4JI6K

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
116
structure length
116
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 28
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4ji6K00
4DV5K 4DR1K 2HHHK 4DR4K 4DR6K 3JAMO 4DUYK 4DUZK 1HNXK 4V19S 4JYAK 4DV1K 3J7AP 2ZM6K 4X65K 2UU9K 1I94K 5LMNK 1N36K 4JI8K 5A2QO 4DV3K 3OTOK 4LF6K 1HR0K 4B3MK 4JI6K 2UXDK 4JI4K 4B3RK 4JI5K 1IBKK 3J7YP 1XNRK 4X64K 4JI0K 1HNZK 4DR7K 1IBMK 2F4VK 4JI2K 4DR2K 4LFAK 1IBLK 4LF8K 4LF5K 1FJGK 4CW7B 2UUCK 5LL6Z 2VQFK 4YHHK 1XMQK 2UUBK 4JI7K 2UXCK 5FLXO 4B3SK 2VQEK 4DV0K 4YY3K 4DR5K 4NXMK 4K0KK 4DV2K 4X66K 4LFCK 1XNQK 5IWAK 4GKJK 4DV7K 4KHPK 4JI1K 5LMUK 4LF7K 4DR3K 1XMOK 4NXNK 4B3TK 2E5LK 1N33K 4LFBK 4LF9K 2UUAK 4DV4K 4JV5K 4OX9K 4X62K 4JI3K 5IT9O 3J80O 1N34K 4GKKK 1J5EK 4AQYK 4LF4K 3T1HK 2UXBK 1N32K 4DV6K 4CVNE 3J81O 3T1YK 5AJ3K 1HNWK 5BR8K
chains in the Genus database with same CATH superfamily
4FWLA 5AQNA 4DR1K 3MX2A 4DQSA 4CFAA 1LV5A 4U67L 3K2PA 4IJNA 1GLFO 4CJEA 4CECA 3RR7A 3CMEN 2PAVA 3MCPA 3SBGA 3SLCA 2E4LA 1YAGA 1I94K 2QW9A 3CI5A 1N36K 1QSLA 1WSIA 2DFHA 5J2NA 1VQKN 3ZSOA 3CJCA 1B9DA 5J2QA 1I3AA 1U2VA 4H5RA 4Z4EA 4FWQA 2O8DB 3THYB 4DQIA 2KW4A 3CJ1A 5FROA 3DLBA 3IUCA 4BR7A 3SQ1A 1YVUA 4CEDA 2W40A 1NGGA 4FWRA 1WB9A 4GMJB 2I5JA 3RRHA 2KLAA 1YUWA 4EFHA 2IS3A 3K59A 4KHWA 4KHQA 2LSNA 1EXQA 3ULDA 1NMDA 2FBVA 3CQXA 3ASMA 1DTTA 1E4FT 4CW7B 1VSKA 1WOQA 4JHDB 3TTFA 5AQZA 1QSYA 3VGLA 2ETJA 1YJWN 5F0XA 1O1WA 2A5XA 4K0KK 1L5UA 2HNZA 2W41A 1JL2A 4DV7K 2GX9A 4B1ZA 1CXQA 5LMUK 1MA9B 3BF1A 5JVGL 1KXPA 1D4XA 4I2QA 2F9WA 3KVGA 3OYJA 4DQ8A 1IKVA 5LJWA 1WSGA 3MXIA 1YHQN 3CERA 2EX3A 3G10A 4LY7A 3VEYA 2WONA 4J2AA 4WF9L 3W0LA 1BA0A 4YOYA 1LWCA 3ENHA 3LP1A 3DRPA 2AP1A 1U48A 4YORA 5C42A 1J5EK 4KHSA 4J2DA 1LW2A 4A61A 2A6AA 4AHUA 4A62A 4H03B 3BY5A 2E2QA 3O3GA 4DLEA 4QS7A 4PWDA 1QHAA 1XHXA 2QI2A 1D8YA 2HHUA 4CHZA 3NH0A 3CG7A 4RG8A 4EAHD 4DS4A 3CM5A 4NYNA 3S3MA 2P9UA 5AQVA 3OYMA 4E7KA 5AQWA 3CF5L 1JL1A 4CJKA 4OJRA 3F9KA 2OPQA 5TKYA 3HO1A 1ATSA 4CZMA 1NK7A 3AA3A 1JCEA 5C10A 3O4NA 2YX6A 3OTOK 3MN5A 2NRVA 2JWLA 3S9HA 3VQ6A 1VSFA 2FSNA 3O9SA 5FRNA 3SBTA 1FKOA 3VEWA 4BRGA 4IG3A 3AO4A 3OYDA 1VQLN 4Z0UA 1QHTA 1RT6A 3KLHA 4CZEA 1Z26A 1K8KB 3PO5A 5M1OA 4CEEA 4ZTJA 4WQ4C 3DXKA 3KK3A 3AVIA 5FRMA 1BGXT 1R59O 2OPRA 4BREA 1TYQA 4CZHA 3EZ5A 1SL0A 1TAQA 4CHYA 2P9NA 4M3WA 5FLXO 4CGJA 3LALA 4CGDA 4CEZA 1JLGA 1IKYA 5GIOA 1ASVA 4CHQA 1WAJA 4K25A 1LWFA 2GTDA 3OYFA 1S6QA 2HHVA 4CF2A 4F2SA 4OPAA 1XMOK 4CIEA 3R9PA 3ENBA 1EO1A 1RDUA 2IGIA 3MN9A 4JK8A 4IKFA 3OYBA 4C8LA 1DTQA 4WFNL 3SPZA 5BPNA 1K73O 1IV0A 3UB5A 2VG7A 1NGHA 4IOCL 4Z4IA 4O8KA 3V9ZA 4MO5A 3MEGA 4BRFA 3ATUA 3QO9A 3KK1A 4LF4K 4N5SA 1TK8A 1A5WA 4B1XB 4Z4GA 4M3RA 3Q7CA 1RBTA 3AVFA 3OJUA 4KH6A 4NLCA 3SZ2A 4KI6A 1WBBA 4FYDA 3ZT1A 4CGHA 1WSHA 4BR9A 4GV9A 1HUXA 1ZXOA 3THVA 3THXB 3TAPA 3JAMO 1FK9A 1RCHA 5KGWA 1BHLA 1WAFA 4EIAA 3CC7N 4WQ5A 1C1BA 3VGMA 1UA1A 2G8UA 4GV3A 3BP8A 2G8VA 2BH1A 3IMXA 3ZSQA 1BI4A 5AQXA 3VPZA 3D2EB 5A2QO 5SWMA 4TSXA 4CZJA 5KGXA 3EEQA 3CQ8A 1TL1A 2XY6A 4B3RK 3ISNC 1NM1A 2DFEA 2CGLA 5CYQA 4FWPA 1TK5A 4FLVA 3OYNA 4ELTA 3WXIA 2ZQBA 3PSFA 2NUBA 3CPEA 5HBMA 3HM9A 4C23A 4H0XB 3H1VX 2A40A 5BPMA 1BCOA 1XMQK 3SUQA 2GWKA 4AF1A 4F2RA 3RVCA 4IOAL 1Q82O 3O5BA 1KSPA 1IH7A 2P9PA 1VQMN 1M1KO 4FW1A 2ITMA 2Y1IA 4HUEA 1QZ5A 4Q5VA 3I0SA 1QTMA 1QQNA 3VETA 1MWMA 5JLFA 4Y0WA 4LH5A 2P9SA 3SNNA 4DV4K 1GLLO 3K9JA 4H8KA 4OPKA 4BE2A 3U4LA 4IJAA 1BIUA 3J7ZO 2FLOA 1LWEA 5IT9O 4BRQA 4GKKK 3O08A 2Q36A 2VYPA 4FWOA 3LWMA 3HRGA 3QEXA 4I9LA 1UA0A 3VQBA 1C6VA 1DGKN 1JCGA 1HJRA 2E1YA 4BRIA 3SAFA 4FJXA 1HYSA 2F8TA 3DLHA 1NGCA 5ADXH 3CCMN 1DT9A 3VQQA 4DUYK 4BRAA 1YT3A 3K5LA 1XWLA 1MWKA 3M8SA 1T03A 4CZLA 2FSJA 1NOYA 4DSLA 2O8CA 4BE0A 4HUFA 4LH4A 1L3VA 4HCCA 2WUSA 4B9MA 4DG1A 2EHGA 4CJVA 5LMNK 2E6MA 2OTJN 3TR8A 1W0HA 5AZIB 2HF3A 2D0OA 1BA1A 2UXDK 3D6RA 4CD3A 2ZJPL 3PO4A 4MLHA 4M41A 3NVKA 3J7YP 2IVOA 2KFNA 2YI1A 3ID6A 3FE1A 3CJBA 2W42A 2HHWA 4ISEA 3LM2A 2WFBA 4M7YA 1JCFA 1L3TA 2G8WA 3RSEB 3C94A 3H3NO 3ZSWA 4O5BA 4J2EA 3ITHA 3L4IA 2P9LB 3TPQA 5E41A 1VK0A 2BTFA 1NK0A 1TKZA 4JKEA 4FK0A 3RRGA 4B8CA 4FLYA 4UY8O 4DQRA 1GOCA 3OYCA 3NHGA 4UQGA 3LM9A 5CZ2A 3N4PA 1GLEG 3HOSA 3VQ7A 4QS8A 3B8AX 4F9OA 1SS6A 5GAHP 3CCSN 3WT0A 3TAFA 1BO5O 3VQCA 2D5RA 3W3DA 1KFDA 3R1XA 4DTJA 2UUAK 4OX9K 1Q9YA 3N4QA 1XC3A 4DLGA 1N34K 1W9HA 1NGJA 4HCBA 3IKMA 3CCJN 4KH4A 3CCLN 4DWIA 4DFJA 4KTQA 3LP2A 3OS1A 2HBLA 3E1YA 3BDPA 3J81O 3T1YK 2RN2A 2QM1A 2QTDA 4FJIA 1VRUA 4DV5K 4FJLA 3AVJA 1TUUA 5C25A 2F96A 4H0TB 3CCUN 1WN7A 3LDSA 3OS2A 3P1GA 4BRMA 3VTHA 5AQIA 2ITGA 3DRSA 2YJFA 3J7AP 1ZYQA 4X65K 4DTNA 4BQZA 4FOEA 5AZJB 3FR0A 3NBPA 4CHNA 2XO7A 3CJ7A 1NU0A 2D0PA 3V6DA 3GE1A 1NJWA 3GBTA 4GY2B 1CZ9A 3L4QA 3AGKA 3SJJA 1HPZA 4N41A 3HPHA 2FBYA 1V4SA 1JLEA 2HNYA 2JGUA 4NO7A 3PX4A 3CPWM 1CZAN 4BC3A 4CE9A 5M1NA 5CY4A 4AHCA 4H5VA 