1I94K

Crystal structures of the small ribosomal subunit with tetracycline, edeine and if3
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
123
structure length
123
Chain Sequence
KKKVKRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RRNA
publication title Crystal structures of complexes of the small ribosomal subunit with tetracycline, edeine and IF3.
pubmed doi rcsb
molecule tags Ribosome
total genus 18
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2001-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 1i94K00
2HHHK 1IBMK 3OTOK 1N32K 1N36K 4DR4K 2UXBK 4GKKK 1IBKK 2UUAK 2UUCK 5AJ3K 4K0KK 5A2QO 4YHHK 4DR2K 1FJGK 5LMUK 4DR3K 4JI8K 4DV4K 4JYAK 4LF7K 4V19S 1IBLK 3J7YP 4DR6K 2E5LK 4OX9K 1HNXK 1XMQK 1HNZK 4CVNE 2VQFK 4JI2K 3J81O 4DV7K 4DR1K 4JI0K 2UXDK 4B3MK 1N33K 3T1YK 4JI3K 4DV3K 4X65K 5IWAK 2UXCK 4GKJK 4X62K 1N34K 4DV5K 1XNRK 4B3TK 1I94K 4YY3K 1XNQK 5BR8K 4AQYK 5LMNK 4LF8K 4X66K 4DV1K 3J7AP 4LF6K 3JAMO 4JI1K 4DUYK 4JI4K 4DV2K 4DV0K 4B3SK 2UU9K 3T1HK 4LFCK 4JI5K 4DR7K 4JI7K 2UUBK 4JI6K 3J80O 4DR5K 5IT9O 1HR0K 4NXNK 4LFBK 1XMOK 5LL6Z 2VQEK 4LF4K 4LF5K 4LF9K 2ZM6K 5FLXO 4DV6K 4JV5K 4B3RK 4DUZK 4NXMK 4KHPK 4X64K 2F4VK 4CW7B 4LFAK 1J5EK 1HNWK
chains in the Genus database with same CATH superfamily
3L2UA 3VGMA 1N32K 3H08A 5AQSA 5ELZA 3LDLA 2E6LA 4AF1A 4ELTA 4DFKA 1IG8A 2YHXA 3OW2M 1NU0A 4CEBA 1VRTA 2X6SA 3F73A 4BWJA 2QXFA 5EX5A 4MLHA 1NJYA 2DFFA 2EWSA 3KK1A 3HL8A 3O5BA 5GAGP 4M3UA 1V4SA 4DR6K 2D0BA 1RDWX 2HHXA 4JK7A 5K14A 4A61A 3GBTA 2HMPA 4E7HA 4BY9C 2ASOA 4IDKA 3T1YK 4KH4A 1VQKN 3W0LA 4DTXA 1D9FA 4CECA 2GUIA 3DXKA 2WONA 3TSQA 4CJ4A 5BREA 1ZYQA 2BUPA 1MDUB 4DSLA 1ZBLA 1XNQK 2PFUA 4ZHRA 4XH4A 3IMXA 4FWRA 3ZSVA 3MXMA 4CK1A 4PHTX 3GOIA 3LL3A 1BOTO 2ZJRL 1IKVA 4B1UB 1LOTB 1SL0A 1ZBIA 1WNSA 2I5JA 2NUBA 3C6AA 1X9MA 1WAFA 2P9LB 3OYIA 2HNZA 3A5MC 4B3OA 3LAKA 3CPEA 4E3SA 1TK5A 4KREA 3FZFA 3RMAA 1GLBG 2UUBK 4DU4A 4OKJA 4Z4CA 2A1SA 4YOWA 2A1RA 1X1PA 4MO5A 1FKPA 4LFBK 3RTVA 1S1TA 3ZEUB 3E01A 1EWRA 4I2PA 1VSKA 1J9AA 2YJFA 3KD5E 3MN6A 5AQMA 3GG4A 1BWFO 3VTHA 1NOYA 1RGIA 3DRSA 3QBXA 3BF1A 2W41A 4IJAA 3U9ZA 3ZSYA 2E4LA 5AQXA 1VQMN 4DU1A 4CJTA 1WSJA 3AVKA 5C42A 3EO3A 1TKXA 2H3GX 2O4GA 2YHAA 4BR4A 3SAFA 4K42A 1WBDA 4KHWA 4YNQA 4O5FA 5BPNA 5H1SQ 4KV8A 5AR0A 3M8SA 3AVCA 4W5RA 2NRRA 1K9MO 1YF5L 3O08A 3HP9A 4CK3A 3RMCA 5AQHA 3SV4A 1QSLA 4EHUA 4OPKA 1HJRA 1QVFM 2P9LA 1S72N 4KFBA 1VSDA 4QS9A 3M8RA 3TAPA 4FLUA 1XHZA 1NKCA 3QLHA 3L8BA 3QFUA 2IVPA 3MCPA 4DHYA 3O4NA 4B3MK 4ISGA 4CEOA 2YNGA 3CJ9A 1VSLA 1W0HA 4X62K 1DEJA 5CR4A 5SZTA 3KLGA 3DLRA 4H4OA 3ZEUA 3RMDA 2HF4A 2OPSA 2BH1A 1RBRA 2A40A 4WE1A 3GDQA 3UE5A 3VEWA 3VQ6A 1VQNN 4PA1A 3F9MA 3E9LA 3HBTA 2GUPA 1WLJA 3TI0A 1RT1A 3O9UA 3HP6A 4MQ3A 4OKEA 4X66K 4HUGA 4F9OA 3QEXA 3VA3A 1T05A 4Y1DA 2IVOA 5CYQA 1WN7A 2ATQA 1TKZA 4AM7A 2O8EB 2Q36A 3SV3A 1L3SA 1JLAA 2FC0A 1KAXA 1HLUA 1WOQA 1HKBA 4XEIA 1XI1A 1T3VA 4GY2B 1OH7A 5LJVA 4NXNK 4PQUA 3I56N 4KTQA 4BG9A 1BIZA 2VQEK 4FJMA 4LF4K 1NK7A 1KFSA 4WFNL 4I7FA 1NGDA 5TKYA 1NJZA 3AO1A 2VG7A 5GIPA 4H5RA 2RKIA 1J5EK 2IVNA 5AZJB 3PX6A 5AFUH 3QB0A 4IOAL 1DLOA 1QZ6A 3K9KA 3PX0A 3C6HA 4WFBL 4H0OA 4BR9A 4E7JA 4M45A 4CZLA 3I55N 3M1FA 1WAJA 3DMJA 3VETA 4DS5A 3OHRA 3EZ5A 4O5BA 5MLCQ 4B9MA 3LPUA 2HBJA 4DSEA 1ZBSA 3LP3A 2I7NA 3R6MA 3V1QA 2D0AA 2O8EA 1NK9A 2DFEA 4UY8O 2HSTA 4DTSA 4JI3K 3DRPA 3TSPA 3L2QA 4A62A 2E1YA 4BRHA 4AHCA 4H0VB 3DRRA 4J2AA 4B9QA 1YJWN 3G25A 1R0AA 4AHSA 3KKRA 1SZ2A 4CZJA 4FK4A 4DV1K 5AZJA 4GVEA 3AA2A 1WSEA 4XH1A 3DLGA 4B8CA 1SAZA 4DU3A 5HP1A 2ITMA 3WXMB 4J2DA 5DMRA 2HVIA 1RBVA 2X74A 1EP4A 4FW2A 1VQ6N 5BPMA 1RNHA 4JEPA 4O0IA 3OYDA 4HWIA 3CCQN 1FW6A 4FJJA 4M42A 4FO0A 2WOMA 4CF8A 1M1KO 4KH5A 1HKCA 1K6YA 4WQ4A 4CJUA 3CPWM 4FJHA 3VERA 3SZ2A 1NKEA 1VK0A 1T6CA 4IJNA 3TAMA 4CZMA 3AAQA 2OYQA 4NB4A 5FLXO 3HOTA 1SKRA 3NF6A 4DUZK 4M7YA 2G8UA 2E2QA 4IOXA 5GAEP 1KRPA 3WQUA 4X64K 4KAZA 2F4VK 1FXXA 4JD2B 4U67L 1QQCA 4B9LA 5I9EB 1HNWK 1GOBA 4CZIA 4DR4K 2QW9A 4E0DA 1ZXOA 3CMEN 3H45C 1WSFA 2QWNA 3DXMB 4YDUC 4FLTA 4B08A 1BCMA 3O4QA 5C25A 1J5OA 4FSVA 3VQDA 4BE1A 4CHPA 2YNFA 4CHQA 4FXDA 3QMLA 2OCEA 1U6ZA 3IFRA 4FPBA 4O8UA 2KTQA 3TAGA 3ZT1A 4BRCA 4DCHA 4DKWA 1K8KB 1RDBA 3J7YP 5HLFA 2E5LK 2OTJN 3ID8A 4Z4IA 2VGMA 2HNDA 1N33K 5AQGA 4X65K 2W42A 3OYFA 3PUFA 3E1YA 3P1GA 3ID6A 4YY3K 4CZEA 3B8AX 1HNVA 5HBMA 1HQEA 3Q7BA 4FJ9A 4TSXA 4AQYK 3OJSA 2KLAA 1NM1A 1E3MA 4JD2A 5FRMA 4JKEA 4EHTA 4CE9A 3U9DA 2FLOA 1NMNA 3SPYA 4UQGA 3DXMA 4CCHA 3MEEA 3AO5A 4JI5K 3HO1A 3S41A 1YJ9N 3WXIA 3ASMA 3FE1A 2O8CB 3OYCA 1X3NA 5AQVA 4L3QA 1A5XA 2WTUA 1LAVA 1HR0K 1YUWA 2PYLA 1K8KA 3VEZA 3EL2A 3DLLL 4KO0A 4F2RA 5AFUA 1N6QA 4CJWA 1NK0A 4B3RK 4C1NK 3NDKA 1OVYA 4DMNA 3LDNA 4CJKA 5EU7A 5M1NA 2PYJA 3OYJA 4YOVA 1U47A 3MMVA 3IAYA 3O6WA 3SK3A 4FWSA 4MFBA 4PL7A 1H1VA 3RR7A 1KLMA 4JK8A 1U4BA 4FL9A 1TAUA 4N5SA 2OA8A 2WUSA 2QTDA 3HZ6A 2Q1NA 3CHWA 4CIFA 3MECA 3AA5X 2O8CA 1X3MA 3LWMA 