5KRTA

Hiv-1 integrase catalytic core domain (ccd) in complex with a fragment-derived allosteric inhibitor
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
152
structure length
143
Chain Sequence
SSPGIWQLDTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAAWWAGIKQEFGIPYNPGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRGGYSAGERIVDIIATD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase, transferase/inhibitor
molecule keywords Integrase
publication title A New Class of Allosteric HIV-1 Integrase Inhibitors Identified by Crystallographic Fragment Screening of the Catalytic Core Domain.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 47
structure length 143
sequence length 152
ec nomenclature
pdb deposition date 2016-07-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5krtA00
2FBVA 3V9UA 2IC3A 2KFNA 1YTAA 3TAMA 4ELUA 2W42A 2R7YA 3NGYA 4JS5A 3SPYA 2HHWA 4KHQA 1GOBA 4B08A 4KAZA 4FLVA 3NCIA 2BANA 4FM2A 3RMDA 4CFAA 1NK8A 1RT6A 1VSKA 3O4NA 2YHBA 3QO9A 4CJWA 1RT3A 5HRNA 3CFRA 3C94A 3O4QA 3SUNA 3O3HA 1UWBA 3L3UA 5CZ2A 1WNSA 3AO2A 3ZSQA 4CEEA 4CF0A 1NKEA 4NCBA 3D0PA 1S1XA 2RKIA 4B8CA 3TAFA 4EZ9A 3AO1A 1C1BA 3VQCA 4CHYA 1RBVA 3FFIA 1BCMA 3C95A 1LAVA 4OKKA 3LWLA 1VSDA 3AVIA 4MFBA 5EU7A 1X9WA 3KD1E 4CERA 3ZT4A 4BDPA 4I2QA 1RDDA 2QXFA 3LPTA 4RW7A 3MXJA 4YNQA 4CFCA 2YNGA 3WNGA 1TKXA 3CM6A 1C0TA 1XI1A 3RR8A 1KCFA 3KK3A 2PYLA 2O4GA 1L5UA 3VQBA 3ZT1A 1JLQA 1YT3A 3SQ2A 5CZ1A 1WSHA 1ASUA 1XWLA 1D8YA 4ELVA 1VSMA 1RT1A 1DTTA 3AVNA 3U6FA 4B9SA 4FW2A 4J2BA 1S1WA 4OPJA 3HVRA 4FZXC 4HCBA 2X78A 4UQGA 5HLFA 4Z4GA 4MQ3A 3EZ5A 3ZT2A 4M3TA 3NE6A 4FM0A 4Z4HA 4IG3A 3S3MA 3TAGA 4KTQA 2VG5A 2XY5A 3HL8A 1J54A 3SUQA 3PX4A 1S1UA 3OJUA 1LWFA 1RDBA 4RW9A 5JS2A 1BI4B 1QS4A 3QEVA 2ZQBA 4QOZB 2B6AA 4KHNA 1TKTA 1VSHA 2F96A 2WOMA 4FVMA 2RN2A 4IFVA 4FLWA 4PY5A 5HRSA 4E7HA 1TKZA 3ZSYA 3NF6A 4DU3A 1REVA 2HHSA 2EX3A 1D5AA 1VRTA 1WSEA 3L3VA 3DRRA 3LZJA 4DTRA 2IS3A 2XY6A 4DSKA 4W5OA 4HUEA 3PY8A 3NGZA 4NCGA 1TL3A 4E7IA 1T7PA 2HVIA 1TVRA 3ZSWA 4Q0BA 3U3GA 2A1SA 4M45A 3DLBA 5J2MA 1NK5A 2Q3SA 3E01A 1ZBFA 1D9DA 4DTXA 2E6MA 1UA0A 3P83D 4HVJA 5FDLA 3KK2A 2IDOA 3VA3A 3I0RA 3PO4A 5C42A 2B5JA 1O1WA 4CGIA 4HTUA 4EP4A 1RTDA 4FLTA 4DQRA 4E7KA 4DFPA 4CK3A 2OPRA 1VSEA 4CJUA 1T8EA 2OPQA 1IG9A 4J2DA 1S6PA 4FJKA 4CEBA 3M8PA 4DQPA 5J2NA 1L3SA 3EYZA 4NCAA 1QE1A 3TI0A 4CFBA 3O3FA 1X9MA 2G8HA 2GUIA 3AA2A 1W9HA 3QIPA 4O0JA 2HW3A 2KQ2A 3V1RA 4N56A 3KLEA 4CJFA 4CHZA 4CJEA 1CXQA 4CFDA 1BIZA 3T3FA 3V4IA 4CJTA 4KRFA 2KZMA 4KTZA 3OYLA 1S5JA 1Z25A 2D0CA 2XRIA 3VA0A 1ASWA 3OYAA 1HJRA 3OVNA 4W5RA 1VSJA 1YVUA 1RBSA 4CEAA 3RRGA 1UAXA 1K6YA 3TAQA 2F8TA 4KPYA 4NYFA 1NKCA 4C8MA 2OA8A 2YNHA 3HM9A 3VQ4A 4J2AA 3C6TA 1NK0A 4CF2A 4DMNA 1U45A 5KGWA 4I9QA 3IAYA 1ITGA 4C8NA 1Q9YA 1IKXA 1KLNA 3KKRA 4GVMA 3AVCA 4FYDA 2IAJA 2KFZA 3CFOA 4CIGA 4DLEA 4ICLA 2YNFA 4E7LA 1EKEA 2X74A 5HBMA 3VQ6A 3NF8A 2HB5A 2X6NA 1L3TA 3LAKA 5J2PA 4O44A 3OYJA 4OKJA 4B9NA 2E4LA 3O3GA 2QKBA 2EHGA 1A5XA 4QAGA 3HO1A 1S9EA 4E0DA 4RW8A 3SCXA 4J2EA 3ZSRA 1D9FA 3DLGA 4FZZA 4DSFA 1X1PA 3OY9A 3LZIA 4M3XA 3NF7A 4I2PA 2HHTA 4CGJA 4TSXA 1JLFA 3H08A 3OS0A 3ZSOA 3TARA 3ASMA 4R5PA 2XY8A 3K2PA 3VQ9A 3OYKA 4EP5A 1B9DA 3DLRA 4O5BA 2D0BA 4DG1A 3DRPA 1WSIA 3MXMA 1LW2A 5FRNA 3DYAA 5KTQA 4HUFA 3CG7A 4W5TA 1KRPA 4KHYA 3UIQA 3SUOA 2ITGA 4CEOA 5J1EA 3RMBA 4PWDA 3OJSA 2XO7A 1YTUA 1QSSA 4FLXA 3I0SA 3V1OA 4DWIA 4FZYA 4N5SA 4Z4FA 2OZSA 1HPZA 2RPIA 1JLEA 4DQIA 4M3ZA 1JLGA 1CZ9A 4H8KA 3NDKA 4DSIA 4FJ9A 4JS4A 1TGOA 3PO5A 1BQMA 2XHBA 3V6DA 3SNNA 4KHWA 1IO2A 1HNVA 3SI6A 2P5OA 1TV6A 1IH7A 2E6LA 3OYBA 4BACA 2G8WA 4I7FA 3SPZA 4K8XA 3RTVA 3TAEA 4B9UA 1RCHA 1JXEA 4DS4A 1A5WA 1NJYA 2G8UA 3TANA 3ULDA 1KVCA 3K5OA 2HHVA 4CGHA 3RMCA 4KI6A 4BE2A 4Z0UA 3VQ7A 2B4JA 4E3SA 2PZSA 4CJ4A 3KLGA 3K57A 3BGRA 1NJXA 4ELTA 2P1JA 1TK5A 2PYJA 3AV9A 2P5GA 4JLHA 4F3TA 3SV4A 2Z1HA 5I3UA 2AJQA 4DSJA 4DFKA 4AH9A 1XHZA 4PUOA 4W5QA 4F8RA 1I3AA 4ID1A 1RILA 1WSGA 3OS1A 1F21A 4KHSA 3K59A 5DMRA 4M41A 1WAFA 3DLEA 1MU2A 1CZBA 4CHOA 1S9GA 4RG8A 4PA1A 3LALA 3K58A 1U4BA 3BDPA 4B9VA 4B9MA 3AVGA 1EX4A 4CHNA 1VSLA 3KJVA 1B9FA 1DLOA 1S1VA 3DLKA 3SUPA 2Z1GA 3S3OA 4ID5A 2YKNA 2WONA 4LSNA 4O4GA 4DU4A 4OPKA 1NK6A 1NOZA 4DS5A 4CK1A 1KVAA 3L2UA 1C0MA 4FJIA 3WNEA 3TAPA 1NK4A 4GW6A 3L8BA 4DSEA 4IFYA 3G10A 1NK9A 3QEIA 1SKSA 1HQEA 1RTIA 5CY4A 2P51A 4HCCA 1TAUA 1BIUA 1JLAA 2Z1IA 1QSLA 3V81A 3AVAA 3HK2A 1RTJA 2JLEA 1BGXT 3SV3A 3JSMA 4FW1A 3KLHA 3CFPA 5HROA 1I39A 1TKDA 3OYHA 2QK9A 2X6SA 2KW4A 4E7JA 4AHSA 5JS1A 4H4OA 4BDZA 1VSFA 1U49A 5D3GA 4WE1A 3DI6A 4AHUA 3OYIA 3ISNC 1ZBHA 3HVTA 1TK0A 3AVLA 3LPUA 4W5NA 2HHXA 5KRSA 3OYCA 3QETA 3QEXA 1NK7A 3HP6A 2FBYA 1S6QA 4OGEA 5DK5A 4CE9A 3OYFA 1XC9A 4N47A 4DF4A 4CJPA 1HQUA 1NJWA 4KREA 3NGIA 1ZBIA 2I5JA 3LAMA 4AILC 3AO4A 3NF9A 1S1TA 1A5VA 4ZHRA 1SL0A 4KO0A 4EZ6A 3T19A 3WNFA 4OJRA 3VQPA 4M3RA 1KSPA 3LANA 3KLFA 1SKWA 4LH5A 3VQAA 4CIEA 3P1GA 2YHAA 4DQSA 1Q9XA 4N41A 1GOAA 4Z4CA 4FJ5A 4OLAA 1JKHA 2YV0X 3LWMA 2NUBA 1JLCA 3ZT3A 4B8AB 2GV9A 3U3YA 1KFSA 3DRSA 4FJ7A 3KLIA 4F4KA 5T7BA 1GOCA 1SV5A 4CJ3A 5SWMA 4C8OA 4FJMA 5KGXA 4GMJB 3HYFA 2A1RA 1HYSA 4F3OA 2D5RA 1VRUA 1LWCA 1FXXA 1RT7A 3WNHA 3HT3A 2XY7A 1JL2A 1W0HA 3JYTA 1JL1A 2DFEA 5HRPA 2HNDA 4AHVA 4JRPA 3V9XA 2JGUA 4CJKA 4M42A 1WAJA 3LDSA 3KK1A 4OLBA 1FK9A 1QQCA 3VQ8A 1BHLA 1L3UA 4DTSA 4DTJA 3D45A 4IG0A 3RWUA 5HP1A 3ALYA 1QTMA 4CJLA 3MEEA 5E41A 3M8QA 4IDKA 4BE1A 2Y1JA 3MEDA 4FJGA 2O4IA 3A2FA 4YFUA 3I8DA 1U48A 1RDAA 3RR7A 1WSJA 4E89A 2IGIA 4CGDA 1HNIA 1JLBA 2FC0A 3DOKA 3B6PA 1Q8IA 3VQEA 1WLJA 1ZYQA 4Z4EA 2FBTA 3QEPA 3V9SA 1BISA 5CYMA 4Y1CA 1KLMA 4CESA 1T05A 2G8IA 1QHTA 2YNIA 1RBUA 2ATQA 4BWJA 4DFMA 4CF1A 3QESA 5FRMA 4M3YA 4KI4A 2BE2A 1HYZA 4XIUA 4FLUA 4FK2A 1RT4A 1HMVA 3QINA 3THVA 1DTQA 1RT2A 4CEQA 2Y1IA 3SQ0A 4G1QA 3G0ZA 4DFJA 3OYMA 4H4MA 3NH1A 2BDPA 4FLYA 3ZSXA 2PY5A 4KHUA 4DTMA 3SQ1A 1ZBUA 1C1CA 4DTOA 4B9LA 4E19A 1KTQA 4LSLA 3L2QA 1C1AA 4NYNA 4LD0A 2VWJA 4AHCA 3HP9A 3AA5X 3B6OA 1ZBLA 4CJQA 1B92A 4B3OA 1RT5A 4CEDA 2HVHA 1XHXA 2DFHA 3OYNA 3QIOA 1C6VA 3IRXA 4IBNA 5J2QA 3AA4A 3LP0A 3PX6A 1IKYA 4Q5VA 4BE0A 2Z1JA 4KB0A 3QLHA 1SUQA 5CYQA 3MEGA 4M3WA 2HMIA 1LW0A 1U04A 1Y97A 4C8LA 4DU1A 1SL1A 4FJJA 1G15A 3QEWA 3TWHA 3AVHA 3KD5E 2ZE2A 3ZT0A 3NH0A 4CIFA 1NOYA 4C8KA 4LY7A 2RF2A 4LH4A 1TK8A 3S9HA 4ZTJA 4K8ZA 4F2RA 4CEFA 4IKFA 1VSIA 4CGFA 4FLZA 2OPSA 2VG7A 3F9KA 4BWMA 2KTQA 1JXBA 4DF8A 3ITHA 3AO3A 3HPOA 2IOCA 3M8SA 1RTHA 3QNNA 3EY1A 3PUFA 1UA1A 4CF9A 4DTPA 1BL3A 4RW4A 3VQQA 2YKMA 1NKBA 4FJHA 1WN7A 3LP2A 3TR8A 3OYEA 3L2WA 3NHGA 4FXDA 2KZZA 1TL1A 2OPPA 3CM5A 3OS2A 3TABA 1U47A 3NH2A 2VWKA 4DTNA 5I42A 4PQUA 4CJ5A 1R0AA 2DTUA 3V9ZA 2HHQA 3S3NA 4O55A 3V1QA 2HNYA 4L8RB 4KFBA 2G8VA 3SQ4A 3NAEA 3RMAA 1ASVA 4FCYA 4CHQA 4AHTA 3SYZA 2LSNA 4AHRA 2OZMA 3KKSA 1N6QA 2GBZA 3AO5A 3IG1A 4KV8A 4KKOA 4OKEA 3ZSZA 3SZ2A 1IKWA 3HPGA 3P5JA 3QNOA 1N5YA 4Z4IA 4Y1DA 3F73A 5KI6A 4DLGA 2FBXA 3AVFA 3ZCMA 5HRRA 5SZTA 1LAWA 3PX0A 3IS9A 1LV5A 1CXUA 4M3UA 4FK0A 4DTUA 3DM2A 1Z26A 4CJRA 3T1AA 2VG6A 4FJXA 1RNHA 3NFAA 3VQDA 3MAQA 4DQQA 1C0UA 3RRHA 3CQ8A 1SL2A 4HUGA 5KRTA 3CYMA 3AVKA 4F2SA 4OGCA 1BI4A 3OYDA 1LWEA 3L2RA 4BDYA 5K14A 1BQNA 3LP1A 4HHTA 4RW6A 1SKRA 4FJLA 4N76A 1L3VA 4CF8A 1FKPA 4KB1A 1KFDA 1CLQA 1J53A 4FM1A 1HRHA 4OVLA 3HXMA 1TAQA 1UOCA 5C24A 2HHUA 1EXQA 4CJVA 2G8KA 4FJNA 4QCLA 4FK4A 3HSTB 3QERA 1RBRA 4CK2A 3OYGA 3M8RA 5C25A 3K5LA 3ZSVA 3C6UA 3K5MA 4E1NA 1J5OA 4CCHA 1X9SA 2G8FA 1EETA 1NJZA 3V9WA 4CHPA 2OYQA 2D0AA 5FROA 4DSLA 1J9AA 3DMJA 3LP3A 3HJFA 2DFFA 3DOLA 1RBTA 4JRQA 2ZD1A 2DY4A 3MECA 1HYVA 2F8SA 3KTQA 1KVBA 3AVMA 2QKKA 3NBPA 1EP4A 1FKOA 3AA3A 4CECA 3MXIA 1IKVA 3K5NA 1BCOA 3L2VA 2HNZA 3AVBA 3SJJA 4CGGA 3PV8A 3HPHA 3AVJA 4E1MA 4CJSA 1VK0A 4ZTFA 4I9LA 3DLHA 1RDCA 4B9TA 4FJ8A 2BGGA 4KTWA 3KIOA 3VN5A 2ETJA 1QSYA 4CEZA 4O0IA 3VQ5A 1WSFA 1T03A
chains in the Genus database with same CATH superfamily
