2D5RA

Crystal structure of a tob-hcaf1 complex
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
252
structure length
252
Chain Sequence
RICEVWACNLDEEMKKIRQVIRKYNYVAMDTEFPGVVARPIGEFRSNADYQYQLLRCNVDLLKIIQLGLTFMNEQGEYPPGTSTWQFNFKFNLTEDMYAQDSIELLTTSGIQFKKHEEEGIETQYFAELLMTSGVVLCEGVKWLSFHSGYDFGYLIKILTNSNLPEEELDFFEILRLFFPVIYDVKYLMKSCKNLKGGLQEVAEQLELERIGPQHQAGSDSLLTGMAFFKMREMFFEDHIDDAKYCGHLYGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CCR4-NOT transcription complex subunit 7
publication title Structural basis for the antiproliferative activity of the Tob-hCaf1 complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 82
structure length 252
sequence length 252
ec nomenclature ec 3.1.13.4: Poly(A)-specific ribonuclease.
pdb deposition date 2005-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04857 CAF1 CAF1 family ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2d5rA00
5C25A 3QETA 2KW4A 4FW2A 3MXIA 1NK0A 2YNHA 4KI6A 5D3GA 2P5GA 4PA1A 1KLMA 4Y1DA 3WNEA 3SQ0A 1DTTA 1NJYA 4DSLA 2XRIA 3TR8A 4CJFA 3RR8A 1RT3A 3DYAA 4GMJB 4CGGA 4Q0BA 3AA3A 4FK2A 1D8YA 3ZSOA 4FK4A 1LWCA 3C95A 3HJFA 3NCIA 4Y1CA 1BHLA 2IDOA 4DSEA 3KKRA 2JGUA 4JLHA 3M8PA 3OYJA 1KLNA 1JLFA 3HO1A 3L2UA 4B9NA 4NCBA 1KTQA 4LSNA 4CJTA 2G8UA 2QXFA 4CJUA 2XO7A 1IH7A 1BCMA 1VSMA 4B9TA 4L8RB 4DMNA 5FRNA 4DFKA 3KD1E 3QEWA 3SUNA 4JRPA 1RT4A 1RNHA 3VQ4A 3L2VA 3PO4A 3DOKA 4NYNA 4DTMA 4Z4HA 3VQPA 4RW4A 4DS4A 2KQ2A 4CJRA 2P1JA 3AVHA 1L3UA 4BWJA 3L2WA 5KI6A 3VQBA 3RR7A 3OYEA 2QK9A 2QKBA 4OLAA 5EU7A 2HNZA 1U4BA 3ZT1A 4DU1A 2XY5A 2HVHA 2E6LA 4O44A 2PY5A 3AVJA 4CEQA 3SYZA 4CJ5A 2HVIA 2OPPA 4DTNA 1HQEA 1MU2A 3LALA 5J1EA 4HVJA 4BE2A 4O4GA 4BDZA 4BDPA 1XHZA 1WSIA 4DU3A 3RRGA 1NJZA 1GOBA 1VSJA 3L2QA 1S9GA 3HM9A 3OYAA 4FLZA 5I3UA 4DSJA 4BDYA 1WSJA 3LP0A 3VQ8A 1TGOA 3OS1A 1S5JA 1CXUA 3HP9A 4GVMA 4ID1A 4E89A 4J2BA 1C1CA 1A5XA 5KGWA 1IKWA 3SQ2A 4CFDA 4W5TA 3KLEA 1TL1A 1DLOA 4OJRA 3MXMA 1RDAA 1Q9YA 4DU4A 4IKFA 2VWKA 1LW2A 1ZBUA 4E7HA 4FJHA 4FJ9A 4FVMA 4O5BA 4PUOA 3TI0A 3M8SA 3DRSA 4E7JA 4W5OA 4CFBA 3NH1A 3LP1A 4CGIA 4TSXA 3OJUA 3O3GA 1NK7A 3AA2A 2HHTA 1JLAA 1WSEA 2HHWA 1GOCA 1BGXT 2Z1JA 4IBNA 1S1XA 1A5WA 4UQGA 3HPOA 4N5SA 3V1QA 2EX3A 3HXMA 3QESA 3V9WA 1XHXA 4KB0A 4J2DA 3DMJA 1J53A 4GW6A 1XI1A 1KVCA 2P5OA 4CEOA 1QHTA 4KHYA 4AHTA 3NF9A 5K14A 1ASUA 1R0AA 2IOCA 4AHCA 1Q9XA 3SV4A 3F73A 2HNYA 3K5MA 4KHSA 4HUGA 3PO5A 1B9DA 1IKVA 1Q8IA 1ZBHA 2ATQA 3V4IA 3KLFA 5C42A 4B9SA 4CF9A 5CZ2A 4LD0A 1RILA 1Z26A 3ALYA 4FLVA 2JLEA 1X9SA 2IAJA 3LWMA 2BE2A 4FM0A 4DTUA 3SQ4A 3HYFA 2VWJA 3SCXA 4CE9A 4DLGA 3BGRA 3TAPA 4FK0A 1U47A 3G0ZA 4FJJA 3MEEA 4EZ9A 4DQQA 2VG6A 4FZZA 2X6SA 4MQ3A 2G8IA 3LPTA 4FLUA 4CEDA 3SZ2A 3QINA 3DLBA 2QKKA 3VQ7A 2BDPA 2Q3SA 3ZT3A 3PX0A 3KLHA 4LH5A 3ZSYA 3S3MA 3NGZA 3QO9A 3LZIA 3ZSVA 1YT3A 2ITGA 2OPSA 1T05A 2Z1IA 4RW9A 2RF2A 1BL3A 3K2PA 2P51A 4B8AB 3OYIA 3K5LA 4FLYA 3RWUA 3QEXA 2ZQBA 3RMDA 1VRTA 2W42A 3ASMA 1D9DA 4HCBA 1C1AA 4Z4IA 5FRMA 1RT6A 4LH4A 1VSIA 3D45A 4AHUA 4DFPA 1B92A 1JL1A 4AHVA 3ZT2A 2X74A 4OKJA 4KTWA 2G8FA 4M3XA 1BCOA 1SKRA 5E41A 1D5AA 1T7PA 4E0DA 3TABA 4R5PA 3FFIA 1TAQA 3MXJA 4B08A 2RN2A 1EETA 1VSEA 1EKEA 2GUIA 4KTZA 3ITHA 4LSLA 5HRSA 4Z4GA 1ZBFA 2XY8A 4H8KA 5HBMA 4F2SA 1TAUA 2Y1JA 3V1OA 4IFYA 1RTIA 1RT5A 3MAQA 1L3TA 4CEBA 4CJVA 1LW0A 3KIOA 3U3GA 4CJWA 4K8XA 3C6UA 1NK4A 3AO4A 3AA4A 3PX4A 4N41A 4E7KA 3TARA 1WSFA 4CGJA 3EZ5A 2XY7A 4FJLA 3AVBA 1JLCA 3LPUA 3QERA 2IS3A 1UOCA 2FC0A 3VQDA 1U45A 1NK9A 3NFAA 5HRPA 3OY9A 3O4NA 4FJIA 1IKXA 3E01A 1HQUA 3LZJA 4CF8A 4FM2A 1CXQA 4CJQA 1IG9A 1UA0A 1JLQA 1C1BA 4CIGA 2O4IA 4YNQA 3SI6A 4FLXA 1Z25A 4DF8A 3DM2A 3TAGA 1YTAA 2YHAA 3MEGA 3TANA 4C8NA 4CERA 1CLQA 4CFCA 4CEAA 2OYQA 3DOLA 3M8RA 3VQ6A 3QNOA 1QS4A 2RPIA 4DSKA 3I0SA 4NCGA 4E7IA 2FBXA 4DG1A 4KPYA 2X6NA 2GV9A 1NKBA 4G1QA 2KTQA 2OPQA 1WAFA 1T8EA 2OA8A 2O4GA 4W5RA 5J2QA 1VSLA 5C24A 2HHVA 4DFJA 4C8KA 1CZBA 3S3NA 4PQUA 4IG0A 4H4OA 1F21A 5KRSA 2KZZA 3SQ1A 1QQCA 4C8MA 1HYVA 4MFBA 4RW6A 3KTQA 4FJMA 3OYFA 4PY5A 3AVMA 3THVA 1EX4A 1JLGA 3A2FA 3BDPA 3DLGA 4CJ4A 4E1MA 3QIOA 4ZTFA 3DRPA 4KHWA 1SL0A 3SUOA 5HRNA 4Z4EA 2BGGA 4KREA 1QE1A 2HNDA 1C0MA 4AH9A 1KFDA 2PYLA 4OPKA 1UA1A 4K8ZA 1BI4B 3AVLA 3OYBA 1S6QA 2VG5A 2YNFA 1J9AA 3CM6A 3OJSA 2HHXA 1JXEA 4J2EA 3V9SA 1RBSA 1B9FA 3HT3A 3TAQA 1RT2A 1LWFA 3V1RA 3MEDA 3KLIA 2RKIA 3NGYA 2F96A 3WNFA 5T7BA 2B4JA 3O3HA 3ZCMA 3HVRA 3SPYA 4FJGA 4KRFA 4F4KA 1RBTA 1JKHA 4M3UA 1NKEA 1TK8A 1WNSA 2FBTA 4CHYA 2YV0X 3QIPA 3VA3A 1G15A 1KVAA 1HNIA 4F8RA 3VQ9A 3T3FA 1TL3A 4DQSA 1NKCA 4CJPA 3AO3A 1UWBA 4RG8A 3D0PA 1QTMA 4IG3A 3QEPA 1VSFA 2Z1HA 3LWLA 1FK9A 4I7FA 3OS0A 4KFBA 5CYQA 3NH2A 4FLWA 4DFMA 4E1NA 1VSDA 3UIQA 3B6PA 4E7LA 1X1PA 3H08A 1VSKA 2BANA 1K6YA 3AO5A 3DRRA 3OYMA 4B9VA 1RBRA 3V9ZA 1S1VA 5HP1A 1KFSA 4M3ZA 1LV5A 4CF0A 1C0UA 4KHQA 3LP3A 4M3WA 1CZ9A 2OZSA 1BQMA 3VN5A 4OVLA 3DLRA 2A1SA 2D5RA 3TWHA 2D0BA 3AO1A 3DLKA 3ZSWA 3ULDA 1W0HA 4HTUA 3ZSXA 3DLHA 4O0IA 1FXXA 4DWIA 3KJVA 1VSHA 4HUFA 1SKSA 4LY7A 3OYCA 3LDSA 4HHTA 1ZBLA 1S6PA 4CK1A 1NK8A 3DLEA 4CK3A 1X9MA 3LANA 3VQAA 4DTPA 2HHUA 3CG7A 3S9HA 4ELVA 1ZBIA 3ZSZA 3ZT4A 3HPHA 4CHZA 3VQQA 1TV6A 1WAJA 4W5NA 4FZXC 1J5OA 4M41A 1S9EA 3IAYA 3LAMA 3OYLA 3AVAA 4CJEA 2E4LA 3NE6A 3EY1A 4OKEA 1NJWA 2DFEA 3QNNA 4FZYA 1HRHA 5KRTA 3AO2A 4B9UA 1U49A 3P1GA 4I2PA 2HHSA 1YTUA 4OGEA 4BWMA 3WNHA 1O1WA 5SZTA 4FJ7A 5DMRA 3NF8A 3SJJA 4DQPA 3CFRA 4DF4A 4B3OA 1LAWA 4FLTA 1A5VA 4CGFA 4O55A 4CF2A 4DSIA 4CHQA 1ITGA 3G10A 2DY4A 1KSPA 4NCAA 4OKKA 3SNNA 1SKWA 4CIEA 3OYKA 1KVBA 3LAKA 4CIFA 1UAXA 2IC3A 5FDLA 4CJ3A 3L8BA 4DLEA 1ZYQA 1C6VA 3JYTA 2YNGA 1RDDA 2I5JA 3PV8A 1BI4A 1WN7A 3KK2A 4C8OA 4N76A 4KHUA 4JS5A 1GOAA 2EHGA 5HLFA 5JS1A 2OPRA 1J54A 3AVKA 4N56A 2KZMA 3AVIA 3L3VA 3K59A 1XWLA 3SPZA 5KTQA 2DFFA 3KK3A 3TAFA 5J2PA 4C8LA 4M42A 3HK2A 1IO2A 1Y97A 3T19A 2R7YA 3IG1A 3NF7A 3C6TA 4M3YA 4F3OA 4DS5A 3KD5E 2HW3A 4I2QA 4ZTJA 2PZSA 4E3SA 4QOZB 1BISA 1HYZA 1S1UA 1RBVA 2IGIA 3CYMA 3KLGA 1HJRA 1EP4A 3RMAA 1HMVA 4O0JA 3K58A 2HMIA 3SUQA 3NF6A 2HB5A 3EYZA 4AILC 1KRPA 1U48A 3F9KA 3KK1A 2GBZA 1RT1A 4CHOA 1WSGA 4DTXA 1XC9A 3O3FA 4CEFA 3NBPA 2Y1IA 4JS4A 4YFUA 4EP4A 4JRQA 2KFNA 1HNVA 1JL2A 1HPZA 1RTHA 4CGDA 4FCYA 1QSYA 4ELTA 4HCCA 2HHQA 3NGIA 3PX6A 4CEZA 4XIUA 1W9HA 3B6OA 5HRRA 2E6MA 2FBVA 3CQ8A 4ICLA 3OYNA 1L5UA 2G8KA 1S1TA 4NYFA 2YKMA 4N47A 3PY8A 1SL2A 4Z4CA 1SUQA 3P5JA 4DTJA 5HROA 4WE1A 3AVFA 4I9QA 1RTDA 4CHNA 4BE1A 4F2RA 4DTRA 3TAMA 3QEVA 1REVA 2KFZA 1NK5A 5CYMA 1N6QA 2YHBA 2ETJA 1QSSA 1I3AA 2G8VA 3JSMA 2WOMA 1RT7A 3QLHA 3OS2A 2G8WA 4ELUA 1RTJA 1YVUA 4Q5VA 4F3TA 1NOYA 3HP6A 4M3RA 3HSTB 3O4QA 3L3UA 3NHGA 1RDCA 1VK0A 4B8CA 1TKZA 1NOZA 3VA0A 4KI4A 2DTUA 4OGCA 3NAEA 1NJXA 3OYHA 4FW1A 1TVRA 2ZD1A 3AV9A 2NUBA 4CGHA 4FM1A 3KKSA 3T1AA 4QCLA 2LSNA 3P83D 2XHBA 5CZ1A 4KB1A 1X9WA 4IFVA 3CFOA 4DQIA 2F8SA 4KKOA 1RBUA 3AVNA 3TAEA 4Z4FA 3NDKA 1VRUA 3RMCA 1KCFA 1WSHA 4KV8A 4E19A 3VQCA 1JLBA 5J2NA 1JLEA 4EZ6A 1QSLA 4M45A 5CY4A 4FJ5A 1ASVA 5FROA 4DTOA 3I8DA 1SV5A 1U04A 4CHPA 4B9LA 1T03A 1L3VA 3DI6A 3HPGA 5I42A 3K5OA 2B6AA 4OLBA 1BIUA 3AVCA 5SWMA 3OYDA 5JS2A 1IKYA 3MECA 1ASWA 1BIZA 5KGXA 4HUEA 4BE0A 1WLJA 4CF1A 4EP5A 2VG7A 3RMBA 2ZE2A 3V6DA 3WNGA 1I39A 4CECA 4CCHA 3OVNA 1N5YA 1RDBA 3OYGA 4DTSA 2YKNA 3ZT0A 4ZHRA 4J2AA 4AHRA 2YNIA 1C0TA 4CEEA 4QAGA 2XY6A 3ZSRA 4CESA 3RTVA 4Z0UA 4DQRA 4ID5A 4H4MA 2X78A 1TK5A 1HYSA 4CFAA 3SV3A 3RRHA 1D9FA 3AA5X 3U3YA 4KHNA 4PWDA 3ISNC 1FKOA 4CJLA 3NH0A 3HL8A 3I0RA 3V9UA 3U6FA 4M3TA 3K57A 3V81A 3IRXA 2G8HA 4FJXA 1TKXA 2AJQA 4KO0A 4AHSA 1TK0A 1TKTA 4IDKA 4B9MA 3VQEA 1L3SA 2FBYA 2Z1GA 2F8TA 4RW8A 4CJSA 3S3OA 3VQ5A 4BACA 1BQNA 3K5NA 4FJNA 2PYJA 2WONA 1TKDA 4KTQA 1EXQA 1NK6A 4CK2A 4FJKA 2DFHA 1DTQA 1FKPA 3CM5A 4DSFA 4FJ8A 4I9LA 3CFPA 2B5JA 3AVGA 3ZSQA 1SL1A 3SUPA 3V9XA 4CJKA 3IS9A 3M8QA 5J2MA 1LAVA 3QEIA 3HVTA 2A1RA 4KAZA 2D0AA 4FYDA 1RCHA 4OPJA 4RW7A 2OZMA 3LP2A 1LWEA 3C94A 4FXDA 1JXBA 4W5QA 2D0CA 5DK5A 1S1WA 3PUFA 3L2RA
chains in the Genus database with same CATH superfamily
