3ZSXA

Small molecule inhibitors of the ledgf site of hiv type 1 integrase identified by fragment screening and structure based drug design
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords INTEGRASE
publication title Small Molecule Inhibitors of the Ledgf Site of Human Immunodeficiency Virus Integrase Identified by Fragment Screening and Structure Based Design.
pubmed doi rcsb
source organism Human immunodeficiency virus
total genus 56
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.-:
pdb deposition date 2011-07-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3zsxA00
4NYFA 1WSGA 3SQ2A 1VSEA 1BCOA 3MXMA 2G8KA 4OLBA 1TKZA 4AHVA 1FKOA 4FVMA 3CFOA 4CJSA 3KLEA 3HSTB 2HHUA 1L3TA 3AA3A 1HQUA 4O55A 3TR8A 1KTQA 3AA5X 4OLAA 4B8CA 3G10A 4NYNA 4ELUA 4GW6A 3VQQA 3KKSA 5J2QA 2OZMA 3HPHA 3HYFA 3SNNA 3V1QA 3VQAA 4CGFA 3IG1A 1EETA 4DQSA 4DFMA 3AVFA 4DU3A 4KHWA 1REVA 3D0PA 1R0AA 1U48A 1RT2A 4GMJB 5SZTA 4CFDA 1I39A 3NAEA 4FM0A 4Q5VA 3QEPA 1QQCA 2YNIA 3LWLA 4FJMA 3LWMA 3S3MA 1KFSA 4B9MA 2BE2A 1Q8IA 3K57A 1RDBA 4DLGA 4FCYA 3DI6A 3V1RA 3E01A 4BWJA 1C1CA 3F73A 3SQ4A 4E1NA 4KPYA 2QKBA 4CFBA 4IG3A 4B9UA 2Z1JA 3OS0A 3HL8A 3AO4A 4O0JA 4B9NA 5HRNA 2HVHA 2PY5A 4DMNA 2HB5A 4ICLA 1NJZA 3NF9A 1BQMA 2HHSA 2GBZA 1RTIA 3NGIA 1X9WA 5E41A 2DFEA 3SQ1A 2HHTA 4QCLA 3AVGA 3C6TA 4B3OA 3P83D 3LDSA 2DFHA 4FLUA 5J2PA 1F21A 4DQIA 4DS5A 3RMAA 3NGZA 3LP0A 4KHYA 3K5MA 2G8FA 3O4QA 4DTUA 2G8WA 2EX3A 2P5GA 3SPYA 4B8AB 1X1PA 4MFBA 1XHZA 3V9WA 4B9LA 1RTHA 1BL3A 3HP9A 5KGWA 1ASVA 1RBSA 3VQDA 4CESA 3TAQA 1EKEA 2ETJA 4FM2A 3C95A 2B4JA 4M42A 5CYMA 4CJFA 1LAVA 1NK0A 1NK5A 4PUOA 3VQ7A 1NOZA 3VQEA 1HJRA 1K6YA 2FBXA 5C25A 4DSLA 1BIUA 2XY8A 1RTDA 1HNIA 4M3XA 4CJ4A 4DTXA 4DLEA 3L2VA 3V4IA 4FK0A 1QSYA 4FJXA 1RBUA 1QE1A 3NH1A 2JLEA 3SUOA 2HNYA 4FLZA 1J53A 1SL2A 1RT1A 2RN2A 4CEFA 1WAFA 1ZBUA 3CFRA 1NK7A 1J9AA 3V9XA 4OPJA 1YVUA 3NE6A 2AJQA 1VSMA 1JLEA 3F9KA 3VQ8A 1A5VA 3LALA 3TAGA 4KB0A 2HVIA 1JLBA 1LWCA 2OPPA 3AVBA 3QESA 3ZSZA 3DLBA 2NUBA 3H08A 3IAYA 1DTQA 2E6MA 2B5JA 3NF6A 3TAEA 4KRFA 4FM1A 4CJTA 4QOZB 1CZBA 2FBYA 2R7YA 4AHSA 1B92A 2D0BA 3DLEA 3ALYA 3LP1A 4H4OA 4CJWA 4E0DA 1ASWA 4JLHA 3ZSVA 2O4GA 4OGEA 1UOCA 3OYMA 1U04A 1RBVA 3SUQA 3SQ0A 1KSPA 3I0SA 3AO3A 1BHLA 4WE1A 4W5OA 2YKMA 2ZQBA 3CM6A 1SKSA 3OVNA 5J2MA 4HUFA 2VG6A 2HHWA 4R5PA 2YV0X 4ZTFA 4FJLA 4M3TA 3HK2A 3B6OA 3ZT4A 3AO1A 3T3FA 3U6FA 2D5RA 3TAMA 1BI4B 4KB1A 2QK9A 3V9ZA 4BDYA 4IFYA 2F96A 3WNHA 1NK4A 3QEWA 1RTJA 4J2AA 2F8SA 1NKCA 2Q3SA 4FJHA 3TABA 4E89A 2Y1IA 1B9FA 3QEIA 3P5JA 4KHQA 3KLHA 1JXBA 1S1XA 2X78A 1EX4A 4AHRA 1D5AA 1HNVA 3OJUA 3NBPA 4IG0A 4LSNA 4W5TA 2IDOA 3OYLA 3L3VA 1FXXA 4AHCA 3SV3A 3I0RA 1RDAA 5DK5A 3ZCMA 4CEDA 4BDZA 2OPSA 4CJRA 3VA3A 1ZBIA 3OYJA 2KFNA 1VRTA 3TI0A 2WOMA 4FK4A 5DMRA 4KV8A 2XY6A 2I5JA 1S1VA 3BDPA 3LAKA 1C0UA 3VN5A 2YHAA 3P1GA 3C94A 3HVTA 1XHXA 3JSMA 2G8VA 4OGCA 4CIGA 4CK1A 4K8ZA 5HBMA 5FROA 1C1AA 3KD1E 3U3YA 2FBTA 4O44A 3ULDA 4NCAA 4I2PA 5CY4A 3V1OA 3O4NA 4EP4A 3MXIA 3K5LA 1C1BA 5KI6A 1TVRA 4CECA 4W5NA 4L8RB 1SUQA 2YKNA 4OPKA 4FLXA 4RW8A 1YTUA 1RDDA 3CQ8A 3KJVA 4CHZA 4LSLA 4CCHA 3ZSXA 4CGHA 2VG7A 3V81A 3AVHA 1CZ9A 4CF9A 4FJJA 1TAUA 1GOCA 1TAQA 1Z26A 3SV4A 4F3TA 4KI6A 1LV5A 2KQ2A 4LH4A 4E3SA 3IS9A 1WAJA 3VQ6A 1LW0A 2WONA 4DWIA 1SL0A 1TK5A 1VSIA 4RW7A 3ZSQA 4E7KA 4CJ3A 1WSFA 3L2UA 3VQ9A 2Y1JA 4DFJA 2FC0A 4CERA 1RNHA 4CJ5A 4FJKA 4Q0BA 4AHUA 4CHPA 3DRPA 3NHGA 4CJEA 4E7IA 2YHBA 3QIPA 4DFKA 1A5WA 1S9EA 1L5UA 1B9DA 2XRIA 3NF7A 4DTRA 1HYVA 4CHOA 4JRQA 4F4KA 1J54A 3SZ2A 3MEGA 1IKXA 4Z0UA 4F2SA 2BGGA 1XWLA 3SUNA 4CFAA 3AO5A 4HHTA 3PV8A 1W9HA 1D9FA 1QS4A 4EZ6A 1CXUA 2VWKA 1JXEA 1VRUA 2QXFA 3DMJA 4RG8A 3NF8A 1IO2A 4M41A 3T1AA 4XIUA 1KVAA 3IRXA 2XO7A 4FJGA 4B9SA 1GOBA 2FBVA 2HHQA 1BIZA 1EXQA 4CEEA 3LZIA 4ELTA 3SYZA 1NJXA 2GV9A 4CHQA 4K8XA 3CM5A 3QNNA 3A2FA 3NFAA 4CF8A 1ASUA 3SCXA 3OYGA 4CFCA 4CK3A 1I3AA 4DF8A 4FLYA 4NCBA 2DTUA 3QETA 5CZ2A 2YNGA 3AVAA 2ATQA 1ZBFA 3AVJA 3PY8A 1S1UA 4DTNA 2OYQA 4F3OA 3ZT0A 4CF0A 3PX4A 3ISNC 1DTTA 1BGXT 1WSJA 4N47A 3DLKA 4FJ9A 5JS2A 4CJKA 1IKYA 3RMBA 4EP5A 3V6DA 4KAZA 2X74A 4ID5A 1NJWA 4HUEA 3KK2A 4CJUA 3EY1A 3PO5A 3LAMA 4C8KA 1VSJA 4M3YA 1RT5A 3QLHA 2D0CA 3O3HA 4FJ8A 4JS4A 3ITHA 1KLMA 3OYDA 2Z1HA 1L3SA 4CJVA 3EZ5A 3S3OA 4M3RA 3OYAA 4CGIA 3JYTA 5HLFA 1SL1A 4CGJA 1WLJA 1ZYQA 4CHNA 1IKWA 2G8UA 2Z1GA 4FZYA 4CEAA 4ZHRA 3AVNA 1BI4A 4BDPA 1RBRA 1RCHA 1S1TA 3HPOA 4RW9A 3K58A 3AVMA 3KLGA 3SJJA 4N41A 1NK9A 3VQPA 3M8SA 4O5BA 2HMIA 1TKTA 4FJNA 5KTQA 3PX6A 4FYDA 1HYZA 3U3GA 2KTQA 3QEXA 3DLRA 4E19A 3L8BA 1SKWA 5J1EA 1WNSA 2YNHA 1GOAA 3M8RA 2RKIA 3L2QA 1ZBLA 5FRNA 3DYAA 3NDKA 4E7LA 1UA1A 5KRTA 4KREA 3MEEA 4KHUA 1C0MA 4CF1A 1O1WA 1U47A 4I9QA 3KK3A 1NOYA 4E7HA 1HRHA 3TANA 1RT3A 1X9SA 3RMDA 1Q9YA 1IG9A 3ZSYA 3FFIA 3QINA 2VWJA 4M3UA 4KFBA 5JS1A 3V9SA 1DLOA 2OPRA 4J2BA 1C0TA 4DTOA 3THVA 4CGDA 1S6QA 5FDLA 1L3UA 4CF2A 1JL1A 3LP3A 1CLQA 3AVCA 3DOKA 2HW3A 3S3NA 2P51A 4F8RA 4J2EA 4Z4FA 3SPZA 1LWEA 3DLHA 4H8KA 4M3WA 4OKEA 1S6PA 2RF2A 3QO9A 1NK6A 2O4IA 4BACA 2G8HA 3PX0A 4CE9A 1J5OA 3CG7A 3LPUA 1LWFA 3OS1A 4C8LA 3QERA 3SUPA 3OYCA 1XI1A 1UAXA 5CZ1A 1JLFA 4DTPA 4W5QA 1NJYA 3OYFA 4DSIA 3L2RA 1T03A 3OYIA 1JKHA 3ZT3A 1UA0A 1ZBHA 3HO1A 1D8YA 2G8IA 2HNDA 4DG1A 1L3VA 1N6QA 1TK0A 3C6UA 4DU1A 2PYLA 3B6PA 3NGYA 4FW2A 3KIOA 3LPTA 3WNEA 5HRPA 4DSEA 1W0HA 4HCBA 1C6VA 4H4MA 4IBNA 1RBTA 3AA2A 4FK2A 2KW4A 1LW2A 4BE1A 1VSKA 3I8DA 3HXMA 2ZD1A 3HVRA 1JLQA 3CFPA 1HYSA 2XY7A 4ZTJA 3D45A 4Z4CA 5EU7A 3OS2A 3UIQA 4YFUA 3PUFA 4BWMA 3OYNA 2BDPA 2E4LA 1RT7A 5KRSA 5T7BA 4HUGA 5I42A 4IDKA 4JS5A 3QNOA 2B6AA 1JLGA 1JLCA 4KKOA 4Z4GA 5KGXA 4Y1CA 3MAQA 1NKEA 1KRPA 3PO4A 4I7FA 4OJRA 4M3ZA 3M8PA 3L3UA 4PY5A 3DRSA 5SWMA 2KFZA 4FJ7A 3K59A 4FZXC 4M45A 2HHXA 1MU2A 4CJLA 3K5NA 4DS4A 1KVCA 4GVMA 4TSXA 3BGRA 1HPZA 1IKVA 4CK2A 3HM9A 1VSHA 4DSJA 4CJPA 1LAWA 1T05A 3ASMA 3MEDA 3TAPA 4OKKA 3WNFA 4CEOA 3AVIA 4E1MA 3RRHA 1Q9XA 3KD5E 4B08A 3ZT2A 4PWDA 3ZSWA 4CEBA 4B9TA 5D3GA 3OYEA 4DQQA 4KTWA 4CEQA 1BCMA 4NCGA 4HTUA 3OYBA 2LSNA 3O3GA 4DF4A 2E6LA 2W42A 3RTVA 2A1RA 4FLWA 4HVJA 1WN7A 4KO0A 5FRMA 1QTMA 2DFFA 3QIOA 2Z1IA 1VSFA 4RW6A 3TARA 1S5JA 4AH9A 3WNGA 1Y97A 1TV6A 3CYMA 1BQNA 1HQEA 1RT6A 2OPQA 4C8OA 4BE2A 1WSIA 1YT3A 3MXJA 1JLAA 4Z4HA 3LP2A 3VQ5A 1VSLA 4LD0A 1U45A 4KHNA 4FLTA 4YNQA 4HCCA 2IGIA 4DQPA 4C8NA 1X9MA 3KKRA 3VQCA 1QHTA 4FW1A 4J2DA 2F8TA 1WSEA 1G15A 5K14A 3NCIA 3AV9A 1QSLA 4B9VA 4Z4IA 2KZMA 4KTZA 4CJQA 4FJIA 3DOLA 4W5RA 3OYKA 1S1WA 4OKJA 1SV5A 2ZE2A 5C42A 5HP1A 1N5YA 4FZZA 4LH5A 1T7PA 4EZ9A 1A5XA 1RILA 3HT3A 4LY7A 4AHTA 1TK8A 2PZSA 3AVLA 3NH2A 1WSHA 5J2NA 1U4BA 4F2RA 4IKFA 4Z4EA 1JL2A 4FLVA 2HNZA 4CGGA 1VK0A 3MECA 3DM2A 4FXDA 3K2PA 1KCFA 3QEVA 4UQGA 4N76A 4C8MA 4N5SA 2VG5A 4AILC 4I9LA 1S9GA 4N56A 2XHBA 3RR7A 1KFDA 1TL1A 3O3FA 1IH7A 3ZT1A 4IFVA 3L2WA 1ITGA 4DFPA 3SI6A 1XC9A 2KZZA 2P5OA 3HPGA 4O4GA 5CYQA 3NH0A 3LZJA 1TKDA 1QSSA 2BANA 3RMCA 4FJ5A 2OA8A 2IAJA 4CIFA 1FK9A 4DTJA 4KI4A 3M8QA 2OZSA 3LANA 4DU4A 1HMVA 1TGOA 2XY5A 1FKPA 4G1QA 4E7JA 4DQRA 4DSKA 2DY4A 3AA4A 1SKRA 2X6NA 3OYHA 4PQUA 3K5OA 3KLFA 3OJSA 3HP6A 3VQBA 2RPIA 3TAFA 4MQ3A 3VQ4A 3ZSRA 2ITGA 1BISA 3KLIA 4DTSA 2PYJA 4KHSA 2QKKA 4CEZA 2IC3A 4Y1DA 4OVLA 1RDCA 1D9DA 1KVBA 2IOCA 2A1SA 3KK1A 1CXQA 1TKXA 4RW4A 2D0AA 1TL3A 4QAGA 1RT4A 3AO2A 2GUIA 3ZSOA 3VA0A 1KLNA 3KTQA 4CHYA 2HHVA 3AVKA 3RR8A 1YTAA 2X6SA 1NK8A 4JRPA 4I2QA 4BE0A 2P1JA 1EP4A 3EYZA 5HRSA 4DTMA 2EHGA 3DRRA 4PA1A 3TWHA 3V9UA 3RRGA 2JGUA 2YNFA 5C24A 1Z25A 3OY9A 4ELVA 1NKBA 4O0IA 3RWUA 2IS3A 4DSFA 1VSDA 4CIEA 3T19A 1U49A 5I3UA 4KTQA 3HJFA 1UWBA 4ID1A 1T8EA 3DLGA 5HROA 3G0ZA 5HRRA 3S9HA
chains in the Genus database with same CATH superfamily
