1I94K

Crystal structures of the small ribosomal subunit with tetracycline, edeine and if3
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
123
structure length
123
Chain Sequence
KKKVKRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of complexes of the small ribosomal subunit with tetracycline, edeine and IF3.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RRNA
total genus 18
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2001-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 1i94K00
2ZM6K 4JI0K 4DR2K 5LMNK 4B3RK 3T1HK 4JI5K 4LF5K 5BR8K 4B3TK 4DR3K 2UUCK 4JI7K 4LFCK 5FLXO 4V19S 1HNWK 4JV5K 4K0KK 4DV5K 5LL6Z 4DV7K 2UU9K 1XMOK 1N32K 4LF9K 3J7AP 1IBKK 4JYAK 1HNXK 1N36K 4JI3K 3JAMO 4LF6K 4GKJK 1XNRK 1FJGK 4AQYK 3J80O 4DR5K 2E5LK 4NXMK 5AJ3K 5IWAK 4NXNK 4JI1K 1HNZK 2UXDK 4DR4K 1N34K 5A2QO 2VQEK 1XMQK 4LF4K 4X65K 2UXCK 5LMUK 2UUAK 1N33K 4LFBK 4JI2K 4DR1K 1XNQK 2UUBK 4B3MK 4KHPK 1IBMK 2HHHK 5IT9O 4JI8K 4DV3K 4YHHK 4DV2K 4DV4K 4GKKK 3T1YK 4LF8K 4DV0K 4CW7B 4OX9K 4YY3K 4B3SK 4JI6K 2UXBK 4DR7K 4DUYK 3OTOK 4LF7K 2VQFK 4CVNE 4X62K 4DUZK 3J7YP 1IBLK 4DV6K 4DR6K 1HR0K 4X66K 4JI4K 3J81O 2F4VK 4LFAK 4DV1K 1J5EK 4X64K 1I94K
chains in the Genus database with same CATH superfamily
4WCEL 4LH4A 2QI2A 4H03B 3DLEA 1NGIA 2Q31A 3AGKA 5AFUH 2P9IB 3ZCMA 4O4GA 3OYDA 1Z05A 3HVRA 4Q0BA 3VQ4A 5KTQA 3VQ5A 3O4WA 3OS2A 4IFVA 5GAEP 4ILJA 3C94A 3JSMA 3NAEA 4DS5A 2GWJA 3RR7A 3VQEA 5M1FA 1TGOA 5C24A 4DV5K 3WNGA 4PA1A 4JS5A 3V1OA 1RCHA 4I9LA 4CHYA 2VG5A 3THWB 2ZGZA 4ZTFA 4CD1A 4BQZA 4BRQA 2KZZA 2X6SA 3VQ7A 4JI3K 1S1UA 2G8VA 4BRCA 4I2PA 4JKHA 1ASWA 4BWJA 2KHOA 3QIOA 3DXMA 3NGIA 3HOSA 4DTMA 2P1JA 4EHUA 3ZT4A 3VF6A 3UKRB 3DYAA 1E3MA 4DTXA 3ENOA 2P9UB 3ZLJA 1BQMA 1SAZA 1HQUA 4CK3A 1WBDA 4H5NA 5C0YA 5BN9A 1C6VA 1U48A 3SZ2A 4ID1A 4O55A 2A40A 4BRGA 4FZZA 3OHRA 1BGXT 1KVAA 4O8UA 4DR1K 4IZ9A 2P9SB 4FWSA 2FC0A 4I9QA 3A0IX 3I33A 3QMLA 3LDOA 1NJYA 1WN7A 1RDUA 1UWBA 1KFSA 4FXDA 2Z1HA 4YY3K 1WAFA 1XUPO 4PUOA 1JLQA 1QZ6A 1E4GT 3ALYA 2FXUA 4OLBA 2VYPA 3FFKB 5CZ2A 5ADXH 1X9SA 2D1KA 1J6ZA 4CIEA 2O8FB 3KK2A 2ZD1A 4AILC 4Z4IA 3O3FA 1YHQN 1NNEA 3V9SA 4K42A 2E1YA 3NMUA 1ATSA 1C0FA 1U6ZA 1Q82O 1QQMA 1IG9A 1RTHA 3VETA 2Q97A 2CGJA 1T05A 3SLCA 5DM7L 4AHTA 3DLHA 1WBBA 1RT2A 2P9NB 3IRXA 4JI0K 1YJ9N 3HM8A 1TKXA 3AGRA 1SUQA 3WNFA 4K41A 1UOCA 4DTJA 5AQXA 4FJGA 2B6AA 1QQOA 3RRGA 2ITGA 1W9HA 1D9DA 2D0PA 4JI7K 3RMAA 5AQOA 3MX5A 4CJ5A 4CE9A 2IVPA 2GV9A 4BRIA 2A41A 4KHNA 2O8DB 4YOXA 3GBTA 1DEJA 4CF1A 4E0DA 2CGLA 1BO5O 1N32K 3WQUA 1SKRA 1QTMA 3RMCA 3HRGA 5M1KA 3CG7A 2NRZA 2D0OA 3ATUA 1SZ2A 3AVIA 4FWQA 3DLRA 1YVNA 1SV5A 1J9AA 5BPNA 1FJGK 3FR0A 3EYZA 3PV8A 2PY5A 2P9PB 1G15A 4PKHA 1CXQA 2ETJA 4FJHA 1LWEA 4I6MA 4KI6A 4KH6A 3L4QA 3NDKA 1UA0A 4O5FA 3A5LC 1JLFA 1ZBFA 3ZETB 3D45A 1XQSC 4O44A 3VQ6A 2W42A 1VQKN 4DSKA 4X65K 3LP1A 3TAEA 4FLYA 4BR0A 3NF9A 1JLGA 1V4SA 3B6OA 3L3VA 4BACA 1GOCA 3VQDA 2AA4A 5F2RA 4YHHK 4DV4K 3SUNA 2GWKA 4LF8K 5JICA 4BG8A 1NK8A 4CEFA 2IVNA 2FSJA 2D0BA 2GELA 4IWVA 5HOOA 3OBYA 5C2DA 3LAKA 1TK0A 1QHTA 2HHVA 1IH7A 4AM7A 3CETA 1NK7A 4CGFA 5I9EB 1VQMN 1NKBA 4DB3A 3V9WA 4DWIA 5AR0A 4G1QA 4MLEA 3WEEA 3BF3A 1HQEA 3ZT3A 2NZTA 1XWLA 4FJ5A 1TK8A 3KD1E 2P9LA 2O8BB 2A42A 3UE5A 3VN5A 3KK7A 1NGAA 3BUZB 1ZBSA 3CCJN 3T1HK 3IKMA 4NLCA 1VQNN 4LF5K 3D7EO 1NK0A 1QVFM 1S3XA 2RHKA 4DF8A 1ZBUA 3O3GA 2QXFA 4LD0A 2E1ZA 5EX5A 5HROA 4FJMA 3IG1A 2HB5A 1NMNA 1XHZA 4OO1J 1SL1A 5HP1A 3KLHA 4WF9L 1LWFA 1K9MO 4KFBA 4LF9K 4H0PA 1RFQA 3A5OC 4Z0UA 4CJ3A 3DLGA 3G10A 3O9QA 3HL8A 4WYBA 4CJ7A 4FSVA 5FRNA 1JLCA 4CHNA 1NBWA 3ZSXA 2P9SA 4JNEA 3EN9A 3I8DA 5HRPA 1RT4A 4DLGA 1YVUA 2IGIA 3K5NA 2F9TA 3O9SA 1I3AA 4NXNK 1SS6A 3C65A 1QQNA 3PX4A 1GLAG 3HM9A 3AVKA 4CZIA 4E89A 3VA0A 1VQPN 5SWMA 3E66A 1Q86O 3WEEB 1NK6A 3QEPA 3M8RA 4CJKA 1JL1A 5HL7L 2VGMA 2QTDA 4OKKA 1RTDA 3QINA 2YNFA 1NK4A 3R9PA 1S9GA 3MAQA 4M3ZA 2IVOA 4CVNE 1WSJA 4CGHA 3KLEA 3AO2A 4CFDA 2AP1A 2YHAA 4JN4A 4E7HA 4JK7A 4NO7A 1TV6A 3QIPA 4PKGA 2HMPA 3SV3A 3QLHA 2OA8A 5FPNA 4XIUA 4BR5A 4WQ4C 3LALA 3WNEA 4CESA 1WUAA 4B9NA 3NCIA 3ISNC 2GX9A 3LPUA 3ZSVA 4JI5K 3A2FA 1OH5A 3P5JA 4AHSA 4DR3K 4CZMA 3UIQA 3OW2M 3HJFA 5C10A 4IG3A 4CJUA 3LM2A 3SQ4A 1HPMA 1NM1A 3DLKA 2YCHA 4FK4A 2QEXN 1HKCA 1RDDA 3CCVN 3PUFA 2R7YA 3DMJA 1U49A 2XY8A 4BRHA 4AHRA 1NJIO 3U8XA 3TTFA 1EWRA 4CJEA 2YHXA 2QA4N 3L2WA 4KHWA 3QESA 3TAQA 1BUPA 3OYCA 1JLEA 4O0JA 1IKWA 2G8WA 3J8AA 3HP9A 3SAFA 5AQZA 2QWLA 2QKKA 1W2BM 3EE8A 5CR4A 4MLHA 2QW9A 5HRSA 4DSIA 2P9KA 4ISEA 2YNGA 2ZE2A 3L4IA 3K0SA 3PX6A 4DFPA 2UXCK 4FOIA 3JS6A 3M3ZA 3TSPA 4W5OA 1BA0A 1IBMK 3DRPA 4YFUA 3MMVA 4Z4GA 2HHHK 5IT9O 1JXBA 4JKFA 3DWLA 4CZLA 3T1YK 4E1JA 3KHYA 3LPTA 4DTSA 4PL7A 4LC9B 3T19A 1YIJN 3D6RA 4JRPA 2IAJA 2FLOA 4H0VB 3C7NA 3DXKB 3EZWA 4KPYA 5AZJB 4LF7K 2VQFK 3O9TA 4KKOA 3NH2A 4WE1A 2WTUA 3PO5A 4JKGB 4QS7A 3RTVA 5AQUA 2QWNA 3J81O 1TK5A 3ID6A 2JGUA 3KKRA 3RMDA 3ZEUA 4CFBA 3V6DA 4CBUA 2ZM6K 