1S1UA

Crystal structure of l100i mutant hiv-1 reverse transcriptase in complex with nevirapine
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
536
structure length
524
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGIKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Reverse transcriptase
publication title Crystal structures of HIV-1 reverse transcriptases mutated at codons 100, 106 and 108 and mechanisms of resistance to non-nucleoside inhibitors
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 140
structure length 524
sequence length 536
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1s1uA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s1uA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s1uA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s1uA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1s1uA05
4J2EA 2D7SA 1T05B 2R8IA 3AVKA 1ZTTA 2AJQA 3NDKA 3EY1A 1L3VA 2QK9A 1UWBB 3V6DB 2JEFA 2IBKA 4JV0A 4F4ZA 3KK3A 2J6SA 4YR0A 1TKTA 4DU1A 4EO8A 1TVRB 1NK8A 1WAJA 5KT2A 2AQ4A 1HNVA 3KK3B 1KVAA 1VSJA 2OPQA 2UVRA 1TKTB 4Q5VA 2KTQA 4ECWA 3RR7A 1HNVB 1N6QA 2OPQB 2XI3A 3TVKA 3VQ4A 3HL8A 2DPJA 3C94A 3NH0A 1N6QB 4H8KA 3V1QA 1SL0A 4Y2CA 3LPTA 2FLNA 1X1PA 1I6JA 4KPYA 4CIEA 4MQ3A 4AHCA 4U7CA 2OPRA 3OYGA 5J2NB 4O4RA 1TL3A 3KK1A 1J54A 2W8KA 2C2DA 3U3YA 1GX6A 3BQ2A 3PHEA 1DTTA 2HHSA 2JEJA 5FRMA 3NF6A 5KT6A 2OPRB 4FLZA 1TL3B 3KK1B 4KHMA 2IAJA 2FBXA 2YKMA 1T8EA 2DFEA 1UOCA 4R8UA 2IM2A 2DFFA 3H08A 1DTTB 1JKHA 1U4BA 3F73A 4JV1A 2IAJB 4W5NA 2YKMB 3M9MB 3GV5B 4R8UB 1A5WA 1TKDA 1JLAA 3ZSOA 3MECA 4CJSA 1NJYA 1JKHB 4B9SA 4OL8A 1CZ9A 1WSHA 3QIOA 4DTUA 4ECZA 4DL4A 3KOAA 1IKVA 4ED1A 4NLPA 3CFPA 2OPPA 3ZSRA 1OS5A 4HUFA 4CEFA 3OLAA 1IKVB 4FXDA 4ECUA 3BSOA 2IDOA 2OPPB 2IJFA 1NK6A 3OVNA 1GX5A 4FJIA 4Y2AA 3LP2B 1LW0A 1TAQA 3OS1A 3QZ8A 3VQAA 4FLTA 2FVCA 3S9HA 4DFJA 1KSPA 1HQUA 3QLHB 2HHXA 4O3NA 4E7HA 1JLFA 2P51A 3MR2A 2Y1JA 1LW0B 2GIRA 3H5XA 4FK0A 4QPXA 5KFVA 1HQUB 1HPZA 4ECTA 4KHQA 1JLFB 3KLGA 4DF8A 1BI4A 4RZRA 5DG8A 4FLUA 3CVKA 2YNGB 3KK2A 2ASJA 4FJKA 1HPZB 2D5RA 3V9SA 3LZJA 1S48A 3KLGB 1JXBA 3V6JA 1BI4B 3OLBA 4CHQA 1NKBA 3GYNA 3KK2B 3PJXA 4HTUA 2G8FA 2HHWA 4J9KA 2UUTA 4DS5A 4M41A 2BQ3A 1S1UA 3CJ0A 3ZT3A 4LD0A 2QKKA 3KLIB 4K50A 4KTQA 1S1UB 3QETA 1K6YA 3DLHA 2XY6A 3LPUA 4CHYA 1RT2A 2FVPA 4ZP8A 1RTDA 3T3FA 4KO0A 3TAPA 5F8HA 1LWFA 1RT2B 4IRKA 1RT4B 1U45A 1RTDB 4CHNA 3HT3A 4KO0B 4KREA 4NLTA 4TSXA 1D5AA 1LWFB 5HLFA 1G15A 3M8PA 1BCOA 1XR7A 4K4XA 4M3ZA 5J2QA 5HRPA 3BSNA 3QZ7A 3ZT0A 4B9NA 3M8PB 3PW2A 3WNHA 5J2QB 1REVA 2FC0A 2FVRA 5T14A 4FZYA 1W25A 2Z1HA 2IS3A 5CYMA 1C0MA 3PW5A 2R8KA 1RDAA 5HRRA 4IG0A 4OLAA 3VN5A 1W9HA 4W5OA 1REVB 4I2QA 3ZT4A 1RDDA 4FM1A 3G6VA 5CYMB 4Z4CA 3RB0A 3TI0A 4IG0B 3SFUA 3ULDA 4B8AB 4DTPA 4ZHRA 4I2QB 1S6PA 2X74A 3QGIA 2I1RA 2GBZA 4CF1A 4EYHB 4RW7A 2Z1IA 1TK0A 1N5YA 1S6PB 4KHRA 4I9LA 1IKWA 4YNQA 4RW7B 1L3SA 1JLGA 4J9PA 2YHAA 4NLWA 4KSEB 5KFQA 4NCGA 1LAVA 1N5YB 4CJQA 4NLRA 1IKWB 1U47A 3ICLA 3IGVA 1RA7A 1TL1A 3VA0A 1JLGB 1XC9A 2V0NA 1VSFA 4F4WA 4IH6A 4NCGB 4J9RA 3PW7A 3AVBA 4QOZB 4EP5A 3K5OA 2FVQA 3L3VA 1J53A 1TL1B 4O5BA 3QEVA 2O4GA 4KHUA 1UA1A 1TP7A 5FDLA 4M94A 4F3TA 5EDWA 3V9XA 4KHSA 4B9LA 4NLGA 3H4DA 3LP3A 4ECRA 3DM2A 4DQPA 3HVTA 4KTZA 1MMLA 5FDLB 4NLQA 3GILA 4GC6A 4WFXA 5KFHA 4FLXA 4EBDA 3DM2B 5KFUA 2XWYA 4ED7A 3HVTB 1BIUA 4KHNA 2BQRA 1XHXA 4HKQA 3DRSB 3ZSQA 1SL2A 4KB1A 2XCPA 2UVVA 4O3RA 4IQXA 3WNEA 1ZTWA 3MXMA 4LSNA 3SV3A 2ILYA 3KD5E 3BGRA 3CM6A 4WYLA 1LWEA 5CYQA 3OYNA 5KFOA 3OJSA 4BE1A 4LSNB 1JLBB 3CYMA 3OYAA 1NOYA 3BGRB 4MIBA 1VRUA 2ETJA 1LWEB 4DFPA 5CYQB 3SUOA 3D28A 2HHTA 3CQ8A 2E6MA 4IRDA 3AO5A 4G1QB 3U6FA 1NK4A 4E7LA 4Z4GA 1VRUB 4MK9A 4H4OA 4E1MA 4Z4IA 4CE9A 1N4LA 1YTAA 3KD1E 3Q8QB 4KTWA 3V9ZA 4H4OB 3HPGA 1HYVA 3T5LA 1DLOB 4ED3A 1TKXA 2OZSA 2UVUA 2BDPA 4B9TA 3HVAA 3RBDA 2HHVA 3E01A 4DG1A 4DL3A 3HPHA 2UUWA 4FJ8A 3KMSA 1HRHA 3NBPA 3SJJA 2AGQA 1ZBIA 1TKXB 3O3GA 3E01B 4DG1B 4TQRA 3HP9A 3NBPB 2WCXA 1KLNA 4KB0A 4I7FA 3N6LA 2ZE2A 3C95A 3SFGA 4FS1A 4I7FB 4CF8A 3LDSA 3D45A 1C0TA 3PY8A 2ZE2B 4E1NA 5I3UA 4FW2A 4Q45A 3AO1A 4CFCA 3BSAA 2XY7A 1RT1A 1QHTA 1C0TB 2HVHA 4ELUA 4QWCA 3V9WA 5DG7A 4DTXA 5I3UB 2HB5A 4FK2A 1WSFA 5C24A 2V9WA 1RT1B 4C8MA 4UQGA 3RB4A 4NYFA 4PQUA 5C24B 1NKEA 1QE1A 4IR9A 4FJJA 3SPYA 1L3TA 1F21A 2O4IA 4OGCA 4E19A 1QQCA 2R2RA 1WNEA 1QSSA 3SV4A 4PQUB 1BGXT 1QE1B 4AHTA 4LH5A 4DU4A 2C28A 4XO0A 1D9FA 3OS2A 1SUQA 2DPIA 3K5LA 4KI4A 4O3OA 5HRNA 2VWJA 4FJXA 3KHGA 3ZSZA 4ELVA 4DSIA 1KVBA 4C8LA 3TWHA 1SUQB 3TARA 4GW6A 2PZSA 1RNHA 4ZPAA 4IKAA 2WK4A 2JGUA 4CFAA 1VSIA 4NLUA 3RRHA 4ID5A 4RG8A 3RR8A 3OYLA 5EWFA 2ZKUA 3DLRA 3ZT2A 2AU0A 5J1EA 4AHSA 2W9AA 1WSJA 4ID5B 5KFSA 3MR3A 2RN2A 4B9MA 2BANA 5L9XA 2IOCA 4ZMMA 3HHKA 5F8LA 5J1EB 1C1CA 3GV8B 1XR5A 3OSPA 4F2RA 1N56A 3IAYA 3OYCA 3HSTB 1VSLA 1C1CB 4E0DA 4AILC 3CWJA 3AVNA 2GUIA 2E6LA 2X78A 4M3XA 4QWBA 1S1XA 2HNZA 1JLEA 1T05A 3M9OB 1K1SA 3MXIA 1GOBA 1GOAA 3FDSA 3DMJA 1O1WA 2HNZB 1JLEB 1HMVA 3SUNA 4CGFA 3RWUA 3THVA 4ED6A 4FM2A 4IG3A 1CXQA 3DMJB 1TVRA 2KW4A 1SKWA 1HMVB 1FK9A 2W9CA 1U04A 2P5OA 