3H46O 1WSGA 4NYFA 5LJWA 2G8KA 3UKUA 4IEEA 4XH1A 3UKRA 3CCMN 2HHUA 3A5OC 4K43A 3TR8A 1KTQA 5AR0A 3EL2A 1RDWX 3CPWM 5ADXA 4AM6A 5J2QA 2OZMA 3HYFA 3VQAA 4CGFA 4DFMA 1REVA 3ZETB 3RVCA 3A5LC 4CFDA 1I39A 1KFSA 3E01A 4LFAK 1C1CA 4B9UA 1ATSA 2HVHA 5HRNA 4DMNA 2HF3A 4IEIA 2HHTA 1QQOA 4WYBA 1EWQA 3DLLL 3M5RA 4FLUA 2OANA 4DQIA 2AA4A 4DS5A 2WBNA 3IMXA 5E84A 4DTUA 5GAHP 4B8AB 1XQSC 1JCGA 4MFBA 2YHWA 3HP9A 4ISFA 1ASVA 4CESA 4CJFA 1LAVA 1NK0A 2NRRA 2NRVA 2ZJQL 1NK5A 3VQ7A 4DSLA 2FBXA 3E9OA 2XY8A 4DR2K 1HNIA 3IFRA 4JKGA 3V4IA 2Q2RA 4DLEA 3RSEA 5BPLA 2FXUA 4GV9A 1QE1A 3NH1A 4FLZA 1J53A 1RT1A 3GG4A 1NGBA 2FSNA 3CETA 4JHDA 4H5VA 3A8YA 1YVUA 4FWQA 2AJQA 5CE3A 3LALA 1JLBA 3O6WA 3ZSZA 3FR0A 3MDQA 3H08A 4PKHA 4RCHA 2B5JA 2R7YA 1QHAA 1N32K 1ASWA 4JLHA 2O4GA 3ATVA 3OYMA 3AO3A 1MDUB 5AQVA 3CM6A 3OVNA 3DJCA 2VG6A 4R5PA 4FJLA 3ZT4A 3AO1A 2PBDA 3T3FA 3U6FA 4QS7A 1T6CA 2DPNA 3W0LA 4B1WB 3THYB 3VERA 1E4GT 4IFYA 3O1BA 1NK4A 3QEWA 2F8SA 3O9SA 2P9LA 1B9FA 3O80A 4CI6A 1JXBA 3CC7N 2X78A 1M1KO 2PAVA 3CJ7A 3L3VA 1FXXA 4AHCA 3I0RA 2O8BB 3ZCMA 3VA3A 3CHWA 4JKHA 4K25A 3H1QA 5DMRA 1K8KA 5LJVA 2XY6A 3LAKA 1C0UA 2QEXN 1XHXA 1GLFO 4K8ZA 2KHOA 3HZ6A 5DM6L 1C1AA 3OTOK 4I2PA 3V1OA 2Q31A 4EP4A 3MXIA 3K5LA 4MLEA 2GEMA 5AQMA 2ZJRL 3QBXA 4XEIA 2YKNA 1YTUA 4BC3A 1SAZA 1V4TA 2QWLA 1Z26A 4KI6A 1LV5A 3IS9A 2WONA 4DWIA 1CZAN 4EHUA 1ZC6A 4FPBA 3ZSQA 4E7KA 4NXNK 1RNHA 3BF1A 4AHUA 4XH5A 4CHPA 1Q86O 4DFKA 2YHBA 3QIPA 1S9EA 1L5UA 4JAXA 4CHOA 4JRQA 1J54A 3SZ2A 1XWLA 1Z05A 5FLXO 1NGCA 1D9FA 1QS4A 3MMVA 4EZ6A 2VWKA 4A61A 3NF8A 4XIUA 4M41A 3T1AA 3J7AP 4ELTA 2JWLA 3A0IX 4WFAL 5JMVA 5B8HA 4JKDA 1R59O 3A5MC 3SCXA 3O08A 3NFAA 4L3QA 3P38A 1I3AA 4FWLA 2YNGA 3VENA 3AVJA 4F3OA 4LF9K 1NM1A 1BGXT 4BVOA 3CMAN 2UUBK 3DLKA 1OH5A 3L6QA 3VGKA 3KK2A 2OTLN 3LAMA 2A40A 1RT5A 2ZGZA 3QLHA 4CBXA 2O8FA 1VQ4N 5JLHA 4CJVA 4DR1K 3S3OA 1L3SA 1T6DA 4CGIA 3JYTA 1WLJA 3AY9A 5HOOA 4CEAA 5AQXA 4DR5K 3S41A 3R6MA 4BDPA 1RBRA 4FWNA 3THXA 4DUYK 4FYDA 1HYZA 3B8AX 3H3NO 2HSTA 3M3ZA 2KTQA 3DLRA 4E19A 4BRDA 4CZKA 4DR3K 2O8DB 4BRLA 1BO5O 1GOAA 1ZBLA 5FRNA 4DV4K 1UA1A 4KREA 3GE1A 1C0MA 4HTLA 4CF1A 1O1WA 3CJCA 1NOYA 4I9QA 1HRHA 3L4QA 1RT3A 3N4PA 3IUCA 1X9SA 4R79A 2HBMA 1YJWN 3QINA 5JS1A 5GADP 4J2BA 1L3UA 4CF2A 3PSIA 1JL1A 4CD3A 3AVCA 3G4SN 3ZETA 3DLHA 5M1KA 4H8KA 4M3WA 3DAWA 3MWTA 4I6MB 2HBJA 2RF2A 1NK6A 1KD1O 2HHHK 2O4IA 4NLCA 2F7TA 3SUPA 1XI1A 1UAXA 5CZ1A 3AAPA 4ISEA 1NJYA 4DSIA 3L2RA 3OYIA 1KAZA 3ZT3A 4MLHA 4CVNE 4DG1A 1L3VA 2WC9A 3U4LA 3C6UA 3CCJN 3B6PA 3DXKB 3LPTA 1NMDA 5HRPA 1C6VA 4H4MA 2KW4A 1SQKA 4KH5A 4CZIA 3HVRA 1JLQA 1HYSA 1GLEG 4ZTJA 1HNZK 2QWOA 5EU7A 3UIQA 4JI3K 3UKUB 3CJAA 3EKUA 3MK6A 3UKRB 4IDKA 5I42A 1JLGA 3MX5A 5C10A 3PO4A 4I7FA 3T7ZA 4M45A 1MU2A 1IBKK 4DS4A 3BGRA 1IKVA 4DSJA 3F9MA 1YF5L 5JVGL 3CCUN 2CH5A 4E1MA 4X62K 4PWDA 1FW6A 3P39A 5GIPA 4DQQA 4KTWA 3TU5A 4JV5K 4HTUA 4DF4A 2A1RA 1EO1A 2E6LA 2W42A 4FLWA 4KO0A 3I33A 3VEZA 4NB4A 3QIOA 4BRMA 3TARA 4JI1K 4AH9A 3WNGA 1Y97A 1TV6A 4CZMA 1BQNA 5BREA 4YOXA 2ZM6K 4LD0A 1U45A 1IV0A 1YAGA 4KHNA 5M1OA 4BR7A 2IGIA 3CIPA 4C8NA 2NZTA 4H5TA 1QSLA 4JK9A 1W2BM 2KZMA 3ZX0A 3DOLA 3O9QA 3HT3A 1RILA 5H1SQ 3NH2A 3WXJA 4F2RA 1BU6O 1JL2A 2NRZA 3MECA 1VQMN 1YJ9N 4UQGA 3THYA 2KLAA 3VETA 4GVEA 4JKGB 4JKEA 3RSEB 1VQ5N 1KFDA 2KZZA 4BC2A 1XC9A 4YDUA 2P5OA 2VGNA 2OA8A 1FK9A 3OA9A 4DU4A 2O8BA 1XMQK 4H0VB 4DSKA 5AQPA 1SKRA 1QQNA 3OJSA 3VQBA 2VCPA 4MQ3A 3K0SA 3CI5A 2PYJA 4JI0K 4Y1DA 1RDCA 1D9DA 1BOTO 2O8EA 5AQGA 1CXQA 4RW4A 1TL3A 3KTQA 3P31A 2IIRA 1HPMA 3ID6A 4IOXA 3U9DA 3R1XA 3C0BA 2P1JA 4A59A 4BRIA 3TWHA 4CZEA 5F1XA 1NMNA 2IS3A 3MN5A 1VSDA 4H03B 1TUYA 3HJFA 1T8EA 5HROA 3G0ZA 3HK2A 5HRRA 3CCVN 3S9HA 1VSEA 4UY8O 3MXMA 2P9LB 4AHVA 1L3TA 4BR0A 4GW6A 3VQQA 1IBLK 4H0PA 3H45C 4DUZK 3V1QA 4DQSA 1WOQA 3D0PA 1R0AA 2UUAK 1DEJA 1HKGA 1QZ5A 3NAEA 3TTDA 4Q5VA 2CGLA 2YNIA 3LWLA 4FJMA 3C6HA 1Y64A 3S3MA 4B9MA 1Q8IA 5AQHA 3K57A 4DLGA 3V1RA 4CBWA 3SQ4A 4CFBA 3OS0A 3AO4A 3EEQA 5E41A 4QCLA 3WXLA 3D2FA 2DFHA 5J2PA 5AQRA 3LP0A 3K5MA 4BC5A 2G8WA 2EX3A 2P5GA 3SPYA 1X1PA 4JI7K 2HOEA 1BL3A 5KGWA 1BA1A 1EKEA 1NGIA 2VQFK 4FM2A 1E3MA 1YUWA 3VQEA 1HJRA 5AQKA 2HF4A 4M3XA 2Q0RA 4U7BA 2J4RA 5DM7L 2E1YA 4BRQA 2HNYA 2O8DA 3CFRA 1NK7A 3NE6A 3KWIA 3F9KA 1OH8A 1YIJN 5KQDA 3QESA 2BUPA 3NVMA 5BPMA 5AQOA 3P4IA 3IAYA 3NF6A 3TAEA 4A5BA 2D0BA 4CJWA 3ALYA 4E0DA 4U67L 3C7NA 3SUQA 1U04A 2O8FB 3I0SA 1XMOK 2ITMA 2NRWA 4IXCA 5BPNA 1GLBG 3CERA 3O4WA 3QDKA 4LF6K 4KBOA 3LDNA 5C12A 2D5RA 3SBGA 2WTUA 2A5XA 3V9ZA 4JKCA 2F96A 3HOSA 1RTJA 3THXB 4FL9A 4DV6K 2Q3SA 3QEIA 3P5JA 4DV2K 5JVHL 1K9MO 3KLHA 1S1XA 4AHRA 1D5AA 1HNVA 1M90O 3NBPA 4LSNA 5AQYA 2IDOA 1Q7YO 5DK5A 1RDAA 3VTIA 4M7XA 1ZBIA 2IVNA 4BRAA 4FK4A 4KV8A 2UXCK 1QQMA 1VQ6N 3CCLN 3VN5A 3HVTA 2GTDA 4OGCA 3QFUA 3A5NC 3KD1E 3U3YA 4O44A 5AQZA 4H5WA 3O4NA 4YOYA 1C1BA 5AQJA 3LM9A 1Q81O 2VGMA 3D7EO 3J80O 4OPKA 1RDDA 3CQ8A 3L4IA 5AQLA 3KJVA 4LSLA 1QVGM 3ZSXA 4FJJA 4CF9A 3SV4A 4F3TA 4LH4A 3R8EA 3VQ6A 1SL0A 1TK5A 1VSIA 4RW7A 4DKWA 1WSFA 5ELZA 3VQ9A 3VF2A 4Q0BA 4O8UA 4J8FA 4NO7A 1S3XA 3DRPA 1XNQK 3NF7A 2D1KA 2GELA 1IKXA 3MEGA 2ASMA 3BY5A 4Z0UA 5C2DA 4CJ7A 2W6KA 1CXUA 1JXEA 4FPAA 2IVPA 1VQLN 1IO2A 2FF3B 1KVAA 3IRXA 1GOBA 4CZJA 3I56N 3VF4A 4WQ5A 3LZIA 3SYZA 2NRTA 4XH4A 4CHQA 3QNNA 3ULEB 3OYGA 3WT0A 5CZ2A 2ATQA 4YOTA 1N34K 3PY8A 4C23A 1S1UA 2OYQA 3VEVA 1WSJA 1VQ9N 4BR4A 5JS2A 4CJKA 3RMBA 3V6DA 3CPEA 1NJWA 4CJUA 4GV3A 1VSJA 5JICA 1BWFO 4JI8K 4BQZA 2D0CA 4A57A 3OYDA 3ENBA 3EZ5A 4M3RA 1SL1A 1IKWA 2G8UA 1WUAA 3I8BA 1HUXA 2QI2A 3WQTA 2E88A 2VYPA 3HPOA 4RW9A 3GOIA 3AVMA 3K58A 1ZBSA 3M8SA 2HMIA 3QICA 3U3GA 3QEXA 1K73O 5J1EA 3L2QA 1YHQN 3DYAA 4GKKK 5KRTA 3EN9A 2OTJN 1KXPA 1U47A 2D4WA 3RMDA 1Q9YA 1JCEA 5TKWA 3ZSYA 3HTVA 3FFIA 1ATNA 2VWJA 4KFBA 4WFNL 1HX1A 2OPRA 4B3SK 1S6QA 1HKBA 4M63C 3LP3A 1OH7A 3DWLA 4WQ4C 4OKEA 4IOAL 4CE9A 1J5OA 2O8EB 4H0OA 3QERA 1JCFA 2Q1NA 4MO4A 5AQTA 4YHHK 1UA0A 1ZBHA 3H3OB 1D8YA 3SBTA 4FSVA 4E1JA 3NGYA 1WBBA 1EQYA 4DSEA 4FK2A 5M1PA 1LW2A 4BE1A 3CFPA 1ATRA 1SZ2A 3HXMA 2XY7A 5IT9O 5M1QA 4WFBL 5M1NA 4IO9L 2W40A 5IWAK 1RT7A 5KRSA 5AQUA 4Y1CA 3MAQA 4JEPA 1NKEA 1KRPA 4IDHA 1Q18A 3SMPA 2KFZA 1LCUA 4FJ7A 5AZIB 1NWKA 2QTDA 1KVCA 4GVMA 1P8ZA 3HM9A 4CK2A 4IZ9A 4CJPA 1LAWA 3ASMA 4OKKA 1TYQB 1Q9XA 4H0TB 3KD5E 4B08A 1V4SA 4CEBA 4NCGA 3E66A 2LSNA 3OYBA 4EAHD 5FRMA 4HVJA 1WN7A 2F4VK 2Z1IA 1P90A 1RT6A 1I94K 1HJOA 2QW9A 4Z4HA 3LP2A 3VQ5A 3D2FB 4FLTA 4DQPA 1X9MA 4FW1A 2NLXA 1WSEA 1G15A 4DR4K 4KTZA 4YOUA 4OKJA 1N5YA 5C42A 4FZZA 5LMNK 4LH5A 3FZHA 1A5XA 4LY7A 4A2BA 4AHTA 3WXIA 2PZSA 3AVLA 1RGIA 1WSHA 3THWA 1U4BA 3C65A 3KWGA 5AFUA 4IKFA 3EKSA 5BN8A 3K2PA 1KCFA 2ZF5O 4C8MA 4AILC 4BRFA 4N56A 2XHBA 2P9SA 3L2WA 3KK7A 5CYQA 3NH0A 4FJ5A 3T1YK 2OZSA 3HM8A 1KQSM 1TGOA 3LL3A 1FKPA 4G1QA 5GIOA 4FVUA 3AA4A 3LDPA 3CCQN 3HP6A 3TAFA 3ZSRA 2ITGA 3KLIA 5F2RA 1NG9A 5CHIA 2IOCA 3TPQA 1GLLO 2D0AA 1RT4A 3AO2A 2PFUA 3VA0A 3CCSN 3C7NB 2HHVA 4KH6A 3AVKA 1YTAA 4I2QA 1EP4A 2NRXA 3EYZA 5HRSA 4DTMA 3DRRA 3V9UA 3RRGA 2JGUA 4ELVA 3T19A 2P9IA 4KTQA 1J5EK 4ID1A 1N33K 3DLGA 2CGJA 2JWKA 4JKFA 2V51B 1HNWK 4OLBA 1FKOA 4FVMA 3CFOA 3VEWA 2A42A 3AA3A 4O55A 2IVOA 3AA5X 4OLAA 3G10A 4NYNA 4BRPA 4G9ZA 3HPHA 3JAMO 1LOTB 1EETA 3BZCA 2E2OA 4BRCA 1RT2A 1QQCA 3H6EA 4MDBA 3M6GA 4BWJA 3BUZB 3F73A 2GX9A 4IG3A 4K0KK 3ULEA 3TSQA 3SAFA 2HMPA 4BRGA 2HHSA 1X9WA 4ILHA 3NVKA 3O1WA 4DV3K 3BP8A 3AVGA 3C6TA 3CJ9A 1X3MA 3P83D 4RWTA 1MWMA 1TUUA 3NGZA 3AGRA 4KHYA 1Z6RA 3O4QA 5CR4A 3CD6N 5A2QO 1U6ZA 2GUPA 5ADXH 5C0YA 4LF7K 3ZLJA 3VQDA 3VGLA 3TAQA 4H5NA 4DV7K 4M42A 5CYMA 4BQLA 4PUOA 1BIUA 1RTDA 5EX5A 3PIOL 1KC8O 4EHTA 4CJ4A 4DTXA 3CQXA 3L2VA 4FK0A 3CF5L 4EIAA 1SL2A 1GLCG 4BRKA 4X64K 4CEFA 1ZBUA 4AF1A 1J9AA 1J6ZA 3V9XA 4OPJA 1X9JA 1VSMA 3VQ8A 2HVIA 4KB0A 3I55N 1LWCA 2OPPA 1XNRK 3IDHA 2E6MA 2Q97A 4CZHA 2QWPA 4KRFA 4FM1A 4CJTA 4QOZB 1CZBA 5E26A 3ENHA 4AHSA 1B92A 4O5FA 3DLEA 3LP1A 1FJGK 5LMUK 1UOCA 1RBVA 4JYAK 4W5OA 4WE1A 1BHLA 2ZQBA 1SKSA 5J2MA 3N4QA 2HHWA 3WEEA 2YV0X 4M3TA 2VWBA 3O9RA 2ZWHA 3EO3A 2E1ZA 3TAMA 3F2KA 2QK9A 1NGDA 3WNHA 1NKCA 1IBMK 4CZLA 2Y1IA 2YX6A 3CXCM 2P9UA 3H1VX 4KHPK 3OYLA 1OH6A 3SV3A 4PHTX 4GNIA 1VRTA 3TI0A 3FLCO 4JI5K 2I5JA 1S1VA 5GAGP 3BDPA 3JSMA 3P1GA 3C94A 4CIGA 5FROA 4B1XB 4RTFD 3ULDA 4NCAA 3R3LA 5AZIA 5KQ8A 4W5NA 5FPDA 4L8RB 1SUQA 3GL1A 4RW8A 1TYQA 4BR5A 3O9UA 1NGAA 2VG7A 2KKZA 3AVHA 5AQFA 3V81A 4FWPA 1GOCA 2P9KA 2KQ2A 1MA9B 4ILGB 1LW0A 2Y1JA 4CJ3A 2AP1A 4CJ5A 4FJKA 4CJEA 4E7IA 3HBTA 3ATUA 4F4KA 5LL6Z 2BGGA 3SUNA 4KH4A 4CFAA 2WFBA 5AJ3K 4HHTA 3PV8A 3E9PA 1RFQA 4FWKA 3DMJA 2QXFA 4RG8A 5AQSA 1EXQA 4CEEA 4AQYK 2QA4N 3CM5A 4FWSA 4CF8A 1ASUA 2YHYA 4ILJA 4CK3A 4NCBA 2DTUA 4FLYA 3SJHA 3QETA 1ZBFA 3ZEUB 2EWSA 3ZT0A 4CF0A 3PX4A 3ISNC 1DTTA 1T3VA 4CW7B 1IKYA 4EP5A 1YXQA 4ID5A 2E8AA 3WUHA 1KAXA 2GWKA 4B1ZA 4H5RA 4DR7K 4BRNA 3O3HA 3ITHA 1KLMA 2Z1HA 4O8KA 1HKCA 3OYAA 4B3MK 3BZKA 2QWRA 3HRGA 4CGJA 1IJJA 3HOTA 1ZYQA 2YI1A 4CHNA 4FZYA 2Q36A 1BI4A 1QZ6A 1RCHA 3KLGA 4N41A 3VQPA 4O5BA 1TKTA 5KTQA 3PX6A 3KZBA 4BY9C 4B1UB 3QB0A 3OBWA 3THWB 3L8BA 1SKWA 2YNHA 3M8RA 2RKIA 4JKBA 3NDKA 4E7LA 3J81O 3MEEA 4KHUA 3MN7A 4GV6A 4E7HA 2P9SB 5C2FA 3TANA 2WUSA 1VAZA 1IG9A 4JD2A 2O8CA 4M3UA 1DLOA 3IKMA 3QFPA 2F9WA 3DOKA 2P51A 1K8AO 2P9PA 4J2EA 1LWEA 3D2EA 1Q82O 4JI6K 4BACA 3PX0A 3CG7A 4B1YB 1LWFA 4FWOA 1JLFA 4DTPA 1VQPN 4W5QA 3OYFA 3TTCA 3HO1A 1JKHA 4V19S 1N6QA 3KHYA 1TK0A 2PYLA 2RHKA 4DU1A 1ZXOA 3KIOA 4WCEL 2P9IB 1RBTA 3AA2A 1VSKA 5FPEA 3D45A 2VQEK 3FE1A 4YFUA 3PUFA 4BWMA 3OYNA 2A41A 2E4LA 4HUGA 3GDQA 5BR9A 1JLCA 4KKOA 2YCHA 5KGXA 4LF4K 4M3ZA 3M8PA 3DRSA 4B9QA 5TKYA 3K9KA 4TSXA 1HPZA 4HWIA 1VSHA 3CC2N 4PKIA 3MEDA 3RRHA 3ZT2A 1VQ7N 3ZSWA 3K9JA 3BEXA 5D3GA 3FFKB 2OCEA 3RTVA 3T1HK 3FZMA 4DV1K 1VSFA 3Q7CA 4C8OA 3CYMA 3DXMB 4CZFA 4BE2A 1WSIA 1JLAA 1VSLA 3FZLA 1G99A 3VQCA 1QHTA 2F8TA 4J2DA 5K14A 3NCIA 4B9VA 4DQ8A 1XC3A 1S1WA 2P9NA 1T7PA 4JI2K 1TK8A 3ZYYX 2H3GX 2E2QA 4Z4EA 1RDUA 5AQIA 2HNZA 2YJEA 4FXDA 5BRHA 5FPNA 4N5SA 2D0PA 2VG5A 4OX9K 4BR2A 4H0YB 4BROA 1NGJA 3O3FA 3ZT1A 2W41A 1ITGA 3HPGA 3M1FA 1VHXA 2V7YA 3U8XA 3LZJA 4CIFA 4DTJA 4KI4A 3LANA 4B1VA 2XY5A 4C1NK 4DQRA 1OKJA 