4JI6K

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
116
structure length
116
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
total genus 28
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4ji6K00
4DV1K 1FJGK 5LMUK 1XMQK 4JYAK 4DR6K 1HNWK 3J81O 2ZM6K 4YHHK 3OTOK 4NXNK 4DV3K 2F4VK 4JI1K 1IBKK 4LFCK 4JI0K 4LFAK 3J7YP 3T1HK 4LF9K 2HHHK 4V19S 4DV7K 1XMOK 1XNRK 4LF6K 2VQEK 2UXCK 1HR0K 5A2QO 4DV5K 4X66K 2E5LK 4JI3K 4NXMK 4DR2K 4JI4K 4CW7B 4JI2K 2UU9K 5FLXO 4DR1K 4GKKK 5AJ3K 3J80O 4JI8K 2UUBK 2UUCK 4B3RK 4DR4K 1N32K 2UUAK 5IWAK 5IT9O 4CVNE 1IBLK 4LF8K 5LL6Z 4K0KK 3JAMO 4JI7K 4DUYK 3T1YK 3J7AP 2UXDK 1IBMK 4LF7K 4JI6K 4X65K 4X62K 1J5EK 4DV2K 1HNXK 5LMNK 2UXBK 4DUZK 4DV4K 4X64K 4DR7K 4DR3K 4B3MK 4AQYK 4DR5K 1N34K 1N33K 4JI5K 4KHPK 1XNQK 4LF5K 4LFBK 4B3SK 4DV6K 1HNZK 4DV0K 4OX9K 4JV5K 4YY3K 2VQFK 5BR8K 1N36K 4GKJK 4B3TK 1I94K 4LF4K
chains in the Genus database with same CATH superfamily
3C65A 2HVIA 3ZT0A 1BO5O 4B1VA 1OKJA 3A0IX 1SL1A 2ZD1A 4H5WA 5D3GA 1D9FA 1NWKA 4H8KA 3BGRA 1RBVA 2ZM6K 5AQQA 3SUNA 2A6AA 3ZSRA 4BE1A 1T03A 3WNHA 4PQUA 3O80A 4FCYA 1JLGA 3TU5A 3J7YP 4BRHA 4CECA 4ISEA 3HRGA 1BIZA 2YHAA 3ZX2A 3K57A 4DQRA 4DTNA 3DRRA 3ITHA 5HRSA 1S1TA 4C8MA 1NBWA 1EWRA 4XH1A 5CR4A 5AQGA 1L5UA 1RDDA 3VGLA 3ZT4A 5AJ3K 3OYGA 2PZSA 2IVPA 3ZETA 3LPTA 2QKBA 1P90A 4ICLA 2P9UA 3L2UA 1U04A 4BWMA 3SMPA 4M7YA 3UE5A 1LOTB 2E6LA 2I7NA 3VGKA 1D8YA 4KBOA 3S41A 4F4KA 4WQ5A 4Z4EA 3V9SA 3D0PA 3V4IA 3EY1A 5EXWA 1U6ZA 3QEWA 4BDYA 3V1QA 1EX4A 3J7AP 4BQZA 1KRPA 1TV6A 5TKYA 3CFOA 1C1AA 1K8KA 3PY8A 2B5JA 3L6QA 1U2VB 3KK1A 1TAQA 3DLLL 2IAJA 3LALA 1W9HA 3WEEA 3ID6A 2RN2A 4IWVA 5AQOA 4PUOA 1BI4A 3ZT3A 1B92A 1QZ6A 1RT6A 2ZJPL 3VQ4A 1S5JA 4OX9K 1ILYA 2YNIA 2OPRA 2I7PA 2X78A 1E4FT 1NGBA 4OKJA 3DLBA 2OYQA 3VOVA 2Q36A 3GL1A 5EOYA 2V51B 4FJMA 3EKUA 1ZBSA 4CEZA 4B3TK 4A5BA 4CFBA 4OPJA 1J54A 4CJSA 3QNNA 3ZX3A 2VWJA 2JWKA 1JLEA 2ZE2A 4DU3A 4DTUA 4YOWA 3OYCA 3ULEB 4PA1A 4U67L 3L3VA 3BEXA 4CGDA 4JKAA 3CFRA 3DWLA 4CGIA 1HPZA 3KD1E 2E20A 4CJEA 1M1KO 4AH9A 3LP3A 2VQEK 5LJWA 4IXCA 4JS5A 3VGMA 3QLHA 3U9ZA 2HOEA 1N8RO 3J7ZO 3A8YA 3SYZA 3DLEA 3VQ9A 4CW7B 3OYLA 5AFUA 4CGJA 2G8IA 3JYTA 3VTHA 2P9KB 1CZAN 2F96A 4ZHRA 3V9WA 4BE2A 4I6MB 3U8XA 1FKPA 3PLAA 4K8XA 1WAFA 1TYQB 4AM7A 3OYAA 4B1ZA 3C6AA 2KFNA 1HKCA 2E2NA 2QWPA 4M7XA 4IBNA 4KH4A 1IBMK 1W97L 2IVNA 1JCFA 1OH5A 3NHGA 4DTPA 1J5EK 2P9PB 4I9LA 5M1QA 4J2DA 3CMEN 1NMDA 4GNIA 1HYSA 4N41A 1GOAA 2AP1A 2QTDA 4JKDA 4CF2A 4EP4A 4WQ4C 2QWMA 4KHPK 5C10A 4AF1A 4YOUA 4LFBK 1YJ9N 1A5VA 4DTRA 1K9MO 3HP9A 3AA2A 3F2KA 3QEXA 4KI4A 4FWOA 4FLTA 1RBTA 3RR8A 2PFUA 4YY3K 4M3XA 1DGKN 3VEWA 3M8SA 1KAYA 4IDKA 3M3ZA 4BC4A 2YHBA 5BREA 5HRRA 3SUQA 1IKYA 3CJCA 1GLFO 4PL7A 1GLLO 5H1SQ 4DV1K 1Q9YA 2HF3A 4IZ9A 1RT4A 1U47A 3TWHA 3MCPA 1WBDA 1LWFA 2RE2A 3CI5A 2QWOA 4IO9L 3ZETB 3D45A 4LFCK 3FZFA 1ZBLA 2GTDA 4CZGA 1Q9XA 4LSLA 3MN5A 3C0BA 4AHSA 3TTDA 4HUFA 1HJRA 3FFIA 1RT3A 3MDQA 4CK1A 3QERA 3HZ6A 5AQXA 2ASMA 4BY9C 3AO5A 5DM6L 1FK9A 2QK9A 3KZBA 3HPGA 3QESA 3QFPA 1E4GT 1K6YA 4H0PA 3QO9A 3DYAA 3ZLJA 4DR1K 1NJWA 2G8WA 1WSHA 3OBYA 3PIPL 4KPYA 1MWKA 2P9SA 4O0JA 1S9GA 1P8ZA 2F9WA 3K5OA 1HMVA 4NCAA 5KPZA 3B8AX 5HRNA 3WEEB 5IT9O 1IBLK 4M41A 2YV0X 2FLOA 3SQ0A 1S9EA 1V4TA 1HKBA 2B6AA 3CG7A 1C1CA 5JVHL 2D5RA 4RG8A 1VRUA 2GUPA 3NH0A 4YFUA 1XC3A 4DF4A 5F2RA 4FM0A 3G0ZA 1IKWA 4BRLA 2YNHA 3QICA 3UB5A 2E1YA 5AQMA 4LSNA 3NFAA 1VSMA 3KK7A 1HQEA 4LF5K 2Q1NA 4FJJA 1VSJA 2QXFA 1T6CA 2WC9A 3OYKA 4I9QA 4DV0K 3RWUA 4F9OA 1J6ZA 4M3RA 4M3UA 1QQOA 1FW6A 1BCMA 1NGCA 3AA5X 3CETA 5AQWA 3ENOA 3CF5L 3CCSN 5M1PA 4A59A 3KK2A 4JYAK 2NLXA 3CM5A 3OS0A 4A62A 1TKTA 4CHOA 4O55A 3SBTA 2QXLA 3O9UA 2AJQA 1YT3A 4DV3K 4BDPA 3AVKA 2OPSA 4CJUA 5TKWA 3CC2N 4LC9B 4JN4A 3G6EN 3VQCA 1RTDA 2QW9A 1RDUA 3A5OC 2OA8A 4NCBA 1LV5A 4KTQA 3MEGA 1LWEA 3A2FA 2CH6A 1YAGA 3AVFA 4RW8A 3ZSOA 4FJIA 4O5BA 3L8BA 2OANA 1QSSA 1YJNN 4PHTX 3MX5A 1BHLA 2CGLA 5AQUA 4JKGA 1QVGM 3RMCA 5GAHP 3PSFA 4FJ5A 1HJOA 3F73A 1T8EA 1RDCA 4CHQA 3VA3A 1NLVA 5M1NA 3NF7A 4OO1J 1RTJA 3VQ7A 4CF1A 5KQ8A 3DLGA 1TL3A 3K2PA 1NK5A 2RF2A 2P9IA 3BP8A 2O8CA 3E9OA 4KFBA 4DFKA 3PO4A 3CCUN 3LP2A 3LDQA 1QSLA 4C8KA 1JXEA 4RTFD 5M1KA 1J9AA 3O9TA 3TTCA 1ASVA 4L3QA 3LPUA 2NNWA 2E1ZA 3CD6N 2HHUA 1EO1A 2UXBK 3FZKA 5BRHA 4H5RA 4AILC 2PY5A 3A5MC 2RPIA 3SK3A 1VQ9N 3ENBA 3AAQA 1XUPO 3BUZB 5AQLA 1BCOA 3UKUB 1S3XA 4E1NA 4OJRA 1HNZK 3OYHA 4F3TA 4OLAA 4HUEA 4DMNA 3THYA 3QBWA 2X6NA 2VQFK 1MA9B 3OYEA 3QIOA 4DQQA 1MWMA 4B9VA 3ZYYX 3C6HA 3NH2A 1NJZA 3TTFA 3I8DA 1Z26A 4JHDA 3CCEN 4BRFA 3OHRA 3V6DA 2GBZA 1VHXA 4FLUA 3VQBA 2QM1A 2JWLA 2P9SB 4MO5A 4GVEA 4WQ4A 3BY5A 3VTIA 3O9RA 3QINA 1WB9A 1WN7A 3UKRB 1N6QA 1DTTA 4CD1A 3VEXA 1NM1A 5A2QO 1HR0K 1WAJA 4CZFA 1ATSA 4H5VA 4H0VB 4HHTA 2YHXA 3QETA 3CXCM 4WCEL 1U2VA 3VPZA 2V7YA 3E66A 4DR2K 4Z4HA 4JI4K 1WSFA 4W5QA 1S1UA 3A5LC 4CZLA 4FJKA 3AVLA 4DFMA 1HX1A 1YXQA 3FZHA 