4PHTX

Atpase gspe in complex with the cytoplasmic domain of gspl from the vibrio vulnificus type ii secretion system
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
234
structure length
224
Chain Sequence
SEFLTVRLSSEQYSPIPWLVWSSSQQEVIASGELSDWQQLDDLKNYAEQRPIVVLVAASDVVLTEVDIPPGASRQFESMLPYLLEDEIAQDVDDLHFSVLAKENGKAQVCGVDRRWLQHMLDAFRAQGLDVKRVLPDSLALPLDDEGISAAQLGEQWLFRHSACQGSAVDDSWMPVYLNSVACFSSLPEQQAHWLSRPVEMTMALLSQGVADGKFSLLTGEFKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords Type II secretion system protein L
publication title Crystal structure of the full-length ATPase GspE from the Vibrio vulnificus type II secretion system in complex with the cytoplasmic domain of GspL.
pubmed doi rcsb
source organism Vibrio vulnificus
total genus 58
structure length 224
sequence length 234
chains with identical sequence Y, Z
ec nomenclature
pdb deposition date 2014-05-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.370 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4phtX02
3.30.420.380 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4phtX01
1YF5L 5TKWA 1W97L 2BH1A 4PHTX
chains in the Genus database with same CATH superfamily
2GV9A 2XY5A 1D9DA 1NGHA 1GOBA 1B9DA 1NK0A 3ZX0A 3O80A 3BF1A 4E89A 4OLAA 4ELTA 2NRVA 1N36K 4CJSA 1ZBSA 2QK9A 1NOYA 4RTFD 3EEQA 2FXUA 1Z05A 4C8MA 1G99A 2P9SB 1NGAA 3K5MA 3K5LA 4CJVA 2Q97A 4FWPA 3V1QA 4I7FA 4MFBA 4X64K 1TAQA 3D2FA 4LD0A 1VRUA 1NKBA 3KK7A 4BDYA 4F2RA 2YKMA 2VWKA 4CZMA 1TKTA 2W6KA 2D0BA 3AA3A 4MDBA 2J4RA 3IS9A 3G4SN 3SCXA 3HOSA 3K5OA 1U2VB 3ZEUB 4DFMA 2UXDK 1NK8A 2ZJPL 4NCBA 2OPPA 1BDGA 3CCLN 2Z1IA 4WQ4A 4DTMA 3VENA 4WQ5A 3C6HA 4B3MK 2D0PA 4FJGA 1T03A 4AHSA 2ZF5O 2KFNA 4KRFA 1U45A 2EHGA 1RT3A 5GAEP 3M8SA 2ZQBA 1VQ8N 4KTZA 1M90O 1JL2A 1K8KA 4BE2A 1NWKA 4B9UA 5KRSA 1RTDA 3HJFA 4BRGA 5AQNA 4CJFA 4EZ6A 3LP3A 1UA1A 3VGLA 3L2QA 4ILHA 3OA9A 2A42A 5LJWA 1HKBA 5JLHA 4C1NK 2BDPA 3O9TA 1P90A 4CF9A 1HQUA 3ENHA 1BA0A 5FPEA 2E1YA 4J2EA 1TL1A 1RT4A 3MX5A 4YDUC 3D0PA 1X9WA 4BDPA 4FVMA 4C8LA 3CHWA 1RDUA 2PY5A 3G0ZA 2IOCA 4M41A 4CIEA 5BRHA 2Q2RA 3EN9A 4PY5A 4PKIA 4IZ9A 5AQFA 1JCFA 4DUYK 3NE6A 5M1OA 4YORA 4A2BA 2IVOA 4CEZA 2YNGA 1Z25A 1RDCA 4BRQA 4KV8A 1HJRA 3CQXA 1BQNA 3LP2A 4CGDA 3M8PA 3QIPA 1WNSA 2QXLA 2FBTA 3J80O 3AARA 3AO5A 4FOIA 1Z6RA 3WXIA 4FJLA 2F96A 5CY4A 4CJUA 3AY9A 1XHZA 4E7IA 1NK4A 4BR9A 3V9ZA 1P8ZA 3SPZA 4LFAK 1BO5O 3ZT0A 4CJ3A 4KI6A 2EX3A 4ELVA 1TV6A 2QKBA 3JSMA 4H5TA 4LH4A 2I7PA 4BG9A 1TK8A 4FJNA 4NXMK 3SMPA 2PFUA 1U48A 4DQPA 3I8DA 5LJVA 4H0TB 3DLEA 4X66K 3NF8A 5BN8A 4KHPK 3O3GA 4JS5A 1W7AA 2BTFA 4YFUA 1GLLO 1I94K 3CC2N 3NH0A 4JK7A 4J2BA 5BN9A 5BRFA 1NGDA 4JKGB 1JLEA 1YXQA 1FJGK 4FZZA 3DRRA 5DK5A 1NU0A 3M8QA 1IKXA 1YITN 2UXCK 4B08A 1LV5A 4FWMA 3T7ZA 1N33K 2HVHA 3N4PA 3SAHA 1LW2A 2FBXA 3THXA 1TL3A 1BGXT 3AVIA 1L5UA 4B9TA 4KHWA 5K14A 4CJQA 3KD1E 5D3GA 5FRNA 3HL8A 4A62A 4BE0A 2CH5A 1RT6A 4B1YB 4M45A 3CIPA 2OTLN 2P9IA 2X78A 3TSPA 4CEQA 4BRNA 3VESA 1ATNA 3FZFA 2WOMA 4O8UA 1HNVA 4CJRA 4W5NA 3FGUA 1GLCG 1LCUA 2ZM6K 4RG8A 1SZ2A 1TGOA 4RW8A 3D2FB 1ZBUA 2PYJA 4DR7K 3K58A 2GELA 2E4LA 3TR8A 4AHUA 1EETA 5E26A 3VF2A 1ITGA 4YHHK 4M3XA 4M63C 3QDKA 1YTAA 4GVEA 3V9UA 1I39A 3O9QA 4K25A 4H0VB 3CMEN 4H0YB 3O5BA 3QEXA 4Z4GA 3KLFA 4JRQA 3V9WA 2HW3A 1ZXOA 2NRZA 4HWIA 4NCAA 4DSJA 4O4GA 3RTVA 4Z0UA 1K73O 2IC3A 2RHKA 4TSXA 4WFNL 1VQKN 3BZCA 3AO3A 2ZJQL 1YHQN 4Z4FA 1NJZA 2XHBA 4ILJA 4FK2A 5AFUA 3KKSA 4FSVA 3VA3A 3VQPA 3M5RA 4O44A 4YNQA 4K42A 5AQXA 3VGKA 5B8HA 4B1XB 4GV9A 1YVNA 4PQUA 5A2QO 3VQ9A 3SI6A 3U3YA 2AP1A 1LAWA 3AVBA 3ZT3A 1QQOA 1YTUA 3MDQA 4N5SA 2OANA 1VQ4N 4IBNA 3I33A 4IJAA 1A5WA 4CVNE 1X3NA 3SQ1A 2ATQA 1DTQA 3EYZA 1WAJA 4JN4A 3WNEA 1SS6A 1T6CA 4DV2K 4HUEA 3O08A 1L3VA 1VSHA 4NXNK 4BREA 1YJWN 1KVCA 2Q1NA 4IG0A 3C7NA 3HVTA 3AO2A 4CIGA 3DYAA 3RR8A 4H5RA 3VQAA 4ID1A 4BRAA 3CMAN 3HSCA 5AQGA 2IVNA 1YI2N 1GOCA 1X9MA 4RWTA 2E8AA 1DTTA 4BWMA 4DCHA 3MN6A 4MO5A 1VQMN 3H1VX 3C6UA 4AILC 5J2MA 1J53A 4CF0A 3CD6N 2IDOA 3ZLJA 4JYAK 2Q31A 4DR6K 4KI4A 3E9PA 1KRPA 4H0PA 1V4SA 3A0IX 2P9NB 3O4QA 3K9JA 4CESA 2X74A 1OVYA 4I6MA 2QWLA 3H08A 1RCHA 5M1PA 4ISFA 2F4VK 3CCMN 3MXMA 3SJHA 4JHDA 4OVLA 2VQEK 1CLQA 5LL6Z 1NK5A 3ZX3A 2GWKA 4JLHA 1VQ5N 3KLEA 3MN7A 2V7YA 4E1NA 3K2PA 3UKRA 4B9LA 1ZYQA 4AM7A 1WOQA 4CF1A 4BY9C 1TUUA 4F2SA 2A40A 3OYHA 4CJLA 3IUCA 3C65A 4JEPA 2XY6A 2UUCK 2KKZA 4FWSA 3H46O 4O8KA 4CK1A 3UE5A 1R0AA 5SZTA 3CM6A 2ZE2A 5FRMA 1NKCA 4H5WA 1JLFA 2PBDA 2E2OA 3P4IA 4V19S 5MLCQ 2F7TA 2QWRA 3CI5A 3THXB 4LC9B 2FSNA 3OS2A 3K59A 3TU5A 4LH5A 3VQQA 3HXMA 1TYQB 4JI5K 3FZHA 4DQSA 2OZMA 2HBKA 1T8EA 2VGNA 3WNGA 1XHXA 2VGMA 4PUOA 2P9IB 4A5BA 4CBUA 3HPHA 2Z1HA 4DQQA 4CZEA 4CZKA 2G8UA 2VWJA 3N4QA 2E6LA 1SL0A 2HHTA 4MDAA 4E3SA 4M7XA 5KTQA 4QAGA 3NF9A 2B6AA 4BGAA 3V9SA 4H8KA 4DTSA 1QZ5A 3QEPA 5BPLA 3OJSA 1BWFO 3AA2A 4BRHA 4HUFA 3G6EN 1RT5A 5I3UA 4KBOA 4FJHA 4CI6A 4BR7A 1FK9A 5AQOA 2XY8A 1NGBA 2RN2A 2F8TA 2O8EA 2FC0A 2PAVA 2BH1A 4LF9K 1HYZA 5AQPA 1SKSA 4QS8A 2HBLA 4QS7A 3HM9A 1IJJA 2G8VA 1IKVA 3QO9A 4DR5K 4BRDA 3AA5X 4CFDA 3MXJA 3CF5L 2GTDA 1IKWA 1VSFA 3OYGA 3NFAA 5JLFA 3QEIA 3SQ2A 1WSHA 5AR0A 2RKIA 1VRTA 3VF6A 2QW9A 3AA4A 1EP4A 3L4QA 2P5GA 4JI1K 3UKUA 1S9EA 3LWMA 1ZC6A 4KB1A 4FM1A 3RWUA 1BA1A 1L3TA 4N47A 4H5NA 3MEEA 3TAFA 3CQYA 4JI2K 1XQSC 1J9AA 3D45A 5CYMA 3S3OA 2P9UA 1JCEA 3MECA 1K9MO 3NH1A 2Z1GA 1T6DA 4DKWA 5KPZA 1U47A 4CZLA 3K57A 4F8RA 3LPTA 3P83D 1QSSA 3JXUA 4FWQA 2G8KA 1F21A 2H3GX 4FLUA 3ID6A 1KVAA 1OH6A 4R79A 3KVGA 2B5JA 5FPMA 1BG3A 2GEMA 3ALYA 1N32K 4DTUA 4DHYA 4I2QA 4UQGA 3DJCA 3CC7N 5AQHA 4CZJA 1T3VA 5HROA 4EFHA 4KHUA 3P1GA 5C2DA 1KD1O 4FO0A 4GKKK 3CXCM 3C6AA 3LAMA 2QWOA 1I3AA 1S1TA 2FLOA 4KKOA 5AJ3K 4AQYK 3OYAA 4JS4A 2NLXA 2ITMA 4BC2A 4E19A 4OLBA 4BACA 1VSMA 4UY8O 3NMUA 1TUYA 3D2EA 4I6MB 4DF4A 4KH5A 4E7KA 4B9VA 4LF5K 2IAJA 3WT0A 3U6FA 2OPRA 4DTNA 4BRKA 4IG3A 3R6MA 3CCRN 3I55N 3CC4N 3ENBA 2VWBA 4OKJA 3U9ZA 4C8KA 4ZTJA 4KHSA 3ZSQA 3O4NA 5HLFA 3AV9A 3CJBA 3VQ4A 1S6PA 3SPYA 3NH2A 3MK6A 3KTQA 2HHXA 2YHBA 5HRSA 3UKRB 3LPUA 4CEOA 3L3UA 2QWMA 3MAQA 4F3TA 3GE1A 3RRHA 3VQ6A 1VQNN 1U49A 3EY1A 3E01A 2O4GA 4Z4IA 3S3NA 3TAGA 4MLHA 5FDLA 1IBMK 1IH7A 1S5JA 4CEAA 1RBUA 1ZBIA 3F2KA 2D0AA 5C0YA 1JKHA 5DM6L 3GBTA 2JLEA 4OKEA 3L3VA 1W2BM 4CW7B 1BI4A 3V1RA 4XEIA 5AQMA 4FYDA 4DQRA 4CJ5A 5GIPA 4OPJA 2QWNA 5AQKA 3DM2A 4CFAA 4HCCA 3TAPA 4YOWA 1IBLK 1MA9B 2KW4A 2IVPA 3GDQA 2F9TA 2RF2A 5AQSA 4YY3K 4DTOA 1EO1A 3VQ5A 4CEEA 4JKEA 4L8RB 2BE2A 3L2VA 2FF6A 2P5OA 4M3WA 3WQUA 4AM6A 