4E7JA 2A3ZA 2DY4A 3R9PA 2X6NA 3K5OA 4NLBA 5EVZA 4FOEA 2RPIA 2HBKA 4DTSA 1YI2N 1JJ2M 1OVYA 3WQUA 2IC3A 1W97L 2BTFA 1TKXA 4WF9L 4QAGA 2GUIA 3ZSOA 3SK3A 2X6SA 1U2VB 4QS9A 1NK8A 4JRPA 4DCHA 3TTFA 2EHGA 4PA1A 3T69A 2YNFA 3WEEB 3OY9A 1VQKN 1BA0A 4B3TK 2ASOA 2FF6A 3VF6A 4BGBA 5I3UA 3C6AA 5F0XA 3SQ2A 1BCOA 3OW2M 1TKZA 5KPTA 4CJSA 3KLEA 3HSTB 3SAHA 3MN6A 2P9UB 1HQUA 3JXUA 1BUPA 4A5AA 4B8CA 4ELUA 4BG8A 5I9EB 4MO5A 3KKSA 3E9LA 5C15A 3FZKA 1QVFM 5KPRA 3SNNA 3IG1A 4JI4K 3AVFA 3NMUA 4DU3A 4KHWA 1U48A 4OO1J 4B3RK 5GAEP 4GMJB 5SZTA 4FM0A 3ENOA 3QEPA 3LWMA 4IWVA 4BR9A 2BE2A 1N8RO 1RDBA 4K42A 4FCYA 3DI6A 4KPYA 4E1NA 2QKBA 4LC9B 2Z1JA 3OHRA 3HL8A 3Q7BA 4O0JA 4B9NA 2PY5A 1HNXK 2HB5A 3OBYA 4ICLA 1NJZA 4LFCK 3NF9A 4BGAA 3ZEUA 1BQMA 2YJFA 2GBZA 1RTIA 3NGIA 3AGKA 3LDLA 2DFEA 4DHYA 3SQ1A 4JN4A 4B3OA 2QWQA 2P9KB 2GWJA 3LDSA 3O8MA 1F21A 1N36K 3RMAA 2G8FA 4JKAA 3VPZA 5BRFA 1YJNN 1XHZA 1XUPO 3V9WA 4YDUC 4B9LA 1RTHA 2I7PA 1RBSA 4Y0WA 4YOVA 2ETJA 3C95A 2B4JA 5C25A 1NOZA 1K6YA 4FOIA 3VMFB 1QSYA 2A6AA 4FJXA 2RE2A 1RBUA 2JLEA 3SUOA 2RN2A 2E20A 1WAFA 3EZWA 3BF3A 1JLEA 2YHXA 1A5VA 4YORA 4JNEA 3TAGA 3HI0A 3AVBA 4M7YA 3DLBA 2NUBA 1NGFA 2ASPA 1DTQA 1EWRA 3G6EN 2FBYA 3VTHA 3J7YP 4H4OA 3UE5A 1VQ8N 2QM1A 3ZSVA 4OGEA 3SQ0A 1KSPA 2YKMA 4HUFA 2NRHA 2E2NA 1NGHA 3MCAB 5FPMA 5BN9A 4ZTFA 3B6OA 4FWRA 1BI4B 4KB1A 4GY2B 4BDYA 3KVGA 4J2AA 3G25A 4FJHA 3TABA 4GKJK 4E89A 4KHQA 3VEYA 2E2PA 1EX4A 4BRHA 4DR6K 4NXMK 1DKGD 4IJNA 3OJUA 4IG0A 4W5TA 1T44A 3EE8A 4CEDA 2I7NA 4BDZA 2OPSA 4CJRA 2KFNA 3OYJA 4CZGA 1X3NA 2WOMA 3VEXA 3AARA 2YHAA 2G8VA 4BVPA 4JD2B 5AQWA 4CK1A 2O8CB 1C0FA 5HBMA 2E5LK 2FBTA 3CMEN 5CY4A 3QMLA 4A62A 3PIPL 3CJBA 5KI6A 5LY3A 1S72N 3UB5A 2P9PB 5BRDA 1TVRA 4MDAA 4CECA 3D2EB 5M1FA 5AZJB 4FLXA 3MN9A 4DV5K 4CHZA 2CGKA 4CCHA 4CGHA 1E4FT 2V7ZA 1CZ9A 1TAUA 1TAQA 4E3SA 1WAJA 4WQ4A 3L2UA 4DFJA 2FC0A 4CERA 3DXMA 3HSCA 3NHGA 4LFBK 1A5WA 1B9DA 1YVNA 2XRIA 4DTRA 1HYVA 4F2SA 4OPAA 3AO5A 1W9HA 1D4XA 1VRUA 4LF8K 4FJGA 2XO7A 4B9SA 2FBVA 3FZFA 1BIZA 2HHQA 2UXBK 4PKGA 1ILYA 3LM2A 4ISGA 1NJXA 2GV9A 2QWMA 4K8XA 3A2FA 3J8AA 1IG8A 1DT9A 4CFCA 4DF8A 3AVAA 4DTNA 5KPZA 4IO8A 4C1NI 5EOYA 4N47A 2Q0UA 4FJ9A 1WB9A 4KAZA 2X74A 4HUEA 3PO5A 3EY1A 4C8KA 4DV0K 3L0QA 1NJIO 4M3YA 4FJ8A 4JS4A 5EXWA 2FSKA 4QS8A 3VEOA 3CQYA 1MWKA 2NNWA 5HLFA 3EE9A 3JS6A 3J7ZO 2Z1GA 4ZHRA 1W7AA 4YY3K 3AVNA 1S1TA 1U2VA 3SJJA 3VGMA 1NK9A 4FJNA 2P9NB 3AAQA 3ZX2A 1NGGA 4LF5K 1WNSA 4JHDB 5GINA 2FLOA 4F9OA 1C0GA 3KK3A 1BG3A 4A2AA 4PL8A 4DB3A 3E1YA 3SMSA 2W6LA 3V9SA 1C0TA 3LDQA 4DTOA 4CGDA 5FDLA 3THVA 4OPHA 1CLQA 3CCEN 4YOWA 3MX2A 3ZX3A 2HW3A 3S3NA 1GLJO 4F8RA 4Z4FA 4BC4A 3SPZA 5HL7L 1S6PA 3QO9A 3O9TA 2G8HA 2CH6A 3LPUA 3OS1A 4C8LA 3OYCA 2V52B 1BDGA 2FSJA 4CD1A 4X66K 1T03A 3WXMB 2UU9K 2G8IA 3W3DA 2HNDA 3CJ1A 4FW2A 3WNEA 3GBTA 4EFHA 1W0HA 2HBLA 4HCBA 4IBNA 5MLCQ 4WQ5C 3I8DA 2ZD1A 5AQQA 2ZJPL 4Z4CA 3OS2A 1GLAG 2BDPA 3PLAA 5T7BA 1K8KB 4JS5A 3QNOA 2B6AA 4IOCL 1NGEA 4Z4GA 3WXKA 4OJRA 3L3UA 4PY5A 5AQNA 5SWMA 3K59A 1NLVA 4FZXC 4PL7A 2HHXA 1ESVA 4CJLA 2UUCK 3K5NA 4IFEA 5BR8K 3LDOA 1T05A 4CBUA 3TAPA 3WNFA 4CEOA 3AVIA 4FWMA 3QBWA 4B9TA 3OYEA 4K41A 4CEQA 1BCMA 1SS6A 3O3GA 1QTMA 4X65K 2UYTA 2DFFA 4RW6A 1OVQA 1S5JA 4AM7A 3FGUA 1H1VA 1YITN 3CC4N 2OPQA 1HQEA 1DGKN 1YT3A 3MXJA 1GLDG 5JLFA 4YNQA 4HCCA 1NBWA 1NU0A 3KKRA 3SLCA 4JK8A 3MCPA 3AV9A 4Z4IA 4CJQA 2UXDK 4FJIA 3OYKA 4W5RA 2ZGYA 5HP1A 1SV5A 2ZE2A 4FO0A 4BG9A 4EZ9A 3VOVA 1KAYA 3TSPA 5J2NA 2D0OA 3VESA 3ID8A 3O5BA 4FLVA 4CGGA 1VK0A 3DM2A 3U9ZA 3QEVA 1HR0K 4N76A 4IJAA 4I9LA 1S9GA 3RR7A 1TL1A 1IH7A 4H0XB 4IFVA 4DFPA 3SI6A 4O4GA 5EY4A 1TKDA 1QSSA 2BANA 3RMCA 3F5TA 2IAJA 3M8QA 1HMVA 4JK7A 3OYHA 1S22A 4PQUA 3KLFA 1HLUA 3G71N 2QXLA 3VQ4A 4Z94A 3TSUA 1BISA 3SAGA 4I6MA 4KHSA 3MWPA 2QKKA 4CEZA 4OVLA 1KVBA 2A1SA 3KK1A 1O13A 1KLNA 3D6RA 4CHYA 3RR8A 3CCRN 4BE0A 2F9TA 5AFUH 5AZJA 5C24A 1Z25A 1NKBA 4O0IA 3DXKA 4DSFA 3RWUA 4CIEA 2QWNA 2BH1A 1VQNN 1U49A 3PSFA 1WBDA 4BREA 1NNEA 1VQON 1UWBA
chains in the Genus database with same CATH topology
4NYFA 1WSGA 3SQ2A 1VSEA 1BCOA 3MXMA 2G8KA 4OLBA 1TKZA 4AHVA 1FKOA 4FVMA 3CFOA 4CJSA 3KLEA 3HSTB 2HHUA 1L3TA 3AA3A 1HQUA 4O55A 3TR8A 1KTQA 3AA5X 4OLAA 4B8CA 3G10A 4NYNA 4ELUA 4GW6A 3VQQA 3KKSA 5J2QA 2OZMA 3HPHA 3HYFA 3SNNA 3V1QA 3VQAA 4CGFA 3IG1A 1EETA 4DQSA 4DFMA 3AVFA 4DU3A 4KHWA 1REVA 3D0PA 1R0AA 1U48A 1RT2A 4GMJB 5SZTA 4CFDA 1I39A 3NAEA 4FM0A 4Q5VA 3QEPA 1QQCA 2YNIA 3LWLA 4FJMA 3LWMA 3S3MA 1KFSA 4B9MA 2BE2A 1Q8IA 3K57A 1RDBA 4DLGA 4FCYA 3DI6A 3V1RA 3E01A 4BWJA 1C1CA 3F73A 3SQ4A 4E1NA 4KPYA 2QKBA 4CFBA 4IG3A 4B9UA 2Z1JA 3OS0A 3HL8A 3AO4A 4O0JA 4B9NA 5HRNA 2HVHA 2PY5A 4DMNA 2HB5A 4ICLA 1NJZA 3NF9A 1BQMA 2HHSA 2GBZA 1RTIA 3NGIA 1X9WA 5E41A 2DFEA 3SQ1A 2HHTA 4QCLA 3AVGA 3C6TA 4B3OA 3P83D 3LDSA 2DFHA 4FLUA 5J2PA 1F21A 4DQIA 4DS5A 3RMAA 3NGZA 3LP0A 4KHYA 3K5MA 2G8FA 3O4QA 4DTUA 2G8WA 2EX3A 2P5GA 3SPYA 4B8AB 1X1PA 4MFBA 1XHZA 3V9WA 4B9LA 1RTHA 1BL3A 3HP9A 5KGWA 1ASVA 1RBSA 3VQDA 4CESA 3TAQA 1EKEA 2ETJA 4FM2A 3C95A 2B4JA 4M42A 5CYMA 4CJFA 1LAVA 1NK0A 1NK5A 4PUOA 3VQ7A 1NOZA 3VQEA 1HJRA 1K6YA 2FBXA 5C25A 4DSLA 1BIUA 2XY8A 1RTDA 1HNIA 4M3XA 4CJ4A 4DTXA 4DLEA 3L2VA 3V4IA 4FK0A 1QSYA 4FJXA 1RBUA 1QE1A 3NH1A 2JLEA 3SUOA 2HNYA 4FLZA 1J53A 1SL2A 1RT1A 2RN2A 4CEFA 1WAFA 1ZBUA 3CFRA 1NK7A 1J9AA 3V9XA 4OPJA 1YVUA 3NE6A 2AJQA 1VSMA 1JLEA 3F9KA 3VQ8A 1A5VA 3LALA 3TAGA 4KB0A 2HVIA 1JLBA 1LWCA 2OPPA 3AVBA 3QESA 3ZSZA 3DLBA 2NUBA 3H08A 3IAYA 1DTQA 2E6MA 2B5JA 3NF6A 3TAEA 4KRFA 4FM1A 4CJTA 4QOZB 1CZBA 2FBYA 2R7YA 4AHSA 1B92A 2D0BA 3DLEA 3ALYA 3LP1A 4H4OA 4CJWA 4E0DA 1ASWA 4JLHA 3ZSVA 2O4GA 4OGEA 1UOCA 3OYMA 1U04A 1RBVA 3SUQA 3SQ0A 1KSPA 3I0SA 3AO3A 1BHLA 4WE1A 4W5OA 2YKMA 2ZQBA 3CM6A 1SKSA 3OVNA 5J2MA 4HUFA 2VG6A 2HHWA 4R5PA 2YV0X 4ZTFA 4FJLA 4M3TA 3HK2A 3B6OA 3ZT4A 3AO1A 3T3FA 3U6FA 2D5RA 3TAMA 1BI4B 4KB1A 2QK9A 3V9ZA 4BDYA 4IFYA 2F96A 3WNHA 1NK4A 3QEWA 1RTJA 4J2AA 2F8SA 1NKCA 2Q3SA 4FJHA 3TABA 4E89A 2Y1IA 1B9FA 3QEIA 3P5JA 4KHQA 3KLHA 1JXBA 1S1XA 2X78A 1EX4A 4AHRA 1D5AA 1HNVA 3OJUA 3NBPA 4IG0A 4LSNA 4W5TA 2IDOA 3OYLA 3L3VA 1FXXA 4AHCA 3SV3A 3I0RA 1RDAA 5DK5A 3ZCMA 4CEDA 4BDZA 2OPSA 4CJRA 3VA3A 1ZBIA 3OYJA 2KFNA 1VRTA 3TI0A 2WOMA 4FK4A 5DMRA 4KV8A 2XY6A 2I5JA 1S1VA 3BDPA 3LAKA 1C0UA 3VN5A 2YHAA 3P1GA 3C94A 3HVTA 1XHXA 3JSMA 2G8VA 4OGCA 4CIGA 4CK1A 4K8ZA 5HBMA 5FROA 1C1AA 3KD1E 3U3YA 2FBTA 4O44A 3ULDA 4NCAA 4I2PA 5CY4A 3V1OA 3O4NA 4EP4A 3MXIA 3K5LA 1C1BA 5KI6A 1TVRA 4CECA 4W5NA 4L8RB 1SUQA 2YKNA 4OPKA 4FLXA 4RW8A 1YTUA 1RDDA 3CQ8A 3KJVA 4CHZA 4LSLA 4CCHA 3ZSXA 4CGHA 2VG7A 3V81A 3AVHA 1CZ9A 4CF9A 4FJJA 1TAUA 1GOCA 1TAQA 1Z26A 3SV4A 4F3TA 4KI6A 1LV5A 2KQ2A 4LH4A 4E3SA 3IS9A 1WAJA 3VQ6A 1LW0A 2WONA 4DWIA 1SL0A 1TK5A 1VSIA 4RW7A 3ZSQA 4E7KA 4CJ3A 1WSFA 3L2UA 3VQ9A 2Y1JA 4DFJA 2FC0A 4CERA 1RNHA 4CJ5A 4FJKA 4Q0BA 4AHUA 4CHPA 3DRPA 3NHGA 4CJEA 4E7IA 2YHBA 3QIPA 4DFKA 1A5WA 1S9EA 1L5UA 1B9DA 2XRIA 3NF7A 4DTRA 1HYVA 4CHOA 4JRQA 4F4KA 1J54A 3SZ2A 3MEGA 1IKXA 4Z0UA 4F2SA 2BGGA 1XWLA 3SUNA 4CFAA 3AO5A 4HHTA 3PV8A 1W9HA 1D9FA 1QS4A 4EZ6A 1CXUA 2VWKA 1JXEA 1VRUA 2QXFA 3DMJA 4RG8A 3NF8A 1IO2A 4M41A 3T1AA 4XIUA 1KVAA 3IRXA 2XO7A 4FJGA 4B9SA 1GOBA 2FBVA 2HHQA 1BIZA 1EXQA 4CEEA 3LZIA 4ELTA 3SYZA 1NJXA 2GV9A 4CHQA 4K8XA 3CM5A 3QNNA 3A2FA 3NFAA 4CF8A 1ASUA 3SCXA 3OYGA 4CFCA 4CK3A 1I3AA 4DF8A 4FLYA 4NCBA 2DTUA 3QETA 5CZ2A 2YNGA 3AVAA 2ATQA 1ZBFA 3AVJA 3PY8A 1S1UA 4DTNA 2OYQA 4F3OA 3ZT0A 4CF0A 3PX4A 3ISNC 1DTTA 1BGXT 1WSJA 4N47A 3DLKA 4FJ9A 5JS2A 4CJKA 1IKYA 3RMBA 4EP5A 3V6DA 4KAZA 2X74A 4ID5A 1NJWA 4HUEA 3KK2A 4CJUA 3EY1A 3PO5A 3LAMA 4C8KA 1VSJA 4M3YA 1RT5A 3QLHA 2D0CA 3O3HA 4FJ8A 4JS4A 3ITHA 1KLMA 3OYDA 2Z1HA 1L3SA 4CJVA 3EZ5A 3S3OA 4M3RA 3OYAA 4CGIA 3JYTA 5HLFA 1SL1A 4CGJA 1WLJA 1ZYQA 4CHNA 1IKWA 2G8UA 2Z1GA 4FZYA 4CEAA 4ZHRA 3AVNA 1BI4A 4BDPA 1RBRA 1RCHA 1S1TA 3HPOA 4RW9A 3K58A 3AVMA 3KLGA 3SJJA 4N41A 1NK9A 3VQPA 3M8SA 4O5BA 2HMIA 1TKTA 4FJNA 5KTQA 3PX6A 4FYDA 1HYZA 3U3GA 2KTQA 3QEXA 3DLRA 4E19A 3L8BA 1SKWA 5J1EA 1WNSA 2YNHA 1GOAA 3M8RA 2RKIA 3L2QA 1ZBLA 5FRNA 3DYAA 3NDKA 4E7LA 1UA1A 5KRTA 4KREA 3MEEA 4KHUA 1C0MA 4CF1A 1O1WA 1U47A 4I9QA 3KK3A 1NOYA 4E7HA 1HRHA 3TANA 1RT3A 1X9SA 3RMDA 1Q9YA 1IG9A 3ZSYA 3FFIA 3QINA 2VWJA 4M3UA 4KFBA 5JS1A 3V9SA 1DLOA 2OPRA 4J2BA 1C0TA 4DTOA 3THVA 4CGDA 1S6QA 5FDLA 1L3UA 4CF2A 1JL1A 3LP3A 1CLQA 3AVCA 3DOKA 2HW3A 3S3NA 2P51A 4F8RA 4J2EA 4Z4FA 3SPZA 1LWEA 3DLHA 4H8KA 4M3WA 4OKEA 1S6PA 2RF2A 3QO9A 1NK6A 2O4IA 4BACA 2G8HA 3PX0A 4CE9A 1J5OA 3CG7A 3LPUA 1LWFA 3OS1A 4C8LA 3QERA 3SUPA 3OYCA 1XI1A 1UAXA 5CZ1A 1JLFA 4DTPA 4W5QA 1NJYA 3OYFA 4DSIA 3L2RA 1T03A 3OYIA 1JKHA 3ZT3A 1UA0A 1ZBHA 3HO1A 1D8YA 2G8IA 2HNDA 4DG1A 1L3VA 1N6QA 1TK0A 3C6UA 4DU1A 2PYLA 3B6PA 3NGYA 4FW2A 3KIOA 3LPTA 3WNEA 5HRPA 4DSEA 1W0HA 4HCBA 1C6VA 4H4MA 4IBNA 1RBTA 3AA2A 4FK2A 2KW4A 1LW2A 4BE1A 1VSKA 3I8DA 3HXMA 2ZD1A 3HVRA 1JLQA 3CFPA 1HYSA 2XY7A 4ZTJA 3D45A 4Z4CA 