4IFVA

Detecting allosteric sites of hiv-1 reverse transcriptase by x-ray crystallographic fragment screening
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
556
structure length
556
Chain Sequence
b'MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Exoribonuclease H, p66 RT
publication title Detecting Allosteric Sites of HIV-1 Reverse Transcriptase by X-ray Crystallographic Fragment Screening.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase/transferase inhibitor
total genus 167
structure length 556
sequence length 556
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4ifvA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ifvA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ifvA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ifvA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ifvA05
2KW4A 4Z0UA 3L8BA 2HHXA 1HPZB 1KLMB 2FLLA 3CIZA 3PVXA 4O55A 2B5JA 3AVJA 1RT7B 1GOBA 1JLFB 4ED2A 3ZSOA 2HMIB 3PJWA 2W42A 3LP0A 1S1VB 5F8JA 3V9WA 1S1UB 1CLQA 5DK5A 3DLHA 2R2UA 3OY9A 1X9WA 4RU9A 1BCOA 1HMVA 3KD5E 3AO1A 4FJKA 3TAMB 4IH6A 1FKOB 3TAGA 3U6FA 1X9SA 3VQCA 1HYZA 2RDJA 4C8LA 3IG1A 3KLHA 3G6XA 3K57A 4NLWA 2B43A 4B3OB 5KFKA 3JYTA 1KHWA 4O3QA 4CHZA 4DFJA 3OYBA 3PO5A 4ECTA 1JLEA 3DI6A 3ZT2A 2OYQA 4RW9A 5HP1B 4URQU 4JV2A 4AHCA 1LWCA 4YR0A 2XGPA 3BQ0A 4DWIA 3H5YA 3DDKA 2HW3A 1D0EA 3T3FA 3V9SA 2GUIA 3TAPA 3GV5B 5D3GA 5KI6A 5KFNA 2E4LA 5JUMA 1NNDA 3QO9B 2YKNB 3FQKA 4DTOA 5J2MB 4NLQA 3TAQA 4EYIB 3K58A 1L3TA 3KLVA 4N47A 1FKPB 1C1CB 4MK9A 4XO0A 5SZTA 4ZHRB 3FFIA 5HLFA 3SNNA 4KTQA 1VSEA 4GVMA 4U6PA 1JL2A 1W9HA 3VQDA 1BIUA 3OYLA 5DQIA 3C94A 2P5OA 3RMAA 1XR6A 1BQMB 3SV4A 1LW0A 2XI3A 3HVAA 2GC8A 4O44A 4OGEA 3H08A 2RF2A 1S6QA 3LWMA 3C6TA 3T5JA 3DOLB 3LALA 5KRTA 4HUEA 1QAIA 3MAQA 4RW6B 4FZYA 2UVVA 4W5QA 3KK3B 2KFNA 3V6JA 2B6AB 4NLSA 4E1MA 3DRPB 2I5JB 4FLXA 4NLXA 4K50A 2ASDA 3Q8SB 4RUCA 2BQRA 3M8RA 2BR0A 2XI2A 1C0UB 1S9GA 4W5TA 3I5BA 2FBXA 3PHEA 1XC9A 4EZ6A 3CJ4A 1REVA 2AGPA 2YNIA 2IAJA 4CGGA 3KOAA 2XWYA 4CJFA 4OLBA 4JLHA 1KRPA 3VQEA 4TYAA 1Q9XA 1C0TB 5KFXA 4Q0BA 3VQ7A 3CJ5A 3HVTB 4F3TA 3V4IA 1LV5A 4LSLA 4G1QA 4WE1A 1VSLA 4CHPA 3FDSA 1QUVA 4CEFA 4CGDA 4ECRA 3VQQA 5KT2A 5DQHA 1UWBB 4NCBA 1ZBFA 2IM0A 1U45A 3SUQA 1IG9A 3AA3A 3LDSA 2R2SA 1S1TA 5FROA 3TWHA 3O4NA 5HRNA 1KCFA 3SQ2A 3QETA 4N76A 2JC0A 1T03A 4ZTFA 4CGIA 2ALZA 4CF9A 3MEGA 4URGA 4IOBA 3P83D 2HWIA 3DRSB 4IRDA 5DG9A 4ZVFA 3N6MA 4QOZB 4KREA 4Y2CA 4DL4A 3NGIA 1RT3B 1S1XA 5KFFA 3MEEB 3JSMB 4M3ZA 3HPOA 5T7BA 4J2EA 1JKHB 3GV8B 3BJYA 3M9NB 4CHQA 1HQUA 3HL8A 1S5JA 2HHQA 4OL8A 4RW4B 4OGCA 3KK1A 3NGYA 1SV5B 5KFGA 3OYEA 4M3RA 5KG6A 3BQ2A 4M3WA 1NK5A 5FRNA 4FJNA 5C42B 1HQEB 1WSEA 3MXMA 3LP2A 1L3VA 3PX6A 1RDAA 2PZSA 3VQPA 3UPFA 1LWFA 3KLFB 4FM1A 3V1OA 1U48A 3F73A 4CJ3A 4YQWA 1Q8IA 1SH0A 3V1QA 3V6DA 2ZQBA 4CGFA 1JLQA 3CJ3A 3LAMA 2D7SA 3GIIA 3DLGB 4PQUA 4AHRA 3M9OB 3K59A 5EWEA 3IS9A 3DYAA 3BSCA 1SUQB 3H4DA 2VG7B 2FLNA 1LAWA 1VSHA 4F3OA 3VQSA 4AH9A 3PR5B 4CJQA 1TGOA 2BRLA 4CK3A 3IRXA 3Q8RB 4FLZA 1T05A 2J6TA 4Z4GA 5F8MA 2JEIA 5HRPA 1SL0A 4O4GB 3QGHA 4K4ZA 3KHLA 3G0ZA 4KTZA 3ISNC 2FVCA 3HPGA 4F4WA 3PR4A 4J9SA 1TAUA 4KV8A 1RDDA 4FW1A 2A1RA 5DG7A 1HNIB 2FC0A 1GX6A 4DL3A 4W5NA 4KO0A 4ZVHA 4PWDA 3QEIA 4CF8A 1QE1A 2QXFA 4H4MA 3SQ0A 2R2TA 4I7FA 5KFRA 2HNDB 2BE2B 5J1EB 4NLYA 5KG4A 3KLEA 2FBVA 2W9AA 3NF6A 3HO1A 4NLGA 5J2NB 1HJRA 2VG5B 3HYFA 4DTNA 3I0RB 1NHVA 3QLHA 3WNGA 5KT7A 4W5OA 1QTMA 1LW2B 2C2EA 1VSDA 3MTKA 4H4OB 4B9SA 4BWJA 5CYMB 2D41A 5T14A 2JGUA 4TQSA 3TANA 3KMQA 3SUOA 3OYMA 1RDBA 4ECYA 3MXIA 3IGNA 4KKOA 3SJJA 4NLVA 4DTSA 2JEGA 2HWHA 4ICLB 4OPKA 5I42B 4XPEA 4CJ4A 2UVRA 1NK9A 1RT6B 3SZ2A 4NRTA 3OSPA 1IKWA 1VRTB 3DM2B 5J2QB 1RT1A 3DRRB 1KFDA 1RTDB 3EPIA 4TXSA 2OPPA 4Y1DA 4FJIA 4DU1A 1JLGB 1JLCB 2WRMA 1ZTWA 3ZCMA 4B9NA 1WSFA 1L3SA 4BE1A 3SFGA 4O3OA 2AQ4A 2G8IA 1N56A 3M8PB 4K8ZA 3HHKA 3QERA 1N5YA 4QWBA 1BHLA 4RW8B 5K14B 5HROA 3LP1A 4GC6A 2VG6A 3UDLA 2X6SA 1TL3A 2DPJA 4FJ7A 3RMDA 4RZRA 4F2SA 4LD0A 3CM5A 4JRPA 2XGQA 1U47A 1R0AB 3PX4A 3LPUA 4O3RA 4OLAA 1XI1A 4ZVEA 4G3IA 2HNZB 1B92A 3OYNA 2Z1HA 4M45A 4J9RA 1BI4B 2YNHB 2D0CA 1VSJA 2KZMA 3LPTA 5FDLA 2RPIA 3RRGA 1JLAB 4NLUA 4U7CA 1ZBHA 5EDWA 4JV1A 4E7JA 3K5NA 4DLGA 3NDKA 2ZE2B 4ZMMA 4R8UA 3S9HA 4DSLA 4M41A 3CM6A 2ZD1A 4FLVA 5JS1A 3LP0B 5EU7A 1JIHA 1S4FA 3AVCA 5L1IA 4WFYA 4MFBA 1C0MA 3QZ7A 5F8NA 3EYZA 2QKBA 4LSNA 1ASUA 1T7PA 1GX5A 4AHUA 1IKYB 1HMVB 4JUZA 1MMLA 3WNHA 3PX0A 4R5PA 1NK0A 3OLAA 2XRIA 3RRHA 4Y2AA 1C1BA 2ATLA 2PYLA 1VRUB 4KB7A 4DFMA 1SKWA 1TK8A 2OPSB 4K4XA 1RAJA 4CGJA 3KLGA 4EO6A 3H40A 3QNOA 3CDUA 3PJXA 4ZPBA 4URSA 1CXUA 3BSOA 4IG3A 4BWMA 3AVLA 4YNQA 1TKDA 3AVMA 3OYFA 5DG8A 1JLEB 3DI6B 1S9EA 2ATQA 5EUHA 2B4JA 5KG2A 4B9MA 3GV7B 1BQNB 4MH8A 2OPRB 3QINA 4YR3A 5DMRA 1NJZA 2HHTA 5DGAA 3K5LA 1SKSA 2D0AA 3NKYA 2XY7A 2RKIA 4MKBA 1TVRB 2XCPA 4I2PB 4X2BA 2YNFB 2W9BB 3ICLA 1ASVA 1RT4B 4Q44A 5HBMB 1TL1A 1WN7A 4FM0A 4ID5A 4IDKA 4ZPDA 3IAYA 4EBCA 2OH2A 3MECB 3KK2B 1UOCA 4K4UA 4CEZA 4KI6A 2FLPA 3CO9A 2FVPA 1HRHA 1HNVA 4PUOA 1TKTA 1HYSB 1NHUA 2YKMA 3QEPA 2WCXA 1ITGA 4O44B 2FBTA 3C6TB 