3HTVA 4IXCA 1S3XA 1SKWA 4LSNA 3D45A 1B9DA 3NVKA 4AHUA 3AVMA 3BGRA 1I94K 5JS2A 3LZIA 1LWFA 3DWLA 1JLFA 3KK2A 2PY5A 1XUPO 1S6QA 1HX1A 4M3ZA 5LMNK 3L2RA 1VSMA 3CG7A 1KVCA 1KAYA 1JLQA 2G8KA 4FK0A 4BRGA 1N5YA 2G8HA 3DM2A 3S9HA 3MN9A 2ZJPL 1JXEA 3AVGA 3CCMN 5FRNA 1OVQA 1BG3A 1P90A 3PSIA 3UKUB 1HKGA 1Z6RA 5F1XA 5GAHP 5HOOA 4E1NA 4M3RA 4KI6A 1IV0A 1FK9A 2VWBA 4GMJB 1BHLA 4ISEA 3RSEB 3SBTA 1X9WA 4RW8A 3AVIA 5BR9A 3DLEA 4E89A 1KCFA 1O1WA 5M1FA 1ZBUA 3JYTA 4CEZA 4DLGA 4B9UA 4RW9A 4B1YB 1IKYA 4KHSA 3KHYA 2GELA 4CHNA 3AO4A 3OJUA 3THVA 5BRDA 4CI6A 2VWJA 3SNNA 4DSKA 2OANA 4FJ7A 4CFBA 4DSFA 3K9JA 2YJEA 4B1ZA 3CCUN 5C10A 1QZ5A 2XY7A 1YXQA 3CYMA 1QHTA 4B1VA 2YNIA 4AH9A 3QBWA 3AVJA 4CGFA 2YKNA 4FYDA 2XY6A 5AQIA 3ITHA 3SJJA 4F2SA 4DQ8A 1WUAA 3DAWA 2BANA 4FWNA 4CZHA 3QEVA 3NVMA 3CQ8A 3NH0A 1BA0A 4CBXA 5E26A 1NK8A 4GV9A 4BRNA 3T3FA 4CJLA 1JLEA 1ITGA 4BGBA 4DSJA 1T6DA 3UKUA 3U3YA 3LDPA 2BTFA 1XMQK 5CE3A 3UIQA 1C0TA 2XY8A 4DTRA 3RSEA 3OBWA 1XHXA 3D7EO 1U49A 1NGCA 3HVTA 5BRHA 3G6EN 2HBLA 3VQPA 3O9TA 2F9WA 3SI6A 4FJKA 1CXQA 4H0PA 2E2NA 2ZF5O 3SMPA 1NJIO 3ZSRA 4CZGA 3ZX2A 1NMDA 3MN7A 2KZMA 3PIOL 3TAFA 1JCFA 4QCLA 4FWLA 1Q82O 3IUCA 3KK3A 2P9KB 1SUQA 2B5JA 4RW7A 1U48A 1G15A 1QE1A 3EY1A 3CFRA 1RBTA 5ADXH 1CZ9A 3O3HA 4FW1A 2HVHA 1D9DA 4Z94A 4C1NI 2D1KA 3E9PA 2JLEA 4KH6A 3VQEA 4AM6A 4E1MA 3IDHA 3L0QA 3HPOA 1B92A 4A2AA 4CERA 4JKDA 2FF6A 3A5NC 4PKGA 1U2VB 2D0CA 1NGEA 1Q9XA 2QEXN 3BDPA 4I9QA 3L4QA 3DLHA 4Z4FA 2ZM6K 1RT3A 4FVUA 1U45A 5I42A 3GE1A 1GLLO 3KLHA 2HNYA 1HPMA 2UYTA 1ESVA 1VSHA 2FSNA 4BE0A 1UAXA 2HHQA 1NKBA 1P8ZA 1RT2A 1VSIA 3KVGA 3ZYYX 3R3LA 5E41A 2NLXA 4GKKK 3WNHA 1D4XA 2VCPA 2QA4N 4DG1A 1IO2A 1XC9A 4FJGA 1RT5A 3I0SA 2FBXA 2P9KA 4HTLA 4OPAA 3G71N 1NK5A 2NRWA 4K41A 1NK6A 4WQ5C 1K73O 1BCOA 2G8WA 4E19A 4EIAA 3VA0A 2A42A 1HYVA 1BQNA 1VQ7N 4KB0A 3DLBA 3TTCA 4JI0K 4MO4A 1U2VA 3VQAA 4BDYA 2Y1IA 4M63C 3PLAA 2ITGA 4FZZA 4RTFD 4FWPA 4NLBA 3SMSA 4F3OA 3DLKA 2ASPA 5C15A 4FLVA 2R7YA 3BY5A 4B9NA 3T7ZA 1TK0A 3VESA 4BRKA 2D0PA 3HRGA 4FZYA 2VWKA 3KWIA 1KVAA 4C8KA 3ENOA 4BRMA 5JVGL 3AAPA 3E9OA 3CJBA 4IEEA 2WBNA 4DV2K 1T8EA 1BDGA 2HF3A 2OZSA 3U8XA 1S6PA 2HW3A 4B3SK 1UOCA 1WBBA 3NF8A 5E84A 1LWEA 2E20A 1RBSA 1DT9A 5M1PA 3SBGA 3NGIA 4OPHA 4DFMA 3THWB 1NJWA 1VAZA 3EZWA 1M90O 3H1QA 3TARA 3HSCA 2E1ZA 4CFCA 4IO9L 2J4RA 1W2BM 4EP5A 4BROA 4JRQA 1UWBA 3LM9A 3ZSXA 5KPRA 3SAHA 3V9XA 3CCLN 1ATNA 1ASWA 4FJ5A 4QOZB 1KVBA 2D4WA 3J8AA 3LP0A 2WC9A 4CZFA 1S1VA 4BDPA 3VOVA 4K8XA 1NGAA 4CJQA 5AQLA 2X78A 2PAVA 3CFOA 4F3TA 4IO8A 4I6MB 2OPRA 2QKKA 3MWPA 2UUCK 4FLXA 4M3TA 1JLCA 3D2FB 4C23A 1YJNN 4DR2K 5J1EA 2A5XA 4NLCA 4DV4K 3G4SN 1S5JA 4CF2A 2PZSA 5I3UA 3QNNA 4A57A 2ZD1A 2ZGZA 1JCGA 1K8AO 5AQTA 2QWLA 3R8EA 2KFZA 3R9PA 4OX9K 1SV5A 4CVNE 1SS6A 5JS1A 4ELVA 3THWA 3C94A 1JL2A 5JLFA 4OGEA 1YTAA 4GKJK 5JICA 4AHTA 3HVRA 3CQYA 3VQ4A 1RDAA 1S1UA 4B3TK 1CLQA 1YTUA 4N47A 3P39A 4Z4HA 4ISFA 2HHSA 2PBDA 3RMBA 2OZMA 2P9NB 4DTMA 4Q0BA 1LWCA 3MX2A 4N41A 5AQYA 2F8SA 3DJCA 3NHGA 2YNHA 3SPZA 2QI2A 4I6MA 4BRFA 4BR2A 5JVHL 2RPIA 3OYAA 3D2FA 5EVZA 3V81A 4BQZA 4KB1A 2HB5A 1RFQA 4NYNA 3LM2A 2CGLA 1D8YA 2GV9A 1B9FA 4NYFA 2JGUA 4B1XB 3OY9A 1IJJA 3AARA 4BC4A 3CJAA 3CM5A 1OKJA 4CFAA 2CH5A 2QKBA 2DFHA 1WSIA 4JV5K 3TTDA 3ZT3A 3H3OB 2CH6A 2EHGA 4OO1J 1EETA 3L4IA 3OYNA 5C2DA 3VN5A 1Q9YA 5J2PA 5HROA 4IOCL 3ZSOA 2F96A 3SUPA 1S1XA 3LDSA 3HM8A 3P4IA 3PSFA 4DQSA 2OPPA 3LANA 1KD1O 2UXBK 3J7ZO 3VGLA 3B6PA 4JKAA 3U6FA 5HRSA 1JKHA 3H3NO 4OGCA 2P9NA 3QINA 1X9SA 2KW4A 1LV5A 2NZTA 4CD3A 4YDUA 3IG1A 3O8MA 1UA0A 2G8IA 1Q86O 2IDOA 3DYAA 4W5NA 2RN2A 4H03B 3QEIA 1IBLK 1SQKA 1UA1A 3THYB 1ILYA 4H8KA 1L3VA 1OH8A 3NFAA 2FBYA 3EYZA 4DR1K 3MEGA 4U7BA 4HCCA 4OLBA 5IWAK 2G8FA 3MK6A 3O3GA 3FLCO 1HMVA 2GWJA 4JKHA 4OVLA 4YORA 2RF2A 2GWKA 2DY4A 1QQNA 1BO5O 3HPHA 4JS4A 3EN9A 4CGGA 3VQ7A 5AQWA 3NBPA 4NCBA 3I8BA 4FK2A 3C95A 1RILA 3P5JA 5CZ2A 4BR0A 3TSUA 4JRPA 4LF8K 4K8ZA 1J53A 3JAMO 2GTDA 4FM0A 3FGUA 3AV9A 1VSFA 4CFDA 1TGOA 3AA3A 4I9LA 3WXJA 3QIPA 2V7ZA 4BRPA 2P9UB 1EQYA 3ZCMA 3VPZA 1IH7A 4RWTA 2VYPA 3RWUA 3QETA 3TAQA 4QAGA 4Z0UA 3K0SA 1Y97A 4ID1A 4O0JA 3J80O 4E1JA 3CCRN 5EOYA 1VQ4N 1XMOK 1WB9A 3QICA 1IG9A 1I39A 3THYA 4JKBA 3SQ0A 5GADP 3SYZA 3OS1A 4IG0A 2FSKA 5M1KA 3R1XA 5BN8A 2BE2A 1J54A 3AA4A 4CK2A 4JLHA 4ZTJA 4CEQA 1C0GA 4FWQA 1Z05A 5D3GA 1VQLN 1ATSA 2Q97A 1NGIA 1LW0A 1GLCG 1NLVA 2Q0RA 4DF4A 5AQKA 3GL1A 1VSEA 3T1AA 4HTUA 1E4FT 4FLWA 5KRTA 2NNWA 4WYBA 3MXIA 3NH1A 2HHWA 4JI8K 1BI4B 5AQUA 4H4MA 2RE2A 3JSMA 2NRTA 4IBNA 2D5RA 3ZSWA 1D5AA 2O8BB 2HOEA 3CQXA 3K59A 3KTQA 2P9UA 2W6KA 4KHUA 3ATVA 2F8TA 3F2KA 1HNZK 2B6AA 3HYFA 1IKWA 4DWIA 2VG6A 4Z4EA 3J81O 5FPEA 1MWKA 4CGIA 2UXDK 2IAJA 3AO3A 2I7PA 4BDZA 1NGJA 1YITN 1Q8IA 3FFIA 4N56A 3TABA 1TYQB 4M3WA 3I0RA 3C65A 3OYMA 4BR7A 3L2WA 4BG8A 1TKDA 3SAGA 2WFBA 2P51A 2IS3A 3CC7N 3AVNA 1YVNA 4JI4K 3EKSA 1TUYA 3WT0A 2OPQA 4ELUA 4CJ7A 3NCIA 4ID5A 4FJ8A 3RR8A 4MDAA 1RDDA 3FZHA 4DFJA 3CERA 