1LW2A

Crystal structure of t215y mutant hiv-1 reverse transcriptase in complex with 1051u91
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
539
structure length
518
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFARKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLYTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of Zidovudine- or Lamivudine-resistant human immunodeficiency virus type 1 reverse transcriptases containing mutations at codons 41, 184, and 215.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
total genus 141
structure length 518
sequence length 539
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2002-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1lw2A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lw2A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lw2A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lw2A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1lw2A05
4IG3A 5CZ2A 3OLAA 3HP6A 1WNEA 2HNDA 2JEGA 1UA1A 4Y34A 3KHGA 2HHXA 4CJTA 2FLPA 3V1QA 4TY8B 4CJ5A 3DMJA 2HHQA 3I0RA 3AO2A 4ZVGA 2XY7A 2PY5A 3MEEA 2JEFA 3PX6A 2W7OA 1L3UA 1SV5B 2QE5A 2YNGB 3Q8RB 5HROB 5C25B 4CHOA 4J9RA 3RMDA 2OPRB 2KZMA 3QNOA 4OKEA 4WZQA 1EXQA 2ZE2A 4FJJA 2OPPB 3ZSXA 2FBVA 3M8PA 3S3NA 1ASUA 1NKEA 4LSNA 3LPUA 5FROA 4GC6A 4FLXA 3KHHA 4ELTA 3H5XA 2R2UA 3V81B 1K1SA 4NYFA 3QNNA 1KLMA 3PHEA 1IKXB 4I9QA 3QO9A 3ZSRA 4B3OB 5JUMA 4K4UA 5JXSA 1HQEA 1TL1A 3HP9A 3IG1A 3S9HA 3NBPB 3BSOA 3T5LA 1FKPB 2IOCA 3T19A 1FK9A 1XR5A 2IC3B 3KLHB 4F4ZA 4CEEA 4ECQA 3E01B 3ISND 2E9ZA 4CGFA 3MEDB 4EEYA 4H4OA 5L1IA 2OZSA 3K5LA 1SH2A 3OL7A 4FLVA 2HWHA 2UVRA 3V9ZA 3QYYA 3OHAA 3BSAA 2W9BB 1X9WA 4IKFA 4EYHB 4R8UA 4IBNA 3MR5A 1I39A 4LSLA 3Q8QB 3KK1B 2EC0A 4F4KA 1U49A 3MXIA 4DSEA 1XR6A 3OY9A 1TQLA 1XR7A 4WYLA 4IRDA 4Z0UA 4HHTA 2E6LA 3PO5A 4FJKA 1IKVA 1S6QA 3JSMA 3IS9A 1JLCA 4M3RA 3V9XA 3ALYA 4OVLA 1S97A 5I3UB 4XPCA 2ILYA 1KTQA 5KGXA 3BQ1A 4TXSA 1D9DA 1S0NA 2YNHB 3HVTB 5KI6A 5EWFA 4BWMA 2D3ZA 1D1UA 3RMAA 3SV3A 4FK0A 2C22A 4QPXA 2QXFA 1QTMA 5J1EA 4K4VA 3NCIA 2HHVA 2YNIA 4FLUA 3B6OA 3VA3A 4DQSA 4J2BA 4CHYA 4OL8A 3AVNA 1S6PB 2FJWA 1S6QB 2VG7A 3D5MA 4M3ZA 4CGHA 3DLGA 2B43A 3KJVB 3BGRB 4CGDA 1CZBA 3ZT3A 2DY4A 1BISA 1FK9B 5KFBA 3MF5A 4ED1A 4FM1A 2ASJA 5KG5A 1ZBUA 3ISNC 4QWAA 3HYFA 2HHSA 2YNFB 1BQMB 3MECB 1ZTTA 3LP3A 3V9SA 3RB3A 1S1UB 1RCHA 2JC1A 1HYZA 3TQ1A 2IC3A 3KLHA 2XGPA 3OJUA 1N6QB 3E51A 3RB0A 3OYEA 4CJKA 1HPZB 1RDDA 4CJEA 3M9OB 5CYQB 1T3NA 3QIOA 1KCFA 4F3OA 1G15A 1NNDA 4TQSA 3OYFA 5KFYA 1EP4A 4LD0A 3WNFA 2C2RA 3V1OA 3OYBA 3KD5E 4LSLB 3H98A 1J5OB 5EUHA 2HNYB 3QEVA 1BL3A 4E1MA 1MU2B 4RNOA 2HNZA 5J1EB 1I6JA 4Q8EA 2BANB 5HP1B 3DRPB 2VG5A 3LP1B 4IFYB 4PQUA 4UQGA 3GIJA 2RN2A 4CK1A 2WONB 1NOZA 1IM4A 4TY9A 1XHZA 4RG8A 3UQSA 4G3IA 4HYKA 1VSMA 4OPJA 4RNNA 5E41A 3PX4A 1RTJB 2WOMA 3KLGB 2E6MA 4Q0BA 3QLHB 2R8JA 3OYDA 3CVKA 4NYNA 4E1NA 5F9NA 3RR7A 4FM2A 4NLDA 4MQ3A 3CFRA 1KFSA 1HMVB 3LP0B 3FQLA 1QSLA 3C6TB 4QW8A 3SQ1A 3D28A 5EDWA 3SQ2A 3PW0A 4CHPA 1A5WA 3NGIA 4LH5A 4KI6A 2YKMA 2XI3A 3IRXA 4FLZA 1HPZA 2IBKA 4XIUA 4FJ7A 3T5JA 4AHVA 3A2FA 3LWMA 4RNHA 3HPHA 5KFOA 3IS9B 3ZT0A 3U6FA 4FXDA 4NLOA 1CLQA 3KLGA 2C28A 4BDYA 4K4ZA 5FDLB 2OPQB 1EETA 4KREA 3ITHA 3OL6A 1RBVA 4CGJA 3VQQA 3V6DA 3C6TA 2IAJB 1C0UB 1QE1B 1C1CB 1JLBA 3VN5A 4Z4IA 4DTPA 1IKVB 3QIDA 2AGPA 3RR8A 4DQPA 1MU2A 2HHUA 5I42B 4EBDA 4ID1A 1SKSA 3G10A 4KI4A 2UUWA 1RTHB 1NJZA 2KTQA 1SH3A 3F73A 2W7PA 4FLYA 5F8JA 2P1JA 4BACA 3PR5B 1YVUA 2W9CA 1RNHA 3NFAA 4E7IA 1DTTA 1TK5A 3NAHA 4F4WA 2A1SA 2XY8A 4H4MB 4CHNA 1U45A 3NGZA 1LWEA 2C2DA 2XI2A 4KO0B 3ZT4A 5KFLA 4JV1A 3TAQA 3CJ2A 1BQNB 4MFBB 4ZVHA 1LAVA 3BDPA 5HBMB 4AHSA 1KHVA 1BCMA 3H40A 1DTQB 5KT5A 4C8NA 3RRGA 3MFIA 3SUPA 2FLNA 3VQAA 2HHTA 2XHBA 1IKYB 4TY8A 1RT6B 4R5PA 2GUIA 3AA4A 2C2EA 3ASMA 1F21A 2F8EX 2ZQBA 3EY1A 2ZE2B 1VSHA 2XC9A 4I2QA 1LAWA 4EP5A 3EZUA 3AA2A 4M3UA 1VSDA 4CEOA 1Q9XA 1T05A 4IKAA 1A5XA 3VQDA 5HLFA 4IR9A 2FJXA 3IG1B 3MEEB 3P83D 4E0DA 5KG3A 5DGAA 3CM5A 1YTUA 3OJSA 3QGIA 4FW2A 4E7LA 2IDOA 5KG1A 1S1TA 3RAQA 1DTTB 3NHGA 4ECTA 4CFBA 2HNDB 3OS1A 1R0AB 4H4MA 1RT4B 2FBXA 1NJXA 1J54A 4B3OA 5J2QA 1RT2A 3VQ8A 1S9EA 4RW6B 4E7HA 1SKRA 3EZ5A 2QV6A 2EX3A 5KFIA 5FDLA 2GIRA 4ZVFA 1WSGA 3KOAA 4KFBB 4RW4B 4CCHA 1IKWB 4TQRA 4BE2A 1QAJA 4ZP6A 3LANA 3BR9A 4QW9A 3AA3A 4N47A 1Q9YA 4MIBA 4Q43A 3M8RA 1TKZB 4CHQA 1D8YA 4NCGA 1BQNA 4XO0A 4I2QB 3OYLA 3G86A 1BIUA 1JX4A 4ID5B 1WAFA 4NRTA 4CF9A 2XCPA 2UUTA 4AHUA 3OYKA 1JLGB 4IG0A 2W9AA 4Z4EA 1TKTA 1JXBA 3G6VA 2HW3A 4R0EA 4Y1DA 1RTDA 1Y97A 3CDUA 3V1RA 1S9FA 1GX5A 4OLAA 5DQGA 2VG6A 1TK0A 1Z25A 1S1VB 3CIZA 1HQUA 2GBZA 3TAFA 3D0PA 4F8RA 2YKNA 5HRPA 2V4RA 4R8UB 3SPYA 1JLAB 3NAEA 1VK0A 1S10A 4QAGA 3NDKA 2OZMA 4IDKA 4JV0A 5KFSA 3VQ5A 4X2BA 1IG9A 3KMQA 4EZ9A 4AILC 4KV8B 3VA0A 4DSIA 3OVNA 4Q5VA 4F3TA 4JS4A 4LQ3A 3DOLB 1T8EA 3VQ9A 1N6QA 4IOBA 3LP1A 1S1TB 3TWHA 2XY6A 3RAXA 3T1AA 1R0AA 4RW4A 5L1LA 1LWFA 4ID5A 4MK9A 5F8NA 3PJWA 4FZYA 1BI4A 4LY7A 1TV6B 1CXQA 1VSLA 4U7CA 3KD1E 5T14A 1FKOA 4J2EA 4DS5A 1S1XA 4QOZB 1C6VA 4NLQA 4FZZA 4NLVA 1XWLA 2HNZB 3DLGB 3SUOA 