1S1UA

Crystal structure of l100i mutant hiv-1 reverse transcriptase in complex with nevirapine
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
536
structure length
524
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGIKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase
publication title Crystal structures of HIV-1 reverse transcriptases mutated at codons 100, 106 and 108 and mechanisms of resistance to non-nucleoside inhibitors
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 140
structure length 524
sequence length 536
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1s1uA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s1uA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s1uA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s1uA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1s1uA05
3DLEB 3MEGA 4AHVA 2V4QA 3MR5A 1NNDA 1S6PB 4H4MB 2F8EX 1RTDB 2VA2A 3FQKA 1LAVA 3HHKA 4B9TA 4DSJA 1C2PA 5KT3A 4NCAA 3LP3A 4FYDA 3V81B 1RBSA 2OPQA 5KG1A 3T5HA 4ZP7A 1BIZA 1N6QA 4CGDA 4WZQA 5KFKA 4O4GA 2UVUA 1T05A 5KG7A 4BE0A 4CFCA 4LH5A 3B6OA 3K57A 4WFXA 4I7FA 3M8QB 5KGXA 3LPTA 1C0UA 4ED3A 3LPUA 2HHWA 1IH7A 1RT4B 4AHSA 5E41A 1JLCB 1VSFA 3SYZA 3FSIA 1XHXA 4CGFA 1CXUA 3DM2B 1ZBHA 4I2PA 3SFGA 4ZMMA 4YP3A 4O3OA 3CDWA 2ZKUA 3HVWA 1J5OA 3AA3A 4GMJB 1BISA 3RBEA 4CECA 4R8UA 4KFBA 2UVVA 3MECB 5KFZA 3CJ2A 4KHYA 3ICLA 2W9BB 3V1RA 2EC0A 4DSLA 4M3TA 2RN2A 2E9TA 1B9DA 4EO8A 3FDSA 3CIZA 3V6DB 3CVKA 1RTHB 4I2QA 4W5QA 3NL0A 2A1RA 1UA0A 3MR6A 4K50A 3O3HA 1S49A 1TKZA 3Q8SB 4O3NA 4DL3A 2W7OA 4QWBA 3AVHA 2GC8A 4Q45A 3QINA 4GC7A 2JC1A 2FJXA 3BSAA 3ULDA 1WSJA 1VRTA 3KK1A 3PX6A 3OYCA 3QERA 3KD1E 1GOBA 4ZPDA 1U4BA 4MKBA 2I1RA 4RUCA 3NF8A 1RAJA 1TV6B 4DTMA 2VWJA 2XI2A 4M3RA 2W7PA 5K14B 5L9XA 4Q5VA 3QESA 4DSFA 3N6LA 3OYMA 3OYIA 1EXQA 3OL8A 3E51A 1XR6A 4FLYA 3ZSYA 3P83D 4N76A 1LW0A 2OYQA 4K8XA 4FK0A 2IAJB 2E6MA 1W0HA 3MAQA 4EYHB 3CFOA 4LQ9A 4WZMA 1QAIA 4DQRA 5J2PA 1BI4B 2YKNA 3SPZA 5J2NB 4Z4FA 2HNYA 1C1CB 5J2QA 4CHYA 3GIMA 3LWLA 4TXSA 3G0ZA 4ZP9A 3AO4A 3V4IA 3KJVB 4CJEA 4KSEB 3V9ZA 4ID5B 4DU4A 1T3NA 3V9SA 4J9RA 1ZBUA 4FW1A 3M8RA 3PR4A 4K4WA 2RF2A 2IA6A 1S4FA 4RG8A 1RYRA 1NK5A 4Z4GA 1HQEB 3EY1A 4F3TA 4ECQA 4TQRA 4O0IA 2I5JB 3ZSVA 3MEGB 5I3UA 1HARA 2R8IA 3IRXA 3TANA 3DLRA 4QCLA 2DY4A 3CDEA 4XPCA 1QSSA 3LP2A 4O55A 5D3GA 4IKAA 1SKRA 1VSDA 3KOAA 3G86A 2OPQB 3TAMA 2R2UA 4CFBA 3L2RA 5F8JA 3K5LA 2BQUA 1N6QB 3PX0A 2UUWA 4Q43A 3OYEA 1CSJA 2P5OA 3RB6A 4O5BA 3PJXA 3SQ0A 1T05B 2DFEA 5SZTA 5EDWA 3NAHA 2BANA 3P1GA 3QNOA 3HPGA 3S9HA 4I7FB 4MIAA 3VQ7A 3KLGB 3RMBA 2RDIA 3KK3A 3PX4A 1C0UB 4MK8A 2RDJA 1SH3A 5F8GA 1NHVA 1QE1A 3RR8A 1RTIA 4B9VA 3NCIA 1J9AA 4YR3A 4FZYA 4I2PB 1IKVA 4OJRA 3QEPA 3FFIA 5KFIA 3D5MA 4QPXA 1J5OB 4KHNA 3AVKA 4R8UB 1VSIA 4ZPCA 4KFBB 2HHTA 1S9EA 3OL6A 4DTRA 4FJJA 4E19A 1REVA 2IOCA 5HP1A 5KFQA 3QEVA 3Q8PB 1QS4A 3AVJA 4ZVEA 4DF4A 4CJSA 4J9QA 3OYNA 4E7KA 2Z1HA 4QWDA 4F50A 1VRUB 2AU0A 3IGVA 2IMWP 4B8CA 4DFMA 4O3QA 1JKHA 3TWHA 1TKZB 3Q8QB 3ZT0A 3DOKA 4KKOB 3IGNA 1DTQB 3TR8A 1BL3A 3AVMA 2KZMA 2D0BA 1VRTB 4MK7A 3KK1B 4OGEA 3HVAA 1ZTTA 1U47A 4K4YA 4ZPBA 2JGUA 1UA1A 4Y34A 2IBKA 1S1TA 5HRSA 4NRUA 3QGIA 3DDKA 4CJLA 3LWMA 3GIJA 2HHUA 5F8LA 5HRRA 2AGPA 2HHSA 4FBTA 2D3UA 3C94A 4AH9A 1KRPA 4B8AB 4M3YA 5KFHA 2XY8A 4G1QA 4NCGA 3KD5E 1HYZA 1LW0B 4FK2A 4PA1A 2C2DA 1ZYQA 3KK2A 1S0MA 1S1WA 2ATQA 5HBMB 5DLFA 5KTQA 5J2PB 4IH6A 3PV8A 2IM2A 4IFYA 2HNYB 3AO5A 1CLQA 5J2QB 4LSLA 3SV3A 4ELVA 4F4KA 4FJNA 3N6NA 2X6SA 2Y1IA 4IQXA 3SNNA 1S1VA 3V4IB 3K2PA 4B3OA 4J2DA 2AGOA 4OGCA 2ALZA 1S97A 3RBDA 1I3AA 4B9LA 2RF2B 1NOZA 2KTQA 1K1QA 4RNMA 4ECSA 2UVWA 1BHLA 2F8TA 3PO4A 3AA5X 4DMNA 1SH2A 4CJ3A 3T5KA 3D28A 4FS1A 1SUQB 3DLEA 1L3UA 5I3UB 3NF9A 1MU2A 4IBNA 1J54A 3OYHA 4Q8FA 3K5NA 4U7CA 2D3ZA 2R2SA 2XCAA 3LP2B 1RTDA 5D3GB 4WXWA 3V81A 3OVNA 3BSCA 3TAMB 3M8PA 3OL9A 3OL7A 2IJNA 3EZUA 3AV9A 5FROA 5KFOA 5KFRA 3V6KA 1RYSA 2BANB 1BQMA 1RT1A 4ZHRA 4J2BA 2ZE2A 1TGOA 3QGHA 3G6YA 2W8LA 1KFDA 2AWZA 1ASUA 4YR0A 2ASDA 1RT6A 1QE1B 4B9NA 1RTIB 2Z1JA 3QO9A 3RR7A 1JIHA 2YNHA 3DLHA 1IKVB 4TN2A 3DRSA 1K6YA 2XY6A 1JLEB 1EX4A 4CESA 3H4DA 3AVFA 2XO7A 2XC9A 3KTQA 4IOBA 4KE5A 4RNNA 2P1JA 4BDZA 3HO1A 3H98A 1KFSA 3MECA 3OS1A 4WYWA 4CCHA 3LANA 3EPGA 1KSPA 4CGGA 1REVB 4NLVA 3K5MA 1Z25A 2W9BA 5HP1B 1S9GA 1T94A 1RBUA 2V9WA 2HHVA 1RA7A 3VQPA 1JLGB 3H5UA 3AVLA 5KFDA 4DSKA 1BIUA 1SH0A 3THVA 4CJWA 1JKHB 3ZSZA 3DOKB 1FK9A 2VWKA 4XIUA 4U6PA 4NYZA 3I5CA 5KG6A 3OYAA 3UQSA 4FJMA 4JRQA 1S1TB 4IFVB 5KFLA 4CFAA 3LDSA 2IGIA 1N56A 5K14A 3G6XA 4Z4HA 4E1MA 3EYZA 4ED7A 4O4RA 4J2EA 4CHNA 2D7SA 3OY9A 1XI1A 4EBCA 1N48A 4W5RA 4NLTA 4CGJA 4MK9A 4J9LA 2JEIA 1NJWA 4YFUA 3WNEA 4K4TA 1LWFA 4G1QB 2O5DA 5KRSA 4QWAA 4Z0UA 4ZVFA 5F8MA 3ZSQA 1D5AA 3H40A 1JLBA 3NMAA 4ECXA 1TK5A 3VQCA 4JV1A 1SL1A 1SL0A 4IFYB 4X2BA 1RBRA 3L2WA 4J9NA 4DL4A 1S1VB 2ILYA 3NGDA 4B3OB 4ID5A 3MR2A 1WSGA 1T8EA 4NZ0A 4OKKA 4LSNA 4EP4A 1Q9YA 3CFPA 1ASWA 4CEDA 2HVHA 2IS3A 3DLKA 3CWJA 2WCXA 4WXOA 4L8RB 3ASMA 2D5RA 1NKCA 1WLJA 1BQNB 1UWBA 4H54A 4DTJA 3AO3A 2I5JA 2CKWA 4F3OA 5C25A 3PVXA 1MU2B 