4BC2A

Crystal structure of human d-xylulokinase in complex with d-xylulose and adenosine diphosphate
Total Genus 180
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
180
sequence length
528
structure length
528
Chain Sequence
APRRCCLGWDFSTQQVKVVAVDAELNVFYEESVHFDRDLPEFGTQGGVHVHKDGLTVTSPVLMWVQALDIILEKMKASGFDFSQVLALSGAGQQHGSIYWKAGAQQALTSLSPDLRLHQQLQDCFSISDCPVWMDSSTTAQCRQLEAAVGGAQALSCLTGSRAYERFTGNQIAKIYQQNPEAYSHTERISLVSSFAASLFLGSYSPIDYSDGSGMNLLQIQDKVWSQACLGACAPHLEEKLSPPVPSCSVVGAISSYYVQRYGFPPGCKVVAFTGDNPASLAGMRLEEGDIAVSLGTSDTLFLWLQEPMPALEGHIFCNPVDSQHYMALLCFKNGSLMREKIRNESVSRSWSDFSKALQSTEMGNGGNLGFYFDVMEITPEIIGRHRFNTENHKVAAFPGDVEVRALIEGQFMAKRIHAEGLGYRVMSKTKILATGGASHNREILQVLADVFDAPVYVIDTANSACVGSAYRAFHGLAGGTDVPFSEVVKLAPNPRLAATPSPGASQVYEALLPQYAKLEQRILSQTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords XYLULOSE KINASE
publication title Structure and Function of Human Xylulokinase, an Enzyme with Important Roles in Carbohydrate Metabolism
pubmed doi rcsb
source organism Homo sapiens
total genus 180
structure length 528
sequence length 528
chains with identical sequence B, C
ec nomenclature ec 2.7.1.17: Xylulokinase.
pdb deposition date 2012-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00370 FGGY_N FGGY family of carbohydrate kinases, N-terminal domain
A PF02782 FGGY_C FGGY family of carbohydrate kinases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4bc2A02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4bc2A01
2P9IA 1X9JA 2ITMA 3FFKB 4FWKA 4FOEA 4BC2A 1XQSC 3AAQA 4WQ4A 5AQYA 3CJ9A 2E2NA 3CQYA 3F9MA 1NGAA 3J8AA 2W40A 5AQNA 2YI1A 2P9UB 4YDUC 2QWRA 5I9EB 1NBWA 1U6ZA 1GLJO 1NLVA 2YHWA 1GLFO 4IJAA 3H6EA 3UKUB 1CZAN 3VF6A 1YUWA 2Q36A 2QW9A 3S41A 4K42A 3QB0A 1NGIA 4H5RA 5AQHA 1MA9B 4Y0WA 2A3ZA 3VETA 3O4WA 2QXLA 3CJ7A 1YXQA 4BR7A 3KZBA 3LL3A 4H03B 4F9OA 3VENA 5EY4A 3WXIA 1BA1A 2P9NA 4FPAA 4RCHA 5AZIA 4BC5A 4K41A 1SZ2A 2GUPA 3I33A 3FZFA 5BPNA 3H1VX 5AQWA 1GLDG 3ENOA 3VEVA 1J6ZA 4BC4A 5BRFA 2VYPA 3TU5A 1ZC6A 3M6GA 1NGDA 1HUXA 4ISGA 1HLUA 3CJBA 2A41A 2PAVA 4IO8A 5F2RA 2ASOA 2VCPA 4B1YB 3FR0A 1TUUA 4CZFA 2P9UA 5BPMA 1NGHA 4H5VA 4WYBA 3JS6A 4H0YB 1GLBG 2E1ZA 2Q31A 2IVNA 1NWKA 2J4RA 1P8ZA 4BROA 5AQVA 5KPZA 4B1UB 5E84A 4EAHD 4BR4A 3HM8A 3LDQA 5AQJA 4ISFA 3UKUA 1SQKA 3QBXA 4ISEA 2ASMA 5AQIA 5JLHA 3A0IX 4IXCA 4FL9A 4BRHA 2F9WA 3C7NB 3D2FB 3VESA 3CHWA 1WOQA 3IMXA 3LM2A 1QQNA 3O80A 5AFUA 4H0XB 3WQTA 3A5OC 1U2VB 4EHTA 5BRDA 1NGJA 2A6AA 3QMLA 2HOEA 2FSKA 4FWPA 5FPDA 3CJ1A 3EZWA 2NRHA 1WUAA 4JHDB 1JCFA 1T44A 3W0LA 2IVOA 5EX5A 2ZGZA 5BN9A 2QWOA 4BG9A 4CJ7A 2WUSA 2V52B 3VEWA 2W41A 5JLFA 1DGKN 2E2QA 5AQTA 2GWJA 3VGKA 2ZGYA 1QQMA 3GBTA 4DCHA 3CIPA 5JICA 1KXPA 2P9LB 3IUCA 4GY2B 5AFUH 3IDHA 3QDKA 3VGLA 3I8BA 4FWNA 2I7PA 3VEYA 5ADXA 1GLAG 4FWMA 3O8MA 3C7NA 4B1XB 3EO3A 3JXUA 3VEXA 3D2EB 4CZHA 3UE5A 1MWMA 4CZMA 5EOYA 3AY9A 1U2VA 4BRAA 2Q2RA 4BRCA 3ATVA 3LDLA 4JD2B 4A61A 3DXMA 3L4IA 3MCPA 1KAYA 2YJEA 4MO4A 3H45C 3WXKA 3LM9A 3FZKA 3P4IA 3ULEA 1GLLO 3MN9A 5FPEA 5CE3A 2E1YA 4Z94A 2PBDA 4BR9A 1ZXOA 3LDNA 2EWSA 2CH6A 3R6MA 3A5NC 4JHDA 1RGIA 3VF2A 3ZEUA 3KVGA 3O1BA 3WXJA 1DKGD 2P9SA 5BREA 3VEOA 2H3GX 3DAWA 3EN9A 4JNEA 4AM7A 3MN6A 3MN7A 5ADXH 3GDQA 4BGAA 3QICA 1TYQB 3FZMA 4M7YA 3WXLA 1OKJA 1E4FT 3QFUA 3EKUA 5AQLA 4YDUA 3ZX2A 5BR9A 2FXUA 4FOIA 4CZGA 4BRDA 4BR2A 2A5XA 4B1VA 3AAPA 3CQXA 2A40A 5AQZA 1JCGA 3EL2A 3D2EA 4HWIA 1QHAA 3UKRA 5AQRA 3O5BA 1MDUB 4CBXA 3DWLA 3DXKB 4FSVA 1RDWX 1HKGA 1S3XA 2GEMA 1NGCA 3BF1A 4JN4A 3MN5A 3HZ6A 1BA0A 3D7EO 4BRNA 2QWLA 2D1KA 1S22A 3BP8A 3U9ZA 2D0OA 2E8AA 4LC9B 4KBOA 2YCHA 3LDPA 2UYTA 1SAZA 5ELZA 2F9TA 3C0BA 3WUHA 1V4SA 3GE1A 1JCEA 1TYQA 3GOIA 4CD1A 4WQ5C 3H3NO 5KQ8A 2YHXA 1R59O 4CZEA 3TPQA 2OANA 3GG4A 3BUZB 5FPMA 4BREA 4IZ9A 4PKGA 1BWFO 2IIRA 3ATUA 5BN8A 5AQSA 3ID8A 4B1ZA 5AZJB 4XEIA 2YJFA 3A5MC 1ATSA 3DXKA 4QS7A 1Z6RA 4PL8A 2IVPA 4XH4A 5KQDA 1XC3A 3FGUA 1C0GA 1H1VA 2E2PA 4A62A 1NGGA 1YVNA 3VF4A 5AQUA 2AP1A 1NGFA 3RSEB 4BRIA 1QZ5A 2DPNA 1XUPO 2CGJA 4RWTA 3WQUA 4BRKA 1IJJA 3H46O 3HBTA 3VEZA 4B9QA 2P9KB 4JAXA 1K8KB 4FWQA 4PKHA 5EVZA 3FZLA 3VGMA 4J8FA 4C23A 4FWLA 4EHUA 4BQLA 3VOVA 1MWKA 3ZETB 4H5TA 4A2BA 4FWSA 4BRFA 3D2FA 4BRQA 4FPBA 3FE1A 1NMDA 1T6CA 1ZBSA 4BC3A 4NO7A 5E26A 4IWVA 1D4XA 1HPMA 3MK6A 4CZKA 5LY3A 4QS9A 5AQOA 2FSNA 3AARA 1LOTB 4WQ4C 1BOTO 2NZTA 4MO5A 1KAXA 3G25A 1EQYA 3B8AX 5FPNA 3SLCA 4M63C 2VWBA 2AA4A 2ZF5O 5TKYA 1NGEA 2GELA 2GWKA 3SJHA 2P9NB 5AZIB 2BUPA 1GLEG 3SMSA 4L3QA 1RFQA 5BRHA 3A8YA 5AQKA 3O08A 4H5NA 4BQZA 2QM1A 2Q0UA 3QFPA 3R8EA 3U9DA 5AQXA 2HF3A 2CH5A 3RSEA 2V7ZA 4H0OA 5B8HA 4MLHA 1HKBA 1QZ6A 2P9LA 1HKCA 2E20A 2HMPA 4IJNA 2P9KA 1K8KA 4BG8A 3CJAA 4CZLA 4FWOA 4H0TB 2Q97A 3WEEB 3ZETA 4BR5A 4CZIA 4DHYA 3ENHA 4AM6A 1BUPA 1Y64A 3R9PA 4BRMA 3IFRA 3U4LA 4M7XA 2KHOA 4O5FA 2E88A 4XH1A 4BRLA 3MMVA 3ZX0A 4BR0A 5AQGA 2FF3B 1NM1A 3M3ZA 4JD2A 3SMPA 1KAZA 1BO5O 2D0PA 3FZHA 5AQFA 4K25A 5KPTA 3UB5A 2QWQA 5EXWA 2ZWHA 3VERA 4I6MB 3CJCA 4XH5A 5F0XA 3HSCA 2QWNA 1ATRA 3CI5A 4RTFD 2QWMA 1BG3A 2Q1NA 4DQ8A 1LCUA 2CGLA 4B1WB 3QBWA 5LJVA 3A5LC 5AQMA 5AR0A 3OHRA 4FWRA 2FSJA 3WEEA 1QQOA 1Q18A 5F1XA 3EKSA 3BEXA 1HJOA 1T6DA 4EIAA 2FLOA 2FF6A 1DEJA 2ASPA 2P9PB 2V51B 2YHYA 3DJCA 3HTVA 4BGBA 4BRGA 4E1JA 1NGBA 4DB3A 4O8KA 2P9IB 4BVPA 4FO0A 3BF3A 4H0PA 4WQ5A 3MDQA 3L0QA 1Z05A 3DXMB 3GL1A 1BDGA 4CD3A 4I6MA 2A42A 5AQQA 2BTFA 3ULEB 4CBUA 3CETA 4BVOA 5AQPA 3O6WA 4K43A 3CERA 4CI6A 2QWPA 4QS8A 4PL7A 4EFHA 1V4TA 1X3MA 2E2OA 1YAGA 2CGKA 3KHYA 2D4WA 2V7YA 3ZEUB 4MLEA 3U8XA 3L6QA 1HX1A 3H3OB 2P9SB 3VPZA 1G99A 3LDOA 4A2AA 3HI0A 3O1WA 1IG8A 1E4GT 1TUYA 3SK3A 3W3DA 5BPLA 2GTDA 2I7NA 2NLXA 3H1QA 4GNIA 4PKIA 1ATNA 4NB4A 4BRPA 2Q0RA 3FLCO 5LJWA 3M1FA 1ESVA 5JMVA 4CBWA 1GLCG 2P9PA 1X3NA 3ZX3A 4CZJA 5AZJA 1BU6O 4H0VB 4H5WA 3WT0A 5KPRA 3UKRB 1C0FA 2HF4A 4HTLA
chains in the Genus database with same CATH superfamily
1X9JA 2Y1JA 5FLXO 3FFKB 4FWKA 1VQON 3SAFA 5H1SQ 4DV0K 2ETJA 3F9MA 2ZM6K 5HOOA 4IEEA 3HP9A 3S3OA 1Q82O 3SCXA 5I9EB 3M8RA 4CJKA 1CXQA 3UKUB 1CZAN 1MU2A 3VF6A 1OH5A 4K42A 3O9RA 1NGIA 2RHKA 2A3ZA 3VETA 3O4WA 2O8FA 2NRWA 4R5PA 3DOKA 1YXQA 1L3VA 2QXFA 1C0UA 4F9OA 4V19S 1BA1A 5TKWA 2ZJQL 1SZ2A 1NNEA 2GUPA 3L3UA 3I33A 3FZFA 3H1VX 4LFBK 1GLDG 1KVAA 4DFMA 1J6ZA 1NKEA 1WNSA 5BRFA 3PO5A 4FZXC 4ZTJA 3TU5A 5GAHP 3M6GA 4A59A 3B6OA 2PAVA 4FLVA 4MDAA 1VRTA 4HCCA 3WXMB 1KCFA 1GLBG 4M3WA 2IVNA 3U3YA 4BROA 4B1UB 5LMUK 3H08A 3LDQA 3EE9A 3UKUA 3AO3A 1HPZA 1OH7A 2F9WA 3D2FB 3ZT1A 2DFEA 4M3RA 4M3TA 3WQTA 2IS3A 5GIPA 4RG8A 1NGJA 3MXJA 2LSNA 4DUZK 3CC4N 3RWUA 2G8UA 2HOEA 2FSKA 4KHYA 1JL1A 1Y97A 4FWPA 1TAQA 3C6TA 4F4KA 1EO1A 4CK3A 2PFUA 3I8DA 2WUSA 3RMAA 2FBTA 3VEWA 4I9LA 2A1SA 3OYMA 3KKSA 1TL1A 2OPRA 1WSHA 3LPUA 4FJMA 3NCIA 3QESA 3CIPA 4KH6A 2P9LB 3IUCA 1UA0A 4CJ5A 4B3OA 3QDKA 3SQ2A 4FWNA 3VEYA 4Z4IA 1Q86O 5GAGP 4FWMA 4FZZA 4ID1A 3JXUA 3VEXA 3OYFA 1QSSA 1T8EA 4DFJA 4CFBA 3T7ZA 3AVBA 3VQCA 1RTHA 3PX0A 1WAFA 1VQ6N 4BRAA 4BRCA 5LL6Z 4JLHA 4EP5A 3H45C 5A2QO 2O8BB 3NGYA 1GLLO 4KKOA 4E3SA 1JXBA 2EWSA 2CH6A 3VF2A 1DKGD 2P9SA 4F2RA 4JNEA 4AM7A 4ELVA 1HNZK 3AA4A 5ADXH 4GVMA 3THWB 1TYQB 3DRPA 3C94A 1VSEA 3V9WA 4JKCA 1E4FT 3QFUA 4JKDA 3IS9A 4DFKA 4B9SA 1RBTA 4FOIA 4BR2A 4DFPA 1W9HA 3P38A 5M1OA 3OYKA 3UKRA 4O55A 1QVGM 4DS4A 3DWLA 3OYJA 2D0BA 1HQEA 3OYIA 2GEMA 1S3XA 4IG3A 1NOYA 3BF1A 1FK9A 3HZ6A 3TABA 1ZBFA 1RT7A 2D1KA 3LP3A 1DT9A 3SAHA 4GVEA 4FJLA 3CFRA 2HNDA 4HTUA 4AQYK 4CEZA 5C10A 2YCHA 4CEBA 3J81O 1UOCA 1LWEA 1IBLK 5LMNK 1S1XA 1KVBA 4B08A 3THVA 1L3SA 3THWA 2EHGA 4W5NA 1TYQA 1VQMN 1CZ9A 4CJPA 2ZE2A 4CGFA 1ASWA 1R59O 2F7TA 4CZEA 3QEVA 2VGNA 1VHXA 2OANA 5FPMA 4CK2A 4PKGA 3AVCA 3ID8A 4B1ZA 3TSPA 3S9HA 2YJFA 3CMAN 2NRTA 1ATSA 3KK2A 2VG6A 1YVUA 1XC3A 1H1VA 3OYCA 4E19A 5AQUA 2JLEA 1JLAA 3D45A 1BIZA 3RSEB 4BRIA 5M1FA 2DPNA 3K9JA 4CEQA 3DLLL 4H4OA 1J5OA 4QCLA 2IGIA 1J9AA 3CCRN 2P9KB 4YOTA 1TL3A 