1LW2A

Crystal structure of t215y mutant hiv-1 reverse transcriptase in complex with 1051u91
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
539
structure length
518
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFARKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLYTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
publication title Crystal structures of Zidovudine- or Lamivudine-resistant human immunodeficiency virus type 1 reverse transcriptases containing mutations at codons 41, 184, and 215.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 141
structure length 518
sequence length 539
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2002-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1lw2A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lw2A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lw2A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lw2A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1lw2A05
3GV5B 1HARA 4FJIA 3EY1A 2D0CA 5DG7A 1NNDA 3ZT2A 2UVRA 2OZMA 4KPYA 1GX5A 4G1QA 1Y97A 3Q8PB 3DI6B 1UWBA 3KK2B 2P5GA 4FJHA 3Q8QB 5HRRA 4XIUA 1TKTA 3V9WA 2Z1JA 1BCOA 4M3TA 1RAJA 4RNNA 2UVWA 1RDAA 3PO5A 4ID5A 1WSEA 1X9MA 3NFAA 2ZD1B 3PO4A 2DFHA 3LP1B 4O5BA 4K4UA 3L2UA 3SFUA 4FZYA 1C0UA 4WFYA 3AA2A 4R5PB 3CFPA 5KG1A 5DK5A 1TQLA 2GUIA 4BDZA 4M3YA 2WB4A 1VSJA 4FJ7A 1U49A 2Q3SA 1IKYB 4W5QA 4EP5A 4E7LA 4KB0A 3H40A 4NLYA 3VQ7A 2F8EX 3H4BA 3NMAA 1TKZA 3KNAA 3SYZA 5FDLA 2A1SA 4RW9A 4DQQA 2RF2A 4IH6A 4TN2A 1BL3A 3CJ3A 3P5JA 5T14A 1CZBA 3HYFA 3T5JA 5DG8A 1TVRB 4UQGA 3S9HA 3K2PA 3H2LA 3TARA 3V1OA 2R2RA 2VWKA 2BANA 1NK9A 3TR8A 3KTQA 4KHQA 3LALA 4AHRA 4TY9A 3ITHA 4BWJA 4M3UA 4FJMA 3K5LA 4Q0BA 5DQHA 3L2RA 4Y1CA 3HO1A 3PX4A 1N6QB 3KLIB 1JLFA 1LWEB 2B43A 4F2SA 4BDPA 3OLAA 3I5BA 1GOBA 5FRMA 1KVCA 2ETJA 1RTHB 3HPOA 3TAGA 3VQAA 3HVTA 4KAZA 1RT3A 2IAJB 4I7FB 3OJUA 4XO0A 4ECTA 4CGGA 4ZHRB 3DYAA 3EZUA 1T94A 2W8KA 3UPFA 2GC8A 4AH9A 2OPQA 1WN7A 3SQ4A 3CJ0A 4E7IA 1NK0A 3QZ7A 4TXSA 5KG4A 4MFBB 3P83D 2FJVA 4FJKA 2C28A 3C6UB 4WFXA 2ATQA 1D9FA 5CYMA 4NRUA 3OYKA 4E1NA 2HB5A 5KFNA 3O4NA 4J9RA 5J2QB 4FLTA 1EP4A 2Z1HA 1I39A 3ALYA 4KBIA 2IM1A 3K59A 3KIOA 3MXMA 4JV0A 5KFLA 1ZETA 3QIOA 4DF4A 1HYZA 1XC9A 3BGRA 5KFZA 3MTKA 3M8QA 3NAEA 3B6PA 3KK3B 4R0EA 2KTQA 2HNYA 4B9MA 3UIQA 4ECUA 1RT4A 4ZPAA 5D3GB 4MKAA 4NLSA 3CJ4A 4EYHB 1QTMA 3HT3A 2YNGA 5F9LA 2FBTA 5EWFA 4AILC 4DTPA 2YNFB 1LWFB 3PW0A 2OYQA 1T03A 1HYSB 3DRPA 4ECSA 3BQ1A 1JLQA 3I0RA 3DMJA 4KHMA 1T7PA 5KFCA 4O0IA 2B5JA 1NHVA 3KLFA 1S1VA 4FW2A 4IFVB 4C8KA 4WYWA 1IH7A 1LW2B 4CGDA 4KKOA 4JLHA 3I8DA 3QNOA 1EETA 4ELTA 1JLEA 3ISNC 1MU2B 3EPGA 4RW7A 5KFBA 1JXBA 5K14B 4LSNB 3HK2A 2D3UA 1VK0A 1S1WB 3BSOA 4CIGA 5DGAA 2OPSB 3CVKA 3SUNA 1RILA 3AVHA 4DFJA 2ALZA 3DLKB 5KFPA 1FXXA 4CE9A 4LSLA 3AA4A 3SCXA 3MFHA 4KI4A 2KZZA 4IG3B 4Z4FA 2PZSA 3MAQA 3N6LA 1RT1B 3DOKA 3V6DA 1L5UA 2AGQA 4NLGA 4K50A 2AJQA 3DLEA 5KFFA 5HRNA 4WE1A 4J9SA 5CYQA 2X6SA 5J1EA 5KT6A 5KFDA 2WCXA 5F8LA 4U7CA 3S3MA 4B9VA 4ELUA 4KHUA 4IH5A 2WOMB 5JS2A 1N48A 3UQSA 3V4IA 1HMVA 1YVUA 1REVA 1DLOA 3KLVA 4FLZA 3LZIA 2XWYA 3TAMB 4K4SA 4KHRA 4I9QA 2R8HA 2QKBA 1I3AA 1QSLA 3LWLA 3FFIB 4TSXA 1NOYA 4CIFA 3OL6A 1TAUA 1JLCA 3LP0B 2AX1A 2ILZA 1J53A 2W9AA 1C1AA 1QQCA 4E1MA 5T7BA 3OYLA 3RBDA 4DSIA 4FLWA 1IKXB 3RWUA 3OVNA 3JSMB 3V81B 4IG0B 2HHUA 3RMCA 4NRTA 3IG1A 1FK9B 3C6TA 2DPIA 4ECYA 1S1UA 3CFRA 3OS0A 4F4KA 4F4XA 2WONA 3QO9A 2O5DA 3DM2B 3RB4A 1N5YB 4IFYB 4IRDA 3LP2A 1CLQA 3MECA 3NBPA 5L1IA 4B3OA 4JUZA 2RPIA 3RMBA 3VA3A 3TAFA 4K8XA 1L3TA 2E9ZA 4MIBA 3RB6A 3I5AA 4TY8A 4GVMA 3VQQA 1UOCA 1SV5A 1TL1A 1S6PA 1HQUA 4CFAA 1S4FA 4O4RA 5C42B 3QIDA 1ZBIA 4RNOA 2XY5A 4DTRA 3KLHA 4W5NA 3BSAA 2VG5A 4DSJA 2R2UA 3NKYA 2E6LA 4RW4B 4NLTA 1VSIA 3OYBA 2W9BA 3D45A 1TV6B 1ZBUA 4KTZA 2AU0A 4FZXC 2D41A 3T1AA 2AGOA 2F96A 3SI6A 4OKKA 4YFUA 4ZVGA 3OSPA 2BR0A 3TAQA 3ZSOA 4B9SA 2YHBA 3QLHA 2AQ4A 3OYIA 4DL2A 3H5UA 3KMQA 3DLHA 3CDEA 4DU4A 1QAJA 1S0MA 1SKRA 2G8KA 3MFIA 4NCAA 4OLAA 4KV8A 1RTIB 1WSGA 3QEIA 1RTJB 2V0NA 1RTDB 4CECA 3I0SB 5J2NB 4DL5A 4CF9A 2GBZA 4HCCA 2ASJA 4OPJA 3NH2A 4Z4IA 4JRPA 2V4QA 3IGVA 3CFOA 1KCFA 4TLRA 3HP9A 3OS2A 3GIKA 2IOCA 4QWBA 1LWCA 3AO5A 4IKFA 2CJQA 3VA0A 2JGUA 5HROA 4CEDA 1NK7A 1NJZA 4DF8A 3U6FA 2G8VA 2QV6A 4KTQA 3V6KA 2WHOA 5EUHA 4DQRA 5C24A 3AA5X 3QINA 1VRUB 1KVBA 3WNFA 5EDWA 2B4JA 2B6AB 3PZPA 4KAIA 3PW4A 4MKBA 4RUAA 1JLGA 3GV8B 1S9GB 4RZRA 5F8JA 2IDOA 3SUOA 3OYHA 2R8KA 3MEGA 4KHSA 2IC3B 2W9CA 4DG1A 1VSFA 3MR5A 1BI4A 1B9FA 2YNHA 3AVIA 1SL1A 1DTQB 2IBKA 1JLAA 1C1BB 3N6MA 5DQIA 1TK5A 4TYAA 5KFHA 2QK9A 3PHEA 4HUFA 1K6YA 4DFKA 2E9RX 3PUFA 3D5MA 3QIPB 3K57A 1C1CB 4KFBA 4NYZA 4E89A 3FSIA 3AVAA 5KT7A 2R8JA 2ZE2B 1J9AA 3RRHA 4NCGB 5I42A 2YV0X 1VRTB 3IN5A 1XHXA 5C5JA 3HPGA 3PR4A 3L2WA 4J9MA 2FLPA 1ITGA 4DS4A 4ICLB 4DTMA 4F8RA 3ZSVA 1KSPA 4DQPA 5KFQA 2YNIB 1BIZA 5FRNA 2HNDB 1Z4UA 2BE2B 2OZSA 5KFSA 4DL4A 1FKOB 3DI6A 1DTTB 2HWIA 5E41A 1TGOA 1VSEA 3TABA 3KK2A 3CJ5A 2YHAA 4J2BA 4WFZA 4IDKB 4ED2A 1CSJA 1S48A 3QEWA 3JYTB 1KLNA 3LP1A 2ZQBA 5EU7A 1UA0A 4OKEA 4R5PA 1GOAA 4URGA 3ZSRA 4CGJA 4PWDB 