A;  5EXW A;  4DV5 K;  4LF5 K;  3D0P A;  2VG7 A;  1JLA A;  1S1T A;  4BGB A;  3MCA B;  1TL1 A;  3EN9 A;  1NK6 A;  4LD0 A;  4EZ9 A;  2UUA K;  3MEG A;  3JSM A;  4ZTF A;  3G0Z A;  1BQN A;  3SQ2 A;  3VQD A;  3A5N C;  1S1X A;  2OPR A;  3K58 A;  1R59 O;  1HKB A;  4OGE A;  4B1X B;  3KD1 E;  2HF4 A;  1U2V B;  3DJC A;  2V7Z A;  5AQJ A;  3C0B A;  3ZSQ A;  4BGA A;  4PL7 A;  4GVM A;  4FJI A;  4KH5 A;  5ELZ A;  3NVK A;  2HHX A;  3OYG A;  4Q0B A;  1WB9 A;  5JLF A;  2G8I A;  1MWM A;  4FLT A;  4ICL A;  4MLH A;  1ASV A;  5H1S Q;  3BEX A;  3M8P A;  4DQP A;  1TL3 A;  1Q9X A;  3TI0 A;  2AA4 A;  4XH1 A;  4FWQ A;  1L5U A;  4B9U A;  1JCF A;  3PO4 A;  3SPY A;  3CQY A;  5LMU K;  3AA2 A;  1C1A A;  4RW9 A;  3THX B;  4FM0 A;  3RRH A;  1VQ6 N;  1CZA N;  2A1S A;  3QNO A;  3JAM O;  1VQP N;  1ZBU A;  2QXL A;  4EFH A;  4EAH D;  3HM9 A;  3QNN A;  3QIN A;  3C6H A;  5EY4 A;  3CMA N;  4K8X A;  3EYZ A;  2D0B A;  4MO5 A;  4IKF A;  3D6R A;  3L0Q A;  3FLC O;  3HL8 A;  3L2R A;  4FLW A;  1Z05 A;  3KIO A;  3LDP A;  4F9O A;  3CFO A;  2O8E B;  2X78 A;  3KLI A;  3V1Q A;  4X66 K;  4OO1 J;  4NB4 A;  2BH1 A;  3P5J A;  3VQ7 A;  2O8D B;  4DLE A;  1Q18 A;  1TKX A;  4CZM A;  1TAU A;  3OYE A;  4CF9 A;  3VEZ A;  1NJZ A;  4FJN A;  3U9Z A;  1W9H A;  1RDU A;  3SV4 A;  5GAH P;  5FLX O;  3LM2 A;  2BGG A;  5LJV A;  2YJE A;  1K6Y A;  2O8C A;  3DLG A;  5C24 A;  2HOE A;  3U3Y A;  3I33 A;  4J2B A;  3K5M A;  4QCL A;  1KFD A;  4CJV A;  3V9X A;  2FSJ A;  1A5X A;  4OKE A;  4CJP A;  3V9U A;  2R7Y A;  3VTH A;  1NJW A;  1L3U A;  4FZY A;  4B08 A;  2O8B B;  2G8W A;  3GDQ A;  3LAN A;  4A61 A;  4CK2 A;  4AHC A;  3M3Z A;  3AO3 A;  1NGJ A;  1QTM A;  4BWM A;  4FLV A;  2WBN A;  3FFI A;  3D45 A;  4OLA A;  3ZT3 A;  4BRH A;  3T1A A;  1VSL A;  1X9J A;  2P5O A;  4FCY A;  4BRK A;  1TYQ A;  4YOX A;  1S6P A;  3ZSV A;  1YVN A;  3CJ1 A;  4L8R B;  1T03 A;  3LP1 A;  4CJT A;  4DTS A;  3AVF A;  4B1V A;  2GUP A;  1XC3 A;  4LC9 B;  4DQ8 A;  2W42 A;  4BR4 A;  4HHT A;  2EHG A;  2ZJP L;  4CEZ A;  1T05 A;  1K73 O;  1FKP A;  2YHB A;  2P9I A;  3R9P A;  2QXF