5KRTA

Hiv-1 integrase catalytic core domain (ccd) in complex with a fragment-derived allosteric inhibitor
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
152
structure length
143
Chain Sequence
SSPGIWQLDTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAAWWAGIKQEFGIPYNPGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRGGYSAGERIVDIIATD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title A New Class of Allosteric HIV-1 Integrase Inhibitors Identified by Crystallographic Fragment Screening of the Catalytic Core Domain.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Hydrolase, transferase/inhibitor
total genus 47
structure length 143
sequence length 152
ec nomenclature
pdb deposition date 2016-07-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5krtA00
3AVNA 3THVA 5HRSA 3TAEA 4Z4CA 3OYBA 1RT4A 4F2RA 2O4IA 1L3TA 1W0HA 4BDYA 4IFVA 1SL2A 3CFRA 3OYAA 4DTJA 2E6MA 1RCHA 1TL3A 3ZSRA 1L3SA 3K58A 4CHQA 4OKKA 1L5UA 3C95A 2G8UA 4DFPA 1LAVA 3T19A 3ALYA 1TK0A 1HMVA 1HNVA 3AVFA 3O4NA 4IFYA 3JYTA 2HHQA 1JLFA 3CM5A 4CJUA 4FJXA 1HRHA 2XY7A 4E7LA 1TV6A 2P5GA 1U04A 1UAXA 1QSLA 1VSEA 3S3MA 1NK8A 1NK9A 1KCFA 4CJVA 3ZSVA 4C8KA 1NK7A 3OYJA 2JGUA 3QINA 5HROA 3AA3A 1IG9A 2EX3A 3OJSA 1LW2A 5HRNA 2YV0X 1VSHA 3AO2A 3MAQA 1SKWA 4CF9A 4CFCA 1X9WA 2YNIA 1WLJA 2HW3A 3U3GA 4CJPA 2GBZA 3NF7A 4CEFA 4EP5A 3QEPA 1RBTA 2YNGA 1S9GA 3C6UA 2BGGA 1XHZA 1SL1A 3ULDA 4F3TA 1UWBA 4M45A 3OYHA 1QSYA 3K57A 2HHXA 1C6VA 1FK9A 1RBRA 1RTDA 4FW1A 4ELTA 4DF4A 2FC0A 1NJZA 1NJXA 3L2VA 3RWUA 1A5WA 1RDAA 4QAGA 4QOZB 1NJWA 3AO3A 3TWHA 4AHCA 4FZZA 1CZ9A 3AA5X 3I0RA 3NBPA 1NK0A 3NDKA 4PWDA 4HHTA 3VA3A 4H8KA 4J2EA 3ASMA 5KRTA 4FJJA 3AA4A 1YT3A 3DLEA 4DQSA 5KI6A 2DFFA 5HRPA 4M3XA 3VQEA 4W5QA 2X74A 4ELUA 3ISNC 4B9UA 4PQUA 3AVLA 3VQ9A 3AVAA 3PUFA 3DLHA 1EXQA 3DOLA 4RW8A 1U47A 3VQQA 3F9KA 3KLEA 3SV3A 2G8WA 4M3TA 1TKTA 4N47A 3KLFA 3KLHA 4CEOA 1HJRA 3U6FA 3B6OA 4DSIA 4YNQA 3KK2A 3HK2A 1BL3A 1NK6A 2WOMA 4CGGA 4DSFA 4FW2A 1ITGA 2E4LA 1C0MA 1RT5A 4Z4EA 4PY5A 3TAFA 4OLAA 2BDPA 2HNDA 4B9MA 2P5OA 4IG3A 2KQ2A 1JKHA 3RMCA 1N5YA 4DWIA 1RDCA 3CFPA 4CJKA 1WSIA 4CJ5A 2OPRA 3DLRA 4DQRA 1IKYA 1KLMA 4O44A 4CJFA 3FFIA 4CIEA 1ASUA 4BE1A 2FBVA 2OYQA 3HM9A 4FLTA 1HPZA 4YFUA 1HYSA 1A5XA 2VWKA 4B9VA 3OYCA 1BHLA 3HJFA 4JRQA 3DLGA 4OJRA 1WSFA 2ETJA 2NUBA 4O5BA 3OYKA 4M42A 2HVHA 4Q5VA 3ZSYA 3HYFA 3MXIA 4Z4FA 2KZZA 3TR8A 3SV4A 1T05A 3CM6A 4CK3A 4DTRA 4E1NA 4B8AB 3TI0A 4DF8A 3MXJA 4RW4A 3KK1A 4B9LA 4LSNA 3QIOA 4FZXC 3DLBA 3NFAA 3KTQA 1DTTA 4AHTA 3U3YA 3LWLA 3QEWA 4E7IA 2HMIA 1NKCA 2KW4A 3D45A 3RRGA 4FLVA 1S1TA 4JLHA 4B8CA 1IKVA 4CJEA 5J1EA 3IAYA 4IKFA 1EETA 1J5OA 1C0TA 1KVBA 4TSXA 2HNZA 4CEZA 3KKRA 3BDPA 4CIFA 3O3GA 3KD1E 1TVRA 4O0JA 1D8YA 4NYNA 4FK2A 2IAJA 4FK4A 2KZMA 5CYMA 1QE1A 1RT3A 2XY8A 4CESA 5T7BA 4W5TA 1IKWA 4E89A 1RT7A 4BDZA 2B5JA 4C8MA 4AHRA 2RPIA 4NYFA 5DMRA 1XHXA 3ZSWA 4NCBA 1KVCA 3VQ4A 1XI1A 4N76A 1BCOA 4RW9A 3P83D 4DTXA 1EX4A 3ZSXA 2GUIA 1L3VA 1KSPA 2G8IA 1XWLA 3HP9A 4EP4A 3VQBA 2B4JA 2ZQBA 3OYGA 3K5LA 4E7KA 4CF8A 3NF9A 2PZSA 4B9SA 3LPUA 1T03A 3TAQA 2BANA 1A5VA 3RR7A 4FJNA 1CXUA 1JLAA 4F3OA 2X6NA 2PYLA 1S1UA 1TAUA 4R5PA 3SJJA 2WONA 3C94A 1G15A 3ITHA 1KRPA 4OLBA 3ZSOA 1HYZA 1S9EA 3SQ2A 4DLGA 3WNEA 3NGYA 1RTJA 2HB5A 4DMNA 1BGXT 4G1QA 3LZIA 3LANA 4CJTA 2YHAA 4IG0A 4AILC 4KHQA 2O4GA 3EY1A 1EP4A 4KB1A 3VQCA 1MU2A 1NKEA 1JL2A 3LAKA 4DU3A 4BDPA 2D0AA 3PX6A 4KHNA 3V1QA 3KD5E 1ZBHA 1U48A 1KVAA 4KHYA 3SPYA 3AV9A 4DSEA 4CJ4A 1RNHA 3JSMA 4H4OA 4CEQA 4EZ9A 4FLXA 1BQMA 4KHSA 2BE2A 3V6DA 3I0SA 1ZBFA 3QLHA 4I2QA 1JLCA 1VRTA 1ZBLA 1KFDA 4CJQA 3O3FA 1NOZA 4FM0A 1ASWA 4KTQA 4UQGA 4K8ZA 4IDKA 3QIPA 2YNHA 3VQDA 4ZTFA 3L3VA 2KTQA 1VSLA 3NH1A 3IS9A 1S6QA 4BACA 1RT2A 1BISA 3OVNA 3WNFA 3A2FA 4RG8A 4BWMA 4OPJA 4HUFA 3PV8A 5I42A 3M8RA 3ZSZA 4M3ZA 4ZHRA 4F8RA 1T7PA 4I2PA 3WNHA 4HCBA 4GVMA 1BI4B 4L8RB 1RILA 4DQIA 1TKDA 3EZ5A 5C42A 3OS0A 4CE9A 3TABA 3SUQA 3SQ1A 1BIZA 2F8TA 5CZ1A 3ZCMA 2HHVA 3OYMA 1UA1A 2VWJA 2OPSA 3VQAA 4CGHA 2IOCA 3OYLA 1Q9YA 3VQ6A 1C1BA 2Z1GA 4BE0A 3RRHA 4KI6A 1BQNA 3VQ8A 5EU7A 4CEBA 3PX0A 2X78A 3OYIA 3AO1A 3VQ7A 4DS5A 1VSIA 3AVMA 3G10A 1X9SA 3HVRA 4Z4IA 2YHBA 1RDBA 4FJHA 2OPQA 3HPOA 1IO2A 2A1SA 4KTWA 3V9ZA 1QS4A 3KKSA 1RBUA 3KLIA 3SUPA 4KAZA 1VSMA 3AVKA 3NF8A 2DFEA 4OGEA 2RF2A 3HPGA 3LPTA 5J2NA 4WE1A 1Y97A 1ZBIA 3HXMA 2D0BA 3O3HA 4LD0A 3V9WA 1XC9A 1VRUA 4CJLA 1N6QA 3DYAA 4FVMA 4B08A 4MQ3A 4FJLA 4KREA 3OYNA 3DM2A 1U45A 1B9FA 1D5AA 2HNYA 3CYMA 4DFMA 1B9DA 2OA8A 5D3GA 4QCLA 4FLYA 4PUOA 4OVLA 4CEDA 1L3UA 4DTPA 4J2DA 4XIUA 2ZE2A 3M8PA 4B3OA 4CFBA 3DRRA 5DK5A 3MEGA 3VQPA 3ZSQA 4HCCA 3LZJA 3SZ2A 1DTQA 2Z1HA 5FDLA 1WSGA 3ZT4A 3L8BA 4ID1A 4IBNA 1F21A 4CJ3A 3NGZA 4DSJA 4Z4GA 3HP6A 5J2PA 4BE2A 3ZT3A 4CECA 3S3OA 4RW6A 3NH2A 1LAWA 3NHGA 3AVIA 1EKEA 5KGWA 3WNGA 3RTVA 4W5NA 1Z26A 4N5SA 4CFDA 3SUNA 3LP3A 3OS2A 3V1OA 4OKJA 4E3SA 3QEXA 4FJ9A 2XRIA 3KJVA 1NOYA 4CCHA 2I5JA 3RMDA 1S1XA 4ZTJA 2D0CA 1C1CA 3ZT2A 5CYQA 3T3FA 1SKRA 4C8NA 2PY5A 5KTQA 3I8DA 3V81A 4FZYA 1SUQA 2XO7A 1BCMA 1BIUA 4OGCA 3K2PA 4DTNA 1LWCA 2FBTA 4FM1A 4FK0A 4CF1A 4AHUA 4CEAA 3T1AA 4N41A 4M3WA 2HHTA 1TKXA 5E41A 3OYFA 3LP0A 3UIQA 1C1AA 5I3UA 4FLZA 1LWFA 1J54A 4ID5A 3NF6A 4CGIA 1HQUA 1VSDA 3LP1A 3LDSA 4DLEA 1WAFA 2X6SA 5C24A 4E19A 4FLUA 3V9XA 3BGRA 4E7JA 3LALA 4KO0A 4DU4A 5HP1A 2PYJA 4ELVA 5FRMA 3L2UA 1I39A 3K5NA 1GOBA 1WNSA 1TL1A 3M8QA 4LH5A 3HT3A 3EYZA 3LP2A 3KLGA 4FJMA 4KPYA 5HBMA 2GV9A 3AVJA 1JXBA 3V1RA 2Y1IA 2YKMA 3V4IA 4KHWA 3MEDA 2E6LA 3QESA 4DFKA 1CXQA 2FBYA 3HPHA 4CF0A 3HL8A 4C8LA 2KFNA 3AO5A 4DQQA 3VN5A 4N56A 4FLWA 1RTHA 1FKOA 1HQEA 1J9AA 3K59A 3PO4A 1RTIA 4MFBA 2JLEA 1Q8IA 4O4GA 3NH0A 4Y1DA 4AHSA 2G8VA 4DTOA 1B92A 4KTZA 3MXMA 1SKSA 3QERA 1HNIA 4C8OA 1JLEA 4AH9A 4I9LA 5JS1A 4CEEA 2QKKA 4FJIA 2KFZA 4FJ8A 3AVCA 4CK1A 4OPKA 3KK3A 2XHBA 4JS5A 1ASVA 4CHPA 3QO9A 3AVGA 3V9SA 4B9NA 4PA1A 3MECA 2RKIA 4W5RA 1WSJA 2IGIA 4FM2A 3S9HA 3P5JA 1LV5A 4FJ7A 3O4QA 4CHNA 1R0AA 2IDOA 4ICLA 2W42A 2Y1JA 3NE6A 4F2SA 4CFAA 4HUGA 3VQ5A 4Y1CA 3HSTB 3SI6A 1GOCA 2ZD1A 4HVJA 3KIOA 4F4KA 4CJWA 2D5RA 3L3UA 2YNFA 3DI6A 4CERA 4CJSA 3NAEA 4KFBA 3DMJA 1WSHA 3IRXA 2YKNA 3SYZA 1KLNA 2Z1IA 3NGIA 3RR8A 1KTQA 3G0ZA 3OJUA 2HHUA 1I3AA 3S3NA 3L2WA 2ITGA 3H08A 3PX4A 2DFHA 1WSEA 3DLKA 3LAMA 4J2BA 5FRNA 1K6YA 5J2QA 4M3RA 4JRPA 1S1WA 1RDDA 5HRRA 3TANA 3PO5A 4CF2A 3NCIA 3F73A 4FJGA 4DFJA 1UOCA 4DG1A 1RT1A 2VG6A 5SZTA 3AA2A 1U49A 4M3YA 3TAGA 1S6PA 2OZSA 1S5JA 4BWJA 4H4MA 4KRFA 2IS3A 3CQ8A 4DQPA 1VSKA 3SUOA 1QSSA 5CZ2A 2EHGA 3SPZA 2F96A 1QTMA 2HVIA 4CHYA 1RBSA 5CY4A 1NKBA 2QKBA 1IKXA 1T8EA 4O0IA 1TAQA 3P1GA 4CHOA 4CJRA 3SNNA 4NCGA 4E7HA 1U4BA 3TAMA 1CZBA 1JL1A 2OPPA 2FBXA 2LSNA 2G8KA 1ZBUA 1YVUA 4DSKA 4DTUA 3OY9A 4GW6A 1TK5A 1X9MA 1D9FA 4Z4HA 1RT6A 4CIGA 4I9QA 4DU1A 1BI4A 1REVA 4GMJB 4KV8A 3AO4A 4K8XA 2B6AA 2IC3A 1J53A 1VSFA 1TGOA 2P1JA 4B9TA 1Z25A 1SL0A 3C6TA 4CHZA 4CGFA 5KRSA 5SWMA 3QEVA 2ATQA 3TARA 1Q9XA 3VA0A 1FXXA 2F8SA 4M3UA 1QHTA 1VSJA 2DY4A 3TAPA 1JLQA 4CGJA 4FYDA 1FKPA 1WAJA 2VG5A 4Q0BA 3E01A 1JLGA 1GOAA 2QXFA 1TK8A 4AHVA 4W5OA 4LSLA 4KKOA 1CLQA 1YTAA 3SCXA 3DOKA 3AVHA 3QNNA 2Z1JA 3ZT1A 3V9UA 2RN2A 3DRPA 5K14A 5JS2A 4M41A 4FCYA 2AJQA 3LWMA 3OYEA 2Q3SA 1W9HA 4CGDA 3PY8A 5J2MA 1C0UA 3K5MA 1DLOA 4HUEA 5HLFA 2A1RA 4OKEA 2P51A 4O55A 2HHWA 4J2AA 3M8SA 3OS1A 1NK4A 3CG7A 4I7FA 2G8FA 4NCAA 3QEIA 4FJ5A 3L2QA 1KFSA 4KI4A 1JXEA 3MEEA 3QNOA 4EZ6A 1WN7A 4E1MA 5KGXA 4KHUA 1S1VA 1ZYQA 3HVTA 4DTMA 1HYVA 4E0DA 1O1WA 1SV5A 3QETA 1LWEA 1TKZA 3B6PA 1LW0A 1VK0A 3CFOA 1UA0A 1D9DA 2XY5A 3HO1A 3RMAA 4KB0A 1NK5A 4Z0UA 3DRSA 4LH4A 1YTUA 2HHSA 2G8HA 3K5OA 1RBVA 4LY7A 2OZMA 2R7YA 3D0PA 1JLBA 1QQCA 3ZT0A 1NJYA 5C25A 3OYDA 3SQ4A 2QK9A 4HTUA 3L2RA 4JS4A 1IH7A 4DSLA 3SQ0A 3RMBA 4DTSA 5FROA 3AVBA 2DTUA 4CK2A 1X1PA 4DS4A 4FJKA 3IG1A 4FXDA 4RW7A 2VG7A 2XY6A
chains in the Genus database with same CATH superfamily
