1LW2A

Crystal structure of t215y mutant hiv-1 reverse transcriptase in complex with 1051u91
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
539
structure length
518
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFARKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLYTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
publication title Crystal structures of Zidovudine- or Lamivudine-resistant human immunodeficiency virus type 1 reverse transcriptases containing mutations at codons 41, 184, and 215.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 141
structure length 518
sequence length 539
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2002-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1lw2A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lw2A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lw2A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lw2A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1lw2A05
2WOMB 4QPXA 4IFVA 3AVCA 2XY6A 1RTJB 3P1GA 4WE1B 4YFUA 4DSLA 1BCMA 2W9BB 1ZYQA 1T8EA 1FKPA 4C8LA 4ELVA 2R8KA 1BI4B 1NK5A 4UQGA 1JLGA 1YVUA 3D0PA 1UA0A 1NKCA 4ECWA 4KAZA 1JIHA 4G1QA 4CFBA 1OS5A 2G8UA 4WXOA 1S4FA 4C8NA 3VQ7A 4AHRA 4CGFA 4URQU 4B9TA 3SJJA 3MEEA 2GBZA 3OYLA 5C5JA 3NFAA 1RBRA 3KMQA 4IH7A 1RCHA 1NK4A 1RDBA 4DSJA 4CEAA 1S0OA 4DQQA 4PWDB 3MXIA 3ASMA 1F21A 1VSFA 4PUOA 4E7JA 4HVJA 4AHUA 4CIFA 2WTFA 1TVRA 4LD0A 3CJ5A 3ZT4A 3DYAA 4OVLA 4QCLA 4EBDA 5F8HA 4DQSA 4CF9A 2DTUA 3OJUA 2AWZA 3ZSVA 1QAIA 1NHUA 4FK2A 4E89A 2OPSB 3AA2A 2IA6A 5KFAA 4B9SA 4CJFA 5KG0A 4BDPA 3PO4A 5CY4A 4L8RB 3BGRB 3I0SA 5JUMA 5KG5A 3FSIA 2XCPA 3VQSA 4TQSA 1RBSA 4IG0B 4RW9A 2JEFA 3HO1A 5E41A 4IR1A 3JYTA 4CHQA 3M9MB 4QWDA 3H5XA 4CJUA 1RTIB 4NCBA 2O5DA 3QGHA 4KI6A 3NF8A 2HB5A 1LV5A 3HP6A 5C42A 5DG7A 4MK9A 4B3OA 4KTWA 3RMBA 3ISNC 3CIZA 5CZ1A 3PX0A 4ECZA 4ZPCA 5K14B 4O3SA 3CDUA 3K5OA 5KFFA 4CEEA 3VQ4A 3O3HA 5J2MB 3DOKB 1FK9A 3WNGA 2HHQA 4Y2AA 2ILYA 4OGCA 5DGBA 1RDAA 1RT3A 1BHLA 3V9XA 1TKDA 5KFJA 2WONA 1N4LA 2ALZA 4ECUA 4ZPDA 3MXMA 4TYBA 4K8ZA 4ZVGA 4CEZA 3T5HA 4CGDA 2B43A 4KI4A 4RNFA 4DFJA 4DEZA 3NAHA 1C1CA 1ZTWA 2D7SA 3FQLA 3KLGB 2GC8A 1J53A 2Z1HA 1S6QA 4X2BA 2VG7A 4F4ZA 4CCHA 2DFEA 2DY4A 4HKQA 1TAUA 4F2SA 1DTTB 1HYZA 4Y1DA 3ZSWA 4NLVA 4QOZB 2W9CB 2B5JB 1S6PA 1WAJA 5CYMB 3V81A 3LP2B 3HVTA 1CLQA 1R0AA 3PR4A 3LWLA 4ED3A 4TYAA 3OVNA 3AO2A 4NYZA 3PR5B 2BR0A 5I42B 2YKMA 2XI2A 3LPUA 4KAIA 1C2PA 5KFVA 4CEQA 1QSLA 2V9WA 4DG1B 1HQEB 2Z1GA 1CZ9A 4H4MA 4ZPAA 1Z4UA 2IM2A 3QEWA 4O3NA 3NH0A 1SUQA 4M42A 3C6UA 3OL8A 1LWEA 4FK0A 1RAJA 1U09A 1CZBA 4CHOA 5KG4A 3GV7B 4ECXA 3ZT0A 3M8QA 4J2DA 2C2DA 3NL0A 4LH5A 3E51A 3C6TB 2XY5A 4YMEA 2AGOA 1RT6A 2WHOA 3PX4A 1RTDA 3AO4A 4MKBA 3G6VA 3AO3A 1S9GA 2UVUA 4DQIA 3ZSQA 1IKYA 4MKAA 4QW9A 2W8KA 1RT1B 3OYNA 3VQ5A 3GV8B 5C25B 4ZP7A 4RW7A 3G6XA 5KFWA 4CGGA 4LY7A 1IKXA 4TY9A 4B8AB 3DI6B 3VQAA 3HPGA 4Z4HA 2FJXA 4R5PA 3KHGA 3O3FA 2VG5B 1WAFA 3M8RA 2RKIB 4EZ6A 4RW4A 5KFIA 4IRKA 1HPZA 4JV0A 3NCIA 3OSPA 2LSNA 3LALA 1UWBA 2FVQA 4NLOA 3ZSXA 4O4GA 2IS3A 3DLGA 1DTQB 3QIPA 1I39A 3H59A 1RYSA 1ASWA 1KVBA 2RF2B 4OKJA 4Y3CA 4YR3A 1TKXA 4QWBA 1D5AA 5FDLA 4J9KA 3N6LA 4CJ4A 2ZKUA 5DLFA 3CYMA 3ZSOA 3HHKA 2HW3A 5HROA 4OKEA 1SV5B 3LDSA 2G8HA 1RT2A 3LP3A 2HWIA 1L5UA 4B08A 2E6MA 3KLFB 3CM5A 1HQUA 1KRPA 1NK6A 3RB4A 1SKSA 3OYKA 1U48A 3LP1B 3MEGA 3DRSB 4ED1A 1I3AA 5DG9A 4DU1A 3TAQA 4DSIA 4DL4A 3NH1A 3RMAA 5KT2A 5C24A 2UVVA 2D3ZA 3BSNA 4K4ZA 3SQ1A 4DFMA 2CJQA 3EPIA 1IKWA 1QTMA 3OYEA 5CZ2A 1HMVB 3BJYA 1HNIB 4TQRA 1XHZA 4ZP9A 3OYGA 4CE9A 5KTQA 3LZJA 3JSMA 1K1SA 4ECQA 2QXFA 5HP1B 4AHSA 4W5NA 4DL2A 3OYCA 4CERA 3NHGA 5KFHA 4AILC 4Q43A 1VSJA 2P5GA 2A1RA 1RBUA 2QV6A 4DTMA 4Q5VA 2KFZA 1S9EA 1BQNA 4LQ9A 2G8IA 2AQ4A 5L1IA 2V4QA 1C0TB 2IC3A 1S49A 2OPQA 2AX1A 3CDEA 1RTHB 1QE1B 3QINA 2HHXA 3E01A 3NKYA 5KRTA 1VRUB 4NRUA 1YTUA 3SPZA 2YKNB 3LP0A 4RNMA 4KKOB 4F8RA 4KREA 2P1JA 2W7PA 5KFBA 4DS4A 5T14A 1NKEA 4I7FB 2FVPA 4CJLA 1C0UA 4BWMA 4ECSA 3QGIA 4DF4A 1MMLA 4ECYA 3L2QA 4ZTJA 2JLEA 3DRRA 4ID5A 5KFUA 4CHZA 2XWYA 3KK1A 4KB7A 3L2UA 4DQRA 1U47A 1NJWA 1S48A 2HVIA 3Q8PB 1ZBHA 3BSAA 3HM9A 4Q45A 3DLKB 4ED0A 2YNHA 1N48A 4OPJA 1FKOA 2BE2B 2YHAA 2RDJA 4FVMA 3ZT3A 3ALYA 4KHMA 3QNNA 4N47A 3L3VA 3HYFA 3TR8A 4KRFA 1HJRA 3AVHA 2KTQA 5F9NA 5KGWA 4IH6A 2GV9A 4CJVA 4CIEA 4K4VA 4PQUB 5J1EA 1D1UA 1C1BA 4O4RA 2D0BA 2E6LA 4BE1A 2XY7A 1JXLA 1GOAA 1D9FA 3ZT1A 1KTQA 2HWHA 4EO8A 3NBPB 2ASDA 1J9AA 1BIZA 1LW2A 2JEJA 1JLAA 1RT4A 2Y1IA 4JV1A 4R8UA 1GOCA 4N56A 5FRNA 1TV6A 4N5SA 3LANA 5D3GA 4Z4EA 1MU2A 4F2RA 4Z4CA 4EO6A 3P5JA 3K5NA 4N76A 2UUWA 3DLEA 1B92A 4IRDA 2A1SA 2W9AA 4M95A 3KLHB 3OL7A 1T05A 1BIUA 2XI3A 4RW6B 4WXWA 4KE5A 2RN2A 3AVJA 3QO9B 3HSTB 1KLNA 2C22A 1D9DA 3SUQA 3Q8SB 1C6VA 4O3RA 3OYMA 3CFPA 1S1TA 2HHWA 1NOZA 2FVSA 4O3QA 3KLIA 3HT3A 1JKHB 3DMJB 4B9VA 1WSIA 4Z4IA 4ZMMA 4W5QA 5J2QA 3NGIA 3PW5A 5HRRA 1L3SA 1EXQA 2G8KA 2YNGA 1WSEA 3MEDB 5T7BA 4K8XA 2IAJB 1SH2A 3CJ3A 3OS2A 4W5RA 4NYFA 3V1OA 3KNAA 4KSEB 1IO2A 4CF1A 1LWCA 1VRTB 2OPPB 4MH8A 3SZ2A 1C1AA 3OJSA 1J5OB 3QEPA 1NNDA 5KFRA 4IFVB 1RILA 3HPOA 