4DU4A 1NKBA 5EWFA 4O4RA 3HT3A 3OS0A 2R8HA 3LZJA 3DLKB 2J6SA 4HUFA 3KKSA 1D9DA 4KHQA 4M3XA 4FYDA 3ZSZA 3ITHA 3KD1E 4CJWA 4CFAA 3L2UA 3KMSA 3WNEA 4Y3CA 2WK4A 1RBTA 4F4KA 5KG1A 4E7HA 3U3GA 3VQ6A 2XO7A 4KFBB 1RBSA 4DTPA 2IGIA 3UIQA 3PY8A 2R7YA 1U49A 3RB3A 4WXWA 3AVNA 3O4QA 1IM4A 1RBUA 4HKQA 1XR5A 5CYQB 4O3PA 4LSLB 1VSIA 5C24A 4WE1B 2P51A 3OL9A 3KHGA 3RBDA 4FJLA 4F4XA 5KGWA 3QGIA 3DOKB 4NCGB 3QGGA 3N6NA 2X6NA 2HHSA 3SQ1A 2IM3A 4IG0A 1RTIA 4CEBA 1IO2A 5KFSA 1YVUA 3CFRA 4IRCA 3HVWA 3Q8QB 4FW2A 5L1JA 3AO4A 1S9FA 3G6VA 4QAGA 4J9OA 5CZ1A 2FVSA 4FJ5A 1IKXA 2VA3A 4KTWA 3OYDA 5C25A 2G8VA 3H59A 4CJUA 3K5OA 3LANA 4MIBA 3KLIA 3MEDB 5DGBA 1N48A 1XWLA 4NZ0A 1TV6A 2IC3A 4RNNA 4Z4IA 1TK0A 3Q8PB 3V9UA 4J9LA 4O0IA 4IFVB 3HK2A 1HQUB 4DTJA 3NGZA 2C28A 3KK1B 1C1AA 1KVCA 2IJFA 2IMWP 3NBPA 2W8LA 4B9VA 1IKVA 4HCBA 1RA7A 2G8FA 2QV6A 4NRUA 5KG7A 4ECQA 1JLBB 3LP2B 4FJHA 2OPQB 5KT5A 1HPZA 1KLMA 3MR5A 4KE5A 3LZIA 1G15A 4ZP6A 1BISA 1RT7A 4RNFA 3V6DB 2HMIA 1UAXA 3ULDA 4F8RA 4PA1A 3U3YA 5HRSA 1S1VA 4DFPA 1S1UA 4C8OA 4BE0A 3CVKA 2IDOA 2WOMB 2BANB 5KFPA 3TAMA 3C6UA 2PY5A 1S0NA 2W7PA 2FJXA 3IRXB 3GQCA 4DTRA 4WFXA 3MR6A 3ALYA 2AGQA 2HNYB 1DLOA 2D5RA 4HHTA 4B3OA 2X78A 3NFAA 1WSGA 1CZBA 4FXDA 2EC0A 4J2DA 4B08A 4F4YA 3E01B 4OPJA 1TQLA 1DTTB 2DFHA 4IKFA 4PWDB 2D3ZA 5HP1A 2V4RA 4DG1A 3BGRA 4FJXA 3I5CA 3SPZA 1T3NA 4RW7B 4XIUA 3OYCA 1SH3A 3BSNA 3SUPA 3ZSVA 1HARA 3DLRA 4FLYA 4FJJA 3QO9A 2YKNA 2C2DA 5KGXA 4QWCA 5J2MA 3OYHA 4I2QB 2Y1JA 4ECXA 4FS1A 4O3SA 1FKPA 3RBEA 4ZHRA 4FLWA 3AVGA 3L2RA 4CGHA 4DL2A 1Y97A 3HKWA 4CF2A 1J5OB 1BQMA 4KAZA 4B8AB 4CJTA 1MU2B 4KKOB 4FZZA 5CY4A 2QE5A 3DOLA 3ZT3A 3NAIA 4RW6A 3H98A 3KK3A 2D3UA 4WYLA 4NYZA 2B6AA 1VSKA 3DRPA 4CFDA 5KT4A 1YTUA 2I5JA 1LWEB 2ASLA 4YP3A 3CDEA 4ELTA 4ZPAA 3EPGA 3ZT1A 1K6YA 1RA6A 1C0UA 1N6QB 4EBDA 4DQQA 3T5HA 3EZUA 4NLOA 1ZYQA 4RNHA 4EYHB 2IA6A 4KHRA 1RTHB 4BDZA 1C0TA 3GILA 4DQRA 4Z4FA 5HROB 3LP1B 3FSIA 1YTAA 3HVTA 5J2PB 2VG6B 3KHRA 4TLRA 3OSNA 4WZMA 3DMJA 3OYGA 4KI4A 3CJ0A 4Q5VA 2IM1A 4DL7A 1SKRA 1RT5B 4FZXC 1EP4B 3PW4A 3F9KA 4K4VA 4B9UA 5KTQA 5KFMA 5L1KA 3AVAA 4IR9A 1RT2B 4NLDA 2Z1IA 3S3OA 3QIPB 1TKZA 3AA4A 4CJVA 1A5VA 2F8SA 2YNGA 3TARA 4F4ZA 1S6PB 2ETJA 1VSMA 3SI6A 3DRSA 2PYJA 4LH5A 1WSJA 3QYYA 2QK9A 2R8JA 3V9ZA 1EETB 1RT3A 3THVA 3MEEA 4FLUA 3JSMA 4MFBB 3MFHA 3M8QA 3OL6A 2WHOA 4GC7A 4M3TA 4AHSA 3OYKA 4ZPCA 1JKHA 2GV9A 4ELUA 1C1BB 4QPXA 4RW4A 3OL7A 4OJRA 1SV5A 2WONB 4CK1A 5KT3A 3BSAA 2IM2A 3KLGB 3KIOA 4FM2A 4WZQA 4ZP9A 3PZPA 2FVQA 2RDIA 1HQEA 4WXOA 3NH2A 3LWLA 4IG3B 4NYNA 4DF8A 1T8EA 4O3NA 4IFYB 3NH1A 4CEDA 3DLEB 4ECZA 1FK9B 4Q43A 1DTQB 4K4WA 3IGVA 3NMAA 1HYVA 3G6YA 1RTJB 3MR3A 2F8EX 3V6HA 2VA2A 4QWEA 4KHYA 2ZKUA 3DLGA 1NKEA 2G8HA 3RB0A 3CJ2A 1B9DA 3H5XA 3L2WA 4K8XA 1Z4UA 1NK8A 1SUQA 3B6PA 3OLBA 2VG7A 3V81A 5E41A 4Z4EA 1WAJA 3OHBA 2YHBA 2EX3A 5KG0A 4YMEA 2BDPA 5KFLA 4CJSA 4E3SA 3ZSRA 2HHWA 2BGGA 3K2PA 3QIOA 3GIJA 2WB4A 3CFPA 4BACA 4CEQA 1RBVA 3NAEA 5DLGA 4RNOA 4I9LA 1S1WA 3AO2A 4DEZA 1KVAA 3D28A 2UVWA 1ZTTA 1ZBIA 1JXEA 3KTQA 1Z25A 3NL0A 2B5JB 5J1EA 3ITHB 2AGOA 5KFDA 4QW9A 4CK2A 2IJNA 4CHOA 5J2NA 1TP7A 3RR8A 3CQ8A 3I0RA 4YR2A 1SH2A 4M3UA 3SV3A 1RYRA 3RWUA 2HHUA 2G8UA 4XPCA 4E19A 3OYAA 1LW2A 1D1UA 4NLPA 4DL6A 4DLEA 4H4OA 2AWZA 5CYMA 5SWMA 5F8GA 4YFUA 1BL3A 3T5LA 4F50A 1VSFA 4IH5A 3IG1B 3KLHB 3OS2A 4EZ9A 3VQ9A 1C6VA 4ICLA 3JYTB 3HPHA 4KHWA 3D45A 3I0SA 4OKEA 1JXBA 1QAJA 4B8CA 5F9NA 5DLFA 2JEFA 4RW9B 3MR2A 2KFZA 3DM2A 1VRTA 5KFWA 3MFIA 5J2QA 1S97A 3K5MA 1LWCB 4C8NA 2G8WA 4FBTA 3DRRA 4IG0B 4J9KA 1RTDA 2W9CA 2E6MA 4TQRA 2W7OA 5D3GB 3QESA 1JLCA 2R8KA 3SCXA 4EO8A 4FS2A 2HAIA 3G86A 4MK7A 1IKXB 1I39A 3M8PA 5C25B 2Y1IA 4CF1A 3FFIB 4RW8A 2V9WA 5HLFB 5K14A 4JS5A 4CFBA 3TVKA 4LQ3A 3QEVA 3SPYA 4TY8A 5KT6A 1LW0B 1A5XA 3HSTB 1U04A 2OA8A 1R0AA 1WAFA 3M9MB 2RF2B 3FRZA 1WSHA 1S6QB 4RUAA 2HNZA 2JC1A 4CJKA 3SI8A 4ED0A 1SL1A 3RAXA 3KJVA 4DSEA 1B9FA 2HB5A 3PO4A 1N4LA 1BI4A 3ZT4A 2YNHA 1IKVB 3PW5A 3NAHA 1TKXA 1JLAA 3D5MA 1NK7A 3ISND 3SYZA 1RDRA 4R0EA 3OYIA 1S9GB 4Q8FA 2P5GA 2I1RA 2ZE2A 5F8IA 1KSPA 1REVB 2YNIB 1QQCA 2IAJB 4FJGA 1GOAA 1ASWA 1JX4A 4CCHA 3OYJA 1TAQA 3I5AA 4CE9A 2VWKA 4Q0BB 2XY8A 4IR1A 3V4IB 5I3UA 1BGXT 4DSKA 4G1QB 1IKYA 3AA2A 3O3GA 4L8RB 3BR9A 3AO3A 3NF7A 3C6UB 1EX4A 1VRUA 4JRQA 2OPSA 2J6UA 3NH0A 3KKRA 4DSJA 3NF9A 4DTUA 2YHAA 4CHNA 1DLOB 2V4QA 1IH7A 4Z4HA 3UQSA 1S1TB 4CJ5A 5DQGA 3GIKA 3OS1A 2AX0A 1T03B 1D5AA 4DTXA 4DTMA 3B6OA 3MEGB 2XC9A 3VA0A 2UVUA 4DG1B 3VQ4A 3D0PA 1BQNA 4FVMA 3BGRB 2OPRA 4N56A 3H5SA 4H54A 3VQ5A 2VWJA 2XY5A 4F2RA 1A5WA 3G10A 4Z4CA 3FQLA 1TVRA 4IBNA 4I2PA 1KTQA 1S1XB 3ZSQA 2YNFA 4ZP8A 2W9BA 4KHMA 5F8HA 3T1AA 3AVFA 4E7KA 1L3UA 1RT4A 5HBMA 4TYBA 4PY5A 1W25A 2XHBA 3LP3A 3MXJA 3MECA 4Y1CA 3KK2A 3RMCA 5KFJA 3WNFA 2FJVA 1XHZA 1HYSA 3OL8A 2KQ2A 1U4BA 4LQ9A 4ED1A 1QHTA 2NUBA 3CWJA 3TI0A 3OJUA 2EHGA 3NGDA 1C2PA 4MKAA 1LWFB 3DLKA 1Q9YA 4CEEA 3OJSA 4J2BA 4HVJA 1JLFA 1L5UA 4CFCA 1JLQB 2E9ZA 1QSLA 1UA0A 1WSIA 4PQUB 1XHXA 4LY7A 4CIEA 3IS9B 3DYAB 4NLRA 4AILC 4C8KA 4KFBA 5JS2A 2Q3SA 1FKOA 4FBUA 1D8YA 3RAQA 2OZMA 1T05B 3VA3A 4KPYA 4KB1A 1K1SA 4E7IA 3L3UA 4O5BA 5CYQA 1YVFA 