4JI6K

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
116
structure length
116
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 28
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4ji6K00
4LF9K 4CVNE 4DR2K 4DV5K 2ZM6K 4OX9K 4B3MK 2UU9K 1HR0K 4DV7K 4YHHK 3J80O 4B3TK 5BR8K 5A2QO 4LF6K 1HNWK 4X62K 1IBMK 4DR7K 4DV2K 1N36K 1HNXK 5LMNK 4LF4K 1XNQK 4GKKK 2UXCK 4JI5K 3T1HK 1J5EK 5LL6Z 4DUYK 4DV4K 2UUAK 1IBLK 4DV1K 2UUBK 4LF8K 1N32K 4JI3K 4JI1K 4NXNK 2VQEK 1N34K 3J81O 2UXDK 4GKJK 1FJGK 5AJ3K 1I94K 4K0KK 4DR3K 3T1YK 4DV3K 4LFBK 1XNRK 4JI8K 4LFCK 4V19S 4DR4K 2F4VK 4X64K 2HHHK 5LMUK 4LF5K 4X65K 1N33K 3J7YP 4AQYK 4JI6K 4X66K 3J7AP 1HNZK 4DR6K 4LFAK 4JYAK 4DR5K 4DV0K 4DR1K 4JI0K 5IWAK 4B3RK 4LF7K 4NXMK 5IT9O 4JI2K 1XMQK 1XMOK 4JI7K 2UXBK 4KHPK 5FLXO 2VQFK 3JAMO 4YY3K 4DUZK 2E5LK 2UUCK 4JI4K 4DV6K 3OTOK 1IBKK 4CW7B 4B3SK 4JV5K
chains in the Genus database with same CATH superfamily
3IDHA 3SAFA 2HHWA 1Z05A 3UKRB 1G15A 4DV5K 2FLOA 1VQ9N 3QIOA 1J5OA 5EOYA 5AZJB 2IVPA 3LAKA 4BROA 3NVMA 2OCEA 5MLCQ 5BR8K 1U2VA 5T7BA 4G9ZA 3QINA 1FXXA 4CJKA 4PQUA 4E7IA 2ZE2A 4DFPA 3O4QA 4YOTA 3SV3A 5CR4A 2E1YA 4CEDA 2HNYA 3A5OC 4CFDA 3NFAA 1NK9A 3K9KA 3JS6A 1VSEA 4IFEA 2W6LA 3H45C 4F3OA 3GBTA 4DQPA 1HX1A 3KZBA 4GMJB 5FPEA 4CI6A 1Z25A 2NRZA 4IXCA 3ZSQA 1VRUA 4CIGA 4K42A 3CI5A 3OJSA 1RDBA 1IKYA 1NK4A 4K25A 3OYKA 5KPRA 3SUOA 1B92A 1MWMA 3VA0A 1BCOA 4M3UA 4WYBA 3V9SA 3SI6A 4CJ7A 1VSMA 2PFUA 4CEOA 1C0FA 3O9SA 5BRFA 5JICA 5D3GA 3F9MA 3FFKB 1Q82O 1N33K 4IO9L 3CCEN 3MN9A 3PIOL 4DQQA 4JYAK 4BRQA 4IDHA 2NRVA 4KHNA 4EAHD 2YHYA 3BDPA 1M1KO 3IKMA 3HPOA 1XMQK 1HLUA 1BO5O 4NLBA 1KFDA 4BRLA 2YNGA 1HYSA 4IJAA 2KFZA 4BQZA 2GELA 3L0QA 4BVOA 5GAEP 3NF6A 2VG7A 4DG1A 3TAMA 3NGYA 3VN5A 1C0TA 2P9IA 3KLIA 3C6UA 3W3DA 3D2EA 3DAWA 3SMPA 2FSNA 4IEIA 1FW6A 1ATRA 1RDDA 3MMVA 4KB1A 5JMVA 4OX9K 3WNHA 2WTUA 4GVMA 3FGUA 1ZBFA 5FDLA 3VMFB 4BRFA 1ITGA 2QWMA 2H3GX 4N76A 1X3MA 3H6EA 4DV2K 1BA1A 4B1UB 3AVKA 4FJXA 2PYJA 5GIOA 3TAPA 3DOLA 3DWLA 4CZKA 1I3AA 2E20A 3H1VX 1WAJA 2IC3A 2P1JA 3DXKA 3RRGA 2HVHA 4HVJA 4BDYA 1N34K 4KHQA 3K0SA 1KRPA 3LP0A 3C95A 1A5WA 4JRPA 5AJ3K 5KGWA 4KBOA 3IS9A 4CHPA 3HSTB 4H5TA 5EX5A 3G25A 2QEXN 3ID6A 4CGFA 3NH2A 2YHAA 4CZFA 4M63C 3CJBA 4YNQA 4CF9A 3SV4A 3D0PA 1VAZA 5TKYA 3VF6A 5BPNA 5KRSA 1Q86O 1VQNN 2XY7A 2Z1GA 4Z4IA 4KFBA 3KLHA 4DQRA 4CBWA 4EP4A 4X66K 3ZSWA 4KHSA 4I6MB 4KO0A 3WXKA 4YFUA 3EN9A 2WFBA 3I55N 1NGIA 2IS3A 4C8NA 1GLLO 3OYNA 1LV5A 3JSMA 5F0XA 3WUHA 3NF9A 3LDQA 4K43A 3ZYYX 4ID5A 1TKXA 3WT0A 4FJKA 3KKSA 1SL1A 4MLEA 3MEEA 2UUCK 2W42A 1JCEA 4JKGB 1RDUA 2YJEA 4WFBL 1NGAA 4DU3A 3WEEB 3VGLA 4DQ8A 2ITGA 5HRNA 3E9LA 3UKUA 3ZSXA 1U45A 2A1SA 3AA2A 3KLEA 3OYAA 1C0UA 4DV7K 5I3UA 1TYQA 3R9PA 4CZHA 4CHYA 4E1JA 4W5QA 4FYDA 4O4GA 3VQ6A 4CHQA 3EO3A 3QFUA 1JLAA 1HUXA 1VQMN 5JS2A 5C25A 4HCCA 2QTDA 1S1TA 4TSXA 1TYQB 4WQ5C 4DS5A 2WBNA 3HT3A 1DTQA 3CJCA 1LOTB 2ZJPL 1TVRA 1RT5A 2HF4A 1VQ4N 4CD3A 1NK8A 3ZT1A 1JCFA 2VQEK 2D0OA 1X9MA 3DYAA 3ENBA 5EXWA 3RSEB 2UXDK 4CJ4A 2UYTA 4DTOA 2QA4N 4DCHA 1NGHA 2R7YA 1NKEA 3ENHA 4M7YA 4GY2B 3V9UA 4UQGA 3TAEA 4FLYA 4AH9A 1U47A 3OS0A 1KC8O 2OTLN 1CZBA 4E7HA 4GV9A 2GWJA 2FXUA 4CIFA 5CHIA 3VQ8A 2P9UA 3F2KA 4DTXA 1U6ZA 4JI2K 2D1KA 1DGKN 3IRXA 4C8LA 3QEIA 1YJNN 3V81A 3NH1A 1NJZA 3QBWA 4ISEA 4YY3K 1VSFA 4B9SA 3PLAA 3VQ9A 3L3VA 3O5BA 3ALYA 4LSLA 3QLHA 1ASUA 5J1EA 4PWDA 4IFVA 4JKHA 4BR5A 4DKWA 4H0TB 4CERA 3MECA 2GX9A 5EVZA 4OJRA 4CJUA 3WNGA 4DR2K 3EEQA 3I0SA 2FF3B 1TL1A 1NJXA 4M7XA 4YHHK 1F21A 1XUPO 3CFRA 3B6OA 1ZXOA 3RWUA 1HNWK 1D4XA 4YOWA 4N5SA 3SBGA 2DTUA 5SWMA 4H0OA 4N47A 2UXCK 3WXMB 1U2VB 1WAFA 1J5EK 2G8IA 1QZ6A 2P9KB 4PHTX 3O80A 2UUAK 1NU0A 4JKBA 4KPYA 2EWSA 3J7ZO 1SV5A 3I8BA 3PSIA 2BH1A 3DLLL 4KH4A 4CF1A 3O4WA 4EFHA 1WOQA 4IEEA 4JKCA 1VSKA 1HPZA 1OH8A 1RCHA 2IOCA 3HK2A 4Q0BA 1VQ7N 5EY4A 3HM9A 3OYJA 5AQHA 4BGBA 4RW8A 2DFFA 1GLFO 4XH4A 4N56A 1VQ8N 3AA4A 3K9JA 1U4BA 1GLDG 3QBXA 4CGGA 4IFYA 3TSPA 3C94A 1LW2A 1LCUA 3PY8A 3L2QA 4E1NA 3ZEUA 4WF9L 2PAVA 1FKPA 4F3TA 3VTHA 4H4MA 3P39A 5M1FA 3GE1A 3SPZA 3UE5A 3M8SA 5JVHL 4B9TA 2BE2A 1Q18A 1EKEA 2DPNA 1X3NA 2O8CB 2FSKA 4IKFA 4IOAL 3VETA 2GTDA 4BQLA 3LANA 4GVEA 4CE9A 2G8FA 5I42A 3DXMA 3VEOA 3MCAB 4WQ4A 3MN5A 1S9EA 3DOKA 4YOVA 4BC2A 4EZ9A 2E4LA 1VQLN 3DRRA 2VG6A 3KJVA 4YORA 3CJ7A 4W5TA 4WCEL 4LF6K 4CJTA 4C23A 5AQWA 3WXIA 4ISGA 1VSHA 4FK0A 4ILGB 3NE6A 4DB3A 3MEDA 4JI5K 1NMDA 3C7NA 2Y1JA 1RGIA 3NCIA 3KVGA 1SKWA 1T8EA 3ZT4A 2O4IA 2QWNA 3HVRA 3TAFA 3ZT3A 1RTIA 3C0BA 4W5NA 1YIJN 2Q0UA 4CEBA 1NBWA 3NMUA 4BGAA 3DLBA 3UKRA 1VHXA 4B3OA 3L3UA 1FJGK 2WONA 5HRPA 4BRKA 1R0AA 2J4RA 4FWNA 4H0YB 5GAGP 3T1YK 3U3YA 3O3GA 4DQIA 4FLXA 1VQKN 4DFMA 5KPTA 4NCBA 2ASOA 2QWLA 5B8HA 1JCGA 1MA9B 1LAVA 2OPQA 5AQXA 4FJ9A 1P90A 4B08A 2FF6A 5DK5A 3VEWA 5AR0A 1NLVA 3QIPA 3I8DA 4LFAK 4RCHA 4E0DA 3KIOA 3Q7CA 4JKAA 1WLJA 5K14A 3HZ6A 5IWAK 3AO3A 3SK3A 4NXMK 4BC5A 