1S1UA

Crystal structure of l100i mutant hiv-1 reverse transcriptase in complex with nevirapine
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
536
structure length
524
Chain Sequence
b'PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGIKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase
publication title Crystal structures of HIV-1 reverse transcriptases mutated at codons 100, 106 and 108 and mechanisms of resistance to non-nucleoside inhibitors
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 140
structure length 524
sequence length 536
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1s1uA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s1uA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s1uA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s1uA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1s1uA05
3RBEA 4H4MA 4FJKA 3LWLA 1SL0A 2GC8A 1RT4A 3L8BA 4B3OB 3VQSA 3QO9B 1ASVA 1NNDA 3T3FA 3PZPA 3AO2A 2EHGA 1LWFB 1X9MA 3H08A 4EZ6A 2IAJA 3L2WA 4J9MA 3VQ6A 3GV8B 2QV6A 1WSGA 2X78A 2IM1A 2AJQA 2XO7A 3AVNA 3BREA 4EYIB 1BIUA 5I42B 5KRSA 3V9XA 4BACA 1JLGA 3OJSA 1RT7A 3MXMA 4WFZA 3LWMA 3ITHA 1EETB 5KFXA 3VQEA 2EX3A 1WAFA 4KAIA 4OKEA 4OLBA 1VSJA 3KKSA 4M3YA 2IM2A 2BRLA 3L3UA 4ZTFA 1IKYB 5EWGA 3RBDA 1IKXB 3QEPA 4CEQA 2G8VA 5C24A 4ECQA 3T5HA 1T05A 2D3ZA 2JC0A 1FK9A 1LW0A 1BCMA 1NK4A 2P51A 4AHTA 1JLBB 4CHZA 4B8AB 4RW8B 2Z1HA 2XWYA 1T7PA 2B5JA 4J2BA 5DG7A 4YNQA 1CZ9A 5F8IA 2A1RA 3H2LA 4YQWA 4DSFA 4I2PA 3AA5X 1UAXA 2HHSA 1RA7A 4MKAA 2HMIA 3N6MA 4HTUA 3V6JA 5KT6A 3MF5A 3GIMA 1L3TA 2G8KA 1TKXB 4EP5A 1QE1A 4F4KA 2O4IA 3NH2A 3DMJA 1S0NA 3LP2B 5L1JA 3UQSA 4E3SA 3RMBA 4IOBA 3H4DA 2OPSB 4TN2A 1KSPA 4ECRA 5J2MB 3HPOA 1RNHA 3BGRA 1S9EA 2DPIA 1WLJA 2JLEA 3QEVA 1NJZA 2UUWA 2DTUA 4O5BA 3KD5E 2C2RA 4CJWA 1FKOA 4W5OA 3FQKA 4CIEA 5KTQA 4TQRA 3LANA 4RUAA 4CFDA 2VG5A 3CJ5A 2WCXA 1HYVA 3DOLB 4DF8A 1EX4A 1RTHB 4RW9B 4MK8A 2WOMA 1XR5A 2KW4A 3NFAA 1B92A 3IRXB 4E1NA 4ZVGA 4NLDA 5EUHA 2AGPA 2HW3A 1JLCA 2VG6B 5CZ1A 1K1SA 2GIRA 3UDLA 3MAQA 1C0UB 2R2UA 3HPGA 1TL3A 4R5PA 2HNZB 3DOKB 5J2PA 2V0NA 4FJGA 2E6MA 3OVNA 3RR7A 3AO5A 5C25A 3V6DB 2DFFA 4HVJA 2IA6A 4CF0A 2VA2A 1YVUA 5FROA 3ZT4A 3LP1A 3ASMA 5J1EB 1W9HA 1HPZB 2ZD1A 1NK7A 3VQAA 2W8LA 2AGQA 2QK9A 1IH7A 3TI0A 2NUBA 3DLKB 4J9PA 3WNFA 3I0SA 4O4GA 4M94A 3KMSA 4EBCA 1I3AA 1S1VB 1NK5A 1NOZA 3FFIB 1TKDA 3GYNA 3KK3A 3O3HA 3NDKA 3CDEA 5KFDA 1Z25A 4GW6A 3PO5A 2I1RA 4OVLA 3S3NA 3ZT0A 1N5YA 1SV5B 4GMJB 4ZMMA 3DRSB 2B43A 5F8GA 5J2NB 3OL8A 3QEXA 3Q8SB 1OS5A 3HP6A 2FBXA 1IKVB 3L3VA 4KB1A 4NLYA 5KFVA 2QKKA 1YTUA 2HVHA 4NLXA 3NBPA 4NLWA 2YNIB 4Q43A 3KIOA 1ZBUA 2D0AA 3K2PA 3MFIA 3WNHA 4OPKA 4ZVHA 3V4IA 4RW4B 4NZ0A 2BQRA 4LH4A 5HRRA 4CEEA 3PW2A 3D0PA 1C1CB 5KG1A 3O3FA 3NMAA 4LSLB 2AX1A 3KHHA 1KFDA 4Q44A 1RBSA 4B3OA 1RT2B 3AVKA 1HARA 1IKWA 3L2UA 4KTZA 5CY4A 3SV4A 5SWMA 4ELTA 2LSNA 3T19A 2FBYA 4TSXA 1CSJA 5JXSA 4C8MA 1UA0A 1XC9A 4LSNB 4Z4CA 3B6PA 4CJ5A 3G6YA 2ITGA 1B9FA 4W5TA 3NKYA 3MFHA 2ILYA 1RBVA 3V81B 3QEWA 2XCPA 5L1IA 4EZ9A 3HO1A 3AO3A 4E7JA 5I42A 2RF2A 2WONB 1MU2B 5KG3A 3PX6A 3MXIA 2RKIA 3DM2B 3I5CA 1VSHA 2AX0A 4DQQA 1HNVB 3DRRB 2E9TA 4LD0A 4Z4HA 4DS4A 1IKXA 4CJRA 3AVLA 2Q3SA 3SQ1A 5CYQB 4QWBA 4J9SA 2IDOA 2HHXA 3QZ7A 4FLZA 3BSCA 4RW8A 1T3NA 3D45A 5F8NA 2FVPA 3KLHB 4ZPCA 4JRPA 1O1WA 1ZYQA 1S1UB 2RN2A 4F50A 1WNSA 2IM0A 3OYBA 3HKWA 1TKXA 4ZPAA 3KHRA 4ZP7A 1RBUA 3RRGA 4LQ3A 1L3VA 5HLFB 3LP2A 4I9LA 1Q9XA 4FZZA 2E6LA 1GOCA 1JL1A 4FLVA 1LWCB 3QIPB 1S6PB 4DQSA 3DRPB 4FYDA 2FJXA 3HM9A 4FXDA 4FW2A 3CFPA 1HNIA 3M8SA 3VA3A 3E01B 1NHUA 4KAZA 1NJXA 2EC0A 1EKEA 5KG6A 1YT3A 3NHGA 4W5NA 4E89A 1C1BB 3OYIA 2V4RA 2HHTA 4NYFA 2YNHB 3DOLA 2R2SA 4FJLA 3Q8RB 3QIOA 3CJ4A 4RW9A 5HRNA 3H59A 4I7FB 1RYRA 4IR1A 3T5LA 4CEAA 3OYFA 4B9MA 3IRXA 4KO0A 3PJXA 3NAHA 1U47A 4OGCA 3AA3A 3HXMA 2KZMA 1D0EA 1NKBA 2HNDA 5CZ2A 3SUNA 3RAXA 4TY8B 3PX0A 3KMQA 5KT5A 3K58A 2HNZA 3UR0A 2AGOA 3DOKA 4KFBB 1TK5A 4Q0BB 4ED3A 1FKPB 3V6DA 3ZSVA 4CJTA 4CHOA 3CFOA 4M3ZA 2WTFA 4FM2A 4DQPA 3VQ4A 1HPZA 5KFBA 1JXEA 4I2QA 4ID5A 5KG5A 2F96A 1K1QA 1HQEA 4TXSA 2VG7B 3QIDA 2XY5A 3NL0A 1S9GB 4EP4A 4U7CA 2HHWA 1C6VA 3FSIA 4O3SA 5KFOA 3PR4A 3M9NB 4RNOA 3FFIA 3PW7A 2Y1IA 5F8HA 1VSLA 3PHEA 3KLFB 2CJQA 3SZ2A 4KRFA 5JUMA 3K59A 4ZPBA 3U3GA 3HVTB 1TVRB 3H98A 5KT4A 3PJWA 2YV0X 3AVFA 1SUQB 2ATQA 3AA2A 4FM1A 5T14A 1S97A 2YNGB 2YHBA 5J2NA 5K14B 1IKVA 4W5RA 5J2QB 5F9LA 2OPPB 3OYKA 3OYLA 1VSFA 1TV6B 2J6TA 4RW6B 5F8JA 1JX4A 1QS4A 4CEBA 1TGOA 3H5UA 3V1QA 4IH6A 1JLAA 4CGGA 3AA4A 4RW4A 3SYZA 4QWEA 5SZTA 4IFVB 3KJVB 3RB3A 5DG9A 4ZP6A 5FDLA 3M9MB 4DTNA 4DU3A 1S48A 4F4ZA 2HWHA 1TL1A 4ECVA 1C1CA 4QAGA 3KOAA 3T1AA 4LSLA 3PY8A 1JLQA 2BE2A 3PO4A 1JKHB 2G8UA 1JLEA 2ALZA 4BE1A 4FZYA 1XR7A 3SUPA 4ZTJA 2HNYA 2ZE2A 3AVGA 4DFMA 4NLPA 4J9OA 4CCHA 3CJ2A 3H5YA 3P1GA 3KLVA 4ECZA 3K57A 2F8EX 1TQLA 3KLIB 1N48A 4FJNA 1SL1A 1T94A 4WXOA 3V81A 4RG8A 1RTJA 3LDSA 2OPRA 1BQMB 5KFCA 4BDYA 4TQSA 2WONA 1HRHA 2FLPA 4NLOA 3RB6A 1S6QB 4EBEA 4PWDB 3QGIA 5KFYA 1Z26A 1QSYA 5KFIA 3RMDA 3OHBA 2XRIA 4M3UA 3MECB 4B08A 5CYQA 3C94A 3SPYA 3DI6B 