5CY4A

Crystal structure of an oligoribonuclease from acinetobacter baumannii
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
184
structure length
182
Chain Sequence
HMSSTLNTRLIWIDLEMTGLDTDNDQIIEIATIITDDHLNVLAEGPVLAIHQPDRILNAMDEWNTRQHGQSGLIERVRRSKLTARDAELQTLEFLKKWVNPKVSPMCGNSICQDRRFLHRLMPELEQYFHYRNLDVSTVKELSKRWRPEIMSGLKASHLAMDDIRDSISELKYYREYFFIMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Oligoribonuclease
publication title Crystal structure of an oligoribonuclease from Acinetobacter baumannii
rcsb
source organism Acinetobacter baumannii
molecule tags Oxidoreductase
total genus 65
structure length 182
sequence length 184
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.1.-.-:
pdb deposition date 2015-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00929 RNase_T Exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5cy4A00
1XI1A 1BCMA 1BL3A 1A5XA 1GOAA 2Z1IA 3AVBA 4RW9A 1WSGA 3AVJA 1L3UA 4KHUA 2XY5A 4DQQA 1LWEA 1ZBHA 5J2NA 1JLBA 3ZSZA 4B9LA 3LAMA 4RG8A 3ZT2A 2VG6A 5KGXA 2BDPA 4F8RA 5SZTA 1KLMA 3HO1A 1L5UA 5K14A 1BIUA 4CJSA 3HVRA 2OYQA 2B5JA 4I9QA 3JSMA 2D0BA 4KAZA 3HL8A 4BWMA 4ELVA 3D0PA 1XHXA 3O3HA 4DQIA 4FJGA 1RT4A 3ZSWA 3OYEA 5J2QA 1S1VA 3CYMA 3M8PA 2Z1JA 5HRRA 1LW2A 1TL3A 3DMJA 2YNHA 4CECA 3RR7A 1SL1A 4CK1A 2Y1IA 4DSFA 4FJ9A 3NHGA 3AVFA 3OS1A 5C42A 4KHSA 3LWLA 3QNOA 3JYTA 1HNIA 4DU3A 4EZ9A 4CEQA 3AVMA 5KTQA 1L3TA 4E7KA 3VQ5A 4FJIA 3HJFA 3HM9A 3C6UA 4KRFA 4K8XA 2XY7A 1GOBA 1RT5A 3OVNA 4FW2A 3RRGA 3L2UA 4OLBA 4DTPA 4KTZA 4CHQA 3VA0A 1FKPA 2QXFA 3NCIA 3K59A 4Z4HA 5DK5A 3TWHA 4FM1A 3O4NA 2XO7A 3QETA 2F96A 4CHPA 2KFNA 1KTQA 3AV9A 4CHNA 4CJRA 3NAEA 4B9UA 3CG7A 2YHAA 2G8VA 4FJ5A 3AA4A 4CGFA 2BGGA 1ITGA 3M8SA 3L2VA 4C8KA 4PQUA 1KSPA 3SV3A 2FBYA 1T7PA 1RTHA 1J5OA 3BDPA 1BHLA 1MU2A 2WONA 4ELTA 4EZ6A 1IKWA 4O55A 2I5JA 5EU7A 3OYLA 3RTVA 1TK5A 3M8RA 4F3TA 1U45A 1D5AA 3ASMA 3S3NA 2EHGA 3LP2A 4CCHA 3F73A 3SQ2A 3S3OA 1SKWA 5I3UA 3NFAA 4B9TA 1UWBA 4E19A 4EP5A 2DFHA 1TV6A 4L8RB 1UOCA 3MEDA 1F21A 3H08A 1JXBA 5CYMA 4H8KA 4FLUA 4QCLA 3SPYA 4FJLA 2JGUA 1D9FA 4J2BA 3L2RA 3F9KA 4WE1A 1HMVA 4CIGA 4FJMA 1X9MA 2OZSA 4AHTA 2RKIA 4ID5A 3QIOA 4AHCA 3QIPA 5FROA 3KLFA 4JS4A 1KVAA 1RT2A 3WNHA 3OYCA 3EYZA 4FLVA 3SPZA 4DSIA 4XIUA 4JRPA 3AVHA 4AHVA 1BISA 3MEGA 2YHBA 3DI6A 3VQDA 3U3GA 2G8HA 3V6DA 1Q8IA 3KKSA 2A1SA 4OPKA 3V9XA 1C1AA 2FBVA 4LH4A 2DY4A 3U6FA 1RCHA 3VQ8A 1D8YA 2GV9A 2HHVA 2B4JA 2HVIA 2IS3A 2YNIA 5JS2A 1QS4A 2KZZA 5HRSA 2QK9A 2E6MA 3KLIA 1C1BA 3ZT1A 4HUGA 4DFKA 1QTMA 3DLHA 4DG1A 4KB0A 1A5VA 3AA2A 4CJPA 1TAQA 5HLFA 1Q9YA 4KREA 4LSLA 5KI6A 2PYJA 1DTTA 1WLJA 3MAQA 4DTXA 1NJXA 1LV5A 4M3RA 2G8UA 1TKDA 4CGJA 2D0CA 4IFYA 3SJJA 1EKEA 3LANA 5E41A 3M8QA 3CM5A 4IBNA 1ZBUA 4OPJA 1LWFA 1WSIA 1Z26A 2YKMA 1ASVA 3AVNA 4DTMA 2IGIA 3RRHA 3RMDA 4CJUA 1XC9A 3SV4A 2FBTA 4CHZA 3SQ4A 1QSSA 1RDBA 1X9SA 1JLQA 3QEPA 3B6PA 1JLGA 1X1PA 3KLEA 3TAEA 4B8AB 2Y1JA 1WSFA 4FZZA 1WAFA 2EX3A 4E1MA 2X6SA 4FLTA 1SV5A 5J2PA 3KK1A 1RILA 4AH9A 3ISNC 4O44A 4BE1A 4TSXA 2X6NA 3LWMA 3NGIA 3PO4A 3DLEA 4FLWA 3IAYA 4F3OA 1VSIA 3ITHA 4N76A 1QHTA 4G1QA 4FJ8A 3VQBA 3OYIA 1QE1A 4CESA 4CF8A 4CGIA 4FCYA 5HBMA 1VSDA 2OPQA 1HYZA 5FDLA 1TK0A 3AO2A 2X74A 3EY1A 4DU1A 5KRSA 3EZ5A 1JLAA 3G0ZA 2XY6A 4CFDA 3QEVA 3E01A 1RDAA 1BGXT 1RBUA 2O4IA 3AVGA 4LSNA 2FBXA 1CZBA 3CM6A 1VSFA 4CEAA 2B6AA 4CK2A 3HXMA 4HUEA 1RBSA 3C6TA 3QO9A 3L2WA 2P51A 2HVHA 4OKEA 2E4LA 1WSEA 3SQ0A 4R5PA 2KTQA 4M3TA 1I39A 1B9FA 3KJVA 3PX0A 1TGOA 2GBZA 2HHXA 5SWMA 4Z4CA 4AHRA 4DWIA 3RWUA 3SUNA 1S1XA 1HYVA 3NE6A 4DTUA 3TAGA 3OYNA 3SQ1A 3QINA 4E3SA 1TAUA 4J2EA 4I9LA 4DFJA 2IAJA 2A1RA 1QQCA 4BACA 1TVRA 4W5NA 3LP3A 4CEOA 3NH2A 3V9SA 1RT1A 1WNSA 1JL2A 2F8TA 4N41A 4KB1A 2OPSA 5D3GA 3QERA 1RBVA 1NKCA 3DOKA 3LALA 4F2SA 1BI4B 4GVMA 1SUQA 2ATQA 2Z1GA 4O5BA 1KVBA 1NK8A 4N47A 2XHBA 3K5NA 4FM2A 4DU4A 2E6LA 3L2QA 4JLHA 3CFPA 4M3YA 3KLHA 3K2PA 1VRTA 1L3VA 2DFFA 3ZT4A 1RTIA 3QESA 4OKJA 3P83D 4B9VA 3ALYA 3THVA 4FK2A 1YT3A 4DTJA 3QNNA 1TL1A 4QAGA 4CJVA 2YV0X 3IS9A 1NJZA 4F2RA 2RPIA 3OYBA 3LZJA 3QEIA 4B9MA 2D0AA 1S9EA 4KTQA 2ZE2A 3HP9A 3VA3A 4CEBA 3KTQA 2HHWA 1JKHA 1TKTA 4IFVA 3DLGA 4JS5A 3QEXA 1RBTA 1RTJA 4BE2A 2YNGA 2XRIA 2ETJA 3MXIA 4CE9A 4CJTA 1NK9A 1NOYA 4DSJA 1WSJA 3NBPA 1KCFA 2HHSA 1HPZA 1CZ9A 3T3FA 1VRUA 1XWLA 4CJKA 1TKZA 4AHUA 4YNQA 4W5TA 3K5LA 3SNNA 4M45A 4RW6A 4B08A 1VSMA 3DYAA 3CFRA 1T8EA 1N6QA 2AJQA 4CHOA 4I2PA 3CFOA 3TAQA 4BDPA 3L3UA 2HMIA 4RW8A 1NK6A 3VQAA 5KGWA 4DSLA 4DS4A 3CQ8A 4M41A 1RTDA 3AVCA 1Y97A 1YVUA 4E7LA 3AVKA 4DF4A 4DF8A 3PX6A 3VQ6A 3VQCA 4ICLA 1SKSA 1Z25A 1IKXA 1JXEA 2YKNA 3AVIA 3VN5A 4W5QA 1EX4A 2FC0A 3SUQA 4ZHRA 3OYJA 4FVMA 1U48A 3PUFA 1VSKA 5CZ1A 1VSEA 1R0AA 1C1CA 1UA1A 4F4KA 4CF2A 4PA1A 1TK8A 4FLXA 5HROA 4IKFA 3SUPA 4I7FA 1NKEA 4QOZB 3RMCA 1TKXA 3IRXA 2VG5A 4ELUA 4W5RA 5JS1A 2VWKA 4KI6A 4CIEA 4O4GA 3K5OA 3LAKA 4KTWA 1T03A 4DFMA 4FLZA 4Z4GA 3O3GA 2G8IA 4OVLA 4KV8A 1D9DA 2LSNA 1U49A 3BGRA 3PY8A 4B9SA 4FLYA 4Z4FA 1HYSA 3O3FA 2Q3SA 2NUBA 3V9ZA 3RMBA 1UAXA 2G8WA 3NH1A 3VQ4A 5C24A 3HPHA 1RNHA 3VQ7A 1S1UA 3AVAA 3KKRA 1RT6A 1GOCA 1B9DA 4MQ3A 2Z1HA 3NGYA 4HHTA 3V9WA 2ITGA 4YFUA 3DLRA 4BDZA 3UIQA 2HHQA 1RDDA 3V1QA 4DMNA 4HCCA 4UQGA 4CGDA 1EP4A 4PY5A 3DLBA 1W9HA 3LP0A 4CEEA 2PZSA 3LPUA 4E7IA 3PO5A 5CY4A 1SL2A 1S1WA 4CIFA 1I3AA 1S6PA 3WNEA 4CGGA 2W42A 4KFBA 3KD1E 1IKVA 1RDCA 4OLAA 4KKOA 4M3UA 2IC3A 5CYQA 4E7JA 4M3WA 3TAMA 1FXXA 3TI0A 1KVCA 3DRPA 1S1TA 4LY7A 3K5MA 3ULDA 1BQMA 1NK4A 1K6YA 4FJHA 4FJKA 3T19A 3DM2A 3OYAA 4HUFA 1KLNA 4DSKA 2KFZA 2VG7A 3ZT0A 4CJ3A 4DTNA 4ZTFA 3OYFA 2JLEA 3HPGA 3KIOA 4Z0UA 2RF2A 4OGCA 4NCBA 1S5JA 3I0RA 4M3XA 4FW1A 1HQUA 4KHWA 4FJXA 4M42A 5HRPA 4E7HA 1J9AA 1IKYA 4IG3A 4O0JA 3SYZA 3VQPA 3OS0A 1RT3A 4CEZA 4Y1DA 3OYMA 4DLEA 1O1WA 3ZSXA 3OYGA 4KHNA 3HK2A 1KFDA 2D5RA 1B92A 3SZ2A 1CXUA 4CJEA 4DSEA 4DTSA 2PYLA 3IG1A 1S6QA 1IG9A 3ZSRA 4NCGA 4DTRA 2VWJA 3TARA 1FKOA 4AILC 3MXJA 4LD0A 4DQRA 3QEWA 2QKBA 5C25A 4B9NA 3ZSVA 1EETA 3OJSA 4FZXC 1FK9A 3V1RA 1QSLA 3RR8A 3NF6A 3PX4A 1WN7A 3P1GA 4RW7A 2ZD1A 3O4QA 5HP1A 1IO2A 2YNFA 4AHSA 4KHYA 2IDOA 2KZMA 4MFBA 3QLHA 2O4GA 3V1OA 3TANA 1ZBLA 1UA0A 1T05A 4RW4A 4K8ZA 4FXDA 3MEEA 1CXQA 2HNDA 4CJ5A 1RT7A 1JLEA 4BWJA 5J2MA 3OY9A 2PY5A 1ZBIA 1HRHA 2OPPA 3HT3A 3NF8A 3NGZA 1NK7A 1EXQA 3OJUA 1YTAA 3LP1A 3V4IA 4ZTJA 5FRMA 4IG0A 3A2FA 4PUOA 1G15A 3K57A 1N5YA 3NDKA 1HQEA 4Z4EA 1NOZA 4B8CA 1A5WA 3RMAA 4CF0A 1SL0A 2G8KA 2X78A 1ZBFA 4KI4A 5T7BA 3HPOA 1LW0A 2HNYA 3T1AA 1W0HA 3C95A 5HRNA 2KQ2A 1XHZA 1U04A 4GMJB 3S3MA 4FZYA 3KD5E 4DTOA 4HCBA 4E0DA 1J54A 4BE0A 3OYHA 2P1JA 1L3SA 4H4OA 3TAFA 3TABA 4CFCA 1NJWA 2P5GA 5CZ2A 2HNZA 3DRRA 4FJNA 1VSHA 4IDKA 1REVA 2GUIA 4ID1A 1VSJA 3AA3A 1J53A 1SKRA 1U47A 3L3VA 3HVTA 4CGHA 4C8MA 4PWDA 2HW3A 1S9GA 4EP4A 3HP6A 3ZCMA 4CJLA 4DFPA 4J2AA 1KRPA 4DQSA 4C8OA 3ZSYA 2IOCA 4HTUA 3TAPA 3C94A 2OA8A 1JLCA 3PV8A 1X9WA 3AVLA 3AO4A 3U3YA 4KPYA 1LAWA 2BANA 4CHYA 3V9UA 1NK5A 1IH7A 3P5JA 2HHUA 1BI4A 4I2QA 4NCAA 1C0TA 1BCOA 3AA5X 3AO3A 3OYKA 4Y1CA 3DOLA 2KW4A 3OYDA 3I8DA 1JLFA 3ZT3A 3K58A 3L8BA 1NK0A 4Z4IA 3SUOA 2HHTA 2DFEA 3MECA 1WSHA 3WNFA 4N5SA 4BDYA 1DTQA 2QKKA 2F8SA 4HVJA 1C6VA 1ZYQA 3LPTA 1WAJA 3LZIA 2G8FA 1Q9XA 1LAVA 1YTUA 1VSLA 3V81A 1BIZA 5I42A 4O0IA 1DLOA 1QSYA 4KO0A 2BE2A 4DQPA 1HNVA 4B3OA 3SI6A 3G10A 4DLGA 2RN2A 4NYFA 4FK0A 3FFIA 1HJRA 3KK2A 2OZMA 3KK3A 4CFBA 5J1EA 4M3ZA 4FK4A 1C0UA 4H4MA 4OGEA 4CJQA 3OS2A 3MXMA 3I0SA 5KRTA 4J2DA 4CFAA 4LH5A 4JRQA 4DS5A 1NKBA 1VK0A 1CLQA 1RBRA 3ZSOA 4OJRA 4E89A 2WOMA 1JL1A 4FM0A 4NYNA 3LDSA 3B6OA 4CJFA 4C8NA 3AO5A 4CJ4A 4GW6A 4CEDA 3TR8A 3HSTB 3S9HA 4FJJA 3NF7A 3VQ9A 4Q5VA 2HB5A 1KFSA 3D45A 4N56A 2R7YA 4Q0BA 4CF1A 4CF9A 5FRNA 4CJWA 4FJ7A 4FYDA 2P5OA 4C8LA 4W5OA 4CERA 1NJYA 5DMRA 3SCXA 1LWCA 4CK3A 2DTUA 3ZSQA 3DLKA 3WNGA 1ASUA 3VQEA 1BQNA 4E1NA 4KHQA 2OPRA 2ZQBA 1ASWA 3AO1A 3VQQA 4CEFA 1C0MA 2XY8A 3DRSA 3NF9A 3NH0A 3KLGA 3HYFA 1U4BA 4OKKA
chains in the Genus database with same CATH superfamily
