1LW2A

Crystal structure of t215y mutant hiv-1 reverse transcriptase in complex with 1051u91
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
539
structure length
518
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFARKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLYTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
publication title Crystal structures of Zidovudine- or Lamivudine-resistant human immunodeficiency virus type 1 reverse transcriptases containing mutations at codons 41, 184, and 215.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 141
structure length 518
sequence length 539
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2002-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1lw2A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lw2A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lw2A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lw2A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1lw2A05
5KTQA 4F3TA 3OLAA 3OL6A 3MECB 3JYTA 4I7FB 3IAYA 3LALA 3VA0A 4F50A 3E51A 3U3YA 4IDKA 4EO8A 3PW0A 5HRRA 1TGOA 3FFIA 2QKKA 4CERA 1YVFA 2X6NA 3L8BA 5T14A 3LZJA 4WZQA 2XGPA 3BREA 3O3HA 3AVNA 3SV4A 2W8KA 2FC0A 4LY7A 3TARA 5JS1A 4RW4B 3D5MA 3OYNA 1NK8A 4H4MB 2HHQA 3T5KA 2J6UA 4FXDA 1TV6A 4JS4A 4RW6A 2IJNA 2VWJA 2GBZA 3AO1A 3VQEA 4AHVA 3GILA 4TYAA 4DLEA 4ZVFA 4IOBA 4O3OA 1ZTWA 2V4QA 1GOBA 3NCIA 2BRLA 1ZBUA 4B3OA 4IR1A 5KFOA 1TP7A 4WZMA 3HXMA 4I2PA 1D8YA 5CYQB 1NKEA 3KD5E 4ZVEA 4IRCA 2Z1GA 4KHNA 1TL3A 3CJ2A 4FZXC 2UUWA 1REVB 1XR5A 3LZIA 4TN2A 3N6LA 4DTMA 5HRNA 5KG1A 4CJTA 4KTQA 4DL6A 3QIPA 3CDWA 3DRPA 3HYFA 2RDJA 3LP0A 3DRSA 4E19A 1VSJA 2HHVA 3RAQA 1HMVA 4NLOA 3HVTA 3KLGA 3TQ1A 4I9LA 1A5VA 4M3RA 4B9SA 2JGUA 1YT3A 2ASDA 4R0EA 5DLFA 2R2SA 2AGOA 1ZBHA 2B5JA 1Z26A 4C8MA 4ED8A 4NLQA 2FJVA 5I3UB 4RNOA 2C2DA 4IR9A 4K4SA 1BI4A 2XY8A 3I8DA 4ZTJA 3ZCMA 2VA3A 3IN5A 4DL2A 5F8NA 3V1QA 5SZTA 1KVCA 3M8PA 2BANB 2C2EA 1UWBA 4LH5A 3NKYA 2KW4A 1IG9A 3KTQA 3BR9A 4C8NA 4DQSA 4NLXA 1EX4A 1FXXA 2D41A 2CKWA 5KFPA 4WXOA 4O5BA 4MIAA 5HROA 3IS9B 1JLAB 1JLCA 4Z4GA 1CSJA 4W5QA 1U48A 2IGIA 4FJXA 4ZPBA 1J5OB 4NLRA 1TKZA 3VN5A 2YKNA 4DQQA 3KLEA 3GYNA 3QGIA 1UA1A 5DQHA 2YNHB 5HRSA 1LW0B 4Q43A 3HL8A 4ID5B 4PWDB 3OS1A 3AVGA 1KTQA 4TQSA 1BISA 4RU9A 2YHBA 3SI6A 4FJHA 1RBTA 4E1MA 2W7PA 2P51A 3TI0A 3LWMA 3BQ1A 4Q44A 4CGHA 1FKOA 3TAGA 4CFAA 1O1WA 4ID1A 3ZSWA 4O4RA 3OL9A 1RTIA 2WRMA 1C0MA 3SUOA 5FROA 4ZP8A 4U7CA 3MR6A 2VG5B 1TVRB 3G0ZA 4CEBA 4YNQA 4ZTFA 1NK7A 2ASLA 2BE2B 5C25A 3H5YA 1VSDA 4BE2A 4IFVA 5D3GA 5J1EB 4O44A 3UDLA 4G1QB 4CJ4A 3U6FA 1B92A 4CEEA 4CF1A 3HT3A 1N56A 4R5PB 2JC1A 3THVA 4KHUA 3CFRA 4CJVA 3NH0A 3DYAA 3DOLB 3DMJA 3Q8RB 3H4DA 2I5JB 1S1VB 4ZVHA 3TAFA 1HQUB 4FLTA 5KFNA 1VRTB 4KE5A 3SUNA 5KT4A 3GV5B 3CFOA 1WSFA 1LAVA 1ZBLA 3ISND 5K14A 3DLRA 3OYLA 1XC9A 4FZZA 2HHXA 3RR8A 1RT2A 1T05A 1D9DA 1RT6B 3ULDA 4AH9A 3KMQA 2IM3A 4Q8FA 3RAXA 3E01B 4YMEA 2IS3A 4J2DA 2OPQB 1RT7B 4O0JA 2AJQA 3SYZA 1XR6A 2J6SA 3N6MA 4HUEA 2WONB 5J2PA 2Z1JA 5DG9A 1ITGA 2V9WA 2AX0A 4B08A 3V9ZA 2OPSB 4DTUA 1KSPA 3A2FA 3OS0A 3SPYA 4QW9A 3CDUA 4DL7A 2Y1IA 1FK9B 1BQMB 4RW7B 5L1KA 2E4LA 3LP2B 1BL3A 4CEQA 3ZT4A 4FJIA 4FK2A 4FCYA 3SQ0A 4GW6A 2YHAA 2PY5A 4B9TA 2ASJA 1WNSA 4DFPA 1XHXA 5C42B 4DL3A 3SQ4A 4FLVA 1SUQB 1VSLA 5HLFB 4ECXA 5KT3A 3LP3A 1S9FA 3SFUA 4XIUA 5HP1A 3O3GA 4EEYA 3KK1A 2VA2A 3DM2A 4H4MA 3F9KA 3T1AA 4BDYA 4XO0A 2A1RA 1MU2B 1RYSA 4RNNA 4WFXA 2IA6A 2E9RX 4OLAA 1LW2B 3NFAA 4KKOA 4KB7A 3BSNA 4LSNB 4NLTA 4CHYA 3MAQA 3S3NA 3TAMB 5KFMA 3QZ7A 3FRZA 3QEPA 3ZSRA 2AU0A 3NDKA 1HRHA 4ECUA 3KNAA 4JRQA 4KB1A 1RT5B 4URQU 3ICLA 1SKRA 1NOYA 3MEDA 3VA3A 3M9MB 1QTMA 3HVWA 5J2QB 2ZE2A 3NGYA 1CLQA 2F96A 3V9XA 3C6TB 4CJ5A 2HNYB 4M3TA 3OYAA 2P5OA 2HNDB 2VG6B 4DL4A 4MKAA 3NGIA 1T8EA 4DTOA 4KAZA 3T5HA 4Y3CA 4O3SA 3JSMA 2E6MA 4KHMA 2OPPA 3KHGA 5KFXA 3OVNA 1C1BB 4TXSA 3NF9A 3RBDA 3SV3A 2YKMA 4FVMA 5FDLB 3K5MA 3AVCA 3QGHA 2PZSA 5I3UA 3DI6A 3LANA 1YTUA 4WXWA 3MEGA 1S97A 4QCLA 5DG8A 4CESA 1N48A 4OKEA 1NK4A 3HPHA 4F4WA 2HVIA 2HHWA 4JLHA 4CIFA 3IG1A 4B8AB 3KIOA 5L1IA 1EP4A 4ZP7A 3WNFA 3IS9A 2XY6A 4JV2A 4ECVA 3GIKA 1KFDA 1T94A 3HSTB 4XPCA 1J5OA 4J9NA 5KFQA 2OA8A 3RRGA 1S10A 4CGDA 1ASWA 2RDIA 4ZP9A 2WOMB 4DWIA 1T03B 4CK1A 1X9MA 4PWDA 3PJXA 4EBEA 2YNGB 5KFRA 4HTUA 5HBMB 4WFZA 3DLKA 5C24B 3MXJA 3V4IB 4YR2A 4O3RA 1C2PA 3OYKA 3L2WA 2RKIA 2NUBA 3QESA 2OZMA 1DLOB 4H8KA 1FKPA 1XHZA 3CVKA 4RW9B 3CWJA 3KK3B 3KLHB 3GV7B 4RUCA 4EZ9A 5EWGA 3KJVA 2BQ3A 4LH4A 2VG5A 1TVRA 1S9EB 1UOCA 4CJUA 1IKVB 1HYVA 3LAKA 4LSLB 3HPOA 3G6XA 2W9BB 4I2QB 4PY5A 5KFFA 1NNDA 3NMAA 4KHRA 2R7YA 2DFHA 2IAJA 3SZ2A 4R5PA 1D0EA 2FBYA 5KRSA 1YTAA 4E7LA 1Q8IA 4FLYA 2G8UA 3LWLA 3TAPA 3OS2A 5DQGA 1DTTA 3DOLA 3KKSA 4NLGA 5KG6A 4DU4A 4TSXA 3S9HA 4R8UB 4IRKA 3MXIA 1U04A 3H59A 1U45A 2Z1HA 3PX4A 3ZSYA 4GMJB 4CECA 5F8IA 4Y2CA 1LWEB 4KB0A 4KAIA 4DQPA 4CK3A 1RDRA 3C6UA 3SUQA 3M8QB 4J9SA 1JLBB 2B4JA 1JL2A 2FLPA 1XR7A 4HYKA 1RT6A 4Y2AA 1SL2A 3E01A 3TANA 3RMBA 2YNIB 5KFKA 2OPQA 1RT7A 4U6PA 4XPEA 4IQXA 1LWCB 3DOKA 3VQ5A 2WONA 2PYLA 3SI8A 1BCOA 4DTPA 4CFCA 1I6JA 4QWDA 3QNOA 