4PHTX

Atpase gspe in complex with the cytoplasmic domain of gspl from the vibrio vulnificus type ii secretion system
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
234
structure length
224
Chain Sequence
SEFLTVRLSSEQYSPIPWLVWSSSQQEVIASGELSDWQQLDDLKNYAEQRPIVVLVAASDVVLTEVDIPPGASRQFESMLPYLLEDEIAQDVDDLHFSVLAKENGKAQVCGVDRRWLQHMLDAFRAQGLDVKRVLPDSLALPLDDEGISAAQLGEQWLFRHSACQGSAVDDSWMPVYLNSVACFSSLPEQQAHWLSRPVEMTMALLSQGVADGKFSLLTGEFKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Type II secretion system protein L
publication title Crystal structure of the full-length ATPase GspE from the Vibrio vulnificus type II secretion system in complex with the cytoplasmic domain of GspL.
pubmed doi rcsb
source organism Vibrio vulnificus
molecule tags Protein transport
total genus 58
structure length 224
sequence length 234
chains with identical sequence Y, Z
ec nomenclature
pdb deposition date 2014-05-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.370 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4phtX02
3.30.420.380 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4phtX01
5TKWA 2BH1A 1W97L 4PHTX 1YF5L
chains in the Genus database with same CATH superfamily
4JI4K 3L2WA 4K42A 3RWUA 4FZYA 3DLHA 1GOBA 1K6YA 4M3XA 3A5MC 1C0TA 3MDQA 2VWKA 4CGFA 1D4XA 3S41A 1KVBA 2HOEA 1EKEA 2FBVA 4KHPK 3E01A 3H45C 4E7IA 3Q7BA 3UKUA 4DG1A 1K73O 3NAEA 3AO2A 1LCUA 2A1RA 3FZLA 3Q7CA 1HKBA 3HPHA 4LY7A 3P4IA 4HWIA 3K9JA 4C8NA 4Z94A 3V9ZA 1OH5A 4DQIA 3MEGA 1JLAA 4DHYA 3CCVN 1ATSA 3M6GA 3SV4A 5KQDA 4DR3K 4C8KA 4YDUA 1WSJA 4N56A 3SQ0A 3V1OA 4B9NA 1X9SA 2OANA 3V6DA 1S9EA 5FPEA 4FWRA 4BRMA 4JI5K 1VSHA 1U49A 5EVZA 1NKBA 4DTOA 1XMOK 2AP1A 4HVJA 2ZGYA 3LALA 1C0GA 2O8CB 4CFBA 2W41A 3ZX2A 4FZZA 1NGIA 5I42A 4CD3A 4MLEA 3LPUA 2XRIA 4LF9K 1YF5L 4BQLA 3D2FA 1QSLA 4FVUA 2DFFA 4IJAA 2O8DB 1CXQA 1NWKA 3B6OA 5LMNK 1V4SA 2F8TA 3LANA 3SK3A 4GKJK 4M3TA 5I3UA 1L3UA 1P90A 1IH7A 3N4QA 4OKKA 1FKPA 3PY8A 4FL9A 2RE2A 1Z25A 2B6AA 4O55A 2RKIA 1JL2A 1MA9B 5BRDA 2E6LA 5IWAK 4YOWA 3CPWM 1DLOA 3RMBA 2PBDA 3NH1A 4B3RK 2WONA 4CHPA 3M8SA 3THWB 4JS5A 2P9IB 1X9MA 4K0KK 2HVHA 1C1BA 5AQTA 2O8BA 4HUFA 5DM7L 2YNHA 3PX6A 3H08A 4B1ZA 4UQGA 2GTDA 4CZFA 1WSEA 2P9NA 4ID1A 4A2BA 1YT3A 4BE0A 4O0JA 4FM1A 3J7YP 1VQKN 5AQVA 2ZQBA 1K8KA 1JLFA 3O1BA 1RT6A 1Q86O 4N47A 4CBUA 4O4GA 1NMNA 3KWIA 2ZM6K 3SAGA 3WUHA 4JV5K 2X78A 3CJ9A 4JI2K 3ZT2A 1MU2A 2IGIA 5FRMA 2ZJRL 3NH0A 3J7ZO 5LMUK 4FJGA 4CEAA 4A61A 5C0YA 1GLJO 1NNEA 4E7KA 5KPRA 1A5VA 1ESVA 4KI4A 4ELVA 4CBXA 2AA4A 3L3VA 2Y1IA 2E8AA 3LDQA 3O08A 4Q5VA 4WYBA 3C95A 2EHGA 1TV6A 1VQNN 4FLUA 4JHDA 3FZMA 5AQIA 3HOSA 2YX6A 4XEIA 4B1XB 2B5JA 4NXNK 4F3OA 1QQMA 3VEXA 5AQKA 4OGEA 2G8HA 3HSCA 1E4GT 3HSTB 1KTQA 1OH7A 3QDKA 3G6EN 4DV2K 3THYB 4BR4A 3O6WA 1VRUA 3GBTA 3CQXA 3E9OA 3K5LA 4DU3A 2Q1NA 1ZBSA 2F9TA 3KLEA 4H0TB 4KV8A 1YIJN 3ULDA 1S72N 1XHXA 4AHUA 3BZKA 1LOTB 3AVFA 3DXMB 2ASPA 2P51A 2WBNA 3VQ6A 5BR8K 2ETJA 1CZBA 3LWLA 2D0PA 4BRGA 2CH5A 3KLGA 3CF5L 4BY9C 2O8EA 3ZSRA 2YJFA 2HBKA 1QVGM 3DJCA 3VQ9A 3MX2A 4PUOA 3HYFA 3WEEB 2UUCK 3C0BA 3F73A 4DV7K 3FLCO 4DR2K 3ZCMA 1DEJA 1KLMA 4X65K 3A2FA 4W5OA 3TR8A 1JXBA 2Q36A 2GUIA 3HTVA 3S3MA 4BGAA 3NFAA 4CJUA 1BIZA 2YCHA 3U9DA 3NE6A 3BY5A 4BRIA 2QWLA 3SJJA 4FJLA 1BIUA 4DF4A 2HBJA 2XHBA 4WQ5C 1Q9YA 3U3GA 4H0VB 2QKBA 3SYZA 1BL3A 4EIAA 3NVKA 2FC0A 2X6NA 3CC7N 4KBOA 5C10A 2RN2A 4RW6A 2HHWA 2KFZA 3C65A 2P9UA 5AQSA 4FJHA 1SAZA 2O8DA 4R5PA 2G8UA 4H5RA 3KIOA 4PKIA 2WOMA 4DSEA 3CFOA 4ELUA 3KK1A 3KKSA 5FDLA 3VEWA 4FLXA 4JKBA 3KD5E 4OLAA 3LZIA 4OPHA 4I7FA 1NGDA 3DRSA 2V52B 3ENBA 3ZX3A 2XY7A 1QSSA 1TKXA 5HRRA 3ID6A 1YAGA 4BC2A 4BR7A 5C2DA 1U04A 1ZBLA 4DSKA 1NGAA 2P9LB 1M1KO 4IFYA 1Q81O 3WQTA 2P9IA 4MDBA 4PA1A 4E1JA 1F21A 2A3ZA 4CF0A 1REVA 2VGMA 1NGBA 4AHRA 3PIOL 5F0XA 2Q2RA 1HKCA 3TAGA 1ASUA 1LWEA 4WQ5A 3DAWA 5IT9O 3THXB 4FCYA 1DKGD 4JKFA 1NK7A 3M3ZA 3JSMA 4H8KA 2D4WA 3AA2A 3HVRA 2W6KA 4CZJA 4ISEA 2YHBA 3O9RA 3LZJA 3DLBA 5BN9A 3WXKA 4Y1CA 4C23A 2KHOA 4HHTA 1K8AO 1IBKK 4FOEA 2BDPA 4GV9A 4GNIA 4G1QA 2V7YA 4NYNA 3AVGA 3O4WA 3VQ7A 1L3VA 3RSEB 1HNIA 3LP1A 4KO0A 2E5LK 2DFHA 4KB0A 3CMEN 4JNEA 4CJTA 2AJQA 4FWKA 1KAZA 4BR9A 3VQCA 3DRRA 2HB5A 3ZSOA 5FLXO 4A62A 4M3WA 3I56N 4DTMA 3O3FA 5FROA 2O4IA 5AQFA 1VHXA 5FPMA 3L6QA 3ENOA 5AQOA 1YHQN 1KCFA 4BREA 3BZCA 1RDAA 2OPQA 3WXLA 2G8KA 4H4OA 3THYA 2A5XA 1MWMA 1HYVA 1EWRA 1YXQA 3C6AA 4B1YB 2LSNA 3L2QA 2XY8A 3FZFA 4DFKA 2YHYA 5JS2A 3AVKA 3TTCA 4ISFA 1MDUB 4HUGA 4AM7A 4B9LA 4K25A 3HO1A 2HHSA 1C6VA 3OYJA 4X64K 4LF6K 3BDPA 3MXIA 5AQMA 2BH1A 3TARA 4DSJA 4BDYA 2E2QA 2NRVA 1VSIA 2BE2A 2YNGA 1XNRK 1JLBA 4B08A 2QWOA 1GLLO 1GLEG 1KC8O 4IG3A 1IBMK 1KLNA 5AJ3K 4O8UA 5EOYA 5BPNA 4DS4A 5KGXA 3WEEA 1KSPA 5KQ8A 4FLYA 4CBWA 1TUUA 5FPDA 3K0SA 1NK9A 3QLHA 1SKWA 4IDKA 2OZMA 3AAPA 2PY5A 4E0DA 4DV1K 4LFAK 3NH2A 1Q9XA 3CJAA 3KLFA 4A5BA 1L3TA 2FBXA 3D7EO 3KJVA 1ZYQA 4IEIA 1GLAG 4KFBA 1VSDA 5K14A 4F9OA 3VTIA 1S1XA 3M5RA 4FWLA 3HOTA 4FJ9A 3FZKA 1TYQB 2IOCA 2ATQA 5AZIB 3ZETA 3C7NB 3VN5A 1UAXA 3NF6A 3NVMA 3IRXA 4FW2A 1M90O 3SLCA 2YHWA 1CZAN 4OLBA 3HM9A 2P9PB 4WFAL 1GLBG 1NK8A 3A5NC 1U48A 1I3AA 4DQSA 1TKDA 3MAQA 4JKDA 1JLQA 1W7AA 4DCHA 3T7ZA 3C6TA 3SZ2A 3O4NA 4QS9A 4JI0K 1NLVA 1BISA 3MN5A 1EXQA 3LP3A 1XUPO 4FLTA 4C8LA 3CCSN 4BR2A 2FSJA 3OYGA 2D0AA 3ZT4A 1R59O 1TK0A 1R0AA 3HPOA 4RWTA 3VMFB 1LAWA 3ZT1A 4YOUA 5A2QO 4B9QA 2JWLA 4B3SK 3JS6A 3CCEN 4KTQA 2YV0X 3OS0A 3THXA 4FJ7A 2NRHA 4CIGA 5J1EA 4M3UA 1JLCA 4CE9A 5J2PA 5J2NA 1QQNA 2O8FA 3A5LC 4H03B 3GOIA 1BQNA 5H1SQ 1HYZA 3QBWA 2EX3A 1OH6A 2KFNA 4KH5A 5KRTA 2QXFA 2UXBK 1N6QA 2UXDK 4DTUA 3OHRA 2PFUA 3OY9A 4CGIA 3RRGA 3IAYA 2B4JA 3BF3A 1A5WA 2W42A 3DOKA 4CJVA 2ITMA 5AZJB 4DQPA 3LP0A 4A2AA 4BQZA 3VA3A 4L8RB 2WC9A 4GY2B 3MWTA 4I9LA 2HHUA 1NK4A 3O3GA 3TU5A 4O5BA 1XHZA 3HXMA 3LDNA 4KB1A 3CCQN 1ZBHA 3NGZA 3H6EA 1WNSA 4A57A 5EU7A 3ZLJA 3RR7A 1ZBFA 1HPMA 1RT3A 3QESA 1TKZA 3MN7A 3V1QA 4WFBL 4OO1J 2HBMA 3K5OA 1T8EA 3PV8A 3O1WA 4AH9A 1IG8A 1HKGA 4Z0UA 3SMSA 4FWSA 1C0MA 4C1NI 3L3UA 2FBYA 5AR0A 2GUPA 2IVOA 1Z05A 3W0LA 5J2QA 4CHQA 4H5WA 3U9ZA 1BI4B 4CK3A 4IO9L 3PIPL 4CF9A 1IBLK 2HHQA 1NJWA 2X74A 4MFBA 1RBSA 3CHWA 1GLCG 4OPAA 1JJ2M 3VQAA 3JXUA 3SBTA 1JXEA 4PQUA 1W97L 5BPMA 5C2FA 4Q0BA 4O0IA 1EX4A 3DXKB 1LWFA 3CG7A 4OPKA 3OYEA 4FM0A 4MLHA 1NJXA 4B9TA 3OS2A 4LSNA 4LD0A 1LW0A 2E6MA 1S3XA 3VETA 3ULEB 4BG8A 4NLCA 3VEOA 3ZT0A 1GOCA 4WCEL 3TWHA 3OS1A 1UA1A 5CYMA 4E7HA 3MEDA 4BDPA 5SWMA 4NLBA 1H1VA 4L3QA 4ICLA 1JL1A 3LDPA 1VK0A 1YVUA 1JCGA 3IS9A 