3HP9A 4FJ5A 4URQU 1RT6B 5DGBA 1D1UA 4ED1A 2I5JB 3BQ2A 4WE1A 1DTQB 3KLHA 5KG7A 3OLBA 4AHVA 4OPJA 3VQPA 3PW4A 4UQGA 1S1UA 1T8EA 4J9QA 4Z4IA 3G6XA 4IH5A 4IG3B 4JS4A 3D5MA 4ED6A 1HYSB 3CM6A 1R0AB 5KFRA 2JEIA 3ISNC 4N47A 3T5KA 3IG1A 3BDPA 5HLFA 2R8JA 1UOCA 4ZHRB 1BI4A 1L3SA 1Z4UA 4RNMA 4IG0B 1SKSA 1S1TA 1S1XA 4DEZA 4E7KA 3DRPA 3SUQA 3KKRA 1NOYA 5DG8A 2WK4A 1VSKA 3ZT1A 3VQCA 3VN5A 4FJMA 4OKKA 4N56A 3EPIA 3VQ8A 2W9BA 1RT5B 4FVMA 4DTMA 3MXJA 5KG4A 4FS1A 4IBNA 4FJXA 1VRUB 3OYCA 1YVFA 1VSEA 2G8FA 3T5JA 4FK0A 4RNNA 2R8HA 3V9SA 4HHTA 4CHQA 5KI6A 4URGA 5KFNA 2DFHA 4LQ9A 3V9ZA 4FW1A 3C95A 1N4LA 1JIHA 4KHSA 2XY7A 4NYZA 2O5DA 5DLFA 2YKNB 3HT3A 3BR9A 1QSSA 3DLEB 2OZMA 3QYYA 4AHRA 4KFBA 3SUOA 4MIBA 4WFXA 2DY4A 4Y1CA 1NJYA 2D7SA 3K5NA 5D3GB 5HP1B 4QWDA 4KHWA 4Z4GA 1WAJA 4HKQA 1Q9YA 4Y1DA 4DL2A 2W9CB 4RU9A 2FJWA 1EP4B 5HROA 3IGNA 3S3OA 3FQLA 3HVAA 2XHBA 4IDKB 4M3XA 3PUFA 3ZSWA 4ELUA 4M42A 4ICLA 2FLNA 2VG7A 1FXXA 1IG9A 3BQ0A 4MK9A 5EU7A 4O4RA 3PVXA 3OL6A 3PX4A 3LP0A 2QE5A 3KLFA 1WSIA 3RAQA 2CKWA 5DQHA 2BANA 1CXQA 2PYJA 5KFZA 5KFQA 1U45A 4IQXA 3HVTA 5F9NA 1CXUA 3KLEB 1TKTB 4CGJA 2C22A 2QXFA 5K14A 4B9LA 1J5OB 3HK2A 2KFNA 1QUVA 3CM5A 3SFGA 3F73A 4ED7A 4DMNA 2JC1A 2HHVA 3ZSZA 3ZCMA 5KT7A 1TV6A 1ASUA 2G8IA 4RW6A 3KK2A 1TAQA 5EWEA 4K4SA 2YNFB 4KV8B 3AVJA 5L1LA 4CERA 1KLNA 2FBVA 4K4TA 4KB0A 4KI4A 3KJVA 2XY6A 3KHLA 3PV8A 3NCIA 4DFJA 2IM3A 1LWEB 3GILA 2BRKA 2DPJA 3AVIA 1GOBA 4CGFA 4M3RA 1RTDB 1TKZB 1SKRA 1X9WA 3EZ5A 4EYHB 4DSKA 4FBUA 3KLGA 2D3UA 1JLFB 4RZRA 4CJKA 4N5SA 3SQ0A 4JRQA 4PUOA 4NCBA 4E7IA 3OS0A 3JSMB 1HQUB 1DLOB 3TAEA 3TAMB 3GIKA 1RYSA 3NGYA 2IC3B 3RRHA 3VQ5A 2FVCA 4CK3A 3QERA 3KLIA 2R2TA 2IJFA 2OPQA 2UVVA 3ICLA 5C42B 2V4QA 4CJ4A 3RMAA 2FC0A 4FBTA 1J9AA 1S4FA 1BQMA 3UPFA 5KFTA 3OL7A 3SQ2A 4AHCA 4IRDA 1ZBLA 1S6QA 4YR0A 1QAIA 4F4WA 3QO9A 3V9UA 4J2AA 2HVIA 3K5LA 2ETJA 4K4WA 3LAMA 4ZP9A 1NJWA 1C0TB 1RT1B 4R8UB 1KVAA 3JYTB 3HPHA 1LWFA 2PZSA 4NCGB 3OSNA 2F8TA 3IAYA 1BQNB 3ZT3A 2B6AB 4G3IA 1ZTWA 4QWCA 4K8ZA 5I3UB 4ECWA 3DI6A 4WXWA 3SJJA 1YTAA 4DTUA 4MQ3A 1Y97A 4NLUA 4DTJA 1I39A 4C8KA 2OZSA 1RT6A 2Z1JA 4MFBB 4OLAA 2I5JA 1S1WB 4NCAA 4G1QB 3I5BA 4F3OA 1NHVA 3S3MA 1C2PA 1N6QB 5KT3A 1EETA 1KLMB 1UWBB 4IG3A 4KSEB 4CESA 4FJ7A 4H8KA 5KFLA 5L1KA 1R0AA 4CIGA 2FVSA 4E1MA 1IKYA 2RDJA 4KB7A 1U4BA 5KFAA 4IG0A 1HYZA 4KBIA 4DFKA 1JLBA 3BSAA 3H40A 1QTMA 4J2EA 4CEDA 3KHGA 4WZMA 1SH2A 4CFCA 2J6UA 3MTKA 2OH2A 2OA8A 4XIUA 4HUGA 4DLEA 1VRUA 4XPCA 2AQ4A 3ALYA 4E0DA 4OKJA 4F8RA 3O3GA 4HCBA 1JLGB 1RT7B 2XY8A 5HBMB 4URSA 3E51A 3RTVA 2E9RX 2OPSA 4PY5A 4KPYA 2KQ2A 5J2MA 3DLHA 3M9OB 2IGIA 1J54A 4CF9A 4ED0A 3DLEA 4JV0A 3G10A 3ZSQA 3CFRA 2B5JB 4KHNA 1S10A 5EDWA 4K8XA 2FVRA 4DQRA 4I2PB 4OL8A 1RTHA 1A5VA 1ITGA 1W25A 2HMIB 4F3TA 5KG0A 4XO0A 2BR0A 1EP4A 3VQ9A 4KKOB 3MEEB 5KFPA 4DWIA 3LZIA 4DL6A 3OYNA 2VG6A 4FM0A 3DMJB 4BDZA 1LAVA 1C0UA 4QW9A 2FJVA 2BDPA 4GC6A 1L5UA 1D8YA 3CIZA 4ECYA 1BCOA 3TARA 3LALA 2C2EA 1REVB 3NF9A 3M8PB 3RMCA 3BGRB 2ZKUA 4CF1A 4QW8A 1KVBA 1S49A 4B9UA 2R8IA 3KLEA 2AU0A 4K4VA 3KNAA 5J1EA 4EO6A 1FKOB 2A1SA 4HYKA 3SCXA 1ZBFA 3DLKA 1S0MA 1RBRA 4K4YA 1S1VA 2WOMB 4Z4EA 4Y2AA 2YNFA 5KFEA 1TAUA 2IJNA 5T7BA 4DL3A 3NF6A 4O44B 2Z1IA 2ATLA 2JEGA 1JLCB 2XI3A 1QAJA 3OS2A 3V6HA 4CJPA 1S0OA 2BQUA 3NGIA 2VWJA 1LWEA 5KFMA 1SV5A 4R5PB 3DRSA 3G6VA 4DSIA 3OYMA 5J2PB 4F2RA 5KRTA 1TKZA 4FS2A 4I9QA 1JLFA 3CDWA 3VA0A 1RDBA 2YNIA 1C0MA 3OYGA 4ED2A 3JSMA 2P5OA 4M41A 2R2RA 3V1OA 4B9TA 2KFZA 4QWAA 4CJFA 1SH0A 2R8GA 1S5JA 2ASDA 3TABA 3NGDA 3NF7A 3QESA 1RTIB 1XHXA 3AVMA 3ZT2A 4WFYA 4BE0A 4H4OB 1RT2A 1ZBHA 3KK3B 1C0TA 4R8UA 3JYTA 1U09A 4W5QA 1BQNA 4CGIA 4LSNA 4HUEA 2B6AA 1N5YB 3WNEA 4FJIA 3QEIA 1X9SA 4YR3A 2W8KA 2X6NA 3SI6A 1BGXT 4EO8A 4KHMA 3DLRA 3FRZA 3AO4A 2FBTA 2AWZA 4ZP8A 1HMVB 1D5AA 3H5SA 4PQUB 1LW2B 4G1QA 4O0JA 1MU2A 1GX6A 4CHYA 3V4IB 3DM2A 4DL7A 1U49A 1RBTA 3EZUA 3ZSRA 4FCYA 1HNVA 1TP7A 3DRRA 2ASJA 3IGVA 3Q8PB 4DG1B 4ECXA 3NAIA 4DTRA 5E41A 4F2SA 4YFUA 2FVQA 3VQDA 1I6JA 3TQ1A 4CECA 4BDPA 4Y34A 1J53A 5DQGA 1IKWB 2JEFA 3V9WA 3D28A 3SFUA 4CEFA 4IR9A 4XPEA 4DTSA 3OY9A 2WB4A 1NK9A 1NKCA 3C6TB 4JV2A 4B9VA 4Y2CA 3ULDA 5KGXA 2ILZA 2J6SA 4FLWA 3HSTB 1TK8A 4TYBA 4KTWA 3OJUA 2D5RA 4C8LA 1LWCA 2RF2B 3QIPA 1S6PA 3QLHB 5F8LA 4J9LA 2GUIA 5HBMA 4IRKA 3V6KA 3P5JA 3CWJA 2RKIB 2UVWA 2B4JA 5KFSA 1U04A 3HVWA 3E01A 5JS2A 4BWMA 4LY7A 1XWLA 4DL5A 1JL2A 5KT2A 4JUZA 3OS1A 5KFKA 3PR5B 2X6SA 1ZETA 4K4UA 1C1BA 4CFBA 2YNHA 3O4QA 4K4ZA 1XR6A 4FK2A 2E4LA 1U48A 4I7FA 3SPZA 2RPIA 3DLBA 4ZVFA 2W9AA 4E7LA 4KHQA 4LH5A 4DSLA 2P1JA 3U3YA 4KKOA 4KHYA 3MEEA 1CZBA 4CFAA 3RR8A 3TAGA 1BHLA 4GC7A 1VSDA 3WNGA 2QKBA 3O4NA 1WSFA 1S9FA 4TY8A 1N56A 4ELVA 4Q8FA 4AH9A 4CJUA 1CLQA 1KTQA 1G15A 2G8HA 1T03B 3RB4A 4K50A 4O3PA 3SQ4A 1REVA 3ZSOA 3M8PA 4Q0BA 1HNIB 4C8OA 1FKPA 2UVRA 2X74A 2F8SA 1WSJA 1KHVA 1EXQA 3I5AA 4ZPDA 3EY1A 2XC9A 4Q8EA 3DLGB 4YMEA 4FLUA 3RWUA 2PY5A 4QCLA 3OHAA 3HVRA 3GQCA 2GBZA 1BL3A 3VQBA 2ASLA 3SI8A 3QINA 2P5GA 3TAFA 4FLXA 4DS5A 2W7OA 2HWIA 2HHUA 4IFYB 1S9GA 3SV3A 1IO2A 4MIAA 4N76A 3ZSXA 4CGHA 4FLTA 4KO0B 2DFEA 3SNNA 4O44A 4DF4A 2HB5A 3TAPA 3AVAA 1D9FA 