2DFFA 2AJQA 4CF8A 3CQ8A 4W5OA 3LAKA 5KFVA 4JLHA 3EPIA 5I42B 3WNFA 3MXJA 3O4QA 4BDPA 4C8KA 4CJKA 3V6HA 4ELTA 5KFGA 3GQCA 1A5VA 3HP6A 1HNVA 3M8PB 2R8HA 4KAIA 4TY9A 4I9LA 2HHQA 3RAQA 4KHUA 1S1UB 1BQMB 1RT1B 4ZHRB 3BGRA 4O3SA 1XR5A 2ZE2B 3KLGA 1LV5A 4FJXA 4KREA 4RW7B 2IJFA 4E7LA 5F8IA 1U48A 3RB3A 1RT6B 4KTWA 1TVRA 3QO9B 3GILA 3TAPA 1W25A 1XC9A 4HCBA 3OS0A 2YNHB 2E4LA 3HL8A 3DRSB 2XRIA 4YR2A 4DS5A 3NHGA 4W5TA 3HVRA 4Q0BA 4BWMA 1IG9A 5J1EA 4CGIA 3RAXA 4KRFA 3L2UA 5KT2A 2W42A 3K58A 5KFWA 1Q9XA 1S9GB 4FM1A 3EZ5A 3NGIA 4FM2A 4EYIB 1JLFA 4TYBA 3SZ2A 1C6VA 4TY8A 2AQ4A 3U3GA 1RA6A 1VRUA 2GBZA 2VA3A 5T14A 3RMCA 1S6QA 4I9QA 1L3TA 3PW0A 4KKOA 1DTQA 1FK9B 3LALA 3TARA 3TVKA 3MEEB 4R0EA 2FBYA 3KHRA 3OYBA 2WONB 1JL2A 5EWGA 3L2VA 1NKEA 1TP7A 3SFUA 4OVLA 1NK4A 4RW6A 4CHOA 2JEFA 3C95A 1Q8IA 5CYMA 3TAEA 4CE9A 3NGYA 3L3VA 3HT3A 3V9UA 2OPPA 3PW4A 5KRTA 3KNAA 1LWFB 3FQLA 1YVUA 5EUHA 1JLBB 2PYJA 3SJJA 4ECVA 2ASLA 3DRPA 4KBIA 2J6UA 5HBMA 5KG0A 3OYFA 1X9MA 5CZ2A 5L1LA 3PW7A 3K5OA 2HVIA 3HJFA 4E7IA 3I0RA 4WFYA 4RW8A 3PY8A 4KB0A 3ISND 5KG3A 4DL2A 3BREA 1QHTA 2ZQBA 1YT3A 4H4OA 3MFIA 2P5GA 2GUIA 4ZP6A 1KCFA 3L3UA 1SL2A 4LSNB 1ZBIA 4FLUA 4Z4IA 3DLKB 4PUOA 4CEAA 3NAEA 2ILZA 1TL1A 4O3PA 5JS2A 1UWBB 4Y1CA 3BQ1A 1F21A 1SUQA 5C25B 2B5JA 3BDPA 1D9DA 2QE5A 1WAJA 2FVPA 3IN5A 2V0NA 4K4XA 4QOZB 2J6TA 1T03A 2GV9A 1NOYA 2YV0X 4ICLA 3UDLA 2G8KA 1Z26A 2VG6B 3H5SA 5KG5A 1VSMA 1A5XA 1HNVB 1DLOA 4CHPA 2D41A 3UIQA 3NH2A 1RT7A 3TAQA 4CJ4A 1I6JA 1TKXA 1QAJA 5CYQA 1YTUA 4DTOA 3BGRB 1HMVA 3KLVA 4MFBA 1XWLA 4FXDA 4Y2AA 4NRTA 4FJLA 3PZPA 3TQ1A 3M9MB 1TVRB 5DG8A 4PY5A 2WK4A 1TAQA 4CK1A 2PY5A 2W9CA 4DG1A 3HSTB 1JLEA 4JV2A 3DRRA 2HWHA 2FLNA 4Q0BB 1FKOB 5J1EB 3QIDA 4RZRA 4CJ5A 5CZ1A 1ASVA 4MKAA 4DLGA 4KI6A 3E01A 2FLLA 2JEJA 1RT3A 3PHEA 1BCOA 4FK4A 1EP4A 3JYTA 2B43A 1JLFB 4FLWA 4TY8B 1JLGA 4HKQA 5KFSA 3ZSXA 3CFRA 4IDKA 1VSKA 3RRHA 1SV5B 1D8YA 2G8IA 1S6QB 4CF9A 3T3FA 1CXQA 3GIIA 3SI8A 3JSMB 5C5JA 3VQ9A 3K59A 3AO2A 3I5BA 4E0DA 4FJHA 5FRNA 4NYNA 4CHZA 3WNGA 4OLAA 3SI6A 1WSEA 4O3RA 1D0EA 3RRGA 2ZD1A 2YNFA 4IFVA 2W8KA 4ED1A 1WSIA 3HP9A 4RW6B 4DL7A 4R5PA 3AA2A 5CYMB 3MF5A 4N41A 3T1AA 2OPPB 4M3ZA 1JX4A 4Y3CA 1WNEA 2DPJA 2JEGA 3BQ2A 3VA3A 5J2MA 4H8KA 1S0OA 4KHMA 3DRPB 1S9FA 5KFMA 2PZSA 2FBXA 2P51A 5F8NA 3AVNA 3I0RB 4RW8B 4DTSA 1HPZA 1ZTWA 4H4OB 4CIEA 4HHTA 4OL8A 1NK6A 4DSIA 2G8VA 2E9RX 4KTZA 3SUPA 2G8HA 3L2QA 3QYYA 5KT5A 2IM0A 3AVAA 4DQIA 4PUOB 1TL1B 5SWMA 1JLAB 1UAXA 1BQNA 4NCBA 1GX5A 4KHQA 2R8JA 3KHLA 4CF1A 1MMLA 2B5JB 3SQ4A 4F8RA 3VQBA 3HPHA 3AVGA 4M3UA 2QXFA 4CFDA 5I42A 1T03B 1I39A 4ICLB 2YNIB 4NLQA 3H5YA 5DG9A 2FVRA 3S3NA 4NLWA 2FVSA 1DLOB 2ASJA 4J2AA 4YQWA 4OLBA 1RT7B 1TQLA 1RNHA 3OSPA 2FJWA 1C1BA 4RW4A 3QETA 1TKXB 2DTUA 3D45A 2GIQA 4NYFA 1S1UA 3PJWA 5CYQB 4OPJA 5FDLA 4UQGA 4DTXA 3KMQA 3LZJA 1HMVB 4YNQA 4IH7A 4MFBB 4RW7A 1KHVA 3VQAA 3OYLA 5EWFA 4IR1A 4FJIA 4CF0A 5KI6A 3H59A 3O3GA 2VG7A 3LZIA 5KT4A 2W9CB 4DG1B 1QQCA 3I0SB 1GOCA 4DL5A 3DRRB 2ETJA 5EU7A 3CJ4A 4IG3A 1XHZA 1C0MA 4FBUA 2ITGA 3E01B 2OA8A 1BCMA 1ITGA 3HVTA 3UPFA 1RT3B 1TL3A 1VSLA 4FJ9A 3DLBA 4LY7A 2XGPA 5DMRA 3C6TA 3QLHA 2X78A 2BGGA 2G8UA 5T7BA 1EP4B 3JYTB 1RT5A 1NK7A 2YNGA 4IDKB 4C8OA 3F9KA 4N56A 5KG4A 2LSNA 4CIFA 4ED6A 3L8BA 1EETA 4FLVA 3MEEA 5DLGA 4XO0A 5F9NA 2UUTA 2WONA 4FLZA 1NJXA 4CHQA 3G6VA 4FJ8A 3U3YA 1KVBA 2ZD1B 1R0AA 2JC0A 2YNFB 2IDOA 5FRMA 3I8DA 4QAGA 4HTUA 4ZPAA 3KHHA 4YMEA 4ZVHA 3OSNA 4R5PB 1EKEA 3AVIA 3ZT2A 2FC0A 3AO1A 3NF7A 3RB0A 4BWJA 2BR0A 4DLEA 2BDPA 5KT7A 4MIBA 4KO0B 1HQUA 1LAWA 4EBDA 3QEWA 1CZ9A 2KFZA 3MXIA 1QSYA 4DTNA 5J2MB 4BACA 4FZXC 1NHUA 3LP0A 1RTJB 1BGXT 4BE1A 4KB1A 3OJUA 5F9LA 3ZSRA 3DYAA 1HPZB 1GX6A 4AHUA 2AX1A 4FW2A 1UOCA 2F8SA 2KFNA 2OH2A 4KPYA 2FVCA 4CIGA 4LH4A 4CEBA 1B92A 1RCHA 4MH8A 4PQUA 3HXMA 4E3SA 3ZSWA 2FJVA 1J53A 2HW3A 2WTFA 2HWIA 5L1IA 1U45A 4DU1A 4DFJA 1JLQB 3KHGA 1TKTB 4DL6A 1KTQA 1WSFA 4CJFA 4N47A 5C42A 4NLRA 1JXEA 1X1PA 4DQQA 1HNIA 3QGGA 4M94A 2BRLA 4JRPA 2IM1A 3ZT4A 4AHRA 3ZT3A 1OS5A 1LW2A 2VG6A 3RMAA 4K4SA 1IKYA 3KKSA 2QK9A 4C8NA 2ATLA 4F4WA 1C1BB 1VSJA 4NLOA 1C1AA 4RW4B 2Q3SA 3NF6A 1VSEA 5FDLB 2XCPA 1TK8A 4NLGA 4KHSA 4KV8B 4QW8A 1KVAA 4DQSA 4JS4A 2E6LA 4KI4A 5KFEA 3VQEA 3DLGA 1S48A 4FM0A 4CJQA 3SQ2A 2VG7B 3SUOA 1K1SA 4CEFA 4GW6A 1IKWA 1JXBA 3KMSA 1FKOA 4IG3B 3IS9B 4CEQA 3KLFA 4KB7A 1RDRA 5KFBA 2C2RA 1RDCA 4E89A 3HVTB 1TL3B 5DQHA 3ITHA 1W9HA 4C8LA 5EWEA 3C6TB 3QLHB 1A5WA 1O1WA 3KLIA 1RT5B 1NJYA 4IRDA 3S3MA 4O44B 5KFXA 3GV8B 2YNGB 1RBVA 3QZ7A 4B9UA 3U6FA 5L1KA 4AILC 2EX3A 1SV5A 3QEXA 4TYAA 4AHCA 3NKYA 2KZZA 3BQ0A 3ISNC 1VSHA 1EETB 3JSMA 5HROA 4FLXA 3V9XA 4XPEA 3RMDA 2YKMA 4B9MA 4HUGA 1WNSA 1KLNA 4GVMA 3DOLA 2BE2B 3DMJB 3BR9A 4E1NA 4K4UA 4DSEA 4CK2A 3NBPA 4DTPA 4QWCA 1R0AB 4JV0A 2BRKA 1RDBA 4ECYA 4KAZA 3CO9A 4M3WA 3FRZA 3QIPA 2G8WA 2VG5B 2BQRA 3PO5A 1KLMB 4O0JA 3CDUA 2OZSA 1HQUB 4ID1A 4CJVA 1L3VA 4F2SA 4E7JA 2WRMA 2OPRB 5DQIA 3IG1A 4QWEA 1QTMA 2R8KA 4Q8EA 4EBEA 3LP0B 3KKRA 2IC3A 1QUVA 4LQ3A 2OPSB 3WNHA 2BQ3A 4BDYA 4QW9A 1NKBA 3AVCA 3HKWA 3DYAB 1RT2B 3VQSA 4CF2A 5L1JA 4CJPA 4TLRA 3OS2A 3BSOA 2W9AA 3OHAA 3G10A 