4PHTX

Atpase gspe in complex with the cytoplasmic domain of gspl from the vibrio vulnificus type ii secretion system
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
234
structure length
224
Chain Sequence
SEFLTVRLSSEQYSPIPWLVWSSSQQEVIASGELSDWQQLDDLKNYAEQRPIVVLVAASDVVLTEVDIPPGASRQFESMLPYLLEDEIAQDVDDLHFSVLAKENGKAQVCGVDRRWLQHMLDAFRAQGLDVKRVLPDSLALPLDDEGISAAQLGEQWLFRHSACQGSAVDDSWMPVYLNSVACFSSLPEQQAHWLSRPVEMTMALLSQGVADGKFSLLTGEFKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Type II secretion system protein L
publication title Crystal structure of the full-length ATPase GspE from the Vibrio vulnificus type II secretion system in complex with the cytoplasmic domain of GspL.
pubmed doi rcsb
source organism Vibrio vulnificus
molecule tags Protein transport
total genus 58
structure length 224
sequence length 234
chains with identical sequence Y, Z
ec nomenclature
pdb deposition date 2014-05-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.370 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4phtX02
3.30.420.380 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4phtX01
4PHTX 1YF5L 5TKWA 1W97L 2BH1A
chains in the Genus database with same CATH superfamily
4B1ZA 5ADXA 3LP1A 3SAFA 1EXQA 2HVHA 3WT0A 2FXUA 3VGMA 4CZIA 1LCUA 2GELA 4O5BA 4KRFA 1KFSA 4CE9A 2PYLA 2QWMA 1TKTA 4K25A 3O3FA 3VEYA 3ZX2A 3FZHA 3OJSA 3O9RA 3UE5A 4KH4A 4IEEA 1N36K 4IG3A 5KPZA 2NRTA 1GLEG 4CFCA 4UY8O 3SBTA 3HPHA 2VG6A 3NF7A 3G0ZA 1RDUA 1GLLO 4NYFA 4BRCA 1E4GT 3MEDA 4LSLA 4CK3A 2V51B 4NXMK 5KPRA 2HVIA 1W9HA 3LP3A 3M8RA 2I5JA 3AVAA 3G10A 1IV0A 5CR4A 1ZBSA 3F5TA 3C6TA 1NGHA 1O13A 1VAZA 1HQEA 3PLAA 2QXFA 1NU0A 2Q1NA 3KK7A 4FWOA 3I8DA 2BDPA 3FFKB 5AQLA 4I6MB 3VQ7A 1RT6A 1LW2A 3A5MC 1EX4A 3G71N 4Z4CA 1VQ4N 3PIOL 1OH7A 2HBMA 1VQLN 1YHQN 3VA3A 5FROA 1FKOA 3A2FA 4B1WB 3ZSQA 2RHKA 2OPSA 4K0KK 3WXJA 1QQNA 4FJGA 4A59A 1A5WA 2CGJA 4CF2A 3IDHA 5AR0A 4GVMA 4DS5A 3VEZA 2OA8A 3L3VA 4HHTA 4IO8A 4BRKA 4LH4A 4A5AA 4Z0UA 1HNXK 3SAHA 1BCOA 4JHDA 5EVZA 3KLHA 3SUQA 1YJWN 4CEOA 3MWPA 3OYGA 3LP2A 3ALYA 3C7NA 3D6RA 2XY5A 2Y1JA 3U8XA 4ELTA 4O0IA 4X66K 1S5JA 2GX9A 1NK6A 1Z25A 5F0XA 3CCSN 1QE1A 3VGKA 4DTSA 1Y64A 2OTLN 1NK8A 4JI6K 5GAEP 4DG1A 3BGRA 1SQKA 1CXQA 4G1QA 3UIQA 2CGLA 4JK8A 1IH7A 4PHTX 4KH5A 4FM2A 3IUCA 1OVQA 4M42A 5CY4A 4DSFA 2YNGA 5AQYA 3OYFA 3AV9A 3VERA 4JI3K 4BWJA 3OYDA 1UA0A 4H5TA 4B3SK 3RMAA 4Z4EA 3LALA 5AQIA 5GAHP 4FJXA 4JD2A 3HZ6A 2X6NA 3DXKA 3MAQA 2PAVA 1DLOA 1S1TA 4PUOA 1JLQA 4F3TA 1BG3A 4K41A 4KHWA 1EWRA 3ZT3A 1W7AA 2QXLA 4QCLA 4JS5A 3J7ZO 1X9MA 1RCHA 1LWEA 1I39A 3QEPA 5DM7L 3NGIA 4IFEA 3U6FA 3R9PA 4DS4A 3SLCA 1BO5O 1S6PA 2FC0A 3AVIA 4FLXA 4FZYA 4IOAL 1NMNA 4DV1K 1X3MA 1U2VA 1KLNA 4EP5A 3RVCA 5TKYA 4LSNA 2QWOA 4U7BA 1KTQA 4RW8A 3OYMA 4JS4A 4B1UB 2DY4A 3SI6A 1B9FA 1C1BA 4BG9A 2P9UA 3HOSA 3SQ0A 4DKWA 1JXEA 3LM2A 5A2QO 3QEWA 5ELZA 3G25A 2NLXA 1I3AA 5B8HA 2NRZA 4DR3K 3IKMA 2YHBA 4DV0K 1X9WA 3QMLA 5D3GA 2BUPA 3DYAA 3U9ZA 2IS3A 4RCHA 3QNOA 1RBUA 4XH4A 4DU1A 1WSEA 4GV3A 4BRHA 4CZEA 3LZJA 1KAYA 2QWLA 3HVRA 3E1YA 1NK9A 4AQYK 5DMRA 3QICA 2GTDA 4DR1K 4KI6A 4ELVA 5KGWA 4ILJA 2PYJA 3D2EB 1XUPO 3B6PA 4BRIA 4JI1K 4JD2B 4JRQA 1SZ2A 2FSJA 3O3GA 4AHRA 1XMQK 4JK9A 1LAVA 4CGFA 2Z1JA 1U47A 4DV3K 1T3VA 3U3YA 2JWLA 5BPMA 5F1XA 4CJLA 4JYAK 1JCEA 3SUOA 4MQ3A 2YNHA 5CYMA 3TTFA 1TK8A 1N33K 5EY4A 1I94K 3CFPA 1TKDA 1S9GA 1HMVA 3DLEA 4WFAL 4Z4HA 3O4QA 1JKHA 2D0CA 4KPYA 4AM7A 4CJ4A 2KKZA 5MLCQ 2D0OA 3SQ4A 3NF9A 4FJ8A 1ZBLA 2VCPA 4BRNA 3K5LA 4C1NK 3O4WA 4NB4A 5IWAK 1ZC6A 3ZSXA 1S6QA 5KQ8A 4AH9A 4N56A 4HUEA 2HNDA 4FWNA 2WC9A 4BRLA 4JI0K 3U9DA 4DQSA 1Q82O 3VQAA 2QI2A 3ZSOA 5AQNA 3TPQA 4M3TA 2ZD1A 3BF1A 4ZTJA 4Q5VA 4KO0A 1XMOK 4B08A 4C8LA 2YNIA 4JKEA 3CFOA 1ATNA 1VHXA 4YDUC 3VQCA 3HT3A 4DV2K 4LF7K 4PWDA 2FBYA 3O6WA 1HNIA 3QINA 4B9LA 1Z6RA 5BPNA 3ITHA 3KZBA 4FLWA 4C8OA 2WONA 4DU4A 4CBUA 4AF1A 4O5FA 3KTQA 1R59O 4CEQA 1C6VA 2QKKA 2D4WA 3T7ZA 5AFUH 4BR5A 4TSXA 1L5UA 3ATVA 5BPLA 5GAGP 5AQPA 4B9NA 3KD1E 4RW9A 2BH1A 2QWNA 2OZSA 3ID6A 3QETA 3THWB 1HKBA 1NGCA 2GWJA 4W5TA 4JRPA 1KFDA 4OGCA 3CJAA 2UXBK 2VG5A 4FJ7A 4KTZA 1FKPA 4MO4A 1N8RO 2GBZA 3U4LA 4CZLA 2ASOA 2EHGA 1LOTB 3K58A 2FSKA 5AZIA 4GV9A 1VSFA 1T7PA 3VQ8A 3HP9A 3VEXA 1MA9B 4BE1A 3CQXA 3UKRA 4DUYK 3H6EA 3UB5A 1VSMA 2I7NA 3DJCA 3WQTA 4CGJA 1TGOA 3M8SA 3TAFA 4OVLA 4FJLA 4F2RA 4FPBA 3VEOA 3OTOK 4CFAA 2X78A 5LL6Z 5LJWA 3QESA 2V7ZA 4LF8K 4YDUA 2FSNA 4WFBL 2A5XA 4YY3K 1WBBA 3SMPA 1OH6A 1V4SA 2W6LA 4IFVA 1N5YA 4DCHA 3RRGA 1VRUA 4Y0WA 1ASUA 2O8BB 2A6AA 4JKAA 1HRHA 4CGGA 4BC5A 1K8KA 1XC3A 3OBYA 1NJIO 3NGZA 4DFPA 1NG9A 3SV4A 2OTJN 3H08A 1TL1A 4M3XA 3KLFA 2FBTA 3B6OA 3I56N 4CF8A 3FFIA 3HO1A 1NGEA 3S3OA 4M3UA 1WAJA 1ZYQA 4FPAA 1BDGA 1BQMA 1W97L 3AO2A 4CHNA 1RBVA 4X64K 1JLFA 3ZT2A 4OGEA 1R0AA 2I7PA 4IO9L 3CMEN 4E7HA 1ESVA 3LPUA 3KIOA 5AQMA 2QKBA 4CJPA 2O8CA 2ZF5O 2HHXA 2ZWHA 4FVMA 1S1UA 2OPQA 3THVA 3V6DA 4DTOA 3KK3A 3HSTB 2YHYA 5JICA 2NRHA 3A5NC 3MWTA 2YHXA 1YI2N 4LY7A 1M90O 3RMCA 1VQ9N 2O4GA 3DMJA 3HK2A 3K9JA 4CIEA 2IAJA 3GG4A 1XHZA 4UQGA 2G8UA 1D9DA 5C2DA 4I7FA 3VQ6A 2OPRA 4CJRA 4MO5A 5KRSA 1SAZA 2E20A 5E41A 1YF5L 4NCGA 4Z4GA 1HYSA 3EKSA 2HW3A 1QZ6A 1EP4A 1RT5A 4CK1A 1WOQA 1CXUA 4M3YA 3O08A 3HYFA 5C2FA 3HPGA 3K5OA 3VMFB 2E1YA 1TAQA 2JLEA 4QOZB 2LSNA 4BRMA 3P31A 4DUZK 2P51A 4Z4FA 4LFCK 3QNNA 2VG7A 4OPAA 4OPKA 3TSQA 2AP1A 4H5RA 4W5NA 3SYZA 5JMVA 3VTIA 3I55N 3RMBA 4KTQA 3CCLN 4CVNE 3M5RA 3CQYA 2W41A 5KI6A 1LW0A 3PO5A 3O3HA 4I6MA 3CJ1A 3VQ4A 3Q7CA 4YNQA 3CCRN 3P1GA 3KKSA 1CZ9A 2HF4A 4KBOA 5CZ2A 1BWFO 3TTDA 1YVUA 3D7EO 1L3SA 4NCBA 4O55A 4B8AB 3Q7BA 4O4GA 1CZBA 4BWMA 3PY8A 3WEEB 4CGHA 3G4SN 4RW6A 4BR9A 1IBLK 4ID5A 3LANA 4CD1A 4OPJA 1HPZA 1K8AO 1CLQA 2UYTA 1YTUA 3H45C 5EOYA 2DFEA 1C0MA 3VQEA 4EIAA 4B3MK 4FLTA 4FWMA 1N6QA 3M8PA 5HRPA 4CERA 5LMNK 4K8ZA 4H5WA 5FLXO 4LF9K 1HNVA 3TANA 1XHXA 4DTNA 4IOXA 2Q36A 1GOAA 3T69A 3SJHA 4BGBA 4EHTA 4FM0A 2BTFA 1U6ZA 2Y1IA 1C0UA 4IWVA 4BC2A 1Q18A 4BE0A 1G15A 3NH1A 1HYVA 2KFNA 5HROA 2PY5A 4QAGA 4AM6A 2E2NA 5GADP 1VSEA 4A61A 2R7YA 4Y1CA 3T19A 1IO2A 1BU6O 3AARA 3MECA 2HHTA 4NLBA 1JL1A 1H1VA 3ZT4A 3KWIA 4B9MA 2KZZA 3I33A 2D5RA 3VQ5A 4OO1J 3BUZB 3AY9A 3CFRA 3CCEN 1IKWA 2D1KA 3VENA 1NJZA 4CW7B 2ATQA 3WNGA 3H3OB 4W5RA 4J2BA 3CCJN 4DSIA 3AVLA 1NWKA 4DV7K 2VQFK 5J2MA 4CBWA 1NGFA 4ILHA 3K0SA 3DLBA 2O8DB 2IVOA 3VGLA 2NRVA 3NMUA 4JEPA 3ZETB 3D45A 2IC3A 2F9TA 4A5BA 3TAQA 3DI6A 3T1AA 4DQRA 4CFBA 3PO4A 1NK4A 3V9SA 3ZSRA 3AO4A 3SCXA 2QTDA 1JLBA 3AVKA 4CJ7A 2HBLA 4MLHA 3CD6N 