2F9TA

Structure of the type iii coaa from pseudomonas aeruginosa
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
250
structure length
241
Chain Sequence
ASMILELDCGNSLIKWRVIEGAARSVAGGLAESDDALVEQLTSQQALPVRACRLVSVRSEQETSQLVARLEQLFPVSALVASSGKQLAGVRNGYLDYQRLGLDRWLALVAAHHLAKKACLVIDLGTAVTSDLVAADGVHLGGYICPGMTLMRSQLRDAEARRALASLQPGQATAEAVERGCLLMLRGFVREQYAMACELLGPDCEIFLTGGDAELVRDELAGARIMPDLVFVGLALACPIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pantothenate Kinase
publication title Prokaryotic Type II and Type III Pantothenate Kinases: The Same Monomer Fold Creates Dimers with Distinct Catalytic Properties.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase
total genus 66
structure length 241
sequence length 250
chains with identical sequence B
ec nomenclature ec 2.7.1.33: Pantothenate kinase.
pdb deposition date 2005-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03309 Pan_kinase Type III pantothenate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2f9tA01
3.30.420.490 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2f9tA02
3BUZB 1XQSC 2I7PA 5AQPA 4Y0WA 3QBXA 4AM6A 3CJ1A 4LC9B 4O8KA 2E88A 1WUAA 3VEZA 4BRGA 3QMLA 1C0FA 4FPBA 4B1VA 1BUPA 2FF3B 1HLUA 5E84A 2IVNA 1YAGA 2VCPA 3ZX3A 2GEMA 3EO3A 4BVOA 2F9WA 5ELZA 4FL9A 3C0BA 4CZFA 4BRAA 5AZJA 1OKJA 3MN5A 5FPMA 2Q0UA 5AQRA 3GL1A 3BP8A 3UB5A 5ADXA 4BRMA 1E4FT 5FPDA 3A5LC 3U8XA 4BRDA 2QWMA 1ESVA 3CQYA 5AQTA 4B1UB 4DCHA 3MK6A 3QFUA 4XH1A 4NB4A 4RCHA 3M1FA 4WQ5A 4YDUA 5AQYA 4CZIA 4QS8A 4B1YB 3LDLA 3WT0A 2ITMA 4FWKA 1E4GT 1H1VA 3WXIA 4PL7A 4BG9A 3VEOA 1Z6RA 3O1BA 4A2AA 2ZF5O 3CETA 5EY4A 4BREA 3GBTA 4CJ7A 2V52B 1BU6O 1D4XA 1HKCA 5AZIA 3WQUA 4EHUA 2D0PA 2VWBA 4J8FA 3ULEA 3VF2A 4BRKA 3MMVA 3ZEUA 3MN9A 1BOTO 3WXKA 1NGAA 1S3XA 3D2EB 1DKGD 5AQKA 5AQGA 4PL8A 4BRNA 3FZLA 4H5VA 2E1ZA 3EN9A 3KHYA 1EQYA 2IVPA 4JAXA 4NO7A 3ID8A 2CH5A 4BR5A 1BA0A 1YVNA 1JCFA 1CZAN 3LDOA 2P9PA 2UYTA 4JHDB 3IMXA 5AQVA 3VEXA 3WXJA 3H1VX 2D1KA 4DB3A 5AR0A 1G99A 3UKUA 5JLFA 3UKRB 2ASOA 3H3OB 3I8BA 3EKSA 3SLCA 3VETA 1KAZA 1HX1A 3DXKA 2V7YA 1DGKN 4IZ9A 1ZBSA 3A5MC 3VEVA 3WQTA 3VERA 3QFPA 4BC2A 3ZETA 1ATRA 4BRLA 3WUHA 1SQKA 4BRHA 2IVOA 2Q36A 4CBUA 4HWIA 1P8ZA 2Q97A 2QWQA 2QM1A 3HM8A 4PKGA 4DHYA 1JCEA 2CH6A 2BUPA 2E1YA 4GY2B 3WEEB 4B9QA 4BROA 4M63C 4JNEA 3DXMB 3U9DA 1RDWX 2FSJA 2ASMA 4XEIA 4EHTA 5EVZA 4CZEA 4H0VB 2ASPA 3D2FB 4ISGA 3C7NB 3JS6A 3VEYA 4I6MB 1QHAA 1DEJA 3U4LA 2PBDA 5JMVA 1Y64A 2P9KA 3H45C 4CZMA 2P9UA 4Z94A 2P9NA 1KXPA 3EKUA 4WQ4C 3TU5A 2YHYA 3VGLA 4B1XB 2P9LB 4XH4A 4AM7A 1KAYA 5TKYA 4M7XA 3SJHA 5AQOA 3FE1A 2QWPA 1HKBA 4H0YB 4A62A 2AA4A 4BR9A 4BR2A 3KZBA 1WOQA 2Q1NA 4FWOA 2FF6A 4B1ZA 2GELA 2ZGYA 3MDQA 4BRFA 4CBXA 4A2BA 2E8AA 3A8YA 2QWNA 2QW9A 5F2RA 1HKGA 1K8KA 1NBWA 2FXUA 3CJ7A 4CZKA 2QWLA 2PAVA 2KHOA 2YJFA 3AAPA 5KQDA 4CZLA 3H1QA 5B8HA 5BR9A 5EX5A 2NLXA 5E26A 3BEXA 5AQIA 3VOVA 4JN4A 1MWMA 1YUWA 1RFQA 2QWOA 3FZKA 5AQSA 5AZJB 1TYQA 3VEWA 3ATVA 2ZGZA 4IJAA 1V4TA 1ATSA 4CZGA 2ZWHA 2HF4A 1NGJA 3CERA 3LM2A 3HBTA 5AQFA 4DQ8A 3FZFA 4BRQA 5EXWA 3I33A 1LCUA 3O8MA 3CJBA 3U9ZA 4C23A 1NGBA 4FO0A 2CGLA 4FWSA 2QWRA 2P9SA 1QZ6A 1NGEA 4CD3A 1BO5O 2Q2RA 1J6ZA 1TUUA 3W3DA 1TYQB 2YJEA 4EAHD 4F9OA 5AQUA 4QS7A 3VESA 3CJAA 2EWSA 4IXCA 4EFHA 5BPNA 3LDPA 3TPQA 5AFUH 3F9MA 1NGFA 4FWLA 5AZIB 4E1JA 2A6AA 5KPZA 3VPZA 3LL3A 3MCPA 3ULEB 4O5FA 4BC5A 4MLEA 2D0OA 3ZEUB 1U2VA 4FWMA 2CGJA 1GLCG 1QQNA 4H0PA 1NM1A 4JD2A 3KVGA 4CZHA 3UE5A 1QQOA 1BWFO 4H5RA 3HTVA 4BC4A 4ISFA 3O80A 2P9PB 4K42A 1NGIA 4H0TB 3VGKA 4BGBA 5BREA 4MO4A 3JXUA 2BTFA 3GG4A 4CI6A 5CE3A 1Q18A 1SAZA 3CI5A 3UKUB 1TUYA 1YXQA 2P9IA 2YHXA 2GWJA 1NMDA 5AFUA 5LJVA 1X3NA 3SMSA 4IWVA 1GLAG 2YHWA 3M3ZA 1MWKA 1NGCA 1KAXA 2HF3A 1RGIA 2H3GX 4K41A 3DXKB 2YI1A 4QS9A 5BN8A 1MA9B 3BF1A 2GWKA 2E2QA 3QICA 1C0GA 1ZC6A 4RWTA 2YCHA 3SMPA 3ZETB 3FFKB 2W41A 3L6QA 5FPNA 3HI0A 5AQZA 1HPMA 2FSNA 2WUSA 5AQLA 4H03B 4WQ5C 1X3MA 4YDUC 4BR0A 3IUCA 3P4IA 3SK3A 1MDUB 3CHWA 2F9TA 2E20A 2A42A 3MN6A 4PKIA 5BPMA 5BRHA 1BA1A 1GLBG 4ISEA 2Q31A 1T44A 3AY9A 1HUXA 4HTLA 3ATUA 4CBWA 2D4WA 3GDQA 1Z05A 1T6CA 4BC3A 5BPLA 2E2PA 3FLCO 1X9JA 3DJCA 3ZX2A 4BVPA 3FGUA 3OHRA 2P9KB 2A41A 4BG8A 2P9UB 2P9NB 4KBOA 3DWLA 3A5NC 4B1WB 1QZ5A 4CZJA 1NGGA 3QDKA 1XUPO 3LDNA 4H5NA 4CD1A 3FR0A 2A5XA 3IFRA 4A61A 2Q0RA 3RSEA 3ENOA 3W0LA 1GLFO 1V4SA 2FLOA 3R8EA 3BF3A 2V7ZA 1XC3A 2GUPA 4MO5A 5AQNA 3VENA 5I9EB 3M6GA 3DAWA 4H5TA 4RTFD 1K8KB 2A40A 1BG3A 3VGMA 3IDHA 3R9PA 3QB0A 1LOTB 4XH5A 4EIAA 5AQMA 2HOEA 4BR4A 4BRIA 4WQ4A 5AQWA 3RSEB 3O1WA 3GE1A 2NZTA 3D2EA 4BR7A 4M7YA 4GNIA 5KQ8A 4FWPA 2VYPA 2IIRA 5BN9A 5AQHA 4BGAA 4WYBA 2QXLA 3S41A 2CGKA 2E2NA 1SZ2A 3A5OC 3J8AA 4JHDA 3EL2A 1IJJA 3H46O 3LM9A 4BQLA 1NGDA 4FWNA 4H5WA 4BRCA 3L0QA 3UKRA 1QQMA 5LY3A 3G25A 3O08A 3VF4A 5KPRA 2GTDA 5AQJA 3ENHA 2P9SB 1IG8A 3D7EO 5BRDA 1BDGA 2AP1A 4H0OA 2NRHA 3ZX0A 5AQQA 3MN7A 4IO8A 3FZMA 2J4RA 3R6MA 3AAQA 3FZHA 1NWKA 2DPNA 2HMPA 5LJWA 2A3ZA 5KPTA 1U2VB 3O4WA 3CJ9A 4IJNA 2I7NA 1NGHA 3CIPA 4FSVA 1HJOA 1ATNA 4JD2B 5BRFA 1T6DA 3HZ6A 3CJCA 3WEEA 3DXMA 4FOIA 3H6EA 4K25A 5F1XA 1GLJO 4FPAA 1R59O 3GOIA 3AARA 3D2FA 4FWQA 5JICA 3C7NA 4I6MA 5EOYA 3H3NO 1S22A 2W40A 3O6WA 3WXLA 2P9IB 4K43A 4MLHA 5AQXA 2P9LA 5JLHA 3CQXA 1GLLO 1U6ZA 3B8AX 4L3QA 3VF6A 2FSKA 4FWRA 5FPEA 3L4IA 5F0XA 2E2OA 1GLDG 3O5BA 3QBWA 4BQZA 1NLVA 2OANA 4FOEA 3A0IX 1JCGA 3HSCA 5ADXH 1GLEG 3LDQA 4H0XB 2V51B 4PKHA 4BRPA 3EZWA 1ZXOA
chains in the Genus database with same CATH superfamily
5GIPA 1XQSC 4HUGA 4GKJK 3ZSZA 4M3RA 4Z4GA 1F21A 1WUAA 1YF5L 3VEZA 1CZ9A 4FJJA 1LAWA 4IG3A 4KB1A 4LF6K 4WFNL 4DSEA 3PIOL 5SZTA 2IVNA 2VCPA 3ZX3A 4FL9A 3C0BA 4CZFA 4BRAA 2KFZA 2Q0UA 4CJ5A 2FBXA 4YFUA 4JK8A 4BRMA 3AVNA 1L3VA 4IKFA 4G1QA 4BRDA 4DCHA 2P5GA 3MK6A 4B9MA 4WQ5A 4NLCA 4YDUA 5AQYA 1S1WA 5E41A 1ZBHA 3RWUA 1RNHA 3LDLA 3OYJA 4C8OA 1SUQA 2ITMA 1EXQA 4LFCK 4PL7A 4BG9A 4OKKA 3G71N 4CFDA 1D9FA 1KFDA 3O1BA 2NRRA 3NMUA 3O9TA 3I8DA 1N8RO 2UXCK 2OTLN 5M1OA 1BU6O 1D4XA 1QE1A 5AZIA 4ILGB 2D0PA 4J8FA 3ULEA 5CZ2A 4DV4K 1Q8IA 3MN9A 1BOTO 2DFHA 4PHTX 2GX9A 3D2EB 4CEZA 4CJWA 4M3UA 3AO1A 4H5VA 1VQPN 5A2QO 1EQYA 4HVJA 4NCBA 2CH5A 5M1NA 2ETJA 3ZT1A 4JHDB 3VQAA 3VEXA 4DV3K 3THYB 5TKWA 1RDCA 3H1VX 3WXJA 1TKTA 3E1YA 4PWDA 3HOTA 4CJUA 1X9WA 1TV6A 3PUFA 3U3GA 4W5TA 3EKSA 1XHXA 4KFBA 3SLCA 3KK1A 1ZBFA 3QEVA 1ASUA 1ZBSA 4GMJB 3VEVA 1NKEA 3VERA 3HVTA 2XY8A 4BC2A 3ZETA 1RDBA 4MDAA 3J80O 4BRLA 3WUHA 1SQKA 3T1YK 5HOOA 1QQCA 3AO4A 2ZD1A 3KK2A 1Q9XA 2DFEA 4JKDA 5HRSA 4KAZA 1RBUA 2LSNA 2QM1A 1SS6A 1JCEA 2CH6A 3T19A 4Z4CA 4E7HA 4CJTA 4W5RA 4E7IA 3LPTA 4GY2B 4B9QA 4LD0A 1U49A 3VQDA 3TABA 2BDPA 4DQSA 4XEIA 4QOZB 4A57A 2ASPA 4ISGA 1NKCA 4I6MB 3U4LA 1Y64A 1K6YA 3P38A 4HUFA 4CZMA 4IDHA 2P9UA 3AVAA 3SAFA 3TU5A 4A5AA 3P1GA 3K5LA 4FJNA 4EP4A 5AQOA 4H0YB 4A62A 4BR2A 3KZBA 5M1QA 1WOQA 2Q1NA 2FF6A 4CJVA 1VQ6N 4GV9A 5BR8K 4FJKA 3A8YA 2QWNA 1NG9A 2PZSA 2QW9A 1U45A 3SV4A 4DU3A 1K8KA 4FJ8A 4CZKA 2PYJA 2YJFA 1HNIA 3BY5A 1KLNA 2Z1GA 4CZLA 5B8HA 3TAEA 4HUEA 1L5UA 3ZT3A 4DSKA 1RFQA 3FZKA 1NJIO 4FZYA 2VQFK 4OO1J 2ZGZA 1NK4A 2NNWA 3MX5A 3AO5A 5GAHP 1V4TA 3K57A 1ATSA 4GV3A 4N76A 2JLEA 3VQ8A 4KKOA 3I33A 2X6NA 1NK5A 3AVJA 3CJBA 3U9ZA 3I56N 2B5JA 2F7TA 1NK8A 3QO9A 3NF6A 2CGLA 2QWRA 3OS0A 3V1OA 3W3DA 3SYZA 4AQYK 1VSKA 1C0MA 5AQUA 1T7PA 1HYVA 4JI4K 4IXCA 5BPNA 4DS5A 3KLEA 3F9MA 1NGFA 5KPZA 1I3AA 1SL1A 3MCPA 4O5FA 3JSMA 3LZJA 4ZTFA 1U2VA 2WTUA 2CGJA 2I5JA 2KLAA 4O8UA 1VK0A 3UE5A 3SUOA 4BE2A 1X9SA 3AO2A 3BZCA 4BGBA 1KC8O 5BREA 4MO4A 3QEWA 5CE3A 3PX0A 3AVLA 3CI5A 1TUYA 1YXQA 3OBYA 5LJVA 3OTOK 1X3NA 2RN2A 4IWVA 1GOBA 1NGCA 2HF3A 4K41A 4JI2K 4CFBA 2XY7A 2YI1A 4BE0A 1MA9B 4FLZA 4FJLA 2E2QA 5CZ1A 3AVIA 4CGIA 2YCHA 4WFAL 2W41A 5JVGL 3HI0A 4ILHA 1HPMA 4AHSA 4JI0K 5AQLA 1X3MA 3EE8A 2XO7A 4J2BA 1J5OA 5J2NA 3IUCA 3P4IA 3HPHA 4CHYA 4ICLA 4IEEA 1VRUA 3MN6A 