3DI6A 1VQMN 1DT9A 4CF0A 1GLDG 4MO4A 3L2VA 3VEZA 2KQ2A 3WNEA 2NRRA 1NGGA 1YJWN 4FM2A 1QHAA 4DU1A 4LH5A 4DUYK 3AGKA 1L3VA 4CGGA 2BTFA 4XIUA 5JS1A 4H0YB 4FW1A 2W6KA 2BGGA 3ULEA 4QS7A 4JKFA 1QQNA 1WOQA 2ZJRL 3TSPA 3OYMA 4K25A 5M1FA 3PSIA 3FE1A 2XY7A 4B3OA 4FL9A 4H5TA 4BQLA 2E2QA 4ID5A 4BC5A 1BGXT 1YHQN 3BDPA 4BRCA 3T19A 4CCHA 1SKSA 3DM2A 3AAPA 3MECA 3V9ZA 3KIOA 4IG3A 1OVQA 4ILGB 3NCIA 4U7BA 1N36K 1C0FA 1FXXA 2NRVA 3HL8A 3K5LA 1MU2A 1X3MA 4BR7A 1DKGD 2P9KA 1IJJA 1VSDA 2YKMA 5EU7A 3LWLA 4JKGB 2WOMA 1T3VA 4DTMA 1TUYA 4DQIA 2F4VK 5BPNA 1GLJO 1XHZA 3QIPA 1N5YA 2P9IB 3MCAB 3T1HK 4LFAK 2DTUA 2HHHK 4V19S 2O8CB 1BDGA 1EP4A 4FLXA 1ZYQA 1NK4A 1X3NA 3AVMA 4EP5A 4E7IA 2P9PA 3V81A 4BVOA 4J8FA 1DEJA 3KJVA 4FVUA 4DG1A 3E01A 1HQUA 1NGHA 4EFHA 4IOCL 1UA1A 3E9LA 1YF5L 3R9PA 4EHUA 4B1XB 1S6QA 2HHWA 1NK9A 4DTOA 4HVJA 3NVMA 4BDZA 5AQSA 4C1NI 3SQ1A 3IG1A 1GLBG 4JI8K 4G9ZA 4BR2A 2IDOA 3SV3A 2OTJN 3VF2A 1T44A 4B8CA 4CEQA 3BF3A 4UY8O 3I8BA 4BRNA 3SQ4A 3O8MA 2W40A 4KB1A 1KD1O 3JAMO 4YDUA 5CHIA 1NGEA 3VEVA 3R1XA 5J2NA 4O8UA 3CQXA 3THYB 3CQYA 4LF7K 2KFZA 2ZGZA 4RWTA 1BL3A 4ISGA 4X65K 1VQ4N 4X62K 2Z1HA 3E9PA 1JL2A 3PIOL 3AVGA 4JHDB 4N56A 5AQVA 3LWMA 3TABA 4KHSA 3RMDA 4AQYK 3RSEB 5KGWA 4CI6A 1SKWA 4FK4A 1XHXA 3NF8A 4M3TA 2HB5A 1X9MA 4ID1A 2GX9A 5JLHA 3NMUA 4R79A 3N4QA 1U4BA 3KTQA 4FVMA 3DMJA 5C2FA 3TAQA 3CJAA 2XO7A 1UAXA 4O44A 5BRFA 2ZF5O 3QEIA 3CCQN 4Q5VA 1JLCA 4JRQA 3JSMA 2YNGA 1DLOA 5K14A 3DXKA 1ASUA 4CZIA 3NGZA 4F2SA 3QB0A 3RRHA 3DAWA 3LAKA 3AO4A 2VGNA 5I3UA 3WXIA 4B9UA 4Y0WA 4CESA 1BUPA 1X1PA 3AO3A 5C25A 3PX4A 2QWQA 3LL3A 1UWBA 4QCLA 2O8DA 1S22A 2D0AA 2ZGYA 5GINA 1I3AA 1OH8A 2FF3B 3C7NA 5E41A 5AQIA 3R3LA 4DV7K 3VQDA 4FJ9A 3K58A 3C6TA 4OLBA 4AHRA 2Z1GA 4WF9L 1JLFA 2P5OA 4IJNA 4JI3K 1F21A 4DTSA 3OYNA 4KH5A 5BPMA 4PKHA 1XI1A 1TK8A 4CHPA 3QMLA 4Q0BA 3CM6A 2HVHA 1RT2A 3MWPA 4Z4IA 2GUIA 2UUCK 3TR8A 3ATUA 3M1FA 2UYTA 4CJWA 4DHYA 3D2FA 2O4GA 1CXUA 4CVNE 4NCGA 4BR0A 2JLEA 4DSLA 4K41A 4YOYA 5LL6Z 5KGXA 4OGEA 4F2RA 3I33A 2DFFA 1BA0A 3M6GA 2HNYA 4I2PA 1JLBA 2YJEA 4FWSA 3DOKA 3DRPA 4FYDA 1JL1A 4E7LA 2Y1IA 5JLFA 1GOCA 3OJSA 1EXQA 3S3OA 4WFBL 4DR7K 1KFDA 4ELTA 1OH6A 1Y64A 2W6LA 2NRZA 4OPAA 4HTUA 1HRHA 4CJVA 1NGFA 1JCEA 2KHOA 3MN9A 4CE9A 1VQKN 3DOLA 4O0IA 3EYZA 3NGIA 4ELVA 1VQ7N 1KQSM 2E4LA 3CMAN 3AVAA 1NGAA 1NK7A 3DRSA 1O1WA 4A57A 4QOZB 4DLGA 4GKJK 3U9DA 2BUPA 3QBXA 1ZC6A 2QWLA 1NJYA 4YHHK 4NXNK 4CF8A 4FZYA 2P9LB 3LP1A 3TPQA 2GELA 4CBUA 3TI0A 4LF9K 1SAZA 3M8QA 4AHTA 1NK8A 1BIUA 4DV5K 5FPDA 1NKEA 3P4IA 2E5LK 2F8TA 3NE6A 4BG8A 3SAGA 1YVNA 3NAEA 1NGJA 4JI2K 1K73O 2UU9K 3L2QA 1BQMA 4Y1CA 4MDAA 3UKUA 3CQ8A 3D7EO 3KWGA 5FPMA 4CHNA 3Q7BA 3VESA 2VG7A 4B9QA 4A2AA 2GWJA 5AQFA 1C0MA 3HT3A 3LANA 4IKFA 4GVMA 1M90O 4OGCA 1HYVA 2HNDA 3VF6A 1VSKA 3ATVA 1NK0A 3DXKB 1SV5A 4HTLA 2NRTA 2A1RA 4G1QA 5GIPA 3WXJA 3H45C 3LZJA 1U49A 4PY5A 5AQJA 3CJ9A 2KLAA 3CPWM 1BISA 2ZJQL 4LY7A 3T3FA 1LCUA 4UQGA 3UKRA 4N47A 2F9TA 1Z25A 3P5JA 5J2MA 3HM8A 2O8DB 4BRMA 4CFDA 3C7NB 5J1EA 2PYJA 4RW4A 4CZKA 4FJ7A 5CY4A 4BWJA 3HXMA 2DPNA 3AA3A 2ZQBA 2LSNA 1RGIA 3IFRA 5JS2A 1IKVA 5J2QA 3ZEUA 5EVZA 1W0HA 3PUFA 2BDPA 4DR6K 1NG9A 2IVOA 3KLGA 1HNWK 4CJ5A 1QE1A 3HM9A 2W41A 3P38A 4CGHA 3G71N 3QDKA 3U4LA 4JK7A 2Q31A 1RT7A 3D2FB 5I42A 2FSJA 4BRPA 5HRPA 2ASPA 3LDOA 1ATNA 4LF6K 1KVBA 2Q0UA 4CIEA 2E2PA 1RFQA 1VQON 4X66K 1YUWA 1JKHA 2I5JA 2A42A 3RRGA 3FFKB 3DXMB 4NXMK 2VWKA 3ZCMA 3SZ2A 2ITMA 4DFJA 3VN5A 1Y97A 3L2RA 1ESVA 3VQ6A 1GLCG 3GE1A 2G8FA 4FW2A 3WUHA 4O4GA 4E1MA 5C0YA 4GV6A 3SCXA 4ZTFA 4DR4K 4IO8A 3ASMA 3LDNA 1X9WA 1SUQA 2IGIA 1EKEA 3F9MA 3T7ZA 5J2PA 4DSJA 4JI7K 4BRIA 2YCHA 2VG6A 3MEDA 3OYIA 2WONA 5FROA 4CEBA 4DV2K 2RHKA 2YHWA 4KH6A 1W2BM 3HOSA 4BE0A 4CJQA 2XHBA 3PO5A 2R7YA 2A3ZA 3PX6A 1I39A 4KHWA 3AV9A 4CBWA 3V9UA 4WYBA 2HHTA 1T05A 3HTVA 4CJ7A 4Z4CA 2VWBA 1QHTA 2D0OA 3TAFA 5GAEP 3LZIA 1KTQA 4C1NK 3OS2A 4DS4A 1EETA 4JV5K 1UOCA 4WQ5C 3DJCA 1L3SA 5AZIA 5AZJA 3GG4A 1X9JA 2NRWA 3H3OB 3HOTA 4MQ3A 3AVNA 3DLRA 1QSYA 4DCHA 3B6OA 2YX6A 1VQ8N 3G10A 1B9DA 4DLEA 4CERA 2P5GA 3HSTB 1FKOA 2NRHA 4B1YB 1IO2A 4HWIA 1HYZA 3MWTA 1J53A 4JLHA 3LP0A 3QEPA 4BC2A 3HP6A 1RTIA 1JLQA 1YTAA 1XC9A 3MXJA 4J2AA 4DS5A 3VF4A 3OY9A 3CCLN 3CERA 3RMAA 1QQMA 2FC0A 3ZSWA 3RSEA 1IH7A 2CGKA 3VQ5A 1KVCA 2ATQA 4IEEA 1G15A 1VK0A 4KKOA 2PAVA 3HJFA 2V7ZA 3O1BA 3OS1A 3RMBA 4JD2B 3NF6A 1QTMA 4CHZA 1CLQA 4JS4A 3KLFA 2HMIA 4DF8A 4YOTA 3O4WA 5DM7L 2P9NB 4KHNA 2HHXA 4I7FA 4E1JA 4FO0A 1IG9A 2YJFA 5LY3A 1OVYA 3P39A 4CJFA 1W7AA 4C23A 4DSFA 4DFPA 4ILJA 3E1YA 3T1YK 4KV8A 4FXDA 1KFSA 3LAMA 5DK5A 3L0QA 5C2DA 1V4SA 3SV4A 4FJ8A 3R8EA 2XRIA 3TSUA 3ZEUB 3MX2A 4EZ6A 5MLCQ 4W5OA 3NVKA 2QWRA 1VSIA 1KLNA 1T6DA 1KCFA 4JKBA 3SUOA 4CFAA 2E88A 4FWMA 4QS8A 1BQNA 3ZT1A 4JKCA 1EWQA 3FGUA 2XY5A 4FPBA 1HLUA 3AVBA 4BR5A 2E6MA 4CEEA 2D0PA 2YHYA 4JEPA 1U48A 1NMNA 4QAGA 5C42A 1C6VA 2O8FB 4BVPA 3JS6A 5AQYA 4H0TB 5ADXH 1VSLA 1H1VA 