4X66K 1NJZA 4JK7A 3K5NA 5BRHA 3THVA 3C7NA 3WNFA 4Z4IA 1HNVA 2E2NA 4FXDA 3VA0A 1N36K 3ALYA 1E3MA 4YOVA 3ASMA 1ATRA 4B1VA 2P9PA 3HVTA 4BWMA 3RR8A 5AQLA 1T44A 1HUXA 3P31A 2KTQA 3F9MA 4JKCA 1NGFA 1WLJA 4J2EA 2HF3A 3DLKA 3IUCA 4B9VA 1XNQK 5M1NA 4B3MK 4CEQA 1WBDA 4KTZA 2BUPA 3HK2A 3B8AX 1VQPN 3VEZA 1N5YA 1EWQA 1NGHA 4FOIA 3U4LA 1ZBUA 1GOAA 4B9UA 4F3TA 1GLDG 4FWMA 1P8ZA 5DK5A 3MXJA 4CIFA 5LJVA 3OYAA 4JI6K 2QWQA 5BR9A 3SUOA 4CK2A 3U3YA 3KLIA 4J2DA 3L4IA 3I8BA 2VG7A 4LF4K 4YHHK 2ZJPL 1X9JA 2CH6A 5C15A 4DQQA 1WSGA 2W40A 1YJ9N 1BWFO 5CHIA 1VQ8N 3TSUA 2RHKA 4CJFA 3CCLN 3BUZB 3KLHA 3H1QA 4NCBA 3VQDA 3WXJA 4CF1A 1B9FA 1VRTA 1EQYA 3L2VA 4FLWA 3OTOK 1D9FA 3VEVA 4W5NA 2PZSA 3QEXA 3QEWA 4M42A 2OCEA 2Q0RA 2VWBA 5TKYA 1BQMA 3AY9A 1NK6A 3AA4A 2OTJN 3CIPA 5HOOA 4E89A 1WAJA 3I0RA 4EZ6A 5J2MA 3VENA 2VQEK 4K8XA 4DLGA 3EO3A 1J9AA 4AHTA 4ELTA 1T7PA 3FGUA 4CIEA 1QQCA 2NRTA 3AVAA 1J5OA 4CJQA 4ZTFA 2BANA 1J54A 1TKTA 4IJNA 1Z26A 1WOQA 4IWVA 5AFUH 4IEEA 5C12A 4Z4FA 4LF5K 3DLRA 1YTUA 3UE5A 4DV6K 1BCMA 3I33A 1QHAA 3CERA 3HM8A 3IDHA 2A6AA 1EO1A 1U4BA 5EX5A 5CE3A 3RMAA 4DUZK 1SL0A 2VG6A 5AQPA 4M3ZA 3HI0A 2UUAK 4E3SA 5JICA 3VQBA 4CFCA 1ATNA 3ZEUB 1RBTA 3QIOA 3M8PA 4KREA 2PAVA 4AHCA 1QQOA 1OKJA 1VSFA 4DV5K 4NXMK 1RT5A 3KZBA 4K43A 5M1QA 4OPJA 5E41A 3F5TA 1SUQA 4YOXA 1TK5A 1NGEA 2GEMA 4J2BA 4CEBA 3TTFA 3A5OC 2FSKA 1EETA 1HQEA 4EP4A 4BE1A 4DB3A 3MEEA 3ISNC 1RDUA 4JLHA 4LF8K 5CZ1A 2QTDA 5M1FA 1SL1A 1X3MA 3CJ1A 4U7BA 2O8CA 2QWRA 4CJ5A 2NNWA 1T05A 3T1YK 4JKGB 4AF1A 4AHVA 3O9TA 1FJGK 5JVGL 1MWKA 3WQUA 5CYQA 3P38A 4YOTA 4I6MB 1HX1A 2KZMA 3MCPA 3SNNA 5CY4A 4LFCK 1NBWA 3PO4A 2A1SA 4CHNA 1HNWK 4BROA 4BRNA 4F8RA 4ZHRA 3VERA 2H3GX 4MQ3A 4CHOA 4IZ9A 1T6CA 4JKHA 4LSLA 3R8EA 1U2VB 3CJCA 5M1PA 1KVCA 1QZ5A 3I0SA 1N32K 3KK2A 4YOYA 1Y97A 3MECA 4FPBA 4CZHA 4CD1A 1RDBA 4EHUA 3THWA 5C42A 2E2OA 5KPTA 3DMJA 4E19A 4K41A 2G8WA 3LL3A 3G4SN 2HNYA 1EP4A 1VSMA 2KKZA 1S1VA 2IAJA 4G9ZA 3KTQA 2P9KB 4MO5A 3G71N 1HJRA 3N4PA 1C1AA 3TABA 2Q31A 1LWCA 2Q97A 4DSLA 1FW6A 1Q82O 2HSTA 4E7LA 1JKHA 1KAYA 4B3TK 4M3RA 3CXCM 4CZLA 2ASOA 1RTDA 5HRNA 4ID5A 3H3OB 1XMQK 2FSNA 1ITGA 1NM1A 2HNZA 3T1HK 3TSPA 3TAMA 3VPZA 5DMRA 4RG8A 5C24A 4JD2B 2UUBK 3OBYA 4PL7A 4F2RA 1X1PA 2D0OA 3VGMA 4FJ8A 1XI1A 2QK9A 3G25A 4AILC 1VQ7N 1YVNA 2QXLA 4E1MA 4HCCA 2QWNA 2RF2A 4OKJA 4DFJA 4FJKA 4JK8A 4JI3K 1WB9A 4Z4GA 1TK8A 3ZSVA 2WTUA 1WN7A 3VGLA 4CZEA 4DKWA 3O5BA 4CEOA 5AFUA 5GIPA 4BG9A 2Z1JA 4DTSA 1Q18A 4Y1DA 3ID8A 3I55N 4M7XA 3UKRB 3SJHA 1XC3A 3ZSQA 2P9SB 3VQPA 5AQHA 3L4QA 3SV3A 3AGRA 4FW1A 4OX9K 1KD1O 3QERA 4IFVA 1FK9A 2RPIA 4JKAA 2F8SA 4DTRA 2V51B 3D2EB 4BVOA 3AO5A 4KH6A 3VQEA 1O13A 3EYZA 4JKEA 4CJ3A 3P83D 2VWJA 4CZGA 2UYTA 3ZSYA 2KZZA 3DXMA 4IDHA 1UOCA 4RW7A 5GADP 4AHSA 4CFAA 4B8CA 3KWGA 4CZKA 4EFHA 2E1YA 3SAFA 3R3LA 3AAQA 2QA4N 4J2AA 5M1OA 3AGKA 3ZSZA 3FFIA 5CZ2A 4U67L 3QNOA 4C8OA 4DR7K 3SAHA 2HMPA 3OYFA 3EE8A 2QWPA 3CJ7A 3TAQA 3NGYA 4DSIA 1RDWX 4BC5A 3CMAN 4BE2A 4IO8A 3HP6A 2D1KA 3G0ZA 4BGBA 2Z1IA 4QS8A 3LPTA 2UXCK 1QTMA 3AO4A 3LDOA 3F9KA 1N34K 1NOYA 2GBZA 5F1XA 1XQSC 2QI2A 2FXUA 2ZE2A 3SCXA 3LAMA 2JWKA 3HPGA 3VQ5A 4CEDA 3OYLA 1NG9A 4CJEA 3E9PA 3VESA 1S6PA 1W9HA 3SUNA 4CEZA 3B6PA 1ZBIA 1RILA 2VYPA 1Y64A 4H0PA 3HZ6A 1KXPA 4I6MA 4BRKA 5JMVA 3D2FB 1RBVA 5AQGA 4BVPA 1WSHA 1BUPA 2P5OA 1D9DA 3RTVA 1HPZA 4Y0WA 1T3VA 2E1ZA 3KD1E 2D0CA 1KAXA 1FKOA 3MK6A 3CFRA 4JS4A 1SQKA 2NUBA 4FK0A 3VQQA 3J80O 3SPYA 2HF4A 1I94K 2F96A 3UB5A 3HRGA 1VSJA 2HMIA 4Z4CA 1SKSA 5JLFA 1J5EK 4JYAK 2P9LA 4DWIA 3D0PA 3AA3A 3DLGA 2KLAA 4FO0A 3MX5A 3VF4A 4CEEA 1NKCA 2QEXN 5KI6A 3QINA 3L0QA 1V4TA 4H5VA 1NGJA 3CD6N 4B1WB 3EY1A 2QW9A 3AVBA 4RTFD 4IKFA 4BRDA 3WNGA 4YNQA 2QM1A 4CHZA 4GVMA 4BRCA 3KK3A 3LDSA 3WXMB 4CJPA 2A41A 2PYJA 2VQFK 5JS1A 1K8KB 4GW6A 3OYDA 4M3YA 3J81O 4XIUA 2E4LA 2G8FA 2BTFA 4NO7A 2YJEA 4DV0K 3RSEA 4FPAA 3OYCA 2J4RA 5C25A 3CCUN 2KQ2A 1S1WA 3TAEA 4DV3K 2GWJA 3TSQA 3MN6A 3VGKA 1GLFO 3E66A 3KKRA 3NF7A 2G8VA 2A42A 4JI1K 3GL1A 1RFQA 4CJKA 5AQNA 1LW2A 3MMVA 3V4IA 4J8FA 2IIRA 4BC3A 3K2PA 4JHDB 4PKHA 2JLEA 3SQ1A 1BOTO 3O4QA 1XC9A 2G8IA 1VAZA 4CECA 1RGIA 4BACA 3ZT3A 4CERA 1IG9A 4LFBK 2P1JA 4CESA 3QIPA 2ZD1A 1RBRA 3C94A 1NU0A 3DM2A 5AQWA 4CHYA 2DFEA 4HTLA 4X62K 1DTQA 5HLFA 3OYNA 1HLUA 4WFNL 2WUSA 4CVNE 5LJWA 3VTHA 4ILJA 1B9DA 5TKWA 2IS3A 1VQ9N 3LAKA 4CCHA 4PL8A 1BO5O 1VQLN 3AA5X 3RRHA 5GINA 3S3NA 3ZX0A 2FF3B 3J7AP 1NKEA 1CLQA 3W3DA 3CM5A 5KRSA 2GX9A 1Z6RA 4DTJA 1TVRA 4H5NA 5T7BA 3AVLA 1JLGA 4EP5A 2O8EB 1YUWA 4CFDA 3ZSWA 4I2QA 1KRPA 1S5JA 5HP1A 1NJIO 1QS4A 4O44A 4NCAA 1N33K 2OPPA 3CC4N 4AM6A 2P5GA 4UY8O 3K59A 4EZ9A 4GVEA 2NLXA 3C6HA 2Z1GA 4XH1A 4B9MA 5SZTA 3QEPA 3P1GA 3VF2A 4DQRA 3VF6A 3J8AA 3VQ4A 1QE1A 1TYQA 5GAHP 1VQON 4BR0A 5AZIA 4FJJA 2D0BA 4E7JA 1ZC6A 2ZF5O 3FFKB 3M1FA 3TI0A 5EXWA 5BN8A 2YNFA 3CCJN 1X3NA 5HRSA 5GAEP 1VSKA 2Z1HA 2CGJA 2P9UB 4DTNA 3QB0A 1OH8A 4FVMA 4H4MA 4HUEA 5LY3A 3GE1A 4IOXA 4IBNA 4CF8A 1NK0A 3R9PA 5E84A 4CGDA 1CXUA 5AQYA 1N8RO 4IOAL 4W5RA 3QEVA 1RTJA 5BRFA 3ZYYX 1JLEA 3ENHA 3OBWA 4GV3A 4BRQA 3OW2M 1WSIA 1SKRA 3LM2A 3OA9A 3S3OA 4DU1A 3TAFA 3E9LA 3O8MA 3LDLA 3M8QA 3EZWA 4CK1A 3QBXA 2DTUA 3OYKA 4B8AB 2V7ZA 1KFDA 5FRNA 1X9WA 4EHTA 3AVMA 4RW4A 5CR4A 4FK2A 1YJNN 3PUFA 3NF9A 4IG0A 4CJRA 5AQUA 1BGXT 1DT9A 3H1VX 4DTPA 1YI2N 4QCLA 3MN9A 3AVCA 1UA0A 2HHHK 2W6LA 3HJFA 4RW8A 2HNDA 4DV4K 4IFEA 5AZJA 4FYDA 1NGCA 4ZTJA 3GDQA 4FM2A 1NOZA 3BF1A 1QSYA 4TSXA 4JN4A 1YTAA 1A5XA 3DI6A 3TANA 3HL8A 1G15A 1JCEA 3AV9A 4BWJA 3MWPA 4H0YB 1LV5A 2GWKA 4KKOA 4AQYK 4LF7K 4ILGB 4FJXA 3WXIA 4KHUA 4YY3K 1FXXA 1HNXK 3NHGA 3FZHA 1T03A 5FPNA 1RDCA 3MCAB 3IFRA 2FBTA 1S22A 3G10A 3V9UA 4M41A 4DFPA 3ITHA 2WFBA 5I9EB 5HL7L 3QFUA 5E26A 2NRRA 3R1XA 3NDKA 2ZWHA 4CJSA 3DWLA 1RT2A 5MLCQ 2FF6A 4JRQA 3AVHA 4CI6A 4CZIA 2Y1JA 1BI4A 2YKMA 4FJ5A 3O80A 1RT4A 4BRFA 1O1WA 4KHQA 1NJYA 2DPNA 4CJ7A 4RW9A 4BC4A 4YFUA 2OPRA 2HW3A 2HHVA 4O8KA 3CQYA 2YHAA 3DXKA 4DU4A 2E2PA 2EWSA 1RCHA 4NB4A 3L8BA 1VSEA 1C1CA 4DR5K 2XY5A 1SS6A 3LP2A 1RTHA 4KTWA 4A5AA 4FJMA 2Q0UA 3ULEA 1YITN 1TUYA 1BA1A 4BRAA 4HCBA 4KHNA 1KVAA 4BDZA 2OPSA 5AQJA 3HT3A 1J6ZA 1SZ2A 2HHTA 3IG1A 3DYAA 4JAXA 1NK5A 1RTIA 1QHTA 4KHSA 1VQMN 3KK7A 3K9KA 4FLZA 2R7YA 1OVQA 1HRHA 2KW4A 3V81A 1LAVA 1U6ZA 3IKMA 2OZSA 4JI8K 4DR6K 4FWOA 2UU9K 2VCPA 3DRPA 2XY6A 1B92A 3EKSA 5ADXH 1XWLA 4IOCL 3ZETB 4KHWA 3LM9A 3PSIA 3TAPA 4DSFA 1VSLA 1WBBA 1WSFA 4H0XB 1BDGA 4CF2A 3VQ8A 1TAUA 4Z4HA 4HTUA 1DTTA 3PX0A 4JRPA 1NMDA 3KVGA 4B1UB 2I5JA 3RMDA 4R79A 3OJSA 1OVYA 3CI5A 2I7NA 3K58A 4EAHD 3O3HA 4C1NK 