4PHTX

Atpase gspe in complex with the cytoplasmic domain of gspl from the vibrio vulnificus type ii secretion system
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
234
structure length
224
Chain Sequence
SEFLTVRLSSEQYSPIPWLVWSSSQQEVIASGELSDWQQLDDLKNYAEQRPIVVLVAASDVVLTEVDIPPGASRQFESMLPYLLEDEIAQDVDDLHFSVLAKENGKAQVCGVDRRWLQHMLDAFRAQGLDVKRVLPDSLALPLDDEGISAAQLGEQWLFRHSACQGSAVDDSWMPVYLNSVACFSSLPEQQAHWLSRPVEMTMALLSQGVADGKFSLLTGEFKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the full-length ATPase GspE from the Vibrio vulnificus type II secretion system in complex with the cytoplasmic domain of GspL.
pubmed doi rcsb
source organism Vibrio vulnificus
molecule tags Protein transport
molecule keywords Type II secretion system protein L
total genus 58
structure length 224
sequence length 234
chains with identical sequence Y, Z
ec nomenclature
pdb deposition date 2014-05-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.370 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4phtX02
3.30.420.380 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4phtX01
5TKWA 1W97L 4PHTX 1YF5L 2BH1A
chains in the Genus database with same CATH superfamily
5LMNK 3O9SA 3VF2A 3OVNA 4BDPA 3P38A 2CH5A 4CIFA 2WUSA 4B3SK 1TK0A 5AZIB 2ITMA 4CJ5A 1U48A 3TSPA 2XHBA 1VHXA 4CJKA 1GLJO 4CGJA 4U7BA 4BY9C 2JGUA 3L0QA 1LCUA 3HP6A 3NE6A 4FM0A 1RDWX 2GELA 3M8QA 2IIRA 5DM6L 4NCAA 4Y0WA 4LH5A 3JXUA 5F2RA 1IKYA 3CPWM 3M8PA 2HNYA 3V9SA 4LFAK 2HF4A 3CJBA 4GVEA 1N6QA 3WNGA 3AVKA 1Z25A 3DRPA 3WNHA 5GINA 1IBMK 4I9QA 4CFAA 2OA8A 3NDKA 4KH4A 4C23A 4CJFA 4IO9L 3AO1A 1J53A 1QQOA 1NK7A 4GKKK 3RWUA 3AVBA 4C1NK 2P9LA 5JVGL 1E4GT 2Q31A 2QM1A 3VA3A 5KGWA 4MQ3A 1VSJA 3ZSWA 2E88A 3B8AX 3SAGA 3TAFA 1N34K 2O8BB 1IH7A 2RE2A 3JYTA 1YXQA 1RT4A 4N76A 3IS9A 5AJ3K 5C25A 2Q2RA 1QSSA 4A5BA 5M1QA 3H3NO 4YOVA 3UKRA 3K57A 4FYDA 3MXIA 3CXCM 2HOEA 3QO9A 2P9SB 3RMDA 4DQIA 2DPNA 1OH8A 1MA9B 3M1FA 4DV6K 5BR9A 3MX2A 2IC3A 2Q3SA 4AHSA 3H46O 1ZXOA 1NJIO 3NH2A 5IWAK 4RW9A 1Z26A 3WNEA 5FRMA 3WEEB 4IOCL 2RHKA 1L5UA 2E4LA 1VQ5N 3CQYA 1ATSA 5LJVA 4RCHA 1KSPA 4CEDA 4FWSA 3RSEB 2V7ZA 1Q86O 3HOSA 1YUWA 3O5BA 4CHNA 3FGUA 4O8UA 4AHVA 4DB3A 3KK1A 1NK8A 2JWLA 1OVQA 3ID8A 3SNNA 5BRDA 1NKCA 4J2DA 3ULDA 1U45A 4U67L 3VEVA 2FSNA 1JCGA 4DQ8A 4OPJA 3ZX3A 4OLBA 5SWMA 3DLRA 1S1VA 4AHTA 2UXDK 1RDCA 4H5WA 3LDPA 5CY4A 4FOIA 2DTUA 1JXBA 3IG1A 4IG3A 2P5GA 4DUYK 1NU0A 2Q36A 4CW7B 1YF5L 3QESA 3VESA 1GOCA 5CYQA 3CMAN 3AVFA 1DEJA 4CEQA 1VSLA 2F4VK 5BRHA 3I33A 1NKEA 5AQWA 1HPZA 3O4QA 1GLFO 5AQXA 3LAKA 4JKFA 3MDQA 5C15A 1G15A 3VQ5A 4FWPA 2W41A 4OGCA 4IOXA 3WNFA 5SZTA 3CCMN 4K8ZA 1KC8O 1S6QA 3SLCA 2QTDA 1TVRA 1QVFM 2Z1HA 1QZ6A 3NGYA 3ZETB 2NRTA 3AVNA 2OANA 1Z05A 4CK2A 5KRTA 3SV4A 2OZSA 1QSYA 1JKHA 3HM9A 1XUPO 3NGIA 3SJJA 3WXLA 3OS1A 1BUPA 2AA4A 4BRCA 2YHAA 5FPDA 3ID6A 5AQPA 3SAHA 3SUQA 3HZ6A 3MN7A 2PFUA 1HMVA 3MWPA 5AQNA 3QEXA 3ZT3A 4BR7A 3O1WA 4CIGA 2O8CB 5AQHA 3SZ2A 3N4QA 2ETJA 4FLWA 1RCHA 3VGKA 2FC0A 2E2PA 1U47A 3QEWA 4KTQA 1ILYA 1YJWN 2YNHA 3S3MA 3VEOA 3CCVN 4B3OA 1NMDA 1XC3A 3G71N 1WLJA 4DFKA 3CFPA 4DU1A 2KZZA 5I9EB 3N4PA 5BRFA 1U6ZA 4LSLA 5HROA 1JCFA 3U9DA 4FO0A 1UA1A 1RNHA 2GTDA 5F1XA 3OW2M 4E1NA 5J2NA 3QNNA 3LDNA 4MDAA 4NXNK 3L8BA 4LH4A 3VQ6A 1K9MO 2D0OA 2D0BA 1KAXA 1OKJA 4OPKA 1EO1A 4IDKA 3WXJA 3ZSZA 5E41A 5AQMA 3O3HA 3HOTA 1HNZK 2HBKA 3QIPA 2HBLA 4BRIA 2HSTA 3LM9A 3U8XA 5E84A 1S1WA 3HO1A 2BH1A 4DSJA 1RDUA 4KKOA 1ASVA 1IKWA 2DY4A 4ISFA 1X3MA 5KQ8A 3TAMA 3ZSRA 4RW7A 4M3YA 4Z4FA 1GLCG 1HKGA 1TKXA 1JXEA 3NF8A 4AHCA 1GLDG 2QKKA 4DTXA 1KCFA 1HYZA 3JS6A 3VEXA 3DYAA 3CMEN 1Q7YO 4CEOA 1LOTB 1RBSA 5CZ2A 2HHWA 1ATRA 3THWA 4E3SA 3CM6A 1A5WA 3TSQA 3T3FA 3DLBA 4DV2K 5CR4A 3J8AA 4B9VA 3HTVA 2QWMA 3QFUA 1YI2N 2O8CA 2E20A 1VQNN 2UYTA 4I6MB 4RW6A 4BR4A 4N47A 4LC9B 4FZZA 3L6QA 4LD0A 4HTLA 1C1BA 1NOYA 5AZIA 3V4IA 1MWKA 4KHUA 1R59O 4A61A 4EFHA 2E1YA 4FJ5A 4HVJA 5LY3A 4F4KA 2VQFK 4NCBA 4BRDA 2O8BA 4OJRA 1BWFO 3K59A 3RVCA 3ISNC 4BG8A 5BPLA 4DR1K 1S1TA 4F3TA 4FJJA 3SMPA 1ESVA 4LF4K 2X78A 3AO5A 4K42A 3ENHA 5CYMA 3AY9A 4LFCK 4DR2K 3P83D 4KI4A 1Q8IA 2O8EB 3VQ4A 1KTQA 4L3QA 1QQCA 1EX4A 2PYJA 3DM2A 4B9SA 2YHBA 4JK7A 3NVKA 1B9FA 5M1NA 3SBGA 4KTWA 3OTOK 3D2EB 2UXBK 4KTZA 1N5YA 1MWMA 3D2FA 4O5BA 3O1BA 2XO7A 2HHQA 3EZ5A 5CHIA 1ZBHA 5GADP 3QNOA 4MO4A 2G8KA 4JI4K 3LWMA 3OYNA 1Y97A 3KK2A 1XI1A 1BQNA 3DXMB 4HUEA 4OKEA 5H1SQ 4ILHA 1BCOA 1TKDA 3OYAA 2G8HA 1RT5A 5T7BA 1VRTA 3PSFA 1IJJA 3FFIA 5AQYA 1NGBA 2XRIA 1NJXA 2KLAA 5KGXA 4CFCA 4KB1A 4CJVA 2CGKA 3UKRB 1I3AA 4FWNA 5ADXH 1U49A 2E6MA 4JHDB 5C10A 1EWRA 5AQUA 2A40A 3UKUA 4CZJA 3NF7A 4W5TA 2EWSA 1NJWA 4ELTA 5AQVA 1JCEA 4FLYA 4UY8O 4WF9L 1SKSA 4M3TA 3SQ2A 1HKBA 3K5NA 3D2EA 4H8KA 5J2QA 1SL2A 4FSVA 2KW4A 4CFBA 2P9LB 3CJCA 5M1KA 5KPTA 4K8XA 4BDZA 4AM6A 2QI2A 4C1NI 3K58A 4KRFA 3AAQA 3MN9A 1K73O 4PWDA 4DMNA 1V4SA 4JK8A 3ZX0A 1KD1O 4CJEA 3S9HA 3VF4A 3DOKA 3BGRA 4M45A 2YCHA 4JAXA 4O8KA 3FZLA 4BC4A 1K8KA 3AV9A 1MU2A 4BG9A 4CJSA 1GOAA 1D5AA 4M41A 3LDSA 4BQLA 1TYQA 5EX5A 3ENOA 1D9FA 2P9PA 1NGFA 3ATUA 5AR0A 1XNRK 4PL8A 4K25A 1ZC6A 4BE0A 3CIPA 3TARA 3ZSYA 4KV8A 3OY9A 2VCPA 1C0UA 1FW6A 4CHZA 3WQTA 1QTMA 1DGKN 4J2EA 4XEIA 3HPOA 3SMSA 4FJLA 2KFZA 1X3NA 1NJYA 1U2VA 1WN7A 1HNXK 1CZAN 5J1EA 4DQPA 4AILC 1CXUA 2P5OA 4CJ4A 2HHTA 1TUYA 4KHSA 4EHUA 1TUUA 3DLLL 3VQCA 1LAWA 1LW0A 3EO3A 4KFBA 3ENBA 4H5VA 1QQNA 2P9SA 3E66A 3IKMA 2LSNA 3GL1A 2O8FA 4A2AA 5CZ1A 4F3OA 1FXXA 3KWIA 4JI2K 3ZT4A 4BRMA 3SCXA 2RF2A 1B9DA 4DV0K 5AQZA 2OCEA 4YOXA 4IBNA 4HWIA 1RDBA 4BWMA 2I5JA 5GAHP 3VMFB 3OA9A 3HSCA 4M3XA 4RWTA 3LAMA 3CM5A 3MECA 4CJPA 1SQKA 4CBXA 3EE9A 5BR8K 3HM8A 2KZMA 3K5MA 4GV6A 2O4GA 2FBTA 1BHLA 4FJMA 4FK0A 3KJVA 1VQ9N 5JS1A 3E01A 2UUBK 2WFBA 4DHYA 1X9SA 4BC3A 3C6TA 4DTUA 3U3YA 3VA0A 5M1OA 3K5OA 4FZXC 5HOOA 3VGLA 5AQJA 4F8RA 5I42A 4IZ9A 3QBWA 4FPBA 1LV5A 1RDAA 4WYBA 3QINA 1J9AA 4OKJA 4M42A 3C6AA 4PY5A 2WTUA 4CJ3A 4J2AA 3FZFA 3OYMA 1S3XA 4FK4A 3VF6A 4V19S 4YOWA 3J81O 2ASOA 4FWLA 3MEDA 4BRHA 4CERA 3T19A 4DUZK 1HNVA 3C0BA 3TU5A 5DM7L 3ZYYX 1RTIA 4CK1A 5AZJA 3HK2A 1C0MA 3AO3A 1BIUA 3OYJA 2HMIA 2KHOA 4B9NA 2IS3A 2P9IA 3V1RA 1BGXT 2NRXA 3FR0A 2EX3A 1JJ2M 1QVGM 4BVPA 3P31A 3C7NA 2F9WA 2QKBA 1VK0A 2HNZA 4W5RA 3LPTA 4TSXA 4DTRA 2O8FB 5KPZA 1O1WA 4EP4A 3MEGA 3J7YP 1RBRA 4HUGA 1S72N 2G8IA 3MXJA 2A3ZA 1NGHA 2GUIA 1RDDA 1KAYA 2IAJA 1NKBA 4E89A 3VQ8A 3DI6A 3GG4A 4Z0UA 4B8AB 3V9UA 5AQGA 3AGRA 2UUAK 4DKWA 1G99A 1UAXA 4ID1A 1YIJN 4W5NA 3V6DA 3V9WA 2HB5A 3CHWA 4JLHA 3QEIA 2PZSA 2A42A 