4DWIA 1RT1B 4FJMA 2VG7B 2X6NA 4FJ8A 2Z1HA 4W5OA 4LSNB 1OS5A 2WOMB 2J6UA 1KVBA 3O4NA 5DQHA 2YNFA 2YNIB 3K5MA 3DI6B 2R8GA 4CEDA 2AX1A 2R8IA 5F8IA 1LWFB 3NAIA 4FK4A 2XGQA 3KMSA 4PQUB 3BQ2A 1RTDB 2D0CA 1VSJA 4ECYA 5KFWA 5FRNA 4DF8A 4ECVA 2XWYA 4ECZA 3GV7B 4HCCA 2V0NA 4O55A 4QWEA 3V6DB 2ASLA 1KVAA 2Y1IA 2IMWP 4DTOA 3SYZA 3Q8PB 4DF4A 4DS4A 1L3SA 4B9TA 3THVA 4ED7A 4IH6A 1N4LA 4KTQA 3KJVA 3HVRA 5J2PA 1U47A 4CJ4A 4DTUA 2W9BA 3I0SA 2F8SA 3KLIA 1RTIA 3QERA 2BE2A 3GV5B 4AHTA 4DTNA 1C0TB 4CFAA 5HRSA 4WXOA 4MK8A 3RBDA 1RDRA 4FW1A 4DU1A 1TAUA 2D3UA 3H4DA 1QS4A 2AGOA 4NYZA 2WRMA 3NMAA 3QETA 4DSLA 3I5BA 4KRFA 3HT3A 1SUQB 2R8KA 4RU9A 3CFOA 3QLHA 3BSNA 4I7FA 3WNEA 4TLRA 2ETJA 1RT3B 5KFVA 3EPGA 4F4XA 1HNVA 1IO2A 1ZBHA 2G8FA 1KLMB 3AVIA 3LP0A 1WSIA 5KT2A 2WTFA 3DRSB 4K4YA 3GYNA 3ZT1A 1TAQA 1ZBLA 3L2UA 3O4QA 3RBEA 3QESA 3SZ2A 3NBPA 1RTJA 1SL0A 5J2MB 5KFMA 4F4YA 1HNIB 2D0AA 3B6PA 4ECRA 1EX4A 1XC9A 2Y1JA 3L3VA 4FJ5A 4O4GA 2AQ4A 4URGA 3NH0A 1TL3B 4TYBA 3MEDA 4FM0A 2R8HA 1LV5A 2LSNA 4CJPA 3NH2A 2O4IA 4ZHRB 2Z1GA 1KRPA 5KG7A 4ECWA 1NOYA 2JGUA 3HL8A 4NLSA 2HMIA 2CKWA 4DTRA 4R5PB 2D5RA 4WE1A 3GQCA 1BCOA 2QKKA 2YHBA 3FFIA 4ZMMA 4PWDB 3FDSA 4DG1B 4NLUA 3L2RA 3FSIA 5J2NA 2D41A 1U04A 5CYQA 4JLHA 4MKAA 2ATQA 2R7YA 4CF2A 2DFEA 3V4IA 4HUGA 3O3GA 3MTKA 1ZETA 3VQ4A 3PJXA 4NLYA 4NLXA 4CERA 5HBMA 3HO1A 2DPJA 1RT6A 3VQEA 5DMRA 1A5VA 3AVLA 1HYVA 4BE0A 2B5JA 3PO4A 3MFHA 4M3XA 5C42A 3U3YA 4O44A 1NK6A 2XRIA 2X74A 3CO9A 3BJYA 3HVWA 2BE2B 1RT5A 4BDZA 3ZCMA 3GIMA 1RAJA 3C6UA 2VA3A 4ZP8A 1B9DA 4CJVA 3F9KA 1J9AA 1IKWA 3H5YA 2IM0A 4J2DA 4Z4CA 3CJ4A 1S1WA 3VQ7A 1X9SA 4EZ6A 4PUOA 4DQRA 5K14B 4K50A 1VSKA 4MH8A 1W0HA 3DM2A 1XHXA 4NLTA 4IG3B 4O4RA 1HNIA 2P5OA 4CEFA 4Q45A 2DFFA 2I5JA 1RT7B 2BGGA 2G8IA 4NLGA 5KGWA 3NF9A 2B6AA 3AVAA 3I5CA 1HQUB 2VA2A 2BR0A 4G1QB 3G0ZA 3SNNA 3CJ0A 2BDPA 1S0OA 4W5QA 4KB7A 2D7SA 5KFXA 3V6KA 3LPTA 4M95A 5JS2A 2D0BA 4DFMA 3HPOA 3K58A 3TARA 2RKIA 3LP2A 3KTQA 1K6YA 4AH9A 1CZ9A 1TKDA 3HJFA 3T5KA 4J9KA 1S9GA 4CEQA 5DG8A 4ZPCA 5KG6A 1W25A 2JLEA 1NHUA 4CF1A 4B9UA 2E4LA 4HCBA 4KHRA 2V9WA 4IH7A 3HPGA 4RW7B 4OJRA 4DEZA 1L5UA 4FJHA 4B9VA 4Q0BB 1WSEA 4IQXA 4B8CA 3TAPA 1NK7A 2XY5A 3FFIB 2IM1A 4IFVB 4KHMA 1TKZA 2HB5A 2R2TA 4YQWA 3VQCA 4W5NA 1NK0A 2E9TA 4ICLB 3TVKA 3SJJA 1HQEB 1SL2A 3WNGA 1RT5B 4ECSA 5KTQA 2YKNB 4YP3A 1WSHA 2FVRA 3KKSA 5CYMB 4DLEA 2OPSB 3NE6A 1SV5A 4FJXA 4O44B 4EO8A 4JRQA 2DPIA 1N48A 3SV4A 5KT6A 4PUOB 1RA6A 4KHYA 1C2PA 5KFPA 1FKOB 3ICLA 1CXUA 4BDPA 2QKBA 3RTVA 1SKWA 4ZPAA 3FRZA 1JXEA 1HRHA 1KFDA 4N5SA 2AWZA 2PYLA 1K1QA 1JL1A 1QQCA 4B9LA 1C1CA 1VRUB 3AVBA 4IH5A 3N6NA 2YNGA 4FS1A 2ILZA 2IJFA 4CK3A 1BI4B 2YNHA 4YMEA 2I1RA 4RW7A 2WK4A 3OLBA 5HRRA 4Y2CA 4FCYA 4CJRA 4NCBA 3K2PA 2CJQA 4ELUA 3TAGA 2RF2B 3DLEB 3SFUA 4J9PA 4ED8A 4FJIA 4BE1A 1S1VA 3ZSVA 1RT1A 1RILA 2DFHA 2W9CB 3DOKA 4HTUA 1JLAA 4Y2AA 5C5JA 5F9LA 2IA6A 3MEGA 4ZP9A 3KLIB 5L1KA 4TSXA 1DTQA 4DL6A 1BHLA 1GOBA 1VRTB 1NK4A 3PV8A 4RW8A 4KHWA 3RRHA 4NCAA 2HVIA 1NK9A 2ATLA 3RMBA 2V4QA 5KFRA 4DLGA 4J9SA 5DQIA 5L1JA 2BQ3A 1JLBB 3T5HA 1UA0A 3DM2B 3GIKA 1T05B 4URSA 1S4FA 3OS2A 3HVTA 2I5JB 4RNMA 4KKOA 4AHRA 2JEJA 3O3FA 4FVMA 4FJGA 1REVA 5F8LA 3G6YA 4K8ZA 2KFZA 1KHWA 1S6PA 1RTIB 3BSCA 2RDIA 4RZRA 5J2PB 3MR2A 2AJQA 1T03B 4FLWA 2KQ2A 4DTXA 3P5JA 3KK1A 3KLFB 3GILA 4B9NA 4RW9B 1WSJA 4FJNA 3QINA 2G8VA 3VQBA 5KG0A 3OL9A 2KW4A 2NUBA 1ZTWA 4W5TA 3AVJA 3FQKA 4CJFA 1IH7A 1RBUA 4C8KA 3IGVA 1Z26A 1YVFA 1JLEA 4EP4A 4O0IA 1UWBB 3RMCA 1U4BA 3MXJA 5HLFB 1VRUA 3K5OA 4RW8B 4M41A 1HYSB 3DLKA 1JKHA 3I8DA 3ZSYA 4Z4FA 2UVWA 2BANA 1GOCA 4CJSA 3RWUA 4F2SA 2UVVA 2YHAA 4YR2A 4DU4A 3MR6A 4E19A 1NKCA 1NJYA 4M42A 2HNYA 4DL5A 3MEGB 1VSIA 2RPIA 4Z4HA 1EKEA 4OLBA 2X78A 3V4IB 4W5RA 1N56A 1S9EB 2OPRA 3QEWA 1ZYQA 1ASVA 2OPSA 2F96A 4CF0A 5C24B 4E3SA 5HP1A 2ZD1B 3M8PB 2R2RA 1QAIA 4CIEA 4DSKA 2ITGA 4CFCA 4URQU 2J6TA 3QEXA 2GV9A 3HVAA 1HNVB 2O5DA 4L8RB 1TL3A 4WE1B 3SQ0A 2GIQA 1BIZA 4DL2A 1T03A 4H54A 2R2SA 1RDBA 4QWBA 2G8HA 3RB6A 2Z1JA 4WFXA 1JLFB 4KAIA 4K8XA 4F2RA 1WSFA 5KFEA 1JLQA 2JC0A 1EP4B 3AVHA 1HYSA 3AVKA 3V81A 2FJVA 3QIPA 5EWEA 3ITHB 3HM9A 2OPQA 1TKTB 3C94A 3KIOA 3NH1A 4C8OA 4TYAA 4KTWA 2W8KA 4Q44A 4ZPBA 4O5BA 4CJQA 4RNFA 1T7PA 2B4JA 4HVJA 2GC8A 2IJNA 4QWCA 4DQQA 4WFZA 2VWKA 2B6AB 4E7KA 4CJWA 3NGDA 1RBSA 4BWJA 3TANA 1REVB 3OYGA 2G8UA 2XO7A 4B9SA 2J6SA 3V6JA 3SI8A 2FVQA 4M3YA 4MFBA 4GMJB 2IS3A 3CQ8A 4CGGA 4G1QA 5KT7A 3GIIA 3OYIA 4KSEB 1LWEB 1YT3A 3I5AA 2ASDA 5D3GB 1TL1B 2WB4A 1TKXB 4DFPA 3LAMA 5DLGA 3AVMA 2VG6B 3K59A 2IGIA 5KFUA 2FVSA 4AHCA 1LW2A 3SI6A 3KLEA 5CY4A 1QSSA 1C0UA 2FLLA 1RA7A 1NKBA 5J2NB 4CJ3A 4KB0A 4O3SA 5K14A 1U48A 3TABA 3KNAA 1FXXA 3PZPA 1JLQB 1TK8A 1RBTA 5I42A 3KKRA 4F50A 3I0SB 1NHVA 3ZSOA 4YFUA 4ICLA 1JLCB 3AO3A 3PUFA 4FZXC 5FRMA 3PW7A 4H4OB 3NL0A 3PR4A 3OS0A 3CJ3A 3DLRA 3OYNA 2P5GA 2B5JB 5KFKA 3QEPA 3T3FA 3ZSZA 4TN2A 1VSFA 4KO0A 3NKYA 4OGCA 1UWBA 2HHWA 2HAIA 2Q3SA 4NLWA 1LW0A 2IM3A 5KFGA 1S0MA 3KK2A 3DYAA 4DL3A 5T7BA 3M9MB 2PYJA 4J9LA 1BGXT 5KT4A 3AO1A 2ALZA 3M8QB 1Z4UA 4JUZA 3CFPA 4OGEA 4I2PA 1XI1A 3HSTB 2VWJA 4J9NA 2HVHA 2FVPA 3K5NA 4KHNA 2W8LA 5DG7A 4DL4A 3KLEB 