5AQSA 1KAZA 3EL2A 4FJMA 1IJJA 4MDAA 2QEXN 1U04A 1WSIA 3NF6A 3OYKA 3C94A 4I2PA 4CZMA 3ZX3A 4H0YB 1HNZK 3EY1A 3D0PA 4QS8A 1KD1O 1K9MO 1NKBA 2YHAA 2D0BA 2G8FA 2E8AA 4B8CA 1MU2A 3VETA 1RT7A 1VRTA 3LWLA 1SL2A 4FJIA 3VTHA 2NNWA 3QDKA 4JLHA 2V7YA 5HRNA 3JSMA 4QS9A 5M1PA 3FZMA 4NO7A 1GOCA 4IOCL 2AA4A 1RDAA 3BZKA 1NLVA 3SZ2A 2RKIA 1E3MA 4H5NA 4L8RB 4JNEA 4LF4K 1HX1A 2Q97A 4CF0A 3D2EA 3QLHA 3ZLJA 4XEIA 1DGKN 2GEMA 4CIFA 1VQKN 1J9AA 1TV6A 1FXXA 4CEZA 2WUSA 3H46O 1RBRA 3HM9A 3O4NA 3J81O 3WQUA 4ISEA 5I9EB 1V4TA 3QFUA 4N47A 1EWQA 3ZSVA 1BQNA 1K73O 3PSFA 1UAXA 3VF6A 4CEFA 5AFUA 4GW6A 4FSVA 3OS1A 4OX9K 4JI5K 3OYIA 3OYNA 3T1YK 2KW4A 3M1FA 2ZJRL 3ZEUB 2H3GX 4CJ5A 1SL0A 4J2AA 2Q3SA 1NKEA 2P9IB 1QHTA 4H0PA 5F2RA 1T6CA 4A2BA 4A57A 1U49A 4YOUA 3SQ2A 5GIPA 4KHYA 3C6HA 4DLGA 3PUFA 5AQUA 1BUPA 1TL3A 4CJFA 1RTHA 3NFAA 3O1WA 4K42A 4FLYA 1N34K 1LAWA 3DLHA 3LWMA 4F3OA 1TK5A 4BACA 4KAZA 3C6AA 1IKVA 3O1BA 1TUYA 4RG8A 3WXIA 5JLHA 2UXDK 4BRQA 3L2VA 3AA3A 1VQ8N 3MX5A 4M3RA 3JS6A 1RGIA 3N4QA 4B9UA 3LP0A 3NDKA 2OANA 1ZBIA 4DTUA 3MXMA 4B3TK 1L3VA 4FW1A 1RBTA 1XI1A 3H3NO 4BG8A 1Q8IA 1C0FA 3ZX0A 1C0GA 2GUPA 3VEVA 5JS1A 4DF8A 3CM5A 1QVGM 1YTAA 4BDYA 2CH5A 3THWA 1RBSA 1RT3A 4B3OA 4HVJA 3F2KA 4JK7A 4FWSA 2P9SB 2NRWA 4CJUA 4BRGA 5CZ1A 4EP4A 3PV8A 5FPDA 5JVHL 3MCPA 3M8QA 4JN4A 4JKCA 5LJVA 4H5VA 2ITGA 2GV9A 4CJKA 3TWHA 3LZIA 4R5PA 1NGJA 2E1ZA 3EE8A 2YHWA 4LF5K 5AQXA 3OW2M 3L2WA 3MN6A 3OVNA 2XY8A 3DRRA 3A0IX 3DLLL 4CECA 3HRGA 4R79A 5CHIA 3AA4A 1YIJN 4M7YA 1NNEA 2O8FA 4E89A 5AQRA 3TARA 2J4RA 5C24A 1IG9A 5T7BA 4JV5K 1Y97A 4DV4K 3I0SA 2YKMA 1YJNN 2A41A 1RTJA 1WN7A 3V1RA 1REVA 2P9LB 3LDNA 4F9OA 4AHCA 5GIOA 4L3QA 3J80O 5HLFA 2F96A 4FLZA 4FWQA 4CEBA 2O8BA 3IRXA 3MXIA 5AQWA 3NE6A 1SL1A 2E2OA 3C95A 2ASMA 2HF3A 4WE1A 4CZGA 1FW6A 4IXCA 3J7AP 4FO0A 4CJEA 4MDBA 2UU9K 1D5AA 1NBWA 3WXLA 1QZ5A 1IBMK 2A3ZA 1NK0A 3GE1A 3SAGA 3R1XA 4KHNA 3H1VX 3MDQA 3FE1A 3WUHA 2ZE2A 1MWKA 1KQSM 3FLCO 2BGGA 3OBWA 4H4OA 3L2RA 4JI8K 4KHUA 3NH2A 3VEWA 1HR0K 3E9OA 1HUXA 2XY7A 4H4MA 4YOWA 3NGYA 3OYCA 1S9EA 4JKGB 4JKBA 3OY9A 1GLFO 4BQLA 1ZXOA 1QVFM 1EO1A 2F7TA 4FOEA 3QEXA 1VSLA 1BI4A 3AGRA 3TABA 4XIUA 3UKUB 2HHWA 3BP8A 3QB0A 1ILYA 1HKCA 4JI7K 2WFBA 1F21A 2IIRA 1A5VA 3KLEA 3NAEA 2KHOA 2P9KB 4DTPA 4N76A 2O8FB 5J2NA 2KFZA 3S3NA 2P9NB 1HLUA 2RF2A 4GVEA 1JCGA 4FLUA 3VQPA 2HOEA 3OYLA 4H0OA 4RTFD 1K6YA 5C10A 1J54A 4DSJA 2A40A 3V4IA 3CJ9A 3O80A 1WAFA 2RN2A 2IVPA 3L6QA 3ASMA 1TKXA 2E2QA 4E1JA 4GKKK 3HI0A 5BRFA 1QQOA 5K14A 4AILC 3DLGA 3HP6A 1TYQA 1T8EA 1VQNN 2CGKA 1NM1A 2JWKA 4CD3A 4BDZA 3QIPA 3CG7A 3DXMB 5BRHA 2KLAA 3TR8A 4CGIA 2YI1A 2YV0X 4C8MA 2OCEA 3VF2A 3CF5L 4OLBA 3LPTA 4AHUA 3CC7N 2E4LA 4GNIA 5C25A 3DLRA 3FZFA 2HHVA 3I0RA 4KH6A 4DSKA 1JCFA 3CERA 1LWCA 5AQOA 4JAXA 3ZSZA 1VQ6N 4IJAA 1NGBA 3WEEA 4E0DA 3SBGA 4BROA 2Q0UA 3F73A 5JLFA 2CH6A 3V1OA 5JVGL 4FZXC 3PIPL 3AVNA 1O1WA 1GLCG 4LC9B 2EX3A 1UWBA 4DFKA 4B9TA 3R6MA 1BI4B 2F8TA 5AQQA 4E7LA 3SV3A 1ASVA 2VWKA 4OPHA 1EQYA 1X9SA 3OYAA 3R8EA 3RR8A 1QHAA 1BA0A 2NUBA 4G9ZA 2QW9A 4JI2K 2NRXA 4OJRA 4BGAA 2YJFA 4CF9A 1KRPA 2VWBA 3OYJA 1BGXT 4YOVA 1NK7A 3NVKA 5AJ3K 3MK6A 3RR7A 2P1JA 3LAMA 3CJBA 2FLOA 4K43A 3ZSWA 4OLAA 5C0YA 5J1EA 4IBNA 3TI0A 4YORA 3JAMO 4YOXA 2ITMA 1TYQB 3FZLA 5KTQA 4JKHA 3GDQA 3LDPA 2O8EA 4DTXA 3QBXA 2AJQA 1TUUA 3S9HA 3WNHA 1VQPN 1Q81O 4Z4IA 1RTIA 3I8BA 4IZ9A 4U67L 3AVGA 1C1CA 2A42A 5AQVA 3F9MA 5M1QA 3M3ZA 4CJ3A 3CQ8A 1J5OA 4JKDA 3CJCA 4JKFA 4DHYA 3L2UA 1RDBA 1KVCA 2P9PB 4DQIA 2FBVA 5HRRA 1QSSA 4MLEA 3DOKA 3QFPA 5LY3A 1NJXA 5FPNA 1NGAA 4IEIA 2UXCK 4XH1A 2O8DA 3SUNA 5E84A 1YVNA 4DTRA 3N4PA 3ZETA 3BEXA 1ATSA 4ISFA 3MN9A 4DQPA 1Q9XA 5AQZA 4F8RA 4FVUA 5HOOA 1D4XA 1KCFA 2JGUA 3A5LC 2RPIA 1MDUB 5E26A 4E19A 1WLJA 4KV8A 5C12A 4FWPA 4IKFA 4LFBK 2A1SA 1NJYA 2O4IA 2G8KA 2UUBK 4ELUA 4W5OA 4KREA 1NGGA 3OYEA 1DKGD 4KHPK 4FJJA 4DR4K 3D2FB 3EZWA 4X65K 4B1YB 1KVAA 3KVGA 1RDCA 4HUGA 3DLKA 4BY9C 2PBDA 1L3UA 4CHZA 4B3RK 3KK1A 4CJTA 3O8MA 3JXUA 4M3WA 3TSUA 5HP1A 5FDLA 3CJ7A 1MWMA 3CXCM 4HTLA 4FZZA 3VN5A 4ZTFA 1GLAG 2ETJA 3T1HK 4ILGB 2E88A 1RTDA 4M3ZA 5GINA 1BIUA 3DM2A 4DV5K 3L4IA 3ZCMA 2QM1A 1KC8O 3TU5A 4B9VA 4WQ5C 4YFUA 3DAWA 3VQ9A 3H1QA 4YHHK 1JL2A 4EFHA 4WFNL 3TAEA 2O8EB 3BY5A 5M1OA 2W40A 1HJOA 4N5SA 2QWPA 3KWGA 3W0LA 4QS7A 2WOMA 2Z1HA 4I9QA 3RSEB 3ULEA 3WNFA 3AGKA 5AZJB 2G8VA 3SK3A 3O9QA 4FW2A 1SKRA 3CPWM 3TTCA 3AO1A 4O8KA 4FJ5A 4B1VA 1SV5A 4N41A 3B8AX 4FLVA 3NCIA 2Z1IA 4AHSA 1VQMN 3ZEUA 1UA1A 4CIGA 3EEQA 3THXA 4CBXA 1Q9YA 1Q7YO 4BE2A 2P9IA 4RW4A 4PKGA 4J8FA 4BVOA 2XRIA 1NJWA 2KZMA 2ZGYA 1S1WA 1XQSC 4CI6A 3DRSA 3ZSYA 3E01A 3VOVA 4K8XA 2FBXA 1VQ5N 2HHHK 5FRMA 3CM6A 1J6ZA 4ICLA 3EYZA 1ASWA 3VQDA 3RMDA 1VSKA 2XY6A 4H0VB 5I3UA 2YKNA 1RFQA 4BREA 1L3TA 4PL8A 1IBKK 2ZJPL 3THYA 3AO5A 3S3MA 2DFHA 4DSEA 3E9LA 1RDWX 4M41A 1S72N 4F4KA 3L0QA 3TSPA 2IDOA 2HMIA 1YUWA 3BDPA 3OA9A 4CZFA 1UOCA 3V9UA 3CYMA 3O9UA 4WQ5A 1W0HA 1GLBG 5BR8K 4WCEL 2OZMA 1HKGA 1TVRA 1WSGA 4BC3A 4PL7A 1VSDA 1KLMA 1B9DA 5DM6L 5DK5A 2A1RA 5M1FA 3O9SA 3BZCA 1EETA 2P5OA 4DR7K 4CJSA 1NOZA 2IGIA 1RT2A 3ULEB 4WF9L 3VQQA 3PX4A 3DWLA 3CCQN 2ZQBA 3OYHA 1RNHA 4PY5A 2XHBA 4PA1A 2P9SA 4EZ6A 1DT9A 4A2AA 3NF8A 4M45A 1YXQA 1NMDA 3WNEA 3GOIA 3CCUN 4B1XB 1EKEA 4CK2A 3JYTA 2DFFA 3HTVA 1BIZA 3K59A 1RT4A 3BF3A 3THXB 3AO3A 1N32K 2YX6A 4KHQA 5EU7A 3K9KA 4CGDA 4A62A 1NGDA 3IS9A 4CHQA 4FK2A 3KKRA 5H1SQ 3A5OC 4KHSA 3KJVA 2V52B 1QQMA 4OKEA 3SMSA 1KSPA 4C23A 4BQZA 3FR0A 4FJHA 5M1NA 2WBNA 1VSHA 3HOTA 2WTUA 3AAPA 2Q2RA 3IG1A 3EN9A 4B9QA 3AAQA 3L8BA 1YITN 5ADXH 4PKIA 3ENBA 5EX5A 3HBTA 2P9LA 4DLEA 3THYB 5BREA 3ZT1A 5LMUK 4IDKA 1ITGA 3ULDA 3OJUA 2YNFA 3LDSA 2P5GA 3HVTA 3CCMN 4CFDA 2HHQA 4JHDB 3ENOA 3M6GA 4YOYA 1W2BM 4ZHRA 1BA1A 3C7NB 4GV6A 3V9XA 3CI5A 2E5LK 1IKXA 1T6DA 4DQ8A 2ZJQL 2EWSA 3AVHA 4H8KA 3V9ZA 5J2QA 4BRPA 3GL1A 1HNWK 4WQ4C 4CJVA 1TAUA 4O8UA 2VGNA 1BISA 3SPZA 3KLIA 3EE9A 2W6KA 5FPEA 4KKOA 1VK0A 3NBPA 1NK5A 2DPNA 4JKGA 4HCBA 2XO7A 3DXKB 1HPMA 4CEEA 5C15A 4X62K 3P4IA 5I42A 3ENHA 4IJNA 3P38A 4MFBA 5KPTA 5FPMA 2VGMA 1C0TA 3HPOA 3UKUA 1NKCA 4GKJK 3NHGA 1WUAA 3ID8A 2VQEK 3IAYA 3EO3A 3GBTA 3OS2A 5HRSA 4DFJA 2FF3B 1GLJO 1G99A 1WBDA 4EHUA 2HSTA 2P9KA 1KVBA 5SZTA 4DTJA 3PX0A 2P9NA 4CEDA 4CJQA 2E2PA 4IDHA 1U2VB 4GMJB 1WNSA 3WXKA 1DEJA 1JLEA 3AVCA 2PZSA 4FL9A 4FWLA 4FJNA 3RTVA 1RT1A 4W5QA 3HXMA 1QTMA 2Q31A 3AA2A 3KK2A 4CHOA 2YJEA 4E7KA 4C8KA 2P9UB 2F9WA 2VYPA 1B92A 1SKWA 4NYNA 2UUAK 1NGIA 1BL3A 4Z94A 3RRHA 3OHRA 3VA0A 1LV5A 4Y1DA 1TK0A 3DXMA 2Q0RA 4H0TB 1KXPA 3W3DA 4DB3A 1DTQA 1HJRA 