4ECWA 2R8IA 3C95A 4KV8B 2W8KA 5FRMA 3DMJB 1X9MA 5F9LA 3PV8A 1S0OA 3DOKA 1QS4A 4IH7A 4KO0B 4NCGA 3PW7A 3ZT0A 1QE1B 4H4MB 3I8DA 3PW0A 3AVHA 3BREA 4KRFA 4I7FB 2XCAA 4KSEB 4IQXA 3OHAA 4FJ8A 2OZSA 1U09A 1NJXA 2KZZA 3L2VA 1J54A 3KLEB 4ECUA 1TKZB 4E0DA 3HM9A 4WFZA 1TK5A 1I3AA 2YNGB 3BQ1A 4W5RA 4OKKA 5KG3A 1NJWA 3QLHB 4ECVA 1F21A 3O3HA 4DFKA 2R8GA 1X1PA 5KFHA 1C1CA 3QEWA 2XY6A 1KFSA 1SL2A 3OVNA 3S3NA 3MEDA 3QNNA 4NLTA 3RB4A 3DLBA 3BDPA 3O3FA 2G8KA 4GMJB 4N5SA 2GBZA 3ZSWA 3M8QB 4IFVA 1BIZA 4MIAA 1JL1A 2Z1JA 4K4YA 4CEOA 2DTUA 3V9XA 3S3MA 2C2RA 1IKWB 1BCMA 1RT1B 2LSNA 4BDYA 3TAFA 1D9FA 1JLBA 2OPPB 3QZ8A 1T94A 2FBYA 4WYWA 2R2RA 2OPQA 4E7LA 4BDPA 3AA5X 3AO5A 2JEJA 2RN2A 4ED3A 3KHHA 3TR8A 4J9PA 4J2AA 2HVHA 5L9XA 1ZETA 3H2LA 2FJWA 3NF8A 5F8LA 3T5KA 4ECSA 1RBRA 1N5YB 2ILZA 4IKAA 2P1JA 3KNAA 1J53A 1TL3B 4ZTJA 4HUGA 4O0JA 2O5DA 3T19A 2E9RX 4KHNA 2WOMA 1S0MA 3V81B 2V0NA 2BANA 4DQSA 3SFUA 5KFIA 1RILA 4CJPA 3HP6A 4DF4A 4DS5A 1RCHA 3HXMA 3VQBA 3V6KA 1LAVA 1UWBA 4NCAA 4ID1A 3IN5A 2HNYA 3LAKA 3P1GA 3L2QA 2AX1A 5FDLB 3E01A 4CERA 1KLNA 4CEAA 1DTTA 1ZBUA 5C5JA 4FJ9A 4TSXA 4LH4A 4ZP7A 5L1LA 1S1WB 3ZSXA 3RTVA 4CJRA 1EXQA 2F8TA 4RW7A 2C22A 4R8UB 1I6JA 2ITGA 2ASJA 4FLTA 2ZD1B 2UUWA 4M94A 3AVIA 3CYMA 3VQAA 5KFQA 3AVBA 4OKJA 4H8KA 5KRSA 4LSNB 1GOCA 3AVKA 1OS5A 4I2QA 4CF0A 4AHTA 1WNSA 4QWAA 1CXQA 3SQ4A 4R5PB 2A1SA 3VN5A 4EEYA 2BQ3A 4EP5A 1J5OA 4IRKA 1MU2A 3RB6A 1CZ9A 3M8SA 1J9AA 5C42A 5KFTA 1NK4A 2UUTA 4QCLA 3I0SB 4ED8A 3KLFA 1S48A 4ZVGA 1S9EB 4OVLA 4DSIA 1LWEA 3EY1A 3NHGA 2W9CB 1Z26A 4E1NA 1O1WA 2RKIB 4KAIA 1NJYA 3EZ5A 3HP9A 4J9QA 4Q8EA 2KTQA 1N6QA 5KFOA 4QW8A 1ZBLA 2IOCA 4FCYA 2CJQA 3A2FA 4JS4A 4E89A 4FK2A 2YV0X 4HTUA 2DFFA 1TL1B 4ID5B 4IDKB 3QEXA 3TQ1A 3P5JA 1XR7A 3NE6A 1RTHA 3VQ8A 5CZ2A 4DSFA 4O4GA 4TN2A 2CKWA 4QWDA 4FK4A 5J2PA 5KFBA 4KHSA 1HNVB 4PUOB 1TKTB 3PUFA 2YKMB 4TY8B 1HNIA 1VK0A 4CIFA 2E9TA 1RDCA 3HJFA 1RT5A 4NYFA 1EP4A 2BRKA 3H4BA 4DS4A 5KFAA 4CECA 2GIQA 3KJVB 4AHVA 4MK8A 2HNDA 2BE2A 1JXLA 2AJQA 2HHVA 5KFEA 3HVRA 1RT2A 1TKXB 3RR7A 3QIPA 4CIGA 4CESA 2Z1GA 1FXXA 4KB0A 3SUNA 4C8MA 1UA1A 1QSYA 4DL5A 2VG5A 4Y34A 1S6PA 4FK0A 4UQGA 4K4SA 3UR0A 5KFCA 3GIMA 4HCCA 1RYSA 2IBKA 1YT3A 2E6LA 3TABA 1EETA 4M95A 3CDWA 4B9LA 4DQIA 1S49A 3H5UA 1QSSA 2DY4A 4CJEA 4ED6A 4FJMA 4J9MA 3QIDA 1S10A 5I3UB 5KG5A 4EP4A 5I42A 5C24B 1WNEA 3GYNA 2F96A 1NKCA 1NOYA 4TY9A 1KVBA 1RT6A 4RG8A 2D0BA 4KBIA 2WONA 2AU0A 4HYKA 1RTIB 3E51A 2HVIA 3CG7A 4DQPA 4Q45A 1KHVA 2X74A 2BQUA 2DFEA 4IFYA 3ASMA 3DLEA 1FK9A 2FVRA 3RMBA 1JLGA 5EWGA 3PW2A 4KHUA 1DTQA 5JXSA 1EKEA 3ZSYA 4CHYA 4K4TA 3N6LA 2DPIA 1RTJA 3MF5A 1WLJA 2GIRA 3L3VA 4J9NA 5KFYA 2JLEA 3KLIB 5HRRA 4ED7A 3V1RA 4B9TA 1NK6A 1TV6B 2IC3B 1W0HA 4MQ3A 5KFZA 4CJLA 3AV9A 2WTFA 2IS3A 4DU3A 5KFUA 2O4IA 3TAEA 4I9QA 4M42A 5KFVA 4EBEA 4GW6A 2ILYA 1CSJA 4JV0A 2QKKA 4N41A 1K1QA 3NBPB 4BE2A 1NOZA 1RNHA 4RNMA 3NCIA 3CFOA 2O4GA 4ELVA 4DMNA 4M3YA
chains in the Genus database with same CATH superfamily
4MYTA 2KW4A 4CZEA 3VAMA 4I64A 3PVXA 1BWVA 2ZWHA 2MKCA 4M5LA 2KI2A 3L7OA 4IQMA 1JLFB 4ED2A 4USUA 3PJWA 2K1RB 1S1VB 5F8JA 2IBOA 5HVGA 2A42A 2Q0UA 4RU9A 1BCOA 4BRQA 1I94K 2CNKB 3KD5E 1IXKA 3K2YA 2AJ2A 3ENQA 4AQYF 3U6FA 1X9SA 4NX9A 3HHLB 5LY3A 4RWXA 3IG1A 3G6XA 3K57A 1D4XA 1R6VA 3ZZTA 5TKYA 1KHWA 1SC1B 4CHZA 4DFJA 3N4PA 4NI2A 1DHMA 2XB2D 1FHTA 2FTRA 3DI6A 4OFZA 4XH1A 1Y5IB 3A8EA 2R3VA 1XMBA 4GV3A 3BQ0A 3ZZPA 1IR2A 4C1NI 2X1AA 1UJ5A 2BX6A 3DDKA 2DGSA 5IM0B 2HW3A 3T3FA 3V9SA 5FIIA 4G6VB 2NUUG 3GR1A 3M2UB 5JUMA 4ENOA 3Q24A 4X66F 4KH6A 5CZXA 3TAQA 3KLVA 1NCLA 1NB7A 4X65K 1K8KB 1VHFA 4N47A 3M8ZA 4ZHRB 3SNNA 4KTQA 4GKKK 5FLXY 2QYCA 3RMAA 4Y2IA 1XR6A 3ZYYX 3HVAA 4OJHA 1KKHA 4CBXA 1YIJN 3LWMA 3DOLB 3MDQA 4RW6B 2DNZA 3RRKA 1Q7YO 4FNHA 3MN9A 2P6TA 1TMMA 1FE4A 1VMBA 3R9LA 2MJNA 4OI6A 2VC1A 1VLOA 2BQRA 5ETTA 3M8RA 4OZ3A 1S9GA 4KYZA 1RDWX 2HHHF 1REVA 2YNIA 2XMUA 3KOAA 2JWKA 4BBYA 3HHNB 3IFEA 5G0RA 3VQ7A 1WHYA 3CJ5A 4LSLA 1Q86T 1NBWA 5AQJA 4CHPA 3FDSA 2DO0A 3D3CJ 2IPOB 3EN9A 2VL1A 5KT2A 2WVDA 4OX6A 4GVEA 2ZH4A 1S79A 1ZBFA 3CCUS 1RAHB 3D0HE 3AA3A 3CI5A 5FROA 4BREA 2M5YA 2VBZA 2F7TA 5KQ8A 1T03A 1CQMA 1F9HA 2OEMA 2ALZA 1HL6A 1U26A 5AQGA 3DXMB 2MGZA 5D0RA 5B0CA 1AUSL 3MCAB 2NXCA 3T9ZA 5D8HB 1RT3B 1XTZA 5KFFA 3MEEB 4NXNK 3EKUA 1RACB 4M3ZA 2UUCJ 4KH5A 4DPOA 3BJYA 3M9NB 2Q6CA 4OL8A 1IJJA 1S77D 3BEGB 2V8PA 3OTCA 3BO3A 1X31C 5KG6A 3MEKA 3UD3P 3OTEA 2N4CA 4M3WA 5C42B 4OZ5A 2PZSA 4OHWA 3RU0A 5C2DA 2HFNA 3KLFB 4FM1A 1U48A 1CJUB 3F73A 4CJ3A 4LFAK 1KC8O 1R31A 3NCPA 3RBZA 3H8YA 3HLUA 3V6DA 4DV5F 4CGFA 3DWLA 4JI2K 3SMPA 3LAMA 4C8ZA 2YPZA 4AE5A 3M6GA 2W6LA 2R4FA 3OTBA 3M9OB 3C15A 3P5BP 3DXBA 1U6FA 1SI9A 1YBTA 3K59A 1GMVA 3IS9A 1KVIA 1LNQA 1SUQB 1R27B 1VSHA 2D9PA 2ZGZA 3BKUA 4AH9A 4YEAA 4CJQA 1TGOA 2BRLA 4ZIVA 4CK3A 3GSIA 3ZZ0A 5F8MA 3QGHA 2ZC4A 2MZQA 4WYBA 3B6BA 2FVCA 3HPGA 4C7QA 3MHYA 3OBWA 3UD4P 1HBMB 1YK9A 4PEOA 1O6XA 1WTBA 4DL3A 1MDUB 2Y1LB 3AA9A 4KO0A 4ZVHA 4PWDA 3QEIA 2EWSA 1RFQA 3UKRA 2ZZTA 2E5LK 1WI8A 1D9AA 4GNIA 1NJIO 1N5TA 2MHNA 4YHHK 2DJWA 4O5FA 2DNNA 3QJLA 1KVKA 3MM8B 3NWGA 2RAQA 3MM9A 4M7XA 3CCJN 4NLGA 4NL5A 