1ATSA 3WXLA 2YNHA 1KLMA 3BUZB 3SQ0A 3CMEN 3BF1A 5CR4A 2H3GX 4FK4A 3ZSOA 3HJFA 2V51B 3NCIA 3KKRA 4YY3K 2Q36A 1IJJA 1K9MO 4CZFA 1LCUA 2CH6A 4NCBA 3TSQA 4CJTA 1U6ZA 5ELZA 3FFKB 4DFKA 2V52B 1WUAA 3QEWA 3SUNA 2P9UA 3L4QA 3DOKA 4B1VA 2FF3B 1W2BM 4DS4A 3RSEA 1S3XA 1T6CA 4BR2A 1VQLN 1U4BA 3ZT1A 2HVHA 4O44A 4G9ZA 1VQ9N 5J1EA 4CJ7A 4PKHA 4FL9A 4BR4A 4O4GA 1XHZA 1WSIA 3TSUA 3L2QA 4FLZA 3HM9A 1WSJA 1S5JA 1CXUA 1FJGK 3EO3A 4FOIA 4BC5A 3VEYA 1T6DA 4DUYK 4CFDA 4IKFA 1Q9YA 2CH5A 4FVUA 4DU4A 3OHRA 4PUOA 1IBLK 1ZBUA 1VQ7N 3D2EA 4FVMA 4O5BA 2E20A 3TI0A 3M8SA 3CCLN 3DRSA 1N33K 1VQ6N 3TU5A 4IBNA 1S1XA 1A5WA 4BVOA 4C23A 1SAZA 1XHXA 3O1WA 3IFRA 1J53A 4GW6A 3MCAB 4FWSA 1Q86O 5K14A 1NG9A 1ASUA 1R0AA 2IOCA 4AHCA 4QS9A 4K25A 4HUGA 1Q8IA 2Q0UA 5C42A 2HBKA 4LD0A 2E2QA 2NRVA 1N32K 1YIJN 1IBMK 3MEEA 4JKDA 4DQQA 4FSVA 4FLUA 4JI5K 4CEDA 3B8AX 3PX0A 3ZSVA 1E3MA 3DXMB 4NXNK 1VRTA 2W42A 3ASMA 2UXDK 4EAHD 3UKRA 3O6WA 1RT6A 4LH4A 4AHUA 5BR8K 4DFPA 3CCEN 4JAXA 1C0FA 4AHVA 3ZT2A 3G25A 2G8FA 3VPZA 4M3XA 1BCOA 3CJ9A 3O9QA 1SKRA 3DXKA 3MDQA 2EWSA 4R5PA 1X3MA 2V7YA 1ZXOA 1EETA 1VSEA 2YI1A 4LSLA 5HRSA 5BPMA 1ZBFA 2XY8A 5HBMA 2GWKA 4IFYA 1RT5A 2FSJA 3TTFA 3U3GA 3GL1A 1NK4A 2QWOA 1MDUB 3PX4A 4CGJA 2XY7A 3AVBA 3QERA 3OY9A 1XMQK 4BR7A 2VWBA 4YNQA 3H46O 3CC4N 3O8MA 3THYA 3TAGA 5KQDA 3MEGA 1CLQA 2OYQA 3DOLA 1QS4A 4E7IA 1J5EK 4KPYA 1OH8A 4G1QA 1NGEA 3ID6A 5C24A 4DR1K 3QDKA 2HHVA 2QXLA 1CZBA 4ISEA 3VTIA 3TTDA 5C15A 3FLCO 1QQCA 4H0PA 3KTQA 4FJMA 5F0XA 3C6HA 3A2FA 2FXUA 3DLGA 4KHWA 2O8EA 1SL0A 3UKUB 2QWQA 3E66A 3SBGA 1KFDA 4FWLA 2YX6A 4K8ZA 3AVLA 2RHKA 2VG5A 3OJSA 1NGIA 4XEIA 3V9SA 1RBSA 1B9FA 2VCPA 3HT3A 4B1ZA 3MEDA 2D0PA 3KLIA 5T7BA 2B4JA 3ZCMA 1JKHA 3NVKA 1VQMN 4JI4K 3VQ9A 4DQSA 2VYPA 4CJPA 3AO3A 2FSKA 1YJWN 1ILYA 2Z1HA 4PKGA 4KFBA 4FLWA 1VSKA 2BANA 3DRRA 3P31A 1OVYA 4BRGA 1KFSA 5HP1A 4KH5A 1BQMA 4AM6A 4JNEA 2A1SA 4GKKK 2NLXA 3J7AP 2ZJQL 3WQTA 4V19S 1W0HA 4HTUA 3HBTA 1S22A 3LDSA 1ZBLA 4CK1A 2WFBA 3CG7A 4IXCA 1WAJA 5C0YA 2A6AA 3NE6A 3EY1A 3AO2A 1YTUA 4BWMA 1O1WA 4DQPA 4FLTA 1TYQB 4DSIA 4CHQA 3THWB 4A57A 2YHWA 3VTHA 3SNNA 5BPLA 1SKWA 1UAXA 1XC3A 1ZYQA 3PV8A 3KK2A 4C8OA 3A5OC 1GOAA 2D4WA 4BGAA 4WFBL 3R1XA 2DFFA 3KK3A 3KHYA 4BC4A 4IZ9A 1Y97A 2R7YA 3KZBA 3IG1A 4LF7K 4M63C 4M3YA 5AFUH 4I2QA 4ZTJA 4QOZB 4JKFA 1S1UA 3QFPA 4IEIA 2QTDA 3SUQA 5TKWA 3F9KA 2GBZA 5GAGP 1WSGA 1XC9A 5AQRA 5AZJB 4UY8O 3H1VX 4JS4A 4JRQA 1HNVA 4FCYA 3CJ7A 4CEZA 4IOAL 3B6OA 2FBVA 3OYNA 2ASOA 1DEJA 2G8KA 1S1TA 3PY8A 4Z4CA 1K73O 1SUQA 4H5TA 3IKMA 5AQQA 4CVNE 1YUWA 4EIAA 4CHNA 4BE1A 4F2RA 2GX9A 2UYTA 1N6QA 5CYMA 4CBXA 5EX5A 4KH6A 3AAPA 3HP6A 1NOYA 4DCHA 3HSTB 1RDCA 4YOUA 4E1JA 4KI4A 1OKJA 4H5WA 3OYHA 4FW1A 3AV9A 3CC2N 5CZ1A 4IFVA 1GLDG 2OTJN 1RBUA 1BG3A 1VRUA 2YJEA 1KCFA 1WSHA 1BU6O 3WUHA 4JK9A 3CETA 5FROA 3Q7CA 4YORA 1P8ZA 1ZC6A 3R3LA 4B9LA 1T03A 2B6AA 5JS2A 3WEEB 3WXMB 4BE0A 1WLJA 2ZE2A 4DV1K 3V6DA 2HF3A 1N5YA 5KPTA 3OYGA 2YKNA 5IT9O 5CHIA 5BRFA 4ILGB 4YDUA 3ULEB 4CESA 4DQRA 4ID5A 2X78A 1HYSA 2P9KA 3O9SA 4K43A 1NGHA 3ISNC 1T44A 1FKOA 4CJLA 3HL8A 4JD2A 5AZIA 5LJVA 3BEXA 2E2OA 2AJQA 4IDKA 1WBDA 2F8TA 1BA0A 3S3OA 4NB4A 3VQ5A 4FWOA 3VGLA 2HMPA 4WQ5C 2GEMA 4FJKA 5M1PA 1FKPA 4EFHA 5JVGL 4DHYA 3G6EN 4O8UA 3BP8A 4DSFA 4FJ8A 4I9LA 3CFPA 3AVGA 3WQUA 3V9XA 3J7YP 3IS9A 2A1RA 2NZTA 1LAVA 5EVZA 1EWQA 1HLUA 2O8DA 1GLEG 5AQJA 3HOSA 1KQSM 5C25A 3RVCA 2KW4A 3EE9A 3MXIA 1K8AO 4KI6A 2P5GA 5F1XA 3WNEA 1DTTA 4DSLA 2XRIA 3TR8A 4CJFA 3RR8A 4GMJB 3DYAA 4O5FA 4Q0BA 5AQHA 1IV0A 3NVMA 4FK2A 1HNZK 1LWCA 3ZX3A 2JGUA 2NRTA 2W40A 3OYJA 1JLFA 3R8EA 4B9NA 2G8UA 2QXFA 4CJUA 1IH7A 4CW7B 4B9TA 4DMNA 5FRNA 1X9JA 3VEWA 1RT4A 3SJHA 3WXJA 3VQ4A 2FLOA 4H5NA 2QI2A 3VOVA 4Z94A 2WTUA 5E26A 5GIPA 1NM1A 3VQBA 3RR7A 4JV5K 2HNZA 4DU1A 2XY5A 3LM2A 3AVJA 5AQIA 4CEQA 5EOYA 2OPPA 5AQXA 4DTNA 4HVJA 3E1YA 4DU3A 2FF6A 3AGRA 3OYAA 1YITN 4BDYA 2J4RA 3LP0A 3EZWA 2Q31A 4GVMA 4E89A 1YXQA 4DV4K 1IKWA 2QWMA 4H03B 3KLEA 5JLFA 3VETA 1LW2A 3TTCA 4E7HA 3EEQA 5AR0A 4E7JA 4W5OA 1NK7A 4TSXA 5FPDA 2HHTA 1NNEA 1BGXT 3O9TA 3HPOA 4C1NI 4ISFA 4N5SA 3HXMA 4LF5K 4KB0A 1VQON 4IJAA 1YHQN 1KVCA 4CEOA 4KHYA 4A5AA 4AHTA 3LDOA 5LL6Z 4IO9L 3SV4A 3F73A 2HNYA 3K5MA 4KHSA 1B9DA 1IKVA 2ATQA 3V4IA 3KLFA 3H6EA 4EHUA 4BRKA 4DUZK 4MDAA 3CCJN 4JKBA 3AAQA 4B1WB 3VF6A 3SCXA 4DLGA 1KD1O 4FK0A 3G0ZA 4FJJA 3O08A 4EZ9A 4MQ3A 4CD3A 5CE3A 2G8IA 3LPTA 1LOTB 3SZ2A 3QINA 2CGJA 4B1YB 3ZT3A 4LH5A 3ZSYA 3S3MA 2FSNA 4DR2K 1ESVA 2I7NA 3FZKA 1T05A 4RW9A 3W0LA 3RWUA 3K5LA 3QEXA 1D9DA 4HCBA 1C1AA 5FRMA 1B92A 4XH5A 5H1SQ 3HOTA 4I6MB 3EKUA 1D5AA 1D4XA 4H0VB 3FFIA 3SAFA 3MXJA 4B08A 1EKEA 5ADXA 1U2VB 1NGCA 1TUUA 4F2SA 4H5RA 2Q1NA 2Y1JA 3V1OA 4LFBK 3O80A 3GBTA 5FLXO 3MAQA 1KAYA 3UE5A 4CEBA 1L3TA 3C6UA 3FR0A 3AO4A 3D2FB 1V4TA 2ZJRL 4FWRA 4FJLA 2IS3A 2FC0A 3CMAN 1NK9A 1IKXA 4BRFA 1UA0A 2W6LA 3C7NB 3BY5A 3SI6A 3DM2A 1YTAA 2YHAA 1YVNA 4JN4A 4C8NA 4CERA 3M8RA 3VQ6A 2RPIA 5E84A 4NCGA 1VQ4N 2FBXA 1JCEA 2X6NA 4BR5A 2OPQA 2OA8A 4DQ8A 1JCGA 4JKGB 1GLFO 4A59A 4JK8A 4W5RA 5GAEP 4DFJA 4PQUA 4IG0A 1F21A 4HTLA 3DLLL 2KZZA 3F2KA 3SQ1A 4RW6A 1NU0A 1SQKA 5BPNA 3BDPA 4E1MA 3DRPA 3JAMO 4CZEA 5HRNA 3HI0A 3M1FA 4Z4EA 1BUPA 1QE1A 2HNDA 1WBBA 1BI4B 2HOEA 1S6QA 1J9AA 2HHXA 2E88A 3DXMA 4CI6A 1RT2A 2RKIA 4JK7A 3WNFA 3HVRA 2UXBK 1RFQA 4M3UA 2FBTA 4XH1A 1KVAA 1N34K 1HNIA 4IFEA 3R6MA 4IEEA 3D0PA 3DJCA 4IG3A 1VSFA 3U4LA 3LWLA 1FK9A 5CYQA 3NH2A 1NGAA 3VGKA 1VSDA 4A2BA 4CBWA 3UIQA 3H08A 1K6YA 4PL8A 3OYMA 3H3OB 4B9VA 3PSIA 3V9ZA 4LF4K 5JMVA 1NBWA 2P9UB 1S1VA 2O8FB 4CF0A 1C0UA 2D5RA 3TWHA 4FOEA 1HR0K 3DLHA 4KH4A 1H1VA 4O0IA 1ATRA 4RWTA 1SKSA 1RDWX 4LY7A 4HHTA 4M7XA 4CK3A 1X9MA 2HHUA 4DTPA 4A61A 3ZT4A 3SAHA 3VQQA 1TV6A 4BRAA 1EO1A 2O8CB 4M41A 3A5MC 3KVGA 3OBWA 4CJEA 2P9SB 3MCPA 4OKEA 1NJWA 2DFEA 4LF9K 2F9WA 3GOIA 5SZTA 3CQYA 1LAWA 1GLCG 4CGFA 3VENA 1ITGA 4JKEA 4JI2K 2ZF5O 3SLCA 4NCAA 1KVBA 4WQ4C 4CIFA 5FDLA 3UKUA 1RDDA 2I5JA 4KBOA 2VQEK 3FZMA 3KK7A 1W97L 1J54A 4N56A 3L3VA 3K59A 4MDBA 1XWLA 3SPZA 5KTQA 5J2PA 4BVPA 4C8LA 3CCSN 3NF7A 3KD5E 4QS8A 3KLGA 3CYMA 2IGIA 3C65A 3TPQA 1HJRA 4CZMA 1EP4A 3K58A 4DKWA 2HB5A 3EYZA 4AILC 4CBUA 4CHOA 4DTXA 3FZLA 4EP4A 3QBXA 1JL2A 3M5RA 5M1NA 4HCCA 3NGIA 4GVEA 4XIUA 1W9HA 4N47A 2ZJPL 5HROA 4ILJA 4WE1A 4I9QA 3TAMA 2UU9K 1QSSA 2G8VA 4DV6K 3JSMA 1HKGA 5AQFA 4BR0A 4ELUA 3OS2A 4F3TA 4Q5VA 1XQSC 2P9NB 4M3RA 2PAVA 1BWFO 3NHGA 4JKHA 4OGCA 3NAEA 1NJXA 4FM1A 5JICA 3KKSA 1YAGA 4BRCA 5AQTA 4QCLA 2XHBA 4KB1A 3MN7A 3TAEA 3C6AA 2CGKA 4JI7K 1BA1A 3T1YK 3CJ1A 1TYQA 1VHXA 3FGUA 3THWA 4YOXA 5J2NA 2JWLA 5GAHP 2D1KA 4DTOA 3I8DA 1SV5A 1HKBA 5I42A 3K5OA 5AQLA 2F9TA 4YDUC 1GLLO 5AQUA 3MECA 3PLAA 2KLAA 5KGXA 1QVGM 4JEPA 2VG7A 3ID8A 3RMBA 4CECA 2E1YA 5BRDA 4DR4K 1C0TA 1DT9A 4GY2B 3RTVA 2VGNA 4CFAA 4KHNA 4M3TA 1HJOA 5AZJA 3K57A 3IRXA 3PIOL 2G8HA 4FJXA 4KHPK 5BREA 2O8EB 1TKTA 1L3SA 2FBYA 2Z1GA 3LDNA 4CJSA 1BQNA 3VEVA 1TKDA 1VAZA 1EXQA 1R59O 4BRQA 1SL1A 2VGMA 4KAZA 3HVTA 3CD6N 2D0AA 2OZMA 3LDPA 2D0CA 1NGBA 3LDQA 5C2DA 1JJ2M 3QETA 2ASPA 4FW2A 1KXPA 1BOTO 4WQ4A 4PA1A 1NJYA 5KPZA 4A2AA 1RT3A 3EKSA 1HUXA 3C95A 5AQYA 1HNXK 1KAZA 4Y1CA 1BHLA 1M1KO 4JLHA 3QMLA 1KLNA 5TKYA 3WT0A 1KTQA 2E2NA 5AQKA 2XO7A 1QQMA 3P38A 3CJCA 2A41A 3KD1E 2IVPA 3MMVA 4JRPA 3L2VA 3PO4A 3G71N 4NYNA 4DTMA 4Z4HA 3VQPA 4RW4A 3WEEA 2QWRA 3BZCA 2V7ZA 5IWAK 1L3UA 4BWJA 2P9IB 5FPEA 2QKBA 4OLAA 5EU7A 3WXKA 4DV7K 3MWPA 2E6LA 3ULEA 2HVIA 1HQEA 1MU2A 4BDZA 4FPBA 4BG8A 3RRGA 1NGDA 1VSJA 5I3UA 1TGOA 3OS1A 2GTDA 3HP9A 4J2BA 1C1CA 3AY9A 1A5XA 4BRLA 2RE2A 4W5TA 4OJRA 1DLOA 1RDAA 1QHAA 1TAUA 2VWKA 4DR3K 1TUYA 4NLBA 3NH1A 4CGIA 3O3GA 3AA2A 3CJBA 1GOCA 2Z1JA 3GDQA 3V1QA 4B9QA 3DMJA 1XI1A 2P5OA 1GLJO 1RDUA 3NF9A 5AQMA 3PO5A 2P9PB 4H5VA 3THXB 3CXCM 1RILA 5AFUA 3ALYA 4FLVA 1N36K 2JLEA 4X66K 3I55N 2BE2A 4FM0A 4DTUA 2VWJA 4CE9A 4BRDA 1NMDA 1U47A 1IBKK 3CI5A 4BC2A 4FZZA 2VG6A 4BC3A 3MN9A 3QICA 4L3QA 4H0YB 3G4SN 2KKZA 4OPAA 3CCUN 2QKKA 2BDPA 3NGZA 3QO9A 2F4VK 2BTFA 1YT3A 2ITGA 2Z1IA 2RF2A 1BL3A 2P51A 3OYIA 2ZQBA 4Z4IA 3CCQN 1JL1A 2HBJA 1YF5L 4JI1K 1K8KB 2X74A 4OKJA 3O9RA 4R79A 2IVNA 1T7PA 3TABA 3J7ZO 4KTZA 2BUPA 2IVOA 2A3ZA 1Q7YO 2UUBK 1YJ9N 4CJVA 4K8XA 1MWKA 3AA4A 4N41A 3ENBA 3TARA 3LPUA 1U45A 3VQDA 1MWMA 3NFAA 1QVFM 3E01A 4FPAA 3LZJA 1SZ2A 4CF8A 5LJWA 1HNWK 4FM2A 4JI0K 1C1BA 4CIGA 1NGFA 1Z25A 5BN8A 3TANA 2HBMA 4DSKA 1NKBA 4YOWA 1EWRA 1WAFA 1T8EA 4BQZA 5J2QA 1VSLA 2F7TA 2P9LB 3MN5A 4Y0WA 4C8KA 3S3NA 3I33A 5AQPA 3F5TA 4H4OA 5M1QA 3U9DA 5KRSA 2A42A 4C8MA 4MFBA 4X64K 1T3VA 1QZ5A 2OTLN 3QFUA 4ZTFA 2PBDA 3E9LA 4KREA 4AH9A 4OPKA 5FPNA 4PKIA 3S41A 1LWFA 5HL7L 3NGYA 2F96A 4KRFA 4FJGA 3SPYA 4F4KA 1RBTA 3MX5A 3VA3A 3T1HK 1G15A 2NRHA 4LFAK 4I6MA 1KC8O 3T3FA 1NKCA 3VGMA 4O8KA 3CCVN 1C0GA 3F9MA 1QTMA 3OS0A 5C10A 4MO4A 4DFMA 3WXIA 4E7LA 4JKAA 3AO5A 2E2PA 3HRGA 3ATVA 3U8XA 5DM7L 5AQNA 4M3ZA 1LV5A 3D2FA 3LP3A 3W3DA 1CZ9A 4F9OA 4FO0A 2KHOA 4OVLA 3DLRA 3QB0A 2VQFK 2D0BA 3CHWA 3VMFB 4LFCK 4DWIA 1FXXA 4BGBA 1VSHA 4HUFA 3C7NA 3GE1A 5BRHA 1VQPN 1S6PA 1JCFA 2UUCK 3O1BA 1NK8A 3LANA 3VQAA 1DGKN 5KQ8A 2QEXN 1ZBIA 3HPHA 4CHZA 4W5NA 4FZXC 2OCEA 1J5OA 4BY9C 3IAYA 3R9PA 3LAMA 4M7YA 4GKJK 2GELA 4BRPA 4JKGA 3QNNA 2E1ZA 5JLHA 1E4FT 4IWVA 3ZEUB 4JHDB 3NF8A 3SAGA 2NRWA 4DF4A 4FWMA 4MLHA 3ZETB 1A5VA 4CF2A 2HHHK 4FWNA 1BO5O 4OKKA 3OYKA 3ENHA 4DB3A 2IC3A 3N4PA 3L8BA 4CJ3A 1YI2N 4DLEA 1C6VA 2YNGA 1BI4A 4IOXA 4N76A 2KZMA 4JS5A 4J8FA 2OPRA 4BR9A 3AVIA 1ZBSA 3TAFA 5M1OA 3HK2A 2O8BB 4DR5K 5MLCQ 3T19A 2QM1A 4RTFD 4F3OA 2HW3A 2PZSA 4E3SA 3A5LC 1RBVA 5AQSA 2HMIA 4BROA 4JI3K 5BR9A 1Y64A 1MA9B 3P4IA 4CEFA 3NBPA 1HPZA 1RTHA 3JXUA 4CGDA 2GUPA 4JYAK 5HRRA 2WUSA 3CQ8A 1L5UA 2O8FA 2YKMA 4IJNA 3AVFA 4DTRA 3QEVA 2KFZA 2NRXA 3VEZA 1WB9A 1I3AA 3CCMN 4BRNA 2WOMA 1RT7A 5LY3A 2G8WA 4H0OA 1Q18A 3O4QA 3L3UA 3K0SA 2O8CA 3O9UA 1TKZA 1NOZA 4BQLA 4CZGA 1EQYA 2P9SA 4FWKA 3OBYA 3T1AA 3U9ZA 3P83D 1X9WA 4DQIA 3A8YA 3AVNA 5M1FA 2HBLA 