4DV0K

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u20g
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
116
structure length
116
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
total genus 27
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4dv0K00
4X66K 1XMQK 4LF5K 4JYAK 5BR8K 3OTOK 4DR6K 4JI4K 4CW7B 3J80O 2UUAK 4NXMK 2VQFK 2UUBK 4DR2K 4JI7K 4JV5K 4DV4K 4JI6K 4X64K 4LF7K 4GKJK 5FLXO 4X65K 4DV0K 4DV3K 3JAMO 4DV7K 4LF8K 5IWAK 4OX9K 4DV1K 4LF6K 4X62K 4LFAK 1N32K 4GKKK 4JI2K 4DR1K 4JI8K 2F4VK 4DR5K 1N33K 1HNWK 1N36K 2ZM6K 4LF9K 1IBKK 5LL6Z 5IT9O 2VQEK 2UU9K 3J7YP 2HHHK 1IBMK 3T1HK 1N34K 1HNXK 4KHPK 4K0KK 4LFCK 4CVNE 3T1YK 1HNZK 1J5EK 2UXCK 3J7AP 4JI1K 4DV2K 4DUYK 4DV6K 1XMOK 2E5LK 5A2QO 1IBLK 4DV5K 4NXNK 4LF4K 4AQYK 4B3RK 3J81O 4YY3K 4DR7K 1FJGK 4V19S 4B3SK 1XNQK 4DR4K 5LMNK 4B3MK 1I94K 1HR0K 4YHHK 2UXDK 4LFBK 4JI5K 4JI0K 2UXBK 1XNRK 4B3TK 5AJ3K 4DR3K 4JI3K 5LMUK 4DUZK 2UUCK
chains in the Genus database with same CATH superfamily
1CZBA 1HYZA 1VHXA 4LF5K 4YORA 5BR8K 4CE9A 5F0XA 3O4WA 1Q8IA 1N5YA 4GVEA 4IJAA 5JVHL 3AO4A 4WE1A 3PSFA 1B9DA 3V9WA 2AP1A 4R79A 1KLNA 2O8CA 3DRPA 4K43A 2NRXA 4X64K 4FWRA 4DTPA 1VQ6N 2E1YA 4EFHA 3EYZA 1NBWA 3OYNA 3TR8A 1WBDA 3WNFA 2GX9A 3L4QA 3TAQA 3S41A 3L6QA 3ZSOA 3OYLA 4E1MA 1EETA 1WSFA 4OX9K 1EWQA 5KGWA 2FF6A 1TK5A 5FDLA 4B1YB 1NWKA 3OYJA 2ZGYA 2D4WA 5T7BA 4QCLA 1CLQA 3RR8A 2HBLA 4MO5A 3AA5X 4W5RA 3OYCA 1OH8A 1SL1A 1IKWA 2IOCA 2RKIA 4DFJA 4KB0A 3VA0A 5AQZA 5E26A 2GWJA 4EHTA 1IH7A 1SKSA 1L3TA 4CFCA 3HL8A 3A5MC 4WYBA 4CZLA 3QEPA 3KD5E 4CJLA 2CH5A 5EY4A 3OBWA 1JJ2M 4NB4A 2ETJA 2HMPA 1TL3A 2KHOA 4CIEA 1CZ9A 4LFCK 3DLHA 2Z1JA 2E2NA 4OJRA 4GV9A 4DS5A 3FGUA 1GLEG 4EAHD 2AJQA 3AA4A 1RGIA 4GV3A 1G99A 4OO1J 1YXQA 3J81O 2O8FA 2XY5A 4MDAA 4KHWA 1RT1A 2YHXA 3QLHA 4J2BA 3THXA 5HRNA 4IEIA 4FJ5A 1I39A 2G8FA 3RWUA 5EXWA 3TTCA 4E1NA 3FLCO 4Y1DA 1JL2A 3HOSA 3NVMA 3NF6A 4CFBA 2HBKA 4FWLA 3K9JA 2VWJA 2NRWA 4H0YB 4BQLA 2P9UA 3AAPA 5C24A 4CJWA 1K9MO 1J53A 1UAXA 1VAZA 3NAEA 1NGEA 4AF1A 3J80O 3D45A 3GE1A 3B6PA 4NLBA 2WOMA 1QZ5A 4BC2A 2P51A 1BCOA 4HCBA 3KLEA 2OYQA 3LDNA 4DV4K 3CMAN 4KHYA 4EP4A 3THYA 3SQ1A 4CD3A 4KHUA 4CGJA 4FWQA 4E7IA 3OYKA 4YOXA 3DYAA 3CJBA 1S1UA 2GWKA 3W0LA 4M45A 3BP8A 2OPSA 4FZXC 5LJWA 1EXQA 3THWA 3MX5A 1QE1A 4FPBA 1NGBA 3DRSA 4IO9L 4KTQA 3WQUA 2PYLA 2NLXA 3ZT3A 4BG8A 4FZYA 2ZWHA 4CFAA 4UQGA 3SUQA 3DOKA 3Q7CA 1C0TA 3QIPA 3VGMA 4KTZA 1GLCG 4LH5A 3HP6A 4FJNA 3WNGA 1QTMA 3UKUB 1N34K 1X9JA 1JCGA 5J1EA 1RNHA 1YTUA 1JKHA 5GAEP 2JLEA 4YOTA 2UXCK 5GAGP 4KHSA 3PV8A 1T6CA 1BL3A 3AVGA 5BPNA 4DV5K 4PL8A 4ISGA 2O4IA 1A5VA 1QQNA 4FW2A 2E1ZA 3OJSA 1QVFM 2O8CB 5E41A 3TU5A 3J8AA 2HVIA 4JHDA 3QEIA 2D0CA 1Q7YO 4PQUA 3LDPA 2X6NA 3PIPL 4QS9A 2Z1IA 3PLAA 2DFHA 2G8IA 4KBOA 4WQ5C 4DU1A 2B4JA 4PKHA 3ZCMA 4RWTA 1WBBA 4JYAK 4CZJA 4O5BA 1W97L 4B1XB 3L0QA 4JRQA 5C10A 1WUAA 4FLYA 4MFBA 3O4NA 3E9LA 1QQCA 3ALYA 3U8XA 5HL7L 4FK2A 2P9IB 1C6VA 2BE2A 1JLAA 3LDLA 1EX4A 2YNFA 3ZSQA 2P5OA 3F5TA 3JAMO 4M42A 3O8MA 4I6MB 3QINA 4CJQA 2Q97A 4KHNA 3I55N 1SS6A 1U2VA 3I8BA 1NJZA 3D2FB 3VQEA 4W5OA 3CCUN 2NRHA 3NFAA 4LD0A 1J5OA 3CMEN 1TVRA 2DFFA 5AFUA 2VGMA 3HK2A 4JKGB 3AY9A 1M1KO 2O8FB 1O1WA 1SZ2A 1T6DA 1GLLO 2E8AA 2Q0UA 3SK3A 2HHUA 3VQAA 3THXB 3VQ6A 2HW3A 1QSLA 1YUWA 5AQVA 1S1TA 3QEXA 3O1BA 3VQDA 4F8RA 5HRSA 4YOVA 3RSEB 3BF3A 4ILJA 4BDYA 1D9FA 4F3OA 2P9UB 3C6HA 3TABA 3CPWM 2YNIA 4KKOA 2HNYA 4RW7A 1J54A 3KJVA 3CHWA 3VMFB 3BZKA 3C7NB 4HWIA 3NBPA 4B3RK 4F2RA 1GLFO 3E1YA 3MMVA 3ZX0A 2FBYA 3DXKA 2IS3A 4RW9A 1NMNA 3QBXA 5JS2A 4KAZA 2F9WA 4YHHK 4O0JA 1HUXA 4DSJA 1GOCA 3PO5A 3CJCA 4FJ7A 2QM1A 5M1PA 1W7AA 5CZ1A 1YI2N 3AGRA 3LDQA 3TTDA 3RVCA 1KAZA 2UUCK 3FZLA 1HQUA 3HYFA 4BRHA 1S72N 1NNEA 4CEBA 4CZFA 2NRVA 4CW7B 4DSFA 3VESA 3CC7N 2AA4A 4IBNA 1RBUA 4FJKA 1JLFA 3HPGA 1D5AA 4BR4A 4CEOA 4H5WA 4PWDA 2FXUA 4JI6K 4LF7K 3V9ZA 1NM1A 3HPOA 3MXJA 3E9PA 1VQ7N 1NK6A 4DV7K 4OPHA 3SQ4A 2DPNA 2GEMA 3E01A 3T1AA 1VK0A 4FJGA 4GKKK 5TKYA 1BG3A 3ZT0A 3K5MA 5DM7L 4Z4CA 1VSMA 4B08A 4M3ZA 1NGAA 2VGNA 4CCHA 3MN6A 5M1NA 4CJRA 1IBKK 2P9PA 4FLWA 4DTNA 5LL6Z 1LW0A 4OPJA 3PX0A 1FW6A 3CCJN 5AQLA 2CGKA 4CEAA 3M8PA 2A40A 2YHWA 3OVNA 4BY9C 3LWLA 1GLJO 1IKVA 3LM9A 4KHPK 1YHQN 4FYDA 1BUPA 4IKFA 4ZTFA 2W40A 1J5EK 2V7YA 5AQIA 1S9GA 3OW2M 1ASUA 1ZXOA 4ELVA 3CIPA 3ZYYX 4A61A 1QQMA 2KZZA 3C65A 4ID1A 3VTIA 3G4SN 4BROA 4CZEA 1HMVA 3BF1A 1Q81O 2OCEA 1BHLA 2YV0X 4TSXA 3AO2A 4CJTA 3L8BA 4DFMA 1XC9A 3KIOA 4CEEA 1WLJA 3CC4N 3TAMA 3OYHA 3MAQA 1YVUA 3PX4A 1NOYA 5J2NA 3LP1A 1VRUA 4CJEA 2HNDA 4IOAL 4YDUA 5AJ3K 4BE0A 1UOCA 3AV9A 1VRTA 1TYQB 3AO3A 5C2DA 2F7TA 4ID5A 4KTWA 3H3NO 1ILYA 4KH4A 1W0HA 4DKWA 2OZSA 1UWBA 4JI4K 3G0ZA 3ZSVA 1W9HA 2FF3B 4DCHA 3OS2A 2P9LA 4NXMK 2P1JA 2QXLA 3DLBA 4XH4A 2YCHA 3KTQA 1RT4A 1SKRA 3CCRN 2YNHA 1J9AA 4DTJA 4C23A 1K8AO 1ESVA 3I56N 1E4GT 3MN9A 3M3ZA 4B9TA 1TUYA 3HPHA 4AM6A 3VF2A 3DI6A 2IIRA 5F2RA 