5CY4A

Crystal structure of an oligoribonuclease from acinetobacter baumannii
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
184
structure length
182
Chain Sequence
b'HMSSTLNTRLIWIDLEMTGLDTDNDQIIEIATIITDDHLNVLAEGPVLAIHQPDRILNAMDEWNTRQHGQSGLIERVRRSKLTARDAELQTLEFLKKWVNPKVSPMCGNSICQDRRFLHRLMPELEQYFHYRNLDVSTVKELSKRWRPEIMSGLKASHLAMDDIRDSISELKYYREYFFIMN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Oligoribonuclease
publication title Crystal structure of an oligoribonuclease from Acinetobacter baumannii
rcsb
source organism Acinetobacter baumannii
molecule tags Oxidoreductase
total genus 65
structure length 182
sequence length 184
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.1.-.-:
pdb deposition date 2015-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00929 RNase_T Exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5cy4A00
3IRXA 1RILA 1VSMA 3QLHA 4J2BA 4KFBA 3DMJA 3QETA 3OYEA 3HPHA 4E7IA 4LY7A 4DFMA 3OYCA 2VG7A 1XI1A 5KGXA 1SKSA 3SQ0A 1S6QA 4CHQA 3M8SA 4HUFA 4OGCA 4CHPA 2DY4A 3NBPA 3P5JA 1NK6A 1S1UA 4FM0A 3HXMA 3DLGA 3JYTA 3V9ZA 4DQQA 4C8LA 3HL8A 2IOCA 4N41A 1ASUA 3U3GA 3LP3A 2YNIA 1VK0A 1LWFA 1S5JA 4DTMA 3F73A 3TAPA 4NCAA 4Z4GA 3ZSRA 1RBVA 4FW2A 1L3TA 4DS4A 4KTQA 3PUFA 3ZT0A 2Z1GA 2G8HA 3ZT2A 3KIOA 4BE2A 4CGFA 4CF1A 4MFBA 1JLGA 3MXJA 3MXIA 4M41A 1S9GA 1W0HA 3LALA 5K14A 4CJQA 3OJUA 1UA0A 1WLJA 4KO0A 5CY4A 1HNIA 1LW2A 4W5QA 3KKSA 4CF8A 3O4NA 3HVRA 1VSFA 5KI6A 4KTWA 3OYAA 1VSKA 2ZQBA 4C8MA 1QE1A 3LWMA 3SZ2A 2FC0A 2D0AA 2EHGA 3ALYA 1Q8IA 1VRUA 3K57A 1TKDA 1L3UA 4AHTA 4OVLA 5KTQA 2B6AA 2BANA 3CQ8A 3DOLA 2XY8A 4FJGA 3AVAA 3LP2A 4PA1A 4JRPA 4FM2A 3V1OA 2ATQA 1WSJA 1S6PA 4IBNA 3PX6A 1J54A 3VQDA 2LSNA 4OGEA 4ZTFA 1C0TA 5I42A 3AVIA 3TAQA 1VSLA 3H08A 3AVHA 4CFAA 3QEPA 1S1TA 3S9HA 1VSIA 3TAMA 1JLAA 1HNVA 3NAEA 4CGDA 3AA3A 2KFNA 4FLUA 3HVTA 5CYMA 4DMNA 3IG1A 4Z4EA 1BHLA 2F8SA 3AVGA 3OYKA 1XHZA 1SKRA 4CEQA 4DSJA 2Z1HA 4F3OA 4CF0A 3G0ZA 1NJZA 3JSMA 3P1GA 4BWJA 2VWKA 3VN5A 4KTZA 3UIQA 3ULDA 3SYZA 3PX0A 3IAYA 4CCHA 1KFSA 3HPGA 2E6LA 1KSPA 3KLEA 4N5SA 2D0BA 3QERA 3DLHA 4M3XA 1HQEA 5FRMA 5KRSA 3QINA 4E19A 1U04A 2X78A 3AO3A 3V81A 3DRRA 3OS2A 3S3MA 1DTTA 3AO5A 2FBXA 3DRSA 4CFBA 1GOBA 3AVKA 1HQUA 1S1VA 3TWHA 3U6FA 1NJWA 1B9FA 1KVAA 3QNOA 1FXXA 4FK2A 1IKYA 2B4JA 3D0PA 4E7JA 4B9LA 4Z4FA 4RW4A 4XIUA 3K2PA 3SPZA 4FJJA 1YT3A 4DTOA 4AILC 4DU3A 2DFFA 2ZE2A 3AA4A 1B9DA 4DFJA 3HSTB 3VQCA 1RT1A 3DM2A 1IKWA 1ZBUA 1IH7A 3OYJA 4N47A 4Q0BA 1HMVA 2FBYA 1X1PA 3C95A 4E89A 4EP5A 4B9SA 4J2DA 1DLOA 3S3NA 3B6PA 2IDOA 1SL0A 4IG0A 2Z1IA 4DU4A 4CJFA 2HNDA 4CJVA 5HRNA 4KI6A 1WN7A 5J2QA 4CEDA 2HHVA 1RBSA 1NJXA 4CJKA 3OYLA 3C6UA 3K5LA 4CFDA 4B8AB 3NF9A 4OLAA 1WSGA 3DRPA 2KTQA 4FJHA 4O55A 4KAZA 4CJEA 3FFIA 4WE1A 4DLEA 4C8OA 1QTMA 4FW1A 4CEAA 4CGGA 3AVFA 5SZTA 4CK2A 5JS2A 2BDPA 3HM9A 3PX4A 1RCHA 1HYSA 1WSFA 4FZYA 2RF2A 2E4LA 3OYDA 3DLBA 4FXDA 4OJRA 4CJUA 4AHRA 3RMAA 1G15A 2HMIA 2O4IA 3LZJA 4KHYA 1BGXT 2A1RA 3MEDA 1C0MA 3DI6A 3ZSWA 3MEGA 4CF2A 4KHSA 1D9DA 2G8UA 1Z26A 4CJTA 3ZSOA 4DTUA 2YKNA 4JLHA 4FJKA 1X9SA 4E7LA 1LAVA 1TL3A 1QSLA 1DTQA 2W42A 4JS5A 4B3OA 5JS1A 1FK9A 1RT5A 5T7BA 2Y1JA 2Z1JA 3OYBA 4C8KA 3AVBA 4CGJA 2HHUA 4RG8A 3I0RA 4ZTJA 3NH2A 1NK5A 3DLKA 3NF8A 5HROA 2HHWA 4LSNA 3QEXA 2OA8A 2YKMA 4PQUA 4DTRA 2IGIA 3VQ7A 3WNHA 4CJ5A 4HUEA 4QOZB 4K8XA 1WSHA 4ID5A 4AHSA 1T8EA 1F21A 4Y1DA 2HW3A 4F2SA 3RMCA 3SV4A 4FJ9A 1EXQA 2JGUA 3O3FA 4Z0UA 3VQEA 4DS5A 4KI4A 3K5NA 4IG3A 5KGWA 1T03A 3AO2A 3K5MA 3SUNA 2GV9A 4KREA 3M8QA 1CLQA 3C94A 5J2NA 1HYVA 1B92A 1RBUA 3OYHA 4NCGA 4YFUA 2F96A 4I7FA 4CEBA 3AVNA 2HNZA 4H8KA 1QS4A 1RT2A 4CEEA 4CIFA 2G8KA 1RT7A 3KJVA 1LW0A 4R5PA 1Q9XA 3WNEA 4DTSA 4KHWA 4TSXA 2EX3A 2RKIA 1A5WA 3QEVA 1VSEA 4F8RA 4FJ8A 1C1AA 3V9WA 3VQQA 4ELTA 4H4OA 3L3UA 2Y1IA 1RBRA 1ITGA 3QIPA 1IKXA 1J9AA 4M3ZA 3TAEA 3AVJA 3S3OA 4CF9A 4FK0A 1S1WA 3CM5A 1O1WA 1QSYA 3VQ4A 2KZZA 3PY8A 3KK2A 4LH5A 1UOCA 2YHBA 1RT4A 3OVNA 3DYAA 4KKOA 3KD5E 1HJRA 1QHTA 4CHOA 1TKZA 3RWUA 4PWDA 3F9KA 1TAUA 2D0CA 3C6TA 4KHNA 3SQ1A 1NKBA 5I3UA 2BE2A 3RRHA 1LAWA 3ZT1A 1BI4A 2A1SA 4M45A 2PYJA 4DWIA 5EU7A 3KK1A 1NK8A 5J2MA 3TAFA 4I9LA 4FLTA 4IFYA 1UA1A 3M8PA 1BISA 1SL2A 1IO2A 5E41A 1RT3A 1JLFA 4KB1A 2QK9A 1SV5A 3LP0A 3L8BA 3VA3A 4NCBA 5HLFA 1BI4B 2VG5A 4E1MA 3EZ5A 5HBMA 3RR8A 1GOAA 4F3TA 4DQRA 4KHQA 4ELVA 1RTIA 3CFOA 1I3AA 1XHXA 3RMDA 1RDAA 4GW6A 4W5RA 3PV8A 1U45A 4O0JA 3QNNA 3MXMA 2OPPA 1TVRA 2RPIA 1BQNA 2DTUA 5HRSA 4DFKA 4KHUA 5CZ1A 2IS3A 1TGOA 2HNYA 3KLIA 1RTHA 4O4GA 1SL1A 3AVCA 4I2PA 4FLVA 2KQ2A 3EYZA 1X9WA 4H4MA 1X9MA 4DQPA 4AHCA 5CYQA 2HHTA 1ASWA 3T19A 4CJ4A 5SWMA 3SV3A 3CYMA 1JLEA 1VSHA 1SUQA 3ZSYA 3OY9A 3SCXA 4KRFA 3IS9A 2DFEA 4IDKA 3VQ8A 1JL2A 5J2PA 2QXFA 3NGIA 3LAMA 4B9UA 3MEEA 4AH9A 2GUIA 5HRRA 1TKTA 5J1EA 4EZ9A 4CK3A 3PO4A 1LWCA 3QO9A 4CK1A 4FZXC 3A2FA 4FM1A 2ITGA 1KLNA 4CJWA 3SUQA 4F4KA 5KRTA 4EZ6A 3QIOA 2HVHA 4E7KA 3SPYA 1J5OA 3SNNA 1FKOA 3LAKA 2VG6A 1KLMA 1D8YA 5D3GA 3RRGA 4YNQA 1TL1A 4ZHRA 3TANA 3SQ4A 2OYQA 4M42A 5CZ2A 3CM6A 3G10A 4KPYA 2XY7A 4HCBA 1TV6A 4RW9A 4DTNA 4CGIA 4B9NA 4CGHA 1BCOA 3NGYA 1JXBA 1TKXA 1WNSA 4CJLA 4Q5VA 3LANA 2G8WA 4GMJB 2P1JA 2QKKA 3ZT3A 3RTVA 4E7HA 3TR8A 2D5RA 4OKJA 2X6SA 1C6VA 4LH4A 4OPKA 3HP6A 3AVMA 4ID1A 3O3GA 3MAQA 1U4BA 1RNHA 1RT6A 2RN2A 4I2QA 1RDBA 3ZSQA 3OS1A 4DLGA 1Q9YA 3V1RA 3VQAA 4PY5A 2AJQA 1K6YA 5DMRA 3SUOA 4DSKA 1NKCA 4K8ZA 3NH0A 4HUGA 3VQ9A 2G8FA 2YHAA 2IC3A 4OKKA 3NGZA 4MQ3A 1XC9A 4CHYA 2HB5A 3V9UA 2OZSA 2HHSA 3O4QA 3DOKA 4O0IA 4DSFA 4IKFA 2GBZA 4DU1A 1NJYA 3K5OA 1ZBIA 4B9TA 4EP4A 3M8RA 4CESA 1WSEA 4FZZA 1YTAA 1ZYQA 3KLHA 2OPRA 5FDLA 5C24A 3ZSVA 3L2QA 3AO4A 4DTPA 4FLYA 1NK9A 1QQCA 4CEOA 4Z4IA 3HT3A 1J53A 3OS0A 3L2UA 4FJLA 4DF8A 3VQ5A 1CZBA 4HHTA 2P5OA 1QSSA 2XRIA 3BGRA 4CJ3A 3WNFA 4FJMA 3B6OA 3KTQA 2HHXA 2IAJA 1A5VA 1BQMA 3ZSZA 2OZMA 2HHQA 1KVCA 5HP1A 1NK7A 1L3SA 4FLXA 3HPOA 1CXUA 4CEZA 3ZCMA 1UWBA 3ASMA 4IFVA 4W5OA 4CFCA 2WONA 3AV9A 1YTUA 4DSEA 4O44A 4RW6A 2R7YA 4ELUA 1RDDA 4CIEA 3LZIA 3NDKA 3LWLA 4LSLA 4JS4A 1U48A 3KK3A 3V4IA 2I5JA 1XWLA 4FLWA 3LPTA 1ZBLA 1BIUA 3TABA 3KD1E 4FVMA 4M3WA 4CJRA 4HCCA 1KFDA 1W9HA 3AA2A 3LP1A 4CECA 2G8VA 4FCYA 3SJJA 2FBTA 4FK4A 1FKPA 3AA5X 2YNHA 2OPSA 2G8IA 4BWMA 2XO7A 3AO1A 3L2VA 3QESA 2KW4A 1KVBA 1UAXA 1VRTA 1C0UA 1WSIA 4FJXA 4W5NA 1KCFA 1GOCA 3ZSXA 4DQIA 4E3SA 1JLQA 4DQSA 2QKBA 1WAFA 2PY5A 2WOMA 4W5TA 4F2RA 3L3VA 3BDPA 1D9FA 1Y97A 4BACA 4BE1A 3KLGA 2HVIA 3KLFA 2YNGA 2Q3SA 3RR7A 1BL3A 2ETJA 3OYNA 2PYLA 3OJSA 3VQPA 4AHVA 3NF6A 3V9SA 2KZMA 4DFPA 4E0DA 3V1QA 3U3YA 3THVA 4OPJA 1TK8A 2VWJA 2FBVA 3CFPA 1NK0A 4ICLA 1KRPA 1EX4A 2NUBA 4N56A 3PO5A 2PZSA 3HYFA 3VA0A 2KFZA 4UQGA 4OLBA 4CERA 1EETA 1JL1A 1L5UA 1I39A 3K58A 2X6NA 4G1QA 1REVA 3OYMA 3MECA 1R0AA 3OYFA 1N5YA 1HPZA 3OYIA 4DSIA 4FJIA 4Z4CA 4CIGA 4L8RB 2X74A 3V6DA 3TAGA 1RTJA 1EKEA 4B9VA 4BDZA 1MU2A 1T7PA 4C8NA 4CHNA 4BDYA 1EP4A 1VSJA 1KTQA 3TARA 1NKEA 4I9QA 5FRNA 4BDPA 4OKEA 3AVLA 1S1XA 3O3HA 3CFRA 3ZT4A 3I8DA 3HP9A 2F8TA 2XHBA 4O5BA 1T05A 5C42A 4DTXA 4Z4HA 3T3FA 4FJ5A 3SUPA 2YNFA 1VSDA 1IKVA 4LD0A 1NK4A 1BCMA 1U49A 3ITHA 3L2RA 4CHZA 1NOYA 1HRHA 2DFHA 4KB0A 1JLBA 2ZD1A 1JKHA 3NFAA 1SKWA 3HJFA 4FLZA 3LDSA 3V9XA 4M3UA 5FROA 4GVMA 5DK5A 4DTJA 1WAJA 2XY6A 1A5XA 1BIZA 3T1AA 2E6MA 4J2EA 4HTUA 3SI6A 4M3RA 4M3YA 2BGGA 2P51A 4B08A 3L2WA 1ZBFA 3DLEA 3ISNC 4RW8A 4HVJA 4DSLA 4DF4A 4AHUA 1RTDA 3DLRA 3TI0A 2XY5A 4BE0A 1C1CA 2JLEA 3HO1A 3QEWA 1CZ9A 4N76A 2B5JA 3D45A 3VQBA 1RDCA 3WNGA 3OYGA 4J2AA 4E1NA 3K59A 4M3TA 3RMBA 1TK5A 3HK2A 4QCLA 4FJ7A 3I0SA 1HYZA 5C25A 1RBTA 3QEIA 1TAQA 3NE6A 1D5AA 4CE9A 4DG1A 1IG9A 2P5GA 1S9EA 1U47A 1N6QA 3LPUA 3NHGA 3NH1A 4FJNA 4NYFA 3NCIA 3NF7A 4JRQA 3KKRA 1LV5A 1C1BA 1L3VA 1ZBHA 4CJPA 1LWEA 4KV8A 3E01A 1NOZA 1YVUA 4Y1CA 4CEFA 4B9MA 1JLCA 1ASVA 5HRPA 4RW7A 2O4GA 3CG7A 1JXEA 2OPQA 4NYNA 4QAGA 4CJSA 4PUOA 1CXQA 4B8CA 1TK0A 4FYDA 3SQ2A 3VQ6A 3EY1A 1Z25A 3P83D 2YV0X
chains in the Genus database with same CATH superfamily