1W2BM 1ASWA 3K57A 5EY4A 5DM6L 4A59A 1Q8IA 3PSFA 3DLLL 3AO3A 3P39A 3H3NO 3CJBA 4F2SA 2BGGA 1WUAA 3VEYA 1HJOA 2VG5A 1L3SA 1TL3A 1D8YA 4FWQA 4RCHA 3ATVA 4DUYK 4DF8A 3AARA 5BREA 1BU6O 3OYBA 1HQUA 2NRXA 2QWMA 2IDOA 1KQSM 3QMLA 4YORA 2O8FB 2IVPA 2F4VK 5M1KA 3K5MA 3BEXA 3JAMO 2IVNA 3LWMA 5KGWA 4CJ4A 2O4GA 4DR4K 1I39A 4ISGA 1W0HA 3MXMA 1TL1A 1Q7YO 1BCOA 4CEFA 3HBTA 4WF9L 3A0IX 2F9WA 3OYIA 3OVNA 3PX4A 3CCMN 4KHYA 3DOLA 3QNNA 4H0OA 3FE1A 4DS5A 1ILYA 1HNZK 1J53A 3H46O 2CGKA 4I2PA 3T3FA 3QETA 3AVNA 2E88A 4LC9B 4NYFA 3S9HA 3M8RA 3WNEA 1SL2A 1S6QA 3L2UA 3SPZA 3A8YA 4O5FA 4ILHA 4B3OA 2QKKA 2NRZA 1TAQA 4CZMA 5KTQA 2YI1A 3JYTA 4C8MA 3WNHA 5HBMA 3SQ2A 5HRPA 3NBPA 4W5TA 4DFMA 4QOZB 3ZEUA 4M45A 3TPQA 4DLEA 3EEQA 2VGNA 3UKUB 4CGHA 3AVJA 3CM6A 1G99A 1T6DA 3E1YA 3OYHA 4PY5A 3R6MA 2IC3A 2FLOA 2XO7A 1TGOA 5ELZA 4KI6A 3CETA 4KH4A 3V9SA 2E20A 4FK4A 5AQRA 5F2RA 4FWNA 3L2RA 3WT0A 4LH4A 1HYSA 2ZJQL 2NZTA 4BRLA 2Q3SA 1U47A 3QEIA 4FZXC 3EN9A 4V19S 3AVIA 4WE1A 3T1AA 4IXCA 3ZSXA 3CCRN 3SMPA 2YKNA 3U6FA 1IO2A 1BHLA 4QS7A 4WQ4C 4K8ZA 4QAGA 4PWDA 4GV6A 4NCGA 5ADXA 1QZ6A 4JKGA 5KPZA 1IKXA 3AO1A 3HP9A 4MDAA 4F4KA 3GG4A 1IKYA 2HBLA 3O9UA 1D5AA 3I8DA 1JCFA 4CW7B 5JLHA 4E1NA 1SV5A 4PHTX 4KRFA 1VQ5N 1RT1A 3V9WA 3CPEA 4DR1K 1YJWN 2ZGZA 1C0FA 4DMNA 3FR0A 3P5JA 4W5QA 3IMXA 1U2VA 4MO4A 1L5UA 4B9SA 3V1RA 4JK9A 4Z4EA 3CYMA 2OYQA 5AQQA 1ZXOA 4FJNA 3UIQA 4H5TA 5LL6Z 3ATUA 2ASMA 4N76A 1DGKN 4FWPA 3OYMA 1VQ4N 2ITGA 1BG3A 1KFSA 4I9QA 4JI7K 2P9KA 3EE9A 2HHXA 3CQ8A 4CJLA 4OKEA 3EL2A 2O8BB 4N41A 4M63C 2PYLA 4M7YA 1VQ6N 2GELA 5HROA 4KAZA 1S1TA 3T69A 3QO9A 2HVIA 1E4FT 1HMVA 4GMJB 1RNHA 2JGUA 2P9NB 3SQ4A 4LH5A 3V9XA 3QICA 4WQ4A 4CGJA 1S1UA 5AQXA 4KPYA 3C6UA 1HR0K 1NGGA 3RMCA 4CGGA 2NRWA 3QFPA 1RBUA 3DLEA 3U8XA 2CGLA 3NGIA 1RDDA 1K9MO 3NMUA 3CC2N 1IJJA 4JD2A 3T19A 1IKWA 5B8HA 3SI6A 5JVHL 1S9GA 1CZ9A 3PLAA 1RT7A 4XH5A 2YNIA 3NCIA 3D45A 4BR5A 4BRHA 3PO5A 2A40A 2D5RA 1ASVA 2I7PA 4BRPA 1U45A 5BPLA 1QVFM 3TTDA 5D3GA 3RVCA 3SUPA 2F7TA 1IKVA 2YHXA 4DTXA 3SBGA 4FSVA 1BA0A 2X6SA 3F2KA 3SUQA 5AQZA 3EKUA 4XH4A 4N5SA 4YDUC 1WAFA 4OGCA 4FJIA 4CJWA 3OJUA 3UKRA 4DQ8A 3CFPA 4OVLA 3D6RA 2OA8A 5GIOA 2P9SA 3O9SA 5GAGP 2DY4A 1UWBA 1IV0A 4JEPA 2OTLN 3O9QA 2GV9A 3BGRA 3BP8A 4GKKK 4OJRA 4PKGA 4FLVA 3D2EA 3VOVA 3KHYA 3EZ5A 1C0UA 3NF8A
chains in the Genus database with same CATH topology
4YOYA 1DT9A 3H1VX 4FPBA 4K42A 1YI2N 3CJAA 3MN9A 4CZHA 4CD1A 4EHUA 4A5BA 2E2OA 3D7EO 5KPTA 4K41A 3A5MC 3LL3A 3MDQA 4IEIA 3G4SN 1D4XA 3S41A 2HOEA 2KKZA 4IFEA 5AZJA 4G9ZA 1GLAG 2P9KB 4MO5A 4F9OA 1NGCA 3G71N 3VTIA 3M5RA 4FWLA 3GDQA 3H45C 3Q7BA 3UKUA 3HOTA 3BF1A 3FZKA 1TYQB 1K73O 1LCUA 3N4PA 2Q31A 4JN4A 2Q97A 3FZLA 3Q7CA 1HKBA 5AZIB 3P4IA 4HWIA 1Q82O 1JCEA 3K9JA 3ZETA 2HSTA 3C7NB 4Z94A 3MWPA 4H0YB 1KAYA 2GWKA 3NVMA 3CXCM 4CZLA 2ASOA 4ILGB 3WXIA 3H3OB 1M90O 4DHYA 3SLCA 2YHWA 1CZAN 2FSNA 3CCVN 1NM1A 1ATSA 2P9PB 3TSPA 3FZHA 3M6GA 5FPNA 4WFAL 3VPZA 5KQDA 3MCAB 3IFRA 4YDUA 4JD2B 1GLBG 1S22A 3A5NC 2WFBA 5I9EB 5HL7L 3OBYA 3QFUA 5E26A 4PL7A 2D0OA 2NRRA 3R1XA 3VGMA 2OANA 2ZWHA 4JKDA 5FPEA 3DWLA 4FWRA 4BRMA 4DCHA 3G25A 3T7ZA 5EVZA 4QS9A 5MLCQ 1NLVA 2FF6A 3MN5A 1YVNA 2QXLA 1VQ7N 2AP1A 4CI6A 4CZIA 1XUPO 2QWNA 2ZGYA 3CCSN 4JK8A 4BR2A 2FSJA 1C0GA 3O80A 2W41A 4BRFA 3ZX2A 3VGLA 1R59O 4CZEA 1NGIA 4CD3A 4MLEA 4DKWA 3O5BA 5AFUA 2DPNA 4RWTA 1YF5L 4BQLA 3VMFB 5GIPA 3D2FA 4BG9A 4YOUA 4CJ7A 1Q18A 4FVUA 3ID8A 4BC4A 4IJAA 3I55N 4B9QA 2JWLA 4M7XA 3JS6A 3CCEN 1NWKA 4O8KA 3UKRB 3SJHA 1V4SA 3CQYA 2NRHA 3SK3A 1XC3A 3DXKA 2E2PA 2EWSA 4NB4A 2P9SB 1P90A 3N4QA 5AQHA 1QQNA 1SS6A 3L4QA 3AGRA 3A5LC 4FL9A 2RE2A 1KD1O 4A5AA 2Q0UA 4H03B 3ULEA 3GOIA 1MA9B 4JKAA 1TUYA 5BRDA 1BA1A 4BRAA 5H1SQ 3QBWA 4YOWA 2V51B 3D2EB 3CPWM 4BVOA 4KH5A 2PBDA 5AQJA 4KH6A 1J6ZA 1SZ2A 1O13A 4JAXA 4JKEA 4CZGA 3OHRA 2UYTA 1VQMN 2PFUA 3DXMA 4IDHA 3KK7A 2P9IB 3BF3A 3K9KA 5GADP 5AQTA 2ITMA 3KWGA 4CZKA 1U6ZA 3IKMA 5AZJB 4B1ZA 4EFHA 2E1YA 5DM7L 3SAFA 4A2AA 4BQZA 2GTDA 4FWOA 3R3LA 3AAQA 2QA4N 2WC9A 2VCPA 5M1OA 3AGKA 4CZFA 4GY2B 2P9NA 3MWTA 4A2BA 3TU5A 3EKSA 3LDNA 4U67L 5ADXH 4IOCL 3ZETB 3LM9A 3SAHA 2HMPA 1VQKN 5AQVA 3CCQN 3EE8A 2QWPA 3CJ7A 1K8KA 3H6EA 4H0XB 1BDGA 4A57A 1RDWX 3O1BA 4BC5A 3CMAN 4IO8A 1YITN 1Q86O 4CBUA 2D1KA 1HPMA 3KWIA 4BGBA 3SAGA 3WUHA 3MN7A 1NMDA 3CJ9A 4QS8A 4WFBL 2ZJRL 4OO1J 3KVGA 4B1UB 2HBMA 3LDOA 3J7ZO 3O1WA 5C0YA 4R79A 1IG8A 4A61A 1GLJO 1HKGA 1OVYA 3SMSA 4FWSA 3CI5A 5F1XA 4C1NI 1XQSC 2I7NA 5KPRA 2QI2A 2FXUA 5AR0A 1ESVA 2GUPA 4EAHD 2IVOA 2JWKA 1Z05A 4CBXA 2AA4A 3W0LA 4C1NK 1W2BM 5EY4A 5DM6L 2E8AA 3LDQA 3O08A 3E9PA 4WYBA 4H5WA 3U9ZA 3VESA 4A59A 4IO9L 3PIPL 1VQNN 3DLLL 4JHDA 3FZMA 5AQIA 3P39A 3H3NO 2VYPA 2YX6A 3CJBA 1Y64A 4XEIA 4H0PA 4B1XB 3HOSA 1WUAA 3HZ6A 1QQMA 1KXPA 3VEYA 3CHWA 1GLCG 1HJOA 4I6MA 4OPAA 3VEXA 5AQKA 4BRKA 1JJ2M 3JXUA 5JMVA 3D2FB 3SBTA 3HSCA 5AQGA 4BVPA 1BUPA 4FWQA 4RCHA 3ATVA 1W97L 1E4GT 5BPMA 5C2FA 4Y0WA 3DXKB 3AARA 5BREA 3QDKA 3G6EN 1BU6O 1T3VA 2E1ZA 4BR4A 1KAXA 3O6WA 3MK6A 2NRXA 1SQKA 2QWMA 4MLHA 1KQSM 3GBTA 3CQXA 3QMLA 2HF4A 3E9OA 4YORA 2Q1NA 1ZBSA 2F9TA 2IVPA 3UB5A 5M1KA 1S3XA 3BEXA 4H0TB 3ULEB 3VETA 3HRGA 1YIJN 4BG8A 2IVNA 1S72N 4NLCA 3VEOA 4WCEL 5JLFA 2P9LA 4ISGA 1LOTB 2KLAA 4FO0A 3MX5A 3VF4A 2QEXN 1Q7YO 3DXMB 3HBTA 2ASPA 2WBNA 4NLBA 1H1VA 4L3QA 2D0PA 3L0QA 4BRGA 4WF9L 3LDPA 3A0IX 2CH5A 1V4TA 2F9WA 3CF5L 4H5VA 3CCMN 1JCGA 1NGJA 3CD6N 4BY9C 4B1WB 4H0OA 2QW9A 3FE1A 4JK7A 2YJFA 4RTFD 2HBKA 4BRDA 1QVGM 1ILYA 5BRHA 3H46O 2CGKA 2QM1A 3DJCA 3MX2A 3C7NA 4BRCA 2E88A 3WXMB 3WEEB 2E2NA 4LC9B 2A41A 3C0BA 3FLCO 4YOVA 3A8YA 1DEJA 4ILHA 4O5FA 1ATRA 4B1VA 1K8KB 2P9PA 2NRZA 2Q36A 3HTVA 4CZMA 2BTFA 5AQLA 4BGAA 4NO7A 1T44A 1HUXA 3P31A 2YJEA 2YI1A 3RSEA 3F9MA 2YCHA 4JKCA 3U9DA 1NGFA 4FPAA 2HF3A 2J4RA 3CCUN 4BRIA 2QWLA 3IUCA 2GWJA 2HBJA 3TSQA 4WQ5C 3MN6A 3VGKA 1GLFO 3E66A 5M1NA 2A42A 3ZEUA 3TPQA 3GL1A 1RFQA 2VGNA 3UKUB 5AQNA 2BUPA 4H0VB 3B8AX 1VQPN 3MMVA 3VEZA 4J8FA 4EIAA 3NVKA 2IIRA 4BC3A 1G99A 1NGHA 4FOIA 3CC7N 1T6DA 3U4LA 4KBOA 4JHDB 4PKHA 5C10A 3E1YA 1GLDG 4FWMA 1P8ZA 3R6MA 5LJVA 2FLOA 2P9UA 3C65A 1BOTO 5AQSA 1SAZA 1VAZA 2QWQA 5BR9A 5ELZA 1RGIA 3L4IA 3CETA 3I8BA 4KH4A 2E20A 5AQRA 4H5RA 5F2RA 2ZJPL 4FWNA 1X9JA 2CH6A 3WT0A 4PKIA 5C15A 2ZJQL 2NZTA 4BRLA 3VEWA 4JKBA 2W40A 5AQWA 4HTLA 3EN9A 1YJ9N 1BWFO 5CHIA 1VQ8N 4OPHA 3TSUA 1HLUA 4WFNL 2RHKA 2WUSA 4IXCA 1NGDA 2V52B 3CCRN 3CCLN 3BUZB 5LJWA 3H1QA 3SMPA 3VTHA 3ENBA 4ILJA 3WXJA 5TKWA 3ZX3A 4QS7A 4WQ4C 1VQ9N 4PL8A 1BO5O 4GV6A 3ID6A 1YAGA 4BC2A 1EQYA 4BR7A 5C2DA 