5KRTA

Hiv-1 integrase catalytic core domain (ccd) in complex with a fragment-derived allosteric inhibitor
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
152
structure length
143
Chain Sequence
SSPGIWQLDTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAAWWAGIKQEFGIPYNPGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRGGYSAGERIVDIIATD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title A New Class of Allosteric HIV-1 Integrase Inhibitors Identified by Crystallographic Fragment Screening of the Catalytic Core Domain.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Hydrolase, transferase/inhibitor
total genus 47
structure length 143
sequence length 152
ec nomenclature
pdb deposition date 2016-07-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5krtA00
5KGXA 1A5WA 1KTQA 2YKMA 4FW1A 5FRMA 3KLEA 1WSHA 4KHUA 4RW8A 5HLFA 1HRHA 1QE1A 3LALA 1YTUA 3VQ5A 1RT2A 3AVHA 3QIPA 4CEDA 4JRPA 4N47A 4ELVA 4CJQA 1YVUA 3HPHA 4KTZA 2P5OA 5C25A 3NGYA 5J2MA 1CLQA 4C8MA 3K5MA 3C94A 1HNIA 2KFNA 3RWUA 1VSLA 2B6AA 3LANA 3HPGA 5DMRA 2YNGA 4DTXA 1ZBIA 1TK0A 4OPJA 2Y1JA 4YNQA 3I0SA 4M3RA 4CHZA 4UQGA 4ZTFA 4C8LA 2A1SA 2PZSA 2OPSA 4DFMA 1J54A 1KLMA 4CFBA 1U47A 2QKKA 1ASWA 4W5NA 3O3HA 3PO4A 3ISNC 4BE1A 1S1VA 1D9FA 2XRIA 3AVNA 4B8AB 4N41A 3OS0A 2RN2A 3VQ8A 4E7LA 3U3YA 4IKFA 3FFIA 1FXXA 3C6TA 3DRSA 4FJ7A 4NYNA 4CJ4A 3IAYA 2OZSA 4BE0A 5JS2A 1UA1A 2Z1JA 4FJ5A 3SZ2A 1S9GA 1GOBA 3AA2A 4FK4A 4IG0A 3IS9A 4LSLA 3HJFA 3CG7A 3ZSVA 2HHQA 5HP1A 4DTNA 1NK7A 4QAGA 4E0DA 4F2RA 5C24A 3IG1A 3AVMA 2Z1IA 5J2PA 3T3FA 4M42A 4M45A 4CJVA 2B4JA 2ITGA 1NKBA 2G8UA 4FLZA 1HMVA 1S1UA 4B9MA 4CCHA 4M3UA 4RW7A 1R0AA 1UAXA 5CYQA 2HMIA 4PWDA 1B9DA 4BWMA 2FBXA 3K5NA 4PA1A 2OYQA 1W9HA 1VSFA 4B9LA 3B6PA 2BE2A 4HUGA 1TK5A 1NKCA 2XO7A 1T7PA 3MEEA 1HNVA 3AO1A 4LY7A 4E19A 3HPOA 4BDYA 2X74A 1RBVA 1T8EA 2PYJA 5JS1A 1UOCA 1TL3A 3ITHA 3SPYA 4CFAA 3OJSA 2F8SA 1IG9A 1BHLA 1YT3A 1HYSA 2DY4A 5FDLA 1JLCA 5SZTA 3V1OA 1G15A 3OYLA 5KGWA 3OYHA 1RTJA 3DOKA 3U6FA 1JLAA 4IDKA 4DSIA 3OYKA 4JS4A 3VQAA 4CGJA 4HUEA 1EX4A 4DS4A 5K14A 1TK8A 4FJXA 4Z4EA 3WNEA 4EP5A 3SQ0A 4CEEA 3VA3A 4M41A 3KIOA 4DQQA 1C1BA 5J2NA 3QEPA 1C6VA 4J2AA 5HRPA 1BISA 4OGCA 2Z1HA 4K8XA 1JLQA 1RTHA 2YNFA 3CFOA 3DYAA 4MQ3A 2FBYA 5EU7A 3F73A 1SKRA 1D8YA 1QSLA 3AVJA 5DK5A 2GBZA 2KW4A 1W0HA 1Z26A 4CJPA 3T19A 3V9XA 5HRNA 3BDPA 1CXUA 1C0UA 4LH5A 4AHSA 3OYGA 2YHAA 3KTQA 4B9TA 3DLKA 3DOLA 2W42A 1B9FA 3ZSOA 4DLEA 4DS5A 1BL3A 3HM9A 4AHTA 4DTMA 3PX4A 3ASMA 1TVRA 3TR8A 4BDZA 3RMDA 2G8HA 4B9VA 1X9MA 3VQEA 4PQUA 4F8RA 3L2QA 1WAJA 3P1GA 3K57A 3PX6A 2KZMA 3NGIA 2E6LA 3SUPA 4FLYA 2G8FA 2KFZA 4CFCA 4DQRA 2HNZA 3U3GA 4I2PA 4DSKA 3HP6A 2Z1GA 4CF8A 4FLWA 1S5JA 1JLBA 3V9WA 1HYZA 2VWJA 1NJZA 3SJJA 3V1RA 1D9DA 3LAKA 1RT1A 1EP4A 2HHUA 2HHXA 1A5VA 3NH2A 3RR8A 4L8RB 1XWLA 2WONA 3K59A 2OA8A 3NF7A 1NJXA 2G8IA 3TWHA 4BDPA 3KLHA 2HB5A 2YHBA 4W5TA 1VSMA 3D0PA 4HVJA 1WLJA 4M3XA 1S6QA 2R7YA 5I3UA 4KRFA 2HVIA 4F4KA 4EP4A 1RNHA 2I5JA 3AA4A 3P83D 1RT5A 1TGOA 3NF8A 4CFDA 5J2QA 1DTQA 1NOYA 4FZYA 3DLHA 3KLFA 3K5OA 3L2VA 1FKPA 4Z4CA 1S9EA 4O0IA 3C95A 4W5QA 4FXDA 2GV9A 2D0CA 1QHTA 3MEDA 3LZJA 4CGHA 1IKXA 1NK9A 4OGEA 3LZIA 1T05A 1KLNA 1SL2A 3AVFA 4KHYA 3AVCA 4KHSA 1RBUA 4F3TA 4QCLA 1XHXA 4CESA 1J9AA 1I39A 3LP1A 3V1QA 4E7HA 2YV0X 2ZE2A 1L3SA 3SUQA 3KK3A 2XHBA 1RDCA 3OYFA 1K6YA 1NOZA 4LD0A 2VG6A 4I2QA 3ZSQA 3PV8A 3SCXA 4KFBA 1SL0A 3AVBA 3I0RA 1J5OA 3RRGA 3CFPA 4B3OA 2FC0A 4CF9A 2HHTA 1C0TA 1WSEA 3SQ1A 4FJJA 4CJEA 1ASVA 3L2WA 4CEOA 3KK2A 3QERA 1EKEA 2WOMA 3HO1A 1NJYA 2F96A 3RRHA 3DM2A 4CJLA 1WSIA 2X6NA 4CEBA 3G0ZA 5KRSA 1F21A 4KI4A 3MEGA 4I9LA 2XY6A 1L5UA 4NCBA 4M3TA 4DSLA 4FLTA 4OJRA 4FLVA 4DU4A 1NK0A 3UIQA 4J2BA 1JXEA 3VQ9A 2Y1IA 1XC9A 1KVCA 3DRRA 3ZCMA 4CIFA 3LP2A 2G8VA 4CJ3A 4CGIA 4DTRA 1TKZA 3M8SA 1Y97A 2RF2A 4HHTA 4DF8A 2BANA 2QKBA 4CF1A 4E89A 4Z4HA 5J1EA 4DFJA 3EYZA 4O44A 3MECA 3KK1A 4TSXA 2QK9A 4KTQA 3BGRA 2ZQBA 1BI4A 4FJHA 2OPQA 4ID1A 4NCGA 5KI6A 4LH4A 1WSFA 2OZMA 3K2PA 3TAPA 1BIUA 3AVAA 5I42A 3OYAA 2AJQA 4CERA 1S6PA 4GMJB 3LWLA 2XY7A 2FBVA 3VQ6A 2DFEA 1RDDA 4FZXC 1HQEA 3QEVA 3RMBA 4OVLA 4DG1A 3QEXA 1GOCA 2ZD1A 4RW6A 4CK3A 1LW0A 2DTUA 2G8KA 1VSEA 4KTWA 2F8TA 4B08A 4XIUA 1C1CA 2X6SA 4CHNA 4FJIA 4FK0A 3F9KA 1WNSA 1RBTA 4DSJA 1XHZA 1VSJA 1CZ9A 3HL8A 3WNHA 3HK2A 1S1XA 3LP0A 3M8PA 3KD1E 4JS5A 1JL1A 1DTTA 1VSIA 1TAQA 3OYJA 2NUBA 3AO2A 3AO3A 1VK0A 5CZ2A 1L3VA 1RCHA 1X1PA 3QLHA 1JLGA 1SKSA 3CM5A 1TKDA 3HP9A 3HVTA 3VQCA 5CY4A 4H4MA 4CIGA 3AVLA 3ZSYA 2EX3A 1A5XA 4KV8A 2O4IA 3NF9A 4Z0UA 4C8OA 4JLHA 4M3YA 1IO2A 3L3UA 1RT7A 4C8NA 1QTMA 4OKKA 4CJFA 3SV4A 2XY5A 1UA0A 1VSKA 2LSNA 4N5SA 3RMAA 3AV9A 4RW4A 1S1WA 3ZSRA 3WNFA 2P1JA 3LPUA 1U04A 4DSFA 4HTUA 3ZT4A 4DTJA 1L3TA 1Q9YA 1TAUA 1RDAA 2ETJA 3L2RA 1ZBHA 3OYDA 4DU1A 3VQBA 3SQ4A 2JGUA 4B8CA 4FCYA 3KKRA 3AA5X 2KQ2A 3HXMA 1IKVA 4YFUA 4OLAA 3PX0A 3NCIA 4CHQA 1BGXT 2IOCA 3B6OA 3CYMA 4CEQA 5E41A 4E3SA 1RBRA 4O5BA 3NGZA 4PUOA 1CZBA 4FJLA 3M8RA 3D45A 4QOZB 1LAWA 3LWMA 2RKIA 1YTAA 4CF2A 4DQPA 5SWMA 3K58A 1J53A 1EXQA 1D5AA 3QESA 4J2DA 2KZZA 1LWEA 4N76A 3JYTA 4RW9A 2HVHA 3V9UA 1O1WA 1XI1A 3LP3A 4LSNA 3NDKA 3DLGA 3NFAA 1JLEA 3NF6A 3LAMA 1IKYA 4GW6A 3TAMA 3EZ5A 1KFSA 3AA3A 3VQ4A 3NH0A 3V81A 1T03A 4ELTA 3QETA 1WSGA 3OYIA 3TANA 1X9SA 4KO0A 4FJ8A 4CECA 2D0BA 3OYEA 4DTSA 5HROA 1QS4A 2OPRA 4I7FA 1NKEA 4DWIA 1TV6A 3THVA 1IKWA 4CHYA 5KRTA 1HJRA 5HBMA 3HT3A 3MXMA 2HHWA 3DLEA 4KKOA 4Q5VA 3EY1A 4FLUA 4IFVA 2P51A 1L3UA 1VSHA 4ICLA 1KFDA 1WAFA 2PY5A 3MAQA 3O3GA 1TL1A 4CK1A 2GUIA 3RR7A 3L3VA 1FK9A 1U48A 3QO9A 1U49A 4W5OA 1I3AA 1IH7A 1LWFA 4H4OA 3I8DA 3V9SA 4CIEA 1KVBA 4OKJA 4KB0A 4MFBA 3VA0A 2Q3SA 1ZBLA 2D5RA 3TAEA 2YNIA 1ZBUA 4CEZA 1WSJA 3L8BA 3MXJA 4ID5A 1U45A 4CEFA 1QSYA 4IG3A 1LW2A 2OPPA 1N6QA 4B9NA 4F3OA 4K8ZA 3TABA 4CJUA 4KHWA 4O0JA 3HSTB 2DFHA 1DLOA 1BI4B 2QXFA 4RG8A 4CJSA 4GVMA 1KVAA 1QQCA 3PUFA 4FM0A 3C6UA 2IAJA 4CJTA 1S1TA 4FVMA 4CJKA 4FJ9A 1RT6A 3AO4A 4FYDA 1HYVA 4DU3A 2BDPA 1HPZA 4B9SA 4F2SA 2IDOA 3OVNA 3TI0A 4KHNA 3O4QA 4DMNA 2HHSA 5FROA 1JKHA 2HHVA 1LWCA 3AVKA 4BACA 4DSEA 3OYBA 4FM1A 3SYZA 1GOAA 1RDBA 3ZSXA 5KTQA 3ZT2A 1KCFA 4E7KA 3MXIA 3ULDA 1C0MA 3S3NA 1WN7A 1LV5A 3VQ7A 1KRPA 2D0AA 4CGGA 5CYMA 3VQDA 3TAQA 4AH9A 3ZSZA 1U4BA 4DTOA 4O4GA 1MU2A 4DF4A 4G1QA 4Y1DA 4DFPA 2X78A 1NK5A 1RBSA 5HRSA 1BQNA 4J2EA 1ZYQA 3LPTA 4CK2A 4I9QA 1BIZA 4CHOA 1RT4A 4KB1A 4Q0BA 1HQUA 4EZ9A 1JLFA 3A2FA 4FW2A 3DI6A 4NCAA 4AHRA 4B9UA 1LAVA 4AHVA 4DFKA 4FLXA 3TAFA 2E6MA 4FJMA 3OYNA 2A1RA 4R5PA 2ATQA 2KTQA 1SKWA 1SL1A 3H08A 3S3MA 3ZT3A 5CZ1A 1JL2A 5HRRA 5T7BA 4NYFA 3P5JA 4CGFA 3ZT0A 4E1MA 1ITGA 3DMJA 3QINA 4CJRA 3NHGA 2YKNA 3NAEA 1BCOA 3QEWA 4DQIA 3VQQA 2RPIA 3OYMA 1NK8A 3VN5A 2B5JA 3DRPA 1KSPA 3O4NA 3VQPA 3KLGA 3NBPA 1TKTA 1RTIA 4AHUA 3CFRA 3V6DA 3NH1A 3HVRA 2E4LA 3KKSA 3WNGA 4CF0A 3OJUA 4HUFA 1CXQA 3M8QA 4DTPA 3SUNA 4H8KA 4JRQA 4FJKA 3RTVA 1N5YA 4DTUA 4Y1CA 1X9WA 2BGGA 3KLIA 3JSMA 4AILC 1SV5A 4ZHRA 3LDSA 1RTDA 1NJWA 3IRXA 2PYLA 4CHPA 2O4GA 4ELUA 3SPZA 2IC3A 2IGIA 1Z25A 2VWKA 3T1AA 3OYCA 3KJVA 1B92A 3NE6A 4AHCA 1C1AA 4FJNA 4Z4GA 3OS1A 1Q8IA 3ZT1A 4HCBA 1QSSA 2EHGA 4E1NA 3V9ZA 2YNHA 2DFFA 1RILA 3KD5E 3ALYA 3AVIA 1NK4A 4E7IA 4W5RA 4DLGA 3V4IA 2VG7A 4KI6A 3G10A 3S9HA 3TARA 4EZ6A 1EETA 2HNDA 3SQ2A 3AVGA 3HYFA 4CJWA 4M3WA 4Z4FA 1RT3A 4CJ5A 4FM2A 4FJGA 4HCCA 5D3GA 1NK6A 3K5LA 3QNOA 1FKOA 4KAZA 2FBTA 3E01A 5C42A 3QNNA 3S3OA 2VG5A 3PY8A 4KHQA 4FZZA 3PO5A 4Z4IA 1BCMA 4BWJA 4KPYA 3SNNA 2HW3A 1ZBFA 3AO5A 4N56A 3OS2A 4CGDA 2XY8A 4ZTJA 3O3FA 4PY5A 4IBNA 3OY9A 2HNYA 3SUOA 2JLEA 1VRUA 3DLBA 1VRTA 1REVA 3TAGA 3QEIA 1TKXA 5FRNA 4C8KA 4WE1A 4BE2A 3ZSWA 4O55A 4FK2A 1VSDA 3RMCA 3SV3A 2P5GA 4OPKA 1BQMA 4M3ZA 3L2UA 1JXBA 2IS3A 4OKEA 4CE9A 4IFYA 1Q9XA 3DLRA 3SI6A 4E7JA 3QIOA 4KREA 3CM6A 3CQ8A 1ASUA 1UWBA 4OLBA 1SUQA 4DQSA 2G8WA 4CEAA
chains in the Genus database with same CATH superfamily
