5KRTA

Hiv-1 integrase catalytic core domain (ccd) in complex with a fragment-derived allosteric inhibitor
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
152
structure length
143
Chain Sequence
b'SSPGIWQLDTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAAWWAGIKQEFGIPYNPGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRGGYSAGERIVDIIATD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title A New Class of Allosteric HIV-1 Integrase Inhibitors Identified by Crystallographic Fragment Screening of the Catalytic Core Domain.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Hydrolase, transferase/inhibitor
total genus 47
structure length 143
sequence length 152
ec nomenclature
pdb deposition date 2016-07-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5krtA00
3V6DA 2IS3A 1NK9A 1LAWA 4C8MA 3QEWA 2B6AA 4CIFA 4FLVA 2VWJA 3ZCMA 1EXQA 3SPYA 4CEOA 3A2FA 1X9WA 1HNVA 1C1AA 4O5BA 1IKVA 2HB5A 4Y1DA 3SPZA 5FDLA 1ZYQA 1VSLA 3QNNA 1TKXA 1QQCA 2B5JA 4FVMA 4CJ4A 2BE2A 1BGXT 4CHOA 4E3SA 3RRHA 3U3GA 5CYMA 4O0IA 1BISA 3SUQA 3VQAA 1RTIA 2KW4A 2E6LA 2XHBA 4M3XA 3VQBA 3C6UA 2HVHA 3OYNA 4IBNA 2X6NA 1KVBA 4B08A 3PX4A 3ZSQA 4ELUA 2XY7A 3U6FA 2G8WA 2KZZA 3K5OA 1RTDA 3ZSVA 1UAXA 3VQ6A 4JLHA 3SZ2A 3ZSOA 3ZT2A 5E41A 4DSJA 4CJKA 4QCLA 3RTVA 3L2RA 5KGXA 1WSFA 4F2SA 1BIUA 1YVUA 3V9WA 4DWIA 4B8CA 4CJEA 1TAUA 3DRPA 5HRPA 2YNIA 3RMAA 1T7PA 3DOLA 4KTQA 4CF8A 3B6OA 4M3RA 3NH1A 1WAJA 4IFVA 4W5NA 4B9LA 3VQ9A 3NAEA 4BE1A 3SQ4A 3SQ1A 4N41A 1B9FA 3TAEA 1QTMA 3F9KA 2X78A 3NF8A 4CF9A 1U45A 4HUGA 1T03A 3RRGA 3HM9A 4CJ3A 1BQNA 4JS5A 2P51A 4J2AA 3LALA 1D9FA 4C8LA 3MEDA 4CGGA 3JSMA 2NUBA 2HMIA 4RW9A 3HPHA 2W42A 3QEXA 1TKDA 2GV9A 4N5SA 4CGIA 4MQ3A 3T1AA 4CGJA 1W0HA 2VG6A 1N6QA 1I39A 3VN5A 4CEBA 2QKKA 4DTOA 3S3OA 1TL3A 1TGOA 4ELTA 3SNNA 4C8KA 4CF2A 3MECA 3CQ8A 3VA3A 1EX4A 4H8KA 3KKRA 4BWMA 4HHTA 2G8HA 4DSIA 2LSNA 3OYIA 3KK3A 1NJXA 1J54A 4B9NA 4Q0BA 2QKBA 3ZSWA 2YKMA 3L2VA 2XY6A 1VSFA 3SI6A 4FJNA 3RR7A 1RTHA 4FM1A 4FM0A 4M42A 5JS1A 1XI1A 4HTUA 1VSKA 4DMNA 4FJMA 1VRUA 2RN2A 4FJ9A 1S9EA 5KI6A 4CFCA 2EX3A 4IG0A 4J2EA 3SJJA 2WOMA 3L2UA 1QHTA 4ELVA 1CLQA 2PZSA 1QS4A 2HHSA 1W9HA 5CYQA 4E1MA 4OLBA 3QO9A 5I42A 3SYZA 3PV8A 3SV3A 4J2DA 4O4GA 1U48A 1HYZA 4JRPA 3TAPA 3AVAA 2HHWA 1KFSA 3AVLA 5KRSA 4FJJA 3F73A 3S9HA 4FLTA 4KI6A 1S1XA 4HCCA 3V1QA 4KI4A 4FJGA 2KZMA 4KB0A 5HRRA 3ISNC 4LH5A 3DYAA 4FLYA 4WE1A 4PQUA 4XIUA 2ITGA 1R0AA 4KPYA 2YHBA 3ZSZA 2BGGA 1ASVA 4DTMA 4CF0A 1TKTA 3LP2A 2R7YA 3PUFA 4IKFA 3LZIA 4G1QA 4I2QA 4JS4A 1SKRA 3OYHA 3DMJA 4Z4GA 1HYVA 3SV4A 3OVNA 3VQCA 1KLNA 4BACA 4I9LA 1RT1A 1SUQA 3OS2A 4ZTFA 2HNYA 2GBZA 3DLRA 4RW4A 4CECA 3OYBA 3RMDA 3IS9A 3AO4A 2OPSA 4HUFA 3ZSYA 3HYFA 3ULDA 3HVRA 3KIOA 4E89A 4CHQA 1BIZA 3P83D 1L5UA 4B9UA 2A1SA 1J9AA 1UA0A 1SL0A 1LAVA 2OPQA 1RILA 4CE9A 1NJWA 1C1BA 1FK9A 1WSGA 3AA3A 3HVTA 3NH2A 3PX6A 4LSNA 3DLEA 1EKEA 3I0RA 5T7BA 4GVMA 2HW3A 3ZT1A 1QSYA 2AJQA 4CEEA 3D45A 3DRRA 3UIQA 4FJHA 2OYQA 4CEFA 4FLXA 1JL2A 1VSMA 3OYGA 4IG3A 1U49A 4DTSA 1KSPA 2OA8A 4EZ6A 4KAZA 2FC0A 1J5OA 3K59A 3AO5A 4E7LA 1NJYA 5CY4A 4CFAA 1MU2A 4KB1A 1RTJA 2FBTA 3AVGA 1X1PA 1TV6A 4CEZA 3L8BA 1BI4A 4CJPA 1U4BA 1SKSA 4B3OA 3LP1A 1TKZA 5HP1A 4KHNA 3HK2A 2EHGA 5FROA 4CJ5A 4DQQA 3TWHA 1JXBA 3HPGA 2Z1JA 1RDAA 1RT4A 1HYSA 3V9SA 5J2NA 1LV5A 3MAQA 3KJVA 5KRTA 3QEPA 4DQSA 4KTZA 4PA1A 1IKYA 4Z0UA 1ZBFA 4C8OA 4CIGA 1HNIA 3ALYA 3RR8A 3DOKA 1S6PA 4CJTA 4GMJB 4DLGA 4ICLA 4DU4A 1RBTA 3RMCA 3TI0A 1NKEA 1CXUA 1JLBA 1RT5A 4CJSA 1D5AA 1TK5A 3QLHA 1XHZA 1K6YA 1WN7A 1F21A 2Y1IA 3KD5E 4M3WA 4F8RA 4FZXC 2DFEA 2XY5A 4KTWA 1S5JA 1NK4A 4RW7A 3C6TA 4AHRA 3G10A 5HRSA 4KHWA 3K57A 4O0JA 1GOBA 1RBSA 4CIEA 1BCMA 1T05A 2HHTA 5HRNA 2XO7A 4E7IA 1ASUA 1RT2A 3CFRA 5HLFA 1XHXA 5EU7A 4M45A 3D0PA 4AH9A 3DLKA 3NF6A 4B8AB 3OYKA 2YNGA 1DTTA 4FLUA 3VQ4A 3MXJA 3QIOA 4NYFA 1VSHA 3DM2A 4CHPA 1VSDA 4CFBA 4KHQA 3TAFA 3NCIA 1HQUA 2IOCA 2ZE2A 4CHNA 4DTNA 4DFJA 3H08A 1YTUA 4OPJA 4K8XA 3AVFA 4CESA 3KLHA 3PX0A 3ZSXA 4E7HA 1A5XA 1HPZA 1KVAA 4OJRA 4DS5A 4KHYA 3HO1A 2KFZA 3CG7A 2ATQA 3K5LA 3TAGA 3M8PA 1WSJA 3AVCA 4Q5VA 1G15A 2F8TA 3V9UA 3OS0A 1VSIA 3NE6A 2YV0X 3K2PA 5KGWA 1S1WA 3QETA 1L3UA 3O3HA 2G8IA 2OZMA 1NK7A 3SCXA 1RT6A 4DU1A 1JXEA 1FXXA 3S3MA 1RBUA 5SZTA 5I3UA 3QERA 3C94A 1FKOA 3IG1A 3TARA 4FZYA 1REVA 3HP6A 1C0UA 3P1GA 5CZ1A 4I2PA 1T8EA 3KTQA 2QK9A 3WNGA 4FJLA 1NOZA 5FRMA 1Z25A 2RF2A 1GOAA 1KLMA 4CF1A 1L3TA 1CZBA 3TR8A 4W5OA 3L3UA 3KD1E 4AHTA 1JL1A 4H4MA 1NKCA 2ZQBA 3QIPA 3NHGA 4KV8A 1IKWA 3VA0A 4FJ5A 4ZHRA 2HHXA 1RBRA 1TAQA 1X9MA 4AHVA 1QSSA 4CEAA 4KFBA 4FK2A 3NGYA 3VQQA 4Z4IA 3LDSA 4N47A 3HP9A 3ZSRA 3V9ZA 4BE2A 1S1UA 2P1JA 4CJWA 2Y1JA 1CXQA 4M3YA 3HSTB 3L3VA 1ASWA 3G0ZA 3LPUA 3EZ5A 1IO2A 1ZBHA 2IC3A 4OPKA 4FCYA 3T3FA 1Z26A 1TL1A 3ZT4A 2FBXA 3VQ8A 1C0MA 1RDBA 4CHZA 1EP4A 3O4QA 1IG9A 3AVKA 3OYEA 3QNOA 3KLFA 3I8DA 3AVBA 3QEIA 5HBMA 4OKKA 1A5VA 4H4OA 3CM5A 4Z4CA 1WSIA 3NDKA 3SUNA 3OYDA 4BDYA 4EP4A 3O3FA 1QSLA 3K5NA 3SQ0A 1RNHA 4K8ZA 2IAJA 3KKSA 4CFDA 3ZT3A 5DMRA 2VWKA 1DLOA 2YNHA 3HPOA 4N76A 3O4NA 3LWMA 4DU3A 1JLCA 2OZSA 4Z4HA 3L2WA 1KRPA 4CJQA 3AO3A 4CK2A 2B4JA 4FLZA 1B9DA 3M8SA 2D5RA 4DSEA 1SL1A 3KLEA 4CEQA 3CFPA 4KRFA 4L8RB 1WSEA 3MXMA 3RWUA 3ZT0A 4M3TA 1BHLA 5J2MA 2O4IA 2KFNA 4BE0A 4OKEA 1VSJA 5C42A 4W5TA 3O3GA 1O1WA 5JS2A 4JRQA 1RBVA 4DTJA 2DTUA 1U04A 1C1CA 3M8RA 1NK6A 3FFIA 3DLHA 1WNSA 2G8UA 3WNEA 5HROA 5D3GA 3AO2A 4CGHA 5SWMA 4DF4A 4DSKA 3AA2A 3QINA 4KREA 2OPPA 3JYTA 3NF7A 3PY8A 4PY5A 1QE1A 1A5WA 3DLGA 4BWJA 3THVA 3NH0A 1NOYA 1LW0A 3TAQA 4PUOA 1BI4B 2WONA 4DS4A 5DK5A 4ZTJA 1DTQA 4QAGA 4FJ8A 1RDDA 4F4KA 3OYLA 2BANA 1UWBA 2YNFA 2FBVA 4ID1A 3K5MA 4FLWA 3QESA 4W5QA 1S6QA 1N5YA 4M3UA 3V4IA 4E1NA 2G8KA 4R5PA 3RMBA 4FJIA 1ZBLA 3L2QA 1VRTA 4DFMA 3LZJA 2F96A 2P5GA 3KLGA 2PY5A 2OPRA 3NFAA 4FW2A 3TABA 1JLQA 3M8QA 1S1VA 2PYLA 1FKPA 1VSEA 4KO0A 1I3AA 4LY7A 4YNQA 5J1EA 3HJFA 4RW6A 4BDPA 3CYMA 1TK8A 4FK4A 1ITGA 1WSHA 4CERA 4CJFA 1NK0A 1JLEA 2X74A 4MFBA 4B9VA 4OKJA 1Y97A 3E01A 3AVNA 2Z1IA 4DQIA 4DTRA 4CGFA 4KKOA 4B9TA 3EY1A 2QXFA 1TVRA 1X9SA 1XWLA 5J2PA 5KTQA 1NKBA 1LW2A 2HVIA 4KHUA 2D0BA 2IGIA 2Z1GA 4FZZA 3U3YA 3AA5X 4DFKA 4FJKA 3TANA 3IRXA 4DLEA 1JLFA 3AA4A 2G8FA 3LAKA 3QEVA 1SL2A 4F3OA 4Z4FA 5K14A 1WLJA 3NF9A 2JGUA 3VQPA 1KTQA 4FW1A 4ID5A 5J2QA 5C25A 5CZ2A 3LP0A 4DSLA 1C6VA 3OJUA 2G8VA 2DFFA 3LAMA 5FRNA 1D8YA 4NCBA 4CGDA 4NCGA 4LD0A 2XRIA 3KK1A 3AVHA 3OYJA 2HHVA 2ZD1A 4DTPA 4I7FA 3NGIA 4CEDA 4BDZA 1S9GA 4DFPA 1D9DA 3AVMA 4Y1CA 1SV5A 3LPTA 1ZBUA 3AO1A 4AHUA 3HL8A 2RKIA 1NK8A 1EETA 1HMVA 4E19A 3AV9A 1U47A 2FBYA 3VQ7A 4DSFA 4YFUA 3HXMA 2D0CA 2I5JA 4F2RA 1C0TA 2X6SA 5C24A 4AILC 3SUPA 4E0DA 4NCAA 3K58A 4I9QA 1IH7A 2DFHA 1JKHA 3OYAA 3SUOA 2HNZA 4CK3A 4HUEA 3KK2A 3SQ2A 4LSLA 3DI6A 4UQGA 1J53A 1UA1A 1CZ9A 3VQEA 1ZBIA 3TAMA 2BDPA 1HQEA 3VQ5A 3EYZA 4Z4EA 3HT3A 3CFOA 4N56A 1XC9A 1B92A 3MXIA 4GW6A 3LWLA 1IKXA 4B9SA 2P5OA 4KHSA 4IDKA 4AHSA 3ASMA 1SKWA 4J2BA 3V1OA 1KFDA 3KLIA 1YT3A 4QOZB 4LH4A 1L3VA 2O4GA 3DLBA 3OYCA 3V9XA 1Q9XA 2ETJA 3DRSA 3MEEA 3VQDA 4CJVA 4CK1A 3V81A 4PWDA 1JLGA 1UOCA 2KQ2A 3WNFA 3OJSA 3B6PA 4AHCA 3OYMA 1NJZA 2RPIA 4DQPA 3P5JA 4F3TA 4CJUA 4DG1A 2YHAA 2A1RA 3PO4A 4FYDA 4C8NA 4FJ7A 4O44A 1S1TA 4HVJA 1JLAA 1LWFA 2HHUA 2PYJA 1TK0A 1HRHA 1LWCA 2IDOA 4EZ9A 4FJXA 1VK0A 4O55A 2YKNA 3MEGA 3LANA 1BCOA 1KVCA 3T19A 2Q3SA 4CHYA 4HCBA 1YTAA 2XY8A 1GOCA 1BL3A 3NGZA 1HJRA 1BQMA 4OVLA 4M3ZA 2JLEA 3WNHA 4OGEA 3OY9A 2VG7A 4E7KA 3IAYA 2GUIA 3I0SA 4RW8A 4TSXA 4EP5A 4W5RA 3ITHA 4IFYA 3OS1A 1RCHA 3OYFA 4FXDA 1KCFA 1RT3A 1NK5A 2KTQA 3V1RA 4B9MA 3AVIA 1Q8IA 3S3NA 4DF8A 1L3SA 4FK0A 3BDPA 2E4LA 4CCHA 4DTXA 4E7JA 2D0AA 2F8SA 4NYNA 1LWEA 4FM2A 4M41A 2HHQA 3C95A 2Z1HA 3NBPA 1RDCA 2HNDA 1RT7A 2DY4A 3AVJA 4DQRA 4OLAA 2E6MA 3PO5A 1Q9YA 1WAFA 2VG5A 4OGCA 4CJRA 3BGRA 4CJLA 3LP3A 3CM6A 4RG8A 4DTUA
chains in the Genus database with same CATH superfamily
