3ZETA

Structure of a salmonella typhimurium ygjd-yeaz heterodimer.
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
229
structure length
226
Chain Sequence
MRILAIDTATEACSVALWNNGTINAHFELCPREHTQRILPMVQEILAASGASLNEIDALAFGRGPGSFTGVRIGIGIAQGLALGANLPMIGVSTLATMAQGAWRKTGATRVLAAIDARMGEVYWAEYQRDAQGVWQGEETEAVLKPERVGERLKQLSGEWATVGTGWSAWPDLAGLTLHDGEVSLPAAEDMLPIASQKLAAGETVAVEHAEPVYLRNEVAWKKLPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords PUTATIVE M22 PEPTIDASE YEAZ
publication title Crystal Structure of the Dimer of Two Essential Salmonella Typhimurium Proteins, Ygjd & Yeaz and Calorimetric Evidence for the Formation of a Ternary Ygjd-Yeaz-Yjee Complex.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium str. st4/74
total genus 67
structure length 226
sequence length 229
ec nomenclature
pdb deposition date 2012-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00814 Peptidase_M22 Glycoprotease family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3zetA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3zetA02
4H5TA 4BRGA 4BRPA 2Q1NA 3R8EA 3CJ7A 5BRHA 3A5NC 3C0BA 5KPRA 2ZGYA 1V4SA 5KQ8A 3UKUB 4FWPA 4F9OA 2A41A 1XQSC 2GELA 3EKSA 4WQ5A 4MO5A 3MN7A 1NGIA 2Q31A 4BQZA 3D2EA 1TUYA 3CQYA 4XH5A 2FLOA 4B1XB 4H0TB 3DXKA 2VCPA 4M7YA 5AQSA 5LJWA 3FZMA 3UB5A 3VEYA 1XUPO 3H3NO 5FPDA 1MA9B 3JXUA 3CHWA 4AM7A 3WQUA 3KVGA 4JD2B 5JMVA 4FPBA 3QBWA 3QICA 1BUPA 3H45C 2F9WA 4XEIA 5BN8A 3A0IX 3WUHA 5KQDA 2QWNA 1NMDA 4FPAA 4A62A 5AQNA 3O08A 3LDPA 5B8HA 4BR2A 3FZHA 3FE1A 2PAVA 4A2AA 4BQLA 2V51B 2E2OA 1DKGD 3LDLA 3P4IA 4B1YB 2P9SA 1U2VA 3R6MA 4B1VA 4I6MA 4BRKA 5JLHA 4KBOA 3RSEA 3ID8A 1BO5O 1X3MA 3WXLA 2E1ZA 2FSNA 1NGFA 4IJAA 1KAXA 1NBWA 4CBWA 3D2EB 1QQOA 3DXKB 4BR4A 3LL3A 3M3ZA 3QB0A 4DHYA 3OHRA 5F2RA 3HBTA 1NWKA 3I33A 4CZMA 2CGKA 1BOTO 1MWKA 4H0YB 4QS9A 4H5WA 2E1YA 3MCPA 5AQJA 5AQZA 2GEMA 5ADXA 2AP1A 4FOIA 4YDUC 3VERA 4GY2B 4BVPA 1YAGA 3CI5A 4QS7A 5AQFA 3R9PA 3MN6A 5JLFA 3BF1A 5EX5A 2QWLA 3VETA 3LM2A 3O8MA 1LCUA 5AZIA 2E20A 3O1BA 3MK6A 5AQMA 5AZJB 1XC3A 2YI1A 1QZ5A 5AQGA 2QWMA 2D4WA 1ATSA 4JNEA 1Y64A 2GWKA 2P9SB 3ZETA 2ASMA 4BREA 2ITMA 3VEWA 3IFRA 3RSEB 2PBDA 3ZX0A 1E4FT 3BF3A 3MN5A 1HJOA 2P9NA 3MDQA 3O1WA 2IVOA 1YXQA 5BREA 4BR7A 3JS6A 2EWSA 5AQPA 5AQUA 5AFUA 3EO3A 2Q2RA 3H46O 4K43A 4FO0A 4FWLA 1LOTB 5AQVA 4H03B 2GTDA 4CBXA 3ZX2A 2V52B 2BTFA 1T6DA 2BUPA 3U8XA 1NGEA 3CJBA 3ATVA 3GDQA 2QWQA 3VOVA 3IMXA 5EOYA 1KAZA 5AQRA 4FWRA 5AZIB 2VYPA 3CJ9A 3FZKA 3U9ZA 2Q0RA 1Q18A 2HF4A 3O4WA 2AA4A 2E2PA 2QM1A 5KPZA 4CD3A 1C0FA 1GLBG 2YHYA 4PKHA 2WUSA 5E84A 4EFHA 1X3NA 3W3DA 4BC4A 3IUCA 3ZETB 4CZJA 3ULEA 1SAZA 4JAXA 4CZKA 1SQKA 3ZX3A 5F1XA 4B1UB 4BROA 1E4GT 3HTVA 2P9NB 1HLUA 2FSJA 3VEVA 3WEEB 1NGGA 1NM1A 1TYQA 2ZGZA 2VWBA 5KPTA 1GLCG 2QWPA 1J6ZA 4IWVA 1JCFA 4RTFD 3CJ1A 3D7EO 5EVZA 4A61A 4BC5A 4BG9A 4B1ZA 2P9PA 1K8KA 3VGMA 4BGBA 4XH1A 5JICA 4C23A 1NGBA 3C7NA 3EN9A 4IO8A 3VESA 3QFUA 3WQTA 3EZWA 4BG8A 3KZBA 1QQNA 5AQHA 3H6EA 2YCHA 4O8KA 5AQQA 4GNIA 2P9KA 1GLAG 3WXIA 2J4RA 4PKGA 2P9UA 3J8AA 2FF3B 3L6QA 3WXKA 1BA1A 1BA0A 3VGKA 3BEXA 1T6CA 4FWSA 4IXCA 2E8AA 2CH5A 2YJFA 4PKIA 3ULEB 2IIRA 4M63C 4CI6A 2Q0UA 1GLFO 1SZ2A 3FZLA 4BRCA 1TYQB 4ISFA 4BRNA 1IG8A 3FGUA 1GLDG 2ZF5O 1HPMA 2I7PA 4FL9A 1V4TA 4H0PA 3A5LC 1P8ZA 2V7YA 1BU6O 3ENOA 2P9PB 3VF4A 3AY9A 3D2FA 4BVOA 1K8KB 5AQWA 3A5OC 3O6WA 3VGLA 2FXUA 3GE1A 5BRFA 3DXMA 4K41A 5BRDA 1BG3A 3VEXA 4YDUA 3QBXA 5BN9A 4Z94A 1GLJO 3FZFA 4CJ7A 1T44A 1Z6RA 2P9KB 3UE5A 3F9MA 4H0XB 2P9UB 4CZHA 1MDUB 1DEJA 4BR9A 1S3XA 4BRHA 3VEZA 2OANA 5AQIA 1HKCA 4BRFA 1U2VB 4DQ8A 4I6MB 4H5NA 1QQMA 1ESVA 3HSCA 4EHTA 2V7ZA 1ZC6A 3BP8A 3GOIA 1X9JA 3ENHA 5ADXH 1BDGA 4PL7A 2NLXA 4CZGA 4K42A 2HMPA 3BUZB 2D0PA 3W0LA 4NB4A 3TPQA 5FPEA 1BWFO 3G25A 5AQOA 3D2FB 2E88A 1QZ6A 3GL1A 3HZ6A 2FF6A 4J8FA 2IVNA 2P9IA 3EKUA 5TKYA 3DJCA 4ISGA 4BRDA 2UYTA 3CERA 2NZTA 5E26A 1OKJA 1NGAA 3FR0A 3CJCA 1ZBSA 4CZIA 2P9LA 2IVPA 4FWMA 5BPLA 3ZEUA 3TU5A 4WQ4C 1NGDA 2I7NA 3SK3A 2Q36A 1GLLO 1IJJA 4L3QA 2QWRA 3FFKB 5LY3A 1WUAA 4CZEA 3LDNA 4CZLA 4LC9B 3CQXA 4E1JA 3LDQA 2FSKA 3AAPA 2CH6A 5AQTA 3UKRA 2W41A 1JCGA 4JHDA 2KHOA 1DGKN 2YHXA 4MLHA 2A3ZA 3I8BA 4M7XA 1CZAN 1KXPA 4ISEA 1KAYA 3AARA 5ELZA 4K25A 3WXJA 4XH4A 3SJHA 4B9QA 3O5BA 4HWIA 4BRAA 2NRHA 2P9IB 2YJEA 3QFPA 5EY4A 3VPZA 3ATUA 4WQ5C 5AQKA 4AM6A 1U6ZA 3HM8A 1HUXA 2GUPA 5LJVA 4FWOA 3VENA 3H3OB 1EQYA 1YVNA 3CETA 2P9LB 3CIPA 3EL2A 1G99A 4H5VA 1JCEA 5BPMA 3M6GA 3ZEUB 5AQXA 3MMVA 3SLCA 4FWQA 3HI0A 2QW9A 4B1WB 3WT0A 1C0GA 2ASPA 2A40A 3GG4A 1ATNA 3FLCO 2DPNA 3UKRB 3VF6A 4A2BA 5FPMA 5F0XA 4JHDB 4BRQA 5AQLA 5EXWA 4EIAA 4RCHA 1RFQA 4EAHD 5AZJA 4EHUA 3A5MC 1ZXOA 1ATRA 2F9TA 2A5XA 5AR0A 1RGIA 2CGJA 4BC3A 2QWOA 3S41A 4MLEA 4CZFA 2HOEA 3C7NB 5FPNA 1HKGA 4FOEA 4H0OA 2E2QA 4HTLA 2Q97A 5BR9A 3SMSA 5CE3A 1Z05A 4DCHA 3CJAA 1QHAA 3H1VX 1NGCA 2A42A 2ASOA 3M1FA 1S22A 4H5RA 3LDOA 3SMPA 4DB3A 1HKBA 1WOQA 4BRIA 2A6AA 2ZWHA 3VEOA 4BRLA 1NGHA 4Y0WA 2W40A 3QDKA 4BGAA 1GLEG 4MO4A 4QS8A 3L0QA 4RWTA 2E2NA 3DAWA 3U9DA 1D4XA 2H3GX 1NGJA 4CD1A 1TUUA 3UKUA 3VF2A 3IDHA 3U4LA 3A8YA 2D1KA 1H1VA 3DWLA 3DXMB 4FSVA 4IZ9A 5BPNA 3O80A 4O5FA 4BR0A 4CBUA 1MWMA 3WEEA 5I9EB 4BR5A 4FWKA 3B8AX 1HX1A 3H1QA 4WQ4A 4NO7A 4BC2A 1NLVA 3GBTA 3KHYA 5AQYA 2CGLA 3AAQA 1R59O 2QXLA 2YHWA 2HF3A 4JD2A 4H0VB 3MN9A 4PL8A 5AFUH 3LM9A 4IJNA 4JN4A 3L4IA 1YUWA 2D0OA 1RDWX 4BRMA 3QMLA 2GWJA 4FWNA 4WYBA
chains in the Genus database with same CATH superfamily
2HW3A 1MU2A 3R8EA 2VQEK 4DFMA 4Y1CA 2PYJA 5KPRA 1S1VA 3VQQA 5SWMA 1YTUA 1XQSC 3D6RA 1O13A 1RTIA 3EKSA 3MN7A 2YV0X 3OTOK 4BQZA 4B3TK 3CQYA 4XH5A 2FLOA 4B1XB 1OH5A 4M7YA 1BIUA 3VEYA 3KTQA 1XUPO 3H3NO 3PLAA 2VGNA 4I2QA 1FKOA 3WQUA 1RDBA 3KVGA 2G8HA 5HP1A 3ENBA 4DV5K 3OJUA 1BUPA 1IKWA 2OPPA 5KQDA 2QWNA 3VN5A 4DV7K 4YORA 2YNGA 1QTMA 1LV5A 4GVMA 3NHGA 3O08A 3HK2A 5HBMA 3VQDA 3FE1A 3HP9A 4BE0A 2O8FB 1HYZA 2PY5A 3LDLA 3P4IA 4B1YB 2HVIA 3S3NA 4MFBA 5JLHA 4V19S 3RSEA 1JLQA 1BO5O 4JKHA 1W0HA 2E1ZA 2FSNA 1NGFA 3ZSZA 4FZZA 3D2EB 4ZHRA 1QQOA 1TK5A 1JKHA 3LL3A 5CR4A 1RDDA 4OO1J 4CGJA 4EP4A 1BOTO 2X74A 4QS9A 3L8BA 5ADXA 2AP1A 1CZBA 4ELUA 3DRRA 3VERA 4BVPA 5AQFA 3EEQA 5EX5A 2E20A 2KTQA 5AQMA 5A2QO 1XC3A 2B6AA 2UXBK 3SAFA 4M3YA 2QWMA 4FJMA 1ATSA 5LMUK 2HHHK 4DTUA 3SPZA 3VQ7A 1NJIO 3MN5A 1HJOA 1A5VA 1I3AA 3MDQA 3O1WA 3K5OA 2G8IA 5M1OA 3NF9A 4C8OA 5T7BA 5LMNK 4PQUA 4BDYA 3JS6A 3P5JA 5AQUA 1QSYA 2Q2RA 4FXDA 3H46O 1X9SA 4DV6K 4FO0A 4JI8K 2P5GA 1U04A 3R3LA 5AQVA 1Q7YO 1LWCA 4DLEA 2Z1HA 1RBVA 1T8EA 2QWQA 3CC4N 1YT3A 5AQRA 3TAPA 4KHNA 4ELTA 4DTJA 2HF4A 1NKCA 2IGIA 4CJWA 1UA0A 3VTIA 1KFDA 4M3ZA 2WUSA 3PIPL 3ULEA 2O8BB 3DLBA 4NXMK 4B1UB 1E4GT 1RNHA 3U6FA 2ZGZA 3HOSA 4KRFA 2VWBA 2UXDK 4KAZA 4BG9A 2ZJRL 3CJ1A 4BC5A 4B1ZA 3SZ2A 2XO7A 2O8EB 3P83D 4UY8O 1HNXK 4M3WA 5GINA 3CYMA 1K8KA 4BGBA 3P31A 3U3GA 4CJKA 4CF8A 1NGBA 1Q81O 4G1QA 1KRPA 3VQPA 4O55A 4CJSA 3T7ZA 4K8XA 3H6EA 4RG8A 1VRUA 4FJIA 1GLAG 5J2PA 5C10A 2RN2A 3L6QA 4JKGA 1BA1A 3VGKA 3BEXA 3DRPA 2XHBA 3O4NA 3HL8A 4C8NA 2Y1JA 1GLFO 3AVHA 1N5YA 3J80O 1GLDG 1RDCA 1HPMA 4OKEA 1JL1A 3TWHA 4L8RB 1V4TA 4H0PA 1P8ZA 3BDPA 3HRGA 5J2NA 1NK6A 4FLVA 3AO3A 1RBTA 2W6LA 3A5OC 1WSFA 4KHYA 1OH7A 1JLCA 4K41A 3ZSXA 4J2BA 4B3MK 3DOLA 1TV6A 4CEDA 4CJ7A 3JSMA 3F9MA 4CZHA 1DEJA 2FBVA 4BR9A 4OGCA 2OANA 5AQIA 1RTHA 3D45A 4PY5A 3L2QA 1Q8IA 3E66A 3HOTA 2OPSA 4FJKA 3SV3A 1BQMA 3MAQA 3K57A 3HSCA 4WFNL 1DTQA 1KTQA 3ENHA 3SAHA 3U3YA 1WSIA 1Q82O 3AO2A 4FZXC 1VQ9N 1Z26A 2VWKA 2Z1GA 1QVGM 1C1AA 4CIFA 1RT3A 3W0LA 4FVUA 5AQOA 2E88A 3HZ6A 4JI6K 4I2PA 2G8VA 3EKUA 4MQ3A 3M8SA 4F8RA 3L4QA 3OYJA 4FWMA 1UWBA 3DI6A 3D0PA 2QKKA 4WQ4C 2I7NA 3ALYA 1J5EK 4K0KK 1LWFA 4DU4A 1N34K 1T7PA 4FJJA 2QWRA 2W42A 3LP0A 2W6KA 4IDHA 4CJRA 2D5RA 1C0TA 4E1JA 3V1RA 3QNOA 5AQTA 2W41A 4AQYK 1JCGA 4JHDA 3LPUA 5DK5A 4NCGA 4CFCA 3NH1A 2A3ZA 4DR6K 3CQ8A 