1NGIA 3MX2A 2IIRA 4H0XB 4B1VA 4LF6K 2V51B 2CGLA 4B9QA 3TI0A 2E2PA 1X3MA 4FLWA 2HHQA 3M6GA 2FSJA 2OPQA 1XMOK 3KK3A 3W0LA 5H1SQ 1OH5A 4CHOA 1YIJN 2HMPA 3DLRA 2P51A 5F1XA 1FXXA 2O8EB 4BRPA 3BF3A 5I42A 4FLYA 2DFEA 4DSIA 5HOOA 3L8BA 3OS1A 2NRTA 2YNHA 1J6ZA 4OGCA 2I7NA 3SAGA 3ATVA 4CJ7A 4O55A 2XY7A 5CZ1A 4LFCK 4CJEA 4FOEA 4BR5A 1H1VA 1ASUA 1BHLA 4GKJK 2Q0UA 1W97L 4DUZK 2V52B 1ZBHA 3UKUB 5KQDA 4DU3A 1QE1A 1YVUA 2UUAK 3CM5A 4KH6A 4B8AB 5HL7L 3THYB 4F3OA 3DLLL 3DMJA 2ZD1A 1DT9A 1WBDA 2D5RA 3HK2A 2O8CA 4N56A 3G71N 5BREA 5EOYA 3THWA 4WQ4C 3HI0A 2QWPA 3DXMA 4WQ5C 4DS4A 4WFAL 1Q7YO 2Q36A 5ADXH 4CJ4A 3CERA 3DXKA 3VOVA 1WBBA 4PKGA 4CZHA 4CECA 1WLJA 1BU6O 3CCVN 5JVHL 2Y1JA 1KFSA 5J2NA 3DRPA 4CJWA 3AVNA 4FW2A 2YJFA 1VQON 4BE1A 2YHWA 3RSEB 3WXLA 1KLMA 4E7LA 3EE9A 4PL7A 3ZSYA 3T3FA 4CHZA 1REVA 3EL2A 3P31A 1NM1A 1JLBA 4CHQA 1S22A 4KPYA 1QTMA 2XO7A 4C8NA 2GX9A 3OBYA 5HRPA 4BQLA 4JI3K 1RILA 3UIQA 3VQEA 3QFPA 3ZETA 1HPZA 4FPBA 1T7PA 3DWLA 3OVNA 2E6MA 4RW4A 3TTFA 3W3DA 3IDHA 5CZ2A 1C1CA 3TAMA 3BDPA 1XC9A 5CR4A 1KFDA 2RPIA 3CCSN 4FWOA 5IT9O 1N8RO 3A5MC 1QSYA 2Q3SA 1BQMA 2P9KA 1SL1A 4EP4A 4CZGA 3CCEN 1YT3A 4DF8A 4CEDA 3L6QA 4FLVA 1HQEA 1NJWA 2D0CA 4CHNA 1Q8IA 2O8FA 1Q86O 3R3LA 4C1NI 3EZ5A 2NRWA 3V81A 4CJKA 1NOZA 4KTWA 3OYCA 2OTJN 2ASPA 1N6QA 3SJJA 1G15A 2X6NA 1E4FT 1RBTA 1HYSA 4M3UA 1XNQK 3OBWA 1JLCA 1Z26A 4QOZB 5KGXA 1ASVA 3O6WA 4G1QA 3RMCA 4FWRA 3FFKB 4GV3A 1SUQA 5AZIA 5T7BA 5LMNK 3SK3A 2E2NA 1NG9A 1J5EK 2BUPA 3QETA 2KZMA 2I5JA 4B3SK 2QTDA 1VQPN 4JI0K 3VETA 3V1OA 1RT7A 2G8HA 1FKPA 4B1UB 2HF3A 1KAZA 1C1BA 3QEWA 3DOKA 1C6VA 3A2FA 3B8AX 4IFYA 2Z1JA 1CZBA 1L3SA 3CPWM 3FLCO 1K8KB 3ITHA 4A2AA 1Y64A 2UUBK 3P38A 2OYQA 4Q0BA 3JS6A 2P1JA 4LF7K 3ULEA 5M1KA 4M42A 5C10A 4WYBA 4E1MA 1JXEA 1GLBG 3SUNA 4DTXA 3M3ZA 4PHTX 1RDWX 1S1UA 4B3RK 5GIOA 3PUFA 4IFEA 3OY9A 4YOTA 4Z4CA 5BPMA 3TANA 3J7YP 3MMVA 3BY5A 1HPMA 4AH9A 5AQJA 3B6PA 3G10A 1Q81O 3AVAA 3WEEA 5J2QA 4B9MA 4KFBA 3PIPL 4BG8A 3HM8A 5FPDA 4W5TA 1TK5A 1ATSA 1O13A 2WBNA 2E1ZA 4OPAA 3J7ZO 4DR4K 2O8CB 3CETA 1WN7A 3VQDA 3AO1A 1EWRA 4FM0A 1NNEA 2R7YA 4I9QA 3NCIA 4DV0K 1XMQK 4IEIA 4XH1A 5DM7L 3PSIA 4I9LA 1RFQA 3VEYA 4U67L 3DXKB 1NJXA 1IBKK 3I8BA 4H0OA 2UYTA 3S9HA 1UWBA 5ELZA 3VF4A 5JS1A 1VQ9N 3S41A 1XNRK 4DR2K 4H4OA 4ILGB 4PA1A 4CK2A 3CYMA 4OGEA 3LL3A 5AZJA 5KGWA 4W5RA 2F9WA 4Y1DA 4BR2A 3HP6A 4OO1J 3ATUA 4EHUA 3ZSZA 3EE8A 2HBMA 3CJ9A 4M3RA 1A5XA 3CQ8A 2KZZA 1TAUA 1HLUA 2DPNA 3CFOA 3QBWA 2HHHK 1E4GT 2XRIA 1RTJA 3M1FA 1CXQA 5AQUA 4DLEA 1EQYA 1BIUA 3SZ2A 4A59A 2YV0X 3C6TA 2QI2A 3H3NO 4FL9A 5M1NA 2P9SA 4CBXA 4J8FA 4JI6K 3CFRA 3LM2A 4QCLA 4A61A 5BR8K 2O4IA 1VSJA 1W9HA 5JMVA 5M1FA 4RW6A 4KH4A 4CEFA 3QNNA 4W5OA 4FWLA 5AQWA 3ENOA 3LAKA 3RMBA 3IKMA 3MN5A 4XH4A 1X9SA 2O8FB 3IFRA 1S1VA 1X1PA 3CPEA 3WNHA 2YNIA 3BZKA 3MXIA 3DLGA 4DQIA 5EX5A 1EX4A 3O3FA 3C0BA 5SWMA 4EAHD 3OYLA 2A41A 5GAGP 1VSKA 2NNWA 4FLZA 1TKXA 2KLAA 1HX1A 1YUWA 1C0TA 1QQMA 2IS3A 3WXJA 4CHPA 3P39A 3IMXA 3M8RA 1JLAA 1SKRA 4MQ3A 4M3ZA 1RT1A 3NGYA 3H45C 4U7BA 3SQ0A 1UAXA 3KWGA 2V7ZA 3D7EO 3LDQA 1YJ9N 5HRNA 2YX6A 3NHGA 2E5LK 3VN5A 5C2FA 1OH7A 3LP1A 1KLNA 3QINA 1ESVA 5C12A 4HCBA 1O1WA 3FZLA 5FLXO 3ZX2A 4JKBA 5FROA 1IG8A 1T05A 3TWHA 1D9FA 1XWLA 1QVGM 3OHRA 4EZ9A 1C0FA 2LSNA 1SKWA 2HOEA 2NZTA 3S3MA 1NK9A 4DB3A 3K5NA 5I9EB 2W41A 4HUGA 3HPOA 1KTQA 3CCQN 5HP1A 3ULEB 4M3YA 2VYPA 4BRLA 5CE3A 5GINA 4GY2B 2A1SA 1A5VA 4CD3A 4ELUA 3CJ1A 3OJUA 1Q9YA 5ADXA 2ZGZA 5KQ8A 3DAWA 1HMVA 3C7NB 3HO1A 3SUOA 1WB9A 1QSLA 4BQZA 2KQ2A 2OPSA 3OS0A 4RW7A 3RMDA 2HHVA 3SBTA 1VSLA 5BRDA 2JGUA 1N34K 3VQ7A 3H1QA 3LZJA 1X9JA 1HNXK 1KSPA 4ID5A 3O1WA 4BC3A 3I0RA 5LY3A 4C8OA 4O5FA 1WUAA 2HHSA 2HHWA 2VG5A 3OTOK 3LDSA 4IO8A 1S1WA 3LP0A 1RBSA 1FW6A 4AHCA 2GWJA 4LF8K 5EVZA 1TVRA 1WSIA 5HRRA 3AGKA 4CE9A 2G8IA 3GG4A 1HRHA 3FR0A 3ZSRA 4B1WB 2HNZA 4E7JA 5KI6A 4JHDB 2D0OA 1MWMA 3MEDA 3SV3A 3T69A 1HJOA 4RCHA 1DKGD 5EXWA 4K43A 4K8XA 3MWPA 4Y0WA 2ZWHA 3H3OB 3ZYYX 1VQ6N 3AVGA 4FXDA 3QMLA 3HVRA 3CJCA 3K0SA 3O1BA 3VEZA 1QZ6A 1KXPA 1U04A 2YHXA 2HVIA 2E88A 3MWTA 1IV0A 3MEGA 1WSFA 4FLXA 3SV4A 3U4LA 4O0JA 2HSTA 4HVJA 4JKDA 1J54A 2DTUA 4CGHA 1Y97A 5JS2A 4YDUA 4CBWA 1C0MA 1QHAA 4H4MA 3HPGA 4BC5A 1ASWA 3JAMO 4DFPA 3QEVA 4B9NA 3V9XA 3KD5E 2QEXN 3F73A 4E7HA 3WXMB 3HT3A 1R59O 4JKAA 3OYMA 2Q0RA 4JNEA 1BCMA 1M1KO 3EO3A 3AVJA 3EKUA 3DLKA 3SMSA 4PL8A 3ZSOA 2O8DA 2QXFA 1KAYA 4JAXA 1RNHA 4CGJA 3QICA 1QQNA 4PKHA 1TKDA 2KFZA 3TTDA 4DLGA 2BANA 1JL1A 1RBRA 3V4IA 2PZSA 1HNWK 1S6QA 3NF7A 3IAYA 3CFPA 3BP8A 1J5OA 3E66A 3PY8A 1Q9XA 5TKWA 2W6LA 4BR0A 1D4XA 4LSNA 4BWJA 3THVA 4CGGA 3RR7A 1QHTA 3PX6A 3OYEA 2WC9A 5AQYA 4B9SA 4FJ8A 4DFKA 4OX9K 1IO2A 4IJNA 2NRHA 2F8SA 1VAZA 1C0GA 3KWIA 4DR3K 5KPRA 2HB5A 3QB0A 4FJIA 1HR0K 2NUBA 1D5AA 2Y1IA 3QLHA 4BC4A 4H5VA 4N41A 1XC3A 5C25A 4ISGA 3LALA 2QM1A 1WSGA 4FJMA 5IWAK 3NBPA 2VCPA 3SBGA 1SQKA 4K0KK 3K9KA 4DU1A 4JV5K 3TABA 5BR9A 4DTRA 3VQBA 1BOTO 4JI8K 1NLVA 1EKEA 4JKFA 3A5NC 4NO7A 1BL3A 4FLTA 4RW9A 4KAZA 2OZSA 4CF8A 3RVCA 4HTLA 4DSEA 3KIOA 1T44A 4DWIA 2P9UB 4QS9A 4H03B 4LSLA 4JK9A 1HNZK 4JI4K 3TSQA 1UA0A 4KHNA 4Y1CA 2P9PA 3VEWA 4CD1A 2OCEA 3R1XA 4CHYA 1JLGA 4IOCL 2HNYA 1NGCA 4IOXA 1JJ2M 3Q7BA 1KVBA 3WNFA 2P9NA 4DV3K 2ETJA 1C0UA 4DR1K 1DEJA 3QFUA 2YCHA 2E20A 4NLCA 3AGRA 3KLGA 1UOCA 5FPNA 3A5LC 4CZIA 4BRIA 1NGFA 4KREA 2O8BA 3GL1A 1CZAN 2KTQA 4A5AA 1RTHA 3O9SA 3O8MA 1LAVA 1NGEA 4CZFA 4FZXC 3D2EB 4BRCA 2UXBK 3VTHA 4DTPA 1WSJA 1U6ZA 4CJPA 3T1HK 3J7AP 2NRXA 1NGGA 5HBMA 4J2AA 3DOLA 4FVUA 3SUPA 5J1EA 3SUQA 2YJEA 4DSFA 2AA4A 5F2RA 3LDPA 3L2UA 1RBVA 1CXUA 2EWSA 4K41A 4DFJA 4AHVA 5AQZA 3CJAA 3NDKA 3ULDA 4KB0A 2G8FA 4X65K 1SL2A 1LWFA 1MU2A 3MN9A 4CGFA 4YOYA 1DLOA 1TYQA 3L4IA 4F9OA 3PIOL 3LANA 1FKOA 4HHTA 3OYIA 3V6DA 4OPKA 4X62K 3LDNA 2W42A 1VSDA 1BI4B 4IO9L 4OKKA 3WQTA 3AO4A 3RRGA 5E84A 1LWCA 1DGKN 4DQ8A 4R5PA 1NK7A 3MCAB 4LY7A 4DTJA 5AQRA 3BGRA 1ILYA 3LM9A 3SLCA 1RT2A 3FE1A 4IFVA 3TAEA 3PO4A 4F4KA 4BRMA 4CK3A 2YI1A 5C15A 2FSKA 4FCYA 1JCGA 3FZKA 3CG7A 3NGIA 2O8DB 2DY4A 4W5QA 5F0XA 3OYBA 3D6RA 3VEXA 1EWQA 3AVHA 1HUXA 5TKYA 3F5TA 3L0QA 4C23A 3A5OC 3HP9A 1Q82O 2GUIA 1RDAA 4CIFA 1S1XA 3KHYA 3TTCA 3HRGA 1GLFO 3SYZA 3NF6A 4MLEA 3P5JA 1V4TA 1VQ7N 4G9ZA 3OYKA 4CCHA 4JD2A 1S72N 2HMIA 1CZ9A 2A5XA 4ZHRA 5GADP 1HKCA 2WONA 4GVMA 4IEEA 2QKKA 2CH6A 1OVQA 4M3TA 4DV5K 4FJ9A 3OYNA 3F9KA 1NJIO 1BUPA 1NK6A 1YAGA 3VERA 4CGIA 3PX0A 1HNIA 1Q18A 4K8ZA 2FBVA 3I0SA 2QWQA 4E0DA 3TAQA 4GV6A 3WUHA 5CHIA 4LFBK 3C95A 3ZSWA 3J81O 4FJ7A 3HTVA 1VQLN 3QIOA 5KPTA 2A1RA 3PV8A 4FK4A 1OH8A 