3J7AP 1RBTA 3HVTA 1JL2A 3OYFA 4HTUA 3KD1E 4DSIA 2HVHA 3OYDA 3WXIA 1T03A 4Q0BA 5AFUH 4R79A 5EU7A 3CCSN 1HRHA 4BQZA 1S5JA 3PX4A 2P1JA 1T6DA 4CGHA 3O9UA 4F9OA 1MDUB 1TKTA 1SZ2A 3HPGA 3IMXA 3ZSVA 4CIEA 3NMUA 1HJRA 3PLAA 2D0PA 3CFOA 2D5RA 3Q7CA 3E9OA 4CF1A 1C1AA 3H08A 4HUFA 4KHPK 1S1XA 4CJ7A 3QETA 2YHYA 2ZQBA 3AVAA 3LZIA 4JI6K 1T8EA 4IOAL 3F9MA 4C8LA 1WNSA 5CE3A 1TV6A 3PY8A 2EHGA 4FJXA 4DTMA 1S6PA 4JEPA 2V51B 1W2BM 4OO1J 1W7AA 2FBXA 5C24A 4IKFA 4JKBA 3CQ8A 3NF9A 5AZJB 2HBMA 4IFYA 3H45C 3LL3A 1YITN 4DTOA 3DLKA 1E4FT 2OPQA 2B4JA 3CCJN 1WAJA 4CJQA 3VQ9A 2G8WA 4BR0A 4DF8A 4B9TA 2QWLA 4DFJA 1RILA 3HL8A 3G4SN 1N8RO 2OTJN 1FK9A 4RTFD 4BROA 1J6ZA 1RGIA 1RBUA 1SL1A 1JLBA 3VOVA 3MN5A 2QXLA 4BRKA 2W6KA 1BI4B 4GVMA 5KRSA 4H03B 3NF6A 4JS5A 2NLXA 3K5LA 4I6MA 3ZCMA 4M3RA 3EY1A 3UE5A 1N36K 1NGDA 1YT3A 4CZHA 1BCMA 3ZT0A 3PV8A 4Y1CA 4X62K 4B9QA 4YORA 1CZBA 4FLVA 4LF6K 2ZWHA 4KH5A 3AVMA 4FLZA 1U2VB 5AQLA 5HP1A 3O80A 4BWJA 4AH9A 3R6MA 4FM2A 2OYQA 4CEBA 1Q9XA 3AVGA 1P8ZA 3AA4A 4JNEA 3PX6A 3P5JA 2Q0UA 1S1UA 4YOTA 3I56N 3KHYA 3PSIA 4KH6A 1NK9A 1BA1A 4JKAA 4M7YA 1BISA 1XQSC 3VPZA 2A5XA 4C8OA 1F21A 3AAPA 3CPEA 3U4LA 3SQ0A 1TK5A 3CF5L 1NGCA 2NRWA 3R1XA 4NXMK 4FJ7A 1NGAA 3VQDA 5C12A 1HQEA 4I9LA 1T05A 3HJFA 3RMBA 4JS4A 3DOLA 1Q82O 2OZMA 3VEWA 2GWKA 4PL7A 4YDUC 2P9KA 4FWQA 3VQBA 1QZ5A 3HXMA 1JLGA 3TSUA 3ZLJA 1DT9A 2J4RA 3CCRN 4OVLA 4JI1K 3VQ7A 1M1KO 2P9UB 2NRRA 1DLOA 4CD3A 2P9UA 3OBWA 3VQAA 4CD1A 3SQ1A 3S3OA 2BGGA 1WUAA 2ATQA 2HHUA 3V9XA 5AQKA 5C42A 3S3NA 3QICA 3CC4N 2X6SA 3R3LA 4CZEA 1WB9A 4X66K 3AO4A 4AM7A 3VQQA 3E9PA 4FOEA 4DSEA 4DR7K 4FM1A 1NGIA 1EXQA 3MX5A 4Z4EA 3LDLA 2WBNA 1WSFA 1BI4A 1YHQN 4N56A 3KK7A 4BRPA 3K9JA 2E2NA 3NHGA 3MCAB 4C8MA 4IEEA 3D2FB 4Y1DA 2QA4N 4DFPA 3O08A 4ILJA 3L4IA 4O4GA 3THXB 3A0IX 2ZE2A 2CGLA 4LF7K 1U04A 1C0TA 5EVZA 5AQFA 1RTJA 3DXMA 3R8EA 3CCEN 3EKUA 3VERA 4KHNA 5HL7L 3O4WA 5GAGP 3I0SA 1P90A 3ZETA 4XH5A 4CF0A 1HPMA 5D3GA 2I7NA 2BE2A 5FPMA 4H0TB 1HJOA 3E9LA 3SJHA 3IAYA 3AARA 3HPHA 1NK4A 3T1AA 5FLXO 3C7NB 1FJGK 3RMAA 3V9ZA 1OH6A 1D8YA 1ATNA 3EYZA 3TPQA 4CVNE 3WT0A 1NK5A 4DF4A 4LY7A 1C0FA 5KI6A 4FJIA 5FRNA 2VWKA 5GIPA 2ZGYA 5TKYA 3PIPL 3CJ9A 1EP4A 5JICA 1OH5A 2HHXA 1NBWA 4PHTX 4B8CA 1IV0A 5BREA 1NGJA 4GMJB 2GBZA 3L2RA 4JV5K 1JL1A 3OYKA 2DFEA 3CCLN 1HX1A 1XNQK 4DU4A 4GW6A 4JN4A 3L3UA 4R5PA 4EHTA 4N5SA 4FJ9A 4WQ4A 3L2QA 4FJ8A 5I3UA 3BF1A 4PQUA 3IDHA 1WAFA 1VRUA 2YX6A 4Q5VA 4J8FA 4WFNL 2ZM6K 2E8AA 4ILGB 3ZT2A 4OPAA 4WQ4C 1VSEA 4JD2B 1KFDA 4MDBA 4I7FA 3PO4A 4AHRA 4ELVA 1VSMA 4CE9A 4CECA 3QMLA 1TK8A 4JKHA 1YTAA 4EIAA 2KKZA 3BUZB 2QWNA 4F2SA 1UOCA 4CZKA 3NCIA 1Y64A 1ZYQA 2QWQA 1UWBA 2Q97A 1O13A 3KLIA 2DFHA 2H3GX 3BF3A 4IXCA 3U3GA 4CF8A 4LF8K 3TR8A 5BN8A 3KVGA 2CGJA 3A5OC 3KLHA 1KLNA 2Z1IA 2XY6A 4KAZA 5DMRA 1XHXA 4BRGA 1NM1A 1WBBA 2E5LK 4B9MA 4KO0A 3F9KA 4E7KA 5C0YA 4MLHA 4FJGA 4PKHA 4ZTJA 4AHUA 1YJ9N 3EEQA 2A1RA 4EZ6A 4FJHA 1RT6A 4IEIA 2Z1GA 3SAFA 4B08A 1YAGA 3C65A 3AVCA 3C95A 4FCYA 1XMOK 4EZ9A 2Y1JA 2YJFA 4CEFA 2YNIA 4BRLA 2F96A 3C94A 3VENA 2IDOA 1SL0A 4WE1A 3W3DA 1H1VA 4LSNA 5A2QO 3L2WA 3CD6N 3O9QA 4DS4A 2RKIA 2PY5A 4ISGA 2Q0RA 1IG8A 2FF3B 2Q1NA 3CCUN 1DTTA 2FSJA 4YOYA 3OS0A 1S22A 3SK3A 2F8TA 1NOZA 4JI8K 1L3VA 2A1SA 4FWMA 2R7YA 1NJZA 1W97L 2G8FA 3WUHA 4IFEA 3HT3A 3TTCA 4F2RA 2FXUA 2Z1JA 3H3OB 1K8AO 3VTIA 2NNWA 4YY3K 2QWPA 2QWOA 3GOIA 1V4TA 1Z6RA 2ZJRL 1RT7A 2GV9A 1VQ8N 4CGDA 4MFBA 4H0OA 3RSEA 3KKSA 4CFDA 3VN5A 1WOQA 1VSDA 3THYB 4KREA 2ZJQL 4YDUA 4RG8A 5J2PA 3NH1A 3LP1A 1EETA 4PKGA 3KLFA 2ZGZA 1X9WA 1IKXA 3AA5X 3OYCA 1GOBA 4BVOA 3GE1A 4Z4GA 2QWRA 4DTNA 5AQQA 3KKRA 1WSIA 4JRPA 4MLEA 2QK9A 4W5OA 4FJKA 3CQXA 3MWTA 2YNFA 3D7EO 3FE1A 4OGEA 2BANA 4B9LA 3OYEA 3K9KA 4H0XB 1HNIA 1GLAG 4AF1A 4IFVA 1IO2A 4B1XB 1VQLN 3TWHA 1TKZA 2HHHK 2GEMA 3O9TA 4ELUA 4FWKA 5BPMA 4A5AA 4IDHA 1R0AA 4BREA 2IVNA 3JSMA 1GLEG 4QS8A 2KFNA 1X1PA 1B92A 2OPRA 3DRSA 3QLHA 1C6VA 1RBVA 3L3VA 1IKVA 3D0PA 2NZTA 1BU6O 4M7XA 1XMQK 4ISEA 2JWKA 3LP2A 1VSHA 5EOYA 4O55A 2P51A 1HNWK 3OYHA 1CZ9A 3KZBA 5KTQA 2PBDA 3SUNA 4OX9K 3M8RA 4M3ZA 3WQUA 1XC9A 3IRXA 4C8KA 1ZBLA 4B1WB 4BRNA 5E26A 4B1ZA 2E2OA 4DLGA 4A57A 2KTQA 3AVJA 2WC9A 3H1VX 2VYPA 4B3TK 3LZJA 4B3MK 1GLLO 1HQUA 4ZTFA 4GNIA 1Q9YA 3QEPA 4NB4A 3B6OA 5DK5A 3AO2A 3IFRA 1SKRA 3K2PA 2YI1A 5JS2A 2O8DB 3K0SA 5HRRA 1VSKA 2VWJA 1KAZA 2NRVA 5HBMA 4CJWA 1ZBUA 4QOZB 4CGFA 3HP9A 3H1QA 1BO5O 2YHXA 3OYBA 4JI0K 1JLFA 3OYGA 3RTVA 3KLEA 1K8KB 1RT1A 3NFAA 3DRRA 3SPYA 5JLFA 1NG9A 1FKOA 2GUPA 2E6LA 4FW1A 1WSEA 4CJTA 1TYQB 3O3FA 1FKPA 1LWCA 5ADXA 4JKGB 2IGIA 3PX0A 3ULEB 2VWBA 2DFFA 2XY5A 1KQSM 1T7PA 3M5RA 3J7ZO 4B1YB 2YKMA 1N32K 5LJWA 2X6NA 1T6CA 1NK6A 3MMVA 3P4IA 3DLGA 3RMCA 1I39A 4M3WA 4FL9A 1BG3A 4Z4CA 2HMPA 3LALA 2UXCK 3F73A 3NVMA 4BC2A 2A41A 5AQOA 1LW2A 1NMNA 3CJAA 2W42A 4BR2A 2O4IA 4E0DA 3NAEA 4YHHK 3G6EN 1VQON 3ZX2A 2HHSA 4DSLA 3O4NA 3FLCO 4IWVA 3KWGA 2HBJA 3Q7BA 2KQ2A 2P9IB 5JMVA 4DU3A 4DV4K 1VQKN 2D0CA 4E7LA 3M8SA 4DR3K 1CLQA 3AGKA 3TANA 1W9HA 3ASMA 2D1KA 2BDPA 2P9PB 1YVUA 1TAQA 2YKNA 5AFUA 4FJNA 4L8RB 2IVPA 3V1OA 4QAGA 3AVHA 4YFUA 1U4BA 4JD2A 5LL6Z 1VQ7N 4BACA 3LDOA 1KLMA 1J5OA 4E7IA 4CZGA 4DCHA 5HRSA 4XIUA 2P9KB 3PIOL 2HW3A 2F7TA 4KB0A 4QS7A 1LAVA 4WCEL 1VSFA 4FLTA 3JAMO 2B5JA 1VQ4N 1WSHA 4NLBA 4A59A 4BR5A 4DTPA 3LANA 4IJNA 3WXMB 2A6AA 3TAPA 1WSGA 3L2VA 1IBLK 2GWJA 3ITHA 2FBYA 4FVMA 3VTHA 3MN6A 3VQPA 3O9RA 3C6UA 1KRPA 4ICLA 3ALYA 1J5EK 1TGOA 2FLOA 3D6RA 3TAGA 1RTDA 4NCGA 1YJNN 4DTSA 4IG0A 4QS9A 2X74A 3THWB 1RFQA 2JLEA 4H0YB 3HI0A 4W5QA 2OPSA 3MCPA 1QQMA 3UIQA 4CHQA 4A2BA 1L3TA 5FPNA 3RRGA 2YJEA 4G1QA 4E7HA 3SI6A 4WQ5C 3F5TA 5KPRA 4BRQA 2V52B 4GV9A 4DV7K 1HLUA 3L2UA 3D45A 3CC2N 2QEXN 3OJSA 4NLCA 3DJCA 1BL3A 3QDKA 3W0LA 4DR6K 2YV0X 2V7YA 5BPNA 4HCCA 2Y1IA 3PO5A 3I8BA 3HVRA 4FVUA 2ZJPL 3FZMA 2VGMA 2BTFA 2F9TA 3GBTA 5FPEA 4FK2A 4JYAK 4C8NA 4GKJK 3I8DA 1D9DA 4UQGA 1KVBA 3TABA 4CF2A 4JKCA 4DV3K 5HLFA 3MAQA 4GV3A 5C2FA 1HYVA 3HBTA 2O8EA 1WBDA 3SQ4A 4QCLA 3FZKA 2WOMA 3UKUB 5JLHA 1CXQA 1NK0A 4BRFA 1DKGD 4DSFA 3DXKA 4XH1A 3EN9A 2D0AA 4YNQA 4K41A 4M63C 5FROA 3NGZA 4Z4IA 3TAEA 2NRZA 4BC5A 2G8VA 2PAVA 4E7JA 3U6FA 3DLEA 4E19A 3ZSXA 3I0RA 3TI0A 4X65K 3M6GA 1GLBG 4NYNA 3THXA 1SKWA 1HUXA 2ITGA 1JLCA 3O6WA 4E1JA 1C0GA 3NBPA 3C6HA 1XHZA 3TTDA 1S9GA 4CZMA 2QW9A 3T69A 4CEAA 3QERA 3RR8A 3OJUA 3BZKA 1NGEA 4FWOA 2RN2A 4KBOA 4DQSA 3G10A 5ELZA 2XY7A 4CZFA 2B6AA 3ULEA 3E1YA 4JKGA 4BE1A 1EWQA 4PA1A 3VQEA 4DV1K 1KXPA 1RTHA 2ASPA 2GX9A 3OS2A 3OYLA 3BY5A 5KQDA 4KHWA 3T1HK 4JI5K 1QHAA 2IOCA 5AQIA 5GIOA 