3AARA 5M1FA 3T3FA 4HWIA 1RT1A 4BRAA 4F3TA 4CW7B 4DSLA 3QFPA 3SI6A 2YNHA 4AM6A 1U6ZA 4PA1A 3HM8A 2GUPA 2YNFA 3HVTA 3H3OB 2P9LB 3CIPA 4OPHA 5BPMA 1NK5A 4B9SA 5AQXA 4E7JA 1BCMA 3K59A 1EXQA 4FJHA 3OS1A 1S1XA 2QW9A 3LP2A 3ZT0A 4JI4K 2D0CA 1KLMA 3FLCO 2BANA 2DPNA 3UKRB 3VF6A 4A2BA 2QXFA 2VG7A 1U48A 4CIGA 3NGIA 4ZTJA 2B4JA 1SKWA 4EHUA 4CEAA 3LPTA 4E89A 1ATRA 5AR0A 2A5XA 1KCFA 4YOTA 4CZFA 1IBMK 3C7NB 4M3TA 3MWPA 5FPNA 1VQ8N 1HQUA 1EWRA 2E4LA 2E2QA 4CK1A 4FM2A 1OVQA 5BR8K 5JVHL 2YHBA 4H5RA 3OY9A 1ZBHA 4YNQA 2ZD1A 4FM0A 4DB3A 1HKBA 4LF9K 4BRIA 2A6AA 1WSJA 3CCVN 1S1TA 4Y0WA 1TKDA 1J9AA 3S9HA 4BGAA 4IFVA 1WNSA 1JLEA 4MO4A 4QS8A 4CJEA 4JYAK 4CGIA 3A2FA 4CJFA 3AGRA 4C1NI 5M1KA 3N4QA 1LW0A 3M5RA 3DAWA 3MXIA 1W97L 3UIQA 2ZQBA 1VK0A 2DY4A 5C2FA 5J2MA 3UKUA 3EZ5A 2QKBA 4ZTFA 4YY3K 3T1YK 3CF5L 3DWLA 3DXMB 4IEIA 4IZ9A 3O80A 1VSLA 4O5FA 4CBUA 1RCHA 1TL3A 3WEEA 5I9EB 3VQCA 1FKPA 3K0SA 3H1QA 3LWMA 4BC2A 3GBTA 3O4QA 3QO9A 2QXLA 4JD2A 3MN9A 1RBSA 5CYMA 4CEZA 3ITHA 3DLRA 1WB9A 2AJQA 3THWB 4Q0BA 3L4IA 3B6PA 4FLZA 1DLOA 3C6UA 2OTJN 3CM6A 4WYBA 3H08A 2NRWA 4BRGA 4EP5A 1HRHA 2Q1NA 3C6TA 1VSMA 3CPEA 5BRHA 2A1SA 3A5NC 3C0BA 1V4SA 5FLXO 4FJ8A 2JLEA 4JKFA 4A5BA 4JKCA 1M90O 3J7ZO 4X62K 4IBNA 4WQ5A 4MO5A 3NBPA 2OPQA 2D0BA 3I55N 3OS2A 3DXKA 3UB5A 2LSNA 2WTUA 4CIEA 5FRNA 3NAEA 4JI0K 3CHWA 3CM5A 4GV6A 4GVEA 4KTWA 1D5AA 2ZJPL 3QICA 1X9WA 3H45C 5BN8A 3THXA 3BGRA 3NGZA 1NMDA 4IFEA 1ZBFA 5E41A 4CHZA 1JXEA 3HVRA 3VQ8A 3FZHA 4BQLA 2V51B 3ZSWA 3ID6A 2P9SA 1U2VA 4OKJA 1S1WA 1W9HA 4BRKA 4DG1A 3L2RA 1X3MA 4NCAA 1NBWA 4EZ6A 3M3ZA 3QB0A 5CZ2A 1LAVA 5F2RA 4WE1A 2CGKA 4DMNA 1IH7A 4DR4K 3HSTB 1WAFA 3L3UA 2E1YA 3S3MA 4YOWA 5AQZA 1KLNA 4GKKK 4YDUC 4QS7A 4CF2A 3VQ5A 3G71N 1VQ6N 3VETA 3O8MA 1LCUA 4YFUA 5AZIA 1IV0A 2O8DA 3ZT2A 1BGXT 1Y64A 1B92A 3AVFA 3F73A 1ZBLA 3G10A 1HNZK 1RBRA 4BREA 3OYAA 3TSUA 2UXCK 3LP3A 1WSGA 3LANA 3RSEB 3T1AA 4CF0A 3OYIA 1VSJA 5IT9O 1RT2A 3DM2A 4N56A 1EX4A 1D8YA 4BR7A 1J53A 4BACA 1VQLN 4EZ9A 5AQPA 5H1SQ 5AFUA 2VG5A 3EO3A 3NF7A 5C2DA 1J5OA 3PO4A 3OYKA 4DFPA 4FJ7A 2KLAA 2F8TA 4FWLA 2IDOA 1XMOK 1C0UA 1LWEA 4LY7A 2GTDA 3ZSOA 5FROA 2V52B 3MXJA 1T6DA 4M3UA 1N33K 5HLFA 3V6DA 2VGMA 3CJBA 4LF7K 3ZYYX 1KAZA 2Q0RA 1Q18A 1NK7A 1JLGA 2E2PA 1FJGK 3MX5A 1ASWA 1GLBG 2YHYA 4PKHA 4RW9A 5E84A 1Q86O 3QLHA 4BC4A 3W3DA 4IO9L 1ZBIA 4NXNK 4NCBA 4CZKA 5HRSA 1SQKA 3ZT3A 1QS4A 3V9UA 1L3UA 3V1OA 3ISNC 1KQSM 4A57A 1NGGA 5I42A 4CFBA 5KPTA 2ZE2A 1GLCG 5EVZA 4E7LA 2NRVA 3RTVA 4AHCA 1SL0A 4O5BA 1RILA 3QFUA 3PO5A 3VTHA 3KZBA 1NMNA 4OPAA 1XI1A 3CMEN 4C1NK 4O44A 4AHVA 4FK0A 3WXIA 3HO1A 2J4RA 1BCOA 2HBJA 2FBXA 2KFNA 3WXKA 2KFZA 4LF5K 4DKWA 3VQBA 4E1NA 4FWSA 2E8AA 4FK4A 1S5JA 2YJFA 4PKIA 1M1KO 3ULEB 4E7HA 4M63C 3BY5A 4JKEA 4GW6A 1U45A 1SZ2A 4X64K 3AVKA 3DMJA 4FZYA 3OBYA 4ISFA 3FGUA 1YVUA 3R1XA 1NKEA 2YKNA 3KKSA 4IG3A 4OVLA 5JS2A 3ENOA 5KGWA 3S3OA 3PX0A 2OZSA 1K8KB 5AQWA 4KHQA 3CMAN 3HYFA 1T05A 3VEXA 3OBWA 3C65A 2HHQA 1JLBA 3FZFA 4DQSA 1HNWK 3O3FA 5M1PA 1S6QA 3UE5A 4AHRA 3VQAA 1MDUB 4U7BA 4BRHA 1ZBUA 4JKGB 1W2BM 2XY6A 4BRFA 5C15A 1B9DA 3OYGA 4I6MB 4CGFA 4H5NA 1YHQN 2NRXA 1QQMA 2F8SA 1ESVA 1I39A 3I0RA 3DLGA 1ZC6A 3BP8A 1BDGA 2KW4A 2NLXA 2HMPA 1IKYA 3C95A 2D0PA 4NB4A 1S9GA 3TPQA 4B08A 1BWFO 1UA1A 2DFFA 4O0JA 1QZ6A 3GL1A 4J8FA 4Z4CA 2IVNA 4WF9L 1YJWN 5TKYA 4ISGA 4BRDA 1SS6A 5HROA 2NZTA 3FR0A 1VSFA 4F2SA 5KTQA 3AA5X 3NDKA 1HPZA 3ZEUA 1YI2N 3ASMA 1NGDA 2Q36A 1GLLO 4W5RA 3O3GA 3DYAA 4L3QA 2O4IA 2YKMA 1WUAA 4JKAA 3LDNA 4CF9A 3KKRA 4CZLA 3AAPA 2CH6A 3V9WA 3QEIA 2OTLN 1QSSA 4KTZA 1BIZA 1NJYA 3E1YA 2E6MA 2YHXA 1HYVA 4MLHA 3VQ4A 1TK8A 2UUBK 3I8BA 4M7XA 1CZAN 4ISEA 5ELZA 2O8FA 4K25A 3SJHA 4AILC 3TAFA 1SKSA 3IAYA 2YJEA 5DMRA 4C8MA 4E7KA 5KI6A 4FK2A 4Z4HA 3QERA 4H5VA 3V1QA 1EP4A 3I8DA 4FJ5A 3OVNA 3M6GA 4JI3K 4IOAL 3SLCA 1HNIA 3P39A 2WC9A 3VA0A 4WCEL 4B1WB 1EETA 3CCMN 3SNNA 1LAWA 2ASPA 4ILHA 1VHXA 2YHAA 5CZ1A 5FPMA 5F0XA 4JHDB 4IFYA 4B8CA 2KKZA 5EXWA 3ZSRA 3AVCA 3QEWA 1ZXOA 3CG7A 3PIOL 2CGJA 5MLCQ 1VRTA 2HOEA 4DSJA 2O4GA 4OGEA 1HKGA 3SQ2A 1YJ9N 4HTLA 2Q97A 4PUOA 3SMSA 3QIOA 3H1VX 4CFDA 2HBKA 3M1FA 3SMPA 5KRTA 1WOQA 4CF1A 1NGHA 4Z0UA 3CC7N 5DM7L 2QK9A 4BE2A 4F4KA 3L0QA 2E2NA 2R7YA 4DU3A 5M1NA 1ASVA 1QQCA 4PHTX 3U9DA 3ZSYA 3IDHA 2NNWA 3U4LA 3T69A 1WSEA 2D1KA 3LDSA 4GV9A 5FRMA 4FSVA 3LP1A 2PFUA 5C0YA 4JI7K 4DUZK 1MWMA 4BR5A 2IS3A 4Z4GA 4DUYK 3NH2A 4WQ4A 1RT5A 1SV5A 4AHTA 4LF4K 3C6HA 1KC8O 1NLVA 5AQYA 2CGLA 3AAQA 4ILGB 4KPYA 1R59O 3K9JA 3RMCA 4DR5K 3HPHA 3SJJA 2HF3A 5AFUH 3LM9A 1VAZA 4BRMA 1RDWX 2HHXA 2G8FA 4DS5A 2ZJQL 1O1WA 2HHVA 3F9KA 1XHZA 2HBMA 5AJ3K 4CEEA 4LSLA 3CJ7A 1YJNN 1J54A 2ZGYA 3SYZA 1XNRK 1QHTA 3UKUB 4FLWA 4NLBA 4F9OA 2A41A 4O4GA 4DTRA 4IOXA 2Q31A 3SBGA 1VSKA 1N32K 4B3SK 1S9EA 2VCPA 5LJWA 1RDUA 2EX3A 3MECA 1WSHA 1HR0K 2E6LA 4AM7A 2QA4N 3EYZA 1TAQA 2GX9A 4DR7K 4JD2B 3ULDA 4XEIA 1IKXA 2F9WA 2O8CA 1ILYA 2P51A 3A0IX 3WUHA 5FDLA 4M3XA 2YNIA 3SUNA 4CECA 3HXMA 4FM1A 4BR2A 2PYLA 4A2AA 3THYA 1F21A 1DKGD 4HCBA 4FCYA 4B1VA 3DOKA 4KFBA 2HHWA 3CFOA 3ID8A 3WXLA 4CBWA 1NK0A 3DXKB 3V9SA 4BR4A 4DHYA 4I9QA 3HBTA 3I33A 3OYEA 3SCXA 3CFRA 1MWKA 4E19A 4H0YB 5C12A 3MCAB 3K9KA 4CHQA 3DLKA 3ZLJA 4QOZB 1IKVA 4FOIA 4GY2B 1YAGA 3CI5A 3THXB 3LZJA 1B9FA 3SBTA 3MN6A 1GOCA 2BE2A 3BF1A 2GUIA 1JL2A 2QWLA 1A5WA 1EO1A 4KREA 4GKJK 5AZJB 3OYLA 1QZ5A 3BZCA 4DTNA 4GV3A 2D4WA 1QSLA 4KHPK 2GWKA 2P9SB 3ZETA 2ASMA 3L2UA 4DF8A 4DTSA 3VEWA 3IFRA 3N4PA 2PBDA 3ZX0A 1E4FT 2HBLA 2FBTA 2P9NA 4B8AB 4I7FA 4Z4FA 2IVOA 3SUPA 1YXQA 4UQGA 1VSDA 1Y97A 1QVFM 2OA8A 2GBZA 2DFHA 3LZIA 1LOTB 3MX2A 4H03B 2G8WA 3G6EN 3U8XA 4LF6K 1NGEA 3AO5A 2UU9K 4KO0A 3VOVA 2P1JA 3IMXA 5EOYA 1TK0A 5AZIB 2O8DB 1BQNA 2VYPA 3CJ9A 3AVJA 3U9ZA 4CGGA 1KVCA 2OCEA 3M8QA 4KB0A 2AA4A 3E9OA 3SQ4A 3CD6N 1C0FA 3PSFA 4EFHA 1X3NA 3IUCA 3IS9A 4JAXA 4CJ5A 5F1XA 3ZX3A 4DSIA 1OH8A 3HTVA 1LW2A 2NRZA 5GAEP 3VEVA 1FW6A 4FLYA 1TYQA 4F3OA 3P38A 4CK3A 2QWPA 1JCFA 4A61A 3AA3A 3D7EO 4YOYA 2P9PA 1P90A 2VWJA 3O9TA 2ZM6K 5GIOA 3C7NA 3EN9A 4IO8A 3VESA 4CJLA 3O9QA 5AQHA 2WFBA 2RPIA 4HHTA 1WBBA 3RRGA 3HM9A 3NVKA 5AQQA 4JI2K 3NE6A 2P9KA 3EY1A 4CVNE 4PKGA 2P9UA 3KK7A 2FF3B 2Z1IA 4JKDA 3TTDA 1G15A 2CH5A 3KLGA 1SL1A 3DLEA 1VQKN 1TGOA 3OJSA 2D0AA 2IIRA 1T3VA 4CI6A 3K58A 3M8RA 2F7TA 2F96A 5EU7A 1EWQA 4DTXA 3OA9A 3TTFA 4BRNA 4FL9A 1NU0A 5GIPA 2V7YA 1BU6O 1CXQA 3D2FA 4BVOA 4Z4IA 3QEXA 3SUOA 3O6WA 4C8LA 2FXUA 3K5MA 3GE1A 3DXMA 3K2PA 4KV8A 4YDUA 3QBXA 3C94A 3F2KA 5BN9A 2JWKA 3PSIA 4Z94A 1GLJO 1WBDA 1UOCA 1SUQA 1Z6RA 4JLHA 4DSKA 3RMBA 1HJRA 1JLAA 4W5QA 1S3XA 3VEZA 3QETA 4X65K 5JS1A 3ZT1A 1HKCA 3VMFB 4DTOA 3TR8A 4YOUA 1C0MA 4DLGA 1RTJA 4EHTA 2V7ZA 1HYSA 1VQPN 3GOIA 5HOOA 1X9JA 4PL7A 3LALA 4JRPA 4K42A 1VSIA 1VQMN 3TAGA 5IWAK 3RR7A 5HRNA 3G25A 4H4MA 4DR1K 2FF6A 4MDAA 1Q9XA 2P9IA 3QEPA 5E26A 1NGAA 1XHXA 4CZIA 1K6YA 4LF8K 2IVPA 3TAQA 1U4BA 3CCJN 4DV2K 2IC3A 1NOYA 3QNNA 4W5TA 1NK4A 1XMQK 3VQ6A 4J2EA 1IJJA 4G9ZA 3WNFA 4A5AA 3BZKA 4LC9B 4OJRA 1K9MO 2FSKA 4LH4A 1D9FA 1NJWA 1IG9A 4FW1A 3L2WA 3KLFA 2KHOA 4NYFA 1DGKN 2Q3SA 3HP6A 2QTDA 4KTQA 1KXPA 1KAYA 3WXJA 4B9QA 3O5BA 4KHUA 3VPZA 1IBLK 3ATUA 5AQKA 1HUXA 3VENA 1FK9A 1EQYA 1YVNA 4DQRA 3EL2A 3MWTA 3CCSN 2WOMA 3ZEUB 3ZT4A 1S6PA 4LD0A 3MMVA 3HI0A 1GOBA 4DQQA 3QESA 4IDKA 2HB5A 4CEFA 3MXMA 2A40A 3GG4A 4CHOA 2OPRA 4YOVA 4DS4A 1N8RO 3TTCA 3C6AA 2XY7A 4N76A 3I56N 4BRQA 2HNDA 2DTUA 4EIAA 3OW2M 3SV4A 3KD1E 4EAHD 4K8ZA 2HNZA 4HVJA 4DFJA 3HT3A 4CESA 2F9TA 1RGIA 3S41A 4MLEA 1NKBA 1FXXA 3NCIA 4GMJB 3WNHA 4AHSA 4FOEA 1ITGA 2UUCK 4JI5K 4JI1K 4CEBA 1VQON 1QHAA 2BDPA 1NGCA 1GOAA 2A42A 2ASOA 4N47A 3AA2A 1X1PA 4DWIA 1BI4A 3ZSQA 3LDOA 4E1MA 2ETJA 1T03A 2ZWHA 3VEOA 3V9ZA 3O9RA 4BRLA 1OH6A 3VA3A 3PX6A 4RW6A 3J7YP 1GLEG 1E3MA 4RWTA 4DV1K 2XY8A 1RT4A 4RW8A 4FJLA 1JJ2M 1D4XA 4CD1A 2RE2A 3VF2A 5J2QA 1DTTA 1N6QA 3A8YA 3RMDA 4OPKA 1TKZA 3AVLA 5BPNA 2P5OA 2JGUA 1KD1O 4PWDA 4JV5K 1REVA 