4IG0A 2QKBA 4IG3A 4CK3A 3RMDA 1BU6O 3CC7N 3KLGA 4DF4A 3OYCA 3LWMA 1MU2A 1W9HA 4JS5A 1XHXA 2P9PA 5KI6A 3OYMA 4W5OA 3I33A 4CW7B 3LALA 3U4LA 4O8UA 3CYMA 2NRWA 2GUPA 2ITMA 1IKWA 3S41A 3OYFA 1QSLA 2E2QA 4LD0A 5J2PA 4K8XA 2E6MA 1WBDA 3TU5A 5JLFA 5CZ2A 3KKRA 4BRGA 3CCJN 3J80O 4CZGA 3BUZB 3OBWA 5GIPA 5AQTA 4BACA 2HF3A 4BE1A 1S3XA 1NGBA 4Z0UA 3MWTA 3SMSA 3HVTA 5LMNK 4FM2A 1HNVA 4LF4K 1ZYQA 2YHWA 4BR2A 1X9SA 4B1VA 2P9NA 1TGOA 4LH5A 3DJCA 3O9TA 4DSEA 4H4OA 3THXB 4RW6A 1HQEA 2QI2A 4BWMA 4M41A 3VTIA 5C12A 4GNIA 1WSIA 2XY5A 1ATNA 3WQTA 4FJ5A 3BGRA 4U67L 4MDAA 3ITHA 5AZIA 4R5PA 5FPDA 3IUCA 3VGMA 3TARA 3CF5L 3U6FA 1S1UA 1TK0A 1NGGA 4M3TA 1JKHA 1HYVA 1RDCA 3CIPA 2V51B 3W0LA 4Z4FA 4B9LA 4C8OA 3M6GA 2W6KA 3VF4A 1X9JA 1DEJA 2F96A 2FC0A 5LJWA 2I5JA 4KI6A 4YDUC 4HUFA 3SQ0A 4LF5K 3U9ZA 4CESA 3NF8A 4FJGA 3HRGA 3HSCA 1YHQN 4NB4A 4JK9A 2B6AA 2OANA 2QW9A 3H08A 4H0VB 2PZSA 5CE3A 1QE1A 2V7ZA 2P5OA 2HHTA 3WXLA 3E1YA 1T05A 4FLVA 2HBKA 3ISNC 4YOUA 3OVNA 2GBZA 3BP8A 1S1XA 4AHTA 4FM0A 3DLHA 4I2PA 2GEMA 2HW3A 2F7TA 4Q5VA 1IG9A 1JLQA 3N4QA 1YXQA 1WSHA 2Z1IA 3MEGA 4DV6K 5TKWA 3VQQA 4BRMA 3KK1A 2ZWHA 1XC9A 4CHOA 3JXUA 2V52B 2DFHA 3GL1A 2IAJA 1D9FA 4XH5A 2BDPA 3OBYA 3RVCA 1TK5A 2NRHA 2YX6A 3M8QA 1Q9XA 3MX5A 1XI1A 1VSLA 4DR7K 3FR0A 2A40A 1N36K 4OKKA 1TK8A 5C2DA 1T6CA 4FWSA 1BIZA 3KLFA 5GAHP 3CC2N 4Z94A 3OYDA 1L3VA 4DHYA 1IKVA 4C1NI 5HRRA 2AA4A 2ZGYA 3SLCA 3AVCA 4DFJA 2QM1A 4LF8K 4DU1A 1BI4A 3CCLN 1I39A 4FK4A 4NLCA 4I9LA 4I9QA 3JYTA 3D2FA 3MX2A 1S6PA 1YVNA 4GV3A 5HOOA 1RT4A 2VWBA 3WXJA 4EHUA 1BL3A 2YNFA 3AVHA 5AFUH 5CYMA 2Q1NA 4DR4K 2CGLA 4X64K 1ATSA 3NAEA 4PKGA 3VOVA 4IO8A 3HYFA 1KCFA 3LZJA 3S3OA 1BWFO 3AGRA 4BWJA 4F2RA 4KH6A 5E84A 4JI6K 1WSEA 3HJFA 1X1PA 4DSFA 3CFOA 2KZZA 3QEVA 2O8EB 3ULDA 4FM1A 4I7FA 3RMCA 2P9IB 3LWLA 5AQQA 1RBVA 3Q7BA 3NH0A 1V4SA 4FWRA 3THYA 4FWOA 4B9UA 3FZKA 3GDQA 3BZCA 3P38A 3CM6A 3R8EA 3THXA 1W97L 4IOCL 1YF5L 4FOEA 2P9NB 1K8KA 5AQUA 2P9KA 5CZ1A 1V4TA 3S9HA 1K9MO 3OTOK 1N8RO 3TAGA 4F9OA 4BDPA 1B9DA 4AF1A 3A2FA 5AQOA 4CHNA 3O3HA 2ZJQL 4RW4A 4BVPA 4B8CA 3AO4A 4H5NA 3HP9A 3THVA 4CJSA 3CG7A 3PO5A 4GV6A 2BUPA 3V9WA 1LWFA 3HOTA 4FVUA 4BG9A 4BE2A 1A5VA 3DXMB 1BI4B 3VESA 1MDUB 3NGZA 1TV6A 4DFKA 2CH5A 2IIRA 4CJPA 4NXNK 4ISFA 5BN8A 2O8CA 1CZ9A 3BY5A 5KTQA 1R59O 2HNZA 3C6HA 3G71N 3C7NB 2HHUA 4BRPA 4KTZA 2A5XA 4KHUA 4CHZA 1SZ2A 1TAUA 1J6ZA 2PBDA 1N6QA 3CCQN 3ZSRA 1KAXA 4V19S 3CMAN 3SAGA 4WQ5A 1VRTA 4IBNA 5FRNA 2RE2A 3QFPA 1QQOA 2JGUA 3CC4N 3EYZA 3QERA 1D9DA 4NYFA 4L3QA 1L5UA 3ENOA 3U3GA 2F9WA 1REVA 1CXUA 3B8AX 4Z4GA 5AQJA 5M1QA 1FKOA 4DR1K 1NJYA 5C24A 3CCSN 3TR8A 3A5MC 4FLZA 2FBYA 1HPMA 3OYGA 3QICA 5HP1A 3TPQA 4HTUA 4IJNA 2DY4A 1KXPA 3DXKB 3HL8A 2HOEA 3HBTA 4FZYA 1RILA 4E7JA 2RN2A 4W5RA 3O9UA 1JL1A 3CJ1A 1YI2N 1QVFM 4B9QA 3HM8A 5BRHA 3LDNA 2BANA 3TANA 4CK1A 1QZ5A 2X6NA 2ASMA 4AM7A 4LSNA 4BR9A 1HKGA 3VQ5A 4CVNE 4BRNA 4LF9K 2GWKA 3BF1A 1NGDA 4CJWA 1BIUA 3I0RA 2VWKA 3BEXA 1W7AA 1GLBG 3RR7A 2QK9A 3LAMA 1WBBA 2A1RA 1XNQK 4FWPA 2AJQA 3T1HK 4FJ8A 2HSTA 1ZBSA 4E3SA 3DLEA 2F9TA 4HUEA 1JLBA 3ULEB 4IWVA 1BA0A 4DLGA 3EZ5A 1WUAA 4BDZA 3B6PA 4UY8O 2D4WA 1IV0A 3CQ8A 4B1YB 4KTWA 2G8WA 2Q31A 2XO7A 1NGCA 1NOZA 3QEWA 3THWA 1KAZA 2B4JA 3ZX0A 1QHAA 4QAGA 3N4PA 1WSFA 4LFCK 2NRTA 4JLHA 3IG1A 1Q7YO 3O9QA 1DLOA 3AA5X 3OYHA 4BC4A 3CCMN 4H5VA 4X65K 3ULEA 3V6DA 1A5XA 3D2EB 3G10A 2KLAA 3FZLA 4CFAA 5J2MA 3CCUN 4FLUA 1S9GA 4DV0K 2WUSA 4PA1A 3LDOA 3RMBA 5BREA 4CGHA 4CBXA 4F8RA 5C10A 1M90O 5E26A 4BRHA 4RW7A 3SUQA 3IMXA 3L2UA 1BGXT 1YAGA 3MDQA 3EY1A 3CFPA 4HWIA 3JAMO 4A62A 4NO7A 1ZBUA 5AQSA 2Z1HA 2YNHA 5SZTA 1IBKK 3SAHA 1SL2A 1KSPA 4ILJA 2QXLA 2YI1A 3MK6A 2ASPA 3BF3A 3ATVA 5AQVA 5LY3A 4CEZA 4M3ZA 4HUGA 1HNIA 3ZCMA 3AGKA 2ZM6K 2A41A 3H3NO 4J2AA 2UU9K 1HR0K 1W0HA 1LWCA 3NHGA 1UA0A 3PIPL 1XHZA 5A2QO 4NCAA 4FPBA 3DLKA 4QOZB 3T7ZA 1Z26A 4FWQA 4GKKK 4MO4A 3J8AA 3ZLJA 5HBMA 1K6YA 2W41A 4EIAA 1QQMA 2YHBA 4FOIA 3UB5A 3AVNA 4DV1K 3ZT2A 2OPPA 4Y1DA 4FLWA 3GG4A 4FW1A 3ZETB 3J81O 4H5WA 3HXMA 4QS9A 4FJJA 5CY4A 2O8BB 2E1ZA 1VSDA 3CCVN 1RTJA 1DKGD 4JK7A 5C0YA 2D0BA 3VA3A 3QEXA 4HCBA 4IDKA 3OW2M 4DTUA 5KGXA 2E2NA 5AZJA 4AHRA 3MAQA 3NBPA 4OKJA 4H5RA 4OGEA 4DTSA 4WFNL 3VQ7A 3HTVA 1RBSA 3O6WA 3ZT0A 1HKBA 3C6TA 1WSJA 4JKGA 1RBTA 3AO5A 4HTLA 3P83D 1C0MA 4JNEA 1ZBLA 3M3ZA 3LPUA 1XWLA 4EZ6A 3O1WA 2D0CA 3AO1A 1VK0A 1RBRA 1RTDA 1ILYA 5H1SQ 5HL7L 3M1FA 4CJ5A 4DWIA 4BC3A 3KK2A 4IZ9A 4JI4K 1RFQA 4BR4A 1UAXA 3P4IA 4B3SK 1U04A 4CJRA 3AAPA 4M45A 3KD5E 1NJIO 3QEPA 1SAZA 1EP4A 1Y97A 2JWKA 1HMVA 4MDBA 4FJLA 3D45A 4KB0A 1JL2A 2RPIA 2WC9A 4PL7A 4J2BA 3ZSVA 2G8VA 2Q36A 3H1QA 3MWPA 1G99A 3O4NA 1IBMK 1IJJA 1C1CA 2HBLA 3CHWA 1GOAA 3EE9A 3A0IX 4OPHA 4E7LA 1ASVA 2QXFA 2O8EA 3S3MA 3K57A 4B1ZA 2X74A 4A5AA 3IFRA 4DUYK 4LC9B 3CJAA 3RMAA 1VQ5N 3FZMA 2OZMA 1IBLK 2RF2A 2IDOA 3GOIA 3DM2A 2NLXA 3G0ZA 3NGIA 4KTQA 2CGJA 5HROA 1X9WA 3OYEA 1NM1A 3NDKA 3THWB 4KI4A 