1LW2A

Crystal structure of t215y mutant hiv-1 reverse transcriptase in complex with 1051u91
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
539
structure length
518
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFARKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLYTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of Zidovudine- or Lamivudine-resistant human immunodeficiency virus type 1 reverse transcriptases containing mutations at codons 41, 184, and 215.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
total genus 141
structure length 518
sequence length 539
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2002-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1lw2A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lw2A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lw2A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lw2A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1lw2A05
4WFZA 1TVRB 3K2PA 2F8EX 4ZHRB 4DLGA 1S6PA 4OPJA 4OPKA 3AV9A 3K5NA 4DL7A 4F4KA 4RZRA 3QGGA 4OKKA 3RMDA 2JGUA 4XPEA 2HNDA 4K4ZA 2X6NA 4LSLB 1RT5A 3QEWA 2DFFA 3EZ5A 4O5BA 4J9OA 4IFVA 1HMVB 4IBNA 2OPRA 5FROA 3SFGA 4FW2A 5EDWA 4CJFA 3N6LA 2OPPB 3OYMA 4K4WA 4M3XA 5EWFA 1C0TB 3CJ5A 1LWCB 4Q0BA 4B9NA 4GMJB 3OYEA 4CJQA 3VQ4A 4FLUA 4CJSA 3WNHA 4FLTA 1IKXA 5I3UB 2YNIB 3OL9A 4O0JA 1NOZA 1IKVA 4FS1A 4W5OA 5KFAA 4ECSA 2B4JA 2YV0X 3KK1B 4CE9A 4FBUA 1D9FA 2IAJB 4KFBB 3GV8B 1ZBHA 3D5MA 3EZUA 2F96A 4DQQA 1I39A 2BQUA 2WK4A 4CEQA 3KHGA 2DFEA 3PO5A 1HNIB 2WONB 3WNEA 5KFBA 4H4OA 1T7PA 3AO4A 3BDPA 1UWBB 4B08A 1JLAB 2JC0A 1WNEA 3BJYA 4B8CA 2BE2A 4I7FA 4WYWA 5CZ2A 1RT1A 1ZBIA 1SKSA 1JLFA 4M45A 2FVQA 1ITGA 3QINA 4Q43A 1J53A 1S9EA 1LW0A 3RB4A 4ZVGA 1RTIA 2JEFA 4I2QA 4IH7A 5F8GA 4NCGB 1QAIA 3TR8A 1TK5A 4QWCA 4BDPA 1VRUB 5KFHA 4W5QA 4C8OA 3THVA 1UWBA 1JLCA 3ASMA 2IM2A 2IM3A 3C6TB 4DTXA 4F4ZA 2ASLA 4X2BA 1SUQA 2F8SA 4K4TA 4OKJA 2ASJA 4GC6A 3ZT1A 5L1LA 4ZVFA 1TK8A 3DMJA 2IC3B 5L1KA 1WSGA 3KHLA 4OGEA 3DLRA 4ECXA 3C94A 4ED2A 1RT2B 3KLEB 4ZVEA 1CLQA 4LQ9A 4TY9A 3MEEA 1RDDA 1JIHA 3CVKA 3HPHA 5I42B 2EHGA 5K14B 4BWJA 4KRFA 1TV6A 1TKZB 2R8JA 3V6KA 1S0MA 1MU2A 1C1CB 3OJSA 2KW4A 3BSOA 1L3UA 1WSEA 3VQ6A 3H98A 3V4IB 1N48A 4KV8A 2WHOA 4YMEA 4CF2A 5J1EB 4LY7A 2KZZA 2YKMB 4DQPA 4E89A 3I0SA 4B9UA 4IFVB 3G86A 4PWDB 3P5JA 2XRIA 4URQU 3Q8PB 1GOAA 3NDKA 4R5PA 1L3VA 4LH4A 1QTMA 1Y97A 3PO4A 5KFFA 2WOMB 3AVCA 3V4IA 4RNOA 1QHTA 1S1VA 4QPXA 1GX5A 3LAKA 1WSHA 1BHLA 3V9WA 3DYAB 2FBTA 1RDAA 2E9TA 2IJFA 2D3UA 2ETJA 1JXBA 3DRSB 1JLBA 3FDSA 2XC9A 4CERA 3NGZA 2XGQA 4IG3B 4WFXA 3PJWA 1D1UA 3ZSOA 4O3RA 5J2MA 1DTTA 1YVUA 3NF6A 4K50A 1D5AA 4CESA 5T14A 2YNFA 5J2NA 1CXUA 1RBVA 4IQXA 3IS9B 4ECWA 3BQ1A 3NFAA 4YR2A 3ISND 1C0UB 2OZSA 1ZETA 1RTJB 4ZVHA 2ZKUA 1HMVA 1JL1A 3NH1A 1LW0B 5C5JA 4NLTA 2OA8A 4EBDA 1BL3A 4GW6A 4DTUA 3DLGB 4J2AA 3K59A 3KMQA 1RBRA 3TAQA 1UAXA 4KB1A 2ASDA 1REVA 4MH8A 1RTIB 4O3NA 4CEOA 3LP3A 3LPTA 3UIQA 4FZYA 3GIKA 4B9SA 1LWCA 1K6YA 4CGDA 3QEPA 4E3SA 3QNOA 2O4GA 2PZSA 1EETA 1C0UA 3HVWA 4HCCA 1S1WB 4YR0A 4DFPA 4Y2CA 3ICLA 4JRQA 4ICLA 3C6UA 3IG1A 3LWLA 3OYDA 1HJRA 4MK8A 3V6HA 3F73A 2JLEA 4KB0A 1RT4B 3DOLB 3AO2A 1T03A 1KCFA 1CXQA 3MF5A 1J5OA 3V9SA 1BI4B 2ITGA 4FZXC 1C6VA 2FJVA 2XY5A 1TKZA 4EYIB 2BANA 2IBKA 1ASVA 3KLHB 2EC0A 4CGIA 1VRTA 1B9FA 4CEDA 4UQGA 3U3YA 2UVRA 4Z4EA 1D9DA 4PQUB 3IG1B 3LDSA 4K4UA 2IS3A 1W9HA 4HVJA 1SL2A 1WSIA 3CDEA 4K4YA 5KG1A 2XY6A 2JEIA 4RW9A 1FKPA 4DQIA 4L8RB 2VG6A 5KI6A 3PW7A 4FM2A 4CJWA 2QKKA 1LAWA 1JLGB 3M8PA 5JS2A 4F3TA 2YKNA 2FLNA 4NCBA 1JLEB 3KK2A 4DTPA 1RA6A 3HSTB 4DG1A 1NK6A 4ELTA 4RW4A 3NE6A 4DU4A 1O1WA 3DYAA 3VQQA 4KHMA 3OS2A 2AGOA 3HJFA 3OYHA 3FQLA 1IKYB 4CJPA 4IDKB 3G6YA 5KFDA 3NAHA 4ECUA 1QAJA 1T8EA 1HYSB 4NLSA 4MIBA 4AILC 4H4MA 2YNGA 1MU2B 4ECRA 2AJQA 5J2QB 4O44A 5J2MB 3RMAA 3AVKA 4FLXA 1S49A 4RNNA 4DL4A 1T3NA 1JXLA 3M8QA 3UDLA 4KTZA 4EYHB 3UPFA 1XR5A 3AVMA 3IGVA 4DFKA 1MMLA 3HT3A 1YTUA 4TY8A 2WRMA 4DQRA 2DY4A 4K8ZA 1HNVA 2HVHA 3NGDA 3HVAA 5F9LA 1NHVA 3DOKB 5JXSA 2RDIA 5J2QA 4YQWA 4ED7A 1HPZA 2V4QA 1NOYA 5HP1A 2Y1IA 3P1GA 2XGPA 2IGIA 1U4BA 2KFNA 3KLIB 2AGPA 4FJMA 3KKSA 5DMRA 1K1SA 5KFYA 4ZPCA 3O3GA 4EZ9A 2VWKA 2QKBA 3CJ3A 4NLVA 4R8UB 1C0MA 4IG3A 4J9MA 4O55A 1C2PA 2HHUA 3D28A 2EX3A 4ZP9A 4YFUA 5DGAA 4B9LA 3SUPA 4KO0A 5HRPA 3G10A 1S4FA 2R8GA 1RTHA 4DTSA 4CJ5A 4NLYA 4CK1A 1KLMA 3OYIA 3TABA 2GC8A 4DSFA 1R0AB 4R0EA 2FBYA 3UQSA 4FJNA 4I2PA 4RW6B 2XWYA 4M3RA 4Y1DA 3HL8A 1WSFA 3H2LA 4XPCA 4KAIA 5DG9A 3OS0A 1EP4B 1SKWA 4DS4A 4O3OA 4AHCA 4ID5B 4NYNA 2FVPA 1LW2A 1HNIA 3T5LA 2RPIA 1GX6A 1RNHA 2DFHA 2XY7A 3H5XA 4FCYA 4FLZA 1KRPA 4FJ8A 3H59A 1RAJA 3NF7A 3JYTA 4JV0A 1KTQA 4DSIA 5KGXA 2AGQA 1NKCA 4K4VA 4J9RA 3CM5A 4U7CA 4Z4HA 3K5MA 3EPIA 3MR3A 1JLFB 3FQKA 3DM2A 4Q44A 4ZMMA 3KLFB 4DL5A 3NL0A 4FJJA 2D5RA 4J9LA 4Q8FA 2D0BA 3OL8A 3V9UA 1U49A 3ZT4A 4IFYB 1NK8A 1S0NA 4B9TA 3OYKA 3DRPA 3LAMA 1SUQB 4OGCA 4H4MB 3HVRA 4QWAA 4JS4A 4FJGA 3PW4A 2R8IA 3QO9A 4XO0A 5KFWA 4F3OA 1NK4A 1T05A 3OL6A 4B3OB 4DTNA 3HVTA 2IC3A 5KFIA 3VQ5A 3CQ8A 2AU0A 4FJ5A 3AVLA 1HNVB 2YNHA 1FK9B 1NK7A 3BQ2A 