4GV3A 2D0OA 3M6GA 4Z4FA 2HSTA 4KV8A 4E19A 1P90A 2JWKA 2Q97A 1JLEA 4EZ6A 1QSLA 4FJ5A 1ASVA 2QWNA 3VESA 3DAWA 1XUPO 3HPGA 4BRHA 4YOTA 4OLBA 1BIUA 3CPEA 3OYDA 3BF3A 3RSEB 2CGLA 3I8BA 3PIPL 4PL7A 5LMUK 3EN9A 4K41A 4CCHA 2DPNA 1RDBA 1M90O 4DTSA 3ZT0A 4J2AA 4AHRA 2YNIA 4CEEA 3VF2A 3PSFA 4YOVA 4QAGA 3ZSRA 3LL3A 3L4IA 4Z0UA 4H4MA 3SV3A 3RRHA 1D9FA 3U6FA 3O5BA 3V81A 1TKXA 5I9EB 4WCEL 4KO0A 3SMPA 4AHSA 4B9MA 3FE1A 4DR6K 3K5NA 3VEOA 2PYJA 2W6KA 3K9KA 3D2EB 2QW9A 3J80O 1Q81O 1NK6A 1DTQA 4DV5K 3CM5A 3HSCA 4RCHA 3AARA 1NWKA 2B5JA 3ZSQA 3HZ6A 3OTOK 1I94K 2YJFA 5J2MA 3QEIA 4FYDA 4K0KK 3MWTA 4A62A 3C94A 4FXDA 4W5QA 5M1KA 2P9NA 5DK5A 1S1WA 4DS5A 3PUFA 3L2RA 1NK0A 5D3GA 1YJNN 4Y1DA 1NGJA 3ZX2A 2WBNA 4CGGA 3AA3A 5FPMA 1D8YA 4H0TB 4CD1A 2IDOA 4DSEA 3M8PA 3HO1A 3L2UA 1Z05A 2NRRA 5A2QO 4LSNA 1BCMA 1VSMA 4L8RB 2ASMA 1RNHA 3CERA 4XH4A 4C1NK 2KQ2A 4CJRA 4X65K 2P1JA 3AVHA 3UKRB 3L2WA 5KI6A 3SBTA 3OYEA 2QK9A 3CQXA 2YHYA 3T7ZA 4U67L 2PY5A 3SYZA 4CJ5A 3K9JA 3DXKB 3LALA 1VQKN 3IDHA 2ZGYA 3VERA 4BE2A 2UUAK 2AP1A 4BDPA 1QZ6A 1NJZA 1GOBA 4DSJA 1S9GA 1VQNN 1XMOK 3VQ8A 2PFUA 4ID1A 1RGIA 4ISGA 5KGWA 3SQ2A 2I7PA 3MXMA 1TL1A 4FJHA 4FJ9A 5EXWA 4CFBA 3OJUA 3LP1A 2YCHA 1JLAA 1WSEA 2HHWA 3NMUA 4UQGA 2E5LK 2EX3A 3QESA 2Q2RA 3V9WA 3THYB 4J2DA 3L0QA 1QHTA 4FWQA 1OH7A 1Q9XA 3Q7BA 1ZBHA 1J6ZA 4B9SA 4CF9A 5CZ2A 1Z26A 1SS6A 5GIOA 1X9SA 2IAJA 3E9PA 2YHXA 4AM7A 3LWMA 3SQ4A 4X62K 3HYFA 3BGRA 3TAPA 2X6SA 2W41A 1QQOA 3BZKA 3DLBA 3VQ7A 2Q3SA 3KLHA 1N8RO 2OANA 3LZIA 4JKCA 2OPSA 3K2PA 4B8AB 4FLYA 1CZAN 3ZYYX 3RMDA 4MO5A 1VSIA 3D45A 2P9IA 4B3RK 4KTWA 3CF5L 5E41A 4E0DA 1TAQA 4WFNL 2RN2A 2GUIA 2QWLA 3ITHA 2HF4A 4LF8K 4Z4GA 4B3SK 4H8KA 3J8AA 3ZLJA 1RTIA 1LW0A 3KIOA 5GADP 4CJWA 3O4WA 4E7KA 1WSFA 3EZ5A 4IOCL 4CZKA 2E8AA 1JLCA 3E9OA 1Q82O 4GV6A 1UOCA 4FJIA 5HRPA 3O4NA 1NGGA 1HQUA 2AA4A 3VEXA 1CXQA 4CJQA 1IG9A 1JLQA 2O4IA 4FLXA 4DF8A 4AQYK 4CFCA 4CEAA 3LM9A 3QNOA 3M3ZA 3A0IX 1OVQA 3I0SA 1O13A 4DG1A 3CIPA 4AF1A 2GV9A 4DV2K 3SK3A 2KTQA 2P9PA 2O4GA 3SMSA 1V4SA 3THXA 5GINA 5LMNK 4ILHA 4MLEA 1KAXA 1HYVA 3OYFA 4PY5A 3AVMA 3THVA 1EX4A 1JLGA 4CJ4A 3QIOA 1QQNA 3SUOA 1VQ8N 2BGGA 1C0MA 2PYLA 1UA1A 2ZWHA 4HWIA 3OYBA 3CM6A 2YNFA 1JXEA 4BRIA 3MN6A 4J2EA 3EL2A 3TAQA 4DV0K 3V1RA 3O3HA 1FW6A 3IUCA 1NKEA 1G99A 1WNSA 4CHYA 1TK8A 2IIRA 2YV0X 3QIPA 4F8RA 1K8KA 1TL3A 1UWBA 4RG8A 4B1XB 3QEPA 4WFAL 4I7FA 5JVHL 2A5XA 4E1NA 3B6PA 1X1PA 3H45C 3FZHA 1XNRK 1RBRA 5AQZA 1GLAG 3L6QA 4KHQA 4M3WA 3ZX0A 4OPHA 2OZSA 3VN5A 4K42A 4IO8A 3AO1A 3DLKA 3ENOA 3ZSWA 3ULDA 3ZSXA 3IMXA 5F2RA 3KJVA 3OYCA 4PHTX 3HM8A 3DLEA 4OX9K 4NO7A 3S9HA 3JS6A 3ZSZA 4CZHA 4ELVA 4BREA 5AQWA 1S9EA 3H3NO 3OYLA 3AVAA 2E4LA 1HX1A 4FZYA 1HRHA 5KRTA 4B9UA 1U49A 3P1GA 4I2PA 2P9LA 2HHSA 4OGEA 3CCRN 3WNHA 1W7AA 4YOYA 4FJ7A 5DMRA 5EY4A 3SJJA 3CFRA 4B3OA 4H0XB 4O55A 3G10A 2DY4A 1KSPA 3C0BA 4CIEA 3D6RA 3LAKA 5AQVA 3EE8A 2Q0RA 4FWPA 3A5NC 1OH5A 3JYTA 1OH6A 1WN7A 4KHUA 3N4QA 2EHGA 5HLFA 2NRZA 5JS1A 5B8HA 3AVKA 4CZLA 4M42A 1IO2A 3C6TA 3H1QA 1BISA 1HYZA 2QWPA 2A40A 4WF9L 5AQOA 4QS7A 3RMAA 1HMVA 4O0JA 4IDHA 3NF6A 2P9KB 1KRPA 1U48A 3KK1A 1RT1A 1BDGA 1NMNA 3O3FA 4JD2B 5AZIB 2Y1IA 1S72N 1XNQK 4YFUA 1HPMA 1NLVA 2KFNA 3LDLA 2ZGZA 1QSYA 4ELTA 2HHQA 3PX6A 2E6MA 4ICLA 3CJAA 4NYFA 1IG8A 1SL2A 3P5JA 4DTJA 2UXCK 1RTDA 5BN9A 5DM6L 3VF4A 1REVA 3MK6A 4DR7K 3HTVA 2ITMA 1NK5A 5AJ3K 2YHBA 2ETJA 2QA4N 2O8DB 3QLHA 2GWJA 1RTJA 1YVUA 4A5BA 5ADXH 1VK0A 4B8CA 3VA0A 2DTUA 1DKGD 1GLBG 1TVRA 2ZD1A 2NUBA 4CGHA 3J81O 2LSNA 2ZM6K 2F8SA 3CFOA 3ATUA 4KKOA 4U7BA 3ZEUA 4JHDA 3NDKA 3RMCA 3ZETA 3VQCA 1JLBA 4JI6K 1U2VA 3FZFA 3OW2M 1X3NA 1HKCA 4M45A 5CY4A 1WOQA 3TSPA 4B3MK 2WC9A 4B3TK 1U04A 4CHPA 4GV9A 1L3VA 3DI6A 3AVCA 4WYBA 3T69A 5SWMA 3CC7N 1IKYA 3UB5A 4EHTA 3I56N 1ASWA 1BIZA 4HUEA 4CF1A 4EP5A 3QBWA 4CZIA 4NLCA 2O8BA 3WNGA 5HOOA 1I39A 4OO1J 3OVNA 2NNWA 4ZHRA 3AGKA 5KPRA 3OA9A 2XY6A 4DV3K 4JI8K 3GG4A 1TK5A 3AA5X 3U3YA 4PWDA 4LF6K 5C12A 3NH0A 3I0RA 3V9UA 3D7EO 1TK0A 1E4GT 3VQEA 4CZJA 2BH1A 4RW8A 1VQ5N 4BACA 4FJNA 3KWIA 4NXMK 2WONA 4BG9A 4KTQA 3MX2A 3P39A 4B1UB 4CK2A 2DFHA 4BRMA 5C2FA 3CPWM 3DWLA 3KWGA 4LC9B 4YHHK 3SUPA 4CJKA 3M8QA 1ATNA 5AQGA 1RCHA 4OPJA 1Z6RA 4RW7A 3LP2A 1LWEA 4GNIA 1JXBA 1NJIO 4WQ5A
chains in the Genus database with same CATH topology
5C25A 3QETA 2KW4A 4FW2A 3MXIA 1NK0A 2YNHA 4KI6A 5D3GA 2P5GA 4PA1A 1KLMA 4Y1DA 3WNEA 3SQ0A 1DTTA 1NJYA 4DSLA 2XRIA 3TR8A 4CJFA 3RR8A 1RT3A 3DYAA 4GMJB 4CGGA 4Q0BA 3AA3A 4FK2A 1D8YA 3ZSOA 4FK4A 1LWCA 3C95A 3HJFA 3NCIA 4Y1CA 1BHLA 2IDOA 4DSEA 3KKRA 2JGUA 4JLHA 3M8PA 3OYJA 1KLNA 1JLFA 3HO1A 3L2UA 4B9NA 4NCBA 1KTQA 4LSNA 4CJTA 2G8UA 2QXFA 4CJUA 2XO7A 1IH7A 1BCMA 1VSMA 4B9TA 4L8RB 4DMNA 5FRNA 4DFKA 3KD1E 3QEWA 3SUNA 4JRPA 1RT4A 1RNHA 3VQ4A 3L2VA 3PO4A 3DOKA 4NYNA 4DTMA 4Z4HA 3VQPA 4RW4A 4DS4A 2KQ2A 4CJRA 2P1JA 3AVHA 1L3UA 4BWJA 3L2WA 5KI6A 3VQBA 3RR7A 3OYEA 2QK9A 2QKBA 4OLAA 5EU7A 2HNZA 1U4BA 3ZT1A 4DU1A 2XY5A 2HVHA 2E6LA 4O44A 2PY5A 3AVJA 4CEQA 3SYZA 4CJ5A 2HVIA 2OPPA 4DTNA 1HQEA 1MU2A 3LALA 5J1EA 4HVJA 4BE2A 4O4GA 4BDZA 4BDPA 1XHZA 1WSIA 4DU3A 3RRGA 1NJZA 1GOBA 1VSJA 3L2QA 1S9GA 3HM9A 3OYAA 4FLZA 5I3UA 4DSJA 4BDYA 1WSJA 3LP0A 3VQ8A 1TGOA 3OS1A 1S5JA 1CXUA 3HP9A 4GVMA 4ID1A 4E89A 4J2BA 1C1CA 1A5XA 5KGWA 1IKWA 3SQ2A 4CFDA 4W5TA 3KLEA 1TL1A 1DLOA 4OJRA 3MXMA 1RDAA 1Q9YA 4DU4A 4IKFA 2VWKA 1LW2A 1ZBUA 4E7HA 4FJHA 4FJ9A 4FVMA 4O5BA 4PUOA 3TI0A 3M8SA 3DRSA 4E7JA 4W5OA 4CFBA 3NH1A 3LP1A 4CGIA 4TSXA 3OJUA 3O3GA 1NK7A 3AA2A 2HHTA 1JLAA 1WSEA 2HHWA 1GOCA 1BGXT 2Z1JA 4IBNA 1S1XA 1A5WA 4UQGA 3HPOA 4N5SA 3V1QA 2EX3A 3HXMA 3QESA 3V9WA 1XHXA 4KB0A 4J2DA 3DMJA 1J53A 4GW6A 1XI1A 1KVCA 2P5OA 4CEOA 1QHTA 4KHYA 4AHTA 3NF9A 5K14A 1ASUA 1R0AA 2IOCA 4AHCA 1Q9XA 3SV4A 3F73A 2HNYA 3K5MA 4KHSA 4HUGA 3PO5A 1B9DA 1IKVA 1Q8IA 1ZBHA 2ATQA 3V4IA 3KLFA 5C42A 4B9SA 4CF9A 5CZ2A 4LD0A 1RILA 1Z26A 3ALYA 4FLVA 2JLEA 1X9SA 2IAJA 3LWMA 2BE2A 4FM0A 4DTUA 3SQ4A 3HYFA 2VWJA 3SCXA 4CE9A 4DLGA 3BGRA 3TAPA 4FK0A 1U47A 3G0ZA 4FJJA 3MEEA 4EZ9A 4DQQA 2VG6A 4FZZA 2X6SA 4MQ3A 2G8IA 3LPTA 4FLUA 4CEDA 3SZ2A 3QINA 3DLBA 2QKKA 3VQ7A 2BDPA 2Q3SA 3ZT3A 3PX0A 3KLHA 4LH5A 3ZSYA 3S3MA 3NGZA 3QO9A 3LZIA 3ZSVA 1YT3A 2ITGA 2OPSA 1T05A 2Z1IA 4RW9A 2RF2A 1BL3A 3K2PA 2P51A 4B8AB 3OYIA 3K5LA 4FLYA 3RWUA 3QEXA 2ZQBA 3RMDA 1VRTA 2W42A 3ASMA 1D9DA 4HCBA 1C1AA 4Z4IA 5FRMA 1RT6A 4LH4A 1VSIA 3D45A 4AHUA 4DFPA 1B92A 1JL1A 4AHVA 3ZT2A 2X74A 4OKJA 4KTWA 2G8FA 4M3XA 1BCOA 1SKRA 5E41A 1D5AA 1T7PA 4E0DA 3TABA 4R5PA 3FFIA 1TAQA 3MXJA 4B08A 2RN2A 1EETA 1VSEA 1EKEA 2GUIA 4KTZA 3ITHA 4LSLA 5HRSA 4Z4GA 1ZBFA 2XY8A 4H8KA 5HBMA 4F2SA 1TAUA 2Y1JA 3V1OA 4IFYA 1RTIA 1RT5A 3MAQA 1L3TA 4CEBA 4CJVA 1LW0A 3KIOA 3U3GA 4CJWA 4K8XA 3C6UA 1NK4A 3AO4A 3AA4A 3PX4A 4N41A 4E7KA 3TARA 1WSFA 4CGJA 3EZ5A 2XY7A 4FJLA 3AVBA 1JLCA 3LPUA 3QERA 2IS3A 1UOCA 2FC0A 3VQDA 1U45A 1NK9A 3NFAA 5HRPA 3OY9A 3O4NA 4FJIA 1IKXA 3E01A 1HQUA 3LZJA 4CF8A 4FM2A 1CXQA 4CJQA 1IG9A 1UA0A 1JLQA 1C1BA 4CIGA 2O4IA 4YNQA 3SI6A 4FLXA 1Z25A 4DF8A 3DM2A 3TAGA 1YTAA 2YHAA 3MEGA 3TANA 4C8NA 4CERA 1CLQA 4CFCA 4CEAA 2OYQA 3DOLA 3M8RA 3VQ6A 3QNOA 1QS4A 2RPIA 4DSKA 3I0SA 4NCGA 4E7IA 2FBXA 4DG1A 4KPYA 2X6NA 2GV9A 1NKBA 4G1QA 2KTQA 2OPQA 1WAFA 1T8EA 2OA8A 2O4GA 4W5RA 5J2QA 1VSLA 5C24A 2HHVA 4DFJA 4C8KA 1CZBA 3S3NA 4PQUA 4IG0A 4H4OA 1F21A 5KRSA 2KZZA 3SQ1A 1QQCA 4C8MA 1HYVA 4MFBA 4RW6A 3KTQA 4FJMA 3OYFA 4PY5A 3AVMA 3THVA 1EX4A 1JLGA 3A2FA 3BDPA 3DLGA 4CJ4A 4E1MA 3QIOA 4ZTFA 3DRPA 4KHWA 1SL0A 3SUOA 5HRNA 4Z4EA 2BGGA 4KREA 1QE1A 2HNDA 1C0MA 4AH9A 1KFDA 2PYLA 4OPKA 1UA1A 4K8ZA 1BI4B 3AVLA 3OYBA 1S6QA 2VG5A 2YNFA 1J9AA 3CM6A 3OJSA 2HHXA 1JXEA 4J2EA 3V9SA 1RBSA 1B9FA 3HT3A 3TAQA 1RT2A 1LWFA 3V1RA 3MEDA 3KLIA 2RKIA 3NGYA 2F96A 3WNFA 5T7BA 2B4JA 3O3HA 3ZCMA 3HVRA 3SPYA 4FJGA 4KRFA 4F4KA 1RBTA 1JKHA 4M3UA 1NKEA 1TK8A 1WNSA 2FBTA 4CHYA 2YV0X 3QIPA 3VA3A 1G15A 1KVAA 1HNIA 4F8RA 3VQ9A 3T3FA 1TL3A 4DQSA 1NKCA 4CJPA 3AO3A 1UWBA 4RG8A 3D0PA 1QTMA 4IG3A 3QEPA 1VSFA 2Z1HA 3LWLA 1FK9A 4I7FA 3OS0A 4KFBA 5CYQA 3NH2A 4FLWA 4DFMA 4E1NA 1VSDA 3UIQA 3B6PA 4E7LA 1X1PA 3H08A 1VSKA 2BANA 1K6YA 3AO5A 3DRRA 3OYMA 4B9VA 1RBRA 3V9ZA 1S1VA 5HP1A 1KFSA 4M3ZA 1LV5A 4CF0A 1C0UA 4KHQA 3LP3A 4M3WA 1CZ9A 2OZSA 1BQMA 3VN5A 4OVLA 3DLRA 2A1SA 2D5RA 3TWHA 2D0BA 3AO1A 3DLKA 3ZSWA 3ULDA 1W0HA 4HTUA 3ZSXA 3DLHA 4O0IA 1FXXA 4DWIA 3KJVA 1VSHA 4HUFA 1SKSA 4LY7A 3OYCA 3LDSA 4HHTA 1ZBLA 1S6PA 4CK1A 1NK8A 3DLEA 4CK3A 1X9MA 3LANA 3VQAA 4DTPA 2HHUA 3CG7A 3S9HA 4ELVA 1ZBIA 3ZSZA 3ZT4A 3HPHA 4CHZA 3VQQA 1TV6A 1WAJA 4W5NA 4FZXC 1J5OA 4M41A 1S9EA 3IAYA 3LAMA 3OYLA 3AVAA 4CJEA 2E4LA 3NE6A 3EY1A 4OKEA 1NJWA 2DFEA 3QNNA 4FZYA 1HRHA 5KRTA 3AO2A 4B9UA 1U49A 3P1GA 4I2PA 2HHSA 1YTUA 4OGEA 4BWMA 3WNHA 1O1WA 5SZTA 4FJ7A 5DMRA 3NF8A 3SJJA 4DQPA 3CFRA 4DF4A 4B3OA 1LAWA 4FLTA 1A5VA 4CGFA 4O55A 4CF2A 4DSIA 4CHQA 1ITGA 3G10A 2DY4A 1KSPA 4NCAA 4OKKA 3SNNA 1SKWA 4CIEA 3OYKA 1KVBA 3LAKA 4CIFA 1UAXA 2IC3A 5FDLA 4CJ3A 3L8BA 4DLEA 1ZYQA 1C6VA 3JYTA 