5KGXA 2QWQA 3CJ7A 3KLEA 4O5FA 2NRRA 5A2QO 3BZKA 4RW8A 3EO3A 2VCPA 3QIPA 4CEDA 4JRPA 2P5OA 4KTZA 1VHXA 4XH4A 5C25A 1CLQA 4C8MA 4M7XA 2QI2A 1VSLA 1ZXOA 2B6AA 1HKGA 1U2VA 2YNGA 4OPJA 4CHZA 4C8LA 3TSQA 2ASOA 2A1SA 2PZSA 2OPSA 1I94K 5ADXH 2GTDA 2XRIA 3VQ8A 3U3YA 4JKAA 4CJ7A 1FXXA 3DRSA 3WQUA 5AZIA 4FJ7A 2W40A 4CJ4A 4FJ5A 5JS2A 3WQTA 1S9GA 1GOBA 3EL2A 4IG0A 4LSLA 3H1QA 2HHQA 2FSNA 5JICA 4FSVA 4B3TK 4E0DA 3AVMA 4M45A 2ZF5O 4JI2K 2B4JA 4FLZA 1S1UA 2GX9A 4B9MA 2YHXA 3PIOL 1R0AA 1UAXA 5CYQA 4GV9A 2OYQA 3IFRA 1GLBG 1VSFA 4GVEA 4B9LA 1YF5L 1NKCA 3CD6N 4BC2A 5BRHA 4E19A 1RBVA 4KH5A 3VF2A 3ITHA 2A3ZA 3RVCA 2F8SA 1HYSA 4DQ8A 1JLCA 3V1OA 2H3GX 5KGWA 3DOKA 3U6FA 1JLAA 4FO0A 4JS4A 3VQAA 5BR8K 1TK8A 4B1YB 1V4SA 3WNEA 4CEEA 3VA3A 3QEPA 1C6VA 3KWIA 5CE3A 1WBDA 1JLQA 5EU7A 2FBYA 5MLCQ 4WQ4A 5DK5A 2KW4A 3THYA 3T19A 4AHSA 3TTDA 3OYGA 2NZTA 4B9TA 1RDUA 5AQLA 3QBXA 4K43A 3HM9A 3VF6A 4BRAA 3J7ZO 1X9MA 3EE8A 4F8RA 1WAJA 3PX6A 4CFCA 3MCAB 2HNZA 3HI0A 4NB4A 2VWJA 3SJJA 1D9DA 3LAKA 3KVGA 1T44A 2HHUA 5BPMA 4KHPK 4L8RB 3CIPA 1XWLA 3K59A 3Q7CA 1NJXA 2YHBA 3WEEA 3BF1A 4HVJA 2R7YA 5KQDA 3HTVA 1NOYA 2YCHA 3DLHA 4FXDA 3OW2M 1QHTA 3PSFA 1C0FA 3LZIA 1T05A 1U2VB 3LM2A 4KHSA 4QCLA 1XHXA 4CZFA 1J9AA 4E7HA 3CXCM 1RDCA 1K6YA 3P39A 4DUZK 4KFBA 3UKRA 4CF9A 3SQ1A 5IWAK 3DAWA 4WQ5A 3HO1A 1NJYA 2F96A 5DM6L 5AZIB 4CJLA 3G0ZA 3MEGA 4I9LA 1ZBSA 1L5UA 4NCBA 4FLVA 3UIQA 1JCEA 2Y1IA 1YAGA 3DRRA 3ZCMA 4CIFA 1XMQK 3W3DA 1G99A 1IBMK 4CGIA 4HHTA 4CVNE 4CF1A 4CBWA 4DFJA 4BREA 3MX5A 4TSXA 2ZQBA 2OPQA 3TAPA 3R1XA 5M1NA 4GMJB 3VQ6A 5AQKA 3RMBA 3AARA 3O9TA 3CC7N 4DV0K 4KH6A 5LMNK 4KTWA 3CJCA 2X6SA 4DSJA 3VPZA 3FZHA 1QHAA 5CZ2A 3AO2A 3AO3A 1L3VA 1RCHA 4PKIA 1JLGA 3THYB 3CM5A 2A6AA 3I33A 2NRTA 1TKDA 3QICA 3MWTA 3ZSYA 4BC4A 2NLXA 3H3OB 1IO2A 2NRVA 3L3UA 1RT7A 2QWOA 3FZMA 3HRGA 4OKKA 3ZX2A 4CJFA 3Q7BA 1Q86O 1UA0A 2LSNA 4CZGA 4N5SA 4RW4A 3ZSRA 3WNFA 3SAFA 3VERA 4CD1A 1RDAA 5C10A 2JGUA 1NGFA 2OTJN 2KQ2A 3SMSA 3QFPA 4BRPA 3NCIA 4CHQA 1VQ8N 1MWKA 2IOCA 4ISEA 4JI1K 2VGMA 5E41A 2Q31A 3D2FA 1S72N 3M8RA 4C1NK 3D45A 4QOZB 3WEEB 1KAXA 3BY5A 2RKIA 5AQNA 1YTAA 3EKSA 4DQPA 1NGJA 3A5OC 3ULEA 2A41A 4EHTA 1O1WA 3LP3A 4LSNA 3NDKA 1IKYA 1KFSA 3AA3A 3VQ4A 3OYIA 4MO4A 1X9SA 1T6DA 2OTLN 3UKRB 5HROA 1NKEA 2IVNA 1TV6A 4Z94A 1IKWA 1HJRA 5HBMA 3EY1A 4A5BA 3QB0A 1L3UA 2PY5A 2UUCK 3O3GA 1QQNA 1TL1A 3TTCA 4WFAL 3L3VA 1U48A 3QO9A 1U49A 3V9SA 3ENBA 4OKJA 2P9NB 3P38A 4KB0A 1QVFM 3TAEA 1ZBUA 3L8BA 1VQMN 1U45A 4CEFA 4KHWA 3TABA 4CJUA 4O0JA 2HBKA 4CJSA 4GKKK 1QQCA 1HJOA 2IAJA 2FXUA 1S1TA 4H0YB 1NGCA 4CJKA 4FJ9A 1BA1A 2P9PA 5M1OA 5M1FA 4FYDA 1HYVA 4HWIA 4NLCA 2BDPA 1DEJA 1HPZA 4B9SA 4KHNA 4M7YA 2ZGZA 2HHVA 2Q1NA 2IIRA 3SYZA 1GOAA 4I6MA 3ZSXA 4E7KA 1KCFA 5H1SQ 3ULDA 4AQYK 2O8CA 4DR4K 1LV5A 1KRPA 4YORA 4FL9A 4LF8K 3DLLL 2X78A 2VQEK 2BTFA 4MO5A 4CK2A 3LL3A 4JKCA 1BIZA 4CHOA 1RT4A 5BREA 4Q0BA 1VQLN 4EZ9A 3EEQA 4AHRA 1LAVA 2E2PA 2E6MA 1VQNN 1LOTB 2P9LA 5CZ1A 5HRRA 4BRQA 1VAZA 4E1MA 3DMJA 2ZJQL 2O8FA 3NAEA 1BCOA 1NK8A 3I56N 1ZC6A 3CQYA 3O4NA 3VQPA 4DHYA 4IWVA 1RTIA 3V6DA 3D2FB 4UY8O 3WNGA 4CF0A 3OJUA 4HUFA 4JKFA 1CXQA 2DPNA 4DTPA 1GLLO 3ULEB 4YDUC 4Y1CA 5AQJA 2BGGA 1RTDA 1SV5A 2PYLA 4JEPA 1EWRA 2VWKA 3NE6A 1QSSA 1HKCA 1BDGA 4CZLA 4IO9L 3ALYA 3AVIA 5AZJA 1BUPA 4E7IA 4W5RA 4DLGA 1NG9A 3G10A 3S9HA 5GAEP 4FM2A 2P9IA 3E1YA 1Q7YO 5D3GA 3CCLN 3QNOA 5C42A 2YX6A 2P9KA 1BCMA 5EX5A 3SNNA 5EXWA 4CGDA 2XY8A 4ZTJA 3C0BA 4PY5A 2E20A 2JLEA 1SAZA 3K9JA 3TAGA 3PLAA 1TKXA 5FPEA 4DR2K 3ZSWA 4LFCK 5KPZA 4OPKA 1BQMA 3UKUA 2F4VK 4CE9A 4IFYA 3HBTA 3SI6A 3QIOA 3QDKA 2P9PB 1CZAN 1ASUA 4AF1A 4DQSA 2G8WA 5M1PA 5AJ3K 3D7EO 4I6MB 4DCHA 1Y64A 2F9WA 1QE1A 2O8CB 1YTUA 3D6RA 3SK3A 5FLXO 3LDQA 4YOTA 2YJEA 3VEOA 1YVUA 3HPHA 3IUCA 3NGYA 3A5LC 2WFBA 2KFNA 2QM1A 1TK0A 2CGLA 3O9RA 2V52B 1K73O 4M3RA 4UQGA 4ZTFA 4K41A 1KLMA 1U47A 2YJFA 1ASWA 3O3HA 4WQ4C 1S1VA 4HTLA 4IKFA 4CD3A 3HSCA 5TKYA 2JWLA 4NYNA 2P9LB 3SZ2A 1YUWA 3BEXA 4WCEL 3O8MA 1XUPO 2UUAK 2E5LK 2O8FB 4DTNA 3C7NA 1N36K 4JD2A 1ATNA 3IG1A 4BRFA 2G8UA 2ITGA 4CCHA 3ENOA 4K42A 3L6QA 2BE2A 1TK5A 1T6CA 4ILGB 2XO7A 3MEEA 1T7PA 1HNVA 4LY7A 4A61A 1QVGM 5ADXA 1T8EA 1UOCA 4CFAA 4FPAA 2DY4A 5SZTA 1G15A 1RTJA 3WXJA 1EX4A 1N32K 2O8BA 4EP5A 5AZJB 4M41A 4J2AA 1C1BA 1BISA 2Z1HA 5AQGA 3DYAA 1D8YA 3F73A 1YIJN 1SKRA 2P9IB 1ESVA 3AVJA 3CCMN 1W0HA 2UXCK 2QW9A 4YHHK 2ZJRL 4DR1K 3HOSA 3C6AA 4CZJA 2P9KB 3VTHA 2QEXN 4DLEA 4DS5A 4GV6A 4DV1K 1BL3A 4DTMA 1X3MA 1NGDA 1TVRA 3CJ9A 3VEVA 2KZMA 3VGKA 4EIAA 1KAZA 3NGIA 3SUPA 2KFZA 2EWSA 3O9UA 4I2PA 4DSKA 3UKUB 2Z1GA 1S5JA 1JLBA 4O8UA 1HYZA 3P31A 1RT1A 2AP1A 4QS9A 2FSJA 2KKZA 2OA8A 3NF7A 2G8IA 3TWHA 5CHIA 4BDPA 2HB5A 4BC5A 1VSMA 3SAHA 4A5AA 1NNEA 3J7AP 2PAVA 3H45C 5C2DA 3P83D 4FZYA 1RT5A 5AQQA 3CC2N 3KLFA 3K5OA 3L2VA 1S9EA 3A5NC 2FLOA 2NRXA 4C1NI 3I55N 2W6LA 1RBUA 5AQWA 4F3TA 1I39A 3V1QA 4IO8A 3CPWM 2YV0X 2KLAA 3SUQA 3KK3A 1EQYA 2XHBA 4I2QA 3ZSQA 3SCXA 3PV8A 3I0RA 3CFPA 3FR0A 3EKUA 1WSEA 1ASVA 4JKGA 4CEOA 3QERA 1EKEA 2WOMA 2YI1A 5B8HA 2E2OA 4JKEA 4WYBA 3KZBA 1F21A 2VYPA 2XY6A 2CGKA 4J2BA 3VQ9A 1X9JA 2QXLA 2G8VA 4BRCA 3C7NB 1TKZA 4JD2B 4GKJK 4DF8A 2BANA 4Z4HA 4O44A 3KK1A 2QK9A 2QWNA 1BI4A 4FJHA 3MN9A 3C65A 4ID1A 3NVMA 5KI6A 4AM7A 2A40A 2OZMA 3G25A 1NJIO 1S6PA 2XY7A 5F0XA 2DFEA 3WXIA 2NRWA 4FZXC 4OVLA 2ZD1A 2HHHK 4CI6A 4CHNA 5LJWA 2O8BB 3F9KA 1T3VA 1VSJA 3HK2A 1S1XA 3KD1E 5C12A 4JS5A 1TAQA 2NUBA 1VK0A 3CCQN 3IKMA 1BG3A 5AQFA 3VQCA 4CIGA 1A5XA 4B3MK 4Z0UA 3FLCO 4M3YA 4JLHA 2UUBK 1JCFA 2CH5A 4NXNK 5M1KA 2P1JA 4DV5K 4LF9K 4DU1A 3VQBA 3SQ4A 4FCYA 1IV0A 5BN9A 3AA5X 5LJVA 1IKVA 4YFUA 2D1KA 2HF3A 3B6OA 1OH8A 1RBRA 4FJLA 1RDWX 1TYQA 1WOQA 5BRDA 2HBMA 4FWQA 4FOIA 4J2DA 5KPRA 2KZZA 2PBDA 3TTFA 3LDOA 1XI1A 3NF6A 3NFAA 3OBWA 5AQHA 4WFBL 4X62K 4GW6A 3V81A 4J8FA 3U9DA 3TANA 3O80A 2D0BA 4BRLA 4DWIA 3GG4A 3J80O 5E84A 4RCHA 3MXMA 5KRTA 3E9PA 4K0KK 3DLEA 4JKGB 4M63C 5EVZA 4IFVA 2P51A 4JI6K 3FZLA 1VSHA 1KFDA 3JXUA 3ZX3A 1IH7A 1VQ7N 1LWFA 3I8DA 1KQSM 1KVBA 1OH7A 2Q3SA 3WUHA 2D5RA 2YNIA 4CEZA 1Q18A 4LF5K 1YXQA 1QZ5A 1LW2A 2DFHA 4RG8A 1BI4B 4GVMA 3CCJN 4FM0A 3C6UA 4CJTA 4FVMA 3DXMA 3AO4A 1D4XA 2E88A 4X66K 4F2SA 5LY3A 4B3SK 2I7NA 3O4QA 5FROA 1JKHA 1LWCA 3A8YA 4JHDA 3ATUA 2BH1A 5KTQA 3ZT2A 3MXIA 3O9SA 1Q81O 1OKJA 3VQ7A 3R6MA 3CPEA 5CYMA 4CGGA 1U4BA 4DTOA 4FVUA 3ID6A 4G1QA 4Y1DA 4DFPA 2BUPA 3CERA 1NK5A 5HRSA 1DGKN 1NGBA 3ZEUA 4R79A 3ZETA 3W0LA 3DI6A 4NCAA 4B9UA 4AHVA 3B8AX 3TAFA 1VQ5N 3OYNA 5AQSA 1WBBA 4YY3K 4NYFA 2GWKA 4CGFA 3ZT0A 4CJRA 3NHGA 3QEWA 4DQIA 3T7ZA 3VQQA 4CW7B 3PIPL 3ENHA 3VEXA 3NBPA 4GY2B 1Z05A 1TYQB 2E4LA 5GINA 1U6ZA 3M8QA 4JRQA 4FJKA 3CCSN 4DTUA 3KLIA 4AILC 4ZHRA 2HBJA 4BRGA 4CHPA 3THWA 1OH6A 2UXBK 4ELUA 3SPZA 2E2NA 2IC3A 2IGIA 1Z25A 2NRZA 2HSTA 1C1AA 4FJNA 3OS1A 1Q8IA 4FWKA 3V9ZA 4WFNL 3O1WA 4QS8A 2IVOA 2HNDA 3WT0A 4Z4FA 4M3WA 1RT3A 4HCCA 3WXKA 1N34K 2VG5A 4Z4IA 3J81O 3JAMO 5ELZA 3DLBA 1TUUA 1VRTA 1REVA 3QEIA 4JYAK 1BOTO 4C8KA 4WE1A 2Q2RA 4BE2A 4FK2A 1VSDA 2P5GA 3SV3A 4XH5A 1Q9XA 3DXMB 3QFUA 1MA9B 3SAGA 1C0GA 2QWPA 4JI3K 4JNEA 1A5WA 1KTQA 4JHDB 4KHUA 3LDLA 3LALA 3P4IA 1RT2A 3AVHA 4AM6A 2J4RA 3C94A 1HNIA 3RWUA 1H1VA 1ZBIA 5AQRA 2Y1JA 3K0SA 3ZEUB 3ZETB 3E66A 4DFMA 4W5NA 5KQ8A 5F2RA 4H5VA 5AQOA 5DM7L 3OS0A 2RN2A 4YOUA 4ISFA 3C6TA 1W2BM 1UA1A 2Z1JA 3L4QA 4BQLA 3AA2A 1K8AO 3GBTA 3WXMB 2Z1IA 4DV7K 2P9UA 3T3FA 1NKBA 4M3UA 2HMIA 2A42A 1B9DA 2FBXA 3RSEA 4A62A 1E4FT 1W9HA 4BR7A 3K5NA 3B6PA 4BRKA 1R59O 2PYJA 2X74A 3TSPA 4IZ9A 3VMFB 1IG9A 3THWB 1YT3A 3OYLA 3TSUA 3VOVA 4IDKA 4BRDA 4CGJA 2HOEA 4DS4A 4JK8A 3SQ0A 3KIOA 3IDHA 5J2NA 3BP8A 5AQYA 4K8XA 2YNFA 3CFOA 3CCUN 1QSLA 3O1BA 2GBZA 1J5EK 1IBLK 3V9XA 5HRNA 3BDPA 1CXUA 1C0UA 4LH5A 2YHAA 3VTIA 4CZKA 3TU5A 3VENA 1N33K 4DR7K 1B9FA 2W41A 4BDZA 4RTFD 4PKGA 2G8HA 4PQUA 3L2QA 2Q36A 2NNWA 2E6LA 4DQRA 3U3GA 4CF8A 4FLWA 1NJZA 2GWJA 3T1YK 3A5MC 1EP4A 2HHXA 1A5VA 3NH2A 3H6EA 2WONA 3AY9A 1YI2N 1WLJA 3O6WA 1S6QA 3CETA 4F4KA 1YJWN 4EP4A 2I5JA 3AA4A 4CFDA 3HJFA 5J2QA 1X3NA 3NF8A 1VQ4N 4Z4CA 4BR2A 3C95A 4W5QA 2D0CA 3VGLA 1IJJA 3MEDA 3LZJA 4CGHA 1IKXA 4OGEA 3R9PA 4CZIA 1KLNA 1SL2A 4BRIA 3AVCA 1KAYA 4F9OA 1XC3A 3LP1A 1L3SA 4JK9A 3OYFA 4LD0A 2VG6A 5FPMA 3RRGA 3AVBA 1J5OA 4DR5K 4FJJA 3BF3A 3T1HK 3VESA 3KHYA 3DM2A 1NU0A 1WSIA 1QZ6A 1NGGA 4GNIA 4H0PA 4FLTA 4OJRA 4DU4A 1NK0A 4CBXA 4BROA 5FPDA 1XC9A 2E1YA 5JLFA 4CJ3A 1DT9A 3M8SA 1HPMA 1Y97A 2RF2A 2QKBA 2P9UB 4H5NA 4FWNA 4E89A 5J1EA 4JI7K 3EYZA 3NVKA 4KTQA 4NCGA 2QTDA 1HUXA 2IVPA 3RSEB 4LH4A 1WSFA 1BIUA 3AVAA 4EHUA 3OYAA 2AJQA 4CERA 3LWLA 2FBVA 4A2AA 4BR5A 1RDDA 1HQEA 3QEVA 1GOCA 4RW6A 2DTUA 4O8KA 1VSEA 2F8TA 1GLDG 4B1UB 4B08A 1KC8O 1C1CA 4BR4A 4FK0A 1S3XA 1WNSA 3ZX0A 2WC9A 1CZ9A 3WNHA 3M8PA 3LP0A 5C15A 3CC4N 1JL1A 4H0TB 3OTOK 3O5BA 3MDQA 5GAGP 2ASMA 4PHTX 1WUAA 4JV5K 3M3ZA 3HP9A 4XH1A 5AQIA 4CZMA 4BRNA 4H5RA 4IXCA 1YJ9N 4KV8A 3U4LA 3NF9A 4H0OA 4C8OA 2D0PA 5FPNA 2PFUA 3DJCA 3SMPA 1DKGD 1VSKA 3FZKA 4BG9A 3RMAA 1S1WA 4DTJA 2RE2A 3LPUA 1U04A 4CZHA 4DSFA 5BR9A 1L3TA 4XEIA 1TAUA 3CJBA 4JKHA 3L2RA 3R8EA 3CMAN 2CGJA 4B8CA 3OA9A 3HXMA 1GLEG 5EY4A 2Q0RA 3ZYYX 4JKBA 4OLAA 3PX0A 3ZLJA 4CEQA 4E3SA 4O5BA 3U9ZA 3NGZA 3F9MA 4PUOA 1CZBA 3PSIA 1HNWK 3LWMA 3HM8A 1J53A 1D5AA 3QESA 3T69A 1LWEA 4N76A 3JYTA 4RW9A 1M1KO 3V9UA 1JLEA 3LAMA 4ILJA 3EZ5A 1NM1A 3GE1A 4ELTA 3NH0A 5AFUH 3QETA 1WSGA 3FE1A 4A2BA 4KO0A 4FJ8A 3OYEA 4DTSA 5KPTA 1QS4A 4BVPA 5GADP 4DV4K 4CHYA 3HT3A 1HNXK 4FLUA 1BO5O 1WAFA 2F7TA 3MAQA 4CK1A 2GUIA 3RR7A 1FK9A 3CCEN 2NRHA 3MX2A 4H4OA 4CIEA 4JI0K 1ZBLA 5BN8A 5HL7L 1WSJA 1XNQK 3MXJA 3J8AA 3SLCA 4K8ZA 4IG3A 1N6QA 1KD1O 3O4WA 5GAHP 3H1VX 1KVAA 3PUFA 2CH6A 3JS6A 1RT6A 4Y0WA 4DU3A 4KH4A 4IOCL 1YHQN 2HHSA 4DMNA 1KXPA 4FWPA 1XQSC 2E1ZA 4FM1A 4IOXA 1N8RO 3GOIA 1Z6RA 4BRHA 1W97L 1RFQA 3E9LA 4BG8A 1WB9A 3S3NA 4DR6K 1GLAG 2D0AA 3IMXA 3VQDA 3ZSZA 3ATVA 3AGKA 4A57A 1RBSA 3CF5L 1BQNA 1ZYQA 4I9QA 2YHWA 1HQUA 3VEYA 5AQPA 5AQTA 4DFKA 4FJMA 3MN6A 3N4QA 2D0OA 2A1RA 5C2FA 4R5PA 2ATQA 2KTQA 5LMUK 5AR0A 