3B8AX 4J2AA 4E0DA 1HX1A 4RW4A 4KHWA 3CXCM 2HNYA 2DFEA 3KHYA 4Z4EA 3RWUA 3AVIA 1VSHA 4DV4K 4QAGA 4H0VB 4PL8A 1EKEA 3HJFA 4KKOA 1K73O 4KH5A 1OVYA 4B9MA 3QMLA 3TAEA 1N36K 4FWNA 3OYBA 2B5JA 2Y1IA 3B6OA 1S1UA 3TANA 4KB1A 2IOCA 4H5TA 1ASUA 1ZYQA 4BRPA 2FBYA 5KRSA 2HHTA 4KH6A 4LH5A 3IRXA 5KQ8A 4BWJA 3O3HA 4FWPA 4HUFA 2GELA 4JK9A 4CERA 4DQIA 3AVAA 4BWMA 1NGIA 3TSQA 3D2EA 3CCUN 1TUYA 4H0TB 5AQSA 1HNVA 3FZMA 2HHUA 5FPDA 2EHGA 1MA9B 3JXUA 3PV8A 4XIUA 2E5LK 3RRHA 4YOXA 4DQPA 5JMVA 4FPBA 3QBWA 3JYTA 4CHNA 4FPAA 4A62A 4RW7A 5AQNA 1XNQK 3PY8A 4CE9A 2ATQA 3LDPA 5B8HA 3MEEA 2I5JA 2PAVA 4W5OA 3AGKA 4CJ4A 2E2OA 4M45A 3NH0A 3R6MA 4LFCK 4I6MA 4AHUA 5JVGL 2RF2A 2WONA 3IKMA 4KBOA 3RVCA 2XY5A 4CJQA 5LL6Z 4IJAA 1KAXA 4N41A 2X6NA 2GV9A 4LFAK 3OHRA 4B3RK 1NWKA 4CGDA 4CZMA 4DTMA 2G8KA 3DLLL 4CEOA 3P1GA 1WLJA 4JKBA 4H5WA 3NGYA 3MCPA 5AQJA 4CJTA 4DR3K 2GEMA 4CHYA 3NF8A 4R79A 3VQEA 4M41A 2O8CB 3R9PA 4OKKA 5JLFA 3ZCMA 4N5SA 3VQ9A 3LM2A 3K5NA 3LAMA 3O1BA 3MK6A 3THYB 2YI1A 3KWGA 5AQGA 4HTUA 2NRTA 1L3TA 4JNEA 4HUEA 2O8BA 4F2RA 2ITMA 4HUGA 4BY9C 4B9VA 3BF3A 1WN7A 1TVRA 5BREA 5DM6L 4OLAA 1YIJN 1KFSA 4IEEA 2EWSA 3NVMA 2VG6A 3V81A 2A1RA 2O8EA 4K43A 1C6VA 3AO4A 4CBXA 3ZX2A 2BTFA 4JEPA 4M42A 3PX4A 3SUQA 1L5UA 3ZSVA 2BUPA 1S72N 3ATVA 3GDQA 2NUBA 3PUFA 4FWRA 2BH1A 3FZKA 2JWLA 4FJNA 3O4WA 4NYNA 3AVNA 1A5XA 2QM1A 5KPZA 4CD3A 4ID1A 1KVAA 3AVBA 3ZETB 4CZJA 4R5PA 3I0SA 4DR2K 1SAZA 2KZMA 1DT9A 4BROA 1K8AO 4CCHA 5D3GA 4FVMA 3AV9A 4ILJA 2P9NB 1HLUA 2FSJA 4DSEA 3WEEB 1NM1A 3KJVA 1QE1A 4IWVA 1J6ZA 4RTFD 3TSPA 4JRQA 4HCCA 1BISA 2FC0A 3VGMA 4M3RA 2HVHA 4XH1A 2RKIA 5JICA 4C23A 2OZMA 1KSPA 3THVA 3SQ1A 5J1EA 4MDBA 3DLHA 3WQTA 1BL3A 1UAXA 3EZWA 1SL2A 3DRSA 2IAJA 1QQNA 4BG8A 4CJ3A 1L3SA 2X78A 2YCHA 4O8KA 4GNIA 4KI4A 3J8AA 1YITN 2HSTA 3CCLN 3J7AP 2Z1JA 1BA0A 1T6CA 1RDAA 4IXCA 3TABA 4B9TA 1NOZA 5I3UA 3KLIA 1RT7A 3T19A 1C1BA 4FLTA 2Q0UA 2VQFK 1XC9A 3FZLA 4BRCA 1TYQB 3MEDA 4DTPA 1SKRA 4ID5A 3OYMA 1IG8A 3L3VA 3CC2N 2ZF5O 2I7PA 2KQ2A 3A5LC 2YX6A 1WAJA 2P9PB 3VF4A 3AY9A 5CYQA 3KLHA 3VGLA 1RBUA 2G8UA 1JLFA 5BRFA 5BRDA 1BG3A 4JS4A 3KLEA 4O8UA 4U67L 1VQ4N 1IO2A 3EE8A 5GAHP 1T44A 1VQ5N 3WNEA 4A59A 5CHIA 2HHSA 2P9KB 4H0XB 2P9UB 3KWIA 2OYQA 3KK2A 4OPJA 4O0IA 1CXUA 3OYDA 4OLBA 1U2VB 5C24A 4DQ8A 4CJUA 4FJXA 1TAUA 3CCEN 3QIPA 5HL7L 4BE1A 3M8PA 1L3VA 5ADXH 1D9DA 1VQ7N 4CZGA 1NJXA 1TKTA 3BUZB 3O9SA 4JS5A 3RMAA 1U49A 5FPEA 3D2FB 2HMIA 2NRRA 5M1QA 2QEXN 2QI2A 4DV3K 3DJCA 2UYTA 1BHLA 3CERA 1OKJA 1JXBA 3CJCA 1ZBSA 5SZTA 3QEVA 2P9LA 5BPLA 1HMVA 3TI0A 3TU5A 3SK3A 4LFBK 5TKWA 4FW2A 3FFKB 5LY3A 4CZEA 1W7AA 5CY4A 4FLXA 4Y1DA 4H4OA 1NJZA 3CQXA 3EE9A 3LDQA 4I9LA 1XWLA 4H8KA 3Q7BA 4JK7A 3UKRA 1KVBA 4CFAA 3OYNA 1X9MA 3QINA 1Q9YA 1I94K 4KH4A 3WXMB 4ELVA 3KIOA 2X6SA 4XH4A 4ICLA 3SPYA 2NRHA 2P9IB 5EY4A 4LSNA 1RTDA 4WQ5C 3E9PA 5LJVA 3HPGA 3AVMA 4FWOA 3Q7CA 1TKXA 3E01A 1VQNN 3CETA 2KZZA 3TARA 1G99A 4NLCA 1JCEA 5KGXA 4FJGA 1RT6A 4DF4A 1CZ9A 4TSXA 5GADP 4B9LA 4FWQA 3F5TA 3SQ0A 4B9NA 3AA4A 3WT0A 4B3OA 4DFKA 1C0GA 4KI6A 4BDPA 1CLQA 4CEQA 4WFAL 4W5NA 1ATNA 3OYFA 4IKFA 4IG0A 4CHPA 3KD5E 5AQLA 4FLUA 5GAGP 4RCHA 1RFQA 5AZJA 3V9XA 3KK1A 3WNGA 3A5MC 4DSFA 1NK9A 3NFAA 4C8KA 3NMUA 4BC3A 2QWOA 3K5LA 3CPWM 3AVGA 5HRRA 4H0OA 4CGHA 5BR9A 4DU1A 4AH9A 5CE3A 1Z05A 3FFIA 3HPOA 4Q5VA 4DCHA 3CJAA 4FJ9A 1VSEA 4DV0K 4IOCL 1YF5L 1U47A 1S22A 3OYCA 4CJVA 3L2VA 2XRIA 2BGGA 5K14A 1TL1A 3O9UA 2W40A 3CCQN 5C42A 3QDKA 4WFBL 3LAKA 3THWA 2F4VK 1R0AA 4E3SA 3RR8A 4CJPA 3E9LA 4AF1A 5HRPA 2UUAK 3CFPA 1NG9A 4JK8A 3T1HK 4J2DA 2H3GX 1NGJA 3OYHA 1TUUA 3KK3A 3AO1A 2PZSA 3IG1A 4X66K 3MEGA 3NF6A 4BDZA 1H1VA 4FYDA 4BR0A 3JAMO 4CK2A 3CCRN 4KHSA 4FWKA 3TAMA 4E7IA 2ITGA 4QCLA 4YHHK 3V4IA 3LWLA 4NO7A 1BI4B 3J81O 3G0ZA 4B9UA 2YHWA 3SAGA 3OS0A 1NK8A 1NNEA 4OX9K 1C1CA 4IJNA 4JN4A 1Z25A 5C25A 1YTAA 1YUWA 2D0OA 2RHKA 1HQEA 2GWJA 1IBKK 3G4SN 2WBNA
chains in the Genus database with same CATH topology
2HBMA 4H5TA 4BRGA 4BRPA 2Q1NA 3R8EA 5KPZA 3CPEA 3CJ7A 5BRHA 4KH6A 3A5NC 1YJNN 3C0BA 5KPRA 2ZGYA 1V4SA 5KQ8A 4JKFA 3UKUB 4A5BA 4JKCA 1M90O 4NLBA 4FWPA 3J7ZO 4F9OA 2A41A 1XQSC 2GELA 3D6RA 4JK9A 1O13A 3EKSA 4IOXA 4WQ5A 4MO5A 3MN7A 1NGIA 3TSQA 2Q31A 3SBGA 4BQZA 3D2EA 3I55N 3CCUN 1TUYA 3CQYA 4XH5A 2FLOA 4B1XB 4H0TB 3DXKA 2VCPA 4M7YA 5AQSA 5LJWA 3FZMA 3UB5A 3VEYA 1RDUA 1XUPO 3H3NO 3PLAA 5FPDA 1MA9B 3JXUA 2VGNA 3CHWA 4GV6A 4AM7A 2QA4N 3WQUA 4GVEA 3KVGA 4YOXA 3ENBA 2GX9A 4JD2B 2ZJPL 5JMVA 4FPBA 3QBWA 3QICA 1BUPA 3H45C 2F9WA 4XEIA 1ILYA 5BN8A 3A0IX 3WUHA 5KQDA 2QWNA 1NMDA 4FPAA 4IFEA 4A62A 4YORA 5AQNA 3O08A 3LDPA 5B8HA 4BR2A 3FZHA 2PAVA 3FE1A 4A2AA 4BQLA 3AGKA 2V51B 2E2OA 1DKGD 3ID6A 3LDLA 3P4IA 4B1YB 2P9SA 1U2VA 3R6MA 4B1VA 4I6MA 4BRKA 5JVGL 3IKMA 5JLHA 4KBOA 3RSEA 3RVCA 3ID8A 1BO5O 1X3MA 4JKHA 3WXLA 2E1ZA 2FSNA 1NGFA 4IJAA 1KAXA 1NBWA 4CBWA 3D2EB 1QQOA 3DXKB 4BR4A 3LL3A 3M3ZA 3QB0A 5CR4A 4DHYA 3OHRA 5F2RA 3HBTA 1NWKA 3I33A 4CZMA 2CGKA 4OO1J 3DLLL 1BOTO 1MWKA 4H0YB 4QS9A 5C12A 4JKBA 3MCAB 4H5WA 2E1YA 3K9KA 3MCPA 5AQJA 4YOWA 5AQZA 2GEMA 5ADXA 2AP1A 4R79A 4FOIA 4YDUC 3VERA 4GY2B 4BVPA 1YAGA 3CI5A 4QS7A 5AQFA 3R9PA 3SBTA 3MN6A 5JLFA 3BF1A 5EX5A 3G71N 2QWLA 1VQ6N 3VETA 3LM2A 3O8MA 1LCUA 5AZIA 2E20A 1EO1A 3O1BA 3MK6A 5AQMA 5AZJB 1XC3A 2YI1A 3KWGA 1QZ5A 3SAFA 5AQGA 4GV3A 2QWMA 2D4WA 2NRTA 1ATSA 4JNEA 1Y64A 2GWKA 2P9SB 3ZETA 2ASMA 4BREA 3TSUA 2ITMA 4BY9C 3N4PA 3IFRA 3RSEB 2PBDA 3VEWA 1E4FT 3BF3A 3ZX0A 3MN5A 1NJIO 1HJOA 2HBLA 2P9NA 3MDQA 3O1WA 2IVOA 5M1OA 1YXQA 5BREA 5DM6L 4BR7A 1YIJN 4IEEA 1VQLN 3JS6A 2EWSA 3NVMA 5AQPA 5H1SQ 5AQUA 5AFUA 3EO3A 1QVFM 2Q2RA 3H46O 4K43A 5C2DA 4FO0A 2KLAA 3R3LA 4FWLA 1LOTB 5AQVA 3MX2A 4H03B 1Q7YO 2GTDA 4CBXA 3ZX2A 2V52B 2BTFA 4JEPA 1T6DA 3G6EN 2BUPA 3U8XA 1S72N 1NGEA 2VGMA 3CJBA 3ATVA 3GDQA 2QWQA 3VOVA 3CC4N 3ZYYX 3IMXA 5EOYA 1KAZA 5AQRA 4FWRA 5AZIB 2VYPA 2BH1A 3CJ9A 3FZKA 3U9ZA 2Q0RA 1Q18A 2JWLA 2HF4A 3O4WA 2AA4A 3E9OA 2E2PA 3CD6N 2QM1A 3MX5A 4CD3A 1C0FA 1GLBG 2YHYA 4PKHA 3VTIA 2WUSA 5E84A 4EFHA 1Q86O 1X3NA 3W3DA 4BC4A 3IUCA 3ZETB 4CZJA 4IO9L 3PIPL 3ULEA 1SAZA 4JAXA 4CZKA 1SQKA 3ZX3A 5F1XA 4B1UB 1DT9A 4BROA 1E4GT 1K8AO 4ILJA 1KQSM 3HTVA 2P9NB 1HLUA 2NRZA 2FSJA 3VEVA 4A57A 5GAEP 3WEEB 1NGGA 1NM1A 1TYQA 2ZGZA 3HOSA 3P38A 2VWBA 5KPTA 1GLCG 2QWPA 1J6ZA 4IWVA 1JCFA 4RTFD 3CJ1A 3D7EO 5EVZA 4A61A 4BC5A 4BG9A 4B1ZA 2ZJRL 3TSPA 2NRVA 4YOYA 2P9PA 1P90A 4UY8O 5GINA 1K8KA 3VGMA 3P31A 4BGBA 3O9TA 4XH1A 5JICA 4C23A 5GIOA 1NGBA 3C7NA 3EN9A 4IO8A 3VESA 4MDBA 3QFUA 3WQTA 1Q81O 3O9QA 3EZWA 3VTHA 4BG8A 3KZBA 1QQNA 2WFBA 5AQHA 3T7ZA 4OPAA 3H6EA 3CMEN 4C1NK 3NVKA 2YCHA 4O8KA 5AQQA 4GNIA 2P9KA 1GLAG 3WXIA 5C10A 2J4RA 2HBJA 2P9UA 3J8AA 3KK7A 2FF3B 2HSTA 3L6QA 4PKGA 3WXKA 1YITN 4JKGA 4JKDA 1BA1A 3CCLN 1BA0A 3TTDA 3VGKA 3BEXA 4DKWA 1T6CA 4FWSA 4IXCA 2E8AA 2CH5A 2YJFA 4PKIA 1M1KO 1VQKN 3ULEB 2IIRA 4M63C 1T3VA 4CI6A 4JKEA 2F7TA 2Q0UA 1GLFO 1SZ2A 3FZLA 4BRCA 1TYQB 3OBYA 3OA9A 3TTFA 4ISFA 4BRNA 1IG8A 3FGUA 3CC2N 1GLDG 2ZF5O 1HPMA 2I7PA 3R1XA 4FL9A 1V4TA 4H0PA 3A5LC 5GIPA 1P8ZA 2V7YA 2YX6A 3HRGA 1BU6O 3ENOA 2P9PB 3VF4A 3AY9A 3D2FA 4BVOA 1K8KB 5AQWA 3A5OC 3CMAN 3O6WA 3VGLA 2FXUA 3GE1A 5BRFA 3DXMA 4K41A 5BRDA 1BG3A 3VEXA 4YDUA 3QBXA 3OBWA 3F2KA 3C65A 2JWKA 5BN9A 4Z94A 4O8UA 1GLJO 3FZFA 4U67L 4CJ7A 1VQ4N 3EE8A 5GAHP 1T44A 1VQ5N 1Z6RA 5M1PA 4A59A 5CHIA 2P9KB 3UE5A 3F9MA 4H0XB 2P9UB 4CZHA 1MDUB 1DEJA 4BR9A 3KWIA 4U7BA 1S3XA 4BRHA 4JKGB 3VEZA 1W2BM 2OANA 5AQIA 1HKCA 3VMFB 4BRFA 1U2VB 5C15A 4DQ8A 4I6MB 3E66A 3HOTA 3CCEN 4H5NA 1YHQN 2NRXA 1QQMA 4YOUA 1ESVA 3HSCA 4WFNL 4EHTA 2V7ZA 1ZC6A 5HL7L 1VQPN 3BP8A 3GOIA 5HOOA 1X9JA 3ENHA 3SAHA 5ADXH 1BDGA 4PL7A 2NLXA 4CZGA 1Q82O 4K42A 2HMPA 1VQ7N 3BUZB 1VQ9N 3O9SA 1VQMN 1QVGM 2D0PA 3W0LA 4NB4A 4FVUA 3TPQA 5FPEA 1BWFO 3G25A 5AQOA 3D2FB 2E88A 1QZ6A 2NRRA 3GL1A 2FF6A 3HZ6A 4J8FA 2IVNA 4MDAA 5M1QA 2P9IA 3EKUA 4WF9L 2QEXN 2QI2A 