4BGBA 3IRXA 4J2BA 5AQZA 4FWLA 4E7IA 3OYCA 3MN9A 1S6QA 3M8SA 3NBPA 3P5JA 3R9PA 2O8CB 3WXLA 3WT0A 3HXMA 2GEMA 4DQQA 2IOCA 2FF3B 1ASUA 1WB9A 2YNIA 1VK0A 4DTMA 2QWLA 1S3XA 3QICA 1ATNA 3ATVA 3HOTA 3PUFA 3ZT0A 1GLAG 5JICA 3KIOA 4CF1A 1JLGA 3MXJA 3CERA 3H3NO 1W0HA 3OJUA 1HNIA 4W5QA 4CF8A 3O4NA 3HVRA 5EX5A 1VSFA 4WFAL 1QVGM 4C23A 1WUAA 1ZBHA 3ALYA 1GLFO 5E26A 3AVAA 3V1OA 1WSJA 5LMNK 2LSNA 2QW9A 4BGAA 3AVIA 1VSLA 3H08A 2FSNA 3QEPA 1S1TA 5M1KA 4FLUA 2F8SA 4DMNA 3IG1A 4IOAL 1BHLA 3BY5A 1XHZA 1SKRA 2E1YA 4DSJA 2Z1HA 3CF5L 1YVNA 4F3OA 3ULEB 4BY9C 4DV1K 4BWJA 4KTZA 1X9JA 4BVOA 3IAYA 4CCHA 1KFSA 4M3XA 3F9MA 5KRSA 1RDUA 1XQSC 3DRSA 1RDWX 1HQUA 1S1VA 4FWRA 5AQWA 3PIOL 1B9FA 4DUYK 3QNOA 2QEXN 4FK2A 1IKYA 4E7JA 3TSPA 4ISFA 1KAZA 3C0BA 4WQ4C 1K9MO 5TKWA 3AA4A 4DFJA 1IKWA 1ZBUA 1IH7A 1VQ9N 3C95A 4A59A 4J2DA 1DLOA 3B6PA 2IDOA 3VEZA 4IG0A 2HNDA 5HRNA 4KI6A 1RBSA 3HI0A 5AQYA 1NJXA 3OYLA 4DV5K 3K5LA 4YHHK 4A57A 3FFIA 3TSUA 1QTMA 4XH1A 3UB5A 4R79A 5JS2A 3LDOA 1VQMN 3OYDA 3ZX0A 3RMAA 2HMIA 1BGXT 4FPAA 4PHTX 1C0MA 4EAHD 3DI6A 3MEGA 2PFUA 4JI4K 4CF2A 2G8UA 3ZSOA 2E2OA 1DTQA 1RT5A 4GVEA 5M1FA 5TKYA 2ZJQL 3I0RA 4JKAA 3NH2A 1NK5A 5HROA 4LSNA 3QEXA 1KD1O 2IGIA 4HUEA 4CJ5A 3VOVA 4JK8A 1E3MA 5M1PA 1T8EA 1Y64A 4FJ9A 2JGUA 3O3FA 4Z0UA 3WUHA 3K5NA 5KGWA 4GY2B 2IIRA 3JS6A 3EKUA 3VTHA 5C2DA 1HYVA 1JCFA 2HF3A 4YFUA 4JI5K 3AVNA 2HNZA 3EE9A 5M1OA 4DUZK 1Q9XA 4DTSA 4KHWA 3G25A 5AQFA 1YITN 1JCEA 1ZXOA 1V4TA 2EX3A 3V9WA 4H4OA 1RBRA 4DR6K 1ITGA 4BR5A 4M3ZA 3LL3A 1S1WA 2CH5A 2KZZA 2Q0RA 5BPLA 3OVNA 1BU6O 3DYAA 1QHTA 1TKZA 4KHNA 1NKBA 3RRHA 4BC3A 1BI4A 2HBKA 3KK1A 4YOTA 1MWMA 1UA1A 2BH1A 4I9LA 4IFYA 1SV5A 4DV7K 1BI4B 1HR0K 3EZ5A 3RR8A 2I7NA 1RTIA 3TTDA 3VEYA 1U45A 1VHXA 3VPZA 1M1KO 3MDQA 3SAFA 4F8RA 4O4GA 3AVCA 2O8EA 1X9MA 3SJHA 3ENBA 3T19A 3SV3A 3MCPA 1SUQA 5M1NA 3IS9A 4IDKA 5ADXH 5HRRA 3O08A 4EZ9A 2O8EB 1LWCA 2Q36A 3BZKA 2HVHA 4E7KA 3SNNA 1FKOA 3LAKA 4H0VB 3OBWA 3CCVN 2GTDA 3VGLA 1WBBA 3VF2A 3SQ4A 4KPYA 4DV0K 1TV6A 4RW9A 1T44A 4WFBL 1JXBA 2P9IA 3LANA 2G8WA 4LF6K 1SAZA 4GMJB 4JI6K 1E4FT 3ZX2A 4LH4A 4Y0WA 3HP6A 1RT6A 2PYJA 4DLGA 2P9IB 3MX2A 1QVFM 4DSKA 1OVYA 4K8ZA 4BVPA 3VQ9A 2YHAA 2IC3A 2QM1A 4OKKA 4MQ3A 3RVCA 1XC9A 3MWTA 3V9UA 4YDUA 1HNXK 2HHSA 3O4QA 4DSFA 3ENOA 3CI5A 2GELA 1NGFA 3M8RA 3NMUA 1DGKN 3EN9A 1WBDA 1YTAA 5BRHA 4BC4A 3KLHA 5C24A 3LM2A 1QQCA 1QZ5A 3IFRA 4OPAA 2KLAA 3OS0A 4FJLA 3MN6A 4KH4A 4DF8A 3VQ5A 1CZBA 2VCPA 4JEPA 4H0OA 4B1VA 3W3DA 3KTQA 1BQMA 2HHHK 1NU0A 2YHWA 5GAGP 1S22A 3QFPA 2DPNA 4DSEA 4HWIA 1OKJA 1RDDA 2I5JA 4O8KA 3KD1E 4M3WA 5ADXA 3TABA 4FVMA 1KFDA 2NNWA 1OVQA 2W6LA 1KAYA 2FBTA 4FK4A 2YNHA 1R59O 2G8IA 4BWMA 3A5NC 4BRHA 3QESA 1KVBA 1UAXA 1VRTA 4Z94A 1IBKK 4QS8A 3S41A 4F9OA 4CZMA 4DQSA 4E3SA 1BO5O 4W5TA 3BDPA 1D9FA 5AQQA 4BACA 3FZKA 3ZEUA 4H0XB 2PYLA 1SQKA 3VQPA 3OJSA 3FFKB 4DFPA 4BRFA 1TK8A 4GV3A 2RE2A 2Q1NA 3NVMA 3CFPA 1NK0A 3SAGA 4N56A 3ZEUB 1NGIA 2V51B 4EHTA 4UQGA 4OLBA 1JL1A 3GOIA 3K58A 2ZWHA 1REVA 1R0AA 3I8BA 4LF9K 2OTJN 4LF5K 1MU2A 5GIPA 5FPMA 1EP4A 1NKEA 4JHDA 4OKEA 3CFRA 4XEIA 4KBOA 2F8TA 2NZTA 3SMSA 3T3FA 3TU5A 3SUPA 1H1VA 4WQ5C 4JHDB 2FSJA 3EZWA 2QA4N 1JLBA 5AQSA 1BG3A 3V9XA 5FROA 4GVMA 2E20A 5DK5A 4DTJA 4IEEA 1A5XA 3KVGA 3MN5A 3SI6A 4X65K 4M3RA 4CD1A 4B08A 5BRDA 1ZBFA 3DLEA 3ISNC 3PSFA 4DKWA 2XY5A 3CQYA 2JLEA 2V7YA 4NXNK 3QEWA 1CZ9A 1NGAA 4N76A 3D45A 3WNGA 1J5EK 3K59A 4M3TA 1TK5A 4FJ7A 1HYZA 5C25A 3QEIA 4H5TA 2P5GA 4FL9A 4L3QA 2E2PA 3LPUA 3CPEA 4FPBA 1L3VA 3QMLA 4IOCL 4B9MA 1YVUA 5AQKA 3P4IA 4JKFA 4FO0A 5HRPA 2O4GA 3CG7A 4BRKA 1JXEA 4NYNA 4CJSA 4B8CA 3BUZB 3CC4N 4DLEA 2NLXA 2YV0X 3WQTA 3DMJA 3HPHA 4DFMA 1XI1A 2VG7A 4WFNL 4HUFA 4OGCA 3I56N 3VF6A 4B9QA 4FM0A 2OTLN 4MDBA 3EEQA 1S5JA 2NRXA 3MMVA 4NCAA 5GADP 1RBVA 3N4PA 4DS4A 4QS9A 4MFBA 1S9GA 5K14A 2NRTA 4CBWA 5MLCQ 4DCHA 4DR2K 1LW2A 3WEEA 3KKSA 1GLEG 4JN4A 4OX9K 4NO7A 4B3TK 1VSKA 2ZQBA 1X3MA 4C8MA 3LWMA 3U4LA 1YUWA 1VRUA 4BRGA 3O80A 3WEEB 1NGJA 1Z05A 2BANA 2H3GX 1K8KA 3LP2A 4ISEA 1J6ZA 3JXUA 4IBNA 3A8YA 4ZTFA 3G4SN 3TAQA 3AVHA 1K8KB 1VSIA 1JLAA 1HNVA 3AA3A 3HVTA 3OYKA 1T6DA 4CEQA 3O6WA 5AQRA 4JKCA 1HJOA 3R6MA 2VWKA 1GLJO 5JMVA 2D0BA 3QERA 3DLHA 1W7AA 4BR2A 3QINA 2A40A 4E19A 3AO3A 5AQOA 3V81A 3DRRA 4DR7K 2VYPA 3OS2A 1QZ6A 3AO5A 3S3MA 5AQJA 5F0XA 1T6CA 1GOBA 3AVKA 3OBYA 3U6FA 1FW6A 3MCAB 3D0PA 3C6AA 4FJJA 4LC9B 2WUSA 2DFFA 4KH5A 1B9DA 4EHUA 2YCHA 1RT1A 3DM2A 3OYJA 2FBYA 3JAMO 4EP5A 4B9SA 1GLDG 4H5VA 2Z1IA 2OANA 4BR7A 2ZJRL 5J2QA 5HL7L 2O8DA 3C6UA 1X3NA 2VWBA 4B8AB 4KAZA 4WE1A 3KWIA 2WBNA 4FW1A 4CEAA 3AVFA 5SZTA 3PIPL 2O8DB 3VETA 4FZYA 2RF2A 2QWMA 4OJRA 4CBXA 4CJUA 1G15A 2O4IA 4KHYA 1EWRA 4NB4A 2P9SB 3ZSWA 4DR4K 4PL8A 3CCJN 4CJTA 4IOXA 3H6EA 1YIJN 4JLHA 1X9SA 4B3OA 1TL3A 3BF1A 4C8KA 3OYBA 5AQUA 4M7YA 2HHUA 4RG8A 3T7ZA 3DLKA 2HHWA 1KC8O 2JWKA 2YKMA 4BRCA 4PQUA 3VQ7A 3WNHA 4CD3A 4K8XA 1F21A 2HMPA 3RMCA 4F2SA 4Z4FA 1EXQA 4MDAA 4KI4A 5H1SQ 1BA0A 4IZ9A 3LDPA 3SUNA 3M8QA 4BRQA 2F96A 3VGKA 4CEBA 2PBDA 4JKBA 4H8KA 1QS4A 1RT7A 2FF6A 4CZGA 3KJVA 3WNEA 3ZX3A 1GLBG 3ID8A 1A5WA 3QEVA 4BC2A 3L3UA 2Y1IA 1J9AA 4IJNA 3TAEA 1KXPA 4CZEA 4FK0A 3Q7BA 5AR0A 1QSYA 4NXMK 3M6GA 4AM6A 1C0GA 4KKOA 5KPRA 3VF4A 4CHOA 3RWUA 1TAUA 5I3UA 2P9UA 2BE2A 3ULEA 3ZT1A 4A5BA 3VEOA 1ZBSA 5I9EB 5J2MA 3TAFA 4FLTA 1BOTO 1SL2A 3SK3A 5E41A 1RT3A 4KB1A 2IVOA 3O9RA 3L8BA 2P9UB 4NLBA 3O9UA 3WXMB 4DR1K 4RCHA 3G71N 1I3AA 3FLCO 1XHXA 1RDAA 4GW6A 4W5RA 4KH6A 1G99A 5C2FA 2DTUA 1Q81O 4ISGA 1SL1A 5AFUA 1GLCG 3THYA 2KQ2A 5CHIA 3CCRN 2HHTA 2ZGZA 1JLEA 4B9UA 3VQ8A 5J2PA 3NGIA 3LAMA 3THYB 4AH9A 4B3RK 2GUIA 2JWLA 2ZGYA 3OHRA 4BRMA 3CCLN 3PO4A 4U67L 5AZJA 4FM1A 4CJWA 3SUQA 4DV3K 4CBUA 1J5OA 4PKGA 2E2QA 3P31A 4FOEA 4LF4K 5AZJB 2E8AA 3AARA 4ZHRA 3TANA 3BF3A 3CM6A 2PAVA 1KAXA 1BCOA 1WNSA 1TKXA 3CHWA 4Q5VA 4MLEA 5F2RA 2P1JA 2F4VK 2D5RA 2X6SA 1C6VA 4OPKA 1U4BA 4ID1A 3O3GA 3SLCA 4PY5A 3VQAA 1NKCA 3NH0A 2WFBA 3NGZA 4CHYA 2GBZA 3ATUA 1HKBA 4DU1A 1NJYA 3K5OA 4BRDA 2UXDK 3U9DA 4FZZA 5AZIA 1ZYQA 2F9TA 4B1UB 3L2QA 4DTPA 3AO4A 5AQGA 5AJ3K 2ZJPL 5AQLA 4CEOA 1VQLN 3K9JA 4LFCK 1J53A 5AZIB 3QBXA 4HHTA 4KHPK 2P5OA 3U8XA 2XRIA 3BGRA 3DJCA 3HBTA 2OZMA 1A5VA 2HHQA 5JVGL 1MWKA 5HP1A 1L3SA 3HPOA 1CXUA 1OH5A 3ASMA 4IFVA 4W5OA 2WC9A 3AV9A 4BG8A 1YTUA 2YHXA 3LWLA 2P9KA 3W0LA 4FLWA 1ZBLA 1BIUA 4OPHA 1VQON 1MDUB 3LP1A 3CCMN 1I94K 4B1XB 3CCUN 4FCYA 3A5OC 2OPSA 1U6ZA 2P9KB 2HBJA 2QTDA 1NNEA 1P90A 2ITMA 4FJXA 1KCFA 3ZSXA 4DQIA 1ATRA 4F2RA 1XMQK 4X62K 4BE1A 3KLGA 2HVIA 1HKCA 3KLFA 4JI8K 2E1ZA 1NM1A 3V9SA 1QQOA 4K42A 4E0DA 3V1QA 3THVA 1VQ6N 2FBVA 4LFAK 4WCEL 2NUBA 2PZSA 4MO4A 1I39A 5GAHP 3H1VX 3VGMA 3IMXA 2KHOA 3OYMA 3CMEN 3OYFA 4FJIA 3IUCA 4BRNA 5KQ8A 3V6DA 1RTJA 2ASOA 4BDZA 4C8NA 4B1WB 1VSJA 3TARA 3H3OB 5C10A 3AVLA 4O5FA 3VMFB 3ZT4A 3J81O 5BRFA 5C42A 4AQYK 3DWLA 1VSDA 1IKVA 4LD0A 4BROA 1NK4A 1BCMA 4UY8O 4FWSA 4KB0A 3HJFA 3NFAA 4OO1J 4M3UA 2HSTA 3UKUA 5GAEP 1Q82O 2E6MA 4HTUA 4M3YA 3VEXA 4GV6A 3AY9A 4RW8A 4DSLA 3UKUB 4AHUA 3TI0A 3D7EO 1NGGA 4FWPA 2O8FA 2B5JA 4JI0K 4J2AA 4WQ5A 3MX5A 3HK2A 4BRAA 4QCLA 2BTFA 3I0SA 1RBTA 1TAQA 3IDHA 3NE6A 2YJFA 4DG1A 3MWPA 2O8FB 3NHGA 4FJNA 1LV5A 3KKRA 3UE5A 1C1BA 3O1BA 3WXKA 3ZLJA 3H1QA 1ASVA 1E4GT 2OPQA 4QAGA 4PUOA 3VENA 1TK0A 3SQ2A 3VQ6A 1D9DA 1HX1A 4V19S 1NJIO 4KFBA 3OYEA 2F9WA 4LY7A 2FLOA 5KGXA 3SQ0A 4CHQA 4CHPA 1N8RO 3HTVA 3O9TA 1S1UA 4BG9A 3V9ZA 3CJ9A 4C8LA 3CC2N 3HL8A 3U3GA 1LWFA 3TAPA 4BR9A 5KPZA 3KWGA 2Z1GA 4I6MA 2G8HA 3ZT2A 3KHYA 4BE2A 4CGFA 2KFNA 1UA0A 4CJQA 3E9OA 5CY4A 4IO9L 1DKGD 4GKKK 4I6MB 4KTWA 2RHKA 3T69A 3OYAA 1EO1A 2EHGA 1Q8IA 3K57A 1TKDA 1L3UA 4AHTA 5KTQA 2B6AA 1OH7A 4PA1A 4JRPA 4FM2A 2ATQA 5AQIA 1BA1A 3PX6A 3VQDA 4ILGB 5IWAK 1C0TA 3F2KA 1YAGA 1M90O 3S9HA 3TAMA 4JYAK 4CGDA 2NRRA 5CE3A 2CH6A 5CYMA 3TTCA 3J80O 1NWKA 3EO3A 1YI2N 1XC3A 5JLHA 4CF0A 4BRLA 4FWNA 3JSMA 2HBLA 3P1GA 3UIQA 4H0PA 3SYZA 2YHYA 1NGCA 4N5SA 1QQMA 1N36K 1N34K 2FBXA 5LMUK 3MK6A 1KQSM 1XNRK 1KVAA 4B9LA 4IWVA 1YF5L 4RW4A 3K2PA 3J7ZO 1YT3A 2D0OA 4AILC 4DU3A 1K8AO 2ZE2A 3EKSA 2P9NA 4Q0BA 2YX6A 2UXBK 1X1PA 4X64K 1D4XA 3OTOK 3S3NA 2P9NB 4DU4A 4CJFA 4CJVA 2HHVA 1WN7A 3AGRA 4DR5K 3LM9A 4M7XA 1WSGA 4K41A 2KTQA 2F7TA 4O55A 4C8OA 3SMPA 4FVUA 3D2EA 2BDPA 1IBLK 1HYSA 2GX9A 1WSFA 4H5RA 3BZCA 3LZJA 2E88A 2A1RA 4JI7K 3D2EB 1QHAA 1S72N 2A3ZA 4KHSA 1Z26A 4DTUA 1U2VA 2A6AA 3CPWM 3DXMA 1QSLA 3PLAA 1FK9A 2Y1JA 3AVBA 5AQMA 4CGJA 5HOOA 4FWQA 3NF8A 1U2VB 4BRPA 2OA8A 3DXMB 2ZM6K 5AQVA 1IV0A 2VQEK 2UUCK 1WSHA 4ID5A 4Y1DA 2HW3A 2Q2RA 1NBWA 4JD2A 3SV4A 4DQ8A 2VGMA 4DS5A 4XH4A 3VQEA 4YORA 1T03A 4KREA 1OH8A 2GV9A 1CLQA 1RBUA 2W41A 4I7FA 4JD2B 5C12A 4CEEA 1HUXA 1LW0A 1DT9A 2RKIA 5KQDA 3HOSA 4FJ8A 3O8MA 3VQQA 2UUBK 2Q31A 3H46O 4CF9A 3CM5A 1O1WA 3VQ4A 3KK2A 4LH5A 1RT4A 1MA9B 1HJRA 4DB3A 1TYQA 3I33A 2D0CA 3C6TA 3ID6A 3SQ1A 5LL6Z 3GE1A 5EVZA 2A1SA 3N4QA 3UKRA 1NK8A 3KK7A 3CIPA 4EFHA 1TYQB 4RWTA 1BISA 2FSKA 1JLFA 3VA3A 2P9LB 4H0YB 4E1MA 3UKRB 5HBMA 4F3TA 2EWSA 4DQRA 3ZETA 4ELVA 3CFOA 3RMDA 3PV8A 1YJ9N 1HLUA 4A2AA 3QNNA 3MXMA 2OPPA 2CGLA 2P9PA 2RPIA 1BQNA 5HRSA 1Z6RA 3ZETB 4A2BA 1TGOA 3CD6N 3KLIA 4JKDA 2ASPA 4H5WA 4FLVA 3EYZA 4MLHA 3VEWA 4CZIA 4DQPA 4AHCA 3FZHA 1HKGA 1ASWA 2P9PB 4CJ4A 5SWMA 3CYMA 1VSHA 4H03B 3VESA 1WOQA 2DFEA 5J1EA 3FE1A 4CK3A 5F1XA 3QO9A 4CK1A 4PL7A 3U9ZA 3L6QA 4FZXC 1KLNA 4F4KA 5EXWA 3O4WA 3SPYA 5D3GA 2VG6A 1KLMA 1LOTB 1VAZA 4YNQA 2OYQA 1OH6A 4DTNA 4CGIA 3LDQA 4CGHA 3NGYA 2P9SA 4WQ4A 3CJCA 2QKKA 3ZT3A 3RTVA 4E7HA 4OKJA 4J8FA 3AVMA 4IO8A 3RSEA 3MAQA 2RN2A 4I2QA 4BR4A 2UU9K 1Q9YA 2YJEA 1K6YA 1Q18A 4K25A 2G8FA 1HNWK 2QWNA 3WXIA 3RSEB 2AA4A 2OZSA 4O0IA 4AF1A 4B9TA 1N32K 1WSEA 2OPRA 1NK9A 5AQTA 1P8ZA 3L2UA 4K0KK 2W40A 4CJ3A 3WNFA 4FJMA 3QB0A 2IAJA 3ZSZA 1KVCA 2J4RA 1NK7A 4FLXA 1EWQA 3ZCMA 2WONA 3HM8A 2Q0UA 2ASMA 4IJAA 4JS4A 4JI1K 1U48A 1XWLA 1JCGA 3E66A 2QWOA 4CJRA 3AA2A 2G8VA 3R1XA 3SJJA 2OCEA 5KPTA 2XO7A 2KW4A 1C0UA 4EIAA 3DXKA 1JLQA 4CI6A 3THXA 2QKBA 1WAFA 3L3VA 