2FBVA 4K41A 4FWMA 4QS9A 1S3XA 5FPDA 5GADP 2W42A 3NGYA 4JS5A 3SPYA 4DV2K 1NK8A 1RT6A 3O4NA 2YHBA 5HRNA 4CF0A 1XNRK 4BRCA 5B8HA 5BPLA 3D0PA 2RKIA 3AO1A 3KWIA 4WQ4A 4CHYA 1BCMA 3C95A 4FPBA 1WBDA 3UE5A 1VSDA 5EU7A 3MCPA 4MFBA 3ZT4A 4BDPA 2D0PA 3O6WA 1BOTO 5AQFA 3CM6A 1RDUA 2F9TA 4M7YA 3CIPA 3ZT1A 1VQ4N 1K73O 1ASUA 3EKUA 2UXDK 1XWLA 1BWFO 2WUSA 5KPTA 3ZEUB 4J2BA 1S1WA 4OPJA 3HVRA 4Z4GA 1QQMA 4KH5A 4KTQA 2VG5A 4IXCA 5BR8K 3OJUA 1P90A 1RDBA 2QM1A 3QEVA 2B6AA 1VSHA 2A3ZA 2F96A 2WOMA 4PY5A 2RN2A 3JXUA 3ZSYA 4BREA 2IS3A 3A8YA 3OHRA 3PY8A 1TL3A 3N4QA 4CBXA 3DLBA 1EO1A 2Q3SA 3E01A 3ENOA 4DTXA 1JCEA 4CBWA 3GDQA 3TPQA 2IDOA 3PO4A 3T1YK 3D2EA 3TSQA 3A0IX 4CZHA 4EP4A 2PAVA 4DFPA 1VSEA 4CJUA 1S6PA 3GBTA 1BA1A 4JKDA 1QE1A 4NCAA 3KZBA 2G8HA 1W9HA 1H1VA 3V1RA 1GLJO 4CJFA 4BRIA 4CJEA 1BIZA 4JI1K 4CJTA 4KRFA 2KZMA 3OYLA 1S5JA 3VA0A 4BR2A 4LF4K 3BP8A 3CETA 3J81O 1VQMN 1VSJA 1YVUA 4CEAA 4K25A 3CCLN 3MWTA 5BR9A 3QBXA 4C8MA 4J2AA 4I9QA 4DMNA 2F4VK 1Q9YA 3KKRA 2F9WA 4YOUA 2YNFA 5AJ3K 1RFQA 4NXNK 5HL7L 1EKEA 1Q18A 2X74A 3NF8A 3D7EO 5ADXH 3BZCA 5J2PA 3OYJA 1OVYA 4OKJA 2E4LA 4GY2B 2QKBA 2EHGA 1A5XA 1J6ZA 2IVNA 3MN6A 4RW8A 3SCXA 1D9FA 4DSFA 3OY9A 1JLFA 1QHAA 3CCQN 3ZSOA 3ASMA 4R5PA 4EP5A 1YITN 4EHUA 4MLEA 1OH8A 3DLRA 4IOXA 4A2AA 3DYAA 4B1UB 5KTQA 2NRTA 3UKUB 3CG7A 5M1FA 3UIQA 4PWDA 1R59O 2Q1NA 3O08A 3ENHA 5AQYA 4FZYA 4JNEA 2OZSA 2ZM6K 4FJ9A 2VQFK 3PO5A 2XHBA 4KHWA 2A6AA 3SNNA 1HNVA 4BACA 4CZEA 3SPZA 4LF9K 2ASOA 3VENA 1XNQK 3HBTA 4DS4A 1A5WA 4BGAA 3KVGA 3RSEA 2GUPA 3J7ZO 2B4JA 2PZSA 4FPAA 1T6DA 4IOAL 3AV9A 3LDPA 1VAZA 2AJQA 4W5QA 4F8RA 1WSGA 4IEIA 3K59A 1NLVA 4M41A 3DLEA 4B3MK 1S9GA 2ZJRL 4B9VA 3AVGA 4NXMK 1VSLA 3H3NO 3SUPA 1S1VA 4FOEA 4AQYK 4A2BA 4O4GA 1NK6A 3VF6A 4DHYA 1NOZA 2QXLA 3L2UA 1C0MA 4GW6A 3G10A 3QEIA 1ATSA 1TAUA 1JLAA 1QSLA 2A40A 2V52B 1RTJA 2NRRA 3JSMA 3KLHA 3CFPA 3O9QA 2QK9A 2KW4A 4DR6K 3FZFA 4BDZA 1U49A 5D3GA 4WE1A 2W6LA 3OYIA 4BRAA 4BC4A 4W5NA 5KRSA 5E26A 3QETA 3HP6A 3W0LA 4N47A 4CJPA 1HQUA 3NGIA 3TSUA 2I5JA 3LAMA 3O8MA 3S41A 4AILC 2W40A 3VGLA 1ILYA 4CIEA 4FJ5A 3LWMA 2YV0X 3VF2A 4FJ7A 4A5AA 4F4KA 1GOCA 4IFEA 2HHHK 1HYSA 5KGXA 3HYFA 2V51B 2FXUA 1KAZA 5LJVA 1FXXA 1NU0A 3R6MA 3R3LA 1HUXA 2HNDA 3V9XA 4M42A 4YOXA 2HSTA 3AGKA 4OLBA 4DTSA 1SS6A 1VQNN 4CJLA 3MEEA 5E41A 1G99A 4IDKA 4BE1A 3MEDA 1NGAA 4YFUA 3FLCO 1ATNA 1JLBA 4A5BA 3DOKA 4FWRA 4OPAA 5AQOA 3VTIA 1BISA 5CYMA 4Y1CA 1KLMA 4CESA 1T05A 1RBUA 2ATQA 3O1BA 5FRMA 2OTLN 4CZLA 1RT4A 1GLFO 4CZGA 2NZTA 3CXCM 2Y1IA 3SQ0A 3GL1A 3DXMA 3G6EN 3E9PA 4BG8A 4B9LA 4E19A 3CCSN 3L2QA 5LL6Z 4LD0A 4ILHA 3THXB 2P9NB 3AA5X 1ZBLA 4CJQA 4B3OA 1YJNN 3UKRA 2DFHA 2D1KA 5J2QA 4JI0K 3PX6A 5CHIA 2CH5A 1TUUA 4Q5VA 1SUQA 2AA4A 1E4FT 2HMIA 3FZHA 1LW0A 3VEZA 1Y97A 4JI8K 4FWNA 1VQ9N 2O8DA 4C8KA 1JCGA 4LH4A 1VHXA 4H0TB 4K8ZA 4F2RA 5KPRA 4FLZA 4BWMA 4NLCA 2P9UA 4X64K 3HPOA 3M8SA 2IOCA 2WTUA 4WQ4C 4DTPA 3ID6A 3O9UA 5C0YA 1NKBA 5AZIA 2GELA 1U47A 4LFAK 3SMPA 3NH2A 3FR0A 5AQQA 3QB0A 4CJ5A 1V4SA 3MN7A 4GV3A 2G8VA 2BH1A 3SYZA 4AHRA 3SBTA 3KKSA 1N6QA 2GBZA 3IG1A 4OKEA 3HPGA 3WEEA 3P5JA 1N5YA 4X62K 1E3MA 3F73A 4G9ZA 1K9MO 1E4GT 3AVFA 3PX0A 1CXUA 3DM2A 1Z26A 1RGIA 5JLFA 3WXMB 4FJXA 3VQDA 1LOTB 1C0UA 1JJ2M 4H0XB 5I9EB 1SL2A 3CERA 4A57A 5AQUA 4OGCA 1N8RO 4DR3K 1YUWA 5K14A 3THWB 3LP1A 3CPWM 4CF8A 4KB1A 1KFDA 4OVLA 3HXMA 4FWLA 3CCRN 2QWLA 3WXKA 2QWOA 5C25A 2F7TA 3K5MA 4E1NA 1GLDG 4MO4A 2GWJA 3QDKA 4CHPA 5FROA 3LP3A 3DXMB 1NJIO 3IKMA 4C1NI 3ENBA 1Q82O 4FWOA 2WC9A 3AVMA 3NBPA 1FKOA 3J80O 3L2VA 5AQJA 3CD6N 3AVBA 3SJJA 3HPHA 5DM6L 4ZTFA 3KIOA 3VN5A 2ETJA 3G71N 3VQ5A 1JXEA 1WSFA 1T03A 3V9UA 2IC3A 1MA9B 1YTAA 3TAMA 4ELUA 2O8DB 2A42A 2P9KA 4JHDA 4KAZA 3CJ7A 5EX5A 4FM2A 3ULEA 4CFAA 2P9SB 3C94A 3O4QA 1UWBA 4JI4K 1GLBG 1NKEA 3AO2A 4CEEA 2CGJA 1S1XA 3E9OA 5GIOA 1C1BA 1K8KA 3FFIA 3LWLA 2NRXA 3KD1E 4JK8A 3M1FA 4I2QA 3LPTA 4CFCA 1C0TA 4EAHD 5AQTA 5M1OA 2O4GA 5CZ1A 3CJ1A 2UXCK 3U9ZA 2O8BA 4ELVA 1RT1A 3U6FA 4FVUA 3EZ5A 5GAGP 4IG3A 4FWPA 3JS6A 2XY5A 1J54A 3C6HA 1S1UA 4A59A 3LDOA 3R9PA 5LMNK 5KQ8A 4KHNA 4FVMA 3BF1A 4IFVA 3HSCA 2CGKA 3R8EA 4DU3A 1REVA 2EX3A 3HTVA 4DTRA 3LDNA 4CZKA 4WFBL 1T7PA 3OTOK 4Q0BA 1NGIA 5AQRA 4M45A 3WQUA 1NK5A 1ZBFA 4CZMA 4L3QA 1UA0A 3P83D 4HVJA 1W7AA 4DUZK 4JD2B 3KK2A 3LL3A 2B5JA 4FLTA 1YHQN 4CK3A 4J2DA 2OPQA 4FJKA 3TI0A 3O3FA 2GUIA 3QIPA 2KQ2A 3ZX2A 3KLEA 4CHZA 2J4RA 1CXQA 4CFDA 3T3FA 2D0CA 2XRIA 3LM9A 3DJCA 1HJRA 3H6EA 3OVNA 4W5RA 1UAXA 1K6YA 1YVNA 2F8TA 5TKWA 1NKCA 2VYPA 1KAXA 2YNHA 3VQ4A 4JHDB 3HM9A 1NK0A 5KGWA 1NMDA 3P38A 1YIJN 1KLNA 4BC2A 1IBKK 1Z6RA 2IAJA 5ADXA 1KXPA 4ISEA 5HBMA 3VQ6A 2HB5A 2DPNA 2X6NA 2YCHA 3LAKA 4CZIA 4BRGA 4B1XB 1GLEG 3T69A 4B1ZA 1S9EA 4E0DA 4FZZA 3ZSRA 3DLGA 3CJBA 3LZIA 4M3XA 3NF7A 3CCMN 3OS0A 4EHTA 3K2PA 3VQ9A 4Z94A 4PKGA 3DRPA 2O8BB 3MXMA 5FRNA 1VQ8N 1WOQA 5LY3A 4E1JA 2E5LK 3CJAA 3OJSA 3K9JA 1QSSA 4FLXA 2ZJQL 3MN5A 4DWIA 3WT0A 4B3RK 4M3ZA 2RPIA 4KREA 3QICA 4H8KA 1Q7YO 1BQMA 3AAPA 1IO2A 3SI6A 2QI2A 1P8ZA 3TAEA 5LJWA 1HR0K 1C0GA 4IZ9A 2YJEA 1W97L 1DGKN 1KVCA 2HHVA 4ISGA 1HLUA 3UKUA 3BGRA 3K9KA 4NB4A 3FE1A 1NJXA 2PYJA 5M1NA 4F3TA 2Z1HA 5I3UA 4DSJA 1X3NA 3OS1A 1F21A 4KHSA 2KKZA 5DMRA 4ISFA 4JKHA 1KQSM 4CHOA 3SAHA 4DR2K 1S22A 2IIRA 5BN8A 2I7NA 4H0VB 3AY9A 3CF5L 4QS8A 2KHOA 4LSNA 4DU4A 4OPKA 3HOTA 4H0YB 1NBWA 2NRVA 3L8BA 1NK9A 1HQEA 4BGBA 5CY4A 2P51A 3V81A 3HK2A 1OKJA 5AFUH 4U7BA 1BGXT 3SV3A 3HOSA 2X6SA 4AHSA 1VSFA 3DI6A 1YF5L 3ISNC 3HVTA 1RDWX 3LPUA 1IBMK 2HHXA 3OYCA 5JVGL 1NK7A 4PL7A 3CPEA 3HZ6A 4CE9A 1XC9A 4DF4A 4GVEA 1NJWA 4O8UA 1ZBIA 5E84A 3AO4A 3CCJN 4I6MB 5C2DA 1S1TA 3O80A 1SL0A 3U4LA 1QQOA 2FSJA 4EZ6A 4YDUA 1KC8O 3VQPA 3AARA 1T6CA 1WB9A 4M3RA 3LANA 5TKYA 1GLLO 1MDUB 2GTDA 4FWQA 4KH4A 5BN9A 1EQYA 4UY8O 3ID8A 2NRZA 5JICA 4ILGB 4BRHA 5SWMA 3BF3A 4C8OA 2A1RA 4F3OA 3Q7CA 1LWCA 1W0HA 1LCUA 5EY4A 4JRPA 1O13A 1WAJA 1WBBA 3KK1A 1FK9A 1QQCA 3VQ8A 1BHLA 3D6RA 4AM6A 1L3UA 4IG0A 3RWUA 5HP1A 4C23A 1HKBA 2Y1JA 2O4IA 3RR7A 2NRHA 4CGDA 1ATRA 5MLCQ 5BRFA 3V9SA 1QHTA 3MDQA 1BDGA 3EE9A 1YXQA 2HBLA 3WUHA 4IWVA 4DUYK 4H03B 4LC9B 5AQIA 2Q0UA 4B3TK 4CEQA 3OYMA 2BDPA 3CC2N 4FLYA 3ZSXA 3SQ1A 1QZ5A 1QVGM 2VWJA 4H0PA 3E9LA 3C7NB 2Q31A 4WQ5C 1B92A 4CEDA 4DR7K 4K0KK 2Z1JA 4M3WA 3QLHA 1VQLN 2RHKA 1U04A 3D2FA 2FF6A 3QEWA 3KD5E 2ZE2A 3ZT0A 3F2KA 3NVKA 1NOYA 2NLXA 5M1QA 1WUAA 2RF2A 2O8FB 1TK8A 1MWMA 4CGFA 2OPSA 2KTQA 4DF8A 4CJ7A 3QNNA 3THXA 2P9NA 3PUFA 1BL3A 4RW4A 5LMUK 3L2WA 3NHGA 1TL1A 3OS2A 3OBYA 3TABA 4DTNA 1R0AA 2DTUA 3S3NA 4BRDA 3O9TA 3SQ4A 4BRMA 3MWPA 3O9SA 4DV5K 1ASVA 4CI6A 4AHTA 2LSNA 2OZMA 3OW2M 3AO5A 3THYB 3SZ2A 1NGDA 4NO7A 5F1XA 3H1VX 4DLGA 3VERA 3T7ZA 5SZTA 3IS9A 4HWIA 1EWRA 4FK0A 4DTUA 2W41A 2VG6A 3OA9A 3MAQA 3NFAA 3I33A 1KD1O 3CQ8A 3GOIA 1ZC6A 1NNEA 5KRTA 3CYMA 4F2SA 1HNXK 4OO1J 1BI4A 5BREA 1LWEA 3L2RA 2QEXN 4HHTA 1SKRA 4OX9K 4N76A 1L3VA 3VEVA 1CLQA 1FKPA 2E2NA 3WXLA 1TAQA 3I56N 2HHUA 1EXQA 2G8KA 4QCLA 1BO5O 4JK7A 3HSTB 1RBRA 3OYGA 3SAFA 4DCHA 3ZSVA 3VOVA 2UUAK 1J5OA 1X9SA 4B1VA 1NJZA 2D0AA 1J9AA 3DMJA 3MK6A 2DFFA 1T44A 3MECA 3MXIA 4CECA 5BPMA 4RWTA 1IKVA 4H5RA 3THWA 4A61A 4CGGA 3O4WA 3PV8A 3GG4A 3TTCA 1VK0A 4B9TA 3TU5A 1RDCA 2BGGA 5CR4A 4YOVA 4B1YB 5AQSA 3VETA 3D2FB 1C0FA 5CE3A 1GOBA 4DR1K 4BRLA 4FLVA 2ASPA 1VSKA 3QO9A 3CFRA 1RT3A 1KAYA 3O3HA 5AQXA 4XEIA 4JYAK 4DV3K 4B8CA 3TAFA 4XH1A 4EZ9A 3CJCA 4U67L 2AP1A 1LAVA 4J8FA 4OKKA 3AVIA 1X9WA 3L4IA 2QXFA 3GE1A 2YNGA 1KCFA 2PYLA 3SQ2A 1JLQA 1YT3A 1YJ9N 1WSHA 2P9SA 4JKFA 1VSMA 4B9SA 1NM1A 2VGNA 4MQ3A 3ZT2A 2UUCK 4FM0A 3S3MA 1NGBA 5AQHA 3HL8A 3SUQA 4RW9A 1BI4B 5C2FA 4QOZB 1TKTA 2BTFA 3FZLA 5HRSA 3EEQA 4FO0A 3NF6A 3KHYA 1VRTA 2ASMA 2GEMA 1ESVA 3HI0A 4DV1K 4DSKA 2HVIA 5AQMA 3ZSWA 4B3SK 3ZYYX 2A1SA 5J2MA 1XMQK 3IFRA 1D9DA 3VA3A 5C42A 4CGIA 4HTUA 1RTDA 4DQRA 3MX5A 4E7KA 2YHXA 4DQPA 4H5WA 1L3SA 3DAWA 5M1PA 4CFBA 1X9MA 4AF1A 3AA2A 2HW3A 4O0JA 2VCPA 3L4QA 4N56A 2E1YA 3V4IA 4KTZA 3OYAA 2YJFA 1RBSA 4H5NA 3ZETA 4KPYA 2V7ZA 4JD2A 3C6TA 4FWSA 1U45A 1M90O 4WCEL 4C8NA 2I7PA 3VEYA 1HPMA 4GVMA 3AVCA 2KFZA 4WYBA 4CIGA 4DLEA 4ICLA 4GV6A 4DV4K 3MCAB 4E7LA 4CZJA 3CMAN 4KBOA 2HF3A 3EZWA 3CI5A 5H1SQ 4B9NA 2QWQA 4JAXA 4QAGA 3HO1A 2V7YA 1X1PA 4I2PA 2O8EB 3LM2A 3O1WA 4TSXA 3SK3A 4BRNA 1B9DA 1X9JA 4O5BA 2D0BA 4DG1A 1WSIA 4HUFA 3L0QA 4W5TA 1KRPA 1Z05A 3SUOA 2ITGA 5J1EA 4BR0A 3PSIA 2XO7A 1QQNA 5GIPA 1D4XA 4N5SA 4Z4FA 1XMOK 2HBMA 4DQIA 1OH7A 1JLGA 1CZ9A 3NDKA 4DSIA 4JS4A 3V6DA 1TV6A 1IH7A 2E6LA 4I7FA 3RTVA 1MWKA 3IUCA 3O5BA 4WFAL 4B9UA 3DXKB 2G8UA 3ULDA 1HX1A 2A41A 4CGHA 3RMCA 1VQ6N 4BE2A 4Z0UA 3VQ7A 4E3SA 4BY9C 3SLCA 3K57A 1TK5A 2E2PA 4JLHA 4JKCA 3I8BA 4DFKA 3PSFA 1XHZA 4ID1A 4PKIA 2IVPA 4JI7K 1CZBA 4ILJA 4X65K 5AQNA 4RG8A 2E2QA 1U6ZA 4B9MA 4CHNA 1EX4A 4C1NK 4DB3A 3KJVA 1DLOA 4FL9A 4K43A 2Z1GA 4JKEA 3S3OA 4ID5A 2YKNA 5FPEA 2E1ZA 4CK1A 1KVAA 5DM7L 3IMXA 4FJIA 5JLHA 3WNEA 5AFUA 3TAPA 1NK4A 4DSEA 4IFYA 1IBLK 1RTIA 4HCCA 2UXBK 2Z1IA 1IG8A 3ZETB 3AVAA 2JLEA 3A5MC 5HROA 1I39A 3OYHA 4E7JA 3TTFA 5JS1A 4H4OA 1ZBHA 1BA0A 4JK9A 1DEJA 3WXIA 5BPNA 3SAGA 2FBYA 1S6QA 4OGEA 5DK5A 3OYFA 1NGCA 2HOEA 3W3DA 1YI2N 3C65A 4BR7A 3NF9A 2O8CA 5A2QO 1A5VA 1CZAN 4KO0A 3T19A 4YORA 3WNFA 4CW7B 1KSPA 1SKWA 4LH5A 4IJNA 3VQAA 2YHAA 4N41A 4Z4CA 3K0SA 4OLAA 1U2VB 2NUBA 1JLCA 3U3YA 2PFUA 4O8KA 4CJ3A 4FJMA 5EXWA 2D4WA 4K42A 3PIPL 4FSVA 3WNHA 1RT7A 3HT3A 5FLXO 2XY7A 1JL2A 5HRPA 4X66K 2JGUA 4KH6A 2VQEK 4I6MA 1Y64A 3ALYA 1QTMA 3M8QA 3VEWA 4FJGA 3A2FA 1U48A 4BG9A 4E89A 4IO8A 2FC0A 3B6PA 3VQEA 1WLJA 1ZYQA 2FBTA 3QEPA 4IJAA 3TTDA 2G8IA 2P9LB 2YNIA 3QESA 1HKCA 4M3YA 2BE2A 3LDLA 4XIUA 1HMVA 3DLLL 3QINA 3THVA 1DTQA 4G1QA 3G0ZA 4H4MA 3NH1A 5KQDA 4KHUA 1ZBUA 4DTOA 3T1HK 4LSLA 4NYNA 2ITMA 1K8AO 3BEXA 3B6OA 4DV7K 4H5TA 1RT5A 3OYNA 2HMPA 2QWNA 1Q81O 4IBNA 3LP0A 3E1YA 3JAMO 1IKYA 5CYQA 3MEGA 4FOIA 4JKGA 4BC5A 3NVMA 3AVHA 3NH0A 4CIFA 2EWSA 3QFPA 4BRFA 4LY7A 4ZTJA 4CEFA 4IKFA 1VSIA 2VGMA 3F9KA 1M1KO 3ITHA 1YAGA 3AO3A 2FSNA 3U8XA 3EY1A 4JI3K 3RVCA 3C7NA 1UA1A 4CF9A 