4JI6K

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
116
structure length
116
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 28
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4ji6K00
1IBMK 2VQEK 3J80O 4DV1K 4B3TK 4JI8K 4DR5K 3J7YP 3T1HK 4CVNE 4NXNK 5A2QO 5IT9O 5AJ3K 2UXBK 2UU9K 4DR6K 4LFBK 3T1YK 4DR4K 4DV3K 4YHHK 5BR8K 4X62K 1XMOK 4JI5K 4DR1K 1IBLK 3OTOK 5IWAK 2F4VK 2E5LK 4JI7K 1XNQK 4B3MK 1J5EK 1XMQK 4YY3K 2UUAK 4JI1K 1N36K 4LF8K 1HNXK 4DUYK 3J7AP 1N32K 2UXCK 2UXDK 4DV4K 4NXMK 4X64K 4DUZK 4DR2K 4GKJK 4JI6K 4JI0K 4DV5K 4LFCK 2ZM6K 4LF6K 5LMNK 4LFAK 1HNWK 4DV2K 4GKKK 4JI3K 4DV0K 4CW7B 1N33K 4V19S 4KHPK 4DR7K 1HNZK 4AQYK 4B3SK 2VQFK 2UUCK 4LF9K 2UUBK 4JI2K 4OX9K 1N34K 4LF4K 4X66K 3J81O 5FLXO 4LF7K 3JAMO 5LMUK 1HR0K 2HHHK 4JV5K 4JI4K 4B3RK 4X65K 1I94K 1FJGK 4DR3K 4LF5K 4DV6K 1XNRK 1IBKK 4K0KK 4DV7K 5LL6Z 4JYAK
chains in the Genus database with same CATH superfamily
4AM6A 1RDDA 1B9FA 3C6TA 5DMRA 1LWFA 1JXEA 4HTLA 5JVHL 2DTUA 3H45C 3RRGA 2QWLA 4YDUA 4E19A 4F2SA 2UXBK 1YIJN 4CJTA 4EP4A 1RFQA 1D5AA 2OANA 3IUCA 4DSEA 1RCHA 4H0XB 5EXWA 1QSYA 4FW1A 5M1OA 4DV3K 3THXA 1S5JA 3RR8A 2OYQA 4E1JA 5FDLA 3DOLA 4CERA 3VQ7A 3H3OB 4KH5A 4CIEA 3KK1A 4M45A 5CYQA 3LM9A 1XHXA 2GTDA 1E4GT 4AHVA 3CIPA 3LWMA 1JJ2M 1XI1A 4PKHA 3OS0A 3D45A 4BWMA 4DB3A 1N36K 3K0SA 1N32K 2UXDK 3OHRA 4X64K 2FC0A 4Z4FA 3H46O 4H0VB 1BL3A 1M90O 3OYEA 1W97L 3CJCA 3ZSVA 3EYZA 1Q7YO 4NCBA 1RDCA 4KTZA 1WBDA 3LWLA 1TUYA 1KVBA 3TABA 4HUGA 2ZE2A 3TR8A 3DXMB 4E7KA 1NGGA 4AHSA 1S22A 3FZMA 4ILGB 4YNQA 2NUBA 3NVMA 4DR7K 2IVNA 3H3NO 1B9DA 4Z4EA 4BDZA 1KLMA 1WSJA 1C0FA 3T1AA 4CJVA 2P9PB 2KTQA 2OPRA 3EKUA 4O44A 2OPQA 4GMJB 3UKUA 3FZKA 4KB1A 5FPEA 2Z1IA 3RSEA 1VSDA 3GL1A 4KHUA 4JKDA 3R8EA 3AVMA 3O9RA 4NLCA 3QEVA 4CEQA 3G4SN 1Z05A 1ZBFA 4FJNA 3PSIA 2IVOA 1NJZA 2YNFA 1S6QA 4FVUA 3VQ4A 1RNHA 2KKZA 2ZGZA 4YFUA 5C24A 4DV1K 3R1XA 4CEZA 4IBNA 1X1PA 5J2MA 3DAWA 5A2QO 3IFRA 4ILHA 1HUXA 3QLHA 5AQMA 1H1VA 5B8HA 2I7NA 4O8UA 3LZIA 3VERA 3NF8A 1BISA 5J2QA 2EWSA 3ZSOA 5K14A 1TL1A 3LPTA 5AQXA 3CYMA 3L2WA 4M3XA 1W7AA 4Y1CA 3TAPA 3B8AX 2O4IA 3AVHA 4O0IA 1S9GA 3THVA 3WUHA 3I56N 2DFHA 3T69A 1T44A 4BRKA 1WN7A 4NYNA 3F9KA 4DTXA 4FK2A 4ICLA 3U6FA 3C6UA 4FWRA 4B1ZA 1Q82O 4CHYA 1NLVA 4DUYK 4FWKA 4FLYA 3UKUB 3OYGA 4B8CA 4QAGA 1ZBHA 2V7YA 3QBWA 1RGIA 2Q2RA 4CGDA 4WYBA 4BRQA 4KO0A 4Y1DA 4FZYA 4O0JA 4C8KA 1NK5A 4CBWA 4A57A 4CF0A 1UA1A 2F8TA 3JXUA 4J2EA 4KB0A 1S72N 1JCEA 2B6AA 4OGEA 2D0AA 1UOCA 5HRPA 4IO9L 4DF4A 4JKFA 1GLBG 2HOEA 2A41A 3K5NA 4ZTJA 2FBXA 3BUZB 2QW9A 1VSEA 2OPPA 5AQOA 3BF3A 1V4SA 4LF4K 3SI6A 1ZXOA 4CJPA 4DS5A 3TANA 4CJFA 2VYPA 4IG0A 3PX4A 4RW8A 4JV5K 3MECA 4RCHA 4HCCA 1LWCA 4BWJA 2D0BA 4F9OA 4CFBA 4N76A 4K0KK 1LAVA 4M7YA 3IDHA 2XO7A 3ZT3A 2ITGA 4H03B 3SQ4A 2W40A 3ENHA 4KH4A 2D5RA 2R7YA 2QKKA 4DF8A 5AQFA 3ZX0A 4CZEA 3I8DA 3J8AA 3S3MA 4LFBK 3T1YK 3AO4A 4ISFA 4DR4K 5CHIA 3M8RA 2O8CB 1QQCA 3A2FA 1S1VA 4YHHK 4IG3A 1LV5A 1ILYA 1BWFO 2Z1HA 4KH6A 2BUPA 4DQPA 3L4IA 3EN9A 2FBVA 2VWBA 4KTWA 1NKBA 4FPAA 2GBZA 4EZ6A 3PSFA 4W5QA 1CZBA 3LP1A 3HP9A 4OVLA 1KFSA 3DXKA 1CZ9A 2E1ZA 4H0OA 1SUQA 3FLCO 3HRGA 3F2KA 3VQQA 2AA4A 5KI6A 4I2QA 3NGIA 4C1NK 4BE0A 1HNXK 3CCLN 2HHTA 1KD1O 1U49A 3VGLA 1JLAA 2Y1JA 4CF8A 1BIZA 2AJQA 4YOYA 2G8HA 4Z4GA 3MEEA 5J2PA 4K8ZA 4Z94A 3CC7N 3SK3A 1T03A 3HTVA 2ZM6K 1QVFM 1C0UA 3HJFA 5F2RA 3WT0A 1B92A 2CH5A 2CGKA 2HHWA 1HNWK 3A5LC 1ZC6A 3MX5A 4FLUA 2A6AA 3OA9A 1NKEA 5HROA 2GEMA 4CJ4A 1UAXA 4RW4A 4KRFA 3FR0A 1N33K 4FLZA 3LM2A 4C8NA 3MMVA 3TWHA 4V19S 2E2OA 3ZT4A 5M1QA 4JKGB 1O1WA 4CZHA 3NF6A 2X6NA 4KHNA 4B08A 1JLBA 3P39A 5J2NA 2NRZA 3WNGA 4UQGA 4BC5A 1VSMA 1U04A 2D0PA 4DU3A 2D4WA 1A5XA 1VAZA 2E6MA 3KLIA 1FJGK 4KHYA 4BRIA 4O55A 1BA0A 1TKDA 4JYAK 4FJHA 4CHZA 1HRHA 3KK3A 1EP4A 1RILA 4WQ5A 1SL0A 1K9MO 2QKBA 4LSNA 1HPZA 4O8KA 2WOMA 2W42A 4FJ7A 1XC9A 3V9XA 1RBRA 2Z1GA 1D4XA 3BDPA 1YXQA 2P5OA 2I7PA 1TK8A 3HPGA 4H5RA 2YKNA 3D0PA 2EHGA 1ZBSA 1ASUA 1CXUA 3LDLA 4NCAA 5KRTA 1J9AA 5CZ2A 4DKWA 5EOYA 2IOCA 3KWGA 1TKXA 3Q7CA 4XIUA 4QS7A 3U4LA 3WEEB 4B1YB 1K6YA 3ZETA 3ZT0A 4QS8A 1IBLK 3G25A 3IAYA 3C7NA 2XY5A 2ASOA 1XNQK 5C15A 1BG3A 5AQPA 1OH5A 5GIPA 3FZLA 3LL3A 3TU5A 4KAZA 1WLJA 2XY8A 3ZSWA 4M41A 5KQDA 3AARA 4O4GA 2ZWHA 5AZIA 3SAFA 2E6LA 3QESA 5FPNA 2ASPA 2KW4A 5ADXH 1VQ4N 3R6MA 3O9TA 4CI6A 4JRPA 5I9EB 2XY7A 2G8KA 2A40A 1ZBIA 1NM1A 1NJYA 4LD0A 4CEOA 5LMNK 3L4QA 3C6HA 4F3OA 3RVCA 3MCAB 1Q81O 1C0MA 2YJEA 2B4JA 3MN5A 3WNHA 4LSLA 2I5JA 5KPRA 3I33A 1DKGD 1Q8IA 4AH9A 3TSQA 1YVNA 4CCHA 3CMEN 2UUCK 3P4IA 4IFEA 4OPJA 2FF6A 4FPBA 2FLOA 1N5YA 3UKRA 3CQYA 3DLEA 4BACA 3QEPA 5JLHA 1W2BM 2BE2A 3P83D 4EZ9A 4KKOA 4YOTA 4DV6K 3TAGA 3V1RA 1ATRA 4DV7K 2HMIA 3G6EN 1DEJA 5DM6L 3OYMA 4PQUA 2RKIA 3SV4A 5SZTA 4CK3A 1HNIA 1HQUA 1WNSA 5AQYA 4JN4A 1C0TA 5FPDA 2V51B 5AQQA 3NH1A 3CJ1A 1KC8O 1NJXA 4A2AA 4R79A 3AGRA 5F1XA 4N5SA 4BVOA 5C2DA 5BR8K 4FJXA 4O5BA 