1QZ6A 5ADXA 1VQLN 3VEVA 1NGAA 4JKGA 2P9LB 5KPZA 5GINA 1M1KO 3ZX0A 2Q0RA 3WQTA 2FF3B 4MDAA 2VWBA 2P9IA 3GG4A 4MDBA 5TKYA 4E1JA 3W3DA 2HBLA 2A3ZA 3O9UA 3AY9A 2OTJN 2GX9A 1Z6RA 3CIPA 2VGMA 5HOOA 1JCFA 1NGBA 5JLHA 3PIOL 4H5NA 5F0XA 2Q2RA 3VENA 1HKCA 4PHTX 1VQ5N 4WQ5A 3EO3A 1YUWA 3DAWA 1DKGD 3CPEA 1YJWN 4JKFA 3FGUA 3M3ZA 2ZGZA 1C0FA 2NRTA 2D4WA 3FR0A 4CZJA 4ISEA 1NJIO 3IMXA 3O9RA 1U2VA 4MO4A 1Q81O 4IJNA 4JK9A 5BN9A 5AFUH 1WOQA 4IWVA 3WXKA 4IEEA 4C23A 2KHOA 5C12A 3CC4N 4AM6A 1K8AO 5AQQA 1ZXOA 4FOEA 4GV9A 4GNIA 3UE5A 4H5TA 2V7YA 3ATUA 3I33A 1QHAA 4UY8O 3CERA 3HM8A 3IDHA 2A6AA 1EO1A 3O4WA 2ASMA 4GVEA 1DGKN 3RSEB 4FWPA 2NLXA 5EX5A 1VQ4N 3C6HA 5CE3A 1BG3A 5AQPA 2P9KA 4XH1A 3EE9A 3CMEN 4JNEA 3EL2A 3HI0A 3VF2A 4M63C 5JICA 4M7YA 3J8AA 3VF6A 1VQ6N 1TYQA 4FWKA 5GAHP 1KAZA 2GELA 1ATNA 3ZEUB 3T69A 4BR9A 1VQON 4BR0A 1E4FT 5AZIA 1ZC6A 2PAVA 2P9NB 2ZF5O 3FFKB 3M1FA 1QQOA 1OKJA 5EXWA 5BN8A 3QICA 4WQ4A 3CCJN 1X3NA 3KZBA 4K43A 5AQXA 5M1QA 4A62A 5GAEP 3I56N 1NGGA 2CGJA 2NRWA 3QFPA 3U8XA 5AQFA 2CGLA 3F5TA 5FPMA 4YOXA 1K9MO 2P9UB 3L6QA 3NMUA 3CC2N 1IJJA 3QB0A 3ENOA 4JD2A 5AQOA 1YHQN 1NGEA 2GEMA 4BREA 5B8HA 5JVHL 3TTFA 3WXLA 3A5OC 2FSKA 5LY3A 3GE1A 2A5XA 4IOXA 1MWMA 1YXQA 3C6AA 4B1YB 3PLAA 4XH5A 4DB3A 3FZFA 3R9PA 2YHYA 3TTCA 5E84A 4BR5A 4ISFA 1MDUB 1RDUA 4BRHA 2A40A 4AM7A 5AQYA 4K25A 1N8RO 4IOAL 2I7PA 4BRPA 2QTDA 5M1FA 5BRFA 1X3MA 3ZYYX 3CJ1A 5BPLA 1QVFM 3ENHA 4U7BA 3OBWA 3TTDA 2QWRA 2NNWA 4GV3A 3RVCA 2F7TA 2YHXA 4BRQA 4JKGB 3SBGA 4AF1A 5AQMA 3O9TA 1BA0A 2BH1A 4FSVA 3OW2M 3LM2A 3F2KA 2E2QA 2NRVA 5JVGL 1MWKA 3OA9A 5AQZA 3EKUA 3WQUA 4XH4A 4YDUC 2QWOA 1GLLO 3P38A 4YOTA 4I6MB 1HX1A 3E9LA 1GLEG 3O8MA 3MCPA 1KC8O 3LDLA 3UKRA 4DQ8A 3EZWA 1NBWA 3QBXA 3D6RA 2V7ZA 4O8UA 5EOYA 5BPNA 4BROA 4BRNA 5GIOA 2P9SA 3O9SA 5GAGP 4EHTA 3WEEA 4JEPA 2H3GX 3VERA 5CR4A 5KQ8A 4CBWA 2OTLN 1YJNN 1TUUA 3O9QA 4IZ9A 5FPDA 1T6CA 3BP8A 4JKHA 4PKGA 3R8EA 3AAPA 3D2EA 1U2VB 3CJCA 3VOVA 5M1PA 3KHYA 1QZ5A 5AQUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TKW A;  2BH1 A;  1W97 L;  4PHT X;  1YF5 L; 
#chains in the Genus database with same CATH topology
 4JI4 K;  3L2W A;  4K42 A;  3RWU A;  4FZY A;  3DLH A;  1GOB A;  1K6Y A;  4M3X A;  3A5M C;  1C0T A;  3MDQ A;  2VWK A;  4CGF A;  1D4X A;  3S41 A;  1KVB A;  2HOE A;  1EKE A;  2FBV A;  4KHP K;  3E01 A;  3H45 C;  4E7I A;  3Q7B A;  3UKU A;  4DG1 A;  1K73 O;  3NAE A;  3AO2 A;  1LCU A;  2A1R A;  3FZL A;  3Q7C A;  1HKB A;  3HPH A;  4LY7 A;  3P4I A;  4HWI A;  3K9J A;  4C8N A;  4Z94 A;  3V9Z A;  1OH5 A;  4DQI A;  3MEG A;  1JLA A;  4DHY A;  3CCV N;  1ATS A;  3M6G A;  3SV4 A;  5KQD A;  4DR3 K;  4C8K A;  4YDU A;  1WSJ A;  4N56 A;  3SQ0 A;  3V1O A;  4B9N A;  1X9S A;  2OAN A;  3V6D A;  1S9E A;  5FPE A;  4FWR A;  4BRM A;  4JI5 K;  1VSH A;  1U49 A;  5EVZ A;  1NKB A;  4DTO A;  1XMO K;  2AP1 A;  4HVJ A;  2ZGY A;  3LAL A;  1C0G A;  2O8C B;  4CFB A;  2W41 A;  3ZX2 A;  4FZZ A;  1NGI A;  5I42 A;  4CD3 A;  4MLE A;  3LPU A;  2XRI A;  4LF9 K;  1YF5 L;  4BQL A;  3D2F A;  1QSL A;  4FVU A;  2DFF A;  4IJA A;  2O8D B;  1CXQ A;  1NWK A;  3B6O A;  5LMN K;  1V4S A;  2F8T A;  3LAN A;  3SK3 A;  4GKJ K;  4M3T A;  5I3U A;  1L3U A;  1P90 A;  1IH7 A;  3N4Q A;  4OKK A;  1FKP A;  3PY8 A;  4FL9 A;  2RE2 A;  1Z25 A;  2B6A A;  4O55 A;  2RKI A;  1JL2 A;  1MA9 B;  5BRD A;  2E6L A;  5IWA K;  4YOW A;  3CPW M;  1DLO A;  3RMB A;  2PBD A;  3NH1 A;  4B3R K;  2WON A;  4CHP A;  3M8S A;  3THW B;  4JS5 A;  2P9I B;  1X9M A;  4K0K K;  2HVH A;  1C1B A;  5AQT A;  2O8B A;  4HUF A;  5DM7 L;  2YNH A;  3PX6 A;  3H08 A;  4B1Z A;  4UQG A;  2GTD A;  4CZF A;  1WSE A;  2P9N A;  4ID1 A;  4A2B A;  1YT3 A;  4BE0 A;  4O0J A;  4FM1 A;  3J7Y P;  1VQK N;  5AQV A;  2ZQB A;  1K8K A;  1JLF A;  3O1B A;  1RT6 A;  1Q86 O;  4N47 A;  4CBU A;  4O4G A;  1NMN A;  3KWI A;  2ZM6 K;  3SAG A;  3WUH A;  4JV5 K;  2X78 A;  3CJ9 A;  4JI2 K;  3ZT2 A;  1MU2 A;  2IGI A;  5FRM A;  2ZJR L;  3NH0 A;  3J7Z O;  5LMU K;  4FJG A;  4CEA A;  4A61 A;  5C0Y A;  1GLJ O;  1NNE A;  4E7K A;  5KPR A;  1A5V A;  1ESV A;  4KI4 A;  4ELV A;  4CBX A;  2AA4 A;  3L3V A;  2Y1I A;  2E8A A;  3LDQ A;  3O08 A;  4Q5V A;  4WYB A;  3C95 A;  2EHG A;  1TV6 A;  1VQN N;  4FLU A;  4JHD A;  3FZM A;  5AQI A;  3HOS A;  2YX6 A;  4XEI A;  4B1X B;  2B5J A;  4NXN K;  4F3O A;  1QQM A;  3VEX A;  5AQK A;  4OGE A;  2G8H A;  3HSC A;  1E4G T;  3HST B;  1KTQ A;  1OH7 A;  3QDK A;  3G6E N;  4DV2 K;  3THY B;  4BR4 A;  3O6W A;  1VRU A;  3GBT A;  3CQX A;  3E9O A;  3K5L A;  4DU3 A;  2Q1N A;  1ZBS A;  2F9T A;  3KLE A;  4H0T B;  4KV8 A;  1YIJ N;  3ULD A;  1S72 N;  1XHX A;  4AHU A;  3BZK A;  1LOT B;  3AVF A;  3DXM B;  2ASP A;  2P51 A;  2WBN A;  3VQ6 A;  5BR8 K;  2ETJ A;  1CZB A;  3LWL A;  2D0P A;  4BRG A;  2CH5 A;  3KLG A;  3CF5 L;  4BY9 C;  2O8E A;  3ZSR A;  2YJF A;  2HBK A;  1QVG M;  3DJC A;  3VQ9 A;  3MX2 A;  4PUO A;  3HYF A;  3WEE B;  2UUC K;  3C0B A;  3F73 A;  4DV7 K;  3FLC O;  4DR2 K;  3ZCM A;  1DEJ A;  1KLM A;  4X65 K;  3A2F A;  4W5O A;  3TR8 A;  1JXB A;  2Q36 A;  2GUI A;  3HTV A;  3S3M A;  4BGA A;  3NFA A;  4CJU A;  1BIZ A;  2YCH A;  3U9D A;  3NE6 A;  3BY5 A;  4BRI A;  2QWL A;  3SJJ A;  4FJL A;  1BIU A;  4DF4 A;  2HBJ A;  2XHB A;  4WQ5 C;  1Q9Y A;  3U3G A;  4H0V B;  2QKB A;  3SYZ A;  1BL3 A;  4EIA A;  3NVK A;  2FC0 A;  2X6N A;  3CC7 N;  4KBO A;  5C10 A;  2RN2 A;  4RW6 A;  2HHW A;  2KFZ A;  3C65 A;  2P9U A;  5AQS A;  4FJH A;  1SAZ A;  2O8D A;  4R5P A;  2G8U A;  4H5R A;  3KIO A;  4PKI A;  2WOM A;  4DSE A;  3CFO A;  4ELU A;  3KK1 A;  3KKS A;  5FDL A;  3VEW A;  4FLX A;  4JKB A;  3KD5 E;  4OLA A;  3LZI A;  4OPH A;  4I7F A;  1NGD A;  3DRS A;  2V52 B;  3ENB A;  3ZX3 A;  2XY7 A;  1QSS A;  1TKX A;  5HRR A;  3ID6 A;  1YAG A;  4BC2 A;  4BR7 A;  5C2D A;  1U04 A;  1ZBL A;  4DSK A;  1NGA A;  2P9L B;  1M1K O;  4IFY A;  1Q81 O;  3WQT A;  2P9I A;  4MDB A;  4PA1 A;  4E1J A;  1F21 A;  2A3Z A;  4CF0 A;  1REV A;  2VGM A;  1NGB A;  4AHR A;  3PIO L;  5F0X A;  2Q2R A;  1HKC A;  3TAG A;  1ASU A;  1LWE A;  4WQ5 A;  3DAW A;  5IT9 O;  3THX B;  4FCY A;  1DKG D;  4JKF A;  1NK7 A;  3M3Z A;  3JSM A;  4H8K A;  2D4W A;  3AA2 A;  3HVR A;  2W6K A;  4CZJ A;  4ISE A;  2YHB A;  3O9R A;  3LZJ A;  3DLB A;  5BN9 A;  3WXK A;  4Y1C A;  4C23 A;  2KHO A;  4HHT A;  1K8A O;  1IBK K;  4FOE A;  2BDP A;  4GV9 A;  4GNI A;  4G1Q A;  2V7Y A;  4NYN A;  3AVG A;  3O4W A;  3VQ7 A;  1L3V A;  3RSE B;  1HNI A;  3LP1 A;  4KO0 A;  2E5L K;  2DFH A;  4KB0 A;  3CME N;  4JNE A;  4CJT