3LDOA 4DV6K 3J8AA 3A8YA 1GLEG 3SQ4A 5AQTA 3DLBA 3DI6A 5AQIA 2E2QA 4KHYA 3TSUA 3FZMA 1VSIA 4B8CA 3KK2A 1LW0A 3ZT2A 4CF2A 5M1QA 4B3TK 1K8AO 4GMJB 1ZBLA 1NMDA 1IG9A 2G8WA 3THWB 1EXQA 5E41A 1B9FA 3AAPA 2HBJA 4BVPA 4M7YA 3DXMB 4FW1A 4NB4A 4NLBA 4AHTA 1HYVA 2CGJA 3TARA 5DMRA 4FJJA 1RDDA 3ZT1A 3JYTA 5JVGL 1IKYA 2P9PB 2D4WA 3RMAA 4MO4A 3C94A 3Q7CA 4KO0A 3DRSA 4AHRA 2DFHA 1K6YA 2ZGYA 4JK8A 3QNOA 4IDHA 4FK0A 1KAXA 1SV5A 4B3OA 4BROA 3PO5A 2WFBA 3U9DA 1VHXA 2D1KA 3OYJA 4JI7K 3KLHA 4FWNA 2P9LA 3AVMA 3IG1A 2O8BB 1XI1A 4JRPA 1RDBA 1NMNA 3ISNC 1KC8O 5BPNA 4BVOA 3F9MA 1JLQA 1KQSM 4YOUA 4GNIA 4WE1A 2YHAA 1WAFA 3ZCMA 3ZETB 1HKGA 1ZBFA 2ASOA 1LOTB 4A57A 4CJTA 4BGBA 1GLAG 1GLJO 3AVLA 3SNNA 2OA8A 2KHOA 1B92A 1LWEA 2IGIA 4CFCA 2JWKA 3ID8A 3U3GA 2GBZA 2B4JA 4IKFA 5CYQA 3IRXA 4IOAL 1BCOA 2A6AA 3VQ8A 3VEVA 4Z4HA 2P9KB 1QVFM 4KHQA 2CGKA 3CJ7A 3L2RA 1TKZA 4ICLA 1TK0A 3PLAA 4CERA 2ASMA 4DV1K 2DFFA 3HBTA 1BIZA 4ZTFA 1N5YA 3VPZA 4NYFA 4N76A 1U2VA 3L2WA 3ZEUA 3KLIA 2YKNA 5EY4A 3H6EA 3GOIA 2A3ZA 1S3XA 5LMUK 3LDLA 3LWLA 5AQVA 1C1AA 3KK1A 1KCFA 3U8XA 3ZSVA 5AQQA 1NKEA 4EP5A 4FJKA 4LF4K 4Z94A 5EU7A 3AVFA 2JWLA 4L3QA 3HOTA 4AF1A 4J2DA 5AZIB 4WF9L 4BRFA 1MDUB 3T19A 3BUZB 2HHUA 5C42A 1D8YA 2VG7A 3VMFB 2HF4A 3BEXA 3VA0A 3G25A 2FBYA 1QQCA 3O9RA 4CEBA 3NVMA 2FF3B 2WTUA 4ISEA 1RGIA 3KZBA 3EZWA 3NAEA 1W0HA 3ZSXA 3E9LA 4B1ZA 3TPQA 3O3HA 2VQFK 4FJ5A 3I56N 1XUPO 4JKHA 2GUPA 4WFBL 4DSLA 2BGGA 1GOAA 1YF5L 3O9UA 4FM2A 4DG1A 3VQCA 4JD2B 3VGMA 4WCEL 4DV4K 4KTQA 5C24A 5AFUH 1U4BA 1YJNN 5AQLA 4EIAA 3OYFA 2ZJRL 4FWKA 4GW6A 3KJVA 1NBWA 2X6SA 4DMNA 2NRRA 4IWVA 1WSEA 4FPAA 4I2PA 3THYA 4DSKA 3WXKA 2WUSA 1BISA 3B6OA 3T1AA 3QESA 1MWKA 3FFIA 5GAHP 1VSEA 1NGJA 3PX4A 2VG6A 3UB5A 3OW2M 1L3UA 3WEEB 3T1YK 3QBXA 3E1YA 3SAFA 4EHTA 3KKRA 2YHYA 4O0IA 4FZYA 4Q5VA 2PYLA 4O5BA 4IDKA 3R8EA 2ITGA 4XIUA 2YNFA 4CFBA 4YOVA 1NJYA 4NYNA 3HSTB 3ZT4A 5KRTA 3MCPA 4IXCA 4NCGA 3HZ6A 1GLDG 3VEOA 4E1JA 4Z4EA 3RSEA 3AVCA 3NVKA 4OPHA 3AVKA 3VTIA 4BDZA 4DV7K 2RE2A 4HTUA 3CCJN 5JICA 2W40A 3NGZA 3LZIA 1S9GA 3DLHA 4XH5A 2UU9K 4JKGA 3AAQA 3ASMA 3E9OA 4DU4A 5AZJB 4YOXA 3QERA 1VK0A 4BR4A 1JXBA 3R9PA 1QS4A 1RTIA 1SAZA 1OKJA 3CCUN 4DS5A 2AJQA 4FJXA 2P9LB 2HNDA 3PSFA 3OYDA 4JKCA 1E3MA 3EKSA 4PWDA 1ATRA 5J2PA 4OJRA 3HYFA 3O4WA 2QA4N
chains in the Genus database with same CATH topology
1RDWX 4BGAA 5GIOA 1NGHA 3ZX0A 3O80A 1QZ5A 4IFEA 1DEJA 3BF1A 1BWFO 3QFUA 4YOTA 5BPLA 5BPMA 2YCHA 2E20A 4BRHA 4NLCA 3AGRA 3G6EN 2NRVA 4KBOA 1ZBSA 4CI6A 4RTFD 4BR7A 2FXUA 5FPNA 3A5LC 1Z05A 3MMVA 1G99A 2P9SB 5AQOA 4CZIA 1NGAA 1NGFA 1NGBA 4BRIA 1HPMA 2Q97A 5AQJA 4FWPA 2PAVA 2BH1A 1Q81O 5AQPA 3D2FA 3WEEA 3GL1A 4QS8A 1CZAN 2HBLA 4QS7A 4A5AA 3O9SA 3O8MA 3KK7A 3PIPL 1IJJA 1NGEA 4BG8A 4CZFA 3HM8A 5FPDA 3D2EB 4CZMA 4BRCA 4BRDA 1ATSA 1O13A 4MDBA 3VTHA 2J4RA 2WBNA 2E1ZA 4OPAA 3J7ZO 3CF5L 2GTDA 1U6ZA 3CETA 3G4SN 5JLFA 3HOSA 2NRXA 1NGGA 1U2VB 3ZEUB 4IEIA 4XH1A 5AR0A 5DM7L 4FVUA 3VF6A 2ZJPL 2QW9A 2YJEA 1BDGA 3CCLN 2AA4A 1RFQA 3L4QA 5F2RA 4WQ4A 3UKUA 3VEYA 3LDPA 3VENA 4WQ5A 3C6HA 2D0PA 2EWSA 4K41A 4U67L 3DXKB 5AQZA 3CJAA 1ZC6A 2ZF5O 3I8BA 4H0OA 2UYTA 1BA1A 5ELZA 3VF4A 4H5NA 1VQ9N 3S41A 3MN9A 5GAEP 4YOYA 1VQ8N 4ILGB 1TYQA 3L4IA 3CQYA 4F9OA 3PIOL 1M90O 1XQSC 3LL3A 1K8KA 1JCEA 2P9UA 5AZJA 1K9MO 2F9WA 1NWKA 1T6DA 4BR2A 4DKWA 5KPZA 4BRGA 4CZLA 5AQNA 4OO1J 3LDNA 4IO9L 3WQTA 3JXUA 3ATUA 4FWQA 4EHUA 3VGLA 5E84A 3EE8A 2HBMA 1DGKN 3CJ9A 4ILHA 3OA9A 4DQ8A 2A42A 1HLUA 1HKBA 2DPNA 2H3GX 3MCAB 3O9TA 4C1NK 5JLHA 5LJWA 1P90A 3ID6A 3ENHA 3QBWA 1BA0A 4R79A 5AQRA 2E1YA 3KVGA 5FPEA 1E4GT 3LM9A 5FPMA 1ILYA 3SLCA 3FE1A 3M1FA 3MX5A 1BG3A 5AQUA 4YDUC 4BRMA 2YI1A 2GEMA 1EQYA 5C15A 2FSKA 4DHYA 4A59A 1JCGA 3FZKA 2QI2A 3DJCA 3H3NO 4FL9A 5AQHA 4CZJA 1T3VA 5M1NA 4EFHA 3CHWA 3CC7N 5C2DA 1RDUA 5F0XA 1KD1O 3D6RA 4FO0A 3VEXA 2P9SA 3CXCM 5BRHA 2Q2RA 1HUXA 3C6AA 3EN9A 5TKYA 4CBXA 3F5TA 4PKIA 4IZ9A 2QWOA 3L0QA 4J8FA 4C23A 3A5OC 5AQFA 2QA4N 1Q82O 2FLOA 3LM2A 1JCFA 2NLXA 4A61A 2ITMA 3KHYA 5M1OA 4BC2A 3TTCA 4YORA 3HRGA 4A2BA 2IVOA 1GLFO 5JMVA 5M1FA 4KH4A 4UY8O 4MLEA 3NMUA 1TUYA 1V4TA 3D2EA 4FWLA 3ENOA 4I6MB 5AQWA 4BRQA 1VQ7N 4KH5A 4G9ZA 4JD2A 1S72N 3CQXA 3WT0A 3IKMA 2A5XA 3MN5A 4BRKA 5GADP 4XH4A 1HKCA 3R6MA 3CCRN 3I55N 3CC4N 2QXLA 3ENBA 4IEEA 3IFRA 2VWBA 2CH6A 3CPEA 3AARA 4FOIA 3U9ZA 1Z6RA 3WXIA 1NJIO 1BUPA 3CJBA 4PHTX 1YAGA 3VERA 1Q18A 5EX5A 3C0BA 2QWQA 3MK6A 4EAHD 3AY9A 3UKRB 2A41A 5GAGP 4GV6A 2QWMA 3WUHA 2NNWA 4BR9A 3GE1A 5CHIA 1P8ZA 2KLAA 1HX1A 1VQNN 1YUWA 1BO5O 1QQMA 3HTVA 3WXJA 1VQLN 5KPTA 3P39A 3IMXA 4MLHA 3H45C 4U7BA 3LDOA 3J8AA 3A8YA 3KWGA 1GLEG 2V7ZA 3D7EO 4H5TA 2I7PA 4BG9A 3LDQA 5AQTA 1YJ9N 3F2KA 5C0YA 2YX6A 5AQIA 3SMPA 2PFUA 2E2QA 5LJVA 5DM6L 3TSUA 3FZMA 3GBTA 4H0TB 5C2FA 1W2BM 4XEIA 5AQMA 5BN8A 1ESVA 5C12A 5M1QA 5GIPA 2BTFA 2QWNA 3FZLA 5AQKA 4JKBA 3ZX2A 1IG8A 1K8AO 1GLLO 3CC2N 1NMDA 4JK7A 4YOWA 1MA9B 5BN9A 5BRFA 1NGDA 2IVPA 2F9TA 2HBJA 3AAPA 3GDQA 4JKGB 4M7YA 4BVPA 5AQSA 1YXQA 3DXMB 3OHRA 4NB4A 4NLBA 1QVGM 2CGJA 1YITN 1C0FA 1EO1A 2HOEA 4JKEA 4FWMA 3T7ZA 2NZTA 2FF6A 4DB3A 3WQUA 5JVGL 5I9EB 2P9PB 4AM6A 1NGIA 2D4WA 3MX2A 2IIRA 3N4PA 4MO4A 2W41A 3Q7CA 3SAHA 4H0XB 4B1VA 3CCQN 3ULEB 2V51B 2CGLA 2VYPA 4B9QA 4BRLA 2ZGYA 4JK8A 5CE3A 5GINA 4GY2B 4IDHA 2E2PA 1KAXA 1X3MA 4A62A 4CD3A 3M6GA 2FSJA 2CH5A 4B1YB 3CIPA 2OTLN 2P9IA 3CJ1A 4BROA 3TSPA 2OTJN 2WFBA 4BRNA 3VESA 3U9DA 5ADXA 1ATNA 2D1KA 2ZGZA 3FZFA 3DAWA 3C7NB 3W0LA 5KQ8A 4O8UA 5H1SQ 4FWNA 1YIJN 2P9LA 2HMPA 3FGUA 1GLCG 1LCUA 4BQZA 5F1XA 1KC8O 1SZ2A 5BPNA 4BRPA 3BF3A 3F9MA 4BVOA 1KQSM 4YOUA 3D2FB 4GNIA 5HOOA 3SBTA 2GELA 5BRDA 2NRTA 3ZETB 1J6ZA 1HKGA 3H1QA 2ASOA 1LOTB 1X9JA 2I7NA 4A57A 3SAGA 4BGBA 5E26A 3VF2A 3ATVA 4CJ7A 1GLAG 1GLJO 4M63C 2KHOA 3QDKA 3O1WA 4BC3A 5LY3A 4FOEA 4O5FA 4BR5A 1WUAA 1H1VA 4GVEA 3O9QA 4K25A 2JWKA 4H0VB 3ID8A 3CMEN 2Q0UA 4H0YB 1W97L 4IOAL 2V52B 3O5BA 2A6AA 3VEVA 2P9KB 1QVFM 2CGKA 3CJ7A 4IO8A 1ZXOA 2NRZA 3UKUB 5KQDA 4HWIA 4KH6A 5HL7L 2GWJA 3PLAA 2ASMA 5EVZA 3HBTA 3DLLL 1DT9A 1K73O 3AGKA 2RHKA 4WFNL 1VQKN 3GG4A 3FR0A 4B1WB 3VPZA 2ZJQL 1YHQN 3G71N 4JHDB 1U2VA 2D0OA 5BREA 1MWMA 3ZEUA 5EOYA 3T69A 1HJOA 4ILJA 3H6EA 3GOIA 4RCHA 1DKGD 4WQ4C 3HI0A 5EXWA 2QWPA 5AFUA 3DXMA 4WQ5C 1Q7YO 4WFAL 4K43A 2A3ZA 1S3XA 3MWPA 4FSVA 4Y0WA 2ZWHA 2Q36A 5ADXH 3H3OB 3CERA 3LDLA 3ZYYX 5AQVA 1VQ6N 3M5RA 4K42A 3DXKA 3VOVA 5AQXA 3QMLA 3U8XA 3VGKA 5B8HA 4B1XB 4GV9A 4PKGA 5AQQA 1YVNA 4CZHA 3CJCA 1BU6O 3O1BA 3VEZA 3CCVN 5JVHL 1QZ6A 1KXPA 4Z94A 2AP1A 2JWLA 4L3QA 3HOTA 2YHXA 4AF1A 1QQOA 