3KK3A 4DWIA 2YHWA 3O8MA 4CZLA 4FZYA 1NNEA 2HVIA 3QFPA 4B3RK 3OYIA 1A5XA 4DR5K 3SV3A 3BEXA 3THVA 3ZSOA 3CC7N 3EE8A 1HYSA 4JRQA 3CYMA 4H4OA 1K6YA 5AQRA 3I55N 1Q18A 4O0JA 4RW4A 1BDGA 3P1GA 5K14A 3KLGA 4CHPA 4IO8A 5M1FA 5B8HA 2RPIA 2FF6A 4FLUA 1BOTO 4FPAA 1ZBSA 1IBKK 1QS4A 4HHTA 4FLXA 1KFSA 5M1PA 2QXFA 3HSTB 4WFBL 4CHOA 4FW2A 3DWLA 1BQMA 1BIZA 3HYFA 1N33K 1TL3A 4H5RA 4CBWA 4BGBA 5MLCQ 3A5MC 3QEVA 3LPUA 1OVYA 4FXDA 1Q81O 4H5NA 2P9NA 4BE2A 2VGNA 4NYFA 4HCBA 2ZD1A 4BRAA 3CJ1A 1EKEA 3F2KA 3LM2A 1RT2A 4LFBK 4PKIA 5FDLA 2VG6A 2W6LA 2G8UA 2NRHA 3V1QA 1TAUA 4CEEA 3CFRA 5BN9A 2BUPA 1E3MA 3S41A 4O44A 1WSJA 3EL2A 1M90O 1TL1A 3WXKA 3T1YK 1X9JA 4JKDA 3R9PA 4B1VA 1W0HA 4KHYA 3CI5A 4H5TA 5HRPA 4CGGA 3SUOA 3OBYA 4KHQA 1JLAA 4DSKA 4LF9K 1XWLA 1ZBFA 2CH6A 4B1UB 1SV5A 4DQQA 4JHDA 4RW8A 3DXKB 1QE1A 3OHRA 1LWFA 3VETA 5JVHL 4DTJA 1S9EA 2XY8A 3QIOA 3VEYA 2UUCK 4G9ZA 1NGGA 5AQSA 3CCQN 3CG7A 1I94K 3PUFA 1SS6A 2E1ZA 2HF3A 4K0KK 1X9MA 3SPZA 3QB0A 3AA3A 3LWLA 4N41A 4ZHRA 3L4QA 3SBTA 2OTLN 2HHVA 4A62A 3DAWA 1L3UA 4DV5K 4CEZA 4CHYA 3H6EA 1QSLA 4JI3K 5GAEP 4EP5A 1JLEA 4OKKA 5C2DA 2AP1A 4JKEA 3KIOA 4BGAA 2FSKA 3G25A 3ZT1A 3G0ZA 5J2MA 1KVAA 3BDPA 5AQTA 3CERA 2ASMA 5EXWA 5IT9O 5LMUK 3AVIA 3T7ZA 4CI6A 2YNGA 1ITGA 1NWKA 3KTQA 1NLVA 3ATVA 3EKSA 4X64K 1KVCA 2OPPA 4Z94A 1EQYA 3IUCA 4JK9A 3ZEUB 3B6PA 3MK6A 3ZEUA 2P9NB 3RRHA 4NO7A 1YTUA 1SUQA 5TKWA 2AJQA 1LWEA 4CJRA 1HKCA 4J2BA 3TTFA 1L3SA 1SAZA 4CJUA 3KD5E 4O5FA 2IVOA 3VEZA 3CJ7A 3NH0A 4DLEA 4BDYA 3TAQA 1REVA 3LDQA 4YOUA 1C1CA 4CJLA 3RR7A 2ZF5O 3AA2A 1VAZA 1DTQA 3A2FA 4BR9A 4EAHD 3A5LC 1D4XA 4IJAA 1BA0A 3QBXA 4DG1A 4Z4HA 4CESA 1VSIA 5F0XA 4K43A 3MEEA 3UB5A 4KPYA 4JI7K 3AVLA 4CCHA 3V81A 4OLAA 4WQ5A 5HRNA 2UU9K 1VQ6N 4I2PA 1J54A 3A5NC 1JLQA 3FZHA 4H0VB 3WEEA 3HRGA 3A8YA 4WFAL 3SYZA 1ASWA 4CF9A 4DR4K 4FWRA 1HR0K 4I2QA 1ZBIA 4LF5K 4B9UA 4M3UA 2VG5A 2E2QA 2HNDA 4GY2B 3DMJA 3LP3A 3P39A 1YVNA 2FBVA 4KI6A 3CETA 1UA0A 4MO5A 1T3VA 3THYA 4E1MA 4OPHA 2PYLA 4CGIA 3BP8A 3SUPA 2O8DA 2VG7A 1QHTA 1IG9A 4CBUA 4PUOA 4ID5A 3LP0A 2VQEK 4DQRA 4XH4A 3EZWA 1A5VA 4H4MA 3O3GA 4DS5A 3VGMA 3J80O 1VQPN 4CZIA 4CK3A 2W40A 3BZCA 1ASUA 1VQMN 1OH7A 4H0PA 3M3ZA 2WONA 4O0IA 3ZSQA 4DFMA 4AQYK 2F8SA 3U9ZA 2NUBA 3DLHA 3FFKB 1T44A 2D4WA 3GDQA 5EY4A 1RT3A 2I7PA 3MXMA
chains in the Genus database with same CATH topology
3PIOL 3O9SA 2F7TA 3VF2A 3MCAB 4FSVA 3P38A 2CH5A 4QS7A 4IEEA 3D2FB 4WCEL 2P9LB 2WUSA 2QA4N 3O08A 4ILJA 3CJCA 3L4IA 5AZIB 2ITMA 3TSPA 5M1KA 5KPTA 3A0IX 4AM6A 2QI2A 4C1NI 1GLJO 1VQ4N 2CGLA 3AAQA 3MN9A 1K73O 4NLBA 4A59A 4BR5A 4U7BA 1V4SA 4JK8A 3ZX0A 4BY9C 5EVZA 3L0QA 5AQFA 4IJNA 1KD1O 1LCUA 3DXMA 3VF4A 3R8EA 3WXMB 2A6AA 1RDWX 2GELA 2YCHA 3EKUA 3FZLA 4JAXA 4O8KA 3VERA 4BC4A 1K8KA 2IIRA 4BG9A 3O4WA 2GWJA 5HL7L 5GAGP 5DM6L 1P90A 4Y0WA 3ZETA 3JXUA 3VTHA 3MN6A 4XH5A 5F2RA 1HPMA 3O9RA 2I7NA 3CPWM 5FPMA 4BQLA 4H0TB 2FLOA 1HJOA 3D6RA 3E9LA 3SJHA 3AARA 2HF4A 1YJNN 1TYQA 5EX5A 4QS9A 3CJBA 4GVEA 3ENOA 3C7NB 2P9PA 1RFQA 1NGFA 3ATUA 3HI0A 4H0YB 5AR0A 3MCPA 1ATNA 1QQMA 4PL8A 5GINA 3TPQA 4A2BA 5FPNA 4K25A 1ZC6A 2YJEA 4KH4A 4C23A 3WT0A 4IO9L 3CIPA 3F5TA 1C0FA 4WQ5C 5KPRA 5GIPA 4BRQA 2ZGYA 1QQOA 5TKYA 3PIPL 3CJ9A 5JICA 2V52B 4GV9A 4C1NK 2P9LA 2VCPA 1HLUA 3WQTA 5JVGL 1E4GT 2Q31A 1NBWA 2QM1A 3CC2N 1DGKN 2QEXN 4NLCA 3DJCA 3QDKA 3W0LA 4PHTX 4XEIA 3SMSA 2E88A 3B8AX 1NGJA 2V7YA 5BREA 3SAGA 5BPNA 2RE2A 3I8BA 1X3NA 1YXQA 4FVUA 3CCLN 1U2VA 2ZJPL 1CZAN 3FZMA 2VGMA 2BTFA 2F9TA 2Q2RA 3GBTA 5FPEA 1HX1A 4JN4A 4A5BA 4EHTA 1TUYA 4WQ4A 5M1QA 3H3NO 4YOVA 3UKRA 4EHUA 1TUUA 3BF1A 4JKCA 3IDHA 3CXCM 2HOEA 3DLLL 2YX6A 4GV3A 4J8FA 3EO3A 5C2FA 2P9SB 4WFNL 3ENBA 4H5VA 3HBTA 1QQNA 2P9SA 3E66A 3IKMA 2E8AA 4ILGB 2DPNA 3FZKA 4OPAA 4WQ4C 1MA9B 3M1FA 3GL1A 3UKUB 4A2AA 5BR9A 5JLHA 3MX2A 1DKGD 4BRFA 4JD2B 4MDBA 3DXKA 3KWIA 3H46O 4XH1A 3EN9A 4BRMA 1ZXOA 4K41A 1NJIO 4M63C 3QMLA 4JKHA 5AQZA 2NRZA 4BC5A 2PAVA 3WEEB 4EIAA 4IOCL 2RHKA 1VQ5N 2KKZA 3CQYA 1ATSA 3BUZB 5LJVA 4RCHA 4YOXA 4FWSA 3RSEB 2V7ZA 4HWIA 1Q86O 2QWNA 5GAHP 3HOSA 3VMFB 1YUWA 3O5BA 3FGUA 4O8UA 4DB3A 3M6GA 3OA9A 4CZKA 1GLBG 3HSCA 4RWTA 1Y64A 2JWLA 2QWQA 3ID8A 5BRDA 1HUXA 1SQKA 4CBXA 2Q97A 3EE9A 3HM8A 1O13A 3O6WA 2H3GX 4E1JA 4GV6A 3BF3A 4IXCA 1C0GA 3C6HA 4U67L 3VEVA 2FSNA 3TTDA 5BN8A 1JCGA 4DQ8A 1VQ9N 3KVGA 2CGJA 3ZX3A 2QW9A 4CZMA 3A5OC 3T69A 1NGEA 4FWOA 2WFBA 4KBOA 4H5WA 4DHYA 4BRGA 1NM1A 3LDPA 4BC3A 5ELZA 4FOIA 4CZFA 3ULEA 3CCEN 3E1YA 5M1OA 4JKGA 5C0YA 4MLHA 4PKHA 5HOOA 1YJ9N 3VGLA 5AQJA 1KXPA 2ASPA 2GX9A 2Q36A 1YF5L 4IZ9A 3QBWA 5KQDA 4FPBA 4IEIA 3VESA 1QHAA 3CMAN 1DEJA 3SAFA 5AQIA 4WYBA 5GIOA 5BRHA 3I33A 5AQWA 3C6AA 1YAGA 3C65A 2YHWA 3O8MA 1GLFO 5AQXA 4CZLA 2YJFA 3FZFA 3QFPA 1S3XA 3MDQA 4JKFA 3VF6A 4YOWA 5C15A 4BRLA 2ASOA 3BEXA 4FWLA 4FWPA 2W41A 3VENA 4BRHA 3W3DA 1H1VA 3CC7N 4IOXA 3CD6N 3EE8A 3C0BA 3O9QA 3TU5A 5DM7L 3CCMN 1KC8O 3ZYYX 3SLCA 2QTDA 4ISGA 2Q0RA 5AZJA 1IG8A 2FF3B 2Q1NA 5AQRA 3CCUN 1QVFM 2FSJA 4YOYA 3I55N 1Q18A 1BDGA 1QZ6A 5M1FA 4IO8A 1S22A 3SK3A 5B8HA 2FF6A 3ZETB 2NRTA 1BOTO 4FPAA 2OANA 1Z05A 1ZBSA 2KHOA 4FWMA 1W97L 2P9IA 5M1PA 1XUPO 2NRXA 3WUHA 3FR0A 3WXLA 4IFEA 1BUPA 3TTCA 1JJ2M 2AA4A 2FXUA 4BVPA 4WFBL 4BRCA 3P31A 3C7NA 2F9WA 1QVGM 3DWLA 5FPDA 3ID6A 5AQPA 3SAHA 3HZ6A 3MN7A 3H3OB 5KPZA 2NNWA 2PFUA 3VTIA 1K8AO 4H5RA 3MWPA 5AQNA 4CBWA 2QWPA 4BGBA 5MLCQ 4BR7A 2QWOA 3A5MC 3O1WA 1OVYA 3GOIA 1V4TA 5AQHA 1S72N 1Q81O 2A3ZA 1NGHA 4H5NA 1Z6RA 2P9NA 2ZJRL 1VQ8N 2VGNA 1KAYA 3N4QA 4H0OA 4BRAA 3CJ1A 3RSEA 3VGKA 2E2PA 3F2KA 3LM2A 1ILYA 3GG4A 1YJWN 1WOQA 4PKIA 5AQGA 3VEOA 3AGRA 2NRHA 1G99A 4DKWA 3CCVN 1YIJN 2ZJQL 4YDUA 1NMDA 5BN9A 1XC3A 2BUPA 3CHWA 3G71N 3S41A 2A42A 5I9EB 3N4PA 4PKGA 3EL2A 2ZGZA 1M90O 5BRFA 3WXKA 1U6ZA 1X9JA 4JKDA 3R9PA 4B1VA 4BVOA 3GE1A 3WXIA 5AFUH 2QWRA 3CI5A 4R79A 1JCFA 3U9DA 4H5TA 5AQQA 4FO0A 3CCSN 4MLEA 2GTDA 5F1XA 3OW2M 3OBYA 3CQXA 3LDNA 4MDAA 3MWTA 3D7EO 4BQZA 3FE1A 2CH6A 1T6DA 4B1UB 3O9UA 4F9OA 1K9MO 2D0OA 1MDUB 1KAXA 1OKJA 1SZ2A 4JHDA 1EO1A 3K9KA 3IMXA 4H0XB 3DXKB 1GLAG 3OHRA 3WXJA 4AF1A 4B1XB 1VQLN 3VETA 5JVHL 5AQMA 3NMUA 3PLAA 3HOTA 3VEYA 2D0PA 4G9ZA 1NGGA 2HBKA 2GEMA 2HBLA 3Q7CA 3E9OA 5AQSA 3CCQN 3O9TA 1SS6A 2E1ZA 4FWKA 4CJ7A 4A5AA 5BPMA 4IDHA 2HF3A 4BRIA 2HSTA 4BREA 2IVNA 2YHYA 3LM9A 3U8XA 5E84A 3QB0A 1GLEG 4QS8A 4IOAL 2BH1A 3F9MA 3L4QA 1RDUA 5CE3A 3SBTA 4ISFA 1X3MA 5KQ8A 2OTLN 2NZTA 3DAWA 4A62A 1BU6O 4JEPA 2V51B 4M7XA 1W2BM 4OO1J 3H6EA 4JKBA 5GAEP 1GLCG 5AZJB 1HKGA 2HBMA 4ISEA 2JWKA 3H45C 3LL3A 5C2DA 1GLDG 2AP1A 1YITN 4JKEA 4BGAA 2FSKA 