A;  3VET A;  3KK1 A;  2B4J A;  3UIQ A;  3UKU B;  2HHU A;  2P9L A;  3WXM B;  3KK7 A;  2QWO A;  3F5T A;  4PA1 A;  3TSQ A;  3VEX A;  3CFR A;  2UXC K;  1RDA A;  1HLU A;  1O1W A;  5GAE P;  4F8R A;  3ZEU A;  4M7X A;  3CC4 N;  5EX5 A;  1GOA A;  2HND A;  2BAN A;  1OH5 A;  4EHT A;  2KTQ A;  4CJQ A;  3J7Y P;  2ASP A;  2ZD1 A;  1EXQ A;  2P51 A;  2W41 A;  5T7B A;  1RTJ A;  4CFB A;  3OYC A;  3QEP A;  2CGL A;  5AQH A;  3I8B A;  1UAX A;  1GOB A;  1VSI A;  4YY3 K;  3D2F A;  1Y97 A;  4JN4 A;  3NVM A;  1VK0 A;  2BDP A;  1XMO K;  1ITG A;  2QM1 A;  4FWK A;  1UWB A;  4K0K K;  1X9S A;  3J80 O;  3DOL A;  1S72 N;  2HVH A;  2Y1J A;  3H3O B;  4CHP A;  3KHY A;  1XMQ K;  1XNQ K;  1WSE A;  4R5P A;  4DR6 K;  4B9S A;  3BGR A;  3ZSX A;  3THV A;  4FPB A;  1C0U A;  4B9T A;  5D3G A;  4O55 A;  1YI2 N;  3MMV A;  4DTN A;  4O5F A;  1M90 O;  1BWF O;  2NUB A;  3U4L A;  3VQ9 A;  3QBW A;  1TK0 A;  5HRP A;  2GWK A;  3OVN A;  3WNG A;  1RT4 A;  3KWI A;  1J5O A;  2HHV A;  1MWK A;  3ZSR A;  2KQ2 A;  3MX2 A;  4CW7 B;  3PO5 A;  2AP1 A;  4J2D A;  5AR0 A;  2D4W A;  1GLD G;  3NGY A;  4PUO A;  3CCM N;  4BG8 A;  4M3Y A;  4QS9 A;  1Q8I A;  3G4S N;  2RF2 A;  3OYN A;  3NHG A;  4CBU A;  3RMC A;  4B3M K;  4FWP A;  2I7N A;  3OYL A;  4IOA L;  3HSC A;  4GMJ B;  4JYA K;  3DLR A;  4RTF D;  1A5V A;  4FZX C;  4H4O A;  3O9U A;  1G15 A;  4GKK K;  2P9S B;  4DFM A;  2KFN A;  1D4X A;  1QQO A;  3RVC A;  3ZET B;  3CJC A;  4DV0 K;  1I39 A;  1BIZ A;  1W7A A;  1T6D A;  1JLC A;  3A8Y A;  4NCG A;  5AZJ B;  4BRC A;  4IWV A;  4DQQ A;  1LWF A;  4CGF A;  5HBM A;  3LZJ A;  3M8R A;  3RTV A;  5AZI B;  3NGI A;  4JEP A;  1NGH A;  3K57 A;  3KK2 A;  1NGC A;  4AHU A;  1WAF A;  2ITM A;  4M7Y A;  2FBX A;  2FXU A;  3CHW A;  3OBW A;  3BZK A;  1S3X A;  3HPO A;  1VRT A;  5J2M A;  2FSN A;  1QE1 A;  4N47 A;  1K8A O;  3CCL N;  4FJM A;  2OCE A;  3I0S A;  2XO7 A;  1HNI A;  3VN5 A;  3HXM A;  4W5T A;  4RG8 A;  1F21 A;  3ATV A;  3MN6 A;  1SL2 A;  3AAQ A;  5GIP A;  3DRR A;  2PFU A;  1W97 L;  5F0X A;  1YUW A;  1HJO A;  3W3D A;  4CHO A;  3U3G A;  4H5N A;  1U47 A;  