4IH6A 1X9WA 1FK9A 5I42B 1BQMA 1F21A 4RW7A 2IC3B 1S49A 2HMIB 5KI6A 5DMRA 4LQ3A 3F73A 4DQIA 4FM0A 2O4GA 5KFIA 4ED1A 3OHAA 1EETB 5C42A 2BQUA 1NJYA 1SUQA 2D7SA 4NLDA 4PUOA 4BE1A 3KLIB 5L1JA 3CJ5A 1RT4B 1TKTA 2R8GA 2YNFB 4B9NA 3L2UA 1GX6A 4ZVGA 3K5LA 4FM2A 1RBUA 1MMLA 1LW2A 4CJKA 3HVAA 4I9QA 1YVUA 1RDBA 3BGRA 4KHSA 2KZZA 3MR3A 3PO4A 3V9UA 2ILYA 3K5OA 4IBNA 3DLEA 2JEIA 4ICLA 2A1SA 4F4XA 2HNZB 4Q8EA 3KMSA 4CJWA 1NK6A 1RT5A 4CHNA 3QYYA 4FJGA 1QAIA 3VQ6A 3TVKA 4CFDA 3C6TA 1SV5B 3I0SB 4ZHRB 3GQCA 3ITHB 2W42A 2VG6A 3PZPA 3H5UA 3RB0A 1U49A 2EX3A 3RMAA 5DLGA 5L1LA 4CGIA 1UA0A 3AVIA 1C1BA 1NHUA 2KQ2A 1HYZA 1N6QB 1ASUA 4WYWA 5EDWA 4O4GB 2AX1A 3RMCA 2EC0A 3PW4A 5FDLA 4Y34A 4CF9A 1BCMA 4RUAA 4HKQA 5CZ2A 4JUZA 1S6PB 4M42A 1UAXA 3H98A 4CIGA 2V0NA 4IRDA 1JLEB 5KG5A 4ECYA 3HK2A 2JEGA 1RTJA 5J2MA 4Q45A 3I0RB 1RT1B 2Y1JA 2BDPA 2E6LA 4MQ3A 3LP1B 4CEOA 4KREA 1S1TA 2X6SA 4J9QA 4JV1A 2D5RA 3P5JA 5KFCA 2HHTA 3GIMA 4CGFA 4CGJA 4EP4A 4F3OA 4Z4CA 1IH7A 3OL7A 3AO2A 3H4BA 4MK7A 4BDZA 3ZT0A 4JV0A 3V6KA 1TAUA 3RRHA 3GIJA 3AVBA 1JLQA 1CZ9A 3QZ8A 2UVRA 3AVJA 2WOMA 1S4FA 4DS5A 2R2TA 3AVFA 3C94A 3AA3A 3Q8QB 2YNGA 3KOAA 3OY9A 5C24A 3NGDA 4B9UA 4IH7A 3V4IA 4RZRA 4O3NA 2XC9A 2FBTA 2I1RA 2VG7A 3DLBA 1RBSA 3C95A 4DG1B 3CO9A 3KK3A 4FK0A 3KLHA 1K1QA 3SQ2A 1KHVA 4ECZA 2ZQBA 4CEAA 4Q0BA 2G8HA 2ALZA 2OZSA 3NHGA 1OS5A 4DU1A 5KT6A 3G6VA 3VQCA 1S1XA 1NKBA 4QWAA 1BQNA 3MEEB 2R8JA 2W9AA 4I2QA 5DK5A 4E7IA 4CEFA 5E41A 2UVWA 3OJUA 4ELTA 2JC0A 3MFHA 3UR0A 4FJNA 1RTHA 3NBPA 4URSA 3DDKA 4ED3A 1S9GA 1WSJA 3WNGA 2OH2A 3UQSA 3GIIA 2UUTA 4PQUA 1KRPA 1VK0A 3B6PA 5J2NB 4R8UA 4M3XA 2WK4A 4Z4HA 3AV9A 3K2PA 2XCPA 3EZUA 4K4ZA 4DSIA 2GC8A 3FDSA 1ZYQA 3DRRB 4F8RA 1JIHA 1JXEA 4B9VA 4ED2A 4OKJA 4CHZA 4GC7A 1N5YB 3PVXA 3TWHA 4TQRA 3M8QA 5F9NA 5KT5A 1ZETA 1S6QB 2W9CA 1VRUB 1Z4UA 3WNEA 2YNIA 3MXMA 4DEZA 1HQEB 1BHLA 2XRIA 1LWCA 2GIQA 3ZT3A 4KI6A 4K4VA 2F8SA 3T19A 4E1NA 2IM0A 4BDPA 4M94A 4HUGA 1HJRA 1IKWB 1KVBA 3VQ7A 3QEVA 4W5TA 1RA7A 1RA6A 2HMIA 3SPZA 4DSJA 4FW1A 5JXSA 3S3MA 1VSIA 3MECA 3QEIA 2O5DA 1A5XA 1WSGA 4J2AA 2XI3A 4I7FA 3NF7A 4QOZB 1EETA 2LSNA 3BJYA 3S3OA 3G86A 3QIDA 4RW8B 3BSOA 1S1UB 4DTRA 1NK5A 4FZYA 4KRFA 1RT4A 4ECTA 4F4ZA 1VSFA 1KCFA 1W9HA 5KFTA 3V81B 1RTDB 4F2RA 4ED0A 4CJRA 3TAEA 4RW4A 4OL8A 4MFBB 4KTZA 4BWJA 4CEDA 3BQ2A 1VSEA 1S1WB 4MIBA 4Z0UA 3PJWA 3Q8PB 1G15A 4IDKB 2GUIA 1RBVA 4BACA 3IGNA 4J2BA 2XWYA 4ECWA 1NJXA 5CYQA 2DPIA 2HHUA 2IBKA 4E3SA 3I0SA 4ZHRA 3FQLA 3BSCA 4DMNA 3ITHA 1REVA 5KFBA 3CG7A 4WFYA 5KFHA 1X9SA 1JL1A 4NLYA 4H4OB 4NYFA 4E7JA 1N6QA 3OYHA 2R8KA 4O4GA 4FM1A 1WSHA 1TKXB 3SJJA 2ATQA 4HCCA 3OYMA 3CJ0A 1TL1B 2G8FA 1S6PA 3KK2B 1S0MA 4AHUA 4I2PB 2FVRA 1QSLA 3NF8A 3NL0A 3KKRA 1JLEA 1S0NA 4NRUA 1D1UA 2IJFA 2ATLA 3ZSXA 2WTFA 3I0RA 1L5UA 1RT1A 3VQAA 4FJ9A 4IKAA 3LP1A 4NLWA 3WNHA 2E9ZA 5KG2A 1GOCA 1L3UA 5KFGA 4NCAA 1C1CB 4LQ9A 1L3VA 3U3GA 3SFGA 2BANA 4O0IA 4FW2A 4AILC 4RNMA 3IGVA 4NYZA 1XI1A 1RDAA 1HMVB 4NZ0A 1RYRA 4J9OA 4YFUA 1JLAA 4KSEB 3MF5A 4OJRA 4RNHA 3AA2A 4FJ8A 1QQCA 1BI4B 4ELVA 2B6AB 5KFUA 3EPIA 3HO1A 1ZTTA 4FJ7A 2IDOA 3H08A 4BE0A 2AGPA 3P1GA 1VSHA 2YNHA 2GIRA 2OPRB 1LW0A 1UWBB 5KFYA 2HB5A 4ID5A 2IMWP 4ED6A 4URGA 3VQQA 4RG8A 3PR4A 2EHGA 3AA4A 5JS2A 4M95A 5KG4A 2FBVA 1JKHB 2RF2B 2CJQA 4CJQA 3VQ4A 3MEEA 2DY4A 3RBEA 1TKZB 3OYIA 1LAWA 1S48A 2ETJA 2G8IA 3BSAA 3V1OA 3NF6A 4DTSA 4CJEA 2BE2A 4Z4EA 1QUVA 1NK9A 1Z25A 5J1EA 2R8HA 1SL0A 2RN2A 3ZSQA 4G1QA 3D28A 5J2NA 2X74A 4DFMA 3QLHB 4FLWA 3HKWA 3V9SA 3NE6A 4FBTA 4EYHB 3ASMA 3DRRA 1B9FA 1IKYB 5EWFA 4NCBA 1HPZB 2I5JA 3CFPA 5SWMA 1S1VA 3CM6A 5KFSA 2XCAA 1HQUA 4FLXA 3PUFA 4OKKA 2QK9A 3DLGB 1S6QA 1VRTA 3PO5A 4IFVB 1SH3A 3AVAA 1VRUA 2W7OA 3QO9B 3CDEA 3PY8A 4O44B 4ZP6A 3QIOA 1HQEA 1QE1B 2JEJA 4C8LA 3EYZA 5KGWA 1HYSB 4PA1A 2D0CA 3QGGA 4FJ5A 3DYAB 4DTNA 2ZD1B 1L3TA 5KG3A 1WAJA 3K5NA 2G8KA 2FVPA 4X2BA 3CQ8A 4FBUA 2YV0X 2D0AA 2IOCA 3N6NA 2W8LA 2OPSA 4W5RA 4TY9A 1QAJA 1C0UB 5KFJA 1S0OA 3KLFB 4FK4A 2D3ZA 3H40A 3LP2A 3LPUA 4O55A 3QEXA 1RT3B 1HNIB 1R0AB 3EPGA 3V81A 4HCBA 5HLFA 1JLGB 1NOZA 4ZMMA 4MFBA 4K8XA 1KFSA 2OYQA 3ALYA 5J2PB 1S1WA 2HW3A 4WE1B 1MU2A 4J9MA 1C0TB 2FJXA 1RAJA 1HNVB 4FLZA 4LSNA 4N5SA 3PX6A 3TAMA 1DTQB 4J9RA 2VWKA 3G6YA 1SL1A 3HHKA 4IFYB 3HJFA 4IG3B 2BGGA 4AHRA 3G10A 4KV8B 5KFAA 3RB3A 4ZPCA 4KPYA 3T5LA 1Y97A 4MK8A 3K57A 3RB6A 5HP1B 2KZMA 3KK1B 4NLUA 2DPJA 3DM2B 4G3IA 1JXBA 1WAFA 4IG0B 2X78A 3O4QA 5J2QA 4H4OA 5KGXA 5KG7A 3NH1A 3K58A 1WSIA 3CM5A 5FRNA 2HNYA 4KKOB 4ZPAA 2HNDA 3QNNA 1TKXA 4NRTA 4L8RB 4KI4A 3NGZA 4K4XA 1U47A 4CJFA 5F8MA 2XY5A 4KHWA 1TL1A 4DU3A 3KK2A 5EU7A 5F8LA 1T7PA 5KRTA 2FBXA 1VSMA 3CJ4A 3KLVA 4B9MA 3D0PA 3O3FA 2XHBA 3NAHA 1IO2A 3MTKA 3MEDB 1RILA 1I39A 2ZE2B 3QERA 1C1CA 3ZSZA 3OL8A 5DQIA 3RR7A 4NCGB 4IH5A 2XGQA 4QPXA 1LWFB 4N41A 2XO7A 3DLHA 4TY8B 3JSMB 5CYMB 3OSPA 4M45A 2WB4A 2OPPB 1SH0A 1SKWA 4QAGA 4E7KA 1LV5A 4CF0A 4DLGA 1RDCA 2YKMB 1BIUA 5HRPA 3QETA 2G8WA 3OHBA 3RTVA 2Z1IA 1XWLA 4MKBA 3AA5X 3DI6B 4DSFA 3MEGB 1TAQA 2B6AA 2BRKA 1RDDA 4J9LA 1W25A 3VQPA 3M9NB 3PX0A 1K6YA 4B8CA 3V6JA 1BIZA 2OPRA 2KFNA 1T03A 4KFBB 1CZBA 3LAMA 3IG1B 3M8RA 3OLBA 3T3FA 3IRXB 5HBMA 