4BC5A 3HXMA 3ZSWA 3DWLA 4LC9B 3O08A 1FKPA 5J2PA 1T8EA 1O13A 5EU7A 3U3YA 3R9PA 3C94A 1FKOA 4AHVA 4LSNA 3CJ7A 4HTUA 3QIOA 3F73A 3H1QA 2O8BA 1IBMK 1RT5A 2GELA 3AARA 3V1QA 3VF6A 5CE3A 1JXEA 1V4TA 3NF8A 1HNIA 2ASMA 4IG0A 1NGDA 4BR0A 3PY8A 1NGCA 3U4LA 2QXFA 3CJAA 1VSFA 1NK0A 1XHZA 5C0YA 1WSGA 3TAFA 2R7YA 5AQTA 3HTVA 4FJHA 3CQ8A 4DU3A 3P38A 4HUFA 3ENOA 1KRPA 3MXIA 4CGFA 2XHBA 2HHXA 1VSLA 1YTAA 2E88A 1YJNN 4RTFD 4BRFA 5GIOA 3EO3A 2G8KA 2HSTA 3IG1A 2UXDK 2LSNA 4DLGA 4K8XA 5LJVA 2HF4A 3HVRA 5K14A 1DKGD 4CJFA 4DUZK 3WXIA 4E7HA 4CD1A 2IGIA 4FM1A 3EKUA 3VQ5A 1DGKN 3OTOK 4Z4EA 3U9DA 3VQ8A 3THVA 1RBSA 4CGDA 4DSLA 3FFIA 3PSIA 3P5JA 4FK4A 3MCAB 4CJPA 3H45C 1P8ZA 3K59A 2BH1A 3CYMA 4LSLA 5AQNA 4JV5K 3H46O 1RDWX 2W41A 5KRTA 4LH4A 4CEQA 1HLUA 1KVBA 1W2BM 2B5JA 4CIFA 4J2AA 3CXCM 4JKAA 4HUGA 1RBRA 4BRQA 3OYEA 3L3VA 3W3DA 3H1VX 2VG6A 4BRDA 3QNOA 1N33K 3SBTA 3G10A 4N41A 1XHXA 2A1SA 1X9SA 4WFAL 1WSEA 2Q3SA 2WC9A 1ASVA 1OKJA 4FXDA 2ZGZA 2UU9K 1XUPO 3MEGA 5EX5A 1TKDA 4KH5A 4RW6A 3V6DA 3CCLN 5KPZA 3G6EN 1NJWA 3CQXA 4OKJA 4BG9A 2YNGA 1K8KA 4JS5A 3ULDA 1BIUA 3CQYA 2F8TA 2ASPA 5CYMA 4WFNL 1WNSA 4PKGA 5AQUA 4C1NI 1G15A 3OHRA 1U45A 3DMJA 5FRNA 4JKDA 2VCPA 1NMDA 3ZLJA 5AZIA 2A3ZA 1REVA 1KVAA 5KGXA 4YFUA 1YAGA 4AH9A 5DK5A 4V19S 1SV5A 2NNWA 1B9FA 3VETA 1ZBLA 3LAKA 2IVNA 3ITHA 3JSMA 4WFBL 4MQ3A 3LAMA 4Z4FA 3P39A 3LP0A 2VWKA 5KPTA 3GBTA 3UIQA 1SQKA 3VEXA 3EE8A 5AZJA 4CJUA 2I7PA 3SMSA 3LWMA 1HJRA 3M1FA 3WNEA 3A5OC 1DLOA 3B8AX 3JYTA 1BGXT 1ZYQA 2P9SB 3MX2A 4B3OA 4BDZA 2Q1NA 1Q9YA 4M3TA 4JLHA 4OVLA 4N47A 5D3GA 3AVJA 3OYBA 3MECA 3NGZA 3DLGA 3VQ9A 3MN7A 2IVPA 1VQ8N 4ILHA 4DQQA 4CK1A 3RMAA 3NE6A 3D7EO 1HJOA 2QWOA 3CCMN 1QS4A 4Q5VA 3K2PA 3J7ZO 1MA9B 4XEIA 3O3HA 3D2EA 4M3RA 1NK9A 1JCFA 5M1FA 2P9KA 2QWRA 4F9OA 3BY5A 3JS6A 4E7JA 1Y64A 3P4IA 2F4VK 3SUNA 3NF9A 3VQCA 3TSPA 1NK5A 4JS4A 5HP1A 1RT2A 3NGIA 1RTHA 1J6ZA 3EZWA 1IO2A 5IT9O 3CPEA 1Q82O 1HNVA 5FPMA 4W5TA 2OANA 3WEEB 4QS7A 3SAFA 3CD6N 3G25A 4CERA 4ZHRA 1BA1A 1WAFA 4Z4IA 5AQRA 2O8EA 3TARA 4JNEA 3WNHA 3O9QA 3EN9A 1MDUB 3T7ZA 2J4RA 4DTSA 4KFBA 4DUYK 4CGGA 4CZKA 3TAEA 3EY1A 5I9EB 4FM2A 2BUPA 3SBGA 3WXKA 4LF4K 3DM2A 2P5GA 3I33A 1JLEA 3LPTA 3S9HA 2RN2A 4MLHA 5FPDA 2O8DB 3NGYA 2GUIA 3B6OA 4FJMA 1ZBHA 4CGIA 4MDBA 3OYFA 1D8YA 4WF9L 4K8ZA 4NO7A 2QWLA 2X74A 3AO5A 3CF5L 4FLXA 3VEWA 5ADXH 5JLFA 4Z4HA 3TAPA 1U48A 4FSVA 2OTLN 4JI0K 2UXBK 1ZBFA 4B3TK 4DR3K 3O9SA 1LWEA 3ZSYA 4B9QA 3NMUA 4IJNA 5M1QA 1Q18A 1L3SA 1HKGA 2RHKA 3L4IA 4X66K 2XO7A 3NVKA 2V52B 4QOZB 3LALA 2D1KA 3VA3A 1QSYA 3WXMB 1B92A 4GKJK 5C15A 3T3FA 4E3SA 4IXCA 1VSJA 1NGFA 4DV0K 5J2QA 1LCUA 3CCVN 1MWMA 4H5VA 5GADP 3KLFA 4GMJB 2HF3A 3K5NA 4DV1K 1QHAA 5HRRA 3O6WA 1KTQA 3F2KA 3BUZB 4X62K 1RDAA 3CI5A 1QZ6A 1BU6O 2HNZA 2KQ2A 1LW2A 5AQPA 1C0GA 4DQRA 3HVTA 4IG3A 1T7PA 2FBVA 4PHTX 4JK8A 2KKZA 5CY4A 3CJ1A 4BC4A 2OPPA 3O3GA 5M1OA 3SAHA 5EOYA 5AQXA 3RR7A 3CFOA 4DQ8A 4IEEA 4QAGA 4DQSA 3DLLL 3QNNA 2E4LA 1C1AA 1V4SA 3TTFA 2NRRA 2CH6A 1XMOK 4A2AA 1IBLK 4A59A 2D0AA 2A1RA 4Z94A 1X3NA 4W5QA 1JL1A 3QEVA 2XRIA 1TK0A 1EQYA 2RPIA 2W6LA 1XNQK 4O0IA 3MCPA 1NJXA 1KSPA 5BRHA 2FSJA 4H4OA 5I42A 5HLFA 2XY8A 4BQZA 4M3WA 3F9MA 1VSKA 1IKXA 1RDBA 2HVHA 3S3OA 2CGJA 1H1VA 2H3GX 3ULEA 4CF8A 1QVGM 1SAZA 1RBTA 2QK9A 3C6UA 3SZ2A 3THYB 3SI6A 4DG1A 4CF1A 3MWPA 4G9ZA 3ZX2A 4H0VB 3KK2A 5GIPA 4ICLA 5KI6A 5SWMA 5AQMA 3FE1A 4QS8A 3DLRA 3LDOA 3TI0A 3O5BA 1KAYA 4DSKA 4LF8K 2O8EB 2YX6A 3THWB 4ELUA 2WFBA 3QERA 4IDHA 4NYFA 1TKTA 4BRPA 2D0BA 1XC3A 4BRNA 4LFAK 3VERA 2F8SA 4FJ8A 4Z4GA 1BI4A 3EE9A 3I8DA 3VENA 1N36K 1LOTB 4CHOA 4CJ3A 1UA0A 2WUSA 4KPYA 4OKEA 3QESA 4BRKA 1RT7A 3ZEUA 3J7YP 2Y1JA 1C0MA 4GV6A 4CJKA 1CXUA 2E6MA 4BWJA 4A62A 1BCMA 4BVOA 1VQ5N 3VF4A 4JAXA 4ELTA 3T1YK 3E9OA 1GLDG 1RTJA 1YIJN 1DEJA 1QHTA 2QWNA 4CEFA 2HB5A 3AA3A 5A2QO 1WSIA 4B1UB 1BQMA 3KK1A 4B9MA 4JHDB 2WBNA 3FR0A 1MU2A 2YKMA 1WAJA 3DXMA 4B3SK 4R5PA 3ENBA 3KHYA 3IMXA 2VG7A 1VQLN 5CZ2A 2NRZA 1HPMA 4BACA 2QWQA 1EO1A 4FWMA 4BRMA 2NRTA 5ELZA 5MLCQ 4DB3A 3OS0A 5LMUK 1VSDA 1BDGA 1RTDA 3KKRA 4LY7A 4M7XA 3SQ2A 3PIOL 5HOOA 2Z1HA 3CFPA 3VQ7A 4WQ5A 5GAHP 2IDOA 3AVBA 3ZSRA 3AO1A 4DF8A 3AGKA 4J2EA 4UY8O 2YHBA 4BGBA 4MO4A 4JD2A 3ZETA 4CZMA 1WSJA 2QKKA 4YOUA 5FLXO 3CM6A 4Y0WA 4Q0BA 1XQSC 4B9NA 1U2VB 4N76A 3EEQA 3ZT2A 4E7LA 2HBJA 2HHSA 3GOIA 4IOXA 2PY5A 4EZ9A 3UE5A 1NK7A 3QFUA 1U47A 1X3MA 4DQPA 4IOCL 4LF6K 1YVNA 3C6AA 1T44A 1YT3A 3VOVA 4CF9A 2PAVA 4I7FA 4JI8K 5AQGA 1KXPA 3AVKA 3SJHA 1TK8A 1HNWK 2QI2A 1C1CA 3QMLA 3RRGA 2ZM6K 4NLCA 3RMDA 3SYZA 5TKWA 3EL2A 4M3XA 2KW4A 5DMRA 4BDPA 3OS1A 2A5XA 2VYPA 3TSQA 4FCYA 5SZTA 3FFKB 4DLEA 1RILA 2ITMA 4KRFA 4YNQA 3VPZA 4CHZA 4ILGB 3P83D 3V1OA 4NCGA 2BGGA 1NOZA 4FLZA 3FZHA 1RDDA 3A0IX 4DMNA 2D5RA 3IAYA 1GLAG 5BN9A 4DSIA 5AFUH 3DXKB 5EVZA 3LANA 2O4GA 5HBMA 5F1XA 4PUOA 4CZGA 2OPQA 2DTUA 4AHSA 3OYGA 2P9NA 1KCFA 1HR0K 3S3NA 1EWRA 2BTFA 2JGUA 4B1ZA 3M8RA 4AHTA 3OYAA 3ATUA 