2D5RA

Crystal structure of a tob-hcaf1 complex
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
252
structure length
252
Chain Sequence
RICEVWACNLDEEMKKIRQVIRKYNYVAMDTEFPGVVARPIGEFRSNADYQYQLLRCNVDLLKIIQLGLTFMNEQGEYPPGTSTWQFNFKFNLTEDMYAQDSIELLTTSGIQFKKHEEEGIETQYFAELLMTSGVVLCEGVKWLSFHSGYDFGYLIKILTNSNLPEEELDFFEILRLFFPVIYDVKYLMKSCKNLKGGLQEVAEQLELERIGPQHQAGSDSLLTGMAFFKMREMFFEDHIDDAKYCGHLYGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords CCR4-NOT transcription complex subunit 7
publication title Structural basis for the antiproliferative activity of the Tob-hCaf1 complex.
pubmed doi rcsb
source organism Homo sapiens
total genus 82
structure length 252
sequence length 252
ec nomenclature ec 3.1.13.4: Poly(A)-specific ribonuclease.
pdb deposition date 2005-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04857 CAF1 CAF1 family ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2d5rA00
3AA4A 2IS3A 3DYAA 2PYLA 4H4OA 3SQ4A 4ZTFA 4PQUA 3U6FA 1ZBLA 4KTZA 4F2RA 2E6LA 3AVCA 4CGGA 3KIOA 3OYKA 4J2EA 4O0IA 3DLEA 1LAVA 4PA1A 4BE0A 3AVFA 3VA3A 4LH4A 4C8KA 3QNOA 3NH2A 3DMJA 4I2PA 3ZT4A 3S3MA 1L3VA 4Y1CA 3VQPA 2FBTA 3O3FA 1LWCA 3B6PA 3SI6A 1NK7A 4M42A 3HK2A 3QEIA 4DQSA 3TAQA 1EX4A 2OA8A 3PY8A 5FRNA 1WLJA 4IFYA 3TAEA 3ZT2A 3LWLA 2XY7A 3QEWA 1GOCA 4CJFA 1J53A 3KJVA 4CIFA 4I7FA 4CJRA 2O4GA 4CEEA 1Y97A 4DG1A 1RCHA 3SV4A 5I3UA 3T3FA 1KVAA 1TKDA 3UIQA 3KTQA 2QK9A 4FYDA 1T05A 2LSNA 4BDPA 1C6VA 4FXDA 3O4QA 1QE1A 5C25A 1IKVA 1XC9A 1Q9YA 4F3OA 3KK3A 2PY5A 2I5JA 4O55A 1EXQA 4N56A 1VSMA 1VSDA 1QHTA 2D0AA 1GOAA 3HPGA 3K5MA 4FLYA 5J2NA 2OPSA 2FBYA 4KO0A 3TAGA 1NKCA 2DFHA 3MAQA 2YV0X 1ASWA 3LP2A 4G1QA 3OJSA 1KSPA 3MXIA 4IDKA 4Q0BA 4CFAA 2YNHA 4CGHA 1SL2A 4N76A 4E7LA 3QIOA 4GVMA 3NH1A 3MEDA 3ITHA 4KI6A 1BQMA 5DMRA 4CESA 4CJSA 4CJVA 4RW9A 4OLBA 2X78A 1NKEA 1QSLA 1WSGA 1FXXA 1QS4A 2XY8A 1J5OA 2HMIA 3LDSA 4DSJA 1IKXA 3QLHA 1X1PA 2BANA 4FLWA 1C1CA 3RR8A 2HHTA 1VSLA 5EU7A 4N5SA 4FJJA 3RMDA 3LALA 4H4MA 4BE2A 3HP9A 5HBMA 3HPHA 1RDBA 3DOKA 2X6SA 2YHBA 1WSHA 4DQRA 2QXFA 2Z1JA 3KK1A 1QSSA 5D3GA 4ELTA 1BL3A 3DLBA 3RRGA 2KTQA 4I9QA 1BI4B 3NHGA 3IAYA 3V81A 4DSKA 3S3NA 3L3VA 3K5NA 4DSIA 4CIGA 5C24A 3KLFA 3AO3A 3SCXA 4K8ZA 5CYMA 4O0JA 3LAKA 4Z4EA 4DFMA 4CEAA 3TWHA 4IG3A 4YNQA 2R7YA 3V9WA 3L2RA 3LPUA 4LSLA 4DTRA 3JSMA 4CGJA 1JXEA 2PZSA 4KHNA 4DSLA 1RT5A 3LWMA 5JS2A 3I0SA 4BWMA 1ZYQA 3VA0A 3NCIA 4M3XA 4OLAA 3OYCA 4UQGA 4F8RA 1VSFA 3DLGA 1SL1A 4M3WA 4FK2A 1CLQA 3V9UA 5FRMA 4FJHA 3JYTA 4FLUA 4CK3A 4NCGA 3T19A 3THVA 3TARA 4MQ3A 1VK0A 3G10A 1L3TA 3F9KA 4LD0A 3PX4A 2A1RA 1N6QA 1CXUA 3ZSWA 1IO2A 4DLGA 1TV6A 1JLFA 4J2BA 2HVHA 1JLQA 2Z1IA 1BI4A 4GW6A 4KFBA 3EY1A 1ZBUA 1HQEA 3V1OA 3RWUA 4FCYA 3NGZA 5KI6A 2HHSA 4KHSA 4Z4GA 4FJGA 3T1AA 2W42A 2RKIA 3F73A 1IH7A 3ASMA 4CEFA 4E7HA 4KI4A 4JLHA 1C1AA 3O3HA 3LP3A 3MXMA 4C8NA 2XHBA 1TK8A 2X74A 3AVLA 3L3UA 3HVRA 3OVNA 3ULDA 4DSFA 3QNNA 1RBUA 3O3GA 3L2VA 4Z4HA 2Z1GA 4XIUA 1JLCA 1IKWA 1G15A 5KRSA 3ISNC 4OPKA 3M8QA 3SJJA 3KD1E 2KQ2A 2YHAA 3AVHA 1I3AA 1U49A 4Q5VA 3SPYA 3L2QA 3VN5A 1NOZA 2HVIA 3VQ5A 1C1BA 1C0UA 1XI1A 1XWLA 5K14A 3ZSVA 4ZHRA 3TAMA 4E19A 4DU4A 4DF4A 1EETA 4CFDA 3H08A 3VQ8A 3SZ2A 4KHYA 4W5QA 4HTUA 1TAQA 3DLHA 1SL0A 2OZMA 1ZBHA 1VSHA 1BIZA 4BWJA 4JRQA 2F8TA 1Z26A 1RTHA 2Z1HA 2FBXA 3OYGA 4DU3A 4F4KA 1RBTA 2OPQA 4E1NA 4CHNA 4QAGA 4IKFA 2D0BA 4RG8A 3QERA 5FDLA 1S1XA 3ZSXA 1IG9A 1CZBA 1XHZA 1JL2A 4BDZA 4DU1A 3B6OA 1TVRA 2VWJA 1RDAA 4OPJA 1S1VA 3VQ7A 3E01A 4CHYA 4DTNA 4DF8A 3KLGA 3MEGA 2KFZA 3CM6A 3RR7A 4B3OA 2P1JA 4FW2A 4CEDA 1C0TA 2VG7A 4DSEA 1RDCA 2EX3A 4KTWA 1ITGA 1S6PA 1Z25A 3DRPA 3VQCA 3WNHA 4JS5A 1NJZA 1TL3A 3PX6A 1KCFA 1L5UA 1T7PA 4H8KA 4DQIA 1DTTA 4KHWA 3RMBA 3KKSA 3AVAA 2WONA 1RNHA 4M3TA 2DFFA 3HSTB 3K58A 4J2DA 3ZSYA 4DTPA 4KB0A 1I39A 5T7BA 2IOCA 4PUOA 1GOBA 3D45A 2XY5A 4KV8A 4E1MA 1U45A 1S6QA 4JS4A 4M45A 1WN7A 3QEPA 3WNEA 4CJKA 3FFIA 1EP4A 4Z4CA 3MXJA 4CJWA 4LY7A 4B9NA 1D5AA 2HW3A 1RBVA 1TKZA 3U3GA 4B8AB 4CJTA 3DOLA 2Y1JA 3SQ0A 4CCHA 5FROA 3AO5A 4B8CA 4CGIA 4B9TA 4FJLA 3PUFA 3QO9A 1WNSA 4DTSA 5J2QA 1SKSA 3NDKA 1CXQA 1YTUA 3AVJA 3K2PA 4OVLA 4AHUA 3HPOA 2YNFA 4CEQA 3TAFA 4FM0A 3VQ4A 4M3RA 3RTVA 3DRSA 1W9HA 2X6NA 1YVUA 1RT2A 4FLZA 4BE1A 4FK0A 3TR8A 4EZ6A 4C8MA 4B9LA 4DTJA 3LP1A 4OGEA 3G0ZA 4FJKA 4CFBA 4TSXA 3OYHA 3ZSZA 1RBRA 1JLGA 1HQUA 4E7KA 1BCMA 1WSJA 4K8XA 3L2WA 3TANA 4NCBA 3NF8A 2ITGA 1NK8A 4E7JA 1KVCA 2F8SA 3KKRA 4AHVA 4KTQA 1NK4A 1LW0A 3LPTA 3NAEA 1IKYA 1J9AA 1RT6A 3HM9A 3OYLA 1RT4A 3P1GA 4F2SA 4YFUA 1XHXA 2HNZA 1BQNA 4IFVA 4BACA 2KFNA 4FJ7A 3TI0A 1S9EA 3NF9A 4O4GA 3LZJA 4OGCA 4NYFA 1RBSA 5HRNA 4CJUA 3VQAA 1WSFA 3AV9A 3AVIA 5HRRA 4B08A 4CF1A 2PYJA 1X9SA 2HB5A 1A5VA 3WNFA 4Z4IA 1LWFA 1U04A 5SWMA 1VSJA 5KTQA 1SKRA 1HMVA 4I9LA 2DFEA 4FLTA 3DRRA 3SUPA 1TGOA 2IGIA 4E7IA 4ID5A 4CERA 1UWBA 2Y1IA 3NGIA 3SUQA 1NK9A 3IRXA 1KLNA 1MU2A 4CHQA 4HUFA 3PX0A 3NFAA 4PWDA 4CHZA 1RT3A 4CJ4A 3ALYA 5CZ2A 1J54A 1QQCA 1FK9A 4AILC 4IG0A 3NH0A 4FJ5A 5I42A 2QKBA 2HHUA 4W5TA 3I0RA 1SV5A 1L3UA 1RTDA 4B9MA 3S3OA 4FJMA 3K57A 3AVMA 3V9SA 5HP1A 1LAWA 2YKNA 5J2PA 2OZSA 4Z4FA 4DFJA 1B9FA 4EZ9A 3LZIA 2JGUA 3SYZA 4ICLA 2ETJA 1KFSA 4B9UA 5CY4A 4N47A 3ZSRA 1FKOA 1SKWA 3CFPA 4LSNA 4CIEA 3BDPA 4RW4A 1JKHA 3DM2A 2G8UA 3U3YA 1S9GA 1NJXA 3QESA 4FZXC 4RW7A 3OYNA 3HO1A 3HL8A 4LH5A 2O4IA 2VG6A 5CZ1A 3OYDA 1D8YA 3HJFA 2HHVA 5HRPA 2GUIA 1TL1A 4CK2A 1ZBIA 3ZT3A 1BCOA 4I2QA 2IAJA 3AA5X 4OKKA 1X9MA 4KPYA 1ASUA 2YNIA 3I8DA 2P5OA 3LANA 4PY5A 1LWEA 3OYMA 4Z0UA 3OYBA 1ASVA 3HXMA 3QETA 4DS5A 3PV8A 2EHGA 1D9DA 3PO5A 3D0PA 4CGDA 3OYFA 3HP6A 4DQQA 4C8OA 4FJ8A 4W5RA 4AHCA 4KHQA 2KZMA 4ELVA 3CYMA 1UOCA 1UAXA 4CGFA 1D9FA 4CE9A 3QIPA 4DWIA 1HYVA 4FVMA 4CJEA 4DTXA 4DS4A 1T03A 5HRSA 2G8VA 3SUNA 1S1WA 2OYQA 2JLEA 2B4JA 3SUOA 4QOZB 3DI6A 3ZT1A 4B9SA 1BGXT 4C8LA 3QEXA 2FBVA 3V1RA 3RMAA 3V4IA 3VQQA 1LW2A 1RTIA 1RT1A 3MEEA 3BGRA 4OJRA 3AA3A 1DLOA 3NE6A 4R5PA 3C94A 1K6YA 3IS9A 5J2MA 2RF2A 4CJPA 2BDPA 3WNGA 2HHWA 4FM2A 3L8BA 5DK5A 4OKEA 2P5GA 2ZE2A 2G8KA 1O1WA 1YT3A 1NK0A 2ATQA 4FJ9A 1U48A 2D0CA 1HYZA 3MECA 4CJ3A 3HVTA 5JS1A 3NGYA 3KLEA 4DQPA 4F3TA 2VG5A 4B9VA 3NF7A 1ZBFA 2AJQA 1S1TA 1U4BA 1JLAA 2G8HA 3NF6A 3P5JA 3VQBA 1QSYA 1DTQA 2IDOA 2P51A 1REVA 3K5LA 3SPZA 1VRTA 2KW4A 4CFCA 1KLMA 1FKPA 1HNVA 4CJ5A 1NJWA 2F96A 1TK5A 1N5YA 1BISA 3QINA 4HHTA 4DLEA 1HYSA 1CZ9A 4KB1A 4E89A 2G8WA 1JLEA 4AHTA 3HT3A 3OS2A 4EP4A 3OYIA 2D5RA 4EP5A 2B6AA 5HLFA 3P83D 1HRHA 4KREA 4O44A 3VQDA 4DTOA 4HCBA 3AO1A 1B9DA 3LP0A 4E3SA 4DFPA 4FK4A 1A5XA 5HROA 5KRTA 1F21A 1EKEA 4CF9A 3PO4A 3CFRA 4N41A 3NBPA 2ZD1A 2XRIA 3VQ6A 4HUEA 4CK1A 4E0DA 1HNIA 2GV9A 1RT7A 4RW8A 2G8IA 3C6TA 1U47A 4OKJA 3C6UA 1UA1A 4KAZA 4CF0A 2BGGA 4BDYA 3TABA 4AH9A 2HNDA 3DLRA 4WE1A 3C95A 4M41A 2HHQA 2RN2A 4CF2A 1TKXA 4CHOA 4CJQA 2YKMA 3V6DA 5CYQA 1T8EA 4FJNA 1A5WA 1KFDA 1W0HA 2RPIA 3ZSOA 3M8RA 1NK6A 4KKOA 4AHSA 4FLVA 2E4LA 2NUBA 1JL1A 2E6MA 3AA2A 5E41A 2WOMA 4FLXA 4M3YA 1Q9XA 3AVKA 3OYEA 4CF8A 4CECA 2XY6A 3S9HA 2B5JA 3K5OA 1L3SA 4O5BA 3OY9A 3SNNA 1WSIA 1WAJA 2GBZA 4Y1DA 3V1QA 3M8SA 5J1EA 3OS1A 3OYJA 3AVBA 4ELUA 3KLIA 4DFKA 3CG7A 3VQ9A 3AO4A 2QKKA 4FJIA 4NCAA 1QTMA 3AVNA 4GMJB 4IBNA 1NKBA 4L8RB 4RW6A 3EYZA 4CEZA 4M3ZA 1S5JA 4FM1A 1HPZA 3VQEA 4CJLA 3QEVA 1VSIA 4QCLA 3K59A 2HNYA 1BIUA 3CFOA 1JXBA 5KGXA 3L2UA 2KZZA 4CHPA 1RTJA 2IC3A 4HVJA 3V9ZA 4J2AA 4W5NA 3OS0A 1R0AA 1NJYA 2ZQBA 1HJRA 2G8FA 4HUGA 4M3UA 3CM5A 2XO7A 4KHUA 3OYAA 1KRPA 1VSEA 2DTUA 1UA0A 4DMNA 4JRPA 3DLKA 3SV3A 4FZZA 4W5OA 3ZT0A 3KK2A 4ID1A 3ZSQA 3HYFA 1RILA 3CQ8A 2BE2A 3RRHA 1KVBA 1TK0A 4AHRA 1X9WA 3KD5E 4FJXA 3SQ1A 2A1SA 4ZTJA 1TKTA 4FW1A 3ZCMA 1Q8IA 4DTMA 2DY4A 1VSKA 1BHLA 1JLBA 2VWKA 1WAFA 3O4NA 3AVGA 1NOYA 3RMCA 1LV5A 3TAPA 1C0MA 3LAMA 3AO2A 1RDDA 5SZTA 4CEBA 1YTAA 1NK5A 3KLHA 1S1UA 4NYNA 3OJUA 1WSEA 4KRFA 3IG1A 4MFBA 1TAUA 3EZ5A 5C42A 2OPRA 3A2FA 5KGWA 4CEOA 3V9XA 1KTQA 4DTUA 4HCCA 2HHXA 3SQ2A 1B92A 1SUQA 2OPPA 2YNGA 3M8PA 2Q3SA 4FZYA 2FC0A 1VRUA
chains in the Genus database with same CATH superfamily
