4DV0K

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u20g
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
116
structure length
116
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
total genus 27
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4dv0K00
4V19S 4B3TK 4AQYK 1HNZK 2UXCK 1HNXK 4JI3K 4LF8K 4DR3K 4DV2K 4DR5K 1N34K 4DR1K 4DV0K 1HR0K 1N36K 1IBKK 2UXBK 4CVNE 4YHHK 3OTOK 4B3RK 4DV3K 4K0KK 1N33K 4JV5K 1FJGK 1XNQK 2VQFK 2UUAK 1IBLK 4JI5K 5A2QO 5BR8K 4JI8K 2F4VK 5LL6Z 2E5LK 3T1YK 1J5EK 2VQEK 4GKJK 1XMQK 4JI2K 4DV6K 4DV1K 4LF6K 4NXNK 4LF9K 1XNRK 4CW7B 2UU9K 4DR7K 1XMOK 4JI7K 4X65K 4DV7K 4GKKK 3J81O 3J80O 4DUZK 4YY3K 1N32K 1HNWK 2HHHK 4LF5K 2UXDK 3J7YP 4DR4K 2UUBK 4JI6K 4B3SK 2UUCK 5LMUK 3T1HK 4LFAK 1I94K 3JAMO 2ZM6K 4DV4K 4NXMK 3J7AP 5IT9O 5AJ3K 5IWAK 4B3MK 4KHPK 4DR2K 4LF4K 4JYAK 5LMNK 4X64K 4X66K 4DV5K 4OX9K 4DR6K 5FLXO 4JI4K 4JI0K 1IBMK 4DUYK 4LFCK 4JI1K 4X62K 4LFBK 4LF7K
chains in the Genus database with same CATH superfamily
4V19S 1HKBA 5AZIB 4ILHA 5LY3A 3KTQA 4BC3A 3HM8A 3ULEB 4BVOA 3K57A 3LDQA 3O08A 4FJ8A 1YUWA 3CHWA 1NJYA 4IXCA 5BN8A 2HOEA 4BG9A 3HOTA 1VQ9N 3OTOK 4B3RK 1CZ9A 1UOCA 4CJ5A 4M3WA 4DSEA 4JV5K 4K41A 3IUCA 1Q86O 5AQUA 3RMBA 4LH4A 1HX1A 3D2EB 5EOYA 4KRFA 3G0ZA 3NMUA 4N47A 1NK9A 4FZXC 3KD1E 2FBVA 3TTDA 3HSTB 1T6DA 2HVHA 4LF9K 3OJSA 4K8XA 4JKDA 3O9TA 4KPYA 2YI1A 1S3XA 3ZSXA 4DCHA 3T3FA 1YJNN 3F5TA 1TAUA 3I55N 2W41A 2WONA 1E4FT 4CEZA 3H45C 1S6PA 1WAFA 3VQ7A 2QKBA 1TKXA 1DLOA 4JI6K 1CXQA 3R1XA 3RR7A 3U3GA 4CJVA 1B92A 1S22A 3ZETB 4IOAL 3PX4A 1WLJA 4IKFA 3CJCA 4W5RA 3QFPA 3SLCA 2HSTA 4CHZA 4FVMA 4OPHA 1KAZA 4DQ8A 3AGRA 1GOCA 4CIGA 3NGIA 3TU5A 1NM1A 1JJ2M 4KHUA 4GNIA 4WQ5A 2VWJA 3LL3A 4PA1A 1S9GA 3OBYA 3CF5L 1UAXA 4BC5A 1XQSC 3MEEA 5FLXO 3SV4A 5HL7L 1RDCA 4BE2A 1JLAA 4CJPA 1RT7A 1CZAN 5K14A 2E20A 2QWLA 1LOTB 3J8AA 4DF8A 4HCCA 4JI1K 2V52B 4M63C 4DSJA 1UWBA 4LF7K 1EP4A 3RMDA 3EEQA 5M1PA 4KFBA 4B3TK 3L4QA 1SUQA 3OYKA 4FCYA 4FWLA 1FKPA 1SV5A 3QEVA 4DR3K 4BR7A 1XI1A 3HT3A 1NGBA 3GDQA 4BE1A 3G71N 1XC9A 1BGXT 3ZSVA 4KHWA 2O8CB 2P5GA 3VA3A 5F2RA 4W5NA 3QMLA 3LDNA 1NG9A 3CQ8A 4OKJA 2F96A 1VSKA 3MEGA 2E88A 4JK9A 3OYGA 4HHTA 1QQMA 3O9RA 1JCGA 1NWKA 4B9VA 3A5OC 1JLBA 3AVLA 4K42A 3MDQA 1X3NA 3BZCA 4CK1A 3OJUA 1IO2A 4JHDB 1HKGA 2OA8A 2F9WA 4BRLA 1U45A 3DJCA 3GL1A 3VQ4A 3TAGA 3AA5X 1QS4A 2OPSA 2P9UB 2GTDA 4CZFA 1MWKA 1RDWX 3CJAA 2G8VA 5FPNA 4GV6A 1JXEA 4I2QA 2VWKA 3E66A 4LF5K 4F3OA 5HRPA 4B9TA 3KK2A 2O8BA 2YJFA 2A1SA 5LMUK 3H1VX 4LFAK 3ATVA 4FLZA 4MDBA 4JKEA 1TYQB 3E9LA 4FLWA 3ZEUB 1Q7YO 3AO2A 1GLCG 5IWAK 1K9MO 5GADP 2KW4A 4M3RA 3C95A 3NF9A 3KKRA 5H1SQ 3HRGA 4OLBA 2ASPA 3B8AX 3K9KA 1X1PA 2XO7A 4FLYA 4DR6K 3ZT1A 4A5BA 4JI4K 4CHQA 4Y1CA 2O4IA 4C1NI 1VHXA 3EZ5A 1RGIA 4HUEA 4K8ZA 3C6HA 4H0PA 4CFDA 3EKSA 4WFBL 1SKSA 3SYZA 4B1ZA 3H3NO 3VQQA 3AVMA 1S1XA 1Q81O 2DTUA 1EO1A 4YOUA 4BWMA 3S3OA 4IOCL 5JVHL 2IGIA 4RTFD 2KHOA 4BWJA 1S1TA 2BGGA 4IG0A 5AFUH 2Q97A 2E1YA 4MLEA 3CPWM 4M3UA 1J53A 2P9SB 3QBXA 3ENBA 4DR5K 1ITGA 1O13A 3CIPA 4DTPA 1TL3A 3K9JA 4CBWA 2E6LA 2NNWA 3CM5A 3QDKA 4H4MA 4RW6A 4BC2A 3CM6A 3I33A 3OS0A 5EXWA 4BE0A 2UUAK 4A62A 2HB5A 2Z1HA 1D9DA 3NBPA 3U3YA 2YHWA 3ZT3A 1T7PA 3QINA 3EYZA 3G4SN 4E1NA 3AVJA 3O4QA 3CPEA 4B3OA 3IG1A 4DV1K 1Z26A 5HROA 1WBBA 3LANA 3B6PA 2X74A 3SPYA 2D1KA 3MWTA 4CJFA 4WFAL 4YOWA 2IVPA 2HHHK 2ZE2A 3R8EA 5LJVA 4DTXA 1C1CA 1QQOA 3L6QA 4HUFA 1EX4A 5I9EB 3HM9A 4CIEA 1A5VA 3R9PA 3WNHA 4OGCA 3WQTA 4FK4A 1BWFO 1DT9A 3J7AP 4ISEA 3VF4A 1RILA 1L3VA 4JKGB 4KHPK 4RW9A 4YOVA 3FFKB 5AQLA 2HNDA 2IVNA 3PSFA 1RT6A 4BR5A 2Y1JA 3C6TA 2YKNA 4LSNA 3ZYYX 4FWRA 3MMVA 3OVNA 4A5AA 5AQKA 1IKXA 5KGXA 4ICLA 1IG8A 3ENHA 4O8KA 5JMVA 4LC9B 4DTUA 1U2VB 2OZSA 4F4KA 2HBMA 4I7FA 1BIUA 4DTMA 4BDYA 1YF5L 3SBTA 1HNZK 3S9HA 4O0IA 4DSFA 3NF6A 4CK3A 1YTUA 3C65A 5FRNA 3THXB 5AQJA 3KWGA 4M45A 5C2FA 3ZSRA 3AO5A 1U48A 4RW8A 2DFFA 3JS6A 3KZBA 2OZMA 3EE8A 2UXBK 3QO9A 4RW7A 1HQEA 3MXMA 3UIQA 3OYIA 2YHXA 4FWKA 4CBXA 5JLHA 2IS3A 1EWRA 4CJQA 4LY7A 2P5OA 3O3GA 3SQ2A 2QW9A 3VOVA 2IC3A 4XH4A 5LL6Z 1H1VA 3THYA 2QEXN 1XC3A 4M3TA 5MLCQ 1OVQA 4GKJK 3GG4A 1XMQK 5HLFA 3AVHA 4IEIA 5DM6L 2YJEA 2KTQA 3SI6A 4FWOA 3ZSQA 2QI2A 2YNIA 1VSDA 2GEMA 3OYHA 2UU9K 2KZMA 4OO1J 4X65K 1NNEA 1O1WA 3QB0A 4Z4CA 2X6NA 3VEXA 2WBNA 4CE9A 1OKJA 2RHKA 5KPTA 3KHYA 3MWPA 4CBUA 1NGAA 3TSUA 4PKHA 5CYQA 2HNYA 4DKWA 2ZM6K 4FLVA 2HBKA 1TVRA 3L2VA 5TKWA 3SK3A 1KAXA 3RMCA 2O8DB 1OH5A 4Y0WA 5C24A 1QSSA 5I3UA 5BPMA 2HHSA 1YVUA 3VQBA 4QS9A 5AQWA 3SQ1A 3T19A 4H0YB 4R79A 5CZ2A 4JKHA 4KAZA 1OVYA 1RBTA 1QSLA 1HNVA 1UA0A 2G8UA 2BANA 3VN5A 2YX6A 4YOYA 4JKCA 4I9QA 3WNGA 4CF1A 2UXCK 4CEDA 3VQCA 4NLBA 3SAHA 4NO7A 1NOZA 2F8SA 4H0TB 3OYFA 2P9NA 1J9AA 3HZ6A 3SAFA 1KVAA 2HHUA 3F2KA 4BACA 3QNNA 2WOMA 2Q3SA 3AVBA 3JSMA 4FJMA 3P4IA 5E41A 1SQKA 3CJ1A 4B1VA 4CJ3A 3V9ZA 1YHQN 3BGRA 4YDUA 4YOXA 2B4JA 3CFRA 2VQFK 2PAVA 2Q36A 3OA9A 4XH5A 