1RBVA 2Q0RA 2G8HA 2QW9A 1BI4B 1EP4A 5KQDA 4C8NA 4DR6K 5C25A 1KVCA 4H0TB 3SPYA 4L3QA 4AILC 4KH6A 4B8AB 1D9DA 1Q9XA 1Z6RA 1ZBSA 1BWFO 1Z25A 2V51B 3RMBA 1A5WA 3F9KA 4O44A 2OTJN 4FLUA 3IRXA 4JK7A 4JEPA 5JVGL 1T03A 1VQMN 1QQOA 3SNNA 2E2QA 4BR5A 4MLEA 2E20A 4CIGA 1OVYA 1BOTO 3ENHA 4CJ7A 4B1VA 3P31A 4OGEA 4KI6A 1RT3A 1HPZA 3ZX3A 5BRFA 3AVNA 4DR1K 3TPQA 1HYSA 1RDUA 1IKYA 2P9PB 4CBWA 4CHQA 1NK4A 1JXBA 5FPNA 3NDKA 1VQ9N 3AVHA 4JN4A 3MN5A 5KQ8A 2NUBA 3DXMB 1Q86O 1N8RO 4NYNA 4H0XB 3VEZA 4PL7A 5AQQA 2FC0A 2FBTA 2X78A 3PUFA 3IFRA 1RDCA 3K57A 4FPAA 1IG9A 1E4FT 4K0KK 4C8LA 4EHUA 4JK9A 4DTUA 3UKUA 2Z1GA 2WONA 1HNZK 3C95A 3L2QA 1TL1A 4JI1K 3I0RA 4IFYA 3NH0A 1LAVA 3N4QA 3IDHA 1QSSA 4AQYK 5I3UA 1ITGA 1NKCA 4FWKA 5BN8A 4JD2B 3ZETB 4RW8A 4OPAA 3SLCA 4J2DA 3VEYA 4W5NA 3K58A 4E19A 5C12A 4O55A 1VSEA 5FPEA 3K5OA 5FROA 1TUUA 4NCAA 3BGRA 4JKHA 3VEOA 1XNRK 1R0AA 1BQNA 5AQJA 1KFDA 3NH1A 4FLTA 1TAUA 4I9LA 2P9LB 4WQ4C 3QB0A 2X6SA 5JLHA 4C8KA 1VSIA 1TV6A 4DFKA 4IWVA 1YJWN 1VQNN 3HP9A 4DTRA 1Y97A 3VGLA 4JI7K 4FW1A 3V1RA 4B1WB 3CCEN 3A2FA 2YJFA 5BR9A 1RFQA 3WXJA 2DY4A 2D0PA 3R6MA 2P9IA 5BREA 3QDKA 1KLMA 4F3TA 5CYQA 3QO9A 5JICA 3OYIA 1SUQA 4BR9A 3ZSXA 3SMPA 2ITGA 2YKNA 4I6MA 4CJSA 4CF0A 4A5BA 4IZ9A 4BRIA 3M5RA 4M7YA 3D2FA 5AQYA 1X9MA 1KQSM 4IFVA 4DU4A 1CXQA 3GG4A 4N5SA 2O8BB 5B8HA 4JKGA 3H6EA 4L8RB 1U49A 2G8WA 3KWIA 2P9NB 2Y1IA 3HBTA 4PA1A 1NGHA 2RF2A 1GOBA 2FBXA 4BE1A 3V9XA 4RG8A 1JLCA 3NHGA 3P1GA 4BRCA 4CF2A 2JWLA 3LP2A 1ATSA 3QICA 3BEXA 4CJ4A 4HVJA 3KWGA 3RSEA 4AHUA 3RRHA 3SPZA 2EWSA 4DV2K 4GNIA 4DTMA 4DV6K 3V9UA 2ATQA 1MWKA 1U04A 4FK0A 4JKCA 4DQIA 1RCHA 3O9RA 1FJGK 1NKEA 3M8SA 4E89A 3GL1A 2YI1A 3V9SA 3C7NA 1X1PA 1HKCA 4KV8A 4K25A 3KK7A 3JXUA 4B3MK 4JKBA 1S1XA 5AQKA 4CJ5A 2HHVA 3KLGA 3H08A 3E66A 4I9QA 2YHYA 4BWMA 1S6PA 1P90A 1KC8O 2E2PA 4A57A 1JLGA 3IKMA 4XIUA 3OA9A 1DTTA 3KZBA 3AVMA 1R59O 2EHGA 1WSHA 3A5NC 5KRSA 2G8UA 2I5JA 5BRDA 4CZIA 3LP3A 2HMIA 2VQFK 2V7ZA 4DR2K 3QFPA 3MXMA 4K41A 3HOTA 3ATVA 4U67L 3O3FA 2Q31A 2UYTA 4CEZA 1Z05A 2JWKA 3D0PA 5GINA 4HTLA 1GOAA 4FL9A 4EIAA 3LZIA 1S5JA 4CEDA 2F96A 4B8CA 1YITN 3Q7BA 2PZSA 1N32K 3AVLA 2W6KA 4CBUA 4WCEL 3OYDA 4DR5K 2ZQBA 4JRPA 3L2UA 4I2QA 2I7NA 2ASOA 3OBYA 3R1XA 3I0SA 1NGJA 4OGCA 3WUHA 1K8KB 2KFNA 4C8MA 3VQ4A 3R8EA 1ZC6A 4GVMA 1BIZA 3QBWA 3R3LA 1KAXA 1RTIA 4IO8A 5AZIB 1K6YA 2GUPA 3OYMA 1HKBA 4H5TA 4BGAA 3TAGA 3ZT4A 3KD1E 1WN7A 4H8KA 2Q2RA 4U7BA 5C42A 3MWTA 1FXXA 4IFEA 2FLOA 5BPMA 3SV4A 3ISNC 4I2PA 5BPLA 4YDUC 1X9WA 4A2BA 4FOIA 4H5NA 5AZJB 4YOYA 4WQ4A 3H3OB 3OY9A 2HHQA 3SV3A 3SCXA 2IC3A 4DTOA 4JI5K 4ISEA 4HCCA 2IAJA 1U4BA 4JI3K 3CM5A 4OKKA 3HM8A 5C2FA 2A42A 4BRGA 3SAGA 3KLHA 4DSEA 2NZTA 1L3VA 3MEDA 5CR4A 1XMQK 4DHYA 3VN5A 2KFZA 1HRHA 3CCSN 5HRPA 1ATNA 1TYQA 3G71N 4CZHA 1F21A 1LWCA 2VWBA 4CHYA 3L2WA 4BREA 3BDPA 1C0FA 3NF7A 4CI6A 1SL0A 4F2SA 4GW6A 2RE2A 3SUPA 4FJJA 3KLIA 3C6TA 4FZZA 1VQPN 3D2EB 4G1QA 4X65K 1XWLA 2P9KB 3DLEA 4AHCA 1C1BA 1VQ4N 3QETA 2QTDA 3NCIA 2ZJPL 1UA1A 3CERA 3HT3A 1NJIO 2BANA 3FZKA 4CECA 3PO4A 3HZ6A 2IVOA 3HRGA 2ZJRL 3KVGA 3M8QA 3A8YA 3DJCA 2D0OA 4RW4A 4IDKA 2QEXN 1WOQA 4CGHA 2VQEK 4OLBA 4DS4A 2DFEA 1OVQA 2B6AA 3AVCA 3U6FA 1HNXK 1Z26A 4H5RA 2OZMA 3HO1A 4BRLA 2KZMA 4H0OA 1KFSA 1VQON 3KKSA 1OH7A 4CBXA 1OH6A 3VQBA 4OPKA 1ZBUA 3DRRA 1C0UA 3RMCA 1WB9A 3LL3A 4HHTA 1DTQA 3S3MA 2BDPA 4M3YA 3SUOA 4DR4K 1CZAN 3QEWA 3HM9A 4FLVA 4KO0A 4FOEA 3DAWA 3WQTA 1S3XA 4LFBK 1YF5L 4FVUA 3IS9A 3HSCA 1KD1O 5KTQA 4N56A 3VTHA 4CJVA 2ZJQL 4FJXA 4FJ9A 2VG5A 2GBZA 3CCQN 4XH1A 3O80A 4KREA 4BVPA 1YJ9N 2FSKA 3DLKA 3T69A 4BE2A 1NGGA 1T3VA 4FO0A 3WXLA 4CHNA 4HUEA 1I3AA 1JLQA 4H0PA 5KPRA 4Z0UA 4PKIA 3VQPA 1LV5A 4O8UA 1EKEA 3CG7A 4M3UA 3L3UA 4DV3K 3AVIA 5JMVA 3A5LC 1XI1A 5H1SQ 4FVMA 3ID8A 4DF4A 3UKRA 1NJYA 1L3UA 2XY6A 3MDQA 4CFDA 3M6GA 2PYJA 4BR7A 4XH5A 1LAWA 4A5AA 2YJEA 4BRAA 2WTUA 4CK3A 4H03B 1SL2A 3U9ZA 3LDSA 4CK2A 4O5FA 3D6RA 1VSHA 3V4IA 5AQOA 3U3GA 1HQEA 1JCEA 3C0BA 3O1WA 2PFUA 3TSUA 1BA0A 2QA4N 1LWFA 2FSNA 1HYVA 4NCBA 3FZMA 3T1HK 1S1WA 4FWNA 1U6ZA 2ZE2A 3EKSA 4CVNE 1NU0A 1S1VA 2ZD1A 3K5LA 5E84A 3K0SA 1NKBA 3KK3A 4KI4A 4M63C 2E5LK 3ZSZA 5LY3A 3CJ9A 1BISA 1TKZA 4FJIA 3HJFA 4OLAA 1S6QA 4H4MA 1OH5A 4FM0A 1N6QA 2QWPA 4DR7K 1RT6A 1TAQA 4EZ6A 3ID6A 2ZF5O 3EZ5A 1SKWA 4O4GA 1BO5O 4ISFA 5LMNK 1I94K 4J8FA 4JKFA 2A41A 3L2VA 3ULEB 3VGKA 3CFRA 4B9VA 3TWHA 1T05A 3GDQA 5M1KA 4FJLA 4B9SA 1NG9A 4ZTJA 2UUAK 4O8KA 3O4QA 2E2OA 3LPUA 2KTQA 1IG8A 3HSTB 3FZFA 3AVAA 2UUBK 3L2RA 3VEVA 2P9SA 4M41A 3WT0A 3TANA 3LM2A 2QKBA 1D4XA 1NGIA 1FK9A 2GTDA 4KHQA 4FWOA 3DOLA 4BC3A 3ZT1A 3PX6A 3OJUA 4B9UA 1IJJA 3AAQA 2CGLA 3RTVA 5IWAK 1ZBIA 1M90O 5AQHA 5DM6L 5AQSA 4DTXA 1IV0A 2EX3A 1VQKN 4FWPA 2E6LA 2XY7A 2GV9A 4JI2K 3NH2A 2YHAA 2HHWA 3V81A 2A6AA 3O9TA 4DFPA 5CHIA 5J2MA 2G8VA 4Y1CA 1ASWA 3ZEUB 4LF9K 4F4KA 4K42A 3LZJA 1S9EA 4C1NK 4E1JA 5ADXA 2HHHK 4RCHA 3VQQA 5AR0A 3UB5A 3T19A 3AVFA 3O9UA 1NLVA 1K73O 1JLBA 3HI0A 2OA8A 1E3MA 3WEEA 4YOWA 1DT9A 2Q36A 1TKXA 4C8OA 4GY2B 3J7AP 4AHRA 4E7KA 5AQWA 1ATRA 4B9LA 4NXNK 5HROA 5FRMA 1A5XA 3MEEA 4JKEA 2QWMA 4BR2A 2HOEA 4YY3K 2KLAA 3AA2A 3N4PA 3BZCA 4DWIA 2O8DA 2F9TA 2OPRA 3MK6A 3IUCA 4E0DA 3K9KA 4AM7A 1L5UA 5JS1A 4EP5A 1TGOA 3UKRB 3CETA 1NK8A 1GLBG 2HBMA 5AQFA 3ASMA 1S22A 3SJJA 4KB1A 2HHTA 3CC2N 4CHPA 1HX1A 4CESA 2W42A 3SQ0A 2PBDA 4PY5A 4FWSA