3MDQA 2OANA 2E88A 3MWTA 1VQ4N 5AZIB 3I33A 4IJAA 4BRFA 2YJFA 4WF9L 1VQON 1X3NA 1MDUB 2YHWA 4JN4A 3U4LA 1SS6A 3RSEB 2HSTA 1T6CA 3WXLA 3BUZB 3EE9A 3O08A 4PL7A 4JKDA 3VMFB 4BREA 2HF4A 4YDUA 4CBWA 1QHAA 1YJWN 2Q1NA 3C7NA 3BEXA 3EL2A 3P31A 1NM1A 3G25A 4BC5A 3O9RA 4H5RA 3NVMA 4BRAA 1S22A 3CMAN 3HSCA 2FF3B 5AQGA 2QEXN 2GX9A 3OBYA 2IVNA 4ISEA 4BQLA 1YI2N 3WXMB 1RGIA 4RWTA 2E8AA 3KZBA 1R59O 3EZWA 4JKAA 4B1ZA 4DCHA 3E9LA 3MN6A 4MO5A 3TPQA 1VQMN 2Q0RA 3H1VX 3QFPA 1XUPO 4JKHA 4JNEA 3I56N 3ZETA 3EO3A 2GUPA 1M1KO 4FPBA 4WFBL 3DWLA 3TTFA 3W3DA 3EKUA 3IDHA 1YF5L 3O9UA 4PL8A 3SMSA 1KAYA 4JAXA 3CD6N 4JD2B 3QICA 1QQNA 2Q31A 4PKHA 3VGMA 3TTDA 4WCEL 3E9PA 5CR4A 5AFUH 4H0PA 3CCSN 1YJNN 4FWOA 5AQLA 1V4SA 3A0IX 4EIAA 2ZJRL 4FWKA 2P9NB 1N8RO 3A5MC 1NBWA 3K9JA 2P9KA 4CZGA 2NRRA 3CCEN 3BP8A 4IWVA 1OVYA 4FPAA 3E66A 4I6MA 2QWLA 3WXKA 2WUSA 5M1PA 5TKWA 4BR0A 1D4XA 4ISFA 3CCMN 3L6QA 1MWKA 3SJHA 1Q86O 2WC9A 3R3LA 4JHDA 5AQYA 4C1NI 5GAHP 2NRWA 4IJNA 1NGJA 3ZX3A 2NRHA 2GWKA 1VAZA 1C0GA 3KWIA 3UB5A 3OW2M 1VQ5N 3MN7A 2ASPA 2V7YA 3WEEB 5KPRA 3QBXA 3QB0A 3E1YA 3UKRA 3SAFA 1E4FT 4EHTA 2YHYA 4AM7A 3OBWA 1WOQA 4BC4A 4BY9C 4H5VA 1TUUA 1XC3A 2A40A 4ISGA 2QM1A 3R8EA 3IUCA 3O6WA 4FWRA 4YOVA 3C65A 3FFKB 2VCPA 4JEPA 3SBGA 4GV3A 3MCPA 1SQKA 2KKZA 4IXCA 4FWSA 5AZIA 3H46O 3K9KA 3SK3A 2E2NA 4O8KA 2BUPA 3HZ6A 3UE5A 1GLDG 5BR9A 3VEOA 4E1JA 3RSEA 1BOTO 3NVKA 4OPHA 2QTDA 3VTIA 1VQPN 1NLVA 4H5WA 2RE2A 3VETA 2PBDA 2E2OA 3P4IA 5MLCQ 4JKFA 3A5NC 5JICA 2F7TA 2QWRA 2W40A 3CI5A 4NO7A 3CCJN 4B1UB 2HF3A 4LC9B 1KAZA 2FSNA 4XH5A 3RVCA 3TU5A 3B8AX 4HTLA 1TYQB 3AAQA 3FZHA 4JKGA 1T44A 3CPWM 3E9OA 2HBKA 1K8KB 2P9UB 3FLCO 5AZJB 4A2AA 1Y64A 4QS9A 4YOXA 4H03B 2VGNA 4JK9A 3P38A 2VGMA 3R9PA 4BR4A 2P9IB 3TSQA 4A5BA 1SAZA 1OKJA 3CCUN 3JS6A 2P9PA 4CBUA 3VEWA 4CD1A 2P9LB 5EY4A 3ULEA 5M1KA 3R1XA 4CZKA 4CZEA 4JKCA 5C10A 3EKSA 3N4QA 4IOCL 1ATRA 4IOXA 1NGCA 4WYBA 1JJ2M 4MDAA 4M7XA 3Q7BA 1GLBG 2P9NA 3O4WA 3M3ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YF5 L;  5TKW A;  1W97 L;  2BH1 A;  4PHT X; 
#chains in the Genus database with same CATH topology
 2GV9 A;  2XY5 A;  1D9D A;  1NGH A;  1GOB A;  1B9D A;  1NK0 A;  3ZX0 A;  3O80 A;  3BF1 A;  4E89 A;  4OLA A;  4ELT A;  2NRV A;  1N36 K;  4CJS A;  1ZBS A;  2QK9 A;  1NOY A;  4RTF D;  3EEQ A;  2FXU A;  1Z05 A;  4C8M A;  1G99 A;  2P9S B;  1NGA A;  3K5M A;  3K5L A;  4CJV A;  2Q97 A;  4FWP A;  3V1Q A;  4I7F A;  4MFB A;  4X64 K;  1TAQ A;  3D2F A;  4LD0 A;  1VRU A;  1NKB A;  3KK7 A;  4BDY A;  4F2R A;  2YKM A;  2VWK A;  4CZM A;  1TKT A;  2W6K A;  2D0B A;  3AA3 A;  4MDB A;  2J4R A;  3IS9 A;  3G4S N;  3SCX A;  3HOS A;  3K5O A;  1U2V B;  3ZEU B;  4DFM A;  2UXD K;  1NK8 A;  2ZJP L;  4NCB A;  2OPP A;  1BDG A;  3CCL N;  2Z1I A;  4WQ4 A;  4DTM A;  3VEN A;  4WQ5 A;  3C6H A;  4B3M K;  2D0P A;  4FJG A;  1T03 A;  4AHS A;  2ZF5 O;  2KFN A;  4KRF A;  1U45 A;  2EHG A;  1RT3 A;  5GAE P;  3M8S A;  2ZQB A;  1VQ8 N;  4KTZ A;  1M90 O;  1JL2 A;  1K8K A;  4BE2 A;  1NWK A;  4B9U A;  5KRS A;  1RTD A;  3HJF A;  4BRG A;  5AQN A;  4CJF A;  4EZ6 A;  3LP3 A;  1UA1 A;  3VGL A;  3L2Q A;  4ILH A;  3OA9 A;  2A42 A;  5LJW A;  1HKB A;  5JLH A;  4C1N K;  2BDP A;  3O9T A;  1P90 A;  4CF9 A;  1HQU A;  3ENH A;  1BA0 A;  5FPE A;  2E1Y A;  4J2E A;  1TL1 A;  1RT4 A;  3MX5 A;  4YDU C;  3D0P A;  1X9W A;  4BDP A;  4FVM A;  4C8L A;  3CHW A;  1RDU A;  2PY5 A;  3G0Z A;  2IOC A;  4M41 A;  4CIE A;  5BRH A;  2Q2R A;  3EN9 A;  4PY5 A;  4PKI A;  4IZ9 A;  5AQF A;  1JCF A;  4DUY K;  3NE6 A;  5M1O A;  4YOR A;  4A2B A;  2IVO A;  4CEZ A;  2YNG A;  1Z25 A;  1RDC A;  4BRQ A;  4KV8 A;  1HJR A;  3CQX A;  1BQN A;  3LP2 A;  4CGD A;  3M8P A;  3QIP A;  1WNS A;  2QXL A;  2FBT A;  3J80 O;  3AAR A;  3AO5 A;  4FOI A;  1Z6R A;  3WXI A;  4FJL A;  2F96 A;  5CY4 A;  4CJU A;  3AY9 A;  1XHZ A;  4E7I A;  1NK4 A;  4BR9 A;  3V9Z A;  1P8Z A;  3SPZ A;  4LFA K;  1BO5 O;  3ZT0 A;  4CJ3 A;  4KI6 A;  2EX3 A;  4ELV A;  1TV6 A;  2QKB A;  3JSM A;  4H5T A;  4LH4 A;  2I7P A;  4BG9 A;  1TK8 A;  4FJN A;  4NXM K;  3SMP A;  2PFU A;  1U48 A;  4DQP A;  3I8D A;  5LJV A;  4H0T B;  3DLE A;  4X66 K;  3NF8 A;  5BN8 A;  4KHP K;  3O3G A;  4JS5 A;  1W7A A;  2BTF A;  4YFU A;  1GLL O;  1I94 K;  3CC2 N;  3NH0 A;  4JK7 A;  4J2B A;  5BN9 A;  5BRF A;  1NGD A;  4JKG B;  1JLE A;  1YXQ A;  1FJG K;  4FZZ A;  3DRR A;  5DK5 A;  1NU0 A;  3M8Q A;  1IKX A;  1YIT N;  2UXC K;  4B08 A;  1LV5 A;  4FWM A;  3T7Z A;  1N33 K;  2HVH A;  3N4P A;  3SAH A;  1LW2 A;  2FBX A;  3THX A;  1TL3 A;  1BGX T;  3AVI A;  1L5U A;  4B9T A;  4KHW A;  5K14 A;  4CJQ A;  3KD1 E;  5D3G A;  5FRN A;  3HL8 A;  4A62 A;  4BE0 A;  2CH5 A;  1RT6 A;  4B1Y B;  4M45 A;  3CIP A;  2OTL N;  2P9I A;  2X78 A;  3TSP A;  4CEQ A;  4BRN A;  3VES A;  1ATN A;  3FZF A;  2WOM A;  4O8U A;  1HNV A;  4CJR A;  4W5N A;  3FGU A;  1GLC G;  1LCU A;  2ZM6 K;  4RG8 A;  1SZ2 A;  1TGO A;  4RW8 A;  3D2F B;  1ZBU A;  2PYJ A;  4DR7 K;  3K58 A;  2GEL A;  2E4L A;  3TR8 A;  4AHU A;  1EET A;  5E26 A;  3VF2 A;  1ITG A;  4YHH K;  4M3X A;  4M63 C;  3QDK A;  1YTA A;  4GVE A;  3V9U A;  1I39 A;  3O9Q A;  4K25 A;  4H0V B;  3CME N;  4H0Y B;  3O5B A;  3QEX A;  4Z4G A;  3KLF A;  4JRQ A;  3V9W A;  2HW3 A;  1ZXO A;  2NRZ A;  4HWI A;  4NCA A;  4DSJ A;  4O4G A;  3RTV A;  4Z0U A;  1K73 O;  2IC3 A;  2RHK A;  4TSX A;  4WFN L;  1VQK N;  3BZC A;  3AO3 A;  2ZJQ L;  1YHQ N;  4Z4F A;  1NJZ A;  2XHB A;  4ILJ A;  4FK2 A;  5AFU A;  3KKS A;  4FSV A;  3VA3 A;  3VQP A;  3M5R A;  4O44 A;  4YNQ A;  4K42 A;  5AQX A;  3VGK A;  5B8H A;  4B1X B;  4GV9 A;  1YVN A;  4PQU A;  5A2Q O;  3VQ9 A;  3SI6 A;  3U3Y A;  2AP1 A;  1LAW A;  3AVB A;  3ZT3 A;  1QQO A;  1YTU A;  3MDQ A;  4N5S A;  2OAN A;  1VQ4 N;  4IBN A;  3I33 A;  4IJA A;  1A5W A;  4CVN E;  1X3N A;  3SQ1 A;  2ATQ A;  1DTQ A;  3EYZ A;  1WAJ A;  4JN4 A;  3WNE A;  1SS6 A;  1T6C A;  4DV2 K;  4HUE A;  3O08 A;  1L3V A;  1VSH A;  4NXN K;  4BRE A;  1YJW N;  1KVC A;  2Q1N A;  4IG0 A;  3C7N A;  3HVT A;  3AO2 A;  4CIG A;  3DYA A;  3RR8 A;  4H5R A;  3VQA A;  4ID1 A;  4BRA A;  3CMA N;  3HSC A;  5AQG A;  2IVN A;  1YI2 N;  1GOC A;  1X9M A;  4RWT A;  2E8A A;  1DTT A;  4BWM A;  4DCH A;  3MN6 A;  4MO5 A;  1VQM N;  3H1V X;  3C6U A;  4AIL C;  5J2M A;  1J53 A;  4CF0 A;  3CD6 N;  2IDO A;  3ZLJ A;  4JYA K;  2Q31 A;  4DR6 K;  4KI4 A;  3E9P A;  1KRP A;  4H0P A;  1V4S A;  3A0I X;  2P9N B;  3O4Q A;  3K9J A;  4CES A;  2X74 A;  1OVY A;  4I6M A;  2QWL A;  3H08 A;  1RCH A;  5M1P A;  4ISF A;  