1LW2A

Crystal structure of t215y mutant hiv-1 reverse transcriptase in complex with 1051u91
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
539
structure length
518
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFARKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLYTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of Zidovudine- or Lamivudine-resistant human immunodeficiency virus type 1 reverse transcriptases containing mutations at codons 41, 184, and 215.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
total genus 141
structure length 518
sequence length 539
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2002-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1lw2A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lw2A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lw2A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lw2A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1lw2A05
1WSEA 3QEXA 1LW2B 4Y2AA 3V1RA 1KVBA 3V4IB 1RT7B 1WSJA 3LPUA 4CK3A 4OPKA 3BSCA 1LWEA 3PJWA 4K8ZA 1RT7A 3OL7A 1VK0A 1NK0A 3MEDA 3GV7B 3G0ZA 4FLXA 4KPYA 2GC8A 3OY9A 5L1LA 1W25A 4CJTA 2AU0A 2G8KA 1S6QB 1ZBHA 2GUIA 2IM0A 4JV2A 1LAWA 4B9TA 3VQAA 3TANA 1SV5B 4ZPDA 3KD5E 2X6NA 4NLWA 3CFRA 5HROB 2KQ2A 4CJUA 1LWFB 3CM5A 1NNDA 4CF2A 3MFIA 2WK4A 3QO9B 3HPHA 1YT3A 1UAXA 1U45A 3V81A 5KT4A 1Z26A 4RW8B 4FXDA 3DYAB 4AHVA 4YMEA 2FLNA 4CIFA 3OYCA 4IFVA 4FJIA 1RT6A 3PVXA 3DLRA 3MEDB 4WXWA 4KB0A 1RBUA 4FS2A 1BI4A 1N56A 3H59A 2GIQA 3H5SA 2HW3A 3IN5A 1S1VB 4TQSA 2Q3SA 3C94A 3KLHB 4CJLA 1QSYA 2FVQA 3OLBA 1RTHA 4KKOB 3S9HA 4NLSA 5SWMA 2PY5A 4F50A 4RU9A 3BDPA 3ITHA 2FC0A 2XY8A 4E7IA 3CJ0A 3HP9A 4JS4A 2E9RX 4KRFA 2HNDB 1TAQA 1S0OA 1D5AA 2CJQA 2O4GA 5DQIA 4B9LA 5L9XA 4K4ZA 1NK4A 5L1IA 4F4XA 1S1TA 3SCXA 4FJJA 4O4GA 3BGRB 3KLFB 3SQ2A 4M3UA 3LZIA 4FJ8A 4FM2A 1XI1A 3ASMA 1IKXB 4G1QA 4GC7A 1RTHB 4KKOA 4NYZA 1TL3A 2XC9A 3TAFA 1RDCA 2BANA 1BI4B 4FLZA 4TY9A 1YTAA 4DTPA 1RBVA 4FM1A 4DTOA 5EWGA 1N6QB 5KFPA 3T5KA 1BGXT 2JEJA 4M45A 1DLOA 1ZTTA 1K1SA 2DY4A 4MFBA 3CJ2A 4F2RA 5KFSA 4CJRA 1T03B 1D1UA 3I5AA 4CEOA 1NKEA 3AA4A 4YR2A 1UOCA 3DOKB 3OYLA 4FLVA 3HSTB 2V4QA 3AO5A 3O3FA 1JKHA 4BWJA 3SQ4A 4ZVGA 3KHRA 4K4SA 3JYTA 2C2DA 4CE9A 5DLGA 2IMWP 3C95A 1KLNA 3WNFA 3SQ0A 4OLBA 1J5OA 2IOCA 2O5DA 4Y2CA 4EYIB 4N76A 3OYEA 3H08A 3L2VA 3C6TA 1KHVA 3DMJB 1HQEB 2IAJA 1JLGA 2B43A 4JRPA 3KLEA 4RW7A 4JV1A 4M95A 5KG7A 4J2BA 1U09A 4KREA 4DQSA 4B3OB 1CSJA 4H8KA 1N5YA 3ULDA 4LSNB 4Q0BA 5EU7A 2UUTA 2KZZA 2ZQBA 4M3WA 3AVNA 3C6UA 1QQCA 2HVIA 3PR5B 3NBPA 1IKWB 4AHSA 5DLFA 1S9GB 1ZBFA 4CFDA 4TYBA 2DFHA 2C28A 3NGIA 4FZXC 3OYBA 4FLTA 5CYQB 2OZSA 4DF4A 3BR9A 3OS0A 5I3UB 2BDPA 3IS9A 1HNIB 2EC0A 2R2UA 4L8RB 1S1UB 5KFXA 3F9KA 5JS2A 3UDLA 5KFBA 4NCGB 4I2PA 2IDOA 3OYMA 4MH8A 4ECZA 2BRLA 1G15A 3HVRA 4KHSA 3ZT2A 4E7JA 3RB0A 3HXMA 4KI6A 3H40A 4EBEA 2ETJA 4TLRA 3CO9A 3KLEB 4C8NA 3H98A 4OKKA 1RAJA 2XI2A 2IM1A 5KFHA 3DRPB 2G8VA 4KBIA 4RW9A 4I2QA 4AHCA 4IFVB 4ZPAA 2AGPA 4EEYA 3LANA 3IS9B 2KW4A 4CFCA 2FBTA 4DU3A 1VRTA 5KI6A 4FJKA 2ZE2B 1NKCA 1RBSA 3RAQA 4BE0A 1JLCA 3D45A 1HQUB 3T5LA 3SUNA 4W5QA 1EETA 1BIUA 2XY5A 4J2DA 4OJRA 3TABA 4NRUA 3CJ3A 3MR3A 4O3QA 3GIJA 2P51A 1GOBA 2O4IA 4CF0A 2D0BA 5HBMA 4LQ3A 1N6QA 1Z4UA 2ASDA 5HRPA 2YNGB 1RT1B 3DRSA 3P5JA 3RR7A 1XR5A 1TL3B 2C2EA 1TP7A 4O0JA 3C6TB 3QZ8A 2FLPA 1NJYA 1TKTB 3TAQA 1BISA 2Y1JA 2R8IA 5CZ1A 3HVAA 3LZJA 3EZ5A 1VSDA 4Q43A 4DTNA 1BQMA 3I0RB 4ZPBA 1S4FA 1S0NA 3KK2A 1JKHB 3ICLA 3HL8A 1Q8IA 3KLGB 2JEGA 3FSIA 1WSIA 1J53A 4YFUA 2D5RA 4KI4A 2B6AA 1D9FA 4DQQA 3Q8QB 1ZETA 1N48A 1T03A 3NHGA 1IM4A 4K8XA 1C1AA 3KK3B 3LP0B 1SL2A 4CJEA 4WZMA 3AVIA 1REVA 3LP1A 3GQCA 3AVBA 4PQUB 4YR3A 2FJVA 2V4RA 2KFZA 3OS2A 2R2TA 4QW8A 3CG7A 2VG7A 1RNHA 1FKPB 3HPOA 5HLFB 1RT5A 3L2RA 5F9LA 5FRNA 5FROA 4J9SA 1RCHA 1WN7A 5J2MB 2W9CB 4EBCA 3K57A 4ZTFA 2XO7A 3PO5A 2JC0A 3VQEA 1EETB 3QEVA 4DFKA 2OYQA 4O3SA 1HQUA 5KFWA 1JLQA 2DPJA 3K58A 1T05B 4BDZA 1QAIA 4N41A 3HHKA 5F8LA 3Q8PB 3VQCA 2YKNB 2GIRA 1Q9YA 1JLQB 2D7SA 4TQRA 2HNYB 4ZP6A 3MR2A 3CM6A 3UPFA 2HNDA 3AV9A 4CK1A 4RW9B 3AVCA 4O5BA 4KTZA 1NJZA 5HP1B 4DTXA 4IG3B 5J2MA 1SKSA 4RW6A 4H4OB 5KFJA 3MR5A 4B8CA 1S6QA 2E4LA 4CECA 4FJLA 4DG1B 4Y1DA 3M8RA 4CEZA 1T94A 1SUQA 4CESA 5KFYA 4PUOB 3QINA 2ATQA 4DSIA 1RDRA 1TK0A 3N6LA 3TWHA 2X74A 4FJ7A 3NF6A 1U48A 3VQ8A 4KSEB 5D3GB 3OYIA 1REVB 1RDAA 1RTJB 1QSLA 1HNIA 1RILA 3NF9A 3ZSVA 2B4JA 4KHWA 1C2PA 4KHUA 4KB1A 2W9BA 3K5NA 1QHTA 2JLEA 4GMJB 3T3FA 4CF9A 4KFBA 3DOKA 3SUOA 1K6YA 1EP4A 4BWMA 4OL8A 4ZVEA 3QEWA 4IDKB 3CIZA 4CFBA 4TN2A 1RTIA 4ZVHA 3OYKA 1DLOB 2YKMB 5F8MA 2G8WA 5EWFA 5HLFA 3K5MA 2GBZA 3CFOA 4NLTA 3AVMA 2R8JA 1BHLA 2YKMA 3O4NA 1EXQA 3SYZA 4IFYB 1LW2A 3MEEB 4WFXA 5KFDA 2FJWA 1UWBB 3HPGA 2OPQB 4IDKA 1X9MA 3KHLA 1TK5A 5KFAA 3ZSZA 1RBTA 4HCCA 5KG3A 4ZPCA 3PR4A 2D0AA 3GIKA 4NYNA 1FKOA 1BQNB 4IH7A 4MIAA 2W9BB 3KIOA 3PW7A 2G8HA 1WLJA 1NK9A 1VSMA 1UA0A 4J9QA 4DTRA 4O55A 4YQWA 1WAJA 1ZYQA 3AVLA 4ECTA 3I8DA 4JV0A 2Y1IA 1NK8A 4OKEA 3UQSA 3HVTA 3KJVB 4BE2A 1RT4A 2OPRA 1VRUA 5HRSA 3VQ5A 1IG9A 4QWEA 3Q8SB 3PW5A 4CJPA 1KLMB 2W42A 