4ILGB 1A5XA 1M1KO 1GOAA 1DKGD 2D0OA 4KHUA 4DQQA 5J2NA 3ZX2A 4RG8A 2VG6A 3K9KA 3THYA 2FSNA 3QBXA 3HVRA 1IJJA 5AR0A 3P39A 4I9QA 4JNEA 4KAZA 3CJ7A 1JJ2M 4BWMA 4F9OA 3D0PA 3CI5A 1RT4A 5AQXA 3OYEA 4BG9A 1S1VA 3N4QA 3RR7A 5ELZA 4CK1A 2Y1IA 5M1NA 3NHGA 3OS1A 3VESA 2P9UB 3AVMA 1L3TA 3HM9A 3C6UA 4K8XA 4FWRA 4FW2A 3RRGA 4DV2K 3VA0A 3NCIA 3EL2A 3CERA 2XO7A 4RTFD 3FGUA 2KFNA 2E1ZA 3NAEA 2YHAA 4WFBL 2G8VA 3AA4A 4CGFA 4PQUA 2HBJA 3SV3A 5FPMA 2FBYA 1BHLA 1JCGA 2WONA 2YJFA 3EE9A 2ITMA 3OHRA 4O55A 3OYLA 1IBMK 1YXQA 1VQ9N 5AQVA 3ASMA 4CCHA 3F73A 3S3OA 3R6MA 4E19A 1TV6A 2UUBK 1UOCA 5EXWA 2NRZA 4H8KA 4FLUA 1D9FA 3F9KA 1HMVA 4AHTA 2RKIA 2VQFK 3QIOA 5FROA 1RT2A 1NGFA 3OYCA 3SPZA 2JWKA 2YHBA 1Q8IA 3KKSA 5AZIA 4OPKA 5AQOA 1D8YA 2O8DB 5CHIA 1QS4A 5GINA 1ATSA 5HRSA 4EAHD 3ZT1A 3C6AA 2OANA 3TSPA 5HLFA 1XMOK 1WLJA 4M3RA 2D0CA 3EO3A 3SJJA 3CHWA 2CH6A 4WQ5A 5E41A 3M8QA 1Z26A 3TSUA 2YCHA 3RMDA 1E3MA 3HRGA 2I7NA 4CD1A 1JLGA 1X1PA 4B8AB 3LDNA 3JS6A 5AJ3K 4NXMK 4IO9L 4BE1A 3PO4A 3LWMA 1EO1A 4FLWA 3DXMB 1VSIA 2VYPA 1QHTA 4G1QA 3CQYA 4CESA 1YUWA 4FCYA 1VSDA 2OPQA 3TTFA 3AO2A 2X74A 3MDQA 2W40A 3G0ZA 3MWTA 3QEVA 1RDAA 1BGXT 3SMPA 1BDGA 2O4IA 4BRHA 5LJWA 2FBXA 1CZBA 4HUEA 2B6AA 4O5FA 2P51A 3I8BA 4OKEA 2E4LA 3E1YA 4C1NI 2KTQA 4PL8A 1I39A 3ZX3A 5SWMA 3HI0A 3TAGA 4LFAK 3SQ1A 4CEOA 3V9SA 3MCAB 3MMVA 4KB1A 2OPSA 5M1FA 1RBVA 5KPTA 1QVFM 4JI3K 4JI8K 4CZHA 4IZ9A 5IWAK 1NJIO 4N47A 2XHBA 4YOXA 1XNQK 3K2PA 3HM8A 1VRTA 1L3VA 4RWTA 2UUAK 1RTIA 4X64K 4OKJA 3D2FA 2NZTA 4B9VA 1Z6RA 1YT3A 4DTJA 1VQLN 3CC7N 4CD3A 3S41A 3IS9A 4F2RA 4CVNE 4JKEA 2QTDA 3D2EA 4JHDA 3VA3A 3KTQA 4AQYK 4DR6K 4J8FA 2DPNA 2YNGA 3C65A 3HOTA 1KCFA 1NGAA 4BREA 5EX5A 1VQMN 5JVGL 2QEXN 3CJ1A 3L4IA 3CFOA 3FR0A 3TAQA 2O8BA 1NK6A 4DSLA 3PLAA 3PX6A 4ICLA 1Z25A 1IKXA 2KKZA 1HNZK 2YKNA 4FWQA 3CCQN 4B3RK 4W5QA 1EX4A 3N4PA 2FC0A 2A6AA 3OYJA 3PUFA 2HBLA 4XH1A 1UA1A 4BVOA 4QS9A 1KD1O 2NRVA 4CF2A 5HROA 1NKEA 4QOZB 1TKXA 4ELUA 2FF3B 4IDHA 3CPWM 3TTCA 1T03A 4DFMA 4DKWA 2G8IA 2ZGZA 5JLHA 3THYB 2Q3SA 2NUBA 3RMBA 4FOEA 3J7YP 5C24A 4PKHA 3VQ7A 1S1UA 3ENHA 3HTVA 4IJAA 3V9WA 3V1QA 5C12A 1Q82O 1EP4A 1GLEG 3ENOA 2PZSA 3R9PA 1LCUA 2QI2A 1S6PA 2W42A 4KHPK 1IKVA 3E9PA 3LDLA 3U8XA 4M3UA 2IC3A 5CYQA 3CCVN 5HL7L 3VEWA 1FXXA 4IFEA 1KVCA 3K5MA 4FJKA 3ULDA 4JKDA 4DQ8A 4DSKA 1KLNA 1QQNA 2VG7A 3ZT0A 4CJ3A 3WQTA 2JLEA 1YAGA 4Z0UA 2RF2A 5LY3A 4M3XA 4K41A 4AM7A 5HRPA 1J9AA 1IKYA 4FOIA 1T3VA 3KZBA 2HBKA 1RT3A 4CEZA 4Y1DA 3OYMA 4DLEA 3T69A 3OYGA 3HK2A 3QICA 1CXUA 4B1VA 3DWLA 3IG1A 4NCGA 2VWJA 4JKHA 4H0TB 5BRFA 1IBKK 3TARA 1FKOA 4KBOA 4LD0A 4DQRA 2CGLA 4B9NA 1EETA 3V1RA 3RR8A 3PX4A 3L4QA 5BR8K 1OH7A 1YI2N 2V52B 4AHSA 1ZBSA 4JI7K 4K8ZA 2P9NA 5AZIB 3MEEA 1ATRA 1CXQA 4PKIA 3OY9A 1ZBIA 2OPPA 3VENA 1RFQA 1NK7A 3OJUA 3QBWA 3V4IA 1R59O 1T44A 3K57A 1N5YA 1HQEA 3MWPA 2OCEA 1ZBFA 5JMVA 4IOAL 1GLFO 1W0HA 1K73O 2KQ2A 1U04A 2YHYA 2Q0RA 3OYHA 4H4OA 5CZ2A 3CCEN 4IDKA 5LJVA 1BO5O 4CGHA 1BUPA 3HP6A 3MX5A 1BA0A 2W6KA 1Q81O 4DQSA 2KLAA 3JAMO 2UUCK 4DV7K 1JLCA 1NGEA 1LAWA 2P9IA 4CHYA 1NK5A 1IH7A 2UXBK 4GVEA 3OYKA 3K58A 1JLFA 5GAHP 4WYBA 4W5NA 5AQUA 4HVJA 3LZIA 1LAVA 1S72N 3E9OA 3G10A 3G71N 4NYFA 1VQ8N 1E4FT 3KK2A 1YJNN 4M3ZA 3D6RA 5KRTA 3EZWA 1VK0A 4E89A 1Q18A 2WOMA 2E2NA 3LDSA 4BR9A 1YF5L 4C8NA 3CIPA 3TR8A 4KH6A 4MLEA 4N56A 2PBDA 4IO8A 4FJ7A 4FYDA 3D2FB 4CERA 1NJYA 1LWCA 3WNGA 1BQNA 3VQQA 2XY8A 3NH0A 4A2BA 3D2EB 4JHDB 5KQ8A 1XI1A 5BRHA 1JLBA 5KGXA 2BDPA 4F8RA 5SZTA 1KLMA 1L5UA 2CGKA 4GY2B 3SLCA 2F9WA 3HZ6A 2OYQA 3H6EA 1EWQA 5BPMA 4ELVA 3O3HA 4FJGA 3VEYA 2O8BB 1FJGK 4EHTA 5M1PA 3M8PA 1LW2A 3DMJA 4H5WA 2ASPA 3AVFA 1IBLK 3QFPA 5C42A 3QNOA 1HNIA 4DU3A 4CEQA 5KTQA 4K43A 3VQ5A 4FJIA 1I94K 1GOBA 5C10A 4DTPA 1NGIA 4FM1A 3QETA 1KTQA 3AV9A 4B9UA 4BR7A 4FJ5A 4K0KK 1ITGA 3L2VA 2NNWA 1MU2A 1IKWA 3MN7A 1TK5A 3MN6A 4F3TA 1U45A 4PKGA 2BH1A 2QWNA 3S3NA 4BRAA 2EHGA 3LP2A 3SQ2A 1QZ5A 3HSCA 4EP5A 4QCLA 3R3LA 4IOXA 5E26A 3M5RA 3L2RA 1TUUA 4FJMA 4CW7B 4BRKA 1GLDG 4DV4K 4ID5A 2OZSA 4AHCA 3KLFA 4FLVA 4DSIA 3MEGA 2P9LA 2BTFA 1VQ6N 2NLXA 3VQ8A 3H45C 3NVMA 2HHVA 2HVIA 3RSEA 2YNIA 2D0PA 1ZC6A 3KLIA 3DLHA 4DFKA 2WBNA 1QTMA 3OTOK 4KB0A 1A5VA 4JK8A 1TAQA 3GG4A 1JCFA 2PYJA 3MAQA 4DTXA 3GDQA 4IXCA 2G8UA 1BU6O 3KK7A 4EIAA 2OTLN 4NB4A 1QHAA 4ISGA 4YOVA 1ZBUA 1LWFA 2YKMA 4DTMA 4JI2K 3QMLA 3SQ4A 4CHZA 1HLUA 1RDBA 2GEMA 3QEPA 4B9QA 3B6PA 5LMUK 3PSFA 4PL7A 4B3TK 1WAFA 4E1MA 4FLTA 1SV5A 4MO5A 5J2PA 2P9NB 5F0XA 5BRDA 4AH9A 3NGIA 3IAYA 1Z05A 3LDPA 3OYIA 1QE1A 5AQYA 4CF8A 1TK0A 4DU1A 5KRSA 2XY6A 3KWIA 3IMXA 3AVGA 2JWLA 4CEAA 1VSFA 4BRFA 1RBSA 1NGHA 3L2WA 2NRRA 3H1QA 3P4IA 3SQ0A 4M3TA 3CJ9A 1YIJN 3SAGA 2GBZA 3RWUA 3O6WA 3SUNA 4DTUA 1TAUA 3OYNA 4DB3A 4OPHA 5AQJA 1NMNA 2A1RA 3SAHA 1OH5A 4BACA 3FZFA 3LP3A 3SBTA 3NH2A 4H0PA 3TTDA 1JL2A 4GKJK 3FFKB 4B3SK 5KQDA 2F8TA 2P9SA 2P9IB 3LALA 5AQWA 4YOTA 5TKYA 1NK8A 1KVBA 2CH5A 4YOWA 5HOOA 3L2QA 3CFPA 4M3YA 3A8YA 3U9ZA 4K42A 2DFFA 3MX2A 4DHYA 3QESA 4XH5A 4BR0A 5B8HA 3P83D 1QQMA 3THVA 3THXA 1TL1A 2YV0X 4Z94A 1NWKA 3LZJA 3QEIA 2D0AA 3DJCA 1S9EA 4ILHA 4KTQA 4DR1K 2ZE2A 2ZJRL 1JKHA 4BR4A 4IFVA 1P8ZA 3DLGA 1RTJA 4EFHA 3CJBA 1NK9A 1HKBA 4CJTA 3I33A 4DSJA 1WSJA 3NBPA 1NLVA 1CZ9A 4W5TA 3SNNA 4AHUA 4BVPA 4RW6A 3NMUA 1V4TA 3UKUA 2ZJPL 4JKCA 1K8AO 4RW8A 2W6LA 3VQAA 5KGWA 1RTDA 4E7LA 1ZXOA 4MDBA 4DF8A 3VQ6A 4OX9K 5AQTA 1Q86O 1WB9A 1JXEA 3VN5A 4ZHRA 1GLJO 3EKSA 1VSEA 3QB0A 5GIOA 1J5EK 5AQIA 2FXUA 4PA1A 4FLXA 1TYQA 4IKFA 4G9ZA 2E20A 2VG5A 1IG8A 4KI6A 3LAKA 1YJWN 2D1KA 3O3GA 1D9DA 3CJCA 3PY8A 4B9SA 3BGRA 1ATNA 3RVCA 2G8WA 2NRWA 2Q31A 1RNHA 3KKRA 2Q97A 1GLLO 4YFUA 3O9QA 3UIQA 4A59A 4FWLA 1HUXA 5AQHA 2P9KA 1W9HA 3C7NA 4E7IA 3PO5A 4LFBK 1SL2A 1S1WA 4CGGA 3LM9A 3O1WA 3FZLA 2WUSA 1YITN 4M3WA 3TI0A 4DR7K 5F2RA 4FJHA 1K6YA 3A5LC 4JI0K 4O8KA 4BRNA 3VERA 1ILYA 4OGCA 1RGIA 1NGBA 2O8CA 1HQUA 2F9TA 4KHWA 2YHXA 4FJXA 4M42A 4I6MA 3CPEA 4FL9A 4BRCA 1O1WA 3O9SA 3SZ2A 1QZ6A 1OVYA 1IG9A 3O4WA 3OBWA 5AQFA 4FZXC 1FK9A 1LOTB 4MO4A 4RW7A 1GLAG 5HP1A 1IO2A 2IDOA 2KZMA 2P9LB 1EQYA 1WUAA 2O4GA 1Q7YO 4CJ5A 1JLEA 3G25A 3NGZA 3RSEB 1YTAA 3LP1A 2A42A 4ZTJA 3A2FA 3VF4A 1NOZA 4B8CA 2G8KA 2VGMA 4CF0A 5A2QO 2X78A 4FPBA 1LW0A 3FE1A 4JKBA 3CD6N 5KPRA 3CC4N 3BF3A 2ZWHA 1N33K 4CFCA 5AZJA 2HNZA 3DRRA 4FJNA 3F2KA 2GUIA 4ID1A 1VSJA 2VCPA 1SKRA 3L3VA 3HVTA 4AF1A 1S9GA 4BC5A 4EP4A 5I9EB 2Q0UA 3ZCMA 4DFPA 4JKFA 4C8OA 4HTUA 2AP1A 3PV8A 1X9WA 2BANA 3P5JA 1BI4A 3QFUA 3UKRA 4NCAA 5FPEA 4DR5K 1V4SA 4CZLA 3WXMB 3AA5X 3AO3A 3OYDA 3I8DA 3L8BA 4AM6A 3ZT3A 4Z4IA 2HHTA 4N5SA 3MECA 1WSHA 5KPZA 1DTQA 3VEXA 1C6VA 4CJ7A 4DV5K 1ZYQA 3V81A 1BIZA 4KO0A 3EN9A 2RE2A 2QM1A 2YJEA 3FFIA 1HJRA 5J1EA 2VGNA 4FK4A 3CCRN 4CJQA 4OGEA 3MXMA 3W3DA 2O8FA 4J2DA 3BP8A 3VGLA 1CLQA 4IEIA 1NM1A 2GX9A 2P9SB 1RBRA 4FM0A 1JL1A 4LF6K 4CJFA 3U4LA 4BR5A 4CJ4A 4CEDA 3S9HA 3HSTB 4CZIA 3VQ9A 3O9UA 3G4SN 3CMEN 3ZEUA 2I7PA 4Q0BA 4BC4A 4CF1A 2E2OA 4CF9A 4CJWA 4FWPA 3THXB 5DMRA 5EY4A 4CK3A 3DLKA 1ASUA 4E1NA 2ZQBA 1MWMA 3DRSA 5AQZA 3HYFA 3AGRA 1BL3A 4RW9A 1WSGA 1ZBHA 4NO7A 3ZSZA 4B9LA 3LAMA 4YDUC 5GIPA 2HHHK 5K14A 1BIUA 4CJSA 3J7AP 2V7ZA 3JXUA 3JSMA 2D0BA 4BRGA 3HL8A 3UKUB 1XHXA 4MDAA 3Q7CA 3ZSWA 5J2QA 4X66K 3CYMA 5HRRA 1TL3A 5DM7L 4KRFA 1SL1A 4OPAA 3VOVA 3J81O 3JYTA 4ISFA 4E7KA 3HJFA 3O1BA 2XY7A 4K25A 1TYQB 1XNRK 4KTZA 1BA1A 4QS7A 3K59A 3TWHA 2F96A 1HPMA 4CHNA 1U6ZA 1EWRA 4C8KA 1KSPA 1TUYA 3A5NC 1RTHA 1J5OA 4BGBA 4EZ6A 4XEIA 5EU7A 4H5TA 2QWPA 1D5AA 3THWA 2DFHA 4L8RB 3MEDA 2ASMA 1F21A 5CYMA 2P9KB 3C7NB 3E9LA 3SPYA 4J2BA 1W97L 4WE1A 2A41A 3VEZA 3QIPA 4JS4A 1XMQK 3EYZA 2QW9A 4JRPA 4AHVA 1BISA 3IUCA 3U3GA 3V6DA 2V7YA 2FSKA 4YHHK 3CCJN 3TSQA 5C15A 3V9XA 3U6FA 1DT9A 3OA9A 2O8CB 1X3NA 2B4JA 2IS3A 5JS2A 4FWNA 2E6MA 4I6MB 5AFUA 4HUGA 4DG1A 3AA2A 3M6GA 4CJPA 4KREA 1VQ5N 5KI6A 2BUPA 1DTTA 4NLBA 1LV5A 1HR0K 4IFYA 1EKEA 3CM5A 5FPNA 3RRHA 4Y0WA 5CE3A 1XC9A 3SV4A 3NVKA 5MLCQ 1X9SA 1JLQA 5C2FA 3I55N 3KLEA 3TAEA 1WSFA 4FZZA 2EX3A 4U67L 2IIRA 4LF7K 3KK1A 1RILA 3IFRA 2PFUA 4TSXA 4F3OA 3DLEA 5DM6L 1XQSC 3W0LA 2RHKA 3PIOL 3ITHA 4N76A 4FJ8A 1BWFO 4LC9B 4CGIA 5AQKA 1HYZA 2ASOA 2ZF5O 3T7ZA 4CFDA 1NGJA 3KVGA 4LSNA 3CM6A 4CK2A 5AZJB 2HVHA 1N36K 1WSEA 3AGKA 4R5PA 5M1QA 3EKUA 5E84A 5GAEP 3ID6A 1B9FA 3KJVA 3J8AA 4Z4CA 4DWIA 3AY9A 1S1XA 3NE6A 3QINA 4E3SA 2Q1NA 4J2EA 4I9LA 2IAJA 4H03B 4A62A 1TVRA 1RT1A 4NXNK 1VQ7N 3Q7BA 3ATVA 4N41A 5D3GA 1HNWK 4CZJA 1O13A 1BI4B 3UKRB 1OKJA 2ATQA 4A61A 5BPNA 4FM2A 2E6LA 4KH4A 4C23A 5LL6Z 4LF4K 3CQXA 4FSVA 1NGDA 1NG9A 2NRXA 4QAGA 4CJVA 3CC2N 1N32K 1NMDA 4BROA 4B9MA 4CEBA 4PHTX 3QEXA 4JS5A 3A0IX 5IT9O 4BE2A 2O8FB 2XRIA 3T1HK 3MXIA 4GV9A 3VGKA 2QWQA 4CE9A 1NOYA 3G6EN 2HHSA 3T3FA 3K5LA 4CJKA 1TKZA 4H0OA 4B08A 4B1XB 1VSMA 3DYAA 2QWMA 2HMIA 1T6CA 4B1YB 3VTHA 5F1XA 1YVUA 3ZEUB 3AVKA 2UXDK 2GWKA 4R79A 1XC3A 4DV1K 1N8RO 2E8AA 4H0XB 4FVMA 3M1FA 1U48A 1VSKA 1R0AA 5JVHL 1C1CA 1ESVA 2FLOA 4F4KA 1TK8A 2ZM6K 3DXKA 2YHWA 3SUPA 3RMCA 3IRXA 2VWKA 4CIEA 4O4GA 4OO1J 1QQOA 5CR4A 4Z4GA 4OVLA 4KV8A 4Z4FA 4YDUA 1HYSA 3VETA 3O3FA 3V9ZA 4DR4K 3NH1A 3B8AX 3VQ4A 1CZAN 1RT6A 1GOCA 1YHQN 2ITGA 3E66A 1RDDA 3DLLL 4HCCA 3M3ZA 4PY5A 3DLBA 1C0FA 5CY4A 4CIFA 1I3AA 1RDCA 4OLAA 4BRLA 2QA4N 4KKOA 4E7JA 2GELA 4L3QA 3C0BA 1NK4A 3OYAA 4WCEL 4DTNA 3OYFA 3KIOA 3LDQA 2A5XA 1M90O 1VQNN 4FW1A 2IVOA 2GUPA 3WUHA 3SAFA 3CF5L 4E7HA 2A3ZA 3BF1A 3R8EA 3CETA 3SYZA 3VEOA 3THWB 4KHNA 1KFDA 4DSEA 1B92A 4EHUA 2PYLA 2YI1A 2ZJQL 3OW2M 3GL1A 4DTRA 3ID8A 4AILC 3QEWA 5C25A 3ZSVA 3IDHA 3OJSA 4IOCL 5EOYA 3NF6A 1D4XA 1QSLA 4BC2A 1WN7A 4JI4K 2V51B 4JV5K 3QLHA 3WEEA 4WQ4C 3TANA 3V1OA 1ZBLA 1T05A 4FXDA 1MA9B 1RT7A 4BWJA 5J2MA 1HRHA 3HT3A 3NF8A 3CXCM 3ULEA 1EXQA 1C0GA 5FRMA 4IG0A 1G15A 2HF4A 3RMAA 1A5WA 1SL0A 3L0QA 3FZMA 5T7BA 3CMAN 1NNEA 4GMJB 4FZYA 4DTOA 1J54A 3P38A 4DV0K 3TABA 1U2VA 1X3MA 3O9TA 2P5GA 3VF2A 3MN5A 1VSHA 1REVA 1J53A 2WFBA 1K8KA 1KAZA 4IEEA 1U47A 1KAXA 1GLCG 1BOTO 4JYAK 2QWRA 3ZSYA 3SK3A 4LF8K 1DGKN 2HSTA 