5CY4A

Crystal structure of an oligoribonuclease from acinetobacter baumannii
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
184
structure length
182
Chain Sequence
HMSSTLNTRLIWIDLEMTGLDTDNDQIIEIATIITDDHLNVLAEGPVLAIHQPDRILNAMDEWNTRQHGQSGLIERVRRSKLTARDAELQTLEFLKKWVNPKVSPMCGNSICQDRRFLHRLMPELEQYFHYRNLDVSTVKELSKRWRPEIMSGLKASHLAMDDIRDSISELKYYREYFFIMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Oligoribonuclease
publication title Crystal structure of an oligoribonuclease from Acinetobacter baumannii
rcsb
source organism Acinetobacter baumannii
total genus 65
structure length 182
sequence length 184
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.1.-.-:
pdb deposition date 2015-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00929 RNase_T Exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5cy4A00
3C94A 4AHUA 2HHQA 4IFVA 5C42A 4CE9A 2VG5A 2P5GA 3M8PA 1QSYA 3THVA 4KREA 1RDAA 4BE1A 3MEGA 4M3XA 5SWMA 4N41A 1RBRA 4FVMA 2VWJA 3HVRA 4IDKA 4FJXA 1NK5A 1NK9A 2YNGA 2XHBA 1UA0A 3U3YA 3K5LA 1A5VA 1N6QA 3V81A 1X9SA 3C95A 3RRGA 1ZBIA 2OPSA 4CHQA 3AA2A 2VWKA 4FM0A 2OPPA 3NBPA 1NJYA 1SL2A 4ELUA 3KIOA 1RBVA 2YHBA 1NJZA 3TAEA 3MXIA 4F3OA 4AHRA 4KTWA 1SV5A 1ASUA 4FLTA 4Z0UA 2EX3A 4J2DA 4CESA 2DFEA 3HPGA 3LZIA 3MAQA 3SPZA 3ZSQA 1U49A 3IAYA 2KW4A 1KLMA 3F9KA 5HROA 4I9QA 4CF2A 1EP4A 3DI6A 3ZSRA 3VA0A 4NYFA 1U45A 3MEEA 4O55A 4H8KA 4XIUA 3V9SA 2Y1IA 4IKFA 2E6MA 3E01A 1S6PA 4O0JA 3O3HA 1CXQA 1RBUA 1RTJA 1ZBUA 2YNHA 3K5NA 4DF4A 4M3WA 2Z1GA 4CJ3A 2KQ2A 5HP1A 2IS3A 2KTQA 3K2PA 1SL0A 3OYAA 2GV9A 2RN2A 1VK0A 4HUFA 3TWHA 1RTDA 3SUOA 4Z4HA 5EU7A 1BIUA 3HPOA 2W42A 5CYMA 4N5SA 3EYZA 5JS2A 4IBNA 1JLQA 1LWFA 3OJUA 1RNHA 3D0PA 4L8RB 3OYBA 2HB5A 1TGOA 4CJTA 4B9TA 2F8SA 3ZCMA 2FC0A 3OYIA 2EHGA 4KKOA 3DLRA 5HRNA 2YNIA 3OS2A 3KTQA 3VQ9A 1Q9XA 2HHTA 4DSLA 1ZYQA 4OKKA 3WNEA 4O5BA 5T7BA 3SQ0A 1QHTA 4ELTA 2ZD1A 3SPYA 1N5YA 2BDPA 3I0RA 4B8AB 2OA8A 3DRRA 4FLUA 4OJRA 4ICLA 4Y1DA 2G8FA 1A5XA 3MECA 2PYLA 3L2WA 1YTUA 4CECA 2HNYA 3KK3A 1CZ9A 2O4GA 3VQDA 3NF9A 3OY9A 4C8KA 3HK2A 3HSTB 2KFNA 4Z4EA 1SKSA 3OS0A 3DOKA 3MXJA 1NOZA 4B9NA 4FZZA 2P51A 3LP3A 4FK2A 3DLHA 1VSFA 2X78A 4RW6A 1JKHA 3VN5A 4CIGA 3K59A 1NKBA 5FDLA 1NKCA 4FJ9A 3KD5E 3CFRA 3A2FA 2FBVA 4DFJA 1GOBA 4FLZA 1S1XA 3SV4A 4M3TA 4Z4CA 1VSEA 2OZSA 3K57A 3PV8A 3PX0A 4AH9A 5C24A 1T05A 4KHNA 3QNNA 3QEWA 4DTUA 4M3YA 1C6VA 2X6NA 4CGDA 4DLEA 2G8IA 3NGYA 1XHZA 3WNGA 3LDSA 1RT6A 3VQ8A 4TSXA 5I3UA 4ID1A 3CFOA 4C8MA 1TKZA 1JLAA 3CFPA 3L2VA 1U4BA 1NK7A 4CHZA 4DTOA 2XY6A 1TKTA 4AHVA 4DSIA 3B6OA 2IGIA 3TAMA 2G8WA 1K6YA 1IKVA 2G8HA 1IO2A 3K5MA 3HYFA 1TAQA 1XHXA 1I39A 4PUOA 4CIFA 2QKBA 5JS1A 1D5AA 3BGRA 5HRPA 4CGFA 1TK5A 1HYSA 1TKDA 1NK6A 3PX6A 4WE1A 1D9FA 4FJ8A 4B08A 4FJHA 4DFPA 4J2AA 1WLJA 3DOLA 3IS9A 1JLFA 5KGWA 1KFSA 4DQPA 2G8UA 2FBTA 3LAKA 4CJ5A 4G1QA 4JS5A 1NOYA 3HP9A 4QOZB 4AHCA 4DQIA 4CHNA 4DFKA 1J9AA 4RW4A 3ZT3A 1TL1A 4FCYA 5CZ2A 4CHOA 4JS4A 2ETJA 4DFMA 3KD1E 1QQCA 5HRRA 2HHVA 4OPKA 5FRMA 2F96A 3RMCA 3HP6A 5HRSA 2XY7A 4QAGA 1RT3A 1LAVA 1HNIA 3V1QA 4BE2A 1XI1A 4CFCA 4M3RA 1IKWA 1L3UA 4O4GA 4CFBA 4N76A 3SI6A 4OKEA 2ZQBA 4ZHRA 1XC9A 2DY4A 3LP0A 2FBXA 3JYTA 4K8XA 4KB0A 3SQ4A 4FM1A 3RR7A 3SUPA 3ZT4A 4W5RA 1FK9A 4BDYA 4KTQA 4BDPA 3HVTA 3NCIA 4NCGA 4F3TA 3QIOA 2HHWA 4FM2A 3HT3A 1C1CA 4LY7A 1C0TA 4J2EA 4E1MA 3RR8A 3AVLA 4GVMA 4OKJA 3FFIA 1EKEA 3AVGA 2VG7A 1SL1A 4KB1A 2D5RA 1U47A 1WSIA 1BL3A 3G10A 3V9XA 4MFBA 4DU1A 4DTNA 3V4IA 1T7PA 2IC3A 3UIQA 3SUNA 1RILA 3DRPA 1IKXA 3OYLA 1RT1A 4R5PA 1SKWA 4NYNA 3OYEA 4M3UA 2BGGA 3O3FA 1VSDA 2LSNA 4RW8A 1T03A 4FJMA 3AVJA 3SZ2A 2Y1JA 3NE6A 2IAJA 4KTZA 3NF8A 4W5TA 3NGIA 4Y1CA 4DU4A 1TK0A 1RTHA 2JGUA 4DWIA 3KJVA 3KK1A 4M3ZA 1RT5A 4I2PA 4PA1A 2YHAA 5KI6A 2YKMA 2QKKA 2A1SA 2D0AA 4CGGA 4CHYA 4H4MA 2ZE2A 1TV6A 3NF6A 3AVAA 1VRTA 1G15A 3ZSYA 3TARA 2HHXA 5HLFA 1J54A 1B92A 2RPIA 2BANA 3AO5A 5KTQA 1D9DA 3SJJA 1X1PA 4QCLA 1WSHA 4IG3A 1QSLA 3JSMA 1ZBHA 3LP1A 3LALA 4CERA 3TI0A 3AA4A 1JL1A 2I5JA 2WONA 3AA5X 4DSKA 4CJLA 1REVA 4KHWA 5DMRA 1VSJA 4GW6A 4F2SA 4DTSA 3WNFA 5D3GA 1U48A 1L5UA 5SZTA 1GOCA 3ASMA 3IRXA 2A1RA 3OYMA 1WSFA 4B3OA 4DSFA 3RMDA 1UA1A 2P5OA 1EX4A 2HNDA 4I7FA 4CJFA 4UQGA 1JLEA 4CGHA 1YT3A 2D0CA 4CHPA 3VQ7A 3ZT0A 3PUFA 4E7LA 2Z1JA 1L3TA 4LH5A 3HPHA 4HCBA 2DFFA 1RDDA 4CEZA 5CYQA 4HVJA 1JLCA 1KLNA 3DLBA 3M8SA 3OVNA 3VQEA 5C25A 1NK0A 1SKRA 4FJ5A 1YTAA 1IKYA 1D8YA 1QSSA 2HW3A 4JRQA 2OPRA 3NFAA 3DLGA 1KCFA 3NH1A 3VQAA 2QXFA 1WSEA 4BWMA 3OYNA 4FJNA 2E4LA 3B6PA 4M42A 3LP2A 4FJ7A 3NHGA 1Y97A 4CJUA 3G0ZA 4FJKA 1FKPA 3L3VA 3V1OA 3VQ5A 4CEDA 3OS1A 3HXMA 2OYQA 3DRSA 4CK2A 1BHLA 1KRPA 4LSLA 3V9ZA 1FXXA 4KHUA 4E1NA 4ID5A 4BACA 3SCXA 3VQCA 3DMJA 3ISNC 3ZSWA 3KLFA 1HNVA 3ZSZA 3OJSA 3KLEA 3OYFA 4FK0A 5K14A 3ZSXA 3NH2A 1TKXA 2VG6A 4RG8A 4E7JA 3S9HA 3CYMA 2JLEA 1T8EA 1X9WA 4FK4A 1BQMA 1Z25A 4E7KA 1C0MA 4CF9A 3S3MA 4FJGA 1RDCA 5J2QA 4N56A 3QEVA 1C1BA 1RBTA 1NKEA 1S1VA 4HCCA 4W5OA 1DLOA 4KAZA 3NF7A 3LPTA 3L3UA 4EP5A 4CFDA 2F8TA 1GOAA 4FLVA 3V6DA 2XY5A 1BCMA 4F2RA 4DSEA 4OLBA 4LSNA 3SQ1A 3SV3A 4DTPA 4NCAA 4EZ6A 1CLQA 2KFZA 2RKIA 4O0IA 1HYVA 2BE2A 3VA3A 3TAGA 3T19A 1TVRA 4DG1A 3LWLA 1UWBA 1KFDA 3I8DA 4DF8A 1O1WA 3C6TA 3QESA 1ZBFA 2HHUA 4E7IA 4FXDA 3ZSOA 4FLWA 3QIPA 1KSPA 1JLBA 4HTUA 4PWDA 3M8QA 1S9GA 2P1JA 1BCOA 3KKRA 3TANA 4JLHA 4ZTJA 3TR8A 1TAUA 3WNHA 1WAJA 4AHSA 4JRPA 4DS4A 4DQSA 1R0AA 1RBSA 1NK8A 3O4NA 2HVIA 2KZZA 3CG7A 1UAXA 4HHTA 3K5OA 4DU3A 1VSKA 2GBZA 1KVBA 4PY5A 1VSIA 3TAFA 1CZBA 1B9FA 3ULDA 2D0BA 3PO4A 4GMJB 4CCHA 1MU2A 1LAWA 2AJQA 3VQPA 1NK4A 3LPUA 1BGXT 4OGCA 4KFBA 4I2QA 1B9DA 1YVUA 3QERA 3K58A 1BI4B 2XRIA 2HNZA 3SUQA 3IG1A 1LV5A 1Z26A 4EZ9A 4KHYA 4OGEA 3VQQA 3RWUA 4DTMA 3EY1A 4FZYA 3CM5A 2YV0X 4M45A 4B9VA 4CJPA 2XO7A 4CF8A 1NJXA 2ITGA 4CJWA 1HPZA 3QEPA 1BI4A 3ALYA 4CEFA 1WAFA 4FLYA 1WSGA 4MQ3A 3HL8A 1EETA 1Q9YA 4Q0BA 4CJEA 3HJFA 1CXUA 3AA3A 3NDKA 3AVNA 1HYZA 2PYJA 3AVBA 1S1WA 4Z4IA 3HO1A 3CM6A 1A5WA 4Z4GA 2HVHA 1LW0A 1RCHA 2PZSA 4KI4A 1ITGA 4FW1A 1ASVA 1JLGA 3AVMA 1C0UA 1QS4A 2PY5A 3QETA 3F73A 4RW9A 1W9HA 3ITHA 5FROA 4HUEA 4DTXA 4AHTA 5KRSA 1WNSA 3AO4A 3AVFA 1LW2A 1RT2A 1L3SA 4KI6A 3DM2A 4LD0A 2B4JA 2R7YA 3H08A 5CY4A 1I3AA 3LZJA 3T3FA 1KVCA 4DMNA 4PQUA 3P1GA 2HHSA 1IG9A 1S6QA 5FRNA 3AO2A 3TAPA 4CEBA 4IG0A 4CF0A 1TK8A 4B9MA 4DTJA 3SYZA 4FJJA 4N47A 5KGXA 4DQRA 2YKNA 1KTQA 2OPQA 3QEXA 1DTQA 1X9MA 3OYKA 4F8RA 3P5JA 3DLEA 3KKSA 3V1RA 2B5JA 3QNOA 3HM9A 4E7HA 4E89A 4K8ZA 1S5JA 1JXBA 3C6UA 3NGZA 1L3VA 1KVAA 1HRHA 1TL3A 3QLHA 3NH0A 4CFAA 4DQQA 2Z1HA 4H4OA 4CGJA 3CQ8A 3I0SA 4E0DA 1RDBA 4F4KA 1LWCA 4LH4A 1BISA 5KRTA 4CGIA 4KO0A 3TABA 3L2UA 1BQNA 3D45A 4B8CA 3P83D 5E41A 4OPJA 3V9UA 3LWMA 4RW7A 1QE1A 2XY8A 4W5QA 4KPYA 4BWJA 2E6LA 3V9WA 3TAQA 1ZBLA 4B9SA 4OLAA 4HUGA 3ZSVA 1HQUA 4YFUA 1LWEA 1S9EA 3VQ6A 3OYGA 4KRFA 1HJRA 2RF2A 3AO1A 4OVLA 4CJKA 3KLHA 3U6FA 3PX4A 3O4QA 3OYHA 5J2NA 3QO9A 4CF1A 5J2PA 3KK2A 4FJIA 1C1AA 1JXEA 3AVIA 2O4IA 4CEQA 3OYCA 4W5NA 2FBYA 4IFYA 3NAEA 4CJRA 4KHSA 3OYJA 1IH7A 3QINA 3VQ4A 4BE0A 4KV8A 3RTVA 1RT7A 1HMVA 3AVHA 3ZT1A 3PO5A 2KZMA 3QEIA 2WOMA 3AVKA 4ZTFA 4CJ4A 4O44A 1DTTA 4J2BA 2Q3SA 2X74A 1U04A 3RRHA 1VRUA 2G8VA 4B9LA 1J53A 5J1EA 4E19A 2HMIA 3LAMA 4CK3A 1QTMA 4DSJA 4CEAA 1EXQA 1XWLA 2Z1IA 2ATQA 4FW2A 3EZ5A 3BDPA 3S3OA 4CJSA 3S3NA 1FKOA 4CIEA 3M8RA 4BDZA 1VSHA 4C8NA 4CEOA 4FYDA 4M41A 1NJWA 3SQ2A 1RTIA 3AO3A 2DTUA 4CJVA 4YNQA 2GUIA 3U3GA 4Q5VA 1ASWA 4ELVA 1SUQA 2G8KA 3SNNA 1UOCA 4I9LA 3LANA 1F21A 3L2QA 1Q8IA 3DYAA 3T1AA 4E3SA 4DTRA 2DFHA 3KLGA 1VSMA 4AILC 3MXMA 4KHQA 3L8BA 3O3GA 4NCBA 3AV9A 1W0HA 1VSLA 2X6SA 3MEDA 3ZT2A 1BIZA 1HQEA 2OZMA 5DK5A 5I42A 1J5OA 4CEEA 2B6AA 5J2MA 3L2RA 4DLGA 3RMBA 5HBMA 1WSJA 4Z4FA 1S1UA 2IOCA 3AVCA 3KLIA 3RMAA 3PY8A 2YNFA 4CJQA 3DLKA 3OYDA 4C8LA 2NUBA 3VQBA 1S1TA 4FLXA 2IDOA 4CK1A 4B9UA 5CZ1A 1WN7A 1JL2A 4EP4A 1RT4A 4C8OA 4DS5A 4FZXC 2QK9A 4FJLA
chains in the Genus database with same CATH superfamily