3VQ9A 3SI6A 2WONB 1I39A 2VA3A 3NAEA 1VSIA 3IRXB 1C6VA 3I0SA 1S9EB 2PZSA 5C24A 1ASWA 2HHQA 2RF2B 1KLMA 4NCGA 3CJ5A 5C42B 2VG6B 5FDLB 1SH2A 3QESA 1EKEA 4CHZA 4CIGA 3KJVA 1SH0A 2OA8A 4CGHA 3T5JA 3WNHA 3SPYA 4RW4A 2R8GA 4EBDA 4O44A 2AJQA 1U4BA 5KT2A 4F4YA 4KV8A 3V6KA 3SFUA 3EPIA 1WSGA 1LWFA 1TKDA 4EO6A 2X78A 4M3TA 4Q8FA 3QGIA 5DG9A 1HPZA 1FKOB 2W9CA 3QGHA 3P83D 2ALZA 3ITHB 4HTUA 4W5TA 4TYAA 2IM2A 4KHRA 1FXXA 1B9FA 1BIZA 2R7YA 2UVRA 1BCMA 1KVAA 4LSLA 4FJXA 1HYSA 1SH3A 3HJFA 3ZT1A 1ZBIA 3OLAA 3OL9A 1HQEA 2IAJB 1NK7A 1X9WA 4LQ9A 3SUQA 1N4LA 4ED0A 2IJFA 4QWCA 4FS1A 4KTQA 4ZP7A 2AWZA 3LP0A 4M94A 4R8UB 3E51A 3G6YA 3TAMB 2DFFA 1QE1B 5EWEA 3Q8RB 4Y1CA 4J9PA 4ELTA 3DM2A 1QTMA 3ALYA 3QO9A 2ATLA 1A5XA 2G8IA 3DLGB 4RUCA 5KFIA 4K4VA 3AO3A 4QOZB 3DOLA 3I0RA 2ZD1B 5KFUA 4U7CA 4RUAA 1VSLA 4CJ3A 3OYFA 1S48A 4CFAA 4WXOA 4PY5A 1VSJA 3B6OA 3DM2B 3BQ2A 4ID5A 4CHOA 3E01A 5DG7A 1NKBA 2JC1A 3BSAA 2G8UA 1ZBUA 3LALA 5J2NA 1FK9B 2VG6A 5FDLA 2YHBA 4CIEA 2R8KA 4XPCA 1RT1A 3AA5X 5KFMA 3D5MA 4FBTA 2BANB 1TGOA 2AGOA 3S3NA 1JXBA 2HHUA 1IKVA 1DTTA 3H5YA 5L1JA 4ZVFA 3M9OB 1XHXA 4E7KA 1VRUB 3JYTB 3RAXA 3BGRA 4LH4A 3TR8A 2YNIB 4FZYA 3RB4A 3NFAA 3HVTB 3IAYA 3PUFA 4CGJA 3QGGA 2DTUA 3IGVA 4E3SA 1S0MA 1UA1A 4M3YA 1KFSA 1U04A 3GYNA 3KNAA 1T7PA 3ZSOA 1IO2A 4LH5A 1XWLA 4CHYA 1O1WA 4Q5VA 1NJXA 4IR9A 3U3YA 3L3VA 2F8SA 1NHUA 2WHOA 3KMQA 4CCHA 3G6VA 3MEGA 3PW2A 2FBYA 5C42A 3RR8A 1UWBA 4DL3A 1GOAA 4F4KA 2F8TA 3ZSWA 5F8GA 4YR0A 2WB4A 3KD1E 3IG1B 3AVHA 1TKZA 2YNFA 4JRQA 1R0AA 2XI3A 1X1PA 3MFHA 2IS3A 1QSSA 3V9WA 2BE2B 4ICLA 1C1BB 4F2SA 3SZ2A 1RT3B 4CJSA 4PQUA 4DQIA 4FCYA 4OKJA 3TI0A 4ECXA 4IH6A 1HNVB 3DDKA 1S1XB 3TQ1A 4O3NA 2Z1GA 1KTQA 4BACA 4X2BA 1VSKA 3EPGA 2GV9A 4QAGA 4NLPA 2Z1JA 4KHQA 3NDKA 4IR1A 1RBRA 3MXIA 2DPIA 1RTDB 3NAIA 3KKSA 1S49A 1DTQA 4DLGA 4LY7A 3EYZA 1L3TA 3K2PA 3CDUA 4NLQA 1DTTB 4W5OA 2PYJA 4CEDA 4RW7B 1JLFA 4Y34A 1S1VA 4DL4A 3FQKA 4ZHRB 5DG8A 3G86A 1QAJA 2AGQA 3ZSYA 1YTUA 2HVHA 2W7OA 4LSLB 2C22A 1JXEA 3QYYA 3B6PA 3LP3A 4ED7A 3DLHA 1HMVB 3MECB 4DG1A 5SZTA 4RW8A 4CEAA 5CYMA 2JEFA 4EZ6A 1HPZB 1NHVA 4NLUA 3LWMA 2QKKA 1MU2A 1TVRB 2UVWA 4PA1A 1C0TA 2XHBA 2BGGA 2XCPA 5KFQA 4ED8A 4NLYA 3H2LA 3OYHA 3CVKA 4B8AB 1L5UA 4N47A 1ASUA 2F96A 4WYLA 3LWLA 4FW1A 1Z25A 3NH2A 3HYFA 3V6DB 1S1WB 4K4WA 2YHAA 1KSPA 4KHNA 4FLYA 2R2SA 4J2AA 1L3VA 2YNHA 3DRRA 5C24B 3SUPA 3I0SB 4KO0A 5KG5A 3VQ6A 1EX4A 1RT5B 4DLEA 1HYSB 4FZZA 3PX6A 4CF1A 5KFFA 2D3ZA 3KLVA 2XRIA 1U49A 3PY8A 1TL1B 3HK2A 3NH0A 4TY8A 3CQ8A 1RYSA 2J6TA 1WNSA 3KOAA 4F8RA 3DI6A 4IKAA 4B9SA 1S1TB 3L2QA 4IG3A 1QS4A 1YVUA 2Z1IA 3D28A 2E6MA 4RZRA 3LAKA 2I5JA 2OPPB 1JIHA 4W5NA 2YKNA 4B9NA 4ECRA 1NK6A 4DSJA 4O44B 3SNNA 5CYQA 3N6MA 4N56A 4R5PA 2BRKA 5KT5A 4DMNA 3CDEA 3AO1A 2YV0X 3OYJA 4NLOA 4DF8A 4O4RA 4JUZA 1RYRA 4FJNA 4CEBA 3MEEA 4YNQA 3C6UB 3LP2A 2XGQA 1GX6A 4Z4FA 2OPSA 1XHZA 3NL0A 1C1CB 4URQU 5KTQA 3DRSB 3MTKA 2WONA 2BQUA 2G8FA 2QXFA 3RTVA 4CHQA 2QE5A 1JLAB 4CHPA 3FQLA 2IGIA 1RT4B 3OJUA 4ELUA 4J2EA 4FK4A 5J2PA 4AHTA 3NAHA 1S1WA 3DMJA 4ED2A 4IQXA 3V1QA 1S6PA 1RTIB 4ECWA 4OLAA 3KLIB 4JS5A 4DL2A 4OPJA 2D3UA 2ILYA 1Y97A 3RMCA 3ZSXA 3SI8A 3UIQA 4E7LA 4FK0A 4ID1A 3AA3A 5HROA 2E9ZA 1MU2B 1TVRA 4Z4EA 4FLUA 2KTQA 1NK5A 4DU4A 3GV8B 4CGFA 4B08A 1WSHA 4J9MA 4ECVA 5DMRA 3OJSA 3NMAA 1YVFA 3BQ0A 4R8UA 3QLHA 4BE1A 3QIDA 1RTJA 4HUGA 4XPEA 4CGIA 1A5VA 1K1QA 3V6JA 5D3GA 3ISND 2W8LA 4OVLA 3GIIA 3V9XA 1JLEB 1GX5A 3OL6A 5K14B 4NLXA 3V4IA 3QZ7A 3H5XA 2QKBA 4ED3A 4PUOA 2J6SA 1J9AA 4CGGA 2QK9A 5HBMB 5J2NB 3VQBA 4J9KA 1I3AA 4RW6B 2OZMA 4F4ZA 1HRHA 4OGCA 5HP1A 1LWCA 4E89A 3T1AA 3SV3A 1C0UB 4PWDB 2ZD1A 3M8PB 4CF8A 3M8QA 3TVKA 2IBKA 5F9NA 4WE1B 4KFBB 2JGUA 4GVMA 5KGXA 3T5HA 1JL2A 4FJGA 2AQ4A 5KG4A 2ZE2A 1WAFA 4EP5A 4FJMA 1VRTB 4KAZA 1HNVA 1T05A 4DL7A 3DLKB 1ASVA 2W9AA 2BE2A 4ICLB 1JXLA 5DK5A 1KVCA 4W5RA 3KTQA 2VWJA 2VWKA 3V6HA 1S9EA 1TV6A 4IOBA 3TARA 4O0IA 2ASLA 4I9QA 3IRXA 4I7FA 3PHEA 4B3OA 1B92A 3L2UA 3MXMA 3MAQA 2B5JB 1HARA 4DTMA 4MKBA 2BR0A 3M8SA 2UUWA 1JLBA 3M9NB 1TV6B 3QNOA 5DGBA 4MQ3A 3LP1B 4I2PB 3QEIA 4AILC 4DU1A 3QERA 3DLBA 4RG8A 2XGPA 3DLKA 4KV8B 3AVGA 3V81B 4FW2A 3AVAA 3OVNA 3U6FA 3TAEA 4Z4GA 2JEIA 3TAPA 5KFRA 4B9VA 3KLGA 1I6JA 3QNNA 1SL0A 1GOCA 4DEZA 3OHAA 3NF8A 3EY1A 4CJ4A 3ZSRA 1LWCB 3VQ4A 4XO0A 1TQLA 3NBPB 3HT3A 2RF2A 4F3TA 2FBVA 4Q8EA 5CYMB 4DTJA 3ZSQA 3O3GA 4Q44A 2WOMB 1N5YB 2RKIA 5KG2A 2VG7B 1D0EA 3OYDA 3FFIB 2XY6A 2XWYA 4M3ZA 3KHHA 4RNHA 2HWHA 5JXSA 1JLGB 3NGZA 2AX1A 1ITGA 3G6XA 3OSPA 4AHRA 3LDSA 4ECQA 4CEFA 3KMSA 1S10A 3RMBA 2W7PA 4U6PA 5F8HA 3BSNA 3VQDA 2DFEA 1EP4B 4NCBA 1RT2B 3CYMA 1SKWA 3LPTA 4K4TA 3HM9A 3AVKA 3RWUA 3PO4A 2VG5B 4CJKA 3AVFA 1BQMB 5KFLA 2HB5A 1QE1A 3NCIA 3TAMA 3TAGA 2KFNA 2AX0A 3V9UA 1U47A 1S1XA 5T7BA 4DL6A 2FLLA 3VQSA 1J54A 1S6PB 4MFBB 4M3XA 2KZMA 3RMAA 1JLBB 3ZT0A 1WSFA 3OYNA 1RT3A 4EYHB 4TY8B 1TKXA 5KGWA 2B5JA 4NZ0A 3OS1A 4HUFA 4HVJA 4EZ9A 5KG1A 1SUQB 4DSFA 4CGDA 3WNEA 4I7FB 3P1GA 2WOMA 1KHWA 1XC9A 2P5GA 2XY7A 5J2QA 2IC3B 3GILA 2HWIA 5I42A 4Y3CA 3RB6A 2V9WA 4ECYA 3PW0A 3OSNA 2YNHB 1LV5A 1S1UA 5C25A 4ZP9A 3V6DA 3AVJA 4DTUA 4DWIA 2EHGA 4NLRA 1JLCB 3HP6A 3K59A 3H4DA 