1YJWN 5TKYA 3DJCA 4ISGA 4BRDA 2UYTA 1SS6A 3CERA 2NZTA 5E26A 1OKJA 1NGAA 3FR0A 3CJCA 1ZBSA 3L4QA 4CZIA 2P9LA 2IVPA 4FWMA 3CCJN 5BPLA 3ZEUA 1YI2N 3TU5A 4WQ4C 1NGDA 2I7NA 3SK3A 2Q36A 1GLLO 5TKWA 1IJJA 4L3QA 4G9ZA 2QWRA 3FFKB 5LY3A 1WUAA 4CZEA 4A5AA 4JKAA 3LDNA 4IDHA 4CZLA 4LC9B 3CQXA 3EE9A 3LDQA 4E1JA 2FSKA 1K9MO 3AAPA 2CH6A 5AQTA 3Q7BA 4JK7A 2W41A 3UKRA 2OTLN 1JCGA 4JHDA 2KHOA 3E1YA 1DGKN 2YHXA 2QTDA 4MLHA 2A3ZA 3I8BA 4KH4A 1CZAN 1KXPA 4M7XA 3WXMB 4ISEA 1KAYA 3AARA 5ELZA 4K25A 3WXJA 4XH4A 3SJHA 4B9QA 5M1FA 3O5BA 4HWIA 4BRAA 2NRHA 2P9IB 2YJEA 3QFPA 5EY4A 3VPZA 3ATUA 4WQ5C 5AQKA 4AM6A 1U6ZA 3E9PA 3HM8A 1HUXA 2GUPA 5LJVA 4FWOA 3Q7CA 3VENA 3H3OB 1EQYA 1YVNA 1VQNN 3CETA 2P9LB 3CIPA 3EL2A 3MWTA 3CCSN 1G99A 4H5VA 4NLCA 1JCEA 4OPHA 5BPMA 3M6GA 3ZEUB 4IOAL 5AQXA 3MMVA 3SLCA 5GADP 4FWQA 3P39A 3F5TA 3HI0A 2WC9A 4WCEL 2QW9A 4B1WB 3CCMN 3WT0A 1C0GA 2ASPA 2A40A 4WFAL 3GG4A 4YOVA 1ATNA 4ILHA 3FLCO 2NRWA 1N8RO 2DPNA 3TTCA 3UKRB 3VF6A 4A2BA 3C6AA 5FPMA 5F0XA 3I56N 4JHDB 4BRQA 2KKZA 5AQLA 5EXWA 4EIAA 5GAGP 3OW2M 4RCHA 1RFQA 4EAHD 5AZJA 4EHUA 3A5MC 1ZXOA 1ATRA 3PIOL 3NMUA 2F9TA 2A5XA 5AR0A 1RGIA 2CGJA 4BC3A 2QWOA 3S41A 5MLCQ 4MLEA 3CPWM 4YOTA 4CZFA 2HOEA 3C7NB 3MWPA 5FPNA 1VQ8N 1HKGA 4FOEA 4H0OA 2E2QA 1YJ9N 4HTLA 2Q97A 5BR9A 3SMSA 5CE3A 1Z05A 5JVHL 1VQON 4DCHA 3CJAA 1QHAA 3H1VX 2HBKA 4IOCL 1YF5L 1NGCA 2A42A 2ASOA 3M1FA 1S22A 4H5RA 3LDOA 3SMPA 4DB3A 1HKBA 1WOQA 4BRIA 2A6AA 2ZWHA 3VEOA 3O9RA 4BRLA 3CCVN 1NGHA 3O9UA 4Y0WA 2W40A 3CCQN 3CC7N 3QDKA 5DM7L 4WFBL 4BGAA 1GLEG 4MO4A 4QS8A 3E9LA 4AF1A 3L0QA 4RWTA 2E2NA 3AGRA 4C1NI 5M1KA 3N4QA 5M1NA 4JK8A 3M5RA 3DAWA 4PHTX 1W97L 3U9DA 1JJ2M 5C2FA 1D4XA 2H3GX 1NGJA 4CD1A 1TUUA 2RE2A 3UKUA 3VF2A 3IDHA 2NNWA 3U4LA 3A8YA 3T69A 2D1KA 3CF5L 4GV9A 1H1VA 3DWLA 3DXMB 4FSVA 2PFUA 4IEIA 4IZ9A 5BPNA 5C0YA 3O80A 4O5FA 4BR0A 4CBUA 1MWMA 3WEEA 3CCRN 5I9EB 4BR5A 1KD1O 4FWKA 3B8AX 1HX1A 3H1QA 4WQ4A 4NO7A 3CXCM 3C6HA 4BC2A 1KC8O 1NLVA 3GBTA 3KHYA 5AQYA 2CGLA 3AAQA 4ILGB 1R59O 3K9JA 2QXLA 2YHWA 2HF3A 4JD2A 4H0VB 3MN9A 4PL8A 3SAGA 5AFUH 3LM9A 1K73O 4IJNA 4KH5A 1VAZA 4JN4A 1OVYA 3L4IA 1YUWA 2D0OA 1RDWX 4BRMA 3QMLA 2RHKA 2OTJN 2GWJA 2ZJQL 4FWNA 4WYBA 3G4SN 2WBNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H5T A;  4BRG A;  4BRP A;  2Q1N A;  3R8E A;  3CJ7 A;  5BRH A;  3A5N C;  3C0B A;  5KPR A;  2ZGY A;  1V4S A;  5KQ8 A;  3UKU B;  4FWP A;  4F9O A;  2A41 A;  1XQS C;  2GEL A;  3EKS A;  4WQ5 A;  4MO5 A;  3MN7 A;  1NGI A;  2Q31 A;  4BQZ A;  3D2E A;  1TUY A;  3CQY A;  4XH5 A;  2FLO A;  4B1X B;  4H0T B;  3DXK A;  2VCP A;  4M7Y A;  5AQS A;  5LJW A;  3FZM A;  3UB5 A;  3VEY A;  1XUP O;  3H3N O;  5FPD A;  1MA9 B;  3JXU A;  3CHW A;  4AM7 A;  3WQU A;  3KVG A;  4JD2 B;  5JMV A;  4FPB A;  3QBW A;  3QIC A;  1BUP A;  3H45 C;  2F9W A;  4XEI A;  5BN8 A;  3A0I X;  3WUH A;  5KQD A;  2QWN A;  1NMD A;  4FPA A;  4A62 A;  5AQN A;  3O08 A;  3LDP A;  5B8H A;  4BR2 A;  3FZH A;  3FE1 A;  2PAV A;  4A2A A;  4BQL A;  2V51 B;  2E2O A;  1DKG D;  3LDL A;  3P4I A;  4B1Y B;  2P9S A;  1U2V A;  3R6M A;  4B1V A;  4I6M A;  4BRK A;  5JLH A;  4KBO A;  3RSE A;  3ID8 A;  1BO5 O;  1X3M A;  3WXL A;  2E1Z A;  2FSN A;  1NGF A;  4IJA A;  1KAX A;  1NBW A;  4CBW A;  3D2E B;  1QQO A;  3DXK B;  4BR4 A;  3LL3 A;  3M3Z A;  3QB0 A;  4DHY A;  3OHR A;  5F2R A;  3HBT A;  1NWK A;  3I33 A;  4CZM A;  2CGK A;  1BOT O;  1MWK A;  4H0Y B;  4QS9 A;  4H5W A;  2E1Y A;  3MCP A;  5AQJ A;  5AQZ A;  2GEM A;  5ADX A;  2AP1 A;  4FOI A;  4YDU C;  3VER A;  4GY2 B;  4BVP A;  1YAG A;  3CI5 A;  4QS7 A;  5AQF A;  3R9P A;  3MN6 A;  5JLF A;  3BF1 A;  5EX5 A;  2QWL A;  3VET A;  3LM2 A;  3O8M A;  1LCU A;  5AZI A;  2E20 A;  3O1B A;  3MK6 A;  5AQM A;  5AZJ B;  1XC3 A;  2YI1 A;  1QZ5 A;  5AQG A;  2QWM A;  2D4W A;  1ATS A;  4JNE A;  1Y64 A;  2GWK A;  2P9S B;  3ZET A;  2ASM A;  4BRE A;  2ITM A;  3VEW A;  3IFR A;  3RSE B;  2PBD A;  3ZX0 A;  1E4F T;  3BF3 A;  3MN5 A;  1HJO A;  2P9N A;  3MDQ A;  3O1W A;  2IVO A;  1YXQ A;  5BRE A;  4BR7 A;  3JS6 A;  2EWS A;  5AQP A;  5AQU A;  5AFU A;  3EO3 A;  2Q2R A;  3H46 O;  4K43 A;  4FO0 A;  4FWL A;  1LOT B;  5AQV A;  4H03 B;  2GTD A;  4CBX A;  3ZX2 A;  2V52 B;  2BTF A;  1T6D A;  2BUP A;  3U8X A;  1NGE A;  3CJB A;  3ATV A;  3GDQ A;  2QWQ A;  3VOV A;  3IMX A;  5EOY A;  1KAZ A;  5AQR A;  4FWR A;  5AZI B;  2VYP A;  3CJ9 A;  3FZK A;  3U9Z A;  2Q0R A;  1Q18 A;  2HF4 A;  3O4W A;  2AA4 A;  2E2P A;  2QM1 A;  5KPZ A;  4CD3 A;  1C0F A;  1GLB G;  2YHY A;  4PKH A;  2WUS A;  5E84 A;  4EFH A;  1X3N A;  3W3D A;  4BC4 A;  3IUC A;  3ZET B;  4CZJ A;  3ULE A;  1SAZ A;  4JAX A;  4CZK A;  1SQK A;  3ZX3 A;  5F1X A;  4B1U B;  4BRO A;  1E4G T;  3HTV A;  2P9N B;  1HLU A;  2FSJ A;  3VEV A;  3WEE B;  1NGG A;  1NM1 A;  1TYQ A;  2ZGZ A;  2VWB A;  5KPT A;  1GLC G;  2QWP A;  1J6Z A;  4IWV A;  1JCF A;  4RTF D;  3CJ1 A;  3D7E O;  5EVZ A;  4A61 A;  4BC5 A;  4BG9 A;  4B1Z A;  2P9P A;  1K8K A;  3VGM A;  4BGB A;  4XH1 A;  5JIC A;  4C23 A;  1NGB A;  3C7N A;  3EN9 A;  4IO8 A;  3VES A;  3QFU A;  3WQT A;  3EZW A;  4BG8 A;  3KZB A;  1QQN A;  5AQH A;  3H6E A;  2YCH A;  4O8K A;  5AQQ A;  4GNI A;  2P9K A;  1GLA G;  3WXI A;  2J4R A;  4PKG A;  2P9U A;  3J8A A;  2FF3 B;  3L6Q A;  3WXK A;  1BA1 A;  1BA0 A;  3VGK A;  3BEX A;  1T6C A;  4FWS A;  4IXC A;  2E8A A;  2CH5 A;  2YJF A;  4PKI A;  3ULE B;  2IIR A;  4M63 C;  4CI6 A;  2Q0U A;  1GLF O;  1SZ2 A;  3FZL A;  4BRC A;  1TYQ B;  4ISF A;  4BRN A;  1IG8 A;  3FGU A;  1GLD G;  2ZF5 O;  1HPM A;  2I7P A;  4FL9 A;  1V4T A;  4H0P A;  3A5L C;  1P8Z A;  2V7Y A;  1BU6 O;  3ENO A;  2P9P B;  3VF4 A;  3AY9 A;  3D2F A;  4BVO A;  1K8K B;  5AQW A;  3A5O C;  3O6W A;  3VGL A;  2FXU A;  3GE1 A;  5BRF A;  3DXM A;  4K41 A;  5BRD A;  1BG3 A;  3VEX A;  4YDU A;  3QBX A;  5BN9 A;  4Z94 A;  1GLJ O;  3FZF A;  4CJ7 A;  1T44 A;  1Z6R A;  2P9K B;  3UE5 A;  3F9M A;  4H0X B;  2P9U B;  4CZH A;  1MDU B;  1DEJ A;  4BR9 A;  1S3X A;  4BRH A;  3VEZ A;  2OAN A;  5AQI A;  1HKC A;  4BRF A;  1U2V B;  4DQ8 A;  4I6M B;  4H5N A;  1QQM A;  1ESV A;  3HSC A;  4EHT A;  2V7Z A;  1ZC6 A;  3BP8 A;  3GOI A;  1X9J A;  3ENH A;  5ADX H;  1BDG A;  4PL7 A;  2NLX A;  4CZG A;  4K42 A;  2HMP A;  3BUZ B;  2D0P A;  3W0L A;  4NB4 A;  3TPQ A;  5FPE A;  1BWF O;  3G25 A;  5AQO A;  3D2F B;  2E88 A;  1QZ6 A;  3GL1 A;  3HZ6 A;  2FF6 A;  4J8F A;  2IVN A;  2P9I A;  3EKU A;  5TKY A;  3DJC A;  4ISG A;  4BRD A;  2UYT A;  3CER A;  2NZT A;  5E26 A;  1OKJ A;  1NGA A;  3FR0 A;  3CJC A;  1ZBS A;  4CZI A;  2P9L A;  2IVP A;  4FWM A;  5BPL A;  3ZEU A;  3TU5 A;  4WQ4 C;  1NGD A;  2I7N A;  3SK3 A;  2Q36 A;  1GLL O;  1IJJ A;  4L3Q A;  2QWR A;  3FFK B;  5LY3 A;  1WUA A;  4CZE A;  3LDN A;  4CZL A;  4LC9 B;  3CQX A;  4E1J A;  3LDQ A;  2FSK A;  3AAP A;  2CH6 A;  5AQT A;  3UKR A;  2W41 A;  1JCG A;  4JHD A;  2KHO A;  1DGK N;  2YHX A;  4MLH A;  2A3Z A;  3I8B A;  4M7X A;  1CZA N;  1KXP A;  4ISE A;  1KAY A;  3AAR A;  5ELZ A;  4K25 A;  3WXJ A;  4XH4 A;  3SJH A;  4B9Q A;  3O5B A;  4HWI A;  4BRA A;  2NRH A;  2P9I B;  2YJE A;  3QFP A;  5EY4 A;  3VPZ A;  3ATU A;  4WQ5 C;  5AQK A;  4AM6 A;  1U6Z A;  3HM8 A;  1HUX A;  2GUP A;  5LJV A;  4FWO A;  3VEN A;  3H3O B;  1EQY A;  1YVN A;  3CET A;  2P9L B;  3CIP A;  3EL2 A;  1G99 A;  4H5V A;  1JCE A;  5BPM A;  3M6G A;  3ZEU B;  5AQX A;  3MMV A;  3SLC A;  4FWQ A;  3HI0 A;  2QW9 A;  4B1W B;  3WT0 A;  1C0G A;  2ASP A;  2A40 A;  3GG4 A;  1ATN A;  3FLC O;  2DPN A;  3UKR B;  3VF6 A;  4A2B A;  5FPM A;  5F0X A;  4JHD B;  4BRQ A;  5AQL A;  5EXW A;  4EIA A;  4RCH A;  1RFQ A;  4EAH D;  5AZJ A;  4EHU A;  3A5M C;  1ZXO A;  1ATR A;  2F9T A;  2A5X A;  5AR0 A;  1RGI A;  2CGJ A;  4BC3 A;  2QWO A;  3S41 A;  4MLE A;  4CZF A;  2HOE A;  3C7N B;  5FPN A;  1HKG A;  4FOE A;  4H0O A;  2E2Q A;  4HTL A;  2Q97 A;  5BR9 A;  3SMS A;  5CE3 A;  1Z05 A;  4DCH A;  3CJA A;  1QHA A;  3H1V X;  1NGC A;  2A42 A;  2ASO A;  3M1F A;  1S22 A;  4H5R A;  3LDO A;  3SMP A;  4DB3 A;  1HKB A;  1WOQ A;  4BRI A;  2A6A A;  2ZWH A;  3VEO A;  4BRL A;  1NGH A;  4Y0W A;  2W40 A;  3QDK A;  4BGA A;  1GLE G;  4MO4 A;  4QS8 A;  3L0Q A;  4RWT A;  2E2N A;  3DAW A;  3U9D A;  1D4X A;  2H3G X;  1NGJ A;  4CD1 A;  1TUU A;  3UKU A;  3VF2 A;  3IDH A;  3U4L A;  3A8Y A;  2D1K A;  1H1V A;  3DWL A;  3DXM B;  4FSV A;  4IZ9 A;  5BPN A;  3O80 A;  4O5F A;  4BR0 A;  4CBU A;  1MWM A;  3WEE A;  5I9E B;  4BR5 A;  4FWK A;  3B8A X;  1HX1 A;  3H1Q A;  4WQ4 A;  4NO7 A;  4BC2 A;  1NLV A;  3GBT A;  3KHY A;  5AQY A;  2CGL A;  3AAQ A;  1R59 O;  2QXL A;  2YHW A;  2HF3 A;  4JD2 A;  4H0V B;  3MN9 A;  4PL8 A;  5AFU H;  3LM9 A;  4IJN A;  4JN4 A;  3L4I A;  1YUW A;  2D0O A;  1RDW X;  4BRM A;  3QML A;  2GWJ A;  4FWN A;  4WYB A; 
