1I94K

Crystal structures of the small ribosomal subunit with tetracycline, edeine and if3
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
123
structure length
123
Chain Sequence
b'KKKVKRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RRNA
publication title Crystal structures of complexes of the small ribosomal subunit with tetracycline, edeine and IF3.
pubmed doi rcsb
molecule tags Ribosome
total genus 18
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2001-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 1i94K00
4LF5K 3J81O 1IBKK 2ZM6K 4DR1K 4AQYK 3T1YK 1FJGK 4LF9K 5FLXO 1HNWK 2UU9K 4GKJK 4LFAK 1HNXK 3J7YP 5LMUK 1N34K 4JI1K 1HNZK 4JI0K 1XNRK 5AJ3K 4DV1K 4DV5K 4X66K 5IWAK 4OX9K 2VQEK 2UXDK 4X65K 2UUCK 4JI2K 4B3SK 4DR6K 4X62K 4JYAK 1XNQK 5LMNK 4DR5K 2E5LK 2UUAK 4LF7K 1I94K 4CVNE 4DR2K 4YHHK 1HR0K 4LF8K 4DUZK 4DV7K 4DV0K 4DV6K 1N32K 4DUYK 1N36K 4K0KK 3J7AP 4DV3K 2UUBK 4NXNK 2HHHK 2UXCK 1IBLK 4CW7B 3OTOK 2UXBK 5A2QO 4JV5K 4LFCK 4JI8K 4V19S 5BR8K 4DR4K 1XMOK 4DR7K 4DV2K 4LF6K 4GKKK 4LFBK 4DR3K 2F4VK 1IBMK 4YY3K 4JI6K 1N33K 4JI5K 1J5EK 4B3RK 2VQFK 5IT9O 3J80O 4LF4K 3T1HK 4DV4K 4NXMK 3JAMO 4B3TK 4X64K 4JI4K 1XMQK 4JI7K 4KHPK 4JI3K 4B3MK 5LL6Z
chains in the Genus database with same CATH superfamily
5KQ8A 1WBDA 2FC0A 3HOSA 1RT2A 1ATSA 5BREA 3T1YK 1JJ2M 3O5BA 1ZBSA 2Z1GA 2Q1NA 2O8FA 4Z4FA 2Q31A 3MWPA 1OH7A 4JHDB 1YJ9N 1N34K 1IKVA 4KRFA 4DU4A 2NRHA 4FZZA 4KKOA 3VQEA 3QNOA 2Q0UA 3BEXA 4KAZA 1RBUA 4DV5K 3AVCA 4HCBA 3TTFA 2X74A 2A6AA 3ZX0A 5KRSA 4CEOA 4H03B 1NK7A 2YNFA 4AHVA 5FPMA 3B6PA 3WEEA 4JRQA 4WE1A 4NCGA 2AP1A 5TKWA 3ZT4A 1RTJA 4RW4A 1ESVA 3VMFB 3QINA 2HNYA 1J9AA 4PHTX 1N36K 3ATVA 1S1WA 1X1PA 4C23A 3VQ5A 4CCHA 4H0OA 3JYTA 1KVAA 3PIOL 3OTOK 4PUOA 4K25A 3CJAA 2P9KB 3CMEN 2AJQA 1JXBA 4GY2B 4H4OA 4CF9A 1BWFO 4LF6K 1NGAA 4E7LA 2P9LB 3AV9A 1YTAA 2HB5A 4CI6A 1N33K 4K41A 2QWQA 3ZT3A 1HYZA 4UQGA 2KFNA 2FBTA 3GE1A 3O08A 3P31A 5AQOA 4CK1A 3OYNA 4NXMK 3KZBA 1VSFA 1D5AA 1CZAN 1VSEA 1VK0A 3TAEA 3VQ8A 1VQNN 1ZBLA 2NRVA 3SQ0A 4BR4A 4Z94A 4LF5K 1W9HA 4F3TA 1IKWA 2RPIA 2F8SA 3PUFA 4CESA 4C1NK 3F9KA 5SZTA 4XH5A 1NWKA 1V4TA 1YT3A 3M8PA 3AA4A 3AA2A 5MLCQ 3SUOA 2BH1A 3C65A 4NLCA 3TAPA 1RTHA 3SLCA 1K8KA 1RT5A 1NJWA 2ASOA 4JI0K 1Q86O 4M3YA 3AO5A 3U9DA 1YI2N 1SL1A 2P5GA 4Z4EA 3ZLJA 2E2OA 1GLCG 3VEOA 3I33A 3JSMA 3NVKA 4DU1A 3I56N 5LMNK 3AARA 1IG9A 3VQCA 1I94K 4CGHA 3DWLA 3ID8A 1HR0K 5BPLA 1XC3A 1MWMA 3AY9A 2HBLA 3T3FA 1NM1A 3DXKB 3ATUA 3K5NA 4QAGA 1NJXA 4MDBA 1S1VA 4LH5A 5AQXA 4DSLA 4CF0A 3JS6A 2XY5A 4BRIA 2VWBA 4O55A 4DTUA 2E6MA 4IOXA 3O4NA 2B6AA 1UAXA 2GWJA 4CJ5A 4GV9A 2NRWA 2NZTA 4YFUA 1K73O 1L5UA 4JI8K 4AH9A 4CGFA 3L2QA 3KTQA 3M6GA 2OTLN 1QSYA 3A5LC 3GL1A 2XHBA 4DTMA 5DMRA 1WSIA 5JICA 3QESA 1W97L 2F4VK 1QHAA 1JCFA 4WFAL 3CM5A 2O8BB 4BRQA 2GELA 1VRTA 3CCMN 4KBOA 4JRPA 3TPQA 4KB1A 3CPEA 3OY9A 1J5EK 5JLHA 1KRPA 4IBNA 3U8XA 5IT9O 1HMVA 1JLFA 2HNZA 3LANA 1A5XA 4JKAA 2P9PA 3NGZA 4B3TK 4Z4CA 4JI4K 5FRNA 4DTSA 5KPTA 3ID6A 1NKCA 4XH1A 1W0HA 4B1YB 4BR2A 3G4SN 4FYDA 3CCUN 3VEVA 4OLAA 4M3TA 4QS9A 4JKEA 2JWKA 4FK2A 3NCIA 3L4IA 3L2WA 1GLLO 4CZHA 2FF6A 2IVNA 1S22A 3B6OA 1HNXK 1UOCA 2D0PA 1JLGA 1Q82O 3SBTA 4IFYA 1EQYA 4CIEA 1U45A 5M1NA 4FW1A 4HVJA 2BDPA 3VQAA 2Z1HA 5BRHA 1RBVA 3E66A 2KZMA 1HJOA 4CK2A 2V7ZA 1RDDA 1RT1A 4NCAA 4ISEA 2QEXN 4RWTA 3E9PA 1KAZA 1VRUA 2E5LK 3GDQA 4ID1A 3QFPA 3IRXA 3THYA 1C1BA 1CXQA 3ASMA 5AZJA 3CPWM 1S72N 5AQFA 4CHOA 4GV3A 3CCLN 4H8KA 4WQ4A 3MEGA 1DTTA 4G9ZA 3NVMA 4DV3K 2PFUA 4CJTA 3VENA 1QSSA 1TL3A 2WBNA 3CCSN 3DXMA 1NLVA 4CZLA 2KFZA 5H1SQ 3LDPA 4WQ5C 3DLBA 4OVLA 4JKGA 1RBTA 1VQKN 3O4QA 1OH6A 3PX0A 3UB5A 2FSJA 5FRMA 1A5WA 1S1UA 2ZD1A 2QWPA 3BDPA 3G6EN 4H0YB 4FWPA 3ULEB 4B3RK 3IKMA 5HRPA 3SI6A 4IWVA 3FFIA 4IFEA 4B9VA 4DS5A 1QVFM 3DOKA 5GAHP 4Y0WA 5GADP 3KWGA 4N5SA 3SMPA 4KV8A 3BZKA 3IMXA 3HP9A 4DQIA 1T03A 5M1QA 1X3MA 2FBXA 4KH5A 1RDBA 1YVUA 2HHXA 4PWDA 1OVQA 3I8BA 4U7BA 3QEPA 1CLQA 3W0LA 4GKJK 3M3ZA 4PA1A 2O8CA 2QWOA 3V1QA 2XO7A 2ZGYA 4O0IA 3E9LA 3O4WA 4C8KA 4CEBA 3CC7N 5LMUK 2OYQA 4F8RA 4ZHRA 4K8ZA 3QNNA 1GLAG 3C6AA 1XQSC 4E0DA 3AVMA 3ZX2A 1TGOA 3KK1A 4IEEA 3CCVN 4DTOA 2E6LA 2WC9A 4DLEA 3ZX3A 3LP0A 3OS1A 3O9UA 1XNQK 4NLBA 3HL8A 4AHUA 3ZSOA 1KC8O 3V6DA 3VTIA 1I3AA 5J1EA 1HYSA 2P9NB 4YOTA 3QIPA 4LF8K 1YXQA 1BIUA 3CJ9A 1Q8IA 3KJVA 3EZWA 5I42A 4JHDA 4AM7A 1BGXT 4DUYK 3VOVA 2CGKA 4KTZA 4CJVA 5F2RA 4M7XA 5C2FA 3KLHA 3K58A 3L2RA 3MECA 4M7YA 2UXBK 5AQHA 4BGBA 3MN5A 3RTVA 3CFOA 5AQSA 4FVMA 1XMOK 4M3UA 3QFUA 1QQOA 4CJPA 1VSIA 4JK8A 3NGYA 1XHZA 1B92A 2Z1JA 3M8SA 3CIPA 3S3NA 3IUCA 2AA4A 2Q36A 1RT4A 3MX5A 3CMAN 1IG8A 4C1NI 3BY5A 3R8EA 3C0BA 5DK5A 2ITMA 3KLFA 3MN9A 4QS7A 1Z05A 4DTPA 3D7EO 4BQLA 1KVCA 2A5XA 4LH4A 2GV9A 1HLUA 3F2KA 4CJWA 3G0ZA 1NGHA 1C1CA 1BI4B 4R5PA 3Q7BA 2NRRA 2P9KA 3PX4A 4XEIA 5ADXA 4M3ZA 1HNWK 2W6KA 2IAJA 2P9LA 4FCYA 1L3VA 3VGMA 1FW6A 1E4GT 3SQ4A 3V9UA 3PY8A 1EP4A 1Q18A 5ADXH 3CM6A 