4DV0K

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u20g
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
116
structure length
116
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
total genus 27
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4dv0K00
5BR8K 4DV1K 4B3MK 1HR0K 1IBMK 4CVNE 4JI2K 3JAMO 4JI3K 4X64K 4DR5K 1XNQK 1N32K 2UXBK 4OX9K 3OTOK 1XMQK 2ZM6K 2UUBK 2UXDK 4LFAK 1IBLK 3T1HK 5FLXO 3T1YK 4JI4K 4DUZK 2VQFK 4GKKK 3J81O 4NXNK 4JI8K 4CW7B 4LF8K 2F4VK 5LMUK 4JYAK 3J7YP 5LL6Z 2HHHK 4B3TK 4X62K 4YHHK 4LF4K 4GKJK 4DV4K 1J5EK 2UUAK 4JI1K 4DR4K 2UXCK 3J80O 4B3SK 4DR2K 4YY3K 5A2QO 5IT9O 4LFBK 4DV3K 1XMOK 4NXMK 4X66K 4LF5K 2UUCK 1N33K 3J7AP 4DV6K 4V19S 4AQYK 4LF6K 4JI7K 4LF9K 4DR6K 4DR3K 4KHPK 1I94K 1HNXK 2VQEK 4JI6K 1N36K 1IBKK 2E5LK 4LF7K 4DR1K 1HNWK 4K0KK 4DV2K 2UU9K 4DUYK 1FJGK 5AJ3K 1N34K 4DV0K 4X65K 4B3RK 4LFCK 5IWAK 4DV7K 5LMNK 4JI0K 4DR7K 1XNRK 4JI5K 4DV5K 1HNZK 4JV5K
chains in the Genus database with same CATH superfamily
2KTQA 3NF6A 2I7PA 3E1YA 4N56A 3SUQA 1KXPA 3K59A 2XY7A 4F9OA 4KB0A 1GLJO 5KPTA 2QTDA 2KZMA 1T03A 4DFMA 3WEEB 1MA9B 3VEZA 1D9FA 2ZM6K 1WSJA 4FJXA 3SYZA 2O8DB 3UB5A 3FE1A 5JVGL 3T1YK 3ZSXA 4CJFA 4O44A 2IAJA 4JK9A 3I8BA 4IJAA 4CK2A 4A5BA 4BC5A 4CEFA 3V9ZA 2I7NA 2F4VK 1D8YA 4RW9A 2W42A 2HNZA 1ZBLA 2D0AA 2KFZA 1VHXA 2QKBA 4Q5VA 2YHBA 3BUZB 3TSPA 4Y1DA 4M63C 2Z1IA 4KHWA 4DF8A 3EY1A 1CLQA 3VMFB 3HT3A 4FL9A 4LH5A 4DR2K 1BA0A 4PKHA 2ZJQL 5C42A 1U2VB 5ADXA 2DFEA 2P9SA 3P38A 4H4MA 3V4IA 1RTJA 5JICA 1V4SA 1T6CA 4KH4A 4LD0A 1TL3A 3KLFA 3CQ8A 4YFUA 1N33K 2FLOA 1C0GA 4KTQA 2JGUA 5AZJB 3SV3A 2P9SB 5JVHL 2QWMA 2FF6A 1HNXK 4LC9B 2E6LA 3ENBA 5BPMA 1VSDA 1NK8A 3SQ4A 1ZBSA 3ATVA 1WBDA 3RR8A 1RDDA 1OKJA 5EY4A 3KIOA 2BANA 3ZSQA 4KTWA 5C10A 1VQ5N 3KLIA 3IAYA 3O9UA 3RTVA 4Z0UA 1K73O 3MN9A 4GV9A 1NGDA 3VQDA 4MFBA 3L4IA 2ZGZA 3MN6A 4E89A 3VPZA 3CJAA 4DR7K 3D6RA 1NK7A 1X9MA 3L6QA 3ALYA 1W97L 4JNEA 1MWMA 4FJ7A 2Q1NA 5EX5A 4YOTA 1ZBHA 1KVCA 4JK7A 1NGJA 3T1AA 2YHWA 3AVLA 4KH5A 2WTUA 3HVTA 4OPJA 3HTVA 4DWIA 4B1VA 3FZHA 3TPQA 3MK6A 2D1KA 1KFDA 1HJOA 2JLEA 3RRHA 4GVEA 3ISNC 3A8YA 4DCHA 4KHNA 4G9ZA 2NRWA 3IDHA 4CW7B 1GLFO 3AAPA 1HMVA 1LWEA 1B9FA 3P31A 3QBWA 2NRHA 4BR4A 4KV8A 1QHTA 3EE8A 4YOWA 4CJTA 4R5PA 4M3YA 4RWTA 4BRCA 1U45A 4WF9L 4LY7A 4GKJK 2QWPA 5LJWA 4LSNA 2D5RA 2UUAK 3SQ1A 3LANA 1RT6A 1R0AA 4FLTA 4XEIA 3K58A 3SZ2A 4FJ5A 5KGWA 5M1NA 1HNIA 3O9RA 4K8XA 3BZCA 4FVMA 1RBUA 4GV6A 4LF5K 3QO9A 3T19A 3L2QA 5DM7L 1Z25A 3QESA 3CFPA 3SK3A 3OYDA 2YHYA 3S3NA 3ZT1A 1U48A 3RWUA 4DF4A 3OBYA 2QK9A 3OW2M 4DTJA 2VGNA 1NGBA 4KHPK 5E41A 3G10A 1NK9A 2E5LK 3KK7A 3EO3A 4E19A 3AVNA 4CZHA 3W0LA 1ZBUA 4IEIA 5J2QA 4CJEA 4CZMA 4JKCA 4BC2A 1D9DA 4CEQA 1Q9YA 5F2RA 3U4LA 2XHBA 3THWA 4IOAL 3QB0A 4B9UA 4MO4A 3SBTA 1VSMA 2A6AA 2HBMA 3S3MA 3ZSRA 3B6OA 4BWMA 4YNQA 1K8KA 3DLBA 1ESVA 1WBBA 4B3MK 1NM1A 3NDKA 1HQEA 1ITGA 3SQ0A 3GG4A 3MXJA 4ICLA 4CVNE 1ZXOA 3VESA 3CFRA 4DR5K 3DRRA 2CGLA 1K8KB 1KLMA 4BRHA 4ISGA 1EWQA 5FLXO 2PYLA 4M41A 4O0JA 3SJJA 2VCPA 3CM6A 3O6WA 4FWPA 5JS2A 1WSFA 4JI8K 4KHQA 4DB3A 3KWIA 1L3VA 4HTLA 5JLHA 5AQRA 2HBJA 3LZJA 2OPSA 3I56N 1BCMA 2A1SA 4LF4K 2GWJA 5AQPA 2A1RA 4JD2A 3J8AA 4CGGA 4DG1A 2ETJA 2QW9A 3KKRA 4M7XA 4BQLA 4M3WA 4OPKA 2PY5A 3N4PA 5E26A 4KPYA 3LAMA 1S1XA 3K2PA 4BC4A 1GLBG 4X66K 3DXKA 2HNYA 3U9ZA 1VSKA 4J2EA 4CZKA 3LP3A 4YDUA 4U7BA 4AHSA 2Q0UA 3EE9A 3QLHA 4CECA 3HOSA 3ULEA 4IBNA 1CZAN 1KCFA 4DR6K 5AQMA 2QWOA 3WXJA 4H5WA 4JI6K 3TU5A 3U3GA 1IBKK 4J2AA 1C1BA 2FXUA 4JK8A 4JHDA 4ILHA 4WE1A 4K8ZA 3AGRA 3MEDA 3K5MA 3V1OA 1N8RO 1VSJA 1QVGM 4BR9A 2OPRA 4FJNA 3D2EA 1ASVA 5BRHA 1WUAA 4DQSA 1YUWA 3LPUA 1N6QA 4H0PA 3ZEUB 1YVNA 4CBWA 5LMNK 1C1CA 3DMJA 1YHQN 1X3NA 4CZEA 3OS2A 4BG8A 1K9MO 4FLVA 1B92A 1MDUB 3OYAA 2PAVA 1BL3A 3CQXA 4OJRA 4BRLA 3EZWA 1ATSA 3VGLA 4XH4A 4FCYA 3AO3A 3E9PA 1LAVA 4B1YB 2YKNA 4FWSA 4C8LA 3C95A 2F8SA 3JAMO 4PKGA 5LJVA 4X64K 5SWMA 4W5NA 4E1NA 4CEEA 4W5OA 1NJWA 1TAUA 1TK8A 2UUBK 1Q18A 1EXQA 4FLUA 5FROA 3T1HK 1Z6RA 3HVRA 3AA3A 1UA1A 3QEWA 3DXMB 3VQ7A 3F9MA 1VAZA 1W2BM 1LV5A 3QBXA 2FBYA 4W5TA 1CXQA 1ASUA 2A3ZA 5AQSA 5BRFA 1LW2A 5LMUK 4IDHA 5CZ1A 4C8NA 4KKOA 3MXIA 1I3AA 3CFOA 1C1AA 3BEXA 4BVPA 3CMEN 4JKGA 1VQLN 3QFUA 2UXCK 2HBLA 3TSQA 3RMDA 2Q2RA 3ZSYA 4DSLA 3NH2A 3F9KA 4OGCA 2GBZA 3JYTA 4CHQA 2W40A 4FWNA 4RW7A 4CEOA 1KAYA 1YJNN 3O1BA 4KTZA 3LDSA 3A2FA 1JCGA 2HHXA 3O08A 4CJWA 3OYFA 4WQ5C 1RDCA 2XY8A 1BISA 3CJ9A 4I9LA 1U49A 1IKVA 3BY5A 2NLXA 5KRSA 3PY8A 4K0KK 3DYAA 3PLAA 1RT5A 1OH6A 2LSNA 4BRAA 1TKXA 3VF4A 3UKRA 3HPGA 4NYFA 3L2WA 2FBTA 1TYQB 4BRGA 5M1QA 1RILA 3RSEB 2AP1A 4KFBA 2IIRA 4L8RB 4WFBL 2X74A 5ADXH 2P1JA 1NKBA 3QICA 2D0CA 4CEBA 1BDGA 3NF8A 3PSIA 1IH7A 3VEVA 3V1QA 3EZ5A 3QEPA 1U47A 3OYMA 3TTCA 3SV4A 3KD1E 2E88A 2BUPA 2HBKA 1G99A 4Z4GA 4CGDA 3QEVA 4K43A 4H0TB 1E3MA 3ZETA 3U9DA 1VQ4N 4N41A 2W6LA 4F4KA 2OYQA 4NXNK 2Y1IA 3AVAA 1D4XA 1M1KO 1JLCA 