5KG2A 3MR3A 4ZP7A 2G8WA 2XCAA 3V9UA 4ED2A 5KFFA 2AGQA 3SCXA 1IKYA 1U09A 3M9NB 3QGGA 3QEIA 1W9HA 4J2AA 1NK8A 3OSNA 1L3TA 4E7JA 2A1RA 5CYMA 4KBIA 3QZ7A 4CK2A 2WHOA 3CYMA 2WCXA 3KHRA 2QK9A 1HARA 2FBYA 3PX0A 3DRSA 1TP7A 3OL8A 5KT3A 1JLGA 4IG0B 2FC0A 4C8MA 3AA5X 3DRRA 1RT3A 4MKBA 4M94A 4Y1CA 2G8KA 4FBTA 3P1GA 3QZ8A 3H2LA 3S3OA 3HHKA 3TAMB 3UDLA 4WZMA 4I7FB 1KVCA 4ZHRA 4KE5A 3VQ6A 4NCGB 4K4WA 2KFNA 4M3WA 1QUVA 5EWGA 4YR0A 2BRKA 3AO5A 4N76A 4EO6A 4ECUA 4H8KA 1O1WA 3DMJB 1RYRA 1D0EA 4FJLA 4KFBA 4O0JA 5L9XA 3N6LA 1JL2A 3LDSA 4ZVEA 4JV2A 3PW4A 3LWLA 4RUCA 3C95A 3IN5A 2FVCA 5KFNA 3OHBA 1UOCA 1T94A 2FBTA 2YV0X 4FS2A 1Q8IA 4DQIA 4PWDA 3AVFA 4IFYA 4WYWA 5D3GA 4OPKA 4GC7A 3LZJA 3PW2A 1QE1A 1GOAA 4O3RA 3CDEA 3JYTA 2W42A 1IKXA 4CEAA 4I9LA 4YNQA 4K4XA 3HXMA 4CGIA 3PY8A 3C6UB 1DLOA 2PZSA 5C24A 4ZPDA 4NZ0A 3H4BA 1L3VA 1LW0B 1B9FA 3KHLA 2IAJA 3E01A 4OKJA 4J9OA 3CG7A 3ZSWA 4DFJA 4FLTA 1JIHA 1YTAA 2JEIA 4NLRA 4DTJA 4WFYA 3LZIA 3QO9B 1EETB 1FKPA 4IRKA 4O3PA 1JLFA 4FBUA 2OPPA 3TI0A 4DTMA 1S1XB 4DG1A 4K4SA 3NF7A 1JKHB 4U6PA 3CM6A 3MAQA 1MMLA 4JRPA 1KSPA 5KFQA 3GV8B 3OYAA 3BGRA 1SL1A 3EPIA 5KG4A 3AV9A 3V6HA 1TVRA 3LP2B 3KLFA 1C0TA 3G6XA 3HKWA 4K4TA 4CJLA 3M8SA 2IM2A 1QHTA 4HUEA 1RT4A 4HKQA 3SQ4A 3MECA 3NGYA 1RBRA 4O3QA 5SZTA 4CE9A 3N6MA 3UR0A 3VQPA 3U3GA 3ZSQA 3NF8A 1C1AA 1D5AA 4IFVA 4ED6A 3L2VA 4DSFA 4CIGA 2BQUA 5F8GA 1X1PA 3H59A 3OYCA 1WN7A 1JLEB 4ELVA 1GX6A 3KLVA 3BREA 4RW9A 5I3UA 1LWCB 3JYTB 4DSJA 4CFDA 5CZ1A 1S5JA 2RDJA 4ED3A 5SWMA 3KK3B 4M3TA 4LQ9A 4LH4A 1RDAA 1SUQA 2OH2A 3O3HA 4GW6A 1CSJA 1DLOB 3CJ5A 3QIPB 2OYQA 1NJWA 1S9GB 3TAEA 5KFDA 4MIAA 1LW2B 4DMNA 3SUQA 4CEZA 3K57A 2KZZA 1S1UA 1C1BB 3OSPA 1WNSA 3H5UA 5KFTA 4NRUA 1J53A 1TGOA 3S3MA 3Q8SB 3OYJA 5HRNA 5DLFA 4WXWA 1WAJA 4KAZA 3AVCA 4B08A 1I3AA 3SUNA 3LAKA 4J9MA 3DLBA 4N41A 4XPEA 4CEBA 4B9MA 1TVRB 3AO4A 3IAYA 4CIFA 2WONA 1TKXA 3PW5A 4KHSA 1S48A 5DG9A 3PVXA 1D9FA 5KFAA 4RUAA 3SPZA 3DRPA 4KTZA 5DGBA 2X6SA 4ZTFA 3DOKB 4IR1A 5DK5A 1VRTA 1HJRA 2P51A 3OYMA 4ED0A 1SH0A 3NF6A 3DLHA 2RF2A 3DLEA 2HWIA 1N5YB 3L3UA 3UPFA 3ULDA 1LWCA 4ECXA 5J2QB 5HROA 4KHQA 3CWJA 4KPYA 1HMVA 4IDKB 4ZTJA 3L2WA 1BQMA 1B92A 1X9MA 4CF8A 3EYZA 4B8AB 4CHZA 3RB4A 4PY5A 4GVMA 2AU0A 3H08A 4HUFA 3DOLA 5KFHA 4EYIB 3AVGA 3IRXB 5KRSA 3DYAB 2YKMB 4OKKA 3QGHA 3ZT2A 1ZBFA 4KHUA 3LALA 1J5OA 4C8LA 4EBCA 4Y3CA 1RT2B 4I2PB 4J9QA 1VSEA 4N56A 4DL7A 4O4GB 1C0MA 2HMIB 3SFGA 2OA8A 3KK2B 5KRTA 1S49A 4Q8FA 1RDCA 4CECA 3I0RB 5J2MA 4KV8A 3DLKB 4Z4GA 4DU3A 3TR8A 4CESA 4KKOB 1C1BA 3L2QA 4QWDA 4O3OA 5EU7A 5KFJA 1RYSA 3HK2A 5JS1A 2BQRA 2DTUA 1RTHA 5C25A 2VG5B 3D45A 3L8BA 1N5YA 4EBEA 1UAXA 2Z1IA 1TV6A 5F8HA 1S1WB 4M45A 3H5SA 1NK5A 4QCLA 3CDWA 1ASWA 4O3NA 4E89A 1ZBIA 2BRLA 5KFZA 3MXMA 4FJ9A 4IRCA 2AX0A 1ITGA 4FYDA 2E9RX 2O4GA 4FK2A 3VQSA 2ZKUA 5KFCA 4CJUA 2RKIB 3V9WA 4NLPA 3DI6A 4MK7A 4YR3A 1KLNA 3KK3A 4PA1A 3JSMB 4DFKA 1JXLA 3UIQA 3DRRB 3OYHA 1QSYA 3WNHA 2UVUA 4JS5A 5C42B 3IGNA 4RW6A 3BQ0A 1WLJA 3DDKA 2ZD1A 4DTSA 3TAMA 2EHGA 1RT7A 3M8QA 5F8MA 2F8TA 4KB1A
chains in the Genus database with same CATH superfamily
4IG3A 3NOGA 5CZ2A 4YORA 2HNDA 2JEGA 5KPTA 4Y34A 3LH2S 4CJTA 3SK3A 4BRKA 3M2VB 2RU9A 1HA1A 3CCMS 5DDRC 1H38A 3ATVA 4ZVGA 2PY5A 5BRHA 1L3UA 1O8BA 2QE5A 3AJDA 3VERA 3OVBA 4DV0J 2E5LF 3TSQA 4J9RA 2V4JA 2CPXA 3RMDA 5HJXA 2M4MA 1WKJA 1R89A 1KQSR 3PFEA 3GL1A 2ZE2A 4QOTA 5GAGI 3G4SS 4LFBK 5GVQA 2VCPA 3S3NA 1ASUA 4LSNA 4TU7A 2DXFA 2JJ4D 2R2UA 1WORA 3LDQA 1K1SA 2NUHA 4PPDA 1KLMA 2XLJA 3A3OB 4X66K 4K4UA 2VBZA 1HR0J 1SXLA 1EWRA 1JNRB 2CZ9A 3DHWC 1TL1A 3BN7A 1DAXA 1XMQF 3S9HA 5HQ8A 2IYGA 1TUUA 3O80A 5CZXA 2IC3B 3CCQS 4USVA 4F4ZA 3MM6A 3EVMA 2E9ZA 2J9DE 3LDPA 5K8PA 4JKCA 2JH3A 4CGFA 4I68A 4EEYA 4JV5K 1NM2A 2F5GA 5L1IA 1QTNB 4OX9K 2HWHA 1NGHA 1BA1A 4CO3A 4JI4F 3MGJA 3OHAA 3BSAA 5DDPC 4BC9A 1HI8A 5MLCQ 2H5EA 2W4DA 3GCWP 2R7OA 3KK1B 1NHKL 3PTWA 1M90O 3OTOF 4DR5K 2AHOB 4IRDA 4HHTA 3TRGA 2HHHF 4C0OC 1VGYA 5IC6B 3VAJA 2Q36A 3NNCA 3GG4A 4M3RA 5I3UB 2P2CB 2WSEC 2ERRA 1TUYA 4YB1P 4ZVQB 2KJVA 5KI6A 2Y1LB 5AQTA 3IDHA 1TUVA 1D1UA 4F67A 1FCAA 3RMAA 4EFAC 2C22A 4QPXA 5LL6d 5J1EA 5T7LB 3QWPA 4FOIA 3NCIA 2KXHA 2AEMA 4RUBA 5MAOA 1VMBA 3VA3A 1FWLA 4HEA9 4DX5A 4JYAK 3M6VA 1S6PB 3SSSA 2DK2A 1RADB 4BRFA 3D5MA 4M3ZA 4JI5K 5KPZA 2NNWA 2C2OB 3TVYA 1FK9B 2VV5A 3PSFA 3MF5A 1J5EJ 3N5BA 1DQ9A 2ASJA 1UW4A 4NO7A 4R0JA 2HHSA 1VYAA 1ZTTA 3J81j 3MMBB 5F0UA 2JC1A 1PBUA 2IC3A 3ZNUA 1N6QB 2YWKA 3OYEA 3BZCA 1HPZB 3CCWA 3SMPA 4CJEA 2CNKB 4F3OA 1G15A 1EP4A 2F8MA 2ZDOA 2XMWA 1VQ6N 3GR0A 5EUHA 4CD3A 4A8XA 2Q1NA 5FLXY 4CVNE 2CPEA 4RNOA 5J1EB 5T7LA 4Q8EA 3DRPB 3O8WA 5B0AA 4IFYB 1YRUA 2WVFA 4UQGA 4DL0C 2R7RA 1WKKA 1NOZA 1ATRA 1XHZA 3ELHA 2F9TA 4D3GA 1RWWB 3CERA 1RTJB 3KLGB 2Q31A 2E6MA 4DV5K 4NYNA 3ZEUB 5IT0A 5ETLA 2WSCC 4MQ3A 5BXIA 1KFSA 4P9SA 3LP0B 4L3QA 4GMKA 1I1GA 2IFXA 3SQ1A 2D9PA 1HWIA 1E6VB 2OD6A 3HD2A 3NGIA 1B4SA 3BH6B 3IRXA 2DNGA 2DY9A 2VKZG 4AHVA 3E66A 4F0HA 2VC1A 4USUA 3LWMA 3RYLA 3T1YJ 5KFOA 3IS9B 3ZT0A 1NGJA 4DR1K 4NLOA 1Q86T 4BDYA 3M1VA 1M1GA 4CLLA 1DJ0A 5LXRA 1N8RO 3DJCA 3PEHA 1EETA 4UY8O 1HKAA 3OXLA 1VQON 1F1BB 3TX0A 4AL7A 2WAQD 