1I94K

Crystal structures of the small ribosomal subunit with tetracycline, edeine and if3
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
123
structure length
123
Chain Sequence
KKKVKRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RRNA
publication title Crystal structures of complexes of the small ribosomal subunit with tetracycline, edeine and IF3.
pubmed doi rcsb
total genus 18
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2001-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 1i94K00
1N34K 4GKKK 4DV2K 5AJ3K 4JI2K 4X64K 4DV3K 3J7YP 4DV6K 4X66K 4NXNK 5LMUK 4B3SK 4DR4K 4LF6K 4DV7K 3JAMO 1I94K 3OTOK 2UUCK 1N32K 4JYAK 4DR6K 4JI6K 4B3TK 2HHHK 4YHHK 4GKJK 1J5EK 1HNZK 1HR0K 4AQYK 5FLXO 1N36K 4JI3K 4LFCK 4DV0K 4JI8K 4DV5K 2VQFK 4DR7K 5LL6Z 5BR8K 5LMNK 1IBLK 4CW7B 5IT9O 1HNWK 2UXBK 2VQEK 1FJGK 4DV1K 4JI5K 4KHPK 4LF9K 4LF5K 4YY3K 3J80O 1XMOK 4DR1K 4LF8K 4DR3K 4V19S 4K0KK 4DR5K 5IWAK 5A2QO 4DUYK 4LF4K 2F4VK 4CVNE 1XNQK 4X65K 2UUAK 4LF7K 2UU9K 3T1YK 4B3RK 3T1HK 3J81O 4X62K 1IBKK 4JI0K 4JI4K 3J7AP 2UXDK 4JV5K 1XMQK 4NXMK 1HNXK 4DR2K 1N33K 4DV4K 2ZM6K 2UXCK 2E5LK 4LFAK 4JI7K 2UUBK 4B3MK 4DUZK 4OX9K 4JI1K 4LFBK 1IBMK 1XNRK
chains in the Genus database with same CATH superfamily
2A1SA 2OTJN 5M1NA 3JS6A 4AHTA 4I6MA 4BE1A 4OPKA 3VERA 3O9TA 4LY7A 2YNHA 3MN7A 1UWBA 1YXQA 4FZXC 2OCEA 5CYMA 1WSEA 3V9ZA 4IOXA 1YTAA 4I9QA 2VYPA 3DXMB 3UB5A 3J8AA 4CGFA 3QIOA 3WXIA 3KK7A 5CHIA 1YJNN 4NO7A 3CCJN 3C6UA 4IJAA 4J8FA 4JI8K 5M1KA 1TAUA 4CJEA 5LL6Z 1XQSC 5HLFA 1RDAA 4QOZB 4W5TA 3SBTA 3WT0A 4CFCA 5GAHP 3KWIA 4YOWA 2XY7A 2QWNA 1NWKA 5HOOA 5AFUA 3HVRA 5AQJA 4H0XB 4DTPA 3RSEA 3PSIA 1ITGA 3AVIA 4O5FA 2YJEA 4CHYA 4HTLA 1VRUA 4LF8K 4DTUA 4NLCA 3JXUA 5IWAK 4DUYK 3E9PA 4KRFA 1VQON 2X74A 1WBBA 2QEXN 2UUAK 5AQQA 4H8KA 4E0DA 1RBVA 4JN4A 1T44A 1K6YA 2YKNA 3A5MC 5AZIB 5BPLA 1IBKK 1TUYA 4CZIA 1HX1A 5BRDA 1RT7A 1KQSM 2FSNA 2WONA 2Q3SA 3LZJA 1HNXK 5FRMA 5HBMA 1CZAN 3SUNA 4CK1A 3SUQA 1NKEA 3DLHA 1IKVA 1QHAA 4DV4K 3AY9A 2XRIA 4GW6A 3BF1A 4BRIA 3HPGA 4E1JA 3KLHA 5JS2A 4L8RB 2JWLA 2GV9A 1DKGD 3HT3A 1UAXA 1HJRA 3CIPA 4PL7A 3LL3A 3OW2M 4MO5A 5C15A 1Q81O 3WNHA 5AQOA 4O44A 4H5TA 5AFUH 3V6DA 4NXNK 2O8EB 3VQ8A 3O9SA 4FWKA 4AM7A 4IDHA 4EAHD 2Z1IA 4BQZA 4EHUA 4YOYA 3UIQA 3VESA 4B3SK 1BCOA 3MN6A 1YUWA 4F3OA 3U6FA 3AAPA 4LF6K 4DQ8A 3PO4A 2VGMA 4CF9A 2G8FA 3CPWM 4QS8A 4CEFA 4DR6K 1LWCA 4CHPA 1LAVA 2Q0UA 1YI2N 4B1ZA 1MA9B 3VEYA 4J2BA 3I0SA 3HRGA 2O8DB 4M3UA 3CFPA 3CCLN 4OO1J 2W6KA 4CJPA 1XI1A 1YITN 3OS0A 4KREA 4M45A 1TKDA 2P1JA 5EXWA 4AHUA 4KHWA 2WTUA 3DXMA 1RDCA 2DY4A 4IOAL 2PYJA 4IZ9A 3AA4A 3L8BA 4Z4EA 3QEIA 1YJWN 3SBGA 2HSTA 4AHCA 5HRSA 3QFUA 4JKDA 2P9PB 1NGJA 3CYMA 4AILC 3L6QA 1JLBA 2QXLA 4LF4K 4DFJA 4CVNE 4CF8A 3SMPA 1U48A 3CI5A 5CYQA 5BPNA 3P31A 4A62A 4B9TA 3O3GA 4Y1DA 3CFOA 3IFRA 3VEVA 4B1UB 1UA1A 1L5UA 3MN5A 1J53A 3V1QA 3BP8A 1ZC6A 3LPUA 2V51B 3U3GA 4BROA 1VK0A 1N33K 4CHOA 1BWFO 4NYFA 5CY4A 3SQ1A 4XH5A 5J1EA 1WN7A 3ENOA 1SL1A 5AZIA 2Y1IA 1BI4B 1K8AO 4J2DA 1IG8A 1RDWX 1CZBA 3ZETB 4IDKA 1JCEA 2BUPA 4CZMA 3F5TA 3BGRA 3SPZA 3ZX0A 2IIRA 4NLBA 5B8HA 2HHSA 4KHQA 1NK8A 5FPDA 1RBRA 4BC5A 4HCBA 3E9LA 3MAQA 4CEQA 2UUCK 5JVHL 1N32K 3PX6A 3G4SN 4JHDB 1SZ2A 2HHHK 3A5LC 1T7PA 2O8EA 4RW6A 3ZSOA 4BRLA 5E41A 1JCGA 4KHYA 4CGDA 1VRTA 3FZFA 4CK3A 4PKHA 1NJYA 2W40A 3M5RA 4CCHA 2E20A 3P38A 1ATNA 2PY5A 3CC2N 5KRSA 1NGBA 2XY6A 2PZSA 4A5BA 2QKBA 3QESA 4M63C 2O8DA 4N47A 3EZWA 4ELTA 1C0MA 4Z94A 1ASVA 3P83D 4DFMA 1FJGK 1EQYA 3KD5E 5C10A 4H0PA 1QQCA 1HYSA 4H4MA 2PBDA 2WBNA 1X9JA 4JKFA 4FM1A 4O55A 2VGNA 2FSKA 3T69A 3H3NO 1TYQB 5EU7A 4DU3A 4CGJA 4CK2A 1NK4A 5DMRA 3VEZA 1TAQA 1GLLO 4DTNA 2IAJA 5GADP 3E1YA 4JI0K 1EWRA 2FXUA 3LALA 3VPZA 2P9PA 3HPOA 4K8ZA 3DM2A 4DQRA 2AJQA 3S3MA 4EFHA 1XMQK 3W3DA 3RMBA 1OH5A 1VQ6N 4BG9A 5AZJB 4KB0A 1X9MA 3VN5A 1ESVA 4LFAK 4Y1CA 3KKSA 3EL2A 4OX9K 5JMVA 3N4QA 3CQ8A 3LPTA 3ENBA 3P4IA 3OJUA 4FXDA 4DV2K 3SV4A 4FJXA 3VQAA 4CJKA 1NJWA 4X64K 4JK7A 4DSLA 4DV6K 1BI4A 4Z4IA 3TSUA 1L3SA 3PO5A 3I0RA 3ZETA 3IMXA 3O4NA 4KH5A 1T8EA 5JS1A 3WXMB 4C8OA 3QMLA 2BH1A 3V9SA 4F4KA 1J5EK 3QINA 2KHOA 3S41A 5FROA 4AQYK 2GWKA 1BCMA 3IUCA 5AQNA 3C6HA 2NRHA 4BC2A 4CZLA 2WFBA 2HF3A 1LAWA 4ILJA 3T19A 4M3XA 3QEXA 3THXB 4JHDA 3F2KA 1XHZA 5BR8K 5ADXH 2DFEA 1SV5A 5CE3A 1YHQN 2VG6A 3A0IX 1CXUA 2GTDA 4BY9C 4H0OA 1MU2A 3MK6A 3KLIA 1RBTA 1VSIA 4CZFA 3K9KA 3OYCA 3UKUB 4AM6A 1N6QA 1IKXA 3U9DA 4H5RA 2P9SB 4X65K 4WFAL 4A5AA 2R7YA 3K5OA 4BREA 4BWJA 3SAHA 4EZ9A 4CESA 3AVFA 4CJ4A 4RW9A 1NGDA 1L3UA 4LSLA 4CJVA 2ZJPL 1NMDA 3AGRA 3VF6A 3U3YA 1TYQA 4CJ5A 1XUPO 3BY5A 4DR2K 3FLCO 4DCHA 2NRTA 3AVCA 1HKGA 4KFBA 3O5BA 1VQKN 3I8DA 1SQKA 1KSPA 1NOZA 2HNYA 4DUZK 1S9GA 3ID6A 1EKEA 4M42A 1C0UA 2B5JA 1RT4A 3G10A 3RWUA 1WSHA 1BISA 3O9RA 5AZJA 3CCQN 4ELUA 3GE1A 1VAZA 3RRGA 4WCEL 3AVLA 1OKJA 1BQMA 1BL3A 1RBSA 5M1PA 3ZSVA 1KCFA 3M8SA 5LMUK 4LH4A 3SLCA 3FZHA 1EWQA 3J7ZO 3LP3A 5T7BA 