4PL7A 4IFVA 4AF1A 5C42A 3LDOA 4LF7K 1QSYA 2QA4N 4KREA 1MA9B 4M3XA 5SWMA 4N41A 1RBRA 4FVMA 1QQMA 3THXB 4FJXA 1UA0A 2W6LA 4IDHA 3U3YA 3RRGA 1V4TA 3C95A 5EXWA 2GEMA 5DM7L 2OPSA 1LCUA 2VWKA 2OPPA 1TUYA 3KIOA 1NJZA 1T6CA 4AHRA 3THXA 3HTVA 3HPGA 5BPMA 3FR0A 3MAQA 3SPZA 3ZSQA 4U7BA 4JHDB 2KW4A 3IAYA 3UKRB 3MEEA 4O55A 4MDAA 3CI5A 1CXQA 1XQSC 4JHDA 4F9OA 2HF3A 3UKRA 3MWTA 5JS2A 2V51B 4IBNA 3OJUA 1NGCA 4L8RB 2HB5A 2F8SA 4NXNK 3ZCMA 3KTQA 3OS2A 1V4SA 3SQ0A 3S41A 2Q0UA 1QHTA 2ZD1A 3U9DA 3SPYA 1N5YA 3I0RA 1RDWX 4LF4K 3K9JA 4Y1DA 5AQOA 4KH5A 3MECA 2PYLA 2E5LK 1GLEG 3I33A 3R6MA 1CZ9A 3TTDA 4C8KA 4NLBA 3GL1A 1SKSA 3AAPA 1NOZA 1XUPO 3O8MA 3LP3A 3CCSN 2X78A 5AJ3K 1NKCA 4FJ9A 4YOTA 3KD5E 4HTLA 3I56N 2FBVA 3SV4A 2OZSA 1VSEA 4AH9A 3CMEN 4JI3K 1GLAG 3CERA 1C6VA 1GLDG 2E1YA 5I3UA 1QZ6A 4ID1A 5GAHP 4C8MA 3FZKA 1C0GA 2XY6A 3MCPA 2HF4A 1Z05A 1NMDA 3CF5L 5AQHA 4PUOA 1TAQA 1XHXA 1I39A 4O8KA 4CIFA 4JKEA 3BGRA 4CGFA 5H1SQ 4FJHA 3DOLA 3IS9A 1KFSA 2D0OA 1ESVA 3JXUA 1YIJN 3H6EA 3O4WA 4BRFA 4YDUC 4FWSA 1NLVA 5CZ2A 3E1YA 3BF3A 3MX2A 2HHVA 5FRMA 3L0QA 3WQUA 1HR0K 2Q2RA 4LF9K 4B1ZA 3Q7BA 1RT3A 1HNIA 4M3RA 4FWMA 4O4GA 4CFBA 1HJOA 1QVFM 2ZQBA 2DY4A 3LP0A 4H0OA 1EO1A 3SQ4A 2QI2A 1FK9A 5ELZA 4DV3K 4JV5K 2NNWA 3CETA 4WFAL 3QIOA 4JN4A 2HHWA 1NBWA 4LY7A 1C0TA 4E1MA 4GVMA 3U9ZA 1Q81O 5AQKA 3FFIA 3SBTA 3VF2A 1WSIA 1BL3A 3V9XA 4GKKK 3UIQA 2J4RA 1IKXA 4H5WA 2E88A 2Q97A 3OYEA 2VQEK 1HX1A 1VSDA 3SAGA 3NE6A 4W5TA 3NGIA 2JGUA 4DWIA 4M3ZA 4DV1K 2YHAA 2YKMA 4WFBL 1VQLN 3SAFA 4QS7A 4CHYA 4ISFA 4ISEA 3AVAA 3VEWA 3ZSYA 2HHXA 1NGFA 3DWLA 5KTQA 1X1PA 1WSHA 4CBUA 1ZBHA 3JSMA 1VQNN 3MDQA 2A42A 3WXMB 3AA4A 3TI0A 1M1KO 1REVA 5DMRA 4ISGA 4F2SA 3H1QA 1H1VA 1U48A 1NNEA 2A1RA 1ATSA 3QFPA 4DR3K 4CJFA 3CD6N 1YT3A 2DPNA 3ZT0A 1J5EK 4E7LA 3G71N 2OTJN 5CYQA 1KLNA 4FJ5A 1SKRA 4DV2K 3DLLL 3MN6A 1HNXK 2HW3A 2OPRA 3NFAA 3CC2N 1WSEA 2E4LA 3LP2A 2FSKA 1FKPA 3V1OA 3O9SA 3VQ5A 3DRSA 4BQZA 4CK2A 1FXXA 3CCRN 4E1NA 4ID5A 3M3ZA 3DMJA 3ISNC 3KLFA 4FK0A 3ZSXA 3S9HA 1TKXA 2VG6A 4RG8A 5GIOA 4E7JA 3CYMA 1X9WA 1BQMA 1NKEA 5AZIB 4DHYA 2UU9K 4CFDA 5JVGL 3UKUB 4DSEA 4OLBA 4LSNA 5DM6L 3P38A 5AZIA 2QEXN 1NGEA 4EZ6A 1HYVA 1T6DA 3UKUA 1TVRA 4DF8A 1VQON 1O1WA 3CCQN 1Q86O 4FLWA 1QVGM 1S9GA 2P1JA 4JLHA 1M90O 3VERA 3WNHA 4AHSA 4DQSA 1SS6A 4DV5K 3CG7A 1UAXA 3J80O 3HSCA 3K5OA 2GBZA 3OBWA 1KVBA 4NB4A 4B1XB 3PO4A 1MU2A 5AFUH 3LPUA 1BGXT 4OGCA 4I2QA 4BGBA 1U2VB 2Q0RA 4YOWA 3K58A 3CMAN 3SUQA 3IG1A 1LV5A 4DTMA 1K8KB 4WQ4A 4K41A 4M45A 2A3ZA 4B9QA 4FL9A 2XO7A 4A61A 1HPZA 1U2VA 3QEPA 4MQ3A 3HL8A 5AQPA 1Q9YA 4Q0BA 1K8KA 1BO5O 3AVBA 1S1WA 3VENA 4Z4GA 4BRIA 2A5XA 3B8AX 3IKMA 3SK3A 2PY5A 3QETA 1KXPA 3AVFA 3AO4A 3A5MC 2Q31A 1L3SA 2E20A 3ZLJA 2R7YA 3H08A 3QBXA 3H1VX 4IG0A 4FSVA 4M63C 4FJJA 4GV3A 4N47A 3QEXA 4A5AA 2CGKA 3KKSA 2UUBK 3HM9A 5AFUA 4K8ZA 1JXBA 3C6UA 1L3VA 1KVAA 1XNRK 4JKBA 4H4OA 3CQ8A 4E0DA 1RDBA 1IJJA 1LWCA 4LH4A 1BQNA 4X66K 3O9QA 2XY8A 4BWJA 3V9WA 1ZBLA 3WXLA 4HUGA 5AQGA 3OYGA 4CJKA 3AO1A 3KLHA 3PX4A 3U6FA 1HLUA 3O4QA 3WT0A 3W0LA 4MLEA 5GIPA 4PL8A 4CEQA 4CJRA 3E9PA 3QINA 3RTVA 1HMVA 3AVHA 2WOMA 4G9ZA 4ZTFA 1HUXA 1U04A 4E19A 3LAMA 4DSJA 5AQNA 1XWLA 2WTUA 2ATQA 1BDGA 3NMUA 3VEVA 1FKOA 4CIEA 4M41A 3SQ2A 1VQ8N 3VOVA 2GUIA 3SNNA 1UOCA 4DTRA 1KAXA 2UYTA 2KLAA 5LJVA 1W0HA 1VSLA 2IVOA 3ZT2A 3H46O 5J2MA 2NRVA 3L2RA 4DLGA 2HBLA 4GNIA 1NGBA 3OYDA 3EKUA 4FLXA 1WN7A 4DV4K 3CCJN 5E26A 2VG5A 2P5GA 3M8PA 3KWGA 3SMSA 1WOQA 4Y0WA 2VWJA 5BRDA 4CZLA 4YHHK 3CJBA 5C0YA 1RDUA 1N6QA 3K5LA 1A5VA 5AQZA 3V81A 1ZBIA 4HWIA 4CHQA 4ELUA 3ZX3A 2YJFA 3TAEA 3MXIA 4FLTA 3TSPA 4J2DA 4BGAA 1XC3A 5AQUA 1U49A 1ATRA 1EP4A 3ZSRA 4CZKA 2Y1IA 1VQ7N 4IKFA 5FPMA 3EE9A 4O0JA 4YOYA 1ZBUA 3K5NA 3KZBA 4M3WA 2KQ2A 4FO0A 2KTQA 3K2PA 3OYAA 3FZLA 2GV9A 4YY3K 4HUFA 3TWHA 3CCLN 4Z4HA 1BIUA 5AQJA 3HPOA 2W42A 5CYMA 1JLQA 3F2KA 1RNHA 3L4IA 3NVMA 2JWKA 2I7PA 4XEIA 4B9TA 4CVNE 4CZFA 5HRNA 1SAZA 3G4SN 1GLLO 3E9OA 5T7BA 1FW6A 4IOAL 4OJRA 4BR7A 4QS8A 4JKCA 1YTUA 4CECA 3KK3A 2NLXA 3NF9A 2KFNA 3FFKB 5ADXA 4DR4K 3DOKA 4IJNA 4CZGA 2OCEA 4B1VA 1JKHA 1BU6O 3CFRA 3PIOL 4FLZA 4X62K 3CCUN 3K57A 3MN7A 5LMUK 4L3QA 1T05A 3QNNA 3T69A 2X6NA 4CGDA 1XHZA 3WNGA 1RT6A 3VQ8A 1YI2N 2D1KA 3M5RA 4NLCA 3CFPA 3L2VA 4IFEA 3LDNA 1SZ2A 1IV0A 1X9JA 2G8WA 1K6YA 5FPEA 1IO2A 3K5MA 3HYFA 1D5AA 3VMFB 1NK6A 1D9FA 4B08A 1HNWK 1N33K 4CJ5A 3CC7N 3O1WA 4DQIA 3C0BA 1J9AA 1XNQK 4DV7K 1TL1A 3EE8A 4FCYA 1NGJA 4JS4A 1X3MA 5AQRA 5F1XA 2E2NA 3SAHA 4OPKA 3T1YK 3RMCA 4QAGA 1LAVA 1IKWA 3DXMB 4OKEA 1EQYA 3SJHA 3P39A 4K8XA 4PKIA 5CHIA 3VEOA 4W5RA 4KTQA 1OH6A 3NCIA 4NCGA 4F3TA 3DXMA 1NMNA 4FWNA 1NJIO 1EKEA 3CPWM 3AGRA 1SL1A 4JI6K 4LC9B 2HBJA 1U47A 3G10A 3WEEB 3V4IA 3OYLA 1YITN 2BGGA 3O5BA 1T03A 2YJEA 3NF8A 3WEEA 4Y1CA 3VGMA 4BR9A 3KK1A 1RT5A 4I2PA 4PA1A 2D0AA 4CGGA 4H4MA 3ZETB 1G15A 4IWVA 1J54A 1B92A 2BTFA 3FGUA 1KQSM 1VQ4N 3GDQA 4DSKA 3AA5X 4KHWA 3ZETA 2ZJQL 5D3GA 3LL3A 3C6HA 3ZEUB 2WUSA 3O80A 3TSUA 4B3OA 4EIAA 1UA1A 1EX4A 4I7FA 3CCVN 4CGHA 2FXUA 3W3DA 3ZEUA 4H0VB 3PUFA 3R8EA 1L3TA 4OX9K 4LH5A 3GBTA 2GTDA 3HPHA 3EO3A 2DFFA 4DKWA 4HVJA 1JLCA 3M8SA 3OVNA 3O1BA 3VQEA 5C25A 1NK0A 2ZF5O 2O8EB 4DR2K 1IKYA 3FE1A 1QSSA 1D8YA 3QB0A 1HKGA 2UUCK 4JI4K 1DGKN 2QW9A 4JD2B 3DLGA 1KCFA 3C65A 3NH1A 3VQAA 2RE2A 4BWMA 3NHGA 5FLXO 3G0ZA 4FJKA 3OS1A 3L3VA 4CEDA 2O8EA 2OYQA 3UE5A 1BHLA 5HOOA 4LSLA 4JD2A 3ID8A 4BACA 2VCPA 3SCXA 3ZSWA 1HNVA 3U4LA 1MWMA 3OJSA 3KLEA 3OYFA 1Z25A 1RDCA 5J2QA 4N56A 1C1BA 3CJAA 1DLOA 5BN9A 4DUZK 4EP5A 4IEIA 4DCHA 2F8TA 4U67L 3U8XA 2XY5A 1BCMA 3AGKA 3SQ1A 5AQVA 4NCAA 3ATVA 4BG8A 4KH6A 5C10A 2BE2A 2YI1A 3T19A 5AQLA 1UWBA 3I8DA 2OTLN 2AA4A 2HHUA 1ZBFA 1KSPA 2HBKA 2EWSA 5GADP 1S3XA 1BCOA 1TAUA 1WAJA 4DS4A 4JRPA 1RBSA 3MN5A 4HHTA 3SBGA 5JICA 1CZBA 2D0BA 4FOIA 2HBMA 3NVKA 1B9DA 4OPAA 3VESA 1Z26A 4EZ9A 4KHYA 3T7ZA 4K0KK 4JKGB 2YV0X 4WCEL 3QICA 1MDUB 4B9VA 4CJPA 3E9LA 3ALYA 4CEFA 1WAFA 3LM9A 4CJEA 1CXUA 3AA3A 4JKGA 3NDKA 3AVNA 2PYJA 1JCEA 2PZSA 4KI4A 1ITGA 4FW1A 1E3MA 1QS4A 1ZBSA 2GX9A 4AHTA 2YCHA 1GLCG 2VGMA 1RT2A 2CH6A 2B4JA 3ENBA 1NGDA 4CD1A 2IVNA 4PQUA 2HHSA 5FRNA 3AO2A 4BC5A 5KGXA 4DQRA 2YKNA 2OPQA 4XH4A 3CIPA 1DTQA 3OYKA 4BRMA 5LY3A 3QNOA 1D4XA 4E89A 3UB5A 1S5JA 4E7HA 3NGZA 1VAZA 3J8AA 2NRXA 3QLHA 4CFAA 4DQQA 2Z1HA 3OW2M 4BR4A 5KRTA 1BISA 3TABA 3L2UA 4FWLA 3D45A 4CI6A 5E41A 3LWMA 1QE1A 4W5QA 2NRWA 4LF6K 2RF2A 2QTDA 1P8ZA 2AP1A 5TKYA 2O8FB 3KK2A 1C1AA 2O4IA 3OYCA 2FBYA 4X65K 4H0YB 4JI1K 1VQ6N 3VQ4A 4BE0A 3PO5A 2KZMA 2O8FA 4WQ4C 2W6KA 3RSEB 3FLCO 4A59A 3RRHA 4B9LA 4DB3A 1J53A 5J1EA 2HMIA 1O13A 3VGKA 3EL2A 4FWRA 3CHWA 2Z1IA 1W2BM 4FW2A 3WQTA 1W97L 3RSEA 4CJSA 3M8RA 1LOTB 5GINA 4CEOA 4DR7K 4AM6A 1NG9A 4CJVA 4LFCK 4Q5VA 1ASWA 1SUQA 2V7YA 3OBYA 5JLFA 2G8KA 3A8YA 3L2QA 1VSMA 3L8BA 4H0TB 3AV9A 1BIZA 1HQEA 1QQOA 5I42A 3TSQA 2B6AA 3Q7CA 4Z4FA 1S1UA 2IOCA 3RMAA 2YNFA 4CJQA 3DLKA 4B9UA 2IDOA 3VEZA 4C8OA 1JL2A 4EP4A 1RT4A 3VTIA 4GV6A 3C6AA 1K73O 4AHUA 2HHQA 5TKWA 3A5OC 3THVA 4BE1A 4B3MK 4IDKA 4ILGB 5E84A 4A5BA 1NK5A 1NGAA 3M1FA 5EY4A 2XHBA 4IOCL 1X9SA 3AA2A 1NJYA 1SL2A 3O6WA 4OPHA 3RVCA 2YHBA 3AAQA 2KHOA 1SV5A 2F9WA 4GY2B 3IFRA 3CJCA 4JKFA 1KLMA 3K0SA 5HROA 2ZWHA 2D0PA 3VA0A 3V9SA 4H8KA 4IJAA 3R1XA 3P31A 2YNHA 4DF4A 1OKJA 3TPQA 4CJ3A 5HP1A 3D6RA 1SL0A 3O9TA 4JEPA 1VK0A 1RTDA 3SUOA 2P9KB 4PKHA 4N5SA 1LWFA 3OYBA 4Z94A 1TGOA 4V19S 2FC0A 4JK8A 1FJGK 2EHGA 3DLRA 2WC9A 2YNIA 2P9KA 3TU5A 4MO5A 4RCHA 1ZYQA 1BOTO 4O5BA 5IT9O 4ELTA 2BDPA 2OA8A 3H45C 4B8AB 3F5TA 4FLUA 1KC8O 1VQ5N 4JKDA 2ZGYA 3GE1A 3L2WA 5LMNK 3VETA 4JI2K 3OY9A 3VQDA 3HK2A 1Q82O 4CBXA 4B9NA 4FZZA 3DLHA 1VSFA 4RW6A 3K59A 1NKBA 4CIGA 5FDLA 3TTCA 4CZIA 5A2QO 3H3OB 4DTUA 4CZEA 4DLEA 3VEXA 3NGYA 3LDSA 4TSXA 2KKZA 3CFOA 1TKZA 4DTOA 1U6ZA 1WBBA 1TKTA 4DSIA 1RFQA 2IGIA 3TAMA 3VF6A 1IKVA 4H5RA 4BR2A 2G8HA 4H0XB 5JS1A 2QKBA 3MN9A 3O9UA 3VGLA 1TK5A 1HYSA 4B3SK 4WE1A 5KGWA 2I7NA 4BVPA 3C7NB 1Z6RA 2FBTA 4BQLA 1N34K 4KHPK 1NOYA 4JS5A 3HP9A 1T3VA 1I94K 1MWKA 3ZT3A 4FWOA 2HSTA 3D7EO 2E2OA 4CHOA 1IBMK 1JCFA 2ETJA 3C7NA 4MO4A 1X3NA 3HP6A 5HRSA 3QFUA 1QQNA 4BE2A 3CXCM 5KQDA 2HOEA 4FWQA 1WBDA 2UXDK 1BG3A 2VQFK 2HHHK 4N76A 4ZHRA 1XC9A 4B1YB 2FBXA 3JYTA 3VF4A 3RR7A 3ZT4A 4BDYA 4PKGA 5BR9A 4X64K 4FM2A 3HT3A 2VWBA 3RR8A 2F4VK 4WQ5A 2QXLA 4YOVA 3AVGA 2VG7A 4UY8O 4KB1A 2D5RA 4DTNA 4DU1A 3BY5A 2IC3A 3SUNA 1RILA 3DRPA 5EOYA 1EWRA 1RT1A 1KAYA 4JI0K 2PAVA 5B8HA 3O3FA 4RW8A 5M1NA 3AVJA 2Y1JA 2IAJA 3DJCA 2UXBK 3KJVA 3LM2A 4AM7A 3G25A 1EWQA 3BEXA 1QHAA 4EFHA 2QKKA 2ZE2A 3TARA 1HKCA 4JAXA 2RPIA 4EHTA 1RGIA 2BANA 3CCMN 5KQ8A 4IG3A 1QSLA 3LP1A 3LALA 4CERA 2GWKA 4JYAK 4GW6A 2ITMA 4DTSA 4BVOA 4B3TK 1GOCA 3ASMA 4A57A 2VGNA 1NGHA 4H5NA 2Q36A 1WSFA 4JKAA 4DSFA 3RMDA 2HNDA 1JLEA 4YOUA 3FZFA 4H0PA 3VQ7A 3QDKA 2E2PA 2QWRA 1YHQN 3HOSA 3M6GA 4CEZA 5JLHA 3DLBA 4JK7A 2KFZA 3J7ZO 1E4GT 1YTAA 2QWQA 3H3NO 3R3LA 4PHTX 3N4QA 4YORA 2GUPA 2NZTA 2QXFA 3OYNA 4FJNA 4M42A 4FJ7A 1Y97A 4CJUA 4DUYK 1KRPA 1N32K 2CGJA 3VQCA 5K14A 1T8EA 3T1HK 2UUAK 4FK4A 1C0MA 3S3MA 5C12A 1S1VA 2YX6A 4KAZA 3NF7A 3L3UA 4RWTA 5FPDA 4FLVA 1IBLK 2GWJA 1R59O 2BH1A 3SV3A 4IXCA 4GV9A 2RKIA 3MWPA 3JAMO 4O0IA 3WXJA 3KK7A 4DG1A 3LWLA 3G6EN 1DT9A 4E7IA 3QIPA 3FZHA 1JLBA 5C15A 4HTUA 4PWDA 4FPBA 3TR8A 5AQYA 4H5VA 1NK8A 2KZZA 3TAFA 1B9FA 4CCHA 1LAWA 3VQPA 4CZMA 5GAEP 5MLCQ 1S22A 1YVUA 2V7ZA 1BI4B 3VQQA 3RWUA 3EY1A 4FZYA 3CPEA 4CF8A 1OVYA 1GLBG 1NU0A 5M1FA 3J7AP 1BI4A 3L4QA 4JI8K 4FLYA 1WSGA 1NWKA 3HJFA 1ATNA 5AR0A 2P9NB 4BC4A 3HO1A 3CM6A 1IG8A 1A5WA 2HVHA 3OA9A 1LW0A 4LF8K 1C0UA 3HI0A 3F73A 4RW9A 1W9HA 2P9NA 3L6QA 1YF5L 5AQSA 2F9TA 1LW2A 2QWLA 4A2AA 3DM2A 1HKBA 3R9PA 3WUHA 1I3AA 3T3FA 1KVCA 4DMNA 1IG9A 1S6QA 4WFNL 4CEBA 1S72N 1T44A 1X9MA 4BC3A 3P5JA 4F8RA 5GAGP 2A41A 2CGLA 3V1RA 4CW7B 4DR1K 3O9RA 3GOIA 1TL3A 3NH0A 3ZYYX 1K9MO 5BR8K 4CGJA 4F4KA 2E2QA 4CGIA 4KO0A 5C2FA 1K8AO 4B3RK 5AQFA 4LFBK 1C0FA 5I9EB 3SMPA 4BY9C 2E6LA 2P9PB 4OLAA 1HQUA 3VQ6A 2E8AA 4KRFA 3K9KA 3CJ9A 3OYHA 5JMVA 