3BEXA 1RT4A 4IFVA 1SL2A 3MX5A 1TL3A 2G8UA 4OKKA 4GKJK 3C95A 5BPNA 4C1NI 3LM9A 3AVFA 3O4NA 4WQ4A 2HHQA 4FJXA 1HRHA 1N34K 4JAXA 3S3MA 4DR5K 3E9OA 4IWVA 1MA9B 4FWPA 5HROA 2FF6A 1IG9A 2O8CB 3AA3A 2EX3A 3OJSA 1X9JA 3O8MA 1ZXOA 1VSHA 3AO2A 4CF9A 5EOYA 1WLJA 2HW3A 3OA9A 2OCEA 4CJPA 2V52B 3F5TA 1XHZA 3FZFA 1UWBA 3OYHA 3H6EA 3K57A 1BDGA 3BUZB 5EXWA 5F2RA 2P9PB 2O8FB 1RDAA 3ZX2A 1NJWA 1NK0A 5AQKA 3SJHA 2A5XA 2P9KA 4H8KA 3WXKA 5AQIA 2UUAK 1YT3A 2O8EB 2DFFA 5HRPA 3CCQN 2HOEA 3ISNC 2ZM6K 2ZGYA 3AVLA 3WXJA 2GELA 1EXQA 4DQ8A 4RW8A 4K0KK 3ULEA 5LY3A 4BRHA 4M3TA 1TKTA 5MLCQ 3B6OA 4DSIA 2NRZA 3KK2A 3HK2A 4CGGA 1ITGA 2E4LA 4Z4EA 4OLAA 4BRKA 3I33A 3L6QA 3D2FA 3CFPA 2OPRA 3AGRA 3DLRA 4CJFA 3FFIA 1ASUA 1ATRA 1NU0A 1HPZA 3CCJN 4YFUA 1HYSA 1Q82O 4OJRA 2NUBA 3OYKA 1G99A 3AAQA 3KHYA 3AAPA 4XH4A 3TR8A 2GUPA 4H5NA 1BOTO 1EWRA 4DF8A 3MXJA 4JI7K 1WB9A 2Q97A 4IO9L 1W7AA 2KW4A 4U7BA 4CJEA 5J1EA 4IKFA 2IIRA 1J5OA 1KVBA 3KKRA 3BDPA 3KD1E 4H0OA 1TVRA 4NYNA 4FK2A 2IAJA 4DCHA 5FPNA 1QE1A 1RT3A 3UB5A 4CESA 4CZFA 1IKWA 2W41A 3I55N 4CW7B 2QW9A 3LM2A 4NCBA 4N76A 1BUPA 4ISFA 4DTXA 4WF9L 3HP9A 3VQBA 4E7KA 4FJNA 3CMEN 1A5VA 2HBLA 3RR7A 1CXUA 1D4XA 3SLCA 4F3OA 1TAUA 3C94A 4BRLA 1XMQK 5A2QO 3T1HK 4H5VA 4DLGA 3HOSA 3MWPA 1RTJA 2WTUA 2YHAA 2O4GA 4FWOA 4KB1A 4RCHA 3LDPA 4DU3A 4XH1A 4A62A 2D0AA 4JKGB 4LF9K 4KHYA 1KVAA 4CJ4A 2D4WA 3V6DA 4DR2K 3I0SA 3IMXA 3QLHA 4I2QA 4A2AA 3CD6N 1YHQN 1KFDA 3H45C 3O3FA 4FM0A 1ASWA 4CD1A 1Z6RA 1VQNN 3THXA 4G9ZA 5AJ3K 1JCGA 3IS9A 3LDNA 1S6QA 3DXKA 5I42A 4RG8A 4BWMA 3M8RA 3ULEB 3R3LA 4ZHRA 3KZBA 4DQIA 5AZJB 5C42A 3PIOL 4CE9A 2GTDA 1NGAA 3FZKA 5F1XA 3D2FB 4IFEA 2IOCA 2YJFA 1Q9YA 4KI6A 4PKIA 1BQNA 3MN9A 3AO1A 3KWGA 3CJ7A 3TSUA 1X9SA 4JI4K 1RDBA 2OPQA 3HPOA 1IO2A 2ASPA 1QS4A 4DR1K 4KAZA 2DFEA 3WXLA 5AR0A 2RF2A 3VPZA 3HPGA 5ADXH 2VGNA 3O3HA 3V9WA 4B1UB 4CZGA 3ZLJA 3OYNA 3DM2A 1YITN 1D5AA 3CYMA 3H3NO 5JMVA 3HI0A 5D3GA 1NGEA 4IEIA 1L3UA 5AQYA 2ZE2A 3M8PA 5AQRA 4B3OA 3EO3A 3J7AP 1DTQA 3E1YA 1XMOK 3L8BA 4PL8A 1JCEA 4IBNA 2D1KA 4H0YB 3M5RA 5B8HA 3WUHA 4BQZA 4CECA 3NH2A 4H0VB 3RTVA 4N5SA 3AARA 4FWRA 3LP3A 2GX9A 3CJBA 4NO7A 2VYPA 3V1OA 2XRIA 1NOYA 4JI3K 3NVMA 1OH7A 3CC2N 2D0CA 1C1CA 5KQDA 4C8NA 3I8DA 3V81A 5HL7L 3MN7A 1BIUA 4MDBA 4OGCA 4DTNA 1LWCA 4FM1A 4CF1A 4AHUA 1V4TA 4CEAA 2O8BA 4BRIA 1TKXA 3OYFA 1C1AA 1YJNN 5I3UA 1LWFA 1W97L 4DLEA 4MDAA 3LDSA 1QVFM 1WAFA 2X6SA 4A5AA 2NRWA 5C2FA 4E7JA 3BGRA 4KO0A 3VEVA 5HP1A 4WCEL 3M8QA 3V1RA 3THXB 4JHDA 2FBYA 3HPHA 3KWIA 1IV0A 4FLWA 1FKOA 3A5OC 5M1PA 3K59A 1J5EK 4B1ZA 1TUUA 3PO4A 3DXKB 3W0LA 3TU5A 2AP1A 2JLEA 4WQ5A 4O4GA 5BPMA 3NH0A 4H5TA 1B92A 3LDOA 4AH9A 5JS1A 4CEEA 2QKKA 4CBUA 4FJ8A 3WT0A 5LL6Z 4B9NA 3P5JA 4H0TB 4CHNA 1R0AA 2IDOA 4K25A 3NE6A 4F2SA 2NRTA 1NGDA 5M1OA 3CHWA 4IDHA 3P38A 2ZD1A 1XNQK 4JV5K 3DMJA 2Q0RA 3ZX3A 3ENBA 3PSFA 4DV3K 3HTVA 4EAHD 3OJUA 2HHUA 4CZHA 5IWAK 2ITGA 3H08A 2JWLA 4M3RA 2A41A 3J80O 5GAGP 1RDDA 5HRRA 3TANA 1QQOA 4BC4A 1UOCA 4DG1A 4JKFA 1VQ4N 4BWJA 4IEEA 4KRFA 5AQMA 1VSKA 2F96A 4C1NK 1T8EA 4CZKA 1CZBA 1OH8A 1GLAG 1YVUA 3ATVA 1K8KA 1X9MA 1D9FA 2PBDA 2E2NA 3NVKA 3MCPA 3ATUA 2IC3A 2P1JA 3CPEA 4CHZA 3SAHA 3QEVA 1LOTB 4CGJA 5M1QA 3VEZA 4Q0BA 2VG5A 2QXFA 1TK8A 3M3ZA 3N4QA 2F9TA 3SCXA 3QNNA 2Z1JA 2RN2A 3K9KA 5JS2A 3CCLN 5J2MA 5HLFA 4DUZK 2HHWA 3MDQA 1NK4A 3QEIA 4YOXA 3WQTA 3HVTA 3U9DA 3ZETB 3ZEUA 1O1WA 3QETA 3A5MC 1D9DA 1OH6A 2RE2A 4OX9K 4KB0A 4Z0UA 1YTUA 1BWFO 4LF5K 2R7YA 1JLBA 4HTUA 3L2RA 3CIPA 4JS4A 4GKKK 3J81O 4DTSA 5FROA 4EFHA 4FWQA 4JD2A 2ZJQL 2QEXN 4LFCK 5AQTA 4DV2K 3THVA 2PAVA 3E66A 4CZIA 4Z4CA 4HWIA 3VTIA 4F2RA 4BDYA 5JLFA 1HR0K 4FWKA 3K58A 1L5UA 5ELZA 3T19A 1TK0A 1HMVA 2BUPA 3G25A 5AQLA 1HNVA 2GWKA 2YHXA 4CJUA 2XY7A 4E7LA 3CMAN 1UAXA 1QSLA 2UXDK 3MK6A 1NK9A 1KCFA 3VESA 4C8KA 4PKHA 3CJ1A 3QINA 1GLEG 3VOVA 4A5BA 4BC3A 4BRQA 3MAQA 1SKWA 3U3GA 2UXBK 4IXCA 3T1YK 4JYAK 2Q36A 4CEFA 1BA1A 3QEPA 3C6UA 2BGGA 1U2VA 3BZKA 3ULDA 4B1YB 4FW1A 4ELTA 4DF4A 2FC0A 1NJZA 1NJXA 3L2VA 3RWUA 4NXNK 4QOZB 3TWHA 4FL9A 5AQOA 4HHTA 2ZGZA 3DLEA 4M3XA 4BRDA 3PUFA 3DLHA 3DOLA 1U47A 2G8WA 1HX1A 4JK8A 1HJRA 4YHHK 1NK6A 2WOMA 4DSFA 3GDQA 3TAFA 4LF6K 2HNDA 1T3VA 1BU6O 4C23A 3RMCA 4AM7A 4DWIA 1RDCA 2NNWA 1IKYA 4O44A 2FBVA 4BRMA 4B9VA 3ZEUB 4FPBA 2A42A 4O5BA 2ETJA 1T44A 3CCRN 3MXIA 3HYFA 2E88A 4B9QA 1T05A 3C6HA 4YDUC 4DTRA 4E1NA 4BQLA 4RW4A 1HLUA 5EVZA 1V4SA 4LSNA 3QIOA 2A3ZA 4NB4A 4FZXC 3KTQA 4AHTA 4DUYK 4E7IA 4JD2B 4H0XB 1NKCA 3H1QA 1Q86O 1EETA 1C0TA 2HNZA 1VAZA 4O0JA 2CH5A 1D8YA 2UU9K 2W40A 4FK4A 4JK9A 4GV6A 5CYMA 4F9OA 4BDZA 2B5JA 4KH5A 2RPIA 2ZJPL 5DMRA 3UE5A 3VQ4A 1BCOA 2FF3B 3P83D 4FWLA 2GUIA 3R9PA 4PKGA 2ZWHA 3O5BA 1KSPA 2JWKA 4EP4A 3FZHA 1VQLN 3K5LA 1IBKK 1VQ7N 3EE8A 3T69A 5AQNA 1S1UA 4R5PA 2WONA 4JEPA 1S22A 2IVOA 1KC8O 4R79A 4ISEA 4CZJA 1P8ZA 1BGXT 4KHQA 1U2VB 3EY1A 1MU2A 4KHNA 3V1QA 1ZBHA 3SPYA 4DSEA 4H4OA 2BE2A 3L4QA 4GNIA 1ZBFA 1IBMK 3QIPA 1OVQA 1KQSM 4ZTFA 1HNXK 3PIPL 3NH1A 5KPZA 4PL7A 1NGHA 4BACA 4CVNE 1BISA 4JKEA 3A2FA 4CBXA 4F8RA 1T7PA 4I2PA 4GVMA 1RILA 2HF3A 1TKDA 3DXMA 3EZ5A 2E2PA 3OS0A 3CF5L 3TTCA 3J8AA 4CGHA 5M1NA 3CQYA 1VQ8N 1C1BA 2QWOA 3P4IA 4QS8A 4A2BA 5EU7A 4CEBA 3PX0A 5CR4A 4CBWA 3VQ7A 1ATSA 4JNEA 3HVRA 4Z4IA 2YHBA 2A1SA 3KKSA 3KLIA 3SUPA 1S72N 5GIPA 4WE1A 5CE3A 1XC9A 4KREA 4EHUA 1B9FA 2RHKA 2HNYA 4DFMA 1B9DA 4QCLA 2A40A 4OVLA 4CEDA 4DKWA 4BR0A 3DRRA 5DK5A 3MEGA 3ENOA 2Z1HA 3AY9A 2P9NA 1FW6A 4Z4GA 2GEMA 3HP6A 4BE2A 3ZT3A 4BGBA 1LAWA 1EKEA 4W5NA 5KQ8A 3OS2A 4FJ9A 4OKJA 4CCHA 1S1XA 4ZTJA 5AQUA 2V7YA 5KTQA 3K9JA 2Q1NA 3EL2A 4I6MA 1SUQA 2WBNA 3T1AA 3FR0A 4M3WA 3VTHA 5FPEA 3ID6A 4KBOA 5BPLA 4FLZA 1NMDA 4YOWA 4CGIA 1HQUA 4E19A 5BRFA 4Z94A 3L2UA 1K73O 1I39A 3JS6A 3NMUA 4LH5A 4KPYA 2Q31A 2Y1IA 2YKMA 1M1KO 3QESA 2WFBA 1CXQA 2KFNA 2QWLA 3VN5A 4N56A 1HQEA 1VQ9N 3MN6A 5ADXA 1EQYA 5AQJA 2G8VA 4C8OA 3MXMA 1SKSA 4DV0K 1OKJA 3C0BA 2KFZA 4FJIA 2GWJA 4Y0WA 2NZTA 4CK1A 4OPKA 3KK3A 2XHBA 1ASVA 3QO9A 3AVGA 3V9SA 3DAWA 2P9KB 1WSJA 1T6DA 4ICLA 4AQYK 1Z05A 4Y1CA 4RWTA 1EWQA 1KAYA 3KK7A 3FLCO 4CJSA 3IRXA 1YI2N 3SYZA 1VQKN 3VGMA 3NGIA 3RR8A 1KTQA 3UKUA 3J7ZO 1I3AA 3VEYA 5FRNA 2DFHA 1WSEA 4BC5A 4JRPA 1H1VA 3CPWM 3F9MA 3PO5A 4CF2A 1U49A 3OHRA 1NLVA 3CC7N 2A6AA 2I7NA 3TAGA 1S6PA 5AQXA 3LDLA 4X62K 3W3DA 3KVGA 1QSSA 4BC2A 2EHGA 3R1XA 3SPZA 2E1ZA 4IO8A 2QKBA 4O0IA 2E1YA 3SNNA 5LJVA 2J4RA 2OPPA 2FBXA 3ENHA 1ZBUA 1X3MA 3CETA 4Z4HA 3A5NC 2QXLA 4CIGA 4DU1A 1BI4A 3QDKA 1NWKA 4KV8A 3AO4A 2E5LK 3LL3A 3H46O 2B6AA 1J53A 1TGOA 1N36K 5SWMA 4I6MB 4IJNA 5FPDA 3EE9A 5LMUK 4O5FA 4LSLA 4JKCA 4B3TK 1QQNA 3ZT1A 3V9UA 5K14A 4IOAL 2AJQA 2Q3SA 4YY3K 1KXPA 4OO1J 4EIAA 3CJAA 4NLBA 4OKEA 2P51A 2QWQA 2E20A 3IFRA 3S41A 3FFKB 3M8SA 3CG7A 4I7FA 4KI4A 3MEEA 4EZ6A 1WN7A 4FWMA 3TTFA 3O4WA 4KHUA 4DHYA 1NGCA 3VF4A 1LWEA 3MN5A 3B6PA 1LW0A 1VK0A 3CFOA 2P9UA 4YOUA 2XY5A 3O9RA 3K5OA 4LY7A 1NJYA 3ZT0A 3SQ4A 3OYDA 1RDWX 3OBWA 1IH7A 4DR7K 3OW2M 3RMBA 1C0FA 1MDUB 4CK2A 5IT9O 1X1PA 4FJKA 4BR2A 4FXDA 2VG7A 2XY6A 3AVNA 5HRSA 3CCEN 3RVCA 3K0SA 4A59A 3OYBA 1L3TA 1W0HA 3O9QA 3CFRA 4X64K 3OYAA 4DTJA 3SMSA 3ZSRA 4CHQA 1BA0A 4LFAK 2QTDA 3JYTA 1E4FT 2QA4N 1JLFA 1CZAN 3CM5A 1RDUA 1U04A 3I8BA 3ZSVA 1NK7A 2JGUA 1NGGA 4CFCA 2YNIA 2GBZA 3NF7A 4EP5A 1RBTA 1SL1A 4M45A 2OANA 4YDUA 2HHXA 2KHOA 1C6VA 1RBRA 4UY8O 4FZZA 4AHCA 2CGLA 3AA5X 1I94K 3NBPA 3H1VX 4J2EA 4FWNA 3ASMA 2KKZA 4FJJA 3AA4A 4BG9A 4FOEA 3VQEA 4ELUA 4PQUA 3VETA 3TPQA 3M1FA 3F9KA 3KLFA 3KLHA 2QI2A 3U6FA 2FSJA 1BL3A 5AQVA 4BVPA 4FW2A 3DJCA 5FPMA 1C0MA 1RT5A 5BR9A 4PY5A 4B3RK 3EN9A 3D6RA 5M1KA 1R59O 3EKSA 3HRGA 4FPAA 4CJKA 1WSIA 4CJ5A 2O8BB 4DQRA 2CGJA 4BE1A 5KPTA 5AQPA 2NRVA 1BHLA 4FO0A 4M63C 3DLGA 4M42A 2HVHA 2YHWA 5AQFA 1YXQA 3CCVN 4Q5VA 2KZZA 3O6WA 1VQMN 3CM6A 4CK3A 2UYTA 4B8AB 3OTOK 4JHDB 3DLBA 1DTTA 3P39A 3U3YA 1ESVA 3LWLA 3SBGA 4WFNL 3D45A 3RRGA 3O9UA 4B8CA 1IKVA 3IAYA 1K8AO 1NBWA 4TSXA 4CEZA 2P5GA 5GIOA 2KZMA 1FJGK 1WUAA 1HUXA 5T7BA 4E89A 1RT7A 4C8MA 3M6GA 4NYFA 1XHXA 3C65A 4GY2B 1XI1A 5BRDA 4BRPA 4RW9A 1EX4A 4EHTA 1L3VA 2G8IA 1XWLA 4DR6K 3QFUA 4A61A 4KH6A 2B4JA 2WC9A 2ZQBA 4B9SA 3NF9A 3TSPA 2PZSA 3LPUA 4OLBA 2UUBK 2X6NA 2PYLA 4H5WA 4DV6K 2NRXA 1KRPA 3SQ2A 1BG3A 1WOQA 4NLCA 1WBBA 4DMNA 2VGMA 3LZIA 3LANA 5E26A 4IG0A 4CJTA 3C7NA 1NKEA 1VQPN 1JL2A 1M90O 4BDPA 4ILJA 3KD5E 1U48A 3AV9A 1BQMA 4KH4A 1N6QA 2YX6A 1NOZA 1RGIA 4IDKA 4JI8K 3VQDA 3PLAA 3L3VA 1JJ2M 1NM1A 4FVUA 3WXIA 3BF3A 4OPJA 3WNFA 1GLCG 1SAZA 4L3QA 4DR3K 3HSCA 1K8KB 3WNHA 2UXCK 1YJ9N 3SUQA 3GE1A 1BIZA 5CZ1A 2HHVA 5AQSA 1UA1A 2VWJA 3VQAA 3OYLA 4H03B 2Z1GA 3GL1A 3G4SN 4BE0A 3RRHA 3VQ8A 3OYIA 2AA4A 4ILGB 4DS5A 1VSIA 3G10A 4K41A 1IJJA 1HJOA 4FJHA 4LF7K 3V9ZA 1VQON 3CQXA 3VEOA 4WQ5C 4CI6A 1ZBIA 3BY5A 2D0BA 4LD0A 2OZMA 5M1FA 4CJLA 5BR8K 4FVMA 2QM1A 4MQ3A 1XNRK 3L0QA 1YVNA 2OA8A 4FLYA 3A8YA 4LC9B 3MX2A 4PUOA 1KAXA 1E3MA 4DTPA 3GOIA 2P9PA 4BVOA 3G71N 5C15A 4CFBA 3VQPA 4HCCA 2ASOA 3O08A 3ZT4A 4OPAA 2QWRA 2ITMA 2O8EA 3NGZA 4DSJA 3QICA 3S3OA 5JICA 3SAGA 2VCPA 3AVIA 5KGWA 2VQEK 1Z26A 4CFDA 3SUNA 3VF6A 4JKHA 4E3SA 3HZ6A 4JKBA 4NXMK 3KJVA 2I5JA 3RMDA 5AQZA 3ZT2A 5CYQA 3T3FA 4B1XB 2ZJRL 1BCMA 4FK0A 4N41A 4B3SK 5E41A 4GV3A 3UIQA 4FOIA 1Q81O 1J54A 1NMNA 2YHYA 2PYJA 3WXMB 1GLJO 4WFBL 4ELVA 3K5NA 3HT3A 1TL1A 5AQWA 3EYZA 4FJMA 4B3MK 2E6LA 4DFKA 4C8LA 3HL8A 5AFUA 3AO5A 4DQQA 1J9AA 2ZF5O 4Y1DA 4KTZA 4M7YA 1HNIA 1JLEA 3G6EN 1GLBG 1HNWK 3N4PA 4JS5A 4CHPA 4PA1A 3MECA 2RKIA 1LCUA 4W5RA 1LV5A 3VENA 2Y1JA 4K42A 4CFAA 4HUGA 4BY9C 2ASMA 2H3GX 3HSTB 1GOCA 4K43A 4HVJA 4F4KA 3RSEA 1QQMA 2D5RA 1YF5L 3VF2A 2YNFA 3DI6A 4CERA 4KFBA 5KPRA 1WSHA 3VERA 5AZIA 1KLNA 4YOTA 4BRGA 4GV9A 3G0ZA 1RFQA 3S3NA 3PX4A 3LAMA 4J2BA 3HOTA 1K6YA 5J2QA 1S1WA 4DV7K 3BZCA 3NCIA 3F73A 2IVNA 2WUSA 4DFJA 1RT1A 2E2OA 3AA2A 3TSQA 5BN8A 1E4GT 2OZSA 4JKGA 4H4MA 1HPMA 2IS3A 5AFUH 4DQPA 3SAFA 5CZ2A 1IBLK 1T6CA 1QTMA 4CHYA 5CY4A 1NKBA 1TAQA 1NGJA 4CJRA 1Q18A 4RTFD 4E7HA 1U4BA 3TAMA 1TYQA 1JL1A 4CJ7A 1XQSC 2W6KA 2G8KA 4DSKA 4DTUA 3UKRA 5I9EB 5LMNK 4K8XA 5AZJA 