2YNGA 1RDDA 2I5JA 3PV8A 1BI4A 1WN7A 3KK2A 4C8OA 4N76A 4KHUA 4JS5A 1GOAA 2EHGA 5HLFA 5JS1A 2OPRA 1J54A 3AVKA 4N56A 2KZMA 3AVIA 3L3VA 3K59A 1XWLA 3SPZA 5KTQA 2DFFA 3KK3A 3TAFA 5J2PA 4C8LA 4M42A 3HK2A 1IO2A 1Y97A 3T19A 2R7YA 3IG1A 3NF7A 3C6TA 4M3YA 4F3OA 4DS5A 3KD5E 2HW3A 4I2QA 4ZTJA 2PZSA 4E3SA 4QOZB 1BISA 1HYZA 1S1UA 1RBVA 2IGIA 3CYMA 3KLGA 1HJRA 1EP4A 3RMAA 1HMVA 4O0JA 3K58A 2HMIA 3SUQA 3NF6A 2HB5A 3EYZA 4AILC 1KRPA 1U48A 3F9KA 3KK1A 2GBZA 1RT1A 4CHOA 1WSGA 4DTXA 1XC9A 3O3FA 4CEFA 3NBPA 2Y1IA 4JS4A 4YFUA 4EP4A 4JRQA 2KFNA 1HNVA 1JL2A 1HPZA 1RTHA 4CGDA 4FCYA 1QSYA 4ELTA 4HCCA 2HHQA 3NGIA 3PX6A 4CEZA 4XIUA 1W9HA 3B6OA 5HRRA 2E6MA 2FBVA 3CQ8A 4ICLA 3OYNA 1L5UA 2G8KA 1S1TA 4NYFA 2YKMA 4N47A 3PY8A 1SL2A 4Z4CA 1SUQA 3P5JA 4DTJA 5HROA 4WE1A 3AVFA 4I9QA 1RTDA 4CHNA 4BE1A 4F2RA 4DTRA 3TAMA 3QEVA 1REVA 2KFZA 1NK5A 5CYMA 1N6QA 2YHBA 2ETJA 1QSSA 1I3AA 2G8VA 3JSMA 2WOMA 1RT7A 3QLHA 3OS2A 2G8WA 4ELUA 1RTJA 1YVUA 4Q5VA 4F3TA 1NOYA 3HP6A 4M3RA 3HSTB 3O4QA 3L3UA 3NHGA 1RDCA 1VK0A 4B8CA 1TKZA 1NOZA 3VA0A 4KI4A 2DTUA 4OGCA 3NAEA 1NJXA 3OYHA 4FW1A 1TVRA 2ZD1A 3AV9A 2NUBA 4CGHA 4FM1A 3KKSA 3T1AA 4QCLA 2LSNA 3P83D 2XHBA 5CZ1A 4KB1A 1X9WA 4IFVA 3CFOA 4DQIA 2F8SA 4KKOA 1RBUA 3AVNA 3TAEA 4Z4FA 3NDKA 1VRUA 3RMCA 1KCFA 1WSHA 4KV8A 4E19A 3VQCA 1JLBA 5J2NA 1JLEA 4EZ6A 1QSLA 4M45A 5CY4A 4FJ5A 1ASVA 5FROA 4DTOA 3I8DA 1SV5A 1U04A 4CHPA 4B9LA 1T03A 1L3VA 3DI6A 3HPGA 5I42A 3K5OA 2B6AA 4OLBA 1BIUA 3AVCA 5SWMA 3OYDA 5JS2A 1IKYA 3MECA 1ASWA 1BIZA 5KGXA 4HUEA 4BE0A 1WLJA 4CF1A 4EP5A 2VG7A 3RMBA 2ZE2A 3V6DA 3WNGA 1I39A 4CECA 4CCHA 3OVNA 1N5YA 1RDBA 3OYGA 4DTSA 2YKNA 3ZT0A 4ZHRA 4J2AA 4AHRA 2YNIA 1C0TA 4CEEA 4QAGA 2XY6A 3ZSRA 4CESA 3RTVA 4Z0UA 4DQRA 4ID5A 4H4MA 2X78A 1TK5A 1HYSA 4CFAA 3SV3A 3RRHA 1D9FA 3AA5X 3U3YA 4KHNA 4PWDA 3ISNC 1FKOA 4CJLA 3NH0A 3HL8A 3I0RA 3V9UA 3U6FA 4M3TA 3K57A 3V81A 3IRXA 2G8HA 4FJXA 1TKXA 2AJQA 4KO0A 4AHSA 1TK0A 1TKTA 4IDKA 4B9MA 3VQEA 1L3SA 2FBYA 2Z1GA 2F8TA 4RW8A 4CJSA 3S3OA 3VQ5A 4BACA 1BQNA 3K5NA 4FJNA 2PYJA 2WONA 1TKDA 4KTQA 1EXQA 1NK6A 4CK2A 4FJKA 2DFHA 1DTQA 1FKPA 3CM5A 4DSFA 4FJ8A 4I9LA 3CFPA 2B5JA 3AVGA 3ZSQA 1SL1A 3SUPA 3V9XA 4CJKA 3IS9A 3M8QA 5J2MA 1LAVA 3QEIA 3HVTA 2A1RA 4KAZA 2D0AA 4FYDA 1RCHA 4OPJA 4RW7A 2OZMA 3LP2A 1LWEA 3C94A 4FXDA 1JXBA 4W5QA 2D0CA 5DK5A 1S1WA 3PUFA 3L2RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C25 A;  3QET A;  2KW4 A;  4FW2 A;  3MXI A;  1NK0 A;  2YNH A;  4KI6 A;  5D3G A;  2P5G A;  4PA1 A;  1KLM A;  4Y1D A;  3WNE A;  3SQ0 A;  1DTT A;  1NJY A;  4DSL A;  2XRI A;  3TR8 A;  4CJF A;  3RR8 A;  1RT3 A;  3DYA A;  4GMJ B;  4CGG A;  4Q0B A;  3AA3 A;  4FK2 A;  1D8Y A;  3ZSO A;  4FK4 A;  1LWC A;  3C95 A;  3HJF A;  3NCI A;  4Y1C A;  1BHL A;  2IDO A;  4DSE A;  3KKR A;  2JGU A;  4JLH A;  3M8P A;  3OYJ A;  1KLN A;  1JLF A;  3HO1 A;  3L2U A;  4B9N A;  4NCB A;  1KTQ A;  4LSN A;  4CJT A;  2G8U A;  2QXF A;  4CJU A;  2XO7 A;  1IH7 A;  1BCM A;  1VSM A;  4B9T A;  4L8R B;  4DMN A;  5FRN A;  4DFK A;  3KD1 E;  3QEW A;  3SUN A;  4JRP A;  1RT4 A;  1RNH A;  3VQ4 A;  3L2V A;  3PO4 A;  3DOK A;  4NYN A;  4DTM A;  4Z4H A;  3VQP A;  4RW4 A;  4DS4 A;  2KQ2 A;  4CJR A;  2P1J A;  3AVH A;  1L3U A;  4BWJ A;  3L2W A;  5KI6 A;  3VQB A;  3RR7 A;  3OYE A;  2QK9 A;  2QKB A;  4OLA A;  5EU7 A;  2HNZ A;  1U4B A;  3ZT1 A;  4DU1 A;  2XY5 A;  2HVH A;  2E6L A;  4O44 A;  2PY5 A;  3AVJ A;  4CEQ A;  3SYZ A;  4CJ5 A;  2HVI A;  2OPP A;  4DTN A;  1HQE A;  1MU2 A;  3LAL A;  5J1E A;  4HVJ A;  4BE2 A;  4O4G A;  4BDZ A;  4BDP A;  1XHZ A;  1WSI A;  4DU3 A;  3RRG A;  1NJZ A;  1GOB A;  1VSJ A;  3L2Q A;  1S9G A;  3HM9 A;  3OYA A;  4FLZ A;  5I3U A;  4DSJ A;  4BDY A;  1WSJ A;  3LP0 A;  3VQ8 A;  1TGO A;  3OS1 A;  1S5J A;  1CXU A;  3HP9 A;  4GVM A;  4ID1 A;  4E89 A;  4J2B A;  1C1C A;  1A5X A;  5KGW A;  1IKW A;  3SQ2 A;  4CFD A;  4W5T A;  3KLE A;  1TL1 A;  1DLO A;  4OJR A;  3MXM A;  1RDA A;  1Q9Y A;  4DU4 A;  4IKF A;  2VWK A;  1LW2 A;  1ZBU A;  4E7H A;  4FJH A;  4FJ9 A;  4FVM A;  4O5B A;  4PUO A;  3TI0 A;  3M8S A;  3DRS A;  4E7J A;  4W5O A;  4CFB A;  3NH1 A;  3LP1 A;  4CGI A;  4TSX A;  3OJU A;  3O3G A;  1NK7 A;  3AA2 A;  2HHT A;  1JLA A;  1WSE A;  2HHW A;  1GOC A;  1BGX T;  2Z1J A;  4IBN A;  1S1X A;  1A5W A;  4UQG A;  3HPO A;  4N5S A;  3V1Q A;  2EX3 A;  3HXM A;  3QES A;  3V9W A;  1XHX A;  4KB0 A;  4J2D A;  3DMJ A;  1J53 A;  4GW6 A;  1XI1 A;  1KVC A;  2P5O A;  4CEO A;  1QHT A;  4KHY A;  4AHT A;  3NF9 A;  5K14 A;  1ASU A;  1R0A A;  2IOC A;  4AHC A;  1Q9X A;  3SV4 A;  3F73 A;  2HNY A;  3K5M A;  4KHS A;  4HUG A;  3PO5 A;  1B9D A;  1IKV A;  1Q8I A;  1ZBH A;  2ATQ A;  3V4I A;  3KLF A;  5C42 A;  4B9S A;  4CF9 A;  5CZ2 A;  4LD0 A;  1RIL A;  1Z26 A;  3ALY A;  4FLV A;  2JLE A;  1X9S A;  2IAJ A;  3LWM A;  2BE2 A;  4FM0 A;  4DTU A;  3SQ4 A;  3HYF A;  2VWJ A;  3SCX A;  4CE9 A;  4DLG A;  3BGR A;  3TAP A;  4FK0 A;  1U47 A;  3G0Z A;  4FJJ A;  3MEE A;  4EZ9 A;  4DQQ A;  2VG6 A;  4FZZ A;  2X6S A;  4MQ3 A;  2G8I A;  3LPT A;  4FLU A;  4CED A;  3SZ2 A;  3QIN A;  3DLB A;  2QKK A;  3VQ7 A;  2BDP A;  2Q3S A;  3ZT3 A;  3PX0 A;  3KLH A;  4LH5 A;  3ZSY A;  3S3M A;  3NGZ A;  3QO9 A;  3LZI A;  3ZSV A;  1YT3 A;  2ITG A;  2OPS A;  1T05 A;  2Z1I A;  4RW9 A;  2RF2 A;  1BL3 A;  3K2P A;  2P51 A;  4B8A B;  3OYI A;  3K5L A;  4FLY A;  3RWU A;  3QEX A;  2ZQB A;  3RMD A;  1VRT A;  2W42 A;  3ASM A;  1D9D A;  4HCB A;  1C1A A;  4Z4I A;  5FRM A;  1RT6 A;  4LH4 A;  1VSI A;  3D45 A;  4AHU A;  4DFP A;  1B92 A;  1JL1 A;  4AHV A;  3ZT2 A;  2X74 A;  4OKJ A;  4KTW A;  2G8F A;  4M3X A;  1BCO A;  1SKR A;  5E41 A;  1D5A A;  1T7P A;  4E0D A;  3TAB A;  4R5P A;  3FFI A;  1TAQ A;  3MXJ A;  4B08 A;  2RN2 A;  1EET A;  1VSE A;  1EKE A;  2GUI A;  4KTZ A;  3ITH A;  4LSL A;  5HRS A;  4Z4G A;  1ZBF A;  2XY8 A;  4H8K A;  5HBM A;  4F2S A;  1TAU A;  2Y1J A;  3V1O A;  4IFY A;  1RTI A;  1RT5 A;  3MAQ A;  1L3T A;  4CEB A;  4CJV A;  1LW0 A;  3KIO A;  3U3G A;  4CJW A;  4K8X A;  3C6U A;  1NK4 A;  3AO4 A;  3AA4 A;  3PX4 A;  4N41 A;  4E7K A;  3TAR A;  1WSF A;  4CGJ A;  3EZ5 A;  2XY7 A;  4FJL A;  3AVB A;  1JLC A;  3LPU A;  3QER A;  2IS3 A;  1UOC A;  2FC0 A;  3VQD A;  1U45 A;  1NK9 A;  3NFA A;  5HRP A;  3OY9 A;  3O4N A;  4FJI A;  1IKX A;  3E01 A;  1HQU A;  3LZJ A;  4CF8 A;  4FM2 A;  1CXQ A;  4CJQ A;  1IG9 A;  1UA0 A;  1JLQ A;  1C1B A;  4CIG A;  2O4I A;  4YNQ A;  3SI6 A;  4FLX A;  1Z25 A;  4DF8 A;  3DM2 A;  3TAG A;  1YTA A;  2YHA A;  3MEG A;  3TAN A;  4C8N A;  4CER A;  1CLQ A;  4CFC A;  4CEA A;  2OYQ A;  3DOL A;  3M8R A;  3VQ6 A;  3QNO A;  1QS4 A;  2RPI A;  4DSK A;  3I0S A;  4NCG A;  4E7I A;  2FBX A;  4DG1 A;  4KPY A;  2X6N A;  2GV9 A;  1NKB A;  4G1Q A;  2KTQ A;  2OPQ A;  1WAF A;  1T8E A;  2OA8 A;  2O4G A;  4W5R A;  5J2Q A;  1VSL A;  5C24 A;  2HHV A;  4DFJ A;  4C8K A;  1CZB A;  3S3N A;  4PQU A;  4IG0 A;  4H4O A;  1F21 A;  5KRS A;  2KZZ A;  3SQ1 A;  1QQC A;  4C8M A;  1HYV A;  4MFB A;  4RW6 A;  3KTQ A;  4FJM A;  3OYF A;  4PY5 A;  3AVM A;  3THV A;  1EX4 A;  1JLG A;  3A2F A;  3BDP A;  3DLG A;  4CJ4 A;  4E1M A;  3QIO A;  4ZTF A;  3DRP A;  4KHW A;  1SL0 A;  3SUO A;  5HRN A;  4Z4E A;  2BGG A;  4KRE A;  1QE1 A;  2HND A;  1C0M A;  4AH9 A;  1KFD A;  2PYL A;  4OPK A;  1UA1 A;  4K8Z A;  1BI4 B;  3AVL A;  3OYB A;  1S6Q A;  2VG5 A;  2YNF A;  1J9A A;  3CM6 A;  3OJS A;  2HHX A;  1JXE A;  4J2E A;  3V9S A;  1RBS A;  1B9F A;  3HT3 A;  3TAQ A;  1RT2 A;  1LWF A;  3V1R A;  3MED A;  3KLI A;  2RKI A;  3NGY A;  2F96 A;  3WNF A;  5T7B A;  2B4J A;  3O3H A;  3ZCM A;  3HVR A;  3SPY A;  4FJG A;  4KRF A;  4F4K A;  1RBT A;  1JKH A;  4M3U A;  1NKE A;  1TK8 A;  1WNS A;  2FBT A;  4CHY A;  2YV0 X;  3QIP A;  3VA3 A;  1G15 A;  1KVA A;  1HNI A;  4F8R A;  3VQ9 A;  3T3F A;  1TL3 A;  4DQS A;  1NKC A;  4CJP A;  3AO3 A;  1UWB A;  4RG8 A;  3D0P A;  1QTM A;  4IG3 A;  3QEP A;  1VSF A;  2Z1H A;  3LWL A;  1FK9 A;  4I7F A;  3OS0 A;  4KFB A;  5CYQ A;  3NH2 A;  4FLW A;  4DFM A;  4E1N A;  1VSD A;  3UIQ A;  3B6P A;  4E7L A;  1X1P A;  3H08 A;  1VSK A;  2BAN A;  1K6Y A;  3AO5 A;  3DRR A;  3OYM A;  4B9V A;  1RBR A;  3V9Z A;  1S1V A;  5HP1 A;  1KFS A;  4M3Z A;  1LV5 A;  4CF0 A;  1C0U A;  4KHQ A;  3LP3 A;  4M3W A;  1CZ9 A;  2OZS A;  1BQM A;  3VN5 A;  4OVL A;  3DLR A;  2A1S A;  2D5R A;  3TWH A;  2D0B A;  3AO1 A;  3DLK A;  3ZSW A;  3ULD A;  1W0H A;  4HTU A;  3ZSX A;  3DLH A;  4O0I A;  1FXX A;  4DWI A;  3KJV A;  1VSH A;  4HUF A;  1SKS A;  4LY7 A;  3OYC A;  3LDS A;  4HHT A;  1ZBL A;  1S6P A;  4CK1 A;  1NK8 A;  3DLE A;  4CK3 A;  1X9M A;  3LAN A;  3VQA A;  4DTP A;  2HHU A;  3CG7 A;  3S9H A;  4ELV A;  1ZBI A;  3ZSZ A;  3ZT4 A;  3HPH A;  4CHZ A;  3VQQ A;  1TV6 A;  1WAJ A;  4W5N A;  4FZX C;  1J5O A;  4M41 A;  1S9E A;  3IAY A;  3LAM A;  3OYL A;  3AVA A;  4CJE A;  2E4L A;  3NE6 A;  3EY1 A;  4OKE A;  1NJW A;  2DFE A;  3QNN A;  4FZY A;  1HRH A;  5KRT A;  3AO2 A;  4B9U A;  1U49 A;  3P1G A;  