3QFUA 1Y97A 4JI2K 3Q7CA 3T1HK 2Q3SA 1BL3A 2ETJA 4H0TB 5BN9A 4CZKA 3DXKB 1VQ4N 3THXB 2KZMA 3U3YA 3A5LC 4ICLA 1KRPA 1TUUA 3HYFA 5B8HA 3VA0A 4CERA 2A41A 4JKEA 2IVPA 1N5YA 1HPZA 3OYIA 4DSIA 5IT9O 3MN7A 2QWPA 4JNEA 4L8RB 2X74A 2E5LK 2I7PA 3E1YA 1VQKN 4B9VA 3M3ZA 2BUPA 4BDYA 2E2NA 5FRNA 4I9QA 1S1XA 3O3HA 3I8DA 3HP9A 2XHBA 4O5BA 4DTXA 4Z4HA 2ZF5O 1O13A 2CGJA 3A0IX 3C7NA 1U49A 2V52B 4CHZA 1NOYA 1HRHA 2DFHA 1JKHA 1SKWA 4JK9A 4FLZA 3LDSA 3C7NB 4M63C 1WAJA 2XY6A 3L4IA 1BIZA 3T1AA 4J2EA 2BGGA 4BR0A 3BEXA 4HVJA 5C15A 3DLRA 2GWJA 5C0YA 5EY4A 1NMDA 1Q7YO 4LFBK 1RDCA 4WF9L 3P38A 4E1NA 5E84A 3RMBA 2W6KA 5LJVA 4CE9A 1T3VA 1N6QA 1K73O 5LY3A 3NF7A 4JAXA 1LWEA 1JLCA 4RW7A 4HTLA 5BPNA 1CXQA 1GLLO 1TUYA 4DV4K 1Z25A 5FLXO 1FJGK 1RILA 1VSMA 3QLHA 5BR8K 3QETA 3A5MC 1SKSA 3GDQA 3C6HA 4FOIA 1CZAN 2DY4A 4BQLA 3DLGA 3JYTA 3SBTA 4N41A 3SAHA 2HF4A 3LP3A 4O8UA 3F73A 4Z4GA 3CJ1A 5ELZA 3ZSRA 4FW2A 4YOWA 1L3TA 1IG8A 1XUPO 4KTQA 3MXIA 4M41A 3LALA 1WLJA 4KO0A 3AAQA 1W2BM 5KI6A 1QE1A 3SZ2A 2FC0A 2A42A 2D0AA 5JS1A 3K9KA 4OVLA 4G9ZA 3CQ8A 3DOLA 3L0QA 2XY8A 4FJGA 4A61A 1LCUA 1S6PA 1J54A 3GBTA 4OGEA 4CZLA 1RFQA 3M1FA 2NRVA 5I42A 5AQPA 1HPMA 4CFAA 3NAEA 5AQHA 4Z4EA 3AVGA 1NGEA 2A5XA 3CCQN 3G0ZA 1NJZA 3BP8A 3VN5A 4BREA 3ULDA 3PX0A 3HPGA 2E6LA 1KSPA 3EL2A 3KLEA 2QXLA 3WXJA 1HQEA 5FRMA 1U04A 2X78A 2D0PA 5BREA 5DM6L 4FWOA 1DTTA 1SZ2A 4CFBA 3D6RA 3TWHA 1NJWA 4CZFA 1FXXA 1NGHA 4RTFD 2B4JA 5AQXA 3H45C 4XIUA 3SPZA 5BN8A 1W97L 4DTOA 3TSQA 4YOXA 3HSTB 3VQCA 4JI3K 4N47A 2QI2A 1HMVA 2QWRA 4E89A 5JLFA 1SL0A 3L4QA 1VQ5N 4CEDA 4CJKA 1NGDA 2D4WA 4CFDA 3NF9A 4OLAA 3F5TA 3DRPA 3QDKA 4FJHA 4CJEA 4DHYA 1YXQA 4CGGA 3I55N 4CK2A 3HM9A 3PX4A 1RCHA 2E4LA 3DLBA 2YI1A 4AHRA 1VQNN 4A62A 3MEDA 3AGKA 4WYBA 2YKNA 4FJKA 4E7LA 1LAVA 2VQFK 4JS5A 2W42A 1QQNA 5T7BA 4LF7K 2Z1JA 3DAWA 3B8AX 3QBWA 4ZTJA 3FR0A 3SBGA 5LJWA 3CMAN 1ATSA 2NRZA 4DTRA 3OW2M 2CGKA 4QOZB 2HOEA 3P39A 4C1NK 4AHSA 5AQNA 4H5NA 3K0SA 1BWFO 4IG3A 3THWA 3AO2A 3K5MA 3C94A 5J2NA 3OYHA 1B92A 4NCGA 1RT2A 2G8KA 4CIFA 4FWKA 3EE8A 4R5PA 3THWB 2Q97A 3J7YP 5GINA 4TSXA 1VSEA 1C1AA 4ELTA 3CJ7A 3QIPA 2WTUA 1IKXA 2UUAK 3AVJA 3S3OA 3GL1A 4YOUA 3O1WA 5GIOA 3PY8A 1UOCA 1ZC6A 2YHBA 3KD5E 2O8BA 4PWDA 3F9KA 2UYTA 1LAWA 1XMOK 4M45A 4ILHA 4DWIA 5EU7A 1YJWN 2O8BB 3M8PA 1IO2A 2QK9A 4FXDA 3LP0A 4NCBA 5HLFA 4GNIA 2VG5A 1N33K 3NVKA 1SS6A 4NLCA 1GOAA 2HBMA 3O9SA 4KHQA 1BDGA 4BRIA 1HNZK 4ILJA 4O0JA 1TVRA 5CR4A 4KHUA 3CJAA 4CVNE 4DFKA 5CZ1A 2IS3A 2HNYA 1RTHA 4I2PA 2UXCK 4GV9A 1X9WA 4H4MA 5EOYA 5CYQA 5FPNA 4LF8K 3T1YK 3OY9A 3ZSYA 2GWKA 4KRFA 3SCXA 3TPQA 2AJQA 1JL2A 4JK7A 2QXFA 3MEEA 1TKTA 4YOYA 4DV2K 4IDHA 1XNQK 4BC5A 3A2FA 2ITGA 3O5BA 5KRTA 4EZ6A 4B3MK 3QIOA 3O9QA 1NLVA 1D8YA 4XH5A 3RRGA 4X66K 1IJJA 3OA9A 4YDUC 1TL1A 1NGBA 4M42A 5CZ2A 3G10A 2XY7A 4HCBA 3VTIA 1JJ2M 4B9NA 2D1KA 1NMNA 4CJLA 1IBMK 4CZHA 4GKJK 1NG9A 3TR8A 4B1ZA 3CETA 1NK6A 1RNHA 3ZSQA 3RR7A 1RDBA 3OS1A 3V1RA 2QWQA 5FPEA 5DMRA 3SUOA 4HUGA 1BUPA 3E9PA 2HB5A 3GG4A 1V4SA 3DOKA 3CQXA 4BQZA 4IKFA 5BR9A 2IVNA 3PSIA 1ZBIA 1YHQN 4EP4A 4CESA 3IKMA 4E1JA 4JV5K 3CXCM 3CCEN 2GUPA 5FDLA 3ZSVA 4FLYA 4Z4IA 3HT3A 3J8AA 2NRHA 1QSSA 4K43A 4DV6K 3B6OA 3C65A 2HHXA 1ILYA 3CC7N 3CCSN 1VQPN 4DR3K 3HRGA 3E9LA 3LDLA 4CEZA 1UWBA 3G6EN 3TTFA 2FXUA 4A5AA 4CFCA 4O44A 2VGNA 4RW6A 2R7YA 1ESVA 4ELUA 3AAPA 3M5RA 4CIEA 4YOVA 3LZIA 3NDKA 4LSLA 5BPMA 4CJ7A 3KK3A 3V4IA 3LPTA 4QS7A 4HCCA 1W9HA 4CECA 4MO5A 2NRWA 3CJBA 1FKPA 3AA5X 5JVHL 2P9LA 3AO1A 3L2VA 1WSIA 4W5NA 1GOCA 3FGUA 2PY5A 2WOMA 1RGIA 3WQUA 2YNGA 3VEVA 4PKHA 3KZBA 3OYNA 4AHVA 1EQYA 3NF6A 4OPJA 2VWJA 3D2FA 4B3SK 1EX4A 4JKHA 3PO5A 2KFZA 1EETA 4B1YB 1L5UA 4JKGA 2X6NA 4G1QA 3MECA 3D2FB 4Z4CA 4CIGA 3TAGA 2KKZA 1EKEA 5FPDA 1YJNN 1T7PA 4CHNA 4JKGB 3HSCA 3R8EA 1KTQA 5A2QO 3DLLL 4BDPA 1C0FA 3FZMA 4CW7B 4FWMA 4IXCA 1T05A 5DM7L 3FZFA 4FJ5A 3LDNA 2YNFA 3ITHA 3L2RA 4U7BA 5M1QA 2ZD1A 4IEIA 4AM7A 3FZLA 1Q86O 4IFEA 3HZ6A 2P51A 3L2WA 2V7ZA 3R3LA 4DF4A 4C1NI 1RTDA 3J7AP 4BE0A 1C1CA 1VQ8N 4CZJA 3HO1A 1DEJA 3VQBA 3OYGA 3ZYYX 4PKIA 1D5AA 1IG9A 1S9EA 1U47A 3NH1A 4NYFA 3NCIA 4JRQA 4YY3K 4CJPA 4KV8A 1VQ7N 3E01A 1NOZA 4Y1CA 4CEFA 3VERA 4FSVA 5AFUH 3ENHA 4FYDA 2AP1A 3EY1A 3P83D 2O8CA
chains in the Genus database with same CATH topology
3IRXA 1RILA 1VSMA 3QLHA 4J2BA 4KFBA 3DMJA 3QETA 3OYEA 3HPHA 4E7IA 4LY7A 4DFMA 3OYCA 2VG7A 1XI1A 5KGXA 1SKSA 3SQ0A 1S6QA 4CHQA 3M8SA 4HUFA 4OGCA 4CHPA 2DY4A 3NBPA 3P5JA 1NK6A 1S1UA 4FM0A 3HXMA 3DLGA 3JYTA 3V9ZA 4DQQA 4C8LA 3HL8A 2IOCA 4N41A 1ASUA 3U3GA 3LP3A 2YNIA 1VK0A 1LWFA 1S5JA 4DTMA 3F73A 3TAPA 4NCAA 4Z4GA 3ZSRA 1RBVA 4FW2A 1L3TA 4DS4A 4KTQA 3PUFA 3ZT0A 2Z1GA 2G8HA 3ZT2A 3KIOA 4BE2A 4CGFA 4CF1A 4MFBA 1JLGA 3MXJA 3MXIA 4M41A 1S9GA 1W0HA 3LALA 5K14A 4CJQA 3OJUA 1UA0A 1WLJA 4KO0A 5CY4A 1HNIA 1LW2A 4W5QA 3KKSA 4CF8A 3O4NA 3HVRA 1VSFA 5KI6A 4KTWA 3OYAA 1VSKA 2ZQBA 4C8MA 1QE1A 3LWMA 3SZ2A 2FC0A 2D0AA 2EHGA 3ALYA 1Q8IA 1VRUA 3K57A 1TKDA 1L3UA 4AHTA 4OVLA 5KTQA 2B6AA 2BANA 3CQ8A 3DOLA 2XY8A 4FJGA 3AVAA 3LP2A 4PA1A 4JRPA 4FM2A 3V1OA 2ATQA 1WSJA 1S6PA 4IBNA 3PX6A 1J54A 3VQDA 2LSNA 4OGEA 4ZTFA 1C0TA 5I42A 3AVIA 3TAQA 1VSLA 3H08A 3AVHA 4CFAA 3QEPA 1S1TA 3S9HA 1VSIA 3TAMA 1JLAA 1HNVA 3NAEA 4CGDA 3AA3A 2KFNA 4FLUA 3HVTA 5CYMA 4DMNA 3IG1A 4Z4EA 1BHLA 2F8SA 3AVGA 3OYKA 1XHZA 1SKRA 4CEQA 4DSJA 2Z1HA 4F3OA 4CF0A 3G0ZA 1NJZA 3JSMA 3P1GA 4BWJA 2VWKA 3VN5A 4KTZA 3UIQA 3ULDA 3SYZA 3PX0A 3IAYA 4CCHA 1KFSA 3HPGA 2E6LA 1KSPA 3KLEA 4N5SA 2D0BA 3QERA 3DLHA 4M3XA 1HQEA 5FRMA 5KRSA 3QINA 4E19A 1U04A 2X78A 3AO3A 3V81A 3DRRA 3OS2A 3S3MA 1DTTA 3AO5A 2FBXA 3DRSA 4CFBA 1GOBA 3AVKA 1HQUA 1S1VA 3TWHA 3U6FA 1NJWA 1B9FA 1KVAA 3QNOA 1FXXA 4FK2A 1IKYA 2B4JA 3D0PA 4E7JA 4B9LA 4Z4FA 4RW4A 4XIUA 3K2PA 3SPZA 4FJJA 1YT3A 4DTOA 4AILC 4DU3A 2DFFA 2ZE2A 3AA4A 1B9DA 4DFJA 3HSTB 3VQCA 1RT1A 3DM2A 1IKWA 1ZBUA 1IH7A 3OYJA 4N47A 4Q0BA 1HMVA 2FBYA 1X1PA 3C95A 4E89A 4EP5A 4B9SA 4J2DA 1DLOA 3S3NA 3B6PA 2IDOA 1SL0A 4IG0A 2Z1IA 4DU4A 4CJFA 2HNDA 4CJVA 5HRNA 4KI6A 1WN7A 5J2QA 4CEDA 2HHVA 1RBSA 1NJXA 4CJKA 3OYLA 3C6UA 3K5LA 4CFDA 4B8AB 3NF9A 4OLAA 1WSGA 3DRPA 2KTQA 4FJHA 4O55A 4KAZA 4CJEA 3FFIA 4WE1A 4DLEA 4C8OA 1QTMA 4FW1A 4CEAA 4CGGA 3AVFA 5SZTA 4CK2A 5JS2A 2BDPA 3HM9A 3PX4A 1RCHA 1HYSA 1WSFA 4FZYA 2RF2A 2E4LA 3OYDA 3DLBA 4FXDA 4OJRA 4CJUA 4AHRA 3RMAA 1G15A 2HMIA 2O4IA 3LZJA 4KHYA 1BGXT 2A1RA 3MEDA 1C0MA 3DI6A 3ZSWA 3MEGA 4CF2A 4KHSA 1D9DA 2G8UA 1Z26A 4CJTA 3ZSOA 4DTUA 2YKNA 4JLHA 4FJKA 1X9SA 4E7LA 1LAVA 1TL3A 1QSLA 1DTQA 2W42A 4JS5A 4B3OA 5JS1A 1FK9A 1RT5A 5T7BA 2Y1JA 2Z1JA 3OYBA 4C8KA 3AVBA 4CGJA 2HHUA 4RG8A 3I0RA 4ZTJA 3NH2A 1NK5A 3DLKA 3NF8A 5HROA 2HHWA 4LSNA 3QEXA 2OA8A 2YKMA 4PQUA 4DTRA 2IGIA 3VQ7A 3WNHA 4CJ5A 4HUEA 4QOZB 4K8XA 1WSHA 4ID5A 4AHSA 1T8EA 1F21A 4Y1DA 2HW3A 4F2SA 3RMCA 3SV4A 4FJ9A 1EXQA 2JGUA 3O3FA 4Z0UA 3VQEA 4DS5A 4KI4A 3K5NA 4IG3A 5KGWA 1T03A 3AO2A 3K5MA 3SUNA 2GV9A 4KREA 3M8QA 1CLQA 3C94A 5J2NA 1HYVA 1B92A 1RBUA 3OYHA 4NCGA 4YFUA 2F96A 4I7FA 4CEBA 3AVNA 2HNZA 4H8KA 1QS4A 1RT2A 4CEEA 4CIFA 2G8KA 1RT7A 3KJVA 1LW0A 4R5PA 1Q9XA 3WNEA 4DTSA 4KHWA 4TSXA 2EX3A 2RKIA 1A5WA 3QEVA 1VSEA 4F8RA 4FJ8A 1C1AA 3V9WA 3VQQA 4ELTA 4H4OA 3L3UA 2Y1IA 1RBRA 1ITGA 3QIPA 1IKXA 1J9AA 4M3ZA 3TAEA 3AVJA 3S3OA 4CF9A 4FK0A 1S1WA 3CM5A 1O1WA 1QSYA 3VQ4A 2KZZA 3PY8A 3KK2A 4LH5A 1UOCA 2YHBA 1RT4A 3OVNA 3DYAA 4KKOA 3KD5E 1HJRA 1QHTA 4CHOA 1TKZA 3RWUA 4PWDA 3F9KA 1TAUA 2D0CA 3C6TA 4KHNA 3SQ1A 1NKBA 5I3UA 2BE2A 3RRHA 1LAWA 3ZT1A 1BI4A 2A1SA 4M45A 2PYJA 4DWIA 5EU7A 3KK1A 1NK8A 5J2MA 3TAFA 4I9LA 4FLTA 4IFYA 1UA1A 3M8PA 1BISA 1SL2A 1IO2A 5E41A 1RT3A 1JLFA 4KB1A 2QK9A 1SV5A 3LP0A 3L8BA 3VA3A 4NCBA 5HLFA 1BI4B 2VG5A 4E1MA 3EZ5A 5HBMA 3RR8A 1GOAA 4F3TA 4DQRA 4KHQA 4ELVA 1RTIA 3CFOA 1I3AA 1XHXA 3RMDA 1RDAA 4GW6A 4W5RA 3PV8A 1U45A 4O0JA 3QNNA 3MXMA 2OPPA 1TVRA 2RPIA 1BQNA 2DTUA 5HRSA 4DFKA 4KHUA 5CZ1A 2IS3A 1TGOA 2HNYA 3KLIA 1RTHA 4O4GA 1SL1A 3AVCA 4I2PA 4FLVA 2KQ2A 3EYZA 1X9WA 4H4MA 1X9MA 4DQPA 4AHCA 5CYQA 2HHTA 1ASWA 3T19A 4CJ4A 5SWMA 3SV3A 3CYMA 1JLEA 1VSHA 1SUQA 3ZSYA 3OY9A 3SCXA 4KRFA 3IS9A 2DFEA 4IDKA 3VQ8A 1JL2A 5J2PA 2QXFA 3NGIA 3LAMA 4B9UA 3MEEA 4AH9A 2GUIA 5HRRA 1TKTA 5J1EA 4EZ9A 4CK3A 3PO4A 1LWCA 3QO9A 4CK1A 4FZXC 3A2FA 4FM1A 2ITGA 1KLNA 4CJWA 3SUQA 4F4KA 5KRTA 4EZ6A 3QIOA 2HVHA 4E7KA 3SPYA 1J5OA 3SNNA 1FKOA 3LAKA 2VG6A 1KLMA 1D8YA 5D3GA 3RRGA 4YNQA 1TL1A 4ZHRA 3TANA 3SQ4A 2OYQA 4M42A 5CZ2A 3CM6A 3G10A 4KPYA 2XY7A 4HCBA 1TV6A 4RW9A 4DTNA 4CGIA 4B9NA 4CGHA 1BCOA 3NGYA 1JXBA 1TKXA 1WNSA 4CJLA 4Q5VA 3LANA 2G8WA 4GMJB 2P1JA 2QKKA 3ZT3A 3RTVA 4E7HA 3TR8A 2D5RA 4OKJA 2X6SA 1C6VA 4LH4A 4OPKA 3HP6A 3AVMA 4ID1A 3O3GA 3MAQA 1U4BA 1RNHA 1RT6A 2RN2A 4I2QA 1RDBA 3ZSQA 3OS1A 4DLGA 1Q9YA 3V1RA 3VQAA 4PY5A 2AJQA 1K6YA 5DMRA 3SUOA 4DSKA 1NKCA 4K8ZA 3NH0A 4HUGA 3VQ9A 2G8FA 2YHAA 2IC3A 4OKKA 3NGZA 4MQ3A 1XC9A 4CHYA 2HB5A 3V9UA 2OZSA 2HHSA 3O4QA 3DOKA 4O0IA 4DSFA 4IKFA 2GBZA 4DU1A 1NJYA 3K5OA 1ZBIA 4B9TA 4EP4A 3M8RA 4CESA 1WSEA 4FZZA 