#chains in the Genus database with same CATH topology
 2HW3 A;  1MU2 A;  3R8E A;  2VQE K;  4DFM A;  4Y1C A;  2PYJ A;  5KPR A;  1S1V A;  3VQQ A;  5SWM A;  1YTU A;  1XQS C;  3D6R A;  1O13 A;  1RTI A;  3EKS A;  3MN7 A;  2YV0 X;  3OTO K;  4BQZ A;  4B3T K;  3CQY A;  4XH5 A;  2FLO A;  4B1X B;  1OH5 A;  4M7Y A;  1BIU A;  3VEY A;  3KTQ A;  1XUP O;  3H3N O;  3PLA A;  2VGN A;  4I2Q A;  1FKO A;  3WQU A;  1RDB A;  3KVG A;  2G8H A;  5HP1 A;  3ENB A;  4DV5 K;  3OJU A;  1BUP A;  1IKW A;  2OPP A;  5KQD A;  2QWN A;  3VN5 A;  4DV7 K;  4YOR A;  2YNG A;  1QTM A;  1LV5 A;  4GVM A;  3NHG A;  3O08 A;  3HK2 A;  5HBM A;  3VQD A;  3FE1 A;  3HP9 A;  4BE0 A;  2O8F B;  1HYZ A;  2PY5 A;  3LDL A;  3P4I A;  4B1Y B;  2HVI A;  3S3N A;  4MFB A;  5JLH A;  4V19 S;  3RSE A;  1JLQ A;  1BO5 O;  4JKH A;  1W0H A;  2E1Z A;  2FSN A;  1NGF A;  3ZSZ A;  4FZZ A;  3D2E B;  4ZHR A;  1QQO A;  1TK5 A;  1JKH A;  3LL3 A;  5CR4 A;  1RDD A;  4OO1 J;  4CGJ A;  4EP4 A;  1BOT O;  2X74 A;  4QS9 A;  3L8B A;  5ADX A;  2AP1 A;  1CZB A;  4ELU A;  3DRR A;  3VER A;  4BVP A;  5AQF A;  3EEQ A;  5EX5 A;  2E20 A;  2KTQ A;  5AQM A;  5A2Q O;  1XC3 A;  2B6A A;  2UXB K;  3SAF A;  4M3Y A;  2QWM A;  4FJM A;  1ATS A;  5LMU K;  2HHH K;  4DTU A;  3SPZ A;  3VQ7 A;  1NJI O;  3MN5 A;  1HJO A;  1A5V A;  1I3A A;  3MDQ A;  3O1W A;  3K5O A;  2G8I A;  5M1O A;  3NF9 A;  4C8O A;  5T7B A;  5LMN K;  4PQU A;  4BDY A;  3JS6 A;  3P5J A;  5AQU A;  1QSY A;  2Q2R A;  4FXD A;  3H46 O;  1X9S A;  4DV6 K;  4FO0 A;  4JI8 K;  2P5G A;  1U04 A;  3R3L A;  5AQV A;  1Q7Y O;  1LWC A;  4DLE A;  2Z1H A;  1RBV A;  1T8E A;  2QWQ A;  3CC4 N;  1YT3 A;  5AQR A;  3TAP A;  4KHN A;  4ELT A;  4DTJ A;  2HF4 A;  1NKC A;  2IGI A;  4CJW A;  1UA0 A;  3VTI A;  1KFD A;  4M3Z A;  2WUS A;  3PIP L;  3ULE A;  2O8B B;  3DLB A;  4NXM K;  4B1U B;  1E4G T;  1RNH A;  3U6F A;  2ZGZ A;  3HOS A;  4KRF A;  2VWB A;  2UXD K;  4KAZ A;  4BG9 A;  2ZJR L;  3CJ1 A;  4BC5 A;  4B1Z A;  3SZ2 A;  2XO7 A;  2O8E B;  3P83 D;  4UY8 O;  1HNX K;  4M3W A;  5GIN A;  3CYM A;  1K8K A;  4BGB A;  3P31 A;  3U3G A;  4CJK A;  4CF8 A;  1NGB A;  1Q81 O;  4G1Q A;  1KRP A;  3VQP A;  4O55 A;  4CJS A;  3T7Z A;  4K8X A;  3H6E A;  4RG8 A;  1VRU A;  4FJI A;  1GLA G;  5J2P A;  5C10 A;  2RN2 A;  3L6Q A;  4JKG A;  1BA1 A;  3VGK A;  3BEX A;  3DRP A;  2XHB A;  3O4N A;  3HL8 A;  4C8N A;  2Y1J A;  1GLF O;  3AVH A;  1N5Y A;  3J80 O;  1GLD G;  1RDC A;  1HPM A;  4OKE A;  1JL1 A;  3TWH A;  4L8R B;  1V4T A;  4H0P A;  1P8Z A;  3BDP A;  3HRG A;  5J2N A;  1NK6 A;  4FLV A;  3AO3 A;  1RBT A;  2W6L A;  3A5O C;  1WSF A;  4KHY A;  1OH7 A;  1JLC A;  4K41 A;  3ZSX A;  4J2B A;  4B3M K;  3DOL A;  1TV6 A;  4CED A;  4CJ7 A;  3JSM A;  3F9M A;  4CZH A;  1DEJ A;  2FBV A;  4BR9 A;  4OGC A;  2OAN A;  5AQI A;  1RTH A;  3D45 A;  4PY5 A;  3L2Q A;  1Q8I A;  3E66 A;  3HOT A;  2OPS A;  4FJK A;  3SV3 A;  1BQM A;  3MAQ A;  3K57 A;  3HSC A;  4WFN L;  1DTQ A;  1KTQ A;  3ENH A;  3SAH A;  3U3Y A;  1WSI A;  1Q82 O;  3AO2 A;  4FZX C;  1VQ9 N;  1Z26 A;  2VWK A;  2Z1G A;  1QVG M;  1C1A A;  4CIF A;  1RT3 A;  3W0L A;  4FVU A;  5AQO A;  2E88 A;  3HZ6 A;  4JI6 K;  4I2P A;  2G8V A;  3EKU A;  4MQ3 A;  3M8S A;  4F8R A;  3L4Q A;  3OYJ A;  4FWM A;  1UWB A;  3DI6 A;  3D0P A;  2QKK A;  4WQ4 C;  2I7N A;  3ALY A;  1J5E K;  4K0K K;  1LWF A;  4DU4 A;  1N34 K;  1T7P A;  4FJJ A;  2QWR A;  2W42 A;  3LP0 A;  2W6K A;  4IDH A;  4CJR A;  2D5R A;  1C0T A;  4E1J A;  3V1R A;  3QNO A;  5AQT A;  2W41 A;  4AQY K;  1JCG A;  4JHD A;  3LPU A;  5DK5 A;  4NCG A;  4CFC A;  3NH1 A;  2A3Z A;  4DR6 K;  3CQ8 A;  3AAR A;  5M1F A;  3T3F A;  4HWI A;  1RT1 A;  4BRA A;  4F3T A;  4CW7 B;  4DSL A;  3QFP A;  3SI6 A;  2YNH A;  4AM6 A;  1U6Z A;  4PA1 A;  3HM8 A;  2GUP A;  2YNF A;  3HVT A;  3H3O B;  2P9L B;  3CIP A;  4OPH A;  5BPM A;  1NK5 A;  4B9S A;  5AQX A;  4E7J A;  1BCM A;  3K59 A;  1EXQ A;  4FJH A;  3OS1 A;  1S1X A;  2QW9 A;  3LP2 A;  3ZT0 A;  4JI4 K;  2D0C A;  1KLM A;  3FLC O;  2BAN A;  2DPN A;  3UKR B;  3VF6 A;  4A2B A;  2QXF A;  2VG7 A;  1U48 A;  4CIG A;  3NGI A;  4ZTJ A;  2B4J A;  1SKW A;  4EHU A;  4CEA A;  3LPT A;  4E89 A;  1ATR A;  5AR0 A;  2A5X A;  1KCF A;  4YOT A;  4CZF A;  1IBM K;  3C7N B;  4M3T A;  3MWP A;  5FPN A;  1VQ8 N;  1HQU A;  1EWR A;  2E4L A;  2E2Q A;  4CK1 A;  4FM2 A;  1OVQ A;  5BR8 K;  5JVH L;  2YHB A;  4H5R A;  3OY9 A;  1ZBH A;  4YNQ A;  2ZD1 A;  4FM0 A;  4DB3 A;  1HKB A;  4LF9 K;  4BRI A;  2A6A A;  1WSJ A;  3CCV N;  1S1T A;  4Y0W A;  1TKD A;  1J9A A;  3S9H A;  4BGA A;  4IFV A;  1WNS A;  1JLE A;  4MO4 A;  4QS8 A;  4CJE A;  4JYA K;  4CGI A;  3A2F A;  4CJF A;  3AGR A;  4C1N I;  5M1K A;  3N4Q A;  1LW0 A;  3M5R A;  3DAW A;  3MXI A;  1W97 L;  3UIQ A;  2ZQB A;  1VK0 A;  2DY4 A;  5C2F A;  5J2M A;  3UKU A;  3EZ5 A;  2QKB A;  4ZTF A;  4YY3 K;  3T1Y K;  3CF5 L;  3DWL A;  3DXM B;  4IEI A;  4IZ9 A;  3O80 A;  1VSL A;  4O5F A;  4CBU A;  1RCH A;  1TL3 A;  3WEE A;  5I9E B;  3VQC A;  1FKP A;  3K0S A;  3H1Q A;  3LWM A;  4BC2 A;  3GBT A;  3O4Q A;  3QO9 A;  2QXL A;  4JD2 A;  3MN9 A;  1RBS A;  5CYM A;  4CEZ A;  3ITH A;  3DLR A;  1WB9 A;  2AJQ A;  3THW B;  4Q0B A;  3L4I A;  3B6P A;  4FLZ A;  1DLO A;  3C6U A;  2OTJ N;  3CM6 A;  4WYB A;  3H08 A;  2NRW A;  4BRG A;  4EP5 A;  1HRH A;  2Q1N A;  3C6T A;  1VSM A;  3CPE A;  5BRH A;  2A1S A;  3A5N C;  3C0B A;  1V4S A;  5FLX O;  4FJ8 A;  2JLE A;  4JKF A;  4A5B A;  4JKC A;  1M90 O;  3J7Z O;  4X62 K;  4IBN A;  4WQ5 A;  4MO5 A;  3NBP A;  2OPQ A;  2D0B A;  3I55 N;  3OS2 A;  3DXK A;  3UB5 A;  2LSN A;  2WTU A;  4CIE A;  5FRN A;  3NAE A;  4JI0 K;  3CHW A;  3CM5 A;  4GV6 A;  4GVE A;  4KTW A;  1D5A A;  2ZJP L;  3QIC A;  1X9W A;  3H45 C;  5BN8 A;  3THX A;  3BGR A;  3NGZ A;  1NMD A;  4IFE A;  1ZBF A;  5E41 A;  4CHZ A;  1JXE A;  3HVR A;  3VQ8 A;  3FZH A;  4BQL A;  2V51 B;  3ZSW A;  3ID6 A;  2P9S A;  1U2V A;  4OKJ A;  1S1W A;  1W9H A;  4BRK A;  4DG1 A;  3L2R A;  1X3M A;  4NCA A;  1NBW A;  4EZ6 A;  3M3Z A;  3QB0 A;  5CZ2 A;  1LAV A;  5F2R A;  4WE1 A;  2CGK A;  4DMN A;  1IH7 A;  4DR4 K;  3HST B;  1WAF A;  3L3U A;  2E1Y A;  3S3M A;  4YOW A;  5AQZ A;  1KLN A;  4GKK K;  4YDU C;  4QS7 A;  4CF2 A;  3VQ5 A;  3G71 N;  1VQ6 N;  3VET A;  3O8M A;  1LCU A;  4YFU A;  5AZI A;  1IV0 A;  2O8D A;  3ZT2 A;  1BGX T;  1Y64 A;  1B92 A;  3AVF A;  3F73 A;  1ZBL A;  3G10 A;  1HNZ K;  1RBR A;  4BRE A;  3OYA A;  3TSU A;  2UXC K;  3LP3 A;  1WSG A;  3LAN A;  3RSE B;  3T1A A;  4CF0 A;  3OYI A;  1VSJ A;  5IT9 O;  1RT2 A;  3DM2 A;  4N56 A;  1EX4 A;  1D8Y A;  4BR7 A;  1J53 A;  4BAC A;  1VQL N;  4EZ9 A;  5AQP A;  5H1S Q;  5AFU A;  2VG5 A;  3EO3 A;  3NF7 A;  5C2D A;  1J5O A;  3PO4 A;  3OYK A;  4DFP A;  4FJ7 A;  2KLA A;  2F8T A;  4FWL A;  2IDO A;  1XMO K;  1C0U A;  1LWE A;  4LY7 A;  2GTD A;  3ZSO A;  5FRO A;  2V52 B;  3MXJ A;  1T6D A;  4M3U A;  1N33 K;  5HLF A;  3V6D A;  2VGM A;  3CJB A;  4LF7 K;  3ZYY X;  1KAZ A;  2Q0R A;  1Q18 A;  