3ZSXA

Small molecule inhibitors of the ledgf site of hiv type 1 integrase identified by fragment screening and structure based drug design
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Small Molecule Inhibitors of the Ledgf Site of Human Immunodeficiency Virus Integrase Identified by Fragment Screening and Structure Based Design.
pubmed doi rcsb
source organism Human immunodeficiency virus
molecule tags Transferase
molecule keywords INTEGRASE
total genus 56
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.-:
pdb deposition date 2011-07-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3zsxA00
3TWHA 3HK2A 2DY4A 2LSNA 1BI4B 3IS9A 4DSLA 3VQPA 1T7PA 1X1PA 3SNNA 3L2UA 3ZSOA 1HYZA 3V9ZA 4F3TA 1FXXA 1JKHA 2OA8A 4M41A 2PYLA 4AH9A 1S1WA 4FJIA 4AHVA 3QESA 3QEVA 1RNHA 3LP3A 4DLGA 3LP0A 4E1NA 3HXMA 3V81A 1HQUA 1G15A 1VRUA 3EY1A 1TL1A 3CM6A 4HUGA 4DS4A 4Z4EA 2OPQA 2RF2A 3QLHA 3KK1A 4Z4GA 1KVCA 4M3ZA 3VQ7A 1NJWA 1D9FA 1NOYA 1C0TA 4LY7A 2QK9A 1K6YA 4RW6A 1YVUA 4KHQA 3AVLA 4N41A 1RBRA 1Z25A 3B6OA 4CHPA 3VQ8A 4CJPA 3D45A 1TK0A 3VQAA 3KD5E 4J2EA 1EXQA 4CHNA 3I0RA 2Z1JA 1TGOA 4Z4FA 4MQ3A 1VSIA 4M45A 4CESA 1IKVA 3S3MA 1U45A 4KHSA 4CJEA 3EZ5A 4FLZA 3MEEA 3SQ0A 3M8PA 1WSIA 3VQCA 1I39A 4EP4A 4CJRA 4HUFA 4M42A 1F21A 2YNFA 1ASWA 4L8RB 2D0AA 3L2RA 3V6DA 3S3OA 3WNHA 4CJWA 1UWBA 4FLXA 2FBXA 2Q3SA 3BGRA 4DTNA 1IKXA 4E19A 1HYSA 3G0ZA 3ZT2A 1L3TA 3OYFA 1X9MA 4CGIA 3K59A 4PWDA 3S9HA 4CJUA 3JYTA 3V4IA 3HVRA 4J2DA 4FJ5A 4BDZA 2A1SA 3VQ4A 3KJVA 4Z4CA 1Q9XA 3BDPA 1VK0A 4OKKA 4CHQA 1QSLA 1WSGA 2YNHA 4CGDA 3NH1A 1TK8A 2X78A 3CQ8A 1RT2A 1QTMA 2RPIA 3KLIA 1FKPA 3MXJA 3HT3A 5KGXA 2YNIA 1RTDA 4CERA 1LAWA 1BIUA 2X74A 3DYAA 1RT3A 1XC9A 3SI6A 1JLBA 3ZCMA 3SUNA 4M3RA 3AVAA 3I0SA 3NF8A 4DTSA 3PV8A 4FJJA 4JS4A 1UAXA 2HB5A 2OPRA 4DS5A 3P1GA 3KD1E 4NYNA 3K2PA 3NBPA 2Y1JA 1RDBA 3SUOA 4FZXC 3ZSYA 4CK2A 3NDKA 2P5OA 1GOAA 2BGGA 4DQQA 1W9HA 1CXQA 1WNSA 1HPZA 5FDLA 3ZSZA 4CFCA 4OPKA 4CFBA 3OYEA 4FW2A 4DTXA 3PO5A 2KZZA 2D5RA 4O55A 4OLAA 3G10A 3RMAA 4DSKA 3QIPA 5KRSA 3RWUA 2EX3A 2HVIA 3MEGA 3LZJA 4LSNA 4W5QA 3OYCA 1LWCA 2G8HA 4EZ9A 4FM2A 2XY6A 1LWFA 2IS3A 1VSKA 4KI4A 3AA2A 1TL3A 4CJFA 4BACA 4FLTA 4DWIA 3IAYA 4CGJA 1J53A 1C0MA 4DF8A 4ID5A 4IKFA 3DOLA 3QINA 1BISA 2IOCA 1X9WA 3L2VA 1RTHA 3NHGA 3C94A 4IG3A 2IAJA 3SZ2A 3AVJA 2HNDA 1ZBHA 2XRIA 1IKYA 1VSJA 3T19A 1D5AA 3LPTA 2YKNA 3AO3A 4DTPA 4KB0A 3OS0A 5J2PA 2BANA 1HNVA 3VQ6A 1NK7A 4MFBA 1TKXA 5HRPA 5J1EA 1NKBA 4B08A 2XY5A 1ZBFA 3V9WA 3AVKA 4Z0UA 4O4GA 4HUEA 2ZD1A 3T3FA 1S1UA 4CEFA 4PQUA 3K5OA 3KLHA 1JL2A 3OY9A 4FW1A 1KCFA 1U47A 2GUIA 1RT7A 3L3VA 3AV9A 3SQ2A 3HVTA 4LD0A 4AHCA 3ZT1A 2DFHA 3AVIA 3HP6A 4CF2A 4HCBA 4RW7A 1S6QA 3SPZA 5K14A 3VN5A 1TKDA 2IDOA 4C8KA 1L3UA 5KI6A 4DSJA 1UA0A 3KTQA 4KAZA 3AVNA 4IDKA 4CK1A 4FJ7A 1KLNA 3SV4A 1EETA 1IO2A 1RTIA 3V9XA 2HHSA 1TAUA 2O4GA 3TAGA 4N47A 3QNNA 3SCXA 3KKSA 3QIOA 3DLRA 2YNGA 3OYLA 3KKRA 3HL8A 2X6SA 1U04A 1WSJA 2VWKA 4I9QA 3DLEA 3OYDA 4M3WA 3ZT4A 1RDAA 4K8XA 3OYGA 3VA3A 1XI1A 1JLGA 2KTQA 1B92A 2B6AA 1EP4A 5C42A 2OZMA 1BGXT 3LP1A 1QQCA 1Q8IA 3NF7A 3QEIA 5C24A 4FJHA 4E7JA 4N56A 4BWMA 5KRTA 4B9MA 1A5WA 4I2PA 1VRTA 4O5BA 3NAEA 4C8LA 3HPOA 5HRSA 3QEPA 4BDPA 1C1AA 4AILC 4CFAA 1RBVA 3OYNA 4B9UA 1WSEA 3HYFA 3P5JA 5HLFA 4CJQA 4EP5A 2HHQA 3A2FA 5J2NA 1L5UA 4NCAA 4HVJA 4GMJB 4B8CA 1QSYA 1JL1A 4CCHA 4IFYA 4FLUA 1U49A 3DLBA 4FLVA 3OYJA 4F2SA 3DLKA 2Z1GA 1KTQA 4B8AB 2FBTA 1IKWA 1VSEA 2GBZA 5SZTA 3CFPA 3OS2A 4E7IA 3P83D 1QE1A 1S9EA 4N76A 4KFBA 3AO5A 1WSHA 4Y1DA 4DSIA 2E6MA 4DQIA 2HMIA 4O44A 4E89A 1BL3A 1RT4A 4NCBA 2P5GA 5FRMA 4CF0A 3TAPA 4F2RA 3TI0A 2HVHA 3U3GA 5J2MA 1TV6A 4C8NA 3AVCA 4FK4A 1KVBA 3DMJA 3DLHA 3QERA 1BCOA 5KGWA 3ZSXA 4Z4IA 4DSFA 1HRHA 3TAMA 3KK2A 1JXBA 1WSFA 3V9SA 3OYMA 3NH0A 2YKMA 1KFSA 1ZBUA 4CJKA 1IG9A 4JLHA 2OPPA 4FLWA 4FJKA 4KHYA 4DQSA 4FK0A 4OJRA 1BQNA 1RBTA 3MXIA 4HTUA 4B3OA 3LDSA 4BE0A 1TKTA 4CEDA 3PY8A 5FRNA 3WNFA 1A5XA 3AVMA 3TR8A 3WNGA 4FXDA 4KTZA 1T8EA 1SKRA 2F8SA 4H8KA 4DFKA 4OVLA 4QOZB 4W5NA 3M8RA 3PUFA 3UIQA 1J9AA 2BDPA 1JLEA 3DRPA 4ZHRA 3SPYA 3SJJA 1LW0A 3K58A 3RR7A 4CGGA 3OYHA 4ZTFA 4G1QA 1NJXA 3ZSRA 2HNYA 4B9VA 4CE9A 3NGIA 5D3GA 4UQGA 3DRSA 4CF9A 1NJZA 5I3UA 3ZSQA 3ZSVA 4BE2A 1NKEA 2KFZA 2WONA 5E41A 4PA1A 1SV5A 4JRPA 4ELTA 1QSSA 2HHTA 2IGIA 2AJQA 3AO2A 1SL1A 2QXFA 3LANA 3OVNA 4RW9A 4RW8A 5JS2A 4FJGA 3DOKA 2HHUA 4XIUA 3SQ4A 2XHBA 1Q9YA 3QEXA 2VG7A 1S5JA 3L8BA 4CK3A 3L2WA 1J5OA 4CJSA 1SKSA 1CLQA 2VG6A 1O1WA 3LAKA 3NCIA 4DTJA 4KTWA 1WN7A 3PX4A 4E0DA 5CY4A 1D8YA 1XHZA 1NK6A 3V1RA 2OYQA 3HM9A 1SKWA 4OGEA 1UA1A 1YT3A 4DMNA 3SV3A 4FJ9A 1CZBA 3T1AA 1NK9A 3TARA 2OZSA 1RTJA 1VSMA 2QKBA 2ITGA 4FVMA 5I42A 1WAFA 1RT1A 4RG8A 1DLOA 2NUBA 5CYMA 3THVA 4J2AA 3HO1A 3L2QA 3KK3A 3I8DA 1LAVA 2E4LA 3OYKA 1QS4A 4CEEA 1ZBLA 3KLFA 4DQRA 1Y97A 4GVMA 4YFUA 5HBMA 1LV5A 1N5YA 1RT5A 2KW4A 3D0PA 1C1BA 1DTQA 3OYAA 3KLEA 1QHTA 4BWJA 4O0IA 1N6QA 4FJLA 3AO1A 4I9LA 3VQ9A 4HCCA 3LALA 1S9GA 3S3NA 3IG1A 4FK2A 5HROA 4OPJA 3AA4A 2R7YA 2QKKA 2HW3A 3WNEA 1LWEA 3MAQA 4B9NA 4CF1A 4CIFA 4CEAA 4FJMA 1KLMA 3OJUA 3PX0A 4PY5A 2ATQA 2YHBA 3ZT3A 3QEWA 3OS1A 2FC0A 4DLEA 2A1RA 2PY5A 3CFRA 4KHWA 1REVA 1Z26A 4GW6A 3SYZA 3HPHA 5EU7A 3AA5X 3DM2A 3NH2A 3ALYA 3QETA 5J2QA 3ZT0A 3ULDA 4NYFA 3U3YA 2RKIA 1XHXA 4AHRA 4Q5VA 1NK4A 2XY7A 1BCMA 2DFFA 4OKJA 4AHUA 4R5PA 1SL2A 3MXMA 2P1JA 4DQPA 4KTQA 1C6VA 2PZSA 1FKOA 3AVFA 1HYVA 4CHYA 4CF8A 1ZYQA 4DFJA 1WLJA 2HNZA 4CEOA 1L3VA 3AO4A 5CZ2A 1YTAA 3CM5A 3LP2A 1JLQA 1W0HA 3O3FA 1R0AA 4M3XA 4E1MA 4CHOA 2HHVA 3O4NA 1S6PA 4H4MA 2JLEA 1TK5A 5DK5A 1RT6A 3FFIA 4ELVA 4W5RA 4PUOA 4FZZA 1TKZA 4FJ8A 1RCHA 5HP1A 3QO9A 4W5OA 1JLCA 1KRPA 1VSFA 3AVHA 2ZQBA 3O3HA 5HRRA 1D9DA 3HPGA 3RRHA 4QCLA 1FK9A 4DTOA 1A5VA 2EHGA 2D0BA 4CIGA 3TAQA 1HJRA 4ICLA 4B9LA 4CJVA 2YV0X 3VQQA 4FJXA 1TVRA 1ITGA 2VG5A 1X9SA 1NK5A 4IFVA 3DLGA 4OGCA 4F3OA 2RN2A 2ETJA 3C6UA 2X6NA 2WOMA 4FM0A 2JGUA 2BE2A 4CFDA 3LWLA 3K5NA 1U4BA 4CEBA 1BHLA 1KVAA 3AA3A 3LPUA 4ZTJA 4CJTA 4ELUA 3H08A 3OJSA 1RDCA 3OYIA 1SUQA 4DTMA 2ZE2A 4BE1A 4I2QA 2D0CA 3RTVA 2YHAA 4F8RA 1ASVA 3QNOA 2O4IA 2F8TA 4B9SA 4NCGA 1VSHA 4Y1CA 3B6PA 4KV8A 5CYQA 3IRXA 1RILA 3SQ1A 3F73A 3ITHA 1KFDA 1UOCA 2FBVA 4DTRA 3V1OA 4KPYA 3RRGA 1S1VA 4CJLA 1CXUA 4FCYA 3MEDA 2HHXA 3RR8A 2B5JA 4KHNA 1C1CA 3CYMA 1ASUA 3KLGA 1GOBA 4H4OA 2GV9A 3CFOA 3VQ5A 3L3UA 1HMVA 5FROA 4CJ5A 3VQEA 4HHTA 4N5SA 4DFMA 1NJYA 4CEQA 2FBYA 3ZSWA 5CZ1A 1TAQA 4ID1A 4Q0BA 3SUQA 2KFNA 3HP9A 3PO4A 4OLBA 3JSMA 4DU4A 1L3SA 4BDYA 2E6LA 4JRQA 5SWMA 3TABA 1ZBIA 5JS1A 3NGZA 1BQMA 3VQDA 3K5LA 4KB1A 2G8WA 1JXEA 4QAGA 4TSXA 4CHZA 1XWLA 3NE6A 2Y1IA 4M3TA 4C8OA 4YNQA 4W5TA 3C6TA 4E7KA 1IH7A 1RDDA 1NOZA 2B4JA 3C95A 4CEZA 1EKEA 1JLFA 3AVBA 2G8KA 2DTUA 1I3AA 3DRRA 3KIOA 4E3SA 3RMDA 4J2BA 4KO0A 1GOCA 2G8UA 4JS5A 1NK8A 3K5MA 3O3GA 1SL0A 1B9FA 3M8SA 4FYDA 1S1XA 3V9UA 4DF4A 1U48A 1VSDA 1C0UA 4AHSA 4FJNA 1MU2A 2P51A 4DFPA 1DTTA 3K57A 4EZ6A 5T7BA 2PYJA 1T03A 3F9KA 3LWMA 3M8QA 3TAFA 4CGFA 3SUPA 4DU3A 2G8FA 3RMBA 3O4QA 3V1QA 4CGHA 4LH4A 4IG0A 4LSLA 4C8MA 3VQBA 3TAEA 4F4KA 4K8ZA 1YTUA 2G8IA 3MECA 2KQ2A 1BI4A 4DG1A 4KRFA 3NF9A 1EX4A 5DMRA 3LZIA 3AVGA 2W42A 2G8VA 4LH5A 2F96A 4DU1A 1T05A 1RBUA 2HHWA 2XO7A 4WE1A 4E7LA 2Z1HA 4CECA 5KTQA 4DSEA 4M3UA 3ASMA 4FLYA 1NKCA 1KSPA 4M3YA 4OKEA 4E7HA 1LW2A 2XY8A 2VWJA 1HQEA 3PX6A 4Z4HA 5HRNA 1BIZA 1WAJA 3NGYA 4FM1A 3U6FA 5C25A 3TANA 1HNIA 1RBSA 1CZ9A 3RMCA 4KI6A 4FZYA 3E01A 4AHTA 3EYZA 3HJFA 3NFAA 1S1TA 1B9DA 4KKOA 3VA0A 3LAMA 1NK0A 4KHUA 2KZMA 2Z1IA 3DI6A 1VSLA 2OPSA 2DFEA 3CG7A 1J54A 3ISNC 3NF6A 4IBNA 3OYBA 4RW4A 4B9TA 1JLAA 4O0JA 4CJ4A 4CIEA 3HSTB 2IC3A 2I5JA 4DTUA 4KREA 4I7FA 4CJ3A
chains in the Genus database with same CATH superfamily