1YTAA 1ZYQA 3KLHA 2OPRA 5FDLA 5C24A 3ZSVA 3L2QA 3AO4A 4DTPA 4FLYA 1NK9A 1QQCA 4CEOA 4Z4IA 3HT3A 1J53A 3OS0A 3L2UA 4FJLA 4DF8A 3VQ5A 1CZBA 4HHTA 2P5OA 1QSSA 2XRIA 3BGRA 4CJ3A 3WNFA 4FJMA 3B6OA 3KTQA 2HHXA 2IAJA 1A5VA 1BQMA 3ZSZA 2OZMA 2HHQA 1KVCA 5HP1A 1NK7A 1L3SA 4FLXA 3HPOA 1CXUA 4CEZA 3ZCMA 1UWBA 3ASMA 4IFVA 4W5OA 4CFCA 2WONA 3AV9A 1YTUA 4DSEA 4O44A 4RW6A 2R7YA 4ELUA 1RDDA 4CIEA 3LZIA 3NDKA 3LWLA 4LSLA 4JS4A 1U48A 3KK3A 3V4IA 2I5JA 1XWLA 4FLWA 3LPTA 1ZBLA 1BIUA 3TABA 3KD1E 4FVMA 4M3WA 4CJRA 4HCCA 1KFDA 1W9HA 3AA2A 3LP1A 4CECA 2G8VA 4FCYA 3SJJA 2FBTA 4FK4A 1FKPA 3AA5X 2YNHA 2OPSA 2G8IA 4BWMA 2XO7A 3AO1A 3L2VA 3QESA 2KW4A 1KVBA 1UAXA 1VRTA 1C0UA 1WSIA 4FJXA 4W5NA 1KCFA 1GOCA 3ZSXA 4DQIA 4E3SA 1JLQA 4DQSA 2QKBA 1WAFA 2PY5A 2WOMA 4W5TA 4F2RA 3L3VA 3BDPA 1D9FA 1Y97A 4BACA 4BE1A 3KLGA 2HVIA 3KLFA 2YNGA 2Q3SA 3RR7A 1BL3A 2ETJA 3OYNA 2PYLA 3OJSA 3VQPA 4AHVA 3NF6A 3V9SA 2KZMA 4DFPA 4E0DA 3V1QA 3U3YA 3THVA 4OPJA 1TK8A 2VWJA 2FBVA 3CFPA 1NK0A 4ICLA 1KRPA 1EX4A 2NUBA 4N56A 3PO5A 2PZSA 3HYFA 3VA0A 2KFZA 4UQGA 4OLBA 4CERA 1EETA 1JL1A 1L5UA 1I39A 3K58A 2X6NA 4G1QA 1REVA 3OYMA 3MECA 1R0AA 3OYFA 1N5YA 1HPZA 3OYIA 4DSIA 4FJIA 4Z4CA 4CIGA 4L8RB 2X74A 3V6DA 3TAGA 1RTJA 1EKEA 4B9VA 4BDZA 1MU2A 1T7PA 4C8NA 4CHNA 4BDYA 1EP4A 1VSJA 1KTQA 3TARA 1NKEA 4I9QA 5FRNA 4BDPA 4OKEA 3AVLA 1S1XA 3O3HA 3CFRA 3ZT4A 3I8DA 3HP9A 2F8TA 2XHBA 4O5BA 1T05A 5C42A 4DTXA 4Z4HA 3T3FA 4FJ5A 3SUPA 2YNFA 1VSDA 1IKVA 4LD0A 1NK4A 1BCMA 1U49A 3ITHA 3L2RA 4CHZA 1NOYA 1HRHA 2DFHA 4KB0A 1JLBA 2ZD1A 1JKHA 3NFAA 1SKWA 3HJFA 4FLZA 3LDSA 3V9XA 4M3UA 5FROA 4GVMA 5DK5A 4DTJA 1WAJA 2XY6A 1A5XA 1BIZA 3T1AA 2E6MA 4J2EA 4HTUA 3SI6A 4M3RA 4M3YA 2BGGA 2P51A 4B08A 3L2WA 1ZBFA 3DLEA 3ISNC 4RW8A 4HVJA 4DSLA 4DF4A 4AHUA 1RTDA 3DLRA 3TI0A 2XY5A 4BE0A 1C1CA 2JLEA 3HO1A 3QEWA 1CZ9A 4N76A 2B5JA 3D45A 3VQBA 1RDCA 3WNGA 3OYGA 4J2AA 4E1NA 3K59A 4M3TA 3RMBA 1TK5A 3HK2A 4QCLA 4FJ7A 3I0SA 1HYZA 5C25A 1RBTA 3QEIA 1TAQA 3NE6A 1D5AA 4CE9A 4DG1A 1IG9A 2P5GA 1S9EA 1U47A 1N6QA 3LPUA 3NHGA 3NH1A 4FJNA 4NYFA 3NCIA 3NF7A 4JRQA 3KKRA 1LV5A 1C1BA 1L3VA 1ZBHA 4CJPA 1LWEA 4KV8A 3E01A 1NOZA 1YVUA 4Y1CA 4CEFA 4B9MA 1JLCA 1ASVA 5HRPA 4RW7A 2O4GA 3CG7A 1JXEA 2OPQA 4NYNA 4QAGA 4CJSA 4PUOA 1CXQA 4B8CA 1TK0A 4FYDA 3SQ2A 3VQ6A 3EY1A 1Z25A 3P83D 2YV0X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IRX A;  1RIL A;  1VSM A;  3QLH A;  4J2B A;  4KFB A;  3DMJ A;  3QET A;  3OYE A;  3HPH A;  4E7I A;  4LY7 A;  4DFM A;  3OYC A;  2VG7 A;  1XI1 A;  5KGX A;  1SKS A;  3SQ0 A;  1S6Q A;  4CHQ A;  3M8S A;  4HUF A;  4OGC A;  4CHP A;  2DY4 A;  3NBP A;  3P5J A;  1NK6 A;  1S1U A;  4FM0 A;  3HXM A;  3DLG A;  3JYT A;  3V9Z A;  4DQQ A;  4C8L A;  3HL8 A;  2IOC A;  4N41 A;  1ASU A;  3U3G A;  3LP3 A;  2YNI A;  1VK0 A;  1LWF A;  1S5J A;  4DTM A;  3F73 A;  3TAP A;  4NCA A;  4Z4G A;  3ZSR A;  1RBV A;  4FW2 A;  1L3T A;  4DS4 A;  4KTQ A;  3PUF A;  3ZT0 A;  2Z1G A;  2G8H A;  3ZT2 A;  3KIO A;  4BE2 A;  4CGF A;  4CF1 A;  4MFB A;  1JLG A;  3MXJ A;  3MXI A;  4M41 A;  1S9G A;  1W0H A;  3LAL A;  5K14 A;  4CJQ A;  3OJU A;  1UA0 A;  1WLJ A;  4KO0 A;  5CY4 A;  1HNI A;  1LW2 A;  4W5Q A;  3KKS A;  4CF8 A;  3O4N A;  3HVR A;  1VSF A;  5KI6 A;  4KTW A;  3OYA A;  1VSK A;  2ZQB A;  4C8M A;  1QE1 A;  3LWM A;  3SZ2 A;  2FC0 A;  2D0A A;  2EHG A;  3ALY A;  1Q8I A;  1VRU A;  3K57 A;  1TKD A;  1L3U A;  4AHT A;  4OVL A;  5KTQ A;  2B6A A;  2BAN A;  3CQ8 A;  3DOL A;  2XY8 A;  4FJG A;  3AVA A;  3LP2 A;  4PA1 A;  4JRP A;  4FM2 A;  3V1O A;  2ATQ A;  1WSJ A;  1S6P A;  4IBN A;  3PX6 A;  1J54 A;  3VQD A;  2LSN A;  4OGE A;  4ZTF A;  1C0T A;  5I42 A;  3AVI A;  3TAQ A;  1VSL A;  3H08 A;  3AVH A;  4CFA A;  3QEP A;  1S1T A;  3S9H A;  1VSI A;  3TAM A;  1JLA A;  1HNV A;  3NAE A;  4CGD A;  3AA3 A;  2KFN A;  4FLU A;  3HVT A;  5CYM A;  4DMN A;  3IG1 A;  4Z4E A;  1BHL A;  2F8S A;  3AVG A;  3OYK A;  1XHZ A;  1SKR A;  4CEQ A;  4DSJ A;  2Z1H A;  4F3O A;  4CF0 A;  3G0Z A;  1NJZ A;  3JSM A;  3P1G A;  4BWJ A;  2VWK A;  3VN5 A;  4KTZ A;  3UIQ A;  3ULD A;  3SYZ A;  3PX0 A;  3IAY A;  4CCH A;  1KFS A;  3HPG A;  2E6L A;  1KSP A;  3KLE A;  4N5S A;  2D0B A;  3QER A;  3DLH A;  4M3X A;  1HQE A;  5FRM A;  5KRS A;  3QIN A;  4E19 A;  1U04 A;  2X78 A;  3AO3 A;  3V81 A;  3DRR A;  3OS2 A;  3S3M A;  1DTT A;  3AO5 A;  2FBX A;  3DRS A;  4CFB A;  1GOB A;  3AVK A;  1HQU A;  1S1V A;  3TWH A;  3U6F A;  1NJW A;  1B9F A;  1KVA A;  3QNO A;  1FXX A;  4FK2 A;  1IKY A;  2B4J A;  3D0P A;  4E7J A;  4B9L A;  4Z4F A;  4RW4 A;  4XIU A;  3K2P A;  3SPZ A;  4FJJ A;  1YT3 A;  4DTO A;  4AIL C;  4DU3 A;  2DFF A;  2ZE2 A;  3AA4 A;  1B9D A;  4DFJ A;  3HST B;  3VQC A;  1RT1 A;  3DM2 A;  1IKW A;  1ZBU A;  1IH7 A;  3OYJ A;  4N47 A;  4Q0B A;  1HMV A;  2FBY A;  1X1P A;  3C95 A;  4E89 A;  4EP5 A;  4B9S A;  4J2D A;  1DLO A;  3S3N A;  3B6P A;  2IDO A;  1SL0 A;  4IG0 A;  2Z1I A;  4DU4 A;  4CJF A;  2HND A;  4CJV A;  5HRN A;  4KI6 A;  1WN7 A;  5J2Q A;  4CED A;  2HHV A;  1RBS A;  1NJX A;  4CJK A;  3OYL A;  3C6U A;  3K5L A;  4CFD A;  4B8A B;  3NF9 A;  4OLA A;  1WSG A;  3DRP A;  2KTQ A;  4FJH A;  4O55 A;  4KAZ A;  4CJE A;  3FFI A;  4WE1 A;  4DLE A;  4C8O A;  1QTM A;  4FW1 A;  4CEA A;  4CGG A;  3AVF A;  5SZT A;  4CK2 A;  5JS2 A;  2BDP A;  3HM9 A;  3PX4 A;  1RCH A;  1HYS A;  1WSF A;  4FZY A;  2RF2 A;  2E4L A;  3OYD A;  3DLB A;  4FXD A;  4OJR A;  4CJU A;  4AHR A;  3RMA A;  1G15 A;  2HMI A;  2O4I A;  3LZJ A;  4KHY A;  1BGX T;  2A1R A;  3MED A;  1C0M A;  3DI6 A;  3ZSW A;  3MEG A;  4CF2 A;  4KHS A;  1D9D A;  2G8U A;  1Z26 A;  4CJT A;  3ZSO A;  4DTU A;  2YKN A;  4JLH A;  4FJK A;  1X9S A;  4E7L A;  1LAV A;  1TL3 A;  1QSL A;  1DTQ A;  2W42 A;  4JS5 A;  4B3O A;  5JS1 A;  1FK9 A;  1RT5 A;  5T7B A;  2Y1J A;  2Z1J A;  3OYB A;  4C8K A;  3AVB A;  4CGJ A;  2HHU A;  4RG8 A;  3I0R A;  4ZTJ A;  3NH2 A;  1NK5 A;  3DLK A;  3NF8 A;  5HRO A;  2HHW A;  4LSN A;  3QEX A;  2OA8 A;  2YKM A;  4PQU A;  4DTR A;  2IGI A;  3VQ7 A;  3WNH A;  4CJ5 A;  4HUE A;  4QOZ B;  4K8X A;  1WSH A;  4ID5 A;  4AHS A;  1T8E A;  1F21 A;  4Y1D A;  2HW3 A;  4F2S A;  3RMC A;  3SV4 A;  4FJ9 A;  1EXQ A;  2JGU A;  3O3F A;  4Z0U A;  3VQE A;  4DS5 A;  4KI4 A;  3K5N A;  4IG3 A;  5KGW A;  1T03 A;  3AO2 A;  3K5M A;  3SUN A;  2GV9 A;  4KRE A;  3M8Q A;  1CLQ A;  3C94 A;  5J2N A;  1HYV A;  1B92 A;  1RBU A;  3OYH A;  4NCG A;  4YFU A;  2F96 A;  4I7F A;  4CEB A;  3AVN A;  2HNZ A;  4H8K A;  1QS4 A;  1RT2 A;  4CEE A;  4CIF A;  2G8K A;  1RT7 A;  3KJV A;  1LW0 A;  4R5P A;  1Q9X A;  3WNE A;  4DTS A;  4KHW A;  4TSX A;  2EX3 A;  2RKI A;  1A5W A;  3QEV A;  1VSE A;  4F8R A;  4FJ8 A;  1C1A A;  3V9W A;  3VQQ A;  4ELT A;  4H4O A;  3L3U A;  2Y1I A;  1RBR A;  1ITG A;  3QIP A;  1IKX A;  1J9A A;  4M3Z A;  3TAE A;  3AVJ A;  3S3O A;  4CF9 A;  4FK0 A;  1S1W A;  3CM5 A;  1O1W A;  1QSY A;  3VQ4 A;  2KZZ A;  3PY8 A;  3KK2 A;  4LH5 A;  1UOC A;  2YHB A;  1RT4 A;  3OVN A;  3DYA A;  4KKO A;  3KD5 E;  1HJR A;  1QHT A;  4CHO A;  1TKZ A;  3RWU A;  4PWD A;  3F9K A;  1TAU A;  2D0C A;  3C6T A;  4KHN A;  3SQ1 A;  1NKB A;  5I3U A;  2BE2 A;  3RRH A;  1LAW A;  3ZT1 A;  1BI4 A;  2A1S A;  4M45 A;  2PYJ A;  4DWI A;  5EU7 A;  3KK1 A;  1NK8 A;  5J2M A;  3TAF A;  4I9L A;  4FLT A;  4IFY A;  1UA1 A;  3M8P A;  1BIS A;  1SL2 A;  1IO2 A;  5E41 A;  1RT3 A;  1JLF A;  4KB1 A;  2QK9 A;  1SV5 A;  3LP0 A;  3L8B A;  3VA3 A;  4NCB A;  5HLF A;  1BI4 B;  2VG5 A;  4E1M A;  3EZ5 A;  5HBM A;  3RR8 A;  1GOA A;  4F3T A;  4DQR A;  4KHQ A;  4ELV A;  1RTI A;  3CFO A;  1I3A A;  1XHX A;  3RMD A;  1RDA A;  4GW6 A;  4W5R A;  3PV8 A;  1U45 A;  4O0J A;  3QNN A;  3MXM A;  2OPP A;  1TVR A;  2RPI A;  1BQN A;  2DTU A;  5HRS A;  4DFK A;  4KHU A;  5CZ1 A;  2IS3 A;  1TGO A;  2HNY A;  3KLI A;  1RTH A;  4O4G A;  1SL1 A;  3AVC A;  4I2P A;  4FLV A;  2KQ2 A;  3EYZ A;  1X9W A;  4H4M A;  1X9M A;  4DQP A;  4AHC A;  5CYQ A;  2HHT A;  1ASW A;  3T19 A;  4CJ4 A;  5SWM A;  3SV3 A;  3CYM A;  1JLE A;  1VSH A;  1SUQ A;  3ZSY A;  3OY9 A;  3SCX A;  4KRF A;  3IS9 A;  2DFE A;  4IDK A;  3VQ8 A;  1JL2 A;  5J2P A;  2QXF A;  3NGI A;  3LAM A;  4B9U A;  3MEE A;  4AH9 A;  2GUI A;  5HRR A;  1TKT A;  5J1E A;  4EZ9 A;  4CK3 A;  3PO4 A;  1LWC A;  3QO9 A;  4CK1 A;  4FZX C;  3A2F A;  4FM1 A;  2ITG A;  1KLN A;  4CJW A;  3SUQ A;  4F4K A;  5KRT A;  4EZ6 A;  3QIO A;  2HVH A;  4E7K A;  3SPY A;  1J5O A;  3SNN A;  1FKO A;  3LAK A;  2VG6 A;  1KLM A;  1D8Y A;  5D3G A;  3RRG A;  4YNQ A;  1TL1 A;  4ZHR A;  3TAN A;  3SQ4 A;  2OYQ A;  4M42 A;  5CZ2 A;  3CM6 A;  3G10 A;  4KPY A;  2XY7 A;  4HCB A;  1TV6 A;  4RW9 A;  4DTN A;  4CGI A;  4B9N A;  4CGH A;  1BCO A;  3NGY A;  1JXB A;  1TKX A;  1WNS A;  4CJL A;  4Q5V A;  3LAN A;  2G8W A;  4GMJ B;  2P1J A;  2QKK A;  3ZT3 A;  3RTV A;  4E7H A;  3TR8 A;  2D5R A;  4OKJ A;  2X6S A;  1C6V A;  4LH4 A;  4OPK A;  3HP6 A;  3AVM A;  4ID1 A;  3O3G A;  3MAQ A;  1U4B A;  1RNH A;  1RT6 A;  