4I2P A;  2HHS A;  1YTU A;  4OGE A;  4BWM A;  3WNH A;  1O1W A;  5SZT A;  4FJ7 A;  5DMR A;  3NF8 A;  3SJJ A;  4DQP A;  3CFR A;  4DF4 A;  4B3O A;  1LAW A;  4FLT A;  1A5V A;  4CGF A;  4O55 A;  4CF2 A;  4DSI A;  4CHQ A;  1ITG A;  3G10 A;  2DY4 A;  1KSP A;  4NCA A;  4OKK A;  3SNN A;  1SKW A;  4CIE A;  3OYK A;  1KVB A;  3LAK A;  4CIF A;  1UAX A;  2IC3 A;  5FDL A;  4CJ3 A;  3L8B A;  4DLE A;  1ZYQ A;  1C6V A;  3JYT A;  2YNG A;  1RDD A;  2I5J A;  3PV8 A;  1BI4 A;  1WN7 A;  3KK2 A;  4C8O A;  4N76 A;  4KHU A;  4JS5 A;  1GOA A;  2EHG A;  5HLF A;  5JS1 A;  2OPR A;  1J54 A;  3AVK A;  4N56 A;  2KZM A;  3AVI A;  3L3V A;  3K59 A;  1XWL A;  3SPZ A;  5KTQ A;  2DFF A;  3KK3 A;  3TAF A;  5J2P A;  4C8L A;  4M42 A;  3HK2 A;  1IO2 A;  1Y97 A;  3T19 A;  2R7Y A;  3IG1 A;  3NF7 A;  3C6T A;  4M3Y A;  4F3O A;  4DS5 A;  3KD5 E;  2HW3 A;  4I2Q A;  4ZTJ A;  2PZS A;  4E3S A;  4QOZ B;  1BIS A;  1HYZ A;  1S1U A;  1RBV A;  2IGI A;  3CYM A;  3KLG A;  1HJR A;  1EP4 A;  3RMA A;  1HMV A;  4O0J A;  3K58 A;  2HMI A;  3SUQ A;  3NF6 A;  2HB5 A;  3EYZ A;  4AIL C;  1KRP A;  1U48 A;  3F9K A;  3KK1 A;  2GBZ A;  1RT1 A;  4CHO A;  1WSG A;  4DTX A;  1XC9 A;  3O3F A;  4CEF A;  3NBP A;  2Y1I A;  4JS4 A;  4YFU A;  4EP4 A;  4JRQ A;  2KFN A;  1HNV A;  1JL2 A;  1HPZ A;  1RTH A;  4CGD A;  4FCY A;  1QSY A;  4ELT A;  4HCC A;  2HHQ A;  3NGI A;  3PX6 A;  4CEZ A;  4XIU A;  1W9H A;  3B6O A;  5HRR A;  2E6M A;  2FBV A;  3CQ8 A;  4ICL A;  3OYN A;  1L5U A;  2G8K A;  1S1T A;  4NYF A;  2YKM A;  4N47 A;  3PY8 A;  1SL2 A;  4Z4C A;  1SUQ A;  3P5J A;  4DTJ A;  5HRO A;  4WE1 A;  3AVF A;  4I9Q A;  1RTD A;  4CHN A;  4BE1 A;  4F2R A;  4DTR A;  3TAM A;  3QEV A;  1REV A;  2KFZ A;  1NK5 A;  5CYM A;  1N6Q A;  2YHB A;  2ETJ A;  1QSS A;  1I3A A;  2G8V A;  3JSM A;  2WOM A;  1RT7 A;  3QLH A;  3OS2 A;  2G8W A;  4ELU A;  1RTJ A;  1YVU A;  4Q5V A;  4F3T A;  1NOY A;  3HP6 A;  4M3R A;  3HST B;  3O4Q A;  3L3U A;  3NHG A;  1RDC A;  1VK0 A;  4B8C A;  1TKZ A;  1NOZ A;  3VA0 A;  4KI4 A;  2DTU A;  4OGC A;  3NAE A;  1NJX A;  3OYH A;  4FW1 A;  1TVR A;  2ZD1 A;  3AV9 A;  2NUB A;  4CGH A;  4FM1 A;  3KKS A;  3T1A A;  4QCL A;  2LSN A;  3P83 D;  2XHB A;  5CZ1 A;  4KB1 A;  1X9W A;  4IFV A;  3CFO A;  4DQI A;  2F8S A;  4KKO A;  1RBU A;  3AVN A;  3TAE A;  4Z4F A;  3NDK A;  1VRU A;  3RMC A;  1KCF A;  1WSH A;  4KV8 A;  4E19 A;  3VQC A;  1JLB A;  5J2N A;  1JLE A;  4EZ6 A;  1QSL A;  4M45 A;  5CY4 A;  4FJ5 A;  1ASV A;  5FRO A;  4DTO A;  3I8D A;  1SV5 A;  1U04 A;  4CHP A;  4B9L A;  1T03 A;  1L3V A;  3DI6 A;  3HPG A;  5I42 A;  3K5O A;  2B6A A;  4OLB A;  1BIU A;  3AVC A;  5SWM A;  3OYD A;  5JS2 A;  1IKY A;  3MEC A;  1ASW A;  1BIZ A;  5KGX A;  4HUE A;  4BE0 A;  1WLJ A;  4CF1 A;  4EP5 A;  2VG7 A;  3RMB A;  2ZE2 A;  3V6D A;  3WNG A;  1I39 A;  4CEC A;  4CCH A;  3OVN A;  1N5Y A;  1RDB A;  3OYG A;  4DTS A;  2YKN A;  3ZT0 A;  4ZHR A;  4J2A A;  4AHR A;  2YNI A;  1C0T A;  4CEE A;  4QAG A;  2XY6 A;  3ZSR A;  4CES A;  3RTV A;  4Z0U A;  4DQR A;  4ID5 A;  4H4M A;  2X78 A;  1TK5 A;  1HYS A;  4CFA A;  3SV3 A;  3RRH A;  1D9F A;  3AA5 X;  3U3Y A;  4KHN A;  4PWD A;  3ISN C;  1FKO A;  4CJL A;  3NH0 A;  3HL8 A;  3I0R A;  3V9U A;  3U6F A;  4M3T A;  3K57 A;  3V81 A;  3IRX A;  2G8H A;  4FJX A;  1TKX A;  2AJQ A;  4KO0 A;  4AHS A;  1TK0 A;  1TKT A;  4IDK A;  4B9M A;  3VQE A;  1L3S A;  2FBY A;  2Z1G A;  2F8T A;  4RW8 A;  4CJS A;  3S3O A;  3VQ5 A;  4BAC A;  1BQN A;  3K5N A;  4FJN A;  2PYJ A;  2WON A;  1TKD A;  4KTQ A;  1EXQ A;  1NK6 A;  4CK2 A;  4FJK A;  2DFH A;  1DTQ A;  1FKP A;  3CM5 A;  4DSF A;  4FJ8 A;  4I9L A;  3CFP A;  2B5J A;  3AVG A;  3ZSQ A;  1SL1 A;  3SUP A;  3V9X A;  4CJK A;  3IS9 A;  3M8Q A;  5J2M A;  1LAV A;  3QEI A;  3HVT A;  2A1R A;  4KAZ A;  2D0A A;  4FYD A;  1RCH A;  4OPJ A;  4RW7 A;  2OZM A;  3LP2 A;  1LWE A;  3C94 A;  4FXD A;  1JXB A;  4W5Q A;  2D0C A;  5DK5 A;  1S1W A;  3PUF A;  3L2R A; 
#chains in the Genus database with same CATH topology
 1ATS A;  3WXL A;  2YNH A;  1KLM A;  3BUZ B;  3SQ0 A;  3CME N;  3BF1 A;  5CR4 A;  2H3G X;  4FK4 A;  3ZSO A;  3HJF A;  2V51 B;  3NCI A;  3KKR A;  4YY3 K;  2Q36 A;  1IJJ A;  1K9M O;  4CZF A;  1LCU A;  2CH6 A;  4NCB A;  3TSQ A;  4CJT A;  1U6Z A;  5ELZ A;  3FFK B;  4DFK A;  2V52 B;  1WUA A;  3QEW A;  3SUN A;  2P9U A;  3L4Q A;  3DOK A;  4B1V A;  2FF3 B;  1W2B M;  4DS4 A;  3RSE A;  1S3X A;  1T6C A;  4BR2 A;  1VQL N;  1U4B A;  3ZT1 A;  2HVH A;  4O44 A;  4G9Z A;  1VQ9 N;  5J1E A;  4CJ7 A;  4PKH A;  4FL9 A;  4BR4 A;  4O4G A;  1XHZ A;  1WSI A;  3TSU A;  3L2Q A;  4FLZ A;  3HM9 A;  1WSJ A;  1S5J A;  1CXU A;  1FJG K;  3EO3 A;  4FOI A;  4BC5 A;  3VEY A;  1T6D A;  4DUY K;  4CFD A;  4IKF A;  1Q9Y A;  2CH5 A;  4FVU A;  4DU4 A;  3OHR A;  4PUO A;  1IBL K;  1ZBU A;  1VQ7 N;  3D2E A;  4FVM A;  4O5B A;  2E20 A;  3TI0 A;  3M8S A;  3CCL N;  3DRS A;  1N33 K;  1VQ6 N;  3TU5 A;  4IBN A;  1S1X A;  1A5W A;  4BVO A;  4C23 A;  1SAZ A;  1XHX A;  3O1W A;  3IFR A;  1J53 A;  4GW6 A;  3MCA B;  4FWS A;  1Q86 O;  5K14 A;  1NG9 A;  1ASU A;  1R0A A;  2IOC A;  4AHC A;  4QS9 A;  4K25 A;  4HUG A;  1Q8I A;  2Q0U A;  5C42 A;  2HBK A;  4LD0 A;  2E2Q A;  2NRV A;  1N32 K;  1YIJ N;  1IBM K;  3MEE A;  4JKD A;  4DQQ A;  4FSV A;  4FLU A;  4JI5 K;  4CED A;  3B8A X;  3PX0 A;  3ZSV A;  1E3M A;  3DXM B;  4NXN K;  1VRT A;  2W42 A;  3ASM A;  2UXD K;  4EAH D;  3UKR A;  3O6W A;  1RT6 A;  4LH4 A;  4AHU A;  5BR8 K;  4DFP A;  3CCE N;  4JAX A;  1C0F A;  4AHV A;  3ZT2 A;  3G25 A;  2G8F A;  3VPZ A;  4M3X A;  1BCO A;  3CJ9 A;  3O9Q A;  1SKR A;  3DXK A;  3MDQ A;  2EWS A;  4R5P A;  1X3M A;  2V7Y A;  1ZXO A;  1EET A;  1VSE A;  2YI1 A;  4LSL A;  5HRS A;  5BPM A;  1ZBF A;  2XY8 A;  5HBM A;  2GWK A;  4IFY A;  1RT5 A;  2FSJ A;  3TTF A;  3U3G A;  3GL1 A;  1NK4 A;  2QWO A;  1MDU B;  3PX4 A;  4CGJ A;  2XY7 A;  3AVB A;  3QER A;  3OY9 A;  1XMQ K;  4BR7 A;  2VWB A;  4YNQ A;  3H46 O;  3CC4 N;  3O8M A;  3THY A;  3TAG A;  5KQD A;  3MEG A;  1CLQ A;  2OYQ A;  3DOL A;  1QS4 A;  4E7I A;  1J5E K;  4KPY A;  1OH8 A;  4G1Q A;  1NGE A;  3ID6 A;  5C24 A;  4DR1 K;  3QDK A;  2HHV A;  2QXL A;  1CZB A;  4ISE A;  3VTI A;  3TTD A;  5C15 A;  3FLC O;  1QQC A;  4H0P A;  3KTQ A;  4FJM A;  5F0X A;  3C6H A;  3A2F A;  2FXU A;  3DLG A;  4KHW A;  2O8E A;  1SL0 A;  3UKU B;  2QWQ A;  3E66 A;  3SBG A;  1KFD A;  4FWL A;  2YX6 A;  4K8Z A;  3AVL A;  2RHK A;  2VG5 A;  3OJS A;  1NGI A;  4XEI A;  3V9S A;  1RBS A;  1B9F A;  2VCP A;  3HT3 A;  4B1Z A;  3MED A;  2D0P A;  3KLI A;  5T7B A;  2B4J A;  3ZCM A;  1JKH A;  3NVK A;  1VQM N;  4JI4 K;  3VQ9 A;  4DQS A;  2VYP A;  4CJP A;  3AO3 A;  2FSK A;  1YJW N;  1ILY A;  2Z1H A;  4PKG A;  4KFB A;  4FLW A;  1VSK A;  2BAN A;  3DRR A;  3P31 A;  1OVY A;  4BRG A;  1KFS A;  5HP1 A;  4KH5 A;  1BQM A;  4AM6 A;  4JNE A;  2A1S A;  4GKK K;  2NLX A;  3J7A P;  2ZJQ L;  3WQT A;  4V19 S;  1W0H A;  4HTU A;  3HBT A;  1S22 A;  3LDS A;  1ZBL A;  4CK1 A;  2WFB A;  3CG7 A;  4IXC A;  1WAJ A;  5C0Y A;  2A6A A;  3NE6 A;  3EY1 A;  3AO2 A;  1YTU A;  4BWM A;  1O1W A;  4DQP A;  4FLT A;  1TYQ B;  4DSI A;  4CHQ A;  3THW B;  4A57 A;  2YHW A;  3VTH A;  3SNN A;  5BPL A;  1SKW A;  1UAX A;  1XC3 A;  1ZYQ A;  3PV8 A;  3KK2 A;  4C8O A;  3A5O C;  1GOA A;  2D4W A;  4BGA A;  4WFB L;  3R1X A;  2DFF A;  3KK3 A;  3KHY A;  4BC4 A;  4IZ9 A;  1Y97 A;  2R7Y A;  3KZB A;  3IG1 A;  4LF7 K;  4M63 C;  4M3Y A;  5AFU H;  4I2Q A;  4ZTJ A;  4QOZ B;  4JKF A;  1S1U A;  3QFP A;  4IEI A;  2QTD A;  3SUQ A;  5TKW A;  3F9K A;  2GBZ A;  5GAG P;  1WSG A;  1XC9 A;  5AQR A;  5AZJ B;  4UY8 O;  3H1V X;  4JS4 A;  4JRQ A;  1HNV A;  4FCY A;  3CJ7 A;  4CEZ A;  4IOA L;  3B6O A;  2FBV A;  3OYN A;  2ASO A;  1DEJ A;  2G8K A;  1S1T A;  3PY8 A;  4Z4C A;  1K73 O;  1SUQ A;  4H5T A;  3IKM A;  5AQQ A;  4CVN E;  1YUW A;  4EIA A;  4CHN A;  4BE1 A;  4F2R A;  2GX9 A;  2UYT A;  1N6Q A;  5CYM A;  4CBX A;  5EX5 A;  4KH6 A;  3AAP A;  3HP6 A;  1NOY A;  4DCH A;  3HST B;  1RDC A;  4YOU A;  4E1J A;  4KI4 A;  1OKJ A;  4H5W A;  3OYH A;  4FW1 A;  3AV9 A;  3CC2 N;  5CZ1 A;  4IFV A;  1GLD G;  2OTJ N;  1RBU A;  1BG3 A;  1VRU A;  2YJE A;  1KCF A;  1WSH A;  1BU6 O;  3WUH A;  4JK9 A;  3CET A;  5FRO A;  3Q7C A;  4YOR A;  1P8Z A;  1ZC6 A;  3R3L A;  4B9L A;  1T03 A;  2B6A A;  5JS2 A;  3WEE B;  3WXM B;  4BE0 A;  1WLJ A;  2ZE2 A;  4DV1 K;  3V6D A;  2HF3 A;  1N5Y A;  5KPT A;  3OYG A;  2YKN A;  5IT9 O;  5CHI A;  5BRF A;  4ILG B;  4YDU A;  3ULE B;  4CES A;  4DQR A;  4ID5 A;  2X78 A;  1HYS A;  2P9K A;  3O9S A;  4K43 A;  1NGH A;  3ISN C;  1T44 A;  1FKO A;  4CJL A;  3HL8 A;  4JD2 A;  5AZI A;  5LJV A;  3BEX A;  2E2O A;  2AJQ A;  4IDK A;  1WBD A;  2F8T A;  1BA0 A;  3S3O A;  4NB4 A;  3VQ5 A;  4FWO A;  3VGL A;  2HMP A;  4WQ5 C;  2GEM A;  4FJK A;  5M1P A;  1FKP A;  4EFH A;  5JVG L;  4DHY A;  3G6E N;  4O8U A;  3BP8 A;  4DSF A;  4FJ8 A;  4I9L A;  3CFP A;  3AVG A;  3WQU A;  3V9X A;  