2IS3A 1NK9A 3VTHA 4IFEA 4CIFA 3SPYA 3ZCMA 1OH8A 5JMVA 1HNVA 1C1AA 2Q2RA 4O5BA 5FDLA 1VSLA 4CZEA 2B5JA 2O8BA 1YF5L 3CJ1A 3EL2A 3RRHA 5AQOA 1BISA 3SUQA 4Y0WA 2HVHA 1BA1A 2XY7A 2YHYA 2G8WA 3K5OA 3ZSVA 3SZ2A 2NRXA 4QCLA 3L2RA 5KGXA 4IO8A 1BIUA 1YVUA 1QZ6A 3DRPA 4DR7K 1VHXA 1WAJA 4BGAA 4W5NA 4FOIA 3CJCA 3NAEA 4BE1A 1X3MA 2QM1A 3SQ1A 3VESA 1NGDA 3CCMN 3F9KA 4CBWA 4CJ3A 2YI1A 1BU6O 2P51A 3DWLA 3CF5L 1GLEG 3MEDA 4YDUC 1W97L 4N5SA 4BVOA 4JKBA 4CGIA 4DV3K 1N6QA 1I39A 4CEBA 2QWQA 4L3QA 3EE9A 5JLHA 4BRLA 1TGOA 3SBGA 3SNNA 3BEXA 4CF2A 1EX4A 4H8KA 3KKRA 3OYIA 3KK3A 1GLAG 4OO1J 1K8KA 2XY6A 1VSFA 3VF6A 3O9RA 3CMAN 4FM1A 1XI1A 1KD1O 1YXQA 4DMNA 1RDUA 3A8YA 1S9EA 3ENBA 4IG0A 4ELVA 1EQYA 1QHTA 1QS4A 5BRFA 1N34K 1TYQB 3QO9A 1NGIA 4LF6K 5I9EB 1P8ZA 2A40A 3P4IA 4J2DA 2P9IB 3TAPA 3AVAA 1KFSA 4FWLA 1S1XA 3ZX2A 5TKYA 1DKGD 4CJ7A 1QHAA 1R0AA 2BGGA 4CF0A 4FWOA 1ZC6A 2ASOA 4I2QA 3JS6A 3WEEB 1SKRA 3SV4A 3ZETA 1RT1A 1TUUA 3AAQA 3ULDA 5AFUA 3BDPA 4HUFA 1L5UA 1BIZA 1J9AA 1LAVA 5BN9A 2ZGYA 1FK9A 4PKIA 3NH2A 1X9MA 1KLNA 3DLEA 4UY8O 4DQ8A 2O8BB 3CCEN 2OYQA 4DV4K 1VSMA 2OA8A 4DTSA 2PBDA 4JI7K 2KKZA 5CY4A 2HBJA 1RTJA 2FBTA 4CEZA 5FPDA 4FWSA 5GAHP 4A62A 2EHGA 2ZJQL 1LOTB 1RT4A 1DEJA 1X9JA 5KRTA 4PA1A 5GINA 3TI0A 4I6MB 3RMCA 4RWTA 3J81O 3LM9A 4CJSA 1K6YA 1WN7A 3KD5E 2YCHA 4M3WA 4LFAK 1S5JA 3D2EA 4CZJA 3IMXA 4KHWA 4DR4K 3OBYA 1RBSA 3U9ZA 4CIEA 4E7IA 1YUWA 5HLFA 4MLEA 4B8AB 1DTTA 3MXJA 1VSHA 4CHPA 1VSDA 4JI2K 3VEWA 3TAFA 2IOCA 4DTNA 4DFJA 3D7EO 3AVFA 3BP8A 1HPZA 4KHYA 4KH6A 4AM7A 2F8TA 3T1YK 3NE6A 4JI1K 3WXMB 2YV0X 3QETA 3E9LA 2G8IA 2OZMA 1NK7A 4DU1A 1JXEA 2V51B 5SZTA 4JI6K 5EY4A 3DAWA 4FZYA 1K8KB 4B9QA 4JV5K 1T8EA 5C0YA 2ASMA 1Z25A 2RHKA 3MCPA 4H4MA 2ZQBA 4JEPA 2UU9K 1RBRA 2CGLA 4AHVA 4KFBA 3VQQA 2IVNA 1S1UA 1CXQA 4KBOA 4LF8K 5BN8A 3G0ZA 3EZ5A 1TL1A 2HBMA 3VQ8A 2A41A 5AQIA 2OANA 3OYEA 3QNOA 3KLFA 3I8DA 4HTLA 3QEIA 5HBMA 3C6AA 4B3TK 2E2PA 3SMPA 1HNXK 3OYDA 4BDYA 4NXMK 3KKSA 5DMRA 4DR5K 3ZETB 3HPOA 4DU3A 1JLCA 3L2WA 2E20A 1NGBA 4CK2A 5EOYA 4DSEA 2D5RA 2IIRA 3KLEA 4CEQA 3CCJN 5C15A 4L8RB 3RWUA 1GLBG 2O4IA 4OKEA 4W5TA 4JRQA 1RBVA 1U04A 3LL3A 5HROA 3AO2A 1NU0A 4DSKA 3AA2A 2E2NA 3NF7A 3DLGA 4BWJA 3NH0A 3VEOA 1NOYA 1LW0A 3TAQA 1JCGA 3R1XA 2WC9A 3OYLA 4FLWA 1N5YA 2FBVA 3K5MA 4W5QA 1HKCA 1S6QA 2YJEA 3FZMA 2UUAK 3HSCA 1VRTA 2A5XA 3NFAA 3TABA 3LM2A 1JLQA 1S1VA 1G99A 1W2BM 1FKPA 1VSEA 2VGMA 5F1XA 1Q7YO 3HJFA 3D2EB 4BDPA 5AQGA 3THWA 1QVGM 2X74A 5JVGL 4OKJA 1ZXOA 5LMNK 2Z1IA 4DQIA 3LDPA 4CGFA 1TVRA 1X9SA 1XWLA 5J2PA 4FZZA 2D0BA 4DFKA 3UKRA 3F5TA 3H6EA 2I7PA 3AA4A 3L6QA 3LAKA 4WYBA 4F3OA 4Z4FA 1VQON 5AFUH 3VF4A 1MDUB 3TU5A 3TTDA 1KTQA 1WBBA 4FW1A 3CC2N 1C6VA 2E2OA 3LAMA 3BF1A 5FRNA 1D8YA 4NCBA 4LD0A 3KK1A 4DTPA 4KH5A 5H1SQ 3AARA 3LPTA 3AO1A 3HL8A 1HMVA 4E19A 3AV9A 3OTOK 2CH6A 4BRKA 2X6SA 4E0DA 4BC5A 3SUOA 3KK2A 4DR1K 4UQGA 1OVYA 5M1NA 3VQEA 3C65A 3TAMA 2GELA 3EYZA 4V19S 3MXIA 2P5OA 1IKXA 4B9SA 4GV9A 1SKWA 3ASMA 4R79A 4J2BA 1KFDA 4BREA 4LF5K 3O6WA 1YJNN 5JICA 1L3VA 3DLBA 1LCUA 4WQ5A 4PWDA 1XC3A 3O5BA 4CK1A 2KQ2A 3E66A 3OYMA 1NJZA 4DQPA 5AQUA 2E88A 3CQXA 4YOUA 5AZIA 1JLAA 1LWFA 2FSKA 4XH4A 2PYJA 1TK0A 4ISEA 3SBTA 1KVCA 4BR5A 5GADP 1HJRA 3JXUA 3O9UA 4OVLA 4M3ZA 1ATNA 5HL7L 1S3XA 1SQKA 1P90A 4TSXA 3GG4A 3ITHA 1D4XA 3K9KA 1RCHA 4FXDA 2KTQA 1NK5A 4B9MA 4IJAA 2FF6A 4GNIA 1NGGA 4FK0A 2BUPA 4H03B 4CCHA 4E7JA 3WQUA 2D0AA 4YOXA 2F8SA 4FM2A 2YHXA 2Z1HA 1RT7A 3AVJA 1ZBSA 3FE1A 4FWMA 2GWKA 3PO5A 4OGCA 1QQMA 4CJLA 3V6DA 1LAWA 4QS9A 4B1VA 3QEWA 2B6AA 2VWJA 1BG3A 4PHTX 3NVKA 3SPZA 3QNNA 1TKXA 1IV0A 1BGXT 3EEQA 4CHOA 2QWRA 2NZTA 3VQAA 1RTIA 2E6LA 1IBLK 3O9QA 4IBNA 1KVBA 3THWB 4B3MK 3BY5A 3U6FA 5HOOA 1RTDA 3VQ6A 4X66K 3ZSOA 4CJKA 2AA4A 3O1WA 4CZGA 1WSFA 3FZFA 4F2SA 1Q82O 4A2AA 3V9WA 3UKRB 1N33K 1TAUA 5HRPA 3RMAA 3C7NA 3ID6A 4CF8A 3B6OA 4M3RA 3NH1A 3VPZA 3BZKA 2ASPA 4IFVA 2P9KA 5AJ3K 1T6DA 3VQ9A 3SQ4A 2A6AA 1B9FA 2X78A 4CF9A 3O80A 4DV2K 1T03A 4JS5A 1D9FA 1K73O 5BR8K 4CGGA 3EN9A 2HMIA 4RW9A 3HPHA 4DR6K 2O8EA 4H5TA 1NM1A 1W0HA 2VG6A 1VQ8N 1TL3A 4C8KA 3VA3A 5AQJA 4HHTA 4DSIA 2NRZA 2NRTA 1NJXA 1M1KO 3ZSWA 3IDHA 3L2VA 2I7NA 3SI6A 4FJNA 3VEXA 4K25A 1RTHA 5ADXH 5JS1A 1VSKA 2NLXA 3CD6N 3VEZA 4BR0A 2Q36A 5AZIB 4CFCA 2EX3A 4J2EA 2WOMA 2PZSA 1Z6RA 5CYQA 4DHYA 4E1MA 1WUAA 3SYZA 4EIAA 1HYZA 2HHWA 4BR4A 3S9HA 4KI6A 1HKGA 3V1QA 4FJGA 4KB0A 1HJOA 4WE1A 2ITGA 2YHBA 1GLJO 3G25A 1ASVA 4DTMA 3ZLJA 1TKTA 3LP2A 2R7YA 3PUFA 3T7ZA 3PIOL 4JS4A 5BRHA 3OYHA 3DMJA 1HYVA 3OVNA 3A5LC 2W41A 3VQCA 4BACA 2QWPA 4RW4A 1YI2N 3IS9A 3EKSA 2OPSA 4CHQA 3P83D 5KPRA 4B9UA 2A1SA 1RILA 2UXDK 3AA3A 1WSGA 3HVTA 4CD1A 5T7BA 2HW3A 2AJQA 2HOEA 4CEEA 3DRRA 3UIQA 4FLXA 4EZ6A 4IG3A 1J5OA 4E7LA 4CD3A 1C0GA 1TV6A 1K9MO 1BI4A 4CJPA 4B3OA 4CZKA 1TKZA 4CJ5A 3JAMO 4DQQA 3TWHA 1JXBA 3HPGA 3R8EA 2Z1JA 3NMUA 4XH5A 5J2NA 3QEPA 1IKYA 3HOTA 1KC8O 2HMPA 1HNIA 3ZX0A 3C7NB 3DOKA 4CJTA 4DLGA 4GMJB 1NKEA 4LF4K 1R59O 1RT5A 4NLBA 1D5AA 1VQNN 1XHZA 2UXBK 3QICA 3UB5A 2P9KB 1NK4A 4C1NI 3C6TA 3G10A 1O13A 1H1VA 5AQMA 3K57A 1T3VA 2KHOA 1GOBA 4O0JA 4AQYK 1BCMA 1T05A 5HRNA 1C0FA 1ASUA 3O1BA 4LFCK 1XHXA 4B3RK 4M45A 3L4QA 3DLKA 3NF6A 3OYKA 1NMDA 2UXCK 4FSVA 2O8EB 2ZE2A 4BGBA 3H08A 1XMQK 3PX0A 4E7HA 5M1OA 2KFZA 2HBKA 2YHWA 3TAGA 3CJ9A 1WSJA 3AVCA 1T44A 3K2PA 1S1WA 3MN9A 3WXKA 1FXXA 2KLAA 3IG1A 3VEVA 1REVA 3P1GA 2P9UB 4H0YB 2QK9A 4IEEA 3WNGA 1NOZA 2D0OA 2AP1A 1KLMA 4CF1A 1L3TA 1CZBA 4W5OA 1ATRA 5AQZA 3VTIA 3WT0A 4KV8A 2VWBA 4WQ4A 4H5RA 1BO5O 5C2FA 3EE8A 2WTUA 4CEAA 4FK2A 3WXJA 3LDLA 4N47A 3V9ZA 2Y1JA 3L3VA 1ZBHA 1IO2A 5GAEP 4WFNL 4OPKA 1KXPA 2W40A 3ZT4A 2FBXA 3UKUB 1C0MA 2IVPA 4CHZA 5AQLA 3VERA 2O8DA 3AVKA 2QA4N 3AVBA 2HHHK 3AY9A 1VQ9N 2NRWA 3TSQA 3O9SA 4CFDA 2VWKA 4H5VA 1X3NA 5C12A 4JNEA 4CJQA 1SL1A 2B4JA 1B9DA 4QS8A 4WFBL 3BZCA 4DUYK 4KRFA 3O8MA 3ULEA 3UE5A 5KPTA 1QQNA 4BE0A 3QFPA 1VSJA 5C42A 3O3GA 5JS2A 4IZ9A 3PSFA 2DTUA 4BG8A 2G8UA 3W0LA 1WB9A 2QTDA 3MX2A 4CGHA 5SWMA 4NXNK 4BVPA 4KREA 2RE2A 1QE1A 3IUCA 2P9LA 4PUOA 1BI4B 2WONA 5BRDA 5A2QO 3G4SN 4DS4A 4JD2A 2BANA 4ISGA 1UWBA 2YNFA 1NLVA 3H46O 4E1NA 1ZBLA 3L2QA 3LZJA 2P5GA 4FW2A 1XNQK 3SJHA 2CH5A 2H3GX 2PYLA 1BUPA 1I3AA 3MCAB 4MO4A 4FK4A 3CYMA 3THXA 2Q31A 1ITGA 1NK0A 3VEYA 1JLEA 4MFBA 2QXLA 3E01A 1TUYA 3AVNA 4B9TA 4KKOA 3H1QA 3SLCA 1NKBA 4KHUA 2IGIA 2Z1GA 3MMVA 3U3YA 3GBTA 2UUBK 4IEIA 5AQNA 4DKWA 4DLEA 4FO0A 1SL2A 4LF9K 5FLXO 3O9TA 3NF9A 3VQPA 5C25A 3CC7N 3OJUA 2G8VA 2NRRA 3AVHA 3ZYYX 5AQPA 4BDZA 2GUPA 3AVMA 4Y1CA 1SV5A 1SS6A 4CZIA 5AQFA 1NK8A 1DGKN 5LY3A 1U47A 1QVFM 3PLAA 4YFUA 3MX5A 4JI4K 2I5JA 1C0TA 4I9QA 3H3OB 2DFHA 5CR4A 1HNZK 2HNZA 3THYA 3SQ2A 3DI6A 4B1WB 1CZ9A 1HQEA 2O8FA 1U6ZA 3VQ5A 4Z4EA 4N56A 3HOSA 4BC3A 4KHSA 3DJCA 2E8AA 4FWRA 4WFAL 3V1OA 2Q0UA 5AQTA 3R3LA 1Y64A 2ETJA 3DRSA 3MEEA 3WNFA 4XH1A 2O8DB 3P5JA 4F3TA 4IOAL 4IO9L 4C8NA 4FJ7A 1S1TA 1BWFO 3FGUA 4A61A 1VK0A 3MEGA 3T19A 4CHYA 1YTAA 3ZEUA 1OH5A 2JLEA 3OY9A 2QWLA 3PSIA 4E7KA 4RW8A 4W5RA 4EP5A 3OS1A 1KCFA 1RT3A 3V1RA 3ULEB 4CZMA 1Q8IA 4DF8A 2Q1NA 3CPWM 3PIPL 3NBPA 1RDCA 4IOXA 1Q81O 2DY4A 4XEIA 3EKUA 4JN4A 4DQRA 3VGMA 1WBDA 2Q97A 2VG5A 4CJRA 2P9LB 4BRCA 4JD2B 4C8MA 4FLVA 1EXQA 2QWNA 1X9WA 3DLLL 4YOWA 2HB5A 1ZYQA 4FVMA 2BE2A 3AGKA 5CYMA 1EWRA 4ILJA 2XHBA 3TSPA 3C6UA 5ADXA 3THXB 3HZ6A 3ZSQA 3FZLA 1UAXA 5BR9A 1BDGA 3J7AP 4CJEA 5KQDA 3IKMA 4KTQA 5DM6L 2F9WA 4C1NK 2YX6A 3QBXA 4DV1K 4B9LA 4N41A 4FWNA 3G71N 1QTMA 4FVUA 3NF8A 1U45A 4JK8A 5BPLA 1BQNA 5AQKA 4J2AA 2NUBA 3QB0A 4H0OA 3A0IX 1TKDA 4JI5K 2ZF5O 3T1AA 3VN5A 3SK3A 3A5OC 2P9NA 2QKKA 4KHPK 4DTOA 1XUPO 4ELTA 4LC9B 3CQ8A 1S72N 2JWKA 2G8HA 3CC4N 5FPNA 3OHRA 2FSNA 1SAZA 4B9NA 2QKBA 1HPMA 4OPHA 5JLFA 2YKMA 1U2VA 4JHDA 1KAYA 2V7ZA 3LDQA 4CZHA 5AQRA 1VQ4N 3L4IA 1VRUA 2RN2A 4FJ9A 5JVHL 5M1PA 4JKDA 1CLQA 3L2UA 2HHSA 5E84A 4IOCL 1XNRK 2V52B 4K41A 5B8HA 2Q0RA 2A42A 3PV8A 3SV3A 3ZEUB 1N8RO 3AVLA 5EVZA 3T1HK 4FJJA 3CHWA 4HCCA 4DR2K 2GTDA 3ISNC 4FLYA 3DYAA 3LDOA 4B1YB 1JCEA 4FL9A 4XIUA 3GOIA 4IKFA 1VQKN 4G1QA 4IXCA 1KAZA 4Z4GA 2A3ZA 3FZHA 1SUQA 3OS2A 4ZTFA 1NGJA 2HNYA 4CECA 3OYBA 3RMDA 3AO4A 3ZSYA 3HYFA 3M3ZA 3KIOA 1HNWK 4BC4A 2OPQA 1NGAA 3PX6A 3I0RA 1EKEA 3ZT1A 3D45A 4AF1A 4A5BA 1JL2A 3OYGA 1U49A 4MDBA 3S41A 4H0VB 3K59A 1J5EK 4CFAA 4K0KK 3AVGA 1X1PA 1U4BA 1SKSA 3LP1A 1E4FT 5FROA 3WXLA 4BRMA 1RDAA 1HYSA 3V9SA 3KJVA 1NBWA 3U9DA 4KTZA 1ZBFA 2GEMA 3M1FA 4FJHA 4KAZA 1E3MA 1GLFO 2FLOA 1CXUA 1JLBA 1TK5A 1IBMK 3QLHA 3N4QA 1F21A 2Y1IA 4F8RA 4JAXA 4DV7K 3GL1A 4AHRA 4FWQA 2ITMA 1RGIA 3CPEA 2HHTA 2XO7A 1RT2A 3CFRA 1BOTO 3Q7CA 5EU7A 3D0PA 3CJAA 3VQ4A 3QIOA 4NYFA 5LJWA 3DM2A 4CFBA 1HQUA 4CHNA 4DR3K 3B8AX 4CESA 3ZSXA 4JKCA 1A5XA 1KVAA 4OJRA 3HO1A 2P9NB 3FFKB 3CG7A 3M8PA 4Q5VA 1G15A 5AQWA 3OS0A 3V9UA 5KGWA 1L3UA 4GV3A 3SCXA 3CJBA 1YJ9N 1RBUA 1YVNA 3C94A 1FKOA 3TARA 1U2VB 5AQVA 4JHDB 3KTQA 4I2PA 3ZX3A 2WBNA 5FRMA 2RF2A 1GOAA 3ENHA 4FPAA 1XMOK 3KD1E 1K8AO 4AHTA 3ENOA 1NKCA 1VQ7N 3NHGA 1IKWA 4CBUA 4DUZK 4ZHRA 2VQEK 1QSSA 3NGYA 3G6EN 3LDSA 1ATSA 3HP9A 2HSTA 3ZSRA 2P1JA 4CJWA 4M3YA 2W6LA 4GY2B 1ASWA 3DXKA 4A59A 3VGKA 5KQ8A 3T3FA 3BUZB 5E26A 2NNWA 3RSEA 1RDBA 1EP4A 3O4QA 2FSJA 2VCPA 3MDQA 4Z4CA 1WSIA 4PKHA 5BREA 4K8ZA 4EP4A 3O3FA 3SQ0A 4BRQA 2IAJA 4BR7A 4O8KA 1E4GT 1DLOA 2YNHA 4N76A 2VYPA 4Z4HA 3QBWA 3FLCO 1M90O 2HF4A 1NGEA 1WSEA 4M3TA 5J2MA 1O1WA 3M8RA 3TTFA 3WNEA 4CZFA 4F9OA 4M7XA 3WEEA 4LF7K 4CW7B 3CCVN 4DF4A 3HTVA 3QINA 4BRHA 3TPQA 3PY8A 4PY5A 3THVA 1DTQA 4QAGA 1RDDA 4JKEA 4ID1A 3QESA 4M3UA 2D0PA 3V4IA 2OTJN 5F0XA 2G8KA 4FJIA 3SAFA 3RMBA 1JCFA 2F96A 4WQ5C 2PY5A 2OPRA 1MA9B 4JI8K 4DB3A 5M1KA 4H0TB 4KO0A 4LY7A 5J1EA 1VQ5N 4RW6A 5M1FA 4BROA 1WSHA 4CERA 4CJFA 1Y97A 4FOEA 4B1XB 3EY1A 2QXFA 2HVIA 5IWAK 4JI0K 4FPBA 1EO1A 3AA5X 1XQSC 3TANA 3IRXA 4I6MA 4H5NA 2G8FA 3QEVA 5K14A 2JGUA 2PAVA 5ELZA 5J2QA 4DSLA 2DFFA 4CGDA 2XRIA 3OYJA 2HHVA 3HBTA 2ZD1A 4C8OA 3NGIA 4CEDA 4DFPA 5MLCQ 4AHUA 2RKIA 1HUXA 1ILYA 2ZGZA 3HXMA 4NCAA 1VAZA 1JKHA 4HUEA 3J7ZO 1UA1A 1J53A 3MN5A 5KPZA 3HT3A 3CCRN 5AZJA 