4L8RB 4IG3B 4QAGA 3H2LA 3OYHA 4PA1A 4CEBA 4O3QA 3SI6A 4K8ZA 2VG6A 1FK9B 5L1LA 2W9CB 5C25A 1CLQA 3PVXA 3IRXA 2VG6B 4O0JA 1NJWA 5C25B 1S1VB 4DLEA 2W7OA 3SUQA 3GIMA 3E51A 4RNHA 4CECA 1SKRA 4DMNA 3IRXB 1C6VA 1A5VA 4HYKA 3UQSA 5KFXA 5J2PA 3DRPA 4CIFA 4CJEA 1S10A 3G86A 5J2NA 3RAXA 1ZBLA 4CJWA 4DWIA 2ASDA 4MKBA 5J2PB 3DRPB 4CEDA 4LH4A 4F4KA 1NJXA 3HVWA 3LZIA 1NOZA 4K4YA 4FJMA 3H5UA 4RNOA 1GOCA 3EYZA 2B6AA 3S3MA 4JS5A 3AVAA 4FJLA 4IRCA 4XPEA 4Q8EA 3VQDA 1ASUA 4NRTA 3VQBA 4E89A 3OYBA 3HJFA 4ECYA 2BRKA 2B6AB 4NLXA 3V6HA 4J9SA 2A1RA 4ED8A 3RAQA 2R7YA 4AHVA 3O4QA 2D3UA 3LAKA 3GIIA 4CFBA 4OVLA 1B9DA 3B6PA 2IM3A 5KFFA 3V1RA 1Y97A 2HW3A 3DLKA 1SH3A 1NHUA 3LWLA 3LP2A 4K4ZA 3NGYA 3OYIA 1UA0A 1KLMA 3DLKB 1BIZA 3AO2A 1WNSA 3QLHA 3NF7A 4EZ6A 2QKBA 3AO4A 1B9FA 5HRSA 2V4QA 3PV8A 3PX4A 5KFYA 1KLMB 1RA6A 4MK8A 3KMQA 3QESA 4K4TA 2P1JA 1RT5B 1VSHA 4FJNA 2YNGA 2CKWA 1Q9XA 3OS0A 4CGHA 2IC3A 3QEPA 4Z4FA 1XHZA 5L1JA 4JLHA 4FW1A 4EO6A 1RBUA 3SNNA 3QIDA 2GIQA 1QSLA 3O3HA 1QAIA 3NAIA 2IC3B 1WLJA 2NUBA 3BREA 3DLGA 1MU2A 3VQ9A 3NCIA 4OPJA 4DTOA 3MR5A 1S9EA 3DYAA 4CJVA 4CJ5A 3VQ8A 3DLGB 3TABA 1MU2B 3KLIA 3PR4A 2G8WA 1BQNA 5KFDA 1S1TA 2IMWP 3GV7B 1FKOA 1S9EB 3DYAB 4ZVFA 3UPFA 5KFBA 2HWIA 3V81A 1A5XA 3IG1A 3MEGA 3HM9A 2FJVA 1D8YA 4CEOA 4KI6A 2B4JA 1BQNB 4JRQA 3KHLA 1S1TB 1FKOB 3KLVA 4WFZA 4Y1CA 4K4VA 4RW8A 3V81B 3IG1B 3MEGB 2HNDA 5KFAA 1JIHA 4F4YA 1X9MA 1RT4A 5F8IA 1VRTA 1RBSA 3NGZA 5KT3A 4RW8B 3Q8SB 1ZETA 2HNDB 4M42A 3RB6A 3EZUA 2FVSA 2RDJA 1VRTB 3I0SA 2XGQA 4CJRA 5KFEA 3NH2A 4AH9A 4RU9A 2XI2A 1CXUA 4QWAA 2OZMA 3TAMA 1LAWA 3I0SB 4W5RA 1ZYQA 3L2RA 4KKOA 1S9GA 5KFZA 4X2BA 2WOMA 2W9BA 3V9UA 2F8SA 4RW9A 4CJKA 3TAMB 1SH0A 3I5AA 4O0IA 4KKOB 2WB4A 3F9KA 1S9GB 4BDZA 4E7IA 3QERA 2WOMB 2W9BB 4RW9B 4J9LA 3KLEB 5KG0A 4ZVEA 4ECQA 3DOLA 4FK4A 1BL3A 3RMAA 3NAEA 2OPSA 4CJFA 4RNNA 2JC0A 4O3SA 1KTQA 3HP6A 3DOLB 4CCHA 1J5OA 2BQUA 4ZP7A 1RBVA 1RDCA 2OPSB 3M9NB 1BHLA 1TAUA 4PUOA 2V4RA 1RAJA 3NH1A 4HCBA 3ASMA 4FJHA 1J5OB 1TGOA 3U3GA 3NF8A 3WNFA 3T5KA 5EWGA 4HUEA 3ZSVA 4PUOB 4WXOA 4J9QA 1ASWA 4CHPA 4WZMA 1BQMA 3HVRA 3K57A 4RW4A 3L2UA 4Q0BA 4ZPCA 4TY8A 4Y1DA 5EWEA 3TR8A 1BQMB 5F8NA 3BSCA 1QSYA 5T7BA 4RW4B 2CJQA 4Q0BB 3AA5X 3KHRA 4TY8B 2KQ2A 1JLQA 2EHGA 2KFZA 4WYWA 4LSLA 4KHYA 4KV8A 4URSA 3TQ1A 5KRTA 4IFVA 2AGOA 4OKEA 3LALA 4MK7A 1JLQB 3DRSA 2QV6A 4FS2A 4DF4A 4LSLB 5KG1A 4KV8B 4IFVB 1RYSA 3M8SA 2QXFA 3FQLA 3OY9A 4ED2A 2DFHA 5JS2A 3RTVA 1B92A 4E3SA 2DY4A 1WSIA 3OL8A 3VA3A 3OYKA 3HKWA 3OYMA 3AA2A 5DQGA 1S6QA 2Y1IA 3DI6A 4XPCA 1JLBA 3RBEA 3NHGA 4B9UA 2G8VA 4CF2A 3KIOA 3CM5A 1S6QB 1HNIA 1S5JA 4YR3A 4G1QA 3CDWA 3DI6B 4WE1A 1ZBFA 4TN2A 2BRLA 4M3YA 4K4WA 4NCBA 2ASLA 5L1IA 4ZTFA 4EP4A 4ZTJA 1HNIB 2AWZA 5KG6A 3S3OA 5CZ1A 4WE1B 1YT3A 3MXJA 4K8XA 2VG7A 1RDRA 5KFMA 4KB7A 1Z26A 4J2BA 3OJUA 2FBTA 5KFNA 3CFOA 2ALZA 3H59A 2BGGA 4MKAA 4DQQA 4RW6A 1YVFA 1DLOA 2VG7B 3VQQA 4B3OB 3VQ5A 2ATLA 4NZ0A 4BE2A 1VSEA 2Z1JA 3MEDA 2Q3SA 3TAEA 4RW6B 3H40A 4YP3A 4Q44A 3K58A 4CJLA 5EUHA 3L8BA 3QGGA 2J6UA 5DLGA 4DQIA 3MEDB 4IH7A 4DFKA 1NKCA 5HROA 4KFBB 3KJVA 1BISA 4YQWA 5HP1A 1HARA 5JUMA 4EBEA 2IGIA 1D9DA 5D3GA 2YNIA 3SQ4A 1KCFA 3DLBA 4TLRA 5HROB 3KJVB 5HP1B 3JYTA 4CGDA 1RBTA 5D3GB 1NK7A 2YNIB 4M95A 4NYZA 4I9QA 3RB3A 1RT6B 1RTIA 3AVMA 1IKYA 1JLCA 3JYTB 3AVLA 4F3OA 4FZXC 2WONA 3BDPA 3RMCA 4RUCA 4PWDB 1CZBA 4JRPA 3ITHA 5KFCA 1RTIB 1IKYB 1JLCB 3ISNC 4ECVA 5L1KA 3QIPA 2WONB 4DL2A 3TAFA 5KRSA 1C1AA 3T1AA 3LAMA 4DU3A 2EC0A 4GC7A 3ITHB 4M45A 1T3NA 4F50A 4FLVA 2VG5A 1S97A 3QIPB 3LP0A 3ZT1A 4WZQA 2HVIA 5I42B 2WRMA 2RDIA 1TV6A 4OKJA 2VG5B 3LP0B 4EYIB 2IA6A 1WAFA 4M3RA 4URGA 1TV6B 1HJRA 3BQ1A 3OYFA 4CK2A 4M3TA 3AA4A 3Q8PB 3V1OA 3A2FA 5DK5A 1Z4UA 5F8GA 2GC8A 4FCYA 4DTJA 3UDLA 2DTUA 3QYYA 4HCCA 2D0BA 4DSEA 1QUVA 3PX6A 3MF5A 2BR0A 4Z4EA 2E9ZA 2WTFA 4KHWA 4TXSA 4KAZA 3PZPA 4NLVA 2W7PA 3MAQA 1SL1A 3L2VA 3NGIA 3SUPA 3I8DA 1FXXA 5F8JA 3AVHA 3IS9A 2HHQA 4CJUA 5DQIA 2F96A 4ZP9A 1L5UA 1VSKA 3EPIA 4B8CA 2E9TA 3IS9B 1I39A 1VK0A 1LV5A 3Q8RB 4FJ7A 2KFNA 3C6UB 4LQ9A 4RNMA 3ZCMA 3I5BA 2JEGA 3G10A 4EBCA 3KLHA 3L3UA 2JEIA 4E7KA 4NRUA 2PYLA 4R5PA 3AVGA 3KLHB 2HHUA 4EZ9A 1S0NA 2AGPA 5KFPA 4R5PB 1XR6A 3C6TA 4H54A 3QEXA 1J9AA 3DRRA 2RPIA 4CIGA 3RMDA 4Y34A 4ED0A 3PR5B 2E9RX 4M3WA 4ICLA 1YTUA 3C6TB 5JS1A 3BR9A 1JL2A 2OYQA 3DRRB 3OHAA 3ZSXA 4CK3A 1S1VA 4ICLB 3PX0A 4O55A 4DL7A 4H4MA 4CHZA 3V4IA 5KTQA 1QS4A 3K5NA 2YV0X 1U48A 4O4GA 4IOBA 2XY5A 3S3NA 4BDPA 4CF0A 1NK9A 4ZPDA 4H4MB 4K4SA 3V4IB 5KG2A 4U6PA 5KFTA 4NCAA 4CGGA 5FRNA 1NK0A 4O4GB 1S1WA 4K4UA 5KI6A 1TK5A 4LQ3A 3KTQA 1RDBA 2OH2A 3O3FA 1R0AA 1RYRA 4CEZA 4KBIA 1S1WB 4DQRA 5KT4A 3PUFA 3RRGA 2F8EX 4QW9A 4OLBA 1T03A 3I0RA 4CEAA 1R0AB 4B08A 3QEWA 5KG7A 3LANA 4NLOA 4IBNA 3CG7A 4CEEA 2J6TA 1T03B 4JS4A 4BWMA 4TY9A 3RMBA 2B5JA 3I0RB 1NJZA 1RBRA 5SZTA 1EETA 4TQSA 1IO2A 5J2MA 4IKFA 5JXSA 4DTSA 1RT3A 2B5JB 1YVUA 2IM0A 3OHBA 2XGPA 1KHWA 4FLWA 1EETB 4ZP6A 5J2MB 2D0AA 1RT3B 1TKZA 4N56A 4M3UA 4F2SA 2UVWA 1N48A 2GV9A 3NFAA 1TKZB 1X9SA 2ZQBA 4QCLA 2I5JA 4AHUA 3CO9A 1Q8IA 4QW8A 3TANA 4O3PA 5C5JA 3D5MA 4CHOA 1RT5A 1L3UA 3HK2A 1JLAB 3MECB 3T19A 1RTHA 