2R2TA 1JL1A 3K57A 3L2RA 1FKPB 1A5WA 4CGIA 4KFBA 3WNEA 1XR7A 4M3RA 4RUCA 4KTZA 1XHXA 1KLMA 4G1QB 4I9LA 3TAEA 5KFQA 1IKVB 3CJ0A 4KV8A 3QZ8A 5L1JA 3M9OB 1W9HA 2PYJA 1TKZB 5FRMA 3L2WA 1TL3A 4RNNA 1IM4A 4Z4FA 4XPEA 3H08A 3MEEB 2ZD1A 3M8PA 1B9DA 3RB0A 5CYQB 4NLTA 4E7LA 4CGJA 4NLQA 4GC6A 4J9QA 4WE1A 4CK1A 1JXEA 4BACA 3F9KA 1FXXA 1HNVB 2E9ZA 4PUOB 5KI6A 3U6FA 1WSJA 1TVRB 3KHRA 3VQBA 4WFYA 3DYAB 3KKSA 4NZ0A 1G15A 2QE5A 3KK2B 3ZSZA 2HNYA 1SH3A 3RR8A 1EETA 4K4TA 2YNFA 1KHWA 2ILZA 4J9LA 4DQPA 1HRHA 3IAYA 1BQMA 3IGVA 3MR5A 3SQ2A 2C2EA 2EHGA 4RW8A 3PW2A 2FBYA 5HLFB 1RT7A 2XY8A 3RBDA 4ED7A 4FJJA 5KT7A 3JYTB 3HXMA 2VWKA 3CFRA 4OLAA 3Q8QB 4H4OB 2YHBA 4GMJB 2FC0A 1U4BA 5DQHA 4NLPA 4C8OA 3SCXA 2RPIA 2OH2A 3QESA 4NCGA 2B6AA 3CG7A 1L3VA 4B3OB 3QGGA 1JLCA 1QAJA 2BQUA 4CECA 4J2EA 3SQ4A 3MTKA 3I5CA 3MXJA 3EPGA 3NF6A 3V9ZA 1ASVA 2FBVA 3RRGA 3BR9A 1S0MA 2PZSA 4IR9A 2XGQA 4FW2A 3ZSRA 3HP9A 1RT3B 3IS9B 4F4KA 2WONB 4MIBA 3MFIA 4O0IA 2R2SA 1J54A 4LSLA 4RZRA 2OZSA 4Q0BA 3ITHA 4URSA 2R8HA 4EYHB 3D45A 4NLYA 4MK7A 4ZPBA 4HCBA 4EBCA 4M3XA 1C1CB 4O44A 1JLFA 1S6QB 1JX4A 4YQWA 3ULDA 5KFPA 3QYYA 2VG7B 5SZTA 2KZMA 3T1AA 2E4LA 4WYLA 3SFUA 2VWJA 4JRPA 3NF9A 2XHBA 3LZIA 2HHTA 1S6PB 1L3TA 1REVB 2I5JA 4CJKA 3UPFA 4ZVFA 2WCXA 1R0AB 2IGIA 3NGYA 3TAFA 3T19A 4F3OA 5KFEA 1S1XA 4DTJA 1DLOA 3KK3A 3ICLA 3H5SA 4CJWA 2G8VA 3KLGA 1HYSA 4BE0A 3AVLA 4GW6A 5J2NA 1U49A 1NJYA 2OPRA 1SUQB 3C6UB 1LWEB 4DFKA 4CGHA 3DOLA 4I2QA 4ED6A 4B9MA 3NH2A 5KG7A 3LP2A 4AHVA 2W8LA 4FM2A 2IM1A 3M8QB 4NLGA 4DL3A 1RT6B 3PJXA 4LSNA 5I42A 4HCCA 2O4IA 3AA3A 2JEIA 1IKYB 3D5MA 1HQEA 4E0DA 3V6HA 4RW7B 3WNHA 3SUNA 1IKXB 4O55A 4IOBA 4J2AA 3KLEA 4NCAA 4R5PB 4DF8A 4FLTA 2VG6B 2ZE2A 2B4JA 4BWJA 4RW4B 4DL5A 2OYQA 3FFIA 2F8TA 1BCOA 3B6OA 3V6JA 5EWFA 1UWBB 1D0EA 3T5LA 4BDZA 3RRHA 2R2RA 1NK8A 4I9QA 4JUZA 4EP5A 3K5MA 2FBXA 4K4SA 2AGPA 3GIJA 5HRSA 1TKXB 4HUEA 1QUVA 1T3NA 5KFXA 4C8MA 5KFLA 4F4XA 5EDWA 1TAQA 4LQ3A 1QSYA 1JLBA 3DLBA 5HROB 4EP4A 2D0CA 1LW0A 1RT2B 4K50A 1ZETA 3IRXA 1HQUB 3SNNA 4I2PB 4IKFA 1YVFA 2ITGA 3MEGB 5EWEA 2XGPA 4FJNA 1DTQA 4KHNA 3KTQA 4IDKB 3FQKA 1TKTA 5C24B 3KHLA 1N56A 1ZBFA 3EYZA 1WN7A 1S0NA 3T5JA 2IBKA 2BDPA 3OYFA 3K58A 2FBTA 3DRPA 4B9NA 4MK8A 1CXUA 4ICLB 1WSGA 4YP3A 3CFOA 5JS1A 3PW7A 2QKBA 1EKEA 4MFBA 5KG6A 3OYBA 3KIOA 3NAIA 3IG1A 2HNZA 2R8IA 2UVWA 1S9EB 4KB0A 1BQNB 1LAVA 2IC3B 2OPQB 2JC1A 3K5LA 3AVBA 3E01B 2IM3A 1JL2A 5KFTA 1IH7A 4OL8A 3V9SA 4CF8A 1X9WA 2KZZA 3BREA 3I8DA 3SV4A 3SI8A 1HNIA 2W7OA 1NJXA 4TY8A 1KSPA 4DSFA 3KKRA 5HP1A 5KRSA 1A5XA 3DLRA 3QLHB 4EYIB 3MECB 1S1VA 1NK7A 4ZHRB 4IG3A 2HMIA 2F8EX 4QWCA 4BDYA 4M3WA 4KB1A 3KJVB 3DRRB 4ID5B 4F50A 4FLZA 3O4QA 2C28A 3QIOA 4CK2A 1Z26A 1TP7A 3U3GA 4CF0A 5EUHA 1SL1A 2AU0A 1L3UA 3HVRA 2GIRA 3THVA 2JGUA 4DLGA 4DU4A 3RMDA 1HYVA 3VA0A 2ETJA 1EP4B 4ID1A 3OYAA 4FJHA 1S1WB 3MAQA 4DFPA 2O4GA 3V6DA 3BQ0A 1W25A 2XC9A 4I7FA 4E7HA 1GOBA 3QIDA 3OY9A 4FJLA 5HBMB 4DSKA 1ZBUA 4FZZA 1TGOA 2IJFA 4KHRA 3H98A 5EWGA 3SPYA 4JS5A 4CEBA 3QZ7A 2IOCA 1TL1B 2J6SA 4KO0A 3TAMA 5KFDA 4HHTA 4RNOA 1S9FA 1JLEA 2FVCA 1WSFA 3SUPA 1C1BB 5KT3A 2IDOA 4DTOA 3OL6A 1LWFA 2BANA 1SL2A 2GIQA 1ZBIA 2BE2A 4B9UA 1ASUA 2YNIA 3H5YA 3S3MA 1QS4A 1T03A 1N5YB 3VQCA 2G8FA 3I0RB 4DL6A 4HUGA 1TV6B 1WSHA 4U7CA 2X6NA 3MF5A 5DMRA 4FYDA 3DDKA 3LPTA 1MU2B 2VA2A 3MR6A 5EU7A 1S97A 4DTSA 3DLEB 3KD5E 4O3PA 5KG2A 3GILA 4FJ5A 1T94A 4TXSA 3GQCA 3LAKA 3OYIA 4FJ9A 5L9XA 3NBPA 4PA1A 3NF7A 2KFNA 3RB3A 5I3UA 4WZMA 3L8BA 1S1TB 4IFYA 5J2PB 2ATQA 4WZQA 3CJ4A 2IMWP 3CM6A 3HVAA 3ISND 2HHUA 1WNEA 5J2QB 2HNDB 1S1UB 1ZTTA 3L3UA 2KQ2A 1XI1A 3BSCA 3TAGA 2WK4A 3ZSYA 4WFZA 3OS1A 4DTXA 3KLHA 4J9PA 4RG8A 2R8JA 4M3ZA 1JLQB 3V4IA 3NDKA 3RR7A 4URGA 2X78A 4ZP8A 1UOCA 2D3UA 1NKBA 3VQ9A 5L1KA 4ZVHA 4FLVA 4CJ5A 4J9OA 3RAXA 4E7KA 4C8KA 3DMJA 1N6QA 4OGEA 3KD1E 1QHTA 3V1RA 2FJWA 4KFBB 4W5TA 3AVAA 3ZT2A 1RT5A 2OA8A 2DPIA 5F8JA 1JLGB 4CJTA 3PJWA 4YR2A 2DFHA 3O4NA 3DM2A 2JC0A 4ECRA 4NLRA 1TL3B 2R7YA 1RA6A 3AO1A 3M8PB 1WNSA 4DMNA 3S9HA 3UR0A 4FJKA 2J6TA 4NLUA 3PY8A 2WOMA 4JS4A 4FJIA 3H4BA 1B9FA 1LAWA 4HUFA 1RTJA 2D0AA 2W9BA 3EY1A 2EC0A 5SWMA 4E1NA 1BI4A 4NLSA 1BL3A 3NGDA 1IKVA 2HNYB 4QAGA 1W0HA 3AA4A 4F4WA 4B9LA 1RA7A 1TKZA 1VSDA 1X9SA 1EETB 4AHCA 3V9WA 3CQ8A 1KVCA 4CJRA 2YNFB 5JS2A 3GIKA 1TK5A 3OL9A 4YNQA 4ZP6A 3TAPA 5CYQA 4FXDA 1BQMB 4ED8A 2FVRA 4FBUA 3VQ8A 4CJPA 4RW8B 1HNVA 3H40A 1RT7B 1K6YA 3I0SB 4K4WA 4PWDA 4EBEA 2G8WA 4K4XA 2DFFA 1KVAA 3KK2A 4RW9B 3TWHA 4ELTA 5KG1A 4O0JA 3I5BA 4M94A 4FLWA 2V0NA 3OYJA 4ECVA 4CHNA 3RWUA 4FZYA 1QSSA 1X1PA 4NCGB 4E7IA 2B6AB 3LAMA 1JLCB 3K59A 3MFHA 2AJQA 1S5JA 2OPSA 2I1RA 1VSKA 5C42B 1TK0A 4KHUA 4CK3A 4E3SA 4ZVEA 5KFSA 3RTVA 3PVXA 2XCAA 4IBNA 5HLFA 3BGRA 3N6MA 4FBTA 4J9MA 3GYNA 3TVKA 4KHSA 4IG0A 4QWEA 4H4OA 3BQ1A 5KT6A 3G6YA 4NRTA 4W5OA 1FK9B 4J9NA 4CJ3A 4OLBA 2BGGA 4IQXA 4IKAA 1RTIA 3PUFA 3EZUA 3OHBA 3HVWA 4LSLB 3AVNA 4Q0BB 3ITHB 2Z1IA 3UQSA 3AA5X 3SYZA 3QEIA 4IRCA 5FROA 3KOAA 3C95A 3G0ZA 4O44B 2UUTA 1JLFB 5K14A 4CFAA 4WYWA 3VN5A 1ZBLA 1I6JA 1RDCA 3AV9A 4HTUA 4M45A 1VSIA 3VQPA 2BRLA 4FM0A 5J2MA 3IS9A 3DOKA 2I5JB 3QEVA 3OLAA 2V4RA 4KHQA 5KFKA 5HRPA 2DPJA 