2D5RA

Crystal structure of a tob-hcaf1 complex
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
252
structure length
252
Chain Sequence
RICEVWACNLDEEMKKIRQVIRKYNYVAMDTEFPGVVARPIGEFRSNADYQYQLLRCNVDLLKIIQLGLTFMNEQGEYPPGTSTWQFNFKFNLTEDMYAQDSIELLTTSGIQFKKHEEEGIETQYFAELLMTSGVVLCEGVKWLSFHSGYDFGYLIKILTNSNLPEEELDFFEILRLFFPVIYDVKYLMKSCKNLKGGLQEVAEQLELERIGPQHQAGSDSLLTGMAFFKMREMFFEDHIDDAKYCGHLYGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the antiproliferative activity of the Tob-hCaf1 complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords CCR4-NOT transcription complex subunit 7
total genus 82
structure length 252
sequence length 252
ec nomenclature ec 3.1.13.4: Poly(A)-specific ribonuclease.
pdb deposition date 2005-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04857 CAF1 CAF1 family ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2d5rA00
4PQUA 2FBTA 3DLHA 4Y1DA 1EX4A 1RT4A 5KRTA 3KLEA 3TANA 4CGDA 2IOCA 4RW7A 1S1VA 2Z1HA 1RILA 1W9HA 5KGXA 3OYLA 3SUNA 3VA3A 1FKPA 2FBXA 4ID1A 3QEIA 1TKZA 4W5QA 4M41A 1K6YA 4H4MA 1A5VA 4O5BA 2E4LA 2RPIA 4FCYA 3TAQA 1J54A 2A1SA 4G1QA 2OA8A 4C8MA 3V4IA 1ITGA 4M3ZA 3HVTA 3KK2A 2B5JA 2I5JA 3L2RA 4DWIA 4DU1A 3LDSA 2IS3A 4KTZA 1LAVA 3MEDA 3ZCMA 4M45A 1UOCA 2GBZA 3AO2A 1IKWA 1S1TA 1VSJA 2QXFA 4OKEA 4CK2A 4TSXA 1HQUA 2YV0X 3HVRA 2YHAA 4XIUA 3OYFA 5FDLA 5EU7A 3SV3A 3T3FA 3T19A 4B9SA 3C6UA 5DMRA 2VG7A 1XHZA 1C1BA 1JXEA 2HNZA 3V81A 3PX6A 4FW2A 3F9KA 3IS9A 3L2WA 4Z4IA 3TAMA 4DTPA 1D9DA 3AO1A 3PV8A 4DFJA 4PWDA 2ZE2A 1U47A 2KZZA 2EHGA 1QHTA 2IC3A 2YNIA 4HUFA 3SYZA 1IKVA 3QIOA 4E0DA 3KKSA 4CF2A 1RCHA 2OPQA 3AA3A 1L3SA 1ZBUA 1JLBA 3VQ7A 3B6OA 5E41A 1RT1A 3LPTA 3O4NA 3S3NA 1CZ9A 3ZT1A 1VRUA 3D45A 2ETJA 3OYNA 4FLTA 4PY5A 3ITHA 2VG5A 1C1AA 1NK8A 3C6TA 3NF6A 4CJ4A 3PO4A 4DQIA 1VSEA 4OKJA 3IRXA 3KD1E 1HYZA 3TWHA 2VWKA 1VK0A 4DTXA 3VQ6A 4RG8A 4FM0A 2WONA 4Z4EA 4E7IA 2YNFA 1J9AA 2QK9A 1WSHA 3UIQA 3OS1A 3G10A 4FJGA 4KAZA 1MU2A 3KTQA 1B9DA 4CEEA 3SJJA 3RMBA 1G15A 4CHNA 2JLEA 2G8KA 4I7FA 1IH7A 4CF1A 1GOCA 1JLCA 4KHYA 4KV8A 4FJ5A 2KFNA 3SV4A 3ZSWA 4B9LA 4FJNA 1BIUA 3QO9A 3M8PA 1HPZA 1REVA 1WN7A 1NJXA 3TAFA 3EZ5A 3AVCA 1ASUA 1QSYA 4CFDA 4Z4GA 1TGOA 3QNOA 4DSKA 2P5GA 4C8OA 4B8CA 1U45A 3K2PA 3OYEA 4CF8A 3K59A 4DQRA 3SCXA 1UAXA 1CXQA 4I2PA 3QEVA 3SQ0A 2PYJA 4J2EA 2X6NA 4UQGA 4B3OA 3LANA 1QSSA 3HP9A 4JS4A 3AA5X 5J2PA 2AJQA 3MXMA 4FVMA 5CYMA 3K58A 1LWCA 2XY8A 3OJUA 3ZT0A 1CZBA 1L3UA 4FM2A 1RDAA 3EYZA 3MXIA 1QS4A 1SKRA 3AO5A 5SZTA 3QEXA 4Z4CA 1LWEA 4FLUA 4FZYA 4CGJA 4B8AB 2X78A 1NK9A 4K8XA 3V6DA 4MFBA 1KCFA 4IG3A 4KHQA 1TK8A 3I0SA 4LY7A 3LZIA 3AO3A 1WSIA 3NHGA 3BGRA 3HXMA 5CY4A 1YTAA 2EX3A 1U04A 4CIGA 1ZBFA 5I42A 4ZTJA 4B9UA 4AHTA 3LP2A 5HROA 1RBUA 2FBVA 3ZSOA 3AO4A 5C24A 4CJ5A 4N56A 2XO7A 3OY9A 4FLZA 4DQQA 4CK1A 4CGHA 5C25A 1BI4A 3KLFA 1BISA 1BQMA 4E1MA 1YVUA 3PUFA 1EXQA 3LP3A 1SV5A 4CHQA 4KFBA 5HRPA 1NK0A 4CGIA 4B9NA 1JL1A 1ASWA 4C8NA 3ZSZA 3V9WA 1BIZA 4CJEA 3LWLA 3K5MA 4DQSA 1T8EA 4KHWA 1B9FA 3HM9A 3MEGA 2D0CA 4N47A 4FJJA 4ZHRA 4DF8A 1F21A 1RT5A 4CGGA 2P1JA 4Q0BA 1S5JA 3DOLA 1WAFA 3P1GA 4KB1A 2O4GA 2X74A 3AVGA 3VQDA 1RTDA 3PY8A 4DS4A 3LP0A 1SL2A 1DTTA 2P5OA 1S1WA 3CFRA 4IDKA 4DTRA 2QKBA 1KVBA 1D9FA 2RF2A 4DMNA 2G8FA 3WNGA 4CFCA 3CQ8A 2VWJA 4IKFA 3DLKA 2XHBA 2BDPA 1NK7A 4CEQA 4DQPA 4OKKA 2OZMA 3TARA 3AA2A 3TR8A 3ZT3A 3BDPA 4EP5A 4N41A 3THVA 3SQ4A 4F3TA 4DU3A 1VSFA 3QIPA 4LH5A 4CJSA 2HMIA 2KTQA 1T7PA 1A5XA 4BWJA 3V1OA 3QNNA 3NGYA 3SI6A 3SQ1A 1YT3A 3NF7A 4KTQA 1KVCA 1LW2A 4QCLA 2B6AA 3L3VA 4CEOA 2G8HA 3QEWA 1Q9YA 4CHYA 4DSFA 3SUPA 4AH9A 2YNGA 4W5OA 1L5UA 1JXBA 4M3YA 2BANA 1WAJA 2KFZA 3RRGA 4BE2A 4OLAA 3TI0A 4DSEA 5KTQA 1Y97A 4BDPA 1NJYA 1N5YA 1RBTA 1L3VA 2HHXA 2D0BA 4N76A 1WSGA 5FRNA 4GW6A 1X9WA 3RWUA 2KQ2A 4AHVA 4E7LA 4DF4A 4J2DA 1Q9XA 1XWLA 4CJQA 3HPOA 4JRPA 3U3YA 5KGWA 4H8KA 3DLGA 4OVLA 4HUEA 3ULDA 2B4JA 4CJWA 3VQPA 3O3GA 3KIOA 1I3AA 1O1WA 3PX4A 1JLEA 3ZT4A 1J53A 4WE1A 3V1QA 3V9UA 5FRMA 4FK2A 1C0UA 2X6SA 4F4KA 4BDYA 2PY5A 3L2QA 2XY6A 3SUOA 2G8VA 4F2SA 4OPJA 4DFPA 4HVJA 1HRHA 2IDOA 4CIFA 5HP1A 1NK6A 1NOYA 4Q5VA 3S9HA 2HNYA 1SL1A 3PO5A 2HVIA 4CJKA 2DY4A 4I2QA 4HUGA 1KLMA 4LD0A 2Z1JA 2DFEA 1DTQA 1NK4A 4C8KA 4YNQA 1RTIA 1RDCA 3IAYA 2YNHA 3FFIA 4M3WA 3QINA 2OZSA 1BI4B 3RRHA 1ZYQA 3QLHA 1BGXT 4J2BA 2BGGA 2D5RA 1XC9A 3VQ8A 3OYBA 3I8DA 4FJXA 3HT3A 1KLNA 1S1XA 3U6FA 1QTMA 4B9TA 2GV9A 2PYLA 1EETA 3V9ZA 1KRPA 3NCIA 4OJRA 1C1CA 4CHPA 3KLGA 1VSIA 1JL2A 1ZBLA 4W5RA 4DSJA 3B6PA 3V9SA 2GUIA 5DK5A 4CJUA 4CHOA 4HCCA 2HHWA 1D8YA 4NCAA 4ELVA 4PUOA 4DTSA 2P51A 3TAEA 3VQAA 4CJRA 1HYVA 4IFYA 5J2QA 1NOZA 4F2RA 4KHNA 1YTUA 3RR8A 2DFFA 3VQ4A 4CK3A 1C0TA 3OYKA 4NYFA 1LWFA 2YKNA 3O3HA 1SL0A 3K5LA 5HRSA 3AVHA 5J1EA 3MAQA 4EP4A 1TKDA 2DFHA 2E6MA 5JS2A 4CESA 4IFVA 4FLWA 3M8QA 4CF0A 1U4BA 1S1UA 1RTHA 4CEDA 3NE6A 2QKKA 4KI4A 3LAMA 1LV5A 2XRIA 5KRSA 4OLBA 3CFOA 4JRQA 2HHVA 2ATQA 1VSKA 3SPZA 3OYCA 3G0ZA 3QERA 4FJ8A 4QOZB 3OYGA 2RKIA 1RBSA 4OGCA 2FBYA 3DLBA 1S6QA 1EKEA 4NYNA 1SUQA 5T7BA 3DOKA 3K5NA 4ICLA 4Z4HA 3NH0A 3T1AA 2KZMA 3SUQA 1TKTA 1TVRA 3NAEA 4DSIA 4CIEA 5D3GA 4LSNA 5CZ1A 4RW4A 3JSMA 4BE1A 3EY1A 3HJFA 2ZD1A 1RT7A 1SKWA 4W5NA 1GOAA 2KW4A 3D0PA 3PX0A 1TAQA 1BCMA 1RT6A 5I3UA 3SZ2A 3DMJA 3VN5A 4CJVA 2A1RA 4FXDA 3LALA 3NBPA 2HW3A 2HHTA 3OS0A 4KTWA 3VQ5A 4OGEA 1ZBHA 3HL8A 3AV9A 1WSJA 3JYTA 3OYAA 1XI1A 4FJ7A 3DRRA 1TAUA 4B9MA 4FZXC 4ZTFA 1QQCA 2F96A 5KI6A 3I0RA 4DU4A 1NKEA 4ELUA 3L2VA 2HHSA 2RN2A 4CEFA 1QSLA 1GOBA 3P83D 1RBRA 3SQ2A 3OJSA 4IG0A 3L3UA 3HYFA 2LSNA 4B9VA 5C42A 4FK0A 3ZSVA 1D5AA 2WOMA 3DLRA 4H4OA 5J2NA 1JKHA 1T03A 4O55A 1TL1A 1HNVA 3MEEA 3HP6A 1CLQA 4O44A 4DFKA 3IG1A 4CEZA 4FZZA 3OYJA 4HTUA 3HSTB 3VQCA 3SPYA 3LWMA 3NH2A 3AVMA 4AHUA 4O0IA 5CYQA 4E3SA 1N6QA 1NJWA 5HLFA 3KK3A 2OPPA 4EZ6A 3WNFA 4DLGA 1LAWA 3DI6A 1RBVA 2G8WA 4BWMA 1IKYA 2YKMA 1RTJA 1X9MA 2HHQA 1WSFA 3TAGA 3OYHA 4CEBA 1NKBA 3NDKA 4KHSA 4Z4FA 3DRSA 1TV6A 3LP1A 3NF9A 2E6LA 4FYDA 3ZSXA 3TAPA 4DFMA 1XHXA 4FJKA 4E7JA 4CJLA 5HRRA 3MECA 4CF9A 2Z1IA 4HCBA 1UWBA 4PA1A 4AILC 1Z25A 4KKOA 2Y1JA 3HPGA 3AVBA 1VSDA 1BL3A 1VSMA 2VG6A 3U3GA 3VQBA 1RDDA 4L8RB 2HHUA 5FROA 3SNNA 4DG1A 3C95A 5SWMA 4FM1A 4CJ3A 2NUBA 3AVNA 2IAJA 4E7KA 4FLYA 4M3XA 3DYAA 4E1NA 3NH1A 1VRTA 1WSEA 4KPYA 2F8TA 3RMDA 1C6VA 4R5PA 4KI6A 4FW1A 4KREA 1WNSA 3AVAA 3QETA 3QESA 1FXXA 5HBMA 1A5WA 4OPKA 4FJIA 3AA4A 4FLXA 3L2UA 2G8IA 2HNDA 2F8SA 3K5OA 1TKXA 4MQ3A 4DTJA 3AVLA 3RMCA 1UA0A 4RW6A 3CYMA 4NCGA 4CECA 4KB0A 1ASVA 4Z0UA 1C0MA 2ZQBA 4CJFA 1NKCA 1WLJA 1RT2A 3P5JA 1IKXA 1RT3A 4YFUA 1HJRA 1HYSA 3ISNC 1X9SA 4FJ9A 3VA0A 1VSLA 3K57A 3LZJA 4NCBA 3DLEA 4W5TA 2PZSA 2D0AA 3HPHA 4C8LA 4M42A 1J5OA 2OYQA 3NGIA 2R7YA 4RW8A 4CGFA 3S3OA 2G8UA 1UA1A 3ZSQA 4DSLA 2Y1IA 4QAGA 3AVFA 4F3OA 1BHLA 4FK4A 1JLGA 3H08A 3OYMA 4JS5A 1TK5A 1NJZA 4M3RA 3OYIA 4FJHA 1FK9A 1JLQA 3TABA 4M3UA 3DRPA 1Q8IA 3VQEA 4AHSA 4KHUA 4M3TA 2HB5A 3AVJA 3RTVA 4DS5A 4KO0A 4E19A 4I9LA 3KD5E 1KFSA 1B92A 3NF8A 1U49A 5HRNA 4ID5A 3LPUA 4JLHA 3O4QA 3MXJA 1I39A 1VSHA 4O0JA 1U48A 4CCHA 4BDZA 3V9XA 2YHBA 1CXUA 1RNHA 1QE1A 4CFAA 1RDBA 4CEAA 4CJTA 3KJVA 4E7HA 5J2MA 1JLFA 2FC0A 4IBNA 4CERA 3ZSYA 1NK5A 4K8ZA 1TL3A 1FKOA 4ELTA 3E01A 1BCOA 4DTNA 1T05A 1HNIA 3F73A 4BE0A 1IO2A 3CFPA 3LAKA 1S9EA 2Q3SA 1BQNA 2Z1GA 3C94A 3KKRA 2W42A 3AVKA 1KSPA 3ZT2A 1IG9A 4J2AA 3CM5A 5JS1A 1S6PA 3M8RA 2ITGA 4HHTA 2O4IA 1HMVA 5K14A 3OYDA 4O4GA 4FLVA 3KK1A 1R0AA 3RR7A 2OPSA 1S9GA 3CM6A 1L3TA 4I9QA 3A2FA 3V1RA 3CG7A 3VQQA 4N5SA 1KVAA 1JLAA 3OS2A 4BACA 4DLEA 3ALYA 1ZBIA 2JGUA 2HVHA 1HQEA 4RW9A 4DTOA 3NFAA 1KFDA 1SKSA 2IGIA 1EP4A 3ASMA 3OVNA 4E89A 3O3FA 4DTUA 4CE9A 4AHCA 3HO1A 4F8RA 2XY7A 1Z26A 5CZ2A 4CJPA 4B08A 3WNEA 1W0HA 3KLHA 4GVMA 2BE2A 2OPRA 3QEPA 3VQ9A 3ZSRA 4FJLA 4FJMA 4EZ9A 4CFBA 1TK0A 4KRFA 3HK2A 1DLOA 3S3MA 2DTUA 1LW0A 1X1PA 4DTMA 3M8SA 3RMAA 3DM2A 4CHZA 3AVIA 4AHRA 1KTQA 3L8BA 4GMJB 4LH4A 4LSLA 3WNHA 3KLIA 3NGZA 2XY5A 4Y1CA
chains in the Genus database with same CATH superfamily
