1LW2A

Crystal structure of t215y mutant hiv-1 reverse transcriptase in complex with 1051u91
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
539
structure length
518
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFARKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLYTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
publication title Crystal structures of Zidovudine- or Lamivudine-resistant human immunodeficiency virus type 1 reverse transcriptases containing mutations at codons 41, 184, and 215.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 141
structure length 518
sequence length 539
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2002-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1lw2A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lw2A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lw2A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lw2A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1lw2A05
4TYBA 5DQHA 2OZMA 2IS3A 3V9WA 1TK8A 3M8PA 4KV8B 5EWEA 3BQ1A 4FJMA 4LSLB 3DLEB 4YMEA 2G8VA 3M8RA 3P83D 4Y3CA 4CJWA 4ECRA 1JXEA 2BE2B 2EX3A 1L3SA 1X9SA 4E1MA 3PV8A 2A1RA 1Q9XA 2VG6A 5KG4A 2DPIA 4C8MA 4TSXA 3AVIA 4E7HA 3THVA 4AH9A 1NK4A 3D5MA 4CE9A 4ID5B 4IDKA 2XI2A 2YKNA 5J2MA 2RKIB 1NK9A 3AVNA 2FVCA 5DGBA 1WSJA 4DQIA 1WNEA 3ZSXA 3KLVA 4MK9A 3CJ0A 5F8GA 4WYLA 3Q8RB 1QE1A 1IKYB 5KFZA 3VQPA 3OSPA 4KFBA 4Q5VA 1HPZA 2OPRA 3I5BA 1QSSA 5CY4A 1RNHA 4KB0A 4BACA 1DTTA 4M3UA 5KT5A 3KLFB 2YNGB 3ZT4A 4EP4A 1RT5A 2XGQA 1S10A 1NK0A 5KFOA 4DU1A 1TK0A 1YVFA 4TYAA 3MR3A 4PUOA 1FKOA 4KKOA 4CERA 4K4WA 1C0MA 4CJFA 3BREA 4J9SA 2YNFB 1N48A 1I39A 1RT1B 3TVKA 3QO9B 3O3FA 4WYWA 5EWFA 3CJ3A 4BWJA 3T19A 3AV9A 2UVVA 2XY7A 4KAIA 4FZZA 4KO0A 5L9XA 2RN2A 4I7FA 2KFNA 1TQLA 3CM5A 3NGDA 4IFVB 3O3HA 2XY5A 4YQWA 4QCLA 3UDLA 1RTIB 4W5OA 2BQRA 4GW6A 5KRSA 2C22A 2ITGA 3QGHA 5E41A 3ITHA 5D3GA 3AA4A 2J6TA 3EPIA 4GC6A 1TK5A 3QINA 2ZE2B 4RW6A 4ZPBA 4EEYA 1JIHA 4IRCA 1C0UB 1SV5B 1JLEB 2FBTA 4ED3A 3DOLA 3MEGA 1NKBA 3HYFA 4NCGB 2ZQBA 3DM2A 3SI6A 5CYMA 3P5JA 3U3GA 2HVIA 3D0PA 1W25A 4C8LA 4TY9A 3I0RA 4ECUA 5HRNA 5KT7A 4FZXC 4ZPCA 3OVNA 5KG3A 5I42B 3TARA 2IAJA 4O3NA 4Q43A 4B8CA 1S0OA 5KRTA 3V1RA 3RB3A 1DTTB 3L3UA 3VQSA 5KFSA 2W8KA 3AVCA 1IKWB 1S1VA 4R8UA 4RUCA 1XHZA 4KAZA 3DOKA 4XO0A 2HVHA 2O4GA 4OGCA 2IGIA 4Q45A 2X78A 3RR7A 3LP0A 1JLQA 2IM1A 3CDWA 3H5SA 4BWMA 1FKPA 3L2VA 3MAQA 1K6YA 4GMJB 4DG1B 1RDBA 1TVRA 1QS4A 4O3RA 4KREA 2IM2A 3LP1B 1C0TB 2IOCA 1SKRA 3OYJA 1TV6B 3IS9A 3V9ZA 2D0CA 4J9KA 5FRNA 5KFIA 1UAXA 2R8KA 3V6DA 4N76A 4OGEA 4J9LA 5FRMA 4EYHB 4IQXA 4AHCA 1C1AA 1EX4A 1BCMA 4CFDA 1LW2A 4O4GB 4DTMA 5D3GB 1KVCA 4WFZA 3LAMA 3NGZA 4CF0A 5K14A 1QUVA 4RW6B 3DLKB 4AHRA 1IKVB 1IKXA 2RPIA 5DLGA 4O0IA 4R5PB 1ZBLA 3PZPA 4JV2A 1IG9A 1TAQA 4PY5A 3DM2B 1L5UA 4EP5A 3CG7A 4LH5A 5J2QA 5EUHA 3GILA 5F8NA 2OPQB 2XGPA 3SPYA 3PR5B 2OPSA 2IAJB 1JXLA 4Q0BB 1W9HA 3ZT1A 3IG1A 2QKKA 3AA2A 4OLAA 1KCFA 4HHTA 1HYVA 4N47A 3KJVB 4O0JA 4K4VA 4B8AB 1T05A 3MF5A 4HUFA 3OYHA 1N5YB 3MECA 4C8OA 5KFRA 3DYAA 4DS4A 2HB5A 1T3NA 4K4TA 4RZRA 3KKRA 1LWEB 4FJIA 4IBNA 3LP0B 2C28A 3V9SA 4HUEA 4CEEA 1U48A 3S3OA 1JLCA 3H5UA 2OZSA 4Z4GA 3CIZA 2AGOA 2AU0A 1WAJA 1DTQB 2VWKA 2ASJA 3OYEA 2VA2A 5DK5A 3N6LA 4CK3A 1RT2B 1RBUA 4W5TA 4EO6A 4RW9A 1GOCA 3C6TA 3V6DB 3QNOA 1B9FA 4IR1A 4B08A 1S6PB 3HKWA 2ZKUA 4NLWA 3G6VA 3KK3B 3LAKA 3KIOA 3NL0A 2O5DA 2BRLA 3EYZA 3OYDA 1CZBA 1KTQA 2AJQA 4RNFA 4F2SA 4CESA 1UA1A 3KK1A 1FK9B 1LWFA 4DFPA 3AVMA 1RT4B 2OA8A 1TKZA 1LW0B 3N6NA 3H40A 5HRSA 1RCHA 1ZBFA 2ZD1B 4KTQA 1T03A 2C2EA 3OYNA 2OPSB 4DQPA 5DG7A 1S6QB 2FBVA 1GOAA 1Z25A 2W7PA 5C24B 4CJUA 4M3WA 5KT3A 2ATLA 4FK4A 3MEEA 5FROA 2HNZA 3KLGB 3H98A 4B3OA 1JX4A 3V6JA 3TAEA 3BSOA 5F8MA 1ZTWA 3BR9A 3ALYA 3T5KA 4IRDA 3QERA 4KTZA 1CXUA 4QW9A 3MECB 1S9EB 4NLVA 3KLEB 3H5XA 1HQUA 2ATQA 4PQUB 2D3ZA 4ECXA 3WNEA 4B9MA 1RT7A 4LQ3A 1LWCA 1QHTA 3KHGA 1JLCB 4CJ4A 3SUPA 2XY8A 4RG8A 4KHSA 2F8SA 5T7BA 4DTUA 2R7YA 3AA3A 4XPEA 2R2RA 3PY8A 3VQ5A 4ZMMA 4KB7A 3C94A 1RYSA 4XIUA 3QGIA 4K4YA 5DGAA 2ASLA 3LPTA 3H08A 1HJRA 2XRIA 4XPCA 4H8KA 3GIMA 3NF9A 3T5LA 4DTNA 4U7CA 3PX0A 1YTAA 4LQ9A 3DRSB 5EU7A 1WSIA 1NKCA 4KV8A 3TANA 4B9UA 4BDZA 5HRPA 4AHUA 5EDWA 2EC0A 3DLEA 3BSCA 3OYFA 4QW8A 4TQRA 1W0HA 1SH2A 3KK1B 1WAFA 3GIJA 3K2PA 2BE2A 2I5JA 2G8IA 3PJXA 4M3TA 3KLIA 5HP1B 2FJWA 4KI6A 4ID5A 3SV3A 3QIDA 3HPHA 4MFBA 4C8KA 4TLRA 2RKIA 4YR0A 2QV6A 4ZP6A 3MFIA 1NOZA 2FVSA 3VQCA 4LY7A 3PW7A 2CJQA 2W9CB 1IKYA 3T5JA 1S97A 4Q44A 2W9AA 2HHVA 1S1XB 3NDKA 3H59A 1EP4B 1UA0A 3CJ2A 3RMCA 1ZBIA 3RRHA 4ECZA 4OVLA 1BL3A 3RBEA 2YNGA 1KRPA 1RT7B 4NRTA 2VG5B 4ZVFA 4K4SA 3FQKA 4RW7B 5J2PB 3SI8A 3B6OA 3KLHB 1HARA 4J9QA 4OKJA 2XY6A 3KMSA 3KMQA 2O4IA 2ASDA 4O55A 2YNFA 3HJFA 2IBKA 3UPFA 3G10A 3TWHA 1LAVA 1T94A 4CJ3A 3QO9A 4DL4A 4F3OA 2IDOA 3BDPA 2FVRA 2IMWP 4FLUA 2BGGA 2P5GA 2JC1A 3C95A 2E9ZA 4PA1A 4NYFA 4H54A 4IFVA 1IH7A 3NH2A 1RTIA 4DTPA 1QSYA 3GIIA 4DFMA 2WHOA 1XR5A 2WB4A 1F21A 2DFHA 2I5JB 4Y1DA 3F73A 5KFNA 4DS5A 2GIQA 2LSNA 3KLIB 3DLHA 1JL2A 2D0AA 1Q8IA 2ZE2A 4OJRA 1VRUA 4W5QA 1RDCA 1C0UA 1SV5A 