4FM0A 4GVMA 4CJKA 2HB5A 2A1RA 2IM1A 4FW1A 4KV8B 3P83D 3RAQA 3ZSZA 2WB4A 1D8YA 2WCXA 3ZCMA 2Y1JA 3IRXA 4KHNA 4FZZA 1C1BA 5CYMB 3AO5A 1S1TA 3K58A 4CHZA 4ZPAA 1HYVA 2XCPA 3D45A 4ZPBA 1RCHA 3L8BA 1LV5A 5F8JA 2GIQA 4AH9A 4FJKA 3KJVB 2W7PA 3NH2A 5EU7A 3Q8SB 3BGRA 5KFVA 4CF8A 3H08A 1SH0A 1VSFA 4N5SA 3TAFA 4QWEA 4F4WA 5HBMB 3RBEA 1S1VB 3HO1A 4WE1A 5KRSA 3WNFA 1SKRA 1DLOB 2ATQA 1NK0A 3RB0A 3MEGB 2YHBA 1BQNB 5KFPA 2Z1GA 2GUIA 2LSNA 3CYMA 5KG0A 3AA4A 3KKRA 1QE1B 1X1PA 3BSNA 3V1OA 3K5OA 1IG9A 4C8LA 1WLJA 4FM1A 3AVHA 4DU3A 1K1QA 4O4GA 3MR5A 4IKFA 3CWJA 1QSLA 4QWDA 3DI6B 2OPRB 4HTUA 1EX4A 4IR9A 4KKOA 4WE1B 3SPYA 3VQSA 1L5UA 1W0HA 3LP1B 4NLOA 4CCHA 4JLHA 4IRDA 4N56A 2P51A 2ZQBA 3JYTB 3D0PA 4M3ZA 3V81B 3NAEA 3HKWA 4M3UA 3IS9A 5KG4A 4HKQA 3L3UA 1JLQA 4IOBA 3PR4A 4BE2A 3SUNA 1IKVB 3TAPA 1CZBA 4J9QA 1S9GA 5D3GB 3KK1A 5DLFA 2W9AA 4CGHA 2B5JB 4JV1A 4CIGA 2IJNA 2V0NA 4DTJA 3M8SA 1HYZA 4MFBA 4RW6A 2HNDB 3ITHB 1IKWB 3JSMB 4CFCA 3QIOA 4CJ3A 3V6JA 4XIUA 3PV8A 2BRKA 4LSNA 4ID5A 3L3VA 3VQPA 2R7YA 3CO9A 1T03B 1NJZA 4FK0A 4Q5VA 3C6UB 4ICLB 3DLEB 5HRNA 3K5LA 2XCAA 2YNHB 1UA0A 1KLNA 4BWMA 2OPQA 3SPZA 4FXDA 3ZSYA 5J2PB 4JUZA 4KTQA 3I0RB 4RNHA 4LSNB 5EWGA 1XR7A 5HLFA 3QEIA 4DFJA 3EPGA 5DLGA 2V4RA 1LWFB 1QSSA 4QCLA 3ALYA 1N6QB 4RNMA 3DLEA 3KJVA 2R2SA 2D41A 4RW8A 2VG6B 3AVFA 3KMSA 2HHQA 1J54A 1X9SA 1VSMA 3GV5B 3S3NA 1KHVA 4M94A 1OS5A 5F8NA 3T5JA 4NLQA 1QQCA 3SCXA 4CJ4A 4J2BA 2P1JA 1RTDB 4B3OA 4DTOA 3M8PB 4E7HA 1FXXA 1ZTTA 3RR8A 3IN5A 2HHSA 5KFGA 4KPYA 3N6NA 1TKXA 5L9XA 2FC0A 2G8KA 3SQ4A 1QE1A 4RW8B 1RT6B 3V6DA 2JEGA 4NLDA 3AVIA 1T94A 2F8TA 4Y2AA 1TVRA 2D0AA 4PWDA 1ZBFA 3C6TA 2IA6A 3KLVA 5L1JA 1TP7A 3A2FA 4QW8A 4I9QA 2NUBA 1C1BB 5CYMA 4NLGA 3SI8A 1LWEA 3CDUA 1A5WA 3SUOA 4DTMA 4K4XA 4CHNA 4TY8B 3NBPB 3V81A 5CYQA 4J2EA 3M8QB 4BDZA 3QLHB 4RW7B 2DPJA 3M9NB 2Q3SA 3PUFA 2IMWP 4DSLA 3MAQA 3M9OB 3PHEA 4M95A 3MFHA 4BDYA 4G1QA 4URSA 1N4LA 2Z1IA 3T3FA 4NRUA 1A5XA 1DTTB 4EP4A 4CEAA 2AX1A 2C28A 2QK9A 4PUOB 3ITHA 3JSMA 4IRCA 4EBEA 3VN5A 4R8UA 2P5OA 4O4GB 4N47A 3QERA 1L3TA 4FJXA 4KAZA 3MECA 3FFIA 4FJ9A 1VSEA 4KFBA 3QIPA 1YT3A 1N56A 4B8AB 3KOAA 2GBZA 2HAIA 3RBDA 4DQSA 3L2QA 3L2VA 3LZIA 3OHBA 5HRRA 4TLRA 5KT6A 4ED3A 1VSDA 4DS5A 3DRSA 2FVSA 5KFXA 3TAMA 3H40A 1S1WA 1J9AA 3I5BA 3ZSXA 1GOBA 5KT4A 4NCAA 2OPPA 3KHHA 4CFDA 4ECTA 2FLPA 4WZQA 2VG5A 4ED8A 1TL1A 1RT4A 5HRSA 3ZT2A 1XHXA 1J5OB 3OYGA 5C24A 4Q0BB 3T19A 4CF0A 4RUCA 2BANB 2OPSB 3HP9A 4BACA 4CK2A 3AVAA 2XO7A 4RG8A 4EZ6A 2XI2A 1DTQB 4C8KA 3SYZA 1TGOA 3DLKB 3PX0A 2HNZB 1RT2A 1TL1B 4ZP6A 4O3SA 3DRPB 3OYFA 1UOCA 1S5JA 2ZD1B 4CFBA 5KG6A 1U48A 5C24B 3V1QA 1JLAA 4CJUA 4B9VA 1EETB 3OL7A 5HLFB 4K4SA 2X78A 2UVUA 1HRHA 3O3FA 3HVTB 3RTVA 1JKHA 3KK2B 4OJRA 4IRKA 5C25B 3MXJA 1T05B 1TKTB 4EEYA 4N41A 2I5JB 3EYZA 4CGFA 1FK9A 4CJEA 4AHRA 5KG5A 2YKMA 3PJXA 4EBCA 3OYNA 3NH0A 4KE5A 4BE0A 4OKEA 3E51A 1S6PB 3HP6A 2BGGA 1FKOB 3OSNA 2R8KA 4DSJA 2HMIB 2CJQA 1RTDA 4KHRA 3KLHA 1TKDA 4G1QB 1TK0A 3CG7A 4QOZB 4DSEA 3ZSWA 5F8IA 3DMJB 4O44B 4MQ3A 1JKHB 1X9WA 2HVIA 4DL2A 4TYBA 1Q9YA 4ECQA 2BQ3A 5C25A 5FDLB 3GILA 1HARA 1U04A 3BSAA 2B6AA 3KLGB 1EKEA 4PA1A 3KLEA 5EUHA 3AO1A 3S3OA 1JLBB 2J6UA 3IAYA 2DPIA 1FKPB 4O3QA 1WAJA 3TQ1A 2HMIA 4IR1A 3QIPB 1SH3A 3BSCA 1JLGA 3VQ7A 3EY1A 2HHTA 4WFYA 1LWEB 3VQ9A 2IDOA 3HXMA 2YNFB 1KHWA 4KB7A 3TI0A 3NBPA 2E4LA 5HROA 5CYQB 3NMAA 1XWLA 4OVLA 2OYQA 4QWBA 1RYSA 1BQNA 3SFUA 3KTQA 2XHBA 5KFTA 4ID1A 1RBSA 5L1IA 2YHAA 1ZYQA 3NGYA 2G8HA 4OL8A 1ZBLA 2ATLA 5DK5A 3RR7A 4R5PB 5DQGA 4O3PA 2YNGB 4CHQA 1REVB 3ZT0A 3AVBA 2D0CA 5DGBA 3KHRA 1RTHB 1I3AA 4DL6A 1YTAA 3OYLA 1KSPA 3U6FA 4CJTA 1VSLA 4F4XA 3PW0A 1Q9XA 4F2SA 4CFAA 4J9NA 4W5RA 2KFZA 1UA1A 2BE2B 4EO6A 4KHWA 2QXFA 3MEDA 1YVFA 4LH5A 4DTRA 3L2WA 2B43A 3RMCA 2R2TA 4DWIA 5JS1A 2J6SA 3HM9A 3H5UA 1KVAA 2B5JA 5KFJA 2CKWA 2HNZA 3PX6A 4NCGA 4J9SA 1KVBA 5KFOA 1RA7A 2QV6A 2A1SA 1VSKA 5CY4A 3L2RA 2FVRA 1SL0A 1S6QB 4ELUA 1IKWA 1RT3A 3B6PA 4CF9A 3MXIA 1RTJA 5T7BA 1TQLA 3HPGA 5C42B 1VK0A 2VA2A 1BIZA 4FJIA 3ZT3A 4TYAA 4MKBA 3NHGA 4NYZA 2HNYB 4Z4GA 2I5JA 2VG5B 1XI1A 3TAEA 2W8KA 1SV5A 5KFRA 3IGNA 2RKIB 5KFNA 4EP5A 1ZBUA 5EWEA 1S1XB 4WYLA 2Z1JA 4F8RA 3VQEA 1S10A 3O3HA 1TV6B 1FKOA 2W9CA 4DF4A 4M3WA 3I0RA 1RT1B 3VQDA 3AA5X 3ZSVA 4M3YA 2ILYA 4NYFA 4AHSA 4HCBA 2YKNB 3LP2A 1RYRA 2KZMA 3SV4A 3HK2A 1ZTWA 3CFRA 1EP4A 4JRPA 3HYFA 1N6QA 5FDLA 2HNYA 4CJRA 3DLKA 4I2QB 2OZMA 2AX0A 4ED1A 4DF8A 3DOLA 1RDBA 4CGGA 1LAVA 4W5TA 1U09A 5KFLA 5KT3A 3PZPA 2ZD1A 1QSYA 4IG0B 2W7OA 4DL3A 1NKBA 4NRTA 4E19A 4YP3A 1VSJA 2W9CB 5KG2A 1TAUA 3GIJA 2Z1HA 2UUWA 4Z4FA 4HYKA 4CIFA 4CGJA 3I5AA 4CEEA 3NKYA 4KHSA 3O4QA 3U3GA 2E6MA 3FRZA 1BCOA 3HHKA 4RNFA 2ALZA 3TAGA 5HROB 1F21A 1RT6A 3V6DB 5FRMA 2XI3A 4E7IA 4CECA 3MFIA 4QW9A 4CJLA 3QNNA 4RW9B 3N6MA 3SNNA 4KTWA 5K14A 3LP0A 1S97A 1RILA 3TANA 4HUFA 3H4BA 4JV2A 5FRNA 1EXQA 1HPZB 4NZ0A 3PR5B 4TQRA 3OS1A 3QO9B 2VA3A 1VSIA 3SJJA 2FBVA 1Z25A 3KLIA 3BREA 1U47A 3NAIA 4OLAA 5E41A 1G15A 3I8DA 1HQUB 2FJXA 3TVKA 4MKAA 4DU1A 3MEGA 1NJWA 4Q8EA 3I0SB 3LWMA 4CHYA 3VQAA 4ED6A 3AVJA 5SZTA 1HYSA 3QZ7A 2BQRA 3VQBA 4H8KA 3S9HA 2FBXA 4LD0A 2BRLA 3T1AA 2AWZA 1XR6A 