1JCFA 4BVPA 3IS9A 3R9PA 4BC5A 4DV6K 2ASMA 3ZSOA 1JKHA 4B1WB 2OA8A 4AHVA 3QEVA 1T44A 2V7ZA 4YORA 3HXMA 4MO4A 4NO7A 5EXWA 1G15A 1VRUA 1TL1A 3CM6A 4Z4EA 4Z4GA 3HOTA 5EVZA 3VQ7A 1D9FA 2FSNA 2PAVA 4LY7A 1K6YA 3AVLA 3QFUA 4N41A 1RBRA 1MWMA 2E8AA 2FSKA 4K0KK 1TK0A 1VQNN 4JHDB 4Z4FA 4MQ3A 5CR4A 1IKVA 3T69A 3MEEA 3SQ0A 2GWKA 3VQCA 3E9LA 4EP4A 3ZETA 3VF2A 4CJRA 4HUFA 1F21A 4M42A 1BDGA 1MWKA 2Q31A 3S3OA 2FBXA 3BGRA 5EOYA 2ZM6K 1VQ4N 3G0ZA 3P38A 2IVNA 4CGIA 4PWDA 3V4IA 3HVRA 4FJ5A 5ADXA 5FLXO 3BDPA 3WUHA 4B1VA 4IJAA 1QSLA 3DJCA 4EIAA 3IDHA 2YNHA 5F0XA 4CGDA 1BOTO 3OW2M 3MCPA 3MXJA 3PSFA 5KGXA 4XEIA 1QQNA 2YNIA 4CERA 5BR8K 1BIUA 3DYAA 3CETA 3AAQA 3VEZA 2WFBA 3TPQA 3ZCMA 2NRTA 4DTSA 3B8AX 2HB5A 4BRFA 3KD1E 3ZX2A 2Y1JA 4FZXC 4M63C 1GOAA 2BGGA 1CXQA 3PO5A 4O55A 3A8YA 3QIPA 4GY2B 3RWUA 2HVIA 3LZJA 4LSNA 4W5QA 2G8HA 2Q0UA 2FF3B 4FM2A 4EZ9A 3NVMA 3IAYA 2FLOA 1C0MA 2IOCA 3NHGA 4IG3A 2IAJA 2D1KA 4XH5A 5AQMA 3MMVA 3IMXA 2P9SB 1YHQN 2IVPA 2XRIA 3MN7A 3IUCA 3UKRB 4DTPA 3CJ7A 4FWLA 3OS0A 5J2PA 5CE3A 3C7NB 5A2QO 4MFBA 3CQXA 2XY5A 3AVKA 4DHYA 3E1YA 4H5WA 3U9ZA 1KCFA 4FPAA 1U47A 1NGAA 3QFPA 3LDPA 4BROA 3RSEA 4MDBA 2DFHA 3AVIA 1S6QA 3SPZA 1TKDA 2YHXA 1NJIO 4LFAK 4IDKA 4M7XA 2P9PA 3L4QA 1WBDA 4BRNA 1KQSM 3LDQA 3HL8A 1U04A 4I9QA 3ZEUA 4K8XA 3ZETB 2I7PA 4LF7K 4K43A 2B6AA 1QQCA 4E7JA 5M1PA 4N56A 3P39A 4C8LA 1VRTA 3QEPA 4FWNA 1C1AA 5EY4A 3HYFA 5LY3A 3O9SA 5HLFA 2F4VK 3QBXA 3AGRA 2HHQA 4JK9A 1N32K 4BRAA 4IOXA 4GMJB 4BY9C 4CZHA 1QSYA 3E9OA 4FLVA 4F2SA 1T3VA 3DLKA 2Z1GA 1KTQA 2FBTA 3P4IA 3CFPA 2OTLN 2VCPA 4KFBA 1WSHA 4Y1DA 2YX6A 2I7NA 1RT4A 5C2DA 2HVHA 1J6ZA 3TI0A 2ZWHA 3U3GA 1TV6A 3DXKB 3A5MC 4C8NA 4FK4A 3DMJA 3DLHA 4Z4IA 1Q18A 1IG9A 1YITN 4FJKA 4FK0A 3MXIA 2Q1NA 4B3OA 4B9QA 1W97L 4K42A 3WNFA 3AVMA 1T8EA 1ZXOA 4GKKK 3M8RA 5BPMA 4KHPK 4ZHRA 3E66A 3SPYA 5AQLA 3RR7A 3J8AA 4PL8A 3OYHA 2P9SA 4CE9A 4JKGA 1NJZA 5I3UA 1NKEA 5E41A 5LMUK 4DV1K 3HM8A 3HTVA 1WBBA 5AFUH 3LANA 4DV5K 2P9UA 3BEXA 1J5OA 4Y0WA 1CLQA 3NCIA 5AQPA 2O8CA 3V1RA 1SKWA 2A42A 4DMNA 2ITGA 5I42A 3TU5A 5CYMA 4HWIA 3I8DA 4CZLA 3VEOA 4CEEA 1ZBLA 5AQVA 2Q2RA 2GWJA 1N5YA 3D0PA 1C1BA 5AR0A 3G25A 4BWJA 4O0IA 3AO1A 2QEXN 1S9GA 5HROA 1BA0A 3MAQA 4FJMA 1KLMA 3AARA 3ZT3A 4ILGB 3CFRA 1K8KB 3O4WA 4GW6A 2E88A 3AA5X 3NH2A 3QETA 2A40A 3ULDA 3QB0A 2YHYA 4NYFA 5BRDA 1XHXA 4AHRA 4CZFA 4BQLA 4OKJA 2DFFA 3K0SA 3I33A 1M90O 2PZSA 1T6CA 3AVFA 4DFJA 2HNZA 3LM9A 1LOTB 4WF9L 1W0HA 3O3FA 3O4NA 3H1QA 1FJGK 3DXKA 5M1QA 1W7AA 1RT6A 1ATSA 3FFIA 4A61A 4FZZA 3FZKA 1RCHA 5BN9A 5HP1A 4BRCA 4RWTA 4JK8A 1JLCA 1KRPA 1VSFA 4QCLA 2ZQBA 5HRRA 3RRHA 1S3XA 5JICA 5BR9A 4CJVA 2YV0X 3O8MA 2VG5A 2VWBA 1NK5A 3DLGA 2QWQA 2RN2A 2ETJA 3C6UA 4CFDA 1U4BA 1CZAN 1BHLA 3LPUA 3T1YK 4ZTJA 4YY3K 3OJSA 3OYIA 5F1XA 1SUQA 2A3ZA 3FFKB 4DTMA 1HNXK 4BE1A 4F8RA 4B3MK 1K8AO 3EKSA 5FPMA 1HNZK 4B9SA 3MX5A 3CCEN 1RILA 2JWLA 4JKDA 3G71N 4JHDA 4KPYA 3TSQA 3RRGA 2HHXA 5AQNA 3RR8A 3CMAN 4FOIA 2O8EA 4JI5K 1HMVA 5FROA 4HHTA 4N5SA 4AM7A 4DR4K 2FBYA 3CI5A 1E4FT 5AZJA 4Q0BA 2O8DA 4OLBA 3JSMA 4DKWA 4IWVA 3TABA 5SWMA 1NMDA 3K5LA 4CHZA 3HZ6A 3NE6A 2Y1IA 1XWLA 4W5TA 1RDDA 4CEZA 1EKEA 1JLFA 1K9MO 3AAPA 3DRRA 4J2BA 4QS8A 4BRQA 3H6EA 3J7ZO 1NK8A 3UE5A 2ZGYA 3K5MA 1SL0A 4OO1J 5AQUA 2FSJA 2UUAK 1VSDA 1C0UA 4FO0A 3T1HK 4FJNA 1NGGA 4MO5A 3F9MA 3K57A 4EZ6A 3VEXA 2PYJA 3LWMA 3M8QA 4JYAK 4DU3A 3O4QA 3VQBA 4BREA 4K8ZA 4DCHA 3MECA 2ZJRL 2KQ2A 3Q7BA 4FWRA 4DG1A 1DT9A 1IV0A 3NF9A 1VQON 3FLCO 5DMRA 3FE1A 4LF5K 2W42A 1RBUA 2HHWA 1XNQK 4OX9K 4CECA 5KTQA 4M3UA 3ASMA 3AY9A 4FLYA 4JV5K 5HRNA 3U6FA 4KI6A 4AHTA 3HJFA 1IBKK 1S1TA 4DR3K 1WB9A 2Q0RA 3VERA 1VSLA 2OPSA 2DFEA 3ISNC 4IBNA 4KREA 3FZMA 4LF4K 4CJ3A 5TKWA 4DR1K 2DY4A 2QWNA 1OVYA 4BRHA 4EFHA 4DSLA 3QICA 1X1PA 3L2UA 1HYZA 1FXXA 2P9NA 1QHAA 4M41A 1RNHA 3VGMA 2AP1A 1V4SA 4DLGA 4BR0A 4DS4A 3NMUA 2CGLA 1Q86O 2OPQA 2RF2A 3EL2A 4M3ZA 3AGKA 4JK7A 4IOCL 4IO9L 1NOYA 3CC2N 3A5NC 3LL3A 2V51B 2E2PA 1Z25A 3D2EA 3O6WA 3VQ8A 4C23A 2QWPA 3D45A 1VQ5N 3ENBA 4M45A 5C10A 2QW9A 3EZ5A 4FLZA 4YOXA 2ITMA 1WSIA 2VQEK 1ASWA 4L8RB 2O8BB 3V6DA 3WNHA 4CJWA 1IKXA 5AZJB 4CD3A 4E19A 3OYFA 1HKBA 4CBWA 3K59A 4CJUA 3JYTA 3VQ4A 1VK0A 1TK8A 1DEJA 1RT2A 1X3NA 3KLIA 1FKPA 5AQOA 5M1NA 3HT3A 1FW6A 3SAFA 2X74A 4AQYK 3I0SA 4FJJA 4DS5A 1KAZA 4WQ5C 2QA4N 3K2PA 1SS6A 3SUOA 3ZSYA 3F5TA 4CK2A 3GDQA 2ZJQL 3O9TA 4OPKA 3OYEA 2D5RA 2AA4A 4OLAA 4JNEA 4YOVA 4DSKA 4BGBA 1LWCA 3LDLA 3CIPA 3EZWA 3D7EO 3E9PA 4A2AA 3AA2A 1TL3A 4BACA 4FLTA 1KC8O 4ID5A 2UUBK 3QINA 3M1FA 3L2VA 3MCAB 3SZ2A 4GV6A 3AVJA 4LF8K 4MLHA 3VPZA 3T19A 1BWFO 5HOOA 4KB0A 2NRHA 2E1YA 1HNVA 5HRPA 1NKBA 4B08A 4IXCA 4HUEA 2P9NB 2ZD1A 4H0VB 3SMPA 3A5OC 3KLHA 5ELZA 3EN9A 1J5EK 4ISFA 3L3VA 3AV9A 1N8RO 3SQ2A 4LD0A 4AHCA 3ZT1A 1EO1A 3HP6A 2E2QA 3BF1A 3O08A 2HMPA 4KAZA 4CK1A 5AQWA 4BVOA 3D2EB 3EO3A 1RTIA 1IO2A 3SV4A 4JI3K 2HHSA 1TAUA 2O4GA 3TAGA 3FZHA 3KKSA 3IFRA 4FWMA 1GLAG 1YUWA 3KKRA 3ZYYX 1WSJA 3OYGA 3SMSA 3VA3A 1JLGA 3CCQN 1YJ9N 5KQDA 1ZBSA 1QZ5A 2OZMA 3LP1A 4DR6K 1YJNN 3CCRN 3QEIA 4FJHA 1A5WA 4I2PA 1NGIA 4O5BA 4BG8A 4CZGA 5HRSA 2F9WA 4BDPA 1SQKA 3THWB 4B9UA 3OYNA 3P5JA 3SAGA 4RCHA 3VEYA 3O1WA 1L5UA 1NGHA 4NCAA 2HBLA 4B8CA 4IFYA 4PKIA 3DLBA 4O8KA 2UU9K 2GBZA 4E7IA 4WQ4A 3ZEUB 3AO5A 4KH4A 4E89A 4NCBA 1YJWN 2ASOA 3BY5A 3V9SA 4PL7A 2F9TA 4JLHA 3VTIA 1KD1O 2OPPA 4KHYA 4DQSA 4A59A 3CCMN 5IWAK 4CEDA 3PY8A 1Q81O 1N33K 3WNGA 4OVLA 4QOZB 4BRPA 4BR2A 1JLEA 3CJAA 5GAGP 4O8UA 3K58A 3C0BA 4H5VA 4MDAA 4ZTFA 4CF9A 3ZSQA 2WONA 5JLFA 4PA1A 4ELTA 3N4QA 5BRFA 4JRPA 3MDQA 2HHTA 2NLXA 1NBWA 4RW8A 2HHUA 3DOKA 5HL7L 4XIUA 3SQ4A 2XHBA 1S5JA 1KAXA 3SBTA 1O1WA 1VQ8N 3CCLN 4E0DA 1NK6A 1GLBG 3HM9A 3L0QA 2O8DB 1UA1A 4FJ9A 1CZBA 3T1AA 5M1KA 2QM1A 2YI1A 3TARA 2O8EB 1VSMA 2A41A 4FVMA 1WAFA 4RG8A 4J2AA 2WC9A 3HO1A 3L2QA 3KK3A 1VHXA 3KLFA 4DQRA 3HOSA 3QBWA 4CBXA 5CHIA 4WYBA 3MWTA 4HTLA 3CC4N 4FOEA 3VQ9A 1E4GT 3UKUB 2R7YA 2HW3A 1LWEA 1NGJA 4B9NA 2HBMA 2NRZA 3MN9A 4CI6A 5AQRA 4CIFA 1U6ZA 2ATQA 2YHBA 3OS1A 2FC0A 4DLEA 2A1RA 2CGKA 1Z26A 3PIPL 3SYZA 2WTUA 3CXCM 5J2QA 2QWRA 4WFNL 4CZMA 4Q5VA 2HSTA 1NK4A 4R5PA 2DPNA 2P1JA 4DQPA 1C6VA 1ZYQA 3DWLA 3ATUA 4CEOA 1L3VA 2V7YA 5CZ2A 1JLQA 3J81O 4E1MA 4H4MA 4W5RA 4FJ8A 4B1ZA 3QO9A 4KH6A 3AVHA 3GG4A 3O3HA 2QWOA 2EHGA 2D0BA 3TAQA 2UXBK 1HJRA 2UYTA 1TVRA 1HKGA 2JWKA 4F3OA 4IFVA 3ENHA 4OGCA 2WOMA 2JGUA 2D0PA 1TUYA 3AA3A 4ELUA 4CJTA 3H08A 1TUUA 1RDCA 3O9QA 5AQSA 2ZE2A 1HUXA 3IKMA 1E3MA 2EWSA 3H1VX 2F8SA 4NCGA 1VSHA 3IRXA 3CD6N 3F73A 3R6MA 1RGIA 3V1OA 5AQZA 1CXUA 3MEDA 4KHNA 2Q97A 1ASUA 3KLGA 2NRVA 4H4OA 5ADXH 4NXNK 3L3UA 4DFMA 3O9UA 4LFBK 1NJYA 4CEQA 1VQ9N 4PKGA 4JI8K 2GEMA 5CZ1A 4KH5A 5AQIA 3PO4A 4LF6K 1L3SA 4BDYA 5LJVA 3NGZA 1BQMA 4CD1A 4C8OA 4YNQA 1S72N 4E7KA 3C95A 3ULEB 1MDUB 3MX2A 4XH4A 1B9FA 3M8SA 4FYDA 4JKAA 2P9LB 4AHSA 4JD2A 3UB5A 1T03A 3CF5L 3VF4A 3FZFA 4X66K 4CGFA 3RMBA 1ATRA 2ZF5O 4IG0A 4C8MA 1U2VA 2E20A 1BI4A 4JI1K 3LZIA 1OKJA 3MN6A 4LH5A 1Z6RA 2F96A 2FXUA 3FGUA 4WE1A 3WT0A 2Z1HA 4BRDA 1NKCA 2XY8A 1RDWX 2OANA 2VWJA 4Z4HA 3ZLJA 4ILHA 4JI7K 1CZ9A 4FZYA 3EYZA 3NFAA 5JVHL 4KKOA 3DI6A 3CG7A 1J54A 1QZ6A 3OHRA 4DTUA 3EKUA 2IC3A 1QQOA 5M1FA 4I7FA 3MXMA 3TWHA 4A2BA 3HK2A 4YOTA 1ESVA 3W0LA 3SNNA 2GELA 3LDNA 4AH9A 4WQ5A 4FJIA 4H0PA 3CJ9A 3QESA 3LP3A 3S41A 1V4TA 3V81A 4CZEA 3EY1A 4DR5K 3BF3A 4HUGA 3QLHA 1KVCA 1LCUA 2QK9A 1YVUA 3Q7CA 4JAXA 3B6OA 4NLCA 2VQFK 3VQAA 3K9KA 3I0RA 5BPNA 1HNWK 1ILYA 1VSIA 3VESA 1U45A 4CJEA 5AZIB 3M8PA 4IDHA 4O5FA 5F2RA 1XNRK 2YNFA 1G99A 3T7ZA 3C6AA 5AQTA 1NLVA 1UWBA 1OVQA 3SJHA 1VQLN 3LDOA 1HYSA 1L3TA 1X9MA 3S9HA 5LMNK 4IOAL 3M6GA 5KQ8A 2A1SA 3KJVA 4EHTA 4Z4CA 1GLJO 3J80O 4OKKA 1KXPA 4CHQA 3THYA 1WSGA 1GLCG 2X78A 3CQ8A 1QTMA 2QI2A 5AQGA 2A6AA 1RT3A 1I94K 3SI6A 4DV3K 1SZ2A 3SUNA 3AVAA 1Q7YO 3P1GA 4J8FA 3NBPA 3NDKA 2P5OA 2W40A 1NGCA 4BRMA 1WNSA 1HPZA 4CFBA 3NVKA 4FW2A 4DTXA 2KZZA 2P9KA 3G10A 1M1KO 5DM6L 3MEGA 3ATVA 2CGJA 3D6RA 2XY6A 1O13A 2IS3A 1VSKA 5AQXA 4KI4A 4CJFA 4DWIA 4CGJA 4DF8A 3DOLA 3TTCA 1BISA 3I55N 3C94A 3SLCA 2HNDA 3BUZB 1ZBHA 1HKCA 1IKYA 3LPTA 5GADP 4BG9A 2YKNA 3AO3A 3JAMO 2BANA 3VQ6A 4IJNA 3U4LA 4B3TK 4Z0UA 3O9RA 4O4GA 1HJOA 4PQUA 4DV4K 1VQKN 3O80A 4LF9K 3OY9A 4FW1A 2FF6A 2GUIA 4JKHA 1RT7A 3TSPA 3C65A 3HVTA 4DR7K 4HCBA 4RTFD 4QS9A 5K14A 3VN5A 2OTJN 4DQ8A 1L3UA 4DSJA 3KTQA 2UXDK 3W3DA 4FJ7A 1KLNA 5C0YA 1EETA 4BR5A 3FR0A 3BP8A 3QNNA 4JKCA 3QIOA 2YNGA 4CBUA 2GUPA 4K41A 3CC7N 3DLEA 3OYDA 4M3WA 1EWQA 3ZT4A 1RDAA 3PSIA 2KTQA 3EE9A 1EP4A 5C42A 3R3LA 5FPDA 1Q8IA 5C24A 5KRTA 3NAEA 3HPOA 4AILC 4CFAA 1RBVA 1WSEA 4ILJA 3A2FA 4BC4A 3THYB 2IVOA 4HVJA 4CCHA 3GL1A 2ZGZA 4FLUA 3OYJA 1RFQA 4PHTX 1IKWA 1X3MA 5SZTA 3OS2A 2YJFA 1QE1A 1S9EA 4PKHA 4BC2A 1K8KA 2HF4A 2E6MA 4H0XB 4JKBA 5FPEA 2HMIA 1BL3A 3CJCA 3OBWA 4BR9A 2UXCK 4F2RA 5J2MA 3AVCA 3QERA 1BCOA 5KGWA 3ZSXA 4DSFA 1JXBA 3OYMA 1KFSA 3THWA 4OJRA 1NGFA 1BQNA 1RBTA 3LDSA 4BE0A 2P9IA 5FRNA 1A5XA 3TR8A 1ZC6A 1SKRA 4H8KA 3MN5A 3UIQA 2BDPA 3SJJA 4CGGA 4A5BA 3ZSRA 5D3GA 4B9VA 3DRSA 1QVFM 3ZSVA 2KFZA 4DB3A 1SV5A 3WEEA 1QSSA 3H3OB 2IGIA 2AJQA 3AO2A 3ZX3A 2F7TA 3WXJA 1MA9B 5JS2A 5M1OA 3VEVA 1SAZA 2O8FA 2VG7A 4FWOA 3L8BA 4CK3A 3KHYA 4CJSA 2VG6A 3LAKA 4DTJA 1WN7A 1WOQA 3PX4A 5CY4A 1XHZA 2KKZA 5C15A 1YT3A 1BUPA 3SV3A 5AQJA 1NK9A 5BN8A 2OZSA 2QKBA 5GIOA 4H0YB 4A5AA 2BTFA 4IEIA 4EAHD 3U9DA 3CQYA 3ULEA 4YFUA 1LV5A 4BRGA 2KW4A 3I8BA 3KLEA 1N6QA 4FJLA 2KLAA 3QMLA 1VQ7N 3DXMB 3LALA 4FK2A 4IO8A 3AA4A 4OPJA 4GNIA 3WNEA 4CF1A 4CEAA 3OBYA 3OJUA 4PY5A 5I9EB 4BRLA 2PY5A 1NGBA 2ASPA 4BR7A 3HPHA 5EU7A 4BC3A 3DM2A 5BPLA 3FZLA 1YF5L 4WQ4C 5AQHA 4CVNE 3WQTA 2RKIA 3EEQA 4IEEA 1BCMA 1SL2A 1IJJA 5MLCQ 1FKOA 3J7YP 1HYVA 4CF8A 1WLJA 3AO4A 1YTAA 3VETA 4B3RK 4M3XA 1VQMN 4CHOA 5B8HA 3DAWA 4E1JA 1S6PA 1BA1A 2VGNA 3CPWM 5DK5A 3SBGA 4C1NK 4W5OA 2W41A 1D9DA 1FK9A 4DTOA 1A5VA 4ICLA 4FJXA 2NNWA 1X9SA 1QVGM 4CZKA 2ZJPL 4FM0A 2BE2A 3LWLA 4JEPA 1KVAA 2YCHA 4A57A 4BRIA 3KZBA 3G4SN 2D0CA 3RTVA 1ASVA 3QNOA 3L6QA 3ZX0A 2F8TA 3SQ1A 4OPAA 2BH1A 4KV8A 5CYQA 2NRRA 1RDUA 3ITHA 1UOCA 2FBVA 4DTRA 4CJLA 4YHHK 4FCYA 4AF1A 2B5JA 3CYMA 2RE2A 4B3SK 1GOBA 5TKYA 2GV9A 4CJ5A 4JI2K 5FPNA 4CZIA 1TAQA 