4IFVA

Detecting allosteric sites of hiv-1 reverse transcriptase by x-ray crystallographic fragment screening
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
556
structure length
556
Chain Sequence
MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Exoribonuclease H, p66 RT
publication title Detecting Allosteric Sites of HIV-1 Reverse Transcriptase by X-ray Crystallographic Fragment Screening.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase/transferase inhibitor
total genus 167
structure length 556
sequence length 556
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4ifvA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ifvA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ifvA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ifvA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ifvA05
4R8UB 2YHAA 4CFDA 1LAVA 5I42A 1WN7A 3QGIA 4FJXA 3HPGA 4IRDA 3IRXA 1RT1B 2IBKA 1W9HA 2DFEA 4C8OA 4OLBA 1SL2A 4FJ7A 3S3MA 1GOAA 2HWIA 3QO9B 4KSEB 3I0RB 3NAEA 4DG1A 2IC3A 2OPPA 2OH2A 3KKSA 4MFBA 5EU7A 2Z1GA 4TYBA 4N41A 5C24A 2YKMB 4ZTFA 4FJ9A 4FLXA 1NJWA 1NK5A 2VWJA 1KCFA 1TKZA 4ECRA 3NF7A 4HVJA 3OSPA 4E7LA 2F96A 5J1EA 1N5YA 3DOLA 3L3UA 1TGOA 4RUCA 4OPJA 4ZVGA 4Z4IA 1JLGB 1QSYA 5DQGA 3MFHA 1SUQB 4ED1A 4YMEA 4GW6A 1U49A 3ZSYA 3Q8PB 3AO3A 5F8NA 1U48A 1XHZA 4DSIA 4OKKA 3ZSRA 3MAQA 1RT5B 4L8RB 2OYQA 2V0NA 2PYJA 4HCBA 5DLFA 3V4IA 2RN2A 3HVRA 4E1MA 4M3TA 3SCXA 3T5KA 3QEPA 1S0OA 4NYNA 4LH5A 2IAJB 2F8TA 2W42A 3CM6A 1QTMA 4KB7A 4NRUA 3HL8A 1K6YA 4JUZA 1SV5B 3AVHA 1JLCA 3DM2B 4GC6A 3V6DA 4CFCA 3ZT2A 4CHZA 4G1QA 4CECA 3AA5X 4DTJA 5D3GA 1LWEA 3GIKA 2AGOA 2HNDA 4J9NA 5EDWA 4N56A 4DWIA 4CJLA 3VA0A 2RKIB 3G6VA 3AVGA 1S9GB 1IKXB 2G8FA 3KJVA 1JLQA 3PW4A 1JXEA 1VSMA 1IKYA 3VQ4A 2R8GA 1S6PA 3DRPA 3KK2B 4CJWA 2R2UA 1RYSA 4AHRA 2XWYA 3LP0B 2YNIB 3G6YA 3KLVA 5JS1A 2ZE2A 4QOZB 1RTHA 4NLSA 1TP7A 3HYFA 5DG8A 5K14A 2C2RA 1SL1A 1QHTA 4FZXC 4KB0A 3NGIA 4JV0A 3V9SA 3AA3A 4JRQA 5J2PA 1RBTA 1IO2A 3SV3A 3MR5A 4DTNA 3NGDA 3KHGA 1S1WA 4FS1A 2OPQB 4IFVB 5J2QB 4K4WA 3ZSVA 4Z4HA 3V1RA 2JEGA 2ILYA 4CEAA 4EEYA 2QK9A 2IM1A 3RMBA 1C6VA 3E51A 4NLDA 4UQGA 1REVB 3TAFA 1X9WA 3DDKA 4O5BA 3KLHB 3V81B 1B9DA 4MK7A 2QV6A 4QWBA 3DLGB 2DFFA 1Z26A 1VRTB 2W7OA 2X78A 1KVAA 2BRKA 3AO5A 4FJ8A 1BI4B 1C1BB 3MEGB 3VQSA 3VQ5A 5KFRA 2UVWA 4J9LA 4DFMA 1KFSA 1HYSA 3LPUA 3CDWA 2BANA 3ALYA 3GIJA 4EO8A 4YP3A 1BQMA 3KOAA 3FFIB 3IG1A 1YT3A 1HPZA 4DTXA 2X74A 5KRSA 4LD0A 4AHTA 5FDLB 3CJ0A 3LZJA 3V9ZA 5KFLA 3NF6A 1LW0A 2RF2A 4KKOB 3KIOA 2OPSA 1TQLA 1T7PA 1TKXB 1LWFB 2E9RX 4I9QA 4TY8A 5KT5A 2HNYA 1K1SA 4DL4A 1RT2B 3NF9A 4ECXA 3QIOA 4KTWA 1SKWA 1EETA 3ZSWA 1HNIB 5KFWA 4ZHRA 4OPKA 4ZP8A 4KO0A 1Y97A 2Z1HA 1JLBB 4R0EA 4YR3A 4FBUA 3IS9B 4PWDB 2I1RA 4ED3A 1JLAB 3PHEA 1WSJA 3WNFA 4CHYA 2Z1JA 2E6MA 3V1QA 5KFYA 5KG2A 4ECSA 1D0EA 2XY6A 4B9NA 4W5RA 4IFYA 3OS2A 2B6AB 2FLLA 3HVTA 4ZPAA 5F8IA 4CF0A 1XC9A 1JXBA 1RDRA 3KD5E 2XY8A 2XY5A 1SKSA 3OYHA 5C42A 2X6NA 3IAYA 1F21A 4B9MA 1EKEA 3DLRA 2E6LA 5C25A 2R2TA 5KG5A 2J6TA 4FK2A 2P5OA 3HP9A 1R0AB 1RT6A 2HHUA 2E9TA 4IQXA 1QSSA 1VSFA 3DLHA 3QLHA 5HROA 2AGQA 3SYZA 4DFKA 1S1UB 2ATLA 4CK2A 5L1KA 2G8IA 3RR8A 3BQ2A 1BCOA 5F8LA 4CGDA 5HRSA 2OPRA 4DS4A 3TR8A 1MU2B 3AV9A 2XI2A 3KLEB 4F4KA 4ED6A 2JEIA 4ZPDA 3OYKA 4I2QB 1WAFA 3AVMA 3L2WA 5KFHA 1ZETA 3LP2B 2AX0A 4ZVEA 3JYTB 5EWFA 4CGIA 3RTVA 4KI4A 4Y1DA 4TSXA 4ECVA 4H4OB 4F2SA 5HLFB 5KFGA 3ZCMA 3RMDA 4O4GA 4DL5A 2VG5A 2IDOA 1BL3A 3C94A 3M8PB 4RW7A 4WYWA 3MXJA 4CF2A 4O3NA 1JKHB 4M3ZA 1NK0A 4H8KA 2B5JB 4AHSA 1VRUA 1SH0A 2JEFA 4IG0B 4NCAA 2IGIA 1TL3A 4K50A 4E19A 4DQIA 1W25A 5JXSA 1S4FA 2D7SA 3KLFB 2IMWP 1RA7A 1U45A 1J54A 1RT3B 4R5PB 3GILA 1D1UA 1HMVA 1JLFA 4FM2A 4FJGA 2QXFA 2HW3A 3SQ0A 3HHKA 3OJUA 3OYLA 1JL2A 1LW2B 1DTQB 3PR4A 4CHOA 2XY7A 2O4GA 5T14A 5EUHA 3N6MA 5KFQA 4HUEA 4E1NA 1NK9A 4CESA 1LWCB 3QO9A 1TK5A 3I0RA 4ELVA 1S9EA 4XPCA 4QW9A 2R2RA 2FJVA 2YKMA 4J9KA 4CJEA 1NKCA 1S97A 3DRSA 1NHVA 3OYGA 2W8KA 1ZBFA 2W9BB 2IS3A 3PZPA 4I9LA 3UQSA 2W8LA 3NH2A 1JLGA 3OYBA 4EP4A 4DSJA 2BGGA 2O4IA 4PQUB 4YFUA 3K58A 4OKJA 4ZP7A 1O1WA 3JSMB 4EBDA 2C2DA 3T5JA 4CJTA 1RT5A 1FXXA 3WNEA 4Q0BB 2IA6A 2RDJA 1KHVA 4ED0A 3VQPA 3I5BA 1GOCA 1TK8A 3GV8B 3NL0A 3KMQA 3BDPA 4NLYA 5J2NA 4FW1A 4DQSA 3EY1A 4CJPA 3H5YA 4DTUA 3C6UB 2J6SA 1C2PA 1N6QB 4ED8A 3NF8A 4FLVA 3AVAA 3RR7A 4RNFA 4F50A 3BSNA 1JIHA 3CFPA 4DTSA 3QIPB 1FK9B 1SL0A 4ZP9A 1KRPA 1C0UA 4NLTA 3AO2A 3MEEB 1SV5A 3IGNA 3DM2A 1NK4A 1FKPB 2FBVA 5KFEA 4FJJA 3LP1B 4ZPCA 4DQRA 3SPYA 1T03B 1TKTB 4KAIA 3DMJB 4ICLA 4MKAA 4URGA 3TAGA 4EZ9A 3SUOA 2RKIA 1S9GA 4DU1A 3DRRB 4NYFA 3KK3B 3EYZA 1S1XA 4O3RA 2IJNA 5KG3A 4FJLA 1S1TB 2W9CA 4C8KA 3QNOA 2ILZA 4QWEA 2QKBA 1X9SA 4KE5A 4RG8A 3GIIA 2XI3A 3LP0A 2YNIA 3OYCA 4CJVA 4E89A 4RNNA 4O44B 4KFBB 2D0BA 4PUOB 2Q3SA 4E7IA 5SZTA 3VQDA 3RWUA 4KHSA 3QEIA 3NFAA 3OSNA 4O4RA 1EP4A 5DGBA 1DLOB 3ITHB 5KG0A 1ASUA 2OPQA 4IFVA 5J2QA 4CE9A 3BGRB 3OL6A 4F4XA 5KT3A 3VQEA 4CF8A 5KT4A 5KFIA 1RAJA 1CLQA 3SUNA 3O3FA 1REVA 3K2PA 1D9DA 3IN5A 5KFMA 4CJ5A 3KLHA 1IKVB 3V81A 4Z4GA 4AHVA 3E01A 3QGGA 3QYYA 3V9XA 5I3UB 3DLEB 3DLGA 