2VQFK 1VSFA 3THYA 4DR4K 3U9ZA 3C6TA 1N8RO 1Q9XA 2ATQA 3VA0A 4BR5A 3TAPA 1FKPA 3JXUA 1JLGA 1GOAA 4AHVA 4W5OA 1CLQA 4YORA 1YTAA 4BR7A 3OBYA 4FCYA 4X65K 3LWMA 4BROA 3OYEA 2F9WA 1W9HA 4CZLA 3CI5A 1C0UA 3K5MA 4HUEA 3R6MA 4O55A 4E1JA 5BREA 1KD1O 1XC3A 4WYBA 2G8FA 4NCAA 2P9IA 4FJ5A 1KFSA 1JXEA 3QNOA 3FE1A 5KGXA 1VQ5N 3D2EA 3EZWA 1HYVA 4E0DA 4H0PA 3BF1A 3HO1A 3RMAA 1YAGA 1NK5A 2KLAA 1QZ6A 3DRSA 4GVEA 4LH4A 2HHSA 1ATNA 5JVGL 1RBVA 3D0PA 1QQCA 2HMPA 2QK9A 1SQKA 2V7ZA 5C10A 5H1SQ 4DSLA 3SQ0A 3U4LA 3DLLL 4JI2K 4RW7A 4FJ7A 3RSEB 4BGAA 3I56N 3TAEA 2O4IA 2P9SA 5AZIB 3DXMB 2E6MA 1RCHA 2F8TA 1L3SA 4CD3A 1LAVA 4DFPA 3ALYA 3SK3A 3IKMA 3VEWA 2NLXA 4IFYA 1TV6A 5TKWA 1VSEA 1NK8A 4CJVA 3SMPA 3OYJA 5AQHA 3GG4A 3B8AX 5CHIA 1LW2A 5HRNA 2YV0X 1Y64A 3CJCA 3PSIA 1X9WA 3O80A 1NGFA 3ZX0A 1X3NA 5TKYA 4MO4A 2YNGA 3VGLA 1S9GA 1TYQB 2NRRA 4F3TA 1QSYA 4JK7A 1FK9A 3UKRB 1RTDA 2E8AA 1A5WA 4QAGA 3AO3A 1CZ9A 3I0RA 4IOXA 1DGKN 4PWDA 3NDKA 3THYB 2EWSA 1J6ZA 4J8FA 3VA3A 5KRTA 2P9NB 5FLXO 3EEQA 4DQSA 5KI6A 4W5QA 2X74A 4B9UA 3VQ9A 3AVAA 4U67L 1Q7YO 3VQQA 3KLEA 3SV3A 4N47A 4A57A 2DPNA 4CEOA 3MWTA 3R8EA 4YNQA 4WQ4C 2OTLN 2BDPA 4B9MA 2P5OA 4IG3A 2KQ2A 1JKHA 3CC4N 1N5YA 2P9IB 1QHAA 1ZBSA 1KAZA 3QBWA 1KLMA 4CIEA 4XEIA 2OYQA 3D2EB 3HM9A 4FLTA 1A5XA 2VWKA 4AF1A 3OYCA 3HJFA 4JRQA 1WSFA 2HSTA 3ZSYA 4Z4FA 4PHTX 3SV4A 3IDHA 3CCUN 4DV4K 3QB0A 3TI0A 4BRNA 3KK1A 4B9LA 4DV1K 3QFPA 5BRHA 3NFAA 3QEWA 2HMIA 5EX5A 4FLVA 1S1TA 4JLHA 3Q7BA 4KHPK 4CIFA 2P9SB 3O3GA 3A0IX 3WEEA 1YJWN 2XY8A 4W5TA 4JI6K 3DWLA 1NG9A 2YCHA 1NNEA 4AHRA 3ZSWA 1KVCA 2W6LA 1HKGA 3ZSXA 2FXUA 4JI5K 4FWSA 3L4IA 5F0XA 2HHHK 3OYGA 4CF8A 1T03A 3TAQA 2BANA 1JLAA 1TUYA 3UKUB 1ILYA 1NGBA 3SJJA 1G15A 3ITHA 3O9TA 4MO5A 3ZSOA 1HYZA 1S9EA 3WNEA 3NGYA 1VQ6N 2HB5A 4G1QA 5GINA 4AILC 3MMVA 1EP4A 3VQCA 3ZETA 3LAKA 2BH1A 4WFAL 3PX6A 1SS6A 3O1BA 4EZ9A 1RNHA 3JSMA 4CEQA 4FLXA 4KHSA 5BN9A 1ZBLA 3VGKA 1JLCA 1VRTA 4CJQA 2Q0UA 1DT9A 4UQGA 4K8ZA 4BG8A 2YNHA 2IVPA 2KTQA 1VSLA 3IUCA 3H3OB 1OVYA 1RT2A 3OVNA 4HUFA 3PV8A 3ZSZA 2I7PA 2HBMA 4YOYA 5DM7L 4HCBA 5HOOA 1BI4B 4L8RB 1NGIA 1XUPO 4V19S 4BRCA 3TABA 3SQ1A 4LFBK 3ZCMA 4DB3A 4JKAA 3OYMA 4IOCL 2OPSA 1HKBA 1GLLO 3BP8A 3VQ6A 3JAMO 2X78A 2HBKA 3AVMA 2F7TA 2QWNA 4KTWA 3THWA 1RBUA 1VSMA 3AVKA 3NF8A 4OGEA 3LPTA 5J2NA 1Y97A 3HXMA 4LF4K 1VRUA 4FJLA 2HBJA 3DYAA 3E9PA 4B08A 3CCSN 1U45A 4BR9A 4H5RA 2F4VK 3J7YP 3HBTA 1YIJN 4CZMA 4J2DA 4XIUA 2P9UB 5JVHL 3ZSQA 1HNZK 3LZJA 3SZ2A 5FDLA 1NJIO 1WSGA 3WEEB 4ID1A 3VMFB 1F21A 4CJ3A 4YOVA 3QMLA 2CGKA 4OPHA 2HF4A 5J2PA 4QS7A 2Q2RA 4RW6A 3NHGA 4JKDA 3WNGA 3QEXA 4B1WB 2P9LA 4XH5A 1SKRA 2PY5A 4JI1K 5E84A 4FZYA 2XO7A 3K2PA 2FBTA 2HHTA 3CXCM 3WQUA 3D7EO 1SZ2A 3LP0A 4ISGA 2FLOA 4ID5A 3NF6A 1N32K 1VSDA 3LP1A 4LF8K 5C24A 4DU4A 4FLUA 4KTQA 3V9XA 5FRMA 3LALA 3CERA 3FGUA 1GOBA 1WNSA 4CZEA 3ZYYX 3LP2A 3KLGA 5HBMA 2GV9A 5C12A 3AVJA 1JXBA 1ZC6A 1YUWA 3V4IA 4KHWA 3MEDA 3T7ZA 4HTLA 2VWBA 5C0YA 4CF0A 1W2BM 1RTHA 1RTIA 3HM8A 4MFBA 2D0PA 1Q8IA 4DV5K 2O8DA 2QWMA 4AHSA 4M3ZA 4DTOA 3QERA 4I9LA 4X66K 3AVCA 3A5LC 4BREA 1QZ5A 1O13A 2D0OA 4B1VA 2IGIA 4FM2A 3S9HA 3EKUA 3O4QA 3FZMA 2W42A 4QS9A 3VQ5A 1C0GA 3FZLA 3LDQA 3SI6A 2FSNA 3KIOA 4CJWA 2BTFA 3MCAB 3L3UA 1EO1A 1DEJA 3NAEA 2YKNA 3THWB 2Z1IA 2FSKA 4MLEA 3L2WA 3DLKA 5GAEP 3CCMN 3O1WA 4FJGA 4IZ9A 2OTJN 2VG6A 5EY4A 5SZTA 1IG8A 4M3YA 2CH6A 3F2KA 1S5JA 3U8XA 3CQ8A 4ILHA 2O8CA 3SUOA 5GAHP 3GBTA 3CJ9A 2HVIA 4BR4A 1RBSA 5GADP 1IKXA 2NRHA 1N33K 3P1GA 4CHOA 4NCGA 2LSNA 3OY9A 3O9SA 4GW6A 1TK5A 4O8UA 1HKCA 1RT6A 4FSVA 4I9QA 1K9MO 1REVA 4GMJB 3SBTA 3VEXA 2O8FA 2P9LB 1QVGM 1VHXA 1JCFA 4B9TA 1Z25A 2V51B 2YJEA 1SL0A 3TARA 4CGFA 5KRSA 2F8SA 1FXXA 4M3UA 1QHTA 1VSJA 2DY4A 4M7XA 1JLQA 1P90A 4FYDA 1WAJA 3E01A 4KKOA 4JN4A 3DOKA 3AVHA 1MWMA 3DRPA 1MWKA 2UUCK 4M41A 1WBDA 4IJAA 4CGDA 3P31A 3PY8A 1DLOA 2A1RA 4J2AA 4JI0K 3OS1A 5DM6L 3Q7CA 2E2QA 3L2QA 4BRFA 2QWPA 3AGKA 4AM6A 4E1MA 1OH5A 1S1VA 1ZYQA 3C7NB 4MLHA 5JLHA 4DTMA 2PFUA 1U6ZA 1SV5A 2O8DB 1TKZA 1GLFO 1UA0A 4O8KA 3ID8A 1S3XA 5C2DA 5LJWA 4BRAA 2G8HA 3E9LA 1BO5O 5AQGA 3QBXA 5C25A 1DKGD 5AQQA 1GLDG 2YI1A 3AVBA 2DTUA 4DS4A 3C6AA 3IG1A 3TTDA
chains in the Genus database with same CATH topology
3AVNA 3THVA 5HRSA 3TAEA 4Z4CA 3OYBA 1RT4A 4F2RA 2O4IA 1L3TA 1W0HA 4BDYA 4IFVA 1SL2A 3CFRA 3OYAA 4DTJA 2E6MA 1RCHA 1TL3A 3ZSRA 1L3SA 3K58A 4CHQA 4OKKA 1L5UA 3C95A 2G8UA 4DFPA 1LAVA 3T19A 3ALYA 1TK0A 1HMVA 1HNVA 3AVFA 3O4NA 4IFYA 3JYTA 2HHQA 1JLFA 3CM5A 4CJUA 4FJXA 1HRHA 2XY7A 4E7LA 1TV6A 2P5GA 1U04A 1UAXA 1QSLA 1VSEA 3S3MA 1NK8A 1NK9A 1KCFA 4CJVA 3ZSVA 4C8KA 1NK7A 3OYJA 2JGUA 3QINA 5HROA 3AA3A 1IG9A 2EX3A 3OJSA 1LW2A 5HRNA 2YV0X 1VSHA 3AO2A 3MAQA 1SKWA 4CF9A 4CFCA 1X9WA 2YNIA 1WLJA 2HW3A 3U3GA 4CJPA 2GBZA 3NF7A 4CEFA 4EP5A 3QEPA 1RBTA 2YNGA 1S9GA 3C6UA 2BGGA 1XHZA 1SL1A 3ULDA 4F3TA 1UWBA 4M45A 3OYHA 1QSYA 3K57A 2HHXA 1C6VA 1FK9A 1RBRA 1RTDA 4FW1A 4ELTA 4DF4A 2FC0A 1NJZA 1NJXA 3L2VA 3RWUA 1A5WA 1RDAA 4QAGA 4QOZB 1NJWA 3AO3A 3TWHA 4AHCA 4FZZA 1CZ9A 3AA5X 3I0RA 3NBPA 1NK0A 3NDKA 4PWDA 4HHTA 3VA3A 4H8KA 4J2EA 3ASMA 5KRTA 4FJJA 3AA4A 1YT3A 3DLEA 4DQSA 5KI6A 2DFFA 5HRPA 4M3XA 3VQEA 4W5QA 2X74A 4ELUA 3ISNC 4B9UA 4PQUA 3AVLA 3VQ9A 3AVAA 3PUFA 3DLHA 1EXQA 3DOLA 4RW8A 1U47A 3VQQA 3F9KA 3KLEA 3SV3A 2G8WA 4M3TA 1TKTA 4N47A 3KLFA 3KLHA 4CEOA 1HJRA 3U6FA 3B6OA 4DSIA 4YNQA 3KK2A 3HK2A 1BL3A 1NK6A 2WOMA 4CGGA 4DSFA 4FW2A 1ITGA 2E4LA 1C0MA 1RT5A 4Z4EA 4PY5A 3TAFA 4OLAA 2BDPA 2HNDA 4B9MA 2P5OA 4IG3A 2KQ2A 1JKHA 3RMCA 1N5YA 4DWIA 1RDCA 3CFPA 4CJKA 1WSIA 4CJ5A 2OPRA 3DLRA 4DQRA 1IKYA 1KLMA 4O44A 4CJFA 3FFIA 4CIEA 1ASUA 4BE1A 2FBVA 2OYQA 3HM9A 4FLTA 1HPZA 4YFUA 1HYSA 1A5XA 2VWKA 4B9VA 3OYCA 1BHLA 3HJFA 4JRQA 3DLGA 4OJRA 1WSFA 2ETJA 2NUBA 4O5BA 3OYKA 4M42A 2HVHA 4Q5VA 3ZSYA 3HYFA 3MXIA 4Z4FA 2KZZA 3TR8A 3SV4A 1T05A 3CM6A 4CK3A 4DTRA 4E1NA 4B8AB 3TI0A 4DF8A 3MXJA 4RW4A 3KK1A 4B9LA 4LSNA 3QIOA 4FZXC 3DLBA 3NFAA 3KTQA 1DTTA 4AHTA 3U3YA 3LWLA 3QEWA 4E7IA 2HMIA 1NKCA 2KW4A 3D45A 3RRGA 4FLVA 1S1TA 4JLHA 4B8CA 1IKVA 4CJEA 5J1EA 3IAYA 4IKFA 1EETA 1J5OA 1C0TA 1KVBA 4TSXA 2HNZA 4CEZA 3KKRA 3BDPA 4CIFA 3O3GA 3KD1E 1TVRA 4O0JA 1D8YA 4NYNA 4FK2A 2IAJA 4FK4A 2KZMA 5CYMA 1QE1A 1RT3A 2XY8A 4CESA 5T7BA 4W5TA 1IKWA 4E89A 1RT7A 4BDZA 2B5JA 4C8MA 4AHRA 2RPIA 4NYFA 5DMRA 1XHXA 3ZSWA 4NCBA 1KVCA 3VQ4A 1XI1A 4N76A 1BCOA 4RW9A 3P83D 4DTXA 1EX4A 3ZSXA 2GUIA 1L3VA 1KSPA 2G8IA 1XWLA 3HP9A 4EP4A 3VQBA 2B4JA 2ZQBA 3OYGA 3K5LA 4E7KA 4CF8A 3NF9A 2PZSA 4B9SA 3LPUA 1T03A 3TAQA 2BANA 1A5VA 3RR7A 4FJNA 1CXUA 1JLAA 4F3OA 2X6NA 2PYLA 1S1UA 1TAUA 4R5PA 3SJJA 2WONA 3C94A 1G15A 3ITHA 1KRPA 4OLBA 3ZSOA 1HYZA 1S9EA 3SQ2A 4DLGA 3WNEA 3NGYA 1RTJA 2HB5A 4DMNA 1BGXT 4G1QA 3LZIA 3LANA 4CJTA 2YHAA 4IG0A 4AILC 4KHQA 2O4GA 3EY1A 1EP4A 4KB1A 3VQCA 1MU2A 1NKEA 1JL2A 3LAKA 4DU3A 4BDPA 2D0AA 3PX6A 4KHNA 3V1QA 3KD5E 1ZBHA 1U48A 1KVAA 4KHYA 3SPYA 3AV9A 4DSEA 4CJ4A 1RNHA 3JSMA 4H4OA 4CEQA 4EZ9A 4FLXA 1BQMA 4KHSA 2BE2A 3V6DA 3I0SA 1ZBFA 3QLHA 4I2QA 1JLCA 1VRTA 1ZBLA 1KFDA 4CJQA 3O3FA 1NOZA 4FM0A 1ASWA 4KTQA 4UQGA 4K8ZA 4IDKA 3QIPA 2YNHA 3VQDA 4ZTFA 3L3VA 2KTQA 1VSLA 3NH1A 3IS9A 1S6QA 4BACA 1RT2A 1BISA 3OVNA 3WNFA 3A2FA 4RG8A 4BWMA 4OPJA 4HUFA 3PV8A 5I42A 3M8RA 3ZSZA 4M3ZA 4ZHRA 4F8RA 1T7PA 4I2PA 3WNHA 4HCBA 4GVMA 1BI4B 4L8RB 1RILA 4DQIA 1TKDA 3EZ5A 5C42A 3OS0A 4CE9A 3TABA 3SUQA 3SQ1A 1BIZA 2F8TA 5CZ1A 3ZCMA 2HHVA 3OYMA 1UA1A 2VWJA 2OPSA 3VQAA 4CGHA 2IOCA 3OYLA 1Q9YA 3VQ6A 1C1BA 2Z1GA 4BE0A 3RRHA 4KI6A 1BQNA 3VQ8A 5EU7A 4CEBA 3PX0A 2X78A 3OYIA 3AO1A 3VQ7A 4DS5A 1VSIA 3AVMA 3G10A 1X9SA 3HVRA 4Z4IA 2YHBA 1RDBA 4FJHA 2OPQA 3HPOA 1IO2A 2A1SA 4KTWA 3V9ZA 1QS4A 3KKSA 1RBUA 3KLIA 3SUPA 4KAZA 1VSMA 3AVKA 3NF8A 2DFEA 4OGEA 2RF2A 3HPGA 3LPTA 5J2NA 4WE1A 1Y97A 1ZBIA 3HXMA 2D0BA 3O3HA 4LD0A 3V9WA 1XC9A 1VRUA 4CJLA 1N6QA 3DYAA 4FVMA 4B08A 4MQ3A 4FJLA 4KREA 3OYNA 3DM2A 1U45A 1B9FA 1D5AA 2HNYA 3CYMA 4DFMA 1B9DA 2OA8A 5D3GA 4QCLA 4FLYA 4PUOA 4OVLA 4CEDA 1L3UA 4DTPA 4J2DA 4XIUA 2ZE2A 3M8PA 4B3OA 4CFBA 3DRRA 5DK5A 3MEGA 3VQPA 3ZSQA 4HCCA 3LZJA 3SZ2A 1DTQA 2Z1HA 5FDLA 1WSGA 3ZT4A 3L8BA 4ID1A 4IBNA 1F21A 4CJ3A 3NGZA 4DSJA 4Z4GA 3HP6A 5J2PA 4BE2A 3ZT3A 4CECA 3S3OA 4RW6A 3NH2A 1LAWA 3NHGA 3AVIA 1EKEA 5KGWA 3WNGA 3RTVA 4W5NA 1Z26A 4N5SA 4CFDA 3SUNA 3LP3A 3OS2A 3V1OA 4OKJA 4E3SA 3QEXA 4FJ9A 2XRIA 3KJVA 1NOYA 4CCHA 2I5JA 3RMDA 1S1XA 4ZTJA 2D0CA 1C1CA 3ZT2A 5CYQA 3T3FA 1SKRA 4C8NA 2PY5A 5KTQA 3I8DA 3V81A 4FZYA 1SUQA 2XO7A 1BCMA 1BIUA 4OGCA 3K2PA 4DTNA 1LWCA 2FBTA 4FM1A 4FK0A 4CF1A 4AHUA 4CEAA 3T1AA 4N41A 4M3WA 2HHTA 1TKXA 5E41A 3OYFA 3LP0A 3UIQA 1C1AA 5I3UA 4FLZA 1LWFA 1J54A 4ID5A 3NF6A 4CGIA 1HQUA 1VSDA 3LP1A 3LDSA 4DLEA 1WAFA 2X6SA 5C24A 4E19A 4FLUA 3V9XA 3BGRA 4E7JA 3LALA 4KO0A 4DU4A 5HP1A 2PYJA 4ELVA 5FRMA 3L2UA 1I39A 3K5NA 1GOBA 1WNSA 1TL1A 3M8QA 4LH5A 3HT3A 3EYZA 3LP2A 3KLGA 4FJMA 4KPYA 5HBMA 2GV9A 3AVJA 1JXBA 3V1RA 2Y1IA 2YKMA 3V4IA 4KHWA 3MEDA 2E6LA 3QESA 4DFKA 1CXQA 2FBYA 3HPHA 4CF0A 3HL8A 4C8LA 