3GQCA 4CIEA 1HQUA 3OY9A 1S1TB 1RT3B 3TARA 1N5YB 1A5VA 1S9FA 4QAGA 4J9KA 3FFIB 4CHOA 1WN7A 4E1MA 2G8FA 2KTQA 5KG7A 4IH6A 3DOKA 1JLQB 3PW5A 4GC7A 3M9MB 1U45A 5HP1B 2QE5A 1JXEA 4C8MA 5HBMA 4DFMA 4F50A 1BIUA 1BI4A 1S1XA 3SI6A 2BR0A 4M3TA 3ISNC 1DLOA 2VWJA 1CZ9A 1TL3B 4KI4A 1S1UA 3H5YA 3CM6A 1BGXT 1S48A 4Y34A 1IO2A 5KTQA 1NHUA 3DLGA 4DMNA 3UR0A 1GOCA 4U6PA 1C1AA 4DEZA 3V9ZA 1IKXB 5I3UA 3TAMB 3KLFA 1XC9A 2PYLA 4Z4IA 5F9NA 4FS2A 4JS5A 4KKOB 5KT2A 4BE1A 1BCMA 2G8IA 4CHPA 1KLMB 2FJWA 5KFEA 4RUAA 3CJ0A 1TL3A 1Q8IA 4I9LA 4CEFA 4I2PB 3LPUA 3QEVA 3V1RA 4ZTFA 1NKEA 1JX4A 4DG1B 5KFZA 2J6TA 2ZE2A 1WNSA 5KFMA 4KHQA 2PY5A 3QETA 1VRUA 4CJVA 1LWFA 3MR6A 3G6XA 2RKIA 3KNAA 3LALA 3PW2A 4FJLA 4ECYA 3OVNA 3OYJA 3LP0B 4NLUA 2O4IA 3T5KA 3AVNA 3CJ4A 3OJUA 4HHTA 4FVMA 2E6LA 1XHZA 4KREA 2ILZA 1S0OA 4MFBB 4YNQA 1JLCB 2UVWA 2HWIA 4TN2A 4KHYA 3RAXA 3DLHA 3DM2B 3RRHA 1NK5A 2C22A 3TWHA 5CZ1A 4AHVA 5KGWA 4HUGA 4E1NA 4IG0A 1ASUA 1TKTA 3ULDA 2W9BB 3AA2A 4DLEA 3G6VA 4CEBA 5I42A 3KK3B 2HHWA 5KFUA 1JL2A 4LQ3A 1BQMA 3SQ1A 3MEEB 2PYJA 4FJHA 4F2RA 3CIZA 3O4NA 4NLXA 3PY8A 1TAQA 4TSXA 3QESA 1IM4A 4AHUA 3H5SA 2RF2A 1QS4A 3FSIA 3QGIA 3V9XA 4FLVA 2B6AB 3KLGA 4FLWA 1N5YA 3T5HA 3QZ8A 4FLYA 2IOCA 4IH5A 5JUMA 3M8RA 2W9BA 1KVCA 4ED0A 2DTUA 4TXSA 3I5CA 5J1EA 1BQMB 1CSJA 3Q8RB 1L3SA 4ZTJA 5DG7A 2VG7B 4KHUA 3CDWA 3SV3A 1Z26A 4KO0B 4FBTA 3VA3A 1W25A 2AQ4A 3RRGA 3L2UA 4IKAA 5KT5A 3ZSRA 4HUEA 4K8XA 2D3ZA 2HWHA 4CEZA 2WOMA 2IM0A 2P5GA 4WXWA 4CF1A 3HPOA 4EO8A 2FVCA 3GIMA 4OLBA 1QUVA 4ZP7A 1S1UB 4NLPA 3BR9A 4ZP8A 2BDPA 3NCIA 3CJ2A 1SH2A 1RT5B 1VSHA 4F4YA 5KFCA 4E7JA 4E7KA 4DSKA 4FK4A 2HW3A 4M42A 3MECB 4Y3CA 1LW2B 3PVXA 5D3GA 5F8HA 4TQSA 3DLBA 2OH2A 2O5DA 4YR3A 2RDJA 1RBUA 4WXOA 3S3MA 1B92A 3BQ0A 1C0TA 3F9KA 2JC1A 3GYNA 2G8WA 4ELVA 3MEDB 1BISA 5J2NB 3NF8A 3DDKA 4KSEB 3RWUA 2HHXA 4MK7A 2WTFA 1NJXA 1WSJA 3OYAA 3RB3A 4URGA 1HQEB 4O0IA 3OSPA 2YNIA 3DI6A 3SZ2A 3LZJA 4ZHRA 2W42A 3MR2A 4CK3A 3QYYA 4E0DA 2G8UA 4O4RA 3QGHA 4N76A 2IAJA 3VA0A 3LP1A 3MXMA 4FK2A 1R0AA 1KFDA 3SUQA 2E9ZA 2C2DA 3GIIA 5KFSA 1SL1A 3KD5E 4PUOA 1S6QA 4ECZA 1IH7A 4AHTA 2HHVA 5J2PA 5KFKA 5C42A 3WNGA 2OPSA 3OLAA 1HQEA 4NLRA 2UVVA 3CFPA 3KIOA 3VQ8A 1RT7B 1SV5B 1S9GB 5DQIA 4E7LA 3DRRA 3Q8QB 2C2RA 4Z4CA 2XY8A 2GV9A 4NLWA 4H54A 3VQCA 3GV7B 4KBIA 3QEXA 5SWMA 2R2RA 2RN2A 1X9MA 3ZSQA 1VRTB 2R2UA 4RU9A 1RDCA 3C95A 4PY5A 4ZPDA 2X74A 3G0ZA 2G8VA 3KD1E 4PQUA 2ZE2B 1RBTA 4G3IA 5KG3A 3LP2B 4ECVA 5KRTA 2C2EA 1RT7A 2FLLA 4M41A 1NK9A 3OLBA 3QIDA 4IFYA 3OHAA 2E9RX 1TKXB 3RMBA 5F8MA 3E01A 3DRRB 2JEJA 3SQ0A 4FJ7A 4KI6A 1RDRA 3B6OA 1ASWA 4FYDA 3SQ2A 4J9PA 4J2DA 2W8LA 5KT7A 5KFQA 2WONA 1D0EA 4H4OB 3BGRB 2VG7A 2OPQB 2GIRA 4MK9A 2X6SA 1NNDA 2D7SA 3K57A 4I7FB 4W5NA 4Q45A 4WZMA 4RW4B 3AVGA 1C1CA 3AO3A 3NF9A 1S9EB 1JLEA 2UUTA 1DTQA 4Y1CA 3MTKA 1IKYA 5F8LA 3E01B 3PX4A 3KK3A 1WAFA 4MIAA 3OYBA 4IDKA 3QLHA 4RW7A 2KQ2A 4Z0UA 2I1RA 2V9WA 3H4DA 3OYCA 3CFOA 3AA3A 1KFSA 2RF2B 1Z4UA 3IRXB 3LANA 3RB6A 1B9DA 5DG8A 5DQHA 1NJYA 2R8HA 3NGIA 4B9MA 4C8NA 4LSLA 1I6JA
chains in the Genus database with same CATH superfamily
3VZHA 2ITMA 3HSCA 5KAKA 1NUEA 2P6TA 1U2FA 5KPZA 3R6LB 1H0HB 4ZHRB 4DLGA 3AV9A 3RBZA 3K5NA 4H0VB 3I9ZA 5AQHA 5CE3A 1APSA 1H2VZ 1SIZA 4QIVA 3O4WA 2JGUA 1RWVB 4XPEA 2QX0A 2U2FA 2QSWA 4LSLB 1RT5A 3WBZA 4F3QA 4H5TA 1VIOA 1NNEA 3QEWA 4E2FB 1SBRA 4DOZA 4O5BA 4IFVA 3PM9A 3P8BB 4A8XA 5FROA 2DGOA 3FCWA 3CJ1A 5EDWA 1UJ5A 2DT9A 3CJSA 4UY8O 2H65B 4OJHA 1Y3JA 4DV7J 4Q0BA 4X4NA 3D0HE 4B9NA 4DQ8A 2XYPB 3PYFA 3M2VB 4DV3J 3OL9A 3T7ZA 2O8EA 1S76D 4W5OA 5KPRA 4ECSA 5A0YB 2B4JA 4DHYA 1XNRJ 2IAJB 1I1GA 3RRKA 4JP8A 2BQUA 4HACB 2W4DA 1HNIB 2DTJA 1T7PA 3OR1B 3WXKA 1AXQA 3HZ6A 1JLAB 2UXDJ 3OTEA 1WNEA 4I7FA 1ZBIA 1ZOTA 4Q43A 4NYPA 3M30B 4DX7A 2D1CA 3SXLA 2E1MC 3VGSA 3HT0A 2HHHK 1RTIA 5AQPA 3RW7A 5DJBA 1LEOA 4BDPA 5F8GA 4NCGB 1DEJA 5KFHA 1JK9B 2DD8S 3THVA 1JMTA 2V8VA 2IM3A 1NDKA 3H42A 4IO1A 5F3ZA 2F8SA 1P27B 4JI8K 4GC6A 2R7RA 2XZTB 3SAHA 3FGUA 1TK8A 1UWAA 2JDJA 1FD2A 2FHMA 3CGIA 3KHLA 1PO6A 4TU7A 4OGEA 3FZBA 3T41A 4ECXA 2GEMA 3JAMU 3IKMA 4DB3A 4ZVEA 2HRUA 2G13A 1RDDA 4GKJJ 2QO3A 3CVKA 2MDAA 3HPHA 4KRFA 1VLOA 5BJRA 2G4BA 1YHQN 1MU2A 1C1CB 3OJSA 3RSEA 1L3UA 2KW4A 2C2OB 3VQ6A 3NS6A 3TUPA 2QWQA 2WHOA 5MAOA 2LVWA 4X62K 4CF2A 4ZK7M 2NRHA 4LFCF 5J1EB 2LKZA 2QZ8A 4J91A 3G86A 2XMKA 3NDKA 1NLVA 2FGCA 2ADBA 1L3VA 1QTMA 4OV1A 1Y97A 4WFNL 4YOWA 1IR1A 4DPUA 1DARA 2D1KA 3MGJA 4QPXA 3TTFA 1Z6RA 1GMWA 1VMBA 3OPKA 1RDAA 3IBCB 1KDNA 2E9TA 2IJFA 3EVMA 2QLBB 4X62F 2D3UA 4KC5A 2C3PA 1JXBA 3DRSB 5B7WA 1XMQK 1JJ4A 4DUYK 3DXKA 3UFCX 2QRRA 3TWZA 3ISZA 5IM0B 2W41A 2P9NA 2K1RB 1KD1T 4QS7A 5JVGL 2LEAA 5J2MA 4PEOA 1DTTA 1YVUA 4K50A 3C8YA 2HSTA 1HLUA 2DITA 2RHKA 1CXUA 1YJ9S 5FPNA 2LXFA 4ECWA 2L41A 3BQ1A 3NFAA 2LP4A 1C0UB 3S1TA 4X4SA 1BA1A 1DY3A 4Z7YA 1GLAG 2BJDA 1HMVA 5HANA 2OA8A 4EBDA 1BL3A 4CH7A 3HHLB 4H4KA 2ASDA 3JXUA 1RTIB 2K1RA 3GPAA 4O3NA 4ZKAA 2A3ZA 2OP5A 4DPOA 3HM8A 3QJPA 5AQZA 4EWTA 3C46A 4BC3A 4CGDA 3QEPA 3BBBA 2GUPA 2O4GA 4LF6F 1J5EK 1FXDA 1C0UA 3RG6A 3U1NA 4HCCA 5BRHA 1S1WB 1P8GA 3CCQN 3ICLA 3CJBA 5AZJA 1ITPA 2F9DA 4K2XA 3CCVS 3OYDA 1HJRA 3H25A 1RT4B 1RJJA 2FPHX 2UUCJ 1YXQA 1J5OA 3V9SA 4HDGA 4WCEQ 5JVHL 1WHYA 1XK8A 1IBLF 1EKRA 1C6VA 2XY5A 3D1HA 1R8BA 5HMWA 4EYIB 2BANA 3CCMN 2FYXA 4OZ0A 4FKYA 5L39A 1P1LA 1VRTA 2HGMA 1T6DA 2D3O1 3LDLA 1DGKN 5AQKA 4CEDA 1NU4A 2UVRA 4QOTA 2VD3A 4Z4EA 2Z0GA 4LRAA 3IFEA 4U8YA 1ZA1B 3FK4A 2HFSA 4K4YA 2A2CA 2YHXA 2MHEA 4L73A 4FL9A 5KI6A 3D6HB 1LAWA 4DPYA 1JLGB 4CLLA 3CD0A 2YKNA 1JLEB 4CNYA 2CA9A 1Q86O 3KK2A 3P5TL 3BR8A 4O8KA 1O1WA 3VQQA 5GAGP 4ZDNA 2AGOA 1H7WA 1XTZA 5KFDA 4ECUA 3K8VA 1ZPVA 1HYSB 3R7BB 3D1OA 4H4MA 1RGVA 2P9NB 3ILIA 3BEGB 4X4OA 4O44A 1VCTA 3FLCO 3AVKA 2IVNA 2HFZA 4FLXA 1F9HA 1S49A 4DL4A 2UXCK 2C3OA 4DV2K 5AXKA 4ZVUB 3UDLA 3ZXWA 4TU9A 4EYHB 1SC6A 1PIEA 2Y9HA 1HNVA 4JI2F 1B0PA 5F9LA 3VEXA 5JXSA 1X3MA 3G96A 2RDIA 3R1LA 4DV4F 5J2QA 3LGHA 3AOCA 2DNQA 2Y1IA 3Q89A 3U9ZA 2ZJQL 2IGIA 1GMVA 1TFYA 1YIJN 2VKRA 5AXNA 4CI0B 4X64K 2BJ8A 2KHCA 1YRXA 3CJ3A 1NMNA 2WAQD 4BRCA 2YWEA 3W8GA 4O55A 3JAMO 3D28A 2KM8B 4FWLA 1FFGB 1S4FA 1RTHA 3GBTA 5F41A 1VHFA 2GNKA 4LF6J 3L4IA 1KLMA 3OYIA 4DSFA 2UP1A 2PC6A 3AODA 2R7QA 5GVQA 3CCVN 3HL8A 1K8KA 3TUJC 3FGVA 4DV7F 1TMMA 5DG9A 3PIOQ 5E26A 1T44A 1NXIA 1ATRA 1WEXA 4OHXA 2XSFA 2DNRA 3BKFA 3U1LA 3T5LA 3ELHA 1WC6A 1SJ1A 2EG1A 1OY9A 1X4CA 3H5XA 5ETVA 5BREA 5BN8A 2MQ8A 2FJBB 3H59A 1NO8A 5KGXA 1IQTA 4GVBB 3CM5A 4Z4HA 3MR3A 1JLFB 3DM2A 4BG8A 4ZMMA 2DNOA 5HQLA 4DL5A 4MIWA 1U49A 4Q8FA 3ZT4A 1YJ9N 2ASMA 1FJEB 3CC7N 1FX2A 4DV3F 1P9YA 3DRPA 3LAMA 2HFUA 4OGCA 4H4MB 2DGUA 3QT7A 2DR7A 3HVRA 3O08A 4RKUC 3PW4A 1IBKK 4CJ7A 1IM6A 1NK4A 2GQQA 3PEJA 1Q5VA 3OL6A 3Q2SC 4B3OB 8ATCB 3R5GA 1YVNA 2MQLA 4OLOA 3VQ5A 3CQ8A 4IO9L 1XMQJ 1X7VA 4G6VB 3AVLA 4CD1A 1HNVB 3KZBA 5D0RA 4A8KA 3BQ2A 1SAZA 4GVMA 4HTJA 2IM1A 2Z4PA 1CZAN 4KV8B 3RAQA 1F5BA 2P9IB 3I87A 1JCGA 1Z05A 3QMLA 3ZCMA 5HMZA 1M90T 1TUWA 2E2OA 3S8SA 1S1TA 4CHZA 2XCPA 5J1NA 5C15A 4LF1A 2HFOA 4X66F 4CF8A 1GK8A 2YKPA 4N5SA 1VSFA 3KK7A 4M7YA 1YHQS 3QRRA 3MM5A 3DXSX 4WE1A 2ZH5A 3CCWA 4DV0J 4WKYA 1SKRA 1KNZA 3WNFA 4H5VA 5BYSA 3TVYA 1P9QC 3FFKB 3C6HA 1HA1A 3MEGB 4HVZA 3M1VB 3I55S 2Z1GA 3JQKA 1RACB 5E3AA 5KG0A 3AA4A 3KKRA 4YY3K 3VF0B 3WXLA 1MWQA 1NPKA 3D3CJ 4Z37A 3MCPA 1WLJA 4XH5A 3CWJA 3DRYA 3SDEA 2ZC3A 2MQMA 3BDEA 4J90A 4C0OC 4WE1B 1W0HA 4JI8J 2APOA 1AZSB 4NOHA 1NGEA 4CCHA 1OWXA 1KC8T 2EK6A 4N56A 2ZQBA 3GDQA 4M3ZA 3NAEA 3ENOA 3ZEUB 3TA1A 3IS9A 5KG4A 3LGNA 3M2RA 4CLUA 5LMUF 3TUZC 1QVGM 1IKVB 4ISEA 1S9GA 5DLFA 2F4FA 4CO5A 1WSRA 4L3KA 3GJQB 4L74A 5AFUH 4OI3A 2DNHA 4RW6A 2HNDB 3ITHB 1IKWB 3JSMB 3ZEUA 5E3PA 4CJ3A 4KR0B 4JI0J 1OIAA 2KRRA 2PFDA 2HURA 3NMRA 2IBOA 4HTLA 2E5JA 1EARA 2M4MA 3EXYA 4Q5VA 1FRJA 1QHAA 4X65F 3WQTA 1B64A 4WTOB 5C0YA 1Q16B 1QAYA 5HAOA 2DNMA 3SPZA 1T02A 5J2PB 1TL7A 3A4TA 4KTQA 1S7IA 1DAXA 4IOAL 2MKYA 1HBOB 1RAEB 1UW4A 3MUMP 2ADCA 1FDBA 3MOJB 1BXNA 2YQ3A 1NDCA 3MAAA 1N6QB 4RNMA 3DLEA 2FSNA 2F4VK 4DXLA 3KJVA 1X4BA 1XERA 2VL1A 4RW8A 3R27A 2VG6B 1EB0A 4BS2A 5T7LB 4DV6K 3J7AP 1FXRA 3GV5B 4ED4A 2ZH9A 3R6MA 1OS5A 3MM5B 5F8NA 4MAKA 2ZH7A 1QQCA 1HR0K 4J2BA 1G2EA 1YDLA 2PT0A 2DH7A 4E7HA 1ZTTA 2CH5A 1M5OC 1FF2A 4MKVA 3HLUA 1AROP 3DGPB 3KVGA 3DDIA 3SQ4A 2J4RA 5GAGI 1RT6B 3V6DA 2GVDA 2CZVC 2HBJA 4C98A 3B82A 4B3SF 1FRMA 3RZAA 4Y2AA 1TVRA 3NXZA 2O8CA 4PWDA 3BBFA 4BGAA 3MPDA 3KLVA 5L1JA 4QW8A 1VBKA 1C1BB 5H9EJ 4NLGA 2HWTA 3C16B 1ZM9A 4CHNA 4TY8B 3NBPB 3DLJA 3VGMA 3V81A 2QWMA 2HAFA 4M63C 1SIWB 3GSDA 1UL3A 3CSKA 3CE8A 4RW7B 1ROFA 1TMJA 5C7PA 3D7EO 2Q3SA 2IMWP 3ZNJ1 2AJFE 3M9OB 3PHEA 4UZCA 2IYIA 1E4GT 2Z1IA 4WK3A 5AQNA 4EP4A 3DNCA 2ZNYA 2DY9A 3WHIA 2OJ3A 4Z2XA 3GOIA 3Q0AA 3GFXA 1FW6A 4KAZA 2NPIA 3MECA 2Z2MA 2CPFA 2KVIA 5A6WA 1RADB 3VEYA 4YOXA 4NZ7A 3AGRA 1N56A 2X1GA 3WQPA 4B8AB 4EGLA 1XNQK 1T95A 2HRTA 1VHIA 3L2VA 3W63A 2Z57B 2G2YA 4ZVQB 4ED3A 4UY8T 2J5AA 2LYVA 2FVSA 5KFXA 3H40A 3I5BA 4QZVB 1QQOA 1DRZA 1GOBA 4NB4A 5KT4A 4NCAA 4ECTA 3VF2A 2FLPA 3P3DA 1XHXA 1KBRA 1I3OB 4Q0BB 3MOZA 4K0KF 4ANCA 2E29A 3CCLN 3LH2S 4CIOA 1HD0A 4FPBA 2KT5A 3BB5A 3AVAA 2XI2A 2E5IA 4NX9A 3F5TA 2P9CA 5GAEP 2V5HG 3ULHA 2G9OA 2P9KA 1ZXOA 2OI2A 3OYFA 1H1VA 4DX8H 3R8YA 1U48A 2ZH4A 3HFKA 1JLAA 1R0CB 3MM7A 1YJTA 4CJUA 3EVWA 4OZ5A 4CW7B 3G8TA 2E2QA 4ZITA 4B1VA 2VICA 1HRHA 1K8AO 4ZPTR 2GJFA 3C16A 2NSBA 5C25B 1HR0J 4LF7J 5AZIB 5HI7A 4EEYA 4M5NA 4ZIVA 3A8JA 3TEHB 4GRSA 3CEDA 4KE5A 3FNNA 3W3DA 2GGPB 3LM9A 1FJGK 1FKOB 4X64J 2R8KA 3VENA 4DSJA 2BBEA 2KB2A 1RTDA 4CZEA 4CTAA 4QOZB 3ZSWA 5F8IA 2HZAA 5HJYA 2DO4A 1X9WA 1Q7YT 4ZVRB 4TYBA 3D2EB 3NWGA 2VBWA 3NCQA 3UO0A 3KLGB 4PA1A 1M1GA 5EUHA 2BTFA 2GX9A 3AO1A 4F0MA 2Z2YB 3MD1A 1MMDA 1NGDA 2J6UA 1VQ9N 1NBEB 2PGCA 1O5JA 4ZIWA 2HMIA 2RU9A 1NDPA 1SH3A 4OPHA 2HHTA 2W2PP 3IXQA 2E1YA 3VQ9A 2GMLA 2LEBA 4NE9C 3HXMA 2YNFB 1KHWA 4KB7A 2QI2A 2E4LA 3NMAA 2OYQA 3ENQA 2MZRA 3CHWA 3KTQA 2RQMA 2W01A 5KFTA 3G9CA 2YHAA 4FWSA 2G8HA 2HSEB 1I94K 1ZBLA 5D0GA 4DR4K 2IVFB 3RR7A 4R5PB 2IRYA 3C7NA 2XZWA 3CJCA 3UD4P 4CHQA 4IXCA 1IBKF 2BJ3A 3KHRA 4DL6A 2X1AA 2CH6A 1RWXB 1S72S 1VSLA 5A2QO 4PRFA 2KFZA 4ES2A 3GZ7A 2BE2B 4KHWA 2QXFA 3MEDA 1YVFA 4I69A 4QPTA 4WU3A 3CCUS 1VI7A 3POTA 4PABA 2J6SA 1RLDA 2M88A 1KVAA 1OPZA 5BN9A 4R25A 2CKWA 4BGBA 2CPHA 5ETQA 