1OVYA 4CEAA 1ATRA 4WQ4A 1XNQK 3HL8A 3OYBA 4FXDA 3KLGA 3AVJA 4CHYA 2HBJA 1XC9A 5AQGA 4CESA 3CMAN 3DOLA 5EXWA 1XNRK 4CZHA 3EKUA 3LL3A 4C1NI 4E3SA 1J53A 4H0XB 1VQON 3FGUA 2GUIA 3K5NA 2D0AA 3G6EN 1BHLA 3O9TA 3RWUA 1NOYA 1YT3A 2Z1GA 3MMVA 5CYQA 1FK9A 4RWTA 4FYDA 4FCYA 4V19S 4KTWA 1A5XA 2ZM6K 4PKHA 3J8AA 3VESA 3F9KA 3IMXA 4NCAA 1C1AA 3MXJA 3TAMA 4IG0A 3LM9A 1Z26A 2B5JA 5SWMA 2G8WA 3ATUA 3L3UA 3NVMA 2QWRA 4O44A 3V9WA 4HCCA 3R3LA 4B9SA 3MX2A 4HUFA 3CCVN 3HM8A 1M1KO 5BR9A 2QWQA 3LAKA 1U4BA 4PQUA 4BR2A 5KRTA 1TKZA 4E1MA 2HBKA 1YJ9N 5C42A 2QA4N 3PSIA 2OPPA 4CHPA 3V81A 4WYBA 4J2DA 1FJGK 5IT9O 1CZAN 4NLCA 2G8IA 3LDLA 4FWRA 1OKJA 4HTUA 1KAXA 3E9PA 4FK0A 3VQBA 3U3GA 4CF1A 3CC4N 3LDQA 1JLAA 3QEIA 1BOTO 4DU3A 4BC4A 4EZ9A 5BN8A 3CHWA 5AQFA 1S1XA 4JI4K 4BRFA 4DF4A 1BCMA 1XWLA 4LH5A 2PFUA 1OH5A 4FK4A 1HYZA 1WSFA 2P9PA 3MCAB 1QSLA 4J2EA 1GOBA 2G8HA 2X6SA 1QS4A 4DV6K 3J7YP 4BR0A 4BDPA 4LF6K 5M1KA 2F8SA 1DTTA 2IOCA 4FWKA 2UUCK 3KHYA 4XH5A 4HWIA 5AQKA 4AHTA 3NH0A 4DFMA 2HMPA 2E6LA 3A8YA 3L4QA 5HL7L 3TAGA 3CPEA 3P83D 1Q86O 1VSJA 1QSYA 5KGXA 4LFAK 4DR6K 4I2QA 3V1QA 2NRRA 4E1NA 3K5MA 3O5BA 4ID1A 1D9FA 4KB0A 3KD5E 3D2FA 3ZYYX 1X9JA 1IKYA 4AHVA 1SKSA 4CCHA 5HBMA 4FOIA 1YAGA 1WSJA 3SUPA 3HJFA 1Z05A 5AQJA 1SUQA 1IG8A 1E4FT 1WSHA 4DMNA 4C8NA 3SJJA 3CETA 1S3XA 3CC2N 2KQ2A 4M63C 5AZIB 3P5JA 1X3NA 3AVBA 5BRDA 3TAPA 5AQTA 3FZKA 2ASPA 1J5EK 1SS6A 2HNYA 1U48A 1JJ2M 3WXMB 4E7IA 1T05A 5CE3A 4OKKA 3UKRB 3VF4A 4CJWA 4M7XA 3K57A 4DQQA 1OH8A 4NXNK 3L2QA 1HQUA 2OYQA 1ZBFA 3CIPA 3K2PA 2DTUA 2HB5A 1WB9A 3C0BA 4DSLA 5AQHA 2ZGZA 3MN7A 3RSEA 5AZJA 4FM1A 2HNZA 5FRNA 1JLCA 2YCHA 2FF6A 5KQDA 3EZ5A 3AA5X 3IFRA 3SQ1A 2B6AA 2HHSA 3DRPA 4F2SA 4BVPA 3AVMA 1K8KB 1LWFA 3LDOA 3QO9A 4BR4A 4CZKA 4LD0A 3MEEA 4KI4A 3MN5A 4RW7A 1S22A 4GY2B 2VWJA 1U45A 1T44A 4FJKA 4IFYA 2NZTA 2X74A 2B4JA 1VQ7N 1GLDG 2IVNA 3P39A 4FJ9A 3OS0A 1T03A 4Q0BA 1JXBA 5BN9A 3ZT0A 4BRDA 4BRAA 1P8ZA 5J2PA 4H03B 1JLGA 3QBWA 2HHUA 3ISNC 3E66A 2D0PA 2KTQA 1X1PA 4DR2K 2RE2A 2BE2A 1D8YA 2F4VK 4KB1A 2GWKA 2O8CB 4EAHD 4E7JA 1QQCA 5JS2A 1RILA 3QERA 1ZBUA 3PX6A 3AVFA 3S41A 2E6MA 3C6UA 4DR5K 4I9LA 4BR7A 1P90A 5TKWA 3QEVA 4DTMA 3MEGA 1RDDA 3C65A 2QK9A 3HSCA 4YOTA 3SPYA 3SNNA 2BANA 3QIOA 1S1VA 3VPZA 1ZBHA 1VSIA 4ISGA 2W42A 4DWIA 4OKJA 4KFBA 3T3FA 4CZJA 4O0JA
chains in the Genus database with same CATH topology
4B1ZA 3LDNA 4F9OA 5ADXA 3SAFA 5GIOA 3HTVA 4L3QA 3WT0A 3BF3A 2FXUA 3VGMA 2I7PA 4CZIA 1LCUA 2GELA 4FWQA 4IO9L 2YX6A 3CMEN 3K9KA 1ESVA 2QWMA 5AQWA 4K25A 4A62A 1NGDA 5AQMA 3VEYA 2E2OA 2ASMA 2HF3A 3A5OC 3ZX2A 5H1SQ 2V52B 3FZHA 3O9RA 4CZGA 1QQMA 4KH4A 2ZF5O 3UE5A 2ZWHA 4IXCA 4IEEA 3SMSA 4C23A 4FO0A 3FR0A 4BQZA 5M1NA 2WBNA 5KPZA 4MDBA 2NRTA 3HOTA 1GLEG 4UY8O 1NBWA 3AAPA 3SBTA 3WXLA 1QZ5A 2Q2RA 2YHYA 2A3ZA 1RDUA 5JICA 3GE1A 1GLLO 2NRHA 4BRCA 3A5NC 3SAGA 3R1XA 1E4GT 3H1VX 2YHXA 3MWTA 3EN9A 1YI2N 3MDQA 3FE1A 4B9QA 3AAQA 1M90O 3WUHA 1YITN 5ADXH 4PKIA 2V51B 1MWKA 1VQ9N 3ENBA 5EX5A 3HBTA 2P9LA 3K9JA 5KPRA 3FLCO 1KQSM 3OBWA 3GG4A 3VEWA 5BREA 5CR4A 1ZBSA 3F5TA 3E9OA 1HUXA 5C2DA 1NGHA 1O13A 1VAZA 4YOWA 4MO5A 3PLAA 1SAZA 2E20A 1YF5L 2Q1NA 3KK7A 4FWOA 3CCMN 3FFKB 4JKGB 5AQLA 4I6MB 4JKBA 3EKSA 1QZ6A 3A5MC 4JHDB 1GLFO 1WOQA 3G71N 4BQLA 3ENOA 1ZXOA 3M6GA 1VQ4N 2F7TA 4YOYA 1QVFM 3PIOL 1W2BM 3O08A 1EO1A 5C2FA 2HBMA 1BA1A 3C7NB 4FOEA 1VQLN 1YHQN 4GV6A 3VMFB 2E1YA 3AGRA 3CI5A 1T6DA 4BRMA 4DQ8A 3P31A 2ZJQL 3UKUB 2EWSA 4BRPA 3GL1A 4B1WB 2RHKA 3BP8A 4WQ4C 3QB0A 1ILYA 4OPAA 3WXJA 1QQNA 1HKCA 3TSQA 2WFBA 2AP1A 4H5RA 4A59A 4O8UA 2IIRA 2CGJA 2VGNA 5JMVA 3IDHA 5AR0A 2KHOA 2P9KB 3VTIA 3I55N 3VEZA 3CCLN 3EE9A 2P9NB 3CQYA 1HLUA 3M5RA 4IO8A 5FPEA 4BRKA 4GVEA 1JCGA 2W41A 4A5AA 2DPNA 2HOEA 4JKGA 4H0OA 3CJ1A 4I6MA 3Q7CA 4RTFD 3DXKB 3SAHA 4JHDA 5EVZA 5C10A 3CCRN 1HPMA 1YJWN 3MWPA 5C15A 2HF4A 3P4IA 4KBOA 3ENHA 2A40A 3C7NA 4IJNA 3D6RA 3P38A 5KPTA 3CJ9A 3O80A 5FPMA 3U8XA 2IVPA 1BWFO 3L6QA 3TTDA 2VGMA 2E2QA 4E1JA 3D7EO 2GX9A 3UKUA 3HI0A 5F0XA 5BRFA 3CCSN 1WUAA 3ID8A 1QQOA 3Q7BA 3VGKA 3WEEB 3G4SN 1Y64A 2OTLN 3EO3A 1TYQA 5GAEP 1SQKA 3GBTA 2CGKA 1VQNN 1NM1A 2JWKA 2CGLA 2FF3B 4CD3A 4BR9A 1GLJO 1G99A 4JK8A 3DXMB 4PHTX 5BRHA 4KH5A 4CD1A 1K8AO 2KLAA 3IUCA 4EHUA 5AQYA 2HSTA 2UYTA 2P9KA 2YI1A 3VERA 3H45C 4H5TA 5EOYA 3VF2A 2P9NA 5AQIA 5GAHP 2E2PA 4EIAA 4FWMA 4JD2A 4IDHA 3HZ6A 1U2VB 3WXKA 1DEJA 3CF5L 3DXKA 2PAVA 4H5WA 3CC7N 4FL9A 4GNIA 3FZFA 4KH6A 4FWLA 4IOXA 2Q36A 1BG3A 1JCFA 3CERA 4K41A 5AQOA 4JAXA 3T69A 2Q31A 3SJHA 4BGBA 4EHTA 2BTFA 1VQ6N 1U6ZA 2YJEA 1NGBA 4IJAA 2QXLA 2P9UB 2F9WA 3WEEA 4IWVA 2VYPA 4BC2A 3J7ZO 1Q18A 3SBGA 1NGIA 2Q0UA 4BROA 4Z94A 5JLFA 5DM7L 3OHRA 3DXMA 2CH6A 5JVGL 3PIPL 4IFEA 2Q0RA 3R9PA 1GLCG 4LC9B 3SLCA 1BO5O 2E2NA 4AM6A 5GADP 4H0TB 1KXPA 3R6MA 3W3DA 4DB3A 4A61A 1OVYA 1ATRA 5AQQA 1BU6O 4WQ4A 4OPHA 3AARA 1EQYA 4IOAL 4NLBA 1H1VA 1X3MA 1U2VA 3KWIA 3I33A 2HBJA 5AQGA 3R8EA 4OO1J 1QHAA 3BUZB 5TKYA 3RVCA 4U7BA 2QWOA 1BA0A 3AY9A 3CMAN 3CCEN 5EXWA 2QW9A 4G9ZA 2NRXA 4B1UB 2D1KA 3VENA 4BGAA 3H3OB 2YJFA 3CCJN 4BG9A 4CZHA 2P9UA 3HOSA 3EKUA 3LL3A 4C1NI 4DKWA 3LM2A 1NWKA 2VWBA 5ELZA 4CBWA 1NGFA 4H0XB 4YOVA 1VQON 3FGUA 3G25A 4ILHA 3G6EN 3O9TA 3NVKA 2IVOA 2NLXA 3MK6A 3VGLA 5B8HA 3CJBA 2FLOA 2NRZA 2NRVA 4K43A 3IKMA 3NMUA 4B1XB 4JEPA 3QMLA 3ZETB 5C0YA 2F9TA 4A5BA 3MMVA 5BPNA 4RWTA 2BUPA 3U9ZA 4RCHA 4YORA 4XH4A 4YOXA 4GV3A 4PKHA 3J8AA 2ITMA 1TYQB 3FZLA 2QTDA 3VESA 4BRHA 4CZEA 4JKHA 3GDQA 3LDPA 4CJ7A 1KAYA 2HBLA 2QWLA 4MLHA 3CD6N 3QBXA 3IMXA 1TUUA 5AQSA 1KAZA 3EL2A 3E1YA 1IJJA 4MDAA 1VQPN 1Q81O 2QEXN 3LM9A 3QICA 2GTDA 3I8BA 4IZ9A 4U67L 3ATUA 2A42A 3NVMA 3F9MA 2QWRA 3M3ZA 5AQVA 5M1QA 3ZX3A 4H0YB 4JKDA 3CJCA 4JKFA 4DHYA 4ILJA 3R3LA 3MX2A 3D2EB 1XUPO 4QS8A 2P9PB 1KD1O 4BRIA 1K9MO 3CCVN 3HM8A 4JD2B 4MLEA 1SZ2A 2FSJA 3QFPA 5LY3A 1M1KO 5FPNA 1NGAA 4IEIA 5BR9A 2E8AA 2QWQA 3VETA 4XH1A 4BR2A 5E84A 1YVNA 2HBKA 1YJ9N 3N4PA 4JK9A 2QA4N 3ZETA 3VTHA 3BEXA 2NNWA 4WYBA 1T3VA 1ATSA 4ISFA 3MN9A 2JWLA 3QDKA 5BPMA 1CZAN 4NLCA 5AQZA 5F1XA 4FVUA 5HOOA 1D4XA 2V7YA 3LDLA 3A5LC 1MDUB 5E26A 1JCEA 4QS9A 4FWRA 5M1PA 1OKJA 3FZMA 4FWPA 5C12A 1KAXA 3TTFA 4NO7A 3E9PA 5EY4A 4IOCL 2AA4A 1NLVA 3CC4N 3LDQA 1BOTO 4H5NA 4JNEA 1NGGA 4BC4A 1DKGD 5BN8A 3CHWA 5AQFA 4WFAL 3D2FB 4BRFA 1HX1A 3EZWA 2Q97A 2PFUA 3D2EA 4AM7A 2P9PA 4B1YB 2KKZA 3MCAB 5MLCQ 2D0OA 3KVGA 4XEIA 1DGKN 4BY9C 2PBDA 2VCPA 4BRNA 2GEMA 4BR0A 4C1NK 3O8MA 3JXUA 3O4WA 4NB4A 5M1KA 1ZC6A 3TSUA 1VQKN 4FWKA 3KHYA 2WUSA 3H46O 4XH5A 5KQ8A 4HWIA 5AQKA 3CJ7A 4FWNA 2WC9A 1MWMA 3WQUA 4BRLA 4ISEA 