2O4IA 1EP4B 3VQDA 4FJLA 2R2RA 1NHVA 5C5JA 1KHWA 1JKHA 4C8KA 2RF2A 4OLBA 4N56A 4FJMA 1DLOA 3B6OA 1JLFB 4M3YA 4RW9A 4CJPA 2PYJA 2QKBA 4CCHA 1TK8A 4DQRA 1K1SA 2J6TA 1CXQA 2GV9A 1U09A 1S9EA 1KLMB 2DFFA 4FS2A 1IKVA 3PHEA 1ASVA 4DSLA 1EXQA 4W5NA 4LSLA 3OYGA 2W9BA 1TKDA 4BWMA 2QXFA 4NLVA 1A5WA 4M41A 4YP3A 3DLKB 3OYCA 3SNNA 3QLHA 4NYNA 4CK2A 4JS5A 4KO0B 1WN7A 2D3UA 2RKIB 3QEWA 1CXUA 3PV8A 1FKPB 1EKEA 1IKYA 1HPZA 1GX5A 2F8TA 2JEFA 2BQRA 3V6DB 3KJVB 4CHQA 3HM9A 3VQSA 4FJJA 3O4NA 3ZSOA 5KG0A 3DLGA 4KTWA 1LWEA 3QO9A 4E89A 1T3NA 4CE9A 1QE1A 1NJZA 3H2LA 2IAJB 1W0HA 1HYSA 1JLBA 1QS4A 4K4WA 4CHOA 4J9PA 2HWHA 3D45A 3V1RA 1SKSA 4DFJA 3KHLA 3HP6A 4B9LA 1DTTB 2ZD1A 2ITGA 1BGXT 2FVCA 2DTUA 3AO3A 5KT2A 2RPIA 4AHSA 1WSEA 3P83D 2JLEA 3L2VA 2ILZA 4O3PA 5KFDA 4M3ZA 4DSKA 3RMDA 3PW5A 1C0UA 5KT7A 3KD1E 2R8IA 3HVRA 3MR2A 3KLFA 4K4UA 4Y1CA 4AHTA 5I42A 1IM4A 2IM1A 1WNEA 1KLNA 2IC3A 4Z4FA 2UVUA 1RBRA 3C6UB 4ELUA 3QINA 1IKXB 2DFEA 3OYJA 3LPTA 5CZ1A 2HHSA 3SUPA 1RT3A 1J9AA 3AVKA 3FSIA 1HNIA 4EO6A 4CJ3A 1R0AA 1HARA 4QWEA 3PW7A 1JLGA 3KLIA 4F4YA 3L2RA 4OGCA 4EP5A 2YNFA 3DOKB 4WE1A 4F2SA 4QWBA 2WCXA 1C0TA 1C1AA 4KHYA 3AO4A 3OYFA 1HNVA 4CJLA 1DTQA 2IM2A 3OYBA 1TK5A 5T7BA 2P1JA 4IFYA 4CF2A 4IG3A 4KBIA 5EUHA 2HWIA 3JYTB 4WYLA 1X1PA 4KV8A 2C28A 2QV6A 2FJWA 4EZ6A 2HNZA 4PUOB 2Q3SA 3T5JA 4Y1DA 4DFKA 3FFIB 1NK0A 1TKTB 3NAEA 3MR5A 4IG0A 4DF4A 2C2RA 1SV5A 3I5BA 1J53A 4QWCA 3BGRB 4CIEA 3I5AA 1ZBFA 1QSSA 5F8HA 1JX4A 2WHOA 4EBCA 3AVLA 1TV6B 4DTJA 4EYIB 4CF8A 4RW6B 4H54A 3NAIA 3DLEB 4E0DA 4ICLB 4OGEA 3TAQA 4OPKA 1S5JA 1RCHA 3ZSVA 3M8SA 2HAIA 2XI2A 3K59A 4F4KA 4QW8A 2AQ4A 4B3OB 1L3SA 4CJSA 4E7HA 4CFBA 1TK0A 3RWUA 4MK9A 2FVQA 3BDPA 4J2EA 4NCGA 1TL3B 1LWFA 4UQGA 4AHCA 1NJWA 4TY8A 5CYMA 1B9DA 2KFZA 3CYMA 3QIPB 3DRPB 3LP0B 3L2QA 5F9LA 2C22A 4DS4A 3DRSB 1J54A 4K8ZA 3OJSA 1QHTA 5KFWA 2AGQA 3HVTB 5KFZA 3KLGB 2P5GA 3OSNA 3H5SA 1NKCA 3TR8A 4DTXA 2B5JB 4ZPDA 4YR0A 1WLJA 1RTJB 5J2MB 3CIZA 1KVAA 4KFBA 4J9KA 4OVLA 3MFIA 5F8JA 3I5CA 2HVHA 2QE5A 1S1TB 3IRXA 4MH8A 3V9WA 3PR5B 3H5XA 4IKFA 1TQLA 3M8PB 4DSEA 1JLFA 3VQ8A 4GVMA 5CY4A 3RB4A 4DG1A 3Q8SB 5DG7A 4NLPA 4HHTA 5HROB 4KHQA 1JLCB 1KLMA 5L9XA 3ISNC 2ZKUA 4LD0A 3VQ9A 1JLQB 3OYEA 3ZT1A 3TABA 1SH2A 3L3UA 1JXLA 4FJKA 4JRPA 2V4RA 2YKNB 3AO5A 2FLLA 3BQ0A 3KLEB 1QSYA 3UIQA 4KO0A 4TYBA 4EBDA 2B43A 1RNHA 3EY1A 4K4YA 2VG7B 2UVVA 3AVHA 4GC6A 4C8OA 5FRMA 4M3UA 3AVMA 3OYDA 1FKOB 3V6DA 4Q0BB 4K4TA 3LDSA 4Q5VA 5EWEA 2AWZA 2F8EX 4ECSA 1S1XB 3EZ5A 3UPFA 1BQNB 4CEZA 4FLUA 4CGGA 1RTIB 2E9TA 1Q9XA 4W5OA 4ECRA 2KTQA 4K50A 1N5YA 4DL5A 4M3WA 2D0BA 3FQKA 3V6HA 1Q9YA 1RTHB 3NBPB 4ED7A 5C25B 5KFLA 3M9OB 5D3GB 4CHPA 1S9GB 4HUFA 3KHRA 4Z4IA 3SCXA 4PQUB 2FVSA 2R2UA 3VQBA 3L3VA 4FS1A 4NLSA 5KFEA 5JUMA 1N4LA 2G8VA 1C6VA 3DMJB 1IKWA 5DGBA 3KHHA 4O3QA 5DGAA 4FYDA 1U4BA 1IKXA 4N47A 4ECQA 4RNFA 1D9FA 4HVJA 2XY7A 3GV8B 2BR0A 1I3AA 3HP9A 2W9CB 3ZT2A 2FLNA 3CJ3A 5KFVA 1ZBIA 3SQ1A 4YR3A 4RW8A 4N76A 1GOAA 1S1UA 1VSKA 4TLRA 1D5AA 4OPJA 5K14B 3NH2A 4YQWA 1RT2B 1T05B 3HPGA 5F8GA 1RTDA 4DF8A 3PW2A
chains in the Genus database with same CATH superfamily
5AT1B 1IWGA 4PAAA 1BXNA 5KTQA 2Z2LA 2HSEB 4OV6A 4MYTA 1C4AA 3HFVA 1H7XA 3DKDA 3GL1A 1M1KO 4JKDA 2YWHA 3VA0A 4OX8A 4ZJLA 5B0CA 4IDKA 4EO8A 4RO0A 5C2FA 3GCXP 2GVDB 5HRRA 4A48A 5ETOA 1YVFA 2IVOA 1YI2S 2W01A 3L8BA 1XIQA 8ATCB 2XGPA 4LY7A 5DRKA 2CZ9A 1WF0A 3OYNA 2BYCA 3HCXA 1TL5A 3MWBA 1NK8A 3T5KA 2XO6A 1B4SA 2IJNA 3BH7B 2GBZA 4CRJA 1U6ZA 4JI8K 4YOYA 4ZVFA 3E3XA 4XAKA 4OZJA 3TO8A 2MKIA 1VQSA 3JQJA 2XLJA 2VKRA 1YHQS 4B3OA 2GJFA 5DDOC 1J5EK 3KK7A 2Q43A 4IO9L 4ZVEA 3FZHA 5MAOA 5D77A 1TL3A 4KHNA 4FZXC 2UUWA 4H5RA 4YOUA 1K73T 4DX6A 1FRKA 5HRNA 5EN1A 3M2RB 4DL6A 4DXLA 4BC4A 3DRPA 4LT6A 4FYVB 2IFXA 5ETMA 4DR4K 2YJEA 2V7ZA 2FB0A 3BB5A 1VSJA 2F4VK 1HMVA 4NLOA 2J0QD 3CCJN 2M9KA 4I9LA 1A5VA 4M3RA 2MZJA 2ASDA 2B5JA 4C8MA 1SPBP 3X1LB 1RWNB 5I3UB 2XY8A 4A2AA 3ZCMA 1DBDA 1HHSA 2KG0A 4N77A 4ILRA 4DBQA 3G8TA 2WVEA 3C15B 2C2EA 4B1WB 2HHHJ 3AQOA 3BR9A 2E2OA 1W26A 4DQSA 2D41A 1RAAB 4MIAA 1RGVA 3ZX0A 4Z4GA 5AQOA 1VOMA 3D6RA 4ZPBA 4NLRA 4IYQA 5B0BA 3A5LC 3VN5A 2CG4A 3IXQA 4XEIA 1FTCA 1QVFR 3QGIA 1UA1A 5DQHA 5FLXU 1YITS 1U7LA 4MJKA 5ADXA 2CGLA 2OTJS 4QIWD 4FYWB 1Y00A 1UJ5A 2C3OA 1KVIA 2P51A 1NH7A 1HD1A 3TI0A 3LWMA 2QL9B 4Q44A 3TAGA 3BS9A 1G7CB 2LDIA 2VC0A 2ZUGA 3R6GB 1RTIA 2WRMA 1TFWA 1C0MA 2VQEF 3SUOA 2I6WA 3HHEA 3CE8A 3IR6B 4ZP8A 4U7CA 3MR6A 2VG5B 1TVRB 3DN9A 4BVPA 1KBRA 4E1JA 4BE2A 4IFVA 5D3GA 5J1EB 1XMOK 1M5KC 1LK7A 3POTB 4CJ4A 3D2FA 4CF1A 3OTBA 1X60A 1KQSR 2HIYA 4ZVHA 1YLXA 2DB1A 2EFPA 2OSQA 3SUNA 4DV3J 5KT4A 3GV5B 3CCLN 1WHVA 7AT1B 2ZFHA 1Y0HA 5K14A 3WZ0A 2Y8YA 3DLRA 2ITMA 2HHPA 3CULA 2HHXA 2VONA 1P1LA 3J7AP 1RT2A 1XMQK 4AH9A 4B3MF 4YMEA 4J2DA 4HACA 1P1TA 3QAUA 4JI4J 3N6MA 4HUEA 2WONB 3AJ2A 1ITGA 1CJTA 5EVZA 3V9ZA 3WXIA 4QW9A 3L7UA 3CDUA 4DL7A 2IRXA 3I33A 2DR9A 2E4LA 3LP2B 1XK8A 3U02A 1BL3A 2KYXA 2HQGA 4OYBA 1N33J 3SQ0A 2A2CA 2YHAA 3ZYYX 2OELA 2PY5A 1S7IA 1WNSA 2LQ8A 4X4UA 4DFPA 3SBGA 4U8YA 3SQ4A 1VSLA 5HLFB 2J7KA 2VQEK 5KT3A 4DX7A 1KAXA 3SFUA 2DNGA 4EEYA 3IKMA 2P9SB 3KK1A 4BRFA 2KXHA 2A1RA 