4H4OA 2FLOA 3SQ4A 1ZBLA 5M1FA 3KIOA 1LOTB 4CZJA 4LF6K 4M63C 4CBUA 2YX6A 3A5NC 3ZETA 2ZGZA 3FZHA 2FBTA 2ZF5O 4BR2A 1GLFO 4DQSA 3TAQA 1EX4A 3PY8A 4I6MA 3I56N 2XY7A 4CJFA 1J53A 2QW9A 2O4GA 4CEEA 1TKDA 1KVAA 3HRGA 4XH4A 1T05A 4A5BA 4FL9A 4WFNL 4F3OA 1VSMA 1VSDA 4MO4A 5BPLA 2FBYA 4YOUA 3TAGA 4G1QA 3ULEB 4JKBA 4CFAA 1SL2A 4N76A 5DM7L 3QB0A 4CJSA 2Q1NA 1NKEA 2NRHA 1FXXA 1QS4A 2XY8A 3S41A 2HMIA 5JVGL 2OTJN 2WUSA 1U2VB 3RMDA 3VEZA 5HBMA 2X6SA 4CBWA 3CQYA 4DR6K 3V81A 4IFEA 4JKAA 1QVGM 3TTDA 4BRCA 4CIGA 3HOTA 1HJOA 4K8ZA 4X62K 1K8KA 4Z4EA 3FZKA 4GVEA 4JKGA 2E20A 1FW6A 4IG3A 2R7YA 3L2RA 4CGJA 4KHNA 1HNXK 4JNEA 3I0SA 1ZYQA 5FPDA 1VSFA 4L3QA 3MN6A 2ZM6K 4QS7A 4YOTA 3T19A 2OTLN 3HI0A 4FSVA 4LD0A 4CW7B 1N6QA 1CXUA 3KK7A 5BRDA 4DLGA 2QA4N 2WFBA 3D2FB 4DR4K 3EE8A 3TSQA 1BI4A 4C1NK 3UKUA 3RWUA 3BZKA 4YORA 4Z4GA 4FJGA 3T1AA 1IH7A 4JKHA 4CEFA 1XNRK 3O6WA 5C0YA 3HVRA 2NRWA 4BY9C 1G15A 1IKWA 5KRSA 3ZX2A 4OPKA 3H45C 1NGCA 2YHAA 5AQUA 1U49A 3UKRB 1NOZA 5KPTA 3ZSVA 4BVOA 4E19A 1YITN 3H08A 4BRPA 4FYDA 5JLFA 3CPEA 4BWJA 1Z26A 2O8EA 2ASOA 5GIPA 1IV0A 4JN4A 3J80O 2D0BA 2YI1A 3ATUA 2UXBK 5M1KA 4DU1A 2VWJA 5KPRA 4OPJA 3VQ7A 4CHYA 4GV3A 4B3OA 4JHDA 4DSEA 2FF3B 1S6PA 4ISGA 2HF4A 4C1NI 3ZEUA 4A5AA 1KCFA 1L5UA 3EO3A 4O5FA 1NGHA 2WONA 1RNHA 4IO9L 3CJAA 4KB0A 3ZLJA 2HOEA 4IXCA 3O1WA 2IOCA 4PUOA 3KWIA 1YF5L 4JS4A 4M45A 3MX2A 4ILHA 3VEYA 4CJKA 5FPEA 3I33A 3GL1A 4LF5K 4CJWA 2QWOA 4LY7A 2HW3A 1SAZA 1HNWK 2QWNA 3U3GA 3SQ0A 3DOLA 2Y1JA 2FXUA 1T6CA 5J2QA 2A42A 5KPZA 3E9OA 4FWNA 4OVLA 4AHUA 4CEQA 3TAFA 2KHOA 2NRVA 2QWRA 4DV5K 4BE1A 4FK0A 1S22A 1VAZA 4CJ7A 4JK9A 3CCUN 4O8UA 3OYHA 4E7KA 4K8XA 5AZIB 5F0XA 1NK8A 4Z94A 3LDLA 4E7JA 1NK4A 1XQSC 3DXKB 1IKYA 4JI3K 5M1OA 1RT6A 2CH6A 1XHXA 1YJWN 2AP1A 4FJ7A 4O4GA 1RBSA 1VQ4N 4FPBA 1YI2N 2PYJA 3THXA 1X9SA 5M1PA 5KTQA 3CXCM 1HMVA 2DFEA 1TGOA 4OPHA 1Q7YO 1NK9A 3NGIA 4FOEA 3TSUA 3BEXA 4PWDA 2JWLA 1GLAG 3WT0A 4FWMA 5CZ2A 1VQMN 4IG0A 4FJ5A 5I42A 4LFCK 1GLBG 1SV5A 4B9MA 3QFPA 3SAGA 3NVKA 2NZTA 3LZIA 4KBOA 4B9UA 1GLEG 5KQDA 1QHAA 1S9GA 1NJXA 3QESA 3FLCO 3AAPA 3ZETB 4RW7A 3BF1A 3BF3A 3THYB 3VERA 5HRPA 1Q82O 4CK2A 3C6AA 5ADXH 2P5OA 1LWEA 3QETA 3G71N 2IVOA 3OYFA 3HP6A 2P9UB 3TPQA 4C8OA 4OX9K 4AHCA 4KHQA 1M1KO 4PKGA 1UOCA 2RHKA 4CZKA 4HTLA 4CE9A 4DCHA 4DWIA 4FVMA 4CJEA 4DTXA 1IBMK 4LF9K 2A3ZA 5HRSA 4Y0WA 2OYQA 3CHWA 2B4JA 3CCJN 3VQQA 3VF2A 1LW2A 1RTIA 1RT1A 3BGRA 3C94A 2QXLA 4AF1A 3THWA 3WNGA 2GELA 5DK5A 3TTCA 2ZE2A 2D0CA 3CMEN 1ILYA 4YOYA 4ILGB 3VF6A 3I8BA 4MLHA 2GWKA 3NF6A 4YOWA 3P5JA 3SAHA 2NNWA 1QSYA 4B3SK 2P51A 3SPZA 1NGGA 3VGMA 1ZXOA 4CFCA 2Q0RA 3MN5A 2W6LA 3C7NA 1MWMA 4KH5A 5JMVA 4EP5A 1NGAA 3JXUA 5HLFA 4O44A 3AGRA 4DFPA 1DT9A 3EE9A 1EKEA 4CF9A 3O5BA 4N41A 2W40A 2XRIA 1VQ6N 2G8IA 3EEQA 5AQFA 4WE1A 3C95A 1TKXA 3M8RA 2E6MA 4EAHD 2WOMA 3AVKA 3OYEA 4CF8A 4LFBK 2GBZA 3E1YA 1NG9A 4ELUA 3AVBA 4NCAA 3CPWM 4IBNA 5AQZA 4CEZA 5AQIA 4FPAA 4FM1A 3VQEA 4JV5K 4QCLA 3K59A 3CFOA 5KGXA 4R79A 2IC3A 4J2AA 4HWIA 4W5NA 2UU9K 3E9LA 2ZQBA 2IVPA 4HUGA 4M3UA 2DTUA 3K0SA 1E3MA 2P9LA 3SV3A 3O9QA 3SLCA 4H5RA 3HYFA 1WBDA 4AHRA 1X9WA 2ZJRL 3SQ1A 4ISEA 1VSKA 2VWKA 1WAFA 3T1HK 1NOYA 3QBXA 3RMCA 1LV5A 5M1QA 4DV0K 4CEBA 3KLHA 1WSEA 3IG1A 2OPRA 4CEOA 5KGWA 4DTUA 1KQSM 1KTQA 4HCCA 1KAXA 4LFAK 3VGKA 3IUCA 3AA4A 4ZTFA 3CD6N 1N32K 4CGGA 2BUPA 3DXMB 2HBMA 1LAVA 1ZC6A 4BE0A 3DMJA 3IDHA 5CHIA 4Y1CA 3VQPA 3O3FA 3B6PA 4NLBA 3SI6A 3QEIA 2P9KA 2OA8A 1WLJA 3TAEA 4H5VA 5AQQA 3ZT2A 2Q36A 2BH1A 5C12A 3VEVA 5AQOA 4CIFA 4CJRA 4EIAA 4M7YA 4DG1A 1Y97A 3MMVA 3UIQA 2KFZA 3T3FA 1RDWX 3TU5A 4A59A 2LSNA 4BDPA 3O4QA 5C25A 1HKCA 2PY5A 4O55A 4WFAL 3HPGA 1QHTA 1NKCA 2KKZA 3MXIA 4YOXA 4Q0BA 3R1XA 4E7LA 2D4WA 4GVMA 3IKMA 1T6DA 4DR5K 3MEDA 4KI6A 4CESA 2X78A 1QSLA 1WSGA 1QQNA 1J5OA 1QQMA 4FWLA 2ITMA 2HHTA 2O8FB 2QEXN 4H0PA 4N5SA 4FJJA 4X66K 4H4MA 3HPHA 5BREA 2P9PB 2Z1JA 1QSSA 5D3GA 4ELTA 4BROA 2KTQA 3CCEN 2Q2RA 4BRMA 3S3NA 3K5NA 3CJ9A 3CCLN 4BQZA 3EN9A 2YJEA 4O0JA 3LAKA 3TWHA 2EWSA 1X3MA 1EQYA 3E66A 3LPUA 4LSLA 3JSMA 1JXEA 4BR5A 4DSLA 1YUWA 1J6ZA 1HNZK 1GLJO 3LWMA 3VEWA 4BWMA 4B3MK 3O08A 4M3XA 3OYCA 2OCEA 3CCMN 4M3WA 4BRKA 3JYTA 4FLUA 3THVA 3TARA 1L3TA 4B3TK 3C6HA 3F9KA 4GV9A 1NGEA 2A1RA 1IO2A 2CGKA 1JLFA 3PIPL 2HVHA 4PL7A 3P38A 1JLQA 2IIRA 1MWKA 3CCSN 4FWSA 5FLXO 3NGZA 4FCYA 4E7HA 4JLHA 3MXMA 2XHBA 1TK8A 2X74A 3AVLA 3L3UA 3PSIA 3OVNA 4DV2K 3L2VA 4Z4HA 2GEMA 3ISNC 3CC2N 3M8QA 2V7ZA 2KQ2A 1ATSA 4FWOA 3O8MA 5CR4A 3MCAB 3L2QA 1QZ6A 5EY4A 5AQVA 1XWLA 5K14A 3TAMA 4GKKK 4KHYA 4HTUA 1ZBHA 1SL0A 1GLCG 2F8TA 1RTHA 1ATNA 5AFUA 3OYGA 4DU3A 4E1NA 2HBJA 4PKHA 4RG8A 5FDLA 1S1XA 2Q0UA 1JCGA 3ZSXA 1IG9A 3G4SN 5BPNA 1CZBA 5GIOA 1T44A 3B6OA 1RDAA 3E01A 4H0VB 3KLGA 2P1JA 4JI1K 4FW2A 2JWKA 1C0TA 2EX3A 4KTWA 3WNHA 2VYPA 4CZHA 2PBDA 1NJZA 1TL3A 3U4LA 4BGBA 5HL7L 3T1YK 3PX6A 1RDUA 1DTTA 2E2QA 3KKSA 3K58A 3QMLA 2V51B 3WEEA 4E1MA 1NM1A 1WN7A 3QEPA 3WNEA 2HBKA 3FFIA 3K9JA 1D5AA 1YIJN 2W6KA 2P9IA 5FROA 4B8CA 4CGIA 4B9TA 4DTSA 1SKSA 3CETA 3NDKA 2GX9A 1CXQA 1YTUA 3K2PA 3HPOA 3VQ4A 3DRSA 1W9HA 4FLZA 2ASMA 4H0TB 4EZ6A 1J5EK 2NRTA 3G0ZA 4TSXA 4YOVA 1BCMA 3DAWA 3TANA 4NCBA 4B1WB 1KVCA 2F8SA 3KKRA 4AHVA 4KTQA 3NAEA 3RSEB 2VGMA 1RT4A 3P1GA 4NB4A 2HNZA 2KFNA 1S9EA 3NF9A 4OGCA 4NYFA 4CJUA 3VQAA 1WSFA 4CF1A 3WNFA 4Z4IA 3H6EA 5SWMA 1SKRA 1BA0A 5BRFA 3DRRA 4FLTA 4C23A 4E7IA 4CERA 4IO8A 1SS6A 3IRXA 4HUFA 1RT3A 2UXDK 3WXIA 3CCVN 4K25A 1QQCA 4RCHA 4AILC 2BTFA 3NH0A 5FPNA 1L3UA 3M6GA 5JLHA 4JKCA 5HP1A 2OZSA 4Z4FA 1D4XA 3AGKA 3WXMB 1V4TA 3ENBA 3FR0A 4XH5A 3SYZA 1KFSA 5CY4A 3M5RA 4OO1J 1SKWA 3LM2A 1FKOA 4MDAA 4LSNA 4RW4A 3DM2A 3L6QA 2G8UA 3HO1A 4WQ4A 2UUCK 2HHVA 4ISFA 1ZBIA 4KPYA 1KXPA 3LDQA 1KC8O 1ASUA 2YNIA 3I8DA 4PY5A 3HXMA 4U67L 2E1ZA 3TSPA 4DS5A 1QVFM 3PO5A 2GUPA 4WQ5C 1W2BM 4DQQA 1WBBA 4FJ8A 4FWKA 4X64K 2D0PA 2QTDA 3CYMA 4ELVA 1UAXA 2QWPA 1MA9B 1D9FA 3QIPA 2P9NB 4DS4A 2CH5A 2G8VA 3SUNA 1DGKN 1BGXT 1BU6O 1DKGD 3N4QA 3R3LA 3VF4A 1DLOA 4R5PA 3U8XA 1K73O 4BRHA 1YXQA 4CJPA 4BG8A 4FM2A 2UYTA 1O1WA 3EL2A 5AQXA 2ATQA 1NK0A 4WFBL 3HVTA 2YJFA 4F3TA 2AJQA 1S1TA 1VHXA 2F9TA 2G8HA 1Q18A 3VQBA 4BREA 3K5LA 1REVA 3KZBA 1P8ZA 4YDUA 2D0OA 1N33K 2F96A 1BISA 4BRIA 3QINA 2W41A 3K9KA 1CZ9A 2ZGYA 4E89A 4AHTA 3FZFA 2YHYA 3OS2A 3OYIA 3O9RA 4KREA 1JCFA 3PLAA 4JD2A 3VQDA 4DTOA 1NBWA 4JKDA 4IEEA 3LP0A 3GE1A 4DV3K 1NNEA 3CFRA 3VQ6A 4NLCA 2GV9A 1RT7A 3C6TA 4OKJA 1BO5O 1OH5A 4BDYA 5ELZA 3TABA 3DLRA 4M41A 1VQLN 2RN2A 3L4IA 1HKGA 2UXCK 4CJQA 2YKMA 3WXJA 4FJNA 1W0HA 3ZSOA 4KKOA 4FLVA 2E4LA 4GKJK 2A5XA 3KWGA 3S9HA 4CI6A 3K5OA 5AZJA 4K43A 3OY9A 4JK7A 1W97L 3NVMA 3KLIA 1IBKK 3J7ZO 3VQ9A 3CMAN 4FJIA 1QTMA 3I55N 4XEIA 4BRLA 4RW6A 3H46O 2P9SB 1VSIA 1KD1O 2HNYA 1JXBA 3Q7CA 3FZMA 2KZZA 1HKBA 4HVJA 5AQHA 2O8DA 3D2EA 3OS0A 1HJRA 2XO7A 4KHUA 3OYAA 1KRPA 4JRPA 1TYQA 4W5OA 3ZT0A 3KK2A 3KD5E 4H03B 1RFQA 2A1SA 4ZTJA 3SBGA 3J7AP 3ZCMA 1BHLA 1JLBA 4I6MB 3O4NA 1C0MA 5LJVA 4KHPK 5SZTA 1YTAA 1NK5A 4NYNA 3OJUA 3J81O 1TAUA 5C42A 3V9XA 3SQ2A 2PFUA 1JJ2M 2OPPA 5AQJA 3ZX0A 1VRUA 2IS3A 3JAMO 3QBWA 3T7ZA 3U6FA 2O8BA 3MN9A 4KTZA 4BQLA 4F2RA 5EVZA 4J2EA 3DLEA 3A8YA 3AVFA 2QM1A 3O1BA 2O8CA 5IWAK 3QNOA 4C8KA 2A6AA 3NH2A 4I2PA 3ZT4A 3S3MA 3P4IA 1LWCA 1NK7A 3HK2A 3C0BA 1WB9A 4IFYA 3WXLA 3LWLA 1DEJA 3VTIA 4X65K 4I7FA 2QWLA 4GY2B 1RCHA 3LDOA 3SV4A 2QK9A 4B3RK 3H1VX 4UY8O 1QE1A 4FWPA 2D0AA 1GOAA 4LC9B 1K8KB 5C10A 4JKGB 3LP2A 3OBYA 4H5TA 4IDKA 4DQ8A 4CGHA 3HBTA 1O13A 3QIOA 3NH1A 1OH8A 3CIPA 4OLBA 5DMRA 1NGFA 3B8AX 4DSJA 1IKXA 2Q97A 3QLHA 1VSLA 5EU7A 3U9ZA 5GAEP 3LALA 4BE2A 3HP9A 2UUAK 1RDBA 3DOKA 2YHBA 1WSHA 5GAGP 3RRGA 4I9QA 1BI4B 3NHGA 2HMPA 3UKUB 4DSIA 3KLFA 4IOXA 4H0OA 4DFMA 3ULEA 1JCEA 4YNQA 4BG9A 3V9WA 4DTRA 1RT5A 3NCIA 1OH7A 4FK2A 1CLQA 3SMSA 4NCGA 2NLXA 1U2VA 1VK0A 3PX4A 2QWQA 4NXMK 4J2BA 4JYAK 2O8EB 2Z1IA 4KH4A 2H3GX 1HQEA 3V1OA 2HHSA 2ZJQL 3F73A 2A40A 1C1AA 3O3HA 4O8KA 3VOVA 3QNNA 1RBUA 4A61A 4JHDB 2Z1GA 4XIUA 1JLCA 5AQGA 4DR3K 1XUPO 3SJJA 1X9JA 3ZEUB 2F4VK 2YHWA 4PL8A 4Q5VA 3SPYA 3H3NO 3ID6A 4CD1A 1XI1A 5M1NA 3T69A 4IWVA 3SZ2A 4W5QA 2OZMA 1TAQA 3IMXA 1VSHA 1BIZA 5KQ8A 3D2FA 3O9UA 4QAGA 1YHQN 4IKFA 5AQWA 3QERA 4DKWA 5BN8A 3J7YP 4K41A 4CZFA 4DTNA 3RR7A 3MWTA 1RDCA 1Z25A 4JS5A 2HF3A 3LDNA 1EWRA 1T7PA 5BR8K 4DQIA 4KHWA 3UKRA 3AVAA 3HTVA 4M3TA 2Q31A 3ZSYA 4DTPA 1I39A 5T7BA 2V52B 1GOBA 3D45A 1BWFO 1Z05A 4KV8A 1U45A 1X3NA 1K8AO 2PAVA 1EP4A 4Z4CA 5F1XA 4B9NA 1RBVA 4CJTA 4B8AB 4YHHK 1M90O 1VQKN 4IEIA 4CCHA 3AO5A 4FJLA 3BY5A 1WNSA 2V7YA 3THXB 3VESA 1Y64A 4FM0A 1E4GT 3BP8A 4M3RA 1YVUA 3QICA 2A41A 1YAGA 4IDHA 5AQNA 4B9LA 2F9WA 4DTJA 4B1UB 4FJKA 1ESVA 1RBRA 3ZSZA 4EHUA 4LF8K 3WUHA 2GTDA 1G99A 1LW0A 3HM9A 1GLLO 3OYLA 4F2SA 1BG3A 4YFUA 4U7BA 1VQ5N 4BACA 3TI0A 3D7EO 3LZJA 5HRNA 3AVIA 3CQXA 3WQUA 1A5VA 4BR9A 1U04A 3VPZA 4ILJA 4I9LA 4DUZK 3SUPA 5IT9O 2E2OA 3VMFB 3SUQA 1T3VA 1KLNA 1MU2A 4CHZA 4LF7K 4BC2A 1I94K 3DJCA 4CJ4A 3ALYA 4JI4K 5E84A 5AZIA 1FK9A 2HHUA 5AQLA 3DXKA 3I0RA 1C0GA 1RTDA 3D6RA 2YHXA 3S3OA 4FJMA 1YVNA 3AVMA 1HR0K 1ZBSA 1LAWA 3U9DA 5J2PA 4DFJA 3P39A 4EZ9A 1EO1A 2JGUA 5E26A 2ETJA 4N47A 3ZSRA 1NLVA 3EZWA 2IVNA 3CFPA 3BDPA 1JKHA 3U3YA 4G9ZA 1HUXA 2ZJPL 3THWB 2GUIA 3ZT3A 1FJGK 4OKKA 1X9MA 3UB5A 3LANA 3VEXA 3OYMA 3OYBA 3PV8A 2EHGA 3F5TA 3VENA 1NMNA 4CGDA 3D0PA 3QDKA 4W5RA 5DM6L 2VCPA 4RTFD 4WCEL 4WYBA 4CGFA 5GADP 1HYVA 2FSNA 1YJNN 2JLEA 4QOZB 3ZT1A 4C8LA 4J8FA 1TUUA 3QEXA 2FBVA 3RMAA 3W0LA 3GG4A 1NGIA 3NE6A 3HSCA 3C7NB 1K6YA 3F9MA 1HPMA 5J2MA 5AQMA 2RF2A 3THYA 3L8BA 1MDUB 2P5GA 2G8KA 1YT3A 3NMUA 4JI0K 3MECA 3NGYA 4DQPA 4NXNK 2VG5A 3NF7A 1ZBFA 1XMOK 1U4BA 3SMPA 2P9UA 3HZ6A 3MX5A 4DV4K 3A5LC 4MO5A 1DTQA 2IDOA 3Q7BA 2KW4A 4DR2K 1KLMA 1FKPA 1HNVA 4CJ5A 1NJWA 1TK5A 4A62A 3CCQN 4HHTA 4DLEA 1VQ7N 3EKSA 4KB1A 1JLEA 1V4SA 4B1XB 1H1VA 3M1FA 2CGLA 1HRHA 1ATRA 3CCRN 4HCBA 5LMUK 1BDGA 4E3SA 2AA4A 3KVGA 4BRNA 5KRTA 1IG8A 3NBPA 4RW8A 4PQUA 3LL3A 4KAZA 2BGGA 