4B9MA 2RPIA 4DR2K 1TUUA 4NCBA 3RWUA 4DG1A 1T6CA 4PKIA 4DU3A 4BREA 5FRMA 2P5GA 3GE1A 4B8AB 3TI0A 5GAGP 4FJ7A 4B9UA 3OYNA 3V1RA 3H6EA 2BGGA 4B1ZA 5FLXO 1Z25A 1HYZA 4JKCA 4W5RA 1NU0A 1K8KA 5BRHA 3K9JA 1GLLO 4M45A 4HWIA 4M3UA 3DI6A 1H1VA 3G4SN 5M1OA 5FDLA 1XMOK 3GOIA 1NGHA 1NKEA 2O8CA 1QE1A 3KVGA 3IUCA 3SQ0A 2O8CB 2HF4A 5M1PA 1KLNA 3VGMA 3CM6A 4LF6K 3G6EN 1NMDA 3LL3A 4BE1A 3H3NO 2YX6A 2CH5A 2F8TA 4CIFA 3CPWM 3QNNA 1BCMA 4IFYA 3NH1A 4MO4A 1TYQB 3RSEA 4BRLA 4MO5A 2OPQA 3ZETA 3BDPA 2HHXA 3TAFA 5C12A 4FJJA 1VQON 5B8HA 3LANA 5KI6A 1NG9A 2FF3B 2UUBK 4ELUA 2A1RA 1HYSA 4G9ZA 4JI8K 5M1NA 4DLEA 4IO9L 4YOVA 4CD3A 2DPNA 4CHQA 4IG0A 4EFHA 1BIUA 4FWLA 1X9JA 2XY7A 3KK3A 3SUQA 3AVMA 4F3TA 3AVBA 4YORA 3L2QA 1YF5L 1GLDG 4M3YA 2UXBK 4U7BA 2O8FA 5DK5A 2X6NA 2QXLA 1ZXOA 1VHXA 4AH9A 2HF3A 4FZXC 2WUSA 4CJRA 4O0IA 1NOYA 4YOYA 5F1XA 2NUBA 1YTUA 4A2BA 1C1BA 4BRKA 3OYBA 4IDHA 1OH8A 5KGWA 4FCYA 1BCOA 3H1QA 1Q18A 2V51B 3OY9A 3QBXA 5AQWA 3O1WA 2HHTA 3VEXA 3SK3A 3PLAA 3HXMA 3O80A 4H4MA 4PWDA 1N5YA 1S1TA 1U2VB 3G0ZA 4HTUA 1T3VA 4BC3A 1B92A 4FO0A 4JHDB 4JKAA 1BQNA 2BTFA 2YJFA 5HBMA 5LL6Z 2HSTA 1VQ6N 1CZBA 3SI6A 1RDBA 3G25A 2YKMA 4C8KA 4BR2A 2I7NA 4FLZA 1T03A 4CZHA 3TAGA 3JAMO 1NGFA 1SL2A 4EZ9A 4DHYA 4XH4A 2YI1A 3MN7A 1XNRK 3Q7BA 2RN2A 4E1MA 3V81A 3MXMA 4FJKA 4A5AA 3VEOA 1P8ZA 3UKUA 3QERA 1X1PA 2VWBA 4E3SA 3K5LA 4K43A 3IDHA 3LM9A 1JL2A 3RSEB 5D3GA 2VGNA 4CZFA 4C1NI 4CK1A 3ASMA 5JVHL 4R5PA 3MWPA 4CEQA 4CJQA 4OPJA 4XH1A 2KFZA 4DV3K 3R3LA 2FBXA 3NF7A 1ZBHA 4IEEA 2NRVA 4Z94A 4FWRA 5JLHA 2ZWHA 5AQQA 4KHYA 4E1NA 1EO1A 2Z1IA 4CGIA 1HUXA 2FBTA 1L3TA 4QS9A 4PHTX 5KRSA 1GLFO 4BRMA 5AQMA 4B1WB 3DM2A 4LSLA 3BZKA 5TKYA 3KD5E 4IDKA 3OYLA 3D2FA 1VQ8N 3BY5A 3FZKA 5T7BA 3IAYA 1I94K 3SYZA 5HLFA 3ATVA 2FF6A 2HHSA 1VSHA 3H45C 4B3RK 5TKWA 4DQ8A 1WNSA 3TANA 5JLFA 4JRQA 1UAXA 4CJTA 1NGEA 3K59A 1CXUA 3AO4A 2ASMA 1C1AA 4B1XB 2G8IA 1KD1O 1U2VA 5KQDA 3AVGA 1MA9B 3DXMB 2EHGA 1L3SA 1LV5A 2P9PA 3MEGA 2IOCA 1BL3A 3CD6N 4DCHA 1FW6A 3VQAA 3C6TA 2Q1NA 4KREA 3L2VA 1P90A 2YJEA 4JYAK 3ZSZA 2OYQA 4UY8O 2FBVA 1IG8A 1QVGM 3FGUA 3ENBA 4Y1DA 5HRRA 4CZKA 3VA3A 2O4IA 1OKJA 5CE3A 3J80O 3BGRA 3OYMA 2BDPA 3H3OB 4ILGB 4FZYA 4A59A 3OS1A 1S9EA 3T69A 3WQTA 4FLUA 3E01A 3NHGA 2QWQA 4C8OA 4B1YB 3MECA 4CJPA 1KCFA 3PIPL 3SQ1A 2I5JA 1G99A 2WFBA 3RVCA 4JKDA 2NRXA 5AQNA 1MDUB 4J2DA 3NH0A 4CEAA 3U3GA 2YHYA 4JAXA 4IKFA 2YNIA 3CIPA 4C23A 1ZC6A 1FKOA 1NGGA 2JWKA 4CW7B 4L3QA 1UA1A 4MQ3A 3AA5X 4CF9A 2HVHA 4AF1A 3TPQA 4JI6K 2P9NA 2I7PA 3LDSA 3SUOA 4H4OA 5BN8A 1NLVA 3AVFA 4BC4A 4KHUA 3SCXA 3GG4A 3OA9A 3IS9A 1QZ5A 1J5OA 4M42A 3NBPA 3N4PA 1OH6A 3TAMA 4O8KA 2BH1A 4EAHD 3VQPA 2YHBA 4FW1A 3WXKA 3HPOA 3QEIA 3NF8A 1YAGA 5J2QA 4I2QA 4BRAA 2RKIA 1A5WA 1L3VA 3OYIA 3L2RA 2KZMA 3K2PA 3V4IA 3CJBA 1DKGD 1VSIA 2D0AA 3ZSQA 3LP2A 4N56A 2HOEA 1Q9YA 1KVCA 1FXXA 2YKNA 2Z1JA 4B1UB 4CERA 3MXJA 3OBWA 1X3MA 4DV7K 4IFEA 3THYA 4E7IA 4E7JA 1IKXA 4OLAA 3CHWA 3C6HA 3B8AX 2OCEA 3S41A 1N36K 3LP3A 1BI4B 2RF2A 4CF2A 3I55N 1REVA 1DTQA 4DR5K 2F7TA 3PO4A 3EO3A 2ZF5O 3EKSA 4FL9A 4BVPA 3BEXA 3CERA 2F96A 5IWAK 4HUEA 3U4LA 2GTDA 3LDNA 1IKVA 1W97L 3C6AA 4KH5A 4KI4A 4H0TB 4QS8A 1IJJA 4FK2A 3KWIA 3A5NC 1VQLN 2WC9A 3KTQA 4Z4CA 1VK0A 4CECA 4FVUA 3VENA 5E84A 4DFJA 3CCQN 3M6GA 2NRTA 2W40A 5LJWA 4DQSA 2W6KA 3OYKA 2HHWA 5KRTA 4EZ6A 4B3SK 3D2EA 1T8EA 1GOAA 4OKEA 3MX2A 1X9MA 4K8ZA 3FZHA 1D4XA 3SBTA 1VQ4N 3CFRA 1JCGA 2E4LA 4ILHA 3CJCA 3NVMA 1HX1A 1S5JA 1ILYA 2HBKA 3F9KA 1WAJA 4H5VA 2X78A 3V9ZA 4FJ8A 1KVBA 1YI2N 1RBSA 3AV9A 3EZ5A 4OGEA 4I7FA 3AVAA 3P39A 4DSFA 4BRDA 2W41A 4CBWA 3THYB 5GAHP 4PY5A 4BR9A 5CZ1A 3THVA 3EY1A 4A5BA 1CLQA 1C1CA 4M7YA 2O8EA 4CEDA 5F0XA 3LP0A 2XY5A 3O8MA 4K0KK 3OYJA 2ASPA 3BF1A 3NGYA 2WBNA 3THXB 3SMPA 4FJIA 3R8EA 3J7AP 3CJ9A 4CCHA 5MLCQ 4F8RA 3VQBA 1HRHA 3U6FA 3QO9A 1KRPA 3VQQA 3E1YA 1R59O 3EEQA 3QB0A 4JHDA 5FPMA 2P9UA 3AVJA 3UKUB 2Q3SA 3VMFB 3OYHA 3LDLA 2XY6A 3CCEN 3ZYYX 4JS4A 3PY8A 4CK2A 2E88A 4FM1A 4IOCL 3KLGA 4YDUC 5J2MA 4CFCA 1N34K 1FK9A 4B9LA 2P9KB 4DTNA 1F21A 3CCLN 1XMQK 1R0AA 4LF4K 3WXJA 3C95A 3OYAA 4H5WA 2DY4A 5AQSA 1K73O 3OS0A 1DTTA 4MDBA 4JK9A 4DV0K 3DJCA 1Q7YO 1RDCA 1YTAA 1RGIA 4ELTA 1K6YA 2ZQBA 4O5BA 4CJSA 3AA3A 4RW7A 1IV0A 4BC2A 4DUYK 1Y64A 3OTOK 1GLCG 5SZTA 3GL1A 1Y97A 5BRFA 5JMVA 3O4QA 1GLBG 3FZMA 2BANA 1VSMA 1NOZA 2QWPA 1RDAA 3VF2A 4A2AA 4Y0WA 4JI4K 4GY2B 4JKGA 4DMNA 4CI6A 4IBNA 4EHTA 4Y1CA 4N76A 1WSEA 4H0OA 1B9DA 1Z26A 4C1NK 1XC9A 1ZBLA 4B8CA 1WSFA 4WQ5A 3VEZA 4DFMA 4FPAA 4RTFD 4FWPA 4BVOA 2HW3A 3U9ZA 2G8UA 3IFRA 2IDOA 4NB4A 3TTDA 3AVHA 1RT1A 3CI5A 4IOXA 1KAXA 3N4QA 2FSNA 4JV5K 2D5RA 2O8EB 3VGKA 3AVLA 2F8SA 4CBXA 1JKHA 4DQPA 4KO0A 5KQ8A 1WB9A 2IIRA 3EL2A 3P4IA 4GV3A 3O6WA 3MK6A 4CIGA 3TR8A 3Q7CA 4YNQA 1WOQA 2O4GA 4CGGA 1QS4A 1SQKA 4B9SA 4FOEA 4B9QA 5C25A 3S9HA 3H1VX 2P5OA 3VTHA 4M3XA 3L6QA 4EP4A 1T7PA 1SKWA 3HO1A 4CJWA 2XRIA 3S3MA 1ATNA 2YV0X 1NJWA 4FW2A 2VG6A 4JKEA 3CCSN 4HTLA 1BG3A 3VF4A 4CJLA 