1BQMA 4R5PA 3VQ8A 1KSPA 3L0QA 4FYDA 1IH7A 3P5JA 3C65A 2JWLA 1JL1A 1VHXA 3VF6A 4CFAA 5E84A 2FSKA 4CJQA 4FLTA 4LH5A 4PKGA 3B6PA 3O9UA 5C10A 1QQMA 4PKIA 1Z6RA 4QCLA 4CZMA 4I6MA 1ASWA 4FM2A 1YJWN 3ZEUA 1DGKN 4H0PA 2YHXA 1YTUA 4JS4A 4FK4A 1XUPO 2Q3SA 1BOTO 3ZCMA 1FXXA 4NXMK 1TAQA 2CGJA 3ZX2A 1VQON 3PX6A 5E41A 2GX9A 2Q0RA 3VTHA 1VK0A 1YT3A 3HP6A 3NDKA 2QWRA 1D9DA 2OTJN 4CJSA 1EKEA 4DFKA 1NMNA 4IOAL 2YI1A 4JHDB 3VEVA 4B3OA 2W6LA 3KLFA 3VF2A 4UY8O 4DTUA 1Q9YA 2LSNA 4KHWA 1O13A 2WC9A 4DS4A 1NJWA 1BCOA 3F73A 1S1TA 4KPYA 2Z1JA 1VQNN 4DFJA 2VQFK 4DSIA 3THWB 5F0XA 1RDBA 3NE6A 1K8KA 5EY4A 5HP1A 3JAMO 2V52B 3HT3A 5BREA 3O9QA 3QO9A 3VQCA 3QINA 3SAGA 4JD2A 4X65K 2P9NA 4CF1A 3H1VX 4A5AA 4GV3A 2QEXN 4GV9A 1T6DA 3KD1E 2F96A 3NGZA 3P31A 4B9UA 4CZKA 2O4GA 4BQLA 1T3VA 4HHTA 4IFYA 2GWKA 5AR0A 3CHWA 4WFAL 4DQSA 4J8FA 2D0CA 4CIFA 2D0OA 3OS2A 3ULDA 4HTUA 1J6ZA 1RDWX 3VEXA 3K5MA 3ENOA 3LDQA 4JKEA 3QETA 3ULEA 4PL7A 4N47A 4FWLA 3JYTA 3WQUA 3HM9A 1S3XA 1OH7A 4G1QA 5AQUA 2JGUA 1G99A 3QNNA 3LANA 1NGFA 3AV9A 1VSKA 5AQHA 4M3RA 3GOIA 2WUSA 4BREA 5BRHA 4H0TB 1C1CA 2PYJA 1NWKA 3CFOA 5AQGA 1X9MA 2HHSA 2KFNA 3HZ6A 3LALA 3AA5X 1KCFA 5TKWA 4RG8A 3CQ8A 4JI0K 1NGBA 4CF2A 4DV5K 5D3GA 3HM8A 1YUWA 4FOEA 2YHAA 1QHAA 3VQPA 3MDQA 4AILC 2ZF5O 3O8MA 1NOZA 3ALYA 5BN9A 4BGBA 1U2VB 3ID8A 1HNZK 3GDQA 1K73O 3DLHA 3VF4A 1KQSM 4QS9A 4FWQA 4M3YA 1LAWA 2XY6A 1U2VA 5GIOA 4M3UA 4F8RA 3KKRA 1NOYA 1YJ9N 4JKAA 1HR0K 2RHKA 4FWPA 4Q0BA 1NK6A 3UE5A 2VWKA 1WUAA 5DM7L 3CERA 3K9KA 3ZX3A 4PWDA 3OYCA 3M1FA 4KFBA 2VQEK 1RT2A 2BTFA 3OYIA 4CIGA 1DTTA 1KAXA 1JLCA 2YNHA 3MN7A 2ZJPL 4CGHA 1RBTA 3U8XA 4W5NA 3P1GA 1TK0A 2G8FA 1NGDA 3QMLA 5AQLA 3A5NC 1RDAA 3NGYA 3VQBA 2HVHA 3D7EO 5AZJB 3QEIA 3OYBA 1RT5A 1FKOA 3OVNA 3T3FA 2BDPA 5BN8A 2GUPA 3QIOA 4BRFA 3W0LA 1BO5O 4GW6A 4EAHD 1YI2N 4CZLA 1EX4A 4FJIA 1YJNN 3AVNA 3M8PA 1BDGA 4Y0WA 3O4NA 2DFEA 4MO4A 4KREA 2P9SB 1MA9B 2A1SA 5E26A 5FRMA 1E4FT 4Q5VA 3HYFA 3KLGA 3WQTA 3TSPA 3BP8A 3NF9A 1WAJA 4DTSA 3S9HA 4ELTA 2P9IA 4MLHA 3RMAA 4CD3A 4ILJA 2HVIA 2P9IB 2NRHA 4K43A 3LAKA 5LY3A 3WXJA 2P9LA 3ZT2A 1OVYA 4EIAA 1NGAA 4JLHA 1MWMA 1L3UA 4OPHA 2WTUA 2VCPA 4CJLA 4Z4IA 3CFRA 4F2RA 1R59O 3VQ5A 4FM0A 5FROA 4CJWA 5CYMA 1KLNA 4J2BA 1BA1A 3LP0A 2HHUA 3L2RA 4JI4K 1TYQB 1KTQA 3SUNA 4AM7A 4CEBA 1UA0A 1HQEA 3VPZA 3C0BA 3KJVA 2QWNA 2E2PA 4CHOA 3J7ZO 1GLAG 3CM5A 3VGKA 2VG6A 2HHXA 4I9LA 3J7YP 3V9UA 1X3NA 4AHCA 5AJ3K 3ZT1A 2RPIA 4CGGA 3KLHA 1D8YA 5ADXA 1VQ7N 1QE1A 3ZLJA 4JKBA 3MN6A 3C95A 1DLOA 5BR9A 1TAUA 2OA8A 1TVRA 4JI5K 3QBXA 3K2PA 4DQQA 5C42A 3TI0A 3K58A 3MAQA 4H5TA 4BRNA 5FPMA 1Y64A 3N4PA 3ZETB 3SJJA 2BGGA 4B9NA 1JKHA 4ZHRA 1S9EA 1ZBLA 4JKCA 4RTFD 4BRLA 1BQNA 4BR2A 3O5BA 3DOKA 4L3QA 4FL9A 4LF8K 1DTQA 3FGUA 3THXB 3TAQA 3O3GA 2XRIA 1N6QA 2O8FA 4YOXA 3SV3A 1EXQA 1GLCG 3VTIA 2Q31A 4MLEA 4GY2B 1A5VA 4OPAA 2A42A 3A0IX 4TSXA 2J4RA 1VSIA 4IEIA 4NB4A 1QHTA 4LFAK 3PIOL 3KHYA 4IXCA 1VQ5N 1A5WA 1T05A 4CW7B 4DTNA 3FZFA 1QQOA 3SUPA 3LP3A 4DU4A 4YORA 2HBKA 3MX2A 3TAMA 4AHRA 4KHSA 4K42A 1Z25A 4CJ5A 1EQYA 5BPLA 4A5BA 2ZD1A 5M1FA 4PY5A 4BDYA 3F5TA 4B8AB 4ISEA 3CM6A 4MQ3A 5BPMA 5AQZA 4WQ4C 3E9LA 4M7XA 3E01A 5HBMA 3QEWA 3WEEA 2HBLA 4IDHA 4BR5A 4HCBA 5AQKA 1T7PA 3AO2A 4J2AA 1N8RO 2P1JA 2HB5A 3VESA 4E89A 1NK4A 1BGXT 3EY1A 3AA3A 4DQ8A 3V81A 1GLFO 4DR6K 4HUFA 3N4QA 4CGIA 3EZWA 4HWIA 4Z0UA 2O8EB 5M1PA 3CD6N 1RBVA 3R3LA 4CBUA 4OPKA 1IKYA 1TL3A 1FKPA 4B1UB 3OBYA 4JK9A 3SMSA 5LJVA 3RR7A 4CBXA 1I3AA 4FLXA 2BANA 2BH1A 2IC3A 1U47A 3A5OC 2IDOA 3OW2M 3RRHA 5IWAK 4B1VA 4B9MA 2HNYA 4CEFA 1NGJA 1GLDG 4IWVA 4B1XB 1RDUA 4HVJA 1Q9XA 1REVA 4MO5A 4OKEA 3CCSN 2RF2A 3ISNC 4U7BA 1FW6A 1QZ5A 3C6AA 2G8IA 3EE8A 3E66A 3V1QA 2KLAA 3KK7A 4FLVA 3MEGA 3HBTA 4DR2K 2RN2A 3TARA 1RTIA 5GAHP 1C0GA 3TTCA 3BGRA 4IZ9A 3RMCA 1DT9A 2YJFA 1R0AA 4FSVA 1QVGM 1K8AO 4WF9L 1QTMA 4DSKA 3FZHA 4CEDA 4DV2K 2OPSA 3CC4N 1VQPN 3EEQA 4NYFA 1EO1A 3V9WA 4CFDA 3V9SA 3WNEA 1QS4A 3SLCA 4PHTX 2WONA 3OYDA 2PY5A 1K8KB 1XC3A 2NZTA 2IVPA 4CK1A 3SBGA 1P8ZA 4LF9K 4OX9K 1N34K 5I3UA 2FF3B 2KFZA 5C0YA 3LP2A 1TKTA 1RT4A 2ITMA 3AY9A 1YHQN 1Y97A 4JD2B 3ATVA 3I0SA 4M3TA 1ATSA 4B3RK 3THYB 3HVRA 1KVCA 1I94K 1GOCA 4G9ZA 4DR3K 3CJ7A 1WOQA 1YVUA 3VQDA 1J54A 3QICA 4FJMA 1NGIA 2NRWA 4AHTA 5M1KA 3J80O 2OCEA 3ZSXA 4KHQA 3JS6A 3CF5L 4E7IA 1KFDA 4IJAA 5JS2A 3LDNA 5CE3A 3AVFA 2UU9K 3OBWA 1ESVA 3AGKA 1T6CA 1NMDA 2E4LA 2HSTA 3KIOA 3UIQA 2HBMA 1JL2A 3ULEB 2X74A 4EP5A 3TAEA 4K25A 3SYZA 4DSFA 3DRRA 4C8MA 1XMOK 4FWNA 1BCMA 3IG1A 3ZSQA 4FJLA 3G10A 3SAHA 4JKHA 1QZ6A 2NRXA 3O4QA 3CCRN 3Q7BA 4BC2A 4Z4HA 3OYFA 4JNEA 2VWJA 2HF4A 4BQZA 3AVGA 5ELZA 1SAZA 1BU6O 5HRNA 4QOZB 1ASVA 4IKFA 1KRPA 2JWKA 2P9PA 3SQ2A 2UXCK 3OJSA 4AHUA 3OYAA 4I2PA 4JS5A 2HNZA 3SPZA 1NGHA 2Q97A 3U3YA 5FRNA 4WQ4A 3O9SA 1VRTA 1HKGA 5AQWA 2YNIA 3CJ9A 4CHQA 5AQNA 3VEZA 4AF1A 4JI3K 3TAFA 4ELVA 3NVKA 3AVKA 2HF3A 2FSNA 1NKCA 4KHPK 1OH6A 4E7LA 3CCQN 3O4WA 3TTFA 