4FCYA 3M8QA 2F7TA 4BQLA 4AHVA 3U3GA 1BI4A 4JKGB 3S3NA 1O13A 4CEAA 5JMVA 2P9IA 3HOSA 2O8BA 5IT9O 2Q0UA 4HCBA 1YAGA 2AA4A 4FOEA 5LY3A 3FR0A 1TKTA 1XWLA 4YOYA 2HHVA 3K5LA 4DLEA 2FBVA 3ZSZA 1NGGA 5EY4A 3ZT4A 4KHPK 4CHYA 3ZX0A 1NGFA 4GVMA 4KBOA 2B4JA 3H1VX 1N36K 4H0TB 3C7NB 2F9TA 4FJIA 1TYQA 1GLDG 1BUPA 2E2OA 4O8KA 4CD1A 4CZKA 4ILJA 3A2FA 2Z1HA 5M1QA 1JCEA 4FLZA 5AQNA 3WXKA 5B8HA 4BGAA 4H0YB 4IFEA 4IKFA 4CHOA 4YHHK 4IDHA 3PY8A 1FJGK 4DR3K 3L6QA 3M5RA 4FM2A 1YT3A 3G10A 2NRXA 3HI0A 4AILC 3K57A 3OYGA 3O4WA 2O8FB 1KLNA 3V1RA 4JYAK 1S1WA 5BPLA 2NRHA 4BC5A 1KC8O 3CCSN 1MU2A 4H5TA 5LJWA 3UB5A 1QSSA 1ZC6A 3AY9A 4FWMA 4JKGA 5HRRA 4DV7K 3WXLA 1Q18A 4HVJA 2V7YA 2E88A 3CC4N 3NH2A 4YOXA 4LSLA 1OH5A 3ISNC 5AQJA 2FBTA 3WQTA 3K2PA 4A5BA 3QDKA 4CF1A 3K5MA 4LY7A 4CIGA 3S3OA 5C0YA 1HJOA 4FPAA 2A3ZA 3CJCA 1Q7YO 3CETA 3WEEB 4LF6K 1VHXA 1QVGM 1C0UA 3VEXA 5KTQA 5BN9A 4F8RA 3CM6A 3O80A 3C7NA 3MEDA 1NJXA 2YKMA 2P5GA 3F5TA 2RHKA 4A5AA 3A5OC 4J8FA 1U04A 4I2QA 4DQPA 4A2BA 5AZIB 3V9WA 1C6VA 3UKRB 3SQ2A 3KLIA 4DR7K 3G0ZA 1N8RO 3NGZA 2O8FA 4R5PA 2FSJA 3JS6A 2OTLN 3FZKA 4JS5A 3HT3A 4BR5A 4L8RB 3SUNA 2BDPA 3TTFA 4FOIA 1V4TA 4NXMK 2YCHA 2ZE2A 2XRIA 4C8LA 4RW4A 3OA9A 3NGYA 2HHHK 3ULEB 3OTOK 2A41A 3V6DA 1C1AA 2ZQBA 4BRQA 1RCHA 4DTUA 2XHBA 2JWLA 4DTJA 4FLYA 3MAQA 3NMUA 3KLFA 5CZ1A 1CXUA 4GNIA 3WEEA 3WUHA 4OKKA 2IIRA 3AVFA 3L3VA 5FPDA 1YHQN 3K5OA 3LDOA 4BREA 5BRFA 4IFVA 4FVMA 3EE9A 3C6UA 2FF3B 3NE6A 3A0IX 4V19S 4G9ZA 4LC9B 3ALYA 4WQ5A 5AZIA 5CYMA 3UKRA 4KRFA 1NWKA 3PO4A 4H5WA 1EO1A 2IGIA 3RVCA 4JI2K 1JLGA 3V4IA 3S3MA 4Q5VA 1C0FA 2KQ2A 3QFPA 3QEWA 1OH6A 2E6MA 2DTUA 1EKEA 2YHYA 4Y1CA 1VQPN 1NG9A 3PIPL 3HXMA 3CJ1A 3AGRA 4BRDA 3HK2A 5FROA 1F21A 5FPNA 4B8AB 2A6AA 3HPGA 3KWGA 3ZSQA 5DM7L 4FWOA 2P5OA 1C1BA 3DOKA 3ULEA 1T03A 2ASMA 3V9ZA 4CJVA 2CGKA 4BRAA 3CIPA 5JLHA 1VQ5N 3QIOA 4KHYA 3A5LC 3EKUA 3D6RA 1HNIA 3SCXA 3VQBA 4EP4A 1LAWA 4FJXA 3VQQA 2D0OA 2HBMA 1GOCA 1JJ2M 4DQRA 4DR5K 4K25A 1RTIA 5TKWA 1XQSC 4RG8A 4DSIA 5LL6Z 4O44A 1T7PA 1RTDA 1RDUA 3K58A 5KGXA 1RDCA 2CGJA 5AQRA 4ZTFA 2HMIA 3NF9A 1T44A 3SJHA 4W5QA 3TR8A 1DTTA 4OPJA 4Z4GA 1BQMA 5M1OA 1IBKK 3RRHA 2P9PB 3OYEA 2UUAK 1TAQA 4MDBA 3FFKB 4DS4A 2QWQA 2QM1A 3TU5A 4YOUA 1RT7A 2GBZA 4EZ9A 5LMUK 4M3XA 3ENBA 2Q31A 4BVPA 3DOLA 4DTOA 4LF7K 1L3TA 2V52B 3V1OA 3LP1A 1QQMA 4C8OA 1W9HA 1HNXK 5F2RA 4GV6A 2VQFK 3M6GA 3FZMA 3CD6N 1MWMA 4B9TA 2W6LA 2AJQA 4DV3K 3NF7A 1BISA 3VQ5A 3T19A 3W3DA 4CBWA 4JKFA 5DM6L 3LPTA 1I3AA 1L5UA 1RT4A 3O9QA 1TL1A 2DPNA 2GEMA 1VSJA 1GLEG 1TUUA 1S9EA 3J7AP 3WNFA 2YX6A 3OS0A 1S9GA 4BC3A 3E66A 2P9PA 1NGBA 4NO7A 3KZBA 3THXB 2KHOA 1JL1A 3ZLJA 3O3FA 3CC2N 3AO2A 4XH5A 3OYBA 3LZJA 1BL3A 4IWVA 5CHIA 2ZJQL 5ADXA 3KD1E 3EEQA 3CMAN 5KRSA 3LWLA 2NRVA 4LF5K 1A5VA 4PKHA 5GINA 4ILHA 2P1JA 1JXBA 4F4KA 3P83D 4PL8A 1KQSM 4CW7B 3MDQA 3VQ8A 1IBMK 2ZGYA 1R59O 4B1WB 4J2EA 4CJPA 4LH4A 1BU6O 2O8DB 3C6TA 3CCJN 3QNOA 1HPZA 4LH5A 3VEYA 2V51B 4K0KK 3O9RA 3VQCA 4BE2A 3CCVN 1QS4A 3RRGA 5KPTA 2HHTA 4WF9L 4H5VA 2YI1A 2BGGA 1IKXA 4M7XA 1WSGA 2Z1GA 1KAZA 3HJFA 3WNEA 3QERA 4H5NA 5CY4A 3THXA 3L2VA 3VENA 1BA1A 4FJNA 1SL1A 2E2PA 1GOAA 4KKOA 1DGKN 3F9KA 3V9UA 4QS7A 1ZBFA 2VG5A 2X6NA 4IG3A 4DTNA 1BGXT 3IKMA 3AVLA 4B9VA 1GLAG 4O55A 5FDLA 1XNRK 2HBKA 4C8MA 4WCEL 3N4PA 4QS8A 1YI2N 2KKZA 3AVHA 3IS9A 1ASUA 4CEEA 4KTWA 2QWMA 1X9JA 3LAMA 4CEDA 4E7IA 4MLEA 1G99A 4CEFA 3K5NA 3TANA 1TV6A 4PY5A 4PKIA 2XY5A 3LP2A 4KHQA 4A59A 4DV0K 2O8DA 3O1BA 1GLFO 3CXCM 3T1HK 4LFCK 3BZCA 4M41A 5HRNA 4W5TA 3Q7CA 4XIUA 1Q81O 1SL2A 3ZT0A 4GW6A 4WQ4C 1RBUA 3HM9A 5SWMA 3OYHA 4CGHA 3KJVA 3BZKA 1S22A 2Z1IA 3MWTA 3JXUA 5J2MA 4HUEA 1W97L 4ICLA 3P38A 5J2QA 3MX5A 3BP8A 3ULDA 2IOCA 1CZBA 1KXPA 3QEPA 4NCAA 5FPMA 3SUQA 3ENHA 4JKCA 4EZ6A 2HHUA 3MXJA 5KPZA 3MCAB 2ZWHA 3SQ4A 4M3YA 2QXLA 3TPQA 1TL3A 4OJRA 3VF6A 2O4IA 1EXQA 2Q3SA 3OS2A 1EX4A 3KK7A 2YV0X 3M8PA 3VTIA 1QSYA 5GIOA 4CJFA 4N76A 4BVOA 5T7BA 3CCEN 4KTZA 3WNGA 5A2QO 1REVA 1JLBA 1MA9B 4IZ9A 4Y0WA 4FJLA 1A5WA 5KQDA 2QWOA 4CHZA 3D2EB 5DK5A 4H0XB 4CIEA 2EX3A 4BC2A 2G8VA 1XC3A 1W7AA 4ILGB 4CGJA 4CJSA 1ASVA 5EXWA 4W5OA 4J2BA 1TK8A 4HUFA 3VMFB 1QHAA 3C0BA 4JHDB 4RW6A 3EE8A 4IEIA 1VQON 2UXCK 3SUOA 1L3UA 4LD0A 3DI6A 4B9SA 1NK4A 3BUZB 3ZX3A 5HL7L 4CJEA 2P9IB 5BR8K 2AP1A 1TVRA 3IRXA 4NCGA 5C24A 1HYSA 1FKOA 1GLJO 3KLEA 1EWQA 1CZAN 1RTHA 4C8NA 3SQ1A 4JI1K 4E7KA 3BEXA 2P9SB 4K43A 4R79A 3A8YA 1DTQA 4DF8A 4PWDA 4CF9A 2QWRA 5HRPA 3U4LA 3D0PA 2UU9K 4JN4A 1YIJN 4DB3A 2YHWA 4WFAL 4KI4A 4JI7K 2Y1JA 5AQOA 1DKGD 4JI6K 1HYZA 3PX4A 5C2FA 2LSNA 2KZZA 3D2EA 3TWHA 3AGKA 4CJ3A 2FXUA 2W40A 3VF2A 3H6EA 3VGKA 2QWPA 3ZETB 5AQFA 4AHRA 3H46O 1NBWA 1SKSA 4LF9K 1NNEA 4DV6K 4OLAA 3O9SA 1ATRA 4JHDA 4CBUA 4KHNA 1QQOA 4JAXA 5AQZA 4BACA 3AVBA 4G1QA 3KKSA 5AQQA 3QO9A 1C0MA 3P31A 3LALA 4CJ5A 1KFDA 4CGDA 3N4QA 1WSHA 3FZLA 3KIOA 3ATUA 4GV3A 4BWMA 5AJ3K 5KI6A 4FM1A 2P9SA 1RT6A 3OVNA 3B6OA 3HSTB 1LCUA 4KPYA 3AVAA 5KQ8A 3CFPA 3LDQA 2ETJA 3CF5L 1VRUA 4BRLA 4DQQA 2Q2RA 3O1WA 2VGNA 4O4GA 4FZXC 3OBYA 1Y64A 3TAEA 4HHTA 1BIUA 5F0XA 3VQ9A 1N34K 2QK9A 2JWKA 3ZETA 1VQ9N 4DV5K 4BRIA 1RTJA 4JNEA 4E7LA 3SLCA 3I33A 3OYLA 1C1CA 1NOZA 3PO5A 2IC3A 3I8DA 3NAEA 2NRZA 3OYKA 1Z25A 1E4GT 4CJRA 4DUYK 3PV8A 5C12A 4RCHA 3M3ZA 1HRHA 1Z26A 4DQIA 3BF3A 1ZBHA 4EFHA 1KTQA 3QESA 1KSPA 5AQPA 5KGWA 4EAHD 1J6ZA 3VEVA 4CF0A 4DTPA 2Z1JA 3ZT2A 4FWKA 2YHBA 2E8AA 2GX9A 1NGHA 1QTMA 4PUOA 1VQ8N 1YVUA 3VEOA 3DXKB 3V9SA 3CJ7A 3CI5A 1HQUA 3MN5A 5J2NA 1LW2A 4DFPA 1HUXA 2XO7A 3T69A 3L3UA 4IFYA 4JK9A 4YOTA 3VF4A 4YFUA 4LFAK 2KFNA 4CESA