2UXDK 4CF8A 3QEVA 3D2EB 4CEZA 3MN6A 3DRSA 3VQCA 4M3RA 3C6UA 5BR9A 1LAVA 3P1GA 4JI2K 1XNQK 3VESA 3S3OA 3HTVA 1VSDA 2ZJPL 2CH6A 3CC2N 3J7ZO 4AHCA 2OZSA 1JXEA 1ITGA 4HVJA 3MXIA 4WFBL 4M3WA 4DSJA 3AA2A 1GOBA 4DR7K 5C42A 2GEMA 4KAZA 1RT6A 2ATQA 3FFIA 2KFNA 1BHLA 3F2KA 3K5MA 4H0YB 3LZJA 1N8RO 1YUWA 4BE0A 4X64K 2DTUA 4DSEA 1XHXA 1EETA 3PIOL 4GNIA 2DFEA 3WUHA 1L5UA 4A61A 1ZYQA 3QFUA 4OJRA 2P51A 1ASVA 1JCEA 3OYEA 2NNWA 4KHQA 4KTQA 1KFDA 2A5XA 3ZEUB 3SJJA 4KH4A 3HPGA 3VOVA 1W7AA 3TWHA 2G8FA 3OYGA 2PYJA 1TUYA 2QKBA 4BC5A 2E2OA 4HUGA 1Q8IA 4CZJA 2E2NA 4DTUA 1D8YA 3CMAN 5AQJA 3AAPA 1BI4A 4RG8A 3MCPA 4Z4FA 5FPDA 4CJVA 2DFFA 5EOYA 2E2PA 1J54A 1IKYA 1RNHA 5AFUA 4IEIA 4N5SA 4M3TA 1K8KB 1LW0A 1D9FA 1RT3A 3O9UA 5J2PA 4AM6A 2G8KA 1M90O 1V4TA 3ULDA 2J4RA 4RW9A 4WQ5C 5E41A 4B08A 5I3UA 3TSUA 4KTZA 2XO7A 1MU2A 1HJRA 3HPHA 1S1WA 1KAYA 3K58A 2YNHA 4UQGA 1LWCA 1XC3A 4KHPK 4HUFA 4CHOA 4Z4HA 2Q0RA 3CQYA 1X9WA 5AQYA 5C15A 2OTJN 5AQGA 5AQFA 2NRRA 4JLHA 3K57A 3M8SA 3AY9A 3FZLA 1WSIA 4B1VA 1T6DA 4B9TA 5LY3A 4C8LA 1WSGA 1O13A 4KHSA 3MN9A 4X62K 2G8HA 4FWKA 2HHQA 4CHPA 3C0BA 4CGDA 4DR6K 3OVNA 3ZT2A 4FLXA 4KB0A 1L3UA 2HMIA 3VGLA 3MEDA 4NYFA 3SPYA 4BGBA 1HPZA 2PBDA 3KZBA 4A62A 4OVLA 2O8DA 4F4KA 1ATRA 3CJ1A 5ADXA 1BIZA 4Q5VA 2JLEA 4M7XA 5BR8K 5K14A 1Q9XA 1BISA 1EP4A 4IJAA 3ULEA 2BE2A 3G71N 3O4NA 2VCPA 4J2AA 3VERA 1EWQA 5AQRA 3O1BA 3PSIA 3PX0A 2GUIA 3QEXA 3TARA 1U47A 1YITN 5M1QA 3VQ9A 2E6MA 1IBKK 5ELZA 4WFNL 3SAGA 4Z4EA 1NWKA 3AVNA 3CQ8A 3RRHA 3IMXA 4TSXA 5KPZA 5FPEA 3V9UA 1LW2A 4E7KA 3WXLA 3T1AA 4FK0A 3W3DA 5AJ3K 4PQUA 4ELVA 5AQLA 4JI1K 1B9FA 1HNZK 3KWGA 3WXIA 1HYVA 2PFUA 2GUPA 1YXQA 2VQEK 4ISGA 1T44A 4JD2B 4DU1A 1NGBA 2GBZA 2ITMA 3OYFA 1KXPA 3CC4N 3E9LA 1N33K 4LFBK 1XI1A 4R79A 4C8NA 1YT3A 4LY7A 2A6AA 1ZBIA 4J8FA 4LSNA 1M1KO 4DTOA 5LJVA 4DQQA 5J2NA 2KW4A 3GDQA 4I6MB 4A57A 4QCLA 2DFHA 1TKZA 1I39A 4BRFA 4FLWA 4KV8A 3HK2A 3AARA 4L8RB 4BDPA 4FM2A 4GV9A 2KQ2A 1O1WA 4DTRA 1TVRA 5KPTA 1E4FT 3SNNA 3H46O 4CEEA 3P31A 2IS3A 5GADP 2F4VK 4LFAK 5GINA 3A5MC 3F73A 4OPAA 3L3UA 4FWNA 2WOMA 1DT9A 1YJWN 4DQRA 2P9IA 3NVKA 4BR7A 4H8KA 4B3TK 2V52B 1HMVA 4CZEA 4CHZA 3QDKA 1HNWK 1RBVA 1JCFA 4ID5A 3AO1A 1VSLA 1HLUA 3O3HA 5GIOA 3F5TA 4FJ9A 3FLCO 2VWJA 3NF6A 4F3OA 3P83D 2XHBA 4RW4A 2F9WA 2QWRA 1NGCA 2Q36A 4NCAA 3V1QA 3KLFA 4CEBA 5AQHA 1Z6RA 1TKDA 4IXCA 2E5LK 4FJNA 1NJXA 2QM1A 1QSYA 3EE9A 3M8QA 1HJOA 4K8XA 4HCCA 1JLAA 4YOWA 4WQ4A 2E8AA 3ITHA 3DRRA 2Z1GA 4BR4A 1Q81O 5LMUK 2UUAK 4JD2A 1J53A 3OJUA 1KQSM 2WONA 2ASOA 1OVYA 3AO5A 4B3MK 3ID8A 1BDGA 4B3OA 5BRDA 1C0GA 4GKKK 1TAUA 4JKBA 4CJFA 4RWTA 3HOTA 1BA1A 4BY9C 2HHUA 1VSFA 3ZX0A 1OH7A 3SPZA 2HNZA 1S1VA 3TSQA 4IOAL 3QEWA 1C0TA 4FVMA 1A5VA 4FWMA 1ASUA 2FBYA 1QSLA 4KB1A 1TAQA 4ISFA 4RW8A 5JVGL 3KIOA 4GMJB 3RMBA 2OPRA 3L0QA 2A3ZA 3VEWA 4KTWA 4WFAL 3TTCA 1U4BA 4B9VA 4BWMA 1NK5A 1EXQA 4C8MA 4KRFA 4EP5A 5AQIA 2VWKA 1RTIA 2P9LB 4FLVA 2HBMA 1VAZA 3FE1A 3PSFA 4CJ4A 3T3FA 3BP8A 2KLAA 1RDWX 3JYTA 2V7YA 4XH5A 5DM6L 4N41A 3E9PA 4AHUA 2CGKA 3U3YA 1RBUA 2UUCK 3K9KA 4AHVA 4GVMA 2OZMA 3CCMN 3W0LA 4V19S 3AAQA 3HVTA 1KSPA 4NCGA 5KPRA 4CZGA 3LAMA 5CYQA 4H5TA 3DOKA 4KBOA 3I0SA 3NE6A 3MEEA 3THWA 2UYTA 1HNXK 3S3NA 3VEYA 3A8YA 3ULEB 1W0HA 1VSEA 2HVIA 3VPZA 3NFAA 1NK9A 3LWLA 3L8BA 1FKPA 1CZAN 1NGDA 3QICA 5CHIA 4FM0A 1S1XA 4DTPA 2HNYA 2E2QA 2KKZA 2Q2RA 3QETA 3C7NB 2H3GX 3AA4A 1HNIA 3HBTA 4BROA 2HBJA 4U67L 3I56N 3VTIA 4XEIA 4BG9A 3MN5A 1WSHA 2HBLA 2FSKA 1JLBA 1KTQA 3K5OA 5EVZA 4DS4A 4OX9K 4OKJA 3ZSOA 4W5TA 5BREA 2E6LA 2KTQA 3CM5A 5DMRA 2RE2A 1QSSA 3HZ6A 4OGCA 3KK1A 5HRNA 3H08A 3WNHA 4DUZK 1IBLK 3CMEN 5C2FA 4DV6K 3CPEA 2VG7A 1LOTB 3SBGA 1C0UA 4F9OA 3LWMA 2OPSA 1N6QA 2BUPA 4CF0A 3SV4A 1RT5A 4DV1K 2OTLN 2A1SA 3E9OA 1U45A 2YHWA 2Y1JA 3SJHA 4BDYA 4BQLA 1GLEG 3F9MA 1LCUA 5AZJA 4DU4A 1NJZA 2NRWA 4LH5A 1RBTA 1S72N 2PYLA 1TL1A 3VEVA 3BZCA 4F2SA 4DFKA 1A5XA 2ZJRL 4JEPA 5EY4A 5AQKA 5CYMA 5J1EA 4FLTA 4FPBA 2PZSA 3HYFA 1VSJA 4E7LA 5I42A 1TKTA 1K8AO 3T7ZA 1EX4A 5EXWA 5GIPA 3UKRA 5AQTA 4N47A 1EQYA 4W5QA 4NYNA 4M41A 1KAZA 3O08A 5AZIB 1BU6O 1VQ9N 4OPHA 1CZ9A 4BRNA 4DSLA 4PL8A 3ZSRA 3LZIA 4AQYK 3CC7N 4YOUA 3CCRN 4YDUA 4H0XB 4RW6A 3R6MA 2LSNA 4NXMK 1EKEA 3QNOA 1QQCA 3LDQA 1WLJA 1NGJA 3KJVA 1BOTO 3ZX3A 4DR4K 3ZSWA 1YJNN 1RILA 4OPKA 3P38A 4CGJA 4DKWA 1DGKN 2HNDA 1SL0A 3L2UA 1VRUA 4GW6A 4MFBA 2OANA 4HCBA 4DV2K 1HKGA 4HHTA 1X3NA 1VQ7N 4H5RA 4MDAA 2ZGYA 3KKSA 3U9DA 2Q0UA 3QFPA 3SMSA 3O5BA 1C0MA 3AO3A 5FROA 3HSTB 4CEOA 3QBWA 3MCAB 1S6PA 3M1FA 3MDQA 3CJAA 4DQIA 4QOZB 4FWOA 4JK8A 2AJQA 3J7YP 1RTJA 1BWFO 3HI0A 3MWTA 1TL3A 3O9RA 4BDZA 5JS2A 3FZFA 1LAWA 1ESVA 2Y1IA 4X66K 1HR0K 4J2EA 1MWMA 3JXUA 3CQXA 5BPLA 1S22A 3DOLA 3DLLL 1DLOA 1SKSA 3D2FB 2PAVA 3HT3A 2EWSA 4NLBA 3CXCM 3DXKA 3ZT1A 5CY4A 3SUPA 2NRHA 3AVCA 5LMNK 3B6PA 2W6LA 3D0PA 3I8BA 2NLXA 4F2RA 1GLJO 5AZIA 4BRPA 4IO8A 5JS1A 1HNVA 2D0CA 1S6QA 3LDPA 5EU7A 4LFCK 3CFOA 1MWKA 3KLIA 1RBRA 2D4WA 1VSKA 3CYMA 2EX3A 4QAGA 4IJNA 3VQ8A 3CFPA 2UU9K 4W5NA 5H1SQ 2B5JA 3ENHA 3M5RA 2V7ZA 4EIAA 3OJSA 5AQPA 3DLBA 3SQ2A 4J2BA 4GKJK 1VQ5N 4ICLA 5AQVA 4YOTA 2JWLA 3UB5A 4GV6A 3TAPA 3TU5A 5BPMA 1VRTA 4BE2A 3DAWA 4CFAA 3THXA 3M8PA 4E19A 1IO2A 3CJ7A 3ZX2A 5A2QO 1HKBA 1RT7A 2B4JA 1U04A 3CCUN 2IC3A 4K25A 3WT0A 2OPPA 3ZSYA 5E26A 4FJLA 4BGAA 3V9XA 1TYQA 1KC8O 1D5AA 5KGXA 4ZHRA 2QK9A 3R1XA 2QWOA 2QWMA 2O8BA 1JJ2M 3CF5L 1OVQA 3WXMB 3HSCA 3TABA 4GVEA 4RCHA 4FJXA 1KLMA 3EKUA 3HP6A 2ZJQL 3NGZA 4DF4A 3SAHA 3I0RA 4ZTJA 3RR8A 1QHAA 4FYDA 2X74A 1J5EK 1NKCA 4M63C 2E20A 3ZT0A