2I5JB 3H4BA 4F8RA 2XO7A 4DSLA 4J2AA 2OA8A 1RTHB 4CK1A 5DGBA 4E7JA 3ZSWA 3MTKA 3AVCA 1JXEA 4CEQA 2D41A 3AVIA 2VA3A 3VQ7A 3SQ1A 3MEEA 1XI1A 1D0EA 2F8TA 3ALYA 2XC9A 3PO5A 5KG4A 3SI8A 4CFDA 4RNFA 4YR2A 4CJ3A 3CIZA 3MEEB 3M8RA 3NKYA 5DMRA 5CY4A 3I5CA 2VA2A 1WSEA 4B9VA 1LWCA 4FLYA 2FJWA 1D1UA 4C8NA 3JSMA 3G6YA 4IDKA 1UAXA 3EPGA 3PW4A 2FJXA 1WSGA 3FRZA 1XWLA 1LWCB 3H98A 3G0ZA 3ISND 3JSMB 4IDKB 3SQ2A 1NK5A 2AX1A 3DOKA 2R8HA 3EZ5A 3K5MA 3LWMA 2LSNA 2C22A 1S4FA 4MH8A 3SQ0A 3VQCA 2IM1A 3DOKB 3GQCA 3T5HA 3AVJA 2P5GA 1U49A 1RT7A 4EEYA 3P5JA 1W0HA 3QGHA 4HHTA 4Z0UA 5E41A 3KLFA 2HWHA 3KLEA 4DFMA 1RT7B 2R2TA 1IG9A 2RF2A 1T94A 3OYJA 5KFJA 4WFYA 3KLFB 4WXWA 3T5JA 5F9NA 3SYZA 1Q9YA 3LP1A 4AHRA 4FBTA 2RF2B 5HLFB 2ATQA 4MIAA 1S49A 5KGXA 3KNAA 4BWJA 4TYBA 3LP1B 1JXLA 1KRPA 2XRIA 4KAIA 2X6SA 5C42A 4Y3CA 1JL1A 5DQHA 4W5TA 1VSMA 4DSFA 1VSDA 4C8OA 1QAJA 3NAHA 5KT5A 5C42B 3H5SA 2KZZA 2FBVA 3HXMA 2ITGA 3QEIA 3SZ2A 2RKIA 4CF9A 3GIKA 1CSJA 4CESA 5KFRA 3CDEA 4NLDA 3OL9A 2RKIB 3OL7A 2D0CA 3CJ3A 4ZHRB 1C2PA 1KFDA 3HO1A 1HQEA 3DDKA 4IR1A 5CZ2A 2A1SA 4CJTA 3UR0A 2HMIA 3HYFA 2JLEA 1QTMA 2W8LA 1HQEB 2AX0A 4FJ9A 4O44A 3NL0A 3L2WA 2WHOA 2Z1GA 2YHBA 4ID1A 5KG3A 3VQSA 2ILZA 4CGJA 2HMIB 3VQPA 4J9OA 3HPOA 4JUZA 3CJ4A 4O44B 1KFSA 3AO3A 2VWKA 3BJYA 3K2PA 2ZD1A 4FJGA 5F8MA 5FROA 4YMEA 4BACA 3CDUA 1X9WA 4JV2A 3D0PA 2HNYA 2O5DA 4MFBA 4ZVHA 1HYSA 5K14A 3CFRA 2ZD1B 4CGIA 5EU7A 3AV9A 5KFIA 2W42A 1KHVA 4TYAA 2HNYB 4MFBB 4KRFA 1HYSB 4R0EA 4NYNA 5K14B 4J9MA 2R8GA 2G8UA 2IJNA 4J9NA 2C2RA 1EX4A 1NNDA 4PY5A 3FFIA 1S0OA 2YNHA 3AVFA 3IGNA 4DSJA 3PW0A 1IKXA 4Z4HA 3FFIB 1S9FA 2YNHB 2EX3A 1ZBHA 3OYEA 4B3OA 4DSKA 1TQLA 1ITGA 1IKXB 1HYZA 3CJ5A 1S0MA 4YFUA 2C2EA 1RCHA 4DQSA 4DS4A 5DGAA 4BE0A 3G6XA 1RTJA 3K59A 3UIQA 4BDYA 4KFBA 4OGEA 3VQEA 4XIUA 2YKNA 1Z25A 4IH5A 4DLGA 3TAGA 1I3AA 1RTJB 3FSIA 4ZPBA 4URQU 3M8QA 3OSNA 2YKNB 3NE6A 3BQ0A 4ECSA 1RT6A 4NLYA 2X6NA 3NGDA 4N47A 4I2PA 1EXQA 3M8QB 1LW2A 4PWDA 4N5SA 5KFGA 1K1QA 1JX4A 1BCMA 4I2PB 1LW2B 5DG9A 1EKEA 2BE2A 3IN5A 2XY8A 3QNNA 3KHHA 3B6OA 3SPZA 4W5QA 1U09A 5KGWA 2BE2B 3FQKA 5I42A 4J2DA 3GIJA 1KVCA 4OPKA 1C0UA 2G8HA 5KFWA 1SH2A 3V6KA 4ELTA 4DTMA 3O4NA 1EP4A 1C0UB 3MFHA 4ECXA 3DLEA 2FBYA 1EP4B 5SWMA 4FYDA 3CJ2A 1C1BA 3QO9A 2HAIA 3DLEB 4DEZA 3PJWA 3KKRA 4CERA 5HBMA 3QNOA 1FKPA 5KFKA 1DTQA 2B43A 4G3IA 4DTNA 4GVMA 1RILA 1C1BB 3QO9B 3OYDA 5HBMB 1FKPB 1T7PA 1DTQB 4Q43A 3KKSA 1TK8A 4DTRA 1IH7A 4FM0A 2KZMA 4DL6A 4Q8FA 3ZSYA 3TAQA 4DL5A 3QINA 3WNGA 4ZVGA 1SKSA 4OJRA 2QE5A 3N6NA 4FVMA 1ZBUA 4FBUA 2FLPA 3VQ6A 3L2QA 5DLFA 4HVJA 5KT7A 2PYJA 3NF9A 4LY7A 2R2SA 3SCXA 4HUGA 1NHVA 1ASVA 2XHBA 1WN7A 2PY5A 1IM4A 2JC1A 3P1GA 5KG5A 3C6UA 5F9LA 5KFLA 2FLLA 2R8JA 4C8KA 2G8IA 2E4LA 2D3ZA 1SV5A 4RUAA 3PO4A 4FZZA 3P83D 2R2UA 4IFYA 3N6MA 4QWDA 1SV5B 2BANB 4GMJB 4FJ5A 4KE5A 3MFIA 4IFYB 2XCAA 4N41A 4N76A 3AA3A 2YNFA 2G8KA 4CJPA 4F4XA 4QWEA 4OKKA 3H5YA 3MR6A 3OL6A 3NMAA 4NLSA 2YNFB 4CJ4A 1UWBA 3V6DA 1S1XB
chains in the Genus database with same CATH superfamily
3HOTA 3FR0A 3AVKA 4AM7A 3EY1A 1L3VA 2CQ0A 3AQOA 3IXQA 5BR9A 3KK3A 5I3PA 2NXUA 1VQ7S 1NK8A 2AQ4A 1WOSA 3E66A 3W62A 5E33A 2KTQA 2CWXA 5I9EB 1EZZB 4ECWA 3NMUA 1HNVB 1N6QA 3TQEA 3Q8YA 2MLXA 3TVKA 4OX9F 4A8SA 2HRUA 3POTA 2DPJA 4HTLA 1VQON 1HX1A 1GMWA 1TL4A 1T6DA 3LPTA 2UYTA 3T1HK 2IYIA 2H5JB 2PMWA 4LF7J 4IO9L 5AQTA 4DB3A 1X1PA 2V8PA 4CIEA 4MQ3A 1D4XA 2Z2YB 5B7WA 3KK1A 2CQ1A 3Q83A 1TYQA 5BYSA 3BQ2A 3PHEA 2JEJA 5FRMA 2OPRB 1TL3B 2NPIA 2IAJA 4CD3A 1URRA 3GL1A 1T8EA 1PYOB 2IM2A 2DFFA 1RAAB 2NNWA 3FZHA 4ANEA 3RAMA 2DH9A 3F73A 4JV1A 1GLJO 4OHVA 3GV5B 1A5WA 2XS2A 2VDHA 4HHHA 4CJSA 1NJYA 3RUBL 1CZ9A 3UKUB 3EM1A 4ECZA 3J80Y 4XDCA 1IKVA 2GQCA 2ZBQA 4USVA 3ZSRA 1GXLA 4K41A 1U7LA 4CD1A 4CEFA 1EWQA 3NS7B 1J5EK 2VKZG 3IMQJ 4YOEA 4FXDA 3MM8B 1IXKA 1GXTA 3OVNA 2RUSA 2D0OA 2JWLA 4FJIA 3LA0A 4KGXB 4X4QA 3LP2B 4OYIA 2PI5A 1KWMA 4DFJA 4O3NA 3CSKA 1JLFA 1FVSA 2P51A 3MR2A 4F0KA 1VRQC 1MWKA 1K8KB 2QM1A 1HPZA 3FEXB 3ENQA 5LJ5Y 4WFAQ 4RZRA 1XBWA 2YNGB 3PXGa 2D5RA 3V9SA 2M88A 4CI6A 2MQ8A 3HHLB 1JXBA 2F7TA 1BI4B 3OLBA 4CH0S 3HFZB 5FD1A 2ZJQL 3GYNA 5AQNA 3OVBA 3KK2B 4B1UB 5HL7L 2ASOA 4OX6A 4QOTA 2YWEA 2AJ4A 1T9WA 4DV5K 2BM0A 3BKTA 2HZVA 1RQ0A 1HWJA 3VZHA 2M8DB 4LVOP 3HCXA 3NWRA 3LPEA 4V19S 3CEDA 2XMMA 4ZP8A 3T3FA 1VS3A 3OTDA 3K0JA 3TAPA 3WC2A 5D4LA 1MROA 1EAYC 3LDPA 3AXKA 1RT4B 5ETNA 2NRVA 4NLTA 1T02A 4FOIA 4ILLA 3BZCA 5HLFA 5CH7B 1WG5A 1N33J 3QRRA 4DX7A 4M3ZA 3BSNA 3QZ7A 3HHEA 3ZT0A 4B9NA 3M8PB 1QZ6A 3PW2A 2QLJB 1YI2N 1WC3A 2FC0A 3AGRA 3AA8A 1FESA 3G8TA 2Z8QA 1REVB 2BTFA 1ZOTA 3HHNB 3G6VA 4C0BA 3T1YJ 5CYMB 2FQQB 3FBFA 1IR0A 4M5IA 3QB0A 2X74A 3NVKA 3QGIA 2IRUA 4WQ5C 4QR0A 2ROPA 2KT3A 5K8OA 2WC9A 3O1WA 3PSIA 1FTRA 5HQLA 4YNQA 3AD9C 3MCMA 3EDRB 2YHAA 4NCGA 3Q7BA 1UMJA 1IKWB 1UZHA 5E84A 1ZM4A 4QIWD 1LK5A 1U8SA 1JLGB 1H3DA 1WHWA 2O8DB 1Z1ZA 4IH6A 2KU7A 3UR3C 2HIYA 1FRXA 3K5OA 1Z05A 3A12A 4JI5F 4KHUA 1UA1A 4Z2XA 2RILA 1TP7A 2KVIA 1JJ2R 5AQSA 5GAHI 2IVMA 4B9LA 3DM2A 3UNGC 4KTZA 3GZ7A 3AODA 4X66J 2LEBA 2KKHA 5KFHA 2ZKTA 3IUCA 2O8BB 3HVTB 4QS8A 3F2KA 2LXIA 1WOQA 4KB1A 4NA2A 4TLQA 