2GEMA 4ID1A 3OYKA 3HP6A 1QSLA 4FJJA 3BZKA 3TABA 5C2FA 4CEAA 3P4IA 4B3TK 5GIPA 1JXBA 2R7YA 2PZSA 1J5EK 3JS6A 3PIPL 1BWFO 2GELA 2IGIA 5ELZA 3D2FB 2KLAA 1NNEA 4DSKA 3GL1A 3NVKA 3CHWA 3V9UA 2HHTA 5IT9O 4CJPA 4IXCA 3HBTA 3L2VA 2E1ZA 4AHCA 3EKSA 4PY5A 3PX4A 1EP4A 3LM2A 1XI1A 3OVNA 4N76A 3GDQA 2HHUA 3SMSA 1XUPO 2OZMA 3NHGA 1S5JA 2XRIA 2H3GX 3ULDA 2J4RA 3HK2A 2HOEA 4HWIA 5BPNA 1QTMA 4DR1K 4I6MA 4DQQA 1JJ2M 2NNWA 4CBUA 1ZBFA 4CF1A 1DTTA 1Q7YO 5AQIA 2QM1A 3GOIA 4BRFA 3H3NO 4FLZA 4DU3A 3ZLJA 1BI4B 3QDKA 1NGIA 4IOCL 4DV7K 4GV3A 3L2UA 3FGUA 4C1NK 1IJJA 1DTQA 3AGKA 3DOLA 3THVA 1P90A 1KRPA 3R6MA 4B8CA 5KRTA 3L2RA 4Z4CA 1J9AA 1XQSC 3DI6A 3RMBA 3NGZA 1BQNA 1TUUA 1WSIA 3SPYA 2HF4A 2HW3A 4LSLA 1VQNN 1RDAA 4RTFD 4JKDA 1DLOA 4BDYA 2XY5A 2UXBK 1S1UA 3LP0A 2KHOA 3WUHA 4CJSA 2ITGA 2FC0A 2ZQBA 3CC7N 1MU2A 2CGKA 2WUSA 1X9SA 4ELUA 3KKSA 3OS1A 3VTIA 1QQCA 3F2KA 2AJQA 4JYAK 4CFCA 1L3TA 3KVGA 4A62A 4RW4A 3CD6N 1A5WA 3O3FA 4DQRA 3OA9A 2Z1JA 3IG1A 4MO5A 5AQQA 1M90O 3AY9A 1J53A 3FZMA 3L8BA 4JLHA 3AVJA 5EOYA 1Q8IA 2QWNA 2F9TA 1HYSA 1XMOK 1SL2A 4F2RA 2O8FA 1NBWA 4B9TA 1OVYA 2O8BA 3GE1A 1X3MA 3MWTA 1RBSA 4CHOA 1ZYQA 4U67L 4R79A 3SPZA 3ZYYX 4A5AA 4NYNA 1XHXA 4NLBA 4M3XA 1H1VA 4I2QA 1TV6A 1UA0A 2D0OA 2IOCA 1NLVA 1A5XA 4EFHA 2BH1A 3GBTA 5AFUH 2O8FB 2VQEK 3VOVA 2O8BB 1HRHA 4IZ9A 4ELVA 3AVFA 3K5NA 2NZTA 2ZWHA 1HPMA 2V51B 1VQON 4Z4FA 3AVIA 3CM5A 1IKYA 1NK5A 1Q81O 5AJ3K 1TVRA 4K41A 4AHUA 4DV0K 5J1EA 2E2OA 4B1WB 1Z05A 4W5RA 3CYMA 5IWAK 3THYA 4JRQA 2E1YA 5J2MA 2QEXN 4G1QA 4H8KA 4OLBA 3QINA 2FBVA 5CHIA 4PKIA 3O5BA 4CFBA 1Q82O 2YNIA 4LH4A 2BDPA 4CZIA 3DLGA 3D0PA 3O3HA 2P5OA 3N4QA 3EN9A 1EETA 1GOAA 1DT9A 2CH6A 1NGEA 3TANA 5M1OA 1SKSA 4FWQA 1SL1A 3A5LC 4CESA 3G4SN 4CGIA 1XMQK 4A2BA 3DRPA 3ZX3A 3MAQA 2WC9A 4KO0A 4CJUA 1O13A 5HBMA 1S1TA 3SAFA 4FOEA 1YVUA 4JI4K 4BREA 3H6EA 2D0BA 2PYJA 4FO0A 4BRPA 4KHYA 3TAMA 1KFSA 1SUQA 3V6DA 1TK0A 3J7YP 3ID8A 4DSFA 3CJBA 5C15A 3TARA 4RW8A 5FPMA 3QEIA 5FRMA 1RT1A 3LZIA 4DSEA 3BP8A 5A2QO 1RBTA 3BGRA 1T6DA 4O8KA 3WNGA 5KGXA 1HQUA 3FZLA 4I7FA 3TR8A 2DTUA 2Z1HA 4E7HA 2QWRA 1RTHA 5GIOA 1D5AA 4J2BA 4QOZB 4A61A 1EO1A 3AVMA 4NB4A 1S6QA 3SUNA 3LP2A 2P9UA 4CJ4A 1NGAA 3SMPA 5I42A 5CYMA 3KK3A 5AZIA 1VSFA 2IVPA 4KI6A 4DUYK 3HPOA 3F73A 1NK6A 1BGXT 4B9VA 4BY9C 4BROA 2IVNA 3VEYA 4DLGA 1FJGK 1K8AO 2Q36A 1CZBA 3G6EN 3I33A 1P8ZA 2E8AA 4M7YA 4FWMA 3MXMA 1A5VA 3I55N 3OHRA 4PWDA 4CJVA 3T3FA 3UIQA 5CE3A 2YHXA 1Z26A 2A41A 5AQOA 1RGIA 4UQGA 2O4IA 4NO7A 1IBMK 5HROA 4KRFA 2E2PA 3NVMA 4H0VB 3ZX0A 4DSJA 3VGMA 4JKFA 2QKKA 1UAXA 4KB1A 5HL7L 1IKWA 3C0BA 3OS0A 1LAWA 4PL7A 1RT3A 3DLEA 4OVLA 4DLEA 3CCSN 3HPHA 5DK5A 3THWB 3W3DA 1UWBA 1X9WA 3TAQA 3VEXA 4ZTFA 2WFBA 5C2DA 3VQEA 2O4GA 2EWSA 5HOOA 2X6SA 3SNNA 5FRNA 4YHHK 4NCAA 1IV0A 1VSIA 4Q0BA 1OH7A 3LL3A 1K6YA 4EP4A 2JWKA 1HUXA 4ILJA 4CD1A 4OLAA 3DWLA 1DGKN 4DKWA 3M8SA 3DJCA 4OKEA 4BGBA 2NRXA 3OJUA 1OVQA 4ZHRA 1YJWN 4IKFA 1T3VA 1F21A 2Q0RA 4WQ4C 4CF2A 3J7AP 3J7ZO 4AM7A 5AQUA 3OY9A 4BDPA 2X6NA 2FSNA 3A0IX 4B1XB 1KAZA 2NRZA 1N36K 1E4GT 2ASPA 1HNWK 5FDLA 3T7ZA 4K25A 3KK2A 3CJ1A 1VQMN 1IKXA 1VSHA 4JD2B 2HSTA 3FZFA 2JWLA 1YT3A 4XH1A 1JLAA 4I2PA 4O8UA 3KD5E 1J54A 2Y1JA 3HJFA 3VERA 4BC3A 3VQAA 3E9OA 5C24A 1NJYA 1L3SA 5AQXA 3DXKB 1VQ6N 1NK4A 4WQ5A 1HNZK 5JMVA 2Z1GA 1NG9A 1REVA 5BR8K 3OBWA 4A2AA 3ULEB 3AVBA 4IO9L 1BU6O 4Y0WA 1KSPA 2F9WA 1KQSM 4F3TA 2PBDA 1N32K 2YJFA 3CG7A 2VGMA 5B8HA 3CCMN 2YV0X 4IG0A 2UXDK 2F8TA 4CJ3A 3VF6A 5AQVA 5BRDA 5HRPA 4JHDB 4JEPA 5GAHP 1IBLK 1FKOA 2O8CA 2NUBA 2KQ2A 5DM6L 5TKYA 5BN8A 3KTQA 3NBPA 3VF2A 3D2EB 3A5OC 3V81A 4GVMA 3CCJN 4ID5A 4C8MA 3S41A 3ZSOA 1RFQA 1FW6A 4FJMA 3QETA 3MECA 1U04A 1EKEA 1BA1A 3OYBA 2P9LA 3JXUA 1RT2A 1OH8A 3ITHA 3L0QA 3C7NA 4E3SA 3NF7A 3IMXA 4FYDA 1VSLA 3WQUA 1LWFA 5KPRA 1EWRA 3NFAA 1HPZA 4DTXA 4C8OA 3O4WA 2O8EA 2XO7A 3KK1A 4FM1A 5EU7A 3SUOA 3NF9A 3KLGA 3EYZA 2NRTA 1SS6A 1RTIA 3K5OA 4DSIA 4QAGA 2OCEA 4BR5A 1Q86O 4BACA 2YI1A 1GLCG 3P39A 4BWJA 2VYPA 2KFNA 1T44A 1NOYA 2O8EB 1SKWA 3WXKA 5F0XA 3ZT0A 2P9PA 4FJ9A 4M42A 4KH6A 3ZT3A 2KW4A 1LCUA 2G8UA 2QXFA 4JKGB 1ILYA 2ASOA 3RRGA 4A57A 3BF1A 3TTDA 2V52B 3B6PA 3HP9A 3OJSA 1TUYA 1EX4A 2GTDA 2G8KA 1NJXA 3AA5X 4CHPA 5DMRA 4BE2A 3OYJA 3MX5A 2ZJRL 4FWLA 1WSGA 4FK2A 2IDOA 4QCLA 1HR0K 4B9MA 3V1RA 1KVBA 3TI0A 4ZTJA 1T8EA 3VQBA 2ZE2A 3I0SA 4AHRA 3IFRA 4OKJA 2ITMA 1BHLA 4JRPA 3MCAB 2P9NA 4WYBA 3M6GA 1KLNA 4LFAK 5HRSA 1E4FT 3SUPA 2A42A 3IS9A 4DS4A 3AVCA 3P1GA 4JS4A 3UKRB 3WT0A 4CJLA 4CIGA 2P9KA 2VG5A 4JKBA 5AQTA 3QERA 3PO4A 3O3GA 3TAGA 1YTUA 3C6HA 1TKTA 4K42A 4DQPA 4O5FA 4X62K 2PFUA 3DM2A 3EKUA 3MX2A 5HLFA 3H1VX 1O1WA 2FF3B 2GUIA 4FWKA 4JN4A 4CK1A 3H1QA 2V7ZA 5I3UA 4AILC 1FK9A 4B3SK 3M3ZA 2GV9A 4BRMA 2G8HA 3MEGA 5AQKA 4CEDA 3NMUA 4DV3K 3DAWA 1SAZA 1C0UA 4EZ9A 4W5QA 3HYFA 1XC3A 3PX6A 3UE5A 2G8FA 4GNIA 4CJ7A 3ZETB 4KHUA 2HVIA 3EL2A 1LW0A 4JI7K 4E7LA 4F2SA 1KTQA 2RN2A 1V4TA 1HYZA 4LF7K 4RCHA 