3ZSXA

Small molecule inhibitors of the ledgf site of hiv type 1 integrase identified by fragment screening and structure based drug design
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Small Molecule Inhibitors of the Ledgf Site of Human Immunodeficiency Virus Integrase Identified by Fragment Screening and Structure Based Design.
pubmed doi rcsb
source organism Human immunodeficiency virus
molecule tags Transferase
total genus 56
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.-:
pdb deposition date 2011-07-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3zsxA00
3VQAA 4OGCA 3V6DA 1KLNA 5I3UA 1S9GA 2E6MA 1L3SA 4DS5A 1XWLA 3OYMA 4OVLA 4O55A 3F73A 3SCXA 1BI4A 1BL3A 2A1SA 1XI1A 3U6FA 1WSGA 5I42A 3LP3A 1C0UA 4AHUA 1KRPA 3PV8A 1BIUA 3ZSVA 2RF2A 2DFHA 3DI6A 4FLZA 3SYZA 4FW2A 3M8QA 3OY9A 1RDAA 3O4QA 1RT5A 4BDZA 1NK8A 1HYZA 4PWDA 4DF8A 1TAUA 3KKSA 1TK5A 1QSLA 1WLJA 3VQ7A 4FJGA 3WNEA 3NF8A 3NFAA 3P1GA 4E89A 3AA4A 3NCIA 4FJMA 1CXUA 1RT2A 2IDOA 4DFMA 2R7YA 1NJYA 1KFSA 4RW6A 3C94A 4Z0UA 4LH4A 4AHTA 3OS2A 1RT1A 4W5OA 2FBXA 3RR7A 4O0JA 1GOCA 2HHXA 5CY4A 4B8AB 3VQ8A 3ZT1A 1J54A 1JKHA 2B5JA 3HP9A 3V1RA 4CHNA 3LZJA 4DQQA 5D3GA 3TAMA 2Z1HA 4IKFA 4KPYA 4Q5VA 1JLCA 1JLBA 4DWIA 2OPSA 1R0AA 3I0RA 1L5UA 3NGIA 3M8RA 3AV9A 1JLAA 3K5OA 1U04A 2HB5A 3RRGA 1U47A 5CZ1A 1HNIA 3L2QA 1CZ9A 1HJRA 4DTXA 3KD5E 3TI0A 1KVBA 1RILA 3L2VA 4BWJA 3K58A 3ULDA 1XC9A 4PUOA 3LP0A 4FK4A 4CF1A 3NF9A 1S9EA 4FYDA 4LSNA 1A5WA 1ZBLA 1TK0A 3OJUA 3EZ5A 1BHLA 4RW4A 2HNYA 4IBNA 4K8XA 3MEGA 4KHSA 3PY8A 4ELTA 3ZSRA 2D0AA 2QXFA 4HCBA 4LSLA 4FJNA 4KHWA 1RNHA 2X74A 3ALYA 3AA5X 3I0SA 3OYFA 1JLGA 1K6YA 3QEXA 4CEDA 4R5PA 4DSKA 4CF8A 1NKCA 1VRUA 4B9TA 3E01A 4CJEA 3DLRA 4GW6A 4KTWA 3PUFA 1D8YA 4CCHA 3VQ9A 4OLBA 2YKNA 4ID5A 1LWEA 1S6QA 2KW4A 2ITGA 2HNDA 3PO4A 4DFPA 3KLGA 3HVTA 1RDCA 2XRIA 1G15A 3DRSA 4CGGA 4K8ZA 2Z1IA 4CGIA 2G8IA 3SUNA 4KHYA 4KTZA 1WN7A 3VN5A 4ZTFA 1VSMA 2BANA 1HMVA 3AO4A 2FBVA 3V81A 4Y1DA 3VQ5A 1KLMA 4CJWA 2D0CA 4Z4GA 4O44A 1SL1A 4E7HA 3AVFA 1U49A 4DQIA 4CESA 2FBYA 3K57A 3HT3A 1W0HA 4OLAA 1N6QA 5HRSA 4J2DA 4NCBA 1BISA 3KLIA 5E41A 3DRPA 3ZT2A 3HPGA 2P51A 4DG1A 4NYNA 2PZSA 3LDSA 4CJPA 1RTIA 2X78A 3PX6A 3VA3A 4HHTA 3S9HA 3SI6A 1KTQA 2YNGA 4ID1A 4BE0A 4KRFA 2KZMA 1UOCA 4FLWA 1DLOA 5J2MA 1IG9A 4NCGA 3TAEA 4CEBA 1QSYA 4KB0A 3WNHA 3OYAA 3MXMA 3AVHA 1VK0A 4M3XA 2X6SA 1Z26A 5FDLA 5FROA 4Z4IA 1HPZA 1NJZA 1NOZA 1SUQA 4CEFA 1NKEA 2O4IA 3TABA 3EYZA 1BCOA 4RG8A 3SV3A 1KFDA 3DOKA 4QCLA 2KZZA 1KSPA 2B6AA 1NK0A 2HVIA 2YHBA 3NE6A 4JS4A 2HHVA 2JGUA 4DLEA 1DTTA 1VSJA 1CLQA 3K59A 1TKZA 4DSEA 1S1VA 1GOAA 5HLFA 4J2AA 1D5AA 1X9WA 4LY7A 3KD1E 2ZQBA 4KKOA 3HXMA 4NCAA 5KI6A 5EU7A 3I8DA 2IGIA 1WAJA 4FM0A 4FLUA 1HQEA 3ZT3A 3OYHA 4E1MA 1SKSA 1KVCA 1ZBUA 3KIOA 2DTUA 2EHGA 4E7LA 4C8LA 1RBUA 4KHNA 5K14A 3OYNA 2P5GA 1RBSA 3TR8A 4FCYA 3KLHA 3G0ZA 3VQCA 2XY5A 2D0BA 3P5JA 3SUPA 4AHVA 2WONA 5FRNA 4QOZB 4FLXA 3HL8A 2D5RA 4W5TA 3MXJA 4HUGA 4DU1A 3SJJA 2IOCA 3HK2A 3SZ2A 2BE2A 4CHZA 4B3OA 2PYJA 3V9UA 3SUQA 4FJHA 4HUEA 3PX0A 1B9FA 1KCFA 3ASMA 3IRXA 4I7FA 3CFOA 3K5LA 4DTOA 4HVJA 4DTMA 3S3NA 2QKBA 3LWMA 3LP2A 1U4BA 4IFVA 4EP5A 3V9WA 1SL2A 4Z4EA 4F2SA 1XHZA 4CE9A 3AA2A 3NF6A 3KLEA 2KTQA 4DFKA 3AVKA 3V9ZA 3VQEA 4CECA 4BWMA 1O1WA 3FFIA 3ZT0A 4F3OA 4FJ8A 2O4GA 4FJJA 2ETJA 3ITHA 5KRSA 3L3UA 2QK9A 1IKXA 1JL1A 1WSHA 4CJVA 2Q3SA 4IDKA 4M41A 4BDYA 4J2EA 4FJ7A 3AVIA 1UWBA 5HRNA 4O0IA 3KLFA 1WAFA 3MAQA 1C1BA 1HNVA 3QIPA 2E4LA 3KJVA 1FKPA 2VWJA 4HUFA 1UA0A 5DMRA 1C1CA 4CGHA 4H4MA 3M8PA 4ZTJA 3AVBA 1C0MA 4JRQA 2EX3A 4ICLA 3P83D 4KV8A 5C24A 3NGYA 1QS4A 4CJSA 3OJSA 1IH7A 3H08A 2G8WA 3MECA 4CEEA 3HPHA 4B9VA 3PO5A 3LALA 4DFJA 4B9UA 1JXEA 1YVUA 2GUIA 4IG0A 4YNQA 4I2PA 3BDPA 1IO2A 1ZBHA 3NH1A 2XY6A 4FLTA 4W5NA 3RMAA 3QEVA 2OPRA 4H8KA 4DTNA 4DSJA 2Y1JA 1UAXA 3RMBA 4CJTA 3LWLA 3OYJA 1TVRA 4AH9A 4PY5A 2YNFA 3RTVA 2HHWA 5KTQA 4LD0A 2G8HA 4B9NA 4XIUA 1FXXA 5KGXA 5FRMA 1RTJA 1ZYQA 4GVMA 2P1JA 1Q9YA 4RW7A 4FJ5A 1REVA 4KREA 3SQ2A 3ZSXA 4CHQA 2RKIA 4Y1CA 3HO1A 1IKYA 1X9SA 1WSFA 1B92A 3TANA 3V4IA 1DTQA 4FZZA 3OYBA 2Z1GA 4DU3A 2HW3A 4CEZA 1X1PA 2KFZA 4O4GA 3AO5A 2OYQA 3NH2A 3K5MA 1TKXA 3DLGA 4EZ9A 1Z25A 2QKKA 1Q9XA 1EX4A 3AVGA 3RMDA 2OZMA 4W5QA 4BACA 4E7IA 1L3VA 1TAQA 4DMNA 3HP6A 1X9MA 1TV6A 4MQ3A 3HVRA 1RTHA 1LWCA 3LPUA 4CJQA 1LAWA 2PYLA 1JLFA 3KTQA 3CFRA 2DFEA 3QLHA 3F9KA 2FBTA 2RN2A 3A2FA 1TL3A 4E0DA 3QETA 5SWMA 5CZ2A 4CJ3A 4B9MA 1MU2A 3VQQA 3AO3A 1VSEA 5J2PA 2WOMA 1SKRA 4KHQA 4FXDA 3QO9A 4DTPA 5HRRA 4M3ZA 4FJKA 2I5JA 4F2RA 3DM2A 1WSJA 4OJRA 3MEEA 3O3GA 3L2WA 3VA0A 3SUOA 3QEPA 1BCMA 3HYFA 3ZSWA 2PY5A 2X6NA 3VQDA 4CFBA 4DTRA 1S5JA 4LH5A 1B9DA 4AHSA 1XHXA 4CJ4A 4CK3A 3QEIA 1NOYA 4TSXA 4DSFA 2BGGA 2OPQA 4N41A 1JLEA 4M3WA 1HQUA 4FK2A 4OPJA 1S1WA 3L8BA 4CGJA 1LWFA 1YTUA 2AJQA 3MXIA 1ITGA 2VG5A 2A1RA 4B08A 3VQBA 3JYTA 1D9FA 1T05A 4CEQA 2OA8A 1BI4B 1L3TA 5J1EA 4CK2A 2XHBA 4DTJA 1J5OA 4FW1A 4E7JA 2HHUA 3VQ4A 2F8SA 1D9DA 3LZIA 2KQ2A 1WNSA 3K2PA 4DSIA 2OPPA 3KKRA 3JSMA 2GV9A 3L2UA 4IG3A 1S1XA 3NBPA 3CG7A 2XO7A 1EKEA 3S3MA 1L3UA 3U3GA 4QAGA 4CIFA 3QEWA 3QIOA 1IKVA 5HBMA 4E3SA 5J2NA 5JS1A 1JXBA 1LAVA 4KO0A 1T03A 4CJ5A 2KFNA 3T19A 2IS3A 1SL0A 2B4JA 4ELVA 1FKOA 1LW2A 3ISNC 3NF7A 4CGFA 1C1AA 4PQUA 3S3OA 3DRRA 1QHTA 4L8RB 4BE1A 3V9XA 4AHRA 1TK8A 2W42A 3NAEA 3CYMA 4Z4FA 1YT3A 3CQ8A 4DQPA 3TAPA 1HYVA 3TAQA 1WSIA 4OKKA 1RT6A 2RPIA 1WSEA 3TWHA 1NK5A 5C25A 3KK2A 1LV5A 4H4OA 3LAMA 1QSSA 4B9SA 4J2BA 3SQ0A 3L2RA 1ZBIA 4CJFA 1I3AA 5CYMA 3PX4A 5JS2A 4CHPA 1A5XA 4CFAA 3EY1A 1KVAA 3CM6A 1Y97A 1C0TA 4HTUA 1A5VA 1RBRA 3OYDA 3DOLA 1I39A 3LP1A 4FM2A 1VSDA 3AVLA 2YNHA 3BGRA 4I9LA 4CIEA 3KK1A 4DU4A 4B9LA 5KGWA 1J53A 3ZSQA 3V9SA 3QERA 2Z1JA 4CJLA 3NDKA 4FZXC 4Z4HA 1TGOA 1S1TA 2HNZA 1VSLA 3IG1A 3V1OA 3CFPA 1RDDA 3TAGA 1TL1A 2F8TA 3OS0A 1YTAA 2FC0A 3OVNA 4C8KA 3VQ6A 3DMJA 4ZHRA 3OS1A 4B8CA 1ASUA 2ZD1A 1NK6A 4KB1A 4DTSA 1T7PA 4DQRA 4KHUA 4YFUA 4KFBA 3C6TA 3UIQA 3T1AA 2DFFA 5T7BA 4E1NA 1VRTA 4FVMA 2Y1IA 4E19A 1ASWA 1SKWA 3QINA 4M45A 2ZE2A 3THVA 4BDPA 3D0PA 3ZSOA 4HCCA 4C8NA 4N56A 3ZT4A 4CERA 4RW8A 4EP4A 1JLQA 1U45A 1CZBA 4DTUA 1F21A 4FM1A 4FJIA 4I9QA 5HP1A 1NK7A 3RMCA 4IFYA 4FZYA 3DLBA 1RCHA 3WNGA 2DY4A 5KRTA 3AVMA 1U48A 1T8EA 1RBVA 4DLGA 2G8KA 1RDBA 3B6PA 1NJXA 4F8RA 3LAKA 3RRHA 1IKWA 1VSFA 2G8UA 3HM9A 1CXQA 1NK9A 4F4KA 2HHTA 1Q8IA 3ZSYA 1C6VA 4E7KA 4OPKA 3QNOA 1VSKA 4CHOA 1ASVA 1QQCA 3CM5A 4KI6A 3HPOA 1SV5A 4BE2A 4FJ9A 4OKEA 1RT3A 2VG6A 1ZBFA 1S6PA 3C95A 3NH0A 4RW9A 3TARA 3OYEA 2IAJA 1S1UA 4JRPA 1NJWA 4KAZA 2ATQA 3OYKA 1GOBA 2E6LA 3SQ4A 1QTMA 4OKJA 2JLEA 3AVAA 2VWKA 4CF9A 3SNNA 3IS9A 4M3RA 1NKBA 4MFBA 3QNNA 4C8OA 4CJUA 4N47A 3ZCMA 5HROA 1EP4A 2YNIA 4CFDA 4CF2A 3OYGA 4FLYA 4O5BA 3DLKA 1RBTA 1RTDA 2G8FA 3L3VA 2HHSA 1NK4A 4M42A 4M3UA 2HHQA 5SZTA 2BDPA 1EXQA 4FJXA 4DQSA 3LPTA 1EETA 4JS5A 1RT7A 4CFCA 4I2QA 3RWUA 3HSTB 3DYAA 2G8VA 3O4NA 4CF0A 4CJKA 4N5SA 4W5RA 3SQ1A 3T3FA 3G10A 3DLHA 4M3YA 4F3TA 3IAYA 2YKMA 4WE1A 3HJFA 4DF4A 1BQNA 4FK0A 4Z4CA 3ZSZA 5C42A 3QESA 3TAFA 3OYCA 4DSLA 3DLEA 3WNFA 1FK9A 4G1QA 4C8MA 3KK3A 4KI4A 3AVNA 3AVJA 5DK5A 3NGZA 1LW0A 4NYFA 4CGDA 5HRPA 2IC3A 4KTQA 1N5YA 4FLVA 4CEAA 2GBZA 3V1QA 1BQMA 5J2QA 1TKDA 3SV4A 4EZ6A 3C6UA 1UA1A 4CK1A 2P5OA 4CHYA 1VSIA 1BGXT 4OGEA 3NHGA 2XY8A 4AHCA 1BIZA 3K5NA 3B6OA 4M3TA 4ELUA 1J9AA 1TKTA 3U3YA 2F96A 2HMIA 2OZSA 3OYIA 1VSHA 2NUBA 1W9HA 3O3HA 4DS4A 1JL2A 4CEOA 4UQGA 2LSNA 3AA3A 3AO2A 1HRHA 5CYQA 4GMJB 3M8SA 4CJRA 3SPZA 4Q0BA 1HYSA 3D45A 2YHAA 3LANA 3O3FA 3VQPA 4PA1A 4AILC 3AO1A 3SPYA 4N76A 3OYLA 2VG7A 3MEDA 4CIGA 2YV0X 1RT4A 3RR8A 4JLHA 2HVHA 4FJLA 2XY7A 1QE1A 3AVCA
chains in the Genus database with same CATH superfamily