4FWNA 2B4JA 4PA1A 3KK1A 1NGIA 4H5NA 4CJWA 1XC9A 1VSJA 1ZBFA 1IH7A 3LDQA 4AHSA 3OYIA 1GLFO 4GKJK 1HR0K 3QLHA 4K43A 1KAYA 3ISNC 1JLAA 2QI2A 1BIZA 4I7FA 1GLAG 4F9OA 2HMIA 3VMFB 3E66A 2ZGYA 4DU4A 1VSHA 5AQGA 3PY8A 4RWTA 2FSJA 4G9ZA 4BR9A 4CW7B 5IT9O 4FW1A 4KO0A 5C2FA 3FE1A 1QVFM 4BRNA 2UXBK 4E1MA 3WEEB 3AA2A 3CJCA 1BHLA 3THXA 1DTQA 2VCPA 1JLQA 5KPZA 4CECA 3QFPA 4LH5A 4W5OA 1C1CA 3AVAA 5H1SQ 3EKUA 3LWMA 3PX0A 4H5VA 4KHUA 4W5RA 3LP2A 5KPRA 1DT9A 3V9UA 4DS4A 4ILHA 5LJVA 4CIGA 3C65A 1HPMA 4BRFA 4EIAA 3J81O 3UKUA 5F1XA 4GY2B 5CZ2A 1H1VA 2E2OA 1U49A 3TTCA 2P9SA 5C0YA 3SQ2A 2RF2A 1JXEA 3O3HA 3RMAA 1S3XA 3WUHA 3NMUA 4Q5VA 4B3MK 2HHTA 2HBJA 3O08A 1KVAA 1QQNA 2F9TA 1D8YA 5M1QA 4NYNA 3BZKA 4GKKK 1KVBA 2B6AA 3V9XA 2LSNA 1NGGA 4CEAA 2RKIA 4O0JA 4IEEA 4FK0A 4M3YA 3SV3A 1HUXA 4FCYA 2WC9A 5JVGL 4CGGA 3HI0A 1JKHA 2ZQBA 3V9WA 4FO0A 2F8SA 1KVCA 1X3NA 4A2AA 3HTVA 4FK4A 1HPZA 1WSFA 4OLBA 1VQ9N 2HVIA 4CEBA 3RR7A 3D0PA 5BRFA 4FPAA 1VSEA 4JEPA 3NCIA 4B9QA 4BR4A 2A41A 3BZCA 3L3UA 3ZSRA 3RRHA 4LFCK 5JLFA 2H3GX 4M3ZA 4IXCA 2ZE2A 3IRXA 4PKGA 3M8PA 3FZMA 5AQMA 5LMNK 2FLOA 2YHXA 5AR0A 1L3TA 2P5OA 3FFKB 5AQVA 4GV3A 4JI5K 2Z1HA 1NK7A 4CJFA 4WFBL 1T6DA 3SAFA 1RT1A 4YY3K 3VQ6A 4BVOA 3QBWA 1ZBHA 4ID5A 5GAEP 4V19S 1QQOA 3QO9A 4L3QA 4CIFA 3R1XA 4GVMA 4U67L 5A2QO 2HNDA 4ISGA 4B9NA 4WQ4A 2I7NA 3TANA 1UA0A 2RPIA 3WEEA 4XEIA 3M1FA 4OPJA 4RW4A 4MDBA 1OVYA 5LY3A 3TARA 1QQMA 4CFAA 4BR5A 1J5OA 4C8MA 3WNFA 3FGUA 4H0YB 1HKBA 3CJ7A 1J9AA 5LJWA 3CC4N 1LWFA 1X3MA 1TKXA 5HP1A 2ZM6K 2P9IB 1KTQA 1JLFA 1VSDA 3NVMA 2A42A 4DF4A 3SQ4A 3OYNA 4E3SA 5AQKA 2HMPA 3QICA 4I2PA 3UKRB 3DWLA 3GL1A 4KHSA 3O1BA 3PSFA 4BRQA 5J2QA 4FWRA 2X78A 4JKAA 3VENA 2OA8A 3AVGA 2E6MA 3CHWA 2IGIA 1LV5A 4FK2A 3VGMA 3K0SA 4FJKA 5E26A 1BU6O 1WBDA 3DXKB 3UE5A 4J2EA 5BRHA 4K25A 4DSJA 3VQ7A 4CF0A 2KFNA 3PUFA 1TKTA 1S22A 1JLCA 4DSKA 4Z0UA 2BTFA 3MEEA 4FOIA 3KJVA 2OYQA 1OH7A 1NG9A 4CGHA 4DV0K 2KLAA 5K14A 4DV5K 2VQFK 4KAZA 3DMJA 3MXMA 3F9KA 4KB1A 3VQ4A 3ZSYA 2E4LA 2FBTA 5AQPA 4BDYA 2YI1A 1KRPA 1TV6A 4R79A 4E7HA 1S5JA 2W42A 1TK8A 4KHPK 2A3ZA 4JS5A 4YOXA 4M3WA 4A57A 5HRRA 4H03B 2D0OA 4I9LA 4CI6A 4DR3K 3HP9A 3VOVA 4BVPA 2DFHA 3SZ2A 5AQHA 1HQUA 2G8KA 1LWEA 2ITMA 3AAQA 4U7BA 1NK9A 1P8ZA 1GLEG 4IG0A 4H0TB 1GOBA 3ULEB 3E9OA 3THYB 4MDAA 1XNQK 3GG4A 3H45C 4IO8A 5KTQA 1BGXT 1IKYA 3TR8A 2ATQA 1C0TA 3EN9A 4FJIA 1XHXA 1Z05A 5KQDA 3SYZA 4PWDA 4FM2A 3KKRA 4DHYA 2IVNA 2I7PA 1MDUB 4PKIA 3CJAA 3VETA 5I3UA 4BRPA 1B9FA 4FL9A 3SMSA 2QWLA 2E5LK 4Z4GA 4C1NI 1IO2A 4EHTA 4RW8A 3CMEN 1IBMK 4DQSA 3OYFA 5BR9A 3SJHA 1XNRK 3TU5A 4O4GA 2ASMA 1E4GT 4FLWA 4WF9L 2P9IA 3I55N 4FM0A 1M1KO 4IFEA 3VTHA 1EO1A 3VF4A 3I33A 4A61A 4DR4K 2QA4N 1RTHA 1W9HA 4WQ5C 2HNZA 3MEGA 3UKRA 3KLGA 4JKCA 1TGOA 4MQ3A 2KQ2A 1BG3A 2Q0RA 2AP1A 1VQNN 1RT3A 2E1ZA 3LM2A 4A2BA 3OYLA 4FJNA 3GOIA 4UY8O 1JL2A 2V52B 4OPHA 3AA3A 3BEXA 4DTXA 1RBUA 3CETA 3O4WA 3TWHA 1HJOA 3DXKA 1VSFA 3NGYA 1SUQA 5HROA 3ZT3A 4GMJB 4CZHA 2IVPA 1SS6A 3QNOA 1RDUA 2OANA 2ZGZA 3TTFA 2DFFA 2JGUA 4K8XA 3HSCA 3OS1A 4YNQA 3ZSZA 4JKEA 2IDOA 1D9FA 1CZ9A 4K0KK 3IS9A 3VQQA 1FK9A 3CERA 2A5XA 1RTDA 3VQ5A 5JLHA 1JXBA 4FJ5A 2OZSA 2NRVA 4RW7A 3AVMA 4XH4A 4JI4K 4DLGA 2F8TA 2HHXA 2UXDK 4BQLA 4QCLA 1REVA 2D0AA 3FFIA 3FZKA 3MECA 3ULEA 3THYA 3HXMA 1GOAA 3HL8A 3FR0A 4FJJA 4UQGA 2G8VA 3TAGA 4Z4FA 3QEVA 5FPNA 3RR8A 3VQCA 1HNVA 3WXLA 1HRHA 4OGEA 1Q82O 3C0BA 3IG1A 4HUEA 2G8UA 1QZ5A 4B1YB 3ITHA 3MN9A 4N76A 4YDUA 3OYEA 1YT3A 3LANA 1MWKA 4AHRA 2P51A 3TSQA 3PX4A 3ASMA 4MLHA 4DSIA 3T7ZA 4JRQA 2HB5A 3A5NC 2OPRA 3CCEN 5BREA 4IJNA 3C6AA 4FJ7A 3KHYA 4ID1A 4KI6A 4JI6K 2YNIA 4N41A 1E3MA 1VHXA 3NVKA 2YHAA 3CFRA 3VTIA 1YJ9N 1TKZA 2YX6A 4AHVA 4B1VA 3CMAN 3WXJA 1N36K 4A59A 3OBWA 4CHNA 3F73A 1OH8A 5GINA 2FBXA 3LWLA 2DTUA 3G25A 3SQ0A 4DFPA 1ZBIA 2QWMA 4FLYA 1NNEA 4YORA 3Q7CA 3HBTA 5ELZA 4DTOA 3HK2A 3EE9A 2HF4A 1QS4A 3SI6A 1KAXA 4R5PA 3NE6A 3ZT2A 1U04A 3P1GA 2NUBA 3J80O 1EP4A 2D0BA 3L0QA 4CEDA 5DM6L 3ULDA 1C0FA 4WYBA 2QWQA 3H6EA 4FWSA 4HUGA 2EX3A 4CD3A 3K58A 3LDNA 3O3FA 1VQ4N 3IAYA 5DM7L 1W97L 3H08A 1ZYQA 3PLAA 1S1VA 1W7AA 4KV8A 2GBZA 3AV9A 3G0ZA 3ZX3A 3LDSA 4NXMK 4JKBA 4IKFA 4O0IA 1A5XA 1W0HA 4H4OA 3V1RA 1ILYA 4DU1A 4BDZA 3L4IA 1X1PA 3VA3A 2OPQA 1VSKA 2FF6A 3HJFA 4E89A 2G8HA 3NF8A 3KZBA 1U45A 3M6GA 1ZXOA 1WLJA 3MWTA 2QWOA 3ALYA 5AQWA 3WNGA 3S9HA 1Z26A 1J6ZA 3DOKA 4DV7K 1C6VA 5EY4A 4NB4A 4FJGA 4KH4A 4JYAK 4B3TK 3MX5A 4B8CA 5SZTA 4HWIA 2Q2RA 1FKOA 1QSYA 5J2MA 3ZSXA 3TAFA 2D5RA 1RDBA 3RMDA 5HRNA 1NLVA 4NCAA 3TPQA 1KC8O 4YOUA 3THVA 4CJRA 4OKKA 3GDQA 3VGLA 2HOEA 4CHQA 3JSMA 5AQRA 4F2SA 1YF5L 1T6CA 1IBLK 1JLGA 1F21A 4M41A 3SUOA 5C2DA 3MXIA 3TAPA 1K9MO 1GOCA 1BDGA 1BUPA 1Y97A 3IKMA 1VQLN 1HYZA 3ZT1A 3VA0A 3TAQA 2GELA 1FW6A 4DR1K 3OVNA 3LZIA 4OVLA 4NCBA 3RTVA 2KKZA 4ELVA 1S1TA 5KGXA 2UU9K 1KLMA 2KTQA 3T1HK 4FJ8A 4RG8A 2RN2A 1NGCA 4E19A 4OKJA 3W0LA 3J7AP 4F3TA 1GLDG 3SNNA 2IS3A 4CZEA 3NF6A 3DRSA 4DWIA 3ZT0A 4DSFA 3AVKA 2CGJA 