4WYLA 4CEZA 5HLFA 3PW5A 5KFPA 4PQUB 2WHOA 5DQGA 2KQ2A 2OZMA 2QV6A 4DFPA 5C24A 1L3SA 3QZ8A 4ECZA 3OYKA 4IH5A 2FBTA 5HRNA 3F73A 1JLAA 3RTVA 4ECTA 5KFCA 2HNDA 4NLPA 4NLUA 2B6AA 3NH0A 2R8GA 3NAIA 4ED0A 2XY5A 2V4RA 5C42B 4C8MA 3CJ3A 3B6PA 4URGA 5KGWA 1HNIB 4DWIA 3NFAA 4F2RA 3KIOA 2O4IA 3H08A 4EZ9A 4HCCA 3SV4A 3TAFA 1LWCB 2YNIA 3QEIA 4URSA 3M9NB 1LW2B 4CJRA 1S1XB 4LD0A 4EEYA 4IG0A 5DGAA 3I5AA 3H2LA 3T5LA 1IKYB 4NLSA 3V1QA 2XY7A 3KLEA 2YHAA 2R7YA 1JXLA 4DU3A 5KFJA 3HK2A 3M8SA 3TI0A 4RNOA 1U04A 2C28A 2A1SA 3LAMA 2YHBA 2KW4A 3ZT1A 4FCYA 1Z4UA 4RW9A 4DS4A 4Y1DA 3NGZA 3DI6A 3DLGB 4O4GB 4K8ZA 2RPIA 2R2TA 5KFAA 3TABA 4MQ3A 1S0NA 2O4GA 4Q44A 4OPKA 3I0SA 2DFHA 2RKIA 2C22A 1X9WA 1IKWB 3N6MA 3HM9A 3D0PA 5F8HA 4G3IA 4HUFA 1IM4A 4EP5A 1N5YA 3M9OB 3KLFB 2QKKA 4EO6A 1TKDA 3ITHB 4DEZA 4ED2A 3GV5B 4IRCA 1QSLA 4OKJA 4J9PA 3V1OA 3KLIB 3LP1A 1XR7A 3OLBA 2J6SA 3T19A 1SKWA 4M3XA 4RNHA 4WFZA 2Z1IA 3SCXA 4IKFA 2X6NA 3MTKA 3AA4A 1ZBLA 4WE1A 4ZTJA 5HROB 4FVMA 3VQ5A 2YKMB 1RDDA 1TK0A 3PR5B 3DOLB 5KFFA 4ZTFA 4FLTA 1L5UA 2WOMA 1ZETA 3H4BA 4FJGA 3NBPB 4I2QB 2HMIA 4J9KA 4BE2A 3IAYA 4CEEA 4F4ZA 4HUEA 1HYSA 2CJQA 1S10A 2HNZA 1D9FA 3CYMA 3C6UA 2F96A 3RB4A 4ZVGA 3MFHA 3QIPB 4J9OA 5JS1A 4KO0A 3PUFA 3QIOA 3V6JA 1B9FA 4M42A 2PYLA 4K4ZA 3VN5A 4F4XA 3IG1B 4CEOA 3OLAA 2QKBA 4URQU 1RTJA 2IC3B 3AVBA 4DF8A 2WB4A 1D1UA 2XI3A 1LWEA 1RILA 5KFYA 4Z4CA 1IKXA 3ALYA 5KT6A 5KFTA 4J9MA 1NK8A 4ECWA 3VQ6A 2XHBA 1U49A 5DK5A 5HLFB 4JS5A 5DGBA 2YKNB 1VK0A 5C24B 1HYVA 3Q8RB 1DTTA 5KFUA 3O3FA 1YVFA 2IM3A 4PWDA 3OJSA 1JLQA 2HNDB 1TKTA 4IR9A 5JXSA 3GV7B 2B6AB 2D0AA 2HB5A 4Z4EA 4IRKA 1JL1A 3CJ0A 1Y97A 2C2EA 1GOAA 1YTAA 3KLHA 1C0TA 3VQ4A 5HRPA 3TAGA 3V9WA 1FKPA 2FVQA 3MEDA 1G15A 4IG0B 4AHTA 3IRXB 4W5NA 1N4LA 3KLEB 2FBVA 5DG7A 4RNFA 1S6PA 4H4MA 3T5JA 4DTUA 4KHWA 4ELUA 2XWYA 1RBTA 1HJRA 4FJKA 1TAUA 4KV8A 3CJ5A 4RW9B 3DI6B 3QNNA 4GC6A 3BSNA 2AGQA 2D0CA 4B9SA 3ZCMA 1CZBA 1NJZA 2RKIB 3ZSOA 4FJ5A 4NLYA 2B4JA 3M8QA 4EZ6A 3KK3B 3P5JA 4DFKA 2R2RA 4DQPA 1N5YB 3IS9A 3VA0A 3SQ1A 1RT4A 4FJ7A 1JLCA 3PW2A 3VQQA 2G8FA 3DM2A 3RWUA 3GYNA 4JUZA 4F4YA 3VQDA 4CJTA 3LP1B 4ECRA 3FFIB 4O44A 3HPOA 4TQSA 2Z1GA 1WAFA 1S9EB 1HRHA 4WE1B 3CM6A 4E7HA 4CGHA 3GIKA 3H5XA 2XGQA 4ECUA 2BE2A 3DMJA 4N5SA 2DPIA 2WOMB 1RDAA 3SUQA 4HYKA 3V6DA 4M95A 3SPYA 1RTHA 2HMIB 3CG7A 1HYSB 4KTQA 2HNZB 3C6UB 3MR3A 3BJYA 2FLPA 4M41A 2GIRA 4NLDA 2VG5A 1KLMA 2JLEA 1U09A 2NUBA 1TV6A 1SKSA 1S5JA 2EHGA 3O4NA 3SUNA 3OHBA 2OPRA 2HAIA 1FXXA 1KVCA 3A2FA 4CJUA 2OPSA 5CY4A 2HHXA 4NLXA 2UVRA 2X74A 1LWEB 5JUMA 1RT2A 1IKXB 3NE6A 4NCGB 2Y1JA 4FZZA 4K4VA 2IAJA 3KK2B 4CK3A 1S1WB 4M45A 2E9ZA 3HYFA 1BI4A 1WN7A 4TSXA 3MXMA 5J2NA 5KFNA 4Y2CA 4KHRA 1X9SA 3NH1A 1C1CA 4LSLB 1DTTB 4B08A 2AX0A 1NK0A 4PWDB 3UR0A 4ZP8A 4RUAA 3KJVA 1WSHA 4ED8A 4HVJA 1IO2A 1T7PA 4RU9A 4J9SA 5KG2A 3NDKA 1ZBFA 3S3OA 4OKEA 3OYDA 3KLHB 1C0TB 3VQ8A 3OYGA 3OYJA 4CERA 1KHWA 1HQEA 1FKPB 1LWCA 3CM5A 1NK9A 4FS2A 3MEDB 1S1XA
chains in the Genus database with same CATH superfamily
3KDNA 4LF7F 1JCGA 3F2KA 4AHVA 3DLLL 4DUTA 3ZO7A 4WF9Q 2GEMA 5GMDA 2MY7A 1S6PB 2VA2A 3HHKA 4B9TA 5AQGA 1C2PA 5KT3A 4C97A 3LP3A 1RBSA 4WFAL 5KG1A 3HD2A 2G9OA 3TTCA 1W97L 1BXNA 2FGCA 3FVYA 1N36J 2UVUA 5KG7A 2QRRA 3GFHA 1NPRA 1FO1A 4WFXA 3CJKB 4JI8J 1XEZA 4CZFA 4HTLA 3M8QB 4CLZA 3FBBA 1C0UA 3NXZA 5E41A 4AHSA 3SYZA 1VI7A 3FSIA 3DM2B 4LF6J 1ZBHA 2AP1A 4ALZA 1HR0J 2O8CB 2DK2A 1LCUA 5ETVA 1IR1A 3CXCR 2B4UA 3CDWA 1RSCA 4GVBB 3AA3A 3WX4A 4GMJB 2LU2A 2DY9A 3RBEA 3JTNA 2UVVA 3MECB 5KFZA 2WAQD 1PJ7A 2H5EA 1M1KT 2W9BB 1FRJA 2G2YA 4U7UD 3K0JA 1ZBTA 2PMZD 2YPYA 5LM7E 2E9TA 1RE1B 3ETOA 3NRBA 4EMDA 3A8IA 1LOTB 4YB5A 3MN5A 4I2QA 1VQ5N 3MR6A 2NXNA 3MM6B 1TKZA 1BDGA 1F5AA 2O67A 4QWBA 3AVHA 4Q45A 4GC7A 3UD4P 2JC1A 1WSJA 1HPMA 3AD9C 2ZBIA 4H0XB 3KK1A 1FEEA 3PX6A 3Q83A 3KD1E 2E7VA 3NF8A 1EWRA 1RAJA 3IAS9 1C0GA 4DTMA 2QLJB 4HR2A 4PG4A 3PYDA 4YN3B 3ATUA 2XI2A 5E3PA 4M3RA 1HI1A 5L9XA 3R6MA 1VRQC 2F9WA 4DSFA 1WBDA 3OL8A 5F3TA 1RZMA 1LW0A 2OYQA 1N33J 4K8XA 2BABA 3TA0A 4WFBL 4H4KC 4LF2A 3CFOA 2RAQA 4LQ9A 2P9CA 3SEOA 4Y2KA 4DZDA 2HNYA 2R7UA 4A62A 1RWXB 3BBBA 3GIMA 3LWLA 4TXSA 2DY1A 2W01A 3KJVB 4KSEB 3GL1A 2B4VA 2HBYB 2CJBA 3V9SA 3VESA 2Z58B 2RF2A 2IA6A 1KD1O 4BRAA 1RGVA 3GJQB 3QFUA 2W40A 2J0XA 3EY1A 3OQ2A 3MEGB 5I3UA 2AV5A 3DLRA 2UUBJ 1TUGB 4QCLA 5M2RA 3GYGA 2WW8A 1I3OB 4G65A 3IM9A 3LP2A 1SKRA 3KOAA 4CZGA 4ZPTR 2GGPA 2MGZA 2BQUA 1N6QB 3PX0A 4Q43A 3OYEA 2MKYA 1CSJA 3RB6A 3VR1A 4O5BA 3IKMA 2R7WA 2M0GB 3HPGA 3S9HA 1LEOA 4CTAB 4I7FB 4KYZA 4RUHA 1YIJS 4EHUA 2CJXB 3ILIA 3NNAA 4QZVB 2NLXA 3MX2A 1EWQA 2PI5A 1TUUA 4DR6K 2DNMA 3EZWA 4B1XB 1YRUA 4UOHA 4IWVA 3D5MA 2HF3A 3GG0A 1HBUB 2E1AA 2V4JB 2EG1A 4KHNA 4DV4F 3BN4A 4R8UB 4DCOB 4JYAF 1VSIA 4KFBB 2A6OA 2X1GA 2HBLA 4FJJA 3I6PA 5KFQA 3QEVA 4OV6A 4E1JA 1PYSB 4ZVEA 4YHHK 3N9UC 1ZZNA 4CJSA 4E7KA 4QWDA 5EGYA 2COLA 1YGYA 4YOUA 1RWMB 3TWHA 2F8HA 3O80A 2GTDA 2AEMA 5DZ6A 1RAGB 2AYMA 2KZMA 4KBOA 4RLEA 4MK7A 9RUBA 1BUXA 4OGEA 1ZTTA 2W25A 4ITSA 2IMOA 4YDUC 2RILA 1CQMA 2EG2A 3DDKA 4A8KA 5F8LA 1KR4A 2AGPA 1DJ0A 1NHKL 4FBTA 4EUVA 4AH9A 2M8DB 4OX9K 2VDIA 1FDNA 