4Y3CA 3NAHA 3OYAA 3QESA 4W5OA 1VRTA 1RBRA 2P1JA 3BR9A 2I5JB 2RDIA 1RT7A 1T05A 5FRMA 2FBYA 4BDYA 4HUGA 3MEGA 1BI4A 2DY4A 4DL2A 1TV6A 4ECZA 3KK1B 1VSEA 3DYAA 5DG9A 1RTIB 3WNGA 4OL8A 2P51A 4CJRA 5KRTA 3DLKB 3T3FA 4FLTA 4Z4FA 3Q8SB 4BWMA 4LSLB 3BREA 4WE1A 4RW8A 3TAQA 4E3SA 3TARA 2D3ZA 2UUTA 3FFIA 3NH0A 4K4XA 4EBEA 1TVRB 3BJYA 3PW7A 4U7CA 1YTUA 4CEOA 5FDLA 4B9SA 4FJNA 4QW8A 4E0DA 3GV5B 1RBVA 3M8SA 4FLWA 3M9OB 1TKXA 3SI6A 2XC9A 4PY5A 1LWFA 4CERA 3NH1A 3M8RA 1J5OB 3HPOA 4K8XA 4BE2A 2WONB 3QZ8A 1JLBA 3ZSQA 3RBDA 1TL1B 4ELTA 4I2PB 2WHOA 1S1VB 3IS9A 4DSKA 3RAXA 1BIZA 1JLAA 1JL1A 3CVKA 3THVA 4B9VA 1OS5A 4U6PA 3F73A 1CZBA 4CIFA 4URQU 4XPEA 2HHWA 1C1AA 3AVLA 5DLGA 1S5JA 2IM0A 5DG7A 2B6AA 3I0SB 4EYHB 3QEVA 4TYAA 4KREA 5HP1B 1TKDA 3KTQA 4DMNA 3HXMA 2WTFA 1TK0A 4RZRA 3GQCA 1B9FA 1NK8A 1RT4B 2V4QA 5KFTA 5I42B 3HK2A 3VN5A 2HVIA 3QIDA 1NKBA 2ZKUA 4DF8A 1S49A 3SJJA 3NHGA 1S1UA 3T5HA 1VSHA 4DG1B 2IC3B 3SV4A 1NJZA 4KB1A 4MFBB 1ZYQA 3C6TA 3HVAA 3SUQA 4DL6A 4W5NA 1WNEA 1VSJA 3AVBA 3PR5B 2G8KA 3LANA 4NCGB 1SH2A 3KLEA 4FXDA 1QAJA 2A1SA 4ZVFA 2D5RA 3UDLA 1NJXA 3JYTA 5DQIA 5EWEA 3AVJA 4K8ZA 4RUAA 3AVIA 4NLXA 5DK5A 1J53A 4LH4A 1C0MA 4DSFA 1WSFA 4H4OA 2JC1A 2R8HA 1C1CB 4NLUA 1NK7A 2VG6B 2HWHA 1RTJB 3M8PA 5E41A 4KPYA 4KV8A 3PJWA 1GOBA 1JKHA 3LPTA 2YKNB 5L1IA 2B5JA 4EO6A 2LSNA 5CYQA 4RNOA 4FJKA 1IKWB 2WRMA 4Q8EA 3RB4A 4O3OA 4WFZA 4HHTA 4Y34A 4FYDA 4CFBA 3I8DA 2WOMB 5F8JA 3EZ5A 1NNDA 4RNHA 3V6HA 4BWJA 4M95A 2VWKA 1RT3A 4R5PA 4E7HA 4J2AA 1N48A 1CXUA 1JLCB 2G8UA 1VSLA 3OJSA 4G1QB 4FK0A 4CGHA 1LW2A 2HHSA 3AO4A 3P1GA 4DTMA 1DTQA 3G0ZA 3H08A 4NLOA 4FJHA 2HNDB 3K5LA 2NUBA 3G86A 3SUPA 3HM9A 4Q8FA 5HRPA 5DMRA 5J2MA 3MR6A 4FS2A 4DL7A 1HYZA 3P83D 3KJVB 3FSIA 1HQUB 2HNZA 1FKOA 1IKYB 4CF1A 4K4ZA 3MEDB 5CY4A 1S6PB 3DRPB 4Q45A 3NGZA 4NYZA 4OGCA 3M9NB 2G8HA 2XO7A 2GV9A 4RW4A 4O3SA 1C0TB 3L8BA 4CJFA 5KT2A 4BDPA 2VG7B 4Z0UA 4IH7A 4F3TA 3OYNA 2FVCA 4F4ZA 3EZUA 4WFXA 2W9BA 1GX5A 3RB0A 4N76A 5J2PB 3NKYA 1HJRA 4IRKA 3U6FA 5KGWA 3OYMA 1S1WB 3BSOA 2DFHA 4OVLA 1NKEA 4XIUA 3NGYA 4DTPA 3JSMA 3OYFA 4OJRA 3ULDA 2R8IA 4FLYA 4FLUA 1IG9A 4CEDA 3PV8A 2YNHB 4Q0BA 1ZTWA 2YNFA 1HNVA 1NJYA 2V9WA 2CJQA 1UWBA 2C22A 4IH5A 3H2LA 4ZPBA 3GIMA 2Y1JA 2VA3A 4TN2A 3ZT0A 3C6UA 3MECB 4CFAA 1KLMA 4RW9B 4CK3A 1N6QA 4BE0A 4M3UA 3QIPA 1FK9A 1QS4A 2ITGA 5F8HA 4NLWA 3H4DA 3MEEA 3RRGA 4CJKA 1KSPA 1FKPA 3H5SA 3HKWA 3AVCA 1JLEA 3DOKA 3LP1A 4G3IA 2ZD1A 5KGXA 1TKTA 1U04A 3V9WA 4WZMA 3DMJA 3ZSOA 3T19A 1BQMB 3IG1B 3KHLA 3RB3A 3LZIA 3V6JA 3LWLA 5CZ2A 3DRRA 3BSCA 3KK3A 2P5GA 4NLPA 4BACA 4Z4CA 1S1TA 3KNAA 2OPSB 3OYEA 2UVVA 4B8CA 4DTOA 4NZ0A 1S10A 2BE2B 1S0NA 3N6LA 4R8UA 4O44A 3TANA 3OHAA 4AILC 4ZHRB 4IDKB 4J9SA 1WAJA 4YR2A 4KO0B 2EX3A 1T8EA 1RT1A 4O0IA 2G8VA 3D45A 4FBTA 3LP3A 2HMIB 4KHUA 3QZ7A 1N4LA 1DLOA 2D3UA 2KFNA 4ID1A 2ETJA 3ITHA 1XHXA 4F3OA 3BGRA 5FROA 2EC0A 4LSNB 4C8MA 5HBMB 3H98A 3K5MA 2ZQBA 1LV5A 3OS1A 3TAEA 3VA3A 5JUMA 4JLHA 1RDCA 4CEZA 1IKVA 3PY8A 1CXQA 3P5JA 4RNMA 4F2RA 5I3UA 3DLEA 5L9XA 4IOBA 3PJXA 1Z4UA 2Y1IA 2I5JA 4KTZA 1SUQA 5KFFA 3B6PA 3OYDA 1UAXA 1W0HA 4LQ9A 1KVCA 2YHBA 1QE1B 3VQ7A 3KK1A 4KBIA 3ZSXA 1RTIA 1RT6B 2FJXA 5HROB 4F4WA 1IM4A 2ASLA 4ECQA 1B92A 2IJFA 5L1JA 4K4YA 1Q8IA 3FDSA 1RYRA 2OPRB 1A5WA 4ZVHA 3MR3A 4CGGA 1XR6A 3Q8QB 2DPJA 1TVRA 4ZMMA 1MMLA 2IAJA 1WSIA 4K4VA 4CGJA 4YQWA 1VSDA 3QETA 3CFOA 3L2QA 4FCYA 5KFZA 3HO1A 2F8SA 3UPFA 1JXLA 2UUWA 3DI6B 3CM5A 1UA0A 3KLGB 5HRRA 4KI6A 5KG1A 4EZ6A 4J9MA 4IG3B 3PUFA 2EHGA 3PO4A 5KFAA 4E7KA 2YNGB 4H4MB 3K57A 5KG4A 2W9AA 4NRTA 3B6OA 2FVQA 4Y2AA 1WSHA 4O4GB 2VG5B 2BQRA 4IH6A 1TL1A 4I2PA 2KFZA 1S1VA 4GVMA 1IKXA 3FRZA 3D5MA 4QPXA 4RW7B 2JLEA 4M3XA 5KFSA 3OL9A 5JS2A 2GIRA 5KFXA 1XI1A 2OA8A 3KK2A 1LAWA 5CYMB 3D28A 4IBNA 5KFNA 5KFUA 1YVUA 2XGQA 4K4TA 3QEWA 1RCHA 4I7FB 4CIEA 1SH3A 1VSKA 2KTQA 4W5TA 5KTQA 4CEEA 3V1OA 3ISNC 2BRLA 3RB6A 1JLFB 2Z1IA 5HP1A 1XR5A 4WFYA 2X6SA 4B9LA 1RT4A 3GV7B 2ASJA 1HQEB 1ITGA 2KQ2A 2GBZA 3CYMA 3L2RA 4IKAA 4NCBA 3A2FA 4EP5A 3ZT4A 4ID5B 2B4JA 4KRFA 2HHQA 2GIQA 1BCMA 1X9MA 3HJFA 3RAQA 4AHCA 1S9EB 2XCPA 1S6QB 4GMJB 3SFUA 3F9KA 3SFGA 3PW0A 1RILA 3M8QB 3LAKA 3CG7A 3KHRA 4J9PA 2D41A 4Z4EA 4NCGA 1C1BA 4ECWA 3PX4A 3IGVA 3DRSB 3RMAA 2D0CA 3VQ6A 1ASVA 4WYLA 5C5JA 3OVNA 3LDSA 4CIGA 1TAUA 4NLVA 3AO1A 2F8EX 3K5OA 4E7JA 3OYJA 1X1PA 1T3NA 4B3OB 3VQQA 3N6NA 3LAMA 2OZSA 1C1CA 2HVHA 2VG6A 3O4NA 3FQKA 1DTTB 1KFDA 2A1RA 1RTJA 3PVXA 2XGPA 4DFPA 1U47A 3TAMB 2UVUA 2IOCA 2YKNA 1Q9YA 4DL3A 4KKOA 4B8AB 4TY9A 5J2NB 4LY7A 2AU0A 3WNHA 1IKWA 4Q43A 4FM1A 3OHBA 1ZTTA 3NAIA 1RT2A 2WK4A 2KZZA 2WOMA 5F8MA 2R8JA 4J2DA 3H59A 2QKKA 4CGFA 1HNIA 4GC7A 2HAIA 1C0UB 1BQNB 2HHXA 2C2EA 1N56A 4PWDA 3S9HA 3RBEA 2HB5A 4J9OA 5KT6A 1NK6A 3I5CA 4RW6B 1KTQA 2O5DA 3OLAA 4ICLB 4CJUA 3M9MB 3TVKA 4KHYA 3NBPB 4MIBA 4MK8A 4O55A 3VQ9A 1D9FA 3NDKA 1S1XB 1YVFA 1HQUA 3AA4A 4JS4A 3MEDA 1I6JA 2W9CB 3KLIB 1RTDB 1L3UA 2WCXA 4FJMA 2FJWA 5F8GA 1A5VA 2HHVA 1C0TA 1RNHA 3HP6A 3MTKA 1JX4A 4M45A 2VG7A 3RRHA 3KHHA 4HCCA 4F4YA 1RA6A 3IRXB 2E9ZA 4M42A 1G15A 1R0AA 4PA1A 2JC0A 1EP4B 3OLBA 3K5NA 4CEQA 4ECUA 3ASMA 3QNNA 4FVMA 5KFDA 4J9RA 4W5QA 2OPPB 