4XIUA 3D0PA 3K5OA 4TSXA 1S97A 4M3RA 4E7HA 4RW4B 1Q9XA 2WCXA 4O3OA 2OPPA 4FK2A 4G3IA 1KCFA 5KFNA 1SV5A 3MF5A 4QW9A 2D0CA 3RB3A 1VSFA 2I1RA 1BL3A 3QIPB 4J9OA 1HMVA 4GW6A 5KRTA 3QIOA 1FKPA 1QUVA 5F8IA 1CZBA 2RPIA 5C5JA 5JUMA 3SFGA 3KLHA 1BCOA 4Q45A 4URGA 1LWEB 3QIPA 4FVMA 1JLFB 3S3MA 4K4XA 3OL8A 2FVCA 4R0EA 3MR6A 4KB7A 3H5UA 5KG0A 3SJJA 4FJHA 4NLVA 3VQ7A 3PJXA 3QLHB 3CWJA 2HAIA 3NH1A 2HNZA 3E01B 4CEQA 2FJXA 3NE6A 4ID5B 3S3OA 3FRZA 1RTDA 4MK8A 1A5WA 2FVRA 4O3RA 2NUBA 1XR6A 3RRHA 4CEEA 1BQNA 2HMIA 3BQ1A 5F8NA 3M8QB 1W0HA 4MKAA 3DOLB 5DQHA 1C0TB 4PWDA 4IRCA 3JSMA 3HVWA 4ZP8A 1IKWA 1CLQA 4N5SA 1MMLA 3KLIA 1TKTA 5I42B 4LSNA 4Q0BB 4KHYA 4ZMMA 5J2PB 3RRGA 2CKWA 4M41A 1WNEA 4I9LA 3SPZA 3FFIA 1HYZA 4DFJA 5K14A 5L1KA 4ZHRA 4J9NA 4HUEA 1NOZA 1JX4A 4MIBA 4WFYA 4OGEA 4RNNA 4G1QB 4DQPA 4ECSA 3SV4A 1HJRA 3PW4A 3PV8A 4DQRA 1C0MA 4DSEA 4EO8A 4J9LA 2VG5A 4R5PB 4IH5A 4J9RA 2FVPA 4ED6A 5DGAA 2J6UA 4DS5A 3O4QA 3L3UA 2P1JA 3DLEB 3A2FA 2R2RA 4Z4CA 1HYVA 5KT3A 4WYWA 1NOYA 2HNZB 2ZKUA 4URSA 2A1SA 4QPXA 1CZ9A 5KT7A 4IRKA 3M9MB 3DRPA 2HHSA 4WZQA 3VQPA 4RNMA 2YNIA 2VA2A 3L8BA 5EUHA 3V1OA 2XCAA 2YNGA 1L3UA 1IKYA 4K4YA 2YNFB 3LAMA 2UVUA 1IKVB 2OPSB 3KKRA 3LP2B 1IKYB 4H4MA 3GIMA 4NRTA 5KFEA 5HRRA 4GC6A 1RDDA 4FYDA 5HRNA 1VSEA 4BDYA 5CZ2A 4FLWA 4K4UA 4AH9A 4Z0UA 4AHUA 3CFPA 4DSLA 3DYAA 1NJWA 3I5CA 4RNFA 2IA6A 2A1RA 3QETA 3BREA 3L2WA 2HHTA 3BSOA 3QEPA 4CK2A 1LAVA 4TXSA 5KRSA 4MK7A 2EX3A 1CXUA 4I2QB 4DS4A 3CDWA 1OS5A 4CHNA 3IGNA 3RBDA 4CJVA 1D8YA 2ILZA 5KT6A 4C8KA 2HHWA 4HKQA 2C2RA 3DI6B 2IC3A 5J2QB 2BQ3A 4QWBA 1LW0B 2OPQA 5T14A 5KFCA 4E1NA 4IFYA 5CY4A 2F8EX 3U3GA 3VN5A 4B9MA 5KFVA 1TKXB 1JLEA 4IG0A 2HHVA 1ZBLA 3AA2A 4C8OA 4NLDA 4HHTA 4E0DA 4RNOA 3ZCMA 4WFZA 2WTFA 2Z1HA 5J1EA 4ELVA 2PYLA 3KHGA 2ASJA 1FK9A 1S5JA 4DFPA 4FM0A 5I3UA 2D41A 4QCLA 1T8EA 3I5BA 4ECUA 5E41A 2B6AB 4CJQA 3AO4A 4DFMA 4Z4IA 3JSMB 3KK2B 4FJ9A 4Z4HA 3DLGA 4FBUA 1KFDA 2UVVA 4O3PA 3G10A 3O3HA 4B9UA 4HYKA 2QV6A 3MECA 4KTWA 5KFTA 1RDBA 1JLAA 5J1EB 3WNGA 4CJWA 1TAUA 1S9FA 3FDSA 4C8MA 1R0AB 2OH2A 4IBNA 4QWDA 4UQGA 1IH7A 1D9DA 2RKIB 4IG0B 4M42A 3NF7A 4BDPA 3ISNC 1J5OB 4C8LA 3MXJA 3ZT4A 2FVSA 4KAIA 1DTQB 1LW0A 2RDIA 4DTSA 3OYGA 3RBEA 1SKRA 4O4GB 4DL5A 3ZT3A 4H4OA 2P5OA 3HKWA 3V9ZA 3VA3A 2HHXA 1TK8A 3PZPA 2RDJA 3NGYA 2R8HA 3NGDA 4KE5A 2HNYA 3V9SA 4LD0A 2I5JB 5JS1A 5KFGA 1CXQA 1W9HA 5DQGA 2LSNA 2WRMA 4H54A 4ZTJA 3KK1B 1F21A 4NYFA 4ED1A 1RA6A 4JLHA 4E1MA 1KRPA 2E9TA 3BJYA 3SQ1A 5C25B 4QWAA 1C1BA 4K50A 3VQQA 1RA7A 3AO2A 3NKYA 4FJ5A 1L3SA 1TL1A 5EDWA 4H4MB 1T3NA 4F3OA 1C1CA 1TKZB 3UR0A 3GV5B 2ITGA 3EZUA 3IG1A 3N6NA 4KO0B 4F4WA 3PX4A 4HCBA 4YP3A 3F73A 4NLGA 1JL1A 3DRRB 3THVA 1IKXA 3RMDA 1XR7A 4KHMA 3KLFA 1RT6B 2OPRB 2BQRA 3VA0A 3CJ4A 3MEGB 1B9DA 4CJFA 5KFZA 2E6LA 4EP4A 4MK9A 3KK1A 3HO1A 2V0NA 3KK3A 4IRDA 2X6SA 1ZTWA 5F8JA 2IM3A 4NCAA 4WE1A 4E19A 4CJ5A 5KG6A 4IKFA 3M8PA 3DLEA 2HMIB 1C0UA 5KFKA 5FRMA 2FBXA 4DSKA 5KFOA 1S9GA 2RN2A 3H4BA 1RT2A 2W8KA 3K5LA 1X9SA 3PX0A 3OHBA 1VSHA 3OYAA 3T19A 1SL1A 2IJNA 4CERA
chains in the Genus database with same CATH superfamily
1AFIA 1S76D 3V1RA 1RT7B 3VCDA 2YKQA 2JRSA 3BSCA 2OKQA 4BROA 1LWEA 3PJWA 3ATVA 1YK9A 3PYDA 5DM6Q 1RT7A 3ENVA 5K8MA 1ZBSA 2RD5C 2MGZB 2YBVA 1UPMB 4KPYA 3AODA 4FNIA 2LXUA 2WBMA 2M9KA 3CPEA 3DRYA 3DLLQ 1HNZK 4M7YA 2XS7A 2EG2A 5HVFA 1ZBHA 5F41A 1SXLA 4NLWA 5HROB 2R7WA 2P9GA 5MLCV 3RGIA 4PQAA 4DPYA 3CM5A 1NNDA 4LF6K 5EN1A 1EHWA 3QO9B 2VC1A 1H7WA 1UAXA 3V81A 5KT4A 4AHVA 4YMEA 5IZHA 2FLNA 4CIFA 2KKHA 3K0SA 3PVXA 4IEIA 1RBUA 1OIAA 3NS7B 3RBZA 1GLCG 2GAHC 2Y8WA 2GIQA 2UUBJ 2PAVA 2HFOA 1VOMA 3C94A 2R7VA 2AJ4A 2FVQA 2PMHA 1RTHA 4ZLLA 2PY5A 4F50A 1U1QA 4RU9A 3ITHA 1TYQA 3BGFA 1WWHA 3L3CA 4H5NA 2MHEA 2QO3A 2XY8A 3W0LA 3CJ0A 2VF3A 3OW2R 3HP9A 4Z37A 1RWUA 3PACA 1S0OA 1S3XA 2WSFC 2XSJA 2O4GA 2EPIA 5A8KB 1KVJA 3IDHA 1UZHA 4K4ZA 2ZJRL 2KN4A 1FDDA 4B3SK 4FJJA 3DCAA 5L46A 5HMZA 4O4GA 3SQ2A 4M3UA 3LZIA 4FJ8A 5ETSA 1GQEA 3ASMA 1HX1A 4U9RA 4G1QA 3T1YJ 4GC7A 1R3NA 2OEJA 2O8FB 3J81U 1EWQA 1CJTA 5GVQA 2HF4A 2BJ1A 1MWMA 1BI4B 2QL9B 2ZBIA 3OXLA 5F3ZA 4DTOA 5EWGA 4F04B 3MM5A 4CZLA 3SCKE 5AQXA 2HWTA 4OZLA 1DLOA 4GNIA 4OHWA 3ZETB 4F2RA 5KFSA 4DV0K 3CCLN 1V5IB 4MLHA 2DH7A 3E2EA 3AA4A 1FEHA 3DLLL 1FRMA 3AO5A 3ETOA 3G6EN 2GX8A 2IMWP 5HOOA 3M2RB 1KLNA 3WNFA 1Z1ZA 2IOCA 2B8QA 4RWTA 3H08A 4DX5A 3L2VA 3AOCA 1HNZF 1KHVA 2RILA 4BC5A 4JRPA 3SDEA 3VTHA 3VEOA 4NYOA 4DPUA 5KG7A 2CJYB 4FOIA 1X0PA 1Q81O 2AMCB 2LKZA 3ULDA 1M5HA 2M0GB 1RUSA 1QQCA 4AHSA 3D2FB 4KPCA 1RKIA 3NY0A 3NGIA 4FZXC 1YUWA 2MMYA 2H48B 5IC6B 4JYAK 4CLUA 3MURP 1FJGK 2OZSA 3Q2SC 2UXDF 2IRYA 3ULEB 3A5OC 4RO0A 3WEEA 1UP1A 1HNIB 2EC0A 2R2UA 3CD6S 1NGDA 1S1UB 5KFXA 3R97A 3F9KA 4OI6A 5AQGA 4LRAA 2VKZG 3I55N 1X5OA 1GMWD 5EGYA 4ECZA 4E7JA 3HXMA 4KI6A 4IO8A 4M63C 2HQFA 2K7KA 4DUYF 2ETJA 2UUAJ 3KLEB 5FD1A 1V4SA 2L08A 2XI2A 2HS3A 3CCRS 1FD8A 2O8CB 3DRPB 2VH7A 2G8VA 4I2QA 2ZUAA 1CLFA 1DQAA 2KB2A 2QXLA 1YJ9N 4ZPAA 3CMQA 4EEYA 1ZM9A 4DU3A 4PYAA 2WFBA 2H51B 3GONA 1I3OB 1JLCA 2NRXA 5ADXH 3T5LA 4C1NI 4W5QA 1IBCB 1BIUA 5HJXA 4YDUA 4B17A 4OJRA 3BF3A 1DAXA 4NRUA 1K0TA 2DK2A 2O4IA 3A3PB 