2F4V K;  3CCM N;  3MXM A;  3SJH A;  4JHD A;  4OVL A;  2VQE K;  1CLQ A;  5LL6 Z;  1NK5 A;  3ZX3 A;  2GWK A;  4JLH A;  1VQ5 N;  3KLE A;  3MN7 A;  2V7Y A;  4E1N A;  3K2P A;  3UKR A;  4B9L A;  1ZYQ A;  4AM7 A;  1WOQ A;  4CF1 A;  4BY9 C;  1TUU A;  4F2S A;  2A40 A;  3OYH A;  4CJL A;  3IUC A;  3C65 A;  4JEP A;  2XY6 A;  2UUC K;  2KKZ A;  4FWS A;  3H46 O;  4O8K A;  4CK1 A;  3UE5 A;  1R0A A;  5SZT A;  3CM6 A;  2ZE2 A;  5FRM A;  1NKC A;  4H5W A;  1JLF A;  2PBD A;  2E2O A;  3P4I A;  4V19 S;  5MLC Q;  2F7T A;  2QWR A;  3CI5 A;  3THX B;  4LC9 B;  2FSN A;  3OS2 A;  3K59 A;  3TU5 A;  4LH5 A;  3VQQ A;  3HXM A;  1TYQ B;  4JI5 K;  3FZH A;  4DQS A;  2OZM A;  2HBK A;  1T8E A;  2VGN A;  3WNG A;  1XHX A;  2VGM A;  4PUO A;  2P9I B;  4A5B A;  4CBU A;  3HPH A;  2Z1H A;  4DQQ A;  4CZE A;  4CZK A;  2G8U A;  2VWJ A;  3N4Q A;  2E6L A;  1SL0 A;  2HHT A;  4MDA A;  4E3S A;  4M7X A;  5KTQ A;  4QAG A;  3NF9 A;  2B6A A;  4BGA A;  3V9S A;  4H8K A;  4DTS A;  1QZ5 A;  3QEP A;  5BPL A;  3OJS A;  1BWF O;  3AA2 A;  4BRH A;  4HUF A;  3G6E N;  1RT5 A;  5I3U A;  4KBO A;  4FJH A;  4CI6 A;  4BR7 A;  1FK9 A;  5AQO A;  2XY8 A;  1NGB A;  2RN2 A;  2F8T A;  2O8E A;  2FC0 A;  2PAV A;  2BH1 A;  4LF9 K;  1HYZ A;  5AQP A;  1SKS A;  4QS8 A;  2HBL A;  4QS7 A;  3HM9 A;  1IJJ A;  2G8V A;  1IKV A;  3QO9 A;  4DR5 K;  4BRD A;  3AA5 X;  4CFD A;  3MXJ A;  3CF5 L;  2GTD A;  1IKW A;  1VSF A;  3OYG A;  3NFA A;  5JLF A;  3QEI A;  3SQ2 A;  1WSH A;  5AR0 A;  2RKI A;  1VRT A;  3VF6 A;  2QW9 A;  3AA4 A;  1EP4 A;  3L4Q A;  2P5G A;  4JI1 K;  3UKU A;  1S9E A;  3LWM A;  1ZC6 A;  4KB1 A;  4FM1 A;  3RWU A;  1BA1 A;  1L3T A;  4N47 A;  4H5N A;  3MEE A;  3TAF A;  3CQY A;  4JI2 K;  1XQS C;  1J9A A;  3D45 A;  5CYM A;  3S3O A;  2P9U A;  1JCE A;  3MEC A;  1K9M O;  3NH1 A;  2Z1G A;  1T6D A;  4DKW A;  5KPZ A;  1U47 A;  4CZL A;  3K57 A;  4F8R A;  3LPT A;  3P83 D;  1QSS A;  3JXU A;  4FWQ A;  2G8K A;  1F21 A;  2H3G X;  4FLU A;  3ID6 A;  1KVA A;  1OH6 A;  4R79 A;  3KVG A;  2B5J A;  5FPM A;  1BG3 A;  2GEM A;  3ALY A;  1N32 K;  4DTU A;  4DHY A;  4I2Q A;  4UQG A;  3DJC A;  3CC7 N;  5AQH A;  4CZJ A;  1T3V A;  5HRO A;  4EFH A;  4KHU A;  3P1G A;  5C2D A;  1KD1 O;  4FO0 A;  4GKK K;  3CXC M;  3C6A A;  3LAM A;  2QWO A;  1I3A A;  1S1T A;  2FLO A;  4KKO A;  5AJ3 K;  4AQY K;  3OYA A;  4JS4 A;  2NLX A;  2ITM A;  4BC2 A;  4E19 A;  4OLB A;  4BAC A;  1VSM A;  4UY8 O;  3NMU A;  1TUY A;  3D2E A;  4I6M B;  4DF4 A;  4KH5 A;  4E7K A;  4B9V A;  4LF5 K;  2IAJ A;  3WT0 A;  3U6F A;  2OPR A;  4DTN A;  4BRK A;  4IG3 A;  3R6M A;  3CCR N;  3I55 N;  3CC4 N;  3ENB A;  2VWB A;  4OKJ A;  3U9Z A;  4C8K A;  4ZTJ A;  4KHS A;  3ZSQ A;  3O4N A;  5HLF A;  3AV9 A;  3CJB A;  3VQ4 A;  1S6P A;  3SPY A;  3NH2 A;  3MK6 A;  3KTQ A;  2HHX A;  2YHB A;  5HRS A;  3UKR B;  3LPU A;  4CEO A;  3L3U A;  2QWM A;  3MAQ A;  4F3T A;  3GE1 A;  3RRH A;  3VQ6 A;  1VQN N;  1U49 A;  3EY1 A;  3E01 A;  2O4G A;  4Z4I A;  3S3N A;  3TAG A;  4MLH A;  5FDL A;  1IBM K;  1IH7 A;  1S5J A;  4CEA A;  1RBU A;  1ZBI A;  3F2K A;  2D0A A;  5C0Y A;  1JKH A;  5DM6 L;  3GBT A;  2JLE A;  4OKE A;  3L3V A;  1W2B M;  4CW7 B;  1BI4 A;  3V1R A;  4XEI A;  5AQM A;  4FYD A;  4DQR A;  4CJ5 A;  5GIP A;  4OPJ A;  2QWN A;  5AQK A;  3DM2 A;  4CFA A;  4HCC A;  3TAP A;  4YOW A;  1IBL K;  1MA9 B;  2KW4 A;  2IVP A;  3GDQ A;  2F9T A;  2RF2 A;  5AQS A;  4YY3 K;  4DTO A;  1EO1 A;  3VQ5 A;  4CEE A;  4JKE A;  4L8R B;  2BE2 A;  3L2V A;  2FF6 A;  2P5O A;  4M3W A;  3WQU A;  4AM6 A;  1NGI A;  3MX2 A;  2IIR A;  4H0X B;  4B1V A;  4LF6 K;  2V51 B;  2CGL A;  4B9Q A;  3TI0 A;  2E2P A;  1X3M A;  4FLW A;  2HHQ A;  3M6G A;  2FSJ A;  2OPQ A;  1XMO K;  3KK3 A;  3W0L A;  5H1S Q;  1OH5 A;  4CHO A;  1YIJ N;  2HMP A;  3DLR A;  2P51 A;  5F1X A;  1FXX A;  2O8E B;  4BRP A;  3BF3 A;  5I42 A;  4FLY A;  2DFE A;  4DSI A;  5HOO A;  3L8B A;  3OS1 A;  2NRT A;  2YNH A;  1J6Z A;  4OGC A;  2I7N A;  3SAG A;  3ATV A;  4CJ7 A;  4O55 A;  2XY7 A;  5CZ1 A;  4LFC K;  4CJE A;  4FOE A;  4BR5 A;  1H1V A;  1ASU A;  1BHL A;  4GKJ K;  2Q0U A;  1W97 L;  4DUZ K;  2V52 B;  1ZBH A;  3UKU B;  5KQD A;  4DU3 A;  1QE1 A;  1YVU A;  2UUA K;  3CM5 A;  4KH6 A;  4B8A B;  5HL7 L;  3THY B;  4F3O A;  3DLL L;  3DMJ A;  2ZD1 A;  1DT9 A;  1WBD A;  2D5R A;  3HK2 A;  2O8C A;  4N56 A;  3G71 N;  5BRE A;  5EOY A;  3THW A;  4WQ4 C;  3HI0 A;  2QWP A;  3DXM A;  4WQ5 C;  4DS4 A;  4WFA L;  1Q7Y O;  2Q36 A;  5ADX H;  4CJ4 A;  3CER A;  3DXK A;  3VOV A;  1WBB A;  4PKG A;  4CZH A;  4CEC A;  1WLJ A;  1BU6 O;  3CCV N;  5JVH L;  2Y1J A;  1KFS A;  5J2N A;  3DRP A;  4CJW A;  3AVN A;  4FW2 A;  2YJF A;  1VQO N;  4BE1 A;  2YHW A;  3RSE B;  3WXL A;  1KLM A;  4E7L A;  3EE9 A;  4PL7 A;  3ZSY A;  3T3F A;  4CHZ A;  1REV A;  3EL2 A;  3P31 A;  1NM1 A;  1JLB A;  4CHQ A;  1S22 A;  4KPY A;  1QTM A;  2XO7 A;  4C8N A;  2GX9 A;  3OBY A;  5HRP A;  4BQL A;  4JI3 K;  1RIL A;  3UIQ A;  3VQE A;  3QFP A;  3ZET A;  1HPZ A;  4FPB A;  1T7P A;  3DWL A;  3OVN A;  2E6M A;  4RW4 A;  3TTF A;  3W3D A;  3IDH A;  5CZ2 A;  1C1C A;  3TAM A;  3BDP A;  1XC9 A;  5CR4 A;  1KFD A;  2RPI A;  3CCS N;  4FWO A;  5IT9 O;  1N8R O;  3A5M C;  1QSY A;  2Q3S A;  1BQM A;  2P9K A;  1SL1 A;  4EP4 A;  4CZG A;  3CCE N;  1YT3 A;  4DF8 A;  4CED A;  3L6Q A;  4FLV A;  1HQE A;  1NJW A;  2D0C A;  4CHN A;  1Q8I A;  2O8F A;  1Q86 O;  3R3L A;  4C1N I;  3EZ5 A;  2NRW A;  3V81 A;  4CJK A;  1NOZ A;  4KTW A;  3OYC A;  2OTJ N;  2ASP A;  1N6Q A;  3SJJ A;  1G15 A;  2X6N A;  1E4F T;  1RBT A;  1HYS A;  4M3U A;  1XNQ K;  3OBW A;  1JLC A;  1Z26 A;  4QOZ B;  5KGX A;  1ASV A;  3O6W A;  4G1Q A;  3RMC A;  4FWR A;  3FFK B;  4GV3 A;  1SUQ A;  5AZI A;  5T7B A;  5LMN K;  3SK3 A;  2E2N A;  1NG9 A;  1J5E K;  2BUP A;  3QET A;  2KZM A;  2I5J A;  4B3S K;  2QTD A;  1VQP N;  4JI0 K;  3VET A;  3V1O A;  1RT7 A;  2G8H A;  1FKP A;  4B1U B;  2HF3 A;  1KAZ A;  1C1B A;  3QEW A;  3DOK A;  1C6V A;  3A2F A;  3B8A X;  4IFY A;  2Z1J A;  1CZB A;  1L3S A;  3CPW M;  3FLC O;  1K8K B;  3ITH A;  4A2A A;  1Y64 A;  2UUB K;  3P38 A;  2OYQ A;  4Q0B A;  3JS6 A;  2P1J A;  4LF7 K;  3ULE A;  5M1K A;  4M42 A;  5C10 A;  4WYB A;  4E1M A;  1JXE A;  1GLB G;  3SUN A;  4DTX A;  3M3Z A;  4PHT X;  1RDW X;  1S1U A;  4B3R K;  5GIO A;  3PUF A;  4IFE A;  3OY9 A;  4YOT A;  4Z4C A;  5BPM A;  3TAN A;  3J7Y P;  3MMV A;  3BY5 A;  1HPM A;  4AH9 A;  5AQJ A;  3B6P A;  3G10 A;  1Q81 O;  3AVA A;  3WEE A;  5J2Q A;  4B9M A;  4KFB A;  3PIP L;  4BG8 A;  3HM8 A;  