5J2NA 1WB9A 3QO9A 5J2PA 4FJIA 3HM8A 4BRNA 2P9PA 4EAHD 1IBKK 4W5NA 4KHSA 3NAEA 3AARA 3OYJA 1IH7A 1RT7A 2FSNA 3ZT1A 3QEIA 2Q1NA 4CJ4A 4O44A 1YJWN 4J2BA 2X74A 5FPNA 3ULEB 1VRUA 4NO7A 1OH7A 1QTMA 4IO8A 4CEAA 1EXQA 2O8CB 3BDPA 3S3NA 4FWPA 4BDZA 4BG9A 1VSHA 5AQXA 4C8NA 4FYDA 1NJWA 2DTUA 3ULEA 4YNQA 4ELVA 3U3GA 5AQQA 3MCAB 2O8CA 4HCCA 1Q8IA 2BUPA 3T1AA 4A2BA 3KLGA 4AILC 3MXMA 4KHQA 3O3GA 4NCBA 3BUZB 3TTFA 3PSFA 4CZHA 4CEEA 1TYQB 3ZX2A 3IMXA 3RMBA 5HBMA 1WSJA 4IO9L 3AVCA 3KLIA 3CJ7A 1VHXA 2NUBA 3VQBA 1S1TA 4JNEA 1JCGA 4FZXC 5CZ1A 4BRHA 4RTFD 4DR6K 1DKGD 1TYQA 4FJLA 3C94A 2YHWA 4CE9A 2F7TA 3BZKA 1RDAA 3MEGA 3D2FB 5M1PA 4WF9L 2YHXA 4EHUA 3HVRA 1NK9A 2YNGA 2UXCK 4FM0A 3NBPA 2V52B 4K25A 5BPNA 3D2FA 1RBVA 4F3OA 4KTWA 1ASUA 3IUCA 4Z0UA 2EX3A 4CESA 2P9IB 1TUUA 1YXQA 2DFEA 3LZIA 3VEYA 3HBTA 1BWFO 3F9KA 1VQ9N 5AQWA 2PBDA 4I9QA 2QWPA 4BC2A 4CF2A 3DI6A 1XMOK 1U45A 4NYFA 4XIUA 2E6MA 4BRKA 4YDUA 2A40A 1S6PA 2P9IA 3E01A 3O3HA 1RBUA 1RTJA 2Z1GA 2IS3A 1N8RO 3A0IX 1BA0A 2RN2A 5EU7A 3EYZA 3D0PA 4BREA 5LJWA 4CJTA 4O5FA 5M1QA 4XH5A 3OYIA 4KKOA 3I55N 3I8BA 4JI7K 3VQ9A 1Q9XA 2HHTA 4B1UB 1E4FT 4DSLA 4OKKA 3WNEA 2H3GX 1VQPN 3DRRA 4ICLA 1GLFO 2G8FA 1A5XA 3MX5A 1N36K 4I6MB 3LDPA 2HNYA 4FOEA 2O4GA 3HSTB 4Z4EA 2VYPA 3MXJA 3OS0A 3GG4A 1BUPA 5M1OA 2P51A 4AQYK 1KAZA 4FK2A 3VN5A 4I6MA 3A2FA 4DFJA 1GOBA 4WYBA 1S1XA 4M3TA 2CH5A 4Z4CA 3PLAA 5KPZA 3PV8A 3PX0A 4GKJK 5C24A 4KHNA 1YUWA 3QEWA 4M3YA 1VQKN 4BRDA 2G8IA 4BRQA 2ZM6K 2NRRA 2P9LB 1JLAA 3CCEN 1NK7A 1U4BA 4CHZA 2FLOA 4AHVA 3F9MA 3B6OA 4ILHA 4QS9A 5IWAK 2P9LA 3HOTA 5HRPA 1TKDA 3PX6A 1OVQA 4FJ8A 5JVHL 4DFPA 4J2AA 1WLJA 4DQPA 1JLFA 3EEQA 1XMQK 2G8UA 3LAKA 4M7XA 4G1QA 1YVNA 3EN9A 4QOZB 4AHCA 2QWOA 4CHNA 4DFKA 4R79A 5BRFA 4RW4A 4LFAK 4IEEA 4DFMA 3KD1E 1QQCA 3IDHA 4IZ9A 5HRRA 4C23A 2F96A 2XY7A 1DEJA 3ENOA 3V1QA 1XI1A 4CFCA 1L3UA 1NGIA 2IIRA 4GVEA 3SI6A 1NGGA 4KBOA 4FVUA 2ASMA 4KB0A 4FM1A 3SUPA 5BN8A 4BDPA 3HVTA 2P9SB 3J7YP 1C1CA 4J2EA 3A5LC 2JWLA 3AVLA 4OKJA 4NXMK 2NRZA 4B1WB 5AZJB 2P9SA 1T7PA 4MFBA 4H03B 3BZCA 4R5PA 4NYNA 1SKWA 4M3UA 2LSNA 4CBWA 5AZJA 4FJMA 4KH4A 3SZ2A 4DU4A 4KTZA 1TK0A 1RTHA 4A62A 5KI6A 2A1SA 3EKSA 1TV6A 3LDLA 4FWKA 3NF6A 5AQIA 1VRTA 5HLFA 3AO5A 3E66A 1HNZK 1D9DA 4QCLA 3SJJA 5CR4A 3CQXA 1JL1A 2I5JA 2WONA 4CJLA 1VSJA 3WNFA 1KD1O 1L5UA 5SZTA 1CZAN 3IRXA 4E1JA 5AQMA 2OANA 2WFBA 3OYMA 4MLHA 2P5OA 4ILJA 4LF5K 4UQGA 2QWNA 2D0CA 4CHPA 3KWIA 3LDQA 2Z1JA 4IOXA 4HCBA 2W41A 1RDDA 2O8DB 2RHKA 4BRLA 4JRQA 1J6ZA 2O8DA 3B6PA 1G99A 1Q18A 3HXMA 3SLCA 2GELA 3KHYA 3JS6A 4O8UA 3V9ZA 4KHUA 2FSJA 4WQ5C 3WXIA 5AQTA 3ZSZA 3NH2A 2JLEA 4FJGA 4E7KA 2W40A 4CF9A 3QEVA 1YJNN 1RBTA 5BREA 3J81O 4CZJA 4W5OA 3D2EB 3LPTA 1GOAA 3V6DA 2HMPA 5BPLA 4F2RA 3EZWA 3THWB 4DTPA 1CLQA 3D2EA 1HPMA 3VA3A 3TAGA 1JJ2M 2O8BB 4BR0A 1KFDA 3QESA 3C6TA 4FXDA 3ZSOA 2ASPA 5CE3A 3THWA 2IVPA 3M8QA 4DR5K 3TANA 3KKRA 3DXKB 4ZTJA 1R0AA 4JI5K 3O4NA 2HVIA 2O8BA 1P90A 1SQKA 4DU3A 1VSKA 4PY5A 1VSIA 5BRHA 4DV6K 3ULDA 4GMJB 2AJQA 1NK4A 3DXKA 2D4WA 1ZXOA 3DAWA 4KFBA 3PIPL 3QERA 4H5TA 2XRIA 2HNZA 4OGEA 5HL7L 3CM5A 4CD3A 5ADXH 1NJXA 2ITGA 5C2DA 4CJWA 5F2RA 1EETA 2QM1A 1HYZA 4Z4IA 4K43A 3VPZA 1RCHA 4BR5A 4DV0K 1ASVA 2FF6A 1JLGA 3AVMA 2QWMA 3ITHA 5FROA 3MK6A 4HUEA 4DTXA 4C1NI 1WUAA 1QZ5A 5KRSA 2NRHA 1WNSA 1W7AA 3N4PA 3PSIA 2YHYA 4KI6A 1OH8A 2ZJRL 4LD0A 4K42A 5CY4A 3CJ1A 3LZJA 4BROA 3P1GA 4DQ8A 1VQMN 2FF3B 4C1NK 3OHRA 3TAPA 4CF0A 5EX5A 1TK8A 5LL6Z 4DTJA 3SYZA 4B9MA 1YAGA 4JKHA 1KTQA 3ATUA 1Y64A 5F0XA 3DLEA 3KVGA 3THYB 2B5JA 2E1ZA 3HRGA 3CQYA 1HRHA 5KPTA 1BA1A 3ZX0A 3OTOK 3WXKA 3I0SA 4BRGA 1ZC6A 1ILYA 3ENHA 3VTHA 4B8CA 4BRCA 3THYA 3P83D 4OPJA 3V9UA 4RW7A 4CJ7A 1GLJO 1YJ9N 4KPYA 3TAQA 5M1KA 3HZ6A 4B9SA 3ZSVA 4YFUA 1LWEA 1S9EA 1OH5A 1HJRA 4OVLA 2PFUA 4CF1A 3MMVA 2ZGZA 1JXEA 3AVIA 4FPAA 2P9UB 4IFYA 4BRPA 4KV8A 3AVKA 3QMLA 3QBWA 3A5NC 1DTTA 5EVZA 3AY9A 2Q3SA 3BP8A 3BF1A 2G8VA 4BRAA 2P9UA 4XH1A 3ID6A 4M7YA 4CK3A 4JK9A 1Q7YO 3EZ5A 3S3OA 2ASOA 5KPRA 1RTIA 3AO3A 3P4IA 4I9LA 3LANA 1F21A 4E3SA 3DYAA 2DFHA 3O08A 2ZJPL 3FZMA 3CC4N 2A6AA 4OO1J 2X6SA 3MEDA 2OZMA 5DK5A 1J5OA 4MDBA 1NM1A 2NRTA 2WBNA 3PY8A 4J8FA 4C8LA 4CK1A 2QK9A 4YOXA 4DS5A
chains in the Genus database with same CATH topology
3C94A 4AHUA 2HHQA 4IFVA 5C42A 4CE9A 2VG5A 2P5GA 3M8PA 1QSYA 3THVA 4KREA 1RDAA 4BE1A 3MEGA 4M3XA 5SWMA 4N41A 1RBRA 4FVMA 2VWJA 3HVRA 4IDKA 4FJXA 1NK5A 1NK9A 2YNGA 2XHBA 1UA0A 3U3YA 3K5LA 1A5VA 1N6QA 3V81A 1X9SA 3C95A 3RRGA 1ZBIA 2OPSA 4CHQA 3AA2A 2VWKA 4FM0A 2OPPA 3NBPA 1NJYA 1SL2A 4ELUA 3KIOA 1RBVA 2YHBA 1NJZA 3TAEA 3MXIA 4F3OA 4AHRA 4KTWA 1SV5A 1ASUA 4FLTA 4Z0UA 2EX3A 4J2DA 4CESA 2DFEA 3HPGA 3LZIA 3MAQA 3SPZA 3ZSQA 1U49A 3IAYA 2KW4A 1KLMA 3F9KA 5HROA 4I9QA 4CF2A 1EP4A 3DI6A 3ZSRA 3VA0A 4NYFA 1U45A 3MEEA 4O55A 4H8KA 4XIUA 3V9SA 2Y1IA 4IKFA 2E6MA 3E01A 1S6PA 4O0JA 3O3HA 1CXQA 1RBUA 1RTJA 1ZBUA 2YNHA 3K5NA 4DF4A 4M3WA 2Z1GA 4CJ3A 2KQ2A 5HP1A 2IS3A 2KTQA 3K2PA 1SL0A 3OYAA 2GV9A 2RN2A 1VK0A 4HUFA 3TWHA 1RTDA 3SUOA 4Z4HA 5EU7A 1BIUA 3HPOA 2W42A 5CYMA 4N5SA 3EYZA 5JS2A 4IBNA 1JLQA 1LWFA 3OJUA 1RNHA 3D0PA 4L8RB 3OYBA 2HB5A 1TGOA 4CJTA 4B9TA 2F8SA 3ZCMA 2FC0A 3OYIA 2EHGA 4KKOA 3DLRA 5HRNA 2YNIA 3OS2A 3KTQA 3VQ9A 1Q9XA 2HHTA 4DSLA 1ZYQA 4OKKA 3WNEA 4O5BA 5T7BA 3SQ0A 1QHTA 4ELTA 2ZD1A 3SPYA 1N5YA 2BDPA 3I0RA 4B8AB 2OA8A 3DRRA 4FLUA 4OJRA 4ICLA 4Y1DA 2G8FA 1A5XA 3MECA 2PYLA 3L2WA 1YTUA 4CECA 2HNYA 3KK3A 1CZ9A 2O4GA 3VQDA 3NF9A 3OY9A 4C8KA 3HK2A 3HSTB 2KFNA 4Z4EA 1SKSA 3OS0A 3DOKA 3MXJA 1NOZA 4B9NA 4FZZA 2P51A 3LP3A 4FK2A 3DLHA 1VSFA 2X78A 4RW6A 1JKHA 3VN5A 4CIGA 3K59A 1NKBA 5FDLA 1NKCA 4FJ9A 3KD5E 3CFRA 3A2FA 2FBVA 4DFJA 1GOBA 4FLZA 1S1XA 3SV4A 4M3TA 4Z4CA 1VSEA 2OZSA 3K57A 3PV8A 3PX0A 4AH9A 5C24A 1T05A 4KHNA 3QNNA 3QEWA 4DTUA 4M3YA 1C6VA 2X6NA 4CGDA 4DLEA 2G8IA 3NGYA 1XHZA 3WNGA 3LDSA 1RT6A 3VQ8A 4TSXA 5I3UA 4ID1A 3CFOA 4C8MA 1TKZA 1JLAA 3CFPA 3L2VA 1U4BA 1NK7A 4CHZA 4DTOA 2XY6A 1TKTA 4AHVA 4DSIA 3B6OA 2IGIA 3TAMA 2G8WA 1K6YA 1IKVA 2G8HA 1IO2A 3K5MA 3HYFA 1TAQA 1XHXA 1I39A 4PUOA 4CIFA 2QKBA 5JS1A 1D5AA 3BGRA 5HRPA 4CGFA 1TK5A 1HYSA 1TKDA 1NK6A 3PX6A 4WE1A 1D9FA 4FJ8A 4B08A 4FJHA 4DFPA 4J2AA 1WLJA 3DOLA 3IS9A 1JLFA 5KGWA 1KFSA 4DQPA 2G8UA 2FBTA 3LAKA 4CJ5A 4G1QA 4JS5A 1NOYA 3HP9A 4QOZB 4AHCA 4DQIA 4CHNA 4DFKA 1J9AA 4RW4A 3ZT3A 1TL1A 4FCYA 5CZ2A 4CHOA 4JS4A 2ETJA 4DFMA 3KD1E 1QQCA 5HRRA 2HHVA 4OPKA 5FRMA 2F96A 3RMCA 3HP6A 5HRSA 2XY7A 4QAGA 1RT3A 1LAVA 1HNIA 3V1QA 4BE2A 1XI1A 4CFCA 4M3RA 1IKWA 1L3UA 4O4GA 4CFBA 4N76A 3SI6A 4OKEA 2ZQBA 4ZHRA 1XC9A 2DY4A 3LP0A 2FBXA 3JYTA 4K8XA 4KB0A 3SQ4A 4FM1A 3RR7A 3SUPA 3ZT4A 4W5RA 1FK9A 4BDYA 4KTQA 4BDPA 3HVTA 3NCIA 4NCGA 4F3TA 3QIOA 2HHWA 4FM2A 3HT3A 1C1CA 4LY7A 1C0TA 4J2EA 4E1MA 3RR8A 3AVLA 4GVMA 4OKJA 3FFIA 1EKEA 3AVGA 2VG7A 1SL1A 4KB1A 2D5RA 1U47A 1WSIA 1BL3A 3G10A 3V9XA 4MFBA 4DU1A 4DTNA 3V4IA 1T7PA 2IC3A 3UIQA 3SUNA 1RILA 3DRPA 1IKXA 3OYLA 1RT1A 4R5PA 1SKWA 4NYNA 3OYEA 4M3UA 2BGGA 3O3FA 1VSDA 2LSNA 4RW8A 1T03A 4FJMA 3AVJA 3SZ2A 2Y1JA 3NE6A 2IAJA 4KTZA 3NF8A 4W5TA 3NGIA 4Y1CA 4DU4A 1TK0A 1RTHA 2JGUA 4DWIA 3KJVA 3KK1A 4M3ZA 1RT5A 4I2PA 4PA1A 2YHAA 5KI6A 2YKMA 2QKKA 2A1SA 2D0AA 4CGGA 4CHYA 4H4MA 2ZE2A 1TV6A 3NF6A 3AVAA 1VRTA 1G15A 3ZSYA 3TARA 2HHXA 5HLFA 1J54A 1B92A 2RPIA 2BANA 3AO5A 5KTQA 1D9DA 3SJJA 1X1PA 4QCLA 1WSHA 4IG3A 1QSLA 3JSMA 1ZBHA 3LP1A 3LALA 4CERA 3TI0A 3AA4A 1JL1A 2I5JA 2WONA 3AA5X 4DSKA 4CJLA 1REVA 4KHWA 5DMRA 1VSJA 4GW6A 4F2SA 4DTSA 3WNFA 5D3GA 1U48A 1L5UA 5SZTA 1GOCA 3ASMA 3IRXA 2A1RA 3OYMA 1WSFA 4B3OA 4DSFA 3RMDA 1UA1A 2P5OA 1EX4A 2HNDA 4I7FA 4CJFA 4UQGA 1JLEA 4CGHA 1YT3A 2D0CA 4CHPA 3VQ7A 3ZT0A 3PUFA 4E7LA 2Z1JA 1L3TA 4LH5A 3HPHA 4HCBA 2DFFA 1RDDA 4CEZA 5CYQA 4HVJA 1JLCA 1KLNA 3DLBA 3M8SA 3OVNA 3VQEA 5C25A 1NK0A 1SKRA 4FJ5A 1YTAA 1IKYA 1D8YA 1QSSA 2HW3A 4JRQA 2OPRA 3NFAA 3DLGA 1KCFA 3NH1A 3VQAA 2QXFA 1WSEA 4BWMA 3OYNA 4FJNA 2E4LA 3B6PA 4M42A 3LP2A 4FJ7A 3NHGA 1Y97A 4CJUA 3G0ZA 4FJKA 1FKPA 3L3VA 3V1OA 3VQ5A 4CEDA 3OS1A 3HXMA 2OYQA 3DRSA 4CK2A 1BHLA 1KRPA 4LSLA 3V9ZA 1FXXA 4KHUA 4E1NA 4ID5A 4BACA 3SCXA 3VQCA 3DMJA 3ISNC 3ZSWA 3KLFA 1HNVA 3ZSZA 3OJSA 3KLEA 3OYFA 4FK0A 5K14A 3ZSXA 3NH2A 1TKXA 2VG6A 4RG8A 4E7JA 3S9HA 3CYMA 2JLEA 1T8EA 1X9WA 4FK4A 1BQMA 1Z25A 4E7KA 1C0MA 4CF9A 3S3MA 4FJGA 1RDCA 5J2QA 4N56A 3QEVA 1C1BA 1RBTA 1NKEA 1S1VA 4HCCA 4W5OA 1DLOA 4KAZA 3NF7A 3LPTA 3L3UA 4EP5A 4CFDA 2F8TA 1GOAA 4FLVA 3V6DA 2XY5A 1BCMA 4F2RA 4DSEA 4OLBA 4LSNA 3SQ1A 3SV3A 4DTPA 4NCAA 4EZ6A 1CLQA 2KFZA 2RKIA 4O0IA 1HYVA 2BE2A 3VA3A 3TAGA 3T19A 1TVRA 4DG1A 3LWLA 1UWBA 1KFDA 3I8DA 4DF8A 1O1WA 3C6TA 3QESA 1ZBFA 2HHUA 4E7IA 4FXDA 3ZSOA 4FLWA 3QIPA 1KSPA 1JLBA 4HTUA 4PWDA 3M8QA 1S9GA 2P1JA 1BCOA 3KKRA 3TANA 4JLHA 4ZTJA 3TR8A 1TAUA 3WNHA 1WAJA 4AHSA 4JRPA 4DS4A 4DQSA 1R0AA 1RBSA 1NK8A 3O4NA 2HVIA 2KZZA 3CG7A 1UAXA 4HHTA 3K5OA 4DU3A 1VSKA 2GBZA 1KVBA 4PY5A 1VSIA 3TAFA 1CZBA 1B9FA 3ULDA 2D0BA 3PO4A 4GMJB 4CCHA 1MU2A 1LAWA 2AJQA 3VQPA 1NK4A 3LPUA 1BGXT 