4AH9A 1NGDA 3SJHA 3GBTA 4CF2A 3V6DA 4DB3A 1U6ZA 4GNIA 1T8EA 3CJ7A 1HLUA 4AHSA 2NUBA 2P9LB 2FSKA 1JL1A 4M3YA 3AA2A 5E41A 4FLXA 1Q9XA 5MLCQ 2KLAA 4CECA 4FWRA 1L3SA 4QS9A 1WSIA 4Y1DA 3M8SA 3OS1A 4H5WA 5EX5A 3CJ1A 4DFKA 3AO4A 5AR0A 3AVNA 4GMJB 1NKBA 4L8RB 3CI5A 3EYZA 1XNQK 3CF5L 1HPZA 4CJLA 3TTFA 4BGAA 3EKUA 2QWMA 2VQFK 4CHPA 3V9ZA 3MDQA 1NJYA 2NRZA 2G8FA 4JEPA 3CM5A 1VSEA 1UA0A 4DMNA 3DLKA 5I9EB 4ID1A 3ZSQA 3A5OC 1RILA 2I7NA 3CQ8A 3RRHA 2NRXA 2P9KB 1TKTA 4FW1A 1Q8IA 4DTMA 5LMNK 4CBXA 4AQYK 3AO2A 4FWQA 1OH6A 1S1UA 4MFBA 2E8AA 2D1KA 4PHTX 2HHXA 4DV6K 1B92A 1SUQA 2GWJA 2Q3SA 3K57A 3IS9A 3DYAA 2PYLA 3L0QA 2E6LA 3AVCA 3VTHA 3OYKA 4O0IA 4PA1A 3VA3A 4B1ZA 4LH4A 3O9TA 1L3VA 2FSJA 2WC9A 4M42A 5FRNA 4FO0A 3HOSA 1VQON 3QEWA 1GOCA 3KJVA 4JI8K 4WF9L 3OA9A 4DSKA 3O9SA 5I3UA 3W3DA 2E1YA 1C6VA 4FXDA 1XC9A 1IKVA 3BUZB 4H0YB 1Q9YA 3KK3A 2I5JA 4N56A 1EXQA 3K5MA 4FLYA 3VEOA 5J2NA 2OPSA 1KAYA 4KO0A 5EOYA 3G6EN 5LL6Z 2DFHA 3MAQA 2YV0X 1ASWA 1KSPA 3OJSA 3DXMA 4E1JA 2YNHA 4IZ9A 2DPNA 3KHYA 3ITHA 1OKJA 1BQMA 4CJVA 5EXWA 3SK3A 4RW9A 3A5MC 3ENOA 3CERA 4B9QA 3LDSA 1X1PA 2BANA 4QS8A 4FLWA 1C1CA 3RR8A 1SQKA 4IJAA 1N34K 1VQ8N 4DQRA 2QXFA 2NRRA 3PSFA 4OPAA 3KK1A 2WTUA 1BL3A 3DLBA 4DR7K 3LDPA 3IAYA 1Q86O 3L3VA 1NJIO 1LCUA 5C24A 1C0FA 3AO3A 3CJCA 3DLLL 3SCXA 5CYMA 2VGNA 4CEAA 2PZSA 3VETA 4FOIA 5JS2A 3VA0A 4OLAA 4UQGA 4F8RA 3DLGA 1SL1A 3V9UA 3R9PA 2O8FA 5FRMA 3PIOL 4FJHA 4CK3A 4JK8A 4MQ3A 1P90A 3G10A 4JKFA 3CJBA 3GDQA 3RVCA 5JVHL 5LY3A 1GLDG 3ZSWA 2P9PA 1NGBA 1TV6A 3OHRA 4B1VA 1BOTO 4GW6A 3N4PA 4KFBA 3EY1A 1ZBUA 5KI6A 4KHSA 5A2QO 2W42A 1OVQA 2RKIA 3ASMA 3R6MA 3CC4N 4JI7K 4KI4A 1W7AA 3J8AA 3LP3A 3ID8A 3OW2M 4C8NA 3KTQA 3ULDA 4DSFA 3O3GA 3ENHA 3KD1E 5LJWA 3A0IX 3AVHA 1I3AA 5C2DA 5B8HA 4FVUA 1XMQK 5AQTA 3VN5A 2HVIA 3VQ5A 1C1BA 1C0UA 4ZHRA 4DF4A 4DU4A 4BC4A 1NGJA 1EETA 4CFDA 3VQ8A 1XC3A 3DLHA 4JRQA 3OTOK 3WEEB 2Z1HA 2FBXA 4F4KA 1RBTA 4WQ4C 2OPQA 4CHNA 1S72N 1XHZA 1JL2A 4BDZA 4EHTA 1VQPN 1TVRA 2P9IB 2OANA 4AM6A 1S1VA 4DF8A 5BR9A 3MEGA 3CM6A 4A2AA 5TKWA 4CEDA 5AQYA 2VG7A 1ITGA 3DRPA 3VQCA 4V19S 4JI5K 4H8KA 3QFUA 3RMBA 5BPMA 3F2KA 2DFFA 3HSTB 4J2DA 4CD3A 3IFRA 1SZ2A 3WXKA 2XY5A 1S6QA 5AQKA 4CZEA 3P31A 3G25A 4A57A 3MXJA 1TKZA 3PUFA 3QO9A 1QZ5A 4BR0A 4IOCL 3AVJA 1BUPA 2YNFA 3DWLA 3RTVA 3JS6A 2X6NA 4BRQA 1RT2A 3TR8A 4MDBA 4C8MA 5H1SQ 4YDUC 3VGLA 5FPMA 3LP1A 4OGEA 1K9MO 4CFBA 4YY3K 2UUBK 1JLGA 1HQUA 1VQ9N 1WSJA 3L2WA 5AQSA 2ZWHA 4LF4K 3NF8A 4BRGA 2ITGA 2VWBA 1KAZA 5HOOA 3LPTA 1J9AA 3OBWA 1HX1A 1YJ9N 1BQNA 4IFVA 1NWKA 4B08A 3AV9A 5HRRA 3CC7N 2HB5A 2J4RA 1LWFA 2E2PA 1VSJA 1IBLK 5F2RA 3BZCA 5AFUH 4A2BA 4H0XB 4IJNA 2IGIA 4ID5A 1UWBA 2Y1IA 1WUAA 4K42A 3MN7A 2QI2A 4CHQA 3PX0A 3NFAA 3FGUA 4EFHA 3FZLA 1J54A 2WBNA 2QKBA 2ASPA 5GINA 2E5LK 4W5TA 3RSEA 2VQEK 5C2FA 5C15A 3V9SA 4CZMA 3ZYYX 1IJJA 2RE2A 2YKNA 1QQOA 1B9FA 3L4QA 4ICLA 5AJ3K 1VQNN 4CIEA 2CGJA 2I7PA 4FZXC 3H1QA 3OYNA 3HL8A 4LH5A 2O4IA 2VG6A 5CZ1A 3OYDA 2YCHA 1D8YA 3HJFA 3UE5A 4DV7K 5AQRA 1TL1A 4RWTA 4MLEA 4DUYK 4BRFA 4BRDA 1BCOA 4I2QA 2IAJA 3AA5X 1WOQA 3SAFA 3LM9A 4Z0UA 1D9DA 1ASVA 5JICA 1EWQA 2KZMA 3AY9A 1N36K 4DHYA 1T03A 4IOAL 1S1WA 3SUOA 3DI6A 4B9SA 4BC5A 3V1RA 3V4IA 4OJRA 3MEEA 3AA3A 4BVPA 2E88A 4PKIA 2BDPA 2HHWA 4OKEA 4JD2B 4FJ9A 3AAQA 1U48A 1HYZA 4BR7A 4CJ3A 2E2NA 5JS1A 3KLEA 3O80A 4B9VA 1JLAA 5ADXA 4BR4A 4XH1A 2HHHK 1R59O 1VRTA 2P9NA 2HBLA 3O4WA 1N5YA 3SBTA 1HYSA 1N8RO 1S3XA 4CVNE 2G8WA 5AZJB 3HT3A 4EP4A 2D5RA 2F7TA 2B6AA 3GOIA 3P83D 1E4FT 4CZIA 4BRAA 3AO1A 1B9DA 3H3OB 4FK4A 1A5XA 5HROA 3WQTA 1F21A 3PO4A 4DV1K 4AM7A 2ZD1A 3MK6A 1NMDA 4HUEA 4CK1A 4E0DA 1HNIA 1U47A 3C6UA 1UA1A 4CF0A 4KH6A 2HNDA 4CZLA 2HHQA 2O8DB 3D2EB 4JI6K 4CHOA 5CYQA 5CE3A 1A5WA 1KFDA 2RPIA 1NK6A 3M3ZA 1TYQB 3FE1A 4B1YB 4F9OA 2XY6A 3C65A 2B5JA 3ATVA 4O5BA 3SNNA 3R8EA 1WAJA 3V1QA 5J1EA 3ZX3A 5GAHP 3OYJA 1CZAN 3CG7A 2QKKA 5TKYA 4M3ZA 1Q81O 5BN9A 1S5JA 3QEVA 4JI2K 2HSTA 1BIUA 4H5NA 1OVYA 3L2UA 2O8BB 1RTJA 3AARA 2FF6A 1R0AA 5AQPA 5BRHA 4GV6A 1NU0A 2O8CB 4JKEA 4DR1K 4FZZA 1BA1A 4BC3A 3MWPA 2BE2A 3E9PA 1KVBA 1TK0A 4FJXA 2DY4A 3AVGA 3FFKB 3TAPA 3HM8A 4WQ5A 1RGIA 3LAMA 1RDDA 1Z6RA 4M7XA 4NO7A 4K0KK 4KRFA 4CZGA 3EZ5A 3A2FA 4JAXA 2P9SA 1TUYA 3MCPA 2YNGA 3M8PA 4FZYA 2FC0A
chains in the Genus database with same CATH topology
3AA4A 2IS3A 3DYAA 2PYLA 4H4OA 3SQ4A 4ZTFA 4PQUA 3U6FA 1ZBLA 4KTZA 4F2RA 2E6LA 3AVCA 4CGGA 3KIOA 3OYKA 4J2EA 4O0IA 3DLEA 1LAVA 4PA1A 4BE0A 3AVFA 3VA3A 4LH4A 4C8KA 3QNOA 3NH2A 3DMJA 4I2PA 3ZT4A 3S3MA 1L3VA 4Y1CA 3VQPA 2FBTA 3O3FA 1LWCA 3B6PA 3SI6A 1NK7A 4M42A 3HK2A 3QEIA 4DQSA 3TAQA 1EX4A 2OA8A 3PY8A 5FRNA 1WLJA 4IFYA 3TAEA 3ZT2A 3LWLA 2XY7A 3QEWA 1GOCA 4CJFA 1J53A 3KJVA 4CIFA 4I7FA 4CJRA 2O4GA 4CEEA 1Y97A 4DG1A 1RCHA 3SV4A 5I3UA 3T3FA 1KVAA 1TKDA 3UIQA 3KTQA 2QK9A 4FYDA 1T05A 2LSNA 4BDPA 1C6VA 4FXDA 3O4QA 1QE1A 5C25A 1IKVA 1XC9A 1Q9YA 4F3OA 3KK3A 2PY5A 2I5JA 4O55A 1EXQA 4N56A 1VSMA 1VSDA 1QHTA 2D0AA 1GOAA 3HPGA 3K5MA 4FLYA 5J2NA 2OPSA 2FBYA 4KO0A 3TAGA 1NKCA 2DFHA 3MAQA 2YV0X 1ASWA 3LP2A 4G1QA 3OJSA 1KSPA 3MXIA 4IDKA 4Q0BA 4CFAA 2YNHA 4CGHA 1SL2A 4N76A 4E7LA 3QIOA 4GVMA 3NH1A 3MEDA 3ITHA 4KI6A 1BQMA 5DMRA 4CESA 4CJSA 4CJVA 4RW9A 4OLBA 2X78A 1NKEA 1QSLA 1WSGA 1FXXA 1QS4A 2XY8A 1J5OA 2HMIA 3LDSA 4DSJA 1IKXA 3QLHA 1X1PA 2BANA 4FLWA 1C1CA 3RR8A 2HHTA 1VSLA 5EU7A 4N5SA 4FJJA 3RMDA 3LALA 4H4MA 4BE2A 3HP9A 5HBMA 3HPHA 1RDBA 3DOKA 2X6SA 2YHBA 1WSHA 4DQRA 2QXFA 2Z1JA 3KK1A 1QSSA 5D3GA 4ELTA 1BL3A 3DLBA 3RRGA 2KTQA 4I9QA 1BI4B 3NHGA 3IAYA 3V81A 4DSKA 3S3NA 3L3VA 3K5NA 4DSIA 4CIGA 5C24A 3KLFA 3AO3A 3SCXA 4K8ZA 5CYMA 4O0JA 3LAKA 4Z4EA 4DFMA 4CEAA 3TWHA 4IG3A 4YNQA 2R7YA 3V9WA 3L2RA 3LPUA 4LSLA 4DTRA 3JSMA 4CGJA 1JXEA 2PZSA 4KHNA 4DSLA 1RT5A 3LWMA 5JS2A 3I0SA 4BWMA 1ZYQA 3VA0A 3NCIA 4M3XA 4OLAA 3OYCA 4UQGA 4F8RA 1VSFA 3DLGA 1SL1A 4M3WA 4FK2A 1CLQA 3V9UA 5FRMA 4FJHA 3JYTA 4FLUA 4CK3A 4NCGA 3T19A 3THVA 3TARA 4MQ3A 1VK0A 3G10A 1L3TA 3F9KA 4LD0A 3PX4A 2A1RA 1N6QA 1CXUA 3ZSWA 1IO2A 4DLGA 1TV6A 1JLFA 4J2BA 2HVHA 1JLQA 2Z1IA 1BI4A 4GW6A 4KFBA 3EY1A 1ZBUA 1HQEA 3V1OA 3RWUA 4FCYA 3NGZA 5KI6A 2HHSA 4KHSA 4Z4GA 4FJGA 3T1AA 2W42A 2RKIA 3F73A 1IH7A 3ASMA 4CEFA 4E7HA 4KI4A 4JLHA 1C1AA 3O3HA 3LP3A 3MXMA 4C8NA 2XHBA 1TK8A 2X74A 3AVLA 3L3UA 3HVRA 3OVNA 3ULDA 4DSFA 3QNNA 1RBUA 3O3GA 3L2VA 4Z4HA 2Z1GA 4XIUA 1JLCA 1IKWA 1G15A 5KRSA 3ISNC 4OPKA 3M8QA 3SJJA 3KD1E 2KQ2A 2YHAA 3AVHA 1I3AA 1U49A 4Q5VA 3SPYA 3L2QA 3VN5A 1NOZA 2HVIA 3VQ5A 1C1BA 1C0UA 1XI1A 1XWLA 5K14A 3ZSVA 4ZHRA 3TAMA 4E19A 4DU4A 4DF4A 1EETA 4CFDA 3H08A 3VQ8A 3SZ2A 4KHYA 4W5QA 4HTUA 1TAQA 3DLHA 1SL0A 2OZMA 1ZBHA 1VSHA 1BIZA 4BWJA 4JRQA 2F8TA 1Z26A 1RTHA 2Z1HA 2FBXA 3OYGA 4DU3A 4F4KA 1RBTA 2OPQA 4E1NA 4CHNA 4QAGA 4IKFA 2D0BA 4RG8A 3QERA 5FDLA 1S1XA 3ZSXA 1IG9A 1CZBA 1XHZA 1JL2A 4BDZA 4DU1A 3B6OA 1TVRA 2VWJA 1RDAA 4OPJA 1S1VA 3VQ7A 3E01A 4CHYA 4DTNA 4DF8A 3KLGA 3MEGA 2KFZA 3CM6A 3RR7A 4B3OA 2P1JA 4FW2A 4CEDA 1C0TA 2VG7A 4DSEA 1RDCA 2EX3A 4KTWA 1ITGA 1S6PA 1Z25A 3DRPA 3VQCA 3WNHA 4JS5A 1NJZA 1TL3A 3PX6A 1KCFA 1L5UA 1T7PA 4H8KA 4DQIA 1DTTA 4KHWA 3RMBA 3KKSA 3AVAA 2WONA 1RNHA 4M3TA 2DFFA 3HSTB 3K58A 4J2DA 3ZSYA 4DTPA 4KB0A 1I39A 5T7BA 2IOCA 4PUOA 1GOBA 3D45A 2XY5A 4KV8A 4E1MA 1U45A 1S6QA 4JS4A 4M45A 1WN7A 3QEPA 3WNEA 4CJKA 3FFIA 1EP4A 4Z4CA 3MXJA 4CJWA 4LY7A 4B9NA 1D5AA 2HW3A 1RBVA 1TKZA 3U3GA 4B8AB 4CJTA 3DOLA 2Y1JA 3SQ0A 4CCHA 5FROA 3AO5A 4B8CA 4CGIA 4B9TA 4FJLA 3PUFA 3QO9A 1WNSA 4DTSA 5J2QA 1SKSA 3NDKA 1CXQA 1YTUA 3AVJA 3K2PA 4OVLA 4AHUA 3HPOA 2YNFA 4CEQA 3TAFA 4FM0A 3VQ4A 4M3RA 3RTVA 3DRSA 1W9HA 2X6NA 1YVUA 1RT2A 4FLZA 4BE1A 4FK0A 3TR8A 4EZ6A 4C8MA 4B9LA 4DTJA 3LP1A 4OGEA 3G0ZA 4FJKA 4CFBA 4TSXA 3OYHA 3ZSZA 1RBRA 1JLGA 1HQUA 4E7KA 1BCMA 1WSJA 4K8XA 3L2WA 3TANA 4NCBA 3NF8A 2ITGA 1NK8A 4E7JA 1KVCA 2F8SA 3KKRA 4AHVA 4KTQA 1NK4A 1LW0A 3LPTA 3NAEA 1IKYA 1J9AA 1RT6A 3HM9A 3OYLA 1RT4A 3P1GA 4F2SA 4YFUA 1XHXA 2HNZA 1BQNA 4IFVA 4BACA 2KFNA 4FJ7A 3TI0A 1S9EA 3NF9A 4O4GA 3LZJA 4OGCA 4NYFA 1RBSA 5HRNA 4CJUA 3VQAA 1WSFA 3AV9A 3AVIA 5HRRA 4B08A 4CF1A 2PYJA 1X9SA 2HB5A 1A5VA 3WNFA 4Z4IA 1LWFA 1U04A 5SWMA 1VSJA 5KTQA 1SKRA 1HMVA 4I9LA 2DFEA 4FLTA 3DRRA 3SUPA 1TGOA 2IGIA 4E7IA 4ID5A 4CERA 1UWBA 2Y1IA 3NGIA 3SUQA 1NK9A 3IRXA 1KLNA 1MU2A 4CHQA 4HUFA 3PX0A 3NFAA 4PWDA 4CHZA 1RT3A 4CJ4A 3ALYA 5CZ2A 1J54A 1QQCA 1FK9A 4AILC 4IG0A 3NH0A 4FJ5A 5I42A 2QKBA 2HHUA 4W5TA 3I0RA 1SV5A 1L3UA 1RTDA 4B9MA 3S3OA 4FJMA 3K57A 3AVMA 3V9SA 5HP1A 1LAWA 2YKNA 5J2PA 2OZSA 4Z4FA 4DFJA 1B9FA 4EZ9A 3LZIA 2JGUA 3SYZA 4ICLA 2ETJA 1KFSA 4B9UA 5CY4A 4N47A 3ZSRA 1FKOA 1SKWA 3CFPA 4LSNA 4CIEA 3BDPA 4RW4A 1JKHA 3DM2A 2G8UA 3U3YA 1S9GA 1NJXA 3QESA 4FZXC 4RW7A 3OYNA 3HO1A 3HL8A 4LH5A 2O4IA 2VG6A 5CZ1A 3OYDA 1D8YA 3HJFA 2HHVA 5HRPA 2GUIA 1TL1A 4CK2A 1ZBIA 3ZT3A 1BCOA 4I2QA 2IAJA 3AA5X 4OKKA 1X9MA 4KPYA 1ASUA 2YNIA 3I8DA 2P5OA 3LANA 4PY5A 1LWEA 3OYMA 4Z0UA 3OYBA 1ASVA 3HXMA 3QETA 4DS5A 3PV8A 2EHGA 1D9DA 3PO5A 3D0PA 4CGDA 3OYFA 3HP6A 4DQQA 4C8OA 4FJ8A 