2P9IA 1TGOA 3SBGA 3DRSA 2OA8A 3OYLA 3AA4A 4DMNA 3ENHA 1SZ2A 1QHAA 3C65A 3S9HA 3LDLA 3MMVA 5FPEA 5FPNA 1XWLA 1NOZA 1RT7A 1QZ6A 3CMAN 1NMDA 1IO2A 4M3UA 4H4OA 4E7KA 3AA2A 4JV5K 2W6KA 3WNEA 2UYTA 2RHKA 3CCEN 1NJZA 4JKHA 1RDWX 4BDZA 1HKBA 4BRNA 3ZSWA 2VG6A 1WSEA 3AAQA 3DOKA 3VN5A 4AH9A 4WFAL 4I6MB 1QQOA 1RT4A 4OPAA 3U8XA 2OPPA 3BDPA 4ELTA 1VRTA 4YOYA 2VQFK 4GKKK 5AQYA 5BREA 4CJ5A 1VQ9N 4FW2A 2VG7A 1YAGA 1JLBA 5E84A 4KAZA 1YTAA 1JL1A 4DQ8A 3TSUA 1L5UA 3CIPA 4J8FA 3MN5A 4BGAA 3CCLN 4DV4K 3DLKA 4C23A 1X9JA 1L3UA 3E01A 2CGJA 4N5SA 4FVUA 4NCBA 5AR0A 3FFKB 1YJ9N 5BPLA 2HHSA 4DTSA 3OYEA 1YXQA 5C12A 4CIFA 2NRVA 1Y97A 3QFPA 1NGFA 2FBXA 3OYIA 2ASMA 3QEXA 2VWBA 4PQUA 3FFIA 1RDUA 1LOTB 1S72N 3EEQA 4LF6K 1U4BA 3PSFA 1I94K 2IS3A 3WXIA 4CZFA 3TAEA 3WEEA 3QIOA 4CGHA 1YI2N 2O8DA 2F96A 3OYGA 1QQMA 3IUCA 4O55A 5AQZA 3SLCA 1VQKN 4DFKA 4DTUA 4MDAA 1C6VA 5AQGA 3U3YA 3U6FA 1JKHA 3AO4A 4DTOA 2GUPA 4JI0K 3R1XA 4JI5K 1S1WA 4DTNA 4DFJA 2IVOA 3AO5A 2ZGYA 3WXLA 1NGGA 4CJQA 4DV1K 2RPIA 1C0MA 4O0IA 4WFNL 1U2VA 3AV9A 5LY3A 3K0SA 1JLQA 4RG8A 3M5RA 3H45C 3ASMA 4Z4HA 3CCRN 1N5YA 5AZJA 4DUZK 2D0PA 1YF5L 3LWLA 4DTPA 1GLAG 4CHNA 3A5MC 5KTQA 3CXCM 3PO5A 2WONA 3VEOA 3NGIA 5AQJA 1T7PA 3O1WA 4WCEL 3THYB 3CCQN 1VQ8N 1JLGA 1WN7A 4OO1J 4ISEA 4DR4K 1VRUA 4XH5A 2OZSA 5GINA 4CEZA 3J80O 4IFEA 3NAEA 4YY3K 3VQQA 3ZSVA 5KPZA 5JS1A 1BIUA 3H08A 1W9HA 5CR4A 5JLFA 2A40A 2Q3SA 4IO8A 5EVZA 4PL8A 5F1XA 4IJNA 3PIOL 4V19S 4BR2A 4DTMA 3K9JA 4CI6A 1NU0A 4FK0A 3CJCA 1NK0A 4YOXA 4BR7A 4BVOA 4BRIA 2G8IA 1I39A 4FOIA 3C6UA 2DY4A 3O9SA 3LP1A 3WNFA 1FXXA 4GY2B 3TAFA 4CF9A 4PHTX 4H5TA 4QS8A 3MDQA 5I9EB 3SJHA 5KQ8A 4WQ4A 4FLWA 4B3RK 1W7AA 2W41A 4IG3A 5CYQA 5FPDA 2YNHA 3K9KA 4BQZA 2GWKA 4FZXC 3RMAA 3CERA 4B9NA 3HRGA 4CE9A 3NH1A 2RF2A 2GX9A 1GLDG 4YORA 3VQ5A 2B5JA 4OKKA 4DS5A 3IRXA 4JI2K 4HHTA 1XNQK 2P9UB 3HSTB 4OX9K 4HCCA 1C0FA 4FWOA 5AZIB 5HP1A 3OTOK 2ZD1A 1RNHA 3RR7A 3CPWM 1NJIO 1ATRA 1WNSA 3RMCA 2HMIA 5CY4A 3CPEA 3O8MA 3J81O 1QE1A 3CQYA 3LDNA 5HRRA 4OPHA 4CF8A 3L3UA 5MLCQ 4KHSA 4BRQA 1DEJA 4FLYA 3VQCA 5CZ2A 4B9SA 2DFHA 4BRDA 3C94A 1HX1A 3KWGA 5KI6A 3KJVA 3AVHA 1B9DA 2IC3A 2EX3A 4IFYA 5AQNA 1ZBIA 3LDPA 1JXEA 4EHUA 2QA4N 3WNHA 2E4LA 1SL0A 3LPTA 4H0OA 1KVAA 1C0TA 3AVKA 2E6MA 3V9SA 1R59O 1RDBA 2XY6A 3G25A 4B3OA 3PX0A 3KHYA 4FWRA 3HOTA 3VA3A 2A5XA 4HUEA 3P83D 3AO2A 3VQPA 4CERA 2BTFA 4HTUA 4Z94A 3O9TA 3ZT4A 1Q9XA 5C25A 2KKZA 3G71N 3QNNA 3KZBA 1Y64A 1TAQA 4XIUA 4BG9A 3IKMA 5AFUA 4EAHD 4E0DA 4MLHA 1J6ZA 4FPBA 4CJRA 3FLCO 4DV5K 3HSCA 1DKGD 3CF5L 4H5VA 1RBVA 2HNDA 4CHZA 3CCVN 2QWLA 3LDOA 3VENA 4UY8O 3PV8A 1ASWA 1QVFM 2HB5A 1ZC6A 5EXWA 3MEEA 3HL8A 2YNGA 3I8DA 1S3XA 3FZKA 1KD1O 5AQFA 3CC4N 4BE0A 1QSYA 4CGJA 4B8AB 5BR9A 1S6PA 3NE6A 2Q31A 4FPAA 4IWVA 1GLLO 1IG8A 1WAFA 2YCHA 1W0HA 2AA4A 4H0XB 4Y1CA 4JS5A 3HZ6A 2HHHK 4FXDA 2I5JA 2VWKA 3K57A 4B9QA 3H3OB 3WXMB 4FJKA 4FZYA 4IFVA 2V7YA 4JI1K 3LM9A 2HVHA 5J2PA 1JLFA 4MLEA 5HRNA 4CFAA 2HHQA 3TWHA 4CCHA 2P5GA 3M8RA 3R9PA 4F8RA 1BO5O 3ZEUA 1NMNA 3NGYA 3OYCA 3AARA 1UOCA 3SAHA 4H5NA 3H46O 1VK0A 4OGEA 4Z4EA 3O80A 2EHGA 4B1ZA 2BE2A 4F3OA 3SQ2A 4JAXA 4FJ8A 4DV6K 3THXA 4FJLA 2O8CB 4N47A 1EQYA 2OTLN 1TK5A 2P51A 3VQ9A 1NGHA 3QIPA 4NCGA 5AQWA 4LF9K 5C0YA 4PA1A 1HJRA 3E9LA 2Q97A 3JSMA 4H0YB 4M3RA 1MWKA 4CK3A 4E1JA 1BG3A 4I9QA 4CGFA 4L3QA 1XC9A 3THXB 3CJ7A 1S1VA 2YX6A 4CHYA 3C6TA 3DXMA 3CC2N 2P9LB 3D7EO 3M8PA 4E7JA 3SCXA 3C7NB 1CXUA 4TSXA 2ZF5O 4DU1A 3HI0A 3VETA 1VQPN 2ATQA 5SZTA 4B9LA 3ZSZA 4JKEA 4CFDA 3QMLA 3VA0A 1TKZA 3ZCMA 4A59A 3T69A 1VQ7N 4M3ZA 3E66A 4CD3A 2OANA 2E2QA 3M8QA 3MCPA 4C8KA 2CH5A 3BF3A 2FSKA 2HHWA 1S9EA 1U6ZA 1BOTO 1RTDA 2P9PB 1G15A 2RKIA 3VGKA 2B6AA 3TTFA 3WQTA 4C1NI 4BR0A 2OPQA 3CCUN 3NCIA 3VQ6A 4CBXA 4DHYA 1J5OA 2DFFA 3A5NC 4J2DA 1JCEA 4FW1A 4H03B 4YDUC 4GW6A 5LL6Z 3LAKA 1RBRA 3O4NA 1QSSA 4FSVA 3M1FA 4M45A 3HO1A 2WOMA 3ID6A 1BQMA 1HYVA 1QQNA 3VQ4A 4ILGB 3UKUA 4CZJA 1TYQA 1YIJN 4E7IA 1TKDA 4AHTA 1JLEA 2RE2A 2D4WA 1QS4A 5GAGP 4LFBK 3RSEA 4KI4A 4FM0A 4NXMK 4M3TA 5GAEP 2P9NB 1WB9A 4DFPA 4B08A 5K14A 3UKUB 3SAGA 2OTJN 4KREA 3V9XA 1VSEA 5D3GA 3V9WA 1HKCA 1T05A 3ZT2A 4FLXA 4CF0A 3Q7CA 2P9KB 4DQIA 1NKEA 3AVGA 4GMJB 4FJGA 4YOVA 4AHVA 3C6AA 4FJHA 4DV2K 1NWKA 4HCBA 2F7TA 5M1PA 4CZLA 4CZGA 1KAXA 1ATNA 4MQ3A 4HUGA 1LWCA 3RVCA 1WAJA 1NKCA 1N34K 1S9GA 1GOBA 3LDQA 2VWJA 1TL1A 2YJEA 2YKMA 3CETA 1GLEG 4LFCK 2QI2A 1WSHA 5H1SQ 3HM9A 4NLCA 1XNRK 1SV5A 1WOQA 4Z4IA 4AM6A 1CZ9A 2QWQA 3CI5A 5AQHA 3FR0A 1SKRA 3NH0A 4QS7A 4O5BA 4H5RA 1OH5A 3D2FA 2QXLA 4EZ6A 1JCFA 4BE1A 4EHTA 3L4QA 3I0RA 4FZZA 4JI3K 1BIZA 1RCHA 3QNOA 4ISFA 3HXMA 4O4GA 2P9IB 2YHAA 4HUFA 3PUFA 1IG9A 1YITN 4YOUA 1HNVA 3O4QA 5KQDA 5M1KA 4LF8K 3VQ8A 5M1FA 3OYHA 3MWPA 3O9QA 4IOXA 3KLEA 1KC8O 3TAPA 3MN7A 4E1MA 3G0ZA 2ZJPL 2E2NA 3ENOA 4IEEA 3B8AX 3VEWA 4B1UB 2KZZA 3P5JA 1BI4A 3OYNA 2HF3A 4FJIA 2G8VA 4DTRA 4AF1A 3KLHA 3DLLL 3S3OA 4MDBA 3ZX2A 3D45A 1X1PA 2HMPA 5TKWA 4PUOA 4DU4A 2UUCK 5BN9A 1HLUA 5AQLA 2BGGA 3Q7BA 2DPNA 1BCOA 4AQYK 3LWMA 4DR3K 4CIEA 4EIAA 2B4JA 1JL2A 3SI6A 1GOCA 4EP5A 4BRKA 1BUPA 3VTHA 4KBOA 3HM8A 2UU9K 3R3LA 3AO1A 2FSJA 3L3VA 4RW6A 3F5TA 2X78A 3K5LA 5GADP 4IDKA 3R8EA 4CJKA 2NRRA 3DLHA 3ATUA 1XHZA 5T7BA 1S22A 4JKAA 1NGCA 4HVJA 4FK4A 2YNFA 2E20A 4X65K 5J2NA 1QZ5A 1HKGA 2WBNA 1SQKA 3LALA 2G8WA 4QS9A 3DLRA 1WLJA 4FM2A 2HHVA 1FKPA