3MEDA 1XUPO 1HLUA 3CCEN 4Z4GA 3WXLA 4OKEA 4BRQA 3T1AA 4RWTA 2CGKA 4DS5A 3BZKA 1LW0A 3NCIA 1HYVA 5BRFA 1W97L 2RN2A 1BISA 4O5BA 2HHVA 4ZHRA 4PUOA 4EP5A 3VQDA 4IO8A 2NZTA 4CEOA 4M3ZA 3LAKA 3OY9A 3VENA 3IAYA 2VG5A 4DSIA 2O8FB 1ESVA 4BRHA 5KPZA 4BG8A 3LWLA 2P9IB 4O5FA 2A5XA 3VETA 4DWIA 4EZ6A 2A1RA 4LF4K 3EZWA 4JK8A 3K5LA 2P9KA 5AQHA 3MX2A 3WEEB 4QOZB 3N4QA 3IKMA 3D7EO 1DTTA 4N76A 2GELA 2EWSA 4AHCA 3O9SA 5KTQA 4FJ7A 3ZX3A 5E84A 5DM7L 2RPIA 3R6MA 3O3FA 1KXPA 2ZJRL 3PUFA 3DRSA 4CJEA 4LFCK 2PFUA 4H4OA 4NCGA 4BRAA 5KI6A 3QLHA 4CHNA 4FWNA 4CJSA 3C7NB 4AQYK 3OYDA 1BA0A 1JL1A 1VSLA 4FW1A 4H5RA 4DU1A 4PKGA 4ZTFA 3AA4A 1P8ZA 1VQ7N 4KTQA 2E1ZA 4OPJA 3VMFB 5M1OA 3VPZA 1VQ5N 3P5JA 3IRXA 2QWMA 3MN9A 2FC0A 3ULDA 4WFNL 1N8RO 3LDOA 4CFCA 1KVCA 4A2BA 1NGIA 4YOTA 4BQLA 2D0AA 5BR8K 1N6QA 3MN7A 3RWUA 5J1EA 3LDLA 4FJHA 3HPHA 3WUHA 3CCQN 3D2FB 1KLMA 3CJ7A 1T44A 3VQ9A 4EHUA 5C2DA 1YAGA 3L2WA 4NYFA 2KQ2A 3KJVA 1NJZA 3HO1A 3CYMA 4CW7B 4L8RB 2CGJA 1HNIA 4ZTJA 4AM7A 3SMSA 1VQNN 2NRWA 3RSEA 5AQOA 4YY3K 1WSFA 4BQZA 1WSJA 3VQ5A 1VQPN 4C8LA 3SV3A 5CZ1A 3S3MA 3CCUN 1DEJA 3L0QA 3VA0A 5EVZA 2QWNA 2P9PA 3AVGA 3M8PA 4XH1A 1Q9YA 1ZBUA 4CFAA 5IT9O 2GBZA 2YV0X 1RTIA 4GW6A 4OPAA 3LWMA 1ZBFA 2Q0UA 1BHLA 4IO9L 1SL1A 4I6MB 3THWA 1RFQA 1MWMA 1G15A 3CCLN 1E4GT 3DOKA 4CZGA 1LAWA 4CCHA 5C12A 3CXCM 1IBMK 3BEXA 3KD5E 2J4RA 2QXLA 3HP9A 1A5WA 3ENOA 4Z0UA 2P9LB 1D5AA 1KQSM 1SS6A 1TL1A 2PYJA 4Q0BA 2W42A 5AQNA 3NH1A 2JWLA 4E7KA 5C25A 2XY8A 4BRPA 3VEYA 1KTQA 5AQSA 3WXMB 3DXKA 1K6YA 2QTDA 4Y1DA 4CGHA 1C1AA 5AQIA 1Z6RA 2ZF5O 2BH1A 3KK1A 1M90O 4E19A 1YJWN 3NHGA 1N5YA 5A2QO 3CC4N 4WF9L 4DLGA 5TKYA 2JGUA 2Q31A 3ID8A 1XHXA 5J2MA 3CMAN 2VYPA 4L3QA 4DV6K 2HHQA 1Z25A 1YI2N 3AVIA 4IFVA 4BRNA 1FK9A 3HJFA 3DYAA 3E1YA 4H5VA 1HRHA 2P9NB 1LCUA 4JS4A 4CD1A 2XRIA 4WE1A 5C10A 1TAQA 4AF1A 4OPKA 5BREA 2OTJN 4CHYA 5ADXA 2CGLA 3DLGA 4F2RA 2NRZA 4AHTA 3LAMA 4DMNA 4JNEA 4DF4A 4DLEA 1X9SA 2P1JA 4LD0A 4KHNA 3F9MA 2AA4A 2ZJQL 1Q82O 1C0FA 1JLQA 1T6CA 3P83D 1BL3A 3Q7CA 2CH5A 1ZXOA 3LALA 1GLAG 1HKCA 1LWEA 3ZSZA 5HRNA 4GV3A 4O4GA 1YXQA 4PKIA 3DLEA 2IIRA 4CZLA 4JD2A 2HBLA 4H0XB 1IJJA 5HBMA 5B8HA 1RBSA 2D0CA 1IKVA 4CEEA 3EY1A 4ILJA 3V9UA 4FJNA 3K5MA 1BG3A 3O9UA 4HWIA 1BO5O 2NRHA 4C8MA 4DFKA 4K25A 1NJIO 3CC2N 3LP0A 3CMEN 1MA9B 4KTZA 1RT3A 3FR0A 4FPBA 1T3VA 3O6WA 1RCHA 3VESA 1NJXA 2IAJA 4ELTA 3BP8A 4DFMA 1NLVA 1X9JA 3MK6A 3DOLA 1ATSA 3NF7A 4JRPA 2KKZA 4PL8A 4W5QA 1NGCA 3V4IA 4MQ3A 2VG6A 3D45A 3VGMA 1EWQA 5SWMA 3H46O 1K8KB 1XWLA 3K5NA 4MDAA 4W5TA 1S72N 4NYNA 3VF6A 5J2QA 3SUOA 2GUIA 1VQ8N 4J2BA 1RDDA 4BRIA 1DKGD 1BIZA 1U47A 1TKDA 4GVMA 3OYNA 3FZKA 5AQQA 3LM2A 4MO4A 3UKRA 1RT2A 4CGFA 4ISFA 3AVCA 3TAEA 1RTDA 5AZJA 1E3MA 3DRRA 2G8FA 3P1GA 4JI7K 4DSLA 2F9TA 3CJ9A 4DSKA 4DU3A 2QWOA 3V9SA 3LM9A 3O1WA 5C0YA 2ZWHA 4NCBA 4DTSA 2UUCK 3AAQA 4F8RA 4KHSA 2AP1A 2IDOA 3LZIA 1JLFA 2YHAA 4FJIA 4FZYA 5AQPA 4JKAA 3V1QA 4Z4IA 3ZSOA 1M1KO 1VSJA 4FOIA 4CEAA 1V4TA 3SMPA 1NK7A 3VEWA 1QQNA 3MN6A 1HUXA 2QA4N 4X66K 2G8WA 5BN9A 3M5RA 1JLGA 4O0JA 4OX9K 4B1WB 4FM2A 2NLXA 3SAGA 4DTOA 4JI0K 4ILGB 4CHPA 4DTJA 5GAHP 4FL9A 1RDBA 1I39A 2B5JA 3AA3A 5BPNA 1JLCA 3LP2A 5BRHA 3KLIA 3O3HA 4IBNA 4JAXA 3A5LC 3VTIA 2R7YA 4CI6A 3TSPA 1JXBA 2A40A 4H03B 3HK2A 4KO0A 5KRSA 3P38A 3L2QA 3U8XA 2A6AA 3QEIA 2HBJA 5HRSA 4FM1A 3TABA 4BR4A 3PX0A 2YKMA 4KH6A 4YFUA 4YHHK 4CZJA 1SL0A 3QEWA 3O9QA 1B9DA 2GV9A 4CGIA 1TK0A 3IDHA 3FZFA 5AQRA 4WQ4C 2Q2RA 4CF9A 5AZIA 3ZCMA 4BR2A 3M8RA 3OW2M 1WB9A 1WNSA 1NMDA 5FPEA 3ULEA 2HHTA 3GOIA 1ZBSA 4H5TA 4B1YB 5GAGP 2OPQA 1SL2A 4QS8A 3SUQA 3VEOA 4BVPA 5HP1A 1I3AA 1NMNA 4M41A 1WN7A 2QKKA 3J80O 2O4GA 1ZBIA 4E1JA 2DPNA 1L3SA 1IG9A 5F1XA 2UUBK 3PLAA 4E3SA 2D0BA 3OYLA 2FBXA 2PY5A 1W2BM 5SZTA 4H0VB 3MAQA 4B9LA 1KVBA 5GINA 3FGUA 3NH2A 4KB0A 4KBOA 4ID5A 4FK2A 2FSKA 1LV5A 5F0XA 1RTHA 4CJTA 1FW6A 2ZGZA 1YT3A 3AO3A 4NLCA 3TR8A 5FRMA 3OYAA 2Z1JA 4XEIA 5GIOA 1GLFO 3DRPA 1FXXA 3D0PA 2FXUA 4CK2A 5C42A 4FWQA 1ZBHA 3A2FA 5JS1A 3CCRN 2YHBA 3ZETA 4N56A 3K58A 2DFHA 3SUPA 4HTLA 3HL8A 1U4BA 4IDHA 4EZ9A 2W40A 1ASUA 3SQ4A 4CEFA 4DG1A 3BF3A 4DQQA 2V51B 4DR1K 3L4IA 3VGLA 2H3GX 3GBTA 4JS5A 4N5SA 3RMAA 1NJWA 1VSIA 1GLLO 1VQON 1ZYQA 4IZ9A 1GLBG 2XY5A 3DI6A 3HYFA 4A61A 3U9DA 1N33K 1VSHA 4CESA 4BRKA 3WNFA 1NK8A 3FZMA 3HBTA 3F73A 1S6QA 2O8BB 4HVJA 4ELVA 2VG7A 1RNHA 2VGMA 4BROA 1C0TA 3SPZA 3CCMN 5JVGL 3BY5A 3CCSN 3I8DA 1X9WA 1TUUA 1NOYA 4DFJA 2KZZA 2O8CA 4C8NA 3TANA 4CZHA 4E7HA 3TPQA 2YNFA 2F8TA 5C15A 4G1QA 5E26A 4E7LA 3ZT2A 4XIUA 4I2PA 2RE2A 1RDUA 2VWBA 2UXDK 4MLHA 3U9ZA 4FWMA 3TSQA 3ITHA 5M1QA 4RG8A 1L3TA 2OTLN 3NFAA 2YCHA 4FWSA 3SBGA 3U4LA 3V6DA 4H0OA 1VAZA 2QWPA 4JHDA 1WAJA 4NXMK 1JL2A 4WQ5C 5AJ3K 1QQCA 2BE2A 2P9UA 4EHTA 3K5OA 3ZSWA 1P90A 4BREA 1T03A 3L2UA 3OYBA 4AHVA 4CJKA 3QETA 3L2RA 1IV0A 1K73O 1RTJA 2GUPA 1NBWA 4EAHD 3AO4A 3UE5A 4A2AA 3G6EN 4X62K 1TYQA 3QFUA 3ZEUA 3RRGA 4DQRA 3NE6A 3NH0A 2E6MA 3ZSYA 