chains in the Genus database with same CATH topology
2ZM6K 4JI0K 4DR2K 5LMNK 4B3RK 3T1HK 4JI5K 4LF5K 5BR8K 4B3TK 4DR3K 2UUCK 4JI7K 4LFCK 5FLXO 4V19S 1HNWK 4JV5K 4K0KK 4DV5K 5LL6Z 4DV7K 2UU9K 1XMOK 1N32K 4LF9K 3J7AP 1IBKK 4JYAK 1HNXK 1N36K 4JI3K 3JAMO 4LF6K 4GKJK 1XNRK 1FJGK 4AQYK 3J80O 4DR5K 2E5LK 4NXMK 5AJ3K 5IWAK 4NXNK 4JI1K 1HNZK 2UXDK 4DR4K 1N34K 5A2QO 2VQEK 1XMQK 4LF4K 4X65K 2UXCK 5LMUK 2UUAK 1N33K 4LFBK 4JI2K 4DR1K 1XNQK 2UUBK 4B3MK 4KHPK 1IBMK 2HHHK 5IT9O 4JI8K 4DV3K 4YHHK 4DV2K 4DV4K 4GKKK 3T1YK 4LF8K 4DV0K 4CW7B 4OX9K 4YY3K 4B3SK 4JI6K 2UXBK 4DR7K 4DUYK 3OTOK 4LF7K 2VQFK 4CVNE 4X62K 4DUZK 3J7YP 1IBLK 4DV6K 4DR6K 1HR0K 4X66K 4JI4K 3J81O 2F4VK 4LFAK 4DV1K 1J5EK 4X64K 1I94K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZM6 K;  4JI0 K;  4DR2 K;  5LMN K;  4B3R K;  3T1H K;  4JI5 K;  4LF5 K;  5BR8 K;  4B3T K;  4DR3 K;  2UUC K;  4JI7 K;  4LFC K;  5FLX O;  4V19 S;  1HNW K;  4JV5 K;  4K0K K;  4DV5 K;  5LL6 Z;  4DV7 K;  2UU9 K;  1XMO K;  1N32 K;  4LF9 K;  3J7A P;  1IBK K;  4JYA K;  1HNX K;  1N36 K;  4JI3 K;  3JAM O;  4LF6 K;  4GKJ K;  1XNR K;  1FJG K;  4AQY K;  3J80 O;  4DR5 K;  2E5L K;  4NXM K;  5AJ3 K;  5IWA K;  4NXN K;  4JI1 K;  1HNZ K;  2UXD K;  4DR4 K;  1N34 K;  5A2Q O;  2VQE K;  1XMQ K;  4LF4 K;  4X65 K;  2UXC K;  5LMU K;  2UUA K;  1N33 K;  4LFB K;  4JI2 K;  4DR1 K;  1XNQ K;  2UUB K;  4B3M K;  4KHP K;  1IBM K;  2HHH K;  5IT9 O;  4JI8 K;  4DV3 K;  4YHH K;  4DV2 K;  4DV4 K;  4GKK K;  3T1Y K;  4LF8 K;  4DV0 K;  4CW7 B;  4OX9 K;  4YY3 K;  4B3S K;  4JI6 K;  2UXB K;  4DR7 K;  4DUY K;  3OTO K;  4LF7 K;  2VQF K;  4CVN E;  4X62 K;  4DUZ K;  3J7Y P;  1IBL K;  4DV6 K;  4DR6 K;  1HR0 K;  4X66 K;  4JI4 K;  3J81 O;  2F4V K;  4LFA K;  4DV1 K;  1J5E K;  4X64 K;  1I94 K; 
#chains in the Genus database with same CATH topology
 4WCE L;  4LH4 A;  2QI2 A;  4H03 B;  3DLE A;  1NGI A;  2Q31 A;  3AGK A;  5AFU H;  2P9I B;  3ZCM A;  4O4G A;  3OYD A;  1Z05 A;  3HVR A;  4Q0B A;  3VQ4 A;  5KTQ A;  3VQ5 A;  3O4W A;  3OS2 A;  4IFV A;  5GAE P;  4ILJ A;  3C94 A;  3JSM A;  3NAE A;  4DS5 A;  2GWJ A;  3RR7 A;  3VQE A;  5M1F A;  1TGO A;  5C24 A;  4DV5 K;  3WNG A;  4PA1 A;  4JS5 A;  3V1O A;  1RCH A;  4I9L A;  4CHY A;  2VG5 A;  3THW B;  2ZGZ A;  4ZTF A;  4CD1 A;  4BQZ A;  4BRQ A;  2KZZ A;  2X6S A;  3VQ7 A;  4JI3 K;  1S1U A;  2G8V A;  4BRC A;  4I2P A;  4JKH A;  1ASW A;  4BWJ A;  2KHO A;  3QIO A;  3DXM A;  3NGI A;  3HOS A;  4DTM A;  2P1J A;  4EHU A;  3ZT4 A;  3VF6 A;  3UKR B;  3DYA A;  1E3M A;  4DTX A;  3ENO A;  2P9U B;  3ZLJ A;  1BQM A;  1SAZ A;  1HQU A;  4CK3 A;  1WBD A;  4H5N A;  5C0Y A;  5BN9 A;  1C6V A;  1U48 A;  3SZ2 A;  4ID1 A;  4O55 A;  2A40 A;  4BRG A;  4FZZ A;  3OHR A;  1BGX T;  1KVA A;  4O8U A;  4DR1 K;  4IZ9 A;  2P9S B;  4FWS A;  2FC0 A;  4I9Q A;  3A0I X;  3I33 A;  3QML A;  3LDO A;  1NJY A;  1WN7 A;  1RDU A;  1UWB A;  1KFS A;  4FXD A;  2Z1H A;  4YY3 K;  1WAF A;  1XUP O;  4PUO A;  1JLQ A;  1QZ6 A;  1E4G T;  3ALY A;  2FXU A;  4OLB A;  2VYP A;  3FFK B;  5CZ2 A;  5ADX H;  1X9S A;  2D1K A;  1J6Z A;  4CIE A;  2O8F B;  3KK2 A;  2ZD1 A;  4AIL C;  4Z4I A;  3O3F A;  1YHQ N;  1NNE A;  3V9S A;  4K42 A;  2E1Y A;  3NMU A;  1ATS A;  1C0F A;  1U6Z A;  1Q82 O;  1QQM A;  1IG9 A;  1RTH A;  3VET A;  2Q97 A;  2CGJ A;  1T05 A;  3SLC A;  5DM7 L;  4AHT A;  3DLH A;  1WBB A;  1RT2 A;  2P9N B;  3IRX A;  4JI0 K;  1YJ9 N;  3HM8 A;  1TKX A;  3AGR A;  1SUQ A;  3WNF A;  4K41 A;  1UOC A;  4DTJ A;  5AQX A;  4FJG A;  2B6A A;  1QQO A;  3RRG A;  2ITG A;  1W9H A;  1D9D A;  2D0P A;  4JI7 K;  3RMA A;  5AQO A;  3MX5 A;  4CJ5 A;  4CE9 A;  2IVP A;  2GV9 A;  4BRI A;  2A41 A;  4KHN A;  2O8D B;  4YOX A;  3GBT A;  1DEJ A;  4CF1 A;  4E0D A;  2CGL A;  1BO5 O;  1N32 K;  3WQU A;  1SKR A;  1QTM A;  3RMC A;  3HRG A;  5M1K A;  3CG7 A;  2NRZ A;  2D0O A;  3ATU A;  1SZ2 A;  3AVI A;  4FWQ A;  3DLR A;  1YVN A;  1SV5 A;  1J9A A;  5BPN A;  1FJG K;  3FR0 A;  3EYZ A;  3PV8 A;  2PY5 A;  2P9P B;  1G15 A;  4PKH A;  1CXQ A;  2ETJ A;  4FJH A;  1LWE A;  4I6M A;  4KI6 A;  4KH6 A;  3L4Q A;  3NDK A;  1UA0 A;  4O5F A;  3A5L C;  1JLF A;  1ZBF A;  3ZET B;  3D45 A;  1XQS C;  4O44 A;  3VQ6 A;  2W42 A;  1VQK N;  4DSK A;  4X65 K;  3LP1 A;  3TAE A;  4FLY A;  4BR0 A;  3NF9 A;  1JLG A;  1V4S A;  3B6O A;  3L3V A;  4BAC A;  1GOC A;  3VQD A;  2AA4 A;  5F2R A;  4YHH