4DR3K 3SPYA 4AHUA 2F8TA 3SJHA 3K5OA 2I7NA 3A8YA 3K2PA 3FFIA 3PUFA 5F2RA 3AO2A 1QHTA 3KWGA 3MXIA 4DMNA 1O1WA 3O3FA 1FK9A 3SQ4A 1EWRA 1RT1A 1T6DA 1HRHA 4B8AB 3KHYA 1YITN 5LMUK 3EKSA 3V1QA 1VQPN 3FZFA 4ELUA 2HHQA 1E3MA 5CYQA 4OVLA 4A57A 5AQPA 2FBXA 4E7KA 2EHGA 3MN6A 4CEQA 1D5AA 4OGCA 3K59A 3E66A 4YOYA 2ATQA 5BR9A 1K73O 1ESVA 4RG8A 1KD1O 4ZHRA 5ADXA 3SNNA 2RHKA 3KWIA 3NF7A 4FWMA 3VPZA 4PKIA 4AM6A 4JI7K 2KFNA 4YDUA 1E4GT 2P9SB 5FLXO 4JEPA 2EX3A 1SQKA 1UWBA 4CF2A 3WNEA 2P9LA 3OYIA 3P1GA 3SBTA 1S5JA 4CEFA 3LM2A 4CF0A 2DFEA 4AHVA 4KHYA 3AVMA 2YV0X 4DSKA 3QDKA 4RTFD 3VQ4A 1Z6RA 5E41A 3LP1A 3U9DA 1JLFA 4FJ7A 4X62K 3A5NC 3SUPA 2NRRA 1L3TA 1BHLA 3LP2A 4JN4A 4O5FA 1LWEA 4CK2A 1QQCA 3HOSA 4CD1A 4QS8A 4DTJA 3AARA 4OO1J 5M1OA 3V4IA 1HJOA 3CXCM 3RRHA 4DV4K 2UUBK 4FZZA 1HQUA 4H0XB 1KAYA 4JI1K 4AHSA 2E2PA 1RT3A 4KH5A 2QWOA 2OZSA 3SZ2A 4FLTA 1XQSC 2F8SA 4DSIA 1TKTA 2ZGZA 2QWPA 2XY6A 4CF8A 4A61A 1GLAG 3VQEA 4Y1CA 2VWJA 1S1VA 3LP3A 2HBJA 4JKFA 1K8KB 4NYNA 4H8KA 5ELZA 4PUOA 2ETJA 5M1KA 1KVBA 4K8ZA 2HMPA 4DTPA 2XRIA 3CQYA 3ZSOA 2X6SA 4CFBA 3WEEA 1TUUA 1YJWN 5AQMA 1VSJA 4DTNA 1MWKA 1HNZK 3J7AP 2XHBA 3PO4A 2O8DA 1QS4A 3EE8A 2NNWA 1RTHA 1YVUA 4KKOA 3G6EN 1RDAA 3WQUA 2YCHA 2P5GA 3TTFA 4J2DA 1T03A 1P8ZA 5KQ8A 4O0IA 4BRDA 3HPHA 4CGIA 4FXDA 4FVMA 5AQIA 4HHTA 1ASWA 5AQLA 1C0GA 3C65A 5LJVA 2UXBK 3CETA 1JXBA 3K5NA 4JD2B 4CJVA 1T7PA 4JKDA 4CCHA 3AVBA 4KRFA 2HVIA 3M5RA 3LM9A 1DT9A 1L3UA 3AVAA 3AVIA 3H3OB 3SQ2A 4O8KA 4DTMA 5JLHA 4K41A 1TUYA 4C8KA 2Q2RA 2NRXA 3DLRA 1NK6A 4LY7A 4BR0A 1S6QA 1NKCA 3CM5A 3MN7A 3THYB 3R1XA 4E19A 2Z1JA 2QKKA 3AVGA 2X78A 3KK3A 3L2WA 3K5MA 4RWTA 4WE1A 4JHDB 2Y1IA 2AP1A 3LL3A 3K5LA 2YKNA 1RT7A 4CECA 4R79A 1KLNA 4BRCA 3KK7A 2GV9A 4JI3K 4FJIA 1IH7A 5I9EB 4FJNA 4QS7A 3DLGA 4Z4EA 4EP5A 2KTQA 2YJFA 4BE0A 4GKJK 3VEYA 5KRTA 2VYPA 4DF8A 4DSJA 1YT3A 2HNDA 1NMNA 1HJRA 5DM7L 1KVAA 5ADXH 1OH5A 3ZSYA 4FZXC 2VCPA 3ATUA 3L4IA 3D2FB 3SUNA 1Q9YA 3OYBA 3VQCA 3VEZA 4LFBK 3UIQA 2LSNA 1XNRK 3LDPA 2KHOA 4OLAA 1U48A 3QETA 1C6VA 1GOBA 4CZEA 3RTVA 1IKXA 3AVLA 4XIUA 3P5JA 2BGGA 2G8UA 1NGJA 4L8RB 2YHXA 3T69A 3L8BA 1YJ9N 3VF2A 3CJ9A 2A6AA 1OVQA 3CQXA 3AAQA 1SL0A 3QMLA 3PSFA 2OTJN 4WFAL 1UA1A 4LF7K 1XC3A 2I7PA 3HO1A 1VQ6N 4QCLA 3A5LC 3K58A 3MCPA 3ZSZA 5C42A 1OH6A 4O0JA 4YOXA 1WNSA 3KD1E 3FE1A 1HKCA 1UOCA 1WN7A 4DUZK 2E5LK 5DM6L 4BRIA 4BRAA 3O08A 1RNHA 2FBTA 2G8HA 1RT2A 4OKEA 5AZIB 4ID1A 2IVNA 1RDWX 5AFUA 4KV8A 3VQDA 4CZLA 3AVJA 5AQFA 4I2QA 3TSUA 4B3MK 1BCMA 3LDSA 3OJUA 3M8RA 1NWKA 3TTDA 5FROA 4DTRA 2PY5A 4H0PA 1CZAN 3DRPA 4MQ3A 5J2NA 4DSLA 5KQDA 1J54A 3T1AA 3TWHA 5J2QA 4DLEA 3TTCA 4MLHA 3F9KA 2Q97A 1CXQA 3G4SN 4CJ3A 1BQNA 2B5JA 4BG8A 1QTMA 3F5TA 3WNFA 4EHTA 2OPSA 3DMJA 1KLMA 2KQ2A 4A2BA 3QNNA 4WQ4C 2NUBA 4K0KK 3QNOA 2ZF5O 4DV3K 2P9PB 1JJ2M 4JI8K 4FW2A 1NNEA 4B9MA 4BREA 2F4VK 1RBUA 4M42A 4Z4HA 1EX4A 2VG5A 3DI6A 2HMIA 4CIEA 2HHHK 1QQNA 3HI0A 3VQBA 2KW4A 5AQYA 3R6MA 4M3XA 3MXMA 1B9FA 3LPTA 4JAXA 3OYLA 4CZJA 4DR6K 1JLGA 2Q3SA 2IGIA 4DS4A 4DR5K 2E6LA 4A2AA 2OA8A 1W2BM 1S1WA 2OYQA 1BISA 3PX6A 4B3RK 4B1XB 1Q81O 2HHSA 5JVGL 4F4KA 5IT9O 4FL9A 3RR8A 2FSJA 1EO1A 3ZX2A 5JS1A 1SKRA 4CJLA 2QWQA 3BZKA 3VGKA 3L6QA 4C8MA 2XY8A 1NGEA 4GW6A 4OLBA 1BOTO 4O5BA 1ZBIA 5GINA 1KVCA 3OHRA 2RKIA 4CFCA 2YNIA 5AQZA 1QVGM 4H03B 5AQRA 1QSSA 2O8FB 1D8YA 3L2VA 3PX4A 2HBMA 4FJHA 1GLJO 4O44A 1LAWA 2O8FA 4AILC 2ZQBA 1NKBA 2OPRA 1C1AA 1IG8A 1T3VA 3FLCO 3EL2A 1HNXK 2VGNA 4O55A 4CJFA 5HRSA 2CGKA 4FWKA 4OPKA 1L3SA 3DRSA 3SJJA 4DQSA 4CJEA 1E4FT 4IOXA 4JD2A 1J53A 3F73A 2A3ZA 3FZHA 4DU4A 3PV8A 3OS2A 1NK5A 1VSIA 4B1WB 4CZIA 1BG3A 4ILHA 3SQ1A 2P9SA 1SS6A 3CERA 3V1RA 1TKDA 3QESA 1VQON 5F1XA 1IO2A 4JK8A 1DTTA 3UKUB 3QO9A 4C1NK 1YTUA 2O8DB 4Y0WA 1I94K 4E1MA 1OVYA 1J9AA 3I56N 2WOMA 4CJQA 1U49A 4KREA 4G1QA 3EKUA 4F2SA 1O13A 3RSEA 3P31A 4PY5A 2NZTA 3VQAA 4FK2A 1ZBHA 1BQMA 1YUWA 2O4GA 3ASMA 1NK0A 1GOCA 3R3LA 3TABA 1EWQA 1YTAA 4OPAA 3CPWM 3J7YP 3EZWA 1NOYA 1KFSA 1EETA 4FCYA 4XEIA 1NG9A 2V7YA 2PYLA 4J8FA 5FRMA 3ZEUB 2Q0RA 3HPGA 5AQNA 4J2EA 1GLCG 5KPZA 1QSYA 4CEEA 4CGDA 1NK7A 1KTQA 4CGJA 5BPMA 1XMOK 1LW0A 1C1BA 1N5YA 3ZX3A 1BUPA 1GLEG 1OKJA 3CPEA 4M3WA 2YKMA 2VQFK 3O1BA 5FPMA 2A42A 1EXQA 2W40A 4B9VA 4N41A 1HYZA 5M1NA 3SYZA 5BN9A 3CMEN 1SUQA 3ID8A 4BR7A 2VGMA 1H1VA 1KQSM 4KAZA 4A59A 1S22A 4ZTJA 5HLFA 4OPJA 3V1OA 3OA9A 4ZTFA 1Q8IA 3U8XA 3V9ZA 3VEVA 1SKSA 3S3NA 4ELVA 5GADP 2E8AA 4MFBA 1S72N 2E88A 3VERA 3KTQA 4PKHA 4B3TK 3T3FA 2HHXA 1BDGA 2BTFA 3QB0A 4CZMA 2G8KA 5AQGA 4JRQA 2HB5A 2P9LB 5BPLA 3AA3A 3AVFA 4AHCA 4I6MA 4M3RA 2P9UB 5LL6Z 3TI0A 5EU7A 5BRDA 4FO0A 4LH4A 1OH7A 1N32K 4Z4CA 3VEXA 2KZMA 3CD6N 2E2OA 2JLEA 2P51A 1NJWA 4CBUA 3HP6A 3D7EO 3NVKA 2KKZA 4JHDA 4ICLA 3H46O 1CLQA 3AY9A 4XH1A 3MXJA 2QWRA 4PL8A 5AQKA 4JKEA 3LZIA 3SCXA 4FSVA 4NCGA 1RT6A 1ZC6A 4A5BA 1JLEA 3OS1A 3OY9A 1K8AO 3IAYA 5M1PA 4FPAA 1NGFA 1TKZA 3CCRN 1JXEA 2D0PA 4M3YA 5DMRA 5C15A 4KHWA 4JS4A 3TAQA 3C6AA 3AV9A 3E9PA 1EQYA 3E01A 4AQYK 3L2RA 3PX0A 3O9RA 2JWLA 4U7BA 3E9OA 4RW9A 1TL3A 3O8MA 2D0AA 1WB9A 4BY9C 4JI0K 5C2FA 4FJMA 2IVOA 2O8BA 4FWLA 1WSGA 4MO5A 4B9NA 2GUIA 3ZETA 3V9XA 2CH6A 1JLCA 3LDLA 3TSQA 3VQPA 4KHPK 4E89A 2D5RA 5FPNA 2ZD1A 4CEAA 1Y64A 1TAQA 2HHVA 2FBVA 1T44A 3T19A 3L4QA 3M8PA 4JV5K 3D6RA 4ELTA 3VENA 2ZJRL