A;  2AJQ A;  4FWK A;  1KAZ A;  4BR9 A;  3VQC A;  3DRR A;  2HB5 A;  3ZSO A;  5FLX O;  4A62 A;  4M3W A;  3I56 N;  4DTM A;  3O3F A;  5FRO A;  2O4I A;  5AQF A;  1VHX A;  5FPM A;  3L6Q A;  3ENO A;  5AQO A;  1YHQ N;  1KCF A;  4BRE A;  3BZC A;  1RDA A;  2OPQ A;  3WXL A;  2G8K A;  4H4O A;  3THY A;  2A5X A;  1MWM A;  1HYV A;  1EWR A;  1YXQ A;  3C6A A;  4B1Y B;  2LSN A;  3L2Q A;  2XY8 A;  3FZF A;  4DFK A;  2YHY A;  5JS2 A;  3AVK A;  3TTC A;  4ISF A;  1MDU B;  4HUG A;  4AM7 A;  4B9L A;  4K25 A;  3HO1 A;  2HHS A;  1C6V A;  3OYJ A;  4X64 K;  4LF6 K;  3BDP A;  3MXI A;  5AQM A;  2BH1 A;  3TAR A;  4DSJ A;  4BDY A;  2E2Q A;  2NRV A;  1VSI A;  2BE2 A;  2YNG A;  1XNR K;  1JLB A;  4B08 A;  2QWO A;  1GLL O;  1GLE G;  1KC8 O;  4IG3 A;  1IBM K;  1KLN A;  5AJ3 K;  4O8U A;  5EOY A;  5BPN A;  4DS4 A;  5KGX A;  3WEE A;  1KSP A;  5KQ8 A;  4FLY A;  4CBW A;  1TUU A;  5FPD A;  3K0S A;  1NK9 A;  3QLH A;  1SKW A;  4IDK A;  2OZM A;  3AAP A;  2PY5 A;  4E0D A;  4DV1 K;  4LFA K;  3NH2 A;  1Q9X A;  3CJA A;  3KLF A;  4A5B A;  1L3T A;  2FBX A;  3D7E O;  3KJV A;  1ZYQ A;  4IEI A;  1GLA G;  4KFB A;  1VSD A;  5K14 A;  4F9O A;  3VTI A;  1S1X A;  3M5R A;  4FWL A;  3HOT A;  4FJ9 A;  3FZK A;  1TYQ B;  2IOC A;  2ATQ A;  5AZI B;  3ZET A;  3C7N B;  3VN5 A;  1UAX A;  3NF6 A;  3NVM A;  3IRX A;  4FW2 A;  1M90 O;  3SLC A;  2YHW A;  1CZA N;  4OLB A;  3HM9 A;  2P9P B;  4WFA L;  1GLB G;  1NK8 A;  3A5N C;  1U48 A;  1I3A A;  4DQS A;  1TKD A;  3MAQ A;  4JKD A;  1JLQ A;  1W7A A;  4DCH A;  3T7Z A;  3C6T A;  3SZ2 A;  3O4N A;  4QS9 A;  4JI0 K;  1NLV A;  1BIS A;  3MN5 A;  1EXQ A;  3LP3 A;  1XUP O;  4FLT A;  4C8L A;  3CCS N;  4BR2 A;  2FSJ A;  3OYG A;  2D0A A;  3ZT4 A;  1R59 O;  1TK0 A;  1R0A A;  3HPO A;  4RWT A;  3VMF B;  1LAW A;  3ZT1 A;  4YOU A;  5A2Q O;  4B9Q A;  2JWL A;  4B3S K;  3JS6 A;  3CCE N;  4KTQ A;  2YV0 X;  3OS0 A;  3THX A;  4FJ7 A;  2NRH A;  4CIG A;  5J1E A;  4M3U A;  1JLC A;  4CE9 A;  5J2P A;  5J2N A;  1QQN A;  2O8F A;  3A5L C;  4H03 B;  3GOI A;  1BQN A;  5H1S Q;  1HYZ A;  3QBW A;  2EX3 A;  1OH6 A;  2KFN A;  4KH5 A;  5KRT A;  2QXF A;  2UXB K;  1N6Q A;  2UXD K;  4DTU A;  3OHR A;  2PFU A;  3OY9 A;  4CGI A;  3RRG A;  3IAY A;  2B4J A;  3BF3 A;  1A5W A;  2W42 A;  3DOK A;  4CJV A;  2ITM A;  5AZJ B;  4DQP A;  3LP0 A;  4A2A A;  4BQZ A;  3VA3 A;  4L8R B;  2WC9 A;  4GY2 B;  3MWT A;  4I9L A;  2HHU A;  1NK4 A;  3O3G A;  3TU5 A;  4O5B A;  1XHZ A;  3HXM A;  3LDN A;  4KB1 A;  3CCQ N;  1ZBH A;  3NGZ A;  3H6E A;  1WNS A;  4A57 A;  5EU7 A;  3ZLJ A;  3RR7 A;  1ZBF A;  1HPM A;  1RT3 A;  3QES A;  1TKZ A;  3MN7 A;  3V1Q A;  4WFB L;  4OO1 J;  2HBM A;  3K5O A;  1T8E A;  3PV8 A;  3O1W A;  4AH9 A;  1IG8 A;  1HKG A;  4Z0U A;  3SMS A;  4FWS A;  1C0M A;  4C1N I;  3L3U A;  2FBY A;  5AR0 A;  2GUP A;  2IVO A;  1Z05 A;  3W0L A;  5J2Q A;  4CHQ A;  4H5W A;  3U9Z A;  1BI4 B;  4CK3 A;  4IO9 L;  3PIP L;  4CF9 A;  1IBL K;  2HHQ A;  1NJW A;  2X74 A;  4MFB A;  1RBS A;  3CHW A;  1GLC G;  4OPA A;  1JJ2 M;  3VQA A;  3JXU A;  3SBT A;  1JXE A;  4PQU A;  1W97 L;  5BPM A;  5C2F A;  4Q0B A;  4O0I A;  1EX4 A;  3DXK B;  1LWF A;  3CG7 A;  4OPK A;  3OYE A;  4FM0 A;  4MLH A;  1NJX A;  4B9T A;  3OS2 A;  4LSN A;  4LD0 A;  1LW0 A;  2E6M A;  1S3X A;  3VET A;  3ULE B;  4BG8 A;  4NLC A;  3VEO A;  3ZT0 A;  1GOC A;  4WCE L;  3TWH A;  3OS1 A;  1UA1 A;  5CYM A;  4E7H A;  3MED A;  4BDP A;  5SWM A;  4NLB A;  1H1V A;  4L3Q A;  4ICL A;  1JL1 A;  3LDP A;  1VK0 A;  1YVU A;  1JCG A;  3IS9 A;  4X66 K;  1NJZ A;  4JK7 A;  3K5N A;  5BRH A;  3THV A;  3C7N A;  3WNF A;  4Z4I A;  1HNV A;  2E2N A;  4FXD A;  3VA0 A;  1N36 K;  3ALY A;  1E3M A;  4YOV A;  3ASM A;  1ATR A;  4B1V A;  2P9P A;  3HVT A;  4BWM A;  3RR8 A;  5AQL A;  1T44 A;  1HUX A;  3P31 A;  2KTQ A;  3F9M A;  4JKC A;  1NGF A;  1WLJ A;  4J2E A;  2HF3 A;  3DLK A;  3IUC A;  4B9V A;  1XNQ K;  5M1N A;  4B3M K;  4CEQ A;  1WBD A;  4KTZ A;  2BUP A;  3HK2 A;  3B8A X;  1VQP N;  3VEZ A;  1N5Y A;  1EWQ A;  1NGH A;  4FOI A;  3U4L A;  1ZBU A;  1GOA A;  4B9U A;  4F3T A;  1GLD G;  4FWM A;  1P8Z A;  5DK5 A;  3MXJ A;  4CIF A;  5LJV A;  3OYA A;  4JI6 K;  2QWQ A;  5BR9 A;  3SUO A;  4CK2 A;  3U3Y A;  3KLI A;  4J2D A;  3L4I A;  3I8B A;  2VG7 A;  4LF4 K;  4YHH K;  2ZJP L;  1X9J A;  2CH6 A;  5C15 A;  4DQQ A;  1WSG A;  2W40 A;  1YJ9 N;  1BWF O;  5CHI A;  1VQ8 N;  3TSU A;  2RHK A;  4CJF A;  3CCL N;  3BUZ B;  3KLH A;  3H1Q A;  4NCB A;  3VQD A;  3WXJ A;  4CF1 A;  1B9F A;  1VRT A;  1EQY A;  3L2V A;  4FLW A;  3OTO K;  1D9F A;  3VEV A;  4W5N A;  2PZS A;  3QEX A;  3QEW A;  4M42 A;  2OCE A;  2Q0R A;  2VWB A;  5TKY A;  1BQM A;  3AY9 A;  1NK6 A;  3AA4 A;  2OTJ N;  3CIP A;  5HOO A;  4E89 A;  1WAJ A;  3I0R A;  4EZ6 A;  5J2M A;  3VEN A;  2VQE K;  4K8X A;  4DLG A;  3EO3 A;  1J9A A;  4AHT A;  4ELT A;  1T7P A;  3FGU A;  4CIE A;  1QQC A;  2NRT A;  3AVA A;  1J5O A;  4CJQ A;  4ZTF A;  2BAN A;  1J54 A;  1TKT A;  4IJN A;  1Z26 A;  1WOQ A;  4IWV A;  5AFU H;  4IEE A;  5C12 A;  4Z4F A;  4LF5 K;  3DLR A;  1YTU A;  3UE5 A;  4DV6 K;  1BCM A;  3I33 A;  1QHA A;  3CER A;  3HM8 A;  3IDH A;  2A6A A;  1EO1 A;  1U4B A;  5EX5 A;  5CE3 A;  3RMA A;  4DUZ K;  1SL0 A;  2VG6 A;  5AQP A;  4M3Z A;  3HI0 A;  2UUA K;  4E3S A;  5JIC A;  3VQB A;  4CFC A;  1ATN A;  3ZEU B;  1RBT A;  3QIO A;  3M8P A;  4KRE A;  2PAV A;  4AHC A;  1QQO A;  1OKJ A;  1VSF A;  4DV5 K;  4NXM K;  1RT5 A;  3KZB A;  4K43 A;  5M1Q A;  4OPJ A;  5E41 A;  3F5T A;  1SUQ A;  4YOX A;  1TK5 A;  1NGE A;  2GEM A;  4J2B A;  4CEB A;  3TTF A;  3A5O C;  2FSK A;  1EET A;  1HQE A;  4EP4 A;  4BE1 A;  4DB3 A;  3MEE A;  3ISN C;  1RDU A;  4JLH A;  4LF8 K;  5CZ1 A;  2QTD A;  5M1F A;  1SL1 A;  1X3M A;  3CJ1 A;  4U7B A;  2O8C A;  2QWR A;  4CJ5 A;  2NNW A;  1T05 A;  3T1Y K;  4JKG B;  4AF1 A;  4AHV A;  3O9T A;  1FJG K;  5JVG L;  1MWK A;  3WQU A;  5CYQ A;  3P38 A;  4YOT A;  4I6M B;  1HX1 A;  2KZM A;  3MCP A;  3SNN A;  5CY4 A;  4LFC K;  1NBW A;  3PO4 A;  2A1S A;  4CHN A;  1HNW K;  4BRO A;  4BRN A;  4F8R A;  4ZHR A;  3VER A;  2H3G X;  4MQ3 A;  4CHO A;  4IZ9 A;  1T6C A;  4JKH A;  4LSL A;  3R8E A;  1U2V B;  3CJC A;  5M1P A;  1KVC A;  1QZ5 A;  3I0S A;  1N32 K;  3KK2 A;  4YOY A;  1Y97 A;  3MEC A;  4FPB A;  4CZH A;  4CD1 A;  1RDB A;  4EHU A;  3THW A;  5C42 A;  2E2O A;  5KPT A;  3DMJ A;  4E19 A;  4K41 A;  2G8W A;  3LL3 A;  3G4S N;  2HNY A;  1EP4 A;  1VSM A;  2KKZ A;  1S1V A;  2IAJ A;  4G9Z A;  3KTQ A;  2P9K B;  4MO5 A;  3G71 N;  1HJR A;  3N4P A;  1C1A A;  