3AVLA 2O8BA 3CG7A 2HHQA 5AQSA 4A59A 2Q1NA 3HXMA 4C8LA 5EVZA 1OVQA 1LW0A 1TKZA 1JXBA 3NHGA 3O80A 1GLEG 2GWJA 1VSFA 2H3GX 3D6RA 3IS9A 5HRSA 1BI4B 1VRUA 4CGFA 4E0DA 2ATQA 1NK9A 1SKWA 4BC3A 4B3TK 5HL7L 3K5OA 1RTHA 4XH4A 1U45A 1SQKA 4BROA 1BI4A 2PFUA 3AA2A 4DG1A 5BPNA 2X6SA 3PUFA 1YTAA 4PL8A 4FWOA 2O8DB 2GUIA 3D2EB 5M1NA 3CCJN 3ATUA 2NRVA 5I42A 3M6GA 3RWUA 1TV6A 3QDKA 1NK7A 3RTVA 1X9WA 2E2QA 2QWPA 5CZ1A 2P51A 3VQ9A 4A61A 3CETA 3CQXA 2P9SA 3ZYYX 4N41A 1NJIO 1BHLA 3BY5A 3AO1A 5AQVA 4JI7K 3BZCA 1VQ9N 4FWMA 2QXLA 4CECA 3TSUA 4YY3K 3D2FB 3QNOA 3K9JA 2YHBA 1HX1A 4M3WA 4BG9A 3NH0A 1NBWA 3AVCA 2O8BB 3TTDA 3MXIA 2FSJA 3HOTA 3TPQA 2WFBA 2ASMA 4GKJK 4FWSA 3SQ0A 1Q86O 4OKKA 5KPTA 2QWMA 3CFPA 3NH2A 4CF9A 5AQRA 2IAJA 2YKMA 2KZMA 3SMPA 1IG8A 4WQ5C 3SBTA 4K41A 3VMFB 3L2QA 3A5MC 3K5LA 5AQIA 3EL2A 2F8SA 5GINA 1LCUA 3LDOA 1YF5L 4B9TA 2W41A 3SZ2A 2O8FB 4GVMA 2ZJQL 3K57A 1SKRA 5FLXO 3HL8A 4DTJA 4LF7K 3G0ZA 1I39A 5AQTA 3ZSRA 4HUEA 5EU7A 3ASMA 3QERA 5C2FA 3WXKA 1XNRK 3FE1A 3AO5A 1IBKK 2HW3A 4OGCA 4DMNA 3E9PA 3HVTA 1VSJA 1EWRA 3LDSA 4DSLA 1HNVA 1GLJO 4RW6A 4CVNE 3BF1A 3CPWM 1X9SA 4NXNK 4B9VA 5GAGP 4IDKA 4CZFA 1P90A 3VGMA 3HPOA 1LW2A 1KVAA 3W3DA 2FBYA 1NGCA 4KBOA 1U48A 5MLCQ 4FOIA 3F9MA 4JAXA 4BC4A 1RTJA 2E8AA 1BIUA 2KQ2A 3AAQA 3DM2A 3B6OA 4OKJA 3H6EA 3K59A 3OJUA 4M3ZA 3QEXA 2CGLA 2Q0UA 3OTOK 2F9WA 1SL1A 2F4VK 2GELA 1IKVA 1KAYA 3UB5A 4B3MK 1NNEA 1KAZA 1NG9A 3KLEA 2QXFA 2VG7A 1VQ6N 2ZGYA 4H0YB 4JI1K 1SV5A 3CI5A 3DLGA 3EO3A 2W6KA 3QIPA 4JKGA 3PY8A 4FW2A 4H5NA 3DLKA 4BE1A 4OJRA 4DQIA 3MCPA 2NLXA 3LAMA 1BUPA 3DRPA 2P9KB 2HMPA 4O5FA 3LZJA 1JCGA 3M8SA 3WNFA 1VQMN 2P9UB 1CZAN 3MEDA 4MFBA 3PX0A 5J1EA 4FZXC 3IMXA 4FZZA 4DFMA 3CJBA 3RMDA 4A62A 1IG9A 4CZGA 3LDPA 4JI2K 3UKRB 3SPYA 2ETJA 3VA3A 5KTQA 1S1WA 3O1BA 3J81O 4XH5A 3T7ZA 3U3GA 4FJ8A 5JICA 4BGAA 2IIRA 3AVIA 3AA4A 5LMUK 1U4BA 4ISGA 1VQ8N 1LOTB 3DWLA 3WXLA 1WSEA 3O1WA 5LL6Z 4LY7A 3S41A 4H4OA 3HK2A 3DJCA 1YAGA 3KZBA 3ZSZA 4BR9A 5IT9O 5LJWA 1M1KO 4WFNL 1HKCA 4BRHA 3M5RA 4CD1A 3KD5E 4FJ9A 4NLBA 5KGXA 4NO7A 4BVPA 1XWLA 4X62K 1CLQA 2F7TA 1CXQA 3VETA 5KPZA 4BRCA 4LC9B 3GE1A 1WBBA 3DI6A 3NMUA 4DU1A 4BRPA 2P9UA 3AVAA 3EKSA 4W5OA 1TK5A 1RTDA 1ZYQA 4YOWA 4W5TA 2QWQA 4C23A 3CJAA 2G8UA 3PLAA 4PUOA 3S3NA 3QFPA 5SWMA 4YOUA 3ZEUB 4XH1A 2PZSA 1WAFA 2NRTA 4DV4K 1Z26A 4CJ3A 4B9LA 4CJRA 3I55N 1QSLA 4WFBL 2NNWA 1IO2A 2VGNA 1SL2A 2UYTA 3EE9A 3QB0A 4BG8A 3H08A 4PA1A 4H5VA 1NK0A 1S6PA 2QI2A 3VEWA 2A1RA 1IJJA 1G15A 1U6ZA 4JRQA 3O3FA 4DLGA 2PBDA 4JHDA 3HOSA 3THWA 2E2NA 3CXCM 3T19A 2DFFA 3DXMA 4DCHA 4BRGA 2O8EA 5GAEP 4JEPA 3WXIA 1HYVA 1S1XA 4K8XA 4DTOA 1W0HA 1C1AA 4CJEA 4FXDA 3FFKB 2KHOA 4ID1A 4I7FA 4E7JA 4LH4A 4EHUA 1IBMK 3THYA 4FO0A 4MDBA 3HSTB 3V1OA 4B9QA 3AO3A 4DR5K 1WSHA 4I6MB 3IRXA 1L3SA 2A3ZA 1GOAA 3DMJA 1GOBA 5C25A 4I9QA 3PIPL 3V4IA 2QK9A 3U9ZA 2ZJRL 3CCUN 3O08A 4YOVA 2G8WA 4IOXA 3AVJA 4C1NI 5BRFA 4FCYA 2EX3A 4FJGA 3VENA 3SQ1A 4BR7A 3MWTA 3L6QA 1QQNA 3L3UA 3L3VA 5C12A 1SS6A 4J2DA 3QFUA 3OYNA 1JLEA 1IKWA 3L2VA 1HMVA 4BR0A 1VQKN 2VGMA 4E3SA 3S3OA 3M3ZA 3EZ5A 4BR4A 3ID6A 4FJJA 1X3MA 4CFCA 3HPHA 1EETA 4N56A 1S1UA 1W9HA 3RMBA 2HHVA 3D2EA 3OY9A 2QWOA 1E3MA 4BDPA 2Y1IA 3AAPA 1KXPA 3H1QA 1RT1A 3RSEB 3E9OA 3NCIA 3VQ6A 1V4TA 1HYZA 3MWPA 4B1WB 1HJRA 2P9NB 1HPMA 3R9PA 4OLAA 4LF6K 4BE2A 3L8BA 4H4MA 4KI4A 1JLGA 4FLWA 1J5OA 5AQJA 4JK8A 4GKKK 4H8KA 1TGOA 1WSFA 1VSHA 4DV0K 4DSJA 4DWIA 4MDAA 4ID5A 5AFUH 2YHWA 3D2FA 1VSLA 4AQYK 4CEEA 4B3SK 1YITN 4M63C 1JLFA 2DPNA 4X66K 4F3TA 3CPEA 2IS3A 3CCEN 1WSIA 2E20A 4XEIA 3AVBA 4CJUA 1MU2A 4FJ5A 5KRSA 2HBJA 3KKSA 4GVEA 1D9FA 3OS1A 2P9LB 1JLQA 2YX6A 4GV6A 3SUQA 3GG4A 5JS1A 5HRRA 4B9SA 3O3HA 4E1MA 4NCGA 4U67L 2X78A 3SUOA 3OYLA 2O8DA 2OZMA 2O8CA 5BRDA 4WE1A 1VQLN 4KTQA 4DTPA 1GLLO 4CEAA 2YNGA 2YCHA 1SZ2A 3SJHA 4RWTA 5JMVA 1WSGA 2D1KA 3CCVN 2ZQBA 3DYAA 4DR1K 2G8VA 1ZBUA 3M8QA 5AZJA 1HKBA 4CJ7A 4WCEL 1HJOA 4DLEA 3SCXA 1XHZA 3O6WA 2QTDA 4DTMA 4C8OA 1J53A 3KWIA 1OH8A 4CHNA 4IOCL 1SKSA 2E5LK 3VN5A 1HLUA 3NBPA 4JK7A 4FVMA 5AFUA 1J5EK 4EHTA 1RT6A 1ITGA 1C6VA 3ENBA 4CHPA 4KV8A 2UUAK 2Q36A 3PO5A 3J7AP 4L8RB 3CCMN 2OZSA 4CE9A 3BEXA 2A5XA 4DUZK 3KK2A 5KQ8A 1RBSA 3U9DA 5KGWA 1OKJA 2P5GA 1JCFA 4LFCK 3G71N 2E88A 3HI0A 4GNIA 4DHYA 3LPUA 3C7NB 1FK9A 4IO8A 3DLLL 4OLBA 2FXUA 2RE2A 3WXMB 5TKYA 5H1SQ 4E7HA 1L3TA 4ZTFA 5AZIB 5GADP 1NK8A 3VEOA 1MDUB 1QSSA 4CK2A 1WB9A 4A2BA 2UUBK 2PAVA 4DQRA 2AP1A 1L3VA 3VQEA 2E1YA 3IKMA 3MN9A 2HHHK 3MXMA 4Z4CA 1MWKA 3DLRA 4LF5K 2XHBA 2B5JA 5T7BA 2PYLA 1ATNA 3I8BA 4CZJA 4BY9C 2F9TA 4F4KA 3HSCA 3DXKB 3SNNA 5CY4A 4JI8K 2VG5A 3T1HK 1RT3A 3GBTA 4BRAA 2YHYA 3KTQA 2V7ZA 3NFAA 4YDUC 3OYHA 3VEYA 4E1NA 4RW7A 1IV0A 4CESA 3NAEA 4IFVA 3BZKA 5JLFA 4FM1A 1IKXA 3FFIA 3DLBA 3ITHA 3MXJA 4W5RA 2QM1A 5CR4A 1NGEA 1EWQA 4BRDA 4DTRA 4BRMA 3HO1A 1XMQK 3MK6A 3VQAA 1XQSC 5HOOA 1Q18A 1RT7A 4M42A 3V6DA 2CH6A 3C94A 3P38A 2FBTA 2WBNA 3E1YA 2QA4N 3ZSYA 2OTLN 5JVGL 1C1BA 3PV8A 5HLFA 1T8EA 4OO1J 4CZIA 3VA0A 4JI6K 2KZZA 4FJKA 1TYQA 3V9ZA 4CJKA 4KI6A 3DRSA 2P9KA 2DY4A 2JLEA 3L2UA 3OYKA 3OYJA 3VOVA 1LWEA 5DK5A 1F21A 4H5WA 3JSMA 1NU0A 4EFHA 1TUUA 2NRRA 1X9JA 4IJNA 1UWBA 2HNDA 4FK0A 4ELUA 5EX5A 3A8YA 4CGJA 1HYSA 2IGIA 3I0RA 3KVGA 3CMAN 4IEEA 4DFPA 1L5UA 3CC2N 1RBUA 4RW9A 3NF7A 2GV9A 2YV0X 3PO4A