3AXKA 5KFOA 5GIPA 1VSKA 3U4LA 2C2KB 3EICA 2CQ4A 2GV1A 5CY4A 2FVRA 3AD7C 4ELUA 3Q23A 2FZGB 2FHJD 5HMYA 4DX5A 2GA7A 4DPTA 3B6PA 1CS4A 3KDOA 5T7BA 5C42B 1VK0A 3MN7A 3NCPA 4FYVB 4Z4GA 2A6OA 5CHIA 2VG5B 1XI1A 1SV5A 3IGNA 4OPAA 3NRBA 1ZBUA 4NI2B 4KH0B 2DNZA 1S10A 2IVPA 5I9EB 4H0TB 2ILYA 3MCAB 4RLEA 1B99A 3LP2A 1VFJA 2KZMA 3SV4A 1R59O 1ZBSA 3CFRA 1EP4A 1R8CA 4DR4F 5FDLA 2FXUA 2OZMA 3MHYA 1LQ9A 4DF8A 3DOLA 1LAVA 1U09A 5KFLA 3EMTA 1QSYA 4IG0B 2BEFA 4DL3A 4FN5A 4CZKA 1NEEA 1VSJA 3R6GB 4X4QA 1HBMB 5KG2A 4WFNQ 1VQMN 3D0GE 4YOUA 4HYKA 3LPYA 3I5AA 5KOWA 3O4QA 4LF9F 4QS8A 2E6MA 1WUUA 2HBYB 4P75A 1QM9A 3FBCA 4QR0A 1AB8A 2DIUA 4BY9C 3JS6A 2OTJS 4M5JA 3DC2A 3QNNA 4RW9B 4DUZF 2CZ9A 4GKKK 1RILA 5C2FA 5ELZA 2JVRA 3TYTA 3H4BA 2UUAJ 3R5DA 2DGQA 1HPZB 2XS2A 1F3FA 4UOGA 2RE1A 3MX2A 2LXIA 2AYMA 1OYEA 3MCMA 1Z25A 3Q7CA 3BREA 3SK3A 3K0SA 4YB5A 4OLAA 1HQUB 2W4CA 2N82B 3AJDA 3W8PA 1ILYA 2BABA 2DJWA 1EWRA 4FWNA 4CHYA 2RQKA 3H1QA 2IA0A 4JI5F 3P39A 1HYSA 4A46A 3QZ7A 3RAMA 3CPWR 2KHDA 4H0OA 5JJBA 3S9HA 4DR2F 6FDRA 3T1AA 3GQCA 1QLNA 1RT3B 2VPXB 1M1HA 1RK8A 5IV3A 1VQKS 3GWCA 2EWHA 2MKJA 2D74B 3DOKA 1JLQB 4DCHA 5AZJB 2E7VA 4YHHF 2VCPA 4DKWA 1YBAA 2QE5A 3NGRA 1SJQA 5F0WA 1S0VA 4OZNA 4ZCMA 2Z30B 3MWBA 4F50A 4IOAQ 2ZVIA 4USJC 1CJTB 3QMQA 4MMOA 4DR6F 4M3TA 1S77D 5H9EK 2QA4S 3ENBA 1DLOA 4S0MA 4Q2MA 3BZCA 2R7VA 1N5QA 4Y34A 1IO2A 2MZQA 1U8SA 1GOCA 4U6PA 2XO6A 2Q6CA 3ADAC 3JTOA 1C4CA 2AEJA 3MM9B 2PYLA 4MDBA 4Z4IA 2HQCA 4QYZJ 2G8IA 4K41A 1KLMB 1R8AA 5KFEA 2XMWA 4I9LA 4I2PB 5C12A 2A6AA 2HBLA 4BQZA 3QEVA 3BO2A 4ZTFA 4NA1A 1HWJA 3CMQA 1WTBA 3ETMA 2J0SD 3WEEB 3TZZA 2PY5A 4CLFA 4PKGA 7FDRA 1VRUA 2YKOA 1LWFA 3SBMA 2CPYA 3LALA 2P9PB 1T9UA 4ECYA 3ZNUA 5HVHA 4BC4A 2ASYA 4FVMA 4KREA 1S0OA 5K8NA 4YNQA 4RWTA 1Y5NB 1JLCB 1ELOA 4KHYA 3RAXA 3FZMA 4DR5J 3OA9A 3DM2B 4ZVTB 2QEXS 5CZ1A 4A2BA 3MUVP 3ET6A 3P31A 3O44A 2FHOB 4FZVA 2ZUGA 1CJUA 1ASUA 4NXNK 1X5OA 3FMBA 4CEBA 2UUAF 5GMEA 4LQ3A 4DR5K 3CJAA 2FUG9 5K9FA 5CYJA 4U67L 2PYJA 4FJHA 3CIZA 3EGZA 4NLXA 2JZ5A 1S6UA 5G0RA 2LXUA 4AHUA 4PG6A 3QGIA 3V9XA 1MG7A 3EGNA 4FLWA 4KPCA 3QZ8A 5JUMA 2P6SA 3JQJA 4K5RA 3N9UC 4KGXB 2ZKTA 2R7UA 2DTUA 2QT7A 3I5CA 5J1EA 1BQMB 1CSJA 1IBLK 5IT9Y 3HSDA 4KHUA 3NOGA 1OPIA 2WVCA 1ZH5A 3L09A 4KO0B 3VA3A 2M8DB 3O9RA 2AA4A 2HWHA 2P5GA 4WXWA 1MROB 3M5RA 5CZVA 4FNHA 4AQYJ 2F4VF 3BR9A 4WQ4C 4A8FA 1A9NB 2B9EA 1XMOK 5A8RB 4J9UE 1SH2A 5IT9U 4F4YA 2ROGA 3O3LA 4DSKA 1K9MO 4Y3CA 4KGKA 5F8HA 3QGPA 3S3MA 1B92A 3J80U 5GAHU 2HQIA 3Q8YA 3W60A 1BISA 4UT4A 3M8ZA 2HHXA 4EI2A 5DZ7A 3JS9A 2RS2A 4BC2A 2AKWB 4USKA 1NSQA 1RDWX 2YNIA 3WEEA 3SZ2A 1J6ZA 2BJ7A 2QLJB 3LOUA 4IOCQ 2G8UA 5ETSA 2NRTA 5HN0A 2GELA 2RHSB 3VAJA 5E3CA 3LP1A 1W26A 2OGUA 3RU0A 3WXMB 2GWKA 2V8PA 2BMBA 3DJCA 1ZM2A 5GADU 3TZWA 1CBKA 3OR1A 1OSDA 5KFKA 2X7IA 4W4MA 2MLXA 1HQEA 4BRMA 3CFPA 4H0PA 3KIOA 2YBVA 1S9GB 2E1ZA 1W2IA 1XIQA 5BXIA 3Q8QB 3DWLA 3H45C 3GSIA 4NLWA 4H54A 4X65J 3GV7B 3QEXA 1Q81T 4PXEA 4JYAK 3HSZA 2VUGA 4ZVSB 4RU9A 4AL6A 2DHHA 1YRUA 4GVBA 4J7CA 4JNEA 4PY5A 2X74A 3G0ZA 2G8VA 2ZE2B 1RBTA 3TQEA 3LP2B 3IBFB 5KRTA 2C2EA 2DEIA 3OHAA 1EX8A 4LBPA 4K2JA 1TKXB 4ILHA 3DRRB 2KU7A 2JEJA 5ETTA 1RDRA 2MZTA 2X3GA 4FYDA 4J9PA 2KL8A 5KFQA 1UJ4A 1VQ8N 2BUPA 4MK9A 1OYDA 4WBFA 2HBQB 2NRWA 4M5GA 4W5NA 1K0TA 4RW4B 4M5LA 1C1CA 1JLEA 4IO8A 2CG4A 1IKYA 2LQJA 4KH6A 2M52A 5F8LA 3E01B 5AJ3F 4HT5A 3GTYX 3KK3A 2V8DA 3C15A 4HEA9 5LOQA 1IQZA 1HX1A 2DCUB 2V6AA 3VF4A 3CFOA 2Z58B 4CRJA 4J37A 1NZ8A 2OIHA 3HULA 2CGLA 5AQLA 2EFNA 1H73A 5DQHA 2QG9B 4GKJF 1NJYA 2MB0B 3IM9A 5L9NA 3OBYA 3DGPA 2DR8A 3CD6S 2GS8A 4BRQA 2VASA 3DGVA 4A59A 4LR8A 1QQMA 2I0XA 2M3DA 3BN7A 4WFZA 2IVMA 1WOOA 3N28A 1YSJA 2GAGC 4OPKA 3CJ8A 4LF8F 5H9FJ 4HR2A 4F4KA 1U1OA 4RZRA 3QGGA 1M0SA 3RMDA 1ZA2B 2W1BA 5EN1A 4LBIA 2HNDA 2X6NA 3O9TA 3QAEA 2DBBA 4PG5A 1V5IB 5AQMA 1Q4RA 2XHWA 5BPNA 4IBNA 4AE5A 3SFGA 3QBCA 1UVKA 2MY8A 4ZLLA 2E7WA 3OW2R 4LF7K 2CJAA 3K0JA 2OPPB 3HHLA 2PAVA 1X5PA 2C1EB 4LIRA 4NXNF 1WI8A 2PIIA 4DUZK 2JWNA 5EWFA 4DN9A 1CC7A 4P7TA 1NLKL 3CC2N 3MPVA 2W4PA 3M6XA 1Q8LA 3EX7B 3SLCA 3WNHA 5I3UB 1G6BA 2Z2LA 4WFAQ 1IKVA 4FS1A 2A0FB 3KK1B 2VB6A 2B4VA 2XEXA 3V4MA 1ZBHA 3D5MA 3PYDA 2B4UA 4CEQA 3LUYA 1J2VA 3WNEA 4H4OA 2QIFA 3BDPA 1O8BA 1UWBB 4B08A 5LMUJ 3W64A 5IFMA 4B8CA 1SKSA 1ITGA 3UNGC 2BM0A 3MCOA 3O2IA 3AA9A 4NLBA 1OVQA 3ENAA 3LO3A 2YHWA 4IH7A 2L08A 4L72B 1NH7A 2ZZNA 3DXMA 1UWBA 2J8SA 3ASMA 3CCTA 4WF9L 2ASLA 3GMGA 1SUQA 1VC0A 4DZ6A 2ASJA 4C4WA 3ZT1A 4KIAA 1LK5A 2IC3B 1WSGA 2PEBA 4FF1A 2G0JA 3FKBA 1KVKA 2F40A 2LQ9A 4F0HA 4ED2A 1RT2B 5E0OA 3KLEB 1GNKA 4KGMA 1YJWN 4TY9A 3MEEA 4CYUB 3ZTQA 3MWPA 6FD1A 5JVHQ 2DHAA 1ZAWA 4YDUA 3J81U 1FTRA 1FO1A 2X1FA 1BWVA 1WSEA 3V4IB 4KV8A 3HKZD 5AZIA 2MZSA 4DL0C 1N33J 2V2KA 4LY7A 1WC5A 2L9NA 2NUUG 1DT9A 2MMYA 2ROEA 2KXFA 2XTJP 3NGUA 3DRXA 3P5JA 3ZZZA 2MQOA 2XRIA 3ONQA 3Q8PB 3ZLJA 3IWXA 2Y0BB 2MKIA 3I6PA 4LH4A 4MLEA 4RTFD 5KFFA 2WOMB 2AYBA 3AVCA 3V4IA 1U0HB 4FWKA 2J9CA 4V19S 4OYAA 1QHTA 4BRNA 3LAKA 4IOCL 4JKFA 2MSTA 3DYAB 9ATCB 1E4FT 2A41A 1YITN 2I38A 3DDNA 2PFFB 3BEXA 4NZ6A 2BKPA 3CUNA 4DCJB 1JLBA 4WTYA 3EE9A 3FDSA 2XC9A 3IAS9 1P1TA 3F44A 