3TAB A;  2Q31 A;  1LWC A;  2Q97 A;  4DSL A;  1FW6 A;  1Q82 O;  2HST A;  4E7L A;  1JKH A;  1KAY A;  4B3T K;  4M3R A;  3CXC M;  4CZL A;  2ASO A;  1RTD A;  5HRN A;  4ID5 A;  3H3O B;  1XMQ K;  2FSN A;  1ITG A;  1NM1 A;  2HNZ A;  3T1H K;  3TSP A;  3TAM A;  3VPZ A;  5DMR A;  4RG8 A;  5C24 A;  4JD2 B;  2UUB K;  3OBY A;  4PL7 A;  4F2R A;  1X1P A;  2D0O A;  3VGM A;  4FJ8 A;  1XI1 A;  2QK9 A;  3G25 A;  4AIL C;  1VQ7 N;  1YVN A;  2QXL A;  4E1M A;  4HCC A;  2QWN A;  2RF2 A;  4OKJ A;  4DFJ A;  4FJK A;  4JK8 A;  4JI3 K;  1WB9 A;  4Z4G A;  1TK8 A;  3ZSV A;  2WTU A;  1WN7 A;  3VGL A;  4CZE A;  4DKW A;  3O5B A;  4CEO A;  5AFU A;  5GIP A;  4BG9 A;  2Z1J A;  4DTS A;  1Q18 A;  4Y1D A;  3ID8 A;  3I55 N;  4M7X A;  3UKR B;  3SJH A;  1XC3 A;  3ZSQ A;  2P9S B;  3VQP A;  5AQH A;  3L4Q A;  3SV3 A;  3AGR A;  4FW1 A;  4OX9 K;  1KD1 O;  3QER A;  4IFV A;  1FK9 A;  2RPI A;  4JKA A;  2F8S A;  4DTR A;  2V51 B;  3D2E B;  4BVO A;  3AO5 A;  4KH6 A;  3VQE A;  1O13 A;  3EYZ A;  4JKE A;  4CJ3 A;  3P83 D;  2VWJ A;  4CZG A;  2UYT A;  3ZSY A;  2KZZ A;  3DXM A;  4IDH A;  1UOC A;  4RW7 A;  5GAD P;  4AHS A;  4CFA A;  4B8C A;  3KWG A;  4CZK A;  4EFH A;  2E1Y A;  3SAF A;  3R3L A;  3AAQ A;  2QA4 N;  4J2A A;  5M1O A;  3AGK A;  3ZSZ A;  3FFI A;  5CZ2 A;  4U67 L;  3QNO A;  4C8O A;  4DR7 K;  3SAH A;  2HMP A;  3OYF A;  3EE8 A;  2QWP A;  3CJ7 A;  3TAQ A;  3NGY A;  4DSI A;  1RDW X;  4BC5 A;  3CMA N;  4BE2 A;  4IO8 A;  3HP6 A;  2D1K A;  3G0Z A;  4BGB A;  2Z1I A;  4QS8 A;  3LPT A;  2UXC K;  1QTM A;  3AO4 A;  3LDO A;  3F9K A;  1N34 K;  1NOY A;  2GBZ A;  5F1X A;  1XQS C;  2QI2 A;  2FXU A;  2ZE2 A;  3SCX A;  3LAM A;  2JWK A;  3HPG A;  3VQ5 A;  4CED A;  3OYL A;  1NG9 A;  4CJE A;  3E9P A;  3VES A;  1S6P A;  1W9H A;  3SUN A;  4CEZ A;  3B6P A;  1ZBI A;  1RIL A;  2VYP A;  1Y64 A;  4H0P A;  3HZ6 A;  1KXP A;  4I6M A;  4BRK A;  5JMV A;  3D2F B;  1RBV A;  5AQG A;  4BVP A;  1WSH A;  1BUP A;  2P5O A;  1D9D A;  3RTV A;  1HPZ A;  4Y0W A;  1T3V A;  2E1Z A;  3KD1 E;  2D0C A;  1KAX A;  1FKO A;  3MK6 A;  3CFR A;  4JS4 A;  1SQK A;  2NUB A;  4FK0 A;  3VQQ A;  3J80 O;  3SPY A;  2HF4 A;  1I94 K;  2F96 A;  3UB5 A;  3HRG A;  1VSJ A;  2HMI A;  4Z4C A;  1SKS A;  5JLF A;  1J5E K;  4JYA K;  2P9L A;  4DWI A;  3D0P A;  3AA3 A;  3DLG A;  2KLA A;  4FO0 A;  3MX5 A;  3VF4 A;  4CEE A;  1NKC A;  2QEX N;  5KI6 A;  3QIN A;  3L0Q A;  1V4T A;  4H5V A;  1NGJ A;  3CD6 N;  4B1W B;  3EY1 A;  2QW9 A;  3AVB A;  4RTF D;  4IKF A;  4BRD A;  3WNG A;  4YNQ A;  2QM1 A;  4CHZ A;  4GVM A;  4BRC A;  3KK3 A;  3LDS A;  3WXM B;  4CJP A;  2A41 A;  2PYJ A;  2VQF K;  5JS1 A;  1K8K B;  4GW6 A;  3OYD A;  4M3Y A;  3J81 O;  4XIU A;  2E4L A;  2G8F A;  2BTF A;  4NO7 A;  2YJE A;  4DV0 K;  3RSE A;  4FPA A;  3OYC A;  2J4R A;  5C25 A;  3CCU N;  2KQ2 A;  1S1W A;  3TAE A;  4DV3 K;  2GWJ A;  3TSQ A;  3MN6 A;  3VGK A;  1GLF O;  3E66 A;  3KKR A;  3NF7 A;  2G8V A;  2A42 A;  4JI1 K;  3GL1 A;  1RFQ A;  4CJK A;  5AQN A;  1LW2 A;  3MMV A;  3V4I A;  4J8F A;  2IIR A;  4BC3 A;  3K2P A;  4JHD B;  4PKH A;  2JLE A;  3SQ1 A;  1BOT O;  3O4Q A;  1XC9 A;  2G8I A;  1VAZ A;  4CEC A;  1RGI A;  4BAC A;  3ZT3 A;  4CER A;  1IG9 A;  4LFB K;  2P1J A;  4CES A;  3QIP A;  2ZD1 A;  1RBR A;  3C94 A;  1NU0 A;  3DM2 A;  5AQW A;  4CHY A;  2DFE A;  4HTL A;  4X62 K;  1DTQ A;  5HLF A;  3OYN A;  1HLU A;  4WFN L;  2WUS A;  4CVN E;  5LJW A;  3VTH A;  4ILJ A;  1B9D A;  5TKW A;  2IS3 A;  1VQ9 N;  3LAK A;  4CCH A;  4PL8 A;  1BO5 O;  1VQL N;  3AA5 X;  3RRH A;  5GIN A;  3S3N A;  3ZX0 A;  2FF3 B;  3J7A P;  1NKE A;  1CLQ A;  3W3D A;  3CM5 A;  5KRS A;  2GX9 A;  1Z6R A;  4DTJ A;  1TVR A;  4H5N A;  5T7B A;  3AVL A;  1JLG A;  4EP5 A;  2O8E B;  1YUW A;  4CFD A;  3ZSW A;  4I2Q A;  1KRP A;  1S5J A;  5HP1 A;  1NJI O;  1QS4 A;  4O44 A;  4NCA A;  1N33 K;  2OPP A;  3CC4 N;  4AM6 A;  2P5G A;  4UY8 O;  3K59 A;  4EZ9 A;  4GVE A;  2NLX A;  3C6H A;  2Z1G A;  4XH1 A;  4B9M A;  5SZT A;  3QEP A;  3P1G A;  3VF2 A;  4DQR A;  3VF6 A;  3J8A A;  3VQ4 A;  1QE1 A;  1TYQ A;  5GAH P;  1VQO N;  4BR0 A;  5AZI A;  4FJJ A;  2D0B A;  4E7J A;  1ZC6 A;  2ZF5 O;  3FFK B;  3M1F A;  3TI0 A;  5EXW A;  5BN8 A;  2YNF A;  3CCJ N;  1X3N A;  5HRS A;  5GAE P;  1VSK A;  2Z1H A;  2CGJ A;  2P9U B;  4DTN A;  3QB0 A;  1OH8 A;  4FVM A;  4H4M A;  4HUE A;  5LY3 A;  3GE1 A;  4IOX A;  4IBN A;  4CF8 A;  1NK0 A;  3R9P A;  5E84 A;  4CGD A;  1CXU A;  5AQY A;  1N8R O;  4IOA L;  4W5R A;  3QEV A;  1RTJ A;  5BRF A;  3ZYY X;  1JLE A;  3ENH A;  3OBW A;  4GV3 A;  4BRQ A;  3OW2 M;  1WSI A;  1SKR A;  3LM2 A;  3OA9 A;  3S3O A;  4DU1 A;  3TAF A;  3E9L A;  3O8M A;  3LDL A;  3M8Q A;  3EZW A;  4CK1 A;  3QBX A;  2DTU A;  3OYK A;  4B8A B;  2V7Z A;  1KFD A;  5FRN A;  1X9W A;  4EHT A;  3AVM A;  4RW4 A;  5CR4 A;  4FK2 A;  1YJN N;  3PUF A;  3NF9 A;  4IG0 A;  4CJR A;  5AQU A;  1BGX T;  1DT9 A;  3H1V X;  4DTP A;  1YI2 N;  4QCL A;  3MN9 A;  3AVC A;  1UA0 A;  2HHH K;  2W6L A;  3HJF A;  4RW8 A;  2HND A;  4DV4 K;  4IFE A;  5AZJ A;  4FYD A;  1NGC A;  4ZTJ A;  3GDQ A;  4FM2 A;  1NOZ A;  3BF1 A;  1QSY A;  4TSX A;  4JN4 A;  1YTA A;  1A5X A;  3DI6 A;  3TAN A;  3HL8 A;  1G15 A;  1JCE A;  3AV9 A;  4BWJ A;  3MWP A;  4H0Y B;  1LV5 A;  2GWK A;  4KKO A;  4AQY K;  4LF7 K;  4ILG B;  4FJX A;  3WXI A;  4KHU A;  4YY3 K;  1FXX A;  1HNX K;  3NHG A;  3FZH A;  1T03 A;  5FPN A;  1RDC A;  3MCA B;  3IFR A;  2FBT A;  1S22 A;  3G10 A;  3V9U A;  4M41 A;  4DFP A;  3ITH A;  2WFB A;  5I9E B;  5HL7 L;  3QFU A;  5E26 A;  2NRR A;  3R1X A;  3NDK A;  2ZWH A;  4CJS A;  3DWL A;  1RT2 A;  5MLC Q;  2FF6 A;  4JRQ A;  3AVH A;  4CI6 A;  4CZI A;  2Y1J A;  1BI4 A;  2YKM A;  4FJ5 A;  3O80 A;  1RT4 A;  4BRF A;  1O1W A;  4KHQ A;  1NJY A;  2DPN A;  4CJ7 A;  4RW9 A;  4BC4 A;  4YFU A;  2OPR A;  2HW3 A;  2HHV A;  4O8K A;  3CQY A;  2YHA A;  3DXK A;  4DU4 A;  2E2P A;  2EWS A;  1RCH A;  4NB4 A;  3L8B A;  1VSE A;  1C1C A;  4DR5 K;  2XY5 A;  1SS6 A;  3LP2 A;  1RTH A;  4KTW A;  4A5A A;  4FJM A;  2Q0U A;  3ULE A;  1YIT N;  1TUY A;  1BA1 A;  4BRA A;  4HCB A;  4KHN A;  1KVA A;  4BDZ A;  2OPS A;  5AQJ A;  3HT3 A;  1J6Z A;  1SZ2 A;  2HHT A;  3IG1 A;  3DYA A;  4JAX A;  1NK5 A;  1RTI A;  1QHT A;  4KHS A;  1VQM N;  3KK7 A;  3K9K A;  4FLZ A;  2R7Y A;  1OVQ A;  1HRH A;  2KW4 A;  3V81 A;  1LAV A;  1U6Z A;  3IKM A;  2OZS A;  4JI8 K;  4DR6 K;  4FWO A;  2UU9 K;  2VCP A;  3DRP A;  2XY6 A;  1B92 A;  3EKS A;  5ADX H;  1XWL A;  4IOC L;  3ZET B;  4KHW A;  3LM9 A;  3PSI A;  3TAP A;  4DSF