2KFNA 3AO5A 4DQQA 3VN5A 4N56A 4FLWA 1RTHA 1FKOA 1HQEA 1J9AA 3K59A 3PO4A 1RTIA 4MFBA 2JLEA 1Q8IA 4O4GA 3NH0A 4Y1DA 4AHSA 2G8VA 4DTOA 1B92A 4KTZA 3MXMA 1SKSA 3QERA 1HNIA 4C8OA 1JLEA 4AH9A 4I9LA 5JS1A 4CEEA 2QKKA 4FJIA 2KFZA 4FJ8A 3AVCA 4CK1A 4OPKA 3KK3A 2XHBA 4JS5A 1ASVA 4CHPA 3QO9A 3AVGA 3V9SA 4B9NA 4PA1A 3MECA 2RKIA 4W5RA 1WSJA 2IGIA 4FM2A 3S9HA 3P5JA 1LV5A 4FJ7A 3O4QA 4CHNA 1R0AA 2IDOA 4ICLA 2W42A 2Y1JA 3NE6A 4F2SA 4CFAA 4HUGA 3VQ5A 4Y1CA 3HSTB 3SI6A 1GOCA 2ZD1A 4HVJA 3KIOA 4F4KA 4CJWA 2D5RA 3L3UA 2YNFA 3DI6A 4CERA 4CJSA 3NAEA 4KFBA 3DMJA 1WSHA 3IRXA 2YKNA 3SYZA 1KLNA 2Z1IA 3NGIA 3RR8A 1KTQA 3G0ZA 3OJUA 2HHUA 1I3AA 3S3NA 3L2WA 2ITGA 3H08A 3PX4A 2DFHA 1WSEA 3DLKA 3LAMA 4J2BA 5FRNA 1K6YA 5J2QA 4M3RA 4JRPA 1S1WA 1RDDA 5HRRA 3TANA 3PO5A 4CF2A 3NCIA 3F73A 4FJGA 4DFJA 1UOCA 4DG1A 1RT1A 2VG6A 5SZTA 3AA2A 1U49A 4M3YA 3TAGA 1S6PA 2OZSA 1S5JA 4BWJA 4H4MA 4KRFA 2IS3A 3CQ8A 4DQPA 1VSKA 3SUOA 1QSSA 5CZ2A 2EHGA 3SPZA 2F96A 1QTMA 2HVIA 4CHYA 1RBSA 5CY4A 1NKBA 2QKBA 1IKXA 1T8EA 4O0IA 1TAQA 3P1GA 4CHOA 4CJRA 3SNNA 4NCGA 4E7HA 1U4BA 3TAMA 1CZBA 1JL1A 2OPPA 2FBXA 2LSNA 2G8KA 1ZBUA 1YVUA 4DSKA 4DTUA 3OY9A 4GW6A 1TK5A 1X9MA 1D9FA 4Z4HA 1RT6A 4CIGA 4I9QA 4DU1A 1BI4A 1REVA 4GMJB 4KV8A 3AO4A 4K8XA 2B6AA 2IC3A 1J53A 1VSFA 1TGOA 2P1JA 4B9TA 1Z25A 1SL0A 3C6TA 4CHZA 4CGFA 5KRSA 5SWMA 3QEVA 2ATQA 3TARA 1Q9XA 3VA0A 1FXXA 2F8SA 4M3UA 1QHTA 1VSJA 2DY4A 3TAPA 1JLQA 4CGJA 4FYDA 1FKPA 1WAJA 2VG5A 4Q0BA 3E01A 1JLGA 1GOAA 2QXFA 1TK8A 4AHVA 4W5OA 4LSLA 4KKOA 1CLQA 1YTAA 3SCXA 3DOKA 3AVHA 3QNNA 2Z1JA 3ZT1A 3V9UA 2RN2A 3DRPA 5K14A 5JS2A 4M41A 4FCYA 2AJQA 3LWMA 3OYEA 2Q3SA 1W9HA 4CGDA 3PY8A 5J2MA 1C0UA 3K5MA 1DLOA 4HUEA 5HLFA 2A1RA 4OKEA 2P51A 4O55A 2HHWA 4J2AA 3M8SA 3OS1A 1NK4A 3CG7A 4I7FA 2G8FA 4NCAA 3QEIA 4FJ5A 3L2QA 1KFSA 4KI4A 1JXEA 3MEEA 3QNOA 4EZ6A 1WN7A 4E1MA 5KGXA 4KHUA 1S1VA 1ZYQA 3HVTA 4DTMA 1HYVA 4E0DA 1O1WA 1SV5A 3QETA 1LWEA 1TKZA 3B6PA 1LW0A 1VK0A 3CFOA 1UA0A 1D9DA 2XY5A 3HO1A 3RMAA 4KB0A 1NK5A 4Z0UA 3DRSA 4LH4A 1YTUA 2HHSA 2G8HA 3K5OA 1RBVA 4LY7A 2OZMA 2R7YA 3D0PA 1JLBA 1QQCA 3ZT0A 1NJYA 5C25A 3OYDA 3SQ4A 2QK9A 4HTUA 3L2RA 4JS4A 1IH7A 4DSLA 3SQ0A 3RMBA 4DTSA 5FROA 3AVBA 2DTUA 4CK2A 1X1PA 4DS4A 4FJKA 3IG1A 4FXDA 4RW7A 2VG7A 2XY6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AVN A;  3THV A;  5HRS A;  3TAE A;  4Z4C A;  3OYB A;  1RT4 A;  4F2R A;  2O4I A;  1L3T A;  1W0H A;  4BDY A;  4IFV A;  1SL2 A;  3CFR A;  3OYA A;  4DTJ A;  2E6M A;  1RCH A;  1TL3 A;  3ZSR A;  1L3S A;  3K58 A;  4CHQ A;  4OKK A;  1L5U A;  3C95 A;  2G8U A;  4DFP A;  1LAV A;  3T19 A;  3ALY A;  1TK0 A;  1HMV A;  1HNV A;  3AVF A;  3O4N A;  4IFY A;  3JYT A;  2HHQ A;  1JLF A;  3CM5 A;  4CJU A;  4FJX A;  1HRH A;  2XY7 A;  4E7L A;  1TV6 A;  2P5G A;  1U04 A;  1UAX A;  1QSL A;  1VSE A;  3S3M A;  1NK8 A;  1NK9 A;  1KCF A;  4CJV A;  3ZSV A;  4C8K A;  1NK7 A;  3OYJ A;  2JGU A;  3QIN A;  5HRO A;  3AA3 A;  1IG9 A;  2EX3 A;  3OJS A;  1LW2 A;  5HRN A;  2YV0 X;  1VSH A;  3AO2 A;  3MAQ A;  1SKW A;  4CF9 A;  4CFC A;  1X9W A;  2YNI A;  1WLJ A;  2HW3 A;  3U3G A;  4CJP A;  2GBZ A;  3NF7 A;  4CEF A;  4EP5 A;  3QEP A;  1RBT A;  2YNG A;  1S9G A;  3C6U A;  2BGG A;  1XHZ A;  1SL1 A;  3ULD A;  4F3T A;  1UWB A;  4M45 A;  3OYH A;  1QSY A;  3K57 A;  2HHX A;  1C6V A;  1FK9 A;  1RBR A;  1RTD A;  4FW1 A;  4ELT A;  4DF4 A;  2FC0 A;  1NJZ A;  1NJX A;  3L2V A;  3RWU A;  1A5W A;  1RDA A;  4QAG A;  4QOZ B;  1NJW A;  3AO3 A;  3TWH A;  4AHC A;  4FZZ A;  1CZ9 A;  3AA5 X;  3I0R A;  3NBP A;  1NK0 A;  3NDK A;  4PWD A;  4HHT A;  3VA3 A;  4H8K A;  4J2E A;  3ASM A;  5KRT A;  4FJJ A;  3AA4 A;  1YT3 A;  3DLE A;  4DQS A;  5KI6 A;  2DFF A;  5HRP A;  4M3X A;  3VQE A;  4W5Q A;  2X74 A;  4ELU A;  3ISN C;  4B9U A;  4PQU A;  3AVL A;  3VQ9 A;  3AVA A;  3PUF A;  3DLH A;  1EXQ A;  3DOL A;  4RW8 A;  1U47 A;  3VQQ A;  3F9K A;  3KLE A;  3SV3 A;  2G8W A;  4M3T A;  1TKT A;  4N47 A;  3KLF A;  3KLH A;  4CEO A;  1HJR A;  3U6F A;  3B6O A;  4DSI A;  4YNQ A;  3KK2 A;  3HK2 A;  1BL3 A;  1NK6 A;  2WOM A;  4CGG A;  4DSF A;  4FW2 A;  1ITG A;  2E4L A;  1C0M A;  1RT5 A;  4Z4E A;  4PY5 A;  3TAF A;  4OLA A;  2BDP A;  2HND A;  4B9M A;  2P5O A;  4IG3 A;  2KQ2 A;  1JKH A;  3RMC A;  1N5Y A;  4DWI A;  1RDC A;  3CFP A;  4CJK A;  1WSI A;  4CJ5 A;  2OPR A;  3DLR A;  4DQR A;  1IKY A;  1KLM A;  4O44 A;  4CJF A;  3FFI A;  4CIE A;  1ASU A;  4BE1 A;  2FBV A;  2OYQ A;  3HM9 A;  4FLT A;  1HPZ A;  4YFU A;  1HYS A;  1A5X A;  2VWK A;  4B9V A;  3OYC A;  1BHL A;  3HJF A;  4JRQ A;  3DLG A;  4OJR A;  1WSF A;  2ETJ A;  2NUB A;  4O5B A;  3OYK A;  4M42 A;  2HVH A;  4Q5V A;  3ZSY A;  3HYF A;  3MXI A;  4Z4F A;  2KZZ A;  3TR8 A;  3SV4 A;  1T05 A;  3CM6 A;  4CK3 A;  4DTR A;  4E1N A;  4B8A B;  3TI0 A;  4DF8 A;  3MXJ A;  4RW4 A;  3KK1 A;  4B9L A;  4LSN A;  3QIO A;  4FZX C;  3DLB A;  3NFA A;  3KTQ A;  1DTT A;  4AHT A;  3U3Y A;  3LWL A;  3QEW A;  4E7I A;  2HMI A;  1NKC A;  2KW4 A;  3D45 A;  3RRG A;  4FLV A;  1S1T A;  4JLH A;  4B8C A;  1IKV A;  4CJE A;  5J1E A;  3IAY A;  4IKF A;  1EET A;  1J5O A;  1C0T A;  1KVB A;  4TSX A;  2HNZ A;  4CEZ A;  3KKR A;  3BDP A;  4CIF A;  3O3G A;  3KD1 E;  1TVR A;  4O0J A;  1D8Y A;  4NYN A;  4FK2 A;  2IAJ A;  4FK4 A;  2KZM A;  5CYM A;  1QE1 A;  1RT3 A;  2XY8 A;  4CES A;  5T7B A;  4W5T A;  1IKW A;  4E89 A;  1RT7 A;  4BDZ A;  2B5J A;  4C8M A;  4AHR A;  2RPI A;  4NYF A;  5DMR A;  1XHX A;  3ZSW A;  4NCB A;  1KVC A;  3VQ4 A;  1XI1 A;  4N76 A;  1BCO A;  4RW9 A;  3P83 D;  4DTX A;  1EX4 A;  3ZSX A;  2GUI A;  1L3V A;  1KSP A;  2G8I A;  1XWL A;  3HP9 A;  4EP4 A;  3VQB A;  2B4J A;  2ZQB A;  3OYG A;  3K5L A;  4E7K A;  4CF8 A;  3NF9 A;  2PZS A;  4B9S A;  3LPU A;  1T03 A;  3TAQ A;  2BAN A;  1A5V A;  3RR7 A;  4FJN A;  1CXU A;  1JLA A;  4F3O A;  2X6N A;  2PYL A;  1S1U A;  1TAU A;  4R5P A;  3SJJ A;  2WON A;  3C94 A;  1G15 A;  3ITH A;  1KRP A;  4OLB A;  3ZSO A;  1HYZ A;  1S9E A;  3SQ2 A;  4DLG A;  3WNE A;  3NGY A;  1RTJ A;  2HB5 A;  4DMN A;  1BGX T;  4G1Q A;  3LZI A;  3LAN A;  4CJT A;  2YHA A;  4IG0 A;  4AIL C;  4KHQ A;  2O4G A;  3EY1 A;  1EP4 A;  4KB1 A;  3VQC A;  1MU2 A;  1NKE A;  1JL2 A;  3LAK A;  4DU3 A;  4BDP A;  2D0A A;  3PX6 A;  4KHN A;  3V1Q A;  3KD5 E;  1ZBH A;  1U48 A;  1KVA A;  4KHY A;  3SPY A;  3AV9 A;  4DSE A;  4CJ4 A;  1RNH A;  3JSM A;  4H4O A;  4CEQ A;  4EZ9 A;  4FLX A;  1BQM A;  4KHS A;  2BE2 A;  3V6D A;  3I0S A;  1ZBF A;  3QLH A;  4I2Q A;  1JLC A;  1VRT A;  1ZBL A;  1KFD A;  4CJQ A;  3O3F A;  1NOZ A;  4FM0 A;  1ASW A;  4KTQ A;  4UQG A;  4K8Z A;  4IDK A;  3QIP A;  2YNH A;  3VQD A;  4ZTF A;  3L3V A;  2KTQ A;  1VSL A;  3NH1 A;  3IS9 A;  1S6Q A;  4BAC A;  1RT2 A;  1BIS A;  3OVN A;  3WNF A;  3A2F A;  4RG8 A;  4BWM A;  4OPJ A;  4HUF A;  3PV8 A;  5I42 A;  3M8R A;  3ZSZ A;  4M3Z A;  4ZHR A;  4F8R A;  1T7P A;  4I2P A;  3WNH A;  4HCB A;  4GVM A;  1BI4 B;  4L8R B;  1RIL A;  4DQI A;  1TKD A;  3EZ5 A;  5C42 A;  3OS0 A;  4CE9 A;  3TAB A;  3SUQ A;  3SQ1 A;  1BIZ A;  2F8T A;  5CZ1 A;  3ZCM A;  2HHV A;  3OYM A;  1UA1 A;  2VWJ A;  2OPS A;  3VQA A;  4CGH A;  2IOC A;  3OYL A;  1Q9Y A;  3VQ6 A;  1C1B A;  2Z1G A;  4BE0 A;  3RRH A;  4KI6 A;  1BQN A;  3VQ8 A;  5EU7 A;  4CEB A;  3PX0 A;  2X78 A;  3OYI A;  3AO1 A;  3VQ7 A;  4DS5 A;  1VSI A;  3AVM A;  3G10 A;  1X9S A;  3HVR A;  4Z4I A;  2YHB A;  1RDB A;  4FJH A;  2OPQ A;  3HPO A;  1IO2 A;  2A1S A;  4KTW A;  3V9Z A;  1QS4 A;  3KKS A;  1RBU A;  3KLI A;  3SUP A;  4KAZ A;  1VSM A;  3AVK A;  3NF8 A;  2DFE A;  4OGE A;  2RF2 A;  3HPG A;  3LPT A;  5J2N A;  4WE1 A;  1Y97 A;  1ZBI A;  3HXM A;  2D0B A;  3O3H A;  4LD0 A;  3V9W A;  1XC9 A;  1VRU A;  4CJL A;  1N6Q A;  3DYA A;  4FVM A;  4B08 A;  4MQ3 A;  4FJL A;  4KRE A;  3OYN A;  3DM2 A;  1U45 A;  1B9F A;  1D5A A;  2HNY A;  3CYM A;  4DFM A;  1B9D A;  2OA8 A;  5D3G A;  4QCL A;  4FLY A;  4PUO A;  4OVL A;  4CED A;  1L3U A;  4DTP A;  4J2D A;  4XIU A;  2ZE2 A;  3M8P A;  4B3O A;  4CFB A;  3DRR A;  5DK5 A;  3MEG A;  3VQP A;  3ZSQ A;  4HCC A;  3LZJ A;  3SZ2 A;  1DTQ A;  2Z1H A;  5FDL A;  1WSG A;  3ZT4 A;  3L8B A;  4ID1 A;  4IBN A;  1F21 A;  4CJ3 A;  3NGZ A;  4DSJ A;  4Z4G A;  3HP6 A;  5J2P A;  4BE2 A;  3ZT3 A;  4CEC A;  3S3O A;  4RW6 A;  3NH2 A;  1LAW A;  3NHG A;  3AVI A;  1EKE A;  5KGW A;  3WNG A;  3RTV A;  4W5N A;  1Z26 A;  4N5S A;  4CFD A;  3SUN A;  3LP3 A;  3OS2 A;  3V1O A;  4OKJ A;  4E3S A;  3QEX A;  4FJ9 A;  2XRI A;  3KJV A;  1NOY A;  4CCH A;  2I5J A;  3RMD A;  1S1X A;  4ZTJ A;  2D0C A;  1C1C A;  3ZT2 A;  5CYQ A;  3T3F A;  1SKR A;  4C8N A;  2PY5 A;  5KTQ A;  3I8D A;  3V81 A;  4FZY A;  1SUQ A;  2XO7 A;  1BCM A;  1BIU A;  4OGC A;  3K2P A;  4DTN A;  1LWC A;  2FBT A;  4FM1 A;  4FK0 A;  4CF1 A;  4AHU A;  4CEA A;  3T1A A;  4N41 A;  4M3W A;  2HHT A;  1TKX A;  5E41 A;  3OYF A;  3LP0 A;  3UIQ A;  1C1A A;  5I3U A;  4FLZ A;  1LWF A;  1J54 A;  4ID5 A;  3NF6 A;  4CGI A;  1HQU A;  