chains in the Genus database with same CATH topology
2HHHK 1IBMK 3OTOK 1N32K 1N36K 4DR4K 2UXBK 4GKKK 1IBKK 2UUAK 2UUCK 5AJ3K 4K0KK 5A2QO 4YHHK 4DR2K 1FJGK 5LMUK 4DR3K 4JI8K 4DV4K 4JYAK 4LF7K 4V19S 1IBLK 3J7YP 4DR6K 2E5LK 4OX9K 1HNXK 1XMQK 1HNZK 4CVNE 2VQFK 4JI2K 3J81O 4DV7K 4DR1K 4JI0K 2UXDK 4B3MK 1N33K 3T1YK 4JI3K 4DV3K 4X65K 5IWAK 2UXCK 4GKJK 4X62K 1N34K 4DV5K 1XNRK 4B3TK 1I94K 4YY3K 1XNQK 5BR8K 4AQYK 5LMNK 4LF8K 4X66K 4DV1K 3J7AP 4LF6K 3JAMO 4JI1K 4DUYK 4JI4K 4DV2K 4DV0K 4B3SK 2UU9K 3T1HK 4LFCK 4JI5K 4DR7K 4JI7K 2UUBK 4JI6K 3J80O 4DR5K 5IT9O 1HR0K 4NXNK 4LFBK 1XMOK 5LL6Z 2VQEK 4LF4K 4LF5K 4LF9K 2ZM6K 5FLXO 4DV6K 4JV5K 4B3RK 4DUZK 4NXMK 4KHPK 4X64K 2F4VK 4CW7B 4LFAK 1J5EK 1HNWK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HHH K;  1IBM K;  3OTO K;  1N32 K;  1N36 K;  4DR4 K;  2UXB K;  4GKK K;  1IBK K;  2UUA K;  2UUC K;  5AJ3 K;  4K0K K;  5A2Q O;  4YHH K;  4DR2 K;  1FJG K;  5LMU K;  4DR3 K;  4JI8 K;  4DV4 K;  4JYA K;  4LF7 K;  4V19 S;  1IBL K;  3J7Y P;  4DR6 K;  2E5L K;  4OX9 K;  1HNX K;  1XMQ K;  1HNZ K;  4CVN E;  2VQF K;  4JI2 K;  3J81 O;  4DV7 K;  4DR1 K;  4JI0 K;  2UXD K;  4B3M K;  1N33 K;  3T1Y K;  4JI3 K;  4DV3 K;  4X65 K;  5IWA K;  2UXC K;  4GKJ K;  4X62 K;  1N34 K;  4DV5 K;  1XNR K;  4B3T K;  1I94 K;  4YY3 K;  1XNQ K;  5BR8 K;  4AQY K;  5LMN K;  4LF8 K;  4X66 K;  4DV1 K;  3J7A P;  4LF6 K;  3JAM O;  4JI1 K;  4DUY K;  4JI4 K;  4DV2 K;  4DV0 K;  4B3S K;  2UU9 K;  3T1H K;  4LFC K;  4JI5 K;  4DR7 K;  4JI7 K;  2UUB K;  4JI6 K;  3J80 O;  4DR5 K;  5IT9 O;  1HR0 K;  4NXN K;  4LFB K;  1XMO K;  5LL6 Z;  2VQE K;  4LF4 K;  4LF5 K;  4LF9 K;  2ZM6 K;  5FLX O;  4DV6 K;  4JV5 K;  4B3R K;  4DUZ K;  4NXM K;  4KHP K;  4X64 K;  2F4V K;  4CW7 B;  4LFA K;  1J5E K;  1HNW K; 
#chains in the Genus database with same CATH topology
 3L2U A;  3VGM A;  1N32 K;  3H08 A;  5AQS A;  5ELZ A;  3LDL A;  2E6L A;  4AF1 A;  4ELT A;  4DFK A;  1IG8 A;  2YHX A;  3OW2 M;  1NU0 A;  4CEB A;  1VRT A;  2X6S A;  3F73 A;  4BWJ A;  2QXF A;  5EX5 A;  4MLH A;  1NJY A;  2DFF A;  2EWS A;  3KK1 A;  3HL8 A;  3O5B A;  5GAG P;  4M3U A;  1V4S A;  4DR6 K;  2D0B A;  1RDW X;  2HHX A;  4JK7 A;  5K14 A;  4A61 A;  3GBT A;  2HMP A;  4E7H A;  4BY9 C;  2ASO A;  4IDK A;  3T1Y K;  4KH4 A;  1VQK N;  3W0L A;  4DTX A;  1D9F A;  4CEC A;  2GUI A;  3DXK A;  2WON A;  3TSQ A;  4CJ4 A;  5BRE A;  1ZYQ A;  2BUP A;  1MDU B;  4DSL A;  1ZBL A;  1XNQ K;  2PFU A;  4ZHR A;  4XH4 A;  3IMX A;  4FWR A;  3ZSV A;  3MXM A;  4CK1 A;  4PHT X;  3GOI A;  3LL3 A;  1BOT O;  2ZJR L;  1IKV A;  4B1U B;  1LOT B;  1SL0 A;  1ZBI A;  1WNS A;  2I5J A;  2NUB A;  3C6A A;  1X9M A;  1WAF A;  2P9L B;  3OYI A;  2HNZ A;  3A5M C;  4B3O A;  3LAK A;  3CPE A;  4E3S A;  1TK5 A;  4KRE A;  3FZF A;  3RMA A;  1GLB G;  2UUB K;  4DU4 A;  4OKJ A;  4Z4C A;  2A1S A;  4YOW A;  2A1R A;  1X1P A;  4MO5 A;  1FKP A;  4LFB K;  3RTV A;  1S1T A;  3ZEU B;  3E01 A;  1EWR A;  4I2P A;  1VSK A;  1J9A A;  2YJF A;  3KD5 E;  3MN6 A;  5AQM A;  3GG4 A;  1BWF O;  3VTH A;  1NOY A;  1RGI A;  3DRS A;  3QBX A;  3BF1 A;  2W41 A;  4IJA A;  3U9Z A;  3ZSY A;  2E4L A;  5AQX A;  1VQM N;  4DU1 A;  4CJT A;  1WSJ A;  3AVK A;  5C42 A;  3EO3 A;  1TKX A;  2H3G X;  2O4G A;  2YHA A;  4BR4 A;  3SAF A;  4K42 A;  1WBD A;  4KHW A;  4YNQ A;  4O5F A;  5BPN A;  5H1S Q;  4KV8 A;  5AR0 A;  3M8S A;  3AVC A;  4W5R A;  2NRR A;  1K9M O;  1YF5 L;  3O08 A;  3HP9 A;  4CK3 A;  3RMC A;  5AQH A;  3SV4 A;  1QSL A;  4EHU A;  4OPK A;  1HJR A;  1QVF M;  2P9L A;  1S72 N;  4KFB A;  1VSD A;  4QS9 A;  3M8R A;  3TAP A;  4FLU A;  1XHZ A;  1NKC A;  3QLH A;  3L8B A;  3QFU A;  2IVP A;  3MCP A;  4DHY A;  3O4N A;  4B3M K;  4ISG A;  4CEO A;  2YNG A;  3CJ9 A;  1VSL A;  1W0H A;  4X62 K;  1DEJ A;  5CR4 A;  5SZT A;  3KLG A;  3DLR A;  4H4O A;  3ZEU A;  3RMD A;  2HF4 A;  2OPS A;  2BH1 A;  1RBR A;  2A40 A;  4WE1 A;  3GDQ A;  3UE5 A;  3VEW A;  3VQ6 A;  1VQN N;  4PA1 A;  3F9M A;  3E9L A;  3HBT A;  2GUP A;  1WLJ A;  3TI0 A;  1RT1 A;  3O9U A;  3HP6 A;  4MQ3 A;  4OKE A;  4X66 K;  4HUG A;  4F9O A;  3QEX A;  3VA3 A;  1T05 A;  4Y1D A;  2IVO A;  5CYQ A;  1WN7 A;  2ATQ A;  1TKZ A;  4AM7 A;  2O8E B;  2Q36 A;  3SV3 A;  1L3S A;  1JLA A;  2FC0 A;  1KAX A;  1HLU A;  1WOQ A;  1HKB A;  4XEI A;  1XI1 A;  1T3V A;  4GY2 B;  1OH7 A;  5LJV A;  4NXN K;  4PQU A;  