1YAGA 2VGNA 1NGBA 4CHNA 1Q81O 1SS6A 1XI1A 1NGCA 4H0TB 2YI1A 3TAFA 1Q9YA 5CY4A 4BVOA 3HVTA 3P38A 2OZSA 2DY4A 3O6WA 2RHKA 4MO4A 4FJ5A 5HOOA 3VEWA 1KLNA 5CYMA 3A0IX 3P1GA 4CFAA 4DFJA 1EXQA 1WSEA 3T69A 2FBVA 1IO2A 1GLEG 3AVKA 3DI6A 2FSNA 3FZLA 3MAQA 4IOCL 2OPPA 1X9MA 1LAVA 4H5VA 3LAMA 3NFAA 1L3UA 4Q5VA 3CXCM 2ZJRL 5HBMA 3CQYA 3T19A 3RMAA 3U3YA 2P51A 2UUBK 1MWKA 2VGMA 3VQPA 5AQZA 3ULDA 3C7NB 4N41A 2D4WA 4KHYA 1X9JA 2HHUA 1NGEA 4LFCK 4OGEA 4FXDA 3A8YA 3WNEA 2KLAA 4DR7K 4KHUA 4OPAA 4PL8A 1U4BA 4CGJA 3TWHA 2A40A 2I7PA 3WQUA 1HX1A 3QLHA 1XWLA 1IKYA 3O9RA 5KPZA 4AILC 2D0BA 4B1UB 4CEEA 3F73A 4DFMA 3G25A 4BRLA 1HPZA 4DTXA 3L0QA 1RGIA 2HVIA 4DV4K 4BWJA 2DFEA 4JEPA 3ALYA 4E89A 1S9EA 5C15A 3CC4N 2GUIA 4YORA 3QICA 1SQKA 2VG6A 3ENBA 4N76A 1NGFA 4E19A 4XH4A 1OH5A 1FKOA 5M1KA 1VSMA 3HSCA 1TYQA 1DLOA 5SWMA 2QTDA 3WQTA 2HBKA 1KVBA 1GOAA 1BA1A 3TSPA 3O1WA 3LZIA 2RKIA 3H1VX 4KH6A 2EWSA 3A2FA 3HT3A 1QZ5A 3KVGA 5TKYA 1XNRK 4DQ8A 1VQON 1VQMN 3BZCA 3CJ7A 4CFCA 3JXUA 3AGRA 5BRDA 4I6MB 4OKJA 5FPEA 4WFNL 5M1PA 2UUCK 1RBRA 1GLJO 4OPHA 4JYAK 2F9WA 4BC2A 1E3MA 3EKUA 3UKRB 5J2PA 1DEJA 1RDUA 1VSLA 3RVCA 4H0PA 1GLBG 4FW2A 1GLDG 2P9SB 3NF6A 1DTQA 4FWRA 2G8HA 3QBWA 3MEDA 1WB9A 1SKSA 3L4QA 1TKDA 4DV0K 2ZJPL 1D9DA 3OYLA 4DSKA 3L3UA 4Z4GA 4AHSA 4BACA 3DLGA 2A42A 1EWQA 2IOCA 4KO0A 3NF7A 3DLKA 4M45A 3KHYA 2EHGA 2HNDA 4RW7A 4JV5K 1WAFA 4QOZB 3ZSZA 3DMJA 4LFBK 5FPDA 4EZ9A 1NK9A 4OKKA 4DMNA 3AGKA 4TSXA 5BN9A 4CJ4A 4WCEL 3D6RA 4DCHA 3A5NC 3KWIA 3GG4A 4CF1A 1IKXA 2IC3A 3NMUA 2VCPA 4FZXC 3AVFA 3O3HA 3OVNA 1ZBIA 3LL3A 4AF1A 3V4IA 5CYQA 3K57A 3M8RA 1QE1A 1QQCA 1WUAA 5AQKA 3OS0A 2HF4A 5JS2A 1NGGA 4KI6A 1DT9A 3V1OA 4B1XB 4XIUA 4OJRA 1X3NA 3TAMA 3MXIA 4CHYA 1TVRA 2B4JA 2ASPA 3U9ZA 3S9HA 3G10A 2LSNA 4IO8A 4H5RA 4E7HA 5CZ2A 1U49A 3NGIA 3RMCA 3KD5E 3DRRA 4JKDA 1DGKN 2GTDA 3DLHA 4DKWA 4DQRA 4DTRA 3HI0A 1MDUB 3KD1E 3MMVA 3SAHA 1C1AA 5AQGA 5AQUA 4DF8A 4O0JA 2J4RA 3AA5X 2R7YA 1KQSM 3BF3A 1IJJA 5EU7A 2ZWHA 4EAHD 2QWMA 4FLUA 1ZBFA 3EL2A 4IO9L 1DKGD 3BF1A 4OPJA 3LP2A 4Z4HA 1QSLA 4Y1CA 4DB3A 1VQ4N 3AAQA 2YJEA 5JLFA 3V9XA 4YOWA 3V9WA 4DSIA 1U6ZA 3TTCA 2QXLA 3K9KA 4CFDA 1X9WA 1WNSA 4A62A 3IFRA 1D8YA 5CR4A 2FLOA 4BRFA 4RW8A 2GWKA 3PX6A 1BCOA 5D3GA 2UXCK 2NUBA 4B9SA 1LWEA 3SPYA 1YHQN 3T1AA 4I2PA 2RN2A 3PSFA 2YKNA 2KW4A 2OCEA 1HJRA 1ILYA 2V7YA 2NRZA 3AVNA 4QS8A 3K5OA 3SYZA 4B1VA 3CYMA 4CEAA 4FWQA 2CGLA 2P9NA 2V51B 2DTUA 1XHXA 2G8WA 3R1XA 2PY5A 1C0FA 4YOUA 3V9ZA 3R3LA 3FGUA 4MFBA 5HRSA 3VQBA 3O8MA 4MO5A 2I7NA 4X64K 4EHUA 5DM7L 1XMQK 5J2MA 3BGRA 3LP1A 4AHRA 1NJZA 1RDAA 2F8TA 4B8CA 1OVYA 1IBKK 1KXPA 2X78A 3AO3A 4FM1A 5JVHL 3HZ6A 3K5LA 3L2UA 3D2FB 3NF9A 4ILGB 3SPZA 1BU6O 3LDOA 5HRNA 2BANA 2O4GA 2ZJQL 3OYKA 2XRIA 4DTJA 4O8KA 4HUGA 4BRGA 2D0CA 1BDGA 4MLEA 3LWLA 4E1MA 1JL1A 2BE2A 3SNNA 3HPGA 3NAEA 4DS4A 5GAEP 3HYFA 1BG3A 3O3GA 4CHZA 4EHTA 3ZSXA 3K59A 5K14A 1LV5A 3IAYA 5AQTA 3WXKA 1BI4A 2BUPA 4X62K 4BRAA 2ZGZA 1JLCA 4BE2A 2QWLA 4FM2A 4KHQA 4FPAA 5KPRA 2Q97A 4M42A 4MQ3A 4DUZK 5CZ1A 4PY5A 1YUWA 2KTQA 1S6PA 3AVAA 4BRDA 4DV7K 5M1OA 3H3NO 1N5YA 3U4LA 3MX2A 1SKRA 1EO1A 2PYJA 3BP8A 3WXIA 1T8EA 1BA0A 3H45C 1HUXA 5GAGP 4B9MA 3V9SA 1RTDA 4CECA 3P39A 5GINA 3HPOA 4ZTJA 2FF3B 5BR8K 2JWLA 2HHWA 4ID5A 3L2VA 2OPRA 4PKIA 5HRRA 3SCXA 2VWJA 1JL2A 3NH2A 1NK0A 4DLGA 2W42A 3N4PA 1SZ2A 4U67L 4HHTA 1RDCA 3ENHA 3MEEA 4J2AA 1CXUA 1SL0A 4M3WA 3SQ2A 4CHPA 1X9SA 3DAWA 3J80O 3FFKB 3K9JA 3F5TA 4LY7A 1UWBA 3PIPL 4B1WB 5JS1A 1JLQA 1EKEA 2QWRA 3ZT0A 1XUPO 3PLAA 3K5MA 1L3SA 1YJWN 1NKBA 4CJ7A 3C7NA 3LP3A 5KI6A 1HNIA 3KK2A 3THWA 1NOYA 1FJGK 3RRGA 3VF6A 2JLEA 1UA0A 4DHYA 5EXWA 4IZ9A 3DLEA 3WXMB 4B8AB 1LWFA 4ISFA 5LY3A 2OTJN 3KKSA 4FJJA 4CJKA 3HRGA 3AVLA 4FWNA 3LPUA 2E8AA 5AJ3K 4FL9A 2OZMA 1TKTA 1WN7A 1WAJA 2ITGA 1TK8A 1XC9A 4M41A 4Y1DA 3QETA 4CEZA 4DU3A 4K43A 3MN6A 4B08A 1VSHA 4CJEA 3O9QA 3UKUB 3SJJA 3I0RA 3THVA 4YNQA 3EE9A 3G71N 4PL7A 3K2PA 3OYJA 5C2DA 1O1WA 4C8NA 2DFFA 1N32K 1OKJA 3J7AP 3CG7A 4FJXA 1K8KB 2HW3A 3HVRA 1NJYA 4PKGA 1NJIO 1LW2A 3ZYYX 2PYLA 3AVJA 4UY8O 3M8QA 3VERA 1T7PA 4FJLA 4CJLA 4DF4A 2YKMA 4FWMA 4I6MA 2YNHA 4JNEA 3OBWA 1RT6A 2WFBA 4F9OA 4YOYA 2ATQA 3UKRA 2CH6A 1EETA 4CGDA 1TK5A 2ZQBA 2P9IB 1YJNN 4FWSA 3HM9A 1KTQA 2VYPA 4BC5A 2P9SA 4CBXA 2W6LA 1T6DA 2P1JA 5KTQA 4BRCA 4H0VB 1SV5A 4L3QA 2HHTA 1EWRA 4KFBA 4IFVA 2Q3SA 3RR7A 4KHPK 4NYNA 5AQJA 1YTUA 4CZGA 3U3GA 2F96A 3H3OB 4DQPA 2ZM6K 3SV4A 2E2NA 5KQDA 1HPMA 3DLLL 1FXXA 1NMDA 1CZBA 4JKCA 3OYMA 4FJ9A 3HK2A 1BCMA 3O9TA 1NK6A 3LM9A 3HOTA 2A3ZA 4BRHA 4GVMA 3DOLA 3W3DA 4HCCA 4F3OA 3ITHA 3QBXA 3LDLA 3V1RA 1SKWA 3VTHA 1REVA 3WT0A 5IWAK 4CEQA 1HQUA 3CCRN 4X65K 3OYCA 3J7ZO 2FXUA 4KTWA 3VESA 5JVGL 2UUAK 2KZZA 3VETA 3TSUA 3AVIA 3QO9A 3B8AX 1RCHA 4FLVA 2EX3A 3ZETB 3SAGA 3KLGA 2G8IA 3GBTA 3CI5A 3CETA 1JXEA 3E1YA 4LC9B 2G8UA 4FJNA 3RR8A 1H1VA 4H0XB 3CJCA 4DWIA 3ZEUB 1F21A 2HHHK 4MDAA 3CFRA 3FZKA 5A2QO 1I39A 4IKFA 4FWOA 3KIOA 1K6YA 3QMLA 3MK6A 4BC3A 2HSTA 