1JLEA 4BE2A 1RTHB 4MFBB 2R8GA 4RNMA 2B5JA 3OL9A 4F4KA 4FJGA 2YKMA 2R8HA 4NCGA 1SH0A 2D7SA 2IJNA 2KZZA 3I0SB 2RDJA 3PW5A 1CXQA 4LH4A 4DTSA 5I42A 2C2DA 1ZYQA 4IG3B 4E3SA 1S9FA 4E7JA 1KVAA 3NAEA 1JLBA 1D8YA 5KG5A 4KHYA 4DEZA 1IKWA 1NK7A 3OSNA 4CIFA 5KFUA 5L1JA 4J2AA 4DMNA 4YR2A 3OYBA 4O3SA 5L1KA 4ID1A 4FJXA 1RTJB 4L8RB 4QWAA 1XI1A 1HYSA 1TKXB 2QKBA 3N6MA 1EKEA 4CGJA 3AA5X 5C42B 3AVAA 1HQEB 3FRZA 3LZJA 4NRUA 2PYJA 4DG1A 5KG6A 4KPYA 3NE6A 2YNHB 3V4IB 4CJLA 4KTWA 5HROB 3S3MA 3LP1A 4RU9A 1C0TA 1CLQA 1UWBB 5FDLB 4TN2A 3MFHA 1TV6A 1K1QA 4M42A 4FW2A 3I5AA 4FS1A 3L3VA 4HKQA 3DLRA 4B9NA 1G15A 2GC8A 1RA6A 4FJ9A 4OKEA 4DTJA 4MIAA 3JSMB 4ZPAA 4J2EA 4O4GA 2G8FA 1D0EA 2ILZA 1X9MA 3QNNA 3KHHA 4OKKA 4M3ZA 1X1PA 1VSHA 1J53A 3DLKA 1VRUB 1IKVA 4NLUA 4FLZA 1FXXA 4CHNA 3SQ2A 4R5PA 3CWJA 2B5JB 4MIBA 2YKMB 1TGOA 2W42A 4CF8A 1QTMA 4CJTA 3U3YA 3AVHA 3KNAA 4IKFA 4OLBA 4WE1A 3QZ8A 3NKYA 4J9RA 3L2RA 2OPQA 1C1BA 4Q0BA 3GQCA 1EETA 1SUQB 1TKDA 1JLBB 2KTQA 2E6MA 3NH0A 4CECA 4DQRA 4CHYA 1VSMA 4I2PB 1S49A 3IGVA 3KJVA 3AO5A 4FJ7A 3PJWA 1N5YA 1BQNB 4RNHA 2V0NA 4ED6A 4FK0A 4IRKA 3ZSOA 1HYSB 1LWEA 1JLGB 1KSPA 2HMIA 1D5AA 3M8QB 4NYZA 3B6PA 4K4XA 1BI4A 3AVLA 3OYLA 4Y1CA 1SL0A 3FSIA 2FVQA 2W8LA 3ZT3A 2KW4A 4FLVA 1YVUA 1T7PA 2IJFA 1S1UA 4ELTA 4FJJA 4CF1A 4IR9A 3RWUA 3WNHA 4RW8A 3KK2B 1DTQA 4UQGA 4TQSA 4DF8A 4CIGA 3KD5E 1RT2A 4F4ZA 4HTUA 4X2BA 2P1JA 4H4MB 4W5RA 4ZP7A 4JV0A 3QEWA 2PYLA 4CK1A 3QGGA 1S6PA 3PW0A 4DTRA 2I1RA 4ECTA 1S5JA 3KK3A 2OYQA 1QAIA 4FJ5A 1S48A 4F50A 4ZVGA 4KHQA 3V1OA 2BQ3A 3WNGA 5F8JA 3OS0A 4CJVA 3SV4A 3KTQA 3UR0A 3QLHB 4ELUA 2Z1GA 3HPOA 1RAJA 4URSA 1ZETA 3KHLA 2XI3A 3M8SA 1FK9A 3NF6A 4MQ3A 3IRXB 3NHGA 1VSJA 5KFWA 3TI0A 4GC7A 4M45A 2KQ2A 4G1QA 1RT4A 4Q8FA 4HUGA 1LW0A 2ZD1A 3HT3A 4WE1B 4ZTJA 2IM3A 4RUAA 4DSEA 3SNNA 4DSKA 5C5JA 4KHNA 3LANA 4J9OA 1C1BB 4EBEA 1HRHA 1S6QA 4ED2A 5C24A 1EETB 4IKAA 2XCAA 1BIZA 3HVWA 3KLGA 3RTVA 3VQ4A 4Y34A 1D9FA 1NJYA 4AILC 1VSLA 3KKSA 4G3IA 2B4JA 5I3UB 1RBTA 4J2DA 3OYGA 3JYTB 3SJJA 1S9EA 3AVFA 1YTUA 3KLEA 4JLHA 4M41A 3AVKA 4F3TA 2HMIB 2R2SA 4MKBA 3V6KA 1REVA 2DPJA 4K8ZA 4PQUA 3CVKA 1BI4B 4B9SA 3QZ7A 1XR7A 5DG8A 3GV7B 3DI6A 3OYCA 2HWHA 1S1UB 1ASWA 3OYIA 3SQ1A 4K50A 4LD0A 2UUTA 1ZBHA 4Z0UA 4FLYA 2FJVA 4RW8B 4NLGA 1I6JA 2WCXA 4I2QB 3MR6A 4URQU 1S9GB 4ECWA 4K4UA 3ZT0A 3TAMB 4KI4A 4BDPA 3IGNA 2ILYA 1ASVA 1NJXA 4ED8A 3M9OB 4MK8A 1RTDA 3ZT2A 3FFIB 3ISND 3DRSA 1QSLA 3T5HA 4GVMA 2G8HA 2RF2B 3E01B 4NLPA 2HNDA 1TP7A 3GV8B 2FC0A 3O3GA 3L2WA 4FCYA 4FLWA 4ZVHA 3NFAA 3V9UA 4DU4A 1KHWA 3DDKA 4G1QB 2F8EX 4FYDA 3NGIA 4KHUA 3HXMA 5HP1A 3HP9A 5L1LA 4QWBA 4NLXA 3OLAA 2KZMA 2Z1IA 4DQSA 1YT3A 4QWDA 5KG7A 4K4ZA 3SYZA 3OYMA 3PW4A 1S0NA 2Z1HA 2WONB 1C6VA 3H4DA 4I9LA 2W9CA 4F4WA 1BQMB 1D1UA 1GX5A 3ZSZA 3OYAA 3HK2A 1C1CA 1S1XA 3UIQA 4BE0A 1JLAB 1EP4A 3CJ4A 3OLBA 4Z4EA 2P5OA 1REVB 4FBUA 3DRRB 2VG5A 4ED7A 5KT4A 4H4OA 3WNFA 3DI6B 3G0ZA 4RW7A 5J2PA 1TL1A 5SZTA 1QAJA 2BANA 5KFTA 2AGQA 2YV0X 3KLHA 3OS2A 3SUNA 3OL6A 5T14A 1KFDA 2Y1JA 1HMVB 5HBMB 1B9DA 4B9LA 5KT6A 2FBYA 4PWDA 4CJKA 2OH2A 3RMAA 1Y97A 4IG0B 4Z4FA 4HYKA 4CGHA 3NAIA 3MXJA 3VA3A 2VG7B 2OPPA 3MTKA 4NZ0A 4M94A 3LP2A 4O4RA 1N56A 3PX4A 3I8DA 3TABA 4IFYB 1RTDB 2V4RA 1SH3A 2HHSA 2F96A 5KFGA 4M3YA 2WRMA 2HNDB 4DL5A 4OPJA 4K8XA 1J5OB 4CHZA 1ASUA 1RBVA 4U6PA 4ZP9A 4YP3A 2IA6A 3LP3A 1WSHA 2F8TA 1X9WA 3KD1E 3LPUA 1WSGA 2DY4A 4F4YA 3U6FA 1XR6A 1BHLA 2FVPA 3CQ8A 4RW4B 3ZSYA 3GIKA 3TAPA 2X6SA 1RTHA 4NLDA 3OJSA 3NAHA 3TAGA 3LZIA 4C8NA 4EO8A 1IO2A 4LSNB 4DTOA 4E7LA 3I0SA 4N41A 3C6UB 4CHQA 2D3UA 3DLGB 1L3UA 1C1CB 5DMRA 2B6AB 4IG3A 2R2TA 3HL8A 3T3FA 2E9TA 3IAYA 4H4OB 1XC9A 4CJQA 3RBDA 3CFRA 1TL1B 1U4BA 1RTJA 2BANB 1TKXA 4DF4A 5KG2A 3MEDA 2UUWA 5DG9A 4CJSA 3HPGA 4NLQA 5C42A 5KI6A 3A2FA 1HQEA 3DRPB 4PWDB 3BQ0A 5DQGA 4RNOA 2AWZA 2W7OA 4QOZB 2YNHA 3V4IA 1RBSA 3ZSVA 1SL2A 5HROA 4E0DA 2OPPB 1MU2B 3MXMA 2VWJA 3LP2B 3DMJB 5KFEA 4CF9A 1UWBA 5FDLA 4OPKA 2WK4A 4URGA 2HNYB 3L2UA 2V4QA 3K58A 1N4LA 5KTQA 4IH5A 1MMLA 4TY8B 4AHTA 3VQDA 3RMDA 3CDEA 3JSMA 4O3QA 3OJUA 1O1WA 4CF2A 2WOMB 3OYKA 3SFGA 4FJHA 1VSEA 2GBZA 3SQ4A 2PY5A 4J9NA 5KG1A 2WTFA 3QEIA 5F8IA 2YHAA 2JC0A 1BCOA 2XHBA 1JKHB 2BRKA 1RA7A 3AVGA 4CFCA 3VQEA 3SZ2A 5KFBA 2GIRA 2G8KA 3AVBA 3ASMA 3OHAA 1HNVB 1UOCA 4HCCA 1J9AA 1RT6B 5DQIA 1JL1A 2ETJA 4WXOA 4FJNA 3NBPB 1SUQA 4NLOA 3L8BA 2A1SA 3HSTB 2XC9A 4I2PA 4ECQA 1NJZA 4QWCA 3PHEA 2BQUA 1S1WB 3ICLA 3KHRA 4DFJA 1RT3B 1NK8A 2HHUA 1BQNA 3CFOA 5KG0A 4NLTA 5KFDA 5L1IA 1JLGA 5HRRA 4DLGA 4CEFA 4KB1A 3MEDB 1N6QB 1C2PA 3M8QA 2YNIA 3E51A 3NF7A 4E7KA 3ZCMA 1S0MA 4ZPDA 4HCBA 4DWIA 4O44B 3OS1A 4Y2CA 3RAXA 3KK2A 4MH8A 5KFCA 3SUQA 5CYQB 3L2QA 2R2UA 2XO7A 1NHUA 4CHOA 4KHWA 2AQ4A 4H4MA 3HVTA 3VQAA 4FXDA 3RRGA 2G8WA 4B9TA 1BGXT 3SQ0A 4EBDA 3AO1A 4M95A 3PUFA 1IM4A 5JUMA 5KGWA 5F8HA 4NYNA 3M8PB 3H5YA 1NHVA 3QLHA 3CDUA 2UVUA 4JRPA 4WZMA 4JS4A 4E7IA 3IRXA 3RMBA 1HNIA 3RB4A 4J9MA 3RR8A 2VG6B 1KHVA 2W9BA 3HHKA 2BDPA 4IDKB 5JS2A 2YKNB 4ICLA 5J2MB 1RYRA 4DL2A 4FM0A 4ZP8A 1VK0A 4ELVA 4CIEA 5JS1A 4CGDA 4DLEA 4E1NA 2IM0A 1KLMA 2HW3A 3VQBA 5I3UA 3V9XA 3EZUA 1QE1B 3D45A 5J2NA 1NJWA 1T8EA 4KFBB 5KFFA 