4C8LA 2HBJA 4BC3A 4GW6A 2Q0RA 4CEFA 4DTJA 4DSKA 4JKHA 3EKSA 4CZEA 1VQPN 1Q82O 4CGFA 4NB4A 4FJGA 4BRGA 2IIRA 3KK3A 2EWSA 1CXQA 1K8AO 3CC7N 2UXCK 3WQTA 2BANA 3OBWA 3KVGA 4HCCA 5DMRA 5AQRA 3O08A 4CF9A 5KPTA 4DQPA 5M1OA 3M5RA 4H4MA 4JNEA 3V1RA 2W42A 3T69A 3VEYA 2HBLA 1X9SA 4O8KA 2WTUA 1RTHA 5KTQA 5C24A 4KO0A 3SQ2A 1WSEA 4Y1DA 3F9KA 1J5OA 1BA1A 4H0OA 3J80O 3ENHA 5GIOA 1KVAA 1A5WA 4YOVA 4HUGA 4E7JA 3THXA 4PKGA 4BRAA 2BH1A 3TANA 5CE3A 1TKDA 3MAQA 4B9SA 1NOZA 3S9HA 4K42A 4K0KK 2JGUA 3SUPA 2FSNA 4HCBA 1IV0A 5AR0A 2GWKA 5AZIB 4FWQA 3K9JA 4DB3A 5AZJB 4OKKA 3THWA 1MDUB 3GDQA 3SPZA 3IDHA 5LMNK 4BGBA 2A5XA 2E8AA 2P9LA 3AVHA 1RT5A 1R0AA 4FJHA 1S1WA 1Q7YO 3OA9A 4RCHA 3LDSA 3TSQA 2HHVA 4JI5K 1Q18A 1QQCA 3FLCO 2HF4A 2WUSA 3I0SA 4J2BA 2O8BA 1B9FA 1O13A 2O8EB 1ZXOA 1KXPA 5KRSA 3HBTA 5KI6A 5E84A 1RILA 1T7PA 1GOBA 2OCEA 4KRFA 4PWDA 4IFEA 2Z1IA 4FWLA 3VQEA 3C94A 2FBVA 2EHGA 1NOYA 4DSEA 3VEOA 1LAVA 1NJIO 1C0GA 4NYFA 3S3NA 3JXUA 3MXMA 2HSTA 5JVGL 2HW3A 2D1KA 1QS4A 4CD3A 2DFHA 3WXLA 1TKZA 5HROA 5JICA 4TSXA 4GV9A 1WUAA 2P51A 1KC8O 3SAFA 1JXBA 2DY4A 3Q7CA 3HSCA 4DKWA 1JCGA 3AVCA 3K59A 4XH4A 2RKIA 4N5SA 3B6PA 5AQZA 3WNFA 3FZMA 1D5AA 3DLKA 4PL8A 4AM6A 4BROA 5GADP 3AA4A 3EZWA 3CYMA 1NU0A 3D2EB 4AHUA 3ZT2A 1HKGA 4LH4A 3VETA 1KLMA 2GEMA 1TAUA 3IKMA 2QA4N 2UUBK 2BE2A 4ILHA 1RCHA 1SQKA 4C8OA 2ASOA 3K5MA 3CCMN 3RTVA 3H1QA 3VQ8A 4DQSA 4MDBA 3ZSZA 3J8AA 2V52B 3O3FA 4PKIA 1SS6A 3O6WA 4YORA 5BRDA 4JI6K 1G99A 4CZJA 2EX3A 1ITGA 1ATRA 3WXMB 4Z4GA 2IS3A 4OPKA 4R5PA 1NK6A 4X64K 4CJ3A 4KTZA 3IS9A 1NGIA 3ZSVA 5FPNA 1N34K 5AQKA 4MLHA 4B9TA 3GBTA 4E0DA 3P31A 4RW7A 4JK8A 4JK9A 1VQNN 3BZKA 4KAZA 1S1VA 4B3SK 3L4IA 4DV6K 3NDKA 3NGYA 2HHSA 3L4QA 3DXMA 3OYDA 1Q8IA 4CJKA 4KTWA 4CJ4A 3BF1A 3LM9A 1S1XA 1CZ9A 2HHQA 1SL2A 2ETJA 2Y1JA 3WQUA 4EAHD 4A61A 3IAYA 2HMPA 4E3SA 5LMUK 1XMQK 1ZBUA 1ZBHA 4CJRA 1NGDA 1IKXA 4CJTA 4AHCA 3G4SN 3R6MA 4FK0A 5CYMA 3THXB 1WSGA 4GV3A 4CZHA 1XWLA 1RBRA 3N4PA 4KI6A 4IDHA 1RDBA 3K9KA 2QI2A 1LWCA 2G8VA 2KW4A 4NLBA 3SPYA 3H3NO 3O3HA 1VSFA 2NRXA 3ZX0A 3THWB 2OPQA 2KTQA 4FJLA 5SZTA 1RBUA 1L3TA 4JRPA 2QKKA 4W5NA 2B4JA 4CBXA 2ITGA 2VGMA 4FM1A 3EZ5A 5HL7L 4M42A 3KLHA 5CZ2A 2A41A 2WBNA 1LAWA 4W5TA 4B1WB 1D4XA 2PBDA 3ZSXA 2O8BB 3ULDA 4IFVA 4FZZA 1WBBA 4IJAA 2X74A 2OPPA 3W0LA 5FPEA 1XQSC 2QWNA 3LM2A 3P83D 1RBSA 1VAZA 4ZTJA 3S3MA 3MMVA 2CGJA 4DWIA 3THVA 3I55N 4MLEA 3AARA 3HPOA 3IUCA 3TARA 3OYFA 4KREA 4K8ZA 4FWNA 2Q3SA 3WT0A 3RVCA 4EHTA 1XNQK 4M45A 4KB0A 4E7HA 1C0UA 1YIJN 2NUBA 3O1WA 1HUXA 5BN8A 4F3OA 4F8RA 5EX5A 5ADXA 4K43A 2P9UB 4NYNA 2G8HA 4WFAL 3U3GA 5BR8K 3SJHA 2FBXA 4CHYA 5HBMA 4MFBA 2D4WA 4JD2A 4BRKA 3KLIA 4Z4FA 2F8SA 1VQ6N 1WSJA 4EZ9A 4WFNL 2P9NA 4BG9A 3MN7A 4YNQA 5HLFA 1BOTO 1ZBFA 2HBMA 1JLAA 3QNOA 4B9MA 2KZMA 2YNFA 1K8KB 3HPHA 5AQHA 2J4RA 4JI0K 3FZLA 4YOXA 3M8RA 1TL1A 5EY4A 5AQPA 3VQAA 1XMOK 3U3YA 5HP1A 3KKSA 1D9DA 4BRQA 4FLWA 2CH5A 3K0SA 1BI4B 2OTLN 4E19A 3VMFB 2FBTA 1NKBA 4RW9A 3IRXA 2Z1JA 5FLXO 2A40A 4A2BA 4BRDA 4IEIA 4XH5A 5FRNA 3SAHA 4FOEA 4H5NA 5B8HA 5AQNA 3HO1A 3SJJA 3EO3A 4B3RK 3CHWA 2UUAK 4KHUA 5IWAK 4FJXA 4IOXA 4WE1A 4FJNA 2O8FA 4CFCA 1R59O 2GV9A 5JMVA 4M3ZA 3VENA 1BG3A 4ISFA 4CK2A 3EE8A 3P1GA 4EIAA 1L3UA 4FWPA 4DR3K 1JJ2M 1HNVA 4QS9A 1RT1A 3I56N 4DR5K 1N33K 3H6EA 2YI1A 3ID8A 3SLCA 3KLEA 1SZ2A 2IOCA 1HPMA 3OW2M 4B8AB 1RDWX 1CZBA 4FWRA 4C8NA 4B9LA 2Q2RA 3ALYA 3ISNC 4NO7A 4OVLA 4FLVA 3OYJA 2VCPA 4W5RA 4O5FA 4Z0UA 3V9XA 1TGOA 3H46O 2D0CA 3CPEA 2H3GX 2NZTA 4YDUC 1WNSA 3TAEA 3MEEA 1I94K 4LF4K 4LD0A 1HNIA 3EN9A 1U45A 4DU4A 4CEAA 1LW0A 1SKRA 3EEQA 3AO1A 4H4OA 3W3DA 5HOOA 5E26A 1S6PA 4BREA 3MK6A 1UA0A 1TKXA 4IOAL 4CIGA 3OTOK 3TAPA 1VQLN 5SWMA 3EL2A 4A5AA 3TAMA 5GAGP 3HI0A 2ZWHA 3EE9A 1ASWA 2OZMA 1XNRK 4DTXA 3RR7A 1VQ5N 3I0RA 4JKEA 3CJ1A 5C15A 4FOIA 5T7BA 3CCVN 2Q97A 2AA4A 1Z6RA 1S72N 5CYQA 3UIQA 1KSPA 3CJBA 1DTQA 4GKKK 1VRTA 3CJ7A 1VSHA 2FSKA 3G25A 2O8EA 1GLEG 5KRTA 3FR0A 3H1VX 4DSIA 3SI6A 3VQQA 3L2WA 1A5XA 3TAGA 5AFUH 4B9NA 3SBGA 5FRMA 2X6SA 4GMJB 2XY6A 4BACA 4AHVA 3VERA 3A5NC 5F0XA 3O4NA 5CZ1A 2FBYA 2DFEA 4BR4A 2UXDK 2E2OA 2FF6A 3C95A 5BPLA 4L8RB 3KKRA 4H03B 2G8UA 3LDPA 2P1JA 1C0TA 5BR9A 2VYPA 1WLJA 4DUZK 5KPRA 3KWIA 3U6FA 4B3MK 1EQYA 2HNZA 4IFYA 5F1XA 5FDLA 2HBKA 4M3WA 4BR9A 1BWFO 3CIPA 1VSEA 2A1SA 1REVA 4H0XB 2XY8A 2KKZA 3PX0A 3LDLA 3SMSA 3VQPA 1SL0A 3AGRA 4FLZA 1ZBIA 3O5BA 3NH1A 3ZSQA 4CJLA 4FZXC 3AO2A 4CEDA 2O4IA 3D2EA 1NJXA 4IG0A 1Q86O 4OPHA 4KHQA 3T1AA 3ZSYA 2WFBA 3OVNA 1FJGK 1RNHA 3KHYA 3H08A 3O3GA 3J81O 3CFPA 4N76A 5C12A 5AQTA 4JAXA 3PV8A 1TK0A 3OJUA 2FXUA 4JI1K 3SNNA 3K5NA 1IBKK 3O9SA 1GLAG 3O9QA 4ELUA 1YTUA 1Z05A 4OKEA 4NLCA 5LJVA 2D0BA 3V1OA 4CZMA 4CEOA 3MN6A 4CJPA 4KHYA 3WNGA 3D6RA 1OH7A 1BU6O 4RW6A 3DLHA 2G8KA 5ELZA 3L3UA 4E89A 3QEVA 3VA0A 3KD5E 1IG8A 4Z94A 5I9EB 4FSVA 4XEIA 1N32K 3GOIA 4GY2B 4J2EA 5BN9A 3O4QA 1QZ5A 1YI2N 2PYLA 3NBPA 2KZZA 4E7KA 4LF8K 2VG5A 3HVRA 1YITN 1RDAA 3AVJA 3BZCA 2IC3A 3MXIA 1KAZA 3HVTA 4DQ8A 3OYBA 1Q81O 4B08A 3IMXA 3C6UA 4I2QA 1TUUA 5KQDA 1HNXK 1E3MA 1TVRA 4DV4K 2F7TA 3NF9A 4FPAA 4B1UB 2YKNA 1C1BA 3CCJN 3CCRN 1LW2A 4CK3A 4CIFA 1KAXA 3AVIA 4FLYA 4I6MA 4M63C 1TK5A 3F5TA 3WXKA 1TYQA 3M8PA 4M3YA 1NKCA 1YVUA 3AY9A 4BGAA 1NNEA 3HK2A 4FK2A 2OZSA 3HYFA 3CC4N 1WSIA 4FWKA 1QVFM 2QEXN 3QFUA