1HJRA 3LDNA 4WCEL 3I0RB 3W8GA 1NHVA 1SS6A 5BR8K 4OYIA 5KT7A 3MPVA 4BR7A 4HVZA 3TQEA 4OQJA 4CZLA 4HEA9 1QTMA 1LW2B 1VSDA 1NEEA 3OR2A 1PSDA 4JI0F 5CYMB 2D41A 5T14A 3CPWM 1GK8A 4ECYA 3MXIA 4D3GA 3SJJA 4Z7YA 4LF5F 4DR2F 5HOOA 4DTSA 2JEGA 2HWHA 2QSWA 3J80O 4XPEA 2OO4A 4DV3K 4CJ4A 2P9KA 2VKRA 3C46A 4RBVA 1NMEB 4LF7J 4NWBA 1IKWA 1Q79A 1RT1A 3M3ZA 1RAGB 3VZHA 4CLYA 5MLCV 1XMQF 3BN7A 1NBEB 3K8VA 3TSPA 1JLGB 4B9QA 4OX7A 2HS0A 4GVLA 1B4SA 4HACA 1T3OA 3PFOA 1L3SA 1WSFA 4BE1A 4DPYA 2G8IA 1N56A 3M8PB 3FZKA 1BHLA 2CGJA 4GC6A 1FFSB 3C16B 3UDLA 4LD0A 2DHXA 3AH6A 4EUVA 2BEFA 2BJ3A 1FKAF 4HI2A 3PX4A 2LXFA 3LPUA 4L76A 4OLAA 2RQCA 5CABA 3H2UB 2HF3A 4M7YA 1VYAA 5E3CA 3UDVA 2Z1HA 1U1MA 3UO0A 4ZVQB 2ERRA 4CZFA 2D0CA 2WBMA 3CCMN 5ETQA 4WWSA 2WC9A 2V34A 3FFKB 2QA4G 1NGGA 4R8UA 3S9HA 2A41A 1FJGK 3B4DA 3OFGA 4M41A 1G7CB 2QL9B 3S7RA 1S57A 1RWKB 4QR2A 5L1IA 2WUSA 1C0MA 3QZ7A 2HQIA 3VR1A 2QKBA 4CLUA 1T44A 3UNYA 3DDNA 4CI0B 1MMLA 1C1BA 4X4QA 1W7WA 3LPEA 3U4LA 4JKHA 5LMUK 2ABYA 4DFMA 1TK8A 2OPSB 2B3TB 3Q7CA 2AJFE 3I6PA 4CGJA 1FTRA 3CMEN 2RHKA 3QNOA 3CDUA 2O8BB 4OHZA 4BWMA 3BSOA 3VF2A 4NI2B 1TKDA 3AVMA 3DI6B 3GJRB 5EUHA 2B4JA 2R7RA 5KPRA 4MH8A 4DV1K 4YR3A 3HZGA 4L3QA 4CZIA 2DH9A 1LCUA 2D0AA 2V7YA 3NKYA 2XY7A 2RKIA 1YQHA 4LIRA 1X3MA 1Q8BA 2XCPA 2J9CA 3DN9A 2CG4A 5HVHA 4DCJB 3ICLA 1FDDA 5CHIA 3CC7S 4Q44A 2GUPA 1WN7A 4FM0A 1R43A 4JKAA 4A8YA 1WUAA 3S41A 4YORA 3IAYA 4EAHD 1TELA 3KK2B 1UOCA 4CEZA 2B7BB 2FVPA 1TTHB 5DRKA 1HNVA 3N5BA 4H5NA 2L9WA 1Y4ZB 2P9CA 2QTWA 2VHGA 4DU4A 3N28A 3BM7A 1Y9OA 2I6WA 2R8HA 5K5MA 2M8DB 3DLKB 2NXJA 1D9DA 4KHQA 1U0HB 2GFFA 4CO5A 3KMSA 5IWAJ 4BRLA 1KR4A 2P9NA 2VB6A 3R6LB 4MAKA 3IWNC 1AFJA 3THYA 2PSZA 2GAGC 4DTPA 1WG5A 3RB3A 2NRHA 4NA2A 1IM4A 1RBUA 4Q2MA 3B8AX 3A4TA 1CS4A 4LSLB 2D3OR 2HBMA 4BR2A 3KHGA 1Q82T 4FJLA 2BUNA 3CCVN 4P7VA 2B4UA 4QS7A 4DR4F 3D2EB 3SQ1A 1RTIA 1IO2A 1S12A 3TX0A 3HFVA 2KXNB 4H5WA 4H0PA 1YGYA 3HD2A 2HS3A 1KTVA 2GO9A 5L1JA 2XMTA 4ETZA 5M1PA 1IKXA 3OYDA 3GFYA 4CJUA 1VBZA 4IOAL 3MEDB 3O9SA 2HQFA 1XWLA 1JXVA 2AV5A 4TKTA 1NDKA 4RNNA 5EY4A 4CT9A 1TK0A 5A8WB 3Q8PB 4OX8A 1U1KA 2QEXS 5EXWA 3HK2A 1C4CA 4DTJA 2YVSA 2F4VK 3ZXWA 2FY8A 1MSWD 2IMWP 3FZLA 3NBPA 3W2VB 5BRFA 3VAHA 4YOXA 2Z2LA 1RAFB 1M5HA 4JKGA 1IKVA 4HCBA 2G8FA 2C3OA 4ZIWA 4F67A 3IAS9 2YKOA 4FJHA 1AT1B 1P8GA 2GV1A 2OPQB 3T1HJ 1G15A 5K8PA 3MURP 1PAEX 4DUYK 4UY8O 4LFBJ 4CLZA 1M5KC 3V6DB 3ULDA 2WZ1A 4PA1A 4C1NK 3GLJA 1SC6A 3GYXB 3EGNA 1I51B 1VQNN 4LFCJ 2F63A 2V2ZA 1X5PA 1WC4A 5AXLA 2W1BA 3TAMA 3K9KA 4USIA 3CJ9A 2MZSA 4QR0A 1YITN 4WFXA 3MR6A 1AUDA 4WFNL 2PFUA 3KVGA 1VQ4N 4FO0A 2FIUA 3EVWA 4P7TA 5HANA 3ZZOA 1TQLA 2BM0A 3R6GB 5B0EA 4IKFA 3DRYA 4PWDB 4DG1A 3PIPL 3BGRA 3SPZA 1SC4B 3OYCA 1UEVA 1ZH5A 1UPPA 2PFFB 3BSNA 1YX2A 4DV6F 2B0GA 5DZ7A 3ZSVA 1BMQB 4FJJA 3L4IA 1ZZFA 3HI9A 2CJXB 1HJOA 3OTOK 2DHHA 4I2QB 5ADXA 2Y3YA 4WP9A 4FS1A 1D09B 3RBEA 3HKZD 1JJ2M 3M32B 4CGHA 4DL2A 3AA8A 3D6MB 4CF2A 1E6VA 2AEFA 1Q53A 3QB0A 2D9OA 2HVDA 3POTA 2EK6A 2FC9A 3QRRA 4JV5F 1B0TA 3AAWB 4RR5A 2Z8QA 2ZJQL 2Z0GA 1X4GA 2PMZD 4NYZA 4AM6A 1VSKA 5JMVA 3TUPA 2KDOA 1YTUA 2I5JA 3ZLJA 3SMSA 2R7SA 1CVJA 2XM3A 3LUYA 5LMNF 1RA6A 3MGJA 4LF4K 1C0UA 3R5JB 1CULB 5JLFA 5AZJA 3T5HA 3EZUA 2QX0A 6FDRA 3R2CJ 3U1LA 1RTHB 2R42A 2AYBA 1C0TA 1YTAA 4UW2A 3HVTA 1OSCA 2CDRB 2EEYA 5M2UA 2UU9K 3M8YA 1R6YA 3OSNA 4NZ6A 1RKIA 1MROB 3N01A 3NGSA 1Q81T 1QD1A 5AR0A 1RT5B 4FZXC 2RVJA 4LMZA 1RDUA 2CWKA 4MLEA 5L1KA 4IR9A 1CLFA 2JRSA 4NLDA 2FSKA 1VBYA 1OH8A 3AA4A 1A5VA 4CLTA 5GAGI 5D0EA 3EGWB 4F4ZA 5DDPC 1S6PB 4BLGA 2ETJA 2IVFB 2J4RA 3SI6A 2PYJA 4BRDA 1WSJA 2Y1RI 3QYYA 3T9NA 1ZBTA 1HHQA 3FKBA 5AJ3J 1X4CA 3A8JA 3IRWP 2UP1A 2QLFB 1HW8A 2PAVA 1M1KO 3M8QA 3OL6A 4GC7A 5ELZA 4DR5K 2D4WA 1JKHA 2AMCB 3KJQB 2RJZA 1C1BB 5D4NA 3EX7B 2J76E 2HHPA 1WSRA 2X1BA 1S0VA 5KT3A 4TLQA 3F56A 3KIOA 2KM8B 4OYOA 2E1MC 3A3PB 1H98A 1SQKA 4BVPA 2DR7A 4KGXB 4WXOA 3NH2A 4DF8A 4LF7F 4CWBA 1HBOA 2J0SD 3GJSB 4Q43A 4M5KA 3KJFB 3NMAA 2XS2A 2F9JA 2LKZA 3G6YA 1FF2A 3MR3A 3V6HA 2OSRA 4BC2A 4QWEA 3UN3A 4ZK7M 5DM7L 2GGPA 3TWZA 3DLGA 2G8HA 3RB0A 1HR0K 1MNEA 3QSIA 2XS7A 1Z4UA 1NK8A 4F3MA 4OI3A 3V81A 4BC5A 1Z1ZA 2CA9A 1AZSB 3L9ZA 2Q3PA 3MM7A 3DGVA 1Q18A 4IYQA 3D9BA 5AQRA 4BRCA 2EI5A 2VICA 4CJSA 4E3SA 4ERDA 5D0HA 2BGGA 2AYEA 4OV1A 3KZBA 2HQGA 4EWTA 2QL5B 4CZCA 1QHAA 1RBVA 2X3DA 3U1MA 4I9LA 1S1WA 2MB0B 1ZBIA 4Y28C 3KTQA 1Z25A 1HNZF 3HI0A 1ZOTA 3Q8UA 2V8GA 4A8WA 4BRFA 2D1KA 3TEGA 4CHOA 4K59A 4ZJQA 2ZC3A 2QT7A 1SH2A 2A6MA 3CEDA 4M3UA 4JOUA 2G8UA 5AE3A 5D77A 4XPCA 1D1UA 4YS2A 4DL6A 1WKKA 2C2ZB 3PYEA 4MIWA 4F50A 4IH5A 3M4XA 2LU2A 4BG9A 2HIQA 4EK2A 2EFGA 1D3WA 3JYTB 4CNYA 2PEHA 1G6BA 1KP6A 1Y0HA 2F4FA 3I0SA 3MAHA 3D45A 1QAJA 2VH7A 4CDIA 5J1PA 2KFZA 1RHJB 3MFIA 4C8NA 4QS8A 4ES3A 5ADZA 1CC8A 1QVGR 2W9CA 2E6MA 3AFGA 1WDTA 3PKYA 1SAZA 1BHNA 4KBOA 1FNXH 3MWPA 3M1VA 3EXCX 2GJFA 3OXGA 1T6DA 1FX4A 3BBBA 1IKXB 5AXMA 4HHJA 2A3JA 4CF1A 3MPDA 2V9WA 4RW8A 4CO3A 2VJVA 2M2BA 3JAMY 5A0YA 2L08A 4CFBA 4JYAK 3SPYA 1FCAA 3BY5A 2XSJA 1LW0B 4RBTA 1WAFA 2RD5C 3FRZA 4RUAA 2QIFA 2ALYB 1Q16B 2XS5A 3SI8A 3IUCA 4JK7A 3PO4A 1YI2N 3UE5A 3VENA 4JKGB 1IKVB 