4IFVA

Detecting allosteric sites of hiv-1 reverse transcriptase by x-ray crystallographic fragment screening
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
556
structure length
556
Chain Sequence
MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Detecting Allosteric Sites of HIV-1 Reverse Transcriptase by X-ray Crystallographic Fragment Screening.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase/transferase inhibitor
molecule keywords Exoribonuclease H, p66 RT
total genus 167
structure length 556
sequence length 556
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4ifvA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ifvA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ifvA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ifvA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ifvA05
3TANA 3HVWA 1S1VA 1W9HA 3OYLA 2J6UA 2FBXA 2XC9A 1TKZA 1K6YA 4FCYA 1SUQB 2RPIA 3H5XA 2A1SA 1ITGA 3HVTA 4ZP7A 4KTZA 3ZCMA 2GBZA 3AO2A 1JLQB 4IRDA 1S1TA 4QWBA 2D3ZA 3Q8PB 3PW5A 2YHAA 4ECWA 2ASJA 4I7FB 4J9KA 5DMRA 3G6YA 1TQLA 3V81A 3F9KA 2W7PA 4Z4IA 2KZZA 4ED6A 3QIOA 1RT1B 4O3SA 2OPQA 4YP3A 3AA3A 1HQEB 1ZBUA 1JLBA 3B6OA 4URSA 5E41A 3LPTA 3S3NA 4ECVA 2W9BA 4ZMMA 3C6TA 4CJ4A 4DQIA 1JLFB 1HNVB 4O44B 4RG8A 4Z4EA 5KG5A 3UIQA 3DM2B 3OS1A 2J6SA 3OLBA 3CWJA 1VRTB 1RAJA 2ATLA 4CHNA 4XPEA 3NL0A 4B9LA 1HPZA 1NJXA 5DQIA 1TKZB 3QNOA 3OYEA 4CF8A 4DQRA 2PYJA 3HVTB 2ASLA 3ITHB 4B3OA 4KBIA 3HP9A 4JS4A 1MMLA 3QZ7A 3GILA 4Q0BB 3KLVA 3QEXA 5CYQB 3QZ8A 3KOAA 5FDLB 3V6DA 4MFBA 4JV0A 4KHQA 3NBPB 4ZTJA 4CIGA 4B9UA 3LP2A 1RBUA 3ZSOA 4N56A 3OY9A 3FFIB 5C25A 4CGHA 1REVB 1BQMA 4MKAA 1YVUA 3IGVA 4F50A 1EXQA 3V9WA 1T8EA 4RW8B 1JX4A 3K5MA 4KHWA 2QE5A 3MEGA 5KG6A 4CGGA 2IJNA 3H4BA 2C2DA 1S5JA 4KHRA 4ECZA 2P5OA 1I6JA 1KVBA 2D7SA 1S6QB 4DMNA 2G8FA 2AX1A 3UQSA 3BSNA 4CFCA 3CQ8A 2VA3A 5F8JA 1NK7A 3OLAA 4TN2A 3BDPA 4R8UA 3SQ4A 4ZP6A 4DU3A 4LH5A 4BWJA 3SI6A 4Q44A 3RB6A 4ZPDA 3SQ1A 3MF5A 3NF7A 1NNDA 3L3VA 4CEOA 3QEWA 4CHYA 3SUPA 5KFLA 4BE2A 3V6JA 5KTQA 1N5YA 1L3VA 1RTDB 5T14A 1Q9XA 1XWLA 5KGWA 1C1CB 3DLGA 2B4JA 4WE1B 3KIOA 1O1WA 2ZD1B 4FS1A 3ZT4A 1J53A 3V1QA 5FRMA 1IKXB 2R2TA 3L2QA 1C1BB 5HP1A 3S9HA 4I2QA 2O5DA 1DTQA 5KT2A 1RTIA 1RDCA 3IAYA 3FFIA 4M3WA 3QINA 4IKAA 2R8KA 3LP0B 3BJYA 1KLNA 1S1XA 1QTMA 4B9TA 4H4MB 4EBDA 2PYLA 1T3NA 2UUWA 1JL2A 3B6PA 2IM2A 2GUIA 1S9FA 2HHWA 4NCAA 3IN5A 4ELVA 1RT5B 4PUOA 5L1IA 5EDWA 3V6HA 2P51A 5J2QA 4IFYB 3O3HA 1SL0A 3K5LA 4KV8B 4EP4A 2E6MA 4FLWA 2G8WA 4CEDA 2YNGB 3FDSA 5KRSA 3SPZA 4FJ8A 5KFQA 1RBSA 2FBYA 1S97A 2HNDB 1T03B 4RU9A 4Z4HA 1TVRA 3NAEA 5CZ1A 5KFIA 4BE1A 4QPXA 1RT6A 4WZMA 3SZ2A 5L1LA 4KTWA 2E9ZA 3HL8A 3ISND 1XI1A 5KFAA 3T5LA 3GIJA 2ZE2B 3DLGB 5KI6A 1RTIB 2HHSA 3L2VA 1K1QA 3P83D 3SQ2A 3L3UA 3KHRA 2LSNA 4B9VA 5C42A 4F4ZA 5JXSA 4H4OA 3E01B 5J2NA 4ED1A 1CLQA 1YVFA 4O44A 3IG1A 2E9RX 4FZZA 4HTUA 3HSTB 1NHVA 3SPYA 2WHOA 4IR9A 1RYRA 3NH2A 3AVMA 5HLFA 3PR5B 2FVRA 4MIBA 4EZ6A 1BQNB 3WNFA 4DLGA 5KFFA 2FVQA 1RTJB 4O4GB 3GV7B 1X9MA 2HHQA 3UR0A 1WSFA 4CEBA 4KHSA 3DRSA 3NF9A 2E6LA 2IM1A 3ZSXA 4PUOB 4J9MA 1T94A 2Z1IA 4PA1A 1Z25A 3HPGA 4B3OB 3AVBA 1BL3A 2HHUA 2VG6A 1RDDA 5FROA 4FM1A 3C95A 5SWMA 3GYNA 4E7KA 4DG1B 4E1NA 4KPYA 1C6VA 5HBMA 3FSIA 1FXXA 3GIIA 2F8SA 4MQ3A 4K4VA 4NCGA 1C0MA 1HYSA 1RT3A 4YFUA 3OL7A 4XPCA 3LZJA 4NCBA 3RBEA 3DLEA 3CJ2A 5KFEA 3AVFA 4YMEA 1BHLA 5DLFA 1JLGA 3TABA 3MR2A 4M3UA 1RT6B 3KLEB 3VQEA 4M3TA 2IC3B 4E19A 3CJ5A 4GC7A 1U49A 3BGRB 4ZPBA 1I39A 4CCHA 4G1QB 2YHBA 1TV6B 1DLOB 3KHLA 3ZSYA 3IRXB 1TL3A 3RAXA 3EPIA 1BCOA 3HKWA 1UWBB 4ED3A 4K4SA 4Y3CA 1VRUB 3C94A 2AGQA 1IG9A 4J2AA 3C6UB 1S6PA 3OYDA 4FLVA 1JLAB 4ZVGA 4PWDB 2BANB 4N5SA 5HLFB 4BACA 1N5YB 2OPPB 2JGUA 4RW9A 1SKSA 1TKTB 4IRCA 2IGIA 1EP4A 4CE9A 3RB4A 3KLHA 2BE2A 4QW9A 4FJMA 4EZ9A 4KRFA 3HK2A 3KMQA 4NRTA 3S3MA 2W8KA 5KFJA 2IBKA 1KTQA 4I2QB 3H5UA 2XY5A 4Y1CA 4FK0A 4PQUA 2FBTA 3JYTB 1RT4A 3KLEA 5KRTA 4CGDA 4RW7A 2IOCA 4FBTA 5KGXA 3SUNA 3VA3A 4Q45A 4RNNA 3QEIA 1S1XB 1KHWA 4H4MA 4RW6B 2OA8A 1J54A 4F4XA 4G1QA 3DDKA 4C8MA 4M3ZA 2B5JA 4DU1A 3LDSA 2AQ4A 3MEDA 1UOCA 4DL6A 3HVRA 5HP1B 5KG0A 1XR6A 2UUTA 3OYFA 3T3FA 3T19A 4JV2A 3C6UA 1C1BA 2HNZA 3NKYA 3PX6A 4FW2A 2BR0A 5KG2A 4DTPA 4DFJA 2EHGA 1S0OA 5C24B 1S0MA 3VQ7A 2FLLA 3QGIA 3D45A 3OYNA 3ITHA 3NF6A 2HMIB 4EYIB 3MEEB 2XCAA 2VWKA 4DTXA 1K1SA 2QK9A 3NAIA 4FJGA 1MU2A 2QV6A 1LW2B 4FJ5A 4O3NA 3UPFA 3ZSWA 3DLKB 3HVAA 3M8PA 1REVA 4MK7A 3BSAA 3CDUA 3EZ5A 3AVCA 4Z4GA 4CFDA 2P5GA 1JLBB 4B8CA 3K2PA 3SCXA 3CDEA 4UQGA 4QWDA 2R2UA 3PW2A 3MXMA 5CYMA 3K58A 4EBCA 2XY8A 1L3UA 5KG1A 1CZBA 3EYZA 5KFSA 2XGQA 1SKRA 4FZYA 1DTTB 3BR9A 4IG3A 1KCFA 4ZVHA 3LZIA 4QWCA 3AO3A 3NHGA 3HXMA 2EX3A 4NLPA 2FBVA 5C24A 4DQQA 2XO7A 4CK1A 2F8EX 2AWZA 4ECQA 1BISA 3PUFA 4WFXA 4WXOA 1SV5A 4KFBA 5HRPA 4B9NA 2B5JB 1TL1B 4CJEA 2C22A 3KK1B 1S9GB 3MTKA 4KB7A 2D0CA 4FJJA 4IH7A 4ZHRA 4DF8A 2P1JA 3DOLA 5KFOA 3P1GA 4KB1A 2O4GA 3PY8A 1RTDA 4K4UA 5EWGA 2B43A 1SL2A 1S1WA 2IM3A 2QKBA 2FJVA 2OZMA 3TARA 4K4TA 3TR8A 3H59A 3THVA 4F3TA 2VG6B 4CJSA 2R2RA 2KTQA 1A5XA 3QNNA 3NGYA 1JLGB 4KTQA 1KVCA 2ILZA 1L5UA 1JXBA 