1ZTWA 1LFPA 1UP1A 3D6MB 2PDAA 4LSNA 1M5VC 2HSEB 3IC1A 3KD5E 2PIIA 3R8EA 1DJ0A 4YS2A 4FZVA 3ZNUA 4Y65A 2Z2MA 4U7UK 1XN9A 5M1OA 5CHIA 3BGRB 4MIBA 2PA8D 2YKPA 3GFYA 2ETJA 3RU0A 1A7GE 3D28A 1WDTA 2E6MA 1NGIA 3UN3A 1NK4A 1SZ2A 4E7LA 4Z4GA 4WFBL 5KOWA 4H4OA 4AXJA 4Z4IA 2O8FB 1RWUA 4P6QA 4FYYB 4AFFA 4BRGA 1FJCA 3Q8QB 3V9ZA 3O3LA 2N4CA 3T5LA 2NXEA 3UW1A 2XSFA 1TKXA 2OZSA 3RBDA 2HHVA 3IM9A 4U67Q 4DL3A 1BG3A 2UUWA 4FJ8A 1NB2A 3SJJA 5GAHP 3W63A 1RACB 3PYDA 3OTOF 1ZAVA 4O0NA 1N33K 2CPIA 2OTJN 4TQRA 2PFUA 4MLHA 2WCXA 2VPZB 3BPSP 2VBZA 2C2NA 2H65B 3N6LA 3SDEB 2Y0SD 4IEEA 4K5RA 4GKJJ 1H2VZ 3WIUA 4I7FB 3MN9A 4ES1A 1DURA 4FW2A 1NGJA 3BSAA 5ETRA 3T1YK 2DEJA 5T41A 4C3LA 1C0TB 2HVHA 5I3UB 4PXEA 3D1HA 1IWGA 5A8RA 3GCXP 4V19J 5DDQC 4J37A 3F0NA 4NYFA 1E6VB 4PQUA 1NKEA 3SAFA 3J7AN 2NYHA 4ZPVR 4OGCA 1QLNA 4AUKA 5HO4A 5K20B 3WXKA 3ENHA 5D15A 3TTCA 4E2FB 1QVFM 1D9FA 3OS2A 3FMBA 3K5LA 2KFYA 2IRYA 1HBUB 5GAEI 5HMZA 1VGYA 2XQCA 1VQSA 1MWQA 2VWJA 4ZLJA 2DJWA 2Y1LB 1SUQB 2MLZA 1HKCA 4ZPAA 3O4WA 1X9JA 1KBRA 3UD4P 4Y2KA 4CZFA 4X66K 3GLJA 5C2FA 4M5HA 2BUPA 3OR2A 5DJBA 1VBXA 2E5HA 2ZKUA 1TL7B 2E1MC 4ID5B 3MR3A 2R7SA 4B9MA 5L9XA 2KH9A 4ZMMA 5J1EB 1OH7A 3GV8B 3CCTA 3RG6A 2DKOB 3VAKA 3CF5Q 3OYCA 1SIWB 1OO0B 1VAZA 5A6PA 3KFWX 5HJYA 2H3EB 1XNRK 2X78A 1S1XA 2HNZA 4IFEA 4ISGA 1KR4A 1TFYA 1GOBA 1Y3JA 1NMEB 3EE9A 3VWSA 3K17A 1JLEB 1NSPA 4OLPA 4I6WA 2AV5A 3EE3A 1WG1A 4CGFA 3RWUA 1V6HA 1TVRA 1B3TA 3J7YI 3T9NA 4M5NA 5EOYA 1Q82O 1VC0A 3L09A 8AT1B 2ZWPA 2CQ4A 4PA1A 2MSSA 1CJVB 2IMOA 4K8ZA 3TA2A 4JKGB 1CLQA 1N8RO 5CXTA 5GAEP 2FDNA 2KO1A 3HHLC 1ESVA 1EQYA 2POKA 1NJWA 4UUWA 5C25B 5LMNJ 3MD1A 4DLEA 3R1LA 3GIMA 1Y4ZB 2J9DA 4CECA 1SKRA 1P1LA 4DMNA 3IRXB 1LQ9A 3UVJB 1SJFA 4FSVA 5KFXA 2WSEC 1ZA2B 1OIAA 2ASYA 3FUYA 2FJEB 4CJEA 4CLYA 1UCNA 2V8GA 4GKJK 3H3OB 5J2NA 2CQBA 1ZBLA 3J7ZO 2PA3A 5J2PB 2KHCA 1NJXA 1HKBA 2GVDB 4K4YA 2UXCF 3H5UA 5A8WA 4C11B 3R2CJ 3EYZA 4AF1A 4AQYF 3AVAA 4IRCA 4XPEA 4Q8EA 5ETKA 3VQDA 3CQXA 3W3DA 1ASUA 4E89A 3HJFA 4EFHA 2K7JA 2C2ZB 4DR6F 4NLXA 3V6HA 4J9SA 2ASMA 2LU1A 1UL3A 2HQIA 5RUBA 2CGLA 1JQGA 3O4QA 2A3ZA 3JAMU 3GIIA 1X4DA 1VBZA 3V1RA 1UW9A 4WKRA 1CC8A 2HW3A 3J7YP 5AJ3K 3HOSA 4B3RF 3NGYA 2X3DA 1KLMA 1SJ3P 3P39A 2HAFA 4GY2B 1IWAA 4I6YA 3SQOP 3AO4A 2GVZA 3M6UA 3MOZA 3U1MA 4DBQA 5HRSA 3GCWP 4WQ4C 1Y3KA 1RA6A 4BR4A 1FD2A 3VGVA 4AD6A 3M2RA 2WBRA 1KQSR 2DCLA 1V3ZA 2CKWA 1YK9A 1YJRA 2QI2A 3QEPA 3GIRA 2XLKA 1XHZA 4EO6A 4CZLA 2F9DA 1AYEA 2QMUB 3QIDA 1NMDA 1QSLA 1RDWX 4BRHA 5IC6B 3O3HA 2IC3B 1NCLA 3UKRB 3VQ9A 3BZKA 2GEMA 2UXDF 4DTOA 3W3SA 1PAEX 3DYAA 2YKQA 1A9NB 4DR1K 3PM9A 1M5KC 1WC6A 2VU5A 1FWPA 3ZYYX 1S3XA 5JVGL 1FKOA 1Y7PA 4DV4F 2YX7A 2JOQA 2DGXA 2QLWA 2FJVA 4PKGA 3MCOA 2AP6A 1TUWA 3KHLA 1S1TB 2J9DE 3IKMA 4WFZA 2DNMA 1RHRB 4K4VA 3V81B 3FE1A 3MEGB 1H2UX 3DC2A 5KFAA 3I6PA 2PEHA 4F4YA 4KH1B 4JI3F 4JI4J 4RW8B 3Q8SB 5EX3A 3EZUA 2FVSA 4K0KF 2O8EB 3CC2S 1VRTB 1SJRA 3JQJA 3VGLA 2APOA 3NH2A 3KKFA 4EMDA 4I6MA 3MMBA 1CXUA 1IBKJ 3TAMA 3AY0A 4ID8A 1Q78A 1WD6A 3U1LA 2V69A 2MQOA 1X4FA 2NR0A 1BWVA 4BREA 5KFZA 3ZZUA 4FF1A 3I5AA 2Q1LA 4KKOB 3F9KA 2P5VA 3I9ZA 4JKHA 4H0PA 3KLEB 2E2PA 1CS4B 1HNWJ 4PAAA 3ZZ0A 1YWXA 3OFGA 5L38A 4LSZB 3DOLB 2BQUA 2OFGX 4PPDA 3VGUA 3RVCA 2OPSB 2YX1A 3QRPA 4HCBA 1VQNS 1TGOA 4ZKAA 2H1YA 3WNFA 4P7VA 3K8VA 3B8HA 5IQ6A 4PUOB 1VK8A 1VK3A 2WVEA 1AFJA 4WZMA 3D2EB 2AEMA 2B4PA 2XS7A 2CDRB 4ES3A 2ZJRL 3SQGA 3CC2N 4ZPCA 3G8QA 4TY8A 2VH7A 1KP6A 3CW2C 5F8NA 4RW4B 4Q0BB 3AA5X 4QQBA 3OW2M 2EHGA 1JCFA 3CCVS 4JI2K 3MAAB 1VQLS 4K7QA 5KRTA 5EX0A 2P9PA 4OKEA 4MK7A 2B56A 5E26A 4LSLB 4IFVB 1R31A 2QXFA 3FQLA 3OY9A 4ED2A 4E3SA 3HMJG 3LTOA 1J5EF 3OYKA 3HKWA 3MURP 4CLSA 4JI0F 4ZLNA 3HSCA 1FFGB 5HMYA 4Z7YA 1KD1O 4DR7J 3NHGA 4DDFA 3R7NB 3THWA 1S6QB 2GAHC 2OHDA 5H9FK 1HNIA 1S5JA 4YR3A 3CDWA 1OKJA 3ZTQA 2ASLA 5L1IA 5DETA 1RHQB 4OZLA 2QA4S 2P9KB 5HMXA 3M32A 3VAMA 4AM6A 2PO4A 4K8XA 1YVNA 2LQ9A 3LQVA 4AT1B 4KB7A 1Z26A 3R6LB 2B0GA 1NBWA 3H59A 2DGVA 1SC3B 2VIHA 2GO8A 2RRNA 2Q3SA 3TAEA 1VQLN 1PKUA 4Q44A 1PC4A 2XSJB 4OI0A 3CCLS 3B8AX 4DV5F 1P6TA 5HROA 3J7Z5 3UB5A 2QJ3A 1D9DA 2IVNA 1IBKK 3GFXA 3CO0P 1F60B 4WKYA 3R97A 5HP1B 2V8VA 4R25A 4KRWA 3DLJA 2QFIA 1DZ5A 2YNIB 4C1NI 4M95A 2ZC4A 2ZFHA 2FHMA 1RTIA 2MKCA 5LSLA 1IKYA 1JLCA 3JYTB 4FZXC 2P9GA 3AJDA 3CCZA 1HNWK 5E3PA 3ITHA 2VASA 1UJ5A 3UE5A 4YOUA 4X4PA 4NX9A 3DU6A 1H2TZ 2QA4N 4GC7A 5AQIA 2XMVA 4CYUB 2RS8A 1T3NA 4F50A 4FLVA 2ZBPA 1WACA 1S97A 3QIPB 2HVIA 5AQMA 4OYBA 1N5TA 1TV6A 2RDIA 1M1HA 2J0WA 2XMJA 4WBFA 1X5PA 4GO7X 3LP0B 4LR9A 4URGA 3CCLN 3E1YA 3BQ1A 1N34J 1RP5A 3KDOA 5DO2A 3A2FA 2RDDA 4FCYA 3OTCA 4EFAC 2LYVA 2DTUA 3ZZPA 4LRAA 3R7BB 4FWQA 3QYYA 4MKYA 4DR5J 4DSEA 1QUVA 3PX6A 3GYGA 3MUTP 2BR0A 1Q79A 2P9SB 4Z4EA 2E9ZA 2LLZA 4TXSA 1SIZA 1XC3A 2BV3A 5AXNA 3IS9A 2HHQA 1H6KX 2QWNA 4C0HA 2VWBA 3QGPA 1YJNS 2H48B 2E9TA 1Y5NB 4AL6A 1I39A 2QA1A 4DR7K 1U25A 3D2WA 1O5JA 2ZHAA 1WJ9A 3M2VB 4DV2J 1CBKA 1UVKA 3ZCMA 2BJDA 4DV0J 1F2HA 2JEIA 4KGMA 1Q16B 3VAFA 3OHRA 3SK3A 4EZ9A 3TZXA 4RBVA 3B78A 3UDVA 4TU7A 2D1CA 4H54A 3QEXA 1HPMA 3ONQA 1J9AA 5D4OA 1RWMB 4FKYA 1V4SA 2VBYA 1ZS6A 3IFRA 1M1KT 4CLUA 