5FPD A;  4W5T A;  1TK5 A;  1ATS A;  1O13 A;  2WBN A;  2E1Z A;  4OPA A;  3J7Z O;  4DR4 K;  2O8C B;  3CET A;  1WN7 A;  3VQD A;  3AO1 A;  1EWR A;  4FM0 A;  1NNE A;  2R7Y A;  4I9Q A;  3NCI A;  4DV0 K;  1XMQ K;  4IEI A;  4XH1 A;  5DM7 L;  3PSI A;  4I9L A;  1RFQ A;  3VEY A;  4U67 L;  3DXK B;  1NJX A;  1IBK K;  3I8B A;  4H0O A;  2UYT A;  3S9H A;  1UWB A;  5ELZ A;  3VF4 A;  5JS1 A;  1VQ9 N;  3S41 A;  1XNR K;  4DR2 K;  4H4O A;  4ILG B;  4PA1 A;  4CK2 A;  3CYM A;  4OGE A;  3LL3 A;  5AZJ A;  5KGW A;  4W5R A;  2F9W A;  4Y1D A;  4BR2 A;  3HP6 A;  4OO1 J;  3ATU A;  4EHU A;  3ZSZ A;  3EE8 A;  2HBM A;  3CJ9 A;  4M3R A;  1A5X A;  3CQ8 A;  2KZZ A;  1TAU A;  1HLU A;  2DPN A;  3CFO A;  3QBW A;  2HHH K;  1E4G T;  2XRI A;  1RTJ A;  3M1F A;  1CXQ A;  5AQU A;  4DLE A;  1EQY A;  1BIU A;  3SZ2 A;  4A59 A;  2YV0 X;  3C6T A;  2QI2 A;  3H3N O;  4FL9 A;  5M1N A;  2P9S A;  4CBX A;  4J8F A;  4JI6 K;  3CFR A;  3LM2 A;  4QCL A;  4A61 A;  5BR8 K;  2O4I A;  1VSJ A;  1W9H A;  5JMV A;  5M1F A;  4RW6 A;  4KH4 A;  4CEF A;  3QNN A;  4W5O A;  4FWL A;  5AQW A;  3ENO A;  3LAK A;  3RMB A;  3IKM A;  3MN5 A;  4XH4 A;  1X9S A;  2O8F B;  3IFR A;  1S1V A;  1X1P A;  3CPE A;  3WNH A;  2YNI A;  3BZK A;  3MXI A;  3DLG A;  4DQI A;  5EX5 A;  1EX4 A;  3O3F A;  3C0B A;  5SWM A;  4EAH D;  3OYL A;  2A41 A;  5GAG P;  1VSK A;  2NNW A;  4FLZ A;  1TKX A;  2KLA A;  1HX1 A;  1YUW A;  1C0T A;  1QQM A;  2IS3 A;  3WXJ A;  4CHP A;  3P39 A;  3IMX A;  3M8R A;  1JLA A;  1SKR A;  4MQ3 A;  4M3Z A;  1RT1 A;  3NGY A;  3H45 C;  4U7B A;  3SQ0 A;  1UAX A;  3KWG A;  2V7Z A;  3D7E O;  3LDQ A;  1YJ9 N;  5HRN A;  2YX6 A;  3NHG A;  2E5L K;  3VN5 A;  5C2F A;  1OH7 A;  3LP1 A;  1KLN A;  3QIN A;  1ESV A;  5C12 A;  4HCB A;  1O1W A;  3FZL A;  5FLX O;  3ZX2 A;  4JKB A;  5FRO A;  1IG8 A;  1T05 A;  3TWH A;  1D9F A;  1XWL A;  1QVG M;  3OHR A;  4EZ9 A;  1C0F A;  2LSN A;  1SKW A;  2HOE A;  2NZT A;  3S3M A;  1NK9 A;  4DB3 A;  3K5N A;  5I9E B;  2W41 A;  4HUG A;  3HPO A;  1KTQ A;  3CCQ N;  5HP1 A;  3ULE B;  4M3Y A;  2VYP A;  4BRL A;  5CE3 A;  5GIN A;  4GY2 B;  2A1S A;  1A5V A;  4CD3 A;  4ELU A;  3CJ1 A;  3OJU A;  1Q9Y A;  5ADX A;  2ZGZ A;  5KQ8 A;  3DAW A;  1HMV A;  3C7N B;  3HO1 A;  3SUO A;  1WB9 A;  1QSL A;  4BQZ A;  2KQ2 A;  2OPS A;  3OS0 A;  4RW7 A;  3RMD A;  2HHV A;  3SBT A;  1VSL A;  5BRD A;  2JGU A;  1N34 K;  3VQ7 A;  3H1Q A;  3LZJ A;  1X9J A;  1HNX K;  1KSP A;  4ID5 A;  3O1W A;  4BC3 A;  3I0R A;  5LY3 A;  4C8O A;  4O5F A;  1WUA A;  2HHS A;  2HHW A;  2VG5 A;  3OTO K;  3LDS A;  4IO8 A;  1S1W A;  3LP0 A;  1RBS A;  1FW6 A;  4AHC A;  2GWJ A;  4LF8 K;  5EVZ A;  1TVR A;  1WSI A;  5HRR A;  3AGK A;  4CE9 A;  2G8I A;  3GG4 A;  1HRH A;  3FR0 A;  3ZSR A;  4B1W B;  2HNZ A;  4E7J A;  5KI6 A;  4JHD B;  2D0O A;  1MWM A;  3MED A;  3SV3 A;  3T69 A;  1HJO A;  4RCH A;  1DKG D;  5EXW A;  4K43 A;  4K8X A;  3MWP A;  4Y0W A;  2ZWH A;  3H3O B;  3ZYY X;  1VQ6 N;  3AVG A;  4FXD A;  3QML A;  3HVR A;  3CJC A;  3K0S A;  3O1B A;  3VEZ A;  1QZ6 A;  1KXP A;  1U04 A;  2YHX A;  2HVI A;  2E88 A;  3MWT A;  1IV0 A;  3MEG A;  1WSF A;  4FLX A;  3SV4 A;  3U4L A;  4O0J A;  2HST A;  4HVJ A;  4JKD A;  1J54 A;  2DTU A;  4CGH A;  1Y97 A;  5JS2 A;  4YDU A;  4CBW A;  1C0M A;  1QHA A;  4H4M A;  3HPG A;  4BC5 A;  1ASW A;  3JAM O;  4DFP A;  3QEV A;  4B9N A;  3V9X A;  3KD5 E;  2QEX N;  3F73 A;  4E7H A;  3WXM B;  3HT3 A;  1R59 O;  4JKA A;  3OYM A;  2Q0R A;  4JNE A;  1BCM A;  1M1K O;  3EO3 A;  3AVJ A;  3EKU A;  3DLK A;  3SMS A;  4PL8 A;  3ZSO A;  2O8D A;  2QXF A;  1KAY A;  4JAX A;  1RNH A;  4CGJ A;  3QIC A;  1QQN A;  4PKH A;  1TKD A;  2KFZ A;  3TTD A;  4DLG A;  2BAN A;  1JL1 A;  1RBR A;  3V4I A;  2PZS A;  1HNW K;  1S6Q A;  3NF7 A;  3IAY A;  3CFP A;  3BP8 A;  1J5O A;  3E66 A;  3PY8 A;  1Q9X A;  5TKW A;  2W6L A;  4BR0 A;  1D4X A;  4LSN A;  4BWJ A;  3THV A;  4CGG A;  3RR7 A;  1QHT A;  3PX6 A;  3OYE A;  2WC9 A;  5AQY A;  4B9S A;  4FJ8 A;  4DFK A;  4OX9 K;  1IO2 A;  4IJN A;  2NRH A;  2F8S A;  1VAZ A;  1C0G A;  3KWI A;  4DR3 K;  5KPR A;  2HB5 A;  3QB0 A;  4FJI A;  1HR0 K;  2NUB A;  1D5A A;  2Y1I A;  3QLH A;  4BC4 A;  4H5V A;  4N41 A;  1XC3 A;  5C25 A;  4ISG A;  3LAL A;  2QM1 A;  1WSG A;  4FJM A;  5IWA K;  3NBP A;  2VCP A;  3SBG A;  1SQK A;  4K0K K;  3K9K A;  4DU1 A;  4JV5 K;  3TAB A;  5BR9 A;  4DTR A;  3VQB A;  1BOT O;  4JI8 K;  1NLV A;  1EKE A;  4JKF A;  3A5N C;  4NO7 A;  1BL3 A;  4FLT A;  4RW9 A;  4KAZ A;  2OZS A;  4CF8 A;  3RVC A;  4HTL A;  4DSE A;  3KIO A;  1T44 A;  4DWI A;  2P9U B;  4QS9 A;  4H03 B;  4LSL A;  4JK9 A;  1HNZ K;  4JI4 K;  3TSQ A;  1UA0 A;  4KHN A;  4Y1C A;  2P9P A;  3VEW A;  4CD1 A;  2OCE A;  3R1X A;  4CHY A;  1JLG A;  4IOC L;  2HNY A;  1NGC A;  4IOX A;  1JJ2 M;  3Q7B A;  1KVB A;  3WNF A;  2P9N A;  4DV3 K;  2ETJ A;  1C0U A;  4DR1 K;  1DEJ A;  3QFU A;  2YCH A;  2E20 A;  4NLC A;  3AGR A;  3KLG A;  1UOC A;  5FPN A;  3A5L C;  4CZI A;  4BRI A;  1NGF A;  4KRE A;  2O8B A;  3GL1 A;  1CZA N;  2KTQ A;  4A5A A;  1RTH A;  3O9S A;  3O8M A;  1LAV A;  1NGE A;  4CZF A;  4FZX C;  3D2E B;  4BRC A;  2UXB K;  3VTH A;  4DTP A;  1WSJ A;  1U6Z A;  4CJP A;  3T1H K;  3J7A P;  2NRX A;  1NGG A;  5HBM A;  4J2A A;  3DOL A;  4FVU A;  3SUP A;  5J1E A;  3SUQ A;  2YJE A;  4DSF A;  2AA4 A;  5F2R A;  3LDP A;  3L2U A;  1RBV A;  1CXU A;  2EWS A;  4K41 A;  4DFJ A;  4AHV A;  5AQZ A;  3CJA A;  3NDK A;  3ULD A;  4KB0 A;  2G8F A;  4X65 K;  1SL2 A;  1LWF A;  1MU2 A;  3MN9 A;  4CGF A;  4YOY A;  1DLO A;  1TYQ A;  3L4I A;  4F9O A;  3PIO L;  3LAN A;  1FKO A;  4HHT A;  3OYI A;  3V6D A;  4OPK A;  4X62 K;  3LDN A;  2W42 A;  1VSD A;  1BI4 B;  4IO9 L;  4OKK A;  3WQT A;  3AO4 A;  3RRG A;  5E84 A;  1LWC A;  1DGK N;  4DQ8 A;  4R5P A;  1NK7 A;  3MCA B;  4LY7 A;  4DTJ A;  5AQR A;  3BGR A;  1ILY A;  3LM9 A;  3SLC A;  1RT2 A;  3FE1 A;  4IFV A;  3TAE A;  3PO4 A;  4F4K A;  4BRM A;  4CK3 A;  2YI1 A;  5C15 A;  2FSK A;  4FCY A;  1JCG A;  3FZK A;  3CG7 A;  3NGI A;  2O8D B;  2DY4 A;  4W5Q A;  5F0X A;  3OYB A;  3D6R A;  3VEX A;  1EWQ A;  3AVH A;  1HUX A;  5TKY A;  3F5T A;  3L0Q A;  4C23 A;  3A5O C;  3HP9 A;  1Q82 O;  2GUI A;  1RDA A;  4CIF A;  1S1X A;  3KHY A;  3TTC A;  3HRG A;  1GLF O;  3SYZ A;  3NF6 A;  4MLE A;  3P5J A;  1V4T A;  1VQ7 N;  4G9Z A;  3OYK A;  4CCH A;  4JD2 A;  1S72 N;  2HMI A;  1CZ9 A;  2A5X A;  4ZHR A;  5GAD P;  1HKC A;  2WON A;  4GVM A;  4IEE A;  2QKK A;  2CH6 A;  1OVQ A;  4M3T A;  4DV5 K;  4FJ9 A;  3OYN A;  3F9K A;  1NJI O;  1BUP