4CZIA 1ZC6A 2V7ZA 2FSJA 4LF8K 1GOBA 3QEXA 4DTNA 3QERA 4DQPA 2YNHA 3C6AA 2BDPA 4WQ4A 3KLFA 2OYQA 1ASWA 2IVOA 3HXMA 4M3YA 1N36K 3AARA 2CH6A 1D4XA 4CVNE 3J7ZO 1SAZA 3FLCO 3G25A 1NK0A 5J2PA 3W3DA 4NB4A 1WSIA 4EIAA 2AJQA 4CJUA 3BUZB 4B8CA 1DGKN 1KSPA 1T05A 3GE1A 1CZBA 4DFPA 4FLUA 2D0OA 2E8AA 2RKIA 5BRDA 1KD1O 4CJRA 2W6LA 1HQUA 4JI2K 1Y64A 2P9SA 4LF6K 1JKHA 1LWFA 2VCPA 3LZJA 4B9QA 3MCAB 3N4PA 3TAQA 4FJXA 3E9OA 1UA1A 4FJLA 4JEPA 1N32K 4UQGA 3TI0A 3DLKA 3CFOA 4OLAA 4CZMA 2QM1A 4KHYA 2HW3A 1BCOA 4B1UB 5KRTA 1IKYA 3O80A 5JS2A 1REVA 4TSXA 3LDSA 2HMPA 4YNQA 4DB3A 4RW4A 4HCBA 3ZX2A 1SKWA 1Q18A 2HNZA 1W9HA 3IFRA 1ASVA 1BQNA 3T69A 4WCEL 3HPOA 4KHQA 4JYAK 4FW2A 1S9EA 4KB1A 2ASOA 2V7YA 4M7XA 4CF8A 4AH9A 4DV5K 3AVFA 1MDUB 1KLNA 3SJHA 3M8SA 4CZKA 2KFNA 3KIOA 4IG3A 4DTRA 1F21A 3H3OB 4BDPA 4IFEA 3VTHA 3QEPA 5EY4A 3O4NA 1EKEA 3THYB 2ZJPL 4JKGA 1TK5A 3CD6N 2EX3A 4I9LA 3U6FA 4IEEA 4B9UA 5AQXA 3QBWA 3DLRA 1YVNA 3A0IX 4BC4A 4C1NK 4UY8O 1TKTA 4AHRA 2FLOA 4DV3K 2IOCA 3CQYA 1U2VA 4KI6A 1FJGK 2D0PA 3WT0A 1IBLK 2KLAA 2ITGA 3ASMA 4CF2A 2Q0RA 4R5PA 4FJGA 2F4VK 2Z1GA 3A8YA 3CFPA 1VQ6N 1HJRA 1WUAA 2D4WA 2ETJA 3B6OA 3THXA 2NRTA 3DXMA 1TGOA 5AQYA 3OYJA 2I7PA 3T7ZA 4O55A 1LW2A 1NKEA 2G8IA 5HOOA 3CCVN 1TV6A 4B9NA 1D8YA 2FF3B 4HTUA 1BA1A 1C0MA 3HI0A 2WTUA 2XY6A 3OS1A 4IDKA 2A42A 3DWLA 2WFBA 3RR8A 4U7BA 3J81O 2GX9A 1WSGA 4U67L 4F2SA 2E4LA 4KKOA 1ZBLA 4IJAA 2NRRA 4B3SK 3MXJA 4JLHA 4DHYA 1VQ4N 1QSYA 2HHXA 3AAPA 1VQKN 4A57A 5KGWA 4J2DA 4PWDA 3T1HK 1QVFM 3WQUA 3C6UA 3OYEA 4QS7A 4CECA 4JN4A 1S5JA 1QZ6A 5AQFA 4CZEA 1Q9XA 1X9MA 2NRXA 4BRDA 3VEZA 3K59A 3TAMA 2LSNA 2RF2A 2HF3A 2A41A 2G8KA 2HMIA 3ALYA 3CG7A 4HUGA 5BPLA 2X78A 3HP6A 3TARA 1X3MA 1YTAA 3DLLL 2EHGA 4CEBA 5M1FA 3ZLJA 5FPMA 4CIFA 1NGFA 4Z94A 1QTMA 2NRVA 2PZSA 2FSNA 3K2PA 5AFUA 5EX5A 2O8DA 3EO3A 2HVIA 4DV2K 3SQ0A 3QNOA 1T8EA 4OJRA 1KFDA 2NUBA 1C0GA 4O44A 4CJLA 3DLBA 4WYBA 4JKFA 1LWCA 1G99A 4K0KK 4W5OA 4ELUA 1XNQK 3OYCA 1ILYA 2QWQA 3V9XA 3CJBA 3M6GA 4JI8K 2B6AA 2A3ZA 3MECA 3CC7N 2QWRA 4H5WA 3EKUA 5AQMA 5T7BA 3WXIA 4KTWA 3MX5A 1GLJO 1XNRK 1NGEA 4BR0A 3A5MC 1VK0A 4DQSA 1W7AA 2JLEA 2GWJA 4E1MA 2P9KB 4BRCA 5KPRA 1VQMN 3EE9A 4YORA 5GAEP 4B8AB 1XMOK 3NVKA 3VQ8A 3ZT0A 3VQEA 1DTQA 4BDZA 4FLXA 4LH5A 5ADXH 1RBVA 4J2EA 3DMJA 1WSHA 4CD3A 2QK9A 4FLTA 3SJJA 3LP1A 1BOTO 5JICA 1I94K 1SZ2A 3RVCA 4CEQA 3HTVA 4FYDA 1CXUA 3NVMA 4GVEA 1TUYA 1XHZA 1BCMA 4X64K 5LMNK 4DS4A 5AQGA 4BRMA 1BI4A 4KH5A 4H8KA 3AVNA 2BTFA 4OKKA 1QE1A 4FJ5A 2ITMA 2O8FA 3CETA 5CYMA 3UB5A 4ID1A 4DUYK 3SNNA 1L3UA 4M42A 4M3XA 4J2AA 3UKUA 4JK7A 2P9IA 1KC8O 4OVLA 4JKBA 3MCPA 1BQMA 1IH7A 3HOSA 3D6RA 3LPUA 1OH8A 1TK8A 5GIPA 3OBWA 1R59O 1RT4A 1B9FA 5D3GA 3WEEA 4IOXA 1N34K 4DV0K 4YDUC 3M3ZA 1FKOA 4H5NA 4IFYA 3VGKA 3IS9A 4Z4FA 2XY7A 5ELZA 1EXQA 2O8EA 2F7TA 2VGNA 1BDGA 3RSEB 3IMXA 4BR9A 1Q8IA 3WNEA 2DY4A 2D5RA 3CI5A 3JXUA 2W6KA 4LSLA 5CE3A 3LPTA 3O1BA 3C7NA 3HSCA 3KWIA 3T1YK 5KQDA 4KI4A 3G10A 2BUPA 4BY9C 3A5NC 1J5EK 2P9PB 1YIJN 4NCAA 3HVTA 1RDAA 3KLEA 4CFBA 3ZX0A 3O4WA 4GV9A 4NXNK 1JCEA 4B9SA 4AILC 1HYSA 4DR7K 1JLEA 3QICA 3THWB 2XHBA 4CJWA 3DAWA 1ATNA 1D9FA 4CJ4A 4DUZK 3C0BA 3PIPL 3H1QA 3AVKA 2E2NA 3J7YP 3AA2A 4DR4K 3BDPA 3V1RA 4G9ZA 4CERA 1U04A 1BU6O 3D2FA 5M1KA 1VSFA 3P31A 3JAMO 1VSMA 2HF4A 5DMRA 3K0SA 5AQVA 1SKRA 1C6VA 2YNGA 1JCFA 4BRFA 3PO5A 2WUSA 3DM2A 1WBDA 3V1OA 1KRPA 4F3TA 3DXMB 4FJJA 4PL7A 5AR0A 3DXKB 3RRHA 1S1VA 1R0AA 1J6ZA 5FDLA 5J2NA 3MXIA 4MO5A 1U49A 3D2EA 4FPAA 1VRUA 3LDPA 3V9WA 4EP4A 3HVRA 5HRRA 4IJNA 1NGJA 4DQIA 4GMJB 2KFZA 3HPGA 1HYZA 5DK5A 3S41A 3R3LA 1V4SA 2FF6A 1OH6A 3L3VA 3TWHA 1NK4A 4FZZA 1Y97A 3TAPA 2GWKA 3ZT4A 4FOEA 1KCFA 4F9OA 1WOQA 4M7YA 4I6MA 2I7NA 4A59A 2QXFA 3PX6A 4C8OA 3L3UA 1IBKK 3OYMA 1RT1A 3KVGA 4CJ7A 4E89A 5AQTA 3ISNC 1CLQA 4AM6A 4RCHA 3RTVA 3AVAA 2P9LA 4PHTX 5AQZA 1HPMA 1LAVA 4JI5K 1YJ9N 3VEVA 4BGAA 2PYLA 3NF8A 3TTFA 1W0HA 1RBUA 3M8QA 3QIPA 3H6EA 2E5LK 2FBYA 4B9MA 2ZD1A 5JLFA 1RT5A 3KLHA 3AV9A 3BF1A 3Q7BA 1J54A 1GLDG 3L8BA 5KQ8A 2P51A 4QCLA 1EQYA 4E0DA 1K8AO 1NU0A 3W0LA 4DV7K 1QZ5A 3NGZA 4KH4A 2YHYA 4JD2B 1NK6A 5FROA 4Z4HA 3SZ2A 3PSIA 3O8MA 4AHSA 4IWVA 4Z4EA 1WSEA 2FBTA 1TKZA 3NGYA 2ZGYA 4ISGA 3I0SA 1NGGA 4C8KA 2JWKA 3KK3A 2PBDA 3CCJN 3OHRA 2OCEA 4B3MK 2ZQBA 4KREA 5EU7A 4DR2K 3E01A 4N41A 1HPZA 3AY9A 2ASMA 3AGKA 4FM0A 3FZHA 3SUNA 2X6SA 2Y1IA 1EETA 4Q5VA 1BUPA 5CR4A 3M1FA 3S3NA 3SCXA 3FE1A 1NKBA 4AHUA 4FO0A 2E2QA 2OPRA 3VQAA 3JYTA 1NK5A 3KLGA 4LFBK 1NGDA 2OANA 3KK7A 1VQLN 1HNXK 1OH7A 3WXJA 4JI3K 3VQ6A 4FJKA 3EN9A 3UKRB 5BR9A 1C1BA 1KFSA 1RBRA 1HR0K 5FPDA 2WC9A 2Q1NA 4JRQA 1S1UA 5AZJB 3PO4A 4FSVA 2G8HA 4CGGA 3CERA 3LP3A 4GY2B 4CGJA 3MN5A 1IKWA 4OGEA 2DFEA 1BI4B 1ATRA 4CF0A 4EFHA 3TTCA 1NKCA 3VF2A 1GOAA 4BRGA 4FVUA 3NAEA 3PIOL 2Z1IA 3ATUA 2VQEK 4MFBA 3UKUB 1NGHA 1VSEA 4PY5A 1Z05A 4BGBA 3NDKA 3O5BA 2ATQA 3E9PA 4FWPA 1QHTA 3I0RA 5I42A 4PQUA 3P39A 3F9KA 1J5OA 4GKKK 1K8KA 1QHAA 3ID6A 3FZLA 4CHOA 4B08A 2I5JA 4B1XB 1HNWK 3FFIA 1MU2A 2UYTA 1HMVA 3CQXA 3H08A 4E7JA 3TAFA 2O8EB 1KAYA 1QVGM 4FXDA 4DV4K 4KV8A 4O8UA 4E7IA 1VRTA 3I56N 3WXKA 3VERA 3PY8A 4FJ9A 5LJWA 3V81A 3PV8A 2E2OA 2HHWA 3KKSA 2E2PA 3I8BA 5M1NA 3C94A 4CGDA 3DLHA 5CHIA 1S1WA 4K43A 4DU4A 3QESA 5CY4A 3QIOA 1L5UA 4J8FA 3THVA 1C0UA 3AO1A 4C23A 1GLEG 4QAGA 3VQPA 1HJOA 3EL2A 1A5XA 1YITN 3OS2A 2OPPA 4FK0A 1U6ZA