5ITHA 3UE2A 3SCLE 1JLAA 4K2JA 3ISND 3OYIA 2P5GA 2I1RA 1KEKA 1KSPA 1I94J 2KO1A 1KDNA 3CCTA 1ASWA 1JX4A 1DQ9A 1TAQA 3VEOA 3I5AA 3CJBA 4CE9A 4RU2A 3VGUA 4PR6A 1UTAA 1NG9A 4KRWA 1VRUA 1DY3A 4I67A 4A8SA 3NH0A 2GNKA 1FRXA 4O23A 2QM1A 4DSJA 1YHQS 1QLNA 2CFXA 3LPYA 2BTFA 1IH7A 5DM6L 3CDAA 2JDJA 1CJVA 5KQDA 2MKYA 4J9VA 4ZDNA 1V6HA 4HTIA 3EGZA 2AX0A 2NS1B 4DTXA 4DTMA 3CCES 2X1GA 4DG1B 1BQNA 3D3BJ 3BGRB 4QR1A 3VQ5A 3IWLA 3UW1A 2CJKA 4X65J 4C8YA 3RJMB 1RBOB 2ZNZA 4IBNA 1KTQA 3M7VA 4KY3A 2YJEA 1S1XB 3AVFA 1QM9A 2KL8A 2P9IB 2PIIA 2KRRA 2EC2A 3MECA 3RMCA 3IBWA 4K5RA 3QPIA 2EKNA 4DV4K 4B1ZA 2DR8A 1HYSA 1E6VB 4MTPA 3G9CA 3POTB 3CWJA 2JWLA 2DO4A 3EE8A 5BR9A 1VGYA 2EHGA 2YBVA 3NGDA 2LFVA 4MKAA 1FFWB 4H0TB 2AP6A 4BRKA 1Q9YA 3N4QA 4B1XB 1YZ7A 2XMAA 4IOCL 3OJSA 2DNOA 1ZZNA 4PL7A 4I4BA 4ISEA 4A8QA 1XHXA 1V9OA 2J8SA 2EW9A 4LFBF 1EWQA 1S72S 4AILC 3J7ZO 2QC3A 3RAQA 1BUPA 1YVFA 4ECWA 1GMWD 2BACA 2W4PA 3C95A 1T95A 5AQIA 4KV8B 1S6UA 4FYVB 3E8OA 1AROP 3HSZA 3CERA 5BRHA 2FF6A 3JS9A 1VQMS 1S0OA 3DOKA 4LC9B 4IH7A 2HKEA 2DRDA 3AVHA 1VR6A 2UXDF 3OHAA 1NJXA 1NSAA 1T9YA 3K17A 2ZJRQ 4LF9F 1TK5A 1I3AA 4FN5A 2HFUA 4NXNJ 1NJWA 4OZ2A 3NNCA 1I3OB 4DFKA 3CJKB 3BKFA 1YJVA 1X1PA 2IDLA 2LLZA 2XY6A 3QEWA 1SL2A 3G2XA 5L39A 2NYHA 3CC4S 4M8LA 1R0BG 1Q95G 4YY3K 3FCVA 1UEKA 2FJBB 2GBZA 2AJ1A 3M8QB 4C9DA 1WORA 5CXTA 4CEOA 2DTUA 4U67L 3V9XA 3VVUA 3MAAB 1WDDA 3WT0A 3K7RA 4JI2J 1GLBG 2R7QA 4OYMA 3QGPA 3QZ8A 2OPPB 1VS3A 2FBYA 4E7LA 1HBOB 2NRXA 4Y6IA 2V8VA 4J2AA 4J9PA 1PYSB 4U8YA 5L9XA 4JI6F 2OEKA 2YWEA 3NOGA 3NF8A 5F8LA 1RCXB 3T5KA 4I6YA 1J2VA 2P1JA 3PYFA 4AYBD 3IFRA 4ZTJA 4O0JA 3G25A 2E9RX 2WOMA 3V81B 3PM9A 2QWNA 1RILA 1ICEB 3HP6A 3CSKA 3MM7B 4CJPA 5GAEU 1RLDA 3VQBA 2X3GA 3W9HA 1LAVA 3O9UA 4ZLLA 2E5LJ 4ID1A 2DNPA 3L7PA 4YHHJ 3S01A 3P1GA 3A1YG 1KLNA 2GQQA 4WU2A 2GMHA 5C5JA 4TSXA 4USVA 4DB3A 4KGZB 1S1WB 1NWKA 1V5VA 2EFOA 5BR8J 3D66A 3R1HA 1KQSR 1CG2A 3A0IX 3EUNA 4FLTA 1RXOB 4OJ1A 2UUWA 4N8NA 1RABB 4M94A 3CYMA 3VQAA 3H1VX 5CAAA 4OKJA 4P73A 3FZBA 4HT5A 1K8AO 5AJ3F 4QWAA 1CXQA 4DV3J 1RP5A 2ZHBA 2HS4A 3UDEA 3BEXA 1J5OA 1F3VA 2I38A 4IRKA 1YUWA 1T9TA 2MLZA 2QWLA 5KFTA 1NGJA 4IJNA 2UUTA 1U6BA 3W8PA 1E4GT 3I0SB 4ED8A 1T9WA 3CCUN 4ZVGA 1S9EB 1CPZA 1RUSA 2QA2A 4PRFA 3NHGA 2W9CB 3G96A 4CO2A 4KAIA 1WEZA 4E2FB 3EZ5A 2KTQA 3ZETA 5KFOA 4I6MA 1RCOB 2ZWOA 3CETA 3A2FA 1XIQA 3ULEB 2YV0X 4HTUA 4RL1A 4MO5A 4ID5B 4IDKB 3H3NO 4DV0K 1IVZA 2IDEA 4ZKAA 1WOQA 1SQEA 3VQ8A 3W0LA 2JH3A 4OI4A 3GSDA 4QWDA 4FK4A 5KFBA 4KHSA 5SUHA 4NPOA 2BBEA 3WQUA 1HNIA 2XNRA 3TA2A 4IOXA 1T6CA 2ZJPQ 2CZ9A 3HJFA 5AQQA 1OQ6A 2GIQA 4AHVA 4MK8A 2HHVA 5LOQA 3R7NB 1RT2A 1FJGJ 1FDNA 4JI3F 4CIGA 1ZPWX 1VQ8N 3MCPA 4KB0A 3SUNA 4C8MA 4DL5A 5BYRA 3C7NB 1F6TA 2NXNA 2FHOB 3GIMA 1N34F 3PRDA 2V63A 2E6LA 2JOQA 2QMUB 3TABA 5LMUJ 5K20B 2DISA 2DCUB 1S49A 3D1HA 1QQNA 1VBKA 4L3KA 1WNEA 4RTFD 1KVBA 4B1YB 2VC0A 4CI6A 3PG9A 1RT6A 1GXLA 2E1AA 3THXB 3CJAA 1UPMB 2D0BA 4RG8A 4CW7B 4KBIA 5C2FA 3C14A 4NOHA 2AU0A 1T02A 2HF4A 4DV1J 2CPXA 3CG7A 4DQPA 4OZ0A 2QWMA 4F04B 2B4OA 5CCMA 2KHOA 4DPUA 2VDIA 2HK2A 2PI4A 1FK9A 2ZBIA 1LWXA 3PW2A 4KHUA 1VOMA 2O8CA 1X4EA 2FGOA 4ES1A 3NEKA 3MF5A 3CJ8A 4LF1A 1BA1A 3KLIB 5HRRA 2ZWPA 4ED7A 3V1RA 1WB9A 1NK6A 2IC3B 1RJJA 4CJLA 3AV9A 3UB5A 2DNGA 2IS3A 1WOSA 3TAEA 3ENHA 2CGLA 1EO1A 2XEXA 5KFVA 3GG1A 4C0HA 1UCNA 3D6RA 2ILYA 2AZ3A 4F7VA 1K1QA 3DKDA 4NA3A 1AXQA 1NXIA 2K7JA 4RNMA 2Z4PA 4CIOA 4ELVA 1R8CA 3WC2A 4ZVTB 1Q86O 2ZHAA 4Z0UA 1S76D 1HPZB 3QFWA 1V3SA 2V7ZA 1OH5A 3CIZA 1WC1A 2B5JA 3ZZYA 3AVJA 3MMCB 1RT7B 5A76A 2NRTA 2W42A 1X0PA 4P10A 4ISFA 2YWKA 3V9WA 3I56S 5DK5A 3JXOA 5EN1A 5LT5A 3OY9A 5K9FA 1X9WA 2GX9A 5D4LA 5A2QY 3E2EA 5GADI 3SAGA 3F0NA 2QI2A 2FSJA 3W3DA 4C8LA 1HUXA 3KLHA 4NLWA 4OYAA 1WWHA 4L6V3 4B3OB 3P5TL 3I8BA 1FNOA 3M2RA 3UKUB 1QQOA 1XNRK 1OYEA 2YH0A 2HG4A 4RW9A 4OX9F 1VISA 3TR5A 1LWCA 4YR0A 3G82A 1TUVA 7AT1B 1N32F 4FKXA 3O6QA 1FEEA 3TAPA 4WTOB 1M5OC 3CD6S 4ITSA 3DOMA 2YKNB 4NXMK 4DTOA 5J2MB 3I4PA 1L3TA 1T0TV 1FKPB 4GKKF 1XK8A 4CLPA 5HLFA 3PIOL 1GLAG 4YDUA 3OYLA 3C94A 2F4VJ 1BQMB 4MLHA 2V2KA 2GC8A 2DXDA 3H08A 2RF2A 2KYZA 3T5JA 5HQ8A 2FC8A 1Y00A 4RUBA 4EHUA 2ZOMA 2B6AB 4NLSA 3I31A 3C66A 3DRPB 4DUYJ 3SSSA 4K50A 2DHGA 4NO7A 1NDCA 3Q8SB 4RUCA 1UEUA 2XI2A 4LT6A 3I5BA 2DB1A 2G13A 3CJ4A 2E2QA 3FZMA 2AGPA 2IAJA 3HDSA 2XMVA 3BZCA 4JI7F 3VQEA 1Q9XA 3CC7N 1R7IA 2YKQA 4F3TA 2MJUA 3V4IA 2HGMA 4V19X 2RB7A 4WE1A 3GG0A 2NRZA 3SCJE 4O8KA 3PSFA 4CYUB 1QUVA 4WIQA 3TJ8A 5H9EK 2U2FA 4ECRA 3VQQA 4OYPA 1QJHA 2CQDA 1HBNB 4UOFA 2C2KB 2VBYA 4WJBA 2Z2YB 5LXYA 2IM0A 3SUQA 1IG9A 1HWJA 1S1TA 3MM5A 3UCGA 1SVDA 3QETA 2WSCC 4BR5A 4IOBA 3D7EO 3IC1A 3RAMA 3OTOJ 1BY9A 3DRSB 4IRDA 2EFVA 1FESA 5J1NA 3CJ7A 5DG9A 2UV8G 1P6TA 3PHTA 5GMDA 4QOZB 3FBFA 3NGIA 3CCQS 3AOBA 4M5NA 3JSMB 4NB4A 1HLUA 3HPOA 4J2EA 1SQGA 4CHQA 4RW4B 4ZCKA 4OGCA 3KK1A 2PE8A 3GOIA 3OHRA 3OYEA 3H7HB 5E33A 2CJBA 4M3RA 1IM6A 4DX6A 2ZM6K 2LYVA 2BXJA 1HQEB 4CTAA 3MXMA 3PX6A 4LFAF 3VQPA 1LWFA 3OVSA 4LF4J 2O66A 1HNWK 4YOYA 1WUUA 2DNLA 1RHQB 1MA9B 4NMXA 4C11A 2DEIA 4JI1F 1UVMA 2H3GX 2E1PA 3ZETB 3N9UC 5DS7A 3BSCA 3H4DA 2R7UA 1VIXA 2VG7B 1LAWA 4F3OA 