4OKEA 5EVZA 3FZLA 4JEPA 4FWLA 2QKBA 4KHWA 4BE2A 1MWKA 3ZETB 5HRNA 3KK7A 4FWSA 2BE2A 1JXEA 4FPBA 1NMDA 4BC3A 2KTQA 1JL2A 4FJNA 2KZMA 5E26A 1D4XA 1UWBA 5LY3A 1FKPA 1C6VA 4QS9A 4LFCK 2B6AA 1LOTB 3KD5E 1BOTO 3KJVA 5JVGL 2UXDK 1HQUA 4CEAA 5FPNA 3SLCA 4ICLA 4AHVA 4CJ3A 2GELA 1EX4A 3LZIA 2QEXN 3SMSA 4Y1DA 2WTUA 1RFQA 2DFFA 3VQ4A 3Q7CA 4JI7K 2QM1A 4UY8O 2Q0UA 1YT3A 3O3HA 3O9SA 3R8EA 4CHZA 3KLHA 5AQXA 4CF8A 2A1RA 4FLYA 1YHQN 4FJIA 4B9MA 3RSEA 1YTAA 4JKHA 4H0OA 4MLHA 1NMNA 1HKCA 2HMPA 1SL0A 2P9KA 4FK0A 2WBNA 2Q97A 3SPZA 3CM6A 3AGKA 3ZETA 2G8IA 1ITGA 1I3AA 2EX3A 3QEIA 1RCHA 4CJSA 4O5FA 1I94K 4BR0A 4ILHA 3NH0A 4KREA 4CHNA 3O3GA 2VWJA 3SV4A 5HP1A 3M3ZA 4JD2A 4K25A 3UB5A 2QWQA 5EXWA 5HBMA 1X1PA 2ZWHA 1WSFA 5M1PA 3HSCA 3U6FA 4E1MA 4RTFD 3C95A 3NDKA 1NKBA 4FM2A 1KRPA 4JI8K 4FW1A 4DQ8A 4B3SK 2HMIA 4FJXA 1CZBA 1ZBLA 3PY8A 1QQOA 1RTJA 4DV6K 1RDAA 1HJOA 3OA9A 4DWIA 1DEJA 2ASPA 3DMJA 2YHYA 3DJCA 4BGBA 3O9QA 1N36K 3WNEA 4E1JA 3ENBA 3K2PA 1HYZA 5JS1A 4O8KA 3OYGA 4BVPA 3T69A 4E1NA 4WQ5A 3MDQA 1TK0A 3DXMB 4CHQA 4FJGA 4ELTA 1S1UA 3L2VA 1JJ2M 5AQPA 3LANA 3CERA 2UU9K 1V4TA 3EZ5A 2YNHA 1YAGA 3KHYA 2D4WA 2XHBA 4MLEA 3L6QA 2G8VA 4KHQA 4FJJA 5CZ2A 4FJHA 1IG8A 1E4GT 1TUYA 3SK3A 3OYBA 2XY6A 3OBYA 3OBWA 1NK8A 2VG7A 4B3MK 1N5YA 4PHTX 3CCSN 4NB4A 2KFZA 3ID6A 3CG7A 2RF2A 1BISA 3M1FA 1ESVA 4X62K 2YV0X 1LAVA 3QNNA 4DTNA 1X3NA 2HB5A 4CZJA 3PSIA 5AZJA 4H5WA 1SKWA 3WT0A 1S9EA 2OA8A 4IEIA 1C0FA 3BZKA 4HTLA 3SQ0A 1LW0A 3QIOA 4FCYA 4BC2A 4WQ4A 1O1WA 3ALYA 5AQYA 1VQNN 1A5VA 5AQNA 1YIJN 2YI1A 4JKBA 3TAGA 2P9UB 3SBTA 2YHAA 2QWRA 1VQ7N 4CJFA 1U6ZA 1GLJO 4LF4K 4IDKA 1JLBA 4LF7K 4FJ8A 3BGRA 4ZTFA 5IWAK 3AA3A 2IAJA 5HLFA 2Q36A 2QW9A 4DR6K 3QB0A 4LY7A 3T1HK 4H5RA 5J2NA 4GV6A 2VWKA 1VSDA 3KLGA 4BR7A 2VG5A 1IG9A 4H03B 3K5MA 4DLGA 4OPHA 2P9NA 4RCHA 4BC5A 4K41A 3THXB 3NMUA 5BPNA 3VEVA 1LAWA 3KKRA 2OZMA 4FVUA 3CJBA 5F2RA 4CJLA 4B1YB 2HSTA 5C12A 3ZSYA 2P9UA 1NGHA 3JS6A 4CGGA 1YITN 2ZD1A 2Q31A 2VGMA 3K5OA 1NWKA 4CE9A 1RBSA 5KPZA 2O8CA 5E84A 4BR4A 2OZSA 5GIOA 5AQJA 3LP2A 1EP4A 3T1AA 3A0IX 4PWDA 3V9UA 1VQ5N 3IMXA 2GBZA 1VSHA 2E5LK 4YHHK 2W6LA 4JK7A 1U2VB 4EHTA 2G8FA 3VQ8A 1BIUA 1IKYA 4JI6K 3QMLA 1TAUA 3M8QA 2KZZA 4M3UA 3L2UA 4CJUA 5FPDA 3THXA 2OPQA 5D3GA 1WUAA 4F2SA 1T44A 4DU3A 3EEQA 5EX5A 3QEPA 4BG9A 1JKHA 4EZ6A 4IDHA 4CJ7A 3RTVA 1DGKN 1LW2A 1SL2A 4DTMA 3NH2A 1TKXA 2ZGYA 4FZYA 4DCHA 1KXPA 1U49A 4DV2K 3E01A 3VQEA 3HO1A 4XIUA 3SNNA 5ADXA 5CYMA 2HHHK 4G9ZA 1KTQA 3DRRA 3LWMA 3V1RA 5EOYA 3AY9A 1VQKN 3CCMN 1K73O 1U2VA 4DTRA 1RDUA 3LDLA 4A61A 3L4IA 4DV5K 4CF9A 1GOAA 1U48A 3RRGA 3FZKA 4J2AA 3KWGA 3MN9A 3ITHA 2E1YA 4AHSA 4H4MA 3AVJA 3F9KA 3ZEUA 1D8YA 3KVGA 2DFHA 1YTUA 1CLQA 3MN7A 3TSQA 4JKFA 1NJXA 1HMVA 3QICA 2BDPA 2HHTA 3AVMA 3P39A 4FVMA 3NGZA 5AQLA 1IKVA 3ZX2A 1N33K 3K5LA 4DS5A 1W97L 3SQ4A 2FXUA 4CZGA 1RTIA 5E41A 3K57A 2XY5A 4GMJB 2JWKA 3O3FA 4JI2K 4CBXA 4Z4CA 1HKGA 3OW2M 4F8RA 5FDLA 4LSLA 4BE0A 3MN5A 1XNRK 1BA0A 3L4QA 3T19A 2QWLA 4RW9A 1C0MA 4KB1A 3MEEA 2D0OA 3CQ8A 4M45A 4LC9B 2D5RA 4Y1CA 3HPHA 3D6RA 3VQAA 2HBKA 2Z1HA 3TTCA 3BZCA 1QSLA 3LDPA 4PY5A 2F9TA 3V6DA 1V4SA 4HHTA 4FLWA 4WQ5C 5KQ8A 1OH8A 3FFIA 2YHXA 1IKXA 3NVKA 3EYZA 2YNGA 4Z4EA 4IKFA 1Q7YO 4BREA 1BWFO 1VQ9N 5CHIA 1JLFA 2XO7A 4PL8A 1Q81O 5KQDA 4OO1J 2WC9A 3FGUA 4A62A 5M1NA 3CCVN 1NGGA 3VF4A 2HHWA 1E3MA 3ULDA 3ISNC 1IJJA 3H46O 5FROA 3S3MA 4L8RB 4CHYA 4JAXA 1VSLA 4C23A 3VGMA 2WOMA 4CW7B 2NNWA 3PV8A 4WFAL 4FK2A 4BRFA 4U67L 3AVGA 3D2FA 4A57A 3WNHA 3CMEN 4NO7A 4B8CA 1VSJA 1ZBIA 2FSNA 3AARA 4BWJA 4WQ4C 1WSEA 4H8KA 2IDOA 1KAXA 4N47A 1RDCA 1W0HA 3PUFA 3VN5A 3ZSRA 3B8AX 1X9SA 4M63C 3QO9A 2AA4A 3C65A 3HT3A 2ZF5O 5TKYA 2I5JA 3CCQN 3KLFA 1U47A 3MEGA 4JK8A 5AZIB 4KFBA 3AGRA 4L3QA 2O8DB 5BRHA 3OS1A 3OS0A 5AQKA 4BQZA 4CIFA 3MECA 4BACA 3JAMO 1YJNN 1A5WA 2CH5A 3CM5A 2FC0A 2V7ZA 5B8HA 1HKBA 2P9LA 4IJNA 3QLHA 5CYQA 3J7YP 3I55N 1TKZA 4H0TB 1BCMA 3DLBA 4DHYA 3ENHA 1GOCA 3SUNA 1T7PA 1TVRA 4AM6A 2KW4A 2QI2A 1Y64A 3R9PA 3O9UA 5C2FA 4M7XA 2KHOA 2E88A 3DI6A 3ZX0A 1YI2N 5AQGA 1NM1A 1NJWA 4EZ9A 1BO5O 2D0PA 2PZSA 4K8XA 4J2EA 5KPTA 1C0TA 2O8BA 4DF8A 1I39A 1JLCA 3SQ1A 3QEWA 1N32K 3AO2A 1HJRA 4DR4K 4Z4HA 4YOWA 2O8DA 3TWHA 3DRSA 4C8KA 1WLJA 2QWMA 2Q1NA 2Z1IA 4O8UA 3SYZA 4LF8K 2CGLA 4OGCA 5I42A 1S6QA 4M42A 4NLBA 3ZT4A 1NK4A 3D0PA 3A5LC 2YNFA 1TGOA 4DMNA 3JSMA 4FWRA 3F2KA 4CF0A 3EKSA 1T6DA 4X66K 2FLOA 2FF6A 1XHXA 2P9PB 3NF7A 4NCGA 3ZT2A 2V51B 4LF5K 4C8LA 3HOTA 4DB3A 1VSIA 1VQPN 1IBKK 1QSYA 3HJFA 3NF8A 2P9IB 1Q8IA 4KH4A 4FO0A 5C24A 3BF3A 4JYAK 2OCEA 4IFVA 1RNHA 4OPAA 3JYTA 3L0QA 4M3XA 3GL1A 3NH1A 4CD3A 1VSKA 3AV9A 5AQQA 2BTFA 4I2QA 3ULEB 4N5SA 4BVOA 3O6WA 3ASMA 4CI6A 4DTPA 5SWMA 3IRXA 4AHUA 2GUIA 2DTUA 3U8XA 3VA0A 1HX1A 3H3OB 5M1KA 3TTDA 3LDOA 4A2AA 3TAQA 3CFPA 5K14A 3IG1A 4GNIA 4I9QA 3SAGA 5C42A 4JRQA 3CCEN 1QE1A 2RPIA 3NHGA 4CF2A 3E9OA 4KTWA 3CYMA 4DTJA 1RBVA 1YF5L 2P9PA 2AJQA 3ZX3A 3LAKA 5KGWA 5KPRA 1RT2A 4CFAA 2P9IA 1IO2A 2ITMA 1C1AA 1VRUA 1REVA 1U4BA 1XQSC 3CJ9A 3CQYA 4FXDA 1NGAA 4CF1A 1NK7A 2NUBA 4B9LA 1X9MA 1NLVA 2YHWA 2GV9A 4IJAA 1KD1O 3HP6A 2YX6A 1YUWA 5C25A 3DLGA 3K9KA 3O4NA 4DQSA 3DYAA 3CC2N 1MA9B 4Y0WA 1RBUA 2GX9A 3MCAB 3NF9A 2Q3SA 2HHSA 2YNIA 3CJ7A 1SUQA 4CJVA 3VENA 3ZLJA 5M1QA 3TAEA 3OJUA 3O4QA 4CEEA 4KI6A 3DOLA 3PSFA 3PIOL 3CPWM 1ZC6A 1HUXA 1NJYA 2RE2A 2A41A 4IO8A 2P5GA 3MWTA 4JKAA 4CZFA 1FJGK 4DSEA 5BPMA 4WYBA 2E1ZA 5JS2A 3IAYA 4E7HA 5AQVA 3TAMA 3HM8A 3CCJN 2NRXA 3LDSA 2O4GA 1W2BM 3LWLA 5HRSA 5KI6A 3QBXA 5GAEP 2ASMA 5JLHA 3DLEA 4IXCA 4FL9A 3C7NB 3I0RA 3HSTB 3LZJA 1WOQA 3ZSZA 4H0XB 1BQMA 4JKGB 4KHUA 4YNQA 3A5OC 5BRDA 3A2FA 2A6AA 3U3GA 3CF5L 1WBDA 3VTHA 3AVAA 5J1EA 3KWIA 2WFBA 3MX2A 1WN7A 4O4GA 3EY1A 4RW6A 3CJ1A 2UUAK 1O13A 3AVHA 4CHOA 3RVCA 1BQNA 3W0LA 2IVOA 4AHCA 4NXMK 4R79A 2QK9A 1VQ8N 4M3ZA 3KIOA 4C1NK 2W41A 5JLFA 4M3YA 2E2QA 3F5TA 5AQTA 1M1KO 3VGKA 3CXCM 2X78A 4N56A 5EU7A 4GKKK 5DK5A 3AA5X 3L8BA 4GY2B 5AFUH 2BANA 3KK3A 1XNQK 4ID5A 3IDHA 3I8BA 1JLEA 3RR8A 1GLAG 3O8MA 3C7NA 4B1XB 3KLEA 1JLGA 4RW7A 3D2EB 2G8KA 3P1GA 3AVFA 2KLAA 4JKGA 3E9LA 4B9NA 4CEDA 2Q2RA 1F21A 3E9PA 4RW8A 4IOAL 3DXMA 1NG9A 1KAYA 3WXKA 4JKEA 3MWPA 4BY9C 3TARA 4Z94A 3LDNA 3BDPA 4JI0K 1RGIA 1S1VA 4CERA 4HUEA 3LALA 1HRHA 3LP1A 2UUCK 1ASVA 3EN9A 1RILA 3MN6A 1VAZA 4OGEA 4AF1A 1KVCA 3GDQA 3QIPA 4NCAA 4Q5VA 3FZMA 4M7YA 5SZTA 3TTFA 3EKUA 5AJ3K 4YDUA 5BR9A 4BRDA 2A5XA 3AAPA 4FLUA 1NJIO 5AQZA 2O4IA 2O8EB 1JCGA 3D2EA 2UUBK 1RT4A 3O5BA 1MDUB 3VQDA 3DXKB 2HBJA 3N4PA 3TAPA 1NGCA 4JN4A 3L2WA 3K5NA 4LF6K 1T3VA 2X74A 3D7EO 1EETA 1D9DA 3ZSVA 4BRNA 3OYLA 4FLZA 1OVQA 3M5RA 4B9TA 1KFSA 4DQRA 4CK1A 4W5OA 4RW4A 5T7BA 3TI0A 3C0BA 3SPYA 3GE1A 1JCEA 4CD1A 3H3NO 4KO0A 3OYEA 2ATQA 2ZJPL 2PY5A 4CJTA 1RT3A 3VQ7A 3HRGA 3G10A 4IZ9A 3CC7N 5AQSA 3QETA 2QTDA 1Q9XA 2FBVA 5KGXA 4CECA 4XEIA 2PYJA 2HNZA 1HNXK 4JRPA 3A5MC 3P31A 3DXKA 4KV8A 3VQ6A 4QS7A 1Z6RA 3VTIA 4XH4A 2Y1IA 1C0GA 1RTDA 1YVNA 4FLTA 3DLKA 2AP1A 3KD1E 1RBRA 4CESA 1XUPO 4RWTA 3WQUA 1G15A 4BRKA 3HBTA 3VEZA 1EKEA 4DV3K 4B9QA 5KRTA 1NOZA 4FWQA 4LH5A 3MX5A 4J8FA 2FBXA 4Z0UA 4BQLA 4EHUA 2F8SA 4IFYA 3E66A 4H5TA 4DKWA 4A2BA 2HHQA 2WONA 3FE1A 1T6CA 1ZBSA 5JVHL 4FJ9A 4IWVA 1HPMA 1K9MO 5HRRA 4B3RK 4HCBA 5KRSA 4E7LA 3PX4A 1SKRA 2NZTA 4MO5A 1WSIA 3HL8A 4NCBA 3G25A 3SZ2A 1EQYA 5DM6L 2O8FB 3PIPL 1NGEA 3HPOA 4ZHRA 2GWKA 3T3FA 4AH9A 3THYB 1GLEG 5FRMA 4MQ3A 2HNYA 3A8YA 4DTSA 3O08A 3QFPA 3AA2A 3U9DA 4CGHA 3E1YA 2HF3A 1QS4A 3G0ZA 4DSKA 4QOZB 3DLRA 5HROA 3DLHA 1D9FA 2B4JA 1S1WA 3CJAA 4FWOA 4CZLA 3VQBA 1S5JA 3OTOK 2W6KA 3AVKA 4CZIA 1BUPA 3M8PA 2E4LA 4BRMA 3V9XA 3U4LA 4A5BA 4BRLA 3NGIA 3VQ9A 3KLIA 4YOVA 2FF3B 5C2DA 3HOSA 3UIQA 4IOCL 2DY4A 2HBLA 1HNIA 1Z25A 5HL7L 2YKNA 3VERA 2D0AA 4I6MB 1J53A 3THYA 4XH5A 1RT6A 3T1YK 2QWNA 3K58A 1ATRA 2JGUA 4GW6A 4QAGA 3V9ZA 4BDPA 1LCUA 4BDYA 4Q0BA 5KTQA 4OVLA 4B1WB 3AO5A 3QBWA 2ITGA 2BH1A 4W5RA 5AR0A 4CJWA 2X6NA 1QQCA 3OHRA 3CCUN 5GINA 2FSJA 1Q18A 3NFAA 3DM2A 4E7JA 