2P9KA 2ITMA 3ZEUA 5LMUK 5F1XA 3TANA 4JN4A 4F9OA 1S1VA 1W9HA 3OYLA 2FBXA 1TYQB 2FF3B 1TKZA 3THYB 2E5LK 1K6YA 2QWQA 3KK7A 4FCYA 2RPIA 2A1SA 3CJ1A 3VF6A 1ITGA 3HVTA 3F2KA 4KTZA 4GY2B 3ZCMA 2GBZA 4JI1K 3AO2A 2NRRA 3TSQA 5GAEP 1S1TA 3L6QA 3R1XA 2YHAA 3ZLJA 3ID6A 3OA9A 4NLBA 1EWQA 5DMRA 4PKHA 3V81A 3F9KA 3P39A 4Z4IA 1NBWA 1Q7YO 3IMXA 5IWAK 2KZZA 1P90A 3QIOA 2OPQA 3AA3A 1ZBUA 2ZGYA 4BC4A 1JLBA 3B6OA 3ENHA 5E41A 3LM9A 3LPTA 3S3NA 5AQIA 1WBDA 1YF5L 3C6TA 4CJ4A 4DQIA 4DV7K 3D2EA 2KHOA 4RG8A 4Z4EA 3UIQA 3OS1A 4JI6K 3U9ZA 4CHNA 1Q82O 3LDLA 2PAVA 1WUAA 4H0YB 4HWIA 2CGLA 4BC2A 4B9LA 1NGIA 1HPZA 4I6MA 1NJXA 3QMLA 1GLCG 4PL8A 3QNOA 3THYA 3PIOL 3OYEA 4CF8A 4DQRA 5M1OA 2PYJA 1ZBSA 4B3OA 3QBWA 3CPEA 3HP9A 4JS4A 1DKGD 2NRZA 3U8XA 3QEXA 1BDGA 4WF9L 3V6DA 3PIPL 4MFBA 4KHQA 1OKJA 4ISGA 4ZTJA 4CIGA 4B9UA 4JKGB 3LP2A 4Z94A 1RBUA 3ZSOA 4N56A 2GTDA 1JCFA 3OY9A 4FWLA 5C25A 4CGHA 4DKWA 1JCEA 3MCAB 3BZKA 1BQMA 1YVUA 3O1WA 3SMSA 1EXQA 3T1YK 3V9WA 1T8EA 3K5MA 4KHWA 4BRQA 3MEGA 1K8KB 2O8BB 5C0YA 4CGGA 4GKJK 4CZJA 3THXA 1S5JA 1NGHA 3PSFA 1X9JA 2UXCK 2P5OA 1KVBA 1T3VA 4DMNA 5AR0A 2G8FA 4CFCA 4XH1A 3CQ8A 4BRCA 1NK7A 4BY9C 4C1NI 3BDPA 3VENA 2QM1A 3SQ4A 4DU3A 3WXIA 4LH5A 3CC2N 2FLOA 4BWJA 3SI6A 4BRHA 3SQ1A 3NF7A 3L3VA 4CEOA 3QEWA 4CHYA 3SUPA 2HBKA 1YITN 1KAZA 4BE2A 5KTQA 1N5YA 1L3VA 1Q9XA 1XWLA 4H0OA 5KGWA 4LF9K 1VQ5N 3DLGA 4JI0K 2B4JA 3KIOA 1O1WA 3ZT4A 4DV6K 1J53A 1NGJA 3V1QA 5FRMA 4MLHA 3VF4A 3ID8A 5BN8A 4A5BA 3L2QA 3OW2M 2WBNA 5HP1A 3S9HA 4I2QA 1DTQA 1RTIA 3KVGA 1RDCA 4YOWA 3IAYA 3FFIA 4M3WA 3QINA 5ELZA 1DT9A 4IO9L 1HR0K 2HHHK 1KLNA 1S1XA 1QTMA 4B9TA 2PYLA 3BY5A 3DJCA 1YHQN 1D4XA 1JL2A 1RGIA 3KWGA 3B6PA 2Q36A 3LM2A 2GUIA 2HHWA 4NCAA 4ELVA 4PUOA 4FWMA 5I9EB 3THWA 2P51A 5J2QA 3O5BA 3O3HA 1SL0A 3K5LA 4EP4A 2E6MA 4FLWA 2G8WA 1HKBA 1I94K 4CEDA 2D0PA 5KRSA 2A6AA 2H3GX 2HSTA 3SPZA 4FJ8A 4DV0K 1RBSA 2A3ZA 2FBYA 2WFBA 5CHIA 2V7YA 4BROA 3D6RA 4Z4HA 3E9OA 1TVRA 3NAEA 4A61A 1VQ9N 1ZC6A 2IVNA 5CZ1A 4CZKA 4BE1A 5GIPA 1RT6A 3SZ2A 5FPDA 4KTWA 5AQUA 1YI2N 4JHDB 3HL8A 2FF6A 2I7NA 1XI1A 5EXWA 5AQFA 5KI6A 2HHSA 1SAZA 3L2VA 3P83D 3SQ2A 3L3UA 4RCHA 2LSNA 4B9VA 5C42A 4H4OA 2W6LA 5J2NA 4DHYA 4JI4K 2I7PA 3JXUA 3VTIA 1CLQA 4O44A 3ZX3A 3CMAN 3IG1A 3ENOA 4FZZA 4HTUA 3FLCO 3HSTB 4OPHA 5BREA 3SPYA 3NH2A 3AVMA 2Q1NA 5HLFA 3NVMA 2ASPA 4EZ6A 3WNFA 4DLGA 1T6CA 2HOEA 4BRDA 3GE1A 1X9MA 2HHQA 4JK8A 1WSFA 5BPLA 3QB0A 4CEBA 4KHSA 3DRSA 3NF9A 2E6LA 3P38A 3ZSXA 2AP1A 3CJAA 2UU9K 2Z1IA 4PA1A 1Z25A 3HPGA 3AVBA 1YXQA 1BL3A 2HHUA 2VG6A 4PKGA 1RDDA 5FROA 4FM1A 3C95A 5SWMA 4DR5K 2YHWA 4E7KA 1XMOK 3FFKB 5DM7L 4E1NA 3TSPA 2CGJA 4KPYA 3G6EN 1C6VA 4JYAK 5C10A 2BH1A 1S22A 2O8EB 1YAGA 1FXXA 5HBMA 2UUAK 4GV6A 4IJNA 2F8SA 1P8ZA 3MN5A 4MQ3A 4NCGA 2Q31A 1C0MA 4UY8O 1HYSA 1NGDA 1RT3A 4YFUA 1SS6A 1QQNA 4DR2K 3EEQA 3A8YA 3LZJA 4NCBA 3DLEA 3OBWA 3C7NA 2KLAA 4CVNE 1V4TA 3AVFA 1K8KA 1BHLA 1N34K 1JLGA 3TABA 4M3UA 3VQEA 4M3TA 4E19A 1K73O 1U49A 4K42A 3FGUA 3UB5A 4AQYK 3WXLA 4JKGA 4LFBK 1I39A 4CCHA 2QXLA 2YHBA 1NGCA 3ZSYA 3GDQA 4A2BA 3HOTA 1TL3A 4A5AA 3H3NO 1BCOA 5AQLA 3ULEA 4EFHA 4FOIA 1X3NA 3C94A 1IG9A 4J2AA 4A59A 1S6PA 1QZ6A 3L4IA 3OYDA 4FLVA 5AQMA 2GEMA 4N5SA 2FSJA 4BACA 1XNQK 2V7ZA 2JGUA 4RW9A 1SKSA 4X65K 2IGIA 1EP4A 3QDKA 3ZX2A 4CE9A 4DR6K 4IJAA 3KLHA 2BE2A 3R6MA 4CBXA 1MWKA 4FJMA 4EZ9A 5HOOA 3WQTA 3HK2A 4KRFA 3S3MA 3D2FA 2UXDK 4X66K 1KTQA 1XC3A 5FPEA 4YHHK 2XY5A 4NO7A 4Y1CA 4FK0A 4PQUA 2FBTA 2D1KA 3I8BA 1RT4A 5KRTA 3KLEA 2NLXA 2IOCA 2YCHA 4RW7A 4CGDA 4IXCA 5KGXA 3HSCA 3SUNA 1NU0A 3VA3A 3O9TA 3QEIA 3AAPA 4EHTA 4H4MA 2OA8A 4DR1K 1J54A 4G1QA 4M3ZA 4C8MA 3A0IX 1Q86O 2B5JA 4DU1A 3LDSA 1VQ7N 3MEDA 4G9ZA 1UOCA 2O8CB 4LF8K 5HL7L 3HVRA 1BA1A 3OYFA 4LF4K 3H46O 3T3FA 3T19A 2F9TA 3C6UA 1C1BA 2HNZA 5FLXO 1QQOA 3PX6A 4FW2A 4GNIA 4DTPA 4JKFA 5AZIA 4Y0WA 4DFJA 4CZHA 2EHGA 4WQ4A 3EKUA 3VQ7A 1KAYA 3J81O 3D45A 3OYNA 3ITHA 4B1WB 3JAMO 2E2PA 3NF6A 1YIJN 1OH6A 2VWKA 4DTXA 3T69A 4DV1K 2QK9A 5BRDA 4FJGA 1MU2A 4BC3A 3RVCA 2D4WA 1YJNN 5AQGA 4FJ5A 3ZSWA 3QFPA 3M8PA 1REVA 2QWPA 3EZ5A 3AVCA 4Z4GA 4CFDA 2VQEK 3L4QA 2P5GA 3VGMA 4B8CA 3K2PA 1QZ5A 3SCXA 5C15A 4ILJA 3WEEB 4DV4K 3J7AP 4UQGA 3O6WA 3H1QA 5KPZA 5LJWA 3MXMA 2W40A 5CYMA 3K58A 1VQNN 2XY8A 3N4PA 1L3UA 1CZBA 3EYZA 1SKRA 4FZYA 2WTUA 4IZ9A 4ILHA 4JK9A 4YOTA 1KCFA 4IG3A 3O80A 2UUCK 3LZIA 3AO3A 3NHGA 3HXMA 4BRFA 2EX3A 4ILGB 2FBVA 5C24A 4DQQA 2XO7A 4CK1A 1GLEG 3VGKA 1RDWX 2ZGZA 1BISA 5E26A 3PUFA 1JCGA 1SV5A 4KFBA 5HRPA 4B9NA 3P31A 4CJEA 2IVOA 1VQ8N 3SMPA 2IIRA 2D0CA 2YHYA 4FJJA 4ZHRA 4DF8A 2P1JA 2DPNA 1X3MA 1YJ9N 1RFQA 3DOLA 3P1GA 4KB1A 2VGMA 2O4GA 5KQDA 4ISEA 3G25A 1RTDA 3THXB 3PY8A 2OCEA 1SL2A 1S1WA 2QWLA 2QKBA 1OVYA 5AFUH 2RHKA 4B1XB 2OZMA 1QVFM 3TARA 4JKCA 3TR8A 3WQUA 4EAHD 3MN7A 4LF7K 3THVA 4F3TA 2YHXA 5EVZA 4CJSA 2KTQA 1A5XA 4CI6A 3QNNA 3NGYA 3WUHA 4JI7K 5E84A 4JKBA 4KTQA 1KVCA 4JKHA 1XUPO 1L5UA 1JXBA 4M3YA 2KFZA 4OLAA 4BDPA 1Y97A 3MCPA 4X62K 4GW6A 1X9WA 4DF4A 5C12A 4J2DA 3CJ9A 4JRPA 1LCUA 1JJ2M 4H8KA 5EOYA 4CJWA 1I3AA 4IEEA 1KD1O 4WE1A 3V9UA 1VQ6N 4FK2A 2X6SA 4BR5A 3RSEB 4BDYA 2PY5A 4OPJA 4DFPA 3UKRB 3PO5A 1SL1A 2HNYA 1BUPA 1Q18A 2VGNA 4CJKA 4BRGA 1KLMA 2DFEA 3HI0A 3C0BA 1NK4A 4C8KA 3DAWA 2OZSA 2NNWA 4K0KK 3HZ6A 3KZBA 4H03B 4FJXA 1GLLO 3U6FA 2BUPA 4H0VB 3ATVA 4FVUA 1HNWK 3EE9A 3V9ZA 1KRPA 1C1CA 1U2VA 3V9SA 4CHOA 4BVOA 4KHPK 5EX5A 2ZM6K 1YTUA 1NOZA 4B3MK 4KHNA 4CK3A 4NYFA 5J1EA 1TKDA 4CF0A 4BG9A 4IOAL 3CCVN 1IBMK 4KI4A 4IOXA 3MN9A 3O4WA 1VSKA 5AQTA 1H1VA 3QERA 4DR7K 2RKIA 1M90O 3IDHA 4M7YA 3DOKA 2QTDA 1NM1A 3H6EA 3NH0A 3T1AA 3SUQA 3ZYYX 1TKTA 3FZHA 1OH7A 5AZJA 1G99A 4JD2B 3HJFA 3E1YA 1SKWA 2O8CA 1GOAA 3D0PA 3FZMA 4L3QA 3PSIA 3PX0A 4PHTX 1BCMA 3F5TA 3G4SN 3NBPA 3OS0A 4OGEA 1MDUB 1WSJA 3QFUA 4JAXA 3OYAA 4FJ7A 3DRRA 4ZTFA 2E2QA 3CI5A 3I0RA 1NKEA 1QSLA 1GOBA 4JEPA 2WOMA 1JKHA 1T03A 4O55A 3LDOA 3MEEA 3G71N 1C0GA 3C6AA 3OYJA 5JMVA 1XNRK 4U7BA 5AQXA 5CYQA 3KK3A 3K0SA 3T7ZA 2VCPA 3DI6A 4JHDA 2OTLN 1MWMA 3A5NC 2YKMA 1RTJA 5FPMA 3OYHA 4CZLA 1NKBA 2E2NA 2VQFK 5AZIB 2O8FA 3TAPA 1XHXA 3A5LC 4HCBA 3WEEA 5C2FA 4KKOA 4NXMK 3VQBA 3SNNA 5BRFA 4FLYA 4M3XA 3DYAA 3NH1A 4LC9B 4KREA 3QESA 4CD1A 5DM6L 2G8IA 4OPKA 1W7AA 3AA4A 4FJIA 5CE3A 4O5FA 3K5OA 1HPMA 3LDNA 4JK7A 2W6KA 3CMEN 3LL3A 1ASVA 5GINA 4Z0UA 3VEXA 4CJFA 3SLCA 1NKCA 1IKXA 4AM6A 1FW6A 1HJRA 1V4SA 4GVEA 1X9SA 4BGAA 4JKAA 3VA0A 1E4FT 4FPBA 4IEIA 2PZSA 4C8LA 4IOCL 2R7YA 1UA1A 2Y1IA 3EO3A 4FK4A 3H08A 4DCHA 3K9KA 1FK9A 4FJHA 3DRPA 4M63C 4AHSA 4KHUA 2HB5A 3AVJA 1T44A 3KD5E 2F7TA 4JLHA 1N33K 4BDZA 3V9XA 3M1FA 1CXUA 4PKIA 1RNHA 3DXKA 5M1NA 4KH4A 1RDBA 1YJWN 1JLFA 2Q97A 4IBNA 1E4GT 4YORA 4MDAA 4BG8A 2V51B 3IFRA 3UKUB 4BE0A 3LAKA 3C7NB 3E9LA 2Q3SA 2GX9A 2W42A 3KKRA 1KSPA 1NGEA 3CM5A 5K14A 5M1FA 3DWLA 3KK1A 1Y64A 2OPSA 1S9GA 1L3TA 3A2FA 3V1RA 4EIAA 2NZTA 2HVHA 5AQOA 3L0QA 1KFDA 3OVNA 4IDHA 5CR4A 1QQMA 2OANA 4MLEA 5CZ2A 3VEYA 4B08A 4CJPA 5GIOA 3ATUA 3TTCA 1MA9B 2OPRA 4IO8A 3TU5A 3VQ9A 1WOQA 3CD6N 2AA4A 5H1SQ 1GLDG 3M8SA 3EL2A 5LJVA 3DM2A 5AFUA 4AHRA 4GMJB 3WNHA 1IG8A 4BVPA 1T6DA 4WFNL 2RE2A 2UUBK 4Y1DA 4OX9K 3KWIA 5AQWA 1RILA 1BOTO 3VEVA 4FWOA 1KC8O 1FKPA 4O5BA 2E4LA 4BRNA 3VEWA 3V4IA 3KK2A 1U2VB 1LAVA 4CZMA 2D0OA 1XQSC 3RSEA 1IKWA 1VSJA 2QXFA 1NNEA 4OKEA 1HQUA 3LDPA 5FDLA 5AQPA 3SV3A 1OH5A 4B9SA 3UKRA 3IS9A 3M5RA 3L2WA 1W97L 3TAMA 1D9DA 3AO1A 2ZE2A 1RDUA 1U47A 4HUFA 2P9SA 2YNIA 4CBUA 2WUSA 4E0DA 3PLAA 3KKSA 2P9UB 1L3SA 3IKMA 3BEXA 1HX1A 3O4NA 5LMNK 1CZ9A 2ETJA 2VG5A 3QICA 3SAFA 1C1AA 3PO4A 5KPTA 4BR4A 4GV3A 1VSEA 4OKJA 3WT0A 3WXJA 3TWHA 1VK0A 4B1VA 3VQ6A 4FM0A 3A5MC 3BF1A 4E7IA 5AQSA 2O8EA 1J9AA 1WSHA 1DGKN 3G10A 1B9DA 4CEEA 3SJJA 3CXCM 3RMBA 1G15A 1K9MO 4IFEA 1GOCA 1JLCA 4C23A 3SV4A 4WYBA 1IBLK 5BR8K 1WN7A 4NLCA 2GELA 4C8OA 1U45A 1XMQK 3K59A 4BRAA 1UAXA 1CXQA 3QEVA 3SQ0A 3HOSA 2X6NA 5AQRA 3FZLA 3BUZB 3AA5X 2AJQA 3OJUA 3ZT0A 4LF5K 4FM2A 4WFBL 3MXIA 1QS4A 3AO5A 3AY9A 2QWNA 4Z4CA 1LWEA 5SZTA 4FLUA 4CGJA 3BF3A 1NK9A 2JWLA 2QW9A 1TK8A 3I0SA 4LY7A 3BGRA 1U04A 1ZBFA 2P9LB 3VEOA 4BQLA 1QHAA 3AO4A 4CJ5A 2F9WA 4QS7A 3KLFA 5LY3A 4E1MA 1E3MA 4K41A 3FZKA 3R9PA 1NK0A 3BP8A 1JL1A 1ASWA 4C8NA 3LWLA 2P9NB 1NGAA 4H0PA 1S3XA 5TKYA 1RT5A 5GAGP 1WAFA 1W2BM 1Z6RA 4DS4A 3LP0A 1DTTA 4BGBA 4DTRA 4DR3K 2RF2A 3CC7N 1GLJO 4BRKA 4IKFA 2XHBA 3D2FB 4DQPA 4OKKA 4N41A 4JNEA 3QIPA 5JVHL 1NG9A 3V1OA 1ATSA 1YT3A 3D7EO 3MK6A 4QCLA 2B6AA 2V52B 1Q9YA 4DSFA 5F0XA 5ADXH 2YNGA 4W5OA 2BANA 2GWKA 4A2AA 3RRGA 3TI0A 1TUYA 2HHXA 1WSGA 1IV0A 3H3OB 3RWUA 4AHVA 3VERA 4CJQA 3U3YA 1U6ZA 3DXKB 3ULDA 4HUEA 1VQMN 4OPAA 4I6MB 3OTOK 3VQPA 1JLEA 3MN6A 3OBYA 1C0UA 4F4KA 5M1PA 2CGKA 5AQQA 2XY6A 3SUOA 4MDBA 3UE5A 2G8VA 4AF1A 2P9NA 1NK6A 4BR2A 2HVIA 2Z1JA 1ATRA 3QBXA 3T1HK 2CH6A 1QVGM 3O8MA 2P9LA 5EY4A 2YNHA 3CQYA 4A57A 3RRHA 1ZYQA 4J2BA 2D5RA 3TTFA 1HNXK 3VQ8A 3I8DA 2NRWA 2P9IA 1EETA 1GLAG 3NCIA 3KLGA 1ZBLA 4CJUA 1D8YA 3VOVA 4DTSA 3TAEA 4F2RA 1HYVA 3FR0A 3VQ4A 1C0TA 4H0TB 1LWFA 1HKGA 2YKNA 1FJGK 4YDUC 4B3TK 4DSJA 1VQKN 4CESA 5JS2A 1ESVA 3M8QA 4BR9A 1U4BA 3DXMA 1RTHA 3NE6A 2QKKA 1NWKA 3LAMA 1Q81O 3CJBA 3GL1A 4OLBA 3CFOA 4JRQA 2HHVA 3OYCA 3G0ZA 4K43A 3OYGA 3K9JA 4ISFA 4RTFD 4OGCA 1S6QA 1EKEA 4FWQA 1SUQA 3K5NA 2KZMA 3H45C 4QS8A 4MO5A 1HNZK 4RW4A 3JSMA 3EY1A 4RWTA 2ZD1A 1SZ2A 2UYTA 3CQXA 4FL9A 1TAQA 2PBDA 3DMJA 4CJVA 2HHTA 3LALA 3S41A 1ZBHA 5AQKA 3AV9A 5LL6Z 1TAUA 4B9MA 1EO1A 1QQCA 2F96A 4JKDA 4DU4A 2P9PB 4ELUA 2RN2A 4IG0A 3HYFA 1VAZA 2A41A 3ZSVA 5AJ3K 3DLRA 3ULEB 3U9DA 4B1YB 5M1QA 3VESA 2ASOA 1TL1A 1HNVA 3D2EB 3HP6A 4DFKA 1M1KO 2NRVA 4BREA 2YX6A 2YI1A 1NJWA 2OPPA 1ZXOA 1LAWA 2HMPA 2WC9A 1RBVA 1EQYA 4BWMA 1SQKA 2E2OA 4GKKK 3TAGA 3CCJN 4Z4FA 3NDKA 5BPMA 1TV6A 1BG3A 4CJLA 5HRRA 3MECA 4CF9A 2UXBK 1UWBA 1VSDA 4L8RB 3U3GA 2Q0UA 3DXMB 3P4IA 5MLCQ 3JS6A 5F2RA 1VRTA 1WSEA 3R8EA 4WCEL 3CCEN 4KI6A 1WNSA 3AVAA 3LDQA 2ASMA 3L2UA 2HNDA 3HBTA 1BO5O 2F8TA 1BWFO 4DTJA 3AVLA 3RMCA 1UA0A 4RW6A 3CYMA 4CECA 