2ZZNA 3PR5B 4JEPA 3IRXA 4FLZA 3W9JA 2P9PB 4Z4GA 1SL0A 2D74B 2LEBA 2AHOB 3W2WA 3ISNC 4I68A 2QEXN 1SIWB 2A1RA 3EO3A 5DG7A 1KVJA 1HNIB 2FC0A 3R97A 1GX6A 4C3LA 3R5GA 4K0KF 4CF8A 1H0HB 3SQ0A 2R2TA 3IO1A 3BB5A 1HWUA 3TTCA 4L72B 5J1EB 1FXLA 3D0GE 5KG4A 3KLEA 2W9AA 3HO1A 1W2BR 4P6QA 2VKZG 4F26A 3HYFA 4L75A 4P75A 3QLHA 3WNGA 5ETMA 3P4UB 2POKA 1PCAA 4DR5J 4BWJA 3SSQA 3HHLC 2JGUA 2K8GA 1H7XA 4R0JA 3E66A 3MX2A 4V19J 3SUOA 4PKDB 1P9YA 4DV3F 1RDBA 4OMFG 4KKOA 4PXCA 4QQBA 2CYYA 5EOYA 4OI0A 3OPKA 3KDOA 2WW8A 1RT6B 3BBFA 3DM2B 1VRTB 1F3FA 5J2QB 2V4JA 4C98A 3DRRB 1KFDA 5D4PA 2JLGA 5K8MA 3BUZB 4TXSA 2H51B 3PDNA 3Q0AA 3LDPA 1HR0J 1JLCB 4B17A 2O8CB 4QPTA 2MKJA 4CLSA 2OMLA 2AQ4A 4UF4A 1N5YA 4MKVA 1WD6A 4FJ7A 3ILLA 4J8FA 3CM5A 3L7UA 3RSEA 1U8WA 3BH6B 2HNZB 1YAGA 5GAHI 2QWOA 2CVEA 1EKRA 2YY3A 2O8DA 4DV7F 2YNHB 2KZMA 2YWGA 3RRGA 4JK8A 1KXPA 1REGX 1ZBHA 3Q2SC 4JV1A 2ZBCA 3CW2C 4E7JA 1Q82O 5FPMA 4Q7AA 1FJGF 1DKGD 4B3TK 2H48B 1RWMB 4DSLA 4K2XA 2RU3A 4ZITA 1TYQA 3R1XA 4JI5K 4ZN1A 4FLVA 1N33F 5EU7A 5AQNA 1JIHA 5AQKA 4WFYA 2P9LB 3ZFVA 4HLBA 4LSNA 1ASUA 1T7PA 5BPLA 2RQMA 3PEHA 1GX5A 4AHUA 1IKYB 5LMUF 1DQAA 2VPZB 2DD8S 4R5PA 3TJAA 2HBLA 2HFVA 2VOOA 2B9XA 2PYLA 2NRWA 4KB7A 4A8OA 4K4XA 1WC0A 3KLGA 1VQYA 3H40A 4BG8A 4URSA 3M2RB 3CC2S 1XMOK 3CPEA 2YI1A 1ROFA 2VU5A 5E0OA 5CR4A 3Q22A 2HFSA 2ATQA 2NPIA 2KRBA 4FWOA 3K0SA 2VF3A 4F0MA 2WBRA 1B0PA 2JFKA 1SKSA 1DT9A 5FD1A 4MKBA 3EXYA 3TJ9A 4I2PB 3OUYB 2LXIA 5AZIA 1NZAA 3FLCO 2W9BB 4JYAJ 2MYFA 3BZKA 1RT4B 5HBMB 1YJWS 3W65A 4ZPDA 1M90O 2DGXA 2OH2A 2VV5A 3A5MC 1PIEA 4K4UA 1F60B 4HH0A 1I1GA 2A6AA 1YSJA 4PUOA 1TKTA 1UAWA 1NHUA 1ITGA 2B56A 2KG0A 3D7SB 4J90A 1NKBA 5EWFA 4O4RA 2CADA 5IQQA 1VQ4S 2WVFA 5BXIA 5L38A 5DETA 4M3XA 1IBLF 4IDHA 4FYDA 2LXUA 5EX0A 3ZSZA 3ITHA 1LFWA 4LRDA 2RHSB 2HZAA 3TSQA 8RUCA 3HHDA 3CCLS 3L2UA 3WNEA 4OYXA 1FRIA 1FRKA 1RBTA 5CCLA 4E7HA 1F5AA 4LSZB 2GQCA 2GVZA 3VEYA 4NE9C 3AQOA 4J91A 2ZJPL 5GAGP 3T1YK 2PD1A 3W5XA 1NLKL 3PY8A 2RS2A 4DX7A 3TEHB 5IWAK 4CD1A 4AQYK 4HKQA 4JBCA 5CYQB 4PPDA 4XDCA 3GJQB 4WE1B 2P51A 3JSRA 4LRFA 1FERA 4F4XA 5KGWA 3QGIA 5K8OA 3ETMA 3EZOA 5AT1B 3N6NA 4IZ9A 2IM3A 2O8FA 4IG0A 4CEBA 1RE1B 1WF1A 4FNIA 5KFSA 2C2MB 2I2YA 1Z6RA 1SXLA 1WBDA 1FRJA 3Q83A 2B8QA 4FWSA 2CQ3A 4JKFA 3O2IA 3Q8QB 1DRZA 1QDUB 3AD7C 4M5JA 3AO4A 1S9FA 1T11A 3G8QA 3MD3A 4X66K 4LVOP 4A62A 5CYJA 4ALZA 4MIBA 2OUGA 3W62A 5DGBA 1N48A 4DV4J 2ZUGA 4Z4IA 4Z37A 3EE9A 5AQSA 5A8RB 4LBIA 4IFVB 4KHPK 2F4VF 4M63C 1F0XA 4IFEA 3NGZA 2C28A 3NY0A 3M6WA 3KK1B 3CMQA 1C1AA 1SKUB 1NH7A 4B9VA 1RA7A 2E7WA 3AOAA 3GG4A 2H54B 1LEOA 3ATUA 2R7VA 1U7LA 2QLWA 1IBMF 4UOHA 4FWNA 3U3YA 1H3DA 1S1VA 1C4AA 2JSXA 3Q2TC 4TU9A 4BE0A 4EMDA 4DI6A 4BRNA 2IDOA 5HJYA 1UETA 5KFPA 5E2QA 5AQWA 2DH7A 5GAEI 1H1VA 2PY5A 2ZH8A 3IRXB 1ZAWA 2HNYB 1DLOA 4LFCK 4HHTA 2E7VA 3O9QA 1WSGA 4FXDA 1CZBA 4J2DA 5BYSA 3E01B 3J80Y 3DLLL 1DTTB 1ZS6A 3KDNA 2DFHA 1HBUB 1VDHA 4LF6K 1YDLA 2V4RA 3SQGB 3SBTA 1W97L 3MMBA 3VALA 4RW7B 4XIUA 1VQ7S 2MY7A 3QICA 4CM2A 2DIVA 3IMXA 3CCRS 1KQSM 1HARA 3M2UA 3OTOF 1SPBP 2C2DA 4YY3J 5KGXA 3CNQP 1PYTA 1ATNA 3VAGA 3AXKA 1KONA 1K8KA 2KT3A 3IWXA 3HMJG 4ZHRA 2AD9A 2Y8WA 2HSTA 3DDIA 1DURA 1MLAA 3LO3A 3NP5A 2GA7A 5LM7E 2CQHA 4KKOB 2ASMA 1WEXA 4FZZA 1RI7A 2QE5A 5GIOA 3DOLA 3M6UA 3NAIA 4RW6A 3SCKE 2IHR1 3IBFB 1YHQN 1WG1A 2QWQA 2H3EB 3H90A 3CDEA 4LF4F 3NMUA 5GVQA 3EPGA 3CCEN 4DV5K 1HA1A 1N6QB 3ZC4A 2UUAK 4KGKA 2B9WA 4DQQA 2D0PA 4NLOA 1ZYQA 1SQFA 3OT9A 4ISGA 4KHRA 1WEYA 1GMWA 4ANCA 2VGNA 1TFYA 3GILA 2UU9F 2BZ2A 4A61A 3F2KA 2Q36A 5J2PB 1H6KX 2R7TA 3FE1A 4HL9A 1Y11A 4KI4A 3CJ0A 3OD2A 5IT9U 3TVYA 1SKRA 1FE0A 2I9SA 3F9KA 2VODA 2U1AA 2ITMA 1MWYA 2R9LA 4WF9Q 1UVJA 3AVAA 3CD0A 1F5CA 5D0GA 2IY5B 2F8SA 2YNGA 4V1Ak 3DXMA 2Q1LA 4LF8K 4LH5A 1CC7A 3F5TA 3HHEA 4WK3A 4C48A 1RT3A 1S72N 3NGTA 5DDQC 3MEEA 3MFHA 5LL6Z 4ZPCA 1CZAN 1SIZA 3B8HA 2I7PA 2GV9A 5B09A 4DR2K 4AXIA 1R0CB 3OL7A 9RUBA 1HHTP 2MSTA 3G87A 3KLGB 3J80U 2V67A 3D2WA 1VQMN 3VZIA 3DRXA 4ZP9A 3PZPA 3D2FB 1HD1A 2HPUA 1XMQK 3DLEB 2Q66A 3EWGA 1CJUA 5LJWA 1DTQB 3IGVA 2F8EX 4HI1A 4KHYA 2ZKUA 2CG8A 4DV0J 1B9DA 4FSVA 3H5XA 2J0WA 1SUQA 3B6PA 2UXBF 3DGPB 1FRHA 2DNRA 3DXSX 2GVDB 2CPFA 1WAJA 3OHBA 5IFMA 1U1RA 2E7XA 2YHBA 3CC4N 3BF1A 5KG0A 5B08A 2UXCF 1HBMA 1APSA 2IMOA 3CFPA 2I8EA 3R27A 4MMOA 4RNOA 3QFHA 1KVAA 5HSPA 2UVWA 3QRQA 2E2NA 4K8RA 4XH5A 5JICA 3WUHA 4CZJA 3ITHB 5KFDA 1K44A 2KVIA 4IJAA 4ZVUB 3CQYA 2P9GA 1TP7A 3LM9A 3FBBA 3I0RA 4YR2A 3SSRA 1GTHA 2HHUA 3IR7B 2BJDA 2G2ZA 3WZ0A 1LW2A 4PZVA 1UVIA 4NLPA 4DLEA 3VEZA 2BJ8A 5CYMA 1SCJB 1KBRA 5F8GA 1BL3A 2G0JA 4CBUA 4EZ9A 3VQ9A 1C6VA 3WXJA 1FFGB 3P45B 4B1VA 3GBTA 3P3DA 3M05A 2CJAA 3L6QA 2FHJD 1JXBA 1TUYA 1GLDG 5DLFA 4K43A 2JEFA 3ULHA 3MR2A 3K5MA 2O8FB 4IG0B 1H2VZ 3ENWA 4LRBA 5F0UA 4FF4A 2W7OA 2ZH6A 5D3GB 2M4MA 2R8KA 3Q8YA 3OFFA 2GWJA 2QXLA 3G86A 1I39A 3TA1A 3O9TA 4JI4K 3M8PA 3EGVA 1JCGA 3FFIB 2W6KA 3C16A 4DPWA 1B99A 4LQ3A 4BCAA 3I4HX 2B51A 1U0SA 1A5XA 3HSTB 4YOUA 1U04A 4PYDA 1S6QB 2HK3A 4ANDA 1HNXF 1ZA1B 2AW0A 1SL1A 4CJKA 4ED0A 3CT9A 4F9OA 3RAXA 4DSEA 2HB5A 4I6WA 4E1JA 4WFBQ 3ZT4A 3PW5A 1B0VA 4H0YB 5E26A 1GLFO 3PJ9A 5E3RA 