chains in the Genus database with same CATH topology
4LF9K 4CVNE 4DR2K 4DV5K 2ZM6K 4OX9K 4B3MK 2UU9K 1HR0K 4DV7K 4YHHK 3J80O 4B3TK 5BR8K 5A2QO 4LF6K 1HNWK 4X62K 1IBMK 4DR7K 4DV2K 1N36K 1HNXK 5LMNK 4LF4K 1XNQK 4GKKK 2UXCK 4JI5K 3T1HK 1J5EK 5LL6Z 4DUYK 4DV4K 2UUAK 1IBLK 4DV1K 2UUBK 4LF8K 1N32K 4JI3K 4JI1K 4NXNK 2VQEK 1N34K 3J81O 2UXDK 4GKJK 1FJGK 5AJ3K 1I94K 4K0KK 4DR3K 3T1YK 4DV3K 4LFBK 1XNRK 4JI8K 4LFCK 4V19S 4DR4K 2F4VK 4X64K 2HHHK 5LMUK 4LF5K 4X65K 1N33K 3J7YP 4AQYK 4JI6K 4X66K 3J7AP 1HNZK 4DR6K 4LFAK 4JYAK 4DR5K 4DV0K 4DR1K 4JI0K 5IWAK 4B3RK 4LF7K 4NXMK 5IT9O 4JI2K 1XMQK 1XMOK 4JI7K 2UXBK 4KHPK 5FLXO 2VQFK 3JAMO 4YY3K 4DUZK 2E5LK 2UUCK 4JI4K 4DV6K 3OTOK 1IBKK 4CW7B 4B3SK 4JV5K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF9 K;  4CVN E;  4DR2 K;  4DV5 K;  2ZM6 K;  4OX9 K;  4B3M K;  2UU9 K;  1HR0 K;  4DV7 K;  4YHH K;  3J80 O;  4B3T K;  5BR8 K;  5A2Q O;  4LF6 K;  1HNW K;  4X62 K;  1IBM K;  4DR7 K;  4DV2 K;  1N36 K;  1HNX K;  5LMN K;  4LF4 K;  1XNQ K;  4GKK K;  2UXC K;  4JI5 K;  3T1H K;  1J5E K;  5LL6 Z;  4DUY K;  4DV4 K;  2UUA K;  1IBL K;  4DV1 K;  2UUB K;  4LF8 K;  1N32 K;  4JI3 K;  4JI1 K;  4NXN K;  2VQE K;  1N34 K;  3J81 O;  2UXD K;  4GKJ K;  1FJG K;  5AJ3 K;  1I94 K;  4K0K K;  4DR3 K;  3T1Y K;  4DV3 K;  4LFB K;  1XNR K;  4JI8 K;  4LFC K;  4V19 S;  4DR4 K;  2F4V K;  4X64 K;  2HHH K;  5LMU K;  4LF5 K;  4X65 K;  1N33 K;  3J7Y P;  4AQY K;  4JI6 K;  4X66 K;  3J7A P;  1HNZ K;  4DR6 K;  4LFA K;  4JYA K;  4DR5 K;  4DV0 K;  4DR1 K;  4JI0 K;  5IWA K;  4B3R K;  4LF7 K;  4NXM K;  5IT9 O;  4JI2 K;  1XMQ K;  1XMO K;  4JI7 K;  2UXB K;  4KHP K;  5FLX O;  2VQF K;  3JAM O;  4YY3 K;  4DUZ K;  2E5L K;  2UUC K;  4JI4 K;  4DV6 K;  3OTO K;  1IBK K;  4CW7 B;  4B3S K;  4JV5 K; 
#chains in the Genus database with same CATH topology
 3IDH A;  3SAF A;  2HHW A;  1Z05 A;  3UKR B;  1G15 A;  4DV5 K;  2FLO A;  1VQ9 N;  3QIO A;  1J5O A;  5EOY A;  5AZJ B;  2IVP A;  3LAK A;  4BRO A;  3NVM A;  2OCE A;  5MLC Q;  5BR8 K;  1U2V A;  5T7B A;  4G9Z A;  3QIN A;  1FXX A;  4CJK A;  4PQU A;  4E7I A;  2ZE2 A;  4DFP A;  3O4Q A;  4YOT A;  3SV3 A;  5CR4 A;  2E1Y A;  4CED A;  2HNY A;  3A5O C;  4CFD A;  3NFA A;  1NK9 A;  3K9K A;  3JS6 A;  1VSE A;  4IFE A;  2W6L A;  3H45 C;  4F3O A;  3GBT A;  4DQP A;  1HX1 A;  3KZB A;  4GMJ B;  5FPE A;  4CI6 A;  1Z25 A;  2NRZ A;  4IXC A;  3ZSQ A;  1VRU A;  4CIG A;  4K42 A;  3CI5 A;  3OJS A;  1RDB A;  1IKY A;  1NK4 A;  4K25 A;  3OYK A;  5KPR A;  3SUO A;  1B92 A;  1MWM A;  3VA0 A;  1BCO A;  4M3U A;  4WYB A;  3V9S A;  3SI6 A;  4CJ7 A;  1VSM A;  2PFU A;  4CEO A;  1C0F A;  3O9S A;  5BRF A;  5JIC A;  5D3G A;  3F9M A;  3FFK B;  1Q82 O;  1N33 K;  4IO9 L;  3CCE N;  3MN9 A;  3PIO L;  4DQQ A;  4JYA K;  4BRQ A;  4IDH A;  2NRV A;  4KHN A;  4EAH D;  2YHY A;  3BDP A;  1M1K O;  3IKM A;  3HPO A;  1XMQ K;  1HLU A;  1BO5 O;  4NLB A;  1KFD A;  4BRL A;  2YNG A;  1HYS A;  4IJA A;  2KFZ A;  4BQZ A;  2GEL A;  3L0Q A;  4BVO A;  5GAE P;  3NF6 A;  2VG7 A;  4DG1 A;  3TAM A;  3NGY A;  3VN5 A;  1C0T A;  2P9I A;  3KLI A;  3C6U A;  3W3D A;  3D2E A;  3DAW A;  3SMP A;  2FSN A;  4IEI A;  1FW6 A;  1ATR A;  1RDD A;  3MMV A;  4KB1 A;  5JMV A;  4OX9 K;  3WNH A;  2WTU A;  4GVM A;  3FGU A;  1ZBF A;  5FDL A;  3VMF B;  4BRF A;  1ITG A;  2QWM A;  2H3G X;  4N76 A;  1X3M A;  3H6E A;  4DV2 K;  1BA1 A;  4B1U B;  3AVK A;  4FJX A;  2PYJ A;  5GIO A;  3TAP A;  3DOL A;  3DWL A;  4CZK A;  1I3A A;  2E20 A;  3H1V X;  1WAJ A;  2IC3 A;  2P1J A;  3DXK A;  3RRG A;  2HVH A;  4HVJ A;  4BDY A;  1N34 K;  4KHQ A;  3K0S A;  1KRP A;  3LP0 A;  3C95 A;  1A5W A;  4JRP A;  5AJ3 K;  5KGW A;  4KBO A;  3IS9 A;  4CHP A;  3HST B;  4H5T A;  5EX5 A;  3G25 A;  2QEX N;  3ID6 A;  4CGF A;  3NH2 A;  2YHA A;  4CZF A;  4M63 C;  3CJB A;  4YNQ A;  4CF9 A;  3SV4 A;  3D0P A;  1VAZ A;  5TKY A;  3VF6 A;  5BPN A;  5KRS A;  1Q86 O;  1VQN N;  2XY7 A;  2Z1G A;  4Z4I A;  4KFB A;  3KLH A;  4DQR A;  4CBW A;  4EP4 A;  4X66 K;  3ZSW A;  4KHS A;  4I6M B;  4KO0 A;  3WXK A;  4YFU A;  3EN9 A;  2WFB A;  3I55 N;  1NGI A;  2IS3 A;  4C8N A;  1GLL O;  3OYN A;  1LV5 A;  3JSM A;  5F0X A;  3WUH A;  3NF9 A;  3LDQ A;  4K43 A;  3ZYY X;  4ID5 A;  1TKX A;  3WT0 A;  4FJK A;  3KKS A;  1SL1 A;  4MLE A;  3MEE A;  2UUC K;  2W42 A;  1JCE A;  4JKG B;  1RDU A;  2YJE A;  4WFB L;  1NGA A;  4DU3 A;  3WEE B;  3VGL A;  4DQ8 A;  2ITG A;  5HRN A;  3E9L A;  3UKU A;  3ZSX A;  1U45 A;  2A1S A;  3AA2 A;  3KLE A;  3OYA A;  1C0U A;  4DV7 K;  5I3U A;  1TYQ A;  3R9P A;  4CZH A;  4CHY A;  4E1J A;  4W5Q A;  4FYD A;  4O4G A;  3VQ6 A;  4CHQ A;  3EO3 A;  3QFU A;  1JLA A;  1HUX A;  1VQM N;  5JS2 A;  5C25 A;  4HCC A;  2QTD A;  1S1T A;  4TSX A;  1TYQ B;  4WQ5 C;  4DS5 A;  2WBN A;  3HT3 A;  1DTQ A;  3CJC A;  1LOT B;  2ZJP L;  1TVR A;  1RT5 A;  2HF4 A;  1VQ4 N;  4CD3 A;  1NK8 A;  3ZT1 A;  1JCF A;  2VQE K;  2D0O A;  1X9M A;  3DYA A;  3ENB A;  5EXW A;  3RSE B;  2UXD K;  4CJ4 A;  2UYT A;  4DTO A;  2QA4 N;  4DCH A;  1NGH A;  2R7Y A;  1NKE A;  3ENH A;  4M7Y A;  4GY2 B;  3V9U A;  4UQG A;  3TAE A;  4FLY A;  4AH9 A;  1U47 A;  3OS0 A;  1KC8 O;  2OTL N;  1CZB A;  4E7H A;  4GV9 A;  2GWJ A;  2FXU A;  4CIF A;  5CHI A;  3VQ8 A;  2P9U A;  3F2K A;  4DTX A;  1U6Z A;  4JI2 K;  2D1K A;  1DGK N;  3IRX A;  4C8L A;  3QEI A;  1YJN N;  3V81 A;  3NH1 A;  1NJZ A;  3QBW A;  4ISE A;  4YY3 K;  1VSF A;  4B9S A;  3PLA A;  3VQ9 A;  3L3V A;  3O5B A;  3ALY A;  4LSL A;  3QLH A;  1ASU A;  5J1E A;  4PWD A;  4IFV A;  4JKH A;  4BR5 A;  4DKW A;  4H0T B;  4CER A;  3MEC A;  2GX9 A;  5EVZ A;  4OJR A;  4CJU A;  3WNG A;  4DR2 K;  3EEQ A;  3I0S A;  2FF3 B;  1TL1 A;  1NJX A;  4M7X A;  4YHH K;  1F21 A;  1XUP O;  3CFR A;  3B6O A;  1ZXO A;  3RWU A;  1HNW K;  1D4X A;  4YOW A;  4N5S A;  3SBG A;  2DTU A;  5SWM A;  4H0O A;  4N47 A;  2UXC K;  3WXM B;  1U2V B;  1WAF A;  1J5E K;  2G8I A;  1QZ6 A;  2P9K B;  4PHT X;  3O80 A;  2UUA K;  1NU0 A;  4JKB A;  4KPY A;  2EWS A;  3J7Z O;  1SV5 A;  3I8B A;  3PSI A;  2BH1 A;  3DLL L;  4KH4 A;  4CF1 A;  3O4W A;  4EFH A;  1WOQ A;  4IEE A;  4JKC A;  1VSK A;  1HPZ A;  1OH8 A;  1RCH A;  2IOC A;  3HK2 A;  4Q0B A;  1VQ7 N;  5EY4 A;  3HM9 A;  3OYJ A;  5AQH A;  4BGB A;  4RW8 A;  2DFF A;  1GLF O;  4XH4 A;  4N56 A;  1VQ8 N;  3AA4 A;  3K9J A;  1U4B A;  1GLD G;  3QBX A;  4CGG A;  4IFY A;  3TSP A;  3C94 A;  1LW2 A;  1LCU A;  3PY8 A;  3L2Q A;  4E1N A;  3ZEU A;  4WF9 L;  2PAV A;  1FKP A;  4F3T A;  3VTH A;  4H4M A;  3P39 A;  5M1F A;  3GE1 A;  3SPZ A;  3UE5 A;  3M8S A;  5JVH L;  4B9T A;  2BE2 A;  1Q18 A;  1EKE A;  2DPN A;  1X3N A;  2O8C B;  2FSK A;  4IKF A;  4IOA L;  3VET A;  2GTD A;  4BQL A;  3LAN A;  4GVE A;  4CE9 A;  2G8F A;  5I42 A;  3DXM A;  3VEO A;  3MCA B;  4WQ4 A;  3MN5 A;  1S9E A;  3DOK A;  4YOV A;  4BC2 A;  4EZ9 A;  2E4L A;  1VQL N;  3DRR A;  2VG6 A;  3KJV A;  4YOR A;  3CJ7 A;  4W5T A;  4WCE L;  4LF6 K;  4CJT A;  4C23 A;  5AQW A;  3WXI A;  4ISG A;  1VSH A;  4FK0 A;  4ILG B;  3NE6 A;  4DB3 A;  3MED A;  4JI5 K;  1NMD A;  3C7N A;  2Y1J A;  1RGI A;  3NCI A;  3KVG A;  1SKW A;  1T8E A;  3ZT4 A;  2O4I A;  2QWN A;  3HVR A;  3TAF A;  3ZT3 A;  1RTI A;  3C0B A;  4W5N A;  1YIJ N;  2Q0U A;  4CEB A;  1NBW A;  3NMU A;  4BGA A;  3DLB A;  3UKR A;  1VHX A;  4B3O A;  3L3U A;  1FJG K;  2WON A;  5HRP A;  4BRK A;  1R0A A;  2J4R A;  4FWN A;  4H0Y B;  5GAG P;  3T1Y K;  3U3Y A;  3O3G A;  4DQI A;  4FLX A;  1VQK N;  4DFM A;  5KPT A;  4NCB A;  2ASO A;  2QWL A;  5B8H A;  1JCG A;  1MA9 B;  1LAV A;  2OPQ A;  5AQX A;  4FJ9 A;  1P90 A;  4B08 A;  2FF6 A;  5DK5 A;  3VEW A;  5AR0 A;  1NLV A;  3QIP A;  3I8D A;  4LFA K;  4RCH A;  4E0D A;  3KIO A;  3Q7C A;  4JKA A;  1WLJ A;  5K14 A;  3HZ6 A;  5IWA K;  3AO3 A;  3SK3 A;  4NXM K;  4BC5 A;  4IG0 A;  2QKB A;  4IG3 A;  4CK3 A;  3RMD A;  1BU6 O;  3CC7 N;  3KLG A;  4DF4 A;  3OYC A;  3LWM A;  1MU2 A;  1W9H A;  4JS5 A;  1XHX A;  2P9P A;  5KI6 A;  3OYM A;  4W5O A;  3I33 A;  4CW7 B;  3LAL A;  3U4L A;  4O8U A;  3CYM A;  2NRW A;  2GUP A;  2ITM A;  1IKW A;  3S41 A;  3OYF A;  1QSL A;  2E2Q A;  4LD0 A;  5J2P A;  4K8X A;  2E6M A;  1WBD A;  3TU5 A;  5JLF A;  5CZ2 A;  3KKR A;  4BRG A;  3CCJ N;  3J80 O;  4CZG A;  3BUZ B;  3OBW A;  5GIP A;  5AQT A;  4BAC A;  2HF3 A;  4BE1 A;  1S3X A;  1NGB A;  4Z0U A;  3MWT A;  3SMS A;  3HVT A;  5LMN K;  4FM2 A;  1HNV A;  4LF4 K;  1ZYQ A;  2YHW A;  4BR2 A;  1X9S A;  4B1V A;  2P9N A;  1TGO A;  4LH5 A;  3DJC A;  3O9T A;  4DSE A;  4H4O A;  3THX B;  4RW6 A;  1HQE A;  2QI2 A;  4BWM A;  4M41 A;  3VTI A;  5C12 A;  4GNI A;  1WSI A;  2XY5 A;  1ATN A;  3WQT A;  4FJ5 A;  3BGR A;  4U67 L;  4MDA A;  3ITH A;  5AZI A;  4R5P A;  5FPD A;  3IUC A;  3VGM A;  3TAR A;  3CF5 L;  3U6F A;  1S1U A;  1TK0 A;  1NGG A;  4M3T A;  1JKH A;  1HYV A;  1RDC A;  3CIP A;  2V51 B;  3W0L A;  4Z4F A;  4B9L A;  4C8O A;  3M6G A;  2W6K A;  3VF4 A;  1X9J A;  1DEJ A;  2F96 A;  2FC0 A;  5LJW A;  2I5J A;  4KI6 A;  4YDU C;  4HUF A;  3SQ0 A;  4LF5 K;  3U9Z A;  4CES A;  3NF8 A;  4FJG A;  3HRG A;  3HSC A;  1YHQ N;  4NB4 A;  4JK9 A;  2B6A A;  2OAN A;  2QW9 A;  3H08 A;  4H0V B;  2PZS A;  5CE3 A;  1QE1 A;  2V7Z A;  2P5O A;  2HHT A;  3WXL A;  3E1Y A;  1T05 A;  4FLV A;  2HBK A;  3ISN C;  4YOU A;  3OVN A;  2GBZ A;  3BP8 A;  1S1X A;  4AHT A;  4FM0 A;  3DLH A;  4I2P A;  2GEM A;  2HW3 A;  2F7T A;  4Q5V A;  1IG9 A;  1JLQ A;  3N4Q A;  1YXQ A;  1WSH A;  2Z1I A;  3MEG A;  4DV6 