3TAPA 4UY8O 3AO4A 4B1WB 1C0TA 5AQLA 1IV0A 1NK0A 2KW4A 4JI5K 3SUOA 2DFEA 2QKKA 3WNFA 3KHYA 5AQNA 3ZETA 2F8SA 3LPTA 3F5TA 1WAJA 4DV3K 1Q9XA 3AAPA 4X62K 1YTUA 5I42A 4O0IA 1QSYA 2BE2A 4YY3K 4DQPA 1HNVA 4A5AA 1HKGA 3SI6A 4DLGA 2RN2A 3H46O 3LDOA 1X9JA 3I0SA 5BR9A 1VQKN 3EE8A 4CFAA 3K9JA 3SBGA 4JRQA 4DS5A 2E88A 2QXLA 3B6OA 3LM2A 4GW6A 3NF7A 5C0YA 4GV3A 2HB5A 4CZEA 2R7YA 5FRNA 5H1SQ 4A5BA 2P5OA 4W5OA 4LF5K 2DTUA 2HF3A 4IWVA 3VQEA 4JKGA 1SZ2A 2OPRA 3J7ZO 1ASWA 5AQPA 4BRPA 3NF9A 2UYTA 3LL3A 2J4RA 1BCMA 2Z1IA 3AVBA 1L3UA 3AVJA 2NRHA 1NBWA 4JEPA 2XY5A 1LWEA 5FPDA 3ZT2A 2E2PA 3ZLJA 3HO1A 3DAWA 1VQPN 3VF6A 2B5JA 4JI1K 4DQIA 4YOYA 4HTLA 2Z1JA 3SJHA 4CECA 2YNHA 3KWGA 3D7EO 4DSFA 4FJ9A 5BREA 4YOUA 4KHSA 4BQLA 3LWLA 4EZ9A 4A2AA 4GKKK 3WT0A 3A5OC 3PIPL 3OVNA 1RT5A 3C6HA 3L2UA 4OLBA 3DXKB 4NLCA 4CHQA 3K0SA 5JICA 4CZFA 1FKPA 2QXFA 3O08A 4Z4HA 5DK5A 3O4NA 1OH6A 4CHPA 4CJRA 3CG7A 2BGGA 3M8SA 4DUZK 4JI6K 1T7PA 3BDPA 1WOQA 4DR2K 4ELTA 2DY4A 3RTVA 2I5JA 1NGCA 3M8RA 4CBWA 2OTJN 1SKWA 5I3UA 3NFAA 4B9TA 1UWBA 3R1XA 3UE5A 2EWSA 3H08A 2F4VK 1JXBA 4FJLA 2JGUA 2GWJA 4CIGA 1X9MA 4CBXA 2Q2RA 3EEQA 3I56N 1KVAA 4JD2A 3WNHA 5AQSA 4XIUA 3AVHA 3VQDA 3DI6A 3ENBA 2G8HA 5AQGA 2A1SA 2O8EA 2P9PA 1C1AA 2FBVA 4LH4A 4CZKA 4B1UB 1RCHA 3IKMA 2GV9A 2KZZA 3AAQA 2QK9A 1C1BA 2WTUA 3H1VX 1Q9YA 4LSLA 3SMSA 4FWOA 1NJXA 1TKDA 4CGJA 3H3OB 4M63C 2YX6A 1RDUA 3LANA 4BQZA 2FSJA 4IBNA 2PAVA 4OPJA 1WSIA 3AVNA 1ASVA 2IGIA 4CJUA 2FBTA 1QSSA 4XH4A 3BZKA 2Y1JA 3UB5A 3WEEB 2X6SA 1W7AA 1VAZA 3ISNC 4O44A 5AQMA 2X6NA 4ILJA 4WQ4A 3ULEB 3VQBA 3H3NO 2IVNA 2A40A 5HBMA 4M7YA 5FDLA 3EY1A 3EZ5A 1JLAA 3E01A 1J6ZA 1RBUA 2UXCK 3J80O 3HXMA 2HOEA 3OBYA 1U2VB 3C6TA 3QO9A 4FWMA 2H3GX 1KXPA 3VEVA 4DCHA 3PX0A 1TGOA 2HHXA 1K8KB 4AHRA 4DUYK 1HYVA 4DFJA 2HMPA 1QQCA 1VHXA 4JKAA 3WXKA 5JLFA 1WNSA 4B3MK 5ADXA 3QERA 1NKCA 2F7TA 3DOKA 4F2SA 4GVMA 1SUQA 3CCUN 2Z1GA 4O5BA 3K5NA 4DU4A 2QWOA 4JLHA 2KHOA 3ZETB 3KLHA 2D4WA 1DEJA 1GLBG 3ZT4A 3GBTA 4HWIA 1YJ9N 3ALYA 3VTIA 4FK2A 4BY9C 4FWSA 3QNNA 1WBDA 3CCLN 1QVGM 1NJZA 2RPIA 3OYBA 4FVUA 3HP9A 1S3XA 2HHWA 1TKTA 1SQKA 1RBTA 2QWLA 1T6DA 2ETJA 2E1YA 3MCPA 3A5MC 1HPZA 5FLXO 1VRUA 1XWLA 4YNQA 2HBMA 4M45A 1S22A 1Y64A 2AJQA 2GTDA 3CFRA 1T8EA 1N6QA 4CHOA 4I2PA 4LF9K 4BDPA 3L3UA 2VWBA 3T1YK 4DS4A 3CQ8A 4M41A 3AARA 3AVCA 1Y97A 4DF4A 3VQCA 5BN9A 1SKSA 3TPQA 4CBUA 3AVIA 3BZCA 3GOIA 4JN4A 4M7XA 3SUQA 2P9UA 5CZ1A 2VQEK 4JKGB 5AQRA 1W2BM 2WC9A 4WFAL 4I7FA 4H5RA 3O5BA 4W5RA 5JS1A 3CCMN 3K5OA 2IVPA 4KTWA 1YVNA 4FLZA 1VQON 5ADXH 2LSNA 1U49A 4FLYA 1UAXA 1RDWX 4A57A 3HPHA 2E2QA 3AVAA 4H0VB 1B9DA 4MQ3A 2Z1HA 3F9MA 3NGYA 4HHTA 1MWKA 5AQQA 3DLRA 2ZGYA 2W41A 4BDZA 2HHQA 1SAZA 4DMNA 3O8MA 4UQGA 4CGDA 1HJOA 3FZKA 4BRIA 3LP0A 4CEEA 3LPUA 3TU5A 3VMFB 1KQSM 3WNEA 4KFBA 3KD1E 1MDUB 4CZMA 3TAMA 4BR2A 1E4GT 3DRPA 1S1TA 4H5NA 4LY7A 1BQMA 4ISEA 3T19A 3DM2A 4HUFA 2KFZA 4ZTFA 3HPGA 1K9MO 4NCBA 4JAXA 1S5JA 3I0RA 3HBTA 2O8DA 3HOSA 3O80A 3WQUA 4WF9L 4BC3A 4IG3A 4O0JA 3VQPA 4FWKA 4V19S 3OS0A 3ZSXA 3ATUA 3P31A 2D5RA 4WQ5C 4CJEA 4DTSA 5M1KA 1S6QA 2FF6A 3ZSRA 3WXJA 4X65K 3MXJA 3FLCO 3L6QA 2QKBA 5AFUH 1P90A 4JD2B 4B1ZA 3P1GA 5BPLA 2ZD1A 3O4QA 4YORA 2YNFA 4KHYA 1JCEA 1KC8O 4MFBA 3ZX0A 1UA0A 4RW4A 2O8EB 2P9PB 2HNDA 4FO0A 1HX1A 3DXMA 2PY5A 4MLHA 4KH5A 4DV6K 4PUOA 3NDKA 5GADP 4Z4EA 3WXLA 1BG3A 4KI4A 3HPOA 3BEXA 2HNYA 3T1AA 1XHZA 3C95A 5HRNA 3U9DA 3S3MA 4GNIA 3KD5E 4HCBA 4E0DA 4BE0A 2NRTA 2P1JA 4JK7A 4U7BA 1L3SA 2CGJA 3TAFA 4GV6A 3MK6A 1NJWA 4JK9A 4FPAA 3AA3A 3QDKA 4BRQA 1OVQA 5C2DA 4PWDA 4C8MA 2HW3A 4CZGA 2E5LK 4CJLA 4J2AA 1H1VA 1KRPA 2IOCA 3VPZA 3C94A 2OA8A 4RCHA 3FZHA 3AVLA 4C1NK 3U3YA 4KPYA 2AA4A 3V9UA 2HHUA 1WBBA 1VQ4N 3CJAA 4I2QA 4IJNA 1BCOA 5EVZA 4Y1CA 3DOLA 4BRDA 3ZYYX 4BDYA 1OH8A 4BGAA 2G8FA 1VSLA 4WFNL 1DLOA 4O8UA 2UU9K 1G99A 1FW6A 4B3OA 3VGMA 4FK0A 4E1JA 2OZMA 4CI6A 3KK3A 4CFBA 1C0UA 4H4MA 3OS2A 4LH5A 5BN8A 1NKBA 4DR3K 4QS8A 5TKWA 3ZSOA 4OJRA 5GAGP 1HNXK 4NYNA 4BRMA 3BY5A 3AO5A 4FJJA 4LFCK 4Q5VA 4BG8A 3CCSN 4H0YB 1KFSA 1XUPO 3D45A 3O9RA 5LMNK 3GE1A 5M1OA 4C8LA 1SS6A 3SCXA 3PSIA 3ZSQA 3BUZB 1NU0A 1KAYA 4H5VA 2Q36A 4KHQA 1NGGA 3AO1A 3MN9A 1C0MA 4CEFA 3KLGA 1N34K 1U4BA 3WXIA 4OKKA 1HKCA
chains in the Genus database with same CATH topology
1XI1A 1BCMA 1BL3A 1A5XA 1GOAA 2Z1IA 3AVBA 4RW9A 1WSGA 3AVJA 1L3UA 4KHUA 2XY5A 4DQQA 1LWEA 1ZBHA 5J2NA 1JLBA 3ZSZA 4B9LA 3LAMA 4RG8A 3ZT2A 2VG6A 5KGXA 2BDPA 4F8RA 5SZTA 1KLMA 3HO1A 1L5UA 5K14A 1BIUA 4CJSA 3HVRA 2OYQA 2B5JA 4I9QA 3JSMA 2D0BA 4KAZA 3HL8A 4BWMA 4ELVA 3D0PA 1XHXA 3O3HA 4DQIA 4FJGA 1RT4A 3ZSWA 3OYEA 5J2QA 1S1VA 3CYMA 3M8PA 2Z1JA 5HRRA 1LW2A 1TL3A 3DMJA 2YNHA 4CECA 3RR7A 1SL1A 4CK1A 2Y1IA 4DSFA 4FJ9A 3NHGA 3AVFA 3OS1A 5C42A 4KHSA 3LWLA 3QNOA 3JYTA 1HNIA 4DU3A 4EZ9A 4CEQA 3AVMA 5KTQA 1L3TA 4E7KA 3VQ5A 4FJIA 3HJFA 3HM9A 3C6UA 4KRFA 4K8XA 2XY7A 1GOBA 1RT5A 3OVNA 4FW2A 3RRGA 3L2UA 4OLBA 4DTPA 4KTZA 4CHQA 3VA0A 1FKPA 2QXFA 3NCIA 3K59A 4Z4HA 5DK5A 3TWHA 4FM1A 3O4NA 2XO7A 3QETA 2F96A 4CHPA 2KFNA 1KTQA 3AV9A 4CHNA 4CJRA 3NAEA 4B9UA 3CG7A 2YHAA 2G8VA 4FJ5A 3AA4A 4CGFA 2BGGA 1ITGA 3M8SA 3L2VA 4C8KA 4PQUA 1KSPA 3SV3A 2FBYA 1T7PA 1RTHA 1J5OA 3BDPA 1BHLA 1MU2A 2WONA 4ELTA 4EZ6A 1IKWA 4O55A 2I5JA 5EU7A 3OYLA 3RTVA 1TK5A 3M8RA 4F3TA 1U45A 1D5AA 3ASMA 3S3NA 2EHGA 3LP2A 4CCHA 3F73A 3SQ2A 3S3OA 1SKWA 5I3UA 3NFAA 4B9TA 1UWBA 4E19A 4EP5A 2DFHA 1TV6A 4L8RB 1UOCA 3MEDA 1F21A 3H08A 1JXBA 5CYMA 4H8KA 4FLUA 4QCLA 3SPYA 4FJLA 2JGUA 1D9FA 4J2BA 3L2RA 3F9KA 4WE1A 1HMVA 4CIGA 4FJMA 1X9MA 2OZSA 4AHTA 2RKIA 4ID5A 3QIOA 4AHCA 3QIPA 5FROA 3KLFA 4JS4A 1KVAA 1RT2A 3WNHA 3OYCA 3EYZA 4FLVA 3SPZA 4DSIA 4XIUA 4JRPA 3AVHA 4AHVA 1BISA 3MEGA 2YHBA 3DI6A 3VQDA 3U3GA 2G8HA 3V6DA 1Q8IA 3KKSA 2A1SA 4OPKA 3V9XA 1C1AA 2FBVA 4LH4A 2DY4A 3U6FA 1RCHA 3VQ8A 1D8YA 2GV9A 2HHVA 2B4JA 2HVIA 2IS3A 2YNIA 5JS2A 1QS4A 2KZZA 5HRSA 2QK9A 2E6MA 3KLIA 1C1BA 3ZT1A 4HUGA 4DFKA 1QTMA 3DLHA 4DG1A 4KB0A 1A5VA 3AA2A 4CJPA 1TAQA 5HLFA 1Q9YA 4KREA 4LSLA 5KI6A 2PYJA 1DTTA 1WLJA 3MAQA 4DTXA 1NJXA 1LV5A 4M3RA 2G8UA 1TKDA 4CGJA 2D0CA 4IFYA 3SJJA 1EKEA 3LANA 5E41A 3M8QA 3CM5A 4IBNA 1ZBUA 4OPJA 1LWFA 1WSIA 1Z26A 2YKMA 1ASVA 3AVNA 4DTMA 2IGIA 3RRHA 3RMDA 4CJUA 1XC9A 3SV4A 2FBTA 4CHZA 3SQ4A 1QSSA 1RDBA 1X9SA 1JLQA 3QEPA 3B6PA 1JLGA 1X1PA 3KLEA 3TAEA 4B8AB 2Y1JA 1WSFA 4FZZA 1WAFA 2EX3A 4E1MA 2X6SA 4FLTA 1SV5A 5J2PA 3KK1A 1RILA 4AH9A 3ISNC 4O44A 4BE1A 4TSXA 2X6NA 3LWMA 3NGIA 3PO4A 3DLEA 4FLWA 3IAYA 4F3OA 1VSIA 3ITHA 4N76A 1QHTA 4G1QA 4FJ8A 3VQBA 3OYIA 1QE1A 4CESA 4CF8A 4CGIA 4FCYA 5HBMA 1VSDA 2OPQA 1HYZA 5FDLA 1TK0A 3AO2A 2X74A 3EY1A 4DU1A 5KRSA 3EZ5A 1JLAA 3G0ZA 2XY6A 4CFDA 3QEVA 3E01A 1RDAA 1BGXT 1RBUA 2O4IA 3AVGA 4LSNA 2FBXA 1CZBA 3CM6A 1VSFA 4CEAA 2B6AA 4CK2A 3HXMA 4HUEA 1RBSA 3C6TA 3QO9A 3L2WA 2P51A 2HVHA 4OKEA 2E4LA 1WSEA 3SQ0A 4R5PA 2KTQA 4M3TA 1I39A 1B9FA 3KJVA 3PX0A 1TGOA 2GBZA 2HHXA 5SWMA 4Z4CA 4AHRA 4DWIA 3RWUA 3SUNA 1S1XA 1HYVA 3NE6A 4DTUA 3TAGA 3OYNA 3SQ1A 3QINA 4E3SA 1TAUA 4J2EA 4I9LA 4DFJA 2IAJA 2A1RA 1QQCA 4BACA 1TVRA 4W5NA 3LP3A 4CEOA 3NH2A 3V9SA 1RT1A 1WNSA 1JL2A 2F8TA 4N41A 4KB1A 2OPSA 5D3GA 3QERA 1RBVA 1NKCA 3DOKA 3LALA 4F2SA 1BI4B 4GVMA 1SUQA 2ATQA 2Z1GA 4O5BA 1KVBA 1NK8A 4N47A 2XHBA 3K5NA 4FM2A 4DU4A 2E6LA 3L2QA 4JLHA 3CFPA 4M3YA 3KLHA 3K2PA 1VRTA 1L3VA 2DFFA 3ZT4A 1RTIA 3QESA 4OKJA 3P83D 4B9VA 3ALYA 3THVA 4FK2A 1YT3A 4DTJA 3QNNA 1TL1A 4QAGA 4CJVA 2YV0X 3IS9A 1NJZA 4F2RA 2RPIA 3OYBA 3LZJA 3QEIA 4B9MA 2D0AA 1S9EA 4KTQA 2ZE2A 3HP9A 3VA3A 4CEBA 3KTQA 2HHWA 1JKHA 1TKTA 4IFVA 3DLGA 4JS5A 3QEXA 1RBTA 1RTJA 4BE2A 2YNGA 2XRIA 2ETJA 3MXIA 4CE9A 4CJTA 1NK9A 1NOYA 4DSJA 1WSJA 3NBPA 1KCFA 2HHSA 1HPZA 1CZ9A 3T3FA 1VRUA 1XWLA 4CJKA 1TKZA 4AHUA 4YNQA 4W5TA 3K5LA 3SNNA 4M45A 4RW6A 4B08A 1VSMA 3DYAA 3CFRA 1T8EA 1N6QA 2AJQA 4CHOA 4I2PA 3CFOA 3TAQA 4BDPA 3L3UA 2HMIA 4RW8A 1NK6A 3VQAA 5KGWA 4DSLA 4DS4A 3CQ8A 4M41A 1RTDA 3AVCA 1Y97A 1YVUA 4E7LA 3AVKA 4DF4A 4DF8A 3PX6A 3VQ6A 3VQCA 4ICLA 1SKSA 1Z25A 1IKXA 1JXEA 2YKNA 3AVIA 3VN5A 4W5QA 1EX4A 2FC0A 3SUQA 4ZHRA 3OYJA 4FVMA 1U48A 3PUFA 1VSKA 5CZ1A 1VSEA 1R0AA 1C1CA 1UA1A 4F4KA 4CF2A 4PA1A 1TK8A 4FLXA 5HROA 4IKFA 3SUPA 4I7FA 1NKEA 4QOZB 3RMCA 1TKXA 3IRXA 2VG5A 4ELUA 4W5RA 5JS1A 2VWKA 4KI6A 4CIEA 4O4GA 3K5OA 3LAKA 4KTWA 1T03A 4DFMA 4FLZA 4Z4GA 3O3GA 2G8IA 4OVLA 4KV8A 1D9DA 2LSNA 1U49A 3BGRA 3PY8A 4B9SA 4FLYA 4Z4FA 1HYSA 3O3FA 2Q3SA 2NUBA 3V9ZA 3RMBA 1UAXA 2G8WA 3NH1A 3VQ4A 5C24A 3HPHA 1RNHA 3VQ7A 1S1UA 3AVAA 3KKRA 1RT6A 1GOCA 1B9DA 4MQ3A 2Z1HA 3NGYA 4HHTA 3V9WA 2ITGA 4YFUA 3DLRA 4BDZA 3UIQA 2HHQA 1RDDA 3V1QA 4DMNA 4HCCA 4UQGA 4CGDA 1EP4A 4PY5A 3DLBA 1W9HA 3LP0A 4CEEA 2PZSA 3LPUA 4E7IA 3PO5A 5CY4A 1SL2A 1S1WA 4CIFA 1I3AA 1S6PA 3WNEA 4CGGA 2W42A 4KFBA 3KD1E 1IKVA 1RDCA 4OLAA 4KKOA 4M3UA 2IC3A 5CYQA 4E7JA 4M3WA 3TAMA 1FXXA 3TI0A 1KVCA 3DRPA 1S1TA 4LY7A 3K5MA 3ULDA 1BQMA 1NK4A 1K6YA 4FJHA 4FJKA 3T19A 3DM2A 3OYAA 4HUFA 1KLNA 4DSKA 2KFZA 2VG7A 3ZT0A 4CJ3A 4DTNA 4ZTFA 3OYFA 2JLEA 3HPGA 