chains in the Genus database with same CATH topology
4DV1K 1FJGK 5LMUK 1XMQK 4JYAK 4DR6K 1HNWK 3J81O 2ZM6K 4YHHK 3OTOK 4NXNK 4DV3K 2F4VK 4JI1K 1IBKK 4LFCK 4JI0K 4LFAK 3J7YP 3T1HK 4LF9K 2HHHK 4V19S 4DV7K 1XMOK 1XNRK 4LF6K 2VQEK 2UXCK 1HR0K 5A2QO 4DV5K 4X66K 2E5LK 4JI3K 4NXMK 4DR2K 4JI4K 4CW7B 4JI2K 2UU9K 5FLXO 4DR1K 4GKKK 5AJ3K 3J80O 4JI8K 2UUBK 2UUCK 4B3RK 4DR4K 1N32K 2UUAK 5IWAK 5IT9O 4CVNE 1IBLK 4LF8K 5LL6Z 4K0KK 3JAMO 4JI7K 4DUYK 3T1YK 3J7AP 2UXDK 1IBMK 4LF7K 4JI6K 4X65K 4X62K 1J5EK 4DV2K 1HNXK 5LMNK 2UXBK 4DUZK 4DV4K 4X64K 4DR7K 4DR3K 4B3MK 4AQYK 4DR5K 1N34K 1N33K 4JI5K 4KHPK 1XNQK 4LF5K 4LFBK 4B3SK 4DV6K 1HNZK 4DV0K 4OX9K 4JV5K 4YY3K 2VQFK 5BR8K 1N36K 4GKJK 4B3TK 1I94K 4LF4K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV1 K;  1FJG K;  5LMU K;  1XMQ K;  4JYA K;  4DR6 K;  1HNW K;  3J81 O;  2ZM6 K;  4YHH K;  3OTO K;  4NXN K;  4DV3 K;  2F4V K;  4JI1 K;  1IBK K;  4LFC K;  4JI0 K;  4LFA K;  3J7Y P;  3T1H K;  4LF9 K;  2HHH K;  4V19 S;  4DV7 K;  1XMO K;  1XNR K;  4LF6 K;  2VQE K;  2UXC K;  1HR0 K;  5A2Q O;  4DV5 K;  4X66 K;  2E5L K;  4JI3 K;  4NXM K;  4DR2 K;  4JI4 K;  4CW7 B;  4JI2 K;  2UU9 K;  5FLX O;  4DR1 K;  4GKK K;  5AJ3 K;  3J80 O;  4JI8 K;  2UUB K;  2UUC K;  4B3R K;  4DR4 K;  1N32 K;  2UUA K;  5IWA K;  5IT9 O;  4CVN E;  1IBL K;  4LF8 K;  5LL6 Z;  4K0K K;  3JAM O;  4JI7 K;  4DUY K;  3T1Y K;  3J7A P;  2UXD K;  1IBM K;  4LF7 K;  4JI6 K;  4X65 K;  4X62 K;  1J5E K;  4DV2 K;  1HNX K;  5LMN K;  2UXB K;  4DUZ K;  4DV4 K;  4X64 K;  4DR7 K;  4DR3 K;  4B3M K;  4AQY K;  4DR5 K;  1N34 K;  1N33 K;  4JI5 K;  4KHP K;  1XNQ K;  4LF5 K;  4LFB K;  4B3S K;  4DV6 K;  1HNZ K;  4DV0 K;  4OX9 K;  4JV5 K;  4YY3 K;  2VQF K;  5BR8 K;  1N36 K;  4GKJ K;  4B3T K;  1I94 K;  4LF4 K; 
#chains in the Genus database with same CATH topology
 3C65 A;  2HVI A;  3ZT0 A;  1BO5 O;  4B1V A;  1OKJ A;  3A0I X;  1SL1 A;  2ZD1 A;  4H5W A;  5D3G A;  1D9F A;  1NWK A;  4H8K A;  3BGR A;  1RBV A;  2ZM6 K;  5AQQ A;  3SUN A;  2A6A A;  3ZSR A;  4BE1 A;  1T03 A;  3WNH A;  4PQU A;  3O80 A;  4FCY A;  1JLG A;  3TU5 A;  3J7Y P;  4BRH A;  4CEC A;  4ISE A;  3HRG A;  1BIZ A;  2YHA A;  3ZX2 A;  3K57 A;  4DQR A;  4DTN A;  3DRR A;  3ITH A;  5HRS A;  1S1T A;  4C8M A;  1NBW A;  1EWR A;  4XH1 A;  5CR4 A;  5AQG A;  1L5U A;  1RDD A;  3VGL A;  3ZT4 A;  5AJ3 K;  3OYG A;  2PZS A;  2IVP A;  3ZET A;  3LPT A;  2QKB A;  1P90 A;  4ICL A;  2P9U A;  3L2U A;  1U04 A;  4BWM A;  3SMP A;  4M7Y A;  3UE5 A;  1LOT B;  2E6L A;  2I7N A;  3VGK A;  1D8Y A;  4KBO A;  3S41 A;  4F4K A;  4WQ5 A;  4Z4E A;  3V9S A;  3D0P A;  3V4I A;  3EY1 A;  5EXW A;  1U6Z A;  3QEW A;  4BDY A;  3V1Q A;  1EX4 A;  3J7A P;  4BQZ A;  1KRP A;  1TV6 A;  5TKY A;  3CFO A;  1C1A A;  1K8K A;  3PY8 A;  2B5J A;  3L6Q A;  1U2V B;  3KK1 A;  1TAQ A;  3DLL L;  2IAJ A;  3LAL A;  1W9H A;  3WEE A;  3ID6 A;  2RN2 A;  4IWV A;  5AQO A;  4PUO A;  1BI4 A;  3ZT3 A;  1B92 A;  1QZ6 A;  1RT6 A;  2ZJP L;  3VQ4 A;  1S5J A;  4OX9 K;  1ILY A;  2YNI A;  2OPR A;  2I7P A;  2X78 A;  1E4F T;  1NGB A;  4OKJ A;  3DLB A;  2OYQ A;  3VOV A;  2Q36 A;  3GL1 A;  5EOY A;  2V51 B;  4FJM A;  3EKU A;  1ZBS A;  4CEZ A;  4B3T K;  4A5B A;  4CFB A;  4OPJ A;  1J54 A;  4CJS A;  3QNN A;  3ZX3 A;  2VWJ A;  2JWK A;  1JLE A;  2ZE2 A;  4DU3 A;  4DTU A;  4YOW A;  3OYC A;  3ULE B;  4PA1 A;  4U67 L;  3L3V A;  3BEX A;  4CGD A;  4JKA A;  3CFR A;  3DWL A;  4CGI A;  1HPZ A;  3KD1 E;  2E20 A;  4CJE A;  1M1K O;  4AH9 A;  3LP3 A;  2VQE K;  5LJW A;  4IXC A;  4JS5 A;  3VGM A;  3QLH A;  3U9Z A;  2HOE A;  1N8R O;  3J7Z O;  3A8Y A;  3SYZ A;  3DLE A;  3VQ9 A;  4CW7 B;  3OYL A;  5AFU A;  4CGJ A;  2G8I A;  3JYT A;  3VTH A;  2P9K B;  1CZA N;  2F96 A;  4ZHR A;  3V9W A;  4BE2 A;  4I6M B;  3U8X A;  1FKP A;  3PLA A;  4K8X A;  1WAF A;  1TYQ B;  4AM7 A;  3OYA A;  4B1Z A;  3C6A A;  2KFN A;  1HKC A;  2E2N A;  2QWP A;  4M7X A;  4IBN A;  4KH4 A;  1IBM K;  1W97 L;  2IVN A;  1JCF A;  1OH5 A;  3NHG A;  4DTP A;  1J5E K;  2P9P B;  4I9L A;  5M1Q A;  4J2D A;  3CME N;  1NMD A;  4GNI A;  1HYS A;  4N41 A;  1GOA A;  2AP1 A;  2QTD A;  4JKD A;  4CF2 A;  4EP4 A;  4WQ4 C;  2QWM A;  4KHP K;  5C10 A;  4AF1 A;  4YOU A;  4LFB K;  1YJ9 N;  1A5V A;  4DTR A;  1K9M O;  3HP9 A;  3AA2 A;  3F2K A;  3QEX A;  4KI4 A;  4FWO A;  4FLT A;  1RBT A;  3RR8 A;  2PFU A;  4YY3 K;  4M3X A;  1DGK N;  3VEW A;  3M8S A;  1KAY A;  4IDK A;  3M3Z A;  4BC4 A;  2YHB A;  5BRE A;  5HRR A;  3SUQ A;  1IKY A;  3CJC A;  1GLF O;  4PL7 A;  1GLL O;  