5EU7A 3OS2A 3UIQA 4YFUA 3PUFA 4BWMA 3OYNA 2BDPA 2E4LA 1RT7A 5KRSA 5T7BA 4HUGA 5I42A 4IDKA 4JS5A 3QNOA 2B6AA 1JLGA 1JLCA 4KKOA 4Z4GA 5KGXA 4Y1CA 3MAQA 1NKEA 1KRPA 3PO4A 4I7FA 4OJRA 4M3ZA 3M8PA 3L3UA 4PY5A 3DRSA 5SWMA 2KFZA 4FJ7A 3K59A 4FZXC 4M45A 2HHXA 1MU2A 4CJLA 3K5NA 4DS4A 1KVCA 4GVMA 4TSXA 3BGRA 1HPZA 1IKVA 4CK2A 3HM9A 1VSHA 4DSJA 4CJPA 1LAWA 1T05A 3ASMA 3MEDA 3TAPA 4OKKA 3WNFA 4CEOA 3AVIA 4E1MA 3RRHA 1Q9XA 3KD5E 4B08A 3ZT2A 4PWDA 3ZSWA 4CEBA 4B9TA 5D3GA 3OYEA 4DQQA 4KTWA 4CEQA 1BCMA 4NCGA 4HTUA 3OYBA 2LSNA 3O3GA 4DF4A 2E6LA 2W42A 3RTVA 2A1RA 4FLWA 4HVJA 1WN7A 4KO0A 5FRMA 1QTMA 2DFFA 3QIOA 2Z1IA 1VSFA 4RW6A 3TARA 1S5JA 4AH9A 3WNGA 1Y97A 1TV6A 3CYMA 1BQNA 1HQEA 1RT6A 2OPQA 4C8OA 4BE2A 1WSIA 1YT3A 3MXJA 1JLAA 4Z4HA 3LP2A 3VQ5A 1VSLA 4LD0A 1U45A 4KHNA 4FLTA 4YNQA 4HCCA 2IGIA 4DQPA 4C8NA 1X9MA 3KKRA 3VQCA 1QHTA 4FW1A 4J2DA 2F8TA 1WSEA 1G15A 5K14A 3NCIA 3AV9A 1QSLA 4B9VA 4Z4IA 2KZMA 4KTZA 4CJQA 4FJIA 3DOLA 4W5RA 3OYKA 1S1WA 4OKJA 1SV5A 2ZE2A 5C42A 5HP1A 1N5YA 4FZZA 4LH5A 1T7PA 4EZ9A 1A5XA 1RILA 3HT3A 4LY7A 4AHTA 1TK8A 2PZSA 3AVLA 3NH2A 1WSHA 5J2NA 1U4BA 4F2RA 4IKFA 4Z4EA 1JL2A 4FLVA 2HNZA 4CGGA 1VK0A 3MECA 3DM2A 4FXDA 3K2PA 1KCFA 3QEVA 4UQGA 4N76A 4C8MA 4N5SA 2VG5A 4AILC 4I9LA 1S9GA 4N56A 2XHBA 3RR7A 1KFDA 1TL1A 3O3FA 1IH7A 3ZT1A 4IFVA 3L2WA 1ITGA 4DFPA 3SI6A 1XC9A 2KZZA 2P5OA 3HPGA 4O4GA 5CYQA 3NH0A 3LZJA 1TKDA 1QSSA 2BANA 3RMCA 4FJ5A 2OA8A 2IAJA 4CIFA 1FK9A 4DTJA 4KI4A 3M8QA 2OZSA 3LANA 4DU4A 1HMVA 1TGOA 2XY5A 1FKPA 4G1QA 4E7JA 4DQRA 4DSKA 2DY4A 3AA4A 1SKRA 2X6NA 3OYHA 4PQUA 3K5OA 3KLFA 3OJSA 3HP6A 3VQBA 2RPIA 3TAFA 4MQ3A 3VQ4A 3ZSRA 2ITGA 1BISA 3KLIA 4DTSA 2PYJA 4KHSA 2QKKA 4CEZA 2IC3A 4Y1DA 4OVLA 1RDCA 1D9DA 1KVBA 2IOCA 2A1SA 3KK1A 1CXQA 1TKXA 4RW4A 2D0AA 1TL3A 4QAGA 1RT4A 3AO2A 2GUIA 3ZSOA 3VA0A 1KLNA 3KTQA 4CHYA 2HHVA 3AVKA 3RR8A 1YTAA 2X6SA 1NK8A 4JRPA 4I2QA 4BE0A 2P1JA 1EP4A 3EYZA 5HRSA 4DTMA 2EHGA 3DRRA 4PA1A 3TWHA 3V9UA 3RRGA 2JGUA 2YNFA 5C24A 1Z25A 3OY9A 4ELVA 1NKBA 4O0IA 3RWUA 2IS3A 4DSFA 1VSDA 4CIEA 3T19A 1U49A 5I3UA 4KTQA 3HJFA 1UWBA 4ID1A 1T8EA 3DLGA 5HROA 3G0ZA 5HRRA 3S9HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NYF A;  1WSG A;  3SQ2 A;  1VSE A;  1BCO A;  3MXM A;  2G8K A;  4OLB A;  1TKZ A;  4AHV A;  1FKO A;  4FVM A;  3CFO A;  4CJS A;  3KLE A;  3HST B;  2HHU A;  1L3T A;  3AA3 A;  1HQU A;  4O55 A;  3TR8 A;  1KTQ A;  3AA5 X;  4OLA A;  4B8C A;  3G10 A;  4NYN A;  4ELU A;  4GW6 A;  3VQQ A;  3KKS A;  5J2Q A;  2OZM A;  3HPH A;  3HYF A;  3SNN A;  3V1Q A;  3VQA A;  4CGF A;  3IG1 A;  1EET A;  4DQS A;  4DFM A;  3AVF A;  4DU3 A;  4KHW A;  1REV A;  3D0P A;  1R0A A;  1U48 A;  1RT2 A;  4GMJ B;  5SZT A;  4CFD A;  1I39 A;  3NAE A;  4FM0 A;  4Q5V A;  3QEP A;  1QQC A;  2YNI A;  3LWL A;  4FJM A;  3LWM A;  3S3M A;  1KFS A;  4B9M A;  2BE2 A;  1Q8I A;  3K57 A;  1RDB A;  4DLG A;  4FCY A;  3DI6 A;  3V1R A;  3E01 A;  4BWJ A;  1C1C A;  3F73 A;  3SQ4 A;  4E1N A;  4KPY A;  2QKB A;  4CFB A;  4IG3 A;  4B9U A;  2Z1J A;  3OS0 A;  3HL8 A;  3AO4 A;  4O0J A;  4B9N A;  5HRN A;  2HVH A;  2PY5 A;  4DMN A;  2HB5 A;  4ICL A;  1NJZ A;  3NF9 A;  1BQM A;  2HHS A;  2GBZ A;  1RTI A;  3NGI A;  1X9W A;  5E41 A;  2DFE A;  3SQ1 A;  2HHT A;  4QCL A;  3AVG A;  3C6T A;  4B3O A;  3P83 D;  3LDS A;  2DFH A;  4FLU A;  5J2P A;  1F21 A;  4DQI A;  4DS5 A;  3RMA A;  3NGZ A;  3LP0 A;  4KHY A;  3K5M A;  2G8F A;  3O4Q A;  4DTU A;  2G8W A;  2EX3 A;  2P5G A;  3SPY A;  4B8A B;  1X1P A;  4MFB A;  1XHZ A;  3V9W A;  4B9L A;  1RTH A;  1BL3 A;  3HP9 A;  5KGW A;  1ASV A;  1RBS A;  3VQD A;  4CES A;  3TAQ A;  1EKE A;  2ETJ A;  4FM2 A;  3C95 A;  2B4J A;  4M42 A;  5CYM A;  4CJF A;  1LAV A;  1NK0 A;  1NK5 A;  4PUO A;  3VQ7 A;  1NOZ A;  3VQE A;  1HJR A;  1K6Y A;  2FBX A;  5C25 A;  4DSL A;  1BIU A;  2XY8 A;  1RTD A;  1HNI A;  4M3X A;  4CJ4 A;  4DTX A;  4DLE A;  3L2V A;  3V4I A;  4FK0 A;  1QSY A;  4FJX A;  1RBU A;  1QE1 A;  3NH1 A;  2JLE A;  3SUO A;  2HNY A;  4FLZ A;  1J53 A;  1SL2 A;  1RT1 A;  2RN2 A;  4CEF A;  1WAF A;  1ZBU A;  3CFR A;  1NK7 A;  1J9A A;  3V9X A;  4OPJ A;  1YVU A;  3NE6 A;  2AJQ A;  1VSM A;  1JLE A;  3F9K A;  3VQ8 A;  1A5V A;  3LAL A;  3TAG A;  4KB0 A;  2HVI A;  1JLB A;  1LWC A;  2OPP A;  3AVB A;  3QES A;  3ZSZ A;  3DLB A;  2NUB A;  3H08 A;  3IAY A;  1DTQ A;  2E6M A;  2B5J A;  3NF6 A;  3TAE A;  4KRF A;  4FM1 A;  4CJT A;  4QOZ B;  1CZB A;  2FBY A;  2R7Y A;  4AHS A;  1B92 A;  2D0B A;  3DLE A;  3ALY A;  3LP1 A;  4H4O A;  4CJW A;  4E0D A;  1ASW A;  4JLH A;  3ZSV A;  2O4G A;  4OGE A;  1UOC A;  3OYM A;  1U04 A;  1RBV A;  3SUQ A;  3SQ0 A;  1KSP A;  3I0S A;  3AO3 A;  1BHL A;  4WE1 A;  4W5O A;  2YKM A;  2ZQB A;  3CM6 A;  1SKS A;  3OVN A;  5J2M A;  4HUF A;  2VG6 A;  2HHW A;  4R5P A;  2YV0 X;  4ZTF A;  4FJL A;  4M3T A;  3HK2 A;  3B6O A;  3ZT4 A;  3AO1 A;  3T3F A;  3U6F A;  2D5R A;  3TAM A;  1BI4 B;  4KB1 A;  2QK9 A;  3V9Z A;  4BDY A;  4IFY A;  2F96 A;  3WNH A;  1NK4 A;  3QEW A;  1RTJ A;  4J2A A;  2F8S A;  1NKC A;  2Q3S A;  4FJH A;  3TAB A;  4E89 A;  2Y1I A;  1B9F A;  3QEI A;  3P5J A;  4KHQ A;  3KLH A;  1JXB A;  1S1X A;  2X78 A;  1EX4 A;  4AHR A;  1D5A A;  1HNV A;  3OJU A;  3NBP A;  4IG0 A;  4LSN A;  4W5T A;  2IDO A;  3OYL A;  3L3V A;  1FXX A;  4AHC A;  3SV3 A;  3I0R A;  1RDA A;  5DK5 A;  3ZCM A;  4CED A;  4BDZ A;  2OPS A;  4CJR A;  3VA3 A;  1ZBI A;  3OYJ A;  2KFN A;  1VRT A;  3TI0 A;  2WOM A;  4FK4 A;  5DMR A;  4KV8 A;  2XY6 A;  2I5J A;  1S1V A;  3BDP A;  3LAK A;  1C0U A;  3VN5 A;  2YHA A;  3P1G A;  3C94 A;  3HVT A;  1XHX A;  3JSM A;  2G8V A;  4OGC A;  4CIG A;  4CK1 A;  4K8Z A;  5HBM A;  5FRO A;  1C1A A;  3KD1 E;  3U3Y A;  2FBT A;  4O44 A;  3ULD A;  4NCA A;  4I2P A;  5CY4 A;  3V1O A;  3O4N A;  4EP4 A;  3MXI A;  3K5L A;  1C1B A;  5KI6 A;  1TVR A;  4CEC A;  4W5N A;  4L8R B;  1SUQ A;  2YKN A;  4OPK A;  4FLX A;  4RW8 A;  1YTU A;  1RDD A;  3CQ8 A;  3KJV A;  4CHZ A;  4LSL A;  4CCH A;  3ZSX A;  4CGH A;  2VG7 A;  3V81 A;  3AVH A;  1CZ9 A;  4CF9 A;  4FJJ A;  1TAU A;  1GOC A;  1TAQ A;  1Z26 A;  3SV4 A;  4F3T A;  4KI6 A;  1LV5 A;  2KQ2 A;  4LH4 A;  4E3S A;  3IS9 A;  1WAJ A;  3VQ6 A;  1LW0 A;  2WON A;  4DWI A;  1SL0 A;  1TK5 A;  1VSI A;  4RW7 A;  3ZSQ A;  4E7K A;  4CJ3 A;  1WSF A;  3L2U A;  3VQ9 A;  2Y1J A;  4DFJ A;  2FC0 A;  4CER A;  1RNH A;  4CJ5 A;  4FJK A;  4Q0B A;  4AHU A;  4CHP A;  3DRP A;  3NHG A;  4CJE A;  4E7I A;  2YHB A;  3QIP A;  4DFK A;  1A5W A;  1S9E A;  1L5U A;  1B9D A;  2XRI A;  3NF7 A;  4DTR A;  1HYV A;  4CHO A;  4JRQ A;  4F4K A;  1J54 A;  3SZ2 A;  3MEG A;  1IKX A;  4Z0U A;  4F2S A;  2BGG A;  1XWL A;  3SUN A;  4CFA A;  3AO5 A;  4HHT A;  3PV8 A;  1W9H A;  1D9F A;  1QS4 A;  4EZ6 A;  1CXU A;  2VWK A;  1JXE A;  1VRU A;  2QXF A;  3DMJ A;  4RG8 A;  3NF8 A;  1IO2 A;  4M41 A;  3T1A A;  4XIU A;  1KVA A;  3IRX A;  2XO7 A;  4FJG A;  4B9S A;  1GOB A;  2FBV A;  2HHQ A;  1BIZ A;  1EXQ A;  4CEE A;  3LZI A;  4ELT A;  3SYZ A;  1NJX A;  2GV9 A;  4CHQ A;  4K8X A;  3CM5 A;  3QNN A;  3A2F A;  3NFA A;  4CF8 A;  1ASU A;  3SCX A;  3OYG A;  4CFC A;  4CK3 A;  1I3A A;  4DF8 A;  4FLY A;  4NCB A;  2DTU A;  3QET A;  5CZ2 A;  2YNG A;  3AVA A;  2ATQ A;  1ZBF A;  3AVJ A;  3PY8 A;  1S1U A;  4DTN A;  2OYQ A;  4F3O A;  3ZT0 A;  4CF0 A;  3PX4 A;  3ISN C;  1DTT A;  1BGX T;  1WSJ A;  4N47 A;  3DLK A;  4FJ9 A;  5JS2 A;  4CJK A;  1IKY A;  3RMB A;  4EP5 A;  3V6D A;  4KAZ A;  2X74 A;  4ID5 A;  1NJW A;  4HUE A;  3KK2 A;  4CJU A;  3EY1 A;  3PO5 A;  3LAM A;  4C8K A;  1VSJ A;  4M3Y A;  1RT5 A;  3QLH A;  2D0C A;  3O3H A;  4FJ8 A;  4JS4 A;  3ITH A;  1KLM A;  3OYD A;  2Z1H A;  1L3S A;  4CJV A;  3EZ5 A;  3S3O A;  4M3R A;  3OYA A;  4CGI A;  3JYT A;  5HLF A;  1SL1 A;  4CGJ A;  1WLJ A;  1ZYQ A;  4CHN A;  1IKW A;  2G8U A;  2Z1G A;  4FZY A;  4CEA A;  4ZHR A;  3AVN A;  1BI4 A;  4BDP A;  1RBR A;  1RCH A;  1S1T A;  3HPO A;  4RW9 A;  3K58 A;  3AVM A;  3KLG A;  3SJJ A;  4N41 A;  1NK9 A;  3VQP A;  3M8S A;  4O5B A;  2HMI A;  1TKT A;  4FJN A;  5KTQ A;  3PX6 A;  4FYD A;  1HYZ A;  3U3G A;  2KTQ A;  3QEX A;  3DLR A;  4E19 A;  3L8B A;  1SKW A;  5J1E A;  1WNS A;  2YNH A;  1GOA A;  3M8R A;  2RKI A;  3L2Q A;  1ZBL A;  5FRN A;  3DYA A;  3NDK A;  4E7L A;  1UA1 A;  5KRT A;  4KRE A;  3MEE A;  4KHU A;  1C0M A;  4CF1 A;  1O1W A;  1U47 A;  4I9Q A;  3KK3 A;  1NOY A;  4E7H A;  1HRH A;  3TAN A;  1RT3 A;  1X9S A;  3RMD A;  1Q9Y A;  1IG9 A;  3ZSY A;  3FFI A;  3QIN A;  2VWJ A;  4M3U A;  4KFB A;  5JS1 A;  3V9S A;  1DLO A;  2OPR A;  4J2B A;  1C0T A;  4DTO A;  3THV A;  4CGD A;  1S6Q A;  5FDL A;  1L3U A;  4CF2 A;  1JL1 A;  3LP3 A;  1CLQ A;  3AVC A;  3DOK A;  2HW3 A;  3S3N A;  2P51 A;  4F8R A;  4J2E A;  4Z4F A;  3SPZ A;  1LWE A;  3DLH A;  4H8K A;  4M3W A;  4OKE A;  1S6P A;  2RF2 A;  3QO9 A;  1NK6 A;  2O4I A;  4BAC A;  2G8H A;  3PX0 A;  4CE9 A;  1J5O A;  3CG7 A;  3LPU A;  1LWF A;  3OS1 A;  4C8L