K;  5TKW A;  3VQQ A;  4BRM A;  3KK1 A;  2ZWH A;  1XC9 A;  4CHO A;  3JXU A;  2V52 B;  2DFH A;  3GL1 A;  2IAJ A;  1D9F A;  4XH5 A;  2BDP A;  3OBY A;  3RVC A;  1TK5 A;  2NRH A;  2YX6 A;  3M8Q A;  1Q9X A;  3MX5 A;  1XI1 A;  1VSL A;  4DR7 K;  3FR0 A;  2A40 A;  1N36 K;  4OKK A;  1TK8 A;  5C2D A;  1T6C A;  4FWS A;  1BIZ A;  3KLF A;  5GAH P;  3CC2 N;  4Z94 A;  3OYD A;  1L3V A;  4DHY A;  1IKV A;  4C1N I;  5HRR A;  2AA4 A;  2ZGY A;  3SLC A;  3AVC A;  4DFJ A;  2QM1 A;  4LF8 K;  4DU1 A;  1BI4 A;  3CCL N;  1I39 A;  4FK4 A;  4NLC A;  4I9L A;  4I9Q A;  3JYT A;  3D2F A;  3MX2 A;  1S6P A;  1YVN A;  4GV3 A;  5HOO A;  1RT4 A;  2VWB A;  3WXJ A;  4EHU A;  1BL3 A;  2YNF A;  3AVH A;  5AFU H;  5CYM A;  2Q1N A;  4DR4 K;  2CGL A;  4X64 K;  1ATS A;  3NAE A;  4PKG A;  3VOV A;  4IO8 A;  3HYF A;  1KCF A;  3LZJ A;  3S3O A;  1BWF O;  3AGR A;  4BWJ A;  4F2R A;  4KH6 A;  5E84 A;  4JI6 K;  1WSE A;  3HJF A;  1X1P A;  4DSF A;  3CFO A;  2KZZ A;  3QEV A;  2O8E B;  3ULD A;  4FM1 A;  4I7F A;  3RMC A;  2P9I B;  3LWL A;  5AQQ A;  1RBV A;  3Q7B A;  3NH0 A;  1V4S A;  4FWR A;  3THY A;  4FWO A;  4B9U A;  3FZK A;  3GDQ A;  3BZC A;  3P38 A;  3CM6 A;  3R8E A;  3THX A;  1W97 L;  4IOC L;  1YF5 L;  4FOE A;  2P9N B;  1K8K A;  5AQU A;  2P9K A;  5CZ1 A;  1V4T A;  3S9H A;  1K9M O;  3OTO K;  1N8R O;  3TAG A;  4F9O A;  4BDP A;  1B9D A;  4AF1 A;  3A2F A;  5AQO A;  4CHN A;  3O3H A;  2ZJQ L;  4RW4 A;  4BVP A;  4B8C A;  3AO4 A;  4H5N A;  3HP9 A;  3THV A;  4CJS A;  3CG7 A;  3PO5 A;  4GV6 A;  2BUP A;  3V9W A;  1LWF A;  3HOT A;  4FVU A;  4BG9 A;  4BE2 A;  1A5V A;  3DXM B;  1BI4 B;  3VES A;  1MDU B;  3NGZ A;  1TV6 A;  4DFK A;  2CH5 A;  2IIR A;  4CJP A;  4NXN K;  4ISF A;  5BN8 A;  2O8C A;  1CZ9 A;  3BY5 A;  5KTQ A;  1R59 O;  2HNZ A;  3C6H A;  3G71 N;  3C7N B;  2HHU A;  4BRP A;  4KTZ A;  2A5X A;  4KHU A;  4CHZ A;  1SZ2 A;  1TAU A;  1J6Z A;  2PBD A;  1N6Q A;  3CCQ N;  3ZSR A;  1KAX A;  4V19 S;  3CMA N;  3SAG A;  4WQ5 A;  1VRT A;  4IBN A;  5FRN A;  2RE2 A;  3QFP A;  1QQO A;  2JGU A;  3CC4 N;  3EYZ A;  3QER A;  1D9D A;  4NYF A;  4L3Q A;  1L5U A;  3ENO A;  3U3G A;  2F9W A;  1REV A;  1CXU A;  3B8A X;  4Z4G A;  5AQJ A;  5M1Q A;  1FKO A;  4DR1 K;  1NJY A;  5C24 A;  3CCS N;  3TR8 A;  3A5M C;  4FLZ A;  2FBY A;  1HPM A;  3OYG A;  3QIC A;  5HP1 A;  3TPQ A;  4HTU A;  4IJN A;  2DY4 A;  1KXP A;  3DXK B;  3HL8 A;  2HOE A;  3HBT A;  4FZY A;  1RIL A;  4E7J A;  2RN2 A;  4W5R A;  3O9U A;  1JL1 A;  3CJ1 A;  1YI2 N;  1QVF M;  4B9Q A;  3HM8 A;  5BRH A;  3LDN A;  2BAN A;  3TAN A;  4CK1 A;  1QZ5 A;  2X6N A;  2ASM A;  4AM7 A;  4LSN A;  4BR9 A;  1HKG A;  3VQ5 A;  4CVN E;  4BRN A;  4LF9 K;  2GWK A;  3BF1 A;  1NGD A;  4CJW A;  1BIU A;  3I0R A;  2VWK A;  3BEX A;  1W7A A;  1GLB G;  3RR7 A;  2QK9 A;  3LAM A;  1WBB A;  2A1R A;  1XNQ K;  4FWP A;  2AJQ A;  3T1H K;  4FJ8 A;  2HST A;  1ZBS A;  4E3S A;  3DLE A;  2F9T A;  4HUE A;  1JLB A;  3ULE B;  4IWV A;  1BA0 A;  4DLG A;  3EZ5 A;  1WUA A;  4BDZ A;  3B6P A;  4UY8 O;  2D4W A;  1IV0 A;  3CQ8 A;  4B1Y B;  4KTW A;  2G8W A;  2Q31 A;  2XO7 A;  1NGC A;  1NOZ A;  3QEW A;  3THW A;  1KAZ A;  2B4J A;  3ZX0 A;  1QHA A;  4QAG A;  3N4P A;  1WSF A;  4LFC K;  2NRT A;  4JLH A;  3IG1 A;  1Q7Y O;  3O9Q A;  1DLO A;  3AA5 X;  3OYH A;  4BC4 A;  3CCM N;  4H5V A;  4X65 K;  3ULE A;  3V6D A;  1A5X A;  3D2E B;  3G10 A;  2KLA A;  3FZL A;  4CFA A;  5J2M A;  3CCU N;  4FLU A;  1S9G A;  4DV0 K;  2WUS A;  4PA1 A;  3LDO A;  3RMB A;  5BRE A;  4CGH A;  4CBX A;  4F8R A;  5C10 A;  1M90 O;  5E26 A;  4BRH A;  4RW7 A;  3SUQ A;  3IMX A;  3L2U A;  1BGX T;  1YAG A;  3MDQ A;  3EY1 A;  3CFP A;  4HWI A;  3JAM O;  4A62 A;  4NO7 A;  1ZBU A;  5AQS A;  2Z1H A;  2YNH A;  5SZT A;  1IBK K;  3SAH A;  1SL2 A;  1KSP A;  4ILJ A;  2QXL A;  2YI1 A;  3MK6 A;  2ASP A;  3BF3 A;  3ATV A;  5AQV A;  5LY3 A;  4CEZ A;  4M3Z A;  4HUG A;  1HNI A;  3ZCM A;  3AGK A;  2ZM6 K;  2A41 A;  3H3N O;  4J2A A;  2UU9 K;  1HR0 K;  1W0H A;  1LWC A;  3NHG A;  1UA0 A;  3PIP L;  1XHZ A;  5A2Q O;  4NCA A;  4FPB A;  3DLK A;  4QOZ B;  3T7Z A;  1Z26 A;  4FWQ A;  4GKK K;  4MO4 A;  3J8A A;  3ZLJ A;  5HBM A;  1K6Y A;  2W41 A;  4EIA A;  1QQM A;  2YHB A;  4FOI A;  3UB5 A;  3AVN A;  4DV1 K;  3ZT2 A;  2OPP A;  4Y1D A;  4FLW A;  3GG4 A;  4FW1 A;  3ZET B;  3J81 O;  4H5W A;  3HXM A;  4QS9 A;  4FJJ A;  5CY4 A;  2O8B B;  2E1Z A;  1VSD A;  3CCV N;  1RTJ A;  1DKG D;  4JK7 A;  5C0Y A;  2D0B A;  3VA3 A;  3QEX A;  4HCB A;  4IDK A;  3OW2 M;  4DTU A;  5KGX A;  2E2N A;  5AZJ A;  4AHR A;  3MAQ A;  3NBP A;  4OKJ A;  4H5R A;  4OGE A;  4DTS A;  4WFN L;  3VQ7 A;  3HTV A;  1RBS A;  3O6W A;  3ZT0 A;  1HKB A;  3C6T A;  1WSJ A;  4JKG A;  1RBT A;  3AO5 A;  4HTL A;  3P83 D;  1C0M A;  4JNE A;  1ZBL A;  3M3Z A;  3LPU A;  1XWL A;  4EZ6 A;  3O1W A;  2D0C A;  3AO1 A;  1VK0 A;  1RBR A;  1RTD A;  1ILY A;  5H1S Q;  5HL7 L;  3M1F