2E2NA 3G25A 1E4FT 5EOYA 3CCJN 3JS6A 3VEXA 5AQTA 3CMEN 3CERA 2ASMA 5EXWA 4BR0A 3KZBA 1Q7YO 2QWLA 2PBDA 1LOTB 3T7ZA 4CI6A 3G4SN 1N8RO 1ATRA 2OTJN 4RTFD 1NWKA 4BROA 1J6ZA 1RGIA 1NLVA 3ATVA 3TSQA 3WQUA 3EKSA 4Z94A 5CR4A 1EQYA 5E26A 3J8AA 4B1ZA 4B1WB 2E2OA 4BRNA 3VOVA 3HTVA 2QWMA 3IUCA 3QFUA 4JK9A 4A57A 1YI2N 3MN5A 2QXLA 3ZEUB 4BRKA 2E20A 1VQNN 3MK6A 3ZEUA 2WC9A 3H1VX 2P9NB 2UYTA 4H03B 2VYPA 4I6MB 4NO7A 4BR4A 2NLXA 1GLLO 4LC9B 4I6MA 5TKWA 3L6QA 4GNIA 4HTLA 5AZIA 1MWKA 1HKCA 3UE5A 3TTFA 1R59O 4NB4A 1NGDA 4CZHA 1SAZA 4A61A 4EFHA 3IFRA 2E1YA 4O5FA 2IVOA 3VEZA 3CJ7A 2YI1A 4B9QA 5LY3A 4YORA 3LDQA 4YOUA 1KAZA 2NRVA 2ZWHA 4KH5A 4BRDA 1U2VB 5AQLA 3O80A 1BWFO 3R6MA 3H1QA 3RVCA 4BG8A 2ZF5O 1BO5O 5BPLA 2YHXA 1VAZA 4BR9A 1P8ZA 3SMPA 1ESVA 4EAHD 4JNEA 1K8KB 4K42A 3ENHA 3A5LC 3AY9A 1D4XA 5JLFA 4IJAA 2Q0UA 2GUPA 3I56N 1BA0A 3QBXA 3KHYA 4YOTA 1TYQB 4KH6A 1BA1A 4JKAA 4M7YA 4K43A 5F0XA 1XQSC 4JKGB 3VPZA 2A5XA 5ADXA 4L3QA 3UB5A 3AAPA 3CPEA 3U4LA 3ULEB 2VWBA 3CF5L 1NGCA 2NRWA 3R1XA 4JK7A 3NVKA 4WQ5A 1KQSM 1VQ6N 1NGAA 5C12A 3M5RA 5M1NA 3J7ZO 3SBGA 4B1YB 3A5NC 3D2EB 3FZHA 4H0VB 5LJWA 1T6CA 3WEEA 1Q82O 3HRGA 3A8YA 3MMVA 3P4IA 3VEWA 2GWKA 4PL7A 4WFAL 1MWMA 4YDUC 4FWRA 2P9KA 3D2FA 4FWQA 4FL9A 1BG3A 1QZ5A 3TSUA 2E2QA 1DT9A 2HMPA 3O1BA 4GY2B 2J4RA 5CHIA 3P39A 1YVNA 5GADP 3CCRN 3CETA 2P9UB 1M1KO 2NRRA 3NVMA 4MO5A 4MO4A 2A41A 4BC2A 5AQOA 4CD3A 2P9UA 1T3VA 3OBWA 3CJAA 4OPHA 4CD1A 4BR2A 3BP8A 3G6EN 4CBUA 3DXMB 1WUAA 1VQON 3ZX2A 5H1SQ 4ILHA 4XH4A 3EZWA 3FLCO 4IWVA 3VGMA 1VQPN 1IJJA 3KWGA 4CZIA 2HBJA 5AQYA 3Q7BA 2P9IB 5JMVA 2W40A 5AQKA 1NGBA 1VQKN 1VQMN 2KLAA 3QICA 2CGKA 3CC4N 3UKRB 3R3LA 4CZEA 4FWNA 4H0PA 3M3ZA 5ADXH 4AM7A 3E9PA 3AGKA 4FOEA 4JHDB 5AQUA 5C10A 2A40A 3UKUA 1NGIA 2D1KA 4CZJA 3MX5A 2EWSA 3U9ZA 2P9PB 3LDLA 2WBNA 5AQVA 1JCEA 5AFUA 4WF9L 4UY8O 2IVPA 3FFKB 1HKBA 1T44A 2D4WA 1YHQN 4JD2A 1VQ7N 3GDQA 5EY4A 3KK7A 2I7PA 3LDOA 3D2EA 4CZGA 4BRPA 3K9JA 4DCHA 2P9KB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TKW A;  1W97 L;  4PHT X;  1YF5 L;  2BH1 A; 
#chains in the Genus database with same CATH topology
 5LMN K;  3O9S A;  3VF2 A;  3OVN A;  4BDP A;  3P38 A;  2CH5 A;  4CIF A;  2WUS A;  4B3S K;  1TK0 A;  5AZI B;  2ITM A;  4CJ5 A;  1U48 A;  3TSP A;  2XHB A;  1VHX A;  4CJK A;  1GLJ O;  4CGJ A;  4U7B A;  4BY9 C;  2JGU A;  3L0Q A;  1LCU A;  3HP6 A;  3NE6 A;  4FM0 A;  1RDW X;  2GEL A;  3M8Q A;  2IIR A;  5DM6 L;  4NCA A;  4Y0W A;  4LH5 A;  3JXU A;  5F2R A;  1IKY A;  3CPW M;  3M8P A;  2HNY A;  3V9S A;  4LFA K;  2HF4 A;  3CJB A;  4GVE A;  1N6Q A;  3WNG A;  3AVK A;  1Z25 A;  3DRP A;  3WNH A;  5GIN A;  1IBM K;  4I9Q A;  4CFA A;  2OA8 A;  3NDK A;  4KH4 A;  4C23 A;  4CJF A;  4IO9 L;  3AO1 A;  1J53 A;  1QQO A;  1NK7 A;  4GKK K;  3RWU A;  3AVB A;  4C1N K;  2P9L A;  5JVG L;  1E4G T;  2Q31 A;  2QM1 A;  3VA3 A;  5KGW A;  4MQ3 A;  1VSJ A;  3ZSW A;  2E88 A;  3B8A X;  3SAG A;  3TAF A;  1N34 K;  2O8B B;  1IH7 A;  2RE2 A;  3JYT A;  1YXQ A;  1RT4 A;  4N76 A;  3IS9 A;  5AJ3 K;  5C25 A;  2Q2R A;  1QSS A;  4A5B A;  5M1Q A;  3H3N O;  4YOV A;  3UKR A;  3K57 A;  4FYD A;  3MXI A;  3CXC M;  2HOE A;  3QO9 A;  2P9S B;  3RMD A;  4DQI A;  2DPN A;  1OH8 A;  1MA9 B;  3M1F A;  4DV6 K;  5BR9 A;  3MX2 A;  2IC3 A;  2Q3S A;  4AHS A;  3H46 O;  1ZXO A;  1NJI O;  3NH2 A;  5IWA K;  4RW9 A;  1Z26 A;  3WNE A;  5FRM A;  3WEE B;  4IOC L;  2RHK A;  1L5U A;  2E4L A;  1VQ5 N;  3CQY A;  1ATS A;  5LJV A;  4RCH A;  1KSP A;  4CED A;  4FWS A;  3RSE B;  2V7Z A;  1Q86 O;  3HOS A;  1YUW A;  3O5B A;  4CHN A;  3FGU A;  4O8U A;  4AHV A;  4DB3 A;  3KK1 A;  1NK8 A;  2JWL A;  1OVQ A;  3ID8 A;  3SNN A;  5BRD A;  1NKC A;  4J2D A;  3ULD A;  1U45 A;  4U67 L;  3VEV A;  2FSN A;  1JCG A;  4DQ8 A;  4OPJ A;  3ZX3 A;  4OLB A;  5SWM A;  3DLR A;  1S1V A;  4AHT A;  2UXD K;  1RDC A;  4H5W A;  3LDP A;  5CY4 A;  4FOI A;  2DTU A;  1JXB A;  3IG1 A;  4IG3 A;  2P5G A;  4DUY K;  1NU0 A;  2Q36 A;  4CW7 B;  1YF5 L;  3QES A;  3VES A;  1GOC A;  5CYQ A;  3CMA N;  3AVF A;  1DEJ A;  4CEQ A;  1VSL A;  2F4V K;  5BRH A;  3I33 A;  1NKE A;  5AQW A;  1HPZ A;  3O4Q A;  1GLF O;  5AQX A;  3LAK A;  4JKF A;  3MDQ A;  5C15 A;  1G15 A;  3VQ5 A;  4FWP A;  2W41 A;  4OGC A;  4IOX A;  3WNF A;  5SZT A;  3CCM N;  4K8Z A;  1KC8 O;  1S6Q A;  3SLC A;  2QTD A;  1TVR A;  1QVF M;  2Z1H A;  1QZ6 A;  3NGY A;  3ZET B;  2NRT A;  3AVN A;  2OAN A;  1Z05 A;  4CK2 A;  5KRT A;  3SV4 A;  2OZS A;  1QSY A;  1JKH A;  3HM9 A;  1XUP O;  3NGI A;  3SJJ A;  3WXL A;  3OS1 A;  1BUP A;  2AA4 A;  4BRC A;  2YHA A;  5FPD A;  3ID6 A;  5AQP A;  3SAH A;  3SUQ A;  3HZ6 A;  3MN7 A;  2PFU A;  1HMV A;  3MWP A;  5AQN A;  3QEX A;  3ZT3 A;  4BR7 A;  3O1W A;  4CIG A;  2O8C B;  5AQH A;  3SZ2 A;  3N4Q A;  2ETJ A;  4FLW A;  1RCH A;  3VGK A;  2FC0 A;  2E2P A;  1U47 A;  3QEW A;  4KTQ A;  1ILY A;  1YJW N;  2YNH A;  3S3M A;  3VEO A;  3CCV N;  4B3O A;  1NMD A;  1XC3 A;  3G71 N;  1WLJ A;  4DFK A;  3CFP A;  4DU1 A;  2KZZ A;  5I9E B;  3N4P A;  5BRF A;  1U6Z A;  4LSL A;  5HRO A;  1JCF A;  3U9D A;  4FO0 A;  1UA1 A;  1RNH A;  2GTD A;  5F1X A;  3OW2 M;  4E1N A;  5J2N A;  3QNN A;  3LDN A;  4MDA A;  4NXN K;  3L8B A;  4LH4 A;  3VQ6 A;  1K9M O;  2D0O A;  2D0B A;  1KAX A;  1OKJ A;  4OPK A;  1EO1 A;  4IDK A;  3WXJ A;  3ZSZ A;  5E41 A;  5AQM A;  3O3H A;  3HOT A;  1HNZ K;  2HBK A;  3QIP A;  2HBL A;  4BRI A;  2HST A;  3LM9 A;  3U8X A;  5E84 A;  1S1W A;  3HO1 A;  2BH1 A;  4DSJ A;  1RDU A;  4KKO A;  1ASV A;  1IKW A;  2DY4 A;  4ISF A;  1X3M A;  5KQ8 A;  3TAM A;  3ZSR A;  4RW7 A;  4M3Y A;  4Z4F A;  1GLC G;  1HKG A;  1TKX A;  1JXE A;  3NF8 A;  4AHC A;  1GLD G;  2QKK A;  4DTX A;  1KCF A;  1HYZ A;  3JS6 A;  3VEX A;  3DYA A;  3CME N;  1Q7Y O;  4CEO A;  1LOT B;  1RBS A;  5CZ2 A;  2HHW A;  1ATR A;  3THW A;  4E3S A;  3CM6 A;  1A5W A;  3TSQ A;  3T3F A;  3DLB A;  4DV2 K;  5CR4 A;  3J8A A;  4B9V A;  3HTV A;  2QWM A;  3QFU A;  1YI2 N;  2O8C A;  2E20 A;  1VQN N;  2UYT A;  4I6M B;  4RW6 A;  4BR4 A;  4N47 A;  4LC9 B;  4FZZ A;  3L6Q A;  4LD0 A;  4HTL A;  1C1B A;  1NOY A;  5AZI A;  3V4I A;  1MWK A;  4KHU A;  1R59 O;  4A61 A;  4EFH A;  2E1Y A;  4FJ5 A;  4HVJ A;  5LY3 A;  4F4K A;  2VQF K;  4NCB A;  4BRD A;  2O8B A;  4OJR A;  1BWF O;  3K59 A;  3RVC A;  3ISN C;  4BG8 A;  5BPL A;  4DR1 K;  1S1T A;  4F3T A;  4FJJ A;  3SMP A;  1ESV A;  4LF4 K;  2X78 A;  3AO5 A;  4K42 A;  3ENH A;  5CYM A;  3AY9 A;  4LFC K;  4DR2 K;  3P83 D;  4KI4 A;  1Q8I A;  2O8E B;  3VQ4 A;  1KTQ A;  4L3Q A;  1QQC