1XC9A 1NGFA 1YITN 3LWLA 2ZJRL 2QEXN 4AHSA 1OVQA 2QWMA 4BRDA 2HF3A 3DXKB 4LH4A 1HX1A 3HRGA 2QWOA 2O4GA 4K42A 4CJVA 4JKHA 3V81A 1CZAN 1UOCA 3RSEB 4EHTA 1NWKA 3MK6A 3B6PA 3OJSA 4AHCA 4CJUA 4DG1A 3FR0A 3CJ7A 3L0QA 1LWCA 2YKNA 3LANA 4BRIA 2Q3SA 2HBLA 1BL3A 1GOCA 3NGZA 4OX9K 1NJIO 5AR0A 1YJWN 3C0BA 5LMUK 3IAYA 2GUIA 3I0SA 3OYFA 3P38A 4IFYA 1T6CA 5BPNA 1KAXA 3S3NA 5C2DA 4BC2A 5GAGP 4DTXA 3HM8A 4RCHA 2W6KA 4E1JA 3ID8A 4NYNA 1LWEA 2E1ZA 2HHQA 2IVOA 4BRFA 3CI5A 4B1UB 4EFHA 4OLAA 1Q9YA 1VQPN 3QDKA 4RG8A 1T7PA 1NGHA 4NLCA 2QW9A 1MWKA 5AQXA 4DCHA 4CEOA 3A2FA 1HKBA 1IKVA 3M5RA 4Y1DA 5DM7L 4YOTA 4G9ZA 1N36K 1QQCA 1HLUA 3EZWA 4CJ4A 3K0SA 4E3SA 2E2QA 4BY9C 3U3GA 4O0IA 2KW4A 3EO3A 4M3XA 3VQBA 3OYNA 2X6NA 4B08A 3PX4A 3D2FA 2CGKA 4ELUA 2KZZA 1FJGK 2FF3B 4JLHA 3ZT2A 5E41A 4DSJA 4FWPA 3RTVA 3C6HA 1WOQA 1N32K 4DWIA 4DV5K 4B8CA 4BRAA 3KWIA 4JKFA 2YNIA 4GVEA 3DOLA 4BQLA 1QQOA 2FXUA 3VETA 3KWGA 4A5AA 4DV6K 5GIPA 3TAEA 3AGRA 3RVCA 4HUGA 3RRGA 1GLLO 3HM9A 3U4LA 3SAGA 2P9SA 3LALA 3P31A 4C8LA 3MN7A 3JSMA 2W42A 3VMFB 3QEXA 4NB4A 2GV9A 4MQ3A 3MWTA 4CGJA 2OCEA 3S3OA 5AZJB 4O5FA 3MECA 4BWMA 2LSNA 2BTFA 1J54A 4Q0BA 4K43A 3P39A 4WF9L 3H45C 3RR7A 3W3DA 5AQQA 1Q86O 1W7AA 2F4VK 4FM0A 4M42A 4HTUA 4FJMA 3DXMA 5KI6A 3SJJA 4EAHD 3GDQA 1W9HA 3E9PA 4OLBA 1QZ5A 4JKAA 4CBXA 4EHUA 5CHIA 5I42A 4WCEL 3KZBA 4O4GA 1U48A 3CCLN 4IWVA 4J8FA 4JRPA 5KRSA 2PFUA 4U67L 3F73A 4FLTA 5EXWA 5IT9O 3MWPA 3TSUA 1IBKK 4KI4A 2KZMA 5HRRA 4LH5A 3J8AA 2DPNA 4PQUA 3KVGA 2YJFA 4KPYA 3ZSZA 4ILHA 5M1QA 3LZIA 2EWSA 4QS7A 3CIPA 1IJJA 4X64K 4I9LA 4YORA 1NNEA 3O08A 3WQTA 3DLRA 2GBZA 2HHXA 3HVRA 4E89A 1SL0A 1UA0A 1HR0K 4FWKA 4CE9A 1YIJN 2E5LK 1NJWA 4ILGB 1C1BA 3OA9A 3CETA 4LSNA 3CCUN 4GVMA 1QSYA 2QI2A 4H0PA 4CEFA 1KSPA 2FC0A 3AO5A 1NJYA 2BH1A 4WQ4C 1MU2A 4KB1A 3D2FB 3D6RA 3L8BA 3WUHA 3O4WA 5HP1A 4KHNA 3VF2A 3HK2A 3CXCM 1LV5A 4OPAA 3MAQA 4B1ZA 4DQSA 2GWJA 1Q18A 4Z0UA 4CIGA 3ALYA 3RR8A 1NGCA 1NMNA 1S6PA 4DU4A 4ICLA 4MLHA 1RBTA 1KQSM 2V7YA 4C23A 4YHHK 4B3SK 2DFEA 2ZWHA 4FZXC 2XY5A 4KTWA 5AQSA 2D4WA 4RW7A 1OH6A 3VGLA 5HRSA 4A57A 5C10A 3R6MA 2P9PA 3ATVA 5AQYA 4AH9A 2YNGA 4FLUA 2P9SB 3QFUA 4A2BA 1S22A 4KHQA 5LL6Z 3NCIA 1YHQN 4X62K 2OTLN 1YTUA 3E1YA 4OPJA 1V4TA 4K8XA 3KLHA 3A5NC 3THYB 4DS5A 4NO7A 2ATQA 3K5LA 3H1VX 2O8FB 1VSIA 1VQ6N 3O3HA 3CERA 1RDWX 4KH4A 1RT6A 2CGJA 3S3MA 1OH7A 5I3UA 3QERA 3HP6A 1C0UA 5CZ1A 4FJLA 4Z94A 1J6ZA 3TR8A 3DXMB 3WXIA 4H0XB 3L3UA 1JL1A 2VGNA 3QIPA 4M7YA 3I56N 3VA0A 4FJ5A 1TAQA 4HWIA 3CMEN 4Z4IA 4BE2A 4CZLA 2NRHA 3HSTB 2GX9A 3LPUA 2IC3A 4FCYA 1Z26A 3K9JA 2WUSA 3MN6A 1IG9A 4RTFD 1YAGA 4JK7A 3Q7BA 4OKKA 4DV0K 1A5VA 4H4OA 3CM5A 3NDKA 3SUNA 1QSLA 3K5NA 1RNHA 3BF3A 3ZT3A 3O4NA 3LWMA 2OZSA 4PKGA 4BR2A 1KRPA 4FLZA 3AO3A 3M8SA 3CCQN 4U7BA 3I8BA 3CFPA 4JI3K 4YDUA 3MXMA 3ZT0A 4ISFA 4AM6A 1BHLA 2KFNA 3TTCA 4JKGA 3E9OA 3R9PA 4DTJA 3J80O 3SAHA 4CVNE 1C1CA 1NK6A 3FFIA 3DLHA 1WNSA 5D3GA 2NRVA 3IFRA 2O8CA 5FPMA 2OPPA 3JYTA 1A5WA 2E1YA 5DK5A 5GIOA 4ZTJA 4FJ8A 4F4KA 2F9TA 1Z05A 3KK7A 4CI6A 1GLDG 4BQZA 4GKKK 4R5PA 4DFMA 3KLGA 5EX5A 4LFBK 4PL7A 3HI0A 3M8QA 5F2RA 3A5MC 1RFQA 4YNQA 1FW6A 1TK8A 4B9VA 4BR9A 5CE3A 2JWLA 1VQLN 2P9PB 4BG9A 4DTRA 2UUCK 5AQHA 4YOYA 3CCSN 1JJ2M 3J7YP 5KTQA 4O8UA 1LW2A 3OBWA 4YOVA 4FJKA 3I33A 1JLFA 4M63C 1WLJA 3H3NO 3LDNA 4ID5A 5CZ2A 3LP0A 1DT9A 4BRNA 3I55N 4JK9A 1MWMA 4GV6A 4NCGA 3ATUA 4I7FA 1OKJA 1D9DA 1S9GA 4MDAA 3OW2M 3NVMA 2VQFK 2WFBA 1ZBUA 1SZ2A 1EETA 2FBYA 2D1KA 1ESVA 3VQ7A 4DSFA 3U8XA 4F2RA 2D0CA 4H5WA 4AILC 3SUPA 1IG8A 5C24A 3N4PA 3K58A 1IH7A 3OYAA 3VOVA 5LJVA 4CK3A 4LSLA 3F9MA 2ZM6K 1ZBIA 2BDPA 2J4RA 3CFOA 4PL8A 4IJNA 1B92A 4GW6A 4BRPA 4IDKA 5BPMA 3KLIA 4QOZB 1YT3A 3KHYA 3CQYA 2P9UA 3QMLA 4GKJK 1NG9A 3OYCA 3V9XA 1Q9XA 3VQDA 5TKWA 4BRGA 1JLGA 2RPIA 2YHAA 2A1RA 3PO4A 4FYDA 4O44A 4HVJA 3M6GA 2HHUA 3FZKA 4EZ9A 1HRHA 1TYQA 2IDOA 1VQMN 4FJXA 4O55A 1BCOA 4HCBA 2XY8A 1BQMA 2P9IA 2UYTA 3WNHA 4OGEA 2VG7A 3T69A 3UKUA 3AAPA 1EWQA 3AVIA 4IDHA 1BA0A 4YY3K 1I94K 1V4SA 1L3SA 4JKGB 3F2KA 2E4LA 4X65K 3GE1A 5FPEA 4M41A 4MO5A 4JYAK 3C95A 2HNDA 1GLCG 2O8CB 2E6MA 2ZJPL 3SMSA 2F7TA 1WAFA 3BGRA 3VENA 3LP3A 3CM6A 4DTUA
chains in the Genus database with same CATH topology
3V6DA 2IS3A 1NK9A 1LAWA 4C8MA 3QEWA 2B6AA 4CIFA 4FLVA 2VWJA 3ZCMA 1EXQA 3SPYA 4CEOA 3A2FA 1X9WA 1HNVA 1C1AA 4O5BA 1IKVA 2HB5A 4Y1DA 3SPZA 5FDLA 1ZYQA 1VSLA 3QNNA 1TKXA 1QQCA 2B5JA 4FVMA 4CJ4A 2BE2A 1BGXT 4CHOA 4E3SA 3RRHA 3U3GA 5CYMA 4O0IA 1BISA 3SUQA 3VQAA 1RTIA 2KW4A 2E6LA 2XHBA 4M3XA 3VQBA 3C6UA 2HVHA 3OYNA 4IBNA 2X6NA 1KVBA 4B08A 3PX4A 3ZSQA 4ELUA 2XY7A 3U6FA 2G8WA 2KZZA 3K5OA 1RTDA 3ZSVA 1UAXA 3VQ6A 4JLHA 3SZ2A 3ZSOA 3ZT2A 5E41A 4DSJA 4CJKA 4QCLA 3RTVA 3L2RA 5KGXA 1WSFA 4F2SA 1BIUA 1YVUA 3V9WA 4DWIA 4B8CA 4CJEA 1TAUA 3DRPA 5HRPA 2YNIA 3RMAA 1T7PA 3DOLA 4KTQA 4CF8A 3B6OA 4M3RA 3NH1A 1WAJA 4IFVA 4W5NA 4B9LA 3VQ9A 3NAEA 4BE1A 3SQ4A 3SQ1A 4N41A 1B9FA 3TAEA 1QTMA 3F9KA 2X78A 3NF8A 4CF9A 1U45A 4HUGA 1T03A 3RRGA 3HM9A 4CJ3A 1BQNA 4JS5A 2P51A 4J2AA 3LALA 1D9FA 4C8LA 3MEDA 4CGGA 3JSMA 2NUBA 2HMIA 4RW9A 3HPHA 2W42A 3QEXA 1TKDA 2GV9A 4N5SA 4CGIA 4MQ3A 3T1AA 4CGJA 1W0HA 2VG6A 1N6QA 1I39A 3VN5A 4CEBA 2QKKA 4DTOA 3S3OA 1TL3A 1TGOA 4ELTA 3SNNA 4C8KA 4CF2A 3MECA 3CQ8A 3VA3A 1EX4A 4H8KA 3KKRA 4BWMA 4HHTA 2G8HA 4DSIA 2LSNA 3OYIA 3KK3A 1NJXA 1J54A 4B9NA 4Q0BA 2QKBA 3ZSWA 2YKMA 3L2VA 2XY6A 1VSFA 3SI6A 4FJNA 3RR7A 1RTHA 4FM1A 4FM0A 4M42A 5JS1A 1XI1A 4HTUA 1VSKA 4DMNA 4FJMA 1VRUA 2RN2A 4FJ9A 1S9EA 5KI6A 4CFCA 2EX3A 4IG0A 4J2EA 3SJJA 2WOMA 3L2UA 1QHTA 4ELVA 1CLQA 2PZSA 1QS4A 2HHSA 1W9HA 5CYQA 4E1MA 4OLBA 3QO9A 5I42A 3SYZA 3PV8A 3SV3A 4J2DA 4O4GA 1U48A 1HYZA 4JRPA 3TAPA 3AVAA 2HHWA 1KFSA 3AVLA 5KRSA 4FJJA 3F73A 3S9HA 4FLTA 4KI6A 1S1XA 4HCCA 3V1QA 4KI4A 4FJGA 2KZMA 4KB0A 5HRRA 3ISNC 4LH5A 3DYAA 4FLYA 4WE1A 4PQUA 4XIUA 2ITGA 1R0AA 4KPYA 2YHBA 3ZSZA 2BGGA 1ASVA 4DTMA 4CF0A 1TKTA 3LP2A 2R7YA 3PUFA 4IKFA 3LZIA 4G1QA 4I2QA 4JS4A 1SKRA 3OYHA 3DMJA 4Z4GA 1HYVA 3SV4A 3OVNA 3VQCA 1KLNA 4BACA 4I9LA 1RT1A 1SUQA 3OS2A 4ZTFA 2HNYA 2GBZA 3DLRA 4RW4A 4CECA 3OYBA 3RMDA 3IS9A 3AO4A 2OPSA 4HUFA 3ZSYA 3HYFA 3ULDA 3HVRA 3KIOA 4E89A 4CHQA 1BIZA 3P83D 1L5UA 4B9UA 2A1SA 1J9AA 1UA0A 1SL0A 1LAVA 2OPQA 1RILA 4CE9A 1NJWA 1C1BA 1FK9A 1WSGA 3AA3A 3HVTA 3NH2A 3PX6A 4LSNA 3DLEA 1EKEA 3I0RA 5T7BA 4GVMA 2HW3A 3ZT1A 1QSYA 2AJQA 4CEEA 3D45A 3DRRA 3UIQA 4FJHA 2OYQA 4CEFA 4FLXA 1JL2A 1VSMA 3OYGA 4IG3A 1U49A 4DTSA 1KSPA 2OA8A 4EZ6A 4KAZA 2FC0A 1J5OA 3K59A 3AO5A 4E7LA 1NJYA 5CY4A 4CFAA 1MU2A 4KB1A 1RTJA 2FBTA 3AVGA 1X1PA 1TV6A 4CEZA 3L8BA 1BI4A 4CJPA 1U4BA 1SKSA 4B3OA 3LP1A 1TKZA 5HP1A 4KHNA 3HK2A 2EHGA 5FROA 4CJ5A 4DQQA 3TWHA 1JXBA 3HPGA 2Z1JA 1RDAA 1RT4A 1HYSA 3V9SA 5J2NA 1LV5A 3MAQA 3KJVA 5KRTA 3QEPA 4DQSA 4KTZA 4PA1A 1IKYA 4Z0UA 1ZBFA 4C8OA 4CIGA 1HNIA 3ALYA 3RR8A 3DOKA 1S6PA 4CJTA 4GMJB 4DLGA 4ICLA 4DU4A 1RBTA 3RMCA 3TI0A 1NKEA 1CXUA 1JLBA 1RT5A 4CJSA 1D5AA 1TK5A 3QLHA 1XHZA 1K6YA 1WN7A 1F21A 2Y1IA 3KD5E 4M3WA 4F8RA 4FZXC 2DFEA 2XY5A 4KTWA 1S5JA 1NK4A 4RW7A 3C6TA 4AHRA 3G10A 5HRSA 4KHWA 3K57A 4O0JA 1GOBA 1RBSA 4CIEA 1BCMA 1T05A 2HHTA 5HRNA 2XO7A 4E7IA 1ASUA 1RT2A 3CFRA 5HLFA 1XHXA 5EU7A 4M45A 3D0PA 4AH9A 3DLKA 3NF6A 4B8AB 3OYKA 2YNGA 1DTTA 4FLUA 3VQ4A 3MXJA 3QIOA 4NYFA 1VSHA 3DM2A 4CHPA 1VSDA 4CFBA 4KHQA 3TAFA 3NCIA 1HQUA 2IOCA 2ZE2A 4CHNA 4DTNA 4DFJA 3H08A 1YTUA 4OPJA 4K8XA 3AVFA 4CESA 3KLHA 3PX0A 3ZSXA 4E7HA 1A5XA 1HPZA 1KVAA 4OJRA 4DS5A 4KHYA 3HO1A 2KFZA 3CG7A 2ATQA 3K5LA 3TAGA 3M8PA 1WSJA 3AVCA 4Q5VA 1G15A 2F8TA 3V9UA 3OS0A 1VSIA 3NE6A 2YV0X 3K2PA 5KGWA 1S1WA 3QETA 1L3UA 3O3HA 2G8IA 2OZMA 1NK7A 3SCXA 1RT6A 4DU1A 1JXEA 1FXXA 3S3MA 1RBUA 5SZTA 5I3UA 3QERA 3C94A 1FKOA 3IG1A 3TARA 4FZYA 1REVA 3HP6A 1C0UA 3P1GA 5CZ1A 4I2PA 1T8EA 3KTQA 2QK9A 3WNGA 4FJLA 1NOZA 5FRMA 1Z25A 2RF2A 1GOAA 1KLMA 4CF1A 1L3TA 1CZBA 3TR8A 4W5OA 3L3UA 3KD1E 4AHTA 1JL1A 4H4MA 1NKCA 2ZQBA 3QIPA 3NHGA 4KV8A 1IKWA 3VA0A 4FJ5A 4ZHRA 2HHXA 1RBRA 1TAQA 1X9MA 4AHVA 1QSSA 4CEAA 4KFBA 4FK2A 3NGYA 3VQQA 4Z4IA 3LDSA 4N47A 3HP9A 3ZSRA 3V9ZA 4BE2A 1S1UA 2P1JA 4CJWA 2Y1JA 1CXQA 4M3YA 3HSTB 3L3VA 1ASWA 3G0ZA 3LPUA 3EZ5A 1IO2A 1ZBHA 2IC3A 4OPKA 4FCYA 3T3FA 1Z26A 1TL1A 3ZT4A 2FBXA 3VQ8A 1C0MA 1RDBA 4CHZA 1EP4A 3O4QA 1IG9A 3AVKA 3OYEA 3QNOA 3KLFA 3I8DA 3AVBA 3QEIA 5HBMA 4OKKA 1A5VA 4H4OA 3CM5A 4Z4CA 1WSIA 3NDKA 3SUNA 3OYDA 4BDYA 4EP4A 3O3FA 1QSLA 3K5NA 3SQ0A 1RNHA 4K8ZA 2IAJA 3KKSA 4CFDA 3ZT3A 5DMRA 2VWKA 1DLOA 2YNHA 3HPOA 4N76A 3O4NA 3LWMA 4DU3A 1JLCA 2OZSA 4Z4HA 3L2WA 1KRPA 4CJQA 3AO3A 4CK2A 2B4JA 4FLZA 1B9DA 3M8SA 2D5RA 4DSEA 1SL1A 3KLEA 4CEQA 3CFPA 4KRFA 4L8RB 1WSEA 3MXMA 3RWUA 3ZT0A 4M3TA 1BHLA 5J2MA 2O4IA 2KFNA 4BE0A 4OKEA 1VSJA 5C42A 4W5TA 3O3GA 1O1WA 5JS2A 4JRQA 1RBVA 4DTJA 2DTUA 1U04A 1C1CA 3M8RA 1NK6A 3FFIA 3DLHA 1WNSA 2G8UA 3WNEA 5HROA 5D3GA 3AO2A 4CGHA 5SWMA 4DF4A 4DSKA 3AA2A 3QINA 4KREA 2OPPA 3JYTA 3NF7A 3PY8A 4PY5A 1QE1A 1A5WA 3DLGA 4BWJA 3THVA 3NH0A 1NOYA 1LW0A 3TAQA 4PUOA 1BI4B 