2XMVA 4PL8A 5GMDA 4OLAA 1HLUA 1LW2B 4RL1A 4KB7A 3KUGA 4ZJQA 1K9MT 2EBGA 3BSNA 4LSNB 1HW9A 4FWOA 3S3NA 2JHEA 1M90O 3IA0A 5JICA 3J80U 2WSCC 2XMTA 2GWKA 4ZLNA 3PG9A 5ETRA 1P9YA 4BC7A 3NDKA 1HRHA 4ECUA 4X64J 4URQU 5GAGP 1SKRA 1V6HA 1V5VA 1QTMA 3M9MB 3OPKA 4I0WA 2F96A 1FXDA 2HNYB 4M3TA 4ED5A 2P5OA 2HNDB 2GFFA 2A3JA 4MKAA 3JSMA 1QQMA 1SC4B 3NF9A 4DCPB 3ZZPA 4B3MK 1J2VA 3QFHA 2H51B 3DI6A 3ENHA 1ZM4A 4CBWA 1S97A 3PKYA 1S72N 1WC0A 4IEIA 4OKEA 4ZCKA 3HPHA 2OMLA 1RGIA 5CA5A 3ZETB 1KDNA 2V8VA 2HVIA 3D7EO 3UCGA 1BHNA 3ZO7A 4EWTA 3AD7C 1O8BA 4PKHA 4JV2A 2HFOA 2ASYA 1GMVA 1HBOB 4DR1J 3H46O 1WI6A 1J5OA 4U67L 4J9NA 5KFQA 2HQCA 3ATUA 1SQGA 5JMVA 4CGDA 2A2DA 1R8BA 2AZ1A 2F3JA 1RJJA 4ZP9A 1DKGD 3NS7B 5AQXA 2Q6BA 3ZZOA 1X9MA 2LQBA 2YNGB 1SXLA 3MR7A 3J7YU 5C24B 2QJ3A 1F6TA 2E5HA 3Q8UA 3MXJA 2IRYA 4YR2A 4FWLA 4LRCA 1C2PA 4NEZA 1DQAA 4B1VA 1DLOB 3JAMO 3MMBA 5BRDA 4EHUA 1FKPA 1VQKS 1Q1KA 4EZ9A 2BQ3A 3A3PB 1S9EB 2QW9A 2PEBA 3AOBA 4LSLB 1ZA1B 3I9ZA 2W9BB 3NS6A 4PY5A 2NS1B 1X4BA 3SXLA 2BJ9A 5KFFA 3NMAA 4ILLA 1X4CA 3PDNA 2R7YA 2IAJA 1D0EA 5KRSA 1YTAA 3MOZA 1Q8IA 2G8UA 3LWLA 1WOPA 4R8UB 1FE4A 4PCQA 1JCGA 1HNZJ 2JVRA 4CECA 3FR0A 1ZAVA 2D69A 4KAIA 2W2OP 4CK3A 4GKKK 1YSJA 3VF6A 3SUQA 4QYRA 4J9SA 1JLBB 3HHLA 3D3BJ 4J5OA 3NWRA 2ZNYA 3E01A 2E2NA 1RAEB 2YNIB 4LF6K 2OPQA 3VTHA 4N8OA 3DOKA 4DB3A 3VQ5A 1OY6A 4C3LA 2A5XA 1N33F 4LF5F 5JLHA 4OYIA 5DM6Q 1FK9A 2IC3B 1S49A 2HMIB 4HL9A 2EWSA 4OJ1A 2X1BA 4FM0A 1G1XA 2O4GA 5KFIA 4ED1A 3OHAA 2BQUA 3CJBA 1U0HA 4PHTX 5LJVA 4BE1A 3KLIB 9ATCB 4YOXA 1DRZA 3OHRA 1RT4B 3S6EA 3LUYA 2ALYB 2N3OA 4ZVGA 4H03B 1FJEB 2WW4A 3DDIA 4CJKA 4YDXA 1FI4A 1YVUA 3R5DA 1VQNN 4KHSA 1S79A 1URNA 2LECA 4WQ5A 3PO4A 1IBMJ 2DNMA 1Q81T 1NZAA 3KG4A 4M1KA 4JV5K 3K5OA 4ZVTB 1RWUA 3TVZA 3DLEA 4EFAC 3QBWA 1R8HA 4MTPA 3THXA 5LSOA 3CC2N 4Q8EA 3QGPA 3LW5C 1X3MA 1Q53A 3EKSA 2Z56B 1OQ3A 1RWOB 2HG4A 3OVSA 2DGTA 2IYGA 4NXMK 1SV5B 3I0SB 3ITHB 2VG6A 3H3NO 4IDHA 2J4RA 3TR5A 1VQMS 1C1BA 1NHUA 5EDWA 5FDLA 4JHDA 4CF9A 2OMOA 1S6UA 4A4JA 2DHAA 1IVZA 4RUAA 1IWAA 4HKQA 2P9PB 3N01A 5CZ2A 1F3VA 2CWXA 2QZ8A 4LF5K 4CIGA 2CGJA 2QG9B 3K9JA 2E88A 4IRDA 1JLEB 5KG5A 3S1TA 1M5SA 2JEGA 5DJBA 1YJRA 3SAHA 5J2MA 3LTOA 4Q45A 3I0RB 2QWNA 1RT1B 2W25A 2Y1JA 2BDPA 1PC4A 4HVZA 2W41A 4CEOA 1WWHA 3FMBA 5AZIA 4J9QA 5KFCA 3SQGA 2V2KA 3GIMA 3K0JA 3W9HA 1H2TZ 1WKJA 3MM7A 4F3OA 5IWAJ 2HK3A 4DPOA 3OL7A 3QT8A 2E2PA 4BDZA 2X1FA 3ZT0A 3V6KA 1TAUA 3GIJA 3AVBA 1CZ9A 4FP9A 2UVRA 4DV2F 4JKBA 1SJRA 1S4FA 1NGDA 5AQTA 2MQQA 2R2TA 3R9PA 5B0AA 2Q2RA 4XH4A 3QBCA 2HVDA 3OY9A 1BDGA 4CNYA 4P2XA 3D6HB 4B9UA 4YDUC 4QIFA 4O3NA 1NU0A 2FBTA 2MSSA 2HBJA 1PSDA 4DG1B 2PIIA 3SQ2A 4Y00A 2G8HA 1WKLA 3NHGA 5KT6A 4DV4J 4QWAA 2E5IA 2XSJA 3C0BA 1WEZA 2ZOGA 2QWPA 1UEUA 1UJ4A 4CEFA 1G6BA 3OJUA 2WW8A 2C3MA 4DR7F 2W4DA 3MFHA 3SSRA 1RTHA 4CT9A 3UB5A 4URSA 2P9UA 3IBCB 5BPLA 1S9GA 2GW8A 1HNZF 1CPZA 1NBWA 1XNQK 4PQUA 1I51B 5J2NB 4A5AA 1IBKJ 4I69A 4G6VB 3L95X 1HBNA 3I8BA 1ZYQA 2Z2YB 1H73A 3NNHA 4C98A 2MGZA 3AHPA 2RUGA 1JIHA 1YJVA 4CLKA 1VQ8S 5BYQA 3MM8A 3PVXA 5HJYA 5HSPA 3M8QA 3BM7A 3CCQS 4Q2MA 2GA7A 1VR6A 2R42A 2W9CA 3VV2B 3ILLA 4HEA9 1UPMB 1HQEB 2XRIA 1SKUB 2P6TA 3IR7B 2LEPA 1YK9A 5AQIA 4KI6A 4L6V3 4DV2K 4L74A 2NNWA 2F8SA 5H9FJ 4M94A 4CLPA 1IKWB 2P9LA 2DEIA 1RA7A 2AEFA 4J9VA 4ATNA 1EB0A 1A5XA 4BHQA 2CUYA 4DQ8A 4WFBQ 2M4MA 3G86A 1XJWB 1AUDA 1NK5A 2BM0A 3CCES 4F4ZA 4ETZA 2CH6A 4OX9J 3TW0A 3O08A 2Q0UA 1IBMF 1UVJA 5C15A 1HW8A 2PE8A 1W9HA 3V81B 2NREA 4YORA 2HSTA 4OI1A 1RTDB 1CULB 4ZIVA 4OL8A 4B1ZA 4DR7K 4LREA 2XNRA 2NRZA 3EVMA 2RHSB 4PG7A 3PJWA 1GMWD 3Q8PB 3TX0A 1HNZK 1BWVA 3MN6A 1F5CA 2FQQB 4PXCA 3G71S 4U96A 2KRRA 1QLNA 3OR1A 1YGYA 5CYQA 1K44A 2IBKA 2DVIA 4DMNA 1HKCA 3ZTRA 2W4PA 3UDEA 1REVA 2B9YA 3LGNA 5KFBA 1RUSA 2XZWA 4WFYA 3JTPA 4ZS6A 3NCPA 4NLYA 2UU9F 4GO7X 5LJWA 4O4GA 3QSYB 4R79A 3GJQB 2MDAA 1TKXB 3R6LB 2ZHBA 2HFUA 2G8FA 1S6PA 4BR4A 1UZHA 3D1QA 3OA9A 3EDQB 8RUCA 1U1PA 3NL0A 3LO3A 3P96A 3A12A 1S0NA 2SXLA 5IC4B 4NRUA 2CRLA 3Q89A 3ZX3A 2UXBJ 2QC3A 2E9ZA 5KG2A 1L3UA 4DCHA 4LQ9A 1KS2A 1S59A 3OTCA 5IXUA 1BU6O 5IWAF 2E66A 3R27A 2YY3A 2BANA 4A57A 3VMFB 3VEWA 3IGVA 2JZ5A 3D6TB 2W2QP 3BKTA 2E1PA 2XYPB 4QS9A 4RKUC 2DNRA 3O3LA 4NZ0A 1FF2A 1JLAA 2C42A 3I87A 4LIRA 2BA9A 1NGAA 3C65A 3MF5A 4OJRA 2DH7A 2LQJA 2L48A 3NG8A 1VC0A 3MX2A 3TJ8A 2B6AB 5KFUA 3CW2C 2XTJP 3R1LA 3HO1A 5JVGQ 4BG8A 2VWBA 2FF6A 1YI2N 3SCLE 3IWLA 1AZSB 5HMYA 1LW0A 5KFYA 3AH6A 2HB5A 2CPDA 3UWTA 4N7TA 2E1MC 5JVHQ 2MPUA 1UVMA 4M95A 3OUYA 3ID8A 1S7HA 4LF9K 4NO7A 2XYHB 1IG8A 4V19J 2PEHA 1MNEA 1QAXA 2Z57B 2UU9K 1LKZA 4QS7A 3OXLA 4JKGA 3FVYA 1C4CA 3NF6A 4DTSA 4DR2J 1U1RA 3M8YA 1IBKF 1FVSA 2LXFA 1Z25A 1EZZB 1X4AA 1SL0A 4LF2A 2APOA 3GYXB 3VWSA 4NPOA 3ZSQA 4G1QA 5D4OA 2PBDA 4JI1J 1M1HA 3DRRA 2QLFB 3I96A 2UV8G 1IKYB 3H42A 1HPZB 3MEKA 2A0FB 5DM6L 1S1VA 3W8PA 2OEKA 3CIPA 5KFSA 1HQUA 4FLXA 2QK9A 5CHCB 3HD2A 2DRBA 1Q82T 1RDUA 5ETNA 3PY8A 4O44B 4ZP6A 4HT7A 3QIOA 1R31A 2PMWA 2KJVA 4C8LA 1HYSB 5KOWA 2H48B 3BN4A 3TNVA 4NEYA 1X3NA 2QFIA 4RBUA 3P4IA 3DYAB 1K0TA 5KG3A 2G8KA 3D66A 4Q7AA 3T9ZA 2YV0X 3N6NA 4KGZB 4G1IA 2MQNA 3VAFA 4O0NA 5KFJA 3BO2A 5BPMA 