3RB0A 4O3NA 2HNDB 1RCHA 3PW0A 1TVRA 4M3TA 1DTTB 1NK8A 5KFGA 1WN7A 2Y1JA 1SUQA 3QNOA 2YNGA 4CJLA 1A5WA 4IRCA 5CYMB 5C5JA 2C28A 5J2QA 1KCFA 3I0RB 2OPPA 1BIZA 3PW5A 4O55A 4CJSA 4CK2A 3L2QA 4CF8A 4NLRA 1B9DA 4BE2A 1K6YA 1C1AA 3EPGA 2IS3A 3KK1B 1KVCA 1X1PA 3M8QB 3NAEA 3BSOA 3OLAA 4KHUA 3P83D 4I2QB 4ID5B 3THVA 3MR6A 1HQEB 1KFSA 2UVUA 4J2DA 4IFVA 4FLYA 3G86A 4YR2A 3VQ7A 2G8WA 3NE6A 4AHUA 4KE5A 1RTIA 1IM4A 3BQ1A 1JKHA 4H4OA 4L8RB 3OYEA 5KFJA 3A2FA 4ECSA 3KTQA 4WZQA 3KD1E 2FLLA 4FK4A 5F8MA 1ZBIA 1LAWA 5DK5A 2D41A 2GIQA 2UUTA 4FJHA 1F21A 1VSMA 4IKFA 1RA6A 4EEYA 4J9NA 4H54A 4CHNA 2C2DA 3V1RA 4Q45A 1QHTA 1HMVA 3NH0A 4PQUA 5KGWA 3AVCA 1LW2A 3U6FA 3LAKA 3MR5A 1JLAB 4NLSA 1Q8IA 1RAJA 4J9KA 4PWDA 5HRSA 2VWKA 1L3UA 4DL4A 3DYAB 1RT3B 4KI6A 4DG1A 3MR3A 5FDLB 4DSJA 1JXBA 3MECA 3VQQA 1VRTB 3UIQA 3HL8A 1TL1B 1NK0A 3MEGB 4DLGA 1A5XA 1JLQB 3C6UB 2JGUA 4WYLA 2BE2B 4FJJA 3TVKA 4RW7B 1JLEB 4JLHA 2R8KA 1RDCA 1DTQA 4M45A 2HNYB 2ZE2B 1GOAA 4CEOA 2YKMB 3LZJA 4GVMA 4K4XA 3C6TA 1HYSA 4OGEA 4DU4A 3CYMA 3IS9B 1RTJB 1XHZA 3MEDB 1MMLA 2OPRB 3QETA 3TAQA 4FJ8A 4ZHRA 4H4MB 3OYJA 5FRNA 4B8CA 4MH8A 1RDDA 3B6OA 3QLHA 2O4GA 4QPXA 2E9ZA 1RT4B 4TYAA 3Q8QB 3AVHA 3TWHA 3F9KA 3I8DA 4O3RA 4AILC 5KFHA 4Q5VA 2D0CA 4B9NA 2WHOA 2IAJB 4N41A 1WSHA 3DDKA 4CJQA 4O3OA 4F4YA 1RT5A 3AVBA 2W7PA 2HHQA 1LV5A 4DTOA 2HAIA 4O0IA 4Y3CA 3EYZA 3NGZA 3OL9A 5KFFA 4WE1B 4CGDA 4DU1A 3CDUA 3CJ0A 4ZVEA 3L2VA 4E7HA 1UA1A 3OYAA 4WYWA 3ITHB 2OYQA 1JXLA 2XGPA 3TR8A 1QSLA 3AO1A 3BSNA 3IG1B 4KHRA 5C24B 2YKNA 1T05B 1BI4B 3OSPA 1WNEA 3BJYA 2BGGA 1FK9B 3AV9A 1SL2A 1LW0B 4DTXA 1S1TB 1S1XB 4TY9A 5L9XA 4U6PA 4ECUA 1VK0A 1T03A 5D3GA 3N6NA 1ASWA 4CEZA 5HP1A 4R0EA 4F4XA 4CHPA 3GV7B 3DLGA 2W9CA 4IH7A 4Z0UA 2W9BB 3LPUA 4M95A 1QE1B 5KFWA 3CG7A 1RDRA 3H5XA 2W42A 4IDKA 2ZQBA 4ED8A 4X2BA 2JEJA 4TLRA 4IFYA 4O3QA 4NLGA 2IBKA 2IOCA 1KHWA 3G0ZA 4JV1A 1RDAA 4NRUA 2D0BA 1S9EB 4RNFA 1XI1A 2GV9A 3HYFA 1KRPA 4DTPA 1SKWA 5HRPA 3LP3A 1TKTA 1TK0A 1DTTA 4ID1A 3FDSA 2Z1GA 4HUFA 2KTQA 2IMWP 1J5OA 5CYMA 3M8RA 3I0RA 2VG5B 5FRMA 4CF2A 2RDIA 3TANA 5DMRA 4PA1A 4KV8A 4CE9A 3KK1A 3MEDA 5HROB 4CK1A 4JS5A 3M8QA 1D9DA 1QQCA 3OYDA 3IN5A 4AHSA 4ICLB 1SH3A 3K5MA 1BISA 5DLGA 1TL3B 4NLTA 4IKAA 1NK6A 1RTDA 2PYLA 4EBDA 3LP0B 4CJVA 2BQ3A 2BANB 1VSIA 4HCCA 5C25B 4MKBA 4BWJA 4E19A 3ISND 1HQUA 1DLOA 3TAMA 4OJRA 5DQIA 2IC3A 3LP1B 4KTQA 2V9WA 2ZD1B 4C8NA 4FJ9A 4NLVA 4KREA 2VA3A 4J9RA 4M3WA 5C42A 3QGHA 4CIFA 1ZTTA 3CVKA 3HJFA 4Z4FA 3I0SB 5KFUA 4O4GB 2XI2A 3NF8A 5JS1A 2KZZA 5DGAA 3KK2B 4QOZB 2R7YA 3CJ3A 4DSEA 3OYHA 1RILA 5KG2A 4NLQA 3H4BA 3K5OA 2XGQA 4MK7A 3NH1A 1RT1A 3DYAA 1RT3A 3QGGA 4NCGA 4RNHA 4NRTA 4DQIA 1VRTA 4CJ3A 4B9SA 5I3UA 2WRMA 4ECTA 1HJRA 5EWFA 3MEGA 4CJEA 1WSEA 3C6UA 4YP3A 2YHAA 3QNNA 3HHKA 3GIIA 4NYNA 3KLGB 4RW7A 3LPTA 4MFBA 3ZSYA 3S9HA 3NBPB 4PUOB 1S1WA 3CQ8A 4RUCA 2YKMA 1N6QA 1W0HA 3CO9A 1KLMA 1UWBA 3L2RA 3MR2A 1NKEA 3GIJA 4DFPA 2OPQB 3IS9A 2XCAA 4FZXC 3N6LA 3QZ8A 3GV5B 1GX5A
chains in the Genus database with same CATH superfamily
3ATUA 1Y11A 4YS2A 1JJ4A 1SL0A 1N34K 1UPPA 2CJ9A 3AH6A 4JI5J 3VQSA 3QO9B 2UXCJ 4PR6A 2EHGA 4G1PA 3VF4A 2BMBA 1IWGA 3D67A 3IM8A 3WXKA 2MKIA 4TNOA 3L2WA 4UTGA 4J9MA 1BOTO 3GV8B 2QV6A 4DV1F 1T9VA 4MYTA 2GO9A 1A6LA 2OFGX 5AZIA 3I6PA 1ZAXA 3W0LA 5KRSA 4BACA 4RKUC 3KDOA 1B64A 4WFZA 2NNWA 4CWBA 3A12A 2EX3A 4OLBA 4DCJB 5GAGI 3DOMB 2W7AA 3CD6N 3U1LA 4XDCA 5GMEA 2ZWOA 3L3UA 4NLBA 4CEQA 3GOIA 3IR7B 2BH1A 3F0NA 1LW0A 4EIAA 1BCMA 1NK4A 2P51A 1IG8A 3K89A 4B1WB 1T7PA 5DG7A 3H2LA 4YQWA 1C0FA 5CAAA 4MKAA 3GIMA 3ZTQA 2R7SA 1VQ9S 4RCHA 1QAYA 2HFSA 4ISGA 3NH2A 3DMJA 2WBMA 4GKKK 2RQMA 3HHLC 1XJWB 4IOBA 2YPZA 4TN2A 1IJJA 5HMYA 3EVOA 2JLGA 4HH0A 5HQMA 2O8DB 4WBFA 3TSQA 2BACA 1SJ1A 3SAHA 2JH3A 1PYSB 3W3DA 3JS9A 3FQKA 3LANA 4CFDA 4LF9F 4DF8A 3LH2S 1RTHB 4ATNA 3IWXA 3Q2SC 5EOYA 2X1GA 1B92A 4E1NA 4ZVGA 4PHTX 1CPZA 4RU2A 2AGPA 4OYBA 1Q8BA 2VG6B 2GMHA 3MAQA 1TL3A 1GLEG 2BKOA 4OYPA 1RJJA 3LF0A 2NRXA 2P2CB 3J81O 4Y2MA 1D4XA 1IBMF 3D2FA 3AO5A 3V6DB 2DFFA 4DB3A 4TKTA 1S76D 2FF3B 4QIWD 3TR5A 1HBUA 3VQAA 1SIZA 2B8QA 2CJKA 1UJ6A 2OAUA 2FIUA 2QSFA 4ZVSB 3KMSA 4EBCA 1NM1A 3O5BA 4CD3A 2QFJA 4NI2A 3VESA 4JYAJ 2QA4N 2IRUA 2Y9HA 1NOZA 2WTUA 3A5LC 1WJ9A 3GYNA 1HWUA 3O3HA 2EXUA 3CDEA 3K0SA 3PO5A 2I1RA 4QS9A 2PEBA 3QMLA 3DRSB 4JHDA 5F8GA 3QEXA 3Q8SB 1Y5IB 3L3VA 4KB1A 2QKKA 2HVHA 4XH1A 4NLXA 1VFJA 2YNIB 1NMEB 4Q43A 2LA6A 3K2PA 4K0KF 1BU6O 4ZVHA 3V4IA 1OYDA 1M5KC 2BQRA 5HRRA 4A2AA 2UZAA 1OH8A 3LM2A 2XMMA 2MLYA 2WVBA 3O3FA 4OI4A 4CM0A 3Q24A 2AX1A 3MMBA 1ROFA 1KFDA 1RBSA 5IC6B 2DHHA 1RACB 1HARA 1IKWA 3L2UA 4FKYA 4GMKA 4ELTA 1YI2N 5GAEI 1Q7LB 4C8MA 4M5NA 1UA0A 4LSNB 2YWGA 3BZKA 2KI2A 4Z4CA 1N88A 3D6TB 1V3SA 1YWXA 4X4OA 4CJ5A 2ZH9A 3N9UC 1B9FA 3NKYA 3MFHA 2ILYA 2RT3A 3V81B 5I42A 1ZM9A 3CHWA 2RF2A 1V4SA 2QWRA 3O80A 3AHPA 4RPFA 1VSHA 4H0YB 2H48B 2KYZA 3ZC4A 2E9TA 5EX0A 4LD0A 1I94K 8RUCA 2QG9B 4CJRA 4EK2A 5CYQB 2E7VA 3TRGA 3BS9A 3HT0A 4JI2K 1VOMA 3EMTA 3D45A 3FZHA 2MKCA 3BEGB 1QJHA 2G2ZA 3KLHB 4A48A 2VKZG 4DUYF 1S1UB 2K2PA 4F50A 5KQDA 4RWTA 3OYBA 4GVBA 1WG4A 1A9NB 1QUPA 1VJQA 3PIPL 1WG1A 3KHRA 