A;  1EX4 A;  2PYJ A;  3DM2 A;  4B9S A;  2YHB A;  4JK7 A;  3NVK A;  1B9F A;  5M1N A;  3SBG A;  4KTW A;  3OTO K;  3D2E B;  2UXB K;  4KTZ A;  1N5Y A;  1MWM A;  3D2F A;  4O5B A;  3O1B A;  2XO7 A;  2HHQ A;  3EZ5 A;  5CHI A;  1ZBH A;  5GAD P;  3QNO A;  4MO4 A;  2G8K A;  4JI4 K;  3LWM A;  3OYN A;  1Y97 A;  3KK2 A;  1XI1 A;  1BQN A;  3DXM B;  4HUE A;  4OKE A;  5H1S Q;  4ILH A;  1BCO A;  1TKD A;  3OYA A;  2G8H A;  1RT5 A;  5T7B A;  1VRT A;  3PSF A;  1IJJ A;  3FFI A;  5AQY A;  1NGB A;  2XRI A;  1NJX A;  2KLA A;  5KGX A;  4CFC A;  4KB1 A;  4CJV A;  2CGK A;  3UKR B;  1I3A A;  4FWN A;  5ADX H;  1U49 A;  2E6M A;  4JHD B;  5C10 A;  1EWR A;  5AQU A;  2A40 A;  3UKU A;  4CZJ A;  3NF7 A;  4W5T A;  2EWS A;  1NJW A;  4ELT A;  5AQV A;  1JCE A;  4FLY A;  4UY8 O;  4WF9 L;  1SKS A;  4M3T A;  3SQ2 A;  1HKB A;  3K5N A;  3D2E A;  4H8K A;  5J2Q A;  1SL2 A;  4FSV A;  2KW4 A;  4CFB A;  2P9L B;  3CJC A;  5M1K A;  5KPT A;  4K8X A;  4BDZ A;  4AM6 A;  2QI2 A;  4C1N I;  3K58 A;  4KRF A;  3AAQ A;  3MN9 A;  1K73 O;  4PWD A;  4DMN A;  1V4S A;  4JK8 A;  3ZX0 A;  1KD1 O;  4CJE A;  3S9H A;  3VF4 A;  3DOK A;  3BGR A;  4M45 A;  2YCH A;  4JAX A;  4O8K A;  3FZL A;  4BC4 A;  1K8K A;  3AV9 A;  1MU2 A;  4BG9 A;  4CJS A;  1GOA A;  1D5A A;  4M41 A;  3LDS A;  4BQL A;  1TYQ A;  5EX5 A;  3ENO A;  1D9F A;  2P9P A;  1NGF A;  3ATU A;  5AR0 A;  1XNR K;  4PL8 A;  4K25 A;  1ZC6 A;  4BE0 A;  3CIP A;  3TAR A;  3ZSY A;  4KV8 A;  3OY9 A;  2VCP A;  1C0U A;  1FW6 A;  4CHZ A;  3WQT A;  1QTM A;  1DGK N;  4J2E A;  4XEI A;  3HPO A;  3SMS A;  4FJL A;  2KFZ A;  1X3N A;  1NJY A;  1U2V A;  1WN7 A;  1HNX K;  1CZA N;  5J1E A;  4DQP A;  4AIL C;  1CXU A;  2P5O A;  4CJ4 A;  2HHT A;  1TUY A;  4KHS A;  4EHU A;  1TUU A;  3DLL L;  3VQC A;  1LAW A;  1LW0 A;  3EO3 A;  4KFB A;  3ENB A;  4H5V A;  1QQN A;  2P9S A;  3E66 A;  3IKM A;  2LSN A;  3GL1 A;  2O8F A;  4A2A A;  5CZ1 A;  4F3O A;  1FXX A;  3KWI A;  4JI2 K;  3ZT4 A;  4BRM A;  3SCX A;  2RF2 A;  1B9D A;  4DV0 K;  5AQZ A;  2OCE A;  4YOX A;  4IBN A;  4HWI A;  1RDB A;  4BWM A;  2I5J A;  5GAH P;  3VMF B;  3OA9 A;  3HSC A;  4M3X A;  4RWT A;  3LAM A;  3CM5 A;  3MEC A;  4CJP A;  1SQK A;  4CBX A;  3EE9 A;  5BR8 K;  3HM8 A;  2KZM A;  3K5M A;  4GV6 A;  2O4G A;  2FBT A;  1BHL A;  4FJM A;  4FK0 A;  3KJV A;  1VQ9 N;  5JS1 A;  3E01 A;  2UUB K;  2WFB A;  4DHY A;  1X9S A;  4BC3 A;  3C6T A;  4DTU A;  3U3Y A;  3VA0 A;  5M1O A;  3K5O A;  4FZX C;  5HOO A;  3VGL A;  5AQJ A;  4F8R A;  5I42 A;  4IZ9 A;  3QBW A;  4FPB A;  1LV5 A;  1RDA A;  4WYB A;  3QIN A;  1J9A A;  4OKJ A;  4M42 A;  3C6A A;  4PY5 A;  2WTU A;  4CJ3 A;  4J2A A;  3FZF A;  3OYM A;  1S3X A;  4FK4 A;  3VF6 A;  4V19 S;  4YOW A;  3J81 O;  2ASO A;  4FWL A;  3MED A;  4BRH A;  4CER A;  3T19 A;  4DUZ K;  1HNV A;  3C0B A;  3TU5 A;  5DM7 L;  3ZYY X;  1RTI A;  4CK1 A;  5AZJ A;  3HK2 A;  1C0M A;  3AO3 A;  1BIU A;  3OYJ A;  2HMI A;  2KHO A;  4B9N A;  2IS3 A;  2P9I A;  3V1R A;  1BGX T;  2NRX A;  3FR0 A;  2EX3 A;  1JJ2 M;  1QVG M;  4BVP A;  3P31 A;  3C7N A;  2F9W A;  2QKB A;  1VK0 A;  2HNZ A;  4W5R A;  3LPT A;  4TSX A;  4DTR A;  2O8F B;  5KPZ A;  1O1W A;  4EP4 A;  3MEG A;  3J7Y P;  1RBR A;  4HUG A;  1S72 N;  2G8I A;  3MXJ A;  2A3Z A;  1NGH A;  2GUI A;  1RDD A;  1KAY A;  2IAJ A;  1NKB A;  4E89 A;  3VQ8 A;  3DI6 A;  3GG4 A;  4Z0U A;  4B8A B;  3V9U A;  5AQG A;  3AGR A;  2UUA K;  4DKW A;  1G99 A;  1UAX A;  4ID1 A;  1YIJ N;  4W5N A;  3V6D A;  3V9W A;  2HB5 A;  3CHW A;  4JLH A;  3QEI A;  2PZS A;  2A42 A;  3J7A P;  1RBT A;  3HVT A;  1JL2 A;  3OYF A;  4HTU A;  3KD1 E;  4DSI A;  2HVH A;  3OYD A;  3WXI A;  1T03 A;  4Q0B A;  5AFU H;  4R79 A;  5EU7 A;  3CCS N;  1HRH A;  4BQZ A;  1S5J A;  3PX4 A;  2P1J A;  1T6D A;  4CGH A;  3O9U A;  4F9O A;  1MDU B;  1TKT A;  1SZ2 A;  3HPG A;  3IMX A;  3ZSV A;  4CIE A;  3NMU A;  1HJR A;  3PLA A;  2D0P A;  3CFO A;  2D5R A;  3Q7C A;  3E9O A;  4CF1 A;  1C1A A;  3H08 A;  4HUF A;  4KHP K;  1S1X A;  4CJ7 A;  3QET A;  2YHY A;  2ZQB A;  3AVA A;  3LZI A;  4JI6 K;  1T8E A;  4IOA L;  3F9M A;  4C8L A;  1WNS A;  5CE3 A;  1TV6 A;  3PY8 A;  2EHG A;  4FJX A;  4DTM A;  1S6P A;  4JEP A;  2V51 B;  1W2B M;  4OO1 J;  1W7A A;  2FBX A;  5C24 A;  4IKF A;  4JKB A;  3CQ8 A;  3NF9 A;  5AZJ B;  2HBM A;  4IFY A;  3H45 C;  3LL3 A;  1YIT N;  4DTO A;  3DLK A;  1E4F T;  2OPQ A;  2B4J A;  3CCJ N;  1WAJ A;  4CJQ A;  3VQ9 A;  2G8W A;  4BR0 A;  4DF8 A;  4B9T A;  2QWL A;  4DFJ A;  1RIL A;  3HL8 A;  3G4S N;  1N8R O;  2OTJ N;  1FK9 A;  4RTF D;  4BRO A;  1J6Z A;  1RGI A;  1RBU A;  1SL1 A;  1JLB A;  3VOV A;  3MN5 A;  2QXL A;  4BRK A;  2W6K A;  1BI4 B;  4GVM A;  5KRS A;  4H03 B;  3NF6 A;  4JS5 A;  2NLX A;  3K5L A;  4I6M A;  3ZCM A;  4M3R A;  3EY1 A;  3UE5 A;  1N36 K;  1NGD A;  1YT3 A;  4CZH A;  1BCM A;  3ZT0 A;  3PV8 A;  4Y1C A;  4X62 K;  4B9Q A;  4YOR A;  1CZB A;  4FLV A;  4LF6 K;  2ZWH A;  4KH5 A;  3AVM A;  4FLZ A;  1U2V B;  5AQL A;  5HP1 A;  3O80 A;  4BWJ A;  4AH9 A;  3R6M A;  4FM2 A;  2OYQ A;  4CEB A;  1Q9X A;  3AVG A;  1P8Z A;  3AA4 A;  4JNE A;  3PX6 A;  3P5J A;  2Q0U A;  1S1U A;  4YOT A;  3I56 N;  3KHY A;  3PSI A;  4KH6 A;  1NK9 A;  1BA1 A;  4JKA A;  4M7Y A;  1BIS A;  1XQS C;  3VPZ A;  2A5X A;  4C8O A;  1F21 A;  3AAP A;  3CPE A;  3U4L A;  3SQ0 A;  1TK5 A;  3CF5 L;  1NGC A;  2NRW A;  3R1X A;  4NXM K;  4FJ7 A;  1NGA A;  3VQD A;  5C12 A;  1HQE A;  4I9L A;  1T05 A;  3HJF A;  3RMB A;  4JS4 A;  3DOL A;  1Q82 O;  2OZM A;  3VEW A;  2GWK A;  4PL7 A;  4YDU C;  2P9K A;  4FWQ A;  3VQB A;  1QZ5 A;  3HXM A;  1JLG A;  3TSU A;  3ZLJ A;  1DT9 A;  2J4R A;  3CCR N;  4OVL A;  4JI1 K;  3VQ7 A;  1M1K O;  2P9U B;  2NRR A;  1DLO A;  4CD3 A;  2P9U A;  3OBW A;  3VQA A;  4CD1 A;  3SQ1 A;  3S3O A;  2BGG A;  1WUA A;  2ATQ A;  2HHU A;  3V9X A;  5AQK A;  5C42 A;  3S3N A;  3QIC A;  3CC4 N;  2X6S A;  3R3L A;  4CZE A;  1WB9 A;  4X66 K;  3AO4 A;  4AM7 A;  3VQQ A;  3E9P A;  4FOE A;  4DSE A;  4DR7 K;  4FM1 A;  1NGI A;  1EXQ A;  3MX5 A;  4Z4E A;  3LDL A;  2WBN A;  1WSF A;  1BI4 A;  1YHQ N;  4N56 A;  3KK7 A;  4BRP A;  3K9J A;  2E2N A;  3NHG A;  3MCA B;  4C8M A;  4IEE A;  3D2F B;  4Y1D A;  2QA4 N;  4DFP A;  3O08 A;  4ILJ A;  3L4I A;  4O4G A;  3THX B;  3A0I X;  2ZE2 A;  2CGL A;  4LF7 K;  1U04 A;  1C0T A;  5EVZ A;  5AQF A;  1RTJ A;  3DXM A;  3R8E A;  3CCE N;  3EKU A;  3VER A;  4KHN A;  5HL7 L;  3O4W A;  5GAG P;  3I0S A;  1P90 A;  3ZET A;  4XH5 A;  4CF0 A;  1HPM A;  5D3G A;  2I7N A;  2BE2 A;  5FPM A;  4H0T B;  1HJO A;  