3J7Y P;  3IS9 A;  2A1R A;  2NZT A;  1LAV A;  5EVZ A;  1EWQ A;  1HLU A;  2O8D A;  1GLE G;  5AQJ A;  3HOS A;  1KQS M;  5C25 A;  3RVC A;  2KW4 A;  3EE9 A;  3MXI A;  1K8A O;  4KI6 A;  2P5G A;  5F1X A;  3WNE A;  1DTT A;  4DSL A;  2XRI A;  3TR8 A;  4CJF A;  3RR8 A;  4GMJ B;  3DYA A;  4O5F A;  4Q0B A;  5AQH A;  1IV0 A;  3NVM A;  4FK2 A;  1HNZ K;  1LWC A;  3ZX3 A;  2JGU A;  2NRT A;  2W40 A;  3OYJ A;  1JLF A;  3R8E A;  4B9N A;  2G8U A;  2QXF A;  4CJU A;  1IH7 A;  4CW7 B;  4B9T A;  4DMN A;  5FRN A;  1X9J A;  3VEW A;  1RT4 A;  3SJH A;  3WXJ A;  3VQ4 A;  2FLO A;  4H5N A;  2QI2 A;  3VOV A;  4Z94 A;  2WTU A;  5E26 A;  5GIP A;  1NM1 A;  3VQB A;  3RR7 A;  4JV5 K;  2HNZ A;  4DU1 A;  2XY5 A;  3LM2 A;  3AVJ A;  5AQI A;  4CEQ A;  5EOY A;  2OPP A;  5AQX A;  4DTN A;  4HVJ A;  3E1Y A;  4DU3 A;  2FF6 A;  3AGR A;  3OYA A;  1YIT N;  4BDY A;  2J4R A;  3LP0 A;  3EZW A;  2Q31 A;  4GVM A;  4E89 A;  1YXQ A;  4DV4 K;  1IKW A;  2QWM A;  4H03 B;  3KLE A;  5JLF A;  3VET A;  1LW2 A;  3TTC A;  4E7H A;  3EEQ A;  5AR0 A;  4E7J A;  4W5O A;  1NK7 A;  4TSX A;  5FPD A;  2HHT A;  1NNE A;  1BGX T;  3O9T A;  3HPO A;  4C1N I;  4ISF A;  4N5S A;  3HXM A;  4LF5 K;  4KB0 A;  1VQO N;  4IJA A;  1YHQ N;  1KVC A;  4CEO A;  4KHY A;  4A5A A;  4AHT A;  3LDO A;  5LL6 Z;  4IO9 L;  3SV4 A;  3F73 A;  2HNY A;  3K5M A;  4KHS A;  1B9D A;  1IKV A;  2ATQ A;  3V4I A;  3KLF A;  3H6E A;  4EHU A;  4BRK A;  4DUZ K;  4MDA A;  3CCJ N;  4JKB A;  3AAQ A;  4B1W B;  3VF6 A;  3SCX A;  4DLG A;  1KD1 O;  4FK0 A;  3G0Z A;  4FJJ A;  3O08 A;  4EZ9 A;  4MQ3 A;  4CD3 A;  5CE3 A;  2G8I A;  3LPT A;  1LOT B;  3SZ2 A;  3QIN A;  2CGJ A;  4B1Y B;  3ZT3 A;  4LH5 A;  3ZSY A;  3S3M A;  2FSN A;  4DR2 K;  1ESV A;  2I7N A;  3FZK A;  1T05 A;  4RW9 A;  3W0L A;  3RWU A;  3K5L A;  3QEX A;  1D9D A;  4HCB A;  1C1A A;  5FRM A;  1B92 A;  4XH5 A;  5H1S Q;  3HOT A;  4I6M B;  3EKU A;  1D5A A;  1D4X A;  4H0V B;  3FFI A;  3SAF A;  3MXJ A;  4B08 A;  1EKE A;  5ADX A;  1U2V B;  1NGC A;  1TUU A;  4F2S A;  4H5R A;  2Q1N A;  2Y1J A;  3V1O A;  4LFB K;  3O80 A;  3GBT A;  5FLX O;  3MAQ A;  1KAY A;  3UE5 A;  4CEB A;  1L3T A;  3C6U A;  3FR0 A;  3AO4 A;  3D2F B;  1V4T A;  2ZJR L;  4FWR A;  4FJL A;  2IS3 A;  2FC0 A;  3CMA N;  1NK9 A;  1IKX A;  4BRF A;  1UA0 A;  2W6L A;  3C7N B;  3BY5 A;  3SI6 A;  3DM2 A;  1YTA A;  2YHA A;  1YVN A;  4JN4 A;  4C8N A;  4CER A;  3M8R A;  3VQ6 A;  2RPI A;  5E84 A;  4NCG A;  1VQ4 N;  2FBX A;  1JCE A;  2X6N A;  4BR5 A;  2OPQ A;  2OA8 A;  4DQ8 A;  1JCG A;  4JKG B;  1GLF O;  4A59 A;  4JK8 A;  4W5R A;  5GAE P;  4DFJ A;  4PQU A;  4IG0 A;  1F21 A;  4HTL A;  3DLL L;  2KZZ A;  3F2K A;  3SQ1 A;  4RW6 A;  1NU0 A;  1SQK A;  5BPN A;  3BDP A;  4E1M A;  3DRP A;  3JAM O;  4CZE A;  5HRN A;  3HI0 A;  3M1F A;  4Z4E A;  1BUP A;  1QE1 A;  2HND A;  1WBB A;  1BI4 B;  2HOE A;  1S6Q A;  1J9A A;  2HHX A;  2E88 A;  3DXM A;  4CI6 A;  1RT2 A;  2RKI A;  4JK7 A;  3WNF A;  3HVR A;  2UXB K;  1RFQ A;  4M3U A;  2FBT A;  4XH1 A;  1KVA A;  1N34 K;  1HNI A;  4IFE A;  3R6M A;  4IEE A;  3D0P A;  3DJC A;  4IG3 A;  1VSF A;  3U4L A;  3LWL A;  1FK9 A;  5CYQ A;  3NH2 A;  1NGA A;  3VGK A;  1VSD A;  4A2B A;  4CBW A;  3UIQ A;  3H08 A;  1K6Y A;  4PL8 A;  3OYM A;  3H3O B;  4B9V A;  3PSI A;  3V9Z A;  4LF4 K;  5JMV A;  1NBW A;  2P9U B;  1S1V A;  2O8F B;  4CF0 A;  1C0U A;  2D5R A;  3TWH A;  4FOE A;  1HR0 K;  3DLH A;  4KH4 A;  1H1V A;  4O0I A;  1ATR A;  4RWT A;  1SKS A;  1RDW X;  4LY7 A;  4HHT A;  4M7X A;  4CK3 A;  1X9M A;  2HHU A;  4DTP A;  4A61 A;  3ZT4 A;  3SAH A;  3VQQ A;  1TV6 A;  4BRA A;  1EO1 A;  2O8C B;  4M41 A;  3A5M C;  3KVG A;  3OBW A;  4CJE A;  2P9S B;  3MCP A;  4OKE A;  1NJW A;  2DFE A;  4LF9 K;  2F9W A;  3GOI A;  5SZT A;  3CQY A;  1LAW A;  1GLC G;  4CGF A;  3VEN A;  1ITG A;  4JKE A;  4JI2 K;  2ZF5 O;  3SLC A;  4NCA A;  1KVB A;  4WQ4 C;  4CIF A;  5FDL A;  3UKU A;  1RDD A;  2I5J A;  4KBO A;  2VQE K;  3FZM A;  3KK7 A;  1W97 L;  1J54 A;  4N56 A;  3L3V A;  3K59 A;  4MDB A;  1XWL A;  3SPZ A;  5KTQ A;  5J2P A;  4BVP A;  4C8L A;  3CCS N;  3NF7 A;  3KD5 E;  4QS8 A;  3KLG A;  3CYM A;  2IGI A;  3C65 A;  3TPQ A;  1HJR A;  4CZM A;  1EP4 A;  3K58 A;  4DKW A;  2HB5 A;  3EYZ A;  4AIL C;  4CBU A;  4CHO A;  4DTX A;  3FZL A;  4EP4 A;  3QBX A;  1JL2 A;  3M5R A;  5M1N A;  4HCC A;  3NGI A;  4GVE A;  4XIU A;  1W9H A;  4N47 A;  2ZJP L;  5HRO A;  4ILJ A;  4WE1 A;  4I9Q A;  3TAM A;  2UU9 K;  1QSS A;  2G8V A;  4DV6 K;  3JSM A;  1HKG A;  5AQF A;  4BR0 A;  4ELU A;  3OS2 A;  4F3T A;  4Q5V A;  1XQS C;  2P9N B;  4M3R A;  2PAV A;  1BWF O;  3NHG A;  4JKH A;  4OGC A;  3NAE A;  1NJX A;  4FM1 A;  5JIC A;  3KKS A;  1YAG A;  4BRC A;  5AQT A;  4QCL A;  2XHB A;  4KB1 A;  3MN7 A;  3TAE A;  3C6A A;  2CGK A;  4JI7 K;  1BA1 A;  3T1Y K;  3CJ1 A;  1TYQ A;  1VHX A;  3FGU A;  3THW A;  4YOX A;  5J2N A;  2JWL A;  5GAH P;  2D1K A;  4DTO A;  3I8D A;  1SV5 A;  1HKB A;  5I42 A;  3K5O A;  5AQL A;  2F9T A;  4YDU C;  1GLL O;  5AQU A;  3MEC A;  3PLA A;  2KLA A;  5KGX A;  1QVG M;  4JEP A;  2VG7 A;  3ID8 A;  3RMB A;  4CEC A;  2E1Y A;  5BRD A;  4DR4 K;  1C0T A;  1DT9 A;  4GY2 B;  3RTV A;  2VGN A;  4CFA A;  4KHN A;  4M3T A;  1HJO A;  5AZJ A;  3K57 A;  3IRX A;  3PIO L;  2G8H A;  4FJX A;  4KHP K;  5BRE A;  2O8E B;  1TKT A;  1L3S A;  2FBY A;  2Z1G A;  3LDN A;  4CJS A;  1BQN A;  3VEV A;  1TKD A;  1VAZ A;  1EXQ A;  1R59 O;  4BRQ A;  1SL1 A;  2VGM A;  4KAZ A;  3HVT A;  3CD6 N;  2D0A A;  2OZM A;  3LDP A;  2D0C A;  1NGB A;  3LDQ A;  5C2D A;  1JJ2 M;  3QET A;  2ASP A;  4FW2 A;  1KXP A;  1BOT O;  4WQ4 A;  4PA1 A;  1NJY A;  5KPZ A;  4A2A A;  1RT3 A;  3EKS A;  1HUX A;  3C95 A;  5AQY A;  1HNX K;  1KAZ A;  4Y1C A;  1BHL A;  1M1K O;  4JLH A;  3QML A;  1KLN A;  5TKY A;  3WT0 A;  1KTQ A;  2E2N A;  5AQK A;  2XO7 A;  1QQM A;  3P38 A;  3CJC A;  2A41 A;  3KD1 E;  2IVP A;  3MMV A;  4JRP A;  3L2V A;  3PO4 A;  3G71 N;  4NYN A;  4DTM A;  4Z4H A;  3VQP A;  4RW4 A;  3WEE A;  2QWR A;  3BZC A;  2V7Z A;  5IWA K;  1L3U A;  4BWJ A;  2P9I B;  5FPE A;  2QKB A;  4OLA A;  5EU7 A;  3WXK A;  4DV7 K;  3MWP A;  2E6L A;  3ULE A;  2HVI A;  1HQE A;  1MU2 A;  4BDZ A;  4FPB A;  4BG8 A;  3RRG A;  1NGD A;  1VSJ A;  5I3U A;  1TGO A;  3OS1 A;  2GTD A;  3HP9 A;  4J2B A;  1C1C A;  3AY9 A;  1A5X A;  4BRL A;  2RE2 A;  4W5T A;  4OJR A;  1DLO A;  1RDA A;  1QHA A;  1TAU A;  2VWK A;  4DR3 K;  1TUY A;  4NLB A;  3NH1 A;  4CGI A;  3O3G A;  3AA2 A;  3CJB A;  1GOC A;  2Z1J A;  3GDQ A;  3V1Q A;  4B9Q A;  3DMJ A;  1XI1 A;  2P5O A;  1GLJ O;  1RDU A;  3NF9 A;  5AQM A;  3PO5 A;  2P9P B;  4H5V A;  3THX B;  3CXC M;  1RIL A;  5AFU A;  3ALY A;  4FLV A;  1N36 K;  2JLE A;  4X66 K;  3I55 N;  2BE2 A;  4FM0 A;  4DTU A;  2VWJ A;  4CE9 A;  4BRD A;  1NMD A;  1U47 A;  1IBK K;  3CI5 A;  4BC2 A;  4FZZ A;  2VG6 A;  4BC3 A;  3MN9 A;  3QIC A;  4L3Q A;  4H0Y B;  3G4S N;  2KKZ A;  4OPA A;  3CCU N;  2QKK A;  2BDP A;  3NGZ A;  3QO9 A;  2F4V K;  2BTF A;  1YT3 A;  2ITG A;  2Z1I A;  2RF2 A;  1BL3 A;  2P51 A;  3OYI A;  2ZQB A;  4Z4I A;  3CCQ N;  1JL1 A;  2HBJ A;  1YF5 L;  4JI1 K;  1K8K B;  2X74 A;  4OKJ A;  3O9R A;  4R79 A;  2IVN A;  1T7P A;  3TAB A;  3J7Z O;  4KTZ A;  2BUP A;  2IVO A;  2A3Z A;  1Q7Y O;  2UUB K;  1YJ9 N;  4CJV A;  4K8X A;  1MWK A;  3AA4 A;  4N41 A;  3ENB A;  3TAR A;  3LPU A;  1U45 A;  3VQD A;  1MWM A;  3NFA A;  1QVF M;  3E01 A;  4FPA A;  3LZJ A;  1SZ2 A;  4CF8 A;  5LJW A;  1HNW K;  4FM2 A;  4JI0 K;  1C1B A;  4CIG A;  1NGF A;  1Z25 A;  5BN8 A;  3TAN A;  2HBM A;  4DSK A;  1NKB A;  4YOW A;  1EWR A;  1WAF A;  1T8E A;  4BQZ A;  5J2Q A;  1VSL A;  2F7T A;  2P9L B;  3MN5 A;  4Y0W A;  4C8K A;  3S3N A;  3I33 A;  5AQP A;  3F5T A;  4H4O A;  5M1Q A;  3U9D A;  5KRS A;  2A42 A;  4C8M A;  4MFB A;  4X64 K;  1T3V A;  1QZ5 A;  2OTL N;  3QFU A;  4ZTF A;  2PBD A;  3E9L A;  4KRE A;  4AH9 A;  4OPK A;  5FPN A;  4PKI A;  3S41 A;  1LWF A;  5HL7 L;  3NGY A;  2F96 A;  4KRF A;  4FJG A;  3SPY A;  4F4K A;  1RBT A;  3MX5 A;  3VA3 A;  3T1H K;  1G15 A;  2NRH A;  4LFA K;  4I6M A;  1KC8 O;  3T3F A;  1NKC A;  3VGM A;  4O8K A;  3CCV N;  1C0G A;  3F9M A;  1QTM A;  3OS0 A;  5C10 A;  4MO4 A;  4DFM A;  3WXI A;  4E7L A;  4JKA A;  3AO5 A;  2E2P A;  3HRG A;  3ATV A;  3U8X A;  5DM7 L;  5AQN A;  4M3Z A;  1LV5 A;  3D2F A;  3LP3 A;  3W3D A;  1CZ9 A;  4F9O A;  4FO0 A;  2KHO A;  4OVL A;  3DLR A;  3QB0 A;  2VQF K;  2D0B A;  3CHW A;  3VMF B;  4LFC K;  4DWI A;  1FXX A;  4BGB A;  1VSH A;  4HUF A;  3C7N A;  3GE1 A;  5BRH A;  1VQP N;  1S6P A;  1JCF A;  2UUC K;  3O1B A;  1NK8 A;  3LAN A;  3VQA A;  1DGK N;  5KQ8 A;  2QEX N;  1ZBI A;  3HPH A;  4CHZ A;  4W5N A;  4FZX C;  2OCE A;  1J5O A;  4BY9 C;  3IAY A;  3R9P A;  3LAM A;  4M7Y A;  4GKJ K;  2GEL A;  4BRP A;  4JKG A;  3QNN A;  2E1Z A;  5JLH A;  1E4F T;  4IWV A;  3ZEU B;  4JHD B;  3NF8 A;  3SAG A;  2NRW A;  4DF4 A;  4FWM A;  4MLH A;  3ZET B;  1A5V A;  4CF2 A;  2HHH K;  4FWN A;  