5H1S Q;  4DV1 K;  1Q9Y A;  2HF3 A;  4IZ9 A;  1RT4 A;  1U47 A;  3TWH A;  3MCP A;  1WBD A;  1LWF A;  2RE2 A;  3CI5 A;  2QWO A;  4IO9 L;  3ZET B;  3D45 A;  4LFC K;  3FZF A;  1ZBL A;  2GTD A;  4CZG A;  1Q9X A;  4LSL A;  3MN5 A;  3C0B A;  4AHS A;  3TTD A;  4HUF A;  1HJR A;  3FFI A;  1RT3 A;  3MDQ A;  4CK1 A;  3QER A;  3HZ6 A;  5AQX A;  2ASM A;  4BY9 C;  3AO5 A;  5DM6 L;  1FK9 A;  2QK9 A;  3KZB A;  3HPG A;  3QES A;  3QFP A;  1E4G T;  1K6Y A;  4H0P A;  3QO9 A;  3DYA A;  3ZLJ A;  4DR1 K;  1NJW A;  2G8W A;  1WSH A;  3OBY A;  3PIP L;  4KPY A;  1MWK A;  2P9S A;  4O0J A;  1S9G A;  1P8Z A;  2F9W A;  3K5O A;  1HMV A;  4NCA A;  5KPZ A;  3B8A X;  5HRN A;  3WEE B;  5IT9 O;  1IBL K;  4M41 A;  2YV0 X;  2FLO A;  3SQ0 A;  1S9E A;  1V4T A;  1HKB A;  2B6A A;  3CG7 A;  1C1C A;  5JVH L;  2D5R A;  4RG8 A;  1VRU A;  2GUP A;  3NH0 A;  4YFU A;  1XC3 A;  4DF4 A;  5F2R A;  4FM0 A;  3G0Z A;  1IKW A;  4BRL A;  2YNH A;  3QIC A;  3UB5 A;  2E1Y A;  5AQM A;  4LSN A;  3NFA A;  1VSM A;  3KK7 A;  1HQE A;  4LF5 K;  2Q1N A;  4FJJ A;  1VSJ A;  2QXF A;  1T6C A;  2WC9 A;  3OYK A;  4I9Q A;  4DV0 K;  3RWU A;  4F9O A;  1J6Z A;  4M3R A;  4M3U A;  1QQO A;  1FW6 A;  1BCM A;  1NGC A;  3AA5 X;  3CET A;  5AQW A;  3ENO A;  3CF5 L;  3CCS N;  5M1P A;  4A59 A;  3KK2 A;  4JYA K;  2NLX A;  3CM5 A;  3OS0 A;  4A62 A;  1TKT A;  4CHO A;  4O55 A;  3SBT A;  2QXL A;  3O9U A;  2AJQ A;  1YT3 A;  4DV3 K;  4BDP A;  3AVK A;  2OPS A;  4CJU A;  5TKW A;  3CC2 N;  4LC9 B;  4JN4 A;  3G6E N;  3VQC A;  1RTD A;  2QW9 A;  1RDU A;  3A5O C;  2OA8 A;  4NCB A;  1LV5 A;  4KTQ A;  3MEG A;  1LWE A;  3A2F A;  2CH6 A;  1YAG A;  3AVF A;  4RW8 A;  3ZSO A;  4FJI A;  4O5B A;  3L8B A;  2OAN A;  1QSS A;  1YJN N;  4PHT X;  3MX5 A;  1BHL A;  2CGL A;  5AQU A;  4JKG A;  1QVG M;  3RMC A;  5GAH P;  3PSF A;  4FJ5 A;  1HJO A;  3F73 A;  1T8E A;  1RDC A;  4CHQ A;  3VA3 A;  1NLV A;  5M1N A;  3NF7 A;  4OO1 J;  1RTJ A;  3VQ7 A;  4CF1 A;  5KQ8 A;  3DLG A;  1TL3 A;  3K2P A;  1NK5 A;  2RF2 A;  2P9I A;  3BP8 A;  2O8C A;  3E9O A;  4KFB A;  4DFK A;  3PO4 A;  3CCU N;  3LP2 A;  3LDQ A;  1QSL A;  4C8K A;  1JXE A;  4RTF D;  5M1K A;  1J9A A;  3O9T A;  3TTC A;  1ASV A;  4L3Q A;  3LPU A;  2NNW A;  2E1Z A;  3CD6 N;  2HHU A;  1EO1 A;  2UXB K;  3FZK A;  5BRH A;  4H5R A;  4AIL C;  2PY5 A;  3A5M C;  2RPI A;  3SK3 A;  1VQ9 N;  3ENB A;  3AAQ A;  1XUP O;  3BUZ B;  5AQL A;  1BCO A;  3UKU B;  1S3X A;  4E1N A;  4OJR A;  1HNZ K;  3OYH A;  4F3T A;  4OLA A;  4HUE A;  4DMN A;  3THY A;  3QBW A;  2X6N A;  2VQF K;  1MA9 B;  3OYE A;  3QIO A;  4DQQ A;  1MWM A;  4B9V A;  3ZYY X;  3C6H A;  3NH2 A;  1NJZ A;  3TTF A;  3I8D A;  1Z26 A;  4JHD A;  3CCE N;  4BRF A;  3OHR A;  3V6D A;  2GBZ A;  1VHX A;  4FLU A;  3VQB A;  2QM1 A;  2JWL A;  2P9S B;  4MO5 A;  4GVE A;  4WQ4 A;  3BY5 A;  3VTI A;  3O9R A;  3QIN A;  1WB9 A;  1WN7 A;  3UKR B;  1N6Q A;  1DTT A;  4CD1 A;  3VEX A;  1NM1 A;  5A2Q O;  1HR0 K;  1WAJ A;  4CZF A;  1ATS A;  4H5V A;  4H0V B;  4HHT A;  2YHX A;  3QET A;  3CXC M;  4WCE L;  1U2V A;  3VPZ A;  2V7Y A;  3E66 A;  4DR2 K;  4Z4H A;  4JI4 K;  1WSF A;  4W5Q A;  1S1U A;  3A5L C;  4CZL A;  4FJK A;  3AVL A;  4DFM A;  1HX1 A;  1YXQ A;  3FZH A;  3DI6 A;  1VQM N;  1DT9 A;  4CF0 A;  1GLD G;  4MO4 A;  3L2V A;  3VEZ A;  2KQ2 A;  3WNE A;  2NRR A;  1NGG A;  1YJW N;  4FM2 A;  1QHA A;  4DU1 A;  4LH5 A;  4DUY K;  3AGK A;  1L3V A;  4CGG A;  2BTF A;  4XIU A;  5JS1 A;  4H0Y B;  4FW1 A;  2W6K A;  2BGG A;  3ULE A;  4QS7 A;  4JKF A;  1QQN A;  1WOQ A;  2ZJR L;  3TSP A;  3OYM A;  4K25 A;  5M1F A;  3PSI A;  3FE1 A;  2XY7 A;  4B3O A;  4FL9 A;  4H5T A;  4BQL A;  2E2Q A;  4ID5 A;  4BC5 A;  1BGX T;  1YHQ N;  3BDP A;  4BRC A;  3T19 A;  4CCH A;  1SKS A;  3DM2 A;  3AAP A;  3MEC A;  3V9Z A;  3KIO A;  4IG3 A;  1OVQ A;  4ILG B;  3NCI A;  4U7B A;  1N36 K;  1C0F A;  1FXX A;  2NRV A;  3HL8 A;  3K5L A;  1MU2 A;  1X3M A;  4BR7 A;  1DKG D;  2P9K A;  1IJJ A;  1VSD A;  2YKM A;  5EU7 A;  3LWL A;  4JKG B;  2WOM A;  1T3V A;  4DTM A;  1TUY A;  4DQI A;  2F4V K;  5BPN A;  1GLJ O;  1XHZ A;  3QIP A;  1N5Y A;  2P9I B;  3MCA B;  3T1H K;  4LFA K;  2DTU A;  2HHH K;  4V19 S;  2O8C B;  1BDG A;  1EP4 A;  4FLX A;  1ZYQ A;  1NK4 A;  1X3N A;  3AVM A;  4EP5 A;  4E7I A;  2P9P A;  3V81 A;  4BVO A;  4J8F A;  1DEJ A;  3KJV A;  4FVU A;  4DG1 A;  3E01 A;  1HQU A;  1NGH A;  4EFH A;  4IOC L;  1UA1 A;  3E9L A;  1YF5 L;  3R9P A;  4EHU A;  4B1X B;  1S6Q A;  2HHW A;  1NK9 A;  4DTO A;  4HVJ A;  3NVM A;  4BDZ A;  5AQS A;  4C1N I;  3SQ1 A;  3IG1 A;  1GLB G;  4JI8 K;  4G9Z A;  4BR2 A;  2IDO A;  3SV3 A;  2OTJ N;  3VF2 A;  1T44 A;  4B8C A;  4CEQ A;  3BF3 A;  4UY8 O;  3I8B A;  4BRN A;  3SQ4 A;  3O8M A;  2W40 A;  4KB1 A;  1KD1 O;  3JAM O;  4YDU A;  5CHI A;  1NGE A;  3VEV A;  3R1X A;  5J2N A;  4O8U A;  3CQX A;  3THY B;  3CQY A;  4LF7 K;  2KFZ A;  2ZGZ A;  4RWT A;  1BL3 A;  