2WB4A 2X74A 2AX0A 4JRQA 3V81B 3HVTB 1S1XB 1DLOB 3KK3B 3CVKA 3MR2A 3NAEA 3TI0A 4FK4A 1HYSB 3TANA 2YKMB 1RDDA 2W42A 5J2NB 5F8IA 3MR3A 4AHTA 3EZ5A 4FZXC 2OPRB 3LWMA 4O5BA 1NK9A 4H4MB 3DOLB 3QEXA 1REVA 4I2QB 4NYNA 4K4YA 2BQ3A 1DTTA 2W9CA 3PZPA 4OJRA 2B5JA 3OSNA 3F73A 2RDIA 3HL8A 5CYMA 1KCFA 3AVGA 4CJSA 3PX6A 3NE6A 4U6PA 3OYDA 4LSNB 3OHAA 4FCYA 2BRKA 3IN5A 3K2PA 3ZCMA 4O3OA 1RTDB 4DL7A 1VSHA 2HAIA 5KG3A 4CFCA 3M8SA 5KFZA 4FW1A 1S9GB 2P5OA 4CFDA 3QNOA 3RB6A 4CHYA 3OLBA 3VA3A 3KLEB 4DG1A 2ZE2B 2ASJA 3QETA 4ED2A 5DK5A 1QQCA 1VK0A 4PY5A 2UVRA 3FFIB 1Q8IA 5KFNA 4Q44A 2JEGA 5F8NA 4DSEA 5L1LA 1HPZB 2PY5A 2E9RX 4O4GB 2ATLA 3DLGB 3QIPB 4OPKA 5DQIA 4NLDA 3OYHA 4FLUA 3C6TA 3PO5A 3IGNA 1RBVA 1IG9A 2QKKA 4GC7A 3TQ1A 5FDLB 1JLBB 1RT1A 1K1QA 5KFMA 5C25A 3Q8RB 1LW0B 2VG6A 4FJ7A 4CEOA 1Q9YA 3KHHA 5DG8A 3DI6A 4MQ3A 3IRXB 4JLHA 4RUAA 3RAQA 2VG5A 2Y1JA 2J6UA 2RKIA 4TSXA 4KHWA 1O1WA 1XR6A 4Y34A 1TKTB 4ZTFA 5F8MA 5KFCA 3S3NA 2E9TA 4R0EA 3GV5B 2IJNA 2D5RA 2RF2A 1KFSA 3A2FA 1YT3A 4CESA 1IKWB 3PHEA 3DRPB 3WNFA 4XO0A 1C0MA 4LH4A 3SI6A 3KLVA 4Q8EA 4CJEA 2XO7A 4XIUA 3M9NB 2Z1JA 4CEFA 1T7PA 4KTQA 4MFBB 1Z25A 4N41A 2F8SA 4I2PA 3JSMB 3IG1B 1GX5A 1SV5A 2HNZB 4EZ9A 4Q8FA 2CKWA 1RDRA 3KLFA 4ECTA 4YR0A 4IDKA 2BQRA 4Y1CA 4KBIA 4NLXA 3LP1A 4OKKA 3DRSA 4DTPA 3V1QA 5F8GA 4TY8B 5F8LA 1VSMA 1NHVA 4ICLA 3AVKA 1HMVA 4DLEA 4FLYA 4E19A 4M3UA 3VQQA 3LP0B 4XPCA 1XC9A 3AVMA 3QERA 2VA3A 1S1VB 3H5UA 5KGXA 4IG3B 2HMIB 1VSLA 2P51A 3PW0A 4FJXA 1NK0A 3AVIA 4CF2A 1C0UB 1SH0A 4FS1A 1EX4A 4CHPA 2C2RA 3CWJA 5KFYA 2OZMA 1TQLA 1RYRA 3I5AA 4H54A 3BDPA 3SFGA 3PV8A 3HKWA 3TARA 4Z4GA 1C0TA 4E1MA 3CJ2A 3NMAA 1CSJA 5JXSA 1SKRA 1RTHA 1QE1A 1HARA 1UA1A 5F9LA 3GIIA 4F3TA 3SQ0A 3FDSA 3KK1B 3B6PA 3RBEA 1UAXA 3BSOA 3VQ6A 1VRUA 3CDWA 2YKNA 3V6DB 4KKOA 3QLHA 3L2VA 4EEYA 3MECA 2D41A 4ZHRA 5DLGA 5HRNA 3HPHA 4NLWA 2YNHB 4J9RA 1CXQA 1X9MA 1FKOB 3OS0A 3RMCA 1GX6A 3KJVA 2ASLA 5DGAA 1NJZA 2HHVA 3D28A 4GVMA 3V9UA 4KO0B 2QK9A 3TAMB 3H4DA 1JLEB 1XWLA 4CIGA 3FRZA 1EP4A 3KMSA 1S1WA 2KW4A 4M3TA 1ITGA 3HK2A 2GUIA 5J1EB 1LWFB 2BANB 1YTAA 4ELUA 2ZQBA 1Y97A 3DLKA 5HBMA 3PW4A 2YNIB 1D8YA 1T03B 1KHVA 2FLLA 3H2LA 1BGXT 4CJQA 1LW2B 1WLJA 1JLAB 1RT4B 4FJGA 4R8UB 3G10A 1BISA 4KHYA 1RBTA 3T5KA 3O3GA 1KFDA 1TL1A 4TLRA 3UDLA 1JXBA 5KFOA 2YV0X 3GIMA 4K4UA 5D3GB 3TABA 1TK8A 3VQEA 1XR5A 2WRMA 5KT5A 1SL0A 2FLNA 3C94A 4PQUA 3G86A 4FM1A 3V6KA 1U45A 2IM0A 4MIAA 3CO9A 1T05B 3VQDA 3BQ2A 1Q9XA 1N5YA 3NGZA 5I3UB 4IFYB 3I0RA 4RU9A 2NUBA 2XRIA 2AGQA 4G3IA 3N6NA 4FLXA 3S3OA 3KLIB 2FJVA 4J2BA 1A5VA 4BE2A 3AVFA 3SUOA 1U04A 3UIQA 4M3YA 4F4YA 2YNGB 4RNHA 3P83D 4AH9A 3V4IB 4JV2A 2Q3SA 4M41A 4DU3A 4B8CA 4RW6A 4FJMA 4QWAA 2X6SA 4Y2CA 1LWCB 5J2PA 3QO9A 2R8GA 4J9SA 3HJFA 1SKWA 2HVHA 1NOYA 4HYKA 1N6QB 3DLHA 4DWIA 4DTRA 3U3YA 2HNDA 2PYLA 5DQGA 3AO5A 1RT5B 1S1UA 4TN2A 1JKHA 1VSEA 4CEDA 4DTNA 4DTUA 2R2UA 2HHSA 5KFGA 1KLMB 4KPYA 4DS5A 4QW8A 3DM2B 1JLQA 3MEDA 4FS2A 3SV3A 4FJ8A 2IAJA 4WFXA 4KV8B 2EX3A 4Z0UA 1RNHA 4IH5A 1VRTA 2F96A 2OPPA 3T3FA 4H8KA 1S10A 5KT4A 2ZD1B 1J5OA 2FLPA
chains in the Genus database with same CATH superfamily
4FWPA 4IFVA 1CJVA 3RU0A 2XM3A 1IBCB 4J8FA 2W9BB 4ZCIA 3ZNJ1 3PEHA 3J80O 4C8LA 3M8WA 3CCJS 2R8KA 3M2UB 3K7RA 4G1QA 4CFBA 4TU9A 1EKRA 1OS5A 2G8UA 2JHEA 4LF9K 1XMOJ 4AHRA 2XLIA 4FNIA 5C2CA 4JKAA 3SJJA 4OZLA 3D6TB 2GHVC 2MDAA 4IH7A 1NK4A 3EE8A 4HACB 2UXDF 1N5TA 3R5CA 1KAXA 1S0OA 4DQQA 1CS4A 3PXGa 2ABYA 4CP5A 1VSFA 2GUPA 2EVZA 2WTFA 4LD0A 3AJDA 3CJ5A 3ZT4A 2B3TB 3SEOA 2B8PA 4DQSA 4CF9A 2J8AA 1HNWJ 2L9DA 1G3OA 4KPCA 4LMZA 1UPMB 1TFYA 3N0VA 4MAKA 4L8RB 4QIFA 1PKUA 1M5HA 1NBEB 4ETXA 2MB0B 3I0SA 4UT4A 4BC4A 3FSIA 1DT9A 1RCXB 2KO1A 2I38A 4ILMA 2HFUA 3HO1A 5E41A 2ERRA 3JYTA 1SC3B 5HVHA 1YJUA 4CJUA 3QFWA 3HHLA 1RTIB 5BN8A 4WIQA 1LV5A 3B54A 3TZYA 4MKVA 3E9LA 5DG7A 4C4WA 4B3OA 4ZKAA 3TVYA 4OJGA 2KXNB 2VASA 1QQMA 2HURA 4ZPCA 1RABB 4F3MA 5KOXA 4ZCLA 3EE3A 4K0KJ 3CDUA 1GTHA 2CNNB 3L9ZA 1HNZJ 5HJYA 5DZ7A 3AJ1A 1K47A 2BV3A 1WACA 5J2MB 1R0BG 4Y2AA 1SBRA 5DGBA 2V8DA 1VGYA 2DGTA 1N4LA 4LSZB 2F3JA 3VAKA 2ALZA 1MMNA 1N0VC 4ZPDA 1ZH5A 2E5LF 5GADP 2DKOB 2G1DA 2JZ5A 4CGDA 4DEZA 2DTJA 3FQLA 4OI4A 3KLGB 2GC8A 2ZZMA 3GG4A 1OPZA 1RXOB 1U8SA 1S6QA 3MM8B 2VQFJ 4NI2A 3LL3A 5EX5A 4X2BA 4ANEA 3G8QA 3N4WA 1RWWB 1TAUA 3VENA 4NLVA 4QOZB 2B5JB 1DAXA 1Y11A 3KZBA 2LMIA 5AR0A 4X4SA 4BRQA 5BR8F 4ZLNA 5I42B 3J80U 2CG8A 3ILJA 4CEQA 3W1YC 3QT5A 2V9WA 1FERA 1HQEB 1YHQN 2Z1GA 4LR9A 4H4MA 4DV5F 3MMBB 3THTA 4DCJB 4O3NA 2B7BB 2YXLA 4YOEA 3NH0A 3CW2C 1GFWB 3FSYA 2I9SA 1VCTA 2C2ZB 1CZBA 4I0WA 3B8HA 5KQDA 2KVIA 1F6TA 4ECXA 4G9ZA 1XQIA 4J2DA 4LH5A 4OPAA 2E5IA 2AGOA 2WHOA 1MROA 1IUJA 4LFCJ 3QWUA 2VV5A 3G6VA 5JLHA 4MKAA 2W8KA 1R31A 4USIA 1VAZA 2YQ0A 4I64A 4YHHJ 5AJ3J 1IKXA 3DI6B 3B78A 4Z4HA 2VODA 2FJXA 1LOUA 1H74A 5KFIA 4JV0A 3NCIA 4CLUA 2QA4S 2GX9A 3R5AA 4NLOA 3UKUA 3LGHA 2MJUA 5GIOA 3H59A 4LJMA 3EKUA 4OKJA 1SQFA 2HK3A 4DUYK 2F8HA 1TUGB 4KQZA 5DLFA 3CYMA 5HROA 2QLFB 4OKEA 2CQIA 4DUZF 2GQCA 3LP3A 5BYQA 3O8MA 3CM5A 1OPIA 3RB4A 4F26A 4ED1A 3I56S 3RVCA 1BLUA 3NH1A 8AT1B 5KT2A 2D3ZA 3AB4B 3BSNA 3WQUA 2CA9A 3KVGA 8RUCA 1FX4A 2HAFA 