3P39A 3OY9A 3DI6A 3BDPA 1RILA 3U4LA 1TK5A 1NJIO 4JRPA 5AJ3K 4LSNA 1VQ8N 3GBTA 3ZSQA 3EO3A 3BF3A 3I8BA 3MXJA 4X66K 1M90O 2W6LA 4HHTA 2XY5A 2FC0A 4FSVA 3L3VA 2Q1NA 2RE2A 3HM8A 2ZJQL 3JAMO 3SPYA 1B9DA 4CBWA 4QAGA 2QTDA 3C6TA 3VQ9A 2E2NA 5C25A 1JL1A 2Z1GA 2D4WA 3DRPA 4DFKA 2ETJA 3MX2A 1HNZK 1K8KB 1NK6A 3M8RA 3KD1E 3OYAA 3CCVN 3VGKA 5J2PA 5FLXO 1QVGM 2XHBA 3KVGA 3WNEA 2P9LB 3T1AA 1ZBLA 3NF7A 3LM9A 3PIOL 4FJHA 4DSEA 1BO5O 5KPTA 3L2UA 2CGLA 1HNWK 3LP1A 4DV1K 1GLBG 5GAGP 4BGAA 3SUPA 5CZ1A 1J54A 4JKGB 1S6PA 3ID8A 3L2WA 1XMOK 1OH6A 4ISFA 1DGKN 2W41A 3QDKA 4O5BA 2Y1JA 2O4IA 3K59A 2NLXA 1BA0A 4PL8A 2Q36A 2QW9A 5SWMA 4BR0A 5KRTA 3VEXA 1HQEA 1ATRA 3AO2A 1YVNA 4M7XA 4C8NA 1T03A 1EETA 4DB3A 4IG3A 3ENHA 3HSTB 4DMNA 1LCUA 4Z4CA 4N56A 3U8XA 3DAWA 3KTQA 2IC3A 2BANA 4ISEA 2BGGA 4Q0BA 3MDQA 1WUAA 4FVUA 2E88A 4G1QA 2GWJA 1NU0A 2UYTA 4JI7K 4BC4A 4DTRA 2BE2A 3DLKA 3PV8A 1JJ2M 4KTZA 2NRZA 3EE8A 2OTLN 5AQFA 5FRNA 3AO4A 2HBKA 1QZ6A 5CR4A 3OYJA 1WNSA 3CC7N 3Q7BA 3TAEA 5E84A 1X9WA 3HYFA 2F7TA 4KBOA 1N8RO 3O9UA 1NGHA 2WOMA 5M1FA 1KD1O 3OTOK 4CJTA 4M7YA 4FWQA 3OYDA 2QXFA 3QNNA 4CF2A 2EHGA 1YIJN 4CHZA 1O1WA 4CD1A 4B8AB 3B8AX 3F9MA 4LD0A 5MLCQ 2PFUA 3H3OB 4Y0WA 3HM9A 2QM1A 3S3NA 4CF1A 2VG7A 4ZTJA 1OVQA 4CFDA 1Q9XA 1HNIA 4BE2A 2NZTA 2A6AA 4BRAA 1QE1A 3SK3A 1K8KA 2E6LA 4NCGA 1RT5A 4CJ3A 4I2QA 1QTMA 1A5VA 2VWJA 1NGFA 4FWPA 5HL7L 2BDPA 2QK9A 2P9LA 3EZ5A 3TAMA 1XWLA 5J2NA 2HHQA 4CJQA 2HHWA 4W5NA 3V1OA 2P9KB 1HKCA 3V4IA 1SAZA 5KGWA 4DLEA 2YHBA 4BRMA 4PHTX 2HHVA 3A2FA 4N5SA 4E7IA 4IO9L 4BDPA 1IKWA 2O4GA 4AH9A 4FWLA 3QIPA 4JKGA 3K57A 1BQNA 3NGZA 1WAJA 4IBNA 3AVJA 4CERA 2Q31A 4B9VA 4IOCL 3TI0A 4DQIA 4XH1A 5AQZA 2P9UB 3AO1A 1KXPA 4K42A 1KLNA 1KFDA 4MO4A 1DLOA 2DPNA 1WOQA 4PQUA 2WUSA 4JS4A 4LFBK 1LOTB 2NRWA 3HPHA 2O8BB 3ZT4A 1N34K 2CH6A 3KLFA 4H0VB 1GLCG 4JI2K 2KZMA 5I42A 4E1NA 3J7YP 3R3LA 1D5AA 2NNWA 3HVTA 1NBWA 4HVJA 2E1YA 4BACA 1CXQA 4E7KA 1V4TA 1LW0A 4HTUA 3OYMA 3OYBA 3QB0A 3HOSA 2O8FB 4BRHA 3ZCMA 3H1VX 4BG8A 1Y64A 3CM6A 4FWOA 1TUUA 3L2RA 4JD2B 5GIOA 3KIOA 4BRDA 4IFVA 5AQYA 3OYHA 3DJCA 3AVBA 5AQXA 3DLGA 1SL0A 3O8MA 4WE1A 5F0XA 3VQPA 3SCXA 2QWRA 1VQPN 2KW4A 1Z25A 4QS9A 2QKKA 1FKPA 1G15A 2FBYA 3C95A 2IVOA 1NK0A 2V7YA 3LAMA 5GIPA 4TSXA 3DYAA 4YOTA 4YFUA 4F8RA 1WAFA 3A8YA 1S1XA 4LC9B 1RT6A 4FLVA 4LF9K 1ZBSA 3CF5L 4RTFD 4ZHRA 3OYGA 4CEZA 2FF3B 3CJBA 3QERA 4DR5K 3THWB 4FJLA 3ZEUB 5BN8A 3NH2A 3AVHA 3S3OA 4DTSA 1EX4A 3CG7A 1NK5A 4M3RA 1SKRA 4B1XB 3MCPA 2P9KA 4B9LA 4BRCA 1NM1A 4X62K 3CPEA 3R6MA 2XO7A 1S72N 1IG9A 1RTIA 2VWBA 1TL1A 3OYKA 4CEEA 3DLBA 4FJMA 3CD6N 3DLEA 2D1KA 1JCFA 3I56N 2XY8A 3D2EB 2HHUA 3D45A 3MMVA 1YAGA 1ZBUA 3ZSWA 3NH1A 3R9PA 2P9UA 4B9UA 3VEWA 2OPPA 3AGKA 5FPEA 4CZJA 1UOCA 2D0CA 3WXKA 4WQ4C 2GUPA 5F2RA 1ATSA 2YCHA 1RNHA 4EP5A 3OHRA 3SAGA 3CJ9A 4CGIA 5M1OA 3TABA 4CIEA 3SJJA 1IV0A 2O8BA 1BIUA 1C1BA 5TKWA 4B9MA 1I94K 3DLRA 1RDDA 1G99A 2X6SA 4JK9A 2X6NA 1T3VA 1HYVA 3AO5A 4DTJA 4JK8A 4FPBA 4W5QA 4WFNL 4BR7A 3LP0A 3D2FB 4KKOA 1X9SA 3LDPA 1U2VB 4GVEA 2E2PA 3VQDA 1HLUA 4FWMA 1Z6RA 2Z1JA 1D4XA 2O8FA 1VQ7N 4CFBA 2HVHA 3OBYA 1LW2A 4JD2A 1NJZA 3CJ1A 4QS7A 3CCRN 4CJLA 2Q97A 4K41A 4O8KA 1QSLA 4BC3A 2P9NB 4B08A 2D0PA 4DG1A 1FXXA 1QSSA 3JYTA 4KI4A 5ADXA 3E01A 1V4SA 2YNFA 2YV0X 4OPAA 3K5LA 4BR2A 4M3TA 4OKEA 3NHGA 3QETA 3D6RA 3P5JA 4CE9A 2KZZA 1TVRA 4ZTFA 4JAXA 4KTQA 3U9ZA 4DS5A 3NH0A 4B3RK 1R59O 4DQQA 4CJ7A 3ZX2A 4CBXA 3THWA 3QEPA 3ZEUA 3DOLA 4BRKA 2GEMA 2O8CB 1DTTA 1HMVA 3B6PA 4FLUA 2PAVA 4IFYA 2ASOA 4BRGA 4MFBA 4JI1K 1B92A 2CGKA 3QEWA 1IJJA 2F9WA 4Z4HA 1N5YA 3AVNA 5JICA 1EXQA 2NRRA 2YHWA 1ASUA 3DLLL 3CQYA 4KPYA 3D2EA 2HBLA 4FYDA 2G8WA 1RFQA 1WB9A 3O1WA 4FLTA 2ZD1A 3MEDA 4BGBA 2ZJRL 3IDHA 5C12A 3NGIA 2J4RA 4HUFA 4CZGA 5BPMA 1T05A 1NKCA 3ZYYX 4H5WA 4F2RA 3KLEA 3M8QA 2E8AA 2P5GA 3M3ZA 4B9SA 2V7ZA 4GV9A 4FZYA 2YNGA 4YHHK 2F96A 3EKSA 5AQSA 3NF9A 1QHTA 4PY5A 1I3AA 1RT2A 4DKWA 3LDOA 2GUIA 4OJRA 2EWSA 4E7JA 3A5OC 1Q9YA 1U6ZA 3ZLJA 4JI3K 4C1NK 4PUOA 4BWMA 3CCMN 3O6WA 3KWGA 3LDLA 2VG5A 4DR7K 3ATUA 2YKMA 3AO3A 3L2QA 2NRXA 2G8IA 3D2FA 1SL2A 1NJXA 2VWKA 3C7NB 3TTDA 1RTJA 1U2VA 4ICLA 5C24A 3RMCA 1K73O 4KHNA 4CJUA 5AQUA 2VQEK 3VQEA 4AF1A 3HOTA 3L4QA 1WSGA 5AQLA 1I39A 2GX9A 4HCCA 2HBMA 3HP6A 5TKYA 1O13A 5KI6A 4FVMA 4LF5K 1R0AA 3BUZB 5KQ8A 1S6QA 2JLEA 1BA1A 1VQ5N 4FZZA 2YHYA 2A40A 3EEQA 1DEJA 3H1QA 1RCHA 2P9NA 4FOEA 3WQTA 4C8KA 4FLXA 3NDKA 3NAEA 4LF7K 3R8EA 3T1YK 2ITGA 1VSMA 3L2VA 3DRRA 1D9DA 1GLJO 3QBXA 3K9JA 2AA4A 3TSPA 2IOCA 3NBPA 3MWPA 3RVCA 4EZ6A 4CEOA 3CCSN 4IWVA 4MLEA 1WSIA 3O9QA 1E4FT 5C42A 2ZF5O 3CM5A 3V81A 1Q18A 3K2PA 1MWMA 3K5MA 2UXCK 3OA9A 5DK5A 2UUBK 4I6MB 3KK3A 3AA5X 3OJSA 5EX5A 3MCAB 1XC3A 4KH6A 2E2QA 4JNEA 2O8CA 1SKWA 3HO1A 3VQBA 1U4BA 4CBUA 3K5NA 2JWKA 1NKBA 3ATVA 2YJFA 5FDLA 1KAZA 4DV3K 4DQPA 4CJSA 3H46O 1JLEA 1BOTO 4KTWA 3G6EN 4B3OA 3PIPL 1VSLA 4GV6A 4JKHA 5BN9A 4BE0A 2RHKA 2FBVA 1TK0A 4FJ9A 1VQMN 2CH5A 3C94A 3VEOA 3EYZA 1ASWA 1S1WA 1W2BM 4OLAA 5AQIA 1Q86O 3RSEB 1WSJA 4EP4A 3WQUA 3O4QA 3D7EO 1YVUA 1A5WA 4GNIA 4FLZA 2ZWHA 4B1WB 3B6OA 3HZ6A 4YDUC 3CXCM 3CQXA 5EVZA 2OZMA 1NGEA 5EOYA 1L3VA 1RGIA 1Q8IA 5AQTA 3EY1A 3FZLA 1NGAA 2ASPA 3VF2A 2HW3A 4CZKA 4XIUA 1P90A 3LAKA 3N4PA 4DF8A 3C7NA 2QWPA 2A1RA 5HRPA 2F4VK 4OGCA 1C0GA 2I5JA 4J2AA 5D3GA 4C8LA 1CLQA 1YTUA 3OS2A 4WQ5A 4C23A 4O8UA 1TL3A 1KFSA 1S1UA 2PYLA 1U47A 4IEIA 3T3FA 1S9EA 3O80A 4JLHA 3NFAA 5FPMA 4YOVA 4JV5K 1SKSA 3KK2A 1NMNA 2OPSA 1Q7YO 1C1AA 4FW2A 5I9EB 3AARA 4DTMA 3CCUN 1NOYA 4ILGB 3G71N 2KFZA 4E7LA 4RCHA