4OGEA 4URSA 5SWMA 5C24B 1XR7A 4CHPA 3LWMA 3VQAA 1MU2A 2AWZA 1TKZB 2YNHA 3SQ1A 2VA2A 3OL8A 1NHUA 3VQ8A 4IKFA 3Q8RB 4Y1CA 5J1EB 1N5YB 3DOLB 3AA2A 3E01B 4I2QA 3D0PA 3LP2A 1KHWA 4KHQA 5L1LA 4DTRA 3SQ2A 3MECA 3V6KA 1D8YA 4RW9A 5F9LA 4EYIB 3I5AA 1RT7B 1T05B 5T7BA 5EWGA 3CJ5A 1TV6B 4K4UA 5HLFA 4FM0A 3QEXA 4JV2A 3L2UA 2JEJA 2AJQA 3T5LA 3DYAB 4NLGA 3K59A 4ED7A 1IH7A 4MK9A 1TAQA 3V4IB 3UIQA 2AGPA 5KT7A 4DQPA 3H5UA 4B9UA 1I39A 4CJ4A 3NCIA 4NLRA 3NE6A 4WE1B 4RW8B 4YR0A 3CDUA 4KHMA 3SPZA 4TQRA 4KHNA 4IG0A 1WNSA 4FW2A 4OLAA 2XCAA 3CWJA 1U09A 1ZBUA 2ALZA 2FBTA 1ZBIA 3KLFA 4DQQA 3OS0A 2AQ4A 2AX1A 3TI0A 1L3SA 1NOYA 4CEBA 4MH8A 2FLPA 5KFPA 1S48A 1ASWA 1S9FA 3V6DB 4O0JA 2BE2A 4OKEA 4IR9A 5D3GB 3OYIA 1LWEB 3CDEA 5KFKA 2ATQA 3ISND 2R7YA 4IDKA 4J9QA 4N47A 5KFOA 1S0MA 1RDBA 4DLGA 4JS5A 3VQBA 4DSLA 4NLQA 2R2SA 1JLQB 2HMIA 4WXWA 3EPGA 3NMAA 4MKBA 3H4BA 1LWCA 4AHUA 4C8NA 3MR2A 4CEFA 3PW5A 3QINA 3BSAA 4ED2A 4M3RA 4CJ3A 5HRNA 4N5SA 4LSNA 5HBMA 4MQ3A 1ZBLA 5F9NA 2ZE2B 2RPIA 4BDZA 1RTHB 4AH9A 2XRIA 4JRPA 2C28A 5K14B 3SI8A 3QERA 1K1QA 2V4RA 3TABA 1EXQA 4DFJA 4IRCA 5DGAA 3VQCA 1RDAA 3ICLA 4PQUA 3DLBA 4HYKA 4JV1A 1WSEA 5DQHA 1QE1A 4B08A 4HKQA 4F8RA 3U3GA 2W7PA 2PZSA 3BQ1A 3TAPA 2FVSA 5CZ1A 3TWHA 4M3WA 1Z25A 4DSEA 4QWDA 3C6TB 3KD1E 3TQ1A 1BIUA 1CSJA 4DU3A 1KLNA 3CFRA 4TXSA 1GX6A 4TLRA 3QGHA 4J2EA 4CK1A 1QUVA 3KKRA 2FLNA 2PYLA 3HPHA 3FQLA 2BQ3A 1BISA 1QAIA 1HYSB 4BE1A 3DI6A 2BANB 2BR0A 3KLGA 5KG7A 4IG3A 1T03A 2YNGA 2CKWA 4H4MA 1T94A 3OL7A 3G10A 1RBSA 4DEZA 2DTUA 1NOZA 1HPZB 2FVPA 3OY9A 3MXMA 4RU9A 1BGXT 4EBCA 4KV8B 5KG6A 3ZT1A 2BDPA 4DS5A 1LW0B 2RF2B 4CCHA 5CYQB 5CYMA 1CZ9A 1L3TA 4WZQA 4TY8B 4FLZA 3KMSA 2HNYB 1XWLA 1VSIA 4I7FA 4KHWA 2JGUA 3SQ4A 1EETB 4FZZA 4KFBA 3MXIA 3S3OA 4PUOA 4WXOA 3PX0A 2YV0X 1HYVA 2ASDA 4J2BA 4FZYA 2R8KA 3CO9A 3MF5A 4M3YA 2G8WA 1EX4A 1HRHA 1HQEA 3ZSZA 2GC8A 2FVRA 2J6UA 3MFIA 2IM3A 1L5UA 4LQ3A 4CHNA 3T1AA 3AVKA 4QAGA 4DF4A 3PO5A 3AVFA 4CJSA 5J2MB 1RBUA 4ID5A 1QQCA 1ZBHA 2KW4A 1QSLA 3CJ4A 4IFYB 4ECTA 4C8LA 1UA1A 3L3VA 2D0AA 2HNZB 1FKOB 3HVTB 4KAZA 3V9UA 4QWCA 3H40A 5KFCA 5KI6A 3G6XA 1WSGA 4CJQA 2UVRA 4QWAA 1S6QA 5KFBA 1J9AA 1L3VA 3RMCA 4RW4B 4FJIA 3M8QA 3EPIA 4X2BA 4CHQA 2XHBA 5C42B 4FK4A 4ZP6A 2FBXA 5C25B 1A5XA 4HTUA 4O3PA 4MIAA 3C95A 4XO0A 3PW2A 3DLKA 3QLHB 1VK0A 3O4QA 2KZMA 4O3QA 3BQ0A 3L2VA 4B3OA 4DLEA 4LSLA 5KFJA 3HVWA 3S3NA 4KHRA 4QCLA 1I3AA 1YTAA 1DTTA 2B43A 3U3YA 1D5AA 4YNQA 1SKRA 4ZTJA 2PY5A 3TAMA 2YNFB 1HNVB 4KTQA 3CJ2A 1UWBB 2HHTA 2FC0A 1KVBA 4M94A 1BHLA 1KLMB 3O3GA 2BQUA 1J5OA 3ZT3A 1HARA 4Y2CA 4TQSA 3AVNA 2WONA 1Q9XA 1BQNA 4M41A 4Q5VA 2QE5A 3O3HA 3CQ8A 3UR0A 1JLEB 4ELUA 3DOKB 3SZ2A 2ZD1B 3SNNA 2OZMA 4Q44A 4RW6A 1VRUB 2DPIA 4FJ5A 4B9TA 4K4SA 5KFVA 3HSTB 1TL3B 3NBPA 3PX6A 4IR1A 3GYNA 3CIZA 4CF9A 5FRNA 4H54A 1UOCA 2IM2A 2GUIA 3CJ3A 3I0SA 1HMVB 4DU4A 1WLJA 4HUFA 3KLIA 1RTDA 3H5XA 3LALA 2E4LA 2WB4A 3HT3A 4ECYA 1U4BA 1RDDA
chains in the Genus database with same CATH superfamily
2DTJA 4EFAC 4R8UB 5K8NA 1AYEA 5I42A 3QGIA 2KKZA 3DHWC 2NRTA 2RU9A 4IRDA 3IRXA 4G6VB 3W8PA 4ZPWR 1BE4A 1SL2A 1F60B 4YOEA 3CCEN 4FWSA 1SC1B 4FWNA 1GOAA 3R2DJ 4BC5A 4NEZA 5LJ3Y 3OW2M 3NAEA 3R7BB 3KKSA 4MFBA 4KPCA 5EU7A 2B9XA 1CJTA 4N41A 4BR4A 3GCWP 4HWIA 4FLXA 4OI3A 2JFDA 1KCFA 4JK8A 4MAKA 1R89A 2QLJB 4FPIA 5TKWA 1RBLA 3QT5A 3DOLA 3IA0A 3L3UA 2B8QA 2CJXB 1NG9A 4HHUA 3B4DA 1HHQA 2F5GA 3MFHA 4ED1A 2RJZA 1U49A 3ZSYA 1BU6O 4PKHA 5F8NA 4DSIA 4FWLA 2LKZA 3ZSRA 1RT5B 2QZ8A 4L8RB 6AT1B 2OYQA 2V0NA 2X1AA 4L3NA 2PYJA 3IM9A 2V8DA 5DLFA 3VPZA 2P6SA 3ZLJA 2RN2A 2QC3A 2IMOA 4DR3K 4M3TA 3MHYA 2MZSA 3SCXA 3T5KA 3FE1A 5AJ3F 2UUAK 1NGGA 3FCVA 4GVBB 5DO2A 4ZLLA 3BF4A 2W42A 3MN6A 3CM6A 4KB7A 4NRUA 1K6YA 4JUZA 4Z7CA 1FJEB 2CUYA 3Q7CA 3V6DA 4IWVA 4C0HA 2OMLA 4CFCA 4CECA 1B64A 3GIKA 5HQ8A 1R31A 1UWAA 4DWIA 5A2QY 3PG9A 1VQON 3K9JA 2EI5A 3OTOF 1TFWA 3RJMB 3MM5A 3KJVA 1VSMA 1WDTA 3VAFA 2KXNB 4A8OA 1KEKA 3JQMA 1W2IA 4CJWA 1RYSA 1FDBA 3EICA 3NGUA 4DR3J 2FY8A 2RILA 2EK6A 2YNIB 2J9CA 3W7BA 2UUAJ 2N3OA 1T3VA 5F2RA 1FHTA 3HYFA 5DG8A 4L6V3 3FGUA 2E1AA 2FD2A 1YLXA 3THYA 5ETTA 5J2PA 1K73O 3ENQA 4UY85 3MR5A 1S1WA 2Q79A 5J2QB 4IFVB 2MTLA 3ZSVA 3A3NB 3ZTPA 2JEGA 2ILYA 4CEAA 1YJWS 3AD8C 3MURP 2ZM6F 2J9DE 2KG1A 4NLDA 1REVB 2A0FB 4LBIA 3TAFA 4HACB 5FD1A 3ID6A 5AQOA 1BWEA 4NYPA 4ZVOB 4QWBA 4CO1A 3BO4A 4LVOP 2RQKA 3OXLA 4CDIA 2UZAA 1OH8A 1T9YA 2HS0A 1CC7A 2ZFHA 2HQGA 3KDNA 1BI4B 4JYAK 2D74B 1N33K 5DM7Q 3G8TA 4J9LA 4CZIA 2PT0A 3QFUA 3ALYA 1F5CA 5C2FA 1BC6A 3GIJA 4NXMF 1I94F 3FRYA 3LL3A 2QL9B 5M1QA 3QAEA 3IG1A 2CDQA 3W9JA 3OUYB 2OTLS 1RHMB 3M8WA 2D4WA 3MOZA 3LZJA 3V9ZA 1LW0A 2FHOB 4JI4J 2OPSA 1T7PA 4TY8A 1K1SA 3QIOA 2QEXN 4ATNA 1Y4ZB 4JI2K 3I56S 4CZFA 1HNIB 2HHPA 3TWZA 5AQLA 4ZP8A 1SC6A 3ZZPA 4JYAJ 1AROP 1N33J 1RAEB 4YR3A 1KAXA 1X4GA 4YOYA 4YOTA 3UE5A 4PWDB 4ED3A 3A5MC 3DGPB 1QVFM 2KB2A 2Q3PA 1WSJA 2ZH2A 3FC9A 4YB6A 2GO9A 4NX9A 4CHYA 3AD7C 2CQBA 2ZZTA 1A7GE 3OTBA 4GKKK 1D0EA 2XY6A 4BR0A 5F1XA 1LQ9A 3ISZA 4E8UA 3TUZC 1M5PC 3HCXA 3ZZOA 3DCAA 3CC7S 1B70B 2ZEJA 2FLLA 2GCFA 2P9EA 3HVTA 1WORA 4WTOB 3DXMA 5F8IA 4CF0A 1IBCB 5AFUH 1XC9A 4XH5A 1VQNS 