1NK7 A;  1JLG A;  2E2P A;  1FJG K;  3MX5 A;  1ASW A;  1GLB G;  2YHY A;  4PKH A;  4RW9 A;  5E84 A;  1Q86 O;  3QLH A;  4BC4 A;  3W3D A;  4IO9 L;  1ZBI A;  4NXN K;  4NCB A;  4CZK A;  5HRS A;  1SQK A;  3ZT3 A;  1QS4 A;  3V9U A;  1L3U A;  3V1O A;  3ISN C;  1KQS M;  4A57 A;  1NGG A;  5I42 A;  4CFB A;  5KPT A;  2ZE2 A;  1GLC G;  5EVZ A;  4E7L A;  2NRV A;  3RTV A;  4AHC A;  1SL0 A;  4O5B A;  1RIL A;  3QFU A;  3PO5 A;  3VTH A;  3KZB A;  1NMN A;  4OPA A;  1XI1 A;  3CME N;  4C1N K;  4O44 A;  4AHV A;  4FK0 A;  3WXI A;  3HO1 A;  2J4R A;  1BCO A;  2HBJ A;  2FBX A;  2KFN A;  3WXK A;  2KFZ A;  4LF5 K;  4DKW A;  3VQB A;  4E1N A;  4FWS A;  2E8A A;  4FK4 A;  1S5J A;  2YJF A;  4PKI A;  1M1K O;  3ULE B;  4E7H A;  4M63 C;  3BY5 A;  4JKE A;  4GW6 A;  1U45 A;  1SZ2 A;  4X64 K;  3AVK A;  3DMJ A;  4FZY A;  3OBY A;  4ISF A;  3FGU A;  1YVU A;  3R1X A;  1NKE A;  2YKN A;  3KKS A;  4IG3 A;  4OVL A;  5JS2 A;  3ENO A;  5KGW A;  3S3O A;  3PX0 A;  2OZS A;  1K8K B;  5AQW A;  4KHQ A;  3CMA N;  3HYF A;  1T05 A;  3VEX A;  3OBW A;  3C65 A;  2HHQ A;  1JLB A;  3FZF A;  4DQS A;  1HNW K;  3O3F A;  5M1P A;  1S6Q A;  3UE5 A;  4AHR A;  3VQA A;  1MDU B;  4U7B A;  4BRH A;  1ZBU A;  4JKG B;  1W2B M;  2XY6 A;  4BRF A;  5C15 A;  1B9D A;  3OYG A;  4I6M B;  4CGF A;  4H5N A;  1YHQ N;  2NRX A;  1QQM A;  2F8S A;  1ESV A;  1I39 A;  3I0R A;  3DLG A;  1ZC6 A;  3BP8 A;  1BDG A;  2KW4 A;  2NLX A;  2HMP A;  1IKY A;  3C95 A;  2D0P A;  4NB4 A;  1S9G A;  3TPQ A;  4B08 A;  1BWF O;  1UA1 A;  2DFF A;  4O0J A;  1QZ6 A;  3GL1 A;  4J8F A;  4Z4C A;  2IVN A;  4WF9 L;  1YJW N;  5TKY A;  4ISG A;  4BRD A;  1SS6 A;  5HRO A;  2NZT A;  3FR0 A;  1VSF A;  4F2S A;  5KTQ A;  3AA5 X;  3NDK A;  1HPZ A;  3ZEU A;  1YI2 N;  3ASM A;  1NGD A;  2Q36 A;  1GLL O;  4W5R A;  3O3G A;  3DYA A;  4L3Q A;  2O4I A;  2YKM A;  1WUA A;  4JKA A;  3LDN A;  4CF9 A;  3KKR A;  4CZL A;  3AAP A;  2CH6 A;  3V9W A;  3QEI A;  2OTL N;  1QSS A;  4KTZ A;  1BIZ A;  1NJY A;  3E1Y A;  2E6M A;  2YHX A;  1HYV A;  4MLH A;  3VQ4 A;  1TK8 A;  2UUB K;  3I8B A;  4M7X A;  1CZA N;  4ISE A;  5ELZ A;  2O8F A;  4K25 A;  3SJH A;  4AIL C;  3TAF A;  1SKS A;  3IAY A;  2YJE A;  5DMR A;  4C8M A;  4E7K A;  5KI6 A;  4FK2 A;  4Z4H A;  3QER A;  4H5V A;  3V1Q A;  1EP4 A;  3I8D A;  4FJ5 A;  3OVN A;  3M6G A;  4JI3 K;  4IOA L;  3SLC A;  1HNI A;  3P39 A;  2WC9 A;  3VA0 A;  4WCE L;  4B1W B;  1EET A;  3CCM N;  3SNN A;  1LAW A;  2ASP A;  4ILH A;  1VHX A;  2YHA A;  5CZ1 A;  5FPM A;  5F0X A;  4JHD B;  4IFY A;  4B8C A;  2KKZ A;  5EXW A;  3ZSR A;  3AVC A;  3QEW A;  1ZXO A;  3CG7 A;  3PIO L;  2CGJ A;  5MLC Q;  1VRT A;  2HOE A;  4DSJ A;  2O4G A;  4OGE A;  1HKG A;  3SQ2 A;  1YJ9 N;  4HTL A;  2Q97 A;  4PUO A;  3SMS A;  3QIO A;  3H1V X;  4CFD A;  2HBK A;  3M1F A;  3SMP A;  5KRT A;  1WOQ A;  4CF1 A;  1NGH A;  4Z0U A;  3CC7 N;  5DM7 L;  2QK9 A;  4BE2 A;  4F4K A;  3L0Q A;  2E2N A;  2R7Y A;  4DU3 A;  5M1N A;  1ASV A;  1QQC A;  4PHT X;  3U9D A;  3ZSY A;  3IDH A;  2NNW A;  3U4L A;  3T69 A;  1WSE A;  2D1K A;  3LDS A;  4GV9 A;  5FRM A;  4FSV A;  3LP1 A;  2PFU A;  5C0Y A;  4JI7 K;  4DUZ K;  1MWM A;  4BR5 A;  2IS3 A;  4Z4G A;  4DUY K;  3NH2 A;  4WQ4 A;  1RT5 A;  1SV5 A;  4AHT A;  4LF4 K;  3C6H A;  1KC8 O;  1NLV A;  5AQY A;  2CGL A;  3AAQ A;  4ILG B;  4KPY A;  1R59 O;  3K9J A;  3RMC A;  4DR5 K;  3HPH A;  3SJJ A;  2HF3 A;  5AFU H;  3LM9 A;  1VAZ A;  4BRM A;  1RDW X;  2HHX A;  2G8F A;  4DS5 A;  2ZJQ L;  1O1W A;  2HHV A;  3F9K A;  1XHZ A;  2HBM A;  5AJ3 K;  4CEE A;  4LSL A;  3CJ7 A;  1YJN N;  1J54 A;  2ZGY A;  3SYZ A;  1XNR K;  1QHT A;  3UKU B;  4FLW A;  4NLB A;  4F9O A;  2A41 A;  4O4G A;  4DTR A;  4IOX A;  2Q31 A;  3SBG A;  1VSK A;  1N32 K;  4B3S K;  1S9E A;  2VCP A;  5LJW A;  1RDU A;  2EX3 A;  3MEC A;  1WSH A;  1HR0 K;  2E6L A;  4AM7 A;  2QA4 N;  3EYZ A;  1TAQ A;  2GX9 A;  4DR7 K;  4JD2 B;  3ULD A;  4XEI A;  1IKX A;  2F9W A;  2O8C A;  1ILY A;  2P51 A;  3A0I X;  3WUH A;  5FDL A;  4M3X A;  2YNI A;  3SUN A;  4CEC A;  3HXM A;  4FM1 A;  4BR2 A;  2PYL A;  4A2A A;  3THY A;  1F21 A;  1DKG D;  4HCB A;  4FCY A;  4B1V A;  3DOK A;  4KFB A;  2HHW A;  3CFO A;  3ID8 A;  3WXL A;  4CBW A;  1NK0 A;  3DXK B;  3V9S A;  4BR4 A;  4DHY A;  4I9Q A;  3HBT A;  3I33 A;  3OYE A;  3SCX A;  3CFR A;  1MWK A;  4E19 A;  4H0Y B;  5C12 A;  3MCA B;  3K9K A;  4CHQ A;  3DLK A;  3ZLJ A;  4QOZ B;  1IKV A;  4FOI A;  4GY2 B;  1YAG A;  3CI5 A;  3THX B;  3LZJ A;  1B9F A;  3SBT A;  3MN6 A;  1GOC A;  2BE2 A;  3BF1 A;  2GUI A;  1JL2 A;  2QWL A;  1A5W A;  1EO1 A;  4KRE A;  4GKJ K;  5AZJ B;  3OYL A;  1QZ5 A;  3BZC A;  4DTN A;  4GV3 A;  2D4W A;  1QSL A;  4KHP K;  2GWK A;  2P9S B;  3ZET A;  2ASM A;  3L2U A;  4DF8 A;  4DTS A;  3VEW A;  3IFR A;  3N4P A;  2PBD A;  3ZX0 A;  1E4F T;  2HBL A;  2FBT A;  2P9N A;  4B8A B;  4I7F A;  4Z4F A;  2IVO A;  3SUP A;  1YXQ A;  4UQG A;  1VSD A;  1Y97 A;  1QVF M;  2OA8 A;  2GBZ A;  2DFH A;  3LZI A;  1LOT B;  3MX2 A;  4H03 B;  2G8W A;  3G6E N;  3U8X A;  4LF6 K;  1NGE A;  3AO5 A;  2UU9 K;  4KO0 A;  3VOV A;  2P1J A;  3IMX A;  5EOY A;  1TK0 A;  5AZI B;  2O8D B;  1BQN A;  2VYP A;  3CJ9 A;  3AVJ A;  3U9Z A;  4CGG A;  1KVC A;  2OCE A;  3M8Q A;  4KB0 A;  2AA4 A;  3E9O A;  3SQ4 A;  3CD6 N;  1C0F A;  3PSF A;  4EFH A;  1X3N A;  3IUC A;  3IS9 A;  4JAX A;  4CJ5 A;  5F1X A;  3ZX3 A;  4DSI A;  1OH8 A;  3HTV A;  1LW2 A;  2NRZ A;  5GAE P;  3VEV A;  1FW6 A;  4FLY A;  1TYQ A;  4F3O A;  3P38 A;  4CK3 A;  2QWP A;  1JCF A;  4A61 A;  3AA3 A;  3D7E O;  4YOY A;  2P9P A;  1P90 A;  2VWJ A;  3O9T A;  2ZM6 K;  5GIO A;  3C7N A;  3EN9 A;  4IO8 A;  3VES A;  4CJL A;  3O9Q A;  5AQH A;  2WFB A;  2RPI A;  4HHT A;  1WBB A;  3RRG A;  3HM9 A;  3NVK A;  5AQQ A;  4JI2 K;  3NE6 A;  2P9K A;  3EY1 A;  4CVN E;  4PKG A;  2P9U A;  3KK7 A;  2FF3 B;  2Z1I A;  4JKD A;  3TTD A;  1G15 A;  2CH5 A;  3KLG A;  1SL1 A;  3DLE A;  1VQK N;  1TGO A;  3OJS A;  2D0A A;  2IIR A;  1T3V A;  4CI6 A;  3K58 A;  3M8R A;  2F7T A;  2F96 A;  5EU7 A;  1EWQ A;  4DTX A;  3OA9 A;  3TTF A;  4BRN A;  4FL9 A;  1NU0 A;  5GIP A;  2V7Y A;  1BU6 O;  1CXQ A;  3D2F A;  4BVO A;  4Z4I A;  3QEX A;  3SUO A;  3O6W A;  4C8L A;  2FXU A;  3K5M A;  3GE1 A;  3DXM A;  3K2P A;  4KV8 A;  4YDU A;  3QBX A;  3C94 A;  3F2K A;  5BN9 A;  2JWK A;  3PSI A;  4Z94 A;  1GLJ O;  1WBD A;  1UOC A;  1SUQ A;  1Z6R A;  4JLH A;  4DSK A;  3RMB A;  1HJR A;  1JLA A;  4W5Q A;  1S3X A;  3VEZ A;  3QET A;  4X65 K;  5JS1 A;  3ZT1 A;  1HKC A;  3VMF B;  4DTO A;  3TR8 A;  4YOU A;  1C0M A;  4DLG A;  1RTJ A;  4EHT A;  2V7Z A;  1HYS A;  1VQP N;  3GOI A;  5HOO A;  1X9J A;  4PL7 A;  3LAL A;  4JRP A;  4K42 A;  1VSI A;  1VQM N;  3TAG A;  5IWA K;  3RR7 A;  5HRN A;  3G25 A;  4H4M A;  4DR1 K;  2FF6 A;  4MDA A;  1Q9X A;  2P9I A;  3QEP A;  5E26 A;  1NGA A;  1XHX A;  4CZI A;  1K6Y A;  4LF8 K;  2IVP A;  3TAQ A;  1U4B A;  3CCJ N;  4DV2 K;  2IC3 A;  1NOY A;  3QNN A;  4W5T A;  1NK4 A;  1XMQ K;  3VQ6 A;  4J2E A;  1IJJ A;  4G9Z A;  3WNF A;  4A5A A;  3BZK A;  4LC9 B;  4OJR A;  1K9M O;  2FSK A;  4LH4 A;  1D9F A;  1NJW A;  1IG9 A;  4FW1 A;  3L2W A;  3KLF A;  2KHO A;  4NYF A;  1DGK N;  2Q3S A;  3HP6 A;  2QTD A;  4KTQ A;  1KXP A;  1KAY A;  3WXJ A;  4B9Q A;  3O5B A;  4KHU A;  3VPZ A;  1IBL K;  3ATU A;  5AQK A;  1HUX A;  3VEN A;  1FK9 A;  1EQY A;  1YVN A;  4DQR A;  3EL2 A;  3MWT A;  3CCS N;  2WOM A;  3ZEU B;  3ZT4 A;  1S6P A;  4LD0 A;  3MMV A;  3HI0 A;  1GOB A;  4DQQ A;  3QES A;  4IDK A;  2HB5 A;  4CEF A;  3MXM A;  2A40 A;  3GG4 A;  4CHO A;  2OPR A;  4YOV A;  4DS4 A;  1N8R O;  3TTC A;  3C6A A;  2XY7 A;  4N76 A;  3I56 N;  4BRQ A;  2HND A;  2DTU A;  4EIA A;  3OW2 M;  3SV4 A;  3KD1 E;  4EAH D;  4K8Z A;  2HNZ A;  4HVJ A;  4DFJ A;  3HT3 A;  4CES A;  2F9T A;  1RGI A;  3S41 A;  4MLE A;  1NKB A;  1FXX A;  3NCI A;  4GMJ B;  3WNH A;  4AHS