4M3YA 4ZPCA 2KFZA 4OLAA 4BDPA 1Y97A 4GW6A 3OHAA 1X9WA 4DF4A 4J2DA 4JRPA 4H8KA 4CJWA 1I3AA 4WE1A 3V9UA 4FK2A 1RT3B 2X6SA 4BDYA 2PY5A 4KFBB 5I3UB 4MH8A 4OPJA 4DFPA 3HHKA 3PO5A 1SL1A 2HNYA 4CJKA 1KLMA 2DFEA 1NK4A 4C8KA 3NAHA 2OZSA 1W25A 2XGPA 4FJXA 3U6FA 2EC0A 5L1JA 2UVRA 3V9ZA 5F8MA 5DG9A 1KRPA 1C1CA 4IOBA 3V9SA 4CHOA 5J2QB 3T5KA 2C2EA 1QAJA 1YTUA 1NOZA 4KHNA 4U7CA 5L9XA 3CVKA 4CK3A 4NYFA 3KMSA 5J1EA 4RNHA 1TKDA 4CF0A 4KI4A 5C5JA 1S49A 1S4FA 3G6VA 1VSKA 3QERA 2RKIA 3NMAA 5KFRA 4O3PA 4K4ZA 3DOKA 3NH0A 3T1AA 3SUQA 1TKTA 3BQ2A 3HJFA 1SKWA 1GOAA 3KLHB 5KFZA 4J9QA 3D0PA 3PX0A 1BCMA 3NBPA 4K50A 3PW7A 3OS0A 1C0TB 4NLOA 4OGEA 3V6DB 1WSJA 3OYAA 4FJ7A 3DRRA 4ZTFA 3I0RA 3GQCA 1NKEA 2XWYA 1QSLA 1GOBA 2AU0A 3QLHB 2WOMA 4ID5B 1JKHA 2R8HA 1T03A 4O55A 3MEEA 4QWEA 4ZVEA 4GC6A 2I5JB 3OYJA 3VQSA 3GV8B 2OPSB 5CYQA 4ZPAA 3KK3A 5DQHA 2GIRA 2V4RA 4MFBB 4WFYA 3DI6A 4IFVB 1SH3A 5DQGA 2YKMA 1RTJA 2W9CB 3MFHA 2HNZB 3OYHA 1NKBA 3TAPA 1XHXA 3DRSB 1IKVB 2W7OA 4HCBA 4KKOA 5KG7A 3BREA 1S10A 4LSNB 3VQBA 3SNNA 3SI8A 1S1UB 4FLYA 4M3XA 4NLGA 3DYAA 3NH1A 5HBMB 1WNEA 4KREA 2FVPA 3QESA 2G8IA 4OPKA 4FJIA 3AA4A 4XO0A 4F4WA 1MU2B 3K5OA 4FS2A 3PZPA 1ASVA 3I0RB 4KHMA 4Z0UA 4CJFA 1NKCA 1IKXA 1S1VB 1HJRA 4URGA 1X9SA 3VA0A 1RT2B 2PZSA 4G3IA 4C8LA 5L1KA 2R7YA 1UA1A 2Y1IA 5CYMB 4FK4A 5KFMA 3H08A 4ZHRB 4FJHA 1FK9A 1IKWB 3DRPA 4J9PA 4AHSA 4KHUA 3RBDA 2HB5A 3AVJA 1N6QB 4RNFA 1S0NA 3KD5E 5EWFA 1IM4A 3M9MB 4K4XA 1TP7A 4JLHA 4BDZA 3V9XA 3OL6A 1CXUA 1RNHA 4NLRA 1RDBA 1JLFA 4IBNA 2WRMA 2OPQB 1JLEB 4O3QA 4DL5A 1S9EB 4OL8A 4BE0A 3D5MA 3LAKA 2VG5B 2Q3SA 1S6PB 3H5YA 2W42A 3C6TB 2D3UA 3KKRA 1KSPA 3MR3A 3CM5A 5K14A 5KFGA 3KK1A 2W9CA 2OPSA 1S9GA 1L3TA 3A2FA 3V1RA 3PHEA 4RNOA 2HWHA 2HVHA 1KFDA 1TVRB 3OVNA 4ECTA 4M94A 5CZ2A 4CJPA 4ED0A 4B08A 4EO6A 4QW8A 3UDLA 2OPRA 3N6LA 3VQ9A 3M8SA 4KKOB 3DM2A 4NLSA 4AHRA 4GMJB 3WNHA 1KHVA 4TQSA 4Q43A 4RW7B 4Q8FA 4Y1DA 1RILA 4NLXA 1FKPA 5KG4A 1TKXB 4O5BA 4DL4A 2E4LA 4M95A 3V4IA 1CSJA 3BQ0A 3KK2A 1LAVA 3KLFB 1IKWA 4O3OA 1VSJA 2QXFA 2R8IA 4OKEA 1HQUA 2RDJA 5FDLA 1KLMB 3SV3A 5J1EB 4B9SA 4QWAA 5KT4A 3OHBA 3IS9A 3L2WA 2RF2B 3TAMA 1D9DA 3AO1A 2ZE2A 1U47A 1C2PA 4MKBA 3FQKA 5JUMA 2YNIA 4HUFA 1D0EA 4E0DA 4WYWA 3KKSA 1L3SA 3O4NA 1HARA 1CZ9A 3OL8A 4NZ0A 2ETJA 2VG5A 1C1AA 3PO4A 1RT7B 1VSEA 4OKJA 3TWHA 1VK0A 1S48A 3VQ6A 4FM0A 4E7IA 1J9AA 2BRLA 1WSHA 3PW4A 3G10A 5KT7A 1B9DA 4CEEA 3SJJA 3RMBA 3H40A 1G15A 2VG7B 4K4WA 1GOCA 1JLCA 4RZRA 3SV4A 4WXWA 1WN7A 3OL9A 3ICLA 4C8OA 1U45A 3OSNA 5DGBA 4O3RA 3K59A 1UAXA 1CXQA 3QEVA 3SQ0A 2X6NA 2J6TA 3AA5X 2AJQA 4MIAA 2DPIA 3OJUA 3ZT0A 4FM2A 4ZVFA 3MXIA 1QS4A 3AO5A 5SZTA 4Z4CA 1LWEA 5KT6A 4FLUA 4CGJA 3E51A 1NK9A 4IR1A 4NLTA 4TLRA 3I0SA 3PW0A 4LY7A 1TK8A 3BGRA 5F8NA 1U04A 3QGHA 1ZBFA 4FBUA 3AO4A 4CJ5A 3KLFA 3I5AA 3NGDA 4YR2A 4NLQA 1SV5B 4E1MA 3V4IB 1NK0A 1JL1A 1J5OB 4C8NA 1ASWA 1HMVB 3LWLA 3V6KA 3DOLB 1RT5A 3PJWA 1WAFA 4ECUA 4DS4A 3LP0A 1DTTA 4LQ9A 4DTRA 2RF2A 4IKFA 2XHBA 1HPZB 4DQPA 4OKKA 4N41A 4K4YA 3H2LA 3QIPA 3V1OA 4IH5A 1YT3A 4Y2CA 4QCLA 2B6AA 4DEZA 1Q9YA 4DSFA 2YNGA 4W5OA 2BANA 3RRGA 3TI0A 2HHXA 1WSGA 3RWUA 4AHVA 4CJQA 3U3YA 4IQXA 3ULDA 4HUEA 2IMWP 3JSMB 3VQPA 1JLEA 2JEIA 1FKOB 1T05B 4YR0A 1C0UA 4F4KA 5KFKA 2XY6A 2HNYB 3SUOA 2G8VA 4J9NA 1NK6A 3I5BA 3GIKA 2HVIA 3CJ4A 2Z1JA 1Z4UA 2YNHA 3RRHA 1ZYQA 3G6XA 4IG0B 4J2BA 4LQ3A 2D5RA 3RB0A 3VQ8A 3I8DA 3Q8RB 1EETA 3NCIA 3KLGA 1ZBLA 4ED7A 2WONB 3MEGB 1QAIA 4ECXA 4CJUA 1ZTWA 1D8YA 4EEYA 4DTSA 3TAEA 4F2RA 1HYVA 4ED2A 2IJFA 3VQ4A 1C0TA 3BQ1A 1LWFA 2YKNA 4MK8A 2JEFA 5KFPA 4DSJA 4CESA 5JS2A 3M8QA 1U4BA 3CIZA 1RTHA 3NE6A 2QKKA 3LAMA 4TYAA 4OLBA 3CFOA 4JRQA 2HHVA 3OYCA 3G0ZA 4O4RA 4ICLB 3OYGA 4OGCA 1S6QA 1EKEA 2FJXA 1OS5A 3MECB 1SUQA 3K5NA 2KZMA 2D41A 1LWCB 4Y34A 4RW4A 3JSMA 3EY1A 2ZD1A 1RA6A 1TAQA 2I1RA 3DMJA 5KFNA 4CJVA 2HHTA 3LALA 5F8GA 1ZBHA 1IKYB 3AV9A 4TXSA 1TAUA 4B9MA 4JV1A 1QQCA 2F96A 4DU4A 2WB4A 4ELUA 1HYSB 2RN2A 2BQUA 3M8PB 4IG0A 3HYFA 3QYYA 3ZSVA 3DLRA 4TYBA 1TL1A 1HNVA 3HP6A 4DFKA 2W8LA 5F9LA 1DTQB 2RDIA 2C28A 3T5HA 4ZP8A 1NJWA 4YR3A 2OPPA 1SH0A 1LAWA 1RBVA 4BWMA 1EETB 2HWIA 3Q8SB 3TAGA 1U09A 1JXLA 4Z4FA 3IS9B 3NDKA 1TV6A 3LP1B 4CJLA 5HRRA 3MECA 4CF9A 2W9AA 1UWBA 1VSDA 4L8RB 3U3GA 4JUZA 5KFUA 1VRTA 2IAJB 1WSEA 4J9LA 4KI6A 5DGAA 2BRKA 1WNSA 3AVAA 4R5PB 3M8QB 1JLCB 3L2UA 2HNDA 2F8TA 4DTJA 3DI6B 3AVLA 3RMCA 1UA0A 4RW6A 3CYMA 4CECA 1RYSA 1RT2A 3P5JA 3ISNC 3EZUA 2BQRA 3K57A 2D0AA 3HPHA 1J5OA 2OYQA 4NRUA 4RW8A 2FLPA 4CGFA 3S3OA 3ZSQA 2JEJA 2UVUA 4DSLA 2V4QA 4JS5A 1NJZA 4M3RA 5KFXA 4NLYA 4KO0A 4I9LA 4DL2A 3NF8A 5C42B 3KHHA 5KG3A 3EPGA 3LPUA 1QUVA 1U48A 3MR6A 5C25B 4CFAA 3KJVA 2IM0A 3CO9A 3LP2B 4K8ZA 3RAQA 4ELTA 3E01A 5J2NB 1HNIA 1IO2A 1S9EA 1BQNA 3AVKA 3ZT2A 4EYHB 3N6NA 3M8RA 2B6AB 4HHTA 2O4IA 1HMVA 4O4GA 3RR7A 4ZP9A 3CM6A 3OS2A 4DLEA 1N48A 3DOKB 3NFAA 3D28A 3ASMA 4E89A 5D3GB 2RKIB 4AHCA 3HO1A 2XY7A 3ZSRA 4CFBA 4DTMA 4ECSA 3RMAA 4CHZA 3L8BA 3MFIA 4LH4A 3KLIA 2V0NA 5J2PB 4LSLB 3DLHA 1EX4A 2Z1HA 1RA7A 1GX5A 4ID1A 4W5QA 4M41A 5KFWA 1A5VA 3KNAA 3TAQA 2I5JA 3L2RA 4DWIA 2IS3A 4M45A 3KHGA 4KAIA 4CK2A 4TSXA 2YV0X 4XIUA 5EU7A 1XHZA 2VG7A 