3VF4A 2BUPA 1NMNA 2O8CB 3LP2A 3OYEA 4FXDA 2OPPA 5I42A 4EIAA 4CD1A 4L8RB 3FGUA 5IWAK 5AQGA 5C15A 3NAEA 3CQYA 2O8FA 1NGGA 1FW6A 2P9PB 3QNOA 4AM7A 3MMVA 5KI6A 4LFCK 3ZCMA 5HRRA 4GNIA 1LAWA 1LV5A 4M3UA 3QBWA 4CJRA 3T1AA 4R79A 3VEXA 2WBNA 3RRHA 2ZF5O 4HUGA 2P9IA 3WXJA 5JVHL 5AQWA 3OYDA 3I55N 4FJLA 2W6KA 2ZWHA 1J53A 3CCUN 3CC7N 2QTDA 1HRHA 3ZLJA 1UOCA 5C24A 1NGHA 4MDAA 3THYA 4FJNA 3TSPA 3QERA 4BR4A 3C6UA 2YHWA 4CCHA 1EETA 2UUBK 2OYQA 2KLAA 3DOLA 1RBTA 4JRQA 2ZD1A 2DY4A 2F8SA 1OH5A 1KVBA 2QKKA 1ZBSA 1EP4A 3AA3A 1BCOA 3VGMA 3VMFB 3WQTA 1GLAG 4M63C 4EFHA 3AVJA 2E8AA 3M3ZA 4CJSA 4I9LA 3DLHA 4IO9L 5M1KA 1QSYA 4JKGB 4BR5A 5C12A 3CHWA 3QFUA 4NLBA 3BY5A 2KFNA 4BR9A 4IDHA 2R7YA 1J5EK 4BRPA 2HHWA 4KHQA 4B08A 3NCIA 2BANA 1TYQA 3RMDA 1HNZK 3SUNA 4CJWA 2ZJPL 4JKAA 3Q7BA 3ZX3A 3L3UA 1SAZA 1WNSA 5CZ2A 3ZSQA 4NCBA 4BRKA 3VTHA 4BRQA 3VQCA 1RBVA 3QMLA 5GINA 4CERA 1RDDA 4RW7A 4YNQA 3MXJA 3WNGA 1TKXA 4B9QA 1XI1A 3RR8A 2WFBA 4JI5K 3KK3A 1L5UA 3VQBA 1SQKA 5AQPA 5BRHA 4RCHA 3KWGA 3EKSA 4IEEA 4CVNE 1Q86O 1D8YA 3P31A 1DTTA 3AVNA 4FW2A 4FZXC 4HCBA 2X78A 4UQGA 5HLFA 3M5RA 4M3TA 3NE6A 5GAEP 4Z4HA 3TAGA 3F9MA 3D2EB 3PX4A 1LWFA 5JS2A 2P9IB 2HBJA 1QS4A 4WF9L 2ZQBA 3AAQA 1NGFA 5F0XA 4FLWA 3ATUA 4JEPA 4E7HA 1TKZA 3H1QA 2HHSA 1D5AA 1WSEA 3L3VA 2QW9A 4JKBA 3DRRA 3LZJA 3OBWA 2XY6A 4W5OA 4HUEA 3NGZA 4NCGA 4E7IA 1NGEA 1TVRA 3H3OB 4GKKK 3U3GA 5BRDA 4DQ8A 2E6MA 3O9RA 5FDLA 2QWMA 4CD3A 2E2OA 4LF5K 3I0RA 1O1WA 3G25A 2OPRA 1T8EA 1IG9A 4CEBA 3M8PA 5J2NA 3E66A 3EYZA 1BU6O 3A5OC 3F5TA 3M6GA 4BQZA 2NNWA 1Z25A 4LF6K 4QS7A 1ASWA 3CQXA 2E88A 4O5FA 3RRGA 3ATVA 3TAQA 4NYFA 4PHTX 2OA8A 4CF2A 1TYQB 2QWPA 3IAYA 1ITGA 3G4SN 3H45C 1IKXA 3VPZA 4MLHA 4FYDA 3CFOA 3VESA 3CMEN 4BQLA 4IOCL 1L3TA 4O44A 4V19S 3O3GA 2PBDA 4J2EA 4B1WB 2JWLA 5ELZA 5AR0A 2GX9A 2HHTA 4CGJA 3H08A 3TARA 4LFBK 1DT9A 2XY8A 3OYKA 4DR4K 3RSEB 3LDQA 3A5NC 1LW2A 5HOOA 2CH6A 4KHYA 2JWKA 1BUPA 4CEOA 4MDBA 3RMBA 3A5LC 1YTUA 1BG3A 3CC4N 3I0SA 3V1OA 2A5XA 2OANA 1HPZA 2D0OA 1JLEA 2GWKA 4M7XA 2CGLA 1TGOA 3PIOL 2P5OA 3OYBA 1TUYA 2G8WA 4K8XA 3B8AX 2O8EA 3BUZB 1RCHA 1NJYA 3TANA 3K5OA 1FJGK 4KI6A 2OCEA 4CJ4A 3KLGA 4ELTA 2P1JA 1NG9A 1VQ7N 2P5GA 3SV4A 4AH9A 4PUOA 1I3AA 1RILA 4DV6K 3CJ9A 1WAFA 1MU2A 4WFNL 3VEOA 2FF3B 4PA1A 3LALA 3K58A 1U4BA 3BDPA 4XH4A 3FZMA 1B9FA 2ZGYA 3DLKA 4JI2K 3C6AA 3DXKA 2WONA 3CCVN 4DS5A 2HBKA 4H0OA 5FPMA 1VQON 1SKSA 1JCFA 1BIUA 3J7AP 3MX2A 3IDHA 4FW1A 2H3GX 1TKDA 1OH6A 3KK7A 4AHUA 4DR5K 5EOYA 3AVLA 4CBUA 4BC3A 3MN9A 3ZX0A 4YOWA 1TK0A 4BVPA 3QEXA 2OTJN 4OPHA 5IT9O 4ZHRA 2ZGZA 4OJRA 3VGKA 3KLFA 1VQPN 4DQSA 5C10A 3P1GA 1Q9XA 3U9DA 3EN9A 1GOAA 1JKHA 5JMVA 4B8AB 3ZT3A 2GV9A 1KFSA 1XUPO 3DRSA 2Q2RA 3CCEN 4YY3K 1X3MA 3KLIA 4DV0K 5T7BA 5EVZA 1SV5A 5AZJA 4YOTA 4GMJB 3EE8A 2D5RA 1VRUA 3SJHA 4FWKA 3JYTA 1JL1A 3UB5A 2DFEA 4AHVA 5AQZA 1OVQA 4YDUC 4CJKA 4HTLA 4KHPK 3LDSA 4A62A 4H5VA 4DTJA 3D45A 4PL8A 2UU9K 3I8DA 1RDAA 1WSJA 1U2VA 2IGIA 1HNIA 4JI6K 3P4IA 1Q8IA 3UKRB 1IJJA 4Z4EA 4YOYA 4WQ5A 4BWJA 4DFMA 2NRWA 4CF1A 1XC3A 1QVFM 1S72N 5GAHP 3PLAA 1W2BM 4KI4A 1HYZA 4FLUA 4FK2A 4DKWA 4BROA 1HJOA 3H46O 1RT2A 5AQVA 4DFJA 1VQ5N 2PY5A 4DTMA 1C1CA 3J7YP 1HNWK 1KTQA 2P9UB 1YJWN 1C1AA 1T3VA 2VWBA 4AHCA 3HP9A 1EWQA 4YHHK 2HVHA 1NGJA 1IV0A 1XHXA 3QIOA 4JV5K 1C6VA 3IRXA 2P9LA 3AA4A 5AZIB 4BE0A 4KB0A 3NMUA 4GKJK 3BZKA 4C8LA 4DU1A 1SL1A 4FJJA 2E20A 1G15A 2Q0RA 3TWHA 3L6QA 3R1XA 3EO3A 3HRGA 1N34K 3FFKB 3S9HA 1N32K 2VG7A 3WEEB 1JXBA 4BVOA 1RTHA 2FSKA 4MO5A 3SMSA 1XQSC 4XH5A 1N33K 2IVOA 3VQQA 2YKMA 4FJHA 1WN7A 3TR8A 2KZZA 3CM5A 1SZ2A 2YHYA 2VWKA 4PQUA 3FZKA 3V9ZA 1V4TA 2HHQA 4O55A 3V1QA 2HNYA 2HF4A 4KFBA 1DKGD 1NWKA 3RMAA 4FCYA 4CHQA 1HKGA 3AGRA 3ZSZA 4KV8A 4KKOA 1IKWA 4Z4IA 5AZJB 4Y1DA 3J8AA 2FBXA 3ZEUA 4F9OA 1ZXOA 1GLCG 2Q97A 1RNHA 3C0BA 5F2RA 2YI1A 4DQQA 4Y0WA 3AVKA 3DWLA 2RE2A 4BDYA 5FPNA 1BQNA 3P39A 1VQKN 4RW6A 4JN4A 1I94K 4FM1A 4LF7K 2Q36A 5AQKA 2P9PA 4CJVA 3SBGA 4FK4A 4CK2A 3M8RA 4CZFA 3K5LA 4LF8K 1QZ6A 4GV9A 2G8FA 3V9WA 3HM8A 4DSLA 3HJFA 2P9KB 3N4PA 3ULEB 5KPZA 1HYVA 3KTQA 5AQLA 3K5NA 4RTFD 2HNZA 4PKHA 4E1MA 2QA4N 1K8KB 3EL2A 4FJ8A 2UYTA 2FLOA 1N36K 2QWRA 4KTWA 4CEZA 4O0IA 2YX6A
chains in the Genus database with same CATH topology
2FBVA 3V9UA 2IC3A 2KFNA 1YTAA 3TAMA 4ELUA 2W42A 2R7YA 3NGYA 4JS5A 3SPYA 2HHWA 4KHQA 1GOBA 4B08A 4KAZA 4FLVA 3NCIA 2BANA 4FM2A 3RMDA 4CFAA 1NK8A 1RT6A 1VSKA 3O4NA 2YHBA 3QO9A 4CJWA 1RT3A 5HRNA 3CFRA 3C94A 3O4QA 3SUNA 3O3HA 1UWBA 3L3UA 5CZ2A 1WNSA 3AO2A 3ZSQA 4CEEA 4CF0A 1NKEA 4NCBA 3D0PA 1S1XA 2RKIA 4B8CA 3TAFA 4EZ9A 3AO1A 1C1BA 3VQCA 4CHYA 1RBVA 3FFIA 1BCMA 3C95A 1LAVA 4OKKA 3LWLA 1VSDA 3AVIA 4MFBA 5EU7A 1X9WA 3KD1E 4CERA 3ZT4A 4BDPA 4I2QA 1RDDA 2QXFA 3LPTA 4RW7A 3MXJA 4YNQA 4CFCA 2YNGA 3WNGA 1TKXA 3CM6A 1C0TA 1XI1A 3RR8A 1KCFA 3KK3A 2PYLA 2O4GA 1L5UA 3VQBA 3ZT1A 1JLQA 1YT3A 3SQ2A 5CZ1A 1WSHA 1ASUA 1XWLA 1D8YA 4ELVA 1VSMA 1RT1A 1DTTA 3AVNA 3U6FA 4B9SA 4FW2A 4J2BA 1S1WA 4OPJA 3HVRA 4FZXC 4HCBA 2X78A 4UQGA 5HLFA 4Z4GA 4MQ3A 3EZ5A 3ZT2A 4M3TA 3NE6A 4FM0A 4Z4HA 4IG3A 3S3MA 3TAGA 4KTQA 2VG5A 2XY5A 3HL8A 1J54A 3SUQA 3PX4A 1S1UA 3OJUA 1LWFA 1RDBA 4RW9A 5JS2A 1BI4B 1QS4A 3QEVA 2ZQBA 4QOZB 2B6AA 4KHNA 1TKTA 1VSHA 2F96A 2WOMA 4FVMA 2RN2A 4IFVA 4FLWA 4PY5A 5HRSA 4E7HA 1TKZA 3ZSYA 3NF6A 4DU3A 1REVA 2HHSA 2EX3A 1D5AA 1VRTA 1WSEA 3L3VA 3DRRA 3LZJA 4DTRA 2IS3A 2XY6A 4DSKA 4W5OA 4HUEA 3PY8A 3NGZA 4NCGA 1TL3A 4E7IA 1T7PA 2HVIA 1TVRA 3ZSWA 4Q0BA 3U3GA 2A1SA 4M45A 3DLBA 5J2MA 1NK5A 2Q3SA 3E01A 1ZBFA 1D9DA 4DTXA 2E6MA 1UA0A 3P83D 4HVJA 5FDLA 3KK2A 2IDOA 3VA3A 3I0RA 3PO4A 5C42A 2B5JA 1O1WA 4CGIA 4HTUA 4EP4A 1RTDA 4FLTA 4DQRA 4E7KA 4DFPA 4CK3A 2OPRA 1VSEA 4CJUA 1T8EA 2OPQA 1IG9A 4J2DA 1S6PA 4FJKA 4CEBA 3M8PA 4DQPA 5J2NA 1L3SA 3EYZA 4NCAA 1QE1A 3TI0A 4CFBA 3O3FA 1X9MA 2G8HA 2GUIA 3AA2A 1W9HA 3QIPA 4O0JA 2HW3A 2KQ2A 3V1RA 4N56A 3KLEA 4CJFA 4CHZA 4CJEA 1CXQA 4CFDA 1BIZA 3T3FA 3V4IA 4CJTA 4KRFA 2KZMA 4KTZA 3OYLA 1S5JA 1Z25A 2D0CA 2XRIA 3VA0A 1ASWA 3OYAA 1HJRA 3OVNA 4W5RA 1VSJA 1YVUA 1RBSA 4CEAA 3RRGA 1UAXA 1K6YA 3TAQA 2F8TA 4KPYA 4NYFA 1NKCA 4C8MA 2OA8A 2YNHA 3HM9A 3VQ4A 4J2AA 3C6TA 1NK0A 4CF2A 4DMNA 1U45A 5KGWA 4I9QA 3IAYA 1ITGA 4C8NA 1Q9YA 1IKXA 1KLNA 3KKRA 4GVMA 3AVCA 4FYDA 2IAJA 2KFZA 3CFOA 4CIGA 4DLEA 4ICLA 2YNFA 4E7LA 1EKEA 2X74A 5HBMA 3VQ6A 3NF8A 2HB5A 2X6NA 1L3TA 3LAKA 5J2PA 4O44A 3OYJA 4OKJA 4B9NA 2E4LA 3O3GA 2QKBA 2EHGA 1A5XA 4QAGA 3HO1A 1S9EA 4E0DA 4RW8A 3SCXA 4J2EA 3ZSRA 1D9FA 3DLGA 4FZZA 4DSFA 1X1PA 3OY9A 3LZIA 4M3XA 3NF7A 4I2PA 2HHTA 4CGJA 4TSXA 1JLFA 3H08A 3OS0A 3ZSOA 3TARA 3ASMA 4R5PA 2XY8A 3K2PA 3VQ9A 3OYKA 4EP5A 1B9DA 3DLRA 4O5BA 2D0BA 4DG1A 3DRPA 1WSIA 3MXMA 1LW2A 5FRNA 3DYAA 5KTQA 4HUFA 3CG7A 4W5TA 1KRPA 4KHYA 3UIQA 3SUOA 2ITGA 4CEOA 5J1EA 3RMBA 4PWDA 3OJSA 2XO7A 1YTUA 1QSSA 4FLXA 3I0SA 3V1OA 4DWIA 4FZYA 4N5SA 4Z4FA 2OZSA 1HPZA 2RPIA 1JLEA 4DQIA 4M3ZA 1JLGA 1CZ9A 4H8KA 3NDKA 4DSIA 4FJ9A 4JS4A 1TGOA 3PO5A 1BQMA 2XHBA 3V6DA 3SNNA 4KHWA 1IO2A 1HNVA 3SI6A 2P5OA 1TV6A 1IH7A 2E6LA 3OYBA 4BACA 2G8WA 4I7FA 3SPZA 4K8XA 3RTVA 3TAEA 4B9UA 1RCHA 1JXEA 4DS4A 1A5WA 1NJYA 2G8UA 3TANA 3ULDA 1KVCA 3K5OA 2HHVA 4CGHA 3RMCA 4KI6A 4BE2A 4Z0UA 3VQ7A 2B4JA 4E3SA 2PZSA 4CJ4A 3KLGA 3K57A 3BGRA 1NJXA 4ELTA 2P1JA 1TK5A 2PYJA 3AV9A 2P5GA 4JLHA 4F3TA 3SV4A 2Z1HA 5I3UA 2AJQA 4DSJA 4DFKA 4AH9A 1XHZA 4PUOA 4W5QA 4F8RA 1I3AA 4ID1A 1RILA 1WSGA 3OS1A 1F21A 4KHSA 3K59A 5DMRA 4M41A 1WAFA 3DLEA 1MU2A 1CZBA 4CHOA 1S9GA 4RG8A 4PA1A 3LALA 3K58A 1U4BA 3BDPA 4B9VA 4B9MA 3AVGA 1EX4A 4CHNA 1VSLA 3KJVA 1B9FA 1DLOA 1S1VA 3DLKA 3SUPA 2Z1GA 3S3OA 4ID5A 2YKNA 2WONA 4LSNA 4O4GA 4DU4A 4OPKA 1NK6A 1NOZA 4DS5A 4CK1A 1KVAA 3L2UA 1C0MA 4FJIA 3WNEA 3TAPA 1NK4A 4GW6A 3L8BA 4DSEA 4IFYA 3G10A 1NK9A 3QEIA 1SKSA 1HQEA 1RTIA 5CY4A 2P51A 4HCCA 1TAUA 1BIUA 1JLAA 2Z1IA 1QSLA 3V81A 3AVAA 3HK2A 1RTJA 2JLEA 1BGXT 3SV3A 3JSMA 4FW1A 3KLHA 3CFPA 5HROA 1I39A 1TKDA 3OYHA 2QK9A 2X6SA 2KW4A 4E7JA 4AHSA 5JS1A 4H4OA 4BDZA 1VSFA 1U49A 5D3GA 4WE1A 3DI6A 4AHUA 3OYIA 3ISNC 1ZBHA 3HVTA 1TK0A 3AVLA 3LPUA 4W5NA 2HHXA 5KRSA 3OYCA 3QETA 3QEXA 1NK7A 3HP6A 2FBYA 1S6QA 4OGEA 5DK5A 4CE9A 3OYFA 1XC9A 4N47A 4DF4A 4CJPA 1HQUA 1NJWA 4KREA 3NGIA 1ZBIA 2I5JA 3LAMA 4AILC 3AO4A 3NF9A 1S1TA 1A5VA 4ZHRA 1SL0A 4KO0A 4EZ6A 3T19A 3WNFA 4OJRA 3VQPA 4M3RA 1KSPA 3LANA 3KLFA 1SKWA 4LH5A 3VQAA 4CIEA 3P1GA 2YHAA 4DQSA 1Q9XA 4N41A 1GOAA 4Z4CA 4FJ5A 4OLAA 1JKHA 2YV0X 3LWMA 2NUBA 1JLCA 3ZT3A 4B8AB 2GV9A 3U3YA 1KFSA 3DRSA 4FJ7A 3KLIA 4F4KA 5T7BA 1GOCA 1SV5A 4CJ3A 5SWMA 4C8OA 4FJMA 5KGXA 4GMJB 3HYFA 2A1RA 1HYSA 4F3OA 2D5RA 1VRUA 1LWCA 1FXXA 1RT7A 3WNHA 3HT3A 2XY7A 1JL2A 1W0HA 3JYTA 1JL1A 2DFEA 5HRPA 2HNDA 4AHVA 4JRPA 3V9XA 2JGUA 4CJKA 4M42A 1WAJA 3LDSA 3KK1A 4OLBA 1FK9A 1QQCA 3VQ8A 1BHLA 1L3UA 4DTSA 4DTJA 3D45A 4IG0A 3RWUA 5HP1A 3ALYA 1QTMA 4CJLA 3MEEA 5E41A 3M8QA 4IDKA 4BE1A 2Y1JA 3MEDA 4FJGA 2O4IA 3A2FA 4YFUA 3I8DA 1U48A 1RDAA 3RR7A 1WSJA 4E89A 2IGIA 4CGDA 1HNIA 1JLBA 2FC0A 3DOKA 3B6PA 1Q8IA 3VQEA 