3T3FA 4KB0A 4ISEA 1GLBG 2YHAA 4DQPA 1HUXA 4K0KK 4Y1CA 3V9ZA 2HHSA 1T6CA 5BPLA 2E2PA 4PY5A 4BVPA 1HJRA 4AHVA 3OYGA 1MU2A 1HNZK 2PYLA 1KFSA 3VQPA 3DWLA 4CGDA 3BGRA 1TAQA 1VAZA 3OW2M 3CCJN 2HNDA 3W0LA 3MEGA 5CHIA 3ASMA 2FLOA 3O3GA 3DLHA 2V7ZA 2GUPA 5AQNA 4LY7A 1DT9A 3MAQA 1D8YA 4IFVA 4H5TA 4RTFD 1JLEA 2A40A 3O9UA 2IGIA 4NLBA 4B9SA 4G9ZA 3ZLJA 5LMNK 3C6AA 4CGGA 2OZSA 3QIOA 4I7FA 4HHTA 4WQ4A 3CFOA 1U4BA 1J54A 4PUOA 4LSNA 4M7YA 4GNIA 2O8BA 3WNFA 5AQHA 4BGAA 4CJEA 4FJHA 4WYBA 2UUCK 3S41A 4Z4EA 2E2NA 1T03A 1Q86O 1VQKN 1XWLA 1FKOA 1NGDA 3HP9A 4H5WA 2Y1JA 4BRCA 3UKRA 3ZT4A 2O8DA 2GTDA 1RT1A 1IG8A 3VQ7A 3SQ4A 3D7EO 2O8FB 3C6UA 5BRDA 1SL2A 5GINA 2AP1A 4H0OA 2HSTA 2VWKA 4CJSA 3K9KA 4IO8A 3WNHA 4XIUA 3THWB 3TSPA 1C6VA 3AAQA 4CFAA 4AHRA 3FZHA 1NWKA 3HT3A 1A5WA 2F8SA 3I0RA 1FJGK 2A3ZA 4CFCA 5KPTA 3O4WA 3CJ9A 2I7NA 3DM2A 3CCQN 1L3SA 1ATNA 1T6DA 3CJCA 4CEEA 1S1UA 1WN7A 5GAEP 4YOVA 1HYZA 3H6EA 4K25A 4DSFA 1O1WA 3CC7N 2VG7A 3AARA 4I2PA 3C7NA 3NH2A 3OYFA 3SQ1A 1KCFA 1S22A 5LMUK 1RDUA 3C6HA 3DLGA 5KGWA 5AQXA 4W5QA 5FPEA 1JLFA 3IG1A 4FOEA 1JCGA 4RW4A 3JYTA 4LFAK 3LDQA 4E89A 3OY9A 3I55N 3LANA 3BUZB 3TTDA 4X65K 5AQPA 4Y0WA 4YOXA 3TAPA 3QBXA 4AM6A 3CJ1A 4LC9B 3L3UA 4JI6K 3PIPL 3AVMA 4GV6A 3T7ZA 1FK9A 3QMLA 1C0FA 4B1VA 4Z4HA 4JK9A 1HLUA 3V1RA 5E84A 4JI3K 1W97L 4DV6K 3CCUN 2GEMA 3QNOA 3AVFA 3AVGA 5D3GA 4FW1A 1OKJA 3K58A 1TKZA 3MN5A 4DSIA 1Q9YA 5AQRA 3GL1A 1WSEA 3BP8A 1JLCA 3O4QA 3U8XA 1QS4A 4DFMA 1ESVA 4OKJA 4FLXA 4DF8A 3M1FA 3DLEA 2BE2A 2NRWA 1XMOK 4CHZA 3DYAA 4CZIA 4Q5VA 3NF9A 4JI5K 1BIZA 1ASWA 3ZT2A 3PX6A 4ELUA 1RTHA 5K14A 1S5JA 1VRTA 2BANA 3TAGA 2WOMA 3TSQA 3CETA 1C1CA 1QHTA 1RTDA 4CJ7A 1I94K 2IS3A 2P1JA 1NJYA 4PA1A 4KH6A 4NCAA 1M1KO 4B3MK 5HRPA 3MMVA 4FJIA 4I9QA 4JV5K 2YNGA 1S3XA 2NRXA 4JKGB 4KHUA 5SWMA 3SUQA 2E1ZA 1R0AA 1OH7A 3KHYA 2IVPA 4NO7A 4B8AB 3ID8A 1BA0A 1Q81O 3KLFA 4B3RK 1CZAN 5T7BA 3HP6A 5AQVA 3IMXA 1VQ8N 1GOCA 2D1KA 4H8KA 2ATQA 1SKWA 1G99A 1REVA 5DMRA 3I8BA 4OKEA 3NBPA 4LF4K 3AA5X 3VQ5A 3BDPA 4DLEA 3CFRA 3RR8A 1DGKN 4IZ9A 1OVYA 3A5MC 4I9LA 1LW0A 3WQTA 1B9DA 4M42A 2HVHA 4OPAA 1IKYA 1ATRA 3MX2A 3L2VA 4FYDA 1Y97A 3DMJA 4CBUA 3HSTB 3NH0A 1P8ZA 2X78A 4CERA 4DHYA 1BI4A 3AV9A 2E1YA 4E1MA 4CGFA 4H4MA 3U9DA 3PSIA 4FVMA 1XMQK 3HM9A 4CHNA 3LP0A 1YJWN 4CZEA 2O4IA 3RMDA 3NH1A 3Q7BA 4IDKA 1QHAA 1DEJA 2OPQA 2PBDA 5JMVA 2KW4A 4O44A 4N5SA 3VA3A 4F3TA 1KXPA 4KO0A 3EKUA 4ELTA 3VGLA 4B1XB 4FLWA 1FKPA 2P9LB 3THXB 2KZZA 5TKYA 1HKBA 1TK8A 1HRHA 4BR9A 1RTJA 3C95A 4OX9K 4B1ZA 2GELA 4X62K 4AH9A 3SBTA 4CBXA 5FDLA 3LZIA 2E8AA 4FM1A 3EE9A 5HL7L 3CPEA 4YOUA 2QKBA 1HKGA 2Z1JA 1TGOA 1RBVA 4B9NA 2QWLA 4B3TK 3RMBA 3ID6A 4DTMA 4B9TA 5EX5A 2QA4N 3R1XA 5E26A 2OPRA 4KPYA 1MWMA 2ZE2A 5AZJB 5AQSA 3CPWM 3CCSN 1BISA 3VEWA 4F3OA 3N4PA 3OS1A 3QETA 1YJNN 1NOZA 1XHZA 4KTQA 4DUYK 4QAGA 1W7AA 3FZFA 4BRQA 3KK3A 3MEDA 1NK0A 1RT3A 3CG7A 4BDZA 4CGHA 3HJFA 4C23A 2YV0X 3CCVN 2D0CA 2P9SA 1NGEA 2X6SA 4CD3A 1BO5O 4CEQA 1TUUA 5H1SQ 4F9OA 4A59A 2O8EB 1JLQA 2EWSA 4E0DA 1Z25A 5IWAK 2G8HA 3L4QA 3ISNC 4DR5K 5AFUH 3VPZA 3NGIA 1BCMA 2D0OA 3ZEUB 3N4QA 3QESA 1GLCG 3DRRA 1QQNA 3KKSA 1NM1A 5M1KA 1QQOA 3R3LA 4WE1A 1BWFO 4H5RA 4LF7K 3L3VA 3HTVA 4OPHA 4O0IA 4DR4K 1OH6A 2P9PB 4KI4A 4H0TB 5J2PA 4JRQA 4JKHA 2UUBK 3MXMA 2YHBA 4EP5A 3UKUB 1HR0K 1JLBA 1WAFA 1VSLA 2P9IA 3SMSA 1VQ7N 1GLAG 3M3ZA 3OYAA 1NK7A 1MWKA 4FK4A 1KAXA 4KI6A 1RGIA 2H3GX 2AJQA 3AVBA 3DXKB 4QS9A 3V81A 2HHQA 1RBTA 3HPGA 1QTMA 2VWJA 4RWTA 3SMPA 3L6QA 3ZSQA 1ILYA 5FPNA 5AQZA 4DR2K 1L3UA 2WUSA 4FW2A 2OYQA 1BHLA 5HRNA 2RF2A 4W5OA 1MDUB 1ITGA 3CHWA 2F9TA 3OYNA 4PKIA 5BPMA 5BRHA 3OYEA 2Q31A 3TAMA 3HXMA 3AO3A 3ZSRA 3GDQA 1Z05A 2HW3A 4BC3A 1IV0A 3NHGA 4FLYA 3FLCO 2FBTA 1X9JA 3NCIA 3CCEN 1LAVA 5FRNA 1VQNN 4ID1A 1RDDA 3OHRA 1NU0A 2P9KB 4BG8A 2P9NB 2ITGA 4B1WB 3A5NC 5DM7L 3QDKA 3CCMN 4DUZK 4H5NA 4NXMK 1T8EA 4BWJA 2A5XA 1RDAA 4JKEA 3HPOA 5AJ3K 2WONA 2HHVA 2NRVA 3BF3A 1QSSA 1W2BM 3HL8A 4KH5A 3ZYYX 3VENA 1GOAA 4DFPA 4CJFA 1BL3A 3VGMA 3R9PA 1CZBA 1NJXA 3MCAB 4KTZA 1C0TA 4KHNA 2HOEA 2O4GA 4MQ3A 1S1XA 4M3TA 4BRIA 3CM5A 5M1FA 4KTWA 1WSHA 4DF4A 3DRSA 2NZTA 1P90A 3D2EA 4B08A 4JYAK 2IIRA 3AA4A 3Q7CA 2OPSA 3PO5A 4DTJA 5KRTA 1SZ2A 4C8NA 4OPKA 3J8AA 3E66A 4JHDA 1IJJA 3THYA 3H46O 3L2QA 1XNQK 4JRPA 1QQMA 4TSXA 3G25A 3O08A 3VF4A 3V9WA 4F4KA 3PLAA 3MEEA 5LL6Z 2YNIA 3V6DA 4BDPA 4UY8O 1W0HA 3G6EN 2VQEK 3VTHA 4F2RA 1YT3A 2NRHA 3WXMB 3ZX0A 2RHKA 3SUPA 5IT9O 3MN7A 3SI6A 4HCBA 3FZMA 1BQNA 3R6MA 3VN5A 3SQ2A 1YIJN 4CE9A 3KWIA 4KHYA 1LW2A 3M8PA 3C6TA 3TTFA 4IJNA 2D5RA 1L3TA 2IAJA 4CEBA 2Q3SA 4JD2B 4Z0UA 1N6QA 1LWFA 2HNYA 2G8WA 4M45A 1IH7A 4JLHA 5I42A 2KKZA 4GKKK 1WNSA 4FPAA 3K5OA 2QK9A 3GOIA 3OS2A 2GBZA 3OYBA 4I6MA 1WLJA 3U3YA 1X1PA 1IO2A 3H3NO 3EY1A 2Z1HA 4FLVA 4CJQA 4K43A 4B3OA 3K5NA 3V9SA 4L8RB 4K8XA 3QINA 1JKHA 2FSKA 5KRSA 3SPZA 1EP4A 3L4IA 3TTCA 3CMAN 3QBWA 4BQZA 4Z4FA 2OANA 4JKBA 2O8CB 2VG5A 5ADXH 2UXBK 1TL3A 1T3VA 2V51B 2QEXN 3M8SA 1ZXOA 3EZ5A 3LP3A 2ZJQL 3CM6A 3V1QA 5FRMA 4JKAA 5C15A 2P5OA 2E88A 3H08A 4BRGA 5C24A 3NE6A 3J7AP 2W6LA 1BUPA 1KTQA 2FF3B 2QKKA 4Q0BA 1UA1A 2F96A 3EO3A 4CJLA 2F9WA 5ELZA 2UXDK 3OJSA 5CR4A 4B9UA 5FPMA 2WBNA 3RTVA 3KD5E 3O9SA 2FBYA 1VSDA 4E3SA 2E6MA 5GADP 3E9LA 3CQYA 5AQTA 4B1UB 3QFUA 4XH1A 4NB4A 3ULDA 1YTAA 3K0SA 3DOLA 4GW6A 4BWMA 3TR8A 1E4GT 3WXIA 1N36K 1Z6RA 2XY6A 4A2AA 1WBDA 1VSFA 5EY4A 3CC4N 4DSJA 3GBTA 1B92A 3OYHA 2YKNA 4LSLA 4FK2A 2V52B 4EHUA 2VWBA 4BRKA 3KLGA 3VQBA 3CF5L 3WXKA 1NGAA 4YOWA 4DU4A 5AQGA 4PL8A 4BRNA 4DTSA 4FVUA 3KLHA 4GVEA 1S6QA 4JAXA 3AVCA 1YVNA 1JCFA 3LDOA 4M3WA 2UYTA 3RRGA 4FZZA 5AR0A 3DOKA 1HPZA 1EWRA 3DI6A 3FFIA 4CVNE 4JKFA 3VQ6A 3SUNA 3H3OB 2KTQA 3VETA 4JI8K 1KAZA 2IC3A 1XI1A 3OYMA 1HX1A 2V7YA 3PSFA 3JAMO 3HK2A 1UOCA 2YKMA 3CCLN 4FJ9A 3QFPA 3F5TA 3EEQA 1QVGM 3LP1A 3CMEN 2IVOA 3I0SA 3V9XA 1SL0A 3NF8A 2HHUA 1NKBA 2Q36A 1S6PA 2Q97A 2QWQA 1KRPA 3V9UA 3HM8A 4E1NA 2BUPA 4I2QA 1WSFA 4DU1A 1JJ2M 4JKCA 4ID5A 3WEEB 3HOSA 4M63C 2HBMA 3DXMB 4JEPA 5KTQA 3CYMA 4DTUA 5EVZA 3D2FB 3VEYA 1RT6A 3H45C 3G0ZA 1TK5A 1J53A 4Z94A 1RBSA 2DFFA 4XH4A 4AM7A 1N32K 3BZKA 4M7XA 2QWPA 4KREA 4CEAA 3A2FA 1I39A 4FWOA 5GAGP 3QEIA 3O3HA 4N47A 3KTQA 2ZGYA 4A2BA 4YOYA 4DV5K 1TK0A 3LWLA 3CD6N 2XRIA 5F2RA 3NGZA 3KD1E 1KQSM 2G8FA 1E3MA 5HRRA 1NBWA 2FXUA 3CJ7A 4ZHRA 1DTTA 3HRGA 4DR6K 3O3FA 2PAVA 2KHOA 3M8RA 5C42A 1VHXA 4MFBA 4CEDA 5KQDA 5BR9A 2NLXA 3BEXA 4DKWA 5AQIA 5C25A 3IAYA 3RMCA 4OLBA 5DM6L 1ZBIA 1YUWA 4O0JA 1CXUA 1TYQA 3QERA 2ZWHA 4A5BA 2HF4A 4NYFA 1NGJA 3CERA 4BE1A 3LM2A 3HBTA 4IG0A 4CJ4A 2HNZA 4YNQA 5EXWA 1HNWK 1LCUA 3O8MA 2EX3A 1QZ6A 3L2UA 4JS5A 2O8FA 1WAJA 2GV9A 4FM0A 1VQON 3PY8A 3IS9A 3THWA 3S3OA 2A1SA 4FWLA 5AZIB 3HVRA 1FW6A 4FM2A 3ULEB 4CESA 4WF9L 1YHQN 4C8KA 4FWMA 4FCYA 1N34K 3KVGA 1D9DA 2HMIA 3DRPA 4CZHA 2A1RA 1WB9A 4F8RA 1K9MO 4M3XA 4AF1A 4JI1K 3O80A 4K42A 1NGIA 3VGKA 3RVCA 2BTFA 4CI6A 2E4LA 1SAZA 2EHGA 4NYNA 4DV1K 2YHXA 1NMDA 5AFUA 2PY5A 2YHWA 1WSGA 2W42A 3F73A 3VQ9A 3DLLL 5BN8A 1TVRA 1ZC6A 1Z26A 3NGYA 3TANA 2RKIA 3ZETB 3FFKB 1SV5A 1N5YA 1KVAA 4CEFA 5FLXO 4H03B 4WQ5C 4YDUC 3D6RA 3O9RA 3OYKA 2A42A 1O13A 1BA1A 1T44A 2G8VA 3P5JA 3HYFA 3K9JA 1N33K 2D4WA 3P83D 3NVMA 3NFAA 3VQ4A 3DJCA 3S3NA 2A41A 4CF0A 4E7KA 4UQGA 2P9UB 2DTUA 1NGGA 1XUPO 5CY4A 3ALYA 2R7YA 3LDNA 4J2EA 4CD1A 3FR0A 1K8AO 4A61A 3RSEA 4YOTA 1QVFM 3CFPA 2E5LK 1V4SA 3O9QA 5JS1A 1XC3A 4MO5A 4OPJA 4DV7K 3M6GA 3DAWA 3LDSA 3LALA 1S72N 1K8KB 4KHWA 1EWQA 3IDHA 3LPUA 4CECA 3SAGA 3D0PA 5J2MA 5HROA 1LOTB 2NRTA 1VQMN 1S1VA 5AQMA 4RW6A 4BR4A 4JI7K 3KKRA 1RTIA 3O1WA 3OYLA 3GE1A 3UIQA 3M8QA 2HHHK 1UAXA 3KWGA 4JKGA 3SAHA 4IBNA 2VYPA 5BN9A 1LWCA 4BDYA 3SZ2A 4RW8A 1D5AA 1ZBUA 3A5OC 1A5VA 4CIGA 3CXCM 1VSEA 2D0BA 3LM9A 4FZXC 4BQLA 4FWNA 3L0QA 1IBMK 4DWIA 3C65A 5KPRA 5AQJA 5CYMA 1U04A 3TARA 4FK0A 5KGXA 4DQQA 3OBWA 3QLHA 5HBMA 3RMAA 1JL2A 2J4RA 1DLOA 2ZJPL 3LP2A 3KJVA 1HNVA 3ZSYA 2DPNA 