2XGPA 2R2SA 4BACA 3L8BA 1U04A 3DLGB 3DRSB 4IQXA 1IKYA 1RT2B 3OYDA 1QSYA 2FVPA 3H08A 4X2BA 3N6NA 2Z1GA 3QEVA 1T8EA 3SZ2A 3OYFA 2XCPA 4E7KA 4CEAA 4Q43A 2VG6B 1TVRA 3VQ6A 5KG7A 2IMWP 3M9MB 1S97A 3ASMA 2V4RA 5CZ2A 4FK4A 4B8AB 5HP1B 3ZSYA 1WSFA 2IS3A 1R0AB 3VQ8A 4R8UA 1D1UA 3EZ5A 2RDIA 1W25A 1N6QA 5KI6A 1BQNB 3KLIA 1J5OB 4YR0A 1G15A 4ZVHA 4WXOA 2D0AA 2R2TA 3S3NA 4H4OB 1Z26A 4FJ5A 4KI6A 4DLGA 5L1JA 1RBSA 2I5JB 4G1QB 1RTHA 3BR9A 3KMSA 2JEFA 4BE2A 3CQ8A 3ZT3A 5KFVA 4LQ3A 1RBUA 1XR5A 5KFAA 4DU3A 4I7FA 5DMRA 4B9TA 2RKIA 3LAKA 3NGDA 4ZHRA 4M42A 1CXQA 3PW2A 2WK4A 5F8IA 2FJWA 1ZYQA 4ECWA 3VQSA 4WXWA 3L2QA 4YQWA 5F8MA 3G6VA 4EO6A 3CM5A 2AGPA 1SL0A 4Z4CA 3V9UA 4W5OA 4O3QA 1SUQA 3HKWA 4EEYA 5J2QA 2R7YA 1RDRA 1RBTA 3AO4A 4ZP6A 4Y2AA 3MEEB 4DTSA 3QEXA 3G86A 3I5CA 4FLXA 3NHGA 3RMDA 3DLBA 4CEQA 1ASVA 1J54A 5KGWA 4N5SA 4DFMA 4DL6A 2C2EA 4ZTJA 3KK3A 3T5HA 4FVMA 3GQCA 1RDDA 3PW5A 3V1QA 4CERA 5D3GA 3QETA 4NLQA 3KD1E 1JKHB 3NAIA 3T5KA 3AO1A 1BCMA 4CJPA 3ISND 3LAMA 2YNFA 1LWFA 5KT3A 4O3SA 1TKXB 1HYSA 1HYVA 3L3VA 4BWMA 4K4YA 1RT3B 3BSCA 2G8IA 3GIJA 4CJ4A 4IFVA 4J9QA 4K4ZA 1LW2A 4JRQA 4CJEA 3HM9A 4KHNA 3DYAB 2O4GA 3LPUA 2FVQA 1MU2A 3V6JA 4QCLA 2Y1JA 1B92A 5K14A 4LSNA 3MEDB 4E3SA 1S1WA 2UUWA 3SQ1A 2OPSA 5EWEA 1UA1A 1A5XA 3GIIA 4EZ6A 3VQCA 3DLKA 4CGIA 4K4WA 3F9KA 4CHYA 3SJJA 1I6JA 1KVAA 2XO7A 4CK1A 2D7SA 5F9NA 4IG3A 3SQ0A 4LH5A 5KFWA 2HNZB 1N4LA 1RT1A 3LWMA 2ILYA 4Z4HA 3BREA 1ASUA 3WNHA 4IR1A 4J9OA 4O4GB 3O3GA 3KK1B 1ZBLA 4MK7A 4BE1A 4EZ9A 4DS5A 1KRPA 4CJUA 3UDLA 4DFPA 3G6XA 3L2VA 2BQUA 4G3IA 2LSNA 4DTOA 4O3OA 1RDBA 4ECQA 4K4XA 2WOMA 1S6QB 4I2QA 3IGNA 4ZVEA 1HRHA 4PUOA 1IKWB 3ULDA 3NCIA 3TAMA 4N47A 4NLXA 4WYLA 4ZPCA 3RMAA 4CF2A 3M8RA 4ZMMA 1BISA 3RR8A 3LP0A 3HP6A 1HQEA 1Z25A 3MXJA 1T3NA 4IBNA 1K1SA 4QWAA 4E0DA 3WNEA 1RBRA 5KTQA 1IKXA 5KFOA 5KFEA 3JSMA 3HSTB 4MK9A 3I0RB 4IG0A 3DDKA 2PY5A 1S1VB 3F73A 1U09A 3AA3A 1FK9A 2HHXA 1S9EA 1RNHA 5KFGA 1O1WA 3DM2A 2AWZA 3AVBA 4RW7B 2YKMB 2X6NA 4IFYA 3BQ2A 4DL7A 3NF9A 4OL8A 3AVMA 5KG6A 1LW0A 1JXEA 1LAWA 1VSKA 3H59A 2XY8A 4HUEA 4Q44A 3MR6A 1T05A 4PQUB 2E9TA 3QGIA 3ZSXA 1HNIB 4WZQA 2EX3A 4CEOA 5C42A 4DTJA 2GV9A 3OHAA 5J2MB 2JEJA 2VA2A 2ATLA 2DTUA 4EBDA 2HMIB 1D8YA 3LZJA 4LD0A 1GOCA 4RW4A 4B08A 2O4IA 1KLMB 3ZT1A 1TV6A 4ED1A 3OYGA 4WZMA 2UVVA 1VSLA 3SPYA 2FLNA 2Z1IA 4FM2A 3O4QA 4NYFA 3M9NB 1REVB 4DSLA 3ZCMA 4FYDA 4KHYA 1YVFA 3Q8RB 4ZTFA 4FJGA 3H5XA 4ED0A 2G8WA 3DLRA 1D5AA 4RUCA 4QW8A 3V9ZA 5SWMA 4QWCA 4Z0UA 3NGZA 4OGCA 3DOLB 1RT6A 4QW9A 3LANA 4Z4GA 2FBYA 2P1JA 3OSNA 2JEGA 1QHTA 5HBMB 3I0SA 3AVLA 4F4WA 3NE6A 1ZTWA 1QE1B 4F50A 4QPXA 1D9DA 3OJSA 1ZBHA 3NGYA 4CHPA 3M8SA 5KT2A 4F3OA 2HHVA 1VSDA 3NBPB 1SH2A 2G8UA 2BRKA 3C94A 3IRXB 3V9SA 4BE0A 2XC9A 1F21A 4QOZB 5DQGA 2HWHA 2HAIA 3NF6A 5SZTA 3VQPA 3IS9B 5J2PB 4B8CA 4RW8B 2FJXA 4NLPA 3M8PB 1VRUA 3TI0A 1JL2A 4EO8A 3PY8A 2B6AA 4M95A 4FS2A 4CFBA 2FVSA 3LDSA 2BGGA 4O3RA 1Q8IA 5F8HA 1S9GA 3AO3A 4EBEA 4CK3A 1FKPB 1S1XB 1RYSA 2IC3A 3SUPA 5KG2A 3T5LA 2OPPB 1TP7A 4CK2A 1RCHA 3HVWA 1BQMB 4CJVA 2IGIA 5F8NA 4FLVA 4RNMA 2D3ZA 1DTQA 1EXQA 5HRPA 2WRMA 4NCBA 4KB1A 5KFIA 3E01A 4XPCA 5JUMA 4LY7A 2D5RA 4Y3CA 3VQDA 3AVKA 1S1TB 4CJKA 1IG9A 4F3TA 2DY4A 3VQ4A 4DU1A 4J9KA 4FXDA 1JLBB 2FBXA 2P5OA 3QIPA 4E19A 3HXMA 2R8GA 1C1CA 5KG3A 4CJ5A 4I2PB 1JL1A 3ZSQA 2ASLA 1RT5B 2RN2A 4KSEB 1IM4A 3GIMA 3OL7A 1VRTA 4DEZA 4FJ9A 1HNVB 3RAQA 4ICLA 3OYCA 1IKVB 4HYKA 4Y1DA 2YNIA 1IO2A 3CM6A 2OA8A 2BE2A 1RYRA 5HROB 2QKKA 4MK8A 3DRRB 3QGGA 1FKOA 1DTTA 4CEFA 2QXFA 4ZP7A 4U6PA 2DFFA 5C25A 4DWIA 4GW6A 4B9UA 5CZ1A 3HVRA 4Z4EA 3WNGA 1L3SA 4IDKA 1RT7B 4KTWA 4H4MB 4CJTA 3HJFA 3JYTA 4EYIB 4MQ3A 4CHOA 3AVFA 3SUQA 1NK5A 1C0TB 4GMJB 4KE5A 4KO0B 4TQSA 1SKSA 2W7PA 3OYEA 3GYNA 3DLGA 3DRSA 4O55A 4NLVA 4HTUA 1SH3A 4H8KA 2X74A 2ASDA 1NK4A 3RAXA 4DLEA 3ZT4A 4CJLA 1NKCA 3RTVA 5L9XA 3HL8A 2C2RA 3KLEB 2VG6A 3NF7A 2ZD1A 4DTNA 4RW6B 1TL3B 4O44B 3GV7B 2BDPA 4DL3A 3T19A 4ECXA 3KHGA 3MR2A 3LP3A 4RG8A 5HRSA 2J6TA 4OPKA 4IH7A 2J6SA 3BSNA 2HHTA 2YKNB 2PYJA 1R0AA 4CHZA 1SH0A 3ZT0A 4CFDA 4M94A 1BQNA 1J5OA 4OGEA 3OYAA 3M9OB 4H4OA 1C6VA 4K4VA 5CY4A 4J2AA 2VG7B 5KFYA 2OPRB 2I5JA 3QERA 1JIHA 4M3ZA 4OVLA 4Q45A 4ZP8A 3KLGB 1RBVA 5HLFB 3AVCA 4J9NA 2G8FA 1L3VA 2D0BA 3KJVB 1YTUA 2W7OA 1HPZB 2DPJA 4HHTA 5I3UB 5KG0A 4CESA 4CCHA 1VSMA 3G0ZA 4DSFA 1LWEA 4PY5A 4DTXA 3K5MA 3SPZA 3V9XA 3T3FA 3B6OA 1A5VA 2PYLA 5L1KA 2UUTA 4FK2A 4FLYA 1RA6A 1UWBB 3SFGA 1N56A 3KHLA 4KHWA 2IAJA 5KFMA 3QZ8A 2C2DA 1TKTB 4JS4A 3MEEA 3PV8A 3VQEA 4ID5B 4DQIA 4J9LA 4IR9A 1YTAA 4URQU 2JC0A 3VQ9A 1LAVA 4N41A 1C0UB 4N76A 4MFBA 4DMNA 3C6UA 1WNEA 3QNNA 1NJXA 5JS1A 3AVNA 3CJ2A 1W0HA 4R8UB 2KW4A 3CWJA 4JS5A 3EYZA 1JKHA 3P1GA 2KFZA 3CDUA 3SQ2A 1TKZB 5FDLB 4RW9B 2RF2B 2ITGA 1NOZA 4FK0A 1QS4A 4ECVA 1TKXA 1Q9XA 1SKWA 1TK0A 3K5NA 3KKSA 3PW7A 2BANB 1QSSA 4RU9A 4Y34A 4AHVA 3QGHA 3OHBA 3BDPA 2RKIB 3G10A 3ITHB 4KREA 2JC1A 1C0MA 4AHSA 1U45A 3VQBA 3O3FA 4Q0BB 5DLFA 3TANA 4URSA 3SNNA 4KB7A 4RNFA 2P51A 1HJRA 3MEDA 3FDSA 1JLFB 3G6YA 2FVCA 1EKEA 3HPHA 1UAXA 2X78A 2OH2A 2HW3A 3UR0A 3S3OA 3TVKA 3HVAA 4DQSA 4GC6A 3QEPA 1A5WA 2ZKUA 1S0OA 1C2PA 1SUQB 2I1RA 3OLBA 