4F3OA 1QHTA 4CHPA 4O44A 4EIAA 4N41A 4AHRA 1KLMA 2F96A 3MXMA 1NGBA 4WF9L 3KK1A 4CGJA 4DU1A 2Z1GA 3AO1A 1WSGA 4HVJA 2OPSA 1X9WA 4DR3K 1Z05A 3P5JA 4FM0A 1S72N 4I6MA 2A42A 3SJJA 4CBUA 4K43A 2HBMA 2QWPA 4EFHA 1X3MA 2CGKA 2ZJRL 2OTJN 3CD6N 2P9SB 4DSFA 3VPZA 1CXUA 3W3DA 5BPLA 2I7NA 3G6EN 3H1QA 4DV1K 4IOXA 3B6PA 4BRPA 4X65K 1RDBA 4NYNA 5LJWA 1U45A 2G8WA 2HW3A 4IO9L 4K8ZA 3TANA 1T05A 2UXBK 4CVNE 1GLCG 4WCEL 4J2BA 4YOUA 4OPJA 4FJ5A 1TKTA 3VA3A 3QNOA 3AVLA 3UKRB 3C6UA 4DTOA 3L3VA 4CGDA 2KQ2A 4DSLA 1YJ9N 1NU0A 4FOEA 3K59A 3WNGA 3OJSA 3AAQA 3SUOA 3I56N 3M8SA 2E2NA 1WBBA 1BGXT 4JI1K 1SKSA 1NK5A 3J8AA 2W40A 4A5AA 4YDUC 4F3TA 4WFBL 4C8NA 3IKMA 4GV9A 1TK5A 3R1XA 1DTTA 4E0DA 3RRHA 1NBWA 4DF4A 1BL3A 1GLFO 3H6EA 1Q9YA 1VQ4N 3S41A 3NAEA 2HHUA 4TSXA 5C15A 4OLAA 3OYNA 5AQHA 5CZ1A 1KFDA 2QA4N 2QXLA 3K0SA 1ZBHA 3KZBA 3LL3A 2E6LA 1XWLA 5EY4A 1S9GA 3WXIA 3PLAA 4YY3K 3LPTA 1R0AA 3ZT0A 2F4VK 4FPAA 5AZIA 4ILGB 3QINA 1XI1A 4E7KA 2P5OA 4O5BA 5AQWA 3ENOA 4KTZA 1IV0A 4KB0A 4BC4A 2VYPA 3LAMA 1NGDA 4ISGA 2KFNA 1XMQK 1HLUA 4JV5K 2ASOA 2VCPA 3ZYYX 1SL1A 3FR0A 1TUUA 1HR0K 3QERA 4H5VA 4DQIA 4H0YB 3SI6A 2J4RA 1P8ZA 2FBYA 4EAHD 4CFDA 3QEXA 4ISFA 1SQKA 4ISEA 5AQIA 1ZYQA 1KQSM 4CGIA 4BRHA 3VESA 1K6YA 3J80O 4CJRA 3CHWA 3LM2A 3AO4A 1QQNA 3HVTA 3O80A 5AFUA 3RMDA 5C0YA 4HUFA 4NXNK 4IBNA 1U04A 4CEOA 4KTQA 3WNFA 4CIGA 4BDZA 1S6PA 4DV7K 4AILC 3EZWA 2NRHA 2VQEK 4JHDB 3SV3A 1NK6A 1JCFA 3J7AP 2ZGZA 5BN9A 2QWOA 3ZSQA 3OYAA 2V52B 4YORA 5BR8K 3J7ZO 2GWJA 1B9FA 3VQQA 4MDBA 5HRPA 1QQMA 1WAJA 4BE1A 3GBTA 5JICA 1YJWN 1OH6A 1VK0A 3G4SN 4YOYA 1VSMA 1N34K 4DUYK 4CFCA 3VGLA 2I7PA 4M41A 4C1NI 2NRVA 3EO3A 4CZHA 3UE5A 3OVNA 2F8TA 1MWMA 4LD0A 1BCOA 4CZMA 4AHTA 4JI5K 1IKWA 3SUQA 4FW2A 3ATVA 4JD2B 4MO4A 3MCPA 2YJEA 3P83D 1L5UA 3LM9A 3RMBA 3P4IA 3ULEA 1NJZA 2RN2A 5CE3A 5FPEA 1WSJA 4WE1A 2PBDA 3EE8A 1SS6A 1ZXOA 4BR9A 4UQGA 4DLEA 2OYQA 4C8OA 3R6MA 3A5NC 4JHDA 4I7FA 5CR4A 1HNWK 1WB9A 3O1BA 3WXJA 4DR7K 3CPEA 3AVIA 1T03A 1NK0A 5BREA 4B3TK 3VEOA 2H3GX 3DAWA 4BWMA 4KRFA 4DSJA 1FKOA 2Z1JA 3CCLN 4BGAA 3WXLA 1OKJA 1VSFA 4DR1K 2NRRA 2YKMA 3NBPA 2ZQBA 4O0JA 1DTQA 4B1VA 3CQXA 1GOBA 2A40A 4KHPK 3EL2A 3MXIA 4HWIA 1QHAA 5AQRA 1RDDA 4OJRA 4FSVA 4E89A 1RDWX 2W42A 4GKJK 4WFNL 1XC9A 3V9SA 1VQLN 4DSIA 4JK9A 2HVIA 1NK9A 2OPPA 1S22A 1IBMK 3BP8A 3U9ZA 5MLCQ 2E8AA 1UAXA 2NRZA 4FJKA 4NLCA 1L3TA 4OKJA 3F73A 4KBOA 1W7AA 1P90A 2UYTA 1ZBUA 1SAZA 5ELZA 3S3NA 2XY8A 3WUHA 4NYFA 4FLXA 3GOIA 4JS4A 4LF9K 4KH5A 1QTMA 4ILJA 1RT5A 3TPQA 3HVRA 2XRIA 3GG4A 3BUZB 5BN8A 3V4IA 2IIRA 3ATUA 1SV5A 5AZJB 3RR7A 4JS5A 4HUGA 1S1TA 5CY4A 1ILYA 2IVPA 4CEFA 2E2PA 4DTXA 2D0CA 3ZCMA 4IG0A 3OS2A 2KKZA 1NGFA 2UXCK 3ZSOA 1QZ5A 1DLOA 3NF6A 2CGJA 1KLNA 4J2DA 1EWRA 3HYFA 5IT9O 3V81A 4DR2K 1K8KB 4PKHA 1ASUA 1XMOK 3PO4A 3MEDA 4CCHA 2JWLA 3VOVA 4YFUA 3C6HA 4EP4A 3HM9A 1LV5A 1BI4B 4E7IA 4BRQA 4O0IA 2PYLA 4OLBA 1J54A 3V1OA 3VMFB 3MK6A 4CZKA 4U7BA 5AQOA 4OPKA 4Z4GA 4JI3K 2IC3A 3ZSWA 3OYDA 3L2QA 4X64K 2G8HA 3TR8A 2VWBA 4PA1A 1B92A 2IOCA 1XHZA 1C1CA 4JI4K 4FK4A 2X6SA 3SJHA 2B5JA 2P9NB 2BUPA 2HHXA 3SUPA 3RMCA 4KHSA 3ZT3A 3ZSXA 2E6MA 4CJQA 4H5NA 5I3UA 4DQQA 4CIEA 4KI4A 3HK2A 1QZ6A 2E20A 4FJ7A 1NKCA 4OX9K 4DG1A 1K8KA 4B9VA 1KSPA 4BG8A 3TSUA 2HVHA 1M90O 3WEEB 4N76A 3NE6A 1TKDA 2YHBA 2O8CB 3PX6A 3SBGA 4BR5A 3V1QA 4KAZA 1BI4A 3NVMA 4OKKA 2XY7A 3IFRA 1BHLA 1RT1A 3O9TA 4XH1A 4W5QA 3MMVA 1B9DA 2BGGA 4FYDA 4B8AB 2R7YA 1N8RO 4DTUA 3SMPA 1KAZA 1LWFA 3FZHA 5AQFA 4DR5K 3L2RA 4LSNA 5J2MA 1HYVA 4PUOA 4DV4K 1OVYA 4CJ4A 3MAQA 1EWQA 4ELUA 3CJCA 1UA1A 5F0XA 3OYHA 2QKKA 3CI5A 1BG3A 4I2PA 4Z4FA 4MFBA 3HXMA 1FW6A 4LH4A 4GV3A 3AVNA 4YOXA 1LWCA 5GADP 4CJEA 1J5EK 5LJVA 5DM7L 3KTQA 5J2QA 5AQMA 1JLQA 1A5XA 1KC8O 1TK8A 3WEEA 1Z26A 2VQFK 1L3UA 5F1XA 2O8EA 3BEXA 5FRNA 1D5AA 3BY5A 3G71N 3HTVA 4BRGA 1IH7A 4G1QA 3LP0A 1HNVA 3R3LA 4FM1A 1QVFM 4KHNA 4PQUA 4H0PA 3TAFA 2P51A 4B9UA 1BDGA 3CETA 2P1JA 4QS8A 1C1BA 4PL7A 3I0SA 4LFAK 5J2PA 2E2OA 4KPYA 3HPGA 1HYSA 2V7YA 3ZEUB 4DQPA 2RKIA 2HHVA 1G99A 3HI0A 3O1WA 2GTDA 2NLXA 4C8MA 4PKIA 4K0KK 1ATNA 3VQ5A 3N4QA 2Q0RA 3FLCO 4IFEA 1N6QA 1FXXA 2OTLN 3C6AA 5JMVA 4CBWA 3OY9A 4W5TA 1BU6O 1K8AO 4H0VB 1TV6A 3Q7BA 5DMRA 3CFOA 1EXQA 3VQPA 2HF4A 4DU4A
chains in the Genus database with same CATH topology
2P9IA 1X9JA 2ITMA 1YJ9N 3FFKB 4FWKA 1VQON 4FOEA 4BC2A 1XQSC 3AAQA 4WQ4A 5AQYA 3CJ9A 3SAFA 3I56N 5H1SQ 1VQNN 2E2NA 3CQYA 3F9MA 1NGAA 3J8AA 5HOOA 2W40A 4IEEA 5AQNA 1YIJN 2YI1A 4A5AA 4JKBA 1Q82O 2P9UB 4YDUC 4WFBL 3IKMA 3SBTA 4GV9A 3R1XA 2QWRA 5I9EB 1VQ7N 1NBWA 1U6ZA 1GLJO 1NLVA 2YHWA 1GLFO 4IJAA 1KD1O 3H6EA 3UKUB 1CZAN 2YX6A 3VF6A 1YUWA 2Q36A 3K9KA 2QW9A 1VQ4N 3S41A 4K42A 3QB0A 5C15A 3O9RA 1NGIA 4H5RA 5AQHA 2RHKA 3CC2N 1MA9B 4Y0WA 4GV6A 2A3ZA 3VETA 2GX9A 3O4WA 3MCAB 2QA4N 2QXLA 2NRWA 3CJ7A 1YXQA 4BR7A 3KZBA 3LL3A 4H03B 4F9OA 3VENA 5EY4A 3WXIA 1BA1A 4OPHA 5TKWA 2ZJQL 3PLAA 2P9NA 4FPAA 4ILGB 4RCHA 5AZIA 4K41A 1SZ2A 5M1QA 4BC5A 2GUPA 3NMUA 3I33A 3FZFA 5BPNA 3H1VX 5AQWA 1GLDG 3ENOA 3VEVA 1J6ZA 4BC4A 5BRFA 3PIOL 3CPWM 2VYPA 3TU5A 1ZC6A 3M6GA 1NGDA 1HUXA 4A59A 5GAHP 4ISGA 4FVUA 1HLUA 2RE2A 3CJBA 2A41A 2PAVA 4IO8A 5F2RA 4MDAA 2ASOA 2VCPA 3ZYYX 4B1YB 2HSTA 3MWTA 3FR0A 1TUUA 4JKAA 4CZFA 2P9UA 5C12A 5BPMA 1NGHA 4H5VA 4WYBA 3WXMB 3JS6A 4H0YB 1YITN 1GLBG 2E1ZA 2Q31A 2IVNA 2VGMA 1NWKA 2J4RA 1P8ZA 4BROA 5AQVA 5KPZA 4B1UB 5E84A 4EAHD 4BR4A 3HM8A 5GIOA 3LDQA 2NRXA 5AQJA 3CCJN 1W2BM 3EE9A 4ISFA 3UKUA 1SQKA 3QBXA 4ISEA 5GAEP 2ASMA 5AQIA 5JLHA 1KQSM 3A0IX 4IXCA 4FL9A 4BRHA 2F9WA 3C7NB 3D2FB 3VESA 3CHWA 1WOQA 3IMXA 3LM2A 1VQ5N 1QQNA 3O80A 5AFUA 4H0XB 4JKGB 4JK7A 3WQTA 3A5OC 5GIPA 1U2VB 4EHTA 5C0YA 5BRDA 1NGJA 2A6AA 3CF5L 3QMLA 3VTHA 3CC4N 2HOEA 2FSKA 3KWIA 4FWPA 2WFBA 3MX2A 5FPDA 3CJ1A 3EZWA 2NRHA 1WUAA 1O13A 4JHDB 1JCFA 1T44A 3RVCA 3W0LA 2IVOA 5EX5A 2ZGZA 5BN9A 2QWOA 1EO1A 4BG9A 4R79A 2PFUA 4IDHA 4CJ7A 1VQ8N 2WUSA 2V52B 4YORA 3VEWA 2W41A 4C1NK 5JLFA 3J7ZO 1DGKN 2E2QA 3F5TA 5AQTA 2GWJA 1M1KO 4MDBA 4IEIA 3VGKA 3CXCM 2ZGYA 1QQMA 3GBTA 4DCHA 3CIPA 5JICA 1KXPA 1YJWN 4KH6A 2P9LB 3IUCA 3G4SN 4GY2B 5AFUH 4YOYA 3IDHA 3QDKA 3VGLA 3I8BA 4FWNA 2I7PA 3VEYA 5ADXA 4G9ZA 1GLAG 5GAGP 4FWMA 4C1NI 1Q86O 3O8MA 2NRVA 3C7NA 4B1XB 3EO3A 3JXUA 3VEXA 3D2EB 4CZHA 3UE5A 1MWMA 4CZMA 2KLAA 4JKGA 3E9LA 5EOYA 3T7ZA 3AY9A 1VQKN 3CCMN 1K73O 1U2VA 1VQ6N 4BRAA 2Q2RA 4BRCA 3ATVA 1RDUA 3LDLA 3E9PA 4JD2B 4A61A 3DXMA 3L4IA 3MCPA 1KAYA 2YJEA 4MO4A 4IOAL 3H45C 3WXKA 3LM9A 3FZKA 4JKEA 3KWGA 3P4IA 3ULEA 3MWPA 1GLLO 3MN9A 4BY9C 5FPEA 5CE3A 2E1YA 4Z94A 2PBDA 3EE8A 1SS6A 1ZXOA 4BR9A 3LDNA 2EWSA 2CH6A 3R6MA 3A5NC 4JHDA 1RGIA 3VF2A 3ZEUA 5CR4A 3KVGA 3O1BA 3WXJA 3CPEA 1DKGD 2P9SA 5BREA 3VEOA 2H3GX 3DAWA 3EN9A 4JNEA 4AM7A 3MN6A 3MN7A 1VAZA 5ADXH 3TSQA 4JKFA 4AF1A 3GDQA 3CCLN 4BGAA 3QICA 1TYQB 3FZMA 4M7YA 3WXLA 1OKJA 3P39A 3TTFA 2NRRA 4JKCA 1E4FT 3QFUA 4JKDA 3EKUA 5AQLA 4YDUA 3ZX2A 5BR9A 1W97L 2FXUA 4FOIA 4CZGA 4BRDA 4BR2A 2A5XA 4B1VA 3AAPA 3CQXA 2A40A 5AQZA 1NJIO 1JCGA 3P38A 5M1OA 3EL2A 3D2EA 4HWIA 1QHAA 3UKRA 2JWKA 5AQRA 3O5BA 1MDUB 1QVGM 4CBXA 3DWLA 3DXKB 4FSVA 1RDWX 1HKGA 1S3XA 2GEMA 4WFNL 3OW2M 2HBJA 3N4PA 1VQLN 1NGCA 3BF1A 4JN4A 3MN5A 1T3VA 3HZ6A 1BA0A 3D7EO 3L4QA 4JK9A 4BRNA 2QWLA 2D1KA 1S22A 3BP8A 3U9ZA 1DT9A 3SAHA 2D0OA 5MLCQ 4GVEA 3M5RA 2E8AA 4LC9B 2NRZA 3D6RA 4NLCA 2HBKA 5C10A 3TTCA 4KBOA 2YCHA 1P90A 3LDPA 2UYTA 1SAZA 5ELZA 2F9TA 3C0BA 3WUHA 1V4SA 3GE1A 1JCEA 1TYQA 1VQMN 3GOIA 4CD1A 4WQ5C 3H3NO 4KH5A 5KQ8A 4ILJA 2YHXA 1R59O 2ZJPL 3NVKA 2F7TA 4CZEA 3TPQA 2VGNA 2OANA 3GG4A 3BUZB 3HRGA 1Q7YO 5FPMA 4BREA 4IZ9A 4PKGA 1BWFO 2IIRA 3ATUA 5BN8A 3CC7N 5AQSA 1VQ9N 2QTDA 3ID8A 4B1ZA 5AZJB 4XEIA 5CHIA 3TSPA 2YJFA 3CMAN 2NRTA 1ATSA 3A5MC 3DXKA 3P31A 4QS7A 1Z6RA 4PL8A 2IVPA 3VTIA 1ILYA 4XH4A 1Q81O 5KQDA 1XC3A 4OO1J 2WC9A 3FGUA 1C0GA 1H1VA 2E2PA 4A62A 5M1NA 3CCVN 1NGGA 1YVNA 3VF4A 2KKZA 2AP1A 5AQUA 1NGFA 3RSEB 4BRIA 5M1FA 1QZ5A 2DPNA 3K9JA 1XUPO 2CGJA 4RWTA 3WQUA 