2HMPA 5LJWA 1TKXA 3AA3A 3RRHA 1U2VB 3G10A 4M3ZA 1NGHA 1S9GA 3KLIA 1HJOA 2KFNA 1YI2N 1C1BA 5C2FA 1VSJA 4IFYA 5GIOA 2RE2A 2QI2A 4C1NK 4FOIA 5HLFA 1SKRA 4B3SK 4NCGA 1R59O 3VTIA 1CXQA 5CYQA 4CHPA 1FXXA 5JICA 4KH4A 2D0AA 3DLRA 2W40A 3O6WA 5MLCQ 1YJ9N 2P9LA 1KVBA 3CQXA 3THXA 3B8AX 2KQ2A 3QEXA 4FWRA 5F0XA 3O5BA 5C2DA 3G4SN 2HHTA 1KSPA 1EX4A 3A0IX 3HSCA 4B9LA 1NJWA 1YITN 1TKDA 1EKEA 4H0XB 5JVHL 5FPDA 1QSYA 3EZWA 2I7PA 1DTQA 5C0YA 4O8KA 3WNGA 1RT7A 1VQ4N 4FPBA 3QIPA 3NVKA 1YAGA 3MWPA 3D45A 4BVOA 4CF2A 1IKWA 4FLTA 1BQMA 5AZJA 3ZSWA 4DLGA 1RT5A 1TL1A 2OZMA 3DLKA 1UWBA 4DTRA 3UB5A 4CHQA 5ADXA 4ZTJA 1E4FT 4C1NI 3A5LC 3KIOA 2QWMA 2W6KA 1RBRA 3VA0A 1S1TA 4DSLA 4RCHA 4CCHA 1K73O 4QS8A 4B1YB 3WT0A 4FWKA 1H1VA 4E7LA 2UU9K 1B9FA 2P51A 4V19S 4GVMA 3VEOA 2KZMA 3M5RA 1J5EK 2ZF5O 5J2QA 4H4OA 2O8EA 3QEPA 4HCCA 1VSHA 3SJJA 4BREA 2RPIA 3WQUA 1HKCA 4PQUA 4IFEA 1J9AA 2XY5A 3VF2A 1IBKK 3F2KA 3ZEUA 1HNXK 4RW9A 3E9PA 4DV2K 1DKGD 5AQKA 4C8LA 3OA9A 2O8BB 3FZLA 3EN9A 3O4NA 3IRXA 1Q82O 4BR5A 2ZJRL 4CJ3A 1XNRK 2P9PA 1U48A 4DB3A 2OPPA 1JLGA 3MECA 2YX6A 3UKUA 5JLFA 3UKRB 2QXFA 2ASOA 1RCHA 3VMFB 3TWHA 2O8DB 4K8ZA 4JS4A 4OJRA 3SV3A 2ZQBA 3LAKA 2FC0A 1WBBA 2F4VK 1HMVA 4CF1A 3DXKA 3CQ8A 3IKMA 2G8KA 2G8UA 3S9HA 3J81O 4DFJA 4F2SA 1CLQA 4BRHA 4CF9A 1NOYA 4DQIA 2OCEA 1IKVA 3SPYA 1WSJA 4DR7K 4HWIA 2JWKA 1UA0A 4PKGA 3SQ0A 1RILA 1VSMA 3ITHA 4BROA 4J2DA 4JNEA 1S9EA 4YHHK 4R79A 3ZT0A 1RDWX 2FSJA 4LFBK 2ASMA 1VQ5N 4FJGA 4EHTA 3QNNA 4IOCL 4H0VB 3C7NB 3JS6A 3WNEA 4YY3K 2P9KA 5M1PA 5EU7A 4AILC 1BCOA 1IBLK 3P39A 4IOXA 2P9NA 4WQ4C 1QSLA 2YHYA 1KAYA 2NRZA 1A5XA 3HO1A 1M90O 3SJHA 3FE1A 2UUAK 3TAQA 2AA4A 4HTUA 3VQEA 4LF5K 4IOAL 1ZBLA 3MDQA 3AVKA 4BRFA 4LF9K 2YNHA 4LF8K 3TSUA 4FLUA 1NK9A 4N56A 1LV5A 4M41A 4E7JA 4DG1A 5C12A 4CW7B 1T05A 1EETA 3AAPA 4CK2A 3ENBA 3ZSVA 3E9OA 3H1QA 3NF7A 4LH4A 4IO9L 4O5BA 2G8IA 3VOVA 4JN4A 4CIEA 2QWOA 3K5MA 3ATVA 4IJAA 4AHCA 4KHPK 4CZGA 1KD1O 2VGNA 2WC9A 3K2PA 5AQFA 4DQ8A 4CF8A 3CC2N 4DR3K 3VQCA 1JL1A 3VQQA 1NGBA 4FO0A 1Q7YO 4FWSA 4KV8A 4U7BA 1G15A 2Q2RA 1J6ZA 3PX4A 4OGEA 1TYQB 2YJEA 4EAHD 4DTXA 4QS7A 3VESA 3CJAA 4R5PA 4FJXA 4DR1K 4EFHA 3LDPA 3TPQA 4CJPA 4OVLA 1YVUA 4U67L 2IOCA 3L2RA 4EZ6A 4E1JA 3CCRN 2A6AA 2DY4A 3LL3A 3S3MA 4BC5A 4DQRA 4MLEA 4KHQA 4O55A 1RT2A 4ELVA 4H0PA 4WFBL 4JD2A 4CGJA 1C1AA 3NAEA 2NUBA 1X9MA 1WSIA 2F8TA 4BC4A 1HQUA 4ISFA 1KVCA 2ZM6K 3JXUA 1IKXA 3GG4A 4E19A 4CEOA 4FXDA 1Q18A 1RT4A 3OVNA 3AA2A 4W5NA 1HYSA 2HBKA 2GWJA 1NMNA 1JLAA 4B9VA 3OYIA 1NK6A 1HQEA 1SKSA 3BF1A 3MXJA 2GWKA 1LWEA 2O8CA 3QICA 1C0GA 2OA8A 1ASVA 1OH8A 1VSIA 4CIFA 2BGGA 2FSNA 4NXNK 4Y1DA 3OYDA 1KLMA 2PFUA 2Y1IA 4BR0A 3SK3A 5FROA 1TAUA 1BI4B 2E20A 4X64K 3AY9A 3AGKA 3K59A 4HTLA 3ATUA 4CBWA 3V4IA 3T1HK 3AGRA 4RG8A 3ZX2A 3FGUA 1OH5A 2IDOA 4M3YA 3F9KA 4DTNA 1VQ9N 2GUIA 4WCEL 4KBOA 3RR7A 1QZ5A 4CZJA 1YTUA 4EZ9A 3PO4A 4BY9C 2E6LA 3IFRA 2X74A 2B6AA 5C10A 2Q0RA 3ENOA 2OTJN 3TAFA 2JGUA 1GLFO 3R8EA 4DV0K 2FBVA 5I9EB 3MXIA 3LAMA 3B6PA 4AHTA 1W9HA 1BG3A 3C94A 4J2AA 3QB0A 4XH5A 4CK1A 4EIAA 3ZSOA 2HB5A 3TI0A 2WFBA 3THVA 3DLBA 5JS2A 2JWLA 5AQWA 3RSEB 3SNNA 4KHSA 4FJMA 2VGMA 3PV8A 4BR7A 4LH5A 1JXEA 4N41A 4DTOA 5KQ8A 4FWPA 3L8BA 5KI6A 2HBJA 5J1EA 4MDBA 4DMNA 2QXLA 2CGKA 4KRFA 3NDKA 1XC9A 3EL2A 2VG6A 1VQLN 4OGCA 4CJRA 2Z1IA 5LY3A 1BIUA 3ENHA 2P9SB 4O4GA 4AHUA 1BDGA 1ZYQA 3J7ZO 5AQQA 3T1AA 4DTPA 3J7YP 3ZCMA 4IEIA 4CJKA 3LWMA 4B8CA 4DFKA 1NJZA 3E01A 1EO1A 3SBGA 2HVIA 4FSVA 3CIPA 4RW7A 1IG9A 5BRFA 3U6FA 3HZ6A 4JK7A 4QCLA 2HBLA 3KK7A 3WEEA 3OYCA 2QTDA 3MWTA 3L2WA 4BACA 3DXMA 5F1XA 1JXBA 1GLJO 2HHWA 5DK5A 3AVHA 4C8MA 2XHBA 1BGXT 3D2FA 4FWQA 3T69A 4YORA 3SCXA 5EOYA 1NNEA 3WXLA 2B4JA 2P9IB 3P31A 4MLHA 5I3UA 4ILJA 5JLHA 5HP1A 1GLLO 1U6ZA 4CHOA 4L3QA 3B6OA 3OJUA 4X66K 1U47A 3VF6A 1OVQA 3EYZA 3ZSXA 2E2OA 1GLDG 1C0UA 1NLVA 4FJ7A 4FJ5A 2YNFA 2HHXA 2BH1A 1GLEG 4Z4IA 4CK3A 4PKHA 4BRPA 4DS4A 4OLAA
chains in the Genus database with same CATH topology
3BUZB 3TTDA 5GIPA 2ZJQL 1XQSC 2I7PA 5AQPA 4Y0WA 4YOXA 3QBXA 4AM6A 3CJ1A 4JKAA 4LC9B 5C0YA 5C15A 4O8KA 2E88A 3PIPL 1WUAA 1YF5L 4GV6A 3VEZA 3T7ZA 4BRGA 3QMLA 1C0FA 1VQ4N 4FPBA 4B1VA 4WFNL 4JK9A 1BUPA 2FF3B 1HLUA 5E84A 3NVKA 3PIOL 1W97L 2IVNA 1YAGA 2VCPA 3ZX3A 2GEMA 3EO3A 3MWPA 4BVOA 3CCUN 2F9WA 5ELZA 4FL9A 3C0BA 4CZFA 4BRAA 5CR4A 5AZJA 1OKJA 3MN5A 5FPMA 2Q0UA 2WBNA 5AQRA 3GL1A 3BP8A 3O9SA 3UB5A 5ADXA 4JK8A 4BRMA 1E4FT 5FPDA 4C1NI 3A5LC 3U8XA 5GADP 3E9LA 4BRDA 2QWMA 1ESVA 3CQYA 5AQTA 4B1UB 4DCHA 3MK6A 3QFUA 4XH1A 4NB4A 4RCHA 3M1FA 4WQ5A 1K73O 4NLCA 2NRWA 4YDUA 5AQYA 4CZIA 4QS8A 4B1YB 3LDLA 3WT0A 2ITMA 4FWKA 1E4GT 1H1VA 3WXIA 4PL7A 4BG9A 3VEOA 1Z6RA 3G71N 3M5RA 3O1BA 4A2AA 2NRRA 2ZF5O 3NMUA 3TSQA 3O9TA 3CETA 1N8RO 5EY4A 3CC4N 2OTLN 4BREA 3GBTA 4CJ7A 2V52B 5M1OA 1BU6O 1D4XA 1HKCA 5AZIA 4KH6A 3WQUA 4IFEA 4ILGB 2D0PA 4EHUA 2VWBA 4J8FA 3ULEA 3VF2A 4BRKA 1M1KO 3MMVA 3F2KA 3ZEUA 3MN9A 1BOTO 3CF5L 3E9PA 1NGAA 3WXKA 4YOWA 4PHTX 1S3XA 2GX9A 3D2EB 1DKGD 5AQKA 5AQGA 2NRXA 4JKGB 4PL8A 4BRNA 3OA9A 3FZLA 4H5VA 1VQPN 4FVUA 2E1ZA 3EN9A 4GVEA 3KHYA 1EQYA 2IVPA 4JAXA 4NO7A 1Q82O 3ID8A 2CH5A 4BR5A 1BA0A 1YVNA 5M1NA 1Q81O 2ZJRL 1JCFA 1CZAN 3LDOA 2P9PA 2UYTA 4JHDB 3IMXA 5AQVA 3VEXA 1VQ8N 5TKWA 3H1VX 2D1KA 3WXJA 4DB3A 3E1YA 5AR0A 1G99A 3HOTA 2YX6A 3UKUA 5JLFA 3UKRB 2ASOA 4JKFA 3VMFB 3H3OB 3I8BA 3EKSA 3SLCA 3VETA 1KAZA 1HX1A 3DXKA 2V7YA 1DGKN 4IZ9A 1OVYA 1ZBSA 3A5MC 3IKMA 3VEVA 3WQTA 3CCLN 3VERA 4OPAA 3QFPA 4BC2A 3ZETA 3F5TA 4MDAA 1ATRA 3MX2A 3WUHA 1SQKA 4BRLA 4BRHA 1QVGM 5HOOA 3CMEN 2IVOA 2Q36A 4CBUA 4JKDA 4HWIA 1P8ZA 2JWKA 2Q97A 2QWQA 2QM1A 3HM8A 4PKGA 1SS6A 4DHYA 1JCEA 2CH6A 2BUPA 2E1YA 1JJ2M 4JKCA 4GY2B 3WEEB 4B9QA 4BROA 4M63C 3HOSA 4JNEA 2HBMA 3DXMB 3U9DA 4JEPA 4R79A 1RDWX 2FSJA 2ASMA 1YJWN 1VQ5N 4XEIA 4EHTA 5EVZA 4CZEA 4IOCL 4H0VB 4A57A 2ASPA 3D2FB 3Q7BA 3C7NB 3JS6A 4ISGA 3VEYA 4I6MB 1QHAA 1DEJA 3U4LA 2PBDA 5JMVA 1Y64A 2P9KA 3P38A 5M1PA 3H45C 4CZMA 4IDHA 2P9UA 3P39A 4Z94A 4IOXA 2P9NA 3SAFA 1KXPA 3EKUA 4WQ4C 3TU5A 4A5AA 2YHYA 3VGLA 4B1XB 2P9LB 4XH4A 4AM7A 1KAYA 2NRZA 5TKYA 1M90O 4M7XA 3SJHA 5AQOA 3FE1A 2QWPA 1HKBA 4H0YB 4A62A 2AA4A 4BR9A 4BR2A 3KZBA 5M1QA 5GAGP 1WOQA 2Q1NA 4FWOA 2FF6A 4B1ZA 4IOAL 2GELA 2ZGYA 4GV9A 1VQ6N 3MDQA 4BRFA 3SBTA 4CBXA 4A2BA 2E8AA 4YOYA 3TSUA 3A8YA 2QWNA 2QW9A 3EE9A 5HL7L 3CPEA 4YOUA 5F2RA 3CD6N 1KQSM 1HKGA 1K8KA 1NBWA 2FXUA 5C12A 3CJ7A 4CZKA 3HRGA 2QWLA 2PAVA 2KHOA 2YJFA 3AAPA 5KQDA 3ENBA 4CZLA 3E9OA 3H1QA 5B8HA 3ID6A 5BR9A 5EX5A 2NLXA 3R1XA 5E26A 2QA4N 3BEXA 4DKWA 5AQIA 4IO9L 3VOVA 4JN4A 5DM6L 1MWMA 1YUWA 1RFQA 2QWOA 3FZKA 5AQSA 5AZJB 3CPWM 3CCSN 1NJIO 1TYQA 3VEWA 4OO1J 3ATVA 2ZGZA 3N4PA 4IJAA 2NNWA 3MX5A 5GAHP 4GV3A 1V4TA 1ATSA 4CZGA 2ZWHA 2VGNA 2WC9A 4A5BA 2HF4A 1KD1O 1NGJA 3CERA 3LM2A 3HBTA 1YJNN 5AQFA 4DQ8A 3CC2N 3FZFA 4BRQA 5EXWA 3I33A 1LCUA 3O8MA 3CJBA 3U9ZA 3I56N 2F7TA 4C23A 1NGBA 4FO0A 3CCVN 1Q7YO 2CGLA 4FWSA 2QWRA 2P9SA 1QZ6A 4U7BA 1NGEA 4CD3A 1BO5O 2Q2RA 1J6ZA 1TUUA 5H1SQ 3W3DA 1TYQB 2YJEA 4EAHD 4F9OA 4A59A 5AQUA 4QS7A 3VESA 3CJAA 2EWSA 4IXCA 4EFHA 5BPNA 1VQON 3LDPA 3TPQA 3L4QA 4U67L 5AFUH 3F9MA 1NGFA 4FWLA 5AZIB 4E1JA 2A6AA 3CCRN 5KPZA 3VPZA 3LL3A 3MCPA 3ULEB 4O5FA 4WF9L 4BC5A 1YHQN 4MLEA 2D0OA 3ZEUB 1U2VA 3N4QA 4FWMA 2CGJA 2KLAA 1GLCG 1QQNA 4H0PA 4O8UA 1NM1A 4JD2A 4WFBL 3KVGA 4CZHA 5M1KA 3UE5A 1QQOA 1K9MO 3R3LA 1BWFO 4H5RA 3HTVA 4BC4A 4ISFA 4OPHA 4AF1A 3O80A 2P9PB 4K42A 1NGIA 4H0TB 3VGKA 4BGBA 1KC8O 5BREA 4MO4A 4JKHA 3JXUA 3RVCA 2BTFA 3GG4A 4CI6A 5CE3A 1Q18A 1SAZA 3CI5A 3UKUB 1TUYA 1YXQA 3OBYA 2HBKA 2P9IA 2YHXA 2GWJA 1NMDA 5AFUA 5LJVA 1X3NA 3SMSA 1VQ7N 4IWVA 1GLAG 2YHWA 3M3ZA 1MWKA 1NGCA 1KAXA 2HF3A 1RGIA 2H3GX 3DLLL 4K41A 3DXKB 2YI1A 4QS9A 5BN8A 1MA9B 3BF1A 2GWKA 2E2QA 3QICA 1C0GA 1ZC6A 4RWTA 2YCHA 3SMPA 4WFAL 3ZETB 3FFKB 2W41A 5JVGL 3L6QA 1ILYA 5FPNA 3HI0A 5AQZA 4ILHA 1HPMA 2FSNA 2WUSA 5AQLA 4H03B 4WQ5C 1X3MA 