A;  4FOE A;  1ITG A;  2UUC K;  4JI5 K;  4JI1 K;  4CEB A;  1VQO N;  1QHA A;  2BDP A;  1NGC A;  1GOA A;  2A42 A;  2ASO A;  4N47 A;  3AA2 A;  1X1P A;  4DWI A;  1BI4 A;  3ZSQ A;  3LDO A;  4E1M A;  2ETJ A;  1T03 A;  2ZWH A;  3VEO A;  3V9Z A;  3O9R A;  4BRL A;  1OH6 A;  3VA3 A;  3PX6 A;  4RW6 A;  3J7Y P;  1GLE G;  1E3M A;  4RWT A;  4DV1 K;  2XY8 A;  1RT4 A;  4RW8 A;  4FJL A;  1JJ2 M;  1D4X A;  4CD1 A;  2RE2 A;  3VF2 A;  5J2Q A;  1DTT A;  1N6Q A;  3A8Y A;  3RMD A;  4OPK A;  1TKZ A;  3AVL A;  5BPN A;  2P5O A;  2JGU A;  1KD1 O;  4PWD A;  4JV5 K;  1REV A;  3B8A X;  4J2A A;  4E0D A;  1HX1 A;  4RW4 A;  4KHW A;  3CXC M;  2HNY A;  2DFE A;  3KHY A;  4Z4E A;  3RWU A;  3AVI A;  1VSH A;  4DV4 K;  4QAG A;  4H0V B;  4PL8 A;  1EKE A;  3HJF A;  4KKO A;  1K73 O;  4KH5 A;  1OVY A;  4B9M A;  3QML A;  3TAE A;  1N36 K;  4FWN A;  3OYB A;  2B5J A;  2Y1I A;  3B6O A;  1S1U A;  3TAN A;  4KB1 A;  2IOC A;  4H5T A;  1ASU A;  1ZYQ A;  4BRP A;  2FBY A;  5KRS A;  2HHT A;  4KH6 A;  4LH5 A;  3IRX A;  5KQ8 A;  4BWJ A;  3O3H A;  4FWP A;  4HUF A;  2GEL A;  4JK9 A;  4CER A;  4DQI A;  3AVA A;  4BWM A;  1NGI A;  3TSQ A;  3D2E A;  3CCU N;  1TUY A;  4H0T B;  5AQS A;  1HNV A;  3FZM A;  2HHU A;  5FPD A;  2EHG A;  1MA9 B;  3JXU A;  3PV8 A;  4XIU A;  2E5L K;  3RRH A;  4YOX A;  4DQP A;  5JMV A;  4FPB A;  3QBW A;  3JYT A;  4CHN A;  4FPA A;  4A62 A;  4RW7 A;  5AQN A;  1XNQ K;  3PY8 A;  4CE9 A;  2ATQ A;  3LDP A;  5B8H A;  3MEE A;  2I5J A;  2PAV A;  4W5O A;  3AGK A;  4CJ4 A;  2E2O A;  4M45 A;  3NH0 A;  3R6M A;  4LFC K;  4I6M A;  4AHU A;  5JVG L;  2RF2 A;  2WON A;  3IKM A;  4KBO A;  3RVC A;  2XY5 A;  4CJQ A;  5LL6 Z;  4IJA A;  1KAX A;  4N41 A;  2X6N A;  2GV9 A;  4LFA K;  3OHR A;  4B3R K;  1NWK A;  4CGD A;  4CZM A;  4DTM A;  2G8K A;  3DLL L;  4CEO A;  3P1G A;  1WLJ A;  4JKB A;  4H5W A;  3NGY A;  3MCP A;  5AQJ A;  4CJT A;  4DR3 K;  2GEM A;  4CHY A;  3NF8 A;  4R79 A;  3VQE A;  4M41 A;  2O8C B;  3R9P A;  4OKK A;  5JLF A;  3ZCM A;  4N5S A;  3VQ9 A;  3LM2 A;  3K5N A;  3LAM A;  3O1B A;  3MK6 A;  3THY B;  2YI1 A;  3KWG A;  5AQG A;  4HTU A;  2NRT A;  1L3T A;  4JNE A;  4HUE A;  2O8B A;  4F2R A;  2ITM A;  4HUG A;  4BY9 C;  4B9V A;  3BF3 A;  1WN7 A;  1TVR A;  5BRE A;  5DM6 L;  4OLA A;  1YIJ N;  1KFS A;  4IEE A;  2EWS A;  3NVM A;  2VG6 A;  3V81 A;  2A1R A;  2O8E A;  4K43 A;  1C6V A;  3AO4 A;  4CBX A;  3ZX2 A;  2BTF A;  4JEP A;  4M42 A;  3PX4 A;  3SUQ A;  1L5U A;  3ZSV A;  2BUP A;  1S72 N;  3ATV A;  3GDQ A;  2NUB A;  3PUF A;  4FWR A;  2BH1 A;  3FZK A;  2JWL A;  4FJN A;  3O4W A;  4NYN A;  3AVN A;  1A5X A;  2QM1 A;  5KPZ A;  4CD3 A;  4ID1 A;  1KVA A;  3AVB A;  3ZET B;  4CZJ A;  4R5P A;  3I0S A;  4DR2 K;  1SAZ A;  2KZM A;  1DT9 A;  4BRO A;  1K8A O;  4CCH A;  5D3G A;  4FVM A;  3AV9 A;  4ILJ A;  2P9N B;  1HLU A;  2FSJ A;  4DSE A;  3WEE B;  1NM1 A;  3KJV A;  1QE1 A;  4IWV A;  1J6Z A;  4RTF D;  3TSP A;  4JRQ A;  4HCC A;  1BIS A;  2FC0 A;  3VGM A;  4M3R A;  2HVH A;  4XH1 A;  2RKI A;  5JIC A;  4C23 A;  2OZM A;  1KSP A;  3THV A;  3SQ1 A;  5J1E A;  4MDB A;  3DLH A;  3WQT A;  1BL3 A;  1UAX A;  3EZW A;  1SL2 A;  3DRS A;  2IAJ A;  1QQN A;  4BG8 A;  4CJ3 A;  1L3S A;  2X78 A;  2YCH A;  4O8K A;  4GNI A;  4KI4 A;  3J8A A;  1YIT N;  2HST A;  3CCL N;  3J7A P;  2Z1J A;  1BA0 A;  1T6C A;  1RDA A;  4IXC A;  3TAB A;  4B9T A;  1NOZ A;  5I3U A;  3KLI A;  1RT7 A;  3T19 A;  1C1B A;  4FLT A;  2Q0U A;  2VQF K;  1XC9 A;  3FZL A;  4BRC A;  1TYQ B;  3MED A;  4DTP A;  1SKR A;  4ID5 A;  3OYM A;  1IG8 A;  3L3V A;  3CC2 N;  2ZF5 O;  2I7P A;  2KQ2 A;  3A5L C;  2YX6 A;  1WAJ A;  2P9P B;  3VF4 A;  3AY9 A;  5CYQ A;  3KLH A;  3VGL A;  1RBU A;  2G8U A;  1JLF A;  5BRF A;  5BRD A;  1BG3 A;  4JS4 A;  3KLE A;  4O8U A;  4U67 L;  1VQ4 N;  1IO2 A;  3EE8 A;  5GAH P;  1T44 A;  1VQ5 N;  3WNE A;  4A59 A;  5CHI A;  2HHS A;  2P9K B;  4H0X B;  2P9U B;  3KWI A;  2OYQ A;  3KK2 A;  4OPJ A;  4O0I A;  1CXU A;  3OYD A;  4OLB A;  1U2V B;  5C24 A;  4DQ8 A;  4CJU A;  4FJX A;  1TAU A;  3CCE N;  3QIP A;  5HL7 L;  4BE1 A;  3M8P A;  1L3V A;  5ADX H;  1D9D A;  1VQ7 N;  4CZG A;  1NJX A;  1TKT A;  3BUZ B;  3O9S A;  4JS5 A;  3RMA A;  1U49 A;  5FPE A;  3D2F B;  2HMI A;  2NRR A;  5M1Q A;  2QEX N;  2QI2 A;  4DV3 K;  3DJC A;  2UYT A;  1BHL A;  3CER A;  1OKJ A;  1JXB A;  3CJC A;  1ZBS A;  5SZT A;  3QEV A;  2P9L A;  5BPL A;  1HMV A;  3TI0 A;  3TU5 A;  3SK3 A;  4LFB K;  5TKW A;  4FW2 A;  3FFK B;  5LY3 A;  4CZE A;  1W7A A;  5CY4 A;  4FLX A;  4Y1D A;  4H4O A;  1NJZ A;  3CQX A;  3EE9 A;  3LDQ A;  4I9L A;  1XWL A;  4H8K A;  3Q7B A;  4JK7 A;  3UKR A;  1KVB A;  4CFA A;  3OYN A;  1X9M A;  3QIN A;  1Q9Y A;  1I94 K;  4KH4 A;  3WXM B;  4ELV A;  3KIO A;  2X6S A;  4XH4 A;  4ICL A;  3SPY A;  2NRH A;  2P9I B;  5EY4 A;  4LSN A;  1RTD A;  4WQ5 C;  3E9P A;  5LJV A;  3HPG A;  3AVM A;  4FWO A;  3Q7C A;  1TKX A;  3E01 A;  1VQN N;  3CET A;  2KZZ A;  3TAR A;  1G99 A;  4NLC A;  1JCE A;  5KGX A;  4FJG A;  1RT6 A;  4DF4 A;  1CZ9 A;  4TSX A;  5GAD P;  4B9L A;  4FWQ A;  3F5T A;  3SQ0 A;  4B9N A;  3AA4 A;  3WT0 A;  4B3O A;  4DFK A;  1C0G A;  4KI6 A;  4BDP A;  1CLQ A;  4CEQ A;  4WFA L;  4W5N A;  1ATN A;  3OYF A;  4IKF A;  4IG0 A;  4CHP A;  3KD5 E;  5AQL A;  4FLU A;  5GAG P;  4RCH A;  1RFQ A;  5AZJ A;  3V9X A;  3KK1 A;  3WNG A;  3A5M C;  4DSF A;  1NK9 A;  3NFA A;  4C8K A;  3NMU A;  4BC3 A;  2QWO A;  3K5L A;  3CPW M;  3AVG A;  5HRR A;  4H0O A;  4CGH A;  5BR9 A;  4DU1 A;  4AH9 A;  5CE3 A;  1Z05 A;  3FFI A;  3HPO A;  4Q5V A;  4DCH A;  3CJA A;  4FJ9 A;  1VSE A;  4DV0 K;  4IOC L;  1YF5 L;  1U47 A;  1S22 A;  3OYC A;  4CJV A;  3L2V A;  2XRI A;  2BGG A;  5K14 A;  1TL1 A;  3O9U A;  2W40 A;  3CCQ N;  5C42 A;  3QDK A;  4WFB L;  3LAK A;  3THW A;  2F4V K;  1R0A A;  4E3S A;  3RR8 A;  4CJP A;  3E9L A;  4AF1 A;  5HRP A;  2UUA K;  3CFP A;  1NG9 A;  4JK8 A;  3T1H K;  4J2D A;  2H3G X;  1NGJ A;  3OYH A;  1TUU A;  3KK3 A;  3AO1 A;  2PZS A;  3IG1 A;  4X66 K;  3MEG A;  3NF6 A;  4BDZ A;  1H1V A;  4FYD A;  4BR0 A;  3JAM O;  4CK2 A;  3CCR N;  4KHS A;  4FWK A;  3TAM A;  4E7I A;  2ITG A;  4QCL A;  4YHH K;  3V4I A;  3LWL A;  4NO7 A;  1BI4 B;  3J81 O;  3G0Z A;  4B9U A;  2YHW A;  3SAG A;  3OS0 A;  1NK8 A;  1NNE A;  4OX9 K;  1C1C A;  4IJN A;  4JN4 A;  1Z25 A;  5C25 A;  1YTA A;  1YUW A;  2D0O A;  2RHK A;  1HQE A;  2GWJ A;  1IBK K;  3G4S N;  2WBN A; 
#chains in the Genus database with same CATH homology
 2HBM A;  4H5T A;  4BRG A;  4BRP A;  2Q1N A;  3R8E A;  5KPZ A;  3CPE A;  3CJ7 A;  5BRH A;  4KH6 A;  3A5N C;  1YJN N;  3C0B A;  5KPR A;  2ZGY A;  1V4S A;  5KQ8 A;  4JKF A;  3UKU B;  4A5B A;  4JKC A;  1M90 O;  4NLB A;  4FWP A;  3J7Z O;  4F9O A;  2A41 A;  1XQS C;  2GEL A;  3D6R A;  4JK9 A;  1O13 A;  3EKS A;  4IOX A;  4WQ5 A;  4MO5 A;  3MN7 A;  1NGI A;  3TSQ A;  2Q31 A;  3SBG A;  4BQZ A;  3D2E A;  3I55 N;  3CCU N;  1TUY A;  3CQY A;  4XH5 A;  2FLO A;  4B1X B;  4H0T B;  3DXK A;  2VCP A;  4M7Y A;  5AQS A;  5LJW A;  3FZM A;  3UB5 A;  3VEY A;  1RDU A;  1XUP O;  3H3N O;  3PLA A;  5FPD A;  1MA9 B;  3JXU A;  2VGN A;  3CHW A;  4GV6 A;  4AM7 A;  2QA4 N;  3WQU A;  4GVE A;  3KVG A;  4YOX A;  3ENB A;  2GX9 A;  4JD2 B;  2ZJP L;  5JMV A;  4FPB A;  3QBW A;  3QIC A;  1BUP A;  3H45 C;  2F9W A;  4XEI A;  1ILY A;  5BN8 A;  3A0I X;  3WUH A;  5KQD A;  2QWN A;  1NMD A;  4FPA A;  4IFE A;  4A62 A;  4YOR A;  5AQN A;  3O08 A;  3LDP A;  5B8H A;  4BR2 A;  3FZH A;  2PAV A;  3FE1 A;  4A2A A;  4BQL A;  3AGK A;  2V51 B;  2E2O A;  1DKG D;  3ID6 A;  3LDL A;  3P4I A;  4B1Y B;  2P9S A;  1U2V A;  3R6M A;  4B1V A;  4I6M A;  4BRK A;  5JVG L;  3IKM A;  5JLH A;  4KBO A;  3RSE A;  3RVC A;  3ID8 A;  1BO5 O;  1X3M A;  4JKH A;  3WXL A;  2E1Z A;  2FSN A;  1NGF A;  4IJA A;  1KAX A;  1NBW A;  4CBW A;  3D2E B;  1QQO A;  3DXK B;  4BR4 A;  3LL3 A;  3M3Z A;  