3F2KA 1YAGA 3SUQA 3HP9A 2W6LA 4JRQA 1ZBIA 5JS1A 5AZIA 4NLBA 3VQDA 4KB1A 1JXEA 4QAGA 1Y64A 3D2FB 4TSXA 3C6TA 1IH7A 1NOZA 2B4JA 4YOWA 2G8KA 1I3AA 3RMDA 3KIOA 4E3SA 2E2OA 3VENA 3THXB 3GBTA 4KO0A 1GOCA 4L3QA 4JS5A 1T6DA 3O3GA 3RSEB 1S1XA 4DF4A 1U48A 3RVCA 3M5RA 1NGEA 4DFPA 2P9IB 3CMEN 4F4KA 2G8IA 1YTUA 1BG3A 3HSCA 4KBOA 2J4RA 4I6MA 4KRFA 3AVGA 2G8VA 4DU1A 1T05A 4WCEL 2NRWA 4DSEA 2QWLA 4C1NI 1LW2A 4DV7K 1NU0A 1X9JA 1WAJA 3NGYA 3SK3A 3CCSN 1HNIA 2P9KB 1HLUA 5BREA 2KZMA 1HX1A 2HOEA 1XC3A 3OYBA 4MLEA 1P8ZA 3BZCA 3NF6A 3CCVN 4B9TA 1JLAA 4O0JA 4CJ4A 4E7HA 3C6HA 2LSNA 1BI4B 3VQPA 1T7PA 3BZKA 3A5LC 3V9ZA 4F3TA 1NGDA 2PYLA 1S1WA 4U7BA 2WBNA 3ID6A 3LP0A 4E1NA 2QXLA 1HQUA 3KK1A 1NJWA 1C0TA 1OH8A 2NZTA 4U67L 4RW6A 4KHQA 4H0OA 5KPZA 1XMQK 4CHPA 4FPBA 4CJPA 3KD5E 4J2EA 1EXQA 3ENOA 4NXMK 2YHWA 2Z1JA 1TGOA 4A62A 4CHNA 3CJ1A 4CESA 4JI0K 3S3MA 4KHSA 4FL9A 2E1ZA 2HF3A 3TTFA 1I39A 4WFBL 4XH1A 3O1BA 3KK7A 2D0AA 3L2RA 4FLXA 2Q3SA 4DTNA 5AFUA 3ZT2A 1P90A 4YDUA 3WXIA 3QDKA 4J2DA 4BDZA 3CJBA 1Q9XA 2HBKA 1N36K 3WQUA 3OTOK 3NH1A 4M7YA 2RPIA 1EWRA 1RTDA 1LAWA 1XC9A 1JLBA 4BRKA 4M3RA 3NF8A 2NRXA 3PV8A 4JS4A 1UAXA 2OPRA 1YXQA 2O8BA 4NYNA 3TTDA 1RDBA 1YIJN 4DR2K 4FWKA 4DV2K 1OH5A 4DQQA 1W9HA 5FDLA 4CFCA 3ZSZA 2A5XA 3RMAA 5KRSA 2EX3A 3OYCA 2IIRA 2W6KA 2YJEA 1LWFA 4YOYA 1J53A 4IKFA 1X9WA 3JXUA 1RTHA 4JKFA 4WFAL 4DV0K 1VSJA 1D5AA 5GIPA 1K73O 4AM6A 1NK7A 1TKXA 1DGKN 5J1EA 1IBLK 1BO5O 5GAHP 1ZBFA 3V9WA 3T3FA 1S1UA 4CEFA 3K5OA 1YVNA 1JL2A 4Z94A 1VQPN 3WXLA 1NNEA 2V52B 3R8EA 4CF2A 4RW7A 2IDOA 4C8KA 5KI6A 1UA0A 3CCJN 1GLFO 3AVNA 3VOVA 5KPTA 3V9XA 4N47A 2PBDA 3DLLL 3SCXA 3DLRA 3OYLA 3WXKA 2X6SA 4BR4A 2VWKA 2BUPA 3DXMA 1XI1A 1B92A 1BGXT 4JI4K 3NF7A 1D4XA 3CERA 4BWMA 3LM2A 4B9MA 4FWSA 4X65K 3GOIA 1R59O 4CJQA 4EP5A 4CJ7A 5J2NA 1IBMK 1JL1A 4IFEA 3O5BA 1U49A 2HBJA 4B8AB 5C2FA 1VSEA 3KWIA 3P83D 1EQYA 4N76A 4DSIA 4CW7B 1S22A 4GV3A 4DQIA 4O44A 4FWQA 3VGLA 4JKGB 2P5GA 5FRMA 5AJ3K 4CF0A 3TAPA 3VMFB 1KVBA 1HRHA 3TAMA 3KK2A 1WSFA 3NH0A 2YKMA 4H0TB 2E5LK 3KVGA 1ZBUA 4CJKA 4FLWA 3CPEA 5GINA 3K9JA 1N34K 1Z05A 4HTUA 1TKTA 5LJWA 2H3GX 2QTDA 3OA9A 1GLEG 4H03B 3PIOL 4FXDA 4KTZA 4DFKA 4W5NA 3PUFA 1J9AA 4LC9B 3DRPA 5AQYA 1H1VA 2GTDA 1LW0A 4G1QA 1NJXA 2HNYA 3NGIA 4UQGA 2GX9A 3U8XA 3UKRA 4BE2A 2D0OA 4X62K 4H5TA 3C7NA 1SL1A 2QXFA 4UY8O 2RHKA 3OVNA 4RW9A 4JKEA 4FJGA 4DUZK 1Q9YA 3QEXA 3L2WA 1SKSA 4KTWA 1D8YA 2OYQA 4OGEA 5E84A 4G9ZA 1XUPO 1RTJA 1OH7A 1RT1A 3THVA 1DLOA 2NUBA 3M3ZA 4OPHA 5BRHA 1LAVA 2E4LA 3OYKA 1QS4A 4R79A 5GAEP 1Y97A 4GVMA 5HBMA 4BQZA 1WUAA 3THXA 1RT5A 1VAZA 3WEEB 2OCEA 1DTQA 4H5RA 3OYAA 1C0GA 1QHTA 1Q82O 4I9LA 4HCCA 5JVGL 1W2BM 3S3NA 3IG1A 3MK6A 2WUSA 2O8FB 2QKKA 3I56N 3HRGA 3JS6A 5H1SQ 3EE8A 5AQKA 4X64K 3CCUN 1TYQB 1NG9A 3PX0A 3QEWA 2P9LA 4KHWA 1REVA 1GLLO 4B1YB 3ALYA 3H3NO 4V19S 3ZT0A 3U3YA 2XY7A 4AHUA 4YDUC 4KTQA 4JN4A 4CHYA 4I6MB 3ID8A 3CM5A 1DKGD 3LP2A 1R0AA 2HHVA 4GVEA 5JMVA 3UKUA 2JLEA 3H46O 3TSUA 4DUYK 1TK5A 3J7AP 4ELVA 1ATNA 4PUOA 1TKZA 2D4WA 3VGKA 4H5NA 2CH5A 3HPGA 4CIGA 4B9LA 3P31A 3A0IX 4IZ9A 3VQQA 1HPMA 1ITGA 2X6NA 4FSVA 3CHWA 4B1XB 3K5NA 4QS7A 4CEBA 5DM7L 3PLAA 1OH6A 3HI0A 4I2QA 3L4IA 1XQSC 2P9UB 2YHAA 5IT9O 2O4IA 4Y1CA 3B6PA 4JI6K 1JJ2M 1KFDA 4K25A 1HR0K 1S1VA 2QWMA 4GV9A 1VQ6N 1NM1A 1QQMA 3H45C 5EX5A 4EHUA 1C1CA 1IG8A 2UUCK 3CFOA 2HHHK 2VYPA 3VQ5A 3VQEA 1NMNA 2Q36A 3ZSWA 2O8CB 1NWKA 4CZJA 4ID1A 4F9OA 3VEWA 2KFNA 1U2VB 3VTHA 4DU4A 2E6LA 2VGMA 4GKJK 2G8WA 4B1UB 3R1XA 4M3TA 5E26A 3N4PA 1XMOK 3G6EN 3SAHA 3AVBA 2DTUA 2G8UA 3V9UA 4FWPA 5AQQA 1MU2A 2P51A 4LFCK 1DTTA 2KHOA 5T7BA 1YI2N 3F9KA 3HBTA 4BGAA 3WXMB 3TAFA 3GE1A 3SUPA 4FVUA 2PFUA 2P9PB 5LL6Z 2G8FA 1KAYA 3V1QA 1TYQA 4CGHA 4LH4A 4LSLA 4NB4A 3TAEA 1JCGA 1GLDG 4YOUA 1EX4A 3D2FA 2XO7A 4E7LA 1KSPA 4M3YA 4OKEA 1HQEA 4ISGA 3PX6A 1BIZA 4FM1A 5C25A 3VF6A 3TANA 1RBSA 1BU6O 3RMCA 3E01A 5C12A 4JD2B 1JCEA 1B9DA 5KPRA 3VA0A 3LAMA 1NK0A 4KHUA 2Z1IA 2CH6A 4ISEA 2E2NA 1C0FA 3KWGA 5AQFA 4RW4A 5JLHA 4CIEA 3HSTB 2I5JA 3MWPA
chains in the Genus database with same CATH topology
3TWHA 3HK2A 2DY4A 2LSNA 1BI4B 3IS9A 4DSLA 3VQPA 1T7PA 1X1PA 3SNNA 3L2UA 3ZSOA 1HYZA 3V9ZA 4F3TA 1FXXA 1JKHA 2OA8A 4M41A 2PYLA 4AH9A 1S1WA 4FJIA 4AHVA 3QESA 3QEVA 1RNHA 3LP3A 4DLGA 3LP0A 4E1NA 3HXMA 3V81A 1HQUA 1G15A 1VRUA 3EY1A 1TL1A 3CM6A 4HUGA 4DS4A 4Z4EA 2OPQA 2RF2A 3QLHA 3KK1A 4Z4GA 1KVCA 4M3ZA 3VQ7A 1NJWA 1D9FA 1NOYA 1C0TA 4LY7A 2QK9A 1K6YA 4RW6A 1YVUA 4KHQA 3AVLA 4N41A 1RBRA 1Z25A 3B6OA 4CHPA 3VQ8A 4CJPA 3D45A 1TK0A 3VQAA 3KD5E 4J2EA 1EXQA 4CHNA 3I0RA 2Z1JA 1TGOA 4Z4FA 4MQ3A 1VSIA 4M45A 4CESA 1IKVA 3S3MA 1U45A 4KHSA 4CJEA 3EZ5A 4FLZA 3MEEA 3SQ0A 3M8PA 1WSIA 3VQCA 1I39A 4EP4A 4CJRA 4HUFA 4M42A 1F21A 2YNFA 1ASWA 4L8RB 2D0AA 3L2RA 3V6DA 3S3OA 3WNHA 4CJWA 1UWBA 4FLXA 2FBXA 2Q3SA 3BGRA 4DTNA 1IKXA 4E19A 1HYSA 3G0ZA 3ZT2A 1L3TA 3OYFA 1X9MA 4CGIA 3K59A 4PWDA 3S9HA 4CJUA 3JYTA 3V4IA 3HVRA 4J2DA 4FJ5A 4BDZA 2A1SA 3VQ4A 3KJVA 4Z4CA 1Q9XA 3BDPA 1VK0A 4OKKA 4CHQA 1QSLA 1WSGA 2YNHA 4CGDA 3NH1A 1TK8A 2X78A 3CQ8A 1RT2A 1QTMA 2RPIA 3KLIA 1FKPA 3MXJA 3HT3A 5KGXA 2YNIA 1RTDA 4CERA 1LAWA 1BIUA 2X74A 3DYAA 1RT3A 1XC9A 3SI6A 1JLBA 3ZCMA 3SUNA 4M3RA 3AVAA 3I0SA 3NF8A 4DTSA 3PV8A 4FJJA 4JS4A 1UAXA 2HB5A 2OPRA 4DS5A 3P1GA 3KD1E 4NYNA 3K2PA 3NBPA 2Y1JA 1RDBA 3SUOA 4FZXC 3ZSYA 4CK2A 3NDKA 2P5OA 1GOAA 2BGGA 4DQQA 1W9HA 1CXQA 1WNSA 1HPZA 5FDLA 3ZSZA 4CFCA 4OPKA 4CFBA 3OYEA 4FW2A 4DTXA 3PO5A 2KZZA 2D5RA 4O55A 4OLAA 3G10A 3RMAA 4DSKA 3QIPA 5KRSA 3RWUA 2EX3A 2HVIA 3MEGA 3LZJA 4LSNA 4W5QA 3OYCA 1LWCA 2G8HA 4EZ9A 4FM2A 2XY6A 1LWFA 2IS3A 1VSKA 4KI4A 3AA2A 1TL3A 4CJFA 4BACA 4FLTA 4DWIA 3IAYA 4CGJA 1J53A 1C0MA 4DF8A 4ID5A 4IKFA 3DOLA 3QINA 1BISA 2IOCA 1X9WA 3L2VA 1RTHA 3NHGA 3C94A 4IG3A 2IAJA 3SZ2A 3AVJA 2HNDA 1ZBHA 2XRIA 1IKYA 1VSJA 3T19A 1D5AA 3LPTA 2YKNA 3AO3A 4DTPA 4KB0A 3OS0A 5J2PA 2BANA 1HNVA 3VQ6A 1NK7A 4MFBA 1TKXA 5HRPA 5J1EA 1NKBA 4B08A 2XY5A 1ZBFA 3V9WA 3AVKA 4Z0UA 4O4GA 4HUEA 2ZD1A 3T3FA 1S1UA 4CEFA 4PQUA 3K5OA 3KLHA 1JL2A 3OY9A 4FW1A 1KCFA 1U47A 2GUIA 1RT7A 3L3VA 3AV9A 3SQ2A 3HVTA 4LD0A 4AHCA 3ZT1A 2DFHA 3AVIA 3HP6A 4CF2A 4HCBA 4RW7A 1S6QA 3SPZA 5K14A 3VN5A 1TKDA 2IDOA 4C8KA 1L3UA 5KI6A 4DSJA 1UA0A 3KTQA 4KAZA 3AVNA 4IDKA 4CK1A 4FJ7A 1KLNA 3SV4A 1EETA 1IO2A 1RTIA 3V9XA 2HHSA 1TAUA 2O4GA 3TAGA 4N47A 3QNNA 3SCXA 3KKSA 3QIOA 3DLRA 2YNGA 3OYLA 3KKRA 3HL8A 2X6SA 1U04A 1WSJA 2VWKA 4I9QA 3DLEA 3OYDA 4M3WA 3ZT4A 1RDAA 4K8XA 3OYGA 3VA3A 1XI1A 1JLGA 2KTQA 1B92A 2B6AA 1EP4A 5C42A 2OZMA 1BGXT 3LP1A 1QQCA 1Q8IA 3NF7A 3QEIA 5C24A 4FJHA 4E7JA 4N56A 4BWMA 5KRTA 4B9MA 1A5WA 4I2PA 1VRTA 4O5BA 3NAEA 4C8LA 3HPOA 5HRSA 3QEPA 4BDPA 1C1AA 4AILC 4CFAA 1RBVA 3OYNA 4B9UA 1WSEA 3HYFA 3P5JA 5HLFA 4CJQA 4EP5A 2HHQA 3A2FA 5J2NA 1L5UA 4NCAA 4HVJA 4GMJB 4B8CA 1QSYA 1JL1A 4CCHA 4IFYA 4FLUA 1U49A 3DLBA 4FLVA 3OYJA 4F2SA 3DLKA 2Z1GA 1KTQA 4B8AB 2FBTA 1IKWA 1VSEA 2GBZA 5SZTA 3CFPA 3OS2A 4E7IA 3P83D 1QE1A 1S9EA 4N76A 4KFBA 3AO5A 1WSHA 4Y1DA 4DSIA 2E6MA 4DQIA 2HMIA 4O44A 4E89A 1BL3A 1RT4A 4NCBA 2P5GA 5FRMA 4CF0A 3TAPA 4F2RA 3TI0A 2HVHA 3U3GA 5J2MA 1TV6A 4C8NA 3AVCA 4FK4A 1KVBA 3DMJA 3DLHA 3QERA 1BCOA 5KGWA 3ZSXA 4Z4IA 4DSFA 1HRHA 3TAMA 3KK2A 1JXBA 1WSFA 3V9SA 3OYMA 3NH0A 2YKMA 1KFSA 1ZBUA 4CJKA 1IG9A 4JLHA 2OPPA 4FLWA 4FJKA 4KHYA 4DQSA 4FK0A 4OJRA 1BQNA 1RBTA 3MXIA 4HTUA 4B3OA 3LDSA 4BE0A 1TKTA 4CEDA 3PY8A 5FRNA 3WNFA 1A5XA 3AVMA 3TR8A 3WNGA 4FXDA 4KTZA 1T8EA 1SKRA 2F8SA 4H8KA 4DFKA 4OVLA 4QOZB 4W5NA 3M8RA 3PUFA 3UIQA 1J9AA 2BDPA 1JLEA 3DRPA 4ZHRA 3SPYA 3SJJA 1LW0A 3K58A 3RR7A 4CGGA 3OYHA 4ZTFA 4G1QA 1NJXA 3ZSRA 2HNYA 4B9VA 4CE9A 3NGIA 5D3GA 4UQGA 3DRSA 4CF9A 1NJZA 5I3UA 3ZSQA 3ZSVA 4BE2A 1NKEA 2KFZA 2WONA 5E41A 4PA1A 1SV5A 4JRPA 4ELTA 1QSSA 2HHTA 2IGIA 2AJQA 3AO2A 1SL1A 2QXFA 3LANA 3OVNA 4RW9A 4RW8A 5JS2A 4FJGA 3DOKA 2HHUA 4XIUA 3SQ4A 2XHBA 1Q9YA 3QEXA 2VG7A 1S5JA 3L8BA 4CK3A 3L2WA 1J5OA 4CJSA 1SKSA 1CLQA 2VG6A 1O1WA 3LAKA 3NCIA 4DTJA 4KTWA 1WN7A 3PX4A 4E0DA 5CY4A 1D8YA 1XHZA 1NK6A 3V1RA 2OYQA 3HM9A 1SKWA 4OGEA 1UA1A 1YT3A 4DMNA 3SV3A 4FJ9A 1CZBA 3T1AA 1NK9A 3TARA 2OZSA 1RTJA 1VSMA 2QKBA 2ITGA 4FVMA 5I42A 1WAFA 1RT1A 4RG8A 1DLOA 2NUBA 5CYMA 3THVA 4J2AA 3HO1A 3L2QA 3KK3A 3I8DA 1LAVA 2E4LA 3OYKA 1QS4A 4CEEA 1ZBLA 3KLFA 4DQRA 1Y97A 4GVMA 4YFUA 5HBMA 1LV5A 1N5YA 1RT5A 2KW4A 3D0PA 1C1BA 1DTQA 3OYAA 3KLEA 1QHTA 4BWJA 4O0IA 1N6QA 4FJLA 3AO1A 4I9LA 3VQ9A 4HCCA 3LALA 1S9GA 3S3NA 3IG1A 4FK2A 5HROA 4OPJA 3AA4A 2R7YA 2QKKA 2HW3A 3WNEA 1LWEA 3MAQA 4B9NA 4CF1A 4CIFA 4CEAA 4FJMA 1KLMA 3OJUA 3PX0A 4PY5A 2ATQA 2YHBA 3ZT3A 3QEWA 3OS1A 2FC0A 4DLEA 2A1RA 2PY5A 3CFRA 4KHWA 1REVA 1Z26A 4GW6A 3SYZA 3HPHA 5EU7A 3AA5X 3DM2A 3NH2A 3ALYA 3QETA 5J2QA 3ZT0A 3ULDA 4NYFA 3U3YA 2RKIA 1XHXA 4AHRA 4Q5VA 1NK4A 2XY7A 1BCMA 2DFFA 4OKJA 4AHUA 4R5PA 1SL2A 3MXMA 2P1JA 4DQPA 4KTQA 1C6VA 2PZSA 1FKOA 3AVFA 1HYVA 4CHYA 4CF8A 1ZYQA 4DFJA 1WLJA 2HNZA 4CEOA 1L3VA 3AO4A 5CZ2A 1YTAA 3CM5A 3LP2A 1JLQA 1W0HA 