4CF0A 3VETA 1KXPA 4LBPA 1JCEA 5HBMA 1Z4UA 2QGFB 3QBXA 3SSQA 1SB6A 5HRPA 1TUGB 1K9MO 5B8HA 1XR5A 4DCJB 1VC6A 4DV1J 3MM7A 1TP7A 2LA6A 1NJYA 4ZVRB 3TAQA 4PWWA 2Y1JA 2ZWPA 3HVAA 1ZM3A 3M2UA 1RP5A 2V7ZA 3I0RB 4ZPBA 1X4DA 1JKHB 3SAFA 3HL8A 3FSIA 2MZSA 2GX9A 2PD1A 4YFUA 2D5RA 2MHNA 5ITHA 4WFNL 3EMTA 1SS6A 4DQQA 4PRFA 1BWEA 3D7EO 5IT4A 5M2UA 4AQYF 1YVNA 1T03A 1C1AA 3LP0B 3AVIA 1MMNA 4NZ7A 4CZFA 2POKA 4RLEA 4D3HA 1OSDA 4PQUB 1NEEA 2FJVA 2DH8A 2OTJS 3J7ZT 3BS9A 2KFZA 3L4BC 1NH7A 4ILHA 1FKPB 4DV5F 5FRNA 2UUAF 2U1AA 3FEXB 4J9SA 4JI8K 3FVYA 4DR1J 5J2MB 2W9CB 2FJDB 3K57A 3ZTRA 3DKDA 2JC0A 2ZOMA 5GAEU 5KFWA 1JLQA 3K58A 4FZVA 3GIRA 4NMXA 3C14A 3VQCA 1JLQB 1T9TA 4ZP6A 4E2FB 3AV9A 4RW9B 2VYPA 4KTZA 3MMVA 1NJZA 1DY3A 6FD1A 4DTXA 2XMVA 1XMQJ 3C66A 2KVIA 2H5IB 4P7VA 2DNLA 5GAEP 3QBWA 1QTNB 5BJRA 2P9NB 4IYQA 2GWKA 2AP6A 4ZVOB 3JB9k 1SUQA 4KQZA 2FGOA 2QRRA 3TWHA 4A8OA 2X74A 4DV6J 3CMEN 2KYZA 4KSEB 4X65J 3OR1A 5B0GA 5IFMA 3VEZA 3W5ZA 3ETMA 5EX3A 1QSLA 2RUGA 4BR7A 3H42A 2AKWB 4F26A 3ILOA 1RILA 3ZSVA 2B4JA 4EK2A 4CF9A 1WC1A 3BGLA 4KFBA 4ZVEA 1FRXA 4MT1A 1FVQA 2XMJA 2B9WA 3CCJS 4NASA 1SCJB 1EZZB 2O8EB 3GJQB 2A1BA 2G8WA 1VQMN 5HLFA 5LL6d 3CMAS 3N01A 2FZKB 2KVQE 5DDPC 2B51A 2GBZA 2MQPA 2YX1A 1AYEA 3VPZA 4CBUA 4JI1K 4DUZK 5EXWA 3OXFA 3O4NA 5B09A 3SYZA 3MEEB 4WFXA 1UWBB 3RSEA 1H2TZ 2NLXA 4EMDA 5KFAA 3J81j 1LFPA 4IH7A 4JI7K 1IQTA 2G8HA 4ZPTR 2YI1A 1UA0A 4JK9A 2E5IA 1EQMA 3M2UB 3K7RA 3AVLA 4Y2KA 3AY0A 2Y1IA 2QM1A 2Y3YA 2NNWA 4LF8F 3HVTA 5BREA 1XMOF 3KJVB 5IC4B 5CE3A 1E6VB 3CJ1A 3A1YG 3VQ5A 4J91A 1A7GE 4QWEA 3Q8SB 2BZ2A 4DR2K 1I39A 1RADB 3FZBA 1UWAA 4J5OA 2D3OR 5DRKA 2CRLA 3MZIA 2RF2B 2KXNB 2CG4A 2B4OA 3ILJA 3F44A 5HSPA 4BC7A 1SH2A 3QESA 4CHZA 3KWMA 4X4QA 2XLKA 4KH4A 2HVZA 1SJQA 4C8ZA 4RW4A 2AJQA 2Z30B 2V2KA 3EWGA 1TKDA 4L72B 3GFZA 4LIRA 4M3TA 5AQWA 4Q8FA 3QGIA 4PKDB 2BABA 1HPZA 1FKOB 2W9CA 5C2FA 2ZJPQ 3VTIA 2E5HA 2ALZA 1KONA 2CVEA 2AHOB 1YBUA 3FNNA 2IM2A 4KHRA 4A4JA 1B9FA 1F5BA 1BCMA 3UDEA 1FE4A 2ZOFA 4C3MA 3IR6B 3HJFA 4LQ9A 3SUQA 2BYCA 1N4LA 2IJFA 1VQ4S 4M1KA 2X7IA 4QWCA 2DNGA 4YY3K 3E51A 3MMJA 3BZQA 3PFEA 1T11A 3JAMU 4PG8A 1QTMA 3P5BP 1PJ7A 3O9RA 3QDKA 4RUCA 3AO3A 3DOLA 2ZD1B 1VSLA 3D2WA 4USHA 2F9DA 4PY5A 2W2OP 3KWIA 3US5A 1R0BG 3BH6B 2P5VA 3MX2A 3M2VA 4XH1A 4CHOA 1XIQA 3R8YA 3BGUA 2OEKA 2JC1A 2G8UA 4JI1J 3E66A 1FK9B 2VG6A 5FDLA 5KFMA 3GG4A 3PYGA 4FBTA 2ZM6K 4C1NK 1IKVA 2O8FA 1IUJA 3GJRB 1YJNN 1ZZFA 4ZVFA 3M6UA 3VVTA 4E7KA 1VRUB 2GS8A 3W61A 3TR8A 4HR2A 3K89A 1NDKA 3I96A 2EXUA 2VQEF 5AQMA 3R8EA 3HVTB 1W2BM 2ASOA 1V5VA 2HFUA 3WXKA 1XQSC 4CI6A 1TUVA 4E3SA 3CC7N 1UA1A 3GYNA 3BO4A 2K1RB 4CHYA 4KR0B 2IHR1 2VGNA 4DR5K 3NVMA 1RDUA 2JHEA 1QAYA 2YX6A 3NRBA 1CBKA 4CCHA 1YZ6A 2DIVA 3MEGA 1UMJA 4ZDNA 2FBYA 3T1YF 4DL3A 1GOAA 2V63A 4F4KA 3OUYB 1GK8A 3MDQA 4BRNA 4NZ6A 4YR0A 1Q7YT 3KD1E 5AXLA 3ZZTA 4M5DA 2VL1A 2E66A 1HUXA 1YX2A 4BRQA 1RHUB 1N5SA 1QSSA 4LT6A 2BE2B 3O08A 1U0HB 1NSQA 2PMZD 4F0MA 3ZTPA 4ECXA 2P2CB 3DDKA 5AXMA 3TQ1A 2N3LA 3A5NC 2ZC3A 3SEOA 4NXNF 2M88A 3WC0A 3EPGA 5JMVA 3DXBA 3V5RA 1LOTB 4H03B 4ZVPB 4KHQA 3Q8VA 3NAIA 4OX6A 4FWRA 2U2FA 3HFKA 1Q4RA 2XO6A 3EYZA 4BR9A 3CJRA 1H38A 3K2PA 3ENOA 1FJGJ 4DR6J 4DR4J 3CDUA 4NLQA 1F0XA 1DTTB 4W5OA 4WTYA 2E2OA 2X1GA 3G86A 1RWWB 1P8ZA 2EFQA 1U1RA 1PC5A 2W7OA 3QYYA 1U24A 2EKNA 3LP3A 4B1VA 1P90A 1HMVB 4QS7A 3MECB 4LBIA 2FHKA 2O8EA 4CEAA 5CYMA 2JEFA 5B0BA 4MTPA 4O0NA 3V2UC 3FZHA 1OQ3A 1FE0A 4NLUA 3M05A 3LWMA 2YKPA 1LXNA 3TEGA 2QKKA 4Q2MA 2VV5A 2XCPA 2P9UA 1U26A 3IBCB 3D2EA 2ZGZA 3HSGA 3KYLA 3KDOA 2BUNA 3OYHA 2CQGA 4TVAB 1RQ0A 3F56A 3CCQS 3QMQA 1HR0F 4N47A 4NI2A 2F96A 2ZM6F 2ZDPA 2P9PB 4OYPA 2D74B 4FW1A 4OLOA 3NH2A 3HYFA 1R89A 5ADXA 3V6DB 3PKMA 2YHAA 2AEFA 3LDLA 1VMBA 1YWXA 2R2SA 2YNHA 2O8CA 1R8BA 2PEHA 1X60A 1RBLA 4LREA 1EX4A 2YHWA 4JV5F 1OWXA 9ATCB 1WKLA 5KFFA 3OV7A 4FNHA 2ZGYA 2GQQA 2P9NA 2W01A 4YOEA 2QLWA 4TY8A 1OQ6A 3KOAA 4F8RA 3DI6A 4CM0A 1O51A 4B9SA 4IZ9A 3L2QA 1HI0P 3LAKA 2MLXA 2QIFA 3RVCA 4ECRA 2FZGB 4DSJA 2R7TA 1M5OC 4GKJJ 3ULEA 5CYQA 3AGKA 4R5PA 5KT5A 3CDEA 4QIEA 4CD1A 5A0YA 2FPHX 2SXLA 1VBXA 2VFVA 3GR1A 3OYJA 4NLOA 2G13A 2AJ1A 4YNQA 3TUIC 1CJVA 1HNZJ 2EKYA 1XHZA 5AQUA 3UNGC 2L9NA 4ISFA 1C1CB 1WD6A 2EFGA 5AQFA 2W4CA 2WONA 3RTVA 2IGIA 4ELUA 1QAXA 2COLA 3TWZA 3NAHA 1S1WA 4X65F 4ED2A 1QZ5A 3V1QA 5ETNA 2I2YA 3PIPL 1NWKA 4OPJA 1FWLA 3SI8A 3ZXWA 4FOEA 5HROA 2DR6A 1HHTP 1H98A 2KTQA 3CMES 4DU4A 3SLCA 1NAQA 2DO0A 3GV8B 5B08A 1KC8O 4J9MA 4ECVA 5DMRA 4H0OA 2HQIA 3J7Z5 4ILGB 1T0TV 4F02A 4DN9A 1YZ7A 5HMYA 4L74A 2CQ3A 2H4YB 2W8LA 1YI2S 4WK3A 4OX9F 1JLEB 2OFGX 3OL6A 3DXMA 2A5XA 3N9UC 2QKBA 4PUOA 1B64A 1WJ9A 1J9AA 4CGGA 5J2NB 1KC8T 3O1LA 4CLPA 4X62K 4J9KA 3BYPA 1XMOK 4RW6B 1RKJA 1U8SA 2V51B 2MQLA 4E89A 3EN9A 2HQGA 2JGUA 2AQ4A 4H4KC 1WAFA 2FSNA 1UAWA 1YIJS 2AT1B 4UQTA 5IOLA 1H2VZ 3I8BA 2V52B 2W9AA 2VBXA 2D1KA 2OTJN 1KVCA 2HGLA 3AB4B 1FJGF 5M1OA 4IOBA 4JK7A 2ZZTA 2F4VK 4B3OA 2DXDA 4HH1A 1B92A 3MXMA 2ROPA 1O5JA 1HARA 5BR9A 5HO4A 2BR0A 3M9NB 1VQYA 4DV4K 3LP1B 3TA2A 1IWAA 3NOCA 2Q3PA 3QEIA 4DU1A 3C16A 6FDRA 4DL0C 2OEMA 2XGPA 3H45C 2G2OA 4KV8B 3V81B 4FW2A 2F7VA 2H3EB 4L76A 1DJ0A 