3JYTA 1HPZB 4Z4HA 4CJ5A 2OPRB 4E89A 3CFPA 4DSFA 3FDSA 4KE5A 4FVMA 3GYNA 5KGXA 4O3PA 2YNIB 3TAFA 5EWGA 1RT5B 3S9HA 5KFMA 2RDIA 3HM9A 4Z4CA 3K5LA 2HAIA 4JS5A 2HHQA 3QIPA 1SL1A 3BGRA 4CEZA 4J2BA 4PUOB 1FKOB 4KKOB 4I2QA 3QETA 1GX6A 3SUOA 3HP6A 2BR0A 1S9GA 3NGYA 4ZVEA 3HVTB 3TAMA 2ALZA 4NCBA 2FLLA 4F2RA 1A5WA 4WFYA 3MR5A 3SPZA 2HHXA 1VSFA 4IH7A 3ZSRA 3FFIA 3VQQA 5SWMA 1LV5A 3QEPA 2RF2A 3E01A 4KO0B 4I7FB 5C25A 4N5SA 4FLTA 4W5NA 3EPGA 4NLRA 3GV5B 2VA3A 1WN7A 2B43A 2GUIA 3KOAA 1A5VA 4I9QA 4QWEA 1HNIB 3K5OA 4CEOA 3BSNA 3VA0A 2R8JA 2YHBA 3ITHB 2J6UA 3TQ1A 1SKWA 3VQ9A 2DTUA 3NF8A 2Y1IA 4F8RA 4CJEA 2C2RA 2W9BB 4YFUA 4EBCA 4NCAA 2V9WA 5HLFA 3Q8PB 3UQSA 4MK7A 4ICLB 3M9NB 3HVRA 3DOLB 3MEGB 4DSLA 5CYMB 2WONA 4FBTA 4KHMA 1KLMB 3I0RB 2HHTA 1BQMA 1NK6A 5J2NB 3LALA 4DU3A 4B9VA 2HWIA 4KSEB 3I5CA 2UVRA 1BIUA 5KFYA 3QESA 3NCIA 3V6HA 4DL6A 2E9RX 1JLAA 3HO1A 2JEGA 4R0EA 5KFJA 4AHSA 3DRRA 1NK5A 4ZHRA 5DLFA 4QAGA 1S1VB 4R8UB 3RAQA 1VSIA 3LWLA 3DOKB 4NLSA 1L3VA 1R0AA 4DFKA 3QIPB 2AGPA 2Z1JA 2DFEA 3BGRB 3ISNC 5F9NA 3Q8QB 4ED0A 3BSAA 3S3NA 4MKAA 1JLQB 1ITGA 1HMVA 5HBMA 1CSJA 1XWLA 3Q8SB 3CJ5A 4ECSA 4CEQA 1FKPB 1LAWA 2QK9A 5KFLA 2EHGA 4IG0A 2JEJA 3LWMA 2QXFA 1TVRB 2X6NA 2VG7A 4HVJA 5J1EA 4FM2A 1U47A 3VQ6A 1JXBA 4CEBA 4IFYA 4Q8EA 4WXWA 4O3OA 3IS9B 4CGIA 1KVBA 1U09A 1VSDA 4CHPA 1VSKA 5C25B 4KHRA 2QE5A 2AX0A 1J5OA 3PO4A 3PO5A 3AO4A 1LW2B 3SCXA 2GV9A 4CFAA 3TR8A 3K59A 4OL8A 4FJ8A 5K14B 2D41A 5JXSA 3EY1A 4ECYA 4RW4A 1IKXB 1U04A 5HLFB 3TAQA 3CM6A 2DFFA 5CZ2A 2Q3SA 4KRFA 2J6SA 1RDRA 3OL8A 4DSIA 4IH6A 1KLNA 3ZSQA 4JUZA 3ULDA 1JLFA 4LSNA 4YNQA 4DTXA 4WFXA 3C6UA 2X74A 1B92A 5J2QB 4Z4IA 3K57A 1ZTTA 3DLGA 2FBXA 4CGGA 1RDAA 5KFHA 1WSEA 1TKTA 2B6AA 3CYMA 1S1TA 1VRTA 3VQ7A 3IG1B 5KFAA 1RBRA 1J54A 3O4QA 1D9DA 3SFUA 3EZ5A 4CEDA 3OL7A 4ZHRB 3V1QA 2UVWA 3QEXA 3H4BA 1T05B 4DSJA 3QIOA 1R0AB 2JGUA 3PX6A 4Y2AA 2XWYA 3QYYA 3DYAB 4M3XA 2IC3A 3DRPA 4ZTFA 1Z4UA 1ZBUA 1WSFA 4CJRA 3M9MB 3K5NA 4E19A 1MU2A 5J1EB 3ZSWA 4QPXA 3DMJA 2FLPA 3IN5A 4NLYA 4CK2A 1NOYA 1SKSA 4F4XA 3PR4A 2HNYA 2E4LA 2JLEA 4RW9B 3BJYA 2D0BA 1S4FA 2JEFA 3VN5A 5KFPA 3NH1A 3C6TB 2P51A 4N56A 2PZSA 3V81A 2R8IA 4TY8A 3VQ8A 1U49A 4DL7A 1Z26A 1NNDA 1DLOA 1TL3A 1U45A 3AO3A 4O5BA 3HVAA 3CO9A 1RILA 4IOBA 5KFVA 3AVJA 2WOMA 3K5MA 4FM1A 4CGFA 3AO2A 2XCPA 1OS5A 4CJPA 1I3AA 4LSLA 1RDDA 3LDSA 3PW2A 5CZ1A 3O4NA 4WZQA 1JKHA 4JRQA 1LWFB 2HHWA 1QQCA 1JLFB 3T1AA 3MXIA 1K1SA 1TKZB 2CKWA 4M3RA 1T03B 1HNVA 3FQLA 4KBIA 4FZYA 1EXQA 2NUBA 1RT6A 1TKTB 3RB6A 5KFXA 1S1TB 1VRTB 3NBPA 3RB0A 3MEEB 4J9PA 2HNZB 3NMAA 4B3OB 1WNSA 4CEAA 4FW1A 4EYIB 4BE1A 4ED1A 2FLNA 1S1WA 4DL3A 1HYZA 2JEIA 2E6LA 3H2LA 1RT3A 3F9KA 1NKEA 4FLXA 3G6YA 1WLJA 1Q9YA 1L3TA 4FJKA 4CFBA 1HQUB 1N6QA 4CCHA 2IC3B 3BQ2A 4RNNA 2AX1A 4ECVA 4EZ9A 3KLFA 4YR3A 3G6XA 1LWCB 4AHVA 3PVXA 1GOBA 4O44A 3G86A 4FS2A 5KFQA 3MR2A 3P1GA 1CZ9A 5KT2A 5F9LA 1A5XA 3OHBA 5CYQA 1BISA 1TAUA 1KFSA 2D5RA 1XHXA 5F8LA 3D28A 1RT1A 2KFZA 4TXSA 4JV1A 5KFKA 3QEVA 3OY9A 4EZ6A 3V81B 4FJLA 2FJXA 4BDYA 2G8UA 4FK2A 1DLOB 1TL3B 4DQQA 3DLBA
chains in the Genus database with same CATH superfamily
4TYBA 5DQHA 1AFJA 2OZMA 2IS3A 3V9WA 1TK8A 4U95A 1SJQA 3M8PA 4KV8B 4NXNF 4LSLB 3QFUA 4F04B 3EN9A 1KVIA 4JKCA 4OZ0A 1FESA 1JXEA 2R4FA 3G87A 1JWWA 2EX3A 1L3SA 4DCPB 1X9SA 4E1MA 2BTFA 4ZVRB 5KG4A 3I55N 2FF6A 3IAS9 4C8MA 4OI2A 1NK4A 3D5MA 4EGLA 3FZLA 2Z2ZA 1ZZFA 4CE9A 1RCXB 3CDBA 2YKNA 5J2MA 4DV3F 2RKIB 4FWQA 1NK9A 2FVCA 5DGBA 1CJVA 4Y65A 4K5RA 1OYDA 1W97L 3KLVA 3CJ0A 2V6AA 1IKYB 1VC6A 2QXLA 1HPZA 3M2UA 2QWOA 2UU9K 2OPRA 2DR8A 5CY4A 3G25A 1KAYA 2H54B 5LJ3Y 3R9LA 2YNGB 1WC1A 2B51A 4EP4A 4W98A 4BBYA 3UCUP 1HW8A 4DU1A 4DV5K 3HT0A 4TYAA 3MR3A 4CERA 2ATCB 2MKKA 4J9SA 3R5DA 1N48A 1I39A 2KJWA 3H25A 4PKDB 3DXBA 4LBIA 3AV9A 4OMFG 1NMNA 2BW2A 2GEMA 1TQLA 3CM5A 2CPJA 3HSZA 4QCLA 3CHWA 1OMSA 4BGBA 2GA7A 1RTIB 3IA0A 3EE8A 4GW6A 5KRSA 3IBCB 5A76A 2VOPA 5E41A 1Q86T 1WKJA 4WJBA 3JTNA 4GC6A 3LGMA 2ZE2B 4ZPBA 3WUHA 3R7BB 1JLEB 4KBOA 2EXUA 1H6KX 3HD2A 5CYMA 3P5JA 2HVIA 4C8LA 4BR9A 5HRNA 4DR5F 4GV3A 5JICA 1HNZF 1MLAA 4LF5J 4LF9F 1A0OB 3QBXA 4QIFA 1JJCB 4P2MA 3V1RA 4FPIA 4A5BA 3QMLA 4GRSA 1Z05A 4R8UA 1UEKA 1VQ8S 4XO0A 2LQ8A 4W92B 5AQRA 5LXRA 2X78A 4LIWA 3RR7A 4PAAA 2IYIA 2JRSA 4R25A 4GMJB 1FNMA 4F9OA 1QVGR 4DG1B 2BZ2A 3CCVN 1WC3A 4O3RA 2ZH5A 4KREA 4KPCA 2E7XA 2IM2A 3LP1B 1C0TB 3W5XA 2K1RB 2H51B 3AGKA 3MCSA 1K0VA 3F2KA 3OYJA 2O8EA 3IS9A 1D8ZA 4CBXA 2P9NB 1KOHA 2D0CA 5BYSA 4M63C 3M8YA 2NRWA 1YAGA 3ZTOA 4IQXA 1C1AA 1EX4A 1OSCA 4O4GB 4DTMA 2X1FA 2JNJA 3KKFA 3NGZA 1T6DA 3DLKB 1LOUA 1T9YA 5DLGA 3CPWR 4FL9A 4PY5A 1VQ4S 4BC7A 1IG9A 2E1AA 3LO3A 1BMQB 1FVSA 2EFQA 5F8NA 3SPYA 3ILLA 2OPSA 1W9HA 3ZT1A 5A8WA 3CMES 2CADA 2HIYA 5HJXA 1OPZA 3KNGA 3LGNA 3BGLA 2N7YA 2VDIA 2GVZA 3C16A 4PPZA 3P6YC 2O01C 4B8AB 2RNEA 2J8AA 1N5YB 3SQGB 4DV4J 1CPZA 2SXLA 3DYAA 3RBXA 2HB5A 3TYTA 4IBNA 1PYOB 2P9UB 4HUEA 3Q7BA 1TYQB 1TELA 3AD7C 4QIEA 3OTDA 3H5UA 1M1KO 4Z4GA 2D1KA 2AGOA 4BRIA 2UXDJ 1WAJA 3AJ1A 3EEQA 5TKYA 4WK3A 2KT3A 5E7OB 3HDSA 4P10A 2IIHA 2VA2A 1LNQA 2P2CB 4CK3A 1YIJN 2Y1LB 1UVJA 4RJVA 3HM8A 4OX6A 3V6DB 3QNOA 1ZAVA 2WAQD 