3C6AA 2BH1A 1RDRA 1NAQA 1NDKA 2XY5A 3OYHA 4I1TA 2ZJRQ 5EY4A 4CO3A 4DPTA 1Y9OA 1V9OA 2X6NA 1F21A 4B9MA 4JI2J 5C25A 5KG5A 4GV6A 4X4SA 5CCMA 3HP9A 5AQWA 3T1YF 1RT6A 2R7WA 1VSFA 3KNGA 5HROA 3TPQA 3SYZA 2XS5A 4AL7A 1YJTA 3VVTA 1BCOA 3AAPA 1GXTA 4UF4A 4NL5A 2HRYA 3GL1A 4X65F 1MU2B 4GKKJ 3AV9A 4DR4K 4ED6A 3NS6A 3M30B 4I2QB 3L2WA 1GMWA 1XNQK 4ZVEA 3UE2A 3M8YA 1GMUA 2ZJPQ 3RTVA 3M4XA 3U27A 4KI4A 4NYOA 4ECVA 4JD2A 2R7QA 4OX9F 4IO1A 1G6BA 4ZITA 4JI0F 1UVMA 2CNLB 3C6HA 2W01A 2F9TA 4RW7A 3GFHA 4O3NA 2GO8A 1RHQB 1SH0A 2JEFA 2E5GA 2IGIA 3SQGA 1VQ9S 1HKCA 4A8FA 1W25A 1HA1A 5CZXA 5JXSA 4C3LA 1UFKA 1LOTB 2W2MP 1J54A 4R5PB 2AJFE 4DR4J 3ET6B 3JS9A 3HHKA 3SCJE 3OJUA 1RISA 1XNQJ 3K2YA 3QPIA 3PR4A 4JKAA 3MWPA 1KN6A 1IR2A 2JFKA 3HZEA 1CS4A 2NLWA 3W2WB 3N6MA 3JAMO 3JQKA 3N01A 1XMQF 2POKA 4BQZA 3HULA 3GLJA 4RUHA 3PYEA 1TK5A 3D2FA 1LFWA 1HI0P 3FMBA 3A3PB 1HW9A 5G4DA 2WAQD 4X4NA 3TSUA 1QY7A 3PFOA 1VQ4S 3EE9A 6FD1A 3OTDA 4QW9A 2HG4A 2B9EA 3Q22A 4J9KA 4X4PA 4ZJQA 3R6LB 3CD0A 2MHEA 1NHVA 4OI6A 1U1PA 2AZ1A 1ZBFA 2W9BB 3ENOA 1QUPA 1GXLA 4KGVB 3SXLA 2HYIB 3ENVA 2W2PP 3PZPA 2JVRA 4FF2A 2MZ1A 3OYBA 4EP4A 4F36A 2BGGA 1RI7A 3TOQA 3MX2A 3EUNA 3NWGA 4Y2MA 3ZZZA 3WNEA 2YTCA 2IA6A 1VBZA 1KHVA 4ED0A 5AQHA 3ZYYX 1GOCA 3NL0A 3EE3A 3BDPA 3CCLN 4YN3B 3QBWA 5J2NA 1JJ4A 1ROFA 1FEEA 2ZOFA 1KKHA 3AVAA 3CFPA 3GJRB 1FK9B 2ZH1A 3TA1A 1VFJA 2DR5A 4CZKA 3MEEB 1SV5A 2VWBA 2FBVA 2AEJA 4YS2A 3D1HA 4ZPCA 4YB1P 4YDDB 2K1RB 4M5DA 5BN9A 1TKTB 3DMJB 4ICLA 4URGA 2VKRA 1FXLA 4JOUA 4Z94A 4DR5K 4EZ9A 3BGLA 2RKIA 1S9GA 1G99A 4EFHA 2CYYA 5C0YA 1CJUB 5KG3A 3VOVA 3IAM9 2OTJN 3R1XA 1FFSB 1HWUA 3BZCA 2DO0A 4KE5A 3LGHA 3CDBA 2XI3A 1REGX 2F7VA 2R7XA 1VBXA 1M90O 4F0KA 4CJVA 5HMYA 4E89A 4RNNA 1OH6A 4O44B 4LFBK 5LMUF 1V3ZA 4PQAA 1WKLA 3KUHA 5ETSA 2XS2A 2Q3SA 5AQIA 3HSGA 2NSBA 2P9KB 4UOFA 2W2NP 4KHSA 3NFAA 4O4RA 4F9OA 2FDNA 4RJVA 1CZAN 4G9ZA 4BRFA 2OPQA 1H38A 4I67A 4F4XA 4HT5A 4DR5J 3O3FA 2DY9A 3IN5A 3LDOA 4ANEA 4MTPA 3MWBA 3DLEB 4JHDA 3NAHA 2KO1A 3QESA 5C2GA 2FJDB 4RX6A 2RDIA 4DZDA 2JNJA 2PI4A 2A42A 1HHTP 2ASOA 4LFBJ 1VSEA 2F3JA 2UYTA 2JLFA 5DG9A 1RTIB 3G71S 4CJRA 3HHNB 4J37A 3T3FA 1ZM4A 4JN4A 2O8DA 4Z4FA 4L3QA 3RRKA 2OEJA 4BWMA 5THWA 2OP5A 4K4XA 4EBEA 1NDPA 5IV3A 3PW7A 4U7CA 7AT1B 1SJ1A 4WFNL 5FDLA 2MGZB 4WJBA 4B9SA 4FJNA 4E0DA 3J80U 1RBVA 4FDFA 3M8SA 4FLWA 4PXEA 1EIYB 3SI6A 1U25A 3L7PA 4CERA 4MDAA 1J5OB 1DQ9A 3HSCA 4PHTX 3QZ8A 5DDOC 3SEOA 2QMUB 3ZSQA 3RBDA 4DR1F 5E3AA 1Y3KA 3IS9A 1KOHA 3D7EO 1BIZA 4EWTA 2DXDA 3U9DA 3U1LA 1IN0A 1U2VB 1DGKN 1D8ZA 4FNIA 4WFAQ 1XNRK 3LH2S 1HNZK 2HHWA 4PKIA 3ATUA 3MMBB 1S57A 3U1NA 2IM0A 2NXUA 2QTDA 1Y5IB 2RMLA 4IZ9A 3ONQA 2B6AA 4EYHB 1U1KA 4TYAA 4KREA 3FK4A 1ZA1B 4NI2A 1IG8A 3VR1A 1TKDA 4CO0A 2VCPA 1VQ5N 2WTFA 1SJRA 1NK8A 3U02A 5EN1A 4LFAF 2WSCC 4C0OC 3BPSP 1J27A 3EDQB 2HHHK 2N4DA 3VN5A 3LM2A 4CLPA 4CNZA 2PC6A 4DF8A 1SS6A 1V4TA 4I4BA 2IC3B 1TL4A 4KB1A 2NRHA 4P2MA 3KUGA 4AXJA 1XNRJ 3SUQA 4PRFA 4WWSA 1HNZJ 1VSJA 3G6EN 3MM8A 4AQYJ 3KLEA 2V94A 1Q86T 3GPAA 1R0CB 4ZVFA 2CPYA 1H1VA 3JYTA 2HPUA 3AVJA 4K8ZA 3Q0AA 4R25A 3IO1A 5M1PA 1C0MA 3HD1A 4AYBD 2W40A 3JS6A 4LF8K 1H2VZ 1RBOB 4MLEA 2RRBA 2XYGB 3DU5A 2XNQA 4M1KA 2HHHJ 5E41A 3PJWA 5AQJA 1RTZA 2YKNB 5DM6Q 5EHHA 5CYQA 2DHHA 5ETRA 4ES1A 3DDIA 2F8MA 2DITA 4OPAA 3K8WA 2E29A 1SQFA 2VFVA 2R42A 2G2ZA 5F8JA 3IBFB 1NNDA 4M95A 2HQDA 1OYEA 2AP1A 4EHUA 3WHIA 2OSQA 1CXUA 1H7XA 4DCJB 2ITMA 1JLCB 2A6AA 1NU0A 5AQZA 3OJSA 1N36K 2G0JA 3MK6A 3J7YI 3P1GA 4DTMA 4NLOA 2IRYA 3FNNA 4AXIA 4CH0S 4I6MA 3NCPA 2V4JA 3ZX0A 5DMRA 1FEHA 3OW2R 4LF8J 3MR6A 4FS2A 5IQ6A 2W4DA 4OHYA 2HBMA 3R7SB 3HI9A 1FKOA 2CQDA 4PYDA 3DRPB 4Q45A 4NYZA 3M9NB 2AF6A 2H65B 2M8HA 1T11A 1BD6A 1NLKL 4YEAA 2MXYA 4BDPA 2IIHA 1MWMA 5CA5A 3AARA 4IH7A 1LKZA 3EZUA 3KJNB 3CJKA 2XMMA 2RVJA 1HJRA 1EQYA 3BSOA 2EKNA 1N36J 4OVLA 1NKEA 1C0GA 3JSMA 4I6YA 4M5NA 4USUA 2YNHB 1YIJS 1NU4A 1PSDA 4KH0B 2V9WA 1S3XA 5B0EA 1FVQA 2CJQA 2M9KA 3PKYA 2OTLN 4JV5K 1KQFB 1RWVB 2I2YA 4TN2A 1IR1A 3MR7A 5HMXA 3WEEB 3GSIA 3HOSA 3G8SA 1GLAG 4F04B 4NLWA 4OI1A 3B6BA 5BJRA 1KSPA 1FKPA 3H5SA 3CETA 3AVCA 4LF4F 3DOKA 3LP1A 2GJIA 2WVBA 2ZD1A 1WTFA 3MCNA 5KGXA 2FTRA 3ZSOA 1BQMB 4I0WA 4TKTA 3I82A 3V6JA 3LWLA 3DKDA 2HFVA 1JQGA 1CJKA 3KK3A 2IVPA 2VPXB 2P5GA 1R27B 3W1YC 4NLPA 3C7NA 2UU9K 4Z4CA 1S1TA 3CC7N 4B8CA 4TVAB 1S10A 2VC1A 4BR2A 4JV5J 4BRDA 5LMNF 2BE2B 3WQPA 3AAWB 3UNYA 4R8UA 3T69A 3CJQA 3TANA 2RAQA 4ZHRB 4IDKB 4J9SA 1WAJA 1BHNA 3EO3A 4KO0B 5ETNA 3GOIA 1S6UA 3NS7B 4FBTA 2HMIB 3WC0A 2RH3A 4Q2LA 1CPZA 3ITHA 1XHXA 3UWTA 4DV1K 1ZZFA 2IFXA 5FROA 1IBMF 4LSNB 1PBAA 3H98A 2BJ1A 5KPTA 5JUMA 5IFMA 1RDCA 1CXQA 4RNMA 5ADZA 2UU9J 3OBWA 1Z4UA 3O9SA 2LA4A 1VMBA 5KFFA 2CRLA 1RDUA 1UAXA 1HWJA 2DHAA 1A0OB 2MB0B 2W24A 3D1QA 1QE1B 5E3CA 1SCJB 2XYPB 2JVOA 3Q24A 4F25A 1GTEA 2E5JA 5L1JA 2BUPA 4K4YA 1FFGB 4S0MA 1RGVA 3NGRA 4QR2A 2OPRB 4ZVHA 3DXKB 3MR3A 4DV1J 4CGGA 2ACMA 1QAYA 4DOZA 2A10A 5ITHA 1FFWB 4YQWA 1VSDA 4KGZB 4DR2F 3MDQA 3L2QA 5KFZA 2F8SA 3UPFA 1UA0A 2PBDA 5FPNA 2CPJA 5HRRA 4KI6A 3ULEB 2GHWA 3T1HF 3HZ6A 3CCMN 3MCSA 4E7KA 4HHJA 1O51A 1UZDA 1QVFR 3VAIA 4AD6A 4DR7F 4Y2AA 4O4GB 5HANA 