2H5IB 3GYGA 3FZ2A 4WFXA 3PJWA 1D1UA 4WJBA 4WU2A 4LRFA 4F02A 1EIYB 1IBKJ 2RVJA 2YNFA 3MM8B 2J76E 1WHWA 4JEPA 4IQXA 2RUGA 1AZSA 3ZZPA 5B0DA 2OZSA 2XNQA 2DIVA 1ZETA 2A1BA 2I9SA 1LW0B 5C5JA 3AHPA 4NLTA 5AT1B 4GW6A 4J2AA 3KMQA 2MEWA 1RBRA 3TAQA 3LQVA 1UAXA 2NREA 4KB1A 4MH8A 2MXYA 3TO8A 3CQXA 2QM1A 4YUDA 4CEOA 1NGIA 3SSQA 3UIQA 4FZYA 4B9SA 2V94A 5C2GA 4OX6A 3QNOA 2WBMA 3HHLC 4FDFA 3I56N 3M2VA 2HQFA 4K8RA 4WCEL 1FRLA 3CXCM 4DFPA 1PYOB 4IYQA 1U2RA 4C97A 4WFBL 3C6UA 3F73A 4YY3F 1FXLA 2P2CB 3E66A 1KCFA 3MF5A 2MLZA 5HOOA 1WOQA 2FJVA 4DV6J 2R7WA 1X4HA 2Y1RI 1ASVA 2EC0A 2ZGZA 1DHMA 3E2EA 2ZWHA 4UQGA 2CUYA 3CCES 1NSAA 2Q0RA 5K8MA 1D09B 4G65A 4USVA 1SL2A 1WSIA 2O8FA 5KG1A 2JEIA 1Q78A 4ANDA 3O1BA 4HTIA 1PC4A 2VG6A 3RJMB 4V1Ak 3AGKA 3PW7A 4FM2A 2QKKA 1T9WA 1HW8A 1RAGB 5JS2A 2FLNA 1VQ6S 3ENVA 4F26A 1CEZA 2P9IA 4DTPA 1RA6A 3CB4A 4DG1A 3UDCA 4KHPK 1YF5L 2YTCA 4RW4A 3VAKA 3FRYA 3UCUP 3CMAS 1IBMJ 4CLSA 3HJFA 4BLGA 4CM0A 1IKYB 3G6YA 1FA0A 1KD1O 1S57A 2GGPA 2FF3B 1T8EA 4AILC 4JI7K 1VK3A 1MU2B 3RMAA 2EG2A 5AQVA 4W98A 4UOHA 1WKJA 3SQGB 1N34F 4KTZA 1U1NA 1Z2LA 4H4KC 3AVMA 3IGVA 1MMLA 3HT3A 4M5KA 4TY8A 4DQRA 2DY4A 4OX9F 4A8OA 2CDRB 1IJJA 4BG9A 3HVAA 2OO4A 4YHHK 4WK1A 1NGCA 1HPZA 1NOYA 1FJCA 3SCKE 3P1GA 2XGPA 4QIEA 1GLFO 3KLIB 2AGPA 3M05A 3AA8A 5HL7Q 1M5PC 4ZPCA 3O8WA 4UF4A 1VISA 2R7TA 1HKBA 2VWKA 1KTVA 4DV1F 2QKBA 3E1YA 4NLVA 4JI4J 4FYWB 4QR1A 4J9MA 4ZN1A 2EX3A 4ZP9A 1B4SA 3SUPA 2ZITA 5HRPA 3QFWA 4UTGA 4NLYA 4CK1A 2M0GB 2GC8A 3J81O 3OTBA 1PGZA 2WVBA 3ZX0A 2OD4A 4X65K 4RW6B 2BV3A 2R42A 2FJEB 1FKAF 4XPCA 4QS9A 2J0QD 2XM3A 1EP4B 1SKWA 3EXCX 3W62A 1IR2A 2OFHX 1SC4B 2AYEA 2FVPA 2OELA 1LW2A 5FPEA 1HNIA 1OMSA 2RPIA 1ATSA 3NOCA 2JHEA 1NRKA 4JKGB 2WTUA 4IJNA 4MKYA 1PILA 4FCYA 3UD5A 1N8RO 3ZETA 4LF9K 2V52B 1KTQA 3GG1A 1NKCA 2ZZMA 4J9RA 1YQHA 3UE5A 3FQKA 2VF3A 3GLJA 3NL0A 4FJJA 4O5FA 1KWMA 2D0BA 1NK8A 2ZUAA 2N7CA 3E9PA 1S0NA 3OYKA 4A48A 4LFBJ 4KGZB 4FNIA 1B0VA 2B9YA 3OR2B 1H38A 1RWMB 2CJ9A 3SAFA 2W2NP 2R8IA 4MYTA 2E5HA 3MMCB 3NLCA 1T05A 5EVZA 3SQGA 3HVTA 4PXDA 3WIUA 2AU0A 2KJWA 6AT1B 1YJNN 3EWGA 3UWTA 1HFEL 4NEZA 2YH0A 4JKAA 1T9XA 3P83D 1R8PA 2WB4A 4PYDA 4FZZA 3M2UB 2XMTA 3EGWB 4BCAA 3K58A 4ZPAA 1NHKL 3L8BA 2WBRA 1OJ4A 3O5TB 4GKKF 3QWPA 2UUBJ 4LF9J 3ILLA 1F2HA 3H08A 4QWEA 2OSRA 4F4WA 5HBMB 5LMUK 4IUFA 1U26A 1WTFA 2CJKA 1U1MA 5CD4H 4GVEA 2O66A 1Y9OA 1DLOB 1NK0A 2GUIA 2LSNA 1GXLA 2DISA 1WF0A 1QE1B 3U7JA 4NWBA 2H9ZA 4DI6A 4FM1A 3AVHA 1PAEX 4DU3A 1K1QA 3MR5A 4IKFA 3L9ZA 3NG8A 3DI6B 2UXCF 4DPXA 4HWIA 4ITSA 2HVDA 1EX4A 1HNXF 3VQSA 1WDDA 2JNJA 2UV8G 2Y0SD 2ZJQQ 3MR7A 2P51A 3LA0A 3JYTB 1IWAA 4M3UA 4HKQA 4ILGB 4MT1A 1JLQA 2HGNA 2N3LA 4IOBA 1Y0HA 3PR4A 2FHJA 2AP6A 5D4PA 4YORA 1S7HA 1CZBA 1S59A 5D3GB 2B5JB 2QW9A 4CIGA 5AQQA 5M1NA 5ETKA 4D3GA 1ATNA 4DTJA 3M8SA 4M5DA 4JV5F 1HYZA 2IFXA 5AE2A 4CFCA 1UEVA 4XIUA 1Q82O 3PLAA 2BRKA 5A2QU 5ETOA 3BGFA 4JI6K 3VQPA 3BBCA 2AT1B 2MJUA 3WC0A 1NMEB 4JD2A 4FK0A 3C6UB 1F9EB 4PWWA 1UPMB 1VK8A 3QSIA 1GTHA 2DHXA 4RNHA 1N5VA 2W2OP 1XR7A 4I56A 2HK2A 4DFJA 3EPGA 2AYGA 5IWAJ 2CADA 4QCLA 2BUNA 3WUHA 3CIMA 1VQLN 4HACA 4JI6J 3THPA 2HHQA 1I94F 1BY9A 1VSMA 2VHGA 4BROA 3UD3P 1E3MA 2GHWA 3JB9k 1XMOF 2V51B 1YX2A 1U02A 5FJ4A 2OEJA 4KPYA 3N6NA 4K5SA 1TKXA 2AJ0A 2G8KA 4F67A 3BYPA 1NBWA 3HOTA 3M32B 3AVIA 3NWRA 4A47A 2D0AA 3WDOA 3T1YF 1RHRB 1JCFA 5FLXY 4RBUA 3G71N 2KRBA 2IDEA 3QBXA 4OJ3A 4BC9A 1YLXA 5CYMA 3VGTA 2NUBA 3IR7B 3SUOA 4Q2LA 3FUYA 1WHXA 3CCJS 3A0IX 2M8HA 4J2EA 3M8QB 4C9DA 1WG1A 2OMLA 2K2PA 2RNEA 2YWHA 3L6QA 3PKYA 4K42A 4CBXA 2E66A 3QLHB 3M9NB 3UKRB 2KLAA 3MAQA 3VEZA 4H03B 4TVAB 4FOEA 4M95A 3MFHA 2O8DA 4BDYA 2YWFA 4M63A 1OY6A 3T1HJ 3MPWA 3OV7A 2FY1A 3S41A 2NS1B 3DCAA 3AAQA 1DTTB 2J7UA 4QIWD 3BZQA 2VBYA 4DMZA 2AX1A 3OTOJ 2MTLA 2UZAA 4IRCA 2QWRA 3VN5A 2QJ3A 4RU2A 3THWB 2P5OA 4O4GB 2UUAK 4N47A 3QERA 1QY7A 1VSEA 3VEWA 2H4YB 1L3KA 4JD2B 2EPIA 2LMIA 4KFBA 2NXNA 1YT3A 3T9NA 3HX9A 3KOAA 2HAIA 2IHR1 3NY0A 2ALYB 4AF1A 3KWMA 2XWXA 3K2YA 1JNZB 1VQ4N 4MYUA 1XJWB 4NA2A 3DKDA 4DS5A 3I8BA 3DRSA 3O6WA 1S1WA 3L7UA 1K0VA 4MJKA 1Y5LB 3HDSA 3M3ZA 1YI2S 3ILOA 2AZ1A 2OPPA 3KHHA 4CFDA 4X4PA 2J7WA 2VG5A 3D66A 4ED8A 3R1XA 1J5OB 1Q53A 3OYGA 3T19A 2O67A 2FTRA 1R0BG 3J7ZT 4RUCA 1PJ7A 2OPSB 1X4DA 4YB6A 5B0BA 5FPDA 2ZH6A 2FHKA 4RG8A 4C8KA 1HLWA 3IR6B 1XNRK 1UVJA 2AP1A 3PX0A 3D2FA 1TL1B 4ZP6A 1YBTA 1HKGA 5ETLA 2QWLA 2ZD1B 1ESVA 3G4SN 2J9DA 2C2NA 3C14B 1LXJA 1UFWA 1EETB 2XMJA 3AT1B 1YZ7A 2B56A 4CO4A 3OL7A 4GKJK 2UVUA 4XDCA 5TKWA 2OCEA 1IG8A 3KK2B 3J8AA 2I8EA 2B9WA 4IRKA 4ZVOB 4N41A 2CQ0A 3EYZA 1G4CA 4CO0A 3FCHA 2A18A 1LOUA 4AHRA 5JMVA 3PJXA 2F1FA 4OJ1A 2QFJA 1UCNA 2PDAA 4BBYA 2RSQA 3OSNA 3SIPB 4P2XA 3KLHA 1TK0A 2CQGA 1ICEB 2VH7A 4DSEA 3TRGA 2C2ZB 1N33K 2HVIA 2RDDA 4ECQA 2YKAA 3N0VA 4B1YB 5FPMA 3GILA 2YHYA 1HARA 1F2GA 3WC2A 1MN7A 1HQ2A 1SJRA 3THWA 3EUNA 3S3OA 1YJ7A 4ES1A 3R5CA 3IAYA 3W5XA 1WAJA 5DM6Q 1U1RA 1VIXA 3K7RA 3R2DJ 3N01A 4IR1A 5CCMA 3BSCA 1JLGA 2LLZA 5L8RC 2DB1A 3C3LA 3OXGA 2J0XA 2IDOA 4JKDA 2F65A 4FF3A 1RBOB 2G2OA 1RGIA 4OVLA 1RYSA 1BQNA 5LM7E 4DR6K 3BGOP 4YB7A 4B3TK 4LF4F 3C66A 3TX0A 2ATLA 1S79A 5DQGA 4OI0A 1REVB 