1BO5 O;  4OKK A;  3OYK A;  3ENH A;  4DB3 A;  2IC3 A;  3N4P A;  3L8B A;  4CJ3 A;  1YI2 N;  4DLE A;  1C6V A;  2YNG A;  1BI4 A;  4IOX A;  4N76 A;  2KZM A;  4JS5 A;  4J8F A;  2OPR A;  4BR9 A;  3AVI A;  1ZBS A;  3TAF A;  5M1O A;  3HK2 A;  2O8B B;  4DR5 K;  5MLC Q;  3T19 A;  2QM1 A;  4RTF D;  4F3O A;  2HW3 A;  2PZS A;  4E3S A;  3A5L C;  1RBV A;  5AQS A;  2HMI A;  4BRO A;  4JI3 K;  5BR9 A;  1Y64 A;  1MA9 B;  3P4I A;  4CEF A;  3NBP A;  1HPZ A;  1RTH A;  3JXU A;  4CGD A;  2GUP A;  4JYA K;  5HRR A;  2WUS A;  3CQ8 A;  1L5U A;  2O8F A;  2YKM A;  4IJN A;  3AVF A;  4DTR A;  3QEV A;  2KFZ A;  2NRX A;  3VEZ A;  1WB9 A;  1I3A A;  3CCM N;  4BRN A;  2WOM A;  1RT7 A;  5LY3 A;  2G8W A;  4H0O A;  1Q18 A;  3O4Q A;  3L3U A;  3K0S A;  2O8C A;  3O9U A;  1TKZ A;  1NOZ A;  4BQL A;  4CZG A;  1EQY A;  2P9S A;  4FWK A;  3OBY A;  3T1A A;  3U9Z A;  3P83 D;  1X9W A;  4DQI A;  3A8Y A;  3AVN A;  5M1F A;  2HBL A;  4GV3 A;  2D0O A;  3M6G A;  4Z4F A;  2HST A;  4KV8 A;  4E19 A;  1P90 A;  2JWK A;  2Q97 A;  1JLE A;  4EZ6 A;  1QSL A;  4FJ5 A;  1ASV A;  2QWN A;  3VES A;  3DAW A;  1XUP O;  3HPG A;  4BRH A;  4YOT A;  4OLB A;  1BIU A;  3CPE A;  3OYD A;  3BF3 A;  3RSE B;  2CGL A;  3I8B A;  3PIP L;  4PL7 A;  5LMU K;  3EN9 A;  4K41 A;  4CCH A;  2DPN A;  1RDB A;  1M90 O;  4DTS A;  3ZT0 A;  4J2A A;  4AHR A;  2YNI A;  4CEE A;  3VF2 A;  3PSF A;  4YOV A;  4QAG A;  3ZSR A;  3LL3 A;  3L4I A;  4Z0U A;  4H4M A;  3SV3 A;  3RRH A;  1D9F A;  3U6F A;  3O5B A;  3V81 A;  1TKX A;  5I9E B;  4WCE L;  4KO0 A;  3SMP A;  4AHS A;  4B9M A;  3FE1 A;  4DR6 K;  3K5N A;  3VEO A;  2PYJ A;  2W6K A;  3K9K A;  3D2E B;  2QW9 A;  3J80 O;  1Q81 O;  1NK6 A;  1DTQ A;  4DV5 K;  3CM5 A;  3HSC A;  4RCH A;  3AAR A;  1NWK A;  2B5J A;  3ZSQ A;  3HZ6 A;  3OTO K;  1I94 K;  2YJF A;  5J2M A;  3QEI A;  4FYD A;  4K0K K;  3MWT A;  4A62 A;  3C94 A;  4FXD A;  4W5Q A;  5M1K A;  2P9N A;  5DK5 A;  1S1W A;  4DS5 A;  3PUF A;  3L2R A;  1NK0 A;  5D3G A;  1YJN N;  4Y1D A;  1NGJ A;  3ZX2 A;  2WBN A;  4CGG A;  3AA3 A;  5FPM A;  1D8Y A;  4H0T B;  4CD1 A;  2IDO A;  4DSE A;  3M8P A;  3HO1 A;  3L2U A;  1Z05 A;  2NRR A;  5A2Q O;  4LSN A;  1BCM A;  1VSM A;  4L8R B;  2ASM A;  1RNH A;  3CER A;  4XH4 A;  4C1N K;  2KQ2 A;  4CJR A;  4X65 K;  2P1J A;  3AVH A;  3UKR B;  3L2W A;  5KI6 A;  3SBT A;  3OYE A;  2QK9 A;  3CQX A;  2YHY A;  3T7Z A;  4U67 L;  2PY5 A;  3SYZ A;  4CJ5 A;  3K9J A;  3DXK B;  3LAL A;  1VQK N;  3IDH A;  2ZGY A;  3VER A;  4BE2 A;  2UUA K;  2AP1 A;  4BDP A;  1QZ6 A;  1NJZ A;  1GOB A;  4DSJ A;  1S9G A;  1VQN N;  1XMO K;  3VQ8 A;  2PFU A;  4ID1 A;  1RGI A;  4ISG A;  5KGW A;  3SQ2 A;  2I7P A;  3MXM A;  1TL1 A;  4FJH A;  4FJ9 A;  5EXW A;  4CFB A;  3OJU A;  3LP1 A;  2YCH A;  1JLA A;  1WSE A;  2HHW A;  3NMU A;  4UQG A;  2E5L K;  2EX3 A;  3QES A;  2Q2R A;  3V9W A;  3THY B;  4J2D A;  3L0Q A;  1QHT A;  4FWQ A;  1OH7 A;  1Q9X A;  3Q7B A;  1ZBH A;  1J6Z A;  4B9S A;  4CF9 A;  5CZ2 A;  1Z26 A;  1SS6 A;  5GIO A;  1X9S A;  2IAJ A;  3E9P A;  2YHX A;  4AM7 A;  3LWM A;  3SQ4 A;  4X62 K;  3HYF A;  3BGR A;  3TAP A;  2X6S A;  2W41 A;  1QQO A;  3BZK A;  3DLB A;  3VQ7 A;  2Q3S A;  3KLH A;  1N8R O;  2OAN A;  3LZI A;  4JKC A;  2OPS A;  3K2P A;  4B8A B;  4FLY A;  1CZA N;  3ZYY X;  3RMD A;  4MO5 A;  1VSI A;  3D45 A;  2P9I A;  4B3R K;  4KTW A;  3CF5 L;  5E41 A;  4E0D A;  1TAQ A;  4WFN L;  2RN2 A;  2GUI A;  2QWL A;  3ITH A;  2HF4 A;  4LF8 K;  4Z4G A;  4B3S K;  4H8K A;  3J8A A;  3ZLJ A;  1RTI A;  1LW0 A;  3KIO A;  5GAD P;  4CJW A;  3O4W A;  4E7K A;  1WSF A;  3EZ5 A;  4IOC L;  4CZK A;  2E8A A;  1JLC A;  3E9O A;  1Q82 O;  4GV6 A;  1UOC A;  4FJI A;  5HRP A;  3O4N A;  1NGG A;  1HQU A;  2AA4 A;  3VEX A;  1CXQ A;  4CJQ A;  1IG9 A;  1JLQ A;  2O4I A;  4FLX A;  4DF8 A;  4AQY K;  4CFC A;  4CEA A;  3LM9 A;  3QNO A;  3M3Z A;  3A0I X;  1OVQ A;  3I0S A;  1O13 A;  4DG1 A;  3CIP A;  4AF1 A;  2GV9 A;  4DV2 K;  3SK3 A;  2KTQ A;  2P9P A;  2O4G A;  3SMS A;  1V4S A;  3THX A;  5GIN A;  5LMN K;  4ILH A;  4MLE A;  1KAX A;  1HYV A;  3OYF A;  4PY5 A;  3AVM A;  3THV A;  1EX4 A;  1JLG A;  4CJ4 A;  3QIO A;  1QQN A;  3SUO A;  1VQ8 N;  2BGG A;  1C0M A;  2PYL A;  1UA1 A;  2ZWH A;  4HWI A;  3OYB A;  3CM6 A;  2YNF A;  1JXE A;  4BRI A;  3MN6 A;  4J2E A;  3EL2 A;  3TAQ A;  4DV0 K;  3V1R A;  3O3H A;  1FW6 A;  3IUC A;  1NKE A;  1G99 A;  1WNS A;  4CHY A;  1TK8 A;  2IIR A;  2YV0 X;  3QIP A;  4F8R A;  1K8K A;  1TL3 A;  1UWB A;  4RG8 A;  4B1X B;  3QEP A;  4WFA L;  4I7F A;  5JVH L;  2A5X A;  4E1N A;  3B6P A;  1X1P A;  3H45 C;  3FZH A;  1XNR K;  1RBR A;  5AQZ A;  1GLA G;  3L6Q A;  4KHQ A;  4M3W A;  3ZX0 A;  4OPH A;  2OZS A;  3VN5 A;  4K42 A;  4IO8 A;  3AO1 A;  3DLK A;  3ENO A;  3ZSW A;  3ULD A;  3ZSX A;  3IMX A;  5F2R A;  3KJV A;  3OYC A;  4PHT X;  3HM8 A;  3DLE A;  4OX9 K;  4NO7 A;  3S9H A;  3JS6 A;  3ZSZ A;  4CZH A;  4ELV A;  4BRE A;  5AQW A;  1S9E A;  3H3N O;  3OYL A;  3AVA A;  2E4L A;  1HX1 A;  4FZY A;  1HRH A;  5KRT A;  4B9U A;  1U49 A;  3P1G A;  4I2P A;  2P9L A;  2HHS A;  4OGE A;  3CCR N;  3WNH A;  1W7A A;  4YOY A;  4FJ7 A;  5DMR A;  5EY4 A;  3SJJ A;  3CFR A;  4B3O A;  4H0X B;  4O55 A;  3G10 A;  2DY4 A;  1KSP A;  3C0B A;  4CIE A;  3D6R A;  3LAK A;  5AQV A;  3EE8 A;  2Q0R A;  4FWP A;  3A5N C;  1OH5 A;  3JYT A;  1OH6 A;  1WN7 A;  4KHU A;  3N4Q A;  2EHG A;  5HLF A;  2NRZ A;  5JS1 A;  5B8H A;  3AVK A;  4CZL A;  4M42 A;  1IO2 A;  3C6T A;  3H1Q A;  1BIS A;  1HYZ A;  2QWP A;  2A40 A;  4WF9 L;  5AQO A;  4QS7 A;  3RMA A;  1HMV A;  4O0J A;  4IDH A;  3NF6 A;  2P9K B;  1KRP A;  1U48 A;  3KK1 A;  1RT1 A;  1BDG A;  1NMN A;  3O3F A;  4JD2 B;  5AZI B;  2Y1I A;  1S72 N;  1XNQ K;  4YFU A;  1HPM A;  1NLV A;  2KFN A;  3LDL A;  2ZGZ A;  1QSY A;  4ELT A;  2HHQ A;  3PX6 A;  2E6M A;  4ICL A;  3CJA A;  4NYF A;  1IG8 A;  1SL2 A;  3P5J A;  4DTJ A;  2UXC K;  1RTD A;  5BN9 A;  5DM6 L;  3VF4 A;  1REV A;  3MK6 A;  4DR7 K;  3HTV A;  2ITM A;  1NK5 A;  5AJ3 K;  2YHB A;  2ETJ A;  2QA4 N;  2O8D B;  3QLH A;  2GWJ A;  1RTJ A;  1YVU A;  4A5B A;  5ADX H;  1VK0 A;  4B8C A;  3VA0 A;  2DTU A;  1DKG D;  1GLB G;  1TVR A;  2ZD1 A;  2NUB A;  4CGH A;  3J81 O;  2LSN A;  2ZM6 K;  2F8S A;  3CFO A;  3ATU A;  4KKO A;  4U7B A;  3ZEU A;  4JHD A;  3NDK A;  3RMC A;  3ZET A;  3VQC A;  1JLB A;  4JI6 K;  1U2V A;  3FZF A;  3OW2 M;  1X3N A;  1HKC A;  4M45 A;  5CY4 A;  1WOQ A;  3TSP A;  4B3M K;  2WC9 A;  4B3T K;  1U04 A;  4CHP A;  4GV9 A;  1L3V A;  3DI6 A;  3AVC A;  4WYB A;  3T69 A;  5SWM A;  3CC7 N;  1IKY A;  3UB5 A;  4EHT A;  3I56 N;  1ASW A;  1BIZ A;  4HUE A;  4CF1 A;  4EP5 A;  3QBW A;  4CZI A;  4NLC A;  2O8B A;  3WNG A;  5HOO A;  1I39 A;  4OO1 J;  3OVN A;  2NNW A;  4ZHR A;  3AGK A;  5KPR A;  3OA9 A;  2XY6 A;  4DV3 K;  4JI8 K;  3GG4 A;  1TK5 A;  3AA5 X;  3U3Y A;  4PWD A;  4LF6 K;  5C12 A;  3NH0 A;  3I0R A;  3V9U A;  3D7E O;  1TK0 A;  1E4G T;  3VQE A;  4CZJ A;  2BH1 A;  4RW8 A;  1VQ5 N;  4BAC A;  4FJN A;  3KWI A;  4NXM K;  2WON A;  4BG9 A;  4KTQ A;  3MX2 A;  3P39 A;  4B1U B;  4CK2 A;  2DFH A;  4BRM A;  5C2F A;  3CPW M;  3DWL A;  3KWG A;  4LC9 B;  4YHH K;  3SUP A;  4CJK A;  3M8Q A;  1ATN A;  5AQG A;  1RCH A;  4OPJ A;  1Z6R A;  4RW7 A;  3LP2 A;  1LWE A;  4GNI A;  1JXB A;  1NJI O;  4WQ5 A; 
#chains in the Genus database with same CATH homology
 5C25 A;  3QET A;  2KW4 A;  4FW2 A;  3MXI A;  1NK0 A;  2YNH A;  4KI6 A;  5D3G A;  2P5G A;  4PA1 A;  1KLM A;  4Y1D A;  3WNE A;  3SQ0 A;  1DTT A;  1NJY A;  4DSL A;  2XRI A;  3TR8 A;  4CJF A;  3RR8 A;  1RT3 A;  3DYA A;  4GMJ B;  4CGG A;  4Q0B A;  3AA3 A;  4FK2 A;  1D8Y A;  3ZSO A;  4FK4 A;  1LWC A;  3C95 A;  3HJF A;  3NCI A;  4Y1C A;  1BHL A;  2IDO A;  4DSE A;  3KKR A;  2JGU A;  4JLH A;  3M8P A;  3OYJ A;  1KLN A;  1JLF A;  3HO1 A;  3L2U A;  4B9N A;  4NCB A;  1KTQ A;  4LSN A;  4CJT A;  2G8U A;  2QXF A;  4CJU A;  2XO7 A;  1IH7 A;  1BCM A;  1VSM A;  4B9T A;  4L8R B;  4DMN A;  5FRN A;  4DFK A;  3KD1 E;  3QEW A;  3SUN A;  4JRP A;  1RT4 A;  1RNH A;  3VQ4 A;  3L2V A;  3PO4 A;  3DOK A;  4NYN A;  4DTM A;  4Z4H A;  3VQP A;  4RW4 A;  4DS4 A;  2KQ2 A;  4CJR A;  2P1J A;  3AVH A;  1L3U A;  4BWJ A;  3L2W A;  5KI6 A;  3VQB A;  3RR7 A;  3OYE A;  2QK9 A;  2QKB A;  4OLA A;  5EU7 A;  2HNZ A;  1U4B A;  3ZT1 A;  4DU1 A;  2XY5 A;  2HVH A;  2E6L A;  4O44 A;  2PY5 A;  3AVJ A;  4CEQ A;  3SYZ A;  4CJ5 A;  2HVI A;  2OPP A;  4DTN A;  1HQE A;  1MU2 A;  3LAL A;  5J1E A;  4HVJ A;  4BE2 A;  4O4G A;  4BDZ A;  4BDP A;  1XHZ A;  1WSI A;  4DU3 A;  3RRG A;  1NJZ A;  1GOB A;  1VSJ A;  3L2Q A;  1S9G A;  3HM9 A;  3OYA A;  4FLZ A;  5I3U A;  4DSJ A;  4BDY A;  1WSJ A;  3LP0 A;  3VQ8 A;  1TGO A;  3OS1 A;  1S5J A;  1CXU A;  3HP9 A;  4GVM A;  4ID1 A;  4E89 A;  4J2B A;  1C1C A;  1A5X A;  5KGW A;  1IKW A;  3SQ2 A;  4CFD A;  4W5T A;  3KLE A;  1TL1 A;  1DLO A;  4OJR A;  3MXM A;  1RDA A;  1Q9Y A;  4DU4 A;  4IKF A;  2VWK A;  1LW2 A;  1ZBU A;  4E7H A;  4FJH