1Q82O 3H08A 3A0IX 3ZT3A 1JL2A 5JVHL 5JVGL 1QQMA 2I7PA 1EWQA 2YKNA 2RPIA 3OYMA 2B5JA 1KSPA 2ZM6K 4IJNA 3HZ6A 3NH1A 3KKSA 3HOTA 3SUNA 2QA4N 4X65K 1X9WA 2Q97A 4DR3K 1NJWA 1E4GT 2W6KA 4FOEA 3O9QA 3KJVA 3OYCA 4YOWA 1B92A 4AHCA 1V4TA 2F9TA 2EHGA 4E1NA 5I9EB 2YNHA 1RILA 2VG7A 4KI6A 3SQ2A 4MLHA 3AVGA 1OVQA 3NMUA 3R3LA 4CJ5A 4FJGA 1NK6A 4BC3A 3MK6A 3E01A 3QNNA 3S3OA 3PY8A 4KHQA 4FZZA 3KWGA 4BWJA 4NLBA 4DUYK 4YOVA 4MDAA 3F5TA 3AO5A 2FF3B 4IBNA 3OY9A 2HNYA 3SUOA 3VETA 3BZCA 4O55A 1ATSA 3RMCA 3L2UA 2WUSA 4OKEA 3DLRA 3MWPA 1MDUB 4FPBA 3CM6A 1M90O 4LF7K 1SQKA 2YKMA 4FW1A 1NLVA 5FRMA 1WSHA 3H46O 1SS6A 5HLFA 1HRHA 1YITN 2O8EA 1GLCG 2QWLA 5AQXA 3VQ5A 4GV3A 4N47A 3CI5A 4CJQA 4ELVA 4X64K 2HF4A 3FGUA 1K8KA 5J2MA 3K5MA 4DV6K 2AA4A 3G4SN 3LANA 3THXA 3HPGA 5DMRA 1VQPN 4DTXA 4YNQA 3I0SA 4MLEA 3I8BA 1J54A 4CFBA 2QKKA 3PO4A 3ISNC 4BE1A 2P9NA 1D9FA 4N41A 3AVNA 4B8AB 2UU9K 3SBTA 4E7LA 3UB5A 3VGMA 1HLUA 3FFIA 3IAYA 2OZSA 4BE0A 4H0XB 1ATRA 2V51B 5BPNA 4FK4A 3IS9A 2GELA 3CG7A 3ZSVA 3M6GA 4IEIA 5HP1A 1NK7A 4QAGA 4F2RA 3BUZB 5C24A 5J2PA 4M42A 4CJVA 3E9OA 2O8DA 1HMVA 1HNZK 4IDHA 3SJHA 4RW7A 3SBGA 2JWKA 4PWDA 4BWMA 4EZ6A 4PA1A 4HUGA 4U7BA 1BU6O 3AO1A 3HPOA 4BDYA 5JS1A 3SPYA 1TL3A 3OHRA 3OJSA 2GEMA 1NGHA 1BHLA 4JI8K 3CHWA 5FDLA 3OYHA 4BGAA 4DSIA 3OYKA 4HUEA 4FJXA 5K14A 4Z4EA 2YHYA 3VEZA 4DQQA 3J7YP 5HRPA 4OGCA 1RTHA 4MQ3A 1ILYA 3LM9A 4CJPA 1Z26A 4BQZA 1NMNA 3QBWA 3KTQA 3M5RA 3DLKA 3DOLA 2W42A 3ZSOA 3PX4A 5JMVA 4LC9B 4AHTA 2VQFK 3ASMA 3TR8A 1XNRK 1HX1A 2RHKA 4B9QA 3RMDA 4B9VA 4EFHA 3VQEA 3P1GA 3K57A 4OO1J 5C0YA 4FLYA 2G8FA 3DXKA 4KBOA 4L3QA 4JKDA 2VGNA 2GUPA 3HP6A 1GLFO 2A5XA 3V9WA 3V1RA 1XMOK 1GLJO 1EO1A 3RR8A 1OH5A 5AQMA 3O08A 3KLHA 1YJNN 4W5TA 3D0PA 4FWMA 2HVIA 4M3XA 4KRFA 3VEWA 5I3UA 3K9KA 2O8EB 4LFAK 1RNHA 4CBUA 2QWMA 1TGOA 3CCRN 1DTQA 1FKPA 4O0IA 1W7AA 1K8KB 1HR0K 2GV9A 1NK9A 4KHYA 3AVFA 3THXB 4CESA 2ZE2A 1NOZA 2FSKA 1SL0A 4IOAL 4B3OA 2UYTA 2FC0A 1NBWA 1C0TA 2HHTA 1JCGA 2KHOA 4CJEA 3L2WA 4A59A 3KK2A 4JK7A 3RRHA 4CEBA 2X6NA 5KRSA 4KI4A 4BGBA 4M3TA 4QS7A 4DSLA 1JXEA 3LDNA 1KVCA 3LP2A 4DTRA 1TUYA 1NWKA 3WXLA 2ZWHA 3MN5A 4JN4A 5IT9O 2O8DB 3MECA 4NO7A 4B1WB 3BGRA 4PL7A 3K2PA 5I42A 3ID8A 3OBYA 4E1JA 1S22A 4IJAA 3TPQA 3CJ1A 4DG1A 3QEXA 4OX9K 4CK3A 1LW0A 3D2EA 2G8KA 5AQZA 3F2KA 2E8AA 4XIUA 5BRFA 4FJIA 1RBTA 1XHZA 3HL8A 1YVNA 2E2QA 4JI4K 2QWRA 1DTTA 1VSIA 3OYJA 1X1PA 3QLHA 1SKSA 2HMPA 5LL6Z 3HVTA 2P9SA 4H4MA 5CY4A 3AVLA 4DV3K 4LFBK 2EX3A 2O4IA 1VQ9N 4G9ZA 4C8NA 1NMDA 1QTMA 3MCPA 3SV4A 5BPLA 2XY5A 4BVOA 3AV9A 4HTUA 3ZT4A 1VQ6N 1Q9YA 2ASPA 2ETJA 3DXKB 4YOXA 1ZBHA 3OYDA 4BR9A 4IEEA 3KKRA 5EOYA 3QMLA 1BGXT 3CYMA 1MWMA 3L4IA 1LAWA 4CF2A 5SWMA 3S41A 3K58A 1EXQA 1J6ZA 1NGEA 4B1XB 4RWTA 4H0VB 1VQKN 2HVHA 3DLGA 3TAMA 1T03A 2UXDK 4DB3A 4CECA 3FZFA 2OPRA 4I7FA 4FWLA 3THVA 3H3NO 2HHWA 4KKOA 4Q5VA 3CMEN 4ICLA 4EAHD 4U67L 4V19S 3G6EN 2ZGYA 4W5OA 1I3AA 4JAXA 3EE9A 4MFBA 3VA0A 2D4WA 3FFKB 3AGRA 4K25A 4ID5A 1QSYA 4F3OA 2OPPA 4BR0A 4B9NA 3HSTB 1DLOA 2QXFA 4WF9L 5AFUA 5M1QA 4B3RK 3CJAA 1NGAA 2IDOA 3OVNA 3TI0A 1BWFO 3AVKA 4DSEA 4BACA 3OYBA 1P90A 3D2EB 4MDBA 3AAPA 1RDBA 5HOOA 5JLHA 1O13A 3DWLA 1C0MA 1HKBA 1BA0A 1QQOA 5GIOA 1WN7A 1IG8A 3KK7A 4BRMA 4CZEA 1NGIA 4AH9A 5F1XA 2WTUA 3EZWA 3TAQA 4H03B 4OPAA 1RGIA 1MU2A 1P8ZA 4O4GA 4DF4A 4LF6K 2P9SB 1K9MO 4J2EA 2V7YA 3LPTA 4KB1A 4DKWA 1JLFA 1FJGK 2VWBA 3A2FA 4FW2A 4FLXA 2ZJPL 2FF6A 3CQXA 2OANA 2OCEA 1SKWA 1SL1A 5CR4A 3S3MA 5T7BA 4FWRA 3P5JA 4LF4K 2Q0UA 1ITGA 3GL1A 3QINA 4PKHA 2WBNA 3VN5A 3DRPA 3KLGA 1TKTA 4AHUA 3CFRA 2V7ZA 3AAQA 3HVRA 4C23A 4H8KA 3RTVA 1N5YA 4ISGA 3GDQA 3JSMA 4IFEA 5GIPA 3LDSA 3IRXA 3U8XA 1VQON 2O4GA 1IBKK 3T1AA 3LDPA 3MMVA 4Z4GA 3N4PA 3ZT1A 4HCBA 2DFFA 3KD5E 3VF4A 1NK4A 4JI5K 1SZ2A 4FWOA 5E26A 3V4IA 3MN7A 4ILHA 4H5WA 3TARA 4DV2K 1EETA 4WQ5C 4OPHA 3HYFA 4CJWA 1E3MA 4FWSA 3C6HA 3EN9A 3K5LA 3G71N 1JJ2M 3L0QA 1FKOA 4YOYA 4KAZA 2FBTA 2ITMA 3PO5A 4BY9C 4KPYA 2HW3A 4H5TA 1ZBFA 4N56A 3OS2A 5TKWA 5AQUA 4NXMK 3O3FA 1OVYA 1VRUA 1FW6A 3M1FA 3UE5A 1LCUA 5FRNA 3CCVN 4M3ZA 1JXBA 2IS3A 4E7JA 4PL8A 5AQVA 4KREA 3CQ8A 4B1ZA 1UWBA 4OLBA 1SUQA 4B1VA 4YDUA 4CEAA 2HBLA
chains in the Genus database with same CATH topology
5KGXA 1A5WA 1KTQA 2YKMA 4FW1A 5FRMA 3KLEA 1WSHA 4KHUA 4RW8A 5HLFA 1HRHA 1QE1A 3LALA 1YTUA 3VQ5A 1RT2A 3AVHA 3QIPA 4CEDA 4JRPA 4N47A 4ELVA 4CJQA 1YVUA 3HPHA 4KTZA 2P5OA 5C25A 3NGYA 5J2MA 1CLQA 4C8MA 3K5MA 3C94A 1HNIA 2KFNA 3RWUA 1VSLA 2B6AA 3LANA 3HPGA 5DMRA 2YNGA 4DTXA 1ZBIA 1TK0A 4OPJA 2Y1JA 4YNQA 3I0SA 4M3RA 4CHZA 4UQGA 4ZTFA 4C8LA 2A1SA 2PZSA 2OPSA 4DFMA 1J54A 1KLMA 4CFBA 1U47A 2QKKA 1ASWA 4W5NA 3O3HA 3PO4A 3ISNC 4BE1A 1S1VA 1D9FA 2XRIA 3AVNA 4B8AB 4N41A 3OS0A 2RN2A 3VQ8A 4E7LA 3U3YA 4IKFA 3FFIA 1FXXA 3C6TA 3DRSA 4FJ7A 4NYNA 4CJ4A 3IAYA 2OZSA 4BE0A 5JS2A 1UA1A 2Z1JA 4FJ5A 3SZ2A 1S9GA 1GOBA 3AA2A 4FK4A 4IG0A 3IS9A 4LSLA 3HJFA 3CG7A 3ZSVA 2HHQA 5HP1A 4DTNA 1NK7A 4QAGA 4E0DA 4F2RA 5C24A 3IG1A 3AVMA 2Z1IA 5J2PA 3T3FA 4M42A 4M45A 4CJVA 2B4JA 2ITGA 1NKBA 2G8UA 4FLZA 1HMVA 1S1UA 4B9MA 4CCHA 4M3UA 4RW7A 1R0AA 1UAXA 5CYQA 2HMIA 4PWDA 1B9DA 4BWMA 2FBXA 3K5NA 4PA1A 2OYQA 1W9HA 1VSFA 4B9LA 3B6PA 2BE2A 4HUGA 1TK5A 1NKCA 2XO7A 1T7PA 3MEEA 1HNVA 3AO1A 4LY7A 4E19A 3HPOA 4BDYA 2X74A 1RBVA 1T8EA 2PYJA 5JS1A 1UOCA 1TL3A 3ITHA 3SPYA 4CFAA 3OJSA 2F8SA 1IG9A 1BHLA 1YT3A 1HYSA 2DY4A 5FDLA 1JLCA 5SZTA 3V1OA 1G15A 3OYLA 5KGWA 3OYHA 1RTJA 3DOKA 3U6FA 1JLAA 4IDKA 4DSIA 3OYKA 4JS4A 3VQAA 4CGJA 4HUEA 1EX4A 4DS4A 5K14A 1TK8A 4FJXA 4Z4EA 3WNEA 4EP5A 3SQ0A 4CEEA 3VA3A 4M41A 3KIOA 4DQQA 1C1BA 5J2NA 3QEPA 1C6VA 4J2AA 5HRPA 1BISA 4OGCA 2Z1HA 4K8XA 1JLQA 1RTHA 2YNFA 3CFOA 3DYAA 4MQ3A 2FBYA 5EU7A 3F73A 1SKRA 1D8YA 1QSLA 3AVJA 5DK5A 2GBZA 2KW4A 1W0HA 1Z26A 4CJPA 3T19A 3V9XA 5HRNA 3BDPA 1CXUA 1C0UA 4LH5A 4AHSA 3OYGA 2YHAA 3KTQA 4B9TA 3DLKA 3DOLA 2W42A 1B9FA 3ZSOA 4DLEA 4DS5A 1BL3A 3HM9A 4AHTA 4DTMA 3PX4A 3ASMA 1TVRA 3TR8A 4BDZA 3RMDA 2G8HA 4B9VA 1X9MA 3VQEA 4PQUA 4F8RA 3L2QA 1WAJA 3P1GA 3K57A 3PX6A 2KZMA 3NGIA 2E6LA 3SUPA 4FLYA 2G8FA 2KFZA 4CFCA 4DQRA 2HNZA 3U3GA 4I2PA 4DSKA 3HP6A 2Z1GA 4CF8A 4FLWA 1S5JA 1JLBA 3V9WA 1HYZA 2VWJA 1NJZA 3SJJA 3V1RA 1D9DA 3LAKA 1RT1A 1EP4A 2HHUA 2HHXA 1A5VA 3NH2A 3RR8A 4L8RB 1XWLA 2WONA 3K59A 2OA8A 3NF7A 1NJXA 2G8IA 3TWHA 4BDPA 3KLHA 2HB5A 2YHBA 4W5TA 1VSMA 3D0PA 4HVJA 1WLJA 4M3XA 1S6QA 2R7YA 5I3UA 4KRFA 2HVIA 4F4KA 4EP4A 1RNHA 2I5JA 3AA4A 3P83D 1RT5A 1TGOA 3NF8A 4CFDA 5J2QA 1DTQA 1NOYA 4FZYA 3DLHA 3KLFA 3K5OA 3L2VA 1FKPA 4Z4CA 1S9EA 4O0IA 3C95A 4W5QA 4FXDA 2GV9A 2D0CA 1QHTA 3MEDA 3LZJA 4CGHA 1IKXA 1NK9A 4OGEA 3LZIA 1T05A 1KLNA 1SL2A 3AVFA 4KHYA 3AVCA 4KHSA 1RBUA 4F3TA 4QCLA 1XHXA 4CESA 1J9AA 1I39A 3LP1A 3V1QA 4E7HA 2YV0X 2ZE2A 1L3SA 3SUQA 3KK3A 2XHBA 1RDCA 3OYFA 1K6YA 1NOZA 4LD0A 2VG6A 4I2QA 3ZSQA 3PV8A 3SCXA 4KFBA 1SL0A 3AVBA 3I0RA 1J5OA 3RRGA 3CFPA 4B3OA 2FC0A 4CF9A 2HHTA 1C0TA 1WSEA 3SQ1A 4FJJA 4CJEA 1ASVA 3L2WA 4CEOA 3KK2A 3QERA 1EKEA 2WOMA 3HO1A 1NJYA 2F96A 3RRHA 3DM2A 4CJLA 1WSIA 2X6NA 4CEBA 3G0ZA 5KRSA 1F21A 4KI4A 3MEGA 4I9LA 2XY6A 1L5UA 4NCBA 4M3TA 4DSLA 4FLTA 4OJRA 4FLVA 4DU4A 1NK0A 3UIQA 4J2BA 1JXEA 3VQ9A 2Y1IA 1XC9A 1KVCA 3DRRA 3ZCMA 4CIFA 3LP2A 2G8VA 4CJ3A 4CGIA 4DTRA 1TKZA 3M8SA 1Y97A 2RF2A 4HHTA 4DF8A 2BANA 2QKBA 4CF1A 4E89A 4Z4HA 5J1EA 4DFJA 3EYZA 4O44A 3MECA 3KK1A 4TSXA 2QK9A 4KTQA 3BGRA 2ZQBA 1BI4A 4FJHA 2OPQA 4ID1A 4NCGA 5KI6A 4LH4A 1WSFA 2OZMA 3K2PA 3TAPA 1BIUA 3AVAA 5I42A 3OYAA 2AJQA 4CERA 1S6PA 4GMJB 3LWLA 2XY7A 2FBVA 3VQ6A 2DFEA 1RDDA 4FZXC 1HQEA 3QEVA 3RMBA 4OVLA 4DG1A 3QEXA 1GOCA 2ZD1A 4RW6A 4CK3A 1LW0A 2DTUA 2G8KA 1VSEA 4KTWA 2F8TA 4B08A 4XIUA 1C1CA 2X6SA 4CHNA 4FJIA 4FK0A 3F9KA 1WNSA 1RBTA 4DSJA 1XHZA 1VSJA 1CZ9A 3HL8A 3WNHA 3HK2A 1S1XA 3LP0A 3M8PA 3KD1E 4JS5A 1JL1A 1DTTA 1VSIA 1TAQA 3OYJA 2NUBA 3AO2A 3AO3A 1VK0A 5CZ2A 1L3VA 1RCHA 1X1PA 3QLHA 1JLGA 1SKSA 3CM5A 1TKDA 3HP9A 3HVTA 3VQCA 5CY4A 4H4MA 4CIGA 3AVLA 3ZSYA 2EX3A 1A5XA 4KV8A 2O4IA 3NF9A 4Z0UA 4C8OA 4JLHA 4M3YA 1IO2A 3L3UA 1RT7A 4C8NA 1QTMA 4OKKA 4CJFA 3SV4A 2XY5A 1UA0A 1VSKA 2LSNA 4N5SA 3RMAA 3AV9A 4RW4A 1S1WA 3ZSRA 3WNFA 2P1JA 3LPUA 1U04A 4DSFA 4HTUA 3ZT4A 4DTJA 1L3TA 1Q9YA 1TAUA 1RDAA 2ETJA 3L2RA 1ZBHA 3OYDA 4DU1A 3VQBA 3SQ4A 2JGUA 4B8CA 4FCYA 3KKRA 3AA5X 2KQ2A 3HXMA 1IKVA 4YFUA 4OLAA 3PX0A 3NCIA 4CHQA 1BGXT 2IOCA 3B6OA 3CYMA 4CEQA 5E41A 4E3SA 1RBRA 4O5BA 3NGZA 4PUOA 1CZBA 4FJLA 3M8RA 3D45A 4QOZB 1LAWA 3LWMA 2RKIA 1YTAA 4CF2A 4DQPA 5SWMA 3K58A 1J53A 1EXQA 1D5AA 3QESA 4J2DA 2KZZA 1LWEA 4N76A 3JYTA 4RW9A 2HVHA 3V9UA 1O1WA 1XI1A 3LP3A 4LSNA 3NDKA 3DLGA 3NFAA 1JLEA 3NF6A 3LAMA 1IKYA 4GW6A 3TAMA 3EZ5A 1KFSA 3AA3A 3VQ4A 3NH0A 3V81A 1T03A 4ELTA 3QETA 1WSGA 3OYIA 3TANA 1X9SA 4KO0A 4FJ8A 4CECA 2D0BA 3OYEA 4DTSA 5HROA 1QS4A 2OPRA 4I7FA 1NKEA 4DWIA 1TV6A 3THVA 1IKWA 4CHYA 5KRTA 1HJRA 5HBMA 3HT3A 3MXMA 2HHWA 3DLEA 4KKOA 4Q5VA 3EY1A 4FLUA 4IFVA 2P51A 1L3UA 1VSHA 4ICLA 1KFDA 1WAFA 2PY5A 3MAQA 3O3GA 1TL1A 4CK1A 2GUIA 3RR7A 3L3VA 1FK9A 