2HGLA 1GK8A 3DRRB 1WB9A 4CK3A 1S1VA 3Q23A 3C16A 4KH4A 4ICLB 4RCHA 3IO1A 4GVLA 3CPWR 1U48A 3MM7B 4O4GA 1AA1B 1YRXA 4IOBA 1K73T 1F1BB 2OEJA 4WFNL 2B4OA 2ADCA 2HFNA 4K4SA 2QMXA 4NCAA 3QSIA 3J8AA 5HQMA 3C65A 5KI6A 3GJQB 4A8WA 2HHHJ 1T44A 2Z0GA 4DQRA 1RYRA 3ZETA 1S1WB 3RRGA 3IDHA 3CGIA 1T03A 3MXHP 1WTBA 4PR6A 1F9FA 4BC3A 3LANA 1NXIA 3CG7A 1T3OA 3MM5B 3AARA 1I94J 3G6ES 1U8WA 3I0RB 2FUG9 1VIOA 4MT1A 5JXSA 1VMBA 1VR6A 2AD9A 3CMES 1CJUA 3QMLA 5E3RA 3T1YF 3OHBA 1YIJS 1KHWA 3ZXWA 1EETB 3C3LA 1ZC6A 4CO1A 4A8XA 3ZZYA 1RT3B 4X4NA 1NUEA 2QSWA 2UVWA 2YQ1A 1N48A 1SCJB 2M4MA 3A0IX 1X9SA 3J81O 4BRAA 4AHUA 4DR5K 2Z56B 4QW8A 1Q86O 2VGMA 3R5CA 3TNVA 3G4SS 4CHOA 3N4PA 3HK2A 2GNKA 1JLAB 5AE3A 1FA0A 2OEMA 1Q8LA 3H4BA 4F8RA 1X4EA 4O8KA 3AOBA 2OA8A 1Y00A 3JXUA 3P4UB 4PYAA 3MTKA 2NRHA 3M2UA 3RRKA 4CEQA 2D41A 3WEEB 5B0EA 1WKKA 4YY3J 2CPDA 3CXCR 4GV9A 3G6EN 3ZTPA 9ATCB 2F8TA 4Z94A 4OO1J 3SI8A 4YR2A 4CJ3A 4OJ3A 1RTZA 3MUVP 2HKEA 3CMEN 5DMRA 5E2QA 3U4LA 1WORA 1QVGM 2VA2A 4WF9L 2FJWA 4C8NA 4JI6J 3M8YA 3G6YA 1RHKB 1M90O 2AA4A 5K8NA 3G0ZA 4YOTA 2DNRA 4AE5A 1CZAN 1PCAA 1XNRF 1UEUA 2OEKA 1S0VA 4A4JA 3K5MA 1Y64A 1VBYA 3NGSA 2LSNA 3SQ0A 4RU2A 3DOKB 4ZN1A 2GIFA 3TX0A 3T5HA 1U49A 4EEYA 1EQMA 4O8UA 4Z0UA 4PL8A 3D67A 4FF3A 5HK4A 2DXEA 4DFMA 2CQPA 2HBZB 3VF0B 1RT7B 2JFKA 3SBTA 3HLUA 4YOWA 5CCMA 1T94A 1YX2A 4CZCA 4WFYA 5CABA 5F9NA 3UCGA 1Q9YA 1M1GA 4AHRA 4FBTA 2RF2B 1Q95G 2HHHK 3CPEA 4CZJA 4OV6A 1HKGA 1KRPA 2V51B 4KAIA 1YZ6A 3H45C 3SAHA 4KIAA 1NB7A 3GG4A 4DX6A 3D0HE 5A2QO 3A8YA 4LR8A 3NAHA 1FE4A 5KT5A 5GAHU 1RAIB 2KZZA 2FBVA 3HXMA 4GKJF 4JEPA 4B1XB 3D7SB 4CF9A 2W2NP 4CESA 3CDEA 2GS8A 1T3VA 4OZ3A 4DR3J 1KFDA 3HO1A 3DDKA 1W26A 4IR1A 1JJCB 3AFGA 2IIHA 1ITPA 1OMSA 1QTMA 1HQEB 4FJ9A 3CE8A 1EO1A 2NLWA 2X3GA 4ID1A 5KG3A 3VQSA 2F1FA 4RLEA 1WHYA 5JLFA 4LF6J 1Y9OA 2A0FB 2HOEA 2H9ZA 1W7WA 2W7AA 3BJYA 3OT9A 4YB7A 5FROA 1UVNA 4BACA 3CDUA 4J9UE 5AJ3F 2HNYA 2O1PA 3QJJA 2UZAA 4ZVHA 2DGSA 3UO0A 2ZD1B 2BZ2A 4OYPA 1WUUA 4ZK7M 7FD1A 4ANCA 4NA3A 3HSDA 4TYAA 3DHWC 4MFBB 3OBWA 4R0EA 5K14B 3W9IA 2G8UA 4CH1A 4YY3K 1S76D 4J9NA 2C2RA 4CZMA 1E4GT 1S0OA 2GUPA 1X4HA 3AVFA 3IGNA 5KQDA 1BWEA 4J91A 3OXFA 2RH3A 3PW0A 4LC9B 1NSAA 3W61A 2YNHB 2RQKA 1XMQJ 3ID6A 4OHXA 4B3OA 2DXFA 1JCGA 1IKXB 5HVFA 2Q43A 4HTJA 1MMDA 3CJ5A 1X31C 2V6AA 1SJ1A 1MW7A 3DXBA 4DR1F 4LF8K 3AD8C 2M9KA 3Q2TC 3F9MA 4DQ8A 5DGAA 3K59A 1ZM3A 4WTOB 4XIUA 2LP4A 2RMLA 2K06A 4IH5A 4ZVUB 4D3GA 2N4DA 1GLEG 3AHPA 4ZPBA 1WTFA 3MM6A 2XG8A 1NGCA 3N5BA 4ECSA 4NLYA 1HR0K 3NGDA 4FDFA 4I2PA 4DUTA 1LW2A 4PWDA 3D6HB 4N5SA 5KFGA 2P8IA 4NOHA 1KNZA 1K1QA 3A8EA 2G0CA 4BC5A 1F2GA 2EI5A 3IN5A 1ELOA 2XY8A 3QNNA 4A8QA 5M2UA 3B6OA 3SPZA 1WC0A 1P27B 5BYRA 4W5QA 3HZ6A 3CJ9A 2BE2B 4ZJOA 5K8MA 3GIJA 4DV7F 3MMCA 1RCXB 3V6KA 1YAGA 4PYDA 2H5IB 2KYZA 5DZ7A 3IR7B 3OXGA 2A42A 4ZCKA 3DLEA 1KDNA 2VICA 1IQZA 4KR0B 3O9TA 3DLLQ 2E2OA 1C1BA 3C8YA 3A13A 2FY1A 3NNCA 4DEZA 3PFEA 4AXIA 1D9AA 5HBMA 3QNOA 1FKPA 2B43A 2CA9A 3QO9B 1NSKL 5CR4A 2QMWA 1T7PA 1UJ6A 1MLAA 1GLFO 4CLZA 4Q43A 1TK8A 4UZCA 2KZMA 4DL6A 3OBIA 4Q8FA 3V2UC 5IV4A 4ALZA 1NRKA 4CTAA 4HT7A 4FBUA 3JQKA 4M8LA 2BACA 5D0GA 3DKDA 3TR5A 5ITHA 3AAQA 1OSDA 4HVJA 5C10A 4FYVB 4JI2F 3Q8VA 2HBQB 3NF9A 5GMKa 2CPZA 3P96A 5EVZA 5MLCV 3J7YU 4QIFA 5KFLA 2VC1A 4CO4A 3PO4A 3M5RA 3P83D 1PIEA 2E5LJ 2IVOA 3DXKB 1RISA 3M1VB 4FNHA 1FERA 4JB8B 4BG9A 2DNYA 4KE5A 3AA3A 4M5DB 2CPXA 1PILA 2OP5A 4CJPA 2BE9B 4F4XA 1OH5A 4QWEA 2DITA 3TZZA 5CQGA 2HFZA 4CJ4A 2UV8G 4JI8J 1UWBA 2BXJA 1C0GA 4CJ7A 2AW0A 2C2OB 3ULEA 4EHUA 4C1NK 2AJQA 3V6DB 2JEFA 1G1XA 1EJ7L 4F4ZA 2J6SA 2F63A 3LDOA 4H0TB 2Q2RA 2NCKL 1PBUA 1WAJA 5KT2A 4LF5J 3C0BA 1FE0A 3KK3B 1KVAA 1VSJA 2DXDA 2CQCA 3LH2S 2UVRA 1RWXB 1URNA 4Q5VA 2HF4A 4UOFA 2CQDA 2GHVC 2DGOA 3N01A 2Z57B 3A4TA 4IO9Q 4KGZB 4DPOA 1IBKF 3HL8A 3J81U 1N6QB 3V1QA 1NMNA 2CAJA 4Y2CA 4ILJA 2HFUA 2I7PA 4PEOA 4USHA 2HLTA 3POTB 2IDLA 3MHYA 1VJWA 3CT9A 4GKKJ 4FXWA 2FLNA 4JP8A 1XTZA 4H5WA 1H7WA 3OYGA 2VJVA 1HNWF 3TVZA 1J54A 1CJKA 3C6HA 3H3NO 1DTTA 2HHSA 3KK1B 4IXCA 4KHMA 4BRDA 3H08A 2NZTA 1FFSB 2K1RA 5E5NA 1AZSA 5JLHA 2IAJB 1WC1A 3GU0A 3VVUA 4FPIA 3DGPA 3MECA 3P45B 2Q31A 4DR2J 4K25A 4G1PA 1SAZA 3SMSA 3FFKB 1RFQA 4DL4A 2NREA 3L7UA 2NRRA 4CVNE 2OPPA 2UUAJ 2YWWA 4WP8A 1IKVB 5M1PA 2IDOA 2QC3A 2NRXA 2I0XA 2W6KA 1NGGA 4F7VA 1YJ9N 1LW0A 2PFDA 4FLTA 1KSPA 1HQUA 3QLHB 2HHXA 4DUYK 4MAKA 2B9WA 3ZTOA 1U6BA 2ZH9A 1PBAA 2J0XA 5F41A 4B3SJ 1JLFB 4EIAA 2M3DA 5HL7Q 2E5IA 4FLUA 2ZWOA 2E5LK 1QAXA 4FJKA 1HPZB 2PSZA 2BJ8A 2FHJD 3W66A 3A5LC 1NKBA 4HTUA 4I1TA 4DR7F 1EX8A 5IT9O 3W1YC 2Z2ZA 1NSQA 4DS5A 5M2PA 1S1UA 3CJ0A 3ZNJ1 3L0QA 2CVIA 1XEZA 5CYJA 5DDPC 3PRVA 3NS6A 2E1PA 3WC0A 4JI8K 4BR7A 2WB1D 5A2QU 3QETA 1BOTO 1N88A 2MKYA 2ZUAA 3FZKA 1RTDA 4KO0A 1FXLA 5F8HA 1LWFA 2LDYA 4IRKA 2VPYB 1YDLA 3T6BA 3GYXB 1HW8A 3HT3A 4LF5K 4KREA 1MN7A 2ZITA 4OX9J 5HMWA 2B4UA 1MROB 1BCOA 2BJ1A 3M4XA 1RU2A 3G87A 1NGHA 3U9ZA 3HRGA 3MWBA 2P6TA 1IG8A 2GQQA 5H9EK 4HHUA 5D4PA 3CIMA 2FVRA 4BCAA 5KAKA 2IRXA 2I38A 2NUUG 3PW5A 1RDAA 4IG0A 5B0CA 3HSZA 1WBBA 3VN5A 1W9HA 4W5OA 4I2QA 3ZT4A 1JB0C 4Y0WA 1RDDA 1CJTA 1L3KA 5C2CA 1S6UA 3PYGA 3RB0A 2QLBB 4B8AB 4DTPA 1QZ5A 4ZHRA 2MHEA 1S6PA 1OVQA 4QS7A 1VC6A 4RW7A 1B7FA 1TK0A 1N5YA 3M1FA 2XS5A 4ZOSA 2NZCA 4NLWA 2QWOA 2FGOA 1KONA 1NGAA 1U47A 1TU0B 2P6SA 3IGVA 3DWLA 1IBLK 1XC9A 1VSFA 4NCGB 3PW7A 3AVBA 3T6JA 3L3VA 4O5BA 2UUAK 4V1Ak 2OTLN 3MPWA 4F3TA 4C7QA 3V9XA 4KHSA 3TA0A 4NLGA 3LP3A 5LY3A 4ECRA 2VPWB 4LBIA 4ATNA 5M1KA 1MMLA 3BZQA 4ZVOB 3US5A 8ATCB 4NLQA 4NL5A 4GC6A 2NQPA 2Q36A 2Q1NA 5M1FA 4ZDNA 3PHTA 4EBDA 4CI0B 3DM2B 2XWYA 4KHNA 1LK7A 1XHXA 3DRSB 4BRCA 1FWKA 3ZSQA 1NAQA 1XNQK 5A0YA 2UVVA 2B9XA 4O3RA 2QA2A 4IQXA 3MPYA 2L9WA 4YN3B 3SEOA 3W9HA 2JX2A 3MXMA 2EKYA 4BRLA 4B3TK 4WYLA 1LWEA 1JXVA 3EX7B 4ANDA 3OYNA 4LSNB 3EE8A 2XEXA 1NOYA 1UFKA 3UNYA 2Y8WA 1VRUA 3CCUN 5KOXA 3M6VA 1GTHA 3FGUA 3AO5A 2FC8A 3VTHA 3SSQA 1U1QA 2HQ3A 4XAKA 3GSIA 3WHIA 2CZ9A 1N0VC 2Q3PA 1MN9A 1YTAA 4DPYA 1DQ8A 2GQ2A 4H4OB 3HPGA 1KTVA 3OV7A 1R7IA 1SC1B 2EFGA 5AE1A 1RHMB 3HVAA 3E01A 3I9V9 4DG1A 5C2GA 3HPHA 1NGEA 2B9EA 1TMJA 2PAVA 3SMPA 3GFZA 2OD4A 1TKXB 2QEXS 3HP9A 1NDLA 3ENBA 1KLNA 3EMTA 5B09A 2ZE2A 2K2PA 1BMQB 2Q79A 4CO2A 2JWKA 3SFGA 3FZBA 4E1NA 4K8RA 3TUZC 3KJQB 3OUYA 4L3KA 4CFCA 3MM9A 5FIIA 4DN0A 3K9KA 2KJVA 3CPWM 4ETZA 4ELUA 5DG7A 1VQ8S 4DTXA 3FRYA 1WSFA 3FBEA 5C24A 2V9WA 2KDOA 2YY3A 4B3MK 1M5HA 3K7RA 2M7SA 2EFOA 4NMXA 2MB0B 5A8RB 2FJBB 4FJJA 2C1EB 3SPYA 1F21A 2O4IA 4E19A 3O6WA 1WNEA 1GEHA 5KQ8A 3EL2A 4PQUB 4JI5J 3HF5A 4AHTA 4DU4A 2C28A 2F4FA 3RSEA 4KGKA 4KI4A 1FVQA 2Z58B 1QUPA 4OPAA 1IV0A 1FDBA 3FSXA 1KVBA 2XMWA 3I33A 4GW6A 4W92B 1HWKA 1R27B 4NASA 3HM8A 4L3NA 4F4AA 4RL1A 2MQNA 4CFAA 4NLUA 4L72B 2PMHA 2ZZNA 4X84A 1IR1A 4CBUA 3L7PA 1A6LA 2JVOA 1NDKA 2YQ3A 2NRWA 5KFSA 3OR2B 4LR7A 1X3MA 5HANA 2BANA 2FXUA 2IOCA 3HHKA 5F8LA 2M2BA 1UTAA 1VQ8N 4XH5A 4R79A 2MZSA 5K5MA 2HPUA 4LF4K 3OSPA 4F2RA 1E3MA 6AT1B 3QFPA 3HSTB 3CCMS 4YY3F 1S59A 2GUIA 2ZH4A 2GJIA 3AAWB 3QT8A 2JLFA 3M9OB 4CLTA 1O1WA 1FEEA 4LBPA 1YITN 1QQOA 3E9LA 2HNZB 4QZVB 1BDGA 3SUNA 3M7VA 3THVA 2KW4A 2YX4A 1SKWA 2ZM6J 1ATRA 1FK9A 3NGRA 2W9CA 4QAGA 3OYHA 4LF8F 4O3QA 1RHUB 4M7YA 4Z37A 2HYIB 5L1LA 4JKEA 2K3IA 2H4YB 5CD4H 3BEGB 3HX9A 2CZVC 2PC6A 1FJ7A 4O0JA 2G0JA 2ZNYA 1FTCA 1C6VA 3BUZB 1A5VA 1HR0F 3DRPA 3X1LB 1GQEA 1QY7A 1S10A 3G86A 4P9SA 3AQPA 4U7BA 3CCMN 4CJWA 4RWWA 2OSRA 1W97L 2BJEA 4PXBA 2AYEA 3LZIA 1NOZA 4FJMA 2J0QD 2CPEA 1TUGB 1GOCA 2B6AA 4JI1J 1S77D 3SMZA 3UN5A 5MLCQ 5A8WB 3VMFB 1CG2A 3PFOA 2W24A 1S4EA 3VQBA 1OQ6A 2BRKA 2C3OA 2JHEA 2DD8S 3CJCA 2GTDA 2KN4A 2HIQA 3CCQS 4ED8A 3DRXA 4X4RA 3CETA 3LAKA 3OD2A 1B9DA 5KFFA 2NUHA 4BRFA 2Q97A 4HDHA 1EARA 1NHUA 5LM7E 5IT9U 3LP2A 3OYIA 2KHOA 2QKBA 2A6AA 3CUNA 3PV8A 3PX4A 1KLMB 2LQBA 1K8KA 2GVZB 3BDEA 1RAOA 3THYA 4WP9A 2P1JA 3OR1A 1VSHA 2YNGA 2YI1A 1F3VA 1U1NA 1Q9XA 3OS0A 3M2RB 2DNGA 5L1JA 3TTFA 2DO4A 4OYXA 1HA1A 2GIQA 5C0YA 4TVAB 5F3TA 2BEFA 1WLJA 3JTOA 3BREA 1MU2A 4OPJA 1UVIA 1Q82T 5BPMA 4OMFG 5C15A 4WFAL 1RU1A 3VQ8A 4PHTX 1MA9B 1BQNA 1OH8A 2D3O1 1OYEA 3DYAB 4ZVFA 3UPFA 4JK8A 4C9DA 1A5XA 3CD0A 3HM9A 1N8RT 2H5EA 2N7CA 2RS2A 1WEXA 3EEQA 2VDIA 1FKOB 3MI7X 2AMCB 3KLVA 3BYRA 4Y1CA 4OIXA 5AFUA 1RT4A 5F8IA 3IAS9 2ZM6K 4JN4A 1RWNB 1LXJA 3FVYA 2RIJA 4FOEA 2ZOFA 5KFEA 4RU9A 1ZH5A 4OZ1A 2XI2A 3J7ZT 3BKUA 4U9RA 1FRKA 3C7NA 2CJYB 3X3UA 3LGMA 3E9PA 1S9GA 4I6MB 4I67A 1JCEA 1YJWS 2WOMA 2W9BA 1WG4A 4RW9A 4CJKA 3TAMB 1NO8A 1SH0A 5SUHA 1BU6O 2YWHA 2IFXA 4H4KA 4E7IA 3QERA 1FRJA 4J9LA 1TR0A 2UXCJ 1NWKA 3RMAA 3NAEA 3SCLE 2D9OA 4BQLA 2JC0A 2LQ8A 1AT1B 4AQYJ 4O3SA 1HBNA 2DGWA 4FO0A 1J5OA 1YJTA 3PLAA 1WC5A 1FRIA 2X7IA 3JSBA 3M9NB 2V4RA 3B6BA 2ZJRQ 3EN9A 3IWLA 3ASMA 3NF8A 4JI1K 3W2VA 2O8CA 4FPRA 4M1KA 1V3SA 3ZSVA 2FD2A 4NO7A 1WC4A 3N79A 3K57A 1S57A 2V94A 4YUDA 5M1QA 2EKNA 3WX4A 4Y1DA 5EWEA 5DM6L 1UVJA 1JMTA 3CNQP 2XB2D 4NLBA 1QSYA 1VCTA 5T7BA 2AJ1A 3ZX3A 3SQGB 3IRWP 4TY8B 2IBOA 4H5RA 2ZF5O 5AQRA 2ACMA 2QYCA 2KFZA 4QU7A 3KUGA 1Y0HA 1YJWN 3EICA 3TQ1A 3CCES 3LALA 1KKHA 4QU6A 4LFAK 1M5PC 4DF4A 1F5CA 4QIVA 4OYAA 2MTLA 2P9PB 5H1SV 5AQUA 3KHYA 4LF1A 1YKWA 3OL8A 5IOLA 5DDRC 3OYMA 4FWMA 3KUHA 5DQGA 3BN7A 3QICA 3AD7C 3AOAA 2P9LA 2AZ3A 2UXDJ 3GR1A 1QAYA 2I2YA 3RBEA 5B0DA 2OLWA 2YH1A 2MKKA 1ZBFA 4DUYF 4M3YA 4TN2A 5F1XA 3THWB 4ZTJA 1KOOA 4IQMA 1HNIB 2WVFA 3S3OA 5CZ1A 1YT3A 3EVWA 3C15A 2VG7A 2E5LF 2JL9A 3D3BJ 3OJUA 3CFOA 2BGGA 4MKAA 2FIUA 3M32B 2R7WA 4PG4A 4JI3J 1YVFA 3QAUA 4ILGB 5D4NA 4BR5A 4B02A 1FJEB 1I1GA 3THTA 3VQ5A 4K0KJ 4DHVA 2Z1JA 1IBCB 3MEDA 3VAHA 4JYAK 2B3TB 3CCEN 4FWLA 3QGGA 5DLGA 4DQIA 4JI8F 1XMBA 4KFBB 3KJVA 1BISA 4DZ6A 4EBEA 2IGIA 3ILIA 3A5NC 5GIOA 1TUUA 1X5TA 2WVDA 1SQFA 4TLRA 5HROB 5DS7A 4UQTA 3BS9A 4JKAA 1RDUA 4I9QA 3RB3A 1VQ5S 4ED5A 4LF5F 5B0AA 1RUSA 3AVLA 4F3OA 3QDKA 2WONA 1VYAA 3BBCA 3RMCA 1HNZK 1CZBA 5LXYA 4NMLA 1RTIB 1W2BM 1IKYB 1JLCB 3ISNC 4ECVA 4ILRA 4DL2A 3TU5A 4FVUA 1C1AA 2CG8A 4NEZA 4YEAA 2EC0A 4AQYK 1R89A 2J9EA 3ITHB 2QGFB 3G8SA 3WXMB 3ZT1A 5G0RB 1WUAA 5I42B 4I6AA 3BF1A 4OHWA 3H42A 2LKZA 1NH8A 3A3OB 1RJJA 3KYLA 1H74A 3KG1A 3GR0A 1TV6B 1HJRA 4BC4A 3O44A 3HI0A 4U7UD 1Z4UA 5F8GA 3F56A 3Q22A 1WF1A 4FYXB 2G2YA 5EHHA 5GMDA 5CHCB 5CE3A 4HCCA 2P9CA 2D0BA 3JAMY 2HVEA 3M05A 3UI3A 1UETA 2E29A 