3AT1B 3M1VA 4ZP7A 1DAXA 4C4WA 1S5ZA 1HNXF 4FZZA 3DGVA 1RHJB 3C65A 3FSYA 4FYDA 4USTA 2HGNA 1LK7A 4NA2A 3HFVA 4CNYA 1FD8A 3M8SA 1U2RA 4EWTA 1NJXA 2MKYA 3D6FB 1EKEA 4W5NA 2UUAJ 3MM5A 3DWLA 4E89A 1OIAA 4FKXA 4LF5K 4BR2A 3M1FA 4AYBD 2HHTA 3O8MA 3M4XA 2HSEB 2GQQA 3Q8RB 4JI8F 4BBYA 1WDDA 1N32J 3ILOA 2WVCA 3OYFA 4B9MA 1TR0A 3KWIA 2KZMA 5HAOA 1D0EA 2UXBJ 2JHEA 2QSWA 2A1BA 4ZA1A 2VUGA 3SUNA 2COLA 4YHHK 2AEJA 2B4VA 2YHYA 4DN0A 3FBFA 2HNZA 4ZCMA 2YKQA 2AGOA 3N28A 5BR8K 3EDRB 3R5GA 3K7RA 4ED3A 1FKPB 2L9WA 3MX5A 4CHOA 1A7GE 5LMUF 3VHQA 4FM2A 1IWAA 3ET6B 3DRYA 1HQEA 4ZS6A 2HFZA 2D1KA 1WF1A 3VEXA 2XY5A 1OY9A 1DY3A 1FRXA 5AQNA 2XHCA 4EP4A 4DV3K 2L08A 1M5PC 3I31A 3P45B 2PFFB 1C6VA 5AXNA 2MZTA 4WK1A 4O3SA 3BF3A 3BBBA 3FFIA 2OSQA 3CGIA 2Y1IA 5F8HA 3PHEA 3HCXA 2XNQA 3SZ2A 4AE5A 4DUZJ 2V51B 3K59A 3MI7X 5T7LA 3U3GA 1W97L 1LXNA 1SJRA 3AD7C 3EZWA 2ZUAA 1MN9A 3D1QA 3HHLA 1SUQB 4ANDA 1S97A 3T1HJ 4F26A 4PPDA 4F4AA 5J2QB 3OYLA 1U0SA 3VF0B 2OGUA 1RISA 1JX4A 1ESVA 1JNZB 4CGGA 3AA4A 4RW4A 2RAQA 1FJGF 5SZTA 4BS2A 2E1CA 3W66A 3G25A 4X64K 3O1WA 2HWHA 2E44A 1I5OB 1RDUA 1BWEA 3T1AA 4UUWA 2VDIA 3PY8A 2YQ3A 1CJVA 2D1CA 1MLAA 2HS4A 4BE1A 4FZYA 3FEXB 1XMQJ 2QEXS 2HNYA 2ZE2A 3QMQA 4I6MA 3BKFA 4KH4A 4N77A 3P1GA 4ECZA 5ETQA 4DDFA 3K57A 2F8EX 3OXLA 3BEXA 3KLIB 4NOHA 3KWMA 1Q95G 5BR9A 1SL1A 4PABA 4RG8A 1RTJA 5JVHQ 4DR1F 5JLFA 4BDYA 3KWGA 3H6EA 1RDWX 2CNOB 1VGYA 3F5TA 1XK8A 4NLOA 2QWOA 2V4JB 1S6QB 2HYIB 2P9PA 1Z26A 2FQQB 3X3UA 2O67A 3MECB 4P74A 3T6JA 3R9PA 3C94A 1Q7YO 4B1ZA 4FYWB 5LJWA 1D1UA 2KU7A 5KG7A 2F40A 2GGPA 4AHVA 3I55S 4WP3A 2U2FA 2WVEA 3G6XA 1YJNS 2HQ3A 3D5MA 2QWQA 1HBNB 5DDRC 2OUGA 1MW7A 5HLFA 4JN4A 2CPIA 1Z4UA 3CMAN 4IG0B 3EICA 2BYCA 1S1TA 4DEZA 5A0YB 5GADP 4FOIA 1NOYA 4JI0K 3VEVA 1EARA 4OHWA 2DR5A 1KEKA 3CCQS 3VQCA 2HLUA 2MKJA 4DI6A 1NGDA 3DLLL 4JI1J 4TVAB 3QICA 4OZ5A 1YDLA 3SK3A 1HNZF 2DBBA 2ZHOA 4UW2A 3G8QA 3ULEA 3GJRB 2DXDA 4FXVA 4HHTA 3AQOA 3EX7B 3PXGa 4URGA 4FPIA 2M88A 4MDBA 1N4LA 3VGMA 4JI6J 4K2JA 5IT4A 1JIHA 4DV1K 2UXDJ 4DR2F 1VQMS 2AW0A 4AQYJ 2OZMA 4RLEA 4PXEA 2DY4A 5G0RA 4Y1CA 2E7WA 3K5NA 5HP1B 3C16B 4V19J 2AZ1A 4Z4GA 1ZOTA 1SIWB 2R7VA 2JZ5A 1XNQJ 3HVAA 3KDNA 3TSPA 4M3XA 3ILLA 5LOQA 4M42A 5AQQA 1HFEL 5BXIA 2V2KA 4MK9A 1VR6A 3QBCA 1HD1A 4PCQA 4C8ZA 3SIPB 3W63A 1ZBSA 2QE5A 1ATRA 1WSIA 2M3DA 5KFZA 3CC2S 4I1TA 5CCMA 3HVTA 3KLEB 3OVAA 2EFOA 1ZXOA 2XLIA 4DHYA 3CM5A 1WBDA 2JC1A 5CQGA 3PTWA 3ZSZA 2RHQB 5KT7A 1ASUA 1NU0A 1F5AA 2G8IA 5CZVA 4NXNJ 2L48A 3QT5A 2NLXA 1FA0A 5IC4B 1KLNA 4KI4A 3E9PA 1QTNB 2AT1B 1ZH5A 2GX9A 4CI6A 4ED5A 1ELOA 3ADAC 5EHHA 1WHXA 4AD6A 3S1TA 4RZRA 2BOAA 4EU0A 4PUOA 2V34A 3ZTRA 4NCBA 4E7IA 4BRDA 3OS0A 3JSMB 3CNQP 4AL5A 2V2VA 2ACYA 3A0IX 3RRHA 3VQ5A 4CK3A 1TUYA 3BZCA 1ZPVA 3QERA 2ZBCA 4BR4A 1LOUA 5AE1A 1VC0A 4X4TA 2V4QA 2FC0A 1H0HB 1IBMK 1S4FA 2DO0A 3R27A 2LCWA 1QM9A 2LVWA 3FCWA 1Y4ZB 1RZMA 4AHCA 2WW8A 3GFXA 3I9V9 3LAMA 1C0TB 3CJQA 1BMQB 2P9CA 3JYTB 4JYAF 1LWFA 3HPHA 4NCGB 3IAYA 2F5GA 4G3IA 1F1BB 3UB5A 4K8ZA 3G82A 2KT5A 5CYJA 3DI6A 2J9EA 3MUTP 3LDPA 4AL6A 2YKPA 1RT6A 1WEYA 1CJTA 4OLAA 2I5JA 4JOUA 2H3EB 1VDHA 4NCAA 1RWUA 2G4BA 8AT1B 1NHVA 3S3MA 1C2PA 3ID8A 1EETA 1UWBB 2W24A 1EO1A 4KSEB 2J9CA 2EK6A 1KD1O 2F7VA 2OEMA 4FJ7A 2HEKA 5BPNA 1UFKA 1IKYA 1FI4A 1VQYA 2WBNA 2EFPA 1MWQA 5E3AA 1UKUA 4DFKA 4OO1J 4K0KK 3H40A 1QTMA 2WSEC 1UEUA 4J2EA 2DITA 6FDRA 4WZMA 1GMVA 2B56A 4JK9A 2QFIA 4IJNA 4HUGA 4DLEA 3GR1A 2QC3A 1VRUA 2WVFA 3CD7A 3EE8A 1RKIA 4IOAL 2AQ4A 4E0DA 1S7IA 4OKJA 3NCPA 3MAAA 1PBUA 3W9IA 5HBMB 3TNVA 2XZTB 2OPSA 2H5IB 4PY5A 2N82B 2KQ2A 1Q7YT 2QLXA 3HZGA 1CJUB 2ZEJA 4P7TA 1HHSA 3I4HX 1YKWA 3ZTPA 1WI6A 3M8YA 1WD6A 2IGIA 1HI1A 4CF9A 4ED0A 4ANCA 3DXBA 3DLEA 4JV0A 3BBFA 4PXBA 2JFKA 4B02A 3M2VA 4HHHA 2FVRA 4BGAA 4ZITA 4IEEA 1VQ4N 1VQ7S 1Q5YA 4XO0A 5KG0A 2GELA 2BR0A 3N4PA 4KKOB 2XZWA 2IIHA 4DL6A 1JJ2M 3DMJB 2AA4A 3FCHA 4JKCA 1GXUA 3E8OA 1C0UA 5K8MA 2YWEA 4C0BA 2FJVA 1F3FA 4HR2A 2XSJA 3ZNUA 1H72C 3LALA 5K20B 4FF3A 2C2EA 1WC1A 2Y8YA 3M8PB 3NF9A 2ZKUA 4QW8A 4ILRA 3QGPA 2BTFA 2ZGYA 4A8FA 2IJRA 4K4VA 5LXYA 4EO6A 1VQPN 1HNXK 4I6AA 3L7PA 1ILYA 4HYKA 2BKNA 3MD3A 5LSRA 1WKKA 3QPIA 2DRAA 4FYYB 1CBKA 1UVIA 4NE9C 4LR8A 1RWKB 5KFEA 2IJNA 3CCWA 4DL3A 4L74A 2Z1IA 2R9LA 2W2NP 2DIVA 2HIQA 2BQUA 2FGCA 2VWJA 4CJ7A 3GL1A 1T02A 1SV5A 4JI8K 2BE7D 4CZCA 3OYMA 2K1RA 5KRTA 3RVCA 2UXBF 3JXUA 2HPUA 5H1SV 1KAXA 4BRPA 1RDBA 1WOSA 4USMA 3VERA 1S72S 1SAZA 2P5OA 4Z37A 3MCOA 3AGRA 4M41A 2NRZA 1HBUB 1FFWB 3O08A 1GNKA 2VICA 3CD0A 2R8GA 1K8AT 5EN1A 4ZN3A 4BRAA 3NF7A 2P9SA 3FZ2A 1QVGM 4NI2B 4WU2A 4NZ6A 1NB7A 5LMUK 2MLZA 2YX7A 2MQPA 1T3OA 4H0OA 1RT2A 2W40A 4FF2A 2XMKA 1ZBHA 3MM9A 5HJXA 1RK8A 3UVJA 5A76A 2LMIA 4W5QA 3MPVA 1BE4A 4CGIA 2YCHA 1X9SA 3F44A 1FJ7A 5E7OB 4DR4J 2E5LJ 3DLRA 4OHXA 2FBTA 1FESA 1VQ9N 4BREA 2AWZA 4R0JA 1HMVB 2XB2D 3H5SA 4JI7J 4PQUB 1WEZA 4OLOA 4BR5A 5BN8A 1LW2B 1U2VA 3OV7A 3IP0A 3M7VA 3V4IB 1U49A 3TX8A 1X4AA 2DIUA 3G6ES 3R5JB 1HBMA 4OPAA 4DG1B 4ECXA 5JMVA 4ZPVR 4LF4J 2Y3YA 4YORA 4DTRA 5JMNA 4YFUA 3MTJA 2FVQA 1I6JA 4CECA 3G4SS 4BDPA 1J53A 5GAHP 4DV7J 3DXMA 1W2BR 1IKWB 3CQXA 3MMCA 4PYDA 4NX9A 4BR7A 