2WONA 4DS4A 5DK5A 4ZTJA 1DTQA 4QAGA 4FJ8A 1RDDA 4F4KA 3OYLA 2BANA 1UWBA 2YNFA 2FBVA 4ID1A 3K5MA 4FLWA 3QESA 4W5QA 1S6QA 1N5YA 4M3UA 3V4IA 4E1NA 2G8KA 4R5PA 3RMBA 4FJIA 1ZBLA 3L2QA 1VRTA 4DFMA 3LZJA 2F96A 2P5GA 3KLGA 2PY5A 2OPRA 3NFAA 4FW2A 3TABA 1JLQA 3M8QA 1S1VA 2PYLA 1FKPA 1VSEA 4KO0A 1I3AA 4LY7A 4YNQA 5J1EA 3HJFA 4RW6A 4BDPA 3CYMA 1TK8A 4FK4A 1ITGA 1WSHA 4CERA 4CJFA 1NK0A 1JLEA 2X74A 4MFBA 4B9VA 4OKJA 1Y97A 3E01A 3AVNA 2Z1IA 4DQIA 4DTRA 4CGFA 4KKOA 4B9TA 3EY1A 2QXFA 1TVRA 1X9SA 1XWLA 5J2PA 5KTQA 1NKBA 1LW2A 2HVIA 4KHUA 2D0BA 2IGIA 2Z1GA 4FZZA 3U3YA 3AA5X 4DFKA 4FJKA 3TANA 3IRXA 4DLEA 1JLFA 3AA4A 2G8FA 3LAKA 3QEVA 1SL2A 4F3OA 4Z4FA 5K14A 1WLJA 3NF9A 2JGUA 3VQPA 1KTQA 4FW1A 4ID5A 5J2QA 5C25A 5CZ2A 3LP0A 4DSLA 1C6VA 3OJUA 2G8VA 2DFFA 3LAMA 5FRNA 1D8YA 4NCBA 4CGDA 4NCGA 4LD0A 2XRIA 3KK1A 3AVHA 3OYJA 2HHVA 2ZD1A 4DTPA 4I7FA 3NGIA 4CEDA 4BDZA 1S9GA 4DFPA 1D9DA 3AVMA 4Y1CA 1SV5A 3LPTA 1ZBUA 3AO1A 4AHUA 3HL8A 2RKIA 1NK8A 1EETA 1HMVA 4E19A 3AV9A 1U47A 2FBYA 3VQ7A 4DSFA 4YFUA 3HXMA 2D0CA 2I5JA 4F2RA 1C0TA 2X6SA 5C24A 4AILC 3SUPA 4E0DA 4NCAA 3K58A 4I9QA 1IH7A 2DFHA 1JKHA 3OYAA 3SUOA 2HNZA 4CK3A 4HUEA 3KK2A 3SQ2A 4LSLA 3DI6A 4UQGA 1J53A 1UA1A 1CZ9A 3VQEA 1ZBIA 3TAMA 2BDPA 1HQEA 3VQ5A 3EYZA 4Z4EA 3HT3A 3CFOA 4N56A 1XC9A 1B92A 3MXIA 4GW6A 3LWLA 1IKXA 4B9SA 2P5OA 4KHSA 4IDKA 4AHSA 3ASMA 1SKWA 4J2BA 3V1OA 1KFDA 3KLIA 1YT3A 4QOZB 4LH4A 1L3VA 2O4GA 3DLBA 3OYCA 3V9XA 1Q9XA 2ETJA 3DRSA 3MEEA 3VQDA 4CJVA 4CK1A 3V81A 4PWDA 1JLGA 1UOCA 2KQ2A 3WNFA 3OJSA 3B6PA 4AHCA 3OYMA 1NJZA 2RPIA 4DQPA 3P5JA 4F3TA 4CJUA 4DG1A 2YHAA 2A1RA 3PO4A 4FYDA 4C8NA 4FJ7A 4O44A 1S1TA 4HVJA 1JLAA 1LWFA 2HHUA 2PYJA 1TK0A 1HRHA 1LWCA 2IDOA 4EZ9A 4FJXA 1VK0A 4O55A 2YKNA 3MEGA 3LANA 1BCOA 1KVCA 3T19A 2Q3SA 4CHYA 4HCBA 1YTAA 2XY8A 1GOCA 1BL3A 3NGZA 1HJRA 1BQMA 4OVLA 4M3ZA 2JLEA 3WNHA 4OGEA 3OY9A 2VG7A 4E7KA 3IAYA 2GUIA 3I0SA 4RW8A 4TSXA 4EP5A 4W5RA 3ITHA 4IFYA 3OS1A 1RCHA 3OYFA 4FXDA 1KCFA 1RT3A 1NK5A 2KTQA 3V1RA 4B9MA 3AVIA 1Q8IA 3S3NA 4DF8A 1L3SA 4FK0A 3BDPA 2E4LA 4CCHA 4DTXA 4E7JA 2D0AA 2F8SA 4NYNA 1LWEA 4FM2A 4M41A 2HHQA 3C95A 2Z1HA 3NBPA 1RDCA 2HNDA 1RT7A 2DY4A 3AVJA 4DQRA 4OLAA 2E6MA 3PO5A 1Q9YA 1WAFA 2VG5A 4OGCA 4CJRA 3BGRA 4CJLA 3LP3A 3CM6A 4RG8A 4DTUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V6D A;  2IS3 A;  1NK9 A;  1LAW A;  4C8M A;  3QEW A;  2B6A A;  4CIF A;  4FLV A;  2VWJ A;  3ZCM A;  1EXQ A;  3SPY A;  4CEO A;  3A2F A;  1X9W A;  1HNV A;  1C1A A;  4O5B A;  1IKV A;  2HB5 A;  4Y1D A;  3SPZ A;  5FDL A;  1ZYQ A;  1VSL A;  3QNN A;  1TKX A;  1QQC A;  2B5J A;  4FVM A;  4CJ4 A;  2BE2 A;  1BGX T;  4CHO A;  4E3S A;  3RRH A;  3U3G A;  5CYM A;  4O0I A;  1BIS A;  3SUQ A;  3VQA A;  1RTI A;  2KW4 A;  2E6L A;  2XHB A;  4M3X A;  3VQB A;  3C6U A;  2HVH A;  3OYN A;  4IBN A;  2X6N A;  1KVB A;  4B08 A;  3PX4 A;  3ZSQ A;  4ELU A;  2XY7 A;  3U6F A;  2G8W A;  2KZZ A;  3K5O A;  1RTD A;  3ZSV A;  1UAX A;  3VQ6 A;  4JLH A;  3SZ2 A;  3ZSO A;  3ZT2 A;  5E41 A;  4DSJ A;  4CJK A;  4QCL A;  3RTV A;  3L2R A;  5KGX A;  1WSF A;  4F2S A;  1BIU A;  1YVU A;  3V9W A;  4DWI A;  4B8C A;  4CJE A;  1TAU A;  3DRP A;  5HRP A;  2YNI A;  3RMA A;  1T7P A;  3DOL A;  4KTQ A;  4CF8 A;  3B6O A;  4M3R A;  3NH1 A;  1WAJ A;  4IFV A;  4W5N A;  4B9L A;  3VQ9 A;  3NAE A;  4BE1 A;  3SQ4 A;  3SQ1 A;  4N41 A;  1B9F A;  3TAE A;  1QTM A;  3F9K A;  2X78 A;  3NF8 A;  4CF9 A;  1U45 A;  4HUG A;  1T03 A;  3RRG A;  3HM9 A;  4CJ3 A;  1BQN A;  4JS5 A;  2P51 A;  4J2A A;  3LAL A;  1D9F A;  4C8L A;  3MED A;  4CGG A;  3JSM A;  2NUB A;  2HMI A;  4RW9 A;  3HPH A;  2W42 A;  3QEX A;  1TKD A;  2GV9 A;  4N5S A;  4CGI A;  4MQ3 A;  3T1A A;  4CGJ A;  1W0H A;  2VG6 A;  1N6Q A;  1I39 A;  3VN5 A;  4CEB A;  2QKK A;  4DTO A;  3S3O A;  1TL3 A;  1TGO A;  4ELT A;  3SNN A;  4C8K A;  4CF2 A;  3MEC A;  3CQ8 A;  3VA3 A;  1EX4 A;  4H8K A;  3KKR A;  4BWM A;  4HHT A;  2G8H A;  4DSI A;  2LSN A;  3OYI A;  3KK3 A;  1NJX A;  1J54 A;  4B9N A;  4Q0B A;  2QKB A;  3ZSW A;  2YKM A;  3L2V A;  2XY6 A;  1VSF A;  3SI6 A;  4FJN A;  3RR7 A;  1RTH A;  4FM1 A;  4FM0 A;  4M42 A;  5JS1 A;  1XI1 A;  4HTU A;  1VSK A;  4DMN A;  4FJM A;  1VRU A;  2RN2 A;  4FJ9 A;  1S9E A;  5KI6 A;  4CFC A;  2EX3 A;  4IG0 A;  4J2E A;  3SJJ A;  2WOM A;  3L2U A;  1QHT A;  4ELV A;  1CLQ A;  2PZS A;  1QS4 A;  2HHS A;  1W9H A;  5CYQ A;  4E1M A;  4OLB A;  3QO9 A;  5I42 A;  3SYZ A;  3PV8 A;  3SV3 A;  4J2D A;  4O4G A;  1U48 A;  1HYZ A;  4JRP A;  3TAP A;  3AVA A;  2HHW A;  1KFS A;  3AVL A;  5KRS A;  4FJJ A;  3F73 A;  3S9H A;  4FLT A;  4KI6 A;  1S1X A;  4HCC A;  3V1Q A;  4KI4 A;  4FJG A;  2KZM A;  4KB0 A;  5HRR A;  3ISN C;  4LH5 A;  3DYA A;  4FLY A;  4WE1 A;  4PQU A;  4XIU A;  2ITG A;  1R0A A;  4KPY A;  2YHB A;  3ZSZ A;  2BGG A;  1ASV A;  4DTM A;  4CF0 A;  1TKT A;  3LP2 A;  2R7Y A;  3PUF A;  4IKF A;  3LZI A;  4G1Q A;  4I2Q A;  4JS4 A;  1SKR A;  3OYH A;  3DMJ A;  4Z4G A;  1HYV A;  3SV4 A;  3OVN A;  3VQC A;  1KLN A;  4BAC A;  4I9L A;  1RT1 A;  1SUQ A;  3OS2 A;  4ZTF A;  2HNY A;  2GBZ A;  3DLR A;  4RW4 A;  4CEC A;  3OYB A;  3RMD A;  3IS9 A;  3AO4 A;  2OPS A;  4HUF A;  3ZSY A;  3HYF A;  3ULD A;  3HVR A;  3KIO A;  4E89 A;  4CHQ A;  1BIZ A;  3P83 D;  1L5U A;  4B9U A;  2A1S A;  1J9A A;  1UA0 A;  1SL0 A;  1LAV A;  2OPQ A;  1RIL A;  4CE9 A;  1NJW A;  1C1B A;  1FK9 A;  1WSG A;  3AA3 A;  3HVT A;  3NH2 A;  3PX6 A;  4LSN A;  3DLE A;  1EKE A;  3I0R A;  5T7B A;  4GVM A;  2HW3 A;  3ZT1 A;  1QSY A;  2AJQ A;  4CEE A;  3D45 A;  3DRR A;  3UIQ A;  4FJH A;  2OYQ A;  4CEF A;  4FLX A;  1JL2 A;  1VSM A;  3OYG A;  4IG3 A;  1U49 A;  4DTS A;  1KSP A;  2OA8 A;  4EZ6 A;  4KAZ A;  2FC0 A;  1J5O A;  3K59 A;  3AO5 A;  4E7L A;  1NJY A;  5CY4 A;  4CFA A;  1MU2 A;  4KB1 A;  1RTJ A;  2FBT A;  3AVG A;  1X1P A;  1TV6 A;  4CEZ A;  3L8B A;  1BI4 A;  4CJP A;  1U4B A;  1SKS A;  4B3O A;  3LP1 A;  1TKZ A;  5HP1 A;  4KHN A;  3HK2 A;  2EHG A;  5FRO A;  4CJ5 A;  4DQQ A;  3TWH A;  1JXB A;  3HPG A;  2Z1J A;  1RDA A;  1RT4 A;  1HYS A;  3V9S A;  5J2N A;  1LV5 A;  3MAQ A;  3KJV A;  5KRT A;  3QEP A;  4DQS A;  4KTZ A;  4PA1 A;  1IKY A;  4Z0U A;  1ZBF A;  4C8O A;  4CIG A;  1HNI A;  3ALY A;  3RR8 A;  3DOK A;  1S6P A;  4CJT A;  4GMJ B;  4DLG A;  4ICL A;  4DU4 A;  1RBT A;  3RMC A;  3TI0 A;  1NKE A;  1CXU A;  1JLB A;  1RT5 A;  4CJS A;  1D5A A;  1TK5 A;  3QLH A;  1XHZ A;  1K6Y A;  1WN7 A;  1F21 A;  2Y1I A;  3KD5 E;  4M3W A;  4F8R A;  4FZX C;  2DFE A;  2XY5 A;  4KTW A;  1S5J A;  1NK4 A;  4RW7 A;  3C6T A;  4AHR A;  3G10 A;  5HRS A;  4KHW A;  3K57 A;  4O0J A;  1GOB A;  1RBS A;  4CIE A;  1BCM A;  1T05 A;  2HHT A;  5HRN A;  2XO7 A;  4E7I A;  1ASU A;  1RT2 A;  3CFR A;  5HLF A;  1XHX A;  5EU7 A;  4M45 A;  3D0P A;  4AH9 A;  3DLK A;  3NF6 A;  4B8A B;  3OYK A;  2YNG A;  1DTT A;  4FLU A;  3VQ4 A;  3MXJ A;  3QIO A;  4NYF A;  1VSH A;  3DM2 A;  4CHP A;  1VSD A;  4CFB A;  4KHQ A;  3TAF A;  3NCI A;  1HQU A;  2IOC A;  2ZE2 A;  4CHN A;  4DTN A;  4DFJ A;  3H08 A;  1YTU A;  4OPJ A;  4K8X A;  3AVF A;  4CES A;  3KLH A;  3PX0 A;  3ZSX A;  4E7H A;  1A5X A;  1HPZ A;  1KVA A;  4OJR A;  4DS5 A;  4KHY A;  3HO1 A;  2KFZ A;  3CG7 A;  2ATQ A;  3K5L A;  3TAG A;  3M8P A;  1WSJ A;  3AVC A;  4Q5V A;  1G15 A;  2F8T A;  3V9U A;  3OS0 A;  1VSI A;  3NE6 A;  2YV0 X;  3K2P A;  5KGW A;  1S1W A;  3QET A;  1L3U A;  3O3H A;  2G8I A;  2OZM A;  1NK7 A;  3SCX A;  1RT6 A;  4DU1 A;  1JXE A;  1FXX A;  3S3M A;  1RBU A;  5SZT A;  5I3U A;  3QER A;  3C94 A;  1FKO A;  3IG1 A;  3TAR A;  4FZY A;  1REV A;  3HP6 A;  1C0U A;  3P1G A;  5CZ1 A;  4I2P A;  1T8E A;  3KTQ A;  2QK9 A;  3WNG A;  4FJL A;  1NOZ A;  5FRM A;  1Z25 A;  2RF2 A;  1GOA A;  1KLM A;  4CF1 A;  1L3T A;  1CZB A;  3TR8 A;  4W5O A;  3L3U A;  3KD1 E;  4AHT A;  1JL1 A;  4H4M A;  1NKC A;  2ZQB A;  3QIP A;  3NHG A;  4KV8 A;  1IKW A;  3VA0 A;  4FJ5 A;  4ZHR A;  2HHX A;  1RBR A;  1TAQ A;  1X9M A;  4AHV A;  1QSS A;  4CEA A;  4KFB A;  4FK2 A;  3NGY A;  3VQQ A;  4Z4I A;  3LDS A;  4N47 A;  3HP9 A;  3ZSR A;  3V9Z A;  4BE2 A;  1S1U A;  2P1J A;  4CJW A;  2Y1J A;  1CXQ A;  4M3Y A;  3HST B;  3L3V A;  1ASW A;  3G0Z A;  3LPU A;  3EZ5 A;  1IO2 A;  1ZBH A;  2IC3 A;  4OPK A;  4FCY A;  3T3F A;  1Z26 A;  1TL1 A;  3ZT4 A;  2FBX A;  3VQ8 A;  1C0M A;  1RDB A;  4CHZ A;  1EP4 A;  3O4Q A;  1IG9 A;  3AVK A;  3OYE A;  3QNO A;  3KLF A;  3I8D A;  3AVB A;  3QEI A;  5HBM A;  4OKK A;  1A5V A;  4H4O A;  3CM5 A;  4Z4C A;  1WSI A;  3NDK A;  3SUN A;  3OYD A;  4BDY A;  4EP4 A;  3O3F A;  1QSL A;  3K5N A;  3SQ0 A;  1RNH A;  4K8Z A;  2IAJ A;  3KKS A;  4CFD A;  3ZT3 A;  5DMR A;  2VWK A;  1DLO A;  2YNH A;  3HPO A;  4N76 A;  3O4N A;  3LWM A;  4DU3 A;  1JLC A;  2OZS A;  4Z4H A;  3L2W A;  1KRP A;  4CJQ A;  3AO3 A;  4CK2 A;  2B4J A;  4FLZ A;  1B9D A;  3M8S A;  2D5R A;  4DSE A;  1SL1 A;  3KLE A;  4CEQ A;  3CFP A;  4KRF A;  4L8R B;  1WSE A;  3MXM A;  3RWU A;  3ZT0 A;  4M3T