chains in the Genus database with same CATH topology
5BR8K 4DV1K 4B3MK 1HR0K 1IBMK 4CVNE 4JI2K 3JAMO 4JI3K 4X64K 4DR5K 1XNQK 1N32K 2UXBK 4OX9K 3OTOK 1XMQK 2ZM6K 2UUBK 2UXDK 4LFAK 1IBLK 3T1HK 5FLXO 3T1YK 4JI4K 4DUZK 2VQFK 4GKKK 3J81O 4NXNK 4JI8K 4CW7B 4LF8K 2F4VK 5LMUK 4JYAK 3J7YP 5LL6Z 2HHHK 4B3TK 4X62K 4YHHK 4LF4K 4GKJK 4DV4K 1J5EK 2UUAK 4JI1K 4DR4K 2UXCK 3J80O 4B3SK 4DR2K 4YY3K 5A2QO 5IT9O 4LFBK 4DV3K 1XMOK 4NXMK 4X66K 4LF5K 2UUCK 1N33K 3J7AP 4DV6K 4V19S 4AQYK 4LF6K 4JI7K 4LF9K 4DR6K 4DR3K 4KHPK 1I94K 1HNXK 2VQEK 4JI6K 1N36K 1IBKK 2E5LK 4LF7K 4DR1K 1HNWK 4K0KK 4DV2K 2UU9K 4DUYK 1FJGK 5AJ3K 1N34K 4DV0K 4X65K 4B3RK 4LFCK 5IWAK 4DV7K 5LMNK 4JI0K 4DR7K 1XNRK 4JI5K 4DV5K 1HNZK 4JV5K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BR8 K;  4DV1 K;  4B3M K;  1HR0 K;  1IBM K;  4CVN E;  4JI2 K;  3JAM O;  4JI3 K;  4X64 K;  4DR5 K;  1XNQ K;  1N32 K;  2UXB K;  4OX9 K;  3OTO K;  1XMQ K;  2ZM6 K;  2UUB K;  2UXD K;  4LFA K;  1IBL K;  3T1H K;  5FLX O;  3T1Y K;  4JI4 K;  4DUZ K;  2VQF K;  4GKK K;  3J81 O;  4NXN K;  4JI8 K;  4CW7 B;  4LF8 K;  2F4V K;  5LMU K;  4JYA K;  3J7Y P;  5LL6 Z;  2HHH K;  4B3T K;  4X62 K;  4YHH K;  4LF4 K;  4GKJ K;  4DV4 K;  1J5E K;  2UUA K;  4JI1 K;  4DR4 K;  2UXC K;  3J80 O;  4B3S K;  4DR2 K;  4YY3 K;  5A2Q O;  5IT9 O;  4LFB K;  4DV3 K;  1XMO K;  4NXM K;  4X66 K;  4LF5 K;  2UUC K;  1N33 K;  3J7A P;  4DV6 K;  4V19 S;  4AQY K;  4LF6 K;  4JI7 K;  4LF9 K;  4DR6 K;  4DR3 K;  4KHP K;  1I94 K;  1HNX K;  2VQE K;  4JI6 K;  1N36 K;  1IBK K;  2E5L K;  4LF7 K;  4DR1 K;  1HNW K;  4K0K K;  4DV2 K;  2UU9 K;  4DUY K;  1FJG K;  5AJ3 K;  1N34 K;  4DV0 K;  4X65 K;  4B3R K;  4LFC K;  5IWA K;  4DV7 K;  5LMN K;  4JI0 K;  4DR7 K;  1XNR K;  4JI5 K;  4DV5 K;  1HNZ K;  4JV5 K; 
#chains in the Genus database with same CATH topology
 2KTQ A;  3NF6 A;  2I7P A;  3E1Y A;  4N56 A;  3SUQ A;  1KXP A;  3K59 A;  2XY7 A;  4F9O A;  4KB0 A;  1GLJ O;  5KPT A;  2QTD A;  2KZM A;  1T03 A;  4DFM A;  3WEE B;  1MA9 B;  3VEZ A;  1D9F A;  2ZM6 K;  1WSJ A;  4FJX A;  3SYZ A;  2O8D B;  3UB5 A;  3FE1 A;  5JVG L;  3T1Y K;  3ZSX A;  4CJF A;  4O44 A;  2IAJ A;  4JK9 A;  3I8B A;  4IJA A;  4CK2 A;  4A5B A;  4BC5 A;  4CEF A;  3V9Z A;  2I7N A;  2F4V K;  1D8Y A;  4RW9 A;  2W42 A;  2HNZ A;  1ZBL A;  2D0A A;  2KFZ A;  1VHX A;  2QKB A;  4Q5V A;  2YHB A;  3BUZ B;  3TSP A;  4Y1D A;  4M63 C;  2Z1I A;  4KHW A;  4DF8 A;  3EY1 A;  1CLQ A;  3VMF B;  3HT3 A;  4FL9 A;  4LH5 A;  4DR2 K;  1BA0 A;  4PKH A;  2ZJQ L;  5C42 A;  1U2V B;  5ADX A;  2DFE A;  2P9S A;  3P38 A;  4H4M A;  3V4I A;  1RTJ A;  5JIC A;  1V4S A;  1T6C A;  4KH4 A;  4LD0 A;  1TL3 A;  3KLF A;  3CQ8 A;  4YFU A;  1N33 K;  2FLO A;  1C0G A;  4KTQ A;  2JGU A;  5AZJ B;  3SV3 A;  2P9S B;  5JVH L;  2QWM A;  2FF6 A;  1HNX K;  4LC9 B;  2E6L A;  3ENB A;  5BPM A;  1VSD A;  1NK8 A;  3SQ4 A;  1ZBS A;  3ATV A;  1WBD A;  3RR8 A;  1RDD A;  1OKJ A;  5EY4 A;  3KIO A;  2BAN A;  3ZSQ A;  4KTW A;  5C10 A;  1VQ5 N;  3KLI A;  3IAY A;  3O9U A;  3RTV A;  4Z0U A;  1K73 O;  3MN9 A;  4GV9 A;  1NGD A;  3VQD A;  4MFB A;  3L4I A;  2ZGZ A;  3MN6 A;  4E89 A;  3VPZ A;  3CJA A;  4DR7 K;  3D6R A;  1NK7 A;  1X9M A;  3L6Q A;  3ALY A;  1W97 L;  4JNE A;  1MWM A;  4FJ7 A;  2Q1N A;  5EX5 A;  4YOT A;  1ZBH A;  1KVC A;  4JK7 A;  1NGJ A;  3T1A A;  2YHW A;  3AVL A;  4KH5 A;  2WTU A;  3HVT A;  4OPJ A;  3HTV A;  4DWI A;  4B1V A;  3FZH A;  3TPQ A;  3MK6 A;  2D1K A;  1KFD A;  1HJO A;  2JLE A;  3RRH A;  4GVE A;  3ISN C;  3A8Y A;  4DCH A;  4KHN A;  4G9Z A;  2NRW A;  3IDH A;  4CW7 B;  1GLF O;  3AAP A;  1HMV A;  1LWE A;  1B9F A;  3P31 A;  3QBW A;  2NRH A;  4BR4 A;  4KV8 A;  1QHT A;  3EE8 A;  4YOW A;  4CJT A;  4R5P A;  4M3Y A;  4RWT A;  4BRC A;  1U45 A;  4WF9 L;  4LY7 A;  4GKJ K;  2QWP A;  5LJW A;  4LSN A;  2D5R A;  2UUA K;  3SQ1 A;  3LAN A;  1RT6 A;  1R0A A;  4FLT A;  4XEI A;  3K58 A;  3SZ2 A;  4FJ5 A;  5KGW A;  5M1N A;  1HNI A;  3O9R A;  4K8X A;  3BZC A;  4FVM A;  1RBU A;  4GV6 A;  4LF5 K;  3QO9 A;  3T19 A;  3L2Q A;  5DM7 L;  1Z25 A;  3QES A;  3CFP A;  3SK3 A;  3OYD A;  2YHY A;  3S3N A;  3ZT1 A;  1U48 A;  3RWU A;  4DF4 A;  3OBY A;  2QK9 A;  3OW2 M;  4DTJ A;  2VGN A;  1NGB A;  4KHP K;  5E41 A;  3G10 A;  1NK9 A;  2E5L K;  3KK7 A;  3EO3 A;  4E19 A;  3AVN A;  4CZH A;  3W0L A;  1ZBU A;  4IEI A;  5J2Q A;  4CJE A;  4CZM A;  4JKC A;  4BC2 A;  1D9D A;  4CEQ A;  1Q9Y A;  5F2R A;  3U4L A;  2XHB A;  3THW A;  4IOA L;  3QB0 A;  4B9U A;  4MO4 