1U48A 3QO9A 1U49A 4W5OA 1I3AA 1IH7A 1LWFA 4H4OA 3I8DA 3V9SA 4CIEA 1KVBA 4OKJA 4KB0A 4MFBA 3VA0A 2Q3SA 1ZBLA 2D5RA 3TAEA 2YNIA 1ZBUA 4CEZA 1WSJA 3L8BA 3MXJA 4ID5A 1U45A 4CEFA 1QSYA 4IG3A 1LW2A 2OPPA 1N6QA 4B9NA 4F3OA 4K8ZA 3TABA 4CJUA 4KHWA 4O0JA 3HSTB 2DFHA 1DLOA 1BI4B 2QXFA 4RG8A 4CJSA 4GVMA 1KVAA 1QQCA 3PUFA 4FM0A 3C6UA 2IAJA 4CJTA 1S1TA 4FVMA 4CJKA 4FJ9A 1RT6A 3AO4A 4FYDA 1HYVA 4DU3A 2BDPA 1HPZA 4B9SA 4F2SA 2IDOA 3OVNA 3TI0A 4KHNA 3O4QA 4DMNA 2HHSA 5FROA 1JKHA 2HHVA 1LWCA 3AVKA 4BACA 4DSEA 3OYBA 4FM1A 3SYZA 1GOAA 1RDBA 3ZSXA 5KTQA 3ZT2A 1KCFA 4E7KA 3MXIA 3ULDA 1C0MA 3S3NA 1WN7A 1LV5A 3VQ7A 1KRPA 2D0AA 4CGGA 5CYMA 3VQDA 3TAQA 4AH9A 3ZSZA 1U4BA 4DTOA 4O4GA 1MU2A 4DF4A 4G1QA 4Y1DA 4DFPA 2X78A 1NK5A 1RBSA 5HRSA 1BQNA 4J2EA 1ZYQA 3LPTA 4CK2A 4I9QA 1BIZA 4CHOA 1RT4A 4KB1A 4Q0BA 1HQUA 4EZ9A 1JLFA 3A2FA 4FW2A 3DI6A 4NCAA 4AHRA 4B9UA 1LAVA 4AHVA 4DFKA 4FLXA 3TAFA 2E6MA 4FJMA 3OYNA 2A1RA 4R5PA 2ATQA 2KTQA 1SKWA 1SL1A 3H08A 3S3MA 3ZT3A 5CZ1A 1JL2A 5HRRA 5T7BA 4NYFA 3P5JA 4CGFA 3ZT0A 4E1MA 1ITGA 3DMJA 3QINA 4CJRA 3NHGA 2YKNA 3NAEA 1BCOA 3QEWA 4DQIA 3VQQA 2RPIA 3OYMA 1NK8A 3VN5A 2B5JA 3DRPA 1KSPA 3O4NA 3VQPA 3KLGA 3NBPA 1TKTA 1RTIA 4AHUA 3CFRA 3V6DA 3NH1A 3HVRA 2E4LA 3KKSA 3WNGA 4CF0A 3OJUA 4HUFA 1CXQA 3M8QA 4DTPA 3SUNA 4H8KA 4JRQA 4FJKA 3RTVA 1N5YA 4DTUA 4Y1CA 1X9WA 2BGGA 3KLIA 3JSMA 4AILC 1SV5A 4ZHRA 3LDSA 1RTDA 1NJWA 3IRXA 2PYLA 4CHPA 2O4GA 4ELUA 3SPZA 2IC3A 2IGIA 1Z25A 2VWKA 3T1AA 3OYCA 3KJVA 1B92A 3NE6A 4AHCA 1C1AA 4FJNA 4Z4GA 3OS1A 1Q8IA 3ZT1A 4HCBA 1QSSA 2EHGA 4E1NA 3V9ZA 2YNHA 2DFFA 1RILA 3KD5E 3ALYA 3AVIA 1NK4A 4E7IA 4W5RA 4DLGA 3V4IA 2VG7A 4KI6A 3G10A 3S9HA 3TARA 4EZ6A 1EETA 2HNDA 3SQ2A 3AVGA 3HYFA 4CJWA 4M3WA 4Z4FA 1RT3A 4CJ5A 4FM2A 4FJGA 4HCCA 5D3GA 1NK6A 3K5LA 3QNOA 1FKOA 4KAZA 2FBTA 3E01A 5C42A 3QNNA 3S3OA 2VG5A 3PY8A 4KHQA 4FZZA 3PO5A 4Z4IA 1BCMA 4BWJA 4KPYA 3SNNA 2HW3A 1ZBFA 3AO5A 4N56A 3OS2A 4CGDA 2XY8A 4ZTJA 3O3FA 4PY5A 4IBNA 3OY9A 2HNYA 3SUOA 2JLEA 1VRUA 3DLBA 1VRTA 1REVA 3TAGA 3QEIA 1TKXA 5FRNA 4C8KA 4WE1A 4BE2A 3ZSWA 4O55A 4FK2A 1VSDA 3RMCA 3SV3A 2P5GA 4OPKA 1BQMA 4M3ZA 3L2UA 1JXBA 2IS3A 4OKEA 4CE9A 4IFYA 1Q9XA 3DLRA 3SI6A 4E7JA 3QIOA 4KREA 3CM6A 3CQ8A 1ASUA 1UWBA 4OLBA 1SUQA 4DQSA 2G8WA 4CEAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KGX A;  1A5W A;  1KTQ A;  2YKM A;  4FW1 A;  5FRM A;  3KLE A;  1WSH A;  4KHU A;  4RW8 A;  5HLF A;  1HRH A;  1QE1 A;  3LAL A;  1YTU A;  3VQ5 A;  1RT2 A;  3AVH A;  3QIP A;  4CED A;  4JRP A;  4N47 A;  4ELV A;  4CJQ A;  1YVU A;  3HPH A;  4KTZ A;  2P5O A;  5C25 A;  3NGY A;  5J2M A;  1CLQ A;  4C8M A;  3K5M A;  3C94 A;  1HNI A;  2KFN A;  3RWU A;  1VSL A;  2B6A A;  3LAN A;  3HPG A;  5DMR A;  2YNG A;  4DTX A;  1ZBI A;  1TK0 A;  4OPJ A;  2Y1J A;  4YNQ A;  3I0S A;  4M3R A;  4CHZ A;  4UQG A;  4ZTF A;  4C8L A;  2A1S A;  2PZS A;  2OPS A;  4DFM A;  1J54 A;  1KLM A;  4CFB A;  1U47 A;  2QKK A;  1ASW A;  4W5N A;  3O3H A;  3PO4 A;  3ISN C;  4BE1 A;  1S1V A;  1D9F A;  2XRI A;  3AVN A;  4B8A B;  4N41 A;  3OS0 A;  2RN2 A;  3VQ8 A;  4E7L A;  3U3Y A;  4IKF A;  3FFI A;  1FXX A;  3C6T A;  3DRS A;  4FJ7 A;  4NYN A;  4CJ4 A;  3IAY A;  2OZS A;  4BE0 A;  5JS2 A;  1UA1 A;  2Z1J A;  4FJ5 A;  3SZ2 A;  1S9G A;  1GOB A;  3AA2 A;  4FK4 A;  4IG0 A;  3IS9 A;  4LSL A;  3HJF A;  3CG7 A;  3ZSV A;  2HHQ A;  5HP1 A;  4DTN A;  1NK7 A;  4QAG A;  4E0D A;  4F2R A;  5C24 A;  3IG1 A;  3AVM A;  2Z1I A;  5J2P A;  3T3F A;  4M42 A;  4M45 A;  4CJV A;  2B4J A;  2ITG A;  1NKB A;  2G8U A;  4FLZ A;  1HMV A;  1S1U A;  4B9M A;  4CCH A;  4M3U A;  4RW7 A;  1R0A A;  1UAX A;  5CYQ A;  2HMI A;  4PWD A;  1B9D A;  4BWM A;  2FBX A;  3K5N A;  4PA1 A;  2OYQ A;  1W9H A;  1VSF A;  4B9L A;  3B6P A;  2BE2 A;  4HUG A;  1TK5 A;  1NKC A;  2XO7 A;  1T7P A;  3MEE A;  1HNV A;  3AO1 A;  4LY7 A;  4E19 A;  3HPO A;  4BDY A;  2X74 A;  1RBV A;  1T8E A;  2PYJ A;  5JS1 A;  1UOC A;  1TL3 A;  3ITH A;  3SPY A;  4CFA A;  3OJS A;  2F8S A;  1IG9 A;  1BHL A;  1YT3 A;  1HYS A;  2DY4 A;  5FDL A;  1JLC A;  5SZT A;  3V1O A;  1G15 A;  3OYL A;  5KGW A;  3OYH A;  1RTJ A;  3DOK A;  3U6F A;  1JLA A;  4IDK A;  4DSI A;  3OYK A;  4JS4 A;  3VQA A;  4CGJ A;  4HUE A;  1EX4 A;  4DS4 A;  5K14 A;  1TK8 A;  4FJX A;  4Z4E A;  3WNE A;  4EP5 A;  3SQ0 A;  4CEE A;  3VA3 A;  4M41 A;  3KIO A;  4DQQ A;  1C1B A;  5J2N A;  3QEP A;  1C6V A;  4J2A A;  5HRP A;  1BIS A;  4OGC A;  2Z1H A;  4K8X A;  1JLQ A;  1RTH A;  2YNF A;  3CFO A;  3DYA A;  4MQ3 A;  2FBY A;  5EU7 A;  3F73 A;  1SKR A;  1D8Y A;  1QSL A;  3AVJ A;  5DK5 A;  2GBZ A;  2KW4 A;  1W0H A;  1Z26 A;  4CJP A;  3T19 A;  3V9X A;  5HRN A;  3BDP A;  1CXU A;  1C0U A;  4LH5 A;  4AHS A;  3OYG A;  2YHA A;  3KTQ A;  4B9T A;  3DLK A;  3DOL A;  2W42 A;  1B9F A;  3ZSO A;  4DLE A;  4DS5 A;  1BL3 A;  3HM9 A;  4AHT A;  4DTM A;  3PX4 A;  3ASM A;  1TVR A;  3TR8 A;  4BDZ A;  3RMD A;  2G8H A;  4B9V A;  1X9M A;  3VQE A;  4PQU A;  4F8R A;  3L2Q A;  1WAJ A;  3P1G A;  3K57 A;  3PX6 A;  2KZM A;  3NGI A;  2E6L A;  3SUP A;  4FLY A;  2G8F A;  2KFZ A;  4CFC A;  4DQR A;  2HNZ A;  3U3G A;  4I2P A;  4DSK A;  3HP6 A;  2Z1G A;  4CF8 A;  4FLW A;  1S5J A;  1JLB A;  3V9W A;  1HYZ A;  2VWJ A;  1NJZ A;  3SJJ A;  3V1R A;  1D9D A;  3LAK A;  1RT1 A;  1EP4 A;  2HHU A;  2HHX A;  1A5V A;  3NH2 A;  3RR8 A;  4L8R B;  1XWL A;  2WON A;  3K59 A;  2OA8 A;  3NF7 A;  1NJX A;  2G8I A;  3TWH A;  4BDP A;  3KLH A;  2HB5 A;  2YHB A;  4W5T A;  1VSM A;  3D0P A;  4HVJ A;  1WLJ A;  4M3X A;  1S6Q A;  2R7Y A;  5I3U A;  4KRF A;  2HVI A;  4F4K A;  4EP4 A;  1RNH A;  2I5J A;  3AA4 A;  3P83 D;  1RT5 A;  1TGO A;  3NF8 A;  4CFD A;  5J2Q A;  1DTQ A;  1NOY A;  4FZY A;  3DLH A;  3KLF A;  3K5O A;  3L2V A;  1FKP A;  4Z4C A;  1S9E A;  4O0I A;  3C95 A;  4W5Q A;  4FXD A;  2GV9 A;  2D0C A;  1QHT A;  3MED A;  3LZJ A;  4CGH A;  1IKX A;  1NK9 A;  4OGE A;  3LZI A;  1T05 A;  1KLN A;  1SL2 A;  3AVF A;  4KHY A;  3AVC A;  4KHS A;  1RBU A;  4F3T A;  4QCL A;  1XHX A;  4CES A;  1J9A A;  1I39 A;  3LP1 A;  3V1Q A;  4E7H A;  2YV0 X;  2ZE2 A;  1L3S A;  3SUQ A;  3KK3 A;  2XHB A;  1RDC A;  3OYF A;  1K6Y A;  1NOZ A;  4LD0 A;  2VG6 A;  4I2Q A;  3ZSQ A;  3PV8 A;  3SCX A;  4KFB A;  1SL0 A;  3AVB A;  3I0R A;  1J5O A;  3RRG A;  3CFP A;  4B3O A;  2FC0 A;  4CF9 A;  2HHT A;  1C0T A;  1WSE A;  3SQ1 A;  4FJJ A;  4CJE A;  1ASV A;  3L2W A;  4CEO A;  3KK2 A;  3QER A;  1EKE A;  2WOM A;  3HO1 A;  1NJY A;  2F96 A;  3RRH A;  3DM2 A;  4CJL A;  1WSI A;  2X6N A;  4CEB A;  3G0Z A;  5KRS A;  1F21 A;  4KI4 A;  3MEG A;  4I9L A;  2XY6 A;  1L5U A;  4NCB A;  4M3T A;  4DSL A;  4FLT A;  4OJR A;  4FLV A;  4DU4 A;  1NK0 A;  3UIQ A;  4J2B A;  1JXE A;  3VQ9 A;  2Y1I A;  1XC9 A;  1KVC A;  3DRR A;  3ZCM A;  4CIF A;  3LP2 A;  2G8V A;  4CJ3 A;  4CGI A;  4DTR A;  1TKZ A;  3M8S A;  1Y97 A;  2RF2 A;  4HHT A;  4DF8 A;  2BAN A;  2QKB A;  4CF1 A;  4E89 A;  4Z4H A;  5J1E A;  4DFJ A;  3EYZ A;  4O44 A;  3MEC A;  3KK1 A;  4TSX A;  2QK9 A;  4KTQ A;  3BGR A;  2ZQB A;  1BI4 A;  4FJH A;  2OPQ A;  4ID1 A;  4NCG A;  5KI6 A;  4LH4 A;  1WSF A;  2OZM A;  3K2P A;  3TAP A;  1BIU A;  3AVA A;  5I42 A;  3OYA A;  2AJQ A;  4CER A;  1S6P A;  4GMJ B;  3LWL A;  2XY7 A;  2FBV A;  3VQ6 A;  2DFE A;  1RDD A;  4FZX C;  1HQE A;  3QEV A;  3RMB A;  4OVL A;  4DG1 A;  3QEX A;  1GOC A;  2ZD1 A;  4RW6 A;  4CK3 A;  1LW0 A;  2DTU A;  2G8K A;  1VSE A;  4KTW A;  2F8T A;  4B08 A;  4XIU A;  1C1C A;  2X6S A;  4CHN A;  4FJI A;  4FK0 A;  3F9K A;  1WNS A;  1RBT A;  4DSJ A;  1XHZ A;  1VSJ A;  1CZ9 A;  3HL8 A;  3WNH A;  3HK2 A;  1S1X A;  3LP0 A;  3M8P A;  3KD1 E;  4JS5 A;  1JL1 A;  1DTT A;  1VSI A;  1TAQ A;  3OYJ A;  2NUB A;  3AO2 A;  3AO3 A;  1VK0 A;  5CZ2 A;  1L3V A;  1RCH A;  1X1P A;  3QLH A;  1JLG A;  1SKS A;  3CM5 A;  1TKD A;  3HP9 A;  3HVT A;  3VQC A;  5CY4 A;  4H4M A;  4CIG A;  3AVL A;  3ZSY A;  2EX3 A;  1A5X A;  4KV8 A;  2O4I A;  3NF9 A;  4Z0U A;  4C8O A;  4JLH A;  4M3Y A;  1IO2 A;  3L3U A;  1RT7 A;  4C8N A;  1QTM A;  4OKK A;  4CJF A;  3SV4 A;  2XY5 A;  1UA0 A;  1VSK A;  2LSN A;  4N5S A;  3RMA A;  3AV9 A;  4RW4 A;  1S1W A;  3ZSR A;  3WNF A;  2P1J A;  3LPU A;  1U04 A;  4DSF A;  4HTU A;  3ZT4 A;  4DTJ A;  1L3T A;  1Q9Y A;  1TAU A;  1RDA A;  2ETJ A;  3L2R A;  1ZBH A;  3OYD A;  4DU1 A;  3VQB A;  3SQ4 A;  2JGU A;  4B8C A;  4FCY A;  3KKR A;  3AA5 X;  2KQ2 A;  3HXM A;  1IKV A;  4YFU A;  4OLA A;  3PX0 A;  3NCI A;  4CHQ A;  1BGX T;  2IOC A;  3B6O A;  3CYM A;  4CEQ A;  5E41 A;  4E3S A;  1RBR A;  4O5B A;  3NGZ A;  4PUO A;  1CZB A;  4FJL A;  3M8R A;  3D45 A;  4QOZ B;  1LAW A;  3LWM A;  2RKI A;  1YTA A;  4CF2 A;  4DQP A;  5SWM A;  3K58 A;  1J53 A;  1EXQ A;  1D5A A;  3QES A;  4J2D A;  2KZZ A;  1LWE A;  4N76 A;  3JYT A;  4RW9 A;  2HVH A;  3V9U A;  1O1W A;  1XI1 A;  3LP3 A;  4LSN A;  3NDK A;  3DLG A;  3NFA A;  1JLE A;  3NF6 A;  3LAM A;  1IKY A;  4GW6 A;  3TAM A;  3EZ5 A;  1KFS A;  3AA3 A;  3VQ4 A;  