4OGCA 4KFBA 4I2QA 1B9DA 1YVUA 3QERA 3K58A 1BI4B 2XRIA 2HNZA 3SUQA 3IG1A 1LV5A 1Z26A 4EZ9A 4KHYA 4OGEA 3VQQA 3RWUA 4DTMA 3EY1A 4FZYA 3CM5A 2YV0X 4M45A 4B9VA 4CJPA 2XO7A 4CF8A 1NJXA 2ITGA 4CJWA 1HPZA 3QEPA 1BI4A 3ALYA 4CEFA 1WAFA 4FLYA 1WSGA 4MQ3A 3HL8A 1EETA 1Q9YA 4Q0BA 4CJEA 3HJFA 1CXUA 3AA3A 3NDKA 3AVNA 1HYZA 2PYJA 3AVBA 1S1WA 4Z4IA 3HO1A 3CM6A 1A5WA 4Z4GA 2HVHA 1LW0A 1RCHA 2PZSA 4KI4A 1ITGA 4FW1A 1ASVA 1JLGA 3AVMA 1C0UA 1QS4A 2PY5A 3QETA 3F73A 4RW9A 1W9HA 3ITHA 5FROA 4HUEA 4DTXA 4AHTA 5KRSA 1WNSA 3AO4A 3AVFA 1LW2A 1RT2A 1L3SA 4KI6A 3DM2A 4LD0A 2B4JA 2R7YA 3H08A 5CY4A 1I3AA 3LZJA 3T3FA 1KVCA 4DMNA 4PQUA 3P1GA 2HHSA 1IG9A 1S6QA 5FRNA 3AO2A 3TAPA 4CEBA 4IG0A 4CF0A 1TK8A 4B9MA 4DTJA 3SYZA 4FJJA 4N47A 5KGXA 4DQRA 2YKNA 1KTQA 2OPQA 3QEXA 1DTQA 1X9MA 3OYKA 4F8RA 3P5JA 3DLEA 3KKSA 3V1RA 2B5JA 3QNOA 3HM9A 4E7HA 4E89A 4K8ZA 1S5JA 1JXBA 3C6UA 3NGZA 1L3VA 1KVAA 1HRHA 1TL3A 3QLHA 3NH0A 4CFAA 4DQQA 2Z1HA 4H4OA 4CGJA 3CQ8A 3I0SA 4E0DA 1RDBA 4F4KA 1LWCA 4LH4A 1BISA 5KRTA 4CGIA 4KO0A 3TABA 3L2UA 1BQNA 3D45A 4B8CA 3P83D 5E41A 4OPJA 3V9UA 3LWMA 4RW7A 1QE1A 2XY8A 4W5QA 4KPYA 4BWJA 2E6LA 3V9WA 3TAQA 1ZBLA 4B9SA 4OLAA 4HUGA 3ZSVA 1HQUA 4YFUA 1LWEA 1S9EA 3VQ6A 3OYGA 4KRFA 1HJRA 2RF2A 3AO1A 4OVLA 4CJKA 3KLHA 3U6FA 3PX4A 3O4QA 3OYHA 5J2NA 3QO9A 4CF1A 5J2PA 3KK2A 4FJIA 1C1AA 1JXEA 3AVIA 2O4IA 4CEQA 3OYCA 4W5NA 2FBYA 4IFYA 3NAEA 4CJRA 4KHSA 3OYJA 1IH7A 3QINA 3VQ4A 4BE0A 4KV8A 3RTVA 1RT7A 1HMVA 3AVHA 3ZT1A 3PO5A 2KZMA 3QEIA 2WOMA 3AVKA 4ZTFA 4CJ4A 4O44A 1DTTA 4J2BA 2Q3SA 2X74A 1U04A 3RRHA 1VRUA 2G8VA 4B9LA 1J53A 5J1EA 4E19A 2HMIA 3LAMA 4CK3A 1QTMA 4DSJA 4CEAA 1EXQA 1XWLA 2Z1IA 2ATQA 4FW2A 3EZ5A 3BDPA 3S3OA 4CJSA 3S3NA 1FKOA 4CIEA 3M8RA 4BDZA 1VSHA 4C8NA 4CEOA 4FYDA 4M41A 1NJWA 3SQ2A 1RTIA 3AO3A 2DTUA 4CJVA 4YNQA 2GUIA 3U3GA 4Q5VA 1ASWA 4ELVA 1SUQA 2G8KA 3SNNA 1UOCA 4I9LA 3LANA 1F21A 3L2QA 1Q8IA 3DYAA 3T1AA 4E3SA 4DTRA 2DFHA 3KLGA 1VSMA 4AILC 3MXMA 4KHQA 3L8BA 3O3GA 4NCBA 3AV9A 1W0HA 1VSLA 2X6SA 3MEDA 3ZT2A 1BIZA 1HQEA 2OZMA 5DK5A 5I42A 1J5OA 4CEEA 2B6AA 5J2MA 3L2RA 4DLGA 3RMBA 5HBMA 1WSJA 4Z4FA 1S1UA 2IOCA 3AVCA 3KLIA 3RMAA 3PY8A 2YNFA 4CJQA 3DLKA 3OYDA 4C8LA 2NUBA 3VQBA 1S1TA 4FLXA 2IDOA 4CK1A 4B9UA 5CZ1A 1WN7A 1JL2A 4EP4A 1RT4A 4C8OA 4DS5A 4FZXC 2QK9A 4FJLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C94 A;  4AHU A;  2HHQ A;  4IFV A;  5C42 A;  4CE9 A;  2VG5 A;  2P5G A;  3M8P A;  1QSY A;  3THV A;  4KRE A;  1RDA A;  4BE1 A;  3MEG A;  4M3X A;  5SWM A;  4N41 A;  1RBR A;  4FVM A;  2VWJ A;  3HVR A;  4IDK A;  4FJX A;  1NK5 A;  1NK9 A;  2YNG A;  2XHB A;  1UA0 A;  3U3Y A;  3K5L A;  1A5V A;  1N6Q A;  3V81 A;  1X9S A;  3C95 A;  3RRG A;  1ZBI A;  2OPS A;  4CHQ A;  3AA2 A;  2VWK A;  4FM0 A;  2OPP A;  3NBP A;  1NJY A;  1SL2 A;  4ELU A;  3KIO A;  1RBV A;  2YHB A;  1NJZ A;  3TAE A;  3MXI A;  4F3O A;  4AHR A;  4KTW A;  1SV5 A;  1ASU A;  4FLT A;  4Z0U A;  2EX3 A;  4J2D A;  4CES A;  2DFE A;  3HPG A;  3LZI A;  3MAQ A;  3SPZ A;  3ZSQ A;  1U49 A;  3IAY A;  2KW4 A;  1KLM A;  3F9K A;  5HRO A;  4I9Q A;  4CF2 A;  1EP4 A;  3DI6 A;  3ZSR A;  3VA0 A;  4NYF A;  1U45 A;  3MEE A;  4O55 A;  4H8K A;  4XIU A;  3V9S A;  2Y1I A;  4IKF A;  2E6M A;  3E01 A;  1S6P A;  4O0J A;  3O3H A;  1CXQ A;  1RBU A;  1RTJ A;  1ZBU A;  2YNH A;  3K5N A;  4DF4 A;  4M3W A;  2Z1G A;  4CJ3 A;  2KQ2 A;  5HP1 A;  2IS3 A;  2KTQ A;  3K2P A;  1SL0 A;  3OYA A;  2GV9 A;  2RN2 A;  1VK0 A;  4HUF A;  3TWH A;  1RTD A;  3SUO A;  4Z4H A;  5EU7 A;  1BIU A;  3HPO A;  2W42 A;  5CYM A;  4N5S A;  3EYZ A;  5JS2 A;  4IBN A;  1JLQ A;  1LWF A;  3OJU A;  1RNH A;  3D0P A;  4L8R B;  3OYB A;  2HB5 A;  1TGO A;  4CJT A;  4B9T A;  2F8S A;  3ZCM A;  2FC0 A;  3OYI A;  2EHG A;  4KKO A;  3DLR A;  5HRN A;  2YNI A;  3OS2 A;  3KTQ A;  3VQ9 A;  1Q9X A;  2HHT A;  4DSL A;  1ZYQ A;  4OKK A;  3WNE A;  4O5B A;  5T7B A;  3SQ0 A;  1QHT A;  4ELT A;  2ZD1 A;  3SPY A;  1N5Y A;  2BDP A;  3I0R A;  4B8A B;  2OA8 A;  3DRR A;  4FLU A;  4OJR A;  4ICL A;  4Y1D A;  2G8F A;  1A5X A;  3MEC A;  2PYL A;  3L2W A;  1YTU A;  4CEC A;  2HNY A;  3KK3 A;  1CZ9 A;  2O4G A;  3VQD A;  3NF9 A;  3OY9 A;  4C8K A;  3HK2 A;  3HST B;  2KFN A;  4Z4E A;  1SKS A;  3OS0 A;  3DOK A;  3MXJ A;  1NOZ A;  4B9N A;  4FZZ A;  2P51 A;  3LP3 A;  4FK2 A;  3DLH A;  1VSF A;  2X78 A;  4RW6 A;  1JKH A;  3VN5 A;  4CIG A;  3K59 A;  1NKB A;  5FDL A;  1NKC A;  4FJ9 A;  3KD5 E;  3CFR A;  3A2F A;  2FBV A;  4DFJ A;  1GOB A;  4FLZ A;  1S1X A;  3SV4 A;  4M3T A;  4Z4C A;  1VSE A;  2OZS A;  3K57 A;  3PV8 A;  3PX0 A;  4AH9 A;  5C24 A;  1T05 A;  4KHN A;  3QNN A;  3QEW A;  4DTU A;  4M3Y A;  1C6V A;  2X6N A;  4CGD A;  4DLE A;  2G8I A;  3NGY A;  1XHZ A;  3WNG A;  3LDS A;  1RT6 A;  3VQ8 A;  4TSX A;  5I3U A;  4ID1 A;  3CFO A;  4C8M A;  1TKZ A;  1JLA A;  3CFP A;  3L2V A;  1U4B A;  1NK7 A;  4CHZ A;  4DTO A;  2XY6 A;  1TKT A;  4AHV A;  4DSI A;  3B6O A;  2IGI A;  3TAM A;  2G8W A;  1K6Y A;  1IKV A;  2G8H A;  1IO2 A;  3K5M A;  3HYF A;  1TAQ A;  1XHX A;  1I39 A;  4PUO A;  4CIF A;  2QKB A;  5JS1 A;  1D5A A;  3BGR A;  5HRP A;  4CGF A;  1TK5 A;  1HYS A;  1TKD A;  1NK6 A;  3PX6 A;  4WE1 A;  1D9F A;  4FJ8 A;  4B08 A;  4FJH A;  4DFP A;  4J2A A;  1WLJ A;  3DOL A;  3IS9 A;  1JLF A;  5KGW A;  1KFS A;  4DQP A;  2G8U A;  2FBT A;  3LAK A;  4CJ5 A;  4G1Q A;  4JS5 A;  1NOY A;  3HP9 A;  4QOZ B;  4AHC A;  4DQI A;  4CHN A;  4DFK A;  1J9A A;  4RW4 A;  3ZT3 A;  1TL1 A;  4FCY A;  5CZ2 A;  4CHO A;  4JS4 A;  2ETJ A;  4DFM A;  3KD1 E;  1QQC A;  5HRR A;  2HHV A;  4OPK A;  5FRM A;  2F96 A;  3RMC A;  3HP6 A;  5HRS A;  2XY7 A;  4QAG A;  1RT3 A;  1LAV A;  1HNI A;  3V1Q A;  4BE2 A;  1XI1 A;  4CFC A;  4M3R A;  1IKW A;  1L3U A;  4O4G A;  4CFB A;  4N76 A;  3SI6 A;  4OKE A;  2ZQB A;  4ZHR A;  1XC9 A;  2DY4 A;  3LP0 A;  2FBX A;  3JYT A;  4K8X A;  4KB0 A;  3SQ4 A;  4FM1 A;  3RR7 A;  3SUP A;  3ZT4 A;  4W5R A;  1FK9 A;  4BDY A;  4KTQ A;  4BDP A;  3HVT A;  3NCI A;  4NCG A;  4F3T A;  3QIO A;  2HHW A;  4FM2 A;  3HT3 A;  1C1C A;  4LY7 A;  1C0T A;  4J2E A;  4E1M A;  3RR8 A;  3AVL A;  4GVM A;  4OKJ A;  3FFI A;  1EKE A;  3AVG A;  2VG7 A;  1SL1 A;  4KB1 A;  2D5R A;  1U47 A;  1WSI A;  1BL3 A;  3G10 A;  3V9X A;  4MFB A;  4DU1 A;  4DTN A;  3V4I A;  1T7P A;  2IC3 A;  3UIQ A;  3SUN A;  1RIL A;  3DRP A;  1IKX A;  3OYL A;  1RT1 A;  4R5P A;  1SKW A;  4NYN A;  3OYE A;  4M3U A;  2BGG A;  3O3F A;  1VSD A;  2LSN A;  4RW8 A;  1T03 A;  4FJM A;  3AVJ A;  3SZ2 A;  2Y1J A;  3NE6 A;  2IAJ A;  4KTZ A;  3NF8 A;  4W5T A;  3NGI A;  4Y1C A;  4DU4 A;  1TK0 A;  1RTH A;  2JGU A;  4DWI A;  3KJV A;  3KK1 A;  4M3Z A;  1RT5 A;  4I2P A;  4PA1 A;  2YHA A;  5KI6 A;  2YKM A;  2QKK A;  2A1S A;  2D0A A;  4CGG A;  4CHY A;  4H4M A;  2ZE2 A;  1TV6 A;  3NF6 A;  3AVA A;  1VRT A;  1G15 A;  3ZSY A;  3TAR A;  2HHX A;  5HLF A;  1J54 A;  1B92 A;  2RPI A;  2BAN A;  3AO5 A;  5KTQ A;  1D9D A;  3SJJ A;  1X1P A;  4QCL A;  1WSH A;  4IG3 A;  1QSL A;  3JSM A;  1ZBH A;  3LP1 A;  3LAL A;  4CER A;  3TI0 A;  3AA4 A;  1JL1 A;  2I5J A;  2WON A;  3AA5 X;  4DSK A;  4CJL A;  1REV A;  4KHW A;  5DMR A;  1VSJ A;  4GW6 A;  4F2S A;  4DTS A;  3WNF A;  5D3G A;  1U48 A;  1L5U A;  5SZT A;  1GOC A;  3ASM A;  3IRX A;  2A1R A;  3OYM A;  1WSF A;  4B3O A;  4DSF A;  3RMD A;  1UA1 A;  2P5O A;  1EX4 A;  2HND A;  4I7F A;  4CJF A;  4UQG A;  1JLE A;  4CGH A;  1YT3 A;  2D0C A;  4CHP A;  3VQ7 A;  3ZT0 A;  3PUF A;  4E7L A;  2Z1J A;  1L3T A;  4LH5 A;  3HPH A;  4HCB A;  2DFF A;  1RDD A;  4CEZ A;  5CYQ A;  4HVJ A;  1JLC A;  1KLN A;  3DLB A;  3M8S A;  3OVN A;  3VQE A;  5C25 A;  1NK0 A;  1SKR A;  4FJ5 A;  1YTA A;  1IKY A;  1D8Y A;  1QSS A;  2HW3 A;  4JRQ A;  2OPR A;  3NFA A;  3DLG A;  1KCF A;  3NH1 A;  3VQA A;  2QXF A;  1WSE A;  4BWM A;  3OYN A;  4FJN A;  2E4L A;  3B6P A;  4M42 A;  3LP2 A;  4FJ7 A;  3NHG A;  1Y97 A;  4CJU A;  3G0Z A;  4FJK A;  1FKP A;  3L3V A;  3V1O A;  3VQ5 A;  4CED A;  3OS1 A;  3HXM A;  2OYQ A;  3DRS A;  4CK2 A;  1BHL A;  1KRP A;  4LSL A;  3V9Z A;  1FXX A;  4KHU A;  4E1N A;  4ID5 A;  4BAC A;  3SCX A;  3VQC A;  3DMJ A;  3ISN C;  3ZSW A;  3KLF A;  1HNV A;  3ZSZ A;  3OJS A;  3KLE A;  3OYF A;  4FK0 A;  5K14 A;  3ZSX A;  3NH2 A;  1TKX A;  2VG6 A;  4RG8 A;  4E7J A;  3S9H A;  3CYM A;  2JLE A;  1T8E A;  1X9W A;  4FK4 A;  1BQM A;  1Z25 A;  4E7K A;  1C0M A;  4CF9 A;  3S3M A;  4FJG A;  1RDC A;  5J2Q A;  4N56 A;  3QEV A;  1C1B A;  1RBT A;  1NKE A;  1S1V A;  4HCC A;  4W5O A;  1DLO A;  4KAZ A;  3NF7 A;  3LPT A;  3L3U A;  4EP5 A;  4CFD A;  2F8T A;  1GOA A;  4FLV A;  3V6D A;  2XY5 A;  1BCM A;  4F2R A;  4DSE A;  4OLB A;  4LSN A;  3SQ1 A;  3SV3 A;  4DTP A;  4NCA A;  4EZ6 A;  1CLQ A;  2KFZ A;  2RKI A;  4O0I A;  1HYV A;  2BE2 A;  3VA3 A;  3TAG A;  3T19 A;  1TVR A;  4DG1 A;  3LWL A;  1UWB A;  1KFD A;  3I8D A;  4DF8 A;  1O1W A;  3C6T A;  3QES A;  1ZBF A;  2HHU A;  4E7I A;  4FXD A;  3ZSO A;  4FLW A;  3QIP A;  1KSP A;  1JLB