4ISG A;  4X65 K;  1VQ4 N;  4X62 K;  2Z1H A;  3E9P A;  1JL2 A;  3PIO L;  3AVG A;  4JHD B;  4N56 A;  5AQV A;  3LWM A;  3TAB A;  4KHS A;  3RMD A;  4AQY K;  3RSE B;  5KGW A;  4CI6 A;  1SKW A;  4FK4 A;  1XHX A;  3NF8 A;  4M3T A;  2HB5 A;  1X9M A;  4ID1 A;  2GX9 A;  5JLH A;  3NMU A;  4R79 A;  3N4Q A;  1U4B A;  3KTQ A;  4FVM A;  3DMJ A;  5C2F A;  3TAQ A;  3CJA A;  2XO7 A;  1UAX A;  4O44 A;  5BRF A;  2ZF5 O;  3QEI A;  3CCQ N;  4Q5V A;  1JLC A;  4JRQ A;  3JSM A;  2YNG A;  1DLO A;  5K14 A;  3DXK A;  1ASU A;  4CZI A;  3NGZ A;  4F2S A;  3QB0 A;  3RRH A;  3DAW A;  3LAK A;  3AO4 A;  2VGN A;  5I3U A;  3WXI A;  4B9U A;  4Y0W A;  4CES A;  1BUP A;  1X1P A;  3AO3 A;  5C25 A;  3PX4 A;  2QWQ A;  3LL3 A;  1UWB A;  4QCL A;  2O8D A;  1S22 A;  2D0A A;  2ZGY A;  5GIN A;  1I3A A;  1OH8 A;  2FF3 B;  3C7N A;  5E41 A;  5AQI A;  3R3L A;  4DV7 K;  3VQD A;  4FJ9 A;  3K58 A;  3C6T A;  4OLB A;  4AHR A;  2Z1G A;  4WF9 L;  1JLF A;  2P5O A;  4IJN A;  4JI3 K;  1F21 A;  4DTS A;  3OYN A;  4KH5 A;  5BPM A;  4PKH A;  1XI1 A;  1TK8 A;  4CHP A;  3QML A;  4Q0B A;  3CM6 A;  2HVH A;  1RT2 A;  3MWP A;  4Z4I A;  2GUI A;  2UUC K;  3TR8 A;  3ATU A;  3M1F A;  2UYT A;  4CJW A;  4DHY A;  3D2F A;  2O4G A;  1CXU A;  4CVN E;  4NCG A;  4BR0 A;  2JLE A;  4DSL A;  4K41 A;  4YOY A;  5LL6 Z;  5KGX A;  4OGE A;  4F2R A;  3I33 A;  2DFF A;  1BA0 A;  3M6G A;  2HNY A;  4I2P A;  1JLB A;  2YJE A;  4FWS A;  3DOK A;  3DRP A;  4FYD A;  1JL1 A;  4E7L A;  2Y1I A;  5JLF A;  1GOC A;  3OJS A;  1EXQ A;  3S3O A;  4WFB L;  4DR7 K;  1KFD A;  4ELT A;  1OH6 A;  1Y64 A;  2W6L A;  2NRZ A;  4OPA A;  4HTU A;  1HRH A;  4CJV A;  1NGF A;  1JCE A;  2KHO A;  3MN9 A;  4CE9 A;  1VQK N;  3DOL A;  4O0I A;  3EYZ A;  3NGI A;  4ELV A;  1VQ7 N;  1KQS M;  2E4L A;  3CMA N;  3AVA A;  1NGA A;  1NK7 A;  3DRS A;  1O1W A;  4A57 A;  4QOZ B;  4DLG A;  4GKJ K;  3U9D A;  2BUP A;  3QBX A;  1ZC6 A;  2QWL A;  1NJY A;  4YHH K;  4NXN K;  4CF8 A;  4FZY A;  2P9L B;  3LP1 A;  3TPQ A;  2GEL A;  4CBU A;  3TI0 A;  4LF9 K;  1SAZ A;  3M8Q A;  4AHT A;  1NK8 A;  1BIU A;  4DV5 K;  5FPD A;  1NKE A;  3P4I A;  2E5L K;  2F8T A;  3NE6 A;  4BG8 A;  3SAG A;  1YVN A;  3NAE A;  1NGJ A;  4JI2 K;  1K73 O;  2UU9 K;  3L2Q A;  1BQM A;  4Y1C A;  4MDA A;  3UKU A;  3CQ8 A;  3D7E O;  3KWG A;  5FPM A;  4CHN A;  3Q7B A;  3VES A;  2VG7 A;  4B9Q A;  4A2A A;  2GWJ A;  5AQF A;  1C0M A;  3HT3 A;  3LAN A;  4IKF A;  4GVM A;  1M90 O;  4OGC A;  1HYV A;  2HND A;  3VF6 A;  1VSK A;  3ATV A;  1NK0 A;  3DXK B;  1SV5 A;  4HTL A;  2NRT A;  2A1R A;  4G1Q A;  5GIP A;  3WXJ A;  3H45 C;  3LZJ A;  1U49 A;  4PY5 A;  5AQJ A;  3CJ9 A;  2KLA A;  3CPW M;  1BIS A;  2ZJQ L;  4LY7 A;  3T3F A;  1LCU A;  4UQG A;  3UKR A;  4N47 A;  2F9T A;  1Z25 A;  3P5J A;  5J2M A;  3HM8 A;  2O8D B;  4BRM A;  4CFD A;  3C7N B;  5J1E A;  2PYJ A;  4RW4 A;  4CZK A;  4FJ7 A;  5CY4 A;  4BWJ A;  3HXM A;  2DPN A;  3AA3 A;  2ZQB A;  2LSN A;  1RGI A;  3IFR A;  5JS2 A;  1IKV A;  5J2Q A;  3ZEU A;  5EVZ A;  1W0H A;  3PUF A;  2BDP A;  4DR6 K;  1NG9 A;  2IVO A;  3KLG A;  1HNW K;  4CJ5 A;  1QE1 A;  3HM9 A;  2W41 A;  3P38 A;  4CGH A;  3G71 N;  3QDK A;  3U4L A;  4JK7 A;  2Q31 A;  1RT7 A;  3D2F B;  5I42 A;  2FSJ A;  4BRP A;  5HRP A;  2ASP A;  3LDO A;  1ATN A;  4LF6 K;  1KVB A;  2Q0U A;  4CIE A;  2E2P A;  1RFQ A;  1VQO N;  4X66 K;  1YUW A;  1JKH A;  2I5J A;  2A42 A;  3RRG A;  3FFK B;  3DXM B;  4NXM K;  2VWK A;  3ZCM A;  3SZ2 A;  2ITM A;  4DFJ A;  3VN5 A;  1Y97 A;  3L2R A;  1ESV A;  3VQ6 A;  1GLC G;  3GE1 A;  2G8F A;  4FW2 A;  3WUH A;  4O4G A;  4E1M A;  5C0Y A;  4GV6 A;  3SCX A;  4ZTF A;  4DR4 K;  4IO8 A;  3ASM A;  3LDN A;  1X9W A;  1SUQ A;  2IGI A;  1EKE A;  3F9M A;  3T7Z A;  5J2P A;  4DSJ A;  4JI7 K;  4BRI A;  2YCH A;  2VG6 A;  3MED A;  3OYI A;  2WON A;  5FRO A;  4CEB A;  4DV2 K;  2RHK A;  2YHW A;  4KH6 A;  1W2B M;  3HOS A;  4BE0 A;  4CJQ A;  2XHB A;  3PO5 A;  2R7Y A;  2A3Z A;  3PX6 A;  1I39 A;  4KHW A;  3AV9 A;  4CBW A;  3V9U A;  4WYB A;  2HHT A;  1T05 A;  3HTV A;  4CJ7 A;  4Z4C A;  2VWB A;  1QHT A;  2D0O A;  3TAF A;  5GAE P;  3LZI A;  1KTQ A;  4C1N K;  3OS2 A;  4DS4 A;  1EET A;  4JV5 K;  1UOC A;  4WQ5 C;  3DJC A;  1L3S A;  5AZI A;  5AZJ A;  3GG4 A;  1X9J A;  2NRW A;  3H3O B;  3HOT A;  4MQ3 A;  3AVN A;  3DLR A;  1QSY A;  4DCH A;  3B6O A;  2YX6 A;  1VQ8 N;  3G10 A;  1B9D A;  4DLE A;  4CER A;  2P5G A;  3HST B;  1FKO A;  2NRH A;  4B1Y B;  1IO2 A;  4HWI A;  1HYZ A;  3MWT A;  1J53 A;  4JLH A;  3LP0 A;  3QEP A;  4BC2 A;  3HP6 A;  1RTI A;  1JLQ A;  1YTA A;  1XC9 A;  3MXJ A;  4J2A A;  4DS5 A;  3VF4 A;  3OY9 A;  3CCL N;  3CER A;  3RMA A;  1QQM A;  2FC0 A;  3ZSW A;  3RSE A;  1IH7 A;  2CGK A;  3VQ5 A;  1KVC A;  2ATQ A;  4IEE A;  1G15 A;  1VK0 A;  4KKO A;  2PAV A;  3HJF A;  2V7Z A;  3O1B A;  3OS1 A;  3RMB A;  4JD2 B;  3NF6 A;  1QTM A;  4CHZ A;  1CLQ A;  4JS4 A;  3KLF A;  