3DLLL 4BRKA 1IJJA 3H46O 3HBTA 3VEZA 4B9QA 3CCRN 2P9KB 4JAXA 1K8KB 4YOTA 4FWQA 4PKHA 5EVZA 3FZLA 3MX5A 4J8FA 4JEPA 4FWLA 3VGMA 4BQLA 2JWLA 3VOVA 4C23A 4EHUA 3C6HA 2NNWA 4WFAL 1MWKA 3ZETB 3E66A 3KK7A 4H5TA 4DKWA 4A2BA 4FWSA 4BRFA 4U67L 3D2FA 4A57A 4BRQA 4FPBA 3FE1A 1NMDA 1T6CA 1ZBSA 4BC3A 5JVHL 3CMEN 4NO7A 5E26A 4IWVA 1D4XA 3VMFB 1HPMA 3MK6A 4CZKA 5LY3A 4U7BA 1K9MO 4QS9A 5AQOA 2FSNA 3AARA 1LOTB 4WQ4C 1BOTO 5JVGL 2NZTA 4MO5A 1KAXA 3G25A 1EQYA 3B8AX 5FPNA 3SLCA 4M63C 2VWBA 5DM6L 2AA4A 3C65A 2ZF5O 3PIPL 5TKYA 1NGEA 2GELA 3CCQN 2GWKA 4JK8A 2QEXN 3SJHA 2P9NB 5AZIB 2BUPA 1GLEG 3SMSA 3AGRA 1RFQA 4L3QA 5BRHA 3A8YA 3Q7CA 5AQKA 3O08A 4H5NA 4BQZA 2QM1A 4UY8O 2Q0UA 3QFPA 3O9SA 3R8EA 3U9DA 1YJNN 3E1YA 5AQXA 2HF3A 1YHQN 2CH5A 3RSEA 4JKHA 2V7ZA 4H0OA 5B8HA 4MLHA 1HKBA 1QZ6A 2P9LA 1HKCA 2E20A 2HMPA 4IJNA 2P9KA 1K8KA 3I55N 4BG8A 3CJAA 4CZLA 4FWOA 4H0TB 2WBNA 3TSUA 2Q97A 1M90O 3WEEB 3AGKA 3ZETA 3SBGA 4BR5A 4CZIA 4DHYA 3ENHA 3NVMA 4AM6A 1BUPA 2QI2A 1Y64A 3R9PA 4BRMA 3IFRA 3U4LA 3O9UA 4A5BA 4M7XA 5C2FA 2KHOA 3O9TA 4O5FA 2E88A 4XH1A 4BRLA 3MMVA 3ZX0A 1YI2N 4BR0A 4ILHA 5AQGA 2FF3B 5C2DA 4YOVA 3HOSA 1NM1A 1N8RO 3M3ZA 4JD2A 4IOCL 3SMPA 1KAZA 2HBLA 1BO5O 2D0PA 3FZHA 5AQFA 4K25A 5KPTA 3UB5A 2QWQA 5EXWA 5HL7L 2ZWHA 3VERA 1OVYA 4I6MB 3CJCA 4YOWA 5M1PA 4XH5A 5F0XA 3HSCA 2QWNA 1ATRA 3CI5A 4RTFD 2QWMA 1BG3A 2Q1NA 4O8UA 4GV3A 4YOXA 4DQ8A 1LCUA 2CGLA 5GADP 4B1WB 3QBWA 4NLBA 5LJVA 5DM7L 2BH1A 3A5LC 5AQMA 5AR0A 3OHRA 4FWRA 1KC8O 3CCUN 5GINA 2FSJA 3WEEA 1QQOA 1Q18A 3F2KA 5F1XA 3EKSA 3BEXA 1HJOA 3OA9A 1T6DA 4EIAA 2FLOA 2FF6A 1DEJA 2ASPA 2P9PB 3G71N 2V51B 2YHYA 3DJCA 3HTVA 4BGBA 4BRGA 3O9QA 3HOTA 4E1JA 3ENBA 1NGBA 3R3LA 4DB3A 1VQPN 4WF9L 1QVFM 4O8KA 2P9IB 4KH4A 4BVPA 4FO0A 3T69A 3BF3A 4H0PA 4WQ5A 3MDQA 4OPAA 3L0QA 1Z05A 3DXMB 3GL1A 1BDGA 4CD3A 1S72N 4I6MA 2A42A 5AQQA 2BTFA 3ULEB 4CBUA 3CETA 4BVOA 5AQPA 1JJ2M 3O6WA 4K43A 3CERA 4CI6A 2HBMA 2QWPA 4QS8A 4PL7A 4EFHA 1V4TA 1X3MA 2E2OA 1YAGA 2CGKA 3KHYA 2D4WA 2ZJRL 2V7YA 3ZEUB 4MLEA 3U8XA 2OTJN 3L6QA 3CD6N 1HX1A 3H3OB 2P9SB 5M1KA 3TTDA 1G99A 3LDOA 3VPZA 4A2AA 3HI0A 3O1WA 1IG8A 1E4GT 1TUYA 3SK3A 3W3DA 5BPLA 2GTDA 3OBYA 2I7NA 3OBWA 2NLXA 3G6EN 3H1QA 4GNIA 4PKIA 4IOXA 4PHTX 1ATNA 3SAGA 4NB4A 3CCSN 3ID6A 4BRPA 3CCEN 3N4QA 2Q0RA 3FLCO 4IFEA 3M1FA 5LJWA 1ESVA 4IO9L 3C6AA 2OTLN 5JMVA 4CBWA 3E9OA 1GLCG 4WCEL 1YF5L 2P9PA 1X3NA 3ZX3A 4YOUA 4CZJA 5AZJA 1BU6O 1K8AO 4H0VB 3Q7BA 4H5WA 3WT0A 5KPRA 3UKRB 1C0FA 2HF4A 4HTLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P9I A;  1X9J A;  2ITM A;  3FFK B;  4FWK A;  4FOE A;  4BC2 A;  1XQS C;  3AAQ A;  4WQ4 A;  5AQY A;  3CJ9 A;  2E2N A;  3CQY A;  3F9M A;  1NGA A;  3J8A A;  2W40 A;  5AQN A;  2YI1 A;  2P9U B;  4YDU C;  2QWR A;  5I9E B;  1NBW A;  1U6Z A;  1GLJ O;  1NLV A;  2YHW A;  1GLF O;  4IJA A;  3H6E A;  3UKU B;  1CZA N;  3VF6 A;  1YUW A;  2Q36 A;  2QW9 A;  3S41 A;  4K42 A;  3QB0 A;  1NGI A;  4H5R A;  5AQH A;  1MA9 B;  4Y0W A;  2A3Z A;  3VET A;  3O4W A;  2QXL A;  3CJ7 A;  1YXQ A;  4BR7 A;  3KZB A;  3LL3 A;  4H03 B;  4F9O A;  3VEN A;  5EY4 A;  3WXI A;  1BA1 A;  2P9N A;  4FPA A;  4RCH A;  5AZI A;  4BC5 A;  4K41 A;  1SZ2 A;  2GUP A;  3I33 A;  3FZF A;  5BPN A;  3H1V X;  5AQW A;  1GLD G;  3ENO A;  3VEV A;  1J6Z A;  4BC4 A;  5BRF A;  2VYP A;  3TU5 A;  1ZC6 A;  3M6G A;  1NGD A;  1HUX A;  4ISG A;  1HLU A;  3CJB A;  2A41 A;  2PAV A;  4IO8 A;  5F2R A;  2ASO A;  2VCP A;  4B1Y B;  3FR0 A;  1TUU A;  4CZF A;  2P9U A;  5BPM A;  1NGH A;  4H5V A;  4WYB A;  3JS6 A;  4H0Y B;  1GLB G;  2E1Z A;  2Q31 A;  2IVN A;  1NWK A;  2J4R A;  1P8Z A;  4BRO A;  5AQV A;  5KPZ A;  4B1U B;  5E84 A;  4EAH D;  4BR4 A;  3HM8 A;  3LDQ A;  5AQJ A;  4ISF A;  3UKU A;  1SQK A;  3QBX A;  4ISE A;  2ASM A;  5AQI A;  5JLH A;  3A0I X;  4IXC A;  4FL9 A;  4BRH A;  2F9W A;  3C7N B;  3D2F B;  3VES A;  3CHW A;  1WOQ A;  3IMX A;  3LM2 A;  1QQN A;  3O80 A;  5AFU A;  4H0X B;  3WQT A;  3A5O C;  1U2V B;  4EHT A;  5BRD A;  1NGJ A;  2A6A A;  3QML A;  2HOE A;  2FSK A;  4FWP A;  5FPD A;  3CJ1 A;  3EZW A;  2NRH A;  1WUA A;  4JHD B;  1JCF A;  1T44 A;  3W0L A;  2IVO A;  5EX5 A;  2ZGZ A;  5BN9 A;  2QWO A;  4BG9 A;  4CJ7 A;  2WUS A;  2V52 B;  3VEW A;  2W41 A;  5JLF A;  1DGK N;  2E2Q A;  5AQT A;  2GWJ A;  3VGK A;  2ZGY A;  1QQM A;  3GBT A;  4DCH A;  3CIP A;  5JIC A;  1KXP A;  2P9L B;  3IUC A;  4GY2 B;  5AFU H;  3IDH A;  3QDK A;  3VGL A;  3I8B A;  4FWN A;  2I7P A;  3VEY A;  5ADX A;  1GLA G;  4FWM A;  3O8M A;  3C7N A;  4B1X B;  3EO3 A;  3JXU A;  3VEX A;  3D2E B;  4CZH A;  3UE5 A;  1MWM A;  4CZM A;  5EOY A;  3AY9 A;  1U2V A;  4BRA A;  2Q2R A;  4BRC A;  3ATV A;  3LDL A;  4JD2 B;  4A61 A;  3DXM A;  3L4I A;  3MCP A;  1KAY A;  2YJE A;  4MO4 A;  3H45 C;  3WXK A;  3LM9 A;  3FZK A;  3P4I A;  3ULE A;  1GLL O;  3MN9 A;  5FPE A;  5CE3 A;  2E1Y A;  4Z94 A;  2PBD A;  4BR9 A;  1ZXO A;  3LDN A;  2EWS A;  2CH6 A;  3R6M A;  3A5N C;  4JHD A;  1RGI A;  3VF2 A;  3ZEU A;  3KVG A;  3O1B A;  3WXJ A;  1DKG D;  2P9S A;  5BRE A;  3VEO A;  2H3G X;  3DAW A;  3EN9 A;  4JNE A;  4AM7 A;  3MN6 A;  3MN7 A;  5ADX H;  3GDQ A;  4BGA A;  3QIC A;  1TYQ B;  3FZM A;  4M7Y A;  3WXL A;  1OKJ A;  1E4F T;  3QFU A;  3EKU A;  5AQL A;  4YDU A;  3ZX2 A;  5BR9 A;  2FXU A;  4FOI A;  4CZG A;  4BRD A;  4BR2 A;  2A5X A;  4B1V A;  3AAP A;  3CQX A;  2A40 A;  5AQZ A;  1JCG A;  3EL2 A;  3D2E A;  4HWI A;  1QHA A;  3UKR A;  5AQR A;  3O5B A;  1MDU B;  4CBX A;  3DWL A;  3DXK B;  4FSV A;  1RDW X;  1HKG A;  1S3X A;  2GEM A;  1NGC A;  3BF1 A;  4JN4 A;  3MN5 A;  3HZ6 A;  1BA0 A;  3D7E O;  4BRN A;  2QWL A;  2D1K A;  1S22 A;  3BP8 A;  3U9Z A;  2D0O A;  2E8A A;  4LC9 B;  4KBO A;  2YCH A;  3LDP A;  2UYT A;  1SAZ A;  5ELZ A;  2F9T A;  3C0B A;  3WUH A;  1V4S A;  3GE1 A;  1JCE A;  1TYQ A;  3GOI A;  4CD1 A;  4WQ5 C;  3H3N O;  5KQ8 A;  2YHX A;  1R59 O;  4CZE A;  3TPQ A;  2OAN A;  3GG4 A;  3BUZ B;  5FPM A;  4BRE A;  4IZ9 A;  4PKG A;  1BWF O;  2IIR A;  3ATU A;  5BN8 A;  5AQS A;  3ID8 A;  4B1Z A;  5AZJ B;  4XEI A;  2YJF A;  3A5M C;  1ATS A;  3DXK A;  4QS7 A;  1Z6R A;  4PL8 A;  2IVP A;  4XH4 A;  5KQD A;  1XC3 A;  3FGU A;  1C0G A;  1H1V A;  2E2P A;  4A62 A;  1NGG A;  1YVN A;  3VF4 A;  5AQU A;  2AP1 A;  1NGF A;  3RSE B;  4BRI A;  1QZ5 A;  2DPN A;  1XUP O;  2CGJ A;  4RWT A;  3WQU A;  4BRK A;  1IJJ A;  3H46 O;  3HBT A;  3VEZ A;  4B9Q A;  2P9K B;  4JAX A;  1K8K B;  4FWQ A;  4PKH A;  5EVZ A;  3FZL A;  3VGM A;  4J8F A;  4C23 A;  4FWL A;  4EHU A;  4BQL A;  3VOV A;  1MWK A;  3ZET B;  4H5T A;  4A2B A;  4FWS A;  4BRF A;  3D2F A;  4BRQ A;  4FPB A;  3FE1 A;  1NMD A;  1T6C A;  1ZBS A;  4BC3 A;  4NO7 A;  5E26 A;  4IWV A;  1D4X A;  1HPM A;  3MK6 A;  4CZK A;  5LY3 A;  4QS9 A;  5AQO A;  2FSN A;  3AAR A;  1LOT B;  4WQ4 C;  1BOT O;  2NZT A;  4MO5 A;  1KAX A;  3G25 A;  1EQY A;  3B8A X;  5FPN A;  3SLC A;  4M63 C;  2VWB A;  2AA4 A;  2ZF5 O;  5TKY A;  1NGE A;  2GEL A;  2GWK A;  3SJH A;  2P9N B;  5AZI B;  2BUP A;  1GLE G;  3SMS A;  4L3Q A;  1RFQ A;  5BRH A;  3A8Y A;  5AQK A;  3O08 A;  4H5N A;  4BQZ A;  2QM1 A;  2Q0U A;  3QFP A;  3R8E A;  3U9D A;  5AQX A;  2HF3 A;  2CH5 A;  3RSE A;  2V7Z A;  4H0O A;  5B8H A;  4MLH A;  1HKB A;  1QZ6 A;  2P9L A;  1HKC A;  2E20 A;  2HMP A;  4IJN A;  2P9K A;  1K8K A;  4BG8 A;  3CJA A;  4CZL A;  4FWO A;  4H0T B;  2Q97 A;  3WEE B;  3ZET A;  4BR5 A;  4CZI A;  4DHY A;  3ENH A;  4AM6 A;  1BUP A;  1Y64 A;  3R9P A;  4BRM A;  3IFR A;  3U4L A;  4M7X A;  2KHO A;  4O5F A;  2E88 A;  4XH1 A;  4BRL A;  3MMV A;  3ZX0 A;  4BR0 A;  5AQG A;  2FF3 B;  1NM1 A;  3M3Z A;  4JD2 A;  3SMP A;  1KAZ A;  1BO5 O;  2D0P A;  3FZH A;  5AQF A;  4K25 A;  5KPT A;  3UB5 A;  2QWQ A;  5EXW A;  2ZWH A;  3VER A;  4I6M B;  3CJC A;  4XH5 A;  5F0X A;  3HSC A;  2QWN A;  1ATR A;  3CI5 A;  4RTF D;  2QWM A;  1BG3 A;  2Q1N A;  4DQ8 A;  1LCU A;  2CGL A;  4B1W B;  3QBW A;  5LJV A;  3A5L C;  5AQM A;  5AR0 A;  3OHR A;  4FWR A;  2FSJ A;  3WEE A;  1QQO A;  1Q18 A;  5F1X A;  3EKS A;  3BEX A;  1HJO A;  1T6D A;  4EIA A;  2FLO A;  2FF6 A;  1DEJ A;  2ASP A;  2P9P B;  2V51 B;  2YHY A;  3DJC A;  3HTV A;  4BGB A;  4BRG A;  4E1J A;  1NGB A;  4DB3 A;  4O8K A;  2P9I B;  4BVP A;  4FO0 A;  3BF3 A;  4H0P A;  4WQ5 A;  3MDQ A;  3L0Q A;  1Z05 A;  3DXM B;  3GL1 A;  1BDG A;  4CD3 A;  4I6M A;  2A42 A;  5AQQ A;  2BTF A;  3ULE B;  4CBU A;  3CET A;  4BVO A;  5AQP A;  3O6W A;  4K43 A;  3CER A;  4CI6 A;  2QWP A;  4QS8 A;  4PL7 A;  4EFH A;  1V4T A;  1X3M A;  2E2O A;  1YAG A;  2CGK A;  3KHY A;  2D4W A;  2V7Y A;  3ZEU B;  4MLE A;  3U8X A;  3L6Q A;  1HX1 A;  3H3O B;  2P9S B;  3VPZ A;  1G99 A;  3LDO A;  4A2A A;  3HI0 A;  3O1W A;  1IG8 A;  1E4G T;  1TUY A;  3SK3 A;  3W3D A;  5BPL A;  2GTD A;  2I7N A;  2NLX A;  3H1Q A;  4GNI A;  4PKI A;  1ATN A;  4NB4 A;  4BRP A;  2Q0R A;  3FLC O;  5LJW A;  3M1F A;  1ESV A;  5JMV A;  4CBW A;  1GLC G;  2P9P A;  1X3N A;  3ZX3 A;  4CZJ A;  5AZJ A;  1BU6 O;  4H0V B;  4H5W A;  3WT0 A;  5KPR A;  3UKR B;  1C0F A;  2HF4 A;  4HTL A; 