3VQ4A 3VF2A 4GKKK 3GOIA 3L3VA 2O8EB 2X6SA 4FO0A 3M1FA 4BR5A 4CK3A 5E84A 3WUHA 4BRNA 2QXFA 1VQ7N 3VQQA 3CD6N 3KLEA 3FR0A 1WOQA 4EZ6A 4EP5A 1GOCA 2IGIA 4K42A 3ZSYA 3CCQN 1RBSA 2OPQA 1LWCA 4CGIA 3R9PA 1CZ9A 4DQQA 1ASUA 4KHWA 4H5WA 1WSJA 5AQWA 3VF4A 2WONA 1QQNA 5DM6L 5AQMA 4FJKA 3K0SA 5FLXO 1BUPA 2GUPA 3SBGA 2YHXA 4W5QA 4LFAK 3DXKA 4ELTA 4WFBL 2O4IA 4M63C 2E4LA 4N47A 3T7ZA 4WQ5A 4L8RB 4ILJA 3RSEB 4GVEA 4IG3A 2IVOA 3ENOA 3CJBA 4X66K 4BVPA 3MXJA 3DRSA 1Y64A 3LZJA 2A1SA 1IV0A 3HO1A 1E4FT 1U47A 2O8BA 2F7TA 5F1XA 5T7BA 2E2QA 2RF2A 3I0SA 4HUFA 1U48A 3D2FA 1WSFA 3CCEN 5I3UA 1Y97A 3O80A 2O8DB 4JN4A 3VQ9A 4ZTFA 3TTDA 4OGCA 4LD0A 1FK9A 5BRFA 3MWTA 3IG1A 3VN5A 4YOXA 4KB0A 3TR8A 1D4XA 1LAWA 4FM0A 3HJFA 4IJNA 3O3FA 2W40A 3OA9A 4E1NA 4PKHA 4DFPA 1KCFA 1SAZA 3HBTA 4FLWA 3LDNA 2QM1A 3DYAA 3C6TA 5AQPA 2YX6A 3SJHA 1LW0A 4JAXA 4BG8A 2NLXA 2ZE2A 3ZT1A 3DRPA 3QB0A 1J53A 4Q0BA 1VAZA 4KH4A 4FJMA 3FZHA 3OS2A 2P5OA 3WXLA 3TI0A 2OA8A 1YIJN 3VEZA 2BGGA 5AZIB 4W5NA 3D2EB 1MU2A 4JD2B 4WF9L 3L8BA 1BIZA 4OLBA 4A57A 1NK5A 1BHLA 4DSJA 1JCGA 4WQ4C 5CE3A 1ZC6A 3VGLA 4HTLA 4I7FA 4DR1K 5EY4A 2YHBA 3AVHA 3OBYA 2HMIA 1KLMA 4BDZA 4BE1A 4CJ3A 1ASVA 3EKSA 5FROA 2F9TA 1S5JA 3HSTB 1BOTO 3HP6A 1YF5L 4CJSA 1T44A 1HNZK 5CHIA 4W5OA 4BE0A 1C0TA 5AQYA 1A5VA 4CJFA 2I5JA 4CERA 4KHNA 4W5TA 3OYBA 1NBWA 2E1ZA 1OH8A 3NBPA 1TAUA 2QA4N 3S3MA 1YITN 4CZFA 4B9TA 4FLZA 2UXDK 3SUNA 3NE6A 4JI2K 2VG5A 4DR6K 3TARA 1C0GA 3LM2A 2Y1IA 1RTIA 3D0PA 4FK0A 2YHAA 4CIFA 2Z1IA 4A61A 4ELVA 1VHXA 4BR0A 5HP1A 4DR2K 5KRTA 1K9MO 3SK3A 3ULEA 2JGUA 2WUSA 2ASMA 1U2VB 4JS5A 4BREA 5FDLA 3MN7A 2D1KA 4AM6A 1YVNA 2ETJA 4DFKA 1KFDA 4NXNK 2P9UB 2V52B 4A2AA 4CD3A 3OYHA 1IBLK 1N6QA 1BISA 1J6ZA 1B9DA 2CH5A 3UIQA 2QKBA 2HHVA 3FZFA 3NDKA 3VEYA 1VSKA 1O13A 3EE8A 3EEQA 2UYTA 1L3TA 3UE5A 4BROA 4E7IA 1VSJA 1LOTB 2D0AA 3KKRA 3EZ5A 5AQLA 4DQSA 3UKUA 2RE2A 4JI5K 1V4SA 4C8MA 5AFUA 4CZKA 4FSVA 4W5RA 5FPNA 3CCJN 4YDUA 1TK0A 5AFUH 1WBBA 3ZSWA 4FJ7A 5AQIA 4B3MK 4CZJA 2YV0X 4N56A 1KAYA 4DTNA 4JK7A 1WSGA 1VQLN 2HF3A 2IVPA 2YHWA 5B8HA 2XY6A 1HNVA 5E26A 4BR7A 2QKKA 4H5NA 4I9LA 4QCLA 3SMSA 2HBMA 3OJSA 2HOEA 4IG0A 4C8LA 3AO2A 2P9IA 1RNHA 4ILHA 2YJFA 1BO5O 4HUEA 1ZXOA 3FZMA 4CBWA 2VG7A 3VA3A 1QHTA 2W41A 3C95A 1J5OA 1VSDA 3WXJA 4E7KA 2YHYA 1Z26A 4FLXA 4OX9K 3CJ1A 3CQ8A 3OYIA 2XY8A 1K8AO 2FSKA 1SUQA 2A1RA 4ISGA 5LJWA 1JLEA 2DFHA 3VEXA 3SUPA 1RT7A 2BTFA 1N8RO 3THXB 5KGWA 3H08A 4RG8A 4FWLA 1TYQB 3N4QA 1R0AA 3C94A 2Y1JA 3F9MA 4FPBA 5EVZA 3ZSVA 1HQEA 1HYVA 4CJUA 1VQ6N 4RCHA 4GNIA 4BRMA 4B9NA 4K0KK 1GLFO 3NF8A 3VQ7A 4J2BA 4E7JA 2GBZA 4FJHA 5C12A 2GX9A 3FE1A 4JS4A 1Z25A 1Q9XA 4F2SA 3CF5L 4DR4K 3ZT2A 1MA9B 2O8FB 1S1TA 4KI4A 4BG9A 5GIOA 5KGXA 2XY7A 1QTMA 3H6EA 4JI6K 3RRHA 1KFSA 3VQDA 1B9FA 3ZETA 4FZYA 4O4GA 3MDQA 5E41A 3AAPA 1NGIA 4CEDA 3ZEUA 1NNEA 3CHWA 1VQ8N 1VQ5N 3TAGA 1KSPA 3TAQA 4O5FA 4CEFA 3OYEA 4J8FA 1HKBA 5AR0A 3QERA 1S3XA 4ELUA 4IOAL 4F4KA 2O8EA 3WEEB 4BGAA 1FKPA 1BQMA 2A41A 3QIOA 5ELZA 4JKHA 4B1ZA 3TABA 4CHQA 3AA3A 1TV6A 4B9UA 2X6NA 4JLHA 3EY1A 4BRKA 4O5BA 5J2QA 3VGKA 2VQEK 5M1FA 3HTVA 2NRTA 2E20A 4I2QA 3WNGA 3LDSA 2KQ2A 2HHQA 2E2PA 3CFPA 4LF7K 4PQUA 4CVNE 3NH0A 4BRPA 3LWMA 4YHHK 2Q0RA 4FJGA 2CGJA 3S3OA 4BQZA 4B3OA 5F0XA 2WOMA 1NKEA 4Z4IA 2IIRA 4CZIA 4GMJB 3TSQA 2D0OA 4I9QA 1QQMA 3PSIA 3RSEA 3C6UA 3DLRA 4CD1A 4FWKA 2HMPA 2NNWA 3DJCA 4LSLA 4CBUA 2DPNA 3LPTA 3U6FA 3QEXA 1ZYQA 1T05A 3BUZB 4DR3K 1C0UA 5BN8A 4OKEA 4FJ8A 4HWIA 1EX4A 1KD1O 1VQPN 4RW6A 3HPHA 4GW6A 1NK8A 2O8DA 5GIPA 1WLJA 1LCUA 1ZBHA 3QEIA 5AQQA 1HKCA 3SV3A 4EFHA 3OJUA 3VA0A 4NYFA 4WYBA 3P83D 5BPMA 4AHCA 1RFQA 4BDYA 3A5MC 1VQ9N 1NGJA 3J81O 4CZEA 1RILA 4MLHA 3PO4A 4AQYK 2G8KA 2QI2A 2OANA 4KREA 4LF9K 3NHGA 3KK3A 3AVGA 1TAQA 3J8AA 1R59O 2UU9K 4A5BA 3PO5A 4EIAA 2PBDA 4A2BA 2PAVA 4FK4A 3O1BA 4EP4A 1UA1A 2YNGA 5HROA 4C8OA 1M1KO 4GV6A 5AZIA 1QZ6A 3QEWA 3E01A 1D9FA 4H4MA 2VWKA 3A5OC 3D2EA 2NRXA 1Z6RA 4LSNA 4CZMA 4JD2A 1TUYA 2E1YA 4CIGA 3I55N 1U04A 2B5JA 3SZ2A 1JLAA 4A5AA 3OYDA 4DR5K 3WNHA 4DG1A 4A59A 2G8FA 1W2BM 4ICLA 3WNFA 3I8DA 3ISNC 1TKXA 3SQ1A 4BC4A 2D5RA 3SAFA 1KAXA 1QVGM 3D45A 3EYZA 3TANA 1ITGA 1HRHA 3R6MA 2P9PB 4KTQA 4BR9A 1RT3A 4M3RA 4E3SA 2E88A 3QDKA 5I9EB 1WSHA 4BY9C 5C0YA 4FLTA 5C10A 1ATRA 1P8ZA 1P90A 3KK7A 1C6VA 1S1XA 4IXCA 4OPKA 1NK4A 2YNIA 4BWMA 2FBYA 2PZSA 2HBJA 4BDPA 1IBMK 3DM2A 3VPZA 1NGDA 1NG9A 1M90O 4M3XA 4R79A 1BL3A 3IS9A 3O9SA 5EOYA 3QEVA 2IS3A 4OO1J 2VQFK 3LAKA 4YOVA 2WTUA 2IDOA 3ZSQA 3AVBA 3H1QA 1U2VA 3RMDA 1JCEA 3ZSRA 4G1QA 2OPSA 3MCPA 2G8VA 3HXMA 4JI7K 1HKGA 4IDHA 2P9UA 3M5RA 5EX5A 3RMBA 4Z0UA 3NH1A 4NB4A 1BQNA 1TUUA 4B9QA 1TKZA 2H3GX 3Q7CA 3THYB 4YDUC 1G15A 4JKBA 2HHSA 3KLIA 2Q2RA 5C25A 3V81A 5AZJB 3LDQA 4CF2A 1QS4A 3P4IA 3SUQA 2GEMA 4CFBA 4NCBA 4J2DA 4FOIA 4RW9A 3J7YP 4F2RA 4IJAA 1W7AA 4JI1K 3HM8A 3OHRA 3OW2M 3DXMB 4KHSA 1NOZA 4DV1K 1TL1A 4JKFA 2QW9A 5BPNA 4JKGB 3E9OA 1IH7A 5AQVA 1ASWA 4J2EA 4B3SK 3H46O 4CJRA 1J54A 4FLYA 1GOBA 3CQXA 1C0MA 3AO1A 3C6HA 3EO3A 4AHTA 4HTUA 3THWB 3RWUA 3IDHA 3CC2N 4CF8A 1ATNA 1G99A 4K8XA 3AO4A 4FJIA 2QK9A 1ZBUA 4FOEA 1Q7YO 1JLBA 5C24A 5BR9A 3VQ6A 3ZCMA 4DV6K 4DSEA 1S6QA 4KPYA 5AQRA 1RDWX 3S41A 3PV8A 4H5TA 4CW7B 1SL2A 4E1JA 4O44A 4B9LA 1T3VA 1S9GA 4V19S 5HL7L 4JK9A 4DV2K 3L6QA 3OYGA 2KKZA 2HVHA 3FLCO 4CE9A 4FVUA 5J2NA 3EN9A 3MCAB 4RTFD 4IEIA 3CERA 4DSFA 5HLFA 4YY3K 5LJVA 2O8CB 3THXA 3P5JA 1JKHA 2KHOA 4CJQA 1NMNA 3MXMA 5JMVA 4CGGA 3OYFA 5AQNA 1T6CA 4LF4K 2ZF5O 3T1HK 2QWNA 3JAMO 5C42A 3OYAA 3TU5A 4NO7A 4O8UA 4JI3K 4IDKA 5LL6Z 1NU0A 3LALA 2YCHA