1KFDA 3HVTB 2HNZA 5DG9A 3CIZA 4ED8A 1CZ9A 4YP3A 4CHQA 3TQ1A 1XHZA 1NJYA 2DFEA 3CDWA 3RR7A 4O4GA 3KK1A 4L8RB 2OPQB 2CKWA 3OL9A 3PX6A 3H4DA 2IM0A 1S6QA 2QE5A 1K1QA 1TAQA 3BJYA 1OS5A 3QESA 4J2EA 3OYMA 5CYMB 1QUVA 1RA7A 5DGBA 1IKWA 2BQRA 3V1RA 2J6UA 4K8ZA 1NK6A 4Y2CA 1EP4B 1EX4A 2C22A 3NH0A 4ECRA 4CJRA 4M3WA 3PR5B 3OYJA 5KRSA 4C8NA 2FBVA 2XRIA 4AHUA 3BGRB 2XGQA 2HVHA 3M8QB 4FJLA 1BGXT 1JX4A 4FJJA 2HNYB 4BDYA 1RT4B 3KOAA 3QYYA 2YKMA 4NLRA 3GILA 3O3HA 1Q9YA 3IAYA 4ED7A 1XWLA 3FFIA 1KFSA 2GIQA 2YNGB 3H5YA 4M3XA 4J9PA 1MMLA 2IM2A 4YR3A 4CJ3A 5KGXA 1GX6A 2W42A 3CO9A 2EC0A 5FROA 1T03B 4YNQA 4CF0A 4YR2A 1ZTTA 3DRPB 3V81A 4PQUA 1JLQB 3DMJB 3A2FA 3H5SA 3KHRA 1HNIA 2B5JB 2UVUA 4NZ0A 2HHSA 3RRGA 3H98A 3KLFB 4C8OA 3NAHA 1NK8A 2AX0A 3FRZA 1U48A 4KKOB 1WSJA 2FC0A 3V6HA 2GIRA 5J2MA 3RB0A 1EETB 1JLEB 4CFCA 1N5YA 3L3UA 4HVJA 3OYNA 2HMIA 5L1LA 1X1PA 5KT4A 1KLMA 3MF5A 4CJSA 1TK8A 2VA3A 4CEBA 4B9NA 1L3UA 4MIAA 4I2QB 4NLUA 4IOBA 4LSLB 4PUOB 5KRTA 4HKQA 4NYNA 1WAFA 3DOKB 3V6DB 2FVRA 2E6MA 4FLUA 2BRLA 1HQEB 2R8IA 1LV5A 3DOLA 3NDKA 4Q8FA 3DLEB 2KFNA 3FQLA 4CGHA 4WE1B 5CYQB 5J1EB 4F2RA 5HBMA 4PA1A 4C8MA 2F8SA 2HHQA 4CHNA 1QE1A 3CYMA 1SL2A 3OY9A 2JLEA 4EBCA 4FW1A 1S9EB 3V4IB 1HMVB 1WSIA 1S10A 1DLOB 2KQ2A 1KHVA 2IA6A 4QWEA 3SV3A 4CIEA 5KG5A 1S49A 4NLDA 1JLCB 4LQ9A 2XCAA 1YT3A 4C8LA 3IRXA 1LW0B 1RTIA 2JEIA 1T05B 1RTJA 4ZVFA 4N56A 2XY7A 3IS9A 5J2PA 1RTDA 4Q8EA 1NJWA 3IG1B 5J2NA 1KTQA 3KHHA 2E4LA 4RW8A 3C6TB 4FS1A 4OJRA 4NLWA 5KFTA 3SI8A 1S1UB 1BHLA 3M8PA 2WONB 3QO9B 2BQ3A 4M3RA 3PJWA 1B9DA 3E51A 3LP2B 3MECB 3K5OA 4M45A 4B3OB 3HHKA 3Q8SB 3D28A 3TWHA 1FKPA 1WLJA 3SV4A 1S1XA 4NLOA 3CG7A 2EHGA 4OLBA 4DTUA 2OPPA 4FJ8A 4TY8B 4FM0A 3FQKA 2IJFA 1ZBFA 1BQMA 4EP4A 1SV5B 1TL1B 1S6PB 1HQUB 4KRFA 4CF1A 2V9WA 4LH4A 2F8TA 2IM3A 3KKRA 4ZPBA 4FJXA 3ICLA 5KFJA 3TAPA 1S1TA 3KLHB 1RT6B 4FBUA 4AHCA 4QAGA 2VG5B 4DSEA 3VQ5A 2WTFA 4J2DA 1JLBA 4TQRA 2W9BB 4HUGA 5KFXA 1RDCA 4FCYA 4I2PA 3D0PA 2Y1IA 1KHWA 1RT5A 4W5TA 1W9HA 3QLHB 3AVGA 3OS1A 1HNVA 3AV9A 3PVXA 3BQ0A 1IKVA 1WSHA 4JV2A 5KFUA 1C1BA 4RNHA 4MH8A 4IRKA 3DRRA 4KV8B 4IRCA 4CEEA 1X9SA 3PJXA 4QWDA 4FM1A 4CJFA 4CEZA 4FJNA 4IKAA 4XPEA 4CJWA 2HVIA 2HHWA 4M41A 4HCBA 3MR3A 3AO2A 4Q5VA 3PX0A 2ZE2A 1S0NA 1BIUA 1U4BA 1RT7A 3KD5E 4H4MA 4NCGA 5EWGA 3U3GA 1X9WA 1S5JA 3RBEA 3ZSWA 3OL8A 1C0TA 3NF8A 3K58A 4AHTA 4ID1A 4KO0A 3ZSZA 1LWCB 4OKJA 2HNDA 3NL0A 1QAIA 3THVA 4DSKA 4O3PA 2RDJA 5DLGA 1XR7A 1XI1A 1NKEA 4CJQA 4CGFA 2FLLA 3NH1A 4W5RA 3NGIA 3EPIA 3MXIA 3TAEA 5C24B 1ASWA 3E01B 3LPTA 4F4ZA 3KLEA 4E7JA 2XI2A 4O0JA 2XI3A 1D0EA 2G8HA 4RW6A 1TL3A 4O44A 4F4YA 3VN5A 4ZP9A 4E7HA 1JLGB 2XHBA 4H54A 1CXUA 4ED6A 4PWDA 3MEGB 4ZPDA 5KFRA 4FZZA 2W9CB 1TKDA 4DG1B 2YKNA 4YMEA 4B9LA 1RT2A 4GC7A 1BI4B 2NUBA 2YNHB 5KT5A 1U47A 2XY6A 1NKBA 1NHUA 4TYBA 4ECZA 1JLAB 2VG7A 5JXSA 2VWJA 2OPRA 5F8GA 4CF8A 5KFKA 3AVJA 3KLGA 1S9FA 5HLFA 1XR6A 4O3NA 4ELVA 4KFBB 5C25B 4K4TA 1JXLA 1VSHA 3U3YA 4FBTA 4ED3A 3RB3A 5HP1A 3KJVA 1WAJA 2A1RA 2IJNA 1WNSA 2KZMA 2W8LA 4JV1A 3C95A 1HPZA 5I42B 5I3UA 4I9LA
chains in the Genus database with same CATH superfamily
1TMMA 2WVEA 3EY1A 1NNDA 3NMUA 3F44A 1U8SA 2CQHA 4AQYJ 3SQOP 1Y97A 3R1LA 1YRTA 2NYHA 3BF1A 4FPAA 3TVZA 1TU0B 2H9ZA 5HRRA 1BCOA 1OMSA 1VQ4S 4M3TA 3BGFA 1RDAA 2MZ1A 5DM7Q 4ID5A 4LF7J 4U67Q 1X9MA 3CIPA 2ZGZA 2FYXA 2DFHA 4K4UA 2P9NA 2DEIA 4FZYA 1M1GA 3CFPA 3EE8A 1P27B 2FD2A 4CLSA 2WB4A 3M1VB 3VVUA 3A4TA 3MPYA 1BG3A 4E7LA 3EO3A 3HX9A 3PEHA 5AZJA 3VEYA 1H6KX 4NLYA 5B0AA 2ZH6A 3VQ7A 2F8EX 4I6AA 1Q81O 1FNMA 3H4BA 1ZPVA 1OQ6A 3HJVA 1TKZA 3KNAA 4DV4J 3GE1A 4DQQA 2A1SA 1YJWS 1UVNA 3HYFA 3OXFA 3T5JA 2V52B 3S9HA 1NBWA 1PJ6A 2JOQA 4F25A 3TARA 2UYTA 3V1OA 2VWKA 2BANA 5KOWA 4YHHK 2CGLA 3TA2A 4ANCA 2G0IA 4Q0BA 1BY9A 3HLUA 1B0TA 3GJQB 3HO1A 1YF5L 4CZEA 5C15A 3CNQP 4KHPK 3OLAA 3I5BA 2J0SD 1F5BA 2DK2A 4JI4F 4C97A 5B09A 1RTHB 5BR8K 3Q8UA 2X51A 3H42A 5M1FA 4WP8A 4C0BA 5GAEP 4AL6A 4ECTA 3TO8A 3QFHA 3W2WA 4UOHA 1T94A 1WELA 2GC8A 2E5LJ 3F56A 2KVIA 3JQMA 4LF8K 1VS3A 3L95X 5ETMA 4KT0C 4YOTA 1UMJA 2KH9A 4YDUA 2XZDB 1IBLK 3ISZA 2VJVA 3E2EA 2CYYA 2VL1A 4NRUA 2HB5A 5KFNA 2YX7A 2RRAA 2B9XA 1VC5A 4DV1F 1EP4A 1UEVA 1I51B 3ALYA 3LO3A 4KBIA 2IM1A 3CCVS 4JV0A 3MOZA 5KFLA 4WCEQ 2VF3A 3AH6A 4N8OA 1EWQA 4UY8O 1HYZA 2WSEC 4PG7A 2VFTA 1IXKA 1WOSA 3RW7A 3NAEA 4Y6IA 2VODA 2KTQA 2DY9A 4ECUA 3HKZD 2QWNA 1UTAA 4ZPAA 2N4DA 3UKUA 3E9OA 4C1NK 2AJ4A 2M9KA 1Y3JA 4IDHA 1J5EF 2QM1A 4G65A 1QTNB 3SDEB 2YTCA 1NSKL 1QTMA 2C2MB 1Y9OA 2FBTA 3WQTA 2ZUGA 2GHWA 5ETOA 4AILC 1Z1ZA 2FJBB 8ATCB 4DV5K 1T03A 3IP0A 5AQOA 1HYSB 2CZ9A 5B8HA 5L9NA 3DMJA 4KHMA 2UUBF 2B5JA 4NI2A 4C8KA 1EARA 4JLHA 2N3LA 4ELTA 3ISNC 4X4UA 1MU2B 3EPGA 4RW7A 1JNZB 1AFIA 2HMPA 1OY8A 4ZCLA 4BRGA 3DFEA 3HK2A 5A0YA 1V4SA 2PSZA 5DGAA 2CQPA 4LRDA 1VQ8S 4CIGA 4R79A 2O8FB 2GUPA 3AVHA 3T69A 3A5NC 5GVQA 5C10A 4HWIA 2UXBF 2QMUB 2OMOA 1YTYA 2GQ2A 3A3OB 4Z4FA 1RT1B 3O5TB 3V6DA 4YOEA 3QT5A 4K50A 4BRLA 3PTWA 3LL3A 3R6GB 2YKAA 5HRNA 3C14B 5ADXH 1HA1A 5KT6A 5KFDA 5F8LA 4U7CA 2P9PB 3S3MA 1SIZA 3EZOA 2J9DE 3A5MC 4YUDA 3SCJE 2XLIA 3V4IA 2D74B 3QGPA 1HBUB 2RS2A 2G1DA 4FLZA 3LZIA 3PXGa 