5BYSA 1XTZA 4CYUB 4OX9F 4UY8O 1QM9A 1XNRJ 3TU5A 3H40A 3FJ2A 1WF2A 4PG8A 1ZPWX 4CO5A 3O1WA 2YH0A 2MZRA 5AR0A 1RT3B 3ET6A 3RGIA 1HNIB 4CLUA 2IPOB 1V3RA 2RIJA 4DV5K 3EUNA 1RAIB 2BM1A 1YITN 2RU9A 4K8XA 3M05A 3A4TA 5J2PB 3THYA 2HW3A 2KO1A 2CQCA 2XMUA 1HNVB 2VH7A 3TAMA 1RAFB 2GNKA 4PXDA 1SL1A 3LOUA 4LBHA 3UKUA 2BGGA 3G10A 2AP6A 1Y4ZB 4ZPCA 3M2VB 2YHYA 3T5LA 2YHWA 4MK8A 5LMNJ 5H9EJ 5D8HB 2MZTA 1P6TA 2DPJA 3DM2B 1JXBA 3KWGA 5KG7A 2ZVIA 3GSDA 1ATRA 2J76E 3PRBA 2XM3A 3G8SA 3I32A 4KH0B 1AROP 5EXWA 3PYEA 3NGZA 3D1HA 1U47A 4JP8A 2XY5A 4KHWA 2NPIA 2HMPA 2NXEA 1PJ5A 2UXBF 1U1OA 1CVJA 2AKWB 1YAGA 1VC6A 3PTWA 4B9MA 2XHBA 3NAHA 1HKGA 3MTKA 1HBMA 5EY4A 4OYAA 5G4DA 2DT9A 2YWWA 5AQLA 1UEKA 2NZTA 2GHVC 1C1CA 1TMMA 1GEHA 3ZSZA 5DQIA 2HWTA 3FZLA 2ABYA 5DDQC 1WOSA 3A8EA 3I56N 3PEHA 2NLWA 2CPJA 3DLHA 4CO3A 4YOWA 3AODA 2WB4A 2OPPB 1YBUA 3QT5A 1SKWA 4QAGA 4DU7A 2OSRA 3B54A 1NM1A 4FPAA 1RDCA 1BIUA 4OZ2A 1ITPA 4MLEA 1J27A 1FDAA 1WKKA 4DV1F 1XWLA 3AA5X 2VJVA 4FKXA 3MEGB 1TAQA 2PA3A 1RDDA 5FPNA 2WC9A 4L76A 3IC1A 3PX0A 3Q7CA 4JYAF 4F4AA 4B8CA 3BEGB 2YWKA 1X4DA 1EWQA 2RUSA 1T03A 3VR1A 2EK6A 1FRMA 3IG1B 3M8RA 4DV6J 4C3KA 5AQVA 4L3QA 1TYQB 2E5JA 1EP4B 1YXQA 4CO1A 4I6MB 4K0KF 4I4BA 4C8KA 1WC3A 3HSGA 4DR2F 1JLFB 5LT5A 2ASMA 4CJPA 2FPHX 2QKBA 4P7TA 2BJDA 4DQRA 4CJ7A 3DC2A 2GV9A 5A8KB 5HANA 2DFFA 4FS2A 1RCOB 3OQ2A 5LSRA 1ASVA 1EXQA 1Q18A 2DCUB 1Y5LB 1NH8A 3RSEB 1FDNA 4BWMA 2QXFA 3DGPA 1A5WA 2FJAB 3RRKA 4YP3A 4JS5A 3G8QA 3ZLJA 3PYFA 2RKIB 4H4KC 3WT0A 1CXUA 3C7NB 4C1NK 3UDVA 4JNEA 1QZ6A 3KJVB 4CHQA 3G2XA 1NSPA 3AAWB 5HVFA 4CLTA 3DLGA 3LM2A 2HBMA 4DR5J 4OYMA 2WVBA 2HBKA 4WFBL 1QE1A 1WELA 3W63A 1HJOA 4MIWA 4DV1K 4NL5A 2HWHA 3D45A 2QL7B 3R1XA 4DFJA 2W2MP 3HP6A 4ZVUB 2VV5A 1DTTB 2Y8WA 2DTUA 3OTDA 2GO8A 1XNRF 4JYAK 2DNZA 3PW5A 1VQ6S 1OPIA 1C0UA 3MR2A 3KLFA 2BUPA 5I42A 2EVZA 3I31A 2UVUA 4ELUA 4K0KK 1IKXB 3F2KA 3OYJA 3LPTA 4U7UK 2H5JB 4CJ3A 3SCJE 3WQUA 1R0AA 1FWPA 1U1NA 1V4SA 2WBRA 3CDBA 4DUZK 3NEKA 3L2RA 1PBUA 4EP5A 5JJBA 2YNFA 2NUUG 4JI7J 4WE1A 2WCXA 3BBFA 4NZ6A 4PPDA 1EWRA 3O8MA 5ITHA 3FZFA 2W4CA 4U7BA 2WTUA 3W64A 4ENOA 3TUPA 5LMNF 2AV5A 3O80A 1N32J 4IFYA 3ZZYA 2P1JA 4KBIA 1NZ8A 4O8KA 4KV8A 4CWBA 4EZ6A 4UOFA 4UUWA 1V4TA 2X1AA 2NSCA 4ZLJA 2CIMA 2N4DA 3BP8A 3DHXA 3TUIC 1IJJA 4DFKA 1LOUA 1TKTB 3IWXA 2OGUA 4X4TA 1YRUA 3UN2A 4IG0A 1OSDA 3VVTA 1RLDA 1ATNA 5D78A 3ZTQA 2C2RA 1WTFA 3I5BA 1J53A 3H45C 3MPDA 3P49B 4QWCA 4NOHA 3BGRB 3MCMA 2CPYA 5HVHA 5GVQA 2R7UA 5F8HA 2D0OA 4P2MA 4MO5A 1P9QC 2MLYA 4WU3A 4H54A 3NAIA 2ZH1A 2KHOA 2QA2A 5GMEA 1S5JA 2U1AA 4GNIA 2AZ3A 4QW8A 3PCOB 3MHYA 4AL7A 2VBYA 4ISFA 4B3OB 1VQLS 1RSCA 4B3TJ 1TK0A 3RWUA 1G3OA 4MK9A 3BDPA 4J2EA 1TL3B 3N0VA 3RU0A 4UQGA 4IOCQ 3UD5A 5JVGL 2AEMA 3A5MC 3EE9A 2PT0A 1B9DA 3VGVA 4GY2B 4CBXA 3DRPB 2F7VA 2AJ2A 1JJ4A 2V50A 2VHGA 1NGBA 3L2QA 4DS4A 4HI2A 1J54A 3OJSA 5CQGA 1RTZA 5JVHL 3A8YA 5KFWA 2IMOA 2AGQA 3CETA 2X3DA 4ZN1A 1NMDA 2P5GA 3H5SA 1H74A 4DTXA 2B5JB 4DV6F 2PFFB 4ZPDA 5E2QA 2NLXA 3R8EA 1B99A 4KFBA 3AA8A 2F5GA 5GAHI 3GE1A 4O5FA 1S1TB 2G0JA 1N5SA 1FNXH 1HUXA 3H5XA 4IKFA 3ZTPA 2I2YA 4IJNA 1KONA 3L7PA 3MM5B 2LCWA 1T6CA 2V2ZA 4FNHA 3RB4A 1JJCB 3Q8SB 5A2QY 4A8XA 4NLPA 4U7UD 4KHQA 2FYXA 5L9XA 3ISNC 1JLQB 3OYEA 2BABA 5B09A 3ZT1A 1M1GA 5LOQA 1CEZA 2FLLA 2FDNA 1QSYA 5E3CA 4IEEA 4KO0A 1MROA 4J90A 4P6QA 1QQNA 3C6AA 4EBDA 1OWXA 3EY1A 4K4YA 3FGUA 2VG7B 5D4LA 1FXRA 3L0QA 1VQ4S 1MLAA 3IFEA 4RR5A 3V6DA 5M2UA 2NRHA 1UTAA 3OTOJ 5ETQA 1L3KA 4FLUA 1ZZFA 2KU7A 2DGXA 4CGGA 1RTIB 2VICA 3I9V9 2KTQA 4M3WA 2GGPA 2FZKB 2CVIA 3DNCA 2AJ4A 4DV0K 5LXRA 3NBPB 2L9NA 4ED7A 3TTFA 2MQOA 1KQKA 3OW2M 3QBXA 5D3GB 1MWYA 5E3RA 3MUMP 3KHRA 1PYTA 2FVSA 3D2FB 2VPYB 3KYLA 4FS1A 2HYIB 4LVNP 1WD6A 1BUPA 3MPVA 3CD6S 5HMWA 1IV0A 4BR9A 1C6VA 3O1BA 3C16B 2GIFA 2MY8A 5DGBA 3KHHA 3ZX2A 2RQKA 4DX5A 1F1BB 2FHJA 3CCVN 2FGCA 3KDOA 3QJLA 1IR1A 1PCAA 2A41A 1NDKA 3E8OA 3SQ1A 4CO2A 1GOAA 1VQ5N 1VSKA 5ADZA 1TUYA 4OPJA 5K14B 1RT2B 1N32F 2GWJA 2FJEB 4RBVA 5FJ4A 2M2BA 3WEEA 1B0TA 1XERA 3JYTA 1WG1A 1G99A 4I7FB 2GHWA 3UCZP 1UFWA 1SQFA 4PPZA 4DUYJ 1TUWA 2EEYA 3H20A 3FFIA 2UUCJ 2GO9A 1U8WA 2RRNA 5T14A 3G6ES 3BREA 2W8KA 3CERA 2FC0A 3AAQA 3WX8A 5JS1A 4JKFA 5IT9Y 3D5MA 2YPYA 1A7GE 4UZCA 3NY0A 4FXDA 1F5BA 2VWJA 3EX7B 3GILA 4TYAA 1YJ9S 2A6MA 4IOBA 4O3OA 4HH1A 2V4QA 4A8KA 1NNEA 5CHIA 2VPZB 5KFOA 4WZMA 1D8YA 1NKEA 3OXFA 1NPKA 1ELOA 2G0IA 2UXDF 2Z1GA 5ELZA 2UXCJ 2M5YA 3CCQN 3LZIA 4BRKA 3N6LA 4LF8F 3P39A 4X66F 4XH5A 4NASA 3JAMU 4QPTA 3X3UA 4FF4A 4E19A 2V34A 1NGFA 1YJWS 2FJDB 2WAQD 4LRFA 3HULA 1YT3A 2M8HA 4R0EA 1Q16B 5DLFA 2KXFA 2R2SA 1BWFO 1ZBHA 1ZA2B 1Z26A 4ED8A 5HQMA 3B4MA 2FJVA 1GTEA 2C2DA 4IR9A 4X4NA 2VDHA 4C11B 4FDFA 2AT1B 1QY7A 4MKYA 1VMBA 1CLFA 1CJUA 1KVCA 4BRHA 1R0CB 4LH5A 2B9XA 3OFHA 3O5TB 1EX4A 4OYZA 3CQYA 3VAGA 4IOAQ 1FXXA 2FD2A 2CKWA 5KFPA 4WXOA 5HROA 2Z58B 3MUTP 4QBUA 1CSJA 4W5QA 1U48A 2IGIA 2CZVC 4M7YA 2VOOA 1J5OB 3H1QA 1R8PA 2KLAA 3G71N 1MW7A 2QI2A 2VPXB 5BRHA 1Q5YA 3HHLD 5KQDA 5HRSA 1LEOA 1NJIT 3JXOA 3TOQA 3TVYA 3HL8A 4ID5B 3MURP 1KTQA 4LBPA 1RBTA 1RBLA 3C19A 1D8ZA 2W7PA 2VQFK 2UXDK 3BQ1A 4CGHA 1FKOA 4CFAA 4LF8K 4UOCA 4ID1A 3MMBB 