A;  3SBT A;  1VSM A;  2A6A A;  2HBM A;  3S3M A;  3ZSR A;  3B6O A;  4BWM A;  4YNQ A;  1K8K A;  3DLB A;  1ESV A;  1WBB A;  4B3M K;  1NM1 A;  3NDK A;  1HQE A;  1ITG A;  3SQ0 A;  3GG4 A;  3MXJ A;  4ICL A;  4CVN E;  1ZXO A;  3VES A;  3CFR A;  4DR5 K;  3DRR A;  2CGL A;  1K8K B;  1KLM A;  4BRH A;  4ISG A;  1EWQ A;  5FLX O;  2PYL A;  4M41 A;  4O0J A;  3SJJ A;  2VCP A;  3CM6 A;  3O6W A;  4FWP A;  5JS2 A;  1WSF A;  4JI8 K;  4KHQ A;  4DB3 A;  3KWI A;  1L3V A;  4HTL A;  5JLH A;  5AQR A;  2HBJ A;  3LZJ A;  2OPS A;  3I56 N;  1BCM A;  2A1S A;  4LF4 K;  2GWJ A;  5AQP A;  2A1R A;  4JD2 A;  3J8A A;  4CGG A;  4DG1 A;  2ETJ A;  2QW9 A;  3KKR A;  4M7X A;  4BQL A;  4M3W A;  4OPK A;  2PY5 A;  3N4P A;  5E26 A;  4KPY A;  3LAM A;  1S1X A;  3K2P A;  4BC4 A;  1GLB G;  4X66 K;  3DXK A;  2HNY A;  3U9Z A;  1VSK A;  4J2E A;  4CZK A;  3LP3 A;  4YDU A;  4U7B A;  4AHS A;  2Q0U A;  3EE9 A;  3QLH A;  4CEC A;  3HOS A;  3ULE A;  4IBN A;  1CZA N;  1KCF A;  4DR6 K;  5AQM A;  2QWO A;  3WXJ A;  4H5W A;  4JI6 K;  3TU5 A;  3U3G A;  1IBK K;  4J2A A;  1C1B A;  2FXU A;  4JK8 A;  4JHD A;  4ILH A;  4WE1 A;  4K8Z A;  3AGR A;  3MED A;  3K5M A;  3V1O A;  1N8R O;  1VSJ A;  1QVG M;  4BR9 A;  2OPR A;  4FJN A;  3D2E A;  1ASV A;  5BRH A;  1WUA A;  4DQS A;  1YUW A;  3LPU A;  1N6Q A;  4H0P A;  3ZEU B;  1YVN A;  4CBW A;  5LMN K;  1C1C A;  3DMJ A;  1YHQ N;  1X3N A;  4CZE A;  3OS2 A;  4BG8 A;  1K9M O;  4FLV A;  1B92 A;  1MDU B;  3OYA A;  2PAV A;  1BL3 A;  3CQX A;  4OJR A;  4BRL A;  3EZW A;  1ATS A;  3VGL A;  4XH4 A;  4FCY A;  3AO3 A;  3E9P A;  1LAV A;  4B1Y B;  2YKN A;  4FWS A;  4C8L A;  3C95 A;  2F8S A;  3JAM O;  4PKG A;  5LJV A;  4X64 K;  5SWM A;  4W5N A;  4E1N A;  4CEE A;  4W5O A;  1NJW A;  1TAU A;  1TK8 A;  2UUB K;  1Q18 A;  1EXQ A;  4FLU A;  5FRO A;  3T1H K;  1Z6R A;  3HVR A;  3AA3 A;  1UA1 A;  3QEW A;  3DXM B;  3VQ7 A;  3F9M A;  1VAZ A;  1W2B M;  1LV5 A;  3QBX A;  2FBY A;  4W5T A;  1CXQ A;  1ASU A;  2A3Z A;  5AQS A;  5BRF A;  1LW2 A;  5LMU K;  4IDH A;  5CZ1 A;  4C8N A;  4KKO A;  3MXI A;  1I3A A;  3CFO A;  1C1A A;  3BEX A;  4BVP A;  3CME N;  4JKG A;  1VQL N;  3QFU A;  2UXC K;  2HBL A;  3TSQ A;  3RMD A;  2Q2R A;  3ZSY A;  4DSL A;  3NH2 A;  3F9K A;  4OGC A;  2GBZ A;  3JYT A;  4CHQ A;  2W40 A;  4FWN A;  4RW7 A;  4CEO A;  1KAY A;  1YJN N;  3O1B A;  4KTZ A;  3LDS A;  3A2F A;  1JCG A;  2HHX A;  3O08 A;  4CJW A;  3OYF A;  4WQ5 C;  1RDC A;  2XY8 A;  1BIS A;  3CJ9 A;  4I9L A;  1U49 A;  1IKV A;  3BY5 A;  2NLX A;  5KRS A;  3PY8 A;  4K0K K;  3DYA A;  3PLA A;  1RT5 A;  1OH6 A;  2LSN A;  4BRA A;  1TKX A;  3VF4 A;  3UKR A;  3HPG A;  4NYF A;  3L2W A;  2FBT A;  1TYQ B;  4BRG A;  5M1Q A;  1RIL A;  3RSE B;  2AP1 A;  4KFB A;  2IIR A;  4L8R B;  4WFB L;  2X74 A;  5ADX H;  2P1J A;  1NKB A;  3QIC A;  2D0C A;  4CEB A;  1BDG A;  3NF8 A;  3PSI A;  1IH7 A;  3VEV A;  3V1Q A;  3EZ5 A;  3QEP A;  1U47 A;  3OYM A;  3TTC A;  3SV4 A;  3KD1 E;  2E88 A;  2BUP A;  2HBK A;  1G99 A;  4Z4G A;  4CGD A;  3QEV A;  4K43 A;  4H0T B;  1E3M A;  3ZET A;  3U9D A;  1VQ4 N;  4N41 A;  2W6L A;  4F4K A;  2OYQ A;  4NXN K;  2Y1I A;  3AVA A;  1D4X A;  1M1K O;  1JLC A;  2GEM A;  4ID1 A;  3OYK A;  3HP6 A;  1QSL A;  4FJJ A;  3BZK A;  3TAB A;  5C2F A;  4CEA A;  3P4I A;  4B3T K;  5GIP A;  1JXB A;  2R7Y A;  2PZS A;  1J5E K;  3JS6 A;  3PIP L;  1BWF O;  2GEL A;  2IGI A;  5ELZ A;  3D2F B;  2KLA A;  1NNE A;  4DSK A;  3GL1 A;  3NVK A;  3CHW A;  3V9U A;  2HHT A;  5IT9 O;  4CJP A;  4IXC A;  3HBT A;  3L2V A;  2E1Z A;  4AHC A;  3EKS A;  4PY5 A;  3PX4 A;  1EP4 A;  3LM2 A;  1XI1 A;  3OVN A;  4N76 A;  3GDQ A;  2HHU A;  3SMS A;  1XUP O;  2OZM A;  3NHG A;  1S5J A;  2XRI A;  2H3G X;  3ULD A;  2J4R A;  3HK2 A;  2HOE A;  4HWI A;  5BPN A;  1QTM A;  4DR1 K;  4I6M A;  4DQQ A;  1JJ2 M;  2NNW A;  4CBU A;  1ZBF A;  4CF1 A;  1DTT A;  1Q7Y O;  5AQI A;  2QM1 A;  3GOI A;  4BRF A;  3H3N O;  4FLZ A;  4DU3 A;  3ZLJ A;  1BI4 B;  3QDK A;  1NGI A;  4IOC L;  4DV7 K;  4GV3 A;  3L2U A;  3FGU A;  4C1N K;  1IJJ A;  1DTQ A;  3AGK A;  3DOL A;  3THV A;  1P90 A;  1KRP A;  3R6M A;  4B8C A;  5KRT A;  3L2R A;  4Z4C A;  1J9A A;  1XQS C;  3DI6 A;  3RMB A;  3NGZ A;  1BQN A;  1TUU A;  1WSI A;  3SPY A;  2HF4 A;  2HW3 A;  4LSL A;  1VQN N;  1RDA A;  4RTF D;  4JKD A;  1DLO A;  4BDY A;  2XY5 A;  2UXB K;  1S1U A;  3LP0 A;  2KHO A;  3WUH A;  4CJS A;  2ITG A;  2FC0 A;  2ZQB A;  3CC7 N;  1MU2 A;  2CGK A;  2WUS A;  1X9S A;  4ELU A;  3KKS A;  3OS1 A;  3VTI A;  1QQC A;  3F2K A;  2AJQ A;  4JYA K;  4CFC A;  1L3T A;  3KVG A;  4A62 A;  4RW4 A;  3CD6 N;  1A5W A;  3O3F A;  4DQR A;  3OA9 A;  2Z1J A;  3IG1 A;  4MO5 A;  5AQQ A;  1M90 O;  3AY9 A;  1J53 A;  3FZM A;  3L8B A;  4JLH A;  3AVJ A;  5EOY A;  1Q8I A;  2QWN A;  2F9T A;  1HYS A;  1XMO K;  1SL2 A;  4F2R A;  2O8F A;  1NBW A;  4B9T A;  1OVY A;  2O8B A;  3GE1 A;  1X3M A;  3MWT A;  1RBS A;  4CHO