4DV0K

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u20g
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
116
structure length
116
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 27
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4dv0K00
4OX9K 4JYAK 5A2QO 4YHHK 4DUYK 4DR4K 5IWAK 1IBKK 4CW7B 4DV5K 1HNWK 3J7AP 1N33K 4LF7K 4NXMK 4LF6K 4LFCK 3T1HK 1I94K 1HNZK 2UUCK 3JAMO 4DV1K 5FLXO 2UU9K 1IBLK 4JI3K 4JI6K 4JI0K 4DR6K 4B3SK 4DV3K 1IBMK 4DR1K 1XMQK 4JI2K 2ZM6K 4YY3K 3J7YP 2UXCK 4JI1K 1XNRK 4JI7K 4JI5K 2UUBK 4DR3K 4V19S 4LF8K 1N32K 4DV6K 1HR0K 4B3MK 2E5LK 5LMNK 4DR5K 1N36K 1XMOK 4DR2K 4X64K 4DV4K 3J80O 4KHPK 4DUZK 5BR8K 1XNQK 4LFAK 1N34K 2UXDK 3OTOK 4B3TK 5LL6Z 4LF4K 4K0KK 4X62K 2UUAK 1HNXK 2UXBK 2VQFK 4AQYK 4DV2K 2VQEK 3J81O 4DR7K 4LF9K 5IT9O 4X65K 4JI4K 4X66K 4JI8K 2F4VK 4B3RK 2HHHK 4GKJK 4DV7K 4CVNE 5LMUK 4DV0K 4NXNK 1FJGK 5AJ3K 4GKKK 4LF5K 4JV5K 3T1YK 4LFBK 1J5EK
chains in the Genus database with same CATH superfamily
2OTLN 3CPWM 5AQTA 3RMAA 2FLOA 5A2QO 4DUYK 1ZBSA 4R79A 1HNVA 1YVNA 4KH6A 4BREA 1XHZA 4UQGA 1OH6A 3OYAA 4M3WA 3B8AX 5JVHL 3THVA 4CJ3A 1DGKN 4O0JA 3RSEA 3M5RA 3T1HK 3P4IA 3MN6A 4IG3A 5HRPA 3CXCM 3CCSN 3I55N 2DY4A 3RR8A 1VSLA 1NGIA 5ELZA 4DKWA 2NLXA 1IBLK 3LDOA 4NCAA 2BUPA 1H1VA 5AZJB 5KPRA 3D2EB 4B1XB 3CCMN 4XH4A 4C8MA 3MXIA 3PX4A 1RBSA 2Q0RA 3KK3A 3U9ZA 4IEEA 4BQLA 3HP6A 4JI1K 4CGDA 4BY9C 3WXLA 5C24A 3VPZA 4AHTA 3EY1A 1BWFO 2RHKA 4PL7A 1GOBA 3QIOA 2P9SB 2O4IA 2O8EA 1SQKA 3R1XA 4CFAA 4KHPK 4ELVA 1SL2A 1QSSA 4BR4A 4FWLA 1HRHA 2DTUA 2ATQA 1MA9B 1S22A 3KTQA 1XHXA 2E4LA 3UB5A 5CE3A 2P9LA 3ZT4A 3GE1A 2O8CB 2ITGA 1Y97A 3ZSOA 1IKXA 1KVAA 5BRHA 4ID5A 4DTUA 2P9NA 4KKOA 4FLVA 1SL0A 4DV2K 3TAPA 3K58A 4DR7K 5HROA 1JLFA 3O4WA 3C95A 4HCBA 2X78A 2Q3SA 2F4VK 3AVGA 3M6GA 3TAFA 3PO5A 3P31A 4A5AA 2D0OA 1VSIA 4W5QA 4JEPA 3Q7BA 4WYBA 3G0ZA 1BISA 3HVRA 4JKGA 2KHOA 2GUPA 3OBWA 3OYLA 3KHYA 2D0PA 1DTTA 3PUFA 4BROA 3ZETA 1JXBA 3QESA 1J5EK 3FGUA 1KFSA 3BDPA 2YCHA 3OJSA 4FJGA 5J1EA 4F8RA 5AFUA 2FSNA 1DT9A 4FZXC 1D4XA 1QHTA 1SV5A 3AY9A 2A1SA 4CF9A 4DHYA 3VQ7A 3NGZA 4C23A 4DTMA 4KV8A 1XWLA 1J5OA 3CFPA 2IS3A 5BN9A 2P5OA 3OYIA 3JAMO 3LWLA 1WSEA 4A59A 2D4WA 1VQNN 1BQNA 3HI0A 2PYJA 4B3OA 4M3XA 2UU9K 1L3TA 1A5VA 4Z4IA 2VGNA 1U4BA 4CK2A 4B3SK 1R0AA 1J54A 3LM9A 3OYNA 1E4FT 5AQGA 3I0SA 4DQQA 4CEEA 1D8YA 2E1ZA 1NK8A 4H03B 1BIZA 1C0FA 4LF8K 4CJPA 4BG8A 4DS5A 3CHWA 5KPTA 3J7ZO 3CCUN 5HL7L 1L3UA 1ASUA 4CJWA 3OHRA 1RDDA 3HP9A 4K43A 1LAVA 2KFZA 4YOWA 4GW6A 1DTQA 1EP4A 4FM1A 3FR0A 5BR8K 1YI2N 4FYDA 3HVTA 2DFHA 1V4TA 3IG1A 3S3OA 4N41A 3QBWA 2HNYA 4X62K 3H1VX 4BC5A 2P9UA 2FSKA 4BRDA 3RRHA 3DXMA 5ADXA 2X6SA 5JVGL 1QVFM 4XH1A 1NJWA 3OYCA 3WUHA 1WB9A 3R6MA 3HK2A 4JKDA 1RNHA 1U2VA 4XIUA 4FLWA 4CHOA 3H3OB 4JRQA 1KSPA 5EXWA 3VQDA 3ISNC 1GLJO 5GAGP 1IKYA 3TAGA 1EQYA 1N8RO 2IIRA 1WAFA 4FZZA 3KLEA 3U3GA 4JS4A 3IAYA 3GDQA 3JXUA 2BDPA 4BRCA 1YAGA 3DWLA 5KRTA 3BEXA 1BU6O 4Y0WA 4GMJB 4BC2A 1NGHA 2FSJA 5CZ1A 2HHTA 5HRSA 3FZMA 3NF8A 4WE1A 4OKJA 2X74A 4RW4A 1TVRA 2A40A 4WQ4A 2KLAA 3SCXA 1XC9A 1WOQA 1GLLO 4OJRA 1T7PA 5GAHP 2FBYA 2Q97A 1XQSC 1RFQA 1K8KB 3SAFA 1S1WA 3SJHA 1X3MA 1BIUA 3DRRA 1W2BM 4BR7A 3H46O 3QFPA 3I56N 3DLGA 4DR5K 4ELUA 3ITHA 2NRVA 4JK8A 3K59A 1KTQA 4CHQA 3K57A 4DV4K 1KAXA 1P8ZA 4E3SA 3SQ0A 3H3NO 4BGBA 3ZCMA 3ZT3A 4AHRA 1SKSA 3CPEA 3VEYA 5JLFA 1N34K 3VERA 2AP1A 3AAPA 3ZX0A 3SBGA 3B6OA 5AQOA 2B6AA 1IO2A 3KWGA 3HJFA 4KHNA 1E3MA 3E9OA 1WSHA 2P1JA 3OW2M 2HB5A 2E20A 4U67L 1YJWN 3ZSXA 4XEIA 4H5VA 2CGJA 1W9HA 5K14A 4ISGA 2HBKA 3D0PA 3J81O 3MXJA 1VSJA 3EKSA 1WSJA 5BR9A 1X9WA 2FBTA 4X66K 1NMDA 4B3RK 4BC4A 5EVZA 4AILC 4Q5VA 4CEAA 4UY8O 1TKTA 3O1BA 1QQCA 3K9JA 4FO0A 3IFRA 3LZIA 2HHVA 3ZT2A 2HBJA 2YJFA 4DTNA 5AJ3K 4J2DA 4JRPA 2HHWA 4OPAA 4IBNA 3THWA 4FLYA 1GLFO 4CIEA 3EZWA 3WXMB 1GLEG 2QWNA 4FJLA 4M3YA 1C0UA 1CXUA 2RE2A 3WNHA 5HOOA 1L3SA 3HL8A 2HBMA 3DYAA 5SWMA 4YOUA 1UAXA 2W6LA 3QBXA 4DSIA 2OTJN 3CJ7A 4CF8A 1WAJA 3TPQA 5M1KA 4HVJA 2UUCK 2WTUA 3J8AA 4O0IA 1C1BA 2IGIA 5C25A 1NLVA 2F96A 3NFAA 4BDPA 1S1XA 1Z26A 4CEBA 3TAMA 5AQMA 2JWKA 4CHNA 1YJNN 4Z4CA 2QWOA 1EXQA 3A8YA 3EEQA 1CZBA 3L4IA 2HW3A 3DRSA 1NGJA 3CMAN 3WXJA 4DR2K 1GLCG 4OKEA 4RTFD 4CEDA 3MEGA 1DEJA 2VCPA 2Z1JA 4M63C 3O6WA 4Y1DA 1TAQA 1WSFA 2D0BA 1UA1A 3NH0A 1VQON 3V9UA 4MDBA 1RTDA 4L8RB 3QEIA 1JCFA 3V9ZA 2NRHA 3O9RA 4FWPA 3LALA 1VRUA 5J2QA 3OYMA 1E4GT 3K5MA 3SUNA 1S6QA 4JS5A 3ATUA 1Q82O 2R7YA 3UIQA 3AARA 2BANA 2IVNA 3F9KA 4E7IA 1U45A 3VQEA 3EN9A 3O08A 3R8EA 4BC3A 3KD1E 1KCFA 3L2WA 2BH1A 1KD1O 1KC8O 1C0MA 5GADP 1VQ9N 3PV8A 3ID6A 2ASPA 3VENA 3WQUA 4FCYA 3BZKA 2JWLA 3UKUB 5FRMA 1TK0A 3SPZA 1D9DA 1NGGA 4K8XA 3KKSA 1X3NA 2KQ2A 2E2QA 3CERA 3LP1A 4DV5K 2O8DA 4WQ5A 3CCJN 3G10A 1ESVA 4BR5A 4J2EA 4YOXA 1YJ9N 4BDZA 1RBUA 1HPMA 4JK9A 4HCCA 4B9MA 2YNGA 1NGAA 1JKHA 3AAQA 2G8FA 3ZX2A 3AVLA 1SAZA 3UKRA 4W5TA 4RW9A 3LWMA 4DR1K 1U48A 4BGAA 