5AT1B 4R25A 5FPNA 3R7NB 4X4TA 5KQ8A 3JSMA 2HPUA 3A5OC 5HP1B 4AHSA 2EFPA 4DL2A 2D4WA 3NHGA 4Q43A 2P5GA 1RBUA 3PYEA 1YG0A 4X62J 4LQ9A 4A59A 4JKEA 5L1IA 3SQGA 1JB0C 4K5SA 1S49A 2PE8A 2QA2A 2HBKA 3L4QA 1QE1B 2KT2A 3E01A 2UUBJ 4NMLA 2X1GA 4UZCA 1NGAA 1YTUA 2M8HA 5BR8K 4NOHA 3CPWM 3MM7B 4OPHA 3NXZA 5T14A 4IO8A 3WBZA 4I7FB 2FVPA 5L39A 1C0UA 4DF4A 1U6FA 2KI2A 3GE1A 4ID5A 1S6OA 5KFUA 4CHZA 4M5KA 2A1BA 3KK1A 5LL6d 1IBLF 3U27A 4YOXA 3SSRA 3OR2B 1S48A 1XJWB 1VC6A 2FSNA 2HGNA 4Q45A 3OTOJ 4BC5A 3GP9A 2EI5A 4CYUB 4ED0A 1N48A 1FKOA 3PG9A 4KC5A 2YHAA 4QOTA 4M5MA 3FFKB 2XTJP 3VEOA 3CSKA 3HI0A 2A5XA 3QNNA 5I3PA 4WBFA 3DXSX 3VF6A 4KRFA 1HJRA 3ETOA 4CLTA 5M2PA 4CIEA 3G82B 1PJ5A 4DB3A 3H90A 2VF3A 2XY7A 1HHQA 1ZZFA 1JXLA 3CQXA 3QT6A 3TP2A 3R5BA 1IN0A 2F9WA 2ASDA 4BC2A 4CTAB 1U1RA 1JLAA 3GTYX 4JV1A 1GOCA 1N5VA 3MCAB 1CULB 2QXLA 4CH7A 5FRNA 3VVUA 3SAGA 4Z4EA 1MU2A 4ILGB 3P5JA 2UUWA 3I4HX 3DLEA 4IRDA 4OHZA 2HQFA 2A1SA 1KC8O 4LF5F 1QLNA 2VC0A 3OL7A 5H9EK 4RW6B 4WXWA 5G4DA 5HOOA 3AVJA 4A2AA 2EFOA 2XYHB 5IC4B 3SUQA 1YKWA 4JI7K 3Q8SB 1C6VA 4O3RA 4JHDA 2F9TA 2HHWA 1NOZA 3R97A 2FVSA 3L3CA 2E44A 5LXYA 4W5QA 3D54A 3PW5A 4M5HA 1XERA 2QFIA 1EXQA 2WUSA 4A46A 2VC1A 3QAUA 4CZLA 3CJ3A 4NA1A 3THYA 3CJKB 3OS2A 1WC5A 4W5RA 3KNAA 4EHUA 3HZEA 1DARA 1LWCA 1VRTB 3MOZA 1C1AA 1J5OB 3QEPA 1RILA 2NS1B 3D1QA 1KP6A 5AQWA 1H98A 2PAVA 1JL1A 1FKPB 3M2VA 1A5WA 1XQSC 3OPKA 2PI4A 4DR5F 1YJ7A 2ROEA 4RUCA 1WELA 2YWFA 1XHXA 1BU6O 1KLMA 3GG1A 2DGOA 1WI8A 2CQCA 2EXUA 3I9ZA 5LT5A 3G25A 3N79A 2ZBCA 1RHMB 3SIPB 2ZOMA 3GR1A 4QYRA 2ROGA 1WSVA 1HBUB 3MEEB 1XUPO 4USWA 4GKKF 5CYQB 2CQHA 1DFDA 2ZNYA 4J9QA 3F9KA 3WT0A 3LW5C 3U6FA 4WK3A 3M2UA 3MPVA 3E3XA 3KHRA 2VKRA 3VQBA 5E3RA 3DYAB 1H72C 4DX6A 2EKYA 5ETKA 1G15A 3KK2B 3ZSZA 2CVIA 4ZVUB 4BR4A 1SH3A 3ZTQA 4AYBD 4WFBQ 1EETA 2ILZA 1NPRA 1B3TA 1HR0K 1X3MA 4O0NA 2YPZA 4EU0A 4V1Ak 3MR5A 2H9ZA 3SQ2A 3DXMB 3PW2A 2FBYA 3THPA 4PKDB 2XY8A 4HTLA 1CJTA 3RBDA 2YHWA 4JI0J 4FJJA 3HXMA 1FJGK 3GLJA 1S72N 1X5PA 2F4FA 3FZFA 3C8YA 4JKBA 4GMJB 1U4BA 4MIWA 4NLPA 2MZJA 3SCXA 3QESA 4NCGA 4CI6A 1JLCA 1U0SA 1QAJA 3E2EA 4LF5K 4CIOA 1N34J 4J2EA 3MTKA 1X4FA 1HLWA 3I5CA 1YJ9S 5HK4A 3OVAA 4HI2A 3WXLA 2FLOA 4Y0WA 1JCEA 4A2BA 3R5GA 5CYJA 3W63A 4ZVOB 4NB4A 4IR9A 2DYAA 4JI3J 2MXYA 1OYDA 4RO0A 4K2JA 5AZJA 2O8DB 4OV1A 2AF6A 4IO9L 3IS9B 2WONB 3EZWA 1U6BA 3D7EO 3FCWA 2H48B 2XMKA 3H45C 4Q0BA 2C3PA 2R8HA 4EYHB 3D45A 3VGLA 1Y9OA 3OT9A 3FRYA 2H5JB 3ILIA 3CPWR 4TLQA 5DDOC 1IBKF 4YQWA 3W60A 3CCJN 2VG7B 5SZTA 2XLJA 4FL9A 2OEKA 3PRVA 2HFSA 3BS9A 4JBCA 4WYLA 4BHQA 3T1YJ 2WSFC 3NF9A 1GEHA 2QA4G 3BDEA 4DR5K 4LREA 1REGX 4CJKA 3DLJA 1BWEA 3RUBL 4CVNE 1RAHB 4F3OA 3EVMA 3ILLA 4GO7X 3ICLA 2R7UA 2YQ1A 4NZ7A 4WCEQ 4PKHA 3TUIC 4Z7CA 3KLGA 3MM9A 3W5ZA 2DGSA 3ONQA 3OTEA 2XYPB 1U49A 3NGRA 2BM0A 2VPYB 3VZIA 3S7RA 3AD7C 4AHVA 3PRBA 1LQ9A 4FM2A 2IM1A 3CDAA 5GAGI 3PJ9A 5E3QA 5AQXA 4CT8A 2F7VA 2D9OA 5I42A 1GXUA 4FNHA 4DV0J 1A9NB 3GOIA 4L6V3 1HQEA 2WBRA 3V6HA 3TJ9A 3SUNA 3MMBA 1HFEL 4R5PB 2ZE2A 3JTOA 4UOHA 4D3GA 3V6JA 3VEYA 4ENOA 1D0EA 4DV2K 4BDZA 4F0HA 1IR1A 4EP5A 4FPIA 2FIUA 2AGPA 4K4SA 3G8TA 3HT0A 4HUEA 5HQ8A 2R7SA 1FRHA 3RAMA 2JJ4D 5EDWA 3KWGA 3QICA 5BREA 5JJBA 3CPEA 4IWVA 4DUZJ 3UI3A 2CH6A 2D0CA 3Q83A 1ZAWA 2HBJA 5G0RB 3HHLC 4B1XB 4ZDNA 3NWRA 2FB0A 3SNNA 3HZGA 1VJQA 2KG1A 4UOCA 2ITGA 3IXQA 3MEGB 4DPOA 2YH1A 2ZWHA 1EO1A 5EWEA 4B1WB 5AQPA 5C24B 1N56A 2WVBA 4PG6A 2BZ2A 3D0IE 3EYZA 2XZDB 1TU0B 3T5JA 4LIRA 1S4EA 2FBTA 3PIPL 4G1IA 1CXUA 3NGSA 3CFOA 3PW7A 1BE4A 1YITS 4X4PA 3GCXP 3NCRA 4MFBA 1SJQA 3J7YI 2LXFA 3CCLS 2E2PA 3CMES 3KIOA 3WC0A 3HF5A 2UVWA 1VQ7S 1E4FT 1S9EB 4KB0A 2IC3B 3AQPA 3VEXA 1JL2A 2DHGA 3V9SA 3IM9A 4PZVA 2HSTA 5A8KA 3I8DA 2P5VA 3SI8A 4UTGA 2MKCA 4U7UK 5M2RA 4O8UA 4BRPA 5D0GA 4OYXA 5HP1A 2B9WA 1Y5NB 4OJ3A 3DLRA 3QLHB 4OYPA 1S1VA 2HMIA 2F8EX 1X3NA 3WEEB 3ENOA 1S7HA 4QWCA 4BRGA 4KB1A 4PG8A 3PFEA 3PACA 3DRRB 4F50A 2V8GA 2R42A 4FLZA 2DHHA 1KAZA 1Z26A 5EUHA 3GE9A 2AU0A 3HVRA 2GIRA 3THVA 4DU4A 4DR4K 2MLXA 2O4GA 3UN2A 2MKJA 4I7FA 4E7HA 1GOBA 3OY9A 5E84A 4JI5K 2OP5A 4FZZA 1S57A 1D9AA 1QHAA 4JS5A 1RWOB 1V9OA 2RVJA 3BBBA 3BO4A 3IWLA 4HHTA 1Q7YO 2PIIA 3C3LA 4DTOA 2HHHK 2AJFE 4DCPB 1SL2A 1SXLA 3I33A 4KGXB 1ASUA 4B02A 3TJ8A 5IT9Y 4X4QA 1U2FA 3CCMS 4DL6A 3LDPA 4HUGA 4DV6F 1TV6B 1WSHA 4U7CA 2QL7B 5DMRA 3I56N 4FYDA 3DDKA 3LPTA 3QSYB 5EU7A 2B9XA 4JYAF 2ZWPA 3PRDA 4UF4A 2KJVA 3C0BA 2V63A 1T94A 4P2MA 1PBAA 5HMXA 1GXLA 5ITHA 2VYPA 1KN6A 1NG9A 4GMKA 2WTUA 3TVZA 2KFNA 3IAM9 4PKIA 1CULA 3NVMA 2VOPA 2IMWP 4LF7K 3HVAA 5J2QB 1FDDA 2HNDB 1Y10A 1HKCA 2EBGA 1KR4A 1ZTTA 2OMOA 1NJIT 3BSCA 3CIMA 3TAGA 3ZSYA 3CJ9A 3O5BA 3R1HA 3L09A 4WFNL 4DU7A 3HKZD 3UO0A 1T0TV 2RHSB 5CD4H 4ETZA 1UOCA 1NKBA 3EGWB 3NP5A 2VBXA 4L3KA 4DR1K 3SBTA 1BQXA 1XNRK 3K2YA 4BR2A 5B09A 3CO0P 1CQNA 1N6QA 1S76D 3Q8UA 4M7XA 3JS6A 4CNYA 4KFBB 3AVAA 4ES3A 3HLUA 3MI7X 2UUAF 3C46A 2VHGA 2RQKA 3IFEA 4PG5A 2RJZA 1RFQA 1YIJS 5F8JA 3H2VE 3PJWA 3M30B 2DD8S 2GX8A 1S6UA 1T02A 3QQCD 1UJ4A 1GLBG 4GKKJ 1Q86O 1FX2A 2E5GA 2MQMA 1WNSA 3S9HA 1I94F 3WDOA 7FDRA 2NLXA 2J6TA 2KL8A 2LCWA 3GONA 3VEZA 2EBEA 2WOMA 4JS4A 1JK9B 3POTA 