2KVQE 2AGPA 2XHWA 1K44A 3RUBL 2HHUA 5I42B 1UVIA 1Q16B 5AZJB 3VEYA 3KFWX 2UUWA 2UXDJ 1LWXA 1NJZA 1FDNA 2W7PA 5F8JA 1BOTO 2J0SD 1YVUA 2NCKL 3OT9A 2Y1RI 2VYPA 2ZNYA 1VQSA 1V3RA 1XNQJ 3ZT4A 1ZXOA 1S72S 3CJ2A 3KXDA 5AJ3J 2V7ZA 2QSFA 1KHVA 3G4SN 3H40A 1DTQB 2AV5A 4XH1A 4A5BA 2D3O1 2P9PA 3ADAC 2GUIA 3OVSA 1H2UX 3ASMA 1F21A 1DQ8A 2F8EX 1RWOB 3G71S 2EWSA 3BS9A 1VSHA 2VFRA 5D78A 1E6YA 4I2QA 3D2EB 3CJKA 2XS2A 2HRTA 4M3UA 2RILA 3O4WA 3SAHA 1A5XA 3VQDA 3MEEB 4K5RA 3P83D 4JI3K 1YTUA 2LA6A 4E7LA 2IDOA 3WXIA 3RAQA 1DTTB 1GT8A 3J7YU 3VAHA 2HNDB 4OLOA 2ZWPA 3DLLQ 2FBXA 1NJXA 4LIRA 1MW7A 4B3OA 3THWA 2FPHX 4CQ1A 3VQ8A 1FERA 1DQAA 3O9UA 4NZ7A 1SKRA 2EX3A 2KYXA 1OYEA 4KFBB 4RW4B 1IKWB 4IUFA 2B0GA 4FWSA 4C11B 4N47A 3D2FA 1H73A 3QNWB 4MIBA 4TVAB 2HFNA 4NWBA 1D8YA 4XO0A 1WHYA 2NYIA 4DUYJ 4F02A 4DUZJ 3O1WA 1TUWA 3CF5L 4FSVA 1JX4A 3UN3A 2JHEA 3PM9A 3OYKA 3BM7A 4O8UA 4HTIA 4Z4EA 3W5YA 3NNHA 1Y5IB 2ZC4A 2NXUA 1K47A 2A3JA 3MUMP 3P4UB 2G0CA 1VQMS 4BRNA 2ZOFA 1UJ4A 5ETSA 4F9OA 2VG6A 3DC2A 1TK0A 4UF4A 5F41A 4F8RA 3SPYA 4R8UB 3MOZA 2FTRA 3QMLA 3T6JA 2VDIA 1TL4A 2IVYA 2W2NP 4M5JA 4LC9B 4PWUA 3NDKA 1NJIT 4Y0WA 2OZMA 5M1PA 3HZGA 1N5SA 1OSCA 1IG9A 1WHXA 2NXEA 1WHWA 2FGCA 4K0KK 1HNXK 4JS4A 2A6MA 4LQ3A 3VOVA 4Y28C 1T8EA 3FZ2A 2B56A 2XY6A 1IR1A 2E5JA 4H0VB 5LSLA 2UZAA 2OCEA 2DNMA 1U2RA 2EG1A 1F0XA 3EVOA 1CXQA 4A8WA 1VSLA 4U7CA 2A5XA 1Y64A 3O9SA 4J2EA 1XN9A 3MPWA 2ROEA 4NLQA 2HNZB 3DLGB 1V3SA 2DO4A 2X6NA 4W5OA 3TP2A 2J6UA 1RU2A 1BLUA 1OQ3A 4DPYA 1HQ2A 5DQHA 2FSJA 2YNFA 4YOWA 3G6EN 2W4CA 2R8GA 3PRVA 4PXEA 2AX1A 2BE7D 4KR0B 3KJQB 1LWFB 3NAIA 3ENWA 4FK4A 4PQUB 3GE9A 1RACB 2BJ9A 2X1AA 4YY3J 4U67L 2MB0B 2W40A 4CW7B 4ECYA 5KFWA 3P3DA 3GV7B 4HCCA 1ICEB 3LOUA 2ASLA 4CZFA 1EQYA 2Y1IA 4NEYA 4DTOA 1AB8A 1RABB 1L3SA 3RGIA 2P9LA 3TWZA 4ED7A 5A8RB 3E3XA 4IH6A 3SAFA 3KJVA 4M5DA 3HVRA 1FX4A 1U47A 1CULA 4KH1B 2W9BA 3I0SA 3LUYA 3ILOA 1Q0NA 2LQBA 2IBOA 3UCGA 2DO0A 3T9NA 3KLIA 2CPHA 4CFAA 4WXOA 1QVGR 1FE4A 4FXWA 5HMXA 3RVCA 1TAUA 2AGOA 1IBLK 1IWAA 4NYZA 4JYAF 3ZTPA 3NMAA 2HZAA 3MXHP 2I7NA 1YXQA 2ZBPA 4GKJF 4WTOB 3HT3A 2HBJA 2AF6A 4RU9A 2QEXS 2Q2RA 1RT3B 3EPGA 1HNVA 1IO2A 2A6OA 1ZBHA 1WSIA 4JKFA 2DVIA 3ZT1A 1S72N 1Y3KA 2FHJD 2X1GA 3O4QA 3L2UA 1X8DA 3NBPA 2QWPA 2VQEK 3LTOA 3PACA 4F4YA 2Y1JA 4FJ5A 2AQ4A 4W90B 2R8HA 2YHYA 4XEIA 3NH2A 2FLOA 5G0RB 2FSKA 4CH7A 4NLSA 2A6AA 3VCDA 4C6AA 1MROA 3AHPA 2X1BA 4PQAA 3FFIA 3CSKA 3FSIA 5J2NA 2D41A 2LQ9A 2ASOA 1P8GA 3NMUA 4UUWA 3K17A 1N32K 2AJ2A 3JB9k 2KRRA 4HUGA 3MTKA 1ZETA 3VQ4A 5EY4A 2B4OA 1ATSA 4NLXA 5HBMA 3HO1A 3HRGA 4DCHA 3X1LB 2E29A 4O44A 4JK8A 2QLFB 4EU0A 5FPEA 2HFUA 3ZCMA 5EX5A 1H2VZ 4YY3F 1F9HA 2W1BA 3KJNB 4C4WA 2F65A 3D4JA 1KAXA 2DNRA 1FJ7A 3H5YA 2IM0A 4Z4CA 1YF5L 4AL5A 1Q7LB 4HWIA 2VONA 4EZ6A 5AXNA 3A8YA 2E5LK 4PUOA 3NS7B 4DQRA 3VF2A 5K14B 1M1HA 3QJLA 2Q43A 4O4RA 4MLEA 3T1YF 1NGIA 2PGCA 1RT7B 2PT0A 1CG2A 2BGGA 2G8IA 3HZEA 3NF9A 1YG0A 2BR0A 5GAEU 3G0ZA 3SNNA 2BDPA 1RKJA 2LXFA 1JCFA 2D7SA 1B64A 3V6KA 1FRJA 2D0BA 4LBIA 3QRQA 2XULA 3TARA 3KTQA 3QT5A 4X62J 4ED5A 4F3QA 3HZ6A 4X4NA 1S9GA 5I4MA 5BREA 1W2IA 3MCPA 2DISA 3OPKA 1NHUA 4KHRA 2V9WA 1YZ6A 3DNCA 1L5UA 2O8EB 1NGDA 1GLDG 4IQXA 3R8YA 2XS5A 4DQ8A 2VBWA 2OELA 4WF9Q 4JHDA 2RT3A 3KVGA 2HB5A 2R2TA 4YQWA 2ZJRQ 4W5NA 1U2FA 4ICLB 5GADU 2UU9J 1AFJA 4I64A 3AGRA 3WDOA 3I82A 4ECSA 5KTQA 3L3CA 5CYMB 4WQ4A 2OPSB 3NE6A 1O5JA 5E3PA 4RTFD 1M1KO 4KHYA 5KFPA 1FKOB 4BDPA 4CYUB 1C4CA 1YJ9S 2QKBA 3RBZA 4H4KC 2F7TA 4ZPAA 3FSYA 4YB5A 4N5SA 2FSNA 2O8BA 2Q6BA 4X65K 1JL1A 3R3LA 1QQCA 4IH5A 2DH9A 2YNGA 3EEQA 2ILZA 3WEEA 2WZ1A 3DXMA 2GMJA 4CK3A 4QR1A 2YNHA 4YMEA 2GJIA 2WK4A 2X7IA 1RB0A 5HRRA 2VQEF 1VJQA 1HI1A 3L4IA 3BN4A 1TR0A 2DEIA 1M90T 3AGKA 4J9PA 4FJIA 3PYFA 2NLWA 1BWVA 3OHRA 5A2QO 2NREA 3DOKA 3QAEA 3Q7BA 5F9LA 3AOBA 1YBUA 4JI7K 2FZGB 2RNEA 3KLIB 4TSXA 1DTQA 3K8WA 4DL6A 2L08A 3VGVA 1VRTB 3N5FA 5E0OA 4FWKA 3PV8A 2V8GA 1T11A 3JSBA 3QSYB 4I6AA 4J37A 5ETTA 4KGMA 1HBOB 4CLUA 3UKRA 4DUYF 5I3PA 4X4TA 1EQMA 2YKQA 1S4FA 3OS2A 3CI5A 2I5JB 3D0HE 3JAMU 5EHHA 4AHRA 2UXCF 3O3FA 5F8LA 1KHWA 2RRNA 2VH7A 2EFNA 4ZCLA 5HK4A 3O3LA 4JKAA 2RDIA 4RZRA 3MR2A 2KQ2A 2BOAA 4DTXA 4P2XA 3IRWP 3KLFB 2IPOB 4B9NA 4FJNA 2DNYA 2A1BA 2G8VA 5KG0A 3OD2A 3LGMA 3I33A 1V5VA 1ZM3A 4BRHA 2E1AA 3AVJA 3FQKA 4CJFA 1RBUA 1TMMA 2NRXA 1RAHB 2EFGA 1P6TA 4NXMJ 1Z26A 4XDCA 1UPMB 4ZVOB 4LF8J 3DXBA 2O3DA 2VHGA 4O0IA 3G82A 4FPBA 2AZ1A 1G7CB 2FGOA 4RW8B 5B0FA 3PG9A 3ZZZA 4X64J 3IBFB 2CQIA 1RWMB 3MM5A 2YHAA 3D66A 4JI5J 3CC2N 1NKCA 4IO1A 2HNYA 4DL5A 1NGBA 5AQFA 2XSFA 1E6YB 2HLTA 3VESA 4Z4HA 5E3RA 2P5VA 1R8HA 2CXEA 3W2VA 1MDUB 1ASVA 5LJVA 2DNKA 1HKBA 1P90A 2ZD1B 4JI1J 2XB2D 4JI6F 3SSRA 4CIEA 4URQU 2J6TA 3QEXA 1HNVB 4YDUC 4M7YA 2NZ4A 3D6TB 2NYHA 3CCTA 1BIZA 3C14A 4H54A 2AIRB 3A4TA 4JI6K 4JB8B 5L9NA 3CC7S 4YDDB 2P8IA 2OSRA 5GINA 1R0BG 3EDRB 1EP4B 3AVKA 1HYSA 4GO5X 4V19S 3V81A 2FJVA 1OJ4A 5AT1B 5FLXO 4IO9Q 3FZHA 4DV7F 4LUBA 1YBAA 4Q44A 2P6TA 4C3LA 3JTOA 4CJQA 1T7PA 4HVJA 3IAM9 4DQQA 1BD6A 1MWQA 1DKGD 5GMEA 3FZLA 3HHLA 2G8UA 3JSRA 3GFYA 3SCJE 1FI4A 3KKFA 2WVBA 4ZIWA 3VF6A 3HFZB 3I87A 1R7IA 3C16B 4GMJB 1U1MA 3GIIA 1WBBA 