3SZ2 A;  4KTQ A;  4KHQ A;  1FKO A;  4KH6 A;  4CZJ A;  1HNZ K;  4Z4I A;  3DRP A;  2QWM A;  1VQ7 N;  3ASM A;  4YHH K;  3QLH A;  3S3M A;  3QIP A;  4MDA A;  4BRP A;  4CBX A;  3SBG A;  3QES A;  1OKJ A;  3C95 A;  3VF6 A;  5M1K A;  2HW3 A;  1P8Z A;  3ZSO A;  3L2Q A;  1LAW A;  1QVF M;  2HHQ A;  3QDK A;  3Q7C A;  4A2A A;  5FPD A;  4E3S A;  3BF1 A;  2YHY A;  1IG9 A;  3M6G A;  4YDU A;  3CPE A;  3O9R A;  1RBT A;  2ZM6 K;  4RCH A;  4DLG A;  4KAZ A;  4J2A A;  5AQX A;  3CF5 L;  4K42 A;  1JXB A;  1NJY A;  1GLJ O;  1RDD A;  2NZT A;  1EWR A;  3VEO A;  4LY7 A;  3VQ5 A;  3LM9 A;  3T1H K;  3MCP A;  3R8E A;  4HWI A;  5AZJ A;  2P9N A;  4HVJ A;  4Z0U A;  2O8D A;  3NF9 A;  3S9H A;  4C1N K;  1U6Z A;  2P9K A;  4CZL A;  2AJQ A;  2OPP A;  4B9M A;  2YNF A;  3ZX2 A;  5IWA K;  5GIN A;  5AQM A;  3TAF A;  3AO1 A;  3O4N A;  2HMP A;  4EIA A;  3TAQ A;  4W5R A;  4ZHR A;  1K8K B;  1T7P A;  2ETJ A;  3OYD A;  4JKD A;  2BE2 A;  2Z1I A;  1HKG A;  4M3W A;  1SV5 A;  4CGG A;  3QO9 A;  4IBN A;  4WFA L;  4PY5 A;  2BTF A;  5DM6 L;  4JKC A;  1C0F A;  3WNH A;  2GBZ A;  4BRQ A;  1QZ6 A;  3T7Z A;  3AO5 A;  4UQG A;  4FVM A;  3TAB A;  3HPG A;  4FK0 A;  1XI1 A;  2I7P A;  3K9K A;  2F96 A;  4OJR A;  2UUB K;  3SMP A;  3QET A;  4Z4C A;  3EL2 A;  1XQS C;  4M45 A;  4BRG A;  4V19 S;  1WSI A;  4DU4 A;  3TWH A;  3DLH A;  3AVM A;  3HP6 A;  1WBD A;  4JK9 A;  1VQ8 N;  4CEQ A;  1WSH A;  4CEE A;  1SAZ A;  4XIU A;  4Z4H A;  2GV9 A;  5GIO A;  1DTQ A;  1D9D A;  1YJN N;  1SS6 A;  2JWL A;  4BE1 A;  4L3Q A;  3SI6 A;  2XY7 A;  4DV2 K;  3CCS N;  5SZT A;  4NCA A;  1BCM A;  5M1O A;  1SKW A;  3PSF A;  3GE1 A;  3RRG A;  3J7Z O;  2QWR A;  4O4G A;  3ULE A;  3H46 O;  4BR0 A;  2IDO A;  3DMJ A;  2KFZ A;  5GAD P;  2X74 A;  1BGX T;  4K43 A;  1RBU A;  4FVU A;  2VWK A;  1X3N A;  2NRX A;  4GW6 A;  1MDU B;  4FOI A;  1VQ4 N;  3RMD A;  5JIC A;  3AVC A;  4JI0 K;  1WLJ A;  4IG3 A;  1QVG M;  4KH4 A;  2IVN A;  4CGH A;  4UY8 O;  5AQL A;  1ATS A;  5BPL A;  4CJ5 A;  4CF2 A;  4O5B A;  1Q81 O;  3OW2 M;  3MXI A;  1U45 A;  1S9G A;  1VSM A;  4O0I A;  4KRE A;  