A;  1BHL A;  5J2M A;  2O4I A;  2KFN A;  4BE0 A;  4OKE A;  1VSJ A;  5C42 A;  4W5T A;  3O3G A;  1O1W A;  5JS2 A;  4JRQ A;  1RBV A;  4DTJ A;  2DTU A;  1U04 A;  1C1C A;  3M8R A;  1NK6 A;  3FFI A;  3DLH A;  1WNS A;  2G8U A;  3WNE A;  5HRO A;  5D3G A;  3AO2 A;  4CGH A;  5SWM A;  4DF4 A;  4DSK A;  3AA2 A;  3QIN A;  4KRE A;  2OPP A;  3JYT A;  3NF7 A;  3PY8 A;  4PY5 A;  1QE1 A;  1A5W A;  3DLG A;  4BWJ A;  3THV A;  3NH0 A;  1NOY A;  1LW0 A;  3TAQ A;  4PUO A;  1BI4 B;  2WON A;  4DS4 A;  5DK5 A;  4ZTJ A;  1DTQ A;  4QAG A;  4FJ8 A;  1RDD A;  4F4K A;  3OYL A;  2BAN A;  1UWB A;  2YNF A;  2FBV A;  4ID1 A;  3K5M A;  4FLW A;  3QES A;  4W5Q A;  1S6Q A;  1N5Y A;  4M3U A;  3V4I A;  4E1N A;  2G8K A;  4R5P A;  3RMB A;  4FJI A;  1ZBL A;  3L2Q A;  1VRT A;  4DFM A;  3LZJ A;  2F96 A;  2P5G A;  3KLG A;  2PY5 A;  2OPR A;  3NFA A;  4FW2 A;  3TAB A;  1JLQ A;  3M8Q A;  1S1V A;  2PYL A;  1FKP A;  1VSE A;  4KO0 A;  1I3A A;  4LY7 A;  4YNQ A;  5J1E A;  3HJF A;  4RW6 A;  4BDP A;  3CYM A;  1TK8 A;  4FK4 A;  1ITG A;  1WSH A;  4CER A;  4CJF A;  1NK0 A;  1JLE A;  2X74 A;  4MFB A;  4B9V A;  4OKJ A;  1Y97 A;  3E01 A;  3AVN A;  2Z1I A;  4DQI A;  4DTR A;  4CGF A;  4KKO A;  4B9T A;  3EY1 A;  2QXF A;  1TVR A;  1X9S A;  1XWL A;  5J2P A;  5KTQ A;  1NKB A;  1LW2 A;  2HVI A;  4KHU A;  2D0B A;  2IGI A;  2Z1G A;  4FZZ A;  3U3Y A;  3AA5 X;  4DFK A;  4FJK A;  3TAN A;  3IRX A;  4DLE A;  1JLF A;  3AA4 A;  2G8F A;  3LAK A;  3QEV A;  1SL2 A;  4F3O A;  4Z4F A;  5K14 A;  1WLJ A;  3NF9 A;  2JGU A;  3VQP A;  1KTQ A;  4FW1 A;  4ID5 A;  5J2Q A;  5C25 A;  5CZ2 A;  3LP0 A;  4DSL A;  1C6V A;  3OJU A;  2G8V A;  2DFF A;  3LAM A;  5FRN A;  1D8Y A;  4NCB A;  4CGD A;  4NCG A;  4LD0 A;  2XRI A;  3KK1 A;  3AVH A;  3OYJ A;  2HHV A;  2ZD1 A;  4DTP A;  4I7F A;  3NGI A;  4CED A;  4BDZ A;  1S9G A;  4DFP A;  1D9D A;  3AVM A;  4Y1C A;  1SV5 A;  3LPT A;  1ZBU A;  3AO1 A;  4AHU A;  3HL8 A;  2RKI A;  1NK8 A;  1EET A;  1HMV A;  4E19 A;  3AV9 A;  1U47 A;  2FBY A;  3VQ7 A;  4DSF A;  4YFU A;  3HXM A;  2D0C A;  2I5J A;  4F2R A;  1C0T A;  2X6S A;  5C24 A;  4AIL C;  3SUP A;  4E0D A;  4NCA A;  3K58 A;  4I9Q A;  1IH7 A;  2DFH A;  1JKH A;  3OYA A;  3SUO A;  2HNZ A;  4CK3 A;  4HUE A;  3KK2 A;  3SQ2 A;  4LSL A;  3DI6 A;  4UQG A;  1J53 A;  1UA1 A;  1CZ9 A;  3VQE A;  1ZBI A;  3TAM A;  2BDP A;  1HQE A;  3VQ5 A;  3EYZ A;  4Z4E A;  3HT3 A;  3CFO A;  4N56 A;  1XC9 A;  1B92 A;  3MXI A;  4GW6 A;  3LWL A;  1IKX A;  4B9S A;  2P5O A;  4KHS A;  4IDK A;  4AHS A;  3ASM A;  1SKW A;  4J2B A;  3V1O A;  1KFD A;  3KLI A;  1YT3 A;  4QOZ B;  4LH4 A;  1L3V A;  2O4G A;  3DLB A;  3OYC A;  3V9X A;  1Q9X A;  2ETJ A;  3DRS A;  3MEE A;  3VQD A;  4CJV A;  4CK1 A;  3V81 A;  4PWD A;  1JLG A;  1UOC A;  2KQ2 A;  3WNF A;  3OJS A;  3B6P A;  4AHC A;  3OYM A;  1NJZ A;  2RPI A;  4DQP A;  3P5J A;  4F3T A;  4CJU A;  4DG1 A;  2YHA A;  2A1R A;  3PO4 A;  4FYD A;  4C8N A;  4FJ7 A;  4O44 A;  1S1T A;  4HVJ A;  1JLA A;  1LWF A;  2HHU A;  2PYJ A;  1TK0 A;  1HRH A;  1LWC A;  2IDO A;  4EZ9 A;  4FJX A;  1VK0 A;  4O55 A;  2YKN A;  3MEG A;  3LAN A;  1BCO A;  1KVC A;  3T19 A;  2Q3S A;  4CHY A;  4HCB A;  1YTA A;  2XY8 A;  1GOC A;  1BL3 A;  3NGZ A;  1HJR A;  1BQM A;  4OVL A;  4M3Z A;  2JLE A;  3WNH A;  4OGE A;  3OY9 A;  2VG7 A;  4E7K A;  3IAY A;  2GUI A;  3I0S A;  4RW8 A;  4TSX A;  4EP5 A;  4W5R A;  3ITH A;  4IFY A;  3OS1 A;  1RCH A;  3OYF A;  4FXD A;  1KCF A;  1RT3 A;  1NK5 A;  2KTQ A;  3V1R A;  4B9M A;  3AVI A;  1Q8I A;  3S3N A;  4DF8 A;  1L3S A;  4FK0 A;  3BDP A;  2E4L A;  4CCH A;  4DTX A;  4E7J A;  2D0A A;  2F8S A;  4NYN A;  1LWE A;  4FM2 A;  4M41 A;  2HHQ A;  3C95 A;  2Z1H A;  3NBP A;  1RDC A;  2HND A;  1RT7 A;  2DY4 A;  3AVJ A;  4DQR A;  4OLA A;  2E6M A;  3PO5 A;  1Q9Y A;  1WAF A;  2VG5 A;  4OGC A;  4CJR A;  3BGR A;  4CJL A;  3LP3 A;  3CM6 A;  4RG8 A;  4DTU A; 
#chains in the Genus database with same CATH topology
 2IS3 A;  1NK9 A;  3VTH A;  4IFE A;  4CIF A;  3SPY A;  3ZCM A;  1OH8 A;  5JMV A;  1HNV A;  1C1A A;  2Q2R A;  4O5B A;  5FDL A;  1VSL A;  4CZE A;  2B5J A;  2O8B A;  1YF5 L;  3CJ1 A;  3EL2 A;  3RRH A;  5AQO A;  1BIS A;  3SUQ A;  4Y0W A;  2HVH A;  1BA1 A;  2XY7 A;  2YHY A;  2G8W A;  3K5O A;  3ZSV A;  3SZ2 A;  2NRX A;  4QCL A;  3L2R A;  5KGX A;  4IO8 A;  1BIU A;  1YVU A;  1QZ6 A;  3DRP A;  4DR7 K;  1VHX A;  1WAJ A;  4BGA A;  4W5N A;  4FOI A;  3CJC A;  3NAE A;  4BE1 A;  1X3M A;  2QM1 A;  3SQ1 A;  3VES A;  1NGD A;  3CCM N;  3F9K A;  4CBW A;  4CJ3 A;  2YI1 A;  1BU6 O;  2P51 A;  3DWL A;  3CF5 L;  1GLE G;  3MED A;  4YDU C;  1W97 L;  4N5S A;  4BVO A;  4JKB A;  4CGI A;  4DV3 K;  1N6Q A;  1I39 A;  4CEB A;  2QWQ A;  4L3Q A;  3EE9 A;  5JLH A;  4BRL A;  1TGO A;  3SBG A;  3SNN A;  3BEX A;  4CF2 A;  1EX4 A;  4H8K A;  3KKR A;  3OYI A;  3KK3 A;  1GLA G;  4OO1 J;  1K8K A;  2XY6 A;  1VSF A;  3VF6 A;  3O9R A;  3CMA N;  4FM1 A;  1XI1 A;  1KD1 O;  1YXQ A;  4DMN A;  1RDU A;  3A8Y A;  1S9E A;  3ENB A;  4IG0 A;  4ELV A;  1EQY A;  1QHT A;  1QS4 A;  5BRF A;  1N34 K;  1TYQ B;  3QO9 A;  1NGI A;  4LF6 K;  5I9E B;  1P8Z A;  2A40 A;  3P4I A;  4J2D A;  2P9I B;  3TAP A;  3AVA A;  1KFS A;  4FWL A;  1S1X A;  3ZX2 A;  5TKY A;  1DKG D;  4CJ7 A;  1QHA A;  1R0A A;  2BGG A;  4CF0 A;  4FWO A;  1ZC6 A;  2ASO A;  4I2Q A;  3JS6 A;  3WEE B;  1SKR A;  3SV4 A;  3ZET A;  1RT1 A;  1TUU A;  3AAQ A;  3ULD A;  5AFU A;  3BDP A;  4HUF A;  1L5U A;  1BIZ A;  1J9A A;  1LAV A;  5BN9 A;  2ZGY A;  1FK9 A;  4PKI A;  3NH2 A;  1X9M A;  1KLN A;  3DLE A;  4UY8 O;  4DQ8 A;  2O8B B;  3CCE N;  2OYQ A;  4DV4 K;  1VSM A;  2OA8 A;  4DTS A;  2PBD A;  4JI7 K;  2KKZ A;  5CY4 A;  2HBJ A;  1RTJ A;  2FBT A;  4CEZ A;  5FPD A;  4FWS A;  5GAH P;  4A62 A;  2EHG A;  2ZJQ L;  1LOT B;  1RT4 A;  1DEJ A;  1X9J A;  5KRT A;  4PA1 A;  5GIN A;  3TI0 A;  4I6M B;  3RMC A;  4RWT A;  3J81 O;  3LM9 A;  4CJS A;  1K6Y A;  1WN7 A;  3KD5 E;  2YCH A;  4M3W A;  4LFA K;  1S5J A;  3D2E A;  4CZJ A;  3IMX A;  4KHW A;  4DR4 K;  3OBY A;  1RBS A;  3U9Z A;  4CIE A;  4E7I A;  1YUW A;  5HLF A;  4MLE A;  4B8A B;  1DTT A;  3MXJ A;  1VSH A;  4CHP A;  1VSD A;  4JI2 K;  3VEW A;  3TAF A;  2IOC A;  4DTN A;  4DFJ A;  3D7E O;  3AVF A;  3BP8 A;  1HPZ A;  4KHY A;  4KH6 A;  4AM7 A;  2F8T A;  3T1Y K;  3NE6 A;  4JI1 K;  3WXM B;  2YV0 X;  3QET A;  3E9L A;  2G8I A;  2OZM A;  1NK7 A;  4DU1 A;  1JXE A;  2V51 B;  5SZT A;  4JI6 K;  5EY4 A;  3DAW A;  4FZY A;  1K8K B;  4B9Q A;  4JV5 K;  1T8E A;  5C0Y A;  2ASM A;  1Z25 A;  2RHK A;  3MCP A;  4H4M A;  2ZQB A;  4JEP A;  2UU9 K;  1RBR A;  2CGL A;  4AHV A;  4KFB A;  3VQQ A;  2IVN A;  1S1U A;  1CXQ A;  4KBO A;  4LF8 K;  5BN8 A;  3G0Z A;  3EZ5 A;  1TL1 A;  2HBM A;  3VQ8 A;  2A41 A;  5AQI A;  2OAN A;  3OYE A;  3QNO A;  3KLF A;  3I8D A;  4HTL A;  3QEI A;  5HBM A;  3C6A A;  4B3T K;  2E2P A;  3SMP A;  1HNX K;  3OYD A;  4BDY A;  4NXM K;  3KKS A;  5DMR A;  4DR5 K;  3ZET B;  3HPO A;  4DU3 A;  1JLC A;  3L2W A;  2E20 A;  1NGB A;  4CK2 A;  5EOY A;  4DSE A;  2D5R A;  2IIR A;  3KLE A;  4CEQ A;  3CCJ N;  5C15 A;  4L8R B;  3RWU A;  1GLB G;  2O4I A;  4OKE A;  4W5T A;  4JRQ A;  1RBV A;  1U04 A;  3LL3 A;  5HRO A;  3AO2 A;  1NU0 A;  4DSK A;  3AA2 A;  2E2N A;  3NF7 A;  3DLG A;  4BWJ A;  3NH0 A;  3VEO A;  1NOY A;  1LW0 A;  3TAQ A;  1JCG A;  3R1X A;  2WC9 A;  3OYL A;  4FLW A;  1N5Y A;  2FBV A;  3K5M A;  4W5Q A;  1HKC A;  1S6Q A;  2YJE A;  3FZM A;  2UUA K;  3HSC A;  1VRT A;  2A5X A;  3NFA A;  3TAB A;  3LM2 A;  1JLQ A;  1S1V A;  1G99 A;  1W2B M;  1FKP A;  1VSE A;  2VGM A;  5F1X A;  1Q7Y O;  3HJF A;  3D2E B;  4BDP A;  5AQG A;  3THW A;  1QVG M;  2X74 A;  5JVG L;  4OKJ A;  1ZXO A;  5LMN K;  2Z1I A;  4DQI A;  3LDP A;  4CGF A;  1TVR A;  1X9S A;  1XWL A;  5J2P A;  4FZZ A;  2D0B A;  4DFK A;  3UKR A;  3F5T A;  3H6E A;  2I7P A;  3AA4 A;  3L6Q A;  3LAK A;  4WYB A;  4F3O A;  4Z4F A;  1VQO N;  5AFU H;  3VF4 A;  1MDU B;  3TU5 A;  3TTD A;  1KTQ A;  1WBB A;  4FW1 A;  3CC2 N;  1C6V A;  2E2O A;  3LAM A;  3BF1 A;  5FRN A;  1D8Y A;  4NCB A;  4LD0 A;  3KK1 A;  4DTP A;  4KH5 A;  5H1S Q;  3AAR A;  3LPT A;  3AO1 A;  3HL8 A;  1HMV A;  4E19 A;  3AV9 A;  3OTO K;  2CH6 A;  4BRK A;  2X6S A;  4E0D A;  4BC5 A;  3SUO A;  3KK2 A;  4DR1 K;  4UQG A;  1OVY A;  5M1N A;  3VQE A;  3C65 A;  3TAM A;  2GEL A;  3EYZ A;  4V19 S;  3MXI A;  2P5O A;  1IKX A;  4B9S A;  4GV9 A;  1SKW A;  3ASM A;  4R79 A;  4J2B A;  1KFD A;  4BRE A;  4LF5 K;  3O6W A;  1YJN N;  5JIC A;  1L3V A;  3DLB A;  1LCU A;  4WQ5 A;  4PWD A;  1XC3 A;  3O5B A;  4CK1 A;  2KQ2 A;  3E66 A;  3OYM A;  1NJZ A;  4DQP A;  5AQU A;  2E88 A;  3CQX A;  4YOU A;  5AZI A;  1JLA A;  1LWF A;  2FSK A;  4XH4 A;  2PYJ A;  1TK0 A;  4ISE A;  3SBT A;  1KVC A;  4BR5 A;  5GAD P;  1HJR A;  3JXU A;  3O9U A;  4OVL A;  4M3Z A;  1ATN A;  5HL7 L;  1S3X A;  1SQK A;  1P90 A;  4TSX A;  3GG4 A;  3ITH A;  1D4X A;  3K9K A;  1RCH A;  4FXD A;  2KTQ A;  1NK5 