3CJ7A 4FWOA 3V6DA 1KLNA 2E6MA 1L3SA 4ILJA 3SCXA 1BI4A 4LF8K 3U6FA 1C0UA 2FF6A 3SLCA 3ZSVA 1OH8A 2RF2A 1NU0A 1XNQK 4DF8A 1TAUA 1QSLA 3NF8A 3NFAA 3HRGA 3P1GA 4E89A 1W7AA 1NJYA 2Q0RA 1KFSA 2R7YA 4LF9K 2AP1A 4RW6A 3C94A 4A5BA 4QS9A 1NGHA 3RR7A 4JI3K 4O0JA 2WUSA 2HHXA 3C65A 4DQQA 3LZJA 2Z1HA 2BTFA 1JLBA 4DWIA 3OBWA 3ENOA 4CBWA 3RRGA 2O8CB 1Z6RA 4DTXA 3KD5E 1LCUA 3TI0A 3L2VA 4FK4A 3E9OA 3T7ZA 4RW4A 4CW7B 4IBNA 5KPTA 4A57A 4BY9C 3ZSRA 4HCBA 4DR3K 1YXQA 3S41A 4KHWA 2D0PA 3ALYA 5MLCQ 3QEXA 1BUPA 4CF8A 1QZ6A 4BREA 5AQPA 2UU9K 4GW6A 4CCHA 1D8YA 4OLBA 4ID5A 1LWEA 3DXKA 1KAYA 4DFPA 3PIOL 3HVTA 1JCEA 1EQYA 2FSNA 3DRSA 4IO8A 2Z1IA 4KTZA 1O13A 3H6EA 2FBVA 3U9ZA 3AVFA 4DQIA 1N6QA 1JCGA 4PL7A 3CCMN 3ZT2A 2P51A 1TYQB 4IFEA 3LDSA 1RTIA 1YJ9N 3VA3A 1Q81O 4KRFA 4FO0A 1IG9A 3QICA 3CC2N 3TAEA 4KB0A 3WNHA 1VK0A 2WTUA 4CEFA 3TABA 4U7BA 3SV3A 4IJNA 1KFDA 1BU6O 5AQWA 2B6AA 1NK0A 1Q7YO 1YIJN 3UKUB 4DSEA 4J2AA 1D5AA 4H0XB 1X9WA 3KD1E 2ZQBA 4FOEA 3WQUA 4E1MA 2Q31A 2EHGA 4KHNA 1RBSA 3BEXA 4CZHA 3VQCA 4FLXA 3HK2A 2PYJA 4XH4A 3R9PA 1V4TA 3OW2M 2ZJRL 4FJHA 1B9FA 1ZXOA 3CFOA 4HVJA 4DTMA 3FZFA 4EP5A 4Z4EA 4F2SA 3TU5A 4DFKA 3AVKA 4GKKK 2UYTA 1O1WA 4FJ8A 5F2RA 3ZT0A 5AQKA 2ETJA 3ITHA 3P39A 1S72N 4CZEA 4BGBA 1NGDA 4M41A 4FJ7A 5I9EB 2HBJA 5HRNA 1WAFA 2HSTA 2E4LA 1FKPA 3MN6A 4CGHA 3O9UA 4H4MA 4ZTJA 4JRQA 1R59O 4H5NA 2NRZA 2EX3A 4OPHA 5JVHL 4CZIA 4CEEA 4B9VA 4DFJA 3O1WA 1JXEA 4I2PA 1IO2A 3ZX2A 4WCEL 2VQFK 4DSJA 3RMBA 4PY5A 1HNXK 1VQ8N 2YNFA 2A6AA 3RTVA 1C0FA 1Q86O 1MWKA 5CR4A 5AQUA 1GLCG 3O9QA 5KGXA 5FRMA 1NMNA 2P1JA 4MDAA 3WXKA 4KREA 4CHQA 3O9TA 1X9SA 1WSFA 2QM1A 1GLDG 3TANA 4KHPK 2HW3A 3ZEUB 4CEZA 4FWLA 2OYQA 2QWOA 3NH2A 3K5MA 1TKXA 3DLGA 2QKKA 3AVGA 4H5VA 2O8CA 2ZM6K 3RMDA 2OZMA 4BACA 1L3VA 4JKEA 3O8MA 4DMNA 3THWB 5DM7L 1LAWA 4MLHA 1JLFA 3CFRA 1X3NA 3A2FA 1TL3A 1P90A 1VQ7N 3QFUA 5J2PA 4CI6A 4CD3A 1SKRA 4FXDA 3DXMB 4JV5K 1KAXA 3T1YK 3SUOA 1BCMA 3SAHA 2PY5A 2OTJN 3VQDA 4AM7A 4B1VA 2OPQA 5ELZA 3L8BA 3CCQN 1LWFA 5BPMA 4B08A 3VQBA 4CEQA 1MA9B 3CCRN 2A3ZA 5EVZA 1RDWX 4BRQA 2KQ2A 3K2PA 5KQDA 4UY8O 1S1XA 1TYQA 4AF1A 1EKEA 5IWAK 4X66K 4BC4A 5TKWA 4CIFA 3QEWA 4F9OA 1IKVA 5HBMA 3W0LA 5J2NA 1LAVA 2KFNA 3T19A 2B4JA 1FKOA 1YUWA 3C0BA 2P9SB 1C1AA 5AQLA 1HPMA 4PL8A 4DV4K 4BE1A 1TK8A 2W42A 1BG3A 3M6GA 3TAQA 1WSIA 4BRKA 1LV5A 3M3ZA 3UKUA 5BRFA 3LM2A 5AZJB 1NMDA 5LMUK 2ZF5O 1A5XA 5M1KA 4BGAA 3AGRA 3EY1A 5AQRA 3CM6A 1Y97A 1C0TA 4JEPA 1N36K 3TTCA 2PAVA 3ATVA 1VSDA 4B9LA 1HJOA 2O8FB 1U6ZA 3QERA 2Z1JA 4Z4HA 4ISEA 1RDDA 3J8AA 2ITMA 1NK6A 4B8CA 1QVFM 4KB1A 1M1KO 4DQRA 3SJHA 4E1NA 4FVMA 3TTDA 4DR6K 3I55N 4HCCA 4C8NA 4N56A 3R1XA 3J81O 4DTUA 4IFYA 5EY4A 3AVMA 1T8EA 1RBVA 1RDBA 1NJXA 2QWNA 5C2DA 3JS6A 3LAKA 3A0IX 1VSFA 5GIOA 5FPMA 4OPKA 3QNOA 1Q18A 1VSKA 4KI6A 4JI7K 4FJ9A 3NH0A 5CHIA 4RW9A 2NRVA 3FGUA 3VMFB 1QTMA 3RSEB 1NGBA 4WQ4A 2PFUA 2ASPA 3R8EA 1OH7A 4MFBA 4MO4A 3DLLL 2P9NB 4CFDA 4CF2A 3A5OC 1RTDA 1SAZA 2J4RA 1NK4A 4WQ4C 4M3UA 2HHQA 5SZTA 5BPLA 2E5LK 2P9LB 4DV6K 4CFCA 4I2QA 3HSTB 3DYAA 3DLHA 4CJKA 4CVNE 3ZEUA 4EFHA 1IBMK 3J7AP 2UUCK 3HJFA 3CMAN 3ZSZA 3QESA 1YJNN 3WNFA 1FK9A 4DB3A 3NVMA 4KI4A 3ENHA 3AVJA 3U8XA 4KTQA 4CD1A 4CGDA 3THWA 2IC3A 1N34K 1XC3A 3QB0A 3SV4A 4EZ6A 3C6UA 1BGXT 3NHGA 4AHCA 3D6RA 3B6OA 4ELUA 2BUPA 1XMQK 3DXMA 3CCEN 3OYIA 1VSHA 4H0VB 4B3TK 2WC9A 4DHYA 4DS4A 1JL2A 3A5NC 3AO2A 2NRTA 3O3FA 4ILHA 3VQPA 3AO1A 3OYLA 2VG7A 2YV0X 4JHDB 2HVHA 1QHAA 5EXWA 1QE1A 4CJEA 5HL7L 3VQAA 4OGCA 3VTIA 1S9GA 4CZFA 4DS5A 1XWLA 5M1OA 3F73A 4YDUA 4XH5A 5I42A 5GAGP 3H45C 4AHUA 1NNEA 3PV8A 3THXB 1BIUA 1FW6A 4BDZA 1NK8A 1HYZA 3TSPA 1WLJA 3VQ7A 3FZMA 3NCIA 4FJMA 4DFMA 3TTFA 4CBXA 4LH4A 3CJAA 4AHTA 4W5OA 1YI2N 2W6KA 1GOCA 3TSUA 3VQ8A 3ZT1A 1J54A 3V1RA 3HP9A 5D3GA 2P9SA 3VGKA 3TAMA 2HOEA 4GVEA 3CCLN 3NGIA 1GLAG 3FR0A 3I33A 1JLAA 5C0YA 2HB5A 5CZ1A 5AZJA 1KVBA 1RILA 3U9DA 1XC9A 4YOYA 2FSJA 5GINA 4BR2A 4DV3K 3J7YP 2A40A 4FYDA 4LSNA 2VGMA 4DQ8A 1ZBLA 1TK0A 3PSFA 2NZTA 2HNYA 4K8XA 3PY8A 3JAMO 2QXFA 4LSLA 1RNHA 2O8FA 3OYFA 3KVGA 3LL3A 4CEDA 3MN9A 2PBDA 4R5PA 1NKCA 4WFAL 1VRUA 3E01A 4KTWA 4ILGB 2D0OA 2KW4A 4E1JA 3THYA 2E20A 3KLGA 1G15A 4GV6A 4CGIA 3MX2A 3SUNA 1NGJA 3VN5A 4B3SK 2YHXA 3AO4A 3CPEA 4CJWA 4Z4GA 4O44A 5FLXO 1SL1A 4E7HA 4JI0K 4JI1K 4IOXA 3O1BA 5E41A 3DRPA 4IOAL 3HPGA 3VETA 5AQYA 4NYNA 2PZSA 4CJPA 4K41A 4HHTA 5JMVA 3MK6A 1UOCA 4IDHA 3B8AX 5AQHA 3EO3A 3EN9A 4NCGA 1P8ZA 1QSYA 5F1XA 3OYAA 3AVHA 3HZ6A 5FDLA 1HPZA 3RSEA 1NOZA 2QTDA 1NKEA 1HR0K 2O4IA 3EYZA 4RG8A 4QCLA 2KZZA 1HNZK 1KSPA 2HHVA 2YHBA 4JS4A 4LC9B 2JGUA 4JKBA 4DLEA 1DTTA 1VQLN 2P9NA 3VOVA 1TKZA 4YOXA 1X9JA 1GOAA 5HLFA 3CPWM 3HXMA 4NCAA 4BRGA 5EU7A 3TAGA 4JK8A 4FM0A 4FLUA 1KVCA 3KIOA 4EAHD 1T6CA 2P9LA 5JICA 3VERA 4WF9L 4E7LA 1RBUA 4C8LA 5AQFA 4KH6A 3TR8A 2QXLA 2ZJQL 3P5JA 3AAQA 5FRNA 1Q82O 2D5RA 3HBTA 5M1PA 2VQEK 1SZ2A 4B3OA 3EZWA 3V9UA 4CZJA 5C2FA 1T6DA 3ASMA 3IRXA 4DTOA 1K8KB 3LP2A 3AARA 1BA0A 3O08A 4IFVA 3V9WA 1U4BA 1XHZA 3NF6A 2WBNA 5AQMA 2KTQA 3V9ZA 4BWMA 3FFIA 2O4GA 1ATNA 2CGLA 3ZX0A 1JL1A 2Q3SA 2V52B 4O0IA 3KLFA 2QKBA 3MAQA 4HUFA 1NLVA 3AVBA 1C0MA 3CD6N 4KV8A 3CCVN 5C24A 1QS4A 4PKIA 3OJSA 1IH7A 4JHDA 3HPHA 3PO5A 4B9UA 1YVUA 2E8AA 4DV7K 3LDQA 1ZBHA 3NH1A 4FLTA 3F2KA 4WFNL 3VEXA 1YHQN 2Y1JA 4PKHA 3LWLA 1TVRA 2NRXA 3THXA 3M5RA 1HKCA 2HHWA 5KTQA 4LD0A 2G8HA 4YOTA 4XIUA 5BR8K 4H0OA 4GVMA 4RW7A 1T3VA 1XQSC 4BR4A 1QQMA 3ZSXA 4C23A 1K8AO 1IKYA 3N4QA 1B92A 1S22A 1DTQA 3A5LC 1X1PA 2KFZA 3AO5A 1VQNN 3SBGA 2W41A 5GAEP 4IOCL 4H5WA 4X64K 4W5QA 4GKJK 4FWNA 3C6HA 3K9JA 4E7IA 1X9MA 2CH6A 1RTHA 4IEEA 2PYLA 4FSVA 4C1NK 5SWMA 4CJ3A 4B9MA 3AO3A 3CHWA 3IFRA 3MWTA 2NRWA 3CMEN 1DGKN 2HBLA 3QBWA 3QO9A 4DTPA 1N33K 3DM2A 3QEPA 4OJRA 3MEEA 4B1YB 2ZGZA 4CFBA 4CJ4A 3QEIA 3ZYYX 2BGGA 2O8BB 4N41A 1KAZA 1HQUA 4DR1K 1S1WA 1WUAA 5M1QA 1ITGA 2VG5A 1NGCA 1D9FA 1H1VA 1T05A 3VEYA 2I7PA 3DJCA 3FZHA 3GL1A 3KWGA 1L3TA 2QWPA 3L6QA 4E7JA 4M7XA 1D9DA 3KKRA 5AZIB 3TSQA 2GV9A 3SAFA 4IG3A 2XO7A 3BF3A 1L3UA 2W40A 3U3GA 4IEIA 5AFUA 3F5TA 1GLEG 3QIOA 1JXBA 3NMUA 4FPBA 3PLAA 3S3OA 3CCSN 1MWMA 3WXJA 3OA9A 3V9XA 3VEOA 4Z4FA 5KQ8A 1VHXA 1NOYA 1RT6A 2RPIA 1WSEA 3L4QA 1EO1A 3CCUN 1QSSA 3SQ0A 4CJFA 1I3AA 2QEXN 2HBMA 1NGEA 3PX4A 4HTUA 3WXIA 3OYDA 5BRHA 1I39A 3LP1A 3GE1A 3AVLA 4CIEA 4X65K 4DU4A 5LJVA 5KGWA 3ZSQA 2KHOA 4FPAA 2H3GX 4H5TA 4CJLA 4FZXC 3CFPA 2HNZA 1EWQA 3LDOA 2F8TA 3OVNA 1BDGA 1HLUA 2ZD1A 1K73O 4JI4K 4DTSA 4NXNK 4KHUA 1K8KA 4DCHA 4YFUA 2DFFA 1ASWA 3QINA 4H0PA 2ZE2A 3P4IA 2GTDA 3IMXA 3D0PA 3THVA 4BDPA 3WQTA 4CERA 4I9QA 1F21A 4FJIA 1NK7A 3VF2A 1RCHA 3WNGA 2DY4A 3EL2A 4DV1K 4NLCA 3W3DA 2GEMA 1OH6A 1IKWA 4F4KA 2G8UA 1NK9A 1CXQA 4K42A 3HOTA 2V51B 1C6VA 4E7KA 4JI8K 1ASVA 1QQCA 3VESA 1IBKK 3HPOA 3C95A 1S6PA 2QWLA 4YORA 1YAGA 2E2PA 2IAJA 4WQ5C 2GELA 4JRPA 2ATQA 2E6LA 2QWRA 4OKJA 3IS9A 4M3RA 4DV2K 1HKBA 2W6LA 3C6AA 4N47A 5KPRA 4FLYA 3OYGA 4K0KK 3ULEB 2G8FA 2VYPA 4M42A 1E4FT 4DQSA 1X3MA 3O4NA 4CF0A 1E4GT 3IAYA 2YKMA 4DF4A 1BQNA 3GBTA 4Z4CA 4FK0A 3CJBA 1KD1O 3CF5L 2Q0UA 4G1QA 2UXCK 4A61A 5DK5A 5HRPA 5J2QA 2GBZA 3H3NO 1UA1A 2P5OA 4CHYA 1VSIA 3WXMB 5JLHA 4YY3K 4OGEA 4BVOA 4CBUA 4JI5K 3UKRB 2OZSA 4LFCK 2NUBA 1W9HA 3O3HA 4UQGA 3AA3A 2VGNA 3MWPA 5CYQA 1WOQA 4GMJB 5FPNA 4AQYK 2YHAA 3D2EB 3LANA 2NLXA 1VQON 4N76A 1CZAN 2O8BA 5TKYA 1RT4A 4JLHA 2XY7A 1TKDA 1N8RO 3OYMA 4OVLA 4O55A 1BL3A 1NM1A 3E9LA 2A1SA 2D4WA 1YJWN 1XI1A 4HTLA 1KRPA 3CERA 1VAZA 2OANA 5AZIA 1RDAA 3O4QA 1RT5A 3OY9A 2O8EB 1ZC6A 3HOSA 3KKSA 1TK5A 4FJGA 3WNEA 4GY2B 1IV0A 4LF5K 1CXUA 2IDOA 1RT1A 2IVPA 2FBXA 3D2FB 4QS7A 3THYB 4B8AB 2FSKA 4JK9A 1JKHA 2VWBA 4CHNA 5M1FA 4IKFA 2E88A 4BQLA 2OPSA 1L5UA 3G4SN 4EHUA 1IBLK 3K5OA 1U04A 4YHHK 5AQZA 3H3OB 3K58A 4PUOA 3ULDA 4CF1A 2CGJA 1BHLA 3MEGA 4KHSA 5GADP 1NBWA 3I0SA 1K6YA 4IXCA 4JKAA 4DSKA 1C0GA 1LOTB 4DR7K 3T69A 3DLRA 3GDQA 2AA4A 3PUFA 2E1ZA 2YKNA 1S6QA 2ZWHA 2HNDA 3PO4A 5E84A 4B3RK 4K8ZA 4A59A 1BOTO 3KZBA 4MLEA 1WN7A 4KH4A 2BANA 3SK3A 3V81A 3HSCA 4Y1DA 3VQ5A 1KLMA 1U49A 4BVPA 3HT3A 1W0HA 4JI6K 3VEZA 4JKFA 4J2DA 1BISA 3KLIA 1WBBA 4DG1A 1W97L 3EKUA 3S9HA 2QI2A 1KTQA 3SI6A 4BE0A 2KZMA 2HMPA 2X6SA 1Z26A 5FROA 1HKGA 5AQSA 3CETA 3CCJN 1VSJA 1S1VA 3BZCA 3ULEA 4KKOA 2YHWA 2HVIA 3I8DA 3CC4N 1HQEA 3ZT3A 3OYHA 1ZBUA 5LL6Z 2P9KB 1NGGA 5K14A 3OYNA 1D4XA 2P5GA 4FCYA 2E2QA 2D0BA 4AHVA 3VPZA 2UXBK 3HL8A 4W5TA 4OX9K 3MXJA 4DU1A 2IOCA 2BE2A 4CHZA 3SUQA 4HUEA 3PX0A 2GX9A 3K5LA 5ADXA 5EX5A 4CE9A 3AA2A 3KLEA 4F3OA 4FJJA 3A5MC 4M7YA 2A5XA 5BR9A 4H0YB 3L3UA 3UKRA 1IKXA 1UWBA 5B8HA 2VWJA 1HNVA 1UA0A 3KJVA 5DMRA 1C1CA 1RDUA 2P9UB 3D2EA 2G8WA 3H08A 3VEVA 2E1YA 4RTFD 2GUIA 4YNQA 3BDPA 2HF4A 3MX5A 3IDHA 2OPRA 4ISGA 4CJTA 3OYJA 4LFBK 4DR5K 4BR7A 2O8EA 5M1NA 4BR5A 4YOVA 1S3XA 1RTJA 1Q9YA 3E1YA 1HX1A 3E66A 4FJ5A 3SQ2A 2GWKA 4O8UA 3D2FA 3M1FA 5A2QO 2Z1GA 1OVYA 4O4GA 3H46O 2UUAK 4WFBL 4A62A 1TAQA 1TV6A 4MQ3A 1LWCA 3QLHA 2FBTA 1VQ6N 3QETA 5CZ2A 2D1KA 1MU2A 3VQQA 2WOMA 4JKDA 4KHQA 4FWMA 2VCPA 3MCPA 4FJKA 2I5JA 2HF3A 2BH1A 3F9MA 1WSJA 3VA0A 4DUZK 3ZSWA 3HYFA 2X6NA 1NGFA 3GG4A 1B9DA 1XHXA 1DEJA 4TSXA 1ATRA 4Y0WA 4M3WA 2AJQA 3MXIA 2A1RA 3JYTA 3LM9A 2CH5A 3CJ1A 4CK2A 5J1EA 2XHBA 4DTJA 1J5OA 4K43A 3O9SA 2HHUA 5E26A 2F8SA 1BA1A 2OPPA 1RGIA 3NBPA 4OPAA 4JI2K 3S3MA 2QW9A 3BZKA 4GV3A 4QAGA 2RE2A 2ZGYA 3VF4A 5JS1A 4KO0A 1T03A 4CJ5A 2IS3A 3QFPA 1SL0A 4G9ZA 4CJ7A 1LW2A 1U2VB 3MN5A 5GAHP 1KXPA 3DRRA 2UUBK 1QHTA 3ATUA 2HBKA 4O5FA 4DQPA 3TAPA 1HYVA 4B1WB 1HNWK 3TWHA 1NK5A 4M3XA 3KK2A 1DKGD 1BWFO 4H4OA 3LAMA 3ZX3A 5JVGL 3BP8A 4B9SA 3L2RA 3PIPL 1QVGM 5CYMA 5JS2A 1KVAA 5BREA 1Y64A 2P9KA 4FM2A 1XNRK 4X62K 4I6MB 3KK1A 3V9SA 5HOOA 4V19S 1VSLA 3IG1A 1YTAA 3VGMA 1SS6A 3VQ6A 1VQ5N 3P38A 3C6TA 1RFQA 3T1AA 2A42A 5T7BA 2Y1IA 4E19A 3K9KA 4M45A 1E3MA 3ZSOA 4EP4A 1JLQA 1U45A 4FM1A 5HP1A 2NNWA 3RMCA 3MMVA 3DLBA 4FWQA 4DLGA 2G8KA 3B6PA 3R3LA 2P9UA 4F8RA 3QMLA 1VQMN 3RRHA 2DPNA 4A5AA 4BE2A 4OKEA 4YOUA 3JXUA 3OYEA 1S1UA 4BR9A 1NJWA 3SQ4A 2HHHK 3VF6A 3SNNA 1NKBA 3P31A 4U67L 1VQKN 4C8OA 5CE3A 1G99A 4CJUA 5HROA 3ZCMA 1NG9A 1EP4A 2YNIA 3DWLA 4O5BA 3DLKA 2Q36A 4H5RA 2HHSA 3CJCA 2BDPA 4FJXA 5JLFA 3LPTA 2O8DB 3KHYA 4FOIA 1EETA 4JS5A 1RT7A 3EE9A 