3JB9k 1M1GA 4MKYA 1LAWA 4HUFA 1NMDA 1RTJA 2A2CA 4ZJLA 2VU5A 1SPBP 1BI4A 1GTEA 3GU0A 3UVJA 1BL3A 1QM9A 2XSFA 3K9JA 1BO5O 3V9WA 4AHCA 1KVCA 2YNFB 3SMZA 5JS2A 3OL9A 2IVMA 5B0EA 2AEFA 4ZP6A 1MWMA 3TAPA 5CYQA 1BQMB 5T41A 3ID8A 5EOYA 4CJPA 1RT7B 4XDCA 3DOMB 3TRGA 3AY9A 5B8HA 3ULHA 2G8WA 3KK2A 4WKRA 3TWHA 4O0JA 4WQ4A 4FLWA 2V0NA 3SBGA 3VGKA 6FDRA 1QSSA 2M52A 1AXQA 3K59A 4JK9A 4L73A 2I1RA 1IQZA 1VSKA 1JNZB 3WZ0A 4CK3A 4ZVEA 1IJEB 4A61A 3NNHA 3ZZ0A 4I6YA 3OW2M 4FBTA 1YX2A 5CR4A 4MJKA 5MLCV 2NPFA 4IG0A 2UU9K 3G6YA 2DJWA 4IQXA 4P7TA 3LGMA 1FDNA 3QFUA 3HD2A 4B3TK 1YJTA 2V67A 4ZLPA 1RISA 4LF2A 4C2MA 1U2VB 1IBKJ 3C95A 2HFZA 3CJ8A 1KAYA 5LM7E 4CFAA 4WYWA 3SK3A 1I6JA 4H5RA 2LA6A 2VPZB 1U2CA 2QLBB 2O8DA 2MKHA 4CO4A 4FM0A 2O8FA 3IS9A 1ZAVA 3TEHB 3DOKA 2UUAK 2Q79A 3OLAA 2O01C 3A0IX 4FXVA 1VQOS 3V81B 1H6KX 4ED5A 1DLOB 2ZBIA 3MR2A 2BUNA 4B3MJ 5LMUJ 3QGPA 2UUCF 1Q79A 3TANA 4ATNA 3CC4N 2ZM6J 3BEXA 1T9TA 3EZ5A 4JI4K 1OH5A 3LQVA 2M3DA 1XNQK 3VOVA 3BN7A 1T3OA 5GAGP 3PKYA 5IWAJ 1DTTA 4HT7A 2PMWA 4OYBA 4WU2A 3Q22A 1FWPA 3JAMO 3C65A 5D6GA 3F73A 3AGRA 3HL8A 1KCFA 3ID6A 4BCAA 1UZHA 4PXDA 4DR2K 2UXCJ 4W92B 3OYDA 2NUHA 3I55S 4FCYA 5GIPA 5LY3A 5E3CA 2LQ5A 4J9VA 4LRBA 2Z4PA 2LECA 2HAIA 1V4SA 3I96A 2YY3A 4FW1A 4CFDA 1CJKA 3OLBA 1EARA 1MN7A 2PBDA 2CJAA 2O8EB 3QETA 4UY8T 1QQCA 4LBIA 3DDIA 3ZZZA 2C3OA 4BROA 4DSEA 5L1LA 3CC2N 5K8PA 3FEXB 1WHYA 2HF4A 3W62A 2DH9A 5DQIA 3OYHA 3C6TA 3JQKA 2F4VJ 4EHTA 3R1XA 3VTHA 2DXDA 3ZETA 1MLAA 2QKKA 3TQ1A 4JEPA 4OHYA 3H6EA 4PYDA 1SKUB 3S41A 2F1FA 3T9ZA 1YJNN 4OYMA 1LW0B 4FJ7A 4CEOA 3C66A 2X3GA 3OR1A 4MQ3A 4FSVA 2HS0A 3LGNA 1FO1A 4TU7A 4PWWA 3QFPA 2VG5A 2RQMA 2Y1JA 2RB7A 1PJ6A 3U9DA 2G0JA 4KHWA 4Y34A 5F8MA 3CCWA 2C2MB 1RHJB 2Y8YA 1PAUB 2RF2A 1KFSA 1YT3A 3WQPA 3WNFA 4XO0A 2W6LA 4LBPA 3NNCA 4CJEA 3J7ZT 3IKMA 3KFWX 5AZIA 4CEFA 1RACB 3W5XA 4OLOA 2P9IA 1H7WA 1VS3A 4AQYK 1GX5A 1O8BA 1SV5A 2HNZB 1RDRA 1VFJA 5C0YA 2F9JA 4C8ZA 3MN9A 2BQRA 1ACMB 4KBIA 4OKKA 3HOTA 3DRSA 1K8KA 2GWKA 1OKJA 4FWOA 3V1QA 1FRJA 3ENWA 3CXCM 3PKMA 4TY8B 3IA0A 2Y9HA 1NHVA 4YB5A 1HMVA 4CLSA 4KH0B 3LP0B 2MQNA 4WTOB 2M5YA 3FK4A 3M6UA 5KGXA 1V5IB 5DDRC 3C16B 3H42A 2RS2A 4FJXA 2OI2A 3UN3A 1Z1ZA 1SH0A 4BR7A 5HAOA 3CWJA 5KFYA 2CQDA 3U1MA 3BDPA 1UP1A 3SFGA 3TARA 1C0TA 2P9NA 1MWZA 5GAHU 3NMAA 1HKAA 2FJAB 1UA1A 1H1VA 1VC5A 1KKHA 4YOTA 4D3HA 3VQ6A 3CDWA 1NGHA 2YKNA 3OXLA 1NGIA 4GV3A 3QLHA 4XH1A 2JFDA 3JAMU 2FF6A 2R7RA 2OD4A 3HPHA 4Z7YA 1HKGA 3FSXA 9RUBA 3GJTB 4JK8A 4XTTA 2MEWA 2P9CA 3AAQA 1D4XA 3UB5A 2I7NA 1NJZA 4LRDA 4IO9Q 3BF1A 1URNA 4GVMA 1LXNA 2Z56B 3K5PA 1NH8A 2NYHA 2I8EA 4X4VA 1R27B 2ZOFA 3UN5A 4EIAA 4L72B 2IBOA 1O5JA 2ZJPL 4EAHD 2MZRA 1YTAA 2QSWA 2ZQBA 2CZVC 1FHTA 1FFSB 2YKQA 1M5OC 3U8XA 2P9LB 2A2DA 3OW2R 1VLOA 3VAFA 1RT4B 4F0MA 2FHJD 5M1OA 3O3GA 3MMCB 1KFDA 4JYAJ 2YV0X 1VQMN 2PMHA 4YN3B 2V8PA 4K4UA 4CH1A 5D3GB 3VQEA 1NH7A 2WRMA 5KT5A 1SL0A 1F5AA 4PQUA 3V6KA 1U45A 2G0CA 5CCMA 1MWQA 2PD1A 1Q9XA 3D0GE 3ZO7A 2P6SA 3HM8A 2Y1RI 2CQ2A 1WOOA 3FBBA 3NNAA 2K7KA 1YZ6A 2XRIA 4FN5A 3WX8A 4G3IA 4B1UB 3MK6A 5ETQA 2EG2A 3V2UC 3KLIB 2FJVA 5JMNA 4C3KA 3ADAC 3D68A 2IFXA 3HDSA 3UIQA 3U7JA 4M3YA 2OJ3A 2YNGB 2W25A 1MN9A 4M41A 4B8CA 2R3VA 1UJ6A 2GVDB 4XAKA 4FJMA 3Q2SC 4QWAA 2X6SA 3QO9A 1SKWA 1NOYA 3LH2S 1VQ9N 4WU3A 2M7SA 3BF4A 4BBYA 4DTRA 3U3YA 2HNDA 3AO5A 1KVJA 2B9YA 2AJ4A 4CM0A 4KPYA 4DS5A 3DM2B 3MEDA 4LFAJ 4DR3F 3ELHA 2IAJA 1BD6A 4Y6IA 1P1TA 3BH7B 3CCUN 1I94J 4OYAA 4JI8F 3HOSA 1D3WA 3QBWA 5KT4A 3HFVA 4KGMA 2FLPA 4RJVA 2OFHX 1AFJA 2XY6A 3AVCA 1QDUB 4YFUA 4MDAA 5DETA 4USTA 4DZ6A 2YKPA 2H4YB 1T8EA 4ELVA 2BJDA 4QYZJ 1WHXA 2HRYA 3G2XA 4ECWA 4JI1K 3M30A 1UCNA 1MG7A 4L74A 1RBAA 1S4FA 4FYWB 2GVZA 3ZNUA 4LVNP 2YHYA 5F3TA 2Q97A 1RWKB 3PIPQ 4JI6F 4ISGA 1F5BA 5C5JA 3TR5A 1RAIB 5D0HA 3VVTA 1MNEA 1RCHA 1RDBA 3J81O 4DSJA 1BDGA 3Q86A 4CLFA 2PGCA 1GXTA 3MXIA 4CW7B 5IOLA 1TVRA 2A3JA 4EBDA 2NZ4A 4PABA 3OJUA 2IVFB 3RJMB 2AWZA 3ZSVA 2C2NA 4E89A 5I4MA 2HZAA 4IOAQ 1E6YB 2IA6A 4B9SA 4JKFA 5KG0A 4FWRA 4KH4A 2L41A 1UVNA 4BDPA 2D3OR 5CY4A 2GGPA 3BGRB 3DOMA 4PPZA 2AJ1A 5JUMA 2E29A 2RNEA 3FE1A 5K8OA 4QJVA 1X5SA 2EG1A 3M9MB 4QWDA 2VJVA 3H5XA 1JXVA 2OUGA 3SDEB 4NCBA 4ILJA 4KI6A 4I69A 3HP6A 2J7WA 3CXCR 4KTWA 4GVBA 1H7XA 2MQPA 4CO0A 3O9QA 1HD0A 3CB4A 3PX0A 1ZZNA 2ZJRL 4CO1A 2BOPA 3VGTA 5AQMA 5AQFA 4H4KA 5KFFA 1I3OB 2W2MP 5IM0A 2Q6BA 1IM6A 3VQ4A 3O3HA 3PEJA 1UAWA 1J5EF 5A6PA 3WNGA 1VYAA 5HO4A 2ILYA 2HRTA 4OGCA 2CPIA 1RT3A 1BHLA 1TKDA 2BYCA 5KFJA 2H3GX 5CHCB 4B3RF 3QRQA 5DM7L 4AXJA 3MXMA 2G1HA 2CAJA 4ZVGA 4CEZA 4RNFA 4DFJA 1C1CA 1VQ5S 1VQLS 3BGLA 1BWFO 4ZITA 4CCHA 3HI9A 2V51B 3I82A 2DY4A 1E6VA 4HKQA 4OYZA 2CUYA 1S6PA 3T6JA 5CYMB 2VGMA 3V81A 3LP2B 1FF2A 4P10A 1T9UA 2L9NA 1KD1O 3O44A 1JNRB 2LXUA 4CLLA 4PHTX 1NDPA 3PR5B 2XI2A 4JI6K 4M5IA 1QSLA 4A4JA 4DG1B 1KEKA 1P9YA 1YLXA 2Q66A 3S1TA 2XLKA 3KDNA 1SUQA 4M42A 2UXBK 3BF3A 4FK0A 1RAJA 1U09A 3CJBA 2XG8A 3TZZA 5DO2A 4PQAA 5E0OA 4WFNQ 1B4SA 2QTDA 4PG4A 2C2DA 3X3UA 2X1BA 5D4LA 3J81U 2XY5A 3PX4A 3HSDA 2W2OP 4KYZA 4MKBA 3MM6B 4DQIA 1IKYA 1RT1B 4ZN1A 4RLEA 3OYNA 3VQ5A 3OQ2A 3GV8B 5C25B 4ZP7A 4RW7A 3G6XA 1UW4A 5KFWA 2OMLA 5IQQA 