A;  4B9M A;  4IJA A;  2FF6 A;  4GNI A;  1NGG A;  4FK0 A;  2BUP A;  4H03 B;  4CCH A;  4E7J A;  3WQU A;  2D0A A;  4YOX A;  2F8S A;  4FM2 A;  2YHX A;  2Z1H A;  1RT7 A;  3AVJ A;  1ZBS A;  3FE1 A;  4FWM A;  2GWK A;  3PO5 A;  4OGC A;  1QQM A;  4CJL A;  3V6D A;  1LAW A;  4QS9 A;  4B1V A;  3QEW A;  2B6A A;  2VWJ A;  1BG3 A;  4PHT X;  3NVK A;  3SPZ A;  3QNN A;  1TKX A;  1IV0 A;  1BGX T;  3EEQ A;  4CHO A;  2QWR A;  2NZT A;  3VQA A;  1RTI A;  2E6L A;  1IBL K;  3O9Q A;  4IBN A;  1KVB A;  3THW B;  4B3M K;  3BY5 A;  3U6F A;  5HOO A;  1RTD A;  3VQ6 A;  4X66 K;  3ZSO A;  4CJK A;  2AA4 A;  3O1W A;  4CZG A;  1WSF A;  3FZF A;  4F2S A;  1Q82 O;  4A2A A;  3V9W A;  3UKR B;  1N33 K;  1TAU A;  5HRP A;  3RMA A;  3C7N A;  3ID6 A;  4CF8 A;  3B6O A;  4M3R A;  3NH1 A;  3VPZ A;  3BZK A;  2ASP A;  4IFV A;  2P9K A;  5AJ3 K;  1T6D A;  3VQ9 A;  3SQ4 A;  2A6A A;  1B9F A;  2X78 A;  4CF9 A;  3O80 A;  4DV2 K;  1T03 A;  4JS5 A;  1D9F A;  1K73 O;  5BR8 K;  4CGG A;  3EN9 A;  2HMI A;  4RW9 A;  3HPH A;  4DR6 K;  2O8E A;  4H5T A;  1NM1 A;  1W0H A;  2VG6 A;  1VQ8 N;  1TL3 A;  4C8K A;  3VA3 A;  5AQJ A;  4HHT A;  4DSI A;  2NRZ A;  2NRT A;  1NJX A;  1M1K O;  3ZSW A;  3IDH A;  3L2V A;  2I7N A;  3SI6 A;  4FJN A;  3VEX A;  4K25 A;  1RTH A;  5ADX H;  5JS1 A;  1VSK A;  2NLX A;  3CD6 N;  3VEZ A;  4BR0 A;  2Q36 A;  5AZI B;  4CFC A;  2EX3 A;  4J2E A;  2WOM A;  2PZS A;  1Z6R A;  5CYQ A;  4DHY A;  4E1M A;  1WUA A;  3SYZ A;  4EIA A;  1HYZ A;  2HHW A;  4BR4 A;  3S9H A;  4KI6 A;  1HKG A;  3V1Q A;  4FJG A;  4KB0 A;  1HJO A;  4WE1 A;  2ITG A;  2YHB A;  1GLJ O;  3G25 A;  1ASV A;  4DTM A;  3ZLJ A;  1TKT A;  3LP2 A;  2R7Y A;  3PUF A;  3T7Z A;  3PIO L;  4JS4 A;  5BRH A;  3OYH A;  3DMJ A;  1HYV A;  3OVN A;  3A5L C;  2W41 A;  3VQC A;  4BAC A;  2QWP A;  4RW4 A;  1YI2 N;  3IS9 A;  3EKS A;  2OPS A;  4CHQ A;  3P83 D;  5KPR A;  4B9U A;  2A1S A;  1RIL A;  2UXD K;  3AA3 A;  1WSG A;  3HVT A;  4CD1 A;  5T7B A;  2HW3 A;  2AJQ A;  2HOE A;  4CEE A;  3DRR A;  3UIQ A;  4FLX A;  4EZ6 A;  4IG3 A;  1J5O A;  4E7L A;  4CD3 A;  1C0G A;  1TV6 A;  1K9M O;  1BI4 A;  4CJP A;  4B3O A;  4CZK A;  1TKZ A;  4CJ5 A;  3JAM O;  4DQQ A;  3TWH A;  1JXB A;  3HPG A;  3R8E A;  2Z1J A;  3NMU A;  4XH5 A;  5J2N A;  3QEP A;  1IKY A;  3HOT A;  1KC8 O;  2HMP A;  1HNI A;  3ZX0 A;  3C7N B;  3DOK A;  4CJT A;  4DLG A;  4GMJ B;  1NKE A;  4LF4 K;  1R59 O;  1RT5 A;  4NLB A;  1D5A A;  1VQN N;  1XHZ A;  2UXB K;  3QIC A;  3UB5 A;  2P9K B;  1NK4 A;  4C1N I;  3C6T A;  3G10 A;  1O13 A;  1H1V A;  5AQM A;  3K57 A;  1T3V A;  2KHO A;  1GOB A;  4O0J A;  4AQY K;  1BCM A;  1T05 A;  5HRN A;  1C0F A;  1ASU A;  3O1B A;  4LFC K;  1XHX A;  4B3R K;  4M45 A;  3L4Q A;  3DLK A;  3NF6 A;  3OYK A;  1NMD A;  2UXC K;  4FSV A;  2O8E B;  2ZE2 A;  4BGB A;  3H08 A;  1XMQ K;  3PX0 A;  4E7H A;  5M1O A;  2KFZ A;  2HBK A;  2YHW A;  3TAG A;  3CJ9 A;  1WSJ A;  3AVC A;  1T44 A;  3K2P A;  1S1W A;  3MN9 A;  3WXK A;  1FXX A;  2KLA A;  3IG1 A;  3VEV A;  1REV A;  3P1G A;  2P9U B;  4H0Y B;  2QK9 A;  4IEE A;  3WNG A;  1NOZ A;  2D0O A;  2AP1 A;  1KLM A;  4CF1 A;  1L3T A;  1CZB A;  4W5O A;  1ATR A;  5AQZ A;  3VTI A;  3WT0 A;  4KV8 A;  2VWB A;  4WQ4 A;  4H5R A;  1BO5 O;  5C2F A;  3EE8 A;  2WTU A;  4CEA A;  4FK2 A;  3WXJ A;  3LDL A;  4N47 A;  3V9Z A;  2Y1J A;  3L3V A;  1ZBH A;  1IO2 A;  5GAE P;  4WFN L;  4OPK A;  1KXP A;  2W40 A;  3ZT4 A;  2FBX A;  3UKU B;  1C0M A;  2IVP A;  4CHZ A;  5AQL A;  3VER A;  2O8D A;  3AVK A;  2QA4 N;  3AVB A;  2HHH K;  3AY9 A;  1VQ9 N;  2NRW A;  3TSQ A;  3O9S A;  4CFD A;  2VWK A;  4H5V A;  1X3N A;  5C12 A;  4JNE A;  4CJQ A;  1SL1 A;  2B4J A;  1B9D A;  4QS8 A;  4WFB L;  3BZC A;  4DUY K;  4KRF A;  3O8M A;  3ULE A;  3UE5 A;  5KPT A;  1QQN A;  4BE0 A;  3QFP A;  1VSJ A;  5C42 A;  3O3G A;  5JS2 A;  4IZ9 A;  3PSF A;  2DTU A;  4BG8 A;  2G8U A;  3W0L A;  1WB9 A;  2QTD A;  3MX2 A;  4CGH A;  5SWM A;  4NXN K;  4BVP A;  4KRE A;  2RE2 A;  1QE1 A;  3IUC A;  2P9L A;  4PUO A;  1BI4 B;  2WON A;  5BRD A;  5A2Q O;  3G4S N;  4DS4 A;  4JD2 A;  2BAN A;  4ISG A;  1UWB A;  2YNF A;  1NLV A;  3H46 O;  4E1N A;  1ZBL A;  3L2Q A;  3LZJ A;  2P5G A;  4FW2 A;  1XNQ K;  3SJH A;  2CH5 A;  2H3G X;  2PYL A;  1BUP A;  1I3A A;  3MCA B;  4MO4 A;  4FK4 A;  3CYM A;  3THX A;  2Q31 A;  1ITG A;  1NK0 A;  3VEY A;  1JLE A;  4MFB A;  2QXL A;  3E01 A;  1TUY A;  3AVN A;  4B9T A;  4KKO A;  3H1Q A;  3SLC A;  1NKB A;  4KHU A;  2IGI A;  2Z1G A;  3MMV A;  3U3Y A;  3GBT A;  2UUB K;  4IEI A;  5AQN A;  4DKW A;  4DLE A;  4FO0 A;  1SL2 A;  4LF9 K;  5FLX O;  3O9T A;  3NF9 A;  3VQP A;  5C25 A;  3CC7 N;  3OJU A;  2G8V A;  2NRR A;  3AVH A;  3ZYY X;  5AQP A;  4BDZ A;  2GUP A;  3AVM A;  4Y1C A;  1SV5 A;  1SS6 A;  4CZI A;  5AQF A;  1NK8 A;  1DGK N;  5LY3 A;  1U47 A;  1QVF M;  3PLA A;  4YFU A;  3MX5 A;  4JI4 K;  2I5J A;  1C0T A;  4I9Q A;  3H3O B;  2DFH A;  5CR4 A;  1HNZ K;  2HNZ A;  3THY A;  3SQ2 A;  3DI6 A;  4B1W B;  1CZ9 A;  1HQE A;  2O8F A;  1U6Z A;  3VQ5 A;  4Z4E A;  4N56 A;  3HOS A;  4BC3 A;  4KHS A;  3DJC A;  2E8A A;  4FWR A;  4WFA L;  3V1O A;  2Q0U A;  5AQT A;  3R3L A;  1Y64 A;  2ETJ A;  3DRS A;  3MEE A;  3WNF A;  4XH1 A;  2O8D B;  3P5J A;  4F3T A;  4IOA L;  4IO9 L;  4C8N A;  4FJ7 A;  1S1T A;  1BWF O;  3FGU A;  4A61 A;  1VK0 A;  3MEG A;  3T19 A;  4CHY A;  1YTA A;  3ZEU A;  1OH5 A;  2JLE A;  3OY9 A;  2QWL A;  3PSI A;  4E7K A;  4RW8 A;  4W5R A;  4EP5 A;  3OS1 A;  1KCF A;  1RT3 A;  3V1R A;  3ULE B;  4CZM A;  1Q8I A;  4DF8 A;  2Q1N A;  3CPW M;  3PIP L;  3NBP A;  1RDC A;  4IOX A;  1Q81 O;  2DY4 A;  4XEI A;  3EKU A;  4JN4 A;  4DQR A;  3VGM A;  1WBD A;  2Q97 A;  2VG5 A;  4CJR A;  2P9L B;  4BRC A;  4JD2 B;  4C8M A;  4FLV A;  1EXQ A;  2QWN A;  1X9W A;  3DLL L;  4YOW A;  2HB5 A;  1ZYQ A;  4FVM A;  2BE2 A;  3AGK A;  5CYM A;  1EWR A;  4ILJ A;  2XHB A;  3TSP A;  3C6U A;  5ADX A;  3THX B;  3HZ6 A;  3ZSQ A;  3FZL A;  1UAX A;  5BR9 A;  1BDG A;  3J7A P;  4CJE A;  5KQD A;  3IKM A;  4KTQ A;  5DM6 L;  2F9W A;  4C1N K;  2YX6 A;  3QBX A;  4DV1 K;  4B9L A;  4N41 A;  4FWN A;  3G71 N;  1QTM A;  4FVU A;  3NF8 A;  1U45 A;  4JK8 A;  5BPL A;  1BQN A;  5AQK A;  4J2A A;  2NUB A;  3QB0 A;  4H0O A;  3A0I X;  1TKD A;  4JI5 K;  2ZF5 O;  3T1A A;  3VN5 A;  3SK3 A;  3A5O C;  2P9N A;  2QKK A;  4KHP K;  4DTO A;  1XUP O;  4ELT A;  4LC9 B;  3CQ8 A;  1S72 N;  2JWK A;  2G8H A;  3CC4 N;  5FPN A;  3OHR A;  2FSN A;  1SAZ A;  4B9N A;  2QKB A;  1HPM A;  4OPH A;  5JLF A;  2YKM A;  1U2V A;  4JHD A;  1KAY A;  2V7Z A;  3LDQ A;  4CZH A;  5AQR A;  1VQ4 N;  3L4I A;  1VRU A;  2RN2 A;  4FJ9 A;  5JVH L;  5M1P A;  4JKD A;  1CLQ A;  3L2U A;  2HHS A;  5E84 A;  4IOC L;  1XNR K;  2V52 B;  4K41 A;  5B8H A;  2Q0R A;  2A42 A;  3PV8 A;  3SV3 A;  3ZEU B;  1N8R O;  3AVL A;  5EVZ A;  3T1H K;  4FJJ A;  3CHW A;  4HCC A;  4DR2 K;  2GTD A;  3ISN C;  4FLY A;  3DYA A;  3LDO A;  4B1Y B;  1JCE A;  4FL9 A;  4XIU A;  3GOI A;  4IKF A;  1VQK N;  4G1Q A;  4IXC A;  1KAZ A;  4Z4G A;  2A3Z A;  3FZH A;  1SUQ A;  3OS2 A;  4ZTF A;  1NGJ A;  2HNY A;  4CEC A;  3OYB A;  3RMD A;  3AO4 A;  3ZSY A;  3HYF A;  3M3Z A;  3KIO A;  1HNW K;  4BC4 A;  2OPQ A;  1NGA A;  3PX6 A;  3I0R A;  1EKE A;  3ZT1 A;  3D45 A;  4AF1 A;  4A5B A;  1JL2 A;  3OYG A;  1U49 A;  4MDB A;  3S41 A;  4H0V B;  3K59 A;  1J5E K;  4CFA A;  4K0K K;  3AVG A;  1X1P A;  1U4B A;  1SKS A;  3LP1 A;  1E4F T;  5FRO A;  3WXL A;  4BRM A;  1RDA A;  1HYS A;  3V9S A;  3KJV A;  1NBW A;  3U9D A;  4KTZ A;  1ZBF A;  2GEM A;  3M1F A;  4FJH A;  4KAZ A;  1E3M A;  1GLF O;  2FLO A;  1CXU A;  1JLB A;  1TK5 A;  1IBM K;  3QLH A;  3N4Q A;  1F21 A;  2Y1I A;  4F8R A;  4JAX A;  4DV7 K;  3GL1 A;  4AHR A;  4FWQ A;  2ITM A;  1RGI A;  3CPE A;  2HHT A;  2XO7 A;  1RT2 A;  3CFR A;  1BOT O;  3Q7C A;  5EU7 A;  3D0P A;  3CJA A;  3VQ4 A;  3QIO A;  4NYF A;  5LJW A;  3DM2 A;  4CFB A;  1HQU A;  4CHN A;  4DR3 K;  3B8A X;  4CES A;  3ZSX A;  4JKC A;  1A5X A;  1KVA A;  4OJR A;  3HO1 A;  2P9N B;  3FFK B;  3CG7 A;  3M8P A;  4Q5V A;  1G15 A;  5AQW A;  3OS0 A;  3V9U A;  5KGW A;  1L3U A;  4GV3 A;  3SCX A;  3CJB A;  1YJ9 N;  1RBU A;  1YVN A;  3C94 A;  1FKO A;  3TAR A;  1U2V B;  5AQV A;  4JHD B;  3KTQ A;  4I2P A;  3ZX3 A;  2WBN A;  5FRM A;  2RF2 A;  1GOA A;  3ENH A;  4FPA A;  1XMO K;  3KD1 E;  1K8A O;  4AHT A;  3ENO A;  1NKC A;  1VQ7 N;  3NHG A;  1IKW A;  4CBU A;  4DUZ K;  4ZHR A;  2VQE K;  1QSS A;  3NGY A;  3G6E N;  3LDS A;  1ATS A;  3HP9 A;  2HST A;  3ZSR A;  2P1J A;  4CJW A;  4M3Y A;  2W6L A;  4GY2 B;  1ASW A;  3DXK A;  4A59 A;  3VGK A;  5KQ8 A;  3T3F A;  3BUZ B;  5E26 A;  2NNW A;  3RSE A;  1RDB A;  1EP4 A;  3O4Q A;  2FSJ A;  2VCP A;  3MDQ A;  4Z4C A;  1WSI A;  4PKH A;  5BRE A;  4K8Z A;  4EP4 A;  3O3F A;  3SQ0 A;  4BRQ A;  2IAJ A;  4BR7 A;  4O8K A;  1E4G T;  1DLO A;  2YNH A;  4N76 A;  2VYP A;  4Z4H A;  3QBW A;  3FLC O;  1M90 O;  2HF4 A;  1NGE A;  1WSE A;  4M3T A;  