chains in the Genus database with same CATH topology
1IBMK 2VQEK 3J80O 4DV1K 4B3TK 4JI8K 4DR5K 3J7YP 3T1HK 4CVNE 4NXNK 5A2QO 5IT9O 5AJ3K 2UXBK 2UU9K 4DR6K 4LFBK 3T1YK 4DR4K 4DV3K 4YHHK 5BR8K 4X62K 1XMOK 4JI5K 4DR1K 1IBLK 3OTOK 5IWAK 2F4VK 2E5LK 4JI7K 1XNQK 4B3MK 1J5EK 1XMQK 4YY3K 2UUAK 4JI1K 1N36K 4LF8K 1HNXK 4DUYK 3J7AP 1N32K 2UXCK 2UXDK 4DV4K 4NXMK 4X64K 4DUZK 4DR2K 4GKJK 4JI6K 4JI0K 4DV5K 4LFCK 2ZM6K 4LF6K 5LMNK 4LFAK 1HNWK 4DV2K 4GKKK 4JI3K 4DV0K 4CW7B 1N33K 4V19S 4KHPK 4DR7K 1HNZK 4AQYK 4B3SK 2VQFK 2UUCK 4LF9K 2UUBK 4JI2K 4OX9K 1N34K 4LF4K 4X66K 3J81O 5FLXO 4LF7K 3JAMO 5LMUK 1HR0K 2HHHK 4JV5K 4JI4K 4B3RK 4X65K 1I94K 1FJGK 4DR3K 4LF5K 4DV6K 1XNRK 1IBKK 4K0KK 4DV7K 5LL6Z 4JYAK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IBM K;  2VQE K;  3J80 O;  4DV1 K;  4B3T K;  4JI8 K;  4DR5 K;  3J7Y P;  3T1H K;  4CVN E;  4NXN K;  5A2Q O;  5IT9 O;  5AJ3 K;  2UXB K;  2UU9 K;  4DR6 K;  4LFB K;  3T1Y K;  4DR4 K;  4DV3 K;  4YHH K;  5BR8 K;  4X62 K;  1XMO K;  4JI5 K;  4DR1 K;  1IBL K;  3OTO K;  5IWA K;  2F4V K;  2E5L K;  4JI7 K;  1XNQ K;  4B3M K;  1J5E K;  1XMQ K;  4YY3 K;  2UUA K;  4JI1 K;  1N36 K;  4LF8 K;  1HNX K;  4DUY K;  3J7A P;  1N32 K;  2UXC K;  2UXD K;  4DV4 K;  4NXM K;  4X64 K;  4DUZ K;  4DR2 K;  4GKJ K;  4JI6 K;  4JI0 K;  4DV5 K;  4LFC K;  2ZM6 K;  4LF6 K;  5LMN K;  4LFA K;  1HNW K;  4DV2 K;  4GKK K;  4JI3 K;  4DV0 K;  4CW7 B;  1N33 K;  4V19 S;  4KHP K;  4DR7 K;  1HNZ K;  4AQY K;  4B3S K;  2VQF K;  2UUC K;  4LF9 K;  2UUB K;  4JI2 K;  4OX9 K;  1N34 K;  4LF4 K;  4X66 K;  3J81 O;  5FLX O;  4LF7 K;  3JAM O;  5LMU K;  1HR0 K;  2HHH K;  4JV5 K;  4JI4 K;  4B3R K;  4X65 K;  1I94 K;  1FJG K;  4DR3 K;  4LF5 K;  4DV6 K;  1XNR K;  1IBK K;  4K0K K;  4DV7 K;  5LL6 Z;  4JYA K; 
#chains in the Genus database with same CATH topology
 4AM6 A;  1RDD A;  1B9F A;  3C6T A;  5DMR A;  1LWF A;  1JXE A;  4HTL A;  5JVH L;  2DTU A;  3H45 C;  3RRG A;  2QWL A;  4YDU A;  4E19 A;  4F2S A;  2UXB K;  1YIJ N;  4CJT A;  4EP4 A;  1RFQ A;  1D5A A;  2OAN A;  3IUC A;  4DSE A;  1RCH A;  4H0X B;  5EXW A;  1QSY A;  4FW1 A;  5M1O A;  4DV3 K;  3THX A;  1S5J A;  3RR8 A;  2OYQ A;  4E1J A;  5FDL A;  3DOL A;  4CER A;  3VQ7 A;  3H3O B;  4KH5 A;  4CIE A;  3KK1 A;  4M45 A;  5CYQ A;  3LM9 A;  1XHX A;  2GTD A;  1E4G T;  4AHV A;  3CIP A;  3LWM A;  1JJ2 M;  1XI1 A;  4PKH A;  3OS0 A;  3D45 A;  4BWM A;  4DB3 A;  1N36 K;  3K0S A;  1N32 K;  2UXD K;  3OHR A;  4X64 K;  2FC0 A;  4Z4F A;  3H46 O;  4H0V B;  1BL3 A;  1M90 O;  3OYE A;  1W97 L;  3CJC A;  3ZSV A;  3EYZ A;  1Q7Y O;  4NCB A;  1RDC A;  4KTZ A;  1WBD A;  3LWL A;  1TUY A;  1KVB A;  3TAB A;  4HUG A;  2ZE2 A;  3TR8 A;  3DXM B;  4E7K A;  1NGG A;  4AHS A;  1S22 A;  3FZM A;  4ILG B;  4YNQ A;  2NUB A;  3NVM A;  4DR7 K;  2IVN A;  3H3N O;  1B9D A;  4Z4E A;  4BDZ A;  1KLM A;  1WSJ A;  1C0F A;  3T1A A;  4CJV A;  2P9P B;  2KTQ A;  2OPR A;  3EKU A;  4O44 A;  2OPQ A;  4GMJ B;  3UKU A;  3FZK A;  4KB1 A;  5FPE A;  2Z1I A;  3RSE A;  1VSD A;  3GL1 A;  4KHU A;  4JKD A;  3R8E A;  3AVM A;  3O9R A;  4NLC A;  3QEV A;  4CEQ A;  3G4S N;  1Z05 A;  1ZBF A;  4FJN A;  3PSI A;  2IVO A;  1NJZ A;  2YNF A;  1S6Q A;  4FVU A;  3VQ4 A;  1RNH A;  2KKZ A;  2ZGZ A;  4YFU A;  5C24 A;  4DV1 K;  3R1X A;  4CEZ A;  4IBN A;  1X1P A;  5J2M A;  3DAW A;  5A2Q O;  3IFR A;  4ILH A;  1HUX A;  3QLH A;  5AQM A;  1H1V A;  5B8H A;  2I7N A;  4O8U A;  3LZI A;  3VER A;  3NF8 A;  1BIS A;  5J2Q A;  2EWS A;  3ZSO A;  5K14 A;  1TL1 A;  3LPT A;  5AQX A;  3CYM A;  3L2W A;  4M3X A;  1W7A A;  4Y1C A;  3TAP A;  3B8A X;  2O4I A;  3AVH A;  4O0I A;  1S9G A;  3THV A;  3WUH A;  3I56 N;  2DFH A;  3T69 A;  1T44 A;  4BRK A;  1WN7 A;  4NYN A;  3F9K A;  4DTX A;  4FK2 A;  4ICL A;  3U6F A;  3C6U A;  4FWR A;  4B1Z A;  1Q82 O;  4CHY A;  1NLV A;  4DUY K;  4FWK A;  4FLY A;  3UKU B;  3OYG A;  4B8C A;  4QAG A;  1ZBH A;  2V7Y A;  3QBW A;  1RGI A;  2Q2R A;  4CGD A;  4WYB A;  4BRQ A;  4KO0 A;  4Y1D A;  4FZY A;  4O0J A;  4C8K A;  1NK5 A;  4CBW A;  4A57 A;  4CF0 A;  1UA1 A;  2F8T A;  3JXU A;  4J2E A;  4KB0 A;  1S72 N;  1JCE A;  2B6A A;  4OGE A;  2D0A A;  1UOC A;  5HRP A;  4IO9 L;  4DF4 A;  4JKF A;  1GLB G;  2HOE A;  2A41 A;  3K5N A;  4ZTJ A;  2FBX A;  3BUZ B;  2QW9 A;  1VSE A;  2OPP A;  5AQO A;  3BF3 A;  1V4S A;  4LF4 K;  3SI6 A;  1ZXO A;  4CJP A;  4DS5 A;  3TAN A;  4CJF A;  2VYP A;  4IG0 A;  3PX4 A;  4RW8 A;  4JV5 K;  3MEC A;  4RCH A;  4HCC A;  1LWC A;  4BWJ A;  2D0B A;  4F9O A;  4CFB A;  4N76 A;  4K0K