chains in the Genus database with same CATH topology
4X66K 1XMQK 4LF5K 4JYAK 5BR8K 3OTOK 4DR6K 4JI4K 4CW7B 3J80O 2UUAK 4NXMK 2VQFK 2UUBK 4DR2K 4JI7K 4JV5K 4DV4K 4JI6K 4X64K 4LF7K 4GKJK 5FLXO 4X65K 4DV0K 4DV3K 3JAMO 4DV7K 4LF8K 5IWAK 4OX9K 4DV1K 4LF6K 4X62K 4LFAK 1N32K 4GKKK 4JI2K 4DR1K 4JI8K 2F4VK 4DR5K 1N33K 1HNWK 1N36K 2ZM6K 4LF9K 1IBKK 5LL6Z 5IT9O 2VQEK 2UU9K 3J7YP 2HHHK 1IBMK 3T1HK 1N34K 1HNXK 4KHPK 4K0KK 4LFCK 4CVNE 3T1YK 1HNZK 1J5EK 2UXCK 3J7AP 4JI1K 4DV2K 4DUYK 4DV6K 1XMOK 2E5LK 5A2QO 1IBLK 4DV5K 4NXNK 4LF4K 4AQYK 4B3RK 3J81O 4YY3K 4DR7K 1FJGK 4V19S 4B3SK 1XNQK 4DR4K 5LMNK 4B3MK 1I94K 1HR0K 4YHHK 2UXDK 4LFBK 4JI5K 4JI0K 2UXBK 1XNRK 4B3TK 5AJ3K 4DR3K 4JI3K 5LMUK 4DUZK 2UUCK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X66 K;  1XMQ K;  4LF5 K;  4JYA K;  5BR8 K;  3OTO K;  4DR6 K;  4JI4 K;  4CW7 B;  3J80 O;  2UUA K;  4NXM K;  2VQF K;  2UUB K;  4DR2 K;  4JI7 K;  4JV5 K;  4DV4 K;  4JI6 K;  4X64 K;  4LF7 K;  4GKJ K;  5FLX O;  4X65 K;  4DV0 K;  4DV3 K;  3JAM O;  4DV7 K;  4LF8 K;  5IWA K;  4OX9 K;  4DV1 K;  4LF6 K;  4X62 K;  4LFA K;  1N32 K;  4GKK K;  4JI2 K;  4DR1 K;  4JI8 K;  2F4V K;  4DR5 K;  1N33 K;  1HNW K;  1N36 K;  2ZM6 K;  4LF9 K;  1IBK K;  5LL6 Z;  5IT9 O;  2VQE K;  2UU9 K;  3J7Y P;  2HHH K;  1IBM K;  3T1H K;  1N34 K;  1HNX K;  4KHP K;  4K0K K;  4LFC K;  4CVN E;  3T1Y K;  1HNZ K;  1J5E K;  2UXC K;  3J7A P;  4JI1 K;  4DV2 K;  4DUY K;  4DV6 K;  1XMO K;  2E5L K;  5A2Q O;  1IBL K;  4DV5 K;  4NXN K;  4LF4 K;  4AQY K;  4B3R K;  3J81 O;  4YY3 K;  4DR7 K;  1FJG K;  4V19 S;  4B3S K;  1XNQ K;  4DR4 K;  5LMN K;  4B3M K;  1I94 K;  1HR0 K;  4YHH K;  2UXD K;  4LFB K;  4JI5 K;  4JI0 K;  2UXB K;  1XNR K;  4B3T K;  5AJ3 K;  4DR3 K;  4JI3 K;  5LMU K;  4DUZ K;  2UUC K; 
#chains in the Genus database with same CATH topology
 1CZB A;  1HYZ A;  1VHX A;  4LF5 K;  4YOR A;  5BR8 K;  4CE9 A;  5F0X A;  3O4W A;  1Q8I A;  1N5Y A;  4GVE A;  4IJA A;  5JVH L;  3AO4 A;  4WE1 A;  3PSF A;  1B9D A;  3V9W A;  2AP1 A;  4R79 A;  1KLN A;  2O8C A;  3DRP A;  4K43 A;  2NRX A;  4X64 K;  4FWR A;  4DTP A;  1VQ6 N;  2E1Y A;  4EFH A;  3EYZ A;  1NBW A;  3OYN A;  3TR8 A;  1WBD A;  3WNF A;  2GX9 A;  3L4Q A;  3TAQ A;  3S41 A;  3L6Q A;  3ZSO A;  3OYL A;  4E1M A;  1EET A;  1WSF A;  4OX9 K;  1EWQ A;  5KGW A;  2FF6 A;  1TK5 A;  5FDL A;  4B1Y B;  1NWK A;  3OYJ A;  2ZGY A;  2D4W A;  5T7B A;  4QCL A;  1CLQ A;  3RR8 A;  2HBL A;  4MO5 A;  3AA5 X;  4W5R A;  3OYC A;  1OH8 A;  1SL1 A;  1IKW A;  2IOC A;  2RKI A;  4DFJ A;  4KB0 A;  3VA0 A;  5AQZ A;  5E26 A;  2GWJ A;  4EHT A;  1IH7 A;  1SKS A;  1L3T A;  4CFC A;  3HL8 A;  3A5M C;  4WYB A;  4CZL A;  3QEP A;  3KD5 E;  4CJL A;  2CH5 A;  5EY4 A;  3OBW A;  1JJ2 M;  4NB4 A;  2ETJ A;  2HMP A;  1TL3 A;  2KHO A;  4CIE A;  1CZ9 A;  4LFC K;  3DLH A;  2Z1J A;  2E2N A;  4OJR A;  4GV9 A;  4DS5 A;  3FGU A;  1GLE G;  4EAH D;  2AJQ A;  3AA4 A;  1RGI A;  4GV3 A;  1G99 A;  4OO1 J;  1YXQ A;  3J81 O;  2O8F A;  2XY5 A;  4MDA A;  4KHW A;  1RT1 A;  2YHX A;  3QLH A;  4J2B A;  3THX A;  5HRN A;  4IEI A;  4FJ5 A;  1I39 A;  2G8F A;  3RWU A;  5EXW A;  3TTC A;  4E1N A;  3FLC O;  4Y1D A;  1JL2 A;  3HOS A;  3NVM A;  3NF6 A;  4CFB A;  2HBK A;  4FWL A;  3K9J A;  2VWJ A;  2NRW A;  4H0Y B;  4BQL A;  2P9U A;  3AAP A;  5C24 A;  4CJW A;  1K9M O;  1J53 A;  1UAX A;  1VAZ A;  3NAE A;  1NGE A;  4AF1 A;  3J80 O;  3D45 A;  3GE1 A;  3B6P A;  4NLB A;  2WOM A;  1QZ5 A;  4BC2 A;  2P51 A;  1BCO A;  4HCB A;  3KLE A;  2OYQ A;  3LDN A;  4DV4 K;  3CMA N;  4KHY A;  4EP4 A;  3THY A;  3SQ1 A;  4CD3 A;  4KHU A;  4CGJ A;  4FWQ A;  4E7I A;  3OYK A;  4YOX A;  3DYA A;  3CJB A;  1S1U A;  2GWK A;  3W0L A;  4M45 A;  3BP8 A;  2OPS A;  4FZX C;  5LJW A;  1EXQ A;  3THW A;  3MX5 A;  1QE1 A;  4FPB A;  1NGB A;  3DRS A;  4IO9 L;  4KTQ A;  3WQU A;  2PYL A;  2NLX A;  3ZT3 A;  4BG8 A;  4FZY A;  2ZWH A;  4CFA A;  4UQG A;  3SUQ A;  3DOK A;  3Q7C A;  1C0T A;  3QIP A;  3VGM A;  4KTZ A;  1GLC G;  4LH5 A;  3HP6 A;  4FJN A;  3WNG A;  1QTM A;  3UKU B;  1N34 K;  1X9J A;  1JCG A;  5J1E A;  1RNH A;  1YTU A;  1JKH A;  5GAE P;  2JLE A;  4YOT A;  2UXC K;  5GAG P;  4KHS A;  3PV8 A;  1T6C A;  1BL3 A;  3AVG A;  5BPN A;  4DV5 K;  4PL8 A;  4ISG A;  2O4I A;  1A5V A;  1QQN A;  4FW2 A;  2E1Z A;  3OJS A;  1QVF M;  2O8C B;  5E41 A;  3TU5 A;  3J8A A;  2HVI A;  4JHD A;  3QEI A;  2D0C A;  1Q7Y O;  4PQU A;  3LDP A;  2X6N A;  3PIP L;  4QS9 A;  2Z1I A;  3PLA A;  2DFH A;  2G8I A;  4KBO A;  