3EE8A 2PFUA 3D6RA 4YDUC 4BR0A 3IUCA 3P4IA 3SK3A 1MDUB 3O9RA 4IEEA 3CHWA 2F9TA 2E20A 2A42A 3MN6A 4PKIA 1O13A 5BPMA 5BRHA 1BA1A 1GLBG 4ISEA 2Q31A 1T44A 3AY9A 1HUXA 3AGKA 3K9JA 4HTLA 3ATUA 4CBWA 2D4WA 3GDQA 1Z05A 1T6CA 4BC3A 5BPLA 2E2PA 3NVMA 3FLCO 1X9JA 3AGRA 3DJCA 3CCEN 1VQNN 3ZX2A 4BVPA 3FGUA 3OHRA 2P9KB 2A41A 4BG8A 1VQ9N 2P9UB 2P9NB 4KBOA 4WCEL 3DWLA 3A5NC 4B1WB 1QZ5A 4CZJA 5DM7L 1NGGA 1VAZA 3QDKA 1XUPO 3CCMN 3OW2M 3LDNA 4H5NA 4CD1A 3FR0A 4BY9C 3CCJN 1K8AO 2A5XA 3IFRA 4A61A 5C10A 2Q0RA 4JKEA 3ENOA 4YOTA 3RSEA 2OTJN 3W0LA 1QVFM 5CHIA 1GLFO 1V4SA 2FLOA 3R8EA 2NRVA 3BF3A 2V7ZA 3O9QA 1XC3A 2GUPA 4MO5A 5AQNA 1W2BM 4KH5A 1DT9A 3ZYYX 3VENA 5I9EB 3M6GA 3DAWA 4H5TA 4RTFD 1S72N 1K8KB 2A40A 3O9UA 4NLBA 1BG3A 3VGMA 3IDHA 3R9PA 3SAGA 3QB0A 4G9ZA 1LOTB 2NRTA 4XH5A 3MCAB 3C6AA 4EIAA 2WFBA 1VQMN 5AQMA 2HOEA 2JWLA 4BR4A 4BRIA 4WQ4A 5AQWA 3RSEB 3O1WA 5M1FA 3GE1A 2VGMA 2NZTA 1P90A 3D2EA 4BR7A 3KWGA 4JKGA 4M7YA 3SAHA 2QEXN 4GNIA 5KQ8A 4FWPA 2VYPA 2IIRA 5BN9A 3Q7CA 5AQHA 2HBJA 4BGAA 4WYBA 4MDBA 2QXLA 3S41A 2CGKA 2E2NA 1SZ2A 3A5OC 3J8AA 3E66A 3EL2A 4JHDA 3CXCM 1IJJA 1Q86O 1VQKN 3H46O 3LM9A 1VQLN 4BQLA 1NGDA 4FWNA 4H5WA 4BRCA 3L0QA 3UKRA 1QQMA 5LY3A 3G25A 3C65A 3O08A 3VF4A 5KPRA 3PLAA 2GTDA 5AQJA 3ENHA 2P9SB 1IG8A 3D7EO 4UY8O 5BRDA 1BDGA 5GINA 2AP1A 3OBWA 3G6EN 4H0OA 3VTHA 2NRHA 3WXMB 3ZX0A 3J7ZO 2RHKA 5AQQA 2HSTA 3MN7A 4IEIA 3K9KA 4IO8A 3FZMA 2J4RA 3R6MA 2ZJPL 1YIJN 3TSPA 3AAQA 3KWIA 3FZHA 1NWKA 2DPNA 2HMPA 5LJWA 2A3ZA 1EO1A 5KPTA 1U2VB 3SBGA 3O4WA 3TTFA 3CJ9A 4IJNA 2I7NA 1NGHA 3CIPA 4FSVA 3CCQN 1HJOA 1ATNA 4JD2B 5BRFA 1T6DA 3HZ6A 4JK7A 3CJCA 1YI2N 5C2FA 2HBLA 5GIOA 3KK7A 3WEEA 2KKZA 2RE2A 2QTDA 2QI2A 3MWTA 4C1NK 3DXMA 4FOIA 3H6EA 4K25A 5GAEP 5F1XA 4YOVA 1GLJO 4FPAA 1R59O 3VTIA 3CC7N 3GOIA 3AARA 3D2FA 4FWQA 3T69A 3C7NA 5JICA 4YORA 4I6MA 5EOYA 4KH4A 3H3NO 1S22A 2W40A 3O6WA 1RDUA 3WXLA 3C6HA 5MLCQ 1YJ9N 2P9IB 3P31A 4K43A 4MLHA 5AQXA 4ILJA 2P9LA 5JLHA 3CQXA 1GLLO 1U6ZA 3B8AX 4L3QA 3VF6A 2FSKA 4FWRA 5FPEA 3L4IA 3TTCA 3CMAN 5F0XA 2E2OA 1GLDG 3O5BA 3QBWA 4BQZA 5C2DA 1NLVA 3G4SN 2OANA 4JKBA 4FOEA 3A0IX 1JCGA 3HSCA 5ADXH 2BH1A 1YITN 1GLEG 3LDQA 1T3VA 4H0XB 3I55N 2V51B 5JVHL 4PKHA 4BRPA 3EZWA 1ZXOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BUZ B;  1XQS C;  2I7P A;  5AQP A;  4Y0W A;  3QBX A;  4AM6 A;  3CJ1 A;  4LC9 B;  4O8K A;  2E88 A;  1WUA A;  3VEZ A;  4BRG A;  3QML A;  1C0F A;  4FPB A;  4B1V A;  1BUP A;  2FF3 B;  1HLU A;  5E84 A;  2IVN A;  1YAG A;  2VCP A;  3ZX3 A;  2GEM A;  3EO3 A;  4BVO A;  2F9W A;  5ELZ A;  4FL9 A;  3C0B A;  4CZF A;  4BRA A;  5AZJ A;  1OKJ A;  3MN5 A;  5FPM A;  2Q0U A;  5AQR A;  3GL1 A;  3BP8 A;  3UB5 A;  5ADX A;  4BRM A;  1E4F T;  5FPD A;  3A5L C;  3U8X A;  4BRD A;  2QWM A;  1ESV A;  3CQY A;  5AQT A;  4B1U B;  4DCH A;  3MK6 A;  3QFU A;  4XH1 A;  4NB4 A;  4RCH A;  3M1F A;  4WQ5 A;  4YDU A;  5AQY A;  4CZI A;  4QS8 A;  4B1Y B;  3LDL A;  3WT0 A;  2ITM A;  4FWK A;  1E4G T;  1H1V A;  3WXI A;  4PL7 A;  4BG9 A;  3VEO A;  1Z6R A;  3O1B A;  4A2A A;  2ZF5 O;  3CET A;  5EY4 A;  4BRE A;  3GBT A;  4CJ7 A;  2V52 B;  1BU6 O;  1D4X A;  1HKC A;  5AZI A;  3WQU A;  4EHU A;  2D0P A;  2VWB A;  4J8F A;  3ULE A;  3VF2 A;  4BRK A;  3MMV A;  3ZEU A;  3MN9 A;  1BOT O;  3WXK A;  1NGA A;  1S3X A;  3D2E B;  1DKG D;  5AQK A;  5AQG A;  4PL8 A;  4BRN A;  3FZL A;  4H5V A;  2E1Z A;  3EN9 A;  3KHY A;  1EQY A;  2IVP A;  4JAX A;  4NO7 A;  3ID8 A;  2CH5 A;  4BR5 A;  1BA0 A;  1YVN A;  1JCF A;  1CZA N;  3LDO A;  2P9P A;  2UYT A;  4JHD B;  3IMX A;  5AQV A;  3VEX A;  3WXJ A;  3H1V X;  2D1K A;  4DB3 A;  5AR0 A;  1G99 A;  3UKU A;  5JLF A;  3UKR B;  2ASO A;  3H3O B;  3I8B A;  3EKS A;  3SLC A;  3VET A;  1KAZ A;  1HX1 A;  3DXK A;  2V7Y A;  1DGK N;  4IZ9 A;  1ZBS A;  3A5M C;  3VEV A;  3WQT A;  3VER A;  3QFP A;  4BC2 A;  3ZET A;  1ATR A;  4BRL A;  3WUH A;  1SQK A;  4BRH A;  2IVO A;  2Q36 A;  4CBU A;  4HWI A;  1P8Z A;  2Q97 A;  2QWQ A;  2QM1 A;  3HM8 A;  4PKG A;  4DHY A;  1JCE A;  2CH6 A;  2BUP A;  2E1Y A;  4GY2 B;  3WEE B;  4B9Q A;  4BRO A;  4M63 C;  4JNE A;  3DXM B;  3U9D A;  1RDW X;  2FSJ A;  2ASM A;  4XEI A;  4EHT A;  5EVZ A;  4CZE A;  4H0V B;  2ASP A;  3D2F B;  4ISG A;  3C7N B;  3JS6 A;  3VEY A;  4I6M B;  1QHA A;  1DEJ A;  3U4L A;  2PBD A;  5JMV A;  1Y64 A;  2P9K A;  3H45 C;  4CZM A;  2P9U A;  4Z94 A;  2P9N A;  1KXP A;  3EKU A;  4WQ4 C;  3TU5 A;  2YHY A;  3VGL A;  4B1X B;  2P9L B;  4XH4 A;  4AM7 A;  1KAY A;  5TKY A;  4M7X A;  3SJH A;  5AQO A;  3FE1 A;  2QWP A;  1HKB A;  4H0Y B;  4A62 A;  2AA4 A;  4BR9 A;  4BR2 A;  3KZB A;  1WOQ A;  2Q1N A;  4FWO A;  2FF6 A;  4B1Z A;  2GEL A;  2ZGY A;  3MDQ A;  4BRF A;  4CBX A;  4A2B A;  2E8A A;  3A8Y A;  2QWN A;  2QW9 A;  5F2R A;  1HKG A;  1K8K A;  1NBW A;  2FXU A;  3CJ7 A;  4CZK A;  2QWL A;  2PAV A;  2KHO A;  2YJF A;  3AAP A;  5KQD A;  4CZL A;  3H1Q A;  5B8H A;  5BR9 A;  5EX5 A;  2NLX A;  5E26 A;  3BEX A;  5AQI A;  3VOV A;  4JN4 A;  1MWM A;  1YUW A;  1RFQ A;  2QWO A;  3FZK A;  5AQS A;  5AZJ B;  1TYQ A;  3VEW A;  3ATV A;  2ZGZ A;  4IJA A;  1V4T A;  1ATS A;  4CZG A;  2ZWH A;  2HF4 A;  1NGJ A;  3CER A;  3LM2 A;  3HBT A;  5AQF A;  4DQ8 A;  3FZF A;  4BRQ A;  5EXW A;  3I33 A;  1LCU A;  3O8M A;  3CJB A;  3U9Z A;  4C23 A;  1NGB A;  4FO0 A;  2CGL A;  4FWS A;  2QWR A;  2P9S A;  1QZ6 A;  1NGE A;  4CD3 A;  1BO5 O;  2Q2R A;  1J6Z A;  1TUU A;  3W3D A;  1TYQ B;  2YJE A;  4EAH D;  4F9O A;  5AQU A;  4QS7 A;  3VES A;  3CJA A;  2EWS A;  4IXC A;  4EFH A;  5BPN A;  3LDP A;  3TPQ A;  5AFU H;  3F9M A;  1NGF A;  4FWL A;  5AZI B;  4E1J A;  2A6A A;  5KPZ A;  3VPZ A;  3LL3 A;  3MCP A;  3ULE B;  4O5F A;  4BC5 A;  4MLE A;  2D0O A;  3ZEU B;  1U2V A;  4FWM A;  2CGJ A;  1GLC G;  1QQN A;  4H0P A;  1NM1 A;  4JD2 A;  3KVG A;  4CZH A;  3UE5 A;  1QQO A;  1BWF O;  4H5R A;  3HTV A;  4BC4 A;  4ISF A;  3O80 A;  2P9P B;  4K42 A;  1NGI A;  4H0T B;  3VGK A;  4BGB A;  5BRE A;  4MO4 A;  3JXU A;  2BTF A;  3GG4 A;  4CI6 A;  5CE3 A;  1Q18 A;  1SAZ A;  3CI5 A;  3UKU B;  1TUY A;  1YXQ A;  2P9I A;  2YHX A;  2GWJ A;  1NMD A;  5AFU A;  5LJV A;  1X3N A;  3SMS A;  4IWV A;  1GLA G;  2YHW A;  3M3Z A;  1MWK A;  1NGC A;  1KAX A;  2HF3 A;  1RGI A;  2H3G X;  4K41 A;  3DXK B;  2YI1 A;  4QS9 A;  5BN8 A;  1MA9 B;  3BF1 A;  2GWK A;  2E2Q A;  3QIC A;  1C0G A;  1ZC6 A;  4RWT A;  2YCH A;  3SMP A;  3ZET B;  3FFK B;  2W41 A;  3L6Q A;  5FPN A;  3HI0 A;  5AQZ A;  1HPM A;  2FSN A;  2WUS A;  5AQL A;  4H03 B;  4WQ5 C;  1X3M A;  4YDU C;  4BR0 A;  3IUC A;  3P4I A;  3SK3 A;  1MDU B;  3CHW A;  2F9T A;  2E20 A;  2A42 A;  3MN6 A;  4PKI A;  5BPM A;  5BRH A;  1BA1 A;  1GLB G;  4ISE A;  2Q31 A;  1T44 A;  3AY9 A;  1HUX A;  4HTL A;  3ATU A;  4CBW A;  2D4W A;  3GDQ A;  1Z05 A;  1T6C A;  4BC3 A;  5BPL A;  2E2P A;  3FLC O;  1X9J A;  3DJC A;  3ZX2 A;  4BVP A;  3FGU A;  3OHR A;  2P9K B;  2A41 A;  4BG8 A;  2P9U B;  2P9N B;  4KBO A;  3DWL A;  3A5N C;  4B1W B;  1QZ5 A;  4CZJ A;  1NGG A;  3QDK A;  1XUP O;  3LDN A;  4H5N A;  4CD1 A;  3FR0 A;  2A5X A;  3IFR A;  4A61 A;  2Q0R A;  3RSE A;  3ENO A;  3W0L A;  1GLF O;  1V4S A;  2FLO A;  3R8E A;  3BF3 A;  2V7Z A;  1XC3 A;  2GUP A;  4MO5 A;  5AQN A;  3VEN A;  5I9E B;  3M6G A;  3DAW A;  4H5T A;  4RTF D;  1K8K B;  2A40 A;  1BG3 A;  3VGM A;  3IDH A;  3R9P A;  3QB0 A;  1LOT B;  4XH5 A;  4EIA A;  5AQM A;  2HOE A;  4BR4 A;  4BRI A;  4WQ4 A;  5AQW A;  3RSE B;  3O1W A;  3GE1 A;  2NZT A;  3D2E A;  4BR7 A;  4M7Y A;  4GNI A;  5KQ8 A;  4FWP A;  2VYP A;  2IIR A;  5BN9 A;  5AQH A;  4BGA A;  4WYB A;  2QXL A;  3S41 A;  2CGK A;  2E2N A;  1SZ2 A;  3A5O C;  3J8A A;  4JHD A;  3EL2 A;  1IJJ A;  3H46 O;  3LM9 A;  4BQL A;  1NGD A;  4FWN A;  4H5W A;  4BRC A;  3L0Q A;  3UKR A;  1QQM A;  5LY3 A;  3G25 A;  3O08 A;  3VF4 A;  5KPR A;  2GTD A;  5AQJ A;  3ENH A;  2P9S B;  1IG8 A;  3D7E O;  5BRD A;  1BDG A;  2AP1 A;  4H0O A;  2NRH A;  3ZX0 A;  5AQQ A;  3MN7 A;  4IO8 A;  3FZM A;  2J4R A;  3R6M A;  3AAQ A;  3FZH A;  1NWK A;  2DPN A;  2HMP A;  5LJW A;  2A3Z A;  5KPT A;  1U2V B;  3O4W A;  3CJ9 A;  4IJN A;  2I7N A;  1NGH A;  3CIP A;  4FSV A;  1HJO A;  1ATN A;  4JD2 B;  5BRF A;  1T6D A;  3HZ6 A;  3CJC A;  3WEE A;  3DXM A;  4FOI A;  3H6E A;  4K25 A;  5F1X A;  1GLJ O;  4FPA A;  1R59 O;  3GOI A;  3AAR A;  3D2F A;  4FWQ A;  5JIC A;  3C7N A;  4I6M A;  5EOY A;  3H3N O;  1S22 A;  2W40 A;  3O6W A;  3WXL A;  2P9I B;  4K43 A;  4MLH A;  5AQX A;  2P9L A;  5JLH A;  3CQX A;  1GLL O;  1U6Z A;  3B8A X;  4L3Q A;  3VF6 A;  2FSK A;  4FWR A;  5FPE A;  3L4I A;  5F0X A;  2E2O A;  1GLD G;  3O5B A;  3QBW A;  4BQZ A;  1NLV A;  2OAN A;  4FOE A;  3A0I X;  1JCG A;  3HSC A;  5ADX H;  1GLE G;  3LDQ A;  4H0X B;  2V51 B;  4PKH A;  4BRP A;  3EZW A;  1ZXO A; 