2PN6A 3R2DJ 3I5AA 4P2MA 3SMSA 2ASDA 1TL1B 1HI0P 3CJ1A 1HNXF 1TKXB 1LK5A 4Y2MA 3PFOA 3QT8A 2QLJB 5KFUA 2FVSA 2IDEA 4BRMA 4LF9F 4CTAB 3KJFB 3VF0B 1QSSA 4LF7J 5CY4A 2MZSA 2V52B 1NKBA 1U48A 5JLHA 2LCWA 1FXXA 1Q7YO 1JLQB 2QFIA 2QL9B 3W9JA 5I42A 1JJHA 2ZZTA 4F50A 1MA9B 1WTFA 4QS8A 3I0SB 5DM7L 4H5WA 3BEXA 3TO8A 3M2UA 4OIXA 4YFUA 1JLCB 3O2IA 4LVNP 4DUYK 4H4OB 5T41A 4DV3F 2ACMA 1T95A 1FEEA 2M7SA 3ILLA 3OS0A 3CJ3A 2VODA 1NDPA 3TUJC 1NCLA 4QYZK 2B5JB 5KFKA 3T3FA 2BABA 3R2CJ 3FEZA 1FRKA 4AFFA 1UVLA 4ZS6A 3P49B 3C19A 2C3MA 3NKYA 4DN9A 4DV6F 2DNZA 3G82B 2HHWA 3D6MB 1S0MA 1EHWA 2HF4A 4DL3A 1ZM2A 2PYJA 3M9MB 4DV6K 2ALZA 3G71N 2LECA 4JUZA 1Z4UA 4ZJQA 4OX8A 3P38A 2HVHA 3SLCA 2WFBA 4LBPA 3KLEB 3NGKA 4ANDA 4G1IA 1OSDA 4ZP7A 4JI5F 2ZZMA 2R3VA 2AGQA 1VC5A 2OJ3A 2B4VA 4OQJA 1YGYA 4IOAQ 3QSIA 4JI4J 1VOMA 3OSNA 2WBNA 4PAAA 4A8FA 4DV7K 2VFUA 3GYGA 3M1FA 4KGKA 1C0GA 1AXQA 1CJKA 5KT3A 4LF5F 4IG0B 4C0BA 3AA5X 1K9MO 4LF9K 1RT3A 2G2ZA 2J0XA 2UUCK 4QBUA 3E1YA 3C66A 4AXJA 3IR7B 2HHHJ 3IR6B 3UDLA 4WZMA 4I7FB 4ZHRA 4KE5A 4NCGB 5J1PA 2NZCA 2F8HA 2IRXA 5ETVA 4M3WA 1QUVA 2GNKA 1SC1B 4DR4J 4H8KA 2HQCA 4FYXB 3DMJB 1WACA 1K0TA 4LRDA 4DR2F 1FWPA 4JI4K 2E1YA 3N6LA 3FBCA 5JVHL 1LQ9A 4LFCK 5E3CA 3LWLA 2KHDA 2FVCA 5KFNA 4BR0A 3ZEUA 4DQIA 3MPDA 4PWDA 1QAYA 3AVFA 4KGXB 1HBNB 2Q6CA 3MAHA 4B1ZA 2VQFK 1JNZB 3PW2A 1QE1A 1Y0HA 3GG1A 2LYVA 3CDEA 1TL7B 2A18A 4OLPA 2GWKA 1XC3A 2PFUA 4CEAA 3R7NB 3HXMA 3PYDA 1D8ZA 1R43A 4LF7F 2QXLA 1DURA 4ZPWR 5HMZA 4HI2A 3DXKB 3TA1A 2H1YA 1UMJA 3G8TA 1ZAXA 4NZ0A 3D3CJ 3KHLA 4DV0F 2E5LJ 2IAJA 4KT0C 3E01A 4OKJA 2RB7A 1LOUA 2CNLB 1GTHA 3ZSWA 4WFYA 1JMTA 3W8PA 2UU9F 1S99A 1EX8A 3GFZA 4A46A 2B9YA 4IRKA 2GGPA 1WTBA 4GRSA 4O3PA 4FBUA 4OYMA 4OFZA 5JMVA 1X4CA 3NF7A 1YJRA 4QIVA 1KSPA 4F25A 5KFQA 4QS9A 1UP1A 2HWTA 3PYEA 3IBWA 3I4HX 1RK8A 3P96A 5CHIA 3KLFA 3G6XA 1GLJO 3M8SA 2DNLA 4DV5F 2DGTA 3F9MA 3MECA 4DX6A 2LFVA 3UVJB 4JBCA 2HLUA 4OYWA 1RBRA 3V2UC 3E9PA 4BHQA 3SSQA 3UR0A 2MKHA 3U3GA 1SC6A 2FHMA 3SCLE 3L2VA 5F8GA 1N52B 3FBEA 1X5OA 3N9UC 3PEJA 4ILRA 1VIOA 3QJJA 1NSAA 1SIWB 4LF6J 3TPQA 1YX2A 5F1XA 4RW9A 1U8SA 3HLUA 3POTB 4BRQA 1URRA 3O1BA 2KM8C 1S5JA 2RDJA 4ED3A 5SWMA 3KWIA 3NS5A 2XWXA 3O3HA 4J8FA 4C1NI 3DKDA 4WPAA 2HQDA 3FLCO 1HKCA 3AARA 2QTWA 2JVOA 4B3RJ 4MIAA 2CJYB 1LXJA 4DMNA 4CEZA 3SUQA 3D2FB 1PYOB 5CCMA 2MZ1A 3WIUA 3TR5A 2W41A 3OSPA 2XS7A 1WNSA 3NS6A 1J53A 4V19X 4DPUA 1EO1A 3OYJA 4EHUA 1U25A 5DETA 3RU0A 4KAZA 3DWLA 4HH0A 1VK3A 1A9NB 4FP9A 5M2RA 1A7GE 1UJ5A 3DLBA 4XTTA 3EE8A 2DGWA 1NGGA 1TVRB 3AO4A 4Y65A 3IAYA 4CLZA 4CBWA 3UKUB 2JRSA 1EIYB 4H03B 3BKUA 2X3DA 4KTZA 4LRAA 5AXKA 3DOKB 3W3DA 4IR1A 5DK5A 1HJRA 4JK9A 3OYMA 4WK1A 2HS0A 3ZZYA 4ED0A 2FXUA 1F5BA 3KDOA 2W6LA 2ZM6J 2HWIA 1N5YB 1DT9A 4UZCA 1LWCA 1I94K 4ECXA 2JWKA 3MAAA 4KPYA 1J5EK 1X4EA 4IDKB 3VENA 1N36K 3L2WA 1BQMA 1R8CA 5FIIA 3THXA 4HHJA 3EYZA 2GX8A 4X64F 4CHZA 1WC1A 3CJRA 4JD2A 4PY5A 3IC1A 3U27A 4PR6A 4AQYK 4HUFA 5LSRA 1HW8A 5KFHA 3SEOA 2G2YA 1RHMB 3MMVA 2CH6A 2V68A 1ZBFA 3HD1A 4KHUA 3CCLS 4FVUA 1VQ9N 1RT2B 1VSEA 4M5HA 1IBKK 3GJRB 1C0MA 2RQ4A 4JKBA 3SFGA 1AROP 3KK2B 1CZAN 5U47A 1YUWA 3O9RA 3I0RB 2WVEA 1QM9A 2CG4A 4PG8A 3TR8A 2EKYA 3DRYA 2OHDA 2PMZD 5EU7A 3H8YA 3OTOJ 4P72A 5KFJA 3HULA 3PKYA 1RYSA 1AFIA 2HS4A 4ZN3A 3J80Y 3DN9A 3C0BA 5C25A 4ZK7M 2D3OR 1N5YA 4EBEA 1UAXA 2V8DA 3OR2A 2W2QP 1ASWA 5KFZA 2HRYA 4E8UA 1G1XA 3W5ZA 4WFBQ 2B8QA 2AX0A 1JXVA 1HBMB 4JI8K 4FYDA 4AQYF 2E9RX 2O4GA 3VQSA 2VGNA 1WC3A 3M8WA 4CJUA 5IV3A 4KHPF 4NLPA 5HMWA 4YR3A 1KLNA 1NDLA 4PPZA 5DZ7A 2CQCA 5GAGP 3OUYA 1UFLA 3OXFA 4NE9C 2HKEA 4J7CA 3IGNA 2X3GA 2MPUA 2ZD1A 2BTFA 3RJMB 2JLFA 1B3TA 5H1SV 3MN9A 3W2WA 1UCNA 2W24A 4JI0F 5LMUJ 3KHGA 2HHXA 1Y9OA 2IA0A 2FLPA 2KG1A 5BPNA 4WFAQ 1HNWK 3J8AA 2XY7A 5F0XA 2PMWA 1HPMA 3EICA 5C2GA 1SV5B 2YNGB 4WJBA 4CIOA 2QYGA 3QRPA 2OPRB 2KZMA 4AYBD 3DDNA 1S79A 3FBFA 1XNQK 4USWA 3BBCA 1NKEA 1CC7A 5FROA 1EB0A 2IVFB 5AQZA 4FLXA 4OJ3A 2CQHA 3KHHA 4ELTA 2RS2A 4K41A 1OQ6A 3VTIA 2BW2A 2I7PA 1CJUB 3QNNA 1XMOK 1IKXB 4DPXA 3QO9A 2WBRA 2H54B 2EW9A 3GCXP 2AJFE 1YJ9N 5LSOA 3OR2B 2CAJA 3HP9A 3IG1A 3BPDA 2PDAA 5I9EB 2ZITA 1GMVA 1FK9A 3KLHB 4O0NA 4DPWA 2I2YA 4OYOA 3AFGA 3CW2C 2AYEA 4CLTA 3ISND 2AKWB 1X3NA 3MEDB 1QVFM 2C3YA 3CJKB 1Z6RA 4ISFA 4FLVA 2DITA 4PKDB 2C2MB 3BH7B 3KUEA 4FKXA 1CC8A 4S0MA 4CM2A 1V4TA 1CJTA 3VEOA 2CDQA 4F4KA 3J80U 1U49A 2ZJPQ 2F9WA 3UD4P 4WYLA 3NCQA 4Z0UA 1RHKB 4FJKA 4FYYB 2Z58B 5D0GA 1E4FT 2UXBJ 1IKVA 1EZZB 3HM8A 4F3MA 1IN0A 4DX8H 2N4DA 2K3KA 4RJVA 2NRHA 3ALYA 4OJHA 4JI7J 4XPCA 1TYQB 2ILYA 1KC8O 1KTQA 5KGXA 1VQMN 1S3XA 4TXSA 2GVDA 2LQJA 2N7CA 2YNHB 4GKJJ 4BWMA 1HD0A 3VAFA 4FK0A 5B0EA 4DR6J 2YTCA 4FLUA 2BJ1A 1LEOA 3C15A 4CHYA 1S6QB 3VALA 2YWGA 2C3OA 3QQCD 1VQ7S 2CYYA 1RLCL 3UR3C 1VRQC 3BGRB 4QR2A 3ZXWA 2DY4A 4DPTA 5H9EJ 1RXOB 2QZ8A 3DGPB 1ZBUA 2HQFA 3J7Z5 1BQMB 3LP3A 3V9SA 1VQ9S 1HYZA 3TQ1A 3KLHA 3RB0A 4BRDA 4B1XB 2VU5A 1RDDA 2HFZA 3M9OB 1T3NA 1WOQA 1KCFA 1NNDA 4C23A 2C2RA 3H98A 4A48A 2BH1A 1QZ5A 4E1MA 3CJBA 1NUEA 3H0PA 1NSQA 4NXMK 1I6JA 4DPOA 2Q0UA 5HP1B 1WUAA 2VG5A 2MLZA 1D4XA 2CFXA 2DIUA 4LFAJ 2H48B 2RN2A 4CK1A 3CJ8A 4M5GA 2AP1A 