#chains in the Genus database with same CATH topology
 1X9J A;  2Y1J A;  5FLX O;  3FFK B;  4FWK A;  1VQO N;  3SAF A;  5H1S Q;  4DV0 K;  2ETJ A;  3F9M A;  2ZM6 K;  5HOO A;  4IEE A;  3HP9 A;  3S3O A;  1Q82 O;  3SCX A;  5I9E B;  3M8R A;  4CJK A;  1CXQ A;  3UKU B;  1CZA N;  1MU2 A;  3VF6 A;  1OH5 A;  4K42 A;  3O9R A;  1NGI A;  2RHK A;  2A3Z A;  3VET A;  3O4W A;  2O8F A;  2NRW A;  4R5P A;  3DOK A;  1YXQ A;  1L3V A;  2QXF A;  1C0U A;  4F9O A;  4V19 S;  1BA1 A;  5TKW A;  2ZJQ L;  1SZ2 A;  1NNE A;  2GUP A;  3L3U A;  3I33 A;  3FZF A;  3H1V X;  4LFB K;  1GLD G;  1KVA A;  4DFM A;  1J6Z A;  1NKE A;  1WNS A;  5BRF A;  3PO5 A;  4FZX C;  4ZTJ A;  3TU5 A;  5GAH P;  3M6G A;  4A59 A;  3B6O A;  2PAV A;  4FLV A;  4MDA A;  1VRT A;  4HCC A;  3WXM B;  1KCF A;  1GLB G;  4M3W A;  2IVN A;  3U3Y A;  4BRO A;  4B1U B;  5LMU K;  3H08 A;  3LDQ A;  3EE9 A;  3UKU A;  3AO3 A;  1HPZ A;  1OH7 A;  2F9W A;  3D2F B;  3ZT1 A;  2DFE A;  4M3R A;  4M3T A;  3WQT A;  2IS3 A;  5GIP A;  4RG8 A;  1NGJ A;  3MXJ A;  2LSN A;  4DUZ K;  3CC4 N;  3RWU A;  2G8U A;  2HOE A;  2FSK A;  4KHY A;  1JL1 A;  1Y97 A;  4FWP A;  1TAQ A;  3C6T A;  4F4K A;  1EO1 A;  4CK3 A;  2PFU A;  3I8D A;  2WUS A;  3RMA A;  2FBT A;  3VEW A;  4I9L A;  2A1S A;  3OYM A;  3KKS A;  1TL1 A;  2OPR A;  1WSH A;  3LPU A;  4FJM A;  3NCI A;  3QES A;  3CIP A;  4KH6 A;  2P9L B;  3IUC A;  1UA0 A;  4CJ5 A;  4B3O A;  3QDK A;  3SQ2 A;  4FWN A;  3VEY A;  4Z4I A;  1Q86 O;  5GAG P;  4FWM A;  4FZZ A;  4ID1 A;  3JXU A;  3VEX A;  3OYF A;  1QSS A;  1T8E A;  4DFJ A;  4CFB A;  3T7Z A;  3AVB A;  3VQC A;  1RTH A;  3PX0 A;  1WAF A;  1VQ6 N;  4BRA A;  4BRC A;  5LL6 Z;  4JLH A;  4EP5 A;  3H45 C;  5A2Q O;  2O8B B;  3NGY A;  1GLL O;  4KKO A;  4E3S A;  1JXB A;  2EWS A;  2CH6 A;  3VF2 A;  1DKG D;  2P9S A;  4F2R A;  4JNE A;  4AM7 A;  4ELV A;  1HNZ K;  3AA4 A;  5ADX H;  4GVM A;  3THW B;  1TYQ B;  3DRP A;  3C94 A;  1VSE A;  3V9W A;  4JKC A;  1E4F T;  3QFU A;  4JKD A;  3IS9 A;  4DFK A;  4B9S A;  1RBT A;  4FOI A;  4BR2 A;  4DFP A;  1W9H A;  3P38 A;  5M1O A;  3OYK A;  3UKR A;  4O55 A;  1QVG M;  4DS4 A;  3DWL A;  3OYJ A;  2D0B A;  1HQE A;  3OYI A;  2GEM A;  1S3X A;  4IG3 A;  1NOY A;  3BF1 A;  1FK9 A;  3HZ6 A;  3TAB A;  1ZBF A;  1RT7 A;  2D1K A;  3LP3 A;  1DT9 A;  3SAH A;  4GVE A;  4FJL A;  3CFR A;  2HND A;  4HTU A;  4AQY K;  4CEZ A;  5C10 A;  2YCH A;  4CEB A;  3J81 O;  1UOC A;  1LWE A;  1IBL K;  5LMN K;  1S1X A;  1KVB A;  4B08 A;  3THV A;  1L3S A;  3THW A;  2EHG A;  4W5N A;  1TYQ A;  1VQM N;  1CZ9 A;  4CJP A;  2ZE2 A;  4CGF A;  1ASW A;  1R59 O;  2F7T A;  4CZE A;  3QEV A;  2VGN A;  1VHX A;  2OAN A;  5FPM A;  4CK2 A;  4PKG A;  3AVC A;  3ID8 A;  4B1Z A;  3TSP A;  3S9H A;  2YJF A;  3CMA N;  2NRT A;  1ATS A;  3KK2 A;  2VG6 A;  1YVU A;  1XC3 A;  1H1V A;  3OYC A;  4E19 A;  5AQU A;  2JLE A;  1JLA A;  3D45 A;  1BIZ A;  3RSE B;  4BRI A;  5M1F A;  2DPN A;  3K9J A;  4CEQ A;  3DLL L;  4H4O A;  1J5O A;  4QCL A;  2IGI A;  1J9A A;  3CCR N;  2P9K B;  4YOT A;  1TL3 A;  4OKE A;  5EVZ A;  3FZL A;  4JEP A;  4FWL A;  2QKB A;  4KHW A;  4BE2 A;  1MWK A;  3ZET B;  5HRN A;  3KK7 A;  4FWS A;  2BE2 A;  1JXE A;  4FPB A;  1NMD A;  4BC3 A;  2KTQ A;  1JL2 A;  4FJN A;  2KZM A;  5E26 A;  1D4X A;  1UWB A;  5LY3 A;  1FKP A;  1C6V A;  4QS9 A;  4LFC K;  2B6A A;  1LOT B;  3KD5 E;  1BOT O;  3KJV A;  5JVG L;  2UXD K;  1HQU A;  4CEA A;  5FPN A;  3SLC A;  4ICL A;  4AHV A;  4CJ3 A;  2GEL A;  1EX4 A;  3LZI A;  2QEX N;  3SMS A;  4Y1D A;  2WTU A;  1RFQ A;  2DFF A;  3VQ4 A;  3Q7C A;  4JI7 K;  2QM1 A;  4UY8 O;  2Q0U A;  1YT3 A;  3O3H A;  3O9S A;  3R8E A;  4CHZ A;  3KLH A;  5AQX A;  4CF8 A;  2A1R A;  4FLY A;  1YHQ N;  4FJI A;  4B9M A;  3RSE A;  1YTA A;  4JKH A;  4H0O A;  4MLH A;  1NMN A;  1HKC A;  2HMP A;  1SL0 A;  2P9K A;  4FK0 A;  2WBN A;  2Q97 A;  3SPZ A;  3CM6 A;  3AGK A;  3ZET A;  2G8I A;  1ITG A;  1I3A A;  2EX3 A;  3QEI A;  1RCH A;  4CJS A;  4O5F A;  1I94 K;  4BR0 A;  4ILH A;  3NH0 A;  4KRE A;  4CHN A;  3O3G A;  2VWJ A;  3SV4 A;  5HP1 A;  3M3Z A;  4JD2 A;  4K25 A;  3UB5 A;  2QWQ A;  5EXW A;  5HBM A;  1X1P A;  2ZWH A;  1WSF A;  5M1P A;  3HSC A;  3U6F A;  4E1M A;  4RTF D;  3C95 A;  3NDK A;  1NKB A;  4FM2 A;  1KRP A;  4JI8 K;  4FW1 A;  4DQ8 A;  4B3S K;  2HMI A;  4FJX A;  1CZB A;  1ZBL A;  3PY8 A;  1QQO A;  1RTJ A;  4DV6 K;  1RDA A;  1HJO A;  3OA9 A;  4DWI A;  1DEJ A;  2ASP A;  3DMJ A;  2YHY A;  3DJC A;  4BGB A;  3O9Q A;  1N36 K;  3WNE A;  4E1J A;  3ENB A;  3K2P A;  1HYZ A;  5JS1 A;  4O8K A;  3OYG A;  4BVP A;  3T69 A;  4E1N A;  4WQ5 A;  3MDQ A;  1TK0 A;  3DXM B;  4CHQ A;  4FJG A;  4ELT A;  1S1U A;  3L2V A;  1JJ2 M;  5AQP A;  3LAN A;  3CER A;  2UU9 K;  1V4T A;  3EZ5 A;  2YNH A;  1YAG A;  3KHY A;  2D4W A;  2XHB A;  4MLE A;  3L6Q A;  2G8V A;  4KHQ A;  4FJJ A;  5CZ2 A;  4FJH A;  1IG8 A;  1E4G T;  1TUY A;  3SK3 A;  3OYB A;  2XY6 A;  3OBY A;  3OBW A;  1NK8 A;  2VG7 A;  4B3M K;  1N5Y A;  4PHT X;  3CCS N;  4NB4 A;  2KFZ A;  3ID6 A;  3CG7 A;  2RF2 A;  1BIS A;  3M1F A;  1ESV A;  4X62 K;  2YV0 X;  1LAV A;  3QNN A;  4DTN A;  1X3N A;  2HB5 A;  4CZJ A;  3PSI A;  5AZJ A;  4H5W A;  1SKW A;  3WT0 A;  1S9E A;  2OA8 A;  4IEI A;  1C0F A;  3BZK A;  4HTL A;  3SQ0 A;  1LW0 A;  3QIO A;  4FCY A;  4BC2 A;  4WQ4 A;  1O1W A;  3ALY A;  5AQY A;  1VQN N;  1A5V A;  5AQN A;  1YIJ N;  2YI1 A;  4JKB A;  3TAG A;  2P9U B;  3SBT A;  2YHA A;  2QWR A;  1VQ7 N;  4CJF A;  1U6Z A;  1GLJ O;  4LF4 K;  4IDK A;  1JLB A;  4LF7 K;  4FJ8 A;  3BGR A;  4ZTF A;  5IWA K;  3AA3 A;  2IAJ A;  5HLF A;  2Q36 A;  2QW9 A;  4DR6 K;  3QB0 A;  4LY7 A;  3T1H K;  4H5R A;  5J2N A;  4GV6 A;  2VWK A;  1VSD A;  3KLG A;  4BR7 A;  2VG5 A;  1IG9 A;  4H03 B;  3K5M A;  4DLG A;  4OPH A;  2P9N A;  4RCH A;  4BC5 A;  4K41 A;  3THX B;  3NMU A;  5BPN A;  3VEV A;  1LAW A;  3KKR A;  2OZM A;  4FVU A;  3CJB A;  5F2R A;  4CJL A;  4B1Y B;  2HST A;  5C12 A;  3ZSY A;  2P9U A;  1NGH A;  3JS6 A;  4CGG A;  1YIT N;  2ZD1 A;  2Q31 A;  2VGM A;  3K5O A;  1NWK A;  4CE9 A;  1RBS A;  5KPZ A;  2O8C A;  5E84 A;  4BR4 A;  2OZS A;  5GIO A;  5AQJ A;  3LP2 A;  1EP4 A;  3T1A A;  3A0I X;  4PWD A;  3V9U A;  1VQ5 N;  3IMX A;  2GBZ A;  1VSH A;  2E5L K;  4YHH K;  2W6L A;  4JK7 A;  1U2V B;  4EHT A;  2G8F A;  3VQ8 A;  1BIU A;  1IKY A;  4JI6 K;  3QML A;  1TAU A;  3M8Q A;  2KZZ A;  4M3U A;  3L2U A;  4CJU A;  5FPD A;  3THX A;  2OPQ A;  5D3G A;  1WUA A;  4F2S A;  1T44 A;  4DU3 A;  3EEQ A;  5EX5 A;  3QEP A;  4BG9 A;  1JKH A;  4EZ6 A;  4IDH A;  4CJ7 A;  3RTV A;  1DGK N;  1LW2 A;  1SL2 A;  4DTM A;  3NH2 A;  1TKX A;  2ZGY A;  4FZY A;  4DCH A;  1KXP A;  1U49 A;  4DV2 K;  3E01 A;  3VQE A;  3HO1 A;  4XIU A;  3SNN A;  5ADX A;  5CYM A;  2HHH K;  4G9Z A;  1KTQ A;  3DRR A;  3LWM A;  3V1R A;  5EOY A;  3AY9 A;  