4A2BA 3SYZA 4RWWA 2DHAA 3C6HA 4C97A 2OLWA 1OWXA 4G1PA 5F8IA 3QAUA 4WBFA 2AJ4A 2N3OA 2VASA 4A46A 1GOAA 2CZVC 4FJGA 1U2CA 2IYIA 3O1WA 1PC4A 2R7WA 1B64A 3JSYA 5B0BA 3BGOP 3DJCA 4Q0BB 2KKZA 4AFFA 4AXJA 4CT8A 5I3UA 3G4SS 4G1QB 4OI2A 3AA2A 3PSIA 5ADXH 3ZX2A 1XNRJ 4L8RB 2L9NA 3BR9A 3AO3A 1X5TA 3NF7A 2CJYB 3U1NA 4JRQA 2OPSA 4X64K 1IN0A 2Q0RA 1DARA 1BO5O 1VC6A 2O8BA 1DLOB 1FWKA 1HWIA 4DR4K 3UQSA 4FWLA 4Y0WA 2L9DA 4A8XA 5JVGQ 5DQGA 4KH4A 3H25A 3UNGC 1EB0A 3OS1A 3T6BA 3F9MA 3B6OA 3MEGB 2CQGA 4FPAA 3VQ4A 4NXMJ 2KB2A 3QT8A 3MMBB 1EQYA 1A5WA 4Z4CA 3TX8A 3FQLA 1A7GE 3UCZP 2NSBA 1RK8A 3QRPA 5F8HA 4E7KA 5KAKA 4B02A 3AGKA 2OTLS 4RX6A 1OPZA 2FHMA 2CQ2A 3MXJA 2YHWA 1EJ7L 3KK2A 5KFJA 2HFZA 3WNFA 2KM8C 1V4SA 4DCHA 4EHTA 1XHZA 1CJKB 3NCRA 1HLWA 3TZWA 2D0OA 2XTJP 2NUBA 3TI0A 4B3RJ 1OQ3A 3DLKA 3GJTB 4CEEA 1U0HA 2ACMA 1JCEA 4M1KA 3M1FA 1Q78A 2DH8A 1JLQB 2JL9A 2APOA 3P8BB 3CIMA 1QSLA 4PQUB 2FB0A 2OGUA 2KH9A 1VAZA 3U8XA 3VV2B 4CIEA 3DYAB 1VQKS 5CQGA 4C8KA 1XNQK 1GAOA 2Q3SA 1QZ5A 1VQ6S 4RPFA 4H5RA 5BPMA 5H9EJ 5AQLA 4DR7J 1T05B 3VA3A 4I0WA 4E7IA 3IKMA 3L3UA 1MW7A 3HJVA 2R8IA 4F0HA 2BKOA 5FRMA 5F9LA 3WDOA 3E9LA 3CGIA 2E5JA 3NOCA 3PV8A 3JSBA 1MWZA 4C2MA 1Q8LA 5CD4A 3WHIA 4PQAA 3PW7A 1QE1B 4H4MB 4K7QA 3I8DA 3PW0A 3D2EA 4KRFA 1B3TA 4I7FB 4BS2A 4KSEB 3CB4A 3SBMA 5EX3A 2OZSA 1U09A 2K06A 2MQMA 3L2VA 4BC9A 5AE2A 1EQMA 4ECUA 4BC7A 1HD0A 2OSQA 3HM9A 3FGUA 4X62J 2YNGB 1SJQA 3BQ1A 4DV6K 2BV3A 4ECVA 3O3HA 1RTZA 3I56N 3B82A 2RQ4A 3S3NA 3MEDA 4NLTA 2VFRA 2E88A 4YY3F 3DLBA 1C0GA 4GMJB 2CPIA 2EK1A 4OO1J 2ZM6J 2E1RA 5AFUA 5A8WA 1M1HA 1O0PA 4J7CA 3ID6A 1JL1A 2Z1JA 3S3MA 2C2RA 1HNWJ 3Q86A 3W2VA 2VJUA 1ULRA 3MUTP 4E8UA 1BCMA 1J5EF 2JFDA 5HK4A 3GTYX 4BDYA 3TAFA 4DJBA 3TVZA 1D9FA 3ZTRA 5B7WA 1SBRA 4WYWA 2OPQA 3ZX0A 4PG8A 2JEJA 3MMAB 4UQTA 2RN2A 1VQ8S 2PMHA 2YX6A 5HMZA 3UVJB 2MHEA 2IRUA 1RBRA 3CD6N 4IKAA 1NGDA 2MKKA 4N77A 1TL3B 4HUGA 3BN4A 2NLWA 4H5VA 4KHNA 1E6YA 4CLWA 1ZM3A 2V0NA 2M9KA 3SFUA 5KFIA 4DF4A 4DS5A 3HXMA 3V6KA 5IT9O 4FWPA 1UWBA 3PTWA 3TPQA 5GADP 5EVZA 5L9NA 4X4PA 3AOCA 3QMLA 3P4IA 3L2QA 4ILGB 5FDLB 3BR8A 4CEAA 1RHUB 1ZBUA 4FJ9A 4PABA 3S6EA 3VVTA 1WJ9A 2ZBQA 5EHHA 3ZSXA 2HQCA 3J81U 3VEVA 1EXQA 1AFIA 4DUZF 4P2XA 3EKSA 2C22A 1I6JA 2ITGA 4LF2A 4X4TA 2ZD1B 2IVPA 3AVBA 1S3XA 4QIVA 4F02A 3P38A 4H8KA 1PC5A 3VERA 4I2QA 1BDGA 2LQBA 3SQ4A 5I4MA 4C3KA 2A10A 5B0DA 2A5XA 3O5BA 5IV3A 3M32A 2BQ3A 2XHWA 4ZLJA 2B4PA 3C65A 2MQOA 3M8SA 1CZ9A 3I87A 1NK4A 5DO2A 3VCDA 4BR4A 3EVOA 1YJNN 5LJ5Y 2XBPA 2DIUA 5AQMA 2PEBA 1RWUA 4AM7A 4DU7A 2VPYB 3LW5C 3M2VA 2EG1A 4QYRA 1CBKA 3WIVA 2W01A 3NS7B 1O1WA 2FDNA 4UUXA 4J9QA 4Q8EA 2ZBPA 3AGRA 2IOCA 5E5NA 2CJQA 4JS4A 1CULA 1Q0NA 4DV0F 1TL1B 3AHPA 3TQ1A 4BY9C 3QSYB 3P5JA 3MOZA 1K0TA 3CCQN 4CJ7A 1GTEA 3NE6A 1RTHA 1U1PA 4IO9L 5DDRC 4DSFA 3CIPA 4O4GA 3O9RA 1OYDA 2YKMB 1MROA 1SZ2A 3UFCX 1VK0A 1VQSA 3B78A 1SJ4P 3L95X 1RT5A 4NYFA 1FRLA 2BRKA 3H4BA 2M88A 4DS4A 2HNDA 4B3TJ 2AJQA 3NGUA 4PYAA 5KFEA 5ETOA 3HVRA 4ED5A 2BKNA 4JI5J 4CESA 2Z1GA 2AT1B 1FXXA 4XEIA 3CF5L 4Y34A 1S6PA 1B7FA 4FK0A 1NHKL 4UQGA 4K4SA 2KXHA 2E1ZA 4DU8A 2GEMA 5KFCA 5AQTA 4HCCA 3CQXA 1Q7LB 1YT3A 3MMJA 4DR6K 4JKEA 1FJCA 1BC6A 2I7NA 4M95A 2XZTB 3QDKA 3H5UA 4A48A 2DY4A 4ED6A 1N5VA 4J9MA 5I3UB 4EP4A 5C24B 1NDLA 1NOYA 1XMOJ 3AARA 1HI0P 4C0BA 2UV8A 3AAQA 2HMPA 3E51A 2KLAA 1RAAB 1WF0A 1KHVA 2RH3A 2X74A 2DFEA 1M1KT 3EDQB 3M30B 5THWA 3AB2B 2DR6A 4K4TA 3OVBA 3N6LA 1WG4A 2M3DA 2FZGB 1RGVA 1K47A 3QBWA 4H03B 3J7AP 2GIRA 2HLUA 4LBPA 1VIOA 4NYOA 3WXIA 4GKJF 3VTIA 1A6LA 1BLUA 1TV6B 4MQ3A 3C3LA 1AZSA 3DHXA 2KJVA 1S6OA 2ZH5A 2HBZB 4GW6A 1ATSA 3ZZRA 3WIUA 1RNHA 1UP1A 3J7YI 2O4GA 1N36K 2V51B 5M1FA 4M3YA 2HHXA 2HURA 2W40A 1KLMB 2QZ8A 4NEZA 1M1GA 4O55A 4RCHA 1TR0A 2FY1A 2YHYA 1GOBA 2DCLA 2RSQA 2HMIB 4RKUC 3T1YJ 2MQQA 1H7WA 2BUPA 3ADAC 3LP0A 3D6TB 3HM8A 3FBCA 1S1UB 1CLQA 1GEHA 3G6ES 2DT9A 4AQYJ 2AF6A 2JVOA 3ETOA 1N8RT 4FJKA 3LGNA 3EMTA 2OP5A 3TAGA 2W2NP 3VQCA 1HYZA 3TUJC 2RDJA 1UJ6A 3WC0A 1XNRF 2B43A 2XZWA 1EKSA 3JYTA 2MZJA 3BBCA 4ZVRB 4O3QA 3QBXA 4GO5X 3HOSA 5HP1B 2DNMA 4AHCA 1MN9A 3C19A 2XGPA 1NLVA 4WIIA 2P9SB 1FDAA 4DWIA 4PKIA 4X66J 4FVUA 1D0EA 2WTUA 3TU5A 2GUIA 3GV5B 3HFKA 5KI6A 5KFNA 5MAOA 2QJ3A 1NNDA 3QO9B 2JX2A 3CE8A 3ZTOA 4NLQA 2B4VA 4EYIB 2J5AA 2V6AA 5SZTA 4KHPJ 1ZAVA 1BXNA 4GVMA 1JL2A 5AQZA 3FJ2A 3VQTA 2P5OA 1O8BA 3SV4A 4QIFA 1LW0A 2NQPA 2XI3A 4OGEA 1DEJA 2F9TA 5LSLA 3C6TA 4FXWA 5LSOA 4H0XB 5KRTA 4HUEA 1Y5NB 2JJ4D 3KFWX 2UVVA 1YJUA 3KK3B 2KFNA 1N88A 3NNHA 1VK3A 1EIYB 4E1MA 3CC2N 2P9UB 2XQCA 5GAHP 2RHQB 2P6SA 1TMJA 3EE3A 5D78A 2BR0A 4W5TA 2C3MA 2FBXA 3PHEA 2LQJA 3KG1A 4EZ6A 1CEZA 3BDEA 2XWYA 4RWTA 1NM1A 2MKSA 1KRPA 2QL7B 5M2RA 4DN0A 1YJWN 4NMLA 1HFEL 1NM2A 1NU4A 2DNKA 4WCEQ 1E6YB 1VSLA 3SXLA 4DR3K 4ZOSA 4CEFA 3ENAA 4CGDA 4FVCA 2F9DA 2QGFB 4LF6J 1UWBB 5IT4A 4NCBA 4Z7CA 1U45A 1R8AA 1U1OA 3DXKA 2QLXA 1RAEB 4B3SK 2R2SA 2XMKA 3TWHA 2UXDK 1KCFA 2L41A 3SQ2A 4N76A 2JC0A 4ZTFA 4W4MA 1JJHA 4ID8A 3AXMA 2DNYA 2NRVA 3P83D 3CCLN 2ZVIA 4LF9K 4ZPWR 1M5VC 5ETVA 2R7XA 1S1XA 5KPZA 2OFHX 2YH1A 1HX1A 2EBGA 4DL0C 1X4DA 5T7BA 1NSQA 3D1QA 5JVGL 4GRSA 2P9IA 4HHUA 3HZEA 