3I56 N;  4KTQ A;  4BG9 A;  1BIZ A;  2VQE K;  4FJM A;  4LF4 K;  1NK7 A;  1KFS A;  4WFN L;  4I7F A;  1NGD A;  5TKY A;  1NJZ A;  3AO1 A;  2VG7 A;  5GIP A;  4H5R A;  2RKI A;  1J5E K;  2IVN A;  5AZJ B;  3PX6 A;  5AFU H;  3QB0 A;  4IOA L;  1DLO A;  1QZ6 A;  3K9K A;  3PX0 A;  3C6H A;  4WFB L;  4H0O A;  4BR9 A;  4E7J A;  4M45 A;  4CZL A;  3I55 N;  3M1F A;  1WAJ A;  3DMJ A;  3VET A;  4DS5 A;  3OHR A;  3EZ5 A;  4O5B A;  5MLC Q;  4B9M A;  3LPU A;  2HBJ A;  4DSE A;  1ZBS A;  3LP3 A;  2I7N A;  3R6M A;  3V1Q A;  2D0A A;  2O8E A;  1NK9 A;  2DFE A;  4UY8 O;  2HST A;  4DTS A;  4JI3 K;  3DRP A;  3TSP A;  3L2Q A;  4A62 A;  2E1Y A;  4BRH A;  4AHC A;  4H0V B;  3DRR A;  4J2A A;  4B9Q A;  1YJW N;  3G25 A;  1R0A A;  4AHS A;  3KKR A;  1SZ2 A;  4CZJ A;  4FK4 A;  4DV1 K;  5AZJ A;  4GVE A;  3AA2 A;  1WSE A;  4XH1 A;  3DLG A;  4B8C A;  1SAZ A;  4DU3 A;  5HP1 A;  2ITM A;  3WXM B;  4J2D A;  5DMR A;  2HVI A;  1RBV A;  2X74 A;  1EP4 A;  4FW2 A;  1VQ6 N;  5BPM A;  1RNH A;  4JEP A;  4O0I A;  3OYD A;  4HWI A;  3CCQ N;  1FW6 A;  4FJJ A;  4M42 A;  4FO0 A;  2WOM A;  4CF8 A;  1M1K O;  4KH5 A;  1HKC A;  1K6Y A;  4WQ4 A;  4CJU A;  3CPW M;  4FJH A;  3VER A;  3SZ2 A;  1NKE A;  1VK0 A;  1T6C A;  4IJN A;  3TAM A;  4CZM A;  3AAQ A;  2OYQ A;  4NB4 A;  5FLX O;  3HOT A;  1SKR A;  3NF6 A;  4DUZ K;  4M7Y A;  2G8U A;  2E2Q A;  4IOX A;  5GAE P;  1KRP A;  3WQU A;  4X64 K;  4KAZ A;  2F4V K;  1FXX A;  4JD2 B;  4U67 L;  1QQC A;  4B9L A;  5I9E B;  1HNW K;  1GOB A;  4CZI A;  4DR4 K;  2QW9 A;  4E0D A;  1ZXO A;  3CME N;  3H45 C;  1WSF A;  2QWN A;  3DXM B;  4YDU C;  4FLT A;  4B08 A;  1BCM A;  3O4Q A;  5C25 A;  1J5O A;  4FSV A;  3VQD A;  4BE1 A;  4CHP A;  2YNF A;  4CHQ A;  4FXD A;  3QML A;  2OCE A;  1U6Z A;  3IFR A;  4FPB A;  4O8U A;  2KTQ A;  3TAG A;  3ZT1 A;  4BRC A;  4DCH A;  4DKW A;  1K8K B;  1RDB A;  3J7Y P;  5HLF A;  2E5L K;  2OTJ N;  3ID8 A;  4Z4I A;  2VGM A;  2HND A;  1N33 K;  5AQG A;  4X65 K;  2W42 A;  3OYF A;  3PUF A;  3E1Y A;  3P1G A;  3ID6 A;  4YY3 K;  4CZE A;  3B8A X;  1HNV A;  5HBM A;  1HQE A;  3Q7B A;  4FJ9 A;  4TSX A;  4AQY K;  3OJS A;  2KLA A;  1NM1 A;  1E3M A;  4JD2 A;  5FRM A;  4JKE A;  4EHT A;  4CE9 A;  3U9D A;  2FLO A;  1NMN A;  3SPY A;  4UQG A;  3DXM A;  4CCH A;  3MEE A;  3AO5 A;  4JI5 K;  3HO1 A;  3S41 A;  1YJ9 N;  3WXI A;  3ASM A;  3FE1 A;  2O8C B;  3OYC A;  1X3N A;  5AQV A;  4L3Q A;  1A5X A;  2WTU A;  1LAV A;  1HR0 K;  1YUW A;  2PYL A;  1K8K A;  3VEZ A;  3EL2 A;  3DLL L;  4KO0 A;  4F2R A;  5AFU A;  1N6Q A;  4CJW A;  1NK0 A;  4B3R K;  4C1N K;  3NDK A;  1OVY A;  4DMN A;  3LDN A;  4CJK A;  5EU7 A;  5M1N A;  2PYJ A;  3OYJ A;  4YOV A;  1U47 A;  3MMV A;  3IAY A;  3O6W A;  3SK3 A;  4FWS A;  4MFB A;  4PL7 A;  1H1V A;  3RR7 A;  1KLM A;  4JK8 A;  1U4B A;  4FL9 A;  1TAU A;  4N5S A;  2OA8 A;  2WUS A;  2QTD A;  3HZ6 A;  2Q1N A;  3CHW A;  4CIF A;  3MEC A;  3AA5 X;  2O8C A;  1X3M A;  3LWM A;  3HTV A;  4IXC A;  1S3X A;  1SKW A;  4LSN A;  3D45 A;  1B9D A;  3NVK A;  4AHU A;  3AVM A;  3BGR A;  1I94 K;  5JS2 A;  3LZI A;  1LWF A;  3DWL A;  1JLF A;  3KK2 A;  2PY5 A;  1XUP O;  1S6Q A;  1HX1 A;  4M3Z A;  5LMN K;  3L2R A;  1VSM A;  3CG7 A;  1KVC A;  1KAY A;  1JLQ A;  2G8K A;  4FK0 A;  4BRG A;  1N5Y A;  2G8H A;  3DM2 A;  3S9H A;  3MN9 A;  2ZJP L;  1JXE A;  3AVG A;  3CCM N;  5FRN A;  1OVQ A;  1BG3 A;  1P90 A;  3PSI A;  3UKU B;  1HKG A;  1Z6R A;  5F1X A;  5GAH P;  5HOO A;  4E1N A;  4M3R A;  4KI6 A;  1IV0 A;  1FK9 A;  2VWB A;  4GMJ B;  1BHL A;  4ISE A;  3RSE B;  3SBT A;  1X9W A;  4RW8 A;  3AVI A;  5BR9 A;  3DLE A;  4E89 A;  1KCF A;  1O1W A;  5M1F A;  1ZBU A;  3JYT A;  4CEZ A;  4DLG A;  4B9U A;  4RW9 A;  4B1Y B;  1IKY A;  4KHS A;  3KHY A;  2GEL A;  4CHN A;  3AO4 A;  3OJU A;  3THV A;  5BRD A;  4CI6 A;  2VWJ A;  3SNN A;  4DSK A;  2OAN A;  4FJ7 A;  4CFB A;  4DSF A;  3K9J A;  2YJE A;  4B1Z A;  3CCU N;  5C10 A;  1QZ5 A;  2XY7 A;  1YXQ A;  3CYM A;  1QHT A;  4B1V A;  2YNI A;  4AH9 A;  3QBW A;  3AVJ A;  4CGF A;  2YKN A;  4FYD A;  2XY6 A;  5AQI A;  3ITH A;  3SJJ A;  4F2S A;  4DQ8 A;  1WUA A;  3DAW A;  2BAN A;  4FWN A;  4CZH A;  3QEV A;  3NVM A;  3CQ8 A;  3NH0 A;  1BA0 A;  4CBX A;  5E26 A;  1NK8 A;  4GV9 A;  4BRN A;  3T3F A;  4CJL A;  1JLE A;  1ITG A;  4BGB A;  4DSJ A;  1T6D A;  3UKU A;  3U3Y A;  3LDP A;  2BTF A;  1XMQ K;  5CE3 A;  3UIQ A;  1C0T A;  2XY8 A;  4DTR A;  3RSE A;  3OBW A;  1XHX A;  3D7E O;  1U49 A;  1NGC A;  3HVT A;  5BRH A;  3G6E N;  2HBL A;  3VQP A;  3O9T A;  2F9W A;  3SI6 A;  4FJK A;  1CXQ A;  4H0P A;  2E2N A;  2ZF5 O;  3SMP A;  1NJI O;  3ZSR A;  4CZG A;  3ZX2 A;  1NMD A;  3MN7 A;  2KZM A;  3PIO L;  3TAF A;  1JCF A;  4QCL A;  4FWL A;  1Q82 O;  3IUC A;  3KK3 A;  2P9K B;  1SUQ A;  2B5J A;  4RW7 A;  1U48 A;  1G15 A;  1QE1 A;  3EY1 A;  3CFR A;  1RBT A;  5ADX H;  1CZ9 A;  3O3H A;  4FW1 A;  2HVH A;  1D9D A;  4Z94 A;  4C1N I;  2D1K A;  3E9P A;  2JLE A;  4KH6 