#chains in the Genus database with same CATH topology
 5GIP A;  1XQS C;  4HUG A;  4GKJ K;  3ZSZ A;  4M3R A;  4Z4G A;  1F21 A;  1WUA A;  1YF5 L;  3VEZ A;  1CZ9 A;  4FJJ A;  1LAW A;  4IG3 A;  4KB1 A;  4LF6 K;  4WFN L;  4DSE A;  3PIO L;  5SZT A;  2IVN A;  2VCP A;  3ZX3 A;  4FL9 A;  3C0B A;  4CZF A;  4BRA A;  2KFZ A;  2Q0U A;  4CJ5 A;  2FBX A;  4YFU A;  4JK8 A;  4BRM A;  3AVN A;  1L3V A;  4IKF A;  4G1Q A;  4BRD A;  4DCH A;  2P5G A;  3MK6 A;  4B9M A;  4WQ5 A;  4NLC A;  4YDU A;  5AQY A;  1S1W A;  5E41 A;  1ZBH A;  3RWU A;  1RNH A;  3LDL A;  3OYJ A;  4C8O A;  1SUQ A;  2ITM A;  1EXQ A;  4LFC K;  4PL7 A;  4BG9 A;  4OKK A;  3G71 N;  4CFD A;  1D9F A;  1KFD A;  3O1B A;  2NRR A;  3NMU A;  3O9T A;  3I8D A;  1N8R O;  2UXC K;  2OTL N;  5M1O A;  1BU6 O;  1D4X A;  1QE1 A;  5AZI A;  4ILG B;  2D0P A;  4J8F A;  3ULE A;  5CZ2 A;  4DV4 K;  1Q8I A;  3MN9 A;  1BOT O;  2DFH A;  4PHT X;  2GX9 A;  3D2E B;  4CEZ A;  4CJW A;  4M3U A;  3AO1 A;  4H5V A;  1VQP N;  5A2Q O;  1EQY A;  4HVJ A;  4NCB A;  2CH5 A;  5M1N A;  2ETJ A;  3ZT1 A;  4JHD B;  3VQA A;  3VEX A;  4DV3 K;  3THY B;  5TKW A;  1RDC A;  3H1V X;  3WXJ A;  1TKT A;  3E1Y A;  4PWD A;  3HOT A;  4CJU A;  1X9W A;  1TV6 A;  3PUF A;  3U3G A;  4W5T A;  3EKS A;  1XHX A;  4KFB A;  3SLC A;  3KK1 A;  1ZBF A;  3QEV A;  1ASU A;  1ZBS A;  4GMJ B;  3VEV A;  1NKE A;  3VER A;  3HVT A;  2XY8 A;  4BC2 A;  3ZET A;  1RDB A;  4MDA A;  3J80 O;  4BRL A;  3WUH A;  1SQK A;  3T1Y K;  5HOO A;  1QQC A;  3AO4 A;  2ZD1 A;  3KK2 A;  1Q9X A;  2DFE A;  4JKD A;  5HRS A;  4KAZ A;  1RBU A;  2LSN A;  2QM1 A;  1SS6 A;  1JCE A;  2CH6 A;  3T19 A;  4Z4C A;  4E7H A;  4CJT A;  4W5R A;  4E7I A;  3LPT A;  4GY2 B;  4B9Q A;  4LD0 A;  1U49 A;  3VQD A;  3TAB A;  2BDP A;  4DQS A;  4XEI A;  4QOZ B;  4A57 A;  2ASP A;  4ISG A;  1NKC A;  4I6M B;  3U4L A;  1Y64 A;  1K6Y A;  3P38 A;  4HUF A;  4CZM A;  4IDH A;  2P9U A;  3AVA A;  3SAF A;  3TU5 A;  4A5A A;  3P1G A;  3K5L A;  4FJN A;  4EP4 A;  5AQO A;  4H0Y B;  4A62 A;  4BR2 A;  3KZB A;  5M1Q A;  1WOQ A;  2Q1N A;  2FF6 A;  4CJV A;  1VQ6 N;  4GV9 A;  5BR8 K;  4FJK A;  3A8Y A;  2QWN A;  1NG9 A;  2PZS A;  2QW9 A;  1U45 A;  3SV4 A;  4DU3 A;  1K8K A;  4FJ8 A;  4CZK A;  2PYJ A;  2YJF A;  1HNI A;  3BY5 A;  1KLN A;  2Z1G A;  4CZL A;  5B8H A;  3TAE A;  4HUE A;  1L5U A;  3ZT3 A;  4DSK A;  1RFQ A;  3FZK A;  1NJI O;  4FZY A;  2VQF K;  4OO1 J;  2ZGZ A;  1NK4 A;  2NNW A;  3MX5 A;  3AO5 A;  5GAH P;  1V4T A;  3K57 A;  1ATS A;  4GV3 A;  4N76 A;  2JLE A;  3VQ8 A;  4KKO A;  3I33 A;  2X6N A;  1NK5 A;  3AVJ A;  3CJB A;  3U9Z A;  3I56 N;  2B5J A;  2F7T A;  1NK8 A;  3QO9 A;  3NF6 A;  2CGL A;  2QWR A;  3OS0 A;  3V1O A;  3W3D A;  3SYZ A;  4AQY K;  1VSK A;  1C0M A;  5AQU A;  1T7P A;  1HYV A;  4JI4 K;  4IXC A;  5BPN A;  4DS5 A;  3KLE A;  3F9M A;  1NGF A;  5KPZ A;  1I3A A;  1SL1 A;  3MCP A;  4O5F A;  3JSM A;  3LZJ A;  4ZTF A;  1U2V A;  2WTU A;  2CGJ A;  2I5J A;  2KLA A;  4O8U A;  1VK0 A;  3UE5 A;  3SUO A;  4BE2 A;  1X9S A;  3AO2 A;  3BZC A;  4BGB A;  1KC8 O;  5BRE A;  4MO4 A;  3QEW A;  5CE3 A;  3PX0 A;  3AVL A;  3CI5 A;  1TUY A;  1YXQ A;  3OBY A;  5LJV A;  3OTO K;  1X3N A;  2RN2 A;  4IWV A;  1GOB A;  1NGC A;  2HF3 A;  4K41 A;  4JI2 K;  4CFB A;  2XY7 A;  2YI1 A;  4BE0 A;  1MA9 B;  4FLZ A;  4FJL A;  2E2Q A;  5CZ1 A;  3AVI A;  4CGI A;  2YCH A;  4WFA L;  2W41 A;  5JVG L;  3HI0 A;  4ILH A;  1HPM A;  4AHS A;  4JI0 K;  5AQL A;  1X3M A;  3EE8 A;  2XO7 A;  4J2B A;  1J5O A;  5J2N A;  3IUC A;  3P4I A;  3HPH A;  4CHY A;  4ICL A;  4IEE A;  1VRU A;  3MN6 A;  3T3F A;  4KB0 A;  4ISE A;  1GLB G;  2YHA A;  4DQP A;  1HUX A;  4K0K K;  4Y1C A;  3V9Z A;  2HHS A;  1T6C A;  5BPL A;  2E2P A;  4PY5 A;  4BVP A;  1HJR A;  4AHV A;  3OYG A;  1MU2 A;  1HNZ K;  2PYL A;  1KFS A;  3VQP A;  3DWL A;  4CGD A;  3BGR A;  1TAQ A;  1VAZ A;  3OW2 M;  3CCJ N;  2HND A;  3W0L A;  3MEG A;  5CHI A;  3ASM A;  2FLO A;  3O3G A;  3DLH A;  2V7Z A;  2GUP A;  5AQN A;  4LY7 A;  1DT9 A;  3MAQ A;  1D8Y A;  4IFV A;  4H5T A;  4RTF D;  1JLE A;  2A40 A;  3O9U A;  2IGI A;  4NLB A;  4B9S A;  4G9Z A;  3ZLJ A;  5LMN K;  3C6A A;  4CGG A;  2OZS A;  3QIO A;  4I7F A;  4HHT A;  4WQ4 A;  3CFO A;  1U4B A;  1J54 A;  4PUO A;  4LSN A;  4M7Y A;  4GNI A;  2O8B A;  3WNF A;  5AQH A;  4BGA A;  4CJE A;  4FJH A;  4WYB A;  2UUC K;  3S41 A;  4Z4E A;  2E2N A;  1T03 A;  1Q86 O;  1VQK N;  1XWL A;  1FKO A;  1NGD A;  3HP9 A;  4H5W A;  2Y1J A;  4BRC A;  3UKR A;  3ZT4 A;  2O8D A;  2GTD A;  1RT1 A;  1IG8 A;  3VQ7 A;  3SQ4 A;  3D7E O;  2O8F B;  3C6U A;  5BRD A;  1SL2 A;  5GIN A;  2AP1 A;  4H0O A;  2HST A;  2VWK A;  4CJS A;  3K9K A;  4IO8 A;  3WNH A;  4XIU A;  3THW B;  3TSP A;  1C6V A;  3AAQ A;  4CFA A;  4AHR A;  3FZH A;  1NWK A;  3HT3 A;  1A5W A;  2F8S A;  3I0R A;  1FJG K;  2A3Z A;  4CFC A;  5KPT A;  3O4W A;  3CJ9 A;  2I7N A;  3DM2 A;  3CCQ N;  1L3S A;  1ATN A;  1T6D A;  3CJC A;  4CEE A;  1S1U A;  1WN7 A;  5GAE P;  4YOV A;  1HYZ A;  3H6E A;  4K25 A;  4DSF A;  1O1W A;  3CC7 N;  2VG7 A;  3AAR A;  4I2P A;  3C7N A;  3NH2 A;  3OYF A;  3SQ1 A;  1KCF A;  1S22 A;  5LMU K;  1RDU A;  3C6H A;  3DLG A;  5KGW A;  5AQX A;  4W5Q A;  5FPE A;  1JLF A;  3IG1 A;  4FOE A;  1JCG A;  4RW4 A;  3JYT A;  4LFA K;  3LDQ A;  4E89 A;  3OY9 A;  3I55 N;  3LAN A;  3BUZ B;  3TTD A;  4X65 K;  5AQP A;  4Y0W A;  4YOX A;  3TAP A;  3QBX A;  4AM6 A;  3CJ1 A;  4LC9 B;  3L3U A;  4JI6 K;  3PIP L;  3AVM A;  4GV6 A;  3T7Z A;  1FK9 A;  3QML A;  1C0F A;  4B1V A;  4Z4H A;  4JK9 A;  1HLU A;  3V1R A;  5E84 A;  4JI3 K;  1W97 L;  4DV6 K;  3CCU N;  2GEM A;  3QNO A;  3AVF A;  3AVG A;  5D3G A;  4FW1 A;  1OKJ A;  3K58 A;  1TKZ A;  3MN5 A;  4DSI A;  1Q9Y A;  5AQR A;  3GL1 A;  1WSE A;  3BP8 A;  1JLC A;  3O4Q A;  3U8X A;  1QS4 A;  4DFM A;  1ESV A;  4OKJ A;  4FLX A;  4DF8 A;  3M1F A;  3DLE A;  2BE2 A;  2NRW A;  1XMO K;  4CHZ A;  3DYA A;  4CZI A;  4Q5V A;  3NF9 A;  4JI5 K;  1BIZ A;  1ASW A;  3ZT2 A;  3PX6 A;  4ELU A;  1RTH A;  5K14 A;  1S5J A;  1VRT A;  2BAN A;  3TAG A;  2WOM A;  3TSQ A;  3CET A;  1C1C A;  1QHT A;  1RTD A;  4CJ7 A;  1I94 K;  2IS3 A;  2P1J A;  1NJY A;  4PA1 A;  4KH6 A;  4NCA A;  1M1K O;  4B3M K;  5HRP A;  3MMV A;  4FJI A;  4I9Q A;  4JV5 K;  2YNG A;  1S3X A;  2NRX A;  4JKG B;  4KHU A;  5SWM A;  3SUQ A;  2E1Z A;  1R0A A;  1OH7 A;  3KHY A;  2IVP A;  4NO7 A;  4B8A B;  3ID8 A;  1BA0 A;  1Q81 O;  3KLF A;  4B3R K;  1CZA N;  5T7B A;  3HP6 A;  5AQV A;  3IMX A;  1VQ8 N;  1GOC A;  2D1K A;  4H8K A;  2ATQ A;  1SKW A;  1G99 A;  1REV A;  5DMR A;  3I8B A;  4OKE A;  3NBP A;  4LF4 K;  3AA5 X;  3VQ5 A;  3BDP A;  4DLE A;  3CFR A;  3RR8 A;  1DGK N;  4IZ9 A;  1OVY A;  3A5M C;  4I9L A;  1LW0 A;  3WQT A;  1B9D A;  4M42 A;  2HVH A;  4OPA A;  1IKY A;  1ATR A;  3MX2 A;  3L2V A;  4FYD A;  1Y97 A;  3DMJ A;  4CBU A;  3HST B;  3NH0 A;  1P8Z A;  2X78 A;  4CER A;  4DHY A;  1BI4 A;  3AV9 A;  2E1Y A;  4E1M A;  4CGF A;  4H4M A;  3U9D A;  