A;  3QER A;  3SUP A;  3OYC A;  1XI1 A;  1UAX A;  5CZ1 A;  1JLF A;  4DTP A;  4W5Q A;  1NJY A;  3OYF A;  4DSI A;  3L2R A;  1T03 A;  3OYI A;  1JKH A;  3ZT3 A;  1UA0 A;  1ZBH A;  3HO1 A;  1D8Y A;  2G8I A;  2HND A;  4DG1 A;  1L3V A;  1N6Q A;  1TK0 A;  3C6U A;  4DU1 A;  2PYL A;  3B6P A;  3NGY A;  4FW2 A;  3KIO A;  3LPT A;  3WNE A;  5HRP A;  4DSE A;  1W0H A;  4HCB A;  1C6V A;  4H4M A;  4IBN A;  1RBT A;  3AA2 A;  4FK2 A;  2KW4 A;  1LW2 A;  4BE1 A;  1VSK A;  3I8D A;  3HXM A;  2ZD1 A;  3HVR A;  1JLQ A;  3CFP A;  1HYS A;  2XY7 A;  4ZTJ A;  3D45 A;  4Z4C A;  5EU7 A;  3OS2 A;  3UIQ A;  4YFU A;  3PUF A;  4BWM A;  3OYN A;  2BDP A;  2E4L A;  1RT7 A;  5KRS A;  5T7B A;  4HUG A;  5I42 A;  4IDK A;  4JS5 A;  3QNO A;  2B6A A;  1JLG A;  1JLC A;  4KKO A;  4Z4G A;  5KGX A;  4Y1C A;  3MAQ A;  1NKE A;  1KRP A;  3PO4 A;  4I7F A;  4OJR A;  4M3Z A;  3M8P A;  3L3U A;  4PY5 A;  3DRS A;  5SWM A;  2KFZ A;  4FJ7 A;  3K59 A;  4FZX C;  4M45 A;  2HHX A;  1MU2 A;  4CJL A;  3K5N A;  4DS4 A;  1KVC A;  4GVM A;  4TSX A;  3BGR A;  1HPZ A;  1IKV A;  4CK2 A;  3HM9 A;  1VSH A;  4DSJ A;  4CJP A;  1LAW A;  1T05 A;  3ASM A;  3MED A;  3TAP A;  4OKK A;  3WNF A;  4CEO A;  3AVI A;  4E1M A;  3RRH A;  1Q9X A;  3KD5 E;  4B08 A;  3ZT2 A;  4PWD A;  3ZSW A;  4CEB A;  4B9T A;  5D3G A;  3OYE A;  4DQQ A;  4KTW A;  4CEQ A;  1BCM A;  4NCG A;  4HTU A;  3OYB A;  2LSN A;  3O3G A;  4DF4 A;  2E6L A;  2W42 A;  3RTV A;  2A1R A;  4FLW A;  4HVJ A;  1WN7 A;  4KO0 A;  5FRM A;  1QTM A;  2DFF A;  3QIO A;  2Z1I A;  1VSF A;  4RW6 A;  3TAR A;  1S5J A;  4AH9 A;  3WNG A;  1Y97 A;  1TV6 A;  3CYM A;  1BQN A;  1HQE A;  1RT6 A;  2OPQ A;  4C8O A;  4BE2 A;  1WSI A;  1YT3 A;  3MXJ A;  1JLA A;  4Z4H A;  3LP2 A;  3VQ5 A;  1VSL A;  4LD0 A;  1U45 A;  4KHN A;  4FLT A;  4YNQ A;  4HCC A;  2IGI A;  4DQP A;  4C8N A;  1X9M A;  3KKR A;  3VQC A;  1QHT A;  4FW1 A;  4J2D A;  2F8T A;  1WSE A;  1G15 A;  5K14 A;  3NCI A;  3AV9 A;  1QSL A;  4B9V A;  4Z4I A;  2KZM A;  4KTZ A;  4CJQ A;  4FJI A;  3DOL A;  4W5R A;  3OYK A;  1S1W A;  4OKJ A;  1SV5 A;  2ZE2 A;  5C42 A;  5HP1 A;  1N5Y A;  4FZZ A;  4LH5 A;  1T7P A;  4EZ9 A;  1A5X A;  1RIL A;  3HT3 A;  4LY7 A;  4AHT A;  1TK8 A;  2PZS A;  3AVL A;  3NH2 A;  1WSH A;  5J2N A;  1U4B A;  4F2R A;  4IKF A;  4Z4E A;  1JL2 A;  4FLV A;  2HNZ A;  4CGG A;  1VK0 A;  3MEC A;  3DM2 A;  4FXD A;  3K2P A;  1KCF A;  3QEV A;  4UQG A;  4N76 A;  4C8M A;  4N5S A;  2VG5 A;  4AIL C;  4I9L A;  1S9G A;  4N56 A;  2XHB A;  3RR7 A;  1KFD A;  1TL1 A;  3O3F A;  1IH7 A;  3ZT1 A;  4IFV A;  3L2W A;  1ITG A;  4DFP A;  3SI6 A;  1XC9 A;  2KZZ A;  2P5O A;  3HPG A;  4O4G A;  5CYQ A;  3NH0 A;  3LZJ A;  1TKD A;  1QSS A;  2BAN A;  3RMC A;  4FJ5 A;  2OA8 A;  2IAJ A;  4CIF A;  1FK9 A;  4DTJ A;  4KI4 A;  3M8Q A;  2OZS A;  3LAN A;  4DU4 A;  1HMV A;  1TGO A;  2XY5 A;  1FKP A;  4G1Q A;  4E7J A;  4DQR A;  4DSK A;  2DY4 A;  3AA4 A;  1SKR A;  2X6N A;  3OYH A;  4PQU A;  3K5O A;  3KLF A;  3OJS A;  3HP6 A;  3VQB A;  2RPI A;  3TAF A;  4MQ3 A;  3VQ4 A;  3ZSR A;  2ITG A;  1BIS A;  3KLI A;  4DTS A;  2PYJ A;  4KHS A;  2QKK A;  4CEZ A;  2IC3 A;  4Y1D A;  4OVL A;  1RDC A;  1D9D A;  1KVB A;  2IOC A;  2A1S A;  3KK1 A;  1CXQ A;  1TKX A;  4RW4 A;  2D0A A;  1TL3 A;  4QAG A;  1RT4 A;  3AO2 A;  2GUI A;  3ZSO A;  3VA0 A;  1KLN A;  3KTQ A;  4CHY A;  2HHV A;  3AVK A;  3RR8 A;  1YTA A;  2X6S A;  1NK8 A;  4JRP A;  4I2Q A;  4BE0 A;  2P1J A;  1EP4 A;  3EYZ A;  5HRS A;  4DTM A;  2EHG A;  3DRR A;  4PA1 A;  3TWH A;  3V9U A;  3RRG A;  2JGU A;  2YNF A;  5C24 A;  1Z25 A;  3OY9 A;  4ELV A;  1NKB A;  4O0I A;  3RWU A;  2IS3 A;  4DSF A;  1VSD A;  4CIE A;  3T19 A;  1U49 A;  5I3U A;  4KTQ A;  3HJF A;  1UWB A;  4ID1 A;  1T8E A;  3DLG A;  5HRO A;  3G0Z A;  5HRR A;  3S9H A; 
#chains in the Genus database with same CATH topology
 3H46 O;  1WSG A;  4NYF A;  5LJW A;  2G8K A;  3UKU A;  4IEE A;  4XH1 A;  3UKR A;  3CCM N;  2HHU A;  3A5O C;  4K43 A;  3TR8 A;  1KTQ A;  5AR0 A;  3EL2 A;  1RDW X;  3CPW M;  5ADX A;  4AM6 A;  5J2Q A;  2OZM A;  3HYF A;  3VQA A;  4CGF A;  4DFM A;  1REV A;  3ZET B;  3RVC A;  3A5L C;  4CFD A;  1I39 A;  1KFS A;  3E01 A;  4LFA K;  1C1C A;  4B9U A;  1ATS A;  2HVH A;  5HRN A;  4DMN A;  2HF3 A;  4IEI A;  2HHT A;  1QQO A;  4WYB A;  1EWQ A;  3DLL L;  3M5R A;  4FLU A;  2OAN A;  4DQI A;  2AA4 A;  4DS5 A;  2WBN A;  3IMX A;  5E84 A;  4DTU A;  5GAH P;  4B8A B;  1XQS C;  1JCG A;  4MFB A;  2YHW A;  3HP9 A;  4ISF A;  1ASV A;  4CES A;  4CJF A;  1LAV A;  1NK0 A;  2NRR A;  2NRV A;  2ZJQ L;  1NK5 A;  3VQ7 A;  4DSL A;  2FBX A;  3E9O A;  2XY8 A;  4DR2 K;  1HNI A;  3IFR A;  4JKG A;  3V4I A;  2Q2R A;  4DLE A;  3RSE A;  5BPL A;  2FXU A;  4GV9 A;  1QE1 A;  3NH1 A;  4FLZ A;  1J53 A;  1RT1 A;  3GG4 A;  1NGB A;  2FSN A;  3CET A;  4JHD A;  4H5V A;  3A8Y A;  1YVU A;  4FWQ A;  2AJQ A;  5CE3 A;  3LAL A;  1JLB A;  3O6W A;  3ZSZ A;  3FR0 A;  3MDQ A;  3H08 A;  4PKH A;  4RCH A;  2B5J A;  2R7Y A;  1QHA A;  1N32 K;  1ASW A;  4JLH A;  2O4G A;  3ATV A;  3OYM A;  3AO3 A;  1MDU B;  5AQV A;  3CM6 A;  3OVN A;  3DJC A;  2VG6 A;  4R5P A;  4FJL A;  3ZT4 A;  3AO1 A;  2PBD A;  3T3F A;  3U6F A;  4QS7 A;  1T6C A;  2DPN A;  3W0L A;  4B1W B;  3THY B;  3VER A;  1E4G T;  4IFY A;  3O1B A;  1NK4 A;  3QEW A;  2F8S A;  3O9S A;  2P9L A;  1B9F A;  3O80 A;  4CI6 A;  1JXB A;  3CC7 N;  2X78 A;  1M1K O;  2PAV A;  3CJ7 A;  3L3V A;  1FXX A;  4AHC A;  3I0R A;  2O8B B;  3ZCM A;  3VA3 A;  3CHW A;  4JKH A;  4K25 A;  3H1Q A;  5DMR A;  1K8K A;  5LJV A;  2XY6 A;  3LAK A;  1C0U A;  2QEX N;  1XHX A;  1GLF O;  4K8Z A;  2KHO A;  3HZ6 A;  5DM6 L;  1C1A A;  3OTO K;  4I2P A;  3V1O A;  2Q31 A;  4EP4 A;  3MXI A;  3K5L A;  4MLE A;  2GEM A;  5AQM A;  2ZJR L;  3QBX A;  4XEI A;  2YKN A;  1YTU A;  4BC3 A;  1SAZ A;  1V4T A;  2QWL A;  1Z26 A;  4KI6 A;  1LV5 A;  3IS9 A;  2WON A;  4DWI A;  1CZA N;  4EHU A;  1ZC6 A;  4FPB A;  3ZSQ A;  4E7K A;  4NXN K;  1RNH A;  3BF1 A;  4AHU A;  4XH5 A;  4CHP A;  1Q86 O;  4DFK A;  2YHB A;  3QIP A;  1S9E A;  1L5U A;  4JAX A;  4CHO A;  4JRQ A;  1J54 A;  3SZ2 A;  1XWL A;  1Z05 A;  5FLX O;  1NGC A;  1D9F A;  1QS4 A;  3MMV A;  4EZ6 A;  2VWK A;  4A61 A;  3NF8 A;  4XIU A;  4M41 A;  3T1A A;  3J7A P;  4ELT A;  2JWL A;  3A0I X;  4WFA L;  5JMV A;  5B8H A;  4JKD A;  1R59 O;  3A5M C;  3SCX A;  3O08 A;  3NFA A;  4L3Q A;  3P38 A;  1I3A A;  4FWL A;  2YNG A;  3VEN A;  3AVJ A;  4F3O A;  4LF9 K;  1NM1 A;  1BGX T;  4BVO A;  3CMA N;  2UUB K;  3DLK A;  1OH5 A;  3L6Q A;  3VGK A;  3KK2 A;  2OTL N;  3LAM A;  2A40 A;  1RT5 A;  2ZGZ A;  3QLH A;  4CBX A;  2O8F A;  1VQ4 N;  5JLH A;  4CJV A;  4DR1 K;  3S3O A;  1L3S A;  1T6D A;  4CGI A;  3JYT A;  1WLJ A;  3AY9 A;  5HOO A;  4CEA A;  5AQX A;  4DR5 K;  3S41 A;  3R6M A;  4BDP A;  1RBR A;  4FWN A;  3THX A;  4DUY K;  4FYD A;  1HYZ A;  3B8A X;  3H3N O;  2HST A;  3M3Z A;  2KTQ A;  3DLR A;  4E19 A;  4BRD A;  4CZK A;  4DR3 K;  2O8D B;  4BRL A;  1BO5 O;  1GOA A;  1ZBL A;  5FRN A;  4DV4 K;  1UA1 A;  4KRE A;  3GE1 A;  1C0M A;  4HTL A;  4CF1 A;  1O1W A;  3CJC A;  1NOY A;  4I9Q A;  1HRH A;  3L4Q A;  1RT3 A;  3N4P A;  3IUC A;  1X9S A;  4R79 A;  2HBM A;  1YJW N;  3QIN A;  5JS1 A;  5GAD P;  4J2B A;  1L3U A;  4CF2 A;  3PSI A;  1JL1 A;  4CD3 A;  3AVC A;  3G4S N;  3ZET A;  3DLH A;  5M1K A;  4H8K A;  4M3W A;  3DAW A;  3MWT A;  4I6M B;  2HBJ A;  2RF2 A;  1NK6 A;  1KD1 O;  2HHH K;  2O4I A;  4NLC A;  2F7T A;  3SUP A;  1XI1 A;  1UAX A;  5CZ1 A;  3AAP A;  4ISE A;  1NJY A;  4DSI A;  3L2R A;  3OYI A;  1KAZ A;  3ZT3 A;  4MLH A;  4CVN E;  4DG1 A;  1L3V A;  2WC9 A;  3U4L A;  3C6U A;  3CCJ N;  3B6P A;  3DXK B;  3LPT A;  1NMD A;  5HRP A;  1C6V A;  4H4M A;  2KW4 A;  1SQK A;  4KH5 A;  4CZI A;  3HVR A;  1JLQ A;  1HYS A;  1GLE G;  4ZTJ A;  1HNZ K;  2QWO A;  5EU7 A;  3UIQ A;  4JI3 K;  3UKU B;  3CJA A;  3EKU A;  3MK6 A;  3UKR B;  4IDK A;  5I42 A;  1JLG A;  3MX5 A;  5C10 A;  3PO4 A;  4I7F A;  3T7Z A;  4M45 A;  1MU2 A;  1IBK K;  4DS4 A;  3BGR A;  1IKV A;  4DSJ A;  3F9M A;  1YF5 L;  5JVG L;  3CCU N;  2CH5 A;  4E1M A;  4X62 K;  4PWD A;  1FW6 A;  3P39 A;  5GIP A;  4DQQ A;  4KTW A;  3TU5 A;  4JV5 K;  4HTU A;  4DF4 A;  2A1R A;  1EO1 A;  2E6L A;  2W42 A;  4FLW A;  4KO0 A;  3I33 A;  3VEZ A;  4NB4 A;  3QIO A;  4BRM A;  3TAR A;  4JI1 K;  4AH9 A;  3WNG A;  1Y97 A;  1TV6 A;  4CZM A;  1BQN A;  5BRE A;  4YOX A;  2ZM6 K;  4LD0 A;  1U45 A;  1IV0 A;  1YAG A;  4KHN A;  5M1O A;  4BR7 A;  2IGI A;  3CIP A;  4C8N A;  2NZT A;  4H5T A;  1QSL A;  4JK9 A;  1W2B M;  2KZM A;  3ZX0 A;  3DOL A;  3O9Q A;  3HT3 A;  1RIL A;  5H1S Q;  3NH2 A;  3WXJ A;  4F2R A;  1BU6 O;  1JL2 A;  2NRZ A;  3MEC A;  1VQM N;  1YJ9 N;  4UQG A;  3THY A;  2KLA A;  3VET A;  4GVE A;  4JKG B;  4JKE A;  3RSE B;  1VQ5 N;  1KFD A;  2KZZ A;  4BC2 A;  1XC9 A;  4YDU A;  2P5O A;  2VGN A;  2OA8 A;  1FK9 A;  3OA9 A;  4DU4 A;  2O8B A;  1XMQ K;  4H0V