4EK2A 5KFHA 4LR7A 1HKCA 4KR0B 3LM9A 1S0MA 3L4IA 1S1WA 1C0FA 5DLFA 3DDIA 2ZDPA 2XQCA 3PV8A 4Q2LA 1OYDA 1CLQA 4MO5A 4H5RA 2B8QA 3Q8UA 4FJNA 2X6SA 4IQXA 2E1YA 4DHVA 3K2PA 4I6MB 2DGTA 2C42A 1S97A 3H45C 3U1NA 2HHHF 1UEKA 1K8KB 4RNMA 1RFQA 2UVWA 2NRRA 4HLBA 3OXLA 3AGRA 4CJ3A 2P5VA 3D28A 3P8BB 3NF9A 3D54A 3C16B 2FJEB 2HLUA 3UI3A 3K5NA 2F4VF 2HS4A 4F4AA 2VZ9A 3FR0A 2V34A 4OO1J 4DN9A 4X4VA 1IWAA 3PCOB 3M8PA 1R3NA 3OL9A 2ZBCA 4P10A 2IJNA 3G82A 3EZUA 3VGUA 2GHPA 3OBWA 4CDIA 5FROA 4H5VA 3FNNA 2UV8A 5KFRA 3V6KA 2L41A 1BQMA 2ZE2A 3D6HB 5CHCB 2G0CA 3G6YA 4FWKA 1I94K 5IQQA 4K7QA 2QWOA 2VQFJ 1SC3B 2RMLA 4BS2A 2Z1JA 3M8YA 3FCVA 3KVGA 2HGMA 3PYGA 1EX4A 4CESA 3AJ2A 1X3MA 4ILGB 3TTDA 4IOBA 2P1JA 4BDZA 1KFSA 2M3DA 2X1FA 3MECA 4CCHA 3EPGA 2Q79A 3AFGA 3QNWB 2W9BA 5B0GA 4DN0A 3VQPA 4S0MA 1EJ7L 5KFDA 1SH0A 4CJWA 3ZZ0A 5DM7Q 2C1EB 3CC7S 4JEPA 2Q97A 2ZF5O 2H4YB 3UQSA 4XEIA 4A2BA 1SVDA 5ETTA 1F9FA 2CPXA 4KH0B 3M6GA 2WTUA 2A18A 4GRSA 3O9QA 1N56A 3O6WA 2E2OA 4JKCA 3WC0A 4CHNA 1V4TA 3OY9A 4ATNA 2KHDA 4W5RA 4NLTA 4M63A 3UKRB 1NJWA 5D4NA 3GJTB 3H0PA 4G1QB 1VBXA 2XLJA 1R8HA 4ZVFA 3TO8A 4USIA 1V3RA 2P9UA 3QWUA 1K73O 4JV1A 2V8DA 1SL0A 4JI1J 3DDNA 2VBZA 4IFYB 4L3QA 3KG0A 5HVHA 1HX1A 3GSDA 1U25A 3OUYA 1VK8A 2HYIB 1N8RT 2ILYA 2W6KA 1WSGA 3MR2A 4LSNA 4EP4A 3I9ZA 1YJRA 5K8MA 2QSFA 1HD0A 3M7VA 3MGJA 1VAZA 2NZ4A 3OTOJ 2EW9A 5GAGP 1OYEA 1U0HA 3RAMA 2NYHA 3AO3A 5BR8F 5C25A 1MU2B 1IJJA 1BUPA 3VGSA 1CC7A 2ZUAA 3CQ8A 2MKSA 3FJ2A 3CC4S 4W5OA 3H25A 1WF1A 4JLHA 4R79A 5I42B 3WNFA 3MXJA 3O4QA 1G3OA 5HMYA 2UUCJ 2EFGA 4ELTA 3K2YA 3QRRA 2JVRA 2LXUA 3QAUA 4DPWA 4DV6F 2DGQA 3HP6A 2FJBB 2Z2LA 1D9AA 4KAIA 4TY9A 3L95X 4KC5A 2ZNYA 4U67Q 2KH9A 3K89A 2J0SD 4WTOB 4CTAA 4ZHRB 4J37A 1R6YA 3G4SN 1RGIA 1LV5A 4A61A 4DV5F 2OD4A 3G9CA 1SCJB 4E7LA 1RT6B 2CJ9A 1B70B 1TVRA 3QO9B 4BROA 3TAPA 1W25A 1PYOB 2YNHB 1HJOA 6AT1B 3HL8A 1FE4A 2XRIA 2FHJD 2QWQA 1HBUA 4ZLLA 2JSXA 1RXOB 2ASMA 3VTHA 4WF9L 4KRFA 2DRBA 3L2UA 3TZZA 5KT2A 5KFWA 1NGCA 1KC8T 3CE8A 2G1DA 3QAEA 2CIMA 2W2PP 1JLFA 3ZZUA 4XH1A 4C9DA 1Q8BA 5B0CA 4TY8A 3U3GA 1YLXA 1RA6A 2W2NP 1PJ6A 1M5KC 2VA3A 3RMCA 1S6QA 3H1QA 1XERA 4I9QA 1L3TA 4FZVA 3BO4A 3MEEB 2DXFA 1GLBG 1XUPO 3QJLA 2E7WA 4Y65A 4RBTA 3CCLS 3K7RA 3H46O 3M8WA 4OVLA 2XNQA 1NK4A 4ETZA 4PL7A 4RW6A 4CHOA 1JB0C 3C95A 1Q8IA 2AYBA 2ITMA 2N82B 3TAEA 3NGYA 5A2QY 4LFAK 3HT3A 3QICA 2OPPA 2HVZA 2GVZB 1LWFB 3VAIA 4DV3J 4PEOA 1YVUA 2HSTA 5EUHA 3P49B 1QDUB 3PW7A 2HVIA 1UTAA 1VQLS 4JB8B 1DEJA 3GP9A 4RW8A 1FRHA 3PY8A 2P6TA 3O44A 5KG3A 3BREA 3LGNA 1RADB 2ZQBA 4DV7K 3MFIA 2P5GA 5CCLA 2R7OA 3NS7B 3MM9A 4JI7F 2IVOA 3D0GE 2HBKA 4FLUA 4LFCK 1NZ8A 3FLCO 3DLKB 4CEAA 1NBWA 2ILZA 2YBVA 1WKLA 2HGNA 1YI2S 5JS2A 1YJWN 3BQ1A 1ATRA 1HW9A 2B5JA 3C3LA 4USMA 4DPXA 4C3LA 3Q23A 2A3JA 4CIOA 5IS2A 1T03A 2GV9A 2H3GX 4CP5A 1W2BM 2QX0A 1U6BA 2P9LA 1HNVB 1CS4B 1DLOA 2WBMA 3PRVA 4CHPA 2HS0A 4OLPA 3T1HF 1RT7A 3W7BA 2E1CA 1BO5O 1ESVA 5CYQA 3H3OB 4DTOA 3BGRB 2MLXA 4JD2B 1HMVA 4MFBA 2FF3B 4DCHA 1WI6A 4B3RJ 1FJGF 3MMJA 4MIWA 4OQJA 5IQ6A 2DR7A 3J8AA 2PY5A 2QT7A 2Z57B 1IM6A 2W9CA 1GLFO 3HSTB 5IT9O 4OZ3A 2EFNA 3HHLD 3QIDA 4FXVA 3RSEA 1ASVA 4KI6A 5HO4A 3R8EA 2L9WA 2W7AA 3PHEA 4FK4A 4FLWA 2QA1A 1TELA 4HKQA 5KFSA 3IWLA 3RRHA 4OZ1A 1NU4A 1D8YA 3E66A 2G8IA 2MQMA 2ZVIA 4BC7A 4ZVUB 4MTPA 4CF9A 3MMCB 1CXQA 3SI8A 3EN9A 2UXCF 2BJ7A 4CRJA 2QFIA 2HZVA 1X5SA 3OFHA 5C5JA 1YJNS 4JI3F 3K59A 4V19X 4ER8A 1OH6A 4FJHA 3J7YP 4NYNA 3SI6A 4ES3A 4O3RA 1D0EA 1FT8A 4IJAA 4BC4A 1G2EA 2EVZA 3THXB 2W8KA 4MAKA 1WSIA 3P96A 4JI2K 2FSKA 3QFWA 3UDVA 4F36A 1FW6A 3FZFA 4DL7A 4YB1P 4J8FA 3T7ZA 4USKA 1VQ7S 2VGMA 5CYMB 3CPWR 3W3DA 5HAOA 4YORA 5ETSA 2YWFA 4CWBA 4M3ZA 4NI2A 2PFDA 5HJXA 5A8KB 2DPJA 5LOQA 2JEGA 1TMMA 3OR1B 5J2MA 3IFRA 1RAIB 2R9LA 2Q31A 5KFMA 3AB2B 1NSQA 3VAKA 2A2CA 3I0RB 1VQPN 3BYPA 1HPZA 4X4OA 2WB1D 1QVGM 4H4OB 4ZCIA 1FE0A 1WHVA 1N36K 3A8YA 4MKVA 2CRLA 3AJ1A 2G8HA 4JI8K 2IM0A 1URRA 2D3OR 5AR0A 4PUOB 2GWJA 4WP3A 5CAAA 4J7CA 3VAJA 2HIQA 4JNEA 2ROEA 2RNEA 4LF6K 1NEEA 3KHLA 1HR0K 1VQNS 1ILYA 3SQ4A 4F8RA 3VQBA 3CJ8A 4OYPA 3BKTA 4P2XA 1QJHA 2QXFA 4CLFA 5I42A 4OYIA 1F6TA 3EE3A 3MOZA 4B1VA 1VQ6N 2YVSA 4NLQA 3H5YA 5DG9A 2ZH2A 3WC2A 2FVRA 5LSLA 4NLWA 2V2VA 2FVSA 2MXYA 1GQEA 4Q2MA 5E0OA 3AAWB 1RNHA 5I4MA 1C1BA 1WG5A 3U1LA 1FRLA 2IIRA 1TKXB 1EZZB 3EVMA 1WB9A 5GADI 4LC9B 2GZOA 3D0HE 2H51B 1RAFB 1KHVA 3VQAA 3OYLA 2KJVA 4CF0A 3H59A 1IUJA 1U6FA 1DZ5A 5KT4A 2YCHA 2OMLA 1CPZA 2HQDA 3TX8A 2PBDA 4DL5A 2DNZA 1T3OA 3CMAS 2VPZB 5KAKA 1C0MA 3VERA 1UL3A 4K0KJ 2YQ0A 4GKJJ 2X1BA 1BCMA 4O0NA 3UPFA 2HFNA 1RT3B 4FJ9A 1PGZA 3QLHA 2NUUG 5MLCV 2FPHX 4OI2A 5T7BA 1T02A 1N33K 4F3MA 4YOEA 1JMTA 4C8OA 3DC2A 4CZHA 2XS2A 2HBJA 1SJFA 3ZXWA 3L8BA 3HD1A 3MEEA 4XO0A 3ENQA 2E2QA 2NREA 1GT8A 4CHQA 3LDNA 1YJTA 2LA6A 2JC0A 2YNFB 5T7LA 2QFJA 4ZPAA 1S7IA 5ETOA 3OSNA 4HT5A 1YITN 2AT1B 2BR0A 1FRXA 4KHPF 1WUUA 1Q86T 3CHWA 2KB2A 1M5PC 1LKZA 1PYTA 4NXNF 3MXIA 1X60A 2UUBK 3VAHA 1NHUA 3TEHB 2JHEA 4M63C 5HSPA 5F9LA 2Q3PA 5A8RA 3DYAA 2V51B 4B3SF 4FW2A 1Q7LB 4IDHA 2F63A 1NMNA 5GVQA 5HQLA 3J7Z5 4CIGA 4ZDNA 1ZA2B 4QYZJ 2CJKA 3O3LA 4ZVQB 4A47A 3FSXA 