5CZXA 3G6VA 4LF4K 3LAKA 2WTUA 2DGXA 3BEXA 3J81O 2NZCA 3EYZA 3OYDA 4PPDA 3TTCA 3OVBA 2FDNA 4CESA 2JLFA 3HZEA 4H0OA 1FK9B 2FY8A 3QT7A 1U2VB 1ACMB 5IFMA 4DFPA 2UUAF 3Q23A 2R7TA 2F7TA 1LW0B 4B1VA 2ZD1B 2V9KA 1IBKF 3QAEA 3GDQA 3KFWX 1T03A 4OJ3A 4RKUC 1C0GA 4EIAA 1W7AA 2P9IA 5DG7A 1XNRF 2W2QP 1S6QB 3R27A 1GOAA 4M3WA 4B3OA 1KOOA 4L73A 3ENBA 4Z7YA 2BJ7A 5F8MA 3BR9A 1FVQA 4IRDA 2QTWA 2N4DA 3M30B 4P2SA 3PYFA 5BR8J 5DM7L 3BUZB 4QW9A 2AT1B 4NLVA 4NLCA 3KLEB 4M5GA 2YHXA 4G1IA 2D3ZA 2J7KA 4B9MA 2DNNA 1LWCA 1P1TA 2E5JA 1FTCA 1P27B 1JLCB 2XY8A 4F02A 4X4PA 4DR1K 1T95A 1GXLA 4E8UA 3J7ZO 4RG8A 5BRDA 4IWVA 1IBMJ 1H74A 2X1GA 2R7YA 1O13A 2C2KB 2R2RA 3PY8A 4ZMMA 3C94A 2KXHA 5LY3A 3I32A 5EOYA 4XIUA 2E1MC 4XK8C 5DGAA 1FWPA 4B3TJ 3CULA 3SSSA 3NF9A 4DTNA 5K8PA 3PX0A 3TSPA 1KC8T 1TUVA 2RAQA 4LJMA 4WFNQ 4LR9A 4N8OA 5K20B 4JI3J 3OFEA 1SH2A 4WCEQ 3X3UA 3ZTQA 3G6EN 5IT9U 3UI3A 4M3TA 1IV0A 3ISZA 3NS6A 4NXNJ 3FBEA 3EXYA 5EVZA 2O67A 4ID5A 5I4MA 4MFBA 4JI0J 4PHTX 4HLBA 2KT5A 2QV6A 5K8OA 3QRRA 1RHJB 3SIPB 1Y7PA 2JL9A 4DV2J 4PG6A 2B4OA 2DGWA 3SSQA 4X64J 3C6AA 5ETSA 3RMCA 3QNWB 4NLBA 3RRHA 4OVLA 3RBEA 1RT7B 3HFKA 2W24A 3B6OA 4RBTA 4J37A 3KLHB 2YPZA 4A8QA 2HS0A 2XEXA 2VC0A 3ENVA 2KL8A 3HJFA 2GFFA 3G10A 3TWHA 4CH0S 5LMUK 4OX9F 4ES1A 1VQYA 3N0VA 5IWAJ 4YOEA 5FJ4A 4PL8A 1ESVA 2HWTA 3C7NA 4CYUB 1HBNA 4DTPA 2AJ1A 2I8EA 1F21A 2B3TB 3FZBA 2KKZA 2I5JB 3F73A 5KFNA 3UVJA 2KHCA 3R3TA 5HMWA 3KLIB 3DLHA 1JL2A 3J81Y 3IUCA 1Q8IA 5EX5A 4OJRA 3MPDA 2RDDA 1C0UA 5CA5A 4ZLPA 1SH0A 2ZBQA 3W61A 2KZZA 2AJFE 3I0SB 3PRVA 3PW5A 2IBOA 1CXQA 5C15A 4O23A 2FHJA 4RL1A 4CD1A 9RUBA 1S6UA 4LF2A 1S9FA 2QMXA 1D8YA 1TTHB 5KG5A 1CJKA 4KHYA 2V2ZA 2ASYA 4DEZA 1IKWA 3SCJE 4DUTA 3OSNA 3CEDA 4KC5A 4CIFA 4MTPA 2HRTA 5L1JA 1Y3KA 2RIJA 5L1KA 3NGRA 4JKBA 4TKTA 1FWKA 4QWAA 1WG4A 4X65K 2Q1NA 3KG4A 1WWHA 2E5IA 3AVAA 3UNGC 3LZJA 4UOGA 2E1CA 2QG9B 2LCWA 3R8YA 2YNHB 1SXLA 5HROB 3VR1A 4RU9A 1CZAN 1V3SA 1ZBSA 2HG4A 1HA1A 3SAHA 2YX4A 5FDLB 1TV6A 1K1QA 2AYGA 1SB6A 4TVAB 2COLA 3L3VA 1WUAA 3D2FA 1FRIA 1FA0A 4DTJA 4MIAA 1UW4A 3JSMB 2G8FA 2DXEA 4OKKA 4M3ZA 3G9CA 2M3DA 3SXLA 1FXXA 3SQ2A 4R5PA 3FMBA 3VAJA 4BY9C 1B7YB 4M8LA 2KLAA 1R27B 2WW8A 3G2XA 2RU3A 4WE1A 1XNQJ 1OJ4A 3MAAA 3Q7CA 4BGAA 4ZCLA 3L2RA 4ZJLA 4CI0B 1B0VA 3J80O 3CSKA 1EETA 2QLBB 1SUQB 4A48A 3M32B 4CD3A 1JLBB 4CECA 4DQRA 3FSXA 1VSMA 2XQCA 4DV3K 3JAMO 4F7VA 3IGVA 2DNQA 3KJVA 1NH8A 3U9DA 4L75A 4RCHA 7FDRA 3ZSOA 1LWEA 1JLGB 1R6VA 1KSPA 3M8QB 2DB1A 2YHWA 2HF4A 3B6PA 1ZC6A 4K4XA 3AVLA 4Y1CA 1SL0A 1ZM4A 2W8LA 4FLVA 4TLQA 2IJFA 3TJ9A 4ELTA 2J9EA 1M5HA 4JYAJ 2J0QD 4IR9A 4PKIA 2V5HG 3OW2M 2DHSA 1NWKA 4RW8A 3KK2B 4UQGA 4CIGA 3KD5E 1RT2A 3E9PA 4YOTA 1R8BA 4QR0A 4F4ZA 1PO6A 4HTUA 3CGIA 4CZCA 2VU5A 2P1JA 2W6LA 3QEWA 1UJ4A 2PYLA 4CK1A 3NXZA 2ZFHA 1S6PA 4BRLA 1S48A 3R6MA 3AHPA 1U6BA 4ZLLA 3V1OA 3WNGA 3OS0A 3HULA 4USTA 3KTQA 3SEOA 3ENOA 2A40A 4ELUA 3D2EA 2QI2A 1CS4B 1V4SA 5SUHA 3NF6A 5DRKA 1RTZA 3NHGA 2J0WA 4RUBA 4GC7A 1RT4A 2AIRB 4Q8FA 1F5CA 4ZTJA 1PIEA 3HMJG 1KDNA 3SNNA 4BLGA 3LANA 1YLXA 3C66A 1HRHA 5C24A 2UUAJ 2NPFA 2GV1A 3HVWA 3VWSA 1NJYA 1VSLA 3KKSA 1RBTA 2I38A 3JYTB 1GXTA 4CZLA 4DR5K 2NSCA 3PLAA 1HQ2A 4M41A 4IOAL 1HNZK 2HMIB 1C4CA 3C15A 2J0SD 2DPJA 4PQUA 4LF9K 1BI4B 1QQNA 3DI6A 4JKGA 2HWHA 4ZN3A 2MQNA 2MZ1A 3CCUN 1Q8BA 2BM0A 2HQCA 3QPIA 1K8AT 4FLYA 3THYB 2GVDA 3LDQA 4I6AA 2OELA 2FTRA 4LMZA 5AZIA 4ECWA 3ZLJA 3VENA 2AYMA 2FF3B 5CAAA 4QOTA 2DH7A 4KI4A 4BDPA 4FXWA 2P9PB 1M0SA 4V19J 4JAXA 3AAWB 3E01B 2HNDA 1TP7A 2V7ZA 3CF5Q 1U1RA 3O3GA 4K8RA 1VQKS 4GKKJ 2NZ4A 4A62A 3BV8A 1PGZA 2H5IB 5KAKA 1KHWA 2ZGZA 1VQPS 1MMDA 3HXMA 2KYXA 1RWNB 3HP9A 5L1LA 3QDKA 2FSKA 2RILA 4NLXA 3OLAA 2ZNYA 4Y0WA 4DQSA 1G4CA 2Q79A 2IPOB 4QWDA 5KG7A 4K4ZA 3PW4A 4JI4K 1CULA 1C6VA 2W9CA 5K5MA 4WIQA 4OO1J 4C98A 1GX5A 3OYAA 2NS1B 3VCDA 3NY0A 3JXOA 4BE0A 2RRNA 3M6UA 2VQEK 3HOSA 3OLBA 4DHVA 1REVB 5DDQC 1XMQF 3CCQS 3DRRB 2VG5A 3WNFA 3JAMY 1TL1A 2HSEB 4CNYA 5KFTA 2VWBA 4LF8F 5AQLA 1RU2A 5T14A 1KFDA 3GLJA 2ZUGA 4CZFA 2Y1JA 1JJHA 4YY3J 3RMAA 4QR2A 4DV7K 4IG0B 1RWPB 4HYKA 2ZJRL 3NAIA 2R7VA 1H38A 1NDKA 4Y0FA 3V4MA 2OPPA 4NZ0A 1OWXA 3H46O 1U25A 3DAWA 2V4RA 1GEHA 2D1CA 1VQMS 1ATRA 4HH0A 1F1BB 4OLOA 3TQEA 1N32J 1YRUA 4K8XA 4HTJA 2RU9A 4U6PA 4YP3A 3S7RA 4FWMA 1ATNA 2P9GA 3J7AN 2PAVA 4IJAA 5G0RA 3VAFA 4LR7A 3ET6A 1IWAA 2VHGA 4CZHA 2CGJA 5FPDA 2BX6A 4RW4B 2LXFA 2I7PA 4NLDA 4BRKA 2PEBA 3NAHA 1D3WA 2HFVA 4LRAA 3LZIA 4DTOA 4N41A 3C6UB 3MCOA 5GAHU 2YWHA 3ELHA 2GQQA 3GR1A 2QA1A 2N4CA 2Q0UA 5DMRA 4IO9L 2R2TA 1SC6A 4HDGA 3ZO7A 1IBKK 3HL8A 1EWRA 1BC6A 5A0YB 1XNRK 3IAYA 4YDXA 1ULRA 3D7EO 2HGLA 3W3SA 3DCAA 2FGOA 1XC9A 2CNNB 2MDAA 1Y0HA 5LJWA 1O5JA 4DV1J 4DV0F 1TKXA 4CT8A 5KG2A 7AT1B 5C42A 3ZTSA 1HQEA 4Y2MA 3DRPB 4AL5A 2D9OA 3BQ0A 3OHRA 1Q82O 3ZSVA 1Q18A 5JMNA 1MU2B 4ZVPB 4KQZA 4X62J 4CF9A 2RSQA 4OPKA 1YUWA 4URGA 3RYLA 3L2UA 3DDIA 3K58A 4C4WA 1WDTA 2Q6CA 3N5BA 4M5DA 2MLYA 2YPYA 3WQUA 4M5HA 3T1HF 2NRXA 2CQ2A 3HTVA 1XIQA 1O1WA 3PSFA 2XYHB 4C48A 3T1YF 3D68A 4M63A 5A8RA 1VSEA 3OXGA 4KGXB 4HTLA 1Q1KA 2YHAA 3BBBA 2DO4A 3TNVA 3CJBA 2A2DA 2BRKA 3H7HB 3VQEA 2EPIA 3SZ2A 1Y4ZB 5KQ8A 4FP9A 