4WQ5 C;  4DU1 A;  2B4J A;  4PKH A;  3ZCM A;  4RWT A;  1WBB A;  4JYA K;  4CZJ A;  4O5B A;  1W97 L;  4B1X B;  3L0Q A;  4JRQ A;  5C10 A;  1WUA A;  4FLY A;  4MFB A;  3O4N A;  3E9L A;  1QQC A;  3ALY A;  3U8X A;  5HL7 L;  4FK2 A;  2P9I B;  1C6V A;  2BE2 A;  1JLA A;  3LDL A;  1EX4 A;  2YNF A;  3ZSQ A;  2P5O A;  3F5T A;  3JAM O;  4M42 A;  3O8M A;  4I6M B;  3QIN A;  4CJQ A;  2Q97 A;  4KHN A;  3I55 N;  1SS6 A;  1U2V A;  3I8B A;  1NJZ A;  3D2F B;  3VQE A;  4W5O A;  3CCU N;  2NRH A;  3NFA A;  4LD0 A;  1J5O A;  3CME N;  1TVR A;  2DFF A;  5AFU A;  2VGM A;  3HK2 A;  4JKG B;  3AY9 A;  1M1K O;  2O8F B;  1O1W A;  1SZ2 A;  1T6D A;  1GLL O;  2E8A A;  2Q0U A;  3SK3 A;  2HHU A;  3VQA A;  3THX B;  3VQ6 A;  2HW3 A;  1QSL A;  1YUW A;  5AQV A;  1S1T A;  3QEX A;  3O1B A;  3VQD A;  4F8R A;  5HRS A;  4YOV A;  3RSE B;  3BF3 A;  4ILJ A;  4BDY A;  1D9F A;  4F3O A;  2P9U B;  3C6H A;  3TAB A;  3CPW M;  2YNI A;  4KKO A;  2HNY A;  4RW7 A;  1J54 A;  3KJV A;  3CHW A;  3VMF B;  3BZK A;  3C7N B;  4HWI A;  3NBP A;  4B3R K;  4F2R A;  1GLF O;  3E1Y A;  3MMV A;  3ZX0 A;  2FBY A;  3DXK A;  2IS3 A;  4RW9 A;  1NMN A;  3QBX A;  5JS2 A;  4KAZ A;  2F9W A;  4YHH K;  4O0J A;  1HUX A;  4DSJ A;  1GOC A;  3PO5 A;  3CJC A;  4FJ7 A;  2QM1 A;  5M1P A;  1W7A A;  5CZ1 A;  1YI2 N;  3AGR A;  3LDQ A;  3TTD A;  3RVC A;  1KAZ A;  2UUC K;  3FZL A;  1HQU A;  3HYF A;  4BRH A;  1S72 N;  1NNE A;  4CEB A;  4CZF A;  2NRV A;  4CW7 B;  4DSF A;  3VES A;  3CC7 N;  2AA4 A;  4IBN A;  1RBU A;  4FJK A;  1JLF A;  3HPG A;  1D5A A;  4BR4 A;  4CEO A;  4H5W A;  4PWD A;  2FXU A;  4JI6 K;  4LF7 K;  3V9Z A;  1NM1 A;  3HPO A;  3MXJ A;  3E9P A;  1VQ7 N;  1NK6 A;  4DV7 K;  4OPH A;  3SQ4 A;  2DPN A;  2GEM A;  3E01 A;  3T1A A;  1VK0 A;  4FJG A;  4GKK K;  5TKY A;  1BG3 A;  3ZT0 A;  3K5M A;  5DM7 L;  4Z4C A;  1VSM A;  4B08 A;  4M3Z A;  1NGA A;  2VGN A;  4CCH A;  3MN6 A;  5M1N A;  4CJR A;  1IBK K;  2P9P A;  4FLW A;  4DTN A;  5LL6 Z;  1LW0 A;  4OPJ A;  3PX0 A;  1FW6 A;  3CCJ N;  5AQL A;  2CGK A;  4CEA A;  3M8P A;  2A40 A;  2YHW A;  3OVN A;  4BY9 C;  3LWL A;  1GLJ O;  1IKV A;  3LM9 A;  4KHP K;  1YHQ N;  4FYD A;  1BUP A;  4IKF A;  4ZTF A;  2W40 A;  1J5E K;  2V7Y A;  5AQI A;  1S9G A;  3OW2 M;  1ASU A;  1ZXO A;  4ELV A;  3CIP A;  3ZYY X;  4A61 A;  1QQM A;  2KZZ A;  3C65 A;  4ID1 A;  3VTI A;  3G4S N;  4BRO A;  4CZE A;  1HMV A;  3BF1 A;  1Q81 O;  2OCE A;  1BHL A;  2YV0 X;  4TSX A;  3AO2 A;  4CJT A;  3L8B A;  4DFM A;  1XC9 A;  3KIO A;  4CEE A;  1WLJ A;  3CC4 N;  3TAM A;  3OYH A;  3MAQ A;  1YVU A;  3PX4 A;  1NOY A;  5J2N A;  3LP1 A;  1VRU A;  4CJE A;  2HND A;  4IOA L;  4YDU A;  5AJ3 K;  4BE0 A;  1UOC A;  3AV9 A;  1VRT A;  1TYQ B;  3AO3 A;  5C2D A;  2F7T A;  4ID5 A;  4KTW A;  3H3N O;  1ILY A;  4KH4 A;  1W0H A;  4DKW A;  2OZS A;  1UWB A;  4JI4 K;  3G0Z A;  3ZSV A;  1W9H A;  2FF3 B;  4DCH A;  3OS2 A;  2P9L A;  4NXM K;  2P1J A;  2QXL A;  3DLB A;  4XH4 A;  2YCH A;  3KTQ A;  1RT4 A;  1SKR A;  3CCR N;  2YNH A;  1J9A A;  4DTJ A;  4C23 A;  1K8A O;  1ESV A;  3I56 N;  1E4G T;  3MN9 A;  3M3Z A;  4B9T A;  1TUY A;  3HPH A;  4AM6 A;  3VF2 A;  3DI6 A;  2IIR A;  5F2R A;  4BC5 A;  3HXM A;  3ZSW A;  3DWL A;  4LC9 B;  3O08 A;  1FKP A;  5J2P A;  1T8E A;  1O13 A;  5EU7 A;  3U3Y A;  3R9P A;  3C94 A;  1FKO A;  4AHV A;  4LSN A;  3CJ7 A;  4HTU A;  3QIO A;  3F73 A;  3H1Q A;  2O8B A;  1IBM K;  1RT5 A;  2GEL A;  3AAR A;  3V1Q A;  3VF6 A;  5CE3 A;  1JXE A;  1V4T A;  3NF8 A;  1HNI A;  2ASM A;  4IG0 A;  1NGD A;  4BR0 A;  3PY8 A;  1NGC A;  3U4L A;  2QXF A;  3CJA A;  1VSF A;  1NK0 A;  1XHZ A;  5C0Y A;  1WSG A;  3TAF A;  2R7Y A;  5AQT A;  3HTV A;  4FJH A;  3CQ8 A;  4DU3 A;  3P38 A;  4HUF A;  3ENO A;  1KRP A;  3MXI A;  4CGF A;  2XHB A;  2HHX A;  1VSL A;  1YTA A;  2E88 A;  1YJN N;  4RTF D;  4BRF A;  5GIO A;  3EO3 A;  2G8K A;  2HST A;  3IG1 A;  2UXD K;  2LSN A;  4DLG A;  4K8X A;  5LJV A;  2HF4 A;  3HVR A;  5K14 A;  1DKG D;  4CJF A;  4DUZ K;  3WXI A;  4E7H A;  4CD1 A;  2IGI A;  4FM1 A;  3EKU A;  3VQ5 A;  1DGK N;  3OTO K;  4Z4E A;  3U9D A;  3VQ8 A;  3THV A;  1RBS A;  4CGD A;  4DSL A;  3FFI A;  3PSI A;  3P5J A;  4FK4 A;  3MCA B;  4CJP A;  3H45 C;  1P8Z A;  3K59 A;  2BH1 A;  3CYM A;  4LSL A;  5AQN A;  4JV5 K;  3H46 O;  1RDW X;  2W41 A;  5KRT A;  4LH4 A;  4CEQ A;  1HLU A;  1KVB A;  1W2B M;  2B5J A;  4CIF A;  4J2A A;  3CXC M;  4JKA A;  4HUG A;  1RBR A;  4BRQ A;  3OYE A;  3L3V A;  3W3D A;  3H1V X;  2VG6 A;  4BRD A;  3QNO A;  1N33 K;  3SBT A;  3G10 A;  4N41 A;  1XHX A;  2A1S A;  1X9S A;  4WFA L;  1WSE A;  2Q3S A;  2WC9 A;  1ASV A;  1OKJ A;  4FXD A;  2ZGZ A;  2UU9 K;  1XUP O;  3MEG A;  5EX5 A;  1TKD A;  4KH5 A;  4RW6 A;  3V6D A;  3CCL N;  5KPZ A;  3G6E N;  1NJW A;  3CQX A;  4OKJ A;  4BG9 A;  2YNG A;  1K8K A;  4JS5 A;  3ULD A;  1BIU A;  3CQY A;  2F8T A;  2ASP A;  5CYM A;  4WFN L;  1WNS A;  4PKG A;  5AQU