K;  4DV4 K;  3SUN A;  2GWK A;  4LF8 K;  5JIC A;  4BG8 A;  1NK8 A;  4CEF A;  2IVN A;  2FSJ A;  2D0B A;  2GEL A;  4IWV A;  5HOO A;  3OBY A;  5C2D A;  3LAK A;  1TK0 A;  1QHT A;  2HHV A;  1IH7 A;  4AM7 A;  3CET A;  1NK7 A;  4CGF A;  5I9E B;  1VQM N;  1NKB A;  4DB3 A;  3V9W A;  4DWI A;  5AR0 A;  4G1Q A;  4MLE A;  3WEE A;  3BF3 A;  1HQE A;  3ZT3 A;  2NZT A;  1XWL A;  4FJ5 A;  1TK8 A;  3KD1 E;  2P9L A;  2O8B B;  2A42 A;  3UE5 A;  3VN5 A;  3KK7 A;  1NGA A;  3BUZ B;  1ZBS A;  3CCJ N;  3T1H K;  3IKM A;  4NLC A;  1VQN N;  4LF5 K;  3D7E O;  1NK0 A;  1QVF M;  1S3X A;  2RHK A;  4DF8 A;  1ZBU A;  3O3G A;  2QXF A;  4LD0 A;  2E1Z A;  5EX5 A;  5HRO A;  4FJM A;  3IG1 A;  2HB5 A;  1NMN A;  1XHZ A;  4OO1 J;  1SL1 A;  5HP1 A;  3KLH A;  4WF9 L;  1LWF A;  1K9M O;  4KFB A;  4LF9 K;  4H0P A;  1RFQ A;  3A5O C;  4Z0U A;  4CJ3 A;  3DLG A;  3G10 A;  3O9Q A;  3HL8 A;  4WYB A;  4CJ7 A;  4FSV A;  5FRN A;  1JLC A;  4CHN A;  1NBW A;  3ZSX A;  2P9S A;  4JNE A;  3EN9 A;  3I8D A;  5HRP A;  1RT4 A;  4DLG A;  1YVU A;  2IGI A;  3K5N A;  2F9T A;  3O9S A;  1I3A A;  4NXN K;  1SS6 A;  3C65 A;  1QQN A;  3PX4 A;  1GLA G;  3HM9 A;  3AVK A;  4CZI A;  4E89 A;  3VA0 A;  1VQP N;  5SWM A;  3E66 A;  1Q86 O;  3WEE B;  1NK6 A;  3QEP A;  3M8R A;  4CJK A;  1JL1 A;  5HL7 L;  2VGM A;  2QTD A;  4OKK A;  1RTD A;  3QIN A;  2YNF A;  1NK4 A;  3R9P A;  1S9G A;  3MAQ A;  4M3Z A;  2IVO A;  4CVN E;  1WSJ A;  4CGH A;  3KLE A;  3AO2 A;  4CFD A;  2AP1 A;  2YHA A;  4JN4 A;  4E7H A;  4JK7 A;  4NO7 A;  1TV6 A;  3QIP A;  4PKG A;  2HMP A;  3SV3 A;  3QLH A;  2OA8 A;  5FPN A;  4XIU A;  4BR5 A;  4WQ4 C;  3LAL A;  3WNE A;  4CES A;  1WUA A;  4B9N A;  3NCI A;  3ISN C;  2GX9 A;  3LPU A;  3ZSV A;  4JI5 K;  3A2F A;  1OH5 A;  3P5J A;  4AHS A;  4DR3 K;  4CZM A;  3UIQ A;  3OW2 M;  3HJF A;  5C10 A;  4IG3 A;  4CJU A;  3LM2 A;  3SQ4 A;  1HPM A;  1NM1 A;  3DLK A;  2YCH A;  4FK4 A;  2QEX N;  1HKC A;  1RDD A;  3CCV N;  3PUF A;  2R7Y A;  3DMJ A;  1U49 A;  2XY8 A;  4BRH A;  4AHR A;  1NJI O;  3U8X A;  3TTF A;  1EWR A;  4CJE A;  2YHX A;  2QA4 N;  3L2W A;  4KHW A;  3QES A;  3TAQ A;  1BUP A;  3OYC A;  1JLE A;  4O0J A;  1IKW A;  2G8W A;  3J8A A;  3HP9 A;  3SAF A;  5AQZ A;  2QWL A;  2QKK A;  1W2B M;  3EE8 A;  5CR4 A;  4MLH A;  2QW9 A;  5HRS A;  4DSI A;  2P9K A;  4ISE A;  2YNG A;  2ZE2 A;  3L4I A;  3K0S A;  3PX6 A;  4DFP A;  2UXC K;  4FOI A;  3JS6 A;  3M3Z A;  3TSP A;  4W5O A;  1BA0 A;  1IBM K;  3DRP A;  4YFU A;  3MMV A;  4Z4G A;  2HHH K;  5IT9 O;  1JXB A;  4JKF A;  3DWL A;  4CZL A;  3T1Y K;  4E1J A;  3KHY A;  3LPT A;  4DTS A;  4PL7 A;  4LC9 B;  3T19 A;  1YIJ N;  3D6R A;  4JRP A;  2IAJ A;  2FLO A;  4H0V B;  3C7N A;  3DXK B;  3EZW A;  4KPY A;  5AZJ B;  4LF7 K;  2VQF K;  3O9T A;  4KKO A;  3NH2 A;  4WE1 A;  2WTU A;  3PO5 A;  4JKG B;  4QS7 A;  3RTV A;  5AQU A;  2QWN A;  3J81 O;  1TK5 A;  3ID6 A;  2JGU A;  3KKR A;  3RMD A;  3ZEU A;  4CFB A;  3V6D A;  4CBU A;  2ZM6 K;  4B9M A;  2RPI A;  4DR2 K;  1TUU A;  4NCB A;  3RWU A;  4DG1 A;  1T6C A;  4PKI A;  4DU3 A;  4BRE A;  5FRM A;  2P5G A;  3GE1 A;  4B8A B;  3TI0 A;  5GAG P;  4FJ7 A;  4B9U A;  3OYN A;  3V1R A;  3H6E A;  2BGG A;  4B1Z A;  5FLX O;  1Z25 A;  1HYZ A;  4JKC A;  4W5R A;  1NU0 A;  1K8K A;  5BRH A;  3K9J A;  1GLL O;  4M45 A;  4HWI A;  4M3U A;  3DI6 A;  1H1V A;  3G4S N;  5M1O A;  5FDL A;  1XMO K;  3GOI A;  1NGH A;  1NKE A;  2O8C A;  1QE1 A;  3KVG A;  3IUC A;  3SQ0 A;  2O8C B;  2HF4 A;  5M1P A;  1KLN A;  3VGM A;  3CM6 A;  4LF6 K;  3G6E N;  1NMD A;  3LL3 A;  4BE1 A;  3H3N O;  2YX6 A;  2CH5 A;  2F8T A;  4CIF A;  3CPW M;  3QNN A;  1BCM A;  4IFY A;  3NH1 A;  4MO4 A;  1TYQ B;  3RSE A;  4BRL A;  4MO5 A;  2OPQ A;  3ZET A;  3BDP A;  2HHX A;  3TAF A;  5C12 A;  4FJJ A;  1VQO N;  5B8H A;  3LAN A;  5KI6 A;  1NG9 A;  2FF3 B;  2UUB K;  4ELU A;  2A1R A;  1HYS A;  4G9Z A;  4JI8 K;  5M1N A;  4DLE A;  4IO9 L;  4YOV A;  4CD3 A;  2DPN A;  4CHQ A;  4IG0 A;  4EFH A;  1BIU A;  4FWL A;  1X9J A;  2XY7 A;  3KK3 A;  3SUQ A;  3AVM A;  4F3T A;  3AVB A;  4YOR A;  3L2Q A;  1YF5 L;  1GLD G;  4M3Y A;  2UXB K;  4U7B A;  2O8F A;  5DK5 A;  2X6N A;  2QXL A;  1ZXO A;  1VHX A;  4AH9 A;  2HF3 A;  4FZX C;  2WUS A;  4CJR A;  4O0I A;  1NOY A;  4YOY A;  5F1X A;  2NUB A;  1YTU A;  4A2B A;  1C1B A;  4BRK A;  3OYB A;  4IDH A;  1OH8 A;  5KGW A;  4FCY A;  1BCO A;  3H1Q A;  1Q18 A;  2V51 B;  3OY9 A;  3QBX A;  5AQW A;  3O1W A;  2HHT A;  3VEX A;  3SK3 A;  3PLA A;  3HXM A;  3O80 A;  4H4M A;  4PWD A;  1N5Y A;  1S1T A;  1U2V B;  3G0Z A;  4HTU A;  1T3V A;  4BC3 A;  1B92 A;  4FO0 A;  4JHD B;  4JKA A;  1BQN A;  2BTF A;  2YJF A;  5HBM A;  5LL6 Z;  2HST A;  1VQ6 N;  1CZB A;  3SI6 A;  1RDB A;  3G25 A;  2YKM A;  4C8K A;  4BR2 A;  2I7N A;  4FLZ A;  1T03 A;  4CZH A;  3TAG A;  3JAM O;  1NGF A;  1SL2 A;  4EZ9 A;  4DHY A;  4XH4 A;  2YI1 A;  3MN7 A;  1XNR K;  3Q7B A;  2RN2 A;  4E1M A;  3V81 A;  3MXM A;  4FJK