4W5RA 4AHCA 4KHQA 2KZMA 4ELVA 3CYMA 1UOCA 1UAXA 4CGFA 1D9FA 4CE9A 3QIPA 4DWIA 1HYVA 4FVMA 4CJEA 4DTXA 4DS4A 1T03A 5HRSA 2G8VA 3SUNA 1S1WA 2OYQA 2JLEA 2B4JA 3SUOA 4QOZB 3DI6A 3ZT1A 4B9SA 1BGXT 4C8LA 3QEXA 2FBVA 3V1RA 3RMAA 3V4IA 3VQQA 1LW2A 1RTIA 1RT1A 3MEEA 3BGRA 4OJRA 3AA3A 1DLOA 3NE6A 4R5PA 3C94A 1K6YA 3IS9A 5J2MA 2RF2A 4CJPA 2BDPA 3WNGA 2HHWA 4FM2A 3L8BA 5DK5A 4OKEA 2P5GA 2ZE2A 2G8KA 1O1WA 1YT3A 1NK0A 2ATQA 4FJ9A 1U48A 2D0CA 1HYZA 3MECA 4CJ3A 3HVTA 5JS1A 3NGYA 3KLEA 4DQPA 4F3TA 2VG5A 4B9VA 3NF7A 1ZBFA 2AJQA 1S1TA 1U4BA 1JLAA 2G8HA 3NF6A 3P5JA 3VQBA 1QSYA 1DTQA 2IDOA 2P51A 1REVA 3K5LA 3SPZA 1VRTA 2KW4A 4CFCA 1KLMA 1FKPA 1HNVA 4CJ5A 1NJWA 2F96A 1TK5A 1N5YA 1BISA 3QINA 4HHTA 4DLEA 1HYSA 1CZ9A 4KB1A 4E89A 2G8WA 1JLEA 4AHTA 3HT3A 3OS2A 4EP4A 3OYIA 2D5RA 4EP5A 2B6AA 5HLFA 3P83D 1HRHA 4KREA 4O44A 3VQDA 4DTOA 4HCBA 3AO1A 1B9DA 3LP0A 4E3SA 4DFPA 4FK4A 1A5XA 5HROA 5KRTA 1F21A 1EKEA 4CF9A 3PO4A 3CFRA 4N41A 3NBPA 2ZD1A 2XRIA 3VQ6A 4HUEA 4CK1A 4E0DA 1HNIA 2GV9A 1RT7A 4RW8A 2G8IA 3C6TA 1U47A 4OKJA 3C6UA 1UA1A 4KAZA 4CF0A 2BGGA 4BDYA 3TABA 4AH9A 2HNDA 3DLRA 4WE1A 3C95A 4M41A 2HHQA 2RN2A 4CF2A 1TKXA 4CHOA 4CJQA 2YKMA 3V6DA 5CYQA 1T8EA 4FJNA 1A5WA 1KFDA 1W0HA 2RPIA 3ZSOA 3M8RA 1NK6A 4KKOA 4AHSA 4FLVA 2E4LA 2NUBA 1JL1A 2E6MA 3AA2A 5E41A 2WOMA 4FLXA 4M3YA 1Q9XA 3AVKA 3OYEA 4CF8A 4CECA 2XY6A 3S9HA 2B5JA 3K5OA 1L3SA 4O5BA 3OY9A 3SNNA 1WSIA 1WAJA 2GBZA 4Y1DA 3V1QA 3M8SA 5J1EA 3OS1A 3OYJA 3AVBA 4ELUA 3KLIA 4DFKA 3CG7A 3VQ9A 3AO4A 2QKKA 4FJIA 4NCAA 1QTMA 3AVNA 4GMJB 4IBNA 1NKBA 4L8RB 4RW6A 3EYZA 4CEZA 4M3ZA 1S5JA 4FM1A 1HPZA 3VQEA 4CJLA 3QEVA 1VSIA 4QCLA 3K59A 2HNYA 1BIUA 3CFOA 1JXBA 5KGXA 3L2UA 2KZZA 4CHPA 1RTJA 2IC3A 4HVJA 3V9ZA 4J2AA 4W5NA 3OS0A 1R0AA 1NJYA 2ZQBA 1HJRA 2G8FA 4HUGA 4M3UA 3CM5A 2XO7A 4KHUA 3OYAA 1KRPA 1VSEA 2DTUA 1UA0A 4DMNA 4JRPA 3DLKA 3SV3A 4FZZA 4W5OA 3ZT0A 3KK2A 4ID1A 3ZSQA 3HYFA 1RILA 3CQ8A 2BE2A 3RRHA 1KVBA 1TK0A 4AHRA 1X9WA 3KD5E 4FJXA 3SQ1A 2A1SA 4ZTJA 1TKTA 4FW1A 3ZCMA 1Q8IA 4DTMA 2DY4A 1VSKA 1BHLA 1JLBA 2VWKA 1WAFA 3O4NA 3AVGA 1NOYA 3RMCA 1LV5A 3TAPA 1C0MA 3LAMA 3AO2A 1RDDA 5SZTA 4CEBA 1YTAA 1NK5A 3KLHA 1S1UA 4NYNA 3OJUA 1WSEA 4KRFA 3IG1A 4MFBA 1TAUA 3EZ5A 5C42A 2OPRA 3A2FA 5KGWA 4CEOA 3V9XA 1KTQA 4DTUA 4HCCA 2HHXA 3SQ2A 1B92A 1SUQA 2OPPA 2YNGA 3M8PA 2Q3SA 4FZYA 2FC0A 1VRUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AA4 A;  2IS3 A;  3DYA A;  2PYL A;  4H4O A;  3SQ4 A;  4ZTF A;  4PQU A;  3U6F A;  1ZBL A;  4KTZ A;  4F2R A;  2E6L A;  3AVC A;  4CGG A;  3KIO A;  3OYK A;  4J2E A;  4O0I A;  3DLE A;  1LAV A;  4PA1 A;  4BE0 A;  3AVF A;  3VA3 A;  4LH4 A;  4C8K A;  3QNO A;  3NH2 A;  3DMJ A;  4I2P A;  3ZT4 A;  3S3M A;  1L3V A;  4Y1C A;  3VQP A;  2FBT A;  3O3F A;  1LWC A;  3B6P A;  3SI6 A;  1NK7 A;  4M42 A;  3HK2 A;  3QEI A;  4DQS A;  3TAQ A;  1EX4 A;  2OA8 A;  3PY8 A;  5FRN A;  1WLJ A;  4IFY A;  3TAE A;  3ZT2 A;  3LWL A;  2XY7 A;  3QEW A;  1GOC A;  4CJF A;  1J53 A;  3KJV A;  4CIF A;  4I7F A;  4CJR A;  2O4G A;  4CEE A;  1Y97 A;  4DG1 A;  1RCH A;  3SV4 A;  5I3U A;  3T3F A;  1KVA A;  1TKD A;  3UIQ A;  3KTQ A;  2QK9 A;  4FYD A;  1T05 A;  2LSN A;  4BDP A;  1C6V A;  4FXD A;  3O4Q A;  1QE1 A;  5C25 A;  1IKV A;  1XC9 A;  1Q9Y A;  4F3O A;  3KK3 A;  2PY5 A;  2I5J A;  4O55 A;  1EXQ A;  4N56 A;  1VSM A;  1VSD A;  1QHT A;  2D0A A;  1GOA A;  3HPG A;  3K5M A;  4FLY A;  5J2N A;  2OPS A;  2FBY A;  4KO0 A;  3TAG A;  1NKC A;  2DFH A;  3MAQ A;  2YV0 X;  1ASW A;  3LP2 A;  4G1Q A;  3OJS A;  1KSP A;  3MXI A;  4IDK A;  4Q0B A;  4CFA A;  2YNH A;  4CGH A;  1SL2 A;  4N76 A;  4E7L A;  3QIO A;  4GVM A;  3NH1 A;  3MED A;  3ITH A;  4KI6 A;  1BQM A;  5DMR A;  4CES A;  4CJS A;  4CJV A;  4RW9 A;  4OLB A;  2X78 A;  1NKE A;  1QSL A;  1WSG A;  1FXX A;  1QS4 A;  2XY8 A;  1J5O A;  2HMI A;  3LDS A;  4DSJ A;  1IKX A;  3QLH A;  1X1P A;  2BAN A;  4FLW A;  1C1C A;  3RR8 A;  2HHT A;  1VSL A;  5EU7 A;  4N5S A;  4FJJ A;  3RMD A;  3LAL A;  4H4M A;  4BE2 A;  3HP9 A;  5HBM A;  3HPH A;  1RDB A;  3DOK A;  2X6S A;  2YHB A;  1WSH A;  4DQR A;  2QXF A;  2Z1J A;  3KK1 A;  1QSS A;  5D3G A;  4ELT A;  1BL3 A;  3DLB A;  3RRG A;  2KTQ A;  4I9Q A;  1BI4 B;  3NHG A;  3IAY A;  3V81 A;  4DSK A;  3S3N A;  3L3V A;  3K5N A;  4DSI A;  4CIG A;  5C24 A;  3KLF A;  3AO3 A;  3SCX A;  4K8Z A;  5CYM A;  4O0J A;  3LAK A;  4Z4E A;  4DFM A;  4CEA A;  3TWH A;  4IG3 A;  4YNQ A;  2R7Y A;  3V9W A;  3L2R A;  3LPU A;  4LSL A;  4DTR A;  3JSM A;  4CGJ A;  1JXE A;  2PZS A;  4KHN A;  4DSL A;  1RT5 A;  3LWM A;  5JS2 A;  3I0S A;  4BWM A;  1ZYQ A;  3VA0 A;  3NCI A;  4M3X A;  4OLA A;  3OYC A;  4UQG A;  4F8R A;  1VSF A;  3DLG A;  1SL1 A;  4M3W A;  4FK2 A;  1CLQ A;  3V9U A;  5FRM A;  4FJH A;  3JYT A;  4FLU A;  4CK3 A;  4NCG A;  3T19 A;  3THV A;  3TAR A;  4MQ3 A;  1VK0 A;  3G10 A;  1L3T A;  3F9K A;  4LD0 A;  3PX4 A;  2A1R A;  1N6Q A;  1CXU A;  3ZSW A;  1IO2 A;  4DLG A;  1TV6 A;  1JLF A;  4J2B A;  2HVH A;  1JLQ A;  2Z1I A;  1BI4 A;  4GW6 A;  4KFB A;  3EY1 A;  1ZBU A;  1HQE A;  3V1O A;  3RWU A;  4FCY A;  3NGZ A;  5KI6 A;  2HHS A;  4KHS A;  4Z4G A;  4FJG A;  3T1A A;  2W42 A;  2RKI A;  3F73 A;  1IH7 A;  3ASM A;  4CEF A;  4E7H A;  4KI4 A;  4JLH A;  1C1A A;  3O3H A;  3LP3 A;  3MXM A;  4C8N A;  2XHB A;  1TK8 A;  2X74 A;  3AVL A;  3L3U A;  3HVR A;  3OVN A;  3ULD A;  4DSF A;  3QNN A;  1RBU A;  3O3G A;  3L2V A;  4Z4H A;  2Z1G A;  4XIU A;  1JLC A;  1IKW A;  1G15 A;  5KRS A;  3ISN C;  4OPK A;  3M8Q A;  3SJJ A;  3KD1 E;  2KQ2 A;  2YHA A;  3AVH A;  1I3A A;  1U49 A;  4Q5V A;  3SPY A;  3L2Q A;  3VN5 A;  1NOZ A;  2HVI A;  3VQ5 A;  1C1B A;  1C0U A;  1XI1 A;  1XWL A;  5K14 A;  3ZSV A;  4ZHR A;  3TAM A;  4E19 A;  4DU4 A;  4DF4 A;  1EET A;  4CFD A;  3H08 A;  3VQ8 A;  3SZ2 A;  4KHY A;  4W5Q A;  4HTU A;  1TAQ A;  3DLH A;  1SL0 A;  2OZM A;  1ZBH A;  1VSH A;  1BIZ A;  4BWJ A;  4JRQ A;  2F8T A;  1Z26 A;  1RTH A;  2Z1H A;  2FBX A;  3OYG A;  4DU3 A;  4F4K A;  1RBT A;  2OPQ A;  4E1N A;  4CHN A;  4QAG A;  4IKF A;  2D0B A;  4RG8 A;  3QER A;  5FDL A;  1S1X A;  3ZSX A;  1IG9 A;  1CZB A;  1XHZ A;  1JL2 A;  4BDZ A;  4DU1 A;  3B6O A;  1TVR A;  2VWJ A;  1RDA A;  4OPJ A;  1S1V A;  3VQ7 A;  3E01 A;  4CHY A;  4DTN A;  4DF8 A;  3KLG A;  3MEG A;  2KFZ A;  3CM6 A;  3RR7 A;  4B3O A;  2P1J A;  4FW2 A;  4CED A;  1C0T A;  2VG7 A;  4DSE A;  1RDC A;  2EX3 A;  4KTW A;  1ITG A;  1S6P A;  1Z25 A;  3DRP A;  3VQC A;  3WNH A;  4JS5 A;  1NJZ A;  1TL3 A;  3PX6 A;  1KCF A;  1L5U A;  1T7P A;  4H8K A;  4DQI A;  1DTT A;  4KHW A;  3RMB A;  3KKS A;  3AVA A;  2WON A;  1RNH A;  4M3T A;  2DFF A;  3HST B;  3K58 A;  4J2D A;  3ZSY A;  4DTP A;  4KB0 A;  1I39 A;  5T7B A;  2IOC A;  4PUO A;  1GOB A;  3D45 A;  2XY5 A;  4KV8 A;  4E1M A;  1U45 A;  1S6Q A;  4JS4 A;  4M45 A;  1WN7 A;  3QEP A;  3WNE A;  4CJK A;  3FFI A;  1EP4 A;  4Z4C A;  3MXJ A;  4CJW A;  4LY7 A;  4B9N A;  1D5A A;  2HW3 A;  1RBV A;  1TKZ A;  3U3G A;  4B8A B;  4CJT A;  3DOL A;  2Y1J A;  3SQ0 A;  4CCH A;  5FRO A;  3AO5 A;  4B8C A;  4CGI A;  4B9T A;  4FJL A;  3PUF A;  3QO9 A;  1WNS A;  4DTS A;  5J2Q A;  1SKS A;  3NDK A;  1CXQ A;  1YTU A;  3AVJ A;  3K2P A;  4OVL A;  4AHU A;  3HPO A;  2YNF A;  4CEQ A;  3TAF A;  4FM0 A;  3VQ4 A;  4M3R A;  3RTV A;  3DRS A;  1W9H A;  2X6N A;  1YVU A;  1RT2 A;  4FLZ A;  4BE1 A;  4FK0 A;  3TR8 A;  4EZ6 A;  4C8M A;  4B9L A;  4DTJ A;  3LP1 A;  4OGE A;  3G0Z A;  4FJK A;  4CFB A;  4TSX A;  3OYH A;  3ZSZ A;  1RBR A;  1JLG A;  1HQU A;  4E7K A;  1BCM A;  1WSJ A;  4K8X A;  3L2W A;  3TAN A;  4NCB A;  3NF8 A;  2ITG A;  1NK8 A;  4E7J A;  1KVC A;  2F8S A;  3KKR A;  4AHV A;  4KTQ A;  1NK4 A;  1LW0 A;  3LPT A;  3NAE A;  1IKY A;  1J9A A;  1RT6 A;  3HM9 A;  3OYL A;  1RT4 A;  3P1G A;  4F2S A;  4YFU A;  1XHX A;  2HNZ A;  1BQN A;  4IFV A;  4BAC A;  2KFN A;  4FJ7 A;  3TI0 A;  1S9E A;  3NF9 A;  4O4G A;  3LZJ A;  4OGC A;  4NYF A;  1RBS A;  5HRN A;  4CJU A;  3VQA A;  1WSF A;  3AV9 A;  3AVI A;  5HRR A;  4B08 A;  4CF1 A;  2PYJ A;  1X9S A;  2HB5 A;  1A5V A;  3WNF A;  4Z4I A;  1LWF A;  1U04 A;  5SWM A;  1VSJ A;  5KTQ A;  1SKR A;  1HMV A;  4I9L A;  2DFE A;  4FLT A;  3DRR A;  3SUP A;  1TGO A;  2IGI A;  4E7I A;  4ID5 A;  4CER A;  1UWB A;  2Y1I A;  3NGI A;  3SUQ A;  1NK9 A;  3IRX A;  1KLN A;  1MU2 A;  4CHQ A;  4HUF A;  3PX0 A;  3NFA A;  4PWD A;  4CHZ A;  1RT3 A;  4CJ4 A;  3ALY A;  5CZ2 A;  1J54 A;  1QQC A;  1FK9 A;  4AIL C;  4IG0 A;  3NH0 A;  4FJ5 A;  5I42 A;  2QKB A;  2HHU A;  4W5T A;  3I0R A;  1SV5 A;  1L3U A;  1RTD A;  4B9M A;  3S3O A;  4FJM A;  3K57 A;  3AVM A;  3V9S A;  5HP1 A;  1LAW A;  2YKN A;  5J2P A;  2OZS A;  4Z4F A;  4DFJ A;  1B9F A;  4EZ9 A;  3LZI A;  2JGU A;  3SYZ A;  4ICL A;  2ETJ A;  1KFS A;  4B9U A;  5CY4 A;  4N47 A;  3ZSR A;  1FKO A;  1SKW A;  3CFP A;  4LSN A;  4CIE A;  3BDP A;  4RW4 A;  1JKH A;  3DM2 A;  2G8U A;  3U3Y A;  1S9G A;  1NJX A;  3QES A;  4FZX C;  4RW7 A;  3OYN A;  3HO1 A;  3HL8 A;  