3AVBA 3OHAA 2MB0B 1J9AA 2V67A 2AP1A 5DQIA 3RSEB 4U96A 2F4FA 1ZAXA 4WP9A 4XDDA 1U2FA 3LF0A 1HBUB 3ZC4A 3L8BA 3D3BJ 1U0SA 2G4BA 3HSTB 2XC9A 2K3IA 4QWCA 4QYZK 4LVNP 4DFJA 1RT3B 1NK8A 1BQNA 3TZWA 5KG0A 3BGUA 2KB2A 2YY3A 1FD8A 4CEFA 4KB1A 3DXMA 1FEHA 1CVJA 3MDQA 4NPOA 2HFSA 3A12A 3HHLC 2WUSA 2VGMA 5AFUA 4O44B 2Q6BA 1YJVA 3OS1A 2KRBA 2FGCA 4DPWA 1T02A 5KFCA 3SUQA 2C3PA 3FCWA 4CO1A 3VEVA 2CWKA 4HR2A 1GLCG 4H4MA 1BGXT 4JI1J 3SQ0A 1X4AA 3NGUA 3AO1A 4OX9K 4AM7A 5JUMA 4A8KA 5F8HA 4QIVA 2Y0BB 1BE4A 3LH2S 3M8PB 3H5YA 1UVMA 5EX0A 1CJTA 3CDUA 2VL1A 2UVUA 4HL9A 2O8BA 5IV3A 2N3OA 3IRXA 1FRHA 4FWSA 2JWKA 4BRCA 4QYRA 1DQ9A 3KJQB 4CZMA 1KAZA 1KHVA 5F2RA 4UZBA 4JI8K 5JS2A 2YKNB 5J2MB 3VAGA 3ID6A 5JS1A 3FFKB 1CJVB 3MMBA 4CGDA 1HR0F 3HI9A 2AJ0A 1KLMA 1R8HA 1T8EA 3CC4S 5ETQA 1HPZB 3FRYA 3M2UB 4CJ5A 2NRZA 2OPRB 1UVLA 3HRGA 3FDSA 4KE5A 2HHHF 5IS2A 5HL7Q 3DU6A 3GONA 2DNMA 3J7Z5 1VQ8N 5DM7Q 3EJMA 3K5LA 4FF3A 5MAOA 2OSRA 2VPXB 1SL1A 1LXNA 1X4EA 5HN0A 4CEZA 2OO4A 5CHCB 2PFDA 2O3DA 4DUYJ 1HLUA 3S8SA 3ZX2A 3DRYA 4ZVEA 3HVTB 2ALZA 3CCLS 2VBZA 3MR5A 3SPZA 1VSFA 4B3MJ 4OX7A 3ZSRA 2C42A 3FFIA 3Q22A 4RLEA 3C65A 5DO2A 2CQGA 2Q36A 5LSLA 1S4EA 4K5SA 4N5SA 4W5NA 1NGBA 4NLRA 3GE9A 3GV5B 1RAAB 3ZXWA 4PKGA 2GUIA 3KOAA 2FZGB 1AYEA 3BSNA 4KRWA 3Q2SC 1WF1A 2JJ4D 2QEXS 1TFWA 1F60B 4F8RA 4X4UA 3SAFA 2C2RA 1X3MA 3D6FB 2C2ZB 1SIWB 3R8EA 1VQ4N 4MK7A 3M9NB 5THWA 1HL6A 4P7VA 4B02A 5CYMB 2WONA 2XYGB 3TJAA 3AARA 1EO1A 4YOVA 1BQMA 4NEYA 1R89A 3LALA 2HWIA 4KSEB 4KGKA 1NDPA 4LRDA 5KFYA 2E9RX 3H1VX 2NUHA 3GG4A 3H0PA 2VGNA 2YKPA 4R0EA 1NK5A 3ZZPA 4ZHRA 4R8UB 1G1XA 5CQGA 3MWPA 4NLSA 1V5VA 1R0AA 2BV3A 3CD0A 3QIPB 1FEEA 4Z7CA 1H2UX 2Z1JA 1J2VA 5F9NA 4MKAA 1ITGA 5HBMA 3MMCB 1YSJA 3Q8SB 4CEQA 4DUZF 4MAKA 2HQDA 1LAWA 2QK9A 2HBZB 1TL5A 3CC2S 4LF8J 3IMXA 2RS8A 1ATSA 4L74A 3L7UA 4IFYA 2DEJA 3IS9B 1U09A 3ATVA 2M8HA 3CJ9A 1MMNA 3X1LB 2AX0A 3OXLA 2R3VA 3PO5A 4D3GA 4A8WA 3W3DA 3AO4A 4DN9A 2AP6A 4JD2A 2HVEA 2DXFA 2O8DA 3I87A 5IT4A 2Y9HA 1HWIA 4Y00A 3ZZYA 2QWLA 3K59A 5HVHA 2PIIA 8ATCB 4N7TA 1Z6RA 3N4PA 2EKYA 5HLFB 2DFFA 5CZ2A 1Q78A 1RDRA 4PXDA 3OL8A 4IH6A 1KLNA 3S6EA 4ZS6A 4LSNA 3TA2A 2YH0A 4MLEA 1KQFB 1ZTTA 3DLGA 2DVIA 4CGGA 1RDAA 1WSEA 1TKTA 1M90O 4OLPA 3P38A 2IA0A 5CR4A 5A8WB 1J54A 3J81j 5CD4H 1A7GE 2I6WA 4CEDA 3SDEB 3OL7A 4K2XA 2VZ9A 2UVWA 1C0FA 2GVZB 3C16B 4CZGA 3QIOA 4Y2AA 2FYXA 4FSVA 3QYYA 3DYAB 3CCES 1LFPA 5AQHA 1P6TA 1RLCL 4B1XB 3FZFA 3NOGA 4ZTFA 2BUPA 2X3GA 1T3VA 1V3ZA 3L0QA 4E19A 3AA9A 2ZJQL 4DV0J 3ZSWA 5CH7B 3DMJA 3FR0A 4OPAA 4BREA 1KONA 2E20A 1K73O 4F4XA 2HNYA 3PIPQ 2EVZA 2E4LA 4ZN1A 1S4FA 2JEFA 4TY8A 1U49A 1U1QA 1DLOA 4C3LA 1HBMA 2QSFA 1VDHA 1HNXK 4FM1A 5CZVA 4KGZB 3C3LA 1OH8A 3AO2A 3ILIA 4LSLA 2VD3A 2P9CA 3E8OA 3LDSA 1KBRA 1YDLA 4CLZA 3O4NA 5AJ3J 4WZQA 1JKHA 4JRQA 2H5JB 2HHWA 2ZM6K 3T1AA 1J6ZA 1LOTB 5LJVA 1X4DA 1T03B 1HNVA 3FQLA 1VLYA 2P9IB 1HNWF 1MWQA 1GT8A 1WG1A 1S1TB 1KP6A 2B0GA 5B0EA 3RB0A 2OKQA 4YOWA 3L7OA 4B3OB 3GJRB 4OI3A 4CEAA 3UCZP 4WQ4C 1TUYA 4DL3A 4P71A 5D4LA 4FLXA 4CLUA 4FJKA 1UL3A 1FNXH 2CJKA 1N6QA 2AX1A 1GLEG 4EZ9A 3BP8A 3G6XA 1LWCB 4GVLA 1XMQK 4U9RA 3DXSX 4WBFA 3MR2A 3P1GA 4CLPA 1CZ9A 4PXBA 1A5XA 3UR3C 4K0KK 3MX2A 1F9EB 1TAUA 1BISA 4WPAA 1XHXA 2LMIA 2C2OB 4L76A 3OY9A 4EZ6A 5AQUA 2RHSB 3I4PA 4DX6A 5HJYA 2CPZA 3KK7A 3KDOA 4UUXA 1JMTA 3BQ1A 4AL7A 2ZH4A 3U02A 2UV8A 2F9JA 4USWA 4Y3CA 1YG0A 3KWIA 2BBEA 1VQ9S 2AJ4A 2HOEA 3J7YI 2MQOA 2VG6A 4DR4J 3TEGA 1RP5A 2N82B 4ID5B 1PJ5A 3L6QA 2UXCK 3E66A 3VZHA 3ZSXA 5D78A 1H2VZ 4MK9A 1S72S 4WYLA 1J5EJ 3VQPA 3U1NA 3OSPA 2NSBA 5KOXA 1QSSA 3TUZC 4MKYA 3QSYB 2MXYA 4BACA 3ENWA 3DGPA 2ZBCA 2DHAA 3BF4A 1K8AO 1RT5A 4DPXA 2XGQA 3HHDA 4P75A 1RFQA 3O5BA 3O3LA 5HQLA 4ZK7M 3OR2B 3BO3A 1S57A 2MJNA 2CJBA 4B1YB 4JK9A 1FE4A 3TVKA 4IYQA 3O3FA 2RQMA 1YJRA 5DM6L 3T19A 1F3VA 5E3QA 2PI4A 1NGEA 4KAIA 3JSRA 3C7NB 4O0NA 4FZZA 3OW2R 5L9XA 2RN2A 3OBWA 2KFNA 1WC5A 1HHQA 3NGDA 2XY5A 3UDLA 3NWRA 4YN3B 1YJUA 1H2TZ 1HD0A 3UVJB 2J7WA 2VICA 3AA4A 3T1HK 3SJHA 4OI6A 3VAIA 2PD1A 5BN9A 3QINA 2VKZG 2IVMA 4CO3A 3OUYB 3T1YK 4IRCA 1C0UB 2GWJA 2YQ1A 2ZZMA 3DOLA 2L48A 2FC8A 1SQKA 5AQPA 2HHPA 3LGHA 3U3GA 2BJ3A 2CPEA 2DJWA 3PDNA 4TY9A 3I0RA 1OH7A 2OHDA 1UFLA 4USHA 4U7UD 1MN9A 2KT2A 5HVFA 5GAEI 2ZHAA 3TARA 2NQPA 4B8CA 2WZ1A 1TR0A 4QQBA 4FYVB 3U1LA 3ZZOA 1UJ6A 3RB3A 3AQOA 3R9PA 5KFSA 4PG5A 1IKWB 3QGPA 1S1VA 4KAZA 3WXJA 2V2KA 4OPHA 3OQ2A 3MR7A 1N34K 3SQGA 2MKSA 2HVHA 2IGIA 4Q45A 4DMZA 4DCHA 1NPKA 1JLQA 3CDWA 1OQ3A 1O51A 3H5SA 1EQYA 1RWXB 1JJ2R 1FKPA 1TYQA 3MAQA 3L2VA 2WVCA 4RO0A 3FCHA 3L95X 1RDBA 1TVRA 5FLXU 1ZPWX 4E1JA 1FDAA 4HI1A 2IOCA 5IC4B 3J7A1 1TV6B 2HEKA 3V9ZA 2CQCA 3B8AX 3EMTA 2R8KA 2XMWA 3V6DA 3JSYA 4N76A 4OGEA 3D2FB 2D0OA 4J9LA 3I33A 1SS6A 4I6WA 4CFDA 1LW2A 3NVKA 4NXMF 3FZKA 3POTB 3TR5A 3LAMA 1EIYB 5IOLA 4CF0A 4CLKA 1QUVA 2M2BA 4AHRA 1IKXA 3NGSA 1WKLA 3NRBA 5AQYA 4R5PB 3PZPA 3FE1A 1RABB 4BG9A 1UKUA 4RPFA 1L5UA 2GZOA 4U7BA 4EP5A 2CUYA 5LT5A 3O8WA 2DY1A 4YOXA 3MAAB 3KJFB 3A8EA 4M5KA 2XGPA 3PR5B 2UUCK 3EGZA 3ATUA 2H5EA 2F9WA 3AA2A 1KCFA 4HHTA 3NWGA 2OD4A 3KJVB 4O0JA 3M30A 1HR0K 2Z56B 1IVZA 4C8OA 5E5NA 2HFNA 1T3NA 3K7RA 