3PSI A;  4FVM A;  1XMQ K;  3HM9 A;  4CHN A;  3LP0 A;  1YJW N;  4CZE A;  2O4I A;  3RMD A;  3NH1 A;  3Q7B A;  4IDK A;  1QHA A;  1DEJ A;  2OPQ A;  2PBD A;  5JMV A;  2KW4 A;  4O44 A;  4N5S A;  3VA3 A;  4F3T A;  1KXP A;  4KO0 A;  3EKU A;  4ELT A;  3VGL A;  4B1X B;  4FLW A;  1FKP A;  2P9L B;  3THX B;  2KZZ A;  5TKY A;  1HKB A;  1TK8 A;  1HRH A;  4BR9 A;  1RTJ A;  3C95 A;  4OX9 K;  4B1Z A;  2GEL A;  4X62 K;  4AH9 A;  3SBT A;  4CBX A;  5FDL A;  3LZI A;  2E8A A;  4FM1 A;  3EE9 A;  5HL7 L;  3CPE A;  4YOU A;  2QKB A;  1HKG A;  2Z1J A;  1TGO A;  1RBV A;  4B9N A;  2QWL A;  4B3T K;  3RMB A;  3ID6 A;  4DTM A;  4B9T A;  5EX5 A;  2QA4 N;  3R1X A;  5E26 A;  2OPR A;  4KPY A;  1MWM A;  2ZE2 A;  5AZJ B;  5AQS A;  3CPW M;  3CCS N;  1BIS A;  3VEW A;  4F3O A;  3N4P A;  3OS1 A;  3QET A;  1YJN N;  1NOZ A;  1XHZ A;  4KTQ A;  4DUY K;  4QAG A;  1W7A A;  3FZF A;  4BRQ A;  3KK3 A;  3MED A;  1NK0 A;  1RT3 A;  3CG7 A;  4BDZ A;  4CGH A;  3HJF A;  4C23 A;  2YV0 X;  3CCV N;  2D0C A;  2P9S A;  1NGE A;  2X6S A;  4CD3 A;  1BO5 O;  4CEQ A;  1TUU A;  5H1S Q;  4F9O A;  4A59 A;  2O8E B;  1JLQ A;  2EWS A;  4E0D A;  1Z25 A;  5IWA K;  2G8H A;  3L4Q A;  3ISN C;  4DR5 K;  5AFU H;  3VPZ A;  3NGI A;  1BCM A;  2D0O A;  3ZEU B;  3N4Q A;  3QES A;  1GLC G;  3DRR A;  1QQN A;  3KKS A;  1NM1 A;  5M1K A;  1QQO A;  3R3L A;  4WE1 A;  1BWF O;  4H5R A;  4LF7 K;  3L3V A;  3HTV A;  4OPH A;  4O0I A;  4DR4 K;  1OH6 A;  2P9P B;  4KI4 A;  4H0T B;  5J2P A;  4JRQ A;  4JKH A;  2UUB K;  3MXM A;  2YHB A;  4EP5 A;  3UKU B;  1HR0 K;  1JLB A;  1WAF A;  1VSL A;  2P9I A;  3SMS A;  1VQ7 N;  1GLA G;  3M3Z A;  3OYA A;  1NK7 A;  1MWK A;  4FK4 A;  1KAX A;  4KI6 A;  1RGI A;  2H3G X;  2AJQ A;  3AVB A;  3DXK B;  4QS9 A;  3V81 A;  2HHQ A;  1RBT A;  3HPG A;  1QTM A;  2VWJ A;  4RWT A;  3SMP A;  3L6Q A;  3ZSQ A;  1ILY A;  5FPN A;  5AQZ A;  4DR2 K;  1L3U A;  2WUS A;  4FW2 A;  2OYQ A;  1BHL A;  5HRN A;  2RF2 A;  4W5O A;  1MDU B;  1ITG A;  3CHW A;  2F9T A;  3OYN A;  4PKI A;  5BPM A;  5BRH A;  3OYE A;  2Q31 A;  3TAM A;  3HXM A;  3AO3 A;  3ZSR A;  3GDQ A;  1Z05 A;  2HW3 A;  4BC3 A;  1IV0 A;  3NHG A;  4FLY A;  3FLC O;  2FBT A;  1X9J A;  3NCI A;  3CCE N;  1LAV A;  5FRN A;  1VQN N;  4ID1 A;  1RDD A;  3OHR A;  1NU0 A;  2P9K B;  4BG8 A;  2P9N B;  2ITG A;  4B1W B;  3A5N C;  5DM7 L;  3QDK A;  3CCM N;  4DUZ K;  4H5N A;  4NXM K;  1T8E A;  4BWJ A;  2A5X A;  1RDA A;  4JKE A;  3HPO A;  5AJ3 K;  2WON A;  2HHV A;  2NRV A;  3BF3 A;  1QSS A;  1W2B M;  3HL8 A;  4KH5 A;  3ZYY X;  3VEN A;  1GOA A;  4DFP A;  4CJF A;  1BL3 A;  3VGM A;  3R9P A;  1CZB A;  1NJX A;  3MCA B;  4KTZ A;  1C0T A;  4KHN A;  2HOE A;  2O4G A;  4MQ3 A;  1S1X A;  4M3T A;  4BRI A;  3CM5 A;  5M1F A;  4KTW A;  1WSH A;  4DF4 A;  3DRS A;  2NZT A;  1P90 A;  3D2E A;  4B08 A;  4JYA K;  2IIR A;  3AA4 A;  3Q7C A;  2OPS A;  3PO5 A;  4DTJ A;  5KRT A;  1SZ2 A;  4C8N A;  4OPK A;  3J8A A;  3E66 A;  4JHD A;  1IJJ A;  3THY A;  3H46 O;  3L2Q A;  1XNQ K;  4JRP A;  1QQM A;  4TSX A;  3G25 A;  3O08 A;  3VF4 A;  3V9W A;  4F4K A;  3PLA A;  3MEE A;  5LL6 Z;  2YNI A;  3V6D A;  4BDP A;  4UY8 O;  1W0H A;  3G6E N;  2VQE K;  3VTH A;  4F2R A;  1YT3 A;  2NRH A;  3WXM B;  3ZX0 A;  2RHK A;  3SUP A;  5IT9 O;  3MN7 A;  3SI6 A;  4HCB A;  3FZM A;  1BQN A;  3R6M A;  3VN5 A;  3SQ2 A;  1YIJ N;  4CE9 A;  3KWI A;  4KHY A;  1LW2 A;  3M8P A;  3C6T A;  3TTF A;  4IJN A;  2D5R A;  1L3T A;  2IAJ A;  4CEB A;  2Q3S A;  4JD2 B;  4Z0U A;  1N6Q A;  1LWF A;  2HNY A;  2G8W A;  4M45 A;  1IH7 A;  4JLH A;  5I42 A;  2KKZ A;  4GKK K;  1WNS A;  4FPA A;  3K5O A;  2QK9 A;  3GOI A;  3OS2 A;  2GBZ A;  3OYB A;  4I6M A;  1WLJ A;  3U3Y A;  1X1P A;  1IO2 A;  3H3N O;  3EY1 A;  2Z1H A;  4FLV A;  4CJQ A;  4K43 A;  4B3O A;  3K5N A;  3V9S A;  4L8R B;  4K8X A;  3QIN A;  1JKH A;  2FSK A;  5KRS A;  3SPZ A;  1EP4 A;  3L4I A;  3TTC A;  3CMA N;  3QBW A;  4BQZ A;  4Z4F A;  2OAN A;  4JKB A;  2O8C B;  2VG5 A;  5ADX H;  2UXB K;  1TL3 A;  1T3V A;  2V51 B;  2QEX N;  3M8S A;  1ZXO A;  3EZ5 A;  3LP3 A;  2ZJQ L;  3CM6 A;  3V1Q A;  5FRM A;  4JKA A;  5C15 A;  2P5O A;  2E88 A;  3H08 A;  4BRG A;  5C24 A;  3NE6 A;  3J7A P;  2W6L A;  1BUP A;  1KTQ A;  2FF3 B;  2QKK A;  4Q0B A;  1UA1 A;  2F96 A;  3EO3 A;  4CJL A;  2F9W A;  5ELZ A;  2UXD K;  3OJS A;  5CR4 A;  4B9U A;  5FPM A;  2WBN A;  3RTV A;  3KD5 E;  3O9S A;  2FBY A;  1VSD A;  4E3S A;  2E6M A;  5GAD P;  3E9L A;  3CQY A;  5AQT A;  4B1U B;  3QFU A;  4XH1 A;  4NB4 A;  3ULD A;  1YTA A;  3K0S A;  3DOL A;  4GW6 A;  4BWM A;  3TR8 A;  1E4G T;  3WXI A;  1N36 K;  1Z6R A;  2XY6 A;  4A2A A;  1WBD A;  1VSF A;  5EY4 A;  3CC4 N;  4DSJ A;  3GBT A;  1B92 A;  3OYH A;  2YKN A;  4LSL A;  4FK2 A;  2V52 B;  4EHU A;  2VWB A;  4BRK A;  3KLG A;  3VQB A;  3CF5 L;  3WXK A;  1NGA A;  4YOW A;  4DU4 A;  5AQG A;  4PL8 A;  4BRN A;  4DTS A;  4FVU A;  3KLH A;  4GVE A;  1S6Q A;  4JAX A;  3AVC A;  1YVN A;  1JCF A;  3LDO A;  4M3W A;  2UYT A;  3RRG A;  4FZZ A;  5AR0 A;  3DOK A;  1HPZ A;  1EWR A;  3DI6 A;  3FFI A;  4CVN E;  4JKF A;  3VQ6 A;  3SUN A;  3H3O B;  2KTQ A;  3VET A;  4JI8 K;  1KAZ A;  2IC3 A;  1XI1 A;  3OYM A;  1HX1 A;  2V7Y A;  3PSF A;  3JAM O;  3HK2 A;  1UOC A;  2YKM A;  3CCL N;  4FJ9 A;  3QFP A;  3F5T A;  3EEQ A;  1QVG M;  3LP1 A;  3CME N;  2IVO A;  3I0S A;  3V9X A;  1SL0 A;  3NF8 A;  2HHU A;  1NKB A;  2Q36 A;  1S6P A;  2Q97 A;  2QWQ A;  1KRP A;  3V9U A;  3HM8 A;  4E1N A;  2BUP A;  4I2Q A;  1WSF A;  4DU1 A;  1JJ2 M;  4JKC A;  4ID5 A;  3WEE B;  3HOS A;  4M63 C;  2HBM A;  3DXM B;  4JEP A;  5KTQ A;  3CYM A;  4DTU A;  5EVZ A;  3D2F B;  3VEY A;  1RT6 A;  3H45 C;  3G0Z A;  1TK5 A;  1J53 A;  4Z94 A;  1RBS A;  2DFF A;  4XH4 A;  4AM7 A;  1N32 K;  3BZK A;  4M7X A;  2QWP A;  4KRE A;  4CEA A;  3A2F A;  1I39 A;  4FWO A;  5GAG P;  3QEI A;  3O3H A;  4N47 A;  3KTQ A;  2ZGY A;  4A2B A;  4YOY A;  4DV5 K;  1TK0 A;  3LWL A;  3CD6 N;  2XRI A;  5F2R A;  3NGZ A;  3KD1 E;  1KQS M;  2G8F A;  1E3M A;  5HRR A;  1NBW A;  2FXU A;  3CJ7 A;  4ZHR A;  1DTT A;  3HRG A;  4DR6 K;  3O3F A;  2PAV A;  2KHO A;  3M8R A;  5C42 A;  1VHX A;  4MFB A;  4CED A;  5KQD A;  5BR9 A;  2NLX A;  3BEX A;  4DKW A;  5AQI A;  5C25 A;  3IAY A;  3RMC A;  4OLB A;  5DM6 L;  1ZBI A;  1YUW A;  4O0J A;  1CXU A;  1TYQ A;  3QER A;  2ZWH A;  4A5B A;  2HF4 A;  4NYF A;  1NGJ A;  3CER A;  4BE1 A;  3LM2 A;  3HBT A;  4IG0 A;  4CJ4 A;  2HNZ A;  4YNQ A;  5EXW A;  1HNW K;  1LCU A;  3O8M A;  2EX3 A;  1QZ6 A;  3L2U A;  4JS5 A;  2O8F A;  1WAJ A;  2GV9 A;  4FM0 A;  1VQO N;  3PY8 A;  3IS9 A;  3THW A;  3S3O A;  2A1S A;  4FWL A;  5AZI B;  3HVR A;  1FW6 A;  4FM2 A;  3ULE B;  4CES A;  4WF9 L;  1YHQ N;  4C8K A;  4FWM A;  4FCY A;  1N34 K;  3KVG A;  1D9D A;  2HMI A;  3DRP A;  4CZH A;  2A1R A;  1WB9 A;  4F8R A;  1K9M O;  4M3X A;  4AF1 A;  4JI1 K;  3O80 A;  4K42 A;  1NGI A;  3VGK A;  3RVC A;  2BTF A;  4CI6 A;  2E4L A;  1SAZ A;  2EHG A;  4NYN A;  4DV1 K;  2YHX A;  1NMD A;  5AFU A;  2PY5 A;  2YHW A;  1WSG A;  2W42 A;  3F73 A;  3VQ9 A;  3DLL L;  5BN8 A;  1TVR A;  1ZC6 A;  1Z26 A;  3NGY A;  3TAN A;  2RKI A;  3ZET B;  3FFK B;  1SV5 A;  1N5Y A;  1KVA A;  4CEF A;  5FLX O;  4H03 B;  4WQ5 C;  4YDU C;  3D6R A;  3O9R A;  3OYK A;  2A42 A;  1O13 A;  1BA1 A;  1T44 A;  2G8V A;  3P5J A;  3HYF A;  3K9J A;  1N33 K;  2D4W A;  3P83 D;  3NVM A;  3NFA A;  3VQ4 A;  3DJC A;  3S3N A;  2A41 A;  4CF0 A;  4E7K A;  4UQG A;  2P9U B;  2DTU A;  1NGG A;  1XUP O;  5CY4 A;  3ALY A;  2R7Y A;  3LDN A;  4J2E A;  4CD1 A;  3FR0 A;  1K8A O;  4A61 A;  3RSE A;  4YOT A;  1QVF M;  3CFP A;  2E5L K;  1V4S A;  3O9Q A;  5JS1 A;  1XC3 A;  4MO5 A;  4OPJ A;  4DV7 K;  3M6G A;  3DAW A;  3LDS A;  3LAL A;  1S72 N;  1K8K B;  4KHW A;  1EWQ A;  3IDH A;  3LPU A;  4CEC A;  3SAG A;  3D0P A;  5J2M A;  5HRO A;  1LOT B;  2NRT A;  1VQM N;  1S1V A;  5AQM A;  