5I9EB 1V4TA 3QFUA 3U9DA 3CXCM 2HMPA 4HTLA 3A8YA 3L4QA 1Q82O 5HL7L 2QI2A 5AQNA 3CPEA 1GLAG 3TPQA 1Q86O 3BF1A 1K73O 3VF6A 4ILGB 5AFUA 2E88A 2NRRA 4FSVA 3O5BA 5GINA 3M1FA 2ZJRL 4JKEA 3ZEUB 2H3GX 3D2FA 1ATNA 4YDUC 3L4IA 2QM1A 1KC8O 3TU5A 3ZYYX 1X9JA 3O6WA 4WQ5C 2P9IB 3DAWA 3H1QA 4FOIA 1YAGA 4WFNL 4EFHA 1Z6RA 4H0PA 2W40A 5F2RA 5M1OA 1T6CA 1Z05A 4A2BA 5AQJA 4A57A 1HJOA 1IG8A 2QWPA 3KWGA 3KZBA 1E4FT 4QS7A 4YOUA 3W0LA 5GIPA 3CETA 1S3XA 3C6HA 3RSEB 3ULEA 4CBUA 3CC2N 3AGKA 4M63C 5AQUA 5AZJB 4AF1A 4O5FA 1BUPA 5AZIB 3SK3A 1R59O 1X3NA 3O9QA 5BRDA 5AQTA 3CPWM 3FZKA 3TTCA 2ASPA 4O8KA 1SS6A 1JJ2M 2D4WA 3WXMB 4B1VA 5CE3A 3UKRB 3VF4A 3T7ZA 5AFUH 3O1WA 4BR5A 4K42A 4M7XA 3B8AX 3ATVA 5BPLA 5GAGP 5AQPA 2BH1A 2QWNA 1VQMN 3ZEUA 3ID6A 4CBXA 1HKBA 1NGCA 1Q7YO 2GWJA 2P9IA 3C6AA 3O1BA 4PKGA 3CJAA 4J8FA 4BVOA 3CIPA 1TUYA 3WXIA 2ZGYA 5JLHA 1XQSC 4BRQA 4CI6A 3C0BA 4MO4A 1N8RO 5AQHA 3U4LA 4CZLA 2ZGZA 2ASOA 3MN7A 3RSEA 3VOVA 1LOTB 1VQ5N 3MX5A 1VQ8N 5AZJA 2FSKA 1RGIA 3JS6A 1J6ZA 3N4QA 5AZIA 2YCHA 2FF6A 2OANA 5KQDA 4GV9A 4CZMA 3VEXA 3IFRA 1MA9B 3CQXA 3UKRA 4H0VB 3H3NO 3H6EA 3UB5A 4BVPA 4BG8A 1K8KB 1RFQA 1C0FA 3ZX0A 1C0GA 2I7NA 2GUPA 4BREA 3LDOA 4PL8A 3VEVA 3DJCA 4BR4A 4CZKA 3WQTA 2ZJPL 1QVGM 2CH5A 3MN5A 3E9LA 1RDWX 1S72N 1S22A 4GY2B 3F2KA 4FPBA 4JK7A 3L0QA 4FWSA 3TSPA 3VEOA 2P9SB 2NRWA 1T44A 4BRGA 5LJWA 2NZTA 2V7ZA 1YUWA 5FPDA 5JVHL 3OA9A 3MCPA 4YDUA 4CZFA 2FSNA 4WFBL 2A5XA 1VQ7N 1GLDG 2IVNA 3P39A 4JN4A 3O9UA 4JKCA 3SMPA 4H5VA 4WQ5A 5LJVA 1V4SA 4DCHA 5BN9A 1GLBG 4BRDA 4BRAA 1P8ZA 4Y0WA 4WCEL 1NGJA 4H03B 3QBWA 2E1ZA 1HKGA 3E66A 3EE8A 4BC3A 4PL7A 2YHWA 2D0PA 5AQXA 5DM6L 2A6AA 3OW2M 5M1FA 2RE2A 3O9SA 4JKAA 3MN6A 4BC5A 1K8KA 1XC3A 3OBYA 1NJIO 2GWKA 3A0IX 4EAHD 3DLLL 3HRGA 4R79A 2OTJN 5CHIA 3ULEB 4WF9L 1YIJN 3S41A 4M7YA 3DWLA 3CCQN 5AQRA 4BR7A 1P90A 5TKWA 3I56N 2J4RA 2P9SA 1DT9A 4A2AA 1NGEA 3C65A 3HSCA 4YOTA 1YJNN 3VPZA 4FPAA 2A41A 4ISGA 1BDGA 1W97L 1NMDA 1YXQA 3GOIA 3CCUN 2P9LB 4CZJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PHT X;  1YF5 L;  5TKW A;  1W97 L;  2BH1 A; 
#chains in the Genus database with same CATH topology
 4B1Z A;  5ADX A;  3LP1 A;  3SAF A;  1EXQ A;  2HVH A;  3WT0 A;  2FXU A;  3VGM A;  4CZI A;  1LCU A;  2GEL A;  4O5B A;  4KRF A;  1KFS A;  4CE9 A;  2PYL A;  2QWM A;  1TKT A;  4K25 A;  3O3F A;  3VEY A;  3ZX2 A;  3FZH A;  3OJS A;  3O9R A;  3UE5 A;  4KH4 A;  4IEE A;  1N36 K;  4IG3 A;  5KPZ A;  2NRT A;  1GLE G;  4CFC A;  4UY8 O;  3SBT A;  3HPH A;  2VG6 A;  3NF7 A;  3G0Z A;  1RDU A;  1GLL O;  4NYF A;  4BRC A;  1E4G T;  3MED A;  4LSL A;  4CK3 A;  2V51 B;  4NXM K;  5KPR A;  2HVI A;  1W9H A;  3LP3 A;  3M8R A;  2I5J A;  3AVA A;  3G10 A;  1IV0 A;  5CR4 A;  1ZBS A;  3F5T A;  3C6T A;  1NGH A;  1O13 A;  1VAZ A;  1HQE A;  3PLA A;  2QXF A;  1NU0 A;  2Q1N A;  3KK7 A;  4FWO A;  3I8D A;  2BDP A;  3FFK B;  5AQL A;  4I6M B;  3VQ7 A;  1RT6 A;  1LW2 A;  3A5M C;  1EX4 A;  3G71 N;  4Z4C A;  1VQ4 N;  3PIO L;  1OH7 A;  2HBM A;  1VQL N;  1YHQ N;  3VA3 A;  5FRO A;  1FKO A;  3A2F A;  4B1W B;  3ZSQ A;  2RHK A;  2OPS A;  4K0K K;  3WXJ A;  1QQN A;  4FJG A;  4A59 A;  1A5W A;  2CGJ A;  4CF2 A;  3IDH A;  5AR0 A;  4GVM A;  4DS5 A;  3VEZ A;  2OA8 A;  3L3V A;  4HHT A;  4IO8 A;  4BRK A;  4LH4 A;  4A5A A;  4Z0U A;  1HNX K;  3SAH A;  1BCO A;  4JHD A;  5EVZ A;  3KLH A;  3SUQ A;  1YJW N;  4CEO A;  3MWP A;  3OYG A;  3LP2 A;  3ALY A;  3C7N A;  3D6R A;  2XY5 A;  2Y1J A;  3U8X A;  4ELT A;  4O0I A;  4X66 K;  1S5J A;  2GX9 A;  1NK6 A;  1Z25 A;  5F0X A;  3CCS N;  1QE1 A;  3VGK A;  4DTS A;  1Y64 A;  2OTL N;  1NK8 A;  4JI6 K;  5GAE P;  4DG1 A;  3BGR A;  1SQK A;  1CXQ A;  4G1Q A;  3UIQ A;  2CGL A;  4JK8 A;  1IH7 A;  4PHT X;  4KH5 A;  4FM2 A;  3IUC A;  1OVQ A;  4M42 A;  5CY4 A;  4DSF A;  2YNG A;  5AQY A;  3OYF A;  3AV9 A;  3VER A;  4JI3 K;  4BWJ A;  3OYD A;  1UA0 A;  4H5T A;  4B3S K;  3RMA A;  4Z4E A;  3LAL A;  5AQI A;  5GAH P;  4FJX A;  4JD2 A;  3HZ6 A;  2X6N A;  3DXK A;  3MAQ A;  2PAV A;  1DLO A;  1S1T A;  4PUO A;  1JLQ A;  4F3T A;  1BG3 A;  4K41 A;  4KHW A;  1EWR A;  3ZT3 A;  1W7A A;  2QXL A;  4QCL A;  4JS5 A;  3J7Z O;  1X9M A;  1RCH A;  1LWE A;  1I39 A;  3QEP A;  5DM7 L;  3NGI A;  4IFE A;  3U6F A;  3R9P A;  4DS4 A;  3SLC A;  1BO5 O;  1S6P A;  2FC0 A;  3AVI A;  4FLX A;  4FZY A;  4IOA L;  1NMN A;  4DV1 K;  1X3M A;  1U2V A;  1KLN A;  4EP5 A;  3RVC A;  5TKY A;  4LSN A;  2QWO A;  4U7B A;  1KTQ A;  4RW8 A;  3OYM A;  4JS4 A;  4B1U B;  2DY4 A;  3SI6 A;  1B9F A;  1C1B A;  4BG9 A;  2P9U A;  3HOS A;  3SQ0 A;  4DKW A;  1JXE A;  3LM2 A;  5A2Q O;  3QEW A;  5ELZ A;  3G25 A;  2NLX A;  1I3A A;  5B8H A;  2NRZ A;  4DR3 K;  3IKM A;  2YHB A;  4DV0 K;  1X9W A;  3QML A;  5D3G A;  2BUP A;  3DYA A;  3U9Z A;  2IS3 A;  4RCH A;  3QNO A;  1RBU A;  4XH4 A;  4DU1 A;  1WSE A;  4GV3 A;  4BRH A;  4CZE A;  3LZJ A;  1KAY A;  2QWL A;  3HVR A;  3E1Y A;  1NK9 A;  4AQY K;  5DMR A;  3QIC A;  2GTD A;  4DR1 K;  4KI6 A;  4ELV A;  5KGW A;  4ILJ A;  2PYJ A;  3D2E B;  1XUP O;  3B6P A;  4BRI A;  4JI1 K;  4JD2 B;  4JRQ A;  1SZ2 A;  2FSJ A;  3O3G A;  4AHR A;  1XMQ K;  4JK9 A;  1LAV A;  4CGF A;  2Z1J A;  1U47 A;  4DV3 K;  1T3V A;  3U3Y A;  2JWL A;  5BPM A;  5F1X A;  4CJL A;  4JYA K;  1JCE A;  3SUO A;  4MQ3 A;  2YNH A;  5CYM A;  3TTF A;  1TK8 A;  1N33 K;  5EY4 A;  1I94 K;  3CFP A;  1TKD A;  1S9G A;  1HMV A;  3DLE A;  4WFA L;  4Z4H A;  3O4Q A;  1JKH A;  2D0C A;  4KPY A;  4AM7 A;  4CJ4 A;  2KKZ A;  5MLC Q;  2D0O A;  3SQ4 A;  3NF9 A;  4FJ8 A;  1ZBL A;  2VCP A;  4BRN A;  3K5L A;  4C1N K;  3O4W A;  4NB4 A;  5IWA K;  1ZC6 A;  3ZSX A;  1S6Q A;  5KQ8 A;  4AH9 A;  4N56 A;  4HUE A;  2HND A;  4FWN A;  2WC9 A;  4BRL A;  4JI0 K;  3U9D A;  4DQS A;  1Q82 O;  3VQA A;  2QI2 A;  3ZSO A;  5AQN A;  3TPQ A;  4M3T A;  2ZD1 A;  3BF1 A;  4ZTJ A;  4Q5V A;  4KO0 A;  1XMO K;  4B08 A;  4C8L A;  2YNI A;  4JKE A;  3CFO A;  1ATN A;  1VHX A;  4YDU C;  3VQC A;  3HT3 A;  4DV2 K;  4LF7 K;  4PWD A;  2FBY A;  3O6W A;  1HNI A;  3QIN A;  4B9L A;  1Z6R A;  5BPN A;  3ITH A;  3KZB A;  4FLW A;  4C8O A;  2WON A;  4DU4 A;  4CBU A;  4AF1 A;  4O5F A;  3KTQ A;  1R59 O;  4CEQ A;  1C6V A;  2QKK A;  2D4W A;  3T7Z A;  5AFU H;  4BR5 A;  4TSX A;  1L5U A;  3ATV A;  5BPL A;  5GAG P;  5AQP A;  4B9N A;  3KD1 E;  4RW9 A;  2BH1 A;  2QWN A;  2OZS A;  3ID6 A;  3QET A;  3THW B;  1HKB A;  1NGC A;  2GWJ A;  4W5T A;  4JRP A;  1KFD A;  4OGC A;  3CJA A;  2UXB K;  2VG5 A;  4FJ7 A;  4KTZ A;  1FKP A;  4MO4 A;  1N8R O;  2GBZ A;  3U4L A;  4CZL