chains in the Genus database with same CATH topology
4V19S 4B3TK 4AQYK 1HNZK 2UXCK 1HNXK 4JI3K 4LF8K 4DR3K 4DV2K 4DR5K 1N34K 4DR1K 4DV0K 1HR0K 1N36K 1IBKK 2UXBK 4CVNE 4YHHK 3OTOK 4B3RK 4DV3K 4K0KK 1N33K 4JV5K 1FJGK 1XNQK 2VQFK 2UUAK 1IBLK 4JI5K 5A2QO 5BR8K 4JI8K 2F4VK 5LL6Z 2E5LK 3T1YK 1J5EK 2VQEK 4GKJK 1XMQK 4JI2K 4DV6K 4DV1K 4LF6K 4NXNK 4LF9K 1XNRK 4CW7B 2UU9K 4DR7K 1XMOK 4JI7K 4X65K 4DV7K 4GKKK 3J81O 3J80O 4DUZK 4YY3K 1N32K 1HNWK 2HHHK 4LF5K 2UXDK 3J7YP 4DR4K 2UUBK 4JI6K 4B3SK 2UUCK 5LMUK 3T1HK 4LFAK 1I94K 3JAMO 2ZM6K 4DV4K 4NXMK 3J7AP 5IT9O 5AJ3K 5IWAK 4B3MK 4KHPK 4DR2K 4LF4K 4JYAK 5LMNK 4X64K 4X66K 4DV5K 4OX9K 4DR6K 5FLXO 4JI4K 4JI0K 1IBMK 4DUYK 4LFCK 4JI1K 4X62K 4LFBK 4LF7K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4V19 S;  4B3T K;  4AQY K;  1HNZ K;  2UXC K;  1HNX K;  4JI3 K;  4LF8 K;  4DR3 K;  4DV2 K;  4DR5 K;  1N34 K;  4DR1 K;  4DV0 K;  1HR0 K;  1N36 K;  1IBK K;  2UXB K;  4CVN E;  4YHH K;  3OTO K;  4B3R K;  4DV3 K;  4K0K K;  1N33 K;  4JV5 K;  1FJG K;  1XNQ K;  2VQF K;  2UUA K;  1IBL K;  4JI5 K;  5A2Q O;  5BR8 K;  4JI8 K;  2F4V K;  5LL6 Z;  2E5L K;  3T1Y K;  1J5E K;  2VQE K;  4GKJ K;  1XMQ K;  4JI2 K;  4DV6 K;  4DV1 K;  4LF6 K;  4NXN K;  4LF9 K;  1XNR K;  4CW7 B;  2UU9 K;  4DR7 K;  1XMO K;  4JI7 K;  4X65 K;  4DV7 K;  4GKK K;  3J81 O;  3J80 O;  4DUZ K;  4YY3 K;  1N32 K;  1HNW K;  2HHH K;  4LF5 K;  2UXD K;  3J7Y P;  4DR4 K;  2UUB K;  4JI6 K;  4B3S K;  2UUC K;  5LMU K;  3T1H K;  4LFA K;  1I94 K;  3JAM O;  2ZM6 K;  4DV4 K;  4NXM K;  3J7A P;  5IT9 O;  5AJ3 K;  5IWA K;  4B3M K;  4KHP K;  4DR2 K;  4LF4 K;  4JYA K;  5LMN K;  4X64 K;  4X66 K;  4DV5 K;  4OX9 K;  4DR6 K;  5FLX O;  4JI4 K;  4JI0 K;  1IBM K;  4DUY K;  4LFC K;  4JI1 K;  4X62 K;  4LFB K;  4LF7 K; 
#chains in the Genus database with same CATH topology
 4V19 S;  1HKB A;  5AZI B;  4ILH A;  5LY3 A;  3KTQ A;  4BC3 A;  3HM8 A;  3ULE B;  4BVO A;  3K57 A;  3LDQ A;  3O08 A;  4FJ8 A;  1YUW A;  3CHW A;  1NJY A;  4IXC A;  5BN8 A;  2HOE A;  4BG9 A;  3HOT A;  1VQ9 N;  3OTO K;  4B3R K;  1CZ9 A;  1UOC A;  4CJ5 A;  4M3W A;  4DSE A;  4JV5 K;  4K41 A;  3IUC A;  1Q86 O;  5AQU A;  3RMB A;  4LH4 A;  1HX1 A;  3D2E B;  5EOY A;  4KRF A;  3G0Z A;  3NMU A;  4N47 A;  1NK9 A;  4FZX C;  3KD1 E;  2FBV A;  3TTD A;  3HST B;  1T6D A;  2HVH A;  4LF9 K;  3OJS A;  4K8X A;  4JKD A;  3O9T A;  4KPY A;  2YI1 A;  1S3X A;  3ZSX A;  4DCH A;  3T3F A;  1YJN N;  3F5T A;  1TAU A;  3I55 N;  2W41 A;  2WON A;  1E4F T;  4CEZ A;  3H45 C;  1S6P A;  1WAF A;  3VQ7 A;  2QKB A;  1TKX A;  1DLO A;  4JI6 K;  1CXQ A;  3R1X A;  3RR7 A;  3U3G A;  4CJV A;  1B92 A;  1S22 A;  3ZET B;  4IOA L;  3PX4 A;  1WLJ A;  4IKF A;  3CJC A;  4W5R A;  3QFP A;  3SLC A;  2HST A;  4CHZ A;  4FVM A;  4OPH A;  1KAZ A;  4DQ8 A;  3AGR A;  1GOC A;  4CIG A;  3NGI A;  3TU5 A;  1NM1 A;  1JJ2 M;  4KHU A;  4GNI A;  4WQ5 A;  2VWJ A;  3LL3 A;  4PA1 A;  1S9G A;  3OBY A;  3CF5 L;  1UAX A;  4BC5 A;  1XQS C;  3MEE A;  5FLX O;  3SV4 A;  5HL7 L;  1RDC A;  4BE2 A;  1JLA A;  4CJP A;  1RT7 A;  1CZA N;  5K14 A;  2E20 A;  2QWL A;  1LOT B;  3J8A A;  4DF8 A;  4HCC A;  4JI1 K;  2V52 B;  4M63 C;  4DSJ A;  1UWB A;  4LF7 K;  1EP4 A;  3RMD A;  3EEQ A;  5M1P A;  4KFB A;  4B3T K;  3L4Q A;  1SUQ A;  3OYK A;  4FCY A;  4FWL A;  1FKP A;  1SV5 A;  3QEV A;  4DR3 K;  4BR7 A;  1XI1 A;  3HT3 A;  1NGB A;  3GDQ A;  4BE1 A;  3G71 N;  1XC9 A;  1BGX T;  3ZSV A;  4KHW A;  2O8C B;  2P5G A;  3VA3 A;  5F2R A;  4W5N A;  3QML A;  3LDN A;  1NG9 A;  3CQ8 A;  4OKJ A;  2F96 A;  1VSK A;  3MEG A;  2E88 A;  4JK9 A;  3OYG A;  4HHT A;  1QQM A;  3O9R A;  1JCG A;  1NWK A;  4B9V A;  3A5O C;  1JLB A;  3AVL A;  4K42 A;  3MDQ A;  1X3N A;  3BZC A;  4CK1 A;  3OJU A;  1IO2 A;  4JHD B;  1HKG A;  2OA8 A;  2F9W A;  4BRL A;  1U45 A;  3DJC A;  3GL1 A;  3VQ4 A;  3TAG A;  3AA5 X;  1QS4 A;  2OPS A;  2P9U B;  2GTD A;  4CZF A;  1MWK A;  1RDW X;  3CJA A;  2G8V A;  5FPN A;  4GV6 A;  1JXE A;  4I2Q A;  2VWK A;  3E66 A;  4LF5 K;  4F3O A;  5HRP A;  4B9T A;  3KK2 A;  2O8B A;  2YJF A;  2A1S A;  5LMU K;  3H1V X;  4LFA K;  3ATV A;  4FLZ A;  4MDB A;  4JKE A;  1TYQ B;  3E9L A;  4FLW A;  3ZEU B;  1Q7Y O;  3AO2 A;  1GLC G;  5IWA K;  1K9M O;  5GAD P;  2KW4 A;  4M3R A;  3C95 A;  3NF9 A;  3KKR A;  5H1S Q;  3HRG A;  4OLB A;  2ASP A;  3B8A X;  3K9K A;  1X1P A;  2XO7 A;  4FLY A;  4DR6 K;  3ZT1 A;  4A5B A;  4JI4 K;  4CHQ A;  4Y1C A;  2O4I A;  4C1N I;  1VHX A;  3EZ5 A;  1RGI A;  4HUE A;  4K8Z