3FLCO 2OCEA 2QA4N 4M3YA 3SQ1A 3G10A 5LJWA 4F3TA 1VQ4N 4WE1A 3TPQA 3U4LA 5C42A 5DM6L 3TAFA 3OYCA 1QZ5A 3AVNA 4K25A 4OO1J 1LW0A 4NYFA 1N5YA 4CEAA 3V1QA 1BQMA 4CK1A 4MO5A 1K9MO 4DUYK 3D7EO 4XH1A 1J9AA 1TKTA 3C7NB 1Z05A 2LSNA 3M8SA 4CJRA 3SPZA 3D45A 5C10A 3CJ9A 1GLFO 4PA1A 3SPYA 3FZLA 3HTVA 5BN9A 2A41A 4FJLA 4JD2B 3AVCA 3I8BA 4BRCA 5I3UA 1ATSA 5AQTA 5AR0A 3BUZB 4RCHA 1WSGA 3LP3A 4BRDA 2IVOA 3DI6A 2DFHA 4O8KA 4FLZA 3SYZA 4FW2A 3M8QA 4FVUA 4PWDA 5F0XA 3AA4A 4BRLA 1RT2A 4BG8A 4Z0UA 5AQIA 3OS2A 5CY4A 1U2VA 2B5JA 3Q7CA 5FPEA 4KPYA 4Q5VA 1JLCA 1NWKA 1R0AA 3I0RA 1OKJA 3M8RA 3AV9A 3G25A 4DR4K 2F9TA 1U47A 3H1QA 1IJJA 1HNIA 5AJ3K 3L2QA 1CZ9A 1HJRA 2YHYA 3HO1A 4BWJA 3LP0A 3NF9A 1S9EA 1A5WA 1TUUA 4B1UB 3OJUA 3EZ5A 3A8YA 4WQ5A 2YCHA 2KKZA 3QBXA 4ELTA 2D0AA 4I6MA 4FJNA 2V7YA 2X74A 4IZ9A 3AA5X 2OTLN 1JLGA 4CZMA 1GLBG 2NRRA 4B9TA 3VQ9A 2ITGA 2JWLA 1YVNA 4EIAA 1RDCA 2XRIA 4CGGA 2G8IA 4KHYA 4QS8A 3OTOK 4ZTFA 1VSMA 1BO5O 1HMVA 2GUPA 4JKCA 1VQPN 2D0CA 4CESA 2FBYA 3K57A 3IUCA 2F9WA 4OLAA 3O4WA 1NGIA 5HRSA 4NCBA 1WB9A 5AFUH 4NO7A 5FPDA 4JKGB 3G6EN 2X78A 3PX6A 2Q1NA 2RHKA 5GIPA 2YNGA 4ID1A 3ZLJA 4FLWA 1DLOA 5J2MA 3QDKA 2V7ZA 2Q97A 4CEBA 3MXMA 4Z4IA 1NJZA 1SUQA 1NJIO 1BCOA 3DOKA 4BC2A 3NE6A 3WT0A 2IIRA 3MN7A 3IKMA 1CLQA 3K59A 4BG9A 4BC5A 4LY7A 1XMOK 4BRMA 2QWQA 5KI6A 2IGIA 1WAJA 5C15A 1SKSA 4B3MK 2YJEA 2O8DA 2DTUA 5IT9O 3ZETB 3KLHA 3G0ZA 2XY5A 3SUPA 4FWSA 2I7NA 2WONA 4QOZB 1XUPO 3UE5A 1OH5A 4HUGA 3SJJA 3WEEB 3SZ2A 3DAWA 4JKHA 4I7FA 1KCFA 3CQXA 3J7ZO 3S3NA 3LWMA 4A2BA 4DR2K 1SL2A 3AAPA 4BRNA 4JAXA 4EHTA 3MCAB 3VQEA 4CECA 3LDNA 3EE8A 4NLBA 5KRSA 4IO9L 1KC8O 4B1XB 4RWTA 2QK9A 1J5EK 3C7NA 1WSHA 4CJVA 4IDKA 4BDYA 4J2EA 3H1VX 3AVIA 1C1BA 3L0QA 3L4IA 3QIPA 4XEIA 3M8PA 3AGKA 4ICLA 3P83D 4H0TB 4BRPA 3NGYA 4CJSA 4CZKA 3SAGA 2OA8A 1GLJO 3FE1A 3EKSA 3MECA 4JD2A 3LALA 4FWPA 4IG0A 3RVCA 2XY6A 1YITN 4W5NA 3RMAA 4JN4A 3QEVA 1VQ9N 4ISFA 4H8KA 4DTNA 1UAXA 3O5BA 4BC3A 4AH9A 4PHTX 4JYAK 4FL9A 4A2AA 5AQJA 4B1ZA 4B9NA 3CQYA 1FXXA 4CZGA 1ZYQA 2P9IB 4B9QA 2ASOA 4M63C 1REVA 2RKIA 4Y1CA 2EWSA 4H03B 4NB4A 3BF1A 4Z94A 3I56N 3E9PA 5AQGA 1V4SA 4FZZA 3V4IA 3OYBA 1QQOA 4DU3A 4BRFA 2F4VK 3GOIA 3FZKA 4EZ9A 4LF7K 4J8FA 1Z25A 5C12A 2IVNA 1Q9XA 1EX4A 3KWIA 4L3QA 4WYBA 3HP6A 3HVRA 4BROA 3LPUA 4CJQA 3ID8A 3CXCM 3KTQA 2DFEA 3F9KA 1JCFA 2RN2A 4E0DA 1DT9A 3HM8A 4KH5A 1VSEA 3VTHA 5HRRA 4R79A 4M3ZA 4F2RA 3L2WA 2E2NA 3O3GA 2P9PB 2YJFA 4DTRA 1S5JA 4LH5A 4AHSA 2FLOA 1TUYA 3WXLA 1J6ZA 4CK3A 5BN8A 4DSFA 1JLEA 1ZBSA 4FK2A 4OPJA 3ID6A 4CGJA 4IWVA 1YTUA 1N32K 1I94K 5LY3A 2F7TA 1SQKA 3T1HK 3SMPA 1NGAA 1BI4B 3VEWA 4BR0A 5KPZA 3CI5A 4CZLA 4FW1A 3VQ4A 3LZIA 1KQSM 1WNSA 4DSIA 4IJAA 3JSMA 3L2UA 3CG7A 4JKGA 3VGLA 3UB5A 3K0SA 4C1NI 4E3SA 1IG8A 4LF4K 4ELVA 3ISNC 3NF7A 4CGFA 2ASMA 4PQUA 4L8RB 3O80A 3VENA 4DV0K 4AHRA 3NAEA 3CYMA 1YT3A 5AQVA 3CQ8A 4OKKA 4NXMK 5C25A 1ZBIA 4J2BA 1EWRA 3SMSA 3FFKB 2Q2RA 4GV9A 1HUXA 4CHPA 2E2OA 4CFAA 2KLAA 3SBTA 3ENBA 5EOYA 1A5VA 1RBRA 3DOLA 2YX6A 3ZETA 3BGRA 2YNHA 4I9LA 1JJ2M 1J53A 3PSIA 5LMNK 2UXDK 3AY9A 4YDUC 3NDKA 1TGOA 1S1TA 3V1OA 3J80O 3WEEA 1TL1A 3OS0A 2FC0A 3LDLA 4C8KA 3OS1A 2NRHA 3DMJA 4AM6A 4ZHRA 1ASUA 3O6WA 1T7PA 3Q7BA 4FWRA 3O9RA 4KFBA 3DXKB 3UIQA 1VRTA 1SKWA 2FF3B 4JNEA 5BPNA 3ZT4A 4RW8A 1CZBA 4JK7A 4FZYA 4MDBA 4BRHA 5KRTA 1U48A 4KBOA 3OBYA 4PKGA 3BY5A 2HHTA 3HM9A 1Q8IA 3ZSYA 1MDUB 4CHOA 3CM5A 4BRAA 1SV5A 1ILYA 1RT3A 2VG6A 1ZBFA 3TARA 1WBDA 5AQNA 1YF5L 1GLLO 2CGKA 1OVQA 3N4PA 3EEQA 4KAZA 3OYKA 1GOBA 3CC7N 2JLEA 3AVAA 2VWKA 4CF9A 3LDPA 2GWJA 2JWKA 2FXUA 4LF6K 3QNNA 3NVKA 5BRDA 1W2BM 1RBTA 3L3VA 5AQOA 4GNIA 2P9IA 1EXQA 5AQXA 4YOWA 4HWIA 3G71N 3RWUA 2WFBA 2QWMA 2G8VA 3R6MA 4N5SA 4W5RA 3T3FA 3HI0A 4DV5K 2ZJPL 5ADXH 5H1SQ 4DSLA 3CIPA 3DLEA 4C8MA 3KK3A 1ESVA 3NGZA 4FLVA 2YI1A 1T44A 2XY8A 3KK7A 1BIZA 3K5NA 1QQNA 4M3TA 5AQQA 4FWKA 3U3YA 2F96A 2HMIA 3WUHA 1M90O 1FJGK 4CEOA 2P9PA 3OHRA 1HRHA 4Q0BA 1HYSA 4LFAK 4BQZA 4BRIA 4AILC 3MEDA 4CIGA 4DKWA 3RR8A 3MDQA
chains in the Genus database with same CATH topology
3VQAA 4OGCA 3V6DA 1KLNA 5I3UA 1S9GA 2E6MA 1L3SA 4DS5A 1XWLA 3OYMA 4OVLA 4O55A 3F73A 3SCXA 1BI4A 1BL3A 2A1SA 1XI1A 3U6FA 1WSGA 5I42A 3LP3A 1C0UA 4AHUA 1KRPA 3PV8A 1BIUA 3ZSVA 2RF2A 2DFHA 3DI6A 4FLZA 3SYZA 4FW2A 3M8QA 3OY9A 1RDAA 3O4QA 1RT5A 4BDZA 1NK8A 1HYZA 4PWDA 4DF8A 1TAUA 3KKSA 1TK5A 1QSLA 1WLJA 3VQ7A 4FJGA 3WNEA 3NF8A 3NFAA 3P1GA 4E89A 3AA4A 3NCIA 4FJMA 1CXUA 1RT2A 2IDOA 4DFMA 2R7YA 1NJYA 1KFSA 4RW6A 3C94A 4Z0UA 4LH4A 4AHTA 3OS2A 1RT1A 4W5OA 2FBXA 3RR7A 4O0JA 1GOCA 2HHXA 5CY4A 4B8AB 3VQ8A 3ZT1A 1J54A 1JKHA 2B5JA 3HP9A 3V1RA 4CHNA 3LZJA 4DQQA 5D3GA 3TAMA 2Z1HA 4IKFA 4KPYA 4Q5VA 1JLCA 1JLBA 4DWIA 2OPSA 1R0AA 3I0RA 1L5UA 3NGIA 3M8RA 3AV9A 1JLAA 3K5OA 1U04A 2HB5A 3RRGA 1U47A 5CZ1A 1HNIA 3L2QA 1CZ9A 1HJRA 4DTXA 3KD5E 3TI0A 1KVBA 1RILA 3L2VA 4BWJA 3K58A 3ULDA 1XC9A 4PUOA 3LP0A 4FK4A 4CF1A 3NF9A 1S9EA 4FYDA 4LSNA 1A5WA 1ZBLA 1TK0A 3OJUA 3EZ5A 1BHLA 4RW4A 2HNYA 4IBNA 4K8XA 3MEGA 4KHSA 3PY8A 4ELTA 3ZSRA 2D0AA 2QXFA 4HCBA 4LSLA 4FJNA 4KHWA 1RNHA 2X74A 3ALYA 3AA5X 3I0SA 3OYFA 1JLGA 1K6YA 3QEXA 4CEDA 4R5PA 4DSKA 4CF8A 1NKCA 1VRUA 4B9TA 3E01A 4CJEA 3DLRA 4GW6A 4KTWA 3PUFA 1D8YA 4CCHA 3VQ9A 4OLBA 2YKNA 4ID5A 1LWEA 1S6QA 2KW4A 2ITGA 2HNDA 3PO4A 4DFPA 3KLGA 3HVTA 1RDCA 2XRIA 1G15A 3DRSA 4CGGA 4K8ZA 2Z1IA 4CGIA 2G8IA 3SUNA 4KHYA 4KTZA 1WN7A 3VN5A 4ZTFA 1VSMA 2BANA 1HMVA 3AO4A 2FBVA 3V81A 4Y1DA 3VQ5A 1KLMA 4CJWA 2D0CA 4Z4GA 4O44A 1SL1A 4E7HA 3AVFA 1U49A 4DQIA 4CESA 2FBYA 3K57A 3HT3A 1W0HA 4OLAA 1N6QA 5HRSA 4J2DA 4NCBA 1BISA 3KLIA 5E41A 3DRPA 3ZT2A 3HPGA 2P51A 4DG1A 4NYNA 2PZSA 3LDSA 4CJPA 1RTIA 2X78A 3PX6A 3VA3A 4HHTA 3S9HA 3SI6A 1KTQA 2YNGA 4ID1A 4BE0A 4KRFA 2KZMA 1UOCA 4FLWA 1DLOA 5J2MA 1IG9A 4NCGA 3TAEA 4CEBA 1QSYA 4KB0A 3WNHA 3OYAA 3MXMA 3AVHA 1VK0A 4M3XA 2X6SA 1Z26A 5FDLA 5FROA 4Z4IA 1HPZA 1NJZA 1NOZA 1SUQA 4CEFA 1NKEA 2O4IA 3TABA 3EYZA 1BCOA 4RG8A 3SV3A 1KFDA 3DOKA 4QCLA 2KZZA 1KSPA 2B6AA 1NK0A 2HVIA 2YHBA 3NE6A 4JS4A 2HHVA 2JGUA 4DLEA 1DTTA 1VSJA 1CLQA 3K59A 1TKZA 4DSEA 1S1VA 1GOAA 5HLFA 4J2AA 1D5AA 1X9WA 4LY7A 3KD1E 2ZQBA 4KKOA 3HXMA 4NCAA 5KI6A 5EU7A 3I8DA 2IGIA 1WAJA 4FM0A 4FLUA 1HQEA 3ZT3A 3OYHA 4E1MA 1SKSA 1KVCA 1ZBUA 3KIOA 2DTUA 2EHGA 4E7LA 4C8LA 1RBUA 4KHNA 5K14A 3OYNA 2P5GA 1RBSA 3TR8A 4FCYA 3KLHA 3G0ZA 3VQCA 2XY5A 2D0BA 3P5JA 3SUPA 4AHVA 2WONA 5FRNA 4QOZB 4FLXA 3HL8A 2D5RA 4W5TA 3MXJA 4HUGA 4DU1A 3SJJA 2IOCA 3HK2A 3SZ2A 2BE2A 4CHZA 4B3OA 2PYJA 3V9UA 3SUQA 4FJHA 4HUEA 3PX0A 1B9FA 1KCFA 3ASMA 3IRXA 4I7FA 3CFOA 3K5LA 4DTOA 4HVJA 4DTMA 3S3NA 2QKBA 3LWMA 3LP2A 1U4BA 4IFVA 4EP5A 3V9WA 1SL2A 4Z4EA 4F2SA 1XHZA 4CE9A 3AA2A 3NF6A 3KLEA 2KTQA 4DFKA 3AVKA 3V9ZA 3VQEA 4CECA 4BWMA 1O1WA 3FFIA 3ZT0A 4F3OA 4FJ8A 2O4GA 4FJJA 2ETJA 3ITHA 5KRSA 3L3UA 2QK9A 1IKXA 1JL1A 1WSHA 4CJVA 2Q3SA 4IDKA 4M41A 4BDYA 4J2EA 4FJ7A 3AVIA 1UWBA 5HRNA 4O0IA 3KLFA 1WAFA 3MAQA 1C1BA 1HNVA 3QIPA 2E4LA 3KJVA 1FKPA 2VWJA 4HUFA 1UA0A 5DMRA 1C1CA 4CGHA 4H4MA 3M8PA 4ZTJA 3AVBA 1C0MA 4JRQA 2EX3A 4ICLA 3P83D 4KV8A 5C24A 3NGYA 1QS4A 4CJSA 3OJSA 1IH7A 3H08A 2G8WA 3MECA 4CEEA 3HPHA 4B9VA 3PO5A 3LALA 4DFJA 4B9UA 1JXEA 1YVUA 2GUIA 4IG0A 4YNQA 4I2PA 3BDPA 1IO2A 1ZBHA 3NH1A 2XY6A 4FLTA 4W5NA 3RMAA 3QEVA 2OPRA 4H8KA 4DTNA 4DSJA 2Y1JA 1UAXA 3RMBA 4CJTA 3LWLA 3OYJA 1TVRA 4AH9A 4PY5A 2YNFA 3RTVA 2HHWA 5KTQA 4LD0A 2G8HA 4B9NA 4XIUA 1FXXA 5KGXA 5FRMA 1RTJA 1ZYQA 4GVMA 2P1JA 1Q9YA 4RW7A 4FJ5A 1REVA 4KREA 3SQ2A 3ZSXA 4CHQA 2RKIA 4Y1CA 3HO1A 1IKYA 1X9SA 1WSFA 1B92A 3TANA 3V4IA 1DTQA 4FZZA 3OYBA 2Z1GA 4DU3A 2HW3A 4CEZA 1X1PA 2KFZA 4O4GA 3AO5A 2OYQA 3NH2A 3K5MA 1TKXA 3DLGA 4EZ9A 1Z25A 2QKKA 1Q9XA 1EX4A 3AVGA 3RMDA 2OZMA 4W5QA 4BACA 4E7IA 1L3VA 1TAQA 4DMNA 3HP6A 1X9MA 1TV6A 4MQ3A 3HVRA 1RTHA 1LWCA 3LPUA 4CJQA 1LAWA 2PYLA 1JLFA 3KTQA 3CFRA 2DFEA 3QLHA 3F9KA 2FBTA 2RN2A 3A2FA 1TL3A 4E0DA 3QETA 5SWMA 5CZ2A 4CJ3A 4B9MA 1MU2A 3VQQA 3AO3A 1VSEA 5J2PA 2WOMA 1SKRA 4KHQA 4FXDA 3QO9A 4DTPA 5HRRA 4M3ZA 4FJKA 2I5JA 4F2RA 3DM2A 1WSJA 4OJRA 3MEEA 3O3GA 3L2WA 3VA0A 3SUOA 3QEPA 1BCMA 3HYFA 3ZSWA 2PY5A 2X6NA 3VQDA 4CFBA 4DTRA 1S5JA 4LH5A 1B9DA 4AHSA 1XHXA 4CJ4A 4CK3A 3QEIA 1NOYA 4TSXA 4DSFA 2BGGA 2OPQA 4N41A 1JLEA 4M3WA 1HQUA 4FK2A 4OPJA 1S1WA 3L8BA 4CGJA 1LWFA 1YTUA 2AJQA 3MXIA 1ITGA 2VG5A 2A1RA 4B08A 3VQBA 3JYTA 1D9FA 1T05A 4CEQA 2OA8A 1BI4B 1L3TA 5J1EA 4CK2A 2XHBA 4DTJA 1J5OA 4FW1A 4E7JA 2HHUA 3VQ4A 2F8SA 1D9DA 3LZIA 2KQ2A 1WNSA 3K2PA 4DSIA 2OPPA 3KKRA 3JSMA 2GV9A 3L2UA 4IG3A 1S1XA 3NBPA 3CG7A 2XO7A 1EKEA 3S3MA 1L3UA 3U3GA 4QAGA 4CIFA 3QEWA 3QIOA 1IKVA 5HBMA 4E3SA 5J2NA 5JS1A 1JXBA 1LAVA 4KO0A 1T03A 4CJ5A 2KFNA 3T19A 2IS3A 1SL0A 2B4JA 4ELVA 1FKOA 1LW2A 3ISNC 3NF7A 4CGFA 1C1AA 4PQUA 3S3OA 3DRRA 1QHTA 4L8RB 4BE1A 3V9XA 4AHRA 1TK8A 2W42A 3NAEA 3CYMA 4Z4FA 1YT3A 3CQ8A 4DQPA 3TAPA 1HYVA 3TAQA 1WSIA 4OKKA 1RT6A 2RPIA 1WSEA 3TWHA 1NK5A 5C25A 3KK2A 1LV5A 4H4OA 3LAMA 1QSSA 4B9SA 4J2BA 3SQ0A 3L2RA 1ZBIA 4CJFA 