4X66K 4JI6J 4AL6A 3DDNA 4DZ6A 1EIYB 1NCLA 3NOCA 2D3O1 4ZTFA 2DGVA 2ASLA 1E3MA 1R0BG 2H9ZA 3FZKA 4ILJA 2E1AA 2ZH8A 1OKJA 2ZITA 4CEEA 2K2PA 2XWXA 5AQRA 4L75A 1E6YB 1KXPA 5LL6d 4KHUA 3O9QA 4YB5A 3NH0A 3I6PA 2BE9B 4GVBB 3H4DA 1Y5IB 4K41A 1CJKA 2ROGA 2MKJA 4FF3A 5ETPA 2QLXA 5GMKa 4FLTA 1VRTB 4EMDA 2ATCB 3W2VA 5T41A 3MCOA 2I7NA 2V4JB 2GAGC 3MMAB 3W9IA 3VEZA 2CWKA 2DPNA 1YG0A 4F02A 1H1VA 1KAZA 3OYLA 2MSTA 2PAVA 1D9DA 3ULDA 2IM3A 3E01B 4CP5A 2OPQB 1FJGK 2Z1JA 1HD0A 2EKYA 4DTUA 1KSPA 3VQTA 2UUCF 3VEYA 4GMKA 3OS0A 3A13A 2C3UA 3W5YA 1FK9B 3DU5A 4CEQA 3ZT4A 3I4PA 4FCYA 3CI5A 2YVSA 4DOZA 2ASJA 5GAHP 1CQNA 5HMZA 1U0HB 4BROA 3UVJA 2COLA 3QJPA 5HP1A 1EQMA 4X62J 3LL3A 4BR5A 2Y9HA 4A46A 1DY3A 3T1AA 3BKFA 4BDYA 4XO0A 4RNNA 2IA6A 2IBOA 3N9UC 2DNQA 1KEKA 2BX6A 2RSQA 1S77D 2BKOA 3QZ7A 1NUEA 2UXCF 1I94J 3ZZTA 1YJ7A 2X51A 2AU0A 2MJNA 3THXB 2UUAK 3IBWA 4K59A 2CJ9A 2XS5A 3FSYA 1AXQA 3CMQA 4X4RA 2P9KA 4KB1A 3GMGA 5KPRA 1QVGR 4QYZK 1BE4A 3MEDA 2RHQB 1NEEA 1N88A 5J2QB 2ZE2A 2XBPA 4RWWA 1CLQA 3UD3P 3OYAA 1CJVA 1HI8A 2VG6B 4DL4A 3T6JA 1T8EA 4DTOA 4KAZA 3NGKA 3T5HA 3G4SS 2EBEA 1C1BB 2CPXA 2B4OA 3RBDA 3EICA 3SV3A 2GVZA 5M1OA 2YKMA 1Y10A 2IA0A 5FDLB 1SVDA 2OFGX 4O8UA 3TSQA 3AVCA 3QGHA 2JSXA 3CCWA 3LANA 2E1RA 1YTUA 1TL7A 2QX0A 2AYBA 4E98A 2E5LF 2O3DA 5DG8A 4CESA 3CJ1A 2L3MA 4MMOA 1UETA 4OI6A 3J7ZT 4CIFA 4B8AB 5AZIB 5A2QO 2CJAA 3ELHA 2HS3A 4XK8C 3SQGB 1KFDA 2HLUA 1Q8BA 1T94A 1E6VA 3HSTB 4OYWA 4EGLA 3OFEA 1P8GA 3DOMA 4DDFA 1OH6A 1YKWA 3RYLA 4Y0WA 3QDKA 1IJFB 2CNOB 4PWDA 3VCDA 4HTUA 5HBMB 1RBOB 2RRBA 3FK4A 3GP9A 3UDCA 1OH8A 3MOJB 1VIXA 2RRAA 3CWJA 3JSBA 3CJCA 5GIPA 4LH4A 3LGMA 1UOCA 3GG0A 2WSEC 1HYVA 4M7XA 2XSJB 3HPOA 3G6XA 3ZC4A 3E2EA 2BV3A 5BN9A 4JI2J 3KKFA 2F4FA 4R5PA 2H5IB 3LDLA 2OUGA 1NBEB 2O8EB 4LFCF 4E7LA 2GUPA 4FLYA 4PKIA 3DOLA 3KKSA 2A10A 2PC6A 5B0EA 4DU4A 4NB4A 2E5LK 4TSXA 5AE2A 3BR8A 3TWZA 1LFWA 1U04A 2LA4A 3L09A 3H59A 2QWLA 2YCHA 2LA6A 1HBNB 1Q7YO 5FPDA 2QIFA 1V3ZA 2YKAA 4HI1A 2MGZB 1U25A 1RDRA 3C46A 1HNWF 1VI7A 3M8QB 2RT3A 3H3OB 3E1YA 4Y2AA 1KD1O 1SL2A 2PA8D 3RMBA 5KFKA 1FRLA 1QQOA 1RT7A 1VFJA 4RWXA 5E7OB 4XPEA 2PYLA 3P31A 3R5CA 4USUA 4DTPA 2GMLA 3UKRB 3QNOA 2CQ0A 1BQMA 2L9WA 2DNYA 5DMRA 2VZ9A 3BY5A 2QWMA 3Q24A 2KKZA 3C2PA 3VEVA 2D7SA 4B02A 4UOHA 2VFVA 1C0FA 5IT9O 2R8GA 1VQ7S 1FT8A 1GX6A 1URRA 3ENAA 4FM2A 1MMLA 1I94F 3HVAA 4I9QA 3QICA 2CQHA 4P2FA 2CQPA 2O8BB 3GLJA 1RCXB 1RHKB 4JN4A 2HF3A 3B8HA 4LFCK 5LMUJ 5AQUA 4ICLA 5H1SQ 1HL6A 2DISA 2RS2A 1RT5A 1KNZA 4FWKA 1MWZA 4CHNA 4BRAA 2CPFA 4CD1A 3VQ6A 1UCNA 5CAAA 4CFDA 3VGLA 3MM9A 4FWQA 1VIOA 1Y9OA 1GLLO 5AQQA 3DRXA 2OTLN 2P9NA 1U49A 1HNWK 1Q95G 4DR3J 5DLGA 1PAEX 2YBVA 2ZOFA 2JLFA 1JXVA 1ASUA 4O4GB 2AX1A 2N4CA 1PG5B 2I9SA 2JWNA 3GJRB 2HKEA 2XS2A 4IOAL 2VFSA 2ZJRQ 1BCMA 1VQ6N 3G96A 3CCUS 5DM7Q 1FFSB 1S6PB 3SCIE 2N7CA 4OO1J 1N0UA 4CH1A 1H2UX 3HK2A 1Q79A 3VERA 4K42A 4KYZA 2E6LA 4KREA 2ZHOA 3WDOA 2X6SA 2D5RA 3LDQA 1K47A 3A8KA 3PJ9A 2HHTA 3MAAA 4CGFA 4ZVPB 4CGJA 5TKYA 4EP4A 3GTYX 2L08A 2CQ4A 3R6MA 3BGLA 3GJSB 5AJ3J 4K43A 2BEFA 3H4BA 3FCHA 2MQ8A 1HQ2A 4X65J 3QZ8A 3H1VX 1AB8A 2DIVA 4DS5A 3AVFA 3L4IA 3Q8QB 3NGDA 4IH7A 2F7TA 4RZRA 2XC9A 5B08A 2I1RA 4RUHA 1RBSA 1FW6A 1FRHA 2R7WA 3KLHA 1Z6RA 4USJC 4Q0BA 2ZDPA 3M32B 3VQCA 1VJWA 4JI2F 1BQNA 2F8MA 3GR0A 1GNKA 4I2QA 3FEXB 2K8GA 4ES3A 4PEOA 5E41A 4K8RA 2HRTA 5CD4H 4FKYA 3QRQA 3F44A 3WX4A 3DDKA 2BKNA 2UUTA 4LFAK 4HLBA 3B6PA 4IXCA 3GE9A 5LJ3Y 3AV9A 3K2PA 3VGSA 5C2GA 4DKWA 1YIJS 3FLCO 2GC8A 4RUBA 3DRRB 3M30A 2HFZA 4BC5A 4F8RA 3QT6A 1F60B 3TA2A 4Z2XA 3CCSN 2GMHA 4GC7A 4TQRA 5F9NA 1NSAA 1NGEA 1ZETA 2A42A 5ETSA 5IOLA 4YS2A 1Z4UA 3MXMA 2V52B 1GFWB 1LWCA 2GIQA 1M1KT 3ZT3A 2PSZA 2ZVSA 4K4VA 4JI8J 4JK7A 2A6AA 2IM0A 4HUGA 1HJRA 4W5TA 1X4GA 1WHYA 2O8DA 4F36A 5JXSA 1J5EJ 4YB1P 4FW1A 2HZVA 1VSIA 3QEIA 5A6PA 4IWVA 3NMUA 4QOZB 4KHPF 4NXNK 2J9DE 4RW8B 1CS4B 3BSOA 1T02A 2GVDA 1S1UB 3PFEA 4FZYA 2DCLA 4ECTA 1S4EA 3ET6B 4LFBK 9RUBA 1VK3A 1KCFA 4DR4J 4JBCA 4USTA 2F4VJ 2J9CA 1VSEA 3THYB 2ZWHA 5C0YA 4MDBA 2HFNA 3UNGC 4Z0UA 1VQ4N 1ULRA 3CJRA 3VGTA 4Y2KA 2IHR1 4WQ4A 3C6HA 1RBVA 4B3SF 1V9OA 4BACA 2Q31A 4FN5A 1MA9B 1NJXA 1RQ0A 1F2HA 2KYZA 2Q6CA 2DPIA 4ZHRA 1SC6A 5FPEA 4UOGA 2YKOA 4QU6A 3LGHA 2ZH2A 1T0TV 4CZCA 3NP5A 3IP0A 4RBTA 4E7JA 2HGLA 2BW2A 4FM1A 4FWRA 2B9EA 2RE1A 5GAEI 4WPAA 3UE5A 2ATQA 3D1OA 3AAPA 5M1FA 3QFWA 3QFUA 3EZWA 3VZIA 1AT1B 3HHLC 5I4MA 4AHUA 4I2PB 3ZNUA 2IY5B 1XBWA 3IMXA 3BYRA 3KKRA 1LNQA 4F7VA 4W90B 1NB7A 2IJFA 2WTFA 3A8JA 1NGIA 3NNCA 4CZIA 2MKCA 3WNHA 3AJDA 2DITA 4A8SA 5KFGA 4NCAA 1C1CB 3CJSA 4KHPK 1L3VA 2HZCA 2IYIA 3U3GA 5AJ3F 3C15A 4O0IA 4AILC 1D3WA 1ZBSA 2HQ3A 4X65F 2IIHA 3F41A 4PABA 4YFUA 4ZOSA 4P72A 2ZH9A 4H0XB 5AXLA 1XMOJ 4FJ8A 1BI4B 1QZ5A 1APSA 3EPIA 4J9UE 1ZTTA 2BH1A 2Q1NA 3T1HK 2IDOA 4U8VA 3H08A 4BE0A 3UN3A 3P1GA 3G6EN 1VSHA 2PFDA 4B3SK 4HWIA 1UWBB 2RILA 4WCEL 3VQQA 3FSXA 2WBMA 1UW4A 2LDYA 3AA4A 5JS2A 3EM1A 2JVOA 2FBVA 2CJQA 4CJQA 4OYPA 2DY4A 5J1NA 3RBEA 1HNXK 1TKZB 1S48A 1YJ9N 2G8IA 4M63A 3BSAA 5D4PA 2IVYA 3ID6A 1O51A 4IO1A 1WG4A 1XMQJ 1Q86O 4BQZA 5IZHA 1IBLK 2CQGA 2E2QA 1NK9A 5J1EA 3DGPB 1LFPA 2KN4A 3VZHA 3D28A 