3E9L A;  3SJH A;  3IAY A;  3AAR A;  3HPH A;  1NK4 A;  3T1A A;  5FLX O;  3C7N B;  1FJG K;  3RMA A;  3V9Z A;  1OH6 A;  1D8Y A;  1ATN A;  3EYZ A;  3TPQ A;  4CVN E;  3WT0 A;  1NK5 A;  4DF4 A;  4LY7 A;  1C0F A;  5KI6 A;  4FJI A;  5FRN A;  2VWK A;  5GIP A;  2ZGY A;  5TKY A;  3PIP L;  3CJ9 A;  1EP4 A;  5JIC A;  1OH5 A;  2HHX A;  1NBW A;  4PHT X;  4B8C A;  1IV0 A;  5BRE A;  1NGJ A;  4GMJ B;  2GBZ A;  3L2R A;  4JV5 K;  1JL1 A;  3OYK A;  2DFE A;  3CCL N;  1HX1 A;  1XNQ K;  4DU4 A;  4GW6 A;  4JN4 A;  3L3U A;  4R5P A;  4EHT A;  4N5S A;  4FJ9 A;  4WQ4 A;  3L2Q A;  4FJ8 A;  5I3U A;  3BF1 A;  4PQU A;  3IDH A;  1WAF A;  1VRU A;  2YX6 A;  4Q5V A;  4J8F A;  4WFN L;  2ZM6 K;  2E8A A;  4ILG B;  3ZT2 A;  4OPA A;  4WQ4 C;  1VSE A;  4JD2 B;  1KFD A;  4MDB A;  4I7F A;  3PO4 A;  4AHR A;  4ELV A;  1VSM A;  4CE9 A;  4CEC A;  3QML A;  1TK8 A;  4JKH A;  1YTA A;  4EIA A;  2KKZ A;  3BUZ B;  2QWN A;  4F2S A;  1UOC A;  4CZK A;  3NCI A;  1Y64 A;  1ZYQ A;  2QWQ A;  1UWB A;  2Q97 A;  1O13 A;  3KLI A;  2DFH A;  2H3G X;  3BF3 A;  4IXC A;  3U3G A;  4CF8 A;  4LF8 K;  3TR8 A;  5BN8 A;  3KVG A;  2CGJ A;  3A5O C;  3KLH A;  1KLN A;  2Z1I A;  2XY6 A;  4KAZ A;  5DMR A;  1XHX A;  4BRG A;  1NM1 A;  1WBB A;  2E5L K;  4B9M A;  4KO0 A;  3F9K A;  4E7K A;  5C0Y A;  4MLH A;  4FJG A;  4PKH A;  4ZTJ A;  4AHU A;  1YJ9 N;  3EEQ A;  2A1R A;  4EZ6 A;  4FJH A;  1RT6 A;  4IEI A;  2Z1G A;  3SAF A;  4B08 A;  1YAG A;  3C65 A;  3AVC A;  3C95 A;  4FCY A;  1XMO K;  4EZ9 A;  2Y1J A;  2YJF A;  4CEF A;  2YNI A;  4BRL A;  2F96 A;  3C94 A;  3VEN A;  2IDO A;  1SL0 A;  4WE1 A;  3W3D A;  1H1V A;  4LSN A;  5A2Q O;  3L2W A;  3CD6 N;  3O9Q A;  4DS4 A;  2RKI A;  2PY5 A;  4ISG A;  2Q0R A;  1IG8 A;  2FF3 B;  2Q1N A;  3CCU N;  1DTT A;  2FSJ A;  4YOY A;  3OS0 A;  1S22 A;  3SK3 A;  2F8T A;  1NOZ A;  4JI8 K;  1L3V A;  2A1S A;  4FWM A;  2R7Y A;  1NJZ A;  1W97 L;  2G8F A;  3WUH A;  4IFE A;  3HT3 A;  3TTC A;  4F2R A;  2FXU A;  2Z1J A;  3H3O B;  1K8A O;  3VTI A;  2NNW A;  4YY3 K;  2QWP A;  2QWO A;  3GOI A;  1V4T A;  1Z6R A;  2ZJR L;  1RT7 A;  2GV9 A;  1VQ8 N;  4CGD A;  4MFB A;  4H0O A;  3RSE A;  3KKS A;  4CFD A;  3VN5 A;  1WOQ A;  1VSD A;  3THY B;  4KRE A;  2ZJQ L;  4YDU A;  4RG8 A;  5J2P A;  3NH1 A;  3LP1 A;  1EET A;  4PKG A;  3KLF A;  2ZGZ A;  1X9W A;  1IKX A;  3AA5 X;  3OYC A;  1GOB A;  4BVO A;  3GE1 A;  4Z4G A;  2QWR A;  4DTN A;  5AQQ A;  3KKR A;  1WSI A;  4JRP A;  4MLE A;  2QK9 A;  4W5O A;  4FJK A;  3CQX A;  3MWT A;  2YNF A;  3D7E O;  3FE1 A;  4OGE A;  2BAN A;  4B9L A;  3OYE A;  3K9K A;  4H0X B;  1HNI A;  1GLA G;  4AF1 A;  4IFV A;  1IO2 A;  4B1X B;  1VQL N;  3TWH A;  1TKZ A;  2HHH K;  2GEM A;  3O9T A;  4ELU A;  4FWK A;  5BPM A;  4A5A A;  4IDH A;  1R0A A;  4BRE A;  2IVN A;  3JSM A;  1GLE G;  4QS8 A;  2KFN A;  1X1P A;  1B92 A;  2OPR A;  3DRS A;  3QLH A;  1C6V A;  1RBV A;  3L3V A;  1IKV A;  3D0P A;  2NZT A;  1BU6 O;  4M7X A;  1XMQ K;  4ISE A;  2JWK A;  3LP2 A;  1VSH A;  5EOY A;  4O55 A;  2P51 A;  1HNW K;  3OYH A;  1CZ9 A;  3KZB A;  5KTQ A;  2PBD A;  3SUN A;  4OX9 K;  3M8R A;  4M3Z A;  3WQU A;  1XC9 A;  3IRX A;  4C8K A;  1ZBL A;  4B1W B;  4BRN A;  5E26 A;  4B1Z A;  2E2O A;  4DLG A;  4A57 A;  2KTQ A;  3AVJ A;  2WC9 A;  3H1V X;  2VYP A;  4B3T K;  3LZJ A;  4B3M K;  1GLL O;  1HQU A;  4ZTF A;  4GNI A;  1Q9Y A;  3QEP A;  4NB4 A;  3B6O A;  5DK5 A;  3AO2 A;  3IFR A;  1SKR A;  3K2P A;  2YI1 A;  5JS2 A;  2O8D B;  3K0S A;  5HRR A;  1VSK A;  2VWJ A;  1KAZ A;  2NRV A;  5HBM A;  4CJW A;  1ZBU A;  4QOZ B;  4CGF A;  3HP9 A;  3H1Q A;  1BO5 O;  2YHX A;  3OYB A;  4JI0 K;  1JLF A;  3OYG A;  3RTV A;  3KLE A;  1K8K B;  1RT1 A;  3NFA A;  3DRR A;  3SPY A;  5JLF A;  1NG9 A;  1FKO A;  2GUP A;  2E6L A;  4FW1 A;  1WSE A;  4CJT A;  1TYQ B;  3O3F A;  1FKP A;  1LWC A;  5ADX A;  4JKG B;  2IGI A;  3PX0 A;  3ULE B;  2VWB A;  2DFF A;  2XY5 A;  1KQS M;  1T7P A;  3M5R A;  3J7Z O;  4B1Y B;  2YKM A;  1N32 K;  5LJW A;  2X6N A;  1T6C A;  1NK6 A;  3MMV A;  3P4I A;  3DLG A;  3RMC A;  1I39 A;  4M3W A;  4FL9 A;  1BG3 A;  4Z4C A;  2HMP A;  3LAL A;  2UXC K;  3F73 A;  3NVM A;  4BC2 A;  2A41 A;  5AQO A;  1LW2 A;  1NMN A;  3CJA A;  2W42 A;  4BR2 A;  2O4I A;  4E0D A;  3NAE A;  4YHH K;  3G6E N;  1VQO N;  3ZX2 A;  2HHS A;  4DSL A;  3O4N A;  3FLC O;  4IWV A;  3KWG A;  2HBJ A;  3Q7B A;  2KQ2 A;  2P9I B;  5JMV A;  4DU3 A;  4DV4 K;  1VQK N;  2D0C A;  4E7L A;  3M8S A;  4DR3 K;  1CLQ A;  3AGK A;  3TAN A;  1W9H A;  3ASM A;  2D1K A;  2BDP A;  2P9P B;  1YVU A;  1TAQ A;  2YKN A;  5AFU A;  4FJN A;  4L8R B;  2IVP A;  3V1O A;  4QAG A;  3AVH A;  4YFU A;  1U4B A;  4JD2 A;  5LL6 Z;  1VQ7 N;  4BAC A;  3LDO A;  1KLM A;  1J5O A;  4E7I A;  4CZG A;  4DCH A;  5HRS A;  4XIU A;  2P9K B;  3PIO L;  2HW3 A;  2F7T A;  4KB0 A;  4QS7 A;  1LAV A;  4WCE L;  1VSF A;  4FLT A;  3JAM O;  2B5J A;  1VQ4 N;  1WSH A;  4NLB A;  4A59 A;  4BR5 A;  4DTP A;  3LAN A;  4IJN A;  3WXM B;  2A6A A;  3TAP A;  1WSG A;  3L2V A;  1IBL K;  2GWJ A;  3ITH A;  2FBY A;  4FVM A;  3VTH A;  3MN6 A;  3VQP A;  3O9R A;  3C6U A;  1KRP A;  4ICL A;  3ALY A;  1J5E K;  1TGO A;  2FLO A;  3D6R A;  3TAG A;  1RTD A;  4NCG A;  1YJN N;  4DTS A;  4IG0 A;  4QS9 A;  2X74 A;  3THW B;  1RFQ A;  2JLE A;  4H0Y B;  3HI0 A;  4W5Q A;  2OPS A;  3MCP A;  1QQM A;  3UIQ A;  4CHQ A;  4A2B A;  1L3T A;  5FPN A;  3RRG A;  2YJE A;  4G1Q A;  4E7H A;  3SI6 A;  4WQ5 C;  3F5T A;  5KPR A;  4BRQ A;  2V52 B;  4GV9 A;  4DV7 K;  1HLU A;  3L2U A;  3D45 A;  3CC2 N;  2QEX N;  3OJS A;  4NLC A;  3DJC A;  1BL3 A;  3QDK A;  3W0L A;  4DR6 K;  2YV0 X;  2V7Y A;  5BPN A;  4HCC A;  2Y1I A;  3PO5 A;  3I8B A;  3HVR A;  4FVU A;  2ZJP L;  3FZM A;  2VGM A;  2BTF A;  2F9T A;  3GBT A;  5FPE A;  4FK2 A;  4JYA K;  4C8N A;  4GKJ K;  3I8D A;  1D9D A;  4UQG A;  1KVB A;  3TAB A;  4CF2 A;  4JKC A;  4DV3 K;  5HLF A;  3MAQ A;  4GV3 A;  5C2F A;  1HYV A;  3HBT A;  2O8E A;  1WBD A;  3SQ4 A;  4QCL A;  3FZK A;  2WOM A;  3UKU B;  5JLH A;  1CXQ A;  1NK0 A;  4BRF A;  1DKG D;  4DSF A;  3DXK A;  4XH1 A;  3EN9 A;  2D0A A;  4YNQ A;  4K41 A;  4M63 C;  5FRO A;  3NGZ A;  4Z4I A;  3TAE A;  2NRZ A;  4BC5 A;  2G8V A;  2PAV A;  4E7J A;  3U6F A;  3DLE A;  4E19 A;  3ZSX A;  3I0R A;  3TI0 A;  4X65 K;  3M6G A;  1GLB G;  4NYN A;  3THX A;  1SKW A;  1HUX A;  2ITG A;  1JLC A;  3O6W A;  4E1J A;  1C0G A;  3NBP A;  3C6H A;  1XHZ A;  3TTD A;  1S9G A;  4CZM A;  2QW9 A;  3T69 A;  4CEA A;  3QER A;  3RR8 A;  3OJU A;  3BZK A;  1NGE A;  4FWO A;  2RN2 A;  4KBO