K;  1LAV A;  4M7Y A;  3IDH A;  2XO7 A;  3ZT3 A;  2ITG A;  4H03 B;  3SQ4 A;  2W40 A;  3ENH A;  4KH4 A;  2D5R A;  2R7Y A;  2QKK A;  4DF8 A;  5AQF A;  3ZX0 A;  4CZE A;  3I8D A;  3J8A A;  3S3M A;  4LFB K;  3T1Y K;  3AO4 A;  4ISF A;  4DR4 K;  5CHI A;  3M8R A;  2O8C B;  1QQC A;  3A2F A;  1S1V A;  4YHH K;  4IG3 A;  1LV5 A;  1ILY A;  1BWF O;  2Z1H A;  4KH6 A;  2BUP A;  4DQP A;  3L4I A;  3EN9 A;  2FBV A;  2VWB A;  4KTW A;  1NKB A;  4FPA A;  2GBZ A;  4EZ6 A;  3PSF A;  4W5Q A;  1CZB A;  3LP1 A;  3HP9 A;  4OVL A;  1KFS A;  3DXK A;  1CZ9 A;  2E1Z A;  4H0O A;  1SUQ A;  3FLC O;  3HRG A;  3F2K A;  3VQQ A;  2AA4 A;  5KI6 A;  4I2Q A;  3NGI A;  4C1N K;  4BE0 A;  1HNX K;  3CCL N;  2HHT A;  1KD1 O;  1U49 A;  3VGL A;  1JLA A;  2Y1J A;  4CF8 A;  1BIZ A;  2AJQ A;  4YOY A;  2G8H A;  4Z4G A;  3MEE A;  5J2P A;  4K8Z A;  4Z94 A;  3CC7 N;  3SK3 A;  1T03 A;  3HTV A;  2ZM6 K;  1QVF M;  1C0U A;  3HJF A;  5F2R A;  3WT0 A;  1B92 A;  2CH5 A;  2CGK A;  2HHW A;  1HNW K;  3A5L C;  1ZC6 A;  3MX5 A;  4FLU A;  2A6A A;  3OA9 A;  1NKE A;  5HRO A;  2GEM A;  4CJ4 A;  1UAX A;  4RW4 A;  4KRF A;  3FR0 A;  1N33 K;  4FLZ A;  3LM2 A;  4C8N A;  3MMV A;  3TWH A;  4V19 S;  2E2O A;  3ZT4 A;  5M1Q A;  4JKG B;  1O1W A;  4CZH A;  3NF6 A;  2X6N A;  4KHN A;  4B08 A;  1JLB A;  3P39 A;  5J2N A;  2NRZ A;  3WNG A;  4UQG A;  4BC5 A;  1VSM A;  1U04 A;  2D0P A;  4DU3 A;  2D4W A;  1A5X A;  1VAZ A;  2E6M A;  3KLI A;  1FJG K;  4KHY A;  4BRI A;  4O55 A;  1BA0 A;  1TKD A;  4JYA K;  4FJH A;  4CHZ A;  1HRH A;  3KK3 A;  1EP4 A;  1RIL A;  4WQ5 A;  1SL0 A;  1K9M O;  2QKB A;  4LSN A;  1HPZ A;  4O8K A;  2WOM A;  2W42 A;  4FJ7 A;  1XC9 A;  3V9X A;  1RBR A;  2Z1G A;  1D4X A;  3BDP A;  1YXQ A;  2P5O A;  2I7P A;  1TK8 A;  3HPG A;  4H5R A;  2YKN A;  3D0P A;  2EHG A;  1ZBS A;  1ASU A;  1CXU A;  3LDL A;  4NCA A;  5KRT A;  1J9A A;  5CZ2 A;  4DKW A;  5EOY A;  2IOC A;  3KWG A;  1TKX A;  3Q7C A;  4XIU A;  4QS7 A;  3U4L A;  3WEE B;  4B1Y B;  1K6Y A;  3ZET A;  3ZT0 A;  4QS8 A;  1IBL K;  3G25 A;  3IAY A;  3C7N A;  2XY5 A;  2ASO A;  1XNQ K;  5C15 A;  1BG3 A;  5AQP A;  1OH5 A;  5GIP A;  3FZL A;  3LL3 A;  3TU5 A;  4KAZ A;  1WLJ A;  2XY8 A;  3ZSW A;  4M41 A;  5KQD A;  3AAR A;  4O4G A;  2ZWH A;  5AZI A;  3SAF A;  2E6L A;  3QES A;  5FPN A;  2ASP A;  2KW4 A;  5ADX H;  1VQ4 N;  3R6M A;  3O9T A;  4CI6 A;  4JRP A;  5I9E B;  2XY7 A;  2G8K A;  2A40 A;  1ZBI A;  1NM1 A;  1NJY A;  4LD0 A;  4CEO A;  5LMN K;  3L4Q A;  3C6H A;  4F3O A;  3RVC A;  3MCA B;  1Q81 O;  1C0M A;  2YJE A;  2B4J A;  3MN5 A;  3WNH A;  4LSL A;  2I5J A;  5KPR A;  3I33 A;  1DKG D;  1Q8I A;  4AH9 A;  3TSQ A;  1YVN A;  4CCH A;  3CME N;  2UUC K;  3P4I A;  4IFE A;  4OPJ A;  2FF6 A;  4FPB A;  2FLO A;  1N5Y A;  3UKR A;  3CQY A;  3DLE A;  4BAC A;  3QEP A;  5JLH A;  1W2B M;  2BE2 A;  3P83 D;  4EZ9 A;  4KKO A;  4YOT A;  4DV6 K;  3TAG A;  3V1R A;  1ATR A;  4DV7 K;  2HMI A;  3G6E N;  1DEJ A;  5DM6 L;  3OYM A;  4PQU A;  2RKI A;  3SV4 A;  5SZT A;  4CK3 A;  1HNI A;  1HQU A;  1WNS A;  5AQY A;  4JN4 A;  1C0T A;  5FPD A;  2V51 B;  5AQQ A;  3NH1 A;  3CJ1 A;  1KC8 O;  1NJX A;  4A2A A;  4R79 A;  3AGR A;  5F1X A;  4N5S A;  4BVO A;  5C2D A;  5BR8 K;  4FJX A;  4O5B A;  1BQM A;  4R5P A;  3VQ8 A;  1KSP A;  3L0Q A;  4FYD A;  1IH7 A;  3P5J A;  3C65 A;  2JWL A;  1JL1 A;  1VHX A;  3VF6 A;  4CFA A;  5E84 A;  2FSK A;  4CJQ A;  4FLT A;  4LH5 A;  4PKG A;  3B6P A;  3O9U A;  5C10 A;  1QQM A;  4PKI A;  1Z6R A;  4QCL A;  4CZM A;  4I6M A;  1ASW A;  4FM2 A;  1YJW N;  3ZEU A;  1DGK N;  4H0P A;  2YHX A;  1YTU A;  4JS4 A;  4FK4 A;  1XUP O;  2Q3S A;  1BOT O;  3ZCM A;  1FXX A;  4NXM K;  1TAQ A;  2CGJ A;  3ZX2 A;  1VQO N;  3PX6 A;  5E41 A;  2GX9 A;  2Q0R A;  3VTH A;  1VK0 A;  1YT3 A;  3HP6 A;  3NDK A;  2QWR A;  1D9D A;  2OTJ N;  4CJS A;  1EKE A;  4DFK A;  1NMN A;  4IOA L;  2YI1 A;  4JHD B;  3VEV A;  4B3O A;  2W6L A;  3KLF A;  3VF2 A;  4UY8 O;  4DTU A;  1Q9Y A;  2LSN A;  4KHW A;  1O13 A;  2WC9 A;  4DS4 A;  1NJW A;  1BCO A;  3F73 A;  1S1T A;  4KPY A;  2Z1J A;  1VQN N;  4DFJ A;  2VQF K;  4DSI A;  3THW B;  5F0X A;  1RDB A;  3NE6 A;  1K8K A;  5EY4 A;  5HP1 A;  3JAM O;  2V52 B;  3HT3 A;  5BRE A;  3O9Q A;  3QO9 A;  3VQC A;  3QIN A;  3SAG A;  4JD2 A;  4X65 K;  2P9N A;  4CF1 A;  3H1V X;  4A5A A;  4GV3 A;  2QEX N;  4GV9 A;  1T6D A;  3KD1 E;  2F96 A;  3NGZ A;  3P31 A;  4B9U A;  4CZK A;  2O4G A;  4BQL A;  1T3V A;  4HHT A;  4IFY A;  2GWK A;  5AR0 A;  3CHW A;  4WFA L;  4DQS A;  4J8F A;  2D0C A;  4CIF A;  2D0O A;  3OS2 A;  3ULD A;  4HTU A;  1J6Z A;  1RDW X;  3VEX A;  3K5M A;  3ENO A;  3LDQ A;  4JKE A;  3QET A;  3ULE A;  4PL7 A;  4N47 A;  4FWL A;  3JYT A;  3WQU A;  3HM9 A;  1S3X A;  1OH7 A;  4G1Q A;  5AQU A;  2JGU A;  1G99 A;  3QNN A;  3LAN A;  1NGF A;  3AV9 A;  1VSK A;  5AQH A;  4M3R A;  3GOI A;  2WUS A;  4BRE A;  5BRH A;  4H0T B;  1C1C A;  2PYJ A;  1NWK A;  3CFO A;  5AQG A;  1X9M A;  2HHS A;  2KFN A;  3HZ6 A;  3LAL A;  3AA5 X;  1KCF A;  5TKW A;  4RG8 A;  3CQ8 A;  4JI0 K;  1NGB A;  4CF2 A;  4DV5 K;  5D3G A;  3HM8 A;  1YUW A;  4FOE A;  2YHA A;  1QHA A;  3VQP A;  3MDQ A;  4AIL C;  2ZF5 O;  3O8M A;  1NOZ A;  3ALY A;  5BN9 A;  4BGB A;  1U2V B;  3ID8 A;  1HNZ K;  3GDQ A;  1K73 O;  3DLH A;  3VF4 A;  1KQS M;  4QS9 A;  4FWQ A;  4M3Y A;  1LAW A;  2XY6 A;  1U2V A;  5GIO A;  4M3U A;  4F8R A;  3KKR A;  1NOY A;  1YJ9 N;  4JKA A;  1HR0 K;  2RHK A;  4FWP A;  4Q0B A;  1NK6 A;  3UE5 A;  2VWK A;  1WUA A;  5DM7 L;  3CER A;  3K9K A;  3ZX3 A;  4PWD A;  3OYC A;  3M1F A;  4KFB A;  2VQE K;  1RT2 A;  2BTF A;  3OYI A;  4CIG A;  1DTT A;  1KAX A;  1JLC A;  2YNH A;  3MN7 A;  2ZJP L;  4CGH A;  1RBT A;  3U8X A;  4W5N A;  3P1G A;  1TK0 A;  2G8F A;  1NGD A;  3QML A;  5AQL A;  3A5N C;  1RDA A;  3NGY A;  3VQB A;  2HVH A;  3D7E O;  5AZJ B;  3QEI A;  3OYB A;  1RT5 A;  1FKO A;  3OVN A;  3T3F A;  2BDP A;  5BN8 A;  2GUP A;  3QIO A;  4BRF A;  3W0L A;  1BO5 O;  4GW6 A;  4EAH D;  1YI2 N;  4CZL A;  1EX4 A;  4FJI A;  1YJN N;  3AVN A;  3M8P A;  1BDG A;  4Y0W A;  3O4N A;  2DFE A;  4MO4 A;  4KRE A;  2P9S B;  1MA9 B;  2A1S A;  5E26 A;  5FRM A;  1E4F T;  4Q5V A;  3HYF A;  3KLG A;  3WQT A;  3TSP A;  3BP8 A;  3NF9 A;  1WAJ A;  4DTS A;  3S9H A;  4ELT A;  2P9I A;  4MLH A;  3RMA A;  4CD3 A;  4ILJ A;  2HVI A;  2P9I B;  2NRH A;  4K43 A;  3LAK A;  5LY3 A;  3WXJ A;  2P9L A;  3ZT2 A;  1OVY A;  4EIA A;  1NGA A;  4JLH A;  1MWM A;  1L3U A;  4OPH A;  2WTU A;  2VCP A;  4CJL A;  4Z4I A;  3CFR A;  4F2R A;  1R59 O;  3VQ5 A;  4FM0 A;  5FRO A;  4CJW A;  5CYM A;  1KLN A;  4J2B A;  1BA1 A;  3LP0 A;  2HHU A;  3L2R A;  4JI4 K;  1TYQ B;  1KTQ A;  3SUN A;  4AM7 A;  4CEB A;  1UA0 A;  1HQE A;  3VPZ A;  3C0B A;  3KJV A;  2QWN A;  2E2P A;  4CHO A;  3J7Z O;  1GLA G;  3CM5 A;  3VGK A;  2VG6 A;  2HHX A;  4I9L A;  3J7Y P;  3V9U A;  1X3N A;  4AHC A;  5AJ3 K;  3ZT1 A;  2RPI A;  4CGG A;  3KLH A;  1D8Y A;  5ADX A;  1VQ7 N;  1QE1 A;  3ZLJ A;  4JKB A;  3MN6 A;  3C95 A;  1DLO A;  5BR9 A;  1TAU A;  2OA8 A;  1TVR A;  4JI5 K;  3QBX A;  3K2P A;  4DQQ A;  5C42 A;  3TI0 A;  3K58 A;  3MAQ A;  4H5T A;  4BRN A;  5FPM A;  1Y64 A;  3N4P A;  3ZET B;  3SJJ A;  2BGG A;  4B9N A;  1JKH A;  4ZHR A;  1S9E A;  1ZBL A;  4JKC A;  4RTF D;  4BRL A;  1BQN A;  4BR2 A;  3O5B A;  3DOK A;  4L3Q A;  4FL9 A;  4LF8 K;  1DTQ A;  3FGU A;  3THX B;  3TAQ A;  3O3G A;  2XRI A;  1N6Q A;  2O8F A;  4YOX A;  3SV3 A;  1EXQ A;  1GLC G;  3VTI A;  2Q31 A;  4MLE A;  4GY2 B;  1A5V A;  4OPA A;  2A42 A;  3A0I X;  4TSX A;  2J4R A;  1VSI A;  4IEI A;  4NB4 A;  1QHT A;  4LFA K;  3PIO L;  3KHY A;  4IXC A;  1VQ5 N;  1A5W A;  1T05 A;  4CW7 B;  4DTN A;  3FZF A;  1QQO A;  3SUP A;  3LP3 A;  4DU4 A;  4YOR A;  2HBK A;  3MX2 A;  3TAM A;  4AHR A;  4KHS A;  4K42 A;  1Z25 A;  4CJ5 A;  1EQY A;  5BPL A;  4A5B A;  2ZD1 A;  5M1F A;  4PY5 A;  4BDY A;  3F5T A;  4B8A B;  4ISE A;  3CM6 A;  4MQ3 A;  5BPM A;  5AQZ A;  4WQ4 C;  3E9L A;  4M7X A;  3E01 A;  5HBM A;  3QEW A;  3WEE A;  2HBL A;  4IDH A;  4BR5 A;  4HCB A;  5AQK A;  1T7P A;  3AO2 A;  4J2A A;  1N8R O;  2P1J A;  2HB5 A;  3VES A;  4E89 A;  1NK4 A;  1BGX T;  3EY1 A;  3AA3 A;  4DQ8 A;  3V81 A;  1GLF O;  4DR6 K;  4HUF A;  3N4Q A;  4CGI A;  3EZW A;  4HWI A;  4Z0U A;  2O8E B;  5M1P A;  3CD6 N;  1RBV A;  3R3L A;  4CBU A;  4OPK A;  1IKY A;  1TL3 A;  1FKP A;  4B1U B;  3OBY A;  4JK9 A;  3SMS A;  5LJV A;  3RR7 A;  4CBX A;  1I3A A;  4FLX A;  2BAN A;  2BH1 A;  2IC3 A;  1U47 A;  3A5O C;  2IDO A;  3OW2 M;  3RRH A;  5IWA K;  4B1V A;  4B9M A;  2HNY A;  4CEF A;  1NGJ A;  1GLD G;  4IWV A;  4B1X B;  1RDU A;  4HVJ A;  1Q9X A;  1REV A;  4MO5 A;  4OKE A;  3CCS N;  2RF2 A;  3ISN C;  4U7B A;  1FW6 A;  1QZ5 A;  3C6A A;  2G8I A;  3EE8 A;  3E66 A;  3V1Q A;  2KLA A;  3KK7 A;  4FLV A;  3MEG A;  3HBT A;  4DR2 K;  2RN2 A;  3TAR A;  1RTI A;  5GAH P;  1C0G A;  3TTC A;  3BGR A;  4IZ9 A;  3RMC A;  1DT9 A;  2YJF A;  1R0A A;  4FSV A;  1QVG M;  1K8A O;  4WF9 L;  1QTM A;  4DSK A;  3FZH A;  4CED A;  4DV2 K;  2OPS A;  3CC4 N;  1VQP N;  3EEQ A;  4NYF A;  1EO1 A;  3V9W A;  4CFD A;  3V9S A;  3WNE A;  1QS4 A;  3SLC A;  4PHT X;  2WON A;  3OYD A;  2PY5 A;  1K8K B;  1XC3 A;  2NZT A;  2IVP A;  4CK1 A;  3SBG A;  1P8Z A;  4LF9 K;  4OX9 K;  1N34 K;  5I3U A;  2FF3 B;  2KFZ A;  5C0Y A;  3LP2 A;  1TKT A;  1RT4 A;  2ITM A;  3AY9 A;  1YHQ N;  1Y97 A;  4JD2 B;  3ATV A;  3I0S A;  4M3T A;  1ATS A;  4B3R K;  3THY B;  3HVR A;  1KVC A;  1I94 K;  1GOC A;  4G9Z A;  4DR3 K;  3CJ7 A;  1WOQ A;  1YVU A;  3VQD A;  1J54 A;  3QIC A;  4FJM A;  1NGI A;  2NRW A;  4AHT A;  5M1K A;  3J80 O;  2OCE A;  3ZSX A;  4KHQ A;  3JS6 A;  3CF5 L;  4E7I A;  1KFD A;  4IJA A;  5JS2 A;  3LDN A;  5CE3 A;  3AVF A;  2UU9 K;  3OBW A;  1ESV A;  3AGK A;  1T6C A;  1NMD A;  2E4L A;  2HST A;  3KIO