2ZKUA 1JXEA 1RTHB 5DG8A 3QIDA 5F8HA 4PWDA 3PV8A 2YKMB 5KFTA 2IC3A 1QHTA 3SYZA 1IKVA 4CF2A 1RCHA 4NLUA 4IDKB 1RT1A 3ZT1A 1VRUA 2ALZA 4PY5A 4FLTA 1NK8A 4RW4B 4TY9A 3IRXA 3KD1E 1HYZA 3T5JA 2CJQA 2WONA 4NLDA 2YNFA 2AGOA 3DYAB 4KAZA 3KTQA 3I0SB 5EWEA 2JLEA 2G8KA 4I7FA 1IH7A 4CF1A 4KHYA 4KV8A 2HAIA 2KFNA 3CDWA 3FQLA 2GC8A 4H54A 1BIUA 4FJNA 3QO9A 4RW9B 4MK9A 3TAFA 1ASUA 1QSYA 4J9OA 1TGOA 4DSKA 4WZQA 3PJXA 4I2PA 4J2EA 3LANA 1FK9B 2XI2A 5DLGA 1QSSA 5J2PA 4FVMA 1LWCA 3RB3A 1RDAA 4B8AB 2X78A 4K8XA 3PVXA 1WSIA 5CY4A 1YTAA 5I42A 4AHTA 5HROA 4YQWA 2JEGA 4FLZA 1BI4A 4R8UB 4F4YA 3LP3A 5EUHA 1BQMB 2VA2A 4CHQA 4CGIA 3N6MA 3ZSZA 5K14B 4DQSA 1BIZA 1R0AB 3MEDB 1B9FA 4R0EA 3HM9A 4N47A 2WTFA 1F21A 4Q0BA 2DPJA 2X74A 3AVGA 1LWEB 3VQDA 4KE5A 1ZETA 3QGGA 4IDKA 3CFRA 2ILYA 1D9FA 3WNGA 2VWJA 4IH6A 2R8GA 3DLKA 2BDPA 1LW0B 4CEQA 2OPRB 3BSOA 3AA2A 3GV5B 3ZT3A 4URQU 4EP5A 1SH2A 1VSFA 2HMIA 5KFYA 1T7PA 3QIPB 4RUCA 1LW2A 2FLNA 2G8HA 3SFUA 4AH9A 1WAJA 1FKPB 4TY8B 4DSEA 1NJYA 1RBTA 2UVWA 4RNMA 2D0BA 4N76A 4J9SA 5FRNA 2KQ2A 4E7LA 3HPOA 3KLGB 5DG7A 4OVLA 4EO8A 3KJVB 3O3GA 4WYLA 4NCGB 3PX4A 3CJ0A 3DLEB 1XR5A 2WK4A 4F2SA 4HVJA 1HRHA 2IDOA 4CIFA 1NOYA 4Q5VA 3TAMB 2DY4A 4HUGA 4LD0A 2YNHB 3V81B 4YNQA 1BI4B 4IG3B 2AGPA 3QLHA 1BGXT 2BGGA 1S1WB 1XC9A 3OYBA 3HT3A 5I42B 4U6PA 2GV9A 5KFBA 4OJRA 2XI3A 4CHPA 3KK2B 1VSIA 5KT3A 4W5RA 1TL3B 3H98A 4NLWA 5DK5A 4HCCA 1N56A 1HNIB 3VQAA 4CJRA 4IFYA 3RR8A 2ASDA 2DFFA 3OYKA 3KK3B 5HRSA 3AVHA 3MAQA 1GX6A 2DFHA 4IFVA 4PQUB 1S1UA 4Y2AA 1LV5A 2XRIA 2ATQA 4HYKA 4QOZB 1EP4B 5KFHA 3DLBA 4NYNA 4TQRA 3M9OB 5T7BA 4ICLA 2GIQA 4DSIA 4CIEA 5D3GA 5KFDA 4LSNA 1RT7A 4W5NA 2KW4A 2FVCA 5KT5A 4RUAA 2C2RA 3DRPB 5I3UA 3VN5A 4FXDA 2A1RA 2HW3A 3VQ5A 3MR5A 3OSPA 3JYTA 4FZXC 3I5CA 4TY8A 4NLVA 4CEFA 1RBRA 3OJSA 2E9TA 2IA6A 1D5AA 4KSEB 3Q8QB 4H4OB 1RDRA 1QE1B 4J9RA 3H5SA 2AX0A 4CEZA 3G86A 3VQCA 1N4LA 3LWMA 5KFCA 3GIMA 4O0IA 4AHUA 4E3SA 1N6QA 3DMJB 3SFGA 1IKYA 4NYZA 5F8LA 3QO9B 3LP1A 5J2MB 4FYDA 1JIHA 3CJ3A 4DFMA 2R8JA 4FJKA 4E7JA 2BQ3A 4AILC 2Y1JA 1VSMA 3TQ1A 4DG1A 3TVKA 4ECYA 4CJ3A 2NUBA 3AVNA 2IAJA 5KFVA 2R2SA 3IG1B 3FRZA 3RMDA 4R5PA 4FW1A 2YNFB 3QETA 1A5WA 4FLXA 1TKXA 2OH2A 4I9QA 3DRRB 4KB0A 2ZQBA 1WLJA 1C0UB 4ED8A 4ECRA 4FJ9A 4WFZA 1VSLA 4DL7A 4W5TA 4I2PB 4M42A 3NGIA 2G8UA 3M9NB 4QAGA 4F3OA 3OYMA 1TK5A 3OYIA 1JLQA 4DL3A 1Q8IA 1ZTTA 1HQUB 3RTVA 4DS5A 4EBEA 2FJWA 2UVVA 1KFSA 1B92A 5HRNA 2WOMB 4ID5A 3PR4A 1JKHB 3O4QA 3MXJA 1VSHA 4O0JA 2BE2B 1QE1A 4X2BA 4CJTA 4CEAA 4E7HA 5J2MA 1NK5A 2FC0A 4CERA 5HROB 3H4DA 1FKOA 1S1TB 1T05A 4DTNA 3BSCA 3F73A 5F9NA 3CFPA 3KLIB 2W9BB 1D1UA 2Z1GA 2XCPA 5JS1A 2ITGA 1RT4B 1R0AA 2JC0A 2FVSA 3VQQA 3CG7A 1KVAA 1JLAA 2YNIB 3ALYA 1ZBIA 1HQEA 1XR7A 4DTOA 4KO0B 4DTUA 2CKWA 3O3FA 4F8RA 2JC1A 2V9WA 1Z26A 3WNEA 1W0HA 3QEPA 4GVMA 4FJLA 1TK0A 4HKQA 1DLOA 1NHUA 1LW0A 1X1PA 2DTUA 4Q8EA 3IGNA 3AVIA 4LSLA 3NGZA 1LWFB 2YKNB 5F8IA 2WCXA 4IRKA
chains in the Genus database with same CATH superfamily
4WFBQ 2ITMA 3TANA 1WKLA 1Y5LB 1IBLJ 2EK6A 2K1RA 2J6UA 2E5LK 3THYB 1K6YA 3NGTA 4RUHA 2QWQA 1SUQB 1K0TA 4FXWA 4KTZA 3AO2A 1JLQB 2NRRA 5GAEP 2BMBA 1Q8KA 2FDNA 2H9ZA 3GG0A 2ADBA 3CD5A 2YHAA 4ECWA 4NLBA 2QFJA 5HQMA 3W1YC 3V81A 3IM8A 1K44A 1P90A 2OPQA 4YP3A 2ZGYA 4BC4A 4URSA 5B08A 3LPTA 5AQIA 4ZMMA 1YF5L 2OKQA 1X4BA 2KYZA 4LF4F 4XTTA 4O44B 1UEKA 2PN6A 4Z4EA 2WSCC 2W2QP 2DRAA 3SQGB 2ATLA 1Q82O 3LDLA 1WUAA 4HWIA 4BC2A 4WIQA 1NGIA 2NZ4A 3GFXA 1NJXA 4WFNQ 4PL8A 1TKZB 3PIOL 3HZGA 4FKYA 1F5CA 4M8LA 4PG5A 2PYJA 2I38A 4B3OA 4KBIA 1DKGD 3KLVA 5CYQB 3ENWA 5FDLB 4MFBA 2OEKA 1OKJA 4ISGA 3AXKA 4ZTJA 4JKGB 3LP2A 1RBUA 1VQ4S 4N56A 2GTDA 5ETRA 4FWLA 5C25A 4CGHA 1JCEA 1YVUA 4F50A 1RSCA 1EXQA 1PAEX 3D2WA 1HFEL 1T8EA 4RW8B 3K5MA 4KHWA 3MEGA 4K59A 4RO0A 5KG6A 5C0YA 4UZBA 1U1NA 2IJNA 4H4KA 2IHR1 4ECZA 1X9JA 2UXCK 3KWMA 2KM8B 2D7SA 5BYSA 3CMAS 4DMNA 3BSNA 3UQSA 4XH1A 5F8JA 1UETA 3Q2SC 2CPYA 4DU3A 4LH5A 1WC4A 1GTHA 2OJ3A 3WIVA 2FLOA 2CRLA 4BRHA 4ZPDA 3SQ1A 1TMMA 3D3CJ 3ET6A 1NNDA 3ZC4A 1YITN 1WDDA 2GHVC 5B7WA 3CCWA 1N5YA 2KYXA 1RTDB 3TUIC 2OIHA 1C1CB 2UUAF 3DLGA 4JI0K 2FYXA 3KIOA 1O1WA 1NZAA 3Q8YA 2VC1A 3G82B 1NGJA 3V1QA 5D6GA 3VF4A 4X84A 1C1BB 3QFHA 1ZOTA 1YRUA 2KJWA 3ENAA 4P2SA 3S1TA 1CJTB 4JV5J 4M3WA 3QINA 5ELZA 3C46A 2R8KA 3LP0B 1ZA1B 1S1XA 4EBDA 1OPIA 3DJCA 4TU8A 2MTLA 2ZJPQ 1T3NA 3KWGA 3LM2A 2HHWA 4NCAA 1FO1A 1Q8LA 3C14A 2G0CA 5L1IA 1G7CB 3UDCA 4FWMA 3O5BA 3N5BA 1EAYC 3NOCA 2MSTA 2G8WA 1HKBA 4CEDA 5M2RA 5FLXU 2CQGA 3FDSA 4OHYA 4EFAC 2RS8A 3SPZA 2A3ZA 2WFBA 1SCJB 4Z4HA 2JDJA 6FD1A 1TVRA 1ZC6A 5CZ1A 4PG7A 2WB1D 4QBUA 2KU7A 1RT6A 2DIUA 5L1LA 1J5EJ 1DQAA 2NXEA 4KTWA 3HL8A 2FF6A 2I7NA 3T5LA 5K9FA 2ZE2B 3DLGB 2HHSA 3P83D 2YKOA 1RAIB 3QRPA 1UFKA 3KHRA 4F4ZA 2QZ8A 5JXSA 5J2NA 4ED1A 2C2MB 1MW7A 1SBRA 3GZ7A 3KUHA 2EBGA 4OYXA 1FJGF 2I7PA 3DNCA 1YVFA 2Z2LA 1H38A 3GJSB 1IN0A 3C15A 2B56A 2RB7A 3NH2A 2A2DA 5E5NA 3UR0A 4UOHA 4IYQA 2R9LA 3NF9A 3P38A 3FEZA 1VS3A 2AP1A 4NI2B 5A2QY 2UU9K 2Z1IA 4PA1A 3N01A 2HHUA 2VG6A 5FROA 3C95A 2GMHA 2CGJA 3I87A 4DV6F 3HSJA 5CABA 5C10A 2BH1A 1P8GA 3OW2R 1YAGA 2B0GA 1FXXA 2UUAK 2HKEA 4IJNA 2F8SA 1P8ZA 