4B9VA 1MW7A 4X4PA 2XYHB 3SXLA 4O8UA 4DEZA 4EGLA 3PNIA 3ZSRA 2CNOB 2GQCA 3I9V9 3VQ4A 1WKKA 3NBPB 2DGVA 4RR5A 2WOMB 4NXMF 2NXJA 1D0EA 1PKUA 3OYDA 3FFIB 2KT3A 3T6BA 1EQ0A 3KHHA 1PIEA 2MQNA 3HULA 4JV5J 1NBEB 4H4KA 2XHWA 3NGZA 3LDSA 3G6XA 3OSPA 4AHRA 4C0OC 2EW9A 3KMSA 2BX6A 1BOTO 1ZS6A 2W7PA 4U6PA 3MDFA 3BSNA 5LJWA 2KM8B 1NLKL 4JKCA 1SKWA 4G9ZA 4ALZA 3U8XA 1XNQF 3AVFA 1BQMB 3NCIA 2Y1LB 3V9UA 5ETQA 1KR4A 3VQSA 1XMOJ 2IA0A 1J54A 2V69A 4LRDA 3JSYA 4M5NA 2KZMA 1LWXA 2B9EA 4KH6A 1JLBB 2LA4A 2CQIA 1RT3A 1T9VA 5KGWA 4NZ0A 5DM7Q 1KD1T 3IFRA 2DGTA 3M32B 4BGAA 2MTLA 3WNEA 4CGDA 2WOMA 2P5GA 4U67Q 1V3RA 4BRGA 2IC3B 3IC1A 2J0SD 4Y3CA 3RB6A 4ID8A 1VQ8N 2GMJA 4ECYA 3CJ7A 4U96A 3OSNA 2HLTA 5AZJB 2YNHB 3NMRA 1N8RO 3DXKB 1LKZA 1HBMB 4C8YA 4XIUA 1FWKA 3K5OA 4RW4B 2DRAA 5C12A 4OYIA 3QMLA 1JWWA 1EKSA 4FWKA 2E8AA 1SV5A 2A3ZA 4P75A 2RRAA 4QW9A 2VPWB 5FJ4A 4Z7CA 5IV3A 2D0CA 4DV1K 3O2IA 3QIPB 4J9OA 3P4IA 1P1LA 1HMVA 1GLAG 1VK8A 1YJUA 3VAKA 1UL3A 1BMQB 1IBKK 5F0WA 1N33K 3SFGA 1WHWA 1LWEB 3OL8A 3C0BA 4R0EA 3MR6A 4YB1P 2RQKA 1NGCA 5A8RA 1BQXA 1U1KA 4CEQA 2DBBA 1TZ0A 1RTDA 4CEEA 1BQNA 1KOHA 2RU3A 4MKAA 3B82A 3JSMA 3MHYA 3HVWA 2IVNA 3R3TA 1IKWA 2BJ3A 3CCTA 2LP4A 3T69A 1TKTA 3HT0A 1FEEA 3RRGA 4E8UA 3FGUA 1FNOA 3MM9B 2MGZA 1HYZA 3LOUA 4DFJA 3HMJG 4PXDA 2CPIA 4HT7A 4HUEA 2I7PA 1JX4A 1YBTA 2G4BA 4MIBA 4DQPA 3WC2A 3PW4A 3JAMO 4AQYK 5K20B 2G1HA 2VB6A 3KUGA 4DV7K 2NS1B 2FQQB 3D9BA 4R5PB 5DGAA 4DS5A 1QZ6A 3O4QA 1IWGA 3GCWP 5LM7E 2C42A 2NZCA 2YTCA 3MOZA 2JLGA 3FZKA 3DLJA 1BXNA 1WUUA 5KT3A 4HHJA 3W62A 3SMSA 1NOYA 1SQGA 2ZKUA 4URSA 3K9JA 2FB0A 5KT7A 1CZ9A 4IRKA 1NGGA 4K59A 2E1RA 2LEBA 3VQPA 1HNXJ 2J0XA 1WOQA 3K2YA 2VA2A 4MYTA 1MDUB 3Q7BA 2DVIA 2EG1A 3BKUA 3VGTA 2BOPA 1OKJA 3Q22A 5A6WA 1RAGB 2MKIA 4MKYA 2VIHA 1UFKA 3KKRA 1IKYB 1J5EJ 4H4MA 1H7XA 3GIMA 5HRRA 2C3MA 3JQMA 1RDDA 5HRNA 2CJXB 3GZ7A 5CZ2A 2XM3A 2RHQB 3CFPA 1NHKL 3BUZB 1YLXA 4RNFA 3L7PA 2UXCF 2QSWA 4E1JA 1AXQA 5D4PA 3AA9A 4CK2A 1LAVA 3MUTP 4MK7A 3CDWA 2GMLA 5EHHA 1IJJA 4OFZA 1P1TA 1D8YA 2A42A 2ILZA 5KT6A 4HKQA 3NEKA 1J5EK 3DI6B 5J2QB 1KS2A 3DFEA 1LW0B 3WXIA 4FDFA 1RAFB 5KFCA 5DDRC 2YY3A 5D4OA 2H5EA 4E1NA 3MWTA 1VBKA 1BHNA 1YJTA 5HQLA 1B0VA 4B9MA 3U3GA 3VN5A 5KFVA 1TKXB 2ZDOA 4ES2A 5HI7A 2C3PA 2HHVA 3J80O 2WBNA 4HHTA 2RT3A 4JI3K 3BH7B 3ZCMA 1PAUB 1S72S 2Z1HA 4ELVA 1N32J 1HFEL 1NH8A 4BBYA 2ASJA 4WJBA 3JAMY 1FK9A 4YOVA 5HVGA 2LDYA 1CJKB 2V8GA 4NA2A 3AARA 4CIOA 5I3UA 2D41A 2A6MA 4PXEA 4DUZF 2HRYA 4QCLA 2FY1A 3I5BA 3TNVA 1FWPA 3ISZA 4DFMA 3EKSA 1Q18A 4ZS6A 3ID8A 1PO6A 2MEWA 2UVVA 1Q8BA 3G10A 3F0NA 2DO4A 3MECA 5KFTA 2I8EA 4PL7A 3WNGA 4ZKAA 4CJWA 5GAEI 2M70A 1S9FA 4ZN1A 3H90A 4C8MA 3HTVA 4UQGA 3UD3P 1ZM2A 4OI3A 3ISNC 1JCGA 2QWRA 1RLCL 1Y4ZB 1YDLA 1Q78A 1RK8A 3ZT4A 2P9LB 1ATRA 1WF0A 1D09B 4WF9L 2YKAA 3H20A 2RQCA 1HWIA 4H4OA 3ZYYX 3VA3A 3GYGA 2HHXA 2VONA 4QYZJ 2R8HA 3Q89A 3AOBA 2GJFA 3TA1A 2CPFA 5KFGA 3DDIA 4HT5A 4MDAA 4U7BA 2MQOA 4H54A 4NYFA 3D3BJ 4ED1A 1VQ8S 1NM1A 4LF6J 2ZVIA 1LCUA 2G1DA 2ZH2A 3SQ1A 3KWGA 2P9LA 3BF4A 3IBFB 3NKYA 2BJDA 2VZ9A 1L3SA 2OSRA 3VENA 4C0BA 4F3OA 2UU9K 2ITGA 1URNA 4F4WA 4HCBA 3F73A 1NGEA 5GMEA 1RSCA 1UVIA 3RMDA 2AYMA 3KLFA 3VA0A 3CJ4A 3MEGB 1B9DA 5KPTA 2E6LA 4EP4A 3RRKA 4BRHA 2V0NA 2Z58B 3WBZA 4IRDA 3J7YI 1ZTWA 3BO3A 4WE1A 3CCMS 4F67A 4IKFA 2HHHJ 3M8PA 3W3SA 3DLEA 1C0UA 5KFOA 5HJYA 3MMAB 3MEKA 1RT2A 5BRHA 8AT1B 3P4UB 2YWHA 3OHBA 2NRRA 2IJNA 5CCLA 3UD4P 1WSEA 3QEXA 4X4TA 2PBDA 4PPZA 3V4IB 1WSJA 2LLZA 3ZZUA 3R5AA 3JXOA 5D0RA 3MCMA 4K8ZA 2BM1A 3CF5Q 2KG1A 2W2PP 4C48A 1VK0A 4QS8A 3MEDA 3WIUA 4A8MP 1XC3A 2LYVA 5GMKa 3NNHA 2GC8A 3TR5A 3O1WA 5ETKA 1AUDA 4KH5A 4ISGA 1S6QB 3A13A 2GUIA 3AAPA 4B9TA 1S7HA 3KD5E 3D0GE 4CJUA 1FX2A 4FL9A 1Q5VA 2IDEA 4H5WA 3H8YA 3OYCA 2OJ3A 3LDOA 4IFVA 4F25A 2BMBA 3GFXA 3UCUP 3MEDB 4WXWA 2K8GA 2Q0RA 4KB0A 4FS2A 2NYHA 4DPOA 2MZ1A 1S1VB 2Q3SA 4YORA 5CD4H 3KLHB 4GVBA 1MN7A 1QSYA 1P6TA 1NSKL 4KKOB 2DIUA 4BRAA 5SWMA 2F3JA 5FPMA 4AD6A 4OJHA 2V8VA 1RAIB 1X5PA 4E7IA 8ATCB 4I67A 3RBXA 4U8YA 3HI9A 4PXBA 2HFNA 2ZZNA 1MLAA 3QNWB 3THYB 4XTTA 1JJHA 2ZH4A 3A3OB 4UW2A 2HFVA 2IYGA 2XBPA 5L1IA 4F4XA 1S1TA 2I7NA 4H0YB 4F9OA 2QMWA 3BGRB 3KLFB 1H73A 5BR8K 2ZHBA 1RTHB 4NXMJ 4NYZA 3B4MA 2H5JB 5AR0A 1S0VA 1YI2N 4ZN3A 3H0PA 1RDCA 2BANA 4EHTA 4TY9A 2FJBB 2HS4A 3D1HA 2EFNA 3IAM9 3UN5A 3T5KA 4HEA9 1UVNA 3WZ0A 2J0QD 4M45A 2UUAK 4PABA 1Q7LB 1NJIO 1NO8A 3DU5A 2DHHA 1F60B 2QN6B 1GXTA 1T03B 2DXEA 1JJ2M 3L7OA 4YR2A 3PFOA 2WW8A 4FLVA 3HSTB 1HD0A 3O3FA 1QJHA 1JKHA 3PDNA 4BWJA 1Q81T 5D4LA 3SQ4A 2IBOA 3KHRA 3CXCM 4LF4K 3PSIA 3JYTA 1CJKA 1V3SA 2C2DA 5DLGA 2ZH9A 4A48A 3DWLA 4OLBA 4CZKA 2O5DA 4Y2CA 5H9EK 5ETTA 4F36A 4NB4A 2YPYA 3DMJB 4K42A 1VI7A 1HQEB 2IAJA 2GA7A 2B43A 1JK9B 4DR4F 1CQMA 2CAJA 2KT5A 4PHTX 4B3RK 1U09A 2GELA 1DBDA 1BUPA 3HBTA 1U1NA 2UUTA 5CHCB 2ZQBA 4M3WA 3G8TA 1SIWB 1G6BA 4A61A 4KYZA 3LW5C 1ZM4A 3PR5B 4O5FA 5DLFA 4DU8A 4CFDA 5C2DA 2Q6CA 4TYBA 2LXIA 2DFHA 3RG6A 3FSYA 3OYBA 2P6SA 4CZIA 3THTA 4C6AA 1NMNA 4I6YA 4DF4A 4KGMA 3BR9A 3KXDA 5I3UB 3ZZYA 3IS9A 4WKYA 3ID6A 1W26A 1ICEB 3K5PA 2ATCB 1FO1A 2OELA 2Q66A 3D6MB 3IAS9 3LPYA 3AOAA 3UDLA 9RUBA 