1VQ4N 4FWKA 1CZAN 5ADXA 1RT2A 3P5JA 3ISNC 1YUWA 3K57A 2NRTA 2D0AA 3HPHA 1J5OA 2OYQA 4RW8A 4CGFA 4JI2K 3S3OA 3ZSQA 4DUZK 4DSLA 1BA0A 4V19S 3NVKA 3A5OC 4JS5A 1NJZA 4M3RA 4JI8K 5BPNA 3CCQN 3M3ZA 3M6GA 4B9QA 2HBMA 3HRGA 4KO0A 4I9LA 4KH5A 3NF8A 2A40A 5JVGL 3LPUA 4H5RA 2JWKA 1U48A 4YOYA 2E8AA 4B1UB 4CFAA 3KJVA 5IT9O 4K8ZA 3O9RA 4YOVA 4ELTA 3E01A 1HNIA 1IO2A 3UKUA 1S9EA 2O8DB 1BQNA 2E1ZA 3AGKA 3AVKA 3ZT2A 3M8RA 2O8BA 2O4IA 4HHTA 3SK3A 1HMVA 2EWSA 4H5VA 4O4GA 3RR7A 5AQHA 4A62A 3CM6A 2ZJQL 3OS2A 4DLEA 3MWPA 3O1BA 3O9SA 4LFCK 3NFAA 3SAGA 1WBBA 1J5EK 3ASMA 4E89A 4AHCA 3HO1A 2XY7A 4AM7A 4FSVA 4FPAA 4DV2K 2GUPA 3ZSRA 4CFBA 3AGRA 4EHUA 5FPNA 4DTMA 5AQZA 3RMAA 1N32K 4CHZA 2QI2A 3L8BA 4LH4A 3KLIA 3GBTA 3O08A 5BRHA 5AQNA 3EKSA 4BR0A 3DLHA 1EX4A 2P9SB 2P9KB 2Z1HA 3ZEUB 1TYQA 1ATNA 4ID1A 2P9IB 4W5QA 3EZWA 4M41A 1A5VA 3VEZA 3TAQA 2I5JA 4XH5A 3CJCA 3L2RA 4DWIA 2IS3A 4M45A 4CK2A 3CJ7A 4TSXA 2PFUA 2YV0X 3AARA 3R3LA 4XIUA 5EU7A 4GV9A 1XHZA 2VG7A 1JXEA 3OHRA 1NMNA 4XEIA 4PWDA 3PV8A 4OO1J 3VGLA 4K25A 2IC3A 1QHTA 3SYZA 1IKVA 4WQ5C 4CF2A 1RCHA 5M1KA 3Q7BA 3EE8A 1RT1A 2O8FB 3ZT1A 1VRUA 4PY5A 4FLTA 1NK8A 4JKEA 3U4LA 1LOTB 3IRXA 3WXKA 3KD1E 1HYZA 1TUUA 3HM8A 5AQVA 4H5TA 2WONA 2YNFA 4DUYK 2NRXA 3MMVA 3MX5A 4KAZA 3KTQA 4O8KA 4E1JA 5KPRA 2ZJRL 3J7YP 2JLEA 2G8KA 4I7FA 1IH7A 1VQPN 4CF1A 2Q0RA 4KHYA 4KV8A 2KFNA 3MWTA 4FJNA 1BIUA 3AAQA 3QO9A 4WFAL 3TAFA 1ASUA 2NRHA 5TKWA 1QSYA 1TGOA 4DSKA 2HF3A 2E1YA 3CPWM 4I2PA 4J2EA 4BC5A 1NMDA 3LANA 2A42A 1QSSA 4LF6K 5J2PA 4FVMA 1LWCA 2VWBA 1RDAA 5AQJA 4B8AB 2X78A 4YOUA 4K8XA 4FO0A 4H0XB 3ZETA 1WSIA 5CY4A 1YTAA 5I42A 4AHTA 2F4VK 5HROA 3I33A 4FLZA 1S72N 1BI4A 1WB9A 3LP3A 4CHQA 4CGIA 4YY3K 3ZSZA 4DQSA 2VYPA 1BIZA 1B9FA 3HM9A 4YDUA 4N47A 1GLFO 3SJHA 1F21A 5JLHA 4FWNA 2YJFA 4Q0BA 2E20A 3FZFA 1KQSM 2X74A 3AVGA 3VQDA 1NGGA 3CFRA 4IDKA 1NGFA 4H5NA 3CHWA 1D9FA 3WNGA 2VWJA 4WQ5A 3DLKA 4FWPA 4DB3A 2BDPA 2BTFA 4CEQA 3C6HA 4U67L 3AA2A 3MDQA 3ZT3A 4EP5A 4WQ4C 4LFAK 1VSFA 4B3RK 2HMIA 1T7PA 5AZJB 5BR9A 3ENBA 3FE1A 1GLBG 3SBGA 1LW2A 4CZIA 1N36K 1NJIO 1VQLN 2G8HA 4FOEA 4AH9A 3VMFB 1WAJA 4DSEA 2QWMA 1NJYA 1RBTA 2D0BA 4N76A 3CCUN 5FRNA 2GWJA 2KQ2A 4E7LA 3Q7CA 3HPOA 2FXUA 1N8RO 4OVLA 4BQZA 4HTLA 2W41A 5GADP 3O3GA 4BRMA 2OTJN 3PX4A 3F9MA 4M7XA 3WXMB 3CIPA 4F2SA 4HVJA 1HRHA 1R59O 2IDOA 3O9QA 4CIFA 1NOYA 4Q5VA 2DY4A 4HUGA 4LD0A 3W3DA 2ZWHA 4YNQA 1O13A 2E88A 4B3SK 1BI4B 5JICA 3QLHA 1BGXT 3E66A 2BGGA 3N4QA 1XC9A 4IWVA 3OYBA 4FWRA 3HT3A 1OH8A 2GV9A 3DLLL 2FSKA 4C1NK 4OJRA 4CHPA 1VSIA 4W5RA 3THWB 5DK5A 4HCCA 2ZF5O 3VF2A 3VQAA 4CJRA 4IFYA 3RR8A 3TSUA 3CCLN 2DFFA 3VPZA 3OYKA 2YJEA 4NXNK 5HRSA 3AVHA 3W0LA 1HLUA 3MAQA 2DFHA 5GAHP 4CBWA 3IUCA 1HJOA 4IFVA 1S1UA 4DV5K 1LV5A 2XRIA 1K8AO 2ATQA 4BRLA 2FSNA 4QOZB 2J4RA 5JLFA 3DLBA 2KKZA 4NYNA 5B8HA 5T7BA 4ICLA 1NLVA 4DSIA 4CIEA 3CC4N 5D3GA 4LSNA 1RT7A 4DV3K 4W5NA 2KW4A 1EWRA 5I3UA 3VN5A 4FXDA 2A1RA 2HW3A 4MO4A 3VQ5A 4NB4A 1DEJA 3JYTA 1Z05A 2HF4A 1KXPA 4FZXC 3H1VX 3BZCA 4CEFA 2QA4N 1RBRA 4J8FA 3OJSA 4CZGA 5A2QO 1D5AA 4JI5K 3CERA 2QEXN 4PL7A 4CEZA 3GG4A 4CD3A 1IJJA 1IBKK 3VQCA 3LWMA 3CCMN 3VTHA 4O0IA 4AHUA 3NMUA 4E3SA 1N6QA 3J8AA 4FWSA 2Q2RA 2A5XA 3O9UA 3HTVA 2QWRA 1IKYA 3LP1A 2P9PA 4FYDA 4DFMA 4FJKA 4E7JA 2HBJA 4AILC 2Y1JA 4DQ8A 3VETA 4DR4K 1VSMA 4JD2A 3I55N 4CZFA 4R79A 4DG1A 4CJ3A 2NUBA 3AVNA 2IAJA 3EN9A 3C65A 3TPQA 3RMDA 4R5PA 4FW1A 4QS9A 3QETA 1A5WA 3SBTA 3ZETB 4FLXA 3KHYA 1TKXA 4I9QA 2HBLA 4KB0A 2CH5A 2ZQBA 1HUXA 1WLJA 3CF5L 4FJ9A 1VSLA 1OVQA 4BRPA 4W5TA 4BRIA 4M42A 3NGIA 2G8UA 4QAGA 4F3OA 4KBOA 1YVNA 3OYMA 4CJ7A 1TK5A 3OYIA 1JLQA 2ZJPL 3B8AX 1Q8IA 4B1ZA 3TTDA 3ZX0A 3RTVA 4DS5A 1ILYA 4H5WA 1KFSA 1B92A 5HRNA 4ID5A 3O4QA 2IVPA 1VSHA 3MXJA 4O0JA 3I56N 1BU6O 1KAXA 1QE1A 4E7HA 4CJTA 4CEAA 4KH6A 5J2MA 1NK5A 4CERA 2FC0A 1C0FA 2P9UA 1FKOA 4X64K 4DTNA 1T05A 3F73A 3SAHA 3CFPA 2Z1GA 4XH4A 3CCSN 5JS1A 2O8DA 2ITGA 5C2DA 3GOIA 1J6ZA 4YOXA 1R0AA 3E9PA 3VQQA 1VQON 3CG7A 1KVAA 1JLAA 3ALYA 1ZBIA 4JI3K 3MX2A 1HQEA 4DTOA 3J7ZO 4CZEA 4DTUA 3O3FA 5KQ8A 4F8RA 4BR7A 1Z26A 1VHXA 3CCRN 3WNEA 1W0HA 1HKCA 4GVMA 3J80O 3QEPA 1NGBA 4FJLA 3CETA 1TK0A 1DLOA 2DTUA 1LW0A 1X1PA 4O8UA 4CW7B 5AQYA 3AVIA 2QWOA 4LSLA 3NGZA 5BN9A 4JV5K
chains in the Genus database with same CATH topology
4PQUA 2FBTA 3DLHA 4Y1DA 1EX4A 1RT4A 5KRTA 3KLEA 3TANA 4CGDA 2IOCA 4RW7A 1S1VA 2Z1HA 1RILA 1W9HA 5KGXA 3OYLA 3SUNA 3VA3A 1FKPA 2FBXA 4ID1A 3QEIA 1TKZA 4W5QA 4M41A 1K6YA 4H4MA 1A5VA 4O5BA 2E4LA 2RPIA 4FCYA 3TAQA 1J54A 2A1SA 4G1QA 2OA8A 4C8MA 3V4IA 1ITGA 4M3ZA 3HVTA 3KK2A 2B5JA 2I5JA 3L2RA 4DWIA 4DU1A 3LDSA 2IS3A 4KTZA 1LAVA 3MEDA 3ZCMA 4M45A 1UOCA 2GBZA 3AO2A 1IKWA 1S1TA 1VSJA 2QXFA 4OKEA 4CK2A 4TSXA 1HQUA 2YV0X 3HVRA 2YHAA 4XIUA 3OYFA 5FDLA 5EU7A 3SV3A 3T3FA 3T19A 4B9SA 3C6UA 5DMRA 2VG7A 1XHZA 1C1BA 1JXEA 2HNZA 3V81A 3PX6A 4FW2A 3F9KA 3IS9A 3L2WA 4Z4IA 3TAMA 4DTPA 1D9DA 3AO1A 3PV8A 4DFJA 4PWDA 2ZE2A 1U47A 2KZZA 2EHGA 1QHTA 2IC3A 2YNIA 4HUFA 3SYZA 1IKVA 3QIOA 4E0DA 3KKSA 4CF2A 1RCHA 2OPQA 3AA3A 1L3SA 1ZBUA 1JLBA 3VQ7A 3B6OA 5E41A 1RT1A 3LPTA 3O4NA 3S3NA 1CZ9A 3ZT1A 1VRUA 3D45A 2ETJA 3OYNA 4FLTA 4PY5A 3ITHA 2VG5A 1C1AA 1NK8A 3C6TA 3NF6A 4CJ4A 3PO4A 4DQIA 1VSEA 4OKJA 3IRXA 3KD1E 1HYZA 3TWHA 2VWKA 1VK0A 4DTXA 3VQ6A 4RG8A 4FM0A 2WONA 4Z4EA 4E7IA 2YNFA 1J9AA 2QK9A 1WSHA 3UIQA 3OS1A 3G10A 4FJGA 4KAZA 1MU2A 3KTQA 1B9DA 4CEEA 3SJJA 3RMBA 1G15A 4CHNA 2JLEA 2G8KA 4I7FA 1IH7A 4CF1A 1GOCA 1JLCA 4KHYA 4KV8A 4FJ5A 2KFNA 3SV4A 3ZSWA 4B9LA 4FJNA 1BIUA 3QO9A 3M8PA 1HPZA 1REVA 1WN7A 1NJXA 3TAFA 3EZ5A 3AVCA 1ASUA 1QSYA 4CFDA 4Z4GA 1TGOA 3QNOA 4DSKA 2P5GA 4C8OA 4B8CA 1U45A 3K2PA 3OYEA 4CF8A 3K59A 4DQRA 3SCXA 1UAXA 1CXQA 4I2PA 3QEVA 3SQ0A 2PYJA 4J2EA 2X6NA 4UQGA 4B3OA 3LANA 1QSSA 3HP9A 4JS4A 3AA5X 5J2PA 2AJQA 3MXMA 4FVMA 5CYMA 3K58A 1LWCA 2XY8A 3OJUA 3ZT0A 1CZBA 1L3UA 4FM2A 1RDAA 3EYZA 3MXIA 1QS4A 1SKRA 3AO5A 5SZTA 3QEXA 4Z4CA 1LWEA 4FLUA 4FZYA 4CGJA 4B8AB 2X78A 1NK9A 4K8XA 3V6DA 4MFBA 1KCFA 4IG3A 4KHQA 1TK8A 3I0SA 4LY7A 3LZIA 3AO3A 1WSIA 3NHGA 3BGRA 3HXMA 5CY4A 1YTAA 2EX3A 1U04A 4CIGA 1ZBFA 5I42A 4ZTJA 4B9UA 4AHTA 3LP2A 5HROA 1RBUA 2FBVA 3ZSOA 3AO4A 5C24A 4CJ5A 4N56A 2XO7A 3OY9A 4FLZA 4DQQA 4CK1A 4CGHA 5C25A 1BI4A 3KLFA 1BISA 1BQMA 4E1MA 1YVUA 3PUFA 1EXQA 3LP3A 1SV5A 4CHQA 4KFBA 5HRPA 1NK0A 4CGIA 4B9NA 1JL1A 1ASWA 4C8NA 3ZSZA 3V9WA 1BIZA 4CJEA 3LWLA 3K5MA 4DQSA 1T8EA 4KHWA 1B9FA 3HM9A 3MEGA 2D0CA 4N47A 4FJJA 4ZHRA 4DF8A 1F21A 1RT5A 4CGGA 2P1JA 4Q0BA 1S5JA 3DOLA 1WAFA 3P1GA 4KB1A 2O4GA 2X74A 3AVGA 3VQDA 1RTDA 3PY8A 4DS4A 3LP0A 1SL2A 1DTTA 2P5OA 1S1WA 3CFRA 4IDKA 4DTRA 2QKBA 1KVBA 1D9FA 2RF2A 4DMNA 2G8FA 3WNGA 4CFCA 3CQ8A 2VWJA 4IKFA 3DLKA 2XHBA 2BDPA 1NK7A 4CEQA 4DQPA 4OKKA 2OZMA 3TARA 3AA2A 3TR8A 3ZT3A 3BDPA 4EP5A 4N41A 3THVA 3SQ4A 4F3TA 4DU3A 1VSFA 3QIPA 4LH5A 4CJSA 2HMIA 2KTQA 1T7PA 1A5XA 4BWJA 3V1OA 3QNNA 3NGYA 3SI6A 3SQ1A 1YT3A 3NF7A 4KTQA 1KVCA 1LW2A 4QCLA 2B6AA 3L3VA 4CEOA 2G8HA 3QEWA 1Q9YA 4CHYA 4DSFA 3SUPA 4AH9A 2YNGA 4W5OA 1L5UA 1JXBA 4M3YA 2BANA 1WAJA 2KFZA 3RRGA 4BE2A 4OLAA 3TI0A 4DSEA 5KTQA 1Y97A 4BDPA 1NJYA 1N5YA 1RBTA 1L3VA 2HHXA 2D0BA 4N76A 1WSGA 5FRNA 4GW6A 1X9WA 3RWUA 2KQ2A 4AHVA 4E7LA 4DF4A 4J2DA 1Q9XA 1XWLA 4CJQA 3HPOA 4JRPA 3U3YA 5KGWA 4H8KA 3DLGA 4OVLA 4HUEA 3ULDA 2B4JA 4CJWA 3VQPA 3O3GA 3KIOA 1I3AA 1O1WA 3PX4A 1JLEA 3ZT4A 1J53A 4WE1A 3V1QA 3V9UA 5FRMA 4FK2A 1C0UA 2X6SA 4F4KA 4BDYA 2PY5A 3L2QA 2XY6A 3SUOA 2G8VA 4F2SA 4OPJA 4DFPA 4HVJA 1HRHA 2IDOA 4CIFA 5HP1A 1NK6A 1NOYA 4Q5VA 3S9HA 2HNYA 1SL1A 3PO5A 2HVIA 4CJKA 2DY4A 4I2QA 4HUGA 1KLMA 4LD0A 2Z1JA 2DFEA 1DTQA 1NK4A 4C8KA 4YNQA 1RTIA 1RDCA 3IAYA 2YNHA 3FFIA 4M3WA 3QINA 2OZSA 1BI4B 3RRHA 1ZYQA 3QLHA 1BGXT 4J2BA 2BGGA 2D5RA 1XC9A 3VQ8A 3OYBA 3I8DA 4FJXA 3HT3A 1KLNA 1S1XA 3U6FA 1QTMA 4B9TA 2GV9A 2PYLA 1EETA 3V9ZA 1KRPA 3NCIA 4OJRA 1C1CA 4CHPA 3KLGA 1VSIA 1JL2A 1ZBLA 4W5RA 4DSJA 3B6PA 3V9SA 2GUIA 5DK5A 4CJUA 4CHOA 4HCCA 2HHWA 1D8YA 4NCAA 4ELVA 4PUOA 4DTSA 2P51A 3TAEA 3VQAA 4CJRA 1HYVA 4IFYA 5J2QA 1NOZA 4F2RA 4KHNA 1YTUA 3RR8A 2DFFA 3VQ4A 4CK3A 1C0TA 3OYKA 4NYFA 1LWFA 2YKNA 3O3HA 1SL0A 3K5LA 5HRSA 3AVHA 5J1EA 3MAQA 4EP4A 1TKDA 2DFHA 2E6MA 5JS2A 4CESA 4IFVA 4FLWA 3M8QA 4CF0A 1U4BA 1S1UA 1RTHA 4CEDA 3NE6A 2QKKA 4KI4A 3LAMA 1LV5A 2XRIA 5KRSA 4OLBA 3CFOA 4JRQA 2HHVA 2ATQA 1VSKA 3SPZA 3OYCA 3G0ZA 3QERA 4FJ8A 4QOZB 3OYGA 2RKIA 1RBSA 4OGCA 2FBYA 3DLBA 1S6QA 1EKEA 4NYNA 1SUQA 5T7BA 3DOKA 3K5NA 4ICLA 4Z4HA 3NH0A 3T1AA 2KZMA 3SUQA 1TKTA 1TVRA 3NAEA 4DSIA 4CIEA 5D3GA 4LSNA 5CZ1A 4RW4A 3JSMA 4BE1A 3EY1A 3HJFA 2ZD1A 1RT7A 1SKWA 4W5NA 1GOAA 2KW4A 3D0PA 3PX0A 1TAQA 1BCMA 1RT6A 5I3UA 3SZ2A 3DMJA 3VN5A 4CJVA 2A1RA 4FXDA 3LALA 3NBPA 2HW3A 2HHTA 3OS0A 4KTWA 3VQ5A 4OGEA 1ZBHA 3HL8A 3AV9A 1WSJA 3JYTA 3OYAA 1XI1A 4FJ7A 3DRRA 1TAUA 4B9MA 4FZXC 4ZTFA 1QQCA 2F96A 5KI6A 3I0RA 4DU4A 1NKEA 4ELUA 3L2VA 2HHSA 2RN2A 4CEFA 1QSLA 1GOBA 3P83D 1RBRA 3SQ2A 3OJSA 4IG0A 3L3UA 3HYFA 2LSNA 4B9VA 5C42A 4FK0A 3ZSVA 1D5AA 2WOMA 3DLRA 4H4OA 5J2NA 