A;  4DQS A;  3G10 A;  5ELZ A;  2XY7 A;  4CZF A;  2B6A A;  3ULE A;  3E1Y A;  4JKG A;  4BE1 A;  1EWQ A;  4PA1 A;  3VQE A;  4DV1 K;  1KXP A;  1RTH A;  2ASP A;  2GX9 A;  3OS2 A;  3OYL A;  3BY5 A;  5KQD A;  4KHW A;  3T1H K;  4JI5 K;  1QHA A;  2IOC A;  5AQI A;  5GIO A;  3KK3 A;  4DWI A;  2YHW A;  3O8M A;  4CZL A;  4FZY A;  1NNE A;  2HVI A;  3QFP A;  4B3R K;  3OYI A;  1A5X A;  4DR5 K;  3SV3 A;  3BEX A;  3THV A;  3ZSO A;  3CC7 N;  3EE8 A;  1HYS A;  4JRQ A;  3CYM A;  4H4O A;  1K6Y A;  5AQR A;  3I55 N;  1Q18 A;  4O0J A;  4RW4 A;  1BDG A;  3P1G A;  5K14 A;  3KLG A;  4CHP A;  4IO8 A;  5M1F A;  5B8H A;  2RPI A;  2FF6 A;  4FLU A;  1BOT O;  4FPA A;  1ZBS A;  1IBK K;  1QS4 A;  4HHT A;  4FLX A;  1KFS A;  5M1P A;  2QXF A;  3HST B;  4WFB L;  4CHO A;  4FW2 A;  3DWL A;  1BQM A;  1BIZ A;  3HYF A;  1N33 K;  1TL3 A;  4H5R A;  4CBW A;  4BGB A;  5MLC Q;  3A5M C;  3QEV A;  3LPU A;  1OVY A;  4FXD A;  1Q81 O;  4H5N A;  2P9N A;  4BE2 A;  2VGN A;  4NYF A;  4HCB A;  2ZD1 A;  4BRA A;  3CJ1 A;  1EKE A;  3F2K A;  3LM2 A;  1RT2 A;  4LFB K;  4PKI A;  5FDL A;  2VG6 A;  2W6L A;  2G8U A;  2NRH A;  3V1Q A;  1TAU A;  4CEE A;  3CFR A;  5BN9 A;  2BUP A;  1E3M A;  3S41 A;  4O44 A;  1WSJ A;  3EL2 A;  1M90 O;  1TL1 A;  3WXK A;  3T1Y K;  1X9J A;  4JKD A;  3R9P A;  4B1V A;  1W0H A;  4KHY A;  3CI5 A;  4H5T A;  5HRP A;  4CGG A;  3SUO A;  3OBY A;  4KHQ A;  1JLA A;  4DSK A;  4LF9 K;  1XWL A;  1ZBF A;  2CH6 A;  4B1U B;  1SV5 A;  4DQQ A;  4JHD A;  4RW8 A;  3DXK B;  1QE1 A;  3OHR A;  1LWF A;  3VET A;  5JVH L;  4DTJ A;  1S9E A;  2XY8 A;  3QIO A;  3VEY A;  2UUC K;  4G9Z A;  1NGG A;  5AQS A;  3CCQ N;  3CG7 A;  1I94 K;  3PUF A;  1SS6 A;  2E1Z A;  2HF3 A;  4K0K K;  1X9M A;  3SPZ A;  3QB0 A;  3AA3 A;  3LWL A;  4N41 A;  4ZHR A;  3L4Q A;  3SBT A;  2OTL N;  2HHV A;  4A62 A;  3DAW A;  1L3U A;  4DV5 K;  4CEZ A;  4CHY A;  3H6E A;  1QSL A;  4JI3 K;  5GAE P;  4EP5 A;  1JLE A;  4OKK A;  5C2D A;  2AP1 A;  4JKE A;  3KIO A;  4BGA A;  2FSK A;  3G25 A;  3ZT1 A;  3G0Z A;  5J2M A;  1KVA A;  3BDP A;  5AQT A;  3CER A;  2ASM A;  5EXW A;  5IT9 O;  5LMU K;  3AVI A;  3T7Z A;  4CI6 A;  2YNG A;  1ITG A;  1NWK A;  3KTQ A;  1NLV A;  3ATV A;  3EKS A;  4X64 K;  1KVC A;  2OPP A;  4Z94 A;  1EQY A;  3IUC A;  4JK9 A;  3ZEU B;  3B6P A;  3MK6 A;  3ZEU A;  2P9N B;  3RRH A;  4NO7 A;  1YTU A;  1SUQ A;  5TKW A;  2AJQ A;  1LWE A;  4CJR A;  1HKC A;  4J2B A;  3TTF A;  1L3S A;  1SAZ A;  4CJU A;  3KD5 E;  4O5F A;  2IVO A;  3VEZ A;  3CJ7 A;  3NH0 A;  4DLE A;  4BDY A;  3TAQ A;  1REV A;  3LDQ A;  4YOU A;  1C1C A;  4CJL A;  3RR7 A;  2ZF5 O;  3AA2 A;  1VAZ A;  1DTQ A;  3A2F A;  4BR9 A;  4EAH D;  3A5L C;  1D4X A;  4IJA A;  1BA0 A;  3QBX A;  4DG1 A;  4Z4H A;  4CES A;  1VSI A;  5F0X A;  4K43 A;  3MEE A;  3UB5 A;  4KPY A;  4JI7 K;  3AVL A;  4CCH A;  3V81 A;  4OLA A;  4WQ5 A;  5HRN A;  2UU9 K;  1VQ6 N;  4I2P A;  1J54 A;  3A5N C;  1JLQ A;  3FZH A;  4H0V B;  3WEE A;  3HRG A;  3A8Y A;  4WFA L;  3SYZ A;  1ASW A;  4CF9 A;  4DR4 K;  4FWR A;  1HR0 K;  4I2Q A;  1ZBI A;  4LF5 K;  4B9U A;  4M3U A;  2VG5 A;  2E2Q A;  2HND A;  4GY2 B;  3DMJ A;  3LP3 A;  3P39 A;  1YVN A;  2FBV A;  4KI6 A;  3CET A;  1UA0 A;  4MO5 A;  1T3V A;  3THY A;  4E1M A;  4OPH A;  2PYL A;  4CGI A;  3BP8 A;  3SUP A;  2O8D A;  2VG7 A;  1QHT A;  1IG9 A;  4CBU A;  4PUO A;  4ID5 A;  3LP0 A;  2VQE K;  4DQR A;  4XH4 A;  3EZW A;  1A5V A;  4H4M A;  3O3G A;  4DS5 A;  3VGM A;  3J80 O;  1VQP N;  4CZI A;  4CK3 A;  2W40 A;  3BZC A;  1ASU A;  1VQM N;  1OH7 A;  4H0P A;  3M3Z A;  2WON A;  4O0I A;  3ZSQ A;  4DFM A;  4AQY K;  2F8S A;  3U9Z A;  2NUB A;  3DLH A;  3FFK B;  1T44 A;  2D4W A;  3GDQ A;  5EY4 A;  1RT3 A;  2I7P A;  3MXM A; 
#chains in the Genus database with same CATH homology
 3PIO L;  3O9S A;  2F7T A;  3VF2 A;  3MCA B;  4FSV A;  3P38 A;  2CH5 A;  4QS7 A;  4IEE A;  3D2F B;  4WCE L;  2P9L B;  2WUS A;  2QA4 N;  3O08 A;  4ILJ A;  3CJC A;  3L4I A;  5AZI B;  2ITM A;  3TSP A;  5M1K A;  5KPT A;  3A0I X;  4AM6 A;  2QI2 A;  4C1N I;  1GLJ O;  1VQ4 N;  2CGL A;  3AAQ A;  3MN9 A;  1K73 O;  4NLB A;  4A59 A;  4BR5 A;  4U7B A;  1V4S A;  4JK8 A;  3ZX0 A;  4BY9 C;  5EVZ A;  3L0Q A;  5AQF A;  4IJN A;  1KD1 O;  1LCU A;  3DXM A;  3VF4 A;  3R8E A;  3WXM B;  2A6A A;  1RDW X;  2GEL A;  2YCH A;  3EKU A;  3FZL A;  4JAX A;  4O8K A;  3VER A;  4BC4 A;  1K8K A;  2IIR A;  4BG9 A;  3O4W A;  2GWJ A;  5HL7 L;  5GAG P;  5DM6 L;  1P90 A;  4Y0W A;  3ZET A;  3JXU A;  3VTH A;  3MN6 A;  4XH5 A;  5F2R A;  1HPM A;  3O9R A;  2I7N A;  3CPW M;  5FPM A;  4BQL A;  4H0T B;  2FLO A;  1HJO A;  3D6R A;  3E9L A;  3SJH A;  3AAR A;  2HF4 A;  1YJN N;  1TYQ A;  5EX5 A;  4QS9 A;  3CJB A;  4GVE A;  3ENO A;  3C7N B;  2P9P A;  1RFQ A;  1NGF A;  3ATU A;  3HI0 A;  4H0Y B;  5AR0 A;  3MCP A;  1ATN A;  1QQM A;  4PL8 A;  5GIN A;  3TPQ A;  4A2B A;  5FPN A;  4K25 A;  1ZC6 A;  2YJE A;  4KH4 A;  4C23 A;  3WT0 A;  4IO9 L;  3CIP A;  3F5T A;  1C0F A;  4WQ5 C;  5KPR A;  5GIP A;  4BRQ A;  2ZGY A;  1QQO A;  5TKY A;  3PIP L;  3CJ9 A;  5JIC A;  2V52 B;  4GV9 A;  4C1N K;  2P9L A;  2VCP A;  1HLU A;  3WQT A;  5JVG L;  1E4G T;  2Q31 A;  1NBW A;  2QM1 A;  3CC2 N;  1DGK N;  2QEX N;  4NLC A;  3DJC A;  3QDK A;  3W0L A;  4PHT X;  4XEI A;  3SMS A;  2E88 A;  3B8A X;  1NGJ A;  2V7Y A;  5BRE A;  3SAG A;  5BPN A;  2RE2 A;  3I8B A;  1X3N A;  1YXQ A;  4FVU A;  3CCL N;  1U2V A;  2ZJP L;  1CZA N;  3FZM A;  2VGM A;  2BTF A;  2F9T A;  2Q2R A;  3GBT A;  5FPE A;  1HX1 A;  4JN4 A;  4A5B A;  4EHT A;  1TUY A;  4WQ4 A;  5M1Q A;  3H3N O;  4YOV A;  3UKR A;  4EHU A;  1TUU A;  3BF1 A;  4JKC A;  3IDH A;  3CXC M;  2HOE A;  3DLL L;  2YX6 A;  4GV3 A;  4J8F A;  3EO3 A;  5C2F A;  2P9S B;  4WFN L;  3ENB A;  4H5V A;  3HBT A;  1QQN A;  2P9S A;  3E66 A;  3IKM A;  2E8A A;  4ILG B;  2DPN A;  3FZK A;  4OPA A;  4WQ4 C;  1MA9 B;  3M1F A;  3GL1 A;  3UKU B;  4A2A A;  5BR9 A;  5JLH A;  3MX2 A;  1DKG D;  4BRF A;  4JD2 B;  4MDB A;  3DXK A;  3KWI A;  3H46 O;  4XH1 A;  3EN9 A;  4BRM A;  1ZXO A;  4K41 A;  1NJI O;  4M63 C;  3QML A;  4JKH A;  5AQZ A;  2NRZ A;  4BC5 A;  2PAV A;  3WEE B;  4EIA A;  4IOC L;  2RHK A;  1VQ5 N;  2KKZ A;  3CQY A;  1ATS A;  3BUZ B;  5LJV A;  4RCH A;  4YOX A;  4FWS A;  3RSE B;  2V7Z A;  4HWI A;  1Q86 O;  2QWN A;  5GAH P;  3HOS A;  3VMF B;  1YUW A;  3O5B A;  3FGU A;  4O8U A;  4DB3 A;  3M6G A;  3OA9 A;  4CZK A;  1GLB G;  3HSC A;  4RWT A;  1Y64 A;  2JWL A;  2QWQ A;  3ID8 A;  5BRD A;  1HUX A;  1SQK A;  4CBX A;  2Q97 A;  3EE9 