A;  4HTU A;  4PWD A;  3M8Q A;  1S9G A;  2P1J A;  1BCO A;  3KKR A;  3TAN A;  4JLH A;  4ZTJ A;  3TR8 A;  1TAU A;  3WNH A;  1WAJ A;  4AHS A;  4JRP A;  4DS4 A;  4DQS A;  1R0A A;  1RBS A;  1NK8 A;  3O4N A;  2HVI A;  2KZZ A;  3CG7 A;  1UAX A;  4HHT A;  3K5O A;  4DU3 A;  1VSK A;  2GBZ A;  1KVB A;  4PY5 A;  1VSI A;  3TAF A;  1CZB A;  1B9F A;  3ULD A;  2D0B A;  3PO4 A;  4GMJ B;  4CCH A;  1MU2 A;  1LAW A;  2AJQ A;  3VQP A;  1NK4 A;  3LPU A;  1BGX T;  4OGC A;  4KFB A;  4I2Q A;  1B9D A;  1YVU A;  3QER A;  3K58 A;  1BI4 B;  2XRI A;  2HNZ A;  3SUQ A;  3IG1 A;  1LV5 A;  1Z26 A;  4EZ9 A;  4KHY A;  4OGE A;  3VQQ A;  3RWU A;  4DTM A;  3EY1 A;  4FZY A;  3CM5 A;  2YV0 X;  4M45 A;  4B9V A;  4CJP A;  2XO7 A;  4CF8 A;  1NJX A;  2ITG A;  4CJW A;  1HPZ A;  3QEP A;  1BI4 A;  3ALY A;  4CEF A;  1WAF A;  4FLY A;  1WSG A;  4MQ3 A;  3HL8 A;  1EET A;  1Q9Y A;  4Q0B A;  4CJE A;  3HJF A;  1CXU A;  3AA3 A;  3NDK A;  3AVN A;  1HYZ A;  2PYJ A;  3AVB A;  1S1W A;  4Z4I A;  3HO1 A;  3CM6 A;  1A5W A;  4Z4G A;  2HVH A;  1LW0 A;  1RCH A;  2PZS A;  4KI4 A;  1ITG A;  4FW1 A;  1ASV A;  1JLG A;  3AVM A;  1C0U A;  1QS4 A;  2PY5 A;  3QET A;  3F73 A;  4RW9 A;  1W9H A;  3ITH A;  5FRO A;  4HUE A;  4DTX A;  4AHT A;  5KRS A;  1WNS A;  3AO4 A;  3AVF A;  1LW2 A;  1RT2 A;  1L3S A;  4KI6 A;  3DM2 A;  4LD0 A;  2B4J A;  2R7Y A;  3H08 A;  5CY4 A;  1I3A A;  3LZJ A;  3T3F A;  1KVC A;  4DMN A;  4PQU A;  3P1G A;  2HHS A;  1IG9 A;  1S6Q A;  5FRN A;  3AO2 A;  3TAP A;  4CEB A;  4IG0 A;  4CF0 A;  1TK8 A;  4B9M A;  4DTJ A;  3SYZ A;  4FJJ A;  4N47 A;  5KGX A;  4DQR A;  2YKN A;  1KTQ A;  2OPQ A;  3QEX A;  1DTQ A;  1X9M A;  3OYK A;  4F8R A;  3P5J A;  3DLE A;  3KKS A;  3V1R A;  2B5J A;  3QNO A;  3HM9 A;  4E7H A;  4E89 A;  4K8Z A;  1S5J A;  1JXB A;  3C6U A;  3NGZ A;  1L3V A;  1KVA A;  1HRH A;  1TL3 A;  3QLH A;  3NH0 A;  4CFA A;  4DQQ A;  2Z1H A;  4H4O A;  4CGJ A;  3CQ8 A;  3I0S A;  4E0D A;  1RDB A;  4F4K A;  1LWC A;  4LH4 A;  1BIS A;  5KRT A;  4CGI A;  4KO0 A;  3TAB A;  3L2U A;  1BQN A;  3D45 A;  4B8C A;  3P83 D;  5E41 A;  4OPJ A;  3V9U A;  3LWM A;  4RW7 A;  1QE1 A;  2XY8 A;  4W5Q A;  4KPY A;  4BWJ A;  2E6L A;  3V9W A;  3TAQ A;  1ZBL A;  4B9S A;  4OLA A;  4HUG A;  3ZSV A;  1HQU A;  4YFU A;  1LWE A;  1S9E A;  3VQ6 A;  3OYG A;  4KRF A;  1HJR A;  2RF2 A;  3AO1 A;  4OVL A;  4CJK A;  3KLH A;  3U6F A;  3PX4 A;  3O4Q A;  3OYH A;  5J2N A;  3QO9 A;  4CF1 A;  5J2P A;  3KK2 A;  4FJI A;  1C1A A;  1JXE A;  3AVI A;  2O4I A;  4CEQ A;  3OYC A;  4W5N A;  2FBY A;  4IFY A;  3NAE A;  4CJR A;  4KHS A;  3OYJ A;  1IH7 A;  3QIN A;  3VQ4 A;  4BE0 A;  4KV8 A;  3RTV A;  1RT7 A;  1HMV A;  3AVH A;  3ZT1 A;  3PO5 A;  2KZM A;  3QEI A;  2WOM A;  3AVK A;  4ZTF A;  4CJ4 A;  4O44 A;  1DTT A;  4J2B A;  2Q3S A;  2X74 A;  1U04 A;  3RRH A;  1VRU A;  2G8V A;  4B9L A;  1J53 A;  5J1E A;  4E19 A;  2HMI A;  3LAM A;  4CK3 A;  1QTM A;  4DSJ A;  4CEA A;  1EXQ A;  1XWL A;  2Z1I A;  2ATQ A;  4FW2 A;  3EZ5 A;  3BDP A;  3S3O A;  4CJS A;  3S3N A;  1FKO A;  4CIE A;  3M8R A;  4BDZ A;  1VSH A;  4C8N A;  4CEO A;  4FYD A;  4M41 A;  1NJW A;  3SQ2 A;  1RTI A;  3AO3 A;  2DTU A;  4CJV A;  4YNQ A;  2GUI A;  3U3G A;  4Q5V A;  1ASW A;  4ELV A;  1SUQ A;  2G8K A;  3SNN A;  1UOC A;  4I9L A;  3LAN A;  1F21 A;  3L2Q A;  1Q8I A;  3DYA A;  3T1A A;  4E3S A;  4DTR A;  2DFH A;  3KLG A;  1VSM A;  4AIL C;  3MXM A;  4KHQ A;  3L8B A;  3O3G A;  4NCB A;  3AV9 A;  1W0H A;  1VSL A;  2X6S A;  3MED A;  3ZT2 A;  1BIZ A;  1HQE A;  2OZM A;  5DK5 A;  5I42 A;  1J5O A;  4CEE A;  2B6A A;  5J2M A;  3L2R A;  4DLG A;  3RMB A;  5HBM A;  1WSJ A;  4Z4F A;  1S1U A;  2IOC A;  3AVC A;  3KLI A;  3RMA A;  3PY8 A;  2YNF A;  4CJQ A;  3DLK A;  3OYD A;  4C8L A;  2NUB A;  3VQB A;  1S1T A;  4FLX A;  2IDO A;  4CK1 A;  4B9U A;  5CZ1 A;  1WN7 A;  1JL2 A;  4EP4 A;  1RT4 A;  4C8O A;  4DS5 A;  4FZX C;  2QK9 A;  4FJL A; 
#chains in the Genus database with same CATH topology
 4PL7 A;  4IFV A;  4AF1 A;  5C42 A;  3LDO A;  4LF7 K;  1QSY A;  2QA4 N;  4KRE A;  1MA9 B;  4M3X A;  5SWM A;  4N41 A;  1RBR A;  4FVM A;  1QQM A;  3THX B;  4FJX A;  1UA0 A;  2W6L A;  4IDH A;  3U3Y A;  3RRG A;  1V4T A;  3C95 A;  5EXW A;  2GEM A;  5DM7 L;  2OPS A;  1LCU A;  2VWK A;  2OPP A;  1TUY A;  3KIO A;  1NJZ A;  1T6C A;  4AHR A;  3THX A;  3HTV A;  3HPG A;  5BPM A;  3FR0 A;  3MAQ A;  3SPZ A;  3ZSQ A;  4U7B A;  4JHD B;  2KW4 A;  3IAY A;  3UKR B;  3MEE A;  4O55 A;  4MDA A;  3CI5 A;  1CXQ A;  1XQS C;  4JHD A;  4F9O A;  2HF3 A;  3UKR A;  3MWT A;  5JS2 A;  2V51 B;  4IBN A;  3OJU A;  1NGC A;  4L8R B;  2HB5 A;  2F8S A;  4NXN K;  3ZCM A;  3KTQ A;  3OS2 A;  1V4S A;  3SQ0 A;  3S41 A;  2Q0U A;  1QHT A;  2ZD1 A;  3U9D A;  3SPY A;  1N5Y A;  3I0R A;  1RDW X;  4LF4 K;  3K9J A;  4Y1D A;  5AQO A;  4KH5 A;  3MEC A;  2PYL A;  2E5L K;  1GLE G;  3I33 A;  3R6M A;  1CZ9 A;  3TTD A;  4C8K A;  4NLB A;  3GL1 A;  1SKS A;  3AAP A;  1NOZ A;  1XUP O;  3O8M A;  3LP3 A;  3CCS N;  2X78 A;  5AJ3 K;  1NKC A;  4FJ9 A;  4YOT A;  3KD5 E;  4HTL A;  3I56 N;  2FBV A;  3SV4 A;  2OZS A;  1VSE A;  4AH9 A;  3CME N;  4JI3 K;  1GLA G;  3CER A;  1C6V A;  1GLD G;  2E1Y A;  5I3U A;  1QZ6 A;  4ID1 A;  5GAH P;  4C8M A;  3FZK A;  1C0G A;  2XY6 A;  3MCP A;  2HF4 A;  1Z05 A;  1NMD A;  3CF5 L;  5AQH A;  4PUO A;  1TAQ A;  1XHX A;  1I39 A;  4O8K A;  4CIF A;  4JKE A;  3BGR A;  4CGF A;  5H1S Q;  4FJH A;  3DOL A;  3IS9 A;  1KFS A;  2D0O A;  1ESV A;  3JXU A;  1YIJ N;  3H6E A;  3O4W A;  4BRF A;  4YDU C;  4FWS A;  1NLV A;  5CZ2 A;  3E1Y A;  3BF3 A;  3MX2 A;  2HHV A;  5FRM A;  3L0Q A;  3WQU A;  1HR0 K;  2Q2R A;  4LF9 K;  4B1Z A;  3Q7B A;  1RT3 A;  1HNI A;  4M3R A;  4FWM A;  4O4G A;  4CFB A;  1HJO A;  1QVF M;  2ZQB A;  2DY4 A;  3LP0 A;  4H0O A;  1EO1 A;  3SQ4 A;  2QI2 A;  1FK9 A;  5ELZ A;  4DV3 K;  4JV5 K;  2NNW A;  3CET A;  4WFA L;  3QIO A;  4JN4 A;  2HHW A;  1NBW A;  4LY7 A;  1C0T A;  4E1M A;  4GVM A;  3U9Z A;  1Q81 O;  5AQK A;  3FFI A;  3SBT A;  3VF2 A;  1WSI A;  1BL3 A;  3V9X A;  4GKK K;  3UIQ A;  2J4R A;  1IKX A;  4H5W A;  2E88 A;  2Q97 A;  3OYE A;  2VQE K;  1HX1 A;  1VSD A;  3SAG A;  3NE6 A;  4W5T A;  3NGI A;  2JGU A;  4DWI A;  4M3Z A;  4DV1 K;  2YHA A;  2YKM A;  4WFB L;  1VQL N;  3SAF A;  4QS7 A;  4CHY A;  4ISF A;  4ISE A;  3AVA A;  3VEW A;  3ZSY A;  2HHX A;  1NGF A;  3DWL A;  5KTQ A;  1X1P A;  1WSH A;  4CBU A;  1ZBH A;  3JSM A;  1VQN N;  3MDQ A;  2A42 A;  3WXM B;  3AA4 A;  3TI0 A;  1M1K O;  1REV A;  5DMR A;  4ISG A;  4F2S A;  3H1Q A;  1H1V A;  1U48 A;  1NNE A;  2A1R A;  1ATS A;  3QFP A;  4DR3 K;  4CJF A;  3CD6 N;  1YT3 A;  2DPN A;  3ZT0 A;  1J5E K;  4E7L A;  3G71 N;  2OTJ N;  5CYQ A;  1KLN A;  4FJ5 A;  1SKR A;  4DV2 K;  3DLL L;  3MN6 A;  1HNX K;  2HW3 A;  2OPR A;  3NFA A;  3CC2 N;  1WSE A;  2E4L A;  3LP2 A;  2FSK A;  1FKP A;  3V1O A;  3O9S A;  3VQ5 A;  3DRS A;  4BQZ A;  4CK2 A;  1FXX A;  3CCR N;  4E1N A;  4ID5 A;  3M3Z A;  3DMJ A;  3ISN C;  3KLF A;  4FK0 A;  3ZSX A;  3S9H A;  1TKX A;  2VG6 A;  4RG8 A;  5GIO A;  4E7J A;  3CYM A;  1X9W A;  1BQM A;  1NKE A;  5AZI B;  4DHY A;  2UU9 K;  4CFD A;  5JVG L;  3UKU B;  4DSE A;  4OLB A;  4LSN A;  5DM6 L;  3P38 A;  5AZI A;  2QEX N;  1NGE A;  4EZ6 A;  1HYV A;  1T6D A;  3UKU A;  1TVR A;  4DF8 A;  1VQO N;  1O1W A;  3CCQ N;  1Q86 O;  4FLW A;  1QVG M;  1S9G A;  2P1J A;  4JLH A;  1M90 O;  3VER A;  3WNH A;  4AHS A;  4DQS A;  1SS6 A;  4DV5 K;  3CG7 A;  1UAX A;  3J80 O;  3HSC A;  3K5O A;  2GBZ A;  3OBW A;  1KVB A;  4NB4 A;  4B1X B;  3PO4 A;  1MU2 A;  5AFU H;  3LPU A;  1BGX T;  4OGC A;  4I2Q A;  4BGB A;  1U2V B;  2Q0R A;  4YOW A;  3K58 A;  3CMA N;  3SUQ A;  3IG1 A;  1LV5 A;  4DTM A;  1K8K B;  4WQ4 A;  4K41 A;  4M45 A;  2A3Z A;  4B9Q A;  4FL9 A;  2XO7 A;  4A61 A;  1HPZ A;  1U2V A;  3QEP A;  4MQ3 A;  3HL8 A;  5AQP A;  1Q9Y A;  4Q0B A;  1K8K A;  1BO5 O;  3AVB A;  1S1W A;  3VEN A;  4Z4G A;  4BRI A;  2A5X A;  3B8A X;  3IKM A;  3SK3 A;  2PY5 A;  3QET A;  1KXP A;  3AVF A;  3AO4 A;  3A5M C;  2Q31 A;  1L3S A;  2E20 A;  3ZLJ A;  2R7Y A;  3H08 A;  3QBX A;  3H1V X;  4IG0 A;  4FSV A;  4M63 C;  4FJJ A;  4GV3 A;  4N47 A;  3QEX A;  4A5A A;  2CGK A;  3KKS A;  2UUB K;  3HM9 A;  5AFU A;  4K8Z A;  1JXB A;  3C6U A;  1L3V A;  1KVA A;  1XNR K;  4JKB A;  4H4O A;  3CQ8 A;  4E0D A;  1RDB A;  1IJJ A;  1LWC A;  4LH4 A;  1BQN A;  4X66 K;  3O9Q A;  2XY8 A;  4BWJ A;  3V9W A;  1ZBL A;  3WXL A;  4HUG A;  5AQG A;  3OYG A;  4CJK A;  3AO1 A;  3KLH A;  3PX4 A;  3U6F A;  1HLU A;  3O4Q A;  3WT0 A;  3W0L A;  4MLE A;  5GIP A;  4PL8 A;  4CEQ A;  4CJR A;  3E9P A;  3QIN A;  3RTV A;  1HMV A;  3AVH A;  2WOM A;  4G9Z A;  4ZTF A;  1HUX A;  1U04 A;  4E19 A;  3LAM A;  4DSJ A;  5AQN A;  1XWL A;  2WTU A;  2ATQ A;  1BDG A;  3NMU A;  3VEV A;  1FKO A;  4CIE A;  4M41 A;  3SQ2 A;  1VQ8 N;  3VOV A;  2GUI A;  3SNN A;  1UOC A;  4DTR A;  1KAX A;  2UYT A;  2KLA A;  5LJV A;  1W0H A;  1VSL A;  2IVO A;  