chains in the Genus database with same CATH topology
4LF5K 3J81O 1IBKK 2ZM6K 4DR1K 4AQYK 3T1YK 1FJGK 4LF9K 5FLXO 1HNWK 2UU9K 4GKJK 4LFAK 1HNXK 3J7YP 5LMUK 1N34K 4JI1K 1HNZK 4JI0K 1XNRK 5AJ3K 4DV1K 4DV5K 4X66K 5IWAK 4OX9K 2VQEK 2UXDK 4X65K 2UUCK 4JI2K 4B3SK 4DR6K 4X62K 4JYAK 1XNQK 5LMNK 4DR5K 2E5LK 2UUAK 4LF7K 1I94K 4CVNE 4DR2K 4YHHK 1HR0K 4LF8K 4DUZK 4DV7K 4DV0K 4DV6K 1N32K 4DUYK 1N36K 4K0KK 3J7AP 4DV3K 2UUBK 4NXNK 2HHHK 2UXCK 1IBLK 4CW7B 3OTOK 2UXBK 5A2QO 4JV5K 4LFCK 4JI8K 4V19S 5BR8K 4DR4K 1XMOK 4DR7K 4DV2K 4LF6K 4GKKK 4LFBK 4DR3K 2F4VK 1IBMK 4YY3K 4JI6K 1N33K 4JI5K 1J5EK 4B3RK 2VQFK 5IT9O 3J80O 4LF4K 3T1HK 4DV4K 4NXMK 3JAMO 4B3TK 4X64K 4JI4K 1XMQK 4JI7K 4KHPK 4JI3K 4B3MK 5LL6Z
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF5 K;  3J81 O;  1IBK K;  2ZM6 K;  4DR1 K;  4AQY K;  3T1Y K;  1FJG K;  4LF9 K;  5FLX O;  1HNW K;  2UU9 K;  4GKJ K;  4LFA K;  1HNX K;  3J7Y P;  5LMU K;  1N34 K;  4JI1 K;  1HNZ K;  4JI0 K;  1XNR K;  5AJ3 K;  4DV1 K;  4DV5 K;  4X66 K;  5IWA K;  4OX9 K;  2VQE K;  2UXD K;  4X65 K;  2UUC K;  4JI2 K;  4B3S K;  4DR6 K;  4X62 K;  4JYA K;  1XNQ K;  5LMN K;  4DR5 K;  2E5L K;  2UUA K;  4LF7 K;  1I94 K;  4CVN E;  4DR2 K;  4YHH K;  1HR0 K;  4LF8 K;  4DUZ K;  4DV7 K;  4DV0 K;  4DV6 K;  1N32 K;  4DUY K;  1N36 K;  4K0K K;  3J7A P;  4DV3 K;  2UUB K;  4NXN K;  2HHH K;  2UXC K;  1IBL K;  4CW7 B;  3OTO K;  2UXB K;  5A2Q O;  4JV5 K;  4LFC K;  4JI8 K;  4V19 S;  5BR8 K;  4DR4 K;  1XMO K;  4DR7 K;  4DV2 K;  4LF6 K;  4GKK K;  4LFB K;  4DR3 K;  2F4V K;  1IBM K;  4YY3 K;  4JI6 K;  1N33 K;  4JI5 K;  1J5E K;  4B3R K;  2VQF K;  5IT9 O;  3J80 O;  4LF4 K;  3T1H K;  4DV4 K;  4NXM K;  3JAM O;  4B3T K;  4X64 K;  4JI4 K;  1XMQ K;  4JI7 K;  4KHP K;  4JI3 K;  4B3M K;  5LL6 Z; 
#chains in the Genus database with same CATH topology
 5KQ8 A;  1WBD A;  2FC0 A;  3HOS A;  1RT2 A;  1ATS A;  5BRE A;  3T1Y K;  1JJ2 M;  3O5B A;  1ZBS A;  2Z1G A;  2Q1N A;  2O8F A;  4Z4F A;  2Q31 A;  3MWP A;  1OH7 A;  4JHD B;  1YJ9 N;  1N34 K;  1IKV A;  4KRF A;  4DU4 A;  2NRH A;  4FZZ A;  4KKO A;  3VQE A;  3QNO A;  2Q0U A;  3BEX A;  4KAZ A;  1RBU A;  4DV5 K;  3AVC A;  4HCB A;  3TTF A;  2X74 A;  2A6A A;  3ZX0 A;  5KRS A;  4CEO A;  4H03 B;  1NK7 A;  2YNF A;  4AHV A;  5FPM A;  3B6P A;  3WEE A;  4JRQ A;  4WE1 A;  4NCG A;  2AP1 A;  5TKW A;  3ZT4 A;  1RTJ A;  4RW4 A;  1ESV A;  3VMF B;  3QIN A;  2HNY A;  1J9A A;  4PHT X;  1N36 K;  3ATV A;  1S1W A;  1X1P A;  4C23 A;  3VQ5 A;  4CCH A;  4H0O A;  3JYT A;  1KVA A;  3PIO L;  3OTO K;  4PUO A;  4K25 A;  3CJA A;  2P9K B;  3CME N;  2AJQ A;  1JXB A;  4GY2 B;  4H4O A;  4CF9 A;  1BWF O;  4LF6 K;  1NGA A;  4E7L A;  2P9L B;  3AV9 A;  1YTA A;  2HB5 A;  4CI6 A;  1N33 K;  4K41 A;  2QWQ A;  3ZT3 A;  1HYZ A;  4UQG A;  2KFN A;  2FBT A;  3GE1 A;  3O08 A;  3P31 A;  5AQO A;  4CK1 A;  3OYN A;  4NXM K;  3KZB A;  1VSF A;  1D5A A;  1CZA N;  1VSE A;  1VK0 A;  3TAE A;  3VQ8 A;  1VQN N;  1ZBL A;  2NRV A;  3SQ0 A;  4BR4 A;  4Z94 A;  4LF5 K;  1W9H A;  4F3T A;  1IKW A;  2RPI A;  2F8S A;  3PUF A;  4CES A;  4C1N K;  3F9K A;  5SZT A;  4XH5 A;  1NWK A;  1V4T A;  1YT3 A;  3M8P A;  3AA4 A;  3AA2 A;  5MLC Q;  3SUO A;  2BH1 A;  3C65 A;  4NLC A;  3TAP A;  1RTH A;  3SLC A;  1K8K A;  1RT5 A;  1NJW A;  2ASO A;  4JI0 K;  1Q86 O;  4M3Y A;  3AO5 A;  3U9D A;  1YI2 N;  1SL1 A;  2P5G A;  4Z4E A;  3ZLJ A;  2E2O A;  1GLC G;  3VEO A;  3I33 A;  3JSM A;  3NVK A;  4DU1 A;  3I56 N;  5LMN K;  3AAR A;  1IG9 A;  3VQC A;  1I94 K;  4CGH A;  3DWL A;  3ID8 A;  1HR0 K;  5BPL A;  1XC3 A;  1MWM A;  3AY9 A;  2HBL A;  3T3F A;  1NM1 A;  3DXK B;  3ATU A;  3K5N A;  4QAG A;  1NJX A;  4MDB A;  1S1V A;  4LH5 A;  5AQX A;  4DSL A;  4CF0 A;  3JS6 A;  2XY5 A;  4BRI A;  2VWB A;  4O55 A;  4DTU A;  2E6M A;  4IOX A;  3O4N A;  2B6A A;  1UAX A;  2GWJ A;  4CJ5 A;  4GV9 A;  2NRW A;  2NZT A;  4YFU A;  1K73 O;  1L5U A;  4JI8 K;  4AH9 A;  4CGF A;  3L2Q A;  3KTQ A;  3M6G A;  2OTL N;  1QSY A;  3A5L C;  3GL1 A;  2XHB A;  4DTM A;  5DMR A;  1WSI A;  5JIC A;  3QES A;  1W97 L;  2F4V K;  1QHA A;  1JCF A;  4WFA L;  3CM5 A;  2O8B B;  4BRQ A;  2GEL A;  1VRT A;  3CCM N;  4KBO A;  4JRP A;  3TPQ A;  4KB1 A;  3CPE A;  3OY9 A;  1J5E K;  5JLH A;  1KRP A;  4IBN A;  3U8X A;  5IT9 O;  1HMV A;  1JLF A;  2HNZ A;  3LAN A;  1A5X A;  4JKA A;  2P9P A;  3NGZ A;  