A;  3C6H A;  4H0P A;  4CFD A;  3EKS A;  4WFB L;  1SKS A;  3SYZ A;  4B1Z A;  3H3N O;  3VQQ A;  3AVM A;  1S1X A;  1Q81 O;  2DTU A;  1EO1 A;  4YOU A;  4BWM A;  3S3O A;  4IOC L;  5JVH L;  2IGI A;  4RTF D;  2KHO A;  4BWJ A;  1S1T A;  2BGG A;  4IG0 A;  5AFU H;  2Q97 A;  2E1Y A;  4MLE A;  3CPW M;  4M3U A;  1J53 A;  2P9S B;  3QBX A;  3ENB A;  4DR5 K;  1ITG A;  1O13 A;  3CIP A;  4DTP A;  1TL3 A;  3K9J A;  4CBW A;  2E6L A;  2NNW A;  3CM5 A;  3QDK A;  4H4M A;  4RW6 A;  4BC2 A;  3CM6 A;  3I33 A;  3OS0 A;  5EXW A;  4BE0 A;  2UUA K;  4A62 A;  2HB5 A;  2Z1H A;  1D9D A;  3NBP A;  3U3Y A;  2YHW A;  3ZT3 A;  1T7P A;  3QIN A;  3EYZ A;  3G4S N;  4E1N A;  3AVJ A;  3O4Q A;  3CPE A;  4B3O A;  3IG1 A;  4DV1 K;  1Z26 A;  5HRO A;  1WBB A;  3LAN A;  3B6P A;  2X74 A;  3SPY A;  2D1K A;  3MWT A;  4CJF A;  4WFA L;  4YOW A;  2IVP A;  2HHH K;  2ZE2 A;  3R8E A;  5LJV A;  4DTX A;  1C1C A;  1QQO A;  3L6Q A;  4HUF A;  1EX4 A;  5I9E B;  3HM9 A;  4CIE A;  1A5V A;  3R9P A;  3WNH A;  4OGC A;  3WQT A;  4FK4 A;  1BWF O;  1DT9 A;  3J7A P;  4ISE A;  3VF4 A;  1RIL A;  1L3V A;  4JKG B;  4KHP K;  4RW9 A;  4YOV A;  3FFK B;  5AQL A;  2HND A;  2IVN A;  3PSF A;  1RT6 A;  4BR5 A;  2Y1J A;  3C6T A;  2YKN A;  4LSN A;  3ZYY X;  4FWR A;  3MMV A;  3OVN A;  4A5A A;  5AQK A;  1IKX A;  5KGX A;  4ICL A;  1IG8 A;  3ENH A;  4O8K A;  5JMV A;  4LC9 B;  4DTU A;  1U2V B;  2OZS A;  4F4K A;  2HBM A;  4I7F A;  1BIU A;  4DTM A;  4BDY A;  1YF5 L;  3SBT A;  1HNZ K;  3S9H A;  4O0I A;  4DSF A;  3NF6 A;  4CK3 A;  1YTU A;  3C65 A;  5FRN A;  3THX B;  5AQJ A;  3KWG A;  4M45 A;  5C2F A;  3ZSR A;  3AO5 A;  1U48 A;  4RW8 A;  2DFF A;  3JS6 A;  3KZB A;  2OZM A;  3EE8 A;  2UXB K;  3QO9 A;  4RW7 A;  1HQE A;  3MXM A;  3UIQ A;  3OYI A;  2YHX A;  4FWK A;  4CBX A;  5JLH A;  2IS3 A;  1EWR A;  4CJQ A;  4LY7 A;  2P5O A;  3O3G A;  3SQ2 A;  2QW9 A;  3VOV A;  2IC3 A;  4XH4 A;  5LL6 Z;  1H1V A;  3THY A;  2QEX N;  1XC3 A;  4M3T A;  5MLC Q;  1OVQ A;  4GKJ K;  3GG4 A;  1XMQ K;  5HLF A;  3AVH A;  4IEI A;  5DM6 L;  2YJE A;  2KTQ A;  3SI6 A;  4FWO A;  3ZSQ A;  2QI2 A;  2YNI A;  1VSD A;  2GEM A;  3OYH A;  2UU9 K;  2KZM A;  4OO1 J;  4X65 K;  1NNE A;  1O1W A;  3QB0 A;  4Z4C A;  2X6N A;  3VEX A;  2WBN A;  4CE9 A;  1OKJ A;  2RHK A;  5KPT A;  3KHY A;  3MWP A;  4CBU A;  1NGA A;  3TSU A;  4PKH A;  5CYQ A;  2HNY A;  4DKW A;  2ZM6 K;  4FLV A;  2HBK A;  1TVR A;  3L2V A;  5TKW A;  3SK3 A;  1KAX A;  3RMC A;  2O8D B;  1OH5 A;  4Y0W A;  5C24 A;  1QSS A;  5I3U A;  5BPM A;  2HHS A;  1YVU A;  3VQB A;  4QS9 A;  5AQW A;  3SQ1 A;  3T19 A;  4H0Y B;  4R79 A;  5CZ2 A;  4JKH A;  4KAZ A;  1OVY A;  1RBT A;  1QSL A;  1HNV A;  1UA0 A;  2G8U A;  2BAN A;  3VN5 A;  2YX6 A;  4YOY A;  4JKC A;  4I9Q A;  3WNG A;  4CF1 A;  2UXC K;  4CED A;  3VQC A;  4NLB A;  3SAH A;  4NO7 A;  1NOZ A;  2F8S A;  4H0T B;  3OYF A;  2P9N A;  1J9A A;  3HZ6 A;  3SAF A;  1KVA A;  2HHU A;  3F2K A;  4BAC A;  3QNN A;  2WOM A;  2Q3S A;  3AVB A;  3JSM A;  4FJM A;  3P4I A;  5E41 A;  1SQK A;  3CJ1 A;  4B1V A;  4CJ3 A;  3V9Z A;  1YHQ N;  3BGR A;  4YDU A;  4YOX A;  2B4J A;  3CFR A;  2VQF K;  2PAV A;  2Q36 A;  3OA9 A;  4XH5 A;  3MED A;  1XUP O;  1HLU A;  3CCE N;  4Z4G A;  3WXL A;  4OKE A;  4BRQ A;  3T1A A;  4RWT A;  2CGK A;  4DS5 A;  3BZK A;  1LW0 A;  3NCI A;  1HYV A;  5BRF A;  1W97 L;  2RN2 A;  1BIS A;  4O5B A;  2HHV A;  4ZHR A;  4PUO A;  4EP5 A;  3VQD A;  4IO8 A;  2NZT A;  4CEO A;  4M3Z A;  3LAK A;  3OY9 A;  3VEN A;  3IAY A;  2VG5 A;  4DSI A;  2O8F B;  1ESV A;  4BRH A;  5KPZ A;  4BG8 A;  3LWL A;  2P9I B;  4O5F A;  2A5X A;  3VET A;  4DWI A;  4EZ6 A;  2A1R A;  4LF4 K;  3EZW A;  4JK8 A;  3K5L A;  2P9K A;  5AQH A;  3MX2 A;  3WEE B;  4QOZ B;  3N4Q A;  3IKM A;  3D7E O;  1DTT A;  4N76 A;  2GEL A;  2EWS A;  4AHC A;  3O9S A;  5KTQ A;  4FJ7 A;  3ZX3 A;  5E84 A;  5DM7 L;  2RPI A;  3R6M A;  3O3F A;  1KXP A;  2ZJR L;  3PUF A;  3DRS A;  4CJE A;  4LFC K;  2PFU A;  4H4O A;  4NCG A;  4BRA A;  5KI6 A;  3QLH A;  4CHN A;  4FWN A;  4CJS A;  3C7N B;  4AQY K;  3OYD A;  1BA0 A;  1JL1 A;  1VSL A;  4FW1 A;  4H5R A;  4DU1 A;  4PKG A;  4ZTF A;  3AA4 A;  1P8Z A;  1VQ7 N;  4KTQ A;  2E1Z A;  4OPJ A;  3VMF B;  5M1O A;  3VPZ A;  1VQ5 N;  3P5J A;  3IRX A;  2QWM A;  3MN9 A;  2FC0 A;  3ULD A;  4WFN L;  1N8R O;  3LDO A;  4CFC A;  1KVC A;  4A2B A;  1NGI A;  4YOT A;  4BQL A;  2D0A A;  5BR8 K;  1N6Q A;  3MN7 A;  3RWU A;  5J1E A;  3LDL A;  4FJH A;  3HPH A;  3WUH A;  3CCQ N;  3D2F B;  1KLM A;  3CJ7 A;  1T44 A;  3VQ9 A;  4EHU A;  5C2D A;  1YAG A;  3L2W A;  4NYF A;  2KQ2 A;  3KJV A;  1NJZ A;  3HO1 A;  3CYM A;  4CW7 B;  4L8R B;  2CGJ A;  1HNI A;  4ZTJ A;  4AM7 A;  3SMS A;  1VQN N;  2NRW A;  3RSE A;  5AQO A;  4YY3 K;  1WSF A;  4BQZ A;  1WSJ A;  3VQ5 A;  1VQP N;  4C8L A;  3SV3 A;  5CZ1 A;  3S3M A;  3CCU N;  1DEJ A;  3L0Q A;  3VA0 A;  5EVZ A;  2QWN A;  2P9P A;  3AVG A;  3M8P