A;  4CJ5 A;  4DWI A;  4BC3 A;  3KK2 A;  4IZ9 A;  4JI4 K;  1RFQ A;  4BR4 A;  1UAX A;  3P4I A;  4B3S K;  1U04 A;  4CJR A;  3AAP A;  4M45 A;  3KD5 E;  1NJI O;  3QEP A;  1SAZ A;  1EP4 A;  1Y97 A;  2JWK A;  1HMV A;  4MDB A;  4FJL A;  3D45 A;  4KB0 A;  1JL2 A;  2RPI A;  2WC9 A;  4PL7 A;  4J2B A;  3ZSV A;  2G8V A;  2Q36 A;  3H1Q A;  3MWP A;  1G99 A;  3O4N A;  1IBM K;  1IJJ A;  1C1C A;  2HBL A;  3CHW A;  1GOA A;  3EE9 A;  3A0I X;  4OPH A;  4E7L A;  1ASV A;  2QXF A;  2O8E A;  3S3M A;  3K57 A;  4B1Z A;  2X74 A;  4A5A A;  3IFR A;  4DUY K;  4LC9 B;  3CJA A;  3RMA A;  1VQ5 N;  3FZM A;  2OZM A;  1IBL K;  2RF2 A;  2IDO A;  3GOI A;  3DM2 A;  2NLX A;  3G0Z A;  3NGI A;  4KTQ A;  2CGJ A;  5HRO A;  1X9W A;  3OYE A;  1NM1 A;  3NDK A;  3THW B;  4KI4 A;  4DR3 K;  3SPY A;  4AHU A;  2F8T A;  3SJH A;  3K5O A;  2I7N A;  3A8Y A;  3K2P A;  3FFI A;  3PUF A;  5F2R A;  3AO2 A;  1QHT A;  3KWG A;  3MXI A;  4DMN A;  1O1W A;  3O3F A;  1FK9 A;  3SQ4 A;  1EWR A;  1RT1 A;  1T6D A;  1HRH A;  4B8A B;  3KHY A;  1YIT N;  5LMU K;  3EKS A;  3V1Q A;  1VQP N;  3FZF A;  4ELU A;  2HHQ A;  1E3M A;  5CYQ A;  4OVL A;  4A57 A;  5AQP A;  2FBX A;  4E7K A;  2EHG A;  3MN6 A;  4CEQ A;  1D5A A;  4OGC A;  3K59 A;  3E66 A;  4YOY A;  2ATQ A;  5BR9 A;  1K73 O;  1ESV A;  4RG8 A;  1KD1 O;  4ZHR A;  5ADX A;  3SNN A;  2RHK A;  3KWI A;  3NF7 A;  4FWM A;  3VPZ A;  4PKI A;  4AM6 A;  4JI7 K;  2KFN A;  4YDU A;  1E4G T;  2P9S B;  5FLX O;  4JEP A;  2EX3 A;  1SQK A;  1UWB A;  4CF2 A;  3WNE A;  2P9L A;  3OYI A;  3P1G A;  3SBT A;  1S5J A;  4CEF A;  3LM2 A;  4CF0 A;  2DFE A;  4AHV A;  4KHY A;  3AVM A;  2YV0 X;  4DSK A;  3QDK A;  4RTF D;  3VQ4 A;  1Z6R A;  5E41 A;  3LP1 A;  3U9D A;  1JLF A;  4FJ7 A;  4X62 K;  3A5N C;  3SUP A;  2NRR A;  1L3T A;  1BHL A;  3LP2 A;  4JN4 A;  4O5F A;  1LWE A;  4CK2 A;  1QQC A;  3HOS A;  4CD1 A;  4QS8 A;  4DTJ A;  3AAR A;  4OO1 J;  5M1O A;  3V4I A;  1HJO A;  3CXC M;  3RRH A;  4DV4 K;  2UUB K;  4FZZ A;  1HQU A;  4H0X B;  1KAY A;  4JI1 K;  4AHS A;  2E2P A;  1RT3 A;  4KH5 A;  2QWO A;  2OZS A;  3SZ2 A;  4FLT A;  1XQS C;  2F8S A;  4DSI A;  1TKT A;  2ZGZ A;  2QWP A;  2XY6 A;  4CF8 A;  4A61 A;  1GLA G;  3VQE A;  4Y1C A;  2VWJ A;  1S1V A;  3LP3 A;  2HBJ A;  4JKF A;  1K8K B;  4NYN A;  4H8K A;  5ELZ A;  4PUO A;  2ETJ A;  5M1K A;  1KVB A;  4K8Z A;  2HMP A;  4DTP A;  2XRI A;  3CQY A;  3ZSO A;  2X6S A;  4CFB A;  3WEE A;  1TUU A;  1YJW N;  5AQM A;  1VSJ A;  4DTN A;  1MWK A;  1HNZ K;  3J7A P;  2XHB A;  3PO4 A;  2O8D A;  1QS4 A;  3EE8 A;  2NNW A;  1RTH A;  1YVU A;  4KKO A;  3G6E N;  1RDA A;  3WQU A;  2YCH A;  2P5G A;  3TTF A;  4J2D A;  1T03 A;  1P8Z A;  5KQ8 A;  4O0I A;  4BRD A;  3HPH A;  4CGI A;  4FXD A;  4FVM A;  5AQI A;  4HHT A;  1ASW A;  5AQL A;  1C0G A;  3C65 A;  5LJV A;  2UXB K;  3CET A;  1JXB A;  3K5N A;  4JD2 B;  4CJV A;  1T7P A;  4JKD A;  4CCH A;  3AVB A;  4KRF A;  2HVI A;  3M5R A;  3LM9 A;  1DT9 A;  1L3U A;  3AVA A;  3AVI A;  3H3O B;  3SQ2 A;  4O8K A;  4DTM A;  5JLH A;  4K41 A;  1TUY A;  4C8K A;  2Q2R A;  2NRX A;  3DLR A;  1NK6 A;  4LY7 A;  4BR0 A;  1S6Q A;  1NKC A;  3CM5 A;  3MN7 A;  3THY B;  3R1X A;  4E19 A;  2Z1J A;  2QKK A;  3AVG A;  2X78 A;  3KK3 A;  3L2W A;  3K5M A;  4RWT A;  4WE1 A;  4JHD B;  2Y1I A;  2AP1 A;  3LL3 A;  3K5L A;  2YKN A;  1RT7 A;  4CEC A;  4R79 A;  1KLN A;  4BRC A;  3KK7 A;  2GV9 A;  4JI3 K;  4FJI A;  1IH7 A;  5I9E B;  4FJN A;  4QS7 A;  3DLG A;  4Z4E A;  4EP5 A;  2KTQ A;  2YJF A;  4BE0 A;  4GKJ K;  3VEY A;  5KRT A;  2VYP A;  4DF8 A;  4DSJ A;  1YT3 A;  2HND A;  1NMN A;  1HJR A;  5DM7 L;  1KVA A;  5ADX H;  1OH5 A;  3ZSY A;  4FZX C;  2VCP A;  3ATU A;  3L4I A;  3D2F B;  3SUN A;  1Q9Y A;  3OYB A;  3VQC A;  3VEZ A;  4LFB K;  3UIQ A;  2LSN A;  1XNR K;  3LDP A;  2KHO A;  4OLA A;  1U48 A;  3QET A;  1C6V A;  1GOB A;  4CZE A;  3RTV A;  1IKX A;  3AVL A;  4XIU A;  3P5J A;  2BGG A;  2G8U A;  1NGJ A;  4L8R B;  2YHX A;  3T69 A;  3L8B A;  1YJ9 N;  3VF2 A;  3CJ9 A;  2A6A A;  1OVQ A;  3CQX A;  3AAQ A;  1SL0 A;  3QML A;  3PSF A;  2OTJ N;  4WFA L;  1UA1 A;  4LF7 K;  1XC3 A;  2I7P A;  3HO1 A;  1VQ6 N;  4QCL A;  3A5L C;  3K58 A;  3MCP A;  3ZSZ A;  5C42 A;  1OH6 A;  4O0J A;  4YOX A;  1WNS A;  3KD1 E;  3FE1 A;  1HKC A;  1UOC A;  1WN7 A;  4DUZ K;  2E5L K;  5DM6 L;  4BRI A;  4BRA A;  3O08 A;  1RNH A;  2FBT A;  2G8H A;  1RT2 A;  4OKE A;  5AZI B;  4ID1 A;  2IVN A;  1RDW X;  5AFU A;  4KV8 A;  3VQD A;  4CZL A;  3AVJ A;  5AQF A;  4I2Q A;  3TSU A;  4B3M K;  1BCM A;  3LDS A;  3OJU A;  3M8R A;  1NWK A;  3TTD A;  5FRO A;  4DTR A;  2PY5 A;  4H0P A;  1CZA N;  3DRP A;  4MQ3 A;  5J2N A;  4DSL A;  5KQD A;  1J54 A;  3T1A A;  3TWH A;  5J2Q A;  4DLE A;  3TTC A;  4MLH A;  3F9K A;  2Q97 A;  1CXQ A;  3G4S N;  4CJ3 A;  1BQN A;  2B5J A;  4BG8 A;  1QTM A;  3F5T A;  3WNF A;  4EHT A;  2OPS A;  3DMJ A;  1KLM A;  2KQ2 A;  4A2B A;  