3U8XA 3CCMN 2HEKA 2CUYA 3R3LA 3G8SA 1KTQA 4CJFA 5CYJA 2Z30B 5C42A 5AE2A 3ISZA 1X1PA 4DQQA 3HFZB 2F7TA 2OD6A 1Q8LA 3TJ9A 2XSFA 4JRPA 4W92B 3ZT4A 2DGVA 3MCNA 4J9VA 3ZT3A 1LW2A 2QL9B 4FWNA 3OVBA 2Y0SD 4BR5A 3NMUA 5EN1A 2QK9A 1N0VC 2CJAA 3MK6A 4DDFA 3R9PA 4F4WA 1GMWD 1H6KX 2Q3SA 3NF6A 1VSEA 1VQON 2DIVA 5E33A 2GNKA 2XCPA 2LVWA 3MUTP 4JP8A 4K8RA 4KV8B 4QW8A 5KFEA 4FM0A 3G96A 4LF9F 1KQSM 3KMSA 3PJ9A 4ZVPB 3F9MA 5LL6d 2MQPA 5KFBA 2EI5A 2V94A 3RG6A 2C2RA 1RDCA 1W9HA 5EWEA 3PXGa 2H5IB 2UUAF 3KLIA 1RT5B 4IRDA 4DUZF 3QT8A 3GV8B 4BC3A 2KG1A 2ADCA 4QYRA 1VQSA 1ZM4A 1AT1B 3MMCA 3UB5A 2FHMA 3LDQA 4FLXA 4XPEA 3W0LA 1VHXA 4HUGA 4CBWA 3BR9A 1DFDA 1OWXA 2F40A 3MPVA 4DSEA 1HNWJ 4DR2F 1R0AB 3THXA 4JV0A 4QIGA 2DEJA 4BC5A 1RDBA 2K8GA 3IFEA 1PCAA 3ZLJA 4BRHA 5AZJB 1UFWA 3CO9A 4M3WA 1SQEA 1H3DA 1YVNA 3PO5A 1KLMB 2OZSA 3J81O 3MUVP 1HQUB 1N0UA 3UCUP 1L3VA 1RHMB 4F2SA 2KXFA 4CLUA 3IG1A 2V8VA 2DGXA 3B82A 2FC9A 4Q8EA 3BGUA 3KKRA 3AD8C 3KJFB 4QW9A 3HKWA 3DXBA 3NCRA 1P27B 1RT2B 2APOA 2EFVA 1TUVA 5L1JA 1FX2A 2G0JA 1R6VA 4B1WB 1O13A 3MX5A 5AQTA 1KEKA 1AUDA 3G87A 4DPOA 4CEZA 4OYZA 5HLFA 1U24A 3O1LA 2A10A 4DFPA 3LW5C 3OYKA 4ZITA 1NO8A 2VB6A 4EWTA 2VQFK 2L08A 4NLUA 5GINA 2B6AA 4M1KA 1IR0A 2R8GA 5E3QA 3CJ3A 2AJ4A 3B6PA 3FGUA 4YEAA 2M88A 2NPFA 3H08A 1GXTA 4EZ9A 3SV4A 1S72S 3QEIA 3M9NB 3R9LA 1NRKA 3T5LA 2HMPA 1JXLA 2V2QA 2MZQA 1MMNA 5KFJA 3HK2A 4OHXA 3TI0A 4GO7X 2LQ8A 4LF7J 2KW4A 3ZT1A 2ABYA 1TMJA 3NVMA 1RK8A 4Y1DA 3DLGB 4HHHA 5ETPA 1PSDA 1RDWX 4ZCKA 3P4IA 4P75A 2W2QP 2VUGA 4A5BA 3BYRA 3SMZA 2C22A 2YHXA 2B9EA 4B3TF 4OZ0A 1PBUA 3HM9A 3D0PA 3PDNA 1Q95G 4G3IA 2AZ3A 1IM4A 3KLFB 1XMOF 4F9OA 1Y9OA 3JTOA 3IDHA 1JQGA 2O8FA 3ITHB 1ATSA 1VQKN 3JB9k 1ZOTA 4IRCA 1NPKA 3EO3A 2VFUA 3LP1A 2YHWA 3FMWA 2J6SA 3T19A 1WG4A 2K7JA 3SCXA 2X6NA 1E6VA 4RR5A 4JI1K 4WCEQ 5HROB 1TK0A 4AD6A 3PR5B 3DOLB 4UQTA 1GLLO 1W7AA 2BVZA 3NBPB 2LEBA 2W1BA 4J91A 2HMIA 4J9KA 3EKSA 4BE2A 2GCFA 3IAYA 4F4ZA 1H2VZ 4G6VB 2VPYB 3G25A 2CZVC 3UE2A 1FERA 3CYMA 3OTOK 1FJ7A 2NRWA 5JS1A 3ZETB 3QIOA 1FF2A 4FKYA 3OW2M 4M42A 2ZDOA 3ZX2A 3K0SA 2YTCA 1MN9A 4PXCA 2PT0A 2W41A 4F4XA 1N88A 2OO4A 3DRYA 1FXLA 4GNIA 2UUCK 1UP1A 2WB4A 2DHXA 1LWEA 1Y5IB 3KJNB 3IAM9 5KFYA 1H98A 1IKXA 2AA4A 3ALYA 1NK8A 2FSJA 3D2WA 2HKEA 3J7ZO 4JS5A 4WP8A 4NYPA 4UW2A 4U7BA 1XQIA 1HYVA 2DRDA 2QEXN 4BR9A 1WDTA 1YVFA 5EX0A 1VQYA 3CIPA 4PWDA 2J9CA 2VL1A 3UVJB 4IR9A 3MCAB 3S7RA 4Z4EA 2V2ZA 2JRSA 4IRKA 3DWLA 1Y97A 3L3CA 1YTAA 5HRPA 4BR0A 3TAGA 2WC9A 1FKPA 2OEMA 2FVQA 4W4MA 5JVHQ 3CO0P 1YJ9S 3KLEB 1NJIT 3EE8A 3JAMU 1NCLA 1FFSB 4WK1A 3LF0A 3I56N 3T5JA 1R31A 2XWYA 4FJKA 3IWNC 3GJSB 4KH1B 2A1BA 3Q2SC 4KV8A 4QS9A 5IWAF 3CJ5A 3WZ0A 5C7PA 2CQPA 2OANA 4JKAA 1ZBSA 2E2PA 1FDBA 4C2MA 4QR1A 3VAMA 3CCJN 1CZBA 3GDQA 2CGKA 3ZTOA 4A2AA 4FJ5A 3IMQJ 4H0PA 3AB4B 5ETRA 3L0QA 1N5YB 3KZBA 1RT4A 3FZ2A 2E1MC 3CCVS 1FHTA 1S57A 3BH6B 1ZS6A 1ELOA 3DGVA 4X4NA 4F4YA 1KOOA 4CJTA 4DV3K 1VFJA 4ECRA 3FFIB 2CNKB 1Q82T 3J80U 5A6WA 1WAFA 1HRHA 3W2WB 1ZPWX 4ENOA 4E7HA 4CLWA 5F1XA 4CGHA 5AQWA 3H5XA 2WVFA 4ECUA 4N5SA 2WOMB 4KGXB 1RDAA 1NLKL 4M95A 2X7IA 4DV4J 1RTHA 1BD6A 5ADXH 3SPYA 4JYAJ 1HYSB 5A2QO 3W8GA 2Q1NA 4U7UK 3BJYA 2ZJQL 4OI6A 3GR1A 1U26A 3M6UA 1KLMA 2LEPA 2NUBA 4A4JA 4NA2A 4C0OC 1XNRF 2OTJN 1HI8A 3P39A 3A2FA 3G71S 3GMGA 2XZTB 3C19A 2HHXA 5CY4A 3CJ7A 1RCXB 2UVRA 1JCFA 1VDHA 1RT2A 2D74B 1F1BB 3CEDA 4K4VA 4WKRA 2VC0A 5M1PA 1NSAA 3BDEA 4V19J 4TSXA 3CCSN 4HWIA 3OXFA 3QB0A 3KYLA 1X4GA 3W66A 1C1CA 4LSLB 1DTTB 2EXUA 2EK6A 1AXQA 3I8BA 4OLOA 1YHQS 4IOCL 4B3RK 4ED8A 4HVJA 1IO2A 5AQSA 3UR3C 2XWXA 1M5SA 5K8PA 1T7PA 3RBZA 3GB0A 1RTZA 4PYDA 5G0RB 3S3OA 1U7LA 1KAZA 3KLHB 1C0TB 3BH7B 1ICEB 2D3O1 1NK9A 3IR6B 4L72B 4P52A 1M1GA 5GADU 3EVWA 4BRPA 2HHHJ 1W7WA 1VHFA 2CPIA 1O5JA 2LKZA 2NRZA 2XZWA 1R8AA 3CCRN 3SAFA 1VQ8S 2EWSA 2IDEA 2F4VJ 2ACMA 5GAGU 4CLSA 4BE0A 4YY3F 4LH5A 3K57A 3B6OA 2OFHX 3AQOA 4ILRA 5AQQA 3LPTA 3C7NB 1KVJA 2RIJA 1MA9B 1JLCB 2F4FA 3CCEN 2MB0B 5LL6Z 2HRUA 2XSJB 1CG2A 4I2PA 3PACA 1UVMA 2JNJA 4JKGB 4YP3A 1A0OB 1HBNB 1KOHA 2ZKUA 3HVWA 3FZLA 1J5OA 3OV7A 1UW9A 2HBRB 1S76D 4ED5A 4X4TA 4KHYA 3D2EB 2L48A 4DSLA 4KIAA 4Y0WA 2RN2A 1R43A 5D4LA 3I33A 2QWRA 3FDSA 3V6DB 4K50A 4C3MA 1O0PA 3CCUS 4DL3A 2GC8A 2WVBA 2EKYA 1WACA 4NASA 4L73A 2DNQA 3MDQA 4CYUB 4FPAA 3OYCA 3ENWA 1GOBA 4MKBA 2I1RA 2ZBQA 2VF3A 4OZ2A 2FIUA 4F26A 4EHTA 3CJBA 3A5OC 5BPMA 4M5HA 3QESA 3N6LA 4YOYA 3BV8A 1S59A 3P83D 3E8OA 3SJHA 3THPA 5GAHU 2YWGA 1SXLA 1W0HA 4EYHB 3NS5A 1V3ZA 4WZMA 4ZCLA 3TOQA 5LJVA 5H9EJ 1BI4B 2XM3A 3J7AP 3SPZA 5MLCQ 5J2NB 4OI3A 4OYWA 4CT9A 3THWA 3V4IA 4NEYA 4DU4A 5IM0B 2DNPA 4FDFA 4PL8A 4DR4F 3GYXB 1IR2A 4J9RA 1ZBUA 1VJWA 3D68A 3M8RA 1NM2A 3GJRB 2HQIA 1RYRA 4UF4A 4DL0C 4Z4GA 1HQEB 2U1AA 2HAFA 1P90A 4YOTA 2YPZA 4GKJK 4K0KK 2C3OA 4F3TA 2CQIA 4BREA 4ERDA 1AFIA 2KT5A 1ZZFA 4IO9Q 2DHAA 2E5JA 2MZSA 5KPRA 4P9SA 4U8YA 4IKAA 2F5GA 1VSDA 4M5GA 2OPQB 5BR8J 4PG6A 3RGIA 1M0SA 2CGLA 3PJXA 3AY9A 1T05B 3NAHA 2BANA 3QNOA 2J7WA 3R7BB 4MIAA 1XK8A 2B56A 3VZIA 3RMBA 4DV6J 3PX4A 2V6AA 4MK8A 2NSBA 1NHVA 4LF1A 2HBZB 1QE1A 2DR9A 1RTIA 1UVIA 4QQBA 4C11B 4YR3A 4AF1A 3BBCA 4PYAA 3FFIA 5KFIA 3LGMA 1WG1A 4DV5J 1EKRA 2A2DA 4ZPCA 2HFUA 3T41A 5E3AA 1HL6A 2M9KA 5L39A 5HP1A 1CC8A 2EFOA 3Q8PB 4C7QA 3AVJA 3G6ES 2SXLA 5TKYA 4F50A 4CZLA 1RB0A 1H73A 2R7TA 2IMWP 4B8CA 4O3QA 4QYZK 1JKHA 3B78A 1WWHA 3Q8QB 3NOGA 1WC6A 4KKOB 1CJUA 1DTQB 2MKKA 2MKJA 3AVMA 3MCMA 1WC4A 1VRTB 3R5AA 2HBMA 4JK9A 1CJVA 3KHYA 3HVAA 3LGHA 4K4YA 4UY85 2M4MA 3I55S 2IBKA 4P2MA 1XC3A 5HRSA 3KKFA 4NRUA 3QGIA 3KNGA 4CJLA 3LWMA 2VPWB 3GIJA 4FXWA 5HRRA 2HHSA 3QBXA 2KFYA 4CZMA 1UWAA 4OJ3A 3M2RB 5FJ4A 3C94A 2YWEA 1UJ5A 3DRXA 2QWMA 3GG1A 3FBEA 3P3DA 3CCQS 3KD5E 1HYZA 2C2DA 1VR6A 4ID8A 2OAUA 2CFXA 5HBMB 3D67A 5J2PB 3SBMA 5A0YB 5HMWA 5J2QB 4LSLA 3SV3A 3MR7A 4XTTA 2CYYA 2IVYA 3IR7B 2E66A 4B3OA 4PQAA 1FCAA 2G1HA 4J2DA 2IRUA 4A8SA 4JK7A 3JQJA 2ALZA 3ZX3A 3FZMA 5G0RA 1B7YB 4N77A 2KTQA 5E2QA 2F8TA 3PO4A 2OI2A 2Y1RI 4OV1A 3CCZA 4JI7J 1GTHA 3OR2B 2Z2ZA 4U7CA 2D3ZA 2DH7A 4NEZA 2HFOA 4ZIWA 3DXKB 5D3GB 2XHCA 4WXWA 3ZFVA 3OVNA 3TAMB 4PWUA 3TUZC 1TYQB 3D66A 2ZWHA 4FWLA 3DOMA 5F0XA 1HNWK 3HT0A 3MMBA 2W4PA 1OQ3A 1NGBA 4B1ZA 2MYFA 4BHQA 2N4DA 4BVPA 2W8LA 4Y6IA 5GAEP 4N8OA 1M90T 2QWLA 3T1HJ 2IBOA 4NLBA 1RJJA 1MN7A 2ZWOA 3DLHA 1KVKA 4JAXA 4JKGA 1IKVB 1JLEB 3M2VB 3H4DA 3AVFA 5JVHL 1HBNA 3PFEA 1F60B 4KE5A 2F9TA 2QA4S 3THYA 3OS1A 1R8CA 4X4RA 1REVB 1NSPA 4NLVA 3K5MA 1Z25A 3D2EA 2PD1A 3VOVA 1Z2ZA 3VVTA 4JI0F 1NWKA 2V9WA 2B51A 3HHNB 4DR5F 1HKGA 2PMWA 3M4XA 2D0OA 1MROB 3DOKB 4ZJOA 1R89A 4IOAQ 2VWKA 3MAAB 1EHWA 4MLEA 5DM6Q 4FYYB 5KG6A 2NQPA 3R97A 3PKYA 5E3CA 2B3TB 4FJMA 2IYGA 2IY5B 2GMHA 1S1TB 4CFAA 2IGIA 3WX8A 1IBMF 2UXCJ 3G6XA 4DUYF 5AE1A 4Z4HA 4E1MA 3EYZA 3CJQA 4J2EA 4JI3J 1XI1A 2H65B 1AFJA 3EGNA 4EBCA 1Q0NA 4CGJA 4MK9A 3DCAA 2JEIA 3EDRB 2O5DA 4QWAA 2BEFA 2YKOA 2Q0RA 5F8MA 3CD6N 3H40A 5ITHA 3PSIA 1T95A 4H03B 2RD5C 4M5IA 5L38A 2PN6A 5AQPA 2H3EB 1SL1A 3QJPA 2BKPA 3EJMA 2P8IA 4KY3A 1AB8A 4X2BA 1U1NA 3DLLQ 2V7ZA 3FSYA 2B4OA 3ZNJ1 1RBRA 1YJ7A 4LF7K 1S1VB 4IFEA 1UKUA 3GLJA 1T8EA 2R7RA 3NNCA 4OKKA 2MQQA 1KAXA 1Q9YA 2FHJA 1ASWA 3R1HA 1U6ZA 3ILLA 2BTFA 4A5AA 2CH5A 5J1PA 3ASMA 3R5DA 2HRYA 1RLDA 2DR8A 1U8WA 3BUZB 1UWBA 4H54A 2Q1LA 1A7GE 2M70A 4F3OA 4UUWA 3PVXA 4RWTA 2AJQA 1H74A 1TL7B 2AD9A 3SBTA 5CCMA 1GLDG 1KXPA 4NX9A 1SBRA 4C8KA 3V6HA 3SSRA 3IR5B 5KFGA 4NZ7A 2YJFA 4NLCA 3WXKA 4BQLA 3ADAC 1SS6A 3RAQA 3BY5A 1S1UB 1RT1B 3UKUB 2K2PA 5L46A 4F02A 4KREA 2XMKA 1PILA 1ZAWA 4OPAA 3QJJA 3RB3A 3M30A 1KDNA 3GILA 3BZKA 4HCBA 2E4LA 3CMES 3DRSB 1T3VA 1MNEA 4W5TA 4N7TA 1WBBA 4Q0BA 1FFGB 2J9DE 5J1EA 1WEZA 3TUIC 4CGIA 3RAXA 4HDHA 3K17A 3VEXA 3K58A 2W42A 1S9GB 3IC1A 1GLEG 3EXCX 3KWMA 3PHTA 3IBCB 4TYBA 1HHSA 3SZ2A 1HBMB 2ATCB 2P9EA 3CJCA 3I31A 2VONA 3JAMY 1FVSA 4WFBQ 2E5GA 4KKOA 2J0WA 1DTQA 1FK9B 2XYHB 1Z05A 2VFVA 2Z4PA 3JQKA 3OYBA 2F8MA 2WONB 4K2XA 2FSNA 3KWIA 2XHWA 5EWGA 3L2VA 2I0XA 2GMJA 3UN5A 1YDLA 2CQGA 3SFUA 1RAHB 2WFBA 2JEFA 2Z0GA 3L3VA 2R7VA 3W63A 1OIAA 3C6HA 2OHDA 3H3NO 3PW4A 5GIOA 1KS2A 2EBGA 1JLBB 3LDPA 2FJAB 2E7XA 1OMSA 4PKDB 3SJJA 2ASLA 5JLFA 3DRPA 1SPBP 2J6UA 5HBMA 4KRWA 1X9MA 3QRPA 3NY0A 4KHPJ 4BRNA 3HJFA 4JHDB 1RWNB 3A3PB 4E7IA 3DJCA 3GE9A 3ISND 4X4QA 4EFHA 3MMAA 1QHTA 5B0FA 1HFEL 4NXNJ 4PRFA 1YT3A 3A5NC 2NCKL 2YQ1A 3TJAA 1IV0A 1H72C 3L3UA 1HNXF 3UD5A 4O8UA 2YX1A 1ZBIA 3V2UC 2FY8A 5H9FJ 3HHLA 4B3SJ 2FD2A 4O3PA 1WJ9A 2YQ3A 5CE3A 4JI5F 3TEGA 4UOGA 2P6SA 1VQMS 1X31C 2A41A 1NDKA 4ZPWR 2VOPA 4BCAA 2FVPA 4DPTA 4CBXA 4R0JA 1HWIA 1KQKA 2YV0X 3HM8A 1OKJA 2G8KA 2VG6B 5KG5A 3H7HB 3MPYA 1A5XA 1FWPA 3NH2A 3BS9A 3NGTA 2X51A 1QZ5A 4CJ4A 4DX6A 2P9IA 4DV4K 2ZOGA 4JYAK 2HBQB 2DNOA 3I4PA 4PR6A 3QQCD 3GCWP 4OHZA 5K5MA 2XMMA 1XWLA 1G1XA 4TU8A 1BY9A 5HL7Q 3D6MB 1FNXH 3VALA 1JLEA 3M2VA 4JV2A 2HWHA 2AJ1A 1VIXA 2MJUA 2FLNA 2ZZMA 1IXKA 4WKYA 3E01A 2CQDA 3EM1A 1MMDA 1EP4A 3JYTA 2B43A 4LF9J 2DH8A 4IDKA 1VSKA 1YWXA 1FXRA 4ZVOB 1CQNA 3CDBA 1FNOA 1QQMA 3MCOA 5EHHA 2ZHAA 4OIXA 4DOZA 1JNRB 2UUAJ 3PRBA 1GAOA 4E0DA 4FPIA 1M1KO 3VETA 2AYEA 4DUZJ 5FRNA 4CHZA 3H6EA 2WBNA 3RRGA 2ZD1A 4KGMA 3WEEB 4ED1A 1W26A 3TVYA 1MSWD 4R5PA 3BO2A 2GHVC 4E8UA 3AA2A 3OXGA 1UMJA 3MURP 2QIFA 3M32A 2Z2YB 2FHOB 2BJEA 4WQ4C 1JX4A 4Y3CA 3ILJA 1WNEA 2J4RA 5BN9A 2OKQA 4DR2J 4P73A 2RSQA 2XLIA 4ES1A 2HHHK 1Q81T 3VA3A 4H8KA 4HI1A 1ZXOA 1S9FA 2DCLA 1Q78A 2ZHBA 2P51A 2V8GA 3AVNA 3P5TL 4DTSA 4PKIA 3MN7A 2ZH3A 4PPZA 3ZNUA 3X3UA 1Q4RA 1SJQA 3HI9A 1Y4ZB 4OL8A 2CPFA 2F4VK 3BM7A 1NK6A 2OJ3A 1SIZA 4DV1F 4DSIA 2G8VA 3VV2B 1KVIA 3SUPA 2OELA 4HHJA 4KH4A 2QSWA 3QYYA 5KT5A 1B99A 1PC4A 4CT8A 1TL1B 3CF5Q 5SWMA 2P9KB 2OSRA 4I68A 3D6TB 2YWWA 4KHQA 4HACB 5DDPC 4X62F 3TNVA 2R7QA 1YAGA 4A59A 3HPHA 1HIYA 3BGFA 4M3UA 4ED4A 4CFDA 1I39A 2RQCA 1OY6A 4ICLB 5A8WA 3S3NA 2FXUA 3CJ1A 2JWNA 3M2UB 2ASJA 1NG9A 4OLBA 4YQWA 5I3QA 5JMNA 2FJWA 2LFVA 1YF5L 2VODA 3F44A 2GIQA 4NYFA 2CDQA 1S1UA 3UKUA 4DTXA 4YNQA 3TZXA 3VHQA 2RS8A 3FZHA 2LXFA 4IR1A 2E88A 1WHWA 3R1LA 5KI6A 1LXJA 2P9SA 2DISA 3C14B 3LZIA 1PBAA 1HNZF 3O8WA 4DG1B 3L7PA 1GOCA 3VEOA 3DRRB 2ETJA 1NU0A 5EU7A 3CDAA 2RHSB 4FBUA 3MWBA 2ITGA 2DGUA 1RBOB 2GHWA 1ITGA 3DLBA 2XGPA 2BGGA 2X78A 2G8UA 1Q5VA 2O8DB 3MWPA 2HVDA 3BPDA 4B3TJ 5B8HA 1NK7A 4YOWA 2YNGA 4AXJA 5H9EK 