4WQ5C 4CK1A 1NG9A 3L6QA 2P9KA 1IJJA 1D9DA 2UUBK 4N56A 2QWNA 1JLAA 2YNFA 4K8ZA 4DU1A 3AAPA 1NJIO 1KVAA 3HTVA 4BR4A 5EX5A 1SL1A 3D7EO 4LFCK 5HRRA 3K5NA 3P31A 3SV3A 3SMPA 1JLFA 2HVHA 1B9FA 1CXUA 3HP6A 3NMUA 1X3MA 5FPMA 4KB1A 4FLWA 4F3OA 5JS2A 4CF1A 1SKRA 4M3UA 5JMVA 3QNNA 5C12A 1HKBA 4W5TA 2IAJA 4FLZA 1S72N 1V4TA 2PYLA 3OYKA 1X9SA 3QBXA 3J80O 1SQKA 1HQUA 1HLUA 3LP0A 3KK7A 2F7TA 2QWQA 1C1AA 2RPIA 4AQYK 4H5WA 2OPSA 3CXCM 4DSEA 1TKXA 4JK7A 4DQPA 1EETA 4CJTA 4CVNE 4M42A 3AO1A 4ELVA 3O6WA 4A5BA 1Z25A 5KPZA 1VSMA 1LCUA 4FJ7A 1X1PA 1EQYA 1NK5A 5DK5A 1RT5A 1T05A 2Z1JA 3RMDA 4KREA 4H5TA 4PUOA 4H0OA 4H0VB 3MK6A 4JEPA 4C8NA 3OHRA 4BVOA 2ATQA 4OKEA 4KAZA 3UKRA 3IS9A 4U7BA 4PQUA 4PKHA 1RTIA 2E8AA 3V9UA 1RBUA 3AO2A 1SUQA 5I9EB 1S22A 3DWLA 5JS1A 3D2FA 3QESA 4CK2A 2VG5A 4RCHA 4AM7A 1WBDA 4CJ5A 3LDNA 3RMCA 4C8KA 2Q1NA 1X3NA 2FBTA 4IDKA 3ENOA 2OA8A 3MMVA 4WCEL 1QE1A 5CHIA 4JKAA 1JJ2M 4OO1J 4AHRA 4BC2A 1NJZA 3C6UA 4FPBA 1EKEA 3B6OA 4OPJA 3IAYA 3UKUB 1OH8A 1VQNN 1RDAA 5GADP 1GOBA 1P8ZA 1N8RO 3E66A 4FWNA 1LAWA 2FC0A 1T6DA 1GLAG 5E26A 3LL3A 3SK3A 3V1QA 1RBSA 2X6NA 4KTWA 1A5XA 2Q0RA 3VF2A 2BUPA 3VESA 3ZX3A 1N33K 2JLEA 4PA1A 3HPGA 4BRNA 2DTUA 1HYVA 2O8FA 3U8XA 3RMBA 3GG4A 4CJLA 3U6FA 3PSIA 3KKSA 1WSEA 3TANA 4W5OA 3DXKB 5HL7L 1NK4A 3CJAA 2I7NA 2NRHA 4YNQA 1IG9A 3THWB 4M7XA 3M8QA 3NF8A 5AQGA 4IO8A 4FLUA 2XY5A 1N32K 1NWKA 3WQUA 2D0BA 2O4GA 3F73A 3SUOA 2O4IA 4F3TA 3SQ0A 3FZKA 3E01A 1ZC6A 4CEQA 1BUPA 4DUZK 2HMIA 1BWFO 4JKGA 5AQTA 1HNXK 1ATRA 3AAQA 4YOXA 3H1QA 4FZYA 3FLCO 2IIRA 3R3LA 5KPRA 3AA5X 1QSSA 1ITGA 2P51A 3V9SA 1WLJA 2QEXN 2FBXA 3FZMA 3B6PA 3DOLA 2FF6A 4NB4A 4EP4A 1XQSC 1RT4A 3SQ2A 4NYFA 3K58A 1DEJA 5BPLA 1RBRA 3OA9A 3ZSZA 4WFAL 2KTQA 1C0FA 5AQUA 1W97L 2FXUA 3VF6A 2OPPA 2Z1IA 4L8RB 4DR2K 3TAMA 4AHVA 4FVMA 4K42A 4DS5A 5DM6L 3G0ZA 3VOVA 1HPMA 1X9MA 1C0TA 3PX6A 4ISGA 2UYTA 5I42A 1VQ5N 3TABA 2AJQA 4CJ7A 4BDPA 3T19A 4A5AA 1TKTA 4LSNA 2O8DA 1KD1O 4DSIA 1T6CA 1NGIA 1HKGA 3DYAA 4OLBA 4O44A 4GV6A 3IDHA 3CQYA 3DM2A 2CH6A 4NCAA 3LP3A 4LF9K 5DM7L 4MQ3A 1KCFA 2ASOA 5GINA 3NCIA 3T7ZA 1CLQA 3JSMA 1OH5A 3G71N 3WEEA 1RBVA 3BF3A 5ELZA 4CZIA 4IFYA 3ZT2A 1KC8O 2OZMA 2ZGZA 1S9EA 4ZHRA 3OS0A 5KRSA 4B1YB 4YOVA 4QS9A 4BRHA 4EZ9A 3VQ5A 1S6PA 1A5VA 4CJWA 1T44A 2HHHK 5DMRA 3E9PA 4YOUA 3VEVA 3TAEA 2E6LA 4WE1A 3CCVN 1HYZA 4O4GA 5KI6A 4K8XA 2VWBA 2Z1GA 1O13A 2P9SB 3WXKA 3DRRA 3G6EN 3M1FA 3PY8A 3BZCA 4LD0A 2RE2A 2ZJQL 4IG0A 1QQMA 3T1AA 3G4SN 4IZ9A 4ELUA 4KRFA 3NGZA 2OCEA 4A2BA 4Z4CA 3TU5A 2D1KA 4A2AA 3QFPA 4HWIA 4E7LA 2X78A 4C1NK 4Y1DA 1BQNA 4PKGA 2QXFA 1XHZA 3QETA 1GLCG 3KHYA 5C15A 4JKFA 1J53A 2HVIA 1Q9XA 2O8CB 3DAWA 4YHHK 1SZ2A 4JKHA 4E1MA 3HXMA 4B3SK 5H1SQ 3K0SA 3PIOL 3EO3A 4NXMK 1FKPA 1TL3A 5CE3A 2IC3A 4G9ZA 3HSCA 2OANA 3IFRA 4HTLA 3WXLA 1XNQK 5SZTA 3V9WA 3ZYYX 1HQEA 3AO3A 4DU4A 4DQQA 3CC2N 4B1UB 4QOZB 1JLQA 5T7BA 1ZBUA 5AFUA 4JLHA 2VWJA 4CJRA 3HP9A 4I6MA 4M3YA 1SKWA 1BCMA 2Q0UA 4BGAA 3SQ4A 3NGYA 3MN6A 1BIZA 5AQLA 3J8AA 5BN9A 4M3XA 3AY9A 4CZFA 2Q3SA 2QWLA 5CR4A 3IRXA 5AJ3K 3RMAA 2GUIA 5BR8K 2PZSA 2XHBA 4JN4A 3JS6A 3C7NA 1P90A 3ZETA 1KLNA 1HKCA 3L2UA 3O8MA 1WNSA 4B8AB 3ZCMA 1GLJO 4CGIA 2YNIA 4R5PA 4O0IA 4BE1A 5J2MA 5HP1A 1ZBLA 2BE2A 2YKMA 2VWKA 1REVA 3LPUA 3S41A 5AQMA 3HM8A 3OW2M 3PLAA 1JLBA 2QKKA 2O8EA 1ZBHA 4DTSA 1UAXA 1NGAA 4I7FA 3MCAB 1Q86O 5F1XA 4DV3K 2HF4A 4CF8A 1D9FA 3V81A 1QQOA 4BDYA 1MU2A 2G8FA 3I33A 3LZIA 3CM6A 3CFPA 4XEIA 4L3QA 1D5AA 1IBKK 2W6KA 4BG9A 4JI0K 3QIOA 1Q8IA 2YV0X 4IWVA 4AHTA 4OGEA 3KD5E 2QK9A 4FSVA 3EKSA 1S1XA 4DTMA 4DFMA 2R7YA 1YTUA 4JI2K 3TWHA 1SKSA 3L2VA 2XRIA 4HUGA 1XUPO 3V9XA 5EOYA 1S1UA 4IO9L 4LF5K 4FO0A 3WXMB 4CIFA 2V7YA 4FLXA 1QS4A 2UUCK 4JKCA 1BOTO 4KBOA 3ZT4A 4DR5K 1VQ4N 1W2BM 1J9AA 4BC5A 4DV2K 1OVQA 4FWKA 1RFQA 1RT7A 3BEXA 4ILHA 3TSPA 5I3UA 3WNEA 2A41A 2KHOA 3CIPA 4CJ3A 5GAEP 3QB0A 3WXJA 3AVBA 2GWJA 1HNVA 1C0GA 2E88A 4CF0A 4B3TK 1QVGM 3ULEB 3LAKA 4BC4A 5GAGP 3LPTA 2NNWA 5M1PA 4BWJA 3HK2A 1S1TA 1HRHA 2NLXA 4IBNA 1LAVA 2GUPA 3C6TA 5AQOA 4H0YB 3HOTA 5CZ1A 2HHSA 4BG8A 3H6EA 2D4WA 3MXJA 2P9KB 4M3ZA 3L8BA 4MLEA 1S1VA 1RTHA 3HYFA 1W7AA 1VRTA 1VSEA 2VGNA 1S3XA 4M63C 3OYEA 3UE5A 4CBXA 4Z94A 2HBKA 3M8PA 1C0MA 1G15A 2VG6A 3RTVA 3HL8A 4IFVA 2HMPA 4B1VA 3VN5A 2PBDA 3C95A 3VQDA 4KO0A 1NNEA 5AQHA 3L2WA 4WFBL 2AA4A 3CMAN 2NRTA 4E3SA 4BR5A 3DI6A 4JRPA 3R6MA 3BZKA 1DLOA 4XH5A 4A59A 4JI5K 4EHUA 2PY5A 2YHAA 1H1VA 1Q18A 1ZBSA 4DMNA 3LDQA 3NFAA 3L2RA 1U6ZA 3ZEUA 4FVUA 5TKWA 4H4MA 1NJXA 1B92A 3QEPA 3OJSA 3OYLA 1NBWA 4FLTA 4FL9A 1FJGK 4ID5A 5LL6Z 2YHYA 4ILGB 5E84A 3AVCA 1GLDG 4BR2A 3M5RA 4E7IA 3TAGA 4C1NI 3ALYA 4X66K 3HT3A 4CFCA 1NGEA 3NGIA 5MLCQ 2O8BB 4JI1K 3LWLA 4I9QA 3QDKA 4YOTA 4DR3K 1OH7A 3PUFA 3D2FB 2E2PA 4N47A 3OVNA 2G8IA 4E1NA 3ATVA 4KV8A 3OBYA 3QICA 4CGGA 1RDDA 1HJOA 1U04A 2RKIA 3VQEA 4O8UA 5KPTA 5AQPA 2I7PA 2P9LA 3FFIA 4QAGA 2H3GX 2YKNA 3QEVA 3K9KA 4DB3A 2PFUA 1IO2A 4ISFA 2F8SA 