1VSD A;  3LP1 A;  3LDS A;  4DLE A;  1WAF A;  2X6S A;  5C24 A;  4E19 A;  4FLU A;  3V9X A;  3BGR A;  4E7J A;  3LAL A;  4KO0 A;  4DU4 A;  5HP1 A;  2PYJ A;  4ELV A;  5FRM A;  3L2U A;  1I39 A;  3K5N A;  1GOB A;  1WNS A;  1TL1 A;  3M8Q A;  4LH5 A;  3HT3 A;  3EYZ A;  3LP2 A;  3KLG A;  4FJM A;  4KPY A;  5HBM A;  2GV9 A;  3AVJ A;  1JXB A;  3V1R A;  2Y1I A;  2YKM A;  3V4I A;  4KHW A;  3MED A;  2E6L A;  3QES A;  4DFK A;  1CXQ A;  2FBY A;  3HPH A;  4CF0 A;  3HL8 A;  4C8L A;  2KFN A;  3AO5 A;  4DQQ A;  3VN5 A;  4N56 A;  4FLW A;  1RTH A;  1FKO A;  1HQE A;  1J9A A;  3K59 A;  3PO4 A;  1RTI A;  4MFB A;  2JLE A;  1Q8I A;  4O4G A;  3NH0 A;  4Y1D A;  4AHS A;  2G8V A;  4DTO A;  1B92 A;  4KTZ A;  3MXM A;  1SKS A;  3QER A;  1HNI A;  4C8O A;  1JLE A;  4AH9 A;  4I9L A;  5JS1 A;  4CEE A;  2QKK A;  4FJI A;  2KFZ A;  4FJ8 A;  3AVC A;  4CK1 A;  4OPK A;  3KK3 A;  2XHB A;  4JS5 A;  1ASV A;  4CHP A;  3QO9 A;  3AVG A;  3V9S A;  4B9N A;  4PA1 A;  3MEC A;  2RKI A;  4W5R A;  1WSJ A;  2IGI A;  4FM2 A;  3S9H A;  3P5J A;  1LV5 A;  4FJ7 A;  3O4Q A;  4CHN A;  1R0A A;  2IDO A;  4ICL A;  2W42 A;  2Y1J A;  3NE6 A;  4F2S A;  4CFA A;  4HUG A;  3VQ5 A;  4Y1C A;  3HST B;  3SI6 A;  1GOC A;  2ZD1 A;  4HVJ A;  3KIO A;  4F4K A;  4CJW A;  2D5R A;  3L3U A;  2YNF A;  3DI6 A;  4CER A;  4CJS A;  3NAE A;  4KFB A;  3DMJ A;  1WSH A;  3IRX A;  2YKN A;  3SYZ A;  1KLN A;  2Z1I A;  3NGI A;  3RR8 A;  1KTQ A;  3G0Z A;  3OJU A;  2HHU A;  1I3A A;  3S3N A;  3L2W A;  2ITG A;  3H08 A;  3PX4 A;  2DFH A;  1WSE A;  3DLK A;  3LAM A;  4J2B A;  5FRN A;  1K6Y A;  5J2Q A;  4M3R A;  4JRP A;  1S1W A;  1RDD A;  5HRR A;  3TAN A;  3PO5 A;  4CF2 A;  3NCI A;  3F73 A;  4FJG A;  4DFJ A;  1UOC A;  4DG1 A;  1RT1 A;  2VG6 A;  5SZT A;  3AA2 A;  1U49 A;  4M3Y A;  3TAG A;  1S6P A;  2OZS A;  1S5J A;  4BWJ A;  4H4M A;  4KRF A;  2IS3 A;  3CQ8 A;  4DQP A;  1VSK A;  3SUO A;  1QSS A;  5CZ2 A;  2EHG A;  3SPZ A;  2F96 A;  1QTM A;  2HVI A;  4CHY A;  1RBS A;  5CY4 A;  1NKB A;  2QKB A;  1IKX A;  1T8E A;  4O0I A;  1TAQ A;  3P1G A;  4CHO A;  4CJR A;  3SNN A;  4NCG A;  4E7H A;  1U4B A;  3TAM A;  1CZB A;  1JL1 A;  2OPP A;  2FBX A;  2LSN A;  2G8K A;  1ZBU A;  1YVU A;  4DSK A;  4DTU A;  3OY9 A;  4GW6 A;  1TK5 A;  1X9M A;  1D9F A;  4Z4H A;  1RT6 A;  4CIG A;  4I9Q A;  4DU1 A;  1BI4 A;  1REV A;  4GMJ B;  4KV8 A;  3AO4 A;  4K8X A;  2B6A A;  2IC3 A;  1J53 A;  1VSF A;  1TGO A;  2P1J A;  4B9T A;  1Z25 A;  1SL0 A;  3C6T A;  4CHZ A;  4CGF A;  5KRS A;  5SWM A;  3QEV A;  2ATQ A;  3TAR A;  1Q9X A;  3VA0 A;  1FXX A;  2F8S A;  4M3U A;  1QHT A;  1VSJ A;  2DY4 A;  3TAP A;  1JLQ A;  4CGJ A;  4FYD A;  1FKP A;  1WAJ A;  2VG5 A;  4Q0B A;  3E01 A;  1JLG A;  1GOA A;  2QXF A;  1TK8 A;  4AHV A;  4W5O A;  4LSL A;  4KKO A;  1CLQ A;  1YTA A;  3SCX A;  3DOK A;  3AVH A;  3QNN A;  2Z1J A;  3ZT1 A;  3V9U A;  2RN2 A;  3DRP A;  5K14 A;  5JS2 A;  4M41 A;  4FCY A;  2AJQ A;  3LWM A;  3OYE A;  2Q3S A;  1W9H A;  4CGD A;  3PY8 A;  5J2M A;  1C0U A;  3K5M A;  1DLO A;  4HUE A;  5HLF A;  2A1R A;  4OKE A;  2P51 A;  4O55 A;  2HHW A;  4J2A A;  3M8S A;  3OS1 A;  1NK4 A;  3CG7 A;  4I7F A;  2G8F A;  4NCA A;  3QEI A;  4FJ5 A;  3L2Q A;  1KFS A;  4KI4 A;  1JXE A;  3MEE A;  3QNO A;  4EZ6 A;  1WN7 A;  4E1M A;  5KGX A;  4KHU A;  1S1V A;  1ZYQ A;  3HVT A;  4DTM A;  1HYV A;  4E0D A;  1O1W A;  1SV5 A;  3QET A;  1LWE A;  1TKZ A;  3B6P A;  1LW0 A;  1VK0 A;  3CFO A;  1UA0 A;  1D9D A;  2XY5 A;  3HO1 A;  3RMA A;  4KB0 A;  1NK5 A;  4Z0U A;  3DRS A;  4LH4 A;  1YTU A;  2HHS A;  2G8H A;  3K5O A;  1RBV A;  4LY7 A;  2OZM A;  2R7Y A;  3D0P A;  1JLB A;  1QQC A;  3ZT0 A;  1NJY A;  5C25 A;  3OYD A;  3SQ4 A;  2QK9 A;  4HTU A;  3L2R A;  4JS4 A;  1IH7 A;  4DSL A;  3SQ0 A;  3RMB A;  4DTS A;  5FRO A;  3AVB A;  2DTU A;  4CK2 A;  1X1P A;  4DS4 A;  4FJK A;  3IG1 A;  4FXD A;  4RW7 A;  2VG7 A;  2XY6 A; 
#chains in the Genus database with same CATH topology
 3BEX A;  1RT4 A;  4IFV A;  1SL2 A;  3MX5 A;  1TL3 A;  2G8U A;  4OKK A;  4GKJ K;  3C95 A;  5BPN A;  4C1N I;  3LM9 A;  3AVF A;  3O4N A;  4WQ4 A;  2HHQ A;  4FJX A;  1HRH A;  1N34 K;  4JAX A;  3S3M A;  4DR5 K;  3E9O A;  4IWV A;  1MA9 B;  4FWP A;  5HRO A;  2FF6 A;  1IG9 A;  2O8C B;  3AA3 A;  2EX3 A;  3OJS A;  1X9J A;  3O8M A;  1ZXO A;  1VSH A;  3AO2 A;  4CF9 A;  5EOY A;  1WLJ A;  2HW3 A;  3OA9 A;  2OCE A;  4CJP A;  2V52 B;  3F5T A;  1XHZ A;  3FZF A;  1UWB A;  3OYH A;  3H6E A;  3K57 A;  1BDG A;  3BUZ B;  5EXW A;  5F2R A;  2P9P B;  2O8F B;  1RDA A;  3ZX2 A;  1NJW A;  1NK0 A;  5AQK A;  3SJH A;  2A5X A;  2P9K A;  4H8K A;  3WXK A;  5AQI A;  2UUA K;  1YT3 A;  2O8E B;  2DFF A;  5HRP A;  3CCQ N;  2HOE A;  3ISN C;  2ZM6 K;  2ZGY A;  3AVL A;  3WXJ A;  2GEL A;  1EXQ A;  4DQ8 A;  4RW8 A;  4K0K K;  3ULE A;  5LY3 A;  4BRH A;  4M3T A;  1TKT A;  5MLC Q;  3B6O A;  4DSI A;  2NRZ A;  3KK2 A;  3HK2 A;  4CGG A;  1ITG A;  2E4L A;  4Z4E A;  4OLA A;  4BRK A;  3I33 A;  3L6Q A;  3D2F A;  3CFP A;  2OPR A;  3AGR A;  3DLR A;  4CJF A;  3FFI A;  1ASU A;  1ATR A;  1NU0 A;  1HPZ A;  3CCJ N;  4YFU A;  1HYS A;  1Q82 O;  4OJR A;  2NUB A;  3OYK A;  1G99 A;  3AAQ A;  3KHY A;  3AAP A;  4XH4 A;  3TR8 A;  2GUP A;  4H5N A;  1BOT O;  1EWR A;  4DF8 A;  3MXJ A;  4JI7 K;  1WB9 A;  2Q97 A;  4IO9 L;  1W7A A;  2KW4 A;  4U7B A;  4CJE A;  5J1E A;  4IKF A;  2IIR A;  1J5O A;  1KVB A;  3KKR A;  3BDP A;  3KD1 E;  4H0O A;  1TVR A;  4NYN A;  4FK2 A;  2IAJ A;  4DCH A;  5FPN A;  1QE1 A;  1RT3 A;  3UB5 A;  4CES A;  4CZF A;  1IKW A;  2W41 A;  3I55 N;  4CW7 B;  2QW9 A;  3LM2 A;  4NCB A;  4N76 A;  1BUP A;  4ISF A;  4DTX A;  4WF9 L;  3HP9 A;  3VQB A;  4E7K A;  4FJN A;  3CME N;  1A5V A;  2HBL A;  3RR7 A;  1CXU A;  1D4X A;  3SLC A;  4F3O A;  1TAU A;  3C94 A;  4BRL A;  1XMQ K;  5A2Q O;  3T1H K;  4H5V A;  4DLG A;  3HOS A;  3MWP A;  1RTJ A;  2WTU A;  2YHA A;  2O4G A;  4FWO A;  4KB1 A;  4RCH A;  3LDP A;  4DU3 A;  4XH1 A;  4A62 A;  2D0A A;  4JKG B;  4LF9 K;  4KHY A;  1KVA A;  4CJ4 A;  2D4W A;  3V6D A;  4DR2 K;  3I0S A;  3IMX A;  3QLH A;  4I2Q A;  4A2A A;  3CD6 N;  1YHQ N;  1KFD A;  3H45 C;  3O3F A;  4FM0 A;  1ASW A;  4CD1 A;  1Z6R A;  1VQN N;  3THX A;  4G9Z A;  5AJ3 K;  1JCG A;  3IS9 A;  3LDN A;  1S6Q A;  3DXK A;  5I42 A;  4RG8 A;  4BWM A;  3M8R A;  3ULE B;  3R3L A;  4ZHR A;  3KZB A;  4DQI A;  5AZJ B;  5C42 A;  3PIO L;  4CE9 A;  2GTD A;  1NGA A;  3FZK A;  5F1X A;  3D2F B;  4IFE A;  2IOC A;  2YJF A;  1Q9Y A;  4KI6 A;  4PKI A;  1BQN A;  3MN9 A;  3AO1 A;  3KWG A;  3CJ7 A;  3TSU A;  1X9S A;  4JI4 K;  1RDB A;  2OPQ A;  3HPO A;  1IO2 A;  2ASP A;  1QS4 A;  4DR1 K;  4KAZ A;  2DFE A;  3WXL A;  5AR0 A;  2RF2 A;  3VPZ A;  3HPG A;  5ADX H;  2VGN A;  3O3H A;  3V9W A;  4B1U B;  4CZG A;  3ZLJ A;  3OYN A;  3DM2 A;  1YIT N;  1D5A A;  3CYM A;  3H3N O;  5JMV A;  3HI0 A;  5D3G A;  1NGE A;  4IEI A;  1L3U A;  5AQY A;  2ZE2 A;  3M8P A;  5AQR A;  4B3O A;  3EO3 A;  3J7A P;  1DTQ A;  3E1Y A;  1XMO K;  3L8B A;  4PL8 A;  1JCE A;  4IBN A;  2D1K A;  4H0Y B;  3M5R A;  5B8H A;  3WUH A;  4BQZ A;  4CEC A;  3NH2 A;  4H0V B;  3RTV A;  4N5S A;  3AAR A;  4FWR A;  3LP3 A;  2GX9 A;  3CJB A;  4NO7 A;  2VYP A;  3V1O A;  2XRI A;  1NOY A;  4JI3 K;  3NVM A;  1OH7 A;  3CC2 N;  2D0C A;  1C1C A;  5KQD A;  4C8N A;  3I8D A;  3V81 A;  5HL7 L;  3MN7 A;  1BIU A;  4MDB A;  4OGC A;  4DTN A;  1LWC A;  4FM1 A;  4CF1 A;  4AHU A;  1V4T A;  4CEA A;  2O8B A;  4BRI A;  1TKX A;  3OYF A;  1C1A A;  1YJN N;  5I3U A;  1LWF A;  1W97 L;  4DLE A;  4MDA A;  3LDS A;  1QVF M;  1WAF A;  2X6S A;  4A5A A;  2NRW A;  5C2F A;  4E7J A;  3BGR A;  4KO0 A;  3VEV A;  5HP1 A;  4WCE L;  3M8Q A;  3V1R A;  3THX B;  4JHD A;  2FBY A;  3HPH A;  3KWI A;  1IV0 A;  4FLW A;  1FKO A;  3A5O C;  5M1P A;  3K59 A;  1J5E K;  4B1Z A;  1TUU A;  3PO4 A;  3DXK B;  3W0L A;  3TU5 A;  2AP1 A;  2JLE A;  4WQ5 A;  4O4G A;  5BPM A;  3NH0 A;  4H5T A;  1B92 A;  3LDO A;  4AH9 A;  5JS1 A;  4CEE A;  2QKK A;  4CBU A;  4FJ8 A;  3WT0 A;  5LL6 Z;  4B9N A;  3P5J A;  4H0T B;  4CHN A;  1R0A A;  2IDO A;  4K25 A;  3NE6 A;  4F2S A;  2NRT A;  1NGD A;  5M1O A;  3CHW A;  4IDH A;  3P38 A;  2ZD1 A;  1XNQ K;  4JV5 K;  3DMJ A;  2Q0R A;  3ZX3 A;  3ENB A;  3PSF A;  4DV3 K;  3HTV A;  4EAH D;  3OJU A;  2HHU A;  4CZH A;  5IWA K;  2ITG A;  3H08 A;  2JWL A;  4M3R A;  2A41 A;  3J80 O;  5GAG P;  1RDD A;  5HRR A;  3TAN A;  1QQO A;  4BC4 A;  1UOC A;  4DG1 A;  4JKF A;  1VQ4 N;  4BWJ A;  4IEE A;  4KRF A;  5AQM A;  1VSK A;  2F96 A;  4C1N K;  1T8E A;  4CZK A;  1CZB A;  1OH8 A;  1GLA G;  1YVU A;  3ATV A;  1K8K A;  1X9M A;  1D9F A;  2PBD A;  2E2N A;  3NVK A;  3MCP A;  3ATU A;  2IC3 A;  2P1J A;  3CPE A;  4CHZ A;  3SAH A;  3QEV A;  1LOT B;  4CGJ A;  5M1Q A;  3VEZ A;  4Q0B A;  2VG5 A;  2QXF A;  1TK8 A;  3M3Z A;  3N4Q A;  2F9T A;  3SCX A;  3QNN A;  2Z1J A;  2RN2 A;  3K9K A;  5JS2 A;  3CCL N;  5J2M A;  5HLF A;  4DUZ K;  2HHW A;  3MDQ A;  1NK4 A;  3QEI