3HJF A;  3TAM A;  1S6Q A;  4DSI A;  1ESV A;  1R0A A;  4FK4 A;  3QEI A;  4CK1 A;  5KRT A;  1QQM A;  2HNZ A;  4JS4 A;  4WYB A;  4KHY A;  3H6E A;  4E19 A;  4C8O A;  1YXQ A;  2E4L A;  4H0X B;  2IAJ A;  3TTC A;  3DI6 A;  2FLO A;  4BWJ A;  2ZE2 A;  3WEE B;  4W5O A;  3UE5 A;  3ZT4 A;  3NH2 A;  1BI4 B;  2A41 A;  4NCB A;  3C7N B;  3OYF A;  4E0D A;  3WQT A;  1GLA G;  4CJ3 A;  2KLA A;  2CGJ A;  2KW4 A;  4NYN A;  3WUH A;  3QBX A;  5HRO A;  1WNS A;  1UA0 A;  4WQ4 C;  4O8K A;  1KCF A;  1N36 K;  2NRW A;  4IJN A;  4B1Y B;  3SNN A;  1QSL A;  3HOT A;  4LFC K;  3QIO A;  1CZ9 A;  2HHH K;  4OKJ A;  3O9S A;  5DM7 L;  1HQU A;  3MWT A;  1KSP A;  2Q1N A;  3CC7 N;  2YX6 A;  3L2V A;  1RT2 A;  4YNQ A;  1K9M O;  4NO7 A;  3RR8 A;  1C0G A;  1CZB A;  4PKG A;  3NF7 A;  4CJR A;  4FJK A;  4CHY A;  1BA1 A;  3ENB A;  3SJJ A;  3VEN A;  4OPH A;  2ZGZ A;  3S41 A;  4B8C A;  4DF8 A;  2A40 A;  4DTX A;  3VA0 A;  3PX6 A;  3ZET A;  1B9D A;  5AQP A;  3VPZ A;  4DS5 A;  4BRD A;  4O8U A;  3NAE A;  2P9S A;  1N8R O;  5LL6 Z;  4BDP A;  5FPE A;  1T44 A;  3HBT A;  4F2R A;  4B1Z A;  1N6Q A;  1DT9 A;  3OTO K;  1QZ5 A;  4QOZ B;  1UOC A;  2X6N A;  1YT3 A;  3E9O A;  2HHW A;  1NKB A; 
#chains in the Genus database with same CATH homology
 2P9L A;  4J8F A;  3IKM A;  3WXM B;  3ENH A;  2P9U A;  2QWO A;  3DXM A;  3F5T A;  3DXK A;  3KK7 A;  3TSQ A;  3VEX A;  4BQZ A;  5AQU A;  1Y64 A;  1HLU A;  2RHK A;  3NMU A;  4IJA A;  2VYP A;  4FWS A;  4A57 A;  1HX1 A;  3UB5 A;  5GAE P;  2IVP A;  3ZEU A;  4M7X A;  2CH6 A;  2CH5 A;  4IZ9 A;  4BC2 A;  5F1X A;  3CC4 N;  1V4S A;  5EX5 A;  3G6E N;  3MK6 A;  4BC4 A;  4ISG A;  2HST A;  3JS6 A;  3QIC A;  3VEY A;  5AQZ A;  3F2K A;  3D2E B;  4YOV A;  4EHT A;  2YHW A;  3UKR A;  4GY2 B;  1GLB G;  1ZXO A;  2ASP A;  2DPN A;  2P9I B;  5HOO A;  3M5R A;  2W41 A;  5KPT A;  1VAZ A;  3L4I A;  4MLE A;  4IFE A;  2E20 A;  3BUZ B;  2CGL A;  1NM1 A;  5AQH A;  4IEI A;  3I8B A;  5BN8 A;  3DLL L;  2OTL N;  5C2F A;  3VEW A;  3D2F A;  4JN4 A;  1BA0 A;  3VES A;  3NVM A;  3E9P A;  1YJ9 N;  4KBO A;  4FWN A;  3UKR B;  