1VQK N;  3CCM N;  1K73 O;  1U2V A;  4DTR A;  1RDU A;  3LDL A;  4A61 A;  3L4I A;  4DV5 K;  4CF9 A;  1GOA A;  1U48 A;  3RRG A;  3FZK A;  4J2A A;  3KWG A;  3MN9 A;  3ITH A;  2E1Y A;  4AHS A;  4H4M A;  3AVJ A;  3F9K A;  3ZEU A;  1D8Y A;  3KVG A;  2DFH A;  1YTU A;  1CLQ A;  3MN7 A;  3TSQ A;  4JKF A;  1NJX A;  1HMV A;  3QIC A;  2BDP A;  2HHT A;  3AVM A;  3P39 A;  4FVM A;  3NGZ A;  5AQL A;  1IKV A;  3ZX2 A;  1N33 K;  3K5L A;  4DS5 A;  1W97 L;  3SQ4 A;  2FXU A;  4CZG A;  1RTI A;  5E41 A;  3K57 A;  2XY5 A;  4GMJ B;  2JWK A;  3O3F A;  4JI2 K;  4CBX A;  4Z4C A;  1HKG A;  3OW2 M;  4F8R A;  5FDL A;  4LSL A;  4BE0 A;  3MN5 A;  1XNR K;  1BA0 A;  3L4Q A;  3T19 A;  2QWL A;  4RW9 A;  1C0M A;  4KB1 A;  3MEE A;  2D0O A;  3CQ8 A;  4M45 A;  4LC9 B;  2D5R A;  4Y1C A;  3HPH A;  3D6R A;  3VQA A;  2HBK A;  2Z1H A;  3TTC A;  3BZC A;  1QSL A;  3LDP A;  4PY5 A;  2F9T A;  3V6D A;  1V4S A;  4HHT A;  4FLW A;  4WQ5 C;  5KQ8 A;  1OH8 A;  3FFI A;  2YHX A;  1IKX A;  3NVK A;  3EYZ A;  2YNG A;  4Z4E A;  4IKF A;  1Q7Y O;  4BRE A;  1BWF O;  1VQ9 N;  5CHI A;  1JLF A;  2XO7 A;  4PL8 A;  1Q81 O;  5KQD A;  4OO1 J;  2WC9 A;  3FGU A;  4A62 A;  5M1N A;  3CCV N;  1NGG A;  3VF4 A;  2HHW A;  1E3M A;  3ULD A;  3ISN C;  1IJJ A;  3H46 O;  5FRO A;  3S3M A;  4L8R B;  4CHY A;  4JAX A;  1VSL A;  4C23 A;  3VGM A;  2WOM A;  4CW7 B;  2NNW A;  3PV8 A;  4WFA L;  4FK2 A;  4BRF A;  4U67 L;  3AVG A;  3D2F A;  4A57 A;  3WNH A;  3CME N;  4NO7 A;  4B8C A;  1VSJ A;  1ZBI A;  2FSN A;  3AAR A;  4BWJ A;  4WQ4 C;  1WSE A;  4H8K A;  2IDO A;  1KAX A;  4N47 A;  1RDC A;  1W0H A;  3PUF A;  3VN5 A;  3ZSR A;  3B8A X;  1X9S A;  4M63 C;  3QO9 A;  2AA4 A;  3C65 A;  3HT3 A;  2ZF5 O;  5TKY A;  2I5J A;  3CCQ N;  3KLF A;  1U47 A;  3MEG A;  4JK8 A;  5AZI B;  4KFB A;  3AGR A;  4L3Q A;  2O8D B;  5BRH A;  3OS1 A;  3OS0 A;  5AQK A;  4BQZ A;  4CIF A;  3MEC A;  4BAC A;  3JAM O;  1YJN N;  1A5W A;  2CH5 A;  3CM5 A;  2FC0 A;  2V7Z A;  5B8H A;  1HKB A;  2P9L A;  4IJN A;  3QLH A;  5CYQ A;  3J7Y P;  3I55 N;  1TKZ A;  4H0T B;  1BCM A;  3DLB A;  4DHY A;  3ENH A;  1GOC A;  3SUN A;  1T7P A;  1TVR A;  4AM6 A;  2KW4 A;  2QI2 A;  1Y64 A;  3R9P A;  3O9U A;  5C2F A;  4M7X A;  2KHO A;  2E88 A;  3DI6 A;  3ZX0 A;  1YI2 N;  5AQG A;  1NM1 A;  1NJW A;  4EZ9 A;  1BO5 O;  2D0P A;  2PZS A;  4K8X A;  4J2E A;  5KPT A;  1C0T A;  2O8B A;  4DF8 A;  1I39 A;  1JLC A;  3SQ1 A;  3QEW A;  1N32 K;  3AO2 A;  1HJR A;  4DR4 K;  4Z4H A;  4YOW A;  2O8D A;  3TWH A;  3DRS A;  4C8K A;  1WLJ A;  2QWM A;  2Q1N A;  2Z1I A;  4O8U A;  3SYZ A;  4LF8 K;  2CGL A;  4OGC A;  5I42 A;  1S6Q A;  4M42 A;  4NLB A;  3ZT4 A;  1NK4 A;  3D0P A;  3A5L C;  2YNF A;  1TGO A;  4DMN A;  3JSM A;  4FWR A;  3F2K A;  4CF0 A;  3EKS A;  1T6D A;  4X66 K;  2FLO A;  2FF6 A;  1XHX A;  2P9P B;  3NF7 A;  4NCG A;  3ZT2 A;  2V51 B;  4LF5 K;  4C8L A;  3HOT A;  4DB3 A;  1VSI A;  1VQP N;  1IBK K;  1QSY A;  3HJF A;  3NF8 A;  2P9I B;  1Q8I A;  4KH4 A;  4FO0 A;  5C24 A;  3BF3 A;  4JYA K;  2OCE A;  4IFV A;  1RNH A;  4OPA A;  3JYT A;  3L0Q A;  4M3X A;  3GL1 A;  3NH1 A;  4CD3 A;  1VSK A;  3AV9 A;  5AQQ A;  2BTF A;  4I2Q A;  3ULE B;  4N5S A;  4BVO A;  3O6W A;  3ASM A;  4CI6 A;  4DTP A;  5SWM A;  3IRX A;  4AHU A;  2GUI A;  2DTU A;  3U8X A;  3VA0 A;  1HX1 A;  3H3O B;  5M1K A;  3TTD A;  3LDO A;  4A2A A;  3TAQ A;  3CFP A;  5K14 A;  3IG1 A;  4GNI A;  4I9Q A;  3SAG A;  5C42 A;  4JRQ A;  3CCE N;  1QE1 A;  2RPI A;  3NHG A;  4CF2 A;  3E9O A;  4KTW A;  3CYM A;  4DTJ A;  1RBV A;  1YF5 L;  2P9P A;  2AJQ A;  3ZX3 A;  3LAK A;  5KGW A;  5KPR A;  1RT2 A;  4CFA A;  2P9I A;  1IO2 A;  2ITM A;  1C1A A;  1VRU A;  1REV A;  1U4B A;  1XQS C;  3CJ9 A;  3CQY A;  4FXD A;  1NGA A;  4CF1 A;  1NK7 A;  2NUB A;  4B9L A;  1X9M A;  1NLV A;  2YHW A;  2GV9 A;  4IJA A;  1KD1 O;  3HP6 A;  2YX6 A;  1YUW A;  5C25 A;  3DLG A;  3K9K A;  3O4N A;  4DQS A;  3DYA A;  3CC2 N;  1MA9 B;  4Y0W A;  1RBU A;  2GX9 A;  3MCA B;  3NF9 A;  2Q3S A;  2HHS A;  2YNI A;  3CJ7 A;  1SUQ A;  4CJV A;  3VEN A;  3ZLJ A;  5M1Q A;  3TAE A;  3OJU A;  3O4Q A;  4CEE A;  4KI6 A;  3DOL A;  3PSF A;  3PIO L;  3CPW M;  1ZC6 A;  1HUX A;  1NJY A;  2RE2 A;  2A41 A;  4IO8 A;  2P5G A;  3MWT A;  4JKA A;  4CZF A;  1FJG K;  4DSE A;  5BPM A;  4WYB A;  2E1Z A;  5JS2 A;  3IAY A;  4E7H A;  5AQV A;  3TAM A;  3HM8 A;  3CCJ N;  2NRX A;  3LDS A;  2O4G A;  1W2B M;  3LWL A;  5HRS A;  5KI6 A;  3QBX A;  5GAE P;  2ASM A;  5JLH A;  3DLE A;  4IXC A;  4FL9 A;  3C7N B;  3I0R A;  3HST B;  3LZJ A;  1WOQ A;  3ZSZ A;  4H0X B;  1BQM A;  4JKG B;  4KHU A;  4YNQ A;  3A5O C;  5BRD A;  3A2F A;  2A6A A;  3U3G A;  3CF5 L;  1WBD A;  3VTH A;  3AVA A;  5J1E A;  3KWI A;  2WFB A;  3MX2 A;  1WN7 A;  4O4G A;  3EY1 A;  4RW6 A;  3CJ1 A;  2UUA K;  1O13 A;  3AVH A;  4CHO A;  3RVC A;  1BQN A;  3W0L A;  2IVO A;  4AHC A;  4NXM K;  4R79 A;  2QK9 A;  1VQ8 N;  4M3Z A;  3KIO A;  4C1N K;  2W41 A;  5JLF A;  4M3Y A;  2E2Q A;  3F5T A;  5AQT A;  1M1K O;  3VGK A;  3CXC M;  2X78 A;  4N56 A;  5EU7 A;  4GKK K;  5DK5 A;  3AA5 X;  3L8B A;  4GY2 B;  5AFU H;  2BAN A;  3KK3 A;  1XNQ K;  4ID5 A;  3IDH A;  3I8B A;  1JLE A;  3RR8 A;  1GLA G;  3O8M A;  3C7N A;  4B1X B;  3KLE A;  1JLG A;  4RW7 A;  3D2E B;  2G8K A;  3P1G A;  3AVF A;  2KLA A;  4JKG A;  3E9L A;  4B9N A;  4CED A;  2Q2R A;  1F21 A;  3E9P A;  4RW8 A;  4IOA L;  3DXM A;  1NG9 A;  1KAY A;  3WXK A;  4JKE A;  3MWP A;  4BY9 C;  3TAR A;  4Z94 A;  3LDN A;  3BDP A;  4JI0 K;  1RGI A;  1S1V A;  4CER A;  4HUE A;  3LAL A;  1HRH A;  3LP1 A;  2UUC K;  1ASV A;  3EN9 A;  1RIL A;  3MN6 A;  1VAZ A;  4OGE A;  4AF1 A;  1KVC A;  3GDQ A;  3QIP A;  4NCA A;  4Q5V A;  3FZM A;  4M7Y A;  5SZT A;  3TTF A;  3EKU A;  5AJ3 K;  4YDU A;  5BR9 A;  4BRD A;  2A5X A;  3AAP A;  4FLU A;  1NJI O;  5AQZ A;  2O4I A;  2O8E B;  1JCG A;  3D2E A;  2UUB K;  1RT4 A;  3O5B A;  1MDU B;  3VQD A;  3DXK B;  2HBJ A;  3N4P A;  3TAP A;  1NGC A;  4JN4 A;  3L2W A;  3K5N A;  4LF6 K;  1T3V A;  2X74 A;  3D7E O;  1EET A;  1D9D A;  3ZSV A;  4BRN A;  3OYL A;  4FLZ A;  1OVQ A;  3M5R A;  4B9T A;  1KFS A;  4DQR A;  4CK1 A;  4W5O A;  4RW4 A;  5T7B A;  3TI0 A;  3C0B A;  3SPY A;  3GE1 A;  1JCE A;  4CD1 A;  3H3N O;  4KO0 A;  3OYE A;  2ATQ A;  2ZJP L;  2PY5 A;  4CJT A;  1RT3 A;  3VQ7 A;  3HRG A;  3G10 A;  4IZ9 A;  3CC7 N;  5AQS A;  3QET A;  2QTD A;  1Q9X A;  2FBV A;  5KGX A;  4CEC A;  4XEI A;  2PYJ A;  2HNZ A;  1HNX K;  4JRP A;  3A5M C;  3P31 A;  3DXK A;  4KV8 A;  3VQ6 A;  4QS7 A;  1Z6R A;  3VTI A;  4XH4 A;  2Y1I A;  1C0G A;  1RTD A;  1YVN A;  4FLT A;  3DLK A;  2AP1 A;  3KD1 E;  1RBR A;  4CES A;  1XUP O;  4RWT A;  3WQU A;  1G15 A;  4BRK A;  3HBT A;  3VEZ A;  1EKE A;  4DV3 K;  4B9Q A;  5KRT A;  1NOZ A;  4FWQ A;  4LH5 A;  3MX5 A;  4J8F A;  2FBX A;  4Z0U A;  4BQL A;  4EHU A;  2F8S A;  4IFY A;  3E66 A;  4H5T A;  4DKW A;  4A2B A;  2HHQ A;  2WON A;  3FE1 A;  1T6C A;  1ZBS A;  5JVH L;  4FJ9 A;  4IWV A;  1HPM A;  1K9M O;  5HRR A;  4B3R K;  4HCB A;  5KRS A;  4E7L A;  3PX4 A;  1SKR A;  2NZT A;  4MO5 A;  1WSI A;  3HL8 A;  4NCB A;  3G25 A;  3SZ2 A;  1EQY A;  5DM6 L;  2O8F B;  3PIP L;  1NGE A;  3HPO A;  4ZHR A;  2GWK A;  3T3F A;  4AH9 A;  3THY B;  1GLE G;  5FRM A;  4MQ3 A;  2HNY A;  3A8Y A;  4DTS A;  3O08 A;  3QFP A;  3AA2 A;  3U9D A;  4CGH A;  3E1Y A;  2HF3 A;  1QS4 A;  3G0Z A;  4DSK A;  4QOZ B;  3DLR A;  5HRO A;  3DLH A;  1D9F A;  2B4J A;  1S1W A;  3CJA A;  4FWO A;  4CZL A;  3VQB A;  1S5J A;  3OTO K;  2W6K A;  3AVK A;  4CZI A;  1BUP A;  3M8P A;  2E4L A;  4BRM A;  3V9X A;  3U4L A;  4A5B A;  4BRL A;  3NGI A;  3VQ9 A;  3KLI A;  4YOV A;  2FF3 B;  5C2D A;  3HOS A;  3UIQ A;  4IOC L;  2DY4 A;  2HBL A;  1HNI A;  1Z25 A;  5HL7 L;  2YKN A;  3VER A;  2D0A A;  4I6M B;  1J53 A;  3THY A;  4XH5 A;  1RT6 A;  3T1Y K;  2QWN A;  3K58 A;  1ATR A;  2JGU A;  4GW6 A;  4QAG A;  3V9Z A;  4BDP A;  1LCU A;  4BDY A;  