1I3AA 5CYMA 3PX4A 5JS2A 4CHPA 1A5XA 4CFAA 3EY1A 1KVAA 3CM6A 1Y97A 1C0TA 4HTUA 1A5VA 1RBRA 3OYDA 3DOLA 1I39A 3LP1A 4FM2A 1VSDA 3AVLA 2YNHA 3BGRA 4I9LA 4CIEA 3KK1A 4DU4A 4B9LA 5KGWA 1J53A 3ZSQA 3V9SA 3QERA 2Z1JA 4CJLA 3NDKA 4FZXC 4Z4HA 1TGOA 1S1TA 2HNZA 1VSLA 3IG1A 3V1OA 3CFPA 1RDDA 3TAGA 1TL1A 2F8TA 3OS0A 1YTAA 2FC0A 3OVNA 4C8KA 3VQ6A 3DMJA 4ZHRA 3OS1A 4B8CA 1ASUA 2ZD1A 1NK6A 4KB1A 4DTSA 1T7PA 4DQRA 4KHUA 4YFUA 4KFBA 3C6TA 3UIQA 3T1AA 2DFFA 5T7BA 4E1NA 1VRTA 4FVMA 2Y1IA 4E19A 1ASWA 1SKWA 3QINA 4M45A 2ZE2A 3THVA 4BDPA 3D0PA 3ZSOA 4HCCA 4C8NA 4N56A 3ZT4A 4CERA 4RW8A 4EP4A 1JLQA 1U45A 1CZBA 4DTUA 1F21A 4FM1A 4FJIA 4I9QA 5HP1A 1NK7A 3RMCA 4IFYA 4FZYA 3DLBA 1RCHA 3WNGA 2DY4A 5KRTA 3AVMA 1U48A 1T8EA 1RBVA 4DLGA 2G8KA 1RDBA 3B6PA 1NJXA 4F8RA 3LAKA 3RRHA 1IKWA 1VSFA 2G8UA 3HM9A 1CXQA 1NK9A 4F4KA 2HHTA 1Q8IA 3ZSYA 1C6VA 4E7KA 4OPKA 3QNOA 1VSKA 4CHOA 1ASVA 1QQCA 3CM5A 4KI6A 3HPOA 1SV5A 4BE2A 4FJ9A 4OKEA 1RT3A 2VG6A 1ZBFA 1S6PA 3C95A 3NH0A 4RW9A 3TARA 3OYEA 2IAJA 1S1UA 4JRPA 1NJWA 4KAZA 2ATQA 3OYKA 1GOBA 2E6LA 3SQ4A 1QTMA 4OKJA 2JLEA 3AVAA 2VWKA 4CF9A 3SNNA 3IS9A 4M3RA 1NKBA 4MFBA 3QNNA 4C8OA 4CJUA 4N47A 3ZCMA 5HROA 1EP4A 2YNIA 4CFDA 4CF2A 3OYGA 4FLYA 4O5BA 3DLKA 1RBTA 1RTDA 2G8FA 3L3VA 2HHSA 1NK4A 4M42A 4M3UA 2HHQA 5SZTA 2BDPA 1EXQA 4FJXA 4DQSA 3LPTA 1EETA 4JS5A 1RT7A 4CFCA 4I2QA 3RWUA 3HSTB 3DYAA 2G8VA 3O4NA 4CF0A 4CJKA 4N5SA 4W5RA 3SQ1A 3T3FA 3G10A 3DLHA 4M3YA 4F3TA 3IAYA 2YKMA 4WE1A 3HJFA 4DF4A 1BQNA 4FK0A 4Z4CA 3ZSZA 5C42A 3QESA 3TAFA 3OYCA 4DSLA 3DLEA 3WNFA 1FK9A 4G1QA 4C8MA 3KK3A 4KI4A 3AVNA 3AVJA 5DK5A 3NGZA 1LW0A 4NYFA 4CGDA 5HRPA 2IC3A 4KTQA 1N5YA 4FLVA 4CEAA 2GBZA 3V1QA 1BQMA 5J2QA 1TKDA 3SV4A 4EZ6A 3C6UA 1UA1A 4CK1A 2P5OA 4CHYA 1VSIA 1BGXT 4OGEA 3NHGA 2XY8A 4AHCA 1BIZA 3K5NA 3B6OA 4M3TA 4ELUA 1J9AA 1TKTA 3U3YA 2F96A 2HMIA 2OZSA 3OYIA 1VSHA 2NUBA 1W9HA 3O3HA 4DS4A 1JL2A 4CEOA 4UQGA 2LSNA 3AA3A 3AO2A 1HRHA 5CYQA 4GMJB 3M8SA 4CJRA 3SPZA 4Q0BA 1HYSA 3D45A 2YHAA 3LANA 3O3FA 3VQPA 4PA1A 4AILC 3AO1A 3SPYA 4N76A 3OYLA 2VG7A 3MEDA 4CIGA 2YV0X 1RT4A 3RR8A 4JLHA 2HVHA 4FJLA 2XY7A 1QE1A 3AVCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VQA A;  4OGC A;  3V6D A;  1KLN A;  5I3U A;  1S9G A;  2E6M A;  1L3S A;  4DS5 A;  1XWL A;  3OYM A;  4OVL A;  4O55 A;  3F73 A;  3SCX A;  1BI4 A;  1BL3 A;  2A1S A;  1XI1 A;  3U6F A;  1WSG A;  5I42 A;  3LP3 A;  1C0U A;  4AHU A;  1KRP A;  3PV8 A;  1BIU A;  3ZSV A;  2RF2 A;  2DFH A;  3DI6 A;  4FLZ A;  3SYZ A;  4FW2 A;  3M8Q A;  3OY9 A;  1RDA A;  3O4Q A;  1RT5 A;  4BDZ A;  1NK8 A;  1HYZ A;  4PWD A;  4DF8 A;  1TAU A;  3KKS A;  1TK5 A;  1QSL A;  1WLJ A;  3VQ7 A;  4FJG A;  3WNE A;  3NF8 A;  3NFA A;  3P1G A;  4E89 A;  3AA4 A;  3NCI A;  4FJM A;  1CXU A;  1RT2 A;  2IDO A;  4DFM A;  2R7Y A;  1NJY A;  1KFS A;  4RW6 A;  3C94 A;  4Z0U A;  4LH4 A;  4AHT A;  3OS2 A;  1RT1 A;  4W5O A;  2FBX A;  3RR7 A;  4O0J A;  1GOC A;  2HHX A;  5CY4 A;  4B8A B;  3VQ8 A;  3ZT1 A;  1J54 A;  1JKH A;  2B5J A;  3HP9 A;  3V1R A;  4CHN A;  3LZJ A;  4DQQ A;  5D3G A;  3TAM A;  2Z1H A;  4IKF A;  4KPY A;  4Q5V A;  1JLC A;  1JLB A;  4DWI A;  2OPS A;  1R0A A;  3I0R A;  1L5U A;  3NGI A;  3M8R A;  3AV9 A;  1JLA A;  3K5O A;  1U04 A;  2HB5 A;  3RRG A;  1U47 A;  5CZ1 A;  1HNI A;  3L2Q A;  1CZ9 A;  1HJR A;  4DTX A;  3KD5 E;  3TI0 A;  1KVB A;  1RIL A;  3L2V A;  4BWJ A;  3K58 A;  3ULD A;  1XC9 A;  4PUO A;  3LP0 A;  4FK4 A;  4CF1 A;  3NF9 A;  1S9E A;  4FYD A;  4LSN A;  1A5W A;  1ZBL A;  1TK0 A;  3OJU A;  3EZ5 A;  1BHL A;  4RW4 A;  2HNY A;  4IBN A;  4K8X A;  3MEG A;  4KHS A;  3PY8 A;  4ELT A;  3ZSR A;  2D0A A;  2QXF A;  4HCB A;  4LSL A;  4FJN A;  4KHW A;  1RNH A;  2X74 A;  3ALY A;  3AA5 X;  3I0S A;  3OYF A;  1JLG A;  1K6Y A;  3QEX A;  4CED A;  4R5P A;  4DSK A;  4CF8 A;  1NKC A;  1VRU A;  4B9T A;  3E01 A;  4CJE A;  3DLR A;  4GW6 A;  4KTW A;  3PUF A;  1D8Y A;  4CCH A;  3VQ9 A;  4OLB A;  2YKN A;  4ID5 A;  1LWE A;  1S6Q A;  2KW4 A;  2ITG A;  2HND A;  3PO4 A;  4DFP A;  3KLG A;  3HVT A;  1RDC A;  2XRI A;  1G15 A;  3DRS A;  4CGG A;  4K8Z A;  2Z1I A;  4CGI A;  2G8I A;  3SUN A;  4KHY A;  4KTZ A;  1WN7 A;  3VN5 A;  4ZTF A;  1VSM A;  2BAN A;  1HMV A;  3AO4 A;  2FBV A;  3V81 A;  4Y1D A;  3VQ5 A;  1KLM A;  4CJW A;  2D0C A;  4Z4G A;  4O44 A;  1SL1 A;  4E7H A;  3AVF A;  1U49 A;  4DQI A;  4CES A;  2FBY A;  3K57 A;  3HT3 A;  1W0H A;  4OLA A;  1N6Q A;  5HRS A;  4J2D A;  4NCB A;  1BIS A;  3KLI A;  5E41 A;  3DRP A;  3ZT2 A;  3HPG A;  2P51 A;  4DG1 A;  4NYN A;  2PZS A;  3LDS A;  4CJP A;  1RTI A;  2X78 A;  3PX6 A;  3VA3 A;  4HHT A;  3S9H A;  3SI6 A;  1KTQ A;  2YNG A;  4ID1 A;  4BE0 A;  4KRF A;  2KZM A;  1UOC A;  4FLW A;  1DLO A;  5J2M A;  1IG9 A;  4NCG A;  3TAE A;  4CEB A;  1QSY A;  4KB0 A;  3WNH A;  3OYA A;  3MXM A;  3AVH A;  1VK0 A;  4M3X A;  2X6S A;  1Z26 A;  5FDL A;  5FRO A;  4Z4I A;  1HPZ A;  1NJZ A;  1NOZ A;  1SUQ A;  4CEF A;  1NKE A;  2O4I A;  3TAB A;  3EYZ A;  1BCO A;  4RG8 A;  3SV3 A;  1KFD A;  3DOK A;  4QCL A;  2KZZ A;  1KSP A;  2B6A A;  1NK0 A;  2HVI A;  2YHB A;  3NE6 A;  4JS4 A;  2HHV A;  2JGU A;  4DLE A;  1DTT A;  1VSJ A;  1CLQ A;  3K59 A;  1TKZ A;  4DSE A;  1S1V A;  1GOA A;  5HLF A;  4J2A A;  1D5A A;  1X9W A;  4LY7 A;  3KD1 E;  2ZQB A;  4KKO A;  3HXM A;  4NCA A;  5KI6 A;  5EU7 A;  3I8D A;  2IGI A;  1WAJ A;  4FM0 A;  4FLU A;  1HQE A;  3ZT3 A;  3OYH A;  4E1M A;  1SKS A;  1KVC A;  1ZBU A;  3KIO A;  2DTU A;  2EHG A;  4E7L A;  4C8L A;  1RBU A;  4KHN A;  5K14 A;  3OYN A;  2P5G A;  1RBS A;  3TR8 A;  4FCY A;  3KLH A;  3G0Z A;  3VQC A;  2XY5 A;  2D0B A;  3P5J A;  3SUP A;  4AHV A;  2WON A;  5FRN A;  4QOZ B;  4FLX A;  3HL8 A;  2D5R A;  4W5T A;  3MXJ A;  4HUG A;  4DU1 A;  3SJJ A;  2IOC A;  3HK2 A;  3SZ2 A;  2BE2 A;  4CHZ A;  4B3O A;  2PYJ A;  3V9U A;  3SUQ A;  4FJH A;  4HUE A;  3PX0 A;  1B9F A;  1KCF A;  3ASM A;  3IRX A;  4I7F A;  3CFO A;  3K5L A;  4DTO A;  4HVJ A;  4DTM A;  3S3N A;  2QKB A;  3LWM A;  3LP2 A;  1U4B A;  4IFV A;  4EP5 A;  3V9W A;  1SL2 A;  4Z4E A;  4F2S A;  1XHZ A;  4CE9 A;  3AA2 A;  3NF6 A;  3KLE A;  2KTQ A;  4DFK A;  3AVK A;  3V9Z A;  3VQE A;  4CEC A;  4BWM A;  1O1W A;  3FFI A;  3ZT0 A;  4F3O A;  4FJ8 A;  2O4G A;  4FJJ A;  2ETJ A;  3ITH A;  5KRS A;  3L3U A;  2QK9 A;  1IKX A;  1JL1 A;  1WSH A;  4CJV A;  2Q3S A;  4IDK A;  4M41 A;  4BDY A;  4J2E A;  4FJ7 A;  3AVI A;  1UWB A;  5HRN A;  4O0I A;  3KLF A;  1WAF A;  3MAQ A;  1C1B A;  1HNV A;  3QIP A;  2E4L A;  3KJV A;  1FKP A;  2VWJ A;  4HUF A;  1UA0 A;  5DMR A;  1C1C A;  4CGH A;  4H4M A;  3M8P A;  4ZTJ A;  3AVB A;  1C0M A;  4JRQ A;  2EX3 A;  4ICL A;  3P83 D;  4KV8 A;  5C24 A;  3NGY A;  1QS4 A;  4CJS A;  3OJS A;  1IH7 A;  3H08 A;  2G8W A;  3MEC A;  4CEE A;  3HPH A;  4B9V A;  3PO5 A;  3LAL A;  4DFJ A;  4B9U A;  1JXE A;  1YVU A;  2GUI A;  4IG0 A;  4YNQ A;  4I2P A;  3BDP A;  1IO2 A;  1ZBH A;  3NH1 A;  2XY6 A;  4FLT A;  4W5N A;  3RMA A;  3QEV A;  2OPR A;  4H8K A;  4DTN A;  4DSJ A;  2Y1J A;  1UAX A;  3RMB A;  4CJT A;  3LWL A;  3OYJ A;  1TVR A;  4AH9 A;  4PY5 A;  2YNF A;  3RTV A;  2HHW A;  5KTQ A;  4LD0 A;  2G8H A;  4B9N A;  4XIU A;  1FXX A;  5KGX A;  5FRM A;  1RTJ A;  1ZYQ A;  4GVM A;  2P1J A;  1Q9Y A;  4RW7 A;  4FJ5 A;  1REV A;  4KRE A;  3SQ2 A;  3ZSX A;  4CHQ A;  2RKI A;  4Y1C A;  3HO1 A;  1IKY A;  1X9S A;  1WSF A;  1B92 A;  3TAN A;  3V4I A;  1DTQ A;  4FZZ A;  3OYB A;  2Z1G A;  4DU3 A;  2HW3 A;  4CEZ A;  1X1P A;  2KFZ A;  4O4G A;  3AO5 A;  2OYQ A;  3NH2 A;  3K5M A;  1TKX A;  3DLG A;  4EZ9 A;  1Z25 A;  2QKK A;  1Q9X A;  1EX4 A;  3AVG A;  3RMD A;  2OZM A;  4W5Q A;  4BAC A;  4E7I A;  1L3V A;  1TAQ A;  4DMN A;  3HP6 A;  1X9M A;  1TV6 A;  4MQ3 A;  3HVR A;  1RTH A;  1LWC A;  3LPU A;  4CJQ A;  1LAW A;  2PYL A;  1JLF A;  3KTQ A;  3CFR A;  2DFE A;  3QLH A;  3F9K A;  2FBT A;  2RN2 A;  3A2F A;  1TL3 A;  4E0D A;  3QET A;  5SWM A;  5CZ2 A;  4CJ3 A;  4B9M A;  1MU2 A;  3VQQ A;  3AO3 A;  1VSE A;  5J2P A;  2WOM A;  1SKR A;  4KHQ A;  4FXD A;  3QO9 A;  4DTP A;  5HRR A;  4M3Z A;  4FJK A;  2I5J A;  4F2R A;  3DM2 A;  1WSJ A;  4OJR A;  3MEE A;  3O3G A;  3L2W A;  3VA0 A;  3SUO A;  3QEP A;  1BCM A;  3HYF A;  3ZSW A;  2PY5 A;  2X6N A;  3VQD A;  4CFB A;  4DTR A;  1S5J A;  4LH5 A;  1B9D A;  4AHS A;  1XHX A;  4CJ4 A;  4CK3 A;  3QEI A;  1NOY A;  4TSX A;  4DSF A;  2BGG A;  2OPQ A;  4N41 A;  1JLE A;  4M3W A;  1HQU A;  4FK2 A;  4OPJ A;  1S1W A;  3L8B A;  4CGJ A;  1LWF A;  1YTU A;  2AJQ A;  3MXI A;  1ITG A;  2VG5 A;  2A1R A;  4B08 A;  3VQB A;  3JYT A;  1D9F A;  1T05 A;  4CEQ A;  2OA8 A;  1BI4 B;  1L3T A;  5J1E A;  4CK2 A;  2XHB A;  4DTJ A;  1J5O A;  4FW1 A;  4E7J A;  2HHU A;  3VQ4 A;  2F8S A;  1D9D A;  3LZI A;  2KQ2 A;  1WNS A;  3K2P A;  4DSI A;  2OPP A;  3KKR A;  3JSM A;  2GV9 A;  3L2U A;  4IG3 A;  1S1X A;  3NBP A;  3CG7 A;  2XO7 A;  1EKE A;  3S3M A;  1L3U A;  3U3G A;  4QAG A;  4CIF A;  