1DKGD 1U2VB 3A0IX 4FJNA 1X9JA 5HOOA 3AA2A 3EN9A 4CF9A 4JKDA 1TK0A 4FW2A 4H4OA 5FPNA 3KZBA 4K41A 1LW0A 2Q31A 1KRPA 4DR4K 4DR6K 3ZT0A 4B08A 1VHXA 1K6YA 4CJQA 4C8OA 4CJSA 3CFRA 1NGDA 4CBUA 1C0UA 3E9LA 1ILYA 4RWTA 2YCHA 2O8FB 3D45A 4YOWA 2QWOA 3KLIA 3SUNA 5BRFA 2V51B 4BWMA 3I0RA 2ZF5O 3MEEA 3TSQA 3LAMA 3NDKA 3VEOA 4CBWA 4FM0A 4KKOA 1VQ8N 4KTZA 2KKZA 4M3TA 3SUPA 3TI0A 4JD2A 4X64K 3AVMA 3G25A 1VSHA 1I39A 4BGBA 4YDUA 3HI0A 2P9IA 3T3FA 1ATNA 4KHNA 4GVEA 4LFAK 4DF4A 2NRZA 3MX5A 4MDAA 2B5JA 4JKGB 3TAQA 3M8RA 2BGGA 3AV9A 4CK3A 3U9DA 5AZJA 3SYZA 3DLRA 1N5YA 4DV0K 4YY3K 1KAZA 4B9VA 5EU7A 3H08A 4CJ4A 5BRHA 3DOKA 1NGBA 3AARA 3H3OB 3GL1A 3AVKA 4AHSA 1HX1A 4JS4A 4CESA 1E3MA 1RILA 4IEIA 3I8DA 3VQPA 3ZX0A 4DU3A 3QEIA 1QQCA 4OGCA 4NXNK 1G99A 2P9UB 4LFBK 3U9ZA 4DTRA 5AQQA 3KWIA 3O3HA 3OYHA 4F8RA 2A1RA 3OBWA 4BRCA 3VA0A 4DSKA 5AQSA 3PX0A 2X6SA 1SV5A 3T1HK 4FK2A 3RWUA 3O1BA 1NGFA 3L3UA 1UOCA 3NH1A 3ZSRA 3O9RA 3SMSA 4C8MA 3DXMA 5J2PA 4O0JA 1YTAA 1WSFA 4NCGA 4B1WB 2HHXA 1E4GT 2WBNA 3ID8A 3O9QA 4NLBA 4V19S 4OVLA 4CCHA 3NF6A 4NCBA 4CEFA 2GBZA 4CEOA 1TYQB 4XIUA 2E2OA 2B6AA 5JVHL 3QMLA 3I55N 1R0AA 5HRNA 2P9NB 3P4IA 4DTOA 3LDPA 3JXUA 3WQTA 3SI6A 2YHBA 3WEEB 4LF6K 2GEMA 4JI6K 3MEDA 5HROA 4ID1A 4E7HA 5GIPA 4BR0A 3JYTA 4DFPA 4DF8A 4JKBA 1NK8A 4CD1A 3HSTB 1NK6A 4B9NA 5AQYA 2F4VK 2VCPA 3SJHA 1N6QA 4M45A 2ZWHA 1EP4A 3QLHA 4OKKA 1SAZA 4FWMA 5HRPA 1S5JA 3NAEA 1RT1A 1Y64A 4FM1A 5HRSA 4IEEA 4JI7K 5FPEA 3QBWA 3C65A 4EHTA 3V1OA 2Q2RA 1K8AO 3HVRA 1K9MO 3SAHA 1QZ6A 4DTUA 4KHPK 3FFKB 2D0CA 2Q97A 3MDQA 1NOZA 1ESVA 1VSLA 3P39A 1SL2A 4Z4HA 2P1JA 5BR9A 3IG1A 3U3YA 4IDHA 4MFBA 1RDCA 2V7ZA 2ASPA 4RW9A 2NZTA 3LZJA 2ZE2A 3BUZB 1BI4B 4B9UA 5AFUH 2QKBA 3UKUA 1M90O 3THYA 1Y97A 1JLCA 2ZJRL 4PHTX 1TAUA 1NKEA 2RHKA 4DV6K 5C2DA 1EX4A 3QFUA 2OYQA 5HLFA 4OLAA 4JNEA 4RW8A 4B9QA 3CETA 2HSTA 2YJEA 3A5LC 1NLVA 1EWQA 2P5OA 3DLGA 2CGKA 4DSJA 3OY9A 4EZ6A 3V1RA 4CEAA 4FJKA 5C0YA 4JHDA 3SCXA 4DV1K 3SV4A 3AVHA 4FJJA 3Q7BA 4H5NA 3OYGA 2A42A 3VA3A 4I6MB 2HW3A 2NRXA 3THWA 2X74A 3E9OA 3I56N 3UIQA 2P9PB 3MECA 3T69A 4CZGA 3AGRA 1NJYA 3SPYA 3VTIA 3HVTA 1KQSM 1IG8A 3KJVA 3L3VA 3C6HA 5M1KA 2DFFA 1L3UA 3K5MA 4J8FA 2YNGA 1BISA 4FJMA 2A1SA 2OZSA 4R79A 3C7NB 5LY3A 4B9SA 3ZETB 2YHWA 1IBLK 4LF8K 4O5FA 4RW4A 3TSUA 3CYMA 1JKHA 3QIPA 1NK9A 2VQFK 3FGUA 3HZ6A 5FPDA 3A5OC 3CHWA 3H45C 3EKUA 4IXCA 2O8EB 1KFSA 1HMVA 3L2QA 5AQFA 1CZBA 2B4JA 1Z6RA 1OH6A 1U4BA 3F9MA 5CYMA 3ZSXA 1J5OA 5B8HA 4FJ9A 3K5OA 3NVMA 1FW6A 3CD6N 4YDUC 4XH4A 4CHPA 3VGKA 2NRRA 2J4RA 4CEBA 2XY8A 5AQJA 4J2BA 4AILC 1YJ9N 4CI6A 4FXDA 4JI3K 2ZD1A 3PIPL 4FZXC 3KLGA 2V52B 2FSKA 1U45A 3TARA 3FZHA 5EY4A 3WUHA 3NF7A 3KKRA 1RGIA 4GNIA 4KI4A 5F2RA 1K8KA 4N76A 1RNHA 2E1ZA 1KTQA 3QEWA 4WYBA 1ASWA 4PL7A 3H46O 3KK2A 1VQ6N 4Q0BA 1RTDA 4FZZA 4LC9B 1F21A 4KH5A 4JYAK 4HTUA 3MWPA 3P38A 3CFOA 4JK9A 4CGFA 4CZKA 4DSFA 1HNIA 3ZX2A 4FK4A 1KVCA 3GOIA 1OKJA 1ASUA 1LOTB 2OTLN 2WOMA 2HHTA 4E1JA 4RTFD 3M3ZA 5C24A 1HR0K 4B3MK 1VQPN 1FXXA 3I8BA 4JI4K 1IKXA 3KTQA 2HBJA 4DFKA 4PL8A 4JS5A 4DR7K 4ICLA 2NRWA 4CJUA 3EL2A 1IBMK 3KLFA 1VQ9N 1IKWA 3O4QA 1T8EA 1MDUB 3ZSYA 5LJVA 3QERA 4F4KA 2ZGYA 2QA4N 4W5QA 1KLMA 4IOXA 4Z4FA 2UXCK 4BY9C 2HOEA 3O4WA 1JXEA 4CHOA 3EY1A 1U49A 3O1WA 4CFBA 1RT2A 4PY5A 2A3ZA 3THXA 1TV6A 4FPAA 3OYAA 1X9WA 5EVZA 4FWSA 1U47A 4ILJA 4LF7K 2CH5A 4Y1CA 3O9UA 3ZT3A 3EYZA 3CCEN 3VEZA 3DLKA 1VSJA 4JAXA 3CCQN 1S1WA 5BREA 4PKIA 2IOCA 3VENA 3ZEUB 4BQLA 1RT3A 4X62K 2DPNA 3D2EA 5C2FA 1JXBA 4G1QA 3TTCA 3V4IA 1L3SA 4CIGA 4CFDA 1NMNA 3GDQA 2FF3B 4MDBA 3DLLL 4BROA 4FCYA 4BRKA 3ZSVA 3LANA 4EP5A 2P5GA 2CGJA 1VSDA 3LDLA 5AQKA 1J54A 1QVFM 4HVJA 5M1QA 4BRPA 4KPYA 1NKCA 4B3OA 5J1EA 2WC9A 4BVPA 4CJPA 4FJ8A 3TTDA 1RDWX 1YJNN 3HPOA 2YHXA 3VQ4A 3VF4A 4E0DA 2E2NA 4RW6A 1YF5L 4JRQA 1C1CA 1T3VA 4QCLA 1TUYA 3L0QA 3DMJA 3AO5A 4A57A 1OVYA 2G8KA 4BRLA 3VERA 4RW7A 2KFZA 1KVBA 1VQ7N 3HJFA 3P83D 1VSIA 2KZMA 1NKBA 2QWPA 3A5MC 5KQDA 1HNZK 4KHUA 3MAQA 4BDZA 4FJ5A 4MO4A 4I2PA 1BDGA 1BL3A 5BRDA 1YIJN 3EZWA 5JICA 3CCRN 3OYIA 3AVAA 1YVNA 1Z05A 3DJCA 3MWTA 5JLHA 4YFUA 4FOIA 1YITN 1BQMA 4B9TA 1BG3A 3MN7A 1T7PA 3AVLA 3KWGA 2WTUA 1WSJA 2VQEK 4CJFA 3NE6A 3VMFB 3KD1E 1TGOA 3KLEA 2KZZA 3EE9A 5IWAK 4GKJK 1UWBA 3A2FA 2JWKA 2ASMA 1BU6O 1VQON 3CJ9A 2E5LK 4JD2B 3NH2A 2YNHA 1GLBG 2P9IB 3C0BA 3VQAA 3FZLA 3CC4N 4DKWA 1EWRA 2W6LA 2HB5A 4B9LA 1WUAA 3UKRB 5AZIA 3SAGA 4AH9A 2DY4A 1TKDA 1YXQA 2IVPA 5D3GA 5ADXA 2Y1JA 1RTJA 3QINA 3EE8A 3VQ9A 2BANA 2GV9A 5AR0A 2Z1HA 4KHYA 1KAYA 4CERA 3ZLJA 3S3OA 5AQRA 3ULEA 3A8YA 4WQ4A 3RSEA 2E20A 3VQ8A 4DHYA 2HBMA 3RR8A 4FJHA 2BDPA 2HNDA 2VGMA 2ZM6K 3PV8A 1TVRA 1Q81O 2XY7A 2UU9K 5FDLA 2KQ2A 3KIOA 2PYJA 3U3GA 4JI8K 3DLEA 2D0AA 3VEXA 5BN8A 4KB0A 4O55A 4DTPA 4E19A 2F9TA 1XNRK 2G8HA 1VAZA 4KFBA 4W5RA 2IDOA 3AVNA 3AA4A 5KRTA 3K57A 3M6GA 3O3FA 3DXMB 3HBTA 4GVMA 5KQ8A 4DTXA 4HHTA 4GW6A 1J6ZA 1Q7YO 3LDOA 3F5TA 2QWRA 1ZBFA 4E7JA 3R8EA 1ZBIA 3BGRA 5K14A 4OPHA 4ZTFA 3F2KA 3C6AA 3QNOA 4DCHA 4W5NA 3AVGA 4XH1A 2EWSA 4BRDA 4IFEA 2RF2A 2HHQA 3WNHA 4LSLA 3O9TA 3A5NC 3D0PA 4OKJA 4H0PA 3FZFA 2QXLA 1RDBA 5KTQA 4FJGA 4JV5K 2IVNA 1XC9A 1KAXA 3WNGA 5EXWA 3MXMA 5M1FA 1GOAA 4E89A 2GELA 3S3NA 1S9GA 1XI1A 3NF9A 4K43A 3O80A 2UXBK 1HNWK 4FM2A 4BACA 3P5JA 3WNFA 4AM6A 2QWMA 1YI2N 2O8BA