2QEXS 2X74A 3I55S 3ENWA 2CPHA 4FBTA 2DK2A 2F63A 4EYHB 4C0OC 1RZMA 3IFRA 1GXTA 3D0GE 3TSUA 1ZZNA 1B9FA 1KQFB 4NCBA 1ZAWA 1RAOA 5SWMA 1GXUA 2XCAA 4OKKA 2Y0SD 3DLGB 2VQEJ 1S6QA 3HSDA 4WK3A 1VRUA 2W7OA 1VLYA 4BY9C 4P10A 1YBTA 1QE1B 2E29A 4B1UB 1FTRA 2BJ8A 3CNQP 3ENVA 4FJ5A 4F3QA 3CC7S 1K8AO 1WAJA 4X2BA 4FBUA 4JKCA 2YJFA 1RU1A 1VGYA 4L3NA 2BBEA 2D0AA 2Y0BB 3HSZA 4TY9A 1C0UB 1TTHB 2AMCB 1S0OA 1OVQA 3KLFB 2R9LA 1HHTP 4UTGA 3NCRA 4DR4F 3LP2A 2QSWA 5LSLA 3QEXA 2HRYA 2J0WA 1OSCA 1R0AB 3EPGA 5HLFA 4BR2A 1RWMB 2MTLA 3HOTA 1T9YA 3B4DA 1M90T 3RG6A 2V8PA 1HLWA 3FE1A 4ZMMA 4MFBA 4BRQA 1N8RO 3ALYA 2QA4S 3B8AX 4WE1B 4B3MJ 2FJXA 4FLZA 4LSNA 4N5SA 5ETTA 4JB8B 3PX6A 3WC0A 3FEYB 4HT5A 4IFYB 1WF1A 4CLLA 4TU8A 2ZJRL 4KV8B 2J9EA 4KPYA 3Q22A 5DM7L 3DJCA 5M1QA 2ZDOA 4WKRA 3K57A 3RB6A 1WAFA 4IG0B 4H4OA 5KGXA 3NH1A 1WSIA 5FRNA 3K0SA 2HNYA 4KKOB 4AXJA 2HNDA 4CZJA 2DY9A 4JK9A 4NRTA 4L8RB 3CD0A 1RLCL 4FVCA 3EGNA 3D6MB 4HTLA 4OZLA 3E9PA 4USHA 5F8LA 5EU7A 4IJAA 5AXKA 3OFFA 4ZKAA 2EK1A 2FBXA 5LY3A 1KVKA 3OBYA 4WK1A 3D0PA 3O6QA 1IO2A 4JI3F 5L38A 3ULEA 2E5GA 2ZF5O 3QERA 3RR7A 3OL8A 3CC4S 5A8RA 2G1HA 1CZAN 4N41A 3NRBA 3CCRN 4L72B 1VQOS 4GKJK 2LVWA 1HKBA 4BRCA 1LV5A 2XS7A 1HR0F 1XMOF 2BW7A 4YB7A 2G8WA 5BREA 2MB0B 3CMES 2Z1IA 4FF1A 5L39A 3BF4A 3OW2R 2BRKA 1UMJA 5IT0A 3TZZA 3VQPA 4BGBA 3J80O 1ZPVA 1S6OA 1ZM9A 2OPRA 3MM6A 4KFBB 1FNOA 3TZXA 3OLBA 3ZZRA 2PFUA 4FJLA 5GAHU 1X5TA 4X84A 2R2RA 1F0XA 5C5JA 2B3TB 3EN9A 2RF2A 2AYEA 3NGTA 1DLOA 4DMZA 4I1TA 1TELA 4RU2A 1XMQF 2QYGA 4CCHA 2D1CA 1SJ4P 1TK8A 4PRFA 4GKKJ 1H2VZ 1K1SA 2J6TA 2AF6A 1CXQA 1U09A 2FHJD 1S9EA 5LM7E 4ANDA 2BOAA 1NDCA 4W5NA 4LSLA 2W9BA 1PYSB 1FJCA 2X7IA 4LF6J 4M41A 3GIRA 3DLKB 3UNYA 3O44A 4CK2A 4KO0B 3HZGA 4DCJB 4K2JA 4JI3K 1U6FA 5AFUA 2MJUA 3AY0A 1EKEA 1D09B 1GX5A 2F8TA 2VDIA 3N28A 2BQRA 2D74B 3V6DB 3HM9A 5GADI 1VRQC 3VQSA 2QO3A 4FJJA 3ZSOA 4KTWA 3PFOA 1M5HA 2V5HG 3QO9A 1HIYA 1HR0K 3ZZ0A 3W3DA 3GWCA 2GGPB 3H2LA 3LDOA 1JLBA 3O9RA 2OD4A 4K4WA 1U2VA 3V1RA 3H90A 3MN5A 1SKSA 2Z2ZA 4B9LA 2ZD1A 1F2GA 2J0SD 2ITGA 3SLCA 5GAEP 3AO3A 5KT2A 4AHSA 4JV5J 1WSEA 1QUPA 2FXUA 4O3PA 4DCOB 4M3ZA 4DSKA 3RMDA 2V8HA 4FYYB 2NXCA 1VQPS 5KT7A 3KD1E 1RWVB 3ULHA 4K4UA 4C2MA 1RABB 4Y1CA 2IM1A 1IM4A 1KLNA 2IC3A 2GHPA 2XZTB 4Z4FA 3C6UB 1WHWA 5IT4A 2DFEA 2HHSA 5CZ1A 4NXMJ 3SUPA 1J9AA 3T1YF 4EO6A 1HARA 4QWEA 3BV8A 4OHYA 4LR9A 1JLGA 1NSQA 3KLIA 4WWSA 4F4YA 4I6AA 3R5GA 4OGCA 3AXMA 4USKA 5E26A 4IFEA 3ZZUA 3EGVA 2O8CA 1BD6A 4F2SA 1JJHA 1C0TA 4KHYA 4M5JA 3AO4A 4IQMA 2QM1A 4GVEA 2B8QA 3WEEB 2OEMA 2IM2A 1TK5A 4DR6K 5EX5A 5T7BA 1H7WA 4BS2A 4CF2A 2CQ1A 4IG3A 4LF5J 3JYTB 5A0YA 4BGAA 4CLZA 1UKUA 4K7QA 4PUOB 3GCWP 2UUBK 4A47A 5A8WB 4WIIA 3N4PA 4Y1DA 3FFIB 5AQMA 3NAEA 3TUZC 4Q2LA 1KQGB 1N5VA 1SV5A 1W7WA 5D15A 4X4PA 2YX6A 2PN6A 2ZBQA 4CIEA 1T44A 2CNLB 3BZCA 1ZBFA 1KWMA 4EYIB 4E0DA 3TAQA 3P3DA 4LMZA 3IAS9 1RCHA 1TL4A 3W65A 3M8SA 2HAIA 3K59A 4F4KA 2GELA 1RBAA 2F65A 5HK4A 4CZMA 4NCGA 1OIAA 1R7IA 3JSRA 1U26A 4DU8A 1X0FA 1LWFA 4NLBA 4TY8A 4AXIA 5CYMA 2KFZA 3T1YK 1A9NB 1WDDA 4CQ1A 3D6FB 3I82A 3BPDA 5F9LA 1M5OC 4K8ZA 1VK8A 3H8YA 4YHHK 2EC2A 2ZH6A 4B9QA 2FSNA 4CVNE 4FWNA 3U7JA 1WLJA 1RTJB 1XNQJ 5HN0A 3I5CA 4DV7K 2QE5A 3IRXA 3V9WA 3J7Z5 5E84A 1CJUB 4GKKF 4MAKA 1S0VA 4DSEA 2YKQA 4ZCIA 2G13A 3VQ8A 4GVMA 4YB6A 3R3TA 4DG1A 2QA1A 4HHTA 4LF6F 5HROB 3VTIA 1IBCB 3K89A 1KLMA 1YRXA 2Z4PA 2ZKUA 3AJ1A 3Q86A 3O5BA 3NGUA 3CCZA 5C12A 3M2UA 1X5OA 3RUBL 4DV2J 2YTCA 2YPZA 4TYBA 2B43A 4LRBA 5HO4A 1RNHA 4B3RK 5AZJA 4KJIA 2W24A 4GC6A 4C8OA 5FRMA 2I38A 3AVMA 2JOQA 3NNAA 1FKOB 3TQEA 4K4TA 3LDSA 4Q5VA 4CZFA 1S1XB 1Q8KA 3UPFA 4CEZA 1DARA 1U6BA 2DRAA 1UAWA 1Q9XA 4ECRA 2ZEJA 1K8KB 5ETLA 4K50A 4M5NA 2D0BA 2IVFB 2Q1LA 1Q9YA 3CCUN 4JV5F 4M5DB 2LXIA 3HFKA 1YUWA 5K20B 4HUFA 2VGMA 4DR7J 1F3FA 2R2UA 3L3VA 3FKBA 4NLSA 3PM9A 3M6UA 4DPWA 5KFEA 1SB6A 1ZM2A 2H65B 4NXMF 3RJMB 3CJKB 1YJNS 1IKWA 2OHDA 3EGWB 1CJKB 5K9FA 3ILIA 4ECQA 3K8VA 2WVCA 4HVJA 1I3AA 4WP3A 2AIRB 4A59A 3W2VB 4XH1A 1ZBIA 1X5PA 1WBBA 4OIXA 1U2FA 3EL2A 3D2EA 3EEQA 4ZVQB 3RZAA 4PR6A 1FD8A 2NZ4A 1B0VA 4P9SA 3N5FA 5H1SV 1VYAA 3IUCA 2HURA 1RTDA 3T69A 5KOXA 1CULA 4F3TA 2JX2A 4F26A 1IM6A 3R2DJ 2CH5A 3N79A 3OL6A 3MECB 3GG1A 1FKAF 2D3OR 1Y3JA 3E51A 1RDWX 1RE1B 4JAXA 4QS8A 1DJ0A 3U1MA 1KOHA 3PW0A 2XNQA 1X5SA 4FYXB 2GTDA 5KPZA 4CERA 1S5ZA 3GB0A 3MI7X 3LZJA 1NGCA 2CVEA 3PRVA 3SV4A 3TARA 5K5MA 3UVJB 1GLAG 4IO8A 5A2QU 5E3QA 4WP8A 4ED4A 4A61A 4RW4B 4ITSA 3BN7A 1FRXA 2J6UA 1F9HA 4KH1B 4JS4A 2P5VA 1FJ7A 2ZWPA 3HSJA 4AHVA 3AO1A 3VQEA 3EDRB 2PMHA 1ZTWA 1GOBA 3NCIA 2BRLA 1ZBUA 1S99A 4IR1A 4PWUA 1BUXA 3HXMA 2GQ2A 2CPIA 2L41A 3CJ2A 2P9KB 3PSIA 1XR5A 1GLBG 4TN2A 3BZQA 5KG1A 4CJTA 3QIPA 3NXZA 3LP0A 2N7YA 2P2CB 4LF9J 3DRSA 4NI2A 4JD2B 5GADP 3J81j 2UU9J 2HHVA 2E1CA 3HVTA 4ZPWR 2YQ1A 2EW9A 3KLGA 4LJMA 3TQ1A 3KNGA 1XNQF 1GMWA 4B9SA 2JGUA 2BJ7A 5FIIA 1EQ0A 2C2NA 2IVMA 4RNOA 4K4SA 3QMQA 3I8DA 5EX3A 1TL7B 1WSVA 2VA3A 2LU2A 2VBZA 4DL2A 3GDQA 3V1QA 5SZTA 2XSFA 1KP6A 3FZMA 4B1XB 4TNOA 1AZSA 4YEAA 1KKHA 3NKYA 3NGSA 1U0SA 1IG9A 2LFVA 4C8NA 3DRYA 4NLXA 3M1FA 3AA9A 4O5BA 3IMQJ 4PKDB 2N3LA 2CPZA 4PG6A 1JLCA 2DEJA 