1IG9A 1FXXA 4DTRA 4Z4HA 3V6DA 4B9QA 1FK9A 2PFUA 4PHTX 3VQAA 3LZJA 4ISFA 4L3QA 2KZMA 3T19A 3T3FA 5FDLA 4DV6K 3F5TA 4CJFA 4I7FA 3W3DA 4HTLA 4EIAA 2V7YA 3NAEA 4K41A 3KLFA 3THXA 3HTVA 4LSNA 1NGBA 2NZTA 2WONA 4QCLA 3RSEB 3OS2A 2FF3B 4OO1J 1HYVA 1S5JA 5C2FA 1RT5A 4B3TK 3C7NA 3MK6A 4CJKA 1ZBHA 3RMCA 2Q0UA 4JHDB 3D2EA 1SKWA 1D9FA 1I39A 5T7BA 4BRNA 1VQ7N 2WOMA 4DQPA 4E7LA 4FK4A 5E41A 4PQUA 4Y1CA 3QEVA 5D3GA 3K5LA 4KI4A 3I8DA 4OPJA 4CGIA 4GV6A 3H08A 1IKWA 1ASVA 2P9SA 2Y1JA 4LC9B 3VETA 2HHQA 4HUGA 3P1GA 2G8WA 3W0LA 3F73A 4F3TA 3BF3A 4FZYA 3CYMA 3VEXA 3HPGA 4I9LA 4PKHA 1HNWK 3L3VA 5JS2A 5JICA 1VAZA 3S41A 3AGRA 4IKFA 3V4IA 4HTUA 2P9NB 3AO3A 3SAHA 3HSTB 1HNZK 3AVCA 3KK1A 5F2RA 3V1RA 3DOLA 2NUBA 2P51A 3C6HA 3LDPA 4IZ9A 4O8UA 3CJAA 3IS9A 2DPNA 4KHYA 5F1XA 1S72N 2OCEA 5KGXA 4YORA 4CBWA 2GV9A 1KFDA 2BGGA 2HF4A 2HBLA 2QXLA 3SYZA 1RBTA 4WFAL 1BHLA 1OKJA 4IDHA 2XY6A 3TU5A 5I3UA 3GOIA 3LPTA 1TL1A 1L3VA 3AVHA 3LANA 4CESA 4DU3A 1DLOA 4KH4A 4O8KA 4X64K 1SKRA 4FJIA 3J80O 1NU0A 3G4SN 3MN9A 3HRGA 3E01A 3QINA 3RTVA 4B9UA 3RMBA 3K5OA 3TTCA 3ASMA 1Z6RA 2P9IB 1ITGA 3T7ZA 2E2PA 4FW1A 4DB3A 3HZ6A 3PX0A 4DTXA 3QEWA 4BRAA 4CF1A 1MU2A 3AO2A 4EFHA 4DQRA 2F9WA 4H5RA 4KI6A 3TR8A 5LMUK 2OZMA 1GOAA 5C10A 4EHUA 4Z4FA 4GKKK 1JCEA 3O4QA 1YTUA 4J2AA 2E2NA 2ZJPL 1T8EA 3CC2N 3M8SA 2B4JA 3SLCA 2OA8A 4BRHA 4DR4K 3S3MA 3GBTA 3WXKA 1NJXA 1CLQA 1NGEA 3ZYYX 4CJUA 4DSFA 2F9TA 1QQOA 4FPAA 2HVHA 3MXMA 3TARA 1M1KO 3ZSRA 2I7NA 4IFEA 3MN7A 1JL1A 4LF6K 1Q7YO 4H5NA 2VG5A 1I94K 4KTQA 1S1UA 2XRIA 3OYKA 4IOCL 3HBTA 4CZIA 2P9LB 2QWPA 3FZKA 4E0DA 2ASOA 3UKRB 4U7BA 3AA3A 2HF3A 3A5NC 4BVOA 3WT0A 1WN7A 1XMQK 3O4NA 4DU4A 1KLMA 3VF2A 4FJNA 2FC0A 1GLAG 3CI5A 4C1NI 4NO7A 3U8XA 4JI7K 2YNFA 2UUBK 2HNZA 4FJ5A 4GNIA 5BRDA 2OPSA 1WBBA 4I9QA 1A5XA 3EO3A 3THXB 2P9KA 5BRFA 4DSEA 4DQSA 4AM7A 4ID1A 5B8HA 4CF2A 2VWKA 4DTSA 4FPBA 3IUCA 4F4KA 3NCIA 3EZ5A 4A5BA 1W97L 3MN5A 5C2DA 5DM6L 1XNQK 1VSDA 2A3ZA 5FRNA 1NBWA 5EOYA 3FFIA 3FZLA 1RDAA 2P5GA 4GVMA 2IDOA 2ZWHA 3LPUA 3VQBA 5HBMA 4O44A 4DSKA 2E8AA 1NM1A 4JKHA 2XHBA 1NJIO 4AQYK 3WQTA 1BDGA 1Q9XA 3NBPA 2IVOA 2NRZA 3AO5A 5AQIA 3LDQA 3CMEN 4RW6A 3O8MA 3BY5A 3CCRN 3VGMA 2QEXN 4DV7K 5J2NA 5AQQA 3U9DA 4BE1A 4EZ9A 2BTFA 4Z0UA 3SMSA 1BG3A 1TYQB 1JLAA 3OJUA 1VK0A 2YHYA 3I8BA 1ZBUA 2A6AA 5CHIA 4IDKA 1JCGA 1RDUA 5HP1A 3FFKB 1NKBA 1BCOA 4BDYA 3TTFA 3SBTA 3AVBA 2EHGA 2NRXA 4BRFA 4EP5A 4CGJA 1WNSA 3CCLN 1TGOA 4B9NA 3SQ1A 4I2PA 5AR0A 3C65A 4FVUA 2HMPA 5HRNA 1JLGA 2QW9A 1YF5L 3SI6A 4DG1A 1VQKN 4DR6K 5BPNA 4IJAA 1T3VA 4CFDA 3L3UA 1NWKA 3V9WA 2HHUA 1YUWA 2YHWA 1QTMA 1FW6A 5E26A 3MEEA 4B8CA 4B9VA 2OZSA 3K9KA 4CJ7A 4B1ZA 2GELA 3RRGA 3M1FA 3E9LA 3AV9A 5LMNK 1L5UA 2E2OA 1B9FA 3BZCA 3L4QA 3QEXA 1WSIA 3NMUA 4CJQA 4BRPA 4WFNL 3A5MC 1KVBA 1KAZA 2WC9A 1X9SA 1VQPN 4G9ZA 5HLFA 4IG0A 4DFJA 2P9PA 4M3ZA 2GX9A 2YKNA 1KAYA 3AVFA 4CFBA 2AA4A 1VSFA 3D2FB 4LH4A 3E1YA 4BWJA 4YOVA 3SV4A 1MWKA 1D5AA 2JGUA 5AQJA 4CZKA 4FJXA 1Z25A 1O13A 5AQNA 1VQ6N 1JJ2M 3S3NA 4CJEA 3VQ4A 3KK7A 3SZ2A 3EKUA 4JKBA 5KQ8A 2O8BB 3DLBA 4CZFA 2OYQA 3CFOA 4CBUA 3TSPA 4H0TB 4E7HA 4KHSA 4FWSA 4DF4A 1FJGK 4DFMA 3SUQA 3BGRA 1ASWA 2W40A 3C0BA 2RKIA 4MFBA 4CBXA 3LL3A 3NF6A 1ZC6A 1YITN 4PKGA 4KHQA 4C8LA 4ZHRA 4IEIA 2FF6A 3QFUA 5AQPA 2NRTA 3QICA 5EU7A 1T6CA 3PLAA 1C1CA 4Z4GA 1NGFA 1Z05A 5C42A 4CZJA 1VQLN 1TKXA 4DWIA 2JLEA 3NVKA 4MDAA 2O4GA 4C1NK 5JMVA 2HOEA 1EWQA 3C6TA 1M90O 1G15A 1RT4A 3WEEA 3VQ5A 4FLZA 2ASMA 3E9PA 4JI0K 2Q1NA 1LW0A 3KLHA 4CZHA 2V52B 5AZJA 5M1PA 1J6ZA 3THYB 3QNNA 2UXCK 3VMFB 1ZBIA 4WCEL 3VGLA 4JI5K 4AM6A 1S1VA 1NJZA 1FKOA 3HOTA 4E89A 2O8EB 2RPIA 4JKFA 2V51B 2Z1GA 4RCHA 2HNDA 1QQMA 4ZTJA 4BRLA 3THWB 3F2KA 4DUZK 4DQIA 4YNQA 3PO4A 3KK2A 3OA9A 1FKPA 2YV0X 2NNWA 4G1QA 3T1AA 2FBXA 4CGFA 1Q81O 2O8CA 1VRTA 4W5OA 2XY5A 2QWQA 2QKBA 2GWJA 3O80A 4BRQA 4BE2A 2Q31A 5LL6Z 4CJ5A 2QKKA 4FJ9A 1KQSM 4RWTA 3L2RA 3CJCA 1BI4A 4NCGA 4H0VB 3MWPA 4B8AB 3QLHA 5IT9O 5AQZA 2QWRA 1G99A 1SUQA 3EE8A 4B9LA 4OKKA 4GKJK 2H3GX 3ZT0A 5TKYA 1TKDA 3JSMA 3MAQA 1IH7A 2VG7A 3QNOA 3L0QA 4NYFA 1OVQA 2Z1IA 3CM5A 4BRIA 3FE1A 4KTZA 1C6VA 4M3RA 5CR4A 1YTAA 4M7YA 4QOZB 3FZFA 4N56A 4JKGB 1SL1A 1BGXT 3SQ2A 4CEQA 1EETA 3FZHA 4CGGA 3DLRA 4CJRA 3ULDA 3QERA 4M42A 3C7NB 4EAHD 4MO4A 3J7AP 1BL3A 4DFKA 1Y64A 3AA4A 3AA2A 3O9UA 4LF7K 3KZBA 3D7EO 4BRMA 5AQXA 5GINA 1NJYA 1NK4A 4CJTA 4CJSA 4E1MA 1LOTB 1RBRA 3VF6A 1LWCA 5FROA 5DMRA 3VEVA 1RT2A 3H45C 1U49A 2E6LA 4FXDA 2GTDA 3HPHA 4YY3K 1HPZA 1QQNA 4DFPA 4CZEA 1K8AO 4EZ6A 3N4PA 3LAMA 1BO5O 3ZSYA 2W6KA 4CK1A 1F21A 3O1WA 1UWBA 5AQWA 1S9EA 5GIOA 5LY3A 3NH2A 3QEPA 5CZ2A 1QS4A 1Q86O 2NRRA 3UKUA 1JXEA 2P9PB 4B1WB 3FLCO 3DXKA 4FK2A 3WNFA 3VEWA 4AHCA 1SZ2A 3U3YA 2A5XA 4BVPA 3G25A 3O3HA 2QA4N 3BF1A 4BR2A 3VA0A 3SAGA 3VA3A 4BE0A 3CJBA 4LF4K 1NOYA 2P9UB 1HQEA 3CF5L 3DMJA 4BQZA 4A2AA 2LSNA 5M1NA 3IMXA 3C6AA 3ULEA 3QIPA 1CZAN 3DXMB 1RT1A 4FW2A 3JYTA 2YI1A 4CHPA 1EX4A 1KRPA 4DLEA 