4LH5 A;  2O4I A;  2VG6 A;  5CZ1 A;  3OYD A;  1D8Y A;  3HJF A;  2HHV A;  5HRP A;  2GUI A;  1TL1 A;  4CK2 A;  1ZBI A;  3ZT3 A;  1BCO A;  4I2Q A;  2IAJ A;  3AA5 X;  4OKK A;  1X9M A;  4KPY A;  1ASU A;  2YNI A;  3I8D A;  2P5O A;  3LAN A;  4PY5 A;  1LWE A;  3OYM A;  4Z0U A;  3OYB A;  1ASV A;  3HXM A;  3QET A;  4DS5 A;  3PV8 A;  2EHG A;  1D9D A;  3PO5 A;  3D0P A;  4CGD A;  3OYF A;  3HP6 A;  4DQQ A;  4C8O A;  4FJ8 A;  4W5R A;  4AHC A;  4KHQ A;  2KZM A;  4ELV A;  3CYM A;  1UOC A;  1UAX A;  4CGF A;  1D9F A;  4CE9 A;  3QIP A;  4DWI A;  1HYV A;  4FVM A;  4CJE A;  4DTX A;  4DS4 A;  1T03 A;  5HRS A;  2G8V A;  3SUN A;  1S1W A;  2OYQ A;  2JLE A;  2B4J A;  3SUO A;  4QOZ B;  3DI6 A;  3ZT1 A;  4B9S A;  1BGX T;  4C8L A;  3QEX A;  2FBV A;  3V1R A;  3RMA A;  3V4I A;  3VQQ A;  1LW2 A;  1RTI A;  1RT1 A;  3MEE A;  3BGR A;  4OJR A;  3AA3 A;  1DLO A;  3NE6 A;  4R5P A;  3C94 A;  1K6Y A;  3IS9 A;  5J2M A;  2RF2 A;  4CJP A;  2BDP A;  3WNG A;  2HHW A;  4FM2 A;  3L8B A;  5DK5 A;  4OKE A;  2P5G A;  2ZE2 A;  2G8K A;  1O1W A;  1YT3 A;  1NK0 A;  2ATQ A;  4FJ9 A;  1U48 A;  2D0C A;  1HYZ A;  3MEC A;  4CJ3 A;  3HVT A;  5JS1 A;  3NGY A;  3KLE A;  4DQP A;  4F3T A;  2VG5 A;  4B9V A;  3NF7 A;  1ZBF A;  2AJQ A;  1S1T A;  1U4B A;  1JLA A;  2G8H A;  3NF6 A;  3P5J A;  3VQB A;  1QSY A;  1DTQ A;  2IDO A;  2P51 A;  1REV A;  3K5L A;  3SPZ A;  1VRT A;  2KW4 A;  4CFC A;  1KLM A;  1FKP A;  1HNV A;  4CJ5 A;  1NJW A;  2F96 A;  1TK5 A;  1N5Y A;  1BIS A;  3QIN A;  4HHT A;  4DLE A;  1HYS A;  1CZ9 A;  4KB1 A;  4E89 A;  2G8W A;  1JLE A;  4AHT A;  3HT3 A;  3OS2 A;  4EP4 A;  3OYI A;  2D5R A;  4EP5 A;  2B6A A;  5HLF A;  3P83 D;  1HRH A;  4KRE A;  4O44 A;  3VQD A;  4DTO A;  4HCB A;  3AO1 A;  1B9D A;  3LP0 A;  4E3S A;  4DFP A;  4FK4 A;  1A5X A;  5HRO A;  5KRT A;  1F21 A;  1EKE A;  4CF9 A;  3PO4 A;  3CFR A;  4N41 A;  3NBP A;  2ZD1 A;  2XRI A;  3VQ6 A;  4HUE A;  4CK1 A;  4E0D A;  1HNI A;  2GV9 A;  1RT7 A;  4RW8 A;  2G8I A;  3C6T A;  1U47 A;  4OKJ A;  3C6U A;  1UA1 A;  4KAZ A;  4CF0 A;  2BGG A;  4BDY A;  3TAB A;  4AH9 A;  2HND A;  3DLR A;  4WE1 A;  3C95 A;  4M41 A;  2HHQ A;  2RN2 A;  4CF2 A;  1TKX A;  4CHO A;  4CJQ A;  2YKM A;  3V6D A;  5CYQ A;  1T8E A;  4FJN A;  1A5W A;  1KFD A;  1W0H A;  2RPI A;  3ZSO A;  3M8R A;  1NK6 A;  4KKO A;  4AHS A;  4FLV A;  2E4L A;  2NUB A;  1JL1 A;  2E6M A;  3AA2 A;  5E41 A;  2WOM A;  4FLX A;  4M3Y A;  1Q9X A;  3AVK A;  3OYE A;  4CF8 A;  4CEC A;  2XY6 A;  3S9H A;  2B5J A;  3K5O A;  1L3S A;  4O5B A;  3OY9 A;  3SNN A;  1WSI A;  1WAJ A;  2GBZ A;  4Y1D A;  3V1Q A;  3M8S A;  5J1E A;  3OS1 A;  3OYJ A;  3AVB A;  4ELU A;  3KLI A;  4DFK A;  3CG7 A;  3VQ9 A;  3AO4 A;  2QKK A;  4FJI A;  4NCA A;  1QTM A;  3AVN A;  4GMJ B;  4IBN A;  1NKB A;  4L8R B;  4RW6 A;  3EYZ A;  4CEZ A;  4M3Z A;  1S5J A;  4FM1 A;  1HPZ A;  3VQE A;  4CJL A;  3QEV A;  1VSI A;  4QCL A;  3K59 A;  2HNY A;  1BIU A;  3CFO A;  1JXB A;  5KGX A;  3L2U A;  2KZZ A;  4CHP A;  1RTJ A;  2IC3 A;  4HVJ A;  3V9Z A;  4J2A A;  4W5N A;  3OS0 A;  1R0A A;  1NJY A;  2ZQB A;  1HJR A;  2G8F A;  4HUG A;  4M3U A;  3CM5 A;  2XO7 A;  4KHU A;  3OYA A;  1KRP A;  1VSE A;  2DTU A;  1UA0 A;  4DMN A;  4JRP A;  3DLK A;  3SV3 A;  4FZZ A;  4W5O A;  3ZT0 A;  3KK2 A;  4ID1 A;  3ZSQ A;  3HYF A;  1RIL A;  3CQ8 A;  2BE2 A;  3RRH A;  1KVB A;  1TK0 A;  4AHR A;  1X9W A;  3KD5 E;  4FJX A;  3SQ1 A;  2A1S A;  4ZTJ A;  1TKT A;  4FW1 A;  3ZCM A;  1Q8I A;  4DTM A;  2DY4 A;  1VSK A;  1BHL A;  1JLB A;  2VWK A;  1WAF A;  3O4N A;  3AVG A;  1NOY A;  3RMC A;  1LV5 A;  3TAP A;  1C0M A;  3LAM A;  3AO2 A;  1RDD A;  5SZT A;  4CEB A;  1YTA A;  1NK5 A;  3KLH A;  1S1U A;  4NYN A;  3OJU A;  1WSE A;  4KRF A;  3IG1 A;  4MFB A;  1TAU A;  3EZ5 A;  5C42 A;  2OPR A;  3A2F A;  5KGW A;  4CEO A;  3V9X A;  1KTQ A;  4DTU A;  4HCC A;  2HHX A;  3SQ2 A;  1B92 A;  1SUQ A;  2OPP A;  2YNG A;  3M8P A;  2Q3S A;  4FZY A;  2FC0 A;  1VRU A; 
#chains in the Genus database with same CATH topology
 4H4O A;  2FLO A;  3SQ4 A;  1ZBL A;  5M1F A;  3KIO A;  1LOT B;  4CZJ A;  4LF6 K;  4M63 C;  4CBU A;  2YX6 A;  3A5N C;  3ZET A;  2ZGZ A;  3FZH A;  2FBT A;  2ZF5 O;  4BR2 A;  1GLF O;  4DQS A;  3TAQ A;  1EX4 A;  3PY8 A;  4I6M A;  3I56 N;  2XY7 A;  4CJF A;  1J53 A;  2QW9 A;  2O4G A;  4CEE A;  1TKD A;  1KVA A;  3HRG A;  4XH4 A;  1T05 A;  4A5B A;  4FL9 A;  4WFN L;  4F3O A;  1VSM A;  1VSD A;  4MO4 A;  5BPL A;  2FBY A;  4YOU A;  3TAG A;  4G1Q A;  3ULE B;  4JKB A;  4CFA A;  1SL2 A;  4N76 A;  5DM7 L;  3QB0 A;  4CJS A;  2Q1N A;  1NKE A;  2NRH A;  1FXX A;  1QS4 A;  2XY8 A;  3S41 A;  2HMI A;  5JVG L;  2OTJ N;  2WUS A;  1U2V B;  3RMD A;  3VEZ A;  5HBM A;  2X6S A;  4CBW A;  3CQY A;  4DR6 K;  3V81 A;  4IFE A;  4JKA A;  1QVG M;  3TTD A;  4BRC A;  4CIG A;  3HOT A;  1HJO A;  4K8Z A;  4X62 K;  1K8K A;  4Z4E A;  3FZK A;  4GVE A;  4JKG A;  2E20 A;  1FW6 A;  4IG3 A;  2R7Y A;  3L2R A;  4CGJ A;  4KHN A;  1HNX K;  4JNE A;  3I0S A;  1ZYQ A;  5FPD A;  1VSF A;  4L3Q A;  3MN6 A;  2ZM6 K;  4QS7 A;  4YOT A;  3T19 A;  2OTL N;  3HI0 A;  4FSV A;  4LD0 A;  4CW7 B;  1N6Q A;  1CXU A;  3KK7 A;  5BRD A;  4DLG A;  2QA4 N;  2WFB A;  3D2F B;  4DR4 K;  3EE8 A;  3TSQ A;  1BI4 A;  4C1N K;  3UKU A;  3RWU A;  3BZK A;  4YOR A;  4Z4G A;  4FJG A;  3T1A A;  1IH7 A;  4JKH A;  4CEF A;  1XNR K;  3O6W A;  5C0Y A;  3HVR A;  2NRW A;  4BY9 C;  1G15 A;  1IKW A;  5KRS A;  3ZX2 A;  4OPK A;  3H45 C;  1NGC A;  2YHA A;  5AQU A;  1U49 A;  3UKR B;  1NOZ A;  5KPT A;  3ZSV A;  4BVO A;  4E19 A;  1YIT N;  3H08 A;  4BRP A;  4FYD A;  5JLF A;  3CPE A;  4BWJ A;  1Z26 A;  2O8E A;  2ASO A;  5GIP A;  1IV0 A;  4JN4 A;  3J80 O;  2D0B A;  2YI1 A;  3ATU A;  2UXB K;  5M1K A;  4DU1 A;  2VWJ A;  5KPR A;  4OPJ A;  3VQ7 A;  4CHY A;  4GV3 A;  4B3O A;  4JHD A;  4DSE A;  2FF3 B;  1S6P A;  4ISG A;  2HF4 A;  4C1N I;  3ZEU A;  4A5A A;  1KCF A;  1L5U A;  3EO3 A;  4O5F A;  1NGH A;  2WON A;  1RNH A;  4IO9 L;  3CJA A;  4KB0 A;  3ZLJ A;  2HOE A;  4IXC A;  3O1W A;  2IOC A;  4PUO A;  3KWI A;  1YF5 L;  4JS4 A;  4M45 A;  3MX2 A;  4ILH A;  3VEY A;  4CJK A;  5FPE A;  3I33 A;  3GL1 A;  4LF5 K;  4CJW A;  2QWO A;  4LY7 A;  2HW3 A;  1SAZ A;  1HNW K;  2QWN A;  3U3G A;  3SQ0 A;  3DOL A;  2Y1J A;  2FXU A;  1T6C A;  5J2Q A;  2A42 A;  5KPZ A;  3E9O A;  4FWN A;  4OVL A;  4AHU A;  4CEQ A;  3TAF A;  2KHO A;  2NRV A;  2QWR A;  4DV5 K;  4BE1 A;  4FK0 A;  1S22 A;  1VAZ A;  4CJ7 A;  4JK9 A;  3CCU N;  4O8U A;  3OYH A;  4E7K A;  4K8X A;  5AZI B;  5F0X A;  1NK8 A;  4Z94 A;  3LDL A;  4E7J A;  1NK4 A;  1XQS C;  3DXK B;  1IKY A;  4JI3 K;  5M1O A;  1RT6 A;  2CH6 A;  1XHX A;  1YJW N;  2AP1 A;  4FJ7 A;  4O4G A;  1RBS A;  1VQ4 N;  4FPB A;  1YI2 N;  2PYJ A;  3THX A;  1X9S A;  5M1P A;  5KTQ A;  3CXC M;  1HMV A;  2DFE A;  1TGO A;  4OPH A;  1Q7Y O;  1NK9 A;  3NGI A;  4FOE A;  3TSU A;  3BEX A;  4PWD A;  2JWL A;  1GLA G;  3WT0 A;  4FWM A;  5CZ2 A;  1VQM N;  4IG0 A;  4FJ5 A;  5I42 A;  4LFC K;  1GLB G;  1SV5 A;  4B9M A;  3QFP A;  3SAG A;  3NVK A;  2NZT A;  3LZI A;  4KBO A;  4B9U A;  1GLE G;  5KQD A;  1QHA A;  1S9G A;  1NJX A;  3QES A;  3FLC O;  3AAP A;  3ZET B;  4RW7 A;  3BF1 A;  3BF3 A;  3THY B;  3VER A;  5HRP A;  1Q82 O;  4CK2 A;  3C6A A;  5ADX H;  2P5O A;  1LWE A;  3QET A;  3G71 N;  2IVO A;  3OYF A;  3HP6 A;  2P9U B;  3TPQ A;  4C8O A;  4OX9 K;  4AHC A;  4KHQ A;  1M1K O;  4PKG A;  1UOC A;  2RHK A;  4CZK A;  4HTL A;  4CE9 A;  4DCH A;  4DWI A;  4FVM A;  4CJE A;  4DTX A;  1IBM K;  4LF9 K;  2A3Z A;  5HRS A;  4Y0W A;  2OYQ A;  3CHW A;  2B4J A;  3CCJ N;  3VQQ A;  3VF2 A;  1LW2 A;  1RTI A;  1RT1 A;  3BGR A;  3C94 A;  2QXL A;  4AF1 A;  3THW A;  3WNG A;  2GEL A;  5DK5 A;  3TTC A;  2ZE2 A;  2D0C A;  3CME N;  1ILY A;  4YOY A;  4ILG B;  3VF6 A;  3I8B A;  4MLH A;  2GWK A;  3NF6 A;  4YOW A;  3P5J A;  3SAH A;  2NNW A;  1QSY A;  4B3S K;  2P51 A;  3SPZ A;  1NGG A;  3VGM A;  1ZXO A;  4CFC A;  2Q0R A;  3MN5 A;  2W6L A;  3C7N A;  1MWM A;  4KH5 A;  5JMV A;  4EP5 A;  1NGA A;  3JXU A;  5HLF A;  4O44 A;  3AGR A;  4DFP A;  1DT9 A;  3EE9 A;  1EKE A;  4CF9 A;  3O5B A;  4N41 A;  2W40 A;  2XRI A;  1VQ6 N;  2G8I A;  3EEQ A;  5AQF A;  4WE1 A;  3C95 A;  1TKX A;  3M8R A;  2E6M A;  4EAH D;  2WOM A;  3AVK A;  3OYE A;  4CF8 A;  4LFB K;  2GBZ A;  3E1Y A;  1NG9 A;  4ELU A;  3AVB A;  4NCA A;  3CPW M;  4IBN A;  5AQZ A;  4CEZ A;  5AQI A;  4FPA A;  4FM1 A;  3VQE A;  4JV5 K;  4QCL A;  3K59 A;  3CFO A;  5KGX A;  4R79 A;  2IC3 A;  4J2A A;  4HWI A;  4W5N A;  2UU9 K;  3E9L A;  2ZQB A;  2IVP A;  4HUG A;  4M3U A;  2DTU A;  3K0S A;  1E3M A;  2P9L A;  3SV3 A;  3O9Q A;  3SLC A;  4H5R A;  3HYF A;  1WBD A;  4AHR A;  1X9W A;  2ZJR L;  3SQ1 A;  4ISE A;  1VSK A;  2VWK A;  1WAF A;  3T1H K;  1NOY A;  3QBX A;  3RMC A;  1LV5 A;  5M1Q A;  4DV0 K;  4CEB A;  3KLH A;  1WSE A;  3IG1 A;  2OPR A;  4CEO A;  5KGW A;  4DTU A;  1KQS M;  1KTQ A;  4HCC A;  1KAX A;  4LFA K;  3VGK A;  3IUC