A;  2ASO A;  2EHG A;  1LOT B;  3K58 A;  2FSK A;  5AZI A;  4GV9 A;  1VSF A;  1T7P A;  3VQ8 A;  3HP9 A;  3VEX A;  1MA9 B;  4BE1 A;  3CQX A;  3UKR A;  4DUY K;  3H6E A;  3UB5 A;  1VSM A;  2I7N A;  3DJC A;  3WQT A;  4CGJ A;  1TGO A;  3M8S A;  3TAF A;  4OVL A;  4FJL A;  4F2R A;  4FPB A;  3VEO A;  3OTO K;  4CFA A;  2X78 A;  5LL6 Z;  5LJW A;  3QES A;  2V7Z A;  4LF8 K;  4YDU A;  2FSN A;  4WFB L;  2A5X A;  4YY3 K;  1WBB A;  3SMP A;  1OH6 A;  1V4S A;  2W6L A;  4IFV A;  1N5Y A;  4DCH A;  3RRG A;  1VRU A;  4Y0W A;  1ASU A;  2O8B B;  2A6A A;  4JKA A;  1HRH A;  4CGG A;  4BC5 A;  1K8K A;  1XC3 A;  3OBY A;  1NJI O;  3NGZ A;  4DFP A;  1NG9 A;  3SV4 A;  2OTJ N;  3H08 A;  1TL1 A;  4M3X A;  3KLF A;  2FBT A;  3B6O A;  3I56 N;  4CF8 A;  3FFI A;  3HO1 A;  1NGE A;  3S3O A;  4M3U A;  1WAJ A;  1ZYQ A;  4FPA A;  1BDG A;  1BQM A;  1W97 L;  3AO2 A;  4CHN A;  1RBV A;  4X64 K;  1JLF A;  3ZT2 A;  4OGE A;  1R0A A;  2I7P A;  4IO9 L;  3CME N;  4E7H A;  1ESV A;  3LPU A;  3KIO A;  5AQM A;  2QKB A;  4CJP A;  2O8C A;  2ZF5 O;  2HHX A;  2ZWH A;  4FVM A;  1S1U A;  2OPQ A;  3THV A;  3V6D A;  4DTO A;  3KK3 A;  3HST B;  2YHY A;  5JIC A;  2NRH A;  3A5N C;  3MWT A;  2YHX A;  1YI2 N;  4LY7 A;  1M90 O;  3RMC A;  1VQ9 N;  2O4G A;  3DMJ A;  3HK2 A;  3K9J A;  4CIE A;  2IAJ A;  3GG4 A;  1XHZ A;  4UQG A;  2G8U A;  1D9D A;  5C2D A;  4I7F A;  3VQ6 A;  2OPR A;  4CJR A;  4MO5 A;  5KRS A;  1SAZ A;  2E20 A;  5E41 A;  1YF5 L;  4NCG A;  4Z4G A;  1HYS A;  3EKS A;  2HW3 A;  1QZ6 A;  1EP4 A;  1RT5 A;  4CK1 A;  1WOQ A;  1CXU A;  4M3Y A;  3O08 A;  3HYF A;  5C2F A;  3HPG A;  3K5O A;  3VMF B;  2E1Y A;  1TAQ A;  2JLE A;  4QOZ B;  2LSN A;  4BRM A;  3P31 A;  4DUZ K;  2P51 A;  4Z4F A;  4LFC K;  3QNN A;  2VG7 A;  4OPA A;  4OPK A;  3TSQ A;  2AP1 A;  4H5R A;  4W5N A;  3SYZ A;  5JMV A;  3VTI A;  3I55 N;  3RMB A;  4KTQ A;  3CCL N;  4CVN E;  3M5R A;  3CQY A;  2W41 A;  5KI6 A;  1LW0 A;  3PO5 A;  3O3H A;  4I6M A;  3CJ1 A;  3VQ4 A;  3Q7C A;  4YNQ A;  3CCR N;  3P1G A;  3KKS A;  1CZ9 A;  2HF4 A;  4KBO A;  5CZ2 A;  1BWF O;  3TTD A;  1YVU A;  3D7E O;  1L3S A;  4NCB A;  4O55 A;  4B8A B;  3Q7B A;  4O4G A;  1CZB A;  4BWM A;  3PY8 A;  3WEE B;  4CGH A;  3G4S N;  4RW6 A;  4BR9 A;  1IBL K;  4ID5 A;  3LAN A;  4CD1 A;  4OPJ A;  1HPZ A;  1K8A O;  1CLQ A;  2UYT A;  1YTU A;  3H45 C;  5EOY A;  2DFE A;  1C0M A;  3VQE A;  4EIA A;  4B3M K;  4FLT A;  4FWM A;  1N6Q A;  3M8P A;  5HRP A;  4CER A;  5LMN K;  4K8Z A;  4H5W A;  5FLX O;  4LF9 K;  1HNV A;  3TAN A;  1XHX A;  4DTN A;  4IOX A;  2Q36 A;  1GOA A;  3T69 A;  3SJH A;  4BGB A;  4EHT A;  4FM0 A;  2BTF A;  1U6Z A;  2Y1I A;  1C0U A;  4IWV A;  4BC2 A;  1Q18 A;  4BE0 A;  1G15 A;  3NH1 A;  1HYV A;  2KFN A;  5HRO A;  2PY5 A;  4QAG A;  4AM6 A;  2E2N A;  5GAD P;  1VSE A;  4A61 A;  2R7Y A;  4Y1C A;  3T19 A;  1IO2 A;  1BU6 O;  3AAR A;  3MEC A;  2HHT A;  4NLB A;  1JL1 A;  1H1V A;  3ZT4 A;  3KWI A;  4B9M A;  2KZZ A;  3I33 A;  2D5R A;  3VQ5 A;  4OO1 J;  3BUZ B;  3AY9 A;  3CFR A;  3CCE N;  1IKW A;  2D1K A;  3VEN A;  1NJZ A;  4CW7 B;  2ATQ A;  3WNG A;  3H3O B;  4W5R A;  4J2B A;  3CCJ N;  4DSI A;  3AVL A;  1NWK A;  4DV7 K;  2VQF K;  5J2M A;  4CBW A;  1NGF A;  4ILH A;  3K0S A;  3DLB A;  2O8D B;  2IVO A;  3VGL A;  2NRV A;  3NMU A;  4JEP A;  3ZET B;  3D45 A;  2IC3 A;  2F9T A;  4A5B A;  3TAQ A;  3DI6 A;  3T1A A;  4DQR A;  4CFB A;  3PO4 A;  1NK4 A;  3V9S A;  3ZSR A;  3AO4 A;  3SCX A;  2QTD A;  1JLB A;  3AVK A;  4CJ7 A;  2HBL A;  4MLH A;  3CD6 N;  5AQS A;  1KAZ A;  3EL2 A;  4FJM A;  1IJJ A;  4MDA A;  2QEX N;  1U04 A;  1WSI A;  3NF6 A;  3OYK A;  3C94 A;  4I2P A;  4CZM A;  3ZX3 A;  4H0Y B;  1HNZ K;  3EY1 A;  3D0P A;  4QS8 A;  1KD1 O;  1K9M O;  1NKB A;  2YHA A;  2D0B A;  2G8F A;  2E8A A;  4B8C A;  1MU2 A;  3VET A;  1RT7 A;  1VRT A;  3LWL A;  1SL2 A;  4FJI A;  3VTH A;  2NNW A;  3QDK A;  4JLH A;  2V7Y A;  5HRN A;  3JSM A;  4QS9 A;  5M1P A;  3FZM A;  4NO7 A;  1GOC A;  4IOC L;  2AA4 A;  1RDA A;  3BZK A;  1NLV A;  3SZ2 A;  2RKI A;  1E3M A;  4H5N A;  4L8R B;  4JNE A;  4LF4 K;  1HX1 A;  2Q97 A;  4CF0 A;  3D2E A;  3QLH A;  3ZLJ A;  4XEI A;  1DGK N;  2GEM A;  4CIF A;  1VQK N;  1J9A A;  1TV6 A;  1FXX A;  4CEZ A;  2WUS A;  3H46 O;  1RBR A;  3HM9 A;  3O4N A;  3J81 O;  3WQU A;  4ISE A;  5I9E B;  1V4T A;  3QFU A;  4N47 A;  1EWQ A;  3ZSV A;  1BQN A;  1K73 O;  3PSF A;  1UAX A;  3VF6 A;  4CEF A;  5AFU A;  4GW6 A;  4FSV A;  3OS1 A;  4OX9 K;  4JI5 K;  3OYI A;  3OYN A;  3T1Y K;  2KW4 A;  3M1F A;  2ZJR L;  3ZEU B;  2H3G X;  4CJ5 A;  1SL0 A;  4J2A A;  2Q3S A;  1NKE A;  2P9I B;  1QHT A;  4H0P A;  5F2R A;  1T6C A;  4A2B A;  4A57 A;  1U49 A;  4YOU A;  3SQ2 A;  5GIP A;  4KHY A;  3C6H A;  4DLG A;  3PUF A;  5AQU A;  1BUP A;  1TL3 A;  4CJF A;  1RTH A;  3NFA A;  3O1W A;  4K42 A;  4FLY A;  1N34 K;  1LAW A;  3DLH A;  3LWM A;  4F3O A;  1TK5 A;  4BAC A;  4KAZ A;  3C6A A;  1IKV A;  3O1B A;  1TUY A;  4RG8 A;  3WXI A;  5JLH A;  2UXD K;  4BRQ A;  3L2V A;  3AA3 A;  1VQ8 N;  3MX5 A;  4M3R A;  3JS6 A;  1RGI A;  3N4Q A;  4B9U A;  3LP0 A;  3NDK A;  2OAN A;  1ZBI A;  4DTU A;  3MXM A;  4B3T K;  1L3V A;  4FW1 A;  1RBT A;  1XI1 A;  3H3N O;  4BG8 A;  1Q8I A;  1C0F A;  3ZX0 A;  1C0G A;  2GUP A;  3VEV A;  5JS1 A;  4DF8 A;  3CM5 A;  1QVG M;  1YTA A;  4BDY A;  2CH5 A;  3THW A;  1RBS A;  1RT3 A;  4B3O A;  4HVJ A;  3F2K A;  4JK7 A;  4FWS A;  2P9S B;  2NRW A;  4CJU A;  4BRG A;  5CZ1 A;  4EP4 A;  3PV8 A;  5FPD A;  5JVH L;  3MCP A;  3M8Q A;  4JN4 A;  4JKC A;  5LJV A;  4H5V A;  2ITG A;  2GV9 A;  4CJK A;  3TWH A;  3LZI A;  4R5P A;  1NGJ A;  2E1Z A;  3EE8 A;  2YHW A;  4LF5 K;  5AQX A;  3OW2 M;  3L2W A;  3MN6 A;  3OVN A;  2XY8 A;  3DRR A;  3A0I X;  3DLL L;  4CEC A;  3HRG A;  4R79 A;  5CHI A;  3AA4 A;  1YIJ N;  4M7Y A;  1NNE A;  2O8F A;  4E89 A;  5AQR A;  3TAR A;  2J4R A;  5C24 A;  1IG9 A;  5T7B A;  4JV5 K;  1Y97 A;  4DV4 K;  3I0S A;  2YKM A;  1YJN N;  2A41 A;  1RTJ A;  1WN7 A;  3V1R A;  1REV A;  2P9L B;  3LDN A;  4F9O A;  4AHC A;  5GIO A;  4L3Q A;  3J80 O;  5HLF A;  2F96 A;  4FLZ A;  4FWQ A;  4CEB A;  2O8B A;  3IRX A;  3MXI A;  5AQW A;  3NE6 A;  1SL1 A;  2E2O A;  3C95 A;  2ASM A;  2HF3 A;  4WE1 A;  4CZG A;  1FW6 A;  4IXC A;  3J7A P;  4FO0 A;  4CJE A;  4MDB A;  2UU9 K;  1D5A A;  1NBW A;  3WXL A;  1QZ5 A;  1IBM K;  2A3Z A;  1NK0 A;  3GE1 A;  3SAG A;  3R1X A;  4KHN A;  3H1V X;  3MDQ A;  3FE1 A;  3WUH A;  2ZE2 A;  1MWK A;  1KQS M;  3FLC O;  2BGG A;  3OBW A;  4H4O A;  3L2R A;  4JI8 K;  4KHU A;  