3ZT2 A;  3H46 O;  5J2M A;  2NRV A;  3L2R A;  4DLG A;  2HBL A;  4GNI A;  1NGB A;  3OYD A;  3EKU A;  4FLX A;  1WN7 A;  4DV4 K;  3CCJ N;  5E26 A;  2VG5 A;  2P5G A;  3M8P A;  3KWG A;  3SMS A;  1WOQ A;  4Y0W A;  2VWJ A;  5BRD A;  4CZL A;  4YHH K;  3CJB A;  5C0Y A;  1RDU A;  1N6Q A;  3K5L A;  1A5V A;  5AQZ A;  3V81 A;  1ZBI A;  4HWI A;  4CHQ A;  4ELU A;  3ZX3 A;  2YJF A;  3TAE A;  3MXI A;  4FLT A;  3TSP A;  4J2D A;  4BGA A;  1XC3 A;  5AQU A;  1U49 A;  1ATR A;  1EP4 A;  3ZSR A;  4CZK A;  2Y1I A;  1VQ7 N;  4IKF A;  5FPM A;  3EE9 A;  4O0J A;  4YOY A;  1ZBU A;  3K5N A;  3KZB A;  4M3W A;  2KQ2 A;  4FO0 A;  2KTQ A;  3K2P A;  3OYA A;  3FZL A;  2GV9 A;  4YY3 K;  4HUF A;  3TWH A;  3CCL N;  4Z4H A;  1BIU A;  5AQJ A;  3HPO A;  2W42 A;  5CYM A;  1JLQ A;  3F2K A;  1RNH A;  3L4I A;  3NVM A;  2JWK A;  2I7P A;  4XEI A;  4B9T A;  4CVN E;  4CZF A;  5HRN A;  1SAZ A;  3G4S N;  1GLL O;  3E9O A;  5T7B A;  1FW6 A;  4IOA L;  4OJR A;  4BR7 A;  4QS8 A;  4JKC A;  1YTU A;  4CEC A;  3KK3 A;  2NLX A;  3NF9 A;  2KFN A;  3FFK B;  5ADX A;  4DR4 K;  3DOK A;  4IJN A;  4CZG A;  2OCE A;  4B1V A;  1JKH A;  1BU6 O;  3CFR A;  3PIO L;  4FLZ A;  4X62 K;  3CCU N;  3K57 A;  3MN7 A;  5LMU K;  4L3Q A;  1T05 A;  3QNN A;  3T69 A;  2X6N A;  4CGD A;  1XHZ A;  3WNG A;  1RT6 A;  3VQ8 A;  1YI2 N;  2D1K A;  3M5R A;  4NLC A;  3CFP A;  3L2V A;  4IFE A;  3LDN A;  1SZ2 A;  1IV0 A;  1X9J A;  2G8W A;  1K6Y A;  5FPE A;  1IO2 A;  3K5M A;  3HYF A;  1D5A A;  3VMF B;  1NK6 A;  1D9F A;  4B08 A;  1HNW K;  1N33 K;  4CJ5 A;  3CC7 N;  3O1W A;  4DQI A;  3C0B A;  1J9A A;  1XNQ K;  4DV7 K;  1TL1 A;  3EE8 A;  4FCY A;  1NGJ A;  4JS4 A;  1X3M A;  5AQR A;  5F1X A;  2E2N A;  3SAH A;  4OPK A;  3T1Y K;  3RMC A;  4QAG A;  1LAV A;  1IKW A;  3DXM B;  4OKE A;  1EQY A;  3SJH A;  3P39 A;  4K8X A;  4PKI A;  5CHI A;  3VEO A;  4W5R A;  4KTQ A;  1OH6 A;  3NCI A;  4NCG A;  4F3T A;  3DXM A;  1NMN A;  4FWN A;  1NJI O;  1EKE A;  3CPW M;  3AGR A;  1SL1 A;  4JI6 K;  4LC9 B;  2HBJ A;  1U47 A;  3G10 A;  3WEE B;  3V4I A;  3OYL A;  1YIT N;  2BGG A;  3O5B A;  1T03 A;  2YJE A;  3NF8 A;  3WEE A;  4Y1C A;  3VGM A;  4BR9 A;  3KK1 A;  1RT5 A;  4I2P A;  4PA1 A;  2D0A A;  4CGG A;  4H4M A;  3ZET B;  1G15 A;  4IWV A;  1J54 A;  1B92 A;  2BTF A;  3FGU A;  1KQS M;  1VQ4 N;  3GDQ A;  4DSK A;  3AA5 X;  4KHW A;  3ZET A;  2ZJQ L;  5D3G A;  3LL3 A;  3C6H A;  3ZEU B;  2WUS A;  3O80 A;  3TSU A;  4B3O A;  4EIA A;  1UA1 A;  1EX4 A;  4I7F A;  3CCV N;  4CGH A;  2FXU A;  3W3D A;  3ZEU A;  4H0V B;  3PUF A;  3R8E A;  1L3T A;  4OX9 K;  4LH5 A;  3GBT A;  2GTD A;  3HPH A;  3EO3 A;  2DFF A;  4DKW A;  4HVJ A;  1JLC A;  3M8S A;  3OVN A;  3O1B A;  3VQE A;  5C25 A;  1NK0 A;  2ZF5 O;  2O8E B;  4DR2 K;  1IKY A;  3FE1 A;  1QSS A;  1D8Y A;  3QB0 A;  1HKG A;  2UUC K;  4JI4 K;  1DGK N;  2QW9 A;  4JD2 B;  3DLG A;  1KCF A;  3C65 A;  3NH1 A;  3VQA A;  2RE2 A;  4BWM A;  3NHG A;  5FLX O;  3G0Z A;  4FJK A;  3OS1 A;  3L3V A;  4CED A;  2O8E A;  2OYQ A;  3UE5 A;  1BHL A;  5HOO A;  4LSL A;  4JD2 A;  3ID8 A;  4BAC A;  2VCP A;  3SCX A;  3ZSW A;  1HNV A;  3U4L A;  1MWM A;  3OJS A;  3KLE A;  3OYF A;  1Z25 A;  1RDC A;  5J2Q A;  4N56 A;  1C1B A;  3CJA A;  1DLO A;  5BN9 A;  4DUZ K;  4EP5 A;  4IEI A;  4DCH A;  2F8T A;  4U67 L;  3U8X A;  2XY5 A;  1BCM A;  3AGK A;  3SQ1 A;  5AQV A;  4NCA A;  3ATV A;  4BG8 A;  4KH6 A;  5C10 A;  2BE2 A;  2YI1 A;  3T19 A;  5AQL A;  1UWB A;  3I8D A;  2OTL N;  2AA4 A;  2HHU A;  1ZBF A;  1KSP A;  2HBK A;  2EWS A;  5GAD P;  1S3X A;  1BCO A;  1TAU A;  1WAJ A;  4DS4 A;  4JRP A;  1RBS A;  3MN5 A;  4HHT A;  3SBG A;  5JIC A;  1CZB A;  2D0B A;  4FOI A;  2HBM A;  3NVK A;  1B9D A;  4OPA A;  3VES A;  1Z26 A;  4EZ9 A;  4KHY A;  3T7Z A;  4K0K K;  4JKG B;  2YV0 X;  4WCE L;  3QIC A;  1MDU B;  4B9V A;  4CJP A;  3E9L A;  3ALY A;  4CEF A;  1WAF A;  3LM9 A;  4CJE A;  1CXU A;  3AA3 A;  4JKG A;  3NDK A;  3AVN A;  2PYJ A;  1JCE A;  2PZS A;  4KI4 A;  1ITG A;  4FW1 A;  1E3M A;  1QS4 A;  1ZBS A;  2GX9 A;  4AHT A;  2YCH A;  1GLC G;  2VGM A;  1RT2 A;  2CH6 A;  2B4J A;  3ENB A;  1NGD A;  4CD1 A;  2IVN A;  4PQU A;  2HHS A;  5FRN A;  3AO2 A;  4BC5 A;  5KGX A;  4DQR A;  2YKN A;  2OPQ A;  4XH4 A;  3CIP A;  1DTQ A;  3OYK A;  4BRM A;  5LY3 A;  3QNO A;  1D4X A;  4E89 A;  3UB5 A;  1S5J A;  4E7H A;  3NGZ A;  1VAZ A;  3J8A A;  2NRX A;  3QLH A;  4CFA A;  4DQQ A;  2Z1H A;  3OW2 M;  4BR4 A;  5KRT A;  1BIS A;  3TAB A;  3L2U A;  4FWL A;  3D45 A;  4CI6 A;  5E41 A;  3LWM A;  1QE1 A;  4W5Q A;  2NRW A;  4LF6 K;  2RF2 A;  2QTD A;  1P8Z A;  2AP1 A;  5TKY A;  2O8F B;  3KK2 A;  1C1A A;  2O4I A;  3OYC A;  2FBY A;  4X65 K;  4H0Y B;  4JI1 K;  1VQ6 N;  3VQ4 A;  4BE0 A;  3PO5 A;  2KZM A;  2O8F A;  4WQ4 C;  2W6K A;  3RSE B;  3FLC O;  4A59 A;  3RRH A;  4B9L A;  4DB3 A;  1J53 A;  5J1E A;  2HMI A;  1O13 A;  3VGK A;  3EL2 A;  4FWR A;  3CHW A;  2Z1I A;  1W2B M;  4FW2 A;  3WQT A;  1W97 L;  3RSE A;  4CJS A;  3M8R A;  1LOT B;  5GIN A;  4CEO A;  4DR7 K;  4AM6 A;  1NG9 A;  4CJV A;  4LFC K;  4Q5V A;  1ASW A;  1SUQ A;  2V7Y A;  3OBY A;  5JLF A;  2G8K A;  3A8Y A;  3L2Q A;  1VSM A;  3L8B A;  4H0T B;  3AV9 A;  1BIZ A;  1HQE A;  1QQO A;  5I42 A;  3TSQ A;  2B6A A;  3Q7C A;  4Z4F A;  1S1U A;  2IOC A;  3RMA A;  2YNF A;  4CJQ A;  3DLK A;  4B9U A;  2IDO A;  3VEZ A;  4C8O A;  1JL2 A;  4EP4 A;  1RT4 A;  3VTI A;  4GV6 A;  3C6A A;  1K73 O;  4AHU A;  2HHQ A;  5TKW A;  3A5O C;  3THV A;  4BE1 A;  4B3M K;  4IDK A;  4ILG B;  5E84 A;  4A5B A;  1NK5 A;  1NGA A;  3M1F A;  5EY4 A;  2XHB A;  4IOC L;  1X9S A;  3AA2 A;  1NJY A;  1SL2 A;  3O6W A;  4OPH A;  3RVC A;  2YHB A;  3AAQ A;  2KHO A;  1SV5 A;  2F9W A;  4GY2 B;  3IFR A;  3CJC A;  4JKF A;  1KLM A;  3K0S A;  5HRO A;  2ZWH A;  2D0P A;  3VA0 A;  3V9S A;  4H8K A;  4IJA A;  3R1X A;  3P31 A;  2YNH A;  4DF4 A;  1OKJ A;  3TPQ A;  4CJ3 A;  5HP1 A;  3D6R A;  1SL0 A;  3O9T A;  4JEP A;  1VK0 A;  1RTD A;  3SUO A;  2P9K B;  4PKH A;  4N5S A;  1LWF A;  3OYB A;  4Z94 A;  1TGO A;  4V19 S;  2FC0 A;  4JK8 A;  1FJG K;  2EHG A;  3DLR A;  2WC9 A;  2YNI A;  2P9K A;  3TU5 A;  4MO5 A;  4RCH A;  1ZYQ A;  1BOT O;  4O5B A;  5IT9 O;  4ELT A;  2BDP A;  2OA8 A;  3H45 C;  4B8A B;  3F5T A;  4FLU A;  1KC8 O;  1VQ5 N;  4JKD A;  2ZGY A;  3GE1 A;  3L2W A;  5LMN K;  3VET A;  4JI2 K;  3OY9 A;  3VQD A;  3HK2 A;  1Q82 O;  4CBX A;  4B9N A;  4FZZ A;  3DLH A;  1VSF A;  4RW6 A;  3K59 A;  1NKB A;  4CIG A;  5FDL A;  3TTC A;  4CZI A;  5A2Q O;  3H3O B;  4DTU A;  4CZE A;  4DLE A;  3VEX A;  3NGY A;  3LDS A;  4TSX A;  2KKZ A;  3CFO A;  1TKZ A;  4DTO A;  1U6Z A;  1WBB A;  1TKT A;  4DSI A;  1RFQ A;  2IGI A;  3TAM A;  3VF6 A;  1IKV A;  4H5R A;  4BR2 A;  2G8H A;  4H0X B;  5JS1 A;  2QKB A;  3MN9 A;  3O9U A;  3VGL A;  1TK5 A;  1HYS A;  4B3S K;  4WE1 A;  5KGW A;  2I7N A;  4BVP A;  3C7N B;  1Z6R A;  2FBT A;  4BQL A;  1N34 K;  4KHP K;  1NOY A;  4JS5 A;  3HP9 A;  1T3V A;  1I94 K;  1MWK A;  3ZT3 A;  4FWO A;  2HST A;  3D7E O;  2E2O A;  4CHO A;  1IBM K;  1JCF A;  2ETJ A;  3C7N A;  4MO4 A;  1X3N A;  3HP6 A;  5HRS A;  3QFU A;  1QQN A;  4BE2 A;  3CXC M;  5KQD A;  2HOE A;  4FWQ A;  1WBD A;  2UXD K;  1BG3 A;  2VQF K;  2HHH K;  4N76 A;  4ZHR A;  1XC9 A;  4B1Y B;  2FBX A;  3JYT A;  3VF4 A;  3RR7 A;  3ZT4 A;  4BDY A;  4PKG A;  5BR9 A;  4X64 K;  4FM2 A;  3HT3 A;  2VWB A;  3RR8 A;  2F4V K;  4WQ5 A;  2QXL A;  4YOV A;  3AVG A;  2VG7 A;  4UY8 O;  4KB1 A;  2D5R A;  4DTN A;  4DU1 A;  3BY5 A;  2IC3 A;  3SUN A;  1RIL A;  3DRP A;  5EOY A;  1EWR A;  1RT1 A;  1KAY A;  4JI0 K;  2PAV A;  5B8H A;  3O3F A;  4RW8 A;  5M1N A;  3AVJ A;  2Y1J A;  2IAJ A;  3DJC A;  2UXB K;  3KJV A;  3LM2 A;  4AM7 A;  3G25 A;  1EWQ A;  3BEX A;  1QHA A;  4EFH A;  2QKK A;  2ZE2 A;  3TAR A;  1HKC A;  4JAX A;  2RPI A;  4EHT A;  1RGI A;  2BAN A;  3CCM N;  5KQ8 A;  4IG3 A;  1QSL A;  3LP1 A;  3LAL A;  4CER A;  2GWK A;  4JYA K;  4GW6 A;  2ITM A;  4DTS A;  4BVO A;  4B3T K;  1GOC A;  3ASM A;  4A57 A;  2VGN A;  1NGH A;  4H5N A;  2Q36 A;  1WSF A;  4JKA A;  4DSF A;  3RMD A;  2HND A;  1JLE A;  4YOU A;  3FZF A;  4H0P A;  3VQ7 A;  3QDK A;  2E2P A;  2QWR A;  1YHQ N;  3HOS A;  3M6G A;  4CEZ A;  5JLH A;  3DLB A;  4JK7 A;  2KFZ A;  3J7Z O;  1E4G T;  1YTA A;  2QWQ A;  3H3N O;  3R3L A;  4PHT X;  3N4Q A;  4YOR A;  2GUP A;  2NZT A;  2QXF A;  3OYN A;  4FJN A;  4M42 A;  4FJ7 A;  1Y97 A;  4CJU A;  4DUY K;  1KRP A;  1N32 K;  2CGJ A;  3VQC A;  5K14 A;  1T8E A;  3T1H K;  2UUA K;  4FK4 A;  1C0M A;  3S3M A;  5C12 A;  1S1V A;  2YX6 A;  4KAZ A;  3NF7 A;  3L3U A;  4RWT A;  5FPD A;  4FLV A;  1IBL K;  2GWJ A;  1R59 O;  2BH1 A;  3SV3 A;  4IXC A;  4GV9 A;  2RKI A;  3MWP A;  3JAM O;  4O0I A;  3WXJ A;  3KK7 A;  4DG1 A;  3LWL A;  3G6E N;  1DT9 A;  4E7I A;  3QIP A;  3FZH A;  1JLB A;  5C15 A;  4HTU A;  4PWD A;  4FPB A;  3TR8 A;  5AQY A;  4H5V A;  1NK8 A;  2KZZ A;  3TAF A;  1B9F A;  4CCH A;  1LAW A;  3VQP A;  4CZM A;  