5B0FA 3MN5A 1FE4A 4NCGA 2XMKA 2Q31A 2WW4A 1I51B 3TNVA 2Y8WA 4HVZA 1R8AA 1QQNA 1Y9OA 2BEFA 4PR6A 2MZ1A 3OBWA 2VQFJ 1JXVA 4OHWA 3MMBA 1PIEA 4CVNE 1V4TA 5D4NA 3QBCA 5IT9U 2CG4A 4J5OA 5HAOA 4U8YA 3MR2A 4M3UA 3VQEA 2IC3B 2YXLA 4JI8F 3L7UA 2PMWA 4W4MA 4AQYK 4ZPBA 3CCUS 2VFRA 5IV4A 3ELHA 3ZSYA 3IRXB 4A2BA 3HOTA 4A5AA 3RAXA 3HKWA 4ED3A 1VRUB 1WORA 4EUVA 1H74A 1RWMB 4A59A 3L4IA 1X4DA 3W65A 1HBMB 1KKHA 4BACA 2OPPB 4P2MA 4CLKA 3R2DJ 2JGUA 1SKSA 5L38A 4IRCA 4X65K 3QDKA 4KPCA 1BQXA 4DHVA 3R6MA 4KJIA 1NXIA 5HOOA 1X7VA 3TR5A 2UXDK 2IBKA 3GCXP 1U1LA 4I2QB 4PQUA 2G4BA 2D1KA 4DX7A 3I8BA 3KLEA 3CB4A 5A76A 2IOCA 2I2YA 5KGXA 3TEGA 3SUNA 1NU0A 2P6TA 3AAPA 1BC6A 2C3UA 4RBUA 4DCOB 1R8HA 1GQEA 1YZ6A 2QO3A 2AQ4A 1B4SA 4LF8K 1WKKA 2J0XA 1HNZF 3CMES 1VQKS 1BA1A 2KRBA 3C6UA 2HNZA 4KGMA 5FLXO 3PX6A 2AYBA 2LP4A 5KG2A 3GB0A 2BE9B 4DFJA 4LF8F 2MLZA 5C24B 4A47A 2MQPA 1VFJA 2K1RB 2HQIA 3QGIA 1KAYA 3DKDA 2HMIB 1YIJN 1OH6A 3MEEB 1K1SA 2RMLA 1WEYA 1VBKA 4C6AA 9RUBA 2QV6A 1I94F 3RVCA 2F5GA 1YJNN 2CPDA 1IM6A 3P8BB 1GAOA 3BSAA 4CFDA 2P5GA 3K2PA 4QYZK 3CDEA 4DV4K 1VQSA 2QJ3A 2OMOA 2ZBIA 2R2UA 2L9NA 3PW2A 5LJWA 3K58A 3MURP 5CA5A 3QJJA 3OVSA 2J7WA 1TL5A 2W2NP 1FI4A 5HQLA 4YOTA 2A0FB 3PEJA 1TELA 4QWCA 3AO3A 3FBFA 3HXMA 3CD6S 4NLPA 1FDDA 4ENOA 2XO7A 4CK1A 3VGKA 2AWZA 4HDGA 2HFUA 3PUFA 1JCGA 4LFBF 1TL1B 3TZYA 1BHNA 4KGXB 4CJEA 5IV3A 1S9GB 4P7VA 2IIRA 2D0CA 1H0HB 4IH7A 2U2FA 1NO8A 1YJ9N 4PAAA 3VAJA 4ZKAA 1N5VA 3THXB 2QWLA 4AD6A 4M5NA 5CH7B 5AFUH 2DO4A 2CQ4A 2AYGA 2K3IA 2BOPA 3TQEA 4TVAB 3THVA 4F3TA 5L46A 4DR3F 5E84A 4JKBA 4KTQA 1KVCA 4JKHA 1L5UA 2DR9A 4B02A 4ZPCA 4OLAA 3NEKA 1H3DA 1UVNA 3W3SA 1RWKB 1GXUA 5C12A 4L6V3 1VC6A 3IR6B 2EFVA 1JJ2M 1RCOB 4GKKJ 1KQSR 2Q6CA 2BJ1A 2HS3A 1KD1O 3V9UA 4FK2A 2GAHC 2PY5A 4ZJLA 2V68A 5I3UB 4MH8A 1NDKA 4OPJA 3HHKA 3IAS9 3EX7B 2UXBJ 4BRGA 2J9DE 1NDPA 2DFEA 3D6FB 4DV0J 2VQFF 1CPZA 2OZSA 4OX7A 4LF5F 3A3NB 2OSQA 3BBFA 1GLLO 2BUPA 4H0VB 5DG9A 4Y2KA 1C1CA 1XBWA 7AT1B 1K47A 2PGCA 1GK8A 1YTUA 4B3MK 4U7CA 1HHTP 3CVKA 4NYFA 3KMSA 4OHVA 4NMLA 1S49A 1X4GA 1PYSB 2DITA 1M5HA 3MN9A 2CPEA 3H2UB 3QERA 2IYIA 2RKIA 1M90O 3I6PA 1YKWA 1CC8A 3H6EA 4HTIA 3NH0A 3TZZA 3BQ2A 5A8WA 5KFZA 2ROPA 1U1QA 3PX0A 3LO3A 3M32A 3PW7A 1C0TB 2AV5A 1MDUB 4NA2A 1JNZB 1WC5A 3C16A 2YX1A 2LQ8A 2R7QA 2FY8A 3MDFA 4DV5F 4DUTA 4KRWA 1JKHA 1PILA 4O55A 4QWEA 2OO4A 2AD9A 3C6AA 2GJIA 2CFXA 3QJPA 4DBQA 3WQPA 5DQHA 2O3DA 3T7ZA 1R8CA 1VQMS 3UD4P 3A5NC 1RTJA 3MFHA 3OYHA 5LOQA 4QR1A 3D3BJ 1A6LA 3TAPA 5AZIB 2O8FA 2EG1A 3DRSB 3MEKA 4X64J 4HH0A 4HCBA 5C2FA 2FPHX 3CD7A 5KG7A 3BREA 4QYZJ 4OJ1A 4LSNB 4LRBA 3RUBL 3UN2A 5IQQA 1RHUB 1RAHB 3CT9A 4LBPA 2Z2MA 2W7AA 5HBMB 1LFWA 1OJ4A 2GQQA 2B4UA 2FVPA 1N33F 4OPKA 4FJIA 4F4WA 2V5HG 3K5OA 2CJAA 3PZPA 5GINA 3I0RB 2C42A 1S1VB 1HJRA 1V4SA 4GVEA 2MKHA 1H6KX 5CXTA 4JKAA 1SJ1A 4C8LA 4NI2A 4JI7F 1M5PC 1TL7B 5KFMA 1IKWB 3JAMY 2P2CB 4AHSA 4DR6J 3A8EA 5HMZA 2IRUA 4JLHA 1N33K 4ZLLA 3PEHA 3OL6A 1CXUA 4PKIA 1RNHA 2VFTA 1RDBA 2Q97A 2ZWPA 4YORA 4MDAA 3TVYA 1S9EB 1AB8A 3SBMA 2W42A 3C6TB 3KKRA 1LQ9A 3GR0A 4ALZA 2A6MA 3KG0A 2KXFA 1URRA 1FRIA 2OPSA 2BJDA 6FDRA 3V1RA 1YGYA 1VQNS 1QTNB 3VZIA 2HVHA 5AQOA 1TVRB 2VASA 3TUJC 3PIPQ 5AT1B 4CJPA 4ED0A 4EO6A 5AXLA 3TTCA 3TU5A 3N6LA 4LIWA 1ICEB 2JRSA 5H1SQ 4DV6J 3NMRA 2V4JB 4AHRA 2DGXA 3H0PA 3AOCA 1KHVA 4CLZA 4I1TA 5FD1A 3MZIA 4Y1DA 4LUBA 2DNNA 4NLXA 4FWOA 3DOMB 3H90A 3NWGA 3V4IA 3BQ0A 4KHPJ 2D0OA 1IKWA 4CYUB 4RLEA 3BH6B 1KR4A 1SJ3P 5AQPA 2MY7A 2HZAA 2J5AA 4QWAA 1R0BG 5KT4A 3IS9A 3DC2A 1RUSA 3L2WA 1W97L 4OJHA 1U47A 1C2PA 3UI3A 1RDUA 3IM9A 3M6UA 5JUMA 4E0DA 3HD2A 5F41A 1M90T 4DV3F 3VCDA 4QYRA 3AAWB 3SAFA 4OKJA 4FN5A 1VK0A 1S48A 3T9NA 2AP6A 4FM0A 3BF1A 1MG7A 4ETXA 1J9AA 2Y1LB 2L9DA 4DV5J 3SJJA 3H40A 1G15A 2VG7B 1JLCA 2DNGA 3MCSA 1S72S 3SV4A 1IBLK 1WN7A 4B3SJ 3ICLA 2OFHX 2B9EA 4O23A 2GELA 1XMQK 3DGVA 1Q0NA 2NUHA 4UTGA 1R31A 4RBTA 1B7FA 3FZLA 2J6TA 3AA5X 1OY6A 4FM2A 3AO5A 5SZTA 2QWNA 3AY9A 1LWEA 2DHGA 4FLUA 4CGJA 1NK9A 2MZQA 4DU7A 2JWLA 3TP2A 1UJ5A 2P9LB 1N8RT 3VEOA 2Q79A 4CJ5A 4EGLA 4QS7A 4BLGA 2ZH8A 4NLQA 2Y1RI 1E3MA 4K41A 3FZKA 2W4CA 1ASWA 1E6YB 2P9NB 1NGAA 2BKPA 4IO9Q 5CZXA 3V6KA 3AJDA 5GAGP 4BGBA 3LGHA 4DR3K 2RF2A 4M5HA 2N4CA 4BRKA 3UCUP 4OKKA 2G9OA 4LRCA 4F26A 2ZH1A 4JNEA 5JVHL 3V1OA 3ZTSA 5IWAJ 5B0AA 3HFKA 3D7EO 2LXUA 4QCLA 2B6AA 2NLWA 4DSFA 5F0XA 2UZAA 4W5OA 1KEKA 2GMJA 4ZVRB 2LKZA 2PIIA 3W2WB 4NXMF 4AHVA 1GXLA 3X1LB 4DX6A 3MWBA 2F9DA 1YZ7A 5CCMA 4HUEA 4OPAA 3OTOK 3JSMB 2E1AA 1T05B 1C0UA 2EK1A 4F4KA 5AQQA 2HNYB 3UE5A 2DNQA 4BR2A 2HVIA 3CJ4A 2OSRA 8RUCA 1ATRA 3GIRA 2VQEF 3QBXA 2P9LA 3ZFVA 3K0JA 1Z4UA 3MAHA 4DR7J 4ERDA 5K20B 2RRAA 3CQYA 4GVBB 4IG0B 4J2BA 3I8DA 4PPZA 3NCIA 2IVMA 4NXNJ 4U7UD 1UMJA 4EEYA 3D66A 3HKZD 4FYYB 3VGTA 2MSSA 2IJFA 2M70A 1LWFA 4MK8A 4YDUC 5KFPA 2EG2A 4CESA 5JS2A 4BR9A 1RTHA 3VALA 2J8AA 3GL1A 1WEZA 4OLBA 3OTCA 4JRQA 3OYCA 3G0ZA 2KVQE 4ICLB 4CO1A 4K43A 4KH0B 3MECB 1SUQA 4ER8A 4IOAQ 2D41A 2I8EA 2QC3A 1FNMA 4MO5A 1HNZK 4BS2A 5FJ4A 1PSDA 1CLFA 4FL9A 1GEHA 3ADAC 4RKUC 1VYAA 3DMJA 1Y00A 1NSQA 2MMYA 5F8GA 5ETOA 4DR3J 3BO4A 1FJGJ 4FXVA 4U8VA 1EO1A 2X3GA 2F96A 