3NH2 A;  3VEW A;  1HR0 K;  3E9O A;  1HUX A;  2XY7 A;  4H4M A;  4YOW A;  3NGY A;  3OYC A;  1S9E A;  4JKG B;  4JKB A;  3OY9 A;  1GLF O;  4BQL A;  1ZXO A;  1QVF M;  1EO1 A;  2F7T A;  4FOE A;  3QEX A;  1VSL A;  1BI4 A;  3AGR A;  3TAB A;  4XIU A;  3UKU B;  2HHW A;  3BP8 A;  3QB0 A;  1ILY A;  1HKC A;  4JI7 K;  2WFB A;  1F21 A;  2IIR A;  1A5V A;  3KLE A;  3NAE A;  2KHO A;  2P9K B;  4DTP A;  4N76 A;  2O8F B;  5J2N A;  2KFZ A;  3S3N A;  2P9N B;  1HLU A;  2RF2 A;  4GVE A;  1JCG A;  4FLU A;  3VQP A;  2HOE A;  3OYL A;  4H0O A;  4RTF D;  1K6Y A;  5C10 A;  1J54 A;  4DSJ A;  2A40 A;  3V4I A;  3CJ9 A;  3O80 A;  1WAF A;  2RN2 A;  2IVP A;  3L6Q A;  3ASM A;  1TKX A;  2E2Q A;  4E1J A;  4GKK K;  3HI0 A;  5BRF A;  1QQO A;  5K14 A;  4AIL C;  3DLG A;  3HP6 A;  1TYQ A;  1T8E A;  1VQN N;  2CGK A;  1NM1 A;  2JWK A;  4CD3 A;  4BDZ A;  3QIP A;  3CG7 A;  3DXM B;  5BRH A;  2KLA A;  3TR8 A;  4CGI A;  2YI1 A;  2YV0 X;  4C8M A;  2OCE A;  3VF2 A;  3CF5 L;  4OLB A;  3LPT A;  4AHU A;  3CC7 N;  2E4L A;  4GNI A;  5C25 A;  3DLR A;  3FZF A;  2HHV A;  3I0R A;  4KH6 A;  4DSK A;  1JCF A;  3CER A;  1LWC A;  5AQO A;  4JAX A;  3ZSZ A;  1VQ6 N;  4IJA A;  1NGB A;  3WEE A;  4E0D A;  3SBG A;  4BRO A;  2Q0U A;  3F73 A;  5JLF A;  2CH6 A;  3V1O A;  5JVG L;  4FZX C;  3PIP L;  3AVN A;  1O1W A;  1GLC G;  4LC9 B;  2EX3 A;  1UWB A;  4DFK A;  4B9T A;  3R6M A;  1BI4 B;  2F8T A;  5AQQ A;  4E7L A;  3SV3 A;  1ASV A;  2VWK A;  4OPH A;  1EQY A;  1X9S A;  3OYA A;  3R8E A;  3RR8 A;  1QHA A;  1BA0 A;  2NUB A;  4G9Z A;  2QW9 A;  4JI2 K;  2NRX A;  4OJR A;  4BGA A;  2YJF A;  4CF9 A;  1KRP A;  2VWB A;  3OYJ A;  1BGX T;  4YOV A;  1NK7 A;  3NVK A;  5AJ3 K;  3MK6 A;  3RR7 A;  2P1J A;  3LAM A;  3CJB A;  2FLO A;  4K43 A;  3ZSW A;  4OLA A;  5C0Y A;  5J1E A;  4IBN A;  3TI0 A;  4YOR A;  3JAM O;  4YOX A;  2ITM A;  1TYQ B;  3FZL A;  5KTQ A;  4JKH A;  3GDQ A;  3LDP A;  2O8E A;  4DTX A;  3QBX A;  2AJQ A;  1TUU A;  3S9H A;  3WNH A;  1VQP N;  1Q81 O;  4Z4I A;  1RTI A;  3I8B A;  4IZ9 A;  4U67 L;  3AVG A;  1C1C A;  2A42 A;  5AQV A;  3F9M A;  5M1Q A;  3M3Z A;  4CJ3 A;  3CQ8 A;  1J5O A;  4JKD A;  3CJC A;  4JKF A;  4DHY A;  3L2U A;  1RDB A;  1KVC A;  2P9P B;  4DQI A;  2FBV A;  5HRR A;  1QSS A;  4MLE A;  3DOK A;  3QFP A;  5LY3 A;  1NJX A;  5FPN A;  1NGA A;  4IEI A;  2UXC K;  4XH1 A;  2O8D A;  3SUN A;  5E84 A;  1YVN A;  4DTR A;  3N4P A;  3ZET A;  3BEX A;  1ATS A;  4ISF A;  3MN9 A;  4DQP A;  1Q9X A;  5AQZ A;  4F8R A;  4FVU A;  5HOO A;  1D4X A;  1KCF A;  2JGU A;  3A5L C;  2RPI A;  1MDU B;  5E26 A;  4E19 A;  1WLJ A;  4KV8 A;  5C12 A;  4FWP A;  4IKF A;  4LFB K;  2A1S A;  1NJY A;  2O4I A;  2G8K A;  2UUB K;  4ELU A;  4W5O A;  4KRE A;  1NGG A;  3OYE A;  1DKG D;  4KHP K;  4FJJ A;  4DR4 K;  3D2F B;  3EZW A;  4X65 K;  4B1Y B;  1KVA A;  3KVG A;  1RDC A;  4HUG A;  3DLK A;  4BY9 C;  2PBD A;  1L3U A;  4CHZ A;  4B3R K;  3KK1 A;  4CJT A;  3O8M A;  3JXU A;  4M3W A;  3TSU A;  5HP1 A;  5FDL A;  3CJ7 A;  1MWM A;  3CXC M;  4HTL A;  4FZZ A;  3VN5 A;  4ZTF A;  1GLA G;  2ETJ A;  3T1H K;  4ILG B;  2E88 A;  1RTD A;  4M3Z A;  5GIN A;  1BIU A;  3DM2 A;  4DV5 K;  3L4I A;  3ZCM A;  2QM1 A;  1KC8 O;  3TU5 A;  4B9V A;  4WQ5 C;  4YFU A;  3DAW A;  3VQ9 A;  3H1Q A;  4YHH K;  1JL2 A;  4EFH A;  4WFN L;  3TAE A;  2O8E B;  3BY5 A;  5M1O A;  2W40 A;  1HJO A;  4N5S A;  2QWP A;  3KWG A;  3W0L A;  4QS7 A;  2WOM A;  2Z1H A;  4I9Q A;  3RSE B;  3ULE A;  3WNF A;  3AGK A;  5AZJ B;  2G8V A;  3SK3 A;  3O9Q A;  4FW2 A;  1SKR A;  3CPW M;  3TTC A;  3AO1 A;  4O8K A;  4FJ5 A;  4B1V A;  1SV5 A;  4N41 A;  3B8A X;  4FLV A;  3NCI A;  2Z1I A;  4AHS A;  1VQM N;  3ZEU A;  1UA1 A;  4CIG A;  3EEQ A;  3THX A;  4CBX A;  1Q9Y A;  1Q7Y O;  4BE2 A;  2P9I A;  4RW4 A;  4PKG A;  4J8F A;  4BVO A;  2XRI A;  1NJW A;  2KZM A;  2ZGY A;  1S1W A;  1XQS C;  4CI6 A;  3DRS A;  3ZSY A;  3E01 A;  3VOV A;  4K8X A;  2FBX A;  1VQ5 N;  2HHH K;  5FRM A;  3CM6 A;  1J6Z A;  4ICL A;  3EYZ A;  1ASW A;  3VQD A;  3RMD A;  1VSK A;  2XY6 A;  4H0V B;  5I3U A;  2YKN A;  1RFQ A;  4BRE A;  1L3T A;  4PL8 A;  1IBK K;  2ZJP L;  3THY A;  3AO5 A;  3S3M A;  2DFH A;  4DSE A;  3E9L A;  1RDW X;  4M41 A;  1S72 N;  4F4K A;  3L0Q A;  3TSP A;  2IDO A;  2HMI A;  1YUW A;  3BDP A;  3OA9 A;  4CZF A;  1UOC A;  3V9U A;  3CYM A;  3O9U A;  4WQ5 A;  1W0H A;  1GLB G;  5BR8 K;  4WCE L;  2OZM A;  1HKG A;  1TVR A;  1WSG A;  4BC3 A;  4PL7 A;  1VSD A;  1KLM A;  1B9D A;  5DM6 L;  5DK5 A;  2A1R A;  5M1F A;  3O9S A;  3BZC A;  1EET A;  2P5O A;  4DR7 K;  4CJS A;  1NOZ A;  2IGI A;  1RT2 A;  3ULE B;  4WF9 L;  3VQQ A;  3PX4 A;  3DWL A;  3CCQ N;  2ZQB A;  3OYH A;  1RNH A;  4PY5 A;  2XHB A;  4PA1 A;  2P9S A;  4EZ6 A;  1DT9 A;  4A2A A;  3NF8 A;  4M45 A;  1YXQ A;  1NMD A;  3WNE A;  3GOI A;  3CCU N;  4B1X B;  1EKE A;  4CK2 A;  3JYT A;  2DFF A;  3HTV A;  1BIZ A;  3K59 A;  1RT4 A;  3BF3 A;  3THX B;  3AO3 A;  1N32 K;  2YX6 A;  4KHQ A;  5EU7 A;  3K9K A;  4CGD A;  4A62 A;  1NGD A;  3IS9 A;  4CHQ A;  4FK2 A;  3KKR A;  5H1S Q;  3A5O C;  4KHS A;  3KJV A;  2V52 B;  1QQM A;  4OKE A;  3SMS A;  1KSP A;  4C23 A;  4BQZ A;  3FR0 A;  4FJH A;  5M1N A;  2WBN A;  1VSH A;  3HOT A;  2WTU A;  3AAP A;  2Q2R A;  3IG1 A;  3EN9 A;  4B9Q A;  3AAQ A;  3L8B A;  1YIT N;  5ADX H;  4PKI A;  3ENB A;  5EX5 A;  3HBT A;  2P9L A;  4DLE A;  3THY B;  5BRE A;  3ZT1 A;  5LMU K;  4IDK A;  1ITG A;  3ULD A;  3OJU A;  2YNF A;  3LDS A;  2P5G A;  3HVT A;  3CCM N;  4CFD A;  2HHQ A;  4JHD B;  3ENO A;  3M6G A;  4YOY A;  1W2B M;  4ZHR A;  1BA1 A;  3C7N B;  4GV6 A;  3V9X A;  3CI5 A;  2E5L K;  1IKX A;  1T6D A;  4DQ8 A;  2ZJQ L;  2EWS A;  3AVH A;  4H8K A;  3V9Z A;  5J2Q A;  4BRP A;  3GL1 A;  1HNW K;  4WQ4 C;  4CJV A;  1TAU A;  4O8U A;  2VGN A;  1BIS A;  3SPZ A;  3KLI A;  3EE9 A;  2W6K A;  5FPE A;  4KKO A;  1VK0 A;  3NBP A;  1NK5 A;  2DPN A;  4JKG A;  4HCB A;  2XO7 A;  3DXK B;  1HPM A;  4CEE A;  5C15 A;  4X62 K;  3P4I A;  5I42 A;  3ENH A;  4IJN A;  3P38 A;  4MFB A;  5KPT A;  5FPM A;  2VGM A;  1C0T A;  3HPO A;  3UKU A;  1NKC A;  4GKJ K;  3NHG A;  1WUA A;  3ID8 A;  2VQE K;  3IAY A;  3EO3 A;  3GBT A;  3OS2 A;  5HRS A;  4DFJ A;  2FF3 B;  1GLJ O;  1G99 A;  1WBD A;  4EHU A;  2HST A;  2P9K A;  1KVB A;  5SZT A;  4DTJ A;  3PX0 A;  2P9N A;  4CED A;  4CJQ A;  2E2P A;  4IDH A;  1U2V B;  4GMJ B;  1WNS A;  3WXK A;  1DEJ A;  1JLE A;  3AVC A;  2PZS A;  4FL9 A;  4FWL A;  4FJN A;  3RTV A;  1RT1 A;  4W5Q A;  3HXM A;  1QTM A;  2Q31 A;  3AA2 A;  3KK2 A;  4CHO