5GAE P;  5MLC Q;  1S22 A;  1YVU A;  2V7Z A;  1BI4 B;  3VQQ A;  3RWU A;  3EY1 A;  4FZY A;  3CPE A;  4CF8 A;  1OVY A;  1GLB G;  1NU0 A;  5M1F A;  3J7A P;  1BI4 A;  3L4Q A;  4JI8 K;  4FLY A;  1WSG A;  1NWK A;  3HJF A;  1ATN A;  5AR0 A;  2P9N B;  4BC4 A;  3HO1 A;  3CM6 A;  1IG8 A;  1A5W A;  2HVH A;  3OA9 A;  1LW0 A;  4LF8 K;  1C0U A;  3HI0 A;  3F73 A;  4RW9 A;  1W9H A;  2P9N A;  3L6Q A;  1YF5 L;  5AQS A;  2F9T A;  1LW2 A;  2QWL A;  4A2A A;  3DM2 A;  1HKB A;  3R9P A;  3WUH A;  1I3A A;  3T3F A;  1KVC A;  4DMN A;  1IG9 A;  1S6Q A;  4WFN L;  4CEB A;  1S72 N;  1T44 A;  1X9M A;  4BC3 A;  3P5J A;  4F8R A;  5GAG P;  2A41 A;  2CGL A;  3V1R A;  4CW7 B;  4DR1 K;  3O9R A;  3GOI A;  1TL3 A;  3NH0 A;  3ZYY X;  1K9M O;  5BR8 K;  4CGJ A;  4F4K A;  2E2Q A;  4CGI A;  4KO0 A;  5C2F A;  1K8A O;  4B3R K;  5AQF A;  4LFB K;  1C0F A;  5I9E B;  3SMP A;  4BY9 C;  2E6L A;  2P9P B;  4OLA A;  1HQU A;  3VQ6 A;  2E8A A;  4KRF A;  3K9K A;  3CJ9 A;  3OYH A;  5JMV A;  5J2N A;  1WB9 A;  3QO9 A;  5J2P A;  4FJI A;  3HM8 A;  4BRN A;  2P9P A;  4EAH D;  1IBK K;  4W5N A;  4KHS A;  3NAE A;  3AAR A;  3OYJ A;  1IH7 A;  1RT7 A;  2FSN A;  3ZT1 A;  3QEI A;  2Q1N A;  4CJ4 A;  4O44 A;  1YJW N;  4J2B A;  2X74 A;  5FPN A;  3ULE B;  1VRU A;  4NO7 A;  1OH7 A;  1QTM A;  4IO8 A;  4CEA A;  1EXQ A;  2O8C B;  3BDP A;  3S3N A;  4FWP A;  4BDZ A;  4BG9 A;  1VSH A;  5AQX A;  4C8N A;  4FYD A;  1NJW A;  2DTU A;  3ULE A;  4YNQ A;  4ELV A;  3U3G A;  5AQQ A;  3MCA B;  2O8C A;  4HCC A;  1Q8I A;  2BUP A;  3T1A A;  4A2B A;  3KLG A;  4AIL C;  3MXM A;  4KHQ A;  3O3G A;  4NCB A;  3BUZ B;  3TTF A;  3PSF A;  4CZH A;  4CEE A;  1TYQ B;  3ZX2 A;  3IMX A;  3RMB A;  5HBM A;  1WSJ A;  4IO9 L;  3AVC A;  3KLI A;  3CJ7 A;  1VHX A;  2NUB A;  3VQB A;  1S1T A;  4JNE A;  1JCG A;  4FZX C;  5CZ1 A;  4BRH A;  4RTF D;  4DR6 K;  1DKG D;  1TYQ A;  4FJL A;  3C94 A;  2YHW A;  4CE9 A;  2F7T A;  3BZK A;  1RDA A;  3MEG A;  3D2F B;  5M1P A;  4WF9 L;  2YHX A;  4EHU A;  3HVR A;  1NK9 A;  2YNG A;  2UXC K;  4FM0 A;  3NBP A;  2V52 B;  4K25 A;  5BPN A;  3D2F A;  1RBV A;  4F3O A;  4KTW A;  1ASU A;  3IUC A;  4Z0U A;  2EX3 A;  4CES A;  2P9I B;  1TUU A;  1YXQ A;  2DFE A;  3LZI A;  3VEY A;  3HBT A;  1BWF O;  3F9K A;  1VQ9 N;  5AQW A;  2PBD A;  4I9Q A;  2QWP A;  4BC2 A;  4CF2 A;  3DI6 A;  1XMO K;  1U45 A;  4NYF A;  4XIU A;  2E6M A;  4BRK A;  4YDU A;  2A40 A;  1S6P A;  2P9I A;  3E01 A;  3O3H A;  1RBU A;  1RTJ A;  2Z1G A;  2IS3 A;  1N8R O;  3A0I X;  1BA0 A;  2RN2 A;  5EU7 A;  3EYZ A;  3D0P A;  4BRE A;  5LJW A;  4CJT A;  4O5F A;  5M1Q A;  4XH5 A;  3OYI A;  4KKO A;  3I55 N;  3I8B A;  4JI7 K;  3VQ9 A;  1Q9X A;  2HHT A;  4B1U B;  1E4F T;  4DSL A;  4OKK A;  3WNE A;  2H3G X;  1VQP N;  3DRR A;  4ICL A;  1GLF O;  2G8F A;  1A5X A;  3MX5 A;  1N36 K;  4I6M B;  3LDP A;  2HNY A;  4FOE A;  2O4G A;  3HST B;  4Z4E A;  2VYP A;  3MXJ A;  3OS0 A;  3GG4 A;  1BUP A;  5M1O A;  2P51 A;  4AQY K;  1KAZ A;  4FK2 A;  3VN5 A;  4I6M A;  3A2F A;  4DFJ A;  1GOB A;  4WYB A;  1S1X A;  4M3T A;  2CH5 A;  4Z4C A;  3PLA A;  5KPZ A;  3PV8 A;  3PX0 A;  4GKJ K;  5C24 A;  4KHN A;  1YUW A;  3QEW A;  4M3Y A;  1VQK N;  4BRD A;  2G8I A;  4BRQ A;  2ZM6 K;  2NRR A;  2P9L B;  1JLA A;  3CCE N;  1NK7 A;  1U4B A;  4CHZ A;  2FLO A;  4AHV A;  3F9M A;  3B6O A;  4ILH A;  4QS9 A;  5IWA K;  2P9L A;  3HOT A;  5HRP A;  1TKD A;  3PX6 A;  1OVQ A;  4FJ8 A;  5JVH L;  4DFP A;  4J2A A;  1WLJ A;  4DQP A;  1JLF A;  3EEQ A;  1XMQ K;  2G8U A;  3LAK A;  4M7X A;  4G1Q A;  1YVN A;  3EN9 A;  4QOZ B;  4AHC A;  2QWO A;  4CHN A;  4DFK A;  4R79 A;  5BRF A;  4RW4 A;  4LFA K;  4IEE A;  4DFM A;  3KD1 E;  1QQC A;  3IDH A;  4IZ9 A;  5HRR A;  4C23 A;  2F96 A;  2XY7 A;  1DEJ A;  3ENO A;  3V1Q A;  1XI1 A;  4CFC A;  1L3U A;  1NGI A;  2IIR A;  4GVE A;  3SI6 A;  1NGG A;  4KBO A;  4FVU A;  2ASM A;  4KB0 A;  4FM1 A;  3SUP A;  5BN8 A;  4BDP A;  3HVT A;  2P9S B;  3J7Y P;  1C1C A;  4J2E A;  3A5L C;  2JWL A;  3AVL A;  4OKJ A;  4NXM K;  2NRZ A;  4B1W B;  5AZJ B;  2P9S A;  1T7P A;  4MFB A;  4H03 B;  3BZC A;  4R5P A;  4NYN A;  1SKW A;  4M3U A;  2LSN A;  4CBW A;  5AZJ A;  4FJM A;  4KH4 A;  3SZ2 A;  4DU4 A;  4KTZ A;  1TK0 A;  1RTH A;  4A62 A;  5KI6 A;  2A1S A;  3EKS A;  1TV6 A;  3LDL A;  4FWK A;  3NF6 A;  5AQI A;  1VRT A;  5HLF A;  3AO5 A;  3E66 A;  1HNZ K;  1D9D A;  4QCL A;  3SJJ A;  5CR4 A;  3CQX A;  1JL1 A;  2I5J A;  2WON A;  4CJL A;  1VSJ A;  3WNF A;  1KD1 O;  1L5U A;  5SZT A;  1CZA N;  3IRX A;  4E1J A;  5AQM A;  2OAN A;  2WFB A;  3OYM A;  4MLH A;  2P5O A;  4ILJ A;  4LF5 K;  4UQG A;  2QWN A;  2D0C A;  4CHP A;  3KWI A;  3LDQ A;  2Z1J A;  4IOX A;  4HCB A;  2W41 A;  1RDD A;  2O8D B;  2RHK A;  4BRL A;  4JRQ A;  1J6Z A;  2O8D A;  3B6P A;  1G99 A;  1Q18 A;  3HXM A;  3SLC A;  2GEL A;  3KHY A;  3JS6 A;  4O8U A;  3V9Z A;  4KHU A;  2FSJ A;  4WQ5 C;  3WXI A;  5AQT A;  3ZSZ A;  3NH2 A;  2JLE A;  4FJG A;  4E7K A;  2W40 A;  4CF9 A;  3QEV A;  1YJN N;  1RBT A;  5BRE A;  3J81 O;  4CZJ A;  4W5O A;  3D2E B;  3LPT A;  1GOA A;  3V6D A;  2HMP A;  5BPL A;  4F2R A;  3EZW A;  3THW B;  4DTP A;  1CLQ A;  3D2E A;  1HPM A;  3VA3 A;  3TAG A;  1JJ2 M;  2O8B B;  4BR0 A;  1KFD A;  3QES A;  3C6T A;  4FXD A;  3ZSO A;  2ASP A;  5CE3 A;  3THW A;  2IVP A;  3M8Q A;  4DR5 K;  3TAN A;  3KKR A;  3DXK B;  4ZTJ A;  1R0A A;  4JI5 K;  3O4N A;  2HVI A;  2O8B A;  1P90 A;  1SQK A;  4DU3 A;  1VSK A;  4PY5 A;  1VSI A;  5BRH A;  4DV6 K;  3ULD A;  4GMJ B;  2AJQ A;  1NK4 A;  3DXK A;  2D4W A;  1ZXO A;  3DAW A;  4KFB A;  3PIP L;  3QER A;  4H5T A;  2XRI A;  2HNZ A;  4OGE A;  5HL7 L;  3CM5 A;  4CD3 A;  5ADX H;  1NJX A;  2ITG A;  5C2D A;  4CJW A;  5F2R A;  1EET A;  2QM1 A;  1HYZ A;  4Z4I A;  4K43 A;  3VPZ A;  1RCH A;  4BR5 A;  4DV0 K;  1ASV A;  2FF6 A;  1JLG A;  3AVM A;  2QWM A;  3ITH A;  5FRO A;  3MK6 A;  4HUE A;  4DTX A;  4C1N I;  1WUA A;  1QZ5 A;  5KRS A;  2NRH A;  1WNS A;  1W7A A;  3N4P A;  3PSI A;  2YHY A;  4KI6 A;  1OH8 A;  2ZJR L;  4LD0 A;  4K42 A;  5CY4 A;  3CJ1 A;  3LZJ A;  4BRO A;  3P1G A;  4DQ8 A;  1VQM N;  2FF3 B;  4C1N K;  3OHR A;  3TAP A;  4CF0 A;  5EX5 A;  1TK8 A;  5LL6 Z;  4DTJ A;  3SYZ A;  4B9M A;  1YAG A;  4JKH A;  1KTQ A;  3ATU A;  1Y64 A;  5F0X A;  3DLE A;  3KVG A;  3THY B;  2B5J A;  2E1Z A;  3HRG A;  3CQY A;  1HRH A;  5KPT A;  1BA1 A;  3ZX0 A;  3OTO K;  3WXK A;  3I0S A;  4BRG A;  1ZC6 A;  1ILY A;  3ENH A;  3VTH A;  4B8C A;  4BRC A;  3THY A;  3P83 D;  4OPJ A;  3V9U A;  4RW7 A;  4CJ7 A;  1GLJ O;  1YJ9 N;  4KPY A;  3TAQ A;  5M1K A;  3HZ6 A;  4B9S A;  3ZSV A;  4YFU A;  1LWE A;  1S9E A;  1OH5 A;  1HJR A;  4OVL A;  2PFU A;  4CF1 A;  3MMV A;  2ZGZ A;  1JXE A;  3AVI A;  4FPA A;  2P9U B;  4IFY A;  4BRP A;  4KV8 A;  3AVK A;  3QML A;  3QBW A;  3A5N C;  1DTT A;  5EVZ A;  3AY9 A;  2Q3S A;  3BP8 A;  3BF1 A;  2G8V A;  4BRA A;  2P9U A;  4XH1 A;  3ID6 A;  4M7Y A;  4CK3 A;  4JK9 A;  1Q7Y O;  3EZ5 A;  3S3O A;  2ASO A;  5KPR A;  1RTI A;  3AO3 A;  3P4I A;  4I9L A;  3LAN A;  1F21 A;  4E3S A;  3DYA A;  2DFH A;  3O08 A;  2ZJP L;  3FZM A;  3CC4 N;  2A6A A;  4OO1 J;  2X6S A;  3MED A;  2OZM A;  5DK5 A;  1J5O A;  4MDB A;  1NM1 A;  2NRT A;  2WBN A;  3PY8 A;  4J8F A;  4C8L A;  4CK1 A;  2QK9 A;  4YOX A;  4DS5 A; 
#chains in the Genus database with same CATH homology
 3C94 A;  4AHU A;  2HHQ A;  4IFV A;  5C42 A;  4CE9 A;  2VG5 A;  2P5G A;  3M8P A;  1QSY A;  3THV A;  4KRE A;  1RDA A;  4BE1 A;  3MEG A;  4M3X A;  5SWM A;  4N41 A;  1RBR A;  4FVM A;  2VWJ A;  3HVR A;  4IDK A;  4FJX A;  1NK5 A;  1NK9 A;  2YNG A;  2XHB A;  1UA0 A;  3U3Y A;  3K5L A;  1A5V A;  1N6Q A;  3V81 A;  1X9S A;  3C95 A;  3RRG A;  1ZBI A;  2OPS A;  4CHQ A;  3AA2 A;  2VWK A;  4FM0 A;  2OPP A;  3NBP A;  1NJY A;  1SL2 A;  4ELU A;  3KIO A;  1RBV A;  2YHB A;  1NJZ A;  3TAE A;  3MXI A;  4F3O A;  4AHR A;  4KTW A;  1SV5 A;  1ASU A;  4FLT A;  4Z0U A;  2EX3 A;  4J2D A;  4CES A;  2DFE A;  3HPG A;  3LZI A;  3MAQ A;  3SPZ A;  3ZSQ A;  1U49 A;  3IAY A;  2KW4 A;  1KLM A;  3F9K A;  5HRO A;  4I9Q A;  4CF2 A;  1EP4 A;  3DI6 A;  3ZSR A;  3VA0 A;  4NYF A;  1U45 A;  3MEE A;  4O55 A;  4H8K A;  4XIU A;  3V9S A;  2Y1I A;  4IKF A;  2E6M A;  3E01 A;  1S6P A;  4O0J A;  3O3H A;  1CXQ A;  1RBU A;  1RTJ A;  1ZBU A;  2YNH A;  3K5N A;  4DF4 A;  4M3W A;  2Z1G A;  4CJ3 A;  2KQ2 A;  5HP1 A;  2IS3 A;  2KTQ A;  3K2P A;  1SL0 A;  3OYA A;  2GV9 A;  2RN2 A;  1VK0 A;  4HUF A;  3TWH A;  1RTD A;  3SUO A;  4Z4H A;  5EU7 A;  1BIU A;  3HPO A;  2W42 A;  5CYM A;  4N5S A;  3EYZ A;  5JS2 A;  4IBN A;  1JLQ A;  1LWF A;  3OJU A;  1RNH A;  3D0P A;  4L8R B;  3OYB A;  2HB5 A;  1TGO A;  4CJT A;  4B9T A;  2F8S A;  3ZCM A;  2FC0 A;  3OYI A;  2EHG A;  4KKO A;  3DLR A;  5HRN A;  2YNI A;  3OS2 A;  3KTQ A;  3VQ9 A;  1Q9X A;  2HHT A;  4DSL A;  1ZYQ A;  4OKK A;  3WNE A;  4O5B A;  5T7B A;  3SQ0 A;  1QHT A;  4ELT A;  2ZD1 A;  3SPY A;  1N5Y A;  2BDP A;  3I0R A;  4B8A B;  2OA8 