3KIOA 4Z0UA 2RF2A 4OGCA 4NCBA 1S5JA 3I0RA 4M3XA 4FW1A 1HQUA 4KHWA 4FJXA 4M42A 5HRPA 4E7HA 1J9AA 1IKYA 4IG3A 4O0JA 3SYZA 3VQPA 3OS0A 1RT3A 4CEZA 4Y1DA 3OYMA 4DLEA 1O1WA 3ZSXA 3OYGA 4KHNA 3HK2A 1KFDA 2D5RA 1B92A 3SZ2A 1CXUA 4CJEA 4DSEA 4DTSA 2PYLA 3IG1A 1S6QA 1IG9A 3ZSRA 4NCGA 4DTRA 2VWJA 3TARA 1FKOA 4AILC 3MXJA 4LD0A 4DQRA 3QEWA 2QKBA 5C25A 4B9NA 3ZSVA 1EETA 3OJSA 4FZXC 1FK9A 3V1RA 1QSLA 3RR8A 3NF6A 3PX4A 1WN7A 3P1GA 4RW7A 2ZD1A 3O4QA 5HP1A 1IO2A 2YNFA 4AHSA 4KHYA 2IDOA 2KZMA 4MFBA 3QLHA 2O4GA 3V1OA 3TANA 1ZBLA 1UA0A 1T05A 4RW4A 4K8ZA 4FXDA 3MEEA 1CXQA 2HNDA 4CJ5A 1RT7A 1JLEA 4BWJA 5J2MA 3OY9A 2PY5A 1ZBIA 1HRHA 2OPPA 3HT3A 3NF8A 3NGZA 1NK7A 1EXQA 3OJUA 1YTAA 3LP1A 3V4IA 4ZTJA 5FRMA 4IG0A 3A2FA 4PUOA 1G15A 3K57A 1N5YA 3NDKA 1HQEA 4Z4EA 1NOZA 4B8CA 1A5WA 3RMAA 4CF0A 1SL0A 2G8KA 2X78A 1ZBFA 4KI4A 5T7BA 3HPOA 1LW0A 2HNYA 3T1AA 1W0HA 3C95A 5HRNA 2KQ2A 1XHZA 1U04A 4GMJB 3S3MA 4FZYA 3KD5E 4DTOA 4HCBA 4E0DA 1J54A 4BE0A 3OYHA 2P1JA 1L3SA 4H4OA 3TAFA 3TABA 4CFCA 1NJWA 2P5GA 5CZ2A 2HNZA 3DRRA 4FJNA 1VSHA 4IDKA 1REVA 2GUIA 4ID1A 1VSJA 3AA3A 1J53A 1SKRA 1U47A 3L3VA 3HVTA 4CGHA 4C8MA 4PWDA 2HW3A 1S9GA 4EP4A 3HP6A 3ZCMA 4CJLA 4DFPA 4J2AA 1KRPA 4DQSA 4C8OA 3ZSYA 2IOCA 4HTUA 3TAPA 3C94A 2OA8A 1JLCA 3PV8A 1X9WA 3AVLA 3AO4A 3U3YA 4KPYA 1LAWA 2BANA 4CHYA 3V9UA 1NK5A 1IH7A 3P5JA 2HHUA 1BI4A 4I2QA 4NCAA 1C0TA 1BCOA 3AA5X 3AO3A 3OYKA 4Y1CA 3DOLA 2KW4A 3OYDA 3I8DA 1JLFA 3ZT3A 3K58A 3L8BA 1NK0A 4Z4IA 3SUOA 2HHTA 2DFEA 3MECA 1WSHA 3WNFA 4N5SA 4BDYA 1DTQA 2QKKA 2F8SA 4HVJA 1C6VA 1ZYQA 3LPTA 1WAJA 3LZIA 2G8FA 1Q9XA 1LAVA 1YTUA 1VSLA 3V81A 1BIZA 5I42A 4O0IA 1DLOA 1QSYA 4KO0A 2BE2A 4DQPA 1HNVA 4B3OA 3SI6A 3G10A 4DLGA 2RN2A 4NYFA 4FK0A 3FFIA 1HJRA 3KK2A 2OZMA 3KK3A 4CFBA 5J1EA 4M3ZA 4FK4A 1C0UA 4H4MA 4OGEA 4CJQA 3OS2A 3MXMA 3I0SA 5KRTA 4J2DA 4CFAA 4LH5A 4JRQA 4DS5A 1NKBA 1VK0A 1CLQA 1RBRA 3ZSOA 4OJRA 4E89A 2WOMA 1JL1A 4FM0A 4NYNA 3LDSA 3B6OA 4CJFA 4C8NA 3AO5A 4CJ4A 4GW6A 4CEDA 3TR8A 3HSTB 3S9HA 4FJJA 3NF7A 3VQ9A 4Q5VA 2HB5A 1KFSA 3D45A 4N56A 2R7YA 4Q0BA 4CF1A 4CF9A 5FRNA 4CJWA 4FJ7A 4FYDA 2P5OA 4C8LA 4W5OA 4CERA 1NJYA 5DMRA 3SCXA 1LWCA 4CK3A 2DTUA 3ZSQA 3DLKA 3WNGA 1ASUA 3VQEA 1BQNA 4E1NA 4KHQA 2OPRA 2ZQBA 1ASWA 3AO1A 3VQQA 4CEFA 1C0MA 2XY8A 3DRSA 3NF9A 3NH0A 3KLGA 3HYFA 1U4BA 4OKKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XI1 A;  1BCM A;  1BL3 A;  1A5X A;  1GOA A;  2Z1I A;  3AVB A;  4RW9 A;  1WSG A;  3AVJ A;  1L3U A;  4KHU A;  2XY5 A;  4DQQ A;  1LWE A;  1ZBH A;  5J2N A;  1JLB A;  3ZSZ A;  4B9L A;  3LAM A;  4RG8 A;  3ZT2 A;  2VG6 A;  5KGX A;  2BDP A;  4F8R A;  5SZT A;  1KLM A;  3HO1 A;  1L5U A;  5K14 A;  1BIU A;  4CJS A;  3HVR A;  2OYQ A;  2B5J A;  4I9Q A;  3JSM A;  2D0B A;  4KAZ A;  3HL8 A;  4BWM A;  4ELV A;  3D0P A;  1XHX A;  3O3H A;  4DQI A;  4FJG A;  1RT4 A;  3ZSW A;  3OYE A;  5J2Q A;  1S1V A;  3CYM A;  3M8P A;  2Z1J A;  5HRR A;  1LW2 A;  1TL3 A;  3DMJ A;  2YNH A;  4CEC A;  3RR7 A;  1SL1 A;  4CK1 A;  2Y1I A;  4DSF A;  4FJ9 A;  3NHG A;  3AVF A;  3OS1 A;  5C42 A;  4KHS A;  3LWL A;  3QNO A;  3JYT A;  1HNI A;  4DU3 A;  4EZ9 A;  4CEQ A;  3AVM A;  5KTQ A;  1L3T A;  4E7K A;  3VQ5 A;  4FJI A;  3HJF A;  3HM9 A;  3C6U A;  4KRF A;  4K8X A;  2XY7 A;  1GOB A;  1RT5 A;  3OVN A;  4FW2 A;  3RRG A;  3L2U A;  4OLB A;  4DTP A;  4KTZ A;  4CHQ A;  3VA0 A;  1FKP A;  2QXF A;  3NCI A;  3K59 A;  4Z4H A;  5DK5 A;  3TWH A;  4FM1 A;  3O4N A;  2XO7 A;  3QET A;  2F96 A;  4CHP A;  2KFN A;  1KTQ A;  3AV9 A;  4CHN A;  4CJR A;  3NAE A;  4B9U A;  3CG7 A;  2YHA A;  2G8V A;  4FJ5 A;  3AA4 A;  4CGF A;  2BGG A;  1ITG A;  3M8S A;  3L2V A;  4C8K A;  4PQU A;  1KSP A;  3SV3 A;  2FBY A;  1T7P A;  1RTH A;  1J5O A;  3BDP A;  1BHL A;  1MU2 A;  2WON A;  4ELT A;  4EZ6 A;  1IKW A;  4O55 A;  2I5J A;  5EU7 A;  3OYL A;  3RTV A;  1TK5 A;  3M8R A;  4F3T A;  1U45 A;  1D5A A;  3ASM A;  3S3N A;  2EHG A;  3LP2 A;  4CCH A;  3F73 A;  3SQ2 A;  3S3O A;  1SKW A;  5I3U A;  3NFA A;  4B9T A;  1UWB A;  4E19 A;  4EP5 A;  2DFH A;  1TV6 A;  4L8R B;  1UOC A;  3MED A;  1F21 A;  3H08 A;  1JXB A;  5CYM A;  4H8K A;  4FLU A;  4QCL A;  3SPY A;  4FJL A;  2JGU A;  1D9F A;  4J2B A;  3L2R A;  3F9K A;  4WE1 A;  1HMV A;  4CIG A;  4FJM A;  1X9M A;  2OZS A;  4AHT A;  2RKI A;  4ID5 A;  3QIO A;  4AHC A;  3QIP A;  5FRO A;  3KLF A;  4JS4 A;  1KVA A;  1RT2 A;  3WNH A;  3OYC A;  3EYZ A;  4FLV A;  3SPZ A;  4DSI A;  4XIU A;  4JRP A;  3AVH A;  4AHV A;  1BIS A;  3MEG A;  2YHB A;  3DI6 A;  3VQD A;  3U3G A;  2G8H A;  3V6D A;  1Q8I A;  3KKS A;  2A1S A;  4OPK A;  3V9X A;  1C1A A;  2FBV A;  4LH4 A;  2DY4 A;  3U6F A;  1RCH A;  3VQ8 A;  1D8Y A;  2GV9 A;  2HHV A;  2B4J A;  2HVI A;  2IS3 A;  2YNI A;  5JS2 A;  1QS4 A;  2KZZ A;  5HRS A;  2QK9 A;  2E6M A;  3KLI A;  1C1B A;  3ZT1 A;  4HUG A;  4DFK A;  1QTM A;  3DLH A;  4DG1 A;  4KB0 A;  1A5V A;  3AA2 A;  4CJP A;  1TAQ A;  5HLF A;  1Q9Y A;  4KRE A;  4LSL A;  5KI6 A;  2PYJ A;  1DTT A;  1WLJ A;  3MAQ A;  4DTX A;  1NJX A;  1LV5 A;  4M3R A;  2G8U A;  1TKD A;  4CGJ A;  2D0C A;  4IFY A;  3SJJ A;  1EKE A;  3LAN A;  5E41 A;  3M8Q A;  3CM5 A;  4IBN A;  1ZBU A;  4OPJ A;  1LWF A;  1WSI A;  1Z26 A;  2YKM A;  1ASV A;  3AVN A;  4DTM A;  2IGI A;  3RRH A;  3RMD A;  4CJU A;  1XC9 A;  3SV4 A;  2FBT A;  4CHZ A;  3SQ4 A;  1QSS A;  1RDB A;  1X9S A;  1JLQ A;  3QEP A;  3B6P A;  1JLG A;  1X1P A;  3KLE A;  3TAE A;  4B8A B;  2Y1J A;  1WSF A;  4FZZ A;  1WAF A;  2EX3 A;  4E1M A;  2X6S A;  4FLT A;  1SV5 A;  5J2P A;  3KK1 A;  1RIL A;  4AH9 A;  3ISN C;  4O44 A;  4BE1 A;  4TSX A;  2X6N A;  3LWM A;  3NGI A;  3PO4 A;  3DLE A;  4FLW A;  3IAY A;  4F3O A;  1VSI A;  3ITH A;  4N76 A;  1QHT A;  4G1Q A;  4FJ8 A;  3VQB A;  3OYI A;  1QE1 A;  4CES A;  4CF8 A;  4CGI A;  4FCY A;  5HBM A;  1VSD A;  2OPQ A;  1HYZ A;  5FDL A;  1TK0 A;  3AO2 A;  2X74 A;  3EY1 A;  4DU1 A;  5KRS A;  3EZ5 A;  1JLA A;  3G0Z A;  2XY6 A;  4CFD A;  3QEV A;  3E01 A;  1RDA A;  1BGX T;  1RBU A;  2O4I A;  3AVG A;  4LSN A;  2FBX A;  1CZB A;  3CM6 A;  1VSF A;  4CEA A;  2B6A A;  4CK2 A;  3HXM A;  4HUE A;  1RBS A;  3C6T A;  3QO9 A;  3L2W A;  2P51 A;  2HVH A;  4OKE A;  2E4L A;  1WSE A;  3SQ0 A;  4R5P A;  2KTQ A;  4M3T A;  1I39 A;  1B9F A;  3KJV A;  3PX0 A;  1TGO A;  2GBZ A;  2HHX A;  5SWM A;  4Z4C A;  4AHR A;  4DWI A;  3RWU A;  3SUN A;  1S1X A;  1HYV A;  3NE6 A;  4DTU A;  3TAG A;  3OYN A;  3SQ1 A;  3QIN A;  4E3S A;  1TAU A;  4J2E A;  4I9L A;  4DFJ A;  2IAJ A;  2A1R A;  1QQC A;  4BAC A;  1TVR A;  4W5N A;  3LP3 A;  4CEO A;  3NH2 A;  3V9S A;  1RT1 A;  1WNS A;  1JL2 A;  2F8T A;  4N41 A;  4KB1 A;  2OPS A;  5D3G A;  3QER A;  1RBV A;  1NKC A;  3DOK A;  3LAL A;  4F2S A;  1BI4 B;  4GVM A;  1SUQ A;  2ATQ A;  2Z1G A;  4O5B A;  1KVB A;  1NK8 A;  4N47 A;  2XHB A;  3K5N A;  4FM2 A;  4DU4 A;  2E6L A;  3L2Q A;  4JLH A;  3CFP A;  4M3Y A;  3KLH A;  3K2P A;  1VRT A;  1L3V A;  2DFF A;  3ZT4 A;  1RTI A;  3QES A;  4OKJ A;  3P83 D;  4B9V A;  3ALY A;  3THV A;  4FK2 A;  1YT3 A;  4DTJ A;  3QNN A;  1TL1 A;  4QAG A;  4CJV A;  2YV0 X;  3IS9 A;  1NJZ A;  4F2R A;  2RPI A;  3OYB A;  3LZJ A;  3QEI A;  4B9M A;  2D0A A;  1S9E A;  4KTQ A;  2ZE2 A;  3HP9 A;  3VA3 A;  4CEB A;  3KTQ A;  2HHW A;  1JKH A;  1TKT A;  4IFV A;  3DLG A;  4JS5 A;  3QEX A;  1RBT A;  1RTJ A;  4BE2 A;  2YNG A;  2XRI A;  2ETJ A;  3MXI A;  4CE9 A;  4CJT A;  1NK9 A;  1NOY A;  4DSJ A;  1WSJ A;  3NBP A;  1KCF A;  2HHS A;  1HPZ A;  1CZ9 A;  3T3F A;  1VRU A;  1XWL A;  4CJK A;  1TKZ A;  4AHU A;  4YNQ A;  4W5T A;  3K5L A;  3SNN A;  4M45 A;  4RW6 A;  4B08 A;  1VSM A;  3DYA A;  3CFR A;  1T8E A;  1N6Q A;  2AJQ A;  4CHO A;  4I2P A;  3CFO A;  3TAQ A;  4BDP A;  3L3U A;  2HMI A;  4RW8 A;  1NK6 A;  3VQA A;  5KGW A;  4DSL A;  4DS4 A;  3CQ8 A;  4M41 A;  1RTD A;  3AVC A;  1Y97 A;  1YVU A;  4E7L A;  3AVK A;  4DF4 A;  4DF8 A;  3PX6 A;  3VQ6 A;  3VQC A;  4ICL A;  1SKS A;  1Z25 A;  1IKX A;  1JXE A;  2YKN A;  3AVI A;  3VN5 A;  4W5Q A;  1EX4 A;  2FC0 A;  3SUQ A;  4ZHR A;  3OYJ A;  4FVM A;  1U48 A;  3PUF A;  1VSK A;  5CZ1 A;  1VSE A;  1R0A A;  1C1C A;  1UA1 A;  4F4K A;  4CF2 A;  4PA1 A;  1TK8 A;  4FLX A;  5HRO A;  4IKF A;  3SUP A;  4I7F A;  1NKE A;  4QOZ B;  3RMC A;  1TKX A;  3IRX A;  2VG5 A;  4ELU A;  4W5R A;  5JS1 A;  2VWK A;  4KI6 A;  4CIE A;  4O4G A;  3K5O A;  3LAK A;  4KTW A;  1T03 A;  4DFM A;  4FLZ A;  4Z4G A;  3O3G A;  2G8I A;  4OVL A;  4KV8 A;  1D9D A;  2LSN A;  1U49 A;  3BGR A;  3PY8 A;  4B9S A;  4FLY A;  4Z4F A;  1HYS A;  3O3F A;  2Q3S A;  2NUB A;  3V9Z A;  3RMB A;  1UAX A;  2G8W A;  3NH1 A;  3VQ4 A;  5C24 A;  3HPH A;  1RNH A;  3VQ7 A;  1S1U A;  3AVA A;  3KKR A;  1RT6 A;  1GOC A;  1B9D A;  4MQ3 A;  2Z1H A;  3NGY A;  4HHT A;  3V9W A;  2ITG A;  4YFU A;  3DLR A;  4BDZ A;  3UIQ A;  2HHQ A;  1RDD A;  3V1Q A;  4DMN A;  4HCC A;  4UQG A;  4CGD A;  1EP4 A;  4PY5 A;  3DLB A;  1W9H A;  3LP0 A;  4CEE A;  2PZS A;  3LPU A;  4E7I A;  3PO5 A;  5CY4 A;  