2RN2 A;  4I2Q A;  1RDB A;  3ZSQ A;  3OS1 A;  4DLG A;  1Q9Y A;  3V1R A;  3VQA A;  4PY5 A;  2AJQ A;  1K6Y A;  5DMR A;  3SUO A;  4DSK A;  1NKC A;  4K8Z A;  3NH0 A;  4HUG A;  3VQ9 A;  2G8F A;  2YHA A;  2IC3 A;  4OKK A;  3NGZ A;  4MQ3 A;  1XC9 A;  4CHY A;  2HB5 A;  3V9U A;  2OZS A;  2HHS A;  3O4Q A;  3DOK A;  4O0I A;  4DSF A;  4IKF A;  2GBZ A;  4DU1 A;  1NJY A;  3K5O A;  1ZBI A;  4B9T A;  4EP4 A;  3M8R A;  4CES A;  1WSE A;  4FZZ A;  1YTA A;  1ZYQ A;  3KLH A;  2OPR A;  5FDL A;  5C24 A;  3ZSV A;  3L2Q A;  3AO4 A;  4DTP A;  4FLY A;  1NK9 A;  1QQC A;  4CEO A;  4Z4I A;  3HT3 A;  1J53 A;  3OS0 A;  3L2U A;  4FJL A;  4DF8 A;  3VQ5 A;  1CZB A;  4HHT A;  2P5O A;  1QSS A;  2XRI A;  3BGR A;  4CJ3 A;  3WNF A;  4FJM A;  3B6O A;  3KTQ A;  2HHX A;  2IAJ A;  1A5V A;  1BQM A;  3ZSZ A;  2OZM A;  2HHQ A;  1KVC A;  5HP1 A;  1NK7 A;  1L3S A;  4FLX A;  3HPO A;  1CXU A;  4CEZ A;  3ZCM A;  1UWB A;  3ASM A;  4IFV A;  4W5O A;  4CFC A;  2WON A;  3AV9 A;  1YTU A;  4DSE A;  4O44 A;  4RW6 A;  2R7Y A;  4ELU A;  1RDD A;  4CIE A;  3LZI A;  3NDK A;  3LWL A;  4LSL A;  4JS4 A;  1U48 A;  3KK3 A;  3V4I A;  2I5J A;  1XWL A;  4FLW A;  3LPT A;  1ZBL A;  1BIU A;  3TAB A;  3KD1 E;  4FVM A;  4M3W A;  4CJR A;  4HCC A;  1KFD A;  1W9H A;  3AA2 A;  3LP1 A;  4CEC A;  2G8V A;  4FCY A;  3SJJ A;  2FBT A;  4FK4 A;  1FKP A;  3AA5 X;  2YNH A;  2OPS A;  2G8I A;  4BWM A;  2XO7 A;  3AO1 A;  3L2V A;  3QES A;  2KW4 A;  1KVB A;  1UAX A;  1VRT A;  1C0U A;  1WSI A;  4FJX A;  4W5N A;  1KCF A;  1GOC A;  3ZSX A;  4DQI A;  4E3S A;  1JLQ A;  4DQS A;  2QKB A;  1WAF A;  2PY5 A;  2WOM A;  4W5T A;  4F2R A;  3L3V A;  3BDP A;  1D9F A;  1Y97 A;  4BAC A;  4BE1 A;  3KLG A;  2HVI A;  3KLF A;  2YNG A;  2Q3S A;  3RR7 A;  1BL3 A;  2ETJ A;  3OYN A;  2PYL A;  3OJS A;  3VQP A;  4AHV A;  3NF6 A;  3V9S A;  2KZM A;  4DFP A;  4E0D A;  3V1Q A;  3U3Y A;  3THV A;  4OPJ A;  1TK8 A;  2VWJ A;  2FBV A;  3CFP A;  1NK0 A;  4ICL A;  1KRP A;  1EX4 A;  2NUB A;  4N56 A;  3PO5 A;  2PZS A;  3HYF A;  3VA0 A;  2KFZ A;  4UQG A;  4OLB A;  4CER A;  1EET A;  1JL1 A;  1L5U A;  1I39 A;  3K58 A;  2X6N A;  4G1Q A;  1REV A;  3OYM A;  3MEC A;  1R0A A;  3OYF A;  1N5Y A;  1HPZ A;  3OYI A;  4DSI A;  4FJI A;  4Z4C A;  4CIG A;  4L8R B;  2X74 A;  3V6D A;  3TAG A;  1RTJ A;  1EKE A;  4B9V A;  4BDZ A;  1MU2 A;  1T7P A;  4C8N A;  4CHN A;  4BDY A;  1EP4 A;  1VSJ A;  1KTQ A;  3TAR A;  1NKE A;  4I9Q A;  5FRN A;  4BDP A;  4OKE A;  3AVL A;  1S1X A;  3O3H A;  3CFR A;  3ZT4 A;  3I8D A;  3HP9 A;  2F8T A;  2XHB A;  4O5B A;  1T05 A;  5C42 A;  4DTX A;  4Z4H A;  3T3F A;  4FJ5 A;  3SUP A;  2YNF A;  1VSD A;  1IKV A;  4LD0 A;  1NK4 A;  1BCM A;  1U49 A;  3ITH A;  3L2R A;  4CHZ A;  1NOY A;  1HRH A;  2DFH A;  4KB0 A;  1JLB A;  2ZD1 A;  1JKH A;  3NFA A;  1SKW A;  3HJF A;  4FLZ A;  3LDS A;  3V9X A;  4M3U A;  5FRO A;  4GVM A;  5DK5 A;  4DTJ A;  1WAJ A;  2XY6 A;  1A5X A;  1BIZ A;  3T1A A;  2E6M A;  4J2E A;  4HTU A;  3SI6 A;  4M3R A;  4M3Y A;  2BGG A;  2P51 A;  4B08 A;  3L2W A;  1ZBF A;  3DLE A;  3ISN C;  4RW8 A;  4HVJ A;  4DSL A;  4DF4 A;  4AHU A;  1RTD A;  3DLR A;  3TI0 A;  2XY5 A;  4BE0 A;  1C1C A;  2JLE A;  3HO1 A;  3QEW A;  1CZ9 A;  4N76 A;  2B5J A;  3D45 A;  3VQB A;  1RDC A;  3WNG A;  3OYG A;  4J2A A;  4E1N A;  3K59 A;  4M3T A;  3RMB A;  1TK5 A;  3HK2 A;  4QCL A;  4FJ7 A;  3I0S A;  1HYZ A;  5C25 A;  1RBT A;  3QEI A;  1TAQ A;  3NE6 A;  1D5A A;  4CE9 A;  4DG1 A;  1IG9 A;  2P5G A;  1S9E A;  1U47 A;  1N6Q A;  3LPU A;  3NHG A;  3NH1 A;  4FJN A;  4NYF A;  3NCI A;  3NF7 A;  4JRQ A;  3KKR A;  1LV5 A;  1C1B A;  1L3V A;  1ZBH A;  4CJP A;  1LWE A;  4KV8 A;  3E01 A;  1NOZ A;  1YVU A;  4Y1C A;  4CEF A;  4B9M A;  1JLC A;  1ASV A;  5HRP A;  4RW7 A;  2O4G A;  3CG7 A;  1JXE A;  2OPQ A;  4NYN A;  4QAG A;  4CJS A;  4PUO A;  1CXQ A;  4B8C A;  1TK0 A;  4FYD A;  3SQ2 A;  3VQ6 A;  3EY1 A;  1Z25 A;  3P83 D;  2YV0 X; 
#chains in the Genus database with same CATH topology
 4BGB A;  3IRX A;  4J2B A;  5AQZ A;  4FWL A;  4E7I A;  3OYC A;  3MN9 A;  1S6Q A;  3M8S A;  3NBP A;  3P5J A;  3R9P A;  2O8C B;  3WXL A;  3WT0 A;  3HXM A;  2GEM A;  4DQQ A;  2IOC A;  2FF3 B;  1ASU A;  1WB9 A;  2YNI A;  1VK0 A;  4DTM A;  2QWL A;  1S3X A;  3QIC A;  1ATN A;  3ATV A;  3HOT A;  3PUF A;  3ZT0 A;  1GLA G;  5JIC A;  3KIO A;  4CF1 A;  1JLG A;  3MXJ A;  3CER A;  3H3N O;  1W0H A;  3OJU A;  1HNI A;  4W5Q A;  4CF8 A;  3O4N A;  3HVR A;  5EX5 A;  1VSF A;  4WFA L;  1QVG M;  4C23 A;  1WUA A;  1ZBH A;  3ALY A;  1GLF O;  5E26 A;  3AVA A;  3V1O A;  1WSJ A;  5LMN K;  2LSN A;  2QW9 A;  4BGA A;  3AVI A;  1VSL A;  3H08 A;  2FSN A;  3QEP A;  1S1T A;  5M1K A;  4FLU A;  2F8S A;  4DMN A;  3IG1 A;  4IOA L;  1BHL A;  3BY5 A;  1XHZ A;  1SKR A;  2E1Y A;  4DSJ A;  2Z1H A;  3CF5 L;  1YVN A;  4F3O A;  3ULE B;  4BY9 C;  4DV1 K;  4BWJ A;  4KTZ A;  1X9J A;  4BVO A;  3IAY A;  4CCH A;  1KFS A;  4M3X A;  3F9M A;  5KRS A;  1RDU A;  1XQS C;  3DRS A;  1RDW X;  1HQU A;  1S1V A;  4FWR A;  5AQW A;  3PIO L;  1B9F A;  4DUY K;  3QNO A;  2QEX N;  4FK2 A;  1IKY A;  4E7J A;  3TSP A;  4ISF A;  1KAZ A;  3C0B A;  4WQ4 C;  1K9M O;  5TKW A;  3AA4 A;  4DFJ A;  1IKW A;  1ZBU A;  1IH7 A;  1VQ9 N;  3C95 A;  4A59 A;  4J2D A;  1DLO A;  3B6P A;  2IDO A;  3VEZ A;  4IG0 A;  2HND A;  5HRN A;  4KI6 A;  1RBS A;  3HI0 A;  5AQY A;  1NJX A;  3OYL A;  4DV5 K;  3K5L A;  4YHH K;  4A57 A;  3FFI A;  3TSU A;  1QTM A;  4XH1 A;  3UB5 A;  4R79 A;  5JS2 A;  3LDO A;  1VQM N;  3OYD A;  3ZX0 A;  3RMA A;  2HMI A;  1BGX T;  4FPA A;  4PHT X;  1C0M A;  4EAH D;  3DI6 A;  3MEG A;  2PFU A;  4JI4 K;  4CF2 A;  2G8U A;  3ZSO A;  2E2O A;  1DTQ A;  1RT5 A;  4GVE A;  5M1F A;  5TKY A;  2ZJQ L;  3I0R A;  4JKA A;  3NH2 A;  1NK5 A;  5HRO A;  4LSN A;  3QEX A;  1KD1 O;  2IGI A;  4HUE A;  4CJ5 A;  3VOV A;  4JK8 A;  1E3M A;  5M1P A;  1T8E A;  1Y64 A;  4FJ9 A;  2JGU A;  3O3F A;  4Z0U A;  3WUH A;  3K5N A;  5KGW A;  4GY2 B;  2IIR A;  3JS6 A;  3EKU A;  3VTH A;  5C2D A;  1HYV A;  1JCF A;  2HF3 A;  4YFU A;  4JI5 K;  3AVN A;  2HNZ A;  3EE9 A;  5M1O A;  4DUZ K;  1Q9X A;  4DTS A;  4KHW A;  3G25 A;  5AQF A;  1YIT N;  1JCE A;  1ZXO A;  1V4T A;  2EX3 A;  3V9W A;  4H4O A;  1RBR A;  4DR6 K;  1ITG A;  4BR5 A;  4M3Z A;  3LL3 A;  1S1W A;  2CH5 A;  2KZZ A;  2Q0R A;  5BPL A;  3OVN A;  1BU6 O;  3DYA A;  1QHT A;  1TKZ A;  4KHN A;  1NKB A;  3RRH A;  4BC3 A;  1BI4 A;  2HBK A;  3KK1 A;  4YOT A;  1MWM A;  1UA1 A;  2BH1 A;  4I9L A;  4IFY A;  1SV5 A;  4DV7 K;  1BI4 B;  1HR0 K;  3EZ5 A;  3RR8 A;  2I7N A;  1RTI A;  3TTD A;  3VEY A;  1U45 A;  1VHX A;  3VPZ A;  1M1K O;  3MDQ A;  3SAF A;  4F8R A;  4O4G A;  3AVC A;  2O8E A;  1X9M A;  3SJH A;  3ENB A;  3T19 A;  3SV3 A;  3MCP A;  1SUQ A;  5M1N A;  3IS9 A;  4IDK A;  5ADX H;  5HRR A;  3O08 A;  4EZ9 A;  2O8E B;  1LWC A;  2Q36 A;  3BZK A;  2HVH A;  4E7K A;  3SNN A;  1FKO A;  3LAK A;  4H0V B;  3OBW A;  3CCV N;  2GTD A;  3VGL A;  1WBB A;  3VF2 A;  3SQ4 A;  4KPY A;  4DV0 K;  1TV6 A;  4RW9 A;  1T44 A;  4WFB L;  1JXB A;  2P9I A;  3LAN A;  2G8W A;  4LF6 K;  1SAZ A;  4GMJ B;  4JI6 K;  1E4F T;  3ZX2 A;  4LH4 A;  4Y0W A;  3HP6 A;  1RT6 A;  2PYJ A;  4DLG A;  2P9I B;  3MX2 A;  1QVF M;  4DSK A;  1OVY A;  4K8Z A;  4BVP A;  3VQ9 A;  2YHA A;  2IC3 A;  2QM1 A;  4OKK A;  4MQ3 A;  3RVC A;  1XC9 A;  3MWT A;  3V9U A;  4YDU A;  1HNX K;  2HHS A;  3O4Q A;  4DSF A;  3ENO A;  3CI5 A;  2GEL A;  1NGF A;  3M8R A;  3NMU A;  1DGK N;  3EN9 A;  1WBD A;  1YTA A;  5BRH A;  4BC4 A;  3KLH A;  5C24 A;  3LM2 A;  1QQC A;  1QZ5 A;  3IFR A;  4OPA A;  2KLA A;  3OS0 A;  4FJL A;  3MN6 A;  4KH4 A;  4DF8 A;  3VQ5 A;  1CZB A;  2VCP A;  4JEP A;  4H0O A;  4B1V A;  3W3D A;  3KTQ A;  1BQM A;  2HHH K;  1NU0 A;  2YHW A;  5GAG P;  1S22 A;  3QFP A;  2DPN A;  4DSE A;  4HWI A;  1OKJ A;  1RDD A;  2I5J A;  4O8K A;  3KD1 E;  4M3W A;  5ADX A;  3TAB A;  4FVM A;  1KFD A;  2NNW A;  1OVQ A;  2W6L A;  1KAY A;  2FBT A;  4FK4 A;  2YNH A;  1R59 O;  2G8I A;  4BWM A;  3A5N C;  4BRH A;  3QES A;  1KVB A;  1UAX A;  1VRT A;  4Z94 A;  1IBK K;  4QS8 A;  3S41 A;  4F9O A;  4CZM A;  4DQS A;  4E3S A;  1BO5 O;  4W5T A;  3BDP A;  1D9F A;  5AQQ A;  4BAC A;  3FZK A;  3ZEU A;  4H0X B;  2PYL A;  1SQK A;  3VQP A;  3OJS A;  3FFK B;  4DFP A;  4BRF A;  1TK8 A;  4GV3 A;  2RE2 A;  2Q1N A;  3NVM A;  3CFP A;  1NK0 A;  3SAG A;  4N56 A;  3ZEU B;  1NGI A;  2V51 B;  4EHT A;  4UQG A;  4OLB A;  1JL1 A;  3GOI A;  3K58 A;  2ZWH A;  1REV A;  1R0A A;  3I8B A;  4LF9 K;  2OTJ N;  4LF5 K;  1MU2 A;  5GIP A;  5FPM A;  1EP4 A;  1NKE A;  4JHD A;  4OKE A;  3CFR A;  4XEI A;  4KBO A;  2F8T A;  2NZT A;  3SMS A;  3T3F A;  3TU5 A;  3SUP A;  1H1V A;  4WQ5 C;  4JHD B;  2FSJ A;  3EZW A;  2QA4 N;  1JLB A;  5AQS A;  1BG3 A;  3V9X A;  5FRO A;  4GVM A;  2E20 A;  5DK5 A;  4DTJ A;  4IEE A;  1A5X A;  3KVG A;  3MN5 A;  3SI6 A;  4X65 K;  4M3R A;  4CD1 A;  4B08 A;  5BRD A;  1ZBF A;  3DLE A;  3ISN C;  3PSF