3NH0 A;  3V81 A;  1T03 A;  4ELT A;  3QET A;  1WSG A;  3OYI A;  3TAN A;  1X9S A;  4KO0 A;  4FJ8 A;  4CEC A;  2D0B A;  3OYE A;  4DTS A;  5HRO A;  1QS4 A;  2OPR A;  4I7F A;  1NKE A;  4DWI A;  1TV6 A;  3THV A;  1IKW A;  4CHY A;  5KRT A;  1HJR A;  5HBM A;  3HT3 A;  3MXM A;  2HHW A;  3DLE A;  4KKO A;  4Q5V A;  3EY1 A;  4FLU A;  4IFV A;  2P51 A;  1L3U A;  1VSH A;  4ICL A;  1KFD A;  1WAF A;  2PY5 A;  3MAQ A;  3O3G A;  1TL1 A;  4CK1 A;  2GUI A;  3RR7 A;  3L3V A;  1FK9 A;  1U48 A;  3QO9 A;  1U49 A;  4W5O A;  1I3A A;  1IH7 A;  1LWF A;  4H4O A;  3I8D A;  3V9S A;  4CIE A;  1KVB A;  4OKJ A;  4KB0 A;  4MFB A;  3VA0 A;  2Q3S A;  1ZBL A;  2D5R A;  3TAE A;  2YNI A;  1ZBU A;  4CEZ A;  1WSJ A;  3L8B A;  3MXJ A;  4ID5 A;  1U45 A;  4CEF A;  1QSY A;  4IG3 A;  1LW2 A;  2OPP A;  1N6Q A;  4B9N A;  4F3O A;  4K8Z A;  3TAB A;  4CJU A;  4KHW A;  4O0J A;  3HST B;  2DFH A;  1DLO A;  1BI4 B;  2QXF A;  4RG8 A;  4CJS A;  4GVM A;  1KVA A;  1QQC A;  3PUF A;  4FM0 A;  3C6U A;  2IAJ A;  4CJT A;  1S1T A;  4FVM A;  4CJK A;  4FJ9 A;  1RT6 A;  3AO4 A;  4FYD A;  1HYV A;  4DU3 A;  2BDP A;  1HPZ A;  4B9S A;  4F2S A;  2IDO A;  3OVN A;  3TI0 A;  4KHN A;  3O4Q A;  4DMN A;  2HHS A;  5FRO A;  1JKH A;  2HHV A;  1LWC A;  3AVK A;  4BAC A;  4DSE A;  3OYB A;  4FM1 A;  3SYZ A;  1GOA A;  1RDB A;  3ZSX A;  5KTQ A;  3ZT2 A;  1KCF A;  4E7K A;  3MXI A;  3ULD A;  1C0M A;  3S3N A;  1WN7 A;  1LV5 A;  3VQ7 A;  1KRP A;  2D0A A;  4CGG A;  5CYM A;  3VQD A;  3TAQ A;  4AH9 A;  3ZSZ A;  1U4B A;  4DTO A;  4O4G A;  1MU2 A;  4DF4 A;  4G1Q A;  4Y1D A;  4DFP A;  2X78 A;  1NK5 A;  1RBS A;  5HRS A;  1BQN A;  4J2E A;  1ZYQ A;  3LPT A;  4CK2 A;  4I9Q A;  1BIZ A;  4CHO A;  1RT4 A;  4KB1 A;  4Q0B A;  1HQU A;  4EZ9 A;  1JLF A;  3A2F A;  4FW2 A;  3DI6 A;  4NCA A;  4AHR A;  4B9U A;  1LAV A;  4AHV A;  4DFK A;  4FLX A;  3TAF A;  2E6M A;  4FJM A;  3OYN A;  2A1R A;  4R5P A;  2ATQ A;  2KTQ A;  1SKW A;  1SL1 A;  3H08 A;  3S3M A;  3ZT3 A;  5CZ1 A;  1JL2 A;  5HRR A;  5T7B A;  4NYF A;  3P5J A;  4CGF A;  3ZT0 A;  4E1M A;  1ITG A;  3DMJ A;  3QIN A;  4CJR A;  3NHG A;  2YKN A;  3NAE A;  1BCO A;  3QEW A;  4DQI A;  3VQQ A;  2RPI A;  3OYM A;  1NK8 A;  3VN5 A;  2B5J A;  3DRP A;  1KSP A;  3O4N A;  3VQP A;  3KLG A;  3NBP A;  1TKT A;  1RTI A;  4AHU A;  3CFR A;  3V6D A;  3NH1 A;  3HVR A;  2E4L A;  3KKS A;  3WNG A;  4CF0 A;  3OJU A;  4HUF A;  1CXQ A;  3M8Q A;  4DTP A;  3SUN A;  4H8K A;  4JRQ A;  4FJK A;  3RTV A;  1N5Y A;  4DTU A;  4Y1C A;  1X9W A;  2BGG A;  3KLI A;  3JSM A;  4AIL C;  1SV5 A;  4ZHR A;  3LDS A;  1RTD A;  1NJW A;  3IRX A;  2PYL A;  4CHP A;  2O4G A;  4ELU A;  3SPZ A;  2IC3 A;  2IGI A;  1Z25 A;  2VWK A;  3T1A A;  3OYC A;  3KJV A;  1B92 A;  3NE6 A;  4AHC A;  1C1A A;  4FJN A;  4Z4G A;  3OS1 A;  1Q8I A;  3ZT1 A;  4HCB A;  1QSS A;  2EHG A;  4E1N A;  3V9Z A;  2YNH A;  2DFF A;  1RIL A;  3KD5 E;  3ALY A;  3AVI A;  1NK4 A;  4E7I A;  4W5R A;  4DLG A;  3V4I A;  2VG7 A;  4KI6 A;  3G10 A;  3S9H A;  3TAR A;  4EZ6 A;  1EET A;  2HND A;  3SQ2 A;  3AVG A;  3HYF A;  4CJW A;  4M3W A;  4Z4F A;  1RT3 A;  4CJ5 A;  4FM2 A;  4FJG A;  4HCC A;  5D3G A;  1NK6 A;  3K5L A;  3QNO A;  1FKO A;  4KAZ A;  2FBT A;  3E01 A;  5C42 A;  3QNN A;  3S3O A;  2VG5 A;  3PY8 A;  4KHQ A;  4FZZ A;  3PO5 A;  4Z4I A;  1BCM A;  4BWJ A;  4KPY A;  3SNN A;  2HW3 A;  1ZBF A;  3AO5 A;  4N56 A;  3OS2 A;  4CGD A;  2XY8 A;  4ZTJ A;  3O3F A;  4PY5 A;  4IBN A;  3OY9 A;  2HNY A;  3SUO A;  2JLE A;  1VRU A;  3DLB A;  1VRT A;  1REV A;  3TAG A;  3QEI A;  1TKX A;  5FRN A;  4C8K A;  4WE1 A;  4BE2 A;  3ZSW A;  4O55 A;  4FK2 A;  1VSD A;  3RMC A;  3SV3 A;  2P5G A;  4OPK A;  1BQM A;  4M3Z A;  3L2U A;  1JXB A;  2IS3 A;  4OKE A;  4CE9 A;  4IFY A;  1Q9X A;  3DLR A;  3SI6 A;  4E7J A;  3QIO A;  4KRE A;  3CM6 A;  3CQ8 A;  1ASU A;  1UWB A;  4OLB A;  1SUQ A;  4DQS A;  2G8W A;  4CEA A; 
#chains in the Genus database with same CATH topology
 5KGX A;  2QWQ A;  3CJ7 A;  3KLE A;  4O5F A;  2NRR A;  5A2Q O;  3BZK A;  4RW8 A;  3EO3 A;  2VCP A;  3QIP A;  4CED A;  4JRP A;  2P5O A;  4KTZ A;  1VHX A;  4XH4 A;  5C25 A;  1CLQ A;  4C8M A;  4M7X A;  2QI2 A;  1VSL A;  1ZXO A;  2B6A A;  1HKG A;  1U2V A;  2YNG A;  4OPJ A;  4CHZ A;  4C8L A;  3TSQ A;  2ASO A;  2A1S A;  2PZS A;  2OPS A;  1I94 K;  5ADX H;  2GTD A;  2XRI A;  3VQ8 A;  3U3Y A;  4JKA A;  4CJ7 A;  1FXX A;  3DRS A;  3WQU A;  5AZI A;  4FJ7 A;  2W40 A;  4CJ4 A;  4FJ5 A;  5JS2 A;  3WQT A;  1S9G A;  1GOB A;  3EL2 A;  4IG0 A;  4LSL A;  3H1Q A;  2HHQ A;  2FSN A;  5JIC A;  4FSV A;  4B3T K;  4E0D A;  3AVM A;  4M45 A;  2ZF5 O;  4JI2 K;  2B4J A;  4FLZ A;  1S1U A;  2GX9 A;  4B9M A;  2YHX A;  3PIO L;  1R0A A;  1UAX A;  5CYQ A;  4GV9 A;  2OYQ A;  3IFR A;  1GLB G;  1VSF A;  4GVE A;  4B9L A;  1YF5 L;  1NKC A;  3CD6 N;  4BC2 A;  5BRH A;  4E19 A;  1RBV A;  4KH5 A;  3VF2 A;  3ITH A;  2A3Z A;  3RVC A;  2F8S A;  1HYS A;  4DQ8 A;  1JLC A;  3V1O A;  2H3G X;  5KGW A;  3DOK A;  3U6F A;  1JLA A;  4FO0 A;  4JS4 A;  3VQA A;  5BR8 K;  1TK8 A;  4B1Y B;  1V4S A;  3WNE A;  4CEE A;  3VA3 A;  3QEP A;  1C6V A;  3KWI A;  5CE3 A;  1WBD A;  1JLQ A;  5EU7 A;  2FBY A;  5MLC Q;  4WQ4 A;  5DK5 A;  2KW4 A;  3THY A;  3T19 A;  4AHS A;  3TTD A;  3OYG A;  2NZT A;  4B9T A;  1RDU A;  5AQL A;  3QBX A;  4K43 A;  3HM9 A;  3VF6 A;  4BRA A;  3J7Z O;  1X9M A;  3EE8 A;  4F8R A;  1WAJ A;  3PX6 A;  4CFC A;  3MCA B;  2HNZ A;  3HI0 A;  4NB4 A;  2VWJ A;  3SJJ A;  1D9D A;  3LAK A;  3KVG A;  1T44 A;  2HHU A;  5BPM A;  4KHP K;  4L8R B;  3CIP A;  1XWL A;  3K59 A;  3Q7C A;  1NJX A;  2YHB A;  3WEE A;  3BF1 A;  4HVJ A;  2R7Y A;  5KQD A;  3HTV A;  1NOY A;  2YCH A;  3DLH A;  4FXD A;  3OW2 M;  1QHT A;  3PSF A;  1C0F A;  3LZI A;  1T05 A;  1U2V B;  3LM2 A;  4KHS A;  4QCL A;  1XHX A;  4CZF A;  1J9A A;  4E7H A;  3CXC M;  1RDC A;  1K6Y A;  3P39 A;  4DUZ K;  4KFB A;  3UKR A;  4CF9 A;  3SQ1 A;  5IWA K;  3DAW A;  4WQ5 A;  3HO1 A;  1NJY A;  2F96 A;  5DM6 L;  5AZI B;  4CJL A;  3G0Z A;  3MEG A;  4I9L A;  1ZBS A;  1L5U A;  4NCB A;  4FLV A;  3UIQ A;  1JCE A;  2Y1I A;  1YAG A;  3DRR A;  3ZCM A;  4CIF A;  1XMQ K;  3W3D A;  1G99 A;  1IBM K;  4CGI A;  4HHT A;  4CVN E;  4CF1 A;  4CBW A;  4DFJ A;  4BRE A;  3MX5 A;  4TSX A;  2ZQB A;  2OPQ A;  3TAP A;  3R1X A;  5M1N A;  4GMJ B;  3VQ6 A;  5AQK A;  3RMB A;  3AAR A;  3O9T A;  3CC7 N;  4DV0 K;  4KH6 A;  5LMN K;  4KTW A;  3CJC A;  2X6S A;  4DSJ A;  3VPZ A;  3FZH A;  1QHA A;  5CZ2 A;  3AO2 A;  3AO3 A;  1L3V A;  1RCH A;  4PKI A;  1JLG A;  3THY B;  3CM5 A;  2A6A A;  3I33 A;  2NRT A;  1TKD A;  3QIC A;  3MWT A;  3ZSY A;  4BC4 A;  2NLX A;  3H3O B;  1IO2 A;  2NRV A;  3L3U A;  1RT7 A;  2QWO A;  3FZM A;  3HRG A;  4OKK A;  3ZX2 A;  4CJF A;  3Q7B A;  1Q86 O;  1UA0 A;  2LSN A;  4CZG A;  4N5S A;  4RW4 A;  3ZSR A;  3WNF A;  3SAF A;  3VER A;  4CD1 A;  1RDA A;  5C10 A;  2JGU A;  1NGF A;  2OTJ N;  2KQ2 A;  3SMS A;  3QFP A;  4BRP A;  3NCI A;  4CHQ A;  1VQ8 N;  1MWK A;  2IOC A;  4ISE A;  4JI1 K;  2VGM A;  5E41 A;  2Q31 A;  3D2F A;  1S72 N;  3M8R A;  4C1N K;  3D45 A;  4QOZ B;  3WEE B;  1KAX A;  3BY5 A;  2RKI A;  5AQN A;  1YTA A;  3EKS A;  4DQP A;  1NGJ A;  3A5O C;  3ULE A;  2A41 A;  4EHT A;  1O1W A;  3LP3 A;  4LSN A;  3NDK A;  1IKY A;  1KFS A;  3AA3 A;  3VQ4 A;  3OYI A;  4MO4 A;  1X9S A;  1T6D A;  2OTL N;  3UKR B;  5HRO A;  1NKE A;  2IVN A;  1TV6 A;  4Z94 A;  1IKW A;  1HJR A;  5HBM A;  3EY1 A;  4A5B A;  3QB0 A;  1L3U A;  2PY5 A;  2UUC K;  3O3G A;  1QQN A;  1TL1 A;  3TTC A;  4WFA L;  3L3V A;  1U48 A;  3QO9 A;  1U49 A;  3V9S A;  3ENB A;  4OKJ A;  2P9N B;  3P38 A;  4KB0 A;  1QVF M;  3TAE A;  1ZBU A;  3L8B A;  1VQM N;  1U45 A;  4CEF A;  4KHW A;  3TAB A;  4CJU A;  4O0J A;  2HBK A;  4CJS A;  4GKK K;  1QQC A;  1HJO A;  2IAJ A;  2FXU A;  1S1T A;  4H0Y B;  1NGC A;  4CJK A;  4FJ9 A;  1BA1 A;  2P9P A;  5M1O A;  5M1F A;  4FYD A;  1HYV A;  4HWI A;  4NLC A;  2BDP A;  1DEJ A;  1HPZ A;  4B9S A;  4KHN A;  4M7Y A;  2ZGZ A;  2HHV A;  2Q1N A;  2IIR A;  3SYZ A;  1GOA A;  4I6M A;  3ZSX A;  4E7K A;  1KCF A;  5H1S Q;  3ULD A;  4AQY K;  2O8C A;  4DR4 K;  1LV5 A;  1KRP A;  4YOR A;  4FL9 A;  4LF8 K;  3DLL L;  2X78 A;  2VQE K;  2BTF A;  4MO5 A;  4CK2 A;  3LL3 A;  4JKC A;  1BIZ A;  4CHO A;  1RT4 A;  5BRE A;  4Q0B A;  1VQL N;  4EZ9 A;  3EEQ A;  4AHR A;  1LAV A;  2E2P A;  2E6M A;  1VQN N;  1LOT B;  2P9L A;  5CZ1 A;  5HRR A;  4BRQ A;  1VAZ A;  4E1M A;  3DMJ A;  2ZJQ L;  2O8F A;  3NAE A;  1BCO A;  1NK8 A;  3I56 N;  1ZC6 A;  3CQY A;  3O4N A;  3VQP A;  4DHY A;  4IWV A;  1RTI A;  3V6D A;  3D2F B;  4UY8 O;  3WNG A;  4CF0 A;  3OJU A;  4HUF A;  4JKF A;  1CXQ A;  2DPN A;  4DTP A;  1GLL O;  3ULE B;  4YDU C;  4Y1C A;  5AQJ A;  2BGG A;  1RTD A;  1SV5 A;  2PYL A;  4JEP A;  1EWR A;  2VWK A;  3NE6 A;  1QSS A;  1HKC A;  1BDG A;  4CZL A;  4IO9 L;  3ALY A;  3AVI A;  5AZJ A;  1BUP A;  4E7I A;  4W5R A;  4DLG A;  1NG9 A;  3G10 A;  3S9H