5J2M A;  1O1W A;  3M8R A;  3TTF A;  3WNE A;  4CZF A;  4F9O A;  4M7X A;  3WEE A;  4LF7 K;  4CW7 B;  3CCV N;  4DF4 A;  3HTV A;  3QIN A;  4BRH A;  3TPQ A;  3PY8 A;  4PY5 A;  3THV A;  1DTQ A;  4QAG A;  1RDD A;  4JKE A;  4ID1 A;  3QES A;  4M3U A;  2D0P A;  3V4I A;  2OTJ N;  5F0X A;  2G8K A;  4FJI A;  3SAF A;  3RMB A;  1JCF A;  2F96 A;  4WQ5 C;  2PY5 A;  2OPR A;  1MA9 B;  4JI8 K;  4DB3 A;  5M1K A;  4H0T B;  4KO0 A;  4LY7 A;  5J1E A;  1VQ5 N;  4RW6 A;  5M1F A;  4BRO A;  1WSH A;  4CER A;  4CJF A;  1Y97 A;  4FOE A;  4B1X B;  3EY1 A;  2QXF A;  2HVI A;  5IWA K;  4JI0 K;  4FPB A;  1EO1 A;  3AA5 X;  1XQS C;  3TAN A;  3IRX A;  4I6M A;  4H5N A;  2G8F A;  3QEV A;  5K14 A;  2JGU A;  2PAV A;  5ELZ A;  5J2Q A;  4DSL A;  2DFF A;  4CGD A;  2XRI A;  3OYJ A;  2HHV A;  3HBT A;  2ZD1 A;  4C8O A;  3NGI A;  4CED A;  4DFP A;  5MLC Q;  4AHU A;  2RKI A;  1HUX A;  1ILY A;  2ZGZ A;  3HXM A;  4NCA A;  1VAZ A;  1JKH A;  4HUE A;  3J7Z O;  1UA1 A;  1J53 A;  3MN5 A;  5KPZ A;  3HT3 A;  3CCR N;  5AZJ A;  1XC9 A;  1NGF A;  1YIT N;  3LWL A;  2ZJR L;  2QEX N;  4AHS A;  1OVQ A;  2QWM A;  4BRD A;  2HF3 A;  3DXK B;  4LH4 A;  1HX1 A;  3HRG A;  2QWO A;  2O4G A;  4K42 A;  4CJV A;  4JKH A;  3V81 A;  1CZA N;  1UOC A;  3RSE B;  4EHT A;  1NWK A;  3MK6 A;  3B6P A;  3OJS A;  4AHC A;  4CJU A;  4DG1 A;  3FR0 A;  3CJ7 A;  3L0Q A;  1LWC A;  2YKN A;  3LAN A;  4BRI A;  2Q3S A;  2HBL A;  1BL3 A;  1GOC A;  3NGZ A;  4OX9 K;  1NJI O;  5AR0 A;  1YJW N;  3C0B A;  5LMU K;  3IAY A;  2GUI A;  3I0S A;  3OYF A;  3P38 A;  4IFY A;  1T6C A;  5BPN A;  1KAX A;  3S3N A;  5C2D A;  4BC2 A;  5GAG P;  4DTX A;  3HM8 A;  4RCH A;  2W6K A;  4E1J A;  3ID8 A;  4NYN A;  1LWE A;  2E1Z A;  2HHQ A;  2IVO A;  4BRF A;  3CI5 A;  4B1U B;  4EFH A;  4OLA A;  1Q9Y A;  1VQP N;  3QDK A;  4RG8 A;  1T7P A;  1NGH A;  4NLC A;  2QW9 A;  1MWK A;  5AQX A;  4DCH A;  4CEO A;  3A2F A;  1HKB A;  1IKV A;  3M5R A;  4Y1D A;  5DM7 L;  4YOT A;  4G9Z A;  1N36 K;  1QQC A;  1HLU A;  3EZW A;  4CJ4 A;  3K0S A;  4E3S A;  2E2Q A;  4BY9 C;  3U3G A;  4O0I A;  2KW4 A;  3EO3 A;  4M3X A;  3VQB A;  3OYN A;  2X6N A;  4B08 A;  3PX4 A;  3D2F A;  2CGK A;  4ELU A;  2KZZ A;  1FJG K;  2FF3 B;  4JLH A;  3ZT2 A;  5E41 A;  4DSJ A;  4FWP A;  3RTV A;  3C6H A;  1WOQ A;  1N32 K;  4DWI A;  4DV5 K;  4B8C A;  4BRA A;  3KWI A;  4JKF A;  2YNI A;  4GVE A;  3DOL A;  4BQL A;  1QQO A;  2FXU A;  3VET A;  3KWG A;  4A5A A;  4DV6 K;  5GIP A;  3TAE A;  3AGR A;  3RVC A;  4HUG A;  3RRG A;  1GLL O;  3HM9 A;  3U4L A;  3SAG A;  2P9S A;  3LAL A;  3P31 A;  4C8L A;  3MN7 A;  3JSM A;  2W42 A;  3VMF B;  3QEX A;  4NB4 A;  2GV9 A;  4MQ3 A;  3MWT A;  4CGJ A;  2OCE A;  3S3O A;  5AZJ B;  4O5F A;  3MEC A;  4BWM A;  2LSN A;  2BTF A;  1J54 A;  4Q0B A;  4K43 A;  3P39 A;  4WF9 L;  3H45 C;  3RR7 A;  3W3D A;  5AQQ A;  1Q86 O;  1W7A A;  2F4V K;  4FM0 A;  4M42 A;  4HTU A;  4FJM A;  3DXM A;  5KI6 A;  3SJJ A;  4EAH D;  3GDQ A;  1W9H A;  3E9P A;  4OLB A;  1QZ5 A;  4JKA A;  4CBX A;  4EHU A;  5CHI A;  5I42 A;  4WCE L;  3KZB A;  4O4G A;  1U48 A;  3CCL N;  4IWV A;  4J8F A;  4JRP A;  5KRS A;  2PFU A;  4U67 L;  3F73 A;  4FLT A;  5EXW A;  5IT9 O;  3MWP A;  3TSU A;  1IBK K;  4KI4 A;  2KZM A;  5HRR A;  4LH5 A;  3J8A A;  2DPN A;  4PQU A;  3KVG A;  2YJF A;  4KPY A;  3ZSZ A;  4ILH A;  5M1Q A;  3LZI A;  2EWS A;  4QS7 A;  3CIP A;  1IJJ A;  4X64 K;  4I9L A;  4YOR A;  1NNE A;  3O08 A;  3WQT A;  3DLR A;  2GBZ A;  2HHX A;  3HVR A;  4E89 A;  1SL0 A;  1UA0 A;  1HR0 K;  4FWK A;  4CE9 A;  1YIJ N;  2E5L K;  1NJW A;  4ILG B;  1C1B A;  3OA9 A;  3CET A;  4LSN A;  3CCU N;  4GVM A;  1QSY A;  2QI2 A;  4H0P A;  4CEF A;  1KSP A;  2FC0 A;  3AO5 A;  1NJY A;  2BH1 A;  4WQ4 C;  1MU2 A;  4KB1 A;  3D2F B;  3D6R A;  3L8B A;  3WUH A;  3O4W A;  5HP1 A;  4KHN A;  3VF2 A;  3HK2 A;  3CXC M;  1LV5 A;  4OPA A;  3MAQ A;  4B1Z A;  4DQS A;  2GWJ A;  1Q18 A;  4Z0U A;  4CIG A;  3ALY A;  3RR8 A;  1NGC A;  1NMN A;  1S6P A;  4DU4 A;  4ICL A;  4MLH A;  1RBT A;  1KQS M;  2V7Y A;  4C23 A;  4YHH K;  4B3S K;  2DFE A;  2ZWH A;  4FZX C;  2XY5 A;  4KTW A;  5AQS A;  2D4W A;  4RW7 A;  1OH6 A;  3VGL A;  5HRS A;  4A57 A;  5C10 A;  3R6M A;  2P9P A;  3ATV A;  5AQY A;  4AH9 A;  2YNG A;  4FLU A;  2P9S B;  3QFU A;  4A2B A;  1S22 A;  4KHQ A;  5LL6 Z;  3NCI A;  1YHQ N;  4X62 K;  2OTL N;  1YTU A;  3E1Y A;  4OPJ A;  1V4T A;  4K8X A;  3KLH A;  3A5N C;  3THY B;  4DS5 A;  4NO7 A;  2ATQ A;  3K5L A;  3H1V X;  2O8F B;  1VSI A;  1VQ6 N;  3O3H A;  3CER A;  1RDW X;  4KH4 A;  1RT6 A;  2CGJ A;  3S3M A;  1OH7 A;  5I3U A;  3QER A;  3HP6 A;  1C0U A;  5CZ1 A;  4FJL A;  4Z94 A;  1J6Z A;  3TR8 A;  3DXM B;  3WXI A;  4H0X B;  3L3U A;  1JL1 A;  2VGN A;  3QIP A;  4M7Y A;  3I56 N;  3VA0 A;  4FJ5 A;  1TAQ A;  4HWI A;  3CME N;  4Z4I A;  4BE2 A;  4CZL A;  2NRH A;  3HST B;  2GX9 A;  3LPU A;  2IC3 A;  4FCY A;  1Z26 A;  3K9J A;  2WUS A;  3MN6 A;  1IG9 A;  4RTF D;  1YAG A;  4JK7 A;  3Q7B A;  4OKK A;  4DV0 K;  1A5V A;  4H4O A;  3CM5 A;  3NDK A;  3SUN A;  1QSL A;  3K5N A;  1RNH A;  3BF3 A;  3ZT3 A;  3O4N A;  3LWM A;  2OZS A;  4PKG A;  4BR2 A;  1KRP A;  4FLZ A;  3AO3 A;  3M8S A;  3CCQ N;  4U7B A;  3I8B A;  3CFP A;  4JI3 K;  4YDU A;  3MXM A;  3ZT0 A;  4ISF A;  4AM6 A;  1BHL A;  2KFN A;  3TTC A;  4JKG A;  3E9O A;  3R9P A;  4DTJ A;  3J80 O;  3SAH A;  4CVN E;  1C1C A;  1NK6 A;  3FFI A;  3DLH A;  1WNS A;  5D3G A;  2NRV A;  3IFR A;  2O8C A;  5FPM A;  2OPP A;  3JYT A;  1A5W A;  2E1Y A;  5DK5 A;  5GIO A;  4ZTJ A;  4FJ8 A;  4F4K A;  2F9T A;  1Z05 A;  3KK7 A;  4CI6 A;  1GLD G;  4BQZ A;  4GKK K;  4R5P A;  4DFM A;  3KLG A;  5EX5 A;  4LFB K;  4PL7 A;  3HI0 A;  3M8Q A;  5F2R A;  3A5M C;  1RFQ A;  4YNQ A;  1FW6 A;  1TK8 A;  4B9V A;  4BR9 A;  5CE3 A;  2JWL A;  1VQL N;  2P9P B;  4BG9 A;  4DTR A;  2UUC K;  5AQH A;  4YOY A;  3CCS N;  1JJ2 M;  3J7Y P;  5KTQ A;  4O8U A;  1LW2 A;  3OBW A;  4YOV A;  4FJK A;  3I33 A;  1JLF A;  4M63 C;  1WLJ A;  3H3N O;  3LDN A;  4ID5 A;  5CZ2 A;  3LP0 A;  1DT9 A;  4BRN A;  3I55 N;  4JK9 A;  1MWM A;  4GV6 A;  4NCG A;  3ATU A;  4I7F A;  1OKJ A;  1D9D A;  1S9G A;  4MDA A;  3OW2 M;  3NVM A;  2VQF K;  2WFB A;  1ZBU A;  1SZ2 A;  1EET A;  2FBY A;  2D1K A;  1ESV A;  3VQ7 A;  4DSF A;  3U8X A;  4F2R A;  2D0C A;  4H5W A;  4AIL C;  3SUP A;  1IG8 A;  5C24 A;  3N4P A;  3K58 A;  1IH7 A;  3OYA A;  3VOV A;  5LJV A;  4CK3 A;  4LSL A;  3F9M A;  2ZM6 K;  1ZBI A;  2BDP A;  2J4R A;  3CFO A;  4PL8 A;  4IJN A;  1B92 A;  4GW6 A;  4BRP A;  4IDK A;  5BPM A;  3KLI A;  4QOZ B;  1YT3 A;  3KHY A;  3CQY A;  2P9U A;  3QML A;  4GKJ K;  1NG9 A;  3OYC A;  3V9X A;  1Q9X A;  3VQD A;  5TKW A;  4BRG A;  1JLG A;  2RPI A;  2YHA A;  2A1R A;  3PO4 A;  4FYD A;  4O44 A;  4HVJ A;  3M6G A;  2HHU A;  3FZK A;  4EZ9 A;  1HRH A;  1TYQ A;  2IDO A;  1VQM N;  4FJX A;  4O55 A;  1BCO A;  4HCB A;  2XY8 A;  1BQM A;  2P9I A;  2UYT A;  3WNH A;  4OGE A;  2VG7 A;  3T69 A;  3UKU A;  3AAP A;  1EWQ A;  3AVI A;  4IDH A;  1BA0 A;  4YY3 K;  1I94 K;  1V4S A;  1L3S A;  4JKG B;  3F2K A;  2E4L A;  4X65 K;  3GE1 A;  5FPE A;  4M41 A;  4MO5 A;  4JYA K;  3C95 A;  2HND A;  1GLC G;  2O8C B;  2E6M A;  2ZJP L;  3SMS A;  2F7T A;  1WAF A;  3BGR A;  3VEN A;  3LP3 A;  3CM6 A;  4DTU A; 
#chains in the Genus database with same CATH homology
 3V6D A;  2IS3 A;  1NK9 A;  1LAW A;  4C8M A;  3QEW A;  2B6A A;  4CIF A;  4FLV A;  2VWJ A;  3ZCM A;  1EXQ A;  3SPY A;  4CEO A;  3A2F A;  1X9W A;  1HNV A;  1C1A A;  4O5B A;  1IKV A;  2HB5 A;  4Y1D A;  3SPZ A;  5FDL A;  1ZYQ A;  1VSL A;  3QNN A;  1TKX A;  1QQC A;  2B5J A;  4FVM A;  4CJ4 A;  2BE2 A;  1BGX T;  4CHO A;  4E3S A;  3RRH A;  3U3G A;  5CYM A;  4O0I A;  1BIS A;  3SUQ A;  3VQA A;  1RTI A;  2KW4 A;  2E6L A;  2XHB A;  4M3X A;  3VQB A;  3C6U A;  2HVH A;  3OYN A;  4IBN A;  2X6N A;  1KVB A;  4B08 A;  3PX4 A;  3ZSQ A;  4ELU A;  2XY7 A;  3U6F A;  2G8W A;  2KZZ A;  3K5O A;  1RTD A;  3ZSV A;  1UAX A;  3VQ6 A;  4JLH A;  3SZ2 A;  3ZSO A;  3ZT2 A;  5E41 A;  4DSJ A;  4CJK A;  4QCL A;  3RTV A;  3L2R A;  5KGX A;  1WSF A;  4F2S A;  1BIU A;  1YVU A;  3V9W A;  4DWI A;  4B8C A;  4CJE A;  1TAU A;  3DRP A;  5HRP A;  2YNI A;  3RMA A;  1T7P A;  3DOL A;  4KTQ A;  4CF8 A;  3B6O A;  4M3R A;  3NH1 A;  1WAJ A;  4IFV A;  4W5N A;  4B9L A;  3VQ9 A;  3NAE A;  4BE1 A;  3SQ4 A;  3SQ1 A;  4N41 A;  1B9F A;  3TAE A;  1QTM A;  3F9K A;  2X78 A;  3NF8 A;  4CF9 A;  1U45 A;  4HUG A;  1T03 A;  3RRG A;  3HM9 A;  4CJ3 A;  1BQN A;  4JS5 A;  2P51 A;  4J2A A;  3LAL A;  1D9F A;  4C8L A;  3MED A;  4CGG A;  3JSM A;  2NUB A;  2HMI A;  4RW9 A;  3HPH A;  2W42 A;  3QEX A;  1TKD A;  2GV9 A;  4N5S A;  4CGI A;  4MQ3 A;  3T1A A;  4CGJ A;  1W0H A;  2VG6 A;  1N6Q A;  1I39 A;  3VN5 A;  4CEB A;  2QKK A;  4DTO A;  3S3O A;  1TL3 A;  1TGO A;  4ELT A;  3SNN A;  4C8K A;  4CF2 A;  3MEC A;  3CQ8 A;  3VA3 A;  1EX4 A;  4H8K A;  3KKR A;  4BWM A;  4HHT A;  2G8H A;  4DSI A;  2LSN A;  