4LFBF 3FGVA 3ETMA 2QKBA 4DR4K 3NOGA 4L6V3 2NNWA 1CG2A 4YDUC 2WZ1A 2ILZA 4F04B 1XMQK 5T7BA 3OYLA 3Q22A 4CTAB 3OBYA 4FLWA 2MZRA 1BHNA 4E98A 1KD1O 4ZDNA 2HHUA 3C7NA 2V50A 3CB4A 3IG1A 1FK9B 1W2BR 5E26A 3A8KA 3RB4A 2XS7A 4CI6A 4IRDA 1Y11A 3MECA 3NBPA 4JUZA 5AQIA 4Z2XA 2RPIA 3RMBA 1WHYA 3BPDA 3VA3A 1X5TA 4LF4J 3TAFA 4K8XA 5A6PA 5GAGP 5LOQA 4USJC 2E9ZA 4MIBA 4ZJLA 4TY8A 2VFRA 3VQQA 5AQUA 5LMNF 1H1VA 4K43A 2ZFHA 2GWKA 5C42B 1FF2A 5F0XA 2XY5A 3VOVA 3NMRA 3KLHA 4W5NA 3BSAA 3J7ZO 3DN9A 3P45B 1NWKA 4NLTA 1R8HA 2ADBA 3RRKA 2W9BA 3MHYA 2AU0A 2R7SA 4DR7F 2DGXA 5M1KA 3NS5A 1I94J 4K0KF 2D41A 2AGOA 2P6TA 3ENOA 4B9SA 2YHBA 4DL2A 3KMQA 3H5UA 1S0MA 1SKRA 1QQOA 2CDQA 2FJAB 4JI3F 4OLAA 3VZIA 1CJUB 2H54B 1RTJB 2BM0A 5AQXA 1HNXJ 3M6WA 5J2NB 4DL5A 2W41A 4MO5A 4WQ5C 2R7QA 1H7WA 3PRDA 4BROA 1VQKS 3JTNA 4DQ8A 4PR6A 2V67A 2FQQB 3AB4B 5ETNA 3PRBA 3OS2A 3IKMA 3GIKA 4JV5F 4LIWA 3LM2A 1YAGA 1NGIA 5AQNA 4CEDA 4DF8A 3P3DA 3VERA 2IVNA 1ZA2B 3R6LB 3ZETB 1GLCG 2N82B 3FE1A 1S72S 2M4MA 3SJHA 1U1KA 2PIIA 2H3EB 1D09B 1KVJA 1IBMJ 2Q6BA 4DR6J 2YWKA 4A61A 1KVBA 2E2OA 2HBRB 3MPVA 4MKBA 4RUAA 1WEZA 1JLGA 1GMVA 4RZRA 1NGJA 1YGYA 1SJ1A 2Y9HA 2MLXA 2IC3B 3IWLA 2QL5B 4X64J 3ZZYA 4C3MA 4BHQA 4CZIA 2F3JA 1IJFB 1B4SA 3TOQA 1SL1A 3I32A 2QJ3A 5HL7Q 4M5HA 9RUBA 1R7IA 2CJKA 5DQIA 4ZK7M 2QK9A 3PHEA 1HWIA 1VBYA 4DFKA 2E9RX 2BKOA 1BA0A 1C1CB 4MJKA 1WWHA 1NU0A 1X8DA 3LOUA 3LM9A 4YOWA 3MWPA 4ZVQB 1J9AA 4RO0A 3RRHA 2VQFF 3RBXA 4NCGB 1ELOA 1VRTB 2OGUA 4B3SJ 2ACYA 4ICLB 4DTMA 2QEXN 1U0HA 3UNGC 1KSPA 4GO5X 3UCGA 2HNDB 1MDUB 4BR0A 4B3RJ 2VD3A 2HHHJ 5KFSA 4DL4A 4P2XA 5C12A 3DI6A 2PAVA 1RUSA 3FKBA 1TGOA 1VSEA 1L3KA 4NOHA 4RU2A 1MROB 2YHAA 3FLCO 4WFZA 1H0HB 1GLEG 1NSPA 2NLWA 4BR5A 1UA0A 4R5PA 1GOAA 1ULRA 4PWDB 1N34K 3VTHA 1FDBA 1U04A 3THYA 2Y1LB 3O9TA 2MQNA 1XMBA 1WOQA 4QU7A 4ISEA 2OO4A 2FVPA 4X2BA 3IMXA 3O6QA 3SZ2A 3H1QA 1GH8A 2NSCA 4JI7J 2HVDA 1QVGM 3PDNA 1UFKA 1HBOA 1MWZA 1VQYA 3SQGB 5D4NA 2HURA 2FGCA 2MQOA 3ASMA 1O51A 2V4RA 4B8AB 4LF1A 3O2IA 3BYRA 2I9SA 1S12A 4PG8A 4ZVHA 4DV7K 2D0AA 1M5VC 1OYEA 1Z26A 4JHDB 2M3DA 3KMSA 2QEXS 3CQ8A 4LQ3A 2O8BB 5KFAA 3KFWX 4DU3A 3HZGA 3H90A 5G0RA 3KJFB 3NGDA 4ZHRA 1CXQA 1HI0P 3NWRA 3W60A 2B7CB 5LSOA 1MWYA 1ZYQA 4ECWA 1XNRK 2MGZA 3L2QA 3BDEA 3QRRA 4CM2A 2OI2A 1Y0HA 3JB9k 4FWOA 5IWAJ 2HBMA 1VQNN 2G4BA 3HI9A 3HKWA 4EEYA 3BGLA 3D0IE 3ID6A 4ZP6A 4Y2AA 1AW0A 4DTSA 3TZWA 2JJ4D 3RMDA 4DUTA 2PMZD 4CEQA 1ASVA 1TYQB 1Q8KA 5KPTA 3WX4A 3W3DA 5GAHI 2JWNA 1U1LA 3LDLA 4I6MA 4FVMA 1RDDA 2V9KA 4CBUA 4LF5F 4CERA 3QETA 2H4YB 2J9DA 3KD1E 2CPZA 5LY3A 1W7AA 3QMQA 3GJRB 1OJ4A 3GTYX 3JS6A 4CJPA 1WJ9A 3G87A 3I33A 3MPUB 5AJ3J 4X4QA 3L3VA 3ZX3A 3UD4P 4ZLPA 4K4YA 3QSYB 4IFVA 3CCUS 4JRQA 4CJEA 3HM9A 2GA7A 2PBDA 2VV5A 2CPEA 2MSSA 3D1HA 1Y10A 2UUWA 3SQ1A 4LFCF 1A5XA 1NAQA 4E2FB 5DETA 3GIIA 3HZ6A 2DPNA 3JXUA 3VQCA 3DLKA 4P72A 3SJJA 1FRXA 1I6JA 1S3XA 2C2OB 3LDPA 3D54A 3D2FA 5KFWA 4LH5A 6FD1A 1VQNS 4CO4A 3LWMA 2ILYA 5JICA 1QLNA 3MMAB 3BREA 4OQJA 3PCOB 4H4KC 5D4PA 3QJPA 1RHUB 3WXJA 1ZBLA 1NJIO 4BE1A 4DS5A 1KRPA 2FSKA 4DFPA 3G8TA 2LSNA 2WOMA 1T9TA 1NLVA 4I2QA 1WC3A 2GGPA 1LEOA 5CHCB 2CZVC 4PUOA 1QVGR 2XMAA 3TAMA 4YDDB 4WYLA 4ZPCA 4CF2A 3R9PA 3LP0A 1NPRA 1HQEA 1T3NA 3Q86A 4WYBA 2ALYB 3AD9C 3ILLA 4IBNA 3GG0A 4E0DA 4YB7A 3UN2A 3JSMA 2ROGA 4IG0A 4A5AA 1LXJA 1AUDA 1FT8A 4BRAA 3F73A 1U09A 1PAEX 2MLYA 3AA3A 4DHYA 2DO4A 5GINA 3MMBB 2BMBA 4DR5F 3DM2A 2YKMB 4JI4K 1IWAA 4IFYA 3D7SB 3EICA 3BQ2A 4JBCA 2VFSA 2A0FB 3OHRA 3H59A 2XY8A 4Q44A 2CJBA 3OVAA 2AJ0A 1HNIB 2X1BA 3GU0A 4WZQA 3IC1A 1CZAN 4OX8A 3ZNJ1 2QYCA 3OHAA 2JEJA 2VA2A 1BU6O 2DTUA 2DRDA 4LD0A 3MI7X 1GOCA 4IWVA 1TV6A 1FX2A 1VRQC 2DHHA 2E7VA 3DWLA 5IM0B 3FSXA 4DV1K 3M7VA 1ICEB 4HDGA 4NYFA 4LUBA 2KT3A 4C11A 4V19X 4KHYA 5MAOA 2LU1A 3N4PA 4L3NA 2MSTA 4OPHA 3DLRA 3D0GE 4Z0UA 5HJYA 2E20A 3NGZA 4IOCQ 4KH0B 1VQ9S 2FBYA 2F4VK 4K0KJ 1QHTA 3W8GA 2HGNA 4ZCIA 1UJ4A 3I0SA 1VC6A 1QE1B 3MMCA 4HTIA 4NPOA 4LREA 5FPEA 4IOAQ 4DKWA 4PKIA 1O8BA 2ATCB 2C3OA 2XMVA 2K8GA 4HHHA 2MYFA 3DLLL 1XMOJ 2QLXA 3BF3A 3ILOA 3C94A 3OPKA 2CQDA 4FPIA 3VAHA 4XH1A 2HAIA 5SZTA 3IS9B 2GMJA 4EHTA 2FJXA 3M8PB 2XS2A 5BYSA 1JL2A 3CCQN 3FZMA 3PNIA 1S5ZA 4CI0B 4CFBA 2FVSA 3LDSA 2UXBK 5F8HA 3DRYA 1S1XB 1RYSA 3C46A 2J76E 4P75A 5KG2A 4F9OA 2MKIA 2RNEA 3T5LA 3THTA 1RCHA 2VFUA 3HVWA 1HI8A 4CH7A 2OHDA 2EKYA 4G1IA 1EXQA 4YDXA 1FI4A 4YHHJ 4KB1A 3MMJA 4LY7A 1IG9A 2GVZB 2IVFB 2VPWB 1WKKA 4DU1A 4J9KA 2FBXA 2P5OA 4E19A 2OD4A 4LFBK 4CJ5A 3MM7A 1TUWA 4KHPJ 4I2PB 3BS9A 2ASLA 1Q1KA 2UXCJ 3NNCA 2RN2A 3OXLA 3LPYA 3MCPA 1NRKA 3F9MA 5E3AA 2V2VA 4Y1DA 3CDBA 2QXLA 4RJVA 2D4WA 1X5SA 4PG6A 4ERDA 1DTTA 4CEFA 5E33A 3GCXP 4BBYA 4ZP7A 2P9IA 2VQFJ 4M63A 5C25A 3ETOA 3O8WA 3T9NA 4GW6A 4JD2A 4H03B 4R0JA 4IDKA 3HHNB 3HM8A 1RT7B 2NRWA 2F1FA 4DUZF 3JYTA 1RQ0A 3MCMA 2HS3A 1MA9B 3WEEA 2R42A 2K06A 3PEJA 4IQMA 5LMNK 2W7PA 1HHTP 2LP4A 5FJ4A 3GYNA 3V2UC 4O55A 5EOYA 4F3MA 1LFWA 2ASDA 1Q82T 3AODA 4B1ZA 2C2RA 1TELA 4DR7K 2ZD1A 5TKYA 5IT0A 3BBFA 4O23A 3OUYB 3WXMB 3T19A 3E9PA 5JMVA 3K9JA 2J6SA 3TTDA 3NY0A 1P8ZA 1R0AA 3DOMA 2NRZA 4JI3K 3ZT0A 2Y8YA 4O8KA 2V6AA 3FCVA 1WEYA 2RMLA 3HDSA 5C2CA 