4OX7A 2RE2A 2E5IA 2G4BA 3W65A 4G3IA 4HYKA 2O8FB 1VSMA 2VWBA 4CRJA 5ADZA 4RNNA 5E41A 4UY85 3CPWM 2E8AA 2EFOA 3QLHB 4GV6A 2QN6B 4K5SA 4DR6K 3RR7A 5C12A 1G2EA 3FQLA 8AT1B 1VQPN 2ZUGA 1RAAB 3IAS9 3PW0A 4CHPA 5CCLA 1KP6A 2XI3A 4UZBA 4X4UA 5A0YA 1HPZA 4XIUA 3SAGA 5KOXA 3A2FA 2QTDA 1N34J 1WF0A 4L76A 1U6FA 1YK9A 3Q22A 1CLQA 2YHXA 2G9OA 2MDAA 2P9UA 1N88A 1AYEA 1X9JA 4KREA 2VF3A 3ITHA 1FXDA 5CYJA 1RBVA 2HK3A 2IAJB 1IQZA 5D4PA 1C1CB 1JLBA 2P9EA 3VN5A 4Z4IA 4A5AA 4HDHA 2RSQA 4EFHA 3RR8A 4DQPA 3W66A 1R8BA 3HFVA 3IKMA 2UXDK 2KTQA 4FLYA 4JYAJ 1HBMA 4E7IA 4JK7A 4TKTA 4YOXA 3EE9A 5AQKA 3FR0A 3QFWA 2A1SA 4H4MB 4CHNA 5KQDA 4BY9C 4DR6F 1LWEA 2C2DA 2JDJA 2XI2A 4KO0B 1O0PA 1DARA 3TAQA 1BQNB 1KNZA 4FNHA 3QPIA 4ZVHA 4C0HA 3JQKA 1LAVA 1QLNA 3BDPA 5HBMB 4AHSA 1R6YA 1FD8A 3M1VB 4PL8A 5KT5A 4C8NA 1HWLA 2Q79A 3TTDA 1IKYB 4R5PA 4CZEA 4DV4J 2JWLA 2O8DB 1NXIA 2C2EA 1RI7A 3P6YC 2ZM6F 2ZEJA 1NM1A 1UJ6A 3MMCB 4BREA 2GGPB 2XC9A 5IWAK 3ID8A 3NWGA 4Z37A 2MKKA 3MEKA 4ZLNA 4KIAA 4FZVA 2C2KB 1S12A 3QGIA 2ADBA 1XBWA 3R1LA 4ECTA 2YWEA 4NASA 2JFDA 1K8KB 2GQ2A 3J81U 2VJUA 4RW6B 3EZ5A 5FDLA 2GIRA 3KOAA 1QUPA 5AQPA 1JWWA 4WFNL 4BE2A 1QAJA 2BJ3A 4ZP6A 3IMXA 3AD8C 1IR0A 2QA4G 3AA3A 2ZH5A 3Q8VA 5HVGA 1FRLA 3M8RA 3UKRB 1TKZB 3ID6A 2RU3A 3BF4A 4USIA 3L4BC 4NCGA 4LF5K 4AM7A 4I2QB 1AW0A 2WSFC 2CZ4A 1KVJA 2B4PA 1DHMA 4WU2A 1Y10A 4FF3A 4G1PA 2XCPA 1JLGB 3MK6A 1JXBA 3G6VA 5LMNF 1SQFA 4YB7A 3V1RA 2A0FB 1S9FA 3TOQA 1Z1ZA 1SJ1A 2PO4A 2J9DA 2E1PA 3CIZA 3HMJG 1HQUA 2XNQA 2GBZA 3D68A 2YKNA 4YUDA 3GMGA 4ENOA 1JLAB 3TSUA 1IBMK 3I55S 1BWEA 3FBBA 4KC5A 4GNIA 4QAGA 2OFHX 4X4PA 2CADA 3FUYA 4GV9A 1VQNN 1WF2A 3KMQA 4EZ9A 1C4AA 2QA4S 4KV8B 3ZNJ1 4DSIA 3FFKB 1KOOA 2P9KB 4DV2K 2Y0SD 1BC6A 1RGIA 1FNXH 3VQ9A 1RQ0A 1S1TB 5LJ3Y 2R7WA 5L1LA 1LWFA 2ZH3A 5F8NA 3N4QA 1MWMA 2V9KA 2F40A 4ATNA 3KD1E 3C6AA 5T14A 1IQTA 4RL1A 2NRVA 4DS5A 2QW9A 1SI9A 4FZZA 1WOOA 5CZVA 4DWIA 1LFWA 4N7TA 1SJFA 4N77A 2VG7B 3K9JA 4FJ8A 4NZ6A 2Z1HA 1OS5A 3A5MC 2RQCA 5AQOA 3LA0A 1RDUA 1P1TA 4EI2A 2R8IA 4ILMA 4KHPK 3OBYA 3CMEN 2XGQA 3T9ZA 1QHAA 3CDBA 1S22A 2CQBA 2D0CA 1ZC6A 3WQTA 1KBRA 4DF8A 3TVZA 3BB5A 2F4VK 4ECZA 1XMOF 3DGPA 5AZIA 1OH6A 4QWEA 3EKUA 2BJ7A 5C2FA 2IMWP 5E3AA 4ED4A 3Q8PB 3M32A 4V1Ak 5KAKA 4A8SA 4MO4A 2O67A 3H2VE 1FO1A 1N4LA 4FF1A 1YJWS 1T44A 3C8YA 3OFHA 4U7BA 1PC4A 2A3ZA 4DTUA 2E1MC 1B7YB 3NXZA 3NCRA 1JB0C 4ILLA 1UWAA 1OO0B 5GMKa 1HLWA 5IXUA 3L09A 1RTIA 1D9AA 5IC4B 2BE2A 2WVDA 3POTA 1WI6A 2HVEA 3AT1B 1JJ2R 3IXQA 1FHTA 1WWHA 4FW1A 2JX2A 3JQJA 2D3UA 2MYFA 2DKOB 1FRHA 3QETA 4DDFA 4QJVA 2W25A 2YCHA 4DV1J 3VETA 3I5BA 4AM6A 1YJNS 4LT6A 2V50A 3QLHA 3FVYA 3VEVA 5KFVA 4F4XA 1PILA 1VQKS 2GS8A 1HBOA 4DV3J 2QMUB 1HW9A 5KT2A 4JNEA 4USHA 2MKSA 1FNMA 4HACB 3RBEA 3SZ2A 1RTJA 1SL0A 4LR8A 2DY1A 5HJYA 1HNIB 2GCFA 3C14B 3OFFA 3B6PA 1XC9A 4JAXA 4DR7F 3L3VA 4URGA 5H1SQ 1LKZA 4LF8F 2LA4A 3D6HB 1E3MA 4ILGB 1KQKA 3M6WA 2OSQA 1WBDA 1NOYA 2JGUA 1WEYA 2XLKA 3HL8A 2JL9A 2CKWA 4K2JA 3J81Y 3GQCA 2IVNA 1BCOA 2YH1A 4X64K 4PWDB 2XMUA 3FDSA 4DG1B 4NLUA 1Q8KA 2XHCA 1U04A 2VZ9A 1WC0A 1VC6A 5AXMA 4HT5A 2DGVA 4HTLA 4B3TJ 1P8ZA 4ZA1A 3MMCA 3V4IA 2C3PA 1D09B 3MR7A 4M5KA 3PJXA 3EWGA 4CERA 2DPJA 1RT6A 2XZDB 4DUZK 4HACA 4I1TA 3TSPA 2KYZA 3PO4A 3MFHA 1DFDA 5D4LA 2YX7A 4Y00A 1WOSA 3U3YA 2N3OA 3CJTA 2X74A 4MKYA 3KWGA 3BJYA 1MN7A 2CPJA 3DOMB 1GLFO 3M5RA 3VZHA 2CQGA 2H9ZA 2BUNA 3BYRA 1B9DA 1JCEA 3CJ4A 1WG5A 1X5PA 3VQ7A 1RAOA 4OJGA 5BJRA 4DV7J 1DEJA 1Z2LA 5A76A 4IG3B 1RJJA 2YVSA 3R5AA 4Q45A 4ETZA 3KUHA 2DFFA 5KGWA 2K3IA 2LXIA 2B6AA 3AVAA 5AQGA 1FRIA 1HQUB 1S0OA 4KB7A 3AQOA 3HHDA 4M95A 5JS2A 2QT7A 1HHSA 3K58A 4DR3J 1K6YA 3BR8A 3US5A 3CIPA 4DCOB 4A57A 1TKDA 2BACA 2QX0A 2DB1A 3MDQA 3CD6S 2HQGA 1VR6A 3HX9A 2IIHA 1APSA 3MTJA 4CZHA 1OWXA 5HQLA 3N01A 4ZLJA 4HCBA 3KG0A 1W7AA 4JI3F 3NOCA 4Q0BB 2G0JA 3ZETB 1WSEA 5K9FA 3NY0A 2XY5A 4IFVB 4WFBL 1TKZA 4QIGA 3VQCA 2EKNA 2DD8S 3P5TL 2E9TA 1UFWA 3F44A 3SJJA 4AF1A 1RT5B 2KFYA 5J1NA 4YP3A 3LGHA 2C2NA 4EO8A 4JRQA 4F0KA 2DPIA 2NRZA 2EBGA 1RISA 4P73A 4PABA 5D8HB 4ALZA 3G96A 5EOYA 1CXUA 2GHPA 5HQMA 1HNZJ 1ULRA 1SKWA 1JXEA 3FRZA 3TZXA 1HRHA 1Q7YT 3F56A 2E7XA 4DV5J 1K1QA 2K06A 2V63A 3G8SA 3B54A 4PEOA 1C1CA 1VRUB 2YKPA 3AVBA 3MWBA 4CZCA 2HEKA 2GHWA 4UUXA 1N0UA 3W9HA 3OLBA 2DNOA 2DRDA 1Y11A 4A2AA 1GEHA 1SVDA 4ED8A 4BE1A 4LFBF 2E2OA 4NA1A 1B0PA 4K42A 4HTUA 2GQCA 4DX7A 3MDFA 2CUYA 5M2UA 2IA6A 2HBLA 2KKZA 5FJ4A 1SBRA 1H0HB 5L1KA 1J27A 5IS2A 1RHQB 2XM3A 1BHLA 3MWTA 1PO6A 4L6V3 1NK4A 1FFGB 4I4BA 2QWQA 1NU0A 2NXNA 1FXRA 1VQYA 4NCAA 1IM6A 2P9GA 5CHCB 2ATLA 3D7EO 3RMBA 1VQKN 2HQ3A 2JFKA 5KFRA 5DQIA 2DGSA 3T5HA 3T1HF 3KYLA 4OZNA 3R6LB 4M5DB 2EI5A 3GIKA 1BWFO 1WC4A 2AD9A 2M3DA 2AYBA 1NBEB 4B3TK 4GVEA 2JEJA 1IR2A 4FVMA 4FJGA 2LDYA 3G6YA 4K8ZA 1RTIB 2L41A 4XH5A 5HATA 2AJQA 5FPDA 2ZZNA 5EX3A 2B9EA 3AQPA 3ZX2A 4C3MA 1ZTWA 2PEBA 2FF3B 2J8AA 4NPOA 1OH7A 1JQGA 4FOEA 1FD2A 5C2CA 4OZ0A 2JWNA 2V2KA 1I51B 4EP4A 2QWNA 2HBMA 1UWBB 3MXJA 3VGSA 5HLFB 1VRUA 1YIJS 2OAUA 4M41A 1X4FA 3ZSYA 4Z4FA 4I0WA 4JP8A 2BANA 3RWUA 3M05A 1RBAA 4RU2A 4YR2A 3P39A 3DFEA 2DYAA 3GFHA 2LQ5A 3WXJA 1NJYA 4M42A 1VI7A 3FCWA 3MEGB 1PBAA 