3O3FA 1R0AA 4M3XA 4E1MA 4CHOA 2HHVA 3O4NA 1S6PA 4H4MA 2JLEA 1TK5A 5DK5A 1RT6A 3FFIA 4ELVA 4W5RA 4PUOA 4FZZA 1TKZA 4FJ8A 1RCHA 5HP1A 3QO9A 4W5OA 1JLCA 1KRPA 1VSFA 3AVHA 2ZQBA 3O3HA 5HRRA 1D9DA 3HPGA 3RRHA 4QCLA 1FK9A 4DTOA 1A5VA 2EHGA 2D0BA 4CIGA 3TAQA 1HJRA 4ICLA 4B9LA 4CJVA 2YV0X 3VQQA 4FJXA 1TVRA 1ITGA 2VG5A 1X9SA 1NK5A 4IFVA 3DLGA 4OGCA 4F3OA 2RN2A 2ETJA 3C6UA 2X6NA 2WOMA 4FM0A 2JGUA 2BE2A 4CFDA 3LWLA 3K5NA 1U4BA 4CEBA 1BHLA 1KVAA 3AA3A 3LPUA 4ZTJA 4CJTA 4ELUA 3H08A 3OJSA 1RDCA 3OYIA 1SUQA 4DTMA 2ZE2A 4BE1A 4I2QA 2D0CA 3RTVA 2YHAA 4F8RA 1ASVA 3QNOA 2O4IA 2F8TA 4B9SA 4NCGA 1VSHA 4Y1CA 3B6PA 4KV8A 5CYQA 3IRXA 1RILA 3SQ1A 3F73A 3ITHA 1KFDA 1UOCA 2FBVA 4DTRA 3V1OA 4KPYA 3RRGA 1S1VA 4CJLA 1CXUA 4FCYA 3MEDA 2HHXA 3RR8A 2B5JA 4KHNA 1C1CA 3CYMA 1ASUA 3KLGA 1GOBA 4H4OA 2GV9A 3CFOA 3VQ5A 3L3UA 1HMVA 5FROA 4CJ5A 3VQEA 4HHTA 4N5SA 4DFMA 1NJYA 4CEQA 2FBYA 3ZSWA 5CZ1A 1TAQA 4ID1A 4Q0BA 3SUQA 2KFNA 3HP9A 3PO4A 4OLBA 3JSMA 4DU4A 1L3SA 4BDYA 2E6LA 4JRQA 5SWMA 3TABA 1ZBIA 5JS1A 3NGZA 1BQMA 3VQDA 3K5LA 4KB1A 2G8WA 1JXEA 4QAGA 4TSXA 4CHZA 1XWLA 3NE6A 2Y1IA 4M3TA 4C8OA 4YNQA 4W5TA 3C6TA 4E7KA 1IH7A 1RDDA 1NOZA 2B4JA 3C95A 4CEZA 1EKEA 1JLFA 3AVBA 2G8KA 2DTUA 1I3AA 3DRRA 3KIOA 4E3SA 3RMDA 4J2BA 4KO0A 1GOCA 2G8UA 4JS5A 1NK8A 3K5MA 3O3GA 1SL0A 1B9FA 3M8SA 4FYDA 1S1XA 3V9UA 4DF4A 1U48A 1VSDA 1C0UA 4AHSA 4FJNA 1MU2A 2P51A 4DFPA 1DTTA 3K57A 4EZ6A 5T7BA 2PYJA 1T03A 3F9KA 3LWMA 3M8QA 3TAFA 4CGFA 3SUPA 4DU3A 2G8FA 3RMBA 3O4QA 3V1QA 4CGHA 4LH4A 4IG0A 4LSLA 4C8MA 3VQBA 3TAEA 4F4KA 4K8ZA 1YTUA 2G8IA 3MECA 2KQ2A 1BI4A 4DG1A 4KRFA 3NF9A 1EX4A 5DMRA 3LZIA 3AVGA 2W42A 2G8VA 4LH5A 2F96A 4DU1A 1T05A 1RBUA 2HHWA 2XO7A 4WE1A 4E7LA 2Z1HA 4CECA 5KTQA 4DSEA 4M3UA 3ASMA 4FLYA 1NKCA 1KSPA 4M3YA 4OKEA 4E7HA 1LW2A 2XY8A 2VWJA 1HQEA 3PX6A 4Z4HA 5HRNA 1BIZA 1WAJA 3NGYA 4FM1A 3U6FA 5C25A 3TANA 1HNIA 1RBSA 1CZ9A 3RMCA 4KI6A 4FZYA 3E01A 4AHTA 3EYZA 3HJFA 3NFAA 1S1TA 1B9DA 4KKOA 3VA0A 3LAMA 1NK0A 4KHUA 2KZMA 2Z1IA 3DI6A 1VSLA 2OPSA 2DFEA 3CG7A 1J54A 3ISNC 3NF6A 4IBNA 3OYBA 4RW4A 4B9TA 1JLAA 4O0JA 4CJ4A 4CIEA 3HSTB 2IC3A 2I5JA 4DTUA 4KREA 4I7FA 4CJ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TWH A;  3HK2 A;  2DY4 A;  2LSN A;  1BI4 B;  3IS9 A;  4DSL A;  3VQP A;  1T7P A;  1X1P A;  3SNN A;  3L2U A;  3ZSO A;  1HYZ A;  3V9Z A;  4F3T A;  1FXX A;  1JKH A;  2OA8 A;  4M41 A;  2PYL A;  4AH9 A;  1S1W A;  4FJI A;  4AHV A;  3QES A;  3QEV A;  1RNH A;  3LP3 A;  4DLG A;  3LP0 A;  4E1N A;  3HXM A;  3V81 A;  1HQU A;  1G15 A;  1VRU A;  3EY1 A;  1TL1 A;  3CM6 A;  4HUG A;  4DS4 A;  4Z4E A;  2OPQ A;  2RF2 A;  3QLH A;  3KK1 A;  4Z4G A;  1KVC A;  4M3Z A;  3VQ7 A;  1NJW A;  1D9F A;  1NOY A;  1C0T A;  4LY7 A;  2QK9 A;  1K6Y A;  4RW6 A;  1YVU A;  4KHQ A;  3AVL A;  4N41 A;  1RBR A;  1Z25 A;  3B6O A;  4CHP A;  3VQ8 A;  4CJP A;  3D45 A;  1TK0 A;  3VQA A;  3KD5 E;  4J2E A;  1EXQ A;  4CHN A;  3I0R A;  2Z1J A;  1TGO A;  4Z4F A;  4MQ3 A;  1VSI A;  4M45 A;  4CES A;  1IKV A;  3S3M A;  1U45 A;  4KHS A;  4CJE A;  3EZ5 A;  4FLZ A;  3MEE A;  3SQ0 A;  3M8P A;  1WSI A;  3VQC A;  1I39 A;  4EP4 A;  4CJR A;  4HUF A;  4M42 A;  1F21 A;  2YNF A;  1ASW A;  4L8R B;  2D0A A;  3L2R A;  3V6D A;  3S3O A;  3WNH A;  4CJW A;  1UWB A;  4FLX A;  2FBX A;  2Q3S A;  3BGR A;  4DTN A;  1IKX A;  4E19 A;  1HYS A;  3G0Z A;  3ZT2 A;  1L3T A;  3OYF A;  1X9M A;  4CGI A;  3K59 A;  4PWD A;  3S9H A;  4CJU A;  3JYT A;  3V4I A;  3HVR A;  4J2D A;  4FJ5 A;  4BDZ A;  2A1S A;  3VQ4 A;  3KJV A;  4Z4C A;  1Q9X A;  3BDP A;  1VK0 A;  4OKK A;  4CHQ A;  1QSL A;  1WSG A;  2YNH A;  4CGD A;  3NH1 A;  1TK8 A;  2X78 A;  3CQ8 A;  1RT2 A;  1QTM A;  2RPI A;  3KLI A;  1FKP A;  3MXJ A;  3HT3 A;  5KGX A;  2YNI A;  1RTD A;  4CER A;  1LAW A;  1BIU A;  2X74 A;  3DYA A;  1RT3 A;  1XC9 A;  3SI6 A;  1JLB A;  3ZCM A;  3SUN A;  4M3R A;  3AVA A;  3I0S A;  3NF8 A;  4DTS A;  3PV8 A;  4FJJ A;  4JS4 A;  1UAX A;  2HB5 A;  2OPR A;  4DS5 A;  3P1G A;  3KD1 E;  4NYN A;  3K2P A;  3NBP A;  2Y1J A;  1RDB A;  3SUO A;  4FZX C;  3ZSY A;  4CK2 A;  3NDK A;  2P5O A;  1GOA A;  2BGG A;  4DQQ A;  1W9H A;  1CXQ A;  1WNS A;  1HPZ A;  5FDL A;  3ZSZ A;  4CFC A;  4OPK A;  4CFB A;  3OYE A;  4FW2 A;  4DTX A;  3PO5 A;  2KZZ A;  2D5R A;  4O55 A;  4OLA A;  3G10 A;  3RMA A;  4DSK A;  3QIP A;  5KRS A;  3RWU A;  2EX3 A;  2HVI A;  3MEG A;  3LZJ A;  4LSN A;  4W5Q A;  3OYC A;  1LWC A;  2G8H A;  4EZ9 A;  4FM2 A;  2XY6 A;  1LWF A;  2IS3 A;  1VSK A;  4KI4 A;  3AA2 A;  1TL3 A;  4CJF A;  4BAC A;  4FLT A;  4DWI A;  3IAY A;  4CGJ A;  1J53 A;  1C0M A;  4DF8 A;  4ID5 A;  4IKF A;  3DOL A;  3QIN A;  1BIS A;  2IOC A;  1X9W A;  3L2V A;  1RTH A;  3NHG A;  3C94 A;  4IG3 A;  2IAJ A;  3SZ2 A;  3AVJ A;  2HND A;  1ZBH A;  2XRI A;  1IKY A;  1VSJ A;  3T19 A;  1D5A A;  3LPT A;  2YKN A;  3AO3 A;  4DTP A;  4KB0 A;  3OS0 A;  5J2P A;  2BAN A;  1HNV A;  3VQ6 A;  1NK7 A;  4MFB A;  1TKX A;  5HRP A;  5J1E A;  1NKB A;  4B08 A;  2XY5 A;  1ZBF A;  3V9W A;  3AVK A;  4Z0U A;  4O4G A;  4HUE A;  2ZD1 A;  3T3F A;  1S1U A;  4CEF A;  4PQU A;  3K5O A;  3KLH A;  1JL2 A;  3OY9 A;  4FW1 A;  1KCF A;  1U47 A;  2GUI A;  1RT7 A;  3L3V A;  3AV9 A;  3SQ2 A;  3HVT A;  4LD0 A;  4AHC A;  3ZT1 A;  2DFH A;  3AVI A;  3HP6 A;  4CF2 A;  4HCB A;  4RW7 A;  1S6Q A;  3SPZ A;  5K14 A;  3VN5 A;  1TKD A;  2IDO A;  4C8K A;  1L3U A;  5KI6 A;  4DSJ A;  1UA0 A;  3KTQ A;  4KAZ A;  3AVN A;  4IDK A;  4CK1 A;  4FJ7 A;  1KLN A;  3SV4 A;  1EET A;  1IO2 A;  1RTI A;  3V9X A;  2HHS A;  1TAU A;  2O4G A;  3TAG A;  4N47 A;  3QNN A;  3SCX A;  3KKS A;  3QIO A;  3DLR A;  2YNG A;  3OYL A;  3KKR A;  3HL8 A;  2X6S A;  1U04 A;  1WSJ A;  2VWK A;  4I9Q A;  3DLE A;  3OYD A;  4M3W A;  3ZT4 A;  1RDA A;  4K8X A;  3OYG A;  3VA3 A;  1XI1 A;  1JLG A;  2KTQ A;  1B92 A;  2B6A A;  1EP4 A;  5C42 A;  2OZM A;  1BGX T;  3LP1 A;  1QQC A;  1Q8I A;  3NF7 A;  3QEI A;  5C24 A;  4FJH A;  4E7J A;  4N56 A;  4BWM A;  5KRT A;  4B9M A;  1A5W A;  4I2P A;  1VRT A;  4O5B A;  3NAE A;  4C8L A;  3HPO A;  5HRS A;  3QEP A;  4BDP A;  1C1A A;  4AIL C;  4CFA A;  1RBV A;  3OYN A;  4B9U A;  1WSE A;  3HYF A;  3P5J A;  5HLF A;  4CJQ A;  4EP5 A;  2HHQ A;  3A2F A;  5J2N A;  1L5U A;  4NCA A;  4HVJ A;  4GMJ B;  4B8C A;  1QSY A;  1JL1 A;  4CCH A;  4IFY A;  4FLU A;  1U49 A;  3DLB A;  4FLV A;  3OYJ A;  4F2S A;  3DLK A;  2Z1G A;  1KTQ A;  4B8A B;  2FBT A;  1IKW A;  1VSE A;  2GBZ A;  5SZT A;  3CFP A;  3OS2 A;  4E7I A;  3P83 D;  1QE1 A;  1S9E A;  4N76 A;  4KFB A;  3AO5 A;  1WSH A;  4Y1D A;  4DSI A;  2E6M A;  4DQI A;  2HMI A;  4O44 A;  4E89 A;  1BL3 A;  1RT4 A;  4NCB A;  2P5G A;  5FRM A;  4CF0 A;  3TAP A;  4F2R A;  3TI0 A;  2HVH A;  3U3G A;  5J2M A;  1TV6 A;  4C8N A;  3AVC A;  4FK4 A;  1KVB A;  3DMJ A;  3DLH A;  3QER A;  1BCO A;  5KGW A;  3ZSX A;  4Z4I A;  4DSF A;  1HRH A;  3TAM A;  3KK2 A;  1JXB A;  1WSF A;  3V9S A;  3OYM A;  3NH0 A;  2YKM A;  1KFS A;  1ZBU A;  4CJK A;  1IG9 A;  4JLH A;  2OPP A;  4FLW A;  4FJK A;  4KHY A;  4DQS A;  4FK0 A;  4OJR A;  1BQN A;  1RBT A;  3MXI A;  4HTU A;  4B3O A;  3LDS A;  4BE0 A;  1TKT A;  4CED A;  3PY8 A;  5FRN A;  3WNF A;  1A5X A;  3AVM A;  3TR8 A;  3WNG A;  4FXD A;  4KTZ A;  1T8E A;  1SKR A;  2F8S A;  4H8K A;  4DFK A;  4OVL A;  4QOZ B;  4W5N A;  3M8R A;  3PUF A;  3UIQ A;  1J9A A;  2BDP A;  1JLE A;  3DRP A;  4ZHR A;  3SPY A;  3SJJ A;  1LW0 A;  3K58 A;  3RR7 A;  4CGG A;  3OYH A;  4ZTF A;  4G1Q A;  1NJX A;  3ZSR A;  2HNY A;  4B9V A;  4CE9 A;  3NGI A;  5D3G A;  4UQG A;  3DRS A;  4CF9 A;  1NJZ A;  5I3U A;  3ZSQ A;  3ZSV A;  4BE2 A;  1NKE A;  2KFZ A;  2WON A;  5E41 A;  4PA1 A;  1SV5 A;  4JRP A;  4ELT A;  1QSS A;  2HHT A;  2IGI A;  2AJQ A;  3AO2 A;  1SL1 A;  2QXF A;  3LAN A;  3OVN A;  4RW9 A;  4RW8 A;  5JS2 A;  4FJG A;  3DOK A;  2HHU A;  4XIU A;  3SQ4 A;  2XHB A;  1Q9Y A;  3QEX A;  2VG7 A;  1S5J A;  3L8B A;  4CK3 A;  3L2W A;  1J5O A;  4CJS A;  1SKS A;  1CLQ A;  2VG6 A;  1O1W A;  3LAK A;  3NCI A;  4DTJ A;  4KTW A;  1WN7 A;  3PX4 A;  4E0D A;  5CY4 A;  1D8Y A;  1XHZ A;  1NK6 A;  3V1R A;  2OYQ A;  3HM9 A;  1SKW A;  4OGE A;  1UA1 A;  1YT3 A;  4DMN A;  3SV3 A;  4FJ9 A;  1CZB A;  3T1A A;  1NK9 A;  3TAR A;  2OZS A;  1RTJ A;  1VSM A;  2QKB A;  2ITG A;  4FVM A;  5I42 A;  1WAF A;  1RT1 A;  4RG8 A;  1DLO A;  2NUB A;  5CYM A;  3THV A;  4J2A A;  3HO1 A;  3L2Q A;  3KK3 A;  3I8D A;  1LAV A;  2E4L A;  3OYK A;  1QS4 A;  4CEE A;  1ZBL A;  3KLF A;  4DQR A;  1Y97 A;  4GVM A;  4YFU A;  5HBM A;  1LV5 A;  1N5Y A;  1RT5 A;  2KW4 A;  3D0P A;  1C1B A;  1DTQ A;  3OYA A;  3KLE A;  1QHT A;  4BWJ A;  4O0I A;  1N6Q A;  4FJL A;  3AO1 A;  4I9L A;  3VQ9 A;  4HCC A;  3LAL A;  1S9G A;  3S3N A;  3IG1 A;  4FK2 A;  5HRO A;  4OPJ A;  3AA4 A;  2R7Y A;  2QKK A;  2HW3 A;  3WNE A;  1LWE A;  3MAQ A;  4B9N A;  4CF1 A;  4CIF A;  4CEA A;  4FJM A;  1KLM A;  3OJU A;  3PX0 A;  4PY5 A;  2ATQ A;  2YHB A;  3ZT3 