3K5NA 3S9HA 5C0YA 1VSEA 4B9SA 5KQDA 4I6MA 3L2UA 4K25A 3DM2A 4MO5A 4B1VA 4JKEA 4NXNK 1U2VB 2A42A 3LM2A 4M45A 4WF9L 2G8IA 2O8FA 4FJJA 2EWSA 4LFBK 4H0OA 4C8KA 4PA1A 2F8TA 3KIOA 1UA0A 4OX9K 4M3TA 3QB0A 1RDWX 3AGKA 2IC3A 2YNHA 1VQ5N 1IBKK 2P9IA 4DMNA 3SJJA 4CW7B 4DF8A 1U6ZA 2QWMA 1T44A 2YHAA 3ZX3A 1IKVA 3L2VA 4RW8A 3QDKA 2F7TA 5KTQA 2VYPA 4FWKA 1SS6A 5AFUH 4W5RA 1NNEA 3WEEB 1R59O 1TV6A 4CF0A 5C12A 3WNEA 2HMIA 4JHDA 1ZXOA 1RTHA 3CFRA 5BPLA 2B5JA 1KXPA 4KBOA 4O4GA 3AVAA 3VQ9A 4LD0A 3J7YP 1K8KA 1NMNA 4NLCA 1QZ5A 3MEDA 3CQXA 2E1YA 3OVNA 4H5WA 2YKMA 3ZSVA 3K0SA 3QETA 3OYEA 3ZSWA 2E5LK 1OH7A 5FPDA 4LSLA 1VHXA 4QS8A 4ZTFA 3BP8A 1QVGM 4O5FA 3L8BA 3M8RA 3VEOA 4ELTA 1VQ4N 1LAWA 3KD5E 5CYQA 1J9AA 4H5TA 5AQSA 4BACA 1QZ6A 2EX3A 2VGMA 4CI6A 1JLCA 3GL1A 2ZQBA 3CC7N 1RT6A 2E88A 2FXUA 3ZSZA 3WXIA 3O3FA 3AVNA 4QS9A 2KFNA 2KZZA 2UYTA 3TSUA 4JD2A 1KVCA 1XC3A 3RR7A 3DAWA 2G8HA 4CHYA 1I3AA 4R5PA 3D45A 2NRWA 3OS1A 2HHHK 2G8KA 2GEMA 3MMVA 3PX6A 4N76A 3PSIA 1X9JA 3V1OA 4IWVA 4FJMA 4GY2B 4BRGA 3G71N 5M1OA 1S6PA 1RTJA 4KFBA 2XY7A 2QI2A 1HUXA 4FOEA 2DFEA 3EL2A 4FM0A 5TKWA 1BQMA 1UOCA 5AZIB 1HYSA 3CD6N 3TABA 2ZD1A 1RDCA 4OPHA 1TK5A 4ILHA 3ZEUA 4M41A 3IRXA 1N33K 1CZ9A 3H1QA 3C6UA 1HKGA 2AJQA 2QXFA 5CY4A 3RVCA 3OY9A 1ATNA 1GOCA 1TUUA 2RN2A 3KKRA 1NK0A 4TSXA 2PBDA 4FK0A 3F9MA 4FSVA 4AHVA 4KTWA 3PY8A 3MX2A 4ISEA 1BCMA 5KPZA 2HSTA 1T05A 3KWIA 3HO1A 4OLAA 4HWIA 4PL8A 3V81A 4K42A 5J2MA 4E7KA 2ZE2A 1A5WA 1HJOA 3CQYA 3KJVA 2YJEA 4IOXA 1K9MO 1KLNA 1IV0A 4DSLA 3CCEN 2RF2A 3DLHA 4I2QA 1XMOK 2YNIA 1LWFA 4A2BA 4CK3A 4JN4A 4QAGA 1T6DA 4M7XA 1NG9A 1VQ8N 1IJJA 1N6QA 5AQHA 3G6EN 4FWMA 4PKIA 4WQ5C 2KKZA 2ZJQL 3VTHA 3VGKA 2I5JA 3NGYA 1HNXK 1Q18A 3O9QA 5ADXH 4WQ4C 4CJVA 1ATSA 2D5RA 4I6MB 4FLXA 2HHXA 4JNEA 3IDHA 4A62A 4PY5A 4KREA 4EP4A 3M8QA 4FOIA 5AQUA 5FPMA 5AQRA 2PYLA 1HYZA 2XO7A 1S9GA 2Z1HA 5AQYA 3HM8A 3B6PA 3NHGA 4JK7A 2P9KB 4CIFA 3CQ8A 3K2PA 3LDNA 3OYFA 5H1SQ 3DRPA 2ZGZA 4KH5A 4AHUA 4CD1A 1HKCA 2QM1A 2HHSA 4NXMK 1RILA 2E6MA 3ENOA 2W41A 5I42A 3RMDA 3VQPA 3OYDA 4JKAA 4DV1K 1JLQA 4FLUA 5FLXO 3VQ8A 4KPYA 3P5JA 3NVMA 3AO4A 4DTPA 1QE1A 1YHQN 3ZSQA 1LCUA 3MCPA 4LY7A 4OGEA 1LW2A 4H0XB 1K6YA 2BE2A 4NYNA 2ZM6K 3OBYA 3OYHA 3HT3A 4Z4EA 2QTDA 3CG7A 4IFVA 3OS0A 2CGKA 2G8VA 2ZGYA 4IO8A 3AVJA 1ZYQA 4A61A 4BR0A 3CETA 3O5BA 2CH5A 3PSFA 3ID8A 3VEZA 4KB1A 1RGIA 3QO9A 2OPQA 4J2BA 4LFAK 4W5NA 2F8SA 3OTOK 1U04A 3ZT1A 4GVEA 5EY4A 4FVMA 1BOTO 4IOAL 5GAEP 4CGHA 4CJLA 1OVYA 2WUSA 2UXBK 2A41A 3N4QA 1HX1A 1RDBA 5GIPA 3O9SA 4GV9A 4J8FA 1JLEA 3T69A 4LF9K 4H8KA 5CYMA 4JI4K 4JI8K 1VSMA 3MWTA 1XI1A 1NK6A 4DSJA 1W7AA 1TAUA 1ILYA 4CVNE 3EE9A 4MLEA 4CEOA 4CZGA 5J2PA 2IOCA 2VWJA 5M1FA 4HHTA 1BA0A 3TAEA 3TWHA 3I0RA 5AZIA 1C0TA 2IVPA 1HJRA 4B1YB 3MCAB 1TK8A 1RBVA 1TL3A 5AQFA 2ZJRL 1C0GA 2WFBA 3OYGA 2W42A 4FWNA 2OPRA 1ZBLA 4OVLA 1EO1A 2OANA 4JLHA 3E66A 1BI4B 3I33A 5LJVA 2ITMA 1LWEA 5AQVA 1ZBFA 1S3XA 3MECA 3HOSA 3PIPL 3PIOL 1EKEA 4QS7A 3VOVA 5BPMA 1GLDG 2KTQA 1NKEA 4KHWA 3P38A 4NB4A 5F0XA 4ILJA 4JI3K 3CJ9A 3HPOA 4JI6K 5LJWA 4AF1A 4DV3K 2IAJA 4FJ8A 3TAQA 1EWRA 1NOZA 4BG9A 2PZSA 1WBDA 1CXQA 1XNRK 4AHSA 4H0YB 3C94A 5M1QA 4V19S 4F2SA 4N47A 1N36K 4K8ZA 3U6FA 1W0HA 3JS6A 1HNIA 4IXCA 4RW7A 4YOTA 1MWMA 4JAXA 4CEZA 3KLGA 1RCHA 2ZF5O 5MLCQ 4O5BA 1BA1A 1K73O 3HM9A 4NLBA 2YX6A 4FWOA 5AQLA 5JS1A 2Q36A 1VSHA 3DLLL 3U4LA 3NH1A 4NCBA 5KI6A 1LV5A 3LDSA 4KRFA 1DKGD 2UUAK 3OYJA 3V1QA 4BWMA 3GG4A 4FWRA 3AA5X 3VQ6A 1RT3A 1OH5A 3OYBA 4CIGA 3VESA 4GV3A 4X65K 1Q9YA 2VG6A 3A2FA 3BUZB 2D1KA 2FBVA 3SMPA 3VQQA 4E19A 1P90A 3VTIA 3CCVN 4FLTA 3THYA 2J4RA 3V9XA 1YT3A 2CGLA 3DXKB 4DU1A 3HXMA 1WLJA 3SNNA 3WNGA 1T03A 3QMLA 4JYAK 5HRRA 4YHHK 3V9SA 4Q0BA 3NE6A 1QSLA 2GUIA 4IFYA 4CFCA 2A1RA 3MDQA 4O55A 3IKMA 4E1NA 3Q7CA 4YDUC 3LDLA 2YHXA 1TUYA 3ULEB 3CM6A 3NF7A 4F2RA 3TI0A 4IJNA 4YDUA 5KRSA 3TSQA 1N5YA 4FJKA 4CZLA 1NK5A 4ILGB 1B92A 3A0IX 1VQMN 1V4SA 4CECA 4JI2K 2OPPA 1X9MA 2O8FB 5JLHA 4EHTA 3NDKA 4H4MA 4DR3K 2D0AA 4IO9L 4H0PA 4H4OA 3HSCA 4YFUA 2DFFA 2O8DB 4MLHA 4JKCA 4Z94A 2WBNA 4FL9A 3AVKA 3KLIA 1YIJN 1B9DA 4BRKA 3A5OC 1XUPO 1ATRA 1TKZA 2UXDK 4OGCA 1X1PA 4AH9A 1MDUB 3M3ZA 2GBZA 2X6NA 4WFBL 3ALYA 1Q8IA 4KB0A 2Q2RA 3A5LC 3L2QA 2PY5A 1IG8A 3M8PA 3LP2A 2VQEK 3O3GA 1NGCA 3NGIA 3ENHA 4HUEA 4F3OA 4RG8A 1HQUA 5DK5A 1RT7A 3CIPA 5KGWA 3SUOA 1NK7A 4FM2A 4XH5A 2PAVA 2KW4A 5E84A 1NK9A 2D0CA 4KHUA 1HKBA 1BUPA 1YVUA 3ENBA 3T1YK 3VQCA 3RWUA 1TYQA 4CE9A 2QK9A 1WSGA 3SV3A 3AVIA 4CD3A 4DCHA 3ZETB 3CJ1A 2QWLA 4DTJA 1S1TA 5IWAK 3DLKA 1YXQA 2VWBA 4HUFA 3VF4A 1REVA 3LAKA 1NGDA 1GLBG 4DTOA 4PUOA 3H6EA 4CZMA 4LFCK 4FJ7A 2V7ZA 3TANA 3P83D 4JD2B 3ATVA 1RTIA 3HYFA 3R9PA 3AO1A 1O1WA 4DLGA 4YOYA 2HVIA 3CC4N 1IBMK 2ETJA 4PWDA 4CEFA 1NKCA 3KVGA 3UE5A 4E1JA 5BREA 5DM7L 1HLUA 4C8OA 3DI6A 3DOKA 3TTDA 3ZLJA 1N32K 3SK3A 1HR0K 4B3MK 5BN8A 1QHAA 5C15A 3AVMA 3P39A 3ZEUB 3VN5A 3DLEA 3LP3A 2I7PA 4ICLA 1C1AA 5FPNA 4DS4A 2XY8A 3R3LA 4B1UB 2CH6A 2G8UA 4CCHA 5AQKA 2Y1IA 3D2FA 4LH5A 1U47A 2GWKA 3MX5A 4M3UA 4F9OA 4E7JA 5FPEA 4K0KK 3L6QA 1QSYA 2VQFK 5EX5A 1OH8A 4CHZA 1JL2A 3O9TA 4FWQA 4FJHA 3DJCA 5SZTA 3SPYA 1VSKA 4C8NA 4B08A 3SQ4A 4A57A 4OLBA 4KO0A 1J53A 2O8BA 3CCQN 3D6RA 4KAZA 4OPKA 4N5SA 3SUPA 4DV0K 4CJ4A 1HMVA 4BR9A 3LP0A 4CERA 4DQ8A 1JLBA 5I9EB 4LF5K 1WUAA 4JV5K 4MQ3A 3EYZA 3NF9A 4B9TA 2YHBA