1F3FA 4H0OA 1TL5A 2YWFA 3V4IB 4W5RA 3E9LA 1S9EB 2OPRA 1ZYQA 3TJ8A 3QEWA 4HR2A 3O44A 2KB2A 2OPSA 2W4PA 3R5DA 5C24B 2F96A 4CF0A 1PAUB 1UVMA 3TUZC 5HP1A 2ZWHA 2CA9A 1QAIA 4G6VB 4DSKA 1U24A 2GV9A 1KWMA 3UDVA 4ER8A 2N7YA 1U2CA 2R2SA 4WFXA 3VGLA 1N5VA 3LDOA 4P2SA 1YZ7A 2LP4A 2DR9A 1WSFA 2V67A 2JC0A 2Z2ZA 4M1KA 3IBCB 1FTRA 2WUSA 3AVHA 1U0HA 5EN1A 3NCPA 5FD1A 2OPQA 1TKTB 4K8RA 3I9V9 4ZPBA 4O5BA 2B4JA 2B6AB 4WIIA 1QQNA 2HSEB 1RGVA 4BWJA 1REVB 1M5KC 2U2FA 4B9SA 1SKUB 2RUGA 2XO7A 2MY7A 3R97A 3SI8A 1BHNA 4M3YA 3UO0A 2IS3A 2L9NA 1U6BA 5KT7A 1YTYA 4QIWD 5K8OA 4ANCA 5LL6Z 4KSEB 1NG9A 1LWEB 4PHTX 1FNOA 2MZRA 2WW8A 2V5HG 5D3GB 3WX4A 4WQ5C 3BO3A 4B3SF 1GAOA 4DOZA 1OY6A 4CBXA 3LAMA 3AVMA 2VG6B 5AQWA 3WXKA 3M8ZA 2IGIA 2H4WB 3FGUA 4FWRA 4OHWA 9RUBA 2AJ4A 2ZFHA 4CJ3A 3THYA 5K14A 3PZPA 1SJ4P 3TEHB 1RBTA 2GVDB 3CCRS 1WC5A 3SXLA 2OEJA 2DGXA 3MCSA 5DM6Q 4ICLA 3GJQB 3R9LA 2OO4A 4FZXC 2MQQA 3PW7A 1URNA 3NL0A 4L3NA 3WIVA 2HGLA 1K73O 1S77D 4BG8A 3PR4A 2ZGYA 3DLRA 1KR4A 5B0DA 1FRMA 1UETA 2VICA 1NRKA 2XTJP 1VSFA 3M30B 4W92B 2LVWA 1YRTA 1UWBA 2PI5A 3A3NB 4DI6A 4B9QA 5KFGA 1RUSA 5T7BA 3E9OA 4J9LA 3AO1A 3QBCA 2HQIA 3CFPA 1U2VB 3Q2TC 3HSTB 4OI6A 1NZAA 1UEUA 3K5NA 2FZKB 3B8HA 2W8LA 2U1AA 2O8EA 5M1OA 4EIAA 2B51A 2P6SA 2DIVA 1Q1KA 5KFFA 4MKVA 1U09A 3M9NB 3W0LA 3QGGA 3QEIA 3PCOB 2DR5A 1W9HA 1U0SA 5M1NA 4J2AA 3J81O 4M7XA 4E7JA 3G9CA 1MMDA 5CYMA 2H5IB 1IBKJ 4H0TB 4CK2A 4A47A 2WHOA 4CZGA 1HARA 2FBYA 3W62A 3K0JA 2MGZA 3LW5C 1VQ8N 3DRSA 1MSWD 3OL8A 3FSXA 3DRRA 4MKBA 5CD4A 2BM1A 3V4MA 3T7ZA 2E44A 1HLUA 3H2LA 2KJWA 3S3OA 4DCJB 3HHKA 4HVZA 2UXBF 3TAMB 2R42A 4LR7A 3TEGA 1J6ZA 3VQ6A 4BR5A 4B3RF 2UXCK 2KFNA 3C7NA 3K8VA 2DT9A 5BYRA 4JI8J 5EWGA 3JTPA 4ILJA 2BRKA 3AO5A 4EO6A 4NLBA 1ITPA 1A6LA 6FDRA 1N33K 4GVBA 4OPHA 2VIHA 1RYRA 1D0EA 3BBFA 1N54B 3AXMA 4O0JA 4UY8T 2J4RA 4K2XA 2PA8D 1JL2A 4ZVEA 3PW4A 2ZBQA 4KH5A 3K0SA 3C95A 3QMQA 1VAZA 1EQ0A 4DCPB 3SIPB 3VEXA 2FBTA 4IWVA 1Q8IA 3U02A 3HBTA 4C97A 3D9BA 4IFYA 4OPKA 3LZJA 2RHKA 3X3UA 1YQHA 2ZJQQ 3H2UB 1VQ4N 1I94J 3AAQA 2W42A 5IT4A 5CD4H 3C6UB 2PZSA 3VVUA 4P75A 5D15A 4ZPVR 5C24A 4ZPDA 3HI9A 4I67A 4YN3B 1B9FA 4C1NK 1CBKA 1XNQF 4J9OA 3CG7A 3VQTA 4LF4J 1YTAA 3W63A 1VQLS 3ENVA 3B4MA 3LZIA 4CNYA 3QO9B 2R4FA 2AYMA 5AQQA 2OPPA 1XQSC 4DG1A 3IFEA 2D1CA 4P52A 1U1NA 4JRPA 1GXUA 2RRAA 3OTOK 3T6BA 2MY8A 5KG4A 4AE5A 2D74B 2MQNA 1RDWX 1G4CA 4CJLA 1ELOA 1VJWA 1RT4A 1WG4A 3G8QA 4EMDA 1WDDA 3N6MA 3Q7CA 3BPSP 1D5AA 5THWA 5B08A 1X1PA 4O8KA 3RAMA 1SJQA 1IBLJ 1FVQA 4AQYJ 1GX6A 2ABYA 3PHTA 2F4FA 4ZVUB 4LFBJ 4DSJA 4ANEA 2KDOA 4YEAA 2IRYA 4LQ9A 3JS9A 3AJ1A 2H3EB 2F1FA 1UW9A 3FMWA 3TZZA 5BR8J 3CJ5A 2NRRA 2OYQA 2JNJA 1A0OB 4FWMA 4JI2J 2YWHA 1N32F 2M5YA 3MCNA 1CJTB 3OTEA 3BDEA 3OXGA 3S3MA 3Q8SB 3HDSA 3QWUA 5DLFA 3TA2A 4YY3K 1YJNN 2XMJA 1XJWB 2Q3PA 1I3AA 2CPZA 3SUNA 4C3KA 3LAKA 1K8AT 4RWTA 1FFSB 2QWLA 2J0WA 3HSDA 5BN8A 4F26A 5HO4A 3OQ2A 2A10A 4CIFA 3O5TB 2DHHA 1TKXA 3PW5A 4KHSA 1S48A 1H2TZ 1H1VA 4YOYA 3D1OA 1MN9A 1VRTA 4J90A 5L46A 3H20A 3DLHA 1J5EF 2CGJA 4KHQA 1F5CA 4ZTJA 4USKA 1VLYA 1B92A 4CF8A 1FDAA 3H1QA 5D77A 4M5IA 4GVMA 1IV0A 2LDIA 4EYIB 3DYAB 2YKMB 4OKKA 4BVOA 3ZT2A 4DBQA 2BJ8A 4CT8A 1J5OA 4EBCA 4YOUA 4I2PB 4RR5A 4O4GB 2WW4A 3Q83A 1HWUA 2OA8A 3TJ9A 4Q8FA 2MZQA 2CVIA 3EGNA 3AB4B 3M8YA 4LJMA 1T6CA 4KV8A 4Z4GA 4CESA 1X4GA 3L2QA 3TYTA 4QWDA 2GWJA 1NJIO 3HK2A 5JS1A 3MM6B 2BQRA 1HNWF 2VG5B 1EAYC 1D3WA 3D45A 3L8BA 1T9YA 1MLAA 2ZH2A 5IM0A 1S1WB 2M70A 1N34K 1KDNA 2E20A 4QCLA 4O3NA 3CCVS 4GVBB 5GAGU 1EWQA 1YRXA 3UN2A 3CCJS 3W7BA 1GMWD 3MWPA 3I56N 2E66A 4OYPA 2ZKUA 5KFCA 4JV5F 2RKIB 5GIPA 3CJ7A 1ZAWA 2V8PA 3GPAA 2JLGA 5LY3A 3TW0A 1WC6A 1HJOA 4DFKA 3DRRB 2QGFB 1OY9A 2OTJN 1WLJA 3DOMA 4JI2F 3JQMA 1M5PC 5F8MA 2VFTA 4B3SJ 2DH7A 2QLBB 3OLAA 1WNEA 4DR7K 4Y2IA 2JZ5A 4ZVTB 3C15B 3V1QA 3M6UA 4TY8B 4CJ5A 1NPRA 3DMJA 2C2ZB 4MDAA 1Q53A 2HHQA 2HZVA 2GO9A 3VEZA 4QU6A 1T9XA 3MEEA 1G3OA 2J7UA 3PX6A 3Q86A 3MX5A 4PWWA 3Q8RB 5HROB 5C25B 4LVOP 3MMAA 5RUBA 3QNOA 4OKEA 5B0GA 2OPPB 3ZSXA 9ATCB 2FBVA 3M8PA 2Q1LA 4LREA 2BVZA 3KUGA 1SC4B 4LR9A 3MN7A 4O5FA 1DY3A 4GC6A 4JI6J 3AAPA 2Z8QA 4ID8A 3H5XA 2Z2LA 4DR5J 4NYFA 1P1LA 4LBHA 3ZSRA 3U9DA 2IJRA 5JUMA 4QIFA 3D0IE 1HQEA 1KS2A 3UVJA 8ATCB 1N5QA 4JN4A 4NA2A 4BC7A 3BSOA 3T5LA 3L6QA 3BY5A 1ZM4A 2IOCA 2O8CA 3T19A 1XR5A 3LM2A 1XMOJ 4CZMA 3EGVA 4CEEA 4RWXA 4CZKA 2BKNA 2OZSA 4CO4A 3GZ7A 5AQSA 2NLXA 3CC4S 1Y3JA 1YHQS 2UVRA 1NGFA 3V9ZA 3QYYA 1RAIB 2W9BB 3R5CA 5HL7Q 3CCES 4EYHB 3I32A 3M4XA 4R8UA 3IUCA 3ENAA 3VEWA 4IBNA 3MR5A 4ZCKA 2XBPA 3Q8QB 4CJ7A 2VBYA 3FC9A 1E6VA 3F41A 3V5RA 2NRTA 1XR6A 4H5VA 3RG6A 1XR7A 5D0HA 2FYXA 5EX0A 1IJJA 1VBZA 3QGPA 3PO5A 2DHXA 4PG4A 1HNXJ 3JSMA 2YJEA 4KH0B 3IS9A 1FW6A 1JLCA 1RLDA 2LXUA 2K7JA 2MHNA 4DJBA 3G25A 3BO2A 5DZ6A 5AR0A 4OI0A 1S97A 4P2FA 2ZH8A 3BQ1A 4ZN1A 3CMAS 4J5OA 4ZOSA 3CDAA 5JJBA 1RAEB 1NDKA 3SV3A 4CZLA 1QTMA 3ET6A 4JV5J 3UCZP 2YNIA 4GVLA 3B6OA 5AXLA 3JAMY 1PJ5A 2QA4N 3DLGA 2B43A 4JI1K 3FCVA 3IA0A 2F9JA 5CAAA 1BISA 4DHVA 3DAWA 2YQ0A 4FM1A 5KG5A 3HYFA 3NGTA 1IVZA 3MECB 3RB3A 1S1UB 2NZTA 4UOFA 1RCHA 3CQXA 4OV6A 2XGPA 3NVMA 1WKLA 4DMZA 3CCRN 3H3NO 2F3JA 