2GS8A 4FJXA 4CW7B 2U2FA 4DN9A 5EHHA 3DOMB 3OTEA 4DQQA 3KLEA 2IDLA 1WG5A 3GYNA 3JQKA 3FUYA 1QVGM 3W7BA 4JI0F 4D3HA 2YNHB 4Q43A 4PWDB 3OS1A 4TQSA 1BISA 3SI6A 2RB7A 2CAJA 4NA1A 1DQ9A 2GQCA 3TA1A 4W92B 3KDNA 3CD5A 2QRRA 1R27B 1O1WA 2QWQA 4LUBA 3AY9A 1TU0B 2J5AA 5DDPC 3ZSWA 4I6YA 4O4RA 1N34K 3OL9A 4OHZA 3MMVA 4DJBA 3CMAN 2ZM6K 2EWHA 3CC2S 3THPA 1NK7A 5IT9U 2P9IB 1RWKB 3DXKB 2BE2B 5C25A 4DV5J 1VSDA 1WC4A 4W4MA 3G82A 5E0OA 4O44A 4EK2A 2MQPA 3UDLA 5E3AA 3VALA 3U6FA 2DBBA 1S57A 3HT3A 1N56A 4R5PB 3THVA 2YXLA 4C97A 4UY8T 2CJYB 1FX4A 3CFRA 4CJVA 4AQYK 3DYAA 3TYTA 3DOLB 1BA1A 4C6AA 3D3CJ 2I5JB 2HQFA 3KUHA 3R1HA 3TAFA 3KUEA 5KFNA 3C3LA 2PGCA 2C2OB 2EG1A 4KE5A 4CYUA 3CFOA 2JL9A 2JWKA 3KJQB 1LAVA 2OIHA 1ZBLA 3ISND 3IR5B 2V8GA 4M5IA 1ZH5A 4FZZA 2JRSA 3J81Y 3DU6A 4Q8FA 2CA9A 1GK8A 4BG9A 1RT7B 4O0JA 2AJQA 1XR6A 1GLJO 2H3EB 5J2PA 5DG9A 4JI0K 2AX0A 4B08A 2OPSB 4OZ3A 4XDDA 3VESA 4USIA 2Y1IA 1BQMB 1WC6A 2V2VA 5L1KA 2IRUA 1PJ7A 4YY3K 4FJIA 4FK2A 2V63A 4B9TA 2M88A 2AJ1A 2XMKA 5IM0A 1D9AA 1NB2A 3M2VA 4FLVA 1PAUB 5K8PA 4ECXA 3HZEA 5DETA 3EXCX 1VQYA 4LF7F 2B9WA 3DM2A 4H4MA 3F9KA 4WKYA 2QMWA 2DO4A 4Z37A 1MU2B 1RYSA 2E9RX 2IVPA 2F8HA 4WJBA 2KT5A 4OYOA 5KFMA 3FRZA 3QEPA 4OLOA 5K8MA 2D9OA 3ZSRA 1RHQB 3FC9A 3KNAA 2DXEA 2DGUA 1RT5B 4WFAL 1NOYA 4LF9F 3MUVP 3VA3A 2C3YA 3VETA 2Z0GA 3MM9B 3NGYA 3BPSP 3V9XA 4CJ5A 1WUUA 2LEBA 1WC1A 3NGIA 3Q23A 2P9NB 1R3NA 1SJQA 4Y3CA 2E6MA 4KHMA 5BR8F 2OPPA 4TXSA 5AE3A 4YOEA 5F3ZA 2KRBA 4FVMA 3K5MA 2J0XA 2P9EA 2PZSA 1PKUA 4K5RA 2G2YA 5IQQA 4WXWA 4N8NA 3MEGA 3RBXA 4QCLA 4A8MP 4H5WA 2HOEA 6FD1A 1N48A 3PHTA 1NK4A 4F4WA 2HHWA 4JLHA 3IG1A 3FBEA 1Y7PA 1VHXA 2YH1A 3FMWA 5L1IA 1TYQA 1EP4A 4ZP7A 4OJ3A 4GV9A 3IS9A 3MN7A 1HBUB 2XY6A 4ECVA 5MLCQ 2QA4N 3K8WA 4LF7K 4RCHA 3SDEB 2RHKA 3RRGA 3ENOA 4DV1J 1XN9A 2RDIA 1B3TA 1WOQA 3ETOA 5ADXH 5D4NA 4OMFG 3PJXA 2X3GA 4EBEA 2CQDA 1H6KX 1I3OB 4ES2A 4JYAJ 5GAGI 4USMA 4P7VA 4O3RA 2RKIA 2OZMA 4H8KA 1VHIA 5AFUH 4RW9B 4DV5F 4K0KJ 1IUJA 1E4FT 3A5NC 3KLHB 3GV7B 4RUCA 3KJVA 5CABA 3JS6A 4HTJA 1YHQN 5DDRC 1DHMA 2HGMA 4CI0B 4CJUA 2RNEA 1IKVB 4PWWA 5BR8K 5CE3A 3SBMA 4DUZJ 5B0GA 4I2QB 2LKZA 4A8WA 4FSVA 1KC8O 1NDPA 4JI5K 2B8PA 4OV1A 3FNNA 2MQLA 5AXMA 3SZ2A 1I5OB 2E8AA 1Y3KA 2MY7A 3LH2S 1RISA 2DR6A 4HHHA 3V2UC 3KXDA 3OS2A 5DQGA 1DTTA 5KG6A 4OZNA 3S9HA 3P8BB 4IRKA 3MXIA 1R89A 2WSFC 3FCVA 4AFFA 1U45A 1VQON 2Z1HA 1FFWB 3PX4A 3ZSYA 5CCLA 3MDFA 3THTA 4C0HA 3M30B 5M1PA 2Y1RI 4Y2CA 1LWEB 4KB0A 2PMZD 4ZK7M 2R7VA 3JTOA 1RHUB 1RT6A 3BBCA 3QJJA 2H4WB 4IQXA 1IJEB 1LWCB 4LR8A 3KJNB 3S7RA 3SI8A 1BCOA 2B4UA 1I6JA 3VOVA 4QWDA 4RWTA 4IH6A 4ZCLA 2I8EA 1F21A 4RW7A 2O8DB 1JCEA 5F41A 4LQ3A 5HL7Q 3F73A 4NA2A 3O6WA 3CJ8A 5C42A 2FY8A 3KG1A 1SUQA 4JOUA 2YKPA 3US5A 1YVNA 3CJ5A 3QAEA 1N36K 1TKTA 4J7CA 4B9NA 3E66A 1AYEA 3L2UA 2OTJN 5G0RB 4V1Ak 3BGRA 3EVOA 4H0PA 3V9UA 2E1YA 1OQ6A 3AFGA 4U9RA 4IBNA 3H7HB 2JEIA 5FPMA 2D9PA 2HNZB 3CPWR 4O23A 1NK6A 2X1GA 1EX8A 2O8FA 4YN3B 3TZWA 1GQEA 1QAIA 4M5KA 3TVKA 3LDNA 4RTFD 5AQPA 3C6TA 2VFTA 5IV3A 4ZHRB 3PZPA 2CNKB 3RB0A 4ILHA 1RAGB 5L1LA 4ALZA 2M8DB 1UA0A 1JNZB 1N5TA 2OO4A 1HYZA 4WYWA 2EC0A 3PW4A 4Y34A 3EKUA 5F0XA 2HK2A 5AQZA 3NGRA 1VQPN 5GAEU 3H98A 2NXJA 3PIOQ 1RK8A 1FE0A 2KKHA 3AB2B 4CLSA 4ECYA 2ZUAA 1OY9A 2QMUB 4W98A 2FY1A 3GPAA 4MQ3A 2J8SA 2OFHX 4KT0C 4G9ZA 1NWKA 4ZVRB 2ASOA 1W2BM 1S1TA 4JV1A 3P5JA 3WXJA 3Q7BA 2DNHA 1T9VA 3MM5A 3MPUB 2VPWB 4CTAB 4JK8A 3EJMA 1BOTO 4DV0J 3FGVA 1JLQA 4CO4A 1ACMB 2WOMA 2HBRB 4BBYA 2DNNA 3AA3A 3KOAA 5T7LB 3V4IA 1YRTA 4MKVA 2VG7A 3DLBA 2VGNA 3SMZA 3ZXWA 3CO9A 3KK3A 4FK0A 4DUZF 1K1QA 3ETMA 4QIGA 4ECZA 1TMJA 2ALZA 1OS5A 5E33A 4B1YB 1JJ2R 1NKBA 4LF4F 2R8JA 4K5SA 5E3PA 4CM2A 3CDAA 2POKA 2OKQA 3CJAA 4E7IA 3M8ZA 2XZDB 4ELTA 2LQ9A 2JC0A 4FJNA 3NBPA 4X4QA 3ENBA 2MZQA 2VYPA 1WSJA 3WNGA 2MMYA 3Q83A 4ETXA 4M3XA 1DZ5A 2ZJPQ 4Z4HA 4WTYA 1MSWD 4DSIA 3FDSA 2JJ4D 3C16A 1ZS6A 1JXEA 4B9VA 5THWA 3NVMA 4CHZA 4CH0S 1N5YB 1FA0A 3ZEUA 3TWHA 1HHQA 5KT5A 3C14A 3J81O 1S6QB 3LPEA 1VRUB 3SCKE 3WNEA 3AARA 1DGKN 1HWKA 3HBTA 3I56S 3V4MA 4NYPA 2JLGA 4E1NA 1KVBA 4CO0A 3CJTA 1RA6A 2K1RA 3SPZA 4LC9B 3ZNJ1 1FEHA 3S3MA 4KH5A 1NMEB 3CTRA 4OI4A 2B0GA 2XI3A 4I7FA 4B17A 1EETA 2LSNA 1Y5NB 3S3OA 1WBDA 7FDRA 3QIDA 3PKMA 2ZHAA 3AOCA 1VSFA 4LF4K 3JSYA 2EG2A 3JQMA 3ILOA 4QQBA 3MMCB 3P5BP 3SSSA 4ED0A 4CJRA 3TAEA 1RADB 3SSQA 4MFBB 4BWJA 4CEDA 1T9UA 3CHWA 4K25A 5KPTA 4MIBA 5K8NA 1VQKN 3GU0A 2ROPA 1IQZA 1G15A 4LIWA 1S76D 1N0VC 4IDKB 2DJWA 1UVKA 4WU2A 1AFJA 1G4CA 2XWYA 4ZA1A 1H0HB 4GRSA 1YX2A 2HBZB 4CLFA 2BXJA 3BSCA 2UYTA 2K06A 2LXUA 2OCEA 2H1YA 3G25A 3VAHA 1B7YB 3RBZA 1X9SA 4H4OB 5KQ8A 2EPIA 1N6QA 3SBTA 4HCCA 2FHMA 2M0GB 2PO4A 4FWSA 3CJ0A 4HDHA 1YJNN 1S0MA 1KTVA 2FVRA 1QSLA 1NU4A 2K3KA 1D1UA 2ATLA 3ZSXA 4C11A 3TEGA 3L9ZA 4EHTA 1SC1B 4IKAA 3LP1A 3ULEB 3IWNC 3CJ7A 2VQFJ 2KL8A 2HHHF 2UXDJ 1GOCA 5A8RB 3M1VA 1OPZA 4QU7A 3SFGA 4LF8J 2VOPA 1FEEA 3H25A 4DV0F 4FW2A 4X66J 1SZ2A 4RNMA 1VQ9S 4NYZA 1XI1A 1RDAA 1HMVB 1IXKA 1K73O 3HI0A 1RYRA 4WIQA 3LQVA 5J1PA 1S3XA 2ASPA 4KSEB 1Q4RA 3JXUA 2HZAA 4RNHA 2BTFA 1QQCA 2N82B 4NE9C 3OT9A 2ERRA 1H38A 3ZTSA 4C4WA 4CI6A 2F9JA 4FJ7A 2DXDA 3AQP<