2BRLA 2M52A 3ZT2A 2V50A 3D1OA 1OVQA 5AQJA 5DZ7A 2IVFB 3N28A 4C2MA 4GVBB 5LMUJ 1B99A 1HHSA 3BZCA 3CO9A 1DQ9A 3H98A 4OKKA 1RAJA 4ZLJA 2IM1A 3JXUA 3UKUA 5KFHA 1VCTA 3SAGA 4BVOA 3J7YU 3D0HE 5AE2A 2UUCJ 3M2RA 3U1NA 2KW4A 4CFCA 2FD2A 2D3O1 5KI6A 4FJKA 2ZE2B 1RBSA 4DJBA 2ZWHA 4LRFA 4BE0A 2ZH8A 4A62A 1YRTA 2ACMA 3GE1A 5K8NA 4DR6K 2W1BA 2HPUA 1UKUA 3FBCA 1FESA 3C8YA 3CE8A 4CZHA 4O3QA 3SMZA 2CZVC 4CD3A 4CLKA 3CD5A 2E1MC 4LQ3A 1N6QA 3ZNUA 4WK1A 3IKMA 3FSXA 3GR0A 1N36K 1ZAVA 2VPYB 2GCFA 3QZ8A 1TKTB 4OV6A 3FMWA 1IR0A 3LZJA 2QLBB 4O23A 4Q43A 1VSDA 4ERDA 1S4FA 4C11A 4K5RA 4JYAJ 2EFPA 3VF4A 3ZTOA 4KI4A 2B6AA 1D9FA 1QLNA 1GXUA 2MZJA 1ZETA 2QA4S 4K8XA 3CCMN 1VLOA 1YIJN 3LP1A 4B3RJ 5AQSA 4A59A 4PYDA 1RI7A 3LA0A 3AVBA 5CZXA 5TKYA 5F2RA 3OFGA 3OS2A 2M8HA 1RWPB 3C3LA 2NLWA 4RL1A 1W7AA 1CJTB 5F9LA 5FROA 3BP8A 1N34K 5HMXA 1NGAA 2XO7A 1BWFO 3H2VE 3L7UA 5G4DA 4LFCJ 1EETB 3QEVA 2OYQA 4O3SA 1HQUA 4JI5K 2FSJA 4ZK7M 1T05B 1QAIA 1IN0A 3D4JA 3HHKA 3QAEA 2E1ZA 3Q8PB 4GKKF 2YKNB 1Q9YA 1U1LA 2HNYB 4DCPB 3CM6A 2HNDA 3P49B 4M5GA 3AVCA 4O5BA 1KQSM 2F8MA 4IG3B 4UOHA 4DDFA 2ZH1A 1SKSA 1YTYA 3MR5A 2DNNA 4ZLNA 4FJLA 4Y1DA 4LF7K 3GB0A 2VKRA 2IVYA 1T94A 4K2XA 4PUOB 4CZJA 3N6LA 4J9VA 1VISA 2RVJA 4AM6A 4FJ7A 3R3LA 4BC4A 2HS0A 4BRDA 2VODA 1REVB 3LGMA 4CBWA 1RTJB 2BH1A 5LMUK 1QVFR 2DRDA 3VGUA 2F4FA 2PFFB 4KHWA 3W2VB 4KB1A 3K5NA 1QHTA 2JLEA 2DNOA 1TUYA 5AQRA 2KJVA 1QM9A 3SJHA 1SC4B 1EP4A 4OL8A 4X66K 1YG0A 2J5AA 1RTIA 2GHWA 4FPRA 1G2EA 3LH2S 5K8OA 4FXVA 3OYKA 4K41A 4CLSA 3HZ6A 1Y11A 3K5MA 2CQ1A 5T41A 3GP9A 4ZA1A 4YS2A 3UW1A 2XTJP 1Q16B 2R8JA 2YWFA 1QVFM 1CJVB 2UV8G 2DNMA 2FJWA 3HPGA 3OTDA 5AT1B 1M5VC 4HCCA 4UZBA 1RBTA 2ZJRQ 5KG3A 3GIKA 4MIAA 4M5LA 2ROGA 1NK9A 4B9QA 1YRUA 1P9QC 2P9IB 4J9QA 4DTRA 4Y6IA 4YQWA 1WAJA 2WSCC 2AF6A 4FWOA 4ECTA 3I8DA 4C3KA 2PT0A 3CJBA 3OPKA 3QATA 3M6WA 4FYYB 3L95X 1Z05A 5E3RA 1WBDA 1F9FA 2JLFA 3JTNA 1FXDA 4EFHA 5IWAJ 3T9ZA 1IG9A 3DC2A 3OTBA 1KLMB 3VQ9A 4RWXA 3RW6A 1VIOA 1VSIA 3IRXB 2HGMA 3CB4A 1O8BA 1D3WA 4ZITA 1S9EB 1PILA 2PZSA 1BC6A 4OI4A 1HNWF 1KLMA 3B54A 4N8NA 4J9UE 5B7WA 1EKEA 3AY9A 1C0FA 1GLDG 5IV4A 1RDWX 4CGHA 3VOVA 2R8GA 4EBDA 2DJWA 5AQKA 2NXCA 3V6KA 1GLLO 3D7SB 3NGTA 1LWFA 4MO4A 1WF1A 1N0UA 5DG9A 4UT4A 1WC3A 1OJ4A 4ZCIA 3HD1A 2DEIA 3ITHB 1SJFA 1FVSA 1K73T 4ANCA 1SJ4P 1X5TA 3MUMP 3ENQA 3THWA 1B4SA 3HHDA 4OI2A 3SCJE 1IBMJ 2FXUA 1JB0C 4IUFA 2CNKB 1VQMS 3J7AN 2VASA 1HQEA 2IAJB 5FPEA 1X9WA 3IMXA 4ED0A 3R27A 1SQKA 1L3KA 2AWZA 1K9MT 2V6AA 3POTB 1OYEA 2DFFA 1QE1B 1S4EA 5EWEA 4K0KF 4NI2B 4ELTA 3E9PA 2F9WA 1BWVA 5GIPA 4JI7J 3QO9A 1A5XA 4DBQA 2V94A 3UDCA 2G8IA 2Y0SD 1GTHA 1Z2LA 4U7CA 2F8HA 4WBFA 4CJ3A 3OYFA 4CFAA 1H1VA 1U2VA 3WUHA 1SAZA 4CT8A 2CJ9A 5DG7A 1Z2ZA 1KTVA 3LALA 4WKRA 5J2NA 2XQCA 1EIYB 5IWAF 1RT1A 3M6VA 3AAWB 2BW2A 2AGOA 1JXBA 3K8VA 2HBYB 5L1JA 2GVZA 2AJFE 4EUVA 5E7OB 1HNWJ 1XHXA 1U1OA 2VU5A 3JYTB 3BGRA 4FZYA 2G2YA 3N4PA 4H0TB 4DV7J 2KO1A 4ETXA 3QGGA 1GNKA 2DTUA 3VHQA 2KJWA 3IA0A 2VICA 4FYWB 3W9HA 3HKZD 1T7PA 4LH5A 1U1PA 4X4NA 1NJXA 3U3YA 2MZTA 1EWRA 3B4DA 3GG0A 1NHUA 4CLYA 3W2WA 3G6VA 2KM8C 2QTWA 4RUBA 1HNXF 1WTBA 5ETMA 4OMFG 1RWVB 4K7QA 2F8TA 3ZSWA 5F8GA 3W8PA 2NREA 1RU2A 3IG1B 5E33A 3EE8A 3NNAA 3KG0A 4A8XA 1ATSA 1JMTA 1WHYA 4F2SA 4ICLA 3T6JA 3SZ2A 4OPHA 4FCYA 4WFNQ 3JSBA 3O5TB 5IM0A 2B7CB 2PN6A 4O3NA 2Z1GA 2Z2LA 3KZBA 4C97A 1KTQA 4F3MA 3GU0A 1VSKA 3FLCO 3K0JA 2GV9A 3DU6A 4NLPA 2YJEA 3W60A 1GTEA 3UI3A 3VERA 1RBRA 2DPIA 4DR1K 3OFHA 1OH8A 2H1YA 3KKSA 3GLJA 3G25A 1S49A 4DLGA 4LY7A 1VQSA 4R79A 1L3TA 1D9AA 2PYJA 3CEDA 4DL4A 3FQKA 4ZHRB 3MR7A 3UR3C 1VQPN 2BJ9A 1R7IA 2GMHA 3ZSYA 1FXLA 4RUHA 2YWEA 3C46A 3MPYA 4KGVB 3W64A 4CYUA 4PL8A 4JI4J 3IR7B 4DG1A 5D8HB 2W2MP 4RW8A 1FNMA 3K9KA 2CFXA 2H4WB 1NUEA 3UN2A 1HPZB 1NHVA 2DHGA 4FWNA 4ZJLA 1TVRB 2RNEA 1FTCA 2UVWA 2Z4PA 2XHBA 2BGGA 2ABYA 4ED8A 4XH4A 2J7UA 3CVKA 1M1KO 1ASUA 5H9EJ 3CCRN 3LWLA 3AAQA 1A6LA 4AQYJ 2GAGC 2RHSB 4K4WA 2CWKA 2P9EA 5JVHQ 1EQYA 4DMZA 1HKCA 2H3GX 3RYLA 3ATUA 1L3VA 2GWJA 3M30A 4USKA 5E3QA 2A18A 5LMNK 1Y3KA 4EIAA 2KFYA 4KO0A 3VQ6A 1KVKA 1RT5B 3CCQN 4DLEA 5AFUA 4PAAA 3PX6A 4DUYJ 3KLVA 2D3ZA 1TL1B 1KKHA 3MPWA 4B3TJ 3NH0A 2V68A 2DGSA 5IXUA 3CD6N 4WFBQ 1S72N 4IKAA 3BF1A 4IG3A 5EVZA 1YVUA 4JI3J 1X4HA 3R2DJ 2QA2A 2OPPB 3T7ZA 2HIYA 1NK6A 1CC7A 4IXCA 4L75A 1U25A 2DY9A 2CQ4A 4N56A 2XMTA 4DMNA 1E3MA 3CJKA 1AZSB 1HWJA 4RWWA 1RWKB 5I4MA 2Z0GA 3PKYA 4DF8A 4O4RA 2M5YA 4CEBA 3MEEA 3C6UB 2XGQA 1GX6A 1VQ5N 4R25A 3ILLA 5KTQA 4LF2A 3VAJA 3ZNJ1 3OTOJ 4KHPK 3M30B 2RMLA 1N32F 1JLAB 1EO1A 3FQLA 4FK4A 3OJUA 4B3MJ 4J2EA 1NMDA 4OI1A 5HVHA 3G6ES 3DMJA 3VMFB 2JL9A 3KHYA 3VESA 4DR7K 2K1RA 3RMCA 3ZSXA 1FI4A 2FHJD 3EDRB 1PBUA 3PYEA 2E9ZA 1TVRA 4Z4EA 3A8JA 4C23A 4CGFA 4B08A 3N5FA 1YVFA 3T1YK 2QX0A 3UB5A 4B3RF 1MA9B 3SQGA 4ILJA 4HUGA 1ILYA 1KNZA 4L73A 2PO4A 5K14B 2R9LA 3FE1A 4A5AA 2GQ2A 2J6SA 4BR2A 4UF4A 2UU9J 1I3AA 2OZMA 4F4ZA 3LM9A 1HRHA 4K0KJ 5HP1A 1LWCA 3SV3A 4HH0A 1C0UB 3GSDA 3N4QA 2JWKA 4IEEA 3M8PB 4CF8A 2IBKA 4WE1B 3HSDA 3PEHA 4FYVB 4YY3F 3BDEA 1JL2A 3LDQA 5DM6L 4EP5A 2AJ2A 1VRTB 1HNVA 1VAZA 3DLKB 5D6GA 3QICA 1R8AA 3BZKA 5DK5A 5ELZA 3CCSN 4X64F 3KTQA 