2VG5B 2BQRA 4LF6F 1RAAB 2JLEA 2FLOA 3D0HE 2GIRA 3M32A 2MKHA 2QJ3A 3O1LA 2V9KA 3TQEA 1YVUA 1ZBSA 3HBTA 1NH8A 1RCHA 1OY8A 1VSKA 3GWCA 4W5TA 2GV1A 1VQ8N 4CEEA 2RRNA 1UTAA 5EXWA 3M2RA 2V67A 2HFSA 3PEHA 3EDRB 3HDSA 1RT4A 2ASJA 4WPAA 2XSJA 1QZ5A 1EHWA 4CTAA 2O8FA 2GBZA 3CIPA 2BKOA 4IKAA 4EP5A 3ZT4A 4ID5B 3AJ1A 4M8LA 2VJUA 3CSKA 1K8KB 2P9CA 3P31A 3DOMA 1X9MA 2KKHA 3THWB 3H1VX 2IRUA 3RAQA 1WF0A 2ZH9A 1FE4A 2VQFF 1S6QB 3OVBA 3CJCA 1E4FT 3CG7A 2D41A 2Q2RA 2FJAB 1N52B 2NRZA 1OIAA 1BG3A 3TJ8A 2C1EB 1RADB 3SBGA 4DV2K 4OQJA 1RU2A 3VQ6A 3N5BA 1GMWD 5C5JA 3OVNA 3LDSA 2V2QA 4NLVA 4E7JA 3L3CA 3OYJA 3UN3A 4B3OB 1RHJB 2O67A 4C3KA 4CO5A 2A1RA 4ZDNA 3PVXA 1VQPS 5L8RC 4DFPA 1Z6RA 2DKOB 3FCHA 3UDCA 4TY9A 4JK7A 2OCEA 3ETOA 2ZJRL 3WNHA 1J5EK 4F26A 1KQSM 1X8DA 1FDNA 1Q86O 3WT0A 1TZ0A 2RS2A 2WOMA 2VQEF 4J2DA 1NJIT 4JKFA 2MZQA 1HD0A 1HNIA 1ZAVA 4USKA 5F41A 2C2EA 1V3SA 3LDPA 1N56A 4PWDA 1JMTA 4DV2J 3DGPA 4CM2A 4DKWA 3S9HA 3OHRA 1NK6A 3GJSB 2RHQB 4RW6B 3FMWA 3JXUA 2KHDA 5CYJA 4DX7A 3SDEB 3TVKA 1RAIB 3NBPB 4MIBA 2CIMA 4MK8A 1RQ0A 3THXB 2DEJA 5A0YB 4KHPF 1VRQC 5B0CA 1IJJA 3VF4A 4LJMA 4ITSA 3CJBA 1FVSA 2CJBA 3MEDA 1I6JA 1R8PA 2ZJPL 4FSVA 2CJ9A 3O9QA 5AE2A 1A5VA 4OJ1A 2FF3B 4DPYA 1MROB 3LUYA 1RA6A 2ZNZA 2ZUAA 5DDPC 5LXRA 2JC0A 1EP4B 3OLBA 4ECUA 3ASMA 4FVMA 5KFDA 4J9RA 2VODA 2OKQA 4URSA 5C24B 1BA1A 3EXYA 1MU2A 2AWZA 1TKZB 2MKKA 2VA2A 2UUCK 4IKFA 3K0JA 4LF7F 3E01B 4I2QA 4R79A 9ATCB 4KHQA 3CE8A 5L1LA 4ER8A 3SQ2A 3O44A 1D8YA 4EYIB 4CZEA 1T05B 2CNKB 5EWGA 2O8BB 4FZVA 3H90A 3EN9A 4A8KA 4FM0A 3QNWB 3A8IA 3TSPA 4JV2A 3T5LA 3DYAB 3IKMA 4X4RA 4GKKF 4ED7A 1IH7A 4MK9A 1LOUA 1DBDA 2VF3A 5D0EA 1N5VA 5KT7A 2NCKL 1I39A 4WE1B 3OD2A 2FZGB 4KHNA 4OHWA 3G4SS 1C0FA 1ZBUA 4GKJK 3W5YA 3FBFA 4DCPB 4K0KF 2VHGA 3TI0A 1F9FA 4F0MA 1S22A 2UUCJ 1OJ4A 4YY3K 5HVGA 3Q2TC 5D3GB 1LWEB 2COLA 2DR7A 3CMQA 5KFOA 1RAHB 1RDBA 5AQVA 3IFRA 4DSLA 1VJWA 2FIUA 4B3MF 3EPGA 1HJOA 3ZTSA 4AHUA 3FCWA 4C8NA 3CERA 3MR2A 4CEFA 3BSAA 3QRPA 2RQ4A 3BKUA 4MMOA 4CJ3A 1KNZA 4MQ3A 5F9NA 2KT3A 3UO0A 4Y0FA 4GKJJ 5L39A 2DH9A 1UVJA 4E2FB 2CGJA 2A40A 1HIYA 4YY3J 3ICLA 1ELOA 4F67A 2VU5A 1F5BA 5DQHA 2A2CA 4HKQA 1FWLA 3MXHP 3E3XA 3FLCO 2G13A 4O8KA 2KJVA 4ZVSB 3J7ZT 1EKRA 2DPNA 3N4QA 1OPIA 3TO8A 4B3SJ 4QWDA 3C6TB 3TQ1A 4HI1A 2WVCA 1CSJA 2XMJA 1YJNN 5AQXA 2Z2LA 3F5TA 2A5XA 3LDLA 5KG7A 4NOHA 5CD4H 3M6WA 3EVMA 4H4MA 2HFUA 2D9PA 2HIYA 3OY9A 4C1NI 4RU9A 5AQUA 4KV8B 5KG6A 3BV8A 4CZHA 4HH0A 2NRVA 3HM8A 2P9LA 4L3KA 3J81U 5CYMA 3MEKA 2VFTA 3KMSA 3D4JA 2FSKA 3CMAN 4I7FA 4KHWA 4C2MA 1RWXB 1H6KX 4PWUA 2VDHA 3S3OA 2BX6A 3PX0A 2YV0X 2R8KA 2QM1A 2P9KA 3PSFA 1TTHB 2C2NA 1EX4A 4AL6A 2FVRA 2MJUA 4LQ3A 2YX1A 1N54B 1RSCA 3PO5A 3CMEN 1YJRA 5EVZA 2AIRB 1YG0A 5A6PA 3R5JB 1PYTA 2Z30B 4C8LA 2PGCA 2MLZA 1N0UA 2CZ9A 2VPZB 5KFCA 5KI6A 3IR6B 1WSGA 1V5VA 4CJQA 1L3VA 2XHBA 3N0VA 1WEYA 2DGSA 1GLCG 1X31C 4HTUA 5ETQA 3A5NC 3C95A 4XO0A 3E9LA 1VDHA 3R9PA 4WFAL 1UMJA 4FOIA 3BQ0A 2F9WA 2EG1A 5KFJA 4RLEA 3DRXA 3S3NA 4WFBL 2FSJA 3DRYA 4QCLA 4I68A 1UEKA 2AYGA 2ZNYA 2G2YA 4DV3F 3TAMA 1ZAWA 3CCJN 2FC0A 2W7AA 4RWXA 1KLMB 3CCSS 1J5OA 2XMTA 1DQ8A 4WK3A 4ZS6A 3MMAB 1S4EA 3RW7A 5GAHP 1WC0A 4CLFA 1FRHA 4Q5VA 5AE3A 2WW8A 4KGKA 3P96A 1S72S 5HK4A 4ELUA 2WBNA 2G2OA 3SZ2A 3EEQA 3GYGA 5IT9U 1VRUB 1Y5NB 4B9TA 4K4SA 3HSTB 3H42A 4ZN1A 2M52A 4IR1A 3GYNA 2AV5A 2WUSA 5DJBA 3QJJA 3AQPA 3KHYA 3JTNA 3W2VA 1KXPA 4DU4A 3GR1A 1WLJA 1FD8A 3TVYA 3KLIA 1NJIO 3HT3A 1WC3A 3HHLA 3D2EB 1LAVA 1M5KC 2YQ1A 1WN7A 1OY6A 1FESA 1Q7LB 1RT1B 1W9HA 4OHXA 4C8OA 5DM6L 3CF5Q 4RPFA 4FJ7A 2BJDA 3P6YC 4CZCA 1Y0HA 2ZITA 2IC3A 2OH2A 1N34K 4ZTFA 1NJWA 1NK5A 3P3DA 2ZH4A 3MAAA 4ED4A 4HVJA 3AODA 4FYWB 1U2FA 3C15B 2F96A 1NH7A 4P75A 4V19S 1TGOA 3NNHA 1EQ0A 1W26A 2EFOA 3C19A 4JI6K 4YMEA 5FPDA 1UFLA 3CC4S 3Q8PB 1U48A 3JXOA 2JJ4D 1Q18A 1RWUA 3DXSX 5HVFA 4QS8A 1VISA 1LK5A 1P90A 1KAYA 3QEPA 1ZS6A 4NYNA 4Q2MA 1N34J 2IAJB 2OSRA 2CADA 3ILIA 4RBVA 1QTMA 3HL8A 2OELA 3AVHA 3ILJA 1JLCA 4GC6A 2MMYA 2DRBA 3IC1A 4IQMA 3AA5X 2P9IA 5FIIA 4JI6J 4N56A 4ID8A 2H5IB 4C97A 4C8YA 3VA0A 4CI0B 3AVGA 2EWSA 1IKXB 1VOMA 2BJ7A 2VKZG 2D3O1 3VQ4A 5K5MA 2WSFC 3DRPA 2GHPA 2CQ2A 3CJ1A 1HBNB 3LP0B 4BR5A 3TZZA 4YOXA 3F44A 1Q5VA 4KH5A 8RUCA 1RGIA 1Q16B 1RTHA 5K8OA 5K14A 1SL1A 1QHTA 4KB0A 2HF3A 3NGIA 4JV0A 1MWQA 2VFSA 3AA3A 4P71A 2CG4A 2J76E 2YJFA 1IO2A 3NS5A 4DTNA 3ATVA 1YAGA 5M2RA 3LQVA 4Z4HA 4N8NA 1ZPWX 3FZKA 5KAKA 1YITS 2IM1A 3RMBA 4BRKA 4GV3A 2CXEA 3E51A 3MMCA 1KQGB 3CNQP 1OPZA 1X9WA 5D8HB 4O5BA 3KLHB 3V81B 2FB0A 2QV6A 1F2GA 5GINA 1YHQS 2E5IA 2MSTA 3O4WA 2KG0A 3NOGA 3DLGB 2DFFA 2AJ0A 1UPPA 3NP5A 1VRTB 1LXNA 5IM0B 2W7OA 4WCEQ 3J81Y 3SAGA 5FLXU 2BRKA 3AO5A 2Z2MA 3MEGB 3VQSA 3VQ5A 2UVWA 2OIHA 2LCWA 3TJAA 3L09A 1NSAA 1HYSA 3C16A 3I96A 1F3VA 5BR8F 1GH8A 2BANA 1GLJO 1VK3A 5GAGU 2KH9A 2M2BA 1BY9A 2DGXA 1PBUA 1BQMA 1U02A 2EPIA 3KUEA 2FYXA 4V1Ak 1WBDA 1HPZA 2P9NB 2X74A 3J7ZO 1YI2S 1QVGR 2FHKA 1XQSC 3A8KA 3NF6A 2RF2A 2ZC3A 1P6TA 3QFWA 4KKOB 3MN7A 3KIOA 2DK2A 2DNOA 5EX5A 4PG6A 4WBFA 5KT5A 3UVJB 1R8AA 2YX7A 4ECXA 1NEEA 1U6ZA 1EETA 2VONA 4ZHRA 1PG5B 4EI2A 1F5AA 2PO4A 4DDFA 2B56A 4JI5F 4KO0A 2L9NA 3CCTA 