1SL2 A;  1S1W A;  4CIF A;  1I3A A;  1S6P A;  3WNE A;  4CGG A;  2W42 A;  4KFB A;  3KD1 E;  1IKV A;  1RDC A;  4OLA A;  4KKO A;  4M3U A;  2IC3 A;  5CYQ A;  4E7J A;  4M3W A;  3TAM A;  1FXX A;  3TI0 A;  1KVC A;  3DRP A;  1S1T A;  4LY7 A;  3K5M A;  3ULD A;  1BQM A;  1NK4 A;  1K6Y A;  4FJH A;  4FJK A;  3T19 A;  3DM2 A;  3OYA A;  4HUF A;  1KLN A;  4DSK A;  2KFZ A;  2VG7 A;  3ZT0 A;  4CJ3 A;  4DTN A;  4ZTF A;  3OYF A;  2JLE A;  3HPG A;  3KIO A;  4Z0U A;  2RF2 A;  4OGC A;  4NCB A;  1S5J A;  3I0R A;  4M3X A;  4FW1 A;  1HQU A;  4KHW A;  4FJX A;  4M42 A;  5HRP A;  4E7H A;  1J9A A;  1IKY A;  4IG3 A;  4O0J A;  3SYZ A;  3VQP A;  3OS0 A;  1RT3 A;  4CEZ A;  4Y1D A;  3OYM A;  4DLE A;  1O1W A;  3ZSX A;  3OYG A;  4KHN A;  3HK2 A;  1KFD A;  2D5R A;  1B92 A;  3SZ2 A;  1CXU A;  4CJE A;  4DSE A;  4DTS A;  2PYL A;  3IG1 A;  1S6Q A;  1IG9 A;  3ZSR A;  4NCG A;  4DTR A;  2VWJ A;  3TAR A;  1FKO A;  4AIL C;  3MXJ A;  4LD0 A;  4DQR A;  3QEW A;  2QKB A;  5C25 A;  4B9N A;  3ZSV A;  1EET A;  3OJS A;  4FZX C;  1FK9 A;  3V1R A;  1QSL A;  3RR8 A;  3NF6 A;  3PX4 A;  1WN7 A;  3P1G A;  4RW7 A;  2ZD1 A;  3O4Q A;  5HP1 A;  1IO2 A;  2YNF A;  4AHS A;  4KHY A;  2IDO A;  2KZM A;  4MFB A;  3QLH A;  2O4G A;  3V1O A;  3TAN A;  1ZBL A;  1UA0 A;  1T05 A;  4RW4 A;  4K8Z A;  4FXD A;  3MEE A;  1CXQ A;  2HND A;  4CJ5 A;  1RT7 A;  1JLE A;  4BWJ A;  5J2M A;  3OY9 A;  2PY5 A;  1ZBI A;  1HRH A;  2OPP A;  3HT3 A;  3NF8 A;  3NGZ A;  1NK7 A;  1EXQ A;  3OJU A;  1YTA A;  3LP1 A;  3V4I A;  4ZTJ A;  5FRM A;  4IG0 A;  3A2F A;  4PUO A;  1G15 A;  3K57 A;  1N5Y A;  3NDK A;  1HQE A;  4Z4E A;  1NOZ A;  4B8C A;  1A5W A;  3RMA A;  4CF0 A;  1SL0 A;  2G8K A;  2X78 A;  1ZBF A;  4KI4 A;  5T7B A;  3HPO A;  1LW0 A;  2HNY A;  3T1A A;  1W0H A;  3C95 A;  5HRN A;  2KQ2 A;  1XHZ A;  1U04 A;  4GMJ B;  3S3M A;  4FZY A;  3KD5 E;  4DTO A;  4HCB A;  4E0D A;  1J54 A;  4BE0 A;  3OYH A;  2P1J A;  1L3S A;  4H4O A;  3TAF A;  3TAB A;  4CFC A;  1NJW A;  2P5G A;  5CZ2 A;  2HNZ A;  3DRR A;  4FJN A;  1VSH A;  4IDK A;  1REV A;  2GUI A;  4ID1 A;  1VSJ A;  3AA3 A;  1J53 A;  1SKR A;  1U47 A;  3L3V A;  3HVT A;  4CGH A;  4C8M A;  4PWD A;  2HW3 A;  1S9G A;  4EP4 A;  3HP6 A;  3ZCM A;  4CJL A;  4DFP A;  4J2A A;  1KRP A;  4DQS A;  4C8O A;  3ZSY A;  2IOC A;  4HTU A;  3TAP A;  3C94 A;  2OA8 A;  1JLC A;  3PV8 A;  1X9W A;  3AVL A;  3AO4 A;  3U3Y A;  4KPY A;  1LAW A;  2BAN A;  4CHY A;  3V9U A;  1NK5 A;  1IH7 A;  3P5J A;  2HHU A;  1BI4 A;  4I2Q A;  4NCA A;  1C0T A;  1BCO A;  3AA5 X;  3AO3 A;  3OYK A;  4Y1C A;  3DOL A;  2KW4 A;  3OYD A;  3I8D A;  1JLF A;  3ZT3 A;  3K58 A;  3L8B A;  1NK0 A;  4Z4I A;  3SUO A;  2HHT A;  2DFE A;  3MEC A;  1WSH A;  3WNF A;  4N5S A;  4BDY A;  1DTQ A;  2QKK A;  2F8S A;  4HVJ A;  1C6V A;  1ZYQ A;  3LPT A;  1WAJ A;  3LZI A;  2G8F A;  1Q9X A;  1LAV A;  1YTU A;  1VSL A;  3V81 A;  1BIZ A;  5I42 A;  4O0I A;  1DLO A;  1QSY A;  4KO0 A;  2BE2 A;  4DQP A;  1HNV A;  4B3O A;  3SI6 A;  3G10 A;  4DLG A;  2RN2 A;  4NYF A;  4FK0 A;  3FFI A;  1HJR A;  3KK2 A;  2OZM A;  3KK3 A;  4CFB A;  5J1E A;  4M3Z A;  4FK4 A;  1C0U A;  4H4M A;  4OGE A;  4CJQ A;  3OS2 A;  3MXM A;  3I0S A;  5KRT A;  4J2D A;  4CFA A;  4LH5 A;  4JRQ A;  4DS5 A;  1NKB A;  1VK0 A;  1CLQ A;  1RBR A;  3ZSO A;  4OJR A;  4E89 A;  2WOM A;  1JL1 A;  4FM0 A;  4NYN A;  3LDS A;  3B6O A;  4CJF A;  4C8N A;  3AO5 A;  4CJ4 A;  4GW6 A;  4CED A;  3TR8 A;  3HST B;  3S9H A;  4FJJ A;  3NF7 A;  3VQ9 A;  4Q5V A;  2HB5 A;  1KFS A;  3D45 A;  4N56 A;  2R7Y A;  4Q0B A;  4CF1 A;  4CF9 A;  5FRN A;  4CJW A;  4FJ7 A;  4FYD A;  2P5O A;  4C8L A;  4W5O A;  4CER A;  1NJY A;  5DMR A;  3SCX A;  1LWC A;  4CK3 A;  2DTU A;  3ZSQ A;  3DLK A;  3WNG A;  1ASU A;  3VQE A;  1BQN A;  4E1N A;  4KHQ A;  2OPR A;  2ZQB A;  1ASW A;  3AO1 A;  3VQQ A;  4CEF A;  1C0M A;  2XY8 A;  3DRS A;  3NF9 A;  3NH0 A;  3KLG A;  3HYF A;  1U4B A;  4OKK A; 
#chains in the Genus database with same CATH topology
 4ILG B;  1A5X A;  1M1K O;  1GOA A;  1DKG D;  2D0O A;  4KHU A;  4DQQ A;  5J2N A;  3ZX2 A;  4RG8 A;  2VG6 A;  3K9K A;  3THY A;  2FSN A;  3QBX A;  3HVR A;  1IJJ A;  5AR0 A;  3P39 A;  4I9Q A;  4JNE A;  4KAZ A;  3CJ7 A;  1JJ2 M;  4BWM A;  4F9O A;  3D0P A;  3CI5 A;  1RT4 A;  5AQX A;  3OYE A;  4BG9 A;  1S1V A;  3N4Q A;  3RR7 A;  5ELZ A;  4CK1 A;  2Y1I A;  5M1N A;  3NHG A;  3OS1 A;  3VES A;  2P9U B;  3AVM A;  1L3T A;  3HM9 A;  3C6U A;  4K8X A;  4FWR A;  4FW2 A;  3RRG A;  4DV2 K;  3VA0 A;  3NCI A;  3EL2 A;  3CER A;  2XO7 A;  4RTF D;  3FGU A;  2KFN A;  2E1Z A;  3NAE A;  2YHA A;  4WFB L;  2G8V A;  3AA4 A;  4CGF A;  4PQU A;  2HBJ A;  3SV3 A;  5FPM A;  2FBY A;  1BHL A;  1JCG A;  2WON A;  2YJF A;  3EE9 A;  2ITM A;  3OHR A;  4O55 A;  3OYL A;  1IBM K;  1YXQ A;  1VQ9 N;  5AQV A;  3ASM A;  4CCH A;  3F73 A;  3S3O A;  3R6M A;  4E19 A;  1TV6 A;  2UUB K;  1UOC A;  5EXW A;  2NRZ A;  4H8K A;  4FLU A;  1D9F A;  3F9K A;  1HMV A;  4AHT A;  2RKI A;  2VQF K;  3QIO A;  5FRO A;  1RT2 A;  1NGF A;  3OYC A;  3SPZ A;  2JWK A;  2YHB A;  1Q8I A;  3KKS A;  5AZI A;  4OPK A;  5AQO A;  1D8Y A;  2O8D B;  5CHI A;  1QS4 A;  5GIN A;  1ATS A;  5HRS A;  4EAH D;  3ZT1 A;  3C6A A;  2OAN A;  3TSP A;  5HLF A;  1XMO K;  1WLJ A;  4M3R A;  2D0C A;  3EO3 A;  3SJJ A;  3CHW A;  2CH6 A;  4WQ5 A;  5E41 A;  3M8Q A;  1Z26 A;  3TSU A;  2YCH A;  3RMD A;  1E3M A;  3HRG A;  2I7N A;  4CD1 A;  1JLG A;  1X1P A;  4B8A B;  3LDN A;  3JS6 A;  5AJ3 K;  4NXM K;  4IO9 L;  4BE1 A;  3PO4 A;  3LWM A;  1EO1 A;  4FLW A;  3DXM B;  1VSI A;  2VYP A;  1QHT A;  4G1Q A;  3CQY A;  4CES A;  1YUW A;  4FCY A;  1VSD A;  2OPQ A;  3TTF A;  3AO2 A;  2X74 A;  3MDQ A;  2W40 A;  3G0Z A;  3MWT A;  3QEV A;  1RDA A;  1BGX T;  3SMP A;  1BDG A;  2O4I A;  4BRH A;  5LJW A;  2FBX A;  1CZB A;  4HUE A;  2B6A A;  4O5F A;  2P51 A;  3I8B A;  4OKE A;  2E4L A;  3E1Y A;  4C1N I;  2KTQ A;  4PL8 A;  1I39 A;  3ZX3 A;  5SWM A;  3HI0 A;  3TAG A;  4LFA K;  3SQ1 A;  4CEO A;  3V9S A;  3MCA B;  3MMV A;  4KB1 A;  2OPS A;  5M1F A;  1RBV A;  5KPT A;  1QVF M;  4JI3 K;  4JI8 K;  4CZH A;  4IZ9 A;  5IWA K;  1NJI O;  4N47 A;  2XHB A;  4YOX A;  1XNQ K;  3K2P A;  3HM8 A;  1VRT A;  1L3V A;  4RWT A;  2UUA K;  1RTI A;  4X64 K;  4OKJ A;  3D2F A;  2NZT A;  4B9V A;  1Z6R A;  1YT3 A;  4DTJ A;  1VQL N;  3CC7 N;  4CD3 A;  3S41 A;  3IS9 A;  4F2R A;  4CVN E;  4JKE A;  2QTD A;  3D2E A;  4JHD A;  3VA3 A;  3KTQ A;  4AQY K;  4DR6 K;  4J8F A;  2DPN A;  2YNG A;  3C65 A;  3HOT A;  1KCF A;  1NGA A;  4BRE A;  5EX5 A;  1VQM N;  5JVG L;  2QEX N;  3CJ1 A;  3L4I A;  3CFO A;  3FR0 A;  3TAQ A;  2O8B A;  1NK6 A;  4DSL A;  3PLA A;  3PX6 A;  4ICL A;  1Z25 A;  1IKX A;  2KKZ A;  1HNZ K;  2YKN A;  4FWQ A;  3CCQ N;  4B3R K;  4W5Q A;  1EX4 A;  3N4P A;  2FC0 A;  2A6A A;  3OYJ A;  3PUF A;  2HBL A;  4XH1 A;  1UA1 A;  4BVO A;  4QS9 A;  1KD1 O;  2NRV A;  4CF2 A;  5HRO A;  1NKE A;  4QOZ B;  1TKX A;  4ELU A;  2FF3 B;  4IDH A;  3CPW M;  3TTC A;  1T03 A;  4DFM A;  4DKW A;  2G8I A;  2ZGZ A;  5JLH A;  3THY B;  2Q3S A;  2NUB A;  3RMB A;  4FOE A;  3J7Y P;  5C24 A;  4PKH A;  3VQ7 A;  1S1U A;  3ENH A;  3HTV A;  4IJA A;  3V9W A;  3V1Q A;  5C12 A;  1Q82 O;  1EP4 A;  1GLE G;  3ENO A;  2PZS A;  3R9P A;  1LCU A;  2QI2 A;  1S6P A;  2W42 A;  4KHP K;  1IKV A;  3E9P A;  3LDL A;  3U8X A;  4M3U A;  2IC3 A;  5CYQ A;  3CCV N;  5HL7 L;  3VEW A;  1FXX A;  4IFE A;  1KVC A;  3K5M A;  4FJK A;  3ULD A;  4JKD A;  4DQ8 A;  4DSK A;  1KLN A;  1QQN A;  2VG7 A;  3ZT0 A;  4CJ3 A;  3WQT A;  2JLE A;  1YAG A;  4Z0U A;  2RF2 A;  5LY3 A;  4M3X A;  4K41 A;  4AM7 A;  5HRP A;  1J9A A;  1IKY A;  4FOI A;  1T3V A;  3KZB A;  2HBK A;  1RT3 A;  4CEZ A;  4Y1D A;  3OYM A;  4DLE A;  3T69 A;  3OYG A;  3HK2 A;  3QIC A;  1CXU A;  4B1V A;  3DWL A;  3IG1 A;  4NCG A;  2VWJ A;  4JKH A;  4H0T B;  5BRF A;  1IBK K;  3TAR A;  1FKO A;  4KBO A;  4LD0 A;  4DQR A;  2CGL A;  4B9N A;  1EET A;  3V1R A;  3RR8 A;  3PX4 A;  3L4Q A;  5BR8 K;  1OH7 A;  1YI2 N;  2V52 B;  4AHS A;  1ZBS A;  4JI7 K;  4K8Z A;  2P9N A;  5AZI B;  3MEE A;  1ATR A;  1CXQ A;  4PKI A;  3OY9 A;  1ZBI A;  2OPP A;  3VEN A;  1RFQ A;  1NK7 A;  3OJU A;  3QBW A;  3V4I A;  1R59 O;  1T44 A;  3K57 A;  1N5Y A;  1HQE A;  3MWP A;  2OCE A;  1ZBF A;  5JMV A;  4IOA L;  1GLF O;  1W0H A;  1K73 O;  2KQ2 A;  1U04 A;  2YHY A;  2Q0R A;  3OYH A;  4H4O A;  5CZ2 A;  3CCE N;  4IDK A;  5LJV A;  1BO5 O;  4CGH A;  1BUP A;  3HP6 A;  3MX5 A;  1BA0 A;  2W6K A;  1Q81 O;  4DQS A;  2KLA A;  3JAM O;  2UUC K;  4DV7 K;  1JLC A;  1NGE A;  1LAW A;  2P9I A;  4CHY A;  1NK5 A;  1IH7 A;  2UXB K;  4GVE A;  3OYK A;  3K58 A;  1JLF A;  5GAH P;  4WYB A;  4W5N A;  5AQU A;  4HVJ A;  3LZI A;  1LAV A;  1S72 N;  3E9O A;  3G10 A;  3G71 N;  4NYF A;  1VQ8 N;  1E4F T;  3KK2 A;  1YJN N;  4M3Z A;  3D6R A;  5KRT A;  3EZW A;  1VK0 A;  4E89 A;  1Q18 A;  2WOM A;  2E2N A;  3LDS A;  4BR9 A;  1YF5 L;  4C8N A;  3CIP A;  3TR8 A;  4KH6 