A;  4YOX A;  3WQT A;  3HVT A;  3U9D A;  3ZET B;  3ZEU A;  1O1W A;  3QET A;  3A5M C;  1D9D A;  1OH6 A;  2RE2 A;  4OX9 K;  4KB0 A;  4Z0U A;  1YTU A;  1BWF O;  4LF5 K;  2R7Y A;  1JLB A;  4HTU A;  3L2R A;  3CIP A;  4JS4 A;  4GKK K;  3J81 O;  4DTS A;  5FRO A;  4EFH A;  4FWQ A;  4JD2 A;  2ZJQ L;  2QEX N;  4LFC K;  5AQT A;  4DV2 K;  3THV A;  2PAV A;  3E66 A;  4CZI A;  4Z4C A;  4HWI A;  3VTI A;  4F2R A;  4BDY A;  5JLF A;  1HR0 K;  4FWK A;  3K58 A;  1L5U A;  5ELZ A;  3T19 A;  1TK0 A;  1HMV A;  2BUP A;  3G25 A;  5AQL A;  1HNV A;  2GWK A;  2YHX A;  4CJU A;  2XY7 A;  4E7L A;  3CMA N;  1UAX A;  1QSL A;  2UXD K;  3MK6 A;  1NK9 A;  1KCF A;  3VES A;  4C8K A;  4PKH A;  3CJ1 A;  3QIN A;  1GLE G;  3VOV A;  4A5B A;  4BC3 A;  4BRQ A;  3MAQ A;  1SKW A;  3U3G A;  2UXB K;  4IXC A;  3T1Y K;  4JYA K;  2Q36 A;  4CEF A;  1BA1 A;  3QEP A;  3C6U A;  2BGG A;  1U2V A;  3BZK A;  3ULD A;  4B1Y B;  4FW1 A;  4ELT A;  4DF4 A;  2FC0 A;  1NJZ A;  1NJX A;  3L2V A;  3RWU A;  4NXN K;  4QOZ B;  3TWH A;  4FL9 A;  5AQO A;  4HHT A;  2ZGZ A;  3DLE A;  4M3X A;  4BRD A;  3PUF A;  3DLH A;  3DOL A;  1U47 A;  2G8W A;  1HX1 A;  4JK8 A;  1HJR A;  4YHH K;  1NK6 A;  2WOM A;  4DSF A;  3GDQ A;  3TAF A;  4LF6 K;  2HND A;  1T3V A;  1BU6 O;  4C23 A;  3RMC A;  4AM7 A;  4DWI A;  1RDC A;  2NNW A;  1IKY A;  4O44 A;  2FBV A;  4BRM A;  4B9V A;  3ZEU B;  4FPB A;  2A42 A;  4O5B A;  2ETJ A;  1T44 A;  3CCR N;  3MXI A;  3HYF A;  2E88 A;  4B9Q A;  1T05 A;  3C6H A;  4YDU C;  4DTR A;  4E1N A;  4BQL A;  4RW4 A;  1HLU A;  5EVZ A;  1V4S A;  4LSN A;  3QIO A;  2A3Z A;  4NB4 A;  4FZX C;  3KTQ A;  4AHT A;  4DUY K;  4E7I A;  4JD2 B;  4H0X B;  1NKC A;  3H1Q A;  1Q86 O;  1EET A;  1C0T A;  2HNZ A;  1VAZ A;  4O0J A;  2CH5 A;  1D8Y A;  2UU9 K;  2W40 A;  4FK4 A;  4JK9 A;  4GV6 A;  5CYM A;  4F9O A;  4BDZ A;  2B5J A;  4KH5 A;  2RPI A;  2ZJP L;  5DMR A;  3UE5 A;  3VQ4 A;  1BCO A;  2FF3 B;  3P83 D;  4FWL A;  2GUI A;  3R9P A;  4PKG A;  2ZWH A;  3O5B A;  1KSP A;  2JWK A;  4EP4 A;  3FZH A;  1VQL N;  3K5L A;  1IBK K;  1VQ7 N;  3EE8 A;  3T69 A;  5AQN A;  1S1U A;  4R5P A;  2WON A;  4JEP A;  1S22 A;  2IVO A;  1KC8 O;  4R79 A;  4ISE A;  4CZJ A;  1P8Z A;  1BGX T;  4KHQ A;  1U2V B;  3EY1 A;  1MU2 A;  4KHN A;  3V1Q A;  1ZBH A;  3SPY A;  4DSE A;  4H4O A;  2BE2 A;  3L4Q A;  4GNI A;  1ZBF A;  1IBM K;  3QIP A;  1OVQ A;  1KQS M;  4ZTF A;  1HNX K;  3PIP L;  3NH1 A;  5KPZ A;  4PL7 A;  1NGH A;  4BAC A;  4CVN E;  1BIS A;  4JKE A;  3A2F A;  4CBX A;  4F8R A;  1T7P A;  4I2P A;  4GVM A;  1RIL A;  2HF3 A;  1TKD A;  3DXM A;  3EZ5 A;  2E2P A;  3OS0 A;  3CF5 L;  3TTC A;  3J8A A;  4CGH A;  5M1N A;  3CQY A;  1VQ8 N;  1C1B A;  2QWO A;  3P4I A;  4QS8 A;  4A2B A;  5EU7 A;  4CEB A;  3PX0 A;  5CR4 A;  4CBW A;  3VQ7 A;  1ATS A;  4JNE A;  3HVR A;  4Z4I A;  2YHB A;  2A1S A;  3KKS A;  3KLI A;  3SUP A;  1S72 N;  5GIP A;  4WE1 A;  5CE3 A;  1XC9 A;  4KRE A;  4EHU A;  1B9F A;  2RHK A;  2HNY A;  4DFM A;  1B9D A;  4QCL A;  2A40 A;  4OVL A;  4CED A;  4DKW A;  4BR0 A;  3DRR A;  5DK5 A;  3MEG A;  3ENO A;  2Z1H A;  3AY9 A;  2P9N A;  1FW6 A;  4Z4G A;  2GEM A;  3HP6 A;  4BE2 A;  3ZT3 A;  4BGB A;  1LAW A;  1EKE A;  4W5N A;  5KQ8 A;  3OS2 A;  4FJ9 A;  4OKJ A;  4CCH A;  1S1X A;  4ZTJ A;  5AQU A;  2V7Y A;  5KTQ A;  3K9J A;  2Q1N A;  3EL2 A;  4I6M A;  1SUQ A;  2WBN A;  3T1A A;  3FR0 A;  4M3W A;  3VTH A;  5FPE A;  3ID6 A;  4KBO A;  5BPL A;  4FLZ A;  1NMD A;  4YOW A;  4CGI A;  1HQU A;  4E19 A;  5BRF A;  4Z94 A;  3L2U A;  1K73 O;  1I39 A;  3JS6 A;  3NMU A;  4LH5 A;  4KPY A;  2Q31 A;  2Y1I A;  2YKM A;  1M1K O;  3QES A;  2WFB A;  1CXQ A;  2KFN A;  2QWL A;  3VN5 A;  4N56 A;  1HQE A;  1VQ9 N;  3MN6 A;  5ADX A;  1EQY A;  5AQJ A;  2G8V A;  4C8O A;  3MXM A;  1SKS A;  4DV0 K;  1OKJ A;  3C0B A;  2KFZ A;  4FJI A;  2GWJ A;  4Y0W A;  2NZT A;  4CK1 A;  4OPK A;  3KK3 A;  2XHB A;  1ASV A;  3QO9 A;  3AVG A;  3V9S A;  3DAW A;  2P9K B;  1WSJ A;  1T6D A;  4ICL A;  4AQY K;  1Z05 A;  4Y1C A;  4RWT A;  1EWQ A;  1KAY A;  3KK7 A;  3FLC O;  4CJS A;  3IRX A;  1YI2 N;  3SYZ A;  1VQK N;  3VGM A;  3NGI A;  3RR8 A;  1KTQ A;  3UKU A;  3J7Z O;  1I3A A;  3VEY A;  5FRN A;  2DFH A;  1WSE A;  4BC5 A;  4JRP A;  1H1V A;  3CPW M;  3F9M A;  3PO5 A;  4CF2 A;  1U49 A;  3OHR A;  1NLV A;  3CC7 N;  2A6A A;  2I7N A;  3TAG A;  1S6P A;  5AQX A;  3LDL A;  4X62 K;  3W3D A;  3KVG A;  1QSS A;  4BC2 A;  2EHG A;  3R1X A;  3SPZ A;  2E1Z A;  4IO8 A;  2QKB A;  4O0I A;  2E1Y A;  3SNN A;  5LJV A;  2J4R A;  2OPP A;  2FBX A;  3ENH A;  1ZBU A;  1X3M A;  3CET A;  4Z4H A;  3A5N C;  2QXL A;  4CIG A;  4DU1 A;  1BI4 A;  3QDK A;  1NWK A;  4KV8 A;  3AO4 A;  2E5L K;  3LL3 A;  3H46 O;  2B6A A;  1J53 A;  1TGO A;  1N36 K;  5SWM A;  4I6M B;  4IJN A;  5FPD A;  3EE9 A;  5LMU K;  4O5F A;  4LSL A;  4JKC A;  4B3T K;  1QQN A;  3ZT1 A;  3V9U A;  5K14 A;  4IOA L;  2AJQ A;  2Q3S A;  4YY3 K;  1KXP A;  4OO1 J;  4EIA A;  3CJA A;  4NLB A;  4OKE A;  2P51 A;  2QWQ A;  2E20 A;  3IFR A;  3S41 A;  3FFK B;  3M8S A;  3CG7 A;  4I7F A;  4KI4 A;  3MEE A;  4EZ6 A;  1WN7 A;  4FWM A;  3TTF A;  3O4W A;  4KHU A;  4DHY A;  1NGC A;  3VF4 A;  1LWE A;  3MN5 A;  3B6P A;  1LW0 A;  1VK0 A;  3CFO A;  2P9U A;  4YOU A;  2XY5 A;  3O9R A;  3K5O A;  4LY7 A;  1NJY A;  3ZT0 A;  3SQ4 A;  3OYD A;  1RDW X;  3OBW A;  1IH7 A;  4DR7 K;  3OW2 M;  3RMB A;  1C0F A;  1MDU B;  4CK2 A;  5IT9 O;  1X1P A;  4FJK A;  4BR2 A;  4FXD A;  2VG7 A;  2XY6 A;  3AVN A;  5HRS A;  3CCE N;  3RVC A;  3K0S A;  4A59 A;  3OYB A;  1L3T A;  1W0H A;  3O9Q A;  3CFR A;  4X64 K;  3OYA A;  4DTJ A;  3SMS A;  3ZSR A;  4CHQ A;  1BA0 A;  4LFA K;  2QTD A;  3JYT A;  1E4F T;  2QA4 N;  1JLF A;  1CZA N;  3CM5 A;  1RDU A;  1U04 A;  3I8B A;  3ZSV A;  1NK7 A;  2JGU A;  1NGG A;  4CFC A;  2YNI A;  2GBZ A;  3NF7 A;  4EP5 A;  1RBT A;  1SL1 A;  4M45 A;  2OAN A;  4YDU A;  2HHX A;  2KHO A;  1C6V A;  1RBR A;  4UY8 O;  4FZZ A;  4AHC A;  2CGL A;  3AA5 X;  1I94 K;  3NBP A;  3H1V X;  4J2E A;  4FWN A;  3ASM A;  2KKZ A;  4FJJ A;  3AA4 A;  4BG9 A;  4FOE A;  3VQE A;  4ELU A;  4PQU A;  3VET A;  3TPQ A;  3M1F A;  3F9K A;  3KLF A;  3KLH A;  2QI2 A;  3U6F A;  2FSJ A;  1BL3 A;  5AQV A;  4BVP A;  4FW2 A;  3DJC A;  5FPM A;  1C0M A;  1RT5 A;  5BR9 A;  4PY5 A;  4B3R K;  3EN9 A;  3D6R A;  5M1K A;  1R59 O;  3EKS A;  3HRG A;  4FPA A;  4CJK A;  1WSI A;  4CJ5 A;  2O8B B;  4DQR A;  2CGJ A;  4BE1 A;  5KPT A;  5AQP A;  2NRV A;  1BHL A;  4FO0 A;  4M63 C;  3DLG A;  4M42 A;  2HVH A;  2YHW A;  5AQF A;  1YXQ A;  3CCV N;  4Q5V A;  2KZZ A;  3O6W A;  1VQM N;  3CM6 A;  4CK3 A;  2UYT A;  4B8A B;  3OTO K;  4JHD B;  3DLB A;  1DTT A;  3P39 A;  3U3Y A;  1ESV A;  3LWL A;  3SBG A;  4WFN L;  3D45 A;  3RRG A;  3O9U A;  4B8C A;  1IKV A;  3IAY A;  1K8A O;  1NBW A;  4TSX A;  4CEZ A;  2P5G A;  5GIO A;  2KZM A;  1FJG K;  1WUA A;  1HUX A;  5T7B A;  4E89 A;  1RT7 A;  4C8M A;  3M6G A;  4NYF A;  1XHX A;  3C65 A;  4GY2 B;  1XI1 A;  5BRD A;  4BRP A;  4RW9 A;  1EX4 A;  4EHT A;  1L3V A;  2G8I A;  1XWL A;  4DR6 K;  3QFU A;  4A61 A;  4KH6 A;  2B4J A;  2WC9 A;  2ZQB A;  4B9S A;  3NF9 A;  3TSP A;  2PZS A;  3LPU A;  4OLB A;  2UUB K;  2X6N A;  2PYL A;  4H5W A;  4DV6 K;  2NRX A;  1KRP A;  3SQ2 A;  1BG3 A;  1WOQ A;  4NLC A;  1WBB A;  4DMN A;  2VGM A;  3LZI A;  3LAN A;  5E26 A;  4IG0 A;  4CJT A;  3C7N A;  1NKE A;  1VQP N;  1JL2 A;  1M90 O;  4BDP A;  4ILJ A;  3KD5 E;  1U48 A;  3AV9 A;  1BQM A;  4KH4 A;  1N6Q A;  2YX6 A;  1NOZ A;  1RGI A;  4IDK A;  4JI8 K;  3VQD A;  3PLA A;  3L3V A;  1JJ2 M;  1NM1 A;  4FVU A;  3WXI A;  3BF3 A;  4OPJ A;  3WNF A;  1GLC G;  1SAZ A;  4L3Q A;  4DR3 K;  3HSC A;  1K8K B;  3WNH A;  2UXC K;  1YJ9 N;  3SUQ A;  3GE1 A;  1BIZ A;  5CZ1 A;  2HHV A;  5AQS A;  1UA1 A;  2VWJ A;  3VQA A;  3OYL A;  4H03 B;  2Z1G A;  3GL1 A;  3G4S N;  4BE0 A;  3RRH A;  3VQ8 A;  3OYI A;  2AA4 A;  4ILG B;  4DS5 A;  1VSI A;  3G10 A;  4K41 A;  1IJJ A;  1HJO A;  4FJH A;  4LF7 K;  3V9Z A;  1VQO N;  3CQX A;  3VEO A;  4WQ5 C;  4CI6 A;  1ZBI A;  3BY5 A;  2D0B A;  4LD0 A;  2OZM A;  5M1F A;  4CJL A;  5BR8 K;  4FVM A;  2QM1 A;  4MQ3 A;  1XNR K;  3L0Q A;  1YVN A;  2OA8 A;  4FLY A;  3A8Y A;  4LC9 B;  3MX2 A;  4PUO A;  1KAX A;  1E3M A;  4DTP A;  3GOI A;  2P9P A;  4BVO A;  3G71 N;  5C15 A;  4CFB A;  3VQP A;  4HCC A;  2ASO A;  3O08 A;  3ZT4 A;  4OPA A;  2QWR A;  2ITM A;  2O8E A;  3NGZ A;  4DSJ A;  3QIC A;  3S3O A;  5JIC A;  3SAG A;  2VCP A;  3AVI A;  5KGW A;  2VQE K;  1Z26 A;  4CFD A;  3SUN A;  3VF6 A;  4JKH A;  4E3S A;  3HZ6 A;  4JKB A;  4NXM K;  3KJV A;  2I5J A;  3RMD A;  5AQZ A;  3ZT2 A;  5CYQ A;  3T3F A;  4B1X B;  2ZJR L;  1BCM A;  4FK0 A;  4N41 A;  4B3S K;  5E41 A;  4GV3 A;  3UIQ A;  4FOI A;  1Q81 O;  1J54 A;  1NMN A;  2YHY A;  2PYJ A;  3WXM B;  1GLJ O;  4WFB L;  4ELV A;  3K5N A;  3HT3 A;  1TL1 A;  5AQW A;  3EYZ A;  4FJM A;  4B3M K;  2E6L A;  4DFK A;  4C8L A;  3HL8 A;  5AFU A;  3AO5 A;  