1WLJA 1ZYQA 4Z4EA 2FBTA 3QEPA 3V9SA 1BISA 5CYMA 4Y1CA 1KLMA 4CESA 1T05A 2G8IA 1QHTA 2YNIA 1RBUA 2ATQA 4BWJA 4DFMA 4CF1A 3QESA 5FRMA 4M3YA 4KI4A 2BE2A 1HYZA 4XIUA 4FLUA 4FK2A 1RT4A 1HMVA 3QINA 3THVA 1DTQA 1RT2A 4CEQA 2Y1IA 3SQ0A 4G1QA 3G0ZA 4DFJA 3OYMA 4H4MA 3NH1A 2BDPA 4FLYA 3ZSXA 2PY5A 4KHUA 4DTMA 3SQ1A 1ZBUA 1C1CA 4DTOA 4B9LA 4E19A 1KTQA 4LSLA 3L2QA 1C1AA 4NYNA 4LD0A 2VWJA 4AHCA 3HP9A 3AA5X 3B6OA 1ZBLA 4CJQA 1B92A 4B3OA 1RT5A 4CEDA 2HVHA 1XHXA 2DFHA 3OYNA 3QIOA 1C6VA 3IRXA 4IBNA 5J2QA 3AA4A 3LP0A 3PX6A 1IKYA 4Q5VA 4BE0A 2Z1JA 4KB0A 3QLHA 1SUQA 5CYQA 3MEGA 4M3WA 2HMIA 1LW0A 1U04A 1Y97A 4C8LA 4DU1A 1SL1A 4FJJA 1G15A 3QEWA 3TWHA 3AVHA 3KD5E 2ZE2A 3ZT0A 3NH0A 4CIFA 1NOYA 4C8KA 4LY7A 2RF2A 4LH4A 1TK8A 3S9HA 4ZTJA 4K8ZA 4F2RA 4CEFA 4IKFA 1VSIA 4CGFA 4FLZA 2OPSA 2VG7A 3F9KA 4BWMA 2KTQA 1JXBA 4DF8A 3ITHA 3AO3A 3HPOA 2IOCA 3M8SA 1RTHA 3QNNA 3EY1A 3PUFA 1UA1A 4CF9A 4DTPA 1BL3A 4RW4A 3VQQA 2YKMA 1NKBA 4FJHA 1WN7A 3LP2A 3TR8A 3OYEA 3L2WA 3NHGA 4FXDA 2KZZA 1TL1A 2OPPA 3CM5A 3OS2A 3TABA 1U47A 3NH2A 2VWKA 4DTNA 5I42A 4PQUA 4CJ5A 1R0AA 2DTUA 3V9ZA 2HHQA 3S3NA 4O55A 3V1QA 2HNYA 4L8RB 4KFBA 2G8VA 3SQ4A 3NAEA 3RMAA 1ASVA 4FCYA 4CHQA 4AHTA 3SYZA 2LSNA 4AHRA 2OZMA 3KKSA 1N6QA 2GBZA 3AO5A 3IG1A 4KV8A 4KKOA 4OKEA 3ZSZA 3SZ2A 1IKWA 3HPGA 3P5JA 3QNOA 1N5YA 4Z4IA 4Y1DA 3F73A 5KI6A 4DLGA 2FBXA 3AVFA 3ZCMA 5HRRA 5SZTA 1LAWA 3PX0A 3IS9A 1LV5A 1CXUA 4M3UA 4FK0A 4DTUA 3DM2A 1Z26A 4CJRA 3T1AA 2VG6A 4FJXA 1RNHA 3NFAA 3VQDA 3MAQA 4DQQA 1C0UA 3RRHA 3CQ8A 1SL2A 4HUGA 5KRTA 3CYMA 3AVKA 4F2SA 4OGCA 1BI4A 3OYDA 1LWEA 3L2RA 4BDYA 5K14A 1BQNA 3LP1A 4HHTA 4RW6A 1SKRA 4FJLA 4N76A 1L3VA 4CF8A 1FKPA 4KB1A 1KFDA 1CLQA 1J53A 4FM1A 1HRHA 4OVLA 3HXMA 1TAQA 1UOCA 5C24A 2HHUA 1EXQA 4CJVA 2G8KA 4FJNA 4QCLA 4FK4A 3HSTB 3QERA 1RBRA 4CK2A 3OYGA 3M8RA 5C25A 3K5LA 3ZSVA 3C6UA 3K5MA 4E1NA 1J5OA 4CCHA 1X9SA 2G8FA 1EETA 1NJZA 3V9WA 4CHPA 2OYQA 2D0AA 5FROA 4DSLA 1J9AA 3DMJA 3LP3A 3HJFA 2DFFA 3DOLA 1RBTA 4JRQA 2ZD1A 2DY4A 3MECA 1HYVA 2F8SA 3KTQA 1KVBA 3AVMA 2QKKA 3NBPA 1EP4A 1FKOA 3AA3A 4CECA 3MXIA 1IKVA 3K5NA 1BCOA 3L2VA 2HNZA 3AVBA 3SJJA 4CGGA 3PV8A 3HPHA 3AVJA 4E1MA 4CJSA 1VK0A 4ZTFA 4I9LA 3DLHA 1RDCA 4B9TA 4FJ8A 2BGGA 4KTWA 3KIOA 3VN5A 2ETJA 1QSYA 4CEZA 4O0IA 3VQ5A 1WSFA 1T03A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FBV A;  3V9U A;  2IC3 A;  2KFN A;  1YTA A;  3TAM A;  4ELU A;  2W42 A;  2R7Y A;  3NGY A;  4JS5 A;  3SPY A;  2HHW A;  4KHQ A;  1GOB A;  4B08 A;  4KAZ A;  4FLV A;  3NCI A;  2BAN A;  4FM2 A;  3RMD A;  4CFA A;  1NK8 A;  1RT6 A;  1VSK A;  3O4N A;  2YHB A;  3QO9 A;  4CJW A;  1RT3 A;  5HRN A;  3CFR A;  3C94 A;  3O4Q A;  3SUN A;  3O3H A;  1UWB A;  3L3U A;  5CZ2 A;  1WNS A;  3AO2 A;  3ZSQ A;  4CEE A;  4CF0 A;  1NKE A;  4NCB A;  3D0P A;  1S1X A;  2RKI A;  4B8C A;  3TAF A;  4EZ9 A;  3AO1 A;  1C1B A;  3VQC A;  4CHY A;  1RBV A;  3FFI A;  1BCM A;  3C95 A;  1LAV A;  4OKK A;  3LWL A;  1VSD A;  3AVI A;  4MFB A;  5EU7 A;  1X9W A;  3KD1 E;  4CER A;  3ZT4 A;  4BDP A;  4I2Q A;  1RDD A;  2QXF A;  3LPT A;  4RW7 A;  3MXJ A;  4YNQ A;  4CFC A;  2YNG A;  3WNG A;  1TKX A;  3CM6 A;  1C0T A;  1XI1 A;  3RR8 A;  1KCF A;  3KK3 A;  2PYL A;  2O4G A;  1L5U A;  3VQB A;  3ZT1 A;  1JLQ A;  1YT3 A;  3SQ2 A;  5CZ1 A;  1WSH A;  1ASU A;  1XWL A;  1D8Y A;  4ELV A;  1VSM A;  1RT1 A;  1DTT A;  3AVN A;  3U6F A;  4B9S A;  4FW2 A;  4J2B A;  1S1W A;  4OPJ A;  3HVR A;  4FZX C;  4HCB A;  2X78 A;  4UQG A;  5HLF A;  4Z4G A;  4MQ3 A;  3EZ5 A;  3ZT2 A;  4M3T A;  3NE6 A;  4FM0 A;  4Z4H A;  4IG3 A;  3S3M A;  3TAG A;  4KTQ A;  2VG5 A;  2XY5 A;  3HL8 A;  1J54 A;  3SUQ A;  3PX4 A;  1S1U A;  3OJU A;  1LWF A;  1RDB A;  4RW9 A;  5JS2 A;  1BI4 B;  1QS4 A;  3QEV A;  2ZQB A;  4QOZ B;  2B6A A;  4KHN A;  1TKT A;  1VSH A;  2F96 A;  2WOM A;  4FVM A;  2RN2 A;  4IFV A;  4FLW A;  4PY5 A;  5HRS A;  4E7H A;  1TKZ A;  3ZSY A;  3NF6 A;  4DU3 A;  1REV A;  2HHS A;  2EX3 A;  1D5A A;  1VRT A;  1WSE A;  3L3V A;  3DRR A;  3LZJ A;  4DTR A;  2IS3 A;  2XY6 A;  4DSK A;  4W5O A;  4HUE A;  3PY8 A;  3NGZ A;  4NCG A;  1TL3 A;  4E7I A;  1T7P A;  2HVI A;  1TVR A;  3ZSW A;  4Q0B A;  3U3G A;  2A1S A;  4M45 A;  3DLB A;  5J2M A;  1NK5 A;  2Q3S A;  3E01 A;  1ZBF A;  1D9D A;  4DTX A;  2E6M A;  1UA0 A;  3P83 D;  4HVJ A;  5FDL A;  3KK2 A;  2IDO A;  3VA3 A;  3I0R A;  3PO4 A;  5C42 A;  2B5J A;  1O1W A;  4CGI A;  4HTU A;  4EP4 A;  1RTD A;  4FLT A;  4DQR A;  4E7K A;  4DFP A;  4CK3 A;  2OPR A;  1VSE A;  4CJU A;  1T8E A;  2OPQ A;  1IG9 A;  4J2D A;  1S6P A;  4FJK A;  4CEB A;  3M8P A;  4DQP A;  5J2N A;  1L3S A;  3EYZ A;  4NCA A;  1QE1 A;  3TI0 A;  4CFB A;  3O3F A;  1X9M A;  2G8H A;  2GUI A;  3AA2 A;  1W9H A;  3QIP A;  4O0J A;  2HW3 A;  2KQ2 A;  3V1R A;  4N56 A;  3KLE A;  4CJF A;  4CHZ A;  4CJE A;  1CXQ A;  4CFD A;  1BIZ A;  3T3F A;  3V4I A;  4CJT A;  4KRF A;  2KZM A;  4KTZ A;  3OYL A;  1S5J A;  1Z25 A;  2D0C A;  2XRI A;  3VA0 A;  1ASW A;  3OYA A;  1HJR A;  3OVN A;  4W5R A;  1VSJ A;  1YVU A;  1RBS A;  4CEA A;  3RRG A;  1UAX A;  1K6Y A;  3TAQ A;  2F8T A;  4KPY A;  4NYF A;  1NKC A;  4C8M A;  2OA8 A;  2YNH A;  3HM9 A;  3VQ4 A;  4J2A A;  3C6T A;  1NK0 A;  4CF2 A;  4DMN A;  1U45 A;  5KGW A;  4I9Q A;  3IAY A;  1ITG A;  4C8N A;  1Q9Y A;  1IKX A;  1KLN A;  3KKR A;  4GVM A;  3AVC A;  4FYD A;  2IAJ A;  2KFZ A;  3CFO A;  4CIG A;  4DLE A;  4ICL A;  2YNF A;  4E7L A;  1EKE A;  2X74 A;  5HBM A;  3VQ6 A;  3NF8 A;  2HB5 A;  2X6N A;  1L3T A;  3LAK A;  5J2P A;  4O44 A;  3OYJ A;  4OKJ A;  4B9N A;  2E4L A;  3O3G A;  2QKB A;  2EHG A;  1A5X A;  4QAG A;  3HO1 A;  1S9E A;  4E0D A;  4RW8 A;  3SCX A;  4J2E A;  3ZSR A;  1D9F A;  3DLG A;  4FZZ A;  4DSF A;  1X1P A;  3OY9 A;  3LZI A;  4M3X A;  3NF7 A;  4I2P A;  2HHT A;  4CGJ A;  4TSX A;  1JLF A;  3H08 A;  3OS0 A;  3ZSO A;  3TAR A;  3ASM A;  4R5P A;  2XY8 A;  3K2P A;  3VQ9 A;  3OYK A;  4EP5 A;  1B9D A;  3DLR A;  4O5B A;  2D0B A;  4DG1 A;  3DRP A;  1WSI A;  3MXM A;  1LW2 A;  5FRN A;  3DYA A;  5KTQ A;  4HUF A;  3CG7 A;  4W5T A;  1KRP A;  4KHY A;  3UIQ A;  3SUO A;  2ITG A;  4CEO A;  5J1E A;  3RMB A;  4PWD A;  3OJS A;  2XO7 A;  1YTU A;  1QSS A;  4FLX A;  3I0S A;  3V1O A;  4DWI A;  4FZY A;  4N5S A;  4Z4F A;  2OZS A;  1HPZ A;  2RPI A;  1JLE A;  4DQI A;  4M3Z A;  1JLG A;  1CZ9 A;  4H8K A;  3NDK A;  4DSI A;  4FJ9 A;  4JS4 A;  1TGO A;  3PO5 A;  1BQM A;  2XHB A;  3V6D A;  3SNN A;  4KHW A;  1IO2 A;  1HNV A;  3SI6 A;  2P5O A;  1TV6 A;  1IH7 A;  2E6L A;  3OYB A;  4BAC A;  2G8W A;  4I7F A;  3SPZ A;  4K8X A;  3RTV A;  3TAE A;  4B9U A;  1RCH A;  1JXE A;  4DS4 A;  1A5W A;  1NJY A;  2G8U A;  3TAN A;  3ULD A;  1KVC A;  3K5O A;  2HHV A;  4CGH A;  3RMC A;  4KI6 A;  4BE2 A;  4Z0U A;  3VQ7 A;  2B4J A;  4E3S A;  2PZS A;  4CJ4 A;  3KLG A;  3K57 A;  3BGR A;  1NJX A;  4ELT A;  2P1J A;  1TK5 A;  2PYJ A;  3AV9 A;  2P5G A;  4JLH A;  4F3T A;  3SV4 A;  2Z1H A;  5I3U A;  2AJQ A;  4DSJ A;  4DFK A;  4AH9 A;  1XHZ A;  4PUO A;  4W5Q A;  4F8R A;  1I3A A;  4ID1 A;  1RIL A;  1WSG A;  3OS1 A;  1F21 A;  4KHS A;  3K59 A;  5DMR A;  4M41 A;  1WAF A;  3DLE A;  1MU2 A;  1CZB A;  4CHO A;  1S9G A;  4RG8 A;  4PA1 A;  3LAL A;  3K58 A;  1U4B A;  3BDP A;  4B9V A;  4B9M A;  3AVG A;  1EX4 A;  4CHN A;  1VSL A;  3KJV A;  1B9F A;  1DLO A;  1S1V A;  3DLK A;  3SUP A;  2Z1G A;  3S3O A;  4ID5 A;  2YKN A;  2WON A;  4LSN A;  4O4G A;  4DU4 A;  4OPK A;  1NK6 A;  1NOZ A;  4DS5 A;  4CK1 A;  1KVA A;  3L2U A;  1C0M A;  4FJI A;  3WNE A;  3TAP A;  1NK4 A;  4GW6 A;  3L8B A;  4DSE A;  4IFY A;  3G10 A;  1NK9 A;  3QEI A;  1SKS A;  1HQE A;  1RTI A;  5CY4 A;  2P51 A;  4HCC A;  1TAU A;  1BIU A;  1JLA A;  2Z1I A;  1QSL A;  3V81 A;  3AVA A;  3HK2 A;  1RTJ A;  2JLE A;  1BGX T;  3SV3 A;  3JSM A;  4FW1 A;  3KLH A;  3CFP A;  5HRO A;  1I39 A;  1TKD A;  3OYH A;  2QK9 A;  2X6S A;  2KW4 A;  4E7J A;  4AHS A;  5JS1 A;  4H4O A;  4BDZ A;  1VSF A;  1U49 A;  5D3G A;  4WE1 A;  3DI6 A;  4AHU A;  3OYI A;  3ISN C;  1ZBH A;  3HVT A;  1TK0 A;  3AVL A;  3LPU A;  4W5N A;  2HHX A;  5KRS A;  3OYC A;  3QET A;  3QEX A;  1NK7 A;  3HP6 A;  2FBY A;  1S6Q A;  4OGE A;  5DK5 A;  4CE9 A;  3OYF A;  1XC9 A;  4N47 A;  4DF4 A;  4CJP A;  1HQU A;  1NJW A;  4KRE A;  3NGI A;  1ZBI A;  2I5J A;  3LAM A;  4AIL C;  3AO4 A;  3NF9 A;  1S1T A;  1A5V A;  4ZHR A;  1SL0 A;  4KO0 A;  4EZ6 A;  3T19 A;  3WNF A;  4OJR A;  3VQP A;  4M3R A;  1KSP A;  3LAN A;  3KLF A;  1SKW A;  4LH5 A;  3VQA A;  4CIE A;  3P1G A;  2YHA A;  4DQS A;  1Q9X A;  4N41 A;  1GOA A;  4Z4C A;  4FJ5 A;  4OLA A;  1JKH A;  2YV0 X;  3LWM A;  2NUB A;  1JLC A;  3ZT3 A;  4B8A B;  2GV9 A;  3U3Y A;  1KFS A;  3DRS A;  4FJ7 A;  3KLI A;  4F4K A;  5T7B A;  1GOC A;  1SV5 A;  4CJ3 A;  5SWM A;  4C8O A;  4FJM A;  5KGX A;  4GMJ B;  3HYF A;  2A1R A;  1HYS A;  4F3O A;  2D5R A;  1VRU A;  1LWC A;  1FXX A;  1RT7 A;  3WNH A;  3HT3 A;  2XY7 A;  1JL2 A;  1W0H A;  3JYT A;  1JL1 A;  2DFE A;  5HRP A;  2HND