A;  4A5A A;  3VEO A;  1P8Z A;  3UKU A;  3QER A;  1X1P A;  2VWB A;  4E3S A;  3K5L A;  4K43 A;  3IDH A;  3LM9 A;  1JL2 A;  3RSE B;  5D3G A;  2VGN A;  4CZF A;  4C1N I;  4CK1 A;  3ASM A;  5JVH L;  4R5P A;  3MWP A;  4CEQ A;  4CJQ A;  4OPJ A;  4XH1 A;  2KFZ A;  4DV3 K;  3R3L A;  2FBX A;  3NF7 A;  1ZBH A;  4IEE A;  2NRV A;  4Z94 A;  4FWR A;  5JLH A;  2ZWH A;  5AQQ A;  4KHY A;  4E1N A;  1EO1 A;  2Z1I A;  4CGI A;  1HUX A;  2FBT A;  1L3T A;  4QS9 A;  4PHT X;  5KRS A;  1GLF O;  4BRM A;  5AQM A;  4B1W B;  3DM2 A;  4LSL A;  3BZK A;  5TKY A;  3KD5 E;  4IDK A;  3OYL A;  3D2F A;  1VQ8 N;  3BY5 A;  3FZK A;  5T7B A;  3IAY A;  1I94 K;  3SYZ A;  5HLF A;  3ATV A;  2FF6 A;  2HHS A;  1VSH A;  3H45 C;  4B3R K;  5TKW A;  4DQ8 A;  1WNS A;  3TAN A;  5JLF A;  4JRQ A;  1UAX A;  4CJT A;  1NGE A;  3K59 A;  1CXU A;  3AO4 A;  2ASM A;  1C1A A;  4B1X B;  2G8I A;  1KD1 O;  1U2V A;  5KQD A;  3AVG A;  1MA9 B;  3DXM B;  2EHG A;  1L3S A;  1LV5 A;  2P9P A;  3MEG A;  2IOC A;  1BL3 A;  3CD6 N;  4DCH A;  1FW6 A;  3VQA A;  3C6T A;  2Q1N A;  4KRE A;  3L2V A;  1P90 A;  2YJE A;  4JYA K;  3ZSZ A;  2OYQ A;  4UY8 O;  2FBV A;  1IG8 A;  1QVG M;  3FGU A;  3ENB A;  4Y1D A;  5HRR A;  4CZK A;  3VA3 A;  2O4I A;  1OKJ A;  5CE3 A;  3J80 O;  3BGR A;  3OYM A;  2BDP A;  3H3O B;  4ILG B;  4FZY A;  4A59 A;  3OS1 A;  1S9E A;  3T69 A;  3WQT A;  4FLU A;  3E01 A;  3NHG A;  2QWQ A;  4C8O A;  4B1Y B;  3MEC A;  4CJP A;  1KCF A;  3PIP L;  3SQ1 A;  2I5J A;  1G99 A;  2WFB A;  3RVC A;  4JKD A;  2NRX A;  5AQN A;  1MDU B;  4J2D A;  3NH0 A;  4CEA A;  3U3G A;  2YHY A;  4JAX A;  4IKF A;  2YNI A;  3CIP A;  4C23 A;  1ZC6 A;  1FKO A;  1NGG A;  2JWK A;  4CW7 B;  4L3Q A;  1UA1 A;  4MQ3 A;  3AA5 X;  4CF9 A;  2HVH A;  4AF1 A;  3TPQ A;  4JI6 K;  2P9N A;  2I7P A;  3LDS A;  3SUO A;  4H4O A;  5BN8 A;  1NLV A;  3AVF A;  4BC4 A;  4KHU A;  3SCX A;  3GG4 A;  3OA9 A;  3IS9 A;  1QZ5 A;  1J5O A;  4M42 A;  3NBP A;  3N4P A;  1OH6 A;  3TAM A;  4O8K A;  2BH1 A;  4EAH D;  3VQP A;  2YHB A;  4FW1 A;  3WXK A;  3HPO A;  3QEI A;  3NF8 A;  1YAG A;  5J2Q A;  4I2Q A;  4BRA A;  2RKI A;  1A5W A;  1L3V A;  3OYI A;  3L2R A;  2KZM A;  3K2P A;  3V4I A;  3CJB A;  1DKG D;  1VSI A;  2D0A A;  3ZSQ A;  3LP2 A;  4N56 A;  2HOE A;  1Q9Y A;  1KVC A;  1FXX A;  2YKN A;  2Z1J A;  4B1U B;  4CER A;  3MXJ A;  3OBW A;  1X3M A;  4DV7 K;  4IFE A;  3THY A;  4E7I A;  4E7J A;  1IKX A;  4OLA A;  3CHW A;  3C6H A;  3B8A X;  2OCE A;  3S41 A;  1N36 K;  3LP3 A;  1BI4 B;  2RF2 A;  4CF2 A;  3I55 N;  1REV A;  1DTQ A;  4DR5 K;  2F7T A;  3PO4 A;  3EO3 A;  2ZF5 O;  3EKS A;  4FL9 A;  4BVP A;  3BEX A;  3CER A;  2F96 A;  5IWA K;  4HUE A;  3U4L A;  2GTD A;  3LDN A;  1IKV A;  1W97 L;  3C6A A;  4KH5 A;  4KI4 A;  4H0T B;  4QS8 A;  1IJJ A;  4FK2 A;  3KWI A;  3A5N C;  1VQL N;  2WC9 A;  3KTQ A;  4Z4C A;  1VK0 A;  4CEC A;  4FVU A;  3VEN A;  5E84 A;  4DFJ A;  3CCQ N;  3M6G A;  2NRT A;  2W40 A;  5LJW A;  4DQS A;  2W6K A;  3OYK A;  2HHW A;  5KRT A;  4EZ6 A;  4B3S K;  3D2E A;  1T8E A;  1GOA A;  4OKE A;  3MX2 A;  1X9M A;  4K8Z A;  3FZH A;  1D4X A;  3SBT A;  1VQ4 N;  3CFR A;  1JCG A;  2E4L A;  4ILH A;  3CJC A;  3NVM A;  1HX1 A;  1S5J A;  1ILY A;  2HBK A;  3F9K A;  1WAJ A;  4H5V A;  2X78 A;  3V9Z A;  4FJ8 A;  1KVB A;  1YI2 N;  1RBS A;  3AV9 A;  3EZ5 A;  4OGE A;  4I7F A;  3AVA A;  3P39 A;  4DSF A;  4BRD A;  2W41 A;  4CBW A;  3THY B;  5GAH P;  4PY5 A;  4BR9 A;  5CZ1 A;  3THV A;  3EY1 A;  4A5B A;  1CLQ A;  1C1C A;  4M7Y A;  2O8E A;  4CED A;  5F0X A;  3LP0 A;  2XY5 A;  3O8M A;  4K0K K;  3OYJ A;  2ASP A;  3BF1 A;  3NGY A;  2WBN A;  3THX B;  3SMP A;  4FJI A;  3R8E A;  3J7A P;  3CJ9 A;  4CCH A;  5MLC Q;  4F8R A;  3VQB A;  1HRH A;  3U6F A;  3QO9 A;  1KRP A;  3VQQ A;  3E1Y A;  1R59 O;  3EEQ A;  3QB0 A;  4JHD A;  5FPM A;  2P9U A;  3AVJ A;  3UKU B;  2Q3S A;  3VMF B;  3OYH A;  3LDL A;  2XY6 A;  3CCE N;  3ZYY X;  4JS4 A;  3PY8 A;  4CK2 A;  2E88 A;  4FM1 A;  4IOC L;  3KLG A;  4YDU C;  5J2M A;  4CFC A;  1N34 K;  1FK9 A;  4B9L A;  2P9K B;  4DTN A;  1F21 A;  3CCL N;  1XMQ K;  1R0A A;  4LF4 K;  3WXJ A;  3C95 A;  3OYA A;  4H5W A;  2DY4 A;  5AQS A;  1K73 O;  3OS0 A;  1DTT A;  4MDB A;  4JK9 A;  4DV0 K;  3DJC A;  1Q7Y O;  1RDC A;  1YTA A;  1RGI A;  4ELT A;  1K6Y A;  2ZQB A;  4O5B A;  4CJS A;  3AA3 A;  4RW7 A;  1IV0 A;  4BC2 A;  4DUY K;  1Y64 A;  3OTO K;  1GLC G;  5SZT A;  3GL1 A;  1Y97 A;  5BRF A;  5JMV A;  3O4Q A;  1GLB G;  3FZM A;  2BAN A;  1VSM A;  1NOZ A;  2QWP A;  1RDA A;  3VF2 A;  4A2A A;  4Y0W A;  4JI4 K;  4GY2 B;  4JKG A;  4DMN A;  4CI6 A;  4IBN A;  4EHT A;  4Y1C A;  4N76 A;  1WSE A;  4H0O A;  1B9D A;  1Z26 A;  4C1N K;  1XC9 A;  1ZBL A;  4B8C A;  1WSF A;  4WQ5 A;  3VEZ A;  4DFM A;  4FPA A;  4RTF D;  4FWP A;  4BVO A;  2HW3 A;  3U9Z A;  2G8U A;  3IFR A;  2IDO A;  4NB4 A;  3TTD A;  3AVH A;  1RT1 A;  3CI5 A;  4IOX A;  1KAX A;  3N4Q A;  2FSN A;  4JV5 K;  2D5R A;  2O8E