A;  2YJE A;  4E7K A;  4C8K A;  2P9U B;  2F9W A;  2VYP A;  1B92 A;  1SKW A;  4NYN A;  2UUA K;  1NGI A;  1BL3 A;  4Z94 A;  3RRH A;  3OHR A;  3VA0 A;  1LV5 A;  4Y1D A;  1TK0 A;  3DXM A;  2Q0R A;  4H0T B;  1KXP A;  3W3D A;  4DB3 A;  1DTQ A;  1HJR A;  1OVY A;  4CEA A;  1ATR A;  4WQ4 A;  1XNQ K;  3HL8 A;  3OYB A;  4FXD A;  3KLG A;  3AVJ A;  4CHY A;  2HBJ A;  1XC9 A;  5AQG A;  4CES A;  3CMA N;  3DOL A;  5EXW A;  1XNR K;  4CZH A;  3EKU A;  3LL3 A;  4C1N I;  4E3S A;  1J53 A;  4H0X B;  1VQO N;  3FGU A;  2GUI A;  3K5N A;  2D0A A;  3G6E N;  1BHL A;  3O9T A;  3RWU A;  1NOY A;  1YT3 A;  2Z1G A;  3MMV A;  5CYQ A;  1FK9 A;  4RWT A;  4FYD A;  4FCY A;  4V19 S;  4KTW A;  1A5X A;  2ZM6 K;  4PKH A;  3J8A A;  3VES A;  3F9K A;  3IMX A;  4NCA A;  1C1A A;  3MXJ A;  3TAM A;  4IG0 A;  3LM9 A;  1Z26 A;  2B5J A;  5SWM A;  2G8W A;  3ATU A;  3L3U A;  3NVM A;  2QWR A;  4O44 A;  3V9W A;  4HCC A;  3R3L A;  4B9S A;  3MX2 A;  4HUF A;  3CCV N;  3HM8 A;  1M1K O;  5BR9 A;  2QWQ A;  3LAK A;  1U4B A;  4PQU A;  4BR2 A;  5KRT A;  1TKZ A;  4E1M A;  2HBK A;  1YJ9 N;  5C42 A;  2QA4 N;  3PSI A;  2OPP A;  4CHP A;  3V81 A;  4WYB A;  4J2D A;  1FJG K;  5IT9 O;  1CZA N;  4NLC A;  2G8I A;  3LDL A;  4FWR A;  1OKJ A;  4HTU A;  1KAX A;  3E9P A;  4FK0 A;  3VQB A;  3U3G A;  4CF1 A;  3CC4 N;  3LDQ A;  1JLA A;  3QEI A;  1BOT O;  4DU3 A;  4BC4 A;  4EZ9 A;  5BN8 A;  3CHW A;  5AQF A;  1S1X A;  4JI4 K;  4BRF A;  4DF4 A;  1BCM A;  1XWL A;  4LH5 A;  2PFU A;  1OH5 A;  4FK4 A;  1HYZ A;  1WSF A;  2P9P A;  3MCA B;  1QSL A;  4J2E A;  1GOB A;  2G8H A;  2X6S A;  1QS4 A;  4DV6 K;  3J7Y P;  4BR0 A;  4BDP A;  4LF6 K;  5M1K A;  2F8S A;  1DTT A;  2IOC A;  4FWK A;  2UUC K;  3KHY A;  4XH5 A;  4HWI A;  5AQK A;  4AHT A;  3NH0 A;  4DFM A;  2HMP A;  2E6L A;  3A8Y A;  3L4Q A;  5HL7 L;  3TAG A;  3CPE A;  3P83 D;  1Q86 O;  1VSJ A;  1QSY A;  5KGX A;  4LFA K;  4DR6 K;  4I2Q A;  3V1Q A;  2NRR A;  4E1N A;  3K5M A;  3O5B A;  4ID1 A;  1D9F A;  4KB0 A;  3KD5 E;  3D2F A;  3ZYY X;  1X9J A;  1IKY A;  4AHV A;  1SKS A;  4CCH A;  5HBM A;  4FOI A;  1YAG A;  1WSJ A;  3SUP A;  3HJF A;  1Z05 A;  5AQJ A;  1SUQ A;  1IG8 A;  1E4F T;  1WSH A;  4DMN A;  4C8N A;  3SJJ A;  3CET A;  1S3X A;  3CC2 N;  2KQ2 A;  4M63 C;  5AZI B;  3P5J A;  1X3N A;  3AVB A;  5BRD A;  3TAP A;  5AQT A;  3FZK A;  2ASP A;  1J5E K;  1SS6 A;  2HNY A;  1U48 A;  1JJ2 M;  3WXM B;  4E7I A;  1T05 A;  5CE3 A;  4OKK A;  3UKR B;  3VF4 A;  4CJW A;  4M7X A;  3K57 A;  4DQQ A;  1OH8 A;  4NXN K;  3L2Q A;  1HQU A;  2OYQ A;  1ZBF A;  3CIP A;  3K2P A;  2DTU A;  2HB5 A;  1WB9 A;  3C0B A;  4DSL A;  5AQH A;  2ZGZ A;  3MN7 A;  3RSE A;  5AZJ A;  4FM1 A;  2HNZ A;  5FRN A;  1JLC A;  2YCH A;  2FF6 A;  5KQD A;  3EZ5 A;  3AA5 X;  3IFR A;  3SQ1 A;  2B6A A;  2HHS A;  3DRP A;  4F2S A;  4BVP A;  3AVM A;  1K8K B;  1LWF A;  3LDO A;  3QO9 A;  4BR4 A;  4CZK A;  4LD0 A;  3MEE A;  4KI4 A;  3MN5 A;  4RW7 A;  1S22 A;  4GY2 B;  2VWJ A;  1U45 A;  1T44 A;  4FJK A;  4IFY A;  2NZT A;  2X74 A;  2B4J A;  1VQ7 N;  1GLD G;  2IVN A;  3P39 A;  4FJ9 A;  3OS0 A;  1T03 A;  4Q0B A;  1JXB A;  5BN9 A;  3ZT0 A;  4BRD A;  4BRA A;  1P8Z A;  5J2P A;  4H03 B;  1JLG A;  3QBW A;  2HHU A;  3ISN C;  3E66 A;  2D0P A;  2KTQ A;  1X1P A;  4DR2 K;  2RE2 A;  2BE2 A;  1D8Y A;  2F4V K;  4KB1 A;  2GWK A;  2O8C B;  4EAH D;  4E7J A;  1QQC A;  5JS2 A;  1RIL A;  3QER A;  1ZBU A;  3PX6 A;  3AVF A;  3S41 A;  2E6M A;  3C6U A;  4DR5 K;  4I9L A;  4BR7 A;  1P90 A;  5TKW A;  3QEV A;  4DTM A;  3MEG A;  1RDD A;  3C65 A;  2QK9 A;  3HSC A;  4YOT A;  3SPY A;  3SNN A;  2BAN A;  3QIO A;  1S1V A;  3VPZ A;  1ZBH A;  1VSI A;  4ISG A;  2W42 A;  4DWI A;  4OKJ A;  4KFB A;  3T3F A;  4CZJ A;  4O0J A; 
#chains in the Genus database with same CATH homology
 4B1Z A;  3LDN A;  4F9O A;  5ADX A;  3SAF A;  5GIO A;  3HTV A;  4L3Q A;  3WT0 A;  3BF3 A;  2FXU A;  3VGM A;  2I7P A;  4CZI A;  1LCU A;  2GEL A;  4FWQ A;  4IO9 L;  2YX6 A;  3CME N;  3K9K A;  1ESV A;  2QWM A;  5AQW A;  4K25 A;  4A62 A;  1NGD A;  5AQM A;  3VEY A;  2E2O A;  2ASM A;  2HF3 A;  3A5O C;  3ZX2 A;  5H1S Q;  2V52 B;  3FZH A;  3O9R A;  4CZG A;  1QQM A;  4KH4 A;  2ZF5 O;  3UE5 A;  2ZWH A;  4IXC A;  4IEE A;  3SMS A;  4C23 A;  4FO0 A;  3FR0 A;  4BQZ A;  5M1N A;  2WBN A;  5KPZ A;  4MDB A;  2NRT A;  3HOT A;  1GLE G;  4UY8 O;  1NBW A;  3AAP A;  3SBT A;  3WXL A;  1QZ5 A;  2Q2R A;  2YHY A;  2A3Z A;  1RDU A;  5JIC A;  3GE1 A;  1GLL O;  2NRH A;  4BRC A;  3A5N C;  3SAG A;  3R1X A;  1E4G T;  3H1V X;  2YHX A;  3MWT A;  3EN9 A;  1YI2 N;  3MDQ A;  3FE1 A;  4B9Q A;  3AAQ A;  1M90 O;  3WUH A;  1YIT N;  5ADX H;  4PKI A;  2V51 B;  1MWK A;  1VQ9 N;  3ENB A;  5EX5 A;  3HBT A;  2P9L A;  3K9J A;  5KPR A;  3FLC O;  1KQS M;  3OBW A;  3GG4 A;  3VEW A;  5BRE A;  5CR4 A;  1ZBS A;  3F5T A;  3E9O A;  1HUX A;  5C2D A;  1NGH A;  1O13 A;  1VAZ A;  4YOW A;  4MO5 A;  3PLA A;  1SAZ A;  2E20 A;  1YF5 L;  2Q1N A;  3KK7 A;  4FWO A;  3CCM N;  3FFK B;  4JKG B;  5AQL A;  4I6M B;  4JKB A;  3EKS A;  1QZ6 A;  3A5M C;  4JHD B;  1GLF O;  1WOQ A;  3G71 N;  4BQL A;  3ENO A;  1ZXO A;  3M6G A;  1VQ4 N;  2F7T A;  4YOY A;  1QVF M;  3PIO L;  1W2B M;  3O08 A;  1EO1 A;  5C2F A;  2HBM A;  1BA1 A;  3C7N B;  4FOE A;  1VQL N;  1YHQ N;  4GV6 A;  3VMF B;  2E1Y A;  3AGR A;  3CI5 A;  1T6D A;  4BRM A;  4DQ8 A;  3P31 A;  2ZJQ L;  3UKU B;  2EWS A;  4BRP A;  3GL1 A;  4B1W B;  2RHK A;  3BP8 A;  4WQ4 C;  3QB0 A;  1ILY A;  4OPA A;  3WXJ A;  1QQN A;  1HKC A;  3TSQ A;  2WFB A;  2AP1 A;  4H5R A;  4A59 A;  4O8U A;  2IIR A;  2CGJ A;  2VGN A;  5JMV A;  3IDH A;  5AR0 A;  2KHO A;  2P9K B;  3VTI A;  3I55 N;  3VEZ A;  3CCL N;  3EE9 A;  2P9N B;  3CQY A;  1HLU A;  3M5R A;  4IO8 A;  5FPE A;  4BRK A;  4GVE A;  1JCG A;  2W41 A;  4A5A A;  2DPN A;  2HOE A;  4JKG A;  4H0O A;  3CJ1 A;  4I6M A;  3Q7C A;  4RTF D;  3DXK B;  3SAH A;  4JHD A;  5EVZ A;  5C10 A;  3CCR N;  1HPM A;  1YJW N;  3MWP A;  5C15 A;  2HF4 A;  3P4I A;  4KBO A;  3ENH A;  2A40 A;  3C7N A;  4IJN A;  3D6R A;  3P38 A;  5KPT A;  3CJ9 A;  3O80 A;  5FPM A;  3U8X A;  2IVP A;  1BWF O;  3L6Q A;  3TTD A;  2VGM A;  2E2Q A;  4E1J A;  3D7E O;  2GX9 A;  3UKU A;  3HI0 A;  5F0X A;  5BRF A;  3CCS N;  1WUA A;  3ID8 A;  1QQO A;  3Q7B A;  3VGK A;  3WEE B;  3G4S N;  1Y64 A;  2OTL N;  3EO3 A;  1TYQ A;  5GAE P;  1SQK A;  3GBT A;  2CGK A;  1VQN N;  1NM1 A;  2JWK A;  2CGL A;  2FF3 B;  4CD3 A;  4BR9 A;  1GLJ O;  1G99 A;  4JK8 A;  3DXM B;  4PHT X;  5BRH A;  4KH5 A;  4CD1 A;  1K8A O;  