2P9PB 2IIHA 4YHHJ 3NNHA 3AD9C 3EM1A 2YY3A 1H2TZ 3W61A 4B1YB 1NSKL 1TL1A 2W8LA 1M1KO 1MNEA 5F9LA 2YQ3A 4B3SF 1DTQB 4BREA 3T5HA 4ZP8A 4LF5J 1NJWA 2RU9A 2X7IA 1IWAA 2XMAA 1TZ0A 3TAGA 1U09A 1JXLA 2YPYA 4ANDA 3WX8A 1LK5A 1IR0A 4YDDB 2D74B 2UXBK 3MUVP 2QA2A 1FDAA 1VGYA 4J9LA 5LXRA 1WNSA 5ADZA 3L2UA 1BO5O 3NGSA 4DTJA 1VQ4N 5M2UA 4RW6A 2HIQA 3HHLB 4FWKA 1CZAN 3IWNC 3ISNC 3V4MA 1YUWA 2FJAB 4ZCKA 3TEHB 1J5OA 2OYQA 4NRUA 4RW8A 2FLPA 1XTZA 4JI2K 2W4DA 3A5OC 3PRVA 2JNJA 3I9ZA 5KFXA 1SIZA 2DH8A 2E1PA 2AYEA 3M6GA 4B9QA 4DL2A 3HHEA 3LPUA 4ZLPA 1SQFA 1HBNA 1R8BA 2DNZA 3KJNB 1U48A 3MR6A 2E8AA 5HN0A 3KJVA 3QWPA 4K8ZA 5J2NB 3CW2C 3I96A 1OQ3A 1R6VA 3UKUA 3AVKA 4ES2A 3M8RA 3SK3A 1HMVA 4OHZA 2EWSA 4H5VA 5AQHA 4EU0A 1HIYA 3BYRA 4DLEA 3MWPA 4LFCK 3D28A 2RKIB 4AHCA 2DNRA 4DV2K 2UU9F 3ZSRA 2IMOA 3QSYB 4NEYA 3RMAA 4PG6A 3AJ1A 2QI2A 2M7SA 1H73A 3L8BA 4LH4A 4ZIVA 1RLDA 2GCFA 3I31A 5AQNA 4BR0A 2P9SB 4K2XA 3IXQA 2NPFA 4OYIA 4LR7A 2DNLA 3ZEUB 3W9HA 2P9IB 4EI2A 5KFWA 3GR1A 3VEZA 1WI6A 3MAAA 4ANEA 4XH5A 4DWIA 3KHGA 4TSXA 1FFWB 4IO1A 4UOCA 3ZZRA 3AARA 1T9WA 2K7KA 3DGPA 5EU7A 5HMWA 1YTYA 3QIDA 5F8HA 3PV8A 5KFTA 2IC3A 1QHTA 1ACMB 4NLUA 5IWAF 3Q7BA 2VV5A 2O8FB 3CCES 2YH1A 1Q5VA 3SSQA 5E2QA 4N77A 1ITPA 4FLTA 4PY5A 3VF0B 1NK8A 1LOTB 4F67A 3IRXA 3KD1E 5A0YB 5AQVA 4H5TA 3MX5A 3KTQA 4O8KA 2JLEA 4I7FA 1VQPN 1VK3A 2Q0RA 1YX2A 1HBMA 4XDCA 4FJNA 2VPYB 4MK9A 1UKUA 3MM8A 5ETMA 4WZQA 4CO2A 2M8HA 2BW2A 1HR0J 2XS7A 5JVHQ 4LR8A 2HWTA 1RJJA 2KT2A 5CCLA 4K8XA 3M2UB 4H0XB 1YTAA 3TJ8A 1T3OA 5HROA 4YQWA 4Z7CA 1EB0A 4FLZA 3B54A 5DO2A 2HIYA 1BQMB 1WHYA 4YY3K 4QIWD 3ZSZA 4DQSA 2VYPA 1S77D 2C3YA 3ZXWA 3UCZP 3G6ES 1F21A 5K5MA 3VR1A 2DR5A 2YJFA 4HI2A 2DPJA 3AVGA 3Q86A 1LWEB 1U2CA 1ZETA 3CHWA 1RWWB 4USVA 3RW6A 3BSOA 3MDQA 4WQ4C 2GHPA 4B3RK 3HHLC 2HMIA 5KFYA 5AZJB 3OR2A 3QIPB 4RR5A 3UDEA 2V2VA 2D69A 2VL1A 4AH9A 3DOMA 3BGFA 3D4JA 3ILOA 1NJYA 2UVWA 4RNMA 4N76A 2D0BA 3CCUN 2MGZA 2HFNA 4E7LA 1CS4A 2UXBF 5DG7A 4P71A 1UZHA 4EO8A 5C2CA 4BRMA 2OTJN 3CJ0A 3DLEB 4C97A 3F9MA 5EX3A 4M7XA 4F2SA 4HVJA 4Q5VA 2DHSA 1PJ5A 4CO3A 2YNHB 2ZWHA 2L08A 4YNQA 1JNRB 1XNRJ 2E88A 3FEYB 3PFOA 3JSRA 2BGGA 4ES1A 2EEYA 5I42B 2FSKA 1V6HA 5DJBA 5KFBA 5KT3A 1TL3B 3THWB 1Q82T 4NLWA 1HNIB 3THPA 1I94J 3VQAA 3ZO7A 3RR8A 3TSUA 2ASDA 2OAUA 3CCLN 3OYKA 4NXNK 2MJUA 4USHA 1GX6A 5GAHP 1NJIT 4IFVA 4PQUB 5F0WA 4Y2AA 4BC9A 1U6FA 1FVQA 2FSNA 4QOZB 1EP4B 5KFHA 1UWAA 2KKZA 2Z57B 3JSYA 4AQYJ 3EGVA 1PJ6A 2GIQA 3QFWA 5KFDA 4BC7A 2LVWA 4DV3K 2FVCA 2Z2ZA 5KT5A 1ZA2B 1N88A 2DXFA 4HLBA 3VVTA 2RQMA 3MR5A 4EMDA 1CULA 3JYTA 3ZNUA 1HD1A 5D78A 2HF4A 1KXPA 4FZXC 1S57A 4TY8A 4I64A 5A2QO 1D5AA 4KSEB 3CNQP 2AJFE 1J27A 1F9FA 2V2ZA 2E5LF 4PL7A 4CEZA 1VK8A 3VQCA 5T7LB 3NMUA 3SDEB 2ZOMA 4FWSA 1FWLA 3DMJB 5AE3A 2ABYA 3SFGA 1ZPVA 3BEGB 2P9PA 3PNIA 1CJKA 2WW8A 1U0HB 2BQ3A 2UP1A 1C4AA 5GADU 3AHPA 2PA8D 2ZZTA 3I55N 4CZFA 3R7NB 4CJ3A 3AVNA 2N3LA 2JLGA 3DLJA 4R5PA 5IT9Y 1A5WA 3SBTA 2XTJP 3ZETB 1TKXA 2OH2A 1MWQA 4OX9J 2ZQBA 2VPWB 1C0UB 4ED8A 2X1FA 4M42A 1AUSL 3NGIA 2Q3PA 4QAGA 1JWWA 4DL3A 4B1ZA 3ZX0A 2F7VA 1ILYA 4WIIA 4EBEA 4L3NA 1KFSA 4ID5A 1IVZA 3MXJA 1BU6O 1KAXA 2HQDA 4CEAA 3H25A 2P9UA 4EWTA 4X64K 5F9NA 3HSGA 1SC3B 3KLIB 2ZFHA 2Z1GA 4YOEA 4C3KA 4LRFA 2ZC3A 3CG7A 1KVAA 1JLAA 3ALYA 3BYPA 3W8GA 1RE1B 1XR7A 1B64A 3J7ZO 4CZEA 3PYGA 5LMNJ 5KQ8A 1TR0A 2V9WA 1RKJA 3J80O 2QMWA 3CETA 1TK0A 4HKQA 3GYXB 2DTUA 1Y7PA 3PRDA 2QA4S 3I82A 4O8UA 3IGNA 4LSLA 2YKNB 4IRKA 3U7JA 3SXLA 4DV4F 1XEZA 1VBZA 1JJCB 2FBXA 1TYQB 1TKZA 1QAYA 2QLJB 1GNKA 4FCYA 3CJ1A 1ITGA 2EKNA 1NPRA 4J91A 3SQOP 4GY2B 1FXDA 2DGSA 4IRDA 2D3ZA 4PYAA 3PW5A 2O66A 3ZLJA 5IZHA 1UL3A 1TQLA 4Z4IA 5IWAK 1RT1B 1ZBUA 3ENHA 3LM9A 3S3NA 2HVDA 3AA8A 4M5IA 4DQIA 4LF9J 3BF4A 3D2EA 4NZ6A 2KHOA 3THTA 4USMA 7FDRA 2V34A 4X4QA 3MMCA 2WVBA 4MT1A 4GMKA 3OS1A 4JI6K 2FUG9 2QYGA 2PAVA 2E1RA 4H0YB 2CGLA 7FD1A 2RH3A 4B9LA 1HPZA 4I6MA 3QMLA 5HK4A 1X5PA 3W9JA 2ASLA 1XMQJ 1A0OB 4JS4A 2LCWA 5CZVA 2VPXB 2B9WA 1BDGA 4YB1P 3MPVA 4WF9L 2E7WA 4FKXA 3V6DA 3LGNA 1X60A 4B9UA 4LFCF 3ZSOA 4DKWA 3GYGA 2FHMA 1REVB 3O1WA 3SMSA 3T1YK 3DCAA 3EICA 2HBZB 2R7XA 1K8KB 4JI6J 3PSFA 3F41A 1EKSA 2GHWA 1HNXJ 3CQ8A 4ED5A 2CNLB 4BRCA 4BY9C 3OLAA 4C1NI 4JBCA 4ZP6A 3WXIA 2V6AA 4Q44A 3AT1B 2IVFB 2RJZA 3TYTA 2A6OA 4I0WA 4C98A 3SUPA 2HBKA 4USUA 1KAZA 1YJUA 3FSYA 5KTQA 1F9EB 3HULA 5T14A 3MTJA 3TVZA 4FF3A 1Q9XA 4H0OA 4OYPA 4LF9K 1F0XA 1FFSB 4ZS6A 4WE1B 2ZD1B 4F0MA 3ZT4A 4DV6K 2MEWA 5FRMA 2VF3A 3L2QA 3OW2M 5HP1A 4LF7J 2H65B 1FRKA 5LJ5Y 2O5DA 5KT2A 3IAYA 1VQLS 1DT9A 2HZCA 1HR0K 3BJYA 4OV1A 2RQ4A 4CQ1A 2LA6A 1RGVA 2FJDB 3RZAA 2ERRA 4DUYF 2Q36A 4DV1F 4DPXA 2HLTA 1S9FA 4PUOA 4F7VA 2GW8A 3R1LA 3J7ZT 3JTPA 2PI5A 3O3HA 1SL0A 4JI4F 4M5KA 4EP4A 3LGMA 4FLWA 1AZSA 3L7OA 5LL6d 1I94K 2YNGB 2PEBA 2V2KA 5ETLA 1WHVA 5CHIA 1BWVA 2PA3A 2V7YA 4BROA 3D6RA 3E9OA 3K17A 2M52A 2D3OR 4A61A 1VQ9N 4PG8A 1AXQA 2IVNA 5KFIA 3I56S 1GMWD 1VHFA 5GIPA 2V94A 3M1VA 3SZ2A 2OTLS 5AQUA 4Y2MA 3ISND 2PSZA 3DU6A 4UF4A 3GIJA 1VQPS 1FRMA 5KI6A 1RTIB 2HS4A 1SAZA 3B4MA 1U6BA 3FBBA 3SQ2A 4MJKA 2HGNA 2LSNA 4B9VA 2ZEJA 2C3MA 4LREA 2NREA 1X5SA 2CJBA 1YRXA 3JXUA 