A;  4DKW A;  2XY5 A;  3CQY A;  2JLE A;  2V7Y A;  4NXN K;  3QEW A;  1CZ9 A;  1NGA A;  4N76 A;  3D45 A;  3WNG A;  1J5E K;  3K59 A;  4M3T A;  1TK5 A;  4FJ7 A;  1HYZ A;  5C25 A;  3QEI A;  4H5T A;  2P5G A;  4FL9 A;  4L3Q A;  2E2P A;  3LPU A;  3CPE A;  4FPB A;  1L3V A;  3QML A;  4IOC L;  4B9M A;  1YVU A;  5AQK A;  3P4I A;  4JKF A;  4FO0 A;  5HRP A;  2O4G A;  3CG7 A;  4BRK A;  1JXE A;  4NYN A;  4CJS A;  4B8C A;  3BUZ B;  3CC4 N;  4DLE A;  2NLX A;  2YV0 X;  3WQT A;  3DMJ A;  3HPH A;  4DFM A;  1XI1 A;  2VG7 A;  4WFN L;  4HUF A;  4OGC A;  3I56 N;  3VF6 A;  4B9Q A;  4FM0 A;  2OTL N;  4MDB A;  3EEQ A;  1S5J A;  2NRX A;  3MMV A;  4NCA A;  5GAD P;  1RBV A;  3N4P A;  4DS4 A;  4QS9 A;  4MFB A;  1S9G A;  5K14 A;  2NRT A;  4CBW A;  5MLC Q;  4DCH A;  4DR2 K;  1LW2 A;  3WEE A;  3KKS A;  1GLE G;  4JN4 A;  4OX9 K;  4NO7 A;  4B3T K;  1VSK A;  2ZQB A;  1X3M A;  4C8M A;  3LWM A;  3U4L A;  1YUW A;  1VRU A;  4BRG A;  3O80 A;  3WEE B;  1NGJ A;  1Z05 A;  2BAN A;  2H3G X;  1K8K A;  3LP2 A;  4ISE A;  1J6Z A;  3JXU A;  4IBN A;  3A8Y A;  4ZTF A;  3G4S N;  3TAQ A;  3AVH A;  1K8K B;  1VSI A;  1JLA A;  1HNV A;  3AA3 A;  3HVT A;  3OYK A;  1T6D A;  4CEQ A;  3O6W A;  5AQR A;  4JKC A;  1HJO A;  3R6M A;  2VWK A;  1GLJ O;  5JMV A;  2D0B A;  3QER A;  3DLH A;  1W7A A;  4BR2 A;  3QIN A;  2A40 A;  4E19 A;  3AO3 A;  5AQO A;  3V81 A;  3DRR A;  4DR7 K;  2VYP A;  3OS2 A;  1QZ6 A;  3AO5 A;  3S3M A;  5AQJ A;  5F0X A;  1T6C A;  1GOB A;  3AVK A;  3OBY A;  3U6F A;  1FW6 A;  3MCA B;  3D0P A;  3C6A A;  4FJJ A;  4LC9 B;  2WUS A;  2DFF A;  4KH5 A;  1B9D A;  4EHU A;  2YCH A;  1RT1 A;  3DM2 A;  3OYJ A;  2FBY A;  3JAM O;  4EP5 A;  4B9S A;  1GLD G;  4H5V A;  2Z1I A;  2OAN A;  4BR7 A;  2ZJR L;  5J2Q A;  5HL7 L;  2O8D A;  3C6U A;  1X3N A;  2VWB A;  4B8A B;  4KAZ A;  4WE1 A;  3KWI A;  2WBN A;  4FW1 A;  4CEA A;  3AVF A;  5SZT A;  3PIP L;  2O8D B;  3VET A;  4FZY A;  2RF2 A;  2QWM A;  4OJR A;  4CBX A;  4CJU A;  1G15 A;  2O4I A;  4KHY A;  1EWR A;  4NB4 A;  2P9S B;  3ZSW A;  4DR4 K;  4PL8 A;  3CCJ N;  4CJT A;  4IOX A;  3H6E A;  1YIJ N;  4JLH A;  1X9S A;  4B3O A;  1TL3 A;  3BF1 A;  4C8K A;  3OYB A;  5AQU A;  4M7Y A;  2HHU A;  4RG8 A;  3T7Z A;  3DLK A;  2HHW A;  1KC8 O;  2JWK A;  2YKM A;  4BRC A;  4PQU A;  3VQ7 A;  3WNH A;  4CD3 A;  4K8X A;  1F21 A;  2HMP A;  3RMC A;  4F2S A;  4Z4F A;  1EXQ A;  4MDA A;  4KI4 A;  5H1S Q;  1BA0 A;  4IZ9 A;  3LDP A;  3SUN A;  3M8Q A;  4BRQ A;  2F96 A;  3VGK A;  4CEB A;  2PBD A;  4JKB A;  4H8K A;  1QS4 A;  1RT7 A;  2FF6 A;  4CZG A;  3KJV A;  3WNE A;  3ZX3 A;  1GLB G;  3ID8 A;  1A5W A;  3QEV A;  4BC2 A;  3L3U A;  2Y1I A;  1J9A A;  4IJN A;  3TAE A;  1KXP A;  4CZE A;  4FK0 A;  3Q7B A;  5AR0 A;  1QSY A;  4NXM K;  3M6G A;  4AM6 A;  1C0G A;  4KKO A;  5KPR A;  3VF4 A;  4CHO A;  3RWU A;  1TAU A;  5I3U A;  2P9U A;  2BE2 A;  3ULE A;  3ZT1 A;  4A5B A;  3VEO A;  1ZBS A;  5I9E B;  5J2M A;  3TAF A;  4FLT A;  1BOT O;  1SL2 A;  3SK3 A;  5E41 A;  1RT3 A;  4KB1 A;  2IVO A;  3O9R A;  3L8B A;  2P9U B;  4NLB A;  3O9U A;  3WXM B;  4DR1 K;  4RCH A;  3G71 N;  1I3A A;  3FLC O;  1XHX A;  1RDA A;  4GW6 A;  4W5R A;  4KH6 A;  1G99 A;  5C2F A;  2DTU A;  1Q81 O;  4ISG A;  1SL1 A;  5AFU A;  1GLC G;  3THY A;  2KQ2 A;  5CHI A;  3CCR N;  2HHT A;  2ZGZ A;  1JLE A;  4B9U A;  3VQ8 A;  5J2P A;  3NGI A;  3LAM A;  3THY B;  4AH9 A;  4B3R K;  2GUI A;  2JWL A;  2ZGY A;  3OHR A;  4BRM A;  3CCL N;  3PO4 A;  4U67 L;  5AZJ A;  4FM1 A;  4CJW A;  3SUQ A;  4DV3 K;  4CBU A;  1J5O A;  4PKG A;  2E2Q A;  3P31 A;  4FOE A;  4LF4 K;  5AZJ B;  2E8A A;  3AAR A;  4ZHR A;  3TAN A;  3BF3 A;  3CM6 A;  2PAV A;  1KAX A;  1BCO A;  1WNS A;  1TKX A;  3CHW A;  4Q5V A;  4MLE A;  5F2R A;  2P1J A;  2F4V K;  2D5R A;  2X6S A;  1C6V A;  4OPK A;  1U4B A;  4ID1 A;  3O3G A;  3SLC A;  4PY5 A;  3VQA A;  1NKC A;  3NH0 A;  2WFB A;  3NGZ A;  4CHY A;  2GBZ A;  3ATU A;  1HKB A;  4DU1 A;  1NJY A;  3K5O A;  4BRD A;  2UXD K;  3U9D A;  4FZZ A;  5AZI A;  1ZYQ A;  2F9T A;  4B1U B;  3L2Q A;  4DTP A;  3AO4 A;  5AQG A;  5AJ3 K;  2ZJP L;  5AQL A;  4CEO A;  1VQL N;  3K9J A;  4LFC K;  1J53 A;  5AZI B;  3QBX A;  4HHT A;  4KHP K;  2P5O A;  3U8X A;  2XRI A;  3BGR A;  3DJC A;  3HBT A;  2OZM A;  1A5V A;  2HHQ A;  5JVG L;  1MWK A;  5HP1 A;  1L3S A;  3HPO A;  1CXU A;  1OH5 A;  3ASM A;  4IFV A;  4W5O A;  2WC9 A;  3AV9 A;  4BG8 A;  1YTU A;  2YHX A;  3LWL A;  2P9K A;  3W0L A;  4FLW A;  1ZBL A;  1BIU A;  4OPH A;  1VQO N;  1MDU B;  3LP1 A;  3CCM N;  1I94 K;  4B1X B;  3CCU N;  4FCY A;  3A5O C;  2OPS A;  1U6Z A;  2P9K B;  2HBJ A;  2QTD A;  1NNE A;  1P90 A;  2ITM A;  4FJX A;  1KCF A;  3ZSX A;  4DQI A;  1ATR A;  4F2R A;  1XMQ K;  4X62 K;  4BE1 A;  3KLG A;  2HVI A;  1HKC A;  3KLF A;  4JI8 K;  2E1Z A;  1NM1 A;  3V9S A;  1QQO A;  4K42 A;  4E0D A;  3V1Q A;  3THV A;  1VQ6 N;  2FBV A;  4LFA K;  4WCE L;  2NUB A;  2PZS A;  4MO4 A;  1I39 A;  5GAH P;  3H1V X;  3VGM A;  3IMX A;  2KHO A;  3OYM A;  3CME N;  3OYF A;  4FJI A;  3IUC A;  4BRN A;  5KQ8 A;  3V6D A;  1RTJ A;  2ASO A;  4BDZ A;  4C8N A;  4B1W B;  1VSJ A;  3TAR A;  3H3O B;  5C10 A;  3AVL A;  4O5F A;  3VMF B;  3ZT4 A;  3J81 O;  5BRF A;  5C42 A;  4AQY K;  3DWL A;  1VSD A;  1IKV A;  4LD0 A;  4BRO A;  1NK4 A;  1BCM A;  4UY8 O;  4FWS A;  4KB0 A;  3HJF A;  3NFA A;  4OO1 J;  4M3U A;  2HST A;  3UKU A;  5GAE P;  1Q82 O;  2E6M A;  4HTU A;  4M3Y A;  3VEX A;  4GV6 A;  3AY9 A;  4RW8 A;  4DSL A;  3UKU B;  4AHU A;  3TI0 A;  3D7E O;  1NGG A;  4FWP A;  2O8F A;  2B5J A;  4JI0 K;  4J2A A;  4WQ5 A;  3MX5 A;  3HK2 A;  4BRA A;  4QCL A;  2BTF A;  3I0S A;  1RBT A;  1TAQ A;  3IDH A;  3NE6 A;  2YJF A;  4DG1 A;  3MWP A;  2O8F B;  3NHG A;  4FJN A;  1LV5 A;  3KKR A;  3UE5 A;  1C1B A;  3O1B A;  3WXK A;  3ZLJ A;  3H1Q A;  1ASV A;  1E4G T;  2OPQ A;  4QAG A;  4PUO A;  3VEN A;  1TK0 A;  3SQ2 A;  3VQ6 A;  1D9D A;  1HX1 A;  4V19 S;  1NJI O;  4KFB A;  3OYE A;  2F9W A;  4LY7 A;  2FLO A;  5KGX A;  3SQ0 A;  4CHQ A;  4CHP A;  1N8R O;  3HTV A;  3O9T A;  1S1U A;  4BG9 A;  3V9Z A;  3CJ9 A;  4C8L A;  3CC2 N;  3HL8 A;  3U3G A;  1LWF A;  3TAP A;  4BR9 A;  5KPZ A;  3KWG A;  2Z1G A;  4I6M A;  2G8H A;  3ZT2 A;  3KHY A;  4BE2 A;  4CGF A;  2KFN A;  1UA0 A;  4CJQ A;  3E9O A;  5CY4 A;  4IO9 L;  1DKG D;  4GKK K;  4I6M B;  4KTW A;  2RHK A;  3T69 A;  3OYA A;  1EO1 A;  2EHG A;  1Q8I A;  3K57 A;  1TKD A;  1L3U A;  4AHT A;  5KTQ A;  2B6A A;  1OH7 A;  4PA1 A;  4JRP A;  4FM2 A;  2ATQ A;  5AQI A;  1BA1 A;  3PX6 A;  3VQD A;  4ILG B;  5IWA K;  1C0T A;  3F2K A;  1YAG A;  1M90 O;  3S9H A;  3TAM A;  4JYA K;  4CGD A;  2NRR A;  5CE3 A;  2CH6 A;  5CYM A;  3TTC A;  3J80 O;  1NWK A;  3EO3 A;  1YI2 N;  1XC3 A;  5JLH A;  4CF0 A;  4BRL A;  4FWN A;  3JSM A;  2HBL A;  3P1G A;  3UIQ A;  4H0P A;  3SYZ A;  2YHY A;  1NGC A;  4N5S A;  1QQM A;  1N36 K;  1N34 K;  2FBX A;  5LMU K;  3MK6 A;  1KQS M;  1XNR K;  1KVA A;  4B9L A;  4IWV A;  1YF5 L;  4RW4 A;  3K2P A;  3J7Z O;  1YT3 A;  2D0O A;  4AIL C;  4DU3 A;  1K8A O;  2ZE2 A;  3EKS A;  2P9N A;  4Q0B A;  2YX6 A;  2UXB K;  1X1P A;  4X64 K;  1D4X A;  3OTO K;  3S3N A;  2P9N B;  4DU4 A;  4CJF A;  4CJV A;  2HHV A;  1WN7 A;  3AGR A;  4DR5 K;  3LM9 A;  4M7X A;  1WSG A;  4K41 A;  2KTQ A;  2F7T A;  4O55 A;  4C8O A;  3SMP A;  4FVU A;  3D2E A;  2BDP A;  1IBL K;  1HYS A;  2GX9 A;  1WSF A;  4H5R A;  3BZC A;  3LZJ A;  2E88 A;  2A1R A;  4JI7 K;  3D2E B;  1QHA A;  1S72 N;  2A3Z A;  4KHS A;  1Z26 A;  4DTU A;  1U2V A;  2A6A A;  3CPW M;  3DXM A;  1QSL A;  3PLA A;  1FK9 A;  2Y1J A;  3AVB A;  5AQM A;  4CGJ A;  5HOO A;  4FWQ A;  3NF8 A;  1U2V B;  4BRP A;  2OA8 A;  3DXM B;  2ZM6 K;  5AQV A;  1IV0 A;  2VQE K;  2UUC K;  1WSH A;  4ID5 A;  4Y1D A;  2HW3 A;  2Q2R A;  1NBW A;  4JD2 A;  3SV4 A;  4DQ8 A;  2VGM A;  4DS5 A;  4XH4 A;  3VQE A;  4YOR A;  1T03 A;  4KRE A;  1OH8 A;  2GV9 A;  1CLQ A;  1RBU A;  2W41 A;  4I7F A;  4JD2 B;  5C12 A;  4CEE A;  1HUX A;  1LW0 A;  1DT9 A;  2RKI A;  5KQD A;  3HOS A;  4FJ8 A;  3O8M A;  3VQQ A;  2UUB K;  2Q31 A;  3H46 O;  4CF9 A;  3CM5 A;  1O1W A;  3VQ4 A;  3KK2 A;  4LH5 A;  1RT4 A;  1MA9 B;  1HJR A;  4DB3 A;  1TYQ A;  3I33 A;  2D0C A;  3C6T A;  3ID6 A;  3SQ1 A;  5LL6 Z;  3GE1 A;  5EVZ A;  2A1S A;  3N4Q A;  3UKR A;  1NK8 A;  3KK7 A;  3CIP A;  4EFH A;  1TYQ B;  4RWT A;  1BIS A;  2FSK A;  1JLF A;  3VA3 A;  2P9L B;  4H0Y B;  4E1M A;  3UKR B;  5HBM A;  4F3T A;  2EWS A;  4DQR A;  3ZET A;  4ELV A;  3CFO A;  3RMD A;  3PV8 A;  1YJ9 N;  1HLU A;  4A2A A;  3QNN A;  3MXM A;  2OPP A;  2CGL A;  2P9P A;  2RPI A;  1BQN A;  5HRS A;  1Z6R A;  3ZET B;  4A2B A;  1TGO A;  3CD6 N;  3KLI A;  4JKD A;  2ASP A;  4H5W A;  4FLV A;  3EYZ A;  4MLH A;  3VEW A;  4CZI A;  4DQP A;  4AHC A;  3FZH A;  1HKG A;  1ASW A;  2P9P B;  4CJ4 A;  5SWM A;  3CYM A;  1VSH A;  4H03 B;  3VES A;  1WOQ A;  2DFE A;  5J1E A;  3FE1 A;  4CK3 A;  5F1X A;  3QO9 A;  4CK1 A;  4PL7 A;  3U9Z A;  3L6Q A;  4FZX