2VQEK 1VQYA 1RTHB 1YTAA 1KSPA 3T6JA 2KI2A 1Q9XA 3BO4A 4CFAA 4P7VA 1UA1A 3HFZB 4DTRA 4HT7A 3A8IA 4CI6A 5G4DA 4DWIA 1K8KB 1XEZA 5JS1A 2A40A 3CCEN 1SQGA 2CQPA 3T6BA 3A8YA 1FVSA 2W24A 2JLGA 4BREA 4Z7CA 5JICA 1KVBA 2BKNA 2HHPA 3HRGA 1WF2A 2GJ2A 1IKWA 4JOUA 2L3MA 2GHVC 4LRCA 1UFKA 1FJGF 2YVSA 2VA2A 3GJSB 4FJIA 3ZT3A 4TYAA 3NHGA 5IC4B 5BPLA 2I5JA 2E88A 3CCSS 2UXBF 1YUWA 3I56S 1K8AT 1VQ7N 2RKIB 5KFNA 4EP5A 1S1XB 2DR6A 2PSZA 3CD5A 2F8HA 4WYLA 2Z1JA 2ZJRQ 1RABB 1RCOB 3R9PA 1TV6B 1ZM4A 4M3WA 2L9DA 1RT1B 3ZSVA 4M3YA 2MZ1A 2X3DA 3SBGA 4NYFA 4HCBA 2YKNB 5EX0A 3AOBA 1X4FA 4CLWA 3O9QA 3HK2A 2FC8A 5ADXA 2V8HA 4CLTA 4CJRA 1N5SA 4I6WA 3BGUA 1MA9B 2VQFF 1XNRF 5IT4A 1NH8A 3CERA 2W25A 2KXHA 2VJUA 4NRTA 2OFGX 3P96A 2W9CB 2BE7D 2AV5A 4KGVB 4CEEA 2E2PA 3U27A 4KHSA 1U0HA 2F9TA 4UW2A 3S7RA 1O6XA 3TAGA 1BCOA 4RNFA 2ALZA 4FWPA 4M5MA 2BW2A 1RT6A 3V6DB 5FRMA 4USUA 1N36K 4R79A 3MFIA 3D0IE 3R5BA 3SNNA 1WOSA 4KTWA 3LP0A 1IV0A 3TANA 2IIHA 1R89A 4JV2A 5FRNA 2ZBRA 1EXQA 5IWAF 3UNYA 3PR5B 3TZXA 1VSIA 5IV4A 4JYAF 3W1YC 2IMOA 2C3YA 4H0YB 1YJVA 4JK7A 1KKHA 3LPEA 5E41A 2DRAA 2FJXA 4G1IA 4MKAA 1FNMA 3MEGA 3I0SB 1KEKA 1Z1ZA 3LWMA 2LCWA 3AB2B 1Q1KA 2HQ3A 4ED6A 3AVJA 5SZTA 4OX9J 5AR0A 3L4BC 4JI1K 4LFCK 1EQMA 4LD0A 3J7A1 4F9OA 1ZBTA 2YPZA 2AWZA 1XR6A 4B3MJ 1S99A 3TARA 3U02A 1F6TA 5HO4A 1A5VA 1KONA 2GCFA 4FF4A 4QAGA 4CHOA 4E1MA 1WN7A 2KTQA 4IH6A 3VERA 2NPFA 3N4WA 2QLXA 2XG8A 4OHVA 3OTOK 1U45A 1UAWA 2JVOA 5HP1B 4RPFA 1JXEA 2HF4A 4C8MA 5AQTA 3ZTSA 2G1HA 3Q8UA 3J7Z5 4DPWA 1S1XA 3SI6A 4KHPF 1VQ7S 3B4MA 2VWJA 3PJ9A 2CQDA 1CZ9A 3CCSN 3QRPA 4HLBA 1S48A 3C65A 2Q1LA 3OT9A 1GH8A 4DEZA 1IKXB 2Y8WA 2OAUA 3KLFA 2CQCA 1XC9A 3R3LA 3E3XA 4FXVA 2CPEA 3T9ZA 5F9NA 1NJIT 3OTOF 4JS5A 2PI5A 2WZ1A 4KKOB 4DCPB 4BE1A 2ZHAA 2HQDA 3PIPQ 1GXTA 3THYA 2P9UB 1VJQA 3OXLA 4EIAA 4DR1J 1VQOS 3C19A 1RBLA 4ZCKA 2NCKL 5KFZA 2J6TA 2YX1A 4KHQA 3TW0A 4OZ3A 4C6AA 4CJVA 4K0KJ 3MR6A 3KNAA 3BS9A 3JTPA 4LC9B 4NLUA 2O4IA 2DGTA 3ILJA 3OJUA 1JXVA 1XHZA 2CG8A 3OFEA 3H46O 2L48A 4QIGA 3RRHA 1NK5A 2F63A 1X3NA 4A8QA 2ZJPQ 5KGWA 4IQMA 5JMNA 2NUHA 2IIRA 5IC6B 3VAIA 3KK3B 2IRXA 3HD1A 3SQ1A 3MEEB 5KPTA 1LNQA 1RTZA 2H51B 1YBUA 4F2RA 3O4NA 4E98A 3WT0A 1TAQA 2GW8A 3QESA 2UU9F 2DNNA 3H5SA 3W9JA 3BN4A 1RAIB 2E5LJ 3KLGA 1KAYA 1FRKA 1GT8A 4PHTX 3LDOA 4CZCA 4FLYA 4DV5K 2VZ9A 1N32K 2W9BA 2MHNA 2RB7A 4TXSA 1K9MT 2KH9A 3WZ0A 2Y8YA 4DZDA 4JKEA 1SC3B 3GP9A 2WUSA 3R2CJ 3RRGA 3L2UA 2HGLA 3ZSRA 1D4XA 2V7YA 1EQ0A 2D3ZA 2WOMA 2VC1A 4CF1A 4QYRA 5D8HB 3A5NC 4MO4A 4OLBA 1WSVA 1S1UB 4ZP8A 2E2NA 3NCIA 1ZAXA 3CJ2A 5L46A 1CQMA 4E7JA 4E7KA 3VVUA 2HW3A 4FK4A 3JTNA 1IJFB 2RRBA 3MECB 2O8CB 3GCXP 3P4UB 1TYQB 4OI4A 1YGYA 4JHDB 5M1QA 5HJXA 4YR3A 2HFVA 1PBAA 2MYFA 4ZN3A 2RDJA 1YRTA 2D0OA 5DM6L 1C0TA 3F9KA 2JC1A 2G8WA 3W2VA 3MEDB 3MM8A 3VZIA 4EMDA 3NF8A 3MMVA 1SXLA 1WORA 4KSEB 1H6KX 4NXMF 5DETA 3PTWA 4MK7A 2WTFA 1WSJA 4F3MA 4KYZA 3OYAA 3RB3A 1N33F 2DVIA 3VPZA 1Y4ZB 4ZHRA 4WQ5C 1X4AA 2RU3A 4O4RA 4N76A 3OUYA 1CLFA 3VA0A 3H0PA 4CO1A 2E9ZA 3F2KA 5CABA 3W2VB 3GIIA 3MUTP 2P9SA 2QWNA 4CH1A 3KD5E 3KWGA 4PUOA 5IQQA 4ECZA 4H5WA 3BV8A 1V4TA 3HOSA 4PZVA 2UVVA 3K9JA 3KNGA 4LBHA 3C6AA 1SV5B 1VQ4S 1I5OB 1FWPA 4M5IA 1IJEB 3BPDA 2X51A 2XY8A 3K17A 4UUXA 5T7LA 1NGJA 3H3OB 4IJAA 2R2RA 4GO5X 5AQOA 1VRTB 2R2UA 1TFWA 4JI7F 4ILJA 1IUJA 4LF2A 2GJIA 3D6TB 2BXJA 5AQRA 4DCOB 3KD1E 4PQUA 2MZJA 1RE1B 1DJ0A 4ECVA 2OKQA 2AIRB 2FLLA 3TJ8A 1W2BR 4M41A 4IFYA 2FSJA 1WKLA 1Y10A 3H3NO 3SQ0A 4KI6A 3OXFA 3B6OA 2V2ZA 4QBUA 2E44A 2VQFJ 2WONA 2V68A 1RXOB 4FF2A 3IMXA 2VG7A 1S5ZA 2GIRA 1BO5O 1Q86T 2NRVA 5FLXU 3DHXA 2X6SA 1NNDA 4C0BA 2D7SA 1KN6A 5SUHA 1CJKB 3L3CA 2ACMA 3D2EA 1FI4A 3A3OB 1HNWF 2PMHA 1BQXA 3W2WB 3OYBA 4IDKA 2CDQA 2KKHA 3VOVA 4BR2A 1F5AA 3BF1A 3PHTA 4Z0UA 3B4DA 2V9WA 1ULRA 3H4DA 3UE2A 4P72A 2J7KA 4U67Q 2YX6A 4JHDA 2W6KA 1LCUA 2KJVA 1AT1B 3OTDA 2R8HA 1MN9A 2E1CA 5LJVA 3CMEN 4C8NA 5E84A 3W0LA 2EW9A 4V19J 3CJ7A 2F8EX 3AOAA 2UXDF 2LA6A 2QMXA 1X4GA 5LL6d 2WVEA 4PKIA 1SZ2A 1EWQA 1Q8KA 4DV3K 1OH5A 2BACA 4KH4A 5C10A 5GMKa 4K4ZA 3PCOB 4JI4K 3JXOA 4OYMA 2EI5A 4LFAF 5A2QY 4A2AA 2DFFA 3I33A 3MPUB 4J9OA 1S6OA 2HEKA 2OPRA 4CJFA 3BKUA 1TUYA 3N6LA 3OYMA 3MMJA 4G9ZA 2LQ5A 4DU7A 2VFSA 4Y28C 1VBXA 1OH8A 1YJUA 2CQHA 3OYEA 4CJQA 2M9KA 3VQ4A 4LVOP 4YHHJ 4FLUA 5M1PA 4FLTA 3B78A 4QU6A 2YNIB 1KAZA 4O0JA 2CZ4A 2VIHA 1HNXJ 1NOZA 1EAYC 1VQON 2YV0X 1D9FA 4FBUA 2ZH1A 4AFFA 4KFBB 5IM0A 3GV8B 3UVJB 1PJ5A 3IAM9 2WK4A 3KHGA 2DFEA 3LL3A 3PO5A 2ZWPA 1PCAA 1GTEA 5HVFA 2WONB 1J27A 5KFBA 2XMAA 3UN5A 2BOAA 4BRKA 5BPMA 2JC0A 1XN9A 3BJYA 4DV4J 2BE2A 4WYWA 5CZ2A 4LJMA 1JLFA 1D3WA 4TKTA 3QINA 1J53A 1S9EA 1UKUA 4RBVA 4USIA 4DV1K 3B54A 4YN3B 1B7YB 4KHPJ 2RAQA 1U6ZA 2JEFA 5D78A 4I2QA 4JV5J 2HIYA 1QAIA 1TK5A 4ATNA 2DH8A 5AE1A 1HWKA 1V5VA 4W5QA 4PCQA 2R4FA 3VQTA 1JLCA 2UV8A 2Q79A 2GMHA 4BRFA 3C6TB 4DTXA 4F4ZA 5ETRA 3G2XA 4YY3J 4JI3K 1VAZA 4ZVFA 4L6V3 3DMJA 3N4QA 3H6EA 5L1KA 4DU8A 1QAXA 2BJ1A 3DLRA 2CWKA 3C94A 2OD6A 1CLQA 5CCLA 4LQ9A 3IUCA 1JIHA 2Q6BA 4JYAJ 5K14B 4BWJA 1MWYA 3VCDA 3UKRA 1TKZB 2LU1A 3RGIA 3V6KA 3CXCR 1S0MA 1NGAA 2H5EA 2JSXA 2DRDA 1IVZA 5ADXH 3F56A 3TSPA 1R3NA 