A;  5GAE P;  4FM2 A;  2P9I A;  3E1Y A;  1Q7Y O;  5D3G A;  3CCL N;  3QNO A;  5C42 A;  2YX6 A;  2P9K A;  1BCM A;  5EX5 A;  3SNN A;  5EXW A;  4CGD A;  2XY8 A;  4ZTJ A;  3C0B A;  4PY5 A;  2E20 A;  2JLE A;  1SAZ A;  3K9J A;  3TAG A;  3PLA A;  1TKX A;  5FPE A;  4DR2 K;  3ZSW A;  4LFC K;  5KPZ A;  4OPK A;  1BQM A;  3UKU A;  2F4V K;  4CE9 A;  4IFY A;  3HBT A;  3SI6 A;  3QIO A;  3QDK A;  2P9P B;  1CZA N;  1ASU A;  4AF1 A;  4DQS A;  2G8W A;  5M1P A;  5AJ3 K;  3D7E O;  4I6M B;  4DCH A;  1Y64 A;  2F9W A;  1QE1 A;  2O8C B;  1YTU A;  3D6R A;  3SK3 A;  5FLX O;  3LDQ A;  4YOT A;  2YJE A;  3VEO A;  1YVU A;  3HPH A;  3IUC A;  3NGY A;  3A5L C;  2WFB A;  2KFN A;  2QM1 A;  1TK0 A;  2CGL A;  3O9R A;  2V52 B;  1K73 O;  4M3R A;  4UQG A;  4ZTF A;  4K41 A;  1KLM A;  1U47 A;  2YJF A;  1ASW A;  3O3H A;  4WQ4 C;  1S1V A;  4HTL A;  4IKF A;  4CD3 A;  3HSC A;  5TKY A;  2JWL A;  4NYN A;  2P9L B;  3SZ2 A;  1YUW A;  3BEX A;  4WCE L;  3O8M A;  1XUP O;  2UUA K;  2E5L K;  2O8F B;  4DTN A;  3C7N A;  1N36 K;  4JD2 A;  1ATN A;  3IG1 A;  4BRF A;  2G8U A;  2ITG A;  4CCH A;  3ENO A;  4K42 A;  3L6Q A;  2BE2 A;  1TK5 A;  1T6C A;  4ILG B;  2XO7 A;  3MEE A;  1T7P A;  1HNV A;  4LY7 A;  4A61 A;  1QVG M;  5ADX A;  1T8E A;  1UOC A;  4CFA A;  4FPA A;  2DY4 A;  5SZT A;  1G15 A;  1RTJ A;  3WXJ A;  1EX4 A;  1N32 K;  2O8B A;  4EP5 A;  5AZJ B;  4M41 A;  4J2A A;  1C1B A;  1BIS A;  2Z1H A;  5AQG A;  3DYA A;  1D8Y A;  3F73 A;  1YIJ N;  1SKR A;  2P9I B;  1ESV A;  3AVJ A;  3CCM N;  1W0H A;  2UXC K;  2QW9 A;  4YHH K;  2ZJR L;  4DR1 K;  3HOS A;  3C6A A;  4CZJ A;  2P9K B;  3VTH A;  2QEX N;  4DLE A;  4DS5 A;  4GV6 A;  4DV1 K;  1BL3 A;  4DTM A;  1X3M A;  1NGD A;  1TVR A;  3CJ9 A;  3VEV A;  2KZM A;  3VGK A;  4EIA A;  1KAZ A;  3NGI A;  3SUP A;  2KFZ A;  2EWS A;  3O9U A;  4I2P A;  4DSK A;  3UKU B;  2Z1G A;  1S5J A;  1JLB A;  4O8U A;  1HYZ A;  3P31 A;  1RT1 A;  2AP1 A;  4QS9 A;  2FSJ A;  2KKZ A;  2OA8 A;  3NF7 A;  2G8I A;  3TWH A;  5CHI A;  4BDP A;  2HB5 A;  4BC5 A;  1VSM A;  3SAH A;  4A5A A;  1NNE A;  3J7A P;  2PAV A;  3H45 C;  5C2D A;  3P83 D;  4FZY A;  1RT5 A;  5AQQ A;  3CC2 N;  3KLF A;  3K5O A;  3L2V A;  1S9E A;  3A5N C;  2FLO A;  2NRX A;  4C1N I;  3I55 N;  2W6L A;  1RBU A;  5AQW A;  4F3T A;  1I39 A;  3V1Q A;  4IO8 A;  3CPW M;  2YV0 X;  2KLA A;  3SUQ A;  3KK3 A;  1EQY A;  2XHB A;  4I2Q A;  3ZSQ A;  3SCX A;  3PV8 A;  3I0R A;  3CFP A;  3FR0 A;  3EKU A;  1WSE A;  1ASV A;  4JKG A;  4CEO A;  3QER A;  1EKE A;  2WOM A;  2YI1 A;  5B8H A;  2E2O A;  4JKE A;  4WYB A;  3KZB A;  1F21 A;  2VYP A;  2XY6 A;  2CGK A;  4J2B A;  3VQ9 A;  1X9J A;  2QXL A;  2G8V A;  4BRC A;  3C7N B;  1TKZ A;  4JD2 B;  4GKJ K;  4DF8 A;  2BAN A;  4Z4H A;  4O44 A;  3KK1 A;  2QK9 A;  2QWN A;  1BI4 A;  4FJH A;  3MN9 A;  3C65 A;  4ID1 A;  3NVM A;  5KI6 A;  4AM7 A;  2A40 A;  2OZM A;  3G25 A;  1NJI O;  1S6P A;  2XY7 A;  5F0X A;  2DFE A;  3WXI A;  2NRW A;  4FZX C;  4OVL A;  2ZD1 A;  2HHH K;  4CI6 A;  4CHN A;  5LJW A;  2O8B B;  3F9K A;  1T3V A;  1VSJ A;  3HK2 A;  1S1X A;  3KD1 E;  5C12 A;  4JS5 A;  1TAQ A;  2NUB A;  1VK0 A;  3CCQ N;  3IKM A;  1BG3 A;  5AQF A;  3VQC A;  4CIG A;  1A5X A;  4B3M K;  4Z0U A;  3FLC O;  4M3Y A;  4JLH A;  2UUB K;  1JCF A;  2CH5 A;  4NXN K;  5M1K A;  2P1J A;  4DV5 K;  4LF9 K;  4DU1 A;  3VQB A;  3SQ4 A;  4FCY A;  1IV0 A;  5BN9 A;  3AA5 X;  5LJV A;  1IKV A;  4YFU A;  2D1K A;  2HF3 A;  3B6O A;  1OH8 A;  1RBR A;  4FJL A;  1RDW X;  1TYQ A;  1WOQ A;  5BRD A;  2HBM A;  4FWQ A;  4FOI A;  4J2D A;  5KPR A;  2KZZ A;  2PBD A;  3TTF A;  3LDO A;  1XI1 A;  3NF6 A;  3NFA A;  3OBW A;  5AQH A;  4WFB L;  4X62 K;  4GW6 A;  3V81 A;  4J8F A;  3U9D A;  3TAN A;  3O80 A;  2D0B A;  4BRL A;  4DWI A;  3GG4 A;  3J80 O;  5E84 A;  4RCH A;  3MXM A;  5KRT A;  3E9P A;  4K0K K;  3DLE A;  4JKG B;  4M63 C;  5EVZ A;  4IFV A;  2P51 A;  4JI6 K;  3FZL A;  1VSH A;  1KFD A;  3JXU A;  3ZX3 A;  1IH7 A;  1VQ7 N;  1LWF A;  3I8D A;  1KQS M;  1KVB A;  1OH7 A;  2Q3S A;  3WUH A;  2D5R A;  2YNI A;  4CEZ A;  1Q18 A;  4LF5 K;  1YXQ A;  1QZ5 A;  1LW2 A;  2DFH A;  4RG8 A;  1BI4 B;  4GVM A;  3CCJ N;  4FM0 A;  3C6U A;  4CJT A;  4FVM A;  3DXM A;  3AO4 A;  1D4X A;  2E88 A;  4X66 K;  4F2S A;  5LY3 A;  4B3S K;  2I7N A;  3O4Q A;  5FRO A;  1JKH A;  1LWC A;  3A8Y A;  4JHD A;  3ATU A;  2BH1 A;  5KTQ A;  3ZT2 A;  3MXI A;  3O9S A;  1Q81 O;  1OKJ A;  3VQ7 A;  3R6M A;  3CPE A;  5CYM A;  4CGG A;  1U4B A;  4DTO A;  4FVU A;  3ID6 A;  4G1Q A;  4Y1D A;  4DFP A;  2BUP A;  3CER A;  1NK5 A;  5HRS A;  1DGK N;  1NGB A;  3ZEU A;  4R79 A;  3ZET A;  3W0L A;  3DI6 A;  4NCA A;  4B9U A;  4AHV A;  3B8A X;  3TAF A;  1VQ5 N;  3OYN A;  5AQS A;  1WBB A;  4YY3 K;  4NYF A;  2GWK A;  4CGF A;  3ZT0 A;  4CJR A;  3NHG A;  3QEW A;  4DQI A;  3T7Z A;  3VQQ A;  4CW7 B;  3PIP L;  3ENH A;  3VEX A;  3NBP A;  4GY2 B;  1Z05 A;  1TYQ B;  2E4L A;  5GIN A;  1U6Z A;  3M8Q A;  4JRQ A;  4FJK A;  3CCS N;  4DTU A;  3KLI A;  4AIL C;  4ZHR A;  2HBJ A;  4BRG A;  4CHP A;  3THW A;  1OH6 A;  2UXB K;  4ELU A;  3SPZ A;  2E2N A;  2IC3 A;  2IGI A;  1Z25 A;  2NRZ A;  2HST A;  1C1A A;  4FJN A;  3OS1 A;  1Q8I A;  4FWK A;  3V9Z A;  4WFN L;  3O1W A;  4QS8 A;  2IVO A;  2HND A;  3WT0 A;  4Z4F A;  4M3W A;  1RT3 A;  4HCC A;  3WXK A;  1N34 K;  2VG5 A;  4Z4I A;  3J81 O;  3JAM O;  5ELZ A;  3DLB A;  1TUU A;  1VRT A;  1REV A;  3QEI A;  4JYA K;  1BOT O;  4C8K A;  4WE1 A;  2Q2R A;  4BE2 A;  4FK2 A;  1VSD A;  2P5G A;  3SV3 A;  4XH5 A;  1Q9X A;  3DXM B;  3QFU A;  1MA9 B;  3SAG A;  1C0G A;  2QWP A;  4JI3 K;  4JNE A;  1A5W A;  1KTQ A;  4JHD B;  4KHU A;  3LDL A;  3LAL A;  3P4I A;  1RT2 A;  3AVH A;  4AM6 A;  2J4R A;  3C94 A;  1HNI A;  3RWU A;  1H1V A;  1ZBI A;  5AQR A;  2Y1J A;  3K0S A;  3ZEU B;  3ZET B;  3E66 A;  4DFM A;  4W5N A;  5KQ8 A;  5F2R A;  4H5V A;  5AQO A;  5DM7 L;  3OS0 A;  2RN2 A;  4YOU A;  4ISF A;  3C6T A;  1W2B M;  1UA1 A;  2Z1J A;  3L4Q A;  4BQL A;  3AA2 A;  1K8A O;  3GBT A;  3WXM B;  2Z1I A;  4DV7 K;  2P9U A;  3T3F A;  1NKB A;  4M3U A;  2HMI A;  2A42 A;  1B9D A;  2FBX A;  3RSE A;  4A62 A;  1E4F T;  1W9H A;  4BR7 A;  3K5N A;  3B6P A;  4BRK A;  1R59 O;  2PYJ A;  2X74 A;  3TSP A;  4IZ9 A;  3VMF B;  1IG9 A;  3THW B;  1YT3 A;  3OYL A;  3TSU A;  3VOV A;  4IDK A;  4BRD A;  4CGJ A;  2HOE A;  4DS4 A;  4JK8 A;  3SQ0 A;  3KIO A;  3IDH A;  5J2N A;  3BP8 A;  5AQY A;  4K8X A;  2YNF A;  3CFO A;  3CCU N;  1QSL A;  3O1B A;  2GBZ A;  1J5E K;  1IBL K;  3V9X A;  5HRN A;  3BDP A;  1CXU A;  1C0U A;  4LH5 A;  2YHA A;  3VTI A;  4CZK A;  3TU5 A;  3VEN A;  1N33 K;  4DR7 K;  1B9F A;  2W41 A;  4BDZ A;  4RTF D;  4PKG A;  2G8H A;  4PQU A;  3L2Q A;  2Q36 A;  2NNW A;  2E6L A;  4DQR A;  3U3G A;  4CF8 A;  4FLW A;  1NJZ A;  2GWJ A;  3T1Y K;  3A5M C;  1EP4 A;  2HHX A;  1A5V A;  3NH2 A;  3H6E A;  2WON A;  3AY9 A;  1YI2 N;  1WLJ A;  3O6W A;  1S6Q A;  3CET A;  4F4K A;  1YJW N;  4EP4 A;  2I5J A;  3AA4 A;  4CFD A;  3HJF A;  5J2Q A;  1X3N A;  3NF8 A;  1VQ4 N;  4Z4C A;  4BR2 A;  3C95 A;  4W5Q A;  2D0C A;  3VGL A;  1IJJ A;  3MED A;  3LZJ A;  4CGH A;  1IKX A;  4OGE A;  3R9P A;  4CZI A;  1KLN A;  1SL2 A;  4BRI A;  3AVC A;  1KAY A;  4F9O A;  1XC3 A;  3LP1 A;  1L3S A;  4JK9 A;  3OYF A;  4LD0 A;  2VG6 A;  5FPM A;  3RRG A;  3AVB A;  1J5O A;  4DR5 K;  4FJJ A;  3BF3 A;  3T1H K;  3VES A;  3KHY A;  3DM2 A;  1NU0 A;  1WSI A;  1QZ6 A;  1NGG A;  4GNI A;  4H0P A;  4FLT A;  4OJR A;  4DU4 A;  1NK0 A;  4CBX A;  4BRO A;  5FPD A;  1XC9 A;  2E1Y A;  5JLF A;  4CJ3 A;  1DT9 A;  3M8S A;  1HPM A;  1Y97 A;  2RF2 A;  2QKB A;  2P9U B;  4H5N A;  4FWN A;  4E89 A;  5J1E A;  4JI7 K;  3EYZ A;  3NVK A;  4KTQ A;  4NCG A;  2QTD A;  1HUX A;  2IVP A;  3RSE B;  4LH4 A;  1WSF A;  1BIU A;  3AVA A;  4EHU A;  3OYA A;  2AJQ A;  4CER A;  3LWL A;  2FBV A;  4A2A A;  4BR5 A;  1RDD A;  1HQE A;  3QEV A;  1GOC A;  4RW6 A;  2DTU A;  4O8K A;  1VSE A;  2F8T A;  1GLD G;  4B1U B;  4B08 A;  1KC8 O;  1C1C A;  4BR4 A;  4FK0 A;  1S3X A;  1WNS A;  3ZX0 A;  2WC9 A;  1CZ9 A;  3WNH A;  3M8P A;  3LP0 A;  5C15 A;  3CC4 N;  1JL1 A;  4H0T B;  3OTO K;  3O5B A;  3MDQ A;  5GAG P;  2ASM A;  4PHT X;  1WUA A;  4JV5 K;  3M3Z A;  3HP9 A;  4XH1 A;  5AQI A;  4CZM A;  4BRN A;  4H5R A;  4IXC A;  1YJ9 N;  4KV8 A;  3U4L A;  3NF9 A;  4H0O A;  4C8O A;  2D0P A;  5FPN A;  2PFU A;  3DJC A;  3SMP A;  1DKG D;  1VSK A;  3FZK A;  4BG9 A;  3RMA A;  1S1W A;  4DTJ A;  2RE2 A;  3LPU A;  1U04 A;  4CZH A;  4DSF A;  5BR9 A;  1L3T A;  4XEI A;  1TAU A;  3CJB A;  4JKH A;  3L2R A;  3R8E A;  3CMA N;  2CGJ A;  4B8C A;  3OA9 A;  3HXM A;  1GLE G;  5EY4 A;  2Q0R A;  3ZYY X;  4JKB A;  4OLA A;  3PX0 A;  3ZLJ A;  4CEQ A;  4E3S A;  4O5B A;  3U9Z A;  3NGZ A;  3F9M A;  4PUO A;  1CZB A;  3PSI A;  1HNW K;  3LWM A;  3HM8 A;  1J53 A;  1D5A A;  3QES A;  3T69 A;  1LWE A;  4N76 A;  3JYT A;  4RW9 A;  1M1K O;  3V9U A;  1JLE A;  3LAM A;  4ILJ A;  3EZ5 A;  1NM1 A;  