4DQQ A;  1J9A A;  2ZF5 O;  4Y1D A;  4KTZ A;  4M7Y A;  1HNI A;  1JLE A;  3G6E N;  1GLB G;  1HNW K;  3N4P A;  4JS5 A;  4CHP A;  4PA1 A;  3MEC A;  2RKI A;  1LCU A;  4W5R A;  1LV5 A;  3VEN A;  2Y1J A;  4K42 A;  4CFA A;  4HUG A;  4BY9 C;  2ASM A;  2H3G X;  3HST B;  1GOC A;  4K43 A;  4HVJ A;  4F4K A;  3RSE A;  1QQM A;  2D5R A;  1YF5 L;  3VF2 A;  2YNF A;  3DI6 A;  4CER A;  4KFB A;  5KPR A;  1WSH A;  3VER A;  5AZI A;  1KLN A;  4YOT A;  4BRG A;  4GV9 A;  3G0Z A;  1RFQ A;  3S3N A;  3PX4 A;  3LAM A;  4J2B A;  3HOT A;  1K6Y A;  5J2Q A;  1S1W A;  4DV7 K;  3BZC A;  3NCI A;  3F73 A;  2IVN A;  2WUS A;  4DFJ A;  1RT1 A;  2E2O A;  3AA2 A;  3TSQ A;  5BN8 A;  1E4G T;  2OZS A;  4JKG A;  4H4M A;  1HPM A;  2IS3 A;  5AFU H;  4DQP A;  3SAF A;  5CZ2 A;  1IBL K;  1T6C A;  1QTM A;  4CHY A;  5CY4 A;  1NKB A;  1TAQ A;  1NGJ A;  4CJR A;  1Q18 A;  4RTF D;  4E7H A;  1U4B A;  3TAM A;  1TYQ A;  1JL1 A;  4CJ7 A;  1XQS C;  2W6K A;  2G8K A;  4DSK A;  4DTU A;  3UKR A;  5I9E B;  5LMN K;  4K8X A;  5AZJ A;  2VQF K;  1VSF A;  3THY A;  4DR4 K;  3U9Z A;  3C6T A;  1N8R O;  1Q9X A;  2ATQ A;  3VA0 A;  4BR5 A;  3TAP A;  1FKP A;  3JXU A;  1JLG A;  1GOA A;  4AHV A;  4W5O A;  1CLQ A;  4YOR A;  1YTA A;  4BR7 A;  3OBY A;  4FCY A;  4X65 K;  3LWM A;  4BRO A;  3OYE A;  2F9W A;  1W9H A;  4CZL A;  3CI5 A;  1C0U A;  3K5M A;  4HUE A;  3R6M A;  4O55 A;  4E1J A;  5BRE A;  1KD1 O;  1XC3 A;  4WYB A;  2G8F A;  4NCA A;  2P9I A;  4FJ5 A;  1KFS A;  1JXE A;  3QNO A;  3FE1 A;  5KGX A;  1VQ5 N;  3D2E A;  3EZW A;  1HYV A;  4E0D A;  4H0P A;  3BF1 A;  3HO1 A;  3RMA A;  1YAG A;  1NK5 A;  2KLA A;  1QZ6 A;  3DRS A;  4GVE A;  4LH4 A;  2HHS A;  1ATN A;  5JVG L;  1RBV A;  3D0P A;  1QQC A;  2HMP A;  2QK9 A;  1SQK A;  2V7Z A;  5C10 A;  5H1S Q;  4DSL A;  3SQ0 A;  3U4L A;  3DLL L;  4JI2 K;  4RW7 A;  4FJ7 A;  3RSE B;  4BGA A;  3I56 N;  3TAE A;  2O4I A;  2P9S A;  5AZI B;  3DXM B;  2E6M A;  1RCH A;  2F8T A;  1L3S A;  4CD3 A;  1LAV A;  4DFP A;  3ALY A;  3SK3 A;  3IKM A;  3VEW A;  2NLX A;  4IFY A;  1TV6 A;  5TKW A;  1VSE A;  1NK8 A;  4CJV A;  3SMP A;  3OYJ A;  5AQH A;  3GG4 A;  3B8A X;  5CHI A;  1LW2 A;  5HRN A;  2YV0 X;  1Y64 A;  3CJC A;  3PSI A;  1X9W A;  3O80 A;  1NGF A;  3ZX0 A;  1X3N A;  5TKY A;  4MO4 A;  2YNG A;  3VGL A;  1S9G A;  1TYQ B;  2NRR A;  4F3T A;  1QSY A;  4JK7 A;  1FK9 A;  3UKR B;  1RTD A;  2E8A A;  1A5W A;  4QAG A;  3AO3 A;  1CZ9 A;  3I0R A;  4IOX A;  1DGK N;  4PWD A;  3NDK A;  3THY B;  2EWS A;  1J6Z A;  4J8F A;  3VA3 A;  5KRT A;  2P9N B;  5FLX O;  3EEQ A;  4DQS A;  5KI6 A;  4W5Q A;  2X74 A;  4B9U A;  3VQ9 A;  3AVA A;  4U67 L;  1Q7Y O;  3VQQ A;  3KLE A;  3SV3 A;  4N47 A;  4A57 A;  2DPN A;  4CEO A;  3MWT A;  3R8E A;  4YNQ A;  4WQ4 C;  2OTL N;  2BDP A;  4B9M A;  2P5O A;  4IG3 A;  2KQ2 A;  1JKH A;  3CC4 N;  1N5Y A;  2P9I B;  1QHA A;  1ZBS A;  1KAZ A;  3QBW A;  1KLM A;  4CIE A;  4XEI A;  2OYQ A;  3D2E B;  3HM9 A;  4FLT A;  1A5X A;  2VWK A;  4AF1 A;  3OYC A;  3HJF A;  4JRQ A;  1WSF A;  2HST A;  3ZSY A;  4Z4F A;  4PHT X;  3SV4 A;  3IDH A;  3CCU N;  4DV4 K;  3QB0 A;  3TI0 A;  4BRN A;  3KK1 A;  4B9L A;  4DV1 K;  3QFP A;  5BRH A;  3NFA A;  3QEW A;  2HMI A;  5EX5 A;  4FLV A;  1S1T A;  4JLH A;  3Q7B A;  4KHP K;  4CIF A;  2P9S B;  3O3G A;  3A0I X;  3WEE A;  1YJW N;  2XY8 A;  4W5T A;  4JI6 K;  3DWL A;  1NG9 A;  2YCH A;  1NNE A;  4AHR A;  3ZSW A;  1KVC A;  2W6L A;  1HKG A;  3ZSX A;  2FXU A;  4JI5 K;  4FWS A;  3L4I A;  5F0X A;  2HHH K;  3OYG A;  4CF8 A;  1T03 A;  3TAQ A;  2BAN A;  1JLA A;  1TUY A;  3UKU B;  1ILY A;  1NGB A;  3SJJ A;  1G15 A;  3ITH A;  3O9T A;  4MO5 A;  3ZSO A;  1HYZ A;  1S9E A;  3WNE A;  3NGY A;  1VQ6 N;  2HB5 A;  4G1Q A;  5GIN A;  4AIL C;  3MMV A;  1EP4 A;  3VQC A;  3ZET A;  3LAK A;  2BH1 A;  4WFA L;  3PX6 A;  1SS6 A;  3O1B A;  4EZ9 A;  1RNH A;  3JSM A;  4CEQ A;  4FLX A;  4KHS A;  5BN9 A;  1ZBL A;  3VGK A;  1JLC A;  1VRT A;  4CJQ A;  2Q0U A;  1DT9 A;  4UQG A;  4K8Z A;  4BG8 A;  2YNH A;  2IVP A;  2KTQ A;  1VSL A;  3IUC A;  3H3O B;  1OVY A;  1RT2 A;  3OVN A;  4HUF A;  3PV8 A;  3ZSZ A;  2I7P A;  2HBM A;  4YOY A;  5DM7 L;  4HCB A;  5HOO A;  1BI4 B;  4L8R B;  1NGI A;  1XUP O;  4V19 S;  4BRC A;  3TAB A;  3SQ1 A;  4LFB K;  3ZCM A;  4DB3 A;  4JKA A;  3OYM A;  4IOC L;  2OPS A;  1HKB A;  1GLL O;  3BP8 A;  3VQ6 A;  3JAM O;  2X78 A;  2HBK A;  3AVM A;  2F7T A;  2QWN A;  4KTW A;  3THW A;  1RBU A;  1VSM A;  3AVK A;  3NF8 A;  4OGE A;  3LPT A;  5J2N A;  1Y97 A;  3HXM A;  4LF4 K;  1VRU A;  4FJL A;  2HBJ A;  3DYA A;  3E9P A;  4B08 A;  3CCS N;  1U45 A;  4BR9 A;  4H5R A;  2F4V K;  3J7Y P;  3HBT A;  1YIJ N;  4CZM A;  4J2D A;  4XIU A;  2P9U B;  5JVH L;  3ZSQ A;  1HNZ K;  3LZJ A;  3SZ2 A;  5FDL A;  1NJI O;  1WSG A;  3WEE B;  4ID1 A;  3VMF B;  1F21 A;  4CJ3 A;  4YOV A;  3QML A;  2CGK A;  4OPH A;  2HF4 A;  5J2P A;  4QS7 A;  2Q2R A;  4RW6 A;  3NHG A;  4JKD A;  3WNG A;  3QEX A;  4B1W B;  2P9L A;  4XH5 A;  1SKR A;  2PY5 A;  4JI1 K;  5E84 A;  4FZY A;  2XO7 A;  3K2P A;  2FBT A;  2HHT A;  3CXC M;  3WQU A;  3D7E O;  1SZ2 A;  3LP0 A;  4ISG A;  2FLO A;  4ID5 A;  3NF6 A;  1N32 K;  1VSD A;  3LP1 A;  4LF8 K;  5C24 A;  4DU4 A;  4FLU A;  4KTQ A;  3V9X A;  5FRM A;  3LAL A;  3CER A;  3FGU A;  1GOB A;  1WNS A;  4CZE A;  3ZYY X;  3LP2 A;  3KLG A;  5HBM A;  2GV9 A;  5C12 A;  3AVJ A;  1JXB A;  1ZC6 A;  1YUW A;  3V4I A;  4KHW A;  3MED A;  3T7Z A;  4HTL A;  2VWB A;  5C0Y A;  4CF0 A;  1W2B M;  1RTH A;  1RTI A;  3HM8 A;  4MFB A;  2D0P A;  1Q8I A;  4DV5 K;  2O8D A;  2QWM A;  4AHS A;  4M3Z A;  4DTO A;  3QER A;  4I9L A;  4X66 K;  3AVC A;  3A5L C;  4BRE A;  1QZ5 A;  1O13 A;  2D0O A;  4B1V A;  2IGI A;  4FM2 A;  3S9H A;  3EKU A;  3O4Q A;  3FZM A;  2W42 A;  4QS9 A;  3VQ5 A;  1C0G A;  3FZL A;  3LDQ A;  3SI6 A;  2FSN A;  3KIO A;  4CJW A;  2BTF A;  3MCA B;  3L3U A;  1EO1 A;  1DEJ A;  3NAE A;  2YKN A;  3THW B;  2Z1I A;  2FSK A;  4MLE A;  3L2W A;  3DLK A;  5GAE P;  3CCM N;  3O1W A;  4FJG A;  4IZ9 A;  2OTJ N;  2VG6 A;  5EY4 A;  5SZT A;  1IG8 A;  4M3Y A;  2CH6 A;  3F2K A;  1S5J A;  3U8X A;  3CQ8 A;  4ILH A;  2O8C A;  3SUO A;  5GAH P;  3GBT A;  3CJ9 A;  2HVI A;  4BR4 A;  1RBS A;  5GAD P;  1IKX A;  2NRH A;  1N33 K;  3P1G A;  4CHO A;  4NCG A;  2LSN A;  3OY9 A;  3O9S A;  4GW6 A;  1TK5 A;  4O8U A;  1HKC A;  1RT6 A;  4FSV A;  4I9Q A;  1K9M O;  1REV A;  4GMJ B;  3SBT A;  3VEX A;  2O8F A;  2P9L B;  1QVG M;  1VHX A;  1JCF A;  4B9T A;  1Z25 A;  2V51 B;  2YJE A;  1SL0 A;  3TAR A;  4CGF A;  5KRS A;  2F8S A;  1FXX A;  4M3U A;  1QHT A;  1VSJ A;  2DY4 A;  4M7X A;  1JLQ A;  1P90 A;  4FYD A;  1WAJ A;  3E01 A;  4KKO A;  4JN4 A;  3DOK A;  3AVH A;  1MWM A;  3DRP A;  1MWK A;  2UUC K;  4M41 A;  1WBD A;  4IJA A;  4CGD A;  3P31 A;  3PY8 A;  1DLO A;  2A1R A;  4J2A A;  4JI0 K;  3OS1 A;  5DM6 L;  3Q7C A;  2E2Q A;  3L2Q A;  4BRF A;  2QWP A;  3AGK A;  4AM6 A;  4E1M A;  1OH5 A;  1S1V A;  1ZYQ A;  3C7N B;  4MLH A;  5JLH A;  4DTM A;  2PFU A;  1U6Z A;  1SV5 A;  2O8D B;  1TKZ A;  1GLF O;  1UA0 A;  4O8K A;  3ID8 A;  1S3X A;  5C2D A;  5LJW A;  4BRA A;  2G8H A;  3E9L A;  1BO5 O;  5AQG A;  3QBX A;  5C25 A;  1DKG D;  5AQQ A;  1GLD G;  2YI1 A;  3AVB A;  2DTU A;  4DS4 A;  3C6A A;  3IG1 A;  3TTD A; 
#chains in the Genus database with same CATH homology
 3AVN A;  3THV A;  5HRS A;  3TAE A;  4Z4C A;  3OYB A;  1RT4 A;  4F2R A;  2O4I A;  1L3T A;  1W0H A;  4BDY A;  4IFV A;  1SL2 A;  3CFR A;  3OYA A;  4DTJ A;  2E6M A;  1RCH A;  1TL3 A;  3ZSR A;  1L3S A;  3K58 A;  4CHQ A;  4OKK A;  1L5U A;  3C95 A;  2G8U A;  4DFP A;  1LAV A;  3T19 A;  3ALY A;  1TK0 A;  1HMV A;  1HNV A;  3AVF A;  3O4N A;  4IFY A;  3JYT A;  2HHQ A;  1JLF A;  3CM5 A;  4CJU A;  4FJX A;  1HRH A;  2XY7 A;  4E7L A;  1TV6 A;  2P5G A;  1U04 A;  1UAX A;  1QSL A;  1VSE A;  3S3M A;  1NK8 A;  1NK9 A;  1KCF A;  4CJV A;  3ZSV A;  4C8K A;  1NK7 A;  3OYJ A;  2JGU A;  3QIN A;  5HRO A;  3AA3 A;  1IG9 A;  2EX3 A;  3OJS A;  1LW2 A;  5HRN A;  2YV0 X;  1VSH A;  3AO2 A;  3MAQ A;  1SKW A;  4CF9 A;  4CFC A;  1X9W A;  2YNI A;  1WLJ A;  2HW3 A;  3U3G A;  4CJP A;  2GBZ A;  3NF7 A;  4CEF A;  4EP5 A;  3QEP A;  1RBT A;  2YNG A;  1S9G A;  3C6U A;  2BGG A;  1XHZ A;  1SL1 A;  3ULD A;  4F3T A;  1UWB A;  4M45 A;  3OYH A;  1QSY A;  3K57 A;  2HHX A;  1C6V A;  1FK9 A;  1RBR A;  1RTD A;  4FW1 A;  4ELT A;  4DF4 A;  2FC0 A;  1NJZ A;  1NJX A;  3L2V A;  3RWU A;  1A5W A;  1RDA A;  4QAG A;  4QOZ B;  1NJW A;  3AO3 A;  3TWH A;  4AHC A;  4FZZ A;  1CZ9 A;  3AA5 X;  3I0R A;  3NBP A;  1NK0 A;  3NDK A;  4PWD A;  4HHT A;  3VA3 A;  4H8K A;  4J2E A;  3ASM A;  5KRT A;  4FJJ A;  3AA4 A;  1YT3 A;  3DLE A;  4DQS A;  5KI6 A;  2DFF A;  5HRP A;  4M3X A;  3VQE A;  4W5Q A;  2X74 A;  4ELU A;  3ISN C;  4B9U A;  4PQU A;  3AVL A;  3VQ9 A;  3AVA A;  3PUF A;  3DLH A;  1EXQ A;  3DOL A;  4RW8 A;  1U47 A;  3VQQ A;  3F9K A;  3KLE A;  3SV3 A;  2G8W A;  4M3T A;  1TKT A;  4N47 A;  