2DEIA 5L9NA 2PEBA 2YH0A 2I1RA 1FNXH 3PHEA 1SQGA 1YSJA 2HGNA 3V1QA 4TLQA 2KN4A 5KFYA 3THTA 2BACA 5KG2A 4ECSA 4B9NA 1FT8A 3H45C 2BABA 1GT8A 2KI2A 2I7NA 3QT6A 1U26A 4DHVA 3VCDA 4DV7F 3JSBA 4NWBA 2MQNA 4WKRA 4X66K 2Z2YB 3MGJA 2NPFA 1Z2ZA 5LOQA 1VQMS 4WP9A 5ETKA 4CVNE 1FJGF 2BM0A 2V50A 4BRQA 1EJ7L 4H0XB 5ADXH 3IAYA 2U2FA 2E6LA 1FA0A 3VF6A 1FRIA 1R0AB 2HHUA 2K06A 2O1PA 3JSRA 3DLHA 1Q79A 4H5TA 3O8WA 1E6YB 2ATLA 3NNAA 5L1KA 2OO4A 3BQ2A 2W4CA 4JEPA 4FWMA 5F8LA 1DEJA 2OPRA 3DXKA 4OPHA 3TR8A 3WBZA 1DARA 2HOEA 3AGRA 1URNA 2DNQA 4PEOA 2CZ4A 1KQSR 2JEIA 4NXNK 4ZPDA 3AVMA 1O8BA 5KFHA 4KRWA 3VGLA 1YJUA 4CGIA 3ULEA 2CDRB 4X66J 3L6QA 4J91A 3Q8YA 2OANA 4H4OB 1DKGD 4F2SA 3RMDA 1GLLO 4O4GA 2VG5A 2IDOA 1BL3A 3G2XA 3M8PB 2ZWPA 4CF2A 2OGUA 1JKHB 1NK0A 4HVZA 4H8KA 2B5JB 2I9SA 4AHSA 2NYIA 3GSDA 2VFRA 5IT9O 4IG0B 1TL3A 4E19A 4DQIA 1BUXA 4X64K 1WB9A 1S4FA 4XH1A 2D7SA 3AOBA 2V6AA 1DRZA 2Y8YA 2IMWP 1U2RA 2HQIA 5AQQA 4PCQA 1R8HA 1UVKA 1FJCA 4FJGA 1WELA 4NXNJ 2E1ZA 3K9KA 2QXFA 2HW3A 1U1RA 3WIVA 3QAUA 4JB8B 4ETXA 3IDHA 4HH1A 3A3OB 1N88A 4BS2A 2R7OA 4K2JA 5EUHA 1QJHA 2V34A 2MQPA 3BZQA 1HNXF 4HUEA 4ZK7M 1K8KA 5KPRA 4CESA 3QO9A 4CW7B 3I0RA 4PKDB 2GX8A 2KVQE 2FJVA 2BUNA 4H5WA 2YKMA 2QLBB 4HDGA 4LRDA 4CJEA 1RAGB 5G0RB 2ZH6A 1S97A 2D1CA 1VQKS 3OYGA 3EZOA 4X4OA 1UPMB 4UTGA 3CJTA 1JLGA 3R6GB 4Y65A 4OKJA 2N7YA 1X4CA 1WI6A 3I55S 1UEUA 1PC4A 2ZOGA 5A6WA 3NGKA 4C3MA 3VQPA 1H72C 5AQPA 3PYGA 4QR1A 1G7CB 5T7LA 1R8BA 4DQSA 4EIAA 2HS4A 2JLGA 3EY1A 3VAJA 3TZYA 1HD1A 4DTUA 1HKBA 2HFOA 2J8AA 4DI6A 2WSEC 4QIEA 4FLVA 3BSNA 4RU2A 2NRRA 4CYUA 5BN8A 4OYOA 4BVOA 1KD1O 3AO2A 1MWYA 3IGNA 4OZ2A 3DM2A 2DO4A 3OFGA 4X84A 2MQOA 3AT1B 4DQRA 3SPYA 4PG5A 2MKYA 4KAIA 4UY8T 2QI2A 3T6JA 1UJ4A 5M1NA 1AZSB 3TAGA 2E5LK 3TEGA 2VFUA 3OQ2A 4CIOA 4DU1A 3DRRB 3M6UA 4NYFA 3EYZA 5JICA 4PL8A 4O3RA 1RLCL 2KL8A 2I38A 1KS2A 3RW6A 4FJLA 4DV0K 4NZ7A 4KH1B 4QWEA 4RR5A 1SJ3P 3GIIA 1YF5L 4LF2A 1YXQA 1SI9A 2BW2A 1IUJA 3TZWA 4OYPA 2J7WA 1GLDG 1IV0A 3AA9A 2DHXA 2B4VA 5JLFA 3SJHA 4E7IA 5SZTA 1TUYA 1K44A 5DGBA 1EP4A 3LO3A 2CAJA 3VQEA 3QBXA 2DYAA 1K0VA 3JQJA 1J5EF 1CLQA 2E5LJ 1D9DA 3S1TA 5KFMA 1U1OA 4FNHA 1SVDA 4AHVA 3E01A 4ZVUB 1KC8T 5A8RB 3V9XA 5I3UB 2IVYA 1JCFA 3PCOB 3VV2B 4DV0J 1P27B 1RBRA 2P1JA 3VENA 5A8KB 2I5JB 3VEVA 1T05A 3ENWA 2GQ2A 2FBYA 5FLXO 2O8BA 3THPA 3D1OA 3KK1B 4KR0B 4L76A 4MJKA 3DYAA 3KJQB 4OL8A 5KRTA 3DLKB 1NPPA 2GIFA 1IBLK 4AT1B 2UXDF 4BR9A 4LSLB 2ZBPA 4WE1A 3TARA 2DGUA 4C9DA 3FFIA 3KDOA 4DL0C 1Y3JA 1X5PA 1NMDA 3NMUA 3BDEA 3GV5B 4BRIA 2Q0RA 4X62J 3AY9A 3HFZB 1TKXA 2XC9A 4PY5A 1LWFA 3DGVA 3NH1A 2OEMA 3R3TA 2QWQA 3WXMB 3PFEA 4PABA 1ESVA 2KDOA 2AJ2A 1GXUA 1JLBA 1B7YB 1TL1B 4I2PB 3JSYA 2RB7A 3HT0A 1JLAA 4B9VA 1RK8A 2QA2A 1CZBA 4CIFA 1IBLJ 2J5AA 3VWSA 4XPEA 2E7WA 2ZDOA 1C1AA 3D6RA 4IO8A 2HVDA 3TTDA 4I56A 3UD4P 1XTZA 3U1MA 5HP1B 2XZWA 3HXMA 3B78A 4RZRA 1DHMA 2GHVC 2XO6A 2EEYA 3GQCA 1B9FA 2NSCA 2VPYB 2F4FA 3CCWA 2V4QA 3O6QA 3ZX3A 5D4OA 1X5OA 1MSWD 2BYCA 4B3TF 2HVIA 3R5DA 3CC4N 3QIDA 4U7BA 1NKBA 4DUYK 3O1WA 2H4WB 1S49A 3D2WA 1S1UA 3T5HA 2ZBIA 3D3CJ 3CCVS 1F6TA 3VAGA 1VQSA 3C6TA 1LFPA 4DL6A 5E5NA 2GQCA 1NMEB 4W5NA 4NCGB 1M0SA 1SH2A 2LEPA 3GB0A 2YWWA 4Y28C 5EWEA 3D6TB 2OJ3A 1J53A 4LR8A 4OYWA 1DFDA 1P9YA 1PYSB 1HI8A 2DH7A 2EFQA 2R8HA 4BRPA 1NK7A 1RTJB 1JJHA 5DZ6A 4KV8A 4DUZF 1P1TA 5AXLA 5L1IA 5AQFA 4DUYJ 1S76D 2EXUA 2LSNA 5F0WA 1TYQB 4B1WB 3RB4A 4LF5F 2DNLA 4A61A 1U0HB 2X3DA 1X4HA 4OZLA 3E1YA 4OYMA 3MM7B 2I7PA 4F4AA 1ATRA 3QSIA 4DX8H 3QFHA 4UQTA 1RT3A 3TJ9A 4HTLA 4E7HA 3GONA 5DETA 1FF2A 2J0QD 4PXBA 3HSJA 1LW2A 2YJEA 2AW0A 3CIMA 1YTYA 1DTQA 5AT1B 2UP1A 3SUPA 3C14B 3HM9A 4Q8FA 1WOSA 2H4YB 4Y00A 4DL7A 1HYZA 2EVZA 3Q7BA 4U96A 3FSIA 3G87A 4DPUA 1IKYB 4K4ZA 5CY4A 1S6PB 4DXLA 5DRKA 1WOPA 1SZ2A 4OGCA 3SBTA 2HFZA 2QL5B 2XO7A 4B02A 2GV9A 2BXJA 1C0TB 2ABYA 4CJFA 2QG9B 3UDEA 2Z4PA 4JI3F 3BY5A 3VAKA 3OYNA 2FVCA 4WFXA 3RB0A 2NRXA 1Q53A 3NKYA 3NVKA 4IRKA 3U6FA 5KGWA 1I5OB 3FSYA 5EX0A 4K42A 1RHRB 1M1KT 1JCEA 5A2QU 4BRLA 1GLFO 4DTPA 4FLYA 4FLUA 1IG9A 2F9JA 4Q0BA 2LLZA 2OMOA 3BYPA 1X5TA 2GAGC 3U4LA 2C22A 4MLHA 3LGMA 4CQ1A 3CC2N 3AD9C 2VA3A 2PIIA 3C6UA 5LJVA 4CFAA 1KLMA 1N6QA 2HSEB 4BE0A 2PMZD 4RBUA 3QIPA 1DJ0A 3CF5L 4H4KA 3R7NB 1ZZNA 5F8HA 5AZIA 3RRGA 2I0XA 4EU0A 2NPIA 3O5BA 1IR0A 2FHJD 1WC1A 4DHYA 1VQ7S 4UOHA 1TL7A 2OLWA 3LA0A 4WZMA 3T19A 2P9PA 3KHLA 2NZ4A 3RB3A 2X1FA 3CPEA 3R97A 5CZ2A 4MYTA 4A47A 1S7IA 3F0NA 1WDDA 2GA7A 1W7WA 3KNAA 4DTOA 1N8RO 2ZH5A 1I51B 5B09A 1XIQA 3CPWM 3D2EA 2R7UA 2CGLA 1DY3A 3PRDA 2CPHA 4OO1J 1MN7A 3OR1B 4YR2A 1FTCA 3WUHA 1RT1A 2EFPA 3HOTA 4JKHA 1WC6A 2C2OB 3D45A 3M5RA 4UY8O 3TX8A 4P6QA 3SAFA 1N4LA 1DLOA 2KFNA 4ID1A 4P73A 3QT8A 2B3TB 2ETJA 4FYXB 3BS9A 2F4VF 4BRCA 5KQDA 1FRKA 3BGRA 2VJVA 2EC0A 1CEZA 3D67A 4GNIA 4C8MA 3ENAA 1SXLA 5HBMB 3SSQA 1PC5A 2XBPA 5GMEA 5KOWA 1LV5A 3OS1A 3VA3A 4OLOA 4BC2A 1IKVA 3CD6S 4ERDA 5AQTA 3P5JA 4F2RA 5D0GA 3KG4A 3PJXA 2MDAA 2UUBK 3CJ9A 4LQ9A 1KVCA 3QWPA 1XERA 3KKFA 3VQ7A 5BPNA 2Y1RI 2FJXA 3S41A 5H1SQ 2HQCA 2ASLA 4ECQA 2IJFA 3AHPA 3FDSA 3OPKA 3OXFA 1HR0F 1XR6A 4N8OA 3Q8QB 3PHTA 1Z1ZA 2DPJA 1TVRA 2IAJA 4K4VA 1Z2LA 