3ZX3A 3ENOA 4HTUA 3HSTB 5BREA 3CEDA 4IR9A 2HRYA 4HT5A 1KD1T 3NVMA 2ASPA 2FVQA 2UV8A 2HOEA 3GV7B 1X9MA 2HHQA 2HS0A 4RWWA 5BPLA 3QB0A 2D1CA 1UW4A 1ZZFA 2IM1A 4PUOB 3CJAA 1T94A 3ZZTA 3HPGA 2GAGC 2E7XA 2V8GA 2C3OA 4PKGA 3V2UC 4FM1A 3HFZB 1XMOK 4HTJA 3TSPA 2MJNA 4KPYA 3G6EN 4USJC 1S22A 4JI0F 3GIIA 1P1LA 4H4KC 4XAKA 1HYSA 4UY8O 4YFUA 3OL7A 4ZPWR 1SS6A 1KOOA 4XPCA 3W7BA 3LZJA 3DLEA 2H5IB 4DPUA 3AVFA 2ZDPA 5DLFA 1JLGA 3TABA 4CLPA 3KLEB 1EJ7L 4E19A 3LUYA 3ZZUA 4K42A 1TUVA 5D8HB 3UB5A 3WXLA 4LFBK 3I4HX 3SCJE 1BE4A 1HHQA 1FWPA 3BKUA 3PYDA 2YKQA 1DLOB 3GDQA 1F5BA 1XMOF 1TL3A 4FZVA 3W2VB 3EPIA 1UWBB 4K4SA 4FOIA 3G2XA 1X3NA 1RBAA 2AGQA 1IG9A 3C6UB 1QZ6A 4L76A 5G4DA 4FLVA 2KL8A 4PWDB 5HLFB 2XO6A 1WI8A 1FDNA 3IBWA 2V7ZA 1DZ5A 1TKTB 1ZAVA 1EP4A 2ZH4A 4CE9A 1G2EA 4IJAA 3RB4A 2DNMA 3HHNB 3KLHA 2J7KA 3JXOA 1EKRA 3L9ZA 1MWKA 2ZJRQ 3WQTA 3HK2A 4R0JA 3S3MA 2W8KA 4X66K 5KFJA 4JI2J 1XC3A 1CG2A 5FPEA 5LSOA 3H5UA 4NO7A 4FK0A 4QIFA 2FIUA 2HG4A 2CWXA 3JYTB 4RW7A 4IXCA 5EGYA 1YSJA 1VQOS 3GJQB 4H4MA 4RW6B 3HHLA 2A18A 3QAEA 4G1QA 3G9CA 4M3ZA 3A0IX 1Q86O 1NAQA 3LDSA 2YQ1A 4G9ZA 4JB8B 4CLFA 1IXKA 5CD4H 3SIPB 4CO4A 4DL6A 4UUXA 4AE5A 3HVRA 5HL7L 1XR6A 4LF4K 4K5RA 3OYFA 3T3FA 2F9TA 1EHWA 4K0KJ 4JKFA 4Y0WA 3U1NA 4I68A 3ZZOA 2BW7A 3EKUA 1AA1B 2FHOB 1S0MA 4MAKA 3QPIA 3N5FA 2PD1A 3J81O 2OMLA 2E2PA 3NWRA 4EYIB 1WC3A 3MD1A 2DNPA 2QK9A 2JFKA 2HK3A 4K7QA 3EVWA 1HR0F 1LW2B 3KFWX 3DLKB 5C7PA 2VQEK 3L4QA 2XYGB 5DM7Q 4A4JA 3WEEB 5C15A 3SCXA 3J7AP 4UQGA 2VOOA 1SJQA 2NZCA 5BYQA 1CZBA 2ZC4A 1SKRA 3TUPA 2WTUA 4IZ9A 2RRNA 3DLLQ 1P9QC 2RSQA 5H1SV 3P5BP 3ILJA 3M7VA 2FGCA 4C3LA 2FBVA 3VQTA 2CWKA 3IWXA 4ECQA 4KGKA 5E3CA 4WXOA 4S0MA 2B5JB 2GQ2A 2IVOA 3SMPA 3AODA 1HWJA 4KB7A 1TUWA 4ZHRA 2DPNA 1X3MA 3DOLA 5KFOA 2C2NA 1RTDA 4K4UA 4WK3A 2OCEA 1S1WA 3HSDA 3BPSP 2GVZB 2FJVA 2OZMA 4M1KA 3TARA 4QJVA 4X4RA 3K8VA 4EAHD 1HW9A 4RJVA 2XNQA 3MN7A 2M3DA 2KTQA 4CI6A 3QNNA 3NGYA 4JI7K 1R0CB 5D15A 1XUPO 5ETTA 2KFZA 5F3ZA 1Q7LB 4X62K 4GW6A 1X9WA 4DF4A 1ELOA 5B0CA 1VRQC 4H8KA 4CJWA 1Q79A 2MLYA 1RT3B 2X6SA 4M5JA 3RSEB 4BDYA 4KFBB 3LPYA 2CJKA 3PO5A 1XMQF 1VMBA 1KLMA 2K2PA 3HI0A 4C0BA 1NEEA 4C8KA 2ZNZA 5D0HA 1CJTA 1U8WA 1OMSA 3FZ2A 3M2UA 4K0KK 1RU1A 3MPYA 3KZBA 5L1JA 4A8OA 5LXYA 1HNWK 1JJHA 3V9ZA 5AJ3F 2X3DA 4JI6F 2HFZA 1U2VA 3V9SA 2V67A 3P6YC 5EX5A 2MKSA 4KHNA 3D54A 5ETNA 4V19J 4CK3A 5LMUJ 1PAUB 4CI0B 3JTNA 5J1EA 4CF0A 1NCLA 4KI4A 4Y6IA 2DHXA 2XS2A 1S4FA 1U24A 3KJQB 3VZHA 1VSKA 2IVYA 1P1TA 4LR9A 4K4ZA 3DOKA 2QTDA 3MAAB 3KYLA 3ZYYX 1OH7A 4LBHA 3DFEA 2O8CA 3D0PA 3FZMA 3PSIA 3F5TA 3KKFA 3V6DB 3TUZC 2OEMA 3DRRA 2ZHBA 3I0RA 3GQCA 1JMTA 3MI7X 2AU0A 4KR0B 1V3ZA 4N8OA 3CULA 1A7GE 3LDOA 2L48A 3OYJA 5JMVA 1RACB 2ZWOA 4OX9F 2OPSB 1BMQB 3OQ2A 3MM6A 2V4RA 1VC5A 1HNWF 3DI6A 2VCPA 1SH3A 2OTLN 1MWMA 2W9CB 3MD3A 4WTOB 4CZLA 1NKBA 4DJBA 2VQFK 2HSEB 2PEHA 1KQKA 5A6PA 1XHXA 1NRKA 4A8MP 5B0BA 5CAAA 1H2VZ 5RUBA 3SI8A 1S1UB 4M3XA 1IJEB 3DYAA 1XK8A 4QU7A 4CD1A 4A8WA 2G8IA 3AA4A 1MU2B 3CMEN 2V69A 2RRBA 3FC9A 4G6VB 1NKCA 3SLCA 1FW6A 4URGA 5D77A 2RHSB 4FPBA 4IEIA 3FGVA 2PZSA 1PC5A 4G3IA 4OX6A 5L1KA 5HSPA 5CYMB 2XNRA 2KN4A 3P96A 1U8SA 3H08A 3RYLA 3TO8A 3K8WA 4M63C 1N6QB 4RNFA 3KD5E 4K4XA 4C11A 5IM0A 3M1FA 4F3MA 5M1NA 1H72C 1JLFA 4ETZA 1E4GT 2VC0A 4CYUA 3RG6A 4BG8A 2DR6A 3IFRA 3MOZA 3E9LA 3H5YA 4DX8H 4KQZA 1NGEA 3MR3A 3CM5A 5K14A 3DWLA 3KK1A 2FJEB 2CPZA 2W9CA 2XG8A 3J80Y 3A2FA 2GA7A 4BCAA 3MOJB 3OVNA 4IDHA 3NS6A 3TJAA 2CJYB 2PC6A 4MLEA 3ISZA 3UDLA 1MA9B 4X65J 1KTVA 3VQ9A 2FHJD 4CTAB 3CD6N 3Q89A 3CSKA 3DRXA 1N34J 1GLDG 4KKOB 3DM2A 2HZVA 3CC7S 4YS2A 4GMJB 3WNHA 1IG8A 1VLOA 4TQSA 2MQQA 4Q43A 2RE2A 3G8QA 4B3TJ 1DFDA 4Q8FA 3M8ZA 1VDHA 3IWLA 3KWIA 2XMVA 1BOTO 1RILA 3VEVA 1TKXB 3P45B 4O5BA 3VEWA 3KLFB 3JAMU 2WZ1A 1VSJA 1NNEA 2R8IA 4OI6A 2VZ9A 1OH5A 5JMNA 3CGIA 3UKRA 3OHBA 2RF2B 1D9DA 4MKBA 4HUFA 1X4AA 2YNIA 2WUSA 4WYWA 3KKSA 2MHEA 1L3SA 2XWXA 2SXLA 2W2OP 4XK8C 3BEXA 2E5JA 1HX1A 5LMNK 1CZ9A 2EFNA 5KPTA 4M5DB 2BM0A 4DR7F 1RAAB 2BRLA 2OI2A 2DEJA 1DGKN 3PW4A 3NS5A 2DRDA 1EIYB 1K9MO 3CJRA 1GOCA 4NXNF 4LF1A 1T11A 4WYBA 1KNZA 4UW2A 5BR8K 3W66A 2ZM6F 3OL9A 4DZ6A 1URNA 4C8OA 2Z8QA 3OR1A 3HI9A 3K59A 1RB0A 3H42A 3QEVA 3HOSA 3BUZB 2AJQA 2UXDF 1MWYA 1RHRB 5T7LA 4Z4CA 2G1HA 3E51A 1CEZA 3W2WA 4NLTA 3I0SA 4LF4J 1CJVB 4LY7A 2R42A 1JJ4A 1ZBFA 4U9RA 2RQCA 3G96A 2F9WA 1FXRA 3KLFA 4YR2A 3I55S 1UTAA 3BP8A 3PYEA 4V19X 4H0PA 1RT5A 3HD1A 1XJWB 3BV8A 2YVSA 4LQ9A 1MN7A 4OZ3A 2LLZA 3IBFB 4LF7F 2XHBA 4OYMA 4DQPA 1RHKB 4TU7A 3TJ9A 2BV3A 2VPZB 4K4YA 4DV4J 3SCKE 1YLXA 3SQGA 1YT3A 3MK6A 4DEZA 3H8YA 2ZITA 5ADXH 2VBYA 2OHDA 2UUCJ 2BANA 2GWKA 3RRGA 1TUYA 4ZCIA 2VICA 1IV0A 2VDHA 1Y5NB 2F65A 4F04B 4IQXA 1U6ZA 3DXKB 3ULDA 1FF2A 1VQMN 4I6MB 2IMWP 4OZNA 1JLEA 2RIJA 4OLOA 2F8HA 2QYCA 3BKFA 2K8GA 2CGKA 2YH0A 2VFUA 2VJVA 2AT1B 3R5GA 4DV3J 1O0PA 4MDBA 4AF1A 2G8VA 4BBYA 3I5BA 3GIKA 4LFAJ 2Z1JA 3QRQA 3T1HK 1QVGM 3O8MA 5GAGI 4A57A 3RRHA 3FBCA 2D5RA 1HNXK 3OVAA 2ADCA 1EETA 1WG1A 3KLGA 3R6LB 1F5AA 3MEGB 4CJUA 5A8KB 3VOVA 3TAEA 1EQMA 1C0TA 4H0TB 2YKNA 4B3MJ 1FA0A 1ZM3A 1ESVA 1U4BA 3CJBA 2DD8S 3K9JA 1VQYA 2FJXA 3K5NA 4J7CA 