A;  3AA4 A;  4ZTF A;  3CD6 N;  1N32 K;  4CGG A;  2BUP A;  3DXM B;  2HBM A;  1LAV A;  1ZC6 A;  4BE0 A;  3DMJ A;  3IDH A;  5CHI A;  4Y1C A;  3VQP A;  3O3F A;  3B6P A;  4NLB A;  3SI6 A;  3QEI A;  2P9K A;  2OA8 A;  1WLJ A;  3TAE A;  4H5V A;  5AQQ A;  3ZT2 A;  2Q36 A;  2BH1 A;  5C12 A;  3VEV A;  5AQO A;  4CIF A;  4CJR A;  4EIA A;  4M7Y A;  4DG1 A;  1Y97 A;  3MMV A;  3UIQ A;  2KFZ A;  3T3F A;  1RDW X;  3TU5 A;  4A59 A;  2LSN A;  4BDP A;  3O4Q A;  5C25 A;  1HKC A;  2PY5 A;  4O55 A;  4WFA L;  3HPG A;  1QHT A;  1NKC A;  2KKZ A;  3MXI A;  4YOX A;  4Q0B A;  3R1X A;  4E7L A;  2D4W A;  4GVM A;  3IKM A;  1T6D A;  4DR5 K;  3MED A;  4KI6 A;  4CES A;  2X78 A;  1QSL A;  1WSG A;  1QQN A;  1J5O A;  1QQM A;  4FWL A;  2ITM A;  2HHT A;  2O8F B;  2QEX N;  4H0P A;  4N5S A;  4FJJ A;  4X66 K;  4H4M A;  3HPH A;  5BRE A;  2P9P B;  2Z1J A;  1QSS A;  5D3G A;  4ELT A;  4BRO A;  2KTQ A;  3CCE N;  2Q2R A;  4BRM A;  3S3N A;  3K5N A;  3CJ9 A;  3CCL N;  4BQZ A;  3EN9 A;  2YJE A;  4O0J A;  3LAK A;  3TWH A;  2EWS A;  1X3M A;  1EQY A;  3E66 A;  3LPU A;  4LSL A;  3JSM A;  1JXE A;  4BR5 A;  4DSL A;  1YUW A;  1J6Z A;  1HNZ K;  1GLJ O;  3LWM A;  3VEW A;  4BWM A;  4B3M K;  3O08 A;  4M3X A;  3OYC A;  2OCE A;  3CCM N;  4M3W A;  4BRK A;  3JYT A;  4FLU A;  3THV A;  3TAR A;  1L3T A;  4B3T K;  3C6H A;  3F9K A;  4GV9 A;  1NGE A;  2A1R A;  1IO2 A;  2CGK A;  1JLF A;  3PIP L;  2HVH A;  4PL7 A;  3P38 A;  1JLQ A;  2IIR A;  1MWK A;  3CCS N;  4FWS A;  5FLX O;  3NGZ A;  4FCY A;  4E7H A;  4JLH A;  3MXM A;  2XHB A;  1TK8 A;  2X74 A;  3AVL A;  3L3U A;  3PSI A;  3OVN A;  4DV2 K;  3L2V A;  4Z4H A;  2GEM A;  3ISN C;  3CC2 N;  3M8Q A;  2V7Z A;  2KQ2 A;  1ATS A;  4FWO A;  3O8M A;  5CR4 A;  3MCA B;  3L2Q A;  1QZ6 A;  5EY4 A;  5AQV A;  1XWL A;  5K14 A;  3TAM A;  4GKK K;  4KHY A;  4HTU A;  1ZBH A;  1SL0 A;  1GLC G;  2F8T A;  1RTH A;  1ATN A;  5AFU A;  3OYG A;  4DU3 A;  4E1N A;  2HBJ A;  4PKH A;  4RG8 A;  5FDL A;  1S1X A;  2Q0U A;  1JCG A;  3ZSX A;  1IG9 A;  3G4S N;  5BPN A;  1CZB A;  5GIO A;  1T44 A;  3B6O A;  1RDA A;  3E01 A;  4H0V B;  3KLG A;  2P1J A;  4JI1 K;  4FW2 A;  2JWK A;  1C0T A;  2EX3 A;  4KTW A;  3WNH A;  2VYP A;  4CZH A;  2PBD A;  1NJZ A;  1TL3 A;  3U4L A;  4BGB A;  5HL7 L;  3T1Y K;  3PX6 A;  1RDU A;  1DTT A;  2E2Q A;  3KKS A;  3K58 A;  3QML A;  2V51 B;  3WEE A;  4E1M A;  1NM1 A;  1WN7 A;  3QEP A;  3WNE A;  2HBK A;  3FFI A;  3K9J A;  1D5A A;  1YIJ N;  2W6K A;  2P9I A;  5FRO A;  4B8C A;  4CGI A;  4B9T A;  4DTS A;  1SKS A;  3CET A;  3NDK A;  2GX9 A;  1CXQ A;  1YTU A;  3K2P A;  3HPO A;  3VQ4 A;  3DRS A;  1W9H A;  4FLZ A;  2ASM A;  4H0T B;  4EZ6 A;  1J5E K;  2NRT A;  3G0Z A;  4TSX A;  4YOV A;  1BCM A;  3DAW A;  3TAN A;  4NCB A;  4B1W B;  1KVC A;  2F8S A;  3KKR A;  4AHV A;  4KTQ A;  3NAE A;  3RSE B;  2VGM A;  1RT4 A;  3P1G A;  4NB4 A;  2HNZ A;  2KFN A;  1S9E A;  3NF9 A;  4OGC A;  4NYF A;  4CJU A;  3VQA A;  1WSF A;  4CF1 A;  3WNF A;  4Z4I A;  3H6E A;  5SWM A;  1SKR A;  1BA0 A;  5BRF A;  3DRR A;  4FLT A;  4C23 A;  4E7I A;  4CER A;  4IO8 A;  1SS6 A;  3IRX A;  4HUF A;  1RT3 A;  2UXD K;  3WXI A;  3CCV N;  4K25 A;  1QQC A;  4RCH A;  4AIL C;  2BTF A;  3NH0 A;  5FPN A;  1L3U A;  3M6G A;  5JLH A;  4JKC A;  5HP1 A;  2OZS A;  4Z4F A;  1D4X A;  3AGK A;  3WXM B;  1V4T A;  3ENB A;  3FR0 A;  4XH5 A;  3SYZ A;  1KFS A;  5CY4 A;  3M5R A;  4OO1 J;  1SKW A;  3LM2 A;  1FKO A;  4MDA A;  4LSN A;  4RW4 A;  3DM2 A;  3L6Q A;  2G8U A;  3HO1 A;  4WQ4 A;  2UUC K;  2HHV A;  4ISF A;  1ZBI A;  4KPY A;  1KXP A;  3LDQ A;  1KC8 O;  1ASU A;  2YNI A;  3I8D A;  4PY5 A;  3HXM A;  4U67 L;  2E1Z A;  3TSP A;  4DS5 A;  1QVF M;  3PO5 A;  2GUP A;  4WQ5 C;  1W2B M;  4DQQ A;  1WBB A;  4FJ8 A;  4FWK A;  4X64 K;  2D0P A;  2QTD A;  3CYM A;  4ELV A;  1UAX A;  2QWP A;  1MA9 B;  1D9F A;  3QIP A;  2P9N B;  4DS4 A;  2CH5 A;  2G8V A;  3SUN A;  1DGK N;  1BGX T;  1BU6 O;  1DKG D;  3N4Q A;  3R3L A;  3VF4 A;  1DLO A;  4R5P A;  3U8X A;  1K73 O;  4BRH A;  1YXQ A;  4CJP A;  4BG8 A;  4FM2 A;  2UYT A;  1O1W A;  3EL2 A;  5AQX A;  2ATQ A;  1NK0 A;  4WFB L;  3HVT A;  2YJF A;  4F3T A;  2AJQ A;  1S1T A;  1VHX A;  2F9T A;  2G8H A;  1Q18 A;  3VQB A;  4BRE A;  3K5L A;  1REV A;  3KZB A;  1P8Z A;  4YDU A;  2D0O A;  1N33 K;  2F96 A;  1BIS A;  4BRI A;  3QIN A;  2W41 A;  3K9K A;  1CZ9 A;  2ZGY A;  4E89 A;  4AHT A;  3FZF A;  2YHY A;  3OS2 A;  3OYI A;  3O9R A;  4KRE A;  1JCF A;  3PLA A;  4JD2 A;  3VQD A;  4DTO A;  1NBW A;  4JKD A;  4IEE A;  3LP0 A;  3GE1 A;  4DV3 K;  1NNE A;  3CFR A;  3VQ6 A;  4NLC A;  2GV9 A;  1RT7 A;  3C6T A;  4OKJ A;  1BO5 O;  1OH5 A;  4BDY A;  5ELZ A;  3TAB A;  3DLR A;  4M41 A;  1VQL N;  2RN2 A;  3L4I A;  1HKG A;  2UXC K;  4CJQ A;  2YKM A;  3WXJ A;  4FJN A;  1W0H A;  3ZSO A;  4KKO A;  4FLV A;  2E4L A;  4GKJ K;  2A5X A;  3KWG A;  3S9H A;  4CI6 A;  3K5O A;  5AZJ A;  4K43 A;  3OY9 A;  4JK7 A;  1W97 L;  3NVM A;  3KLI A;  1IBK K;  3J7Z O;  3VQ9 A;  3CMA N;  4FJI A;  1QTM A;  3I55 N;  4XEI A;  4BRL A;  4RW6 A;  3H46 O;  2P9S B;  1VSI A;  1KD1 O;  2HNY A;  1JXB A;  3Q7C A;  3FZM A;  2KZZ A;  1HKB A;  4HVJ A;  5AQH A;  2O8D A;  3D2E A;  3OS0 A;  1HJR A;  2XO7 A;  4KHU A;  3OYA A;  1KRP A;  4JRP A;  1TYQ A;  4W5O A;  3ZT0 A;  3KK2 A;  3KD5 E;  4H03 B;  1RFQ A;  2A1S A;  4ZTJ A;  3SBG A;  3J7A P;  3ZCM A;  1BHL A;  1JLB A;  4I6M B;  3O4N A;  1C0M A;  5LJV A;  4KHP K;  5SZT A;  1YTA A;  1NK5 A;  4NYN A;  3OJU A;  3J81 O;  1TAU A;  5C42 A;  3V9X A;  3SQ2 A;  2PFU A;  1JJ2 M;  2OPP A;  5AQJ A;  3ZX0 A;  1VRU A;  2IS3 A;  3JAM O;  3QBW A;  3T7Z A;  3U6F A;  2O8B A;  3MN9 A;  4KTZ A;  4BQL A;  4F2R A;  5EVZ A;  4J2E A;  3DLE A;  3A8Y A;  3AVF A;  2QM1 A;  3O1B A;  2O8C A;  5IWA K;  3QNO A;  4C8K A;  2A6A A;  3NH2 A;  4I2P A;  3ZT4 A;  3S3M A;  3P4I A;  1LWC A;  1NK7 A;  3HK2 A;  3C0B A;  1WB9 A;  4IFY A;  3WXL A;  3LWL A;  1DEJ A;  3VTI A;  4X65 K;  4I7F A;  2QWL A;  4GY2 B;  1RCH A;  3LDO A;  3SV4 A;  2QK9 A;  4B3R K;  3H1V X;  4UY8 O;  1QE1 A;  4FWP A;  2D0A A;  1GOA A;  4LC9 B;  1K8K B;  5C10 A;  4JKG B;  3LP2 A;  3OBY A;  4H5T A;  4IDK A;  4DQ8 A;  4CGH A;  3HBT A;  1O13 A;  3QIO A;  3NH1 A;  1OH8 A;  3CIP A;  4OLB A;  5DMR A;  1NGF A;  3B8A X;  4DSJ A;  1IKX A;  2Q97 A;  3QLH A;  1VSL A;  5EU7 A;  3U9Z A;  5GAE P;  3LAL A;  4BE2 A;  3HP9 A;  2UUA K;  1RDB A;  3DOK A;  2YHB A;  1WSH A;  5GAG P;  3RRG A;  4I9Q A;  1BI4 B;  3NHG A;  2HMP A;  3UKU B;  4DSI A;  3KLF A;  4IOX A;  4H0O A;  4DFM A;  3ULE A;  1JCE A;  4YNQ A;  4BG9 A;  3V9W A;  4DTR A;  1RT5 A;  3NCI A;  1OH7 A;  4FK2 A;  1CLQ A;  3SMS A;  4NCG A;  2NLX A;  1U2V A;  1VK0 A;  3PX4 A;  2QWQ A;  4NXM K;  4J2B A;  4JYA K;  2O8E B;  2Z1I A;  4KH4 A;  2H3G X;  1HQE A;  3V1O A;  2HHS A;  2ZJQ L;  3F73 A;  2A40 A;  1C1A A;  3O3H A;  4O8K A;  3VOV A;  3QNN A;  1RBU A;  4A61 A;  4JHD B;  2Z1G A;  4XIU A;  1JLC A;  5AQG A;  4DR3 K;  1XUP O;  3SJJ A;  1X9J A;  3ZEU B;  2F4V K;  2YHW A;  4PL8 A;  4Q5V A;  3SPY A;  3H3N O;  3ID6 A;  4CD1 A;  1XI1 A;  5M1N A;  3T69 A;  4IWV A;  3SZ2 A;  4W5Q A;  2OZM A;  1TAQ A;  3IMX A;  1VSH A;  1BIZ A;  5KQ8 A;  3D2F A;  3O9U A;  4QAG A;  1YHQ N;  4IKF A;  5AQW A;  3QER A;  4DKW A;  5BN8 A;  3J7Y P;  4K41 A;  4CZF A;  4DTN A;  3RR7 A;  3MWT A;  1RDC A;  1Z25 A;  4JS5 A;  2HF3 A;  3LDN A;  1EWR A;  1T7P A;  5BR8 K;  4DQI A;  4KHW A;  3UKR A;  3AVA A;  3HTV A;  4M3T A;  2Q31 A;  3ZSY A;  4DTP A;  1I39 A;  5T7B A;  2V52 B;  1GOB A;  3D45 A;  1BWF O;  1Z05 A;  4KV8 A;  1U45 A;  1X3N A;  1K8A O;  2PAV A;  1EP4 A;  4Z4C A;  5F1X A;  4B9N A;  1RBV A;  4CJT A;  4B8A B;  4YHH K;  1M90 O;  1VQK N;  4IEI A;  4CCH A;  3AO5 A;  4FJL A;  3BY5 A;  1WNS A;  2V7Y A;  3THX B;  3VES A;  1Y64 A;  4FM0 A;  1E4G T;  3BP8 A;  4M3R A;  1YVU A;  3QIC A;  2A41 A;  1YAG A;  4IDH A;  5AQN A;  4B9L A;  2F9W A;  4DTJ A;  4B1U B;  4FJK A;  1ESV A;  1RBR A;  3ZSZ A;  4EHU A;  4LF8 K;  3WUH A;  2GTD A;  1G99 A;  1LW0 A;  3HM9 A;  1GLL O;  3OYL A;  4F2S A;  1BG3 A;  4YFU A;  4U7B A;  1VQ5 N;  4BAC A;  3TI0 A;  3D7E O;  3LZJ A;  5HRN A;  3AVI A;  3CQX A;  3WQU A;  1A5V A;  4BR9 A;  1U04 A;  3VPZ A;  4ILJ A;  4I9L A;  4DUZ K;  3SUP A;  5IT9 O;  2E2O A;  3VMF B;  3SUQ A;  1T3V A;  1KLN A;  1MU2 A;  4CHZ A;  4LF7 K;  4BC2 A;  1I94 K;  3DJC A;  4CJ4 A;  3ALY A;  4JI4 K;  5E84 A;  5AZI A;  1FK9 A;  2HHU A;  5AQL A;  3DXK A;  3I0R A;  1C0G A;  1RTD A;  3D6R A;  2YHX A;  3S3O A;  4FJM A;  1YVN A;  3AVM A;  1HR0 K;  1ZBS A;  1LAW A;  3U9D A;  5J2P A;  4DFJ A;  3P39 A;  4EZ9 A;  1EO1 A;  2JGU A;  5E26 A;  2ETJ A;  4N47 A;  3ZSR A;  1NLV A;  3EZW A;  2IVN A;  3CFP A;  3BDP A;  1JKH A;  3U3Y A;  4G9Z A;  1HUX A;  2ZJP L;  3THW B;  2GUI A;  3ZT3 A;  1FJG K;  4OKK A;  1X9M A;  3UB5 A;  3LAN A;  3VEX A;  3OYM A;  3OYB A;  3PV8 A;  2EHG A;  3F5T A;  3VEN A;  1NMN A;  4CGD A;  3D0P A;  3QDK A;  4W5R A;  