4RZRA 1LWEB 2FXUA 3LP0B 4LBPA 2PMZD 3S3OA 4PXCA 2P9EA 1JLCA 2HHHK 4K43A 1D9AA 4XH1A 3AXMA 4L3KA 3N4WA 2VWKA 3OYEA 5DK5A 4MYUA 5U47A 1RT2B 1FDNA 2R7OA 3ZFVA 5E0OA 2ROEA 2KVQE 4W5TA 4RW9A 3J7YP 4ANCA 1B9FA 3A5NC 4B08A 1S6PB 5LMNF 4NLWA 2O5DA 1T9WA 2BRLA 4LR8A 3CPWM 1BWEA 1KTQA 2IMOA 4X84A 3CJQA 1VQKN 3D2EB 4F2SA 5AXKA 2QYGA 2LU1A 3AVMA 1FERA 4B3RJ 4LFCJ 1AW0A 3AB2B 1RT4B 2OA8A 1TKZA 3N6NA 1VQPN 2GO8A 1RCHA 5FPMA 1H73A 2CQ0A 4I0WA 1S59A 2C2EA 3OYNA 1HFEL 2V34A 2OLWA 2W2OP 2WB1D 2FJDB 1S3XA 1UFKA 2QSWA 2FBVA 1Z25A 4FWRA 5C24B 5KT3A 3MEEA 2HNZA 2VJVA 2KXFA 5ETVA 3V6JA 5IT9O 4XTTA 3ALYA 2R9LA 3JSBA 1HNWJ 1RWWB 5DDRC 2VBYA 3MECB 3H5XA 1HQUA 2Q43A 3C15B 1BA1A 3CCQN 1NB2A 4PQUB 1KKHA 2PGCA 4DN0A 4F3MA 2VH7A 1RT7A 4HACB 1DEJA 2CPDA 1YX2A 2DYAA 4CJ4A 4JKGB 3BGFA 4ZJOA 4B1WB 4KHSA 2F8SA 3FSYA 5T7BA 2DNKA 2APOA 2GVDB 3TVYA 4KH5A 1F2HA 4LF6F 1FFSB 2HGNA 3M6XA 4XPEA 5AZIB 3VQ5A 3P45B 3KXDA 5F0WA 3THPA 4A5AA 3H08A 4DUZK 1FJGF 3GIMA 3UDEA 1VQMN 2DNGA 4LQ9A 1Q81T 4CYUA 1NKCA 5I9EB 3T9NA 2CFXA 4L3NA 5T7LB 4K25A 3D4JA 3PFEA 5EDWA 2EC0A 3OYFA 4OZLA 3W65A 2BW7A 5GAEP 3KK1B 4JI2J 1GK8A 2BE2A 2I5JA 3LOUA 2NR0A 3PJXA 3D6TB 2V63A 3NNCA 3KLIA 2F5GA 4WFBL 2EFVA 4M5IA 2OIHA 3PEJA 2FJWA 4MT1A 2F4VJ 3NNAA 4YR0A 4YDUC 1NOZA 4LFBF 2YI1A 2FC9A 2FVSA 5ELZA 3VQCA 1CULB 5E3AA 2W9CB 3VESA 2W9AA 3KG0A 2HHVA 4HEA9 2MHEA 4ILLA 3H59A 1UA0A 2Z8QA 2GJ2A 1IBLF 1QQOA 4HH1A 3QJJA 1GLDG 3IXQA 2QIFA 2XNQA 5E2QA 1G3OA 2LU2A 4NRTA 2VG5B 1KRPA 4ZVFA 4K4SA 5BR9A 2GUPA 3WXMB 2PA8D 2WW4A 1N0UA 4GVEA 5HOOA 1FRMA 4OKJA 3KMSA 1SIZA 2QL7B 4BRMA 4DCJB 5D0RA 2ASDA 2O4IA 2MZJA 3LDNA 2IBKA 1W2IA 3UPFA 4S0MA 4HT7A 1AT1B 5DS7A 1LAVA 3GJTB 1N0VC 4F3OA 3QO9A 4DL4A 3BDPA 2FVRA 1RDUA 2RHQB 2FZCB 3QBCA 3GFYA 2IVFB 2MJUA 5DJBA 4OYMA 4IFVA 5DZ7A 2EG2A 1QSYA 2NCKL 3GIIA 2MZQA 2HQIA 1Y3JA 3Q0AA 4K42A 5G0RB 4Y1DA 4DS5A 2GTDA 3ET6B 3FZHA 4U8VA 2LSNA 2Q97A 4FOIA 2CXEA 4UY8O 2CGKA 4DPTA 3H2UB 1NAQA 3OTOF 3I9V9 1RDCA 4BE2A 4RNMA 1FXRA 3VOVA 4NCGA 2V52B 1CC8A 2IJRA 2E5LJ 2RDJA 2Z2LA 3FEXB 1Q7LB 3QFWA 3P8BB 1X4CA 3WIUA 3VGUA 5I42A 2C2DA 3AOCA 2I7NA 4FYYB 1JLBA 2UUBF 5JVGL 2WC9A 4PKHA 4OYXA 5KFUA 4U67Q 3A1YG 5IT9Y 3SAGA 3GSIA 1VAZA 4OZ5A 4ID1A 3AH6A 3KYLA 3CB4A 2QKBA 1TKXB 3NCRA 1GMWD 4KIAA 1EKEA 3AA5X 5C42B 1HQEB 3FRZA 5M1QA 1VRQC 3MCMA 2CPHA 4KHPF 4H0YB 1RAHB 4WYBA 1EQMA 4KPYA 3NE6A 4LBHA 3CJ8A 4L3QA 3FBBA 2D4WA 2AEFA 1KS2A 1QQMA 2DRBA 3D67A 2V8DA 3M2RA 4OYZA 4FW2A 1IQTA 5GAGU 1R31A 3SSRA 1K44A 3VZIA 3WQTA 4QIGA 4WFNL 4ENOA 1FJ7A 4M5DB 1G15A 5D4OA 4FJ9A 2WBRA 2HBJA 4WCEL 4J2EA 3ILOA 4DR7F 5EXWA 1D0EA 2ILZA 4WP8A 3KHHA 1O6XA 1VSHA 5A8RB 3VTHA 4TU9A 1VRUB 1IKVA 3M3ZA 1KQSM 3MM5A 4CHNA 1NGIA 3MCNA 2MZRA 2YKMB 4A8OA 2IVNA 1QTMA 2RVJA 4FYWB 3AVHA 3WXKA 4IKFA 2OPQA 1O8BA 3GIRA 1FHTA 3MEKA 3GQCA 1IXKA 3EM1A 2RQ4A 5JMVA 1F3FA 4MDBA 2KTQA 4EK2A 2E6MA 2W25A 3RRKA 4CHYA 4CDIA 3CC4N 3ZZRA 1RWMB 2VBXA 4FJ7A 5L46A 3PJWA 1BQNB 1K9MT 2QMWA 2EW9A 4AYBD 3O1LA 4IRKA 5F1XA 6FDRA 3AD8C 1HYSB 3G82A 3K5PA 1NJIO 4GY2B 2HMIA 3BM7A 1X31C 1YBTA 4NYZA 3CCRS 1BI4A 1MDUB 3WC2A 2KW4A 2NXNA 5AE1A 3ZX3A 5ETPA 4CF1A 2ZF5O 2RB7A 1U8SA 4OZ1A 1DTQA 3A8IA 4YB5A 1S0VA 2OAUA 1RGIA 1B3TA 4KY3A 4OV6A 1EKRA 2H48B 3AAPA 4YS2A 3CCLN 1RU1A 3CCJS 4H4MB 4W5RA 1U7LA 2A41A 4JOUA 4JI6F 1DJ0A 3PW0A 4ECTA 3PM9A 3KK3A 2H4WB 3VEYA 2OYQA 1AA1B 4V19X 5F8JA 4CJVA 4QPTA 1CJTB 5H9EJ 2JVOA 2UP1A 1ROFA 1W26A 5AQSA 4URSA 4IFEA 3KHLA 2E1YA 1QD1A 4MQ3A 3IRXB 2PN6A 2F63A 2QEXN 2KQ2A 4QS9A 1F9FA 3DGVA 4K41A 3HT3A 2HAFA 2QL9B 4OJGA 3DHXA 4DSEA 4J5OA 4PQAA 4RTFD 4DSKA 4C23A 1XUPO 1SKUB 5C5JA 4J9OA 3RG6A 1C1BB 1VQ5S 2J9DA 3GJQB 1OY8A 3IC1A 1Y5LB 1FO1A 1GTEA 3TA0A 3H6EA 2NRHA 3MMBB 3VQ4A 4UUWA 1D9FA 4WQ5C 4AILC 1ZOTA 4G3IA 3KUGA 1WF2A 2NRRA 4J2DA 4OYPA 2YTCA 3U1MA 1S9EA 2Q1LA 1YTUA 1YJNS 3NVMA 3AVKA 1I94J 4F3TA 1VFJA 2G9OA 2R2SA 2RH3A 4AQYJ 3MN7A 1REVA 4DR1F 2DISA 2VODA 4WQ4A 1HW9A 3OYCA 1S1UB 3Q24A 1ASWA 1EZZB 4DR6J 1ZBHA 1VQ7S 1LEOA 3MR6A 4Y6IA 5HO4A 4URQU 2G0IA 1NHKL 5FD1A 3CC2N 4DR2J 5H9FJ 2LA4A 1WHVA 4G1PA 1KNZA 1SQGA 3H90A 1E6YA 3IGNA 1NJXA 1ZZNA 3M9OB 2LQJA 2MKIA 3FFIB 2C3OA 3MUVP 3DRSA 1QSLA 3LDOA 3T5HA 4PCQA 4GVMA 1VQ6S 4X66F 1G6BA 1N88A 2VQFJ 4FLWA 3V9UA 4P7TA 4DV6F 1HKBA 2KDOA 2VJUA 4G1QB 2F8EX 2DTJA 3MDFA 2V8GA 4NXMK 3MN6A 1C4AA 3LPEA 4QWBA 3B78A 4KH0B 2KZMA 3K17A 1YT3A 3A4TA 3N79A 1DBDA 4OHYA 3HHEA 2WONB 2GQCA 1NGCA 2I2YA 1YF5L 3H3OB 4F4WA 1BQMB 1D1UA 2ZHOA 5C10A 1HHTP 2NXJA 1GLLO 1TL4A 1EP4A 3CJ4A 4ED5A 2UU9J 1YTYA 3T7ZA 2QM1A 3CERA 3NMUA 1VISA 1ZH5A 2B4UA 2HMPA 2OFHX 5J2PA 5SZTA 3CCEN 4UOCA 2E8AA 3SUNA 3SBTA 3N01A 2YWFA 2FY1A 5HBMB 3EVMA 1XMOF 2FBYA 4DV5J 3A5LC 1Y97A 3K9JA 4CGHA 4AD6A 1VC5A 2RS2A 3MXJA 4MLHA 3MTKA 4I1TA 1FRJA 1KAXA 1UWAA 2Q66A 5CYJA 3I8DA 1JQGA 4IFYB 3O2IA 5M1FA 1SH3A 2MPUA 2F96A 3Q83A 1T9XA 1VQNS 1SBRA 3MI7X 4YORA 4OPJA 9ATCB 3KUEA 1YGYA 4ITSA 1SZ2A 4Y2IA 3ENHA 4TU8A 1ASUA 1RBVA 4FNIA 2IA6A 2Z0GA 3PJ9A 2VFRA 2F8TA 4K2JA 4JD2B 2O8DB 6AT1B 5LMNK 3EKSA 4DHYA 3KD1E 1IJJA 2RE1A 1Y00A 5M1PA 1BA0A 2ZVIA 3W1YC 3MM7A 2DIVA 1I5OB 1HI8A 2IY5B 1Q5YA 4DR3F 4C8NA 1G2EA 4EWTA 4LSNB 4ZPTR 4V19S 