C;  1KLN A;  4F4K A;  5EXW A;  3O4W A;  3SPY A;  5D3G A;  2VG6 A;  1KLM A;  1LOT B;  1VAZ A;  4YNQ A;  2OYQ A;  1OH6 A;  4DTN A;  4CGI A;  3LDQ A;  4CGH A;  3NGY A;  2P9S A;  4WQ4 A;  3CJC A;  2QKK A;  3ZT3 A;  3RTV A;  4E7H A;  4OKJ A;  4J8F A;  3AVM A;  4IO8 A;  3RSE A;  3MAQ A;  2RN2 A;  4I2Q A;  4BR4 A;  2UU9 K;  1Q9Y A;  2YJE A;  1K6Y A;  1Q18 A;  4K25 A;  2G8F A;  1HNW K;  2QWN A;  3WXI A;  3RSE B;  2AA4 A;  2OZS A;  4O0I A;  4AF1 A;  4B9T A;  1N32 K;  1WSE A;  2OPR A;  1NK9 A;  5AQT A;  1P8Z A;  3L2U A;  4K0K K;  2W40 A;  4CJ3 A;  3WNF A;  4FJM A;  3QB0 A;  2IAJ A;  3ZSZ A;  1KVC A;  2J4R A;  1NK7 A;  4FLX A;  1EWQ A;  3ZCM A;  2WON A;  3HM8 A;  2Q0U A;  2ASM A;  4IJA A;  4JS4 A;  4JI1 K;  1U48 A;  1XWL A;  1JCG A;  3E66 A;  2QWO A;  4CJR A;  3AA2 A;  2G8V A;  3R1X A;  3SJJ A;  2OCE A;  5KPT A;  2XO7 A;  2KW4 A;  1C0U A;  4EIA A;  3DXK A;  1JLQ A;  4CI6 A;  3THX A;  2QKB A;  1WAF A;  3L3V A;  3QFU A;  1Y97 A;  4JI2 K;  3Q7C A;  3T1H K;  2Q3S A;  1BL3 A;  2ETJ A;  4H0T B;  5BN9 A;  4CZK A;  3DXK B;  1VQ4 N;  3THX B;  2KZM A;  3U3Y A;  3A5L C;  4ICL A;  1KRP A;  1TUU A;  3HYF A;  5B8H A;  3VA0 A;  4CER A;  2A41 A;  4JKE A;  2IVP A;  1N5Y A;  1HPZ A;  3OYI A;  4DSI A;  5IT9 O;  3MN7 A;  2QWP A;  4JNE A;  4L8R B;  2X74 A;  2E5L K;  2I7P A;  3E1Y A;  1VQK N;  4B9V A;  3M3Z A;  2BUP A;  4BDY A;  2E2N A;  5FRN A;  4I9Q A;  1S1X A;  3O3H A;  3I8D A;  3HP9 A;  2XHB A;  4O5B A;  4DTX A;  4Z4H A;  2ZF5 O;  1O13 A;  2CGJ A;  3A0I X;  3C7N A;  1U49 A;  2V52 B;  4CHZ A;  1NOY A;  1HRH A;  2DFH A;  1JKH A;  1SKW A;  4JK9 A;  4FLZ A;  3LDS A;  3C7N B;  4M63 C;  1WAJ A;  2XY6 A;  3L4I A;  1BIZ A;  3T1A A;  4J2E A;  2BGG A;  4BR0 A;  3BEX A;  4HVJ A;  5C15 A;  3DLR A;  2GWJ A;  5C0Y A;  5EY4 A;  1NMD A;  1Q7Y O;  4LFB K;  1RDC A;  4WF9 L;  3P38 A;  4E1N A;  5E84 A;  3RMB A;  2W6K A;  5LJV A;  4CE9 A;  1T3V A;  1N6Q A;  1K73 O;  5LY3 A;  3NF7 A;  4JAX A;  1LWE A;  1JLC A;  4RW7 A;  4HTL A;  5BPN A;  1CXQ A;  1GLL O;  1TUY A;  4DV4 K;  1Z25 A;  5FLX O;  1FJG K;  1RIL A;  1VSM A;  3QLH A;  5BR8 K;  3QET A;  3A5M C;  1SKS A;  3GDQ A;  3C6H A;  4FOI A;  1CZA N;  2DY4 A;  4BQL A;  3DLG A;  3JYT A;  3SBT A;  4N41 A;  3SAH A;  2HF4 A;  3LP3 A;  4O8U A;  3F73 A;  4Z4G A;  3CJ1 A;  5ELZ A;  3ZSR A;  4FW2 A;  4YOW A;  1L3T A;  1IG8 A;  1XUP O;  4KTQ A;  3MXI A;  4M41 A;  3LAL A;  1WLJ A;  4KO0 A;  3AAQ A;  1W2B M;  5KI6 A;  1QE1 A;  3SZ2 A;  2FC0 A;  2A42 A;  2D0A A;  5JS1 A;  3K9K A;  4OVL A;  4G9Z A;  3CQ8 A;  3DOL A;  3L0Q A;  2XY8 A;  4FJG A;  4A61 A;  1LCU A;  1S6P A;  1J54 A;  3GBT A;  4OGE A;  4CZL A;  1RFQ A;  3M1F A;  2NRV A;  5I42 A;  5AQP A;  1HPM A;  4CFA A;  3NAE A;  5AQH A;  4Z4E A;  3AVG A;  1NGE A;  2A5X A;  3CCQ N;  3G0Z A;  1NJZ A;  3BP8 A;  3VN5 A;  4BRE A;  3ULD A;  3PX0 A;  3HPG A;  2E6L A;  1KSP A;  3EL2 A;  3KLE A;  2QXL A;  3WXJ A;  1HQE A;  5FRM A;  1U04 A;  2X78 A;  2D0P A;  5BRE A;  5DM6 L;  4FWO A;  1DTT A;  1SZ2 A;  4CFB A;  3D6R A;  3TWH A;  1NJW A;  4CZF A;  1FXX A;  1NGH A;  4RTF D;  2B4J A;  5AQX A;  3H45 C;  4XIU A;  3SPZ A;  5BN8 A;  1W97 L;  4DTO A;  3TSQ A;  4YOX A;  3HST B;  3VQC A;  4JI3 K;  4N47 A;  2QI2 A;  1HMV A;  2QWR A;  4E89 A;  5JLF A;  1SL0 A;  3L4Q A;  1VQ5 N;  4CED A;  4CJK A;  1NGD A;  2D4W A;  4CFD A;  3NF9 A;  4OLA A;  3F5T A;  3DRP A;  3QDK A;  4FJH A;  4CJE A;  4DHY A;  1YXQ A;  4CGG A;  3I55 N;  4CK2 A;  3HM9 A;  3PX4 A;  1RCH A;  2E4L A;  3DLB A;  2YI1 A;  4AHR A;  1VQN N;  4A62 A;  3MED A;  3AGK A;  4WYB A;  2YKN A;  4FJK A;  4E7L A;  1LAV A;  2VQF K;  4JS5 A;  2W42 A;  1QQN A;  5T7B A;  4LF7 K;  2Z1J A;  3DAW A;  3B8A X;  3QBW A;  4ZTJ A;  3FR0 A;  3SBG A;  5LJW A;  3CMA N;  1ATS A;  2NRZ A;  4DTR A;  3OW2 M;  2CGK A;  4QOZ B;  2HOE A;  3P39 A;  4C1N K;  4AHS A;  5AQN A;  4H5N A;  3K0S A;  1BWF O;  4IG3 A;  3THW A;  3AO2 A;  3K5M A;  3C94 A;  5J2N A;  3OYH A;  1B92 A;  4NCG A;  1RT2 A;  2G8K A;  4CIF A;  4FWK A;  3EE8 A;  4R5P A;  3THW B;  2Q97 A;  3J7Y P;  5GIN A;  4TSX A;  1VSE A;  1C1A A;  4ELT A;  3CJ7 A;  3QIP A;  2WTU A;  1IKX A;  2UUA K;  3AVJ A;  3S3O A;  3GL1 A;  4YOU A;  3O1W A;  5GIO A;  3PY8 A;  1UOC A;  1ZC6 A;  2YHB A;  3KD5 E;  2O8B A;  4PWD A;  3F9K A;  2UYT A;  1LAW A;  1XMO K;  4M45 A;  4ILH A;  4DWI A;  5EU7 A;  1YJW N;  2O8B B;  3M8P A;  1IO2 A;  2QK9 A;  4FXD A;  3LP0 A;  4NCB A;  5HLF A;  4GNI A;  2VG5 A;  1N33 K;  3NVK A;  1SS6 A;  4NLC A;  1GOA A;  2HBM A;  3O9S A;  4KHQ A;  1BDG A;  4BRI A;  1HNZ K;  4ILJ A;  4O0J A;  1TVR A;  5CR4 A;  4KHU A;  3CJA A;  4CVN E;  4DFK A;  5CZ1 A;  2IS3 A;  2HNY A;  1RTH A;  4I2P A;  2UXC K;  4GV9 A;  1X9W A;  4H4M A;  5EOY A;  5CYQ A;  5FPN A;  4LF8 K;  3T1Y K;  3OY9 A;  3ZSY A;  2GWK A;  4KRF A;  3SCX A;  3TPQ A;  2AJQ A;  1JL2 A;  4JK7 A;  2QXF A;  3MEE A;  1TKT A;  4YOY A;  4DV2 K;  4IDH A;  1XNQ K;  4BC5 A;  3A2F A;  2ITG A;  3O5B A;  5KRT A;  4EZ6 A;  4B3M K;  3QIO A;  3O9Q A;  1NLV A;  1D8Y A;  4XH5 A;  3RRG A;  4X66 K;  1IJJ A;  3OA9 A;  4YDU C;  1TL1 A;  1NGB A;  4M42 A;  5CZ2 A;  3G10 A;  2XY7 A;  4HCB A;  3VTI A;  1JJ2 M;  4B9N A;  2D1K A;  1NMN A;  4CJL A;  1IBM K;  4CZH A;  4GKJ K;  1NG9 A;  3TR8 A;  4B1Z A;  3CET A;  1NK6 A;  1RNH A;  3ZSQ A;  3RR7 A;  1RDB A;  3OS1 A;  3V1R A;  2QWQ A;  5FPE A;  5DMR A;  3SUO A;  4HUG A;  1BUP A;  3E9P A;  2HB5 A;  3GG4 A;  1V4S A;  3DOK A;  3CQX A;  4BQZ A;  4IKF A;  5BR9 A;  2IVN A;  3PSI A;  1ZBI A;  1YHQ N;  4EP4 A;  4CES A;  3IKM A;  4E1J A;  4JV5 K;  3CXC M;  3CCE N;  2GUP A;  5FDL A;  3ZSV A;  4FLY A;  4Z4I A;  3HT3 A;  3J8A A;  2NRH A;  1QSS A;  4K43 A;  4DV6 K;  3B6O A;  3C65 A;  2HHX A;  1ILY A;  3CC7 N;  3CCS N;  1VQP N;  4DR3 K;  3HRG A;  3E9L A;  3LDL A;  4CEZ A;  1UWB A;  3G6E N;  3TTF A;  2FXU A;  4A5A A;  4CFC A;  4O44 A;  2VGN A;  4RW6 A;  2R7Y A;  1ESV A;  4ELU A;  3AAP A;  3M5R A;  4CIE A;  4YOV A;  3LZI A;  3NDK A;  4LSL A;  5BPM A;  4CJ7 A;  3KK3 A;  3V4I A;  3LPT A;  4QS7 A;  4HCC A;  1W9H A;  4CEC A;  4MO5 A;  2NRW A;  3CJB A;  1FKP A;  3AA5 X;  5JVH L;  2P9L A;  3AO1 A;  3L2V A;  1WSI A;  4W5N A;  1GOC A;  3FGU A;  2PY5 A;  2WOM A;  1RGI A;  3WQU A;  2YNG A;  3VEV A;  4PKH A;  3KZB A;  3OYN A;  4AHV A;  1EQY A;  3NF6 A;  4OPJ A;  2VWJ A;  3D2F A;  4B3S K;  1EX4 A;  4JKH A;  3PO5 A;  2KFZ A;  1EET A;  4B1Y B;  1L5U A;  4JKG A;  2X6N A;  4G1Q A;  3MEC A;  3D2F B;  4Z4C A;  4CIG A;  3TAG A;  2KKZ A;  1EKE A;  5FPD A;  1YJN N;  1T7P A;  4CHN A;  4JKG B;  3HSC A;  3R8E A;  1KTQ A;  5A2Q O;  3DLL L;  4BDP A;  1C0F A;  3FZM A;  4CW7 B;  4FWM A;  4IXC A;  1T05 A;  5DM7 L;  3FZF A;  4FJ5 A;  3LDN A;  2YNF A;  3ITH A;  3L2R A;  4U7B A;  5M1Q A;  2ZD1 A;  4IEI A;  4AM7 A;  3FZL A;  1Q86 O;  4IFE A;  3HZ6 A;  2P51 A;  3L2W A;  2V7Z A;  3R3L A;  4DF4 A;  4C1N I;  1RTD A;  3J7A P;  4BE0 A;  1C1C A;  1VQ8 N;  4CZJ A;  3HO1 A;  1DEJ A;  3VQB A;  3OYG A;  3ZYY X;  4PKI A;  1D5A A;  1IG9 A;  1S9E A;  1U47 A;  3NH1 A;  4NYF A;  3NCI A;  4JRQ A;  4YY3 K;  4CJP A;  4KV8 A;  1VQ7 N;  3E01 A;  1NOZ A;  4Y1C A;  4CEF A;  3VER A;  4FSV A;  5AFU H;  3ENH A;  4FYD A;  2AP1 A;  3EY1 A;  3P83 D;  2O8C A; 
#chains in the Genus database with same CATH homology
 3IRX A;  1RIL A;  1VSM A;  3QLH A;  4J2B A;  4KFB A;  3DMJ A;  3QET A;  3OYE A;  3HPH A;  4E7I A;  4LY7 A;  4DFM A;  3OYC A;  2VG7 A;  1XI1 A;  5KGX A;  1SKS A;  3SQ0 A;  1S6Q A;  4CHQ A;  3M8S A;  4HUF A;  4OGC A;  4CHP A;  2DY4 A;  3NBP A;  3P5J A;  1NK6 A;  1S1U A;  4FM0 A;  3HXM A;  3DLG A;  3JYT A;  3V9Z A;  4DQQ A;  4C8L A;  3HL8 A;  2IOC A;  4N41 A;  1ASU A;  3U3G A;  3LP3 A;  2YNI A;  1VK0 A;  1LWF A;  1S5J A;  4DTM A;  3F73 A;  3TAP A;  4NCA A;  4Z4G A;  3ZSR A;  1RBV A;  4FW2 A;  1L3T A;  4DS4 A;  4KTQ A;  3PUF A;  3ZT0 A;  2Z1G A;  2G8H A;  3ZT2 A;  3KIO A;  4BE2 A;  4CGF A;  4CF1 A;  4MFB A;  1JLG A;  3MXJ A;  3MXI A;  4M41 A;  1S9G A;  1W0H A;  3LAL A;  5K14 A;  4CJQ A;  3OJU A;  1UA0 A;  1WLJ A;  4KO0 A;  5CY4 A;  1HNI A;  1LW2 A;  4W5Q A;  3KKS A;  4CF8 A;  3O4N A;  3HVR A;  1VSF A;  5KI6 A;  4KTW A;  3OYA A;  1VSK A;  2ZQB A;  4C8M A;  1QE1 A;  3LWM A;  3SZ2 A;  2FC0 A;  2D0A A;  2EHG A;  3ALY A;  1Q8I A;  1VRU A;  3K57 A;  1TKD A;  1L3U A;  4AHT A;  4OVL A;  5KTQ A;  2B6A A;  2BAN A;  3CQ8 A;  3DOL A;  2XY8 A;  4FJG A;  3AVA A;  3LP2 A;  4PA1 A;  4JRP A;  4FM2 A;  3V1O A;  2ATQ A;  1WSJ A;  1S6P A;  4IBN A;  3PX6 A;  1J54 A;  3VQD A;  2LSN A;  4OGE A;  4ZTF A;  1C0T A;  5I42 A;  3AVI A;  3TAQ A;  1VSL A;  3H08 A;  3AVH A;  4CFA A;  3QEP A;  1S1T A;  3S9H A;  1VSI A;  3TAM A;  1JLA A;  1HNV A;  3NAE A;  4CGD A;  3AA3 A;  2KFN A;  4FLU A;  3HVT A;  5CYM A;  4DMN A;  3IG1 A;  4Z4E A;  1BHL A;  2F8S A;  3AVG A;  3OYK A;  1XHZ A;  1SKR A;  4CEQ A;  4DSJ A;  2Z1H A;  4F3O A;  4CF0 A;  3G0Z A;  