3QB0 A;  5CR4 A;  4DHY A;  3OHR A;  5F2R A;  3HBT A;  1NWK A;  3I33 A;  4CZM A;  2CGK A;  4OO1 J;  3DLL L;  1BOT O;  1MWK A;  4H0Y B;  4QS9 A;  5C12 A;  4JKB A;  3MCA B;  4H5W A;  2E1Y A;  3K9K A;  3MCP A;  5AQJ A;  4YOW A;  5AQZ A;  2GEM A;  5ADX A;  2AP1 A;  4R79 A;  4FOI A;  4YDU C;  3VER A;  4GY2 B;  4BVP A;  1YAG A;  3CI5 A;  4QS7 A;  5AQF A;  3R9P A;  3SBT A;  3MN6 A;  5JLF A;  3BF1 A;  5EX5 A;  3G71 N;  2QWL A;  1VQ6 N;  3VET A;  3LM2 A;  3O8M A;  1LCU A;  5AZI A;  2E20 A;  1EO1 A;  3O1B A;  3MK6 A;  5AQM A;  5AZJ B;  1XC3 A;  2YI1 A;  3KWG A;  1QZ5 A;  3SAF A;  5AQG A;  4GV3 A;  2QWM A;  2D4W A;  2NRT A;  1ATS A;  4JNE A;  1Y64 A;  2GWK A;  2P9S B;  3ZET A;  2ASM A;  4BRE A;  3TSU A;  2ITM A;  4BY9 C;  3N4P A;  3IFR A;  3RSE B;  2PBD A;  3VEW A;  1E4F T;  3BF3 A;  3ZX0 A;  3MN5 A;  1NJI O;  1HJO A;  2HBL A;  2P9N A;  3MDQ A;  3O1W A;  2IVO A;  5M1O A;  1YXQ A;  5BRE A;  5DM6 L;  4BR7 A;  1YIJ N;  4IEE A;  1VQL N;  3JS6 A;  2EWS A;  3NVM A;  5AQP A;  5H1S Q;  5AQU A;  5AFU A;  3EO3 A;  1QVF M;  2Q2R A;  3H46 O;  4K43 A;  5C2D A;  4FO0 A;  2KLA A;  3R3L A;  4FWL A;  1LOT B;  5AQV A;  3MX2 A;  4H03 B;  1Q7Y O;  2GTD A;  4CBX A;  3ZX2 A;  2V52 B;  2BTF A;  4JEP A;  1T6D A;  3G6E N;  2BUP A;  3U8X A;  1S72 N;  1NGE A;  2VGM A;  3CJB A;  3ATV A;  3GDQ A;  2QWQ A;  3VOV A;  3CC4 N;  3ZYY X;  3IMX A;  5EOY A;  1KAZ A;  5AQR A;  4FWR A;  5AZI B;  2VYP A;  2BH1 A;  3CJ9 A;  3FZK A;  3U9Z A;  2Q0R A;  1Q18 A;  2JWL A;  2HF4 A;  3O4W A;  2AA4 A;  3E9O A;  2E2P A;  3CD6 N;  2QM1 A;  3MX5 A;  4CD3 A;  1C0F A;  1GLB G;  2YHY A;  4PKH A;  3VTI A;  2WUS A;  5E84 A;  4EFH A;  1Q86 O;  1X3N A;  3W3D A;  4BC4 A;  3IUC A;  3ZET B;  4CZJ A;  4IO9 L;  3PIP L;  3ULE A;  1SAZ A;  4JAX A;  4CZK A;  1SQK A;  3ZX3 A;  5F1X A;  4B1U B;  1DT9 A;  4BRO A;  1E4G T;  1K8A O;  4ILJ A;  1KQS M;  3HTV A;  2P9N B;  1HLU A;  2NRZ A;  2FSJ A;  3VEV A;  4A57 A;  5GAE P;  3WEE B;  1NGG A;  1NM1 A;  1TYQ A;  2ZGZ A;  3HOS A;  3P38 A;  2VWB A;  5KPT A;  1GLC G;  2QWP A;  1J6Z A;  4IWV A;  1JCF A;  4RTF D;  3CJ1 A;  3D7E O;  5EVZ A;  4A61 A;  4BC5 A;  4BG9 A;  4B1Z A;  2ZJR L;  3TSP A;  2NRV A;  4YOY A;  2P9P A;  1P90 A;  4UY8 O;  5GIN A;  1K8K A;  3VGM A;  3P31 A;  4BGB A;  3O9T A;  4XH1 A;  5JIC A;  4C23 A;  5GIO A;  1NGB A;  3C7N A;  3EN9 A;  4IO8 A;  3VES A;  4MDB A;  3QFU A;  3WQT A;  1Q81 O;  3O9Q A;  3EZW A;  3VTH A;  4BG8 A;  3KZB A;  1QQN A;  2WFB A;  5AQH A;  3T7Z A;  4OPA A;  3H6E A;  3CME N;  4C1N K;  3NVK A;  2YCH A;  4O8K A;  5AQQ A;  4GNI A;  2P9K A;  1GLA G;  3WXI A;  5C10 A;  2J4R A;  2HBJ A;  2P9U A;  3J8A A;  3KK7 A;  2FF3 B;  2HST A;  3L6Q A;  4PKG A;  3WXK A;  1YIT N;  4JKG A;  4JKD A;  1BA1 A;  3CCL N;  1BA0 A;  3TTD A;  3VGK A;  3BEX A;  4DKW A;  1T6C A;  4FWS A;  4IXC A;  2E8A A;  2CH5 A;  2YJF A;  4PKI A;  1M1K O;  1VQK N;  3ULE B;  2IIR A;  4M63 C;  1T3V A;  4CI6 A;  4JKE A;  2F7T A;  2Q0U A;  1GLF O;  1SZ2 A;  3FZL A;  4BRC A;  1TYQ B;  3OBY A;  3OA9 A;  3TTF A;  4ISF A;  4BRN A;  1IG8 A;  3FGU A;  3CC2 N;  1GLD G;  2ZF5 O;  1HPM A;  2I7P A;  3R1X A;  4FL9 A;  1V4T A;  4H0P A;  3A5L C;  5GIP A;  1P8Z A;  2V7Y A;  2YX6 A;  3HRG A;  1BU6 O;  3ENO A;  2P9P B;  3VF4 A;  3AY9 A;  3D2F A;  4BVO A;  1K8K B;  5AQW A;  3A5O C;  3CMA N;  3O6W A;  3VGL A;  2FXU A;  3GE1 A;  5BRF A;  3DXM A;  4K41 A;  5BRD A;  1BG3 A;  3VEX A;  4YDU A;  3QBX A;  3OBW A;  3F2K A;  3C65 A;  2JWK A;  5BN9 A;  4Z94 A;  4O8U A;  1GLJ O;  3FZF A;  4U67 L;  4CJ7 A;  1VQ4 N;  3EE8 A;  5GAH P;  1T44 A;  1VQ5 N;  1Z6R A;  5M1P A;  4A59 A;  5CHI A;  2P9K B;  3UE5 A;  3F9M A;  4H0X B;  2P9U B;  4CZH A;  1MDU B;  1DEJ A;  4BR9 A;  3KWI A;  4U7B A;  1S3X A;  4BRH A;  4JKG B;  3VEZ A;  1W2B M;  2OAN A;  5AQI A;  1HKC A;  3VMF B;  4BRF A;  1U2V B;  5C15 A;  4DQ8 A;  4I6M B;  3E66 A;  3HOT A;  3CCE N;  4H5N A;  1YHQ N;  2NRX A;  1QQM A;  4YOU A;  1ESV A;  3HSC A;  4WFN L;  4EHT A;  2V7Z A;  1ZC6 A;  5HL7 L;  1VQP N;  3BP8 A;  3GOI A;  5HOO A;  1X9J A;  3ENH A;  3SAH A;  5ADX H;  1BDG A;  4PL7 A;  2NLX A;  4CZG A;  1Q82 O;  4K42 A;  2HMP A;  1VQ7 N;  3BUZ B;  1VQ9 N;  3O9S A;  1VQM N;  1QVG M;  2D0P A;  3W0L A;  4NB4 A;  4FVU A;  3TPQ A;  5FPE A;  1BWF O;  3G25 A;  5AQO A;  3D2F B;  2E88 A;  1QZ6 A;  2NRR A;  3GL1 A;  2FF6 A;  3HZ6 A;  4J8F A;  2IVN A;  4MDA A;  5M1Q A;  2P9I A;  3EKU A;  4WF9 L;  2QEX N;  2QI2 A;  1YJW N;  5TKY A;  3DJC A;  4ISG A;  4BRD A;  2UYT A;  1SS6 A;  3CER A;  2NZT A;  5E26 A;  1OKJ A;  1NGA A;  3FR0 A;  3CJC A;  1ZBS A;  3L4Q A;  4CZI A;  2P9L A;  2IVP A;  4FWM A;  3CCJ N;  5BPL A;  3ZEU A;  1YI2 N;  3TU5 A;  4WQ4 C;  1NGD A;  2I7N A;  3SK3 A;  2Q36 A;  1GLL O;  5TKW A;  1IJJ A;  4L3Q A;  4G9Z A;  2QWR A;  3FFK B;  5LY3 A;  1WUA A;  4CZE A;  4A5A A;  4JKA A;  3LDN A;  4IDH A;  4CZL A;  4LC9 B;  3CQX A;  3EE9 A;  3LDQ A;  4E1J A;  2FSK A;  1K9M O;  3AAP A;  2CH6 A;  5AQT A;  3Q7B A;  4JK7 A;  2W41 A;  3UKR A;  2OTL N;  1JCG A;  4JHD A;  2KHO A;  3E1Y A;  1DGK N;  2YHX A;  2QTD A;  4MLH A;  2A3Z A;  3I8B A;  4KH4 A;  1CZA N;  1KXP A;  4M7X A;  3WXM B;  4ISE A;  1KAY A;  3AAR A;  5ELZ A;  4K25 A;  3WXJ A;  4XH4 A;  3SJH A;  4B9Q A;  5M1F A;  3O5B A;  4HWI A;  4BRA A;  2NRH A;  2P9I B;  2YJE A;  3QFP A;  5EY4 A;  3VPZ A;  3ATU A;  4WQ5 C;  5AQK A;  4AM6 A;  1U6Z A;  3E9P A;  3HM8 A;  1HUX A;  2GUP A;  5LJV A;  4FWO A;  3Q7C A;  3VEN A;  3H3O B;  1EQY A;  1YVN A;  1VQN N;  3CET A;  2P9L B;  3CIP A;  3EL2 A;  3MWT A;  3CCS N;  1G99 A;  4H5V A;  4NLC A;  1JCE A;  4OPH A;  5BPM A;  3M6G A;  3ZEU B;  4IOA L;  5AQX A;  3MMV A;  3SLC A;  5GAD P;  4FWQ A;  3P39 A;  3F5T A;  3HI0 A;  2WC9 A;  4WCE L;  2QW9 A;  4B1W B;  3CCM N;  3WT0 A;  1C0G A;  2ASP A;  2A40 A;  4WFA L;  3GG4 A;  4YOV A;  1ATN A;  4ILH A;  3FLC O;  2NRW A;  1N8R O;  2DPN A;  3TTC A;  3UKR B;  3VF6 A;  4A2B A;  3C6A A;  5FPM A;  5F0X A;  3I56 N;  4JHD B;  4BRQ A;  2KKZ A;  5AQL A;  5EXW A;  4EIA A;  5GAG P;  3OW2 M;  4RCH A;  1RFQ A;  4EAH D;  5AZJ A;  4EHU A;  3A5M C;  1ZXO A;  1ATR A;  3PIO L;  3NMU A;  2F9T A;  2A5X A;  5AR0 A;  1RGI A;  2CGJ A;  4BC3 A;  2QWO A;  3S41 A;  5MLC Q;  4MLE A;  3CPW M;  4YOT A;  4CZF A;  2HOE A;  3C7N B;  3MWP A;  5FPN A;  1VQ8 N;  1HKG A;  4FOE A;  4H0O A;  2E2Q A;  1YJ9 N;  4HTL A;  2Q97 A;  5BR9 A;  3SMS A;  5CE3 A;  1Z05 A;  5JVH L;  1VQO N;  4DCH A;  3CJA A;  1QHA A;  3H1V X;  2HBK A;  4IOC L;  1YF5 L;  1NGC A;  2A42 A;  2ASO A;  3M1F A;  1S22 A;  4H5R A;  3LDO A;  3SMP A;  4DB3 A;  1HKB A;  1WOQ A;  4BRI A;  2A6A A;  2ZWH A;  3VEO A;  3O9R A;  4BRL A;  3CCV N;  1NGH A;  3O9U A;  4Y0W A;  2W40 A;  3CCQ N;  3CC7 N;  3QDK A;  5DM7 L;  4WFB L;  4BGA A;  1GLE G;  4MO4 A;  4QS8 A;  3E9L A;  4AF1 A;  3L0Q A;  4RWT A;  2E2N A;  3AGR A;  4C1N I;  5M1K A;  3N4Q A;  5M1N A;  4JK8 A;  3M5R A;  3DAW A;  4PHT X;  1W97 L;  3U9D A;  1JJ2 M;  5C2F A;  1D4X A;  2H3G X;  1NGJ A;  4CD1 A;  1TUU A;  2RE2 A;  3UKU A;  3VF2 A;  3IDH A;  2NNW A;  3U4L A;  3A8Y A;  3T69 A;  2D1K A;  3CF5 L;  4GV9 A;  1H1V A;  3DWL A;  3DXM B;  4FSV A;  2PFU A;  4IEI A;  4IZ9 A;  5BPN A;  5C0Y A;  3O80 A;  4O5F A;  4BR0 A;  4CBU A;  1MWM A;  3WEE A;  3CCR N;  5I9E B;  4BR5 A;  1KD1 O;  4FWK A;  3B8A X;  1HX1 A;  3H1Q A;  4WQ4 A;  4NO7 A;  3CXC M;  3C6H A;  4BC2 A;  1KC8 O;  1NLV A;  3GBT A;  3KHY A;  5AQY A;  2CGL A;  3AAQ A;  4ILG B;  1R59 O;  3K9J A;  2QXL A;  2YHW A;  2HF3 A;  4JD2 A;  4H0V B;  3MN9 A;  4PL8 A;  3SAG A;  5AFU H;  3LM9 A;  1K73 O;  4IJN A;  4KH5 A;  1VAZ A;  4JN4 A;  1OVY A;  3L4I A;  1YUW A;  2D0O A;  1RDW X;  4BRM A;  3QML A;  2RHK A;  2OTJ N;  2GWJ A;  2ZJQ L;  4FWN A;  4WYB A;  3G4S N;  2WBN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...