chains in the Genus database with same CATH topology
4OX9K 4JYAK 5A2QO 4YHHK 4DUYK 4DR4K 5IWAK 1IBKK 4CW7B 4DV5K 1HNWK 3J7AP 1N33K 4LF7K 4NXMK 4LF6K 4LFCK 3T1HK 1I94K 1HNZK 2UUCK 3JAMO 4DV1K 5FLXO 2UU9K 1IBLK 4JI3K 4JI6K 4JI0K 4DR6K 4B3SK 4DV3K 1IBMK 4DR1K 1XMQK 4JI2K 2ZM6K 4YY3K 3J7YP 2UXCK 4JI1K 1XNRK 4JI7K 4JI5K 2UUBK 4DR3K 4V19S 4LF8K 1N32K 4DV6K 1HR0K 4B3MK 2E5LK 5LMNK 4DR5K 1N36K 1XMOK 4DR2K 4X64K 4DV4K 3J80O 4KHPK 4DUZK 5BR8K 1XNQK 4LFAK 1N34K 2UXDK 3OTOK 4B3TK 5LL6Z 4LF4K 4K0KK 4X62K 2UUAK 1HNXK 2UXBK 2VQFK 4AQYK 4DV2K 2VQEK 3J81O 4DR7K 4LF9K 5IT9O 4X65K 4JI4K 4X66K 4JI8K 2F4VK 4B3RK 2HHHK 4GKJK 4DV7K 4CVNE 5LMUK 4DV0K 4NXNK 1FJGK 5AJ3K 4GKKK 4LF5K 4JV5K 3T1YK 4LFBK 1J5EK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OX9 K;  4JYA K;  5A2Q O;  4YHH K;  4DUY K;  4DR4 K;  5IWA K;  1IBK K;  4CW7 B;  4DV5 K;  1HNW K;  3J7A P;  1N33 K;  4LF7 K;  4NXM K;  4LF6 K;  4LFC K;  3T1H K;  1I94 K;  1HNZ K;  2UUC K;  3JAM O;  4DV1 K;  5FLX O;  2UU9 K;  1IBL K;  4JI3 K;  4JI6 K;  4JI0 K;  4DR6 K;  4B3S K;  4DV3 K;  1IBM K;  4DR1 K;  1XMQ K;  4JI2 K;  2ZM6 K;  4YY3 K;  3J7Y P;  2UXC K;  4JI1 K;  1XNR K;  4JI7 K;  4JI5 K;  2UUB K;  4DR3 K;  4V19 S;  4LF8 K;  1N32 K;  4DV6 K;  1HR0 K;  4B3M K;  2E5L K;  5LMN K;  4DR5 K;  1N36 K;  1XMO K;  4DR2 K;  4X64 K;  4DV4 K;  3J80 O;  4KHP K;  4DUZ K;  5BR8 K;  1XNQ K;  4LFA K;  1N34 K;  2UXD K;  3OTO K;  4B3T K;  5LL6 Z;  4LF4 K;  4K0K K;  4X62 K;  2UUA K;  1HNX K;  2UXB K;  2VQF K;  4AQY K;  4DV2 K;  2VQE K;  3J81 O;  4DR7 K;  4LF9 K;  5IT9 O;  4X65 K;  4JI4 K;  4X66 K;  4JI8 K;  2F4V K;  4B3R K;  2HHH K;  4GKJ K;  4DV7 K;  4CVN E;  5LMU K;  4DV0 K;  4NXN K;  1FJG K;  5AJ3 K;  4GKK K;  4LF5 K;  4JV5 K;  3T1Y K;  4LFB K;  1J5E K; 
#chains in the Genus database with same CATH topology
 2OTL N;  3CPW M;  5AQT A;  3RMA A;  2FLO A;  5A2Q O;  4DUY K;  1ZBS A;  4R79 A;  1HNV A;  1YVN A;  4KH6 A;  4BRE A;  1XHZ A;  4UQG A;  1OH6 A;  3OYA A;  4M3W A;  3B8A X;  5JVH L;  3THV A;  4CJ3 A;  1DGK N;  4O0J A;  3RSE A;  3M5R A;  3T1H K;  3P4I A;  3MN6 A;  4IG3 A;  5HRP A;  3CXC M;  3CCS N;  3I55 N;  2DY4 A;  3RR8 A;  1VSL A;  1NGI A;  5ELZ A;  4DKW A;  2NLX A;  1IBL K;  3LDO A;  4NCA A;  2BUP A;  1H1V A;  5AZJ B;  5KPR A;  3D2E B;  4B1X B;  3CCM N;  4XH4 A;  4C8M A;  3MXI A;  3PX4 A;  1RBS A;  2Q0R A;  3KK3 A;  3U9Z A;  4IEE A;  4BQL A;  3HP6 A;  4JI1 K;  4CGD A;  4BY9 C;  3WXL A;  5C24 A;  3VPZ A;  4AHT A;  3EY1 A;  1BWF O;  2RHK A;  4PL7 A;  1GOB A;  3QIO A;  2P9S B;  2O4I A;  2O8E A;  1SQK A;  3R1X A;  4CFA A;  4KHP K;  4ELV A;  1SL2 A;  1QSS A;  4BR4 A;  4FWL A;  1HRH A;  2DTU A;  2ATQ A;  1MA9 B;  1S22 A;  3KTQ A;  1XHX A;  2E4L A;  3UB5 A;  5CE3 A;  2P9L A;  3ZT4 A;  3GE1 A;  2O8C B;  2ITG A;  1Y97 A;  3ZSO A;  1IKX A;  1KVA A;  5BRH A;  4ID5 A;  4DTU A;  2P9N A;  4KKO A;  4FLV A;  1SL0 A;  4DV2 K;  3TAP A;  3K58 A;  4DR7 K;  5HRO A;  1JLF A;  3O4W A;  3C95 A;  4HCB A;  2X78 A;  2Q3S A;  2F4V K;  3AVG A;  3M6G A;  3TAF A;  3PO5 A;  3P31 A;  4A5A A;  2D0O A;  1VSI A;  4W5Q A;  4JEP A;  3Q7B A;  4WYB A;  3G0Z A;  1BIS A;  3HVR A;  4JKG A;  2KHO A;  2GUP A;  3OBW A;  3OYL A;  3KHY A;  2D0P A;  1DTT A;  3PUF A;  4BRO A;  3ZET A;  1JXB A;  3QES A;  1J5E K;  3FGU A;  1KFS A;  3BDP A;  2YCH A;  3OJS A;  4FJG A;  5J1E A;  4F8R A;  5AFU A;  2FSN A;  1DT9 A;  4FZX C;  1D4X A;  1QHT A;  1SV5 A;  3AY9 A;  2A1S A;  4CF9 A;  4DHY A;  3VQ7 A;  3NGZ A;  4C23 A;  4DTM A;  4KV8 A;  1XWL A;  1J5O A;  3CFP A;  2IS3 A;  5BN9 A;  2P5O A;  3OYI A;  3JAM O;  3LWL A;  1WSE A;  4A59 A;  2D4W A;  1VQN N;  1BQN A;  3HI0 A;  2PYJ A;  4B3O A;  4M3X A;  2UU9 K;  1L3T A;  1A5V A;  4Z4I A;  2VGN A;  1U4B A;  4CK2 A;  4B3S K;  1R0A A;  1J54 A;  3LM9 A;  3OYN A;  1E4F T;  5AQG A;  3I0S A;  4DQQ A;  4CEE A;  1D8Y A;  2E1Z A;  1NK8 A;  4H03 B;  1BIZ A;  1C0F A;  4LF8 K;  4CJP A;  4BG8 A;  4DS5 A;  3CHW A;  5KPT A;  3J7Z O;  3CCU N;  5HL7 L;  1L3U A;  1ASU A;  4CJW A;  3OHR A;  1RDD A;  3HP9 A;  4K43 A;  1LAV A;  2KFZ A;  4YOW A;  4GW6 A;  1DTQ A;  1EP4 A;  4FM1 A;  3FR0 A;  5BR8 K;  1YI2 N;  4FYD A;  3HVT A;  2DFH A;  1V4T A;  3IG1 A;  3S3O A;  4N41 A;  3QBW A;  2HNY A;  4X62 K;  3H1V X;  4BC5 A;  2P9U A;  2FSK A;  4BRD A;  3RRH A;  3DXM A;  5ADX A;  2X6S A;  5JVG L;  1QVF M;  4XH1 A;  1NJW A;  3OYC A;  3WUH A;  1WB9 A;  3R6M A;  3HK2 A;  4JKD A;  1RNH A;  1U2V A;  4XIU A;  4FLW A;  4CHO A;  3H3O