4RW6 A;  4BR4 A;  4JI7 K;  3KKR A;  1RTI A;  3O1W A;  3OYL A;  3GE1 A;  3UIQ A;  3M8Q A;  2HHH K;  1UAX A;  3KWG A;  4JKG A;  3SAH A;  4IBN A;  2VYP A;  5BN9 A;  1LWC A;  4BDY A;  3SZ2 A;  4RW8 A;  1D5A A;  1ZBU A;  3A5O C;  1A5V A;  4CIG A;  3CXC M;  1VSE A;  2D0B A;  3LM9 A;  4FZX C;  4BQL A;  4FWN A;  3L0Q A;  1IBM K;  4DWI A;  3C65 A;  5KPR A;  5AQJ A;  5CYM A;  1U04 A;  3TAR A;  4FK0 A;  5KGX A;  4DQQ A;  3OBW A;  3QLH A;  5HBM A;  3RMA A;  1JL2 A;  2J4R A;  1DLO A;  2ZJP L;  3LP2 A;  3KJV A;  1HNV A;  3ZSY A;  2DPN A;  2HMP A;  5LJW A;  1TKX A;  3AA3 A;  3RRH A;  1U2V B;  3G10 A;  4M3Z A;  1NGH A;  1S9G A;  3KLI A;  1HJO A;  2KFN A;  1YI2 N;  1C1B A;  5C2F A;  1VSJ A;  4IFY A;  5GIO A;  2RE2 A;  2QI2 A;  4C1N K;  4FOI A;  5HLF A;  1SKR A;  4B3S K;  4NCG A;  1R59 O;  3VTI A;  1CXQ A;  5CYQ A;  4CHP A;  1FXX A;  5JIC A;  4KH4 A;  2D0A A;  3DLR A;  2W40 A;  3O6W A;  5MLC Q;  1YJ9 N;  2P9L A;  1KVB A;  3CQX A;  3THX A;  3B8A X;  2KQ2 A;  3QEX A;  4FWR A;  5F0X A;  3O5B A;  5C2D A;  3G4S N;  2HHT A;  1KSP A;  1EX4 A;  3A0I X;  3HSC A;  4B9L A;  1NJW A;  1YIT N;  1TKD A;  1EKE A;  4H0X B;  5JVH L;  5FPD A;  1QSY A;  3EZW A;  2I7P A;  1DTQ A;  5C0Y A;  4O8K A;  3WNG A;  1RT7 A;  1VQ4 N;  4FPB A;  3QIP A;  3NVK A;  1YAG A;  3MWP A;  3D45 A;  4BVO A;  4CF2 A;  1IKW A;  4FLT A;  1BQM A;  5AZJ A;  3ZSW A;  4DLG A;  1RT5 A;  1TL1 A;  2OZM A;  3DLK A;  1UWB A;  4DTR A;  3UB5 A;  4CHQ A;  5ADX A;  4ZTJ A;  1E4F T;  4C1N I;  3A5L C;  3KIO A;  2QWM A;  2W6K A;  1RBR A;  3VA0 A;  1S1T A;  4DSL A;  4RCH A;  4CCH A;  1K73 O;  4QS8 A;  4B1Y B;  3WT0 A;  4FWK A;  1H1V A;  4E7L A;  2UU9 K;  1B9F A;  2P51 A;  4V19 S;  4GVM A;  3VEO A;  2KZM A;  3M5R A;  1J5E K;  2ZF5 O;  5J2Q A;  4H4O A;  2O8E A;  3QEP A;  4HCC A;  1VSH A;  3SJJ A;  4BRE A;  2RPI A;  3WQU A;  1HKC A;  4PQU A;  4IFE A;  1J9A A;  2XY5 A;  3VF2 A;  1IBK K;  3F2K A;  3ZEU A;  1HNX K;  4RW9 A;  3E9P A;  4DV2 K;  1DKG D;  5AQK A;  4C8L A;  3OA9 A;  2O8B B;  3FZL A;  3EN9 A;  3O4N A;  3IRX A;  1Q82 O;  4BR5 A;  2ZJR L;  4CJ3 A;  1XNR K;  2P9P A;  1U48 A;  4DB3 A;  2OPP A;  1JLG A;  3MEC A;  2YX6 A;  3UKU A;  5JLF A;  3UKR B;  2QXF A;  2ASO A;  1RCH A;  3VMF B;  3TWH A;  2O8D B;  4K8Z A;  4JS4 A;  4OJR A;  3SV3 A;  2ZQB A;  3LAK A;  2FC0 A;  1WBB A;  2F4V K;  1HMV A;  4CF1 A;  3DXK A;  3CQ8 A;  3IKM A;  2G8K A;  2G8U A;  3S9H A;  3J81 O;  4DFJ A;  4F2S A;  1CLQ A;  4BRH A;  4CF9 A;  1NOY A;  4DQI A;  2OCE A;  1IKV A;  3SPY A;  1WSJ A;  4DR7 K;  4HWI A;  2JWK A;  1UA0 A;  4PKG A;  3SQ0 A;  1RIL A;  1VSM A;  3ITH A;  4BRO A;  4J2D A;  4JNE A;  1S9E A;  4YHH K;  4R79 A;  3ZT0 A;  1RDW X;  2FSJ A;  4LFB K;  2ASM A;  1VQ5 N;  4FJG A;  4EHT A;  3QNN A;  4IOC L;  4H0V B;  3C7N B;  3JS6 A;  3WNE A;  4YY3 K;  2P9K A;  5M1P A;  5EU7 A;  4AIL C;  1BCO A;  1IBL K;  3P39 A;  4IOX A;  2P9N A;  4WQ4 C;  1QSL A;  2YHY A;  1KAY A;  2NRZ A;  1A5X A;  3HO1 A;  1M90 O;  3SJH A;  3FE1 A;  2UUA K;  3TAQ A;  2AA4 A;  4HTU A;  3VQE A;  4LF5 K;  4IOA L;  1ZBL A;  3MDQ A;  3AVK A;  4BRF A;  4LF9 K;  2YNH A;  4LF8 K;  3TSU A;  4FLU A;  1NK9 A;  4N56 A;  1LV5 A;  4M41 A;  4E7J A;  4DG1 A;  5C12 A;  4CW7 B;  1T05 A;  1EET A;  3AAP A;  4CK2 A;  3ENB A;  3ZSV A;  3E9O A;  3H1Q A;  3NF7 A;  4LH4 A;  4IO9 L;  4O5B A;  2G8I A;  3VOV A;  4JN4 A;  4CIE A;  2QWO A;  3K5M A;  3ATV A;  4IJA A;  4AHC A;  4KHP K;  4CZG A;  1KD1 O;  2VGN A;  2WC9 A;  3K2P A;  5AQF A;  4DQ8 A;  4CF8 A;  3CC2 N;  4DR3 K;  3VQC A;  1JL1 A;  3VQQ A;  1NGB A;  4FO0 A;  1Q7Y O;  4FWS A;  4KV8 A;  4U7B A;  1G15 A;  2Q2R A;  1J6Z A;  3PX4 A;  4OGE A;  1TYQ B;  2YJE A;  4EAH D;  4DTX A;  4QS7 A;  3VES A;  3CJA A;  4R5P A;  4FJX A;  4DR1 K;  4EFH A;  3LDP A;  3TPQ A;  4CJP A;  4OVL A;  1YVU A;  4U67 L;  2IOC A;  3L2R A;  4EZ6 A;  4E1J A;  3CCR N;  2A6A A;  2DY4 A;  3LL3 A;  3S3M A;  4BC5 A;  4DQR A;  4MLE A;  4KHQ A;  4O55 A;  1RT2 A;  4ELV A;  4H0P A;  4WFB L;  4JD2 A;  4CGJ A;  1C1A A;  3NAE A;  2NUB A;  1X9M A;  1WSI A;  2F8T A;  4BC4 A;  1HQU A;  4ISF A;  1KVC A;  2ZM6 K;  3JXU A;  1IKX A;  3GG4 A;  4E19 A;  4CEO A;  4FXD A;  1Q18 A;  1RT4 A;  3OVN A;  3AA2 A;  4W5N A;  1HYS A;  2HBK A;  2GWJ A;  1NMN A;  1JLA A;  4B9V A;  3OYI A;  1NK6 A;  1HQE A;  1SKS A;  3BF1 A;  3MXJ A;  2GWK A;  1LWE A;  2O8C A;  3QIC A;  1C0G A;  2OA8 A;  1ASV A;  1OH8 A;  1VSI A;  4CIF A;  2BGG A;  2FSN A;  4NXN K;  4Y1D A;  3OYD A;  1KLM A;  2PFU A;  2Y1I A;  4BR0 A;  3SK3 A;  5FRO A;  1TAU A;  1BI4 B;  2E20 A;  4X64 K;  3AY9 A;  3AGK A;  3K59 A;  4HTL A;  3ATU A;  4CBW A;  3V4I A;  3T1H K;  3AGR A;  4RG8 A;  3ZX2 A;  3FGU A;  1OH5 A;  2IDO A;  4M3Y A;  3F9K A;  4DTN A;  1VQ9 N;  2GUI A;  4WCE L;  4KBO A;  3RR7 A;  1QZ5 A;  4CZJ A;  1YTU A;  4EZ9 A;  3PO4 A;  4BY9 C;  2E6L A;  3IFR A;  2X74 A;  2B6A A;  5C10 A;  2Q0R A;  3ENO A;  2OTJ N;  3TAF A;  2JGU A;  1GLF O;  3R8E A;  4DV0 K;  2FBV A;  5I9E B;  3MXI A;  3LAM A;  3B6P A;  4AHT A;  1W9H A;  1BG3 A;  3C94 A;  4J2A A;  3QB0 A;  4XH5 A;  4CK1 A;  4EIA A;  3ZSO A;  2HB5 A;  3TI0 A;  2WFB A;  3THV A;  3DLB A;  5JS2 A;  2JWL A;  5AQW A;  3RSE B;  3SNN A;  4KHS A;  4FJM A;  2VGM A;  3PV8 A;  4BR7 A;  4LH5 A;  1JXE A;  4N41 A;  4DTO A;  5KQ8 A;  4FWP A;  3L8B A;  5KI6 A;  2HBJ A;  5J1E A;  4MDB A;  4DMN A;  2QXL A;  2CGK A;  4KRF A;  3NDK A;  1XC9 A;  3EL2 A;  2VG6 A;  1VQL N;  4OGC A;  4CJR A;  2Z1I A;  5LY3 A;  1BIU A;  3ENH A;  2P9S B;  4O4G A;  4AHU A;  1BDG A;  1ZYQ A;  3J7Z O;  5AQQ A;  3T1A A;  4DTP A;  3J7Y P;  3ZCM A;  4IEI A;  4CJK A;  3LWM A;  4B8C A;  4DFK A;  1NJZ A;  3E01 A;  1EO1 A;  3SBG A;  2HVI A;  4FSV A;  3CIP A;  4RW7 A;  1IG9 A;  5BRF A;  3U6F A;  3HZ6 A;  4JK7 A;  4QCL A;  2HBL A;  3KK7 A;  3WEE A;  3OYC A;  2QTD A;  3MWT A;  3L2W A;  4BAC A;  3DXM A;  5F1X A;  1JXB A;  1GLJ O;  2HHW A;  5DK5 A;  3AVH A;  4C8M A;  2XHB A;  1BGX T;  3D2F A;  4FWQ A;  3T69 A;  4YOR A;  3SCX A;  5EOY A;  1NNE A;  3WXL A;  2B4J A;  2P9I B;  3P31 A;  4MLH A;  5I3U A;  4ILJ A;  5JLH A;  5HP1 A;  1GLL O;  1U6Z A;  4CHO A;  4L3Q A;  3B6O A;  3OJU A;  4X66 K;  1U47 A;  3VF6 A;  1OVQ A;  3EYZ A;  3ZSX A;  2E2O A;  1GLD G;  1C0U A;  1NLV A;  4FJ7 A;  4FJ5 A;  2YNF A;  2HHX A;  2BH1 A;  1GLE G;  4Z4I A;  4CK3 A;  4PKH A;  4BRP A;  4DS4 A;  4OLA A; 
#chains in the Genus database with same CATH homology
 3BUZ B;  3TTD A;  5GIP A;  2ZJQ L;  1XQS C;  2I7P A;  5AQP A;  4Y0W A;  4YOX A;  3QBX A;  4AM6 A;  3CJ1 A;  4JKA A;  4LC9 B;  5C0Y A;  5C15 A;  4O8K A;  2E88 A;  3PIP L;  1WUA A;  1YF5 L;  4GV6 A;  3VEZ A;  3T7Z A;  4BRG A;  3QML A;  1C0F A;  1VQ4 N;  4FPB A;  4B1V A;  4WFN L;  4JK9 A;  1BUP A;  2FF3 B;  1HLU A;  5E84 A;  3NVK A;  3PIO L;  1W97 L;  2IVN A;  1YAG A;  2VCP A;  3ZX3 A;  2GEM A;  3EO3 A;  3MWP A;  4BVO A;  3CCU N;  2F9W A;  5ELZ A;  4FL9 A;  3C0B A;  4CZF A;  4BRA A;  5CR4 A;  5AZJ A;  1OKJ A;  3MN5 A;  5FPM A;  2Q0U A;  2WBN A;  5AQR A;  3GL1 A;  3BP8 A;  3O9S A;  3UB5 A;  5ADX A;  4JK8 A;  4BRM A;  1E4F T;  5FPD A;  4C1N I;  3A5L C;  3U8X A;  5GAD P;  3E9L A;  4BRD A;  2QWM A;  1ESV A;  3CQY A;  5AQT A;  4B1U B;  4DCH A;  3MK6 A;  3QFU A;  4XH1 A;  4NB4 A;  4RCH A;  3M1F A;  4WQ5 A;  1K73 O;  4NLC A;  2NRW A;  4YDU A;  5AQY A;  4CZI A;  4QS8 A;  4B1Y B;  3LDL A;  3WT0 A;  2ITM A;  4FWK A;  1E4G T;  1H1V A;  3WXI A;  4PL7 A;  4BG9 A;  3VEO A;  1Z6R A;  3G71 N;  3M5R A;  3O1B A;  4A2A A;  2NRR A;  2ZF5 O;  3NMU A;  3TSQ A;  3O9T A;  3CET A;  1N8R O;  5EY4 A;  3CC4 N;  2OTL N;  4BRE A;  3GBT A;  4CJ7 A;  2V52 B;  5M1O A;  1BU6 O;  1D4X A;  1HKC A;  5AZI A;  4KH6 A;  3WQU A;  4IFE A;  4ILG B;  2D0P A;  4EHU A;  2VWB A;  4J8F A;  3ULE A;  3VF2 A;  4BRK A;  1M1K O;  3MMV A;  3F2K A;  3ZEU