chains in the Genus database with same CATH topology
4DV5K 4DR1K 2HHHK 4DR4K 4DR6K 3JAMO 4DUYK 4DUZK 1HNXK 4V19S 4JYAK 4DV1K 3J7AP 2ZM6K 4X65K 2UU9K 1I94K 5LMNK 1N36K 4JI8K 5A2QO 4DV3K 3OTOK 4LF6K 1HR0K 4B3MK 4JI6K 2UXDK 4JI4K 4B3RK 4JI5K 1IBKK 3J7YP 1XNRK 4X64K 4JI0K 1HNZK 4DR7K 1IBMK 2F4VK 4JI2K 4DR2K 4LFAK 1IBLK 4LF8K 4LF5K 1FJGK 4CW7B 2UUCK 5LL6Z 2VQFK 4YHHK 1XMQK 2UUBK 4JI7K 2UXCK 5FLXO 4B3SK 2VQEK 4DV0K 4YY3K 4DR5K 4NXMK 4K0KK 4DV2K 4X66K 4LFCK 1XNQK 5IWAK 4GKJK 4DV7K 4KHPK 4JI1K 5LMUK 4LF7K 4DR3K 1XMOK 4NXNK 4B3TK 2E5LK 1N33K 4LFBK 4LF9K 2UUAK 4DV4K 4JV5K 4OX9K 4X62K 4JI3K 5IT9O 3J80O 1N34K 4GKKK 1J5EK 4AQYK 4LF4K 3T1HK 2UXBK 1N32K 4DV6K 4CVNE 3J81O 3T1YK 5AJ3K 1HNWK 5BR8K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV5 K;  4DR1 K;  2HHH K;  4DR4 K;  4DR6 K;  3JAM O;  4DUY K;  4DUZ K;  1HNX K;  4V19 S;  4JYA K;  4DV1 K;  3J7A P;  2ZM6 K;  4X65 K;  2UU9 K;  1I94 K;  5LMN K;  1N36 K;  4JI8 K;  5A2Q O;  4DV3 K;  3OTO K;  4LF6 K;  1HR0 K;  4B3M K;  4JI6 K;  2UXD K;  4JI4 K;  4B3R K;  4JI5 K;  1IBK K;  3J7Y P;  1XNR K;  4X64 K;  4JI0 K;  1HNZ K;  4DR7 K;  1IBM K;  2F4V K;  4JI2 K;  4DR2 K;  4LFA K;  1IBL K;  4LF8 K;  4LF5 K;  1FJG K;  4CW7 B;  2UUC K;  5LL6 Z;  2VQF K;  4YHH K;  1XMQ K;  2UUB K;  4JI7 K;  2UXC K;  5FLX O;  4B3S K;  2VQE K;  4DV0 K;  4YY3 K;  4DR5 K;  4NXM K;  4K0K K;  4DV2 K;  4X66 K;  4LFC K;  1XNQ K;  5IWA K;  4GKJ K;  4DV7 K;  4KHP K;  4JI1 K;  5LMU K;  4LF7 K;  4DR3 K;  1XMO K;  4NXN K;  4B3T K;  2E5L K;  1N33 K;  4LFB K;  4LF9 K;  2UUA K;  4DV4 K;  4JV5 K;  4OX9 K;  4X62 K;  4JI3 K;  5IT9 O;  3J80 O;  1N34 K;  4GKK K;  1J5E K;  4AQY K;  4LF4 K;  3T1H K;  2UXB K;  1N32 K;  4DV6 K;  4CVN E;  3J81 O;  3T1Y K;  5AJ3 K;  1HNW K;  5BR8 K; 
#chains in the Genus database with same CATH topology
 4FWL A;  5AQN A;  4DR1 K;  3MX2 A;  4DQS A;  4CFA A;  1LV5 A;  4U67 L;  3K2P A;  4IJN A;  1GLF O;  4CJE A;  4CEC A;  3RR7 A;  3CME N;  2PAV A;  3MCP A;  3SBG A;  3SLC A;  2E4L A;  1YAG A;  1I94 K;  2QW9 A;  3CI5 A;  1N36 K;  1QSL A;  1WSI A;  2DFH A;  5J2N A;  1VQK N;  3ZSO A;  3CJC A;  1B9D A;  5J2Q A;  1I3A A;  1U2V A;  4H5R A;  4Z4E A;  4FWQ A;  2O8D B;  3THY B;  4DQI A;  2KW4 A;  3CJ1 A;  5FRO A;  3DLB A;  3IUC A;  4BR7 A;  3SQ1 A;  1YVU A;  4CED A;  2W40 A;  1NGG A;  4FWR A;  1WB9 A;  4GMJ B;  2I5J A;  3RRH A;  2KLA A;  1YUW A;  4EFH A;  2IS3 A;  3K59 A;  4KHW A;  4KHQ A;  2LSN A;  1EXQ A;  3ULD A;  1NMD A;  2FBV A;  3CQX A;  3ASM A;  1DTT A;  1E4F T;  4CW7 B;  1VSK A;  1WOQ A;  4JHD B;  3TTF A;  5AQZ A;  1QSY A;  3VGL A;  2ETJ A;  1YJW N;  5F0X A;  1O1W A;  2A5X A;  4K0K K;  1L5U A;  2HNZ A;  2W41 A;  1JL2 A;  4DV7 K;  2GX9 A;  4B1Z A;  1CXQ A;  5LMU K;  1MA9 B;  3BF1 A;  5JVG L;  1KXP A;  1D4X A;  4I2Q A;  2F9W A;  3KVG A;  3OYJ A;  4DQ8 A;  1IKV A;  5LJW A;  1WSG A;  3MXI A;  1YHQ N;  3CER A;  2EX3 A;  3G10 A;  4LY7 A;  3VEY A;  2WON A;  4J2A A;  4WF9 L;  3W0L A;  1BA0 A;  4YOY A;  1LWC A;  3ENH A;  3LP1 A;  3DRP A;  2AP1 A;  1U48 A;  4YOR A;  5C42 A;  1J5E K;  4KHS A;  4J2D A;  1LW2 A;  4A61 A;  2A6A A;  4AHU A;  4A62 A;  4H03 B;  3BY5 A;  2E2Q A;  3O3G A;  4DLE A;  4QS7 A;  4PWD A;  1QHA A;  1XHX A;  2QI2 A;  1D8Y A;  2HHU A;  4CHZ A;  3NH0 A;  3CG7 A;  4RG8 A;  4EAH D;  4DS4 A;  3CM5 A;  4NYN A;  3S3M A;  2P9U A;  5AQV A;  3OYM A;  4E7K A;  5AQW A;  3CF5 L;  1JL1 A;  4CJK A;  4OJR A;  3F9K A;  2OPQ A;  5TKY A;  3HO1 A;  1ATS A;  4CZM A;  1NK7 A;  3AA3 A;  1JCE A;  5C10 A;  3O4N A;  2YX6 A;  3OTO K;  3MN5 A;  2NRV A;  2JWL A;  3S9H A;  3VQ6 A;  1VSF A;  2FSN A;  3O9S A;  5FRN A;  3SBT A;  1FKO A;  3VEW A;  4BRG A;  4IG3 A;  3AO4 A;  3OYD A;  1VQL N;  4Z0U A;  1QHT A;  1RT6 A;  3KLH A;  4CZE A;  1Z26 A;  1K8K B;  3PO5 A;  5M1O A;  4CEE A;  4ZTJ A;  4WQ4 C;  3DXK A;  3KK3 A;  3AVI A;  5FRM A;  1BGX T;  1R59 O;  2OPR A;  4BRE A;  1TYQ A;  4CZH A;  3EZ5 A;  1SL0 A;  1TAQ A;  4CHY A;  2P9N A;  4M3W A;  5FLX O;  4CGJ A;  3LAL A;  4CGD A;  4CEZ A;  1JLG A;  1IKY A;  5GIO A;  1ASV A;  4CHQ A;  1WAJ A;  4K25 A;  1LWF A;  2GTD A;  3OYF A;  1S6Q A;  2HHV A;  4CF2 A;  4F2S A;  4OPA A;  1XMO K;  4CIE A;  3R9P A;  3ENB A;  1EO1 A;  1RDU A;  2IGI A;  3MN9 A;  4JK8 A;  4IKF A;  3OYB A;  4C8L A;  1DTQ A;  4WFN L;  3SPZ A;  5BPN A;  1K73 O;  1IV0 A;  3UB5 A;  2VG7 A;  1NGH A;  4IOC L;  4Z4I A;  4O8K A;  3V9Z A;  4MO5 A;  3MEG A;  4BRF A;  3ATU A;  3QO9 A;  3KK1 A;  4LF4 K;  4N5S A;  1TK8 A;  1A5W A;  4B1X