5DM6 L;  2VCP A;  4RTF D;  4WCE L;  4WYB A;  4CGF A;  5GAD P;  1HYV A;  2FSN A;  1YJN N;  2JLE A;  4QOZ B;  3ZT1 A;  4C8L A;  4J8F A;  1TUU A;  3QEX A;  2FBV A;  3RMA A;  3W0L A;  3GG4 A;  1NGI A;  3NE6 A;  3HSC A;  3C7N B;  1K6Y A;  3F9M A;  1HPM A;  5J2M A;  5AQM A;  2RF2 A;  3THY A;  3L8B A;  1MDU B;  2P5G A;  2G8K A;  1YT3 A;  3NMU A;  4JI0 K;  3MEC A;  3NGY A;  4DQP A;  4NXN K;  2VG5 A;  3NF7 A;  1ZBF A;  1XMO K;  1U4B A;  3SMP A;  2P9U A;  3HZ6 A;  3MX5 A;  4DV4 K;  3A5L C;  4MO5 A;  1DTQ A;  2IDO A;  3Q7B A;  2KW4 A;  4DR2 K;  1KLM A;  1FKP A;  1HNV A;  4CJ5 A;  1NJW A;  1TK5 A;  4A62 A;  3CCQ N;  4HHT A;  4DLE A;  1VQ7 N;  3EKS A;  4KB1 A;  1JLE A;  1V4S A;  4B1X B;  1H1V A;  3M1F A;  2CGL A;  1HRH A;  1ATR A;  3CCR N;  4HCB A;  5LMU K;  1BDG A;  4E3S A;  2AA4 A;  3KVG A;  4BRN A;  5KRT A;  1IG8 A;  3NBP A;  4RW8 A;  4PQU A;  3LL3 A;  4KAZ A;  2BGG A;  4AH9 A;  1NGD A;  3SJH A;  3GBT A;  4CF2 A;  3V6D A;  4DB3 A;  1U6Z A;  4GNI A;  1T8E A;  3CJ7 A;  1HLU A;  4AHS A;  2NUB A;  2P9L B;  2FSK A;  1JL1 A;  4M3Y A;  3AA2 A;  5E41 A;  4FLX A;  1Q9X A;  5MLC Q;  2KLA A;  4CEC A;  4FWR A;  1L3S A;  4QS9 A;  1WSI A;  4Y1D A;  3M8S A;  3OS1 A;  4H5W A;  5EX5 A;  3CJ1 A;  4DFK A;  3AO4 A;  5AR0 A;  3AVN A;  4GMJ B;  1NKB A;  4L8R B;  3CI5 A;  3EYZ A;  1XNQ K;  3CF5 L;  1HPZ A;  4CJL A;  3TTF A;  4BGA A;  3EKU A;  2QWM A;  2VQF K;  4CHP A;  3V9Z A;  3MDQ A;  1NJY A;  2NRZ A;  2G8F A;  4JEP A;  3CM5 A;  1VSE A;  1UA0 A;  4DMN A;  3DLK A;  5I9E B;  4ID1 A;  3ZSQ A;  3A5O C;  1RIL A;  2I7N A;  3CQ8 A;  3RRH A;  2NRX A;  2P9K B;  1TKT A;  4FW1 A;  1Q8I A;  4DTM A;  5LMN K;  4CBX A;  4AQY K;  3AO2 A;  4FWQ A;  1OH6 A;  1S1U A;  4MFB A;  2E8A A;  2D1K A;  4PHT X;  2HHX A;  4DV6 K;  1B92 A;  1SUQ A;  2GWJ A;  2Q3S A;  3K57 A;  3IS9 A;  3DYA A;  2PYL A;  3L0Q A;  2E6L A;  3AVC A;  3VTH A;  3OYK A;  4O0I A;  4PA1 A;  3VA3 A;  4B1Z A;  4LH4 A;  3O9T A;  1L3V A;  2FSJ A;  2WC9 A;  4M42 A;  5FRN A;  4FO0 A;  3HOS A;  1VQO N;  3QEW A;  1GOC A;  3KJV A;  4JI8 K;  4WF9 L;  3OA9 A;  4DSK A;  3O9S A;  5I3U A;  3W3D A;  2E1Y A;  1C6V A;  4FXD A;  1XC9 A;  1IKV A;  3BUZ B;  4H0Y B;  1Q9Y A;  3KK3 A;  2I5J A;  4N56 A;  1EXQ A;  3K5M A;  4FLY A;  3VEO A;  5J2N A;  2OPS A;  1KAY A;  4KO0 A;  5EOY A;  3G6E N;  5LL6 Z;  2DFH A;  3MAQ A;  2YV0 X;  1ASW A;  1KSP A;  3OJS A;  3DXM A;  4E1J A;  2YNH A;  4IZ9 A;  2DPN A;  3KHY A;  3ITH A;  1OKJ A;  1BQM A;  4CJV A;  5EXW A;  3SK3 A;  4RW9 A;  3A5M C;  3ENO A;  3CER A;  4B9Q A;  3LDS A;  1X1P A;  2BAN A;  4QS8 A;  4FLW A;  1C1C A;  3RR8 A;  1SQK A;  4IJA A;  1N34 K;  1VQ8 N;  4DQR A;  2QXF A;  2NRR A;  3PSF A;  4OPA A;  3KK1 A;  2WTU A;  1BL3 A;  3DLB A;  4DR7 K;  3LDP A;  3IAY A;  1Q86 O;  3L3V A;  1NJI O;  1LCU A;  5C24 A;  1C0F A;  3AO3 A;  3CJC A;  3DLL L;  3SCX A;  5CYM A;  2VGN A;  4CEA A;  2PZS A;  3VET A;  4FOI A;  5JS2 A;  3VA0 A;  4OLA A;  4UQG A;  4F8R A;  3DLG A;  1SL1 A;  3V9U A;  3R9P A;  2O8F A;  5FRM A;  3PIO L;  4FJH A;  4CK3 A;  4JK8 A;  4MQ3 A;  1P90 A;  3G10 A;  4JKF A;  3CJB A;  3GDQ A;  3RVC A;  5JVH L;  5LY3 A;  1GLD G;  3ZSW A;  2P9P A;  1NGB A;  1TV6 A;  3OHR A;  4B1V A;  1BOT O;  4GW6 A;  3N4P A;  4KFB A;  3EY1 A;  1ZBU A;  5KI6 A;  4KHS A;  5A2Q O;  2W42 A;  1OVQ A;  2RKI A;  3ASM A;  3R6M A;  3CC4 N;  4JI7 K;  4KI4 A;  1W7A A;  3J8A A;  3LP3 A;  3ID8 A;  3OW2 M;  4C8N A;  3KTQ A;  3ULD A;  4DSF A;  3O3G A;  3ENH A;  3KD1 E;  5LJW A;  3A0I X;  3AVH A;  1I3A A;  5C2D A;  5B8H A;  4FVU A;  1XMQ K;  5AQT A;  3VN5 A;  2HVI A;  3VQ5 A;  1C1B A;  1C0U A;  4ZHR A;  4DF4 A;  4DU4 A;  4BC4 A;  1NGJ A;  1EET A;  4CFD A;  3VQ8 A;  1XC3 A;  3DLH A;  4JRQ A;  3OTO K;  3WEE B;  2Z1H A;  2FBX A;  4F4K A;  1RBT A;  4WQ4 C;  2OPQ A;  4CHN A;  1S72 N;  1XHZ A;  1JL2 A;  4BDZ A;  4EHT A;  1VQP N;  1TVR A;  2P9I B;  2OAN A;  4AM6 A;  1S1V A;  4DF8 A;  5BR9 A;  3MEG A;  3CM6 A;  4A2A A;  5TKW A;  4CED A;  5AQY A;  2VG7 A;  1ITG A;  3DRP A;  3VQC A;  4V19 S;  4JI5 K;  4H8K A;  3QFU A;  3RMB A;  5BPM A;  3F2K A;  2DFF A;  3HST B;  4J2D A;  4CD3 A;  3IFR A;  1SZ2 A;  3WXK A;  2XY5 A;  1S6Q A;  5AQK A;  4CZE A;  3P31 A;  3G25 A;  4A57 A;  3MXJ A;  1TKZ A;  3PUF A;  3QO9 A;  1QZ5 A;  4BR0 A;  4IOC L;  3AVJ A;  1BUP A;  2YNF A;  3DWL A;  3RTV A;  3JS6 A;  2X6N A;  4BRQ A;  1RT2 A;  3TR8 A;  4MDB A;  4C8M A;  5H1S Q;  4YDU C;  3VGL A;  5FPM A;  3LP1 A;  4OGE A;  1K9M O;  4CFB A;  4YY3 K;  2UUB K;  1JLG A;  1HQU A;  1VQ9 N;  1WSJ A;  3L2W A;  5AQS A;  2ZWH A;  4LF4 K;  3NF8 A;  4BRG A;  2ITG A;  2VWB A;  1KAZ A;  5HOO A;  3LPT A;  1J9A A;  3OBW A;  1HX1 A;  1YJ9 N;  1BQN A;  4IFV A;  1NWK A;  4B08 A;  3AV9 A;  5HRR A;  3CC7 N;  2HB5 A;  2J4R A;  1LWF A;  2E2P A;  1VSJ A;  1IBL K;  5F2R A;  3BZC A;  5AFU H;  4A2B A;  4H0X B;  4IJN A;  2IGI A;  4ID5 A;  1UWB A;  2Y1I A;  1WUA A;  4K42 A;  3MN7 A;  2QI2 A;  4CHQ A;  3PX0 A;  3NFA A;  3FGU A;  4EFH A;  3FZL A;  1J54 A;  2WBN A;  2QKB A;  2ASP A;  5GIN A;  2E5L K;  4W5T A;  3RSE A;  2VQE K;  5C2F A;  5C15 A;  3V9S A;  4CZM A;  3ZYY X;  1IJJ A;  2RE2 A;  2YKN A;  1QQO A;  1B9F A;  3L4Q A;  4ICL A;  5AJ3 K;  1VQN N;  4CIE A;  2CGJ A;  2I7P A;  4FZX C;  3H1Q A;  3OYN A;  3HL8 A;  4LH5 A;  2O4I A;  2VG6 A;  5CZ1 A;  3OYD A;  2YCH A;  1D8Y A;  3HJF A;  3UE5 A;  4DV7 K;  5AQR A;  1TL1 A;  4RWT A;  4MLE A;  4DUY K;  4BRF A;  4BRD A;  1BCO A;  4I2Q A;  2IAJ A;  3AA5 X;  1WOQ A;  3SAF A;  3LM9 A;  4Z0U A;  1D9D A;  1ASV A;  5JIC A;  1EWQ A;  2KZM A;  3AY9 A;  1N36 K;  4DHY A;  1T03 A;  4IOA L;  1S1W A;  3SUO A;  3DI6 A;  4B9S A;  4BC5 A;  3V1R A;  3V4I A;  4OJR A;  3MEE A;  3AA3 A;  4BVP A;  2E88 A;  4PKI A;  2BDP A;  2HHW A;  4OKE A;  4JD2 B;  4FJ9 A;  3AAQ A;  1U48 A;  1HYZ A;  4BR7 A;  4CJ3 A;  2E2N A;  5JS1 A;  3KLE A;  3O80 A;  4B9V A;  1JLA A;  5ADX A;  4BR4 A;  4XH1 A;  2HHH K;  1R59 O;  1VRT A;  2P9N A;  2HBL A;  3O4W A;  1N5Y A;  3SBT A;  1HYS A;  1N8R O;  1S3X A;  4CVN E;  2G8W A;  5AZJ B;  3HT3 A;  4EP4 A;  2D5R A;  2F7T A;  2B6A A;  3GOI A;  3P83 D;  1E4F T;  4CZI A;  4BRA A;  3AO1 A;  1B9D A;  3H3O B;  4FK4 A;  1A5X A;  5HRO A;  3WQT A;  1F21 A;  3PO4 A;  4DV1 K;  4AM7 A;  2ZD1 A;  3MK6 A;  1NMD A;  4HUE A;  4CK1 A;  4E0D A;  1HNI A;  1U47 A;  3C6U A;  1UA1 A;  4CF0 A;  4KH6 A;  2HND A;  4CZL A;  2HHQ A;  2O8D B;  3D2E B;  4JI6 K;  4CHO A;  5CYQ A;  5CE3 A;  1A5W A;  1KFD A;  2RPI A;  1NK6 A;  3M3Z A;  1TYQ B;  3FE1 A;  4B1Y B;  4F9O A;  2XY6 A;  3C65 A;  2B5J A;  3ATV A;  4O5B A;  3SNN A;  3R8E A;  1WAJ A;  3V1Q A;  5J1E A;  3ZX3 A;  5GAH P;  3OYJ A;  1CZA N;  3CG7 A;  2QKK A;  5TKY A;  4M3Z A;  1Q81 O;  5BN9 A;  1S5J A;  3QEV A;  4JI2 K;  2HST A;  1BIU A;  4H5N A;  1OVY A;  3L2U A;  2O8B B;  1RTJ A;  3AAR A;  2FF6 A;  1R0A A;  5AQP A;  5BRH A;  4GV6 A;  1NU0 A;  2O8C B;  4JKE A;  4DR1 K;  4FZZ A;  1BA1 A;  4BC3 A;  3MWP A;  2BE2 A;  3E9P A;  1KVB A;  1TK0 A;  4FJX A;  2DY4 A;  3AVG A;  3FFK B;  3TAP A;  3HM8 A;  4WQ5 A;  1RGI A;  3LAM A;  1RDD A;  1Z6R A;  4M7X A;  4NO7 A;  4K0K K;  4KRF A;  4CZG A;  3EZ5 A;  3A2F A;  4JAX A;  2P9S A;  1TUY A;  3MCP A;  2YNG A;  3M8P A;  4FZY A;  2FC0 A; 
#chains in the Genus database with same CATH homology
 3AA4 A;  2IS3 A;  3DYA A;  2PYL A;  4H4O A;  3SQ4 A;  4ZTF A;  4PQU A;  3U6F A;  1ZBL A;  4KTZ A;  4F2R A;  2E6L A;  3AVC A;  4CGG A;  3KIO A;  3OYK A;  4J2E A;  4O0I A;  3DLE A;  1LAV A;  4PA1 A;  4BE0 A;  3AVF A;  3VA3 A;  4LH4 A;  4C8K A;  3QNO A;  3NH2 A;  3DMJ A;  4I2P A;  3ZT4 A;  3S3M A;  1L3V A;  4Y1C A;  3VQP A;  2FBT A;  3O3F A;  1LWC A;  3B6P A;  3SI6 A;  1NK7 A;  4M42 A;  3HK2 A;  3QEI A;  4DQS A;  3TAQ A;  1EX4 A;  2OA8 A;  3PY8 A;  5FRN A;  1WLJ A;  4IFY A;  3TAE A;  3ZT2 A;  3LWL A;  2XY7 A;  3QEW A;  1GOC A;  4CJF A;  1J53 A;  3KJV A;  4CIF A;  4I7F A;  4CJR A;  2O4G A;  4CEE A;  1Y97 A;  4DG1 A;  1RCH A;  3SV4 A;  5I3U A;  3T3F A;  1KVA A;  1TKD A;  3UIQ A;  3KTQ A;  2QK9 A;  4FYD A;  1T05 A;  2LSN A;  4BDP A;  1C6V A;  4FXD A;  3O4Q A;  1QE1 A;  5C25 A;  1IKV A;  1XC9 A;  1Q9Y A;  4F3O A;  3KK3 A;  2PY5 A;  2I5J A;  4O55 A;  1EXQ A;  4N56 A;  1VSM A;  1VSD A;  1QHT A;  2D0A A;  1GOA A;  3HPG A;  3K5M A;  4FLY A;  5J2N A;  2OPS A;  2FBY A;  4KO0 A;  3TAG A;  1NKC A;  2DFH A;  3MAQ A;  2YV0 X;  1ASW A;  3LP2 A;  4G1Q A;  3OJS A;  1KSP A;  3MXI A;  4IDK A;  4Q0B A;  4CFA A;  2YNH A;  4CGH A;  1SL2 A;  4N76 A;  4E7L A;  3QIO A;  4GVM A;  3NH1 A;  3MED A;  3ITH A;  4KI6 A;  1BQM A;  5DMR A;  4CES A;  4CJS A;  4CJV A;  4RW9 A;  4OLB A;  2X78 A;  1NKE A;  1QSL A;  1WSG A;  1FXX A;  1QS4 A;  2XY8 A;  1J5O A;  2HMI A;  3LDS A;  4DSJ A;  1IKX A;  3QLH A;  1X1P A;  2BAN A;  4FLW A;  1C1C A;  3RR8 A;  2HHT A;  1VSL A;  5EU7 A;  4N5S A;  4FJJ A;  3RMD A;  3LAL A;  4H4M A;  4BE2 A;  3HP9 A;  