1FJGK 3CMEN 3V9WA 2HRYA 4BROA 4DV6F 3UN5A 3JB9k 4XPEA 4DTSA 1RAGB 2VQEJ 2WB4A 3C6TB 3CTRA 4JV2A 5A8KB 2P9NA 2B0GA 4XAKA 3HSTB 1GK8A 2R7WA 3GCWP 1TK8A 5M1OA 4O5FA 4KTWA 4GKJJ 4BQZA 1VMBA 3OJUA 2D5RA 2G0IA 2RF2B 3QIPA 1S6PA 3QLHB 1E4GT 4IRKA 3V6KA 3P5JA 2UVWA 2Q2RA 5BRDA 1MNEA 3HVWA 3E01A 5JS2A 4LJMA 4F0KA 4EHUA 3JXOA 4L73A 4DL5A 5KT2A 2BV3A 1EX8A 3QFHA 1RGIA 1C1BA 1KD1T 4F04B 3J80Y 2KHOA 1NM2A 1U48A 4F25A 3L0QA 2RPIA 4FVCA 2P1JA 4GVBB 3Q83A 2RE2A 1BHLA 3M1VB 2G1DA 3WNGA 1UVLA 2VQFF 2RE1A 4I56A 1WSFA 2I7NA 2XWXA 4CNZA 2Y0SD 2LXUA 5HSPA 1S59A 1VLYA 3W9JA 4BC7A 3VPZA 1SS6A 1T03B 1U24A 4K50A 3PYEA 1REVA 3ZSOA 4Q0BA 4C8OA 1G4CA 1PJ7A 2X74A 1KHVA 1EXQA 1T9UA 3DU5A 3DLGB 1XQSC 4YMEA 4FLUA 3RWUA 4QCLA 4C0OC 4R25A 4FPRA 3C15A 3FVYA 3VQBA 2AEMA 1F5BA 4PRFA 2O01C 3HSJA 4JI1F 3T1YJ 3PNIA 4IFYB 2MTLA 2KFYA 4PWUA 3FEYB 2HB5A 3AVAA 5FPDA 1HNZK 3RB0A 3MM7A 3QB0A 1TVRA 2W2PP 4M3TA 3H8YA 3R5BA 3J7YI 2DY1A 3QNOA 2YNGA 4JI6F 2NXCA 2KHCA 4USHA 3CF5L 1VLOA 2DKOB 2UXDF 1KCFA 3CIMA 4O55A 4CJSA 4OYOA 1SQGA 3L2QA 4HT7A 4CF8A 4NLRA 4J90A 3TSUA 1WACA 4B3MJ 4DR2K 1KVCA 4WIIA 1TFWA 2OFHX 1HW9A 3NAEA 3VMFB 4UZBA 1HQEB 1KFSA 2UVUA 1RAAB 2XMWA 5BRHA 2CVEA 1R3NA 1DT9A 2G8WA 3NE6A 3O6QA 3CJ9A 1YXQA 3K8VA 3OR1A 2D0OA 4A47A 4DMZA 3ENVA 4I6YA 2Z58B 1RQ0A 1XEZA 5T7LB 2XEXA 3CQYA 3FZKA 3A3PB 3KD1E 3AOBA 2FLLA 4FK4A 1LAWA 3H3OB 4DV0J 4NB4A 1P6TA 3M6GA 2MQQA 1VQSA 3GSIA 5CHIA 3JTOA 3PRDA 4FWKA 3BF4A 4EEYA 1DEJA 2C2DA 3EGVA 4OI2A 2DNYA 5KGWA 5GAGP 1Y5NB 4OZLA 5AQVA 2D69A 1IJEB 3A8YA 3NLCA 1NO8A 2MZ1A 4QIEA 3ZTSA 2V8HA 3OFGA 3HM8A 2ROEA 3IDHA 5LJ5Y 1KR4A 2AIRB 3MR3A 3PDNA 2P9LA 1JXBA 3Q0AA 3VQQA 2UU9J 3UIQA 5B0FA 1Y7PA 3OVSA 4DLGA 3C6UB 4WYLA 3MN9A 3TVKA 1C4AA 4A59A 4K42A 2FJEB 3A5NC 2HNYB 2ZE2B 2YKMB 2VGNA 2YX1A 5DM7Q 3D3CJ 1NPRA 3CYMA 2GMLA 3AOCA 1RTJB 3LGHA 3MEDB 3QETA 3N01A 3TAQA 2O8CB 4H4MB 4M5GA 4JNEA 1RDDA 4CZEA 4QIGA 5I3QA 2ZJRL 3DAWA 3Q8QB 1AT1B 1YJVA 2PFDA 3CCSN 2N7CA 3I8DA 1S77D 1TL7A 2I2YA 5CZXA 1HPMA 2QLJB 2R7XA 2IAJB 2RIJA 4N41A 3DDKA 5ETTA 4CJQA 1RT5A 2LKZA 2AZ3A 2HHQA 1LV5A 1FRJA 4DTOA 1UZDA 2IFXA 3DJCA 3CJ0A 2GGPB 1BQXA 1FX2A 4JYAK 4WYWA 2QWMA 2XGPA 2VC1A 1U8SA 2PMWA 3VTIA 5C24B 3HSGA 1WNEA 1TYQA 2BGGA 1S1TB 4ECUA 4B3SJ 3RG6A 1VK0A 4DBQA 4B3RF 5D3GA 4CEZA 2HHHF 3M30A 5AQIA 2H5JB 4CHPA 3QATA 4Z0UA 3PJ9A 1E4FT 3A8IA 1RLDA 4DR3J 3H46O 3LPUA 4JI3J 1QE1B 3BN4A 3Q8UA 3MPDA 1D09B 4QIVA 2DGOA 3ULEB 3I4PA 3G8TA 1H7WA 4O3QA 2IBKA 2ZFHA 3G0ZA 1KC8T 1S9EB 4DTPA 4EMDA 1ZA2B 2NREA 1TKTA 1TK0A 3FDSA 5L9NA 2QEXN 4LRFA 2Z1GA 1NGAA 2DR9A 1HWLA 1J5OA 5CYMA 3MCNA 2ERRA 2DHAA 3I0RA 4HTIA 2VG5B 4F67A 1KQGB 2DH7A 9RUBA 4RJVA 4PA1A 4CE9A 3KK1A 1JCFA 4HI1A 5U47A 1R0BG 3M8QA 1D9DA 3D66A 3OYDA 1B0PA 2O8EB 4P2FA 5L8RC 2CPEA 2ZZNA 2QA4G 2KXFA 5CABA 4F3QA 2CPZA 4U67L 3K0JA 5IM0A 1FHTA 5GAEP 4HCCA 1W26A 5RUBA 4MKBA 2LU2A 2MHNA 4BWJA 2YJFA 4E19A 2KKHA 1NSPA 5DQIA 4OJRA 1D3WA 1J2VA 2IC3A 5HQLA 2I0XA 3E1YA 3I55N 1BA0A 1NAQA 1YJNN 1YAGA 3QGHA 3LDLA 5LL6d 4CTAB 3HJFA 2WZ1A 3MPYA 2XI2A 1HW8A 5JS1A 3TVYA 2Z0GA 4DL0C 4DSEA 2XSFA 4JP8A 4AF1A 3OYHA 1RILA 3SAGA 5ETRA 3H4BA 2XGQA 1JWWA 3VAJA 3CETA 3SXLA 3CCQN 5IV3A 5I3UA 2WRMA 3KXDA 4Y28C 1HJRA 2UUAK 1NHKL 2V8GA 3HHKA 1H38A 1DFDA 4NYNA 2ZZMA 3JQKA 4RW7A 3LPTA 3CI5A 4WF9L 3S9HA 3ZSYA 3NBPB 4PUOB 2E5GA 5DZ6A 1KQFB 4PL8A 1WWHA 1W0HA 3OD2A 1KWMA 1E6YA 1NKEA 2RRNA 1N36F 2QWNA 3MHYA 4QQBA 5HVGA 3QZ8A 4JV5J 2UXBK 1GX5A 3WXIA 3WXMB 1FRIA 1JB0C 3IRWP 1VQMN 2GC8A 3L8BA 2QIFA 1M5SA 1NNDA 4OX9F 3PZPA 4DCOB 3VTHA 4FNHA 1LWFB 4FN5A 1N33F 3PKYA 1YRUA 1S12A 2O3DA 3C66A 2FXUA 2EWHA 3OT9A 3RAMA 1WSGA 2X78A 1BY9A 2IM1A 2J0WA 1Y10A 3HX9A 2IYGA 3CULA 2RHSB 3MXMA 4DR4F 2E5LF 1GLDG 1EETB 3VQEA 1WAFA 4OKEA 3KKSA 3SQOP 1Z6RA 1U1RA 1IKYB 5EWGA 4DV5J 1IKXB 4A8XA 2G8VA 3T5HA 1T05A 2D3ZA 3CC2N 2JC0A 1FK9A 2CG8A 2KJWA 5IT0A 4RW8B 1CVJA 2XWYA 4LF4F 1CZ9A 2A1RA 4DSFA 3AA5X 3L09A 1V9OA 1RA7A 3EGNA 3KJQB 2HHSA 3N6MA 4XTTA 4GV6A 4HHJA 3EJMA 3EDQB 3W9HA 4CZGA 3J80O 4EP5A 2VYPA 2G1HA 1HUXA 2PIIA 1HBOA 3HI9A 3LP2B 2RSQA 2VQEF 3POTA 3MAAB 2CQ4A 4Q2MA 4XH4A 3N5FA 2OPSB 4DV6K 1KSPA 1Q81T 3G71N 1K73T 3HPOA 3OXGA 3QFUA 2NPFA 1XMQK 2CNKB 3NOGA 1NJZA 2UUWA 2DTUA 3CJSA 2C2RA 3AOAA 5M2UA 2M0GB 4E2FB 4CIEA 4U8YA 3A8KA 4HDHA 4KPCA 5HL7Q 3DOLB 2CQHA 4FPBA 4RW9B 4MK8A 2KW4A 1XR5A 2ZH1A 1RHKB 3CCJS 3IRXB 2ZJQL 1NSKL 2P9KA 2IDLA 5EUHA 2HW3A 1AUSL 1N5SA 1JLCA 4UQTA 3CJKA 2N3OA 3DDIA 2HURA 4NMXA 2GIRA 1C0UB 3HPGA 2C3MA 3ETOA 3MOZA 2F4VJ 1VRQC 4R5PA 3QFPA 2IY5B 3DOKB 5J2PA 3RR7A 2MLXA 1NZAA 5ETNA 5C25A 2E1MC 1E3MA 2ITMA 1K8KA 1Q0NA 1Q78A 2ZGZA 4FWMA 3ASMA 1W9HA 3P4UB 2ZD1A 3QRQA 3TOQA 2ADCA 3I56S 2AGQA 2QK9A 2CPFA 1ACMB 1CS4B 3TI0A 3NMRA 4J9PA 3WNFA 1I3AA 1VC6A 2JVOA 4Z2XA 2Z2YB 3KG0A 3ZX3A 5F3ZA 3GYXB 2CZ4A 4NLCA 5KFDA 1Z25A 5BRFA 5BJRA 3C2PA 1SV5B 4JI1K 4GMJB 1CLFA 4K25A 2FC9A 1IKVB 3MCMA 3GJQB 4UY85 4NLYA 5KFVA 3MN6A 1RKJA 2Q0UA 5JVGQ 3M6VA 3MFIA 3LL3A 4OPKA 3A3OB 5ETPA 4ZJOA 5HVFA 4DUTA 3GFYA 1G6BA 2AYBA 4NZ0A 4ZLJA 2RQCA 4LH4A 4CEEA 4JI6K 1SQEA 4CLTA 1RAOA 3QJJA 2UXDK 4H0TB 1T3VA 1C1CB 5KG1A 3IXQA 1U2CA 2BW2A 3NMAA 3L7UA 