A;  3UIQ A;  2HBM A;  1JL2 A;  3ULE B;  2X74 A;  4EP5 A;  3TAE A;  4K25 A;  3SYZ A;  4DSF A;  3DRR A;  4C8M A;  1XMO K;  4FWN A;  1BCM A;  3IG1 A;  3ZSQ A;  4FJL A;  3G10 A;  3SAH A;  4JKH A;  1QZ6 A;  2NRX A;  3O4Q A;  3CCR N;  3Q7B A;  4BC2 A;  4Z4H A;  3OYF A;  4JNE A;  2VWJ A;  2HF4 A;  4BQZ A;  3AVG A;  5ELZ A;  1SAZ A;  1BU6 O;  5HRN A;  4QOZ B;  1ASV A;  4IKF A;  1KRP A;  2JWK A;  2P9P A;  3SQ2 A;  2UXC K;  3OJS A;  4AHU A;  3OYA A;  4I2P A;  4JS5 A;  2HNZ A;  3SPZ A;  1NGH A;  2Q97 A;  3U3Y A;  5FRN A;  4WQ4 A;  3O9S A;  1VRT A;  1HKG A;  5AQW A;  2YNI A;  3CJ9 A;  4CHQ A;  5AQN A;  3VEZ A;  4AF1 A;  4JI3 K;  3TAF A;  4ELV A;  3NVK A;  3AVK A;  2HF3 A;  2FSN A;  1NKC A;  4KHP K;  1OH6 A;  4E7L A;  3CCQ N;  3O4W A;  3TTF A;  3AVL A;  2O8B A;  3CG7 A;  2HHQ A;  5AQS A;  4A59 A;  2Q1N A;  3HXM A;  4C8L A;  5EVZ A;  1OVQ A;  1LW0 A;  1TKZ A;  1JXB A;  3NHG A;  3O80 A;  1GLE G;  2GWJ A;  1VSF A;  2H3G X;  3D6R A;  3IS9 A;  5HRS A;  1BI4 B;  1VRU A;  4CGF A;  4E0D A;  2ATQ A;  1NK9 A;  1SKW A;  4BC3 A;  4B3T K;  5HL7 L;  3K5O A;  1RTH A;  4XH4 A;  1U45 A;  1SQK A;  4BRO A;  1BI4 A;  2PFU A;  3AA2 A;  4DG1 A;  5BPN A;  2X6S A;  3PUF A;  1YTA A;  4PL8 A;  4FWO A;  2O8D B;  2GUI A;  3D2E B;  5M1N A;  3CCJ N;  3ATU A;  2NRV A;  5I42 A;  3M6G A;  3RWU A;  1TV6 A;  3QDK A;  1NK7 A;  3RTV A;  1X9W A;  2E2Q A;  2QWP A;  5CZ1 A;  2P51 A;  3VQ9 A;  4A61 A;  3CET A;  3CQX A;  2P9S A;  3ZYY X;  4N41 A;  1NJI O;  1BHL A;  3BY5 A;  3AO1 A;  5AQV A;  4JI7 K;  3BZC A;  1VQ9 N;  4FWM A;  2QXL A;  4CEC A;  3TSU A;  4YY3 K;  3D2F B;  3QNO A;  3K9J A;  2YHB A;  1HX1 A;  4M3W A;  4BG9 A;  3NH0 A;  1NBW A;  3AVC A;  2O8B B;  3TTD A;  3MXI A;  2FSJ A;  3HOT A;  3TPQ A;  2WFB A;  2ASM A;  4GKJ K;  4FWS A;  3SQ0 A;  1Q86 O;  4OKK A;  5KPT A;  2QWM A;  3CFP A;  3NH2 A;  4CF9 A;  5AQR A;  2IAJ A;  2YKM A;  2KZM A;  3SMP A;  1IG8 A;  4WQ5 C;  3SBT A;  4K41 A;  3VMF B;  3L2Q A;  3A5M C;  3K5L A;  5AQI A;  3EL2 A;  2F8S A;  5GIN A;  1LCU A;  3LDO A;  1YF5 L;  4B9T A;  2W41 A;  3SZ2 A;  2O8F B;  4GVM A;  2ZJQ L;  3K57 A;  1SKR A;  5FLX O;  3HL8 A;  4DTJ A;  4LF7 K;  3G0Z A;  1I39 A;  5AQT A;  3ZSR A;  4HUE A;  5EU7 A;  3ASM A;  3QER A;  5C2F A;  3WXK A;  1XNR K;  3FE1 A;  3AO5 A;  1IBK K;  2HW3 A;  4OGC A;  4DMN A;  3E9P A;  3HVT A;  1VSJ A;  1EWR A;  3LDS A;  4DSL A;  1HNV A;  1GLJ O;  4RW6 A;  4CVN E;  3BF1 A;  3CPW M;  1X9S A;  4NXN K;  4B9V A;  5GAG P;  4IDK A;  4CZF A;  1P90 A;  3VGM A;  3HPO A;  1LW2 A;  1KVA A;  3W3D A;  2FBY A;  1NGC A;  4KBO A;  1U48 A;  5MLC Q;  4FOI A;  3F9M A;  4JAX A;  4BC4 A;  1RTJ A;  2E8A A;  1BIU A;  2KQ2 A;  3AAQ A;  3DM2 A;  3B6O A;  4OKJ A;  3H6E A;  3K59 A;  3OJU A;  4M3Z A;  3QEX A;  2CGL A;  2Q0U A;  3OTO K;  2F9W A;  1SL1 A;  2F4V K;  2GEL A;  1IKV A;  1KAY A;  3UB5 A;  4B3M K;  1NNE A;  1KAZ A;  1NG9 A;  3KLE A;  2QXF A;  2VG7 A;  1VQ6 N;  2ZGY A;  4H0Y B;  4JI1 K;  1SV5 A;  3CI5 A;  3DLG A;  3EO3 A;  2W6K A;  3QIP A;  4JKG A;  3PY8 A;  4FW2 A;  4H5N A;  3DLK A;  4BE1 A;  4OJR A;  4DQI A;  3MCP A;  2NLX A;  3LAM A;  1BUP A;  3DRP A;  2P9K B;  2HMP A;  4O5F A;  3LZJ A;  1JCG A;  3M8S A;  3WNF A;  1VQM N;  2P9U B;  1CZA N;  3MED A;  4MFB A;  3PX0 A;  5J1E A;  4FZX C;  3IMX A;  4FZZ A;  4DFM A;  3CJB A;  3RMD A;  4A62 A;  1IG9 A;  4CZG A;  3LDP A;  4JI2 K;  3UKR B;  3SPY A;  2ETJ A;  3VA3 A;  5KTQ A;  1S1W A;  3O1B A;  3J81 O;  4XH5 A;  3T7Z A;  3U3G A;  4FJ8 A;  5JIC A;  4BGA A;  2IIR A;  3AVI A;  3AA4 A;  5LMU K;  1U4B A;  4ISG A;  1VQ8 N;  1LOT B;  3DWL A;  3WXL A;  1WSE A;  3O1W A;  5LL6 Z;  4LY7 A;  3S41 A;  4H4O A;  3HK2 A;  3DJC A;  1YAG A;  3KZB A;  3ZSZ A;  4BR9 A;  5IT9 O;  5LJW A;  1M1K O;  4WFN L;  1HKC A;  4BRH A;  3M5R A;  4CD1 A;  3KD5 E;  4FJ9 A;  4NLB A;  5KGX A;  4NO7 A;  4BVP A;  1XWL A;  4X62 K;  1CLQ A;  2F7T A;  1CXQ A;  3VET A;  5KPZ A;  4BRC A;  4LC9 B;  3GE1 A;  1WBB A;  3DI6 A;  3NMU A;  4DU1 A;  4BRP A;  2P9U A;  3AVA A;  3EKS A;  4W5O A;  1TK5 A;  1RTD A;  1ZYQ A;  4YOW A;  4W5T A;  2QWQ A;  4C23 A;  3CJA A;  2G8U A;  3PLA A;  4PUO A;  3S3N A;  3QFP A;  5SWM A;  4YOU A;  3ZEU B;  4XH1 A;  2PZS A;  1WAF A;  2NRT A;  4DV4 K;  1Z26 A;  4CJ3 A;  4B9L A;  4CJR A;  3I55 N;  1QSL A;  4WFB L;  2NNW A;  1IO2 A;  2VGN A;  1SL2 A;  2UYT A;  3EE9 A;  3QB0 A;  4BG8 A;  3H08 A;  4PA1 A;  4H5V A;  1NK0 A;  1S6P A;  2QI2 A;  3VEW A;  2A1R A;  1IJJ A;  1G15 A;  1U6Z A;  4JRQ A;  3O3F A;  4DLG A;  2PBD A;  4JHD A;  3HOS A;  3THW A;  2E2N A;  3CXC M;  3T19 A;  2DFF A;  3DXM A;  4DCH A;  4BRG A;  2O8E A;  5GAE P;  4JEP A;  3WXI A;  1HYV A;  1S1X A;  4K8X A;  4DTO A;  1W0H A;  1C1A A;  4CJE A;  4FXD A;  3FFK B;  2KHO A;  4ID1 A;  4I7F A;  4E7J A;  4LH4 A;  4EHU A;  1IBM K;  3THY A;  4FO0 A;  4MDB A;  3HST B;  3V1O A;  4B9Q A;  