4CLFA 1IBLF 2WTFA 1VQ5N 4KHWA 3BH7B 1OYDA 1J5EJ 3PTWA 1B0VA 4HEA9 4JI0J 3SUPA 1FXXA 1U1RA 2A18A 3AVHA 2UUAF 4YDDB 1ICEB 1UVMA 2CIMA 1VSKA 3IS9B 3PJ9A 3W5YA 4O23A 1LV5A 4CLLA 4FWOA 3Q8RB 4JKFA 1FRMA 2OFHX 3C6UB 4LQ9A 5JICA 1XNQF 4CZKA 3B4MA 3G10A 3CF5L 2RSQA 3FGVA 1X0FA 1NLVA 2HHUA 1DQAA 1EB0A 1S0NA 2E1CA 4B3TF 2OMLA 3C6TA 1NDPA 4UOGA 1VQKS 3MPDA 2HZCA 4DV5J 2O67A 3TO8A 4DKWA 2N82B 1X5OA 4ZJQA 2AJ0A 4WFNQ 3AB2B 1VIXA 5B0BA 4FWRA 4PQAA 3PX0A 1WSVA 2P9EA 3UVJA 3V4IA 1QS4A 2HQGA 2F9TA 4DZDA 1GFWB 3C16B 4ZPDA 4KQZA 4U6PA 5FRNA 4O4GB 4K4UA 4B1ZA 5FPEA 5BPLA 3KTQA 4LQ3A 1B4SA 3NGTA 2OH2A 3FZFA 1Q53A 4P7TA 4KBIA 4Y00A 3FZMA 1SQKA 3PUFA 4OLBA 1N54B 3JS9A 3VF6A 1HHTP 3ZETB 4CEEA 2XMKA 1DEJA 1T03B 3FZ2A 3UD3P 3RMBA 2B5JA 4P71A 4JBCA 1VQKN 5J2MA 4IKFA 2YCHA 2Q0RA 1W2IA 2CXEA 3BBFA 1YVUA 4DXLA 1MSWD 2IM0A 4NZ7A 3H90A 2XGPA 3MWTA 2D1KA 1IJEB 1CJUB 1RGVA 5DDOC 2VGNA 4B3MF 3NFAA 1T9YA 1VQ7N 3Q86A 2VQEJ 4QYRA 2BABA 1YF5L 4LJMA 2I5JA 4CO5A 1FRHA 4O3PA 1HL6A 3D5MA 2YVSA 2YWFA 3GG0A 4ZIWA 5HSPA 2NXCA 1RTHA 1YHQS 3I31A 4JAXA 1QJHA 4FP9A 5BYQA 2XTJP 2XO7A 4DSLA 4J2AA 4JI0K 1M0SA 4M5GA 4CK1A 4E7JA 1DKGD 3AVIA 4FL9A 4LFBK 3W64A 4C8ZA 1GXUA 3MEEA 4QYZJ 2OANA 2LDIA 4CWBA 3BYPA 3THXA 3PO5A 2IYGA 5KG4A 4CFDA 1MDUB 4JD2A 1BUPA 2RAQA 4B9VA 4C8YA 4LF4F 3KWIA 4IDKA 4MDBA 4P2SA 3EPGA 2DR6A 3NVMA 2FJXA 3FRZA 3H98A 2R4FA 1SJQA 2O8EA 1EKSA 3EZOA 2HURA 2R8HA 4BRKA 3I87A 1D09B 3EZ5A 1S79A 2J7UA 4NE9C 2DR9A 3VEWA 4MH8A 3VVTA 1YHQN 4AL5A 4EI2A 2P5GA 2ZH3A 2GV1A 2Y0BB 3P5JA 2FZGB 3QGHA 3LM2A 3DGVA 3LUYA 5E41A 3KLFA 4H5TA 3TJ9A 2HWHA 3L95X 3KLEA 1Q18A 1CS4A 4M63A 3LDQA 4KY3A 1QHAA 4CH7A 3OYJA 4WXWA 5DM7Q 2DNQA 4OV1A 3TA1A 2XMUA 5D8HB 2HS4A 2GMHA 2ZVIA 5KGXA 3KNAA 4TYBA 3NMRA 1JXLA 3KXDA 1RAHB 3Q0AA 5C42A 2X6SA 5EN1A 2ATCB 5DQHA 4M5LA 4CO3A 1VSDA 3VHQA 3BBBA 1RWKB 4X62J 3NWGA 2R7VA 2VF3A 4FKXA 4P10A 3SZ2A 3GB0A 5IXUA 2MKHA 1Q86T 2E5GA 1CSJA 4DV1J 3W60A 5E3QA 3OL9A 3OL7A 2CPHA 2C42A 4F36A 3WZ0A 3OFEA 2A1SA 4CZHA 4C3MA 3VERA 2DHXA 3OFHA 3MK6A 1YG0A 4HACB 2W8LA 3NL0A 2VQEK 2W2MP 2QL9B 2WHOA 4FWNA 3MEKA 2AIRB 3CJ4A 2F4VK 2O66A 1U24A 3I55S 2VWKA 3Q89A 5F8MA 4YMEA 1WOPA 4JV2A 2QL5B 3QT5A 1RSCA 1Q7YO 3HSJA 5EU7A 2I9SA 2W42A 2HNYB 4IO8A 2R7QA 4CM2A 3VAGA 4NYNA 1M90T 4QYZK 1EX4A 2BKOA 2BX6A 1U2VA 5E3CA 3LW5C 3CDAA 2HZAA 3DU5A 4Z4HA 1ZBHA 2P9UA 4DSKA 1FDDA 1RLDA 1VQPS 1XNRJ 3CCJS 2XSJA 1FT8A 3NP5A 1OY8A 5HVGA 3O08A 3G6XA 2VFVA 1Z25A 3I55N 1I3AA 8RUCA 3FEYB 2CNNB 4URQU 5HATA 1O8BA 1WHXA 3EKUA 1BE4A 3NE6A 1NBEB 3FLCO 2ZM6F 3MWPA 3UFCX 1EXQA 2Q6BA 2NZ4A 3MM6B 1VHXA 4OI6A 1OY6A 1P90A 1BCMA 4I2PB 4IOAQ 1LW2B 2W01A 2E2QA 4CBWA 1EKEA 2DRDA 4H03B 1PG5B 2M8HA 5FPNA 2DHSA 1U09A 1GT8A 1BWFO 2AEJA 3ETMA 2MSTA 1KVCA 4UOHA 3IWNC 2CPJA 1VQPN 2HK2A 4X62K 4ELTA 4EK2A 5H1SQ 1U6FA 1Z6RA 1GMVA 5L39A 2MDAA 3MMCB 3FBBA 3B54A 4DV1K 5AR0A 2ZJPL 2UUBK 3WX8A 2ZGYA 4WYBA 4J8FA 3DLEB 2VBWA 3VOVA 2AF6A 4X64K 1DTQA 3W5ZA 2L41A 4GVMA 4CZEA 1RILA 1C1BB 2IVYA 1FJGJ 4JI1F 1RBOB 5HBMB 1FKPB 4L73A 1VOMA 2PT0A 1G99A 5AJ3J 4DL5A 2FPHX 4N8NA 3RW6A 4Y2IA 2V8HA 3QINA 3WNGA 2FTRA 4ZVGA 4OJRA 1N36F 3N6NA 2OKQA 3QPIA 1JJHA 1WKJA 1X4GA 3UCUP 2PYJA 4CTAB 5TKWA 1WOOA 2QLFB 2R2SA 4HUGA 1NHVA 3KJNB 3M2VA 3A5MC 1VQMS 2XHBA 2PY5A 5E3AA 4RX6A 4LFAF 2AYBA 3PEHA 1SVDA 4PG7A 2A2CA 4P72A 4C0OC 1SV5A 5ADXH 4RUAA 2ZH2A 2AHOB 2UXBK 2JH3A 3N6MA 1T95A 4USMA 4F04B 4A8MP 3ZEUA 1X4CA 4FJ5A 2VV5A 4L6V3 3MFIA 3HFKA 4N76A 4DR1J 4LBHA 4PL7A 3PIOL 3NCQA 4DPWA 5AQKA 3W2WA 1AXQA 1T9VA 3HULA 3OL6A 4OLOA 3RBXA 3OBYA 4ZVRB 4FWPA 4J2EA 1RABB 2D7SA 1T05B 2R8IA 3NDKA 7AT1B 2QK9A 2JWNA 3ZZRA 5L9NA 1UWBB 2YJEA 2IBKA 1ZBTA 4X4SA 4YR0A 1TKTA 5HJXA 4FF4A 4P52A 4JYAF 3CD6S 3SJHA 1VQMN 2OPQA 1K47A 4RPFA 2L3MA 2MZTA 1C4CA 1UKUA 2E20A 3RR7A 5ELZA 2SXLA 5THWA 1YRTA 4PG6A 3VQ4A 2NRZA 3C94A 4H8KA 2G4BA 1SL0A 4DV7J 1OQ3A 1D8ZA 1QVFR 1FEHA 2QWPA 1SC4B 3BO4A 3E8OA 3A1YG 3BB5A 2AYMA 1HNZF 4AHCA 1NDCA 4U7CA 2ZC3A 1T9TA 4I0WA 1VHIA 3U3YA 1GX6A 3TVYA 1O6XA 5BRFA 2ZUGA 4LMZA 3NF6A 5KT6A 3KWGA 3SSRA 1CJKB 2FBXA 2YKMA 4R8UA 3PG9A 2J76E 1DTTB 1JKHA 1U4BA 1RAEB 1FJGK 3U02A 1TKDA 1U2FA 1JLAA 3ZSOA 5ETSA 4OL8A 3N4WA 2K1RB 3CD6N 1WSHA 1NLKL 1AZSB 4WCEL 3SBMA 4JI7J 2E1ZA 4ED1A 4NLPA 1YBTA 3DGPB 4GNIA 3H2UB 1SPBP 5B0FA 3DRYA 4F3MA 3OXLA 3K5PA 1RKIA 4JI2J 1B70B 1YJUA 1X5SA 3WUHA 4ECUA 3BSOA 2OPPB 4PXCA 1BXNA 4QPTA 1RWWB 4A62A 1TAQA 3VQAA 3VQTA 3CIPA 2FVCA 3CHWA 3H8YA 1IUJA 4KHPK 2WFBA 2Y1JA 1EHWA 4F0MA 1LW0B 2GIRA 3H5XA 4QPXA 5KFVA 3VF2A 4OPHA 1HQUB 2RRAA 4ECTA 4KHQA 3KLGA 5D0EA 3MMAB 5DG8A 3CVKA 4P2XA 1CULA 4MYUA 4MYTA 2ASJA 4HVZA 1UWAA 1XERA 2XYPB 1S48A 3V6JA 2YKOA 5H9FJ 4CHQA 4B9QA 2MPUA 3PJXA 2BYCA 2DO0A 2VKRA 4J9KA 1PAUB 3OFFA 2BQ3A 2W6LA 3ZT3A 3TSPA 4RJVA 2DGTA 2QKKA 3KLIB 2DY9A 4K42A 4RUBA 3VAJA 4KTQA 1S1UB 4K50A 1K6YA 2V9KA 3DLHA 4CHYA 1RT2A 4DI6A 2FVPA 2P9NA 3PDNA 4OI3A 4DV6K 3NOCA 2V7YA 3KK7A 1Z2LA 3N9UC 2B8QA 1RTDB 4KO0B 1LWFB 4K4XA 5J2QA 3G71S 1PYTA 1X4AA 5AZJA 2VOOA 3GWCA 4MTPA 1FI4A 3RZAA 4Z7CA 3TWZA 4DV7K 4FZYA 4MIWA 1W25A 2IS3A 4OJHA 2LQ5A 1HBMA 3SAGA 5BJRA 3N28A 3P6YC 4KH6A 3TW0A 5BN9A 3IWXA 