2ZJQL 3I6PA 5CY4A 2VG7B 2OPRB 1GTHA 3GONA 4EUVA 1EKRA 5K9FA 4Q45A 3V4MA 4ZP8A 3NS6A 2KDOA 1YBUA 2G8FA 4OJ1A 3VMFB 3TZYA 4BRNA 3SSSA 4JV5K 1UWAA 1V3SA 2UUCF 5KG0A 1LCUA 3EDRB 2D0OA 1MWMA 4E1JA 3KHYA 1PIEA 4PXEA 2FIUA 2W25A 3O5BA 3V9XA 1FEEA 2G0CA 4OMFG 4DCPB 4LVOP 2IAJA 3L4QA 2R7OA 2I2YA 4PKHA 4UY85 4MAKA 4X65F 5HK4A 1KN6A 3VQEA 4ID5B 1O0PA 2P9NB 3VQ9A 1LAVA 4J7CA 5F0WA 4M63C 4LF6F 3C6UA 3QNNA 3NCRA 4JNEA 2KL8A 1HLUA 1XMQJ 4L75A 2Q31A 4GKKF 4R8UB 3HOTA 4TU9A 5AZJB 3O1LA 4P10A 3MDFA 2RS8A 1TKZB 2D1CA 5E2QA 3TP2A 1LFPA 4HVZA 4ECVA 1TKXA 3O4WA 3T7ZA 3SK3A 5DZ6A 4LF5J 2CGJA 3TA1A 3PW7A 2BANB 2J0XA 4AHVA 1DURA 3BDPA 3VQBA 1E3MA 4Q0BB 4C98A 2Q97A 2PI4A 3BR8A 5TKWA 4B1YB 4RNFA 5IS2A 2P51A 3FDSA 3CDAA 5CH7B 1PSDA 2NYIA 3S3OA 1FVSA 3OR2A 4DQSA 3ATUA 5CD4A 1A5WA 1FE0A 2DNMA 3DC2A 2NRVA 3OLBA 1QY7A 1X5PA 2HNZA 1PILA 1N54B 4ED8A 1F1BB 2CFXA 4YP3A 4FVUA 3TQ1A 1NJYA 3CDWA 4EWTA 3VAKA 4CLYA 3W2WB 4LR7A 3E8OA 4ZPWR 4J9UE 3HBTA 3R2CJ 2VKRA 4A8XA 5ETKA 4P2SA 3OFEA 2CKWA 1CS4A 3OL9A 1SIWB 3FJ2A 1YI2N 3H4DA 2IM0A 4FNIA 2YX6A 4QR2A 3BJYA 3QESA 2ZUAA 1G3OA 4K8ZA 2XZTB 4Y2CA 3Q2SC 1EP4B 3RJMB 2ZC3A 2GAHC 4XH4A 4C7QA 2H3GX 4ECRA 3PR5B 1Z6RA 3OYJA 3M6VA 5DM7L 3EGZA 4U67L 2P9KA 2CA9A 4FJLA 1BGXT 1WACA 4J91A 4FJJA 2LQJA 3UKUB 1RHQB 5E3CA 2NUUG 1X4CA 3I4PA 2VUGA 2GIQA 1YJ9N 1MMLA 2EC2A 1GX6A 3WXKA 1FJEB 1FXDA 2MB0B 5FROA 1T03B 1V5VA 4CF0A 3W9JA 4YB5A 3DMJB 3A2FA 3H5SA 3J7Z5 4DR5J 2VB6A 3B54A 2B5JB 4NI2B 3D2EA 2UVUA 1BDGA 1KQFB 3NAHA 3VEZA 2OD6A 2VKZG 3Q89A 1N5QA 4CFCA 2BKPA 3OYNA 4WF9Q 4HVJA 2EW9A 4AUKA 3U1NA 5A0YB 2VA3A 1G99A 2ZM6J 1HWUA 4Z94A 1T44A 4IOBA 1K73T 4B1XB 1YI2S 1WAFA 2DNPA 3V6DB 4F26A 2QWQA 3ZZTA 1X7VA 3WQUA 2YQ1A 3NDKA 5FPDA 2KFNA 2O3DA 3AY9A 4CGHA 1MMNA 3TPQA 3BBBA 2FDNA 5HBMA 3TSPA 4PA1A 3HFVA 4C8MA 2RU9A 4CHNA 4DV3F 1SL2A 3T1YK 2LQ8A 1YLXA 5K8NA 1S9EB 3V4IB 1WSIA 2NRHA 5ETRA 3ZZRA 4BS2A 1W2IA 3O08A 1S49A 1NO8A 2HBLA 3HULA 4LQ9A 4C8LA 1FNOA 5E3RA 1LW0B 5AFUA 3J7YI 5LXRA 1YJ9S 4JKEA 2XY7A 4N56A 4ZVFA 1YDLA 3F41A 2RSQA 4B17A 3C7NB 3IG1B 4WCEL 4RW8A 4CZHA 4ETZA 1N34J 4LFCK 2XLKA 2V51B 4NA3A 1IR0A 3HRGA 2AZ3A 3B82A 2HFNA 3FBEA 3E51A 4DR3K 1FA0A 3MECB 4HLBA 4IYQA 4M45A 2B7BB 1ZZNA 2HF4A 3HHKA 3Q8SB 3TWHA 1FKPA 2U1AA 3CG7A 3P31A 2OPPA 4TY8B 2ZH5A 3KLHB 1ZM4A 2H65B 4DUYF 4XTTA 2IVOA 2W9BB 2E7WA 1EQYA 5KFXA 2X1GA 3VENA 4FCYA 1IJEB 4LR9A 3D0PA 5I9EB 1O5JA 3AA8A 2Y1IA 4Z7YA 1FE4A 1IR1A 4L73A 2P9UB 3VEXA 5H1SV 2NXCA 4WU3A 2ZH3A 3PVXA 3BQ0A 2RJZA 2XS5A 1H2UX 1KS2A 3M32A 1X9SA 3W5ZA 1HNZF 4CJFA 1QM9A 3CJ1A 1R89A 2HVIA 4CJWA 4QOTA 3CCSS 2ZE2A 1FXLA 2GCFA 4BC9A 3ZNUA 1KP6A 2XBPA 3KD5E 2OEKA 4FSVA 3G2XA 3ZSWA 1YXQA 3NL0A 3WXIA 4B3MJ 4WWSA 1FERA 3QT6A 3THVA 1QD1A 2RDJA 4BR4A 2HIYA 1WG5A 4CD1A 1I1GA 1RHRB 1U1QA 1UEUA 3WDOA 3B4DA 3GR1A 4DOZA 1UZHA 3E01B 3LPTA 5D6GA 4ILGB 1J6ZA 4KGVB 2DIVA 4F4YA 4E7HA 1JLGB 2G2ZA 5AQSA 4CLUA 1CXUA 4M5MA 3CJ8A 5KFRA 4ATNA 4FZZA 5F0UA 2YKNA 2BXJA 4B9LA 5AQJA 4FWQA 2NUBA 1JQGA 1NGDA 4ECZA 4H5NA 2D69A 3KUHA 2ZZMA 5JXSA 4CLWA 1N5SA 3CPEA 5KFKA 3KLGA 2JLFA 1S9FA 3HTVA 4BRMA 1XR6A 4ELVA 2E1PA 5BREA 1KC8T 2R7VA 3A5LC 3OBIA 1U24A 1T3OA 5HP1A 2A1RA 3DRXA 4CO5A 1HR0J 2KZMA 1RBLA 2FHJA 1WC4A 5I3UA 3ZEUA 3HSCA 4JI5F 1VHFA 1HARA 4FJIA 1YBAA 3ONQA 1H38A 4JI8F 1VQ5S 2QA1A 5DG7A 3SIPB 2HBKA 3GFXA 2AP6A 1KOHA 1Y00A 4YY3F 1P1TA 4G1QA 3Q8PB 4DR2J 3DI6B 2MJUA 3MN5A 2VU5A 5FLXU 2P5GA 5CYJA 2QWPA 1TKTA 2NXJA 2KT5A 1WSEA 2AZ1A 5T7LA 3CETA 1ZM3A 3BPSP 3M2UA 2F4FA 4QR0A 4OX9F 2MQMA 1C0UA 4WFYA 3AA2A 4R5PB 1BWFO 3D6RA 4KGMA 1TQLA 2GUIA 4CO2A 1FWLA 1HBMB 3THYB 1VSJA 2D1KA 4FJ7A 4FO0A 2CH6A 4EP5A 4LT6A 2AYBA 3U1MA 1PG5B 5BYRA 4OHWA 3UVJB 2DR8A 5FDLA 5LJ3Y 1BL3A 3P5JA 4RBVA 2RRBA 1CZBA 4BRHA 3P4UB 4UQGA 1XN9A 1X4HA 3H2LA 3PLAA 1RLDA 4J37A 1YVNA 4TY9A 2A1BA 4UQTA 3IBWA 4DU7A 3T1HF 5F3ZA 1VISA 4ES3A 2UUAF 1N0UA 5EN1A 4DI6A 5K20B 1IBCB 3TW0A 1GOBA 4USTA 4ILMA 4DR1J 5HL7L 4FOEA 4CT9A 1B7FA 1WHWA 3HVTA 4P7VA 1RT3A 4LR8A 2ZKTA 1SI9A 5G0RB 3MM6A 4XO0A 2R7WA 4ZHRB 3MX5A 4CZFA 4A46A 1SC4B 2W8KA 4OV6A 2OPQA 2RHQB 2MGZB 3UE5A 1NK0A 5KG4A 3P83D 4BC3A 2FJVA 4NLCA 4FJKA 2F9DA 2WW4A 5B0GA 3QFWA 2F9TA 2F4VJ 3OYKA 2K1RA 5D8HB 3O4NA 4CW7B 3RSEA 1RE1B 3Q7BA 3CCEN 4F3QA 4DV0K 2DR9A 1YQHA 3SSQA 3MXMA 1ZETA 1N32F 1MN7A 1GMWD 5LMUF 2VWBA 4I6MB 2HNYA 4B9MA 3CPWM 2ZWHA 4FL9A 1G1XA 3L7UA 2Y0BB 4YOVA 1HBNA 2ZJPQ 2YNGA 2G13A 3K9KA 3UN3A 3A5OC 3D4JA 4MTPA 5CZXA 1SJ4P 3DRPA 1H3DA 1JLQA 3CIMA 2UUCK 1OY9A 5GAHP 3KLFA 4IFVB 1IH7A 2ACMA 4OPAA 2FSNA 3TNVA 1EETA 1JLEA 1NUEA 3UCUP 5BPLA 2SXLA 4NYOA 2CJ9A 2Z0GA 2PFFB 4PAAA 3CVKA 1WI6A 3SUNA 5HMYA 4OHVA 3W9HA 3CJQA 5CE3A 3VGLA 3DLKB 4X65K 3SCXA 2FUG9 3KYLA 4DPTA 3D2FB 4DPUA 3MAQA 3N6LA 2ZBQA 1UPPA 1L5UA 4DCHA 1FJCA 2BJ1A 4DZDA 1ZH5A 4I0WA 4FXWA 4PZVA 2AJQA 3DLEA 4WE1A 1RP5A 4J9SA 5CYQA 5J1EA 5FLXY 2ZH2A 4GKKK 2GMHA 4ELUA 4IH5A 2M70A 2MHEA 2WOMB 1N48A 1Z2ZA 4OLPA 1FRHA 2ZBCA 2GGPB 1FJ7A 1HMVA 1YVUA 2YHXA 3TAMB 4K4SA 4KHRA 4I9QA 4FZVA 4OYXA 5FPNA 4NXMF 4CIFA 2GQQA 1JLCA 3LP0B 1WORA 4GNIA 1J53A 1R0CB 2BZ2A 5D0GA 1C1AA 1QQCA 4E1MA 4DSIA 3JSMB 3V81B 1JCEA 4IG0B 1JB0C 2Z2LA 5HI7A 4DHVA 4C3KA 