3GE1 A;  4ELT A;  3NH0 A;  5AFU H;  3QET A;  1WSG A;  3FE1 A;  4A2B A;  4KO0 A;  4FJ8 A;  3OYE A;  4DTS A;  5KPT A;  1QS4 A;  4BVP A;  5GAD P;  4DV4 K;  4CHY A;  3HT3 A;  1HNX K;  4FLU A;  1BO5 O;  1WAF A;  2F7T A;  3MAQ A;  4CK1 A;  2GUI A;  3RR7 A;  1FK9 A;  3CCE N;  2NRH A;  3MX2 A;  4H4O A;  4CIE A;  4JI0 K;  1ZBL A;  5BN8 A;  5HL7 L;  1WSJ A;  1XNQ K;  3MXJ A;  3J8A A;  3SLC A;  4K8Z A;  4IG3 A;  1N6Q A;  1KD1 O;  3O4W A;  5GAH P;  3H1V X;  1KVA A;  3PUF A;  2CH6 A;  3JS6 A;  1RT6 A;  4Y0W A;  4DU3 A;  4KH4 A;  4IOC L;  1YHQ N;  2HHS A;  4DMN A;  1KXP A;  4FWP A;  1XQS C;  2E1Z A;  4FM1 A;  4IOX A;  1N8R O;  3GOI A;  1Z6R A;  4BRH A;  1W97 L;  1RFQ A;  3E9L A;  4BG8 A;  1WB9 A;  3S3N A;  4DR6 K;  1GLA G;  2D0A A;  3IMX A;  3VQD A;  3ZSZ A;  3ATV A;  3AGK A;  4A57 A;  1RBS A;  3CF5 L;  1BQN A;  1ZYQ A;  4I9Q A;  2YHW A;  1HQU A;  3VEY A;  5AQP A;  5AQT A;  4DFK A;  4FJM A;  3MN6 A;  3N4Q A;  2D0O A;  2A1R A;  5C2F A;  4R5P A;  2ATQ A;  2KTQ A;  5LMU K;  5AR0 A;  1Q82 O;  3H08 A;  3A0I X;  3ZT3 A;  1JL2 A;  5JVH L;  5JVG L;  1QQM A;  2I7P A;  1EWQ A;  2YKN A;  2RPI A;  3OYM A;  2B5J A;  1KSP A;  2ZM6 K;  4IJN A;  3HZ6 A;  3NH1 A;  3KKS A;  3HOT A;  3SUN A;  2QA4 N;  4X65 K;  1X9W A;  2Q97 A;  4DR3 K;  1NJW A;  1E4G T;  2W6K A;  4FOE A;  3O9Q A;  3KJV A;  3OYC A;  4YOW A;  1B92 A;  4AHC A;  1V4T A;  2F9T A;  2EHG A;  4E1N A;  5I9E B;  2YNH A;  1RIL A;  2VG7 A;  4KI6 A;  3SQ2 A;  4MLH A;  3AVG A;  1OVQ A;  3NMU A;  3R3L A;  4CJ5 A;  4FJG A;  1NK6 A;  4BC3 A;  3MK6 A;  3E01 A;  3QNN A;  3S3O A;  3PY8 A;  4KHQ A;  4FZZ A;  3KWG A;  4BWJ A;  4NLB A;  4DUY K;  4YOV A;  4MDA A;  3F5T A;  3AO5 A;  2FF3 B;  4IBN A;  3OY9 A;  2HNY A;  3SUO A;  3VET A;  3BZC A;  4O55 A;  1ATS A;  3RMC A;  3L2U A;  2WUS A;  4OKE A;  3DLR A;  3MWP A;  1MDU B;  4FPB A;  3CM6 A;  1M90 O;  4LF7 K;  1SQK A;  2YKM A;  4FW1 A;  1NLV A;  5FRM A;  1WSH A;  3H46 O;  1SS6 A;  5HLF A;  1HRH A;  1YIT N;  2O8E A;  1GLC G;  2QWL A;  5AQX A;  3VQ5 A;  4GV3 A;  4N47 A;  3CI5 A;  4CJQ A;  4ELV A;  4X64 K;  2HF4 A;  3FGU A;  1K8K A;  5J2M A;  3K5M A;  4DV6 K;  2AA4 A;  3G4S N;  3LAN A;  3THX A;  3HPG A;  5DMR A;  1VQP N;  4DTX A;  4YNQ A;  3I0S A;  4MLE A;  3I8B A;  1J54 A;  4CFB A;  2QKK A;  3PO4 A;  3ISN C;  4BE1 A;  2P9N A;  1D9F A;  4N41 A;  3AVN A;  4B8A B;  2UU9 K;  3SBT A;  4E7L A;  3UB5 A;  3VGM A;  1HLU A;  3FFI A;  3IAY A;  2OZS A;  4BE0 A;  4H0X B;  1ATR A;  2V51 B;  5BPN A;  4FK4 A;  3IS9 A;  2GEL A;  3CG7 A;  3ZSV A;  3M6G A;  4IEI A;  5HP1 A;  1NK7 A;  4QAG A;  4F2R A;  3BUZ B;  5C24 A;  5J2P A;  4M42 A;  4CJV A;  3E9O A;  2O8D A;  1HMV A;  1HNZ K;  4IDH A;  3SJH A;  4RW7 A;  3SBG A;  2JWK A;  4PWD A;  4BWM A;  4EZ6 A;  4PA1 A;  4HUG A;  4U7B A;  1BU6 O;  3AO1 A;  3HPO A;  4BDY A;  5JS1 A;  3SPY A;  1TL3 A;  3OHR A;  3OJS A;  2GEM A;  1NGH A;  1BHL A;  4JI8 K;  3CHW A;  5FDL A;  3OYH A;  4BGA A;  4DSI A;  3OYK A;  4HUE A;  4FJX A;  5K14 A;  4Z4E A;  2YHY A;  3VEZ A;  4DQQ A;  3J7Y P;  5HRP A;  4OGC A;  1RTH A;  4MQ3 A;  1ILY A;  3LM9 A;  4CJP A;  1Z26 A;  4BQZ A;  1NMN A;  3QBW A;  3KTQ A;  3M5R A;  3DLK A;  3DOL A;  2W42 A;  3ZSO A;  3PX4 A;  5JMV A;  4LC9 B;  4AHT A;  2VQF K;  3ASM A;  3TR8 A;  1XNR K;  1HX1 A;  2RHK A;  4B9Q A;  3RMD A;  4B9V A;  4EFH A;  3VQE A;  3P1G A;  3K57 A;  4OO1 J;  5C0Y A;  4FLY A;  2G8F A;  3DXK A;  4KBO A;  4L3Q A;  4JKD A;  2VGN A;  2GUP A;  3HP6 A;  1GLF O;  2A5X A;  3V9W A;  3V1R A;  1XMO K;  1GLJ O;  1EO1 A;  3RR8 A;  1OH5 A;  5AQM A;  3O08 A;  3KLH A;  1YJN N;  4W5T A;  3D0P A;  4FWM A;  2HVI A;  4M3X A;  4KRF A;  3VEW A;  5I3U A;  3K9K A;  2O8E B;  4LFA K;  1RNH A;  4CBU A;  2QWM A;  1TGO A;  3CCR N;  1DTQ A;  1FKP A;  4O0I A;  1W7A A;  1K8K B;  1HR0 K;  2GV9 A;  1NK9 A;  4KHY A;  3AVF A;  3THX B;  4CES A;  2ZE2 A;  1NOZ A;  2FSK A;  1SL0 A;  4IOA L;  4B3O A;  2UYT A;  2FC0 A;  1NBW A;  1C0T A;  2HHT A;  1JCG A;  2KHO A;  4CJE A;  3L2W A;  4A59 A;  3KK2 A;  4JK7 A;  3RRH A;  4CEB A;  2X6N A;  5KRS A;  4KI4 A;  4BGB A;  4M3T A;  4QS7 A;  4DSL A;  1JXE A;  3LDN A;  1KVC A;  3LP2 A;  4DTR A;  1TUY A;  1NWK A;  3WXL A;  2ZWH A;  3MN5 A;  4JN4 A;  5IT9 O;  2O8D B;  3MEC A;  4NO7 A;  4B1W B;  3BGR A;  4PL7 A;  3K2P A;  5I42 A;  3ID8 A;  3OBY A;  4E1J A;  1S22 A;  4IJA A;  3TPQ A;  3CJ1 A;  4DG1 A;  3QEX A;  4OX9 K;  4CK3 A;  1LW0 A;  3D2E A;  2G8K A;  5AQZ A;  3F2K A;  2E8A A;  4XIU A;  5BRF A;  4FJI A;  1RBT A;  1XHZ A;  3HL8 A;  1YVN A;  2E2Q A;  4JI4 K;  2QWR A;  1DTT A;  1VSI A;  3OYJ A;  1X1P A;  3QLH A;  1SKS A;  2HMP A;  5LL6 Z;  3HVT A;  2P9S A;  4H4M A;  5CY4 A;  3AVL A;  4DV3 K;  4LFB K;  2EX3 A;  2O4I A;  1VQ9 N;  4G9Z A;  4C8N A;  1NMD A;  1QTM A;  3MCP A;  3SV4 A;  5BPL A;  2XY5 A;  4BVO A;  3AV9 A;  4HTU A;  3ZT4 A;  1VQ6 N;  1Q9Y A;  2ASP A;  2ETJ A;  3DXK B;  4YOX A;  1ZBH A;  3OYD A;  4BR9 A;  4IEE A;  3KKR A;  5EOY A;  3QML A;  1BGX T;  3CYM A;  1MWM A;  3L4I A;  1LAW A;  4CF2 A;  5SWM A;  3S41 A;  3K58 A;  1EXQ A;  1J6Z A;  1NGE A;  4B1X B;  4RWT A;  4H0V B;  1VQK N;  2HVH A;  3DLG A;  3TAM A;  1T03 A;  2UXD K;  4DB3 A;  4CEC A;  3FZF A;  2OPR A;  4I7F A;  4FWL A;  3THV A;  3H3N O;  2HHW A;  4KKO A;  4Q5V A;  3CME N;  4ICL A;  4EAH D;  4U67 L;  4V19 S;  3G6E N;  2ZGY A;  4W5O A;  1I3A A;  4JAX A;  3EE9 A;  4MFB A;  3VA0 A;  2D4W A;  3FFK B;  3AGR A;  4K25 A;  4ID5 A;  1QSY A;  4F3O A;  2OPP A;  4BR0 A;  4B9N A;  3HST B;  1DLO A;  2QXF A;  4WF9 L;  5AFU A;  5M1Q A;  4B3R K;  3CJA A;  1NGA A;  2IDO A;  3OVN A;  3TI0 A;  1BWF O;  3AVK A;  4DSE A;  4BAC A;  3OYB A;  1P90 A;  3D2E B;  4MDB A;  3AAP A;  1RDB A;  5HOO A;  5JLH A;  1O13 A;  3DWL A;  1C0M A;  1HKB A;  1BA0 A;  1QQO A;  5GIO A;  1WN7 A;  1IG8 A;  3KK7 A;  4BRM A;  4CZE A;  1NGI A;  4AH9 A;  5F1X A;  2WTU A;  3EZW A;  3TAQ A;  4H03 B;  4OPA A;  1RGI A;  1MU2 A;  1P8Z A;  4O4G A;  4DF4 A;  4LF6 K;  2P9S B;  1K9M O;  4J2E A;  2V7Y A;  3LPT A;  4KB1 A;  4DKW A;  1JLF A;  1FJG K;  2VWB A;  3A2F A;  4FW2 A;  4FLX A;  2ZJP L;  2FF6 A;  3CQX A;  2OAN A;  2OCE A;  1SKW A;  1SL1 A;  5CR4 A;  3S3M A;  5T7B A;  4FWR A;  3P5J A;  4LF4 K;  2Q0U A;  1ITG A;  3GL1 A;  3QIN A;  4PKH A;  2WBN A;  3VN5 A;  3DRP A;  3KLG A;  1TKT A;  4AHU A;  3CFR A;  2V7Z A;  3AAQ A;  3HVR A;  4C23 A;  4H8K A;  3RTV A;  1N5Y A;  4ISG A;  3GDQ A;  3JSM A;  4IFE A;  5GIP A;  3LDS A;  3IRX A;  3U8X A;  1VQO N;  2O4G A;  1IBK K;  3T1A A;  3LDP A;  3MMV A;  4Z4G A;  3N4P A;  3ZT1 A;  4HCB A;  2DFF A;  3KD5 E;  3VF4 A;  1NK4 A;  4JI5 K;  1SZ2 A;  4FWO A;  5E26 A;  3V4I A;  3MN7 A;  4ILH A;  4H5W A;  3TAR A;  4DV2 K;  1EET A;  4WQ5 C;  4OPH A;  3HYF A;  4CJW A;  1E3M A;  4FWS A;  3C6H A;  3EN9 A;  3K5L A;  3G71 N;  1JJ2 M;  3L0Q A;  1FKO A;  4YOY A;  4KAZ A;  2FBT A;  2ITM A;  3PO5 A;  4BY9 C;  4KPY A;  2HW3 A;  4H5T A;  1ZBF A;  4N56 A;  3OS2 A;  5TKW A;  5AQU A;  4NXM K;  3O3F A;  1OVY A;  1VRU A;  1FW6 A;  3M1F A;  3UE5 A;  1LCU A;  5FRN A;  3CCV N;  4M3Z A;  1JXB A;  2IS3 A;  4E7J A;  4PL8 A;  5AQV A;  4KRE A;  3CQ8 A;  4B1Z A;  1UWB A;  4OLB A;  1SUQ A;  4B1V A;  4YDU A;  4CEA A;  2HBL A; 
#chains in the Genus database with same CATH homology
 5KGX A;  1A5W A;  1KTQ A;  2YKM A;  4FW1 A;  5FRM A;  3KLE A;  1WSH A;  4KHU A;  4RW8 A;  5HLF A;  1HRH A;  1QE1 A;  3LAL A;  1YTU A;  3VQ5 A;  1RT2 A;  3AVH A;  3QIP A;  4CED A;  4JRP A;  4N47 A;  4ELV A;  4CJQ A;  1YVU A;  3HPH A;  4KTZ A;  2P5O A;  5C25 A;  3NGY A;  5J2M A;  1CLQ A;  4C8M A;  3K5M A;  3C94 A;  1HNI A;  2KFN A;  3RWU A;  1VSL A;  2B6A A;  3LAN A;  3HPG A;  5DMR A;  2YNG A;  4DTX A;  1ZBI A;  1TK0 A;  4OPJ A;  2Y1J A;  4YNQ A;  3I0S A;  4M3R A;  4CHZ A;  4UQG A;  4ZTF A;  4C8L A;  2A1S A;  2PZS A;  2OPS A;  4DFM A;  1J54 A;  1KLM A;  4CFB A;  1U47 A;  2QKK A;  1ASW A;  4W5N A;  3O3H A;  3PO4 A;  3ISN C;  4BE1 A;  1S1V A;  1D9F A;  2XRI A;  3AVN A;  4B8A B;  4N41 A;  3OS0 A;  2RN2 A;  3VQ8 A;  4E7L A;  3U3Y A;  4IKF A;  3FFI A;  1FXX A;  3C6T A;  3DRS A;  4FJ7 A;  4NYN A;  4CJ4 A;  3IAY A;  2OZS A;  4BE0 A;  5JS2 A;  1UA1 A;  2Z1J A;  4FJ5 A;  3SZ2 A;  1S9G A;  1GOB A;  3AA2 A;  4FK4 A;  4IG0 A;  3IS9 A;  4LSL A;  3HJF A;  3CG7 A;  3ZSV A;  2HHQ A;  5HP1 A;  4DTN A;  1NK7 A;  4QAG A;  4E0D A;  4F2R A;  5C24 A;  3IG1 A;  3AVM A;  2Z1I A;  5J2P A;  3T3F A;  4M42 A;  4M45 A;  4CJV A;  2B4J A;  2ITG A;  1NKB A;  2G8U A;  4FLZ A;  1HMV A;  1S1U A;  4B9M A;  4CCH A;  4M3U A;  4RW7 A;  1R0A A;  1UAX A;  5CYQ A;  2HMI A;  4PWD A;  1B9D A;  4BWM A;  2FBX A;  3K5N A;  4PA1 A;  2OYQ A;  1W9H A;  1VSF A;  4B9L A;  3B6P A;  2BE2 A;  4HUG A;  1TK5 A;  1NKC A;  2XO7 A;  1T7P A;  3MEE A;  1HNV A;  3AO1 A;  4LY7 A;  4E19 A;  3HPO A;  4BDY A;  2X74 A;  1RBV A;  1T8E A;  2PYJ A;  5JS1 A;  1UOC A;  1TL3 A;  3ITH A;  