3LUYA 3TA0A 2BACA 5EVZA 5LL6Z 3KHGA 3O3FA 3W2VA 4K7QA 2RKIB 3THXB 3AFGA 4EZ6A 1O6XA 4ERDA 2QI2A 4Q2MA 1CEZA 1NGDA 4C48A 3OSPA 3ZX0A 2A18A 2LSNA 2JWLA 1UWBA 5CHIA 2FVQA 3MZIA 2ZGZA 1DTQB 2DNZA 1IBMK 2RT3A 4WPAA 1F3VA 1V6HA 1KOOA 3UE5A 3FZLA 2W4DA 4Y3CA 4YR3A 2A10A 4TVAB 1TKXA 4NXMF 2HQ3A 4RTFD 3N6LA 1ZBTA 2DNLA 2MGZA 5H9EJ 2X51A 2BKNA 1AT1B 1HBNA 2V9KA 5LXRA 2ZH3A 4HTJA 1FNXH 3A8EA 3L6QA 1FWLA 3FEZA 3IR7B 4FWSA 3LDSA 4JI7J 2G8HA 3C19A 5RUBA 2Z2LA 1L5UA 3KLFB 4H03B 2HG4A 1NK6A 1VQON 2R7WA 1U48A 3LP1B 5DG9A 4DU1A 1DRZA 4DSIA 4PR6A 3ZC4A 3O9RA 2YX4A 2FGOA 4YY3F 1YJWN 4DFMA 2CJQA 2IDLA 2E7WA 3IFRA 3BJYA 1XHZA 1ZM4A 4ZP9A 1K0VA 4CE9A 1NEEA 4KHPK 3CCSS 2QXFA 4JD2B 3HSGA 3OYCA 4CERA 5KFHA 2V2VA 2FDNA 2IY5B 3THWA 4DTMA 1U24A 2NRHA 1BQNA 2V4QA 3I55N 2AX1A 4ILHA 3VWSA 4DL0C 4Y2KA 1B70B 1OO0B 3PIOL 1VRUB 5C10A 3HSJA 3SPZA 3LP0A 4RNMA 4KKOB 4F8RA 1EQ0A 3C7NB 5KFBA 2GHPA 4DV7F 3J80Y 4DS4A 4NLBA 3C16A 4CJLA 4BWMA 3H2UB 3QGIA 4CZEA 1IQTA 4DU8A 2E1ZA 2MLYA 3MN5A 4ZTJA 5CD4A 4ZCKA 4Z94A 5JVHL 1TYQA 3F2KA 3CT9A 3BSAA 3HM9A 2ZDPA 3DLKB 2J0SD 1HR0J 2B0GA 2BE2B 3OTDA 3SCLE 2YX6A 4FVMA 2D0OA 1VBZA 4PPDA 3ALYA 3W66A 1LEOA 2N3LA 1HNXK 1NGEA 1CVJA 3TR8A 1QZ6A 2MKYA 1GAOA 2CDRB 5KGWA 4CJVA 4AXIA 4K4VA 2MQLA 2DCUB 1IJFB 2MHNA 5A8RB 4BE1A 3MPYA 4IZ9A 1MWKA 2JOQA 3EUNA 2D1KA 3ZT1A 4OYWA 2CPYA 3NBPB 3IO1A 2JEJA 3M7VA 2O66A 1RT4A 3Q8YA 3MMCA 1DZ5A 5LMNK 1TL7B 3UCZP 2NRRA 3DNCA 4CH0S 5D3GA 3JTNA 5AQUA 4F2RA 3SAFA 4EO6A 3FZKA 1B92A 2KM8B 2W9AA 4OZNA 4EGLA 1TL4A 1X5TA 3KLHB 4AL5A 2M4MA 1BIUA 2HFOA 2P2CB 1DQAA 3MAAB 1KLNA 1D9DA 4A5AA 3O6QA 1S1TA 1SIWB 2BE9B 3KLIA 1JKHB 3DMJB 4WQ5C 3T1HF 4NEYA 1SCJB 3NGIA 2VBYA 5HRRA 5LJVA 3DRYA 1QAXA 1L3SA 1KVIA 2DNKA 2G8KA 4OFZA 2YNGA 1WSEA 4K8XA 1C0GA 1SH2A 1UVJA 3VMFB 2AP1A 3IMXA 4CF1A 3SZ2A 1NNDA 2MZTA 2ZBPA 1VQ8N 5KFRA 4IFVB 1WI6A 1CJVB 3HPOA 2R2TA 4M8LA 3C14A 4YB7A 2YJFA 3IM8A 5BPLA 3WNEA 2R7VA 4M3RA 4KTZA 4OZ0A 4G1QB 4QS8A 3K17A 2GO8A 5KFQA 3I6PA 3UW1A 3U9ZA 3LO3A 4DR6F 4L75A 4Y65A 2PYJA 5FRMA 4RNNA 4Z4FA 3D6RA 3M8PA 1SIZA 3HHDA 2P9PA 4XDDA 4GC6A 1CS4B 3OTCA 1FXXA 1HNVB 3P8BB 2E9ZA 1NSPA 1FT8A 2RS8A 1YF5L 3LDLA 4WFYA 3KKSA 4FPRA 4JKHA 1Q5YA 2QE5A 3R5JB 4DV2J 3IWXA 1K73O 3AJ2A 1XMOF 1Z6RA 4AM6A 3T7ZA 1PG5B 2WVEA 3IAYA 3IGVA 3HSZA 4RW8A 2QWQA 3TUPA 2VBWA 1VQPS 4YOUA 4FKXA 3JYTB 3CFRA 2B4PA 3UD4P 1YDLA 4EMDA 2YHBA 2FC0A 2GO9A 1ZPWX 2VQEK 1F3FA 4C8OA 4A8MP 3ET6A 2OH2A 5BRFA 1HNWF 2B6AA 3CG7A 3CQYA 4B3OB 3QGGA 4DHYA 3DFEA 2HKEA 2XULA 1JCGA 3ATUA 4IJNA 4TU8A 3EPGA 3NF6A 2DNMA 3LPYA 4J5OA 4JB8B 4ZPTR 5BR9A 4RUHA 4AE5A 2ZNZA 1J5EJ 4H5WA 2NREA 3AT1B 3OBYA 3R1LA 2B9EA 2QLJB 3E8OA 4OX6A 3VQTA 1U2RA 1Y7PA 2V7ZA 4OX7A 4MIBA 2AJ2A 2LQJA 2O1PA 1M90T 3MFIA 1WKJA 4KGKA 4USUA 4O0IA 2W6KA 4LSLA 4RZRA 2ZJPQ 3RGIA 3ITHA 4CI0B 4URSA 4A8FA 1VQSA 2QMWA 4HHHA 1HX1A 2KXHA 4MK7A 5HI7A 4HCBA 4EBCA 4O44A 1KS2A 4K0KF 2GHWA 1JLFA 2CH5A 1S6QB 1JX4A 4NI2B 2EFVA 4BC7A 3QYYA 3ZZPA 1HNZF 3T1AA 5C7PA 4CLZA 2E4LA 5B7WA 2EK1A 5DZ6A 4LRCA 1KQFB 2XHBA 4HH0A 2I5JA 3UPFA 2CGLA 2PC6A 2WCXA 2IGIA 5HANA 3T19A 2E2OA 3NRBA 1B64A 3KK3A 2CNKB 2PMZD 1X4DA 1G7CB 5CA5A 1X4EA 2YWGA 5LJ3Y 2DR9A 1AW0A 1H2UX 4E2FB 3QT7A 1HYSA 4DR4J 4BREA 3FMBA 4BE0A 2VQFF 2AZ3A 1T6DA 4JI5J 3WXKA 5AXLA 3GDQA 3DOLA 3AODA 4KT0C 4I2QA 3OVBA 2HWTA 4NXNK 4B9MA 2KHCA 3LP2A 2W8LA 4PG7A 3DGPA 4DL3A 3W2WA 4CZHA 1A0OB 1MROB 1XMOK 2JVOA 2JEIA 2LXIA 1SAZA 3D5MA 4X66K 2HHHJ 4USMA 4TNOA 1FD2A 4DX5A 3CULA 1IKXB 4O55A 4J2AA 4NCAA 4DF8A 2XMUA 1H73A 1R3NA 3TUJC 3MWPA 2MTLA 2VD3A 2OYQA 2F8TA 3C6HA 3T5LA 3UKUB 3RRHA 5L9NA 1HNWK 4NXMJ 1GMWA 1K73T 1HW9A 4LFCF 2QL5B 2ALYB 2NYIA 1QUVA 1T3NA 1M1HA 1QQNA 2K2PA 1KTVA 1QTNB 2E2NA 4K43A 3DJCA 5HROB 4YHHF 5AJ3F 3THXA 1FJCA 1ZETA 1N33K 4X84A 2PT0A 4M63C 1GT8A 4BVOA 1ZM9A 4IKFA 1UZDA 1FESA 1DTQA 4YY3J 1DBDA 2CPXA 4KHNA 4DR7K 3KTQA 3L7OA 3D3BJ 3KHLA 3CI5A 2IBKA 2RUGA 1UVLA 3MPWA 4H4KC 3OBIA 1Q53A 4B9NA 2XMTA 1QZ5A 4YDXA 2H5IB 1FI4A 4DR1J 3RBZA 3OYBA 3TUZC 3ZZTA 3SQGB 4K41A 1ZXOA 2JNJA 1AUSL 3E01B 1RKIA 3OXGA 2IM3A 1X9WA 4FKYA 3E66A 4F25A 1UFWA 1YJRA 3US5A 1RADB 2CPEA 5KRSA 2Z8QA 4F3QA 1A5XA 4I67A 4U8VA 4JV5F 1P8GA 5C12A 2AKWB 3G71N 4BRKA 1GNKA 4M5GA 1QAYA 5DDQC 3A3PB 5DM6L 4ID5B 2FPHX 3O4QA 2C28A 1UPPA 4CF0A 1SL1A 2UUBF 3FZBA 3UCGA 2VJUA 4DLGA 2JGUA 4C6AA 3NGUA 5ETTA 3O9TA 3BPSP 1H2VZ 1F2GA 4FJHA 1KVKA 4DFPA 2W2PP 2XC9A 3DCAA 4I56A 2V4JB 4FJLA 1U1LA 1SZ2A 3IWNC 1G1XA 2AMCB 2I6WA 5A76A 5IFMA 3ENHA 1RB0A 2EFGA 3H98A 2RILA 3C15A 3SSSA 3CC7S 2FSKA 3ZZUA 3SPYA 1K9MO 3QZ7A 3BH6B 2IOCA 1TL1B 3P31A 4KO0A 3TAMA 1V3SA 5KFDA 3WIVA 1BY9A 1S9FA 1JLEA 1NM2A 2YKAA 5KT3A 2QIFA 2IDOA 4JI2J 2BANA 2BE2A 3OTOF 4C98A 1KQSM 4LF4F 1X7VA 1N5YB 2XHWA 3OHRA 2LU1A 3LM2A 3L4BC 2ZVIA 3TX0A 1Q95G 1XC3A 2X6NA 3VAMA 2VFRA 4JAXA 1MU2B 4M5DB 2UU9J 3DLEB 3KD5E 1W2IA 4O3PA 1FW6A 1U0HA 5KG2A 5A8RA 2FZGB 4N8OA 4B3TJ 2PA3A 3ZZOA 2J9DA 3GQCA 4HHUA 3LAKA 3JQJA 2DEJA 3CCSN 3NBPA 2ATCB 5H1SV 3NF7A 4PA1A 4YDDB 1WTBA 5I3UA 4WZMA 4JHDB 4IFYA 3FCVA 2ATQA 2K1RA 3CJ4A 4IXCA 2GJFA 2Y1LB 2HHUA 2POKA 1NNEA 1WJ9A 1GLEG 1WDTA 3THYB 3KLHA 4ER8A 4RG8A 1VQNN 2QEXS 2CJYB 