4LRFA 2VFSA 1XMOJ 1HBOB 2DR6A 2LSNA 3CPEA 3PSFA 4CIFA 4FLVA 1EETA 3Q0AA 4BRKA 5DLGA 2WONA 4FLZA 4UY8T 5LMUF 2VOOA 3U3YA 1UAWA 1KVBA 5FRMA 3A1YG 3KHHA 4YMEA 2KKHA 1EKEA 3AVIA 3ZT2A 1T9TA 3R7NB 3RB0A 5DDQC 3MMVA 4WYBA 3DGPA 3P5BP 4UZCA 4LSZB 1LXNA 1W2BR 1CZ9A 3RUBL 2KFZA 4DTNA 3MM7B 5E84A 1CJTB 1ROFA 2EKNA 3R8YA 1GMWA 3JS6A 4JN4A 4KB1A 1K44A 1GTEA 3C15B 2ZOMA 4X65F 2AX1A 1R59O 5BR8K 1UOCA 3OA9A 3CC2N 2FVCA 4IOAL 4CEBA 5IFMA 1RDUA 4U96A 5DM6L 1UZDA 2K1RB 3SDEA 2KXHA 4PQUA 2CXEA 2NYIA 3ZSWA 2FJVA 1SB6A 2HW3A 2WTFA 3AOAA 5L1IA 1U45A 4BC2A 1T6DA 4DV6K 3KHGA 5D78A 5JMVA 2VBXA 2C2NA 3EVOA 1OPIA 2DO4A 4N47A 4NLRA 1JXEA 2VKZG 2V8PA 4DV5K 3ZTPA 3Q86A 2B9WA 1ZH5A 2IM1A 2BZ2A 4CVNE 1VQ4S 2VG6A 3RMAA 1T9UA 3HFVA 1IKYA 2KVQE 2AEFA 4W98A 3HZ6A 3JXOA 4C0BA 1VBYA 4NLOA 4RW4B 2OTLS 1QUPA 2QMWA 5FDLB 1YZ6A 1M5OC 1L3KA 4QJVA 4NLGA 3L4QA 2GA7A 4DQSA 4JS4A 2JJ4D 4KI4A 4QU6A 1S48A 5FLXY 5HQMA 3D1QA 1HWLA 2VG7B 1ZC6A 4FF1A 4CEFA 4LIWA 1NB7A 1RAEB 2WW4A 4IG3B 5IWAJ 1BQXA 5AT1B 3IS9B 4CEQA 4KB7A 5G4DA 1CJKB 2BXJA 3HVTB 1TL3B 4C8LA 3C6TB 3HFKA 1O1WA 3EKUA 4QPTA 1NJYA 1QVGR 2RU9A 5AQVA 3EDQB 5IXUA 5KFXA 2BM0A 3QZ7A 3U6FA 4AILC 5AQIA 5D4OA 2EX3A 1YTYA 1YJVA 2KZZA 3BQ0A 1VSHA 4UTGA 4QIFA 3W5XA 3E3XA 3OFEA 2YKMA 4XH5A 4B9MA 5DETA 1WNSA 2RRNA 1WKJA 2HGLA 4E1NA 2GX9A 1GXLA 4QWCA 1GEHA 3WEEA 3Q2TC 4DKWA 3U27A 3O9UA 4WIIA 1SJ4P 2BQRA 4M5DB 2C3PA 3CDUA 1YBAA 2XB2D 2LMIA 4ID1A 4IJNA 4JI7K 4E7JA 1R7IA 2BA9A 2OPRB 2PI4A 4QWEA 4ZVTB 4EBEA 3LP0B 2IC3A 4LQ3A 2OPSB 3WNHA 2BQ3A 4BDYA 4RUBA 1NKBA 2O8BA 2PIIA 4ZJLA 3IM8A 5LT5A 2ALYB 4CJPA 4TLRA 2HVEA 1O6XA 3CD7A 2D9PA 1XNRJ 2EEYA 4CLYA 3BSOA 2W9AA 3ZTRA 1JNZB 3MM8A 3FBFA 3R5BA 2WHOA 3MCPA 4CNYA 2QV6A 3PNIA 1NGHA 5C24A 5FIIA 3QZ8A 3SSQA 3MPDA 4ECZA 4IH5A 3VGTA 1FTCA 2GJ2A 4IOXA 2VYPA 5KFCA 2HNDA 3T1HK 4NLPA 2FZCB 4HACA 2H4WB 5IT9U 1N8RO 4ILHA 2AZ1A 1UEUA 2V4RA 4C4WA 4URGA 2UXDF 3HHLC 1HNIB 4DWIA 3KIOA 2CG4A 4A57A 5ADXA 5D4PA 3TAFA 5AQLA 1NNEA 1FJGK 4EEYA 2N4CA 4IG0A 3H90A 1N5QA 2W24A 5M1FA 4FVCA 4AQYF 4BG8A 1S12A 4DU3A 3M8SA 1V5IB 1B4SA 2HK2A 2A1SA 3LAMA 4FKXA 3A3NB 4BGAA 4RW9A 4P2FA 3LOUA 1EQ0A 1CVJA 3L09A 5KFAA 4HVZA 3TP2A 2DFHA 2RKIA 2I8EA 2J9DA 2VKRA 1IKWB 3H2UB 2UXCK 2GJFA 1U2FA 3M9OB 4DR3F 5U47A 4JI3K 2QKKA 2MMYA 4ED2A 2V67A 4YY3J 3GV5B 4BC9A 4OKJA 4D3GA 4UOFA 4B3MF 4DB3A 2FYXA 1X8DA 3KUEA 1SKWA 4RNHA 1UFLA 4WFZA 4P2SA 5FPMA 2ZITA 3MTKA 1B0TA 4ZTJA 3TPQA 5C2FA 1PIEA 3P31A 3VQ5A 1YJUA 1R0CB 1RDDA 2XMTA 4X4SA 1Q7YT 1P6TA 4ZTFA 3GFXA 1WC1A 1KC8O 3H4BA 1CULB 3P45B 5HL7L 2IYIA 4HUEA 1S10A 3C6UA 2DD8S 4ZVGA 2XBPA 3QIPB 2V69A 4J9OA 4LF8F 1QAXA 3V6JA 4HEA9 2PYLA 4ZJQA 5AJ3F 3O9TA 3Q7BA 3B8HA 2OEJA 4QBUA 4CEOA 3EEQA 3ET6A 2QKBA 2BM1A 2NS1B 3LO3A 2B4PA 3D2FA 4DF8A 1FFWB 3VEZA 3D3BJ 3WIVA 2IPOB 1S77D 3MD1A 2H9ZA 1RBLA 4ECWA 1U49A 3M5RA 2WVCA 2K1RA 2YKNB 4OJHA 3S8SA 5HATA 1VK0A 2DVIA 2HPUA 5LSOA 2UV8G 1VYAA 5DJBA 2MKIA 1KQSR 3N4PA 2IM3A 3OJSA 2N7CA 1S3XA 1U1LA 2H5JB 5IOLA 1U2VB 2D0AA 1Q1KA 1E6YA 2B9YA 1JL1A 4DBQA 2ACYA 1SKUB 1K8AO 3QRQA 5BREA 3KDOA 2XO6A 2CQ1A 3MEDA 5AQUA 4AHTA 4DR4J 1DURA 5AQOA 2DHGA 2HG4A 2FBVA 3QT7A 3D1OA 2OUGA 4CO5A 4XAKA 1S6PA 4DTUA 3D6RA 3WHIA 4KHWA 1TAUA 3D9BA 1RBTA 2O01C 1SI9A 2HF4A 1QY7A 3DI6B 3SMPA 2VFRA 4GC6A 3BSNA 3QFHA 3CF5L 5HQ8A 5AE3A 2E1ZA 3UCGA 2IVFB 3CJKA 2B4JA 3M8QA 3P5JA 3A8EA 4LBHA 3QBWA 4DQPA 3IS9A 2LECA 3VA0A 3SQ1A 1ITPA 2PA8D 1H1VA 1CJKA 2G8FA 3DM2A 2O8CA 1DQ9A 2AEJA 4JUZA 3VQDA 2JLFA 3T1YF 1GNKA 4IXCA 4NA1A 1VBZA 1TUYA 5K9FA 1VK3A 3IWXA 4GVBA 3VTIA 2D1KA 2DHSA 4GKKF 4F0MA 4KHPK 1S9EB 4WE1B 1UPMB 3C66A 1GLAG 3OTEA 4NXNK 4M5MA 5BPLA 1FDDA 2E8AA 3DLJA 3M1FA 4HYKA 3MEKA 1JJ2M 2BJ9A 3ENVA 3MM6A 2HNZB 2CQ3A 5H9FK 4LREA 4B3SK 4M41A 3ELHA 4PKGA 1U09A 4OFZA 4V1Ak 4FOEA 3SUNA 4CLTA 2OPRA 3TUJC 1FXXA 2OPSA 1SAZA 1CBKA 3EGWB 4NLXA 3NS6A 4L3KA 3QT6A 3NE6A 4FZZA 5BPNA 2CZ4A 2BJ1A 2JFDA 1VQ5S 3R1XA 2VBWA 2V7YA 1FRMA 4OHVA 3JQMA 2E9ZA 3HYFA 2CZ9A 3K9KA 2KRBA 4EAHD 5KFNA 4Y2CA 1GH8A 4B08A 2Y0BB 3VVUA 2BX6A 3KJVA 3UDEA 1WSHA 3S41A 5F0WA 3VAFA 4C8ZA 3KWGA 4B17A 2Q2RA 4GV3A 2C2KB 5KG2A 2LQ9A 1B64A 3OYDA 4B9QA 3VQ8A 3POTB 2H1YA 3ZZOA 3M1VB 2BH1A 3CM5A 4MJKA 3SCLE 3SCKE 3DLEB 3MEGA 3UFCX 4LF9K 3MR5A 2J76E 1NNDA 4H4MB 2F8EX 1RTDB 3FQKA 1LAVA 4DSJA 3W64A 1U1KA 4FYDA 3T5HA 5AXNA 4ZP7A 1BIZA 3MPWA 1N6QA 1HD1A 3HJVA 4CGDA 2UUAK 3U1MA 3HBTA 4OZLA 4DUZK 1D8ZA 3D3CJ 4RPFA 3PTWA 3OW2R 4I7FA 1N32F 2F3JA 4ED3A 3LPUA 3SQOP 1UVKA 3J81U 3VWSA 1VSFA 1CXUA 4NPOA 4HI2A 4UZBA 1X4EA 3SFGA 4DR2K 3I82A 1S6OA 2AF6A 8ATCB 5C2GA 4O3OA 2V4JA 4CECA 3DXMB 5BN8A 4R8UA 2A6MA 4KFBA 3PIPQ 5A6PA 2EWHA 2ZBPA 3CJ2A 3MDFA 2BKOA 3V1RA 2EC0A 1KN6A 3I96A 4M3TA 2FZKB 1B9DA 2A6AA 3NEKA 4LRAA 4W5QA 3NL0A 1UA0A 1ZM2A 1M1HA 3Q8SB 3D7EO 2VC1A 4CZKA 4JBCA 2FJXA 1UETA 3BSAA 2I6WA 4JI0J 3NOCA 4PHTX 4RU2A 3VCDA 2ZUGA 4ZPDA 3W5ZA 1WDDA 4RUCA 4DR5J 1TV6B 2QGFB 5FD1A 2VWJA 4I6WA 4ZS6A 5K14B 4C48A 4Q5VA 3E9PA 3AGKA 2M7SA 2BW7A 4IZ9A 3OYMA 3OYIA 4UUXA 3HHEA 4M5JA 4O8KA 2HQ3A 2MZRA 1SJ1A 2DNHA 4FK0A 2IAJB 3ETMA 1Q86O 2E6MA 1IBMJ 3MAQA 4GO5X 4DUYJ 2O8EB 1NLVA 4FF4A 1QAIA 2YKNA 4Z4FA 1HKBA 