A;  4MLE A;  4N56 A;  2PBD A;  4IO8 A;  4FJ7 A;  4FYD A;  3D2F B;  4CER A;  1NJY A;  1LWC A;  3WNG A;  1BQN A;  3VQQ A;  2XY8 A;  3NH0 A;  4A2B A;  3D2E B;  4JHD B;  5KQ8 A;  1XI1 A;  5BRH A;  1JLB A;  5KGX A;  2BDP A;  4F8R A;  5SZT A;  1KLM A;  1L5U A;  2CGK A;  4GY2 B;  3SLC A;  2F9W A;  3HZ6 A;  2OYQ A;  3H6E A;  1EWQ A;  5BPM A;  4ELV A;  3O3H A;  4FJG A;  3VEY A;  2O8B B;  1FJG K;  4EHT A;  5M1P A;  3M8P A;  1LW2 A;  3DMJ A;  4H5W A;  2ASP A;  3AVF A;  1IBL K;  3QFP A;  5C42 A;  3QNO A;  1HNI A;  4DU3 A;  4CEQ A;  5KTQ A;  4K43 A;  3VQ5 A;  4FJI A;  1I94 K;  1GOB A;  5C10 A;  4DTP A;  1NGI A;  4FM1 A;  3QET A;  1KTQ A;  3AV9 A;  4B9U A;  4BR7 A;  4FJ5 A;  4K0K K;  1ITG A;  3L2V A;  2NNW A;  1MU2 A;  1IKW A;  3MN7 A;  1TK5 A;  3MN6 A;  4F3T A;  1U45 A;  4PKG A;  2BH1 A;  2QWN A;  3S3N A;  4BRA A;  2EHG A;  3LP2 A;  3SQ2 A;  1QZ5 A;  3HSC A;  4EP5 A;  4QCL A;  3R3L A;  4IOX A;  5E26 A;  3M5R A;  3L2R A;  1TUU A;  4FJM A;  4CW7 B;  4BRK A;  1GLD G;  4DV4 K;  4ID5 A;  2OZS A;  4AHC A;  3KLF A;  4FLV A;  4DSI A;  3MEG A;  2P9L A;  2BTF A;  1VQ6 N;  2NLX A;  3VQ8 A;  3H45 C;  3NVM A;  2HHV A;  2HVI A;  3RSE A;  2YNI A;  2D0P A;  1ZC6 A;  3KLI A;  3DLH A;  4DFK A;  2WBN A;  1QTM A;  3OTO K;  4KB0 A;  1A5V A;  4JK8 A;  1TAQ A;  3GG4 A;  1JCF A;  2PYJ A;  3MAQ A;  4DTX A;  3GDQ A;  4IXC A;  2G8U A;  1BU6 O;  3KK7 A;  4EIA A;  2OTL N;  4NB4 A;  1QHA A;  4ISG A;  4YOV A;  1ZBU A;  1LWF A;  2YKM A;  4DTM A;  4JI2 K;  3QML A;  3SQ4 A;  4CHZ A;  1HLU A;  1RDB A;  2GEM A;  3QEP A;  4B9Q A;  3B6P A;  5LMU K;  3PSF A;  4PL7 A;  4B3T K;  1WAF A;  4E1M A;  4FLT A;  1SV5 A;  4MO5 A;  5J2P A;  2P9N B;  5F0X A;  5BRD A;  4AH9 A;  3NGI A;  3IAY A;  1Z05 A;  3LDP A;  3OYI A;  1QE1 A;  5AQY A;  4CF8 A;  1TK0 A;  4DU1 A;  5KRS A;  2XY6 A;  3KWI A;  3IMX A;  3AVG A;  2JWL A;  4CEA A;  1VSF A;  4BRF A;  1RBS A;  1NGH A;  3L2W A;  2NRR A;  3H1Q A;  3P4I A;  3SQ0 A;  4M3T A;  3CJ9 A;  1YIJ N;  3SAG A;  2GBZ A;  3RWU A;  3O6W A;  3SUN A;  4DTU A;  1TAU A;  3OYN A;  4DB3 A;  4OPH A;  5AQJ A;  1NMN A;  2A1R A;  3SAH A;  1OH5 A;  4BAC A;  3FZF A;  3LP3 A;  3SBT A;  3NH2 A;  4H0P A;  3TTD A;  1JL2 A;  4GKJ K;  3FFK B;  4B3S K;  5KQD A;  2F8T A;  2P9S A;  2P9I B;  3LAL A;  5AQW A;  4YOT A;  5TKY A;  1NK8 A;  1KVB A;  2CH5 A;  4YOW A;  5HOO A;  3L2Q A;  3CFP A;  4M3Y A;  3A8Y A;  3U9Z A;  4K42 A;  2DFF A;  3MX2 A;  4DHY A;  3QES A;  4XH5 A;  4BR0 A;  5B8H A;  3P83 D;  1QQM A;  3THV A;  3THX A;  1TL1 A;  2YV0 X;  4Z94 A;  1NWK A;  3LZJ A;  3QEI A;  2D0A A;  3DJC A;  1S9E A;  4ILH A;  4KTQ A;  4DR1 K;  2ZE2 A;  2ZJR L;  1JKH A;  4BR4 A;  4IFV A;  1P8Z A;  3DLG A;  1RTJ A;  4EFH A;  3CJB A;  1NK9 A;  1HKB A;  4CJT A;  3I33 A;  4DSJ A;  1WSJ A;  3NBP A;  1NLV A;  1CZ9 A;  4W5T A;  3SNN A;  4AHU A;  4BVP A;  4RW6 A;  3NMU A;  1V4T A;  3UKU A;  2ZJP L;  4JKC A;  1K8A O;  4RW8 A;  2W6L A;  3VQA A;  5KGW A;  1RTD A;  4E7L A;  1ZXO A;  4MDB A;  4DF8 A;  3VQ6 A;  4OX9 K;  5AQT A;  1Q86 O;  1WB9 A;  1JXE A;  3VN5 A;  4ZHR A;  1GLJ O;  3EKS A;  1VSE A;  3QB0 A;  5GIO A;  1J5E K;  5AQI A;  2FXU A;  4PA1 A;  4FLX A;  1TYQ A;  4IKF A;  4G9Z A;  2E20 A;  2VG5 A;  1IG8 A;  4KI6 A;  3LAK A;  1YJW N;  2D1K A;  3O3G A;  1D9D A;  3CJC A;  3PY8 A;  4B9S A;  3BGR A;  1ATN A;  3RVC A;  2G8W A;  2NRW A;  2Q31 A;  1RNH A;  3KKR A;  2Q97 A;  1GLL O;  4YFU A;  3O9Q A;  3UIQ A;  4A59 A;  4FWL A;  1HUX A;  5AQH A;  2P9K A;  1W9H A;  3C7N A;  4E7I A;  3PO5 A;  4LFB K;  1SL2 A;  1S1W A;  4CGG A;  3LM9 A;  3O1W A;  3FZL A;  2WUS A;  1YIT N;  4M3W A;  3TI0 A;  4DR7 K;  5F2R A;  4FJH A;  1K6Y A;  3A5L C;  4JI0 K;  4O8K A;  4BRN A;  3VER A;  1ILY A;  4OGC A;  1RGI A;  1NGB A;  2O8C A;  1HQU A;  2F9T A;  4KHW A;  2YHX A;  4FJX A;  4M42 A;  4I6M A;  3CPE A;  4FL9 A;  4BRC A;  1O1W A;  3O9S A;  3SZ2 A;  1QZ6 A;  1OVY A;  1IG9 A;  3O4W A;  3OBW A;  5AQF A;  4FZX C;  1FK9 A;  1LOT B;  4MO4 A;  4RW7 A;  1GLA G;  5HP1 A;  1IO2 A;  2IDO A;  2KZM A;  2P9L B;  1EQY A;  1WUA A;  2O4G A;  1Q7Y O;  4CJ5 A;  1JLE A;  3G25 A;  3NGZ A;  3RSE B;  1YTA A;  3LP1 A;  2A42 A;  4ZTJ A;  3A2F A;  3VF4 A;  1NOZ A;  4B8C A;  2G8K A;  2VGM A;  4CF0 A;  5A2Q O;  2X78 A;  4FPB A;  1LW0 A;  3FE1 A;  4JKB A;  3CD6 N;  5KPR A;  3CC4 N;  3BF3 A;  2ZWH A;  1N33 K;  4CFC A;  5AZJ A;  2HNZ A;  3DRR A;  4FJN A;  3F2K A;  2GUI A;  4ID1 A;  1VSJ A;  2VCP A;  1SKR A;  3L3V A;  3HVT A;  4AF1 A;  1S9G A;  4BC5 A;  4EP4 A;  5I9E B;  2Q0U A;  3ZCM A;  4DFP A;  4JKF A;  4C8O A;  4HTU A;  2AP1 A;  3PV8 A;  1X9W A;  2BAN A;  3P5J A;  1BI4 A;  3QFU A;  3UKR A;  4NCA A;  5FPE A;  4DR5 K;  1V4S A;  4CZL A;  3WXM B;  3AA5 X;  3AO3 A;  3OYD A;  3I8D A;  3L8B A;  4AM6 A;  3ZT3 A;  4Z4I A;  2HHT A;  4N5S A;  3MEC A;  1WSH A;  5KPZ A;  1DTQ A;  3VEX A;  1C6V A;  4CJ7 A;  4DV5 K;  1ZYQ A;  3V81 A;  1BIZ A;  4KO0 A;  3EN9 A;  2RE2 A;  2QM1 A;  2YJE A;  3FFI A;  1HJR A;  5J1E A;  2VGN A;  4FK4 A;  3CCR N;  4CJQ A;  4OGE A;  3MXM A;  3W3D A;  2O8F A;  4J2D A;  3BP8 A;  3VGL A;  1CLQ A;  4IEI A;  1NM1 A;  2GX9 A;  2P9S B;  1RBR A;  4FM0 A;  1JL1 A;  4LF6 K;  4CJF A;  3U4L A;  4BR5 A;  4CJ4 A;  4CED A;  3S9H A;  3HST B;  4CZI A;  3VQ9 A;  3O9U A;  3G4S N;  3CME N;  3ZEU A;  2I7P A;  4Q0B A;  4BC4 A;  4CF1 A;  2E2O A;  4CF9 A;  4CJW A;  4FWP A;  3THX B;  5DMR A;  5EY4 A;  4CK3 A;  3DLK A;  1ASU A;  4E1N A;  2ZQB A;  1MWM A;  3DRS A;  5AQZ A;  3HYF A;  3AGR A;  1BL3 A;  4RW9 A;  1WSG A;  1ZBH A;  4NO7 A;  3ZSZ A;  4B9L A;  3LAM A;  4YDU C;  5GIP A;  2HHH K;  5K14 A;  1BIU A;  4CJS A;  3J7A P;  2V7Z A;  3JXU A;  3JSM A;  2D0B A;  4BRG A;  3HL8 A;  3UKU B;  1XHX A;  4MDA A;  3Q7C A;  3ZSW A;  5J2Q A;  4X66 K;  3CYM A;  5HRR A;  1TL3 A;  5DM7 L;  4KRF A;  1SL1 A;  4OPA A;  3VOV A;  3J81 O;  3JYT A;  4ISF A;  4E7K A;  3HJF A;  3O1B A;  2XY7 A;  4K25 A;  1TYQ B;  1XNR K;  4KTZ A;  1BA1 A;  4QS7 A;  3K59 A;  3TWH A;  2F96 A;  1HPM A;  4CHN A;  1U6Z A;  1EWR A;  4C8K A;  1KSP A;  1TUY A;  3A5N C;  1RTH A;  1J5O A;  4BGB A;  4EZ6 A;  4XEI A;  5EU7 A;  4H5T A;  2QWP A;  1D5A A;  3THW A;  2DFH A;  4L8R B;  3MED A;  2ASM A;  1F21 A;  5CYM A;  2P9K B;  3C7N B;  3E9L A;  3SPY A;  4J2B A;  1W97 L;  4WE1 A;  2A41 A;  3VEZ A;  3QIP A;  4JS4 A;  1XMQ K;  3EYZ A;  2QW9 A;  4JRP A;  4AHV A;  1BIS A;  3IUC A;  3U3G A;  3V6D A;  2V7Y A;  2FSK A;  4YHH K;  3CCJ N;  3TSQ A;  5C15 A;  3V9X A;  3U6F A;  1DT9 A;  3OA9 A;  2O8C B;  1X3N A;  2B4J A;  2IS3 A;  5JS2 A;  4FWN A;  2E6M A;  4I6M B;  5AFU A;  4HUG A;  4DG1 A;  3AA2 A;  3M6G A;  4CJP A;  4KRE A;  1VQ5 N;  5KI6 A;  2BUP A;  1DTT A;  4NLB A;  1LV5 A;  1HR0 K;  4IFY A;  1EKE A;  3CM5 A;  5FPN A;  3RRH A;  4Y0W A;  5CE3 A;  1XC9 A;  3SV4 A;  3NVK A;  5MLC Q;  1X9S A;  1JLQ A;  5C2F A;  3I55 N;  3KLE A;  3TAE A;  1WSF A;  4FZZ A;  2EX3 A;  4U67 L;  2IIR A;  4LF7 K;  3KK1 A;  1RIL A;  3IFR A;  2PFU A;  4TSX A;  4F3O A;  3DLE A;  5DM6 L;  1XQS C;  3W0L A;  2RHK A;  3PIO L;  3ITH A;  4N76 A;  4FJ8 A;  1BWF O;  4LC9 B;  4CGI A;  5AQK A;  1HYZ A;  2ASO A;  2ZF5 O;  3T7Z A;  4CFD A;  1NGJ A;  3KVG A;  4LSN A;  3CM6 A;  4CK2 A;  5AZJ B;  2HVH A;  1N36 K;  1WSE A;  3AGK A;  4R5P A;  5M1Q A;  3EKU A;  5E84 A;  5GAE P;  3ID6 A;  1B9F A;  3KJV A;  3J8A A;  4Z4C A;  4DWI A;  3AY9 A;  1S1X A;  3NE6 A;  3QIN A;  4E3S A;  2Q1N A;  4J2E A;  4I9L A;  2IAJ A;  4H03 B;  4A62 A;  1TVR A;  1RT1 A;  4NXN K;  1VQ7 N;  3Q7B A;  3ATV A;  4N41 A;  5D3G A;  1HNW K;  4CZJ A;  1O13 A;  1BI4 B;  3UKR B;  1OKJ A;  2ATQ A;  4A61 A;  5BPN A;  4FM2 A;  2E6L A;  4KH4 A;  4C23 A;  5LL6 Z;  4LF4 K;  3CQX A;  4FSV A;  1NGD A;  1NG9 A;  2NRX A;  4QAG A;  4CJV A;  3CC2 N;  1N32 K;  1NMD A;  4BRO A;  4B9M A;  4CEB A;  4PHT X;  3QEX A;  4JS5 A;  3A0I X;  5IT9 O;  4BE2 A;  2O8F B;  2XRI A;  3T1H K;  3MXI A;  4GV9 A;  3VGK A;  2QWQ A;  4CE9 A;  1NOY A;  3G6E N;  2HHS A;  3T3F A;  3K5L A;  4CJK A;  1TKZ A;  4H0O A;  4B08 A;  4B1X B;  1VSM A;  3DYA A;  2QWM A;  2HMI A;  1T6C A;  4B1Y B;  3VTH A;  5F1X A;  1YVU A;  3ZEU B;  3AVK A;  2UXD K;  2GWK A;  4R79 A;  1XC3 A;  4DV1 K;  1N8R O;  2E8A A;  4H0X B;  4FVM A;  3M1F A;  1U48 A;  1VSK A;  1R0A A;  5JVH L;  1C1C A;  1ESV A;  2FLO A;  4F4K A;  1TK8 A;  2ZM6 K;  3DXK A;  2YHW A;  3SUP A;  3RMC A;  3IRX A;  2VWK A;  4CIE A;  4O4G A;  4OO1 J;  1QQO A;  5CR4 A;  4Z4G A;  4OVL A;  4KV8 A;  4Z4F A;  4YDU A;  1HYS A;  3VET A;  3O3F A;  3V9Z A;  4DR4 K;  3NH1 A;  3B8A X;  3VQ4 A;  1CZA N;  1RT6 A;  1GOC A;  1YHQ N;  2ITG A;  3E66 A;  1RDD A;  3DLL L;  4HCC A;  3M3Z A;  4PY5 A;  3DLB A;  1C0F A;  5CY4 A;  4CIF A;  1I3A A;  1RDC A;  4OLA A;  4BRL A;  2QA4 N;  4KKO A;  4E7J A;  2GEL A;  4L3Q A;  3C0B A;  1NK4 A;  3OYA A;  4WCE L;  4DTN A;  3OYF A;  3KIO A;  3LDQ A;  2A5X A;  1M90 O;  1VQN N;  4FW1 A;  2IVO