A;  3VQE A;  4AM6 A;  4E1M A;  3IDH A;  3L0Q A;  3HPO A;  1B92 A;  4A2A A;  4CER A;  4JKD A;  2FF6 A;  3A5N C;  4PKG A;  1U2V B;  2D0C A;  1NGE A;  1Q9X A;  2QEX N;  3BDP A;  4I9Q A;  3L4Q A;  3DLH A;  4Z4F A;  2ZM6 K;  1RT3 A;  4FVU A;  1U45 A;  5I42 A;  3GE1 A;  1GLL O;  3KLH A;  2HNY A;  1HPM A;  2UYT A;  1ESV A;  1VSH A;  2FSN A;  4BE0 A;  1UAX A;  2HHQ A;  1NKB A;  1P8Z A;  1RT2 A;  1VSI A;  3KVG A;  3ZYY X;  3R3L A;  5E41 A;  2NLX A;  4GKK K;  3WNH A;  1D4X A;  2VCP A;  2QA4 N;  4DG1 A;  1IO2 A;  1XC9 A;  4FJG A;  1RT5 A;  3I0S A;  2FBX A;  2P9K A;  4HTL A;  4OPA A;  3G71 N;  1NK5 A;  2NRW A;  4K41 A;  1NK6 A;  4WQ5 C;  1K73 O;  1BCO A;  2G8W A;  4E19 A;  4EIA A;  3VA0 A;  2A42 A;  1HYV A;  1BQN A;  1VQ7 N;  4KB0 A;  3DLB A;  3TTC A;  4JI0 K;  4MO4 A;  1U2V A;  3VQA A;  4BDY A;  2Y1I A;  4M63 C;  3PLA A;  2ITG A;  4FZZ A;  4RTF D;  4FWP A;  4NLB A;  3SMS A;  4F3O A;  3DLK A;  2ASP A;  5C15 A;  4FLV A;  2R7Y A;  3BY5 A;  4B9N A;  3T7Z A;  1TK0 A;  3VES A;  4BRK A;  2D0P A;  3HRG A;  4FZY A;  2VWK A;  3KWI A;  1KVA A;  4C8K A;  3ENO A;  4BRM A;  5JVG L;  3AAP A;  3E9O A;  3CJB A;  4IEE A;  2WBN A;  4DV2 K;  1T8E A;  1BDG A;  2HF3 A;  2OZS A;  3U8X A;  1S6P A;  2HW3 A;  4B3S K;  1UOC A;  1WBB A;  3NF8 A;  5E84 A;  1LWE A;  2E20 A;  1RBS A;  1DT9 A;  5M1P A;  3SBG A;  3NGI A;  4OPH A;  4DFM A;  3THW B;  1NJW A;  1VAZ A;  3EZW A;  1M90 O;  3H1Q A;  3TAR A;  3HSC A;  2E1Z A;  4CFC A;  4IO9 L;  2J4R A;  1W2B M;  4EP5 A;  4BRO A;  4JRQ A;  1UWB A;  3LM9 A;  3ZSX A;  5KPR A;  3SAH A;  3V9X A;  3CCL N;  1ATN A;  1ASW A;  4FJ5 A;  4QOZ B;  1KVB A;  2D4W A;  3J8A A;  3LP0 A;  2WC9 A;  4CZF A;  1S1V A;  4BDP A;  3VOV A;  4K8X A;  1NGA A;  4CJQ A;  5AQL A;  2X78 A;  2PAV A;  3CFO A;  4F3T A;  4IO8 A;  4I6M B;  2OPR A;  2QKK A;  3MWP A;  2UUC K;  4FLX A;  4M3T A;  1JLC A;  3D2F B;  4C23 A;  1YJN N;  4DR2 K;  5J1E A;  2A5X A;  4NLC A;  4DV4 K;  3G4S N;  1S5J A;  4CF2 A;  2PZS A;  5I3U A;  3QNN A;  4A57 A;  2ZD1 A;  2ZGZ A;  1JCG A;  1K8A O;  5AQT A;  2QWL A;  3R8E A;  2KFZ A;  3R9P A;  4OX9 K;  1SV5 A;  4CVN E;  1SS6 A;  5JS1 A;  4ELV A;  3THW A;  3C94 A;  1JL2 A;  5JLF A;  4OGE A;  1YTA A;  4GKJ K;  5JIC A;  4AHT A;  3HVR A;  3CQY A;  3VQ4 A;  1RDA A;  1S1U A;  4B3T K;  1CLQ A;  1YTU A;  4N47 A;  3P39 A;  4Z4H A;  4ISF A;  2HHS A;  2PBD A;  3RMB A;  2OZM A;  2P9N B;  4DTM A;  4Q0B A;  1LWC A;  3MX2 A;  4N41 A;  5AQY A;  2F8S A;  3DJC A;  3NHG A;  2YNH A;  3SPZ A;  2QI2 A;  4I6M A;  4BRF A;  4BR2 A;  5JVH L;  2RPI A;  3OYA A;  3D2F A;  5EVZ A;  3V81 A;  4BQZ A;  4KB1 A;  2HB5 A;  1RFQ A;  4NYN A;  3LM2 A;  2CGL A;  1D8Y A;  2GV9 A;  1B9F A;  4NYF A;  2JGU A;  4B1X B;  3OY9 A;  1IJJ A;  3AAR A;  4BC4 A;  3CJA A;  3CM5 A;  1OKJ A;  4CFA A;  2CH5 A;  2QKB A;  2DFH A;  1WSI A;  4JV5 K;  3TTD A;  3ZT3 A;  3H3O B;  2CH6 A;  2EHG A;  4OO1 J;  1EET A;  3L4I A;  3OYN A;  5C2D A;  3VN5 A;  1Q9Y A;  5J2P A;  5HRO A;  4IOC L;  3ZSO A;  2F96 A;  3SUP A;  1S1X A;  3LDS A;  3HM8 A;  3P4I A;  3PSF A;  4DQS A;  2OPP A;  3LAN A;  1KD1 O;  2UXB K;  3J7Z O;  3VGL A;  3B6P A;  4JKA A;  3U6F A;  5HRS A;  1JKH A;  3H3N O;  4OGC A;  2P9N A;  3QIN A;  1X9S A;  2KW4 A;  1LV5 A;  2NZT A;  4CD3 A;  4YDU A;  3IG1 A;  3O8M A;  1UA0 A;  2G8I A;  1Q86 O;  2IDO A;  3DYA A;  4W5N A;  2RN2 A;  4H03 B;  3QEI A;  1IBL K;  1SQK A;  1UA1 A;  3THY B;  1ILY A;  4H8K A;  1L3V A;  1OH8 A;  3NFA A;  2FBY A;  3EYZ A;  4DR1 K;  3MEG A;  4U7B A;  4HCC A;  4OLB A;  5IWA K;  2G8F A;  3MK6 A;  3O3G A;  3FLC O;  1HMV A;  2GWJ A;  4JKH A;  4OVL A;  4YOR A;  2RF2 A;  2GWK A;  2DY4 A;  1QQN A;  1BO5 O;  3HPH A;  4JS4 A;  3EN9 A;  4CGG A;  3VQ7 A;  5AQW A;  3NBP A;  4NCB A;  3I8B A;  4FK2 A;  3C95 A;  1RIL A;  3P5J A;  5CZ2 A;  4BR0 A;  3TSU A;  4JRP A;  4LF8 K;  4K8Z A;  1J53 A;  3JAM O;  2GTD A;  4FM0 A;  3FGU A;  3AV9 A;  1VSF A;  4CFD A;  1TGO A;  3AA3 A;  4I9L A;  3WXJ A;  3QIP A;  2V7Z A;  4BRP A;  2P9U B;  1EQY A;  3ZCM A;  3VPZ A;  1IH7 A;  4RWT A;  2VYP A;  3RWU A;  3QET A;  3TAQ A;  4QAG A;  4Z0U A;  3K0S A;  1Y97 A;  4ID1 A;  4O0J A;  3J80 O;  4E1J A;  3CCR N;  5EOY A;  1VQ4 N;  1XMO K;  1WB9 A;  3QIC A;  1IG9 A;  1I39 A;  3THY A;  4JKB A;  3SQ0 A;  5GAD P;  3SYZ A;  3OS1 A;  4IG0 A;  2FSK A;  5M1K A;  3R1X A;  5BN8 A;  2BE2 A;  1J54 A;  3AA4 A;  4CK2 A;  4JLH A;  4ZTJ A;  4CEQ A;  1C0G A;  4FWQ A;  1Z05 A;  5D3G A;  1VQL N;  1ATS A;  2Q97 A;  1NGI A;  1LW0 A;  1GLC G;  1NLV A;  2Q0R A;  4DF4 A;  5AQK A;  3GL1 A;  1VSE A;  3T1A A;  4HTU A;  1E4F T;  4FLW A;  5KRT A;  2NNW A;  4WYB A;  3MXI A;  3NH1 A;  2HHW A;  4JI8 K;  1BI4 B;  5AQU A;  4H4M A;  2RE2 A;  3JSM A;  2NRT A;  4IBN A;  2D5R A;  3ZSW A;  1D5A A;  2O8B B;  2HOE A;  3CQX A;  3K59 A;  3KTQ A;  2P9U A;  2W6K A;  4KHU A;  3ATV A;  2F8T A;  3F2K A;  1HNZ K;  2B6A A;  3HYF A;  1IKW A;  