1JKHA 1T03A 4O55A 1TL1A 1HNVA 3MEEA 3HP6A 1CLQA 4O44A 4DFKA 3IG1A 4CEZA 4FZZA 3OYJA 4HTUA 3HSTB 3VQCA 3SPYA 3LWMA 3NH2A 3AVMA 4AHUA 4O0IA 5CYQA 4E3SA 1N6QA 1NJWA 5HLFA 3KK3A 2OPPA 4EZ6A 3WNFA 4DLGA 1LAWA 3DI6A 1RBVA 2G8WA 4BWMA 1IKYA 2YKMA 1RTJA 1X9MA 2HHQA 1WSFA 3TAGA 3OYHA 4CEBA 1NKBA 3NDKA 4KHSA 4Z4FA 3DRSA 1TV6A 3LP1A 3NF9A 2E6LA 4FYDA 3ZSXA 3TAPA 4DFMA 1XHXA 4FJKA 4E7JA 4CJLA 5HRRA 3MECA 4CF9A 2Z1IA 4HCBA 1UWBA 4PA1A 4AILC 1Z25A 4KKOA 2Y1JA 3HPGA 3AVBA 1VSDA 1BL3A 1VSMA 2VG6A 3U3GA 3VQBA 1RDDA 4L8RB 2HHUA 5FROA 3SNNA 4DG1A 3C95A 5SWMA 4FM1A 4CJ3A 2NUBA 3AVNA 2IAJA 4E7KA 4FLYA 4M3XA 3DYAA 4E1NA 3NH1A 1VRTA 1WSEA 4KPYA 2F8TA 3RMDA 1C6VA 4R5PA 4KI6A 4FW1A 4KREA 1WNSA 3AVAA 3QETA 3QESA 1FXXA 5HBMA 1A5WA 4OPKA 4FJIA 3AA4A 4FLXA 3L2UA 2G8IA 2HNDA 2F8SA 3K5OA 1TKXA 4MQ3A 4DTJA 3AVLA 3RMCA 1UA0A 4RW6A 3CYMA 4NCGA 4CECA 4KB0A 1ASVA 4Z0UA 1C0MA 2ZQBA 4CJFA 1NKCA 1WLJA 1RT2A 3P5JA 1IKXA 1RT3A 4YFUA 1HJRA 1HYSA 3ISNC 1X9SA 4FJ9A 3VA0A 1VSLA 3K57A 3LZJA 4NCBA 3DLEA 4W5TA 2PZSA 2D0AA 3HPHA 4C8LA 4M42A 1J5OA 2OYQA 3NGIA 2R7YA 4RW8A 4CGFA 3S3OA 2G8UA 1UA1A 3ZSQA 4DSLA 2Y1IA 4QAGA 3AVFA 4F3OA 1BHLA 4FK4A 1JLGA 3H08A 3OYMA 4JS5A 1TK5A 1NJZA 4M3RA 3OYIA 4FJHA 1FK9A 1JLQA 3TABA 4M3UA 3DRPA 1Q8IA 3VQEA 4AHSA 4KHUA 4M3TA 2HB5A 3AVJA 3RTVA 4DS5A 4KO0A 4E19A 4I9LA 3KD5E 1KFSA 1B92A 3NF8A 1U49A 5HRNA 4ID5A 3LPUA 4JLHA 3O4QA 3MXJA 1I39A 1VSHA 4O0JA 1U48A 4CCHA 4BDZA 3V9XA 2YHBA 1CXUA 1RNHA 1QE1A 4CFAA 1RDBA 4CEAA 4CJTA 3KJVA 4E7HA 5J2MA 1JLFA 2FC0A 4IBNA 4CERA 3ZSYA 1NK5A 4K8ZA 1TL3A 1FKOA 4ELTA 3E01A 1BCOA 4DTNA 1T05A 1HNIA 3F73A 4BE0A 1IO2A 3CFPA 3LAKA 1S9EA 2Q3SA 1BQNA 2Z1GA 3C94A 3KKRA 2W42A 3AVKA 1KSPA 3ZT2A 1IG9A 4J2AA 3CM5A 5JS1A 1S6PA 3M8RA 2ITGA 4HHTA 2O4IA 1HMVA 5K14A 3OYDA 4O4GA 4FLVA 3KK1A 1R0AA 3RR7A 2OPSA 1S9GA 3CM6A 1L3TA 4I9QA 3A2FA 3V1RA 3CG7A 3VQQA 4N5SA 1KVAA 1JLAA 3OS2A 4BACA 4DLEA 3ALYA 1ZBIA 2JGUA 2HVHA 1HQEA 4RW9A 4DTOA 3NFAA 1KFDA 1SKSA 2IGIA 1EP4A 3ASMA 3OVNA 4E89A 3O3FA 4DTUA 4CE9A 4AHCA 3HO1A 4F8RA 2XY7A 1Z26A 5CZ2A 4CJPA 4B08A 3WNEA 1W0HA 3KLHA 4GVMA 2BE2A 2OPRA 3QEPA 3VQ9A 3ZSRA 4FJLA 4FJMA 4EZ9A 4CFBA 1TK0A 4KRFA 3HK2A 1DLOA 3S3MA 2DTUA 1LW0A 1X1PA 4DTMA 3M8SA 3RMAA 3DM2A 4CHZA 3AVIA 4AHRA 1KTQA 3L8BA 4GMJB 4LH4A 4LSLA 3WNHA 3KLIA 3NGZA 2XY5A 4Y1CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PQU A;  2FBT A;  3DLH A;  4Y1D A;  1EX4 A;  1RT4 A;  5KRT A;  3KLE A;  3TAN A;  4CGD A;  2IOC A;  4RW7 A;  1S1V A;  2Z1H A;  1RIL A;  1W9H A;  5KGX A;  3OYL A;  3SUN A;  3VA3 A;  1FKP A;  2FBX A;  4ID1 A;  3QEI A;  1TKZ A;  4W5Q A;  4M41 A;  1K6Y A;  4H4M A;  1A5V A;  4O5B A;  2E4L A;  2RPI A;  4FCY A;  3TAQ A;  1J54 A;  2A1S A;  4G1Q A;  2OA8 A;  4C8M A;  3V4I A;  1ITG A;  4M3Z A;  3HVT A;  3KK2 A;  2B5J A;  2I5J A;  3L2R A;  4DWI A;  4DU1 A;  3LDS A;  2IS3 A;  4KTZ A;  1LAV A;  3MED A;  3ZCM A;  4M45 A;  1UOC A;  2GBZ A;  3AO2 A;  1IKW A;  1S1T A;  1VSJ A;  2QXF A;  4OKE A;  4CK2 A;  4TSX A;  1HQU A;  2YV0 X;  3HVR A;  2YHA A;  4XIU A;  3OYF A;  5FDL A;  5EU7 A;  3SV3 A;  3T3F A;  3T19 A;  4B9S A;  3C6U A;  5DMR A;  2VG7 A;  1XHZ A;  1C1B A;  1JXE A;  2HNZ A;  3V81 A;  3PX6 A;  4FW2 A;  3F9K A;  3IS9 A;  3L2W A;  4Z4I A;  3TAM A;  4DTP A;  1D9D A;  3AO1 A;  3PV8 A;  4DFJ A;  4PWD A;  2ZE2 A;  1U47 A;  2KZZ A;  2EHG A;  1QHT A;  2IC3 A;  2YNI A;  4HUF A;  3SYZ A;  1IKV A;  3QIO A;  4E0D A;  3KKS A;  4CF2 A;  1RCH A;  2OPQ A;  3AA3 A;  1L3S A;  1ZBU A;  1JLB A;  3VQ7 A;  3B6O A;  5E41 A;  1RT1 A;  3LPT A;  3O4N A;  3S3N A;  1CZ9 A;  3ZT1 A;  1VRU A;  3D45 A;  2ETJ A;  3OYN A;  4FLT A;  4PY5 A;  3ITH A;  2VG5 A;  1C1A A;  1NK8 A;  3C6T A;  3NF6 A;  4CJ4 A;  3PO4 A;  4DQI A;  1VSE A;  4OKJ A;  3IRX A;  3KD1 E;  1HYZ A;  3TWH A;  2VWK A;  1VK0 A;  4DTX A;  3VQ6 A;  4RG8 A;  4FM0 A;  2WON A;  4Z4E A;  4E7I A;  2YNF A;  1J9A A;  2QK9 A;  1WSH A;  3UIQ A;  3OS1 A;  3G10 A;  4FJG A;  4KAZ A;  1MU2 A;  3KTQ A;  1B9D A;  4CEE A;  3SJJ A;  3RMB A;  1G15 A;  4CHN A;  2JLE A;  2G8K A;  4I7F A;  1IH7 A;  4CF1 A;  1GOC A;  1JLC A;  4KHY A;  4KV8 A;  4FJ5 A;  2KFN A;  3SV4 A;  3ZSW A;  4B9L A;  4FJN A;  1BIU A;  3QO9 A;  3M8P A;  1HPZ A;  1REV A;  1WN7 A;  1NJX A;  3TAF A;  3EZ5 A;  3AVC A;  1ASU A;  1QSY A;  4CFD A;  4Z4G A;  1TGO A;  3QNO A;  4DSK A;  2P5G A;  4C8O A;  4B8C A;  1U45 A;  3K2P A;  3OYE A;  4CF8 A;  3K59 A;  4DQR A;  3SCX A;  1UAX A;  1CXQ A;  4I2P A;  3QEV A;  3SQ0 A;  2PYJ A;  4J2E A;  2X6N A;  4UQG A;  4B3O A;  3LAN A;  1QSS A;  3HP9 A;  4JS4 A;  3AA5 X;  5J2P A;  2AJQ A;  3MXM A;  4FVM A;  5CYM A;  3K58 A;  1LWC A;  2XY8 A;  3OJU A;  3ZT0 A;  1CZB A;  1L3U A;  4FM2 A;  1RDA A;  3EYZ A;  3MXI A;  1QS4 A;  1SKR A;  3AO5 A;  5SZT A;  3QEX A;  4Z4C A;  1LWE A;  4FLU A;  4FZY A;  4CGJ A;  4B8A B;  2X78 A;  1NK9 A;  4K8X A;  3V6D A;  4MFB A;  1KCF A;  4IG3 A;  4KHQ A;  1TK8 A;  3I0S A;  4LY7 A;  3LZI A;  3AO3 A;  1WSI A;  3NHG A;  3BGR A;  3HXM A;  5CY4 A;  1YTA A;  2EX3 A;  1U04 A;  4CIG A;  1ZBF A;  5I42 A;  4ZTJ A;  4B9U A;  4AHT A;  3LP2 A;  5HRO A;  1RBU A;  2FBV A;  3ZSO A;  3AO4 A;  5C24 A;  4CJ5 A;  4N56 A;  2XO7 A;  3OY9 A;  4FLZ A;  4DQQ A;  4CK1 A;  4CGH A;  5C25 A;  1BI4 A;  3KLF A;  1BIS A;  1BQM A;  4E1M A;  1YVU A;  3PUF A;  1EXQ A;  3LP3 A;  1SV5 A;  4CHQ A;  4KFB A;  5HRP A;  1NK0 A;  4CGI A;  4B9N A;  1JL1 A;  1ASW A;  4C8N A;  3ZSZ A;  3V9W A;  1BIZ A;  4CJE A;  3LWL A;  3K5M A;  4DQS A;  1T8E A;  4KHW A;  1B9F A;  3HM9 A;  3MEG A;  2D0C A;  4N47 A;  4FJJ A;  4ZHR A;  4DF8 A;  1F21 A;  1RT5 A;  4CGG A;  2P1J A;  4Q0B A;  1S5J A;  3DOL A;  1WAF A;  3P1G A;  4KB1 A;  2O4G A;  2X74 A;  3AVG A;  3VQD A;  1RTD A;  3PY8 A;  4DS4 A;  3LP0 A;  1SL2 A;  1DTT A;  2P5O A;  1S1W A;  3CFR A;  4IDK A;  4DTR A;  2QKB A;  1KVB A;  1D9F A;  2RF2 A;  4DMN A;  2G8F A;  3WNG A;  4CFC A;  3CQ8 A;  2VWJ A;  4IKF A;  3DLK A;  2XHB A;  2BDP A;  1NK7 A;  4CEQ A;  4DQP A;  4OKK A;  2OZM A;  3TAR A;  3AA2 A;  3TR8 A;  3ZT3 A;  3BDP A;  4EP5 A;  4N41 A;  3THV A;  3SQ4 A;  4F3T A;  4DU3 A;  1VSF A;  3QIP A;  4LH5 A;  4CJS A;  2HMI A;  2KTQ A;  1T7P A;  1A5X A;  4BWJ A;  3V1O A;  3QNN A;  3NGY A;  3SI6 A;  3SQ1 A;  1YT3 A;  3NF7 A;  4KTQ A;  1KVC A;  1LW2 A;  4QCL A;  2B6A A;  3L3V A;  4CEO A;  2G8H A;  3QEW A;  1Q9Y A;  4CHY A;  4DSF A;  3SUP A;  4AH9 A;  2YNG A;  4W5O A;  1L5U A;  1JXB A;  4M3Y A;  2BAN A;  1WAJ A;  2KFZ A;  3RRG A;  4BE2 A;  4OLA A;  3TI0 A;  4DSE A;  5KTQ A;  1Y97 A;  4BDP A;  1NJY A;  1N5Y A;  1RBT A;  1L3V A;  2HHX A;  2D0B A;  4N76 A;  1WSG A;  5FRN A;  4GW6 A;  1X9W A;  3RWU A;  2KQ2 A;  4AHV A;  4E7L A;  4DF4 A;  4J2D A;  1Q9X A;  1XWL A;  4CJQ A;  3HPO A;  4JRP A;  3U3Y A;  5KGW A;  4H8K A;  3DLG A;  4OVL A;  4HUE A;  3ULD A;  2B4J A;  4CJW A;  3VQP A;  3O3G A;  3KIO A;  1I3A A;  1O1W A;  3PX4 A;  1JLE A;  3ZT4 A;  1J53 A;  4WE1 A;  3V1Q A;  3V9U A;  5FRM A;  4FK2 A;  1C0U A;  2X6S A;  4F4K A;  4BDY A;  2PY5 A;  3L2Q A;  2XY6 A;  3SUO A;  2G8V A;  4F2S A;  4OPJ A;  4DFP A;  4HVJ A;  1HRH A;  2IDO A;  4CIF A;  5HP1 A;  1NK6 A;  1NOY A;  4Q5V A;  3S9H A;  2HNY A;  1SL1 A;  3PO5 A;  2HVI A;  4CJK A;  2DY4 A;  4I2Q A;  4HUG A;  1KLM A;  4LD0 A;  2Z1J A;  2DFE A;  1DTQ A;  1NK4 A;  4C8K A;  4YNQ A;  1RTI A;  1RDC A;  3IAY A;  2YNH A;  3FFI A;  4M3W A;  3QIN A;  2OZS A;  1BI4 B;  3RRH A;  1ZYQ A;  3QLH A;  1BGX T;  4J2B A;  2BGG A;  2D5R A;  1XC9 A;  3VQ8 A;  3OYB A;  3I8D A;  4FJX A;  3HT3 A;  1KLN A;  1S1X A;  3U6F A;  1QTM A;  4B9T A;  2GV9 A;  2PYL A;  1EET A;  3V9Z A;  1KRP A;  3NCI A;  4OJR A;  1C1C A;  4CHP A;  3KLG A;  1VSI A;  1JL2 A;  1ZBL A;  4W5R A;  4DSJ A;  3B6P A;  3V9S A;  2GUI A;  5DK5 A;  4CJU A;  4CHO A;  4HCC A;  2HHW A;  1D8Y A;  4NCA A;  4ELV A;  4PUO A;  4DTS A;  2P51 A;  3TAE A;  3VQA A;  4CJR A;  1HYV A;  4IFY A;  5J2Q A;  1NOZ A;  4F2R A;  4KHN A;  1YTU A;  3RR8 A;  2DFF A;  3VQ4 A;  4CK3 A;  1C0T A;  3OYK A;  4NYF A;  1LWF A;  2YKN A;  3O3H A;  1SL0 A;  3K5L A;  5HRS A;  3AVH A;  5J1E A;  3MAQ A;  4EP4 A;  1TKD A;  2DFH A;  2E6M A;  5JS2 A;  4CES A;  4IFV A;  4FLW A;  3M8Q A;  4CF0 A;  1U4B A;  1S1U A;  1RTH A;  4CED A;  3NE6 A;  2QKK A;  4KI4 A;  3LAM A;  1LV5 A;  2XRI A;  5KRS A;  4OLB A;  3CFO A;  4JRQ A;  2HHV A;  2ATQ A;  1VSK A;  3SPZ A;  3OYC A;  3G0Z A;  3QER A;  4FJ8 A;  4QOZ B;  3OYG A;  2RKI A;  1RBS A;  4OGC A;  2FBY A;  3DLB A;  1S6Q A;  1EKE A;  4NYN A;  1SUQ A;  5T7B A;  3DOK A;  3K5N A;  4ICL A;  4Z4H A;  3NH0 A;  3T1A A;  2KZM A;  3SUQ A;  1TKT A;  1TVR A;  3NAE A;  4DSI A;  4CIE A;  5D3G A;  4LSN A;  5CZ1 A;  4RW4 A;  3JSM A;  4BE1 A;  3EY1 A;  3HJF A;  2ZD1 A;  1RT7 A;  1SKW A;  4W5N A;  1GOA A;  2KW4 A;  3D0P A;  3PX0 A;  1TAQ A;  1BCM A;  1RT6 A;  5I3U A;  3SZ2 A;  3DMJ A;  3VN5 A;  4CJV A;  2A1R A;  4FXD A;  3LAL A;  3NBP A;  2HW3 A;  