A;  1ZYQ A;  4U67 L;  4R79 A;  3SPZ A;  3ZYY X;  4A5A A;  4NYN A;  1XHX A;  4NLB A;  4M3X A;  1H1V A;  4I2Q A;  1TV6 A;  1UA0 A;  2D0O A;  2IOC A;  1NLV A;  1A5X A;  4EFH A;  2BH1 A;  3GBT A;  5AFU H;  2O8F B;  2VQE K;  3VOV A;  2O8B B;  1HRH A;  4IZ9 A;  4ELV A;  3AVF A;  3K5N A;  2NZT A;  2ZWH A;  1HPM A;  2V51 B;  1VQO N;  4Z4F A;  3AVI A;  3CM5 A;  1IKY A;  1NK5 A;  1Q81 O;  5AJ3 K;  1TVR A;  4K41 A;  4AHU A;  4DV0 K;  5J1E A;  2E2O A;  4B1W B;  1Z05 A;  4W5R A;  3CYM A;  5IWA K;  3THY A;  4JRQ A;  2E1Y A;  5J2M A;  2QEX N;  4G1Q A;  4H8K A;  4OLB A;  3QIN A;  2FBV A;  5CHI A;  4PKI A;  3O5B A;  4CFB A;  1Q82 O;  2YNI A;  4LH4 A;  2BDP A;  4CZI A;  3DLG A;  3D0P A;  3O3H A;  2P5O A;  3N4Q A;  3EN9 A;  1EET A;  1GOA A;  1DT9 A;  2CH6 A;  1NGE A;  3TAN A;  5M1O A;  1SKS A;  4FWQ A;  1SL1 A;  3A5L C;  4CES A;  3G4S N;  4CGI A;  1XMQ K;  4A2B A;  3DRP A;  3ZX3 A;  3MAQ A;  2WC9 A;  4KO0 A;  4CJU A;  1O13 A;  5HBM A;  1S1T A;  3SAF A;  4FOE A;  1YVU A;  4JI4 K;  4BRE A;  3H6E A;  2D0B A;  2PYJ A;  4FO0 A;  4BRP A;  4KHY A;  3TAM A;  1KFS A;  1SUQ A;  3V6D A;  1TK0 A;  3J7Y P;  3ID8 A;  4DSF A;  3CJB A;  5C15 A;  3TAR A;  4RW8 A;  5FPM A;  3QEI A;  5FRM A;  1RT1 A;  3LZI A;  4DSE A;  3BP8 A;  5A2Q O;  1RBT A;  3BGR A;  1T6D A;  4O8K A;  3WNG A;  5KGX A;  1HQU A;  3FZL A;  4I7F A;  3TR8 A;  2DTU A;  2Z1H A;  4E7H A;  2QWR A;  1RTH A;  5GIO A;  1D5A A;  4J2B A;  4QOZ B;  4A61 A;  1EO1 A;  3AVM A;  4NB4 A;  1S6Q A;  3SUN A;  3LP2 A;  2P9U A;  4CJ4 A;  1NGA A;  3SMP A;  5I42 A;  5CYM A;  3KK3 A;  5AZI A;  1VSF A;  2IVP A;  4KI6 A;  4DUY K;  3HPO A;  3F73 A;  1NK6 A;  1BGX T;  4B9V A;  4BY9 C;  4BRO A;  2IVN A;  3VEY A;  4DLG A;  1FJG K;  1K8A O;  2Q36 A;  1CZB A;  3G6E N;  3I33 A;  1P8Z A;  2E8A A;  4M7Y A;  4FWM A;  3MXM A;  1A5V A;  3I55 N;  3OHR A;  4PWD A;  4CJV A;  3T3F A;  3UIQ A;  5CE3 A;  2YHX A;  1Z26 A;  2A41 A;  5AQO A;  1RGI A;  4UQG A;  2O4I A;  4NO7 A;  1IBM K;  5HRO A;  4KRF A;  2E2P A;  3NVM A;  4H0V B;  3ZX0 A;  4DSJ A;  3VGM A;  4JKF A;  2QKK A;  1UAX A;  4KB1 A;  5HL7 L;  1IKW A;  3C0B A;  3OS0 A;  1LAW A;  4PL7 A;  1RT3 A;  3DLE A;  4OVL A;  4DLE A;  3CCS N;  3HPH A;  5DK5 A;  3THW B;  3W3D A;  1UWB A;  1X9W A;  3TAQ A;  3VEX A;  4ZTF A;  2WFB A;  5C2D A;  3VQE A;  2O4G A;  2EWS A;  5HOO A;  2X6S A;  3SNN A;  5FRN A;  4YHH K;  4NCA A;  1IV0 A;  1VSI A;  4Q0B A;  1OH7 A;  3LL3 A;  1K6Y A;  4EP4 A;  2JWK A;  1HUX A;  4ILJ A;  4CD1 A;  4OLA A;  3DWL A;  1DGK N;  4DKW A;  3M8S A;  3DJC A;  4OKE A;  4BGB A;  2NRX A;  3OJU A;  1OVQ A;  4ZHR A;  1YJW N;  4IKF A;  1T3V A;  1F21 A;  2Q0R A;  4WQ4 C;  4CF2 A;  3J7A P;  3J7Z O;  4AM7 A;  5AQU A;  3OY9 A;  4BDP A;  2X6N A;  2FSN A;  3A0I X;  4B1X B;  1KAZ A;  2NRZ A;  1N36 K;  1E4G T;  2ASP A;  1HNW K;  5FDL A;  3T7Z A;  4K25 A;  3KK2 A;  3CJ1 A;  1VQM N;  1IKX A;  1VSH A;  4JD2 B;  2HST A;  3FZF A;  2JWL A;  1YT3 A;  4XH1 A;  1JLA A;  4I2P A;  4O8U A;  3KD5 E;  1J54 A;  2Y1J A;  3HJF A;  3VER A;  4BC3 A;  3VQA A;  3E9O A;  5C24 A;  1NJY A;  1L3S A;  5AQX A;  3DXK B;  1VQ6 N;  1NK4 A;  4WQ5 A;  1HNZ K;  5JMV A;  2Z1G A;  1NG9 A;  1REV A;  5BR8 K;  3OBW A;  4A2A A;  3ULE B;  3AVB A;  4IO9 L;  1BU6 O;  4Y0W A;  1KSP A;  2F9W A;  1KQS M;  4F3T A;  2PBD A;  1N32 K;  2YJF A;  3CG7 A;  2VGM A;  5B8H A;  3CCM N;  2YV0 X;  4IG0 A;  2UXD K;  2F8T A;  4CJ3 A;  3VF6 A;  5AQV A;  5BRD A;  5HRP A;  4JHD B;  4JEP A;  5GAH P;  1IBL K;  1FKO A;  2O8C A;  2NUB A;  2KQ2 A;  5DM6 L;  5TKY A;  5BN8 A;  3KTQ A;  3NBP A;  3VF2 A;  3D2E B;  3A5O C;  3V81 A;  4GVM A;  3CCJ N;  4ID5 A;  4C8M A;  3S41 A;  3ZSO A;  1RFQ A;  1FW6 A;  4FJM A;  3QET A;  3MEC A;  1U04 A;  1EKE A;  1BA1 A;  3OYB A;  2P9L A;  3JXU A;  1RT2 A;  1OH8 A;  3ITH A;  3L0Q A;  3C7N A;  4E3S A;  3NF7 A;  3IMX A;  4FYD A;  1VSL A;  3WQU A;  1LWF A;  5KPR A;  1EWR A;  3NFA A;  1HPZ A;  4DTX A;  4C8O A;  3O4W A;  2O8E A;  2XO7 A;  3KK1 A;  4FM1 A;  5EU7 A;  3SUO A;  3NF9 A;  3KLG A;  3EYZ A;  2NRT A;  1SS6 A;  1RTI A;  3K5O A;  4DSI A;  4QAG A;  2OCE A;  4BR5 A;  1Q86 O;  4BAC A;  2YI1 A;  1GLC G;  3P39 A;  4BWJ A;  2VYP A;  2KFN A;  1T44 A;  1NOY A;  2O8E B;  1SKW A;  3WXK A;  5F0X A;  3ZT0 A;  2P9P A;  4FJ9 A;  4M42 A;  4KH6 A;  3ZT3 A;  2KW4 A;  1LCU A;  2G8U A;  2QXF A;  4JKG B;  1ILY A;  2ASO A;  3RRG A;  4A57 A;  3BF1 A;  3TTD A;  2V52 B;  3B6P A;  3HP9 A;  3OJS A;  1TUY A;  1EX4 A;  2GTD A;  2G8K A;  1NJX A;  3AA5 X;  4CHP A;  5DMR A;  4BE2 A;  3OYJ A;  3MX5 A;  2ZJR L;  4FWL A;  1WSG A;  4FK2 A;  2IDO A;  4QCL A;  1HR0 K;  4B9M A;  3V1R A;  1KVB A;  3TI0 A;  4ZTJ A;  1T8E A;  3VQB A;  2ZE2 A;  3I0S A;  4AHR A;  3IFR A;  4OKJ A;  2ITM A;  1BHL A;  4JRP A;  3MCA B;  2P9N A;  4WYB A;  3M6G A;  1KLN A;  4LFA K;  5HRS A;  1E4F T;  3SUP A;  2A42 A;  3IS9 A;  4DS4 