chains in the Genus database with same CATH topology
1N34K 4GKKK 4DV2K 5AJ3K 4JI2K 4X64K 4DV3K 3J7YP 4DV6K 4X66K 4NXNK 5LMUK 4B3SK 4DR4K 4LF6K 4DV7K 3JAMO 1I94K 3OTOK 2UUCK 1N32K 4JYAK 4DR6K 4JI6K 4B3TK 2HHHK 4YHHK 4GKJK 1J5EK 1HNZK 1HR0K 4AQYK 5FLXO 1N36K 4JI3K 4LFCK 4DV0K 4JI8K 4DV5K 2VQFK 4DR7K 5LL6Z 5BR8K 5LMNK 1IBLK 4CW7B 5IT9O 1HNWK 2UXBK 2VQEK 1FJGK 4DV1K 4JI5K 4KHPK 4LF9K 4LF5K 4YY3K 3J80O 1XMOK 4DR1K 4LF8K 4DR3K 4V19S 4K0KK 4DR5K 5IWAK 5A2QO 4DUYK 4LF4K 2F4VK 4CVNE 1XNQK 4X65K 2UUAK 4LF7K 2UU9K 3T1YK 4B3RK 3T1HK 3J81O 4X62K 1IBKK 4JI0K 4JI4K 3J7AP 2UXDK 4JV5K 1XMQK 4NXMK 1HNXK 4DR2K 1N33K 4DV4K 2ZM6K 2UXCK 2E5LK 4LFAK 4JI7K 2UUBK 4B3MK 4DUZK 4OX9K 4JI1K 4LFBK 1IBMK 1XNRK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N34 K;  4GKK K;  4DV2 K;  5AJ3 K;  4JI2 K;  4X64 K;  4DV3 K;  3J7Y P;  4DV6 K;  4X66 K;  4NXN K;  5LMU K;  4B3S K;  4DR4 K;  4LF6 K;  4DV7 K;  3JAM O;  1I94 K;  3OTO K;  2UUC K;  1N32 K;  4JYA K;  4DR6 K;  4JI6 K;  4B3T K;  2HHH K;  4YHH K;  4GKJ K;  1J5E K;  1HNZ K;  1HR0 K;  4AQY K;  5FLX O;  1N36 K;  4JI3 K;  4LFC K;  4DV0 K;  4JI8 K;  4DV5 K;  2VQF K;  4DR7 K;  5LL6 Z;  5BR8 K;  5LMN K;  1IBL K;  4CW7 B;  5IT9 O;  1HNW K;  2UXB K;  2VQE K;  1FJG K;  4DV1 K;  4JI5 K;  4KHP K;  4LF9 K;  4LF5 K;  4YY3 K;  3J80 O;  1XMO K;  4DR1 K;  4LF8 K;  4DR3 K;  4V19 S;  4K0K K;  4DR5 K;  5IWA K;  5A2Q O;  4DUY K;  4LF4 K;  2F4V K;  4CVN E;  1XNQ K;  4X65 K;  2UUA K;  4LF7 K;  2UU9 K;  3T1Y K;  4B3R K;  3T1H K;  3J81 O;  4X62 K;  1IBK K;  4JI0 K;  4JI4 K;  3J7A P;  2UXD K;  4JV5 K;  1XMQ K;  4NXM K;  1HNX K;  4DR2 K;  1N33 K;  4DV4 K;  2ZM6 K;  2UXC K;  2E5L K;  4LFA K;  4JI7 K;  2UUB K;  4B3M K;  4DUZ K;  4OX9 K;  4JI1 K;  4LFB K;  1IBM K;  1XNR K; 
#chains in the Genus database with same CATH topology
 2A1S A;  2OTJ N;  5M1N A;  3JS6 A;  4AHT A;  4I6M A;  4BE1 A;  4OPK A;  3VER A;  3O9T A;  4LY7 A;  2YNH A;  3MN7 A;  1UWB A;  1YXQ A;  4FZX C;  2OCE A;  5CYM A;  1WSE A;  3V9Z A;  4IOX A;  1YTA A;  4I9Q A;  2VYP A;  3DXM B;  3UB5 A;  3J8A A;  4CGF A;  3QIO A;  3WXI A;  3KK7 A;  5CHI A;  1YJN N;  4NO7 A;  3CCJ N;  3C6U A;  4IJA A;  4J8F A;  4JI8 K;  5M1K A;  1TAU A;  4CJE A;  5LL6 Z;  1XQS C;  5HLF A;  1RDA A;  4QOZ B;  4W5T A;  3SBT A;  3WT0 A;  4CFC A;  5GAH P;  3KWI A;  4YOW A;  2XY7 A;  2QWN A;  1NWK A;  5HOO A;  5AFU A;  3HVR A;  5AQJ A;  4H0X B;  4DTP A;  3RSE A;  3PSI A;  1ITG A;  3AVI A;  4O5F A;  2YJE A;  4CHY A;  4HTL A;  1VRU A;  4LF8 K;  4DTU A;  4NLC A;  3JXU A;  5IWA K;  4DUY K;  3E9P A;  4KRF A;  1VQO N;  2X74 A;  1WBB A;  2QEX N;  2UUA K;  5AQQ A;  4H8K A;  4E0D A;  1RBV A;  4JN4 A;  1T44 A;  1K6Y A;  2YKN A;  3A5M C;  5AZI B;  5BPL A;  1IBK K;  1TUY A;  4CZI A;  1HX1 A;  5BRD A;  1RT7 A;  1KQS M;  2FSN A;  2WON A;  2Q3S A;  3LZJ A;  1HNX K;  5FRM A;  5HBM A;  1CZA N;  3SUN A;  4CK1 A;  3SUQ A;  1NKE A;  3DLH A;  1IKV A;  1QHA A;  4DV4 K;  3AY9 A;  2XRI A;  4GW6 A;  3BF1 A;  4BRI A;  3HPG A;  4E1J A;  3KLH A;  5JS2 A;  4L8R B;  2JWL A;  2GV9 A;  1DKG D;  3HT3 A;  1UAX A;  1HJR A;  3CIP A;  4PL7 A;  3LL3 A;  3OW2 M;  4MO5 A;  5C15 A;  1Q81 O;  3WNH A;  5AQO A;  4O44 A;  4H5T A;  5AFU H;  3V6D A;  4NXN K;  2O8E B;  3VQ8 A;  3O9S A;  4FWK A;  4AM7 A;  4IDH A;  4EAH D;  2Z1I A;  4BQZ A;  4EHU A;  4YOY A;  3UIQ A;  3VES A;  4B3S K;  1BCO A;  3MN6 A;  1YUW A;  4F3O A;  3U6F A;  3AAP A;  4LF6 K;  4DQ8 A;  3PO4 A;  2VGM A;  4CF9 A;  2G8F A;  3CPW M;  4QS8 A;  4CEF A;  4DR6 K;  1LWC A;  4CHP A;  1LAV A;  2Q0U A;  1YI2 N;  4B1Z A;  1MA9 B;  3VEY A;  4J2B A;  3I0S A;  3HRG A;  2O8D B;  4M3U A;  3CFP A;  3CCL N;  4OO1 J;  2W6K A;  4CJP A;  1XI1 A;  1YIT N;  3OS0 A;  4KRE A;  4M45 A;  1TKD A;  2P1J A;  5EXW A;  4AHU A;  4KHW A;  2WTU A;  3DXM A;  1RDC A;  2DY4 A;  4IOA L;  2PYJ A;  4IZ9 A;  3AA4 A;  3L8B A;  4Z4E A;  3QEI A;  1YJW N;  3SBG A;  2HST A;  4AHC A;  5HRS A;  3QFU A;  4JKD A;  2P9P B;  1NGJ A;  3CYM A;  4AIL C;  3L6Q A;  1JLB A;  2QXL A;  4LF4 K;  4DFJ A;  4CVN E;  4CF8 A;  3SMP A;  1U48 A;  3CI5 A;  5CYQ A;  5BPN A;  3P31 A;  4A62 A;  4B9T A;  3O3G A;  4Y1D A;  3CFO A;  3IFR A;  3VEV A;  4B1U B;  1UA1 A;  1L5U A;  3MN5 A;  1J53 A;  3V1Q A;  3BP8 A;  1ZC6 A;  3LPU A;  2V51 B;  3U3G A;  4BRO A;  1VK0 A;  1N33 K;  4CHO A;  1BWF O;  4NYF