4IG0B 3ULDA 4I2QB 2JZ5A 2FSJA 4DV3K 2I1RA 4CF1A 1CJTB 4P74A 4CNZA 1S6PB 1KN6A 3O2IA 4RW7B 3I82A 4J9PA 2F65A 4KH5A 4KSEB 5KFQA 4OI4A 1N5YB 4NLRA 2M5YA 3JXOA 2DVIA 2RT3A 4OJ1A 2GWJA 1TL1A 1ZAXA 5IT4A 4GMKA 1YJVA 2BVZA 1FCAA 4MJKA 2V0NA 4F4WA 4QOZB 4EP5A 2VQFJ 4PXDA 4JI7K 3W0LA 3QWUA 2O4GA 1FKAF 4G6VB 4IOCQ 1YZ7A 2PBDA 5FDLA 4M94A 3O9SA 4NI2A 4W90B 3H4DA 3JTPA 1D3WA 1X60A 1K0TA 3I4HX 2V68A 5J1PA 1VQYA 2UV8A 4ED7A 1BIUA 4YORA 1SL2A 1SC6A 2EWHA 2QWLA 3QATA 2J0SD 4J7CA 2NPFA 3BF3A 4CIOA 3WNEA 5B08A 2EEYA 1HHSA 3SV3A 5A0YB 2ILYA 4LFBF 3D9BA 3CM6A 1VQNN 3FZLA 1ULRA 1EQ0A 5CYQA 3LOUA 3MX5A 4BE1A 2A1BA 1JLBB 3NY0A 3CYMA 1NG9A 3OYAA 2EFQA 2ZH5A 1ZA1B 1OPIA 1LWEB 2HHTA 3SUOA 3CQ8A 4G1QB 1S22A 3DXMA 3JS6A 1RZMA 1VRUB 1RGIA 3CJQA 4MK9A 1VQ6S 4X65K 2DHGA 3O9QA 4NXMF 1JK9B 1HLUA 1JNRB 2HRTA 3CCVN 2UUCK 1HYVA 4NA1A 1DLOB 2I8EA 4UW2A 2CJKA 2UVUA 2BDPA 4L75A 4B9TA 5LMUJ 5MAOA 3KMSA 1HRHA 3NBPA 2AGQA 1ZBIA 2R3VA 3E01B 4DG1B 1KQFB 3SSSA 3VEXA 4YDUA 3AJ1A 2YPYA 1BO5O 9RUBA 1GTEA 4CW7B 3D1QA 2U1AA 4FS1A 2W40A 4CF8A 3LDSA 3D45A 3RGIA 3PY8A 2ZE2B 2NSCA 1XK8A 2HGNA 2KKZA 1RT1A 3HT0A 3QBCA 4UY8O 1VI7A 3M8ZA 4WIIA 3G9CA 3OUYB 2KXHA 4JV5K 4FK2A 3MM9B 2MZJA 3CCRS 2CADA 4C8MA 3P4IA 4A2AA 5KPRA 3EVMA 3HD1A 4DUZK 4DU7A 5C24B 1QE1A 3PEJA 2R2RA 4BG8A 1LFWA 1QSSA 1FDAA 3G96A 2MQQA 1BGXT 1SJ4P 4LH5A 2JRSA 3U8XA 4U95A 2VQFK 4O3OA 2H51B 3G2XA 5L8RC 3DCAA 4FJXA 4DSIA 4ELVA 3RSEB 3ZSZA 2LCWA 4GV6A 2HFSA 1FNOA 1TMMA 4C8LA 4K43A 5IS2A 3TWHA 3TARA 3VEOA 3QRQA 2PZSA 5IWAJ 1N32K 2VQEF 2WK4A 2JGUA 5BR8J 3RRHA 3OYLA 5EWFA 1T0TV 3DLRA 2F4VF 3ZT2A 1GLAG 3M8WA 4AHSA 2W9AA 2E44A 2GA7A 1W7AA 1WSJA 3GBTA 2GJ2A 2CZ4A 4B1WB 5GADI 1C1CA 1N5QA 4DX5A 2MJNA 2W1BA 2MQMA 2HMPA 1N56A 3CCRN 5FLXO 4ISFA 1RXOB 3MAHA 2DNLA 1ZBSA 2YH0A 3DFEA 3TRGA 2D4WA 3AVNA 2AJFE 1KC8O 3GG1A 3ZZOA 2ZHOA 4QWBA 5B0GA 5ETQA 3IBWA 1DRZA 1K1SA 3MXIA 3T7ZA 1GOAA 2O3DA 3FDSA 4DPTA 3DMJA 2J4RA 4M5MA 2JNJA 2DHAA 5LXRA 1HMVA 1AFIA 1YQHA 2DIUA 2XMAA 2FYXA 4IG3A 2CPFA 1CXQA 4BQZA 3D2FA 3SCJE 2P5OA 1NJIO 4X4TA 3H2LA 4CEBA 2JFDA 2DR5A 2HFOA 2VG6A 2G0IA 1GH8A 1FK9B 5A2QY 2W9CB 1UAWA 4RTFD 5LMUK 1P1TA 3I32A 3OVSA 4FVCA 5ETLA 4H5VA 2ERRA 1ZZFA 3C14A 3SUQA 5BREA 3E51A 4RNHA 3IP0A 2QL7B 4OYZA 1NGDA 4HYKA 3MCNA 4RBUA 4B17A 4DJBA 1YJNN 3TP2A 1S99A 4CIFA 1UPMB 2ASDA 2E7VA 1IBMK 1IJJA 2WBMA 2ZOMA 3DRPB 2KB2A 1WHVA 2KRBA 4TKTA 5GADP 3CCSS 5F0XA 2YBVA 2RE2A 1GLLO 1FX4A 2JSXA 4RNOA 4Q7AA 3H0PA 2DNHA 3CJAA 2NYIA 4JS5A 4ECYA 3O1BA 2B6AB 1S6OA 5L46A 3QFHA 4X62F 3E9OA 3V4MA 4LF9J 4M7XA 5AQQA 2A1RA 3RAQA 2R7YA 2IM3A 3T69A 4UT4A 4DV1F 1Y97A 1HNXJ 4QIEA 2UUBF 5LJWA 2OO4A 2JVRA 4ZIVA 3DLKA 1SH3A 4TU8A 1ZZNA 1E6YA 4X64F 4QIGA 3VR1A 1UA0A 1K9MO 3WQPA 3AO2A 2A40A 3QLHA 1B9FA 5IWAK 3E2EA 2FHKA 4B1YB 2JJ4D 2V4QA 5KFYA 4ZVPB 4JHDA 5BR8K 4LFCK 4MK8A 3KMQA 2MZRA 3NRBA 1RT5B 4LIRA 1NEEA 4BR0A 2Q6CA 3CCSN 4USIA 4JLHA 3THYB 2KI2A 2R9LA 3OR1B 3SNNA 3RBZA 3VGTA 1YI2S 3JAMO 3NAIA 3DLGA 5BN8A 4ZCLA 1SI9A 2L9DA 1S9EA 4PKIA 5IM0A 4CJVA 4CRJA 2KT5A 2DGQA 3TABA 1MU2B 1JJ2M 2FY8A 2G8WA 2VZ9A 1YIJN 4USKA 3GV7B 2UXBF 5J1NA 2HWIA 4OJGA 3IG1A 3R5AA 5AQJA 1D8YA 4CEOA 4PG8A 5ETOA 4KI6A 1BQNB 4CM0A 1H72C 1ROFA 4NZ6A 3HHDA 2HNDA 2GMJA 3ZX0A 4LF8J 1X9MA 1A0OB 2IVPA 1ILYA 1RBSA 1R6YA 3FCHA 2R7RA 4IUFA 3NGZA 5KT3A 1ZETA 3BGUA 3CERA 1R3NA 3JSRA 5GIPA 2E66A 3GMGA 5CZXA 3G4SN 2RDJA 3J7AP 3I0SA 2XGQA 4CJRA 4AH9A 3FNNA 1V9OA 3WIVA 2J9CA 4QWAA 2OZMA 3SCKE 1CEZA 4W98A 4W5RA 4YB1P 4K2JA 2JDJA 1HR0J 2UU9J 4UY85 3IMXA 4A48A 4X2BA 3O5TB 3C7NB 4B1VA 2F8SA 2WB4A 1S9GB 4BDZA 2GZOA 1UFWA 2WOMB 2W9BB 4RW9B 2HQCA 1YTYA 5KG0A 4ZVEA 1RWVB 4LF7K 4ECQA 1OPZA 4ZVTB 1BL3A 4RNNA 5CZVA 1KTQA 3HP6A 2CQ3A 4CCHA 4ZP7A 4LREA 2CWKA 1RBVA 2V2VA 1F5AA 1RDCA 2VFRA 4HI2A 4L76A 4H0XB 5AXLA 1Z2ZA 2HVZA 3HI9A 3NH1A 1HBNB 4CT9A 4BRNA 1J5OB 3U3GA 1TUVA 2A10A 2ALYB 2EK1A 2ZEJA 5DM6Q 4HUEA 4WXOA 3DOMB 5LOQA 1HBOA 1ASWA 1LCUA 4H0VB 1R8CA 1BQMA 4CT8A 4LF9K 4OZ0A 3W2VB 2O8CB 2OGUA 3ILJA 2ZOGA 3TR8A 2V63A 2XHWA 3IAM9 2YHWA 2ZH7A 2LECA 3BSCA 1TFWA 1HNXK 2YKAA 3ZZZA 2KQ2A 1JLQA 3PRDA 1O13A 2MHNA 3A8KA 5I4MA 2GELA 4WYWA 3WDOA 4KHYA 3VF4A 4KV8A 1V5VA 4URSA 1QVGR 2J7WA 1FJGF 1Y5LB 3BH6B 3DRSA 4FS2A 2CH6A 4P2MA 5KG1A 2MZQA 1RYSA 3M8SA 2EWSA 1NNEA 3GOIA 1GLBG 1MWMA 5HVHA 2OELA 4TU9A 1UEVA 4G65A 2DFHA 3RTVA 2DY4A 1B92A 2LMIA 1WSIA 1Q5VA 3VA3A 2OTJS 3LM9A 2DR7A 2WSFC 1WSRA 4Q2LA 3ADAC 3H20A 2J8SA 1VHFA 2EK6A 2FZCB 2R7TA 2ZZMA 4ZPWR 3DI6A 2F9JA 4XPCA 4B9UA 3J80O 2G8VA 4CF2A 1SQEA 3CM5A 1BC6A 3HHLD 4EU0A 4KHPF 5M1NA 2P9LB 3K2YA 4OHZA 4WE1A 3PNIA 2BRLA 2I7NA 4NCBA 1U2RA 5E0OA 4ZTFA 4EP4A 3CI5A 2D69A 2AWZA 5DZ6A 1OJ4A 3MXJA 5LT5A 2X1AA 1RDRA 2LU2A 5KFMA 4J2BA 2FBTA 2CRLA 3H2VE 2ALZA 4RW6A 2DH7A 3OQ2A 3C15B 3MCPA 2VG7B 2MGZB 4BE2A 1VSEA 3A8IA 1MNEA 5A8KA 1PJ7A 3H40A 4JK7A 4UUXA 4YP3A 3K58A 4CJLA 3ATUA 5EUHA 3ZTRA 3L8BA 3MEDB 2X1BA 4DFKA 3EXYA 3Q8UA 5D3GA 1KCFA 3KG4A 3O1LA 3DLBA 3KJVB 2UU9K 4CQ1A 4CGDA 1RBTA 1G4CA 1NK7A 4OQJA 5GMEA 2ZGZA 4NYZA 4DV6F 1RT6B 3AVMA 2MJUA 4ZN3A 2AJ2A 2FSNA 2W25A 3NEKA 3BDPA 3OA9A 2AKWB 4RUCA 2B9YA 3B4DA 4Y28C 4YDXA 1Q7LB 5L1KA