4DWI A;  2VG6 A;  4Z4E A;  3J81 O;  5FPE A;  1MWK A;  4CGI A;  2UXD K;  2IAJ A;  3AO3 A;  2I7P A;  4BDZ A;  1NGJ A;  1YIT N;  1Q8I A;  3FFI A;  4N56 A;  3TAB A;  1TYQ B;  4M3W A;  3I0R A;  3C65 A;  3OYM A;  4BR7 A;  3L2W A;  4BG8 A;  1TKD A;  3SAG A;  2WFB A;  2P51 A;  2IS3 A;  3CC7 N;  3AVN A;  1YVN A;  4JI4 K;  3EKS A;  1TUY A;  3WT0 A;  2OPQ A;  4ELU A;  4CJ7 A;  3NCI A;  4ID5 A;  4FJ8 A;  3RR8 A;  4MDA A;  1RDD A;  3FZH A;  4DFJ A;  3CER A;  4FCY A;  3M8Q A;  2F7T A;  4BQL A;  4AHV A;  3U3G A;  1BI4 A;  4JKG B;  3S3N A;  1O13 A;  4CEA A;  5JMV A;  2P9I A;  3HOS A;  2O8B A;  5IT9 O;  2Q0U A;  4HCB A;  1YAG A;  2AA4 A;  4FOE A;  5LY3 A;  3FR0 A;  1TKT A;  1XWL A;  4YOY A;  2HHV A;  3K5L A;  4DLE A;  2FBV A;  3ZSZ A;  1NGG A;  5EY4 A;  3ZT4 A;  4KHP K;  4CHY A;  3ZX0 A;  1NGF A;  4GVM A;  4KBO A;  2B4J A;  3H1V X;  1N36 K;  4H0T B;  3C7N B;  2F9T A;  4FJI A;  1TYQ A;  1GLD G;  1BUP A;  2E2O A;  4O8K A;  4CD1 A;  4CZK A;  4ILJ A;  3A2F A;  2Z1H A;  5M1Q A;  1JCE A;  4FLZ A;  5AQN A;  3WXK A;  5B8H A;  4BGA A;  4H0Y B;  4IFE A;  4IKF A;  4CHO A;  4YHH K;  4IDH A;  3PY8 A;  1FJG K;  4DR3 K;  3L6Q A;  3M5R A;  4FM2 A;  1YT3 A;  3G10 A;  2NRX A;  3HI0 A;  4AIL C;  3K57 A;  3OYG A;  3O4W A;  2O8F B;  1KLN A;  3V1R A;  4JYA K;  1S1W A;  5BPL A;  2NRH A;  4BC5 A;  1KC8 O;  3CCS N;  1MU2 A;  4H5T A;  5LJW A;  3UB5 A;  1QSS A;  1ZC6 A;  3AY9 A;  4FWM A;  4JKG A;  5HRR A;  4DV7 K;  3WXL A;  1Q18 A;  4HVJ A;  2V7Y A;  2E88 A;  3CC4 N;  3NH2 A;  4YOX A;  4LSL A;  1OH5 A;  3ISN C;  5AQJ A;  2FBT A;  3WQT A;  3K2P A;  4A5B A;  3QDK A;  4CF1 A;  3K5M A;  4LY7 A;  4CIG A;  3S3O A;  5C0Y A;  1HJO A;  4FPA A;  2A3Z A;  3CJC A;  1Q7Y O;  3CET A;  3WEE B;  4LF6 K;  1VHX A;  1QVG M;  1C0U A;  3VEX A;  5KTQ A;  5BN9 A;  4F8R A;  3CM6 A;  3O80 A;  3C7N A;  3MED A;  1NJX A;  2YKM A;  2P5G A;  3F5T A;  2RHK A;  4A5A A;  3A5O C;  4J8F A;  1U04 A;  4I2Q A;  4DQP A;  4A2B A;  5AZI B;  3V9W A;  1C6V A;  3UKR B;  3SQ2 A;  3KLI A;  4DR7 K;  3G0Z A;  1N8R O;  3NGZ A;  2O8F A;  4R5P A;  2FSJ A;  3JS6 A;  2OTL N;  3FZK A;  4JS5 A;  3HT3 A;  4BR5 A;  4L8R B;  3SUN A;  2BDP A;  3TTF A;  4FOI A;  1V4T A;  4NXM K;  2YCH A;  2ZE2 A;  2XRI A;  4C8L A;  4RW4 A;  3OA9 A;  3NGY A;  2HHH K;  3ULE B;  3OTO K;  2A41 A;  3V6D A;  1C1A A;  2ZQB A;  4BRQ A;  1RCH A;  4DTU A;  2XHB A;  2JWL A;  4DTJ A;  4FLY A;  3MAQ A;  3NMU A;  3KLF A;  5CZ1 A;  1CXU A;  4GNI A;  3WEE A;  3WUH A;  4OKK A;  2IIR A;  3AVF A;  3L3V A;  5FPD A;  1YHQ N;  3K5O A;  3LDO A;  4BRE A;  5BRF A;  4IFV A;  4FVM A;  3EE9 A;  3C6U A;  2FF3 B;  3NE6 A;  3A0I X;  4V19 S;  4G9Z A;  4LC9 B;  3ALY A;  4WQ5 A;  5AZI A;  5CYM A;  3UKR A;  4KRF A;  1NWK A;  3PO4 A;  4H5W A;  1EO1 A;  2IGI A;  3RVC A;  4JI2 K;  1JLG A;  3V4I A;  3S3M A;  4Q5V A;  1C0F A;  2KQ2 A;  3QFP A;  3QEW A;  1OH6 A;  2E6M A;  2DTU A;  1EKE A;  2YHY A;  4Y1C A;  1VQP N;  1NG9 A;  3PIP L;  3HXM A;  3CJ1 A;  3AGR A;  4BRD A;  3HK2 A;  5FRO A;  1F21 A;  5FPN A;  4B8A B;  2A6A A;  3HPG A;  3KWG A;  3ZSQ A;  5DM7 L;  4FWO A;  2P5O A;  1C1B A;  3DOK A;  3ULE A;  1T03 A;  2ASM A;  3V9Z A;  4CJV A;  2CGK A;  4BRA A;  3CIP A;  5JLH A;  1VQ5 N;  3QIO A;  4KHY A;  3A5L C;  3EKU A;  3D6R A;  1HNI A;  3SCX A;  3VQB A;  4EP4 A;  1LAW A;  4FJX A;  3VQQ A;  2D0O A;  2HBM A;  1GOC A;  1JJ2 M;  4DQR A;  4DR5 K;  4K25 A;  1RTI A;  5TKW A;  1XQS C;  4RG8 A;  4DSI A;  5LL6 Z;  4O44 A;  1T7P A;  1RTD A;  1RDU A;  3K58 A;  5KGX A;  1RDC A;  2CGJ A;  5AQR A;  4ZTF A;  2HMI A;  3NF9 A;  1T44 A;  3SJH A;  4W5Q A;  3TR8 A;  1DTT A;  4OPJ A;  4Z4G A;  1BQM A;  5M1O A;  1IBK K;  3RRH A;  2P9P B;  3OYE A;  2UUA K;  1TAQ A;  4MDB A;  3FFK B;  4DS4 A;  2QWQ A;  2QM1 A;  3TU5 A;  4YOU A;  1RT7 A;  2GBZ A;  4EZ9 A;  5LMU K;  4M3X A;  3ENB A;  2Q31 A;  4BVP A;  3DOL A;  4DTO A;  4LF7 K;  1L3T A;  2V52 B;  3V1O A;  3LP1 A;  1QQM A;  4C8O A;  1W9H A;  1HNX K;  5F2R A;  4GV6 A;  2VQF K;  3M6G A;  3FZM A;  3CD6 N;  1MWM A;  4B9T A;  2W6L A;  2AJQ A;  4DV3 K;  3NF7 A;  1BIS A;  3VQ5 A;  3T19 A;  3W3D A;  4CBW A;  4JKF A;  5DM6 L;  3LPT A;  1I3A A;  1L5U A;  1RT4 A;  3O9Q A;  1TL1 A;  2DPN A;  2GEM A;  1VSJ A;  1GLE G;  1TUU A;  1S9E A;  3J7A P;  3WNF A;  2YX6 A;  3OS0 A;  1S9G A;  4BC3 A;  3E66 A;  2P9P A;  1NGB A;  4NO7 A;  3KZB A;  3THX B;  2KHO A;  1JL1 A;  3ZLJ A;  3O3F A;  3CC2 N;  3AO2 A;  4XH5 A;  3OYB A;  3LZJ A;  1BL3 A;  4IWV A;  5CHI A;  2ZJQ L;  5ADX A;  3KD1 E;  3EEQ A;  3CMA N;  5KRS A;  3LWL A;  2NRV A;  4LF5 K;  1A5V A;  4PKH A;  5GIN A;  4ILH A;  2P1J A;  1JXB A;  4F4K A;  3P83 D;  4PL8 A;  1KQS M;  4CW7 B;  3MDQ A;  3VQ8 A;  1IBM K;  2ZGY A;  1R59 O;  4B1W B;  4J2E A;  4CJP A;  4LH4 A;  1BU6 O;  2O8D B;  3C6T A;  3CCJ N;  3QNO A;  1HPZ A;  4LH5 A;  3VEY A;  2V51 B;  4K0K K;  3O9R A;  3VQC A;  4BE2 A;  3CCV N;  1QS4 A;  3RRG