3W66A 2VWJA 1V4TA 1TV6A 4G65A 4WP3A 3X3UA 3MN9A 1ESVA 3PTWA 2QMXA 4I7FA 5G0RA 1H2UX 4KT0C 5AZIA 4UOGA 4LF9F 1MSWD 4DTMA 2UUWA 3P5TL 1TV6B 4BC2A 4MQ3A 3MMCA 2IPOB 3DLBA 1DURA 4D3GA 2JDJA 4ED4A 4RG8A 2LQ8A 1U02A 2BA9A 3DLKA 2O67A 2DNQA 3AVAA 2P6TA 4IWVA 1RAEB 4KIAA 3TAEA 5KFRA 1I6JA 4LSZB 5CR4A 3O80A 1SL0A 2XNQA 3MPUB 1YRXA 3EKUA 3CO0P 1ZPVA 4XO0A 1I5OB 1UVMA 1U0SA 4F3TA 5A2QU 4Q8EA 3ZSQA 5AJ3K 2F63A 1UEUA 3O3GA 4MO5A 1N5YB 2QA1A 4WU2A 3EICA 2FYXA 2VG7B 3I4PA 2RQMA 3OR2A 4OX7A 3CETA 4HTLA 4QYRA 1NCLA 2XY6A 2XWYA 2CQBA 3KFWX 4YDUC 3QFHA 4DV6K 1JLGB 2KG0A 1I94K 4JI2F 4GKJK 3J7AP 2F4VJ 2AEJA 4CEFA 2ZEJA 1S10A 2ZBCA 4WQ5C 4B3TK 3DXSX 1WORA 3O9QA 5EX5A 3ILIA 2XS2A 4NCBA 1AZSA 2BBEA 1RT2B 2VPXB 3E9LA 2KXHA 1FFSB 2QSFA 3LPTA 2RHKA 4CH7A 5LMNJ 3PO4A 2VDIA 4CJKA 3TUJC 4MAKA 2OMOA 5KFLA 5IQQA 3TAMA 3TAGA 3R6LB 3Q0AA 1U47A 1S1XA 5T7BA 5KPZA 3OBWA 3SSRA 4M3XA 3MN7A 3O3LA 4EYHB 3ZC4A 4OZ0A 3OVBA 2NSBA 2ZWOA 1G1XA 1OY8A 2B5JA 4CLZA 3OS1A 2DR8A 4EZ9A 3TZZA 1UFWA 1SUQB 1ZAWA 4I7FB 1VBZA 2HSEB 2XY7A 1SC6A 5J2QA 4DV6F 2JJ4D 4X4UA 1VFJA 5K5MA 1Q53A 1R31A 3AHPA 4ZP9A 5E84A 4WQ4C 3BV8A 1KVIA 1WG4A 4GV9A 4P7TA 1JLCB 3K59A 4HDHA 4DV3K 4TSXA 2NRWA 1Q9XA 3OXGA 2WCXA 3BB5A 4DV2J 6AT1B 2H9ZA 5KFNA 3P31A 1IBKF 1DQ8A 3UVJB 3OR1B 1WSRA 1VSFA 1B7FA 2XWXA 2I1RA 1WKJA 5K9FA 3CCJN 1V6HA 1FKPA 3MCAB 3DHWC 2CVIA 2RPIA 5C5JA 5G0RB 1WELA 1N36F 5JUMA 4A8YA 2MKYA 4J90A 5AQQA 3QIPA 4CNZA 4FVMA 1J5EF 2QL5B 1K8KA 3R5CA 5KG0A 3SJJA 4FJHA 4HACB 4NLVA 3M5RA 3QLHB 1BE4A 3CWJA 3CD7A 3FRZA 2B7BB 1A5WA 3M1VB 3MMAA 3M8YA 3AFGA 3BQ1A 3M8QB 2V2VA 3AH6A 4PWDA 2CPDA 4IRCA 2GO8A 2QWPA 1U2FA 3FBEA 1XNRK 1B70B 1FFGB 1PYSB 1E4GT 2G2ZA 3PIPQ 3CCUS 4KHYA 3V4MA 2CKWA 4NE9C 1XN9A 1FCAA 4I9LA 3SPZA 3FFIA 5AE3A 3R7BB 3SBGA 1VR6A 1WEXA 3N79A 1YJNS 1HBOB 4ISEA 3UCZP 5KOXA 2PI5A 3J8AA 2VBWA 4OGEA 4RNNA 4ECSA 1HJRA 5C15A 2JVOA 4BQZA 3PV8A 1IBLJ 4GO7X 3NGUA 4DQRA 3OTEA 1NPPA 1C0MA 3W2WB 4EO8A 3CJKB 4KJIA 1N8RT 4ED5A 1WI8A 4IH5A 2FVPA 5GAGU 1MG7A 2HHHF 3CJ8A 3FZ2A 2UXDJ 1ELOA 3AXMA 2F5GA 2JWNA 1Q82T 1KAXA 2V2QA 3GTYX 4WYWA 4A2AA 5BPNA 3L6QA 1TTHB 3C16B 4QPXA 2YHXA 5BN8A 3E1YA 2HHSA 1U7LA 5HAOA 1XJWB 2CJBA 4NLCA 2YNIA 5EUHA 2YNGA 1XBWA 1L3UA 4FWSA 4AUKA 5GAGI 1ZPWX 4AXIA 2UXDK 2NSCA 2N82B 5MLCQ 1RAAB 4H0PA 4NRTA 3HD2A 2E1YA 1ZAXA 3AXKA 3RW7A 4GC6A 4FYDA 1VSEA 2B9XA 2HQCA 4FLWA 2UUCF 2FZCB 4Z0UA 3DYAA 3I5CA 4LF4F 5A8KA 2HZCA 4W4MA 3BREA 4LF4J 2HHTA 3BSOA 4MDBA 2EX3A 4I2QB 2PC6A 4DS4A 1SIZA 4USUA 3LGHA 2CH6A 3RBDA 4YHHF 4CJVA 2AP1A 1WHXA 2IC3A 2BQ3A 5E3AA 5T14A 2UXBK 4IOAL 3PEJA 2QG9B 3O9SA 3QT5A 4IFYA 1WOOA 2G9OA 5D15A 5HL7L 2VJVA 2CJAA 1JLEA 3IWXA 2DPNA 3NMUA 2MQQA 2IRXA 1R27B 4UUWA 5J1EA 1VQLS 2PYLA 1F9EB 2GO9A 1X4GA 3TZWA 4LVOP 4DFPA 5B0FA 1T8EA 4ECUA 2Z57B 3ONQA 3ULHA 4CJQA 4I56A 3MPVA 2WVBA 3AO4A 2AZ3A 4H5VA 4Y28C 3MD1A 3KK2B 4Z4HA 2RH3A 2XYGB 3O44A 4FBUA 2E5LJ 3MM6A 3O6QA 3VF0B 1IBKJ 2E5JA 3L4IA 3VZHA 1KQSR 1Y5LB 3HFVA 4DR7F 1P27B 2YH1A 2OSQA 3POTA 4HYKA 4FYXB 2XS5A 2DHXA 1FRJA 2CDRB 1TAUA 1CG2A 1R0AB 4QWDA 1FKAF 1F9HA 3NF7A 4B3TF 1XTZA 3GJSB 1FHTA 4BGBA 2HBLA 2FVSA 4KAIA 1DTQB 1LW0A 2CG8A 1TL7B 3AA8A 4WU3A 1OY9A 2P5OA 2XNRA 4JV5K 3PZPA 4K2JA 2RDJA 3NGYA 2XYPB 3NGDA 2X3GA 3V9SA 2RB7A 2I5JB 5JS1A 2XLIA 1W9HA 3OFFA 2LSNA 2WRMA 3OFEA 3KK1B 1HBMA 2HKEA 5IM0B 4KRWA 3I33A 1RA6A 5C2GA 4E1MA 1KRPA 1YJ7A 3D6FB 5C25B 4K50A 4USMA 1XMBA 3KJFB 2LU2A 3IG1A 3TJ8A 2ZJPL 1RCXB 3PX4A 4A46A 7FD1A 2D9OA 3KK7A 4LF9J 3THVA 2IVPA 5F3TA 1IKXA 5D0EA 5GMDA 1QUPA 4KHMA 1RT6B 3GYXB 1RU1A 4ETZA 4RCHA 3D68A 3FEYB 5ETVA 1LOUA 3KUHA 3HM8A 2CGJA 4FO0A 3KK1A 3EZWA 3HO1A 1X4AA 3P6YC 4FWMA 3KK3A 2XMUA 3QJJA 4IO9L 3CCES 5F8JA 4E19A 1ATNA 1VQNN 4OHVA 2O3DA 2P9IA 2R4FA 2HMIB 5KFKA 4X64K 1S9GA 4EI2A 3H4BA 4HTJA 4LUBA 2P9KA 1X9SA 2F40A 2JWLA 2YPZA 1FW6A 3T19A 2DHSA 3CC7S 1LW2B 3ZX0A 4Y2AA 3VGSA 1KVBA 2ZKTA 2LCWA 2E1AA 4CK3A 4NO7A 1GMUA 4OPKA 3LUYA 2VBYA 2LU1A 4KY3A 2RIJA 1X9JA 3GV7B 3G0ZA 4FLXA 3MM9A 2DCLA 3GWCA 3OY9A 1W25A 2BM0A 2AU0A 2G8KA 4FP9A 1J6ZA 5M1PA 2UYTA 1LAWA 1FFWB 2KLAA 3EJMA 3TANA 1SV5B 5BXIA 2D9PA 3JQKA 2VGMA 4WIQA 1LWFB 1YF5L 4CF2A 2WK4A 2E2QA 3HPHA 5LMNF 3VR1A 3AQOA 3B78A 2Q43A 3DYAB 4I6MB 2UUBK 1N34F 1J27A 3NGKA 1U0HA 1A0OB 1RT6A 3DLRA 1OH7A 2M3DA 3OT9A 3ZZRA 2ZH6A 5A76A 3H59A 2WSEC 4BVPA 1FRIA 2HW3A 4TQSA 3CXCR 4UY85 1M1HA 2CQPA 2R7RA 4EHUA 4ZOSA 3EXCX 3WIVA 3S9HA 4X4RA 2VC0A 2L9WA 3VEVA 1VQ4N 3G71S 2FC0A 4HI1A 4CLFA 4JS4A 4KRFA 2HNDB 1TAQA 3H25A 3I55S 2CJQA 3U1LA 2QW9A 2RU9A 4NWBA 5DQIA 1SVDA 1B3TA 2NR0A 2W2QP 1K8AT 5L9XA 1YQHA 3ZX3A 2Z2ZA 5FLXO 2OD6A 1H6KX 5LJ3Y 1NK4A 3KJQB 2DR7A 3DHXA 3SCXA 2NZ4A 3BPSP 2HHPA 1UPPA 1IR2A 3HHEA 2VOPA 4FM2A 1VQ9N 1XI1A 1IKXB 4P73A 4KKOA 3CCWA 2RQ4A 5D4NA 5C2CA 5BYRA 3EUNA 3TAFA 3JSRA 2E2PA 2EI5A 4FLZA 2E7VA 1YTAA 5A8WA 4DTPA 1S7IA 1N6QB 5KFPA 1BGXT 4YDXA 2GJIA 2JEJA 4X4SA 4NEYA 1ZTTA 2DY4A 3HSJA 2B8PA 3M1FA 4GKKK 2V4JA 3CJ2A 1HLWA 4CT9A 3D6RA 4CEOA 2EWHA 1SJRA 2FLOA 1Y5NB 3IM9A 3OYLA 3R5JB 2DITA 3VAHA 1UVJA 4I6WA 3B8HA 1APSA 4ER8A 2NYIA 4ZVGA 1OO0B 3U9DA 3IWLA 4DZDA 3AJ2A 1N5QA 3SQ0A 1J5OA 2OMLA 4Q2LA 1YITN 4N76A 