2XSJB 4CHQA 2EG1A 1T9VA 3DLGB 2FIUA 4GKJK 4PEOA 4IG3A 1E6VB 3DJCA 3T3FA 1HBUA 3PKYA 1XBWA 4ZIWA 4ILRA 4MYTA 4H4OB 3EGVA 3RBDA 2CNOB 3CO0P 2F1FA 5E84A 3MN5A 5B0AA 1RSCA 3DRXA 2XLJA 1WOQA 5DG9A 4CJSA 3HPGA 4NLQA 2OGUA 3GG1A 2MLXA 2AWZA 2W7OA 4USMA 3V4IA 1RBSA 4BRHA 1NM2A 1IG8A 4JI5F 3LP2B 2XZDB 3DMJB 4NX9A 3GWCA 1UWBA 2WK4A 2E5GA 2M52A 2QWNA 1EQ0A 4PG8A 2HNYB 2V4QA 3CT9A 5AQGA 4IH5A 1X7VA 4LF6K 3R1LA 1MMLA 4TY8B 3CF5L 5GMEA 3F5TA 4ISGA 1Q4RA 3RMDA 1HHSA 1M5SA 1HBMB 3CCSS 1N5QA 3OJUA 1FJGK 2EK6A 1B7FA 4I69A 2ZBIA 3KVGA 3WQPA 2JHEA 3GCXP 3CJTA 3EGWB 4EFHA 2PY5A 2F8MA 2DBBA 5KG1A 1YJWS 3QWUA 1OY9A 1VQ9N 2CNLB 1JKHB 3HFVA 3IM9A 4ISEA 4JI7F 2DGVA 5AQJA 3Q8VA 2XMUA 3ASMA 1HNVB 1X4GA 4HCCA 3IBWA 2ETJA 1WC4A 4WXOA 3M6GA 4DU8A 3MCAB 1DHMA 5BRFA 2A1SA 1S72N 5BPMA 1F2GA 2KG1A 4I2PA 3W9HA 4W4MA 4LFBK 3ICLA 3KHRA 3TX0A 3A8KA 1RK8A 1YKWA 5KFDA 3LQVA 5L1IA 4DLGA 1NO8A 1N6QB 3PRDA 3TOQA 1N36F 4E7KA 2DGTA 3ETMA 1NSKL 1IBLK 1XN9A 1BG3A 1RWKB 1YQHA 4JV5F 4LFAF 1FFWB 4FWKA 2L3MA 3RAXA 2V50A 5BPNA 3TPQA 4PL7A 2X51A 2XO7A 4CHOA 2AQ4A 4QJVA 4L72B 2VOOA 2MQLA 3HVTA 2YBVA 3GTYX 1HWUA 2IVOA 1PCAA 4B9TA 4XH4A 3OFGA 1QAXA 4EBDA 3OXFA 4M95A 2KKHA 1IM4A 3PUFA 2H1YA 2RUGA 2M8DB 4NYNA 5CD4A 3O9SA 4LF4J 1QAYA 4X4NA 4JS4A 2PFFB 4FWNA 4E7IA 2ZKTA 2HURA 4LF1A 4ATNA 3RB4A 4GVBA 2HBYB 4A47A 3OVAA 2BJ1A 2W01A 2VG6B 2WBMA 3FZMA 2XMTA 4B9QA 2C2MB 2BDPA 4C3KA 2F9TA 1RYRA 1R6YA 2CVIA 4ELVA 4CIEA 4QS7A 3OTOK 1T0TV 1OY6A 2EFNA 2HW3A 4A2BA 4E1NA 5JVHL 4PZVA 3EZUA 1NJWA 2EBEA 5KFFA 3QFPA 2RRAA 2A6MA 1AUDA 3NCPA 4GO7X 4E89A 3J7YU 4FVMA 3GYNA 3C46A 3DGPB 5EWGA 4QS8A 3M5RA 4OZNA 1RT5B 2G2ZA 2UUBK 3ZZUA 5KFMA 3HM9A 2UZAA 1V3RA 2HAIA 2BYCA 2HHQA 3QIPA 1Y11A 2YWWA 1HKCA 2Y3YA 4DR1J 2Q3PA 3GCWP 5GADI 3MMCA 1PKUA 2ZH6A 3SUOA 3HP6A 4CLSA 1AFIA 4MO5A 3TAMA 4FVUA 2FLLA 4WFYA 2HHXA 4KHPK 4ZCIA 2X7IA 4KJIA 4F3QA 3NEKA 4CLLA 1LV5A 3VQQA 4EI2A 5FPEA 2VPZB 2CJ9A 3AAQA 4DZDA 3BKUA 2OP5A 4HHJA 3RUBL 4B3SF 4FLTA 4ZA1A 3EPGA 3FC9A 2YKAA 5GMKa 4QWEA 3K5OA 3VGSA 2VONA 4CEOA 2CVEA 4FZVA 3VQ9A 1ZXOA 2F9DA 4DR7K 4H0XB 2W9BB 2V9WA 5HLFA 3Q8PB 4JI4F 3UQSA 2Z57B 4ICLB 4CBUA 1JCFA 3DOLB 1T11A 2NXUA 5C2GA 3GFHA 2H65B 4DSLA 3DXKA 3H1QA 2ZNZA 4WFBQ 4KHMA 3I0RB 3U7JA 2V8HA 3ILJA 2HHTA 1NK6A 2VQEF 5ETRA 5B8HA 1BIUA 4OYAA 3QESA 1RISA 3NCIA 1JLAA 4A46A 1CQMA 3H45C 1NRKA 1PYSB 4H03B 3HO1A 4YDUA 2XSFA 3NCQA 4AHSA 5KFJA 3SDEA 2ERRA 1U2CA 1S1VB 2LXIA 2AYBA 4XDCA 1L3VA 1RAIB 1N33F 4MKVA 2DFEA 3BGRB 4H0PA 3Q8QB 4ED0A 4CO2A 4DV7F 1S99A 1JLQB 5L38A 3D0HE 5GAEU 3CJ5A 2HIQA 2DRAA 4A2AA 1FKPB 5KFLA 2JEJA 4M7YA 3LWMA 1NNEA 4OZ3A 2QXFA 1TVRB 2QC3A 3VMFB 1UP1A 2CWXA 4FM2A 1IM6A 1U47A 5D4PA 1WOOA 4USKA 4WTYA 4Q8EA 5LMUJ 4CGIA 1KVBA 4CHPA 1KD1O 4EAHD 1LKZA 5CHIA 5C25B 4KHRA 2CQPA 3PO4A 5AR0A 1XQIA 1LW2B 4JI6K 5HQ8A 1F6TA 4KGVB 4UY85 1X4HA 1YZ6A 3ZZZA 4OQJA 4BR4A 3DU5A 4FJ8A 2XS7A 4ECYA 2LVWA 1IKXB 3BH7B 5LSOA 1IWGA 5DDPC 5C2DA 4N8NA 2QWMA 2WSCC 2MY8A 4JUZA 3O1BA 4YNQA 5B0CA 2FJEB 5C2FA 2X74A 2PDAA 1QHAA 2O8FA 3K57A 5ETMA 2FBXA 5KFHA 1NZ8A 2B6AA 5D15A 1S1TA 2A5XA 1RBRA 3O4QA 4LREA 3M2VA 2CA9A 1WSRA 5HL7L 2ZJPQ 3MMVA 2JGUA 3P5BP 2XWYA 1GH8A 1BQXA 3D6HB 4F0HA 5JVGQ 4M3XA 3TTFA 3PYGA 5BRHA 1WSFA 4X65J 3AJ2A 1JNZB 1HBOB 5ETKA 3BYRA 1IR2A 1O0PA 3VGMA 3IN5A 2VFSA 4CK2A 2VYPA 2OMOA 2J5AA 3W2VA 1U1MA 1SKSA 3PIOL 2MQ8A 4RW9B 2E88A 5DDOC 5E26A 3MD3A 3NH1A 1Q7YO 4B17A 2R8IA 1GMUA 3VQ8A 4DL7A 1Z26A 2U2FA 2P9SB 3FBCA 2PE8A 3AO3A 2RRBA 4NASA 4XAKA 3G4SS 4H5TA 3R3LA 1RILA 5GIOA 2LQ9A 2XCPA 1OS5A 4AFFA 3L4IA 4RWTA 1GLBG 1RAGB 2J9DE 4X66K 3QJLA 3D1HA 3RAMA 2DR5A 1KXPA 2B7BB 2KYZA 2OTJS 2KO1A 1JLFB 1QQCA 4FDFA 3AJDA 3MXIA 1TKZB 2CKWA 3K89A 4EHTA 2E44A 4DV6K 3VEZA 4JKFA 3GBTA 3FUYA 1U1NA 1NSPA 1NEEA 3IM8A 2LEAA 2XZWA 1EXQA 1RT6A 4NZ6A 2QMUB 2O8CA 5KFXA 1VRTB 3NBPA 1UTAA 3MEEB 2HNZB 4ETZA 4FW1A 5GADP 4BE1A 1S1WA 1SC4B 1HYZA 2JEIA 3R1XA 1NKEA 3THXA 4DV3J 1UW9A 4NE9C 3GYGA 2B4PA 1HQUB 5GIPA 4CCHA 3BQ2A 3W62A 4AHVA 4AM6A 2G1DA 1W2BM 4F36A 1S22A 3CD6S 1UZHA 5KT2A 5F9LA 3OHBA 5CYQA 1M1KT 4NMXA 3OR2A 1X5OA 1N8RO 2D5RA 5C7PA 4PABA 4AE5A 5BJRA 3D28A 2XS5A 3HHLB 4JV1A 4JKHA 3QEVA 1FRKA 3R5AA 1VC0A 3V81B 3OT9A 4ZDNA 1XMOK 4FJLA 2FJXA 3O1WA 3MWBA 3DLBA 2MY7A 4H4KC 3UKUA 1RKIA 2WSEC 1RHUB 1ICEB 1SJRA 2G8VA 3P83D 2G2OA 1WF0A 3HCXA 4CJWA 4ECRA 2BE2B 3MN9A 4JI8F 2FD2A 3PV8A 2DR7A 1VCTA 1TMJA 3AVIA 3OUYA 4AH9A 4CLWA 4IDKA 3B54A 3M8ZA 1KQSR 3AVNA 4LF7F 3R97A 2YWGA 1WSJA 1WNEA 1SVDA 2CPFA 4JHDA 4DR3K 1QE1A 1HUXA 3EZOA 2NLXA 4Q5VA 3DWLA 3I5BA 5F41A 3JB9k 4KB0A 3MM9A 3G8TA 4M3UA 1W7WA 5KT5A 4DR5J 3KLFB 4WQ5A 3ZT4A 1HNZJ 3P4IA 1NK0A 1VQSA 4LF9J 2D3O1 3OFFA 1RAEB 4ES2A 4PUOA 1FKOA 2QWQA 1NM1A 3J7ZT 4CJFA 3BREA 4DXLA 3HD1A 2V8PA 3MHYA 3PIPL 3QO9B 4WYWA 2F3JA 3CJ3A 3FZ2A 4BWJA 1JJ4A 3NOCA 5B0BA 2UVVA 2MKJA 4P2FA 2XY7A 4JI5K 5BN8A 1NGDA 5F3TA 4I7FA 3UCGA 5AQMA 4IFVB 1D09B 4YQWA 4CLTA 4C0BA 2YX7A 2CDRB 2C22A 3SCKE 5FLXO 2ITGA 3JS9A 2XM3A 3CCZA 3M1VB 3V2UC 1YRTA 3POTA 3EPIA 3TZXA 1NSQA 3TP2A 4EEYA 1JIHA 1EHWA 1H98A 1N52B 4I4BA 4ZPVR 1S77D 3W63A 1NKBA 4NCGB 1N5TA 2ZQBA 3QJPA 3D9BA 3HI0A 3D0PA 1W25A 2RQCA 4ECUA 5KT7A 3VAMA 2MGZB 5AXLA 5KG3A 4JI7K 3T9ZA 5I42B 1OYEA 4JI4J 3W66A 4BRPA 3H8YA 4Q43A 4WKRA 1MN7A 3WEEA 3QRPA 3ZEUA 3K8WA 1S0OA 5KRTA 2ZH2A 1DTTB 3ZX0A 3O6WA 3VQSA 5BYQA 2VQEJ 2BE9B 4OV1A 3I31A 3DOKA 1NBEB 3B8HA 2O4GA 3CETA 3LP0A 1MSWD 3CCRN 5M2PA 2GJIA 3H42A 3WX8A 3AA8A 4BWMA 3N4QA 2BE7D 3D1QA 1K6YA 3W60A 2L41A 1WI6A 1P8ZA 1N36K 1QS4A 1XEZA 2ZHBA 2W41A 1TUGB 1BUXA 1KVKA 3MURP 3O6QA 1EKSA 5LL6Z 4DV7J 2RHKA 4JV5K 3CTRA 3ENAA 4LFAK 1SKRA 3J8AA 3M2RB 3MTJA 4J9KA 3VF0B 3CCJN 4BCAA 1PC5A 1UAXA 1VHFA 3QSIA 2DHXA 3SLCA 5AZJA 1Q5VA 1HX1A 1VBXA 5CXTA 4JK7A 1BCMA 2Q0RA 1YHQS 4CTAA 5A2QU 5D3GB 2OANA 4CRJA 1KVCA 1V6HA 2Y0SD 4WFZA 3FGVA 3K2YA 5K14A 2HZCA 1TFYA 4RW6B 2HLUA 3W8PA 1IKVB 2JLGA 3MM5B 1OVQA 4O0IA 1ZBLA 3BN7A 4LF5F 4C3MA 4JV2A 3DM2B 4PYDA 4FF1A 2HRYA 4M5LA 3HJVA 4LH5A 5HSPA 5KQDA 2GNKA 4Z2XA 1H1VA 3GILA 2OPQB 2IAJB 3IG1A 1FD2A 4LT6A 4OLAA 2R7QA 2LEBA 2EI5A 1IBKJ 1HYVA 4H5VA 4N47A 1T05A 4DZ6A 3JTOA 4HUFA 3OYHA 1XNRJ 1YJNN 3MECA 2NXCA 4FNHA 2Z4PA 1JJ2M 3QMQA 4K4TA 3G82B 4KH1B 2OSQA 3DDNA 3KKRA 2C28A 2DITA 4CEEA 1FDDA 2MZSA 1ZM9A 1U48A 4HACA 4OFZA 3G8SA 1P9YA 4CZIA 1N54B 3CIZA 1VQ7N 4HI2A 3TEHB 1VI7A 5AQFA 4YOUA 4P52A 1DTQB 2OFGX 3E1YA 3T69A 3VALA 3MPVA 1HNXF 3BKFA 3KK3B 3KIOA 1VQ6N 4OYOA 5HK4A 3TWZA 1Y10A 1PG5B 3BBFA 5T7LA 1CZBA 2AJQA 2ZM6F 1UA1A 3KK1A 3UN2A 4B3SK 2F7VA 1LWFA 3P4UB 4ZVOB 1K47A 3H40A 1KQGB 2ZBPA 4WWSA 1ZBFA 2C3MA 4KTQA 5EN1A 1FTRA 3R2DJ 2GMJA 4DQPA 1U1KA 4FK4A 5FROA 4JKEA 1JX4A 2L9NA 4WFAL 3KG1A 3BSOA 3CJAA 2Y8WA 5E3PA 3QERA 4PYAA 4KTZA 3EE3A 2DNPA 1CXUA 3N5FA 3QT6A 1S9EB 1AZSA 4QYZJ 3J80Y 4FWOA 3HBTA 2KHDA 4ECXA 2FZKB 3SUPA 1RADB 1XQSC 1M5PC 4K0KF 1RI7A 1SJ1A 2RE2A 3EDRB 4DTUA 4WK1A 3WXLA 4CJ7A 5MLCQ 1U8WA 3AA3A 4KT0C 1N33K 1NMEB 3Q8YA 1RYSA 2GGPA 3QGIA 2QGFB 1X0PA 1YWXA 1E6YB 2YVSA 2XRIA 1G99A 2C3UA 4U7CA 1YTAA 2V2QA 1VQNN 3EO3A 3UB5A 3DRSB 5EU7A 3W8GA 5IQQA 4EU0A 3W9JA 4OX9J 5HRPA 3DLEA 3BSCA 1Q86O 2ZOGA 3R5BA 4ZVTB 4TQRA 3UWTA 5K8NA 4CLFA 2Q31A 2FB0A 4IO1A 2UXCF 4UF4A 2HPUA 3BGOP 2VC1A 5BR8F 3LW5C 3HPHA 1K8KA 4TLRA 3TZYA 3QT8A 1QZ5A 4QU6A 1HI0P 4JI8J 2Z30B 2P9LA 3PCOB 3T5JA 2ZH7A 1S97A 4Q44A 2KN4A 3NDKA 2AEJA 1EP4B 3CJ2A 2NPIA 1IBMF 1ZBIA 1J27A 1XTZA 4ECZA 5JVHQ 1BL3A 3MAHA 3DC2A 4CP5A 2P6SA 2R7UA 5D4NA 3GP9A 1HLWA 3R5GA 3TRGA 5J2PB 3SI8A 4E98A 5H1SV 2JVRA 1OH6A 2LP4A 4B3TF 1HARA 3VEXA 2DIUA 2XY6A 2EC2A 3UKRA 4YHHK 2YNFA 5D0GA 2C3YA 3DLJA 2EFOA 2PBDA 2IDOA 3SQOP 2E1ZA 2VQFK 4OZ2A 2PMWA 2ZZTA 3C14A 1OH5A 2CPYA 4JK8A 3NH2A 2D9PA 3CCSN 2WHOA 1XR5A 2WB4A 1YJ9S 4BC9A 4J9VA 5ITHA 2DFHA 4JI0F 2CG8A 4A8MP 1RXOB 1FKAF 1YJWN 4WTOB 2V69A 4HHUA 4JBCA 1VRUA 4W5QA 1SV5A 4OX8A 4DV2F 3D6MB 3VF4A 3MM7B 2R8GA 4FJGA 3OL9A 3FEYB 2YKMA 2G13A 3TZZA 2ZITA 4X64F 3I8BA 2IJNA 4YB1P 1APSA 4CQ1A 1YZ7A 1N5VA 4DTSA 4PXEA 2UXBK 3EWGA 1ZYQA 4IG3B 2CNKB 3THTA 4E7JA 2V7YA 1KVAA 2MQQA 3L3CA 3MD1A 2M70A 4H0TB 3E3XA 1N34F 1JCEA 1NK7A 5M1NA 4J2AA 4JB8B 3P3DA 4DMNA 4YR2A 3OYBA 4O3SA 3I6PA 4FJXA 2BOPA 1HWLA 5IWAF 1EWQA 1HYSA 5GAHP 3IR7B 3N6MA 4CGJA 3GB0A 3K8VA 2GIFA 2FUG9 2PYJA 2BJDA 5KG6A 3US5A 5ETOA 3V4IB 5M2RA 4CJLA 4KTWA 1OIAA 3S3MA 2J76E 1IQZA 3BZKA 2MEWA 1CLQA 2HBKA 1UWBB 4M42A 1K0TA 3QATA 3I5AA 4WF9Q 2ZOFA 1BU6O 4DJBA 2W2NP 4HKQA 3NGKA 4J9UE 3DLRA 4B9NA 2YKOA 5F0UA 1RA6A 1FW6A 2ZC4A 4KR0B 4X4TA 3UDVA 1WBDA 4O8UA 1G7CB 1J53A 4NLUA 4K7QA 2QW9A 3CJSA 4FLZA 1V5IB 1NU4A 5B08A 3CWJA 3OD2A 2B5JB 5D0EA 1BY9A 4MIBA 2W42A 1IR0A 3O08A 4GNIA 5HAOA 2LDYA 4ANEA 2IVYA 2HK3A 2OTLS 3QZ8A 2UUCF 2OCEA 2GS8A 4J9RA 1NB7A 3O4WA 1VQOS 4QBUA 1C1BA 3A5MC 3T6JA 4Q0BA 1HWJA 3D2WA 2HFOA 1WOSA 1TKDA 4B1ZA 1P1LA 4I2PB 1S49A 2YHYA 2QA4S 4LF7K 3FJ2A 1WC0A 4IJNA 4A8SA 2QFIA 2U1AA 1Y5IB 1SAZA 4OZJA 3R7SB 3CD5A 4CLYA 1FJEB 3OYLA 4BR2A 3FSIA 2FVQA 2P9KB 3LDPA 1T7PA 5B0DA 1S1UA 2PEHA 2GAGC 3BO4A 3WNHA 1VBKA 1YI2S 3H3NO 1Q82T 4ZVSB 4TQSA 4DF8A 1IUJA 4UTGA 1EX8A 5AQVA 2Q2RA 4JV0A 2GO9A 4E2FB 3QGGA 2DGUA 1KC8O 4DTRA 4PRFA 1FDBA 3IO1A 1QAIA 4F50A 3PIOQ 4ZVGA 4KHQA 2BJ9A 2BQ3A 3A3NB 2W1BA 1MWZA 3RU0A 1MNEA 4MJKA 3SV4A 3UR0A 1XNQF 3GYXB 4KGMA 1HNXJ 1ZETA 1YK9A 2ASMA 1LXJA 5KFWA 2HVDA 3TI0A 3LM2A 3HHNB 4M45A 4G1QA 4GVBB 1DGKN 1ZAWA 3ZYYX 2KHOA 1FRXA 1NBWA 3FKBA 4L6V3 2GHPA 2JWLA 4C2MA 4RX6A 2ZM6J 3CPEA 4KHNA 1A6LA 2HBLA 4EBEA 3AGRA 1UPMB 4Y2KA 4X4RA 3ENQA 3RGIA 2X3DA 2KG0A 1BIZA 3KLGA 4Y34A 2B56A 1SC3B 1IN0A 2B4JA 4J7CA 3ETOA 2Y1RI 4U67L 4I6MB 3OYGA 1YJTA 2VV5A 2FHJD 3CMEN 2IIRA 4JYAF 4JLHA 4IOCQ 4MIWA 2DD8S 4MKBA 2VDHA 3V6KA 1SCJB 4K8ZA 2ADCA 2OMLA 3QZ7A 1XR7A 3GJSB 5DG8A 4OYIA 1YRXA 2HFUA 3OYIA 1F9HA 2UUTA 2DGSA 4Z0UA 2YKQA 3CJ7A 4NLGA 1I6JA 2WCXA 1XMQJ 2BH1A 1FNOA 4I64A 3ZT0A 1NUEA 4K0KJ 3TAMB 1X4FA 2Z2YB 1LFWA 2ILYA 3OPKA 4ED8A 4ETXA 2ALYB 3ZT2A 2ZZNA 3ISND 2G8HA 4C97A 3BH6B 4NLPA 1U0HA 2FC0A 2KM8C 5GADU 2CQBA 4FCYA 3VF2A 1MW7A 4DU4A 4H4KA 3DDKA 2NRTA 4FYDA 3NGIA 2M4MA 3UN5A 4LSZB 4IDHA 4KHUA 5HP1A 2NYIA 1Z2LA 3VAHA 4FOEA 3PG9A 2PA3A 4NA2A 2GX9A 3DXKB 4JN4A 3OYMA 2Z1HA 2XSJA 3H4DA 4LF5K 2YCHA 2UXCJ 4I9LA 4BQZA 1OQ6A 2L08A 1REGX 4ERDA 3HK2A 1S1XA 1JLAB 1RUSA 1E6VA 3PYDA 2CQDA 4Z4EA 4AT1B 2P5OA 2B9YA 3VVTA 1S76D 4H4OA 4J90A