A;  5CY4 A;  3SQ1 A;  4XH5 A;  5J1E A;  1WN7 A;  3ENO A;  1SL1 A;  5AZI A;  2Y1I A;  1BI4 B;  1K8A O;  4J2D A;  1IG8 A;  1RDW X;  1CZB A;  3ZET B;  4IDK A;  1JCE A;  2BUP A;  4CZM A;  3F5T A;  3BGR A;  3SPZ A;  3ZX0 A;  2IIR A;  4NLB A;  5B8H A;  2HHS A;  4KHQ A;  1NK8 A;  5FPD A;  1RBR A;  4BC5 A;  4HCB A;  3E9L A;  3MAQ A;  4CEQ A;  2UUC K;  5JVH L;  1N32 K;  3PX6 A;  3G4S N;  4JHD B;  1SZ2 A;  2HHH K;  3A5L C;  1T7P A;  2O8E A;  4RW6 A;  3ZSO A;  4BRL A;  5E41 A;  1JCG A;  4KHY A;  4CGD A;  1VRT A;  3FZF A;  4CK3 A;  4PKH A;  1NJY A;  2W40 A;  3M5R A;  4CCH A;  2E20 A;  3P38 A;  1ATN A;  2PY5 A;  3CC2 N;  5KRS A;  1NGB A;  2XY6 A;  2PZS A;  4A5B A;  2QKB A;  3QES A;  4M63 C;  2O8D A;  4N47 A;  3EZW A;  4ELT A;  1C0M A;  4Z94 A;  1ASV A;  3P83 D;  4DFM A;  1FJG K;  1EQY A;  3KD5 E;  5C10 A;  4H0P A;  1QQC A;  1HYS A;  4H4M A;  2PBD A;  2WBN A;  1X9J A;  4JKF A;  4FM1 A;  4O55 A;  2VGN A;  2FSK A;  3T69 A;  3H3N O;  1TYQ B;  5EU7 A;  4DU3 A;  4CGJ A;  4CK2 A;  1NK4 A;  5DMR A;  3VEZ A;  1TAQ A;  1GLL O;  4DTN A;  2IAJ A;  5GAD P;  3E1Y A;  4JI0 K;  1EWR A;  2FXU A;  3LAL A;  3VPZ A;  2P9P A;  3HPO A;  4K8Z A;  3DM2 A;  4DQR A;  2AJQ A;  3S3M A;  4EFH A;  1XMQ K;  3W3D A;  3RMB A;  1OH5 A;  1VQ6 N;  4BG9 A;  5AZJ B;  4KB0 A;  1X9M A;  3VN5 A;  1ESV A;  4LFA K;  4Y1C A;  3KKS A;  3EL2 A;  4OX9 K;  5JMV A;  3N4Q A;  3CQ8 A;  3LPT A;  3ENB A;  3P4I A;  3OJU A;  4FXD A;  4DV2 K;  3SV4 A;  4FJX A;  3VQA A;  4CJK A;  1NJW A;  4X64 K;  4JK7 A;  4DSL A;  4DV6 K;  1BI4 A;  4Z4I A;  3TSU A;  1L3S A;  3PO5 A;  3I0R A;  3ZET A;  3IMX A;  3O4N A;  4KH5 A;  1T8E A;  5JS1 A;  3WXM B;  4C8O A;  3QML A;  2BH1 A;  3V9S A;  4F4K A;  1J5E K;  3QIN A;  2KHO A;  3S41 A;  5FRO A;  4AQY K;  2GWK A;  1BCM A;  3IUC A;  5AQN A;  3C6H A;  2NRH A;  4BC2 A;  4CZL A;  2WFB A;  2HF3 A;  1LAW A;  4ILJ A;  3T19 A;  4M3X A;  3QEX A;  3THX B;  4JHD A;  3F2K A;  1XHZ A;  5BR8 K;  5ADX H;  2DFE A;  1SV5 A;  5CE3 A;  1YHQ N;  2VG6 A;  3A0I X;  1CXU A;  2GTD A;  4BY9 C;  4H0O A;  1MU2 A;  3MK6 A;  3KLI A;  1RBT A;  1VSI A;  4CZF A;  3K9K A;  3OYC A;  3UKU B;  4AM6 A;  1N6Q A;  1IKX A;  3U9D A;  4H5R A;  2P9S B;  4X65 K;  4WFA L;  4A5A A;  2R7Y A;  3K5O A;  4BRE A;  4BWJ A;  3SAH A;  4EZ9 A;  4CES A;  3AVF A;  4CJ4 A;  4RW9 A;  1NGD A;  1L3U A;  4LSL A;  4CJV A;  2ZJP L;  1NMD A;  3AGR A;  3VF6 A;  3U3Y A;  1TYQ A;  4CJ5 A;  1XUP O;  3BY5 A;  4DR2 K;  3FLC O;  4DCH A;  2NRT A;  3AVC A;  1HKG A;  4KFB A;  3O5B A;  1VQK N;  3I8D A;  1SQK A;  1KSP A;  1NOZ A;  2HNY A;  4DUZ K;  1S9G A;  3ID6 A;  1EKE A;  4M42 A;  1C0U A;  2B5J A;  1RT4 A;  3G10 A;  3RWU A;  1WSH A;  1BIS A;  3O9R A;  5AZJ A;  3CCQ N;  4ELU A;  3GE1 A;  1VAZ A;  3RRG A;  4WCE L;  3AVL A;  1OKJ A;  1BQM A;  1BL3 A;  1RBS A;  5M1P A;  3ZSV A;  1KCF A;  3M8S A;  5LMU K;  4LH4 A;  3SLC A;  3FZH A;  1EWQ A;  3J7Z O;  3LP3 A;  5T7B A;  4FWN A;  2B4J A;  4PA1 A;  3KK1 A;  1NGI A;  4H5N A;  4CJW A;  1XC9 A;  1VSJ A;  1ZBF A;  1IH7 A;  3LDQ A;  4AHS A;  3OYI A;  1GLF O;  4GKJ K;  1HR0 K;  3QLH A;  4K43 A;  1KAY A;  3ISN C;  1JLA A;  2QI2 A;  1BIZ A;  4I7F A;  1GLA G;  4F9O A;  2HMI A;  3VMF B;  3E66 A;  2ZGY A;  4DU4 A;  1VSH A;  5AQG A;  3PY8 A;  4RWT A;  2FSJ A;  4G9Z A;  4BR9 A;  4CW7 B;  5IT9 O;  4FW1 A;  4KO0 A;  5C2F A;  3FE1 A;  1QVF M;  4BRN A;  2UXB K;  4E1M A;  3WEE B;  3AA2 A;  3CJC A;  1BHL A;  3THX A;  1DTQ A;  2VCP A;  1JLQ A;  5KPZ A;  4CEC A;  3QFP A;  4LH5 A;  4W5O A;  1C1C A;  3AVA A;  5H1S Q;  3EKU A;  3LWM A;  3PX0 A;  4H5V A;  4KHU A;  4W5R A;  3LP2 A;  5KPR A;  1DT9 A;  3V9U A;  4DS4 A;  4ILH A;  5LJV A;  4CIG A;  3C65 A;  1HPM A;  4BRF A;  4EIA A;  3J81 O;  3UKU A;  5F1X A;  4GY2 B;  5CZ2 A;  1H1V A;  2E2O A;  1U49 A;  3TTC A;  2P9S A;  5C0Y A;  3SQ2 A;  2RF2 A;  1JXE A;  3O3H A;  3RMA A;  1S3X A;  3WUH A;  3NMU A;  4Q5V A;  4B3M K;  2HHT A;  2HBJ A;  3O08 A;  1KVA A;  1QQN A;  2F9T A;  1D8Y A;  5M1Q A;  4NYN A;  3BZK A;  4GKK K;  1KVB A;  2B6A A;  3V9X A;  2LSN A;  1NGG A;  4CEA A;  2RKI A;  4O0J A;  4IEE A;  4FK0 A;  4M3Y A;  3SV3 A;  1HUX A;  4FCY A;  2WC9 A;  5JVG L;  4CGG A;  3HI0 A;  1JKH A;  2ZQB A;  3V9W A;  4FO0 A;  2F8S A;  1KVC A;  1X3N A;  4A2A A;  3HTV A;  4FK4 A;  1HPZ A;  1WSF A;  4OLB A;  1VQ9 N;  2HVI A;  4CEB A;  3RR7 A;  3D0P A;  5BRF A;  4FPA A;  1VSE A;  4JEP A;  3NCI A;  4B9Q A;  4BR4 A;  2A41 A;  3BZC A;  3L3U A;  3ZSR A;  3RRH A;  4LFC K;  5JLF A;  2H3G X;  4M3Z A;  4IXC A;  2ZE2 A;  3IRX A;  4PKG A;  3M8P A;  3FZM A;  5AQM A;  5LMN K;  2FLO A;  2YHX A;  5AR0 A;  1L3T A;  2P5O A;  3FFK B;  5AQV A;  4GV3 A;  4JI5 K;  2Z1H A;  1NK7 A;  4CJF A;  4WFB L;  1T6D A;  3SAF A;  1RT1 A;  4YY3 K;  3VQ6 A;  4BVO A;  3QBW A;  1ZBH A;  4ID5 A;  5GAE P;  4V19 S;  1QQO A;  3QO9 A;  4L3Q A;  4CIF A;  3R1X A;  4GVM A;  4U67 L;  5A2Q O;  2HND