2QM1 A;  3CJB A;  4FWK A;  4DKW A;  1YAG A;  2PBD A;  3G25 A;  5M1F A;  5AFU A;  1S72 N;  4WQ4 A;  1H1V A;  2HBM A;  4BRF A;  1GLC G;  3H3O B;  1KAY A;  4BR2 A;  5KPZ A;  1NLV A;  3KHY A;  4FSV A;  4U7B A;  3O8M A;  1DEJ A;  2BUP A;  5AQN A;  3CCQ N;  2Q0R A;  4H0Y B;  2NRR A;  5AQT A;  4A2B A;  4FPB A;  3HZ6 A;  1J6Z A;  5M1P A;  4CZK A;  3M1F A;  2QWQ A;  3SK3 A;  3DXM B;  2P9U B;  5C12 A;  1KC8 O;  2FF6 A;  3VGL A;  4IOX A;  3I55 N;  1YI2 N;  2ZF5 O;  3HM8 A;  3QFP A;  3MMV A;  1YJW N;  2E2P A;  2NRH A;  3RSE B;  5TKY A;  3E9L A;  3CXC M;  1GLE G;  3N4P A;  2VWB A;  4O5F A;  4H0P A;  4H5W A;  4IEE A;  4CZI A;  1M90 O;  1ATN A;  1BWF O;  3IFR A;  1SZ2 A;  3U4L A;  3QBW A;  5C2D A;  5BPN A;  5KQD A;  2A42 A;  3P4I A;  1O13 A;  2GWK A;  3VEV A;  3VF4 A;  3KWI A;  2F7T A;  4CI6 A;  1P90 A;  2WFB A;  3GOI A;  1MWK A;  3LDN A;  3MX2 A;  2AP1 A;  4PHT X;  2QW9 A;  5AR0 A;  2D4W A;  3CCU N;  1GLD G;  3FZF A;  3F9M A;  3CCM N;  3Q7B A;  4BG8 A;  2QWN A;  4QS9 A;  3DXK B;  3SAH A;  3GBT A;  5AQR A;  2H3G X;  2P9N B;  4CBW A;  1Q86 O;  4BC3 A;  4FO0 A;  3G4S N;  4M63 C;  3WT0 A;  5AQF A;  4CBU A;  3D7E O;  4FWP A;  1T6C A;  2I7N A;  4YOT A;  3VMF B;  4CZH A;  5KQ8 A;  4IOA L;  3HSC A;  4BRA A;  1KD1 O;  4JKE A;  3B8A X;  4CD3 A;  4IOC L;  2QEX N;  4HTL A;  3IDH A;  4PL8 A;  4BRL A;  3CC2 N;  2V7Y A;  4RTF D;  3HRG A;  4ILJ A;  1G99 A;  3TTF A;  1VQL N;  3LDL A;  2V52 B;  2Q2R A;  3O1W A;  3O9U A;  2P9S B;  3E1Y A;  2A6A A;  4A5A A;  4DCH A;  3TTD A;  4C23 A;  2HF3 A;  5BR9 A;  1D4X A;  5CR4 A;  1QQO A;  3CCV N;  3RVC A;  3ZET B;  3AGR A;  1QHA A;  3CJC A;  4WFB L;  4BR9 A;  3KVG A;  1T6D A;  1YIJ N;  4ILH A;  3SJH A;  3A8Y A;  3OA9 A;  5AZJ B;  4BRC A;  4CD1 A;  3W0L A;  4IWV A;  3FFK B;  3BP8 A;  4YOW A;  3VER A;  5AZI B;  4H0V B;  4JEP A;  4MO4 A;  1NGH A;  4AF1 A;  1NGC A;  3OHR A;  3H3N O;  1KXP A;  1BOT O;  3QB0 A;  2ITM A;  3FZH A;  3EKU A;  4M7Y A;  2FXU A;  3CHW A;  2F9T A;  3A5M C;  3OBW A;  1NGI A;  5ADX H;  2KKZ A;  1S3X A;  3CJ7 A;  1DGK N;  5KPR A;  2FSN