B;  4DSK A;  5AQP A;  1SKR A;  1QQN A;  3OJS A;  3VQB A;  2VCP A;  4MQ3 A;  3K0S A;  3CI5 A;  2PYJ A;  4JI0 K;  4Y1D A;  1RDC A;  1D9D A;  1BOT O;  2O8E A;  5AQG A;  1CXQ A;  4RW4 A;  1TL3 A;  3KTQ A;  3P31 A;  2IIR A;  1HPM A;  3ID6 A;  4IOX A;  3U9D A;  3R1X A;  3C0B A;  2P1J A;  4A59 A;  4BRI A;  3TWH A;  4CZE A;  5F1X A;  1NMN A;  2IS3 A;  3MN5 A;  1VSD A;  4H03 B;  1TUY A;  3HJF A;  1T8E A;  5HRO A;  3G0Z A;  3HK2 A;  5HRR A;  3CCV N;  3S9H A;  1VSE A;  4UY8 O;  3MXM A;  2P9L B;  4AHV A;  1L3T A;  4BR0 A;  4GW6 A;  3VQQ A;  1IBL K;  4H0P A;  3H45 C;  4DUZ K;  3V1Q A;  4DQS A;  1WOQ A;  3D0P A;  1R0A A;  2UUA K;  1DEJ A;  1HKG A;  1QZ5 A;  3NAE A;  3TTD A;  4Q5V A;  2CGL A;  2YNI A;  3LWL A;  4FJM A;  3C6H A;  1Y64 A;  3S3M A;  4B9M A;  1Q8I A;  5AQH A;  3K57 A;  4DLG A;  3V1R A;  4CBW A;  3SQ4 A;  4CFB A;  3OS0 A;  3AO4 A;  3EEQ A;  5E41 A;  4QCL A;  3WXL A;  3D2F A;  2DFH A;  5J2P A;  5AQR A;  3LP0 A;  3K5M A;  4BC5 A;  2G8W A;  2EX3 A;  2P5G A;  3SPY A;  1X1P A;  4JI7 K;  2HOE A;  1BL3 A;  5KGW A;  1BA1 A;  1EKE A;  1NGI A;  2VQF K;  4FM2 A;  1E3M A;  1YUW A;  3VQE A;  1HJR A;  5AQK A;  2HF4 A;  4M3X A;  2Q0R A;  4U7B A;  2J4R A;  5DM7 L;  2E1Y A;  4BRQ A;  2HNY A;  2O8D A;  3CFR A;  1NK7 A;  3NE6 A;  3KWI A;  3F9K A;  1OH8 A;  1YIJ N;  5KQD A;  3QES A;  2BUP A;  3NVM A;  5BPM A;  5AQO A;  3P4I A;  3IAY A;  3NF6 A;  3TAE A;  4A5B A;  2D0B A;  4CJW A;  3ALY A;  4E0D A;  4U67 L;  3C7N A;  3SUQ A;  1U04 A;  2O8F B;  3I0S A;  1XMO K;  2ITM A;  2NRW A;  4IXC A;  5BPN A;  1GLB G;  3CER A;  3O4W A;  3QDK A;  4LF6 K;  4KBO A;  3LDN A;  5C12 A;  2D5R A;  3SBG A;  2WTU A;  2A5X A;  3V9Z A;  4JKC A;  2F96 A;  3HOS A;  1RTJ A;  3THX B;  4FL9 A;  4DV6 K;  2Q3S A;  3QEI A;  3P5J A;  4DV2 K;  5JVH L;  1K9M O;  3KLH A;  1S1X A;  4AHR A;  1D5A A;  1HNV A;  1M90 O;  3NBP A;  4LSN A;  5AQY A;  2IDO A;  1Q7Y O;  5DK5 A;  1RDA A;  3VTI A;  4M7X A;  1ZBI A;  2IVN A;  4BRA A;  4FK4 A;  4KV8 A;  2UXC K;  1QQM A;  1VQ6 N;  3CCL N;  3VN5 A;  3HVT A;  2GTD A;  4OGC A;  3QFU A;  3A5N C;  3KD1 E;  3U3Y A;  4O44 A;  5AQZ A;  4H5W A;  3O4N A;  4YOY A;  1C1B A;  5AQJ A;  3LM9 A;  1Q81 O;  2VGM A;  3D7E O;  3J80 O;  4OPK A;  1RDD A;  3CQ8 A;  3L4I A;  5AQL A;  3KJV A;  4LSL A;  1QVG M;  3ZSX A;  4FJJ A;  4CF9 A;  3SV4 A;  4F3T A;  4LH4 A;  3R8E A;  3VQ6 A;  1SL0 A;  1TK5 A;  1VSI A;  4RW7 A;  4DKW A;  1WSF A;  5ELZ A;  3VQ9 A;  3VF2 A;  4Q0B A;  4O8U A;  4J8F A;  4NO7 A;  1S3X A;  3DRP A;  1XNQ K;  3NF7 A;  2D1K A;  2GEL A;  1IKX A;  3MEG A;  2ASM A;  3BY5 A;  4Z0U A;  5C2D A;  4CJ7 A;  2W6K A;  1CXU A;  1JXE A;  4FPA A;  2IVP A;  1VQL N;  1IO2 A;  2FF3 B;  1KVA A;  3IRX A;  1GOB A;  4CZJ A;  3I56 N;  3VF4 A;  4WQ5 A;  3LZI A;  3SYZ A;  2NRT A;  4XH4 A;  4CHQ A;  3QNN A;  3ULE B;  3OYG A;  3WT0 A;  5CZ2 A;  2ATQ A;  4YOT A;  1N34 K;  3PY8 A;  4C23 A;  1S1U A;  2OYQ A;  3VEV A;  1WSJ A;  1VQ9 N;  4BR4 A;  5JS2 A;  4CJK A;  3RMB A;  3V6D A;  3CPE A;  1NJW A;  4CJU A;  4GV3 A;  1VSJ A;  5JIC A;  1BWF O;  4JI8 K;  4BQZ A;  2D0C A;  4A57 A;  3OYD A;  3ENB A;  3EZ5 A;  4M3R A;  1SL1 A;  1IKW A;  2G8U A;  1WUA A;  3I8B A;  1HUX A;  2QI2 A;  3WQT A;  2E88 A;  2VYP A;  3HPO A;  4RW9 A;  3GOI A;  3AVM A;  3K58 A;  1ZBS A;  3M8S A;  2HMI A;  3QIC A;  3U3G A;  3QEX A;  1K73 O;  5J1E A;  3L2Q A;  1YHQ N;  3DYA A;  4GKK K;  5KRT A;  3EN9 A;  2OTJ N;  1KXP A;  1U47 A;  2D4W A;  3RMD A;  1Q9Y A;  1JCE A;  5TKW A;  3ZSY A;  3HTV A;  3FFI A;  1ATN A;  2VWJ A;  4KFB A;  4WFN L;  1HX1 A;  2OPR A;  4B3S K;  1S6Q A;  1HKB A;  4M63 C;  3LP3 A;  1OH7 A;  3DWL A;  4WQ4 C;  4OKE A;  4IOA L;  4CE9 A;  1J5O A;  2O8E B;  4H0O A;  3QER A;  1JCF A;  2Q1N A;  4MO4 A;  5AQT A;  4YHH K;  1UA0 A;  1ZBH A;  3H3O B;  1D8Y A;  3SBT A;  4FSV A;  4E1J A;  3NGY A;  1WBB A;  1EQY A;  4DSE A;  4FK2 A;  5M1P A;  1LW2 A;  4BE1 A;  3CFP A;  1ATR A;  1SZ2 A;  3HXM A;  2XY7 A;  5IT9 O;  5M1Q A;  4WFB L;  5M1N A;  4IO9 L;  2W40 A;  5IWA K;  1RT7 A;  5KRS A;  5AQU A;  4Y1C A;  3MAQ A;  4JEP A;  1NKE A;  1KRP A;  4IDH A;  1Q18 A;  3SMP A;  2KFZ A;  1LCU A;  4FJ7 A;  5AZI B;  1NWK A;  2QTD A;  1KVC A;  4GVM A;  1P8Z A;  3HM9 A;  4CK2 A;  4IZ9 A;  4CJP A;  1LAW A;  3ASM A;  4OKK A;  1TYQ B;  1Q9X A;  4H0T B;  3KD5 E;  4B08 A;  1V4S A;  4CEB A;  4NCG A;  3E66 A;  2LSN A;  3OYB A;  4EAH D;  5FRM A;  4HVJ A;  1WN7 A;  2F4V K;  2Z1I A;  1P90 A;  1RT6 A;  1I94 K;  1HJO A;  2QW9 A;  4Z4H A;  3LP2 A;  3VQ5 A;  3D2F B;  4FLT A;  4DQP A;  1X9M A;  4FW1 A;  2NLX A;  1WSE A;  1G15 A;  4DR4 K;  4KTZ A;  4YOU A;  4OKJ A;  1N5Y A;  5C42 A;  4FZZ A;  5LMN K;  4LH5 A;  3FZH A;  1A5X A;  4LY7 A;  4A2B A;  4AHT A;  3WXI A;  2PZS A;  3AVL A;  1RGI A;  1WSH A;  3THW A;  1U4B A;  3C65 A;  3KWG A;  5AFU A;  4IKF A;  3EKS A;  5BN8 A;  3K2P A;  1KCF A;  2ZF5 O;  4C8M A;  4AIL C;  4BRF A;  4N56 A;  2XHB A;  2P9S A;  3L2W A;  3KK7 A;  5CYQ A;  3NH0 A;  4FJ5 A;  3T1Y K;  2OZS A;  3HM8 A;  1KQS M;  1TGO A;  3LL3 A;  1FKP A;  4G1Q A;  5GIO A;  4FVU A;  3AA4 A;  3LDP A;  3CCQ N;  3HP6 A;  3TAF A;  3ZSR A;  2ITG A;  3KLI A;  5F2R A;  1NG9 A;  5CHI A;  2IOC A;  3TPQ A;  1GLL O;  2D0A A;  1RT4 A;  3AO2 A;  2PFU A;  3VA0 A;  3CCS N;  3C7N B;  2HHV A;  4KH6 A;  3AVK A;  1YTA A;  4I2Q A;  1EP4 A;  2NRX A;  3EYZ A;  5HRS A;  4DTM A;  3DRR A;  3V9U A;  3RRG A;  2JGU A;  4ELV A;  3T19 A;  2P9I A;  4KTQ A;  1J5E K;  4ID1 A;  1N33 K;  3DLG A;  2CGJ A;  2JWK A;  4JKF A;  2V51 B;  1HNW K;  4OLB A;  1FKO A;  4FVM A;  3CFO A;  3VEW A;  2A42 A;  3AA3 A;  4O55 A;  2IVO A;  3AA5 X;  4OLA A;  3G10 A;  4NYN A;  4BRP A;  4G9Z A;  3HPH A;  3JAM O;  1LOT B;  1EET A;  3BZC A;  2E2O A;  4BRC A;  1RT2 A;  1QQC A;  3H6E A;  4MDB A;  3M6G A;  4BWJ A;  3BUZ B;  3F73 A;  2GX9 A;  4IG3 A;  4K0K K;  3ULE A;  3TSQ A;  3SAF A;  2HMP A;  4BRG A;  2HHS A;  1X9W A;  4ILH A;  3NVK A;  3O1W A;  4DV3 K;  3BP8 A;  3AVG A;  3C6T A;  3CJ9 A;  1X3M A;  3P83 D;  4RWT A;  1MWM A;  1TUU A;  3NGZ A;  3AGR A;  4KHY A;  1Z6R A;  3O4Q A;  5CR4 A;  3CD6 N;  5A2Q O;  1U6Z A;  2GUP A;  5ADX H;  5C0Y A;  4LF7 K;  3ZLJ A;  3VQD A;  3VGL A;  3TAQ A;  4H5N A;  4DV7 K;  4M42 A;  5CYM A;  4BQL A;  4PUO A;  1BIU A;  1RTD A;  5EX5 A;  3PIO L;  1KC8 O;  4EHT A;  4CJ4 A;  4DTX A;  3CQX A;  3L2V A;  4FK0 A;  3CF5 L;  4EIA A;  1SL2 A;  1GLC G;  4BRK A;  4X64 K;  4CEF A;  1ZBU A;  4AF1 A;  1J9A A;  1J6Z A;  3V9X A;  4OPJ A;  1X9J A;  1VSM A;  3VQ8 A;  2HVI A;  4KB0 A;  3I55 N;  1LWC A;  2OPP A;  1XNR K;  3IDH A;  2E6M A;  2Q97 A;  4CZH A;  2QWP A;  4KRF A;  4FM1 A;  4CJT A;  4QOZ B;  1CZB A;  5E26 A;  3ENH A;  4AHS A;  1B92 A;  4O5F A;  3DLE A;  3LP1 A;  1FJG K;  5LMU K;  1UOC A;  1RBV A;  4JYA K;  4W5O A;  4WE1 A;  1BHL A;  2ZQB A;  1SKS A;  5J2M A;  3N4Q A;  2HHW A;  3WEE A;  2YV0 X;  4M3T A;  2VWB A;  3O9R A;  2ZWH A;  3EO3 A;  2E1Z A;  3TAM A;  3F2K A;  2QK9 A;  1NGD A;  3WNH A;  1NKC A;  1IBM K;  4CZL A;  2Y1I A;  2YX6 A;  3CXC M;  2P9U A;  3H1V X;  4KHP K;  3OYL A;  1OH6 A;  3SV3 A;  4PHT X;  4GNI A;  1VRT A;  3TI0 A;  3FLC O;  4JI5 K;  2I5J A;  1S1V A;  5GAG P;  3BDP A;  3JSM A;  3P1G A;  3C94 A;  4CIG A;  5FRO A;  4B1X B;  4RTF D;  3ULD A;  4NCA A;  3R3L A;  5AZI A;  5KQ8 A;  4W5N A;  5FPD A;  4L8R B;  1SUQ A;  3GL1 A;  4RW8 A;  1TYQ A;  4BR5 A;  3O9U A;  1NGA A;  2VG7 A;  2KKZ A;  3AVH A;  5AQF A;  3V81 A;  4FWP A;  1GOC A;  2P9K A;  2KQ2 A;  1MA9 B;  4ILG B;  1LW0 A;  2Y1J A;  4CJ3 A;  2AP1 A;  4CJ5 A;  4FJK A;  4CJE A;  4E7I A;  3HBT A;  3ATU A;  4F4K A;  5LL6 Z;  2BGG A;  3SUN A;  4KH4 A;  4CFA A;  2WFB A;  5AJ3 K;  4HHT A;  3PV8 A;  3E9P A;  1RFQ A;  4FWK A;  3DMJ A;  2QXF A;  4RG8 A;  5AQS A;  1EXQ A;  4CEE A;  4AQY K;  2QA4 N;  3CM5 A;  4FWS A;  4CF8 A;  1ASU A;  2YHY A;  4ILJ A;  4CK3 A;  4NCB A;  2DTU A;  4FLY A;  3SJH A;  3QET A;  1ZBF A;  3ZEU B;  2EWS A;  3ZT0 A;  4CF0 A;  3PX4 A;  3ISN C;  1DTT A;  1T3V A;  4CW7 B;  1IKY A;  4EP5 A;  1YXQ A;  4ID5 A;  2E8A A;  3WUH A;  1KAX A;  2GWK A;  4B1Z A;  4H5R A;  4DR7 K;  4BRN A;  3O3H A;  3ITH A;  1KLM A;  2Z1H A;  4O8K A;  1HKC A;  3OYA A;  4B3M K;  3BZK A;  2QWR A;  3HRG A;  4CGJ A;  1IJJ A;  3HOT A;  1ZYQ A;  2YI1 A;  4CHN A;  4FZY A;  2Q36 A;  1BI4 A;  1QZ6 A;  1RCH A;  3KLG A;  4N41 A;  3VQP A;  4O5B A;  1TKT A;  5KTQ A;  3PX6 A;  3KZB A;  4BY9 C;  4B1U B;  3QB0 A;  3OBW A;  3THW B;  3L8B A;  1SKW A;  2YNH A;  3M8R A;  2RKI A;  4JKB A;  3NDK A;  4E7L A;  3J81 O;  3MEE A;  4KHU A;  3MN7 A;  4GV6 A;  4E7H A;  2P9S B;  5C2F A;  3TAN A;  2WUS A;  1VAZ A;  1IG9 A;  4JD2 A;  2O8C A;  4M3U A;  1DLO A;  3IKM A;  3QFP A;  2F9W A;  3DOK A;  2P51 A;  1K8A O;  2P9P A;  4J2E A;  1LWE A;  3D2E A;  1Q82 O;  4JI6 K;  4BAC A;  3PX0 A;  3CG7 A;  4B1Y B;  1LWF A;  4FWO A;  1JLF A;  4DTP