B;  3VGK A;  3AVL A;  2F8S A;  4CBX A;  1JKH A;  4DQP A;  4KO0 A;  5KQ8 A;  1WB9 A;  2IIR A;  3EL2 A;  3P4I A;  4GV3 A;  3O6W A;  3MK6 A;  4CIG A;  3TR8 A;  3Q7C A;  4YNQ A;  1WOQ A;  2O4G A;  4CGG A;  1QS4 A;  1SQK A;  4B9S A;  4FOE A;  4B9Q A;  5C25 A;  3S9H A;  3H1V X;  2P5O A;  3VTH A;  4M3X A;  3L6Q A;  4EP4 A;  1T7P A;  1SKW A;  3HO1 A;  4CJW A;  2XRI A;  3S3M A;  1ATN A;  2YV0 X;  1NJW A;  4FW2 A;  2VG6 A;  4JKE A;  3CCS N;  4HTL A;  1BG3 A;  3VF4 A;  4CJL A;  2UXD K;  4CF8 A;  3QEV A;  3D2E B;  4CEZ A;  3MN6 A;  3DRS A;  3VQC A;  4M3R A;  3C6U A;  5BR9 A;  1LAV A;  3P1G A;  4JI2 K;  1XNQ K;  3VES A;  3S3O A;  3HTV A;  1VSD A;  2ZJP L;  2CH6 A;  3CC2 N;  3J7Z O;  4AHC A;  2OZS A;  1JXE A;  1ITG A;  4HVJ A;  3MXI A;  4WFB L;  4M3W A;  4DSJ A;  3AA2 A;  1GOB A;  4DR7 K;  5C42 A;  2GEM A;  4KAZ A;  1RT6 A;  2ATQ A;  3FFI A;  2KFN A;  1BHL A;  3F2K A;  3K5M A;  4H0Y B;  3LZJ A;  1N8R O;  1YUW A;  4BE0 A;  4X64 K;  2DTU A;  4DSE A;  1XHX A;  1EET A;  3PIO L;  4GNI A;  2DFE A;  3WUH A;  1L5U A;  4A61 A;  1ZYQ A;  3QFU A;  4OJR A;  2P51 A;  1ASV A;  1JCE A;  3OYE A;  2NNW A;  4KHQ A;  4KTQ A;  1KFD A;  2A5X A;  3ZEU B;  3SJJ A;  4KH4 A;  3HPG A;  3VOV A;  1W7A A;  3TWH A;  2G8F A;  3OYG A;  2PYJ A;  1TUY A;  2QKB A;  4BC5 A;  2E2O A;  4HUG A;  1Q8I A;  4CZJ A;  2E2N A;  4DTU A;  1D8Y A;  3CMA N;  5AQJ A;  3AAP A;  1BI4 A;  4RG8 A;  3MCP A;  4Z4F A;  5FPD A;  4CJV A;  2DFF A;  5EOY A;  2E2P A;  1J54 A;  1IKY A;  1RNH A;  5AFU A;  4IEI A;  4N5S A;  4M3T A;  1K8K B;  1LW0 A;  1D9F A;  1RT3 A;  3O9U A;  5J2P A;  4AM6 A;  2G8K A;  1M90 O;  1V4T A;  3ULD A;  2J4R A;  4RW9 A;  4WQ5 C;  5E41 A;  4B08 A;  5I3U A;  3TSU A;  4KTZ A;  2XO7 A;  1MU2 A;  1HJR A;  3HPH A;  1S1W A;  1KAY A;  3K58 A;  2YNH A;  4UQG A;  1LWC A;  1XC3 A;  4KHP K;  4HUF A;  4CHO A;  4Z4H A;  2Q0R A;  3CQY A;  1X9W A;  5AQY A;  5C15 A;  2OTJ N;  5AQG A;  5AQF A;  2NRR A;  4JLH A;  3K57 A;  3M8S A;  3AY9 A;  3FZL A;  1WSI A;  4B1V A;  1T6D A;  4B9T A;  5LY3 A;  4C8L A;  1WSG A;  1O13 A;  4KHS A;  3MN9 A;  4X62 K;  2G8H A;  4FWK A;  2HHQ A;  4CHP A;  3C0B A;  4CGD A;  4DR6 K;  3OVN A;  3ZT2 A;  4FLX A;  4KB0 A;  1L3U A;  2HMI A;  3VGL A;  3MED A;  4NYF A;  3SPY A;  4BGB A;  1HPZ A;  2PBD A;  3KZB A;  4A62 A;  4OVL A;  2O8D A;  4F4K A;  1ATR A;  3CJ1 A;  5ADX A;  1BIZ A;  4Q5V A;  2JLE A;  4M7X A;  5BR8 K;  5K14 A;  1Q9X A;  1BIS A;  1EP4 A;  4IJA A;  3ULE A;  2BE2 A;  3G71 N;  3O4N A;  2VCP A;  4J2A A;  3VER A;  1EWQ A;  5AQR A;  3O1B A;  3PSI A;  3PX0 A;  2GUI A;  3QEX A;  3TAR A;  1U47 A;  1YIT N;  5M1Q A;  3VQ9 A;  2E6M A;  1IBK K;  5ELZ A;  4WFN L;  3SAG A;  4Z4E A;  1NWK A;  3AVN A;  3CQ8 A;  3RRH A;  3IMX A;  4TSX A;  5KPZ A;  5FPE A;  3V9U A;  1LW2 A;  4E7K A;  3WXL A;  3T1A A;  4FK0 A;  3W3D A;  5AJ3 K;  4PQU A;  4ELV A;  5AQL A;  4JI1 K;  1B9F A;  1HNZ K;  3KWG A;  3WXI A;  1HYV A;  2PFU A;  2GUP A;  1YXQ A;  2VQE K;  4ISG A;  1T44 A;  4JD2 B;  4DU1 A;  1NGB A;  2GBZ A;  2ITM A;  3OYF A;  1KXP A;  3CC4 N;  3E9L A;  1N33 K;  4LFB K;  1XI1 A;  4R79 A;  4C8N A;  1YT3 A;  4LY7 A;  2A6A A;  1ZBI A;  4J8F A;  4LSN A;  1M1K O;  4DTO A;  5LJV A;  4DQQ A;  5J2N A;  2KW4 A;  3GDQ A;  4I6M B;  4A57 A;  4QCL A;  2DFH A;  1TKZ A;  1I39 A;  4BRF A;  4FLW A;  4KV8 A;  3HK2 A;  3AAR A;  4L8R B;  4BDP A;  4FM2 A;  4GV9 A;  2KQ2 A;  1O1W A;  4DTR A;  1TVR A;  5KPT A;  1E4F T;  3SNN A;  3H46 O;  4CEE A;  3P31 A;  2IS3 A;  5GAD P;  2F4V K;  4LFA K;  5GIN A;  3A5M C;  3F73 A;  4OPA A;  3L3U A;  4FWN A;  2WOM A;  1DT9 A;  1YJW N;  4DQR A;  2P9I A;  3NVK A;  4BR7 A;  4H8K A;  4B3T K;  2V52 B;  1HMV A;  4CZE A;  4CHZ A;  3QDK A;  1HNW K;  1RBV A;  1JCF A;  4ID5 A;  3AO1 A;  1VSL A;  1HLU A;  3O3H A;  5GIO A;  3F5T A;  4FJ9 A;  3FLC O;  2VWJ A;  3NF6 A;  4F3O A;  3P83 D;  2XHB A;  4RW4 A;  2F9W A;  2QWR A;  1NGC A;  2Q36 A;  4NCA A;  3V1Q A;  3KLF A;  4CEB A;  5AQH A;  1Z6R A;  1TKD A;  4IXC A;  2E5L K;  4FJN A;  1NJX A;  2QM1 A;  1QSY A;  3EE9 A;  3M8Q A;  1HJO A;  4K8X A;  4HCC A;  1JLA A;  4YOW A;  4WQ4 A;  2E8A A;  3ITH A;  3DRR A;  2Z1G A;  4BR4 A;  1Q81 O;  5LMU K;  2UUA K;  4JD2 A;  1J53 A;  3OJU A;  1KQS M;  2WON A;  2ASO A;  1OVY A;  3AO5 A;  4B3M K;  3ID8 A;  1BDG A;  4B3O A;  5BRD A;  1C0G A;  4GKK K;  1TAU A;  4JKB A;  4CJF A;  4RWT A;  3HOT A;  1BA1 A;  4BY9 C;  2HHU A;  1VSF A;  3ZX0 A;  1OH7 A;  3SPZ A;  2HNZ A;  1S1V A;  3TSQ A;  4IOA L;  3QEW A;  1C0T A;  4FVM A;  1A5V A;  4FWM A;  1ASU A;  2FBY A;  1QSL A;  4KB1 A;  1TAQ A;  4ISF A;  4RW8 A;  5JVG L;  3KIO A;  4GMJ B;  3RMB A;  2OPR A;  3L0Q A;  2A3Z A;  3VEW A;  4KTW A;  4WFA L;  3TTC A;  1U4B A;  4B9V A;  4BWM A;  1NK5 A;  1EXQ A;  4C8M A;  4KRF A;  4EP5 A;  5AQI A;  2VWK A;  1RTI A;  2P9L B;  4FLV A;  2HBM A;  1VAZ A;  3FE1 A;  3PSF A;  4CJ4 A;  3T3F A;  3BP8 A;  2KLA