A;  4ISG A;  4B9N A;  4WQ4 A;  2I7N A;  3TAN A;  1UA0 A;  2RPI A;  3WEE A;  4XEI A;  3M1F A;  4OPJ A;  4RW4 A;  4MDB A;  1OVY A;  5LY3 A;  3TAR A;  1QQM A;  4CFA A;  4BR5 A;  1J5O A;  4C8M A;  3WNF A;  3FGU A;  4H0Y B;  1HKB A;  3CJ7 A;  1J9A A;  5LJW A;  3CC4 N;  1LWF A;  1X3M A;  1TKX A;  5HP1 A;  2ZM6 K;  2P9I B;  1KTQ A;  1JLF A;  1VSD A;  3NVM A;  2A42 A;  4DF4 A;  3SQ4 A;  3OYN A;  4E3S A;  5AQK A;  2HMP A;  3QIC A;  4I2P A;  3UKR B;  3DWL A;  3GL1 A;  4KHS A;  3O1B A;  3PSF A;  4BRQ A;  5J2Q A;  4FWR A;  2X78 A;  4JKA A;  3VEN A;  2OA8 A;  3AVG A;  2E6M A;  3CHW A;  2IGI A;  1LV5 A;  4FK2 A;  3VGM A;  3K0S A;  4FJK A;  5E26 A;  1BU6 O;  1WBD A;  3DXK B;  3UE5 A;  4J2E A;  5BRH A;  4K25 A;  4DSJ A;  3VQ7 A;  4CF0 A;  2KFN A;  3PUF A;  1TKT A;  1S22 A;  1JLC A;  4DSK A;  4Z0U A;  2BTF A;  3MEE A;  4FOI A;  3KJV A;  2OYQ A;  1OH7 A;  1NG9 A;  4CGH A;  4DV0 K;  2KLA A;  5K14 A;  4DV5 K;  2VQF K;  4KAZ A;  3DMJ A;  3MXM A;  3F9K A;  4KB1 A;  3VQ4 A;  3ZSY A;  2E4L A;  2FBT A;  5AQP A;  4BDY A;  2YI1 A;  1KRP A;  1TV6 A;  4R79 A;  4E7H A;  1S5J A;  2W42 A;  1TK8 A;  4KHP K;  2A3Z A;  4JS5 A;  4YOX A;  4M3W A;  4A57 A;  5HRR A;  4H03 B;  2D0O A;  4I9L A;  4CI6 A;  4DR3 K;  3HP9 A;  3VOV A;  4BVP A;  2DFH A;  3SZ2 A;  5AQH A;  1HQU A;  2G8K A;  1LWE A;  2ITM A;  3AAQ A;  4U7B A;  1NK9 A;  1P8Z A;  1GLE G;  4IG0 A;  4H0T B;  1GOB A;  3ULE B;  3E9O A;  3THY B;  4MDA A;  1XNQ K;  3GG4 A;  3H45 C;  4IO8 A;  5KTQ A;  1BGX T;  1IKY A;  3TR8 A;  2ATQ A;  1C0T A;  3EN9 A;  4FJI A;  1XHX A;  1Z05 A;  5KQD A;  3SYZ A;  4PWD A;  4FM2 A;  3KKR A;  4DHY A;  2IVN A;  2I7P A;  1MDU B;  4PKI A;  3CJA A;  3VET A;  5I3U A;  4BRP A;  1B9F A;  4FL9 A;  3SMS A;  2QWL A;  2E5L K;  4Z4G A;  4C1N I;  1IO2 A;  4EHT A;  4RW8 A;  3CME N;  1IBM K;  4DQS A;  3OYF A;  5BR9 A;  3SJH A;  1XNR K;  3TU5 A;  4O4G A;  2ASM A;  1E4G T;  4FLW A;  4WF9 L;  2P9I A;  3I55 N;  4FM0 A;  1M1K O;  4IFE A;  3VTH A;  1EO1 A;  3VF4 A;  3I33 A;  4A61 A;  4DR4 K;  2QA4 N;  1RTH A;  1W9H A;  4WQ5 C;  2HNZ A;  3MEG A;  3UKR A;  3KLG A;  4JKC A;  1TGO A;  4MQ3 A;  2KQ2 A;  1BG3 A;  2Q0R A;  2AP1 A;  1VQN N;  1RT3 A;  2E1Z A;  3LM2 A;  4A2B A;  3OYL A;  4FJN A;  3GOI A;  4UY8 O;  1JL2 A;  2V52 B;  4OPH A;  3AA3 A;  3BEX A;  4DTX A;  1RBU A;  3CET A;  3O4W A;  3TWH A;  1HJO A;  3DXK A;  1VSF A;  3NGY A;  1SUQ A;  5HRO A;  3ZT3 A;  4GMJ B;  4CZH A;  2IVP A;  1SS6 A;  3QNO A;  1RDU A;  2OAN A;  2ZGZ A;  3TTF A;  2DFF A;  2JGU A;  4K8X A;  3HSC A;  3OS1 A;  4YNQ A;  3ZSZ A;  4JKE A;  2IDO A;  1D9F A;  1CZ9 A;  4K0K K;  3IS9 A;  3VQQ A;  1FK9 A;  3CER A;  2A5X A;  1RTD A;  3VQ5 A;  5JLH A;  1JXB A;  4FJ5 A;  2OZS A;  2NRV A;  4RW7 A;  3AVM A;  4XH4 A;  4JI4 K;  4DLG A;  2F8T A;  2HHX A;  2UXD K;  4BQL A;  4QCL A;  1REV A;  2D0A A;  3FFI A;  3FZK A;  3MEC A;  3ULE A;  3THY A;  3HXM A;  1GOA A;  3HL8 A;  3FR0 A;  4FJJ A;  4UQG A;  2G8V A;  3TAG A;  4Z4F A;  3QEV A;  5FPN A;  3RR8 A;  3VQC A;  1HNV A;  3WXL A;  1HRH A;  4OGE A;  1Q82 O;  3C0B A;  3IG1 A;  4HUE A;  2G8U A;  1QZ5 A;  4B1Y B;  3ITH A;  3MN9 A;  4N76 A;  4YDU A;  3OYE A;  1YT3 A;  3LAN A;  1MWK A;  4AHR A;  2P51 A;  3TSQ A;  3PX4 A;  3ASM A;  4MLH A;  4DSI A;  3T7Z A;  4JRQ A;  2HB5 A;  3A5N C;  2OPR A;  3CCE N;  5BRE A;  4IJN A;  3C6A A;  4FJ7 A;  3KHY A;  4ID1 A;  4KI6 A;  4JI6 K;  2YNI A;  4N41 A;  1E3M A;  1VHX A;  3NVK A;  2YHA A;  3CFR A;  3VTI A;  1YJ9 N;  1TKZ A;  2YX6 A;  4AHV A;  4B1V A;  3CMA N;  3WXJ A;  1N36 K;  4A59 A;  3OBW A;  4CHN A;  3F73 A;  1OH8 A;  5GIN A;  2FBX A;  3LWL A;  2DTU A;  3G25 A;  3SQ0 A;  4DFP A;  1ZBI A;  2QWM A;  4FLY A;  1NNE A;  4YOR A;  3Q7C A;  3HBT A;  5ELZ A;  4DTO A;  3HK2 A;  3EE9 A;  2HF4 A;  1QS4 A;  3SI6 A;  1KAX A;  4R5P A;  3NE6 A;  3ZT2 A;  1U04 A;  3P1G A;  2NUB A;  3J80 O;  1EP4 A;  2D0B A;  3L0Q A;  4CED A;  5DM6 L;  3ULD A;  1C0F A;  4WYB A;  2QWQ A;  3H6E A;  4FWS A;  4HUG A;  2EX3 A;  4CD3 A;  3K58 A;  3LDN A;  3O3F A;  1VQ4 N;  3IAY A;  5DM7 L;  1W97 L;  3H08 A;  1ZYQ A;  3PLA A;  1S1V A;  1W7A A;  4KV8 A;  2GBZ A;  3AV9 A;  3G0Z A;  3ZX3 A;  3LDS A;  4NXM K;  4JKB A;  4IKF A;  4O0I A;  1A5X A;  1W0H A;  4H4O A;  3V1R A;  1ILY A;  4DU1 A;  4BDZ A;  3L4I A;  1X1P A;  3VA3 A;  2OPQ A;  1VSK A;  2FF6 A;  3HJF A;  4E89 A;  2G8H A;  3NF8 A;  3KZB A;  1U45 A;  3M6G A;  1ZXO A;  1WLJ A;  3MWT A;  2QWO A;  3ALY A;  5AQW A;  3WNG A;  3S9H A;  1Z26 A;  1J6Z A;  3DOK A;  4DV7 K;  1C6V A;  5EY4 A;  4NB4 A;  4FJG A;  4KH4 A;  4JYA K;  4B3T K;  3MX5 A;  4B8C A;  5SZT A;  4HWI A;  2Q2R A;  1FKO A;  1QSY A;  5J2M A;  3ZSX A;  3TAF A;  2D5R A;  1RDB A;  3RMD A;  5HRN A;  1NLV A;  4NCA A;  3TPQ A;  1KC8 O;  4YOU A;  3THV A;  4CJR A;  4OKK A;  3GDQ A;  3VGL A;  2HOE A;  4CHQ A;  3JSM A;  5AQR A;  4F2S A;  1YF5 L;  1T6C A;  1IBL K;  1JLG A;  1F21 