3OYI A;  3KK3 A;  1NJX A;  1J54 A;  4B9N A;  4Q0B A;  2QKB A;  3ZSW A;  2YKM A;  3L2V A;  2XY6 A;  1VSF A;  3SI6 A;  4FJN A;  3RR7 A;  1RTH A;  4FM1 A;  4FM0 A;  4M42 A;  5JS1 A;  1XI1 A;  4HTU A;  1VSK A;  4DMN A;  4FJM A;  1VRU A;  2RN2 A;  4FJ9 A;  1S9E A;  5KI6 A;  4CFC A;  2EX3 A;  4IG0 A;  4J2E A;  3SJJ A;  2WOM A;  3L2U A;  1QHT A;  4ELV A;  1CLQ A;  2PZS A;  1QS4 A;  2HHS A;  1W9H A;  5CYQ A;  4E1M A;  4OLB A;  3QO9 A;  5I42 A;  3SYZ A;  3PV8 A;  3SV3 A;  4J2D A;  4O4G A;  1U48 A;  1HYZ A;  4JRP A;  3TAP A;  3AVA A;  2HHW A;  1KFS A;  3AVL A;  5KRS A;  4FJJ A;  3F73 A;  3S9H A;  4FLT A;  4KI6 A;  1S1X A;  4HCC A;  3V1Q A;  4KI4 A;  4FJG A;  2KZM A;  4KB0 A;  5HRR A;  3ISN C;  4LH5 A;  3DYA A;  4FLY A;  4WE1 A;  4PQU A;  4XIU A;  2ITG A;  1R0A A;  4KPY A;  2YHB A;  3ZSZ A;  2BGG A;  1ASV A;  4DTM A;  4CF0 A;  1TKT A;  3LP2 A;  2R7Y A;  3PUF A;  4IKF A;  3LZI A;  4G1Q A;  4I2Q A;  4JS4 A;  1SKR A;  3OYH A;  3DMJ A;  4Z4G A;  1HYV A;  3SV4 A;  3OVN A;  3VQC A;  1KLN A;  4BAC A;  4I9L A;  1RT1 A;  1SUQ A;  3OS2 A;  4ZTF A;  2HNY A;  2GBZ A;  3DLR A;  4RW4 A;  4CEC A;  3OYB A;  3RMD A;  3IS9 A;  3AO4 A;  2OPS A;  4HUF A;  3ZSY A;  3HYF A;  3ULD A;  3HVR A;  3KIO A;  4E89 A;  4CHQ A;  1BIZ A;  3P83 D;  1L5U A;  4B9U A;  2A1S A;  1J9A A;  1UA0 A;  1SL0 A;  1LAV A;  2OPQ A;  1RIL A;  4CE9 A;  1NJW A;  1C1B A;  1FK9 A;  1WSG A;  3AA3 A;  3HVT A;  3NH2 A;  3PX6 A;  4LSN A;  3DLE A;  1EKE A;  3I0R A;  5T7B A;  4GVM A;  2HW3 A;  3ZT1 A;  1QSY A;  2AJQ A;  4CEE A;  3D45 A;  3DRR A;  3UIQ A;  4FJH A;  2OYQ A;  4CEF A;  4FLX A;  1JL2 A;  1VSM A;  3OYG A;  4IG3 A;  1U49 A;  4DTS A;  1KSP A;  2OA8 A;  4EZ6 A;  4KAZ A;  2FC0 A;  1J5O A;  3K59 A;  3AO5 A;  4E7L A;  1NJY A;  5CY4 A;  4CFA A;  1MU2 A;  4KB1 A;  1RTJ A;  2FBT A;  3AVG A;  1X1P A;  1TV6 A;  4CEZ A;  3L8B A;  1BI4 A;  4CJP A;  1U4B A;  1SKS A;  4B3O A;  3LP1 A;  1TKZ A;  5HP1 A;  4KHN A;  3HK2 A;  2EHG A;  5FRO A;  4CJ5 A;  4DQQ A;  3TWH A;  1JXB A;  3HPG A;  2Z1J A;  1RDA A;  1RT4 A;  1HYS A;  3V9S A;  5J2N A;  1LV5 A;  3MAQ A;  3KJV A;  5KRT A;  3QEP A;  4DQS A;  4KTZ A;  4PA1 A;  1IKY A;  4Z0U A;  1ZBF A;  4C8O A;  4CIG A;  1HNI A;  3ALY A;  3RR8 A;  3DOK A;  1S6P A;  4CJT A;  4GMJ B;  4DLG A;  4ICL A;  4DU4 A;  1RBT A;  3RMC A;  3TI0 A;  1NKE A;  1CXU A;  1JLB A;  1RT5 A;  4CJS A;  1D5A A;  1TK5 A;  3QLH A;  1XHZ A;  1K6Y A;  1WN7 A;  1F21 A;  2Y1I A;  3KD5 E;  4M3W A;  4F8R A;  4FZX C;  2DFE A;  2XY5 A;  4KTW A;  1S5J A;  1NK4 A;  4RW7 A;  3C6T A;  4AHR A;  3G10 A;  5HRS A;  4KHW A;  3K57 A;  4O0J A;  1GOB A;  1RBS A;  4CIE A;  1BCM A;  1T05 A;  2HHT A;  5HRN A;  2XO7 A;  4E7I A;  1ASU A;  1RT2 A;  3CFR A;  5HLF A;  1XHX A;  5EU7 A;  4M45 A;  3D0P A;  4AH9 A;  3DLK A;  3NF6 A;  4B8A B;  3OYK A;  2YNG A;  1DTT A;  4FLU A;  3VQ4 A;  3MXJ A;  3QIO A;  4NYF A;  1VSH A;  3DM2 A;  4CHP A;  1VSD A;  4CFB A;  4KHQ A;  3TAF A;  3NCI A;  1HQU A;  2IOC A;  2ZE2 A;  4CHN A;  4DTN A;  4DFJ A;  3H08 A;  1YTU A;  4OPJ A;  4K8X A;  3AVF A;  4CES A;  3KLH A;  3PX0 A;  3ZSX A;  4E7H A;  1A5X A;  1HPZ A;  1KVA A;  4OJR A;  4DS5 A;  4KHY A;  3HO1 A;  2KFZ A;  3CG7 A;  2ATQ A;  3K5L A;  3TAG A;  3M8P A;  1WSJ A;  3AVC A;  4Q5V A;  1G15 A;  2F8T A;  3V9U A;  3OS0 A;  1VSI A;  3NE6 A;  2YV0 X;  3K2P A;  5KGW A;  1S1W A;  3QET A;  1L3U A;  3O3H A;  2G8I A;  2OZM A;  1NK7 A;  3SCX A;  1RT6 A;  4DU1 A;  1JXE A;  1FXX A;  3S3M A;  1RBU A;  5SZT A;  5I3U A;  3QER A;  3C94 A;  1FKO A;  3IG1 A;  3TAR A;  4FZY A;  1REV A;  3HP6 A;  1C0U A;  3P1G A;  5CZ1 A;  4I2P A;  1T8E A;  3KTQ A;  2QK9 A;  3WNG A;  4FJL A;  1NOZ A;  5FRM A;  1Z25 A;  2RF2 A;  1GOA A;  1KLM A;  4CF1 A;  1L3T A;  1CZB A;  3TR8 A;  4W5O A;  3L3U A;  3KD1 E;  4AHT A;  1JL1 A;  4H4M A;  1NKC A;  2ZQB A;  3QIP A;  3NHG A;  4KV8 A;  1IKW A;  3VA0 A;  4FJ5 A;  4ZHR A;  2HHX A;  1RBR A;  1TAQ A;  1X9M A;  4AHV A;  1QSS A;  4CEA A;  4KFB A;  4FK2 A;  3NGY A;  3VQQ A;  4Z4I A;  3LDS A;  4N47 A;  3HP9 A;  3ZSR A;  3V9Z A;  4BE2 A;  1S1U A;  2P1J A;  4CJW A;  2Y1J A;  1CXQ A;  4M3Y A;  3HST B;  3L3V A;  1ASW A;  3G0Z A;  3LPU A;  3EZ5 A;  1IO2 A;  1ZBH A;  2IC3 A;  4OPK A;  4FCY A;  3T3F A;  1Z26 A;  1TL1 A;  3ZT4 A;  2FBX A;  3VQ8 A;  1C0M A;  1RDB A;  4CHZ A;  1EP4 A;  3O4Q A;  1IG9 A;  3AVK A;  3OYE A;  3QNO A;  3KLF A;  3I8D A;  3AVB A;  3QEI A;  5HBM A;  4OKK A;  1A5V A;  4H4O A;  3CM5 A;  4Z4C A;  1WSI A;  3NDK A;  3SUN A;  3OYD A;  4BDY A;  4EP4 A;  3O3F A;  1QSL A;  3K5N A;  3SQ0 A;  1RNH A;  4K8Z A;  2IAJ A;  3KKS A;  4CFD A;  3ZT3 A;  5DMR A;  2VWK A;  1DLO A;  2YNH A;  3HPO A;  4N76 A;  3O4N A;  3LWM A;  4DU3 A;  1JLC A;  2OZS A;  4Z4H A;  3L2W A;  1KRP A;  4CJQ A;  3AO3 A;  4CK2 A;  2B4J A;  4FLZ A;  1B9D A;  3M8S A;  2D5R A;  4DSE A;  1SL1 A;  3KLE A;  4CEQ A;  3CFP A;  4KRF A;  4L8R B;  1WSE A;  3MXM A;  3RWU A;  3ZT0 A;  4M3T A;  1BHL A;  5J2M A;  2O4I A;  2KFN A;  4BE0 A;  4OKE A;  1VSJ A;  5C42 A;  4W5T A;  3O3G A;  1O1W A;  5JS2 A;  4JRQ A;  1RBV A;  4DTJ A;  2DTU A;  1U04 A;  1C1C A;  3M8R A;  1NK6 A;  3FFI A;  3DLH A;  1WNS A;  2G8U A;  3WNE A;  5HRO A;  5D3G A;  3AO2 A;  4CGH A;  5SWM A;  4DF4 A;  4DSK A;  3AA2 A;  3QIN A;  4KRE A;  2OPP A;  3JYT A;  3NF7 A;  3PY8 A;  4PY5 A;  1QE1 A;  1A5W A;  3DLG A;  4BWJ A;  3THV A;  3NH0 A;  1NOY A;  1LW0 A;  3TAQ A;  4PUO A;  1BI4 B;  2WON A;  4DS4 A;  5DK5 A;  4ZTJ A;  1DTQ A;  4QAG A;  4FJ8 A;  1RDD A;  4F4K A;  3OYL A;  2BAN A;  1UWB A;  2YNF A;  2FBV A;  4ID1 A;  3K5M A;  4FLW A;  3QES A;  4W5Q A;  1S6Q A;  1N5Y A;  4M3U A;  3V4I A;  4E1N A;  2G8K A;  4R5P A;  3RMB A;  4FJI A;  1ZBL A;  3L2Q A;  1VRT A;  4DFM A;  3LZJ A;  2F96 A;  2P5G A;  3KLG A;  2PY5 A;  2OPR A;  3NFA A;  4FW2 A;  3TAB A;  1JLQ A;  3M8Q A;  1S1V A;  2PYL A;  1FKP A;  1VSE A;  4KO0 A;  1I3A A;  4LY7 A;  4YNQ A;  5J1E A;  3HJF A;  4RW6 A;  4BDP A;  3CYM A;  1TK8 A;  4FK4 A;  1ITG A;  1WSH A;  4CER A;  4CJF A;  1NK0 A;  1JLE A;  2X74 A;  4MFB A;  4B9V A;  4OKJ A;  1Y97 A;  3E01 A;  3AVN A;  2Z1I A;  4DQI A;  4DTR A;  4CGF A;  4KKO A;  4B9T A;  3EY1 A;  2QXF A;  1TVR A;  1X9S A;  1XWL A;  5J2P A;  5KTQ A;  1NKB A;  1LW2 A;  2HVI A;  4KHU A;  2D0B A;  2IGI A;  2Z1G A;  4FZZ A;  3U3Y A;  3AA5 X;  4DFK A;  4FJK A;  3TAN A;  3IRX A;  4DLE A;  1JLF A;  3AA4 A;  2G8F A;  3LAK A;  3QEV A;  1SL2 A;  4F3O A;  4Z4F A;  5K14 A;  1WLJ A;  3NF9 A;  2JGU A;  3VQP A;  1KTQ A;  4FW1 A;  4ID5 A;  5J2Q A;  5C25 A;  5CZ2 A;  3LP0 A;  4DSL A;  1C6V A;  3OJU A;  2G8V A;  2DFF A;  3LAM A;  5FRN A;  1D8Y A;  4NCB A;  4CGD A;  4NCG A;  4LD0 A;  2XRI A;  3KK1 A;  3AVH A;  3OYJ A;  2HHV A;  2ZD1 A;  4DTP A;  4I7F A;  3NGI A;  4CED A;  4BDZ A;  1S9G A;  4DFP A;  1D9D A;  3AVM A;  4Y1C A;  1SV5 A;  3LPT A;  1ZBU A;  3AO1 A;  4AHU A;  3HL8 A;  2RKI A;  1NK8 A;  1EET A;  1HMV A;  4E19 A;  3AV9 A;  1U47 A;  2FBY A;  3VQ7 A;  4DSF A;  4YFU A;  3HXM A;  2D0C A;  2I5J A;  4F2R A;  1C0T A;  2X6S A;  5C24 A;  4AIL C;  3SUP A;  4E0D A;  4NCA A;  3K58 A;  4I9Q A;  1IH7 A;  2DFH A;  1JKH A;  3OYA A;  3SUO A;  2HNZ A;  4CK3 A;  4HUE A;  3KK2 A;  3SQ2 A;  4LSL A;  3DI6 A;  4UQG A;  1J53 A;  1UA1 A;  1CZ9 A;  3VQE A;  1ZBI A;  3TAM A;  2BDP A;  1HQE A;  3VQ5 A;  3EYZ A;  4Z4E A;  3HT3 A;  3CFO A;  4N56 A;  1XC9 A;  1B92 A;  3MXI A;  4GW6 A;  3LWL A;  1IKX A;  4B9S A;  2P5O A;  4KHS A;  4IDK A;  4AHS A;  3ASM A;  1SKW A;  4J2B A;  3V1O A;  1KFD A;  3KLI A;  1YT3 A;  4QOZ B;  4LH4 A;  1L3V A;  2O4G A;  3DLB A;  3OYC A;  3V9X A;  1Q9X A;  2ETJ A;  3DRS A;  3MEE A;  3VQD A;  4CJV A;  4CK1 A;  3V81 A;  4PWD A;  1JLG A;  1UOC A;  2KQ2 A;  3WNF A;  3OJS A;  3B6P A;  4AHC A;  3OYM A;  1NJZ A;  2RPI A;  4DQP A;  3P5J A;  4F3T A;  4CJU A;  4DG1 A;  2YHA A;  2A1R A;  3PO4 A;  4FYD A;  4C8N A;  4FJ7 A;  4O44 A;  1S1T A;  4HVJ A;  1JLA A;  1LWF A;  2HHU A;  2PYJ A;  1TK0 A;  1HRH A;  1LWC A;  2IDO A;  4EZ9 A;  4FJX A;  1VK0 A;  4O55 A;  2YKN A;  3MEG A;  3LAN A;  1BCO A;  1KVC A;  3T19 A;  2Q3S A;  4CHY A;  4HCB A;  1YTA A;  2XY8 A;  1GOC A;  1BL3 A;  3NGZ A;  1HJR A;  1BQM A;  4OVL A;  4M3Z A;  2JLE A;  3WNH A;  4OGE A;  3OY9 A;  2VG7 A;  4E7K A;  3IAY A;  2GUI A;  3I0S A;  4RW8 A;  4TSX A;  4EP5 A;  4W5R A;  3ITH A;  4IFY A;  3OS1 A;  1RCH A;  3OYF A;  4FXD A;  1KCF A;  1RT3 A;  1NK5 A;  2KTQ A;  3V1R A;  4B9M A;  3AVI A;  1Q8I A;  3S3N A;  4DF8 A;  1L3S A;  4FK0 A;  3BDP A;  2E4L A;  4CCH A;  4DTX A;  4E7J A;  2D0A A;  2F8S A;  4NYN A;  1LWE A;  4FM2 A;  4M41 A;  2HHQ A;  3C95 A;  2Z1H A;  3NBP A;  1RDC A;  2HND A;  1RT7 A;  2DY4 A;  3AVJ A;  4DQR A;  4OLA A;  2E6M A;  3PO5 A;  1Q9Y A;  1WAF A;  2VG5 A;  4OGC A;  4CJR A;  3BGR A;  4CJL A;  3LP3 A;  3CM6 A;  4RG8 A;  4DTU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...