3QEW A;  3QIO A;  1IKV A;  5HBM A;  4E3S A;  5J2N A;  5JS1 A;  1JXB A;  1LAV A;  4KO0 A;  1T03 A;  4CJ5 A;  2KFN A;  3T19 A;  2IS3 A;  1SL0 A;  2B4J A;  4ELV A;  1FKO A;  1LW2 A;  3ISN C;  3NF7 A;  4CGF A;  1C1A A;  4PQU A;  3S3O A;  3DRR A;  1QHT A;  4L8R B;  4BE1 A;  3V9X A;  4AHR A;  1TK8 A;  2W42 A;  3NAE A;  3CYM A;  4Z4F A;  1YT3 A;  3CQ8 A;  4DQP A;  3TAP A;  1HYV A;  3TAQ A;  1WSI A;  4OKK A;  1RT6 A;  2RPI A;  1WSE A;  3TWH A;  1NK5 A;  5C25 A;  3KK2 A;  1LV5 A;  4H4O A;  3LAM A;  1QSS A;  4B9S A;  4J2B A;  3SQ0 A;  3L2R A;  1ZBI A;  4CJF A;  1I3A A;  5CYM A;  3PX4 A;  5JS2 A;  4CHP A;  1A5X A;  4CFA A;  3EY1 A;  1KVA A;  3CM6 A;  1Y97 A;  1C0T A;  4HTU A;  1A5V A;  1RBR A;  3OYD A;  3DOL A;  1I39 A;  3LP1 A;  4FM2 A;  1VSD A;  3AVL A;  2YNH A;  3BGR A;  4I9L A;  4CIE A;  3KK1 A;  4DU4 A;  4B9L A;  5KGW A;  1J53 A;  3ZSQ A;  3V9S A;  3QER A;  2Z1J A;  4CJL A;  3NDK A;  4FZX C;  4Z4H A;  1TGO A;  1S1T A;  2HNZ A;  1VSL A;  3IG1 A;  3V1O A;  3CFP A;  1RDD A;  3TAG A;  1TL1 A;  2F8T A;  3OS0 A;  1YTA A;  2FC0 A;  3OVN A;  4C8K A;  3VQ6 A;  3DMJ A;  4ZHR A;  3OS1 A;  4B8C A;  1ASU A;  2ZD1 A;  1NK6 A;  4KB1 A;  4DTS A;  1T7P A;  4DQR A;  4KHU A;  4YFU A;  4KFB A;  3C6T A;  3UIQ A;  3T1A A;  2DFF A;  5T7B A;  4E1N A;  1VRT A;  4FVM A;  2Y1I A;  4E19 A;  1ASW A;  1SKW A;  3QIN A;  4M45 A;  2ZE2 A;  3THV A;  4BDP A;  3D0P A;  3ZSO A;  4HCC A;  4C8N A;  4N56 A;  3ZT4 A;  4CER A;  4RW8 A;  4EP4 A;  1JLQ A;  1U45 A;  1CZB A;  4DTU A;  1F21 A;  4FM1 A;  4FJI A;  4I9Q A;  5HP1 A;  1NK7 A;  3RMC A;  4IFY A;  4FZY A;  3DLB A;  1RCH A;  3WNG A;  2DY4 A;  5KRT A;  3AVM A;  1U48 A;  1T8E A;  1RBV A;  4DLG A;  2G8K A;  1RDB A;  3B6P A;  1NJX A;  4F8R A;  3LAK A;  3RRH A;  1IKW A;  1VSF A;  2G8U A;  3HM9 A;  1CXQ A;  1NK9 A;  4F4K A;  2HHT A;  1Q8I A;  3ZSY A;  1C6V A;  4E7K A;  4OPK A;  3QNO A;  1VSK A;  4CHO A;  1ASV A;  1QQC A;  3CM5 A;  4KI6 A;  3HPO A;  1SV5 A;  4BE2 A;  4FJ9 A;  4OKE A;  1RT3 A;  2VG6 A;  1ZBF A;  1S6P A;  3C95 A;  3NH0 A;  4RW9 A;  3TAR A;  3OYE A;  2IAJ A;  1S1U A;  4JRP A;  1NJW A;  4KAZ A;  2ATQ A;  3OYK A;  1GOB A;  2E6L A;  3SQ4 A;  1QTM A;  4OKJ A;  2JLE A;  3AVA A;  2VWK A;  4CF9 A;  3SNN A;  3IS9 A;  4M3R A;  1NKB A;  4MFB A;  3QNN A;  4C8O A;  4CJU A;  4N47 A;  3ZCM A;  5HRO A;  1EP4 A;  2YNI A;  4CFD A;  4CF2 A;  3OYG A;  4FLY A;  4O5B A;  3DLK A;  1RBT A;  1RTD A;  2G8F A;  3L3V A;  2HHS A;  1NK4 A;  4M42 A;  4M3U A;  2HHQ A;  5SZT A;  2BDP A;  1EXQ A;  4FJX A;  4DQS A;  3LPT A;  1EET A;  4JS5 A;  1RT7 A;  4CFC A;  4I2Q A;  3RWU A;  3HST B;  3DYA A;  2G8V A;  3O4N A;  4CF0 A;  4CJK A;  4N5S A;  4W5R A;  3SQ1 A;  3T3F A;  3G10 A;  3DLH A;  4M3Y A;  4F3T A;  3IAY A;  2YKM A;  4WE1 A;  3HJF A;  4DF4 A;  1BQN A;  4FK0 A;  4Z4C A;  3ZSZ A;  5C42 A;  3QES A;  3TAF A;  3OYC A;  4DSL A;  3DLE A;  3WNF A;  1FK9 A;  4G1Q A;  4C8M A;  3KK3 A;  4KI4 A;  3AVN A;  3AVJ A;  5DK5 A;  3NGZ A;  1LW0 A;  4NYF A;  4CGD A;  5HRP A;  2IC3 A;  4KTQ A;  1N5Y A;  4FLV A;  4CEA A;  2GBZ A;  3V1Q A;  1BQM A;  5J2Q A;  1TKD A;  3SV4 A;  4EZ6 A;  3C6U A;  1UA1 A;  4CK1 A;  2P5O A;  4CHY A;  1VSI A;  1BGX T;  4OGE A;  3NHG A;  2XY8 A;  4AHC A;  1BIZ A;  3K5N A;  3B6O A;  4M3T A;  4ELU A;  1J9A A;  1TKT A;  3U3Y A;  2F96 A;  2HMI A;  2OZS A;  3OYI A;  1VSH A;  2NUB A;  1W9H A;  3O3H A;  4DS4 A;  1JL2 A;  4CEO A;  4UQG A;  2LSN A;  3AA3 A;  3AO2 A;  1HRH A;  5CYQ A;  4GMJ B;  3M8S A;  4CJR A;  3SPZ A;  4Q0B A;  1HYS A;  3D45 A;  2YHA A;  3LAN A;  3O3F A;  3VQP A;  4PA1 A;  4AIL C;  3AO1 A;  3SPY A;  4N76 A;  3OYL A;  2VG7 A;  3MED A;  4CIG A;  2YV0 X;  1RT4 A;  3RR8 A;  4JLH A;  2HVH A;  4FJL A;  2XY7 A;  1QE1 A;  3AVC A; 
#chains in the Genus database with same CATH topology
 3CJ7 A;  4FWO A;  3V6D A;  1KLN A;  2E6M A;  1L3S A;  4ILJ A;  3SCX A;  1BI4 A;  4LF8 K;  3U6F A;  1C0U A;  2FF6 A;  3SLC A;  3ZSV A;  1OH8 A;  2RF2 A;  1NU0 A;  1XNQ K;  4DF8 A;  1TAU A;  1QSL A;  3NF8 A;  3NFA A;  3HRG A;  3P1G A;  4E89 A;  1W7A A;  1NJY A;  2Q0R A;  1KFS A;  2R7Y A;  4LF9 K;  2AP1 A;  4RW6 A;  3C94 A;  4A5B A;  4QS9 A;  1NGH A;  3RR7 A;  4JI3 K;  4O0J A;  2WUS A;  2HHX A;  3C65 A;  4DQQ A;  3LZJ A;  2Z1H A;  2BTF A;  1JLB A;  4DWI A;  3OBW A;  3ENO A;  4CBW A;  3RRG A;  2O8C B;  1Z6R A;  4DTX A;  3KD5 E;  1LCU A;  3TI0 A;  3L2V A;  4FK4 A;  3E9O A;  3T7Z A;  4RW4 A;  4CW7 B;  4IBN A;  5KPT A;  4A57 A;  4BY9 C;  3ZSR A;  4HCB A;  4DR3 K;  1YXQ A;  3S41 A;  4KHW A;  2D0P A;  3ALY A;  5MLC Q;  3QEX A;  1BUP A;  4CF8 A;  1QZ6 A;  4BRE A;  5AQP A;  2UU9 K;  4GW6 A;  4CCH A;  1D8Y A;  4OLB A;  4ID5 A;  1LWE A;  3DXK A;  1KAY A;  4DFP A;  3PIO L;  3HVT A;  1JCE A;  1EQY A;  2FSN A;  3DRS A;  4IO8 A;  2Z1I A;  4KTZ A;  1O13 A;  3H6E A;  2FBV A;  3U9Z A;  3AVF A;  4DQI A;  1N6Q A;  1JCG A;  4PL7 A;  3CCM N;  3ZT2 A;  2P51 A;  1TYQ B;  4IFE A;  3LDS A;  1RTI A;  1YJ9 N;  3VA3 A;  1Q81 O;  4KRF A;  4FO0 A;  1IG9 A;  3QIC A;  3CC2 N;  3TAE A;  4KB0 A;  3WNH A;  1VK0 A;  2WTU A;  4CEF A;  3TAB A;  4U7B A;  3SV3 A;  4IJN A;  1KFD A;  1BU6 O;  5AQW A;  2B6A A;  1NK0 A;  1Q7Y O;  1YIJ N;  3UKU B;  4DSE A;  4J2A A;  1D5A A;  4H0X B;  1X9W A;  3KD1 E;  2ZQB A;  4FOE A;  3WQU A;  4E1M A;  2Q31 A;  2EHG A;  4KHN A;  1RBS A;  3BEX A;  4CZH A;  3VQC A;  4FLX A;  3HK2 A;  2PYJ A;  4XH4 A;  3R9P A;  1V4T A;  3OW2 M;  2ZJR L;  4FJH A;  1B9F A;  1ZXO A;  3CFO A;  4HVJ A;  4DTM A;  3FZF A;  4EP5 A;  4Z4E A;  4F2S A;  3TU5 A;  4DFK A;  3AVK A;  4GKK K;  2UYT A;  1O1W A;  4FJ8 A;  5F2R A;  3ZT0 A;  5AQK A;  2ETJ A;  3ITH A;  3P39 A;  1S72 N;  4CZE A;  4BGB A;  1NGD A;  4M41 A;  4FJ7 A;  5I9E B;  2HBJ A;  5HRN A;  1WAF A;  2HST A;  2E4L A;  1FKP A;  3MN6 A;  4CGH A;  3O9U A;  4H4M A;  4ZTJ A;  4JRQ A;  1R59 O;  4H5N A;  2NRZ A;  2EX3 A;  4OPH A;  5JVH L;  4CZI A;  4CEE A;  4B9V A;  4DFJ A;  3O1W A;  1JXE A;  4I2P A;  1IO2 A;  3ZX2 A;  4WCE L;  2VQF K;  4DSJ A;  3RMB A;  4PY5 A;  1HNX K;  1VQ8 N;  2YNF A;  2A6A A;  3RTV A;  1C0F A;  1Q86 O;  1MWK A;  5CR4 A;  5AQU A;  1GLC G;  3O9Q A;  5KGX A;  5FRM A;  1NMN A;  2P1J A;  4MDA A;  3WXK A;  4KRE A;  4CHQ A;  3O9T A;  1X9S A;  1WSF A;  2QM1 A;  1GLD G;  3TAN A;  4KHP K;  2HW3 A;  3ZEU B;  4CEZ A;  4FWL A;  2OYQ A;  2QWO A;  3NH2 A;  3K5M A;  1TKX A;  3DLG A;  2QKK A;  3AVG A;  4H5V A;  2O8C A;  2ZM6 K;  3RMD A;  2OZM A;  4BAC A;  1L3V A;  4JKE A;  3O8M A;  4DMN A;  3THW B;  5DM7 L;  1LAW A;  4MLH A;  1JLF A;  3CFR A;  1X3N A;  3A2F A;  1TL3 A;  1P90 A;  1VQ7 N;  3QFU A;  5J2P A;  4CI6 A;  4CD3 A;  1SKR A;  4FXD A;  3DXM B;  4JV5 K;  1KAX A;  3T1Y K;  3SUO A;  1BCM A;  3SAH A;  2PY5 A;  2OTJ N;  3VQD A;  4AM7 A;  4B1V A;  2OPQ A;  5ELZ A;  3L8B A;  3CCQ N;  1LWF A;  5BPM A;  4B08 A;  3VQB A;  4CEQ A;  1MA9 B;  3CCR N;  2A3Z A;  5EVZ A;  1RDW X;  4BRQ A;  2KQ2 A;  3K2P A;  5KQD A;  4UY8 O;  1S1X A;  1TYQ A;  4AF1 A;  1EKE A;  5IWA K;  4X66 K;  4BC4 A;  5TKW A;  4CIF A;  3QEW A;  4F9O A;  1IKV A;  5HBM A;  3W0L A;  5J2N A;  1LAV A;  2KFN A;  3T19 A;  2B4J A;  1FKO A;  1YUW A;  3C0B A;  2P9S B;  1C1A A;  5AQL A;  1HPM A;  4PL8 A;  4DV4 K;  4BE1 A;  1TK8 A;  2W42 A;  1BG3 A;  3M6G A;  3TAQ A;  1WSI A;  4BRK A;  1LV5 A;  3M3Z A;  3UKU A;  5BRF A;  3LM2 A;  5AZJ B;  1NMD A;  5LMU K;  2ZF5 O;  1A5X A;  5M1K A;  4BGA A;  3AGR A;  3EY1 A;  5AQR A;  3CM6 A;  1Y97 A;  1C0T A;  4JEP A;  1N36 K;  3TTC A;  2PAV A;  3ATV A;  1VSD A;  4B9L A;  1HJO A;  2O8F B;  1U6Z A;  3QER A;  2Z1J A;  4Z4H A;  4ISE A;  1RDD A;  3J8A A;  2ITM A;  1NK6 A;  4B8C A;  1QVF M;  4KB1 A;  1M1K O;  4DQR A;  3SJH A;  4E1N A;  4FVM A;  3TTD A;  4DR6 K;  3I55 N;  4HCC A;  4C8N A;  4N56 A;  3R1X A;  3J81 O;  4DTU A;  4IFY A;  5EY4 A;  3AVM A;  1T8E A;  1RBV A;  1RDB A;  1NJX A;  2QWN A;  5C2D A;  3JS6 A;  3LAK A;  3A0I X;  1VSF A;  5GIO A;  5FPM A;  4OPK A;  3QNO A;  1Q18 A;  1VSK A;  4KI6 A;  4JI7 K;  4FJ9 A;  3NH0 A;  5CHI A;  4RW9 A;  2NRV A;  3FGU A;  3VMF B;  1QTM A;  3RSE B;  1NGB A;  4WQ4 A;  2PFU A;  2ASP A;  3R8E A;  1OH7 A;  4MFB A;  4MO4 A;  3DLL L;  2P9N B;  4CFD A;  4CF2 A;  3A5O C;  1RTD A;  1SAZ A;  2J4R A;  1NK4 A;  4WQ4 C;  4M3U A;  2HHQ A;  5SZT A;  5BPL A;  2E5L K;  2P9L B;  4DV6 K;  4CFC A;  4I2Q A;  3HST B;  3DYA A;  3DLH A;  4CJK A;  4CVN E;  3ZEU A;  4EFH A;  1IBM K;  3J7A P;  2UUC K;  3HJF A;  3CMA N;  3ZSZ A;  3QES A;  1YJN N;  3WNF A;  1FK9 A;  4DB3 A;  3NVM A;  4KI4 A;  3ENH A;  3AVJ A;  3U8X A;  4KTQ A;  4CD1 A;  4CGD A;  3THW A;  2IC3 A;  1N34 K;  1XC3 A;  3QB0 A;  3SV4 A;  4EZ6 A;  3C6U A;  1BGX T;  3NHG A;  4AHC A;  3D6R A;  3B6O A;  4ELU A;  2BUP A;  1XMQ K;  3DXM A;  3CCE N;  3OYI A;  1VSH A;  4H0V B;  4B3T K;  2WC9 A;  4DHY A;  4DS4 A;  1JL2 A;  3A5N C;  3AO2 A;  2NRT A;  