A;  1VQP N;  4W5Q A;  3OYF A;  3TTC A;  3HO1 A;  1JKH A;  4V19 S;  1N6Q A;  3KHY A;  1TK0 A;  2PYL A;  2RHK A;  4DU1 A;  1ZXO A;  3KIO A;  4WCE L;  2P9I B;  1RBT A;  3AA2 A;  1VSK A;  5FPE A;  3D45 A;  2VQE K;  3FE1 A;  4YFU A;  3PUF A;  4BWM A;  3OYN A;  2A41 A;  2E4L A;  4HUG A;  3GDQ A;  5BR9 A;  1JLC A;  4KKO A;  2YCH A;  5KGX A;  4LF4 K;  4M3Z A;  3M8P A;  3DRS A;  4B9Q A;  5TKY A;  3K9K A;  4TSX A;  1HPZ A;  4HWI A;  1VSH A;  3CC2 N;  4PKI A;  3MED A;  3RRH A;  3ZT2 A;  1VQ7 N;  3ZSW A;  3K9J A;  3BEX A;  5D3G A;  3FFK B;  2OCE A;  3RTV A;  3T1H K;  3FZM A;  4DV1 K;  1VSF A;  3Q7C A;  4C8O A;  3CYM A;  3DXM B;  4CZF A;  4BE2 A;  1WSI A;  1JLA A;  1VSL A;  3FZL A;  1G99 A;  3VQC A;  1QHT A;  2F8T A;  4J2D A;  5K14 A;  3NCI A;  4B9V A;  4DQ8 A;  1XC3 A;  1S1W A;  2P9N A;  1T7P A;  4JI2 K;  1TK8 A;  3ZYY X;  2H3G X;  2E2Q A;  4Z4E A;  1RDU A;  5AQI A;  2HNZ A;  2YJE A;  4FXD A;  5BRH A;  5FPN A;  4N5S A;  2D0P A;  2VG5 A;  4OX9 K;  4BR2 A;  4H0Y B;  4BRO A;  1NGJ A;  3O3F A;  3ZT1 A;  2W41 A;  1ITG A;  3HPG A;  3M1F A;  1VHX A;  2V7Y A;  3U8X A;  3LZJ A;  4CIF A;  4DTJ A;  4KI4 A;  3LAN A;  4B1V A;  2XY5 A;  4C1N K;  4DQR A;  1OKJ A;  4E7J A;  2A3Z A;  2DY4 A;  3R9P A;  2X6N A;  3K5O A;  4NLB A;  5EVZ A;  4FOE A;  2RPI A;  2HBK A;  4DTS A;  1YI2 N;  1JJ2 M;  1OVY A;  3WQU A;  2IC3 A;  1W97 L;  2BTF A;  1TKX A;  4WF9 L;  4QAG A;  2GUI A;  3ZSO A;  3SK3 A;  2X6S A;  1U2V B;  4QS9 A;  1NK8 A;  4JRP A;  4DCH A;  3TTF A;  2EHG A;  4PA1 A;  3T69 A;  2YNF A;  3WEE B;  3OY9 A;  1VQK N;  1BA0 A;  4B3T K;  2ASO A;  2FF6 A;  3VF6 A;  4BGB A;  5I3U A;  3C6A A;  5F0X A;  3SQ2 A;  1BCO A;  3OW2 M;  1TKZ A;  5KPT A;  4CJS A;  3KLE A;  3HST B;  3SAH A;  3MN6 A;  2P9U B;  1HQU A;  3JXU A;  1BUP A;  4A5A A;  4B8C A;  4ELU A;  4BG8 A;  5I9E B;  4MO5 A;  3KKS A;  3E9L A;  5C15 A;  3FZK A;  1QVF M;  5KPR A;  3SNN A;  3IG1 A;  4JI4 K;  3AVF A;  3NMU A;  4DU3 A;  4KHW A;  1U48 A;  4OO1 J;  4B3R K;  5GAE P;  4GMJ B;  5SZT A;  4FM0 A;  3ENO A;  3QEP A;  3LWM A;  4IWV A;  4BR9 A;  2BE2 A;  1N8R O;  1RDB A;  4K42 A;  4FCY A;  3DI6 A;  4KPY A;  4E1N A;  2QKB A;  4LC9 B;  2Z1J A;  3OHR A;  3HL8 A;  3Q7B A;  4O0J A;  4B9N A;  2PY5 A;  1HNX K;  2HB5 A;  3OBY A;  4ICL A;  1NJZ A;  4LFC K;  3NF9 A;  4BGA A;  3ZEU A;  1BQM A;  2YJF A;  2GBZ A;  1RTI A;  3NGI A;  3AGK A;  3LDL A;  2DFE A;  4DHY A;  3SQ1 A;  4JN4 A;  4B3O A;  2QWQ A;  2P9K B;  2GWJ A;  3LDS A;  3O8M A;  1F21 A;  1N36 K;  3RMA A;  2G8F A;  4JKA A;  3VPZ A;  5BRF A;  1YJN N;  1XHZ A;  1XUP O;  3V9W A;  4YDU C;  4B9L A;  1RTH A;  2I7P A;  1RBS A;  4Y0W A;  4YOV A;  2ETJ A;  3C95 A;  2B4J A;  5C25 A;  1NOZ A;  1K6Y A;  4FOI A;  3VMF B;  1QSY A;  2A6A A;  4FJX A;  2RE2 A;  1RBU A;  2JLE A;  3SUO A;  2RN2 A;  2E20 A;  1WAF A;  3EZW A;  3BF3 A;  1JLE A;  2YHX A;  1A5V A;  4YOR A;  4JNE A;  3TAG A;  3HI0 A;  3AVB A;  4M7Y A;  3DLB A;  2NUB A;  1NGF A;  2ASP A;  1DTQ A;  1EWR A;  3G6E N;  2FBY A;  3VTH A;  3J7Y P;  4H4O A;  3UE5 A;  1VQ8 N;  2QM1 A;  3ZSV A;  4OGE A;  3SQ0 A;  1KSP A;  2YKM A;  4HUF A;  2NRH A;  2E2N A;  1NGH A;  3MCA B;  5FPM A;  5BN9 A;  4ZTF A;  3B6O A;  4FWR A;  1BI4 B;  4KB1 A;  4GY2 B;  4BDY A;  3KVG A;  4J2A A;  3G25 A;  4FJH A;  3TAB A;  4GKJ K;  4E89 A;  4KHQ A;  3VEY A;  2E2P A;  1EX4 A;  4BRH A;  4DR6 K;  4NXM K;  1DKG D;  4IJN A;  3OJU A;  4IG0 A;  4W5T A;  1T44 A;  3EE8 A;  4CED A;  2I7N A;  4BDZ A;  2OPS A;  4CJR A;  2KFN A;  3OYJ A;  4CZG A;  1X3N A;  2WOM A;  3VEX A;  3AAR A;  2YHA A;  2G8V A;  4BVP A;  4JD2 B;  5AQW A;  4CK1 A;  2O8C B;  1C0F A;  5HBM A;  2E5L K;  2FBT A;  3CME N;  5CY4 A;  3QML A;  4A62 A;  3PIP L;  3CJB A;  5KI6 A;  5LY3 A;  1S72 N;  3UB5 A;  2P9P B;  5BRD A;  1TVR A;  4MDA A;  4CEC A;  3D2E B;  5M1F A;  5AZJ B;  4FLX A;  3MN9 A;  4DV5 K;  4CHZ A;  2CGK A;  4CCH A;  4CGH A;  1E4F T;  2V7Z A;  1CZ9 A;  1TAU A;  1TAQ A;  4E3S A;  1WAJ A;  4WQ4 A;  3L2U A;  4DFJ A;  2FC0 A;  4CER A;  3DXM A;  3HSC A;  3NHG A;  4LFB K;  1A5W A;  1B9D A;  1YVN A;  2XRI A;  4DTR A;  1HYV A;  4F2S A;  4OPA A;  3AO5 A;  1W9H A;  1D4X A;  1VRU A;  4LF8 K;  4FJG A;  2XO7 A;  4B9S A;  2FBV A;  3FZF A;  1BIZ A;  2HHQ A;  2UXB K;  4PKG A;  1ILY A;  3LM2 A;  4ISG A;  1NJX A;  2GV9 A;  2QWM A;  4K8X A;  3A2F A;  3J8A A;  1IG8 A;  1DT9 A;  4CFC A;  4DF8 A;  3AVA A;  4DTN A;  5KPZ A;  4IO8 A;  4C1N I;  5EOY A;  4N47 A;  2Q0U A;  4FJ9 A;  1WB9 A;  4KAZ A;  2X74 A;  4HUE A;  3PO5 A;  3EY1 A;  4C8K A;  4DV0 K;  3L0Q A;  1NJI O;  4M3Y A;  4FJ8 A;  4JS4 A;  5EXW A;  2FSK A;  4QS8 A;  3VEO A;  3CQY A;  1MWK A;  2NNW A;  5HLF A;  3EE9 A;  3JS6 A;  3J7Z O;  2Z1G A;  4ZHR A;  1W7A A;  4YY3 K;  3AVN A;  1S1T A;  1U2V A;  3SJJ A;  3VGM A;  1NK9 A;  4FJN A;  2P9N B;  3AAQ A;  3ZX2 A;  1NGG A;  4LF5 K;  1WNS A;  4JHD B;  5GIN A;  2FLO A;  4F9O A;  1C0G A;  3KK3 A;  1BG3 A;  4A2A A;  4PL8 A;  4DB3 A;  3E1Y A;  3SMS A;  2W6L A;  3V9S A;  1C0T A;  3LDQ A;  4DTO A;  4CGD A;  5FDL A;  3THV A;  4OPH A;  1CLQ A;  3CCE N;  4YOW A;  3MX2 A;  3ZX3 A;  2HW3 A;  3S3N A;  1GLJ O;  4F8R A;  4Z4F A;  4BC4 A;  3SPZ A;  5HL7 L;  1S6P A;  3QO9 A;  3O9T A;  2G8H A;  2CH6 A;  3LPU A;  3OS1 A;  4C8L A;  3OYC A;  2V52 B;  1BDG A;  2FSJ A;  4CD1 A;  4X66 K;  1T03 A;  3WXM B;  2UU9 K;  2G8I A;  3W3D A;  2HND A;  3CJ1 A;  4FW2 A;  3WNE A;  3GBT A;  4EFH A;  1W0H A;  2HBL A;  4HCB A;  4IBN A;  5MLC Q;  4WQ5 C;  3I8D A;  2ZD1 A;  5AQQ A;  2ZJP L;  4Z4C A;  3OS2 A;  1GLA G;  2BDP A;  3PLA A;  5T7B A;  1K8K B;  4JS5 A;  3QNO A;  2B6A A;  4IOC L;  1NGE A;  4Z4G A;  3WXK A;  4OJR A;  3L3U A;  4PY5 A;  5AQN A;  5SWM A;  3K59 A;  1NLV A;  4FZX C;  4PL7 A;  2HHX A;  1ESV A;  4CJL A;  2UUC K;  3K5N A;  4IFE A;  5BR8 K;  3LDO A;  1T05 A;  4CBU A;  3TAP A;  3WNF A;  4CEO A;  3AVI A;  4FWM A;  3QBW A;  4B9T A;  3OYE A;  4K41 A;  4CEQ A;  1BCM A;  1SS6 A;  3O3G A;  1QTM A;  4X65 K;  2UYT A;  2DFF A;  4RW6 A;  1OVQ A;  1S5J A;  4AM7 A;  3FGU A;  1H1V A;  1YIT N;  3CC4 N;  2OPQ A;  1HQE A;  1DGK N;  1YT3 A;  3MXJ A;  1GLD G;  5JLF A;  4YNQ A;  4HCC A;  1NBW A;  1NU0 A;  3KKR A;  3SLC A;  4JK8 A;  3MCP A;  3AV9 A;  4Z4I A;  4CJQ A;  2UXD K;  4FJI A;  3OYK A;  4W5R A;  2ZGY A;  5HP1 A;  1SV5 A;  2ZE2 A;  4FO0 A;  4BG9 A;  4EZ9 A;  3VOV A;  1KAY A;  3TSP A;  5J2N A;  2D0O A;  3VES A;  3ID8 A;  3O5B A;  4FLV A;  4CGG A;  1VK0 A;  3DM2 A;  3U9Z A;  3QEV A;  1HR0 K;  4N76 A;  4IJA A;  4I9L A;  1S9G A;  3RR7 A;  1TL1 A;  1IH7 A;  4H0X B;  4IFV A;  4DFP A;  3SI6 A;  4O4G A;  5EY4 A;  1TKD A;  1QSS A;  2BAN A;  3RMC A;  3F5T A;  2IAJ A;  3M8Q A;  1HMV A;  4JK7 A;  3OYH A;  1S22 A;  4PQU A;  3KLF A;  1HLU A;  3G71 N;  2QXL A;  3VQ4 A;  4Z94 A;  3TSU A;  1BIS A;  3SAG A;  4I6M A;  4KHS A;  3MWP A;  2QKK A;  4CEZ A;  4OVL A;  1KVB A;  2A1S A;  3KK1 A;  1O13 A;  1KLN A;  3D6R A;  4CHY A;  3RR8 A;  3CCR N;  4BE0 A;  2F9T A;  5AFU H;  5AZJ A;  5C24 A;  1Z25 A;  1NKB A;  4O0I A;  3DXK A;  4DSF A;  3RWU A;  4CIE A;  2QWN A;  2BH1 A;  1VQN N;  1U49 A;  3PSF A;  1WBD A;  4BRE A;  1NNE A;  1VQO N;  1UWB A; 
#chains in the Genus database with same CATH homology
 4NYF A;  1WSG A;  3SQ2 A;  1VSE A;  1BCO A;  3MXM A;  2G8K A;  4OLB A;  1TKZ A;  4AHV A;  1FKO A;  4FVM A;  3CFO A;  4CJS A;  3KLE A;  3HST B;  2HHU A;  1L3T A;  3AA3 A;  1HQU A;  4O55 A;  3TR8 A;  1KTQ A;  3AA5 X;  4OLA A;  4B8C A;  3G10 A;  4NYN A;  4ELU A;  4GW6 A;  3VQQ A;  3KKS A;  5J2Q A;  2OZM A;  3HPH A;  3HYF A;  3SNN A;  3V1Q A;  3VQA A;  4CGF A;  3IG1 A;  1EET A;  4DQS A;  4DFM A;  3AVF A;  4DU3 A;  4KHW A;  1REV A;  3D0P A;  1R0A A;  1U48 A;  1RT2 A;  4GMJ B;  5SZT A;  4CFD A;  1I39 A;  3NAE A;  4FM0 A;  4Q5V A;  3QEP A;  1QQC A;  2YNI A;  3LWL A;  4FJM A;  3LWM A;  3S3M A;  1KFS A;  4B9M A;  2BE2 A;  1Q8I A;  3K57 A;  1RDB A;  4DLG A;  4FCY A;  3DI6 A;  3V1R A;  3E01 A;  4BWJ A;  1C1C A;  3F73 A;  3SQ4 A;  4E1N A;  4KPY A;  2QKB A;  4CFB A;  4IG3 A;  4B9U A;  2Z1J A;  3OS0 A;  3HL8 A;  3AO4 A;  4O0J A;  4B9N A;  5HRN A;  2HVH A;  2PY5 A;  4DMN A;  2HB5 A;  4ICL A;  1NJZ A;  3NF9 A;  1BQM A;  2HHS A;  2GBZ A;  1RTI A;  3NGI A;  1X9W A;  5E41 A;  2DFE A;  3SQ1 A;  2HHT A;  4QCL A;  3AVG A;  3C6T A;  4B3O A;  3P83 D;  3LDS A;  2DFH A;  4FLU A;  5J2P A;  1F21 A;  4DQI A;  4DS5 A;  3RMA A;  3NGZ A;  3LP0 A;  4KHY A;  3K5M A;  2G8F A;  3O4Q A;  4DTU A;  2G8W A;  2EX3 A;  2P5G A;  3SPY A;  4B8A B;  1X1P A;  4MFB A;  1XHZ A;  3V9W A;  4B9L A;  1RTH A;  1BL3 A;  3HP9 A;  5KGW A;  1ASV A;  1RBS A;  3VQD A;  4CES A;  3TAQ A;  1EKE A;  2ETJ A;  4FM2 A;  3C95 A;  2B4J A;  4M42 A;  5CYM A;  4CJF A;  1LAV A;  1NK0 A;  1NK5 A;  4PUO A;  3VQ7 A;  1NOZ A;  3VQE A;  1HJR A;  1K6Y A;  2FBX A;  5C25 A;  4DSL A;  1BIU A;  2XY8 A;  1RTD A;  1HNI