A;  1VSL A;  1WBB A;  1WSF A;  4H0X B;  1BDG A;  4CF2 A;  3VQ8 A;  1TAU A;  4Z4H A;  4HTU A;  1DTT A;  3PX0 A;  4JRP A;  1NMD A;  3KVG A;  4B1U B;  2I5J A;  3RMD A;  4R79 A;  3OJS A;  1OVY A;  3CI5 A;  2I7N A;  3K58 A;  4EAH D;  3O3H A;  4C1N K;  1W2B M;  1ASW A;  3K57 A;  5EY4 A;  5DM6 L;  4A59 A;  1Q8I A;  3PSF A;  3DLL L;  3AO3 A;  3P39 A;  3H3N O;  3CJB A;  4F2S A;  2BGG A;  1WUA A;  3VEY A;  1HJO A;  2VG5 A;  1L3S A;  1TL3 A;  1D8Y A;  4FWQ A;  4RCH A;  3ATV A;  4DUY K;  4DF8 A;  3AAR A;  5BRE A;  1BU6 O;  3OYB A;  1HQU A;  2NRX A;  2QWM A;  2IDO A;  1KQS M;  3QML A;  4YOR A;  2O8F B;  2IVP A;  2F4V K;  5M1K A;  3K5M A;  3BEX A;  3JAM O;  2IVN A;  3LWM A;  5KGW A;  4CJ4 A;  2O4G A;  4DR4 K;  1I39 A;  4ISG A;  1W0H A;  3MXM A;  1TL1 A;  1Q7Y O;  1BCO A;  4CEF A;  3HBT A;  4WF9 L;  3A0I X;  2F9W A;  3OYI A;  3OVN A;  3PX4 A;  3CCM N;  4KHY A;  3DOL A;  3QNN A;  4H0O A;  3FE1 A;  4DS5 A;  1ILY A;  1HNZ K;  1J53 A;  3H46 O;  2CGK A;  4I2P A;  3T3F A;  3QET A;  3AVN A;  2E88 A;  4LC9 B;  4NYF A;  3S9H A;  3M8R A;  3WNE A;  1SL2 A;  1S6Q A;  3L2U A;  3SPZ A;  3A8Y A;  4O5F A;  4ILH A;  4B3O A;  2QKK A;  2NRZ A;  1TAQ A;  4CZM A;  5KTQ A;  2YI1 A;  3JYT A;  4C8M A;  3WNH A;  5HBM A;  3SQ2 A;  5HRP A;  3NBP A;  4W5T A;  4DFM A;  4QOZ B;  3ZEU A;  4M45 A;  3TPQ A;  4DLE A;  3EEQ A;  2VGN A;  3UKU B;  4CGH A;  3AVJ A;  3CM6 A;  1G99 A;  1T6D A;  3E1Y A;  3OYH A;  4PY5 A;  3R6M A;  2IC3 A;  2FLO A;  2XO7 A;  1TGO A;  5ELZ A;  4KI6 A;  3CET A;  4KH4 A;  3V9S A;  2E20 A;  4FK4 A;  5AQR A;  5F2R A;  4FWN A;  3L2R A;  3WT0 A;  4LH4 A;  1HYS A;  2ZJQ L;  2NZT A;  4BRL A;  2Q3S A;  1U47 A;  3QEI A;  4FZX C;  3EN9 A;  4V19 S;  3AVI A;  4WE1 A;  3T1A A;  4IXC A;  3ZSX A;  3CCR N;  3SMP A;  2YKN A;  3U6F A;  1IO2 A;  1BHL A;  4QS7 A;  4WQ4 C;  4K8Z A;  4QAG A;  4PWD A;  4GV6 A;  4NCG A;  5ADX A;  1QZ6 A;  4JKG A;  5KPZ A;  1IKX A;  3AO1 A;  3HP9 A;  4MDA A;  4F4K A;  3GG4 A;  1IKY A;  2HBL A;  3O9U A;  1D5A A;  3I8D A;  1JCF A;  4CW7 B;  5JLH A;  4E1N A;  1SV5 A;  4PHT X;  4KRF A;  1VQ5 N;  1RT1 A;  3V9W A;  3CPE A;  4DR1 K;  1YJW N;  2ZGZ A;  1C0F A;  4DMN A;  3FR0 A;  3P5J A;  4W5Q A;  3IMX A;  1U2V A;  4MO4 A;  1L5U A;  4B9S A;  3V1R A;  4JK9 A;  4Z4E A;  3CYM A;  2OYQ A;  5AQQ A;  1ZXO A;  4FJN A;  3UIQ A;  4H5T A;  5LL6 Z;  3ATU A;  2ASM A;  4N76 A;  1DGK N;  4FWP A;  3OYM A;  1VQ4 N;  2ITG A;  1BG3 A;  1KFS A;  4I9Q A;  4JI7 K;  2P9K A;  3EE9 A;  2HHX A;  3CQ8 A;  4CJL A;  4OKE A;  3EL2 A;  2O8B B;  4N41 A;  4M63 C;  2PYL A;  4M7Y A;  1VQ6 N;  2GEL A;  5HRO A;  4KAZ A;  1S1T A;  3T69 A;  3QO9 A;  2HVI A;  1E4F T;  1HMV A;  4GMJ B;  1RNH A;  2JGU A;  2P9N B;  3SQ4 A;  4LH5 A;  3V9X A;  3QIC A;  4WQ4 A;  4CGJ A;  1S1U A;  5AQX A;  4KPY A;  3C6U A;  1HR0 K;  1NGG A;  3RMC A;  4CGG A;  2NRW A;  3QFP A;  1RBU A;  3DLE A;  3U8X A;  2CGL A;  3NGI A;  1RDD A;  1K9M O;  3NMU A;  3CC2 N;  1IJJ A;  4JD2 A;  3T19 A;  1IKW A;  5B8H A;  3SI6 A;  5JVH L;  1S9G A;  1CZ9 A;  3PLA A;  1RT7 A;  4XH5 A;  2YNI A;  3NCI A;  3D45 A;  4BR5 A;  4BRH A;  3PO5 A;  2A40 A;  2D5R A;  1ASV A;  2I7P A;  4BRP A;  1U45 A;  5BPL A;  1QVF M;  3TTD A;  5D3G A;  3RVC A;  3SUP A;  2F7T A;  1IKV A;  2YHX A;  4DTX A;  3SBG A;  4FSV A;  1BA0 A;  2X6S A;  3F2K A;  3SUQ A;  5AQZ A;  3EKU A;  4XH4 A;  4N5S A;  4YDU C;  1WAF A;  4OGC A;  4FJI A;  4CJW A;  3OJU A;  3UKR A;  4DQ8 A;  3CFP A;  4OVL A;  3D6R A;  2OA8 A;  5GIO A;  2P9S A;  3O9S A;  5GAG P;  2DY4 A;  1UWB A;  1IV0 A;  4JEP A;  2OTL N;  3O9Q A;  2GV9 A;  3BGR A;  3BP8 A;  4GKK K;  4OJR A;  4PKG A;  4FLV A;  3D2E A;  3VOV A;  3KHY A;  3EZ5 A;  1C0U A;  3NF8 A; 
#chains in the Genus database with same CATH homology
 4YOY A;  1DT9 A;  3H1V X;  4FPB A;  4K42 A;  1YI2 N;  3CJA A;  3MN9 A;  4CZH A;  4CD1 A;  4EHU A;  4A5B A;  2E2O A;  3D7E O;  5KPT A;  4K41 A;  3A5M C;  3LL3 A;  3MDQ A;  4IEI A;  3G4S N;  1D4X A;  3S41 A;  2HOE A;  2KKZ A;  4IFE A;  5AZJ A;  4G9Z A;  1GLA G;  2P9K B;  4MO5 A;  4F9O A;  1NGC A;  3G71 N;  3VTI A;  3M5R A;  4FWL A;  3GDQ A;  3H45 C;  3Q7B A;  3UKU A;  3HOT A;  3BF1 A;  3FZK A;  1TYQ B;  1K73 O;  1LCU A;  3N4P A;  2Q31 A;  4JN4 A;  2Q97 A;  3FZL A;  3Q7C A;  1HKB A;  5AZI B;  3P4I A;  4HWI A;  1Q82 O;  1JCE A;  3K9J A;  3ZET A;  2HST A;  3C7N B;  4Z94 A;  3MWP A;  4H0Y B;  1KAY A;  2GWK A;  3NVM A;  3CXC M;  4CZL A;  2ASO A;  4ILG B;  3WXI A;  3H3O B;  1M90 O;  4DHY A;  3SLC A;  2YHW A;  1CZA N;  2FSN A;  3CCV N;  1NM1 A;  1ATS A;  2P9P B;  3TSP A;  3FZH A;  3M6G A;  5FPN A;  4WFA L;  3VPZ A;  5KQD A;  3MCA B;  3IFR A;  4YDU A;  4JD2 B;  1GLB G;  1S22 A;  3A5N C;  2WFB A;  5I9E B;  5HL7 L;  3OBY A;  3QFU A;  5E26 A;  4PL7 A;  2D0O A;  2NRR A;  3R1X A;  3VGM A;  2OAN A;  2ZWH A;  4JKD A;  5FPE A;  3DWL A;  4FWR A;  4BRM A;  4DCH A;  3G25 A;  3T7Z A;  5EVZ A;  4QS9 A;  5MLC Q;  1NLV A;  2FF6 A;  3MN5 A;  1YVN A;  2QXL A;  1VQ7 N;  2AP1 A;  4CI6 A;  4CZI A;  1XUP O;  2QWN A;  2ZGY A;  3CCS N;  4JK8 A;  4BR2 A;  2FSJ A;  1C0G A;  3O80 A;  2W41 A;  4BRF A;  3ZX2 A;  3VGL A;  1R59 O;  4CZE A;  1NGI A;  4CD3 A;  4MLE A;  4DKW A;  3O5B A;  5AFU A;  2DPN A;  4RWT A;  1YF5 L;  4BQL A;  3VMF B;  5GIP A;  3D2F A;  4BG9 A;  4YOU A;  4CJ7 A;  1Q18 A;  4FVU A;  3ID8 A;  4BC4 A;  4IJA A;  3I55 N;  4B9Q A;  2JWL A;  4M7X A;  3JS6 A;  3CCE N;  1NWK A;  4O8K A;  3UKR B;  3SJH A;  1V4S A;  3CQY A;  2NRH A;  3SK3 A;  1XC3 A;  3DXK A;  2E2P A;  2EWS A;  4NB4 A;  2P9S B;  1P90 A;  3N4Q A;  5AQH A;  1QQN A;  1SS6 A;  3L4Q A;  3AGR A;  3A5L C;  4FL9 A;  2RE2 A;  1KD1 O;  4A5A A;  2Q0U A;  4H03 B;  3ULE A;  3GOI A;  1MA9 B;  4JKA A;  1TUY A;  5BRD A;  1BA1 A;  4BRA A;  5H1S Q;  3QBW A;  4YOW A;  2V51 B;  3D2E B;  3CPW M;  4BVO A;  4KH5 A;  2PBD A;  5AQJ A;  4KH6 A;  1J6Z A;  1SZ2 A;  1O13 A;  4JAX A;  4JKE A;  4CZG A;  3OHR A;  2UYT A;  1VQM N;  2PFU A;  3DXM A;  4IDH A;  3KK7 A;  2P9I B;  3BF3 A;  3K9K A;  5GAD P;  5AQT A;  2ITM A;  3KWG A;  4CZK A;  1U6Z A;  3IKM A;  5AZJ B;  4B1Z A;  4EFH A;  2E1Y A;  5DM7 L;  3SAF A;  4A2A A;  4BQZ A;  2GTD A;  4FWO A;  3R3L A;  3AAQ A;  2QA4 N;  2WC9 A;  2VCP A;  5M1O A;  3AGK A;  4CZF A;  4GY2 B;  2P9N A;  3MWT A;  4A2B A;  3TU5 A;  3EKS A;  3LDN A;  4U67 L;  5ADX H;  4IOC L;  3ZET B;  3LM9 A;  3SAH A;  2HMP A;  1VQK N;  5AQV A;  3CCQ N;  3EE8 A;  2QWP A;  3CJ7 A;  1K8K A;  3H6E A;  4H0X B;  1BDG A;  4A57 A;  