2HHT A;  3OS0 A;  4KTW A;  3VQ5 A;  4OGE A;  1ZBH A;  3HL8 A;  3AV9 A;  1WSJ A;  3JYT A;  3OYA A;  1XI1 A;  4FJ7 A;  3DRR A;  1TAU A;  4B9M A;  4FZX C;  4ZTF A;  1QQC A;  2F96 A;  5KI6 A;  3I0R A;  4DU4 A;  1NKE A;  4ELU A;  3L2V A;  2HHS A;  2RN2 A;  4CEF A;  1QSL A;  1GOB A;  3P83 D;  1RBR A;  3SQ2 A;  3OJS A;  4IG0 A;  3L3U A;  3HYF A;  2LSN A;  4B9V A;  5C42 A;  4FK0 A;  3ZSV A;  1D5A A;  2WOM A;  3DLR A;  4H4O A;  5J2N A;  1JKH A;  1T03 A;  4O55 A;  1TL1 A;  1HNV A;  3MEE A;  3HP6 A;  1CLQ A;  4O44 A;  4DFK A;  3IG1 A;  4CEZ A;  4FZZ A;  3OYJ A;  4HTU A;  3HST B;  3VQC A;  3SPY A;  3LWM A;  3NH2 A;  3AVM A;  4AHU A;  4O0I A;  5CYQ A;  4E3S A;  1N6Q A;  1NJW A;  5HLF A;  3KK3 A;  2OPP A;  4EZ6 A;  3WNF A;  4DLG A;  1LAW A;  3DI6 A;  1RBV A;  2G8W A;  4BWM A;  1IKY A;  2YKM A;  1RTJ A;  1X9M A;  2HHQ A;  1WSF A;  3TAG A;  3OYH A;  4CEB A;  1NKB A;  3NDK A;  4KHS A;  4Z4F A;  3DRS A;  1TV6 A;  3LP1 A;  3NF9 A;  2E6L A;  4FYD A;  3ZSX A;  3TAP A;  4DFM A;  1XHX A;  4FJK A;  4E7J A;  4CJL A;  5HRR A;  3MEC A;  4CF9 A;  2Z1I A;  4HCB A;  1UWB A;  4PA1 A;  4AIL C;  1Z25 A;  4KKO A;  2Y1J A;  3HPG A;  3AVB A;  1VSD A;  1BL3 A;  1VSM A;  2VG6 A;  3U3G A;  3VQB A;  1RDD A;  4L8R B;  2HHU A;  5FRO A;  3SNN A;  4DG1 A;  3C95 A;  5SWM A;  4FM1 A;  4CJ3 A;  2NUB A;  3AVN A;  2IAJ A;  4E7K A;  4FLY A;  4M3X A;  3DYA A;  4E1N A;  3NH1 A;  1VRT A;  1WSE A;  4KPY A;  2F8T A;  3RMD A;  1C6V A;  4R5P A;  4KI6 A;  4FW1 A;  4KRE A;  1WNS A;  3AVA A;  3QET A;  3QES A;  1FXX A;  5HBM A;  1A5W A;  4OPK A;  4FJI A;  3AA4 A;  4FLX A;  3L2U A;  2G8I A;  2HND A;  2F8S A;  3K5O A;  1TKX A;  4MQ3 A;  4DTJ A;  3AVL A;  3RMC A;  1UA0 A;  4RW6 A;  3CYM A;  4NCG A;  4CEC A;  4KB0 A;  1ASV A;  4Z0U A;  1C0M A;  2ZQB A;  4CJF A;  1NKC A;  1WLJ A;  1RT2 A;  3P5J A;  1IKX A;  1RT3 A;  4YFU A;  1HJR A;  1HYS A;  3ISN C;  1X9S A;  4FJ9 A;  3VA0 A;  1VSL A;  3K57 A;  3LZJ A;  4NCB A;  3DLE A;  4W5T A;  2PZS A;  2D0A A;  3HPH A;  4C8L A;  4M42 A;  1J5O A;  2OYQ A;  3NGI A;  2R7Y A;  4RW8 A;  4CGF A;  3S3O A;  2G8U A;  1UA1 A;  3ZSQ A;  4DSL A;  2Y1I A;  4QAG A;  3AVF A;  4F3O A;  1BHL A;  4FK4 A;  1JLG A;  3H08 A;  3OYM A;  4JS5 A;  1TK5 A;  1NJZ A;  4M3R A;  3OYI A;  4FJH A;  1FK9 A;  1JLQ A;  3TAB A;  4M3U A;  3DRP A;  1Q8I A;  3VQE A;  4AHS A;  4KHU A;  4M3T A;  2HB5 A;  3AVJ A;  3RTV A;  4DS5 A;  4KO0 A;  4E19 A;  4I9L A;  3KD5 E;  1KFS A;  1B92 A;  3NF8 A;  1U49 A;  5HRN A;  4ID5 A;  3LPU A;  4JLH A;  3O4Q A;  3MXJ A;  1I39 A;  1VSH A;  4O0J A;  1U48 A;  4CCH A;  4BDZ A;  3V9X A;  2YHB A;  1CXU A;  1RNH A;  1QE1 A;  4CFA A;  1RDB A;  4CEA A;  4CJT A;  3KJV A;  4E7H A;  5J2M A;  1JLF A;  2FC0 A;  4IBN A;  4CER A;  3ZSY A;  1NK5 A;  4K8Z A;  1TL3 A;  1FKO A;  4ELT A;  3E01 A;  1BCO A;  4DTN A;  1T05 A;  1HNI A;  3F73 A;  4BE0 A;  1IO2 A;  3CFP A;  3LAK A;  1S9E A;  2Q3S A;  1BQN A;  2Z1G A;  3C94 A;  3KKR A;  2W42 A;  3AVK A;  1KSP A;  3ZT2 A;  1IG9 A;  4J2A A;  3CM5 A;  5JS1 A;  1S6P A;  3M8R A;  2ITG A;  4HHT A;  2O4I A;  1HMV A;  5K14 A;  3OYD A;  4O4G A;  4FLV A;  3KK1 A;  1R0A A;  3RR7 A;  2OPS A;  1S9G A;  3CM6 A;  1L3T A;  4I9Q A;  3A2F A;  3V1R A;  3CG7 A;  3VQQ A;  4N5S A;  1KVA A;  1JLA A;  3OS2 A;  4BAC A;  4DLE A;  3ALY A;  1ZBI A;  2JGU A;  2HVH A;  1HQE A;  4RW9 A;  4DTO A;  3NFA A;  1KFD A;  1SKS A;  2IGI A;  1EP4 A;  3ASM A;  3OVN A;  4E89 A;  3O3F A;  4DTU A;  4CE9 A;  4AHC A;  3HO1 A;  4F8R A;  2XY7 A;  1Z26 A;  5CZ2 A;  4CJP A;  4B08 A;  3WNE A;  1W0H A;  3KLH A;  4GVM A;  2BE2 A;  2OPR A;  3QEP A;  3VQ9 A;  3ZSR A;  4FJL A;  4FJM A;  4EZ9 A;  4CFB A;  1TK0 A;  4KRF A;  3HK2 A;  1DLO A;  3S3M A;  2DTU A;  1LW0 A;  1X1P A;  4DTM A;  3M8S A;  3RMA A;  3DM2 A;  4CHZ A;  3AVI A;  4AHR A;  1KTQ A;  3L8B A;  4GMJ B;  4LH4 A;  4LSL A;  3WNH A;  3KLI A;  3NGZ A;  2XY5 A;  4Y1C A; 
#chains in the Genus database with same CATH topology
 2P9K A;  2ITM A;  3ZEU A;  5LMU K;  5F1X A;  3TAN A;  4JN4 A;  4F9O A;  1S1V A;  1W9H A;  3OYL A;  2FBX A;  1TYQ B;  2FF3 B;  1TKZ A;  3THY B;  2E5L K;  1K6Y A;  2QWQ A;  3KK7 A;  4FCY A;  2RPI A;  2A1S A;  3CJ1 A;  3VF6 A;  1ITG A;  3HVT A;  3F2K A;  4KTZ A;  4GY2 B;  3ZCM A;  2GBZ A;  4JI1 K;  3AO2 A;  2NRR A;  3TSQ A;  5GAE P;  1S1T A;  3L6Q A;  3R1X A;  2YHA A;  3ZLJ A;  3ID6 A;  3OA9 A;  4NLB A;  1EWQ A;  5DMR A;  4PKH A;  3V81 A;  3F9K A;  3P39 A;  4Z4I A;  1NBW A;  1Q7Y O;  3IMX A;  5IWA K;  2KZZ A;  1P90 A;  3QIO A;  2OPQ A;  3AA3 A;  1ZBU A;  2ZGY A;  4BC4 A;  1JLB A;  3B6O A;  3ENH A;  5E41 A;  3LM9 A;  3LPT A;  3S3N A;  5AQI A;  1WBD A;  1YF5 L;  3C6T A;  4CJ4 A;  4DQI A;  4DV7 K;  3D2E A;  2KHO A;  4RG8 A;  4Z4E A;  3UIQ A;  3OS1 A;  4JI6 K;  3U9Z A;  4CHN A;  1Q82 O;  3LDL A;  2PAV A;  1WUA A;  4H0Y B;  4HWI A;  2CGL A;  4BC2 A;  4B9L A;  1NGI A;  1HPZ A;  4I6M A;  1NJX A;  3QML A;  1GLC G;  4PL8 A;  3QNO A;  3THY A;  3PIO L;  3OYE A;  4CF8 A;  4DQR A;  5M1O A;  2PYJ A;  1ZBS A;  4B3O A;  3QBW A;  3CPE A;  3HP9 A;  4JS4 A;  1DKG D;  2NRZ A;  3U8X A;  3QEX A;  1BDG A;  4WF9 L;  3V6D A;  3PIP L;  4MFB A;  4KHQ A;  1OKJ A;  4ISG A;  4ZTJ A;  4CIG A;  4B9U A;  4JKG B;  3LP2 A;  4Z94 A;  1RBU A;  3ZSO A;  4N56 A;  2GTD A;  1JCF A;  3OY9 A;  4FWL A;  5C25 A;  4CGH A;  4DKW A;  1JCE A;  3MCA B;  3BZK A;  1BQM A;  1YVU A;  3O1W A;  3SMS A;  1EXQ A;  3T1Y K;  3V9W A;  1T8E A;  3K5M A;  4KHW A;  4BRQ A;  3MEG A;  1K8K B;  2O8B B;  5C0Y A;  4CGG A;  4GKJ K;  4CZJ A;  3THX A;  1S5J A;  1NGH A;  3PSF A;  1X9J A;  2UXC K;  2P5O A;  1KVB A;  1T3V A;  4DMN A;  5AR0 A;  2G8F A;  4CFC A;  4XH1 A;  3CQ8 A;  4BRC A;  1NK7 A;  4BY9 C;  4C1N I;  3BDP A;  3VEN A;  2QM1 A;  3SQ4 A;  4DU3 A;  3WXI A;  4LH5 A;  3CC2 N;  2FLO A;  4BWJ A;  3SI6 A;  4BRH A;  3SQ1 A;  3NF7 A;  3L3V A;  4CEO A;  3QEW A;  4CHY A;  3SUP A;  2HBK A;  1YIT N;  1KAZ A;  4BE2 A;  5KTQ A;  1N5Y A;  1L3V A;  1Q9X A;  1XWL A;  4H0O A;  5KGW A;  4LF9 K;  1VQ5 N;  3DLG A;  4JI0 K;  2B4J A;  3KIO A;  1O1W A;  3ZT4 A;  4DV6 K;  1J53 A;  1NGJ A;  3V1Q A;  5FRM A;  4MLH A;  3VF4 A;  3ID8 A;  5BN8 A;  4A5B A;  3L2Q A;  3OW2 M;  2WBN A;  5HP1 A;  3S9H A;  4I2Q A;  1DTQ A;  1RTI A;  3KVG A;  1RDC A;  4YOW A;  3IAY A;  3FFI A;  4M3W A;  3QIN A;  5ELZ A;  1DT9 A;  4IO9 L;  1HR0 K;  2HHH K;  1KLN A;  1S1X A;  1QTM A;  4B9T A;  2PYL A;  3BY5 A;  3DJC A;  1YHQ N;  1D4X A;  1JL2 A;  1RGI A;  3KWG A;  3B6P A;  2Q36 A;  3LM2 A;  2GUI A;  2HHW A;  4NCA A;  4ELV A;  4PUO A;  4FWM A;  5I9E B;  3THW A;  2P51 A;  5J2Q A;  3O5B A;  3O3H A;  1SL0 A;  3K5L A;  4EP4 A;  2E6M A;  4FLW A;  2G8W A;  1HKB A;  1I94 K;  4CED A;  2D0P A;  5KRS A;  2A6A A;  2H3G X;  2HST A;  3SPZ A;  4FJ8 A;  4DV0 K;  1RBS A;  2A3Z A;  2FBY A;  2WFB A;  5CHI A;  2V7Y A;  4BRO A;  3D6R A;  4Z4H A;  3E9O A;  1TVR A;  3NAE A;  4A61 A;  1VQ9 N;  1ZC6 A;  2IVN A;  5CZ1 A;  4CZK A;  4BE1 A;  5GIP A;  1RT6 A;  3SZ2 A;  5FPD A;  4KTW A;  5AQU A;  1YI2 N;  4JHD B;  3HL8 A;  2FF6 A;  2I7N A;  1XI1 A;  5EXW A;  5AQF A;  5KI6 A;  2HHS A;  1SAZ A;  3L2V A;  3P83 D;  3SQ2 A;  3L3U A;  4RCH A;  2LSN A;  4B9V A;  5C42 A;  4H4O A;  2W6L A;  5J2N A;  4DHY A;  4JI4 K;  2I7P A;  3JXU A;  3VTI A;  1CLQ A;  4O44 A;  3ZX3 A;  3CMA N;  3IG1 A;  3ENO A;  4FZZ A;  4HTU A;  3FLC O;  3HST B;  4OPH A;  5BRE A;  3SPY A;  3NH2 A;  3AVM A;  2Q1N A;  5HLF A;  3NVM A;  2ASP A;  4EZ6 A;  3WNF A;  4DLG A;  1T6C A;  2HOE A;  4BRD A;  3GE1 A;  1X9M A;  2HHQ A;  4JK8 A;  1WSF A;  5BPL A;  3QB0 A;  4CEB A;  4KHS A;  3DRS A;  3NF9 A;  2E6L A;  3P38 A;  3ZSX A;  2AP1 A;  3CJA A;  2UU9 K;  2Z1I A;  4PA1 A;  1Z25 A;  3HPG A;  3AVB A;  1YXQ A;  1BL3 A;  2HHU A;  2VG6 A;  4PKG A;  1RDD A;  5FRO A;  4FM1 A;  3C95 A;  5SWM A;  4DR5 K;  2YHW A;  4E7K A;  1XMO K;  3FFK B;  5DM7 L;  4E1N A;  3TSP A;  2CGJ A;  4KPY A;  3G6E N;  1C6V A;  4JYA K;  5C10 A;  2BH1 A;  1S22 A;  2O8E B;  1YAG A;  1FXX A;  5HBM A;  2UUA K;  4GV6 A;  4IJN A;  2F8S A;  1P8Z A;  3MN5 A;  4MQ3 A;  4NCG A;  2Q31 A;  1C0M A;  4UY8 O;  1HYS A;  1NGD A;  1RT3 A;  4YFU A;  1SS6 A;  1QQN A;  4DR2 K;  3EEQ A;  3A8Y A;  3LZJ A;  4NCB A;  3DLE A;  3OBW A;  3C7N A;  2KLA A;  4CVN E;  1V4T A;  3AVF A;  1K8K A;  1BHL A;  1N34 K;  1JLG A;  3TAB A;  4M3U A;  3VQE A;  4M3T A;  4E19 A;  1K73 O;  1U49 A;  4K42 A;  3FGU A;  3UB5 A;  4AQY K;  3WXL A;  4JKG A;  4LFB K;  1I39 A;  4CCH A;  2QXL A;  2YHB A;  1NGC A;  3ZSY A;  3GDQ A;  4A2B A;  3HOT A;  1TL3 A;  4A5A A;  3H3N O;  1BCO A;  5AQL A;  3ULE A;  4EFH A;  4FOI A;  1X3N A;  3C94 A;  1IG9 A;  4J2A A;  4A59 A;  1S6P A;  1QZ6 A;  3L4I A;  3OYD A;  4FLV A;  5AQM A;  2GEM A;  4N5S A;  2FSJ A;  4BAC A;  1XNQ K;  2V7Z A;  2JGU A;  4RW9 A;  1SKS A;  4X65 K;  2IGI A;  1EP4 A;  3QDK A;  3ZX2 A;  4CE9 A;  4DR6 K;  4IJA A;  3KLH A;  2BE2 A;  