2HMI A;  4DF8 A;  4YOT A;  3O4W A;  5DM7 L;  2P9N B;  4KHN A;  2HHX A;  4I7F A;  4E1J A;  4FO0 A;  1IG9 A;  2YJF A;  5LY3 A;  1OVY A;  3P39 A;  4CJF A;  1W7A A;  4C23 A;  4DSF A;  4DFP A;  4ILJ A;  3E1Y A;  3T1Y K;  4KV8 A;  4FXD A;  1KFS A;  3LAM A;  5DK5 A;  3L0Q A;  5C2D A;  1V4S A;  3SV4 A;  4FJ8 A;  3R8E A;  2XRI A;  3TSU A;  3ZEU B;  3MX2 A;  4EZ6 A;  5MLC Q;  4W5O A;  3NVK A;  2QWR A;  1VSI A;  1KLN A;  1T6D A;  1KCF A;  4JKB A;  3SUO A;  4CFA A;  2E88 A;  4FWM A;  4QS8 A;  1BQN A;  3ZT1 A;  4JKC A;  1EWQ A;  3FGU A;  2XY5 A;  4FPB A;  1HLU A;  3AVB A;  4BR5 A;  2E6M A;  4CEE A;  2D0P A;  2YHY A;  4JEP A;  1U48 A;  1NMN A;  4QAG A;  5C42 A;  1C6V A;  2O8F B;  4BVP A;  3JS6 A;  5AQY A;  4H0T B;  5ADX H;  1VSL A;  1H1V A;  4C8L A;  2HBJ A;  4BC3 A;  4GW6 A;  2Q0R A;  4CEF A;  4DTJ A;  4DSK A;  4JKH A;  3EKS A;  4CZE A;  1VQP N;  1Q82 O;  4CGF A;  4NB4 A;  4FJG A;  4BRG A;  2IIR A;  3KK3 A;  2EWS A;  1CXQ A;  1K8A O;  3CC7 N;  2UXC K;  3WQT A;  2BAN A;  3OBW A;  3KVG A;  4HCC A;  5DMR A;  5AQR A;  3O08 A;  4CF9 A;  5KPT A;  4DQP A;  5M1O A;  3M5R A;  4H4M A;  4JNE A;  3V1R A;  2W42 A;  3T69 A;  3VEY A;  2HBL A;  1X9S A;  4O8K A;  2WTU A;  1RTH A;  5KTQ A;  5C24 A;  4KO0 A;  3SQ2 A;  1WSE A;  4Y1D A;  3F9K A;  1J5O A;  1BA1 A;  4H0O A;  3J80 O;  3ENH A;  5GIO A;  1KVA A;  1A5W A;  4YOV A;  4HUG A;  4E7J A;  3THX A;  4PKG A;  4BRA A;  2BH1 A;  3TAN A;  5CE3 A;  1TKD A;  3MAQ A;  4B9S A;  1NOZ A;  3S9H A;  4K42 A;  4K0K K;  2JGU A;  3SUP A;  2FSN A;  4HCB A;  1IV0 A;  5AR0 A;  2GWK A;  5AZI B;  4FWQ A;  3K9J A;  4DB3 A;  5AZJ B;  4OKK A;  3THW A;  1MDU B;  3GDQ A;  3SPZ A;  3IDH A;  5LMN K;  4BGB A;  2A5X A;  2E8A A;  2P9L A;  3AVH A;  1RT5 A;  1R0A A;  4FJH A;  1S1W A;  1Q7Y O;  3OA9 A;  4RCH A;  3LDS A;  3TSQ A;  2HHV A;  4JI5 K;  1Q18 A;  1QQC A;  3FLC O;  2HF4 A;  2WUS A;  3I0S A;  4J2B A;  2O8B A;  1B9F A;  1O13 A;  2O8E B;  1ZXO A;  1KXP A;  5KRS A;  3HBT A;  5KI6 A;  5E84 A;  1RIL A;  1T7P A;  1GOB A;  2OCE A;  4KRF A;  4PWD A;  4IFE A;  2Z1I A;  4FWL A;  3VQE A;  3C94 A;  2FBV A;  2EHG A;  1NOY A;  4DSE A;  3VEO A;  1LAV A;  1NJI O;  1C0G A;  4NYF A;  3S3N A;  3JXU A;  3MXM A;  2HST A;  5JVG L;  2HW3 A;  2D1K A;  1QS4 A;  4CD3 A;  2DFH A;  3WXL A;  1TKZ A;  5HRO A;  5JIC A;  4TSX A;  4GV9 A;  1WUA A;  2P51 A;  1KC8 O;  3SAF A;  1JXB A;  2DY4 A;  3Q7C A;  3HSC A;  4DKW A;  1JCG A;  3AVC A;  3K59 A;  4XH4 A;  2RKI A;  4N5S A;  3B6P A;  5AQZ A;  3WNF A;  3FZM A;  1D5A A;  3DLK A;  4PL8 A;  4AM6 A;  4BRO A;  5GAD P;  3AA4 A;  3EZW A;  3CYM A;  1NU0 A;  3D2E B;  4AHU A;  3ZT2 A;  1HKG A;  4LH4 A;  3VET A;  1KLM A;  2GEM A;  1TAU A;  3IKM A;  2QA4 N;  2UUB K;  2BE2 A;  4ILH A;  1RCH A;  1SQK A;  4C8O A;  2ASO A;  3K5M A;  3CCM N;  3RTV A;  3H1Q A;  3VQ8 A;  4DQS A;  4MDB A;  3ZSZ A;  3J8A A;  2V52 B;  3O3F A;  4PKI A;  1SS6 A;  3O6W A;  4YOR A;  5BRD A;  4JI6 K;  1G99 A;  4CZJ A;  2EX3 A;  1ITG A;  1ATR A;  3WXM B;  4Z4G A;  2IS3 A;  4OPK A;  4R5P A;  1NK6 A;  4X64 K;  4CJ3 A;  4KTZ A;  3IS9 A;  1NGI A;  3ZSV A;  5FPN A;  1N34 K;  5AQK A;  4MLH A;  4B9T A;  3GBT A;  4E0D A;  3P31 A;  4RW7 A;  4JK8 A;  4JK9 A;  1VQN N;  3BZK A;  4KAZ A;  1S1V A;  4B3S K;  3L4I A;  4DV6 K;  3NDK A;  3NGY A;  2HHS A;  3L4Q A;  3DXM A;  3OYD A;  1Q8I A;  4CJK A;  4KTW A;  4CJ4 A;  3BF1 A;  3LM9 A;  1S1X A;  1CZ9 A;  2HHQ A;  1SL2 A;  2ETJ A;  2Y1J A;  3WQU A;  4EAH D;  4A61 A;  3IAY A;  2HMP A;  4E3S A;  5LMU K;  1XMQ K;  1ZBU A;  1ZBH A;  4CJR A;  1NGD A;  1IKX A;  4CJT A;  4AHC A;  3G4S N;  3R6M A;  4FK0 A;  5CYM A;  3THX B;  1WSG A;  4GV3 A;  4CZH A;  1XWL A;  1RBR A;  3N4P A;  4KI6 A;  4IDH A;  1RDB A;  3K9K A;  2QI2 A;  1LWC A;  2G8V A;  2KW4 A;  4NLB A;  3SPY A;  3H3N O;  3O3H A;  1VSF A;  2NRX A;  3ZX0 A;  3THW B;  2OPQ A;  2KTQ A;  4FJL A;  5SZT A;  1RBU A;  1L3T A;  4JRP A;  2QKK A;  4W5N A;  2B4J A;  4CBX A;  2ITG A;  2VGM A;  4FM1 A;  3EZ5 A;  5HL7 L;  4M42 A;  3KLH A;  5CZ2 A;  2A41 A;  2WBN A;  1LAW A;  4W5T A;  4B1W B;  1D4X A;  2PBD A;  3ZSX A;  2O8B B;  3ULD A;  4IFV A;  4FZZ A;  1WBB A;  4IJA A;  2X74 A;  2OPP A;  3W0L A;  5FPE A;  1XQS C;  2QWN A;  3LM2 A;  3P83 D;  1RBS A;  1VAZ A;  4ZTJ A;  3S3M A;  3MMV A;  2CGJ A;  4DWI A;  3THV A;  3I55 N;  4MLE A;  3AAR A;  3HPO A;  3IUC A;  3TAR A;  3OYF A;  4KRE A;  4K8Z A;  4FWN A;  2Q3S A;  3WT0 A;  3RVC A;  4EHT A;  1XNQ K;  4M45 A;  4KB0 A;  4E7H A;  1C0U A;  1YIJ N;  2NUB A;  3O1W A;  1HUX A;  5BN8 A;  4F3O A;  4F8R A;  5EX5 A;  5ADX A;  4K43 A;  2P9U B;  4NYN A;  2G8H A;  4WFA L;  3U3G A;  5BR8 K;  3SJH A;  2FBX A;  4CHY A;  5HBM A;  4MFB A;  2D4W A;  4JD2 A;  4BRK A;  3KLI A;  4Z4F A;  2F8S A;  1VQ6 N;  1WSJ A;  4EZ9 A;  4WFN L;  2P9N A;  4BG9 A;  3MN7 A;  4YNQ A;  5HLF A;  1BOT O;  1ZBF A;  2HBM A;  