3KLF A;  3KLH A;  4CEO A;  1HJR A;  3U6F A;  3B6O A;  4DSI A;  4YNQ A;  3KK2 A;  3HK2 A;  1BL3 A;  1NK6 A;  2WOM A;  4CGG A;  4DSF A;  4FW2 A;  1ITG A;  2E4L A;  1C0M A;  1RT5 A;  4Z4E A;  4PY5 A;  3TAF A;  4OLA A;  2BDP A;  2HND A;  4B9M A;  2P5O A;  4IG3 A;  2KQ2 A;  1JKH A;  3RMC A;  1N5Y A;  4DWI A;  1RDC A;  3CFP A;  4CJK A;  1WSI A;  4CJ5 A;  2OPR A;  3DLR A;  4DQR A;  1IKY A;  1KLM A;  4O44 A;  4CJF A;  3FFI A;  4CIE A;  1ASU A;  4BE1 A;  2FBV A;  2OYQ A;  3HM9 A;  4FLT A;  1HPZ A;  4YFU A;  1HYS A;  1A5X A;  2VWK A;  4B9V A;  3OYC A;  1BHL A;  3HJF A;  4JRQ A;  3DLG A;  4OJR A;  1WSF A;  2ETJ A;  2NUB A;  4O5B A;  3OYK A;  4M42 A;  2HVH A;  4Q5V A;  3ZSY A;  3HYF A;  3MXI A;  4Z4F A;  2KZZ A;  3TR8 A;  3SV4 A;  1T05 A;  3CM6 A;  4CK3 A;  4DTR A;  4E1N A;  4B8A B;  3TI0 A;  4DF8 A;  3MXJ A;  4RW4 A;  3KK1 A;  4B9L A;  4LSN A;  3QIO A;  4FZX C;  3DLB A;  3NFA A;  3KTQ A;  1DTT A;  4AHT A;  3U3Y A;  3LWL A;  3QEW A;  4E7I A;  2HMI A;  1NKC A;  2KW4 A;  3D45 A;  3RRG A;  4FLV A;  1S1T A;  4JLH A;  4B8C A;  1IKV A;  4CJE A;  5J1E A;  3IAY A;  4IKF A;  1EET A;  1J5O A;  1C0T A;  1KVB A;  4TSX A;  2HNZ A;  4CEZ A;  3KKR A;  3BDP A;  4CIF A;  3O3G A;  3KD1 E;  1TVR A;  4O0J A;  1D8Y A;  4NYN A;  4FK2 A;  2IAJ A;  4FK4 A;  2KZM A;  5CYM A;  1QE1 A;  1RT3 A;  2XY8 A;  4CES A;  5T7B A;  4W5T A;  1IKW A;  4E89 A;  1RT7 A;  4BDZ A;  2B5J A;  4C8M A;  4AHR A;  2RPI A;  4NYF A;  5DMR A;  1XHX A;  3ZSW A;  4NCB A;  1KVC A;  3VQ4 A;  1XI1 A;  4N76 A;  1BCO A;  4RW9 A;  3P83 D;  4DTX A;  1EX4 A;  3ZSX A;  2GUI A;  1L3V A;  1KSP A;  2G8I A;  1XWL A;  3HP9 A;  4EP4 A;  3VQB A;  2B4J A;  2ZQB A;  3OYG A;  3K5L A;  4E7K A;  4CF8 A;  3NF9 A;  2PZS A;  4B9S A;  3LPU A;  1T03 A;  3TAQ A;  2BAN A;  1A5V A;  3RR7 A;  4FJN A;  1CXU A;  1JLA A;  4F3O A;  2X6N A;  2PYL A;  1S1U A;  1TAU A;  4R5P A;  3SJJ A;  2WON A;  3C94 A;  1G15 A;  3ITH A;  1KRP A;  4OLB A;  3ZSO A;  1HYZ A;  1S9E A;  3SQ2 A;  4DLG A;  3WNE A;  3NGY A;  1RTJ A;  2HB5 A;  4DMN A;  1BGX T;  4G1Q A;  3LZI A;  3LAN A;  4CJT A;  2YHA A;  4IG0 A;  4AIL C;  4KHQ A;  2O4G A;  3EY1 A;  1EP4 A;  4KB1 A;  3VQC A;  1MU2 A;  1NKE A;  1JL2 A;  3LAK A;  4DU3 A;  4BDP A;  2D0A A;  3PX6 A;  4KHN A;  3V1Q A;  3KD5 E;  1ZBH A;  1U48 A;  1KVA A;  4KHY A;  3SPY A;  3AV9 A;  4DSE A;  4CJ4 A;  1RNH A;  3JSM A;  4H4O A;  4CEQ A;  4EZ9 A;  4FLX A;  1BQM A;  4KHS A;  2BE2 A;  3V6D A;  3I0S A;  1ZBF A;  3QLH A;  4I2Q A;  1JLC A;  1VRT A;  1ZBL A;  1KFD A;  4CJQ A;  3O3F A;  1NOZ A;  4FM0 A;  1ASW A;  4KTQ A;  4UQG A;  4K8Z A;  4IDK A;  3QIP A;  2YNH A;  3VQD A;  4ZTF A;  3L3V A;  2KTQ A;  1VSL A;  3NH1 A;  3IS9 A;  1S6Q A;  4BAC A;  1RT2 A;  1BIS A;  3OVN A;  3WNF A;  3A2F A;  4RG8 A;  4BWM A;  4OPJ A;  4HUF A;  3PV8 A;  5I42 A;  3M8R A;  3ZSZ A;  4M3Z A;  4ZHR A;  4F8R A;  1T7P A;  4I2P A;  3WNH A;  4HCB A;  4GVM A;  1BI4 B;  4L8R B;  1RIL A;  4DQI A;  1TKD A;  3EZ5 A;  5C42 A;  3OS0 A;  4CE9 A;  3TAB A;  3SUQ A;  3SQ1 A;  1BIZ A;  2F8T A;  5CZ1 A;  3ZCM A;  2HHV A;  3OYM A;  1UA1 A;  2VWJ A;  2OPS A;  3VQA A;  4CGH A;  2IOC A;  3OYL A;  1Q9Y A;  3VQ6 A;  1C1B A;  2Z1G A;  4BE0 A;  3RRH A;  4KI6 A;  1BQN A;  3VQ8 A;  5EU7 A;  4CEB A;  3PX0 A;  2X78 A;  3OYI A;  3AO1 A;  3VQ7 A;  4DS5 A;  1VSI A;  3AVM A;  3G10 A;  1X9S A;  3HVR A;  4Z4I A;  2YHB A;  1RDB A;  4FJH A;  2OPQ A;  3HPO A;  1IO2 A;  2A1S A;  4KTW A;  3V9Z A;  1QS4 A;  3KKS A;  1RBU A;  3KLI A;  3SUP A;  4KAZ A;  1VSM A;  3AVK A;  3NF8 A;  2DFE A;  4OGE A;  2RF2 A;  3HPG A;  3LPT A;  5J2N A;  4WE1 A;  1Y97 A;  1ZBI A;  3HXM A;  2D0B A;  3O3H A;  4LD0 A;  3V9W A;  1XC9 A;  1VRU A;  4CJL A;  1N6Q A;  3DYA A;  4FVM A;  4B08 A;  4MQ3 A;  4FJL A;  4KRE A;  3OYN A;  3DM2 A;  1U45 A;  1B9F A;  1D5A A;  2HNY A;  3CYM A;  4DFM A;  1B9D A;  2OA8 A;  5D3G A;  4QCL A;  4FLY A;  4PUO A;  4OVL A;  4CED A;  1L3U A;  4DTP A;  4J2D A;  4XIU A;  2ZE2 A;  3M8P A;  4B3O A;  4CFB A;  3DRR A;  5DK5 A;  3MEG A;  3VQP A;  3ZSQ A;  4HCC A;  3LZJ A;  3SZ2 A;  1DTQ A;  2Z1H A;  5FDL A;  1WSG A;  3ZT4 A;  3L8B A;  4ID1 A;  4IBN A;  1F21 A;  4CJ3 A;  3NGZ A;  4DSJ A;  4Z4G A;  3HP6 A;  5J2P A;  4BE2 A;  3ZT3 A;  4CEC A;  3S3O A;  4RW6 A;  3NH2 A;  1LAW A;  3NHG A;  3AVI A;  1EKE A;  5KGW A;  3WNG A;  3RTV A;  4W5N A;  1Z26 A;  4N5S A;  4CFD A;  3SUN A;  3LP3 A;  3OS2 A;  3V1O A;  4OKJ A;  4E3S A;  3QEX A;  4FJ9 A;  2XRI A;  3KJV A;  1NOY A;  4CCH A;  2I5J A;  3RMD A;  1S1X A;  4ZTJ A;  2D0C A;  1C1C A;  3ZT2 A;  5CYQ A;  3T3F A;  1SKR A;  4C8N A;  2PY5 A;  5KTQ A;  3I8D A;  3V81 A;  4FZY A;  1SUQ A;  2XO7 A;  1BCM A;  1BIU A;  4OGC A;  3K2P A;  4DTN A;  1LWC A;  2FBT A;  4FM1 A;  4FK0 A;  4CF1 A;  4AHU A;  4CEA A;  3T1A A;  4N41 A;  4M3W A;  2HHT A;  1TKX A;  5E41 A;  3OYF A;  3LP0 A;  3UIQ A;  1C1A A;  5I3U A;  4FLZ A;  1LWF A;  1J54 A;  4ID5 A;  3NF6 A;  4CGI A;  1HQU A;  1VSD A;  3LP1 A;  3LDS A;  4DLE A;  1WAF A;  2X6S A;  5C24 A;  4E19 A;  4FLU A;  3V9X A;  3BGR A;  4E7J A;  3LAL A;  4KO0 A;  4DU4 A;  5HP1 A;  2PYJ A;  4ELV A;  5FRM A;  3L2U A;  1I39 A;  3K5N A;  1GOB A;  1WNS A;  1TL1 A;  3M8Q A;  4LH5 A;  3HT3 A;  3EYZ A;  3LP2 A;  3KLG A;  4FJM A;  4KPY A;  5HBM A;  2GV9 A;  3AVJ A;  1JXB A;  3V1R A;  2Y1I A;  2YKM A;  3V4I A;  4KHW A;  3MED A;  2E6L A;  3QES A;  4DFK A;  1CXQ A;  2FBY A;  3HPH A;  4CF0 A;  3HL8 A;  4C8L A;  2KFN A;  3AO5 A;  4DQQ A;  3VN5 A;  4N56 A;  4FLW A;  1RTH A;  1FKO A;  1HQE A;  1J9A A;  3K59 A;  3PO4 A;  1RTI A;  4MFB A;  2JLE A;  1Q8I A;  4O4G A;  3NH0 A;  4Y1D A;  4AHS A;  2G8V A;  4DTO A;  1B92 A;  4KTZ A;  3MXM A;  1SKS A;  3QER A;  1HNI A;  4C8O A;  1JLE A;  4AH9 A;  4I9L A;  5JS1 A;  4CEE A;  2QKK A;  4FJI A;  2KFZ A;  4FJ8 A;  3AVC A;  4CK1 A;  4OPK A;  3KK3 A;  2XHB A;  4JS5 A;  1ASV A;  4CHP A;  3QO9 A;  3AVG A;  3V9S A;  4B9N A;  4PA1 A;  3MEC A;  2RKI A;  4W5R A;  1WSJ A;  2IGI A;  4FM2 A;  3S9H A;  3P5J A;  1LV5 A;  4FJ7 A;  3O4Q A;  4CHN A;  1R0A A;  2IDO A;  4ICL A;  2W42 A;  2Y1J A;  3NE6 A;  4F2S A;  4CFA A;  4HUG A;  3VQ5 A;  4Y1C A;  3HST B;  3SI6 A;  1GOC A;  2ZD1 A;  4HVJ A;  3KIO A;  4F4K A;  4CJW A;  2D5R A;  3L3U A;  2YNF A;  3DI6 A;  4CER A;  4CJS A;  3NAE A;  4KFB A;  3DMJ A;  1WSH A;  3IRX A;  2YKN A;  3SYZ A;  1KLN A;  2Z1I A;  3NGI A;  3RR8 A;  1KTQ A;  3G0Z A;  3OJU A;  2HHU A;  1I3A A;  3S3N A;  3L2W A;  2ITG A;  3H08 A;  3PX4 A;  2DFH A;  1WSE A;  3DLK A;  3LAM A;  4J2B A;  5FRN A;  1K6Y A;  5J2Q A;  4M3R A;  4JRP A;  1S1W A;  1RDD A;  5HRR A;  3TAN A;  3PO5 A;  4CF2 A;  3NCI A;  3F73 A;  4FJG A;  4DFJ A;  1UOC A;  4DG1 A;  1RT1 A;  2VG6 A;  5SZT A;  3AA2 A;  1U49 A;  4M3Y A;  3TAG A;  1S6P A;  2OZS A;  1S5J A;  4BWJ A;  4H4M A;  4KRF A;  2IS3 A;  3CQ8 A;  4DQP A;  1VSK A;  3SUO A;  1QSS A;  5CZ2 A;  2EHG A;  3SPZ A;  2F96 A;  1QTM A;  2HVI A;  4CHY A;  1RBS A;  5CY4 A;  1NKB A;  2QKB A;  1IKX A;  1T8E A;  4O0I A;  1TAQ A;  3P1G A;  4CHO A;  4CJR A;  3SNN A;  4NCG A;  4E7H A;  1U4B A;  3TAM A;  1CZB A;  1JL1 A;  2OPP A;  2FBX A;  2LSN A;  2G8K A;  1ZBU A;  1YVU A;  4DSK A;  4DTU A;  3OY9 A;  4GW6 A;  1TK5 A;  1X9M A;  1D9F A;  4Z4H A;  1RT6 A;  4CIG A;  4I9Q A;  4DU1 A;  1BI4 A;  1REV A;  4GMJ B;  4KV8 A;  3AO4 A;  4K8X A;  2B6A A;  2IC3 A;  1J53 A;  1VSF A;  1TGO A;  2P1J A;  4B9T A;  1Z25 A;  1SL0 A;  3C6T A;  4CHZ A;  4CGF A;  5KRS A;  5SWM A;  3QEV A;  2ATQ A;  3TAR A;  1Q9X A;  3VA0 A;  1FXX A;  2F8S A;  4M3U A;  1QHT A;  1VSJ A;  2DY4 A;  3TAP A;  1JLQ A;  4CGJ A;  4FYD A;  1FKP A;  1WAJ A;  2VG5 A;  4Q0B A;  3E01 A;  1JLG A;  1GOA A;  2QXF A;  1TK8 A;  4AHV A;  4W5O A;  4LSL A;  4KKO A;  1CLQ A;  1YTA A;  3SCX A;  3DOK A;  3AVH A;  3QNN A;  2Z1J A;  3ZT1 A;  3V9U A;  2RN2 A;  3DRP A;  5K14 A;  5JS2 A;  4M41 A;  4FCY A;  2AJQ A;  3LWM A;  3OYE A;  2Q3S A;  1W9H A;  4CGD A;  3PY8 A;  5J2M A;  1C0U A;  3K5M A;  1DLO A;  4HUE A;  5HLF A;  2A1R A;  4OKE A;  2P51 A;  4O55 A;  2HHW A;  4J2A A;  3M8S A;  3OS1 A;  1NK4 A;  3CG7 A;  4I7F A;  2G8F A;  4NCA A;  3QEI A;  4FJ5 A;  3L2Q A;  1KFS A;  4KI4 A;  1JXE A;  3MEE A;  3QNO A;  4EZ6 A;  1WN7 A;  4E1M A;  5KGX A;  4KHU A;  1S1V A;  1ZYQ A;  3HVT A;  4DTM A;  1HYV A;  4E0D A;  1O1W A;  1SV5 A;  3QET A;  1LWE A;  1TKZ A;  3B6P A;  1LW0 A;  1VK0 A;  3CFO A;  1UA0 A;  1D9D A;  2XY5 A;  3HO1 A;  3RMA A;  4KB0 A;  1NK5 A;  4Z0U A;  3DRS A;  4LH4 A;  1YTU A;  2HHS A;  2G8H A;  3K5O A;  1RBV A;  4LY7 A;  2OZM A;  2R7Y A;  3D0P A;  1JLB A;  1QQC A;  3ZT0 A;  1NJY A;  5C25 A;  3OYD A;  3SQ4 A;  2QK9 A;  4HTU A;  3L2R A;  4JS4 A;  1IH7 A;  4DSL A;  3SQ0 A;  3RMB A;  4DTS A;  5FRO A;  3AVB A;  2DTU A;  4CK2 A;  1X1P A;  4DS4 A;  4FJK A;  3IG1 A;  4FXD A;  4RW7 A;  2VG7 A;  2XY6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...