1KQSM 1NZAA 4F4KA 4X66F 2CPHA 4C4WA 1C0FA 3DM2B 1N5YB 4ILJA 1JJ2M 4IFYB 3LP2A 1SCJB 5L1IA 1KAYA 4OX6A 2IVYA 1NSQA 1XERA 2HWTA 1AUSL 3AFGA 3I56S 1L3TA 1VIXA 3RB6A 2UZAA 2ROEA 3KJQB 1ZAWA 3Q7CA 1S6PA 2IPOB 1HQUA 1SC1B 2CNNB 4RWXA 1S4FA 3QIDA 5DJBA 3D6FB 2ZNYA 1CLFA 2VG5A 5M2UA 4DSJA 2Z4PA 3VAFA 1N36F 3VQTA 3NKYA 2E6LA 3VETA 4B3TF 1YZ6A 5ETQA 2DXEA 3OYBA 3D45A 3EVMA 1TV6B 1X3MA 3NWGA 1A6LA 4DPOA 1H2TZ 3T1AA 5AQQA 2MJNA 4NWBA 4CLFA 3SI6A 4YFUA 3BBCA 3OSPA 3TAQA 5LXYA 2BR0A 3ZSOA 3C2PA 4C11B 4RTFD 5IC6B 2AQ4A 1TL7A 2HFOA 2MY7A 2C42A 4CZGA 3JTPA 6AT1B 3CDEA 4DUYJ 5L39A 4DU4A 3BF4A 3DXKB 2MQ8A 3MFIA 1NU4A 4NCAA 2AEMA 1RTIB 2A3ZA 3QEIA 2CJAA 2VOPA 2VQEF 3D68A 5BJRA 4LF9F 3I0SB 4GVBA 5AXLA 3VEWA 1IQTA 3MMCB 4HCCA 2HSEB 3IMQJ 1MWKA 2V4QA 5IQQA 2BOAA 4QWBA 3AO5A 3LUYA 4ZITA 3CMAN 3EKSA 2IIRA 3VA0A 2JGUA 1LWXA 2J7WA 4GKJJ 4DV6K 1TL5A 2G8VA 2YPYA 1A0OB 3NGKA 2UV8A 3EE9A 3D3BJ 2NZCA 2WHOA 4CBWA 5EUHA 2OTLS 3AA5X 2OLWA 1X4BA 3WNFA 1X4FA 1D3WA 4AYBD 3PW4A 1FTCA 3GV8B 2ROPA 2NQPA 3OTBA 5F8JA 3OYHA 2R8KA 2CJXB 4DG1A 3WX8A 3FSYA 3O9SA 1T02A 1R59O 3KK7A 2GV1A 4P74A 1GLDG 4LFAF 3NCPA 1JCGA 1NM2A 3LW5C 4RX6A 1C1BB 3O8MA 4DV3K 1ILYA 4HDHA 1RAAB 5KFHA 1PC4A 4C0HA 2VC0A 3X3UA 3D5MA 3HD2A 4JN4A 3S41A 1AXQA 3HHLA 3MM7B 3GDQA 4E89A 2AYMA 1RWXB 3AVAA 3U4LA 2R8JA 1XJWB 3THWA 1RBOB 2B0GA 5I42A 1XHXA 5C5JA 3HPGA 1O6XA 3PR4A 3L2WA 1H7XA 4DQPA 2IDEA 2MY8A 3W0LA 1KKHA 4NEZA 3CF5Q 2OZSA 1FFGB 2AW0A 1DTTB 4IOCL 1JJ2R 1LK7A 5A8KB 2VGNA 3R6MA 3KUGA 3CJ5A 4JD2B 4XH5A 4J2BA 3ZZZA 4IDKB 2RVJA 2DCUB 2YJEA 2HBJA 1KAXA 1HNWK 5GADI 1IBKF 3JYTB 1KLNA 5A76A 4F0MA 5M2PA 3LP1A 2CVIA 3DCAA 2ZQBA 3X1LB 2HQIA 4IOAL 2GQCA 4BREA 1SJQA 4DB3A 1U1MA 5IT4A 3JS9A 4X62J 3L8BA 4KH5A 2VPXB 4IQXA 1IKYA 1WSVA 2DHAA 3N6NA 2IRYA 1FRKA 2J7KA 3OYFA 2EXUA 1VR6A 4Q43A 1PAUB 1KQGB 5ADXA 1TVRA 1X3NA 2IMWP 2NUHA 3G6EN 5GAEU 1S97A 4KGZB 4AQYF 1WB9A 5CZ2A 1HUXA 4FK4A 3ZSYA 1WSFA 1WC1A 3C3LA 2IIHA 1R0AB 3DOMB 1D1UA 3K0JA 1N6QA 2ZF5O 3KLIA 2K2PA 3VR1A 1G15A 3G4SN 3TVYA 5AE3A 4LF7F 4CZKA 3S3NA 3D6MB 4D3GA 4HR2A 4DLGA 3I82A 1G7CB 4BE2A 3ZT3A 4C8YA 2E5HA 3RG6A 3MMVA 1XR5A 2YBVA 3PFOA 4TKTA 1OSDA 1B99A 1Y4ZB 4I7FA 3AAWB 2K7JA 5DMRA 1Z2LA 2RKIA 2XSJA 3VAJA 3I4HX 2WK4A 2HS4A 4JK8A 4M5DA 3VQSA 3P5TL 4S0MA 4DV4F 3HHLC 3G6VA 1SL0A 3Q8VA 4K2XA 2FB0A 4JI2F 2RH3A 2NS1B 2M8HA 2LQ5A 4M7YA 1SUQA 2NSBA 2VICA 3QFUA 2R7YA 4NB4A 3FRYA 2F5GA 1RBTA 2EFVA 2ZH7A 4A57A 2L41A 3T1YJ 4DCOB 3PIOQ 5C0YA 4X4SA 4L72B 2YVSA 1ZS6A 5KGWA 1U6BA 2QC3A 1FW6A 4ZTJA 3KK3A 3GQCA 2CQIA 3V1QA 3AXMA 4YOYA 4ZKAA 5I3QA 4CWBA 1S59A 1QVFM 1BCMA 3ZTPA 3LAMA 4CZCA 2LECA 4A8FA 1URNA 3RZAA 1OO0B 2XYGB 1LWFA 4QIEA 4O3SA 1TKXB 3N79A 2CIMA 1YHQN 4BWMA 2DT9A 1LK5A 3A0IX 1F5CA 4CJ4A 2G8IA 1CJTA 3H45C 4K4ZA 1LW2A 2OANA 1RCOB 3FZHA 4JI8K 3DYAB 1DARA 2FVQA 4ZS6A 1VAZA 2A6AA 2VBYA 3C6AA 4QCLA 3T6BA 4YY3K 2Y1JA 1W26A 1B92A 4C48A 5K14A 4E3SA 1IM6A 2DGVA 4WJBA 1XK8A 4EZ6A 3OR2B 3JQKA 2QLBB 2KYZA 4K4WA 2EVZA 1KVAA 4CK1A 3T41A 4IG3A 3DLLQ 3OV7A 1YUWA 2HNZB 5KQDA 4H5TA 5H9FJ 5AZIA 4YORA 4AM6A 2H5IB 1ASUA 1T9XA 3MUMP 4USHA 1G2EA 4QS7A 2EFOA 4ZPVR 1U7LA 4U8YA 3O3GA 2MPUA 5A2QU 4MK7A 1CS4B 3L2VA 5B0BA 2BQUA 4O3OA 1RDBA 1FNXH 3FEYB 4ZLNA 1K0VA 1YK9A 1LOTB 2CQGA 3IGNA 1YKWA 4QQBA 2POKA 3GE9A 2W6KA 4N47A 2AMCB 3EL2A 3M8RA 4ZMMA 1Y3KA 3HP6A 3MXJA 1W97L 4J8FA 4UTGA 4QWAA 2DGUA 2DBBA 3HSTB 3GFHA 2QFJA 1FD8A 3I0RB 3T1HK 2UUAK 1S1VB 4IZ9A 2P9KB 4X4PA 3FGUA 3CW2C 2JDJA 1WF1A 4JKCA 1NPPA 2HHXA 1M0SA 1O1WA 2J5AA 4UOGA 3AVBA 4FKYA 4PWWA 3HD1A 4X4TA 4RBTA 3WUHA 2RDDA 1PJ7A 2CPXA 3M30A 1VLOA 3Q0AA 4IO8A 2QLWA 1JXEA 1LAWA 4HUEA 3BZKA 1GLFO 4KH4A 1VQLN 1UW9A 1BLUA 4MKVA 2E9TA 3K0SA 4QS8A 3QGIA 3D2EB 3ZSXA 4MKYA 2EX3A 1N88A 4DTJA 3PIPQ 2E5GA 3FMBA 1OSCA 2AEJA 2X3GA 4EBDA 3LZJA 2KHDA 4RW4A 2O4IA 4ED1A 2IRXA 2V8DA 4DBQA 2FLNA 4I1TA 2BABA 5BRHA 4WK3A 2DEJA 1REVB 3EDQB 5B0FA 4FYDA 3H3NO 1N32K 2L48A 4PG5A 3E1YA 5LM7E 1VIOA 4ED0A 3BEGB 4TNOA 4QWCA 3GFYA 2Y8WA 1RT6A 1FVQA 1HW8A 2ERRA 2P1JA 3TSUA 1OPIA 3QBWA 3CD0A 1LOUA 1UJ6A 5HBMB 2O8DB 4LF4F 5AE1A 4F50A 4QPXA 3OJSA 1ZBHA 4BG9A 4Q2MA 4CHPA 1K73O 2JVRA 1YJNN 2L08A 2HHVA 2IYIA 2IVMA 2V7ZA 1VBXA 1SH2A 3OTOJ 1IWGA 4RWTA 3SBTA 4BRFA 3GL1A 4LF9J 2BRKA 2ZJRQ 3R27A 4BE0A 2IFXA 4QOZB 1CC8A 5FPMA 4DX7A 5DQGA 1RWMB 1F9HA 3VQPA 4UZCA 1NMNA 2W2QP 1I94F 2UXDJ 4JYAK 4Z37A 5L46A 4RW8B 1OVYA 3PFEA 2DGQA 3P96A 3CC2S 1VRUA 4EO8A 3PY8A 4M95A 2MQLA 4FS2A 1ATNA 2BGGA 1S9GA 4CK3A 5HATA 3NGSA 1FKPB 2HRUA 2J9CA 3J7YP 4IJAA 4BRDA 1VJWA 1NDPA 3SUPA 2V4JA 1T3VA 2OPPB 2GFFA 1TP7A 4CK2A 1HNXF 1HIYA 1XEZA 5IV3A 3J81j 2P6SA 3HI0A 2E1AA 2H5JB 2WRMA 4XPCA 1WI8A 5JUMA 2C1EB 3AVKA 4QS9A 3TEHB 4CJKA 3W7BA 1VFJA 2DNGA 3CHWA 1WBDA 3O1BA 7AT1B 3QIPA 2HRTA 4WF9L 2YPZA 1TMJA 1T0TV 2HBZB 3PSFA 2FHMA 3FNNA 3ZSQA 4NXMK 2PFDA 3ZTOA 5A2QY 4DMZA 2F7TA 4L74A 4JI1K 1ZA1B 4MYTA 3L7PA 3OYCA 1IBMF 4DR6F 4HYKA 1YJNS 4M5NA 1FRIA 4BCAA 2OA8A 2BE2A 4JI0K 3M32B 5HROB 3J7AN 1V3RA 1FKOA 4X66K 1VQ4N 2QXFA 4I4BA 2DFFA 4B9UA 4NXNK 1WD6A 3HVRA 5GMEA 1FO1A 5HVGA 4HTJA 1K44A 4X64F 4KTWA 3HJFA 1VOMA 4DPXA 3P8BB 2QWRA 4CHOA 4O0NA 2JFDA 1B7YB 4LVNP 