A;  3QEW A;  3OS1 A;  2FC0 A;  4DLE A;  2A1R A;  2PY5 A;  3CFR A;  4KHW A;  1REV A;  1Z26 A;  4GW6 A;  3SYZ A;  3HPH A;  5EU7 A;  3AA5 X;  3DM2 A;  3NH2 A;  3ALY A;  3QET A;  5J2Q A;  3ZT0 A;  3ULD A;  4NYF A;  3U3Y A;  2RKI A;  1XHX A;  4AHR A;  4Q5V A;  1NK4 A;  2XY7 A;  1BCM A;  2DFF A;  4OKJ A;  4AHU A;  4R5P A;  1SL2 A;  3MXM A;  2P1J A;  4DQP A;  4KTQ A;  1C6V A;  2PZS A;  1FKO A;  3AVF A;  1HYV A;  4CHY A;  4CF8 A;  1ZYQ A;  4DFJ A;  1WLJ A;  2HNZ A;  4CEO A;  1L3V A;  3AO4 A;  5CZ2 A;  1YTA A;  3CM5 A;  3LP2 A;  1JLQ A;  1W0H A;  3O3F A;  1R0A A;  4M3X A;  4E1M A;  4CHO A;  2HHV A;  3O4N A;  1S6P A;  4H4M A;  2JLE A;  1TK5 A;  5DK5 A;  1RT6 A;  3FFI A;  4ELV A;  4W5R A;  4PUO A;  4FZZ A;  1TKZ A;  4FJ8 A;  1RCH A;  5HP1 A;  3QO9 A;  4W5O A;  1JLC A;  1KRP A;  1VSF A;  3AVH A;  2ZQB A;  3O3H A;  5HRR A;  1D9D A;  3HPG A;  3RRH A;  4QCL A;  1FK9 A;  4DTO A;  1A5V A;  2EHG A;  2D0B A;  4CIG A;  3TAQ A;  1HJR A;  4ICL A;  4B9L A;  4CJV A;  2YV0 X;  3VQQ A;  4FJX A;  1TVR A;  1ITG A;  2VG5 A;  1X9S A;  1NK5 A;  4IFV A;  3DLG A;  4OGC A;  4F3O A;  2RN2 A;  2ETJ A;  3C6U A;  2X6N A;  2WOM A;  4FM0 A;  2JGU A;  2BE2 A;  4CFD A;  3LWL A;  3K5N A;  1U4B A;  4CEB A;  1BHL A;  1KVA A;  3AA3 A;  3LPU A;  4ZTJ A;  4CJT A;  4ELU A;  3H08 A;  3OJS A;  1RDC A;  3OYI A;  1SUQ A;  4DTM A;  2ZE2 A;  4BE1 A;  4I2Q A;  2D0C A;  3RTV A;  2YHA A;  4F8R A;  1ASV A;  3QNO A;  2O4I A;  2F8T A;  4B9S A;  4NCG A;  1VSH A;  4Y1C A;  3B6P A;  4KV8 A;  5CYQ A;  3IRX A;  1RIL A;  3SQ1 A;  3F73 A;  3ITH A;  1KFD A;  1UOC A;  2FBV A;  4DTR A;  3V1O A;  4KPY A;  3RRG A;  1S1V A;  4CJL A;  1CXU A;  4FCY A;  3MED A;  2HHX A;  3RR8 A;  2B5J A;  4KHN A;  1C1C A;  3CYM A;  1ASU A;  3KLG A;  1GOB A;  4H4O A;  2GV9 A;  3CFO A;  3VQ5 A;  3L3U A;  1HMV A;  5FRO A;  4CJ5 A;  3VQE A;  4HHT A;  4N5S A;  4DFM A;  1NJY A;  4CEQ A;  2FBY A;  3ZSW A;  5CZ1 A;  1TAQ A;  4ID1 A;  4Q0B A;  3SUQ A;  2KFN A;  3HP9 A;  3PO4 A;  4OLB A;  3JSM A;  4DU4 A;  1L3S A;  4BDY A;  2E6L A;  4JRQ A;  5SWM A;  3TAB A;  1ZBI A;  5JS1 A;  3NGZ A;  1BQM A;  3VQD A;  3K5L A;  4KB1 A;  2G8W A;  1JXE A;  4QAG A;  4TSX A;  4CHZ A;  1XWL A;  3NE6 A;  2Y1I A;  4M3T A;  4C8O A;  4YNQ A;  4W5T A;  3C6T A;  4E7K A;  1IH7 A;  1RDD A;  1NOZ A;  2B4J A;  3C95 A;  4CEZ A;  1EKE A;  1JLF A;  3AVB A;  2G8K A;  2DTU A;  1I3A A;  3DRR A;  3KIO A;  4E3S A;  3RMD A;  4J2B A;  4KO0 A;  1GOC A;  2G8U A;  4JS5 A;  1NK8 A;  3K5M A;  3O3G A;  1SL0 A;  1B9F A;  3M8S A;  4FYD A;  1S1X A;  3V9U A;  4DF4 A;  1U48 A;  1VSD A;  1C0U A;  4AHS A;  4FJN A;  1MU2 A;  2P51 A;  4DFP A;  1DTT A;  3K57 A;  4EZ6 A;  5T7B A;  2PYJ A;  1T03 A;  3F9K A;  3LWM A;  3M8Q A;  3TAF A;  4CGF A;  3SUP A;  4DU3 A;  2G8F A;  3RMB A;  3O4Q A;  3V1Q A;  4CGH A;  4LH4 A;  4IG0 A;  4LSL A;  4C8M A;  3VQB A;  3TAE A;  4F4K A;  4K8Z A;  1YTU A;  2G8I A;  3MEC A;  2KQ2 A;  1BI4 A;  4DG1 A;  4KRF A;  3NF9 A;  1EX4 A;  5DMR A;  3LZI A;  3AVG A;  2W42 A;  2G8V A;  4LH5 A;  2F96 A;  4DU1 A;  1T05 A;  1RBU A;  2HHW A;  2XO7 A;  4WE1 A;  4E7L A;  2Z1H A;  4CEC A;  5KTQ A;  4DSE A;  4M3U A;  3ASM A;  4FLY A;  1NKC A;  1KSP A;  4M3Y A;  4OKE A;  4E7H A;  1LW2 A;  2XY8 A;  2VWJ A;  1HQE A;  3PX6 A;  4Z4H A;  5HRN A;  1BIZ A;  1WAJ A;  3NGY A;  4FM1 A;  3U6F A;  5C25 A;  3TAN A;  1HNI A;  1RBS A;  1CZ9 A;  3RMC A;  4KI6 A;  4FZY A;  3E01 A;  4AHT A;  3EYZ A;  3HJF A;  3NFA A;  1S1T A;  1B9D A;  4KKO A;  3VA0 A;  3LAM A;  1NK0 A;  4KHU A;  2KZM A;  2Z1I A;  3DI6 A;  1VSL A;  2OPS A;  2DFE A;  3CG7 A;  1J54 A;  3ISN C;  3NF6 A;  4IBN A;  3OYB A;  4RW4 A;  4B9T A;  1JLA A;  4O0J A;  4CJ4 A;  4CIE A;  3HST B;  2IC3 A;  2I5J A;  4DTU A;  4KRE A;  4I7F A;  4CJ3 A; 
#chains in the Genus database with same CATH topology
 1JCF A;  4BVP A;  3IS9 A;  3R9P A;  4BC5 A;  4DV6 K;  2ASM A;  3ZSO A;  1JKH A;  4B1W B;  2OA8 A;  4AHV A;  3QEV A;  1T44 A;  2V7Z A;  4YOR A;  3HXM A;  4MO4 A;  4NO7 A;  5EXW A;  1G15 A;  1VRU A;  1TL1 A;  3CM6 A;  4Z4E A;  4Z4G A;  3HOT A;  5EVZ A;  3VQ7 A;  1D9F A;  2FSN A;  2PAV A;  4LY7 A;  1K6Y A;  3AVL A;  3QFU A;  4N41 A;  1RBR A;  1MWM A;  2E8A A;  2FSK A;  4K0K K;  1TK0 A;  1VQN N;  4JHD B;  4Z4F A;  4MQ3 A;  5CR4 A;  1IKV A;  3T69 A;  3MEE A;  3SQ0 A;  2GWK A;  3VQC A;  3E9L A;  4EP4 A;  3ZET A;  3VF2 A;  4CJR A;  4HUF A;  1F21 A;  4M42 A;  1BDG A;  1MWK A;  2Q31 A;  3S3O A;  2FBX A;  3BGR A;  5EOY A;  2ZM6 K;  1VQ4 N;  3G0Z A;  3P38 A;  2IVN A;  4CGI A;  4PWD A;  3V4I A;  3HVR A;  4FJ5 A;  5ADX A;  5FLX O;  3BDP A;  3WUH A;  4B1V A;  4IJA A;  1QSL A;  3DJC A;  4EIA A;  3IDH A;  2YNH A;  5F0X A;  4CGD A;  1BOT O;  3OW2 M;  3MCP A;  3MXJ A;  3PSF A;  5KGX A;  4XEI A;  1QQN A;  2YNI A;  4CER A;  5BR8 K;  1BIU A;  3DYA A;  3CET A;  3AAQ A;  3VEZ A;  2WFB A;  3TPQ A;  3ZCM A;  2NRT A;  4DTS A;  3B8A X;  2HB5 A;  4BRF A;  3KD1 E;  3ZX2 A;  2Y1J A;  4FZX C;  4M63 C;  1GOA A;  2BGG A;  1CXQ A;  3PO5 A;  4O55 A;  3A8Y A;  3QIP A;  4GY2 B;  3RWU A;  2HVI A;  3LZJ A;  4LSN A;  4W5Q A;  2G8H A;  2Q0U A;  2FF3 B;  4FM2 A;  4EZ9 A;  3NVM A;  3IAY A;  2FLO A;  1C0M A;  2IOC A;  3NHG A;  4IG3 A;  2IAJ A;  2D1K A;  4XH5 A;  5AQM A;  3MMV A;  3IMX A;  2P9S B;  1YHQ N;  2IVP A;  2XRI A;  3MN7 A;  3IUC A;  3UKR B;  4DTP A;  3CJ7 A;  4FWL A;  3OS0 A;  5J2P A;  5CE3 A;  3C7N B;  5A2Q O;  4MFB A;  3CQX A;  2XY5 A;  3AVK A;  4DHY A;  3E1Y A;  4H5W A;  3U9Z A;  1KCF A;  4FPA A;  1U47 A;  1NGA A;  3QFP A;  3LDP A;  4BRO A;  3RSE A;  4MDB A;  2DFH A;  3AVI A;  1S6Q A;  3SPZ A;  1TKD A;  2YHX A;  1NJI O;  4LFA K;  4IDK A;  4M7X A;  2P9P A;  3L4Q A;  1WBD A;  4BRN A;  1KQS M;  3LDQ A;  3HL8 A;  1U04 A;  4I9Q A;  3ZEU A;  4K8X A;  3ZET B;  2I7P A;  4LF7 K;  4K43 A;  2B6A A;  1QQC A;  4E7J A;  5M1P A;  4N56 A;  3P39 A;  4C8L A;  1VRT A;  3QEP A;  4FWN A;  1C1A A;  5EY4 A;  3HYF A;  5LY3 A;  3O9S A;  5HLF A;  2F4V K;  3QBX A;  3AGR A;  2HHQ A;  4JK9 A;  1N32 K;  4BRA A;  4IOX A;  4GMJ B;  4BY9 C;  4CZH A;  1QSY A;  3E9O A;  4FLV A;  4F2S A;  1T3V A;  3DLK A;  2Z1G A;  1KTQ A;  2FBT A;  3P4I A;  3CFP A;  2OTL N;  2VCP A;  4KFB A;  1WSH A;  4Y1D A;  2YX6 A;  2I7N A;  1RT4 A;  5C2D A;  2HVH A;  1J6Z A;  3TI0 A;  2ZWH A;  3U3G A;  1TV6 A;  3DXK B;  3A5M C;  4C8N A;  4FK4 A;  3DMJ A;  3DLH A;  4Z4I A;  1Q18 A;  1IG9 A;  1YIT N;  4FJK A;  4FK0 A;  3MXI A;  2Q1N A;  4B3O A;  4B9Q A;  1W97 L;  4K42 A;  3WNF A;  3AVM A;  1T8E A;  1ZXO A;  4GKK K;  3M8R A;  5BPM A;  4KHP K;  4ZHR A;  3E66 A;  3SPY A;  5AQL A;  3RR7 A;  3J8A A;  4PL8 A;  3OYH A;  2P9S A;  4CE9 A;  4JKG A;  1NJZ A;  5I3U A;  1NKE A;  5E41 A;  5LMU K;  4DV1 K;  3HM8 A;  3HTV A;  1WBB A;  5AFU H;  3LAN A;  4DV5 K;  2P9U A;  3BEX A;  1J5O A;  4Y0W A;  1CLQ A;  3NCI A;  5AQP A;  2O8C A;  3V1R A;  1SKW A;  2A42 A;  4DMN A;  2ITG A;  5I42 A;  3TU5 A;  5CYM A;  4HWI A;  3I8D A;  4CZL A;  3VEO A;  4CEE A;  1ZBL A;  5AQV A;  2Q2R A;  2GWJ A;  1N5Y A;  3D0P A;  1C1B A;  5AR0 A;  3G25 A;  4BWJ A;  4O0I A;  3AO1 A;  2QEX N;  1S9G A;  5HRO A;  1BA0 A;  3MAQ A;  4FJM A;  1KLM A;  3AAR A;  3ZT3 A;  4ILG B;  3CFR A;  1K8K B;  3O4W A;  4GW6 A;  2E88 A;  3AA5 X;  3NH2 A;  3QET A;  2A40 A;  3ULD A;  3QB0 A;  2YHY A;  4NYF A;  5BRD A;  1XHX A;  4AHR A;  4CZF A;  4BQL A;  4OKJ A;  2DFF A;  3K0S A;  3I33 A;  1M90 O;  2PZS A;  1T6C A;  3AVF A;  4DFJ A;  2HNZ A;  3LM9 A;  1LOT B;  4WF9 L;  1W0H A;  3O3F A;  3O4N A;  3H1Q A;  1FJG K;  3DXK A;  5M1Q A;  1W7A A;  1RT6 A;  1ATS A;  3FFI A;  4A61 A;  4FZZ A;  3FZK A;  1RCH A;  5BN9 A;  5HP1 A;  4BRC A;  4RWT A;  4JK8 A;  1JLC A;  1KRP A;  1VSF A;  4QCL A;  2ZQB A;  5HRR A;  3RRH A;  1S3X A;  5JIC A;  5BR9 A;  4CJV A;  2YV0 X;  3O8M A;  2VG5 A;  2VWB A;  1NK5 A;  3DLG A;  2QWQ A;  2RN2 A;  2ETJ A;  3C6U A;  4CFD A;  1U4B A;  1CZA N;  1BHL A;  3LPU A;  3T1Y K;  4ZTJ A;  4YY3 K;  3OJS A;  3OYI A;  5F1X A;  1SUQ A;  2A3Z A;  3FFK B;  4DTM A;  1HNX K;  4BE1 A;  4F8R A;  4B3M K;  1K8A O;  3EKS A;  5FPM A;  1HNZ K;  4B9S A;  3MX5 A;  3CCE N;  1RIL A;  2JWL A;  4JKD A;  3G71 N;  4JHD A;  4KPY A;  3TSQ A;  3RRG A;  2HHX A;  5AQN A;  3RR8 A;  3CMA N;  4FOI A;  2O8E A;  4JI5 K;  1HMV A;  5FRO A;  4HHT A;  4N5S A;  4AM7 A;  4DR4 K;  2FBY A;  3CI5 A;  1E4F T;  5AZJ A;  4Q0B A;  2O8D A;  4OLB A;  3JSM A;  4DKW A;  4IWV A;  3TAB A;  5SWM A;  1NMD A;  3K5L A;  4CHZ A;  3HZ6 A;  3NE6 A;  2Y1I A;  1XWL A;  4W5T A;  1RDD A;  4CEZ A;  1EKE A;  1JLF A;  1K9M O;  3AAP A;  3DRR A;  4J2B A;  4QS8 A;  4BRQ A;  3H6E A;  3J7Z O;  1NK8 A;  3UE5 A;  2ZGY A;  3K5M A;  1SL0 A;  4OO1 J;  5AQU A;  2FSJ A;  2UUA K;  1VSD A;  1C0U A;  4FO0 A;  3T1H K;  4FJN A;  1NGG A;  4MO5 A;  3F9M A;  3K57 A;  4EZ6 A;  3VEX A;  2PYJ A;  3LWM A;  3M8Q A;  4JYA K;  4DU3 A;  3O4Q