3UFCX 4BC3A 3ZEUA 3T69A 3O2IA 1M5VC 1PYOB 1RT2B 3BKUA 4NYOA 3PIOL 2LSNA 3UVJB 3EE9A 1CSJA 2E5HA 3LOUA 5IOLA 1XC9A 2XMAA 4LFCF 5AXLA 4FWNA 1VQ7N 2ZVSA 4BC9A 4L6V3 1RBVA 1K9MT 3BDEA 2XCPA 2AP1A 4DV0F 4EZ9A 3AO3A 1VQ5N 2XS7A 4HL9A 2WONB 1LNQA 5KG3A 4LF8J 4BY9C 2AX0A 1NH7A 1SKUB 3VAMA 1HBMB 1UP1A 2M8HA 4Z4HA 3KK7A 3C0BA 4PG8A 2Q3SA 4JK8A 5F0UA 2LXIA 4FSVA 1YF5L 5GINA 4QWBA 4ZVQB 1HHQA 2KG1A 2VWBA 1R0CB 3FUYA 3O9QA 3NG8A 1P90A 2UU9F 5F8NA 3MMCB 1PAEX 1YJ9S 3K5PA 4JRPA 1O1WA 1ZYQA 1N52B 4NXNK 1WNSA 1FFSB 3U1MA 2U1AA 3R5AA 3OR2B 3OXFA 4YB5A 2VFUA 4ZPAA 1U1NA 2P9NB 5B7WA 3FK4A 5E2QA 5I9EB 1L3VA 4CZLA 3EVWA 2B9XA 4I9LA 3D3BJ 2E6LA 1JL1A 1U1PA 3QIPB 1S6PB 4DQSA 4A8KA 2C3PA 2FJXA 3HM9A 4FXDA 2EG2A 1CJKA 4FW2A 2I8EA 3E01B 3FZMA 1YVNA 1RBAA 1WHVA 1DRZA 3PSFA 5M1FA 2FD2A 3AA9A 2EC0A 1YT3A 1S72N 1B3TA 2F1FA 1C1BB 4C23A 1H1VA 1WI8A 4FJLA 1NUEA 4WYBA 1FWPA 4DQ8A 2YWFA 4IR1A 3KFWX 2WC9A 3OPKA 2ASOA 4MO5A 2NQPA 2DGQA 4KRWA 2LQ8A 2HNDA 3UD4P 1NU4A 2KO1A 1U1LA 4W4MA 1KOOA 1SC6A 2DK2A 2DTJA 4KFBB 2NCKL 2CJAA 2YX6A 4PKDB 4Q0BB 3V6DA 5GADI 3ZSVA 3RYLA 4OZ3A 1IBCB 3CFOA 4M3ZA 4B3SF 4DQPA 2RU3A 3VQ4A 3CMQA 2CZVC 1UVKA 1JXEA 1FFGB 3DDNA 3A13A 3ETMA 3IM9A 4LREA 1FKAF 1FE0A 2MXYA 3UE2A 3QIDA 3NL0A 3D2WA 1LOTB 3G6EN 3FLCO 2HHWA 2HHHK 1WF0A 2BE9B 3R1HA 3PR4A 2ZJPQ 4MLEA 2FJDB 3MM7B 1FDAA 4ZPBA 1TVRB 3H98A 3PJWA 4OZ0A 3AVFA 2ATQA 3C8YA 5T14A 2YNGB 3D0IE 4LFBJ 1Q5VA 5K14B 1TFYA 1CEZA 3OBWA 2VJUA 4KHPJ 2O1PA 5AQXA 3HZ6A 1VSFA 4LT6A 1TV6B 3VQTA 1NDCA 5F8JA 3MR7A 1O6XA 4CEBA 2P9EA 1V5IB 1JLAA 2YQ0A 5HJYA 5K8PA 2PA8D 3KJVB 2E5JA 5DG9A 1HKCA 2EFNA 4I64A 4ECVA 4B9QA 4QAGA 4WIQA 3KOAA 4WTYA 2W4DA 2MZRA 4L3KA 3OR1B 3W2VB 5EVZA 2G8UA 3TUJC 1NXIA 4H0XB 1XR7A 3AVGA 4NLPA 3R2CJ 3J7A1 4BRKA 4X66J 1WC5A 4PKHA 1F9EB 3C7NA 4WXOA 3V81A 2YWHA 3HMJG 1BQMB 5DM6L 1TL5A 5KFCA 3UKRA 1HRHA 1S0VA 2FLPA 3RB6A 2XG8A 4CLWA 5A8WA 1UETA 3PEJA 3V4MA 3OHBA 2W4CA 1W2BM 2P9LB 2XRIA 3OVBA 5CYQA 1CQNA 6FD1A 3HSDA 4URQU 5J1NA 3U4LA 3ATVA 3BQ2A 3K8WA 3KLHA 4LFAJ 1KP6A 1GH8A 3OLBA 3PW4A 3SCJE 1S1UA 3K9KA 4J9QA 4G1IA 4IYQA 1EWQA 4IG3B 4JS4A 3ZZPA 2H1YA 2R42A 4QS7A 1R0AB 3R1LA 4AL7A 3ISNC 5A2QY 3DN9A 2V2QA 3BDPA 2R8JA 2QL9B 3FGUA 1S1XA 4E7KA 1UTAA 3SUQA 4JV5F 5DG8A 2PMHA 1N36K 1HWIA 3L95X 1TL7B 1KN6A 3QQCD 1Q86T 4OI0A 4CLYA 3EPIA 2KT3A 2DGWA 1JQGA 4YDUA 4O8KA 2UUBJ 1RT5B 3A5MC 4FVMA 4DTMA 3MXJA 3AJ1A 4DU7A 1RAIB 4FS1A 3CJTA 2P6TA 3OYCA 4LVNP 3CCRS 2PT0A 4RX6A 5BPLA 3PLAA 1BUXA 3T5JA 4FK0A 1Q8LA 3V9SA 4CHQA 5KI6A 1N33K 2DFHA 4FW1A 4FWRA 3C95A 1U6ZA 2ZH5A 3ZTOA 4YUDA 4U7UD 1G99A 2OD4A 4KHSA 1YX2A 2H5EA 2O5DA 2ABYA 4D3HA 4M8LA 3HT3A 3BR9A 1TYQB 4YB7A 3QYYA 4WFXA 1WUAA 1NJYA 4DR4K 5D3GB 2E5LK 2F65A 3OHRA 3W5ZA 3P5TL 4QWDA 1WAJA 1X5PA 3NNCA 1Q9YA 4DL2A 4NA3A 3AGKA 4LR7A 2HHPA 3SBGA 3IGNA 3FQLA 2ZH6A 2XHBA 3PUFA 3D7EO 2FLNA 5B0GA 2E2QA 3LTOA 4LF4K 3X1LB 5C2GA 4CDIA 3HD2A 1UVJA 1U1QA 2UV8A 1KTVA 3L4BC 2MJUA 4DV7K 1J5EF 2CKWA 2BANA 4MYUA 1CXQA 2PYJA 1X3MA 1NGJA 4I67A 1NLKL 3CMAS 1RABB 3PYDA 4X4NA 1TKTB 3BYRA 3RBZA 2VQEK 2QXFA 4JKHA 1J5OB 4HDGA 3FE1A 1QUVA 1JK9B 2CPDA 3ZCMA 1RWWB 1NSAA 4GKJK 5LXRA 1TAQA 5EWEA 4K4SA 2ZVIA 2YNFB 5L1LA 3BY5A 1F9HA 4KY3A 1YJ7A 4K4TA 2MGZA 5AXMA 2DISA 2HVZA 4KGKA 3M2UB 2IM3A 4C1NK 1NBEB 4CM2A 5E3CA 4WKRA 3CE8A 3GJSB 1GOBA 3GPAA 1FRMA 3QAUA 4EYHB 3KLGA 4IXCA 2D3UA 1JLFB 4BRMA 1QZ6A 2RMLA 2F4VF 3TVZA 1UL3A 2HGLA 3B4MA 1RYSA 4A8MP 3H1VX 4IO9Q 2IC3B 1DQ8A 2FVCA 4YN3B 1FEEA 3KLIA 2HQDA 4FBTA 1J9AA 1MROB 1R6VA 3G9CA 1IBLJ 3OL7A 3SQ2A 3CJCA 2CPHA 3Q22A 4IRDA 3MDQA 1ZBLA 1S6QA 2UP1A 2YKOA 2L9DA 2HZVA 3V9UA 1DQ9A 2HBZB 2ETJA 2PDAA 4M5HA 4ZP9A 4M5DB 4R8UB 2PZSA 2X1AA 4Z7YA 3OSNA 1BQNB 4PYAA 4F02A 2B6AB 4UUXA 5I3UB 3MMJA 2YWWA 2M8DB 4WFAL 3SJJA 1P1LA 4DR6J 1EKRA 4MQ3A 4A8WA 1Y97A 1MMNA 4CO5A 1I39A 2OZSA 2Z1JA 2Q1NA 2IRYA 2BJ3A 2W25A 4QR1A 2Q97A 1KVKA 4U7BA 4CESA 1YZ7A 3UD5A 2M70A 1WC4A 3CDAA 2B7CB 2FVSA 2RDJA 1OH7A 5MLCQ 1U4BA 4IG0A 1HYZA 4C0HA 1JLBA 1S4EA 1UW4A 3K17A 2KHDA 1BWFO 1HNWJ 1MMDA 3KHGA 4BLGA 1RB0A 1SH2A 4CFCA 4B3MK 4M5KA 3M32B 2HZAA 3FEZA 4QR0A 3MTKA 3HRGA 4Z94A 4IOCL 2JX2A 2AV5A 2QXLA 4OZ2A 3O3GA 4CH0S 4CO1A 5BR8F 4URSA 3E51A 4LBIA 4KH0B 1UVMA 4KPYA 4B1UB 4LFCK 1VQ8S 1MWKA 1N0UA 2N4CA 3OQ2A 2GHWA 1JMTA 2CQDA 3Q8VA 4DV0K 3ZSQA 1GLJO 3HLUA 3D1OA 4IJAA 4KHNA 3C16A 4OL8A 2WUSA 5GAHI 3IUCA 4F3TA 4JBCA 1K0TA 3OFEA 3CCUS 5KFPA 4DWIA 3LZIA 1KDNA 4G65A 2XS2A 4ZDNA 1LAVA 3CC4S 3O5TB 2UU9K 3PSIA 1NGGA 3SEOA 4YOEA 1R27B 3TU5A 3R3LA 2CGKA 1H2UX 1GXLA 4EI2A 2VD3A 5AZJB 1S49A 2MQMA 3KLEA 4A2BA 2OMOA 2AU0A 3J81j 2OD6A 3PIPQ 1F2HA 3HZEA 4ILLA 5C7PA 4CLKA 3B82A 2HBRB 2FHJD 1K44A 5L46A 3QRPA 4Y2AA 1TAUA 5T7BA 2P9KB 4JKGB 3NF6A 4DPOA 1FDBA 1JLCB 3CJKB 3OS2A 3V6HA 1PKUA 3R9LA 5KFMA 1WG5A 5K8OA 4R5PB 1FTRA 4I6WA 2F7TA 5J2PB 2MQLA 1NPKA 4DR5J 5HN0A 4I9QA 4IEIA 2E88A 4JD2B 3VA0A 1X60A 1URRA 3L9ZA 3OYGA 1K8KB 1FERA 3JSMA 3D1HA 2EK1A 4FXWA 1XC3A 4IWVA 2V50A 3IBFB 3TUPA 1VQ4S 1BG3A 4GKKJ 3NGDA 3B78A 1KAYA 4JKAA 3QESA 4LIRA 1RTIB 3NRBA 4OYWA 1XHXA 3D6MB 5FPEA 4CZIA 3ZT2A 2GVZB 3SJHA 4B3SK 5M1PA 3MAHA 1UAWA 2OELA 1C0TA 3JYTA 4RUHA 