B;  4JRQ A;  1KSP A;  5EXW A;  3VQD A;  3ISN C;  1GLJ O;  5GAG P;  1IKY A;  3TAG A;  1EQY A;  1N8R O;  2IIR A;  1WAF A;  4FZZ A;  3KLE A;  3U3G A;  4JS4 A;  3IAY A;  3GDQ A;  3JXU A;  2BDP A;  4BRC A;  1YAG A;  3DWL A;  5KRT A;  3BEX A;  1BU6 O;  4Y0W A;  4GMJ B;  4BC2 A;  1NGH A;  2FSJ A;  5CZ1 A;  2HHT A;  5HRS A;  3FZM A;  3NF8 A;  4WE1 A;  4OKJ A;  2X74 A;  4RW4 A;  1TVR A;  2A40 A;  4WQ4 A;  2KLA A;  3SCX A;  1XC9 A;  1WOQ A;  1GLL O;  4OJR A;  1T7P A;  5GAH P;  2FBY A;  2Q97 A;  1XQS C;  1RFQ A;  1K8K B;  3SAF A;  1S1W A;  3SJH A;  1X3M A;  1BIU A;  3DRR A;  1W2B M;  4BR7 A;  3H46 O;  3QFP A;  3I56 N;  3DLG A;  4DR5 K;  4ELU A;  3ITH A;  2NRV A;  4JK8 A;  3K59 A;  1KTQ A;  4CHQ A;  3K57 A;  4DV4 K;  1KAX A;  1P8Z A;  4E3S A;  3SQ0 A;  3H3N O;  4BGB A;  3ZCM A;  3ZT3 A;  4AHR A;  1SKS A;  3CPE A;  3VEY A;  5JLF A;  1N34 K;  3VER A;  2AP1 A;  3AAP A;  3ZX0 A;  3SBG A;  3B6O A;  5AQO A;  2B6A A;  1IO2 A;  3KWG A;  3HJF A;  4KHN A;  1E3M A;  3E9O A;  1WSH A;  2P1J A;  3OW2 M;  2HB5 A;  2E20 A;  4U67 L;  1YJW N;  3ZSX A;  4XEI A;  4H5V A;  2CGJ A;  1W9H A;  5K14 A;  4ISG A;  2HBK A;  3D0P A;  3J81 O;  3MXJ A;  1VSJ A;  3EKS A;  1WSJ A;  5BR9 A;  1X9W A;  2FBT A;  4X66 K;  1NMD A;  4B3R K;  4BC4 A;  5EVZ A;  4AIL C;  4Q5V A;  4CEA A;  4UY8 O;  1TKT A;  3O1B A;  1QQC A;  3K9J A;  4FO0 A;  3IFR A;  3LZI A;  2HHV A;  3ZT2 A;  2HBJ A;  2YJF A;  4DTN A;  5AJ3 K;  4J2D A;  4JRP A;  2HHW A;  4OPA A;  4IBN A;  3THW A;  4FLY A;  1GLF O;  4CIE A;  3EZW A;  3WXM B;  1GLE G;  2QWN A;  4FJL A;  4M3Y A;  1C0U A;  1CXU A;  2RE2 A;  3WNH A;  5HOO A;  1L3S A;  3HL8 A;  2HBM A;  3DYA A;  5SWM A;  4YOU A;  1UAX A;  2W6L A;  3QBX A;  4DSI A;  2OTJ N;  3CJ7 A;  4CF8 A;  1WAJ A;  3TPQ A;  5M1K A;  4HVJ A;  2UUC K;  2WTU A;  3J8A A;  4O0I A;  1C1B A;  2IGI A;  5C25 A;  1NLV A;  2F96 A;  3NFA A;  4BDP A;  1S1X A;  1Z26 A;  4CEB A;  3TAM A;  5AQM A;  2JWK A;  4CHN A;  1YJN N;  4Z4C A;  2QWO A;  1EXQ A;  3A8Y A;  3EEQ A;  1CZB A;  3L4I A;  2HW3 A;  3DRS A;  1NGJ A;  3CMA N;  3WXJ A;  4DR2 K;  1GLC G;  4OKE A;  4RTF D;  4CED A;  3MEG A;  1DEJ A;  2VCP A;  2Z1J A;  4M63 C;  3O6W A;  4Y1D A;  1TAQ A;  1WSF A;  2D0B A;  1UA1 A;  3NH0 A;  1VQO N;  3V9U A;  4MDB A;  1RTD A;  4L8R B;  3QEI A;  1JCF A;  3V9Z A;  2NRH A;  3O9R A;  4FWP A;  3LAL A;  1VRU A;  5J2Q A;  3OYM A;  1E4G T;  3K5M A;  3SUN A;  1S6Q A;  4JS5 A;  3ATU A;  1Q82 O;  2R7Y A;  3UIQ A;  3AAR A;  2BAN A;  2IVN A;  3F9K A;  4E7I A;  1U45 A;  3VQE A;  3EN9 A;  3O08 A;  3R8E A;  4BC3 A;  3KD1 E;  1KCF A;  3L2W A;  2BH1 A;  1KD1 O;  1KC8 O;  1C0M A;  5GAD P;  1VQ9 N;  3PV8 A;  3ID6 A;  2ASP A;  3VEN A;  3WQU A;  4FCY A;  3BZK A;  2JWL A;  3UKU B;  5FRM A;  1TK0 A;  3SPZ A;  1D9D A;  1NGG A;  4K8X A;  3KKS A;  1X3N A;  2KQ2 A;  2E2Q A;  3CER A;  3LP1 A;  4DV5 K;  2O8D A;  4WQ5 A;  3CCJ N;  3G10 A;  1ESV A;  4BR5 A;  4J2E A;  4YOX A;  1YJ9 N;  4BDZ A;  1RBU A;  1HPM A;  4JK9 A;  4HCC A;  4B9M A;  2YNG A;  1NGA A;  1JKH A;  3AAQ A;  2G8F A;  3ZX2 A;  3AVL A;  1SAZ A;  3UKR A;  4W5T A;  4RW9 A;  3LWM A;  4DR1 K;  1U48 A;  4BGA A;  1IG9 A;  1FXX A;  4DTR A;  4Z4H A;  3V6D A;  4B9Q A;  1FK9 A;  2PFU A;  4PHT X;  3VQA A;  3LZJ A;  4ISF A;  4L3Q A;  2KZM A;  3T19 A;  3T3F A;  5FDL A;  4DV6 K;  3F5T A;  4CJF A;  4I7F A;  3W3D A;  4HTL A;  4EIA A;  2V7Y A;  3NAE A;  4K41 A;  3KLF A;  3THX A;  3HTV A;  4LSN A;  1NGB A;  2NZT A;  2WON A;  4QCL A;  3RSE B;  3OS2 A;  2FF3 B;  4OO1 J;  1HYV A;  1S5J A;  5C2F A;  1RT5 A;  4B3T K;  3C7N A;  3MK6 A;  4CJK A;  1ZBH A;  3RMC A;  2Q0U A;  4JHD B;  3D2E A;  1SKW A;  1D9F A;  1I39 A;  5T7B A;  4BRN A;  1VQ7 N;  2WOM A;  4DQP A;  4E7L A;  4FK4 A;  5E41 A;  4PQU A;  4Y1C A;  3QEV A;  5D3G A;  3K5L A;  4KI4 A;  3I8D A;  4OPJ A;  4CGI A;  4GV6 A;  3H08 A;  1IKW A;  1ASV A;  2P9S A;  2Y1J A;  4LC9 B;  3VET A;  2HHQ A;  4HUG A;  3P1G A;  2G8W A;  3W0L A;  3F73 A;  4F3T A;  3BF3 A;  4FZY A;  3CYM A;  3VEX A;  3HPG A;  4I9L A;  4PKH A;  1HNW K;  3L3V A;  5JS2 A;  5JIC A;  1VAZ A;  3S41 A;  3AGR A;  4IKF A;  3V4I A;  4HTU A;  2P9N B;  3AO3 A;  3SAH A;  3HST B;  1HNZ K;  3AVC A;  3KK1 A;  5F2R A;  3V1R A;  3DOL A;  2NUB A;  2P51 A;  3C6H A;  3LDP A;  4IZ9 A;  4O8U A;  3CJA A;  3IS9 A;  2DPN A;  4KHY A;  5F1X A;  1S72 N;  2OCE A;  5KGX A;  4YOR A;  4CBW A;  2GV9 A;  1KFD A;  2BGG A;  2HF4 A;  2HBL A;  2QXL A;  3SYZ A;  1RBT A;  4WFA L;  1BHL A;  1OKJ A;  4IDH A;  2XY6 A;  3TU5 A;  5I3U A;  3GOI A;  3LPT A;  1TL1 A;  1L3V A;  3AVH A;  3LAN A;  4CES A;  4DU3 A;  1DLO A;  4KH4 A;  4O8K A;  4X64 K;  1SKR A;  4FJI A;  3J80 O;  1NU0 A;  3G4S N;  3MN9 A;  3HRG A;  3E01 A;  3QIN A;  3RTV A;  4B9U A;  3RMB A;  3K5O A;  3TTC A;  3ASM A;  1Z6R A;  2P9I B;  1ITG A;  3T7Z A;  2E2P A;  4FW1 A;  4DB3 A;  3HZ6 A;  3PX0 A;  