A;  1RDW X;  3JYT A;  2V7Y A;  4XH5 A;  5DM6 L;  4N41 A;  3E9P A;  4AHU A;  2CGK A;  3U3Y A;  1RBU A;  2UUC K;  3K9K A;  4AHV A;  4GVM A;  2OZM A;  3CCM N;  3W0L A;  4V19 S;  3AAQ A;  3HVT A;  1KSP A;  4NCG A;  5KPR A;  4CZG A;  3LAM A;  5CYQ A;  4H5T A;  3DOK A;  4KBO A;  3I0S A;  3NE6 A;  3MEE A;  3THW A;  2UYT A;  1HNX K;  3S3N A;  3VEY A;  3A8Y A;  3ULE B;  1W0H A;  1VSE A;  2HVI A;  3VPZ A;  3NFA A;  1NK9 A;  3LWL A;  3L8B A;  1FKP A;  1CZA N;  1NGD A;  3QIC A;  5CHI A;  4FM0 A;  1S1X A;  4DTP A;  2HNY A;  2E2Q A;  2KKZ A;  2Q2R A;  3QET A;  3C7N B;  2H3G X;  3AA4 A;  1HNI A;  3HBT A;  4BRO A;  2HBJ A;  4U67 L;  3I56 N;  3VTI A;  4XEI A;  4BG9 A;  3MN5 A;  1WSH A;  2HBL A;  2FSK A;  1JLB A;  1KTQ A;  3K5O A;  5EVZ A;  4DS4 A;  4OX9 K;  4OKJ A;  3ZSO A;  4W5T A;  5BRE A;  2E6L A;  2KTQ A;  3CM5 A;  5DMR A;  2RE2 A;  1QSS A;  3HZ6 A;  4OGC A;  3KK1 A;  5HRN A;  3H08 A;  3WNH A;  4DUZ K;  1IBL K;  3CME N;  5C2F A;  4DV6 K;  3CPE A;  2VG7 A;  1LOT B;  3SBG A;  1C0U A;  4F9O A;  3LWM A;  2OPS A;  1N6Q A;  2BUP A;  4CF0 A;  3SV4 A;  1RT5 A;  4DV1 K;  2OTL N;  2A1S A;  3E9O A;  1U45 A;  2YHW A;  2Y1J A;  3SJH A;  4BDY A;  4BQL A;  1GLE G;  3F9M A;  1LCU A;  5AZJ A;  4DU4 A;  1NJZ A;  2NRW A;  4LH5 A;  1RBT A;  1S72 N;  2PYL A;  1TL1 A;  3VEV A;  3BZC A;  4F2S A;  4DFK A;  1A5X A;  2ZJR L;  4JEP A;  5EY4 A;  5AQK A;  5CYM A;  5J1E A;  4FLT A;  4FPB A;  2PZS A;  3HYF A;  1VSJ A;  4E7L A;  5I42 A;  1TKT A;  1K8A O;  3T7Z A;  1EX4 A;  5EXW A;  5GIP A;  3UKR A;  5AQT A;  4N47 A;  1EQY A;  4W5Q A;  4NYN A;  4M41 A;  1KAZ A;  3O08 A;  5AZI B;  1BU6 O;  1VQ9 N;  4OPH A;  1CZ9 A;  4BRN A;  4DSL A;  4PL8 A;  3ZSR A;  3LZI A;  4AQY K;  3CC7 N;  4YOU A;  3CCR N;  4YDU A;  4H0X B;  4RW6 A;  3R6M A;  2LSN A;  4NXM K;  1EKE A;  3QNO A;  1QQC A;  3LDQ A;  1WLJ A;  1NGJ A;  3KJV A;  1BOT O;  3ZX3 A;  4DR4 K;  3ZSW A;  1YJN N;  1RIL A;  4OPK A;  3P38 A;  4CGJ A;  4DKW A;  1DGK N;  2HND A;  1SL0 A;  3L2U A;  1VRU A;  4GW6 A;  4MFB A;  2OAN A;  4HCB A;  4DV2 K;  1HKG A;  4HHT A;  1X3N A;  1VQ7 N;  4H5R A;  4MDA A;  2ZGY A;  3KKS A;  3U9D A;  2Q0U A;  3QFP A;  3SMS A;  3O5B A;  1C0M A;  3AO3 A;  5FRO A;  3HST B;  4CEO A;  3QBW A;  3MCA B;  1S6P A;  3M1F A;  3MDQ A;  3CJA A;  4DQI A;  4QOZ B;  4FWO A;  4JK8 A;  2AJQ A;  3J7Y P;  1RTJ A;  1BWF O;  3HI0 A;  3MWT A;  1TL3 A;  3O9R A;  4BDZ A;  5JS2 A;  3FZF A;  1LAW A;  1ESV A;  2Y1I A;  4X66 K;  1HR0 K;  4J2E A;  1MWM A;  3JXU A;  3CQX A;  5BPL A;  1S22 A;  3DOL A;  3DLL L;  1DLO A;  1SKS A;  3D2F B;  2PAV A;  3HT3 A;  2EWS A;  4NLB A;  3CXC M;  3DXK A;  3ZT1 A;  5CY4 A;  3SUP A;  2NRH A;  3AVC A;  5LMN K;  3B6P A;  2W6L A;  3D0P A;  3I8B A;  2NLX A;  4F2R A;  1GLJ O;  5AZI A;  4BRP A;  4IO8 A;  5JS1 A;  1HNV A;  2D0C A;  1S6Q A;  3LDP A;  5EU7 A;  4LFC K;  3CFO A;  1MWK A;  3KLI A;  1RBR A;  2D4W A;  1VSK A;  3CYM A;  2EX3 A;  4QAG A;  4IJN A;  3VQ8 A;  3CFP A;  2UU9 K;  4W5N A;  5H1S Q;  2B5J A;  3ENH A;  3M5R A;  2V7Z A;  4EIA A;  3OJS A;  5AQP A;  3DLB A;  3SQ2 A;  4J2B A;  4GKJ K;  1VQ5 N;  4ICL A;  5AQV A;  4YOT A;  2JWL A;  3UB5 A;  4GV6 A;  3TAP A;  3TU5 A;  5BPM A;  1VRT A;  4BE2 A;  3DAW A;  4CFA A;  3THX A;  3M8P A;  4E19 A;  1IO2 A;  3CJ7 A;  3ZX2 A;  5A2Q O;  1HKB A;  1RT7 A;  2B4J A;  1U04 A;  3CCU N;  2IC3 A;  4K25 A;  3WT0 A;  2OPP A;  3ZSY A;  5E26 A;  4FJL A;  4BGA A;  3V9X A;  1TYQ A;  1KC8 O;  1D5A A;  5KGX A;  4ZHR A;  2QK9 A;  3R1X A;  2QWO A;  2QWM A;  2O8B A;  1JJ2 M;  3CF5 L;  1OVQ A;  3WXM B;  3HSC A;  3TAB A;  4GVE A;  4RCH A;  4FJX A;  1KLM A;  3EKU A;  3HP6 A;  2ZJQ L;  3NGZ A;  4DF4 A;  3SAH A;  3I0R A;  4ZTJ A;  3RR8 A;  1QHA A;  4FYD A;  2X74 A;  1J5E K;  1NKC A;  4M63 C;  2E20 A;  3ZT0 A; 
#chains in the Genus database with same CATH homology
 2ZM6 K;  4JI0 K;  4DR2 K;  5LMN K;  4B3R K;  3T1H K;  4JI5 K;  4LF5 K;  5BR8 K;  4B3T K;  4DR3 K;  2UUC K;  4JI7 K;  4LFC K;  5FLX O;  4V19 S;  1HNW K;  4JV5 K;  4K0K K;  4DV5 K;  5LL6 Z;  4DV7 K;  2UU9 K;  1XMO K;  1N32 K;  4LF9 K;  3J7A P;  1IBK K;  4JYA K;  1HNX K;  1N36 K;  4JI3 K;  3JAM O;  4LF6 K;  4GKJ K;  1XNR K;  1FJG K;  4AQY K;  3J80 O;  4DR5 K;  2E5L K;  4NXM K;  5AJ3 K;  5IWA K;  4NXN K;  4JI1 K;  1HNZ K;  2UXD K;  4DR4 K;  1N34 K;  5A2Q O;  2VQE K;  1XMQ K;  4LF4 K;  4X65 K;  2UXC K;  5LMU K;  2UUA K;  1N33 K;  4LFB K;  4JI2 K;  4DR1 K;  1XNQ K;  2UUB K;  4B3M K;  4KHP K;  1IBM K;  2HHH K;  5IT9 O;  4JI8 K;  4DV3 K;  4YHH K;  4DV2 K;  4DV4 K;  4GKK K;  3T1Y K;  4LF8 K;  4DV0 K;  4CW7 B;  4OX9 K;  4YY3 K;  4B3S K;  4JI6 K;  2UXB K;  4DR7 K;  4DUY K;  3OTO K;  4LF7 K;  2VQF K;  4CVN E;  4X62 K;  4DUZ K;  3J7Y P;  1IBL K;  4DV6 K;  4DR6 K;  1HR0 K;  4X66 K;  4JI4 K;  3J81 O;  2F4V K;  4LFA K;  4DV1 K;  1J5E K;  4X64 K;  1I94 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...