1RDW X;  3O1B A;  4BC5 A;  3CMA N;  4IO8 A;  1YIT N;  1Q86 O;  4CBU A;  2D1K A;  1HPM A;  3KWI A;  4BGB A;  3SAG A;  3WUH A;  3MN7 A;  1NMD A;  3CJ9 A;  4QS8 A;  4WFB L;  2ZJR L;  4OO1 J;  3KVG A;  4B1U B;  2HBM A;  3LDO A;  3J7Z O;  3O1W A;  5C0Y A;  4R79 A;  1IG8 A;  4A61 A;  1GLJ O;  1HKG A;  1OVY A;  3SMS A;  4FWS A;  3CI5 A;  5F1X A;  4C1N I;  1XQS C;  2I7N A;  5KPR A;  2QI2 A;  2FXU A;  5AR0 A;  1ESV A;  2GUP A;  4EAH D;  2IVO A;  2JWK A;  1Z05 A;  4CBX A;  2AA4 A;  3W0L A;  4C1N K;  1W2B M;  5EY4 A;  5DM6 L;  2E8A A;  3LDQ A;  3O08 A;  3E9P A;  4WYB A;  4H5W A;  3U9Z A;  3VES A;  4A59 A;  4IO9 L;  3PIP L;  1VQN N;  3DLL L;  4JHD A;  3FZM A;  5AQI A;  3P39 A;  3H3N O;  2VYP A;  2YX6 A;  3CJB A;  1Y64 A;  4XEI A;  4H0P A;  4B1X B;  3HOS A;  1WUA A;  3HZ6 A;  1QQM A;  1KXP A;  3VEY A;  3CHW A;  1GLC G;  1HJO A;  4I6M A;  4OPA A;  3VEX A;  5AQK A;  4BRK A;  1JJ2 M;  3JXU A;  5JMV A;  3D2F B;  3SBT A;  3HSC A;  5AQG A;  4BVP A;  1BUP A;  4FWQ A;  4RCH A;  3ATV A;  1W97 L;  1E4G T;  5BPM A;  5C2F A;  4Y0W A;  3DXK B;  3AAR A;  5BRE A;  3QDK A;  3G6E N;  1BU6 O;  1T3V A;  2E1Z A;  4BR4 A;  1KAX A;  3O6W A;  3MK6 A;  2NRX A;  1SQK A;  2QWM A;  4MLH A;  1KQS M;  3GBT A;  3CQX A;  3QML A;  2HF4 A;  3E9O A;  4YOR A;  2Q1N A;  1ZBS A;  2F9T A;  2IVP A;  3UB5 A;  5M1K A;  1S3X A;  3BEX A;  4H0T B;  3ULE B;  3VET A;  3HRG A;  1YIJ N;  4BG8 A;  2IVN A;  1S72 N;  4NLC A;  3VEO A;  4WCE L;  5JLF A;  2P9L A;  4ISG A;  1LOT B;  2KLA A;  4FO0 A;  3MX5 A;  3VF4 A;  2QEX N;  1Q7Y O;  3DXM B;  3HBT A;  2ASP A;  2WBN A;  4NLB A;  1H1V A;  4L3Q A;  2D0P A;  3L0Q A;  4BRG A;  4WF9 L;  3LDP A;  3A0I X;  2CH5 A;  1V4T A;  2F9W A;  3CF5 L;  4H5V A;  3CCM N;  1JCG A;  1NGJ A;  3CD6 N;  4BY9 C;  4B1W B;  4H0O A;  2QW9 A;  3FE1 A;  4JK7 A;  2YJF A;  4RTF D;  2HBK A;  4BRD A;  1QVG M;  1ILY A;  5BRH A;  3H46 O;  2CGK A;  2QM1 A;  3DJC A;  3MX2 A;  3C7N A;  4BRC A;  2E88 A;  3WXM B;  3WEE B;  2E2N A;  4LC9 B;  2A41 A;  3C0B A;  3FLC O;  4YOV A;  3A8Y A;  1DEJ A;  4ILH A;  4O5F A;  1ATR A;  4B1V A;  1K8K B;  2P9P A;  2NRZ A;  2Q36 A;  3HTV A;  4CZM A;  2BTF A;  5AQL A;  4BGA A;  4NO7 A;  1T44 A;  1HUX A;  3P31 A;  2YJE A;  2YI1 A;  3RSE A;  3F9M A;  2YCH A;  4JKC A;  3U9D A;  1NGF A;  4FPA A;  2HF3 A;  2J4R A;  3CCU N;  4BRI A;  2QWL A;  3IUC A;  2GWJ A;  2HBJ A;  3TSQ A;  4WQ5 C;  3MN6 A;  3VGK A;  1GLF O;  3E66 A;  5M1N A;  2A42 A;  3ZEU A;  3TPQ A;  3GL1 A;  1RFQ A;  2VGN A;  3UKU B;  5AQN A;  2BUP A;  4H0V B;  3B8A X;  1VQP N;  3MMV A;  3VEZ A;  4J8F A;  4EIA A;  3NVK A;  2IIR A;  4BC3 A;  1G99 A;  1NGH A;  4FOI A;  3CC7 N;  1T6D A;  3U4L A;  4KBO A;  4JHD B;  4PKH A;  5C10 A;  3E1Y A;  1GLD G;  4FWM A;  1P8Z A;  3R6M A;  5LJV A;  2FLO A;  2P9U A;  3C65 A;  1BOT O;  5AQS A;  1SAZ A;  1VAZ A;  2QWQ A;  5BR9 A;  5ELZ A;  1RGI A;  3L4I A;  3CET A;  3I8B A;  4KH4 A;  2E20 A;  5AQR A;  4H5R A;  5F2R A;  2ZJP L;  4FWN A;  1X9J A;  2CH6 A;  3WT0 A;  4PKI A;  5C15 A;  2ZJQ L;  2NZT A;  4BRL A;  3VEW A;  4JKB A;  2W40 A;  5AQW A;  4HTL A;  3EN9 A;  1YJ9 N;  1BWF O;  5CHI A;  1VQ8 N;  4OPH A;  3TSU A;  1HLU A;  4WFN L;  2RHK A;  2WUS A;  4IXC A;  1NGD A;  2V52 B;  3CCR N;  3CCL N;  3BUZ B;  5LJW A;  3H1Q A;  3SMP A;  3VTH A;  3ENB A;  4ILJ A;  3WXJ A;  5TKW A;  3ZX3 A;  4QS7 A;  4WQ4 C;  1VQ9 N;  4PL8 A;  1BO5 O;  4GV6 A;  3ID6 A;  1YAG A;  4BC2 A;  1EQY A;  4BR7 A;  5C2D A;  1QZ6 A;  5ADX A;  1VQL N;  3VEV A;  1NGA A;  4JKG A;  2P9L B;  5KPZ A;  5GIN A;  1M1K O;  3ZX0 A;  2Q0R A;  3WQT A;  2FF3 B;  4MDA A;  2VWB A;  2P9I A;  3GG4 A;  4MDB A;  5TKY A;  4E1J A;  3W3D A;  2HBL A;  2A3Z A;  3O9U A;  3AY9 A;  2OTJ N;  2GX9 A;  1Z6R A;  3CIP A;  2VGM A;  5HOO A;  1JCF A;  1NGB A;  5JLH A;  3PIO L;  4H5N A;  5F0X A;  2Q2R A;  3VEN A;  1HKC A;  4PHT X;  1VQ5 N;  4WQ5 A;  3EO3 A;  1YUW A;  3DAW A;  1DKG D;  3CPE A;  1YJW N;  4JKF A;  3FGU A;  3M3Z A;  2ZGZ A;  1C0F A;  2NRT A;  2D4W A;  3FR0 A;  4CZJ A;  4ISE A;  1NJI O;  3IMX A;  3O9R A;  1U2V A;  4MO4 A;  1Q81 O;  4IJN A;  4JK9 A;  5BN9 A;  5AFU H;  1WOQ A;  4IWV A;  3WXK A;  4IEE A;  4C23 A;  2KHO A;  5C12 A;  3CC4 N;  4AM6 A;  1K8A O;  5AQQ A;  1ZXO A;  4FOE A;  4GV9 A;  4GNI A;  3UE5 A;  4H5T A;  2V7Y A;  3ATU A;  3I33 A;  1QHA A;  4UY8 O;  3CER A;  3HM8 A;  3IDH A;  2A6A A;  1EO1 A;  3O4W A;  2ASM A;  4GVE A;  1DGK N;  3RSE B;  4FWP A;  2NLX A;  5EX5 A;  1VQ4 N;  3C6H A;  5CE3 A;  1BG3 A;  5AQP A;  2P9K A;  4XH1 A;  3EE9 A;  3CME N;  4JNE A;  3EL2 A;  3HI0 A;  3VF2 A;  4M63 C;  5JIC A;  4M7Y A;  3J8A A;  3VF6 A;  1VQ6 N;  1TYQ A;  4FWK A;  5GAH P;  1KAZ A;  2GEL A;  1ATN A;  3ZEU B;  3T69 A;  4BR9 A;  1VQO N;  4BR0 A;  1E4F T;  5AZI A;  1ZC6 A;  2PAV A;  2P9N B;  2ZF5 O;  3FFK B;  3M1F A;  1QQO A;  1OKJ A;  5EXW A;  5BN8 A;  3QIC A;  4WQ4 A;  3CCJ N;  1X3N A;  3KZB A;  4K43 A;  5AQX A;  5M1Q A;  4A62 A;  5GAE P;  3I56 N;  1NGG A;  2CGJ A;  2NRW A;  3QFP A;  3U8X A;  5AQF A;  2CGL A;  3F5T A;  5FPM A;  4YOX A;  1K9M O;  2P9U B;  3L6Q A;  3NMU A;  3CC2 N;  1IJJ A;  3QB0 A;  3ENO A;  4JD2 A;  5AQO A;  1YHQ N;  1NGE A;  2GEM A;  4BRE A;  5B8H A;  5JVH L;  3TTF A;  3WXL A;  3A5O C;  2FSK A;  5LY3 A;  3GE1 A;  2A5X A;  4IOX A;  1MWM A;  1YXQ A;  3C6A A;  4B1Y B;  3PLA A;  4XH5 A;  4DB3 A;  3FZF A;  3R9P A;  2YHY A;  3TTC A;  5E84 A;  4BR5 A;  4ISF A;  1MDU B;  1RDU A;  4BRH A;  2A40 A;  4AM7 A;  5AQY A;  4K25 A;  1N8R O;  4IOA L;  2I7P A;  4BRP A;  2QTD A;  5M1F A;  5BRF A;  1X3M A;  3ZYY X;  3CJ1 A;  5BPL A;  1QVF M;  3ENH A;  4U7B A;  3OBW A;  3TTD A;  2QWR A;  2NNW A;  4GV3 A;  3RVC A;  2F7T A;  2YHX A;  4BRQ A;  4JKG B;  3SBG A;  4AF1 A;  5AQM A;  3O9T A;  1BA0 A;  2BH1 A;  4FSV A;  3OW2 M;  3LM2 A;  3F2K A;  2E2Q A;  2NRV A;  5JVG L;  1MWK A;  3OA9 A;  5AQZ A;  3EKU A;  3WQU A;  4XH4 A;  4YDU C;  2QWO A;  1GLL O;  3P38 A;  4YOT A;  4I6M B;  1HX1 A;  3E9L A;  1GLE G;  3O8M A;  3MCP A;  1KC8 O;  3LDL A;  3UKR A;  4DQ8 A;  3EZW A;  1NBW A;  3QBX A;  3D6R A;  2V7Z A;  4O8U A;  5EOY A;  5BPN A;  4BRO A;  4BRN A;  5GIO A;  2P9S A;  3O9S A;  5GAG P;  4EHT A;  3WEE A;  4JEP A;  2H3G X;  3VER A;  5CR4 A;  5KQ8 A;  4CBW A;  2OTL N;  1YJN N;  1TUU A;  3O9Q A;  4IZ9 A;  5FPD A;  1T6C A;  3BP8 A;  4JKH A;  4PKG A;  3R8E A;  3AAP A;  3D2E A;  1U2V B;  3CJC A;  3VOV A;  5M1P A;  3KHY A;  1QZ5 A;  5AQU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...