A;  3AVC A;  3P1G A;  4JS4 A;  3UKR B;  3WT0 A;  4CJL A;  4CIG A;  2P9K A;  2VG5 A;  4JKB A;  5AQT A;  3QER A;  3PO4 A;  3O3G A;  3TAG A;  1YTU A;  3C6H A;  1TKT A;  4K42 A;  4DQP A;  4O5F A;  4X62 K;  2PFU A;  3DM2 A;  3EKU A;  3MX2 A;  5HLF A;  3H1V X;  1O1W A;  2FF3 B;  2GUI A;  4FWK A;  4JN4 A;  4CK1 A;  3H1Q A;  2V7Z A;  5I3U A;  4AIL C;  1FK9 A;  4B3S K;  3M3Z A;  2GV9 A;  4BRM A;  2G8H A;  3MEG A;  5AQK A;  4CED A;  3NMU A;  4DV3 K;  3DAW A;  1SAZ A;  1C0U A;  4EZ9 A;  4W5Q A;  3HYF A;  1XC3 A;  3PX6 A;  3UE5 A;  2G8F A;  4GNI A;  4CJ7 A;  3ZET B;  4KHU A;  2HVI A;  3EL2 A;  1LW0 A;  4JI7 K;  4E7L A;  4F2S A;  1KTQ A;  2RN2 A;  1V4T A;  1HYZ A;  4LF7 K;  4RCH A;  2P9I A;  1TGO A;  3SBG A;  3DRS A;  2OA8 A;  3OYL A;  3AA4 A;  4DMN A;  3ENH A;  1SZ2 A;  1QHA A;  3C65 A;  3S9H A;  3LDL A;  3MMV A;  5FPE A;  5FPN A;  1XWL A;  1NOZ A;  1RT7 A;  1QZ6 A;  3CMA N;  1NMD A;  1IO2 A;  4M3U A;  4H4O A;  4E7K A;  3AA2 A;  4JV5 K;  2W6K A;  3WNE A;  2UYT A;  2RHK A;  3CCE N;  1NJZ A;  4JKH A;  1RDW X;  4BDZ A;  1HKB A;  4BRN A;  3ZSW A;  2VG6 A;  1WSE A;  3AAQ A;  3DOK A;  3VN5 A;  4AH9 A;  4WFA L;  4I6M B;  1QQO A;  1RT4 A;  4OPA A;  3U8X A;  2OPP A;  3BDP A;  4ELT A;  1VRT A;  4YOY A;  2VQF K;  4GKK K;  5AQY A;  5BRE A;  4CJ5 A;  1VQ9 N;  4FW2 A;  2VG7 A;  1YAG A;  1JLB A;  5E84 A;  4KAZ A;  1YTA A;  1JL1 A;  4DQ8 A;  3TSU A;  1L5U A;  3CIP A;  4J8F A;  3MN5 A;  4BGA A;  3CCL N;  4DV4 K;  3DLK A;  4C23 A;  1X9J A;  1L3U A;  3E01 A;  2CGJ A;  4N5S A;  4FVU A;  4NCB A;  5AR0 A;  3FFK B;  1YJ9 N;  5BPL A;  2HHS A;  4DTS A;  3OYE A;  1YXQ A;  5C12 A;  4CIF A;  2NRV A;  1Y97 A;  3QFP A;  1NGF A;  2FBX A;  3OYI A;  2ASM A;  3QEX A;  2VWB A;  4PQU A;  3FFI A;  1RDU A;  1LOT B;  1S72 N;  3EEQ A;  4LF6 K;  1U4B A;  3PSF A;  1I94 K;  2IS3 A;  3WXI A;  4CZF A;  3TAE A;  3WEE A;  3QIO A;  4CGH A;  1YI2 N;  2O8D A;  2F96 A;  3OYG A;  1QQM A;  3IUC A;  4O55 A;  5AQZ A;  3SLC A;  1VQK N;  4DFK A;  4DTU A;  4MDA A;  1C6V A;  5AQG A;  3U3Y A;  3U6F A;  1JKH A;  3AO4 A;  4DTO A;  2GUP A;  4JI0 K;  3R1X A;  4JI5 K;  1S1W A;  4DTN A;  4DFJ A;  2IVO A;  3AO5 A;  2ZGY A;  3WXL A;  1NGG A;  4CJQ A;  4DV1 K;  2RPI A;  1C0M A;  4O0I A;  4WFN L;  1U2V A;  3AV9 A;  5LY3 A;  3K0S A;  1JLQ A;  4RG8 A;  3M5R A;  3H45 C;  3ASM A;  4Z4H A;  3CCR N;  1N5Y A;  5AZJ A;  4DUZ K;  2D0P A;  1YF5 L;  3LWL A;  4DTP A;  1GLA G;  4CHN A;  3A5M C;  5KTQ A;  3CXC M;  3PO5 A;  2WON A;  3VEO A;  3NGI A;  5AQJ A;  1T7P A;  3O1W A;  4WCE L;  3THY B;  3CCQ N;  1VQ8 N;  1JLG A;  1WN7 A;  4OO1 J;  4ISE A;  4DR4 K;  1VRU A;  4XH5 A;  2OZS A;  5GIN A;  4CEZ A;  3J80 O;  4IFE A;  3NAE A;  4YY3 K;  3VQQ A;  3ZSV A;  5KPZ A;  5JS1 A;  1BIU A;  3H08 A;  1W9H A;  5CR4 A;  5JLF A;  2A40 A;  2Q3S A;  4IO8 A;  5EVZ A;  4PL8 A;  5F1X A;  4IJN A;  3PIO L;  4V19 S;  4BR2 A;  4DTM A;  3K9J A;  4CI6 A;  1NU0 A;  4FK0 A;  3CJC A;  1NK0 A;  4YOX A;  4BR7 A;  4BVO A;  4BRI A;  2G8I A;  1I39 A;  4FOI A;  3C6U A;  2DY4 A;  3O9S A;  3LP1 A;  3WNF A;  1FXX A;  4GY2 B;  3TAF A;  4CF9 A;  4PHT X;  4H5T A;  4QS8 A;  3MDQ A;  5I9E B;  3SJH A;  5KQ8 A;  4WQ4 A;  4FLW A;  4B3R K;  1W7A A;  2W41 A;  4IG3 A;  5CYQ A;  5FPD A;  2YNH A;  3K9K A;  4BQZ A;  2GWK A;  4FZX C;  3RMA A;  3CER A;  4B9N A;  3HRG A;  4CE9 A;  3NH1 A;  2RF2 A;  2GX9 A;  1GLD G;  4YOR A;  3VQ5 A;  2B5J A;  4OKK A;  4DS5 A;  3IRX A;  4JI2 K;  4HHT A;  1XNQ K;  2P9U B;  3HST B;  4OX9 K;  4HCC A;  1C0F A;  4FWO A;  5AZI B;  5HP1 A;  3OTO K;  2ZD1 A;  1RNH A;  3RR7 A;  3CPW M;  1NJI O;  1ATR A;  1WNS A;  3RMC A;  2HMI A;  5CY4 A;  3CPE A;  3O8M A;  3J81 O;  1QE1 A;  3CQY A;  3LDN A;  5HRR A;  4OPH A;  4CF8 A;  3L3U A;  5MLC Q;  4KHS A;  4BRQ A;  1DEJ A;  4FLY A;  3VQC A;  5CZ2 A;  4B9S A;  2DFH A;  4BRD A;  3C94 A;  1HX1 A;  3KWG A;  5KI6 A;  3KJV A;  3AVH A;  1B9D A;  2IC3 A;  2EX3 A;  4IFY A;  5AQN A;  1ZBI A;  3LDP A;  1JXE A;  4EHU A;  2QA4 N;  3WNH A;  2E4L A;  1SL0 A;  3LPT A;  4H0O A;  1KVA A;  1C0T A;  3AVK A;  2E6M A;  3V9S A;  1R59 O;  1RDB A;  2XY6 A;  3G25 A;  4B3O A;  3PX0 A;  3KHY A;  4FWR A;  3HOT A;  3VA3 A;  2A5X A;  4HUE A;  3P83 D;  3AO2 A;  3VQP A;  4CER A;  2BTF A;  4HTU A;  4Z94 A;  3O9T A;  3ZT4 A;  1Q9X A;  5C25 A;  2KKZ A;  3G71 N;  3QNN A;  3KZB A;  1Y64 A;  1TAQ A;  4XIU A;  4BG9 A;  3IKM A;  5AFU A;  4EAH D;  4E0D A;  4MLH A;  1J6Z A;  4FPB A;  4CJR A;  3FLC O;  4DV5 K;  3HSC A;  1DKG D;  3CF5 L;  4H5V A;  1RBV A;  2HND A;  4CHZ A;  3CCV N;  2QWL A;  3LDO A;  3VEN A;  4UY8 O;  3PV8 A;  1ASW A;  1QVF M;  2HB5 A;  1ZC6 A;  5EXW A;  3MEE A;  3HL8 A;  2YNG A;  3I8D A;  1S3X A;  3FZK A;  1KD1 O;  5AQF A;  3CC4 N;  4BE0 A;  1QSY A;  4CGJ A;  4B8A B;  5BR9 A;  1S6P A;  3NE6 A;  2Q31 A;  4FPA A;  4IWV A;  1GLL O;  1IG8 A;  1WAF A;  2YCH A;  1W0H A;  