4B3T K;  4Z4C A;  4JI4 K;  5FRN A;  4DTS A;  5KPT A;  3ID6 A;  1NKC A;  4XH1 A;  1W0H A;  4B1Y B;  4BR2 A;  3G4S N;  4FYD A;  3CCU N;  3VEV A;  4OLA A;  4M3T A;  4QS9 A;  4JKE A;  2JWK A;  4FK2 A;  3NCI A;  3L4I A;  3L2W A;  1GLL O;  4CZH A;  2FF6 A;  2IVN A;  1S22 A;  3B6O A;  1HNX K;  1UOC A;  2D0P A;  1JLG A;  1Q82 O;  3SBT A;  4IFY A;  1EQY A;  4CIE A;  1U45 A;  5M1N A;  4FW1 A;  4HVJ A;  2BDP A;  3VQA A;  2Z1H A;  5BRH A;  1RBV A;  3E66 A;  2KZM A;  1HJO A;  4CK2 A;  2V7Z A;  1RDD A;  1RT1 A;  4NCA A;  4ISE A;  2QEX N;  4RWT A;  3E9P A;  1KAZ A;  1VRU A;  2E5L K;  3GDQ A;  4ID1 A;  3QFP A;  3IRX A;  3THY A;  1C1B A;  1CXQ A;  3ASM A;  5AZJ A;  3CPW M;  1S72 N;  5AQF A;  4CHO A;  4GV3 A;  3CCL N;  4H8K A;  4WQ4 A;  3MEG A;  1DTT A;  4G9Z A;  3NVM A;  4DV3 K;  2PFU A;  4CJT A;  3VEN A;  1QSS A;  1TL3 A;  2WBN A;  3CCS N;  3DXM A;  1NLV A;  4CZL A;  2KFZ A;  5H1S Q;  3LDP A;  4WQ5 C;  3DLB A;  4OVL A;  4JKG A;  1RBT A;  1VQK N;  3O4Q A;  1OH6 A;  3PX0 A;  3UB5 A;  2FSJ A;  5FRM A;  1A5W A;  1S1U A;  2ZD1 A;  2QWP A;  3BDP A;  3G6E N;  4H0Y B;  4FWP A;  3ULE B;  4B3R K;  3IKM A;  5HRP A;  3SI6 A;  4IWV A;  3FFI A;  4IFE A;  4B9V A;  4DS5 A;  1QVF M;  3DOK A;  5GAH P;  4Y0W A;  5GAD P;  3KWG A;  4N5S A;  3SMP A;  4KV8 A;  3BZK A;  3IMX A;  3HP9 A;  4DQI A;  1T03 A;  5M1Q A;  1X3M A;  2FBX A;  4KH5 A;  1RDB A;  1YVU A;  2HHX A;  4PWD A;  1OVQ A;  3I8B A;  4U7B A;  3QEP A;  1CLQ A;  3W0L A;  4GKJ K;  3M3Z A;  4PA1 A;  2O8C A;  2QWO A;  3V1Q A;  2XO7 A;  2ZGY A;  4O0I A;  3E9L A;  3O4W A;  4C8K A;  4CEB A;  3CC7 N;  5LMU K;  2OYQ A;  4F8R A;  4ZHR A;  4K8Z A;  3QNN A;  1GLA G;  3C6A A;  1XQS C;  4E0D A;  3AVM A;  3ZX2 A;  1TGO A;  3KK1 A;  4IEE A;  3CCV N;  4DTO A;  2E6L A;  2WC9 A;  4DLE A;  3ZX3 A;  3LP0 A;  3OS1 A;  3O9U A;  1XNQ K;  4NLB A;  3HL8 A;  4AHU A;  3ZSO A;  1KC8 O;  3V6D A;  3VTI A;  1I3A A;  5J1E A;  1HYS A;  2P9N B;  4YOT A;  3QIP A;  4LF8 K;  1YXQ A;  1BIU A;  3CJ9 A;  1Q8I A;  3KJV A;  3EZW A;  5I42 A;  4JHD A;  4AM7 A;  1BGX T;  4DUY K;  3VOV A;  2CGK A;  4KTZ A;  4CJV A;  5F2R A;  4M7X A;  5C2F A;  3KLH A;  3K58 A;  3L2R A;  3MEC A;  4M7Y A;  2UXB K;  5AQH A;  4BGB A;  3MN5 A;  3RTV A;  3CFO A;  5AQS A;  4FVM A;  1XMO K;  4M3U A;  3QFU A;  1QQO A;  4CJP A;  1VSI A;  4JK8 A;  3NGY A;  1XHZ A;  1B92 A;  2Z1J A;  3M8S A;  3CIP A;  3S3N A;  3IUC A;  2AA4 A;  2Q36 A;  1RT4 A;  3MX5 A;  3CMA N;  1IG8 A;  4C1N I;  3BY5 A;  3R8E A;  3C0B A;  5DK5 A;  2ITM A;  3KLF A;  3MN9 A;  4QS7 A;  1Z05 A;  4DTP A;  3D7E O;  4BQL A;  1KVC A;  2A5X A;  4LH4 A;  2GV9 A;  1HLU A;  3F2K A;  4CJW A;  3G0Z A;  1NGH A;  1C1C A;  1BI4 B;  4R5P A;  3Q7B A;  2NRR A;  2P9K A;  3PX4 A;  4XEI A;  5ADX A;  4M3Z A;  1HNW K;  2W6K A;  2IAJ A;  2P9L A;  4FCY A;  1L3V A;  3VGM A;  1FW6 A;  1E4G T;  3SQ4 A;  3V9U A;  3PY8 A;  1EP4 A;  1Q18 A;  5ADX H;  3CM6 A;  1YAG A;  2VGN A;  1NGB A;  4CHN A;  1Q81 O;  1SS6 A;  1XI1 A;  1NGC A;  4H0T B;  2YI1 A;  3TAF A;  1Q9Y A;  5CY4 A;  4BVO A;  3HVT A;  3P38 A;  2OZS A;  2DY4 A;  3O6W A;  2RHK A;  4MO4 A;  4FJ5 A;  5HOO A;  3VEW A;  1KLN A;  5CYM A;  3A0I X;  3P1G A;  4CFA A;  4DFJ A;  1EXQ A;  1WSE A;  3T69 A;  2FBV A;  1IO2 A;  1GLE G;  3AVK A;  3DI6 A;  2FSN A;  3FZL A;  3MAQ A;  4IOC L;  2OPP A;  1X9M A;  1LAV A;  4H5V A;  3LAM A;  3NFA A;  1L3U A;  4Q5V A;  3CXC M;  2ZJR L;  5HBM A;  3CQY A;  3T19 A;  3RMA A;  3U3Y A;  2P51 A;  2UUB K;  1MWK A;  2VGM A;  3VQP A;  5AQZ A;  3ULD A;  3C7N B;  4N41 A;  2D4W A;  4KHY A;  1X9J A;  2HHU A;  1NGE A;  4LFC K;  4OGE A;  4FXD A;  3A8Y A;  3WNE A;  2KLA A;  4DR7 K;  4KHU A;  4OPA A;  4PL8 A;  1U4B A;  4CGJ A;  3TWH A;  2A40 A;  2I7P A;  3WQU A;  1HX1 A;  3QLH A;  1XWL A;  1IKY A;  3O9R A;  5KPZ A;  4AIL C;  2D0B A;  4B1U B;  4CEE A;  3F73 A;  4DFM A;  3G25 A;  4BRL A;  1HPZ A;  4DTX A;  3L0Q A;  1RGI A;  2HVI A;  4DV4 K;  4BWJ A;  2DFE A;  4JEP A;  3ALY A;  4E89 A;  1S9E A;  5C15 A;  3CC4 N;  2GUI A;  4YOR A;  3QIC A;  1SQK A;  2VG6 A;  3ENB A;  4N76 A;  1NGF A;  4E19 A;  4XH4 A;  1OH5 A;  1FKO A;  5M1K A;  1VSM A;  3HSC A;  1TYQ A;  1DLO A;  5SWM A;  2QTD A;  3WQT A;  2HBK A;  1KVB A;  1GOA A;  1BA1 A;  3TSP A;  3O1W A;  3LZI A;  2RKI A;  3H1V X;  4KH6 A;  2EWS A;  3A2F A;  3HT3 A;  1QZ5 A;  3KVG A;  5TKY A;  1XNR K;  4DQ8 A;  1VQO N;  1VQM N;  3BZC A;  3CJ7 A;  4CFC A;  3JXU A;  3AGR A;  5BRD A;  4I6M B;  4OKJ A;  5FPE A;  4WFN L;  5M1P A;  2UUC K;  1RBR A;  1GLJ O;  4OPH A;  4JYA K;  2F9W A;  4BC2 A;  1E3M A;  3EKU A;  3UKR B;  5J2P A;  1DEJ A;  1RDU A;  1VSL A;  3RVC A;  4H0P A;  1GLB G;  4FW2 A;  1GLD G;  2P9S B;  3NF6 A;  1DTQ A;  4FWR A;  2G8H A;  3QBW A;  3MED A;  1WB9 A;  1SKS A;  3L4Q A;  1TKD A;  4DV0 K;  2ZJP L;  1D9D A;  3OYL A;  4DSK A;  3L3U A;  4Z4G A;  4AHS A;  4BAC A;  3DLG A;  2A42 A;  1EWQ A;  2IOC A;  4KO0 