4RPFA 3DRSA 4NLVA 4HTUA 3OFGA 2CQ4A 3MCSA 2QWMA 1N36K 2DR6A 4PXDA 5DS7A 4DLEA 2C3UA 1S7IA 1Q18A 2OIHA 2E66A 2XYPB 3M2VA 1WUAA 2VG6A 2KHCA 4B3SF 1YRUA 4AL5A 4LBIA 4B3RF 2HHHF 4RG8A 3D6HB 2J6TA 4P7TA 4IH7A 2HHTA 4KBOA 2YKNB 2PYJA 4CHZA 1V9OA 1KTVA 2QA4N 3MXHP 4CJ7A 3AJ2A 4FYXB 3BGOP 1C6VA 2FZKB 2O67A 4K4VA 2I5JA 4HH0A 3OQ2A 5D0RA 1KVKA 4M3ZA 4OVLA 4FYVB 2E5JA 5LL6Z 3KLGB 3C8YA 2D0BA 1YTUA 2OFGX 4V19J 1F9FA 2DPJA 5I3UB 2EKNA 4K41A 3ZEUB 4CESA 1NBEB 2CJYB 1PJ5A 2ZH8A 5E84A 5HMWA 4JI7F 3TUZC 3B6OA 2C2NA 1H73A 2PYLA 2E2PA 4ZOSA 4FK2A 1RA6A 3TA0A 2A42A 3CCVN 5GMKa 3TR5A 1TKTB 3C15A 1KC8O 3MEEA 5HAOA 1SJFA 3M8YA 4LBHA 3K17A 5T7LB 2DNRA 4IR9A 1YTAA 2K3KA 2JC0A 4JI2J 1SC3B 1C0UB 4DMNA 4OHZA 3UN5A 4NA1A 4LFAK 1NJXA 4NO7A 3ZC4A 2H4WB 4ZVRB 1W0HA 1NGFA 3GBTA 4JS5A 1JKHA 4K59A 4PXBA 1X4DA 3CDUA 3SQ2A 2EG1A 1N8RT 4XDCA 5FDLB 5JVGQ 1W2BM 4JKDA 1NOZA 2QA4S 1RCXB 3K5NA 3NEKA 1EAYC 5IWAF 3CCRN 4Y2KA 2HG4A 4YOXA 4RU9A 3VESA 2W6LA 3QGHA 2J9EA 1J27A 2JC1A 1YJRA 3O3FA 2RUSA 1VQ8N 2MKYA 1UVJA 3SNNA 2QN6B 3MEDA 4A2BA 3G6YA 1HFEL 1F6TA 5U47A 2OH2A 2HW3A 2GS8A 2XZWA 2NZTA 4CH0S 1KQKA 2VJUA 1QUPA 3NS7B 1FJGJ 2ZKUA 3OTCA 1C2PA 2I1RA 2P9CA 3HVTB 1IBKK 5DG9A 3CIZA 2HQFA 4OI3A 3MM6B 3CQXA 1YIJN 4OZNA 2MXYA 3RR7A 4I64A 4XDDA 3C16B 4L3QA 3DDIA 5E0OA 4O4GA 2V8PA 2OPQB 4HT5A 1NDKA 2Q3PA 4DPYA 4DN0A 3KJNB 5EX3A 2QE5A 5AJ3F 4WPAA 2ZVSA 3OYMA 5HO4A 1QUVA 1RA7A 5DGBA 1IKWA 2YWEA 5T41A 2F63A 3RSEB 2M7SA 4K5RA 5LJ5Y 4X4VA 2J7UA 3K7RA 1ATSA 2HOEA 4M3WA 3A1YG 1N5VA 4C8NA 1UVIA 4BGAA 4P52A 3N01A 2HVHA 1B70B 2QFIA 2I7NA 3UDCA 2KM8C 3N4QA 2HNYB 4BDYA 2JL9A 4LF7K 3KOAA 4DV6J 3CCRS 4NLRA 2A6OA 3O3HA 4C1NI 3T9ZA 4ED7A 1HBNB 1ZOTA 1KFSA 4WIQA 2YNGB 3H5YA 4J9PA 1P1LA 5KGXA 3CO9A 1R3NA 4B1UB 5AQPA 5GAGI 4YR2A 3DRPB 3IR7B 4PQUA 1JLQB 3UD3P 3KHRA 3W2VA 1PKUA 2AJFE 4CLZA 5EY4A 4FF1A 3KLFB 1NK8A 3R2DJ 2E7XA 3RB0A 1EETB 1JLEB 1RGIA 2HMIA 1YIJS 3P5BP 5KT4A 3QRPA 2Q1NA 3MF5A 1TK8A 4CEBA 3GPAA 1L3UA 2JSXA 3P4IA 2XMMA 1U2VA 5JMNA 4HKQA 3HOSA 1DFDA 2MKHA 1WKLA 2QL9B 2ZDOA 2FVRA 5MLCV 4WU2A 3LDNA 1F5AA 3DLEB 1OVQA 2HSTA 4WE1B 5CYQB 1D9AA 5J1EB 3W1YC 3S8SA 1VQKN 3ET6A 2HHQA 2F8SA 1ZAXA 5HANA 1ZXOA 3PYEA 3CERA 2Z2MA 1B64A 1F0XA 4EBCA 1PYSB 3MM5A 1HMVB 1RAOA 2FF3B 1S10A 1KHVA 1DBDA 2VIHA 3R7SB 2E5LK 2VBXA 4CIEA 5KG5A 2DXFA 4NLDA 1JLCB 1S72N 2E1RA 3IRXA 4CYUB 4A59A 2WSFC 3CMQA 1BMQB 1HNWJ 3O80A 5LJVA 2JEIA 1GK8A 1HKGA 1T05B 1RTJA 1K8KA 4Q2LA 4U96A 2V2QA 1NJWA 5J2NA 1KTQA 2E4LA 3TEGA 3QWPA 2UU9J 4XAKA 1JJ4A 3D2WA 1BHLA 1DAXA 4OYIA 4OJ3A 4OZJA 5AQTA 2YX1A 4KRWA 3AJ1A 4PQAA 3LP2B 3K5OA 2DRBA 4BR9A 2ZHAA 5DO2A 3SAHA 3LGNA 3D28A 4UF4A 4AE5A 4KIAA 2ZJPL 5CD4H 3ZETA 1K9MT 2IJFA 3BO2A 1JCFA 1S6PB 3IO1A 1HQUB 2OUGA 2V9WA 2MDAA 2F8TA 2IM3A 3KKRA 3TAPA 1S1TA 2VG5B 1DZ5A 4P6QA 4Y2IA 5IV4A 3D0HE 2LKZA 1XMOF 5GMDA 1SQEA 2HQ3A 2V8HA 3U1LA 1F3FA 4H0XB 2ZBPA 2P9SA 4PKDB 1Q86T 1KHWA 2KB2A 1RT5A 3EUNA 4W5TA 1W9HA 1RWNB 1TL7B 3AVGA 1HNVA 4CLKA 3AV9A 2MKSA 2MZJA 1HPMA 1WSHA 1RHKB 1N33J 4OZ3A 2V68A 3D7EO 3DRRA 3ZXWA 4FM1A 2CNKB 4P73A 4IKAA 4XPEA 1GNKA 7FDRA 4CO0A 1Q7YT 4CQ1A 1BIUA 1U4BA 4H4MA 4NCGA 4CO3A 2HFUA 5HN0A 2CQ2A 3U3GA 1TR0A 2FZCB 4YHHF 3H0PA 1R8AA 3RBEA 1WF0A 1C0TA 3K58A 4AHTA 4KO0A 3DXBA 2I7PA 4OKJA 2HNDA 4USMA 3DXMA 3U9ZA 2F8HA 4MLHA 4DSKA 2GZOA 3ULHA 3E9LA 1IQZA 1NKEA 5EVZA 4CJQA 4DJBA 3NH1A 4KHPF 4W5RA 3EPIA 2UXCF 2LXFA 3KDNA 3TAEA 3OXGA 2W4CA 3JXOA 4F4ZA 3VTIA 3MUVP 3EM1A 4O0JA 4U95A 3AGRA 4RW6A 4O44A 1MLAA 3VN5A 1T9VA 4UZBA 4U7BA 2XHBA 4ALZA 4PWDA 2BBEA 4NMXA 2W4DA 5ETTA 4DG1B 2APOA 2D9PA 4GC7A 1ATRA 4YB6A 4OYAA 4WTOB 3VEVA 3M4XA 4TYBA 4PABA 3L3CA 3KUEA 4LF4K 1EX8A 3DKDA 3CCMS 4USKA 2EI5A 2HPUA 3SBGA 4PYAA 3MAAA 3VWSA 3HHLB 3RUBL 4K4TA 5HQ8A 1VSHA 4BRQA 3GJTB 3KJVA 4ZJOA 3BKFA 4JV1A 4OHYA 3THWB 5AXMA 2WVFA 5I42B 4A2AA 1UL3A 2RAQA 4TVAB 2I6WA 2D0CA 2VOOA 5DDRC 4A8MP 4KPYA 2OZMA 2XTJP 2J0QD 1M1KT 2WBMA 2QSFA 3A8JA 3Q8QB 3BUZB 4XIUA 1XC3A 5D0HA 3GSIA 2Z1JA 3V9WA 2EK6A 2UVWA 2ZNZA 3ENVA 4UW2A 3LP1B 1XNQK 1RKJA 2P9GA 3L2UA 3P39A 1S57A 5A8WA 1KVIA 4NZ7A 5KG1A 2I8EA 1RISA 1U49A 2Q3SA 3K2YA 2YWWA 1IKYB 1RTZA 2AJ2A 3H40A 2MKCA 1Y5LB 3QRQA 3I31A 3NMAA 2VH7A 5GADP 2RF2A 4IH6A 1J2VA 3CCUN 4OI0A 5DG8A 1TVRB 1OH5A 2R2RA 4C0OC 3SXLA 1NK9A 2W24A 3LALA 1VLYA 1WKJA 3DLJA 4AHRA 4LBPA 1RSCA 4BWJA 4M3UA 1HWKA 3MD1A 4FJMA 3EJMA 5DQHA 2V8VA 1E6YA 3L2RA 4Y1CA 3PX4A 1N6QB 3KLIB 1JLFA 3UO0A 1LWEB 1MW7A 2B43A 4F2SA 4BDPA 3WZ0A 3Q2TC 4GO7X 4M1KA 3HPOA 1HHSA 3VQAA 4KAZA 4I7FB 1KOOA 3OJUA 4CP5A 1XMQF 4CGGA 3FC9A 3DHWC 3EZUA 5HQLA 4M5DB 4M8LA 3EGVA 1WN7A 3CJ0A 4E7IA 1VJQA 5D77A 3G82A 4MFBB 2C28A 3CC4N 4BRKA 1HX1A 4JI6J 2ATQA 3CE8A 2CRLA 4PPDA 4E1NA 4NASA 4PRFA 3LPEA 4J9RA 3C65A 3CF5L 4FLTA 1Q53A 4B3SK 1X4EA 4QIGA 2Z1HA 3CC7S 1I39A 4ISFA 1FD2A 4B3RK 3AA9A 2HHHK 3L4BC 1VMBA 3RAMA 4OYMA 4DF4A 3MN9A 4NMLA 4J5OA 1WEXA 2XSFA 5KFZA 4NL5A 5A8RA 5GIOA 3B6PA 3KK3B 4R0EA 3GZ7A 1RT4A 3NLCA 3W62A 4MKAA 2DNQA 4NLSA 4F02A 5M2RA 4JYAJ 2BKNA 3DGPA 2R4FA 5H9EJ 1LWFB 3PW0A 3LGHA 2ZBRA 1QAYA 2LU2A 2V2KA 4ECSA 2QTDA 1T7PA 1NHVA 3PACA 5A6WA 4FW2A 1CJTB 4WYWA 1LW2B 3FK4A 4CGDA 3I8DA 3QNOA 