A;  4C1N I;  1G15 A;  3OHR A;  1U45 A;  3DMJ A;  5FRN A;  4JKD A;  2VCP A;  1NMD A;  3ZLJ A;  5AZI A;  2A3Z A;  1REV A;  1KVA A;  5KGX A;  4YFU A;  1YAG A;  4AH9 A;  5DK5 A;  4V19 S;  1SV5 A;  2NNW A;  1B9F A;  3VET A;  1ZBL A;  3LAK A;  2IVN A;  3ITH A;  3JSM A;  4WFB L;  4MQ3 A;  3LAM A;  4Z4F A;  3P39 A;  3LP0 A;  2VWK A;  5KPT A;  3GBT A;  3UIQ A;  1SQK A;  3VEX A;  3EE8 A;  5AZJ A;  4CJU A;  2I7P A;  3SMS A;  3LWM A;  1HJR A;  3M1F A;  3WNE A;  3A5O C;  1DLO A;  3B8A X;  3JYT A;  1BGX T;  1ZYQ A;  2P9S B;  3MX2 A;  4B3O A;  4BDZ A;  2Q1N A;  1Q9Y A;  4M3T A;  4JLH A;  4OVL A;  4N47 A;  5D3G A;  3AVJ A;  3OYB A;  3MEC A;  3NGZ A;  3DLG A;  3VQ9 A;  3MN7 A;  2IVP A;  1VQ8 N;  4ILH A;  4DQQ A;  4CK1 A;  3RMA A;  3NE6 A;  3D7E O;  1HJO A;  2QWO A;  3CCM N;  1QS4 A;  4Q5V A;  3K2P A;  3J7Z O;  1MA9 B;  4XEI A;  3O3H A;  3D2E A;  4M3R A;  1NK9 A;  1JCF A;  5M1F A;  2P9K A;  2QWR A;  4F9O A;  3BY5 A;  3JS6 A;  4E7J A;  1Y64 A;  3P4I A;  2F4V K;  3SUN A;  3NF9 A;  3VQC A;  3TSP A;  1NK5 A;  4JS4 A;  5HP1 A;  1RT2 A;  3NGI A;  1RTH A;  1J6Z A;  3EZW A;  1IO2 A;  5IT9 O;  3CPE A;  1Q82 O;  1HNV A;  5FPM A;  4W5T A;  2OAN A;  3WEE B;  4QS7 A;  3SAF A;  3CD6 N;  3G25 A;  4CER A;  4ZHR A;  1BA1 A;  1WAF A;  4Z4I A;  5AQR A;  2O8E A;  3TAR A;  4JNE A;  3WNH A;  3O9Q A;  3EN9 A;  1MDU B;  3T7Z A;  2J4R A;  4DTS A;  4KFB A;  4DUY K;  4CGG A;  4CZK A;  3TAE A;  3EY1 A;  5I9E B;  4FM2 A;  2BUP A;  3SBG A;  3WXK A;  4LF4 K;  3DM2 A;  2P5G A;  3I33 A;  1JLE A;  3LPT A;  3S9H A;  2RN2 A;  4MLH A;  5FPD A;  2O8D B;  3NGY A;  2GUI A;  3B6O A;  4FJM A;  1ZBH A;  4CGI A;  4MDB A;  3OYF A;  1D8Y A;  4WF9 L;  4K8Z A;  4NO7 A;  2QWL A;  2X74 A;  3AO5 A;  3CF5 L;  4FLX A;  3VEW A;  5ADX H;  5JLF A;  4Z4H A;  3TAP A;  1U48 A;  4FSV A;  2OTL N;  4JI0 K;  2UXB K;  1ZBF A;  4B3T K;  4DR3 K;  3O9S A;  1LWE A;  3ZSY A;  4B9Q A;  3NMU A;  4IJN A;  5M1Q A;  1Q18 A;  1L3S A;  1HKG A;  2RHK A;  3L4I A;  4X66 K;  2XO7 A;  3NVK A;  2V52 B;  4QOZ B;  3LAL A;  2D1K A;  3VA3 A;  1QSY A;  3WXM B;  1B92 A;  4GKJ K;  5C15 A;  3T3F A;  4E3S A;  4IXC A;  1VSJ A;  1NGF A;  4DV0 K;  5J2Q A;  1LCU A;  3CCV N;  1MWM A;  4H5V A;  5GAD P;  3KLF A;  4GMJ B;  2HF3 A;  3K5N A;  4DV1 K;  1QHA A;  5HRR A;  3O6W A;  1KTQ A;  3F2K A;  3BUZ B;  4X62 K;  1RDA A;  3CI5 A;  1QZ6 A;  1BU6 O;  2HNZ A;  2KQ2 A;  1LW2 A;  5AQP A;  1C0G A;  4DQR A;  3HVT A;  4IG3 A;  1T7P A;  2FBV A;  4PHT X;  4JK8 A;  2KKZ A;  5CY4 A;  3CJ1 A;  4BC4 A;  2OPP A;  3O3G A;  5M1O A;  3SAH A;  5EOY A;  5AQX A;  3RR7 A;  3CFO A;  4DQ8 A;  4IEE A;  4QAG A;  4DQS A;  3DLL L;  3QNN A;  2E4L A;  1C1A A;  1V4S A;  3TTF A;  2NRR A;  2CH6 A;  1XMO K;  4A2A A;  1IBL K;  4A59 A;  2D0A A;  2A1R A;  4Z94 A;  1X3N A;  4W5Q A;  1JL1 A;  3QEV A;  2XRI A;  1TK0 A;  1EQY A;  2RPI A;  2W6L A;  1XNQ K;  4O0I A;  3MCP A;  1NJX A;  1KSP A;  5BRH A;  2FSJ A;  4H4O A;  5I42 A;  5HLF A;  2XY8 A;  4BQZ A;  4M3W A;  3F9M A;  1VSK A;  1IKX A;  1RDB A;  2HVH A;  3S3O A;  2CGJ A;  1H1V A;  2H3G X;  3ULE A;  4CF8 A;  1QVG M;  1SAZ A;  1RBT A;  2QK9 A;  3C6U A;  3SZ2 A;  3THY B;  3SI6 A;  4DG1 A;  4CF1 A;  3MWP A;  4G9Z A;  3ZX2 A;  4H0V B;  3KK2 A;  5GIP A;  4ICL A;  5KI6 A;  5SWM A;  5AQM A;  3FE1 A;  4QS8 A;  3DLR A;  3LDO A;  3TI0 A;  3O5B A;  1KAY A;  4DSK A;  4LF8 K;  2O8E B;  2YX6 A;  3THW B;  4ELU A;  2WFB A;  3QER A;  4IDH A;  4NYF A;  1TKT A;  4BRP A;  2D0B A;  1XC3 A;  4BRN A;  4LFA K;  3VER A;  2F8S A;  4FJ8 A;  4Z4G A;  1BI4 A;  3EE9 A;  3I8D A;  3VEN A;  1N36 K;  1LOT B;  4CHO A;  4CJ3 A;  1UA0 A;  2WUS A;  4KPY A;  4OKE A;  3QES A;  4BRK A;  1RT7 A;  3ZEU A;  3J7Y P;  2Y1J A;  1C0M A;  4GV6 A;  4CJK A;  1CXU A;  2E6M A;  4BWJ A;  4A62 A;  1BCM A;  4BVO A;  1VQ5 N;  3VF4 A;  4JAX A;  4ELT A;  3T1Y K;  3E9O A;  1GLD G;  1RTJ A;  1YIJ N;  1DEJ A;  1QHT A;  2QWN A;  4CEF A;  2HB5 A;  3AA3 A;  5A2Q O;  1WSI A;  4B1U B;  1BQM A;  3KK1 A;  4B9M A;  4JHD B;  2WBN A;  3FR0 A;  1MU2 A;  2YKM A;  1WAJ A;  3DXM A;  4B3S K;  4R5P A;  3ENB A;  3KHY A;  3IMX A;  2VG7 A;  1VQL N;  5CZ2 A;  2NRZ A;  1HPM A;  4BAC A;  2QWQ A;  1EO1 A;  4FWM A;  4BRM A;  2NRT A;  5ELZ A;  5MLC Q;  4DB3 A;  3OS0 A;  5LMU K;  1VSD A;  1BDG A;  1RTD A;  3KKR A;  4LY7 A;  4M7X A;  3SQ2 A;  3PIO L;  5HOO A;  2Z1H A;  3CFP A;  3VQ7 A;  4WQ5 A;  5GAH P;  2IDO A;  3AVB A;  3ZSR A;  3AO1 A;  4DF8 A;  3AGK A;  4J2E A;  4UY8 O;  2YHB A;  4BGB A;  4MO4 A;  4JD2 A;  3ZET A;  4CZM A;  1WSJ A;  2QKK A;  4YOU A;  5FLX O;  3CM6 A;  4Y0W A;  4Q0B A;  1XQS C;  4B9N A;  1U2V B;  4N76 A;  3EEQ A;  3ZT2 A;  4E7L A;  2HBJ A;  2HHS A;  3GOI A;  4IOX A;  2PY5 A;  4EZ9 A;  3UE5 A;  1NK7 A;  3QFU A;  1U47 A;  1X3M A;  4DQP A;  4IOC L;  4LF6 K;  1YVN A;  3C6A A;  1T44 A;  1YT3 A;  3VOV A;  4CF9 A;  2PAV A;  4I7F A;  4JI8 