A;  4M41 A;  3SUO A;  5C2D A;  3MXI A;  3TAP A;  1K9M O;  1GOC A;  1BDG A;  1BUP A;  1Y97 A;  3IKM A;  1VQL N;  1HYZ A;  3ZT1 A;  3VA0 A;  3TAQ A;  2GEL A;  1FW6 A;  4DR1 K;  3OVN A;  3LZI A;  4OVL A;  4NCB A;  3RTV A;  2KKZ A;  4ELV A;  1S1T A;  5KGX A;  2UU9 K;  1KLM A;  2KTQ A;  3T1H K;  4FJ8 A;  4RG8 A;  2RN2 A;  1NGC A;  4E19 A;  4OKJ A;  3W0L A;  3J7A P;  4F3T A;  1GLD G;  3SNN A;  2IS3 A;  4CZE A;  3NF6 A;  3DRS A;  4DWI A;  3ZT0 A;  4DSF A;  3AVK A;  2CGJ A;  3P39 A;  3OY9 A;  3DI6 A;  3BDP A;  1RIL A;  3U4L A;  1TK5 A;  1NJI O;  4JRP A;  5AJ3 K;  4LSN A;  1VQ8 N;  3GBT A;  3ZSQ A;  3EO3 A;  3BF3 A;  3I8B A;  3MXJ A;  4X66 K;  1M90 O;  2W6L A;  4HHT A;  2XY5 A;  2FC0 A;  4FSV A;  3L3V A;  2Q1N A;  2RE2 A;  3HM8 A;  2ZJQ L;  3JAM O;  3SPY A;  1B9D A;  4CBW A;  4QAG A;  2QTD A;  3C6T A;  3VQ9 A;  2E2N A;  5C25 A;  1JL1 A;  2Z1G A;  2D4W A;  3DRP A;  4DFK A;  2ETJ A;  3MX2 A;  1HNZ K;  1K8K B;  1NK6 A;  3M8R A;  3KD1 E;  3OYA A;  3CCV N;  3VGK A;  5J2P A;  5FLX O;  1QVG M;  2XHB A;  3KVG A;  3WNE A;  2P9L B;  3T1A A;  1ZBL A;  3NF7 A;  3LM9 A;  3PIO L;  4FJH A;  4DSE A;  1BO5 O;  5KPT A;  3L2U A;  2CGL A;  1HNW K;  3LP1 A;  4DV1 K;  1GLB G;  5GAG P;  4BGA A;  3SUP A;  5CZ1 A;  1J54 A;  4JKG B;  1S6P A;  3ID8 A;  3L2W A;  1XMO K;  1OH6 A;  4ISF A;  1DGK N;  2W41 A;  3QDK A;  4O5B A;  2Y1J A;  2O4I A;  3K59 A;  2NLX A;  1BA0 A;  4PL8 A;  2Q36 A;  2QW9 A;  5SWM A;  4BR0 A;  5KRT A;  3VEX A;  1HQE A;  1ATR A;  3AO2 A;  1YVN A;  4M7X A;  4C8N A;  1T03 A;  1EET A;  4DB3 A;  4IG3 A;  3ENH A;  3HST B;  4DMN A;  1LCU A;  4Z4C A;  4N56 A;  3U8X A;  3DAW A;  3KTQ A;  2IC3 A;  2BAN A;  4ISE A;  2BGG A;  4Q0B A;  3MDQ A;  1WUA A;  4FVU A;  2E88 A;  4G1Q A;  2GWJ A;  1NU0 A;  2UYT A;  4JI7 K;  4BC4 A;  4DTR A;  2BE2 A;  3DLK A;  3PV8 A;  1JJ2 M;  4KTZ A;  2NRZ A;  3EE8 A;  2OTL N;  5AQF A;  5FRN A;  3AO4 A;  2HBK A;  1QZ6 A;  5CR4 A;  3OYJ A;  1WNS A;  3CC7 N;  3Q7B A;  3TAE A;  5E84 A;  1X9W A;  3HYF A;  2F7T A;  4KBO A;  1N8R O;  3O9U A;  1NGH A;  2WOM A;  5M1F A;  1KD1 O;  3OTO K;  4CJT A;  4M7Y A;  4FWQ A;  3OYD A;  2QXF A;  3QNN A;  4CF2 A;  2EHG A;  1YIJ N;  4CHZ A;  1O1W A;  4CD1 A;  4B8A B;  3B8A X;  3F9M A;  4LD0 A;  5MLC Q;  2PFU A;  3H3O B;  4Y0W A;  3HM9 A;  2QM1 A;  3S3N A;  4CF1 A;  2VG7 A;  4ZTJ A;  1OVQ A;  4CFD A;  1Q9X A;  1HNI A;  4BE2 A;  2NZT A;  2A6A A;  4BRA A;  1QE1 A;  3SK3 A;  1K8K A;  2E6L A;  4NCG A;  1RT5 A;  4CJ3 A;  4I2Q A;  1QTM A;  1A5V A;  2VWJ A;  1NGF A;  4FWP A;  5HL7 L;  2BDP A;  2QK9 A;  2P9L A;  3EZ5 A;  3TAM A;  1XWL A;  5J2N A;  2HHQ A;  4CJQ A;  2HHW A;  4W5N A;  3V1O A;  2P9K B;  1HKC A;  3V4I A;  1SAZ A;  5KGW A;  4DLE A;  2YHB A;  4BRM A;  4PHT X;  2HHV A;  3A2F A;  4N5S A;  4E7I A;  4IO9 L;  4BDP A;  1IKW A;  2O4G A;  4AH9 A;  4FWL A;  3QIP A;  4JKG A;  3K57 A;  1BQN A;  3NGZ A;  1WAJ A;  4IBN A;  3AVJ A;  4CER A;  2Q31 A;  4B9V A;  4IOC L;  3TI0 A;  4DQI A;  4XH1 A;  5AQZ A;  2P9U B;  3AO1 A;  1KXP A;  4K42 A;  1KLN A;  1KFD A;  4MO4 A;  1DLO A;  2DPN A;  1WOQ A;  4PQU A;  2WUS A;  4JS4 A;  4LFB K;  1LOT B;  2NRW A;  3HPH A;  2O8B B;  3ZT4 A;  1N34 K;  2CH6 A;  3KLF A;  4H0V B;  1GLC G;  4JI2 K;  2KZM A;  5I42 A;  4E1N A;  3J7Y P;  3R3L A;  1D5A A;  2NNW A;  3HVT A;  1NBW A;  4HVJ A;  2E1Y A;  4BAC A;  1CXQ A;  4E7K A;  1V4T A;  1LW0 A;  4HTU A;  3OYM A;  3OYB A;  3QB0 A;  3HOS A;  2O8F B;  4BRH A;  3ZCM A;  3H1V X;  4BG8 A;  1Y64 A;  3CM6 A;  4FWO A;  1TUU A;  3L2R A;  4JD2 B;  5GIO A;  3KIO A;  4BRD A;  4IFV A;  5AQY A;  3OYH A;  3DJC A;  3AVB A;  5AQX A;  3DLG A;  1SL0 A;  3O8M A;  4WE1 A;  5F0X A;  3VQP A;  3SCX A;  2QWR A;  1VQP N;  2KW4 A;  1Z25 A;  4QS9 A;  2QKK A;  1FKP A;  1G15 A;  2FBY A;  3C95 A;  2IVO A;  1NK0 A;  2V7Y A;  3LAM A;  5GIP A;  4TSX A;  3DYA A;  4YOT A;  4YFU A;  4F8R A;  1WAF A;  3A8Y A;  1S1X A;  4LC9 B;  1RT6 A;  4FLV A;  4LF9 K;  1ZBS A;  3CF5 L;  4RTF D;  4ZHR A;  3OYG A;  4CEZ A;  2FF3 B;  3CJB A;  3QER A;  4DR5 K;  3THW B;  4FJL A;  3ZEU B;  5BN8 A;  3NH2 A;  3AVH A;  3S3O A;  4DTS A;  1EX4 A;  3CG7 A;  1NK5 A;  4M3R A;  1SKR A;  4B1X B;  3MCP A;  2P9K A;  4B9L A;  4BRC A;  1NM1 A;  4X62 K;  3CPE A;  3R6M A;  2XO7 A;  1S72 N;  1IG9 A;  1RTI A;  2VWB A;  1TL1 A;  3OYK A;  4CEE A;  3DLB A;  4FJM A;  3CD6 N;  3DLE A;  2D1K A;  1JCF A;  3I56 N;  2XY8 A;  3D2E B;  2HHU A;  3D45 A;  3MMV A;  1YAG A;  1ZBU A;  3ZSW A;  3NH1 A;  3R9P A;  2P9U A;  4B9U A;  3VEW A;  2OPP A;  3AGK A;  5FPE A;  4CZJ A;  1UOC A;  2D0C A;  3WXK A;  4WQ4 C;  2GUP A;  5F2R A;  1ATS A;  2YCH A;  1RNH A;  4EP5 A;  3OHR A;  3SAG A;  3CJ9 A;  4CGI A;  5M1O A;  3TAB A;  4CIE A;  3SJJ A;  1IV0 A;  2O8B A;  1BIU A;  1C1B A;  5TKW A;  4B9M A;  1I94 K;  3DLR A;  1RDD A;  1G99 A;  2X6S A;  4JK9 A;  2X6N A;  1T3V A;  1HYV A;  3AO5 A;  4DTJ A;  4JK8 A;  4FPB A;  