A;  1NK6 A;  1YAG A;  3VER A;  4CGI A;  3PX0 A;  1HNI A;  1Q18 A;  4K8Z A;  2FBV A;  3I0S A;  2QWQ A;  4E0D A;  3TAQ A;  4GV6 A;  3WUH A;  5CHI A;  4LFB K;  3C95 A;  3ZSW A;  3J81 O;  4FJ7 A;  3HTV A;  1VQL N;  3QIO A;  5KPT A;  2A1R A;  3PV8 A;  4FK4 A;  1OH8 A;  3LDO A;  4DV6 K;  3J8A A;  3A8Y A;  1GLE G;  3SQ4 A;  5AQT A;  3DLB A;  3DI6 A;  5AQI A;  2E2Q A;  4KHY A;  3TSU A;  3FZM A;  1VSI A;  4B8C A;  3KK2 A;  1LW0 A;  3ZT2 A;  4CF2 A;  5M1Q A;  4B3T K;  1K8A O;  4GMJ B;  1ZBL A;  1NMD A;  1IG9 A;  2G8W A;  3THW B;  1EXQ A;  5E41 A;  1B9F A;  3AAP A;  2HBJ A;  4BVP A;  4M7Y A;  3DXM B;  4FW1 A;  4NB4 A;  4NLB A;  4AHT A;  1HYV A;  2CGJ A;  3TAR A;  5DMR A;  4FJJ A;  1RDD A;  3ZT1 A;  3JYT A;  5JVG L;  1IKY A;  2P9P B;  2D4W A;  3RMA A;  4MO4 A;  3C94 A;  3Q7C A;  4KO0 A;  3DRS A;  4AHR A;  2DFH A;  1K6Y A;  2ZGY A;  4JK8 A;  3QNO A;  4IDH A;  4FK0 A;  1KAX A;  1SV5 A;  4B3O A;  4BRO A;  3PO5 A;  2WFB A;  3U9D A;  1VHX A;  2D1K A;  3OYJ A;  4JI7 K;  3KLH A;  4FWN A;  2P9L A;  3AVM A;  3IG1 A;  2O8B B;  1XI1 A;  4JRP A;  1RDB A;  1NMN A;  3ISN C;  1KC8 O;  5BPN A;  4BVO A;  3F9M A;  1JLQ A;  1KQS M;  4YOU A;  4GNI A;  4WE1 A;  2YHA A;  1WAF A;  3ZCM A;  3ZET B;  1HKG A;  1ZBF A;  2ASO A;  1LOT B;  4A57 A;  4CJT A;  4BGB A;  1GLA G;  1GLJ O;  3AVL A;  3SNN A;  2OA8 A;  2KHO A;  1B92 A;  1LWE A;  2IGI A;  4CFC A;  2JWK A;  3ID8 A;  3U3G A;  2GBZ A;  2B4J A;  4IKF A;  5CYQ A;  3IRX A;  4IOA L;  1BCO A;  2A6A A;  3VQ8 A;  3VEV A;  4Z4H A;  2P9K B;  1QVF M;  4KHQ A;  2CGK A;  3CJ7 A;  3L2R A;  1TKZ A;  4ICL A;  1TK0 A;  3PLA A;  4CER A;  2ASM A;  4DV1 K;  2DFF A;  3HBT A;  1BIZ A;  4ZTF A;  1N5Y A;  3VPZ A;  4NYF A;  4N76 A;  1U2V A;  3L2W A;  3ZEU A;  3KLI A;  2YKN A;  5EY4 A;  3H6E A;  3GOI A;  2A3Z A;  1S3X A;  5LMU K;  3LDL A;  3LWL A;  5AQV A;  1C1A A;  3KK1 A;  1KCF A;  3U8X A;  3ZSV A;  5AQQ A;  1NKE A;  4EP5 A;  4FJK A;  4LF4 K;  4Z94 A;  5EU7 A;  3AVF A;  2JWL A;  4L3Q A;  3HOT A;  4AF1 A;  4J2D A;  5AZI B;  4WF9 L;  4BRF A;  1MDU B;  3T19 A;  3BUZ B;  2HHU A;  5C42 A;  1D8Y A;  2VG7 A;  3VMF B;  2HF4 A;  3BEX A;  3VA0 A;  3G25 A;  2FBY A;  1QQC A;  3O9R A;  4CEB A;  3NVM A;  2FF3 B;  2WTU A;  4ISE A;  1RGI A;  3KZB A;  3EZW A;  3NAE A;  1W0H A;  3ZSX A;  3E9L A;  4B1Z A;  3TPQ A;  3O3H A;  2VQF K;  4FJ5 A;  3I56 N;  1XUP O;  4JKH A;  2GUP A;  4WFB L;  4DSL A;  2BGG A;  1GOA A;  1YF5 L;  3O9U A;  4FM2 A;  4DG1 A;  3VQC A;  4JD2 B;  3VGM A;  4WCE L;  4DV4 K;  4KTQ A;  5C24 A;  5AFU H;  1U4B A;  1YJN N;  5AQL A;  4EIA A;  3OYF A;  2ZJR L;  4FWK A;  4GW6 A;  3KJV A;  1NBW A;  2X6S A;  4DMN A;  2NRR A;  4IWV A;  1WSE A;  4FPA A;  4I2P A;  3THY A;  4DSK A;  3WXK A;  2WUS A;  1BIS A;  3B6O A;  3T1A A;  3QES A;  1MWK A;  3FFI A;  5GAH P;  1VSE A;  1NGJ A;  3PX4 A;  2VG6 A;  3UB5 A;  3OW2 M;  1L3U A;  3WEE B;  3T1Y K;  3QBX A;  3E1Y A;  3SAF A;  4EHT A;  3KKR A;  2YHY A;  4O0I A;  4FZY A;  4Q5V A;  2PYL A;  4O5B A;  4IDK A;  3R8E A;  2ITG A;  4XIU A;  2YNF A;  4CFB A;  4YOV A;  1NJY A;  4NYN A;  3HST B;  3ZT4 A;  5KRT A;  3MCP A;  4IXC A;  4NCG A;  3HZ6 A;  1GLD G;  3VEO A;  4E1J A;  4Z4E A;  3RSE A;  3AVC A;  3NVK A;  4OPH A;  3AVK A;  3VTI A;  4BDZ A;  4DV7 K;  2RE2 A;  4HTU A;  3CCJ N;  5JIC A;  2W40 A;  3NGZ A;  3LZI A;  1S9G A;  3DLH A;  4XH5 A;  2UU9 K;  4JKG A;  3AAQ A;  3ASM A;  3E9O A;  4DU4 A;  5AZJ B;  4YOX A;  3QER A;  1VK0 A;  4BR4 A;  1JXB A;  3R9P A;  1QS4 A;  1RTI A;  1SAZ A;  1OKJ A;  3CCU N;  4DS5 A;  2AJQ A;  4FJX A;  2P9L B;  2HND A;  3PSF A;  3OYD A;  4JKC A;  1E3M A;  3EKS A;  4PWD A;  1ATR A;  5J2P A;  4OJR A;  3HYF A;  3O4W A;  2QA4 N; 
#chains in the Genus database with same CATH homology
 1RDW X;  4BGA A;  5GIO A;  1NGH A;  3ZX0 A;  3O80 A;  1QZ5 A;  4IFE A;  1DEJ A;  3BF1 A;  1BWF O;  3QFU A;  4YOT A;  5BPL A;  5BPM A;  2YCH A;  2E20 A;  4BRH A;  4NLC A;  3AGR A;  3G6E N;  2NRV A;  4KBO A;  1ZBS A;  4CI6 A;  4RTF D;  4BR7 A;  2FXU A;  5FPN A;  3A5L C;  1Z05 A;  3MMV A;  1G99 A;  2P9S B;  5AQO A;  4CZI A;  1NGA A;  1NGF A;  1NGB A;  4BRI A;  1HPM A;  2Q97 A;  5AQJ A;  4FWP A;  2PAV A;  2BH1 A;  1Q81 O;  5AQP A;  3D2F A;  3WEE A;  3GL1 A;  4QS8 A;  1CZA N;  2HBL A;  4QS7 A;  4A5A A;  3O9S A;  3O8M A;  3KK7 A;  3PIP L;  1IJJ A;  1NGE A;  4BG8 A;  4CZF A;  3HM8 A;  5FPD A;  3D2E B;  4CZM A;  4BRC A;  4BRD A;  1ATS A;  1O13 A;  4MDB A;  3VTH A;  2J4R A;  2WBN A;  2E1Z A;  4OPA A;  3J7Z O;  3CF5 L;  2GTD A;  1U6Z A;  3CET A;  3G4S N;  5JLF A;  3HOS A;  2NRX A;  1NGG A;  1U2V B;  3ZEU B;  4IEI A;  4XH1 A;  5AR0 A;  5DM7 L;  4FVU A;  3VF6 A;  2ZJP L;  2QW9 A;  2YJE A;  1BDG A;  3CCL N;  2AA4 A;  1RFQ A;  3L4Q A;  5F2R A;  4WQ4 A;  3UKU A;  3VEY A;  3LDP A;  3VEN A;  4WQ5 A;  3C6H A;  2D0P A;  2EWS A;  4K41 A;  4U67 L;  3DXK B;  5AQZ A;  3CJA A;  1ZC6 A;  2ZF5 O;  3I8B A;  4H0O A;  2UYT A;  1BA1 A;  5ELZ A;  3VF4 A;  4H5N A;  1VQ9 N;  3S41 A;  3MN9 A;  5GAE P;  4YOY A;  1VQ8 N;  4ILG B;  1TYQ A;  3L4I A;  3CQY A;  4F9O A;  3PIO L;  1M90 O;  1XQS C;  3LL3 A;  1K8K A;  1JCE A;  2P9U A;  5AZJ A;  1K9M O;  2F9W A;  1NWK A;  1T6D A;  4BR2 A;  4DKW A;  5KPZ A;  4BRG A;  4CZL A;  5AQN A;  4OO1 J;  3LDN A;  4IO9 L;  3WQT A;  3JXU A;  3ATU A;  4FWQ A;  4EHU A;  3VGL A;  5E84 A;  3EE8 A;  2HBM A;  1DGK N;  3CJ9 A;  4ILH A;  3OA9 A;  4DQ8 A;  2A42 A;  1HLU A;  1HKB A;  2DPN A;  2H3G X;  3MCA B;  3O9T A;  4C1N K;  5JLH A;  5LJW A;  1P90 A;  3ID6 A;  3ENH A;  3QBW A;  1BA0 A;  4R79 A;  5AQR A;  2E1Y A;  3KVG A;  5FPE A;  1E4G T;  3LM9 A;  5FPM A;  1ILY A;  3SLC A;  3FE1 A;  3M1F A;  3MX5 A;  1BG3 A;  5AQU A;  4YDU C;  4BRM A;  2YI1 A;  2GEM A;  1EQY A;  5C15 A;  2FSK A;  4DHY A;  4A59 A;  1JCG A;  3FZK A;  2QI2 A;  3DJC A;  3H3N O;  4FL9 A;  5AQH A;  4CZJ A;  1T3V A;  5M1N A;  4EFH A;  3CHW A;  3CC7 N;  5C2D A;  1RDU A;  5F0X A;  1KD1 O;  3D6R A;  4FO0 A;  3VEX A;  2P9S A;  3CXC M;  5BRH A;  2Q2R A;  1HUX A;  3C6A A;  3EN9 A;  5TKY A;  4CBX A;  3F5T A;  4PKI A;  4IZ9 A;  2QWO A;  3L0Q A;  4J8F A;  4C23 A;  3A5O C;  5AQF A;  2QA4 N;  1Q82 O;  2FLO A;  3LM2 A;  1JCF A;  2NLX A;  4A61 A;  2ITM A;  3KHY A;  5M1O A;  4BC2 A;  3TTC A;  4YOR A;  3HRG A;  4A2B A;  2IVO A;  1GLF O;  5JMV A;  5M1F A;  4KH4 A;  4UY8 O;  4MLE A;  3NMU A;  1TUY A;  1V4T A;  3D2E A;  4FWL A;  3ENO A;  4I6M B;  5AQW A;  4BRQ A;  1VQ7 N;  4KH5 A;  4G9Z A;  4JD2 A;  1S72 N;  3CQX