A;  2GUP A;  3WUH A;  3SAF A;  3CF5 L;  4E7H A;  2A3Z A;  3BF1 A;  3R8E A;  3CET A;  3SYZ A;  3VEO A;  3THW B;  4KHN A;  1KFD A;  4DSE A;  1B92 A;  4EHU A;  2PYL A;  2YI1 A;  2ZJQ L;  3OW2 M;  3GL1 A;  4DTR A;  3ID8 A;  4AIL C;  3QEW A;  5C25 A;  3ZSV A;  3IDH A;  3OJS A;  4IOC L;  5EOY A;  3NF6 A;  1D4X A;  1QSL A;  4BC2 A;  1WN7 A;  4JI4 K;  2V51 B;  4JV5 K;  3QLH A;  3WEE A;  4WQ4 C;  3TAN A;  3V1O A;  1ZBL A;  1T05 A;  4FXD A;  1MA9 B;  1RT7 A;  4BWJ A;  5J2M A;  1HRH A;  3HT3 A;  3NF8 A;  3CXC M;  3ULE A;  1EXQ A;  1C0G A;  5FRM A;  4IG0 A;  1G15 A;  2HF4 A;  3RMA A;  1A5W A;  1SL0 A;  3L0Q A;  3FZM A;  5T7B A;  3CMA N;  1NNE A;  4GMJ B;  4FZY A;  4DTO A;  1J54 A;  3P38 A;  4DV0 K;  3TAB A;  1U2V A;  1X3M A;  3O9T A;  2P5G A;  3VF2 A;  3MN5 A;  1VSH A;  1REV A;  1J53 A;  2WFB A;  1K8K A;  1KAZ A;  4IEE A;  1U47 A;  1KAX A;  1GLC G;  1BOT O;  4JYA K;  2QWR A;  3ZSY A;  3SK3 A;  4LF8 K;  1DGK N;  2HST A;  3TAP A;  4UY8 O;  3AO4 A;  4B1W B;  1C0T A;  5AQL A;  1IV0 A;  1NK0 A;  2KW4 A;  4JI5 K;  3SUO A;  2DFE A;  2QKK A;  3WNF A;  3KHY A;  5AQN A;  3ZET A;  2F8S A;  3LPT A;  3F5T A;  1WAJ A;  4DV3 K;  1Q9X A;  3AAP A;  4X62 K;  1YTU A;  5I42 A;  4O0I A;  1QSY A;  2BE2 A;  4YY3 K;  4DQP A;  1HNV A;  4A5A A;  1HKG A;  3SI6 A;  4DLG A;  2RN2 A;  3H46 O;  3LDO A;  1X9J A;  3I0S A;  5BR9 A;  1VQK N;  3EE8 A;  4CFA A;  3K9J A;  3SBG A;  4JRQ A;  4DS5 A;  2E88 A;  2QXL A;  3B6O A;  3LM2 A;  4GW6 A;  3NF7 A;  5C0Y A;  4GV3 A;  2HB5 A;  4CZE A;  2R7Y A;  5FRN A;  5H1S Q;  4A5B A;  2P5O A;  4W5O A;  4LF5 K;  2DTU A;  2HF3 A;  4IWV A;  3VQE A;  4JKG A;  1SZ2 A;  2OPR A;  3J7Z O;  1ASW A;  5AQP A;  4BRP A;  3NF9 A;  2UYT A;  3LL3 A;  2J4R A;  1BCM A;  2Z1I A;  3AVB A;  1L3U A;  3AVJ A;  2NRH A;  1NBW A;  4JEP A;  2XY5 A;  1LWE A;  5FPD A;  3ZT2 A;  2E2P A;  3ZLJ A;  3HO1 A;  3DAW A;  1VQP N;  3VF6 A;  2B5J A;  4JI1 K;  4DQI A;  4YOY A;  4HTL A;  2Z1J A;  3SJH A;  4CEC A;  2YNH A;  3KWG A;  3D7E O;  4DSF A;  4FJ9 A;  5BRE A;  4YOU A;  4KHS A;  4BQL A;  3LWL A;  4EZ9 A;  4A2A A;  4GKK K;  3WT0 A;  3A5O C;  3PIP L;  3OVN A;  1RT5 A;  3C6H A;  3L2U A;  4OLB A;  3DXK B;  4NLC A;  4CHQ A;  3K0S A;  5JIC A;  4CZF A;  1FKP A;  2QXF A;  3O08 A;  4Z4H A;  5DK5 A;  3O4N A;  1OH6 A;  4CHP A;  4CJR A;  3CG7 A;  2BGG A;  3M8S A;  4DUZ K;  4JI6 K;  1T7P A;  3BDP A;  1WOQ A;  4DR2 K;  4ELT A;  2DY4 A;  3RTV A;  2I5J A;  1NGC A;  3M8R A;  4CBW A;  2OTJ N;  1SKW A;  5I3U A;  3NFA A;  4B9T A;  1UWB A;  3R1X A;  3UE5 A;  2EWS A;  3H08 A;  2F4V K;  1JXB A;  4FJL A;  2JGU A;  2GWJ A;  4CIG A;  1X9M A;  4CBX A;  2Q2R A;  3EEQ A;  3I56 N;  1KVA A;  4JD2 A;  3WNH A;  5AQS A;  4XIU A;  3AVH A;  3VQD A;  3DI6 A;  3ENB A;  2G8H A;  5AQG A;  2A1S A;  2O8E A;  2P9P A;  1C1A A;  2FBV A;  4LH4 A;  4CZK A;  4B1U B;  1RCH A;  3IKM A;  2GV9 A;  2KZZ A;  3AAQ A;  2QK9 A;  1C1B A;  2WTU A;  3H1V X;  1Q9Y A;  4LSL A;  3SMS A;  4FWO A;  1NJX A;  1TKD A;  4CGJ A;  3H3O B;  4M63 C;  2YX6 A;  1RDU A;  3LAN A;  4BQZ A;  2FSJ A;  4IBN A;  2PAV A;  4OPJ A;  1WSI A;  3AVN A;  1ASV A;  2IGI A;  4CJU A;  2FBT A;  1QSS A;  4XH4 A;  3BZK A;  2Y1J A;  3UB5 A;  3WEE B;  2X6S A;  1W7A A;  1VAZ A;  3ISN C;  4O44 A;  5AQM A;  2X6N A;  4ILJ A;  4WQ4 A;  3ULE B;  3VQB A;  3H3N O;  2IVN A;  2A40 A;  5HBM A;  4M7Y A;  5FDL A;  3EY1 A;  3EZ5 A;  1JLA A;  3E01 A;  1J6Z A;  1RBU A;  2UXC K;  3J80 O;  3HXM A;  2HOE A;  3OBY A;  1U2V B;  3C6T A;  3QO9 A;  4FWM A;  2H3G X;  1KXP A;  3VEV A;  4DCH A;  3PX0 A;  1TGO A;  2HHX A;  1K8K B;  4AHR A;  4DUY K;  1HYV A;  4DFJ A;  2HMP A;  1QQC A;  1VHX A;  4JKA A;  3WXK A;  5JLF A;  1WNS A;  4B3M K;  5ADX A;  3QER A;  1NKC A;  2F7T A;  3DOK A;  4F2S A;  4GVM A;  1SUQ A;  3CCU N;  2Z1G A;  4O5B A;  3K5N A;  4DU4 A;  2QWO A;  4JLH A;  2KHO A;  3ZET B;  3KLH A;  2D4W A;  1DEJ A;  1GLB G;  3ZT4 A;  3GBT A;  4HWI A;  1YJ9 N;  3ALY A;  3VTI A;  4FK2 A;  4BY9 C;  4FWS A;  3QNN A;  1WBD A;  3CCL N;  1QVG M;  1NJZ A;  2RPI A;  3OYB A;  4FVU A;  3HP9 A;  1S3X A;  2HHW A;  1TKT A;  1SQK A;  1RBT A;  2QWL A;  1T6D A;  2ETJ A;  2E1Y A;  3MCP A;  3A5M C;  1HPZ A;  5FLX O;  1VRU A;  1XWL A;  4YNQ A;  2HBM A;  4M45 A;  1S22 A;  1Y64 A;  2AJQ A;  2GTD A;  3CFR A;  1T8E A;  1N6Q A;  4CHO A;  4I2P A;  4LF9 K;  4BDP A;  3L3U A;  2VWB A;  3T1Y K;  4DS4 A;  3CQ8 A;  4M41 A;  3AAR A;  3AVC A;  1Y97 A;  4DF4 A;  3VQC A;  5BN9 A;  1SKS A;  3TPQ A;  4CBU A;  3AVI A;  3BZC A;  3GOI A;  4JN4 A;  4M7X A;  3SUQ A;  2P9U A;  5CZ1 A;  2VQE K;  4JKG B;  5AQR A;  1W2B M;  2WC9 A;  4WFA L;  4I7F A;  4H5R A;  3O5B A;  4W5R A;  5JS1 A;  3CCM N;  3K5O A;  2IVP A;  4KTW A;  1YVN A;  4FLZ A;  1VQO N;  5ADX H;  2LSN A;  1U49 A;  4FLY A;  1UAX A;  1RDW X;  4A57 A;  3HPH A;  2E2Q A;  3AVA A;  4H0V B;  1B9D A;  4MQ3 A;  2Z1H A;  3F9M A;  3NGY A;  4HHT A;  1MWK A;  5AQQ A;  3DLR A;  2ZGY A;  2W41 A;  4BDZ A;  2HHQ A;  1SAZ A;  4DMN A;  3O8M A;  4UQG A;  4CGD A;  1HJO A;  3FZK A;  4BRI A;  3LP0 A;  4CEE A;  3LPU A;  3TU5 A;  3VMF B;  1KQS M;  3WNE A;  4KFB A;  3KD1 E;  1MDU B;  4CZM A;  3TAM A;  4BR2 A;  1E4G T;  3DRP A;  1S1T A;  4H5N A;  4LY7 A;  1BQM A;  4ISE A;  3T19 A;  3DM2 A;  4HUF A;  2KFZ A;  4ZTF A;  3HPG A;  1K9M O;  4NCB A;  4JAX A;  1S5J A;  3I0R A;  3HBT A;  2O8D A;  3HOS A;  3O80 A;  3WQU A;  4WF9 L;  4BC3 A;  4IG3 A;  4O0J A;  3VQP A;  4FWK A;  4V19 S;  3OS0 A;  3ZSX A;  3ATU A;  3P31 A;  2D5R A;  4WQ5 C;  4CJE A;  4DTS A;  5M1K A;  1S6Q A;  2FF6 A;  3ZSR A;  3WXJ A;  4X65 K;  3MXJ A;  3FLC O;  3L6Q A;  2QKB A;  5AFU H;  1P90 A;  4JD2 B;  4B1Z A;  3P1G A;  5BPL A;  2ZD1 A;  3O4Q A;  4YOR A;  2YNF A;  4KHY A;  1JCE A;  1KC8 O;  4MFB A;  3ZX0 A;  1UA0 A;  4RW4 A;  2O8E B;  2P9P B;  2HND A;  4FO0 A;  1HX1 A;  3DXM A;  2PY5 A;  4MLH A;  4KH5 A;  4DV6 K;  4PUO A;  3NDK A;  5GAD P;  4Z4E A;  3WXL A;  1BG3 A;  4KI4 A;  3HPO A;  3BEX A;  2HNY A;  3T1A A;  1XHZ A;  3C95 A;  5HRN A;  3U9D A;  3S3M A;  4GNI A;  3KD5 E;  4HCB A;  4E0D A;  4BE0 A;  2NRT A;  2P1J A;  4JK7 A;  4U7B A;  1L3S A;  2CGJ A;  3TAF A;  4GV6 A;  3MK6 A;  1NJW A;  4JK9 A;  4FPA A;  3AA3 A;  3QDK A;  4BRQ A;  1OVQ A;  5C2D A;  4PWD A;  4C8M A;  2HW3 A;  4CZG A;  2E5L K;  4CJL A;  4J2A A;  1H1V A;  1KRP A;  2IOC A;  3VPZ A;  3C94 A;  2OA8 A;  4RCH A;  3FZH A;  3AVL A;  4C1N K;  3U3Y A;  4KPY A;  2AA4 A;  3V9U A;  2HHU A;  1WBB A;  1VQ4 N;  3CJA A;  4I2Q A;  4IJN A;  1BCO A;  5EVZ A;  4Y1C A;  3DOL A;  4BRD A;  3ZYY X;  4BDY A;  1OH8 A;  4BGA A;  2G8F A;  1VSL A;  4WFN L;  1DLO A;  4O8U A;  2UU9 K;  1G99 A;  1FW6 A;  4B3O A;  3VGM A;  4FK0 A;  4E1J A;  2OZM A;  4CI6 A;  3KK3 A;  4CFB A;  1C0U A;  4H4M A;  3OS2 A;  4LH5 A;  5BN8 A;  1NKB A;  4DR3 K;  4QS8 A;  5TKW A;  3ZSO A;  4OJR A;  5GAG P;  1HNX K;  4NYN A;  4BRM A;  3BY5 A;  3AO5 A;  4FJJ A;  4LFC K;  4Q5V A;  4BG8 A;  3CCS N;  4H0Y B;  1KFS A;  1XUP O;  3D45 A;  3O9R A;  5LMN K;  3GE1 A;  5M1O A;  4C8L A;  1SS6 A;  3SCX A;  3PSI A;  3ZSQ A;  3BUZ B;  1NU0 A;  1KAY A;  4H5V A;  2Q36 A;  4KHQ A;  1NGG A;  3AO1 A;  3MN9 A;  1C0M A;  4CEF A;  3KLG A;  1N34 K;  1U4B A;  3WXI A;  4OKK A;  1HKC A; 
#chains in the Genus database with same CATH homology
 1XI1 A;  1BCM A;  1BL3 A;  1A5X A;  1GOA A;  2Z1I A;  3AVB A;  4RW9 A;  1WSG A;  3AVJ A;  1L3U A;  4KHU A;  2XY5 A;  4DQQ A;  1LWE A;  1ZBH A;  5J2N A;  1JLB A;  3ZSZ A;  4B9L A;  3LAM A;  4RG8 A;  3ZT2 A;  2VG6 A;  5KGX A;  2BDP A;  4F8R A;  5SZT A;  1KLM A;  3HO1 A;  1L5U A;  5K14 A;  1BIU A;  4CJS A;  3HVR A;  2OYQ A;  2B5J A;  4I9Q A;  3JSM A;  2D0B A;  4KAZ A;  3HL8 A;  4BWM A;  4ELV A;  3D0P A;  1XHX A;  3O3H A;  4DQI A;  4FJG A;  1RT4 A;  3ZSW A;  3OYE A;  5J2Q A;  1S1V A;  3CYM A;  3M8P A;  2Z1J A;  5HRR A;  1LW2 A;  1TL3 A;  3DMJ A;  2YNH A;  4CEC A;  3RR7 A;  1SL1 A;  4CK1 A;  2Y1I A;  4DSF A;  4FJ9 A;  3NHG A;  3AVF A;  3OS1 A;  5C42 A;  4KHS A;  3LWL A;  3QNO A;  3JYT A;  1HNI A;  4DU3 A;  4EZ9 A;  4CEQ A;  3AVM A;  5KTQ A;  1L3T A;  4E7K A;  3VQ5 A;  4FJI A;  3HJF A;  3HM9 A;  3C6U A;  4KRF A;  4K8X A;  2XY7 A;  1GOB A;  1RT5 A;  3OVN A;  4FW2 A;  3RRG A;  3L2U A;  4OLB A;  4DTP A;  4KTZ A;  4CHQ A;  3VA0 A;  1FKP A;  2QXF A;  3NCI A;  3K59 A;  4Z4H A;  5DK5 A;  3TWH A;  4FM1 A;  3O4N A;  2XO7 A;  3QET A;  2F96 A;  4CHP A;  2KFN A;  1KTQ A;  3AV9 A;  4CHN A;  4CJR A;  3NAE A;  4B9U A;  3CG7 A;  2YHA A;  2G8V A;  4FJ5 A;  3AA4 A;  4CGF A;  2BGG A;  1ITG A;  3M8S A;  3L2V A;  4C8K A;  4PQU A;  1KSP A;  3SV3 A;  2FBY A;  1T7P A;  1RTH A;  1J5O A;  3BDP A;  1BHL A;  1MU2 A;  2WON A;  4ELT A;  4EZ6 A;  1IKW A;  4O55 A;  2I5J A;  5EU7 A;  3OYL A;  3RTV A;  1TK5 A;  3M8R A;  4F3T A;  1U45 A;  1D5A A;  3ASM A;  3S3N A;  2EHG A;  3LP2 A;  4CCH A;  3F73 A;  3SQ2 A;  3S3O A;  1SKW A;  5I3U A;  3NFA A;  