2P9KB 1JLQB 2DNGA 3SCIE 3RR7A 3F44A 1TFWA 3VQ9A 4GKJK 5L1KA 4P2XA 4Y2MA 4ZIWA 4B9QA 1N36K 3RAXA 3J7A1 1O51A 2RRNA 4E7KA 4C8KA 5DRKA 3DMJA 4OGEA 4CT9A 3M2VB 4LFBF 1QHTA 2FJWA 1NZ8A 2G13A 4W5TA 2CFXA 4LF8J 3ZT2A 1RT5A 4X62K 4PXEA 1JLGB 4CJTA 4GVLA 1TUWA 3G4SS 4CWBA 4OX9F 3O4NA 2UUBK 1FDBA 2C2KB 5ETSA 2JC0A 3OVSA 2DHXA 4DR2J 4LRFA 2GAHC 1RA6A 2PA8D 1X0PA 3TQEA 3TJAA 4X64K 1WG4A 3GSIA 3WHIA 4DX7A 4NLUA 5AE1A 3PY8A 3CJQA 3H4BA 1B9FA 3G6EN 4ALZA 2D0AA 3IBCB 4BR5A 4HL9A 4NLSA 3UR3C 1B7YB 4B9LA 4DV3F 1OSDA 4LF6F 1EETB 3QJPA 2C3MA 1WOPA 3CQ8A 3D2WA 3GIKA 2J0XA 4GO5X 2Z2YB 4FXDA 1JJ4A 3OTOK 3CHWA 2GNKA 2CIMA 3OUYA 1NGGA 1WC1A 1HNVA 1K6YA 1CJTB 5K5MA 1OYEA 4PWDA 4EBEA 2Q6CA 2AP6A 1NPPA 5KPTA 1FRIA 3ZFVA 4RW9B 3QT8A 2ZZNA 4ELTA 3L7PA 2FC9A 5KG1A 3PM9A 2YWHA 1Y3KA 3OYJA 3RWUA 3CNQP 1X1PA 3R9LA 4NCGB 4E7IA 4C97A 1JLCB 3MN6A 2CXEA 2AJQA 3MFHA 4LF1A 3P39A 2OPSA 2DHAA 2JL9A 1PYSB 3DAWA 3UDEA 4ILLA 3EXYA 3RTVA 3PVXA 4DHVA 1M5KC 2CPFA 3U4LA 5GAGU 1CC7A 4CBUA 5A6WA 3CE8A 4YB1P 3DGVA 3GPAA 4JI0F 4QWEA 1UL3A 5AZJB 4W5OA 2A42A 4J9NA 3VF0B 2IVPA 3HHLD 3N28A 3EZUA 1VOMA 5JVHQ 1HKBA 4Q0BB 2IYGA 2MZSA 3IRWP 3CJTA 3DWLA 1N34F 4BR0A 3UQSA 3AA5X 4ZA1A 3CMAS 4IRCA 3KOAA 5K14A 2ADCA 1GLLO 1ZBLA 1R8AA 4HTUA 4M45A 1VSIA 3BR8A 2KH9A 1WWHA 3TZWA 4JI3F 1MSWD 2G9OA 2HQCA 3ATVA 2V4RA 4YORA 4KHQA 2DPJA 1ICEB 2WB4A 3E1YA 2AX0A 3TTFA 2QTWA 2ASMA 4WF9L 2CJ9A 2CDQA 4DZDA 2RUSA 3TI0A 3MM9B 4FK4A 1EHWA 2YKMB 3BP8A 2VL1A 2ASYA 4RWXA 2HRUA 2Q3PA 5F8IA 1GMUA 2XMWA 3QEXA 3GR0A 3T1YF 1V4TA 4CO2A 4NYNA 4K4YA 2BQ3A 1DQ9A 2CGJA 4OO1J 3BYPA 2W9CA 2DRBA 3TA2A 1NGFA 4F02A 4CJSA 3NE6A 8ATCB 2XMVA 2BRKA 4NYOA 1RAGB 2FUG9 3R3TA 4BRFA 3J7YU 2BOAA 1RTDB 4DL7A 2KYZA 1VSHA 3A4TA 5KG3A 4CFCA 3M8SA 4LIWA 2UXDK 4AUKA 2N4CA 5IT4A 3R7BB 3D0HE 2JDJA 1KQSR 2ZE2B 5BPNA 4ED2A 1HUXA 2UVRA 5M1FA 4RU2A 2YTCA 5KFNA 1RK8A 3LM9A 5F0WA 3TO8A 2PY5A 2E9RX 3H1QA 5C2GA 2LQ9A 2Y3YA 4O4GB 3D1OA 4WFAQ 4NLDA 5K8MA 3PO5A 3GYXB 4DV1F 4FF3A 3BN4A 4DV0F 1AROP 4GC7A 1Q81O 5FDLB 5KFMA 2QM1A 4QU7A 5D4NA 1Q78A 2CWXA 2V94A 4P2SA 4ZPWR 5GAEI 3HZ6A 4JNEA 4JLHA 4JI0K 4ILRA 1RQ0A 5GMKa 3Q2TC 2E20A 2K7JA 1O1WA 5KFCA 3S3NA 2E9TA 1G2EA 1HI0P 3R2DJ 2IVNA 1D09B 3W65A 3MM5A 3DXKA 2HS4A 3QPIA 1VQKS 3BZQA 3A2FA 1S3XA 1N34K 2ZZTA 3F56A 4E8UA 4LH4A 3SI6A 4Q8EA 5AQGA 2XO7A 3QJJA 3M9NB 2Z1JA 4MFBB 1Z25A 4N41A 2F8SA 4EZ9A 3BEGB 3GMGA 2ZHOA 5H9FJ 4Y1CA 4NLXA 4CZIA 3O4WA 2B4UA 1TUUA 4DPXA 2E5LK 2AD9A 5JMVA 1YI2N 3CCES 3GSDA 5A8KB 2AYBA 2HGMA 4LBHA 2GCFA 2FC8A 4B3SF 2QMXA 5F8LA 3TU5A 2HSEB 1ATSA 4FLYA 2CNLB 4E19A 4M3UA 1XC9A 4JV5J 2NSBA 1PYTA 1S1VB 2RHQB 1OVQA 3H5UA 1FTCA 2VWBA 1P27B 2HMIB 2DNYA 4M5LA 3PW0A 1FCAA 1ZA1B 3AVIA 2FJDB 1Q18A 5AE3A 1MMDA 1FVSA 1TQLA 1RYRA 4JK7A 2QN6B 4FF2A 3PV8A 3HKWA 4Z4GA 2M0GB 1NPKA 4GVEA 1CSJA 4OHXA 5JXSA 1RTHA 3KG4A 5F9LA 3GIIA 4F3TA 3SQ0A 4OI2A 2KFYA 4Y28C 1UAXA 3BSOA 5MAOA 4OYOA 1U1QA 4HTIA 4J37A 4K42A 1RHUB 3I87A 4DV5K 2PN6A 2RMLA 1TMMA 5CAAA 1CXQA 1X9MA 4QR0A 2LLZA 4QIGA 1ESVA 3RMCA 1GX6A 3J7AP 2HBQB 3M3ZA 5DGAA 2GFFA 3D28A 1B0VA 1XMQF 2OTJS 5JVGL 2HVDA 1TL5A 2D9PA 2QK9A 3AGKA 3PCOB 1ZM3A 2ZBRA 2EFNA 1X4GA 3KMSA 5J1EB 4C7QA 2P9SA 4L3NA 4LF4J 1Y97A 2V4JA 2DIUA 1LK7A 1VK8A 1KHVA 1HWIA 4H5VA 4F36A 3CGIA 2QL9B 2QJ3A 1YSJA 3W9JA 4FJGA 4R8UB 3G10A 2R7TA 4KHYA 3T5KA 1TL1A 3GIMA 1WEYA 2PDAA 3FNNA 3HX9A 3C94A 1F2HA 5ETOA 4V19S 1H3DA 4KR0B 3NGTA 1Y64A 4MIAA 2DGVA 2MQOA 1RCOB 1T05B 1K0TA 2VDIA 3CETA 1N5YA 2ROPA 5K9FA 4DUZK 2NXNA 4RU9A 3NMRA 3N6NA 3BKTA 4M5DA 4FOIA 3S3OA 3A5NC 1A5VA 3VAGA 4ZJOA 3AVFA 3SUOA 4RNHA 2NRTA 3P83D 3CCQS 4AH9A 1FRMA 2OSQA 4E1JA 3EDRB 1UKUA 1O0PA 2K8GA 4WP9A 4CLKA 3BV8A 4OZ2A 5CE3A 2DGWA 4LFBJ 2DNRA 3O80A 1N6QB 4DDFA 4BG9A 4MYTA 5AFUH 5A2QY 2MZQA 1EWQA 4YDUA 5AXNA 1VSEA 3IBWA 2GAGC 4CEDA 4DTNA 4OX9J 1P9QC 5B0BA 1RE1B 3NOGA 2P9KA 3NS5A 1JLQA 4FS2A 3B8AX 1NCLA 3SV3A 3W8GA 2WZ1A 4FF4A 3CCRS 1NLKL 5EHHA 3P45B 2F96A 2OPPA 1S10A 1YQHA 2WOMB 3POTB 3R2CJ 3UCUP 1TUYA 4QQBA 1RTJB 2B8QA 3UNGC 3P1GA 4DSLA 3DHWC 3DXBA 1BI4B 4UQGA 1JLGA 1NKCA 3D0PA 3UVJB 3BO2A 4KAZA 4DV3J 1JIHA 4L3QA 4LF6J 1IBLK 5AQQA 4B17A 3R3LA 3CDBA 5LJ5Y 3EKSA 4C0OC 4CGFA 3J81j 1FD8A 4CD1A 4B9TA 2A3ZA 1H38A 4XK8C 1N8RO 2ZH5A 2AEMA 1VK3A 4HI1A 1N0UA 2JRSA 4HEA9 4AL7A 3ASMA 1F21A 3K89A 2IRYA 1HBMB 4PUOA 5M1KA 4E7JA 1PC5A 1WEZA 1JMTA 3W3SA 4CIFA 1EKSA 1YHQS 1HI8A 1FJEB 3H3NO 4HLBA 2CWKA 1UTAA 1QAIA 4YS2A 1NHUA 2QW9A 4FK2A 4CJFA 1YZ7A 5E3PA 1YRUA 4BS2A 1R8HA 3PO4A 4DX8H 5CQGA 2KXFA 1HI1A 4BY9C 2XCPA 4IG0B 4RW9A 5DM6Q 1VBXA 3QSIA 4IR1A 4H0TB 5THWA 3MD1A 4CHQA 1WSRA 2VIHA 3HSCA 1OMSA 1FEHA 2HFNA 2DGXA 2IVYA 3QGHA 5IV4A 4HT5A 3NF8A 2C2OB 4MK9A 1WDDA 1HHSA 1UJ5A 2E88A 3Q24A 3NS7B 5CZ1A 3CJCA 4ECZA 1VHFA 1RWMB 2DH8A 4O3SA 1Q4RA 3AA8A 3K5OA 2HYIB 3LF0A 1PO6A 1VQ6N 5CH7B 4CEEA 5KPZA 2NPIA 3DU5A 2O8FB 2BW7A 3DOKB 1HWUA 1SJ4P 1RDAA 1J6ZA 1YBAA 4OV6A 1KC8T 4RBUA 3N01A 3SQOP 3FEYB 3DU6A 3O1BA 4K8ZA 2NCKL 1K44A 2B43A 4KI4A 3K8WA 5IT0A 3D4JA 3GJRB 1J53A 2Z1HA 5GADI 2Q1LA 2NRWA 1TMJA 5F3ZA 4F4ZA 5E33A 2OEJA 2DFEA 4M5NA 3VZHA 1FRLA 1DTTB 4F2SA 1HYZA 3ZSWA 2CQ0A 1N5SA 4JN4A 4FYXB 1WAJA 2VB6A 