A;  4AHV A;  4JRP A;  3V9X A;  2JGU A;  4CJK A;  4M42 A;  1WAJ A;  3LDS A;  3KK1 A;  4OLB A;  1FK9 A;  1QQC A;  3VQ8 A;  1BHL A;  1L3U A;  4DTS A;  4DTJ A;  3D45 A;  4IG0 A;  3RWU A;  5HP1 A;  3ALY A;  1QTM A;  4CJL A;  3MEE A;  5E41 A;  3M8Q A;  4IDK A;  4BE1 A;  2Y1J A;  3MED A;  4FJG A;  2O4I A;  3A2F A;  4YFU A;  3I8D A;  1U48 A;  1RDA A;  3RR7 A;  1WSJ A;  4E89 A;  2IGI A;  4CGD A;  1HNI A;  1JLB A;  2FC0 A;  3DOK A;  3B6P A;  1Q8I A;  3VQE A;  1WLJ A;  1ZYQ A;  4Z4E A;  2FBT A;  3QEP A;  3V9S A;  1BIS A;  5CYM A;  4Y1C A;  1KLM A;  4CES A;  1T05 A;  2G8I A;  1QHT A;  2YNI A;  1RBU A;  2ATQ A;  4BWJ A;  4DFM A;  4CF1 A;  3QES A;  5FRM A;  4M3Y A;  4KI4 A;  2BE2 A;  1HYZ A;  4XIU A;  4FLU A;  4FK2 A;  1RT4 A;  1HMV A;  3QIN A;  3THV A;  1DTQ A;  1RT2 A;  4CEQ A;  2Y1I A;  3SQ0 A;  4G1Q A;  3G0Z A;  4DFJ A;  3OYM A;  4H4M A;  3NH1 A;  2BDP A;  4FLY A;  3ZSX A;  2PY5 A;  4KHU A;  4DTM A;  3SQ1 A;  1ZBU A;  1C1C A;  4DTO A;  4B9L A;  4E19 A;  1KTQ A;  4LSL A;  3L2Q A;  1C1A A;  4NYN A;  4LD0 A;  2VWJ A;  4AHC A;  3HP9 A;  3AA5 X;  3B6O A;  1ZBL A;  4CJQ A;  1B92 A;  4B3O A;  1RT5 A;  4CED A;  2HVH A;  1XHX A;  2DFH A;  3OYN A;  3QIO A;  1C6V A;  3IRX A;  4IBN A;  5J2Q A;  3AA4 A;  3LP0 A;  3PX6 A;  1IKY A;  4Q5V A;  4BE0 A;  2Z1J A;  4KB0 A;  3QLH A;  1SUQ A;  5CYQ A;  3MEG A;  4M3W A;  2HMI A;  1LW0 A;  1U04 A;  1Y97 A;  4C8L A;  4DU1 A;  1SL1 A;  4FJJ A;  1G15 A;  3QEW A;  3TWH A;  3AVH A;  3KD5 E;  2ZE2 A;  3ZT0 A;  3NH0 A;  4CIF A;  1NOY A;  4C8K A;  4LY7 A;  2RF2 A;  4LH4 A;  1TK8 A;  3S9H A;  4ZTJ A;  4K8Z A;  4F2R A;  4CEF A;  4IKF A;  1VSI A;  4CGF A;  4FLZ A;  2OPS A;  2VG7 A;  3F9K A;  4BWM A;  2KTQ A;  1JXB A;  4DF8 A;  3ITH A;  3AO3 A;  3HPO A;  2IOC A;  3M8S A;  1RTH A;  3QNN A;  3EY1 A;  3PUF A;  1UA1 A;  4CF9 A;  4DTP A;  1BL3 A;  4RW4 A;  3VQQ A;  2YKM A;  1NKB A;  4FJH A;  1WN7 A;  3LP2 A;  3TR8 A;  3OYE A;  3L2W A;  3NHG A;  4FXD A;  2KZZ A;  1TL1 A;  2OPP A;  3CM5 A;  3OS2 A;  3TAB A;  1U47 A;  3NH2 A;  2VWK A;  4DTN A;  5I42 A;  4PQU A;  4CJ5 A;  1R0A A;  2DTU A;  3V9Z A;  2HHQ A;  3S3N A;  4O55 A;  3V1Q A;  2HNY A;  4L8R B;  4KFB A;  2G8V A;  3SQ4 A;  3NAE A;  3RMA A;  1ASV A;  4FCY A;  4CHQ A;  4AHT A;  3SYZ A;  2LSN A;  4AHR A;  2OZM A;  3KKS A;  1N6Q A;  2GBZ A;  3AO5 A;  3IG1 A;  4KV8 A;  4KKO A;  4OKE A;  3ZSZ A;  3SZ2 A;  1IKW A;  3HPG A;  3P5J A;  3QNO A;  1N5Y A;  4Z4I A;  4Y1D A;  3F73 A;  5KI6 A;  4DLG A;  2FBX A;  3AVF A;  3ZCM A;  5HRR A;  5SZT A;  1LAW A;  3PX0 A;  3IS9 A;  1LV5 A;  1CXU A;  4M3U A;  4FK0 A;  4DTU A;  3DM2 A;  1Z26 A;  4CJR A;  3T1A A;  2VG6 A;  4FJX A;  1RNH A;  3NFA A;  3VQD A;  3MAQ A;  4DQQ A;  1C0U A;  3RRH A;  3CQ8 A;  1SL2 A;  4HUG A;  5KRT A;  3CYM A;  3AVK A;  4F2S A;  4OGC A;  1BI4 A;  3OYD A;  1LWE A;  3L2R A;  4BDY A;  5K14 A;  1BQN A;  3LP1 A;  4HHT A;  4RW6 A;  1SKR A;  4FJL A;  4N76 A;  1L3V A;  4CF8 A;  1FKP A;  4KB1 A;  1KFD A;  1CLQ A;  1J53 A;  4FM1 A;  1HRH A;  4OVL A;  3HXM A;  1TAQ A;  1UOC A;  5C24 A;  2HHU A;  1EXQ A;  4CJV A;  2G8K A;  4FJN A;  4QCL A;  4FK4 A;  3HST B;  3QER A;  1RBR A;  4CK2 A;  3OYG A;  3M8R A;  5C25 A;  3K5L A;  3ZSV A;  3C6U A;  3K5M A;  4E1N A;  1J5O A;  4CCH A;  1X9S A;  2G8F A;  1EET A;  1NJZ A;  3V9W A;  4CHP A;  2OYQ A;  2D0A A;  5FRO A;  4DSL A;  1J9A A;  3DMJ A;  3LP3 A;  3HJF A;  2DFF A;  3DOL A;  1RBT A;  4JRQ A;  2ZD1 A;  2DY4 A;  3MEC A;  1HYV A;  2F8S A;  3KTQ A;  1KVB A;  3AVM A;  2QKK A;  3NBP A;  1EP4 A;  1FKO A;  3AA3 A;  4CEC A;  3MXI A;  1IKV A;  3K5N A;  1BCO A;  3L2V A;  2HNZ A;  3AVB A;  3SJJ A;  4CGG A;  3PV8 A;  3HPH A;  3AVJ A;  4E1M A;  4CJS A;  1VK0 A;  4ZTF A;  4I9L A;  3DLH A;  1RDC A;  4B9T A;  4FJ8 A;  2BGG A;  4KTW A;  3KIO A;  3VN5 A;  2ETJ A;  1QSY A;  4CEZ A;  4O0I A;  3VQ5 A;  1WSF A;  1T03 A; 
#chains in the Genus database with same CATH topology
 2FBV A;  4K41 A;  4FWM A;  4QS9 A;  1S3X A;  5FPD A;  5GAD P;  2W42 A;  3NGY A;  4JS5 A;  3SPY A;  4DV2 K;  1NK8 A;  1RT6 A;  3O4N A;  2YHB A;  5HRN A;  4CF0 A;  1XNR K;  4BRC A;  5B8H A;  5BPL A;  3D0P A;  2RKI A;  3AO1 A;  3KWI A;  4WQ4 A;  4CHY A;  1BCM A;  3C95 A;  4FPB A;  1WBD A;  3UE5 A;  1VSD A;  5EU7 A;  3MCP A;  4MFB A;  3ZT4 A;  4BDP A;  2D0P A;  3O6W A;  1BOT O;  5AQF A;  3CM6 A;  1RDU A;  2F9T A;  4M7Y A;  3CIP A;  3ZT1 A;  1VQ4 N;  1K73 O;  1ASU A;  3EKU A;  2UXD K;  1XWL A;  1BWF O;  2WUS A;  5KPT A;  3ZEU B;  4J2B A;  1S1W A;  4OPJ A;  3HVR A;  4Z4G A;  1QQM A;  4KH5 A;  4KTQ A;  2VG5 A;  4IXC A;  5BR8 K;  3OJU A;  1P90 A;  1RDB A;  2QM1 A;  3QEV A;  2B6A A;  1VSH A;  2A3Z A;  2F96 A;  2WOM A;  4PY5 A;  2RN2 A;  3JXU A;  3ZSY A;  4BRE A;  2IS3 A;  3A8Y A;  3OHR A;  3PY8 A;  1TL3 A;  3N4Q A;  4CBX A;  3DLB A;  1EO1 A;  2Q3S A;  3E01 A;  3ENO A;  4DTX A;  1JCE A;  4CBW A;  3GDQ A;  3TPQ A;  2IDO A;  3PO4 A;  3T1Y K;  3D2E A;  3TSQ A;  3A0I X;  4CZH A;  4EP4 A;  2PAV A;  4DFP A;  1VSE A;  4CJU A;  1S6P A;  3GBT A;  1BA1 A;  4JKD A;  1QE1 A;  4NCA A;  3KZB A;  2G8H A;  1W9H A;  1H1V A;  3V1R A;  1GLJ O;  4CJF A;  4BRI A;  4CJE A;  1BIZ A;  4JI1 K;  4CJT A;  4KRF A;  2KZM A;  3OYL A;  1S5J A;  3VA0 A;  4BR2 A;  4LF4 K;  3BP8 A;  3CET A;  3J81 O;  1VQM N;  1VSJ A;  1YVU A;  4CEA A;  4K25 A;  3CCL N;  3MWT A;  5BR9 A;  3QBX A;  4C8M A;  4J2A A;  4I9Q A;  4DMN A;  2F4V K;  1Q9Y A;  3KKR A;  2F9W A;  4YOU A;  2YNF A;  5AJ3 K;  1RFQ A;  4NXN K;  5HL7 L;  1EKE A;  1Q18 A;  2X74 A;  3NF8 A;  3D7E O;  5ADX H;  3BZC A;  5J2P A;  3OYJ A;  1OVY A;  4OKJ A;  2E4L A;  4GY2 B;  2QKB A;  2EHG A;  1A5X A;  1J6Z A;  2IVN A;  3MN6 A;  4RW8 A;  3SCX A;  1D9F A;  4DSF A;  3OY9 A;  1JLF A;  1QHA A;  3CCQ N;  3ZSO A;  3ASM A;  4R5P A;  4EP5 A;  1YIT N;  4EHU A;  4MLE A;  1OH8 A;  3DLR A;  4IOX A;  4A2A A;  3DYA A;  4B1U B;  5KTQ A;  2NRT A;  3UKU B;  3CG7 A;  5M1F A;  3UIQ A;  4PWD A;  1R59 O;  2Q1N A;  3O08 A;  3ENH A;  5AQY A;  4FZY A;  4JNE A;  2OZS A;  2ZM6 K;  4FJ9 A;  2VQF K;  3PO5 A;  2XHB A;  4KHW A;  2A6A A;  3SNN A;  1HNV A;  4BAC A;  4CZE A;  3SPZ A;  4LF9 K;  2ASO A;  3VEN A;  1XNQ K;  3HBT A;  4DS4 A;  1A5W A;  4BGA A;  3KVG A;  3RSE A;  2GUP A;  3J7Z O;  2B4J A;  2PZS A;  4FPA A;  1T6D A;  4IOA L;  3AV9 A;  3LDP A;  1VAZ A;  2AJQ A;  4W5Q A;  4F8R A;  1WSG A;  4IEI A;  3K59 A;  1NLV A;  4M41 A;  3DLE A;  4B3M K;  1S9G A;  2ZJR L;  4B9V A;  3AVG A;  4NXM K;  1VSL A;  3H3N O;  3SUP A;  1S1V A;  4FOE A;  4AQY K;  4A2B A;  4O4G A;  1NK6 A;  3VF6 A;  4DHY A;  1NOZ A;  2QXL A;  3L2U A;  1C0M A;  4GW6 A;  3G10 A;  3QEI A;  1ATS A;  1TAU A;  1JLA A;  1QSL A;  2A40 A;  2V52 B;  1RTJ A;  2NRR A;  3JSM A;  3KLH A;  3CFP A;  3O9Q A;  2QK9 A;  2KW4 A;  4DR6 K;  3FZF A;  4BDZ A;  1U49 A;  5D3G A;  4WE1 A;  2W6L A;  3OYI A;  4BRA A;  4BC4 A;  4W5N A;  5KRS A;  5E26 A;  3QET A;  3HP6 A;  3W0L A;  4N47 A;  4CJP A;  1HQU A;  3NGI A;  3TSU A;  2I5J A;  3LAM A;  3O8M A;  3S41 A;  4AIL C;  2W40 A;  3VGL A;  1ILY A;  4CIE A;  4FJ5 A;  3LWM A;  2YV0 X;  3VF2 A;  4FJ7 A;  4A5A A;  4F4K A;  1GOC A;  4IFE A;  2HHH K;  1HYS A;  5KGX A;  3HYF A;  2V51 B;  2FXU A;  1KAZ A;  5LJV A;  1FXX A;  1NU0 A;  3R6M A;  3R3L A;  1HUX A;  2HND A;  3V9X A;  4M42 A;  4YOX A;  2HST A;  3AGK A;  4OLB A;  4DTS A;  1SS6 A;  1VQN N;  4CJL A;  3MEE A;  5E41 A;  1G99 A;  4IDK A;  4BE1 A;  3MED A;  1NGA A;  4YFU A;  3FLC O;  1ATN A;  1JLB A;  4A5B A;  3DOK A;  4FWR A;  4OPA A;  5AQO A;  3VTI A;  1BIS A;  5CYM A;  4Y1C A;  1KLM A;  4CES A;  1T05 A;  1RBU A;  2ATQ A;  3O1B A;  5FRM A;  2OTL N;  4CZL A;  1RT4 A;  1GLF O;  4CZG A;  2NZT A;  3CXC M;  2Y1I A;  3SQ0 A;  3GL1 A;  3DXM A;  3G6E N;  3E9P A;  4BG8 A;  4B9L A;  4E19 A;  3CCS N;  3L2Q A;  5LL6 Z;  4LD0 A;  4ILH A;  3THX B;  2P9N B;  3AA5 X;  1ZBL A;  4CJQ A;  4B3O A;  1YJN N;  3UKR A;  2DFH A;  2D1K A;  5J2Q A;  4JI0 K;  3PX6 A;  5CHI A;  2CH5 A;  1TUU A;  4Q5V A;  1SUQ A;  2AA4 A;  1E4F T;  2HMI A;  3FZH A;  1LW0 A;  3VEZ A;  1Y97 A;  4JI8 K;  4FWN A;  1VQ9 N;  2O8D A;  4C8K A;  1JCG A;  4LH4 A;  1VHX A;  4H0T B;  4K8Z A;  4F2R A;  5KPR A;  4FLZ A;  4BWM A;  4NLC A;  2P9U A;  4X64 K;  3HPO A;  3M8S A;  2IOC A;  2WTU A;  4WQ4 C;  4DTP A;  3ID6 A;  3O9U A;  5C0Y A;  1NKB A;  5AZI A;  2GEL A;  1U47 A;  4LFA K;  3SMP A;  3NH2 A;  3FR0 A;  5AQQ A;  3QB0 A;  4CJ5 A;  1V4S A;  3MN7 A;  4GV3 A;  2G8V A;  2BH1 A;  3SYZ A;  4AHR A;  3SBT A;  3KKS A;  1N6Q A;  2GBZ A;  3IG1 A;  4OKE A;  3HPG A;  3WEE A;  3P5J A;  1N5Y A;  4X62 K;  1E3M A;  3F73 A;  4G9Z A;  1K9M O;  1E4G T;  3AVF A;  3PX0 A;  1CXU A;  3DM2 A;  1Z26 A;  1RGI A;  5JLF A;  3WXM B;  4FJX A;  3VQD A;  1LOT B;  1C0U A;  1JJ2 M;  4H0X B;  5I9E B;  1SL2 A;  3CER A;  4A57 A;  5AQU A;  4OGC A;  1N8R O;  4DR3 K;  1YUW A;  5K14 A;  3THW B;  3LP1 A;  3CPW M;  4CF8 