A;  3VQB A;  4BRE A;  4K8Z A;  4DCH A;  3MEC A;  2ZJR L;  2KQ2 A;  3Q7B A;  4FWR A;  4DG1 A;  1DT9 A;  1IV0 A;  3NF9 A;  1VQO N;  3FLC O;  5DMR A;  3FE1 A;  4LF5 K;  2W42 A;  1RBU A;  2HHW A;  1XNQ K;  4OX9 K;  4CEC A;  5KTQ A;  4M3U A;  3ASM A;  3AY9 A;  4FLY A;  4JV5 K;  5HRN A;  3U6F A;  4KI6 A;  4AHT A;  3HJF A;  1IBK K;  1S1T A;  4DR3 K;  1WB9 A;  2Q0R A;  3VER A;  1VSL A;  2OPS A;  2DFE A;  3ISN C;  4IBN A;  4KRE A;  3FZM A;  4LF4 K;  4CJ3 A;  5TKW A;  4DR1 K;  2DY4 A;  2QWN A;  1OVY A;  4BRH A;  4EFH A;  4DSL A;  3QIC A;  1X1P A;  3L2U A;  1HYZ A;  1FXX A;  2P9N A;  1QHA A;  4M41 A;  1RNH A;  3VGM A;  2AP1 A;  1V4S A;  4DLG A;  4BR0 A;  4DS4 A;  3NMU A;  2CGL A;  1Q86 O;  2OPQ A;  2RF2 A;  3EL2 A;  4M3Z A;  3AGK A;  4JK7 A;  4IOC L;  4IO9 L;  1NOY A;  3CC2 N;  3A5N C;  3LL3 A;  2V51 B;  2E2P A;  1Z25 A;  3D2E A;  3O6W A;  3VQ8 A;  4C23 A;  2QWP A;  3D45 A;  1VQ5 N;  3ENB A;  4M45 A;  5C10 A;  2QW9 A;  3EZ5 A;  4FLZ A;  4YOX A;  2ITM A;  1WSI A;  2VQE K;  1ASW A;  4L8R B;  2O8B B;  3V6D A;  3WNH A;  4CJW A;  1IKX A;  5AZJ B;  4CD3 A;  4E19 A;  3OYF A;  1HKB A;  4CBW A;  3K59 A;  4CJU A;  3JYT A;  3VQ4 A;  1VK0 A;  1TK8 A;  1DEJ A;  1RT2 A;  1X3N A;  3KLI A;  1FKP A;  5AQO A;  5M1N A;  3HT3 A;  1FW6 A;  3SAF A;  2X74 A;  4AQY K;  3I0S A;  4FJJ A;  4DS5 A;  1KAZ A;  4WQ5 C;  2QA4 N;  3K2P A;  1SS6 A;  3SUO A;  3ZSY A;  3F5T A;  4CK2 A;  3GDQ A;  2ZJQ L;  3O9T A;  4OPK A;  3OYE A;  2D5R A;  2AA4 A;  4OLA A;  4JNE A;  4YOV A;  4DSK A;  4BGB A;  1LWC A;  3LDL A;  3CIP A;  3EZW A;  3D7E O;  3E9P A;  4A2A A;  3AA2 A;  1TL3 A;  4BAC A;  4FLT A;  1KC8 O;  4ID5 A;  2UUB K;  3QIN A;  3M1F A;  3L2V A;  3MCA B;  3SZ2 A;  4GV6 A;  3AVJ A;  4LF8 K;  4MLH A;  3VPZ A;  3T19 A;  1BWF O;  5HOO A;  4KB0 A;  2NRH A;  2E1Y A;  1HNV A;  5HRP A;  1NKB A;  4B08 A;  4IXC A;  4HUE A;  2P9N B;  2ZD1 A;  4H0V B;  3SMP A;  3A5O C;  3KLH A;  5ELZ A;  3EN9 A;  1J5E K;  4ISF A;  3L3V A;  3AV9 A;  1N8R O;  3SQ2 A;  4LD0 A;  4AHC A;  3ZT1 A;  1EO1 A;  3HP6 A;  2E2Q A;  3BF1 A;  3O08 A;  2HMP A;  4KAZ A;  4CK1 A;  5AQW A;  4BVO A;  3D2E B;  3EO3 A;  1RTI A;  1IO2 A;  3SV4 A;  4JI3 K;  2HHS A;  1TAU A;  2O4G A;  3TAG A;  3FZH A;  3KKS A;  3IFR A;  4FWM A;  1GLA G;  1YUW A;  3KKR A;  3ZYY X;  1WSJ A;  3OYG A;  3SMS A;  3VA3 A;  1JLG A;  3CCQ N;  1YJ9 N;  5KQD A;  1ZBS A;  1QZ5 A;  2OZM A;  3LP1 A;  4DR6 K;  1YJN N;  3CCR N;  3QEI A;  4FJH A;  1A5W A;  4I2P A;  1NGI A;  4O5B A;  4BG8 A;  4CZG A;  5HRS A;  2F9W A;  4BDP A;  1SQK A;  3THW B;  4B9U A;  3OYN A;  3P5J A;  3SAG A;  4RCH A;  3VEY A;  3O1W A;  1L5U A;  1NGH A;  4NCA A;  2HBL A;  4B8C A;  4IFY A;  4PKI A;  3DLB A;  4O8K A;  2UU9 K;  2GBZ A;  4E7I A;  4WQ4 A;  3ZEU B;  3AO5 A;  4KH4 A;  4E89 A;  4NCB A;  1YJW N;  2ASO A;  3BY5 A;  3V9S A;  4PL7 A;  2F9T A;  4JLH A;  3VTI A;  1KD1 O;  2OPP A;  4KHY A;  4DQS A;  4A59 A;  3CCM N;  5IWA K;  4CED A;  3PY8 A;  1Q81 O;  1N33 K;  3WNG A;  4OVL A;  4QOZ B;  4BRP A;  4BR2 A;  1JLE A;  3CJA A;  5GAG P;  4O8U A;  3K58 A;  3C0B A;  4H5V A;  4MDA A;  4ZTF A;  4CF9 A;  3ZSQ A;  2WON A;  5JLF A;  4PA1 A;  4ELT A;  3N4Q A;  5BRF A;  4JRP A;  3MDQ A;  2HHT A;  2NLX A;  1NBW A;  4RW8 A;  2HHU A;  3DOK A;  5HL7 L;  4XIU A;  3SQ4 A;  2XHB A;  1S5J A;  1KAX A;  3SBT A;  1O1W A;  1VQ8 N;  3CCL N;  4E0D A;  1NK6 A;  1GLB G;  3HM9 A;  3L0Q A;  2O8D B;  1UA1 A;  4FJ9 A;  1CZB A;  3T1A A;  5M1K A;  2QM1 A;  2YI1 A;  3TAR A;  2O8E B;  1VSM A;  2A41 A;  4FVM A;  1WAF A;  4RG8 A;  4J2A A;  2WC9 A;  3HO1 A;  3L2Q A;  3KK3 A;  1VHX A;  3KLF A;  4DQR A;  3HOS A;  3QBW A;  4CBX A;  5CHI A;  4WYB A;  3MWT A;  4HTL A;  3CC4 N;  4FOE A;  3VQ9 A;  1E4G T;  3UKU B;  2R7Y A;  2HW3 A;  1LWE A;  1NGJ A;  4B9N A;  2HBM A;  2NRZ A;  3MN9 A;  4CI6 A;  5AQR A;  4CIF A;  1U6Z A;  2ATQ A;  2YHB A;  3OS1 A;  2FC0 A;  4DLE A;  2A1R A;  2CGK A;  1Z26 A;  3PIP L;  3SYZ A;  2WTU A;  3CXC M;  5J2Q A;  2QWR A;  4WFN L;  4CZM A;  4Q5V A;  2HST A;  1NK4 A;  4R5P A;  2DPN A;  2P1J A;  4DQP A;  1C6V A;  1ZYQ A;  3DWL A;  3ATU A;  4CEO A;  1L3V A;  2V7Y A;  5CZ2 A;  1JLQ A;  3J81 O;  4E1M A;  4H4M A;  4W5R A;  4FJ8 A;  4B1Z A;  3QO9 A;  4KH6 A;  3AVH A;  3GG4 A;  3O3H A;  2QWO A;  2EHG A;  2D0B A;  3TAQ A;  2UXB K;  1HJR A;  2UYT A;  1TVR A;  1HKG A;  2JWK A;  4F3O A;  4IFV A;  3ENH A;  4OGC A;  2WOM A;  2JGU A;  2D0P A;  1TUY A;  3AA3 A;  4ELU A;  4CJT A;  3H08 A;  1TUU A;  1RDC A;  3O9Q A;  5AQS A;  2ZE2 A;  1HUX A;  3IKM A;  1E3M A;  2EWS A;  3H1V X;  2F8S A;  4NCG A;  1VSH A;  3IRX A;  3CD6 N;  3F73 A;  3R6M A;  1RGI A;  3V1O A;  5AQZ A;  1CXU A;  3MED A;  4KHN A;  2Q97 A;  1ASU A;  3KLG A;  2NRV A;  4H4O A;  5ADX H;  4NXN K;  3L3U A;  4DFM A;  3O9U A;  4LFB K;  1NJY A;  4CEQ A;  1VQ9 N;  4PKG A;  4JI8 K;  2GEM A;  5CZ1 A;  4KH5 A;  5AQI A;  3PO4 A;  4LF6 K;  1L3S A;  4BDY A;  5LJV A;  3NGZ A;  1BQM A;  4CD1 A;  4C8O A;  4YNQ A;  1S72 N;  4E7K A;  3C95 A;  3ULE B;  1MDU B;  3MX2 A;  4XH4 A;  1B9F A;  3M8S A;  4FYD A;  4JKA A;  2P9L B;  4AHS A;  4JD2 A;  3UB5 A;  1T03 A;  3CF5 L;  3VF4 A;  3FZF A;  4X66 K;  4CGF A;  3RMB A;  1ATR A;  2ZF5 O;  4IG0 A;  4C8M A;  1U2V A;  2E20 A;  1BI4 A;  4JI1 K;  3LZI A;  1OKJ A;  3MN6 A;  4LH5 A;  1Z6R A;  2F96 A;  2FXU A;  3FGU A;  4WE1 A;  3WT0 A;  2Z1H A;  4BRD A;  1NKC A;  2XY8 A;  1RDW X;  2OAN A;  2VWJ A;  4Z4H A;  3ZLJ A;  4ILH A;  4JI7 K;  1CZ9 A;  4FZY A;  3EYZ A;  3NFA A;  5JVH L;  4KKO A;  3DI6 A;  3CG7 A;  1J54 A;  1QZ6 A;  3OHR A;  4DTU A;  3EKU A;  2IC3 A;  1QQO A;  5M1F A;  4I7F A;  3MXM A;  3TWH A;  4A2B A;  3HK2 A;  4YOT A;  1ESV A;  3W0L A;  3SNN A;  2GEL A;  3LDN A;  4AH9 A;  4WQ5 A;  4FJI A;  4H0P A;  3CJ9 A;  3QES A;  3LP3 A;  3S41 A;  1V4T A;  3V81 A;  4CZE A;  3EY1 A;  4DR5 K;  3BF3 A;  4HUG A;  3QLH A;  1KVC A;  1LCU A;  2QK9 A;  1YVU A;  3Q7C A;  4JAX A;  3B6O A;  4NLC A;  2VQF K;  3VQA A;  3K9K A;  3I0R A;  5BPN A;  1HNW K;  1ILY A;  1VSI A;  3VES A;  1U45 A;  4CJE A;  5AZI B;  3M8P A;  4IDH A;  4O5F A;  5F2R A;  1XNR K;  2YNF A;  1G99 A;  3T7Z A;  3C6A A;  5AQT A;  1NLV A;  1UWB A;  1OVQ A;  3SJH A;  1VQL N;  3LDO A;  1HYS A;  1L3T A;  1X9M A;  3S9H A;  5LMN K;  4IOA L;  3M6G A;  5KQ8 A;  2A1S A;  3KJV A;  4EHT A;  4Z4C A;  1GLJ O;  3J80 O;  4OKK A;  1KXP A;  4CHQ A;  3THY A;  1WSG A;  1GLC G;  2X78 A;  3CQ8 A;  1QTM A;  2QI2 A;  5AQG A;  2A6A A;  1RT3 A;  1I94 K;  3SI6 A;  4DV3 K;  1SZ2 A;  3SUN A;  3AVA A;  1Q7Y O;  3P1G A;  4J8F A;  3NBP A;  3NDK A;  2P5O A;  2W40 A;  1NGC A;  4BRM A;  1WNS A;  1HPZ A;  4CFB A;  3NVK A;  4FW2 A;  4DTX A;  2KZZ A;  2P9K A;  3G10 A;  1M1K O;  5DM6 L;  3MEG A;  3ATV A;  2CGJ A;  3D6R A;  2XY6 A;  1O13 A;  2IS3 A;  1VSK A;  5AQX A;  4KI4 A;  4CJF A;  4DWI A;  4CGJ A;  4DF8 A;  3DOL A;  3TTC A;  1BIS A;  3I55 N;  3C94 A;  3SLC A;  2HND A;  3BUZ B;  1ZBH A;  1HKC A;  1IKY A;  3LPT A;  5GAD P;  4BG9 A;  2YKN A;  3AO3 A;  3JAM O;  2BAN A;  3VQ6 A;  4IJN A;  3U4L A;  4B3T K;  4Z0U A;  3O9R A;  4O4G A;  1HJO A;  4PQU A;  4DV4 K;  1VQK N;  3O80 A;  4LF9 K;  3OY9 A;  4FW1 A;  2FF6 A;  2GUI A;  4JKH A;  1RT7 A;  3TSP A;  3C65 A;  3HVT A;  4DR7 K;  4HCB A;  4RTF D;  4QS9 A;  5K14 A;  3VN5 A;  2OTJ N;  4DQ8 A;  1L3U A;  4DSJ A;  3KTQ A;  2UXD K;  3W3D A;  4FJ7 A;  1KLN A;  5C0Y A;  1EET A;  4BR5 A;  3FR0 A;  3BP8 A;  3QNN A;  4JKC A;  3QIO A;  2YNG A;  4CBU A;  2GUP A;  4K41 A;  3CC7 N;  3DLE A;  3OYD A;  4M3W A;  1EWQ A;  3ZT4 A;  1RDA A;  3PSI A;  2KTQ A;  3EE9 A;  1EP4 A;  5C42 A;  3R3L A;  5FPD A;  1Q8I A;  5C24 A;  5KRT A;  3NAE A;  3HPO A;  4AIL C;  4CFA A;  1RBV A;  1WSE A;  4ILJ A;  3A2F A;  4BC4 A;  3THY B;  2IVO A;  4HVJ A;  4CCH A;  3GL1 A;  2ZGZ A;  4FLU A;  3OYJ A;  1RFQ A;  4PHT X;  1IKW A;  1X3M A;  5SZT A;  3OS2 A;  2YJF A;  1QE1 A;  1S9E A;  4PKH A;  4BC2 A;  1K8K A;  2HF4 A;  2E6M A;  4H0X B;  4JKB A;  5FPE A;  2HMI A;  1BL3 A;  3CJC A;  3OBW A;  4BR9 A;  2UXC K;  4F2R A;  5J2M A;  3AVC A;  3QER A;  1BCO A;  5KGW A;  3ZSX A;  4DSF A;  1JXB A;  3OYM A;  1KFS A;  3THW A;  4OJR A;  1NGF A;  1BQN A;  1RBT A;  3LDS A;  4BE0 A;  2P9I A;  5FRN A;  1A5X A;  3TR8 A;  1ZC6 A;  1SKR A;  4H8K A;  3MN5 A;  3UIQ A;  2BDP A;  3SJJ A;  4CGG A;  4A5B A;  3ZSR A;  5D3G A;  4B9V A;  3DRS A;  1QVF M;  3ZSV A;  2KFZ A;  4DB3 A;  1SV5 A;  3WEE A;  1QSS A;  3H3O B;  2IGI A;  2AJQ A;  3AO2 A;  3ZX3 A;  2F7T A;  3WXJ A;  1MA9 B;  5JS2 A;  5M1O A;  3VEV A;  1SAZ A;  2O8F A;  2VG7 A;  4FWO A;  3L8B A;  4CK3 A;  3KHY A;  4CJS A;  2VG6 A;  3LAK A;  4DTJ A;  1WN7 A;  1WOQ A;  3PX4 A;  5CY4 A;  1XHZ A;  2KKZ A;  5C15 A;  1YT3 A;  1BUP A;  3SV3 A;  5AQJ A;  1NK9 A;  5BN8 A;  2OZS A;  2QKB A;  5GIO A;  4H0Y B;  4A5A A;  2BTF A;  4IEI A;  4EAH D;  3U9D A;  3CQY A;  3ULE A;  4YFU A;  