4Q0B A;  5KTQ A;  4OVL A;  4B1W B;  3AO5 A;  3QBW A;  2ITG A;  2BH1 A;  4W5R A;  5AR0 A;  4CJW A;  2X6N A;  1QQC A;  3OHR A;  3CCU N;  5GIN A;  2FSJ A;  1Q18 A;  3NFA A;  3DM2 A;  4E7J A;  4F3O A;  1QHT A;  4CHP A;  4O44 A;  4EIA A;  4N41 A;  4AHR A;  1KLM A;  2F96 A;  3MXM A;  1NGB A;  4WF9 L;  3KK1 A;  4CGJ A;  4DU1 A;  2Z1G A;  3AO1 A;  1WSG A;  4HVJ A;  2OPS A;  1X9W A;  4DR3 K;  1Z05 A;  3P5J A;  4FM0 A;  1S72 N;  4I6M A;  2A42 A;  3SJJ A;  4CBU A;  4K43 A;  2HBM A;  2QWP A;  4EFH A;  1X3M A;  2CGK A;  2ZJR L;  2OTJ N;  3CD6 N;  2P9S B;  4DSF A;  3VPZ A;  1CXU A;  3W3D A;  5BPL A;  2I7N A;  3G6E N;  3H1Q A;  4DV1 K;  4IOX A;  3B6P A;  4BRP A;  4X65 K;  1RDB A;  4NYN A;  5LJW A;  1U45 A;  2G8W A;  2HW3 A;  4IO9 L;  4K8Z A;  3TAN A;  1T05 A;  2UXB K;  4CVN E;  1GLC G;  4WCE L;  4J2B A;  4YOU A;  4OPJ A;  4FJ5 A;  1TKT A;  3VA3 A;  3QNO A;  3AVL A;  3UKR B;  3C6U A;  4DTO A;  3L3V A;  4CGD A;  2KQ2 A;  4DSL A;  1YJ9 N;  1NU0 A;  4FOE A;  3K59 A;  3WNG A;  3OJS A;  3AAQ A;  3SUO A;  3I56 N;  3M8S A;  2E2N A;  1WBB A;  1BGX T;  4JI1 K;  1SKS A;  1NK5 A;  3J8A A;  2W40 A;  4A5A A;  4YDU C;  4F3T A;  4WFB L;  4C8N A;  3IKM A;  4GV9 A;  1TK5 A;  3R1X A;  1DTT A;  4E0D A;  3RRH A;  1NBW A;  4DF4 A;  1BL3 A;  1GLF O;  3H6E A;  1Q9Y A;  1VQ4 N;  3S41 A;  3NAE A;  2HHU A;  4TSX A;  5C15 A;  4OLA A;  3OYN A;  5AQH A;  5CZ1 A;  1KFD A;  2QA4 N;  2QXL A;  3K0S A;  1ZBH A;  3KZB A;  3LL3 A;  2E6L A;  1XWL A;  5EY4 A;  1S9G A;  3WXI A;  3PLA A;  4YY3 K;  3LPT A;  1R0A A;  3ZT0 A;  2F4V K;  4FPA A;  5AZI A;  4ILG B;  3QIN A;  1XI1 A;  4E7K A;  2P5O A;  4O5B A;  5AQW A;  3ENO A;  4KTZ A;  1IV0 A;  4KB0 A;  4BC4 A;  2VYP A;  3LAM A;  1NGD A;  4ISG A;  2KFN A;  1XMQ K;  1HLU A;  4JV5 K;  2ASO A;  2VCP A;  3ZYY X;  1SL1 A;  3FR0 A;  1TUU A;  1HR0 K;  3QER A;  4H5V A;  4DQI A;  4H0Y B;  3SI6 A;  2J4R A;  1P8Z A;  2FBY A;  4EAH D;  4CFD A;  3QEX A;  4ISF A;  1SQK A;  4ISE A;  5AQI A;  1ZYQ A;  1KQS M;  4CGI A;  4BRH A;  3VES A;  1K6Y A;  3J80 O;  4CJR A;  3CHW A;  3LM2 A;  3AO4 A;  1QQN A;  3HVT A;  3O80 A;  5AFU A;  3RMD A;  5C0Y A;  4HUF A;  4NXN K;  4IBN A;  1U04 A;  4CEO A;  4KTQ A;  3WNF A;  4CIG A;  4BDZ A;  1S6P A;  4DV7 K;  4AIL C;  3EZW A;  2NRH A;  2VQE K;  4JHD B;  3SV3 A;  1NK6 A;  1JCF A;  3J7A P;  2ZGZ A;  5BN9 A;  2QWO A;  3ZSQ A;  3OYA A;  2V52 B;  4YOR A;  5BR8 K;  3J7Z O;  2GWJ A;  1B9F A;  3VQQ A;  4MDB A;  5HRP A;  1QQM A;  1WAJ A;  4BE1 A;  3GBT A;  5JIC A;  1YJW N;  1OH6 A;  1VK0 A;  3G4S N;  4YOY A;  1VSM A;  1N34 K;  4DUY K;  4CFC A;  3VGL A;  2I7P A;  4M41 A;  4C1N I;  2NRV A;  3EO3 A;  4CZH A;  3UE5 A;  3OVN A;  2F8T A;  1MWM A;  4LD0 A;  1BCO A;  4CZM A;  4AHT A;  4JI5 K;  1IKW A;  3SUQ A;  4FW2 A;  3ATV A;  4JD2 B;  4MO4 A;  3MCP A;  2YJE A;  3P83 D;  1L5U A;  3LM9 A;  3RMB A;  3P4I A;  3ULE A;  1NJZ A;  2RN2 A;  5CE3 A;  5FPE A;  1WSJ A;  4WE1 A;  2PBD A;  3EE8 A;  1SS6 A;  1ZXO A;  4BR9 A;  4UQG A;  4DLE A;  2OYQ A;  4C8O A;  3R6M A;  3A5N C;  4JHD A;  4I7F A;  5CR4 A;  1HNW K;  1WB9 A;  3O1B A;  3WXJ A;  4DR7 K;  3CPE A;  3AVI A;  1T03 A;  1NK0 A;  5BRE A;  4B3T K;  3VEO A;  2H3G X;  3DAW A;  4BWM A;  4KRF A;  4DSJ A;  1FKO A;  2Z1J A;  3CCL N;  4BGA A;  3WXL A;  1OKJ A;  1VSF A;  4DR1 K;  2NRR A;  2YKM A;  3NBP A;  2ZQB A;  4O0J A;  1DTQ A;  4B1V A;  3CQX A;  1GOB A;  2A40 A;  4KHP K;  3EL2 A;  3MXI A;  4HWI A;  1QHA A;  5AQR A;  1RDD A;  4OJR A;  4FSV A;  4E89 A;  1RDW X;  2W42 A;  4GKJ K;  4WFN L;  1XC9 A;  3V9S A;  1VQL N;  4DSI A;  4JK9 A;  2HVI A;  1NK9 A;  2OPP A;  1S22 A;  1IBM K;  3BP8 A;  3U9Z A;  5MLC Q;  2E8A A;  1UAX A;  2NRZ A;  4FJK A;  4NLC A;  1L3T A;  4OKJ A;  3F73 A;  4KBO A;  1W7A A;  1P90 A;  2UYT A;  1ZBU A;  1SAZ A;  5ELZ A;  3S3N A;  2XY8 A;  3WUH A;  4NYF A;  4FLX A;  3GOI A;  4JS4 A;  4LF9 K;  4KH5 A;  1QTM A;  4ILJ A;  1RT5 A;  3TPQ A;  3HVR A;  2XRI A;  3GG4 A;  3BUZ B;  5BN8 A;  3V4I A;  2IIR A;  3ATU A;  1SV5 A;  5AZJ B;  3RR7 A;  4JS5 A;  4HUG A;  1S1T A;  5CY4 A;  1ILY A;  2IVP A;  4CEF A;  2E2P A;  4DTX A;  2D0C A;  3ZCM A;  4IG0 A;  3OS2 A;  2KKZ A;  1NGF A;  2UXC K;  3ZSO A;  1QZ5 A;  1DLO A;  3NF6 A;  2CGJ A;  1KLN A;  4J2D A;  1EWR A;  3HYF A;  5IT9 O;  3V81 A;  4DR2 K;  1K8K B;  4PKH A;  1ASU A;  1XMO K;  3PO4 A;  3MED A;  4CCH A;  2JWL A;  3VOV A;  4YFU A;  3C6H A;  4EP4 A;  3HM9 A;  1LV5 A;  1BI4 B;  4E7I A;  4BRQ A;  4O0I A;  2PYL A;  4OLB A;  1J54 A;  3V1O A;  3VMF B;  3MK6 A;  4CZK A;  4U7B A;  5AQO A;  4OPK A;  4Z4G A;  4JI3 K;  2IC3 A;  3ZSW A;  3OYD A;  3L2Q A;  4X64 K;  2G8H A;  3TR8 A;  2VWB A;  4PA1 A;  1B92 A;  2IOC A;  1XHZ A;  1C1C A;  4JI4 K;  4FK4 A;  2X6S A;  3SJH A;  2B5J A;  2P9N B;  2BUP A;  2HHX A;  3SUP A;  3RMC A;  4KHS A;  3ZT3 A;  3ZSX A;  2E6M A;  4CJQ A;  4H5N A;  5I3U A;  4DQQ A;  4CIE A;  4KI4 A;  3HK2 A;  1QZ6 A;  2E20 A;  4FJ7 A;  1NKC A;  4OX9 K;  4DG1 A;  1K8K A;  4B9V A;  1KSP A;  4BG8 A;  3TSU A;  2HVH A;  1M90 O;  3WEE B;  4N76 A;  3NE6 A;  1TKD A;  2YHB A;  2O8C B;  3PX6 A;  3SBG A;  4BR5 A;  3V1Q A;  4KAZ A;  1BI4 A;  3NVM A;  4OKK A;  2XY7 A;  3IFR A;  1BHL A;  1RT1 A;  3O9T A;  4XH1 A;  4W5Q A;  3MMV A;  1B9D A;  2BGG A;  4FYD A;  4B8A B;  2R7Y A;  1N8R O;  4DTU A;  3SMP A;  1KAZ A;  1LWF A;  3FZH A;  5AQF A;  4DR5 K;  3L2R A;  4LSN A;  5J2M A;  1HYV A;  4PUO A;  4DV4 K;  1OVY A;  4CJ4 A;  3MAQ A;  1EWQ A;  4ELU A;  3CJC A;  1UA1 A;  5F0X A;  3OYH A;  2QKK A;  3CI5 A;  1BG3 A;  4I2P A;  4Z4F A;  4MFB A;  3HXM A;  1FW6 A;  4LH4 A;  4GV3 A;  3AVN A;  4YOX A;  1LWC A;  5GAD P;  4CJE A;  1J5E K;  5LJV A;  5DM7 L;  3KTQ A;  5J2Q A;  5AQM A;  1JLQ A;  1A5X A;  1KC8 O;  1TK8 A;  3WEE A;  1Z26 A;  2VQF K;  1L3U A;  5F1X A;  2O8E A;  3BEX A;  5FRN A;  1D5A A;  3BY5 A;  3G71 N;  3HTV A;  4BRG A;  1IH7 A;  4G1Q A;  3LP0 A;  1HNV A;  3R3L A;  4FM1 A;  1QVF M;  4KHN A;  4PQU A;  4H0P A;  3TAF A;  2P51 A;  4B9U A;  1BDG A;  3CET A;  2P1J A;  4QS8 A;  1C1B A;  4PL7 A;  3I0S A;  4LFA K;  5J2P A;  2E2O A;  4KPY A;  3HPG A;  1HYS A;  2V7Y A;  3ZEU B;  4DQP A;  2RKI A;  2HHV A;  1G99 A;  3HI0 A;  3O1W A;  2GTD A;  2NLX A;  4C8M A;  4PKI A;  4K0K K;  1ATN A;  3VQ5 A;  3N4Q A;  2Q0R A;  3FLC O;  4IFE A;  1N6Q A;  1FXX A;  2OTL N;  3C6A A;  5JMV A;  4CBW A;  3OY9 A;  4W5T A;  1BU6 O;  1K8A O;  4H0V B;  1TV6 A;  3Q7B A;  5DMR A;  3CFO A;  1EXQ A;  3VQP A;  2HF4 A;  4DU4 A; 
#chains in the Genus database with same CATH homology
 2P9I A;  1X9J A;  2ITM A;  1YJ9 N;  3FFK B;  4FWK A;  1VQO N;  4FOE A;  4BC2 A;  1XQS C;  3AAQ A;  4WQ4 A;  5AQY A;  3CJ9 A;  3SAF A;  3I56 N;  5H1S Q;  1VQN N;  2E2N A;  3CQY A;  3F9M A;  1NGA A;  3J8A A;  5HOO A;  2W40 A;  4IEE A;  5AQN A;  1YIJ N;  2YI1 A;  4A5A A;  4JKB A;  1Q82 O;  2P9U B;  4YDU C;  4WFB L;  3IKM A;  3SBT A;  4GV9 A;  3R1X A;  2QWR A;  5I9E B;  1VQ7 N;  1NBW A;  1U6Z A;  1GLJ O;  1NLV A;  2YHW A;  1GLF O;  4IJA A;  1KD1 O;  3H6E A;  3UKU B;  1CZA N;  2YX6 A;  3VF6 A;  1YUW A;  2Q36 A;  3K9K A;  2QW9 A;  1VQ4 N;  3S41 A;  4K42 A;  3QB0 A;  5C15 A;  3O9R A;  1NGI A;  4H5R A;  5AQH A;  2RHK A;  3CC2 N;  1MA9 B;  4Y0W A;  4GV6 A;  2A3Z A;  3VET A;  2GX9 A;  3O4W A;  3MCA B;  2QA4 N;  2QXL A;  2NRW A;  3CJ7 A;  1YXQ A;  4BR7 A;  3KZB A;  3LL3 A;  4H03 B;  4F9O A;  3VEN A;  5EY4 A;  3WXI A;  1BA1 A;  4OPH A;  5TKW A;  2ZJQ L;  3PLA A;  2P9N A;  4FPA A;  4ILG B;  4RCH A;  5AZI A;  4K41 A;  1SZ2 A;  5M1Q A;  4BC5 A;  2GUP A;  3NMU A;  3I33 A;  3FZF A;  5BPN A;  3H1V X;  5AQW A;  1GLD G;  3ENO A;  3VEV A;  1J6Z A;  4BC4 A;  5BRF A;  3PIO L;  3CPW M;  2VYP A;  3TU5 A;  1ZC6 A;  3M6G A;  1NGD A;  1HUX A;  4A59 A;  5GAH P;  4ISG A;  4FVU A;  1HLU A;  2RE2 A;  3CJB A;  2A41 A;  2PAV A;  4IO8 A;  5F2R A;  4MDA A;  2ASO A;  2VCP A;  3ZYY X;  4B1Y