A;  4XH1 A;  1Q9Y A;  1ZBU A;  4CFA A;  5IT9 O;  2GBZ A;  2YV0 X;  1RTI A;  4GW6 A;  4OPA A;  3LWM A;  1ZBF A;  2Q0U A;  1BHL A;  4IO9 L;  1SL1 A;  4I6M B;  3THW A;  1RFQ A;  1MWM A;  1G15 A;  3CCL N;  1E4G T;  3DOK A;  4CZG A;  1LAW A;  4CCH A;  5C12 A;  3CXC M;  1IBM K;  3BEX A;  3KD5 E;  2J4R A;  2QXL A;  3HP9 A;  1A5W A;  3ENO A;  4Z0U A;  2P9L B;  1D5A A;  1KQS M;  1SS6 A;  1TL1 A;  2PYJ A;  4Q0B A;  2W42 A;  5AQN A;  3NH1 A;  2JWL A;  4E7K A;  5C25 A;  2XY8 A;  4BRP A;  3VEY A;  1KTQ A;  5AQS A;  3WXM B;  3DXK A;  1K6Y A;  2QTD A;  4Y1D A;  4CGH A;  1C1A A;  5AQI A;  1Z6R A;  2ZF5 O;  2BH1 A;  3KK1 A;  1M90 O;  4E19 A;  1YJW N;  3NHG A;  1N5Y A;  5A2Q O;  3CC4 N;  4WF9 L;  4DLG A;  5TKY A;  2JGU A;  2Q31 A;  3ID8 A;  1XHX A;  5J2M A;  3CMA N;  2VYP A;  4L3Q A;  4DV6 K;  2HHQ A;  1Z25 A;  1YI2 N;  3AVI A;  4IFV A;  4BRN A;  1FK9 A;  3HJF A;  3DYA A;  3E1Y A;  4H5V A;  1HRH A;  2P9N B;  1LCU A;  4JS4 A;  4CD1 A;  2XRI A;  4WE1 A;  5C10 A;  1TAQ A;  4AF1 A;  4OPK A;  5BRE A;  2OTJ N;  4CHY A;  5ADX A;  2CGL A;  3DLG A;  4F2R A;  2NRZ A;  4AHT A;  3LAM A;  4DMN A;  4JNE A;  4DF4 A;  4DLE A;  1X9S A;  2P1J A;  4LD0 A;  4KHN A;  3F9M A;  2AA4 A;  2ZJQ L;  1Q82 O;  1C0F A;  1JLQ A;  1T6C A;  3P83 D;  1BL3 A;  3Q7C A;  2CH5 A;  1ZXO A;  3LAL A;  1GLA G;  1HKC A;  1LWE A;  3ZSZ A;  5HRN A;  4GV3 A;  4O4G A;  1YXQ A;  4PKI A;  3DLE A;  2IIR A;  4CZL A;  4JD2 A;  2HBL A;  4H0X B;  1IJJ A;  5HBM A;  5B8H A;  1RBS A;  2D0C A;  1IKV A;  4CEE A;  3EY1 A;  4ILJ A;  3V9U A;  4FJN A;  3K5M A;  1BG3 A;  3O9U A;  4HWI A;  1BO5 O;  2NRH A;  4C8M A;  4DFK A;  4K25 A;  1NJI O;  3CC2 N;  3LP0 A;  3CME N;  1MA9 B;  4KTZ A;  1RT3 A;  3FR0 A;  4FPB A;  1T3V A;  3O6W A;  1RCH A;  3VES A;  1NJX A;  2IAJ A;  4ELT A;  3BP8 A;  4DFM A;  1NLV A;  1X9J A;  3MK6 A;  3DOL A;  1ATS A;  3NF7 A;  4JRP A;  2KKZ A;  4PL8 A;  4W5Q A;  1NGC A;  3V4I A;  4MQ3 A;  2VG6 A;  3D45 A;  3VGM A;  1EWQ A;  5SWM A;  3H46 O;  1K8K B;  1XWL A;  3K5N A;  4MDA A;  4W5T A;  1S72 N;  4NYN A;  3VF6 A;  5J2Q A;  3SUO A;  2GUI A;  1VQ8 N;  4J2B A;  1RDD A;  4BRI A;  1DKG D;  1BIZ A;  1U47 A;  1TKD A;  4GVM A;  3OYN A;  3FZK A;  5AQQ A;  3LM2 A;  4MO4 A;  3UKR A;  1RT2 A;  4CGF A;  4ISF A;  3AVC A;  3TAE A;  1RTD A;  5AZJ A;  1E3M A;  3DRR A;  2G8F A;  3P1G A;  4JI7 K;  4DSL A;  2F9T A;  3CJ9 A;  4DSK A;  4DU3 A;  2QWO A;  3V9S A;  3LM9 A;  3O1W A;  5C0Y A;  2ZWH A;  4NCB A;  4DTS A;  2UUC K;  3AAQ A;  4F8R A;  4KHS A;  2AP1 A;  2IDO A;  3LZI A;  1JLF A;  2YHA A;  4FJI A;  4FZY A;  5AQP A;  4JKA A;  3V1Q A;  4Z4I A;  3ZSO A;  1M1K O;  1VSJ A;  4FOI A;  4CEA A;  1V4T A;  3SMP A;  1NK7 A;  3VEW A;  1QQN A;  3MN6 A;  1HUX A;  2QA4 N;  4X66 K;  2G8W A;  5BN9 A;  3M5R A;  1JLG A;  4O0J A;  4OX9 K;  4B1W B;  4FM2 A;  2NLX A;  3SAG A;  4DTO A;  4JI0 K;  4ILG B;  4CHP A;  4DTJ A;  5GAH P;  4FL9 A;  1RDB A;  1I39 A;  2B5J A;  3AA3 A;  5BPN A;  1JLC A;  3LP2 A;  5BRH A;  3KLI A;  3O3H A;  4IBN A;  4JAX A;  3A5L C;  3VTI A;  2R7Y A;  4CI6 A;  3TSP A;  1JXB A;  2A40 A;  4H03 B;  3HK2 A;  4KO0 A;  5KRS A;  3P38 A;  3L2Q A;  3U8X A;  2A6A A;  3QEI A;  2HBJ A;  5HRS A;  4FM1 A;  3TAB A;  4BR4 A;  3PX0 A;  2YKM A;  4KH6 A;  4YFU A;  4YHH K;  4CZJ A;  1SL0 A;  3QEW A;  3O9Q A;  1B9D A;  2GV9 A;  4CGI A;  1TK0 A;  3IDH A;  3FZF A;  5AQR A;  4WQ4 C;  2Q2R A;  4CF9 A;  5AZI A;  3ZCM A;  4BR2 A;  3M8R A;  3OW2 M;  1WB9 A;  1WNS A;  1NMD A;  5FPE A;  3ULE A;  2HHT A;  3GOI A;  1ZBS A;  4H5T A;  4B1Y B;  5GAG P;  2OPQ A;  1SL2 A;  4QS8 A;  3SUQ A;  3VEO A;  4BVP A;  5HP1 A;  1I3A A;  1NMN A;  4M41 A;  1WN7 A;  2QKK A;  3J80 O;  2O4G A;  1ZBI A;  4E1J A;  2DPN A;  1L3S A;  1IG9 A;  5F1X A;  2UUB K;  3PLA A;  4E3S A;  2D0B A;  3OYL A;  2FBX A;  2PY5 A;  1W2B M;  5SZT A;  4H0V B;  3MAQ A;  4B9L A;  1KVB A;  5GIN A;  3FGU A;  3NH2 A;  4KB0 A;  4KBO A;  4ID5 A;  4FK2 A;  2FSK A;  1LV5 A;  5F0X A;  1RTH A;  4CJT A;  1FW6 A;  2ZGZ A;  1YT3 A;  3AO3 A;  4NLC A;  3TR8 A;  5FRM A;  3OYA A;  2Z1J A;  4XEI A;  5GIO A;  1GLF O;  3DRP A;  1FXX A;  3D0P A;  2FXU A;  4CK2 A;  5C42 A;  4FWQ A;  1ZBH A;  3A2F A;  5JS1 A;  3CCR N;  2YHB A;  3ZET A;  4N56 A;  3K58 A;  2DFH A;  3SUP A;  4HTL A;  3HL8 A;  1U4B A;  4IDH A;  4EZ9 A;  2W40 A;  1ASU A;  3SQ4 A;  4CEF A;  4DG1 A;  3BF3 A;  4DQQ A;  2V51 B;  4DR1 K;  3L4I A;  3VGL A;  2H3G X;  3GBT A;  4JS5 A;  4N5S A;  3RMA A;  1NJW A;  1VSI A;  1GLL O;  1VQO N;  1ZYQ A;  4IZ9 A;  1GLB G;  2XY5 A;  3DI6 A;  3HYF A;  4A61 A;  3U9D A;  1N33 K;  1VSH A;  4CES A;  4BRK A;  3WNF A;  1NK8 A;  3FZM A;  3HBT A;  3F73 A;  1S6Q A;  2O8B B;  4HVJ A;  4ELV A;  2VG7 A;  1RNH A;  2VGM A;  4BRO A;  1C0T A;  3SPZ A;  3CCM N;  5JVG L;  3BY5 A;  3CCS N;  3I8D A;  1X9W A;  1TUU A;  1NOY A;  4DFJ A;  2KZZ A;  2O8C A;  4C8N A;  3TAN