A;  3HM8 A;  1O13 A;  3O6W A;  2H3G X;  4E1J A;  4GV6 A;  3BF3 A;  4IXC A;  1C0G A;  3C6H A;  4U67 L;  3VEV A;  2FSN A;  3TTD A;  5BN8 A;  1JCG A;  4DQ8 A;  1VQ9 N;  3KVG A;  2CGJ A;  3ZX3 A;  2QW9 A;  4CZM A;  3A5O C;  3T69 A;  1NGE A;  4FWO A;  2WFB A;  4KBO A;  4H5W A;  4DHY A;  4BRG A;  1NM1 A;  3LDP A;  4BC3 A;  5ELZ A;  4FOI A;  4CZF A;  3ULE A;  3CCE N;  3E1Y A;  5M1O A;  4JKG A;  5C0Y A;  4MLH A;  4PKH A;  5HOO A;  1YJ9 N;  3VGL A;  5AQJ A;  1KXP A;  2ASP A;  2GX9 A;  2Q36 A;  1YF5 L;  4IZ9 A;  3QBW A;  5KQD A;  4FPB A;  4IEI A;  3VES A;  1QHA A;  3CMA N;  1DEJ A;  3SAF A;  5AQI A;  4WYB A;  5GIO A;  5BRH A;  3I33 A;  5AQW A;  3C6A A;  1YAG A;  3C65 A;  2YHW A;  3O8M A;  1GLF O;  5AQX A;  4CZL A;  2YJF A;  3FZF A;  3QFP A;  1S3X A;  3MDQ A;  4JKF A;  3VF6 A;  4YOW A;  5C15 A;  4BRL A;  2ASO A;  3BEX A;  4FWL A;  4FWP A;  2W41 A;  3VEN A;  4BRH A;  3W3D A;  1H1V A;  3CC7 N;  4IOX A;  3CD6 N;  3EE8 A;  3C0B A;  3O9Q A;  3TU5 A;  5DM7 L;  3CCM N;  1KC8 O;  3ZYY X;  3SLC A;  2QTD A;  4ISG A;  2Q0R A;  5AZJ A;  1IG8 A;  2FF3 B;  2Q1N A;  5AQR A;  3CCU N;  1QVF M;  2FSJ A;  4YOY A;  3I55 N;  1Q18 A;  1BDG A;  1QZ6 A;  5M1F A;  4IO8 A;  1S22 A;  3SK3 A;  5B8H A;  2FF6 A;  3ZET B;  2NRT A;  1BOT O;  4FPA A;  2OAN A;  1Z05 A;  1ZBS A;  2KHO A;  4FWM A;  1W97 L;  2P9I A;  5M1P A;  1XUP O;  2NRX A;  3WUH A;  3FR0 A;  3WXL A;  4IFE A;  1BUP A;  3TTC A;  1JJ2 M;  2AA4 A;  2FXU A;  4BVP A;  4WFB L;  4BRC A;  3P31 A;  3C7N A;  2F9W A;  1QVG M;  3DWL A;  5FPD A;  3ID6 A;  5AQP A;  3SAH A;  3HZ6 A;  3MN7 A;  3H3O B;  5KPZ A;  2NNW A;  2PFU A;  3VTI A;  1K8A O;  4H5R A;  3MWP A;  5AQN A;  4CBW A;  2QWP A;  4BGB A;  5MLC Q;  4BR7 A;  2QWO A;  3A5M C;  3O1W A;  1OVY A;  3GOI A;  1V4T A;  5AQH A;  1S72 N;  1Q81 O;  2A3Z A;  1NGH A;  4H5N A;  1Z6R A;  2P9N A;  2ZJR L;  1VQ8 N;  2VGN A;  1KAY A;  3N4Q A;  4H0O A;  4BRA A;  3CJ1 A;  3RSE A;  3VGK A;  2E2P A;  3F2K A;  3LM2 A;  1ILY A;  3GG4 A;  1YJW N;  1WOQ A;  4PKI A;  5AQG A;  3VEO A;  3AGR A;  2NRH A;  1G99 A;  4DKW A;  3CCV N;  1YIJ N;  2ZJQ L;  4YDU A;  1NMD A;  5BN9 A;  1XC3 A;  2BUP A;  3CHW A;  3G71 N;  3S41 A;  2A42 A;  5I9E B;  3N4P A;  4PKG A;  3EL2 A;  2ZGZ A;  1M90 O;  5BRF A;  3WXK A;  1U6Z A;  1X9J A;  4JKD A;  3R9P A;  4B1V A;  4BVO A;  3GE1 A;  3WXI A;  5AFU H;  2QWR A;  3CI5 A;  4R79 A;  1JCF A;  3U9D A;  4H5T A;  5AQQ A;  4FO0 A;  3CCS N;  4MLE A;  2GTD A;  5F1X A;  3OW2 M;  3OBY A;  3CQX A;  3LDN A;  4MDA A;  3MWT A;  3D7E O;  4BQZ A;  3FE1 A;  2CH6 A;  1T6D A;  4B1U B;  3O9U A;  4F9O A;  1K9M O;  2D0O A;  1MDU B;  1KAX A;  1OKJ A;  1SZ2 A;  4JHD A;  1EO1 A;  3K9K A;  3IMX A;  4H0X B;  3DXK B;  1GLA G;  3OHR A;  3WXJ A;  4AF1 A;  4B1X B;  1VQL N;  3VET A;  5JVH L;  5AQM A;  3NMU A;  3PLA A;  3HOT A;  3VEY A;  2D0P A;  4G9Z A;  1NGG A;  2HBK A;  2GEM A;  2HBL A;  3Q7C A;  3E9O A;  5AQS A;  3CCQ N;  3O9T A;  1SS6 A;  2E1Z A;  4FWK A;  4CJ7 A;  4A5A A;  5BPM A;  4IDH A;  2HF3 A;  4BRI A;  2HST A;  4BRE A;  2IVN A;  2YHY A;  3LM9 A;  3U8X A;  5E84 A;  3QB0 A;  1GLE G;  4QS8 A;  4IOA L;  2BH1 A;  3F9M A;  3L4Q A;  1RDU A;  5CE3 A;  3SBT A;  4ISF A;  1X3M A;  5KQ8 A;  2OTL N;  2NZT A;  3DAW A;  4A62 A;  1BU6 O;  4JEP A;  2V51 B;  4M7X A;  1W2B M;  4OO1 J;  3H6E A;  4JKB A;  5GAE P;  1GLC G;  5AZJ B;  1HKG A;  2HBM A;  4ISE A;  2JWK A;  3H45 C;  3LL3 A;  5C2D A;  1GLD G;  2AP1 A;  1YIT N;  4JKE A;  4BGA A;  2FSK A;  2E2N A;  3G25 A;  1E4F T;  5EOY A;  3CCJ N;  3JS6 A;  3VEX A;  5AQT A;  3CME N;  3CER A;  2ASM A;  5EXW A;  4BR0 A;  3KZB A;  1Q7Y O;  2QWL A;  2PBD A;  1LOT B;  3T7Z A;  4CI6 A;  3G4S N;  1N8R O;  1ATR A;  2OTJ N;  4RTF D;  1NWK A;  4BRO A;  1J6Z A;  1RGI A;  1NLV A;  3ATV A;  3TSQ A;  3WQU A;  3EKS A;  4Z94 A;  5CR4 A;  1EQY A;  5E26 A;  3J8A A;  4B1Z A;  4B1W B;  2E2O A;  4BRN A;  3VOV A;  3HTV A;  2QWM A;  3IUC A;  3QFU A;  4JK9 A;  4A57 A;  1YI2 N;  3MN5 A;  2QXL A;  3ZEU B;  4BRK A;  2E20 A;  1VQN N;  3MK6 A;  3ZEU A;  2WC9 A;  3H1V X;  2P9N B;  2UYT A;  4H03 B;  2VYP A;  4I6M B;  4NO7 A;  4BR4 A;  2NLX A;  1GLL O;  4LC9 B;  4I6M A;  5TKW A;  3L6Q A;  4GNI A;  4HTL A;  5AZI A;  1MWK A;  1HKC A;  3UE5 A;  3TTF A;  1R59 O;  4NB4 A;  1NGD A;  4CZH A;  1SAZ A;  4A61 A;  4EFH A;  3IFR A;  2E1Y A;  4O5F A;  2IVO A;  3VEZ A;  3CJ7 A;  2YI1 A;  4B9Q A;  5LY3 A;  4YOR A;  3LDQ A;  4YOU A;  1KAZ A;  2NRV A;  2ZWH A;  4KH5 A;  4BRD A;  1U2V B;  5AQL A;  3O80 A;  1BWF O;  3R6M A;  3H1Q A;  3RVC A;  4BG8 A;  2ZF5 O;  1BO5 O;  5BPL A;  2YHX A;  1VAZ A;  4BR9 A;  1P8Z A;  3SMP A;  1ESV A;  4EAH D;  4JNE A;  1K8K B;  4K42 A;  3ENH A;  3A5L C;  3AY9 A;  1D4X A;  5JLF A;  4IJA A;  2Q0U A;  2GUP A;  3I56 N;  1BA0 A;  3QBX A;  3KHY A;  4YOT A;  1TYQ B;  4KH6 A;  1BA1 A;  4JKA A;  4M7Y A;  4K43 A;  5F0X A;  1XQS C;  4JKG B;  3VPZ A;  2A5X A;  5ADX A;  4L3Q A;  3UB5 A;  3AAP A;  3CPE A;  3U4L A;  3ULE B;  2VWB A;  3CF5 L;  1NGC A;  2NRW A;  3R1X A;  4JK7 A;  3NVK A;  4WQ5 A;  1KQS M;  1VQ6 N;  1NGA A;  5C12 A;  3M5R A;  5M1N A;  3J7Z O;  3SBG A;  4B1Y B;  3A5N C;  3D2E B;  3FZH A;  4H0V B;  5LJW A;  1T6C A;  3WEE A;  1Q82 O;  3HRG A;  3A8Y A;  3MMV A;  3P4I A;  3VEW A;  2GWK A;  4PL7 A;  4WFA L;  1MWM A;  4YDU C;  4FWR A;  2P9K A;  3D2F A;  4FWQ A;  4FL9 A;  1BG3 A;  1QZ5 A;  3TSU A;  2E2Q A;  1DT9 A;  2HMP A;  3O1B A;  4GY2 B;  2J4R A;  5CHI A;  3P39 A;  1YVN A;  5GAD P;  3CCR N;  3CET A;  2P9U B;  1M1K O;  2NRR A;  3NVM A;  4MO5 A;  4MO4 A;  2A41 A;  4BC2 A;  5AQO A;  4CD3 A;  2P9U A;  1T3V A;  3OBW A;  3CJA A;  4OPH A;  4CD1 A;  4BR2 A;  3BP8 A;  3G6E N;  4CBU A;  3DXM B;  1WUA A;  1VQO N;  3ZX2 A;  5H1S Q;  4ILH A;  4XH4 A;  3EZW A;  3FLC O;  4IWV A;  3VGM A;  1VQP N;  1IJJ A;  3KWG A;  4CZI A;  2HBJ A;  5AQY A;  3Q7B A;  2P9I B;  5JMV A;  2W40 A;  5AQK A;  1NGB A;  1VQK N;  1VQM N;  2KLA A;  3QIC A;  2CGK A;  3CC4 N;  3UKR B;  3R3L A;  4CZE A;  4FWN A;  4H0P A;  3M3Z A;  5ADX H;  4AM7 A;  3E9P A;  3AGK A;  4FOE A;  4JHD B;  5AQU A;  5C10 A;  2A40 A;  3UKU A;  1NGI A;  2D1K A;  4CZJ A;  3MX5 A;  2EWS A;  3U9Z A;  2P9P B;  3LDL A;  2WBN A;  5AQV A;  1JCE A;  5AFU A;  4WF9 L;  4UY8 O;  2IVP A;  3FFK B;  1HKB A;  1T44 A;  2D4W A;  1YHQ N;  4JD2 A;  1VQ7 N;  3GDQ A;  5EY4 A;  3KK7 A;  2I7P A;  3LDO A;  3D2E A;  4CZG A;  4BRP A;  3K9J A;  4DCH A;  2P9K B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...