4W5Q A;  4WFN L;  4BR7 A;  3LP0 A;  3D2F B;  4KKO A;  1X9S A;  3LDP A;  1U2V B;  4GVE A;  2E2P A;  3VQD A;  1HLU A;  4FWM A;  1Z6R A;  2Z1J A;  1D4X A;  2O8F A;  1VQ7 N;  4CFB A;  2HVH A;  3OBY A;  1LW2 A;  4JD2 A;  1NJZ A;  3CJ1 A;  4QS7 A;  3CCR N;  4CJL A;  2Q97 A;  4K41 A;  4O8K A;  1QSL A;  4BC3 A;  2P9N B;  4B08 A;  2D0P A;  4DG1 A;  1FXX A;  1QSS A;  3JYT A;  4KI4 A;  5ADX A;  3E01 A;  1V4S A;  2YNF A;  2YV0 X;  4OPA A;  3K5L A;  4BR2 A;  4M3T A;  4OKE A;  3NHG A;  3QET A;  3D6R A;  3P5J A;  4CE9 A;  2KZZ A;  1TVR A;  4ZTF A;  4JAX A;  4KTQ A;  3U9Z A;  4DS5 A;  3NH0 A;  4B3R K;  1R59 O;  4DQQ A;  4CJ7 A;  3ZX2 A;  4CBX A;  3THW A;  3QEP A;  3ZEU A;  3DOL A;  4BRK A;  2GEM A;  2O8C B;  1DTT A;  1HMV A;  3B6P A;  4FLU A;  2PAV A;  4IFY A;  2ASO A;  4BRG A;  4MFB A;  4JI1 K;  1B92 A;  2CGK A;  3QEW A;  1IJJ A;  2F9W A;  4Z4H A;  1N5Y A;  3AVN A;  5JIC A;  1EXQ A;  2NRR A;  2YHW A;  1ASU A;  3DLL L;  3CQY A;  4KPY A;  3D2E A;  2HBL A;  4FYD A;  2G8W A;  1RFQ A;  1WB9 A;  3O1W A;  4FLT A;  2ZD1 A;  3MED A;  4BGB A;  2ZJR L;  3IDH A;  5C12 A;  3NGI A;  2J4R A;  4HUF A;  4CZG A;  5BPM A;  1T05 A;  1NKC A;  3ZYY X;  4H5W A;  4F2R A;  3KLE A;  3M8Q A;  2E8A A;  2P5G A;  3M3Z A;  4B9S A;  2V7Z A;  4GV9 A;  4FZY A;  2YNG A;  4YHH K;  2F96 A;  3EKS A;  5AQS A;  3NF9 A;  1QHT A;  4PY5 A;  1I3A A;  1RT2 A;  4DKW A;  3LDO A;  2GUI A;  4OJR A;  2EWS A;  4E7J A;  3A5O C;  1Q9Y A;  1U6Z A;  3ZLJ A;  4JI3 K;  4C1N K;  4PUO A;  4BWM A;  3CCM N;  3O6W A;  3KWG A;  3LDL A;  2VG5 A;  4DR7 K;  3ATU A;  2YKM A;  3AO3 A;  3L2Q A;  2NRX A;  2G8I A;  3D2F A;  1SL2 A;  1NJX A;  2VWK A;  3C7N B;  3TTD A;  1RTJ A;  1U2V A;  4ICL A;  5C24 A;  3RMC A;  1K73 O;  4KHN A;  4CJU A;  5AQU A;  2VQE K;  3VQE A;  4AF1 A;  3HOT A;  3L4Q A;  1WSG A;  5AQL A;  1I39 A;  2GX9 A;  4HCC A;  2HBM A;  3HP6 A;  5TKY A;  1O13 A;  5KI6 A;  4FVM A;  4LF5 K;  1R0A A;  3BUZ B;  5KQ8 A;  1S6Q A;  2JLE A;  1BA1 A;  1VQ5 N;  4FZZ A;  2YHY A;  2A40 A;  3EEQ A;  1DEJ A;  3H1Q A;  1RCH A;  2P9N A;  4FOE A;  3WQT A;  4C8K A;  4FLX A;  3NDK A;  3NAE A;  4LF7 K;  3R8E A;  3T1Y K;  2ITG A;  1VSM A;  3L2V A;  3DRR A;  1D9D A;  1GLJ O;  3QBX A;  3K9J A;  2AA4 A;  3TSP A;  2IOC A;  3NBP A;  3MWP A;  3RVC A;  4EZ6 A;  4CEO A;  3CCS N;  4IWV A;  4MLE A;  1WSI A;  3O9Q A;  1E4F T;  5C42 A;  2ZF5 O;  3CM5 A;  3V81 A;  1Q18 A;  3K2P A;  1MWM A;  3K5M A;  2UXC K;  3OA9 A;  5DK5 A;  2UUB K;  4I6M B;  3KK3 A;  3AA5 X;  3OJS A;  5EX5 A;  3MCA B;  1XC3 A;  4KH6 A;  2E2Q A;  4JNE A;  2O8C A;  1SKW A;  3HO1 A;  3VQB A;  1U4B A;  4CBU A;  3K5N A;  2JWK A;  1NKB A;  3ATV A;  2YJF A;  5FDL A;  1KAZ A;  4DV3 K;  4DQP A;  4CJS A;  3H46 O;  1JLE A;  1BOT O;  4KTW A;  3G6E N;  4B3O A;  3PIP L;  1VSL A;  4GV6 A;  4JKH A;  5BN9 A;  4BE0 A;  2RHK A;  2FBV A;  1TK0 A;  4FJ9 A;  1VQM N;  2CH5 A;  3C94 A;  3VEO A;  3EYZ A;  1ASW A;  1S1W A;  1W2B M;  4OLA A;  5AQI A;  1Q86 O;  3RSE B;  1WSJ A;  4EP4 A;  3WQU A;  3O4Q A;  3D7E O;  1YVU A;  1A5W A;  4GNI A;  4FLZ A;  2ZWH A;  4B1W B;  3B6O A;  3HZ6 A;  4YDU C;  3CXC M;  3CQX A;  5EVZ A;  2OZM A;  1NGE A;  5EOY A;  1L3V A;  1RGI A;  1Q8I A;  5AQT A;  3EY1 A;  3FZL A;  1NGA A;  2ASP A;  3VF2 A;  2HW3 A;  4CZK A;  4XIU A;  1P90 A;  3LAK A;  3N4P A;  4DF8 A;  3C7N A;  2QWP A;  2A1R A;  5HRP A;  2F4V K;  4OGC A;  1C0G A;  2I5J A;  4J2A A;  5D3G A;  4C8L A;  1CLQ A;  1YTU A;  3OS2 A;  4WQ5 A;  4C23 A;  4O8U A;  1TL3 A;  1KFS A;  1S1U A;  2PYL A;  1U47 A;  4IEI A;  3T3F A;  1S9E A;  3O80 A;  4JLH A;  3NFA A;  5FPM A;  4YOV A;  4JV5 K;  1SKS A;  3KK2 A;  1NMN A;  2OPS A;  1Q7Y O;  1C1A A;  4FW2 A;  5I9E B;  3AAR A;  4DTM A;  3CCU N;  1NOY A;  4ILG B;  3G71 N;  2KFZ A;  4E7L A;  4RCH A; 
#chains in the Genus database with same CATH homology
 1N34 K;  4GKK K;  4DV2 K;  5AJ3 K;  4JI2 K;  4X64 K;  4DV3 K;  3J7Y P;  4DV6 K;  4X66 K;  4NXN K;  5LMU K;  4B3S K;  4DR4 K;  4LF6 K;  4DV7 K;  3JAM O;  1I94 K;  3OTO K;  2UUC K;  1N32 K;  4JYA K;  4DR6 K;  4JI6 K;  4B3T K;  2HHH K;  4YHH K;  4GKJ K;  1J5E K;  1HNZ K;  1HR0 K;  4AQY K;  5FLX O;  1N36 K;  4JI3 K;  4LFC K;  4DV0 K;  4JI8 K;  4DV5 K;  2VQF K;  4DR7 K;  5LL6 Z;  5BR8 K;  5LMN K;  1IBL K;  4CW7 B;  5IT9 O;  1HNW K;  2UXB K;  2VQE K;  1FJG K;  4DV1 K;  4JI5 K;  4KHP K;  4LF9 K;  4LF5 K;  4YY3 K;  3J80 O;  1XMO K;  4DR1 K;  4LF8 K;  4DR3 K;  4V19 S;  4K0K K;  4DR5 K;  5IWA K;  5A2Q O;  4DUY K;  4LF4 K;  2F4V K;  4CVN E;  1XNQ K;  4X65 K;  2UUA K;  4LF7 K;  2UU9 K;  3T1Y K;  4B3R K;  3T1H K;  3J81 O;  4X62 K;  1IBK K;  4JI0 K;  4JI4 K;  3J7A P;  2UXD K;  4JV5 K;  1XMQ K;  4NXM K;  1HNX K;  4DR2 K;  1N33 K;  4DV4 K;  2ZM6 K;  2UXC K;  2E5L K;  4LFA K;  4JI7 K;  2UUB K;  4B3M K;  4DUZ K;  4OX9 K;  4JI1 K;  4LFB K;  1IBM K;  1XNR K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...