A;  3NF7 A;  3DLK A;  4M45 A;  3KHY A;  2EHG A;  2HND A;  4RW7 A;  4JV5 K;  1WAF A;  4QOZ B;  3ZSZ A;  3DMJ A;  4LFB K;  5FPD A;  4EZ9 A;  1NK9 A;  4OKK A;  4DMN A;  3AGK A;  4TSX A;  5BN9 A;  4CJ4 A;  4WCE L;  3D6R A;  4DCH A;  3A5N C;  3KWI A;  3GG4 A;  4CF1 A;  1IKX A;  2IC3 A;  3NMU A;  2VCP A;  4FZX C;  3AVF A;  3O3H A;  3OVN A;  1ZBI A;  3LL3 A;  4AF1 A;  3V4I A;  5CYQ A;  3K57 A;  3M8R A;  1QE1 A;  1QQC A;  1WUA A;  5AQK A;  3OS0 A;  2HF4 A;  5JS2 A;  1NGG A;  4KI6 A;  1DT9 A;  3V1O A;  4B1X B;  4XIU A;  4OJR A;  1X3N A;  3TAM A;  3MXI A;  4CHY A;  1TVR A;  2B4J A;  2ASP A;  3U9Z A;  3S9H A;  3G10 A;  2LSN A;  4IO8 A;  4H5R A;  4E7H A;  5CZ2 A;  1U49 A;  3NGI A;  3RMC A;  3KD5 E;  3DRR A;  4JKD A;  1DGK N;  2GTD A;  3DLH A;  4DKW A;  4DQR A;  4DTR A;  3HI0 A;  1MDU B;  3KD1 E;  3MMV A;  3SAH A;  1C1A A;  5AQG A;  5AQU A;  4DF8 A;  4O0J A;  2J4R A;  3AA5 X;  2R7Y A;  1KQS M;  3BF3 A;  1IJJ A;  5EU7 A;  2ZWH A;  4EAH D;  2QWM A;  4FLU A;  1ZBF A;  3EL2 A;  4IO9 L;  1DKG D;  3BF1 A;  4OPJ A;  3LP2 A;  4Z4H A;  1QSL A;  4Y1C A;  4DB3 A;  1VQ4 N;  3AAQ A;  2YJE A;  5JLF A;  3V9X A;  4YOW A;  3V9W A;  4DSI A;  1U6Z A;  3TTC A;  2QXL A;  3K9K A;  4CFD A;  1X9W A;  1WNS A;  4A62 A;  3IFR A;  1D8Y A;  5CR4 A;  2FLO A;  4BRF A;  4RW8 A;  2GWK A;  3PX6 A;  1BCO A;  5D3G A;  2UXC K;  2NUB A;  4B9S A;  1LWE A;  3SPY A;  1YHQ N;  3T1A A;  4I2P A;  2RN2 A;  3PSF A;  2YKN A;  2KW4 A;  2OCE A;  1HJR A;  1ILY A;  2V7Y A;  2NRZ A;  3AVN A;  4QS8 A;  3K5O A;  3SYZ A;  4B1V A;  3CYM A;  4CEA A;  4FWQ A;  2CGL A;  2P9N A;  2V51 B;  2DTU A;  1XHX A;  2G8W A;  3R1X A;  2PY5 A;  1C0F A;  4YOU A;  3V9Z A;  3R3L A;  3FGU A;  4MFB A;  5HRS A;  3VQB A;  3O8M A;  4MO5 A;  2I7N A;  4X64 K;  4EHU A;  5DM7 L;  1XMQ K;  5J2M A;  3BGR A;  3LP1 A;  4AHR A;  1NJZ A;  1RDA A;  2F8T A;  4B8C A;  1OVY A;  1IBK K;  1KXP A;  2X78 A;  3AO3 A;  4FM1 A;  5JVH L;  3HZ6 A;  3K5L A;  3L2U A;  3D2F B;  3NF9 A;  4ILG B;  3SPZ A;  1BU6 O;  3LDO A;  5HRN A;  2BAN A;  2O4G A;  2ZJQ L;  3OYK A;  2XRI A;  4DTJ A;  4O8K A;  4HUG A;  4BRG A;  2D0C A;  1BDG A;  4MLE A;  3LWL A;  4E1M A;  1JL1 A;  2BE2 A;  3SNN A;  3HPG A;  3NAE A;  4DS4 A;  5GAE P;  3HYF A;  1BG3 A;  3O3G A;  4CHZ A;  4EHT A;  3ZSX A;  3K59 A;  5K14 A;  1LV5 A;  3IAY A;  5AQT A;  3WXK A;  1BI4 A;  2BUP A;  4X62 K;  4BRA A;  2ZGZ A;  1JLC A;  4BE2 A;  2QWL A;  4FM2 A;  4KHQ A;  4FPA A;  5KPR A;  2Q97 A;  4M42 A;  4MQ3 A;  4DUZ K;  5CZ1 A;  4PY5 A;  1YUW A;  2KTQ A;  1S6P A;  3AVA A;  4BRD A;  4DV7 K;  5M1O A;  3H3N O;  1N5Y A;  3U4L A;  3MX2 A;  1SKR A;  1EO1 A;  2PYJ A;  3BP8 A;  3WXI A;  1T8E A;  1BA0 A;  3H45 C;  1HUX A;  5GAG P;  4B9M A;  3V9S A;  1RTD A;  4CEC A;  3P39 A;  5GIN A;  3HPO A;  4ZTJ A;  2FF3 B;  5BR8 K;  2JWL A;  2HHW A;  4ID5 A;  3L2V A;  2OPR A;  4PKI A;  5HRR A;  3SCX A;  2VWJ A;  1JL2 A;  3NH2 A;  1NK0 A;  4DLG A;  2W42 A;  3N4P A;  1SZ2 A;  4U67 L;  4HHT A;  1RDC A;  3ENH A;  3MEE A;  4J2A A;  1CXU A;  1SL0 A;  4M3W A;  3SQ2 A;  4CHP A;  1X9S A;  3DAW A;  3J80 O;  3FFK B;  3K9J A;  3F5T A;  4LY7 A;  1UWB A;  3PIP L;  4B1W B;  5JS1 A;  1JLQ A;  1EKE A;  2QWR A;  3ZT0 A;  1XUP O;  3PLA A;  3K5M A;  1L3S A;  1YJW N;  1NKB A;  4CJ7 A;  3C7N A;  3LP3 A;  5KI6 A;  1HNI A;  3KK2 A;  3THW A;  1NOY A;  1FJG K;  3RRG A;  3VF6 A;  2JLE A;  1UA0 A;  4DHY A;  5EXW A;  4IZ9 A;  3DLE A;  3WXM B;  4B8A B;  1LWF A;  4ISF A;  5LY3 A;  2OTJ N;  3KKS A;  4FJJ A;  4CJK A;  3HRG A;  3AVL A;  4FWN A;  3LPU A;  2E8A A;  5AJ3 K;  4FL9 A;  2OZM A;  1TKT A;  1WN7 A;  1WAJ A;  2ITG A;  1TK8 A;  1XC9 A;  4M41 A;  4Y1D A;  3QET A;  4CEZ A;  4DU3 A;  4K43 A;  3MN6 A;  4B08 A;  1VSH A;  4CJE A;  3O9Q A;  3UKU B;  3SJJ A;  3I0R A;  3THV A;  4YNQ A;  3EE9 A;  3G71 N;  4PL7 A;  3K2P A;  3OYJ A;  5C2D A;  1O1W A;  4C8N A;  2DFF A;  1N32 K;  1OKJ A;  3J7A P;  3CG7 A;  4FJX A;  1K8K B;  2HW3 A;  3HVR A;  1NJY A;  4PKG A;  1NJI O;  1LW2 A;  3ZYY X;  2PYL A;  3AVJ A;  4UY8 O;  3M8Q A;  3VER A;  1T7P A;  4FJL A;  4CJL A;  4DF4 A;  2YKM A;  4FWM A;  4I6M A;  2YNH A;  4JNE A;  3OBW A;  1RT6 A;  2WFB A;  4F9O A;  4YOY A;  2ATQ A;  3UKR A;  2CH6 A;  1EET A;  4CGD A;  1TK5 A;  2ZQB A;  2P9I B;  1YJN N;  4FWS A;  3HM9 A;  1KTQ A;  2VYP A;  4BC5 A;  2P9S A;  4CBX A;  2W6L A;  1T6D A;  2P1J A;  5KTQ A;  4BRC A;  4H0V B;  1SV5 A;  4L3Q A;  2HHT A;  1EWR A;  4KFB A;  4IFV A;  2Q3S A;  3RR7 A;  4KHP K;  4NYN A;  5AQJ A;  1YTU A;  4CZG A;  3U3G A;  2F96 A;  3H3O B;  4DQP A;  2ZM6 K;  3SV4 A;  2E2N A;  5KQD A;  1HPM A;  3DLL L;  1FXX A;  1NMD A;  1CZB A;  4JKC A;  3OYM A;  4FJ9 A;  3HK2 A;  1BCM A;  3O9T A;  1NK6 A;  3LM9 A;  3HOT A;  2A3Z A;  4BRH A;  4GVM A;  3DOL A;  3W3D A;  4HCC A;  4F3O A;  3ITH A;  3QBX A;  3LDL A;  3V1R A;  1SKW A;  3VTH A;  1REV A;  3WT0 A;  5IWA K;  4CEQ A;  1HQU A;  3CCR N;  