3PRDA 4CJKA 3A5LC 3QBWA 3QIOA 4GKKK 4JKEA 5KFYA 4MMOA 4LD0A 3WNFA 4RBUA 3OYBA 1T9WA 1J5OB 4DV3K 3DLLL 2SXLA 1KAYA 3MCOA 3BV8A 4K43A 2HNYB 4KH6A 2CQ0A 2YQ3A 1MU2B 2V2VA 2HNZA 4I56A 3WXMB 4C2MA 2I38A 2KXNB 1P9QC 1GMWA 4PQUA 2IVMA 2WONB 4RBVA 2ZBCA 4TY9A 1EARA 3UQSA 5C7PA 4RG8A 3VGTA 3GONA 3G6ES 2OFGX 4A59A 3PX4A 2WOMA 1YI2N 4Q0BA 3A8EA 4BQLA 1QAXA 5IT9U 2R8JA 5BRDA 3OYDA 1PAEX 3GSIA 3VHQA 3THXB 3I96A 4F04B 4YB6A 3SBMA 3CFRA 1SJ3P 5AQUA 4UOCA 4M5LA 1E4GT 4QW8A 1S59A 1U6ZA 4X66J 5GAHP 3SQ2A 1HX1A 4LH5A 3D2WA 2BM0A 2V51B 4FLZA 2IBKA 3T1HK 5ETQA 1XNRF 3T5JA 3ISZA 1QY7A 3GYXB 2IVPA 4RNHA 2OTJS 3RBXA 2C28A 1BUXA 4OZ1A 3SMZA 3SQGA 1DBDA 4OO1J 1NLVA 3CJQA 1PSDA 4CGJA 3V6DA 2RAQA 2Z2MA 4DXLA 3C6TA 1C0UB 1I5OB 1QJHA 4ES2A 4DTPA 1IKVB 1RHRB 2XO6A 4QZVB 4H5TA 4EBDA 2Y0BB 4DR1F 1HR0K 1SKSA 4WF9L 2JSXA 4NI2B 3G10A 1RTZA 2HS3A 2PC6A 1T02A 1SH3A 5JVGL 3F73A 1NNEA 1W97L 4BACA 1S76D 1HFEL 3LGNA 3SCKE 4RO0A 2KI2A 3ZC4A 3NAHA 3NGZA 1IJEB 4PXBA 2AZ3A 5KFLA 2OMLA 2V4JB 4JV1A 1NMNA 1T0TV 2VGMA 2L48A 3UDCA 2UYTA 1IXKA 2FLNA 3VQAA 4KYZA 2HFOA 4TY8A 2ROPA 2UUCJ 3Q0AA 3AA4A 4L3KA 4DR7J 1KXPA 2ZQBA 3EY1A 2ZE2B 4WCEQ 2N4CA 2V6AA 4LF2A 4BRPA 2YHWA 1G6BA 1NSKL 1SJRA 2GHVC 3AA2A 4IKAA 5HLFA 4IR9A 1LNQA 4AL6A 4E0DA 5KG3A 5DGAA 3CM5A 4HHUA 4DB3A 1R27B 3OJSA 4FW2A 2PA3A 1S0VA 1FXLA 1S1TA 3CB4A 4CFBA 3FZBA 3OS1A 2N3LA 1R0AB 4DU7A 4H4MA 4IOCQ 1NPKA 2ROGA 2EFPA 4ZVFA 4Q2MA 1YI2S 1R3NA 3LANA 1GXTA 4KQZA 3BR9A 4QW9A 1BDGA 5F0WA 1BA0A 2YXLA 2QL7B 4UTGA 2BEFA 3D6FB 4IOXA 1Q9YA 4Q43A 1HWJA 2Q66A 5AQNA 1EJ7L 3TNVA 2J9EA 4RX6A 4MT1A 3NNAA 3G86A 3VR1A 3FK4A 4ID5B 1WAFA 4NRTA 1WUUA 2UUTA 1IBMF 3CMAN 4AHUA 2QL5B 1HBNA 1BMQB 4R0EA 4BRIA 3A13A 2KVIA 1PIEA 1LFPA 3CDUA 1GX5A 4OLAA 5LMUK 5DQGA 1N5TA 4YHHJ 1QQOA 1S1VB 2DR6A 2B9WA 2GJ2A 1BY9A 3D0PA 1IBCB 2ZBIA 4WKRA 3PJ9A 2RIJA 2UV8G 5KFSA 3VQ5A 3TA0A 4RCHA 1VQ6S 4X2BA 1TELA 3VA0A 4BC5A 3DOLB 1JCGA 4KBOA 2G1DA 1N6QA 3LP1A 1TFYA 5DRKA 1OH8A 3ULEA 3RAXA 3JAMO 1TTHB 3ZZUA 2CJAA 3LQVA 1R0AA 4ID5A 3NG8A 4MK9A 3NVKA 4DV2J 4FZYA 2GV1A 1BI4A 4LY7A 1TV6B 1FKOA 2FF6A 1FRXA 4BGBA 2GJFA 1S1XA 1VQLN 4QOZB 4JD2B 1LOTB 1XWLA 3GR1A 3SUOA 4PXCA 1RKIA 4FJMA 1ROFA 4L75A 4LSNB 2WOMB 3RRKA 2H3GX 2YNIB 3DI6B 4CEDA 3FJ2A 5F8IA 3VAMA 1V9OA 5D0RA 3BQ2A 3M2VA 1RTDB 2W2MP 1VFJA 1Q78A 1VSJA 1ZM9A 4N8OA 3R3TA 5FRNA 4H0XB 4ECVA 3FZKA 1VK8A 2XWYA 2MKIA 3ZZ0A 3BKFA 5ETRA 2V0NA 4PG5A 4O55A 3EJMA 3H90A 4KJIA 3V6DB 1Q82O 2VQEJ 1KVAA 5B0CA 4LFCJ 2J7WA 4MDBA 2QM1A 1ZA2B 3SQGB 4CBUA 4MO5A 1PGZA 3CO0P 4DS4A 1R6VA 4B9TA 5AJ3K 3THVA 2MSTA 1UZHA 4KTQA 3UWTA 5J2PA 3FZFA 2J8SA 4KRWA 4CJ4A 4LF5J 3KHYA 3LPEA 3QERA 3GV5B 2H5JB 4DTNA 5ADXA 1VCTA 2UUAK 2RE1A 5HRSA 3EE3A 4MK8A 3AD7C 2UXDF 2X1FA 3H4DA 5HANA 2E7WA 2WRMA 2UUBJ 3MURP 3W3SA 2G13A 3SBTA 4DSLA 5FLXU 4KRFA 2F4VF 3JTNA 4JI3J 1SUQB 1IBMJ 3RSEB 3BSNA 3IR5B 3WNEA 4TLRA 5CH7B 4C98A 2FD2A 1KLMB 5AQMA 1ZOTA 2CQ4A 4OZJA 1UEVA 2WTFA 3DRSB 1OPZA 3GYNA 1TAQA 2Y8YA 4K59A 1RWUA 4CWBA 2YQ1A 5KFMA 4EWTA 1EX4A 4O4GA 3CHWA 1TL3B 1HNZF 2RQKA 1X4BA 1GFWB 3QICA 3MEDA 4FM0A 5DM7Q 1LV5A 4CJPA 3BGFA 4X4QA 2CQ2A 3GDQA 3D1QA 2P9NB 4DZDA 8RUCA 2HMIA 3SDEA 4DTRA 3CJ9A 2D5RA 1FVSA 3D6RA 3J80O 1VBYA 3OTBA 4ZMMA 3L2RA 1O13A 5CYQA 3ZTRA 4JKHA 2MKCA 4CI0B 4JLHA 4MKAA 3BYPA 3F2KA 1QD1A 1MWKA 2O8DA 1GLLO 2BKOA 4KGZB 4JKGB 3U4LA 3VVTA 2PSZA 3GU0A 1QQMA 3O3GA 1LK7A 2CWKA 5AQLA 3PIOL 4NA3A 5E2QA 3MUTP 2VL1A 5DMRA 5ETOA 1A5VA 4DR4K 3AVLA 1HYVA 4PXDA 3CCLN 4FNIA 4BE0A 2ZJRL 2KH9A 2R9LA 4M3XA 1JJ2M 1F9FA 2XRIA 3GSDA 4RKUC 3OV7A 1RT5A 1FJGK 4BDZA 3OUYB 3ETOA 5LMNK 3GIMA 1RAJA 3C6UA 2QLWA 3CTRA 2VA3A 3THYB 3F9KA 2UU9K 1J9AA 1IKWA 4C8ZA 4J2DA 1S1WA 1X9SA 1MNEA 5H9FK 4BRCA 4K50A 1VSKA 4OHVA 4MH8A 1W0HA 3DM2A 3CC7N 1XHXA 4NLTA 2P5OA 2B9XA 4CEFA 4FVCA 1G99A 4GY2B 4NLGA 4A8OA 2I0XA 3C16A 2VJVA 2Z2YB 4HH1A 4G1QB 1NGEA 2RD5C 3CJ0A 1UPPA 4L74A 4LRCA 5KFXA 1K0VA 1O6XA 4NX9A 1GNKA 2GQQA 3GBTA 7AT1B 3AY0A 2OP5A 4AH9A 1CZ9A 1I94F 3HJFA 2VASA 4MLHA 4J9KA 4J9VA 4EHTA 1XTZA 4CF1A 1FJGF 2ZBRA 2E4LA 4YOTA 4U9RA 4A8KA 4RUHA 4ES1A 4IH7A 3HPGA 4RW7B 4OJRA 4DEZA 4FJHA 1NAQA 1B0TA 4B8CA 3TAPA 1NH7A 3I4PA 3TUIC 3FFIB 2ZDPA 1PYSB 4KHMA 3Q8UA 1YJVA 4WU3A 1GLAG 4K7QA 4CDIA 2DR7A 2NXJA 1VDHA 2OD4A 1SL2A 2DGQA 3S7RA 3WNGA 2YKNB 1WSHA 2FVRA 1SB6A 3KKSA 4WKYA 2ASYA 3N4PA 4ILHA 4FJXA 1Q86O 4LMZA 2KLAA 2KRBA 4CO5A 3CULA 4JEPA 2UUCF 5KT6A 1RA6A 3J7YP 1C2PA 3FEYB 3R6MA 3RTVA 5AQHA 4QPTA 2K1RB 2PYLA 2GAGC 2MTLA 3HSGA 3MX2A 5JLFA 2J5AA 3ULEB 4B9LA 3N6NA 1J2VA 1B99A 1N33F 5HMYA 1HBUA 1U1LA 3CCQN 1UL3A 1RZMA 3AB2B 1IBLF 2I1RA 4MIWA 4FCYA 5E84A 4CLWA 2AEJA 4NOHA 4CJRA 4NCBA 4QYZJ 4AXIA 4ELUA 4B3RK 3SFUA 2V8HA 2CVEA 2CDRB 5GAHU 2DFHA 2FY8A 2ZJQL 4A61A 5BPLA 4WTYA 4BLGA 2IHR1 2KM8B 5C5JA 3MEGA 3BZKA 5BPMA 1FKAF 5B09A 1XQIA 5C2DA 1OY8A 1CPZA 1ZBTA 4ISGA 4KHWA 5E7OB 2RDDA 4DU8A 3U8XA 1NK9A 5B8HA 2R7QA 2HOEA 4ZCMA 2V4QA 3DXKA 4L72B 2DHGA 4J9SA 5L1JA 2BQ3A 1JLBB 4ZVRB 3I8BA 2UUAF 4GV3A 2P9IB 1JJ4A 1U02A 1HHTP 2FDNA 1T05B 4URSA 3N4WA 4CLFA 1V4SA 2D1KA 1FESA 4IOCL 3M32B 2QLXA 2KFZA 4UT4A 3BSCA 2HRUA 5J2PB 1MMNA 1T03B 4FLWA 3TTFA 5AJ3F 1K8AO 3QINA