2AA4 A;  4H0X B;  4Y1C A;  4JS5 A;  3HZ6 A;  2HHH K;  4FXD A;  2I5J A;  2VWK A;  3K57 A;  4B9Q A;  3H3O B;  3WXM B;  4FJK A;  4FZY A;  4IFV A;  2V7Y A;  4JI1 K;  3LM9 A;  2HVH A;  5J2P A;  1JLF A;  4MLE A;  5HRN A;  4CFA A;  2HHQ A;  3TWH A;  4CCH A;  2P5G A;  3M8R A;  3R9P A;  4F8R A;  1BO5 O;  3ZEU A;  1NMN A;  3NGY A;  3OYC A;  3AAR A;  1UOC A;  3SAH A;  4H5N A;  3H46 O;  1VK0 A;  4OGE A;  4Z4E A;  3O80 A;  2EHG A;  4B1Z A;  2BE2 A;  4F3O A;  3SQ2 A;  4JAX A;  4FJ8 A;  4DV6 K;  3THX A;  4FJL A;  2O8C B;  4N47 A;  1EQY A;  2OTL N;  1TK5 A;  2P51 A;  3VQ9 A;  1NGH A;  3QIP A;  4NCG A;  5AQW A;  4LF9 K;  5C0Y A;  4PA1 A;  1HJR A;  3E9L A;  2Q97 A;  3JSM A;  4H0Y B;  4M3R A;  1MWK A;  4CK3 A;  4E1J A;  1BG3 A;  4I9Q A;  4CGF A;  4L3Q A;  1XC9 A;  3THX B;  3CJ7 A;  1S1V A;  2YX6 A;  4CHY A;  3C6T A;  3DXM A;  3CC2 N;  2P9L B;  3D7E O;  3M8P A;  4E7J A;  3SCX A;  3C7N B;  1CXU A;  4TSX A;  2ZF5 O;  4DU1 A;  3HI0 A;  3VET A;  1VQP N;  2ATQ A;  5SZT A;  4B9L A;  3ZSZ A;  4JKE A;  4CFD A;  3QML A;  3VA0 A;  1TKZ A;  3ZCM A;  4A59 A;  3T69 A;  1VQ7 N;  4M3Z A;  3E66 A;  4CD3 A;  2OAN A;  2E2Q A;  3M8Q A;  3MCP A;  4C8K A;  2CH5 A;  3BF3 A;  2FSK A;  2HHW A;  1S9E A;  1U6Z A;  1BOT O;  1RTD A;  2P9P B;  1G15 A;  2RKI A;  3VGK A;  2B6A A;  3TTF A;  3WQT A;  4C1N I;  4BR0 A;  2OPQ A;  3CCU N;  3NCI A;  3VQ6 A;  4CBX A;  4DHY A;  1J5O A;  2DFF A;  3A5N C;  4J2D A;  1JCE A;  4FW1 A;  4H03 B;  4YDU C;  4GW6 A;  5LL6 Z;  3LAK A;  1RBR A;  3O4N A;  1QSS A;  4FSV A;  3M1F A;  4M45 A;  3HO1 A;  2WOM A;  3ID6 A;  1BQM A;  1HYV A;  1QQN A;  3VQ4 A;  4ILG B;  3UKU A;  4CZJ A;  1TYQ A;  1YIJ N;  4E7I A;  1TKD A;  4AHT A;  1JLE A;  2RE2 A;  2D4W A;  1QS4 A;  5GAG P;  4LFB K;  3RSE A;  4KI4 A;  4FM0 A;  4NXM K;  4M3T A;  5GAE P;  2P9N B;  1WB9 A;  4DFP A;  4B08 A;  5K14 A;  3UKU B;  3SAG A;  2OTJ N;  4KRE A;  3V9X A;  1VSE A;  5D3G A;  3V9W A;  1HKC A;  1T05 A;  3ZT2 A;  4FLX A;  4CF0 A;  3Q7C A;  2P9K B;  4DQI A;  1NKE A;  3AVG A;  4GMJ B;  4FJG A;  4YOV A;  4AHV A;  3C6A A;  4FJH A;  4DV2 K;  1NWK A;  4HCB A;  2F7T A;  5M1P A;  4CZL A;  4CZG A;  1KAX A;  1ATN A;  4MQ3 A;  4HUG A;  1LWC A;  3RVC A;  1WAJ A;  1NKC A;  1N34 K;  1S9G A;  1GOB A;  3LDQ A;  2VWJ A;  1TL1 A;  2YJE A;  2YKM A;  3CET A;  1GLE G;  4LFC K;  2QI2 A;  1WSH A;  5H1S Q;  3HM9 A;  4NLC A;  1XNR K;  1SV5 A;  1WOQ A;  4Z4I A;  4AM6 A;  1CZ9 A;  2QWQ A;  3CI5 A;  5AQH A;  3FR0 A;  1SKR A;  3NH0 A;  4QS7 A;  4O5B A;  4H5R A;  1OH5 A;  3D2F A;  2QXL A;  4EZ6 A;  1JCF A;  4BE1 A;  4EHT A;  3L4Q A;  3I0R A;  4FZZ A;  4JI3 K;  1BIZ A;  1RCH A;  3QNO A;  4ISF A;  3HXM A;  4O4G A;  2P9I B;  2YHA A;  4HUF A;  3PUF A;  1IG9 A;  1YIT N;  4YOU A;  1HNV A;  3O4Q A;  5KQD A;  5M1K A;  4LF8 K;  3VQ8 A;  5M1F A;  3OYH A;  3MWP A;  3O9Q A;  4IOX A;  3KLE A;  1KC8 O;  3TAP A;  3MN7 A;  4E1M A;  3G0Z A;  2ZJP L;  2E2N A;  3ENO A;  4IEE A;  3B8A X;  3VEW A;  4B1U B;  2KZZ A;  3P5J A;  1BI4 A;  3OYN A;  2HF3 A;  4FJI A;  2G8V A;  4DTR A;  4AF1 A;  3KLH A;  3DLL L;  3S3O A;  4MDB A;  3ZX2 A;  3D45 A;  1X1P A;  2HMP A;  5TKW A;  4PUO A;  4DU4 A;  2UUC K;  5BN9 A;  1HLU A;  5AQL A;  2BGG A;  3Q7B A;  2DPN A;  1BCO A;  4AQY K;  3LWM A;  4DR3 K;  4CIE A;  4EIA A;  2B4J A;  1JL2 A;  3SI6 A;  1GOC A;  4EP5 A;  4BRK A;  1BUP A;  3VTH A;  4KBO A;  3HM8 A;  2UU9 K;  3R3L A;  3AO1 A;  2FSJ A;  3L3V A;  4RW6 A;  3F5T A;  2X78 A;  3K5L A;  5GAD P;  4IDK A;  3R8E A;  4CJK A;  2NRR A;  3DLH A;  3ATU A;  1XHZ A;  5T7B A;  1S22 A;  4JKA A;  1NGC A;  4HVJ A;  4FK4 A;  2YNF A;  2E20 A;  4X65 K;  5J2N A;  1QZ5 A;  1HKG A;  2WBN A;  1SQK A;  3LAL A;  2G8W A;  4QS9 A;  3DLR A;  1WLJ A;  4FM2 A;  2HHV A;  1FKP A; 
#chains in the Genus database with same CATH homology
 5BR8 K;  4DV1 K;  4B3M K;  1HR0 K;  1IBM K;  4CVN E;  4JI2 K;  3JAM O;  4JI3 K;  4X64 K;  4DR5 K;  1XNQ K;  1N32 K;  2UXB K;  4OX9 K;  3OTO K;  1XMQ K;  2ZM6 K;  2UUB K;  2UXD K;  4LFA K;  1IBL K;  3T1H K;  5FLX O;  3T1Y K;  4JI4 K;  4DUZ K;  2VQF K;  4GKK K;  3J81 O;  4NXN K;  4JI8 K;  4CW7 B;  4LF8 K;  2F4V K;  5LMU K;  4JYA K;  3J7Y P;  5LL6 Z;  2HHH K;  4B3T K;  4X62 K;  4YHH K;  4LF4 K;  4GKJ K;  4DV4 K;  1J5E K;  2UUA K;  4JI1 K;  4DR4 K;  2UXC K;  3J80 O;  4B3S K;  4DR2 K;  4YY3 K;  5A2Q O;  5IT9 O;  4LFB K;  4DV3 K;  1XMO K;  4NXM K;  4X66 K;  4LF5 K;  2UUC K;  1N33 K;  3J7A P;  4DV6 K;  4V19 S;  4AQY K;  4LF6 K;  4JI7 K;  4LF9 K;  4DR6 K;  4DR3 K;  4KHP K;  1I94 K;  1HNX K;  2VQE K;  4JI6 K;  1N36 K;  1IBK K;  2E5L K;  4LF7 K;  4DR1 K;  1HNW K;  4K0K K;  4DV2 K;  2UU9 K;  4DUY K;  1FJG K;  5AJ3 K;  1N34 K;  4DV0 K;  4X65 K;  4B3R K;  4LFC K;  5IWA K;  4DV7 K;  5LMN K;  4JI0 K;  4DR7 K;  1XNR K;  4JI5 K;  4DV5 K;  1HNZ K;  4JV5 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...