A;  4CZH A;  4E7H A;  3TPQ A;  2YNF A;  2F8T A;  5C15 A;  4G1Q A;  5E26 A;  4E7L A;  3ZT2 A;  4XIU A;  4I2P A;  2RE2 A;  1RDU A;  2VWB A;  2UXD K;  4MLH A;  3U9Z A;  4FWM A;  3TSQ A;  3ITH A;  5M1Q A;  4RG8 A;  1L3T A;  2OTL N;  3NFA A;  2YCH A;  4FWS A;  3SBG A;  3U4L A;  3V6D A;  4H0O A;  1VAZ A;  2QWP A;  4JHD A;  1WAJ A;  4NXM K;  1JL2 A;  4WQ5 C;  5AJ3 K;  1QQC A;  2BE2 A;  2P9U A;  4EHT A;  3K5O A;  3ZSW A;  1P90 A;  4BRE A;  1T03 A;  3L2U A;  3OYB A;  4AHV A;  4CJK A;  3QET A;  3L2R A;  1IV0 A;  1K73 O;  1RTJ A;  2GUP A;  1NBW A;  4EAH D;  3AO4 A;  3UE5 A;  4A2A A;  3G6E N;  4X62 K;  1TYQ A;  3QFU A;  3ZEU A;  3RRG A;  4DQR A;  3NE6 A;  3NH0 A;  2E6M A;  3ZSY A;  4CZI A;  1ZC6 A;  2V7Z A;  2FSJ A;  4LF8 K;  1GOB A;  3QEX A;  4DTN A;  3QER A;  4DQP A;  2YNH A;  3C6A A;  2BDP A;  4WQ4 A;  3KLF A;  2OYQ A;  1ASW A;  2IVO A;  3HXM A;  4M3Y A;  1N36 K;  3AAR A;  2CH6 A;  1D4X A;  4CVN E;  3J7Z O;  1SAZ A;  3FLC O;  3G25 A;  1NK0 A;  5J2P A;  3W3D A;  4NB4 A;  1WSI A;  4EIA A;  2AJQ A;  4CJU A;  3BUZ B;  4B8C A;  1DGK N;  1KSP A;  1T05 A;  3GE1 A;  1CZB A;  4DFP A;  4FLU A;  2D0O A;  2E8A A;  2RKI A;  5BRD A;  1KD1 O;  4CJR A;  2W6L A;  1HQU A;  4JI2 K;  1Y64 A;  2P9S A;  4LF6 K;  1JKH A;  1LWF A;  2VCP A;  3LZJ A;  4B9Q A;  3MCA B;  3N4P A;  3TAQ A;  4FJX A;  3E9O A;  1UA1 A;  4FJL A;  4JEP A;  1N32 K;  4UQG A;  3TI0 A;  3DLK A;  3CFO A;  4OLA A;  4CZM A;  2QM1 A;  4KHY A;  2HW3 A;  1BCO A;  4B1U B;  5KRT A;  1IKY A;  3O80 A;  5JS2 A;  1REV A;  4TSX A;  3LDS A;  2HMP A;  4YNQ A;  4DB3 A;  4RW4 A;  4HCB A;  3ZX2 A;  1SKW A;  1Q18 A;  2HNZ A;  1W9H A;  3IFR A;  1ASV A;  1BQN A;  3T69 A;  4WCE L;  3HPO A;  4KHQ A;  4JYA K;  4FW2 A;  1S9E A;  4KB1 A;  2ASO A;  2V7Y A;  4M7X A;  4CF8 A;  4AH9 A;  4DV5 K;  3AVF A;  1MDU B;  1KLN A;  3SJH A;  3M8S A;  4CZK A;  2KFN A;  3KIO A;  4IG3 A;  4DTR A;  1F21 A;  3H3O B;  4BDP A;  4IFE A;  3VTH A;  3QEP A;  5EY4 A;  3O4N A;  1EKE A;  3THY B;  2ZJP L;  4JKG A;  1TK5 A;  3CD6 N;  2EX3 A;  4I9L A;  3U6F A;  4IEE A;  4B9U A;  5AQX A;  3QBW A;  3DLR A;  1YVN A;  3A0I X;  4BC4 A;  4C1N K;  4UY8 O;  1TKT A;  4AHR A;  2FLO A;  4DV3 K;  2IOC A;  3CQY A;  1U2V A;  4KI6 A;  1FJG K;  2D0P A;  3WT0 A;  1IBL K;  2KLA A;  2ITG A;  3ASM A;  4CF2 A;  2Q0R A;  4R5P A;  4FJG A;  2F4V K;  2Z1G A;  3A8Y A;  3CFP A;  1VQ6 N;  1HJR A;  1WUA A;  2D4W A;  2ETJ A;  3B6O A;  3THX A;  2NRT A;  3DXM A;  1TGO A;  5AQY A;  3OYJ A;  2I7P A;  3T7Z A;  4O55 A;  1LW2 A;  1NKE A;  2G8I A;  5HOO A;  3CCV N;  1TV6 A;  4B9N A;  1D8Y A;  2FF3 B;  4HTU A;  1BA1 A;  1C0M A;  3HI0 A;  2WTU A;  2XY6 A;  3OS1 A;  4IDK A;  2A42 A;  3DWL A;  2WFB A;  3RR8 A;  4U7B A;  3J81 O;  2GX9 A;  1WSG A;  4U67 L;  4F2S A;  2E4L A;  4KKO A;  1ZBL A;  4IJA A;  2NRR A;  4B3S K;  3MXJ A;  4JLH A;  4DHY A;  1VQ4 N;  1QSY A;  2HHX A;  3AAP A;  1VQK N;  4A57 A;  5KGW A;  4J2D A;  4PWD A;  3T1H K;  1QVF M;  3WQU A;  3C6U A;  3OYE A;  4QS7 A;  4CEC A;  4JN4 A;  1S5J A;  1QZ6 A;  5AQF A;  4CZE A;  1Q9X A;  1X9M A;  2NRX A;  4BRD A;  3VEZ A;  3K59 A;  3TAM A;  2LSN A;  2RF2 A;  2HF3 A;  2A41 A;  2G8K A;  2HMI A;  3ALY A;  3CG7 A;  4HUG A;  5BPL A;  2X78 A;  3HP6 A;  3TAR A;  1X3M A;  1YTA A;  3DLL L;  2EHG A;  4CEB A;  5M1F A;  3ZLJ A;  5FPM A;  4CIF A;  1NGF A;  4Z94 A;  1QTM A;  2NRV A;  2PZS A;  2FSN A;  3K2P A;  5AFU A;  5EX5 A;  2O8D A;  3EO3 A;  2HVI A;  4DV2 K;  3SQ0 A;  3QNO A;  1T8E A;  4OJR A;  1KFD A;  2NUB A;  1C0G A;  4O44 A;  4CJL A;  3DLB A;  4WYB A;  4JKF A;  1LWC A;  1G99 A;  4K0K K;  4W5O A;  4ELU A;  1XNQ K;  3OYC A;  1ILY A;  2QWQ A;  3V9X A;  3CJB A;  3M6G A;  4JI8 K;  2B6A A;  2A3Z A;  3MEC A;  3CC7 N;  2QWR A;  4H5W A;  3EKU A;  5AQM A;  5T7B A;  3WXI A;  4KTW A;  3MX5 A;  1GLJ O;  1XNR K;  1NGE A;  4BR0 A;  3A5M C;  1VK0 A;  4DQS A;  1W7A A;  2JLE A;  2GWJ A;  4E1M A;  2P9K B;  4BRC A;  5KPR A;  1VQM N;  3EE9 A;  4YOR A;  5GAE P;  4B8A B;  1XMO K;  3NVK A;  3VQ8 A;  3ZT0 A;  3VQE A;  1DTQ A;  4BDZ A;  4FLX A;  4LH5 A;  5ADX H;  1RBV A;  4J2E A;  3DMJ A;  1WSH A;  4CD3 A;  2QK9 A;  4FLT A;  3SJJ A;  3LP1 A;  1BOT O;  5JIC A;  1I94 K;  1SZ2 A;  3RVC A;  4CEQ A;  3HTV A;  4FYD A;  1CXU A;  3NVM A;  4GVE A;  1TUY A;  1XHZ A;  1BCM A;  4X64 K;  5LMN K;  4DS4 A;  5AQG A;  4BRM A;  1BI4 A;  4KH5 A;  4H8K A;  3AVN A;  2BTF A;  4OKK A;  1QE1 A;  4FJ5 A;  2ITM A;  2O8F A;  3CET A;  5CYM A;  3UB5 A;  4ID1 A;  4DUY K;  3SNN A;  1L3U A;  4M42 A;  4M3X A;  4J2A A;  3UKU A;  4JK7 A;  2P9I A;  1KC8 O;  4OVL A;  4JKB A;  3MCP A;  1BQM A;  1IH7 A;  3HOS A;  3D6R A;  3LPU A;  1OH8 A;  1TK8 A;  5GIP A;  3OBW A;  1R59 O;  1RT4 A;  1B9F A;  5D3G A;  3WEE A;  4IOX A;  1N34 K;  4DV0 K;  4YDU C;  3M3Z A;  1FKO A;  4H5N A;  4IFY A;  3VGK A;  3IS9 A;  4Z4F A;  2XY7 A;  5ELZ A;  1EXQ A;  