3SPY A;  4CFA A;  3OJS A;  2F8S A;  1IG9 A;  1BHL A;  1YT3 A;  1HYS A;  2DY4 A;  5FDL A;  1JLC A;  5SZT A;  3V1O A;  1G15 A;  3OYL A;  5KGW A;  3OYH A;  1RTJ A;  3DOK A;  3U6F A;  1JLA A;  4IDK A;  4DSI A;  3OYK A;  4JS4 A;  3VQA A;  4CGJ A;  4HUE A;  1EX4 A;  4DS4 A;  5K14 A;  1TK8 A;  4FJX A;  4Z4E A;  3WNE A;  4EP5 A;  3SQ0 A;  4CEE A;  3VA3 A;  4M41 A;  3KIO A;  4DQQ A;  1C1B A;  5J2N A;  3QEP A;  1C6V A;  4J2A A;  5HRP A;  1BIS A;  4OGC A;  2Z1H A;  4K8X A;  1JLQ A;  1RTH A;  2YNF A;  3CFO A;  3DYA A;  4MQ3 A;  2FBY A;  5EU7 A;  3F73 A;  1SKR A;  1D8Y A;  1QSL A;  3AVJ A;  5DK5 A;  2GBZ A;  2KW4 A;  1W0H A;  1Z26 A;  4CJP A;  3T19 A;  3V9X A;  5HRN A;  3BDP A;  1CXU A;  1C0U A;  4LH5 A;  4AHS A;  3OYG A;  2YHA A;  3KTQ A;  4B9T A;  3DLK A;  3DOL A;  2W42 A;  1B9F A;  3ZSO A;  4DLE A;  4DS5 A;  1BL3 A;  3HM9 A;  4AHT A;  4DTM A;  3PX4 A;  3ASM A;  1TVR A;  3TR8 A;  4BDZ A;  3RMD A;  2G8H A;  4B9V A;  1X9M A;  3VQE A;  4PQU A;  4F8R A;  3L2Q A;  1WAJ A;  3P1G A;  3K57 A;  3PX6 A;  2KZM A;  3NGI A;  2E6L A;  3SUP A;  4FLY A;  2G8F A;  2KFZ A;  4CFC A;  4DQR A;  2HNZ A;  3U3G A;  4I2P A;  4DSK A;  3HP6 A;  2Z1G A;  4CF8 A;  4FLW A;  1S5J A;  1JLB A;  3V9W A;  1HYZ A;  2VWJ A;  1NJZ A;  3SJJ A;  3V1R A;  1D9D A;  3LAK A;  1RT1 A;  1EP4 A;  2HHU A;  2HHX A;  1A5V A;  3NH2 A;  3RR8 A;  4L8R B;  1XWL A;  2WON A;  3K59 A;  2OA8 A;  3NF7 A;  1NJX A;  2G8I A;  3TWH A;  4BDP A;  3KLH A;  2HB5 A;  2YHB A;  4W5T A;  1VSM A;  3D0P A;  4HVJ A;  1WLJ A;  4M3X A;  1S6Q A;  2R7Y A;  5I3U A;  4KRF A;  2HVI A;  4F4K A;  4EP4 A;  1RNH A;  2I5J A;  3AA4 A;  3P83 D;  1RT5 A;  1TGO A;  3NF8 A;  4CFD A;  5J2Q A;  1DTQ A;  1NOY A;  4FZY A;  3DLH A;  3KLF A;  3K5O A;  3L2V A;  1FKP A;  4Z4C A;  1S9E A;  4O0I A;  3C95 A;  4W5Q A;  4FXD A;  2GV9 A;  2D0C A;  1QHT A;  3MED A;  3LZJ A;  4CGH A;  1IKX A;  1NK9 A;  4OGE A;  3LZI A;  1T05 A;  1KLN A;  1SL2 A;  3AVF A;  4KHY A;  3AVC A;  4KHS A;  1RBU A;  4F3T A;  4QCL A;  1XHX A;  4CES A;  1J9A A;  1I39 A;  3LP1 A;  3V1Q A;  4E7H A;  2YV0 X;  2ZE2 A;  1L3S A;  3SUQ A;  3KK3 A;  2XHB A;  1RDC A;  3OYF A;  1K6Y A;  1NOZ A;  4LD0 A;  2VG6 A;  4I2Q A;  3ZSQ A;  3PV8 A;  3SCX A;  4KFB A;  1SL0 A;  3AVB A;  3I0R A;  1J5O A;  3RRG A;  3CFP A;  4B3O A;  2FC0 A;  4CF9 A;  2HHT A;  1C0T A;  1WSE A;  3SQ1 A;  4FJJ A;  4CJE A;  1ASV A;  3L2W A;  4CEO A;  3KK2 A;  3QER A;  1EKE A;  2WOM A;  3HO1 A;  1NJY A;  2F96 A;  3RRH A;  3DM2 A;  4CJL A;  1WSI A;  2X6N A;  4CEB A;  3G0Z A;  5KRS A;  1F21 A;  4KI4 A;  3MEG A;  4I9L A;  2XY6 A;  1L5U A;  4NCB A;  4M3T A;  4DSL A;  4FLT A;  4OJR A;  4FLV A;  4DU4 A;  1NK0 A;  3UIQ A;  4J2B A;  1JXE A;  3VQ9 A;  2Y1I A;  1XC9 A;  1KVC A;  3DRR A;  3ZCM A;  4CIF A;  3LP2 A;  2G8V A;  4CJ3 A;  4CGI A;  4DTR A;  1TKZ A;  3M8S A;  1Y97 A;  2RF2 A;  4HHT A;  4DF8 A;  2BAN A;  2QKB A;  4CF1 A;  4E89 A;  4Z4H A;  5J1E A;  4DFJ A;  3EYZ A;  4O44 A;  3MEC A;  3KK1 A;  4TSX A;  2QK9 A;  4KTQ A;  3BGR A;  2ZQB A;  1BI4 A;  4FJH A;  2OPQ A;  4ID1 A;  4NCG A;  5KI6 A;  4LH4 A;  1WSF A;  2OZM A;  3K2P A;  3TAP A;  1BIU A;  3AVA A;  5I42 A;  3OYA A;  2AJQ A;  4CER A;  1S6P A;  4GMJ B;  3LWL A;  2XY7 A;  2FBV A;  3VQ6 A;  2DFE A;  1RDD A;  4FZX C;  1HQE A;  3QEV A;  3RMB A;  4OVL A;  4DG1 A;  3QEX A;  1GOC A;  2ZD1 A;  4RW6 A;  4CK3 A;  1LW0 A;  2DTU A;  2G8K A;  1VSE A;  4KTW A;  2F8T A;  4B08 A;  4XIU A;  1C1C A;  2X6S A;  4CHN A;  4FJI A;  4FK0 A;  3F9K A;  1WNS A;  1RBT A;  4DSJ A;  1XHZ A;  1VSJ A;  1CZ9 A;  3HL8 A;  3WNH A;  3HK2 A;  1S1X A;  3LP0 A;  3M8P A;  3KD1 E;  4JS5 A;  1JL1 A;  1DTT A;  1VSI A;  1TAQ A;  3OYJ A;  2NUB A;  3AO2 A;  3AO3 A;  1VK0 A;  5CZ2 A;  1L3V A;  1RCH A;  1X1P A;  3QLH A;  1JLG A;  1SKS A;  3CM5 A;  1TKD A;  3HP9 A;  3HVT A;  3VQC A;  5CY4 A;  4H4M A;  4CIG A;  3AVL A;  3ZSY A;  2EX3 A;  1A5X A;  4KV8 A;  2O4I A;  3NF9 A;  4Z0U A;  4C8O A;  4JLH A;  4M3Y A;  1IO2 A;  3L3U A;  1RT7 A;  4C8N A;  1QTM A;  4OKK A;  4CJF A;  3SV4 A;  2XY5 A;  1UA0 A;  1VSK A;  2LSN A;  4N5S A;  3RMA A;  3AV9 A;  4RW4 A;  1S1W A;  3ZSR A;  3WNF A;  2P1J A;  3LPU A;  1U04 A;  4DSF A;  4HTU A;  3ZT4 A;  4DTJ A;  1L3T A;  1Q9Y A;  1TAU A;  1RDA A;  2ETJ A;  3L2R A;  1ZBH A;  3OYD A;  4DU1 A;  3VQB A;  3SQ4 A;  2JGU A;  4B8C A;  4FCY A;  3KKR A;  3AA5 X;  2KQ2 A;  3HXM A;  1IKV A;  4YFU A;  4OLA A;  3PX0 A;  3NCI A;  4CHQ A;  1BGX T;  2IOC A;  3B6O A;  3CYM A;  4CEQ A;  5E41 A;  4E3S A;  1RBR A;  4O5B A;  3NGZ A;  4PUO A;  1CZB A;  4FJL A;  3M8R A;  3D45 A;  4QOZ B;  1LAW A;  3LWM A;  2RKI A;  1YTA A;  4CF2 A;  4DQP A;  5SWM A;  3K58 A;  1J53 A;  1EXQ A;  1D5A A;  3QES A;  4J2D A;  2KZZ A;  1LWE A;  4N76 A;  3JYT A;  4RW9 A;  2HVH A;  3V9U A;  1O1W A;  1XI1 A;  3LP3 A;  4LSN A;  3NDK A;  3DLG A;  3NFA A;  1JLE A;  3NF6 A;  3LAM A;  1IKY A;  4GW6 A;  3TAM A;  3EZ5 A;  1KFS A;  3AA3 A;  3VQ4 A;  3NH0 A;  3V81 A;  1T03 A;  4ELT A;  3QET A;  1WSG A;  3OYI A;  3TAN A;  1X9S A;  4KO0 A;  4FJ8 A;  4CEC A;  2D0B A;  3OYE A;  4DTS A;  5HRO A;  1QS4 A;  2OPR A;  4I7F A;  1NKE A;  4DWI A;  1TV6 A;  3THV A;  1IKW A;  4CHY A;  5KRT A;  1HJR A;  5HBM A;  3HT3 A;  3MXM A;  2HHW A;  3DLE A;  4KKO A;  4Q5V A;  3EY1 A;  4FLU A;  4IFV A;  2P51 A;  1L3U A;  1VSH A;  4ICL A;  1KFD A;  1WAF A;  2PY5 A;  3MAQ A;  3O3G A;  1TL1 A;  4CK1 A;  2GUI A;  3RR7 A;  3L3V A;  1FK9 A;  1U48 A;  3QO9 A;  1U49 A;  4W5O A;  1I3A A;  1IH7 A;  1LWF A;  4H4O A;  3I8D A;  3V9S A;  4CIE A;  1KVB A;  4OKJ A;  4KB0 A;  4MFB A;  3VA0 A;  2Q3S A;  1ZBL A;  2D5R A;  3TAE A;  2YNI A;  1ZBU A;  4CEZ A;  1WSJ A;  3L8B A;  3MXJ A;  4ID5 A;  1U45 A;  4CEF A;  1QSY A;  4IG3 A;  1LW2 A;  2OPP A;  1N6Q A;  4B9N A;  4F3O A;  4K8Z A;  3TAB A;  4CJU A;  4KHW A;  4O0J A;  3HST B;  2DFH A;  1DLO A;  1BI4 B;  2QXF A;  4RG8 A;  4CJS A;  4GVM A;  1KVA A;  1QQC A;  3PUF A;  4FM0 A;  3C6U A;  2IAJ A;  4CJT A;  1S1T A;  4FVM A;  4CJK A;  4FJ9 A;  1RT6 A;  3AO4 A;  4FYD A;  1HYV A;  4DU3 A;  2BDP A;  1HPZ A;  4B9S A;  4F2S A;  2IDO A;  3OVN A;  3TI0 A;  4KHN A;  3O4Q A;  4DMN A;  2HHS A;  5FRO A;  1JKH A;  2HHV A;  1LWC A;  3AVK A;  4BAC A;  4DSE A;  3OYB A;  4FM1 A;  3SYZ A;  1GOA A;  1RDB A;  3ZSX A;  5KTQ A;  3ZT2 A;  1KCF A;  4E7K A;  3MXI A;  3ULD A;  1C0M A;  3S3N A;  1WN7 A;  1LV5 A;  3VQ7 A;  1KRP A;  2D0A A;  4CGG A;  5CYM A;  3VQD A;  3TAQ A;  4AH9 A;  3ZSZ A;  1U4B A;  4DTO A;  4O4G A;  1MU2 A;  4DF4 A;  4G1Q A;  4Y1D A;  4DFP A;  2X78 A;  1NK5 A;  1RBS A;  5HRS A;  1BQN A;  4J2E A;  1ZYQ A;  3LPT A;  4CK2 A;  4I9Q A;  1BIZ A;  4CHO A;  1RT4 A;  4KB1 A;  4Q0B A;  1HQU A;  4EZ9 A;  1JLF A;  3A2F A;  4FW2 A;  3DI6 A;  4NCA A;  4AHR A;  4B9U A;  1LAV A;  4AHV A;  4DFK A;  4FLX A;  3TAF A;  2E6M A;  4FJM A;  3OYN A;  2A1R A;  4R5P A;  2ATQ A;  2KTQ A;  1SKW A;  1SL1 A;  3H08 A;  3S3M A;  3ZT3 A;  5CZ1 A;  1JL2 A;  5HRR A;  5T7B A;  4NYF A;  3P5J A;  4CGF A;  3ZT0 A;  4E1M A;  1ITG A;  3DMJ A;  3QIN A;  4CJR A;  3NHG A;  2YKN A;  3NAE A;  1BCO A;  3QEW A;  4DQI A;  3VQQ A;  2RPI A;  3OYM A;  1NK8 A;  3VN5 A;  2B5J A;  3DRP A;  1KSP A;  3O4N A;  3VQP A;  3KLG A;  3NBP A;  1TKT A;  1RTI A;  4AHU A;  3CFR A;  3V6D A;  3NH1 A;  3HVR A;  2E4L A;  3KKS A;  3WNG A;  4CF0 A;  3OJU A;  4HUF A;  1CXQ A;  3M8Q A;  4DTP A;  3SUN A;  4H8K A;  4JRQ A;  4FJK A;  3RTV A;  1N5Y A;  4DTU A;  4Y1C A;  1X9W A;  2BGG A;  3KLI A;  3JSM A;  4AIL C;  1SV5 A;  4ZHR A;  3LDS A;  1RTD A;  1NJW A;  3IRX A;  2PYL A;  4CHP A;  2O4G A;  4ELU A;  3SPZ A;  2IC3 A;  2IGI A;  1Z25 A;  2VWK A;  3T1A A;  3OYC A;  3KJV A;  1B92 A;  3NE6 A;  4AHC A;  1C1A A;  4FJN A;  4Z4G A;  3OS1 A;  1Q8I A;  3ZT1 A;  4HCB A;  1QSS A;  2EHG A;  4E1N A;  3V9Z A;  2YNH A;  2DFF A;  1RIL A;  3KD5 E;  3ALY A;  3AVI A;  1NK4 A;  4E7I A;  4W5R A;  4DLG A;  3V4I A;  2VG7 A;  4KI6 A;  3G10 A;  3S9H A;  3TAR A;  4EZ6 A;  1EET A;  2HND A;  3SQ2 A;  3AVG A;  3HYF A;  4CJW A;  4M3W A;  4Z4F A;  1RT3 A;  4CJ5 A;  4FM2 A;  4FJG A;  4HCC A;  5D3G A;  1NK6 A;  3K5L A;  3QNO A;  1FKO A;  4KAZ A;  2FBT A;  3E01 A;  5C42 A;  3QNN A;  3S3O A;  2VG5 A;  3PY8 A;  4KHQ A;  4FZZ A;  3PO5 A;  4Z4I A;  1BCM A;  4BWJ A;  4KPY A;  3SNN A;  2HW3 A;  1ZBF A;  3AO5 A;  4N56 A;  3OS2 A;  4CGD A;  2XY8 A;  4ZTJ A;  3O3F A;  4PY5 A;  4IBN A;  3OY9 A;  2HNY A;  3SUO A;  2JLE A;  1VRU A;  3DLB A;  1VRT A;  1REV A;  3TAG A;  3QEI A;  1TKX A;  5FRN A;  4C8K A;  4WE1 A;  4BE2 A;  3ZSW A;  4O55 A;  4FK2 A;  1VSD A;  3RMC A;  3SV3 A;  2P5G A;  4OPK A;  1BQM A;  4M3Z A;  3L2U A;  1JXB A;  2IS3 A;  4OKE A;  4CE9 A;  4IFY A;  1Q9X A;  3DLR A;  3SI6 A;  4E7J A;  3QIO A;  4KRE A;  3CM6 A;  3CQ8 A;  1ASU A;  1UWB A;  4OLB A;  1SUQ A;  4DQS A;  2G8W A;  4CEA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...