A;  3WXJ A;  4A59 A;  1K8A O;  4WQ5 C;  1VQO N;  2D1K A;  3CCL N;  1XUP O;  2E2Q A;  1LOT B;  2QWL A;  3IUC A;  3CCR N;  1HUX A;  5TKW A;  1NGA A;  4FWO A;  4BRE A;  4R79 A;  4FL9 A;  1BO5 O;  3ATV A;  4H5V A;  3MN6 A;  1NGE A;  4JHD A;  1BDG A;  2E1Y A;  3AAQ A;  3ZYY X;  5GIP A;  5AQY A;  2GEL A;  2PFU A;  1W97 L;  3U9D A;  5F2R A;  4BC5 A;  5F0X A;  2Q36 A;  4JD2 A;  3HI0 A;  5AQK A;  1TYQ B;  4JKF A;  4CZE A;  4I6M A;  1YUW A;  3CCJ N;  1E4F T;  1HJO A;  5AZI A;  3W3D A;  3AAP A;  3WEE A;  5JMV A;  5AFU H;  2EWS A;  4H5N A;  3P31 A;  3FR0 A;  3K9J A;  5BRH A;  3C65 A;  3L4Q A;  1Z6R A;  1NGD A;  4KH6 A;  3CJ9 A;  4CZJ A;  5E84 A;  4XH5 A;  2QWM A;  1VQ7 N;  1NGF A;  2WUS A;  3R6M A;  4JKH A;  4K25 A;  2QWP A;  3DWL A;  3EO3 A;  4BQL A;  4DB3 A;  3FGU A;  1Q7Y O;  4MDA A;  4BRP A;  4CBX A;  3ZX0 A;  3SBG A;  5BRF A;  3ID8 A;  1NWK A;  4GNI A;  1OKJ A;  2IIR A;  3VF6 A;  5M1K A;  4IO8 A;  1P8Z A;  3CIP A;  3QML A;  1TUY A;  3VGM A;  1QVF M;  3QDK A;  3Q7C A;  4A2A A;  5FPD A;  2W40 A;  2HBL A;  4WQ5 A;  5C0Y A;  3BF1 A;  3OBY A;  1W2B M;  3LDO A;  2YHY A;  3M6G A;  4YDU A;  4PKI A;  2A5X A;  3CPE A;  3O9R A;  4RCH A;  3C7N A;  4H0T B;  5AQX A;  3CF5 L;  4K42 A;  5BN9 A;  4GV3 A;  1KAX A;  1TUU A;  2F9W A;  5MLC Q;  2YCH A;  2HBJ A;  2NRV A;  4FOE A;  4JNE A;  4YOY A;  1GLJ O;  4FWL A;  4ISF A;  2NZT A;  1YHQ N;  3VEO A;  3LM9 A;  2QI2 A;  5EOY A;  2GEM A;  3O5B A;  3MN9 A;  3MCP A;  3R8E A;  4HWI A;  1KQS M;  4G9Z A;  5AZJ A;  2P9N A;  4QS8 A;  4CJ7 A;  3HOS A;  1GLL O;  2E2O A;  2HBK A;  5B8H A;  1BUP A;  2VGN A;  3SBT A;  2JWK A;  4C1N K;  1U2V A;  1U6Z A;  2NNW A;  2P9K A;  4CZL A;  1SQK A;  3O6W A;  1V4T A;  3N4Q A;  3H1V X;  4JKA A;  4DHY A;  4JKG A;  4B9Q A;  3ZX2 A;  1DKG D;  4BRN A;  5GIN A;  1IG8 A;  5AQM A;  3GL1 A;  4GV9 A;  5FPM A;  1LCU A;  2HMP A;  4A5B A;  4EIA A;  3LL3 A;  4AM6 A;  1JCG A;  1K8K B;  1NBW A;  1ZBS A;  2Q31 A;  4K41 A;  1RDW X;  3ENO A;  2ZWH A;  3I56 N;  4RWT A;  4JKD A;  3L6Q A;  4H03 B;  3QFU A;  2QTD A;  2FF3 B;  1HKG