3AO3 A;  4DR5 K;  1WSH A;  4I6M B;  3IRX A;  1L3S A;  2A3Z A;  1GOA A;  3DMJ A;  1GOB A;  5C25 A;  4I9Q A;  3PIP L;  3V4I A;  2QK9 A;  3U9Z A;  2ZJR L;  3CCU N;  3O08 A;  4YOV A;  2G8W A;  4IOX A;  3AVJ A;  4C1N I;  5BRF A;  4FCY A;  2EX3 A;  4FJG A;  3VEN A;  3SQ1 A;  4BR7 A;  3MWT A;  3L6Q A;  1QQN A;  3L3U A;  3L3V A;  5C12 A;  1SS6 A;  4J2D A;  3QFU A;  3OYN A;  1JLE A;  1IKW A;  3L2V A;  1HMV A;  4BR0 A;  1VQK N;  2VGM A;  4E3S A;  3S3O A;  3M3Z A;  3EZ5 A;  4BR4 A;  3ID6 A;  4FJJ A;  1X3M A;  4CFC A;  3HPH A;  1EET A;  4N56 A;  1S1U A;  1W9H A;  3RMB A;  2HHV A;  3D2E A;  3OY9 A;  2QWO A;  1E3M A;  4BDP A;  2Y1I A;  3AAP A;  1KXP A;  3H1Q A;  1RT1 A;  3RSE B;  3E9O A;  3NCI A;  3VQ6 A;  1V4T A;  1HYZ A;  3MWP A;  4B1W B;  1HJR A;  2P9N B;  1HPM A;  3R9P A;  4OLA A;  4LF6 K;  4BE2 A;  3L8B A;  4H4M A;  4KI4 A;  1JLG A;  4FLW A;  1J5O A;  5AQJ A;  4JK8 A;  4GKK K;  4H8K A;  1TGO A;  1WSF A;  1VSH A;  4DV0 K;  4DSJ A;  4DWI A;  4MDA A;  4ID5 A;  5AFU H;  2YHW A;  3D2F A;  1VSL A;  4AQY K;  4CEE A;  4B3S K;  1YIT N;  4M63 C;  1JLF A;  2DPN A;  4X66 K;  4F3T A;  3CPE A;  2IS3 A;  3CCE N;  1WSI A;  2E20 A;  4XEI A;  3AVB A;  4CJU A;  1MU2 A;  4FJ5 A;  5KRS A;  2HBJ A;  3KKS A;  4GVE A;  1D9F A;  3OS1 A;  2P9L B;  1JLQ A;  2YX6 A;  4GV6 A;  3SUQ A;  3GG4 A;  5JS1 A;  5HRR A;  4B9S A;  3O3H A;  4E1M A;  4NCG A;  4U67 L;  2X78 A;  3SUO A;  3OYL A;  2O8D A;  2OZM A;  2O8C A;  5BRD A;  4WE1 A;  1VQL N;  4KTQ A;  4DTP A;  1GLL O;  4CEA A;  2YNG A;  2YCH A;  1SZ2 A;  3SJH A;  4RWT A;  5JMV A;  1WSG A;  2D1K A;  3CCV N;  2ZQB A;  3DYA A;  4DR1 K;  2G8V A;  1ZBU A;  3M8Q A;  5AZJ A;  1HKB A;  4CJ7 A;  4WCE L;  1HJO A;  4DLE A;  3SCX A;  1XHZ A;  3O6W A;  2QTD A;  4DTM A;  4C8O A;  1J53 A;  3KWI A;  1OH8 A;  4CHN A;  4IOC L;  1SKS A;  2E5L K;  3VN5 A;  1HLU A;  3NBP A;  4JK7 A;  4FVM A;  5AFU A;  1J5E K;  4EHT A;  1RT6 A;  1ITG A;  1C6V A;  3ENB A;  4CHP A;  4KV8 A;  2UUA K;  2Q36 A;  3PO5 A;  3J7A P;  4L8R B;  3CCM N;  2OZS A;  4CE9 A;  3BEX A;  2A5X A;  4DUZ K;  3KK2 A;  5KQ8 A;  1RBS A;  3U9D A;  5KGW A;  1OKJ A;  2P5G A;  1JCF A;  4LFC K;  3G71 N;  2E88 A;  3HI0 A;  4GNI A;  4DHY A;  3LPU A;  3C7N B;  1FK9 A;  4IO8 A;  3DLL L;  4OLB A;  2FXU A;  2RE2 A;  3WXM B;  5TKY A;  5H1S Q;  4E7H A;  1L3T A;  4ZTF A;  5AZI B;  5GAD P;  1NK8 A;  3VEO A;  1MDU B;  1QSS A;  4CK2 A;  1WB9 A;  4A2B A;  2UUB K;  2PAV A;  4DQR A;  2AP1 A;  1L3V A;  3VQE A;  2E1Y A;  3IKM A;  3MN9 A;  2HHH K;  3MXM A;  4Z4C A;  1MWK A;  3DLR A;  4LF5 K;  2XHB A;  2B5J A;  5T7B A;  2PYL A;  1ATN A;  3I8B A;  4CZJ A;  4BY9 C;  2F9T A;  4F4K A;  3HSC A;  3DXK B;  3SNN A;  5CY4 A;  4JI8 K;  2VG5 A;  3T1H K;  1RT3 A;  3GBT A;  4BRA A;  2YHY A;  3KTQ A;  2V7Z A;  3NFA A;  4YDU C;  3OYH A;  3VEY A;  4E1N A;  4RW7 A;  1IV0 A;  4CES A;  3NAE A;  4IFV A;  3BZK A;  5JLF A;  4FM1 A;  1IKX A;  3FFI A;  3DLB A;  3ITH A;  3MXJ A;  4W5R A;  2QM1 A;  5CR4 A;  1NGE A;  1EWQ A;  4BRD A;  4DTR A;  4BRM A;  3HO1 A;  1XMQ K;  3MK6 A;  3VQA A;  1XQS C;  5HOO A;  1Q18 A;  1RT7 A;  4M42 A;  3V6D A;  2CH6 A;  3C94 A;  3P38 A;  2FBT A;  2WBN A;  3E1Y A;  2QA4 N;  3ZSY A;  2OTL N;  5JVG L;  1C1B A;  3PV8 A;  5HLF A;  1T8E A;  4OO1 J;  4CZI A;  3VA0 A;  4JI6 K;  2KZZ A;  4FJK A;  1TYQ A;  3V9Z A;  4CJK A;  4KI6 A;  3DRS A;  2P9K A;  2DY4 A;  2JLE A;  3L2U A;  3OYK A;  3OYJ A;  3VOV A;  1LWE A;  5DK5 A;  1F21 A;  4H5W A;  3JSM A;  1NU0 A;  4EFH A;  1TUU A;  2NRR A;  1X9J A;  4IJN A;  1UWB A;  2HND A;  4FK0 A;  4ELU A;  5EX5 A;  3A8Y A;  4CGJ A;  1HYS A;  2IGI A;  3I0R A;  3KVG A;  3CMA N;  4IEE A;  4DFP A;  1L5U A;  3CC2 N;  1RBU A;  4RW9 A;  3NF7 A;  2GV9 A;  2YV0 X;  3PO4 A; 
#chains in the Genus database with same CATH homology
 1IBM K;  2VQE K;  3J80 O;  4DV1 K;  4B3T K;  4JI8 K;  4DR5 K;  3J7Y P;  3T1H K;  4CVN E;  4NXN K;  5A2Q O;  5IT9 O;  5AJ3 K;  2UXB K;  2UU9 K;  4DR6 K;  4LFB K;  3T1Y K;  4DR4 K;  4DV3 K;  4YHH K;  5BR8 K;  4X62 K;  1XMO K;  4JI5 K;  4DR1 K;  1IBL K;  3OTO K;  5IWA K;  2F4V K;  2E5L K;  4JI7 K;  1XNQ K;  4B3M K;  1J5E K;  1XMQ K;  4YY3 K;  2UUA K;  4JI1 K;  1N36 K;  4LF8 K;  1HNX K;  4DUY K;  3J7A P;  1N32 K;  2UXC K;  2UXD K;  4DV4 K;  4NXM K;  4X64 K;  4DUZ K;  4DR2 K;  4GKJ K;  4JI6 K;  4JI0 K;  4DV5 K;  4LFC K;  2ZM6 K;  4LF6 K;  5LMN K;  4LFA K;  1HNW K;  4DV2 K;  4GKK K;  4JI3 K;  4DV0 K;  4CW7 B;  1N33 K;  4V19 S;  4KHP K;  4DR7 K;  1HNZ K;  4AQY K;  4B3S K;  2VQF K;  2UUC K;  4LF9 K;  2UUB K;  4JI2 K;  4OX9 K;  1N34 K;  4LF4 K;  4X66 K;  3J81 O;  5FLX O;  4LF7 K;  3JAM O;  5LMU K;  1HR0 K;  2HHH K;  4JV5 K;  4JI4 K;  4B3R K;  4X65 K;  1I94 K;  1FJG K;  4DR3 K;  4LF5 K;  4DV6 K;  1XNR K;  1IBK K;  4K0K K;  4DV7 K;  5LL6 Z;  4JYA K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...