1OH7A 3CM5A 1VC0A 3CCQN 4F02A 1RAFB 5KG1A 4J9MA 4IG3B 3PUFA 1BQXA 2EHGA 3POTB 5KFAA 3M3ZA 3Q8UA 5KG4A 2W9AA 4NRTA 3B6OA 2FVQA 4DV6F 1WSHA 2UUBJ 4IH6A 1S1VA 3G9CA 1IKXA 3FRZA 3D5MA 4GVMA 3BH7B 5GAEU 1E3MA 3W3DA 3PTWA 1X5SA 1T95A 4M3XA 2XTJP 3NNCA 3U8XA 4WCEL 1LAWA 3D28A 2OI2A 5KFNA 5BYSA 1M5OC 2GJ2A 2CQPA 2XGQA 4JI1K 3HHLC 5B0AA 2RIJA 2KTQA 2LXIA 1IBKK 2ALYB 5KTQA 4U7UK 3ISNC 2BRLA 2HSTA 1HKAA 1XR5A 4YHHK 2QXLA 3T41A 3HHEA 4LRFA 4B9LA 1HQEB 1ITGA 1FTRA 3RSEB 1ZAXA 3QJPA 4NCBA 2B4JA 4LRAA 2GIQA 2GJFA 2L9DA 1RAOA 3E2EA 5CH7B 5GAHI 2VASA 1LNQA 3CHWA 5JMNA 3RVCA 3IR5B 1YJ9N 3P49B 3F2KA 1XMOK 5IM0A 4Z37A 3RBXA 2RD5C 3M8QB 3LAKA 3OBIA 4DCOB 3DFEA 2Y0BB 4CZLA 3BGFA 4JI1J 4ECWA 3PX4A 3ZX2A 3DRSB 1TMJA 1KP6A 1IBKJ 2D0CA 1OYDA 1ASVA 2HMPA 4CIGA 1VQLN 3K5OA 1X4AA 3VGUA 4YHHJ 1X1PA 3W64A 3VQQA 3N6NA 5ETVA 2DGTA 1C1CA 2VG6A 3O4NA 2P9NA 1F9EB 3CULA 2XGPA 4PR6A 4DX5A 2UVUA 2E1CA 3KG0A 4KKOA 2Z0GA 2O3DA 3QSYB 2CWKA 1IKWA 4Q43A 4ANDA 4FM1A 3CCRN 1BXNA 5FPMA 1XMOJ 2KZZA 5F8MA 2IPOB 2QKKA 2LQJA 4GC7A 2HAIA 3UD5A 1C0UB 3S01A 1BQNB 4LBPA 2HHXA 1HBMA 2DH8A 2HB5A 2IDLA 2YCHA 3OLAA 1R43A 2CH6A 3M9MB 1NPRA 1WWHA 1CQNA 3SCKE 4KHYA 3CCZA 3AAQA 2KT5A 4OI0A 1W97L 2GW8A 1HQUA 3AA4A 3OR2A 4JS4A 5GADU 5AJ3K 2V68A 3B8HA 5GAEI 4FJMA 4RO0A 1WHVA 1RNHA 2WVEA 4PAAA 2RQMA 3MTKA 4K5RA 1JX4A 4M45A 2VG7A 1DQAA 4HCCA 1DZ5A 2MSSA 2XSFA 2E2OA 3IRXB 5C10A 1R0AA 4PA1A 3P45B 3VQTA 3K5NA 3QNNA 4ZPVR 5I3PA 3CCUS 4MDBA 4OGEA 3OTOK 1CJTB 1S5ZA 5B0BA 3M2VA 1QQNA 4JI4K 3D66A 4Y1CA 3NLCA 3DOLB 4FVCA 2GNKA 5AJ3J 3MECA 4RW9A 5M1KA 1RE1B 1RT7B 2ZBQA 5T7BA 2C2MB 3VEWA 4LSZB 1ZM2A 1TV6B 3CT9A 5HI7A 2K3IA 3L2UA 2JEJA 3TP2A 4F3QA 1YUWA 1YKWA 1M1KO 1T9WA 3M6VA 2FZCB 3UIQA 2DRAA 2P9UB 2ZM6K 4RW8B 4KHMA 4IG0A 1WNSA 1NB2A 4FW2A 4OLAA 2FF6A 5EX3A 2ADCA 3OTOJ 3R1HA 4CD3A 4DQQA 4A57A 3LOUA 2VH7A 5D4PA 3D68A 3HMJG 4MH8A 2E2PA 4GV9A 3V6DB 1VQ6N 3AGKA 3IMQJ 1HWLA 4OKEA 3OYIA 2FY1A 3KFWX 3CDEA 4DV4F 2ATQA 2DVIA 2KYXA 2R7YA 4J9QA 4K2XA 5E0OA 2CQHA 3FJ2A 4JI7F 4JS5A 3MM5B 2E1MC 3NMAA 4MKBA 4NXMK 1I94K 3GJQB 1CJVB 5HJXA 3KWGA 3HZGA 3T6BA 1WC4A 4KJIA 2ZM6J 4N5SA 2Q97A 1CBKA 5LSLA 5J1PA 4CH7A 2C28A 1K1QA 3A1YG 2V4RA 3THYB 4B17A 5DGAA 2ZZNA 2UXBF 3VQCA 2UXCF 1ATNA 1Y7PA 3AJDA 4CRJA 1U7LA 2Y1LB 1PYOB 3GFZA 4HDHA 1PAEX 4YOUA 4X64F 1HNWF 2HZVA 4MKVA 4NXMJ 1I94J 1Q81O 4CLSA 3ID8A 1N5TA 1G1XA 2CQGA 4DU3A 1KLNA 3CTRA 5AXMA 2KJWA 1PKUA 3QGHA 1TUWA 1QUVA 2XULA 3W62A 3HPHA 2ZH8A 2BQ3A 4QS9A 4U67Q 2VGNA 3I87A 3DI6A 1FI4A 4C11B 3KLGA 2LECA 5AQRA 5IZHA 1WBBA 2QFJA 2YNGA 1T94A 3OL7A 2J4RA 1RBSA 4M5HA 3T1YK 1IQTA 1PO6A 2FVPA 3W5XA 3Q8VA 4EBCA 2VBZA 3ZT1A 2BDPA 2V8VA 1LW0B 4CCHA 2XLIA 4X65K 1KAZA 4WZQA 4TY8B 1XWLA 3PM9A 3C46A 5BPLA 1GNKA 5TKYA 3O9UA 3IUCA 3MXIA 4MO5A 4Q7AA 3EXCX 1NGDA 2VBWA 1NUEA 1HYVA 2ASDA 4J2BA 3AA8A 4FWQA 1R8CA 4FVUA 2O8CB 3ETMA 4IO9Q 3ULHA 4QOTA 3ZSZA 2GC8A 2J6UA 2AMCB 3KVGA 1L5UA 4CHNA 4JI0K 1E6VA 3U7JA 2QT7A 1NRKA 3W5ZA 3T1YJ 2Z58B 3SAHA 1OO0B 4FXWA 1AXQA 2V7ZA 1FRXA 1UA1A 3HVTB 1P8GA 3DXMB 2I6WA 3CGIA 2W2QP 3V9UA 2ACYA 4NA1A 4QWCA 3H40A 4QBUA 1J9AA 5KFBA 4RW4B 1YRUA 2HLTA 2GFFA 3F41A 4X65J 2NR0A 3A5OC 1VHXA 4FJIA 2RDDA 5HMWA 2EFGA 5IXUA 2GX9A 3N79A 4FK4A 5C2CA 3CCES 2N4CA 2OUGA 2GWKA 4ZP6A 1BLUA 5C25B 3IP0A 1A5XA 4O3PA 4OYIA 4H0OA 1YJ7A 3BBFA 5SUHA 3DLKA 1NSPA 3O4QA 1UVNA 3HJVA 4O3QA 4DLEA 5LL6Z 3L2VA 1HFEL 4LSLA 1B3TA 2Q31A 4OX9J 1I3AA 1YTAA 4JI0J 3V2UC 1XMQK 1DTTA 3FEZA 3O3LA 2J0XA 1SKRA 2PFFB 1UFWA 2PY5A 3QWUA 2YNFB 1ILYA 3VEZA 1HNVB 4XEIA 3BH6B 1AFIA 3P4IA 3UCGA 1TUUA 5AQSA 2RUGA 3ZT3A 3KYLA 2AA4A 1HARA 2WVFA 4TQSA 4JD2B 2K2PA 4Y6IA 1Q9XA 4WYBA 3UR0A 2XB2D 2P9GA 2AJ4A 5I9EB 3M6XA 2OZMA 4G1IA 3C3LA 1MA9B 1YX2A 3A8JA 2FHMA 5KFVA 4L74A 3A13A 2KHCA 2GVDB 2GTDA 1HQ2A 4EK2A 1TL5A 1Q95G 1XMQJ 4H54A 4UZCA 2IM2A 1HBOA 2YVSA 4FYYB 4NA3A 1N32F 4YB7A 1RTDA 2G4BA 3N4WA 3H5XA 2DNZA 2IVOA 1U4BA 3EJMA 2QA4N 1RDDA 3CW2C 1VQOS 5DDRC 1FNOA 2XMUA 3A4TA 1IBLF 4NMLA 5LXYA 2A2DA 3O9RA 1K9MT 2IBKA 3MZIA 2DFEA 4OLBA 3JTOA 4WP8A 4ZVTB 1FRLA 2HWIA 3BKFA 4KSEB 3D2FB 2MLXA 2OPPA 2Z1GA 2E20A 1S12A 1OY9A 3CXCM 3CD5A 3NF7A 3OSPA 4E7LA 3K8VA 2H9ZA 5J1EA 1N5YA 4DR6F 4AE5A 5CAAA 3R2CJ 2WC9A 2BTFA 2XEXA 4OPJA 4ZVGA 2B4UA 3UKRA 1QSYA 2PE8A 2W1BA 5LMUK 4WQ4A 1EWQA 1OSCA 1S6OA 3AO3A 1FRMA 1SIZA 1CULB 4USJC 5ETOA 4EMDA 3HF5A 3QRRA 3MCMA 4KY3A 5GIPA 2XZDB 1GFWB 3V4IA 4IYQA 2C3YA 5AQNA 2AJ1A 1AW0A 1U0HA 4LFCF 3AJ2A 3WXJA 2F8TA 3MM7A 5AFUA 3GG0A 2QA1A 3PDNA 3CPWR 3ELHA 1NGFA 1SV5B 1H2TZ 2HK3A 3ZT2A 3L9ZA 4CHZA 4M5DB 3BYRA 4J9NA 5LMUJ 5MAOA 1WG5A 5D77A 2LEAA 4CJLA 2RKIB 3G6VA 1S9GB 5U47A 1FWPA 3QGPA 2G8FA 3BKTA 4K43A 1JLQA 1JXEA 1QAXA 3FSXA 1IKYA 2R8GA 1S6PA 2ZHOA 2QEXS 3KK2B 3C0BA 3D6MB 3VGSA 4USVA 1VCTA 2XWYA 2DR6A 3H1QA 4AQYK 2D0OA 4WFBQ 2ZE2A 3WQTA 3HFKA 4MIWA 4NLSA 1TP7A 2XS7A 4CLYA 4LRBA 2BMBA 2C2RA 3HTVA 4FZXC 2PN6A 2DNKA 3CO0P 4JRQA 1RBTA 1XC3A 2CA9A 4FN5A 2IVNA 3SV3A 2J9DA 3W61A 1O13A 3NGDA 3KHGA 1ZA2B 4FS1A 2OPQB 4K4WA 3V1RA 1LK7A 2EFNA 4DR1K 2CJKA 1C6VA 4FWRA 2VBYA 2XMWA 2BOPA 2EKYA 1R59O 4MK7A 3I4HX 5M2PA 4JHDB 1MNEA 3ZEUB 2OD4A 4M5IA 2GMJA 4HR2A 1U2CA 