A;  4KB1 A;  1KFD A;  4OVL A;  3HXM A;  4FWL A;  3CCR N;  2QWL A;  3WXK A;  2QWO A;  5C25 A;  2F7T A;  3K5M A;  4E1N A;  1GLD G;  4MO4 A;  2GWJ A;  3QDK A;  4CHP A;  5FRO A;  3LP3 A;  3DXM B;  1NJI O;  3IKM A;  4C1N I;  3ENB A;  1Q82 O;  4FWO A;  2WC9 A;  3AVM A;  3NBP A;  1FKO A;  3J80 O;  3L2V A;  5AQJ A;  3CD6 N;  3AVB A;  3SJJ A;  3HPH A;  5DM6 L;  4ZTF A;  3KIO A;  3VN5 A;  2ETJ A;  3G71 N;  3VQ5 A;  1JXE A;  1WSF A;  1T03 A;  3V9U A;  2IC3 A;  1MA9 B;  1YTA A;  3TAM A;  4ELU A;  2O8D B;  2A42 A;  2P9K A;  4JHD A;  4KAZ A;  3CJ7 A;  5EX5 A;  4FM2 A;  3ULE A;  4CFA A;  2P9S B;  3C94 A;  3O4Q A;  1UWB A;  4JI4 K;  1GLB G;  1NKE A;  3AO2 A;  4CEE A;  2CGJ A;  1S1X A;  3E9O A;  5GIO A;  1C1B A;  1K8K A;  3FFI A;  3LWL A;  2NRX A;  3KD1 E;  4JK8 A;  3M1F A;  4I2Q A;  3LPT A;  4CFC A;  1C0T A;  4EAH D;  5AQT A;  5M1O A;  2O4G A;  5CZ1 A;  3CJ1 A;  2UXC K;  3U9Z A;  2O8B A;  4ELV A;  1RT1 A;  3U6F A;  4FVU A;  3EZ5 A;  5GAG P;  4IG3 A;  4FWP A;  3JS6 A;  2XY5 A;  1J54 A;  3C6H A;  1S1U A;  4A59 A;  3LDO A;  3R9P A;  5LMN K;  5KQ8 A;  4KHN A;  4FVM A;  3BF1 A;  4IFV A;  3HSC A;  2CGK A;  3R8E A;  4DU3 A;  1REV A;  2EX3 A;  3HTV A;  4DTR A;  3LDN A;  4CZK A;  4WFB L;  1T7P A;  3OTO K;  4Q0B A;  1NGI A;  5AQR A;  4M45 A;  3WQU A;  1NK5 A;  1ZBF A;  4CZM A;  4L3Q A;  1UA0 A;  3P83 D;  4HVJ A;  1W7A A;  4DUZ K;  4JD2 B;  3KK2 A;  3LL3 A;  2B5J A;  4FLT A;  1YHQ N;  4CK3 A;  4J2D A;  2OPQ A;  4FJK A;  3TI0 A;  3O3F A;  2GUI A;  3QIP A;  2KQ2 A;  3ZX2 A;  3KLE A;  4CHZ A;  2J4R A;  1CXQ A;  4CFD A;  3T3F A;  2D0C A;  2XRI A;  3LM9 A;  3DJC A;  1HJR A;  3H6E A;  3OVN A;  4W5R A;  1UAX A;  1K6Y A;  1YVN A;  2F8T A;  5TKW A;  1NKC A;  2VYP A;  1KAX A;  2YNH A;  3VQ4 A;  4JHD B;  3HM9 A;  1NK0 A;  5KGW A;  1NMD A;  3P38 A;  1YIJ N;  1KLN A;  4BC2 A;  1IBK K;  1Z6R A;  2IAJ A;  5ADX A;  1KXP A;  4ISE A;  5HBM A;  3VQ6 A;  2HB5 A;  2DPN A;  2X6N A;  2YCH A;  3LAK A;  4CZI A;  4BRG A;  4B1X B;  1GLE G;  3T69 A;  4B1Z A;  1S9E A;  4E0D A;  4FZZ A;  3ZSR A;  3DLG A;  3CJB A;  3LZI A;  4M3X A;  3NF7 A;  3CCM N;  3OS0 A;  4EHT A;  3K2P A;  3VQ9 A;  4Z94 A;  4PKG A;  3DRP A;  2O8B B;  3MXM A;  5FRN A;  1VQ8 N;  1WOQ A;  5LY3 A;  4E1J A;  2E5L K;  3CJA A;  3OJS A;  3K9J A;  1QSS A;  4FLX A;  2ZJQ L;  3MN5 A;  4DWI A;  3WT0 A;  4B3R K;  4M3Z A;  2RPI A;  4KRE A;  3QIC A;  4H8K A;  1Q7Y O;  1BQM A;  3AAP A;  1IO2 A;  3SI6 A;  2QI2 A;  1P8Z A;  3TAE A;  5LJW A;  1HR0 K;  1C0G A;  4IZ9 A;  2YJE A;  1W97 L;  1DGK N;  1KVC A;  2HHV A;  4ISG A;  1HLU A;  3UKU A;  3BGR A;  3K9K A;  4NB4 A;  3FE1 A;  1NJX A;  2PYJ A;  5M1N A;  4F3T A;  2Z1H A;  5I3U A;  4DSJ A;  1X3N A;  3OS1 A;  1F21 A;  4KHS A;  2KKZ A;  5DMR A;  4ISF A;  4JKH A;  1KQS M;  4CHO A;  3SAH A;  4DR2 K;  1S22 A;  2IIR A;  5BN8 A;  2I7N A;  4H0V B;  3AY9 A;  3CF5 L;  4QS8 A;  2KHO A;  4LSN A;  4DU4 A;  4OPK A;  3HOT A;  4H0Y B;  1NBW A;  2NRV A;  3L8B A;  1NK9 A;  1HQE A;  4BGB A;  5CY4 A;  2P51 A;  3V81 A;  3HK2 A;  1OKJ A;  5AFU H;  4U7B A;  1BGX T;  3SV3 A;  3HOS A;  2X6S A;  4AHS A;  1VSF A;  3DI6 A;  1YF5 L;  3ISN C;  3HVT A;  1RDW X;  3LPU A;  1IBM K;  2HHX A;  3OYC A;  5JVG L;  1NK7 A;  4PL7 A;  3CPE A;  3HZ6 A;  4CE9 A;  1XC9 A;  4DF4 A;  4GVE A;  1NJW A;  4O8U A;  1ZBI A;  5E84 A;  3AO4 A;  3CCJ N;  4I6M B;  5C2D A;  1S1T A;  3O80 A;  1SL0 A;  3U4L A;  1QQO A;  2FSJ A;  4EZ6 A;  4YDU A;  1KC8 O;  3VQP A;  3AAR A;  1T6C A;  1WB9 A;  4M3R A;  3LAN A;  5TKY A;  1GLL O;  1MDU B;  2GTD A;  4FWQ A;  4KH4 A;  5BN9 A;  1EQY A;  4UY8 O;  3ID8 A;  2NRZ A;  5JIC A;  4ILG B;  4BRH A;  5SWM A;  3BF3 A;  4C8O A;  2A1R A;  4F3O A;  3Q7C A;  1LWC A;  1W0H A;  1LCU A;  5EY4 A;  4JRP A;  1O13 A;  1WAJ A;  1WBB A;  3KK1 A;  1FK9 A;  1QQC A;  3VQ8 A;  1BHL A;  3D6R A;  4AM6 A;  1L3U A;  4IG0 A;  3RWU A;  5HP1 A;  4C23 A;  1HKB A;  2Y1J A;  2O4I A;  3RR7 A;  2NRH A;  4CGD A;  1ATR A;  5MLC Q;  5BRF A;  3V9S A;  1QHT A;  3MDQ A;  1BDG A;  3EE9 A;  1YXQ A;  2HBL A;  3WUH A;  4IWV A;  4DUY K;  4H03 B;  4LC9 B;  5AQI A;  2Q0U A;  4B3T K;  4CEQ A;  3OYM A;  2BDP A;  3CC2 N;  4FLY A;  3ZSX A;  3SQ1 A;  1QZ5 A;  1QVG M;  2VWJ A;  4H0P A;  3E9L A;  3C7N B;  2Q31 A;  4WQ5 C;  1B92 A;  4CED A;  4DR7 K;  4K0K K;  2Z1J A;  4M3W A;  3QLH A;  1VQL N;  2RHK A;  1U04 A;  3D2F A;  2FF6 A;  3QEW A;  3KD5 E;  2ZE2 A;  3ZT0 A;  3F2K A;  3NVK A;  1NOY A;  2NLX A;  5M1Q A;  1WUA A;  2RF2 A;  2O8F B;  1TK8 A;  1MWM A;  4CGF A;  2OPS A;  2KTQ A;  4DF8 A;  4CJ7 A;  3QNN A;  3THX A;  2P9N A;  3PUF A;  1BL3 A;  4RW4 A;  5LMU K;  3L2W A;  3NHG A;  1TL1 A;  3OS2 A;  3OBY A;  3TAB A;  4DTN A;  1R0A A;  2DTU A;  3S3N A;  4BRD A;  3O9T A;  3SQ4 A;  4BRM A;  3MWP A;  3O9S A;  4DV5 K;  1ASV A;  4CI6 A;  4AHT A;  2LSN A;  2OZM A;  3OW2 M;  3AO5 A;  3THY B;  3SZ2 A;  1NGD A;  4NO7 A;  5F1X A;  3H1V X;  4DLG A;  3VER A;  3T7Z A;  5SZT A;  3IS9 A;  4HWI A;  1EWR A;  4FK0 A;  4DTU A;  2W41 A;  2VG6 A;  3OA9 A;  3MAQ A;  3NFA A;  3I33 A;  1KD1 O;  3CQ8 A;  3GOI A;  1ZC6 A;  1NNE A;  5KRT A;  3CYM A;  4F2S A;  1HNX K;  4OO1 J;  1BI4 A;  5BRE A;  1LWE A;  3L2R A;  2QEX N;  4HHT A;  1SKR A;  4OX9 K;  4N76 A;  1L3V A;  3VEV A;  1CLQ A;  1FKP A;  2E2N A;  3WXL A;  1TAQ A;  3I56 N;  2HHU A;  1EXQ A;  2G8K A;  4QCL A;  1BO5 O;  4JK7 A;  3HST B;  1RBR A;  3OYG A;  3SAF A;  4DCH A;  3ZSV A;  3VOV A;  2UUA K;  1J5O A;  1X9S A;  4B1V A;  1NJZ A;  2D0A A;  1J9A A;  3DMJ A;  3MK6 A;  2DFF A;  1T44 A;  3MEC A;  3MXI A;  4CEC A;  5BPM A;  4RWT A;  1IKV A;  4H5R A;  3THW A;  4A61 A;  4CGG A;  3O4W A;  3PV8 A;  3GG4 A;  3TTC A;  1VK0 A;  4B9T A;  3TU5 A;  1RDC A;  2BGG A;  5CR4 A;  4YOV A;  4B1Y B;  5AQS A;  3VET A;  3D2F B;  1C0F A;  5CE3 A;  1GOB A;  4DR1 K;  4BRL A;  4FLV A;  2ASP A;  1VSK A;  3QO9 A;  3CFR A;  1RT3 A;  1KAY A;  3O3H A;  5AQX A;  4XEI A;  4JYA K;  4DV3 K;  4B8C A;  3TAF A;  4XH1 A;  4EZ9 A;  3CJC A;  4U67 L;  2AP1 A;  1LAV A;  4J8F A;  4OKK A;  3AVI A;  1X9W A;  3L4I A;  2QXF A;  3GE1 A;  2YNG A;  1KCF A;  2PYL A;  3SQ2 A;  1JLQ A;  1YT3 A;  1YJ9 N;  1WSH A;  2P9S A;  4JKF A;  1VSM A;  4B9S A;  1NM1 A;  2VGN A;  4MQ3 A;  3ZT2 A;  2UUC K;  4FM0 A;  3S3M A;  1NGB A;  5AQH A;  3HL8 A;  3SUQ A;  4RW9 A;  1BI4 B;  5C2F A;  4QOZ B;  1TKT A;  2BTF A;  3FZL A;  5HRS A;  3EEQ A;  4FO0 A;  3NF6 A;  3KHY A;  1VRT A;  2ASM A;  2GEM A;  1ESV A;  3HI0 A;  4DV1 K;  4DSK A;  2HVI A;  5AQM A;  3ZSW A;  4B3S K;  3ZYY X;  2A1S A;  5J2M A;  1XMQ K;  3IFR A;  1D9D A;  3VA3 A;  5C42 A;  4CGI A;  4HTU A;  1RTD A;  4DQR A;  3MX5 A;  4E7K A;  2YHX A;  4DQP A;  4H5W A;  1L3S A;  3DAW A;  5M1P A;  4CFB A;  1X9M A;  4AF1 A;  3AA2 A;  2HW3 A;  4O0J A;  2VCP A;  3L4Q A;  4N56 A;  2E1Y A;  3V4I A;  4KTZ A;  3OYA A;  2YJF A;  1RBS A;  4H5N A;  3ZET A;  4KPY A;  2V7Z A;  4JD2 A;  3C6T A;  4FWS A;  1U45 A;  1M90 O;  4WCE L;  4C8N A;  2I7P A;  3VEY A;  1HPM A;  4GVM A;  3AVC A;  2KFZ A;  4WYB A;  4CIG A;  4DLE A;  4ICL A;  4GV6 A;  4DV4 K;  3MCA B;  4E7L A;  4CZJ A;  3CMA N;  4KBO A;  2HF3 A;  3EZW A;  3CI5 A;  5H1S Q;  4B9N A;  2QWQ A;  4JAX A;  4QAG A;  3HO1 A;  2V7Y A;  1X1P A;  4I2P A;  2O8E B;  3LM2 A;  3O1W A;  4TSX A;  3SK3 A;  4BRN A;  1B9D A;  1X9J A;  4O5B A;  2D0B A;  4DG1 A;  1WSI A;  4HUF A;  3L0Q A;  4W5T A;  1KRP A;  1Z05 A;  3SUO A;  2ITG A;  5J1E A;  4BR0 A;  3PSI A;  2XO7 A;  1QQN A;  5GIP A;  1D4X A;  4N5S A;  4Z4F A;  1XMO K;  2HBM A;  4DQI A;  1OH7 A;  1JLG A;  1CZ9 A;  3NDK A;  4DSI A;  4JS4 A;  3V6D A;  1TV6 A;  1IH7 A;  2E6L A;  4I7F A;  3RTV A;  1MWK A;  3IUC A;  3O5B A;  4WFA L;  4B9U A;  3DXK B;  2G8U A;  3ULD A;  1HX1 A;  2A41 A;  4CGH A;  3RMC A;  1VQ6 N;  4BE2 A;  4Z0U A;  3VQ7 A;  4E3S A;  4BY9 C;  3SLC A;  3K57 A;  1TK5 A;  2E2P A;  4JLH A;  4JKC A;  3I8B A;  4DFK A;  3PSF A;  1XHZ A;  4ID1 A;  4PKI A;  2IVP A;  4JI7 K;  1CZB A;  4ILJ A;  4X65 K;  5AQN A;  4RG8 A;  2E2Q A;  1U6Z A;  4B9M A;  4CHN A;  1EX4 A;  4C1N K;  4DB3 A;  3KJV A;  1DLO A;  4FL9 A;  4K43 A;  2Z1G A;  4JKE A;  3S3O A;  4ID5 A;  2YKN A;  5FPE A;  2E1Z A;  4CK1 A;  1KVA A;  5DM7 L;  3IMX A;  4FJI A;  5JLH A;  3WNE A;  5AFU A;  3TAP A;  1NK4 A;  4DSE A;  4IFY A;  1IBL K;  1RTI A;  4HCC A;  2UXB K;  2Z1I A;  1IG8 A;  3ZET B;  3AVA A;  2JLE A;  3A5M C;  5HRO A;  1I39 A;  3OYH A;  4E7J A;  3TTF A;  5JS1 A;  4H4O A;  1ZBH A;  1BA0 A;  4JK9 A;  1DEJ A;  3WXI A;  5BPN A;  3SAG A;  2FBY A;  1S6Q A;  4OGE A;  5DK5 A;  3OYF A;  1NGC A;  2HOE A;  3W3D A;  1YI2 N;  3C65 A;  4BR7 A;  3NF9 A;  2O8C A;  5A2Q O;  1A5V A;  1CZA N;  4KO0 A;  3T19 A;  4YOR A;  3WNF A;  4CW7 B;  1KSP A;  1SKW A;  4LH5 A;  4IJN A;  3VQA A;  2YHA A;  4N41 A;  4Z4C A;  3K0S A;  4OLA A;  1U2V B;  2NUB A;  1JLC A;  3U3Y A;  2PFU A;  4O8K A;  4CJ3 A;  4FJM A;  5EXW A;  2D4W A;  4K42 