2Q31A 1R0AA 4QBUA 3HHNB 3PR4A 3P96A 4ED4A 3LWLA 1XBWA 2BW2A 4B3MF 4GKKK 2BR0A 5LMUF 2YKMA 4UUXA 1HIYA 4KAIA 3TOQA 1CJKB 4IQMA 3H8YA 2HIQA 3HHEA 3T6BA 1QVFM 5EX3A 2ZM6F 2IM2A 2MKKA 2Q43A 1RGVA 2VICA 3C6UA 3OL8A 1LWEA 3FBCA 2FHMA 5IWAF 4JKGA 4A8QA 1HNXJ 5KG4A 3GV7B 5D78A 5CABA 2AYGA 3M8QA 2UXCF 4FZVA 4DV1J 3E51A 3C6TB 1RT6A 1RTDA 3ZETB 2IYIA 3N5FA 3R6MA 2UVUA 2CVEA 1R6VA 3P5BP 2ZJQQ 4QW9A 1BUXA 1YWXA 4FVCA 3OV7A 1N32F 4PAAA 4CGGA 4NLCA 3OR1B 2YBVA 4TY9A 1WC0A 3EX7B 3AXKA 3CD6S 2VG5B 1WAFA 3M8RA 3CUNA 4RW4A 4IRKA 1T9WA 5LMNJ 2EC2A 2GELA 1DEJA 3RSEB 3LALA 1KXPA 2NUUG 4CZKA 3R6GB 4EWTA 4O4GA 1I39A 3HFKA 2OCEA 1RYSA 1ASWA 7AT1B 4CLWA 2RF2B 2F4VF 4QWBA 1Y00A 2XMAA 5FDLA 5AQVA 4J9KA 1W26A 3R7SB 2ZWOA 1VISA 4A48A 4CJ4A 3W61A 2ZKUA 4OZ1A 5AZIB 3ZSOA 3HHKA 2P9IB 2YH0A 1IXKA 3AH6A 3SAHA 2MMYA 4NMXA 4OI0A 1SV5B 1RT2A 2ADBA 4B08A 2E6MA 4I6MB 1HQUA 1LKZA 1SKSA 2ZC3A 1Q8LA 3DRSB 1K8KB 5MLCQ 2YHXA 2LQBA 4B3SJ 3BZKA 2VFUA 3SQ1A 3D2EB 1QQOA 1HMVB 4RL1A 1C0FA 1MWYA 1HNIB 1IBKK 4TQRA 4WFBL 1OY9A 4FVUA 3OYGA 2GIFA 3M32A 5AQSA 3KG1A 5AXKA 5KTQA 1VRQC 2KG0A 4ZN3A 4ECQA 4FDFA 2ZGYA 4FOEA 4CZMA 2XBPA 1KNZA 1VSJA 4Q5VA 2KFZA 1RGIA 2FHKA 5IS2A 2AZ1A 1C0TB 2P9NB 2OPQA 2NR0A 3CDEA 3HCXA 2HHXA 2UP1A 3NKYA 4XEIA 1NGBA 2EPIA 3TX8A 4NRUA 2YKNB 2JWNA 2BA9A 5LMUK 4ZVRB 2P1JA 4FXWA 4E98A 2A40A 2FSJA 3B4DA 5ETRA 1NKEA 2E1MC 2QWNA 1XMQJ 4ZLLA 3Q89A 5IWAK 3IP0A 3L2QA 1T44A 2JLEA 1RAAB 1VQYA 4JKCA 2V7YA 2E1AA 4KB7A 4A57A 4DQRA 5K20B 5AQHA 1U8WA 1U47A 1NJWA 3J81Y 5E7OB 3Q8PB 1ZBHA 4QIWD 2LP4A 2WB1D 4CNZA 4IEEA 2QA4N 2RDJA 1VI7A 2DXFA 3ZT3A 1VJWA 4A47A 4KHMA 2E7VA 2F40A 3SLCA 2DITA 5ETMA 3MURP 2L9WA 3L3VA 2O67A 1WB9A 4CDIA 3AVHA 2KTQA 4Q2LA 3KUGA 4WF9Q 4IH6A 2GV9A 2VQEJ 1VIOA 4PQUB 5J1EA 2JX2A 1C1BA 1WUUA 2KU7A 5C2DA 2E6LA 2HIYA 2JH3A 1GOAA 1Y5LB 1KTQA 6FD1A 1N52B 2HWHA 4CM2A 4EO8A 1BIZA 2DBBA 1JJHA 4WCEL 3LPEA 4R8UA 4X65J 4N56A 5SUHA 3HULA 1F9EB 2XEXA 4C11A 4I4BA 4N5SA 3LANA 1U1NA 1VHIA 1NMEB 3CCEN 4PL7A 2LKZA 3K5NA 4N76A 1WOQA 1S72S 1UEUA 2WSCC 4M95A 2KHOA 2PI5A 1T05A 2XI3A 4KE5A 2RN2A 2GMLA 3QO9B 1F0XA 4A5BA 2C22A 3UE2A 3OYMA 3CFPA 1GLCG 2QO3A 4O3QA 2E5HA 1YBTA 2N4DA 2CJXB 4GV6A 2V69A 1GLJO 1SQEA 5DDPC 3PDNA 4F9OA 3MEDB 2DNQA 2IRXA 1TZ0A 2IAJB 3WXMB 2B4OA 2HLUA 4NYFA 4KSEB 3R8YA 5AQNA 3OJSA 3ILOA 3AHPA 5BN9A 5EGYA 1FWKA 4M1KA 1QVFR 3EL2A 3K57A 3L2RA 2OTJN 4H5NA 1HJOA 2ZHAA 2W4CA 2B7CB 1W2BM 4NX9A 4I9LA 4NXNJ 3J7AN 1FNMA 3CJ0A 2GVZB 3QZ8A 4YEAA 5FLXO 4LFAF 2NXCA 4PWUA 1W9HA 1Q8KA 3QFHA 1TL3A 3M8YA 7FD1A 1IM4A 4ID8A 1B9DA 2DO4A 1ZA2B 4NLTA 4E7LA 4NLQA 4X66J 1JXEA 4NPOA 2CQPA 4BACA 3Q23A 4UOFA 2EKNA 1WSJA 5CZXA 2F5GA 4DCHA 2QX0A 1TVRB 3WUHA 2DCLA 3PLAA 2YJEA 4NZ0A 3W0LA 2HNYA 2LQ8A 3MUVP 1RU1A 3RR8A 5ETVA 4K4TA 4EK2A 1KHWA 1T9VA 4J9LA 4DQPA 4KH5A 2GGPB 3H1VX 1ITPA 2C2EA 1BC6A 2EHGA 4DV6K 1U1MA 1HBMA 3H46O 4F67A 3KDOA 4USKA 2MQ8A 5KT7A 2VWKA 5D0RA 1N33J 4JYAK 4OLAA 3Q8QB 4W4MA 1S0VA 5DQHA 3CCQN 4PEOA 1Q7YT 3E9PA 4DR7J 1L3VA 2G0IA 3MWTA 4GVBB 4YUDA 3CJ7A 1YTYA 2QLWA 1NDCA 3BGUA 4DUYF 5F1XA 4H0XB 2FBVA 3BR9A 5IM0B 2E7XA 2G2OA 3GB0A 3FBFA 4QU6A 2UZAA 2PFUA 4FW2A 3ZSRA 2F65A 4RPFA 4DKWA 1RWPB 3RW6A 3H7HB 3EJMA 5JVGQ 1W7AA 1Z2LA 1RT3B 1ATNA 4F4KA 3LOUA 1N54B 3RRKA 4CJ7A 2O8BA 2OGUA 3RW7A 3CCRN 2OZSA 4QIEA 1CG2A 2IRUA 3OTBA 4NLYA 4P73A 4I1TA 4ZPBA 1Q16B 1C1CB 4OJHA 1AZSB 3I9V9 3GWCA 4YDUC 4HH1A 3EICA 3ULDA 5AXMA 3KWIA 1E6VB 3SFUA 4JRPA 2HHTA 1S6PB 1S7IA 3VGMA 4ZVFA 4UY85 4MO4A 1P1LA 3NGYA 2E5JA 2C1EB 3CCTA 5KFEA 4LFAK 2JVRA 1S1XA 4RX6A 2WC9A 1I94K 2ZDOA 3H5SA 2G8VA 3UDVA 4U9RA 3MCNA 2IIHA 2VPWB 5BPMA 3VV2B 3AOAA 4AD6A 5J2NA 4YOYA 2IIRA 1ZPVA 1NJYA 2OPRA 2HS3A 5FLXU 1SUQB 3WXIA 4DFKA 2L48A 4G65A 4QYZK 5KG7A 1RDWX 2M2BA 2WW8A 4NLGA 2J9EA 2A41A 3MDFA 3PJXA 4LSNA 1Q86T 1GK8A 3BYRA 4HCCA 2O4IA 1N32J 1IKYB 2DNPA 1WHVA 2DY9A 2IMOA 4E0DA 5ELZA 4RW7B 3WNHA 3CD0A 4IOBA 3KLEA 4C0BA 4AL6A 4FLTA 3W2VB 2VG6B 3GL1A 3J7Z5 3MPUB 4DL5A 1HA1A 3FFIA 1BCOA 1RBOB 1S79A 5HJXA 2WBMA 5EWFA 1UWBB 5EN1A 1WOSA 2XZWA 1NK8A 1WC6A 1YJ9N 4I9QA 5EX0A 3K5MA 2CGKA 2FBXA 1FXDA 1T9YA 4DV4J 4AFFA 3GIJA 4BC3A 1TKXB 3QMLA 3TSQA 2A0FB 4C8MA 2OFGX 2MGZB 4F4XA 1MDUB 1TAQA 3AD9C 1HBNB 1VBYA 1YRTA 1JLBA 2ZH4A 3JSBA 2J8SA 2Q0RA 3IRXA 2C42A 3RSEA 1YVFA 2FZCB 2XGPA 2M8DB 3MMVA 4F04B 2Y8WA 3GJQB 3JS9A 3FQKA 1TKTA 2HVEA 3KXDA 2XNRA 3KWMA 4GY2B 1S0NA 1RU2A 2OKQA 2BDPA 2FGCA 3K58A 3J7YP 3OYFA 5A8WA 1VC0A 3CJRA 3DRPA 4N77A 4GKJJ 2DR7A 2QKBA 3Q7CA 2G4BA 1UETA 4IYQA 2R7QA 1EKEA 5AQYA 5KG6A 3F41A 1N36J 4I6MA 4JI7F 2BJ1A 3NAIA 3IG1A 3THWB 3MX5A 1BQNB 1LAVA 1W2BR 4FF1A 4H0PA 2JC1A 2JLGA 1EJ7L 3AVBA 1PCAA 3D2EA 3B4MA 3KYLA 4OL8A 4CF8A 2NLWA 4WWSA 4ZCMA 3ZZRA 1AFIA 2UUCK 3SV4A 3ZTRA 1X8DA 3NY0A 1HNIA 5M1PA 2W7OA 3O6WA 1KSPA 2RRBA 1FJ7A 4HR2A 4IUFA 4EYIB 1R89A 2IPOB 3MECB 4UW2A 4X64J 4ZHRB 4IG3A 4BDYA 4M3WA 1IVZA 3KJVB 2K06A 4U7BA 2HQGA 1OJ4A 4KGZB 2HHPA 3W3DA 4LF9J 1L3UA 1TYQB 3RMDA 1HYVA 1EP4B 3FZ2A 3NG8A 3KK7A 3OFHA 4ID1A 1S1WB 3MAQA 3S8SA 1ZOTA 3V6DA 1W25A 5AFUA 3ULEA 3CD6N 5HBMB 4DSKA 1NBWA 3O2IA 1ZBUA 1TGOA 3BBFA 3D7SB 1P8ZA 3GCWP 2D69A 4KHRA 5KPRA 3GG0A 1R8PA 4HVZA