4DTX A;  3QEW A;  4BRA A;  4CF1 A;  1MU2 A;  3AO2 A;  4EFH A;  4DQR A;  2F9W A;  4H5R A;  4KI6 A;  3TR8 A;  5LMU K;  2OZM A;  1GOA A;  5C10 A;  4EHU A;  4Z4F A;  4GKK K;  1JCE A;  3O4Q A;  1YTU A;  4J2A A;  2E2N A;  2ZJP L;  1T8E A;  3CC2 N;  3M8S A;  2B4J A;  3SLC A;  2OA8 A;  4BRH A;  4DR4 K;  3S3M A;  3GBT A;  3WXK A;  1NJX A;  1CLQ A;  1NGE A;  3ZYY X;  4CJU A;  4DSF A;  2F9T A;  1QQO A;  4FPA A;  2HVH A;  3MXM A;  3TAR A;  1M1K O;  3ZSR A;  2I7N A;  4IFE A;  3MN7 A;  1JL1 A;  4LF6 K;  1Q7Y O;  4H5N A;  2VG5 A;  1I94 K;  4KTQ A;  1S1U A;  2XRI A;  3OYK A;  4IOC L;  3HBT A;  4CZI A;  2P9L B;  2QWP A;  3FZK A;  4E0D A;  2ASO A;  3UKR B;  4U7B A;  3AA3 A;  2HF3 A;  3A5N C;  4BVO A;  3WT0 A;  1WN7 A;  1XMQ K;  3O4N A;  4DU4 A;  1KLM A;  3VF2 A;  4FJN A;  2FC0 A;  1GLA G;  3CI5 A;  4C1N I;  4NO7 A;  3U8X A;  4JI7 K;  2YNF A;  2UUB K;  2HNZ A;  4FJ5 A;  4GNI A;  5BRD A;  2OPS A;  1WBB A;  4I9Q A;  1A5X A;  3EO3 A;  3THX B;  2P9K A;  5BRF A;  4DSE A;  4DQS A;  4AM7 A;  4ID1 A;  5B8H A;  4CF2 A;  2VWK A;  4DTS A;  4FPB A;  3IUC A;  4F4K A;  3NCI A;  3EZ5 A;  4A5B A;  1W97 L;  3MN5 A;  5C2D A;  5DM6 L;  1XNQ K;  1VSD A;  2A3Z A;  5FRN A;  1NBW A;  5EOY A;  3FFI A;  3FZL A;  1RDA A;  2P5G A;  4GVM A;  2IDO A;  2ZWH A;  3LPU A;  3VQB A;  5HBM A;  4O44 A;  4DSK A;  2E8A A;  1NM1 A;  4JKH A;  2XHB A;  1NJI O;  4AQY K;  3WQT A;  1BDG A;  1Q9X A;  3NBP A;  2IVO A;  2NRZ A;  3AO5 A;  5AQI A;  3LDQ A;  3CME N;  4RW6 A;  3O8M A;  3BY5 A;  3CCR N;  3VGM A;  2QEX N;  4DV7 K;  5J2N A;  5AQQ A;  3U9D A;  4BE1 A;  4EZ9 A;  2BTF A;  4Z0U A;  3SMS A;  1BG3 A;  1TYQ B;  1JLA A;  3OJU A;  1VK0 A;  2YHY A;  3I8B A;  1ZBU A;  2A6A A;  5CHI A;  4IDK A;  1JCG A;  1RDU A;  5HP1 A;  3FFK B;  1NKB A;  1BCO A;  4BDY A;  3TTF A;  3SBT A;  3AVB A;  2EHG A;  2NRX A;  4BRF A;  4EP5 A;  4CGJ A;  1WNS A;  3CCL N;  1TGO A;  4B9N A;  3SQ1 A;  4I2P A;  5AR0 A;  3C65 A;  4FVU A;  2HMP A;  5HRN A;  1JLG A;  2QW9 A;  1YF5 L;  3SI6 A;  4DG1 A;  1VQK N;  4DR6 K;  5BPN A;  4IJA A;  1T3V A;  4CFD A;  3L3U A;  1NWK A;  3V9W A;  2HHU A;  1YUW A;  2YHW A;  1QTM A;  1FW6 A;  5E26 A;  3MEE A;  4B8C A;  4B9V A;  2OZS A;  3K9K A;  4CJ7 A;  4B1Z A;  2GEL A;  3RRG A;  3M1F A;  3E9L A;  3AV9 A;  5LMN K;  1L5U A;  2E2O A;  1B9F A;  3BZC A;  3L4Q A;  3QEX A;  1WSI A;  3NMU A;  4CJQ A;  4BRP A;  4WFN L;  3A5M C;  1KVB A;  1KAZ A;  2WC9 A;  1X9S A;  1VQP N;  4G9Z A;  5HLF A;  4IG0 A;  4DFJ A;  2P9P A;  4M3Z A;  2GX9 A;  2YKN A;  1KAY A;  3AVF A;  4CFB A;  2AA4 A;  1VSF A;  3D2F B;  4LH4 A;  3E1Y A;  4BWJ A;  4YOV A;  3SV4 A;  1MWK A;  1D5A A;  2JGU A;  5AQJ A;  4CZK A;  4FJX A;  1Z25 A;  1O13 A;  5AQN A;  1VQ6 N;  1JJ2 M;  3S3N A;  4CJE A;  3VQ4 A;  3KK7 A;  3SZ2 A;  3EKU A;  4JKB A;  5KQ8 A;  2O8B B;  3DLB A;  4CZF A;  2OYQ A;  3CFO A;  4CBU A;  3TSP A;  4H0T B;  4E7H A;  4KHS A;  4FWS A;  4DF4 A;  1FJG K;  4DFM A;  3SUQ A;  3BGR A;  1ASW A;  2W40 A;  3C0B A;  2RKI A;  4MFB A;  4CBX A;  3LL3 A;  3NF6 A;  1ZC6 A;  1YIT N;  4PKG A;  4KHQ A;  4C8L A;  4ZHR A;  4IEI A;  2FF6 A;  3QFU A;  5AQP A;  2NRT A;  3QIC A;  5EU7 A;  1T6C A;  3PLA A;  1C1C A;  4Z4G A;  1NGF A;  1Z05 A;  5C42 A;  4CZJ A;  1VQL N;  1TKX A;  4DWI A;  2JLE A;  3NVK A;  4MDA A;  2O4G A;  4C1N K;  5JMV A;  2HOE A;  1EWQ A;  3C6T A;  1M90 O;  1G15 A;  1RT4 A;  3WEE A;  3VQ5 A;  4FLZ A;  2ASM A;  3E9P A;  4JI0 K;  2Q1N A;  1LW0 A;  3KLH A;  4CZH A;  2V52 B;  5AZJ A;  5M1P A;  1J6Z A;  3THY B;  3QNN A;  2UXC K;  3VMF B;  1ZBI A;  4WCE L;  3VGL A;  4JI5 K;  4AM6 A;  1S1V A;  1NJZ A;  1FKO A;  3HOT A;  4E89 A;  2O8E B;  2RPI A;  4JKF A;  2V51 B;  2Z1G A;  4RCH A;  2HND A;  1QQM A;  4ZTJ A;  4BRL A;  3THW B;  3F2K A;  4DUZ K;  4DQI A;  4YNQ A;  3PO4 A;  3KK2 A;  3OA9 A;  1FKP A;  2YV0 X;  2NNW A;  4G1Q A;  3T1A A;  2FBX A;  4CGF A;  1Q81 O;  2O8C A;  1VRT A;  4W5O A;  2XY5 A;  2QWQ A;  2QKB A;  2GWJ A;  3O80 A;  4BRQ A;  4BE2 A;  2Q31 A;  5LL6 Z;  4CJ5 A;  2QKK A;  4FJ9 A;  1KQS M;  4RWT A;  3L2R A;  3CJC A;  1BI4 A;  4NCG A;  4H0V B;  3MWP A;  4B8A B;  3QLH A;  5IT9 O;  5AQZ A;  2QWR A;  1G99 A;  1SUQ A;  3EE8 A;  4B9L A;  4OKK A;  4GKJ K;  2H3G X;  3ZT0 A;  5TKY A;  1TKD A;  3JSM A;  3MAQ A;  1IH7 A;  2VG7 A;  3QNO A;  3L0Q A;  4NYF A;  1OVQ A;  2Z1I A;  3CM5 A;  4BRI A;  3FE1 A;  4KTZ A;  1C6V A;  4M3R A;  5CR4 A;  1YTA A;  4M7Y A;  4QOZ B;  3FZF A;  4N56 A;  4JKG B;  1SL1 A;  1BGX T;  3SQ2 A;  4CEQ A;  1EET A;  3FZH A;  4CGG A;  3DLR A;  4CJR A;  3ULD A;  3QER A;  4M42 A;  3C7N B;  4EAH D;  4MO4 A;  3J7A P;  1BL3 A;  4DFK A;  1Y64 A;  3AA4 A;  3AA2 A;  3O9U A;  4LF7 K;  3KZB A;  3D7E O;  4BRM A;  5AQX A;  5GIN A;  1NJY A;  1NK4 A;  4CJT A;  4CJS A;  4E1M A;  1LOT B;  1RBR A;  3VF6 A;  1LWC A;  5FRO A;  5DMR A;  3VEV A;  1RT2 A;  3H45 C;  1U49 A;  2E6L