A;  3MN9 A;  1BOT O;  3CF5 L;  3E9P A;  1NGA A;  3WXK A;  4YOW A;  4PHT X;  1S3X A;  2GX9 A;  3D2E B;  1DKG D;  5AQK A;  5AQG A;  2NRX A;  4JKG B;  4PL8 A;  4BRN A;  3OA9 A;  3FZL A;  4H5V A;  1VQP N;  4FVU A;  2E1Z A;  3EN9 A;  4GVE A;  3KHY A;  1EQY A;  2IVP A;  4JAX A;  4NO7 A;  1Q82 O;  3ID8 A;  2CH5 A;  4BR5 A;  1BA0 A;  1YVN A;  5M1N A;  1Q81 O;  2ZJR L;  1JCF A;  1CZA N;  3LDO A;  2P9P A;  2UYT A;  4JHD B;  3IMX A;  5AQV A;  3VEX A;  1VQ8 N;  5TKW A;  3H1V X;  2D1K A;  3WXJ A;  4DB3 A;  3E1Y A;  5AR0 A;  1G99 A;  3HOT A;  2YX6 A;  3UKU A;  5JLF A;  3UKR B;  2ASO A;  4JKF A;  3VMF B;  3H3O B;  3I8B A;  3EKS A;  3SLC A;  3VET A;  1KAZ A;  1HX1 A;  3DXK A;  2V7Y A;  1DGK N;  4IZ9 A;  1OVY A;  1ZBS A;  3A5M C;  3IKM A;  3VEV A;  3WQT A;  3CCL N;  3VER A;  4OPA A;  3QFP A;  4BC2 A;  3ZET A;  3F5T A;  4MDA A;  1ATR A;  3MX2 A;  3WUH A;  1SQK A;  4BRL A;  4BRH A;  1QVG M;  5HOO A;  3CME N;  2IVO A;  2Q36 A;  4CBU A;  4JKD A;  4HWI A;  1P8Z A;  2JWK A;  2Q97 A;  2QWQ A;  2QM1 A;  3HM8 A;  4PKG A;  1SS6 A;  4DHY A;  1JCE A;  2CH6 A;  2BUP A;  2E1Y A;  1JJ2 M;  4JKC A;  4GY2 B;  3WEE B;  4B9Q A;  4BRO A;  4M63 C;  3HOS A;  4JNE A;  2HBM A;  3DXM B;  3U9D A;  4JEP A;  4R79 A;  1RDW X;  2FSJ A;  2ASM A;  1YJW N;  1VQ5 N;  4XEI A;  4EHT A;  5EVZ A;  4CZE A;  4IOC L;  4H0V B;  4A57 A;  2ASP A;  3D2F B;  3Q7B A;  3C7N B;  3JS6 A;  4ISG A;  3VEY A;  4I6M B;  1QHA A;  1DEJ A;  3U4L A;  2PBD A;  5JMV A;  1Y64 A;  2P9K A;  3P38 A;  5M1P A;  3H45 C;  4CZM A;  4IDH A;  2P9U A;  3P39 A;  4Z94 A;  4IOX A;  2P9N A;  3SAF A;  1KXP A;  3EKU A;  4WQ4 C;  3TU5 A;  4A5A A;  2YHY A;  3VGL A;  4B1X B;  2P9L B;  4XH4 A;  4AM7 A;  1KAY A;  2NRZ A;  5TKY A;  1M90 O;  4M7X A;  3SJH A;  5AQO A;  3FE1 A;  2QWP A;  1HKB A;  4H0Y B;  4A62 A;  2AA4 A;  4BR9 A;  4BR2 A;  3KZB A;  5M1Q A;  5GAG P;  1WOQ A;  2Q1N A;  4FWO A;  2FF6 A;  4B1Z A;  4IOA L;  2GEL A;  2ZGY A;  4GV9 A;  1VQ6 N;  3MDQ A;  4BRF A;  3SBT A;  4CBX A;  4A2B A;  2E8A A;  4YOY A;  3TSU A;  3A8Y A;  2QWN A;  2QW9 A;  3EE9 A;  5HL7 L;  3CPE A;  4YOU A;  5F2R A;  3CD6 N;  1KQS M;  1HKG A;  1K8K A;  1NBW A;  2FXU A;  5C12 A;  3CJ7 A;  4CZK A;  3HRG A;  2QWL A;  2PAV A;  2KHO A;  2YJF A;  3AAP A;  5KQD A;  3ENB A;  4CZL A;  3E9O A;  3H1Q A;  5B8H A;  3ID6 A;  5BR9 A;  5EX5 A;  2NLX A;  3R1X A;  5E26 A;  2QA4 N;  3BEX A;  4DKW A;  5AQI A;  4IO9 L;  3VOV A;  4JN4 A;  5DM6 L;  1MWM A;  1YUW A;  1RFQ A;  2QWO A;  3FZK A;  5AQS A;  5AZJ B;  3CPW M;  3CCS N;  1NJI O;  1TYQ A;  3VEW A;  4OO1 J;  3ATV A;  2ZGZ A;  3N4P A;  4IJA A;  2NNW A;  3MX5 A;  5GAH P;  4GV3 A;  1V4T A;  1ATS A;  4CZG A;  2ZWH A;  2VGN A;  2WC9 A;  4A5B A;  2HF4 A;  1KD1 O;  1NGJ A;  3CER A;  3LM2 A;  3HBT A;  1YJN N;  5AQF A;  4DQ8 A;  3CC2 N;  3FZF A;  4BRQ A;  5EXW A;  3I33 A;  1LCU A;  3O8M A;  3CJB A;  3U9Z A;  3I56 N;  2F7T A;  4C23 A;  1NGB A;  4FO0 A;  3CCV N;  1Q7Y O;  2CGL A;  4FWS A;  2QWR A;  2P9S A;  1QZ6 A;  4U7B A;  1NGE A;  4CD3 A;  1BO5 O;  2Q2R A;  1J6Z A;  1TUU A;  5H1S Q;  3W3D A;  1TYQ B;  2YJE A;  4EAH D;  4F9O A;  4A59 A;  5AQU A;  4QS7 A;  3VES A;  3CJA A;  2EWS A;  4IXC A;  4EFH A;  5BPN A;  1VQO N;  3LDP A;  3TPQ A;  3L4Q A;  4U67 L;  5AFU H;  3F9M A;  1NGF A;  4FWL A;  5AZI B;  4E1J A;  2A6A A;  3CCR N;  5KPZ A;  3VPZ A;  3LL3 A;  3MCP A;  3ULE B;  4O5F A;  4WF9 L;  4BC5 A;  1YHQ N;  4MLE A;  2D0O A;  3ZEU B;  1U2V A;  3N4Q A;  4FWM A;  2CGJ A;  2KLA A;  1GLC G;  1QQN A;  4H0P A;  4O8U A;  1NM1 A;  4JD2 A;  4WFB L;  3KVG A;  4CZH A;  5M1K A;  3UE5 A;  1QQO A;  1K9M O;  3R3L A;  1BWF O;  4H5R A;  3HTV A;  4BC4 A;  4ISF A;  4OPH A;  4AF1 A;  3O80 A;  2P9P B;  4K42 A;  1NGI A;  4H0T B;  3VGK A;  4BGB A;  1KC8 O;  5BRE A;  4MO4 A;  4JKH A;  3JXU A;  3RVC A;  2BTF A;  3GG4 A;  4CI6 A;  5CE3 A;  1Q18 A;  1SAZ A;  3CI5 A;  3UKU B;  1TUY A;  1YXQ A;  3OBY A;  2HBK A;  2P9I A;  2YHX A;  2GWJ A;  1NMD A;  5AFU A;  5LJV A;  1X3N A;  3SMS A;  1VQ7 N;  4IWV A;  1GLA G;  2YHW A;  3M3Z A;  1MWK A;  1NGC A;  1KAX A;  2HF3 A;  1RGI A;  2H3G X;  3DLL L;  4K41 A;  3DXK B;  2YI1 A;  4QS9 A;  5BN8 A;  1MA9 B;  3BF1 A;  2GWK A;  2E2Q A;  3QIC A;  1C0G A;  1ZC6 A;  4RWT A;  2YCH A;  3SMP A;  4WFA L;  3ZET B;  3FFK B;  2W41 A;  5JVG L;  3L6Q A;  1ILY A;  5FPN A;  3HI0 A;  5AQZ A;  4ILH A;  1HPM A;  2FSN A;  2WUS A;  5AQL A;  4H03 B;  4WQ5 C;  1X3M A;  3EE8 A;  2PFU A;  3D6R A;  4YDU C;  4BR0 A;  3IUC A;  3P4I A;  3SK3 A;  1MDU B;  3O9R A;  4IEE A;  3CHW A;  2F9T A;  2E20 A;  2A42 A;  3MN6 A;  4PKI A;  1O13 A;  5BPM A;  5BRH A;  1BA1 A;  1GLB G;  4ISE A;  2Q31 A;  1T44 A;  3AY9 A;  1HUX A;  3AGK A;  3K9J A;  4HTL A;  3ATU A;  4CBW A;  2D4W A;  3GDQ A;  1Z05 A;  1T6C A;  4BC3 A;  5BPL A;  2E2P A;  3NVM A;  3FLC O;  1X9J A;  3AGR A;  3DJC A;  3CCE N;  1VQN N;  3ZX2 A;  4BVP A;  3FGU A;  3OHR A;  2P9K B;  2A41 A;  4BG8 A;  1VQ9 N;  2P9U B;  2P9N B;  4KBO A;  4WCE L;  3DWL A;  3A5N C;  4B1W B;  1QZ5 A;  4CZJ A;  5DM7 L;  1NGG A;  1VAZ A;  3QDK A;  1XUP O;  3CCM N;  3OW2 M;  3LDN A;  4H5N A;  4CD1 A;  3FR0 A;  4BY9 C;  3CCJ N;  1K8A O;  2A5X A;  3IFR A;  4A61 A;  5C10 A;  2Q0R A;  4JKE A;  3ENO A;  4YOT A;  3RSE A;  2OTJ N;  3W0L A;  1QVF M;  5CHI A;  1GLF O;  1V4S A;  2FLO A;  3R8E A;  2NRV A;  3BF3 A;  2V7Z A;  3O9Q A;  1XC3 A;  2GUP A;  4MO5 A;  5AQN A;  1W2B M;  4KH5 A;  1DT9 A;  3ZYY X;  3VEN A;  5I9E B;  3M6G A;  3DAW A;  4H5T A;  4RTF D;  1S72 N;  1K8K B;  2A40 A;  3O9U A;  4NLB A;  1BG3 A;  3VGM A;  3IDH A;  3R9P A;  3SAG A;  3QB0 A;  4G9Z A;  1LOT B;  2NRT A;  4XH5 A;  3MCA B;  3C6A A;  4EIA A;  2WFB A;  1VQM N;  5AQM A;  2HOE A;  2JWL A;  4BR4 A;  4BRI A;  4WQ4 A;  5AQW A;  3RSE B;  3O1W A;  5M1F A;  3GE1 A;  2VGM A;  2NZT A;  1P90 A;  3D2E A;  4BR7 A;  3KWG A;  4JKG A;  4M7Y A;  3SAH A;  2QEX N;  4GNI A;  5KQ8 A;  4FWP A;  2VYP A;  2IIR A;  5BN9 A;  3Q7C A;  5AQH A;  2HBJ A;  4BGA A;  4WYB A;  4MDB A;  2QXL A;  3S41 A;  2CGK A;  2E2N A;  1SZ2 A;  3A5O C;  3J8A A;  3E66 A;  3EL2 A;  4JHD A;  3CXC M;  1IJJ A;  1Q86 O;  1VQK N;  3H46 O;  3LM9 A;  1VQL N;  4BQL A;  1NGD A;  4FWN A;  4H5W A;  4BRC A;  3L0Q A;  3UKR A;  1QQM A;  5LY3 A;  3G25 A;  3C65 A;  3O08 A;  3VF4 A;  5KPR A;  3PLA A;  2GTD A;  5AQJ A;  3ENH A;  2P9S B;  1IG8 A;  3D7E O;  4UY8 O;  5BRD A;  1BDG A;  5GIN A;  2AP1 A;  3OBW A;  3G6E N;  4H0O A;  3VTH A;  2NRH A;  3WXM B;  3ZX0 A;  3J7Z O;  2RHK A;  5AQQ A;  2HST A;  3MN7 A;  4IEI A;  3K9K A;  4IO8 A;  3FZM A;  2J4R A;  3R6M A;  2ZJP L;  1YIJ N;  3TSP A;  3AAQ A;  3KWI A;  3FZH A;  1NWK A;  2DPN A;  2HMP A;  5LJW A;  2A3Z A;  1EO1 A;  5KPT A;  1U2V B;  3SBG A;  3O4W A;  3TTF A;  3CJ9 A;  4IJN A;  2I7N A;  1NGH A;  3CIP A;  4FSV A;  3CCQ N;  1HJO A;  1ATN A;  4JD2 B;  5BRF A;  1T6D A;  3HZ6 A;  4JK7 A;  3CJC A;  1YI2 N;  5C2F A;  2HBL A;  5GIO A;  3KK7 A;  3WEE A;  2KKZ A;  2RE2 A;  2QTD A;  2QI2 A;  3MWT A;  4C1N K;  3DXM A;  4FOI A;  3H6E A;  4K25 A;  5GAE P;  5F1X A;  4YOV A;  1GLJ O;  4FPA A;  1R59 O;  3VTI A;  3CC7 N;  3GOI A;  3AAR A;  3D2F A;  4FWQ A;  3T69 A;  3C7N A;  5JIC A;  4YOR A;  4I6M A;  5EOY A;  4KH4 A;  3H3N O;  1S22 A;  2W40 A;  3O6W A;  1RDU A;  3WXL A;  3C6H A;  5MLC Q;  1YJ9 N;  2P9I B;  3P31 A;  4K43 A;  4MLH A;  5AQX A;  4ILJ A;  2P9L A;  5JLH A;  3CQX A;  1GLL O;  1U6Z A;  3B8A X;  4L3Q A;  3VF6 A;  2FSK A;  4FWR A;  5FPE A;  3L4I A;  3TTC A;  3CMA N;  5F0X A;  2E2O A;  1GLD G;  3O5B A;  3QBW A;  4BQZ A;  5C2D A;  1NLV A;  3G4S N;  2OAN A;  4JKB A;  4FOE A;  3A0I X;  1JCG A;  3HSC A;  5ADX H;  2BH1 A;  1YIT N;  1GLE G;  3LDQ A;  1T3V A;  4H0X B;  3I55 N;  2V51 B;  5JVH L;  4PKH A;  4BRP A;  3EZW A;  1ZXO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...