4B9T A;  1UWB A;  4E19 A;  4EP5 A;  2DFH A;  1TV6 A;  4L8R B;  1UOC A;  3MED A;  1F21 A;  3H08 A;  1JXB A;  5CYM A;  4H8K A;  4FLU A;  4QCL A;  3SPY A;  4FJL A;  2JGU A;  1D9F A;  4J2B A;  3L2R A;  3F9K A;  4WE1 A;  1HMV A;  4CIG A;  4FJM A;  1X9M A;  2OZS A;  4AHT A;  2RKI A;  4ID5 A;  3QIO A;  4AHC A;  3QIP A;  5FRO A;  3KLF A;  4JS4 A;  1KVA A;  1RT2 A;  3WNH A;  3OYC A;  3EYZ A;  4FLV A;  3SPZ A;  4DSI A;  4XIU A;  4JRP A;  3AVH A;  4AHV A;  1BIS A;  3MEG A;  2YHB A;  3DI6 A;  3VQD A;  3U3G A;  2G8H A;  3V6D A;  1Q8I A;  3KKS A;  2A1S A;  4OPK A;  3V9X A;  1C1A A;  2FBV A;  4LH4 A;  2DY4 A;  3U6F A;  1RCH A;  3VQ8 A;  1D8Y A;  2GV9 A;  2HHV A;  2B4J A;  2HVI A;  2IS3 A;  2YNI A;  5JS2 A;  1QS4 A;  2KZZ A;  5HRS A;  2QK9 A;  2E6M A;  3KLI A;  1C1B A;  3ZT1 A;  4HUG A;  4DFK A;  1QTM A;  3DLH A;  4DG1 A;  4KB0 A;  1A5V A;  3AA2 A;  4CJP A;  1TAQ A;  5HLF A;  1Q9Y A;  4KRE A;  4LSL A;  5KI6 A;  2PYJ A;  1DTT A;  1WLJ A;  3MAQ A;  4DTX A;  1NJX A;  1LV5 A;  4M3R A;  2G8U A;  1TKD A;  4CGJ A;  2D0C A;  4IFY A;  3SJJ A;  1EKE A;  3LAN A;  5E41 A;  3M8Q A;  3CM5 A;  4IBN A;  1ZBU A;  4OPJ A;  1LWF A;  1WSI A;  1Z26 A;  2YKM A;  1ASV A;  3AVN A;  4DTM A;  2IGI A;  3RRH A;  3RMD A;  4CJU A;  1XC9 A;  3SV4 A;  2FBT A;  4CHZ A;  3SQ4 A;  1QSS A;  1RDB A;  1X9S A;  1JLQ A;  3QEP A;  3B6P A;  1JLG A;  1X1P A;  3KLE A;  3TAE A;  4B8A B;  2Y1J A;  1WSF A;  4FZZ A;  1WAF A;  2EX3 A;  4E1M A;  2X6S A;  4FLT A;  1SV5 A;  5J2P A;  3KK1 A;  1RIL A;  4AH9 A;  3ISN C;  4O44 A;  4BE1 A;  4TSX A;  2X6N A;  3LWM A;  3NGI A;  3PO4 A;  3DLE A;  4FLW A;  3IAY A;  4F3O A;  1VSI A;  3ITH A;  4N76 A;  1QHT A;  4G1Q A;  4FJ8 A;  3VQB A;  3OYI A;  1QE1 A;  4CES A;  4CF8 A;  4CGI A;  4FCY A;  5HBM A;  1VSD A;  2OPQ A;  1HYZ A;  5FDL A;  1TK0 A;  3AO2 A;  2X74 A;  3EY1 A;  4DU1 A;  5KRS A;  3EZ5 A;  1JLA A;  3G0Z A;  2XY6 A;  4CFD A;  3QEV A;  3E01 A;  1RDA A;  1BGX T;  1RBU A;  2O4I A;  3AVG A;  4LSN A;  2FBX A;  1CZB A;  3CM6 A;  1VSF A;  4CEA A;  2B6A A;  4CK2 A;  3HXM A;  4HUE A;  1RBS A;  3C6T A;  3QO9 A;  3L2W A;  2P51 A;  2HVH A;  4OKE A;  2E4L A;  1WSE A;  3SQ0 A;  4R5P A;  2KTQ A;  4M3T A;  1I39 A;  1B9F A;  3KJV A;  3PX0 A;  1TGO A;  2GBZ A;  2HHX A;  5SWM A;  4Z4C A;  4AHR A;  4DWI A;  3RWU A;  3SUN A;  1S1X A;  1HYV A;  3NE6 A;  4DTU A;  3TAG A;  3OYN A;  3SQ1 A;  3QIN A;  4E3S A;  1TAU A;  4J2E A;  4I9L A;  4DFJ A;  2IAJ A;  2A1R A;  1QQC A;  4BAC A;  1TVR A;  4W5N A;  3LP3 A;  4CEO A;  3NH2 A;  3V9S A;  1RT1 A;  1WNS A;  1JL2 A;  2F8T A;  4N41 A;  4KB1 A;  2OPS A;  5D3G A;  3QER A;  1RBV A;  1NKC A;  3DOK A;  3LAL A;  4F2S A;  1BI4 B;  4GVM A;  1SUQ A;  2ATQ A;  2Z1G A;  4O5B A;  1KVB A;  1NK8 A;  4N47 A;  2XHB A;  3K5N A;  4FM2 A;  4DU4 A;  2E6L A;  3L2Q A;  4JLH A;  3CFP A;  4M3Y A;  3KLH A;  3K2P A;  1VRT A;  1L3V A;  2DFF A;  3ZT4 A;  1RTI A;  3QES A;  4OKJ A;  3P83 D;  4B9V A;  3ALY A;  3THV A;  4FK2 A;  1YT3 A;  4DTJ A;  3QNN A;  1TL1 A;  4QAG A;  4CJV A;  2YV0 X;  3IS9 A;  1NJZ A;  4F2R A;  2RPI A;  3OYB A;  3LZJ A;  3QEI A;  4B9M A;  2D0A A;  1S9E A;  4KTQ A;  2ZE2 A;  3HP9 A;  3VA3 A;  4CEB A;  3KTQ A;  2HHW A;  1JKH A;  1TKT A;  4IFV A;  3DLG A;  4JS5 A;  3QEX A;  1RBT A;  1RTJ A;  4BE2 A;  2YNG A;  2XRI A;  2ETJ A;  3MXI A;  4CE9 A;  4CJT A;  1NK9 A;  1NOY A;  4DSJ A;  1WSJ A;  3NBP A;  1KCF A;  2HHS A;  1HPZ A;  1CZ9 A;  3T3F A;  1VRU A;  1XWL A;  4CJK A;  1TKZ A;  4AHU A;  4YNQ A;  4W5T A;  3K5L A;  3SNN A;  4M45 A;  4RW6 A;  4B08 A;  1VSM A;  3DYA A;  3CFR A;  1T8E A;  1N6Q A;  2AJQ A;  4CHO A;  4I2P A;  3CFO A;  3TAQ A;  4BDP A;  3L3U A;  2HMI A;  4RW8 A;  1NK6 A;  3VQA A;  5KGW A;  4DSL A;  4DS4 A;  3CQ8 A;  4M41 A;  1RTD A;  3AVC A;  1Y97 A;  1YVU A;  4E7L A;  3AVK A;  4DF4 A;  4DF8 A;  3PX6 A;  3VQ6 A;  3VQC A;  4ICL A;  1SKS A;  1Z25 A;  1IKX A;  1JXE A;  2YKN A;  3AVI A;  3VN5 A;  4W5Q A;  1EX4 A;  2FC0 A;  3SUQ A;  4ZHR A;  3OYJ A;  4FVM A;  1U48 A;  3PUF A;  1VSK A;  5CZ1 A;  1VSE A;  1R0A A;  1C1C A;  1UA1 A;  4F4K A;  4CF2 A;  4PA1 A;  1TK8 A;  4FLX A;  5HRO A;  4IKF A;  3SUP A;  4I7F A;  1NKE A;  4QOZ B;  3RMC A;  1TKX A;  3IRX A;  2VG5 A;  4ELU A;  4W5R A;  5JS1 A;  2VWK A;  4KI6 A;  4CIE A;  4O4G A;  3K5O A;  3LAK A;  4KTW A;  1T03 A;  4DFM A;  4FLZ A;  4Z4G A;  3O3G A;  2G8I A;  4OVL A;  4KV8 A;  1D9D A;  2LSN A;  1U49 A;  3BGR A;  3PY8 A;  4B9S A;  4FLY A;  4Z4F A;  1HYS A;  3O3F A;  2Q3S A;  2NUB A;  3V9Z A;  3RMB A;  1UAX A;  2G8W A;  3NH1 A;  3VQ4 A;  5C24 A;  3HPH A;  1RNH A;  3VQ7 A;  1S1U A;  3AVA A;  3KKR A;  1RT6 A;  1GOC A;  1B9D A;  4MQ3 A;  2Z1H A;  3NGY A;  4HHT A;  3V9W A;  2ITG A;  4YFU A;  3DLR A;  4BDZ A;  3UIQ A;  2HHQ A;  1RDD A;  3V1Q A;  4DMN A;  4HCC A;  4UQG A;  4CGD A;  1EP4 A;  4PY5 A;  3DLB A;  1W9H A;  3LP0 A;  4CEE A;  2PZS A;  3LPU A;  4E7I A;  3PO5 A;  5CY4 A;  1SL2 A;  1S1W A;  4CIF A;  1I3A A;  1S6P A;  3WNE A;  4CGG A;  2W42 A;  4KFB A;  3KD1 E;  1IKV A;  1RDC A;  4OLA A;  4KKO A;  4M3U A;  2IC3 A;  5CYQ A;  4E7J A;  4M3W A;  3TAM A;  1FXX A;  3TI0 A;  1KVC A;  3DRP A;  1S1T A;  4LY7 A;  3K5M A;  3ULD A;  1BQM A;  1NK4 A;  1K6Y A;  4FJH A;  4FJK A;  3T19 A;  3DM2 A;  3OYA A;  4HUF A;  1KLN A;  4DSK A;  2KFZ A;  2VG7 A;  3ZT0 A;  4CJ3 A;  4DTN A;  4ZTF A;  3OYF A;  2JLE A;  3HPG A;  3KIO A;  4Z0U A;  2RF2 A;  4OGC A;  4NCB A;  1S5J A;  3I0R A;  4M3X A;  4FW1 A;  1HQU A;  4KHW A;  4FJX A;  4M42 A;  5HRP A;  4E7H A;  1J9A A;  1IKY A;  4IG3 A;  4O0J A;  3SYZ A;  3VQP A;  3OS0 A;  1RT3 A;  4CEZ A;  4Y1D A;  3OYM A;  4DLE A;  1O1W A;  3ZSX A;  3OYG A;  4KHN A;  3HK2 A;  1KFD A;  2D5R A;  1B92 A;  3SZ2 A;  1CXU A;  4CJE A;  4DSE A;  4DTS A;  2PYL A;  3IG1 A;  1S6Q A;  1IG9 A;  3ZSR A;  4NCG A;  4DTR A;  2VWJ A;  3TAR A;  1FKO A;  4AIL C;  3MXJ A;  4LD0 A;  4DQR A;  3QEW A;  2QKB A;  5C25 A;  4B9N A;  3ZSV A;  1EET A;  3OJS A;  4FZX C;  1FK9 A;  3V1R A;  1QSL A;  3RR8 A;  3NF6 A;  3PX4 A;  1WN7 A;  3P1G A;  4RW7 A;  2ZD1 A;  3O4Q A;  5HP1 A;  1IO2 A;  2YNF A;  4AHS A;  4KHY A;  2IDO A;  2KZM A;  4MFB A;  3QLH A;  2O4G A;  3V1O A;  3TAN A;  1ZBL A;  1UA0 A;  1T05 A;  4RW4 A;  4K8Z A;  4FXD A;  3MEE A;  1CXQ A;  2HND A;  4CJ5 A;  1RT7 A;  1JLE A;  4BWJ A;  5J2M A;  3OY9 A;  2PY5 A;  1ZBI A;  1HRH A;  2OPP A;  3HT3 A;  3NF8 A;  3NGZ A;  1NK7 A;  1EXQ A;  3OJU A;  1YTA A;  3LP1 A;  3V4I A;  4ZTJ A;  5FRM A;  4IG0 A;  3A2F A;  4PUO A;  1G15 A;  3K57 A;  1N5Y A;  3NDK A;  1HQE A;  4Z4E A;  1NOZ A;  4B8C A;  1A5W A;  3RMA A;  4CF0 A;  1SL0 A;  2G8K A;  2X78 A;  1ZBF A;  4KI4 A;  5T7B A;  3HPO A;  1LW0 A;  2HNY A;  3T1A A;  1W0H A;  3C95 A;  5HRN A;  2KQ2 A;  1XHZ A;  1U04 A;  4GMJ B;  3S3M A;  4FZY A;  3KD5 E;  4DTO A;  4HCB A;  4E0D A;  1J54 A;  4BE0 A;  3OYH A;  2P1J A;  1L3S A;  4H4O A;  3TAF A;  3TAB A;  4CFC A;  1NJW A;  2P5G A;  5CZ2 A;  2HNZ A;  3DRR A;  4FJN A;  1VSH A;  4IDK A;  1REV A;  2GUI A;  4ID1 A;  1VSJ A;  3AA3 A;  1J53 A;  1SKR A;  1U47 A;  3L3V A;  3HVT A;  4CGH A;  4C8M A;  4PWD A;  2HW3 A;  1S9G A;  4EP4 A;  3HP6 A;  3ZCM A;  4CJL A;  4DFP A;  4J2A A;  1KRP A;  4DQS A;  4C8O A;  3ZSY A;  2IOC A;  4HTU A;  3TAP A;  3C94 A;  2OA8 A;  1JLC A;  3PV8 A;  1X9W A;  3AVL A;  3AO4 A;  3U3Y A;  4KPY A;  1LAW A;  2BAN A;  4CHY A;  3V9U A;  1NK5 A;  1IH7 A;  3P5J A;  2HHU A;  1BI4 A;  4I2Q A;  4NCA A;  1C0T A;  1BCO A;  3AA5 X;  3AO3 A;  3OYK A;  4Y1C A;  3DOL A;  2KW4 A;  3OYD A;  3I8D A;  1JLF A;  3ZT3 A;  3K58 A;  3L8B A;  1NK0 A;  4Z4I A;  3SUO A;  2HHT A;  2DFE A;  3MEC A;  1WSH A;  3WNF A;  4N5S A;  4BDY A;  1DTQ A;  2QKK A;  2F8S A;  4HVJ A;  1C6V A;  1ZYQ A;  3LPT A;  1WAJ A;  3LZI A;  2G8F A;  1Q9X A;  1LAV A;  1YTU A;  1VSL A;  3V81 A;  1BIZ A;  5I42 A;  4O0I A;  1DLO A;  1QSY A;  4KO0 A;  2BE2 A;  4DQP A;  1HNV A;  4B3O A;  3SI6 A;  3G10 A;  4DLG A;  2RN2 A;  4NYF A;  4FK0 A;  3FFI A;  1HJR A;  3KK2 A;  2OZM A;  3KK3 A;  4CFB A;  5J1E A;  4M3Z A;  4FK4 A;  1C0U A;  4H4M A;  4OGE A;  4CJQ A;  3OS2 A;  3MXM A;  3I0S A;  5KRT A;  4J2D A;  4CFA A;  4LH5 A;  4JRQ A;  4DS5 A;  1NKB A;  1VK0 A;  1CLQ A;  1RBR A;  3ZSO A;  4OJR A;  4E89 A;  2WOM A;  1JL1 A;  4FM0 A;  4NYN A;  3LDS A;  3B6O A;  4CJF A;  4C8N A;  3AO5 A;  4CJ4 A;  4GW6 A;  4CED A;  3TR8 A;  3HST B;  3S9H A;  4FJJ A;  3NF7 A;  3VQ9 A;  4Q5V A;  2HB5 A;  1KFS A;  3D45 A;  4N56 A;  2R7Y A;  4Q0B A;  4CF1 A;  4CF9 A;  5FRN A;  4CJW A;  4FJ7 A;  4FYD A;  2P5O A;  4C8L A;  4W5O A;  4CER A;  1NJY A;  5DMR A;  3SCX A;  1LWC A;  4CK3 A;  2DTU A;  3ZSQ A;  3DLK A;  3WNG A;  1ASU A;  3VQE A;  1BQN A;  4E1N A;  4KHQ A;  2OPR A;  2ZQB A;  1ASW A;  3AO1 A;  3VQQ A;  4CEF A;  1C0M A;  2XY8 A;  3DRS A;  3NF9 A;  3NH0 A;  3KLG A;  3HYF A;  1U4B A;  4OKK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...