1JLA A;  3QNO A;  4B9M A;  2KZM A;  2YNF A;  1K8K B;  3HPH A;  5AQH A;  2J4R A;  4JI0 K;  3FZL A;  4YOX A;  3M8R A;  1TL1 A;  5EY4 A;  5AQP A;  3VQA A;  1XMO K;  3U3Y A;  5HP1 A;  3KKS A;  1D9D A;  4BRQ A;  4FLW A;  2CH5 A;  3K0S A;  1BI4 B;  2OTL N;  4E19 A;  3VMF B;  2FBT A;  1NKB A;  4RW9 A;  3IRX A;  2Z1J A;  5FLX O;  2A40 A;  4A2B A;  4BRD A;  4IEI A;  4XH5 A;  5FRN A;  3SAH A;  4FOE A;  4H5N A;  5B8H A;  5AQN A;  3HO1 A;  3SJJ A;  3EO3 A;  4B3R K;  3CHW A;  2UUA K;  4KHU A;  5IWA K;  4FJX A;  4IOX A;  4WE1 A;  4FJN A;  2O8F A;  4CFC A;  1R59 O;  2GV9 A;  5JMV A;  4M3Z A;  3VEN A;  1BG3 A;  4ISF A;  4CK2 A;  3EE8 A;  3P1G A;  4EIA A;  1L3U A;  4FWP A;  4DR3 K;  1JJ2 M;  1HNV A;  4QS9 A;  1RT1 A;  3I56 N;  4DR5 K;  1N33 K;  3H6E A;  2YI1 A;  3ID8 A;  3SLC A;  3KLE A;  1SZ2 A;  2IOC A;  1HPM A;  3OW2 M;  4B8A B;  1RDW X;  1CZB A;  4FWR A;  4C8N A;  4B9L A;  2Q2R A;  3ALY A;  3ISN C;  4NO7 A;  4OVL A;  4FLV A;  3OYJ A;  2VCP A;  4W5R A;  4O5F A;  4Z0U A;  3V9X A;  1TGO A;  3H46 O;  2D0C A;  3CPE A;  2H3G X;  2NZT A;  4YDU C;  1WNS A;  3TAE A;  3MEE A;  1I94 K;  4LF4 K;  4LD0 A;  1HNI A;  3EN9 A;  1U45 A;  4DU4 A;  4CEA A;  1LW0 A;  1SKR A;  3EEQ A;  3AO1 A;  4H4O A;  3W3D A;  5HOO A;  5E26 A;  1S6P A;  4BRE A;  3MK6 A;  1UA0 A;  1TKX A;  4IOA L;  4CIG A;  3OTO K;  3TAP A;  1VQL N;  5SWM A;  3EL2 A;  4A5A A;  3TAM A;  5GAG P;  3HI0 A;  2ZWH A;  3EE9 A;  1ASW A;  2OZM A;  1XNR K;  4DTX A;  3RR7 A;  1VQ5 N;  3I0R A;  4JKE A;  3CJ1 A;  5C15 A;  4FOI A;  5T7B A;  3CCV N;  2Q97 A;  2AA4 A;  1Z6R A;  1S72 N;  5CYQ A;  3UIQ A;  1KSP A;  3CJB A;  1DTQ A;  4GKK K;  1VRT A;  3CJ7 A;  1VSH A;  2FSK A;  3G25 A;  2O8E A;  1GLE G;  5KRT A;  3FR0 A;  3H1V X;  4DSI A;  3SI6 A;  3VQQ A;  3L2W A;  1A5X A;  3TAG A;  5AFU H;  4B9N A;  3SBG A;  5FRM A;  2X6S A;  4GMJ B;  2XY6 A;  4BAC A;  4AHV A;  3VER A;  3A5N C;  5F0X A;  3O4N A;  5CZ1 A;  2FBY A;  2DFE A;  4BR4 A;  2UXD K;  2E2O A;  2FF6 A;  3C95 A;  5BPL A;  4L8R B;  3KKR A;  4H03 B;  2G8U A;  3LDP A;  2P1J A;  1C0T A;  5BR9 A;  2VYP A;  1WLJ A;  4DUZ K;  5KPR A;  3KWI A;  3U6F A;  4B3M K;  1EQY A;  2HNZ A;  4IFY A;  5F1X A;  5FDL A;  2HBK A;  4M3W A;  4BR9 A;  1BWF O;  3CIP A;  1VSE A;  2A1S A;  1REV A;  4H0X B;  2XY8 A;  2KKZ A;  3PX0 A;  3LDL A;  3SMS A;  3VQP A;  1SL0 A;  3AGR A;  4FLZ A;  1ZBI A;  3O5B A;  3NH1 A;  3ZSQ A;  4CJL A;  4FZX C;  3AO2 A;  4CED A;  2O4I A;  3D2E A;  1NJX A;  4IG0 A;  1Q86 O;  4OPH A;  4KHQ A;  3T1A A;  3ZSY A;  2WFB A;  3OVN A;  1FJG K;  1RNH A;  3KHY A;  3H08 A;  3O3G A;  3J81 O;  3CFP A;  4N76 A;  5C12 A;  5AQT A;  4JAX A;  3PV8 A;  1TK0 A;  3OJU A;  2FXU A;  4JI1 K;  3SNN A;  3K5N A;  1IBK K;  3O9S A;  1GLA G;  3O9Q A;  4ELU A;  1YTU A;  1Z05 A;  4OKE A;  4NLC A;  5LJV A;  2D0B A;  3V1O A;  4CZM A;  4CEO A;  3MN6 A;  4CJP A;  4KHY A;  3WNG A;  3D6R A;  1OH7 A;  1BU6 O;  4RW6 A;  3DLH A;  2G8K A;  5ELZ A;  3L3U A;  4E89 A;  3QEV A;  3VA0 A;  3KD5 E;  1IG8 A;  4Z94 A;  5I9E B;  4FSV A;  4XEI A;  1N32 K;  3GOI A;  4GY2 B;  4J2E A;  5BN9 A;  3O4Q A;  1QZ5 A;  1YI2 N;  2PYL A;  3NBP A;  2KZZ A;  4E7K A;  4LF8 K;  2VG5 A;  3HVR A;  1YIT N;  1RDA A;  3AVJ A;  3BZC A;  2IC3 A;  3MXI A;  1KAZ A;  3HVT A;  4DQ8 A;  3OYB A;  1Q81 O;  4B08 A;  3IMX A;  3C6U A;  4I2Q A;  1TUU A;  5KQD A;  1HNX K;  1E3M A;  1TVR A;  4DV4 K;  2F7T A;  3NF9 A;  4FPA A;  4B1U B;  2YKN A;  1C1B A;  3CCJ N;  3CCR N;  1LW2 A;  4CK3 A;  4CIF A;  1KAX A;  3AVI A;  4FLY A;  4I6M A;  4M63 C;  1TK5 A;  3F5T A;  3WXK A;  1TYQ A;  3M8P A;  4M3Y A;  1NKC A;  1YVU A;  3AY9 A;  4BGA A;  1NNE A;  3HK2 A;  4FK2 A;  2OZS A;  3HYF A;  3CC4 N;  1WSI A;  4FWK A;  1QVF M;  2QEX N;  3QFU A; 
#chains in the Genus database with same CATH homology
 4DV1 K;  1FJG K;  5LMU K;  1XMQ K;  4JYA K;  4DR6 K;  1HNW K;  3J81 O;  2ZM6 K;  4YHH K;  3OTO K;  4NXN K;  4DV3 K;  2F4V K;  4JI1 K;  1IBK K;  4LFC K;  4JI0 K;  4LFA K;  3J7Y P;  3T1H K;  4LF9 K;  2HHH K;  4V19 S;  4DV7 K;  1XMO K;  1XNR K;  4LF6 K;  2VQE K;  2UXC K;  1HR0 K;  5A2Q O;  4DV5 K;  4X66 K;  2E5L K;  4JI3 K;  4NXM K;  4DR2 K;  4JI4 K;  4CW7 B;  4JI2 K;  2UU9 K;  5FLX O;  4DR1 K;  4GKK K;  5AJ3 K;  3J80 O;  4JI8 K;  2UUB K;  2UUC K;  4B3R K;  4DR4 K;  1N32 K;  2UUA K;  5IWA K;  5IT9 O;  4CVN E;  1IBL K;  4LF8 K;  5LL6 Z;  4K0K K;  3JAM O;  4JI7 K;  4DUY K;  3T1Y K;  3J7A P;  2UXD K;  1IBM K;  4LF7 K;  4JI6 K;  4X65 K;  4X62 K;  1J5E K;  4DV2 K;  1HNX K;  5LMN K;  2UXB K;  4DUZ K;  4DV4 K;  4X64 K;  4DR7 K;  4DR3 K;  4B3M K;  4AQY K;  4DR5 K;  1N34 K;  1N33 K;  4JI5 K;  4KHP K;  1XNQ K;  4LF5 K;  4LFB K;  4B3S K;  4DV6 K;  1HNZ K;  4DV0 K;  4OX9 K;  4JV5 K;  4YY3 K;  2VQF K;  5BR8 K;  1N36 K;  4GKJ K;  4B3T K;  1I94 K;  4LF4 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...