5HBM A;  3HPH A;  1RDB A;  3DOK A;  2X6S A;  2YHB A;  1WSH A;  4DQR A;  2QXF A;  2Z1J A;  3KK1 A;  1QSS A;  5D3G A;  4ELT A;  1BL3 A;  3DLB A;  3RRG A;  2KTQ A;  4I9Q A;  1BI4 B;  3NHG A;  3IAY A;  3V81 A;  4DSK A;  3S3N A;  3L3V A;  3K5N A;  4DSI A;  4CIG A;  5C24 A;  3KLF A;  3AO3 A;  3SCX A;  4K8Z A;  5CYM A;  4O0J A;  3LAK A;  4Z4E A;  4DFM A;  4CEA A;  3TWH A;  4IG3 A;  4YNQ A;  2R7Y A;  3V9W A;  3L2R A;  3LPU A;  4LSL A;  4DTR A;  3JSM A;  4CGJ A;  1JXE A;  2PZS A;  4KHN A;  4DSL A;  1RT5 A;  3LWM A;  5JS2 A;  3I0S A;  4BWM A;  1ZYQ A;  3VA0 A;  3NCI A;  4M3X A;  4OLA A;  3OYC A;  4UQG A;  4F8R A;  1VSF A;  3DLG A;  1SL1 A;  4M3W A;  4FK2 A;  1CLQ A;  3V9U A;  5FRM A;  4FJH A;  3JYT A;  4FLU A;  4CK3 A;  4NCG A;  3T19 A;  3THV A;  3TAR A;  4MQ3 A;  1VK0 A;  3G10 A;  1L3T A;  3F9K A;  4LD0 A;  3PX4 A;  2A1R A;  1N6Q A;  1CXU A;  3ZSW A;  1IO2 A;  4DLG A;  1TV6 A;  1JLF A;  4J2B A;  2HVH A;  1JLQ A;  2Z1I A;  1BI4 A;  4GW6 A;  4KFB A;  3EY1 A;  1ZBU A;  1HQE A;  3V1O A;  3RWU A;  4FCY A;  3NGZ A;  5KI6 A;  2HHS A;  4KHS A;  4Z4G A;  4FJG A;  3T1A A;  2W42 A;  2RKI A;  3F73 A;  1IH7 A;  3ASM A;  4CEF A;  4E7H A;  4KI4 A;  4JLH A;  1C1A A;  3O3H A;  3LP3 A;  3MXM A;  4C8N A;  2XHB A;  1TK8 A;  2X74 A;  3AVL A;  3L3U A;  3HVR A;  3OVN A;  3ULD A;  4DSF A;  3QNN A;  1RBU A;  3O3G A;  3L2V A;  4Z4H A;  2Z1G A;  4XIU A;  1JLC A;  1IKW A;  1G15 A;  5KRS A;  3ISN C;  4OPK A;  3M8Q A;  3SJJ A;  3KD1 E;  2KQ2 A;  2YHA A;  3AVH A;  1I3A A;  1U49 A;  4Q5V A;  3SPY A;  3L2Q A;  3VN5 A;  1NOZ A;  2HVI A;  3VQ5 A;  1C1B A;  1C0U A;  1XI1 A;  1XWL A;  5K14 A;  3ZSV A;  4ZHR A;  3TAM A;  4E19 A;  4DU4 A;  4DF4 A;  1EET A;  4CFD A;  3H08 A;  3VQ8 A;  3SZ2 A;  4KHY A;  4W5Q A;  4HTU A;  1TAQ A;  3DLH A;  1SL0 A;  2OZM A;  1ZBH A;  1VSH A;  1BIZ A;  4BWJ A;  4JRQ A;  2F8T A;  1Z26 A;  1RTH A;  2Z1H A;  2FBX A;  3OYG A;  4DU3 A;  4F4K A;  1RBT A;  2OPQ A;  4E1N A;  4CHN A;  4QAG A;  4IKF A;  2D0B A;  4RG8 A;  3QER A;  5FDL A;  1S1X A;  3ZSX A;  1IG9 A;  1CZB A;  1XHZ A;  1JL2 A;  4BDZ A;  4DU1 A;  3B6O A;  1TVR A;  2VWJ A;  1RDA A;  4OPJ A;  1S1V A;  3VQ7 A;  3E01 A;  4CHY A;  4DTN A;  4DF8 A;  3KLG A;  3MEG A;  2KFZ A;  3CM6 A;  3RR7 A;  4B3O A;  2P1J A;  4FW2 A;  4CED A;  1C0T A;  2VG7 A;  4DSE A;  1RDC A;  2EX3 A;  4KTW A;  1ITG A;  1S6P A;  1Z25 A;  3DRP A;  3VQC A;  3WNH A;  4JS5 A;  1NJZ A;  1TL3 A;  3PX6 A;  1KCF A;  1L5U A;  1T7P A;  4H8K A;  4DQI A;  1DTT A;  4KHW A;  3RMB A;  3KKS A;  3AVA A;  2WON A;  1RNH A;  4M3T A;  2DFF A;  3HST B;  3K58 A;  4J2D A;  3ZSY A;  4DTP A;  4KB0 A;  1I39 A;  5T7B A;  2IOC A;  4PUO A;  1GOB A;  3D45 A;  2XY5 A;  4KV8 A;  4E1M A;  1U45 A;  1S6Q A;  4JS4 A;  4M45 A;  1WN7 A;  3QEP A;  3WNE A;  4CJK A;  3FFI A;  1EP4 A;  4Z4C A;  3MXJ A;  4CJW A;  4LY7 A;  4B9N A;  1D5A A;  2HW3 A;  1RBV A;  1TKZ A;  3U3G A;  4B8A B;  4CJT A;  3DOL A;  2Y1J A;  3SQ0 A;  4CCH A;  5FRO A;  3AO5 A;  4B8C A;  4CGI A;  4B9T A;  4FJL A;  3PUF A;  3QO9 A;  1WNS A;  4DTS A;  5J2Q A;  1SKS A;  3NDK A;  1CXQ A;  1YTU A;  3AVJ A;  3K2P A;  4OVL A;  4AHU A;  3HPO A;  2YNF A;  4CEQ A;  3TAF A;  4FM0 A;  3VQ4 A;  4M3R A;  3RTV A;  3DRS A;  1W9H A;  2X6N A;  1YVU A;  1RT2 A;  4FLZ A;  4BE1 A;  4FK0 A;  3TR8 A;  4EZ6 A;  4C8M A;  4B9L A;  4DTJ A;  3LP1 A;  4OGE A;  3G0Z A;  4FJK A;  4CFB A;  4TSX A;  3OYH A;  3ZSZ A;  1RBR A;  1JLG A;  1HQU A;  4E7K A;  1BCM A;  1WSJ A;  4K8X A;  3L2W A;  3TAN A;  4NCB A;  3NF8 A;  2ITG A;  1NK8 A;  4E7J A;  1KVC A;  2F8S A;  3KKR A;  4AHV A;  4KTQ A;  1NK4 A;  1LW0 A;  3LPT A;  3NAE A;  1IKY A;  1J9A A;  1RT6 A;  3HM9 A;  3OYL A;  1RT4 A;  3P1G A;  4F2S A;  4YFU A;  1XHX A;  2HNZ A;  1BQN A;  4IFV A;  4BAC A;  2KFN A;  4FJ7 A;  3TI0 A;  1S9E A;  3NF9 A;  4O4G A;  3LZJ A;  4OGC A;  4NYF A;  1RBS A;  5HRN A;  4CJU A;  3VQA A;  1WSF A;  3AV9 A;  3AVI A;  5HRR A;  4B08 A;  4CF1 A;  2PYJ A;  1X9S A;  2HB5 A;  1A5V A;  3WNF A;  4Z4I A;  1LWF A;  1U04 A;  5SWM A;  1VSJ A;  5KTQ A;  1SKR A;  1HMV A;  4I9L A;  2DFE A;  4FLT A;  3DRR A;  3SUP A;  1TGO A;  2IGI A;  4E7I A;  4ID5 A;  4CER A;  1UWB A;  2Y1I A;  3NGI A;  3SUQ A;  1NK9 A;  3IRX A;  1KLN A;  1MU2 A;  4CHQ A;  4HUF A;  3PX0 A;  3NFA A;  4PWD A;  4CHZ A;  1RT3 A;  4CJ4 A;  3ALY A;  5CZ2 A;  1J54 A;  1QQC A;  1FK9 A;  4AIL C;  4IG0 A;  3NH0 A;  4FJ5 A;  5I42 A;  2QKB A;  2HHU A;  4W5T A;  3I0R A;  1SV5 A;  1L3U A;  1RTD A;  4B9M A;  3S3O A;  4FJM A;  3K57 A;  3AVM A;  3V9S A;  5HP1 A;  1LAW A;  2YKN A;  5J2P A;  2OZS A;  4Z4F A;  4DFJ A;  1B9F A;  4EZ9 A;  3LZI A;  2JGU A;  3SYZ A;  4ICL A;  2ETJ A;  1KFS A;  4B9U A;  5CY4 A;  4N47 A;  3ZSR A;  1FKO A;  1SKW A;  3CFP A;  4LSN A;  4CIE A;  3BDP A;  4RW4 A;  1JKH A;  3DM2 A;  2G8U A;  3U3Y A;  1S9G A;  1NJX A;  3QES A;  4FZX C;  4RW7 A;  3OYN A;  3HO1 A;  3HL8 A;  4LH5 A;  2O4I A;  2VG6 A;  5CZ1 A;  3OYD A;  1D8Y A;  3HJF A;  2HHV A;  5HRP A;  2GUI A;  1TL1 A;  4CK2 A;  1ZBI A;  3ZT3 A;  1BCO A;  4I2Q A;  2IAJ A;  3AA5 X;  4OKK A;  1X9M A;  4KPY A;  1ASU A;  2YNI A;  3I8D A;  2P5O A;  3LAN A;  4PY5 A;  1LWE A;  3OYM A;  4Z0U A;  3OYB A;  1ASV A;  3HXM A;  3QET A;  4DS5 A;  3PV8 A;  2EHG A;  1D9D A;  3PO5 A;  3D0P A;  4CGD A;  3OYF A;  3HP6 A;  4DQQ A;  4C8O A;  4FJ8 A;  4W5R A;  4AHC A;  4KHQ A;  2KZM A;  4ELV A;  3CYM A;  1UOC A;  1UAX A;  4CGF A;  1D9F A;  4CE9 A;  3QIP A;  4DWI A;  1HYV A;  4FVM A;  4CJE A;  4DTX A;  4DS4 A;  1T03 A;  5HRS A;  2G8V A;  3SUN A;  1S1W A;  2OYQ A;  2JLE A;  2B4J A;  3SUO A;  4QOZ B;  3DI6 A;  3ZT1 A;  4B9S A;  1BGX T;  4C8L A;  3QEX A;  2FBV A;  3V1R A;  3RMA A;  3V4I A;  3VQQ A;  1LW2 A;  1RTI A;  1RT1 A;  3MEE A;  3BGR A;  4OJR A;  3AA3 A;  1DLO A;  3NE6 A;  4R5P A;  3C94 A;  1K6Y A;  3IS9 A;  5J2M A;  2RF2 A;  4CJP A;  2BDP A;  3WNG A;  2HHW A;  4FM2 A;  3L8B A;  5DK5 A;  4OKE A;  2P5G A;  2ZE2 A;  2G8K A;  1O1W A;  1YT3 A;  1NK0 A;  2ATQ A;  4FJ9 A;  1U48 A;  2D0C A;  1HYZ A;  3MEC A;  4CJ3 A;  3HVT A;  5JS1 A;  3NGY A;  3KLE A;  4DQP A;  4F3T A;  2VG5 A;  4B9V A;  3NF7 A;  1ZBF A;  2AJQ A;  1S1T A;  1U4B A;  1JLA A;  2G8H A;  3NF6 A;  3P5J A;  3VQB A;  1QSY A;  1DTQ A;  2IDO A;  2P51 A;  1REV A;  3K5L A;  3SPZ A;  1VRT A;  2KW4 A;  4CFC A;  1KLM A;  1FKP A;  1HNV A;  4CJ5 A;  1NJW A;  2F96 A;  1TK5 A;  1N5Y A;  1BIS A;  3QIN A;  4HHT A;  4DLE A;  1HYS A;  1CZ9 A;  4KB1 A;  4E89 A;  2G8W A;  1JLE A;  4AHT A;  3HT3 A;  3OS2 A;  4EP4 A;  3OYI A;  2D5R A;  4EP5 A;  2B6A A;  5HLF A;  3P83 D;  1HRH A;  4KRE A;  4O44 A;  3VQD A;  4DTO A;  4HCB A;  3AO1 A;  1B9D A;  3LP0 A;  4E3S A;  4DFP A;  4FK4 A;  1A5X A;  5HRO A;  5KRT A;  1F21 A;  1EKE A;  4CF9 A;  3PO4 A;  3CFR A;  4N41 A;  3NBP A;  2ZD1 A;  2XRI A;  3VQ6 A;  4HUE A;  4CK1 A;  4E0D A;  1HNI A;  2GV9 A;  1RT7 A;  4RW8 A;  2G8I A;  3C6T A;  1U47 A;  4OKJ A;  3C6U A;  1UA1 A;  4KAZ A;  4CF0 A;  2BGG A;  4BDY A;  3TAB A;  4AH9 A;  2HND A;  3DLR A;  4WE1 A;  3C95 A;  4M41 A;  2HHQ A;  2RN2 A;  4CF2 A;  1TKX A;  4CHO A;  4CJQ A;  2YKM A;  3V6D A;  5CYQ A;  1T8E A;  4FJN A;  1A5W A;  1KFD A;  1W0H A;  2RPI A;  3ZSO A;  3M8R A;  1NK6 A;  4KKO A;  4AHS A;  4FLV A;  2E4L A;  2NUB A;  1JL1 A;  2E6M A;  3AA2 A;  5E41 A;  2WOM A;  4FLX A;  4M3Y A;  1Q9X A;  3AVK A;  3OYE A;  4CF8 A;  4CEC A;  2XY6 A;  3S9H A;  2B5J A;  3K5O A;  1L3S A;  4O5B A;  3OY9 A;  3SNN A;  1WSI A;  1WAJ A;  2GBZ A;  4Y1D A;  3V1Q A;  3M8S A;  5J1E A;  3OS1 A;  3OYJ A;  3AVB A;  4ELU A;  3KLI A;  4DFK A;  3CG7 A;  3VQ9 A;  3AO4 A;  2QKK A;  4FJI A;  4NCA A;  1QTM A;  3AVN A;  4GMJ B;  4IBN A;  1NKB A;  4L8R B;  4RW6 A;  3EYZ A;  4CEZ A;  4M3Z A;  1S5J A;  4FM1 A;  1HPZ A;  3VQE A;  4CJL A;  3QEV A;  1VSI A;  4QCL A;  3K59 A;  2HNY A;  1BIU A;  3CFO A;  1JXB A;  5KGX A;  3L2U A;  2KZZ A;  4CHP A;  1RTJ A;  2IC3 A;  4HVJ A;  3V9Z A;  4J2A A;  4W5N A;  3OS0 A;  1R0A A;  1NJY A;  2ZQB A;  1HJR A;  2G8F A;  4HUG A;  4M3U A;  3CM5 A;  2XO7 A;  4KHU A;  3OYA A;  1KRP A;  1VSE A;  2DTU A;  1UA0 A;  4DMN A;  4JRP A;  3DLK A;  3SV3 A;  4FZZ A;  4W5O A;  3ZT0 A;  3KK2 A;  4ID1 A;  3ZSQ A;  3HYF A;  1RIL A;  3CQ8 A;  2BE2 A;  3RRH A;  1KVB A;  1TK0 A;  4AHR A;  1X9W A;  3KD5 E;  4FJX A;  3SQ1 A;  2A1S A;  4ZTJ A;  1TKT A;  4FW1 A;  3ZCM A;  1Q8I A;  4DTM A;  2DY4 A;  1VSK A;  1BHL A;  1JLB A;  2VWK A;  1WAF A;  3O4N A;  3AVG A;  1NOY A;  3RMC A;  1LV5 A;  3TAP A;  1C0M A;  3LAM A;  3AO2 A;  1RDD A;  5SZT A;  4CEB A;  1YTA A;  1NK5 A;  3KLH A;  1S1U A;  4NYN A;  3OJU A;  1WSE A;  4KRF A;  3IG1 A;  4MFB A;  1TAU A;  3EZ5 A;  5C42 A;  2OPR A;  3A2F A;  5KGW A;  4CEO A;  3V9X A;  1KTQ A;  4DTU A;  4HCC A;  2HHX A;  3SQ2 A;  1B92 A;  1SUQ A;  2OPP A;  2YNG A;  3M8P A;  2Q3S A;  4FZY A;  2FC0 A;  1VRU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...