2O8E A;  2F7T A;  2VGN A;  1BDG A;  3RSE B;  3IMX A;  4BR9 A;  1Q8I A;  3WNE A;  2DY4 A;  2D5R A;  3CI5 A;  3JXU A;  2W6K A;  4LSL A;  5CE3 A;  3LPT A;  3O1B A;  3C7N A;  3HSC A;  3KWI A;  3T1Y K;  5KQD A;  4KI4 A;  3G10 A;  2BUP A;  4BY9 C;  3A5N C;  1J5E K;  2P9P B;  1YIJ N;  4NCA A;  3HVT A;  1RDA A;  3KLE A;  4CFB A;  3ZX0 A;  3O4W A;  4GV9 A;  4NXN K;  1JCE A;  4B9S A;  4AIL C;  1HYS A;  4DR7 K;  1JLE A;  3QIC A;  3THW B;  2XHB A;  4CJW A;  3DAW A;  1ATN A;  1D9F A;  4CJ4 A;  4DUZ K;  3C0B A;  3PIP L;  3H1Q A;  3AVK A;  2E2N A;  3J7Y P;  3AA2 A;  4DR4 K;  3BDP A;  3V1R A;  4G9Z A;  4CER A;  1U04 A;  1BU6 O;  3D2F A;  5M1K A;  1VSF A;  3P31 A;  3JAM O;  1VSM A;  2HF4 A;  5DMR A;  3K0S A;  5AQV A;  1SKR A;  1C6V A;  2YNG A;  1JCF A;  4BRF A;  3PO5 A;  2WUS A;  3DM2 A;  1WBD A;  3V1O A;  1KRP A;  4F3T A;  3DXM B;  4FJJ A;  4PL7 A;  5AR0 A;  3DXK B;  3RRH A;  1S1V A;  1R0A A;  1J6Z A;  5FDL A;  5J2N A;  3MXI A;  4MO5 A;  1U49 A;  3D2E A;  4FPA A;  1VRU A;  3LDP A;  3V9W A;  4EP4 A;  3HVR A;  5HRR A;  4IJN A;  1NGJ A;  4DQI A;  4GMJ B;  2KFZ A;  3HPG A;  1HYZ A;  5DK5 A;  3S41 A;  3R3L A;  1V4S A;  2FF6 A;  1OH6 A;  3L3V A;  3TWH A;  1NK4 A;  4FZZ A;  1Y97 A;  3TAP A;  2GWK A;  3ZT4 A;  4FOE A;  1KCF A;  4F9O A;  1WOQ A;  4M7Y A;  4I6M A;  2I7N A;  4A59 A;  2QXF A;  3PX6 A;  4C8O A;  3L3U A;  1IBK K;  3OYM A;  1RT1 A;  3KVG A;  4CJ7 A;  4E89 A;  5AQT A;  3ISN C;  1CLQ A;  4AM6 A;  4RCH A;  3RTV A;  3AVA A;  2P9L A;  4PHT X;  5AQZ A;  1HPM A;  1LAV A;  4JI5 K;  1YJ9 N;  3VEV A;  4BGA A;  2PYL A;  3NF8 A;  3TTF A;  1W0H A;  1RBU A;  3M8Q A;  3QIP A;  3H6E A;  2E5L K;  2FBY A;  4B9M A;  2ZD1 A;  5JLF A;  1RT5 A;  3KLH A;  3AV9 A;  3BF1 A;  3Q7B A;  1J54 A;  1GLD G;  3L8B A;  5KQ8 A;  2P51 A;  4QCL A;  1EQY A;  4E0D A;  1K8A O;  1NU0 A;  3W0L A;  4DV7 K;  1QZ5 A;  3NGZ A;  4KH4 A;  2YHY A;  4JD2 B;  1NK6 A;  5FRO A;  4Z4H A;  3SZ2 A;  3PSI A;  3O8M A;  4AHS A;  4IWV A;  4Z4E A;  1WSE A;  2FBT A;  1TKZ A;  3NGY A;  2ZGY A;  4ISG A;  3I0S A;  1NGG A;  4C8K A;  2JWK A;  3KK3 A;  2PBD A;  3CCJ N;  3OHR A;  2OCE A;  4B3M K;  2ZQB A;  4KRE A;  5EU7 A;  4DR2 K;  3E01 A;  4N41 A;  1HPZ A;  3AY9 A;  2ASM A;  3AGK A;  4FM0 A;  3FZH A;  3SUN A;  2X6S A;  2Y1I A;  1EET A;  4Q5V A;  1BUP A;  5CR4 A;  3M1F A;  3S3N A;  3SCX A;  3FE1 A;  1NKB A;  4AHU A;  4FO0 A;  2E2Q A;  2OPR A;  3VQA A;  3JYT A;  1NK5 A;  3KLG A;  4LFB K;  1NGD A;  2OAN A;  3KK7 A;  1VQL N;  1HNX K;  1OH7 A;  3WXJ A;  4JI3 K;  3VQ6 A;  4FJK A;  3EN9 A;  3UKR B;  5BR9 A;  1C1B A;  1KFS A;  1RBR A;  1HR0 K;  5FPD A;  2WC9 A;  2Q1N A;  4JRQ A;  1S1U A;  5AZJ B;  3PO4 A;  4FSV A;  2G8H A;  4CGG A;  3CER A;  3LP3 A;  4GY2 B;  4CGJ A;  3MN5 A;  1IKW A;  4OGE A;  2DFE A;  1BI4 B;  1ATR A;  4CF0 A;  4EFH A;  3TTC A;  1NKC A;  3VF2 A;  1GOA A;  4BRG A;  4FVU A;  3NAE A;  3PIO L;  2Z1I A;  3ATU A;  2VQE K;  4MFB A;  3UKU B;  1NGH A;  1VSE A;  4PY5 A;  1Z05 A;  4BGB A;  3NDK A;  3O5B A;  2ATQ A;  3E9P A;  4FWP A;  1QHT A;  3I0R A;  5I42 A;  4PQU A;  3P39 A;  3F9K A;  1J5O A;  4GKK K;  1K8K A;  1QHA A;  3ID6 A;  3FZL A;  4CHO A;  4B08 A;  2I5J A;  4B1X B;  1HNW K;  3FFI A;  1MU2 A;  2UYT A;  1HMV A;  3CQX A;  3H08 A;  4E7J A;  3TAF A;  2O8E B;  1KAY A;  1QVG M;  4FXD A;  4DV4 K;  4KV8 A;  4O8U A;  4E7I A;  1VRT A;  3I56 N;  3WXK A;  3VER A;  3PY8 A;  4FJ9 A;  5LJW A;  3V81 A;  3PV8 A;  2E2O A;  2HHW A;  3KKS A;  2E2P A;  3I8B A;  5M1N A;  3C94 A;  4CGD A;  3DLH A;  5CHI A;  1S1W A;  4K43 A;  4DU4 A;  3QES A;  5CY4 A;  3QIO A;  1L5U A;  4J8F A;  3THV A;  1C0U A;  3AO1 A;  4C23 A;  1GLE G;  4QAG A;  3VQP A;  1HJO A;  3EL2 A;  1A5X A;  1YIT N;  3OS2 A;  2OPP A;  4FK0 A;  1U6Z A; 
#chains in the Genus database with same CATH homology
 4V19 S;  4B3T K;  4AQY K;  1HNZ K;  2UXC K;  1HNX K;  4JI3 K;  4LF8 K;  4DR3 K;  4DV2 K;  4DR5 K;  1N34 K;  4DR1 K;  4DV0 K;  1HR0 K;  1N36 K;  1IBK K;  2UXB K;  4CVN E;  4YHH K;  3OTO K;  4B3R K;  4DV3 K;  4K0K K;  1N33 K;  4JV5 K;  1FJG K;  1XNQ K;  2VQF K;  2UUA K;  1IBL K;  4JI5 K;  5A2Q O;  5BR8 K;  4JI8 K;  2F4V K;  5LL6 Z;  2E5L K;  3T1Y K;  1J5E K;  2VQE K;  4GKJ K;  1XMQ K;  4JI2 K;  4DV6 K;  4DV1 K;  4LF6 K;  4NXN K;  4LF9 K;  1XNR K;  4CW7 B;  2UU9 K;  4DR7 K;  1XMO K;  4JI7 K;  4X65 K;  4DV7 K;  4GKK K;  3J81 O;  3J80 O;  4DUZ K;  4YY3 K;  1N32 K;  1HNW K;  2HHH K;  4LF5 K;  2UXD K;  3J7Y P;  4DR4 K;  2UUB K;  4JI6 K;  4B3S K;  2UUC K;  5LMU K;  3T1H K;  4LFA K;  1I94 K;  3JAM O;  2ZM6 K;  4DV4 K;  4NXM K;  3J7A P;  5IT9 O;  5AJ3 K;  5IWA K;  4B3M K;  4KHP K;  4DR2 K;  4LF4 K;  4JYA K;  5LMN K;  4X64 K;  4X66 K;  4DV5 K;  4OX9 K;  4DR6 K;  5FLX O;  4JI4 K;  4JI0 K;  1IBM K;  4DUY K;  4LFC K;  4JI1 K;  4X62 K;  4LFB K;  4LF7 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...