1IVZA 1XQSC 4JI7K 1U26A 5KFBA 1JXBA 5K14B 1DT9A 1NG9A 2D3UA 1VK0A 3BSOA 1PBUA 4X4OA 2HK2A 1RILA 2AEFA 2ALZA 1FXXA 3IFRA 2KZZA 4IG3B 3CJSA 3GLJA 3CC4S 1P90A 3DOKA 1VQ9N 3L09A 2XB2D 4GV9A 4H0PA 5AZIB 1FRMA 3U9DA 1NCLA 4UUWA 2G2YA 3KWGA 5KFFA 4JI1J 3ID8A 2WCXA 1FDAA 3IUCA 5DRKA 3O9RA 5IM0A 5JS2A 1OQ3A 4WFAQ 1SBRA 4JI0J 3J7AP 3UQSA 1RB0A 1YSJA 1DLOA 1SPBP 3KLVA 2ADCA 5EX0A 1QSLA 3FFIB 4AT1B 4TSXA 1NOYA 3OL6A 3UDVA 4NXNJ 1TAUA 5IWAK 3Q23A 2AX1A 2W9AA 4H0VB 3RBDA 1CQNA 2H1YA 4EFAC 2O8CA 5ETSA 3OVNA 3UKRB 2OAUA 2ZM6F 3RMCA 4NRTA 3PYDA 4LC9B 3PIOL 3C6TA 2DPIA 4ECYA 1NGHA 1S1UA 4F4XA 2JZ5A 3QO9A 2GVDB 2O5DA 2NLXA 2DNKA 2A18A 3BKUA 4DV2J 4A8YA 1UKUA 2JRSA 1FDDA 4B3OA 1KEKA 1ROFA 4UT4A 1UPMB 3G8SA 4GVMA 2BUNA 4K7QA 1RDUA 1UOCA 1SV5A 3C19A 2WBRA 5KOXA 2DNYA 2HEKA 5B0CA 4I6YA 4CFAA 3PJ9A 4O4RA 3CT9A 1ZBIA 3NOCA 4RNOA 3HSGA 2KU7A 4KY3A 2BJ8A 1ZC6A 4XEIA 3W65A 3N0VA 2AYEA 4RW4B 4FXVA 2LXUA 2B51A 2C3YA 2JH3A 1ZBUA 1QZ5A 5DM6Q 4LRAA 1Y5NB 2DHGA 1J5EK 4L3KA 1V6HA 2FF6A 2DTJA 5FLXO 2V69A 4ZVGA 3G71N 3AOAA 3JAMU 2LEPA 3OYIA 1N34F 2BOPA 4ZIWA 3O9UA 2UUBK 4PEOA 2G8KA 4A8QA 1EQMA 3H3OB 2CNOB 3MZIA 4QYZK 2R9LA 2V0NA 5H1SQ 1RTDB 2Q0RA 4C23A 2GBZA 2ASYA 2B8QA 2BJEA 4OPJA 3NH2A 1RU1A 4Z4IA 3SSRA 2W2OP 3IGVA 1QDUB 3CFOA 3TTFA 3AB2B 4TLRA 1XIQA 2DNHA 5KPZA 4KQZA 1WOOA 3NVMA 4ISGA 2IOCA 1LWCA 4IKFA 2CJQA 2GHVC 1NK7A 1EKSA 1NLKL 3CD5A 5AQMA 1RXOB 4ED5A 2OFHX 4KTQA 3V6KA 4DU8A 3CCLN 2Z56B 4DXLA 1N0VC 4QU6A 2PA3A 2EFQA 4DQRA 3B6BA 5C24A 1VRUB 5EDWA 1QAXA 4KAIA 4AF1A 5K8OA 4U8VA 2E2QA 2XEXA 2J8SA 1S9GB 1B0VA 2IDOA 5B0EA 3SUOA 3MEGA 2VPZB 2PGCA 3R97A 2HFZA 5CXTA 1VSFA 3EGNA 3MR5A 1BI4A 1B9FA 2YNHA 2DIUA 5BR8J 2PMHA 3AVIA 3G71S 2YKQA 1SQFA 1OH6A 3HSJA 4RR5A 1HHQA 2A2CA 4TYAA 2BH1A 3PIPL 4HUFA 3THXA 3QATA 5AXKA 3PUFA 1NHKL 3QIPB 4LF8J 3K57A 4B3MF 4NYZA 3FSIA 1IBLJ 1TZ0A 2DR7A 1F3VA 3C0BA 3IN5A 2BUPA 1GLAG 2Q6CA 2FLPA 1ITGA 3H46O 5KQ8A 2CG8A 1BIZA 5FRNA 2HGLA 2PDAA 3O9QA 2BE2B 1M1HA 2KJVA 2GTDA 3A13A 1FKOB 2P9LB 2HWIA 5FD1A 3TABA 3KK2A 3BO3A 2HRYA 3MWTA 4ED2A 3CCLS 3MN7A 1CSJA 3Q24A 3J81U 4K0KK 4OZ5A 3QEWA 2GNKA 2COLA 1FX4A 1GLJO 3ZTQA 3W9IA 4URGA 1SJ3P 3EEQA 4CGJA 3TJ9A 4WFBQ 1X4AA 4P71A 2CQ0A 5I4MA 4BACA 2BJDA 3AAQA 4DV5J 3DRSB 8RUCA 2ZJRL 1RT2B 1AB8A 3OYDA 2ASPA 1QSYA 3FFKB 4LF2A 3R5AA 5J1PA 2Z1GA 1XMOK 1HR0F 2W40A 2XCPA 1ZM9A 3M2VB 2VG6B 4JOUA 2IJRA 3W5XA 3AD8C 3TU5A 2WB1D 4M7XA 4MDBA 4DR2F 2P8IA 4DX5A 5DDOC 1Q0NA 4R8UA 3EZ5A 2RDIA 1Q79A 1W25A 3AARA 4OYPA 4OYOA 4YR0A 2KKZA 5CAAA 2UV8G 3R7BB 5E3QA 2WSCC 4FJ5A 4KI6A 3JAMY 5L1JA 2I5JB 2JEFA 5KFVA 1RBUA 3CCZA 1KNZA 3F5TA 3POTA 2MLZA 3N28A 3LAKA 3HZEA 2CH5A 4K8RA 2JWLA 3BV8A 2E29A 1EO1A 3BYPA 1F60B 4W92B 5KPRA 1HD1A 2OEJA 4JKFA 4Y00A 4DR4J 3PM9A 3CM5A 2UXCK 2AGPA 4W5OA 2QT7A 2HVEA 3CJ9A 1S79A 1VHXA 2B4OA 1DQ8A 5J2QA 4ZVSB 1WC5A 3HCXA 1PC5A 3AO4A 2B9YA 4OJHA 1HQ2A 2Q79A 2KM8B 3C15B 4OZ0A 3MEEB 3D1QA 3QEXA 3MAHA 3G86A 4FLXA 4KYZA 1NGGA 4PKGA 5GAHU 1J54A 2VQFK 3LGMA 4DR1F 4N5SA 4DFMA 2C2EA 2QIFA 3T5HA 2D3OR 1NMDA 4UOCA 3PW5A 2NXEA 2BW2A 5D3GA 3MM9A 3GG1A 4NLQA 1CEZA 1JKHB 3NAIA 1QQNA 1WOPA 3AO1A 5AR0A 2F40A 4CNZA 3ISND 5DDQC 3VGVA 2YNFA 2HKEA 1PO6A 2GWJA 2DKOB 3UE2A 2HBYB 3I55N 1HYVA 1JMTA 2ZOGA 3B8HA 4J9QA 2OEMA 2F4VF 2KO1A 3TWZA 2Q1LA 4EGLA 2O4GA 3LPUA 1URRA 4X84A 4DL0C 3SMSA 4NX9A 4LSNA 3MEDB 1S1WA 2OPSA 2CDRB 1TFYA 2DRAA 3R8EA 4OZ1A 2RT3A 5EWEA 4PL8A 1N8RO 5KAKA 1E6VA 3EXYA 3EGWB 2XO7A 4GMKA 1X4GA 1V5IB 1UVMA 3SQ0A 1N4LA 2VPYB 2IY5B 3WNHA 1UAWA 2YCHA 3ZFVA 4J9OA 5IXUA 2NXUA 4O4GB 1Q16B 1OPZA 2MMYA 4EZ9A 3KZBA 2X1FA 1NPKA 3CEDA 4H0OA 3VF4A 4ECQA 1DGKN 1C0GA 3J81Y 1UVLA 2U2FA 3R1XA 1HRHA 1ZAVA 2BM1A 4OYWA 1NGBA 1IKWB 2QMXA 3ULDA 3UWTA 3NCIA 3JTOA 1JNRB 2PE8A 4KGXB 2QTWA 4WQ5A 1OY6A 4NA2A 2XNQA 3PKYA 2RD5C 1BISA 1Z25A 2KYXA 1YBTA 3WNEA 1RBRA 2LLZA 1IKXA 4MK9A 5EX5A 3MUTP 3DDKA 2PY5A 3BP8A 3I55S 1FDNA 3GFZA 1C4AA 1VQMN 1S9EA 2QG9B 2XM3A 5KFGA 1RNHA 3CXCM 3H2VE 4PYDA 2AWZA 4RW7B 3VPZA 1NGEA 4DL7A 2ZITA 1EQ0A 4OL8A 4ILLA 1XTZA 3I9V9 3BZCA 3VAMA 3AVMA 2RQKA 1Q78A 5KG6A 3FEZA 1LW0A 3OA9A 4JEPA 3TX0A 1AROP 4QR1A 4PQUB 5JVGL 4YEAA 3W2VB 2GJFA 5ELZA 3SAFA 2CQ3A 1FRLA 1GXTA 5F3TA 5IC4B 2XNRA 3QQCD 5IT9U 4IO1A 1BXNA 4W90B 2HMIB 1D8YA 2PD1A 2OSRA 4FYWB 4BRIA 4LF5K 1HKBA 4I67A 3D6TB 2LDYA 4G1PA 2B4UA 4WZMA 4WK1A 2UVVA 1VSLA 3SPYA 4OV1A 2YQ3A 2DGTA 2Z1IA 3FCWA 1UW4A 1U2VB 4FM2A 4TLQA 3DGVA 4JK9A 3ZCMA 1YVFA 2MQQA 3H5XA 2CWKA 3V9ZA 5SWMA 1AZSA 3GG4A 4OGCA 4FKXA 4QW9A 3LANA 4Z4GA 3LTOA 3IWNC 5CABA 3OSNA 4JAXA 4B1WB 3CCSN 2Q2RA 3ET6B 3AVLA 4RUHA 4F4WA 2DXDA 2FY8A 1ZTWA 2L9NA 2B9EA 1D9DA 5BRFA 2E2NA 4BG8A 2P9UA 3MM5B 3NGTA 5KT2A 4BVOA 3NNAA 2RUGA 2HHPA 3ZX2A 3NBPB 1VQMS 3PKMA 3EX7B 3P49B 2W1BA 2VONA 3BM7A 3IRXB 3V9SA 1F21A 1RAFB 2HWHA 3M2RA 3NF6A 1FFWB 2MKKA 1K8KB 1XNQJ 6FDRA 2AYGA 5AE2A 5SUHA 2J0WA 3Q8YA 2LQ9A 2MEWA 4FWSA 3TI0A 2B6AA 2LYVA 2NPFA 2M0GB 4O3RA 3QICA 9ATCB 4BRPA 4CLPA 4DV7J 2FC9A 1H2VZ 1GMUA 4EU0A 3OW2M 1VK3A 2J8AA 3R5JB 2BV3A 2HFSA 3QNWB 2BYCA 5IZHA 2QI2A 5JVHQ 2D3ZA 1DTQA 4U9RA 4RUBA 5KFIA 3E01A 2XMKA 3MN6A 1S1TB 1HWJA 1BO5O 5BN9A 3VQ4A 1NNEA 1S0VA 4DR5<