2QEXS 1HI8A 3ZZ0A 2RUGA 3HZEA 5M2PA 3EY1A 1SZ2A 2UYTA 2RVJA 2AJ2A 4FYVB 1RA6A 3J7YI 4L3KA 2I1RA 4UQTA 2MXYA 2HHTA 3LALA 1BY9A 1IKYB 3AV9A 4TXSA 3N79A 4B3MF 4JV1A 2WB4A 2NSCA 1PCAA 2RN2A 2BQUA 1I1GA 3M8PB 1VAZA 3ZSVA 3FUYA 5AJ3K 3DLRA 3ULEB 4ZLJA 2E1MC 1AUDA 4TYBA 4B3TF 5A6WA 3VESA 2ASOA 3D2EB 2G13A 2NRVA 1NB2A 3KJFB 1RP5A 3GJRB 5K8NA 1H7XA 2YI1A 5CHCB 4YR3A 1KVIA 1ZXOA 4WP9A 2AJ4A 3W5YA 2WC9A 2RE1A 1V5VA 4WWSA 1EQYA 1EETB 2HWIA 4DR4J 5BPMA 1TV6A 2XB2D 1Y10A 5BR8J 3LP1B 1BG3A 2EI5A 4CF9A 4N7TA 3D1QA 4HH1A 2HBQB 4DR6F 3U3GA 2Q0UA 3T1HJ 2CPJA 1UZDA 2HGLA 2BKOA 3R8EA 3CCEN 2BRKA 1XMOJ 3AVAA 3LDQA 4CH7A 2QX0A 3DI6B 3RMCA 2B7CB 4PG4A 3CYMA 3PJ9A 5IS2A 2AMCB 3EZUA 2BQRA 3K57A 2NRTA 4CLTA 1U2FA 2JEJA 3NGKA 2IYGA 2C2OB 2CIMA 4JS5A 1NJZA 2H4WB 4ZLNA 3M3ZA 2LQ5A 2HBMA 3HRGA 4KH5A 3KHHA 5KG3A 2HPUA 1WACA 4JI2F 2XS5A 4QR2A 2IM0A 1N52B 4OYBA 1S9EA 2CVIA 2XLIA 3H20A 2O8BA 4HHTA 4ZJQA 1N48A 1HWUA 3DOKB 2JX2A 1OY9A 1WBBA 1J5EK 3HO1A 4AM7A 4FSVA 1IQZA 2GUPA 3V5RA 5FIIA 4EHUA 1FRXA 1YJ7A 3CDAA 2GZOA 4DTMA 3TA2A 2V8PA 2J7UA 4WPAA 3O08A 4ZN1A 2CQIA 2Z56B 2P9KB 2ZOFA 1RA7A 1YWXA 1ATNA 4W5QA 4JI3J 2KB2A 1YHQS 1NSPA 2DIVA 4M45A 2NPIA 3GLJA 3R3LA 4XIUA 3N28A 1PKUA 2LQ9A 2VG7A 4FYXB 2G2OA 1XN9A 1RLCL 2P9GA 3WHIA 3VGLA 4K25A 1LEOA 4J37A 3JQKA 2ROEA 4IDKB 2H1YA 1VRUA 1Q1KA 2GX8A 1KVKA 4RW4B 4JKEA 3U4LA 3A1YG 1JB0C 1IBKJ 2BZ2A 1HYZA 3T5JA 2WONA 2YNFA 2AEMA 2F4FA 2NRXA 3DYAB 3L95X 3J7YP 4X66F 1RQ0A 4KV8A 3AAQA 1ASUA 4J9OA 1RXOB 1B99A 3L4BC 2HF3A 3PJXA 1SB6A 4J2EA 4X65F 5BXIA 4PYDA 4P7TA 3FMBA 1RAGB 2XI2A 1AYEA 2OEJA 2G1DA 4FVMA 1LWCA 1HBOA 2VWBA 2WAQD 4WKYA 1NDCA 5IC4B 5DZ7A 1RDAA 4W90B 4F4AA 2DBBA 4B8AB 2MKCA 2J9CA 3CC4S 3PVXA 2YWKA 3C3LA 1WSIA 5I42A 2F4VK 2VFVA 4C11B 5IM0B 1OYDA 1S72N 1OYEA 4PQAA 4R8UB 5I4MA 4A46A 2QT7A 1WB9A 3LP3A 2VA2A 4CGIA 5K14B 1X4CA 1BIZA 1R0AB 3PXGa 1W26A 2VUGA 4YDUA 1GLFO 2HURA 1B0PA 3SJHA 5JLHA 3BB5A 4Q0BA 4L72B 2E20A 4L74A 3VQDA 1T95A 5E33A 1LXJA 2ZBRA 3CFRA 4IDKA 4LFBJ 2KH9A 2HHHJ 2ILYA 4H5NA 2E5HA 4NA1A 2UXCF 3WNGA 2VWJA 4CTAA 1WG4A 2R8GA 4FWPA 4DB3A 2BTFA 2A1BA 4CEQA 3OVBA 1YJWS 3GV5B 4URQU 4WTYA 2EC2A 3IO1A 3A8KA 2PDAA 5MLCV 4YN3B 4ZVPB 3J81j 4X4PA 1TFWA 1NJIO 3QMQA 2ZNYA 3TA1A 2DJWA 4TY8B 1G4CA 2LFVA 4MKVA 1FJ7A 2J0QD 2RHQB 4J9SA 4I69A 3KUGA 3D0GE 3Q7CA 2MKYA 2KJVA 3UN3A 1RWXB 2FXUA 2W41A 3A8IA 3O3GA 2CNOB 2H4YB 4PXCA 4F0KA 2DR7A 4P10A 1J2VA 4QR0A 2IDOA 4CT9A 2UXDJ 3W3DA 3V81B 2XEXA 3QLHA 1BGXT 3E66A 3OYBA 4FWRA 4OFZA 1P27B 5AE2A 1VSIA 1UAWA 4W5RA 5E0OA 4HCCA 3VF2A 4CJRA 4IFYA 2WSEC 2DFFA 2C3PA 3SDEA 3BBCA 3KK3B 5LMNF 3U1LA 3IUCA 3Q8UA 1LV5A 3HSZA 1FJEB 2EVZA 2ATQA 4HYKA 4BRLA 4JI5J 3D0IE 3CJKB 2CNNB 4QQBA 4TQRA 3M9OB 4ICLA 1NLVA 3PM9A 5D3GA 2XSJB 4W5NA 2KW4A 2VIHA 1QDUB 4RUAA 1EWRA 3DRPB 5I3UA 2MKJA 4MO4A 2YWEA 3VQ5A 1DEJA 2ACMA 3OPKA 2JOQA 3FKBA 3H1VX 3I5CA 4W92B 1BD6A 3A4TA 4CEFA 2QA4N 1RBRA 3L3CA 2VBXA 2IA6A 3NRBA 3VAKA 1HNWJ 4XDDA 3QJLA 3Q8QB 4H4OB 3H2VE 3H5SA 3R6GB 4CD3A 3HFVA 1IJJA 1IR2A 1IBKK 4I67A 1OSCA 4QPTA 5KFCA 4E3SA 2GIFA 2Q2RA 3OFEA 2QWRA 1IKYA 3LQVA 3QO9B 2I9SA 2XLJA 6AT1B 2HBJA 1ZPWX 1ZM2A 3HHLD 4DR4K 1VSMA 3TQ1A 2I6WA 3DDNA 2VHGA 4DG1A 2J76E 2H48B 3T1YJ 2R2SA 3J80U 4JI3F 3IG1B 3FRZA 1DRZA 5GAEI 1TL4A 1GT8A 3UVJA 5A8RA 4GO5X 1WLJA 4FJ9A 3PFEA 4WFZA 4DL7A 4BRPA 1OPZA 3CE8A 4W5TA 4I2PB 1VQ8S 4ZN3A 2G8UA 4LVOP 3OYIA 3ET6B 5I3PA 3UD5A 4LFCJ 5HVFA 1ZTTA 1HQUB 3ZNJ1 4U7UK 4M63A 2BE7D 3PTWA 4FF1A 5HRNA 2B8PA 1JKHB 1F9HA 3OTEA 2YQ0A 4A8FA 4Q7AA 2GVZA 3LTOA 4E7HA 5J2MA 1NK5A 2FC0A 1C0FA 4JI0J 3H4DA 1PYTA 5CYJA 1IQTA 4TKTA 4AT1B 3F73A 2X1AA 3MM9A 3SAHA 1D1UA 1FERA 2XCPA 4YY3F 4HHHA 2EFQA 2IRXA 5C2DA 3GOIA 1RT4B 2JC0A 3E9PA 2FVSA 5DDQC 1R89A 2CA9A 4AXJA 4F0HA 4ES3A 1SQEA 3O3FA 4F8RA 2JC1A 4BR7A 1Z26A 1HKCA 4OZ5A 1NHUA 1LW0A 1LOUA 3IRWP 4Q8EA 1YJVA 3AVIA 3LH2S 2QWOA 3NOGA 3NGZA 5BN9A 4CH0S 3ZEUA 1EX8A 2CJ9A 4F9OA 1S1VA 3S7RA 1W9HA 3OYLA 2XC9A 5G0RA 2HQFA 2A1SA 3VF6A 3M8YA 4ZP7A 1SI9A 3ENVA 1NM2A 1RTZA 3ZCMA 4C48A 3TSQA 1S1TA 3FK4A 3L6QA 1HKAA 3N4WA 2FC8A 4ATNA 3R1XA 4G1PA 1F3FA 3OA9A 2ASJA 3OD2A 3VV2B 1UEVA 4I7FB 4WU2A 5DMRA 3G6YA 2W7PA 3IMXA 1ZBTA 3AOAA 4ED6A 3G87A 3QIOA 4O3SA 1WHXA 4ANCA 3AA3A 1HQEB 1JLBA 4UOGA 3B6OA 5E41A 5JJBA 1APSA 4ECVA 4P2XA 1WBDA 2MYFA 3C6TA 1JLFB 3EWGA 1HQ2A 1WOPA 5KG5A 3UIQA 1FVSA 1F2GA 2V4JA 2EFPA 3POTA 4NYPA 1RAJA 1FNXH 2RNEA 3NL0A 3C8YA 3J7A1 1VISA 1SC4B 5DQIA 3OYEA 4CF8A 4DQRA 5M1OA 3HVTB 3ITHB 1ZBSA 3MMBB 3HP9A 1MMLA 3GCWP 1TFYA 3GILA 3VGUA 2KG1A 2OP5A 3QZ8A 2FB0A 5LM7E 3PIPL 2ATCB 4CIGA 1WF0A 5MAOA 4X62J 1R3NA 2EPIA 2KVIA 2VH7A 3F44A 3HF5A 3BZKA 1BQMA 1F3VA 4DMZA 2LQJA 3IGVA 2O1PA 2JJ4D 2O8BB 4CGGA 3H4BA 4CZJA 1CVJA 2C2DA 1NGHA 1M5KC 1S5JA 1O6XA 2PMHA 1I5OB 2GGPB 2P5OA 1XIQA 1T3VA 1S6QB 5AR0A 2G8FA 2AX1A 3RRKA 4Z2XA 4CFCA 1VQ6S 4TN2A 1XMBA 3OFFA 5D0RA 3BDPA 3VENA 4R8UA 2QM1A 3SQ4A 3GE9A 3POTB 4DL0C 3CC2N 3MF5A 3L3VA 4CEOA 2QLBB 1VCTA 5KFLA 4BE2A 1L3VA 1OWXA 3JS9A 4PZVA 3CCMS 3EVOA 5B0EA 1XWLA 4RBVA 3MMAA 5KGWA 1MSWD 5IOLA 3KG1A 2MGZB 1VQ5N 3TZXA 1LWXA 2B4JA 2DR8A 4FS1A 1DBDA 4OMFG 1J53A 5HI7A 5K8OA 2R2TA 3MM7B 1R8PA 