A;  4FXD A;  2GTD A;  3HPH A;  4YY3 K;  1HPZ A;  1QQN A;  4DFP A;  4CZE A;  1K8A O;  4EZ6 A;  3N4P A;  3LAM A;  1BO5 O;  3ZSY A;  2W6K A;  4CK1 A;  1F21 A;  3O1W A;  1UWB A;  5AQW A;  1S9E A;  5GIO A;  5LY3 A;  3NH2 A;  3QEP A;  5CZ2 A;  1QS4 A;  1Q86 O;  2NRR A;  3UKU A;  1JXE A;  2P9P B;  4B1W B;  3FLC O;  3DXK A;  4FK2 A;  3WNF A;  3VEW A;  4AHC A;  1SZ2 A;  3U3Y A;  2A5X A;  4BVP A;  3G25 A;  3O3H A;  2QA4 N;  3BF1 A;  4BR2 A;  3VA0 A;  3SAG A;  3VA3 A;  4BE0 A;  3CJB A;  4LF4 K;  1NOY A;  2P9U B;  1HQE A;  3CF5 L;  3DMJ A;  4BQZ A;  4A2A A;  2LSN A;  5M1N A;  3IMX A;  3C6A A;  3ULE A;  3QIP A;  1CZA N;  3DXM B;  1RT1 A;  4FW2 A;  3JYT A;  2YI1 A;  4CHP A;  1EX4 A;  1KRP A;  4DLE A;  3K5N A;  3S9H A;  5C0Y A;  1VSE A;  4B9S A;  5KQD A;  4I6M A;  3L2U A;  4K25 A;  3DM2 A;  4MO5 A;  4B1V A;  4JKE A;  4NXN K;  1U2V B;  2A42 A;  3LM2 A;  4M45 A;  4WF9 L;  2G8I A;  2O8F A;  4FJJ A;  2EWS A;  4LFB K;  4H0O A;  4C8K A;  4PA1 A;  2F8T A;  3KIO A;  1UA0 A;  4OX9 K;  4M3T A;  3QB0 A;  1RDW X;  3AGK A;  2IC3 A;  2YNH A;  1VQ5 N;  1IBK K;  2P9I A;  4DMN A;  3SJJ A;  4CW7 B;  4DF8 A;  1U6Z A;  2QWM A;  1T44 A;  2YHA A;  3ZX3 A;  1IKV A;  3L2V A;  4RW8 A;  3QDK A;  2F7T A;  5KTQ A;  2VYP A;  4FWK A;  1SS6 A;  5AFU H;  4W5R A;  1NNE A;  3WEE B;  1R59 O;  1TV6 A;  4CF0 A;  5C12 A;  3WNE A;  2HMI A;  4JHD A;  1ZXO A;  1RTH A;  3CFR A;  5BPL A;  2B5J A;  1KXP A;  4KBO A;  4O4G A;  3AVA A;  3VQ9 A;  4LD0 A;  3J7Y P;  1K8K A;  1NMN A;  4NLC A;  1QZ5 A;  3MED A;  3CQX A;  2E1Y A;  3OVN A;  4H5W A;  2YKM A;  3ZSV A;  3K0S A;  3QET A;  3OYE A;  3ZSW A;  2E5L K;  1OH7 A;  5FPD A;  4LSL A;  1VHX A;  4QS8 A;  4ZTF A;  3BP8 A;  1QVG M;  4O5F A;  3L8B A;  3M8R A;  3VEO A;  4ELT A;  1VQ4 N;  1LAW A;  3KD5 E;  5CYQ A;  1J9A A;  4H5T A;  5AQS A;  4BAC A;  1QZ6 A;  2EX3 A;  2VGM A;  4CI6 A;  1JLC A;  3GL1 A;  2ZQB A;  3CC7 N;  1RT6 A;  2E88 A;  2FXU A;  3ZSZ A;  3WXI A;  3O3F A;  3AVN A;  4QS9 A;  2KFN A;  2KZZ A;  2UYT A;  3TSU A;  4JD2 A;  1KVC A;  1XC3 A;  3RR7 A;  3DAW A;  2G8H A;  4CHY A;  1I3A A;  4R5P A;  3D45 A;  2NRW A;  3OS1 A;  2HHH K;  2G8K A;  2GEM A;  3MMV A;  3PX6 A;  4N76 A;  3PSI A;  1X9J A;  3V1O A;  4IWV A;  4FJM A;  4GY2 B;  4BRG A;  3G71 N;  5M1O A;  1S6P A;  1RTJ A;  4KFB A;  2XY7 A;  2QI2 A;  1HUX A;  4FOE A;  2DFE A;  3EL2 A;  4FM0 A;  5TKW A;  1BQM A;  1UOC A;  5AZI B;  1HYS A;  3CD6 N;  3TAB A;  2ZD1 A;  1RDC A;  4OPH A;  1TK5 A;  4ILH A;  3ZEU A;  4M41 A;  3IRX A;  1N33 K;  1CZ9 A;  3H1Q A;  3C6U A;  1HKG A;  2AJQ A;  2QXF A;  5CY4 A;  3RVC A;  3OY9 A;  1ATN A;  1GOC A;  1TUU A;  2RN2 A;  3KKR A;  1NK0 A;  4TSX A;  2PBD A;  4FK0 A;  3F9M A;  4FSV A;  4AHV A;  4KTW A;  3PY8 A;  3MX2 A;  4ISE A;  1BCM A;  5KPZ A;  2HST A;  1T05 A;  3KWI A;  3HO1 A;  4OLA A;  4HWI A;  4PL8 A;  3V81 A;  4K42 A;  5J2M A;  4E7K A;  2ZE2 A;  1A5W A;  1HJO A;  3CQY A;  3KJV A;  2YJE A;  4IOX A;  1K9M O;  1KLN A;  1IV0 A;  4DSL A;  3CCE N;  2RF2 A;  3DLH A;  4I2Q A;  1XMO K;  2YNI A;  1LWF A;  4A2B A;  4CK3 A;  4JN4 A;  4QAG A;  1T6D A;  4M7X A;  1NG9 A;  1VQ8 N;  1IJJ A;  1N6Q A;  5AQH A;  3G6E N;  4FWM A;  4PKI A;  4WQ5 C;  2KKZ A;  2ZJQ L;  3VTH A;  3VGK A;  2I5J A;  3NGY A;  1HNX K;  1Q18 A;  3O9Q A;  5ADX H;  4WQ4 C;  4CJV A;  1ATS A;  2D5R A;  4I6M B;  4FLX A;  2HHX A;  4JNE A;  3IDH A;  4A62 A;  4PY5 A;  4KRE A;  4EP4 A;  3M8Q A;  4FOI A;  5AQU A;  5FPM A;  5AQR A;  2PYL A;  1HYZ A;  2XO7 A;  1S9G A;  2Z1H A;  5AQY A;  3HM8 A;  3B6P A;  3NHG A;  4JK7 A;  2P9K B;  4CIF A;  3CQ8 A;  3K2P A;  3LDN A;  3OYF A;  5H1S Q;  3DRP A;  2ZGZ A;  4KH5 A;  4AHU A;  4CD1 A;  1HKC A;  2QM1 A;  2HHS A;  4NXM K;  1RIL A;  2E6M A;  3ENO A;  2W41 A;  5I42 A;  3RMD A;  3VQP A;  3OYD A;  4JKA A;  4DV1 K;  1JLQ A;  4FLU A;  5FLX O;  3VQ8 A;  4KPY A;  3P5J A;  3NVM A;  3AO4 A;  4DTP A;  1QE1 A;  1YHQ N;  3ZSQ A;  1LCU A;  3MCP A;  4LY7 A;  4OGE A;  1LW2 A;  4H0X B;  1K6Y A;  2BE2 A;  4NYN A;  2ZM6 K;  3OBY A;  3OYH A;  3HT3 A;  4Z4E A;  2QTD A;  3CG7 A;  4IFV A;  3OS0 A;  2CGK A;  2G8V A;  2ZGY A;  4IO8 A;  3AVJ A;  1ZYQ A;  4A61 A;  4BR0 A;  3CET A;  3O5B A;  2CH5 A;  3PSF A;  3ID8 A;  3VEZ A;  4KB1 A;  1RGI A;  3QO9 A;  2OPQ A;  4J2B A;  4LFA K;  4W5N A;  2F8S A;  3OTO K;  1U04 A;  3ZT1 A;  4GVE A;  5EY4 A;  4FVM A;  1BOT O;  4IOA L;  5GAE P;  4CGH A;  4CJL A;  1OVY A;  2WUS A;  2UXB K;  2A41 A;  3N4Q A;  1HX1 A;  1RDB A;  5GIP A;  3O9S A;  4GV9 A;  4J8F A;  1JLE A;  3T69 A;  4LF9 K;  4H8K A;  5CYM A;  4JI4 K;  4JI8 K;  1VSM A;  3MWT A;  1XI1 A;  1NK6 A;  4DSJ A;  1W7A A;  1TAU A;  1ILY A;  4CVN E;  3EE9 A;  4MLE A;  4CEO A;  4CZG A;  5J2P A;  2IOC A;  2VWJ A;  5M1F A;  4HHT A;  1BA0 A;  3TAE A;  3TWH A;  3I0R A;  5AZI A;  1C0T A;  2IVP A;  1HJR A;  4B1Y B;  3MCA B;  1TK8 A;  1RBV A;  1TL3 A;  5AQF