3VGLA 4I69A 2D4WA 1TL4A 3AOCA 2YH1A 2YY3A 4HH0A 3V9ZA 4ID5B 2YKAA 1F2GA 4JKBA 3ZYYX 4I6MA 1K8AT 1VLYA 2O66A 2NZCA 1HWJA 3PR4A 1K8KA 4F3QA 2QLXA 1TZ0A 3E9OA 1UEVA 3DU6A 4P6QA 3FBCA 3N79A 2DGOA 3D6FB 4ECQA 2I5JB 1HARA 4RL1A 2R8IA 1J27A 5DDOC 2GQCA 5F41A 3C16A 4BR4A 4B3TK 2DY4A 2G4BA 3CDEA 4XPCA 5CXTA 1QSSA 1XMOK 2A5XA 1Y3JA 3CJSA 4A8YA 4JV5F 3BGLA 3G86A 2L9NA 4CFBA 3K5LA 2UUWA 4DX7A 2QM1A 5CA5A 1F5CA 3SQ0A 4FWQA 3RZAA 5SZTA 5EDWA 3TZYA 3P1GA 5M2PA 4BRLA 1U02A 2QYCA 1RU2A 3VQ7A 3WUHA 1RWOB 3E9LA 1C0UB 2RDJA 1SH3A 2AW0A 4B9VA 2PAVA 3NCIA 3FEZA 1J9AA 3TSUA 1GMUA 4FL9A 2HHPA 2NXEA 4ES2A 1JWWA 2VHGA 2QLWA 1BWVA 3H42A 3A4TA 2HHTA 3NWGA 4P71A 1S9EA 3OL6A 3R6LB 2KVIA 4WK3A 4WU3A 2JFKA 1IJEB 4DF4A 3TZWA 2GFFA 3OYNA 4X64F 2Z1HA 2OSQA 1VRUB 2AU0A 4R25A 2E1RA 1TKZB 1TFWA 1T9WA 3TR8A 1BL3A 2D0BA 4BG9A 4Z37A 5ADZA 3KK1B 4QIEA 1OVQA 1U47A 4ZPBA 2JGUA 1K9MT 1UA1A 4Y34A 4I4BA 2PE8A 1S99A 3TWZA 3TU5A 2RQKA 1ZA1B 2HHUA 3A3OB 5HANA 2D3UA 5E5NA 4B8AB 3UKRA 2XY8A 4G1QA 3R2DJ 1FXDA 1LW0B 4FK2A 3IP0A 3O1BA 5ETMA 3VEVA 2ATQA 1QHAA 3ZEUB 2FDNA 1FNMA 4IFYA 2HNYB 3AO5A 4ELVA 4F4KA 3N6NA 3L7UA 2Y1IA 2AP6A 5KOXA 5KQ8A 1HW8A 5B0BA 4WFNQ 5BRDA 3SLCA 2AGOA 4OGCA 3K5PA 2ZM6F 1BG3A 4B9LA 1I3AA 3TA2A 2RF2B 4BRFA 2QN6B 1BHLA 3POTA 5IWAK 4DR7F 4Q7AA 4WPAA 3AA5X 3LTOA 1YIJN 1SH2A 3W61A 3O5BA 1SUQB 3DLEA 1WOPA 5I3UB 1HNXJ 1MU2A 4PPDA 4JI6F 4IBNA 4MO4A 4OZ5A 3TTFA 2IVNA 1RI7A 4YB7A 2DXDA 2DH9A 3LP2B 2XCAA 3VEWA 1RTDA 3IUCA 2VDHA 2NRXA 2XEXA 4JI5J 4C98A 4LFBJ 3NGRA 3UNGC 3BSCA 1ZM3A 2GGPB 2HFSA 2MGZB 2OGUA 3OL7A 3JSYA 2CQ0A 5KFOA 4GVLA 2HFVA 1TFYA 2I7PA 4RWXA 5A2QU 2QI2A 4ZHRA 4J2BA 1RQ0A 5LJ5Y 3QGHA 2GUPA 1VMBA 1LFWA 1VHIA 2KRRA 1ASUA 1RT6A 4B9NA 1VQ9S 3LUYA 1IQZA 2VBYA 1F3VA 3CSKA 3QO9A 3RR7A 1JIHA 1GLJO 3QATA 2YNHA 4TN2A 2XY6A 3W60A 2ZJQQ 2XO7A 3W5YA 5IZHA 4RNNA 3OVAA 3HO1A 3I32A 4OMFG 5IT9Y 4X4UA 4JI4J 1BWFO 5GAGI 4CGGA 4OPHA 2VGNA 3ZZTA 1GFWB 1O8BA 3LA0A 1RBUA 2HHVA 1XNRK 2HWTA 4DSKA 3G4SS 1BIUA 3CJ9A 5EOYA 3BF1A 2ROGA 1OH5A 4P7TA 2YX6A 4XIUA 4U6PA 1NXIA 4LF5F 5B0EA 1H0HB 3OYAA 1XIQA 4MYTA 3DU5A 1WF0A 4JRQA 4WQ5A 1QQOA 5KFLA 4DR1F 4F0KA 3LDSA 5K14A 4IOCQ 5D0GA 1N48A 2GVZA 4YFUA 3WNEA 4K4TA 1LWFA 4ANEA 4Z0UA 2E2NA 2ZBRA 1D5AA 3A5MC 4ECXA 1NGFA 3VQCA 1NAQA 3DHWC 2OIHA 3G2XA 3CB4A 2XS7A 3FFKB 1U1PA 4J9NA 4DCPB 1KQGB 4ID5A 1Q53A 4OYOA 4DZ6A 2UU9F 5BR9A 4ZOSA 4CZCA 3LPYA 2IS3A 3DLKA 4FOIA 2DITA 5AQKA 4WXOA 4L8RB 5GAHI 4CH0S 1WSVA 2D5RA 2G0IA 1WLJA 3C0BA 4DTJA 4DV1J 2I5JA 2CKWA 2DNNA 4YY3K 2DFFA 2K7KA 2CPYA 4CF8A 3WXIA 2N3LA 7FDRA 1YBUA 3LAKA 1KONA 5HOOA 5KFVA 3QWPA 1P8ZA 4PXEA 4BDPA 4CJKA 2KG0A 4CI0B 2QLFB 1R8PA 3GQCA 1HNVA 1CS4A 3M8PB 4X62J 4Y28C 3G82B 3RRKA 4PWWA 4I9LA 2HHQA 2CPEA 2WSFC 1NJIO 3F5TA 1BQMB 4PCQA 2B9XA 1AUSL 3K9JA 3BGRA 1XR5A 4JD2A 2ZE2B 4FJXA 2ZZTA 1YJWS 2IJFA 2J8AA 3O9RA 1U48A 3CC7N 1QTNB 4P7VA 3ILOA 1XC9A 2ASPA 3OS0A 4IYQA 2CDRB 4JKDA 4YR2A 4K25A 4EI2A 5H1SV 3NHGA 3MTJA 3HVRA 2ZEJA 5HVFA 1V3SA 2L9DA 2ZH4A 1IBLF 5AQMA 2C2MB 4OJ1A 3AAQA 1HNZJ 1NDLA 3FZBA 4FM1A 3EZ5A 4FM2A 4H0VB 5GIPA 4EYIB 1WC5A 1C6VA 3A0IX 2AQ4A 3A12A 4WIQA 1BMQB 1VRUA 2GBZA 1D3WA 3KK7A 3I9V9 1HKAA 5D77A 2JX2A 3PW0A 1Q82O 4FYVB 3LALA 3C6AA 5AQYA 4R0EA 3KHRA 2PC6A 4YDDB 1JL2A 2ZZNA 5C12A 2AHOB 3J7AN 3GBTA 3Q22A 1NKEA 1TP7A 2CPDA 1P8GA 4K2JA 1H7XA 2RJZA 1F5BA 1SC4B 5CYMA 4CE9A 2QL5B 3H2VE 5LMUJ 2V63A 5A8KA 3KNAA 2B7CB 3PIPL 5IT4A 2WVDA 4DR4K 3FQLA 5TKWA 3OR1A 4ECVA 4KBIA 2P9UB 1X4BA 4CZJA 5KG0A 4GVEA 1JJ4A 3ZEUA 3OYFA 3CC4N 5L1LA 1NB2A 2PFFB 2FHKA 3I0RA 3RVCA 4DL2A 3OUYB 5B08A 4H5TA 4H4OA 1SQKA 3EZOA 4AXIA 2GUIA 4ZP6A 1SL2A 4LSNB 4I6AA 4NXMF 2PEBA 4NE9C 2NXCA 2Y1LB 4X65J 4PUOA 3NAEA 1B0PA 4LF4F 2N3OA 1U0HB 2CGJA 1AZSB 1NH7A 4Y1CA 1SUQA 3J7YI 2VIHA 5C25B 1DKGD 2QE5A 3ZTSA 1P9QC 3PYEA 3IN5A 5AQXA 2V0NA 4FSVA 1U1QA 4AM7A 1F3FA 5AQZA 1VQPS 2K3IA 3QMLA 1Y00A 3FK4A 3UCZP 4G9ZA 1KAYA 2YWKA 4OYMA 4BGBA 4PKHA 2C3MA 5BJRA 1I6JA 1TKXA 1X9JA 1QAJA 2KT3A 3V4MA 2NXUA 4OI1A 3US5A 3KLVA 1Y5LB 2HSEB 4CM0A 5AQHA 1TVRB 5DG8A 3QMQA 5JVGQ 4FWPA 1SIWB 1TAQA 2XNRA 3N4QA 1T9YA 3CCLN 1VQ6S 3F0NA 1FKOB 1VBKA 4RZRA 1HA1A 5CZ1A 2NPIA 3WQUA 5LXYA 3B54A 4LBPA 3EXYA 1RT3A 2WUSA 5HI7A 3NGUA 1DQAA 1P1TA 3EWGA 1GK8A 1JLFB 4LUBA 4TY8B 3ZSXA 5AXLA 2PFUA 1SV5B 1S6QB 3MXHP 2UP1A 2BMBA 4H0OA 3SBGA 2DXEA 1VQLN 1N34F 3AO2A 3I5BA 4KH6A 2FGOA 2NXJA 3AD7C 2YNFA 3HP9A 4RW6B 2D9OA 3Q8VA 5GMEA 2GQQA 4LRCA 4DV2F 3KUHA 4JOUA 3KG4A 3MF5A 2OPPB 1YI2N 3CJAA 1RAOA 4RO0A 4IEEA 1HHQA 3J81Y 2DPNA 1X4DA 3G8QA 1PKUA 4DU7A 2NRVA 4FO0A 2E5LF 3EX7B 1U1RA 5F8NA 4WU2A 4RW8B 3NLCA 3MHYA 3B6BA 2X3GA 4ANDA 1NMEB 3NGKA 3TW0A 5LMNF 4CIEA 1ZAXA 4HHTA 3O8MA 4RWWA 3MM9B 2E9RX 4KTZA 2XYGB 2XMVA 4LRBA 3L2QA 2JL9A 1YITS 1F9HA 1KP6A 3AVAA 3CW2C 5C0YA 4U8VA 4ILLA 4AUKA 2HZAA 2V52B 1UAXA 1J6ZA 3ID6A 4F25A 2R8JA 4CF1A 3HSCA 1MMLA 2B5JB 2VFTA 1VOMA 2LEAA 4X66F 2CPZA 4CZEA 2LDIA 3AVGA 4E98A 1T03B 2YNIB 2P9LB 4KT0C 1UVLA 1DLOB 2CWKA 4CI6A 2BJDA 4AE5A 4J2AA 1RT7B 2UXDJ 3U9ZA 2I9SA 2Z56B 3QETA 2DTUA 3D45A 1OQ6A 3CCMS 3BR8A 4WFNL 5K8OA 3OFGA 3PJWA 5CYQB 2QTDA 1MLAA 4FNHA 4UQGA 3R5GA 3KMQA <