3QNN A;  4WQ4 C;  2NUB A;  4K0K K;  3QNO A;  2ZF5 O;  4DV3 K;  2P9P B;  1JJ2 M;  4JI8 K;  4FW2 A;  1NNE A;  4B9M A;  4BRE A;  2F4V K;  1RBU A;  4M42 A;  4Z4H A;  1EX4 A;  2VG5 A;  3DI6 A;  2HMI A;  4CIE A;  2HHH K;  1QQN A;  3HI0 A;  3VQB A;  2KW4 A;  5AQY A;  3R6M A;  4M3X A;  3MXM A;  1B9F A;  3LPT A;  4JAX A;  3OYL A;  4CZJ A;  4DR6 K;  1JLG A;  2Q3S A;  2IGI A;  4DS4 A;  4DR5 K;  2E6L A;  4A2A A;  2OA8 A;  1W2B M;  1S1W A;  2OYQ A;  1BIS A;  3PX6 A;  4B3R K;  4B1X B;  1Q81 O;  2HHS A;  5JVG L;  4F4K A;  5IT9 O;  4FL9 A;  3RR8 A;  2FSJ A;  1EO1 A;  3ZX2 A;  5JS1 A;  1SKR A;  4CJL A;  2QWQ A;  3BZK A;  3VGK A;  3L6Q A;  4C8M A;  2XY8 A;  1NGE A;  4GW6 A;  4OLB A;  1BOT O;  4O5B A;  1ZBI A;  5GIN A;  1KVC A;  3OHR A;  2RKI A;  4CFC A;  2YNI A;  5AQZ A;  1QVG M;  4H03 B;  5AQR A;  1QSS A;  2O8F B;  1D8Y A;  3L2V A;  3PX4 A;  2HBM A;  4FJH A;  1GLJ O;  4O44 A;  1LAW A;  2O8F A;  4AIL C;  2ZQB A;  1NKB A;  2OPR A;  1C1A A;  1IG8 A;  1T3V A;  3FLC O;  3EL2 A;  1HNX K;  2VGN A;  4O55 A;  4CJF A;  5HRS A;  2CGK A;  4FWK A;  4OPK A;  1L3S A;  3DRS A;  3SJJ A;  4DQS A;  4CJE A;  1E4F T;  4IOX A;  4JD2 A;  1J53 A;  3F73 A;  2A3Z A;  3FZH A;  4DU4 A;  3PV8 A;  3OS2 A;  1NK5 A;  1VSI A;  4B1W B;  4CZI A;  1BG3 A;  4ILH A;  3SQ1 A;  2P9S A;  1SS6 A;  3CER A;  3V1R A;  1TKD A;  3QES A;  1VQO N;  5F1X A;  1IO2 A;  4JK8 A;  1DTT A;  3UKU B;  3QO9 A;  4C1N K;  1YTU A;  2O8D B;  4Y0W A;  1I94 K;  4E1M A;  1OVY A;  1J9A A;  3I56 N;  2WOM A;  4CJQ A;  1U49 A;  4KRE A;  4G1Q A;  3EKU A;  4F2S A;  1O13 A;  3RSE A;  3P31 A;  4PY5 A;  2NZT A;  3VQA A;  4FK2 A;  1ZBH A;  1BQM A;  1YUW A;  2O4G A;  3ASM A;  1NK0 A;  1GOC A;  3R3L A;  3TAB A;  1EWQ A;  1YTA A;  4OPA A;  3CPW M;  3J7Y P;  3EZW A;  1NOY A;  1KFS A;  1EET A;  4FCY A;  4XEI A;  1NG9 A;  2V7Y A;  2PYL A;  4J8F A;  5FRM A;  3ZEU B;  2Q0R A;  3HPG A;  5AQN A;  4J2E A;  1GLC G;  5KPZ A;  1QSY A;  4CEE A;  4CGD A;  1NK7 A;  1KTQ A;  4CGJ A;  5BPM A;  1XMO K;  1LW0 A;  1C1B A;  1N5Y A;  3ZX3 A;  1BUP A;  1GLE G;  1OKJ A;  3CPE A;  4M3W A;  2YKM A;  2VQF K;  3O1B A;  5FPM A;  2A42 A;  1EXQ A;  2W40 A;  4B9V A;  4N41 A;  1HYZ A;  5M1N A;  3SYZ A;  5BN9 A;  3CME N;  1SUQ A;  3ID8 A;  4BR7 A;  2VGM A;  1H1V A;  1KQS M;  4KAZ A;  4A59 A;  1S22 A;  4ZTJ A;  5HLF A;  4OPJ A;  3V1O A;  3OA9 A;  4ZTF A;  1Q8I A;  3U8X A;  3V9Z A;  3VEV A;  1SKS A;  3S3N A;  4ELV A;  5GAD P;  2E8A A;  4MFB A;  1S72 N;  2E88 A;  3VER A;  3KTQ A;  4PKH A;  4B3T K;  3T3F A;  2HHX A;  1BDG A;  2BTF A;  3QB0 A;  4CZM A;  2G8K A;  5AQG A;  4JRQ A;  2HB5 A;  2P9L B;  5BPL A;  3AA3 A;  3AVF A;  4AHC A;  4I6M A;  4M3R A;  2P9U B;  5LL6 Z;  3TI0 A;  5EU7 A;  5BRD A;  4FO0 A;  4LH4 A;  1OH7 A;  1N32 K;  4Z4C A;  3VEX A;  2KZM A;  3CD6 N;  2E2O A;  2JLE A;  2P51 A;  1NJW A;  4CBU A;  3HP6 A;  3D7E O;  3NVK A;  2KKZ A;  4JHD A;  4ICL A;  3H46 O;  1CLQ A;  3AY9 A;  4XH1 A;  3MXJ A;  2QWR A;  4PL8 A;  5AQK A;  4JKE A;  3LZI A;  3SCX A;  4FSV A;  4NCG A;  1RT6 A;  1ZC6 A;  4A5B A;  1JLE A;  3OS1 A;  3OY9 A;  1K8A O;  3IAY A;  5M1P A;  4FPA A;  1NGF A;  1TKZ A;  3CCR N;  1JXE A;  2D0P A;  4M3Y A;  5DMR A;  5C15 A;  4KHW A;  4JS4 A;  3TAQ A;  3C6A A;  3AV9 A;  3E9P A;  1EQY A;  3E01 A;  4AQY K;  3L2R A;  3PX0 A;  3O9R A;  2JWL A;  4U7B A;  3E9O A;  4RW9 A;  1TL3 A;  3O8M A;  2D0A A;  1WB9 A;  4BY9 C;  4JI0 K;  5C2F A;  4FJM A;  2IVO A;  2O8B A;  4FWL A;  1WSG A;  4MO5 A;  4B9N A;  2GUI A;  3ZET A;  3V9X A;  2CH6 A;  1JLC A;  3LDL A;  3TSQ A;  3VQP A;  4KHP K;  4E89 A;  2D5R A;  5FPN A;  2ZD1 A;  4CEA A;  1Y64 A;  1TAQ A;  2HHV A;  2FBV A;  1T44 A;  3T19 A;  3L4Q A;  3M8P A;  4JV5 K;  3D6R A;  4ELT A;  3VEN A;  2ZJR L; 
#chains in the Genus database with same CATH homology
 4LF9 K;  4CVN E;  4DR2 K;  4DV5 K;  2ZM6 K;  4OX9 K;  4B3M K;  2UU9 K;  1HR0 K;  4DV7 K;  4YHH K;  3J80 O;  4B3T K;  5BR8 K;  5A2Q O;  4LF6 K;  1HNW K;  4X62 K;  1IBM K;  4DR7 K;  4DV2 K;  1N36 K;  1HNX K;  5LMN K;  4LF4 K;  1XNQ K;  4GKK K;  2UXC K;  4JI5 K;  3T1H K;  1J5E K;  5LL6 Z;  4DUY K;  4DV4 K;  2UUA K;  1IBL K;  4DV1 K;  2UUB K;  4LF8 K;  1N32 K;  4JI3 K;  4JI1 K;  4NXN K;  2VQE K;  1N34 K;  3J81 O;  2UXD K;  4GKJ K;  1FJG K;  5AJ3 K;  1I94 K;  4K0K K;  4DR3 K;  3T1Y K;  4DV3 K;  4LFB K;  1XNR K;  4JI8 K;  4LFC K;  4V19 S;  4DR4 K;  2F4V K;  4X64 K;  2HHH K;  5LMU K;  4LF5 K;  4X65 K;  1N33 K;  3J7Y P;  4AQY K;  4JI6 K;  4X66 K;  3J7A P;  1HNZ K;  4DR6 K;  4LFA K;  4JYA K;  4DR5 K;  4DV0 K;  4DR1 K;  4JI0 K;  5IWA K;  4B3R K;  4LF7 K;  4NXM K;  5IT9 O;  4JI2 K;  1XMQ K;  1XMO K;  4JI7 K;  2UXB K;  4KHP K;  5FLX O;  2VQF K;  3JAM O;  4YY3 K;  4DUZ K;  2E5L K;  2UUC K;  4JI4 K;  4DV6 K;  3OTO K;  1IBK K;  4CW7 B;  4B3S K;  4JV5 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...