3TA2A 4ALZA 3T9NA 2ZBPA 4DR3K 2W8KA 4MO4A 4JI3K 4PG7A 4EO8A 3FRZA 2J76E 3BYPA 2GV1A 1D5AA 4LFBF 1GMWD 4YB1P 4JI0F 4CHYA 3BP8A 3W62A 1HD0A 1RAHB 1PJ5A 1RBTA 1R43A 2V2ZA 3EZUA 1HNVA 1TP7A 3DRRA 2HRUA 5AQMA 2ASJA 3TPQA 3IGVA 1BHNA 3EGWB 1YJWN 5E41A 3T41A 1QZ5A 5H9EJ 1B7YB 3ZEUB 4J8FA 1IXKA 1OQ3A 2BJ9A 3DNCA 2JEFA 1HX1A 4UY8O 1ZBTA 2PI4A 3K2YA 3GZ7A 3BZQA 3WC2A 4ZVPB 1T9YA 2CPXA 5C2DA 5HQ8A 3ISZA 1NK9A 1UEVA 2PMZD 1G2EA 1D8ZA 2OEKA 3ULDA 1HR0J 4FLWA 4X65J 3CCJN 1OSDA 2E2PA 1X0FA 2APOA 2DNQA 2PFUA 4X66F 2MMYA 4K5SA 1LWCA 5A2QO 5HBMA 2RQKA 2D9OA 1FRLA 1RADB 4P73A 1CJUA 4LRCA 4DR7J 3SCKE 4O8UA 2POKA 3F41A 1NG9A 2CH6A 1NCLA 2PO4A 4YY3J 2HBKA 2D0PA 2HOEA 2FB0A 2FHKA 1NMNA 2R7RA 3MPUB 2YNHA 3I56N 1ATNA 4Y2KA 2CH5A 4FK2A 4CLZA 1BD6A 3C3LA 4I7FA 2UUCJ 2W9AA 4DSLA 3WX8A 3SLCA 4ERDA 4KKOA 3DC2A 4CFAA 1U7LA 3TA0A 2BUPA 1KQKA 4LFAF 2QKBA 1DURA 3ELHA 1BA1A 1AFIA 1S9FA 1N56A 4CLPA 1CLQA 5E33A 3IO1A 3B8HA 3WEEB 1KTQA 2NRRA 1VQ6S 3RB4A 5IZHA 2MDAA 1CJKB 3M8PA 2DEJA 2KRBA 1PYTA 1WC0A 3L4IA 3D2EB 3OHAA 2H9ZA 2P5GA 4H5VA 2GZOA 3CMES 2V7ZA 4FLXA 4JV5K 2CDRB 4F0MA 5HVHA 2W7OA 4U8VA 2HWIA 2I7PA 2OO4A 2XZDB 2BJ1A 4OJ3A 5C2CA 2UUBF 1IO2A 1FNOA 3S7RA 3CO0P 3SNNA 4DF4A 1KVJA 5LMNF 1QQOA 3VV2B 1I94J 4O3NA 1PO6A 2HNDB 2EFGA 4LF7J 5F41A 3DRXA 1DTTB 3KHYA 2Y1JA 3DGPA 3BGFA 4CJLA 4IRCA 2R7QA 5C5JA 1Q82O 2J8AA 3GWCA 2OPPA 2LQJA 3MM6B 4P72A 1EQ0A 1K6YA 2QTWA 3VAFA 3VF2A 4C98A 3THVA 1GLFO 4BG8A 2Q79A 4DPUA 3VQ7A 3W65A 4OV1A 3BQ1A 3WHIA 1FT8A 1AYEA 2XYGB 2FY8A 2QYCA 3P5BP 1M1KO 1PGZA 1YIJN 1IV0A 2HFNA 2DNRA 3A2FA 2V63A 3KTQA 4OHYA 4WZQA 4E1JA 3TP2A 3ZETB 3H2VE 3Q8YA 2QJ3A 5F8MA 5BYRA 4NYPA 2JVRA 2XYHB 1K0VA 5DK5A 3ZX0A 1YJ9N 3ZZTA 3OTBA 2C3OA 1H3DA 3VEWA 4LF5J 1VSMA 3QSIA 3R97A 4QYZJ 1FRKA 3AA8A 3R5CA 1XBWA 2Q1LA 2NRTA 1J5EK 1QHTA 1HMVA 3NH0A 4PQUA 3AVCA 3D0GE 1LW2A 3U6FA 2VL1A 2AKWB 5FJ4A 1JLAB 3M8ZA 4QPTA 3HJVA 4XH5A 3DYAB 1RT3B 2DXEA 4KI6A 2QWPA 4DG1A 2BABA 3NS5A 3JQJA 2AJFE 2Q6CA 4YHHJ 3RW6A 5AJ3J 1NK0A 5C12A 2GJ2A 2JGUA 2AYMA 3G2XA 1H2VZ 3VR1A 1RDCA 1DTQA 2W2MP 1Q18A 1U02A 3Q7BA 1ITPA 2OEJA 4K4XA 3C6TA 1HYSA 5A8KA 3C7NB 4OGEA 4DU4A 3IS9B 3MK6A 2OJ3A 2M7SA 3SBTA 1XMOF 4DV3J 4FJ8A 4ZHRA 2F4VK 5FRNA 3KG4A 4B8CA 4MH8A 1SCJB 2Z2MA 3B6OA 3UKRB 3QLHA 2O4GA 3NCQA 2E9ZA 1RT4B 4TYAA 1HKGA 2B9YA 1OYEA 5A8WB 2ROGA 4O3RA 1RCXB 2MSSA 4MJKA 2K3IA 4KGMA 2J4RA 4GVLA 3TUZC 3F9MA 4O3OA 4F4YA 4P9SA 1OVYA 2HBMA 2Y0BB 2W7PA 2V69A 3I32A 1YBAA 5HANA 1KNZA 3OL9A 5CHCB 1O13A 4CGDA 3S01A 3CDUA 3AY0A 2VPYB 2CPJA 5ETVA 3OYAA 4DR6F 3ITHB 1QAXA 2DXFA 2OYQA 2VFTA 1UFLA 1QSLA 2V7YA 3AO1A 1UW9A 4KHRA 1FJEB 2YKNA 3BJYA 2NRWA 3W5XA 4DTXA 1S1XB 4YOXA 1REGX 1LCUA 3P6YC 3Q2TC 4HT5A 2KT2A 1T03A 3FZFA 1ASWA 1TZ0A 1MDUB 3SAFA 1YRXA 5HOOA 2VB6A 2HS0A 4F4XA 3DLGA 4IH7A 3WUHA 1RWXB 4M95A 2AP6A 5KFWA 1HNWF 1RDRA 4IDKA 4X2BA 1JJCB 2KM8B 2PI5A 4PKIA 1V3RA 4IFYA 2W2OP 4OQJA 4WQ5C 2VDHA 2QA2A 2IOCA 1NB2A 4NRUA 2FLOA 2D0BA 3TTDA 1XI1A 1DHMA 5HRPA 3LP3A 2EKYA 2HBQB 1SC4B 1H98A 2RU9A 3AXMA 4ID1A 1OQ6A 1YRTA 3PRBA 2ZUGA 4CLUA 2QMXA 3CCSS 4C7QA 4DPTA 2P9GA 4IOAQ 2CWXA 2JDJA 3JAMU 2ZDPA 2GWKA 5FRMA 1XUPO 1B0TA 2Q66A 2JSXA 4KV8A 1X5TA 1Y5LB 2RJZA 1QQCA 5CXTA 3OFFA 2LQBA 3D68A 3IN5A 5GVQA 4CH7A 4ETZA 5BREA 1OY8A 3NS6A 3K5MA 1BISA 2XNRA 4IKAA 4OX8A 1RTDA 1RWOB 4V1Ak 5L39A 4IZ9A 4OJ1A 4CJVA 2BANB 2J0QD 4OI1A 2KL8A 1MWMA 4USKA 2V9KA 1DLOA 2B51A 3LP1B 4KTQA 2HZCA 2JWKA 2CNLB 4C8NA 4NLVA 4KREA 2ZWHA 4J9RA 2IHR1 2RRAA 1WC3A 4C6AA 4WKYA 3I0SB 4O4GB 3NF8A 4JK7A 2IIRA 1ZPWX 2R7YA 3TEGA 3CJ3A 3CXCR 1CC8A 5KG2A 4OLPA 4X62J 4NLQA 5DETA 2HIYA 2MGZB 4C1NI 3K5OA 4MK7A 2VOPA 2ZH4A 3QGGA 3DLJA 4RNHA 4NRTA 4CJ3A 4JAXA 3W5YA 3C6UA 4YP3A 4ISFA 1V6HA 2YHAA 3QNNA 3CJ1A 3KLGB 5CA5A 4CO4A 4MFBA 1S1WA 2B9EA 3CCRN 2NR0A 4OYZA 5E3RA 1UMJA 4DV4J 5AQUA 2YKMA 4DR5F 1FRHA 1KLMA 5IQ6A 3L2RA 3MR2A 4DFPA 2XCAA 3MEDA 4NASA 4CYUB 1PAUB 2O8CA 4H4MA 1G1XA 4ZN1A 5M1NA 3BO3A 4OFZA 3LWLA 4QBUA 5LL6Z 4B3OB 1P8ZA 1NGBA 5I3PA 4H5RA 1X9MA 1OO0B 4ILHA 2CA9A 2IAJA 2OMLA 2IA0A 3QDKA 1NSQA 5AE2A 3VQ6A 2PE8A 3IWLA 4DCPB 2FC8A 3AVNA 3BREA 1BIUA 3V9XA 3EWGA 3BPSP 1GT8A 4ZKAA 3R8EA 2J0SD 3N4QA 1CG2A 2CIMA 1WEXA 2QMWA 5H9FK 1RT7A 2MKHA 3LWMA 1YBTA 3THXA 1VSJA 3PG9A 5CCLA 4M3YA 2AJ0A 2LQ9A 2IM2A 1FXLA 2BRLA 4IUFA 3JSRA 3RBDA 3J8AA 3QEPA 4NEZA 1U25A 5C24A 4ECQA 4LF9J 2CNNB 3EKSA 4LFBK 1JLBB 2B5JA 1SPBP 4J2BA 4I2PA 3UCGA 1UAXA 2HMIA 2H51B 4HTUA 3V6JA 3MF5A 2G8KA 1L3TA 3VZIA 4JI5F 1UJ5A 1TKXB 2UXCF 1QE1A 5LY3A 2O4IA 5F3TA 5D8HB 1IBMJ 1WOOA 1S0NA 1SJFA 1WHWA 3UDCA 2GJIA 3UQSA 4E3SA 4JB8B 2FGOA 1HI8A 3H4DA 1HR0F 4X65F 1YLXA 4ECRA 2IDEA 3BGRA 1S9EA 2DPIA 1SJQA 4DX5A 4X66K 2ZKTA 4CJWA 5KTQA 4IO1A 2VG5A 3CJ5A 2WCXA 1HYVA 3BF1A 1QQNA 2KVIA 1EX4A 4YY3F 1IM6A 3WDOA 4ZVTB 1VYAA 3NFAA 4CO2A 3HOSA 4RWWA 1BXNA 2O8EA 5CZ1A 2GAGC 1K1SA 1GXTA 2DNOA 3MWPA 1U8WA 2NYHA 2R2UA 3J7AP 3MURP 2VBXA 3F2KA 3MOJB 5B0BA 3N79A 1DQAA 4USIA 2A3JA 2PBDA 4I4BA 1T9TA 4FJGA 2E6MA 3OVNA 2HQIA 4AXIA 4LFAK 4HVJA 3VENA 4FF1A 2IA6A 4CF0A 1YVUA 5FROA 1ZA1B 3ZT4A 2XULA 1HPZB 4CLFA 1NK7A 2NUBA 2VV5A 4LBHA 4CTAA 5A2QU 1T11A 2WFBA 3EGZA 