A;  4M3X A;  4CJ4 A;  4DTX A;  4DLE A;  3L2V A;  3V4I A;  4FK0 A;  1QSY A;  4FJX A;  1RBU A;  1QE1 A;  3NH1 A;  2JLE A;  3SUO A;  2HNY A;  4FLZ A;  1J53 A;  1SL2 A;  1RT1 A;  2RN2 A;  4CEF A;  1WAF A;  1ZBU A;  3CFR A;  1NK7 A;  1J9A A;  3V9X A;  4OPJ A;  1YVU A;  3NE6 A;  2AJQ A;  1VSM A;  1JLE A;  3F9K A;  3VQ8 A;  1A5V A;  3LAL A;  3TAG A;  4KB0 A;  2HVI A;  1JLB A;  1LWC A;  2OPP A;  3AVB A;  3QES A;  3ZSZ A;  3DLB A;  2NUB A;  3H08 A;  3IAY A;  1DTQ A;  2E6M A;  2B5J A;  3NF6 A;  3TAE A;  4KRF A;  4FM1 A;  4CJT A;  4QOZ B;  1CZB A;  2FBY A;  2R7Y A;  4AHS A;  1B92 A;  2D0B A;  3DLE A;  3ALY A;  3LP1 A;  4H4O A;  4CJW A;  4E0D A;  1ASW A;  4JLH A;  3ZSV A;  2O4G A;  4OGE A;  1UOC A;  3OYM A;  1U04 A;  1RBV A;  3SUQ A;  3SQ0 A;  1KSP A;  3I0S A;  3AO3 A;  1BHL A;  4WE1 A;  4W5O A;  2YKM A;  2ZQB A;  3CM6 A;  1SKS A;  3OVN A;  5J2M A;  4HUF A;  2VG6 A;  2HHW A;  4R5P A;  2YV0 X;  4ZTF A;  4FJL A;  4M3T A;  3HK2 A;  3B6O A;  3ZT4 A;  3AO1 A;  3T3F A;  3U6F A;  2D5R A;  3TAM A;  1BI4 B;  4KB1 A;  2QK9 A;  3V9Z A;  4BDY A;  4IFY A;  2F96 A;  3WNH A;  1NK4 A;  3QEW A;  1RTJ A;  4J2A A;  2F8S A;  1NKC A;  2Q3S A;  4FJH A;  3TAB A;  4E89 A;  2Y1I A;  1B9F A;  3QEI A;  3P5J A;  4KHQ A;  3KLH A;  1JXB A;  1S1X A;  2X78 A;  1EX4 A;  4AHR A;  1D5A A;  1HNV A;  3OJU A;  3NBP A;  4IG0 A;  4LSN A;  4W5T A;  2IDO A;  3OYL A;  3L3V A;  1FXX A;  4AHC A;  3SV3 A;  3I0R A;  1RDA A;  5DK5 A;  3ZCM A;  4CED A;  4BDZ A;  2OPS A;  4CJR A;  3VA3 A;  1ZBI A;  3OYJ A;  2KFN A;  1VRT A;  3TI0 A;  2WOM A;  4FK4 A;  5DMR A;  4KV8 A;  2XY6 A;  2I5J A;  1S1V A;  3BDP A;  3LAK A;  1C0U A;  3VN5 A;  2YHA A;  3P1G A;  3C94 A;  3HVT A;  1XHX A;  3JSM A;  2G8V A;  4OGC A;  4CIG A;  4CK1 A;  4K8Z A;  5HBM A;  5FRO A;  1C1A A;  3KD1 E;  3U3Y A;  2FBT A;  4O44 A;  3ULD A;  4NCA A;  4I2P A;  5CY4 A;  3V1O A;  3O4N A;  4EP4 A;  3MXI A;  3K5L A;  1C1B A;  5KI6 A;  1TVR A;  4CEC A;  4W5N A;  4L8R B;  1SUQ A;  2YKN A;  4OPK A;  4FLX A;  4RW8 A;  1YTU A;  1RDD A;  3CQ8 A;  3KJV A;  4CHZ A;  4LSL A;  4CCH A;  3ZSX A;  4CGH A;  2VG7 A;  3V81 A;  3AVH A;  1CZ9 A;  4CF9 A;  4FJJ A;  1TAU A;  1GOC A;  1TAQ A;  1Z26 A;  3SV4 A;  4F3T A;  4KI6 A;  1LV5 A;  2KQ2 A;  4LH4 A;  4E3S A;  3IS9 A;  1WAJ A;  3VQ6 A;  1LW0 A;  2WON A;  4DWI A;  1SL0 A;  1TK5 A;  1VSI A;  4RW7 A;  3ZSQ A;  4E7K A;  4CJ3 A;  1WSF A;  3L2U A;  3VQ9 A;  2Y1J A;  4DFJ A;  2FC0 A;  4CER A;  1RNH A;  4CJ5 A;  4FJK A;  4Q0B A;  4AHU A;  4CHP A;  3DRP A;  3NHG A;  4CJE A;  4E7I A;  2YHB A;  3QIP A;  4DFK A;  1A5W A;  1S9E A;  1L5U A;  1B9D A;  2XRI A;  3NF7 A;  4DTR A;  1HYV A;  4CHO A;  4JRQ A;  4F4K A;  1J54 A;  3SZ2 A;  3MEG A;  1IKX A;  4Z0U A;  4F2S A;  2BGG A;  1XWL A;  3SUN A;  4CFA A;  3AO5 A;  4HHT A;  3PV8 A;  1W9H A;  1D9F A;  1QS4 A;  4EZ6 A;  1CXU A;  2VWK A;  1JXE A;  1VRU A;  2QXF A;  3DMJ A;  4RG8 A;  3NF8 A;  1IO2 A;  4M41 A;  3T1A A;  4XIU A;  1KVA A;  3IRX A;  2XO7 A;  4FJG A;  4B9S A;  1GOB A;  2FBV A;  2HHQ A;  1BIZ A;  1EXQ A;  4CEE A;  3LZI A;  4ELT A;  3SYZ A;  1NJX A;  2GV9 A;  4CHQ A;  4K8X A;  3CM5 A;  3QNN A;  3A2F A;  3NFA A;  4CF8 A;  1ASU A;  3SCX A;  3OYG A;  4CFC A;  4CK3 A;  1I3A A;  4DF8 A;  4FLY A;  4NCB A;  2DTU A;  3QET A;  5CZ2 A;  2YNG A;  3AVA A;  2ATQ A;  1ZBF A;  3AVJ A;  3PY8 A;  1S1U A;  4DTN A;  2OYQ A;  4F3O A;  3ZT0 A;  4CF0 A;  3PX4 A;  3ISN C;  1DTT A;  1BGX T;  1WSJ A;  4N47 A;  3DLK A;  4FJ9 A;  5JS2 A;  4CJK A;  1IKY A;  3RMB A;  4EP5 A;  3V6D A;  4KAZ A;  2X74 A;  4ID5 A;  1NJW A;  4HUE A;  3KK2 A;  4CJU A;  3EY1 A;  3PO5 A;  3LAM A;  4C8K A;  1VSJ A;  4M3Y A;  1RT5 A;  3QLH A;  2D0C A;  3O3H A;  4FJ8 A;  4JS4 A;  3ITH A;  1KLM A;  3OYD A;  2Z1H A;  1L3S A;  4CJV A;  3EZ5 A;  3S3O A;  4M3R A;  3OYA A;  4CGI A;  3JYT A;  5HLF A;  1SL1 A;  4CGJ A;  1WLJ A;  1ZYQ A;  4CHN A;  1IKW A;  2G8U A;  2Z1G A;  4FZY A;  4CEA A;  4ZHR A;  3AVN A;  1BI4 A;  4BDP A;  1RBR A;  1RCH A;  1S1T A;  3HPO A;  4RW9 A;  3K58 A;  3AVM A;  3KLG A;  3SJJ A;  4N41 A;  1NK9 A;  3VQP A;  3M8S A;  4O5B A;  2HMI A;  1TKT A;  4FJN A;  5KTQ A;  3PX6 A;  4FYD A;  1HYZ A;  3U3G A;  2KTQ A;  3QEX A;  3DLR A;  4E19 A;  3L8B A;  1SKW A;  5J1E A;  1WNS A;  2YNH A;  1GOA A;  3M8R A;  2RKI A;  3L2Q A;  1ZBL A;  5FRN A;  3DYA A;  3NDK A;  4E7L A;  1UA1 A;  5KRT A;  4KRE A;  3MEE A;  4KHU A;  1C0M A;  4CF1 A;  1O1W A;  1U47 A;  4I9Q A;  3KK3 A;  1NOY A;  4E7H A;  1HRH A;  3TAN A;  1RT3 A;  1X9S A;  3RMD A;  1Q9Y A;  1IG9 A;  3ZSY A;  3FFI A;  3QIN A;  2VWJ A;  4M3U A;  4KFB A;  5JS1 A;  3V9S A;  1DLO A;  2OPR A;  4J2B A;  1C0T A;  4DTO A;  3THV A;  4CGD A;  1S6Q A;  5FDL A;  1L3U A;  4CF2 A;  1JL1 A;  3LP3 A;  1CLQ A;  3AVC A;  3DOK A;  2HW3 A;  3S3N A;  2P51 A;  4F8R A;  4J2E A;  4Z4F A;  3SPZ A;  1LWE A;  3DLH A;  4H8K A;  4M3W A;  4OKE A;  1S6P A;  2RF2 A;  3QO9 A;  1NK6 A;  2O4I A;  4BAC A;  2G8H A;  3PX0 A;  4CE9 A;  1J5O A;  3CG7 A;  3LPU A;  1LWF A;  3OS1 A;  4C8L A;  3QER A;  3SUP A;  3OYC A;  1XI1 A;  1UAX A;  5CZ1 A;  1JLF A;  4DTP A;  4W5Q A;  1NJY A;  3OYF A;  4DSI A;  3L2R A;  1T03 A;  3OYI A;  1JKH A;  3ZT3 A;  1UA0 A;  1ZBH A;  3HO1 A;  1D8Y A;  2G8I A;  2HND A;  4DG1 A;  1L3V A;  1N6Q A;  1TK0 A;  3C6U A;  4DU1 A;  2PYL A;  3B6P A;  3NGY A;  4FW2 A;  3KIO A;  3LPT A;  3WNE A;  5HRP A;  4DSE A;  1W0H A;  4HCB A;  1C6V A;  4H4M A;  4IBN A;  1RBT A;  3AA2 A;  4FK2 A;  2KW4 A;  1LW2 A;  4BE1 A;  1VSK A;  3I8D A;  3HXM A;  2ZD1 A;  3HVR A;  1JLQ A;  3CFP A;  1HYS A;  2XY7 A;  4ZTJ A;  3D45 A;  4Z4C A;  5EU7 A;  3OS2 A;  3UIQ A;  4YFU A;  3PUF A;  4BWM A;  3OYN A;  2BDP A;  2E4L A;  1RT7 A;  5KRS A;  5T7B A;  4HUG A;  5I42 A;  4IDK A;  4JS5 A;  3QNO A;  2B6A A;  1JLG A;  1JLC A;  4KKO A;  4Z4G A;  5KGX A;  4Y1C A;  3MAQ A;  1NKE A;  1KRP A;  3PO4 A;  4I7F A;  4OJR A;  4M3Z A;  3M8P A;  3L3U A;  4PY5 A;  3DRS A;  5SWM A;  2KFZ A;  4FJ7 A;  3K59 A;  4FZX C;  4M45 A;  2HHX A;  1MU2 A;  4CJL A;  3K5N A;  4DS4 A;  1KVC A;  4GVM A;  4TSX A;  3BGR A;  1HPZ A;  1IKV A;  4CK2 A;  3HM9 A;  1VSH A;  4DSJ A;  4CJP A;  1LAW A;  1T05 A;  3ASM A;  3MED A;  3TAP A;  4OKK A;  3WNF A;  4CEO A;  3AVI A;  4E1M A;  3RRH A;  1Q9X A;  3KD5 E;  4B08 A;  3ZT2 A;  4PWD A;  3ZSW A;  4CEB A;  4B9T A;  5D3G A;  3OYE A;  4DQQ A;  4KTW A;  4CEQ A;  1BCM A;  4NCG A;  4HTU A;  3OYB A;  2LSN A;  3O3G A;  4DF4 A;  2E6L A;  2W42 A;  3RTV A;  2A1R A;  4FLW A;  4HVJ A;  1WN7 A;  4KO0 A;  5FRM A;  1QTM A;  2DFF A;  3QIO A;  2Z1I A;  1VSF A;  4RW6 A;  3TAR A;  1S5J A;  4AH9 A;  3WNG A;  1Y97 A;  1TV6 A;  3CYM A;  1BQN A;  1HQE A;  1RT6 A;  2OPQ A;  4C8O A;  4BE2 A;  1WSI A;  1YT3 A;  3MXJ A;  1JLA A;  4Z4H A;  3LP2 A;  3VQ5 A;  1VSL A;  4LD0 A;  1U45 A;  4KHN A;  4FLT A;  4YNQ A;  4HCC A;  2IGI A;  4DQP A;  4C8N A;  1X9M A;  3KKR A;  3VQC A;  1QHT A;  4FW1 A;  4J2D A;  2F8T A;  1WSE A;  1G15 A;  5K14 A;  3NCI A;  3AV9 A;  1QSL A;  4B9V A;  4Z4I A;  2KZM A;  4KTZ A;  4CJQ A;  4FJI A;  3DOL A;  4W5R A;  3OYK A;  1S1W A;  4OKJ A;  1SV5 A;  2ZE2 A;  5C42 A;  5HP1 A;  1N5Y A;  4FZZ A;  4LH5 A;  1T7P A;  4EZ9 A;  1A5X A;  1RIL A;  3HT3 A;  4LY7 A;  4AHT A;  1TK8 A;  2PZS A;  3AVL A;  3NH2 A;  1WSH A;  5J2N A;  1U4B A;  4F2R A;  4IKF A;  4Z4E A;  1JL2 A;  4FLV A;  2HNZ A;  4CGG A;  1VK0 A;  3MEC A;  3DM2 A;  4FXD A;  3K2P A;  1KCF A;  3QEV A;  4UQG A;  4N76 A;  4C8M A;  4N5S A;  2VG5 A;  4AIL C;  4I9L A;  1S9G A;  4N56 A;  2XHB A;  3RR7 A;  1KFD A;  1TL1 A;  3O3F A;  1IH7 A;  3ZT1 A;  4IFV A;  3L2W A;  1ITG A;  4DFP A;  3SI6 A;  1XC9 A;  2KZZ A;  2P5O A;  3HPG A;  4O4G A;  5CYQ A;  3NH0 A;  3LZJ A;  1TKD A;  1QSS A;  2BAN A;  3RMC A;  4FJ5 A;  2OA8 A;  2IAJ A;  4CIF A;  1FK9 A;  4DTJ A;  4KI4 A;  3M8Q A;  2OZS A;  3LAN A;  4DU4 A;  1HMV A;  1TGO A;  2XY5 A;  1FKP A;  4G1Q A;  4E7J A;  4DQR A;  4DSK A;  2DY4 A;  3AA4 A;  1SKR A;  2X6N A;  3OYH A;  4PQU A;  3K5O A;  3KLF A;  3OJS A;  3HP6 A;  3VQB A;  2RPI A;  3TAF A;  4MQ3 A;  3VQ4 A;  3ZSR A;  2ITG A;  1BIS A;  3KLI A;  4DTS A;  2PYJ A;  4KHS A;  2QKK A;  4CEZ A;  2IC3 A;  4Y1D A;  4OVL A;  1RDC A;  1D9D A;  1KVB A;  2IOC A;  2A1S A;  3KK1 A;  1CXQ A;  1TKX A;  4RW4 A;  2D0A A;  1TL3 A;  4QAG A;  1RT4 A;  3AO2 A;  2GUI A;  3ZSO A;  3VA0 A;  1KLN A;  3KTQ A;  4CHY A;  2HHV A;  3AVK A;  3RR8 A;  1YTA A;  2X6S A;  1NK8 A;  4JRP A;  4I2Q A;  4BE0 A;  2P1J A;  1EP4 A;  3EYZ A;  5HRS A;  4DTM A;  2EHG A;  3DRR A;  4PA1 A;  3TWH A;  3V9U A;  3RRG A;  2JGU A;  2YNF A;  5C24 A;  1Z25 A;  3OY9 A;  4ELV A;  1NKB A;  4O0I A;  3RWU A;  2IS3 A;  4DSF A;  1VSD A;  4CIE A;  3T19 A;  1U49 A;  5I3U A;  4KTQ A;  3HJF A;  1UWB A;  4ID1 A;  1T8E A;  3DLG A;  5HRO A;  3G0Z A;  5HRR A;  3S9H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...