B;  4Z4G A;  4M3R A;  3Q7C A;  1RBT A;  3AVF A;  3OJU A;  4KH6 A;  4NLC A;  3SZ2 A;  4KI6 A;  1WBB A;  4FYD A;  3ZT1 A;  4CGH A;  1WSH A;  4BR9 A;  4GV9 A;  1HUX A;  1ZXO A;  3THV A;  3THX B;  3TAP A;  3JAM O;  1FK9 A;  1RCH A;  5KGW A;  1BHL A;  1WAF A;  4EIA A;  3CC7 N;  4WQ5 A;  1C1B A;  3VGM A;  1UA1 A;  2G8U A;  4GV3 A;  3BP8 A;  2G8V A;  2BH1 A;  3IMX A;  3ZSQ A;  1BI4 A;  5AQX A;  3VPZ A;  3D2E B;  5A2Q O;  5SWM A;  4TSX A;  4CZJ A;  5KGX A;  3EEQ A;  3CQ8 A;  1TL1 A;  2XY6 A;  4B3R K;  3ISN C;  1NM1 A;  2DFE A;  2CGL A;  5CYQ A;  4FWP A;  1TK5 A;  4FLV A;  3OYN A;  4ELT A;  3WXI A;  2ZQB A;  3PSF A;  2NUB A;  3CPE A;  5HBM A;  3HM9 A;  4C23 A;  4H0X B;  3H1V X;  2A40 A;  5BPM A;  1BCO A;  1XMQ K;  3SUQ A;  2GWK A;  4AF1 A;  4F2R A;  3RVC A;  4IOA L;  1Q82 O;  3O5B A;  1KSP A;  1IH7 A;  2P9P A;  1VQM N;  1M1K O;  4FW1 A;  2ITM A;  2Y1I A;  4HUE A;  1QZ5 A;  4Q5V A;  3I0S A;  1QTM A;  1QQN A;  3VET A;  1MWM A;  5JLF A;  4Y0W A;  4LH5 A;  2P9S A;  3SNN A;  4DV4 K;  1GLL O;  3K9J A;  4H8K A;  4OPK A;  4BE2 A;  3U4L A;  4IJA A;  1BIU A;  3J7Z O;  2FLO A;  1LWE A;  5IT9 O;  4BRQ A;  4GKK K;  3O08 A;  2Q36 A;  2VYP A;  4FWO A;  3LWM A;  3HRG A;  3QEX A;  4I9L A;  1UA0 A;  3VQB A;  1C6V A;  1DGK N;  1JCG A;  1HJR A;  2E1Y A;  4BRI A;  3SAF A;  4FJX A;  1HYS A;  2F8T A;  3DLH A;  1NGC A;  5ADX H;  3CCM N;  1DT9 A;  3VQQ A;  4DUY K;  4BRA A;  1YT3 A;  3K5L A;  1XWL A;  1MWK A;  3M8S A;  1T03 A;  4CZL A;  2FSJ A;  1NOY A;  4DSL A;  2O8C A;  4BE0 A;  4HUF A;  4LH4 A;  1L3V A;  4HCC A;  2WUS A;  4B9M A;  4DG1 A;  2EHG A;  4CJV A;  5LMN K;  2E6M A;  2OTJ N;  3TR8 A;  1W0H A;  5AZI B;  2HF3 A;  2D0O A;  1BA1 A;  2UXD K;  3D6R A;  4CD3 A;  2ZJP L;  3PO4 A;  4MLH A;  4M41 A;  3NVK A;  3J7Y P;  2IVO A;  2KFN A;  2YI1 A;  3ID6 A;  3FE1 A;  3CJB A;  2W42 A;  2HHW A;  4ISE A;  3LM2 A;  2WFB A;  4M7Y A;  1JCF A;  1L3T A;  2G8W A;  3RSE B;  3C94 A;  3H3N O;  3ZSW A;  4O5B A;  4J2E A;  3ITH A;  3L4I A;  2P9L B;  3TPQ A;  5E41 A;  1VK0 A;  2BTF A;  1NK0 A;  1TKZ A;  4JKE A;  4FK0 A;  3RRG A;  4B8C A;  4FLY A;  4UY8 O;  4DQR A;  1GOC A;  3OYC A;  3NHG A;  4UQG A;  3LM9 A;  5CZ2 A;  3N4P A;  1GLE G;  3HOS A;  3VQ7 A;  4QS8 A;  3B8A X;  4F9O A;  1SS6 A;  5GAH P;  3CCS N;  3WT0 A;  3TAF A;  1BO5 O;  3VQC A;  2D5R A;  3W3D A;  1KFD A;  3R1X A;  4DTJ A;  2UUA K;  4OX9 K;  1Q9Y A;  3N4Q A;  1XC3 A;  4DLG A;  1N34 K;  1W9H A;  1NGJ A;  4HCB A;  3IKM A;  3CCJ N;  4KH4 A;  3CCL N;  4DWI A;  4DFJ A;  4KTQ A;  3LP2 A;  3OS1 A;  2HBL A;  3E1Y A;  3BDP A;  3J81 O;  3T1Y K;  2RN2 A;  2QM1 A;  2QTD A;  4FJI A;  1VRU A;  4DV5 K;  4FJL A;  3AVJ A;  1TUU A;  5C25 A;  2F96 A;  4H0T B;  3CCU N;  1WN7 A;  3LDS A;  3OS2 A;  3P1G A;  4BRM A;  3VTH A;  5AQI A;  2ITG A;  3DRS A;  2YJF A;  3J7A P;  1ZYQ A;  4X65 K;  4DTN A;  4BQZ A;  4FOE A;  5AZJ B;  3FR0 A;  3NBP A;  4CHN A;  2XO7 A;  3CJ7 A;  1NU0 A;  2D0P A;  3V6D A;  3GE1 A;  1NJW A;  3GBT A;  4GY2 B;  1CZ9 A;  3L4Q A;  3AGK A;  3SJJ A;  1HPZ A;  4N41 A;  3HPH A;  2FBY A;  1V4S A;  1JLE A;  2HNY A;  2JGU A;  4NO7 A;  3PX4 A;  3CPW M;  1CZA N;  4BC3 A;  4CE9 A;  5M1N A;  5CY4 A;  4AHC A;  4H5V A;  4WQ5 C;  4CK1 A;  1NG9 A;  3L6Q A;  2P9K A;  1IJJ A;  1D9D A;  2UUB K;  4N56 A;  2QWN A;  1JLA A;  2YNF A;  4K8Z A;  4DU1 A;  3AAP A;  1NJI O;  1KVA A;  3HTV A;  4BR4 A;  5EX5 A;  1SL1 A;  3D7E O;  4LFC K;  5HRR A;  3K5N A;  3P31 A;  3SV3 A;  3SMP A;  1JLF A;  2HVH A;  1B9F A;  1CXU A;  3HP6 A;  3NMU A;  1X3M A;  5FPM A;  4KB1 A;  4FLW A;  4F3O A;  5JS2 A;  4CF1 A;  1SKR A;  4M3U A;  5JMV A;  3QNN A;  5C12 A;  1HKB A;  4W5T A;  2IAJ A;  4FLZ A;  1S72 N;  1V4T A;  2PYL A;  3OYK A;  1X9S A;  3QBX A;  3J80 O;  1SQK A;  1HQU A;  1HLU A;  3LP0 A;  3KK7 A;  2F7T A;  2QWQ A;  1C1A A;  2RPI A;  4AQY K;  4H5W A;  2OPS A;  3CXC M;  4DSE A;  1TKX A;  4JK7 A;  4DQP A;  1EET A;  4CJT A;  4CVN E;  4M42 A;  3AO1 A;  4ELV A;  3O6W A;  4A5B A;  1Z25 A;  5KPZ A;  1VSM A;  1LCU A;  4FJ7 A;  1X1P A;  1EQY A;  1NK5 A;  5DK5 A;  1RT5 A;  1T05 A;  2Z1J A;  3RMD A;  4KRE A;  4H5T A;  4PUO A;  4H0O A;  4H0V B;  3MK6 A;  4JEP A;  4C8N A;  3OHR A;  4BVO A;  2ATQ A;  4OKE A;  4KAZ A;  3UKR A;  3IS9 A;  4U7B A;  4PQU A;  4PKH A;  1RTI A;  2E8A A;  3V9U A;  1RBU A;  3AO2 A;  1SUQ A;  5I9E B;  1S22 A;  3DWL A;  5JS1 A;  3D2F A;  3QES A;  4CK2 A;  2VG5 A;  4RCH A;  4AM7 A;  1WBD A;  4CJ5 A;  3LDN A;  3RMC A;  4C8K A;  2Q1N A;  1X3N A;  2FBT A;  4IDK A;  3ENO A;  2OA8 A;  3MMV A;  4WCE L;  1QE1 A;  5CHI A;  4JKA A;  1JJ2 M;  4OO1 J;  4AHR A;  4BC2 A;  1NJZ A;  3C6U A;  4FPB A;  1EKE A;  3B6O A;  4OPJ A;  3IAY A;  3UKU B;  1OH8 A;  1VQN N;  1RDA A;  5GAD P;  1GOB A;  1P8Z A;  1N8R O;  3E66 A;  4FWN A;  1LAW A;  2FC0 A;  1T6D A;  1GLA G;  5E26 A;  3LL3 A;  3SK3 A;  3V1Q A;  1RBS