3OYEA 1LQ9A 3C6TA 4K5SA 3CD0A 4CO1A 1I94F 1NB2A 4H0VB 2ALYB 3I6PA 3FEZA 2XG8A 4QU7A 2G0JA 1KOOA 2I0XA 3ADAC 4M95A 3CIMA 3LQVA 1QD1A 5GADP 1TR0A 4DQSA 4B3OB 4H8KA 4FWLA 5BYQA 4FVCA 4LSNB 4Q0BA 1N33F 2KZZA 2V8DA 2ITMA 3AVNA 1WSVA 2HVIA 4JI4K 2I6WA 3NBPA 4OHXA 3C15B 4M5JA 4DUZJ 1X3NA 1ZBFA 3TTDA 4BG9A 4ENOA 2EFOA 3W5XA 4DUTA 3J7YP 5CYQB 1OPZA 3DGPA 3ZTSA 3IUCA 4WTOB 3SMPA 3QAUA 4KGZB 4HACA 5JS2A 5KFBA 2UV8A 4I2PA 1WDDA 3OYMA 3LPEA 3CGIA 4MH8A 2DY1A 3GBTA 1G15A 3HVRA 3TUZC 5AFUH 3H40A 2ZJQQ 1N52B 4EBEA 3O8MA 1HBUA 2HQDA 3PRDA 2E88A 2BKNA 3FFKB 4C8NA 2APOA 2F4VF 2QFJA 3CCZA 3UVJA 4LMZA 4KBIA 1WC0A 4CP5A 3W5YA 4P71A 1N54B 2XZDB 1XNRJ 1FF2A 4KH1B 3VGKA 1S99A 2BOAA 4ATNA 3LANA 3IS9B 2FBTA 3M7VA 2ADCA 4BLGA 2W4DA 4WF9Q 2LVWA 2FGCA 1NKCA 1BG3A 2N7CA 4JOUA 3RAQA 2WVCA 1HQUB 1PJ6A 2QLFB 3SUNA 1XMQK 1EETA 3HSZA 2FHOB 2V7YA 3FCVA 3TABA 1WC4A 1ZH5A 2UXBJ 4QZVB 3MR3A 3GIJA 1HPMA 2P51A 1GOBA 2WW4A 3WT0A 4WIIA 2D0BA 4RKUC 2BE7D 5A2QY 2NPIA 2B4UA 4V19X 2YNGB 4J37A 3FZFA 1NGIA 3P5JA 3RR7A 5LY3A 4JI8F 1TL3B 1TL4A 1QQOA 2FLPA 3M2VB 2K06A 4QIWD 1KWMA 3U4LA 1HNWK 4UOFA 1BISA 3J80U 3GFHA 4ZIWA 2DYAA 1FRHA 2CQ0A 4DTNA 3G4SS 3HOTA 3FGVA 1S0NA 3VAFA 1BY9A 3TUPA 1Q8IA 3KLGB 3I32A 1WSIA 2CDQA 1J53A 3D3CJ 3GPAA 2CUYA 2AEMA 4GO5X 4MIWA 1N48A 1VQ7S 3NHGA 1IM4A 2MDAA 4JI0F 2O8DA 3KK3B 5HQ8A 5LOQA 3NOGA 2ZVSA 4K25A 4CJEA 1Q7YO 2VQFK 4JEPA 1OH5A 1H0HB 3CNQP 2M2BA 3GQCA 2PMWA 4YR3A 2V4RA 3NLCA 3FR0A 1RISA 1SC3B 3QBCA 5DJBA 1G7CB 2R2TA 1ZA1B 4QW8A 3CG7A 2VG7A 1RNHA 3BKTA 5HLFB 2OTLS 3L2RA 4OO1J 2GUPA 1X4FA 1T3VA 2A6OA 1NM2A 4Y2IA 4CVNE 1Q79A 2ZJQL 3VQEA 2BJEA 2O66A 5L39A 4DFKA 4M63A 4WQ5A 2DPJA 2KHOA 2UXCJ 4BDZA 2ADBA 2L41A 3TJ9A 1CULB 2GIRA 2CGKA 4TQRA 3W3DA 3MR2A 3UPFA 2MXYA 4CK1A 5HP1B 2JNJA 3WX4A 1OMSA 1I94J 1K8KB 5J2MA 4PG5A 2A41A 4PG7A 1VQOS 4X64J 1S6QA 4FF1A 4CECA 2BE9B 5BYSA 1XERA 3CCVN 4CESA 2OO4A 5KFYA 3TQEA 4DSIA 1RDRA 1Y0HA 2GTDA 4NL5A 1RHQB 3CJAA 2UUCK 4A5BA 4X62F 1WDTA 3NF6A 1U48A 3VQ8A 1RDAA 3SQGB 2O1PA 2MJNA 1I51B 1M90T 2XMMA 3TRGA 3NF9A 1VJWA 3NWGA 5JMNA 3PSFA 5GAHI 2VQEK 2DKOB 3G4SN 3DOKA 2Q79A 3SUOA 1K6YA 4BWMA 3QEWA 4IDKB 3CIZA 1WACA 2AYBA 4TN2A 2R7XA 4WWSA 4A8QA 2DGQA 4ZVHA 1YXQA 2V8PA 3NP5A 5F8MA 1BLUA 4CJ7A 3MOJB 5C0YA 3MMBA 4DV4J 3W63A 5LMUF 3CFOA 1PGZA 4JKGA 3AVMA 1BHLA 4IO1A 2VCPA 1ZBTA 2YQ3A 3WX8A 3A5LC 5HN0A 4IFYB 2YX4A 5B0DA 2JZ5A 2O8DB 2OPQB 2PEBA 4IDKA 1X9MA 3ZSZA 1TL5A 5CA5A 5DO2A 4NYNA 1FKOA 1BQNB 1UVKA 1NPKA 4CH0S 1JNRB 4N77A 3P96A 4B1WB 1HW8A 1VSMA 1UJ6A 4O55A 1WC6A 2DTJA 4JV0A 1NK8A 2FF3B 4OKEA 3NS6A 1HL6A 2BJ7A 5AQVA 4LF5F 4A8KA 4X66J 2DB1A 2XEXA 1VRUA 2YVSA 2Y0BB 3PW5A 1ZZNA 2W42A 3SI6A 3CCLS 2VA3A 2RRBA 1C4CA 4X62J 4BHQA 2NXUA 3I0SA 3OUYA 5C24A 1ASWA 3PM9A 5GIOA 2YJFA 3CJ5A 1IBLF 2VG6B 5FDLB 3J81Y 4CIGA 4P52A 3KJVA 1SH0A 3MCOA 1NGJA 4DV7F 2KHDA 4JKBA 3SPYA 2FY8A 4PG6A 4O44A 2RE1A 1HJOA 3UKRB 3EPIA 1WSGA 4JI0K 5TKWA 1A9NB 5B0EA 1OY6A 1H74A 3CC4N 4X84A 1GMWA 4OYWA 2VWBA 3QGHA 4BRMA 2MQMA 3P83D 1FXXA 2DCUB 3DAWA 1RZMA 2R7YA 4DV0F 1HYSA 3NG8A 5LT5A 4JI5J 2PGCA 5JJBA 3OLAA 3OL9A 1X31C 4DR1F 2YWWA 3CC2S 2ZH7A 4CW7B 2WC9A 4FS1A 4KTQA 5FPNA 4ZP7A 3LP0A 4M94A 1N88A 4AF1A 3KG4A 2QYCA 3GJTB 4JI7F 3R9PA 3Q8RB 4Y1CA 4J9PA 2K3IA 3DM2A 4ZVQB 5H9FK 1M90O 3TEHB 1G99A 4K4VA 5KFIA 4LC9B 3AT1B 3SSSA 3I0RA 4RUAA 4ZVSB 1S48A 2HSTA 5FPDA 4WXOA 2BV3A 3UFCX 3B6OA 3DM2B 1NPRA 5AJ3F 3BQ2A 2CA9A 3EXYA 1MROB 1IJFB 2DGUA 4WFBL 4JI1F 4ZCMA 1SZ2A 4QIGA 3DNCA 4XDCA 4LFBF 3F41A 2YHBA 4CIEA 3PRVA 2R8KA 4XPCA 3D5MA 2H54B 4JN4A 3OTOF 3S3NA 2OCEA 2HHUA 2IY5B 2OANA 2J8AA 1IBLK 3MCNA 3VAGA 2KKZA 4MKVA 3RAXA 4LH4A 1T9XA 4BREA 2ZH3A 3NCRA 3NFAA 3IAYA 2RE2A 4PPDA 2KT2A 1RHRB 1M5PC 5HQMA 1NBWA 3IGVA 1NSPA 1UW4A 4DQ8A 3L4QA 2XZWA 1U04A 1JNZB 1VQ6S 3KNAA 2A6AA 4QR0A 2CH5A 3ZSOA 1XWLA 2Y1RI 1O1WA 1Y64A 4P6QA 3R1XA 4Q5VA 4IR9A 4OYAA 4NYPA 5GINA 3BO2A 3KMQA 1KD1O 4QU6A 3RR8A 3W9JA 1RLDA 1UWBA 3RSEB 4DHYA 1X4BA 2V9KA 2GVZB 4EFAC 2A0FB 2WB4A 3H6EA 2DR5A 2ZC4A 4WPAA 3X1LB 2MKHA 1BU6O 3AVHA 3EL2A 4PZVA 4I1TA 1MMDA 1CJUA 1WHVA 3MFHA 4Z94A 3V9WA 2GEMA 4CJSA 4PQUA 2M4MA 4CO0A 4OKJA 1BD6A 1VK3A 4CLWA 2Q0UA 1XK8A 2CQCA 4IH6A 4QJVA 3MUVP 1XNQK 1GEHA 3TO8A 4YY3J 1S1XB 5E3CA 4UUXA 3I56N 1EB0A 1QDUB 3KUEA 3LF0A 4X2BA 3I9ZA 4QAGA 2RJZA 3ZZ0A 1RTDB 1TYQB 4LF7F 2GZOA 1IVZA 1HI8A 4WQ4A 2AZ1A 4FPBA 3JS9A 2BVZA 4QS9A 1GLEG 4CZEA 3RU0A 1VQKS 2OP5A 4Y34A 2JH3A 2YXLA 1QAJA 3UE5A 3M8ZA 2LQ5A 1YTUA 2A10A 2HVHA 3L0QA 2V2ZA 5GAGP 4LSLB 2C22A 3G9CA 2OAUA 2MKKA 4OHZA 2JSXA 5J1NA 3DLHA 4JD2B 3CMAN 2CPYA 5SZTA 3E8OA 2LEPA 3VAIA 2JFKA 2WB1D 3J7ZO 2W6KA 3ENBA 2CIMA 2DNPA 7AT1B 1C0TA 1JCFA 1K0VA 1RWXB 2E1PA 1Q5YA 4NLYA 3DRXA 1WOSA 3K17A 4WYLA 1RJJA 2DNHA 3TZYA 4IJAA 1S1WB 1KSPA 1NU0A 2FJEB 4FLYA 2OUGA 4J2AA 4C0HA 2KDOA 4CQ1A 4KH0B 4FPIA 3MAHA 3DRRA 5BPLA 4BCAA 3S7RA 4KHPF 3PY8A 3D6TB 3HK2A 3WQPA 1RYSA 1WNSA 1QS4A 2Z1IA 3D28A 2BKOA 1IXKA 2E6MA 3O8WA 4PKGA 2VBZA 1FERA 2I5JA 4CZCA 4W5NA 2CQDA 1Y7PA 3SNNA 5AJ3J 3WQTA 3MGJA 4B1ZA 2BRKA 4OZJA 3AO1A 2HZAA 2YV0X 1FDNA 3S41A 4GY2B 3UE2A 3LP2A 4Z4FA 4QIFA 5ETRA 4URQU 3MTKA 2G8FA 2QYGA 4LF1A 2HAFA 2QE5A