K;  5AQG A;  1KXP A;  3AVK A;  3SJH A;  1TK8 A;  1HNW K;  2QI2 A;  1C1C A;  3QML A;  3RRG A;  2ZM6 K;  4NLC A;  3RMD A;  3SYZ A;  5TKW A;  3EL2 A;  4M3X A;  2KW4 A;  5DMR A;  4BDP A;  3OS1 A;  2A5X A;  2VYP A;  3TSQ A;  4FCY A;  5SZT A;  3FFK B;  4DLE A;  1RIL A;  2ITM A;  4KRF A;  4YNQ A;  3VPZ A;  4CHZ A;  4ILG B;  3P83 D;  3V1O A;  4NCG A;  2BGG A;  1NOZ A;  4FLZ A;  3FZH A;  1RDD A;  3A0I X;  4DMN A;  2D5R A;  3IAY A;  1GLA G;  5BN9 A;  4DSI A;  5AFU H;  3DXK B;  5EVZ A;  3LAN A;  2O4G A;  5HBM A;  5F1X A;  4PUO A;  4CZG A;  2OPQ A;  2DTU A;  4AHS A;  3OYG A;  2P9N A;  1KCF A;  1HR0 K;  3S3N A;  1EWR A;  2BTF A;  2JGU A;  4B1Z A;  3M8R A;  4AHT A;  3OYA A;  3ATU A;  1RBV A;  2Q0R A;  2G8H A;  2QW9 A;  1BI4 B;  1EP4 A;  5KQD A;  4C8N A;  4DR6 K;  5C25 A;  1KVC A;  4H0T B;  3SPY A;  4L3Q A;  4AIL C;  4KH6 A;  4B8A B;  1D9D A;  1Q9X A;  1Z6R A;  1ZBS A;  1BWF O;  1Z25 A;  2V51 B;  3RMB A;  1A5W A;  3F9K A;  4O44 A;  2OTJ N;  4FLU A;  3IRX A;  4JK7 A;  4JEP A;  5JVG L;  1T03 A;  1VQM N;  1QQO A;  3SNN A;  2E2Q A;  4BR5 A;  4MLE A;  2E20 A;  4CIG A;  1OVY A;  1BOT O;  3ENH A;  4CJ7 A;  4B1V A;  3P31 A;  4OGE A;  4KI6 A;  1RT3 A;  1HPZ A;  3ZX3 A;  5BRF A;  3AVN A;  4DR1 K;  3TPQ A;  1HYS A;  1RDU A;  1IKY A;  2P9P B;  4CBW A;  4CHQ A;  1NK4 A;  1JXB A;  5FPN A;  3NDK A;  1VQ9 N;  3AVH A;  4JN4 A;  3MN5 A;  5KQ8 A;  2NUB A;  3DXM B;  1Q86 O;  1N8R O;  4NYN A;  4H0X B;  3VEZ A;  4PL7 A;  5AQQ A;  2FC0 A;  2FBT A;  2X78 A;  3PUF A;  3IFR A;  1RDC A;  3K57 A;  4FPA A;  1IG9 A;  1E4F T;  4K0K K;  4C8L A;  4EHU A;  4JK9 A;  4DTU A;  3UKU A;  2Z1G A;  2WON A;  1HNZ K;  3C95 A;  3L2Q A;  1TL1 A;  4JI1 K;  3I0R A;  4IFY A;  3NH0 A;  1LAV A;  3N4Q A;  3IDH A;  1QSS A;  4AQY K;  5I3U A;  1ITG A;  1NKC A;  4FWK A;  5BN8 A;  4JD2 B;  3ZET B;  4RW8 A;  4OPA A;  3SLC A;  4J2D A;  3VEY A;  4W5N A;  3K58 A;  4E19 A;  5C12 A;  4O55 A;  1VSE A;  5FPE A;  3K5O A;  5FRO A;  1TUU A;  4NCA A;  3BGR A;  4JKH A;  3VEO A;  1XNR K;  1R0A A;  1BQN A;  5AQJ A;  1KFD A;  3NH1 A;  4FLT A;  1TAU A;  4I9L A;  2P9L B;  4WQ4 C;  3QB0 A;  2X6S A;  5JLH A;  4C8K A;  1VSI A;  1TV6 A;  4DFK A;  4IWV A;  1YJW N;  1VQN N;  3HP9 A;  4DTR A;  1Y97 A;  3VGL A;  4JI7 K;  4FW1 A;  3V1R A;  4B1W B;  3CCE N;  3A2F A;  2YJF A;  5BR9 A;  1RFQ A;  3WXJ A;  2DY4 A;  2D0P A;  3R6M A;  2P9I A;  5BRE A;  3QDK A;  1KLM A;  4F3T A;  5CYQ A;  3QO9 A;  5JIC A;  3OYI A;  1SUQ A;  4BR9 A;  3ZSX A;  3SMP A;  2ITG A;  2YKN A;  4I6M A;  4CJS A;  4CF0 A;  4A5B A;  4IZ9 A;  4BRI A;  3M5R A;  4M7Y A;  3D2F A;  5AQY A;  1X9M A;  1KQS M;  4IFV A;  4DU4 A;  1CXQ A;  3GG4 A;  4N5S A;  2O8B B;  5B8H A;  4JKG A;  3H6E A;  4L8R B;  1U49 A;  2G8W A;  3KWI A;  2P9N B;  2Y1I A;  3HBT A;  4PA1 A;  1NGH A;  2RF2 A;  1GOB A;  2FBX A;  4BE1 A;  3V9X A;  4RG8 A;  1JLC A;  3NHG A;  3P1G A;  4BRC A;  4CF2 A;  2JWL A;  3LP2 A;  1ATS A;  3QIC A;  3BEX A;  4CJ4 A;  4HVJ A;  3KWG A;  3RSE A;  4AHU A;  3RRH A;  3SPZ A;  2EWS A;  4DV2 K;  4GNI A;  4DTM A;  4DV6 K;  3V9U A;  2ATQ A;  1MWK A;  1U04 A;  4FK0 A;  4JKC A;  4DQI A;  1RCH A;  3O9R A;  1FJG K;  1NKE A;  3M8S A;  4E89 A;  3GL1 A;  2YI1 A;  3V9S A;  3C7N A;  1X1P A;  1HKC A;  4KV8 A;  4K25 A;  3KK7 A;  3JXU A;  4B3M K;  4JKB A;  1S1X A;  5AQK A;  4CJ5 A;  2HHV A;  3KLG A;  3H08 A;  3E66 A;  4I9Q A;  2YHY A;  4BWM A;  1S6P A;  1P90 A;  1KC8 O;  2E2P A;  4A57 A;  1JLG A;  3IKM A;  4XIU A;  3OA9 A;  1DTT A;  3KZB A;  3AVM A;  1R59 O;  2EHG A;  1WSH A;  3A5N C;  5KRS A;  2G8U A;  2I5J A;  5BRD A;  4CZI A;  3LP3 A;  2HMI A;  2VQF K;  2V7Z A;  4DR2 K;  3QFP A;  3MXM A;  4K41 A;  3HOT A;  3ATV A;  4U67 L;  3O3F A;  2Q31 A;  2UYT A;  4CEZ A;  1Z05 A;  2JWK A;  3D0P A;  5GIN A;  4HTL A;  1GOA A;  4FL9 A;  4EIA A;  3LZI A;  1S5J A;  4CED A;  2F96 A;  4B8C A;  1YIT N;  3Q7B A;  2PZS A;  1N32 K;  3AVL A;  2W6K A;  4CBU A;  4WCE L;  3OYD A;  4DR5 K;  2ZQB A;  4JRP A;  3L2U A;  4I2Q A;  2I7N A;  2ASO A;  3OBY A;  3R1X A;  3I0S A;  1NGJ A;  4OGC A;  3WUH A;  1K8K B;  2KFN A;  4C8M A;  3VQ4 A;  3R8E A;  1ZC6 A;  4GVM A;  1BIZ A;  3QBW A;  3R3L A;  1KAX A;  1RTI A;  4IO8 A;  5AZI B;  1K6Y A;  2GUP A;  3OYM A;  1HKB A;  4H5T A;  4BGA A;  3TAG A;  3ZT4 A;  3KD1 E;  1WN7 A;  4H8K A;  2Q2R A;  4U7B A;  5C42 A;  3MWT A;  1FXX A;  4IFE A;  2FLO A;  5BPM A;  3SV4 A;  3ISN C;  4I2P A;  5BPL A;  4YDU C;  1X9W A;  4A2B A;  4FOI A;  4H5N A;  5AZJ B;  4YOY A;  4WQ4 A;  3H3O B;  3OY9 A;  2HHQ A;  3SV3 A;  3SCX A;  2IC3 A;  4DTO A;  4JI5 K;  4ISE A;  4HCC A;  2IAJ A;  1U4B A;  4JI3 K;  3CM5 A;  4OKK A;  3HM8 A;  5C2F A;  2A42 A;  4BRG A;  3SAG A;  3KLH A;  4DSE A;  2NZT A;  1L3V A;  3MED A;  5CR4 A;  1XMQ K;  4DHY A;  3VN5 A;  2KFZ A;  1HRH A;  3CCS N;  5HRP A;  1ATN A;  1TYQ A;  3G71 N;  4CZH A;  1F21 A;  1LWC A;  