2KLA A;  3IUC A;  4EHU A;  5AQY A;  2HST A;  2UYT A;  2P9K A;  2YI1 A;  3VER A;  3H45 C;  4H5T A;  5EOY A;  3VF2 A;  2P9N A;  5AQI A;  5GAH P;  2E2P A;  4EIA A;  4FWM A;  4JD2 A;  4IDH A;  3HZ6 A;  1U2V B;  3WXK A;  1DEJ A;  3CF5 L;  3DXK A;  2PAV A;  4H5W A;  3CC7 N;  4FL9 A;  4GNI A;  3FZF A;  4KH6 A;  4FWL A;  4IOX A;  2Q36 A;  1BG3 A;  1JCF A;  3CER A;  4K41 A;  5AQO A;  4JAX A;  3T69 A;  2Q31 A;  3SJH A;  4BGB A;  4EHT A;  2BTF A;  1VQ6 N;  1U6Z A;  2YJE A;  1NGB A;  4IJA A;  2QXL A;  2P9U B;  2F9W A;  3WEE A;  4IWV A;  2VYP A;  4BC2 A;  3J7Z O;  1Q18 A;  3SBG A;  1NGI A;  2Q0U A;  4BRO A;  4Z94 A;  5JLF A;  5DM7 L;  3OHR A;  3DXM A;  2CH6 A;  5JVG L;  3PIP L;  4IFE A;  2Q0R A;  3R9P A;  1GLC G;  4LC9 B;  3SLC A;  1BO5 O;  2E2N A;  4AM6 A;  5GAD P;  4H0T B;  1KXP A;  3R6M A;  3W3D A;  4DB3 A;  4A61 A;  1OVY A;  1ATR A;  5AQQ A;  1BU6 O;  4WQ4 A;  4OPH A;  3AAR A;  1EQY A;  4IOA L;  4NLB A;  1H1V A;  1X3M A;  1U2V A;  3KWI A;  3I33 A;  2HBJ A;  5AQG A;  3R8E A;  4OO1 J;  1QHA A;  3BUZ B;  5TKY A;  3RVC A;  4U7B A;  2QWO A;  1BA0 A;  3AY9 A;  3CMA N;  3CCE N;  5EXW A;  2QW9 A;  4G9Z A;  2NRX A;  4B1U B;  2D1K A;  3VEN A;  4BGA A;  3H3O B;  2YJF A;  3CCJ N;  4BG9 A;  4CZH A;  2P9U A;  3HOS A;  3EKU A;  3LL3 A;  4C1N I;  4DKW A;  3LM2 A;  1NWK A;  2VWB A;  5ELZ A;  4CBW A;  1NGF A;  4H0X B;  4YOV A;  1VQO N;  3FGU A;  3G25 A;  4ILH A;  3G6E N;  3O9T A;  3NVK A;  2IVO A;  2NLX A;  3MK6 A;  3VGL A;  5B8H A;  3CJB A;  2FLO A;  2NRZ A;  2NRV A;  4K43 A;  3IKM A;  3NMU A;  4B1X B;  4JEP A;  3QML A;  3ZET B;  5C0Y A;  2F9T A;  4A5B A;  3MMV A;  5BPN A;  4RWT A;  2BUP A;  3U9Z A;  4RCH A;  4YOR A;  4XH4 A;  4YOX A;  4GV3 A;  4PKH A;  3J8A A;  2ITM A;  1TYQ B;  3FZL A;  2QTD A;  3VES A;  4BRH A;  4CZE A;  4JKH A;  3GDQ A;  3LDP A;  4CJ7 A;  1KAY A;  2HBL A;  2QWL A;  4MLH A;  3CD6 N;  3QBX A;  3IMX A;  1TUU A;  5AQS A;  1KAZ A;  3EL2 A;  3E1Y A;  1IJJ A;  4MDA A;  1VQP N;  1Q81 O;  2QEX N;  3LM9 A;  3QIC A;  2GTD A;  3I8B A;  4IZ9 A;  4U67 L;  3ATU A;  2A42 A;  3NVM A;  3F9M A;  2QWR A;  3M3Z A;  5AQV A;  5M1Q A;  3ZX3 A;  4H0Y B;  4JKD A;  3CJC A;  4JKF A;  4DHY A;  4ILJ A;  3R3L A;  3MX2 A;  3D2E B;  1XUP O;  4QS8 A;  2P9P B;  1KD1 O;  4BRI A;  1K9M O;  3CCV N;  3HM8 A;  4JD2 B;  4MLE A;  1SZ2 A;  2FSJ A;  3QFP A;  5LY3 A;  1M1K O;  5FPN A;  1NGA A;  4IEI A;  5BR9 A;  2E8A A;  2QWQ A;  3VET A;  4XH1 A;  4BR2 A;  5E84 A;  1YVN A;  2HBK A;  1YJ9 N;  3N4P A;  4JK9 A;  2QA4 N;  3ZET A;  3VTH A;  3BEX A;  2NNW A;  4WYB A;  1T3V A;  1ATS A;  4ISF A;  3MN9 A;  2JWL A;  3QDK A;  5BPM A;  1CZA N;  4NLC A;  5AQZ A;  5F1X A;  4FVU A;  5HOO A;  1D4X A;  2V7Y A;  3LDL A;  3A5L C;  1MDU B;  5E26 A;  1JCE A;  4QS9 A;  4FWR A;  5M1P A;  1OKJ A;  3FZM A;  4FWP A;  5C12 A;  1KAX A;  3TTF A;  4NO7 A;  3E9P A;  5EY4 A;  4IOC L;  2AA4 A;  1NLV A;  3CC4 N;  3LDQ A;  1BOT O;  4H5N A;  4JNE A;  1NGG A;  4BC4 A;  1DKG D;  5BN8 A;  3CHW A;  5AQF A;  4WFA L;  3D2F B;  4BRF A;  1HX1 A;  3EZW A;  2Q97 A;  2PFU A;  3D2E A;  4AM7 A;  2P9P A;  4B1Y B;  2KKZ A;  3MCA B;  5MLC Q;  2D0O A;  3KVG A;  4XEI A;  1DGK N;  4BY9 C;  2PBD A;  2VCP A;  4BRN A;  2GEM A;  4BR0 A;  4C1N K;  3O8M A;  3JXU A;  3O4W A;  4NB4 A;  5M1K A;  1ZC6 A;  3TSU A;  1VQK N;  4FWK A;  3KHY A;  2WUS A;  3H46 O;  4XH5 A;  5KQ8 A;  4HWI A;  5AQK A;  3CJ7 A;  4FWN A;  2WC9 A;  1MWM A;  3WQU A;  4BRL A;  4ISE A;  5I9E B;  1V4T A;  3QFU A;  3U9D A;  3CXC M;  2HMP A;  4HTL A;  3A8Y A;  3L4Q A;  1Q82 O;  5HL7 L;  2QI2 A;  5AQN A;  3CPE A;  1GLA G;  3TPQ A;  1Q86 O;  3BF1 A;  1K73 O;  3VF6 A;  4ILG B;  5AFU A;  2E88 A;  2NRR A;  4FSV A;  3O5B A;  5GIN A;  3M1F A;  2ZJR L;  4JKE A;  3ZEU B;  2H3G X;  3D2F A;  1ATN A;  4YDU C;  3L4I A;  2QM1 A;  1KC8 O;  3TU5 A;  3ZYY X;  1X9J A;  3O6W A;  4WQ5 C;  2P9I B;  3DAW A;  3H1Q A;  4FOI A;  1YAG A;  4WFN L;  4EFH A;  1Z6R A;  4H0P A;  2W40 A;  5F2R A;  5M1O A;  1T6C A;  1Z05 A;  4A2B A;  5AQJ A;  4A57 A;  1HJO A;  1IG8 A;  2QWP A;  3KWG A;  3KZB A;  1E4F T;  4QS7 A;  4YOU A;  3W0L A;  5GIP A;  3CET A;  1S3X A;  3C6H A;  3RSE B;  3ULE A;  4CBU A;  3CC2 N;  3AGK A;  4M63 C;  5AQU A;  5AZJ B;  4AF1 A;  4O5F A;  1BUP A;  5AZI B;  3SK3 A;  1R59 O;  1X3N A;  3O9Q A;  5BRD A;  5AQT A;  3CPW M;  3FZK A;  3TTC A;  2ASP A;  4O8K A;  1SS6 A;  1JJ2 M;  2D4W A;  3WXM B;  4B1V A;  5CE3 A;  3UKR B;  3VF4 A;  3T7Z A;  5AFU H;  3O1W A;  4BR5 A;  4K42 A;  4M7X A;  3B8A X;  3ATV A;  5BPL A;  5GAG P;  5AQP A;  2BH1 A;  2QWN A;  1VQM N;  3ZEU A;  3ID6 A;  4CBX A;  1HKB A;  1NGC A;  1Q7Y O;  2GWJ A;  2P9I A;  3C6A A;  3O1B A;  4PKG A;  3CJA A;  4J8F A;  4BVO A;  3CIP A;  1TUY A;  3WXI A;  2ZGY A;  5JLH A;  1XQS C;  4BRQ A;  4CI6 A;  3C0B A;  4MO4 A;  1N8R O;  5AQH A;  3U4L A;  4CZL A;  2ZGZ A;  2ASO A;  3MN7 A;  3RSE A;  3VOV A;  1LOT B;  1VQ5 N;  3MX5 A;  1VQ8 N;  5AZJ A;  2FSK A;  1RGI A;  3JS6 A;  1J6Z A;  3N4Q A;  5AZI A;  2YCH A;  2FF6 A;  2OAN A;  5KQD A;  4GV9 A;  4CZM A;  3VEX A;  3IFR A;  1MA9 B;  3CQX A;  3UKR A;  4H0V B;  3H3N O;  3H6E A;  3UB5 A;  4BVP A;  4BG8 A;  1K8K B;  1RFQ A;  1C0F A;  3ZX0 A;  1C0G A;  2I7N A;  2GUP A;  4BRE A;  3LDO A;  4PL8 A;  3VEV A;  3DJC A;  4BR4 A;  4CZK A;  3WQT A;  2ZJP L;  1QVG M;  2CH5 A;  3MN5 A;  3E9L A;  1RDW X;  1S72 N;  1S22 A;  4GY2 B;  3F2K A;  4FPB A;  4JK7 A;  3L0Q A;  4FWS A;  3TSP A;  3VEO A;  2P9S B;  2NRW A;  1T44 A;  4BRG A;  5LJW A;  2NZT A;  2V7Z A;  1YUW A;  5FPD A;  5JVH L;  3OA9 A;  3MCP A;  4YDU A;  4CZF A;  2FSN A;  4WFB L;  2A5X A;  1VQ7 N;  1GLD G;  2IVN A;  3P39 A;  4JN4 A;  3O9U A;  4JKC A;  3SMP A;  4H5V A;  4WQ5 A;  5LJV A;  1V4S A;  4DCH A;  5BN9 A;  1GLB G;  4BRD A;  4BRA A;  1P8Z A;  4Y0W A;  4WCE L;  1NGJ A;  4H03 B;  3QBW A;  2E1Z A;  1HKG A;  3E66 A;  3EE8 A;  4BC3 A;  4PL7 A;  2YHW A;  2D0P A;  5AQX A;  5DM6 L;  2A6A A;  3OW2 M;  5M1F A;  2RE2 A;  3O9S A;  4JKA A;  3MN6 A;  4BC5 A;  1K8K A;  1XC3 A;  3OBY A;  1NJI O;  2GWK A;  3A0I X;  4EAH D;  3DLL L;  3HRG A;  4R79 A;  2OTJ N;  5CHI A;  3ULE B;  4WF9 L;  1YIJ N;  3S41 A;  4M7Y A;  3DWL A;  3CCQ N;  5AQR A;  4BR7 A;  1P90 A;  5TKW A;  3I56 N;  2J4R A;  2P9S A;  1DT9 A;  4A2A A;  1NGE A;  3C65 A;  3HSC A;  4YOT A;  1YJN N;  3VPZ A;  4FPA A;  2A41 A;  4ISG A;  1BDG A;  1W97 L;  1NMD A;  1YXQ A;  3GOI A;  3CCU N;  2P9L B;  4CZJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...