4WK1A 2ZH7A 3LTOA 3MWTA 4D3HA 2EBEA 4O8UA 3T7ZA 4CT8A 1C1BB 4BROA 4LF1A 4DFMA 3H8YA 2R4FA 1KFSA 5IC6B 3S7RA 5E7OB 3CDWA 3NRBA 1ZH5A 4UZBA 4LFAK 1CLFA 5K8PA 4EO8A 4YP3A 2V69A 3P5TL 4LF9F 3UKUB 1WOOA 4DR1J 2DGVA 4LD0A 3G82B 5FDLB 2HIQA 4YOVA 3CJ0A 3FBBA 4A5AA 5M1FA 5CQGA 2NXEA 4KT0C 4A2BA 8ATCB 3MI7X 3EWGA 1ULRA 5BYRA 2HNYA 1SKWA 3AXMA 1YGYA 4OPKA 2Z1HA 2QYCA 3IS9B 1SAZA 2XWXA 5I4MA 5MLCQ 2GMHA 3WNFA 4L73A 2Z1JA 3I9ZA 4LFAJ 2E6MA 3QMLA 2O66A 2Q6CA 3EGWB 1AT1B 2CPFA 3DNCA 1YJWN 4YORA 4IFYA 4BRHA 3OS2A 2B6AB 4YOWA 2DNHA 3NCQA 4NI2B 1B7FA 5D4LA 2AEFA 1JXBA 2DR8A 3KD5E 2XY8A 1SKSA 3FBCA 3PIOL 1NCLA 2XNRA 4A8QA 2VDIA 5C42A 1RFQA 3PACA 2X1GA 1EKEA 4BLGA 3DLRA 4IOAL 4FK2A 5GAGP 3K89A 3TA0A 4IQXA 5IWAF 3QLHA 3HSDA 2DXFA 4DFKA 4B3RF 2HQ3A 3CEDA 3JB9k 2DHSA 5H1SV 4PWWA 3NVMA 1YK9A 5F0XA 1W2BM 4DS4A 1RACB 3GZ7A 4A46A 3MM8B 2XI2A 4N77A 3KLEB 4F4KA 4H4KC 1RDWX 3H2VE 1DT9A 2GUPA 1ZETA 3LP2B 2AX0A 1VBKA 3JYTB 5EWFA 5F3TA 4P9SA 3VAMA 4Y1DA 1X4BA 5C12A 3GE9A 3AH6A 5HLFB 5KFGA 4USIA 4DL5A 3O9TA 2QL7B 2R7VA 1D09B 3I56N 3CCLS 3C94A 4WYWA 3TA2A 2IRXA 1Q7YT 3GBTA 2XHCA 1RUSA 4JI8F 3S8SA 5AE1A 2MYFA 4OIXA 3SCLE 4K50A 2F40A 1G4CA 3R5AA 1RWKB 1GLEG 3KLFB 5LY3A 3O8MA 1U45A 2YHYA 2DGQA 1HMVA 1RU1A 4PYAA 2YXLA 2ZGZA 1D9AA 3G25A 5JMVA 4I64A 2DY1A 1VQNN 1WKKA 3IM8A 4CHOA 2YI1A 2CQ0A 2O4GA 4UOCA 1UJ5A 2ZF5O 3QDKA 2OTJS 1QZ6A 1F9HA 1H3DA 1LWCB 4K7QA 1WSVA 4ELVA 4XPCA 4AL5A 4ZCKA 3FGVA 3PIPQ 2DNPA 1KONA 5E3QA 3DRSA 2W8KA 2YX6A 2CPEA 3L0QA 4KH4A 5LMNK 5E33A 3UQSA 2W8LA 2KVIA 1M5HA 2W4PA 1BOTO 1K9MO 2O4IA 4PQUB 2X7IA 1K8AT 4YFUA 4ZP7A 1O1WA 3JSMB 4WP3A 2QSFA 3T5JA 1SIWB 1RT5A 4CNYA 4CBUA 2IIRA 3IBWA 4CLZA 3TNVA 3ZZTA 3I5BA 1TK8A 4LF4J 3GV8B 3L4BC 4DCHA 1FO1A 4NLYA 2B0GA 4CJPA 1XBWA 3H5YA 4GMKA 4O23A 2J6SA 4ED8A 4GVBA 3NF8A 5M1OA 2LVWA 1NHKL 4F50A 4JNEA 1VQ9N 2K7KA 1R6YA 1SL0A 1KRPA 3TVZA 1C0UA 3J80O 2NUHA 1NK4A 1FKPB 1D4XA 1MMDA 4ALZA 1UW4A 5LMNJ 3LP1B 4M5MA 1T03B 4QR0A 2W25A 5H9EK 4CLWA 2AYMA 3EX7B 3HI0A 5CE3A 1XUPO 3FKBA 2XLKA 3KK3B 1NNEA 1QQOA 1TFYA 3C7NB 3N5FA 4OZNA 4G65A 2LEBA 1S1TB 3QNOA 2ILZA 1L3KA 2QKBA 1QVGM 1X9SA 2GEMA 2YNIA 4CD1A 2HWTA 1S79A 3OYCA 2M70A 4DR2K 2V2ZA 1VQ4N 1JJ2M 2P8IA 4KFBB 4J5OA 4M5LA 3T9ZA 3JAMU 1LWXA 4PUOB 4B9QA 4DU8A 3VQDA 2DD8S 3T1HK 3MUTP 3RWUA 4A62A 3QEIA 3OSNA 3OA9A 3L7OA 3ITHB 4DR7K 5KG0A 1ASUA 5J2QA 4IFVA 4CE9A 2VB6A 4GVEA 4JK9A 2EFVA 5KT3A 4DR3F 1AB8A 3IMXA 4J8FA 4LF6K 5KFIA 5H9EJ 2V2VA 1R3NA 1RAJA 3B82A 1WEZA 3MMVA 3SUNA 4K25A 2UUAF 1HBUB 1VLYA 1REVA 5JVGQ 3K2PA 5HJYA 1VQ5S 4HACA 2D1KA 3TTFA 2YKOA 2OFGX 4Z4GA 4NPOA 4Y3CA 2J9EA 4W5OA 1VGYA 5B0FA 3BR9A 1RT7A 4CLUA 5FRMA 1CQMA 4BDYA 4HUGA 4WU2A 1BI4A 5LT5A 2DY4A 1TV6A 2HVZA 4FP9A 4DR2J 4ECZA 4OMFG 1IWGA 2EK1A 4X4UA 3GU0A 3WNGA 1MG7A 1WI8A 5CZVA 4FLTA 3T1HJ 3O2IA 2P9UA 3GMGA 3Q8SB 4ZPTR 2PD1A 4KQZA 3W9IA 4RW8A 3KG1A 4E3SA 4TNOA 3G6ES 1U1MA 4DR7J 4RWTA 2HEKA 4MT1A 1Q0NA 2FXUA 4LF6J 3BJYA 3OUYA 4KH6A 3C2PA 3P4UB 4QW8A 1M90T 3L7UA 4WF9L 2VQFK 1YQHA 1VBYA 2RHKA 4HHHA 3KZBA 3M8RA 3E66A 3OVAA 3HPOA 4K8XA 1F2HA 3R5CA 2GGPB 4BBYA 4BE2A 4ILHA 4NLCA 4OFZA 2HGMA 2C3PA 5IT0A 1OKJA 1OQ3A 4CLKA 1CJVA 4JI4F 3CVKA 3THVA 3M32B 1OS5A 2IA0A 1VAZA 3L4IA 2EBGA 2QIFA 3AVLA 5DLGA 4U67L 5DG7A 3I0SB 3M2RB 2IYIA 3H2UB 4JYAF 1N33F 2CWXA 3KTQA 3MTJA 2PMHA 2VQFJ 2VQEK 4RCHA 3O6WA 2CJYB 2HGLA 1RT4B 1S99A 2XSJB 4CTAB 2O8FB 2PI5A 4OZJA 3HK2A 1VC5A 2MZTA 1Q82T 3DOMB 2A3JA 3IBCB 1VSHA 3G71N 4DG1B 3MCPA 3SV4A 4E1JA 2FJEB 4P52A 2V8PA 2B9WA 2CQIA 4KHPK 4FPAA 1RWNB 1K0TA 1WNEA 2IDEA 4OHZA 4A48A 2QWNA 4WIQA 4FXDA 1XJWB 1QAJA 4JI2F 4ILGB 3M30A 4IO9L 3PYFA 4NB4A 4C11A 5DQIA 2KFYA 2E7VA 3AVIA 2PMWA 4LH4A 4DSFA 5KPZA 2DGOA 3ZC4A 2VQEJ 2LXUA 1WSFA 5BRFA 4FPRA 1UKUA 4NLUA 2RQCA 4O0NA 1HLWA 4CLLA 5IS2A 4KPYA 1GOBA 1DAXA 1VK8A 3BN7A 4K8RA 4EO6A 1N0VC 1ICEB 2Q0UA 4FJKA 1RB0A 2WRMA 1WHXA 2RU3A 3BBBA 4HHTA 3AY0A 4KHPJ 3I8DA 2WOMB 4LF7K 4BWJA 2G1HA 4FL9A 5FPEA 1JNRB 4R5PA 3VESA 3UR3C 1C4AA 1N48A 3ET6A 5DS7A 2O8CA 1VSLA 4G1QB 1NZAA 2FZKB 4QQBA 2VBXA 2HHSA 3AO4A 4M7XA 2HNDB 3K5LA 2NUBA 5RUBA 2KT2A 2BE9B 3W2WA 2LU2A 1HX1A 4A5BA 1Q7YO 2LA6A 2LU1A 3BR8A 2WBRA 4ZLNA 2V51B 4CF1A 3NXZA 3MEDB 4DR4F 3CXCR 1HPMA 4B3SK 2DB1A 3C66A 1OVQA 3NGZA 3G96A 2YWGA 2ROPA 4RW4A 1XNQF 3L8BA 1RP5A 2YWKA 4K0KK 4Z0UA 2QSWA 4CJ7A 2DISA 2IBOA 4LF7J 1BMQB 2W9BA 4N76A 2GWJA 3M2UB 3VHQA 4QZVB 3OYMA 2VV5A 3KWMA 2YQ3A 2DFHA 3NGYA 1K47A 3MOJB 1X3MA 3OYFA 2JX2A 3RG6A 3BBCA 2ROGA 4B3MK 5K9FA 1ZTWA 2YNFA 1UEVA 1HNVA 3FZ2A 4PXCA 2RHSB 4ZPBA 3RGIA 3ZT0A 2R9LA 4ILMA 3X3UA 4CK3A 1NXIA 3TX0A 1NGEA 1VJQA 1WF2A 4M3UA 1WG1A 3C8YA 2GELA 2NXJA 1FK9A 1QS4A 4K0KJ 1KOOA 2ITGA 3H4DA 3MEEA 1K8AO 4CJKA 3JAMY 5D0RA 3W60A 2RE1A 3ZTQA 4G3IA 2K1RA 1TKTA 2CNNB 3DMJA 3A12A 2MQ8A 4ANCA 2GVDA 3LW5C 3Q86A 3BSCA 2KU7A 3FZFA 1B0VA 3UW1A 4B3MJ 1EZZB 4BACA 1CJUA 4LBHA 3CCMS 2V8HA 2UVVA 1F3FA 4OI2A 3E9PA 3QRQA 3OVSA 3J7AP 4O44A 3OHAA 1S0VA 1OVYA 1FX4A 1AUDA 4FWKA 1QD1A 3CJ8A 4KHUA 4H0TB 3CQXA 3QZ7A 1EKSA 2D3UA 2CPZA 1FJ7A 2NYHA 4F3OA 2OFHX 2QLXA 1BO5O 2ZVIA 1VQ8S 3K7RA 4B1VA 1JNZB 4XK8C 3K5MA 2ZQBA 1VS3A 1NZ8A 5CHIA 4JKCA 3MPWA