3R6M A;  4CBX A;  1MWK A;  4FJM A;  4EZ9 A;  5HOO A;  3WQT A;  3HK2 A;  4KRF A;  3S3M A;  3D2F A;  2UXD K;  4X66 K;  1KTQ A;  1XC3 A;  5FPE A;  4YHH K;  2XY5 A;  4NO7 A;  4Y1C A;  4FK0 A;  4PQU A;  2FBT A;  2D1K A;  3I8B A;  1RT4 A;  5KRT A;  3KLE A;  2NLX A;  2IOC A;  2YCH A;  4RW7 A;  4CGD A;  4IXC A;  5KGX A;  3HSC A;  3SUN A;  1NU0 A;  3VA3 A;  3O9T A;  3QEI A;  3AAP A;  4EHT A;  4H4M A;  2OA8 A;  4DR1 K;  1J54 A;  4G1Q A;  4M3Z A;  4C8M A;  3A0I X;  1Q86 O;  2B5J A;  4DU1 A;  3LDS A;  1VQ7 N;  3MED A;  4G9Z A;  1UOC A;  2O8C B;  4LF8 K;  5HL7 L;  3HVR A;  1BA1 A;  3OYF A;  4LF4 K;  3H46 O;  3T3F A;  3T19 A;  2F9T A;  3C6U A;  1C1B A;  2HNZ A;  5FLX O;  1QQO A;  3PX6 A;  4FW2 A;  4GNI A;  4DTP A;  4JKF A;  5AZI A;  4Y0W A;  4DFJ A;  4CZH A;  2EHG A;  4WQ4 A;  3EKU A;  3VQ7 A;  1KAY A;  3J81 O;  3D45 A;  3OYN A;  3ITH A;  4B1W B;  3JAM O;  2E2P A;  3NF6 A;  1YIJ N;  1OH6 A;  2VWK A;  4DTX A;  3T69 A;  4DV1 K;  2QK9 A;  5BRD A;  4FJG A;  1MU2 A;  4BC3 A;  3RVC A;  2D4W A;  1YJN N;  5AQG A;  4FJ5 A;  3ZSW A;  3QFP A;  3M8P A;  1REV A;  2QWP A;  3EZ5 A;  3AVC A;  4Z4G A;  4CFD A;  2VQE K;  3L4Q A;  2P5G A;  3VGM A;  4B8C A;  3K2P A;  1QZ5 A;  3SCX A;  5C15 A;  4ILJ A;  3WEE B;  4DV4 K;  3J7A P;  4UQG A;  3O6W A;  3H1Q A;  5KPZ A;  5LJW A;  3MXM A;  2W40 A;  5CYM A;  3K58 A;  1VQN N;  2XY8 A;  3N4P A;  1L3U A;  1CZB A;  3EYZ A;  1SKR A;  4FZY A;  2WTU A;  4IZ9 A;  4ILH A;  4JK9 A;  4YOT A;  1KCF A;  4IG3 A;  3O80 A;  2UUC K;  3LZI A;  3AO3 A;  3NHG A;  3HXM A;  4BRF A;  2EX3 A;  4ILG B;  2FBV A;  5C24 A;  4DQQ A;  2XO7 A;  4CK1 A;  1GLE G;  3VGK A;  1RDW X;  2ZGZ A;  1BIS A;  5E26 A;  3PUF A;  1JCG A;  1SV5 A;  4KFB A;  5HRP A;  4B9N A;  3P31 A;  4CJE A;  2IVO A;  1VQ8 N;  3SMP A;  2IIR A;  2D0C A;  2YHY A;  4FJJ A;  4ZHR A;  4DF8 A;  2P1J A;  2DPN A;  1X3M A;  1YJ9 N;  1RFQ A;  3DOL A;  3P1G A;  4KB1 A;  2VGM A;  2O4G A;  5KQD A;  4ISE A;  3G25 A;  1RTD A;  3THX B;  3PY8 A;  2OCE A;  1SL2 A;  1S1W A;  2QWL A;  2QKB A;  1OVY A;  5AFU H;  2RHK A;  4B1X B;  2OZM A;  1QVF M;  3TAR A;  4JKC A;  3TR8 A;  3WQU A;  4EAH D;  3MN7 A;  4LF7 K;  3THV A;  4F3T A;  2YHX A;  5EVZ A;  4CJS A;  2KTQ A;  1A5X A;  4CI6 A;  3QNN A;  3NGY A;  3WUH A;  4JI7 K;  5E84 A;  4JKB A;  4KTQ A;  1KVC A;  4JKH A;  1XUP O;  1L5U A;  1JXB A;  4M3Y A;  2KFZ A;  4OLA A;  4BDP A;  1Y97 A;  3MCP A;  4X62 K;  4GW6 A;  1X9W A;  4DF4 A;  5C12 A;  4J2D A;  3CJ9 A;  4JRP A;  1LCU A;  1JJ2 M;  4H8K A;  5EOY A;  4CJW A;  1I3A A;  4IEE A;  1KD1 O;  4WE1 A;  3V9U A;  1VQ6 N;  4FK2 A;  2X6S A;  4BR5 A;  3RSE B;  4BDY A;  2PY5 A;  4OPJ A;  4DFP A;  3UKR B;  3PO5 A;  1SL1 A;  2HNY A;  1BUP A;  1Q18 A;  2VGN A;  4CJK A;  4BRG A;  1KLM A;  2DFE A;  3HI0 A;  3C0B A;  1NK4 A;  4C8K A;  3DAW A;  2OZS A;  2NNW A;  4K0K K;  3HZ6 A;  3KZB A;  4H03 B;  4FJX A;  1GLL O;  3U6F A;  2BUP A;  4H0V B;  3ATV A;  4FVU A;  1HNW K;  3EE9 A;  3V9Z A;  1KRP A;  1C1C A;  1U2V A;  3V9S A;  4CHO A;  4BVO A;  4KHP K;  5EX5 A;  2ZM6 K;  1YTU A;  1NOZ A;  4B3M K;  4KHN A;  4CK3 A;  4NYF A;  5J1E A;  1TKD A;  4CF0 A;  4BG9 A;  4IOA L;  3CCV N;  1IBM K;  4KI4 A;  4IOX A;  3MN9 A;  3O4W A;  1VSK A;  5AQT A;  1H1V A;  3QER A;  4DR7 K;  2RKI A;  1M90 O;  3IDH A;  4M7Y A;  3DOK A;  2QTD A;  1NM1 A;  3H6E A;  3NH0 A;  3T1A A;  3SUQ A;  3ZYY X;  1TKT A;  3FZH A;  1OH7 A;  5AZJ A;  1G99 A;  4JD2 B;  3HJF A;  3E1Y A;  1SKW A;  2O8C A;  1GOA A;  3D0P A;  3FZM A;  4L3Q A;  3PSI A;  3PX0 A;  4PHT X;  1BCM A;  3F5T A;  3G4S N;  3NBP A;  3OS0 A;  4OGE A;  1MDU B;  1WSJ A;  3QFU A;  4JAX A;  3OYA A;  4FJ7 A;  3DRR A;  4ZTF A;  2E2Q A;  3CI5 A;  3I0R A;  1NKE A;  1QSL A;  1GOB A;  4JEP A;  2WOM A;  1JKH A;  1T03 A;  4O55 A;  3LDO A;  3MEE A;  3G71 N;  1C0G A;  3C6A A;  3OYJ A;  5JMV A;  1XNR K;  4U7B A;  5AQX A;  5CYQ A;  3KK3 A;  3K0S A;  3T7Z A;  2VCP A;  3DI6 A;  4JHD A;  2OTL N;  1MWM A;  3A5N C;  2YKM A;  1RTJ A;  5FPM A;  3OYH A;  4CZL A;  1NKB A;  2E2N A;  2VQF K;  5AZI B;  2O8F A;  3TAP A;  1XHX A;  3A5L C;  4HCB A;  3WEE A;  5C2F A;  4KKO A;  4NXM K;  3VQB A;  3SNN A;  5BRF A;  4FLY A;  4M3X A;  3DYA A;  3NH1 A;  4LC9 B;  4KRE A;  3QES A;  4CD1 A;  5DM6 L;  2G8I A;  4OPK A;  1W7A A;  3AA4 A;  4FJI A;  5CE3 A;  4O5F A;  3K5O A;  1HPM A;  3LDN A;  4JK7 A;  2W6K A;  3CME N;  3LL3 A;  1ASV A;  5GIN A;  4Z0U A;  3VEX A;  4CJF A;  3SLC A;  1NKC A;  1IKX A;  4AM6 A;  1FW6 A;  1HJR A;  1V4S A;  4GVE A;  1X9S A;  4BGA A;  4JKA A;  3VA0 A;  1E4F T;  4FPB A;  4IEI A;  2PZS A;  4C8L A;  4IOC L;  2R7Y A;  1UA1 A;  2Y1I A;  3EO3 A;  4FK4 A;  3H08 A;  4DCH A;  3K9K A;  1FK9 A;  4FJH A;  3DRP A;  4M63 C;  4AHS A;  4KHU A;  2HB5 A;  3AVJ A;  1T44 A;  3KD5 E;  2F7T A;  4JLH A;  1N33 K;  4BDZ A;  3V9X A;  3M1F A;  1CXU A;  4PKI A;  1RNH A;  3DXK A;  5M1N A;  4KH4 A;  1RDB A;  1YJW N;  1JLF A;  2Q97 A;  4IBN A;  1E4G T;  4YOR A;  4MDA A;  4BG8 A;  2V51 B;  3IFR A;  3UKU B;  4BE0 A;  3LAK A;  3C7N B;  3E9L A;  2Q3S A;  2GX9 A;  2W42 A;  3KKR A;  1KSP A;  1NGE A;  3CM5 A;  5K14 A;  5M1F A;  3DWL A;  3KK1 A;  1Y64 A;  2OPS A;  1S9G A;  1L3T A;  3A2F A;  3V1R A;  4EIA A;  2NZT A;  2HVH A;  5AQO A;  3L0Q A;  1KFD A;  3OVN A;  4IDH A;  5CR4 A;  1QQM A;  2OAN A;  4MLE A;  5CZ2 A;  3VEY A;  4B08 A;  4CJP A;  5GIO A;  3ATU A;  3TTC A;  1MA9 B;  2OPR A;  4IO8 A;  3TU5 A;  3VQ9 A;  1WOQ A;  3CD6 N;  2AA4 A;  5H1S Q;  1GLD G;  3M8S A;  3EL2 A;  5LJV A;  3DM2 A;  5AFU A;  4AHR A;  4GMJ B;  3WNH A;  1IG8 A;  4BVP A;  1T6D A;  4WFN L;  2RE2 A;  2UUB K;  4Y1D A;  4OX9 K;  3KWI A;  5AQW A;  1RIL A;  1BOT O;  3VEV A;  4FWO A;  1KC8 O;  1FKP A;  4O5B A;  2E4L A;  4BRN A;  3VEW A;  3V4I A;  3KK2 A;  1U2V B;  1LAV A;  4CZM A;  2D0O A;  1XQS C;  3RSE A;  1IKW A;  1VSJ A;  2QXF A;  1NNE A;  4OKE A;  1HQU A;  3LDP A;  5FDL A;  5AQP A;  3SV3 A;  1OH5 A;  4B9S A;  3UKR A;  3IS9 A;  3M5R A;  3L2W A;  1W97 L;  3TAM A;  1D9D A;  3AO1 A;  2ZE2 A;  1RDU A;  1U47 A;  4HUF A;  2P9S A;  2YNI A;  4CBU A;  2WUS A;  4E0D A;  3PLA A;  3KKS A;  2P9U B;  1L3S A;  3IKM A;  3BEX A;  1HX1 A;  3O4N A;  5LMN K;  1CZ9 A;  2ETJ A;  2VG5 A;  3QIC A;  3SAF A;  1C1A A;  3PO4 A;  5KPT A;  4BR4 A;  4GV3 A;  1VSE A;  4OKJ A;  3WT0 A;  3WXJ A;  3TWH A;  1VK0 A;  4B1V A;  3VQ6 A;  4FM0 A;  3A5M C;  3BF1 A;  4E7I A;  5AQS A;  2O8E A;  1J9A A;  1WSH A;  1DGK N;  3G10 A;  1B9D A;  4CEE A;  3SJJ A;  3CXC M;  3RMB A;  1G15 A;  1K9M O;  4IFE A;  1GOC A;  1JLC A;  4C23 A;  3SV4 A;  4WYB A;  1IBL K;  5BR8 K;  1WN7 A;  4NLC A;  2GEL A;  4C8O A;  1U45 A;  1XMQ K;  3K59 A;  4BRA A;  1UAX A;  1CXQ A;  3QEV A;  3SQ0 A;  3HOS A;  2X6N A;  5AQR A;  3FZL A;  3BUZ B;  3AA5 X;  2AJQ A;  3OJU A;  3ZT0 A;  4LF5 K;  4FM2 A;  4WFB L;  3MXI A;  1QS4 A;  3AO5 A;  3AY9 A;  2QWN A;  4Z4C A;  1LWE A;  5SZT A;  4FLU A;  4CGJ A;  3BF3 A;  1NK9 A;  2JWL A;  2QW9 A;  1TK8 A;  3I0S A;  4LY7 A;  3BGR A;  1U04 A;  1ZBF A;  2P9L B;  3VEO A;  4BQL A;  1QHA A;  3AO4 A;  4CJ5 A;  2F9W A;  4QS7 A;  3KLF A;  5LY3 A;  4E1M A;  1E3M A;  4K41 A;  3FZK A;  3R9P A;  1NK0 A;  3BP8 A;  1JL1 A;  1ASW A;  4C8N A;  3LWL A;  2P9N B;  1NGA A;  4H0P A;  1S3X A;  5TKY A;  1RT5 A;  5GAG P;  1WAF A;  1W2B M;  1Z6R A;  4DS4 A;  3LP0 A;  1DTT A;  4BGB A;  4DTR A;  4DR3 K;  2RF2 A;  3CC7 N;  1GLJ O;  4BRK A;  4IKF A;  2XHB A;  3D2F B;  4DQP A;  4OKK A;  4N41 A;  4JNE A;  3QIP A;  5JVH L;  1NG9 A;  3V1O A;  1ATS A;  1YT3 A;  3D7E O;  3MK6 A;  4QCL A;  2B6A A;  2V52 B;  1Q9Y A;  4DSF A;  5F0X A;  5ADX H;  2YNG A;  4W5O A;  2BAN A;  2GWK A;  4A2A A;  3RRG A;  3TI0 A;  1TUY A;  2HHX A;  1WSG A;  1IV0 A;  3H3O B;  3RWU A;  4AHV A;  3VER A;  4CJQ A;  3U3Y A;  1U6Z A;  3DXK B;  3ULD A;  4HUE A;  1VQM N;  4OPA A;  4I6M B;  3OTO K;  3VQP A;  1JLE A;  3MN6 A;  3OBY A;  1C0U A;  4F4K A;  5M1P A;  2CGK A;  5AQQ A;  2XY6 A;  3SUO A;  4MDB A;  3UE5 A;  2G8V A;  4AF1 A;  2P9N A;  1NK6 A;  4BR2 A;  2HVI A;  2Z1J A;  1ATR A;  3QBX A;  3T1H K;  2CH6 A;  1QVG M;  3O8M A;  2P9L A;  5EY4 A;  2YNH A;  3CQY A;  4A57 A;  3RRH A;  1ZYQ A;  4J2B A;  2D5R A;  3TTF A;  1HNX K;  3VQ8 A;  3I8D A;  2NRW A;  2P9I A;  1EET A;  1GLA G;  3NCI A;  3KLG A;  1ZBL A;  4CJU A;  1D8Y A;  3VOV A;  4DTS A;  3TAE A;  4F2R A;  1HYV A;  3FR0 A;  3VQ4 A;  1C0T A;  4H0T B;  1LWF A;  1HKG A;  2YKN A;  1FJG K;  4YDU C;  4B3T K;  4DSJ A;  1VQK N;  4CES A;  5JS2 A;  1ESV A;  3M8Q A;  4BR9 A;  1U4B A;  3DXM A;  1RTH A;  3NE6 A;  2QKK A;  1NWK A;  3LAM A;  1Q81 O;  3CJB A;  3GL1 A;  4OLB A;  3CFO A;  4JRQ A;  2HHV A;  3OYC A;  3G0Z A;  4K43 A;  3OYG A;  3K9J A;  4ISF A;  4RTF D;  4OGC A;  1S6Q A;  1EKE A;  4FWQ A;  1SUQ A;  3K5N A;  2KZM A;  3H45 C;  4QS8 A;  4MO5 A;  1HNZ K;  4RW4 A;  3JSM A;  3EY1 A;  4RWT A;  2ZD1 A;  1SZ2 A;  2UYT A;  3CQX A;  4FL9 A;  1TAQ A;  