4X65 K;  3OYC A;  3J7Z O;  2FXU A;  4KTW A;  3VES A;  5JVG L;  2UUA K;  2KZZ A;  3VET A;  3TSU A;  3AVI A;  3QO9 A;  3B8A X;  1RCH A;  4FLV A;  2EX3 A;  3ZET B;  3SAG A;  3KLG A;  2G8I A;  3GBT A;  3CI5 A;  3CET A;  1JXE A;  3E1Y A;  4LC9 B;  2G8U A;  4FJN A;  3RR8 A;  1H1V A;  4H0X B;  3CJC A;  4DWI A;  3ZEU B;  1F21 A;  2HHH K;  4MDA A;  3CFR A;  3FZK A;  5A2Q O;  1I39 A;  4IKF A;  4FWO A;  3KIO A;  1K6Y A;  3QML A;  3MK6 A;  4BC3 A;  2HST A;  3VQ4 A;  3VF2 A;  4GKK K;  3GOI A;  3L3V A;  2O8E B;  2X6S A;  4FO0 A;  3M1F A;  4BR5 A;  4CK3 A;  5E84 A;  3WUH A;  4BRN A;  2QXF A;  1VQ7 N;  3VQQ A;  3CD6 N;  3KLE A;  3FR0 A;  1WOQ A;  4EZ6 A;  4EP5 A;  1GOC A;  2IGI A;  4K42 A;  3ZSY A;  3CCQ N;  1RBS A;  2OPQ A;  1LWC A;  4CGI A;  3R9P A;  1CZ9 A;  4DQQ A;  1ASU A;  4KHW A;  4H5W A;  1WSJ A;  5AQW A;  3VF4 A;  2WON A;  1QQN A;  5DM6 L;  5AQM A;  4FJK A;  3K0S A;  5FLX O;  1BUP A;  2GUP A;  3SBG A;  2YHX A;  4W5Q A;  4LFA K;  3DXK A;  4ELT A;  4WFB L;  2O4I A;  4M63 C;  2E4L A;  4N47 A;  3T7Z A;  4WQ5 A;  4L8R B;  4ILJ A;  3RSE B;  4GVE A;  4IG3 A;  2IVO A;  3ENO A;  3CJB A;  4X66 K;  4BVP A;  3MXJ A;  3DRS A;  1Y64 A;  3LZJ A;  2A1S A;  1IV0 A;  3HO1 A;  1E4F T;  1U47 A;  2O8B A;  2F7T A;  5F1X A;  5T7B A;  2E2Q A;  2RF2 A;  3I0S A;  4HUF A;  1U48 A;  3D2F A;  1WSF A;  3CCE N;  5I3U A;  1Y97 A;  3O80 A;  2O8D B;  4JN4 A;  3VQ9 A;  4ZTF A;  3TTD A;  4OGC A;  4LD0 A;  1FK9 A;  5BRF A;  3MWT A;  3IG1 A;  3VN5 A;  4YOX A;  4KB0 A;  3TR8 A;  1D4X A;  1LAW A;  4FM0 A;  3HJF A;  4IJN A;  3O3F A;  2W40 A;  3OA9 A;  4E1N A;  4PKH A;  4DFP A;  1KCF A;  1SAZ A;  3HBT A;  4FLW A;  3LDN A;  2QM1 A;  3DYA A;  3C6T A;  5AQP A;  2YX6 A;  3SJH A;  1LW0 A;  4JAX A;  4BG8 A;  2NLX A;  2ZE2 A;  3ZT1 A;  3DRP A;  3QB0 A;  1J53 A;  4Q0B A;  1VAZ A;  4KH4 A;  4FJM A;  3FZH A;  3OS2 A;  2P5O A;  3WXL A;  3TI0 A;  2OA8 A;  1YIJ N;  3VEZ A;  2BGG A;  5AZI B;  4W5N A;  3D2E B;  1MU2 A;  4JD2 B;  4WF9 L;  3L8B A;  1BIZ A;  4OLB A;  4A57 A;  1NK5 A;  1BHL A;  4DSJ A;  1JCG A;  4WQ4 C;  5CE3 A;  1ZC6 A;  3VGL A;  4HTL A;  4I7F A;  4DR1 K;  5EY4 A;  2YHB A;  3AVH A;  3OBY A;  2HMI A;  1KLM A;  4BDZ A;  4BE1 A;  4CJ3 A;  1ASV A;  3EKS A;  5FRO A;  2F9T A;  1S5J A;  3HST B;  1BOT O;  3HP6 A;  1YF5 L;  4CJS A;  1T44 A;  1HNZ K;  5CHI A;  4W5O A;  4BE0 A;  1C0T A;  5AQY A;  1A5V A;  4CJF A;  2I5J A;  4CER A;  4KHN A;  4W5T A;  3OYB A;  1NBW A;  2E1Z A;  1OH8 A;  3NBP A;  1TAU A;  2QA4 N;  3S3M A;  1YIT N;  4CZF A;  4B9T A;  4FLZ A;  2UXD K;  3SUN A;  3NE6 A;  4JI2 K;  2VG5 A;  4DR6 K;  3TAR A;  1C0G A;  3LM2 A;  2Y1I A;  1RTI A;  3D0P A;  4FK0 A;  2YHA A;  4CIF A;  2Z1I A;  4A61 A;  4ELV A;  1VHX A;  4BR0 A;  5HP1 A;  4DR2 K;  5KRT A;  1K9M O;  3SK3 A;  3ULE A;  2JGU A;  2WUS A;  2ASM A;  1U2V B;  4JS5 A;  4BRE A;  5FDL A;  3MN7 A;  2D1K A;  4AM6 A;  1YVN A;  2ETJ A;  4DFK A;  1KFD A;  4NXN K;  2P9U B;  2V52 B;  4A2A A;  4CD3 A;  3OYH A;  1IBL K;  1N6Q A;  1BIS A;  1J6Z A;  1B9D A;  2CH5 A;  3UIQ A;  2QKB A;  2HHV A;  3FZF A;  3NDK A;  3VEY A;  1VSK A;  1O13 A;  3EE8 A;  3EEQ A;  2UYT A;  1L3T A;  3UE5 A;  4BRO A;  4E7I A;  1VSJ A;  1LOT B;  2D0A A;  3KKR A;  3EZ5 A;  5AQL A;  4DQS A;  3UKU A;  2RE2 A;  4JI5 K;  1V4S A;  4C8M A;  5AFU A;  4CZK A;  4FSV A;  4W5R A;  5FPN A;  3CCJ N;  4YDU A;  1TK0 A;  5AFU H;  1WBB A;  3ZSW A;  4FJ7 A;  5AQI A;  4B3M K;  4CZJ A;  2YV0 X;  4N56 A;  1KAY A;  4DTN A;  4JK7 A;  1WSG A;  1VQL N;  2HF3 A;  2IVP A;  2YHW A;  5B8H A;  2XY6 A;  1HNV A;  5E26 A;  4BR7 A;  2QKK A;  4H5N A;  4I9L A;  4QCL A;  3SMS A;  2HBM A;  3OJS A;  2HOE A;  4IG0 A;  4C8L A;  3AO2 A;  2P9I A;  1RNH A;  4ILH A;  2YJF A;  1BO5 O;  4HUE A;  1ZXO A;  3FZM A;  4CBW A;  2VG7 A;  3VA3 A;  1QHT A;  2W41 A;  3C95 A;  1J5O A;  1VSD A;  3WXJ A;  4E7K A;  2YHY A;  1Z26 A;  4FLX A;  4OX9 K;  3CJ1 A;  3CQ8 A;  3OYI A;  2XY8 A;  1K8A O;  2FSK A;  1SUQ A;  2A1R A;  4ISG A;  5LJW A;  1JLE A;  2DFH A;  3VEX A;  3SUP A;  1RT7 A;  2BTF A;  1N8R O;  3THX B;  5KGW A;  3H08 A;  4RG8 A;  4FWL A;  1TYQ B;  3N4Q A;  1R0A A;  3C94 A;  2Y1J A;  3F9M A;  4FPB A;  5EVZ A;  3ZSV A;  1HQE A;  1HYV A;  4CJU A;  1VQ6 N;  4RCH A;  4GNI A;  4BRM A;  4B9N A;  4K0K K;  1GLF O;  3NF8 A;  3VQ7 A;  4J2B A;  4E7J A;  2GBZ A;  4FJH A;  5C12 A;  2GX9 A;  3FE1 A;  4JS4 A;  1Z25 A;  1Q9X A;  4F2S A;  3CF5 L;  4DR4 K;  3ZT2 A;  1MA9 B;  2O8F B;  1S1T A;  4KI4 A;  4BG9 A;  5GIO A;  5KGX A;  2XY7 A;  1QTM A;  3H6E A;  4JI6 K;  3RRH A;  1KFS A;  3VQD A;  1B9F A;  3ZET A;  4FZY A;  4O4G A;  3MDQ A;  5E41 A;  3AAP A;  1NGI A;  4CED A;  3ZEU A;  1NNE A;  3CHW A;  1VQ8 N;  1VQ5 N;  3TAG A;  1KSP A;  3TAQ A;  4O5F A;  4CEF A;  3OYE A;  4J8F A;  1HKB A;  5AR0 A;  3QER A;  1S3X A;  4ELU A;  4IOA L;  4F4K A;  2O8E A;  3WEE B;  4BGA A;  1FKP A;  1BQM A;  2A41 A;  3QIO A;  5ELZ A;  4JKH A;  4B1Z A;  3TAB A;  4CHQ A;  3AA3 A;  1TV6 A;  4B9U A;  2X6N A;  4JLH A;  3EY1 A;  4BRK A;  4O5B A;  5J2Q A;  3VGK A;  2VQE K;  5M1F A;  3HTV A;  2NRT A;  2E20 A;  4I2Q A;  3WNG A;  3LDS A;  2KQ2 A;  2HHQ A;  2E2P A;  3CFP A;  4LF7 K;  4PQU A;  4CVN E;  3NH0 A;  4BRP A;  3LWM A;  4YHH K;  2Q0R A;  4FJG A;  2CGJ A;  3S3O A;  4BQZ A;  4B3O A;  5F0X A;  2WOM A;  1NKE A;  4Z4I A;  2IIR A;  4CZI A;  4GMJ B;  3TSQ A;  2D0O A;  4I9Q A;  1QQM A;  3PSI A;  3RSE A;  3C6U A;  3DLR A;  4CD1 A;  4FWK A;  2HMP A;  2NNW A;  3DJC A;  4LSL A;  4CBU A;  2DPN A;  3LPT A;  3U6F A;  3QEX A;  1ZYQ A;  1T05 A;  3BUZ B;  4DR3 K;  1C0U A;  5BN8 A;  4OKE A;  4FJ8 A;  4HWI A;  1EX4 A;  1KD1 O;  1VQP N;  4RW6 A;  3HPH A;  4GW6 A;  1NK8 A;  2O8D A;  5GIP A;  1WLJ A;  1LCU A;  1ZBH A;  3QEI A;  5AQQ A;  1HKC A;  3SV3 A;  4EFH A;  3OJU A;  3VA0 A;  4NYF A;  4WYB A;  3P83 D;  5BPM A;  4AHC A;  1RFQ A;  4BDY A;  3A5M C;  1VQ9 N;  1NGJ A;  3J81 O;  4CZE A;  1RIL A;  4MLH A;  3PO4 A;  4AQY K;  2G8K A;  2QI2 A;  2OAN A;  4KRE A;  4LF9 K;  3NHG A;  3KK3 A;  3AVG A;  1TAQ A;  3J8A A;  1R59 O;  2UU9 K;  4A5B A;  3PO5 A;  4EIA A;  2PBD A;  4A2B A;  2PAV A;  4FK4 A;  3O1B A;  4EP4 A;  1UA1 A;  2YNG A;  5HRO A;  4C8O A;  1M1K O;  4GV6 A;  5AZI A;  1QZ6 A;  3QEW A;  3E01 A;  1D9F A;  4H4M A;  2VWK A;  3A5O C;  3D2E A;  2NRX A;  1Z6R A;  4LSN A;  4CZM A;  4JD2 A;  1TUY A;  2E1Y A;  4CIG A;  3I55 N;  1U04 A;  2B5J A;  3SZ2 A;  1JLA A;  4A5A A;  3OYD A;  4DR5 K;  3WNH A;  4DG1 A;  4A59 A;  2G8F A;  1W2B M;  4ICL A;  3WNF A;  3I8D A;  3ISN C;  1TKX A;  3SQ1 A;  4BC4 A;  2D5R A;  3SAF A;  1KAX A;  1QVG M;  3D45 A;  3EYZ A;  3TAN A;  1ITG A;  1HRH A;  3R6M A;  2P9P B;  4KTQ A;  4BR9 A;  1RT3 A;  4M3R A;  4E3S A;  2E88 A;  3QDK A;  5I9E B;  1WSH A;  4BY9 C;  5C0Y A;  4FLT A;  5C10 A;  1ATR A;  1P8Z A;  1P90 A;  3KK7 A;  1C6V A;  1S1X A;  4IXC A;  4OPK A;  1NK4 A;  2YNI A;  4BWM A;  2FBY A;  2PZS A;  2HBJ A;  4BDP A;  1IBM K;  3DM2 A;  3VPZ A;  1NGD A;  1NG9 A;  1M90 O;  4M3X A;  4R79 A;  1BL3 A;  3IS9 A;  3O9S A;  5EOY A;  3QEV A;  2IS3 A;  4OO1 J;  2VQF K;  3LAK A;  4YOV A;  2WTU A;  2IDO A;  3ZSQ A;  3AVB A;  3H1Q A;  1U2V A;  3RMD A;  1JCE A;  3ZSR A;  4G1Q A;  2OPS A;  3MCP A;  2G8V A;  3HXM A;  4JI7 K;  1HKG A;  4IDH A;  2P9U A;  3M5R A;  5EX5 A;  3RMB A;  4Z0U A;  3NH1 A;  4NB4 A;  1BQN A;  1TUU A;  4B9Q A;  1TKZ A;  2H3G X;  3Q7C A;  3THY B;  4YDU C;  1G15 A;  4JKB A;  2HHS A;  3KLI A;  2Q2R A;  5C25 A;  3V81 A;  5AZJ B;  3LDQ A;  4CF2 A;  1QS4 A;  3P4I A;  3SUQ A;  2GEM A;  4CFB A;  4NCB A;  4J2D A;  4FOI A;  4RW9 A;  3J7Y P;  4F2R A;  4IJA A;  1W7A A;  4JI1 K;  3HM8 A;  3OHR A;  3OW2 M;  3DXM B;  4KHS A;  1NOZ A;  4DV1 K;  1TL1 A;  4JKF A;  2QW9 A;  5BPN A;  4JKG B;  3E9O A;  1IH7 A;  5AQV A;  1ASW A;  4J2E A;  4B3S K;  3H46 O;  4CJR A;  1J54 A;  4FLY A;  1GOB A;  3CQX A;  1C0M A;  3AO1 A;  3C6H A;  3EO3 A;  4AHT A;  4HTU A;  3THW B;  3RWU A;  3IDH A;  3CC2 N;  4CF8 A;  1ATN A;  1G99 A;  4K8X A;  3AO4 A;  4FJI A;  2QK9 A;  1ZBU A;  4FOE A;  1Q7Y O;  1JLB A;  5C24 A;  5BR9 A;  3VQ6 A;  3ZCM A;  4DV6 K;  4DSE A;  1S6Q A;  4KPY A;  5AQR A;  1RDW X;  3S41 A;  3PV8 A;  4H5T A;  4CW7 B;  1SL2 A;  4E1J A;  4O44 A;  4B9L A;  1T3V A;  1S9G A;  4V19 S;  5HL7 L;  4JK9 A;  4DV2 K;  3L6Q A;  3OYG A;  2KKZ A;  2HVH A;  3FLC O;  4CE9 A;  4FVU A;  5J2N A;  3EN9 A;  3MCA B;  4RTF D;  4IEI A;  3CER A;  4DSF A;  5HLF A;  4YY3 K;  5LJV A;  2O8C B;  3THX A;  3P5J A;  1JKH A;  2KHO A;  4CJQ A;  1NMN A;  3MXM A;  5JMV A;  4CGG A;  3OYF A;  5AQN A;  1T6C A;  4LF4 K;  2ZF5 O;  3T1H K;  2QWN A;  3JAM O;  5C42 A;  3OYA A;  3TU5 A;  4NO7 A;  4O8U A;  4JI3 K;  4IDK A;  5LL6 Z;  1NU0 A;  3LAL A;  2YCH A; 
#chains in the Genus database with same CATH homology
 4LF5 K;  3J81 O;  1IBK K;  2ZM6 K;  4DR1 K;  4AQY K;  3T1Y K;  1FJG K;  4LF9 K;  5FLX O;  1HNW K;  2UU9 K;  4GKJ K;  4LFA K;  1HNX K;  3J7Y P;  5LMU K;  1N34 K;  4JI1 K;  1HNZ K;  4JI0 K;  1XNR K;  5AJ3 K;  4DV1 K;  4DV5 K;  4X66 K;  5IWA K;  4OX9 K;  2VQE K;  2UXD K;  4X65 K;  2UUC K;  4JI2 K;  4B3S K;  4DR6 K;  4X62 K;  4JYA K;  1XNQ K;  5LMN K;  4DR5 K;  2E5L K;  2UUA K;  4LF7 K;  1I94 K;  4CVN E;  4DR2 K;  4YHH K;  1HR0 K;  4LF8 K;  4DUZ K;  4DV7 K;  4DV0 K;  4DV6 K;  1N32 K;  4DUY K;  1N36 K;  4K0K K;  3J7A P;  4DV3 K;  2UUB K;  4NXN K;  2HHH K;  2UXC K;  1IBL K;  4CW7 B;  3OTO K;  2UXB K;  5A2Q O;  4JV5 K;  4LFC K;  4JI8 K;  4V19 S;  5BR8 K;  4DR4 K;  1XMO K;  4DR7 K;  4DV2 K;  4LF6 K;  4GKK K;  4LFB K;  4DR3 K;  2F4V K;  1IBM K;  4YY3 K;  4JI6 K;  1N33 K;  4JI5 K;  1J5E K;  4B3R K;  2VQF K;  5IT9 O;  3J80 O;  4LF4 K;  3T1H K;  4DV4 K;  4NXM K;  3JAM O;  4B3T K;  4X64 K;  4JI4 K;  1XMQ K;  4JI7 K;  4KHP K;  4JI3 K;  4B3M K;  5LL6 Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...