B;  2HST A;  3MWT A;  3FR0 A;  1TUU A;  4JKA A;  4CZF A;  2P9U A;  5C12 A;  5BPM A;  1NGH A;  4H5V A;  4WYB A;  3WXM B;  3JS6 A;  4H0Y B;  1YIT N;  1GLB G;  2E1Z A;  2Q31 A;  2IVN A;  2VGM A;  1NWK A;  2J4R A;  1P8Z A;  4BRO A;  5AQV A;  5KPZ A;  4B1U B;  5E84 A;  4EAH D;  4BR4 A;  3HM8 A;  5GIO A;  3LDQ A;  2NRX A;  5AQJ A;  3CCJ N;  1W2B M;  3EE9 A;  4ISF A;  3UKU A;  1SQK A;  3QBX A;  4ISE A;  5GAE P;  2ASM A;  5AQI A;  5JLH A;  1KQS M;  3A0I X;  4IXC A;  4FL9 A;  4BRH A;  2F9W A;  3C7N B;  3D2F B;  3VES A;  3CHW A;  1WOQ A;  3IMX A;  3LM2 A;  1VQ5 N;  1QQN A;  3O80 A;  5AFU A;  4H0X B;  4JKG B;  4JK7 A;  3WQT A;  3A5O C;  5GIP A;  1U2V B;  4EHT A;  5C0Y A;  5BRD A;  1NGJ A;  2A6A A;  3CF5 L;  3QML A;  3VTH A;  3CC4 N;  2HOE A;  2FSK A;  3KWI A;  4FWP A;  2WFB A;  3MX2 A;  5FPD A;  3CJ1 A;  3EZW A;  2NRH A;  1WUA A;  1O13 A;  4JHD B;  1JCF A;  1T44 A;  3RVC A;  3W0L A;  2IVO A;  5EX5 A;  2ZGZ A;  5BN9 A;  2QWO A;  1EO1 A;  4BG9 A;  4R79 A;  2PFU A;  4IDH A;  4CJ7 A;  1VQ8 N;  2WUS A;  2V52 B;  4YOR A;  3VEW A;  2W41 A;  4C1N K;  5JLF A;  3J7Z O;  1DGK N;  2E2Q A;  3F5T A;  5AQT A;  2GWJ A;  1M1K O;  4MDB A;  4IEI A;  3VGK A;  3CXC M;  2ZGY A;  1QQM A;  3GBT A;  4DCH A;  3CIP A;  5JIC A;  1KXP A;  1YJW N;  4KH6 A;  2P9L B;  3IUC A;  3G4S N;  4GY2 B;  5AFU H;  4YOY A;  3IDH A;  3QDK A;  3VGL A;  3I8B A;  4FWN A;  2I7P A;  3VEY A;  5ADX A;  4G9Z A;  1GLA G;  5GAG P;  4FWM A;  4C1N I;  1Q86 O;  3O8M A;  2NRV A;  3C7N A;  4B1X B;  3EO3 A;  3JXU A;  3VEX A;  3D2E B;  4CZH A;  3UE5 A;  1MWM A;  4CZM A;  2KLA A;  4JKG A;  3E9L A;  5EOY A;  3T7Z A;  3AY9 A;  1VQK N;  3CCM N;  1K73 O;  1U2V A;  1VQ6 N;  4BRA A;  2Q2R A;  4BRC A;  3ATV A;  1RDU A;  3LDL A;  3E9P A;  4JD2 B;  4A61 A;  3DXM A;  3L4I A;  3MCP A;  1KAY A;  2YJE A;  4MO4 A;  4IOA L;  3H45 C;  3WXK A;  3LM9 A;  3FZK A;  4JKE A;  3KWG A;  3P4I A;  3ULE A;  3MWP A;  1GLL O;  3MN9 A;  4BY9 C;  5FPE A;  5CE3 A;  2E1Y A;  4Z94 A;  2PBD A;  3EE8 A;  1SS6 A;  1ZXO A;  4BR9 A;  3LDN A;  2EWS A;  2CH6 A;  3R6M A;  3A5N C;  4JHD A;  1RGI A;  3VF2 A;  3ZEU A;  5CR4 A;  3KVG A;  3O1B A;  3WXJ A;  3CPE A;  1DKG D;  2P9S A;  5BRE A;  3VEO A;  2H3G X;  3DAW A;  3EN9 A;  4JNE A;  4AM7 A;  3MN6 A;  3MN7 A;  1VAZ A;  5ADX H;  3TSQ A;  4JKF A;  4AF1 A;  3GDQ A;  3CCL N;  4BGA A;  3QIC A;  1TYQ B;  3FZM A;  4M7Y A;  3WXL A;  1OKJ A;  3P39 A;  3TTF A;  2NRR A;  4JKC A;  1E4F T;  3QFU A;  4JKD A;  3EKU A;  5AQL A;  4YDU A;  3ZX2 A;  5BR9 A;  1W97 L;  2FXU A;  4FOI A;  4CZG A;  4BRD A;  4BR2 A;  2A5X A;  4B1V A;  3AAP A;  3CQX A;  2A40 A;  5AQZ A;  1NJI O;  1JCG A;  3P38 A;  5M1O A;  3EL2 A;  3D2E A;  4HWI A;  1QHA A;  3UKR A;  2JWK A;  5AQR A;  3O5B A;  1MDU B;  1QVG M;  4CBX A;  3DWL A;  3DXK B;  4FSV A;  1RDW X;  1HKG A;  1S3X A;  2GEM A;  4WFN L;  3OW2 M;  2HBJ A;  3N4P A;  1VQL N;  1NGC A;  3BF1 A;  4JN4 A;  3MN5 A;  1T3V A;  3HZ6 A;  1BA0 A;  3D7E O;  3L4Q A;  4JK9 A;  4BRN A;  2QWL A;  2D1K A;  1S22 A;  3BP8 A;  3U9Z A;  1DT9 A;  3SAH A;  2D0O A;  5MLC Q;  4GVE A;  3M5R A;  2E8A A;  4LC9 B;  2NRZ A;  3D6R A;  4NLC A;  2HBK A;  5C10 A;  3TTC A;  4KBO A;  2YCH A;  1P90 A;  3LDP A;  2UYT A;  1SAZ A;  5ELZ A;  2F9T A;  3C0B A;  3WUH A;  1V4S A;  3GE1 A;  1JCE A;  1TYQ A;  1VQM N;  3GOI A;  4CD1 A;  4WQ5 C;  3H3N O;  4KH5 A;  5KQ8 A;  4ILJ A;  2YHX A;  1R59 O;  2ZJP L;  3NVK A;  2F7T A;  4CZE A;  3TPQ A;  2VGN A;  2OAN A;  3GG4 A;  3BUZ B;  3HRG A;  1Q7Y O;  5FPM A;  4BRE A;  4IZ9 A;  4PKG A;  1BWF O;  2IIR A;  3ATU A;  5BN8 A;  3CC7 N;  5AQS A;  1VQ9 N;  2QTD A;  3ID8 A;  4B1Z A;  5AZJ B;  4XEI A;  5CHI A;  3TSP A;  2YJF A;  3CMA N;  2NRT A;  1ATS A;  3A5M C;  3DXK A;  3P31 A;  4QS7 A;  1Z6R A;  4PL8 A;  2IVP A;  3VTI A;  1ILY A;  4XH4 A;  1Q81 O;  5KQD A;  1XC3 A;  4OO1 J;  2WC9 A;  3FGU A;  1C0G A;  1H1V A;  2E2P A;  4A62 A;  5M1N A;  3CCV N;  1NGG A;  1YVN A;  3VF4 A;  2KKZ A;  2AP1 A;  5AQU A;  1NGF A;  3RSE B;  4BRI A;  5M1F A;  1QZ5 A;  2DPN A;  3K9J A;  1XUP O;  2CGJ A;  4RWT A;  3WQU A;  3DLL L;  4BRK A;  1IJJ A;  3H46 O;  3HBT A;  3VEZ A;  4B9Q A;  3CCR N;  2P9K B;  4JAX A;  1K8K B;  4YOT A;  4FWQ A;  4PKH A;  5EVZ A;  3FZL A;  3MX5 A;  4J8F A;  4JEP A;  4FWL A;  3VGM A;  4BQL A;  2JWL A;  3VOV A;  4C23 A;  4EHU A;  3C6H A;  2NNW A;  4WFA L;  1MWK A;  3ZET B;  3E66 A;  3KK7 A;  4H5T A;  4DKW A;  4A2B A;  4FWS A;  4BRF A;  4U67 L;  3D2F A;  4A57 A;  4BRQ A;  4FPB A;  3FE1 A;  1NMD A;  1T6C A;  1ZBS A;  4BC3 A;  5JVH L;  3CME N;  4NO7 A;  5E26 A;  4IWV A;  1D4X A;  3VMF B;  1HPM A;  3MK6 A;  4CZK A;  5LY3 A;  4U7B A;  1K9M O;  4QS9 A;  5AQO A;  2FSN A;  3AAR A;  1LOT B;  4WQ4 C;  1BOT O;  5JVG L;  2NZT A;  4MO5 A;  1KAX A;  3G25 A;  1EQY A;  3B8A X;  5FPN A;  3SLC A;  4M63 C;  2VWB A;  5DM6 L;  2AA4 A;  3C65 A;  2ZF5 O;  3PIP L;  5TKY A;  1NGE A;  2GEL A;  3CCQ N;  2GWK A;  4JK8 A;  2QEX N;  3SJH A;  2P9N B;  5AZI B;  2BUP A;  1GLE G;  3SMS A;  3AGR A;  1RFQ A;  4L3Q A;  5BRH A;  3A8Y A;  3Q7C A;  5AQK A;  3O08 A;  4H5N A;  4BQZ A;  2QM1 A;  4UY8 O;  2Q0U A;  3QFP A;  3O9S A;  3R8E A;  3U9D A;  1YJN N;  3E1Y A;  5AQX A;  2HF3 A;  1YHQ N;  2CH5 A;  3RSE A;  4JKH A;  2V7Z A;  4H0O A;  5B8H A;  4MLH A;  1HKB A;  1QZ6 A;  2P9L A;  1HKC A;  2E20 A;  2HMP A;  4IJN A;  2P9K A;  1K8K A;  3I55 N;  4BG8 A;  3CJA A;  4CZL A;  4FWO A;  4H0T B;  2WBN A;  3TSU A;  2Q97 A;  1M90 O;  3WEE B;  3AGK A;  3ZET A;  3SBG A;  4BR5 A;  4CZI A;  4DHY A;  3ENH A;  3NVM A;  4AM6 A;  1BUP A;  2QI2 A;  1Y64 A;  3R9P A;  4BRM A;  3IFR A;  3U4L A;  3O9U A;  4A5B A;  4M7X A;  5C2F A;  2KHO A;  3O9T A;  4O5F A;  2E88 A;  4XH1 A;  4BRL A;  3MMV A;  3ZX0 A;  1YI2 N;  4BR0 A;  4ILH A;  5AQG A;  2FF3 B;  5C2D A;  4YOV A;  3HOS A;  1NM1 A;  1N8R O;  3M3Z A;  4JD2 A;  4IOC L;  3SMP A;  1KAZ A;  2HBL A;  1BO5 O;  2D0P A;  3FZH A;  5AQF A;  4K25 A;  5KPT A;  3UB5 A;  2QWQ A;  5EXW A;  5HL7 L;  2ZWH A;  3VER A;  1OVY A;  4I6M B;  3CJC A;  4YOW A;  5M1P A;  4XH5 A;  5F0X A;  3HSC A;  2QWN A;  1ATR A;  3CI5 A;  4RTF D;  2QWM A;  1BG3 A;  2Q1N A;  4O8U A;  4GV3 A;  4YOX A;  4DQ8 A;  1LCU A;  2CGL A;  5GAD P;  4B1W B;  3QBW A;  4NLB A;  5LJV A;  5DM7 L;  2BH1 A;  3A5L C;  5AQM A;  5AR0 A;  3OHR A;  4FWR A;  1KC8 O;  3CCU N;  5GIN A;  2FSJ A;  3WEE A;  1QQO A;  1Q18 A;  3F2K A;  5F1X A;  3EKS A;  3BEX A;  1HJO A;  3OA9 A;  1T6D A;  4EIA A;  2FLO A;  2FF6 A;  1DEJ A;  2ASP A;  2P9P B;  3G71 N;  2V51 B;  2YHY A;  3DJC A;  3HTV A;  4BGB A;  4BRG A;  3O9Q A;  3HOT A;  4E1J A;  3ENB A;  1NGB A;  3R3L A;  4DB3 A;  1VQP N;  4WF9 L;  1QVF M;  4O8K A;  2P9I B;  4KH4 A;  4BVP A;  4FO0 A;  3T69 A;  3BF3 A;  4H0P A;  4WQ5 A;  3MDQ A;  4OPA A;  3L0Q A;  1Z05 A;  3DXM B;  3GL1 A;  1BDG A;  4CD3 A;  1S72 N;  4I6M A;  2A42 A;  5AQQ A;  2BTF A;  3ULE B;  4CBU A;  3CET A;  4BVO A;  5AQP A;  1JJ2 M;  3O6W A;  4K43 A;  3CER A;  4CI6 A;  2HBM A;  2QWP A;  4QS8 A;  4PL7 A;  4EFH A;  1V4T A;  1X3M A;  2E2O A;  1YAG A;  2CGK A;  3KHY A;  2D4W A;  2ZJR L;  2V7Y A;  3ZEU B;  4MLE A;  3U8X A;  2OTJ N;  3L6Q A;  3CD6 N;  1HX1 A;  3H3O B;  2P9S B;  5M1K A;  3TTD A;  1G99 A;  3LDO A;  3VPZ A;  4A2A A;  3HI0 A;  3O1W A;  1IG8 A;  1E4G T;  1TUY A;  3SK3 A;  3W3D A;  5BPL A;  2GTD A;  3OBY A;  2I7N A;  3OBW A;  2NLX A;  3G6E N;  3H1Q A;  4GNI A;  4PKI A;  4IOX A;  4PHT X;  1ATN A;  3SAG A;  4NB4 A;  3CCS N;  3ID6 A;  4BRP A;  3CCE N;  3N4Q A;  2Q0R A;  3FLC O;  4IFE A;  3M1F A;  5LJW A;  1ESV A;  4IO9 L;  3C6A A;  2OTL N;  5JMV A;  4CBW A;  3E9O A;  1GLC G;  4WCE L;  1YF5 L;  2P9P A;  1X3N A;  3ZX3 A;  4YOU A;  4CZJ A;  5AZJ A;  1BU6 O;  1K8A O;  4H0V B;  3Q7B A;  4H5W A;  3WT0 A;  5KPR A;  3UKR B;  1C0F A;  2HF4 A;  4HTL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...