2PBD A;  3DMJ A;  4CJV A;  2HHT A;  3LAL A;  3S41 A;  1ZBH A;  5AQK A;  3AV9 A;  5LL6 Z;  1TAU A;  4B9M A;  1EO1 A;  1QQC A;  2F96 A;  4JKD A;  4DU4 A;  2P9P B;  4ELU A;  2RN2 A;  4IG0 A;  3HYF A;  1VAZ A;  2A41 A;  3ZSV A;  5AJ3 K;  3DLR A;  3ULE B;  3U9D A;  4B1Y B;  5M1Q A;  3VES A;  2ASO A;  1TL1 A;  1HNV A;  3D2E B;  3HP6 A;  4DFK A;  1M1K O;  2NRV A;  4BRE A;  2YX6 A;  2YI1 A;  1NJW A;  2OPP A;  1ZXO A;  1LAW A;  2HMP A;  2WC9 A;  1RBV A;  1EQY A;  4BWM A;  1SQK A;  2E2O A;  4GKK K;  3TAG A;  3CCJ N;  4Z4F A;  3NDK A;  5BPM A;  1TV6 A;  1BG3 A;  4CJL A;  5HRR A;  3MEC A;  4CF9 A;  2UXB K;  1UWB A;  1VSD A;  4L8R B;  3U3G A;  2Q0U A;  3DXM B;  3P4I A;  5MLC Q;  3JS6 A;  5F2R A;  1VRT A;  1WSE A;  3R8E A;  4WCE L;  3CCE N;  4KI6 A;  1WNS A;  3AVA A;  3LDQ A;  2ASM A;  3L2U A;  2HND A;  3HBT A;  1BO5 O;  2F8T A;  1BWF O;  4DTJ A;  3AVL A;  3RMC A;  1UA0 A;  4RW6 A;  3CYM A;  4CEC A;  1VQ4 N;  4FWK A;  1CZA N;  5ADX A;  1RT2 A;  3P5J A;  3ISN C;  1YUW A;  3K57 A;  2NRT A;  2D0A A;  3HPH A;  1J5O A;  2OYQ A;  4RW8 A;  4CGF A;  4JI2 K;  3S3O A;  3ZSQ A;  4DUZ K;  4DSL A;  1BA0 A;  4V19 S;  3NVK A;  3A5O C;  4JS5 A;  1NJZ A;  4M3R A;  4JI8 K;  5BPN A;  3CCQ N;  3M3Z A;  3M6G A;  4B9Q A;  2HBM A;  3HRG A;  4KO0 A;  4I9L A;  4KH5 A;  3NF8 A;  2A40 A;  5JVG L;  3LPU A;  4H5R A;  2JWK A;  1U48 A;  4YOY A;  2E8A A;  4B1U B;  4CFA A;  3KJV A;  5IT9 O;  4K8Z A;  3O9R A;  4YOV A;  4ELT A;  3E01 A;  1HNI A;  1IO2 A;  3UKU A;  1S9E A;  2O8D B;  1BQN A;  2E1Z A;  3AGK A;  3AVK A;  3ZT2 A;  3M8R A;  2O8B A;  2O4I A;  4HHT A;  3SK3 A;  1HMV A;  2EWS A;  4H5V A;  4O4G A;  3RR7 A;  5AQH A;  4A62 A;  3CM6 A;  2ZJQ L;  3OS2 A;  4DLE A;  3MWP A;  3O1B A;  3O9S A;  4LFC K;  3NFA A;  3SAG A;  1WBB A;  1J5E K;  3ASM A;  4E89 A;  4AHC A;  3HO1 A;  2XY7 A;  4AM7 A;  4FSV A;  4FPA A;  4DV2 K;  2GUP A;  3ZSR A;  4CFB A;  3AGR A;  4EHU A;  5FPN A;  4DTM A;  5AQZ A;  3RMA A;  1N32 K;  4CHZ A;  2QI2 A;  3L8B A;  4LH4 A;  3KLI A;  3GBT A;  3O08 A;  5BRH A;  5AQN A;  3EKS A;  4BR0 A;  3DLH A;  1EX4 A;  2P9S B;  2P9K B;  2Z1H A;  3ZEU B;  1TYQ A;  1ATN A;  4ID1 A;  2P9I B;  4W5Q A;  3EZW A;  4M41 A;  1A5V A;  3VEZ A;  3TAQ A;  2I5J A;  4XH5 A;  3CJC A;  3L2R A;  4DWI A;  2IS3 A;  4M45 A;  4CK2 A;  3CJ7 A;  4TSX A;  2PFU A;  2YV0 X;  3AAR A;  3R3L A;  4XIU A;  5EU7 A;  4GV9 A;  1XHZ A;  2VG7 A;  1JXE A;  3OHR A;  1NMN A;  4XEI A;  4PWD A;  3PV8 A;  4OO1 J;  3VGL A;  4K25 A;  2IC3 A;  1QHT A;  3SYZ A;  1IKV A;  4WQ5 C;  4CF2 A;  1RCH A;  5M1K A;  3Q7B A;  3EE8 A;  1RT1 A;  2O8F B;  3ZT1 A;  1VRU A;  4PY5 A;  4FLT A;  1NK8 A;  4JKE A;  3U4L A;  1LOT B;  3IRX A;  3WXK A;  3KD1 E;  1HYZ A;  1TUU A;  3HM8 A;  5AQV A;  4H5T A;  2WON A;  2YNF A;  4DUY K;  2NRX A;  3MMV A;  3MX5 A;  4KAZ A;  3KTQ A;  4O8K A;  4E1J A;  5KPR A;  2ZJR L;  3J7Y P;  2JLE A;  2G8K A;  4I7F A;  1IH7 A;  1VQP N;  4CF1 A;  2Q0R A;  4KHY A;  4KV8 A;  2KFN A;  3MWT A;  4FJN A;  1BIU A;  3AAQ A;  3QO9 A;  4WFA L;  3TAF A;  1ASU A;  2NRH A;  5TKW A;  1QSY A;  1TGO A;  4DSK A;  2HF3 A;  2E1Y A;  3CPW M;  4I2P A;  4J2E A;  4BC5 A;  1NMD A;  3LAN A;  2A42 A;  1QSS A;  4LF6 K;  5J2P A;  4FVM A;  1LWC A;  2VWB A;  1RDA A;  5AQJ A;  4B8A B;  2X78 A;  4YOU A;  4K8X A;  4FO0 A;  4H0X B;  3ZET A;  1WSI A;  5CY4 A;  1YTA A;  5I42 A;  4AHT A;  2F4V K;  5HRO A;  3I33 A;  4FLZ A;  1S72 N;  1BI4 A;  1WB9 A;  3LP3 A;  4CHQ A;  4CGI A;  4YY3 K;  3ZSZ A;  4DQS A;  2VYP A;  1BIZ A;  1B9F A;  3HM9 A;  4YDU A;  4N47 A;  1GLF O;  3SJH A;  1F21 A;  5JLH A;  4FWN A;  2YJF A;  4Q0B A;  2E20 A;  3FZF A;  1KQS M;  2X74 A;  3AVG A;  3VQD A;  1NGG A;  3CFR A;  4IDK A;  1NGF A;  4H5N A;  3CHW A;  1D9F A;  3WNG A;  2VWJ A;  4WQ5 A;  3DLK A;  4FWP A;  4DB3 A;  2BDP A;  2BTF A;  4CEQ A;  3C6H A;  4U67 L;  3AA2 A;  3MDQ A;  3ZT3 A;  4EP5 A;  4WQ4 C;  4LFA K;  1VSF A;  4B3R K;  2HMI A;  1T7P A;  5AZJ B;  5BR9 A;  3ENB A;  3FE1 A;  1GLB G;  3SBG A;  1LW2 A;  4CZI A;  1N36 K;  1NJI O;  1VQL N;  2G8H A;  4FOE A;  4AH9 A;  3VMF B;  1WAJ A;  4DSE A;  2QWM A;  1NJY A;  1RBT A;  2D0B A;  4N76 A;  3CCU N;  5FRN A;  2GWJ A;  2KQ2 A;  4E7L A;  3Q7C A;  3HPO A;  2FXU A;  1N8R O;  4OVL A;  4BQZ A;  4HTL A;  2W41 A;  5GAD P;  3O3G A;  4BRM A;  2OTJ N;  3PX4 A;  3F9M A;  4M7X A;  3WXM B;  3CIP A;  4F2S A;  4HVJ A;  1HRH A;  1R59 O;  2IDO A;  3O9Q A;  4CIF A;  1NOY A;  4Q5V A;  2DY4 A;  4HUG A;  4LD0 A;  3W3D A;  2ZWH A;  4YNQ A;  1O13 A;  2E88 A;  4B3S K;  1BI4 B;  5JIC A;  3QLH A;  1BGX T;  3E66 A;  2BGG A;  3N4Q A;  1XC9 A;  4IWV A;  3OYB A;  4FWR A;  3HT3 A;  1OH8 A;  2GV9 A;  3DLL L;  2FSK A;  4C1N K;  4OJR A;  4CHP A;  1VSI A;  4W5R A;  3THW B;  5DK5 A;  4HCC A;  2ZF5 O;  3VF2 A;  3VQA A;  4CJR A;  4IFY A;  3RR8 A;  3TSU A;  3CCL N;  2DFF A;  3VPZ A;  3OYK A;  2YJE A;  4NXN K;  5HRS A;  3AVH A;  3W0L A;  1HLU A;  3MAQ A;  2DFH A;  5GAH P;  4CBW A;  3IUC A;  1HJO A;  4IFV A;  1S1U A;  4DV5 K;  1LV5 A;  2XRI A;  1K8A O;  2ATQ A;  4BRL A;  2FSN A;  4QOZ B;  2J4R A;  5JLF A;  3DLB A;  2KKZ A;  4NYN A;  5B8H A;  5T7B A;  4ICL A;  1NLV A;  4DSI A;  4CIE A;  3CC4 N;  5D3G A;  4LSN A;  1RT7 A;  4DV3 K;  4W5N A;  2KW4 A;  1EWR A;  5I3U A;  3VN5 A;  4FXD A;  2A1R A;  2HW3 A;  4MO4 A;  3VQ5 A;  4NB4 A;  1DEJ A;  3JYT A;  1Z05 A;  2HF4 A;  1KXP A;  4FZX C;  3H1V X;  3BZC A;  4CEF A;  2QA4 N;  1RBR A;  4J8F A;  3OJS A;  4CZG A;  5A2Q O;  1D5A A;  4JI5 K;  3CER A;  2QEX N;  4PL7 A;  4CEZ A;  3GG4 A;  4CD3 A;  1IJJ A;  1IBK K;  3VQC A;  3LWM A;  3CCM N;  3VTH A;  4O0I A;  4AHU A;  3NMU A;  4E3S A;  1N6Q A;  3J8A A;  4FWS A;  2Q2R A;  2A5X A;  3O9U A;  3HTV A;  2QWR A;  1IKY A;  3LP1 A;  2P9P A;  4FYD A;  4DFM A;  4FJK A;  4E7J A;  2HBJ A;  4AIL C;  2Y1J A;  4DQ8 A;  3VET A;  4DR4 K;  1VSM A;  4JD2 A;  3I55 N;  4CZF A;  4R79 A;  4DG1 A;  4CJ3 A;  2NUB A;  3AVN A;  2IAJ A;  3EN9 A;  3C65 A;  3TPQ A;  3RMD A;  4R5P A;  4FW1 A;  4QS9 A;  3QET A;  1A5W A;  3SBT A;  3ZET B;  4FLX A;  3KHY A;  1TKX A;  4I9Q A;  2HBL A;  4KB0 A;  2CH5 A;  2ZQB A;  1HUX A;  1WLJ A;  3CF5 L;  4FJ9 A;  1VSL A;  1OVQ A;  4BRP A;  4W5T A;  4BRI A;  4M42 A;  3NGI A;  2G8U A;  4QAG A;  4F3O A;  4KBO A;  1YVN A;  3OYM A;  4CJ7 A;  1TK5 A;  3OYI A;  1JLQ A;  2ZJP L;  3B8A X;  1Q8I A;  4B1Z A;  3TTD A;  3ZX0 A;  3RTV A;  4DS5 A;  1ILY A;  4H5W A;  1KFS A;  1B92 A;  5HRN A;  4ID5 A;  3O4Q A;  2IVP A;  1VSH A;  3MXJ A;  4O0J A;  3I56 N;  1BU6 O;  1KAX A;  1QE1 A;  4E7H A;  4CJT A;  4CEA A;  4KH6 A;  5J2M A;  1NK5 A;  4CER A;  2FC0 A;  1C0F A;  2P9U A;  1FKO A;  4X64 K;  4DTN A;  1T05 A;  3F73 A;  3SAH A;  3CFP A;  2Z1G A;  4XH4 A;  3CCS N;  5JS1 A;  2O8D A;  2ITG A;  5C2D A;  3GOI A;  1J6Z A;  4YOX A;  1R0A A;  3E9P A;  3VQQ A;  1VQO N;  3CG7 A;  1KVA A;  1JLA A;  3ALY A;  1ZBI A;  4JI3 K;  3MX2 A;  1HQE A;  4DTO A;  3J7Z O;  4CZE A;  4DTU A;  3O3F A;  5KQ8 A;  4F8R A;  4BR7 A;  1Z26 A;  1VHX A;  3CCR N;  3WNE A;  1W0H A;  1HKC A;  4GVM A;  3J80 O;  3QEP A;  1NGB A;  4FJL A;  3CET A;  1TK0 A;  1DLO A;  2DTU A;  1LW0 A;  1X1P A;  4O8U A;  4CW7 B;  5AQY A;  3AVI A;  2QWO A;  4LSL A;  3NGZ A;  5BN9 A;  4JV5 K; 
#chains in the Genus database with same CATH homology
 4PQU A;  2FBT A;  3DLH A;  4Y1D A;  1EX4 A;  1RT4 A;  5KRT A;  3KLE A;  3TAN A;  4CGD A;  2IOC A;  4RW7 A;  1S1V A;  2Z1H A;  1RIL A;  1W9H A;  5KGX A;  3OYL A;  3SUN A;  3VA3 A;  1FKP A;  2FBX A;  4ID1 A;  3QEI A;  1TKZ A;  4W5Q A;  4M41 A;  1K6Y A;  4H4M A;  1A5V A;  4O5B A;  2E4L A;  2RPI A;  4FCY A;  3TAQ A;  1J54 A;  2A1S A;  4G1Q A;  2OA8 A;  4C8M A;  3V4I A;  1ITG A;  4M3Z A;  3HVT A;  3KK2 A;  2B5J A;  2I5J A;  3L2R A;  4DWI A;  4DU1 A;  3LDS A;  2IS3 A;  4KTZ A;  1LAV A;  3MED A;  3ZCM A;  4M45 A;  1UOC A;  2GBZ A;  3AO2 A;  1IKW A;  1S1T A;  1VSJ A;  2QXF A;  4OKE A;  4CK2 A;  4TSX A;  1HQU A;  2YV0 X;  3HVR A;  2YHA A;  4XIU A;  3OYF A;  5FDL A;  5EU7 A;  3SV3 A;  3T3F A;  3T19 A;  4B9S A;  3C6U A;  5DMR A;  2VG7 A;  1XHZ A;  1C1B A;  1JXE A;  2HNZ A;  3V81 A;  3PX6 A;  4FW2 A;  3F9K A;  3IS9 A;  3L2W A;  4Z4I A;  3TAM A;  4DTP A;  1D9D A;  3AO1 A;  3PV8 A;  4DFJ A;  4PWD A;  2ZE2 A;  1U47 A;  2KZZ A;  2EHG A;  1QHT A;  2IC3 A;  2YNI A;  4HUF A;  3SYZ A;  1IKV A;  3QIO A;  4E0D A;  3KKS A;  4CF2 A;  1RCH A;  2OPQ A;  3AA3 A;  1L3S A;  1ZBU A;  1JLB A;  3VQ7 A;  3B6O A;  5E41 A;  1RT1 A;  3LPT A;  3O4N A;  3S3N A;  1CZ9 A;  3ZT1 A;  1VRU A;  3D45 A;  2ETJ A;  3OYN A;  4FLT A;  4PY5 A;  3ITH A;  2VG5 A;  1C1A A;  1NK8 A;  3C6T A;  3NF6 A;  4CJ4 A;  3PO4 A;  4DQI A;  1VSE A;  4OKJ A;  3IRX A;  3KD1 E;  1HYZ A;  3TWH A;  2VWK A;  1VK0 A;  4DTX A;  3VQ6 A;  4RG8 A;  4FM0 A;  2WON A;  4Z4E A;  4E7I A;  2YNF A;  1J9A A;  2QK9 A;  1WSH A;  3UIQ A;  3OS1 A;  3G10 A;  4FJG A;  4KAZ A;  1MU2 A;  3KTQ A;  1B9D A;  4CEE A;  3SJJ A;  3RMB A;  1G15 A;  4CHN A;  2JLE A;  2G8K A;  4I7F A;  1IH7 A;  4CF1 A;  1GOC A;  1JLC A;  4KHY A;  4KV8 A;  4FJ5 A;  2KFN A;  3SV4 A;  3ZSW A;  4B9L A;  4FJN A;  1BIU A;  3QO9 A;  3M8P A;  1HPZ A;  1REV A;  1WN7 A;  1NJX A;  3TAF A;  3EZ5 A;  3AVC A;  1ASU A;  1QSY A;  4CFD A;  4Z4G A;  1TGO A;  3QNO A;  4DSK A;  2P5G A;  4C8O A;  4B8C A;  1U45 A;  3K2P A;  3OYE A;  4CF8 A;  3K59 A;  4DQR A;  3SCX A;  1UAX A;  1CXQ A;  4I2P A;  3QEV A;  3SQ0 A;  2PYJ A;  4J2E A;  2X6N A;  4UQG A;  4B3O A;  3LAN A;  1QSS A;  3HP9 A;  4JS4 A;  3AA5 X;  5J2P A;  2AJQ A;  3MXM A;  4FVM A;  5CYM A;  3K58 A;  1LWC A;  2XY8 A;  3OJU A;  3ZT0 A;  1CZB A;  1L3U A;  4FM2 A;  1RDA A;  3EYZ A;  3MXI A;  1QS4 A;  1SKR A;  3AO5 A;  5SZT A;  3QEX A;  4Z4C A;  1LWE A;  4FLU A;  4FZY A;  4CGJ A;  4B8A B;  2X78 A;  1NK9 A;  4K8X A;  3V6D A;  4MFB A;  1KCF A;  4IG3 A;  4KHQ A;  1TK8 A;  3I0S A;  4LY7 A;  3LZI A;  3AO3 A;  1WSI A;  3NHG A;  3BGR A;  3HXM A;  5CY4 A;  1YTA A;  2EX3 A;  1U04 A;  4CIG A;  1ZBF A;  5I42 A;  4ZTJ A;  4B9U A;  4AHT A;  3LP2 A;  5HRO A;  1RBU A;  2FBV A;  3ZSO A;  3AO4 A;  5C24 A;  4CJ5 A;  4N56 A;  2XO7 A;  3OY9 A;  4FLZ A;  4DQQ A;  4CK1 A;  4CGH A;  5C25 A;  1BI4 A;  3KLF A;  1BIS A;  1BQM A;  4E1M A;  1YVU A;  3PUF A;  1EXQ A;  3LP3 A;  1SV5 A;  4CHQ A;  4KFB A;  5HRP A;  1NK0 A;  4CGI A;  4B9N A;  1JL1 A;  1ASW A;  4C8N A;  3ZSZ A;  3V9W A;  1BIZ A;  4CJE A;  3LWL A;  3K5M A;  4DQS A;  1T8E A;  4KHW A;  1B9F A;  3HM9 A;  3MEG A;  2D0C A;  4N47 A;  4FJJ A;  4ZHR A;  4DF8 A;  1F21 A;  1RT5 A;  4CGG A;  2P1J A;  4Q0B A;  1S5J A;  3DOL A;  1WAF A;  3P1G A;  4KB1 A;  2O4G A;  2X74 A;  3AVG A;  3VQD A;  1RTD A;  3PY8 A;  4DS4 A;  3LP0 A;  1SL2 A;  1DTT A;  2P5O A;  1S1W A;  3CFR A;  4IDK A;  4DTR A;  2QKB A;  1KVB A;  1D9F A;  2RF2 A;  4DMN A;  2G8F A;  3WNG A;  4CFC A;  3CQ8 A;  2VWJ A;  4IKF A;  3DLK A;  2XHB A;  2BDP A;  1NK7 A;  4CEQ A;  4DQP A;  4OKK A;  2OZM A;  3TAR A;  3AA2 A;  3TR8 A;  3ZT3 A;  3BDP A;  4EP5 A;  4N41 A;  3THV A;  3SQ4 A;  4F3T A;  4DU3 A;  1VSF A;  3QIP A;  4LH5 A;  4CJS A;  2HMI A;  2KTQ A;  1T7P A;  1A5X A;  4BWJ A;  3V1O A;  3QNN A;  3NGY A;  3SI6 A;  3SQ1 A;  1YT3 A;  3NF7 A;  4KTQ A;  1KVC A;  1LW2 A;  4QCL A;  2B6A A;  3L3V A;  4CEO A;  2G8H A;  3QEW A;  1Q9Y A;  4CHY A;  4DSF A;  3SUP A;  4AH9 A;  2YNG A;  4W5O A;  1L5U A;  1JXB A;  4M3Y A;  2BAN A;  1WAJ A;  2KFZ A;  3RRG A;  4BE2 A;  4OLA A;  3TI0 A;  4DSE A;  5KTQ A;  1Y97 A;  4BDP A;  1NJY A;  1N5Y A;  1RBT A;  1L3V A;  2HHX A;  2D0B A;  4N76 A;  1WSG A;  5FRN A;  4GW6 A;  1X9W A;  3RWU A;  2KQ2 A;  4AHV A;  4E7L A;  4DF4 A;  4J2D A;  1Q9X A;  1XWL A;  4CJQ A;  3HPO A;  4JRP A;  3U3Y A;  5KGW A;  4H8K A;  3DLG A;  4OVL A;  4HUE A;  3ULD A;  2B4J A;  4CJW A;  3VQP A;  3O3G A;  3KIO A;  1I3A A;  1O1W A;  3PX4 A;  1JLE A;  3ZT4 A;  1J53 A;  4WE1 A;  3V1Q A;  3V9U A;  5FRM A;  4FK2 A;  1C0U A;  2X6S A;  4F4K A;  4BDY A;  2PY5 A;  3L2Q A;  2XY6 A;  3SUO A;  2G8V A;  4F2S A;  4OPJ A;  4DFP A;  4HVJ A;  1HRH A;  2IDO A;  4CIF A;  5HP1 A;  1NK6 A;  1NOY A;  4Q5V A;  3S9H A;  2HNY A;  1SL1 A;  3PO5 A;  2HVI A;  4CJK A;  2DY4 A;  4I2Q A;  4HUG A;  1KLM A;  4LD0 A;  2Z1J A;  2DFE A;  1DTQ A;  1NK4 A;  4C8K A;  4YNQ A;  1RTI A;  1RDC A;  3IAY A;  2YNH A;  3FFI A;  4M3W A;  3QIN A;  2OZS A;  1BI4 B;  3RRH A;  1ZYQ A;  3QLH A;  1BGX T;  4J2B A;  2BGG A;  2D5R A;  1XC9 A;  3VQ8 A;  3OYB A;  3I8D A;  4FJX A;  3HT3 A;  1KLN A;  1S1X A;  3U6F A;  1QTM A;  4B9T A;  2GV9 A;  2PYL A;  1EET A;  3V9Z A;  1KRP A;  3NCI A;  4OJR A;  1C1C A;  4CHP A;  3KLG A;  1VSI A;  1JL2 A;  1ZBL A;  4W5R A;  4DSJ A;  3B6P A;  3V9S A;  2GUI A;  5DK5 A;  4CJU A;  4CHO A;  4HCC A;  2HHW A;  1D8Y A;  4NCA A;  4ELV A;  4PUO A;  4DTS A;  2P51 A;  3TAE A;  3VQA A;  4CJR A;  1HYV A;  4IFY A;  5J2Q A;  1NOZ A;  4F2R A;  4KHN A;  1YTU A;  3RR8 A;  2DFF A;  3VQ4 A;  4CK3 A;  1C0T A;  3OYK A;  4NYF A;  1LWF A;  2YKN A;  3O3H A;  1SL0 A;  3K5L A;  5HRS A;  3AVH A;  5J1E A;  3MAQ A;  4EP4 A;  1TKD A;  2DFH A;  2E6M A;  5JS2 A;  4CES A;  4IFV A;  4FLW A;  3M8Q A;  4CF0 A;  1U4B A;  1S1U A;  1RTH A;  4CED A;  3NE6 A;  2QKK A;  4KI4 A;  3LAM A;  1LV5 A;  2XRI A;  5KRS A;  4OLB A;  3CFO A;  4JRQ A;  2HHV A;  2ATQ A;  1VSK A;  3SPZ A;  3OYC A;  3G0Z A;  3QER A;  4FJ8 A;  4QOZ B;  3OYG A;  2RKI A;  1RBS A;  4OGC A;  2FBY A;  3DLB A;  1S6Q A;  1EKE A;  4NYN A;  1SUQ A;  5T7B A;  3DOK A;  3K5N A;  4ICL A;  4Z4H A;  3NH0 A;  3T1A A;  2KZM A;  3SUQ A;  1TKT A;  1TVR A;  3NAE A;  4DSI A;  4CIE A;  5D3G A;  4LSN A;  5CZ1 A;  4RW4 A;  3JSM A;  4BE1 A;  3EY1 A;  3HJF A;  2ZD1 A;  1RT7 A;  1SKW A;  4W5N A;  1GOA A;  2KW4 A;  3D0P A;  3PX0 A;  1TAQ A;  1BCM A;  1RT6 A;  5I3U A;  3SZ2 A;  3DMJ A;  3VN5 A;  4CJV A;  2A1R A;  4FXD A;  3LAL A;  3NBP A;  2HW3 A;  2HHT A;  3OS0 A;  4KTW A;  3VQ5 A;  4OGE A;  1ZBH A;  3HL8 A;  3AV9 A;  1WSJ A;  3JYT A;  3OYA A;  1XI1 A;  4FJ7 A;  3DRR A;  1TAU A;  4B9M A;  4FZX C;  4ZTF A;  1QQC A;  2F96 A;  5KI6 A;  3I0R A;  4DU4 A;  1NKE A;  4ELU A;  3L2V A;  2HHS A;  2RN2 A;  4CEF A;  1QSL A;  1GOB A;  3P83 D;  1RBR A;  3SQ2 A;  3OJS A;  4IG0 A;  3L3U A;  3HYF A;  2LSN A;  4B9V A;  5C42 A;  4FK0 A;  3ZSV A;  1D5A A;  2WOM A;  3DLR A;  4H4O A;  5J2N A;  1JKH A;  1T03 A;  4O55 A;  1TL1 A;  1HNV A;  3MEE A;  3HP6 A;  1CLQ A;  4O44 A;  4DFK A;  3IG1 A;  4CEZ A;  4FZZ A;  3OYJ A;  4HTU A;  3HST B;  3VQC A;  3SPY A;  3LWM A;  3NH2 A;  3AVM A;  4AHU A;  4O0I A;  5CYQ A;  4E3S A;  1N6Q A;  1NJW A;  5HLF A;  3KK3 A;  2OPP A;  4EZ6 A;  3WNF A;  4DLG A;  1LAW A;  3DI6 A;  1RBV A;  2G8W A;  4BWM A;  1IKY A;  2YKM A;  1RTJ A;  1X9M A;  2HHQ A;  1WSF A;  3TAG A;  3OYH A;  4CEB A;  1NKB A;  3NDK A;  4KHS A;  4Z4F A;  3DRS A;  1TV6 A;  3LP1 A;  3NF9 A;  2E6L A;  4FYD A;  3ZSX A;  3TAP A;  4DFM A;  1XHX A;  4FJK A;  4E7J A;  4CJL A;  5HRR A;  3MEC A;  4CF9 A;  2Z1I A;  4HCB A;  1UWB A;  4PA1 A;  4AIL C;  1Z25 A;  4KKO A;  2Y1J A;  3HPG A;  3AVB A;  1VSD A;  1BL3 A;  1VSM A;  2VG6 A;  3U3G A;  3VQB A;  1RDD A;  4L8R B;  2HHU A;  5FRO A;  3SNN A;  4DG1 A;  3C95 A;  5SWM A;  4FM1 A;  4CJ3 A;  2NUB A;  3AVN A;  2IAJ A;  4E7K A;  4FLY A;  4M3X A;  3DYA A;  4E1N A;  3NH1 A;  1VRT A;  1WSE A;  4KPY A;  2F8T A;  3RMD A;  1C6V A;  4R5P A;  4KI6 A;  4FW1 A;  4KRE A;  1WNS A;  3AVA A;  3QET A;  3QES A;  1FXX A;  5HBM A;  1A5W A;  4OPK A;  4FJI A;  3AA4 A;  4FLX A;  3L2U A;  2G8I A;  2HND A;  2F8S A;  3K5O A;  1TKX A;  4MQ3 A;  4DTJ A;  3AVL A;  3RMC A;  1UA0 A;  4RW6 A;  3CYM A;  4NCG A;  4CEC A;  4KB0 A;  1ASV A;  4Z0U A;  1C0M A;  2ZQB A;  4CJF A;  1NKC A;  1WLJ A;  1RT2 A;  3P5J A;  1IKX A;  1RT3 A;  4YFU A;  1HJR A;  1HYS A;  3ISN C;  1X9S A;  4FJ9 A;  3VA0 A;  1VSL A;  3K57 A;  3LZJ A;  4NCB A;  3DLE A;  4W5T A;  2PZS A;  2D0A A;  3HPH A;  4C8L A;  4M42 A;  1J5O A;  2OYQ A;  3NGI A;  2R7Y A;  4RW8 A;  4CGF A;  3S3O A;  2G8U A;  1UA1 A;  3ZSQ A;  4DSL A;  2Y1I A;  4QAG A;  3AVF A;  4F3O A;  1BHL A;  4FK4 A;  1JLG A;  3H08 A;  3OYM A;  4JS5 A;  1TK5 A;  1NJZ A;  4M3R A;  3OYI A;  4FJH A;  1FK9 A;  1JLQ A;  3TAB A;  4M3U A;  3DRP A;  1Q8I A;  3VQE A;  4AHS A;  4KHU A;  4M3T A;  2HB5 A;  3AVJ A;  3RTV A;  4DS5 A;  4KO0 A;  4E19 A;  4I9L A;  3KD5 E;  1KFS A;  1B92 A;  3NF8 A;  1U49 A;  5HRN A;  4ID5 A;  3LPU A;  4JLH A;  3O4Q A;  3MXJ A;  1I39 A;  1VSH A;  4O0J A;  1U48 A;  4CCH A;  4BDZ A;  3V9X A;  2YHB A;  1CXU A;  1RNH A;  1QE1 A;  4CFA A;  1RDB A;  4CEA A;  4CJT A;  3KJV A;  4E7H A;  5J2M A;  1JLF A;  2FC0 A;  4IBN A;  4CER A;  3ZSY A;  1NK5 A;  4K8Z A;  1TL3 A;  1FKO A;  4ELT A;  3E01 A;  1BCO A;  4DTN A;  1T05 A;  1HNI A;  3F73 A;  4BE0 A;  1IO2 A;  3CFP A;  3LAK A;  1S9E A;  2Q3S A;  1BQN A;  2Z1G A;  3C94 A;  3KKR A;  2W42 A;  3AVK A;  1KSP A;  3ZT2 A;  1IG9 A;  4J2A A;  3CM5 A;  5JS1 A;  1S6P A;  3M8R A;  2ITG A;  4HHT A;  2O4I A;  1HMV A;  5K14 A;  3OYD A;  4O4G A;  4FLV A;  3KK1 A;  1R0A A;  3RR7 A;  2OPS A;  1S9G A;  3CM6 A;  1L3T A;  4I9Q A;  3A2F A;  3V1R A;  3CG7 A;  3VQQ A;  4N5S A;  1KVA A;  1JLA A;  3OS2 A;  4BAC A;  4DLE A;  3ALY A;  1ZBI A;  2JGU A;  2HVH A;  1HQE A;  4RW9 A;  4DTO A;  3NFA A;  1KFD A;  1SKS A;  2IGI A;  1EP4 A;  3ASM A;  3OVN A;  4E89 A;  3O3F A;  4DTU A;  4CE9 A;  4AHC A;  3HO1 A;  4F8R A;  2XY7 A;  1Z26 A;  5CZ2 A;  4CJP A;  4B08 A;  3WNE A;  1W0H A;  3KLH A;  4GVM A;  2BE2 A;  2OPR A;  3QEP A;  3VQ9 A;  3ZSR A;  4FJL A;  4FJM A;  4EZ9 A;  4CFB A;  1TK0 A;  4KRF A;  3HK2 A;  1DLO A;  3S3M A;  2DTU A;  1LW0 A;  1X1P A;  4DTM A;  3M8S A;  3RMA A;  3DM2 A;  4CHZ A;  3AVI A;  4AHR A;  1KTQ A;  3L8B A;  4GMJ B;  4LH4 A;  4LSL A;  3WNH A;  3KLI A;  3NGZ A;  2XY5 A;  4Y1C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...