A;  2ZJR L;  1C0G A;  2WFB A;  3OYG A;  2W42 A;  4FWN A;  2OPR A;  1ZBL A;  4OVL A;  1EO1 A;  2OAN A;  4JLH A;  3E66 A;  1BI4 B;  3I33 A;  5LJV A;  2ITM A;  1LWE A;  5AQV A;  1ZBF A;  1S3X A;  3MEC A;  3HOS A;  3PIP L;  3PIO L;  1EKE A;  4QS7 A;  3VOV A;  5BPM A;  1GLD G;  2KTQ A;  1NKE A;  4KHW A;  3P38 A;  4NB4 A;  5F0X A;  4ILJ A;  4JI3 K;  3CJ9 A;  3HPO A;  4JI6 K;  5LJW A;  4AF1 A;  4DV3 K;  2IAJ A;  4FJ8 A;  3TAQ A;  1EWR A;  1NOZ A;  4BG9 A;  2PZS A;  1WBD A;  1CXQ A;  1XNR K;  4AHS A;  4H0Y B;  3C94 A;  5M1Q A;  4V19 S;  4F2S A;  4N47 A;  1N36 K;  4K8Z A;  3U6F A;  1W0H A;  3JS6 A;  1HNI A;  4IXC A;  4RW7 A;  4YOT A;  1MWM A;  4JAX A;  4CEZ A;  3KLG A;  1RCH A;  2ZF5 O;  5MLC Q;  4O5B A;  1BA1 A;  1K73 O;  3HM9 A;  4NLB A;  2YX6 A;  4FWO A;  5AQL A;  5JS1 A;  2Q36 A;  1VSH A;  3DLL L;  3U4L A;  3NH1 A;  4NCB A;  5KI6 A;  1LV5 A;  3LDS A;  4KRF A;  1DKG D;  2UUA K;  3OYJ A;  3V1Q A;  4BWM A;  3GG4 A;  4FWR A;  3AA5 X;  3VQ6 A;  1RT3 A;  1OH5 A;  3OYB A;  4CIG A;  3VES A;  4GV3 A;  4X65 K;  1Q9Y A;  2VG6 A;  3A2F A;  3BUZ B;  2D1K A;  2FBV A;  3SMP A;  3VQQ A;  4E19 A;  1P90 A;  3VTI A;  3CCV N;  4FLT A;  3THY A;  2J4R A;  3V9X A;  1YT3 A;  2CGL A;  3DXK B;  4DU1 A;  3HXM A;  1WLJ A;  3SNN A;  3WNG A;  1T03 A;  3QML A;  4JYA K;  5HRR A;  4YHH K;  3V9S A;  4Q0B A;  3NE6 A;  1QSL A;  2GUI A;  4IFY A;  4CFC A;  2A1R A;  3MDQ A;  4O55 A;  3IKM A;  4E1N A;  3Q7C A;  4YDU C;  3LDL A;  2YHX A;  1TUY A;  3ULE B;  3CM6 A;  3NF7 A;  4F2R A;  3TI0 A;  4IJN A;  4YDU A;  5KRS A;  3TSQ A;  1N5Y A;  4FJK A;  4CZL A;  1NK5 A;  4ILG B;  1B92 A;  3A0I X;  1VQM N;  1V4S A;  4CEC A;  4JI2 K;  2OPP A;  1X9M A;  2O8F B;  5JLH A;  4EHT A;  3NDK A;  4H4M A;  4DR3 K;  2D0A A;  4IO9 L;  4H0P A;  4H4O A;  3HSC A;  4YFU A;  2DFF A;  2O8D B;  4MLH A;  4JKC A;  4Z94 A;  2WBN A;  4FL9 A;  3AVK A;  3KLI A;  1YIJ N;  1B9D A;  4BRK A;  3A5O C;  1XUP O;  1ATR A;  1TKZ A;  2UXD K;  4OGC A;  1X1P A;  4AH9 A;  1MDU B;  3M3Z A;  2GBZ A;  2X6N A;  4WFB L;  3ALY A;  1Q8I A;  4KB0 A;  2Q2R A;  3A5L C;  3L2Q A;  2PY5 A;  1IG8 A;  3M8P A;  3LP2 A;  2VQE K;  3O3G A;  1NGC A;  3NGI A;  3ENH A;  4HUE A;  4F3O A;  4RG8 A;  1HQU A;  5DK5 A;  1RT7 A;  3CIP A;  5KGW A;  3SUO A;  1NK7 A;  4FM2 A;  4XH5 A;  2PAV A;  2KW4 A;  5E84 A;  1NK9 A;  2D0C A;  4KHU A;  1HKB A;  1BUP A;  1YVU A;  3ENB A;  3T1Y K;  3VQC A;  3RWU A;  1TYQ A;  4CE9 A;  2QK9 A;  1WSG A;  3SV3 A;  3AVI A;  4CD3 A;  4DCH A;  3ZET B;  3CJ1 A;  2QWL A;  4DTJ A;  1S1T A;  5IWA K;  3DLK A;  1YXQ A;  2VWB A;  4HUF A;  3VF4 A;  1REV A;  3LAK A;  1NGD A;  1GLB G;  4DTO A;  4PUO A;  3H6E A;  4CZM A;  4LFC K;  4FJ7 A;  2V7Z A;  3TAN A;  3P83 D;  4JD2 B;  3ATV A;  1RTI A;  3HYF A;  3R9P A;  3AO1 A;  1O1W A;  4DLG A;  4YOY A;  2HVI A;  3CC4 N;  1IBM K;  2ETJ A;  4PWD A;  4CEF A;  1NKC A;  3KVG A;  3UE5 A;  4E1J A;  5BRE A;  5DM7 L;  1HLU A;  4C8O A;  3DI6 A;  3DOK A;  3TTD A;  3ZLJ A;  1N32 K;  3SK3 A;  1HR0 K;  4B3M K;  5BN8 A;  1QHA A;  5C15 A;  3AVM A;  3P39 A;  3ZEU B;  3VN5 A;  3DLE A;  3LP3 A;  2I7P A;  4ICL A;  1C1A A;  5FPN A;  4DS4 A;  2XY8 A;  3R3L A;  4B1U B;  2CH6 A;  2G8U A;  4CCH A;  5AQK A;  2Y1I A;  3D2F A;  4LH5 A;  1U47 A;  2GWK A;  3MX5 A;  4M3U A;  4F9O A;  4E7J A;  5FPE A;  4K0K K;  3L6Q A;  1QSY A;  2VQF K;  5EX5 A;  1OH8 A;  4CHZ A;  1JL2 A;  3O9T A;  4FWQ A;  4FJH A;  3DJC A;  5SZT A;  3SPY A;  1VSK A;  4C8N A;  4B08 A;  3SQ4 A;  4A57 A;  4OLB A;  4KO0 A;  1J53 A;  2O8B A;  3CCQ N;  3D6R A;  4KAZ A;  4OPK A;  4N5S A;  3SUP A;  4DV0 K;  4CJ4 A;  1HMV A;  4BR9 A;  3LP0 A;  4CER A;  4DQ8 A;  1JLB A;  5I9E B;  4LF5 K;  1WUA A;  4JV5 K;  4MQ3 A;  3EYZ A;  3NF9 A;  4B9T A;  2YHB A; 
#chains in the Genus database with same CATH homology
 4OX9 K;  4JYA K;  5A2Q O;  4YHH K;  4DUY K;  4DR4 K;  5IWA K;  1IBK K;  4CW7 B;  4DV5 K;  1HNW K;  3J7A P;  1N33 K;  4LF7 K;  4NXM K;  4LF6 K;  4LFC K;  3T1H K;  1I94 K;  1HNZ K;  2UUC K;  3JAM O;  4DV1 K;  5FLX O;  2UU9 K;  1IBL K;  4JI3 K;  4JI6 K;  4JI0 K;  4DR6 K;  4B3S K;  4DV3 K;  1IBM K;  4DR1 K;  1XMQ K;  4JI2 K;  2ZM6 K;  4YY3 K;  3J7Y P;  2UXC K;  4JI1 K;  1XNR K;  4JI7 K;  4JI5 K;  2UUB K;  4DR3 K;  4V19 S;  4LF8 K;  1N32 K;  4DV6 K;  1HR0 K;  4B3M K;  2E5L K;  5LMN K;  4DR5 K;  1N36 K;  1XMO K;  4DR2 K;  4X64 K;  4DV4 K;  3J80 O;  4KHP K;  4DUZ K;  5BR8 K;  1XNQ K;  4LFA K;  1N34 K;  2UXD K;  3OTO K;  4B3T K;  5LL6 Z;  4LF4 K;  4K0K K;  4X62 K;  2UUA K;  1HNX K;  2UXB K;  2VQF K;  4AQY K;  4DV2 K;  2VQE K;  3J81 O;  4DR7 K;  4LF9 K;  5IT9 O;  4X65 K;  4JI4 K;  4X66 K;  4JI8 K;  2F4V K;  4B3R K;  2HHH K;  4GKJ K;  4DV7 K;  4CVN E;  5LMU K;  4DV0 K;  4NXN K;  1FJG K;  5AJ3 K;  4GKK K;  4LF5 K;  4JV5 K;  3T1Y K;  4LFB K;  1J5E K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...