A;  4IDH A;  3EE9 A;  3D2E A;  1X3M A;  2Q97 A;  3O4W A;  1YIT N;  1NMD A;  5ADX A;  4WFA L;  3P38 A;  3ZX3 A;  2BTF A;  4BY9 C;  5DM6 L;  4JKC A;  4MDB A;  2ASO A;  3ATU A;  1C0F A;  4FWM A;  4E1J A;  3A0I X;  3G71 N;  3SMS A;  1NGB A;  4BRQ A;  1QZ6 A;  4IXC A;  5AQG A;  3T7Z A;  1WUA A;  5M1N A;  4XH4 A;  1M1K O;  4NLC A;  1VQN N;  4ISE A;  4JKB A;  2I7P A;  3TPQ A;  3K9K A;  4YDU C;  1VQ9 N;  3R1X A;  1EQY A;  5EXW A;  2WC9 A;  3SMP A;  5C15 A;  3C6A A;  3O9Q A;  3MCA B;  4BGB A;  1S22 A;  1XQS C;  3EL2 A;  5AQW A;  4BRG A;  3TU5 A;  4FPA A;  3EN9 A;  3D2F B;  5E26 A;  4GV6 A;  2VCP A;  3O80 A;  4CZF A;  2GWJ A;  4H0O A;  2YJF A;  3MN5 A;  4JK9 A;  1VQ8 N;  3FZK A;  1SAZ A;  1QQN A;  3A5N C;  4JKG B;  2ZJR L;  1R59 O;  1HKB A;  3WXK A;  4B1X B;  5GIO A;  5GAG P;  2HF4 A;  1YJN N;  1SS6 A;  1U2V B;  2P9K B;  3DJC A;  2JWL A;  4IO9 L;  1JJ2 M;  4L3Q A;  2E1Z A;  2FSK A;  3EZW A;  3LDQ A;  4BG9 A;  1ATR A;  2V7Z A;  3BF3 A;  3CI5 A;  5AQJ A;  5AQV A;  3CCS N;  5I9E B;  3ZEU B;  2P9L B;  3C0B A;  2IVO A;  4BGA A;  1HKC A;  4PL7 A;  3SLC A;  3NVK A;  4KH5 A;  5ELZ A;  5M1O A;  3CET A;  4WCE L;  2ZJQ L;  3KWG A;  5JLF A;  4BRI A;  2J4R A;  1MWM A;  3GE1 A;  4YOU A;  1VQM N;  3J7Z O;  1K8K A;  2QWR A;  4MLH A;  3MN7 A;  3EE8 A;  3H46 O;  3ULE A;  5H1S Q;  4BVO A;  1GLF O;  1NGG A;  3BEX A;  3FZL A;  4JHD B;  5M1Q A;  2OTJ N;  2A3Z A;  4BR0 A;  5BPM A;  5GAD P;  3TSP A;  5CHI A;  2RE2 A;  4K43 A;  3A5L C;  2AA4 A;  4XH1 A;  3CME N;  4FWQ A;  4FVU A;  3EKS A;  1JCF A;  1X3N A;  3CCE N;  2D0O A;  3CQY A;  2NRX A;  2NRT A;  1MDU B;  2V51 B;  4FOI A;  3H1Q A;  4FWR A;  1JCE A;  1VQ4 N;  3WQU A;  4JAX A;  5JIC A;  1VQ6 N;  1CZA N;  1NJI O;  1KAZ A;  2GTD A;  3PLA A;  1QVG M;  4KH4 A;  2IVN A;  3IMX A;  4UY8 O;  5AQL A;  1ATS A;  5BRE A;  1VQP N;  5BPL A;  2QXL A;  3CQX A;  4EFH A;  4EAH D;  2OAN A;  3WXL A;  3C6H A;  3UKU A;  1Q81 O;  5EY4 A;  3CMA N;  4GVE A;  1E4G T;  1ZC6 A;  3GG4 A;  3OW2 M;  4H5R A;  4EHU A;  4Z94 A;  2E2N A;  3CPW M;  2P9P B;  4I6M B;  2NLX