A;  2X6N A;  4KTW A;  1A5X A;  2Q0R A;  3VF2 A;  2BUP A;  3VES A;  3ZX3 A;  1N33 K;  2JLE A;  4PA1 A;  3HPG A;  4BRN A;  2DTU A;  1HYV A;  2O8F A;  3U8X A;  3RMB A;  3GG4 A;  4CJL A;  3U6F A;  3PSI A;  3KKS A;  1WSE A;  3TAN A;  4W5O A;  3DXK B;  5HL7 L;  1NK4 A;  3CJA A;  2I7N A;  2NRH A;  4YNQ A;  1IG9 A;  3THW B;  4M7X A;  3M8Q A;  3NF8 A;  5AQG A;  4IO8 A;  4FLU A;  2XY5 A;  1N32 K;  1NWK A;  3WQU A;  2D0B A;  2O4G A;  3F73 A;  3SUO A;  2O4I A;  4F3T A;  3SQ0 A;  3FZK A;  3E01 A;  1ZC6 A;  4CEQ A;  1BUP A;  4DUZ K;  2HMI A;  1BWF O;  4JKG A;  5AQT A;  1HNX K;  1ATR A;  3AAQ A;  4YOX A;  3H1Q A;  4FZY A;  3FLC O;  2IIR A;  3R3L A;  5KPR A;  3AA5 X;  1QSS A;  1ITG A;  2P51 A;  3V9S A;  1WLJ A;  2QEX N;  2FBX A;  3FZM A;  3B6P A;  3DOL A;  2FF6 A;  4NB4 A;  4EP4 A;  1XQS C;  1RT4 A;  3SQ2 A;  4NYF A;  3K58 A;  1DEJ A;  5BPL A;  1RBR A;  3OA9 A;  3ZSZ A;  4WFA L;  2KTQ A;  1C0F A;  5AQU A;  1W97 L;  2FXU A;  3VF6 A;  2OPP A;  2Z1I A;  4L8R B;  4DR2 K;  3TAM A;  4AHV A;  4FVM A;  4K42 A;  4DS5 A;  5DM6 L;  3G0Z A;  3VOV A;  1HPM A;  1X9M A;  1C0T A;  3PX6 A;  4ISG A;  2UYT A;  5I42 A;  1VQ5 N;  3TAB A;  2AJQ A;  4CJ7 A;  4BDP A;  3T19 A;  4A5A A;  1TKT A;  4LSN A;  2O8D A;  1KD1 O;  4DSI A;  1T6C A;  1NGI A;  1HKG A;  3DYA A;  4OLB A;  4O44 A;  4GV6 A;  3IDH A;  3CQY A;  3DM2 A;  2CH6 A;  4NCA A;  3LP3 A;  4LF9 K;  5DM7 L;  4MQ3 A;  1KCF A;  2ASO A;  5GIN A;  3NCI A;  3T7Z A;  1CLQ A;  3JSM A;  1OH5 A;  3G71 N;  3WEE A;  1RBV A;  3BF3 A;  5ELZ A;  4CZI A;  4IFY A;  3ZT2 A;  1KC8 O;  2OZM A;  2ZGZ A;  1S9E A;  4ZHR A;  3OS0 A;  5KRS A;  4B1Y B;  4YOV A;  4QS9 A;  4BRH A;  4EZ9 A;  3VQ5 A;  1S6P A;  1A5V A;  4CJW A;  1T44 A;  2HHH K;  5DMR A;  3E9P A;  4YOU A;  3VEV A;  3TAE A;  2E6L A;  4WE1 A;  3CCV N;  1HYZ A;  4O4G A;  5KI6 A;  4K8X A;  2VWB A;  2Z1G A;  1O13 A;  2P9S B;  3WXK A;  3DRR A;  3G6E N;  3M1F A;  3PY8 A;  3BZC A;  4LD0 A;  2RE2 A;  2ZJQ L;  4IG0 A;  1QQM A;  3T1A A;  3G4S N;  4IZ9 A;  4ELU A;  4KRF A;  3NGZ A;  2OCE A;  4A2B A;  4Z4C A;  3TU5 A;  2D1K A;  4A2A A;  3QFP A;  4HWI A;  4E7L A;  2X78 A;  4C1N K;  4Y1D A;  1BQN A;  4PKG A;  2QXF A;  1XHZ A;  3QET A;  1GLC G;  3KHY A;  5C15 A;  4JKF A;  1J53 A;  2HVI A;  1Q9X A;  2O8C B;  3DAW A;  4YHH K;  1SZ2 A;  4JKH A;  4E1M A;  3HXM A;  4B3S K;  5H1S Q;  3K0S A;  3PIO L;  3EO3 A;  4NXM K;  1FKP A;  1TL3 A;  5CE3 A;  2IC3 A;  4G9Z A;  3HSC A;  2OAN A;  3IFR A;  4HTL A;  3WXL A;  1XNQ K;  5SZT A;  3V9W A;  3ZYY X;  1HQE A;  3AO3 A;  4DU4 A;  4DQQ A;  3CC2 N;  4B1U B;  4QOZ B;  1JLQ A;  5T7B A;  1ZBU A;  5AFU A;  4JLH A;  2VWJ A;  4CJR A;  3HP9 A;  4I6M A;  4M3Y A;  1SKW A;  1BCM A;  2Q0U A;  4BGA A;  3SQ4 A;  3NGY A;  3MN6 A;  1BIZ A;  5AQL A;  3J8A A;  5BN9 A;  4M3X A;  3AY9 A;  4CZF A;  2Q3S A;  2QWL A;  5CR4 A;  3IRX A;  5AJ3 K;  3RMA A;  2GUI A;  5BR8 K;  2PZS A;  2XHB A;  4JN4 A;  3JS6 A;  3C7N A;  1P90 A;  3ZET A;  1KLN A;  1HKC A;  3L2U A;  3O8M A;  1WNS A;  4B8A B;  3ZCM A;  1GLJ O;  4CGI A;  2YNI A;  4R5P A;  4O0I A;  4BE1 A;  5J2M A;  5HP1 A;  1ZBL A;  2BE2 A;  2YKM A;  2VWK A;  1REV A;  3LPU A;  3S41 A;  5AQM A;  3HM8 A;  3OW2 M;  3PLA A;  1JLB A;  2QKK A;  2O8E A;  1ZBH A;  4DTS A;  1UAX A;  1NGA A;  4I7F A;  3MCA B;  1Q86 O;  5F1X A;  4DV3 K;  2HF4 A;  4CF8 A;  1D9F A;  3V81 A;  1QQO A;  4BDY A;  1MU2 A;  2G8F A;  3I33 A;  3LZI A;  3CM6 A;  3CFP A;  4XEI A;  4L3Q A;  1D5A A;  1IBK K;  2W6K A;  4BG9 A;  4JI0 K;  3QIO A;  1Q8I A;  2YV0 X;  4IWV A;  4AHT A;  4OGE A;  3KD5 E;  2QK9 A;  4FSV A;  3EKS A;  1S1X A;  4DTM A;  4DFM A;  2R7Y A;  1YTU A;  4JI2 K;  3TWH A;  1SKS A;  3L2V A;  2XRI A;  4HUG A;  1XUP O;  3V9X A;  5EOY A;  1S1U A;  4IO9 L;  4LF5 K;  4FO0 A;  3WXM B;  4CIF A;  2V7Y A;  4FLX A;  1QS4 A;  2UUC K;  4JKC A;  1BOT O;  4KBO A;  3ZT4 A;  4DR5 K;  1VQ4 N;  1W2B M;  1J9A A;  4BC5 A;  4DV2 K;  1OVQ A;  4FWK A;  1RFQ A;  1RT7 A;  3BEX A;  4ILH A;  3TSP A;  5I3U A;  3WNE A;  2A41 A;  2KHO A;  3CIP A;  4CJ3 A;  5GAE P;  3QB0 A;  3WXJ A;  3AVB A;  2GWJ A;  1HNV A;  1C0G A;  2E88 A;  4CF0 A;  4B3T K;  1QVG M;  3ULE B;  3LAK A;  4BC4 A;  5GAG P;  3LPT A;  2NNW A;  5M1P A;  4BWJ A;  3HK2 A;  1S1T A;  1HRH A;  2NLX A;  4IBN A;  1LAV A;  2GUP A;  3C6T A;  5AQO A;  4H0Y B;  3HOT A;  5CZ1 A;  2HHS A;  4BG8 A;  3H6E A;  2D4W A;  3MXJ A;  2P9K B;  4M3Z A;  3L8B A;  4MLE A;  1S1V A;  1RTH A;  3HYF A;  1W7A A;  1VRT A;  1VSE A;  2VGN A;  1S3X A;  4M63 C;  3OYE A;  3UE5 A;  4CBX A;  4Z94 A;  2HBK A;  3M8P A;  1C0M A;  1G15 A;  2VG6 A;  3RTV A;  3HL8 A;  4IFV A;  2HMP A;  4B1V A;  3VN5 A;  2PBD A;  3C95 A;  3VQD A;  4KO0 A;  1NNE A;  5AQH A;  3L2W A;  4WFB L;  2AA4 A;  3CMA N;  2NRT A;  4E3S A;  4BR5 A;  3DI6 A;  4JRP A;  3R6M A;  3BZK A;  1DLO A;  4XH5 A;  4A59 A;  4JI5 K;  4EHU A;  2PY5 