A;  5KPT A;  2HHT A;  4WF9 L;  4H5V A;  2YI1 A;  2BGG A;  1IKX A;  4M7X A;  1WSG A;  2Z1G A;  1KAZ A;  3HJF A;  3WNE A;  3QER A;  4H5N A;  5CY4 A;  3THX A;  3L2V A;  3VEN A;  1BA1 A;  4FJN A;  1SL1 A;  2E2P A;  1GOA A;  4KKO A;  1DGK N;  3F9K A;  3V9U A;  4QS7 A;  1ZBF A;  2VG5 A;  2X6N A;  4IG3 A;  4DTN A;  1BGX T;  3IKM A;  3AVL A;  4B9V A;  1GLA G;  4O55 A;  5FDL A;  1XNR K;  2HBK A;  4C8M A;  4WCE L;  3N4P A;  4QS8 A;  1YI2 N;  2KKZ A;  3AVH A;  3IS9 A;  1ASU A;  4CEE A;  4KTW A;  2QWM A;  1X9J A;  3LAM A;  4CED A;  4E7I A;  4MLE A;  1G99 A;  4CEF A;  3K5N A;  3TAN A;  1TV6 A;  4PY5 A;  4PKI A;  2XY5 A;  3LP2 A;  4KHQ A;  4A59 A;  4DV0 K;  2O8D A;  3O1B A;  1GLF O;  3CXC M;  3T1H K;  4LFC K;  3BZC A;  4M41 A;  5HRN A;  4W5T A;  3Q7C A;  4XIU A;  1Q81 O;  1SL2 A;  3ZT0 A;  4GW6 A;  4WQ4 C;  1RBU A;  3HM9 A;  5SWM A;  3OYH A;  4CGH A;  3KJV A;  3BZK A;  1S22 A;  2Z1I A;  3MWT A;  3JXU A;  5J2M A;  4HUE A;  1W97 L;  4ICL A;  3P38 A;  5J2Q A;  3MX5 A;  3BP8 A;  3ULD A;  2IOC A;  1CZB A;  1KXP A;  3QEP A;  4NCA A;  5FPM A;  3SUQ A;  3ENH A;  4JKC A;  4EZ6 A;  2HHU A;  3MXJ A;  5KPZ A;  3MCA B;  2ZWH A;  3SQ4 A;  4M3Y A;  2QXL A;  3TPQ A;  1TL3 A;  4OJR A;  3VF6 A;  2O4I A;  1EXQ A;  2Q3S A;  3OS2 A;  1EX4 A;  3KK7 A;  2YV0 X;  3M8P A;  3VTI A;  1QSY A;  5GIO A;  4CJF A;  4N76 A;  4BVO A;  5T7B A;  3CCE N;  4KTZ A;  3WNG A;  5A2Q O;  1REV A;  1JLB A;  1MA9 B;  4IZ9 A;  4Y0W A;  4FJL A;  1A5W A;  5KQD A;  2QWO A;  4CHZ A;  3D2E B;  5DK5 A;  4H0X B;  4CIE A;  2EX3 A;  4BC2 A;  2G8V A;  1XC3 A;  1W7A A;  4ILG B;  4CGJ A;  4CJS A;  1ASV A;  5EXW A;  4W5O A;  4J2B A;  1TK8 A;  4HUF A;  3VMF B;  1QHA A;  3C0B A;  4JHD B;  4RW6 A;  3EE8 A;  4IEI A;  1VQO N;  2UXC K;  3SUO A;  1L3U A;  4LD0 A;  3DI6 A;  4B9S A;  1NK4 A;  3BUZ B;  3ZX3 A;  5HL7 L;  4CJE A;  2P9I B;  5BR8 K;  2AP1 A;  1TVR A;  3IRX A;  4NCG A;  5C24 A;  1HYS A;  1FKO A;  1GLJ O;  3KLE A;  1EWQ A;  1CZA N;  1RTH A;  4C8N A;  3SQ1 A;  4JI1 K;  4E7K A;  3BEX A;  2P9S B;  4K43 A;  4R79 A;  3A8Y A;  1DTQ A;  4DF8 A;  4PWD A;  4CF9 A;  2QWR A;  5HRP A;  3U4L A;  3D0P A;  2UU9 K;  4JN4 A;  1YIJ N;  4DB3 A;  2YHW A;  4WFA L;  4KI4 A;  4JI7 K;  2Y1J A;  5AQO A;  1DKG D;  4JI6 K;  1HYZ A;  3PX4 A;  5C2F A;  2LSN A;  2KZZ A;  3D2E A;  3TWH A;  3AGK A;  4CJ3 A;  2FXU A;  2W40 A;  3VF2 A;  3H6E A;  3VGK A;  2QWP A;  3ZET B;  5AQF A;  4AHR A;  3H46 O;  1NBW A;  1SKS A;  4LF9 K;  1NNE A;  4DV6 K;  4OLA A;  3O9S A;  1ATR A;  4JHD A;  4CBU A;  4KHN A;  1QQO A;  4JAX A;  5AQZ A;  4BAC A;  3AVB A;  4G1Q A;  3KKS A;  5AQQ A;  3QO9 A;  1C0M A;  3P31 A;  3LAL A;  4CJ5 A;  1KFD A;  4CGD A;  3N4Q A;  1WSH A;  3FZL A;  3KIO A;  3ATU A;  4GV3 A;  4BWM A;  5AJ3 K;  5KI6 A;  4FM1 A;  2P9S A;  1RT6 A;  3OVN A;  3B6O A;  3HST B;  1LCU A;  4KPY A;  3AVA A;  5KQ8 A;  3CFP A;  3LDQ A;  2ETJ A;  3CF5 L;  1VRU A;  4BRL A;  4DQQ A;  2Q2R A;  3O1W A;  2VGN A;  4O4G A;  4FZX C;  3OBY A;  1Y64 A;  3TAE A;  4HHT A;  1BIU A;  5F0X A;  3VQ9 A;  1N34 K;  2QK9 A;  2JWK A;  3ZET A;  1VQ9 N;  4DV5 K;  4BRI A;  1RTJ A;  4JNE A;  4E7L A;  3SLC A;  3I33 A;  3OYL A;  1C1C A;  1NOZ A;  3PO5 A;  2IC3 A;  3I8D A;  3NAE A;  2NRZ A;  3OYK A;  1Z25 A;  1E4G T;  4CJR A;  4DUY K;  3PV8 A;  5C12 A;  4RCH A;  3M3Z A;  1HRH A;  1Z26 A;  4DQI A;  3BF3 A;  1ZBH A;  4EFH A;  1KTQ A;  3QES A;  1KSP A;  5AQP A;  5KGW A;  4EAH D;  1J6Z A;  3VEV A;  4CF0 A;  4DTP A;  2Z1J A;  3ZT2 A;  4FWK A;  2YHB A;  2E8A A;  2GX9 A;  1NGH A;  1QTM A;  4PUO A;  1VQ8 N;  1YVU A;  3VEO A;  3DXK B;  3V9S A;  3CJ7 A;  3CI5 A;  1HQU A;  3MN5 A;  5J2N A;  1LW2 A;  4DFP A;  1HUX A;  2XO7 A;  3T69 A;  3L3U A;  4IFY A;  4JK9 A;  4YOT A;  3VF4 A;  4YFU A;  4LFA K;  2KFN A;  4CES A; 
#chains in the Genus database with same CATH homology
 2HHH K;  1IBM K;  3OTO K;  1N32 K;  1N36 K;  4DR4 K;  2UXB K;  4GKK K;  1IBK K;  2UUA K;  2UUC K;  5AJ3 K;  4K0K K;  5A2Q O;  4YHH K;  4DR2 K;  1FJG K;  5LMU K;  4DR3 K;  4JI8 K;  4DV4 K;  4JYA K;  4LF7 K;  4V19 S;  1IBL K;  3J7Y P;  4DR6 K;  2E5L K;  4OX9 K;  1HNX K;  1XMQ K;  1HNZ K;  4CVN E;  2VQF K;  4JI2 K;  3J81 O;  4DV7 K;  4DR1 K;  4JI0 K;  2UXD K;  4B3M K;  1N33 K;  3T1Y K;  4JI3 K;  4DV3 K;  4X65 K;  5IWA K;  2UXC K;  4GKJ K;  4X62 K;  1N34 K;  4DV5 K;  1XNR K;  4B3T K;  1I94 K;  4YY3 K;  1XNQ K;  5BR8 K;  4AQY K;  5LMN K;  4LF8 K;  4X66 K;  4DV1 K;  3J7A P;  4LF6 K;  3JAM O;  4JI1 K;  4DUY K;  4JI4 K;  4DV2 K;  4DV0 K;  4B3S K;  2UU9 K;  3T1H K;  4LFC K;  4JI5 K;  4DR7 K;  4JI7 K;  2UUB K;  4JI6 K;  3J80 O;  4DR5 K;  5IT9 O;  1HR0 K;  4NXN K;  4LFB K;  1XMO K;  5LL6 Z;  2VQE K;  4LF4 K;  4LF5 K;  4LF9 K;  2ZM6 K;  5FLX O;  4DV6 K;  4JV5 K;  4B3R K;  4DUZ K;  4NXM K;  4KHP K;  4X64 K;  2F4V K;  4CW7 B;  4LFA K;  1J5E K;  1HNW K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...