3O3F A;  4ILH A;  3VQP A;  3AO1 A;  3OYL A;  2VG7 A;  2YV0 X;  4JHD B;  2HVH A;  1QHA A;  5EXW A;  1QE1 A;  4CJE A;  5HL7 L;  3VQA A;  4OGC A;  3VTI A;  1S9G A;  4CZF A;  4DS5 A;  1XWL A;  5M1O A;  3F73 A;  4YDU A;  4XH5 A;  5I42 A;  5GAG P;  3H45 C;  4AHU A;  1NNE A;  3PV8 A;  3THX B;  1BIU A;  1FW6 A;  4BDZ A;  1NK8 A;  1HYZ A;  3TSP A;  1WLJ A;  3VQ7 A;  3FZM A;  3NCI A;  4FJM A;  4DFM A;  3TTF A;  4CBX A;  4LH4 A;  3CJA A;  4AHT A;  4W5O A;  1YI2 N;  2W6K A;  1GOC A;  3TSU A;  3VQ8 A;  3ZT1 A;  1J54 A;  3V1R A;  3HP9 A;  5D3G A;  2P9S A;  3VGK A;  3TAM A;  2HOE A;  4GVE A;  3CCL N;  3NGI A;  1GLA G;  3FR0 A;  3I33 A;  1JLA A;  5C0Y A;  2HB5 A;  5CZ1 A;  5AZJ A;  1KVB A;  1RIL A;  3U9D A;  1XC9 A;  4YOY A;  2FSJ A;  5GIN A;  4BR2 A;  4DV3 K;  3J7Y P;  2A40 A;  4FYD A;  4LSN A;  2VGM A;  4DQ8 A;  1ZBL A;  1TK0 A;  3PSF A;  2NZT A;  2HNY A;  4K8X A;  3PY8 A;  3JAM O;  2QXF A;  4LSL A;  1RNH A;  2O8F A;  3OYF A;  3KVG A;  3LL3 A;  4CED A;  3MN9 A;  2PBD A;  4R5P A;  1NKC A;  4WFA L;  1VRU A;  3E01 A;  4KTW A;  4ILG B;  2D0O A;  2KW4 A;  4E1J A;  3THY A;  2E20 A;  3KLG A;  1G15 A;  4GV6 A;  4CGI A;  3MX2 A;  3SUN A;  1NGJ A;  3VN5 A;  4B3S K;  2YHX A;  3AO4 A;  3CPE A;  4CJW A;  4Z4G A;  4O44 A;  5FLX O;  1SL1 A;  4E7H A;  4JI0 K;  4JI1 K;  4IOX A;  3O1B A;  5E41 A;  3DRP A;  4IOA L;  3HPG A;  3VET A;  5AQY A;  4NYN A;  2PZS A;  4CJP A;  4K41 A;  4HHT A;  5JMV A;  3MK6 A;  1UOC A;  4IDH A;  3B8A X;  5AQH A;  3EO3 A;  3EN9 A;  4NCG A;  1P8Z A;  1QSY A;  5F1X A;  3OYA A;  3AVH A;  3HZ6 A;  5FDL A;  1HPZ A;  3RSE A;  1NOZ A;  2QTD A;  1NKE A;  1HR0 K;  2O4I A;  3EYZ A;  4RG8 A;  4QCL A;  2KZZ A;  1HNZ K;  1KSP A;  2HHV A;  2YHB A;  4JS4 A;  4LC9 B;  2JGU A;  4JKB A;  4DLE A;  1DTT A;  1VQL N;  2P9N A;  3VOV A;  1TKZ A;  4YOX A;  1X9J A;  1GOA A;  5HLF A;  3CPW M;  3HXM A;  4NCA A;  4BRG A;  5EU7 A;  3TAG A;  4JK8 A;  4FM0 A;  4FLU A;  1KVC A;  3KIO A;  4EAH D;  1T6C A;  2P9L A;  5JIC A;  3VER A;  4WF9 L;  4E7L A;  1RBU A;  4C8L A;  5AQF A;  4KH6 A;  3TR8 A;  2QXL A;  2ZJQ L;  3P5J A;  3AAQ A;  5FRN A;  1Q82 O;  2D5R A;  3HBT A;  5M1P A;  2VQE K;  1SZ2 A;  4B3O A;  3EZW A;  3V9U A;  4CZJ A;  5C2F A;  1T6D A;  3ASM A;  3IRX A;  4DTO A;  1K8K B;  3LP2 A;  3AAR A;  1BA0 A;  3O08 A;  4IFV A;  3V9W A;  1U4B A;  1XHZ A;  3NF6 A;  2WBN A;  5AQM A;  2KTQ A;  3V9Z A;  4BWM A;  3FFI A;  2O4G A;  1ATN A;  2CGL A;  3ZX0 A;  1JL1 A;  2Q3S A;  2V52 B;  4O0I A;  3KLF A;  2QKB A;  3MAQ A;  4HUF A;  1NLV A;  3AVB A;  1C0M A;  3CD6 N;  4KV8 A;  3CCV N;  5C24 A;  1QS4 A;  4PKI A;  3OJS A;  1IH7 A;  4JHD A;  3HPH A;  3PO5 A;  4B9U A;  1YVU A;  2E8A A;  4DV7 K;  3LDQ A;  1ZBH A;  3NH1 A;  4FLT A;  3F2K A;  4WFN L;  3VEX A;  1YHQ N;  2Y1J A;  4PKH A;  3LWL A;  1TVR A;  2NRX A;  3THX A;  3M5R A;  1HKC A;  2HHW A;  5KTQ A;  4LD0 A;  2G8H A;  4YOT A;  4XIU A;  5BR8 K;  4H0O A;  4GVM A;  4RW7 A;  1T3V A;  1XQS C;  4BR4 A;  1QQM A;  3ZSX A;  4C23 A;  1K8A O;  1IKY A;  3N4Q A;  1B92 A;  1S22 A;  1DTQ A;  3A5L C;  1X1P A;  2KFZ A;  3AO5 A;  1VQN N;  3SBG A;  2W41 A;  5GAE P;  4IOC L;  4H5W A;  4X64 K;  4W5Q A;  4GKJ K;  4FWN A;  3C6H A;  3K9J A;  4E7I A;  1X9M A;  2CH6 A;  1RTH A;  4IEE A;  2PYL A;  4FSV A;  4C1N K;  5SWM A;  4CJ3 A;  4B9M A;  3AO3 A;  3CHW A;  3IFR A;  3MWT A;  2NRW A;  3CME N;  1DGK N;  2HBL A;  3QBW A;  3QO9 A;  4DTP A;  1N33 K;  3DM2 A;  3QEP A;  4OJR A;  3MEE A;  4B1Y B;  2ZGZ A;  4CFB A;  4CJ4 A;  3QEI A;  3ZYY X;  2BGG A;  2O8B B;  4N41 A;  1KAZ A;  1HQU A;  4DR1 K;  1S1W A;  1WUA A;  5M1Q A;  1ITG A;  2VG5 A;  1NGC A;  1D9F A;  1H1V A;  1T05 A;  3VEY A;  2I7P A;  3DJC A;  3FZH A;  3GL1 A;  3KWG A;  1L3T A;  2QWP A;  3L6Q A;  4E7J A;  4M7X A;  1D9D A;  3KKR A;  5AZI B;  3TSQ A;  2GV9 A;  3SAF A;  4IG3 A;  2XO7 A;  3BF3 A;  1L3U A;  2W40 A;  3U3G A;  4IEI A;  5AFU A;  3F5T A;  1GLE G;  3QIO A;  1JXB A;  3NMU A;  4FPB A;  3PLA A;  3S3O A;  3CCS N;  1MWM A;  3WXJ A;  3OA9 A;  3V9X A;  3VEO A;  4Z4F A;  5KQ8 A;  1VHX A;  1NOY A;  1RT6 A;  2RPI A;  1WSE A;  3L4Q A;  1EO1 A;  3CCU N;  1QSS A;  3SQ0 A;  4CJF A;  1I3A A;  2QEX N;  2HBM A;  1NGE A;  3PX4 A;  4HTU A;  3WXI A;  3OYD A;  5BRH A;  1I39 A;  3LP1 A;  3GE1 A;  3AVL A;  4CIE A;  4X65 K;  4DU4 A;  5LJV A;  5KGW A;  3ZSQ A;  2KHO A;  4FPA A;  2H3G X;  4H5T A;  4CJL A;  4FZX C;  3CFP A;  2HNZ A;  1EWQ A;  3LDO A;  2F8T A;  3OVN A;  1BDG A;  1HLU A;  2ZD1 A;  1K73 O;  4JI4 K;  4DTS A;  4NXN K;  4KHU A;  1K8K A;  4DCH A;  4YFU A;  2DFF A;  1ASW A;  3QIN A;  4H0P A;  2ZE2 A;  3P4I A;  2GTD A;  3IMX A;  3D0P A;  3THV A;  4BDP A;  3WQT A;  4CER A;  4I9Q A;  1F21 A;  4FJI A;  1NK7 A;  3VF2 A;  1RCH A;  3WNG A;  2DY4 A;  3EL2 A;  4DV1 K;  4NLC A;  3W3D A;  2GEM A;  1OH6 A;  1IKW A;  4F4K A;  2G8U A;  1NK9 A;  1CXQ A;  4K42 A;  3HOT A;  2V51 B;  1C6V A;  4E7K A;  4JI8 K;  1ASV A;  1QQC A;  3VES A;  1IBK K;  3HPO A;  3C95 A;  1S6P A;  2QWL A;  4YOR A;  1YAG A;  2E2P A;  2IAJ A;  4WQ5 C;  2GEL A;  4JRP A;  2ATQ A;  2E6L A;  2QWR A;  4OKJ A;  3IS9 A;  4M3R A;  4DV2 K;  1HKB A;  2W6L A;  3C6A A;  4N47 A;  5KPR A;  4FLY A;  3OYG A;  4K0K K;  3ULE B;  2G8F A;  2VYP A;  4M42 A;  1E4F T;  4DQS A;  1X3M A;  3O4N A;  4CF0 A;  1E4G T;  3IAY A;  2YKM A;  4DF4 A;  1BQN A;  3GBT A;  4Z4C A;  4FK0 A;  3CJB A;  1KD1 O;  3CF5 L;  2Q0U A;  4G1Q A;  2UXC K;  4A61 A;  5DK5 A;  5HRP A;  5J2Q A;  2GBZ A;  3H3N O;  1UA1 A;  2P5O A;  4CHY A;  1VSI A;  3WXM B;  5JLH A;  4YY3 K;  4OGE A;  4BVO A;  4CBU A;  4JI5 K;  3UKR B;  2OZS A;  4LFC K;  2NUB A;  1W9H A;  3O3H A;  4UQG A;  3AA3 A;  2VGN A;  3MWP A;  5CYQ A;  1WOQ A;  4GMJ B;  5FPN A;  4AQY K;  2YHA A;  3D2E B;  3LAN A;  2NLX A;  1VQO N;  4N76 A;  1CZA N;  2O8B A;  5TKY A;  1RT4 A;  4JLH A;  2XY7 A;  1TKD A;  1N8R O;  3OYM A;  4OVL A;  4O55 A;  1BL3 A;  1NM1 A;  3E9L A;  2A1S A;  2D4W A;  1YJW N;  1XI1 A;  4HTL A;  1KRP A;  3CER A;  1VAZ A;  2OAN A;  5AZI A;  1RDA A;  3O4Q A;  1RT5 A;  3OY9 A;  2O8E B;  1ZC6 A;  3HOS A;  3KKS A;  1TK5 A;  4FJG A;  3WNE A;  4GY2 B;  1IV0 A;  4LF5 K;  1CXU A;  2IDO A;  1RT1 A;  2IVP A;  2FBX A;  3D2F B;  4QS7 A;  3THY B;  4B8A B;  2FSK A;  4JK9 A;  1JKH A;  2VWB A;  4CHN A;  5M1F A;  4IKF A;  2E88 A;  4BQL A;  2OPS A;  1L5U A;  3G4S N;  4EHU A;  1IBL K;  3K5O A;  1U04 A;  4YHH K;  5AQZ A;  3H3O B;  3K58 A;  4PUO A;  3ULD A;  4CF1 A;  2CGJ A;  1BHL A;  3MEG A;  4KHS A;  5GAD P;  1NBW A;  3I0S A;  1K6Y A;  4IXC A;  4JKA A;  4DSK A;  1C0G A;  1LOT B;  4DR7 K;  3T69 A;  3DLR A;  3GDQ A;  2AA4 A;  3PUF A;  2E1Z A;  2YKN A;  1S6Q A;  2ZWH A;  2HND A;  3PO4 A;  5E84 A;  4B3R K;  4K8Z A;  4A59 A;  1BOT O;  3KZB A;  4MLE A;  1WN7 A;  4KH4 A;  2BAN A;  3SK3 A;  3V81 A;  3HSC A;  4Y1D A;  3VQ5 A;  1KLM A;  1U49 A;  4BVP A;  3HT3 A;  1W0H A;  4JI6 K;  3VEZ A;  4JKF A;  4J2D A;  1BIS A;  3KLI A;  1WBB A;  4DG1 A;  1W97 L;  3EKU A;  3S9H A;  2QI2 A;  1KTQ A;  3SI6 A;  4BE0 A;  2KZM A;  2HMP A;  2X6S A;  1Z26 A;  5FRO A;  1HKG A;  5AQS A;  3CET A;  3CCJ N;  1VSJ A;  1S1V A;  3BZC A;  3ULE A;  4KKO A;  2YHW A;  2HVI A;  3I8D A;  3CC4 N;  1HQE A;  3ZT3 A;  3OYH A;  1ZBU A;  5LL6 Z;  2P9K B;  1NGG A;  5K14 A;  3OYN A;  1D4X A;  2P5G A;  4FCY A;  2E2Q A;  2D0B A;  4AHV A;  3VPZ A;  2UXB K;  3HL8 A;  4W5T A;  4OX9 K;  3MXJ A;  4DU1 A;  2IOC A;  2BE2 A;  4CHZ A;  3SUQ A;  4HUE A;  3PX0 A;  2GX9 A;  3K5L A;  5ADX A;  5EX5 A;  4CE9 A;  3AA2 A;  3KLE A;  4F3O A;  4FJJ A;  3A5M C;  4M7Y A;  2A5X A;  5BR9 A;  4H0Y B;  3L3U A;  3UKR A;  1IKX A;  1UWB A;  5B8H A;  2VWJ A;  1HNV A;  1UA0 A;  3KJV A;  5DMR A;  1C1C A;  1RDU A;  2P9U B;  3D2E A;  2G8W A;  3H08 A;  3VEV A;  2E1Y A;  4RTF D;  2GUI A;  4YNQ A;  3BDP A;  2HF4 A;  3MX5 A;  3IDH A;  2OPR A;  4ISG A;  4CJT A;  3OYJ A;  4LFB K;  4DR5 K;  4BR7 A;  2O8E A;  5M1N A;  4BR5 A;  4YOV A;  1S3X A;  1RTJ A;  1Q9Y A;  3E1Y A;  1HX1 A;  3E66 A;  4FJ5 A;  3SQ2 A;  2GWK A;  4O8U A;  3D2F A;  3M1F A;  5A2Q O;  2Z1G A;  1OVY A;  4O4G A;  3H46 O;  2UUA K;  4WFB L;  4A62 A;  1TAQ A;  1TV6 A;  4MQ3 A;  1LWC A;  3QLH A;  2FBT A;  1VQ6 N;  3QET A;  5CZ2 A;  2D1K A;  1MU2 A;  3VQQ A;  2WOM A;  4JKD A;  4KHQ A;  4FWM A;  2VCP A;  3MCP A;  4FJK A;  2I5J A;  2HF3 A;  2BH1 A;  3F9M A;  1WSJ A;  3VA0 A;  4DUZ K;  3ZSW A;  3HYF A;  2X6N A;  1NGF A;  3GG4 A;  1B9D A;  1XHX A;  1DEJ A;  4TSX A;  1ATR A;  4Y0W A;  4M3W A;  2AJQ A;  3MXI A;  2A1R A;  3JYT A;  3LM9 A;  2CH5 A;  3CJ1 A;  4CK2 A;  5J1E A;  2XHB A;  4DTJ A;  1J5O A;  4K43 A;  3O9S A;  2HHU A;  5E26 A;  2F8S A;  1BA1 A;  2OPP A;  1RGI A;  3NBP A;  4OPA A;  4JI2 K;  3S3M A;  2QW9 A;  3BZK A;  4GV3 A;  4QAG A;  2RE2 A;  2ZGY A;  3VF4 A;  5JS1 A;  4KO0 A;  1T03 A;  4CJ5 A;  2IS3 A;  3QFP A;  1SL0 A;  4G9Z A;  4CJ7 A;  