A;  2YHA A;  1H1V A;  1Q18 A;  1ZBS A;  4DMN A;  3LDQ A;  3NFA A;  3L2R A;  1U6Z A;  3ZEU A;  4FVU A;  5TKW A;  4H4M A;  1NJX A;  1B92 A;  3QEP A;  3OJS A;  3OYL A;  1NBW A;  4FLT A;  4FL9 A;  1FJG K;  4ID5 A;  5LL6 Z;  2YHY A;  4ILG B;  5E84 A;  3AVC A;  1GLD G;  4BR2 A;  3M5R A;  4E7I A;  3TAG A;  4C1N I;  3ALY A;  4X66 K;  3HT3 A;  4CFC A;  1NGE A;  3NGI A;  5MLC Q;  2O8B B;  4JI1 K;  3LWL A;  4I9Q A;  3QDK A;  4YOT A;  4DR3 K;  1OH7 A;  3PUF A;  3D2F B;  2E2P A;  4N47 A;  3OVN A;  2G8I A;  4E1N A;  3ATV A;  4KV8 A;  3OBY A;  3QIC A;  4CGG A;  1RDD A;  1HJO A;  1U04 A;  2RKI A;  3VQE A;  4O8U A;  5KPT A;  5AQP A;  2I7P A;  2P9L A;  3FFI A;  4QAG A;  2H3G X;  2YKN A;  3QEV A;  3K9K A;  4DB3 A;  2PFU A;  1IO2 A;  4ISF A;  2F8S A;  1DKG D;  1U2V B;  3A0I X;  4FJN A;  1X9J A;  5HOO A;  3AA2 A;  3EN9 A;  4CF9 A;  4JKD A;  1TK0 A;  4FW2 A;  4H4O A;  5FPN A;  3KZB A;  4K41 A;  1LW0 A;  2Q31 A;  1KRP A;  4DR4 K;  4DR6 K;  3ZT0 A;  4B08 A;  1VHX A;  1K6Y A;  4CJQ A;  4C8O A;  4CJS A;  3CFR A;  1NGD A;  4CBU A;  1C0U A;  3E9L A;  1ILY A;  4RWT A;  2YCH A;  2O8F B;  3D45 A;  4YOW A;  2QWO A;  3KLI A;  3SUN A;  5BRF A;  2V51 B;  4BWM A;  3I0R A;  2ZF5 O;  3MEE A;  3TSQ A;  3LAM A;  3NDK A;  3VEO A;  4CBW A;  4FM0 A;  4KKO A;  1VQ8 N;  4KTZ A;  2KKZ A;  4M3T A;  3SUP A;  3TI0 A;  4JD2 A;  4X64 K;  3AVM A;  3G25 A;  1VSH A;  1I39 A;  4BGB A;  4YDU A;  3HI0 A;  2P9I A;  3T3F A;  1ATN A;  4KHN A;  4GVE A;  4LFA K;  4DF4 A;  2NRZ A;  3MX5 A;  4MDA A;  2B5J A;  4JKG B;  3TAQ A;  3M8R A;  2BGG A;  3AV9 A;  4CK3 A;  3U9D A;  5AZJ A;  3SYZ A;  3DLR A;  1N5Y A;  4DV0 K;  4YY3 K;  1KAZ A;  4B9V A;  5EU7 A;  3H08 A;  4CJ4 A;  5BRH A;  3DOK A;  1NGB A;  3AAR A;  3H3O B;  3GL1 A;  3AVK A;  4AHS A;  1HX1 A;  4JS4 A;  4CES A;  1E3M A;  1RIL A;  4IEI A;  3I8D A;  3VQP A;  3ZX0 A;  4DU3 A;  3QEI A;  1QQC A;  4OGC A;  4NXN K;  1G99 A;  2P9U B;  4LFB K;  3U9Z A;  4DTR A;  5AQQ A;  3KWI A;  3O3H A;  3OYH A;  4F8R A;  2A1R A;  3OBW A;  4BRC A;  3VA0 A;  4DSK A;  5AQS A;  3PX0 A;  2X6S A;  1SV5 A;  3T1H K;  4FK2 A;  3RWU A;  3O1B A;  1NGF A;  3L3U A;  1UOC A;  3NH1 A;  3ZSR A;  3O9R A;  3SMS A;  4C8M A;  3DXM A;  5J2P A;  4O0J A;  1YTA A;  1WSF A;  4NCG A;  4B1W B;  2HHX A;  1E4G T;  2WBN A;  3ID8 A;  3O9Q A;  4NLB A;  4V19 S;  4OVL A;  4CCH A;  3NF6 A;  4NCB A;  4CEF A;  2GBZ A;  4CEO A;  1TYQ B;  4XIU A;  2E2O A;  2B6A A;  5JVH L;  3QML A;  3I55 N;  1R0A A;  5HRN A;  2P9N B;  3P4I A;  4DTO A;  3LDP A;  3JXU A;  3WQT A;  3SI6 A;  2YHB A;  3WEE B;  4LF6 K;  2GEM A;  4JI6 K;  3MED A;  5HRO A;  4ID1 A;  4E7H A;  5GIP A;  4BR0 A;  3JYT A;  4DFP A;  4DF8 A;  4JKB A;  1NK8 A;  4CD1 A;  3HST B;  1NK6 A;  4B9N A;  5AQY A;  2F4V K;  2VCP A;  3SJH A;  1N6Q A;  4M45 A;  2ZWH A;  1EP4 A;  3QLH A;  4OKK A;  1SAZ A;  4FWM A;  5HRP A;  1S5J A;  3NAE A;  1RT1 A;  1Y64 A;  4FM1 A;  5HRS A;  4IEE A;  4JI7 K;  5FPE A;  3QBW A;  3C65 A;  4EHT A;  3V1O A;  2Q2R A;  1K8A O;  3HVR A;  1K9M O;  3SAH A;  1QZ6 A;  4DTU A;  4KHP K;  3FFK B;  2D0C A;  2Q97 A;  3MDQ A;  1NOZ A;  1ESV A;  1VSL A;  3P39 A;  1SL2 A;  4Z4H A;  2P1J A;  5BR9 A;  3IG1 A;  3U3Y A;  4IDH A;  4MFB A;  1RDC A;  2V7Z A;  2ASP A;  4RW9 A;  2NZT A;  3LZJ A;  2ZE2 A;  3BUZ B;  1BI4 B;  4B9U A;  5AFU H;  2QKB A;  3UKU A;  1M90 O;  3THY A;  1Y97 A;  1JLC A;  2ZJR L;  4PHT X;  1TAU A;  1NKE A;  2RHK A;  4DV6 K;  5C2D A;  1EX4 A;  3QFU A;  2OYQ A;  5HLF A;  4OLA A;  4JNE A;  4RW8 A;  4B9Q A;  3CET A;  2HST A;  2YJE A;  3A5L C;  1NLV A;  1EWQ A;  2P5O A;  3DLG A;  2CGK A;  4DSJ A;  3OY9 A;  4EZ6 A;  3V1R A;  4CEA A;  4FJK A;  5C0Y A;  4JHD A;  3SCX A;  4DV1 K;  3SV4 A;  3AVH A;  4FJJ A;  3Q7B A;  4H5N A;  3OYG A;  2A42 A;  3VA3 A;  4I6M B;  2HW3 A;  2NRX A;  3THW A;  2X74 A;  3E9O A;  3I56 N;  3UIQ A;  2P9P B;  3MEC A;  3T69 A;  4CZG A;  3AGR A;  1NJY A;  3SPY A;  3VTI A;  3HVT A;  1KQS M;  1IG8 A;  3KJV A;  3L3V A;  3C6H A;  5M1K A;  2DFF A;  1L3U A;  3K5M A;  4J8F A;  2YNG A;  1BIS A;  4FJM A;  2A1S A;  2OZS A;  4R79 A;  3C7N B;  5LY3 A;  4B9S A;  3ZET B;  2YHW A;  1IBL K;  4LF8 K;  4O5F A;  4RW4 A;  3TSU A;  3CYM A;  1JKH A;  3QIP A;  1NK9 A;  2VQF K;  3FGU A;  3HZ6 A;  5FPD A;  3A5O C;  3CHW A;  3H45 C;  3EKU A;  4IXC A;  2O8E B;  1KFS A;  1HMV A;  3L2Q A;  5AQF A;  1CZB A;  2B4J A;  1Z6R A;  1OH6 A;  1U4B A;  3F9M A;  5CYM A;  3ZSX A;  1J5O A;  5B8H A;  4FJ9 A;  3K5O A;  3NVM A;  1FW6 A;  3CD6 N;  4YDU C;  4XH4 A;  4CHP A;  3VGK A;  2NRR A;  2J4R A;  4CEB A;  2XY8 A;  5AQJ A;  4J2B A;  4AIL C;  1YJ9 N;  4CI6 A;  4FXD A;  4JI3 K;  2ZD1 A;  3PIP L;  4FZX C;  3KLG A;  2V52 B;  2FSK A;  1U45 A;  3TAR A;  3FZH A;  5EY4 A;  3WUH A;  3NF7 A;  3KKR A;  1RGI A;  4GNI A;  4KI4 A;  5F2R A;  1K8K A;  4N76 A;  1RNH A;  2E1Z A;  1KTQ A;  3QEW A;  