4NMXA 4LF5J 5IOLA 1U0SA 2H3EB 3UB5A 1YTYA 4E89A 4OLPA 5MLCV 4A4JA 4IFVB 2DR5A 4URQU 1GOAA 4R5PA 3I82A 3PO4A 1VYAA 4OYWA 4RNOA 2MKCA 4NASA 3HSGA 1SB6A 3FZFA 1ZZFA 2FBTA 2DXDA 3O1LA 1PJ6A 2ETJA 3RBXA 3KXDA 3NEKA 4B3SJ 3NGKA 3QJJA 1BHNA 4XK8C 1U1KA 4IG3B 2A42A 3P4IA 3M4XA 4O3RA 3A5OC 2PD1A 3NF6A 1WC0A 4CESA 5T14A 1N88A 1E6VB 3ZZ0A 2B4OA 1RBVA 4EHUA 3IS9B 2CVEA 4YR2A 4CZFA 1UJ6A 4ZVHA 1BDGA 1JL1A 3NH1A 1N0UA 1WHVA 3K59A 1RHMB 3H20A 3TTDA 1REVA 5ADZA 2DGWA 4AD6A 3C2PA 2E8AA 2F8MA 5B0AA 4ZLNA 3GIKA 1LWCA 1K6YA 2YWKA 4E3SA 3L4QA 4CNZA 2QL7B 3AQPA 1SS6A 2ZNZA 2PZSA 1EETA 5BR8K 4KQZA 5B09A 4YR0A 5ETNA 4Y2CA 4DV5J 1N32J 3CJKB 3QT8A 2CPJA 3J7AN 2WVFA 4BRLA 1GLBG 4Q7AA 4X62J 4ETZA 4MK8A 3CQYA 4OHWA 4YDUC 2JLEA 3DOLB 3AO2A 1PBUA 4G1PA 3CCZA 1BI4B 3HMJG 2ITGA 5BYRA 4ALZA 4I68A 4FZXC 3BPSP 1TKZA 3DN9A 1FTCA 2XMUA 1HJOA 3KLHB 1B9FA 1URRA 4P6QA 4P2SA 3PIOL 2QA4G 1D9DA 4PQUB 4DX6A 4IFEA 2FB0A 3LDSA 1U24A 2VQEF 3CC4N 1W9HA 3CDEA 3GU0A 4W90B 2QL5B 4RW9A 3Q22A 1FKPA 4DQIA 1AUSL 2VFUA 2XYHB 4CJWA 2DH9A 2HQGA 3A3PB 2XLIA 1PSDA 4F3TA 4NCBA 2RRNA 2P9GA 2E5LK 1ZS6A 5LXRA 3V5RA 4ELTA 1BMQB 4KHMA 2M2BA 1CJKA 3OS2A 4IEIA 2BVZA 3SMPA 4C0HA 4CZHA 3GL1A 3OYHA 3MD3A 3FQLA 1MW7A 4ZVPB 1V3ZA 1W7AA 4P71A 4X4UA 4MIBA 4OYBA 3IBWA 4ECRA 5J2QB 4CBUA 5JVGQ 4P74A 4PG8A 2ZH2A 5J2MB 4IDHA 4DHVA 2DNGA 3HCXA 4RNNA 2AJ2A 1JXLA 3CJTA 1XR5A 3CMAN 3E9LA 4ID8A 1YTUA 2WRMA 4BVOA 3ZZOA 4TU8A 1NGBA 2HVHA 3NGDA 4RR5A 4CH0S 3DOKB 3PYEA 2FIUA 1U6BA 4YQWA 2V4QA 2QYCA 2G1DA 5DRKA 3ZZUA 2WW4A 3VAHA 4P2MA 2JL9A 4UY85 4HHJA 4BC5A 4IWVA 4FJMA 1FWKA 4I0WA 3KKSA 3HSJA 1K1SA 3NCRA 3CC4S 4AL5A 4EZ9A 1HNZF 2VPZB 3P38A 4B1ZA 4R8UB 2NRZA 2IPOB 1YK9A 1OH7A 4X4TA 1C2PA 2ABYA 4YFUA 5DGAA 4B9LA 1E6YB 4KO0A 3TTCA 3G10A 2CWXA 2R8GA 4GV9A 2P8IA 4ZLPA 1JJCB 3NMUA 2ZDPA 1R0AB 3WXIA 2ZH8A 4R0EA 5I3QA 3UQSA 3UCZP 4FJNA 2CPXA 2JWKA 4FWRA 4I2PA 4DUYJ 1WSFA 1R43A 4KAIA 3OS0A 1HI1A 1PG5B 1FE4A 3EVOA 3IM8A 2D9OA 4DS4A 4O3OA 5IT9O 4ID5B 1MNEA 4X4VA 3OHRA 4PKDB 5HQMA 4PG7A 1FDDA 3PEHA 3VAFA 2FDNA 2XY7A 1ZAVA 1ACMB 2RIJA 1RAJA 4JV0A 4JI1F 2AGQA 2CNNB 1BE4A 4U7CA 3K5MA 2QTDA 4DR1F 2RQ4A 3EDQB 4JI4F 3KLFB 4DR3F 2CYYA 2D5RA 4J8FA 2H5JB 2XMMA 4J9LA 2KYXA 3OL8A 3V9UA 2UXBK 2ZOGA 3DXMB 2IVOA 4B9TA 1EHWA 1RLCL 2VPYB 4AUKA 4LT6A 1RAHB 3SCIE 1SUQB 5DS7A 4UUWA 4QWAA 4JS4A 4FJGA 3C14A 4B3RJ 1G3OA 1OQ3A 4XO0A 4DV0K 4JK8A 4NLCA 3PXGa 5KFIA 4RO0A 3M8WA 2CGJA 3N5BA 2H1YA 2HK3A 4HH1A 1UPPA 1F60B 1FK9B 4YOEA 3TX8A 4CJKA 2A1RA 3O9SA 2KXNB 3D2WA 4FW1A 3ZSZA 1D8YA 2WCXA 4XH4A 2W2QP 2Y1JA 2YX4A 3IRXA 5CYMB 4ZPWR 2UU9J 4M5HA 5M2PA 3QB0A 2FF6A 3D45A 4ZPBA 1RCHA 1LV5A 3BY5A 5F8JA 1AFJA 4USHA 2Q43A 4FJKA 3KJVB 2AEFA 1WKKA 5EU7A 5EX3A 4LF5F 2IRUA 3Q8SB 3BGRA 4RL1A 2Q1NA 3TAFA 1SH0A 2XNRA 5DDOC 2PN6A 1S1VB 3G71S 1X8DA 3HO1A 1BUXA 3LTOA 4XTTA 4TNOA 1YJWS 2XS7A 3RB0A 1MWMA 5KFPA 1KQGB 3CYMA 3CF5Q 1OY8A 1X1PA 2Z2ZA 1H3DA 3BSNA 4C8LA 4O4GA 3SSSA 1IBLJ 1UFLA 5AE3A 1QSLA 4UQTA 4MLHA 2RE2A 2ZH3A 1LK7A 1QZ5A 4I1TA 4HTUA 3DXKB 4LUBA 1X9JA 4KKOA 1FEEA 3SPYA 1UZDA 1L5UA 2AZ3A 1CG2A 4Y00A 3LP1B 1MSWD 1FESA 3J7YU 4DUYF 4JLHA 2CFXA 4IRDA 2CQ1A 3BYRA 4X64F 3Q7BA 3V81B 3D0PA 3EN9A 4B3TJ 1CVJA 4EHTA 1GLLO 4WP3A 2VOPA 2U1AA 2BJ9A 4BE2A 2HVZA 3BGLA 3VMFB 1CULB 2LDIA 3TAPA 1TYQA 3KK1A 5AJ3J 2W9AA 4CGHA 2MGZB 4QIFA 4JV1A 3CIPA 4CZJA 4F4AA 5A76A 2V0NA 3AQOA 3WX4A 3L7OA 2NNWA 2G0IA 3QIOA 4BHQA 4DBQA 2BA9A 1FNOA 3G82B 3EKUA 1F1BB 2PEHA 3ZZRA 2Q97A 1WEYA 3NS7B 1DQ9A 3L3VA 3CO9A 1GEHA 1T03B 1NJZA 1HHSA 1J5EF 4LF6K 2HF3A 3I31A 3PRDA 1N34J 2GZOA 2M70A 3DLEB 3CC2S 5HRNA 3A8EA 3K5LA 3D2FB 4OYZA 4C1NK 3KFWX 4X4RA 4HHHA 4LVNP 2QTWA 2OPQA 3S01A 4FXDA 1QDUB 3DAWA 3ZSYA 1O13A 1HD1A 3I0RB 5D77A 3SMSA 5HLFA 4LRBA 4U7UD 3QEIA 3BUZB 1VJWA 2MJNA 7FD1A 5DLGA 2V4RA 4XEIA 1QVFR 1HNZK 4CT8A 2R2SA 2D41A 2E7XA 1LOTB 1D9AA 3AVFA 4DV1J 3KMSA 2A5XA 1J54A 1DZ5A 1U1LA 3MM6A 1IXKA 1KHVA 3A3NB 4CJ4A 4MTPA 2DCLA 2VODA 4DTOA 1FXXA 3RR8A 5GMDA 5BR8F 3IN5A 4B17A 2HHSA 4LF8K 3MEKA 3SJHA 5IXUA 2D0PA 5L9XA 2FC0A 3CMES 3I55N 4RW8B 3PFEA 2JEGA 4X84A 4F0KA 4UOFA 2F8TA 2WC9A 4RBTA 1UMJA 2XQCA 1ZBFA 3SDEB 2UYTA 3UW1A 1UVNA 1NU0A 3A2FA 2P9LB 4WIQA 5EGYA 4PPDA 4I9QA 3MDFA 3U9DA 3SI8A 1LWEA 1YKWA 1Z2ZA 3CDUA 4BRAA 2D69A 4K4XA 3IWNC 2CQ2A 3FZHA 1BUPA 1RU1A 3NNCA 1V9OA 5CYQA 2KHOA 2YX7A 3KG4A 1O51A 2BM1A 2JJ4D 2WVDA 4RX6A 3PUFA 3H2VE 4FSVA 2JH3A 4BC7A 4URSA 4ZS6A 1A5XA 2F9JA 3VEOA 3W61A 2QK9A 2CQBA 4PUOB 1KQKA 5LSRA 3ITHA 3JSMA 4EBEA 2XULA 3G82A 2Q3PA 2CJXB 1L3TA 4JN4A 4FJXA 4QYZK 3FFIA 1T3OA 1FWLA 2XYGB 2KFYA 3QIPA 2ZEJA 3KG0A 4JB8B 5DDQC 1DURA 1QVFM 2GBZA 3HZEA 3RBDA 2W7AA 3L2QA 2P9EA 2QFIA 3LZIA 3OHBA 5HRRA 5KT6A 1VSDA 1SI9A 4I4BA 1TU0B 3EO3A 2M7SA 1SQKA 3ZSXA 3KUGA 3IA0A 3LM2A 1VS3A 5HL7L 2F3JA 1VRQC 2CGKA 2QC3A 3TZYA 1GAOA 3T1HF 5CZXA 4HI2A 1WG4A 1XBWA 2DHGA 2KT3A 2RT3A 1AW0A 5M1KA 1X60A 3HP9A 1RISA 2VKZG 4CK2A 5U47A 3U8XA 2XO7A 4EZ6A 1DTQB 3OVSA 3GE1A 3UVJA 3D1QA 5K8OA 1HNXK 2HNZB 1RT2A 4U96A 3PNIA 1UOCA 4CFBA 1A7GE 4Y0FA 3V1QA 3VALA 4LFBK 2HZVA 4B9VA 1SQEA 4FOIA 3H90A 4JK9A 2KN4A 4ZCLA 2UXBJ 2NXEA 3FBBA 2FZKB 1WD6A 3O3FA 3HVTB 1RAFB 1JKHA