A;  4MO5 A;  5LJW A;  4OPA A;  3D6R A;  3L0Q A;  3JXU A;  3FLC O;  1ESV A;  3FE1 A;  4AM7 A;  3MWP A;  4ILG B;  1YF5 L;  1ILY A;  2CGK A;  1QQM A;  2YHX A;  3AAR A;  1Z05 A;  3O9T A;  5EVZ A;  4BR5 A;  3MX5 A;  3LDP A;  4WYB A;  3O08 A;  4BVP A;  4WFN L;  3CD6 N;  4C1N I;  4F9O A;  2ASM A;  1VQK N;  3H6E A;  2E8A A;  1YXQ A;  4B1W B;  2VGM A;  4OO1 J;  4H0X B;  2BH1 A;  4NB4 A;  3TTC A;  4U67 L;  2FLO A;  1Q18 A;  4CZM A;  3WEE B;  5JLH A;  3UE5 A;  3VEZ A;  1Q82 O;  5AQQ A;  2KHO A;  3HTV A;  3R3L A;  4JK7 A;  3U9Z A;  4B1U B;  2ZGY A;  4WF9 L;  3SAG A;  2A41 A;  1RDU A;  1RFQ A;  4JD2 B;  3C7N B;  5BRD A;  5LY3 A;  5GAH P;  3LM2 A;  3O1B A;  3WQT A;  5LJV A;  4H5T A;  1GLA G;  2PAV A;  2YJE A;  4NLB A;  2KLA A;  2CGJ A;  3ID6 A;  3PIP L;  3VOV A;  3WUH A;  3QBX A;  2Q0U A;  4CZG A;  3AY9 A;  5JVG L;  2HOE A;  1WOQ A;  3CJA A;  3I33 A;  4WQ4 C;  5JVH L;  3T69 A;  3VGK A;  3WXI A;  4O8K A;  3PIO L;  5CE3 A;  2E88 A;  2FSJ A;  4PKH A;  4BR7 A;  2NRW A;  4IJN A;  2UYT A;  5AQO A;  4B1Y B;  3VTH A;  3H45 C;  4QS7 A;  3E66 A;  3U8X A;  3HOT A;  3GDQ A;  3DAW A;  1HPM A;  3O9S A;  4A61 A;  5DM7 L;  3MWT A;  3M3Z A;  1OVY A;  2GX9 A;  1NGJ A;  2Q1N A;  3KZB A;  2YX6 A;  3CC7 N;  3TSU A;  2WBN A;  4NO7 A;  1K9M O;  3A5O C;  4BRM A;  1C0G A;  5AQS A;  4BRH A;  1X9J A;  5C10 A;  1BU6 O;  4BRK A;  1TYQ A;  4PKG A;  3SAF A;  4YOX A;  4Y0W A;  1VQ5 N;  2QA4 N;  1BA1 A;  1YVN A;  3CJ1 A;  3ENB A;  3VEN A;  4OPH A;  2ZGZ A;  3AGK A;  3S41 A;  3VF2 A;  3P39 A;  3FZM A;  3VTI A;  2A40 A;  5AQI A;  3ZET A;  5AQP A;  2D0P A;  3VPZ A;  4A62 A;  1EO1 A;  4B1V A;  4BRD A;  2GUP A;  1XC3 A;  2YI1 A;  4LC9 B;  4O8U A;  5FPN A;  4BRO A;  4DQ8 A;  4BR4 A;  2P9S A;  1BG3 A;  1N8R O;  5FPE A;  2ZJP L;  1T44 A;  3HBT A;  3CER A;  4B1Z A;  1IJJ A;  1DT9 A;  1QZ5 A;  1K73 O;  1RGI A;  2NRZ A;  2P9P A;  4YOR A;  4JK8 A;  3E9O A;  3MDQ A;  4XEI A;  3J8A A;  1MA9 B;  1T3V A;  2P9I A;  3RSE A;  5HL7 L;  3R9P A;  3VET A;  3ULE B;  3UKU B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...