1LW2 A;  1U2V B;  3MN5 A;  5GAH P;  1KXP A;  3DRR A;  2UUB K;  1QHT A;  3ATU A;  2HBK A;  4O5F A;  4DQP A;  3TAP A;  1HYV A;  4B1W B;  1HNW K;  3TWH A;  1NK5 A;  4M3X A;  3KK2 A;  1DKG D;  1BWF O;  4H4O A;  3LAM A;  3ZX3 A;  5JVG L;  3BP8 A;  4B9S A;  3L2R A;  3PIP L;  1QVG M;  5CYM A;  5JS2 A;  1KVA A;  5BRE A;  1Y64 A;  2P9K A;  4FM2 A;  1XNR K;  4X62 K;  4I6M B;  3KK1 A;  3V9S A;  5HOO A;  4V19 S;  1VSL A;  3IG1 A;  1YTA A;  3VGM A;  1SS6 A;  3VQ6 A;  1VQ5 N;  3P38 A;  3C6T A;  1RFQ A;  3T1A A;  2A42 A;  5T7B A;  2Y1I A;  4E19 A;  3K9K A;  4M45 A;  1E3M A;  3ZSO A;  4EP4 A;  1JLQ A;  1U45 A;  4FM1 A;  5HP1 A;  2NNW A;  3RMC A;  3MMV A;  3DLB A;  4FWQ A;  4DLG A;  2G8K A;  3B6P A;  3R3L A;  2P9U A;  4F8R A;  3QML A;  1VQM N;  3RRH A;  2DPN A;  4A5A A;  4BE2 A;  4OKE A;  4YOU A;  3JXU A;  3OYE A;  1S1U A;  4BR9 A;  1NJW A;  3SQ4 A;  2HHH K;  3VF6 A;  3SNN A;  1NKB A;  3P31 A;  4U67 L;  1VQK N;  4C8O A;  5CE3 A;  1G99 A;  4CJU A;  5HRO A;  3ZCM A;  1NG9 A;  1EP4 A;  2YNI A;  3DWL A;  4O5B A;  3DLK A;  2Q36 A;  4H5R A;  2HHS A;  3CJC A;  2BDP A;  4FJX A;  5JLF A;  3LPT A;  2O8D B;  3KHY A;  4FOI A;  1EET A;  4JS5 A;  1RT7 A;  3EE9 A;  3FLC O;  2OCE A;  2QA4 N;  4M3Y A;  3SQ1 A;  3G10 A;  5LJW A;  4F3T A;  1VQ4 N;  4WE1 A;  3TPQ A;  3U4L A;  5C42 A;  5DM6 L;  3TAF A;  3OYC A;  1QZ5 A;  3AVN A;  4K25 A;  4OO1 J;  1LW0 A;  4NYF A;  1N5Y A;  4CEA A;  3V1Q A;  1BQM A;  4CK1 A;  4MO5 A;  1K9M O;  4DUY K;  3D7E O;  4XH1 A;  1J9A A;  1TKT A;  3C7N B;  1Z05 A;  2LSN A;  3M8S A;  4CJR A;  3SPZ A;  3D45 A;  5C10 A;  3CJ9 A;  1GLF O;  4PA1 A;  3SPY A;  3FZL A;  3HTV A;  5BN9 A;  2A41 A;  4FJL A;  4JD2 B;  3AVC A;  3I8B A;  4BRC A;  5I3U A;  1ATS A;  5AQT A;  5AR0 A;  3BUZ B;  4RCH A;  1WSG A;  3LP3 A;  4BRD A;  2IVO A;  3DI6 A;  2DFH A;  4O8K A;  4FLZ A;  3SYZ A;  4FW2 A;  3M8Q A;  4FVU A;  4PWD A;  5F0X A;  3AA4 A;  4BRL A;  1RT2 A;  4BG8 A;  4Z0U A;  5AQI A;  3OS2 A;  5CY4 A;  1U2V A;  2B5J A;  3Q7C A;  5FPE A;  4KPY A;  4Q5V A;  1JLC A;  1NWK A;  1R0A A;  3I0R A;  1OKJ A;  3M8R A;  3AV9 A;  3G25 A;  4DR4 K;  2F9T A;  1U47 A;  3H1Q A;  1IJJ A;  1HNI A;  5AJ3 K;  3L2Q A;  1CZ9 A;  1HJR A;  2YHY A;  3HO1 A;  4BWJ A;  3LP0 A;  3NF9 A;  1S9E A;  1A5W A;  1TUU A;  4B1U B;  3OJU A;  3EZ5 A;  3A8Y A;  4WQ5 A;  2YCH A;  2KKZ A;  3QBX A;  4ELT A;  2D0A A;  4I6M A;  4FJN A;  2V7Y A;  2X74 A;  4IZ9 A;  3AA5 X;  2OTL N;  1JLG A;  4CZM A;  1GLB G;  2NRR A;  4B9T A;  3VQ9 A;  2ITG A;  2JWL A;  1YVN A;  4EIA A;  1RDC A;  2XRI A;  4CGG A;  2G8I A;  4KHY A;  4QS8 A;  3OTO K;  4ZTF A;  1VSM A;  1BO5 O;  1HMV A;  2GUP A;  4JKC A;  1VQP N;  2D0C A;  4CES A;  2FBY A;  3K57 A;  3IUC A;  2F9W A;  4OLA A;  3O4W A;  1NGI A;  5HRS A;  4NCB A;  1WB9 A;  5AFU H;  4NO7 A;  5FPD A;  4JKG B;  3G6E N;  2X78 A;  3PX6 A;  2Q1N A;  2RHK A;  5GIP A;  2YNG A;  4ID1 A;  3ZLJ A;  4FLW A;  1DLO A;  5J2M A;  3QDK A;  2V7Z A;  2Q97 A;  4CEB A;  3MXM A;  4Z4I A;  1NJZ A;  1SUQ A;  1NJI O;  1BCO A;  3DOK A;  4BC2 A;  3NE6 A;  3WT0 A;  2IIR A;  3MN7 A;  3IKM A;  1CLQ A;  3K59 A;  4BG9 A;  4BC5 A;  4LY7 A;  1XMO K;  4BRM A;  2QWQ A;  5KI6 A;  2IGI A;  1WAJ A;  5C15 A;  1SKS A;  4B3M K;  2YJE A;  2O8D A;  2DTU A;  5IT9 O;  3ZET B;  3KLH A;  3G0Z A;  2XY5 A;  3SUP A;  4FWS A;  2I7N A;  2WON A;  4QOZ B;  1XUP O;  3UE5 A;  1OH5 A;  4HUG A;  3SJJ A;  3WEE B;  3SZ2 A;  3DAW A;  4JKH A;  4I7F A;  1KCF A;  3CQX A;  3J7Z O;  3S3N A;  3LWM A;  4A2B A;  4DR2 K;  1SL2 A;  3AAP A;  4BRN A;  4JAX A;  4EHT A;  3MCA B;  3VQE A;  4CEC A;  3LDN A;  3EE8 A;  4NLB A;  5KRS A;  4IO9 L;  1KC8 O;  4B1X B;  4RWT A;  2QK9 A;  1J5E K;  3C7N A;  1WSH A;  4CJV A;  4IDK A;  4BDY A;  4J2E A;  3H1V X;  3AVI A;  1C1B A;  3L0Q A;  3L4I A;  3QIP A;  4XEI A;  3M8P A;  3AGK A;  4ICL A;  3P83 D;  4H0T B;  4BRP A;  3NGY A;  4CJS A;  4CZK A;  3SAG A;  2OA8 A;  1GLJ O;  3FE1 A;  3EKS A;  3MEC A;  4JD2 A;  3LAL A;  4FWP A;  4IG0 A;  3RVC A;  2XY6 A;  1YIT N;  4W5N A;  3RMA A;  4JN4 A;  3QEV A;  1VQ9 N;  4ISF A;  4H8K A;  4DTN A;  1UAX A;  3O5B A;  4BC3 A;  4AH9 A;  4PHT X;  4JYA K;  4FL9 A;  4A2A A;  5AQJ A;  4B1Z A;  4B9N A;  3CQY A;  1FXX A;  4CZG A;  1ZYQ A;  2P9I B;  4B9Q A;  2ASO A;  4M63 C;  1REV A;  2RKI A;  4Y1C A;  2EWS A;  4H03 B;  4NB4 A;  3BF1 A;  4Z94 A;  3I56 N;  3E9P A;  5AQG A;  1V4S A;  4FZZ A;  3V4I A;  3OYB A;  1QQO A;  4DU3 A;  4BRF A;  2F4V K;  3GOI A;  3FZK A;  4EZ9 A;  4LF7 K;  4J8F A;  1Z25 A;  5C12 A;  2IVN A;  1Q9X A;  1EX4 A;  3KWI A;  4L3Q A;  4WYB A;  3HP6 A;  3HVR A;  4BRO A;  3LPU A;  4CJQ A;  3ID8 A;  3CXC M;  3KTQ A;  2DFE A;  3F9K A;  1JCF A;  2RN2 A;  4E0D A;  1DT9 A;  3HM8 A;  4KH5 A;  1VSE A;  3VTH A;  5HRR A;  4R79 A;  4M3Z A;  4F2R A;  3L2W A;  2E2N A;  3O3G A;  2P9P B;  2YJF A;  4DTR A;  1S5J A;  4LH5 A;  4AHS A;  2FLO A;  1TUY A;  3WXL A;  1J6Z A;  4CK3 A;  5BN8 A;  4DSF A;  1JLE A;  1ZBS A;  4FK2 A;  4OPJ A;  3ID6 A;  4CGJ A;  4IWV A;  1YTU A;  1N32 K;  1I94 K;  5LY3 A;  2F7T A;  1SQK A;  3T1H K;  3SMP A;  1NGA A;  1BI4 B;  3VEW A;  4BR0 A;  5KPZ A;  3CI5 A;  4CZL A;  4FW1 A;  3VQ4 A;  3LZI A;  1KQS M;  1WNS A;  4DSI A;  4IJA A;  3JSM A;  3L2U A;  3CG7 A;  4JKG A;  3VGL A;  3UB5 A;  3K0S A;  4C1N I;  4E3S A;  1IG8 A;  4LF4 K;  4ELV A;  3ISN C;  3NF7 A;  4CGF A;  2ASM A;  4PQU A;  4L8R B;  3O80 A;  3VEN A;  4DV0 K;  4AHR A;  3NAE A;  3CYM A;  1YT3 A;  5AQV A;  3CQ8 A;  4OKK A;  4NXM K;  5C25 A;  1ZBI A;  4J2B A;  1EWR A;  3SMS A;  3FFK B;  2Q2R A;  4GV9 A;  1HUX A;  4CHP A;  2E2O A;  4CFA A;  2KLA A;  3SBT A;  3ENB A;  5EOY A;  1A5V A;  1RBR A;  3DOL A;  2YX6 A;  3ZET A;  3BGR A;  2YNH A;  4I9L A;  1JJ2 M;  1J53 A;  3PSI A;  5LMN K;  2UXD K;  3AY9 A;  4YDU C;  3NDK A;  1TGO A;  1S1T A;  3V1O A;  3J80 O;  3WEE A;  1TL1 A;  3OS0 A;  2FC0 A;  3LDL A;  4C8K A;  3OS1 A;  2NRH A;  3DMJ A;  4AM6 A;  4ZHR A;  1ASU A;  3O6W A;  1T7P A;  3Q7B A;  4FWR A;  3O9R A;  4KFB A;  3DXK B;  3UIQ A;  1VRT A;  1SKW A;  2FF3 B;  4JNE A;  5BPN A;  3ZT4 A;  4RW8 A;  1CZB A;  4JK7 A;  4FZY A;  4MDB A;  4BRH A;  5KRT A;  1U48 A;  4KBO A;  3OBY A;  4PKG A;  3BY5 A;  2HHT A;  3HM9 A;  1Q8I A;  3ZSY A;  1MDU B;  4CHO A;  3CM5 A;  4BRA A;  1SV5 A;  1ILY A;  1RT3 A;  2VG6 A;  1ZBF A;  3TAR A;  1WBD A;  5AQN A;  1YF5 L;  1GLL O;  2CGK A;  1OVQ A;  3N4P A;  3EEQ A;  4KAZ A;  3OYK A;  1GOB A;  3CC7 N;  2JLE A;  3AVA A;  2VWK A;  4CF9 A;  3LDP A;  2GWJ A;  2JWK A;  2FXU A;  4LF6 K;  3QNN A;  3NVK A;  5BRD A;  1W2B M;  1RBT A;  3L3V A;  5AQO A;  4GNI A;  2P9I A;  1EXQ A;  5AQX A;  4YOW A;  4HWI A;  3G71 N;  3RWU A;  2WFB A;  2QWM A;  2G8V A;  3R6M A;  4N5S A;  4W5R A;  3T3F A;  3HI0 A;  4DV5 K;  2ZJP L;  5ADX H;  5H1S Q;  4DSL A;  3CIP A;  3DLE A;  4C8M A;  3KK3 A;  1ESV A;  3NGZ A;  4FLV A;  2YI1 A;  1T44 A;  2XY8 A;  3KK7 A;  1BIZ A;  3K5N A;  1QQN A;  4M3T A;  5AQQ A;  4FWK A;  3U3Y A;  2F96 A;  2HMI A;  3WUH A;  1M90 O;  1FJG K;  4CEO A;  2P9P A;  3OHR A;  1HRH A;  4Q0B A;  1HYS A;  4LFA K;  4BQZ A;  4BRI A;  4AIL C;  3MED A;  4CIG A;  4DKW A;  3RR8 A;  3MDQ A; 
#chains in the Genus database with same CATH homology
 3VQA A;  4OGC A;  3V6D A;  1KLN A;  5I3U A;  1S9G A;  2E6M A;  1L3S A;  4DS5 A;  1XWL A;  3OYM A;  4OVL A;  4O55 A;  3F73 A;  3SCX A;  1BI4 A;  1BL3 A;  2A1S A;  1XI1 A;  3U6F A;  1WSG A;  5I42 A;  3LP3 A;  1C0U A;  4AHU A;  1KRP A;  3PV8 A;  1BIU A;  3ZSV A;  2RF2 A;  2DFH A;  3DI6 A;  4FLZ A;  3SYZ A;  4FW2 A;  3M8Q A;  3OY9 A;  1RDA A;  3O4Q A;  1RT5 A;  4BDZ A;  1NK8 A;  1HYZ A;  4PWD A;  4DF8 A;  1TAU A;  3KKS A;  1TK5 A;  1QSL A;  1WLJ A;  3VQ7 A;  4FJG A;  3WNE A;  3NF8 A;  3NFA A;  3P1G A;  4E89 A;  3AA4 A;  3NCI A;  4FJM A;  1CXU A;  1RT2 A;  2IDO A;  4DFM A;  2R7Y A;  1NJY A;  1KFS A;  4RW6 A;  3C94 A;  4Z0U A;  4LH4 A;  4AHT A;  3OS2 A;  1RT1 A;  4W5O A;  2FBX A;  3RR7 A;  4O0J A;  1GOC A;  2HHX A;  5CY4 A;  4B8A B;  3VQ8 A;  3ZT1 A;  1J54 A;  1JKH A;  2B5J A;  3HP9 A;  3V1R A;  4CHN A;  3LZJ A;  4DQQ A;  5D3G A;  3TAM A;  2Z1H A;  4IKF A;  4KPY A;  4Q5V A;  1JLC A;  1JLB A;  4DWI A;  2OPS A;  1R0A A;  3I0R A;  1L5U A;  3NGI A;  3M8R A;  3AV9 A;  1JLA A;  3K5O A;  1U04 A;  2HB5 A;  3RRG A;  1U47 A;  5CZ1 A;  1HNI A;  3L2Q A;  1CZ9 A;  1HJR A;  4DTX A;  3KD5 E;  3TI0 A;  1KVB A;  1RIL A;  3L2V A;  4BWJ A;  3K58 A;  3ULD A;  1XC9 A;  4PUO A;  3LP0 A;  4FK4 A;  4CF1 A;  3NF9 A;  1S9E A;  4FYD A;  4LSN A;  1A5W A;  1ZBL A;  1TK0 A;  3OJU A;  3EZ5 A;  1BHL A;  4RW4 A;  2HNY A;  4IBN A;  4K8X A;  3MEG A;  4KHS A;  3PY8 A;  4ELT A;  3ZSR A;  2D0A A;  2QXF A;  4HCB A;  4LSL A;  4FJN A;  4KHW A;  1RNH A;  2X74 A;  3ALY A;  3AA5 X;  3I0S A;  3OYF A;  1JLG A;  1K6Y A;  3QEX A;  4CED A;  4R5P A;  4DSK A;  4CF8 A;  1NKC A;  1VRU A;  4B9T