A;  3WT0 A;  3IKM A;  2A5X A;  3MN5 A;  4BRK A;  5GAD P;  4XH4 A;  1HKC A;  3R6M A;  3CCR N;  3I55 N;  3CC4 N;  2QXL A;  3ENB A;  4IEE A;  3IFR A;  2VWB A;  2CH6 A;  3CPE A;  3AAR A;  4FOI A;  3U9Z A;  1Z6R A;  3WXI A;  1NJI O;  1BUP A;  3CJB A;  4PHT X;  1YAG A;  3VER A;  1Q18 A;  5EX5 A;  3C0B A;  2QWQ A;  3MK6 A;  4EAH D;  3AY9 A;  3UKR B;  2A41 A;  5GAG P;  4GV6 A;  2QWM A;  3WUH A;  2NNW A;  4BR9 A;  3GE1 A;  5CHI A;  1P8Z A;  2KLA A;  1HX1 A;  1VQN N;  1YUW A;  1BO5 O;  1QQM A;  3HTV A;  3WXJ A;  1VQL N;  5KPT A;  3P39 A;  3IMX A;  4MLH A;  3H45 C;  4U7B A;  3LDO A;  3J8A A;  3A8Y A;  3KWG A;  1GLE G;  2V7Z A;  3D7E O;  4H5T A;  2I7P A;  4BG9 A;  3LDQ A;  5AQT A;  1YJ9 N;  3F2K A;  5C0Y A;  2YX6 A;  5AQI A;  3SMP A;  2PFU A;  2E2Q A;  5LJV A;  5DM6 L;  3TSU A;  3FZM A;  3GBT A;  4H0T B;  5C2F A;  1W2B M;  4XEI A;  5AQM A;  5BN8 A;  1ESV A;  5C12 A;  5M1Q A;  5GIP A;  2BTF A;  2QWN A;  3FZL A;  5AQK A;  4JKB A;  3ZX2 A;  1IG8 A;  1K8A O;  1GLL O;  3CC2 N;  1NMD A;  4JK7 A;  4YOW A;  1MA9 B;  5BN9 A;  5BRF A;  1NGD A;  2IVP A;  2F9T A;  2HBJ A;  3AAP A;  3GDQ A;  4JKG B;  4M7Y A;  4BVP A;  5AQS A;  1YXQ A;  3DXM B;  3OHR A;  4NB4 A;  4NLB A;  1QVG M;  2CGJ A;  1YIT N;  1C0F A;  1EO1 A;  2HOE A;  4JKE A;  4FWM A;  3T7Z A;  2NZT A;  2FF6 A;  4DB3 A;  3WQU A;  5JVG L;  5I9E B;  2P9P B;  4AM6 A;  1NGI A;  2D4W A;  3MX2 A;  2IIR A;  3N4P A;  4MO4 A;  2W41 A;  3Q7C A;  3SAH A;  4H0X B;  4B1V A;  3CCQ N;  3ULE B;  2V51 B;  2CGL A;  2VYP A;  4B9Q A;  4BRL A;  2ZGY A;  4JK8 A;  5CE3 A;  5GIN A;  4GY2 B;  4IDH A;  2E2P A;  1KAX A;  1X3M A;  4A62 A;  4CD3 A;  3M6G A;  2FSJ A;  2CH5 A;  4B1Y B;  3CIP A;  2OTL N;  2P9I A;  3CJ1 A;  4BRO A;  3TSP A;  2OTJ N;  2WFB A;  4BRN A;  3VES A;  3U9D A;  5ADX A;  1ATN A;  2D1K A;  2ZGZ A;  3FZF A;  3DAW A;  3C7N B;  3W0L A;  5KQ8 A;  4O8U A;  5H1S Q;  4FWN A;  1YIJ N;  2P9L A;  2HMP A;  3FGU A;  1GLC G;  1LCU A;  4BQZ A;  5F1X A;  1KC8 O;  1SZ2 A;  5BPN A;  4BRP A;  3BF3 A;  3F9M A;  4BVO A;  1KQS M;  4YOU A;  3D2F B;  4GNI A;  5HOO A;  3SBT A;  2GEL A;  5BRD A;  2NRT A;  3ZET B;  1J6Z A;  1HKG A;  3H1Q A;  2ASO A;  1LOT B;  1X9J A;  2I7N A;  4A57 A;  3SAG A;  4BGB A;  5E26 A;  3VF2 A;  3ATV A;  4CJ7 A;  1GLA G;  1GLJ O;  4M63 C;  2KHO A;  3QDK A;  3O1W A;  4BC3 A;  5LY3 A;  4FOE A;  4O5F A;  4BR5 A;  1WUA A;  1H1V A;  4GVE A;  3O9Q A;  4K25 A;  2JWK A;  4H0V B;  3ID8 A;  3CME N;  2Q0U A;  4H0Y B;  1W97 L;  4IOA L;  2V52 B;  3O5B A;  2A6A A;  3VEV A;  2P9K B;  1QVF M;  2CGK A;  3CJ7 A;  4IO8 A;  1ZXO A;  2NRZ A;  3UKU B;  5KQD A;  4HWI A;  4KH6 A;  5HL7 L;  2GWJ A;  3PLA A;  2ASM A;  5EVZ A;  3HBT A;  3DLL L;  1DT9 A;  1K73 O;  3AGK A;  2RHK A;  4WFN L;  1VQK N;  3GG4 A;  3FR0 A;  4B1W B;  3VPZ A;  2ZJQ L;  1YHQ N;  3G71 N;  4JHD B;  1U2V A;  2D0O A;  5BRE A;  1MWM A;  3ZEU A;  5EOY A;  3T69 A;  1HJO A;  4ILJ A;  3H6E A;  3GOI A;  4RCH A;  1DKG D;  4WQ4 C;  3HI0 A;  5EXW A;  2QWP A;  5AFU A;  3DXM A;  4WQ5 C;  1Q7Y O;  4WFA L;  4K43 A;  2A3Z A;  1S3X A;  3MWP A;  4FSV A;  4Y0W A;  2ZWH A;  2Q36 A;  5ADX H;  3H3O B;  3CER A;  3LDL A;  3ZYY X;  5AQV A;  1VQ6 N;  3M5R A;  4K42 A;  3DXK A;  3VOV A;  5AQX A;  3QML A;  3U8X A;  3VGK A;  5B8H A;  4B1X B;  4GV9 A;  4PKG A;  5AQQ A;  1YVN A;  4CZH A;  3CJC A;  1BU6 O;  3O1B A;  3VEZ A;  3CCV N;  5JVH L;  1QZ6 A;  1KXP A;  4Z94 A;  2AP1 A;  2JWL A;  4L3Q A;  3HOT A;  2YHX A;  4AF1 A;  1QQO A;  3MDQ A;  2OAN A;  2E88 A;  3MWT A;  1VQ4 N;  5AZI B;  3I33 A;  4IJA A;  4BRF A;  2YJF A;  4WF9 L;  1VQO N;  1X3N A;  1MDU B;  2YHW A;  4JN4 A;  3U4L A;  1SS6 A;  3RSE B;  2HST A;  1T6C A;  3WXL A;  3BUZ B;  3EE9 A;  3O08 A;  4PL7 A;  4JKD A;  3VMF B;  4BRE A;  2HF4 A;  4YDU A;  4CBW A;  1QHA A;  1YJW N;  2Q1N A;  3C7N A;  3BEX A;  3EL2 A;  3P31 A;  1NM1 A;  3G25 A;  4BC5 A;  3O9R A;  4H5R A;  3NVM A;  4BRA A;  1S22 A;  3CMA N;  3HSC A;  2FF3 B;  5AQG A;  2QEX N;  2GX9 A;  3OBY A;  2IVN A;  4ISE A;  4BQL A;  1YI2 N;  3WXM B;  1RGI A;  4RWT A;  2E8A A;  3KZB A;  1R59 O;  3EZW A;  4JKA A;  4B1Z A;  4DCH A;  3E9L A;  3MN6 A;  4MO5 A;  3TPQ A;  1VQM N;  2Q0R A;  3H1V X;  3QFP A;  1XUP O;  4JKH A;  4JNE A;  3I56 N;  3ZET A;  3EO3 A;  2GUP A;  1M1K O;  4FPB A;  4WFB L;  3DWL A;  3TTF A;  3W3D A;  3EKU A;  3IDH A;  1YF5 L;  3O9U A;  4PL8 A;  3SMS A;  1KAY A;  4JAX A;  3CD6 N;  4JD2 B;  3QIC A;  1QQN A;  2Q31 A;  4PKH A;  3VGM A;  3TTD A;  4WCE L;  3E9P A;  5CR4 A;  5AFU H;  4H0P A;  3CCS N;  1YJN N;  4FWO A;  5AQL A;  1V4S A;  3A0I X;  4EIA A;  2ZJR L;  4FWK A;  2P9N B;  1N8R O;  3A5M C;  1NBW A;  3K9J A;  2P9K A;  4CZG A;  2NRR A;  3CCE N;  3BP8 A;  4IWV A;  1OVY A;  4FPA A;  3E66 A;  4I6M A;  2QWL A;  3WXK A;  2WUS A;  5M1P A;  5TKW A;  4BR0 A;  1D4X A;  4ISF A;  3CCM N;  3L6Q A;  1MWK A;  3SJH A;  1Q86 O;  2WC9 A;  3R3L A;  4JHD A;  5AQY A;  4C1N I;  5GAH P;  2NRW A;  4IJN A;  1NGJ A;  3ZX3 A;  2NRH A;  2GWK A;  1VAZ A;  1C0G A;  3KWI A;  3UB5 A;  3OW2 M;  1VQ5 N;  3MN7 A;  2ASP A;  2V7Y A;  3WEE B;  5KPR A;  3QBX A;  3QB0 A;  3E1Y A;  3UKR A;  3SAF A;  1E4F T;  4EHT A;  2YHY A;  4AM7 A;  3OBW A;  1WOQ A;  4BC4 A;  4BY9 C;  4H5V A;  1TUU A;  1XC3 A;  2A40 A;  4ISG A;  2QM1 A;  3R8E A;  3IUC A;  3O6W A;  4FWR A;  4YOV A;  3C65 A;  3FFK B;  2VCP A;  4JEP A;  3SBG A;  4GV3 A;  3MCP A;  1SQK A;  2KKZ A;  4IXC A;  4FWS A;  5AZI A;  3H46 O;  3K9K A;  3SK3 A;  2E2N A;  4O8K A;  2BUP A;  3HZ6 A;  3UE5 A;  1GLD G;  5BR9 A;  3VEO A;  4E1J A;  3RSE A;  1BOT O;  3NVK A;  4OPH A;  2QTD A;  3VTI A;  1VQP N;  1NLV A;  4H5W A;  2RE2 A;  3VET A;  2PBD A;  2E2O A;  3P4I A;  5MLC Q;  4JKF A;  3A5N C;  5JIC A;  2F7T A;  2QWR A;  2W40 A;  3CI5 A;  4NO7 A;  3CCJ N;  4B1U B;  2HF3 A;  4LC9 B;  1KAZ A;  2FSN A;  4XH5 A;  3RVC A;  3TU5 A;  3B8A X;  4HTL A;  1TYQ B;  3AAQ A;  3FZH A;  4JKG A;  1T44 A;  3CPW M;  3E9O A;  2HBK A;  1K8K B;  2P9U B;  3FLC O;  5AZJ B;  4A2A A;  1Y64 A;  4QS9 A;  4YOX A;  4H03 B;  2VGN A;  4JK9 A;  3P38 A;  2VGM A;  3R9P A;  4BR4 A;  2P9I B;  3TSQ A;  4A5B A;  1SAZ A;  1OKJ A;  3CCU N;  3JS6 A;  2P9P A;  4CBU A;  3VEW A;  4CD1 A;  2P9L B;  5EY4 A;  3ULE A;  5M1K A;  3R1X A;  4CZK A;  4CZE A;  4JKC A;  5C10 A;  3EKS A;  3N4Q A;  4IOC L;  1ATR A;  4IOX A;  1NGC A;  4WYB A;  1JJ2 M;  4MDA A;  4M7X A;  3Q7B A;  1GLB G;  2P9N A;  3O4W A;  3M3Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...