4WYB A;  1ASW A;  4PL7 A;  3H46 O;  3KK2 A;  1VQ6 N;  4Q0B A;  1RTD A;  4FZZ A;  4LC9 B;  1F21 A;  4KH5 A;  4JYA K;  4HTU A;  3MWP A;  3P38 A;  3CFO A;  4JK9 A;  4CGF A;  4CZK A;  4DSF A;  1HNI A;  3ZX2 A;  4FK4 A;  1KVC A;  3GOI A;  1OKJ A;  1ASU A;  1LOT B;  2OTL N;  2WOM A;  2HHT A;  4E1J A;  4RTF D;  3M3Z A;  5C24 A;  1HR0 K;  4B3M K;  1VQP N;  1FXX A;  3I8B A;  4JI4 K;  1IKX A;  3KTQ A;  2HBJ A;  4DFK A;  4PL8 A;  4JS5 A;  4DR7 K;  4ICL A;  2NRW A;  4CJU A;  3EL2 A;  1IBM K;  3KLF A;  1VQ9 N;  1IKW A;  3O4Q A;  1T8E A;  1MDU B;  3ZSY A;  5LJV A;  3QER A;  4F4K A;  2ZGY A;  2QA4 N;  4W5Q A;  1KLM A;  4IOX A;  4Z4F A;  2UXC K;  4BY9 C;  2HOE A;  3O4W A;  1JXE A;  4CHO A;  3EY1 A;  1U49 A;  3O1W A;  4CFB A;  1RT2 A;  4PY5 A;  2A3Z A;  3THX A;  1TV6 A;  4FPA A;  3OYA A;  1X9W A;  5EVZ A;  4FWS A;  1U47 A;  4ILJ A;  4LF7 K;  2CH5 A;  4Y1C A;  3O9U A;  3ZT3 A;  3EYZ A;  3CCE N;  3VEZ A;  3DLK A;  1VSJ A;  4JAX A;  3CCQ N;  1S1W A;  5BRE A;  4PKI A;  2IOC A;  3VEN A;  3ZEU B;  4BQL A;  1RT3 A;  4X62 K;  2DPN A;  3D2E A;  5C2F A;  1JXB A;  4G1Q A;  3TTC A;  3V4I A;  1L3S A;  4CIG A;  4CFD A;  1NMN A;  3GDQ A;  2FF3 B;  4MDB A;  3DLL L;  4BRO A;  4FCY A;  4BRK A;  3ZSV A;  3LAN A;  4EP5 A;  2P5G A;  2CGJ A;  1VSD A;  3LDL A;  5AQK A;  1J54 A;  1QVF M;  4HVJ A;  5M1Q A;  4BRP A;  4KPY A;  1NKC A;  4B3O A;  5J1E A;  2WC9 A;  4BVP A;  4CJP A;  4FJ8 A;  3TTD A;  1RDW X;  1YJN N;  3HPO A;  2YHX A;  3VQ4 A;  3VF4 A;  4E0D A;  2E2N A;  4RW6 A;  1YF5 L;  4JRQ A;  1C1C A;  1T3V A;  4QCL A;  1TUY A;  3L0Q A;  3DMJ A;  3AO5 A;  4A57 A;  1OVY A;  2G8K A;  4BRL A;  3VER A;  4RW7 A;  2KFZ A;  1KVB A;  1VQ7 N;  3HJF A;  3P83 D;  1VSI A;  2KZM A;  1NKB A;  2QWP A;  3A5M C;  5KQD A;  1HNZ K;  4KHU A;  3MAQ A;  4BDZ A;  4FJ5 A;  4MO4 A;  4I2P A;  1BDG A;  1BL3 A;  5BRD A;  1YIJ N;  3EZW A;  5JIC A;  3CCR N;  3OYI A;  3AVA A;  1YVN A;  1Z05 A;  3DJC A;  3MWT A;  5JLH A;  4YFU A;  4FOI A;  1YIT N;  1BQM A;  4B9T A;  1BG3 A;  3MN7 A;  1T7P A;  3AVL A;  3KWG A;  2WTU A;  1WSJ A;  2VQE K;  4CJF A;  3NE6 A;  3VMF B;  3KD1 E;  1TGO A;  3KLE A;  2KZZ A;  3EE9 A;  5IWA K;  4GKJ K;  1UWB A;  3A2F A;  2JWK A;  2ASM A;  1BU6 O;  1VQO N;  3CJ9 A;  2E5L K;  4JD2 B;  3NH2 A;  2YNH A;  1GLB G;  2P9I B;  3C0B A;  3VQA A;  3FZL A;  3CC4 N;  4DKW A;  1EWR A;  2W6L A;  2HB5 A;  4B9L A;  1WUA A;  3UKR B;  5AZI A;  3SAG A;  4AH9 A;  2DY4 A;  1TKD A;  1YXQ A;  2IVP A;  5D3G A;  5ADX A;  2Y1J A;  1RTJ A;  3QIN A;  3EE8 A;  3VQ9 A;  2BAN A;  2GV9 A;  5AR0 A;  2Z1H A;  4KHY A;  1KAY A;  4CER A;  3ZLJ A;  3S3O A;  5AQR A;  3ULE A;  3A8Y A;  4WQ4 A;  3RSE A;  2E20 A;  3VQ8 A;  4DHY A;  2HBM A;  3RR8 A;  4FJH A;  2BDP A;  2HND A;  2VGM A;  2ZM6 K;  3PV8 A;  1TVR A;  1Q81 O;  2XY7 A;  2UU9 K;  5FDL A;  2KQ2 A;  3KIO A;  2PYJ A;  3U3G A;  4JI8 K;  3DLE A;  2D0A A;  3VEX A;  5BN8 A;  4KB0 A;  4O55 A;  4DTP A;  4E19 A;  2F9T A;  1XNR K;  2G8H A;  1VAZ A;  4KFB A;  4W5R A;  2IDO A;  3AVN A;  3AA4 A;  5KRT A;  3K57 A;  3M6G A;  3O3F A;  3DXM B;  3HBT A;  4GVM A;  5KQ8 A;  4DTX A;  4HHT A;  4GW6 A;  1J6Z A;  1Q7Y O;  3LDO A;  3F5T A;  2QWR A;  1ZBF A;  4E7J A;  3R8E A;  1ZBI A;  3BGR A;  5K14 A;  4OPH A;  4ZTF A;  3F2K A;  3C6A A;  3QNO A;  4DCH A;  4W5N A;  3AVG A;  4XH1 A;  2EWS A;  4BRD A;  4IFE A;  2RF2 A;  2HHQ A;  3WNH A;  4LSL A;  3O9T A;  3A5N C;  3D0P A;  4OKJ A;  4H0P A;  3FZF A;  2QXL A;  1RDB A;  5KTQ A;  4FJG A;  4JV5 K;  2IVN A;  1XC9 A;  1KAX A;  3WNG A;  5EXW A;  3MXM A;  5M1F A;  1GOA A;  4E89 A;  2GEL A;  3S3N A;  1S9G A;  1XI1 A;  3NF9 A;  4K43 A;  3O80 A;  2UXB K;  1HNW K;  4FM2 A;  4BAC A;  3P5J A;  3WNF A;  4AM6 A;  2QWM A;  1YI2 N;  2O8B A; 
#chains in the Genus database with same CATH homology
 4DV5 K;  4DR1 K;  2HHH K;  4DR4 K;  4DR6 K;  3JAM O;  4DUY K;  4DUZ K;  1HNX K;  4V19 S;  4JYA K;  4DV1 K;  3J7A P;  2ZM6 K;  4X65 K;  2UU9 K;  1I94 K;  5LMN K;  1N36 K;  4JI8 K;  5A2Q O;  4DV3 K;  3OTO K;  4LF6 K;  1HR0 K;  4B3M K;  4JI6 K;  2UXD K;  4JI4 K;  4B3R K;  4JI5 K;  1IBK K;  3J7Y P;  1XNR K;  4X64 K;  4JI0 K;  1HNZ K;  4DR7 K;  1IBM K;  2F4V K;  4JI2 K;  4DR2 K;  4LFA K;  1IBL K;  4LF8 K;  4LF5 K;  1FJG K;  4CW7 B;  2UUC K;  5LL6 Z;  2VQF K;  4YHH K;  1XMQ K;  2UUB K;  4JI7 K;  2UXC K;  5FLX O;  4B3S K;  2VQE K;  4DV0 K;  4YY3 K;  4DR5 K;  4NXM K;  4K0K K;  4DV2 K;  4X66 K;  4LFC K;  1XNQ K;  5IWA K;  4GKJ K;  4DV7 K;  4KHP K;  4JI1 K;  5LMU K;  4LF7 K;  4DR3 K;  1XMO K;  4NXN K;  4B3T K;  2E5L K;  1N33 K;  4LFB K;  4LF9 K;  2UUA K;  4DV4 K;  4JV5 K;  4OX9 K;  4X62 K;  4JI3 K;  5IT9 O;  3J80 O;  1N34 K;  4GKK K;  1J5E K;  4AQY K;  4LF4 K;  3T1H K;  2UXB K;  1N32 K;  4DV6 K;  4CVN E;  3J81 O;  3T1Y K;  5AJ3 K;  1HNW K;  5BR8 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...