1LV5 A;  4BRG A;  2KW4 A;  3I8B A;  3KLE A;  1N6Q A;  4FJL A;  2KLA A;  3QML A;  1VQ7 N;  3DXM B;  3LAL A;  4FK2 A;  4IO8 A;  3AA4 A;  4OPJ A;  4GNI A;  3WNE A;  4CF1 A;  4CEA A;  3OBY A;  3OJU A;  4PY5 A;  5I9E B;  4BRL A;  2PY5 A;  1NGB A;  2ASP A;  4BR7 A;  3HPH A;  5EU7 A;  4BC3 A;  3DM2 A;  5BPL A;  3FZL A;  1YF5 L;  4WQ4 C;  5AQH A;  4CVN E;  3WQT A;  2RKI A;  3EEQ A;  4IEE A;  1BCM A;  1SL2 A;  1IJJ A;  5MLC Q;  1FKO A;  3J7Y P;  1HYV A;  4CF8 A;  1WLJ A;  3AO4 A;  1YTA A;  3VET A;  4B3R K;  4M3X A;  1VQM N;  4CHO A;  5B8H A;  3DAW A;  4E1J A;  1S6P A;  1BA1 A;  2VGN A;  3CPW M;  5DK5 A;  3SBG A;  4C1N K;  4W5O A;  2W41 A;  1D9D A;  1FK9 A;  4DTO A;  1A5V A;  4ICL A;  4FJX A;  2NNW A;  1X9S A;  1QVG M;  4CZK A;  2ZJP L;  4FM0 A;  2BE2 A;  3LWL A;  4JEP A;  1KVA A;  2YCH A;  4A57 A;  4BRI A;  3KZB A;  3G4S N;  2D0C A;  3RTV A;  1ASV A;  3QNO A;  3L6Q A;  3ZX0 A;  2F8T A;  3SQ1 A;  4OPA A;  2BH1 A;  4KV8 A;  5CYQ A;  2NRR A;  1RDU A;  3ITH A;  1UOC A;  2FBV A;  4DTR A;  4CJL A;  4YHH K;  4FCY A;  4AF1 A;  2B5J A;  3CYM A;  2RE2 A;  4B3S K;  1GOB A;  5TKY A;  2GV9 A;  4CJ5 A;  4JI2 K;  5FPN A;  4CZI A;  1TAQ A;  3F2K A;  1YAG A;  3SUQ A;  3HP9 A;  2W6L A;  4JRQ A;  1ZBI A;  5JS1 A;  5AZI A;  4NLB A;  3VQD A;  4KB1 A;  1JXE A;  4QAG A;  1Y64 A;  3D2F B;  4TSX A;  3C6T A;  1IH7 A;  1NOZ A;  2B4J A;  4YOW A;  2G8K A;  1I3A A;  3RMD A;  3KIO A;  4E3S A;  2E2O A;  3VEN A;  3THX B;  3GBT A;  4KO0 A;  1GOC A;  4L3Q A;  4JS5 A;  1T6D A;  3O3G A;  3RSE B;  1S1X A;  4DF4 A;  1U48 A;  3RVC A;  3M5R A;  1NGE A;  4DFP A;  2P9I B;  3CME N;  4F4K A;  2G8I A;  1YTU A;  1BG3 A;  3HSC A;  4KBO A;  2J4R A;  4I6M A;  4KRF A;  3AVG A;  2G8V A;  4DU1 A;  1T05 A;  4WCE L;  2NRW A;  4DSE A;  2QWL A;  4C1N I;  1LW2 A;  4DV7 K;  1NU0 A;  1X9J A;  1WAJ A;  3NGY A;  3SK3 A;  3CCS N;  1HNI A;  2P9K B;  1HLU A;  5BRE A;  2KZM A;  1HX1 A;  2HOE A;  1XC3 A;  3OYB A;  4MLE A;  1P8Z A;  3BZC A;  3NF6 A;  3CCV N;  4B9T A;  1JLA A;  4O0J A;  4CJ4 A;  4E7H A;  3C6H A;  2LSN A;  1BI4 B;  3VQP A;  1T7P A;  3BZK A;  3A5L C;  3V9Z A;  4F3T A;  1NGD A;  2PYL A;  1S1W A;  4U7B A;  2WBN A;  3ID6 A;  3LP0 A;  4E1N A;  2QXL A;  1HQU A;  3KK1 A;  1NJW A;  1C0T A;  1OH8 A;  2NZT A;  4U67 L;  4RW6 A;  4KHQ A;  4H0O A;  5KPZ A;  1XMQ K;  4CHP A;  4FPB A;  4CJP A;  3KD5 E;  4J2E A;  1EXQ A;  3ENO A;  4NXM K;  2YHW A;  2Z1J A;  1TGO A;  4A62 A;  4CHN A;  3CJ1 A;  4CES A;  4JI0 K;  3S3M A;  4KHS A;  4FL9 A;  2E1Z A;  2HF3 A;  3TTF A;  1I39 A;  4WFB L;  4XH1 A;  3O1B A;  3KK7 A;  2D0A A;  3L2R A;  4FLX A;  2Q3S A;  4DTN A;  5AFU A;  3ZT2 A;  1P90 A;  4YDU A;  3WXI A;  3QDK A;  4J2D A;  4BDZ A;  3CJB A;  1Q9X A;  2HBK A;  1N36 K;  3WQU A;  3OTO K;  3NH1 A;  4M7Y A;  2RPI A;  1EWR A;  1RTD A;  1LAW A;  1XC9 A;  1JLB A;  4BRK A;  4M3R A;  3NF8 A;  2NRX A;  3PV8 A;  4JS4 A;  1UAX A;  2OPR A;  1YXQ A;  2O8B A;  4NYN A;  3TTD A;  1RDB A;  1YIJ N;  4DR2 K;  4FWK A;  4DV2 K;  1OH5 A;  4DQQ A;  1W9H A;  5FDL A;  4CFC A;  3ZSZ A;  2A5X A;  3RMA A;  5KRS A;  2EX3 A;  3OYC A;  2IIR A;  2W6K A;  2YJE A;  1LWF A;  4YOY A;  1J53 A;  4IKF A;  1X9W A;  3JXU A;  1RTH A;  4JKF A;  4WFA L;  4DV0 K;  1VSJ A;  1D5A A;  5GIP A;  1K73 O;  4AM6 A;  1NK7 A;  1TKX A;  1DGK N;  5J1E A;  1IBL K;  1BO5 O;  5GAH P;  1ZBF A;  3V9W A;  3T3F A;  1S1U A;  4CEF A;  3K5O A;  1YVN A;  1JL2 A;  4Z94 A;  1VQP N;  3WXL A;  1NNE A;  2V52 B;  3R8E A;  4CF2 A;  4RW7 A;  2IDO A;  4C8K A;  5KI6 A;  1UA0 A;  3CCJ N;  1GLF O;  3AVN A;  3VOV A;  5KPT A;  3V9X A;  4N47 A;  2PBD A;  3DLL L;  3SCX A;  3DLR A;  3OYL A;  3WXK A;  2X6S A;  4BR4 A;  2VWK A;  2BUP A;  3DXM A;  1XI1 A;  1B92 A;  1BGX T;  4JI4 K;  3NF7 A;  1D4X A;  3CER A;  4BWM A;  3LM2 A;  4B9M A;  4FWS A;  4X65 K;  3GOI A;  1R59 O;  4CJQ A;  4EP5 A;  4CJ7 A;  5J2N A;  1IBM K;  1JL1 A;  4IFE A;  3O5B A;  1U49 A;  2HBJ A;  4B8A B;  5C2F A;  1VSE A;  3KWI A;  3P83 D;  1EQY A;  4N76 A;  4DSI A;  4CW7 B;  1S22 A;  4GV3 A;  4DQI A;  4O44 A;  4FWQ A;  3VGL A;  4JKG B;  2P5G A;  5FRM A;  5AJ3 K;  4CF0 A;  3TAP A;  3VMF B;  1KVB A;  1HRH A;  3TAM A;  3KK2 A;  1WSF A;  3NH0 A;  2YKM A;  4H0T B;  2E5L K;  3KVG A;  1ZBU A;  4CJK A;  4FLW A;  3CPE A;  5GIN A;  3K9J A;  1N34 K;  1Z05 A;  4HTU A;  1TKT A;  5LJW A;  2H3G X;  2QTD A;  3OA9 A;  1GLE G;  4H03 B;  3PIO L;  4FXD A;  4KTZ A;  4DFK A;  4W5N A;  3PUF A;  1J9A A;  4LC9 B;  3DRP A;  5AQY A;  1H1V A;  2GTD A;  1LW0 A;  4G1Q A;  1NJX A;  2HNY A;  3NGI A;  4UQG A;  2GX9 A;  3U8X A;  3UKR A;  4BE2 A;  2D0O A;  4X62 K;  4H5T A;  3C7N A;  1SL1 A;  2QXF A;  4UY8 O;  2RHK A;  3OVN A;  4RW9 A;  4JKE A;  4FJG A;  4DUZ K;  1Q9Y A;  3QEX A;  3L2W A;  1SKS A;  4KTW A;  1D8Y A;  2OYQ A;  4OGE A;  5E84 A;  4G9Z A;  1XUP O;  1RTJ A;  1OH7 A;  1RT1 A;  3THV A;  1DLO A;  2NUB A;  3M3Z A;  4OPH A;  5BRH A;  1LAV A;  2E4L A;  3OYK A;  1QS4 A;  4R79 A;  5GAE P;  1Y97 A;  4GVM A;  5HBM A;  4BQZ A;  1WUA A;  3THX A;  1RT5 A;  1VAZ A;  3WEE B;  2OCE A;  1DTQ A;  4H5R A;  3OYA A;  1C0G A;  1QHT A;  1Q82 O;  4I9L A;  4HCC A;  5JVG L;  1W2B M;  3S3N A;  3IG1 A;  3MK6 A;  2WUS A;  2O8F B;  2QKK A;  3I56 N;  3HRG A;  3JS6 A;  5H1S Q;  3EE8 A;  5AQK A;  4X64 K;  3CCU N;  1TYQ B;  1NG9 A;  3PX0 A;  3QEW A;  2P9L A;  4KHW A;  1REV A;  1GLL O;  4B1Y B;  3ALY A;  3H3N O;  4V19 S;  3ZT0 A;  3U3Y A;  2XY7 A;  4AHU A;  4YDU C;  4KTQ A;  4JN4 A;  4CHY A;  4I6M B;  3ID8 A;  3CM5 A;  1DKG D;  3LP2 A;  1R0A A;  2HHV A;  4GVE A;  5JMV A;  3UKU A;  2JLE A;  3H46 O;  3TSU A;  4DUY K;  1TK5 A;  3J7A P;  4ELV A;  1ATN A;  4PUO A;  1TKZ A;  2D4W A;  3VGK A;  4H5N A;  2CH5 A;  3HPG A;  4CIG A;  4B9L A;  3P31 A;  3A0I X;  4IZ9 A;  3VQQ A;  1HPM A;  1ITG A;  2X6N A;  4FSV A;  3CHW A;  4B1X B;  3K5N A;  4QS7 A;  4CEB A;  5DM7 L;  3PLA A;  1OH6 A;  3HI0 A;  4I2Q A;  3L4I A;  1XQS C;  2P9U B;  2YHA A;  5IT9 O;  2O4I A;  4Y1C A;  3B6P A;  4JI6 K;  1JJ2 M;  1KFD A;  4K25 A;  1HR0 K;  1S1V A;  2QWM A;  4GV9 A;  1VQ6 N;  1NM1 A;  1QQM A;  3H45 C;  5EX5 A;  4EHU A;  1C1C A;  1IG8 A;  2UUC K;  3CFO A;  2HHH K;  2VYP A;  3VQ5 A;  3VQE A;  1NMN A;  2Q36 A;  3ZSW A;  2O8C B;  1NWK A;  4CZJ A;  4ID1 A;  4F9O A;  3VEW A;  2KFN A;  1U2V B;  3VTH A;  4DU4 A;  2E6L A;  2VGM A;  4GKJ K;  2G8W A;  4B1U B;  3R1X A;  4M3T A;  5E26 A;  3N4P A;  1XMO K;  3G6E N;  3SAH A;  3AVB A;  2DTU A;  2G8U A;  3V9U A;  4FWP A;  5AQQ A;  1MU2 A;  2P51 A;  4LFC K;  1DTT A;  2KHO A;  5T7B A;  1YI2 N;  3F9K A;  3HBT A;  4BGA A;  3WXM B;  3TAF A;  3GE1 A;  3SUP A;  4FVU A;  2PFU A;  2P9P B;  5LL6 Z;  2G8F A;  1KAY A;  3V1Q A;  1TYQ A;  4CGH A;  4LH4 A;  4LSL A;  4NB4 A;  3TAE A;  1JCG A;  1GLD G;  4YOU A;  1EX4 A;  3D2F A;  2XO7 A;  4E7L A;  1KSP A;  4M3Y A;  4OKE A;  1HQE A;  4ISG A;  3PX6 A;  1BIZ A;  4FM1 A;  5C25 A;  3VF6 A;  3TAN A;  1RBS A;  1BU6 O;  3RMC A;  3E01 A;  5C12 A;  4JD2 B;  1JCE A;  1B9D A;  5KPR A;  3VA0 A;  3LAM A;  1NK0 A;  4KHU A;  2Z1I A;  2CH6 A;  4ISE A;  2E2N A;  1C0F A;  3KWG A;  5AQF A;  4RW4 A;  5JLH A;  4CIE A;  3HST B;  2I5J A;  3MWP A; 
#chains in the Genus database with same CATH homology
 3TWH A;  3HK2 A;  2DY4 A;  2LSN A;  1BI4 B;  3IS9 A;  4DSL A;  3VQP A;  1T7P A;  1X1P A;  3SNN A;  3L2U A;  3ZSO A;  1HYZ A;  3V9Z A;  4F3T A;  1FXX A;  1JKH A;  2OA8 A;  4M41 A;  2PYL A;  4AH9 A;  1S1W A;  4FJI A;  4AHV A;  3QES A;  3QEV A;  1RNH A;  3LP3 A;  4DLG A;  3LP0 A;  4E1N A;  3HXM A;  3V81 A;  1HQU A;  1G15 A;  1VRU A;  3EY1 A;  1TL1 A;  3CM6 A;  4HUG A;  4DS4 A;  4Z4E A;  2OPQ A;  2RF2 A;  3QLH A;  3KK1 A;  4Z4G A;  1KVC A;  4M3Z A;  3VQ7 A;  1NJW A;  1D9F A;  1NOY A;  1C0T A;  4LY7 A;  2QK9 A;  1K6Y A;  4RW6 A;  1YVU A;  4KHQ A;  3AVL A;  4N41 A;  1RBR A;  1Z25 A;  3B6O A;  4CHP A;  3VQ8 A;  4CJP A;  3D45 A;  1TK0 A;  3VQA A;  3KD5 E;  4J2E A;  1EXQ A;  4CHN A;  3I0R A;  2Z1J A;  1TGO A;  4Z4F A;  4MQ3 A;  1VSI A;  4M45 A;  4CES A;  1IKV A;  3S3M A;  1U45 A;  4KHS A;  4CJE A;  3EZ5 A;  4FLZ A;  3MEE A;  3SQ0 A;  3M8P A;  1WSI A;  3VQC A;  1I39 A;  4EP4 A;  4CJR A;  4HUF A;  4M42 A;  1F21 A;  2YNF A;  1ASW A;  4L8R B;  2D0A A;  3L2R A;  3V6D A;  3S3O A;  3WNH A;  4CJW A;  1UWB A;  4FLX A;  2FBX A;  2Q3S A;  3BGR A;  4DTN A;  1IKX A;  4E19 A;  1HYS A;  3G0Z A;  3ZT2 A;  1L3T A;  3OYF A;  1X9M A;  4CGI A;  3K59 A;  4PWD A;  3S9H A;  4CJU A;  3JYT A;  3V4I A;  3HVR A;  4J2D A;  4FJ5 A;  4BDZ A;  2A1S A;  3VQ4 A;  3KJV A;  4Z4C A;  1Q9X A;  3BDP A;  1VK0 A;  4OKK A;  4CHQ A;  1QSL A;  1WSG A;  2YNH A;  4CGD A;  3NH1 A;  1TK8 A;  2X78 A;  3CQ8 A;  1RT2 A;  1QTM A;  2RPI A;  3KLI A;  1FKP A;  3MXJ A;  3HT3 A;  5KGX A;  2YNI A;  1RTD A;  4CER A;  1LAW A;  1BIU A;  2X74 A;  3DYA A;  1RT3 A;  1XC9 A;  3SI6 A;  1JLB A;  3ZCM A;  