2GEMA 4A57A 1SQKA 2GQ2A 5C15A 3SSQA 2XTJP 3AJDA 1Y00A 3PCOB 4GW6A 3A5OC 3MWTA 4OVLA 3S3NA 3PFEA 4KJIA 4BVPA 1N5YA 3B6BA 3CJBA 4WQ5A 3L3CA 3G71S 2MYFA 5J2NB 2UUBK 3OL8A 4BRNA 1VK3A 1TUGB 4LF7F 2MQOA 1U0HB 5B08A 4M5LA 4P52A 5DRKA 2BZ2A 5AR0A 2BXJA 3NBPA 3DHWC 4NLWA 5LMNK 3KIOA 3E9OA 1U1OA 2D0AA 3WNHA 1P9YA 3OTCA 4LIWA 4K41A 2AD9A 3P3DA 3PW2A 1VQ8N 1X7VA 4LSLB 4DUYJ 5BYSA 1LEOA 4Q44A 3CF5Q 2JRSA 3NMUA 2J9DA 1YBUA 4YDDB 3DXKB 5CY4A 3SV4A 5SWMA 3T19A 2HBYB 4A8QA 4TSXA 3C46A 1HKAA 1TMMA 1HNXJ 3B6PA 3T7ZA 3G6YA 2ITGA 2ACMA 4W5TA 1FF2A 3CCUN 3QEWA 5ITHA 1Z05A 2O8FB 5L1IA 4LF1A 4GNIA 1X4CA 4E7JA 4USVA 2VFRA 3CC4N 3D0HE 3MXIA 9ATCB 3NGUA 1F3VA 4DQQA 1HNVB 3DRRB 3WT0A 2RH3A 4DS4A 1IKXA 3J81U 2GUPA 3SQ1A 3W3SA 3GFHA 3IFRA 3D6RA 2HHXA 3QZ7A 1OH6A 4RW8A 4XDDA 4B1YB 3VALA 4A5AA 3N5BA 2FVPA 4WTOB 2IM0A 3U02A 4HTJA 5SUHA 2RNEA 2DR8A 1VISA 4UOCA 1RBUA 3RRGA 1EQYA 2DNNA 3LP2A 4Y0FA 3BGOP 1GOCA 1EZZB 2B9WA 4FLVA 1LWCB 4B3TJ 1HI0P 3DRPB 4EFAC 1HNIA 1N5VA 5AQHA 4KAZA 5LSOA 1TUWA 1XMOK 5KG6A 2QLWA 1Y3KA 2K7KA 4TU7A 3D54A 2CADA 2V4RA 2NUHA 1X5OA 2NPIA 2YNHB 3DOLA 3D7SB 2KJVA 4AXJA 3CJ4A 1IBLK 4RW9A 4I7FB 2L9NA 2EKNA 2VPWB 5KAKA 3T5LA 2IVOA 3UO0A 4CEAA 2QLBB 3IRXA 2NXNA 4KO0A 3NAHA 1U47A 4OGCA 3HXMA 3AA3A 1XIQA 4YB6A 1VQ5S 4QU6A 1NKBA 2F8HA 1DARA 4E8UA 5FPMA 3RAXA 1XTZA 3PX0A 3ID6A 2VZ9A 3K58A 2P8IA 3DOKA 3VVUA 3FBBA 3CCLN 4DR6K 2PSZA 3AD8C 1T9WA 1WDTA 2DNZA 2XMVA 2DGTA 3D6HB 3NNAA 2A6AA 2Y8WA 1FJGJ 3BO2A 2GFFA 3U27A 2QN6B 5HMZA 2R7TA 3R6LB 5KFBA 5KG5A 2F96A 5B8HA 1K1QA 1CS4A 5D0HA 3TJ9A 2VG7B 4K8RA 4OHVA 2QYGA 4M63A 2UUAF 3CW2C 4U7CA 1VQNS 4ZCIA 3CSKA 4RNOA 1EB0A 1YGYA 3CCMS 3PW7A 2YHWA 2QTDA 3KLFB 4L76A 4USJC 4KRFA 1HNWK 1N32F 5EX5A 5KT4A 1VS3A 2YV0X 4DR1J 3DGPB 4FM1A 5AQGA 2GHVC 1IKVA 2XBPA 4W5RA 5F9LA 2OPPB 3OYKA 3EE3A 4Y2IA 2X3GA 4CRJA 4OYMA 1QQMA 2OANA 4RW6B 5AQJA 1QS4A 5JJBA 1TGOA 3H5UA 4IH6A 3IBCB 2OSRA 2IYIA 4E98A 3SYZA 4QWEA 2ZDOA 1VBYA 5G4DA 2DY9A 2DCUB 1S48A 2DGXA 3W2WA 1TL1A 1C1CA 3GIRA 1JLQA 3D4JA 1J6ZA 3PO4A 3N0VA 2ALZA 4WP9A 3SCIE 4AUKA 3MPWA 1VQKS 3UD3P 4CIOA 3ENAA 4CCHA 3H5YA 3UDVA 4JKEA 1NGFA 1TQLA 2Q31A 2CVIA 4DUZF 4H5NA 4GV9A 3VAIA 3M05A 2OPRA 4U67Q 3T1HF 2WONA 4FYXB 2KXNB 1VC5A 2ASPA 4EBEA 3QGIA 5KFYA 1HNZJ 1WORA 1QSYA 4HEA9 2CXEA 5KFIA 3RMDA 3NEKA 4CI0B 2CQCA 1VQ6N 4EUVA 2R3VA 3R3TA 2L41A 3QT7A 4X62F 3SPYA 1R8AA 2A42A 1O51A 4EHTA 1QLNA 3HP9A 4FJ5A 2AYEA 2BA9A 4ER8A 4ED1A 1DTQB 4LC9B 2KYXA 4OPJA 2H4YB 4DR2J 5AQZA 5D4PA 1T8EA 1VHXA 2E20A 3MMVA 4IH5A 2ASMA 3OR2A 1HYSB 3CM6A 1XMQF 1YUWA 5EY4A 4N8NA 1KVIA 1WTBA 4IFEA 3T5KA 4DV4F 1UPMB 4C9DA 2G2OA 1UOCA 4ZHRB 1L3SA 4RBVA 4RNMA 3G96A 1PCAA 2ZITA 5E3QA 4DR5K 2JWLA 4WF9Q 3ZT1A 1F6TA 2BJ7A 4N56A 3NGRA 2W9BA 4FDFA 5E0OA 1GTEA 5KG4A 3PFOA 4YOVA 4IBNA 3KUEA 1VSEA 2F3JA 3LGNA 1KONA 3HFZB 1MA9B 3TO8A 4KGVB 4RNNA 5KFNA 4LQ9A 2VPXB 3V9ZA 1T6CA 1WTFA 2OKQA 1TTHB 3ILIA 2XO6A 4H4KA 1FE4A 5DLFA 2FTRA 2YKNB 3ZNJ1 4PG5A 4KH1B 3B54A 4AHRA 4KFBA 3SUOA 4MIBA 4PWWA 1HIYA 2CJXB 2M2BA 2Z57B 4Y1DA 4AT1B 1GMUA 4IO9L 5GIOA 3TQEA 2FJWA 1EP4B 2AMCB 3MUVP 1TELA 4RO0A 4BR0A 4IDKB 4DCHA 4ICLA 2FF6A 1IG9A 1Q8KA 1VHFA 3QT6A 3THYB 5EU7A 3NGTA 4A8YA 4O4RA 4FVUA 3OL6A 5H9EK 3M6UA 3PX4A 1LK5A 4MTPA 3RAQA 5DQHA 4JI5K 4HACA 2E66A 4BRHA 2UXCK 4IQXA 3TA1A 3U7JA 4MT1A 4CGJA 2C22A 3KUHA 5K14A 2VKRA 3HK2A 1HR0K 3SFGA 4X65K 2HBJA 4DMNA 2RS2A 4AQYF 2Z2ZA 1TV6A 3DFEA 4WCEL 4WK3A 2HFOA 3LA0A 2Z30B 4ZVUB 4KV8B 3HHNB 4F36A 3AVJA 5EGYA 2FBVA 4R79A 4ZIWA 3PYGA 4DR7K 3KJVA 3FZLA 2XY6A 1X4FA 3PV8A 3NCIA 1KAZA 1LWEB 2HVEA 3GILA 2DPJA 3AVIA 7FDRA 3NGSA 4YY3K 1XNQF 1RTDB 2OP5A 1YJRA 4P75A 1TKZB 4TLQA 1X9WA 2CRLA 3W2VA 2JFDA 4N5SA 4K43A 3NXZA 1X4BA 2UUCK 1DLOB 3IC1A 3GIKA 3P49B 3NGYA 2ZJQQ 2P9UB 2D9PA 3THWA 3EVMA 2C42A 2OPQA 2ZC3A 3ICLA 3RMAA 2EI5A 3ENQA 2I6WA 1BQMA 4K59A 1TL4A 2NRVA 5KFTA 3J7YU 5HK4A 2CYYA 1G3OA 1RHRB 3KJNB 3W7BA 2RILA 3R5DA 1NJWA 4NXNF 1NDLA 3NVMA 1KVAA 3SMSA 1JCEA 3ZT3A 2DCLA 2ZWPA 4QYRA 1ZTWA 4QWCA 1SI9A 3UCZP 2WW4A 2GHPA 3W61A 5FPNA 1RHQB 4C8KA 4GO7X 3TJAA 4MFBB 3WX4A 1S1WB 3QBXA 3SSRA 3RGIA 4G1QB 3I5BA 4F3OA 3C6HA 2NXJA 4GV3A 1KLMB 4IG3A 2EFQA 4H8KA 3MWBA 2HFUA 2R4FA 5KFLA 5L1KA 1R0AA 4CIGA 2RUSA 4LF7K 4E1MA 4KB7A 2AJ4A 1NGEA 2B4OA 2YWKA 5KFAA 3AAQA 2MJNA 2NZCA 1RP5A 3SMZA 1AW0A 3WXLA 4GY2B 4CEDA 3CDBA 3FJ2A 2J6UA 2OH2A 1YJTA 2OA8A 2DO4A 3V2UC 4B1VA 2OIHA 2K8GA 3CUNA 2DH9A 4NZ7A 4F8RA 4BR9A 4HCBA 1RT7B 2Q43A 2QI2A 2XY8A 5D0GA 3TZZA 3RTVA 3THXB 4D3GA 3S8SA 3AB4B 5J2MA 3PIOQ 3BKTA 4LF2A 5LM7E 4AFFA 2B5JB 2NSBA 4WJBA 4QYZK 3EL2A 3C6AA 2ZZTA 4DJBA 3A8EA 1S10A 4K8XA 4ETXA 4DQRA 4I2PB 4I68A 1ITGA 5A6WA 2E2OA 1Y9OA 4ILMA 2V5HG 2HMIB 4QOTA 3BB5A 3VQ9A 3MEEB 1RGVA 4DHVA 4N8OA 3OYNA 3CIPA 4BDZA 2FSNA 2IVYA 4WFBL 5AJ3K 4Q2LA 2BDPA 1RTZA 3SSSA 1M1GA 4GC6A 3IMXA 1L5UA 3CIZA 2W6KA 3TARA 4J5OA 4BHQA 3BGRB 3RMCA 2BM0A 2VBZA 4CF1A 4A4JA 1KVBA 4B3TF 1MG7A 1IBKJ 4B9UA 2R8IA 1NWKA 2ZOMA 1VHIA 3O9TA 5J1EA 1C4CA 2A1SA 4UOFA 5FLXY 2XQCA 1ZBFA 2CQ1A 3DLKA 2EBGA 4U95A 3OFHA 3PEHA 1S1VA 2KRRA 2OTLN 4Z4EA 4HHUA 2YNFA 4H5WA 4O44B 1B7FA 3DHXA 2ATLA 2JEGA 2XI3A 3LUYA 3M2UA</