A;  3E01 A;  4CJE A;  3DLR A;  4GW6 A;  4KTW A;  3PUF A;  1D8Y A;  4CCH A;  3VQ9 A;  4OLB A;  2YKN A;  4ID5 A;  1LWE A;  1S6Q A;  2KW4 A;  2ITG A;  2HND A;  3PO4 A;  4DFP A;  3KLG A;  3HVT A;  1RDC A;  2XRI A;  1G15 A;  3DRS A;  4CGG A;  4K8Z A;  2Z1I A;  4CGI A;  2G8I A;  3SUN A;  4KHY A;  4KTZ A;  1WN7 A;  3VN5 A;  4ZTF A;  1VSM A;  2BAN A;  1HMV A;  3AO4 A;  2FBV A;  3V81 A;  4Y1D A;  3VQ5 A;  1KLM A;  4CJW A;  2D0C A;  4Z4G A;  4O44 A;  1SL1 A;  4E7H A;  3AVF A;  1U49 A;  4DQI A;  4CES A;  2FBY A;  3K57 A;  3HT3 A;  1W0H A;  4OLA A;  1N6Q A;  5HRS A;  4J2D A;  4NCB A;  1BIS A;  3KLI A;  5E41 A;  3DRP A;  3ZT2 A;  3HPG A;  2P51 A;  4DG1 A;  4NYN A;  2PZS A;  3LDS A;  4CJP A;  1RTI A;  2X78 A;  3PX6 A;  3VA3 A;  4HHT A;  3S9H A;  3SI6 A;  1KTQ A;  2YNG A;  4ID1 A;  4BE0 A;  4KRF A;  2KZM A;  1UOC A;  4FLW A;  1DLO A;  5J2M A;  1IG9 A;  4NCG A;  3TAE A;  4CEB A;  1QSY A;  4KB0 A;  3WNH A;  3OYA A;  3MXM A;  3AVH A;  1VK0 A;  4M3X A;  2X6S A;  1Z26 A;  5FDL A;  5FRO A;  4Z4I A;  1HPZ A;  1NJZ A;  1NOZ A;  1SUQ A;  4CEF A;  1NKE A;  2O4I A;  3TAB A;  3EYZ A;  1BCO A;  4RG8 A;  3SV3 A;  1KFD A;  3DOK A;  4QCL A;  2KZZ A;  1KSP A;  2B6A A;  1NK0 A;  2HVI A;  2YHB A;  3NE6 A;  4JS4 A;  2HHV A;  2JGU A;  4DLE A;  1DTT A;  1VSJ A;  1CLQ A;  3K59 A;  1TKZ A;  4DSE A;  1S1V A;  1GOA A;  5HLF A;  4J2A A;  1D5A A;  1X9W A;  4LY7 A;  3KD1 E;  2ZQB A;  4KKO A;  3HXM A;  4NCA A;  5KI6 A;  5EU7 A;  3I8D A;  2IGI A;  1WAJ A;  4FM0 A;  4FLU A;  1HQE A;  3ZT3 A;  3OYH A;  4E1M A;  1SKS A;  1KVC A;  1ZBU A;  3KIO A;  2DTU A;  2EHG A;  4E7L A;  4C8L A;  1RBU A;  4KHN A;  5K14 A;  3OYN A;  2P5G A;  1RBS A;  3TR8 A;  4FCY A;  3KLH A;  3G0Z A;  3VQC A;  2XY5 A;  2D0B A;  3P5J A;  3SUP A;  4AHV A;  2WON A;  5FRN A;  4QOZ B;  4FLX A;  3HL8 A;  2D5R A;  4W5T A;  3MXJ A;  4HUG A;  4DU1 A;  3SJJ A;  2IOC A;  3HK2 A;  3SZ2 A;  2BE2 A;  4CHZ A;  4B3O A;  2PYJ A;  3V9U A;  3SUQ A;  4FJH A;  4HUE A;  3PX0 A;  1B9F A;  1KCF A;  3ASM A;  3IRX A;  4I7F A;  3CFO A;  3K5L A;  4DTO A;  4HVJ A;  4DTM A;  3S3N A;  2QKB A;  3LWM A;  3LP2 A;  1U4B A;  4IFV A;  4EP5 A;  3V9W A;  1SL2 A;  4Z4E A;  4F2S A;  1XHZ A;  4CE9 A;  3AA2 A;  3NF6 A;  3KLE A;  2KTQ A;  4DFK A;  3AVK A;  3V9Z A;  3VQE A;  4CEC A;  4BWM A;  1O1W A;  3FFI A;  3ZT0 A;  4F3O A;  4FJ8 A;  2O4G A;  4FJJ A;  2ETJ A;  3ITH A;  5KRS A;  3L3U A;  2QK9 A;  1IKX A;  1JL1 A;  1WSH A;  4CJV A;  2Q3S A;  4IDK A;  4M41 A;  4BDY A;  4J2E A;  4FJ7 A;  3AVI A;  1UWB A;  5HRN A;  4O0I A;  3KLF A;  1WAF A;  3MAQ A;  1C1B A;  1HNV A;  3QIP A;  2E4L A;  3KJV A;  1FKP A;  2VWJ A;  4HUF A;  1UA0 A;  5DMR A;  1C1C A;  4CGH A;  4H4M A;  3M8P A;  4ZTJ A;  3AVB A;  1C0M A;  4JRQ A;  2EX3 A;  4ICL A;  3P83 D;  4KV8 A;  5C24 A;  3NGY A;  1QS4 A;  4CJS A;  3OJS A;  1IH7 A;  3H08 A;  2G8W A;  3MEC A;  4CEE A;  3HPH A;  4B9V A;  3PO5 A;  3LAL A;  4DFJ A;  4B9U A;  1JXE A;  1YVU A;  2GUI A;  4IG0 A;  4YNQ A;  4I2P A;  3BDP A;  1IO2 A;  1ZBH A;  3NH1 A;  2XY6 A;  4FLT A;  4W5N A;  3RMA A;  3QEV A;  2OPR A;  4H8K A;  4DTN A;  4DSJ A;  2Y1J A;  1UAX A;  3RMB A;  4CJT A;  3LWL A;  3OYJ A;  1TVR A;  4AH9 A;  4PY5 A;  2YNF A;  3RTV A;  2HHW A;  5KTQ A;  4LD0 A;  2G8H A;  4B9N A;  4XIU A;  1FXX A;  5KGX A;  5FRM A;  1RTJ A;  1ZYQ A;  4GVM A;  2P1J A;  1Q9Y A;  4RW7 A;  4FJ5 A;  1REV A;  4KRE A;  3SQ2 A;  3ZSX A;  4CHQ A;  2RKI A;  4Y1C A;  3HO1 A;  1IKY A;  1X9S A;  1WSF A;  1B92 A;  3TAN A;  3V4I A;  1DTQ A;  4FZZ A;  3OYB A;  2Z1G A;  4DU3 A;  2HW3 A;  4CEZ A;  1X1P A;  2KFZ A;  4O4G A;  3AO5 A;  2OYQ A;  3NH2 A;  3K5M A;  1TKX A;  3DLG A;  4EZ9 A;  1Z25 A;  2QKK A;  1Q9X A;  1EX4 A;  3AVG A;  3RMD A;  2OZM A;  4W5Q A;  4BAC A;  4E7I A;  1L3V A;  1TAQ A;  4DMN A;  3HP6 A;  1X9M A;  1TV6 A;  4MQ3 A;  3HVR A;  1RTH A;  1LWC A;  3LPU A;  4CJQ A;  1LAW A;  2PYL A;  1JLF A;  3KTQ A;  3CFR A;  2DFE A;  3QLH A;  3F9K A;  2FBT A;  2RN2 A;  3A2F A;  1TL3 A;  4E0D A;  3QET A;  5SWM A;  5CZ2 A;  4CJ3 A;  4B9M A;  1MU2 A;  3VQQ A;  3AO3 A;  1VSE A;  5J2P A;  2WOM A;  1SKR A;  4KHQ A;  4FXD A;  3QO9 A;  4DTP A;  5HRR A;  4M3Z A;  4FJK A;  2I5J A;  4F2R A;  3DM2 A;  1WSJ A;  4OJR A;  3MEE A;  3O3G A;  3L2W A;  3VA0 A;  3SUO A;  3QEP A;  1BCM A;  3HYF A;  3ZSW A;  2PY5 A;  2X6N A;  3VQD A;  4CFB A;  4DTR A;  1S5J A;  4LH5 A;  1B9D A;  4AHS A;  1XHX A;  4CJ4 A;  4CK3 A;  3QEI A;  1NOY A;  4TSX A;  4DSF A;  2BGG A;  2OPQ A;  4N41 A;  1JLE A;  4M3W A;  1HQU A;  4FK2 A;  4OPJ A;  1S1W A;  3L8B A;  4CGJ A;  1LWF A;  1YTU A;  2AJQ A;  3MXI A;  1ITG A;  2VG5 A;  2A1R A;  4B08 A;  3VQB A;  3JYT A;  1D9F A;  1T05 A;  4CEQ A;  2OA8 A;  1BI4 B;  1L3T A;  5J1E A;  4CK2 A;  2XHB A;  4DTJ A;  1J5O A;  4FW1 A;  4E7J A;  2HHU A;  3VQ4 A;  2F8S A;  1D9D A;  3LZI A;  2KQ2 A;  1WNS A;  3K2P A;  4DSI A;  2OPP A;  3KKR A;  3JSM A;  2GV9 A;  3L2U A;  4IG3 A;  1S1X A;  3NBP A;  3CG7 A;  2XO7 A;  1EKE A;  3S3M A;  1L3U A;  3U3G A;  4QAG A;  4CIF A;  3QEW A;  3QIO A;  1IKV A;  5HBM A;  4E3S A;  5J2N A;  5JS1 A;  1JXB A;  1LAV A;  4KO0 A;  1T03 A;  4CJ5 A;  2KFN A;  3T19 A;  2IS3 A;  1SL0 A;  2B4J A;  4ELV A;  1FKO A;  1LW2 A;  3ISN C;  3NF7 A;  4CGF A;  1C1A A;  4PQU A;  3S3O A;  3DRR A;  1QHT A;  4L8R B;  4BE1 A;  3V9X A;  4AHR A;  1TK8 A;  2W42 A;  3NAE A;  3CYM A;  4Z4F A;  1YT3 A;  3CQ8 A;  4DQP A;  3TAP A;  1HYV A;  3TAQ A;  1WSI A;  4OKK A;  1RT6 A;  2RPI A;  1WSE A;  3TWH A;  1NK5 A;  5C25 A;  3KK2 A;  1LV5 A;  4H4O A;  3LAM A;  1QSS A;  4B9S A;  4J2B A;  3SQ0 A;  3L2R A;  1ZBI A;  4CJF A;  1I3A A;  5CYM A;  3PX4 A;  5JS2 A;  4CHP A;  1A5X A;  4CFA A;  3EY1 A;  1KVA A;  3CM6 A;  1Y97 A;  1C0T A;  4HTU A;  1A5V A;  1RBR A;  3OYD A;  3DOL A;  1I39 A;  3LP1 A;  4FM2 A;  1VSD A;  3AVL A;  2YNH A;  3BGR A;  4I9L A;  4CIE A;  3KK1 A;  4DU4 A;  4B9L A;  5KGW A;  1J53 A;  3ZSQ A;  3V9S A;  3QER A;  2Z1J A;  4CJL A;  3NDK A;  4FZX C;  4Z4H A;  1TGO A;  1S1T A;  2HNZ A;  1VSL A;  3IG1 A;  3V1O A;  3CFP A;  1RDD A;  3TAG A;  1TL1 A;  2F8T A;  3OS0 A;  1YTA A;  2FC0 A;  3OVN A;  4C8K A;  3VQ6 A;  3DMJ A;  4ZHR A;  3OS1 A;  4B8C A;  1ASU A;  2ZD1 A;  1NK6 A;  4KB1 A;  4DTS A;  1T7P A;  4DQR A;  4KHU A;  4YFU A;  4KFB A;  3C6T A;  3UIQ A;  3T1A A;  2DFF A;  5T7B A;  4E1N A;  1VRT A;  4FVM A;  2Y1I A;  4E19 A;  1ASW A;  1SKW A;  3QIN A;  4M45 A;  2ZE2 A;  3THV A;  4BDP A;  3D0P A;  3ZSO A;  4HCC A;  4C8N A;  4N56 A;  3ZT4 A;  4CER A;  4RW8 A;  4EP4 A;  1JLQ A;  1U45 A;  1CZB A;  4DTU A;  1F21 A;  4FM1 A;  4FJI A;  4I9Q A;  5HP1 A;  1NK7 A;  3RMC A;  4IFY A;  4FZY A;  3DLB A;  1RCH A;  3WNG A;  2DY4 A;  5KRT A;  3AVM A;  1U48 A;  1T8E A;  1RBV A;  4DLG A;  2G8K A;  1RDB A;  3B6P A;  1NJX A;  4F8R A;  3LAK A;  3RRH A;  1IKW A;  1VSF A;  2G8U A;  3HM9 A;  1CXQ A;  1NK9 A;  4F4K A;  2HHT A;  1Q8I A;  3ZSY A;  1C6V A;  4E7K A;  4OPK A;  3QNO A;  1VSK A;  4CHO A;  1ASV A;  1QQC A;  3CM5 A;  4KI6 A;  3HPO A;  1SV5 A;  4BE2 A;  4FJ9 A;  4OKE A;  1RT3 A;  2VG6 A;  1ZBF A;  1S6P A;  3C95 A;  3NH0 A;  4RW9 A;  3TAR A;  3OYE A;  2IAJ A;  1S1U A;  4JRP A;  1NJW A;  4KAZ A;  2ATQ A;  3OYK A;  1GOB A;  2E6L A;  3SQ4 A;  1QTM A;  4OKJ A;  2JLE A;  3AVA A;  2VWK A;  4CF9 A;  3SNN A;  3IS9 A;  4M3R A;  1NKB A;  4MFB A;  3QNN A;  4C8O A;  4CJU A;  4N47 A;  3ZCM A;  5HRO A;  1EP4 A;  2YNI A;  4CFD A;  4CF2 A;  3OYG A;  4FLY A;  4O5B A;  3DLK A;  1RBT A;  1RTD A;  2G8F A;  3L3V A;  2HHS A;  1NK4 A;  4M42 A;  4M3U A;  2HHQ A;  5SZT A;  2BDP A;  1EXQ A;  4FJX A;  4DQS A;  3LPT A;  1EET A;  4JS5 A;  1RT7 A;  4CFC A;  4I2Q A;  3RWU A;  3HST B;  3DYA A;  2G8V A;  3O4N A;  4CF0 A;  4CJK A;  4N5S A;  4W5R A;  3SQ1 A;  3T3F A;  3G10 A;  3DLH A;  4M3Y A;  4F3T A;  3IAY A;  2YKM A;  4WE1 A;  3HJF A;  4DF4 A;  1BQN A;  4FK0 A;  4Z4C A;  3ZSZ A;  5C42 A;  3QES A;  3TAF A;  3OYC A;  4DSL A;  3DLE A;  3WNF A;  1FK9 A;  4G1Q A;  4C8M A;  3KK3 A;  4KI4 A;  3AVN A;  3AVJ A;  5DK5 A;  3NGZ A;  1LW0 A;  4NYF A;  4CGD A;  5HRP A;  2IC3 A;  4KTQ A;  1N5Y A;  4FLV A;  4CEA A;  2GBZ A;  3V1Q A;  1BQM A;  5J2Q A;  1TKD A;  3SV4 A;  4EZ6 A;  3C6U A;  1UA1 A;  4CK1 A;  2P5O A;  4CHY A;  1VSI A;  1BGX T;  4OGE A;  3NHG A;  2XY8 A;  4AHC A;  1BIZ A;  3K5N A;  3B6O A;  4M3T A;  4ELU A;  1J9A A;  1TKT A;  3U3Y A;  2F96 A;  2HMI A;  2OZS A;  3OYI A;  1VSH A;  2NUB A;  1W9H A;  3O3H A;  4DS4 A;  1JL2 A;  4CEO A;  4UQG A;  2LSN A;  3AA3 A;  3AO2 A;  1HRH A;  5CYQ A;  4GMJ B;  3M8S A;  4CJR A;  3SPZ A;  4Q0B A;  1HYS A;  3D45 A;  2YHA A;  3LAN A;  3O3F A;  3VQP A;  4PA1 A;  4AIL C;  3AO1 A;  3SPY A;  4N76 A;  3OYL A;  2VG7 A;  3MED A;  4CIG A;  2YV0 X;  1RT4 A;  3RR8 A;  4JLH A;  2HVH A;  4FJL A;  2XY7 A;  1QE1 A;  3AVC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...