3SUN A;  4M3R A;  3AVA A;  3I0S A;  3NF8 A;  4DTS A;  3PV8 A;  4FJJ A;  4JS4 A;  1UAX A;  2HB5 A;  2OPR A;  4DS5 A;  3P1G A;  3KD1 E;  4NYN A;  3K2P A;  3NBP A;  2Y1J A;  1RDB A;  3SUO A;  4FZX C;  3ZSY A;  4CK2 A;  3NDK A;  2P5O A;  1GOA A;  2BGG A;  4DQQ A;  1W9H A;  1CXQ A;  1WNS A;  1HPZ A;  5FDL A;  3ZSZ A;  4CFC A;  4OPK A;  4CFB A;  3OYE A;  4FW2 A;  4DTX A;  3PO5 A;  2KZZ A;  2D5R A;  4O55 A;  4OLA A;  3G10 A;  3RMA A;  4DSK A;  3QIP A;  5KRS A;  3RWU A;  2EX3 A;  2HVI A;  3MEG A;  3LZJ A;  4LSN A;  4W5Q A;  3OYC A;  1LWC A;  2G8H A;  4EZ9 A;  4FM2 A;  2XY6 A;  1LWF A;  2IS3 A;  1VSK A;  4KI4 A;  3AA2 A;  1TL3 A;  4CJF A;  4BAC A;  4FLT A;  4DWI A;  3IAY A;  4CGJ A;  1J53 A;  1C0M A;  4DF8 A;  4ID5 A;  4IKF A;  3DOL A;  3QIN A;  1BIS A;  2IOC A;  1X9W A;  3L2V A;  1RTH A;  3NHG A;  3C94 A;  4IG3 A;  2IAJ A;  3SZ2 A;  3AVJ A;  2HND A;  1ZBH A;  2XRI A;  1IKY A;  1VSJ A;  3T19 A;  1D5A A;  3LPT A;  2YKN A;  3AO3 A;  4DTP A;  4KB0 A;  3OS0 A;  5J2P A;  2BAN A;  1HNV A;  3VQ6 A;  1NK7 A;  4MFB A;  1TKX A;  5HRP A;  5J1E A;  1NKB A;  4B08 A;  2XY5 A;  1ZBF A;  3V9W A;  3AVK A;  4Z0U A;  4O4G A;  4HUE A;  2ZD1 A;  3T3F A;  1S1U A;  4CEF A;  4PQU A;  3K5O A;  3KLH A;  1JL2 A;  3OY9 A;  4FW1 A;  1KCF A;  1U47 A;  2GUI A;  1RT7 A;  3L3V A;  3AV9 A;  3SQ2 A;  3HVT A;  4LD0 A;  4AHC A;  3ZT1 A;  2DFH A;  3AVI A;  3HP6 A;  4CF2 A;  4HCB A;  4RW7 A;  1S6Q A;  3SPZ A;  5K14 A;  3VN5 A;  1TKD A;  2IDO A;  4C8K A;  1L3U A;  5KI6 A;  4DSJ A;  1UA0 A;  3KTQ A;  4KAZ A;  3AVN A;  4IDK A;  4CK1 A;  4FJ7 A;  1KLN A;  3SV4 A;  1EET A;  1IO2 A;  1RTI A;  3V9X A;  2HHS A;  1TAU A;  2O4G A;  3TAG A;  4N47 A;  3QNN A;  3SCX A;  3KKS A;  3QIO A;  3DLR A;  2YNG A;  3OYL A;  3KKR A;  3HL8 A;  2X6S A;  1U04 A;  1WSJ A;  2VWK A;  4I9Q A;  3DLE A;  3OYD A;  4M3W A;  3ZT4 A;  1RDA A;  4K8X A;  3OYG A;  3VA3 A;  1XI1 A;  1JLG A;  2KTQ A;  1B92 A;  2B6A A;  1EP4 A;  5C42 A;  2OZM A;  1BGX T;  3LP1 A;  1QQC A;  1Q8I A;  3NF7 A;  3QEI A;  5C24 A;  4FJH A;  4E7J A;  4N56 A;  4BWM A;  5KRT A;  4B9M A;  1A5W A;  4I2P A;  1VRT A;  4O5B A;  3NAE A;  4C8L A;  3HPO A;  5HRS A;  3QEP A;  4BDP A;  1C1A A;  4AIL C;  4CFA A;  1RBV A;  3OYN A;  4B9U A;  1WSE A;  3HYF A;  3P5J A;  5HLF A;  4CJQ A;  4EP5 A;  2HHQ A;  3A2F A;  5J2N A;  1L5U A;  4NCA A;  4HVJ A;  4GMJ B;  4B8C A;  1QSY A;  1JL1 A;  4CCH A;  4IFY A;  4FLU A;  1U49 A;  3DLB A;  4FLV A;  3OYJ A;  4F2S A;  3DLK A;  2Z1G A;  1KTQ A;  4B8A B;  2FBT A;  1IKW A;  1VSE A;  2GBZ A;  5SZT A;  3CFP A;  3OS2 A;  4E7I A;  3P83 D;  1QE1 A;  1S9E A;  4N76 A;  4KFB A;  3AO5 A;  1WSH A;  4Y1D A;  4DSI A;  2E6M A;  4DQI A;  2HMI A;  4O44 A;  4E89 A;  1BL3 A;  1RT4 A;  4NCB A;  2P5G A;  5FRM A;  4CF0 A;  3TAP A;  4F2R A;  3TI0 A;  2HVH A;  3U3G A;  5J2M A;  1TV6 A;  4C8N A;  3AVC A;  4FK4 A;  1KVB A;  3DMJ A;  3DLH A;  3QER A;  1BCO A;  5KGW A;  3ZSX A;  4Z4I A;  4DSF A;  1HRH A;  3TAM A;  3KK2 A;  1JXB A;  1WSF A;  3V9S A;  3OYM A;  3NH0 A;  2YKM A;  1KFS A;  1ZBU A;  4CJK A;  1IG9 A;  4JLH A;  2OPP A;  4FLW A;  4FJK A;  4KHY A;  4DQS A;  4FK0 A;  4OJR A;  1BQN A;  1RBT A;  3MXI A;  4HTU A;  4B3O A;  3LDS A;  4BE0 A;  1TKT A;  4CED A;  3PY8 A;  5FRN A;  3WNF A;  1A5X A;  3AVM A;  3TR8 A;  3WNG A;  4FXD A;  4KTZ A;  1T8E A;  1SKR A;  2F8S A;  4H8K A;  4DFK A;  4OVL A;  4QOZ B;  4W5N A;  3M8R A;  3PUF A;  3UIQ A;  1J9A A;  2BDP A;  1JLE A;  3DRP A;  4ZHR A;  3SPY A;  3SJJ A;  1LW0 A;  3K58 A;  3RR7 A;  4CGG A;  3OYH A;  4ZTF A;  4G1Q A;  1NJX A;  3ZSR A;  2HNY A;  4B9V A;  4CE9 A;  3NGI A;  5D3G A;  4UQG A;  3DRS A;  4CF9 A;  1NJZ A;  5I3U A;  3ZSQ A;  3ZSV A;  4BE2 A;  1NKE A;  2KFZ A;  2WON A;  5E41 A;  4PA1 A;  1SV5 A;  4JRP A;  4ELT A;  1QSS A;  2HHT A;  2IGI A;  2AJQ A;  3AO2 A;  1SL1 A;  2QXF A;  3LAN A;  3OVN A;  4RW9 A;  4RW8 A;  5JS2 A;  4FJG A;  3DOK A;  2HHU A;  4XIU A;  3SQ4 A;  2XHB A;  1Q9Y A;  3QEX A;  2VG7 A;  1S5J A;  3L8B A;  4CK3 A;  3L2W A;  1J5O A;  4CJS A;  1SKS A;  1CLQ A;  2VG6 A;  1O1W A;  3LAK A;  3NCI A;  4DTJ A;  4KTW A;  1WN7 A;  3PX4 A;  4E0D A;  5CY4 A;  1D8Y A;  1XHZ A;  1NK6 A;  3V1R A;  2OYQ A;  3HM9 A;  1SKW A;  4OGE A;  1UA1 A;  1YT3 A;  4DMN A;  3SV3 A;  4FJ9 A;  1CZB A;  3T1A A;  1NK9 A;  3TAR A;  2OZS A;  1RTJ A;  1VSM A;  2QKB A;  2ITG A;  4FVM A;  5I42 A;  1WAF A;  1RT1 A;  4RG8 A;  1DLO A;  2NUB A;  5CYM A;  3THV A;  4J2A A;  3HO1 A;  3L2Q A;  3KK3 A;  3I8D A;  1LAV A;  2E4L A;  3OYK A;  1QS4 A;  4CEE A;  1ZBL A;  3KLF A;  4DQR A;  1Y97 A;  4GVM A;  4YFU A;  5HBM A;  1LV5 A;  1N5Y A;  1RT5 A;  2KW4 A;  3D0P A;  1C1B A;  1DTQ A;  3OYA A;  3KLE A;  1QHT A;  4BWJ A;  4O0I A;  1N6Q A;  4FJL A;  3AO1 A;  4I9L A;  3VQ9 A;  4HCC A;  3LAL A;  1S9G A;  3S3N A;  3IG1 A;  4FK2 A;  5HRO A;  4OPJ A;  3AA4 A;  2R7Y A;  2QKK A;  2HW3 A;  3WNE A;  1LWE A;  3MAQ A;  4B9N A;  4CF1 A;  4CIF A;  4CEA A;  4FJM A;  1KLM A;  3OJU A;  3PX0 A;  4PY5 A;  2ATQ A;  2YHB A;  3ZT3 A;  3QEW A;  3OS1 A;  2FC0 A;  4DLE A;  2A1R A;  2PY5 A;  3CFR A;  4KHW A;  1REV A;  1Z26 A;  4GW6 A;  3SYZ A;  3HPH A;  5EU7 A;  3AA5 X;  3DM2 A;  3NH2 A;  3ALY A;  3QET A;  5J2Q A;  3ZT0 A;  3ULD A;  4NYF A;  3U3Y A;  2RKI A;  1XHX A;  4AHR A;  4Q5V A;  1NK4 A;  2XY7 A;  1BCM A;  2DFF A;  4OKJ A;  4AHU A;  4R5P A;  1SL2 A;  3MXM A;  2P1J A;  4DQP A;  4KTQ A;  1C6V A;  2PZS A;  1FKO A;  3AVF A;  1HYV A;  4CHY A;  4CF8 A;  1ZYQ A;  4DFJ A;  1WLJ A;  2HNZ A;  4CEO A;  1L3V A;  3AO4 A;  5CZ2 A;  1YTA A;  3CM5 A;  3LP2 A;  1JLQ A;  1W0H A;  3O3F A;  1R0A A;  4M3X A;  4E1M A;  4CHO A;  2HHV A;  3O4N A;  1S6P A;  4H4M A;  2JLE A;  1TK5 A;  5DK5 A;  1RT6 A;  3FFI A;  4ELV A;  4W5R A;  4PUO A;  4FZZ A;  1TKZ A;  4FJ8 A;  1RCH A;  5HP1 A;  3QO9 A;  4W5O A;  1JLC A;  1KRP A;  1VSF A;  3AVH A;  2ZQB A;  3O3H A;  5HRR A;  1D9D A;  3HPG A;  3RRH A;  4QCL A;  1FK9 A;  4DTO A;  1A5V A;  2EHG A;  2D0B A;  4CIG A;  3TAQ A;  1HJR A;  4ICL A;  4B9L A;  4CJV A;  2YV0 X;  3VQQ A;  4FJX A;  1TVR A;  1ITG A;  2VG5 A;  1X9S A;  1NK5 A;  4IFV A;  3DLG A;  4OGC A;  4F3O A;  2RN2 A;  2ETJ A;  3C6U A;  2X6N A;  2WOM A;  4FM0 A;  2JGU A;  2BE2 A;  4CFD A;  3LWL A;  3K5N A;  1U4B A;  4CEB A;  1BHL A;  1KVA A;  3AA3 A;  3LPU A;  4ZTJ A;  4CJT A;  4ELU A;  3H08 A;  3OJS A;  1RDC A;  3OYI A;  1SUQ A;  4DTM A;  2ZE2 A;  4BE1 A;  4I2Q A;  2D0C A;  3RTV A;  2YHA A;  4F8R A;  1ASV A;  3QNO A;  2O4I A;  2F8T A;  4B9S A;  4NCG A;  1VSH A;  4Y1C A;  3B6P A;  4KV8 A;  5CYQ A;  3IRX A;  1RIL A;  3SQ1 A;  3F73 A;  3ITH A;  1KFD A;  1UOC A;  2FBV A;  4DTR A;  3V1O A;  4KPY A;  3RRG A;  1S1V A;  4CJL A;  1CXU A;  4FCY A;  3MED A;  2HHX A;  3RR8 A;  2B5J A;  4KHN A;  1C1C A;  3CYM A;  1ASU A;  3KLG A;  1GOB A;  4H4O A;  2GV9 A;  3CFO A;  3VQ5 A;  3L3U A;  1HMV A;  5FRO A;  4CJ5 A;  3VQE A;  4HHT A;  4N5S A;  4DFM A;  1NJY A;  4CEQ A;  2FBY A;  3ZSW A;  5CZ1 A;  1TAQ A;  4ID1 A;  4Q0B A;  3SUQ A;  2KFN A;  3HP9 A;  3PO4 A;  4OLB A;  3JSM A;  4DU4 A;  1L3S A;  4BDY A;  2E6L A;  4JRQ A;  5SWM A;  3TAB A;  1ZBI A;  5JS1 A;  3NGZ A;  1BQM A;  3VQD A;  3K5L A;  4KB1 A;  2G8W A;  1JXE A;  4QAG A;  4TSX A;  4CHZ A;  1XWL A;  3NE6 A;  2Y1I A;  4M3T A;  4C8O A;  4YNQ A;  4W5T A;  3C6T A;  4E7K A;  1IH7 A;  1RDD A;  1NOZ A;  2B4J A;  3C95 A;  4CEZ A;  1EKE A;  1JLF A;  3AVB A;  2G8K A;  2DTU A;  1I3A A;  3DRR A;  3KIO A;  4E3S A;  3RMD A;  4J2B A;  4KO0 A;  1GOC A;  2G8U A;  4JS5 A;  1NK8 A;  3K5M A;  3O3G A;  1SL0 A;  1B9F A;  3M8S A;  4FYD A;  1S1X A;  3V9U A;  4DF4 A;  1U48 A;  1VSD A;  1C0U A;  4AHS A;  4FJN A;  1MU2 A;  2P51 A;  4DFP A;  1DTT A;  3K57 A;  4EZ6 A;  5T7B A;  2PYJ A;  1T03 A;  3F9K A;  3LWM A;  3M8Q A;  3TAF A;  4CGF A;  3SUP A;  4DU3 A;  2G8F A;  3RMB A;  3O4Q A;  3V1Q A;  4CGH A;  4LH4 A;  4IG0 A;  4LSL A;  4C8M A;  3VQB A;  3TAE A;  4F4K A;  4K8Z A;  1YTU A;  2G8I A;  3MEC A;  2KQ2 A;  1BI4 A;  4DG1 A;  4KRF A;  3NF9 A;  1EX4 A;  5DMR A;  3LZI A;  3AVG A;  2W42 A;  2G8V A;  4LH5 A;  2F96 A;  4DU1 A;  1T05 A;  1RBU A;  2HHW A;  2XO7 A;  4WE1 A;  4E7L A;  2Z1H A;  4CEC A;  5KTQ A;  4DSE A;  4M3U A;  3ASM A;  4FLY A;  1NKC A;  1KSP A;  4M3Y A;  4OKE A;  4E7H A;  1LW2 A;  2XY8 A;  2VWJ A;  1HQE A;  3PX6 A;  4Z4H A;  5HRN A;  1BIZ A;  1WAJ A;  3NGY A;  4FM1 A;  3U6F A;  5C25 A;  3TAN A;  1HNI A;  1RBS A;  1CZ9 A;  3RMC A;  4KI6 A;  4FZY A;  3E01 A;  4AHT A;  3EYZ A;  3HJF A;  3NFA A;  1S1T A;  1B9D A;  4KKO A;  3VA0 A;  3LAM A;  1NK0 A;  4KHU A;  2KZM A;  2Z1I A;  3DI6 A;  1VSL A;  2OPS A;  2DFE A;  3CG7 A;  1J54 A;  3ISN C;  3NF6 A;  4IBN A;  3OYB A;  4RW4 A;  4B9T A;  1JLA A;  4O0J A;  4CJ4 A;  4CIE A;  3HST B;  2IC3 A;  2I5J A;  4DTU A;  4KRE A;  4I7F A;  4CJ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...