1YJNS 3ID8A 3IFEA 5E7OB 2WBNA 3AQOA 3BBBA 4I2QA 2ACYA 4P73A 3GONA 3US5A 1QY7A 1RTIA 3KVGA 3GSIA 3K5PA 3FZBA 2KT5A 4IKAA 4IO9L 1T9UA 3KNGA 5DDPC 4MYUA 2E7VA 5IFMA 3BY5A 1YHQN 2OGUA 1JL2A 3DRYA 4BHQA 2GUIA 4ELVA 3THWA 3V6HA 5J2QA 2W2PP 3K5LA 4KV8B 4LSZB 2CADA 2ZBQA 2D0PA 5KRSA 2H3GX 2HSTA 1WJ9A 4FJ8A 2NQPA 3OBIA 1RBSA 1S97A 2HNDB 5DZ6A 3MCOA 3U1MA 2B4PA 3ONQA 4WZMA 3CXCR 2XMWA 1YI2N 2E9ZA 1WSRA 4CLUA 1R43A 2M5YA 4OJGA 3M4XA 2JL9A 4ILLA 3R7BB 3CJQA 3MUMP 4LBIA 5C42A 2W6LA 2VD3A 2Q43A 3VTIA 4O44A 3CMAN 3FCHA 1NBEB 3FLCO 4OPHA 3SPYA 1RYRA 2G0JA 1GMUA 3ZTQA 5HLFA 3PR5B 2FVRA 4MIBA 4EZ6A 1BQNB 3WNFA 1Q4RA 1E6VA 4O4GB 3GE1A 1WSFA 2F63A 2DGUA 4X4TA 3MHYA 3ZSXA 1QVGR 4FNIA 4Z7YA 2NS1B 1RHJB 1DQ9A 4B3OB 2HEKA 4I4BA 3AVBA 1YXQA 2E66A 4RWXA 5SWMA 4DR5K 3GYNA 2YHWA 5DM7L 3DN9A 4E1NA 3R97A 1C6VA 2ZDOA 4JYAK 3OTOF 4DN9A 2O8EB 4C8ZA 3FSIA 1CJVA 4ZVOB 4K4VA 1IUJA 5LT5A 1NGDA 3AFGA 3A8YA 3CJ2A 3T6JA 5KFEA 2KLAA 3D1OA 3VGVA 5HATA 4ZPVR 3UFCX 1RZMA 4YMEA 1Q7YT 1BHLA 1N34K 4Q2LA 4LT6A 5E3AA 3CD0A 4F3QA 3TA0A 1K73O 3CJ5A 1U49A 3FGUA 5DETA 1Q16B 4JKGA 4G1QB 2J9EA 2QXLA 2YHBA 1UVJA 1FTCA 3LOUA 2QMUB 3KHLA 2R7RA 1EZZB 1PG5B 3ULEA 1RABB 4EFHA 1SIWB 4Y3CA 3D7SB 3VVUA 1S6PA 2L9WA 3OYDA 5AQMA 1JLAB 5ETPA 2BANB 3HCXA 4P2FA 3SSRA 1XNQK 1N5YB 1W7WA 4RW9A 3U27A 4NL5A 3CJKA 3G71S 1HW8A 2Q6BA 2LDIA 3BGLA 4QW9A 4CBXA 4EZ9A 2KFYA 4KRFA 3KMQA 5SUHA 3D2FA 2W24A 1KTQA 3M32B 2XY5A 4Y1CA 1HWIA 5E3QA 1RT4A 5KRTA 2NLXA 2YCHA 3HSCA 3O9TA 3QEIA 2E29A 1S1XB 1KHWA 2OA8A 4DR1K 3DDKA 2X1GA 2B5JA 4DU1A 1VQ7N 4ZVSB 3MEDA 5A8WB 1UOCA 4CDIA 3JSBA 4X4UA 2MQOA 2QLWA 5F0UA 4CNZA 2UUTA 2GVDA 4X4VA 4JV2A 1N32J 1C1BA 1QQOA 4FW2A 3RBZA 4GNIA 5AZIA 1S0OA 5H9FJ 3D45A 1UPPA 2HFSA 3JAMO 3NF6A 2QSWA 2IFXA 2W01A 4DTXA 3T69A 4DV1K 2R3VA 3NAIA 5A8RB 4BC3A 4FPIA 2D4WA 2X1BA 3CIMA 2MQ8A 4UT4A 4O3NA 4A48A 3M8PA 5IT0A 1REVA 3EZ5A 5IXUA 1JLBB 3VGMA 4LF6J 5DDOC 4NXMJ 1QZ5A 4JV5F 4ILJA 4ZCMA 3O6WA 4R25A 4QWDA 5KPZA 3E8OA 2W40A 1RWOB 2VQEJ 2JWNA 3EYZA 5KFSA 2XGQA 4FZYA 1DTTB 1N54B 4IG3A 1KCFA 3O80A 2UUCK 3HLUA 3GWCA 4BRFA 1LXNA 2EX3A 4DQQA 1GLEG 2F8EX 1AFIA 1BISA 5E26A 3HHDA 1S7HA 3QATA 4WFXA 1SV5A 4KFBA 4B9NA 5HRPA 1RBLA 4HI1A 1VQ8N 3MTKA 1Q8BA 4FJJA 4DF8A 1FFGB 3JQMA 2P1JA 2CZ9A 1RFQA 4Q2MA 4KB1A 2O4GA 3PY8A 2HGMA 1SL2A 2QKBA 3KDOA 4DR2J 4OZ1A 5L39A 2RHKA 2AHOB 4DR2F 2J0WA 4B1XB 1QVFM 3NS7B 4K4TA 3H59A 3WQUA 4B17A 1UFLA 4LF7K 2VG6B 2YHXA 5EVZA 2R2RA 5LSRA 1YRTA 4I6WA 1WF1A 2M9KA 1NDLA 1JXBA 4M3YA 3AD8C 4V1Ak 2CQBA 3Q0AA 3EGZA 3OHAA 4I6AA 4J2DA 3B6BA 4JRPA 2B9XA 5EOYA 2WVDA 4WE1A 4GKKF 4ZITA 2HLUA 1BUPA 1Q18A 4ZDNA 2ZH3A 3RBXA 2KO1A 1NK4A 1YIJS 4YDXA 3NAHA 2NNWA 1S59A 3HZ6A 2XGPA 4H03B 3U6FA 2UVRA 4HR2A 4IOBA 4CHOA 4BVOA 1XNRF 4KHPK 2QA1A 2C2EA 2ZM6K 1X4FA 2QN6B 1NOZA 4DV7J 4RNHA 1TKDA 2ZHOA 4BG9A 1X0FA 1LKZA 3CCVN 3CF5Q 1YJTA 4IOXA 3G6VA 3KDNA 3O4WA 5AQTA 4PWUA 3NMAA 3IDHA 5KFRA 2MDAA 1NM1A 3T1AA 5AZJA 1G99A 4JD2B 3E1YA 1GOAA 3E3XA 1Q53A 2OLWA 5D4LA 3M1VB 1RCXB 4PHTX 3G4SN 4K50A 4ZIWA 3CJTA 3QFUA 4JAXA 4FJ7A 4ZTFA 2E2QA 3CI5A 1NKEA 1QSLA 1KS2A 1GOBA 3AB2B 4JEPA 4LRAA 3S6EA 2NR0A 3D9BA 2WOMA 1NZ8A 1YJ9S 1V5IB 3MEEA 4ZVEA 4PPDA 4GC6A 2OD6A 4F36A 1C0GA 3VQSA 2BKNA 3GV8B 4ZVUB 4U7BA 5AQXA 4D3GA 4ZPAA 3K0SA 2GIRA 4WFYA 4IFVB 2YKMA 5FPMA 2HNZB 2HBYB 2E2NA 1WHWA 1U25A 4KKOA 1RADB 4NXMK 1S10A 3VQBA 1I3OB 3SNNA 4X64F 5BRFA 3CCQS 4FLYA 4NLGA 4OZ2A 4LC9B 2FZGB 1S6UA 1W7AA 5CE3A 2B9YA 4P6QA 4O5FA 2RU3A 4JK7A 2W6KA 3LL3A 1ASVA 4KHMA 4WJBA 4CJFA 3FRYA 3JQJA 1X9SA 4BGAA 3VA0A 1E4FT 1RT2B 4KYZA 4LIRA 1U1OA 1UA1A 3EO3A 1ZS6A 4FK4A 1FE0A 3K9KA 2OFGX 3DRPA 4J9PA 4KH1B 3RBDA 2F7TA 3O2IA 4GVBA 3M9MB 2C1EB 3V9XA 4NLRA 4KH4A 1YJWN 2DXEA 2XZTB 2WRMA 2OPQB 1U0HA 4F02A 2V51B 2HFVA 4OL8A 1S7IA 2DXDA 4BE0A 2VG5B 3GTYX 4CLSA 3I32A 5M1FA 4EK2A 1S9GA 3U02A 2ZVIA 3PHEA 3L0QA 2NUUG 2W4PA 4ECTA 5CR4A 4M94A 3VEYA 4B08A 2QLXA 4QW8A 2CPFA 2OPRA 4IO8A 4OYOA 4OI1A 1WWHA 1WOQA 2AA4A 1IBLF 2IDLA 1BWEA 3EL2A 5LJVA 5AFUA 2NXNA 4JI5F 1FXLA 1Z1ZA 1T6DA 4BVPA 4WFNL 4RW7B 2CVEA 3WX4A 1TU0B 5AQWA 4DV7F 4K2JA 5KG4A 3OR1B 2E4LA 4M95A 1CSJA 2R7UA 4U96A 1CBKA 4CZMA 1XQSC 2M8DB 3R9LA 3O5TB 4O3OA 4OKEA 1YK9A 3IMQJ 2VB6A 3K89A 3LDPA 2FZCB 2EW9A 2DVIA 5FDLA 3PDNA 5GAGU 2OELA 4B9SA 1YI2S 3M5RA 3TAMA 4ZJOA 3AO1A 1F6TA 2R7VA 2LXIA 2N82B 2P9UB 3IKMA 4ZPTR 2KDOA 5CD4A 1XNQJ 2AYMA 3O4NA 1HARA 3OL8A 2ETJA 2VG5A 3QICA 1C1AA 3C66A 4GV3A 2R4FA 2XSJA 1VSEA 2AEFA 4OIXA 3PHTA 4KHPF 1RWVB 3A5MC 4E7IA 1S6OA 2O8EA 1WSHA 2UUBF 1M5SA 5KT7A 5IT4A 3SSSA 3AXMA 3Q24A 1B9DA 4CEEA 3CXCM 2GVDB 4ID8A 1N0UA 3ZZYA 4C23A 4WXWA 3SMZA 4AUKA 2DHHA 3OSNA 4O3RA 1FD2A 3ZZZA 2O01C 1CXQA 3SQ0A 4DCJB 1HLWA 2DPIA 3OJUA 3ZT0A 4WFBL 4ZVFA 2B3TB 3MXIA 3BF3A 4IR1A 2QW9A 2FQQB 3D67A 4TLRA 1TK8A 1U04A 1QHAA 3I5AA 3R9PA 5KOWA 5AXKA 1WC0A 2YX7A 3HDSA 1GMVA 1JL1A 1J5OB 4C8NA 1HMVB 3R5JB 4HHUA 4A8QA 1X4EA 1S3XA 3DOLB 3MMCB 1ZM4A 1Z6RA 4DS4A 3LP0A 1DTTA 2YPZA 1P6TA 4DTRA 4DCPB 3J7Z5 3FMWA 5GADI 4IKFA 3D2FB 1HPZB 3CUNA 4N41A 2MKKA 1NG9A 1ATSA 4IH5A 1REGX 1WSGA 3RWUA 3VERA 3U3YA 4OYAA 4N8NA 2MKIA 2DY1A 3GPAA 3VQPA 3MN6A 2NSBA 2JEIA 4YR0A