A;  3PIP L;  4FSV A;  3WNH A;  1RT7 A;  3HT3 A;  5FLX O;  2XY7 A;  1JL2 A;  5HRP A;  4X66 K;  2JGU A;  4KH6 A;  2VQE K;  4I6M A;  1Y64 A;  3ALY A;  1QTM A;  3M8Q A;  3VEW A;  4FJG A;  3A2F A;  1U48 A;  4BG9 A;  4E89 A;  4IO8 A;  2FC0 A;  3B6P A;  3VQE A;  1WLJ A;  1ZYQ A;  2FBT A;  3QEP A;  4IJA A;  3TTD A;  2G8I A;  2P9L B;  2YNI A;  3QES A;  1HKC A;  4M3Y A;  2BE2 A;  3LDL A;  4XIU A;  1HMV A;  3DLL L;  3QIN A;  3THV A;  1DTQ A;  4G1Q A;  3G0Z A;  4H4M A;  3NH1 A;  5KQD A;  4KHU A;  1ZBU A;  4DTO A;  3T1H K;  4LSL A;  4NYN A;  2ITM A;  1K8A O;  3BEX A;  3B6O A;  4DV7 K;  4H5T A;  1RT5 A;  3OYN A;  2HMP A;  2QWN A;  1Q81 O;  4IBN A;  3LP0 A;  3E1Y A;  3JAM O;  1IKY A;  5CYQ A;  3MEG A;  4FOI A;  4JKG A;  4BC5 A;  3NVM A;  3AVH A;  3NH0 A;  4CIF A;  2EWS A;  3QFP A;  4BRF A;  4LY7 A;  4ZTJ A;  4CEF A;  4IKF A;  1VSI A;  2VGM A;  3F9K A;  1M1K O;  3ITH A;  1YAG A;  3AO3 A;  2FSN A;  3U8X A;  3EY1 A;  4JI3 K;  3RVC A;  3C7N A;  1UA1 A;  4CF9 A;  3VF4 A;  2BUP A;  1NMN A;  2O8C B;  3LP2 A;  3OYE A;  4FXD A;  2OPP A;  5I42 A;  4EIA A;  4CD1 A;  4L8R B;  3FGU A;  5IWA K;  5AQG A;  5C15 A;  3NAE A;  3CQY A;  2O8F A;  1NGG A;  1FW6 A;  2P9P B;  3QNO A;  4AM7 A;  3MMV A;  5KI6 A;  4LFC K;  3ZCM A;  5HRR A;  4GNI A;  1LAW A;  1LV5 A;  4M3U A;  3QBW A;  4CJR A;  3T1A A;  4R79 A;  3VEX A;  2WBN A;  3RRH A;  2ZF5 O;  4HUG A;  2P9I A;  3WXJ A;  5JVH L;  5AQW A;  3OYD A;  3I55 N;  4FJL A;  2W6K A;  2ZWH A;  1J53 A;  3CCU N;  3CC7 N;  2QTD A;  1HRH A;  3ZLJ A;  1UOC A;  5C24 A;  1NGH A;  4MDA A;  3THY A;  4FJN A;  3TSP A;  3QER A;  4BR4 A;  3C6U A;  2YHW A;  4CCH A;  1EET A;  2UUB K;  2OYQ A;  2KLA A;  3DOL A;  1RBT A;  4JRQ A;  2ZD1 A;  2DY4 A;  2F8S A;  1OH5 A;  1KVB A;  2QKK A;  1ZBS A;  1EP4 A;  3AA3 A;  1BCO A;  3VGM A;  3VMF B;  3WQT A;  1GLA G;  4M63 C;  4EFH A;  3AVJ A;  2E8A A;  3M3Z A;  4CJS A;  4I9L A;  3DLH A;  4IO9 L;  5M1K A;  1QSY A;  4JKG B;  4BR5 A;  5C12 A;  3CHW A;  3QFU A;  4NLB A;  3BY5 A;  2KFN A;  4BR9 A;  4IDH A;  2R7Y A;  1J5E K;  4BRP A;  2HHW A;  4KHQ A;  4B08 A;  3NCI A;  2BAN A;  1TYQ A;  3RMD A;  1HNZ K;  3SUN A;  4CJW A;  2ZJP L;  4JKA A;  3Q7B A;  3ZX3 A;  3L3U A;  1SAZ A;  1WNS A;  5CZ2 A;  3ZSQ A;  4NCB A;  4BRK A;  3VTH A;  4BRQ A;  3VQC A;  1RBV A;  3QML A;  5GIN A;  4CER A;  1RDD A;  4RW7 A;  4YNQ A;  3MXJ A;  3WNG A;  1TKX A;  4B9Q A;  1XI1 A;  3RR8 A;  2WFB A;  4JI5 K;  3KK3 A;  1L5U A;  3VQB A;  1SQK A;  5AQP A;  5BRH A;  4RCH A;  3KWG A;  3EKS A;  4IEE A;  4CVN E;  1Q86 O;  1D8Y A;  3P31 A;  1DTT A;  3AVN A;  4FW2 A;  4FZX C;  4HCB A;  2X78 A;  4UQG A;  5HLF A;  3M5R A;  4M3T A;  3NE6 A;  5GAE P;  4Z4H A;  3TAG A;  3F9M A;  3D2E B;  3PX4 A;  1LWF A;  5JS2 A;  2P9I B;  2HBJ A;  1QS4 A;  4WF9 L;  2ZQB A;  3AAQ A;  1NGF A;  5F0X A;  4FLW A;  3ATU A;  4JEP A;  4E7H A;  1TKZ A;  3H1Q A;  2HHS A;  1D5A A;  1WSE A;  3L3V A;  2QW9 A;  4JKB A;  3DRR A;  3LZJ A;  3OBW A;  2XY6 A;  4W5O A;  4HUE A;  3NGZ A;  4NCG A;  4E7I A;  1NGE A;  1TVR A;  3H3O B;  4GKK K;  3U3G A;  5BRD A;  4DQ8 A;  2E6M A;  3O9R A;  5FDL A;  2QWM A;  4CD3 A;  2E2O A;  4LF5 K;  3I0R A;  1O1W A;  3G25 A;  2OPR A;  1T8E A;  1IG9 A;  4CEB A;  3M8P A;  5J2N A;  3E66 A;  3EYZ A;  1BU6 O;  3A5O C;  3F5T A;  3M6G A;  4BQZ A;  2NNW A;  1Z25 A;  4LF6 K;  4QS7 A;  1ASW A;  3CQX A;  2E88 A;  4O5F A;  3RRG A;  3ATV A;  3TAQ A;  4NYF A;  4PHT X;  2OA8 A;  4CF2 A;  1TYQ B;  2QWP A;  3IAY A;  1ITG A;  3G4S N;  3H45 C;  1IKX A;  3VPZ A;  4MLH A;  4FYD A;  3CFO A;  3VES A;  3CME N;  4BQL A;  4IOC L;  1L3T A;  4O44 A;  4V19 S;  3O3G A;  2PBD A;  4J2E A;  4B1W B;  2JWL A;  5ELZ A;  5AR0 A;  2GX9 A;  2HHT A;  4CGJ A;  3H08 A;  3TAR A;  4LFB K;  1DT9 A;  2XY8 A;  3OYK A;  4DR4 K;  3RSE B;  3LDQ A;  3A5N C;  1LW2 A;  5HOO A;  2CH6 A;  4KHY A;  2JWK A;  1BUP A;  4CEO A;  4MDB A;  3RMB A;  3A5L C;  1YTU A;  1BG3 A;  3CC4 N;  3I0S A;  3V1O A;  2A5X A;  2OAN A;  1HPZ A;  2D0O A;  1JLE A;  2GWK A;  4M7X A;  2CGL A;  1TGO A;  3PIO L;  2P5O A;  3OYB A;  1TUY A;  2G8W A;  4K8X A;  3B8A X;  2O8E A;  3BUZ B;  1RCH A;  1NJY A;  3TAN A;  3K5O A;  1FJG K;  4KI6 A;  2OCE A;  4CJ4 A;  3KLG A;  4ELT A;  2P1J A;  1NG9 A;  1VQ7 N;  2P5G A;  3SV4 A;  4AH9 A;  4PUO A;  1I3A A;  1RIL A;  4DV6 K;  3CJ9 A;  1WAF A;  1MU2 A;  4WFN L;  3VEO A;  2FF3 B;  4PA1 A;  3LAL A;  3K58 A;  1U4B A;  3BDP A;  4XH4 A;  3FZM A;  1B9F A;  2ZGY A;  3DLK A;  4JI2 K;  3C6A A;  3DXK A;  2WON A;  3CCV N;  4DS5 A;  2HBK A;  4H0O A;  5FPM A;  1VQO N;  1SKS A;  1JCF A;  1BIU A;  3J7A P;  3MX2 A;  3IDH A;  4FW1 A;  2H3G X;  1TKD A;  1OH6 A;  3KK7 A;  4AHU A;  4DR5 K;  5EOY A;  3AVL A;  4CBU A;  4BC3 A;  3MN9 A;  3ZX0 A;  4YOW A;  1TK0 A;  4BVP A;  3QEX A;  2OTJ N;  4OPH A;  5IT9 O;  4ZHR A;  2ZGZ A;  4OJR A;  3VGK A;  3KLF A;  1VQP N;  4DQS A;  5C10 A;  3P1G A;  1Q9X A;  3U9D A;  3EN9 A;  1GOA A;  1JKH A;  5JMV A;  4B8A B;  3ZT3 A;  2GV9 A;  1KFS A;  1XUP O;  3DRS A;  2Q2R A;  3CCE N;  4YY3 K;  1X3M A;  3KLI A;  4DV0 K;  5T7B A;  5EVZ A;  1SV5 A;  5AZJ A;  4YOT A;  4GMJ B;  3EE8 A;  2D5R A;  1VRU A;  3SJH A;  4FWK A;  3JYT A;  1JL1 A;  3UB5 A;  2DFE A;  4AHV A;  5AQZ A;  1OVQ A;  4YDU C;  4CJK A;  4HTL A;  4KHP K;  3LDS A;  4A62 A;  4H5V A;  4DTJ A;  3D45 A;  4PL8 A;  2UU9 K;  3I8D A;  1RDA A;  1WSJ A;  1U2V A;  2IGI A;  1HNI A;  4JI6 K;  3P4I A;  1Q8I A;  3UKR B;  1IJJ A;  4Z4E A;  4YOY A;  4WQ5 A;  4BWJ A;  4DFM A;  2NRW A;  4CF1 A;  1XC3 A;  1QVF M;  1S72 N;  5GAH P;  3PLA A;  1W2B M;  4KI4 A;  1HYZ A;  4FLU A;  4FK2 A;  4DKW A;  4BRO A;  1HJO A;  3H46 O;  1RT2 A;  5AQV A;  4DFJ A;  1VQ5 N;  2PY5 A;  4DTM A;  1C1C A;  3J7Y P;  1HNW K;  1KTQ A;  2P9U B;  1YJW N;  1C1A A;  1T3V A;  2VWB A;  4AHC A;  3HP9 A;  1EWQ A;  4YHH K;  2HVH A;  1NGJ A;  1IV0 A;  1XHX A;  3QIO A;  4JV5 K;  1C6V A;  3IRX A;  2P9L A;  3AA4 A;  5AZI B;  4BE0 A;  4KB0 A;  3NMU A;  4GKJ K;  3BZK A;  4C8L A;  4DU1 A;  1SL1 A;  4FJJ A;  2E20 A;  1G15 A;  2Q0R A;  3TWH A;  3L6Q A;  3R1X A;  3EO3 A;  3HRG A;  1N34 K;  3FFK B;  3S9H A;  1N32 K;  2VG7 A;  3WEE B;  1JXB A;  4BVO A;  1RTH A;  2FSK A;  4MO5 A;  3SMS A;  1XQS C;  4XH5 A;  1N33 K;  2IVO A;  3VQQ A;  2YKM A;  4FJH A;  1WN7 A;  3TR8 A;  2KZZ A;  3CM5 A;  1SZ2 A;  2YHY A;  2VWK A;  4PQU A;  3FZK A;  3V9Z A;  1V4T A;  2HHQ A;  4O55 A;  3V1Q A;  2HNY A;  2HF4 A;  4KFB A;  1DKG D;  1NWK A;  3RMA A;  4FCY A;  4CHQ A;  1HKG A;  3AGR A;  3ZSZ A;  4KV8 A;  4KKO A;  1IKW A;  4Z4I A;  5AZJ B;  4Y1D A;  3J8A A;  2FBX A;  3ZEU A;  4F9O A;  1ZXO A;  1GLC G;  2Q97 A;  1RNH A;  3C0B A;  5F2R A;  2YI1 A;  4DQQ A;  4Y0W A;  3AVK A;  3DWL A;  2RE2 A;  4BDY A;  5FPN A;  1BQN A;  3P39 A;  1VQK N;  4RW6 A;  4JN4 A;  1I94 K;  4FM1 A;  4LF7 K;  2Q36 A;  5AQK A;  2P9P A;  4CJV A;  3SBG A;  4FK4 A;  4CK2 A;  3M8R A;  4CZF A;  3K5L A;  4LF8 K;  1QZ6 A;  4GV9 A;  2G8F A;  3V9W A;  3HM8 A;  4DSL A;  3HJF A;  2P9K B;  3N4P A;  3ULE B;  5KPZ A;  1HYV A;  3KTQ A;  5AQL A;  3K5N A;  4RTF D;  2HNZ A;  4PKH A;  4E1M A;  2QA4 N;  1K8K B;  3EL2 A;  4FJ8 A;  2UYT A;  2FLO A;  1N36 K;  2QWR A;  4KTW A;  4CEZ A;  4O0I A;  2YX6 A; 
#chains in the Genus database with same CATH homology
 2FBV A;  3V9U A;  2IC3 A;  2KFN A;  1YTA A;  3TAM A;  4ELU A;  2W42 A;  2R7Y A;  3NGY A;  4JS5 A;  3SPY A;  2HHW A;  4KHQ A;  1GOB A;  4B08 A;  4KAZ A;  4FLV A;  3NCI A;  2BAN A;  4FM2 A;  3RMD A;  4CFA A;  1NK8 A;  1RT6 A;  1VSK A;  3O4N A;  2YHB A;  3QO9 A;  4CJW A;  1RT3 A;  5HRN A;  3CFR A;  3C94 A;  3O4Q A;  3SUN A;  3O3H A;  1UWB A;  3L3U A;  5CZ2 A;  1WNS A;  3AO2 A;  3ZSQ A;  4CEE A;  4CF0 A;  1NKE A;  4NCB A;  3D0P A;  1S1X A;  2RKI A;  4B8C A;  3TAF A;  4EZ9 A;  3AO1 A;  1C1B A;  3VQC A;  4CHY A;  1RBV A;  3FFI A;  1BCM A;  3C95 A;  1LAV A;  4OKK A;  3LWL A;  1VSD A;  3AVI A;  4MFB A;  5EU7 A;  1X9W A;  3KD1 E;  4CER A;  3ZT4 A;  4BDP A;  4I2Q A;  1RDD A;  2QXF A;  3LPT A;  4RW7 A;  3MXJ A;  4YNQ A;  4CFC A;  2YNG A;  3WNG A;  1TKX A;  3CM6 A;  1C0T A;  1XI1 A;  3RR8 A;  1KCF A;  3KK3 A;  2PYL A;  2O4G A;  1L5U A;  3VQB A;  3ZT1 A;  1JLQ A;  1YT3 A;  3SQ2 A;  5CZ1 A;  1WSH A;  1ASU A;  1XWL A;  1D8Y A;  4ELV A;  1VSM A;  1RT1 A;  1DTT A;  3AVN A;  3U6F A;  4B9S A;  4FW2 A;  4J2B A;  1S1W A;  4OPJ A;  3HVR A;  4FZX C;  4HCB A;  2X78 A;  4UQG A;  5HLF A;  4Z4G A;  4MQ3 A;  3EZ5 A;  3ZT2 A;  4M3T A;  3NE6 A;  4FM0 A;  4Z4H A;  4IG3 A;  3S3M A;  3TAG A;  4KTQ A;  2VG5 A;  2XY5 A;  3HL8 A;  1J54 A;  3SUQ A;  3PX4 A;  1S1U A;  3OJU A;  1LWF A;  1RDB A;  4RW9 A;  5JS2 A;  1BI4 B;  1QS4 A;  3QEV A;  2ZQB A;  4QOZ B;  2B6A A;  4KHN A;  1TKT A;  1VSH A;  2F96 A;  2WOM A;  4FVM A;  2RN2 A;  4IFV A;  4FLW A;  4PY5 A;  5HRS A;  4E7H A;  1TKZ A;  3ZSY A;  3NF6 A;  4DU3 A;  1REV A;  2HHS A;  2EX3 A;  1D5A A;  1VRT