2VWB A;  4CHY A;  3L2W A;  4BRE A;  3BDP A;  1C0F A;  3NF7 A;  4CI6 A;  1SL0 A;  4F2S A;  4GW6 A;  2RE2 A;  3SUP A;  4FJJ A;  3KLI A;  3C6T A;  4FZZ A;  1VQP N;  3D2E B;  4G1Q A;  4X65 K;  1XWL A;  2P9K B;  3DLE A;  4AHC A;  1C1B A;  1VQ4 N;  3QET A;  2QTD A;  3NCI A;  2ZJP L;  1UA1 A;  3CER A;  3HT3 A;  1NJI O;  2BAN A;  3FZK A;  4CEC A;  3PO4 A;  3HZ6 A;  2IVO A;  3HRG A;  2ZJR L;  3KVG A;  3M8Q A;  3A8Y A;  3DJC A;  2D0O A;  4RW4 A;  4IDK A;  2QEX N;  1WOQ A;  4CGH A;  2VQE K;  4OLB A;  4DS4 A;  2DFE A;  1OVQ A;  2B6A A;  3AVC A;  3U6F A;  1HNX K;  1Z26 A;  4H5R A;  2OZM A;  3HO1 A;  4BRL A;  2KZM A;  4H0O A;  1KFS A;  1VQO N;  3KKS A;  1OH7 A;  4CBX A;  1OH6 A;  3VQB A;  4OPK A;  1ZBU A;  3DRR A;  1C0U A;  3RMC A;  1WB9 A;  3LL3 A;  4HHT A;  1DTQ A;  3S3M A;  2BDP A;  4M3Y A;  3SUO A;  4DR4 K;  1CZA N;  3QEW A;  3HM9 A;  4FLV A;  4KO0 A;  4FOE A;  3DAW A;  3WQT A;  1S3X A;  4LFB K;  1YF5 L;  4FVU A;  3IS9 A;  3HSC A;  1KD1 O;  5KTQ A;  4N56 A;  3VTH A;  4CJV A;  2ZJQ L;  4FJX A;  4FJ9 A;  2VG5 A;  2GBZ A;  3CCQ N;  4XH1 A;  3O80 A;  4KRE A;  4BVP A;  1YJ9 N;  2FSK A;  3DLK A;  3T69 A;  4BE2 A;  1NGG A;  1T3V A;  4FO0 A;  3WXL A;  4CHN A;  4HUE A;  1I3A A;  1JLQ A;  4H0P A;  5KPR A;  4Z0U A;  4PKI A;  3VQP A;  1LV5 A;  4O8U A;  1EKE A;  3CG7 A;  4M3U A;  3L3U A;  4DV3 K;  3AVI A;  5JMV A;  3A5L C;  1XI1 A;  5H1S Q;  4FVM A;  3ID8 A;  4DF4 A;  3UKR A;  1NJY A;  1L3U A;  2XY6 A;  3MDQ A;  4CFD A;  3M6G A;  2PYJ A;  4BR7 A;  4XH5 A;  1LAW A;  4A5A A;  2YJE A;  4BRA A;  2WTU A;  4CK3 A;  4H03 B;  1SL2 A;  3U9Z A;  3LDS A;  4CK2 A;  4O5F A;  3D6R A;  1VSH A;  3V4I A;  5AQO A;  3U3G A;  1HQE A;  1JCE A;  3C0B A;  3O1W A;  2PFU A;  3TSU A;  1BA0 A;  2QA4 N;  1LWF A;  2FSN A;  1HYV A;  4NCB A;  3FZM A;  3T1H K;  1S1W A;  4FWN A;  1U6Z A;  2ZE2 A;  3EKS A;  4CVN E;  1NU0 A;  1S1V A;  2ZD1 A;  3K5L A;  5E84 A;  3K0S A;  1NKB A;  3KK3 A;  4KI4 A;  4M63 C;  2E5L K;  3ZSZ A;  5LY3 A;  3CJ9 A;  1BIS A;  1TKZ A;  4FJI A;  3HJF A;  4OLA A;  1S6Q A;  4H4M A;  1OH5 A;  4FM0 A;  1N6Q A;  2QWP A;  4DR7 K;  1RT6 A;  1TAQ A;  4EZ6 A;  3ID6 A;  2ZF5 O;  3EZ5 A;  1SKW A;  4O4G A;  1BO5 O;  4ISF A;  5LMN K;  1I94 K;  4J8F A;  4JKF A;  2A41 A;  3L2V A;  3ULE B;  3VGK A;  3CFR A;  4B9V A;  3TWH A;  1T05 A;  3GDQ A;  5M1K A;  4FJL A;  4B9S A;  1NG9 A;  4ZTJ A;  2UUA K;  4O8K A;  3O4Q A;  2E2O A;  3LPU A;  2KTQ A;  1IG8 A;  3HST B;  3FZF A;  3AVA A;  2UUB K;  3L2R A;  3VEV A;  2P9S A;  4M41 A;  3WT0 A;  3TAN A;  3LM2 A;  2QKB A;  1D4X A;  1NGI A;  1FK9 A;  2GTD A;  4KHQ A;  4FWO A;  3DOL A;  4BC3 A;  3ZT1 A;  3PX6 A;  3OJU A;  4B9U A;  1IJJ A;  3AAQ A;  2CGL A;  3RTV A;  5IWA K;  1ZBI A;  1M90 O;  5AQH A;  5DM6 L;  5AQS A;  4DTX A;  1IV0 A;  2EX3 A;  1VQK N;  4FWP A;  2E6L A;  2XY7 A;  2GV9 A;  4JI2 K;  3NH2 A;  2YHA A;  2HHW A;  3V81 A;  2A6A A;  3O9T A;  4DFP A;  5CHI A;  5J2M A;  2G8V A;  4Y1C A;  1ASW A;  3ZEU B;  4LF9 K;  4F4K A;  4K42 A;  3LZJ A;  1S9E A;  4C1N K;  4E1J A;  5ADX A;  2HHH K;  4RCH A;  3VQQ A;  5AR0 A;  3UB5 A;  3T19 A;  3AVF A;  3O9U A;  1NLV A;  1K73 O;  1JLB A;  3HI0 A;  2OA8 A;  1E3M A;  3WEE A;  4YOW A;  1DT9 A;  2Q36 A;  1TKX A;  4C8O A;  4GY2 B;  3J7A P;  4AHR A;  4E7K A;  5AQW A;  1ATR A;  4B9L A;  4NXN K;  5HRO A;  5FRM A;  1A5X A;  3MEE A;  4JKE A;  2QWM A;  4BR2 A;  2HOE A;  4YY3 K;  2KLA A;  3AA2 A;  3N4P A;  3BZC A;  4DWI A;  2O8D A;  2F9T A;  2OPR A;  3MK6 A;  3IUC A;  4E0D A;  3K9K A;  4AM7 A;  1L5U A;  5JS1 A;  4EP5 A;  1TGO A;  3UKR B;  3CET A;  1NK8 A;  1GLB G;  2HBM A;  5AQF A;  3ASM A;  1S22 A;  3SJJ A;  4KB1 A;  2HHT A;  3CC2 N;  4CHP A;  1HX1 A;  4CES A;  2W42 A;  3SQ0 A;  2PBD A;  4PY5 A;  4FWS A; 
#chains in the Genus database with same CATH homology
 4X66 K;  1XMQ K;  4LF5 K;  4JYA K;  5BR8 K;  3OTO K;  4DR6 K;  4JI4 K;  4CW7 B;  3J80 O;  2UUA K;  4NXM K;  2VQF K;  2UUB K;  4DR2 K;  4JI7 K;  4JV5 K;  4DV4 K;  4JI6 K;  4X64 K;  4LF7 K;  4GKJ K;  5FLX O;  4X65 K;  4DV0 K;  4DV3 K;  3JAM O;  4DV7 K;  4LF8 K;  5IWA K;  4OX9 K;  4DV1 K;  4LF6 K;  4X62 K;  4LFA K;  1N32 K;  4GKK K;  4JI2 K;  4DR1 K;  4JI8 K;  2F4V K;  4DR5 K;  1N33 K;  1HNW K;  1N36 K;  2ZM6 K;  4LF9 K;  1IBK K;  5LL6 Z;  5IT9 O;  2VQE K;  2UU9 K;  3J7Y P;  2HHH K;  1IBM K;  3T1H K;  1N34 K;  1HNX K;  4KHP K;  4K0K K;  4LFC K;  4CVN E;  3T1Y K;  1HNZ K;  1J5E K;  2UXC K;  3J7A P;  4JI1 K;  4DV2 K;  4DUY K;  4DV6 K;  1XMO K;  2E5L K;  5A2Q O;  1IBL K;  4DV5 K;  4NXN K;  4LF4 K;  4AQY K;  4B3R K;  3J81 O;  4YY3 K;  4DR7 K;  1FJG K;  4V19 S;  4B3S K;  1XNQ K;  4DR4 K;  5LMN K;  4B3M K;  1I94 K;  1HR0 K;  4YHH K;  2UXD K;  4LFB K;  4JI5 K;  4JI0 K;  2UXB K;  1XNR K;  4B3T K;  5AJ3 K;  4DR3 K;  4JI3 K;  5LMU K;  4DUZ K;  2UUC K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...