A;  4FJ9 A;  4FVM A;  4O5B A;  4PUO A;  3TI0 A;  3M8S A;  3DRS A;  4E7J A;  4W5O A;  4CFB A;  3NH1 A;  3LP1 A;  4CGI A;  4TSX A;  3OJU A;  3O3G A;  1NK7 A;  3AA2 A;  2HHT A;  1JLA A;  1WSE A;  2HHW A;  1GOC A;  1BGX T;  2Z1J A;  4IBN A;  1S1X A;  1A5W A;  4UQG A;  3HPO A;  4N5S A;  3V1Q A;  2EX3 A;  3HXM A;  3QES A;  3V9W A;  1XHX A;  4KB0 A;  4J2D A;  3DMJ A;  1J53 A;  4GW6 A;  1XI1 A;  1KVC A;  2P5O A;  4CEO A;  1QHT A;  4KHY A;  4AHT A;  3NF9 A;  5K14 A;  1ASU A;  1R0A A;  2IOC A;  4AHC A;  1Q9X A;  3SV4 A;  3F73 A;  2HNY A;  3K5M A;  4KHS A;  4HUG A;  3PO5 A;  1B9D A;  1IKV A;  1Q8I A;  1ZBH A;  2ATQ A;  3V4I A;  3KLF A;  5C42 A;  4B9S A;  4CF9 A;  5CZ2 A;  4LD0 A;  1RIL A;  1Z26 A;  3ALY A;  4FLV A;  2JLE A;  1X9S A;  2IAJ A;  3LWM A;  2BE2 A;  4FM0 A;  4DTU A;  3SQ4 A;  3HYF A;  2VWJ A;  3SCX A;  4CE9 A;  4DLG A;  3BGR A;  3TAP A;  4FK0 A;  1U47 A;  3G0Z A;  4FJJ A;  3MEE A;  4EZ9 A;  4DQQ A;  2VG6 A;  4FZZ A;  2X6S A;  4MQ3 A;  2G8I A;  3LPT A;  4FLU A;  4CED A;  3SZ2 A;  3QIN A;  3DLB A;  2QKK A;  3VQ7 A;  2BDP A;  2Q3S A;  3ZT3 A;  3PX0 A;  3KLH A;  4LH5 A;  3ZSY A;  3S3M A;  3NGZ A;  3QO9 A;  3LZI A;  3ZSV A;  1YT3 A;  2ITG A;  2OPS A;  1T05 A;  2Z1I A;  4RW9 A;  2RF2 A;  1BL3 A;  3K2P A;  2P51 A;  4B8A B;  3OYI A;  3K5L A;  4FLY A;  3RWU A;  3QEX A;  2ZQB A;  3RMD A;  1VRT A;  2W42 A;  3ASM A;  1D9D A;  4HCB A;  1C1A A;  4Z4I A;  5FRM A;  1RT6 A;  4LH4 A;  1VSI A;  3D45 A;  4AHU A;  4DFP A;  1B92 A;  1JL1 A;  4AHV A;  3ZT2 A;  2X74 A;  4OKJ A;  4KTW A;  2G8F A;  4M3X A;  1BCO A;  1SKR A;  5E41 A;  1D5A A;  1T7P A;  4E0D A;  3TAB A;  4R5P A;  3FFI A;  1TAQ A;  3MXJ A;  4B08 A;  2RN2 A;  1EET A;  1VSE A;  1EKE A;  2GUI A;  4KTZ A;  3ITH A;  4LSL A;  5HRS A;  4Z4G A;  1ZBF A;  2XY8 A;  4H8K A;  5HBM A;  4F2S A;  1TAU A;  2Y1J A;  3V1O A;  4IFY A;  1RTI A;  1RT5 A;  3MAQ A;  1L3T A;  4CEB A;  4CJV A;  1LW0 A;  3KIO A;  3U3G A;  4CJW A;  4K8X A;  3C6U A;  1NK4 A;  3AO4 A;  3AA4 A;  3PX4 A;  4N41 A;  4E7K A;  3TAR A;  1WSF A;  4CGJ A;  3EZ5 A;  2XY7 A;  4FJL A;  3AVB A;  1JLC A;  3LPU A;  3QER A;  2IS3 A;  1UOC A;  2FC0 A;  3VQD A;  1U45 A;  1NK9 A;  3NFA A;  5HRP A;  3OY9 A;  3O4N A;  4FJI A;  1IKX A;  3E01 A;  1HQU A;  3LZJ A;  4CF8 A;  4FM2 A;  1CXQ A;  4CJQ A;  1IG9 A;  1UA0 A;  1JLQ A;  1C1B A;  4CIG A;  2O4I A;  4YNQ A;  3SI6 A;  4FLX A;  1Z25 A;  4DF8 A;  3DM2 A;  3TAG A;  1YTA A;  2YHA A;  3MEG A;  3TAN A;  4C8N A;  4CER A;  1CLQ A;  4CFC A;  4CEA A;  2OYQ A;  3DOL A;  3M8R A;  3VQ6 A;  3QNO A;  1QS4 A;  2RPI A;  4DSK A;  3I0S A;  4NCG A;  4E7I A;  2FBX A;  4DG1 A;  4KPY A;  2X6N A;  2GV9 A;  1NKB A;  4G1Q A;  2KTQ A;  2OPQ A;  1WAF A;  1T8E A;  2OA8 A;  2O4G A;  4W5R A;  5J2Q A;  1VSL A;  5C24 A;  2HHV A;  4DFJ A;  4C8K A;  1CZB A;  3S3N A;  4PQU A;  4IG0 A;  4H4O A;  1F21 A;  5KRS A;  2KZZ A;  3SQ1 A;  1QQC A;  4C8M A;  1HYV A;  4MFB A;  4RW6 A;  3KTQ A;  4FJM A;  3OYF A;  4PY5 A;  3AVM A;  3THV A;  1EX4 A;  1JLG A;  3A2F A;  3BDP A;  3DLG A;  4CJ4 A;  4E1M A;  3QIO A;  4ZTF A;  3DRP A;  4KHW A;  1SL0 A;  3SUO A;  5HRN A;  4Z4E A;  2BGG A;  4KRE A;  1QE1 A;  2HND A;  1C0M A;  4AH9 A;  1KFD A;  2PYL A;  4OPK A;  1UA1 A;  4K8Z A;  1BI4 B;  3AVL A;  3OYB A;  1S6Q A;  2VG5 A;  2YNF A;  1J9A A;  3CM6 A;  3OJS A;  2HHX A;  1JXE A;  4J2E A;  3V9S A;  1RBS A;  1B9F A;  3HT3 A;  3TAQ A;  1RT2 A;  1LWF A;  3V1R A;  3MED A;  3KLI A;  2RKI A;  3NGY A;  2F96 A;  3WNF A;  5T7B A;  2B4J A;  3O3H A;  3ZCM A;  3HVR A;  3SPY A;  4FJG A;  4KRF A;  4F4K A;  1RBT A;  1JKH A;  4M3U A;  1NKE A;  1TK8 A;  1WNS A;  2FBT A;  4CHY A;  2YV0 X;  3QIP A;  3VA3 A;  1G15 A;  1KVA A;  1HNI A;  4F8R A;  3VQ9 A;  3T3F A;  1TL3 A;  4DQS A;  1NKC A;  4CJP A;  3AO3 A;  1UWB A;  4RG8 A;  3D0P A;  1QTM A;  4IG3 A;  3QEP A;  1VSF A;  2Z1H A;  3LWL A;  1FK9 A;  4I7F A;  3OS0 A;  4KFB A;  5CYQ A;  3NH2 A;  4FLW A;  4DFM A;  4E1N A;  1VSD A;  3UIQ A;  3B6P A;  4E7L A;  1X1P A;  3H08 A;  1VSK A;  2BAN A;  1K6Y A;  3AO5 A;  3DRR A;  3OYM A;  4B9V A;  1RBR A;  3V9Z A;  1S1V A;  5HP1 A;  1KFS A;  4M3Z A;  1LV5 A;  4CF0 A;  1C0U A;  4KHQ A;  3LP3 A;  4M3W A;  1CZ9 A;  2OZS A;  1BQM A;  3VN5 A;  4OVL A;  3DLR A;  2A1S A;  2D5R A;  3TWH A;  2D0B A;  3AO1 A;  3DLK A;  3ZSW A;  3ULD A;  1W0H A;  4HTU A;  3ZSX A;  3DLH A;  4O0I A;  1FXX A;  4DWI A;  3KJV A;  1VSH A;  4HUF A;  1SKS A;  4LY7 A;  3OYC A;  3LDS A;  4HHT A;  1ZBL A;  1S6P A;  4CK1 A;  1NK8 A;  3DLE A;  4CK3 A;  1X9M A;  3LAN A;  3VQA A;  4DTP A;  2HHU A;  3CG7 A;  3S9H A;  4ELV A;  1ZBI A;  3ZSZ A;  3ZT4 A;  3HPH A;  4CHZ A;  3VQQ A;  1TV6 A;  1WAJ A;  4W5N A;  4FZX C;  1J5O A;  4M41 A;  1S9E A;  3IAY A;  3LAM A;  3OYL A;  3AVA A;  4CJE A;  2E4L A;  3NE6 A;  3EY1 A;  4OKE A;  1NJW A;  2DFE A;  3QNN A;  4FZY A;  1HRH A;  5KRT A;  3AO2 A;  4B9U A;  1U49 A;  3P1G A;  4I2P A;  2HHS A;  1YTU A;  4OGE A;  4BWM A;  3WNH A;  1O1W A;  5SZT A;  4FJ7 A;  5DMR A;  3NF8 A;  3SJJ A;  4DQP A;  3CFR A;  4DF4 A;  4B3O A;  1LAW A;  4FLT A;  1A5V A;  4CGF A;  4O55 A;  4CF2 A;  4DSI A;  4CHQ A;  1ITG A;  3G10 A;  2DY4 A;  1KSP A;  4NCA A;  4OKK A;  3SNN A;  1SKW A;  4CIE A;  3OYK A;  1KVB A;  3LAK A;  4CIF A;  1UAX A;  2IC3 A;  5FDL A;  4CJ3 A;  3L8B A;  4DLE A;  1ZYQ A;  1C6V A;  3JYT A;  2YNG A;  1RDD A;  2I5J A;  3PV8 A;  1BI4 A;  1WN7 A;  3KK2 A;  4C8O A;  4N76 A;  4KHU A;  4JS5 A;  1GOA A;  2EHG A;  5HLF A;  5JS1 A;  2OPR A;  1J54 A;  3AVK A;  4N56 A;  2KZM A;  3AVI A;  3L3V A;  3K59 A;  1XWL A;  3SPZ A;  5KTQ A;  2DFF A;  3KK3 A;  3TAF A;  5J2P A;  4C8L A;  4M42 A;  3HK2 A;  1IO2 A;  1Y97 A;  3T19 A;  2R7Y A;  3IG1 A;  3NF7 A;  3C6T A;  4M3Y A;  4F3O A;  4DS5 A;  3KD5 E;  2HW3 A;  4I2Q A;  4ZTJ A;  2PZS A;  4E3S A;  4QOZ B;  1BIS A;  1HYZ A;  1S1U A;  1RBV A;  2IGI A;  3CYM A;  3KLG A;  1HJR A;  1EP4 A;  3RMA A;  1HMV A;  4O0J A;  3K58 A;  2HMI A;  3SUQ A;  3NF6 A;  2HB5 A;  3EYZ A;  4AIL C;  1KRP A;  1U48 A;  3F9K A;  3KK1 A;  2GBZ A;  1RT1 A;  4CHO A;  1WSG A;  4DTX A;  1XC9 A;  3O3F A;  4CEF A;  3NBP A;  2Y1I A;  4JS4 A;  4YFU A;  4EP4 A;  4JRQ A;  2KFN A;  1HNV A;  1JL2 A;  1HPZ A;  1RTH A;  4CGD A;  4FCY A;  1QSY A;  4ELT A;  4HCC A;  2HHQ A;  3NGI A;  3PX6 A;  4CEZ A;  4XIU A;  1W9H A;  3B6O A;  5HRR A;  2E6M A;  2FBV A;  3CQ8 A;  4ICL A;  3OYN A;  1L5U A;  2G8K A;  1S1T A;  4NYF A;  2YKM A;  4N47 A;  3PY8 A;  1SL2 A;  4Z4C A;  1SUQ A;  3P5J A;  4DTJ A;  5HRO A;  4WE1 A;  3AVF A;  4I9Q A;  1RTD A;  4CHN A;  4BE1 A;  4F2R A;  4DTR A;  3TAM A;  3QEV A;  1REV A;  2KFZ A;  1NK5 A;  5CYM A;  1N6Q A;  2YHB A;  2ETJ A;  1QSS A;  1I3A A;  2G8V A;  3JSM A;  2WOM A;  1RT7 A;  3QLH A;  3OS2 A;  2G8W A;  4ELU A;  1RTJ A;  1YVU A;  4Q5V A;  4F3T A;  1NOY A;  3HP6 A;  4M3R A;  3HST B;  3O4Q A;  3L3U A;  3NHG A;  1RDC A;  1VK0 A;  4B8C A;  1TKZ A;  1NOZ A;  3VA0 A;  4KI4 A;  2DTU A;  4OGC A;  3NAE A;  1NJX A;  3OYH A;  4FW1 A;  1TVR A;  2ZD1 A;  3AV9 A;  2NUB A;  4CGH A;  4FM1 A;  3KKS A;  3T1A A;  4QCL A;  2LSN A;  3P83 D;  2XHB A;  5CZ1 A;  4KB1 A;  1X9W A;  4IFV A;  3CFO A;  4DQI A;  2F8S A;  4KKO A;  1RBU A;  3AVN A;  3TAE A;  4Z4F A;  3NDK A;  1VRU A;  3RMC A;  1KCF A;  1WSH A;  4KV8 A;  4E19 A;  3VQC A;  1JLB A;  5J2N A;  1JLE A;  4EZ6 A;  1QSL A;  4M45 A;  5CY4 A;  4FJ5 A;  1ASV A;  5FRO A;  4DTO A;  3I8D A;  1SV5 A;  1U04 A;  4CHP A;  4B9L A;  1T03 A;  1L3V A;  3DI6 A;  3HPG A;  5I42 A;  3K5O A;  2B6A A;  4OLB A;  1BIU A;  3AVC A;  5SWM A;  3OYD A;  5JS2 A;  1IKY A;  3MEC A;  1ASW A;  1BIZ A;  5KGX A;  4HUE A;  4BE0 A;  1WLJ A;  4CF1 A;  4EP5 A;  2VG7 A;  3RMB A;  2ZE2 A;  3V6D A;  3WNG A;  1I39 A;  4CEC A;  4CCH A;  3OVN A;  1N5Y A;  1RDB A;  3OYG A;  4DTS A;  2YKN A;  3ZT0 A;  4ZHR A;  4J2A A;  4AHR A;  2YNI A;  1C0T A;  4CEE A;  4QAG A;  2XY6 A;  3ZSR A;  4CES A;  3RTV A;  4Z0U A;  4DQR A;  4ID5 A;  4H4M A;  2X78 A;  1TK5 A;  1HYS A;  4CFA A;  3SV3 A;  3RRH A;  1D9F A;  3AA5 X;  3U3Y A;  4KHN A;  4PWD A;  3ISN C;  1FKO A;  4CJL A;  3NH0 A;  3HL8 A;  3I0R A;  3V9U A;  3U6F A;  4M3T A;  3K57 A;  3V81 A;  3IRX A;  2G8H A;  4FJX A;  1TKX A;  2AJQ A;  4KO0 A;  4AHS A;  1TK0 A;  1TKT A;  4IDK A;  4B9M A;  3VQE A;  1L3S A;  2FBY A;  2Z1G A;  2F8T A;  4RW8 A;  4CJS A;  3S3O A;  3VQ5 A;  4BAC A;  1BQN A;  3K5N A;  4FJN A;  2PYJ A;  2WON A;  1TKD A;  4KTQ A;  1EXQ A;  1NK6 A;  4CK2 A;  4FJK A;  2DFH A;  1DTQ A;  1FKP A;  3CM5 A;  4DSF A;  4FJ8 A;  4I9L A;  3CFP A;  2B5J A;  3AVG A;  3ZSQ A;  1SL1 A;  3SUP A;  3V9X A;  4CJK A;  3IS9 A;  3M8Q A;  5J2M A;  1LAV A;  3QEI A;  3HVT A;  2A1R A;  4KAZ A;  2D0A A;  4FYD A;  1RCH A;  4OPJ A;  4RW7 A;  2OZM A;  3LP2 A;  1LWE A;  3C94 A;  4FXD A;  1JXB A;  4W5Q A;  2D0C A;  5DK5 A;  1S1W A;  3PUF A;  3L2R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...