1NJZ A;  3JSM A;  3P1G A;  4BWJ A;  2VWK A;  3VN5 A;  4KTZ A;  3UIQ A;  3ULD A;  3SYZ A;  3PX0 A;  3IAY A;  4CCH A;  1KFS A;  3HPG A;  2E6L A;  1KSP A;  3KLE A;  4N5S A;  2D0B A;  3QER A;  3DLH A;  4M3X A;  1HQE A;  5FRM A;  5KRS A;  3QIN A;  4E19 A;  1U04 A;  2X78 A;  3AO3 A;  3V81 A;  3DRR A;  3OS2 A;  3S3M A;  1DTT A;  3AO5 A;  2FBX A;  3DRS A;  4CFB A;  1GOB A;  3AVK A;  1HQU A;  1S1V A;  3TWH A;  3U6F A;  1NJW A;  1B9F A;  1KVA A;  3QNO A;  1FXX A;  4FK2 A;  1IKY A;  2B4J A;  3D0P A;  4E7J A;  4B9L A;  4Z4F A;  4RW4 A;  4XIU A;  3K2P A;  3SPZ A;  4FJJ A;  1YT3 A;  4DTO A;  4AIL C;  4DU3 A;  2DFF A;  2ZE2 A;  3AA4 A;  1B9D A;  4DFJ A;  3HST B;  3VQC A;  1RT1 A;  3DM2 A;  1IKW A;  1ZBU A;  1IH7 A;  3OYJ A;  4N47 A;  4Q0B A;  1HMV A;  2FBY A;  1X1P A;  3C95 A;  4E89 A;  4EP5 A;  4B9S A;  4J2D A;  1DLO A;  3S3N A;  3B6P A;  2IDO A;  1SL0 A;  4IG0 A;  2Z1I A;  4DU4 A;  4CJF A;  2HND A;  4CJV A;  5HRN A;  4KI6 A;  1WN7 A;  5J2Q A;  4CED A;  2HHV A;  1RBS A;  1NJX A;  4CJK A;  3OYL A;  3C6U A;  3K5L A;  4CFD A;  4B8A B;  3NF9 A;  4OLA A;  1WSG A;  3DRP A;  2KTQ A;  4FJH A;  4O55 A;  4KAZ A;  4CJE A;  3FFI A;  4WE1 A;  4DLE A;  4C8O A;  1QTM A;  4FW1 A;  4CEA A;  4CGG A;  3AVF A;  5SZT A;  4CK2 A;  5JS2 A;  2BDP A;  3HM9 A;  3PX4 A;  1RCH A;  1HYS A;  1WSF A;  4FZY A;  2RF2 A;  2E4L A;  3OYD A;  3DLB A;  4FXD A;  4OJR A;  4CJU A;  4AHR A;  3RMA A;  1G15 A;  2HMI A;  2O4I A;  3LZJ A;  4KHY A;  1BGX T;  2A1R A;  3MED A;  1C0M A;  3DI6 A;  3ZSW A;  3MEG A;  4CF2 A;  4KHS A;  1D9D A;  2G8U A;  1Z26 A;  4CJT A;  3ZSO A;  4DTU A;  2YKN A;  4JLH A;  4FJK A;  1X9S A;  4E7L A;  1LAV A;  1TL3 A;  1QSL A;  1DTQ A;  2W42 A;  4JS5 A;  4B3O A;  5JS1 A;  1FK9 A;  1RT5 A;  5T7B A;  2Y1J A;  2Z1J A;  3OYB A;  4C8K A;  3AVB A;  4CGJ A;  2HHU A;  4RG8 A;  3I0R A;  4ZTJ A;  3NH2 A;  1NK5 A;  3DLK A;  3NF8 A;  5HRO A;  2HHW A;  4LSN A;  3QEX A;  2OA8 A;  2YKM A;  4PQU A;  4DTR A;  2IGI A;  3VQ7 A;  3WNH A;  4CJ5 A;  4HUE A;  4QOZ B;  4K8X A;  1WSH A;  4ID5 A;  4AHS A;  1T8E A;  1F21 A;  4Y1D A;  2HW3 A;  4F2S A;  3RMC A;  3SV4 A;  4FJ9 A;  1EXQ A;  2JGU A;  3O3F A;  4Z0U A;  3VQE A;  4DS5 A;  4KI4 A;  3K5N A;  4IG3 A;  5KGW A;  1T03 A;  3AO2 A;  3K5M A;  3SUN A;  2GV9 A;  4KRE A;  3M8Q A;  1CLQ A;  3C94 A;  5J2N A;  1HYV A;  1B92 A;  1RBU A;  3OYH A;  4NCG A;  4YFU A;  2F96 A;  4I7F A;  4CEB A;  3AVN A;  2HNZ A;  4H8K A;  1QS4 A;  1RT2 A;  4CEE A;  4CIF A;  2G8K A;  1RT7 A;  3KJV A;  1LW0 A;  4R5P A;  1Q9X A;  3WNE A;  4DTS A;  4KHW A;  4TSX A;  2EX3 A;  2RKI A;  1A5W A;  3QEV A;  1VSE A;  4F8R A;  4FJ8 A;  1C1A A;  3V9W A;  3VQQ A;  4ELT A;  4H4O A;  3L3U A;  2Y1I A;  1RBR A;  1ITG A;  3QIP A;  1IKX A;  1J9A A;  4M3Z A;  3TAE A;  3AVJ A;  3S3O A;  4CF9 A;  4FK0 A;  1S1W A;  3CM5 A;  1O1W A;  1QSY A;  3VQ4 A;  2KZZ A;  3PY8 A;  3KK2 A;  4LH5 A;  1UOC A;  2YHB A;  1RT4 A;  3OVN A;  3DYA A;  4KKO A;  3KD5 E;  1HJR A;  1QHT A;  4CHO A;  1TKZ A;  3RWU A;  4PWD A;  3F9K A;  1TAU A;  2D0C A;  3C6T A;  4KHN A;  3SQ1 A;  1NKB A;  5I3U A;  2BE2 A;  3RRH A;  1LAW A;  3ZT1 A;  1BI4 A;  2A1S A;  4M45 A;  2PYJ A;  4DWI A;  5EU7 A;  3KK1 A;  1NK8 A;  5J2M A;  3TAF A;  4I9L A;  4FLT A;  4IFY A;  1UA1 A;  3M8P A;  1BIS A;  1SL2 A;  1IO2 A;  5E41 A;  1RT3 A;  1JLF A;  4KB1 A;  2QK9 A;  1SV5 A;  3LP0 A;  3L8B A;  3VA3 A;  4NCB A;  5HLF A;  1BI4 B;  2VG5 A;  4E1M A;  3EZ5 A;  5HBM A;  3RR8 A;  1GOA A;  4F3T A;  4DQR A;  4KHQ A;  4ELV A;  1RTI A;  3CFO A;  1I3A A;  1XHX A;  3RMD A;  1RDA A;  4GW6 A;  4W5R A;  3PV8 A;  1U45 A;  4O0J A;  3QNN A;  3MXM A;  2OPP A;  1TVR A;  2RPI A;  1BQN A;  2DTU A;  5HRS A;  4DFK A;  4KHU A;  5CZ1 A;  2IS3 A;  1TGO A;  2HNY A;  3KLI A;  1RTH A;  4O4G A;  1SL1 A;  3AVC A;  4I2P A;  4FLV A;  2KQ2 A;  3EYZ A;  1X9W A;  4H4M A;  1X9M A;  4DQP A;  4AHC A;  5CYQ A;  2HHT A;  1ASW A;  3T19 A;  4CJ4 A;  5SWM A;  3SV3 A;  3CYM A;  1JLE A;  1VSH A;  1SUQ A;  3ZSY A;  3OY9 A;  3SCX A;  4KRF A;  3IS9 A;  2DFE A;  4IDK A;  3VQ8 A;  1JL2 A;  5J2P A;  2QXF A;  3NGI A;  3LAM A;  4B9U A;  3MEE A;  4AH9 A;  2GUI A;  5HRR A;  1TKT A;  5J1E A;  4EZ9 A;  4CK3 A;  3PO4 A;  1LWC A;  3QO9 A;  4CK1 A;  4FZX C;  3A2F A;  4FM1 A;  2ITG A;  1KLN A;  4CJW A;  3SUQ A;  4F4K A;  5KRT A;  4EZ6 A;  3QIO A;  2HVH A;  4E7K A;  3SPY A;  1J5O A;  3SNN A;  1FKO A;  3LAK A;  2VG6 A;  1KLM A;  1D8Y A;  5D3G A;  3RRG A;  4YNQ A;  1TL1 A;  4ZHR A;  3TAN A;  3SQ4 A;  2OYQ A;  4M42 A;  5CZ2 A;  3CM6 A;  3G10 A;  4KPY A;  2XY7 A;  4HCB A;  1TV6 A;  4RW9 A;  4DTN A;  4CGI A;  4B9N A;  4CGH A;  1BCO A;  3NGY A;  1JXB A;  1TKX A;  1WNS A;  4CJL A;  4Q5V A;  3LAN A;  2G8W A;  4GMJ B;  2P1J A;  2QKK A;  3ZT3 A;  3RTV A;  4E7H A;  3TR8 A;  2D5R A;  4OKJ A;  2X6S A;  1C6V A;  4LH4 A;  4OPK A;  3HP6 A;  3AVM A;  4ID1 A;  3O3G A;  3MAQ A;  1U4B A;  1RNH A;  1RT6 A;  2RN2 A;  4I2Q A;  1RDB A;  3ZSQ A;  3OS1 A;  4DLG A;  1Q9Y A;  3V1R A;  3VQA A;  4PY5 A;  2AJQ A;  1K6Y A;  5DMR A;  3SUO A;  4DSK A;  1NKC A;  4K8Z A;  3NH0 A;  4HUG A;  3VQ9 A;  2G8F A;  2YHA A;  2IC3 A;  4OKK A;  3NGZ A;  4MQ3 A;  1XC9 A;  4CHY A;  2HB5 A;  3V9U A;  2OZS A;  2HHS A;  3O4Q A;  3DOK A;  4O0I A;  4DSF A;  4IKF A;  2GBZ A;  4DU1 A;  1NJY A;  3K5O A;  1ZBI A;  4B9T A;  4EP4 A;  3M8R A;  4CES A;  1WSE A;  4FZZ A;  1YTA A;  1ZYQ A;  3KLH A;  2OPR A;  5FDL A;  5C24 A;  3ZSV A;  3L2Q A;  3AO4 A;  4DTP A;  4FLY A;  1NK9 A;  1QQC A;  4CEO A;  4Z4I A;  3HT3 A;  1J53 A;  3OS0 A;  3L2U A;  4FJL A;  4DF8 A;  3VQ5 A;  1CZB A;  4HHT A;  2P5O A;  1QSS A;  2XRI A;  3BGR A;  4CJ3 A;  3WNF A;  4FJM A;  3B6O A;  3KTQ A;  2HHX A;  2IAJ A;  1A5V A;  1BQM A;  3ZSZ A;  2OZM A;  2HHQ A;  1KVC A;  5HP1 A;  1NK7 A;  1L3S A;  4FLX A;  3HPO A;  1CXU A;  4CEZ A;  3ZCM A;  1UWB A;  3ASM A;  4IFV A;  4W5O A;  4CFC A;  2WON A;  3AV9 A;  1YTU A;  4DSE A;  4O44 A;  4RW6 A;  2R7Y A;  4ELU A;  1RDD A;  4CIE A;  3LZI A;  3NDK A;  3LWL A;  4LSL A;  4JS4 A;  1U48 A;  3KK3 A;  3V4I A;  2I5J A;  1XWL A;  4FLW A;  3LPT A;  1ZBL A;  1BIU A;  3TAB A;  3KD1 E;  4FVM A;  4M3W A;  4CJR A;  4HCC A;  1KFD A;  1W9H A;  3AA2 A;  3LP1 A;  4CEC A;  2G8V A;  4FCY A;  3SJJ A;  2FBT A;  4FK4 A;  1FKP A;  3AA5 X;  2YNH A;  2OPS A;  2G8I A;  4BWM A;  2XO7 A;  3AO1 A;  3L2V A;  3QES A;  2KW4 A;  1KVB A;  1UAX A;  1VRT A;  1C0U A;  1WSI A;  4FJX A;  4W5N A;  1KCF A;  1GOC A;  3ZSX A;  4DQI A;  4E3S A;  1JLQ A;  4DQS A;  2QKB A;  1WAF A;  2PY5 A;  2WOM A;  4W5T A;  4F2R A;  3L3V A;  3BDP A;  1D9F A;  1Y97 A;  4BAC A;  4BE1 A;  3KLG A;  2HVI A;  3KLF A;  2YNG A;  2Q3S A;  3RR7 A;  1BL3 A;  2ETJ A;  3OYN A;  2PYL A;  3OJS A;  3VQP A;  4AHV A;  3NF6 A;  3V9S A;  2KZM A;  4DFP A;  4E0D A;  3V1Q A;  3U3Y A;  3THV A;  4OPJ A;  1TK8 A;  2VWJ A;  2FBV A;  3CFP A;  1NK0 A;  4ICL A;  1KRP A;  1EX4 A;  2NUB A;  4N56 A;  3PO5 A;  2PZS A;  3HYF A;  3VA0 A;  2KFZ A;  4UQG A;  4OLB A;  4CER A;  1EET A;  1JL1 A;  1L5U A;  1I39 A;  3K58 A;  2X6N A;  4G1Q A;  1REV A;  3OYM A;  3MEC A;  1R0A A;  3OYF A;  1N5Y A;  1HPZ A;  3OYI A;  4DSI A;  4FJI A;  4Z4C A;  4CIG A;  4L8R B;  2X74 A;  3V6D A;  3TAG A;  1RTJ A;  1EKE A;  4B9V A;  4BDZ A;  1MU2 A;  1T7P A;  4C8N A;  4CHN A;  4BDY A;  1EP4 A;  1VSJ A;  1KTQ A;  3TAR A;  1NKE A;  4I9Q A;  5FRN A;  4BDP A;  4OKE A;  3AVL A;  1S1X A;  3O3H A;  3CFR A;  3ZT4 A;  3I8D A;  3HP9 A;  2F8T A;  2XHB A;  4O5B A;  1T05 A;  5C42 A;  4DTX A;  4Z4H A;  3T3F A;  4FJ5 A;  3SUP A;  2YNF A;  1VSD A;  1IKV A;  4LD0 A;  1NK4 A;  1BCM A;  1U49 A;  3ITH A;  3L2R A;  4CHZ A;  1NOY A;  1HRH A;  2DFH A;  4KB0 A;  1JLB A;  2ZD1 A;  1JKH A;  3NFA A;  1SKW A;  3HJF A;  4FLZ A;  3LDS A;  3V9X A;  4M3U A;  5FRO A;  4GVM A;  5DK5 A;  4DTJ A;  1WAJ A;  2XY6 A;  1A5X A;  1BIZ A;  3T1A A;  2E6M A;  4J2E A;  4HTU A;  3SI6 A;  4M3R A;  4M3Y A;  2BGG A;  2P51 A;  4B08 A;  3L2W A;  1ZBF A;  3DLE A;  3ISN C;  4RW8 A;  4HVJ A;  4DSL A;  4DF4 A;  4AHU A;  1RTD A;  3DLR A;  3TI0 A;  2XY5 A;  4BE0 A;  1C1C A;  2JLE A;  3HO1 A;  3QEW A;  1CZ9 A;  4N76 A;  2B5J A;  3D45 A;  3VQB A;  1RDC A;  3WNG A;  3OYG A;  4J2A A;  4E1N A;  3K59 A;  4M3T A;  3RMB A;  1TK5 A;  3HK2 A;  4QCL A;  4FJ7 A;  3I0S A;  1HYZ A;  5C25 A;  1RBT A;  3QEI A;  1TAQ A;  3NE6 A;  1D5A A;  4CE9 A;  4DG1 A;  1IG9 A;  2P5G A;  1S9E A;  1U47 A;  1N6Q A;  3LPU A;  3NHG A;  3NH1 A;  4FJN A;  4NYF A;  3NCI A;  3NF7 A;  4JRQ A;  3KKR A;  1LV5 A;  1C1B A;  1L3V A;  1ZBH A;  4CJP A;  1LWE A;  4KV8 A;  3E01 A;  1NOZ A;  1YVU A;  4Y1C A;  4CEF A;  4B9M A;  1JLC A;  1ASV A;  5HRP A;  4RW7 A;  2O4G A;  3CG7 A;  1JXE A;  2OPQ A;  4NYN A;  4QAG A;  4CJS A;  4PUO A;  1CXQ A;  4B8C A;  1TK0 A;  4FYD A;  3SQ2 A;  3VQ6 A;  3EY1 A;  1Z25 A;  3P83 D;  2YV0 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...