A;  3DRR A;  4FLU A;  4OJR A;  4ICL A;  4Y1D A;  2G8F A;  1A5X A;  3MEC A;  2PYL A;  3L2W A;  1YTU A;  4CEC A;  2HNY A;  3KK3 A;  1CZ9 A;  2O4G A;  3VQD A;  3NF9 A;  3OY9 A;  4C8K A;  3HK2 A;  3HST B;  2KFN A;  4Z4E A;  1SKS A;  3OS0 A;  3DOK A;  3MXJ A;  1NOZ A;  4B9N A;  4FZZ A;  2P51 A;  3LP3 A;  4FK2 A;  3DLH A;  1VSF A;  2X78 A;  4RW6 A;  1JKH A;  3VN5 A;  4CIG A;  3K59 A;  1NKB A;  5FDL A;  1NKC A;  4FJ9 A;  3KD5 E;  3CFR A;  3A2F A;  2FBV A;  4DFJ A;  1GOB A;  4FLZ A;  1S1X A;  3SV4 A;  4M3T A;  4Z4C A;  1VSE A;  2OZS A;  3K57 A;  3PV8 A;  3PX0 A;  4AH9 A;  5C24 A;  1T05 A;  4KHN A;  3QNN A;  3QEW A;  4DTU A;  4M3Y A;  1C6V A;  2X6N A;  4CGD A;  4DLE A;  2G8I A;  3NGY A;  1XHZ A;  3WNG A;  3LDS A;  1RT6 A;  3VQ8 A;  4TSX A;  5I3U A;  4ID1 A;  3CFO A;  4C8M A;  1TKZ A;  1JLA A;  3CFP A;  3L2V A;  1U4B A;  1NK7 A;  4CHZ A;  4DTO A;  2XY6 A;  1TKT A;  4AHV A;  4DSI A;  3B6O A;  2IGI A;  3TAM A;  2G8W A;  1K6Y A;  1IKV A;  2G8H A;  1IO2 A;  3K5M A;  3HYF A;  1TAQ A;  1XHX A;  1I39 A;  4PUO A;  4CIF A;  2QKB A;  5JS1 A;  1D5A A;  3BGR A;  5HRP A;  4CGF A;  1TK5 A;  1HYS A;  1TKD A;  1NK6 A;  3PX6 A;  4WE1 A;  1D9F A;  4FJ8 A;  4B08 A;  4FJH A;  4DFP A;  4J2A A;  1WLJ A;  3DOL A;  3IS9 A;  1JLF A;  5KGW A;  1KFS A;  4DQP A;  2G8U A;  2FBT A;  3LAK A;  4CJ5 A;  4G1Q A;  4JS5 A;  1NOY A;  3HP9 A;  4QOZ B;  4AHC A;  4DQI A;  4CHN A;  4DFK A;  1J9A A;  4RW4 A;  3ZT3 A;  1TL1 A;  4FCY A;  5CZ2 A;  4CHO A;  4JS4 A;  2ETJ A;  4DFM A;  3KD1 E;  1QQC A;  5HRR A;  2HHV A;  4OPK A;  5FRM A;  2F96 A;  3RMC A;  3HP6 A;  5HRS A;  2XY7 A;  4QAG A;  1RT3 A;  1LAV A;  1HNI A;  3V1Q A;  4BE2 A;  1XI1 A;  4CFC A;  4M3R A;  1IKW A;  1L3U A;  4O4G A;  4CFB A;  4N76 A;  3SI6 A;  4OKE A;  2ZQB A;  4ZHR A;  1XC9 A;  2DY4 A;  3LP0 A;  2FBX A;  3JYT A;  4K8X A;  4KB0 A;  3SQ4 A;  4FM1 A;  3RR7 A;  3SUP A;  3ZT4 A;  4W5R A;  1FK9 A;  4BDY A;  4KTQ A;  4BDP A;  3HVT A;  3NCI A;  4NCG A;  4F3T A;  3QIO A;  2HHW A;  4FM2 A;  3HT3 A;  1C1C A;  4LY7 A;  1C0T A;  4J2E A;  4E1M A;  3RR8 A;  3AVL A;  4GVM A;  4OKJ A;  3FFI A;  1EKE A;  3AVG A;  2VG7 A;  1SL1 A;  4KB1 A;  2D5R A;  1U47 A;  1WSI A;  1BL3 A;  3G10 A;  3V9X A;  4MFB A;  4DU1 A;  4DTN A;  3V4I A;  1T7P A;  2IC3 A;  3UIQ A;  3SUN A;  1RIL A;  3DRP A;  1IKX A;  3OYL A;  1RT1 A;  4R5P A;  1SKW A;  4NYN A;  3OYE A;  4M3U A;  2BGG A;  3O3F A;  1VSD A;  2LSN A;  4RW8 A;  1T03 A;  4FJM A;  3AVJ A;  3SZ2 A;  2Y1J A;  3NE6 A;  2IAJ A;  4KTZ A;  3NF8 A;  4W5T A;  3NGI A;  4Y1C A;  4DU4 A;  1TK0 A;  1RTH A;  2JGU A;  4DWI A;  3KJV A;  3KK1 A;  4M3Z A;  1RT5 A;  4I2P A;  4PA1 A;  2YHA A;  5KI6 A;  2YKM A;  2QKK A;  2A1S A;  2D0A A;  4CGG A;  4CHY A;  4H4M A;  2ZE2 A;  1TV6 A;  3NF6 A;  3AVA A;  1VRT A;  1G15 A;  3ZSY A;  3TAR A;  2HHX A;  5HLF A;  1J54 A;  1B92 A;  2RPI A;  2BAN A;  3AO5 A;  5KTQ A;  1D9D A;  3SJJ A;  1X1P A;  4QCL A;  1WSH A;  4IG3 A;  1QSL A;  3JSM A;  1ZBH A;  3LP1 A;  3LAL A;  4CER A;  3TI0 A;  3AA4 A;  1JL1 A;  2I5J A;  2WON A;  3AA5 X;  4DSK A;  4CJL A;  1REV A;  4KHW A;  5DMR A;  1VSJ A;  4GW6 A;  4F2S A;  4DTS A;  3WNF A;  5D3G A;  1U48 A;  1L5U A;  5SZT A;  1GOC A;  3ASM A;  3IRX A;  2A1R A;  3OYM A;  1WSF A;  4B3O A;  4DSF A;  3RMD A;  1UA1 A;  2P5O A;  1EX4 A;  2HND A;  4I7F A;  4CJF A;  4UQG A;  1JLE A;  4CGH A;  1YT3 A;  2D0C A;  4CHP A;  3VQ7 A;  3ZT0 A;  3PUF A;  4E7L A;  2Z1J A;  1L3T A;  4LH5 A;  3HPH A;  4HCB A;  2DFF A;  1RDD A;  4CEZ A;  5CYQ A;  4HVJ A;  1JLC A;  1KLN A;  3DLB A;  3M8S A;  3OVN A;  3VQE A;  5C25 A;  1NK0 A;  1SKR A;  4FJ5 A;  1YTA A;  1IKY A;  1D8Y A;  1QSS A;  2HW3 A;  4JRQ A;  2OPR A;  3NFA A;  3DLG A;  1KCF A;  3NH1 A;  3VQA A;  2QXF A;  1WSE A;  4BWM A;  3OYN A;  4FJN A;  2E4L A;  3B6P A;  4M42 A;  3LP2 A;  4FJ7 A;  3NHG A;  1Y97 A;  4CJU A;  3G0Z A;  4FJK A;  1FKP A;  3L3V A;  3V1O A;  3VQ5 A;  4CED A;  3OS1 A;  3HXM A;  2OYQ A;  3DRS A;  4CK2 A;  1BHL A;  1KRP A;  4LSL A;  3V9Z A;  1FXX A;  4KHU A;  4E1N A;  4ID5 A;  4BAC A;  3SCX A;  3VQC A;  3DMJ A;  3ISN C;  3ZSW A;  3KLF A;  1HNV A;  3ZSZ A;  3OJS A;  3KLE A;  3OYF A;  4FK0 A;  5K14 A;  3ZSX A;  3NH2 A;  1TKX A;  2VG6 A;  4RG8 A;  4E7J A;  3S9H A;  3CYM A;  2JLE A;  1T8E A;  1X9W A;  4FK4 A;  1BQM A;  1Z25 A;  4E7K A;  1C0M A;  4CF9 A;  3S3M A;  4FJG A;  1RDC A;  5J2Q A;  4N56 A;  3QEV A;  1C1B A;  1RBT A;  1NKE A;  1S1V A;  4HCC A;  4W5O A;  1DLO A;  4KAZ A;  3NF7 A;  3LPT A;  3L3U A;  4EP5 A;  4CFD A;  2F8T A;  1GOA A;  4FLV A;  3V6D A;  2XY5 A;  1BCM A;  4F2R A;  4DSE A;  4OLB A;  4LSN A;  3SQ1 A;  3SV3 A;  4DTP A;  4NCA A;  4EZ6 A;  1CLQ A;  2KFZ A;  2RKI A;  4O0I A;  1HYV A;  2BE2 A;  3VA3 A;  3TAG A;  3T19 A;  1TVR A;  4DG1 A;  3LWL A;  1UWB A;  1KFD A;  3I8D A;  4DF8 A;  1O1W A;  3C6T A;  3QES A;  1ZBF A;  2HHU A;  4E7I A;  4FXD A;  3ZSO A;  4FLW A;  3QIP A;  1KSP A;  1JLB A;  4HTU A;  4PWD A;  3M8Q A;  1S9G A;  2P1J A;  1BCO A;  3KKR A;  3TAN A;  4JLH A;  4ZTJ A;  3TR8 A;  1TAU A;  3WNH A;  1WAJ A;  4AHS A;  4JRP A;  4DS4 A;  4DQS A;  1R0A A;  1RBS A;  1NK8 A;  3O4N A;  2HVI A;  2KZZ A;  3CG7 A;  1UAX A;  4HHT A;  3K5O A;  4DU3 A;  1VSK A;  2GBZ A;  1KVB A;  4PY5 A;  1VSI A;  3TAF A;  1CZB A;  1B9F A;  3ULD A;  2D0B A;  3PO4 A;  4GMJ B;  4CCH A;  1MU2 A;  1LAW A;  2AJQ A;  3VQP A;  1NK4 A;  3LPU A;  1BGX T;  4OGC A;  4KFB A;  4I2Q A;  1B9D A;  1YVU A;  3QER A;  3K58 A;  1BI4 B;  2XRI A;  2HNZ A;  3SUQ A;  3IG1 A;  1LV5 A;  1Z26 A;  4EZ9 A;  4KHY A;  4OGE A;  3VQQ A;  3RWU A;  4DTM A;  3EY1 A;  4FZY A;  3CM5 A;  2YV0 X;  4M45 A;  4B9V A;  4CJP A;  2XO7 A;  4CF8 A;  1NJX A;  2ITG A;  4CJW A;  1HPZ A;  3QEP A;  1BI4 A;  3ALY A;  4CEF A;  1WAF A;  4FLY A;  1WSG A;  4MQ3 A;  3HL8 A;  1EET A;  1Q9Y A;  4Q0B A;  4CJE A;  3HJF A;  1CXU A;  3AA3 A;  3NDK A;  3AVN A;  1HYZ A;  2PYJ A;  3AVB A;  1S1W A;  4Z4I A;  3HO1 A;  3CM6 A;  1A5W A;  4Z4G A;  2HVH A;  1LW0 A;  1RCH A;  2PZS A;  4KI4 A;  1ITG A;  4FW1 A;  1ASV A;  1JLG A;  3AVM A;  1C0U A;  1QS4 A;  2PY5 A;  3QET A;  3F73 A;  4RW9 A;  1W9H A;  3ITH A;  5FRO A;  4HUE A;  4DTX A;  4AHT A;  5KRS A;  1WNS A;  3AO4 A;  3AVF A;  1LW2 A;  1RT2 A;  1L3S A;  4KI6 A;  3DM2 A;  4LD0 A;  2B4J A;  2R7Y A;  3H08 A;  5CY4 A;  1I3A A;  3LZJ A;  3T3F A;  1KVC A;  4DMN A;  4PQU A;  3P1G A;  2HHS A;  1IG9 A;  1S6Q A;  5FRN A;  3AO2 A;  3TAP A;  4CEB A;  4IG0 A;  4CF0 A;  1TK8 A;  4B9M A;  4DTJ A;  3SYZ A;  4FJJ A;  4N47 A;  5KGX A;  4DQR A;  2YKN A;  1KTQ A;  2OPQ A;  3QEX A;  1DTQ A;  1X9M A;  3OYK A;  4F8R A;  3P5J A;  3DLE A;  3KKS A;  3V1R A;  2B5J A;  3QNO A;  3HM9 A;  4E7H A;  4E89 A;  4K8Z A;  1S5J A;  1JXB A;  3C6U A;  3NGZ A;  1L3V A;  1KVA A;  1HRH A;  1TL3 A;  3QLH A;  3NH0 A;  4CFA A;  4DQQ A;  2Z1H A;  4H4O A;  4CGJ A;  3CQ8 A;  3I0S A;  4E0D A;  1RDB A;  4F4K A;  1LWC A;  4LH4 A;  1BIS A;  5KRT A;  4CGI A;  4KO0 A;  3TAB A;  3L2U A;  1BQN A;  3D45 A;  4B8C A;  3P83 D;  5E41 A;  4OPJ A;  3V9U A;  3LWM A;  4RW7 A;  1QE1 A;  2XY8 A;  4W5Q A;  4KPY A;  4BWJ A;  2E6L A;  3V9W A;  3TAQ A;  1ZBL A;  4B9S A;  4OLA A;  4HUG A;  3ZSV A;  1HQU A;  4YFU A;  1LWE A;  1S9E A;  3VQ6 A;  3OYG A;  4KRF A;  1HJR A;  2RF2 A;  3AO1 A;  4OVL A;  4CJK A;  3KLH A;  3U6F A;  3PX4 A;  3O4Q A;  3OYH A;  5J2N A;  3QO9 A;  4CF1 A;  5J2P A;  3KK2 A;  4FJI A;  1C1A A;  1JXE A;  3AVI A;  2O4I A;  4CEQ A;  3OYC A;  4W5N A;  2FBY A;  4IFY A;  3NAE A;  4CJR A;  4KHS A;  3OYJ A;  1IH7 A;  3QIN A;  3VQ4 A;  4BE0 A;  4KV8 A;  3RTV A;  1RT7 A;  1HMV A;  3AVH A;  3ZT1 A;  3PO5 A;  2KZM A;  3QEI A;  2WOM A;  3AVK A;  4ZTF A;  4CJ4 A;  4O44 A;  1DTT A;  4J2B A;  2Q3S A;  2X74 A;  1U04 A;  3RRH A;  1VRU A;  2G8V A;  4B9L A;  1J53 A;  5J1E A;  4E19 A;  2HMI A;  3LAM A;  4CK3 A;  1QTM A;  4DSJ A;  4CEA A;  1EXQ A;  1XWL A;  2Z1I A;  2ATQ A;  4FW2 A;  3EZ5 A;  3BDP A;  3S3O A;  4CJS A;  3S3N A;  1FKO A;  4CIE A;  3M8R A;  4BDZ A;  1VSH A;  4C8N A;  4CEO A;  4FYD A;  4M41 A;  1NJW A;  3SQ2 A;  1RTI A;  3AO3 A;  2DTU A;  4CJV A;  4YNQ A;  2GUI A;  3U3G A;  4Q5V A;  1ASW A;  4ELV A;  1SUQ A;  2G8K A;  3SNN A;  1UOC A;  4I9L A;  3LAN A;  1F21 A;  3L2Q A;  1Q8I A;  3DYA A;  3T1A A;  4E3S A;  4DTR A;  2DFH A;  3KLG A;  1VSM A;  4AIL C;  3MXM A;  4KHQ A;  3L8B A;  3O3G A;  4NCB A;  3AV9 A;  1W0H A;  1VSL A;  2X6S A;  3MED A;  3ZT2 A;  1BIZ A;  1HQE A;  2OZM A;  5DK5 A;  5I42 A;  1J5O A;  4CEE A;  2B6A A;  5J2M A;  3L2R A;  4DLG A;  3RMB A;  5HBM A;  1WSJ A;  4Z4F A;  1S1U A;  2IOC A;  3AVC A;  3KLI A;  3RMA A;  3PY8 A;  2YNF A;  4CJQ A;  3DLK A;  3OYD A;  4C8L A;  2NUB A;  3VQB A;  1S1T A;  4FLX A;  2IDO A;  4CK1 A;  4B9U A;  5CZ1 A;  1WN7 A;  1JL2 A;  4EP4 A;  1RT4 A;  4C8O A;  4DS5 A;  4FZX C;  2QK9 A;  4FJL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...