2WSFC 3WQTA 1S5JA 2HHQA 2E1CA 3OXFA 1JJ4A 2NLXA 3NGYA 1SV5B 3BGFA 3KHYA 2UUCF 4M5DB 1C0FA 2D3O1 4OZJA 2YCHA 1HNWF 1RDAA 4DV5J 2W4DA 2RILA 2LEAA 2UUAJ 4M5IA 1U6ZA 4YQWA 1Q8IA 2LA6A 1S5ZA 2ZQBA 3M2VB 1TL4A 2CZ4A 1IUJA 3H42A 4JI6K 2D7SA 4JNEA 1T9XA 3VWSA 4AHRA 2B8PA 5H9FK 2CDQA 2VCPA 3LGMA 2H9ZA 3O3LA 2FLNA 4U7UD 1GQEA 4USKA 2DHSA 3VQSA 3W63A 1ZC6A 2J6TA 3SDEB 3O1BA 2JEIA 4O4GB 4K4ZA 4HWIA 1GT8A 3KHLA 3G0ZA 4F4WA 3PR4A 3MWBA 4KV8A 2FD2A 1OVYA 3VPZA 2P5VA 3M5RA 3CJCA 4W5NA 1Y10A 4Y2MA 4BRPA 4LF8J 5KFRA 4ZPTR 2HNDB 4X4NA 3J81O 1UZDA 3K8WA 4NLYA 2KYXA 1OKJA 3NF6A 1BU6O 1IR0A 4EU0A 3O6WA 4JI0J 1EHWA 5J2NB 3X1LB 4DTNA 1GXTA 1JJ2R 3CJKA 2WVBA 1X4BA 1G3OA 5D6GA 2NZCA 2C2EA 2XLJA 4H4OB 3WX8A 1HKBA 4DR2J 4WKRA 3P31A 5U47A 2V68A 2QFIA 3RW7A 3BF3A 3OYMA 4XH4A 2ZDPA 5C10A 3KUHA 4NLVA 4ICLB 4OPKA 5ETSA 4RLEA 4YOWA 1XMQJ 4KH0B 3MAAA 3SZ2A 3NNAA 3QT6A 1KQFB 4NRTA 3CCZA 3OSPA 1PJ6A 5T7LA 3O8MA 4OJGA 2CQIA 5HJXA 1RTDB 3EPIA 1S99A 3MXHP 1PBAA 2OPPA 3MI7X 2LMIA 5E3PA 4D3HA 4MDBA 2CPHA 2WRMA 3ZCMA 2Q97A 1VQ7N 2C1EB 4CZHA 3CCRN 5EX5A 5A6WA 4QWBA 2GHWA 4N8OA 5K14B 3NG8A 3GB0A 2X6SA 4IWVA 2DPJA 4FWKA 3VEXA 4JRPA 2XGQA 3VTHA 1R0AB 2Q79A 2DXEA 3I32A 5HQLA 3QFUA 1XI1A 3UDCA 4G3IA 1NGEA 2OAUA 1B92A 4L3NA 3V4MA 1NGFA 4M45A 3CD7A 5GAEP 1BI4B 1VSJA 5B0GA 3LPTA 4DZDA 2GHPA 1NH8A 2CQPA 2O1PA 4FKYA 5GAGU 5M1QA 5EDWA 3CTRA 2LEPA 2ZE2B 5HVFA 2CPJA 3DCAA 1ZBSA 2F8HA 1N34K 5JS1A 3LP0B 1VBXA 1S4FA 3AVCA 2GELA 4C3MA 4UOCA 4MFBA 2HIYA 4WU3A 3CJTA 2E1YA 1LFPA 4NYPA 4JUZA 3PX0A 3WNHA 4C4WA 5AQPA 3RRHA 2ZH9A 1SKWA 3VGLA 4IOAQ 2QFJA 1VLYA 4EO6A 3PJXA 1KN6A 4ZPBA 4DZ6A 5F3ZA 2DRBA 1CXUA 5E84A 4IG3A 1KNZA 1X7VA 3AVLA 4DMZA 1H74A 1FX2A 2ZH1A 2N82B 4YNQA 2OD4A 3OYFA 5DG8A 1K8AT 1S9EA 2MDAA 1WELA 2NZ4A 5DMRA 2OPRB 2HHTA 1NJZA 3MMVA 3MWTA 4JI4J 3U02A 1RISA 1TVRB 4X2BA 4HTLA 2YNFB 3ULEA 1ASVA 2N3LA 2BMBA 3LH2S 4ID5A 4IDKA 2H5IB 2QSFA 4EBCA 3HRGA 2HRUA 2LECA 4KI6A 3GWCA 4PG7A 4QYZK 2FLPA 3CO9A 5KPTA 2EVZA 3DNCA 1U2VB 2F8MA 2E5IA 1BWFO 3C6TB 3LA0A 3RBXA 1IQTA 2FBTA 4ILLA 2GMJA 3OS0A 3DAWA 3LZJA 1VFJA 2QWRA 3KXDA 2MZTA 4WFNQ 2VFSA 2WVCA 3QMQA 1N0VC 1GLJO 3ENVA 4Y3CA 2YX7A 3C7NA 4LR8A 4F4KA 1QZ6A 5KG1A 4AL6A 3MOJB 3T1YF 2ZOFA 2XO7A 4KFBB 3PIPQ 4A2AA 1PJ5A 5KOWA 1FXDA 1GH8A 5IWAF 2YKPA 2IGIA 4DR1K 3ILIA 3PEJA 1U49A 4WXWA 4X64J 5B0FA 1XR5A 3MCNA 3MUVP 2XYGB 4O3PA 3FEXB 4FPBA 2FHJA 1VSIA 2DEJA 4DR4J 3RBDA 2KKHA 2ADCA 1OVQA 3THXA 2VZ9A 3HSDA 4NCGB 1VQ9S 2Q43A 1L3KA 2J9DA 4YB1P 4OX9K 3DXKB 3EZWA 3L4BC 3F44A 4YB5A 1YVUA 3OR1B 3CFRA 4W90B 4CH7A 1J27A 3HVWA 3IM9A 4DUTA 4FW2A 1N32K 4PL8A 2ZJQQ 3G6VA 4J9OA 5CZ1A 2L48A 4KTWA 1HWLA 4HR2A 2G8VA 2O67A 3H59A 3K5OA 3KLIA 3KJNB 3SIPB 2J9EA 4NZ0A 2IC3A 1G1XA 2RUGA 1R89A 4KHPF 2GCFA 3CXCR 2XYHB 4CRJA 4J9LA 4R25A 3CCWA 2XMMA 4QBUA 2VQEK 4P2MA 4CNZA 2Q1NA 1YRUA 2IJFA 1H2TZ 3R5DA 3O8WA 2W8LA 2BOPA 1PILA 3PNIA 1JLBB 3BV8A 3L4QA 1HPZA 4H0OA 1HI1A 3D1OA 3MPWA 2OEJA 1V3RA 3MK6A 1XNQJ 3MMCA 1RT7A 5GMKa 1TL5A 3T1HF 2KN4A 5ETNA 4ER8A 3QBCA 2F65A 4DFPA 5HRSA 3IM8A 3BS9A 2GS8A 3CCSS 4C8OA 4DV2K 4JI7K 4I69A 2BANB 3A12A 1UMJA 4HDGA 3C6UA 3GL1A 3K9JA 1S0NA 2FJXA 4LFCF 5BREA 3TRGA 2YWFA 3HULA 1T9UA 3ILOA 4HHHA 3ALYA 3D4JA 1SJ1A 4B3OA 4BROA 3NFAA 3DFEA 4RJVA 3UKUA 2EC0A 3WXMB 3GPAA 4B1UB 4LF6F 1YJTA 3WX4A 3FC9A 1WBBA 2H65B 3JQJA 3SAHA 4DV6J 4FJXA 1JWWA 3BGLA 1SH3A 4FXVA 1S7HA 4CZGA 1NU0A 2YKAA 4AD6A 3SUPA 1NMNA 4KGVB 2J8AA 3MR7A 3JQKA 4CO0A 3DLRA 2ZH3A 4FLYA 2H5JB 2YKNA 4FF1A 4CP5A 5J2MA 3OYHA 5MLCQ 2Y1JA 4IEIA 2YQ3A 1Y5LB 1YRXA 4O3SA 1FKPA 4FLWA 1NSKL 5DM7Q 2HGLA 3BPSP 4HT7A 2EPIA 1Y97A 4JV5J 3G4SN 1PO6A 2HZCA 1BQMA 2N7CA 1NAQA 4IUFA 4KAZA 1ZM9A 4CJTA 1MU2B 3KUGA 1YJ9S 4DOZA 2NNWA 3H98A 3O5TB 2D3UA 4QS9A 5HQMA 1IBKK 2B6AA 2QMWA 5LMNJ 3ZEUA 4S0MA 3DRPA 1P1TA 3THPA 5KT4A 1LWEB 5T7LB 4YP3A 2ASLA 2X1FA 4ZPAA 4P2FA 2UUAF 3TP2A 3ZT1A 5HMWA 5TKWA 4JI1K 2QW9A 4EBDA 2CQ4A 2ATCB 2QA4S 2RRBA 3ZZUA 4EYHB 2IA6A 3D67A 2RU9A 5FLXU 2OKQA 1J6ZA 3MPUB 4YDUC 5A8KB 1K9MT 2OTLN 3FSIA 4DQ8A 3KHRA 3HSCA 3P96A 4TLRA 2OIHA 4WZMA 1NGIA 3DMJA 4CYUA 2W2QP 3E9PA 4Q5VA 2RRAA 4NLCA 1HBNA 2N4DA 1EP4B 6AT1B 4K4VA 4WFAQ 4B9UA 5KTQA 4K0KK 5KFMA 2ADBA 2YTCA 4G9ZA 1H73A 4JKCA 2VPWB 1PJ7A 2O8EB 4ANEA 3FGVA 3QIPB 1TKZA 3S3OA 4LF8F 2VQFK 1MG7A 1DQ8A 1XBWA 3DRSA 1NGCA 2QK9A 3QQCD 2R8JA 4AUKA 3V9ZA 2DGTA 3W66A 1EETB 1VQKN 3FMBA 3THVA 1K73O 3KG4A 1HKGA 3JSMA 1UFKA 4NZ7A 4FLUA 4MFBB 2HFOA 1VQ6N 2OCEA 3CDBA 3TA0A 2QO3A 1RB0A 4P2SA 2WHOA 3OYKA 1FXRA 2NYIA 4UUWA 4ELUA 3F41A 4RW4A 3GFXA 4OJRA 2RQKA 2WONB 1X60A 3LDLA 3SAFA 4FWQA 4FM2A 1SJRA 4WZQA 1D8ZA 2IVMA 2RDIA 1HQEA 3LWLA 4IG3B 3O4WA 1KD1O 2K3KA 1T8EA 3W5YA 4IFYB 3MX5A 1FVSA 3H0PA 1RGIA 3IXQA 2LDIA 3N0VA 1HYVA 2FF3B 4FZVA 1RTJB 2VA2A 4Z2XA 3A8YA 3RG6A 1NKEA 2XWXA 4M5GA 2CNLB 1VQON 3J81j 2E5GA 2VG7A 1X0FA 1NB2A 5E41A 4Z4EA 2X7IA 2OTJS 2EX3A 2P9PA 1X5OA 2BDPA 4X4VA 5KFLA 4PXEA 3ZSRA 1S4EA 4ZJOA 2HHWA 3K2PA 4LUBA 4CEQA 1HNZJ 4DV7K 5LXRA 1H38A 3D28A 1JXEA 2AKWB 5HL7Q 3NL0A 5J1EA 5LSRA 1R59O 2PT0A 1RWNB 5DM6Q 2LQ9A 4DR6J 1RAOA 1VI7A 1T3VA 1KAYA 3MCOA 3CQ8A 4MDAA 1N33K 4BGAA 4F0KA 3PYDA 1BQXA 4E19A