A;  1WSE A;  3L3V A;  3DRR A;  3LZJ A;  4DTR A;  2IS3 A;  2XY6 A;  4DSK A;  4W5O A;  4HUE A;  3PY8 A;  3NGZ A;  4NCG A;  1TL3 A;  4E7I A;  1T7P A;  2HVI A;  1TVR A;  3ZSW A;  4Q0B A;  3U3G A;  2A1S A;  4M45 A;  3DLB A;  5J2M A;  1NK5 A;  2Q3S A;  3E01 A;  1ZBF A;  1D9D A;  4DTX A;  2E6M A;  1UA0 A;  3P83 D;  4HVJ A;  5FDL A;  3KK2 A;  2IDO A;  3VA3 A;  3I0R A;  3PO4 A;  5C42 A;  2B5J A;  1O1W A;  4CGI A;  4HTU A;  4EP4 A;  1RTD A;  4FLT A;  4DQR A;  4E7K A;  4DFP A;  4CK3 A;  2OPR A;  1VSE A;  4CJU A;  1T8E A;  2OPQ A;  1IG9 A;  4J2D A;  1S6P A;  4FJK A;  4CEB A;  3M8P A;  4DQP A;  5J2N A;  1L3S A;  3EYZ A;  4NCA A;  1QE1 A;  3TI0 A;  4CFB A;  3O3F A;  1X9M A;  2G8H A;  2GUI A;  3AA2 A;  1W9H A;  3QIP A;  4O0J A;  2HW3 A;  2KQ2 A;  3V1R A;  4N56 A;  3KLE A;  4CJF A;  4CHZ A;  4CJE A;  1CXQ A;  4CFD A;  1BIZ A;  3T3F A;  3V4I A;  4CJT A;  4KRF A;  2KZM A;  4KTZ A;  3OYL A;  1S5J A;  1Z25 A;  2D0C A;  2XRI A;  3VA0 A;  1ASW A;  3OYA A;  1HJR A;  3OVN A;  4W5R A;  1VSJ A;  1YVU A;  1RBS A;  4CEA A;  3RRG A;  1UAX A;  1K6Y A;  3TAQ A;  2F8T A;  4KPY A;  4NYF A;  1NKC A;  4C8M A;  2OA8 A;  2YNH A;  3HM9 A;  3VQ4 A;  4J2A A;  3C6T A;  1NK0 A;  4CF2 A;  4DMN A;  1U45 A;  5KGW A;  4I9Q A;  3IAY A;  1ITG A;  4C8N A;  1Q9Y A;  1IKX A;  1KLN A;  3KKR A;  4GVM A;  3AVC A;  4FYD A;  2IAJ A;  2KFZ A;  3CFO A;  4CIG A;  4DLE A;  4ICL A;  2YNF A;  4E7L A;  1EKE A;  2X74 A;  5HBM A;  3VQ6 A;  3NF8 A;  2HB5 A;  2X6N A;  1L3T A;  3LAK A;  5J2P A;  4O44 A;  3OYJ A;  4OKJ A;  4B9N A;  2E4L A;  3O3G A;  2QKB A;  2EHG A;  1A5X A;  4QAG A;  3HO1 A;  1S9E A;  4E0D A;  4RW8 A;  3SCX A;  4J2E A;  3ZSR A;  1D9F A;  3DLG A;  4FZZ A;  4DSF A;  1X1P A;  3OY9 A;  3LZI A;  4M3X A;  3NF7 A;  4I2P A;  2HHT A;  4CGJ A;  4TSX A;  1JLF A;  3H08 A;  3OS0 A;  3ZSO A;  3TAR A;  3ASM A;  4R5P A;  2XY8 A;  3K2P A;  3VQ9 A;  3OYK A;  4EP5 A;  1B9D A;  3DLR A;  4O5B A;  2D0B A;  4DG1 A;  3DRP A;  1WSI A;  3MXM A;  1LW2 A;  5FRN A;  3DYA A;  5KTQ A;  4HUF A;  3CG7 A;  4W5T A;  1KRP A;  4KHY A;  3UIQ A;  3SUO A;  2ITG A;  4CEO A;  5J1E A;  3RMB A;  4PWD A;  3OJS A;  2XO7 A;  1YTU A;  1QSS A;  4FLX A;  3I0S A;  3V1O A;  4DWI A;  4FZY A;  4N5S A;  4Z4F A;  2OZS A;  1HPZ A;  2RPI A;  1JLE A;  4DQI A;  4M3Z A;  1JLG A;  1CZ9 A;  4H8K A;  3NDK A;  4DSI A;  4FJ9 A;  4JS4 A;  1TGO A;  3PO5 A;  1BQM A;  2XHB A;  3V6D A;  3SNN A;  4KHW A;  1IO2 A;  1HNV A;  3SI6 A;  2P5O A;  1TV6 A;  1IH7 A;  2E6L A;  3OYB A;  4BAC A;  2G8W A;  4I7F A;  3SPZ A;  4K8X A;  3RTV A;  3TAE A;  4B9U A;  1RCH A;  1JXE A;  4DS4 A;  1A5W A;  1NJY A;  2G8U A;  3TAN A;  3ULD A;  1KVC A;  3K5O A;  2HHV A;  4CGH A;  3RMC A;  4KI6 A;  4BE2 A;  4Z0U A;  3VQ7 A;  2B4J A;  4E3S A;  2PZS A;  4CJ4 A;  3KLG A;  3K57 A;  3BGR A;  1NJX A;  4ELT A;  2P1J A;  1TK5 A;  2PYJ A;  3AV9 A;  2P5G A;  4JLH A;  4F3T A;  3SV4 A;  2Z1H A;  5I3U A;  2AJQ A;  4DSJ A;  4DFK A;  4AH9 A;  1XHZ A;  4PUO A;  4W5Q A;  4F8R A;  1I3A A;  4ID1 A;  1RIL A;  1WSG A;  3OS1 A;  1F21 A;  4KHS A;  3K59 A;  5DMR A;  4M41 A;  1WAF A;  3DLE A;  1MU2 A;  1CZB A;  4CHO A;  1S9G A;  4RG8 A;  4PA1 A;  3LAL A;  3K58 A;  1U4B A;  3BDP A;  4B9V A;  4B9M A;  3AVG A;  1EX4 A;  4CHN A;  1VSL A;  3KJV A;  1B9F A;  1DLO A;  1S1V A;  3DLK A;  3SUP A;  2Z1G A;  3S3O A;  4ID5 A;  2YKN A;  2WON A;  4LSN A;  4O4G A;  4DU4 A;  4OPK A;  1NK6 A;  1NOZ A;  4DS5 A;  4CK1 A;  1KVA A;  3L2U A;  1C0M A;  4FJI A;  3WNE A;  3TAP A;  1NK4 A;  4GW6 A;  3L8B A;  4DSE A;  4IFY A;  3G10 A;  1NK9 A;  3QEI A;  1SKS A;  1HQE A;  1RTI A;  5CY4 A;  2P51 A;  4HCC A;  1TAU A;  1BIU A;  1JLA A;  2Z1I A;  1QSL A;  3V81 A;  3AVA A;  3HK2 A;  1RTJ A;  2JLE A;  1BGX T;  3SV3 A;  3JSM A;  4FW1 A;  3KLH A;  3CFP A;  5HRO A;  1I39 A;  1TKD A;  3OYH A;  2QK9 A;  2X6S A;  2KW4 A;  4E7J A;  4AHS A;  5JS1 A;  4H4O A;  4BDZ A;  1VSF A;  1U49 A;  5D3G A;  4WE1 A;  3DI6 A;  4AHU A;  3OYI A;  3ISN C;  1ZBH A;  3HVT A;  1TK0 A;  3AVL A;  3LPU A;  4W5N A;  2HHX A;  5KRS A;  3OYC A;  3QET A;  3QEX A;  1NK7 A;  3HP6 A;  2FBY A;  1S6Q A;  4OGE A;  5DK5 A;  4CE9 A;  3OYF A;  1XC9 A;  4N47 A;  4DF4 A;  4CJP A;  1HQU A;  1NJW A;  4KRE A;  3NGI A;  1ZBI A;  2I5J A;  3LAM A;  4AIL C;  3AO4 A;  3NF9 A;  1S1T A;  1A5V A;  4ZHR A;  1SL0 A;  4KO0 A;  4EZ6 A;  3T19 A;  3WNF A;  4OJR A;  3VQP A;  4M3R A;  1KSP A;  3LAN A;  3KLF A;  1SKW A;  4LH5 A;  3VQA A;  4CIE A;  3P1G A;  2YHA A;  4DQS A;  1Q9X A;  4N41 A;  1GOA A;  4Z4C A;  4FJ5 A;  4OLA A;  1JKH A;  2YV0 X;  3LWM A;  2NUB A;  1JLC A;  3ZT3 A;  4B8A B;  2GV9 A;  3U3Y A;  1KFS A;  3DRS A;  4FJ7 A;  3KLI A;  4F4K A;  5T7B A;  1GOC A;  1SV5 A;  4CJ3 A;  5SWM A;  4C8O A;  4FJM A;  5KGX A;  4GMJ B;  3HYF A;  2A1R A;  1HYS A;  4F3O A;  2D5R A;  1VRU A;  1LWC A;  1FXX A;  1RT7 A;  3WNH A;  3HT3 A;  2XY7 A;  1JL2 A;  1W0H A;  3JYT A;  1JL1 A;  2DFE A;  5HRP A;  2HND A;  4AHV A;  4JRP A;  3V9X A;  2JGU A;  4CJK A;  4M42 A;  1WAJ A;  3LDS A;  3KK1 A;  4OLB A;  1FK9 A;  1QQC A;  3VQ8 A;  1BHL A;  1L3U A;  4DTS A;  4DTJ A;  3D45 A;  4IG0 A;  3RWU A;  5HP1 A;  3ALY A;  1QTM A;  4CJL A;  3MEE A;  5E41 A;  3M8Q A;  4IDK A;  4BE1 A;  2Y1J A;  3MED A;  4FJG A;  2O4I A;  3A2F A;  4YFU A;  3I8D A;  1U48 A;  1RDA A;  3RR7 A;  1WSJ A;  4E89 A;  2IGI A;  4CGD A;  1HNI A;  1JLB A;  2FC0 A;  3DOK A;  3B6P A;  1Q8I A;  3VQE A;  1WLJ A;  1ZYQ A;  4Z4E A;  2FBT A;  3QEP A;  3V9S A;  1BIS A;  5CYM A;  4Y1C A;  1KLM A;  4CES A;  1T05 A;  2G8I A;  1QHT A;  2YNI A;  1RBU A;  2ATQ A;  4BWJ A;  4DFM A;  4CF1 A;  3QES A;  5FRM A;  4M3Y A;  4KI4 A;  2BE2 A;  1HYZ A;  4XIU A;  4FLU A;  4FK2 A;  1RT4 A;  1HMV A;  3QIN A;  3THV A;  1DTQ A;  1RT2 A;  4CEQ A;  2Y1I A;  3SQ0 A;  4G1Q A;  3G0Z A;  4DFJ A;  3OYM A;  4H4M A;  3NH1 A;  2BDP A;  4FLY A;  3ZSX A;  2PY5 A;  4KHU A;  4DTM A;  3SQ1 A;  1ZBU A;  1C1C A;  4DTO A;  4B9L A;  4E19 A;  1KTQ A;  4LSL A;  3L2Q A;  1C1A A;  4NYN A;  4LD0 A;  2VWJ A;  4AHC A;  3HP9 A;  3AA5 X;  3B6O A;  1ZBL A;  4CJQ A;  1B92 A;  4B3O A;  1RT5 A;  4CED A;  2HVH A;  1XHX A;  2DFH A;  3OYN A;  3QIO A;  1C6V A;  3IRX A;  4IBN A;  5J2Q A;  3AA4 A;  3LP0 A;  3PX6 A;  1IKY A;  4Q5V A;  4BE0 A;  2Z1J A;  4KB0 A;  3QLH A;  1SUQ A;  5CYQ A;  3MEG A;  4M3W A;  2HMI A;  1LW0 A;  1U04 A;  1Y97 A;  4C8L A;  4DU1 A;  1SL1 A;  4FJJ A;  1G15 A;  3QEW A;  3TWH A;  3AVH A;  3KD5 E;  2ZE2 A;  3ZT0 A;  3NH0 A;  4CIF A;  1NOY A;  4C8K A;  4LY7 A;  2RF2 A;  4LH4 A;  1TK8 A;  3S9H A;  4ZTJ A;  4K8Z A;  4F2R A;  4CEF A;  4IKF A;  1VSI A;  4CGF A;  4FLZ A;  2OPS A;  2VG7 A;  3F9K A;  4BWM A;  2KTQ A;  1JXB A;  4DF8 A;  3ITH A;  3AO3 A;  3HPO A;  2IOC A;  3M8S A;  1RTH A;  3QNN A;  3EY1 A;  3PUF A;  1UA1 A;  4CF9 A;  4DTP A;  1BL3 A;  4RW4 A;  3VQQ A;  2YKM A;  1NKB A;  4FJH A;  1WN7 A;  3LP2 A;  3TR8 A;  3OYE A;  3L2W A;  3NHG A;  4FXD A;  2KZZ A;  1TL1 A;  2OPP A;  3CM5 A;  3OS2 A;  3TAB A;  1U47 A;  3NH2 A;  2VWK A;  4DTN A;  5I42 A;  4PQU A;  4CJ5 A;  1R0A A;  2DTU A;  3V9Z A;  2HHQ A;  3S3N A;  4O55 A;  3V1Q A;  2HNY A;  4L8R B;  4KFB A;  2G8V A;  3SQ4 A;  3NAE A;  3RMA A;  1ASV A;  4FCY A;  4CHQ A;  4AHT A;  3SYZ A;  2LSN A;  4AHR A;  2OZM A;  3KKS A;  1N6Q A;  2GBZ A;  3AO5 A;  3IG1 A;  4KV8 A;  4KKO A;  4OKE A;  3ZSZ A;  3SZ2 A;  1IKW A;  3HPG A;  3P5J A;  3QNO A;  1N5Y A;  4Z4I A;  4Y1D A;  3F73 A;  5KI6 A;  4DLG A;  2FBX A;  3AVF A;  3ZCM A;  5HRR A;  5SZT A;  1LAW A;  3PX0 A;  3IS9 A;  1LV5 A;  1CXU A;  4M3U A;  4FK0 A;  4DTU A;  3DM2 A;  1Z26 A;  4CJR A;  3T1A A;  2VG6 A;  4FJX A;  1RNH A;  3NFA A;  3VQD A;  3MAQ A;  4DQQ A;  1C0U A;  3RRH A;  3CQ8 A;  1SL2 A;  4HUG A;  5KRT A;  3CYM A;  3AVK A;  4F2S A;  4OGC A;  1BI4 A;  3OYD A;  1LWE A;  3L2R A;  4BDY A;  5K14 A;  1BQN A;  3LP1 A;  4HHT A;  4RW6 A;  1SKR A;  4FJL A;  4N76 A;  1L3V A;  4CF8 A;  1FKP A;  4KB1 A;  1KFD A;  1CLQ A;  1J53 A;  4FM1 A;  1HRH A;  4OVL A;  3HXM A;  1TAQ A;  1UOC A;  5C24 A;  2HHU A;  1EXQ A;  4CJV A;  2G8K A;  4FJN A;  4QCL A;  4FK4 A;  3HST B;  3QER A;  1RBR A;  4CK2 A;  3OYG A;  3M8R A;  5C25 A;  3K5L A;  3ZSV A;  3C6U A;  3K5M A;  4E1N A;  1J5O A;  4CCH A;  1X9S A;  2G8F A;  1EET A;  1NJZ A;  3V9W A;  4CHP A;  2OYQ A;  2D0A A;  5FRO A;  4DSL A;  1J9A A;  3DMJ A;  3LP3 A;  3HJF A;  2DFF A;  3DOL A;  1RBT A;  4JRQ A;  2ZD1 A;  2DY4 A;  3MEC A;  1HYV A;  2F8S A;  3KTQ A;  1KVB A;  3AVM A;  2QKK A;  3NBP A;  1EP4 A;  1FKO A;  3AA3 A;  4CEC A;  3MXI A;  1IKV A;  3K5N A;  1BCO A;  3L2V A;  2HNZ A;  3AVB A;  3SJJ A;  4CGG A;  3PV8 A;  3HPH A;  3AVJ A;  4E1M A;  4CJS A;  1VK0 A;  4ZTF A;  4I9L A;  3DLH A;  1RDC A;  4B9T A;  4FJ8 A;  2BGG A;  4KTW A;  3KIO A;  3VN5 A;  2ETJ A;  1QSY A;  4CEZ A;  4O0I A;  3VQ5 A;  1WSF A;  1T03 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...