4IFVA

Detecting allosteric sites of hiv-1 reverse transcriptase by x-ray crystallographic fragment screening
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
556
structure length
556
Chain Sequence
MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Exoribonuclease H, p66 RT
publication title Detecting Allosteric Sites of HIV-1 Reverse Transcriptase by X-ray Crystallographic Fragment Screening.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase/transferase inhibitor
total genus 167
structure length 556
sequence length 556
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4ifvA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ifvA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ifvA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ifvA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ifvA05
1S4FA 4CEFA 4KFBB 2YHAA 4BDYA 4KHMA 3QERA 3I0SA 2ZD1A 3PR4A 1L3TA 1S1VA 1RTDB 2C28A 1RT4B 4KV8B 5KFYA 4W5TA 2V9WA 2OPPB 1IKXA 1TL3B 1NHVA 2KFZA 1UAXA 2W42A 1G15A 4ECXA 4CJKA 5HROA 2C2DA 3AVIA 4EYHB 1K6YA 4O5BA 5KFLA 1S6QA 4IR1A 2BQ3A 4ZVEA 4LQ3A 1IH7A 3OHAA 4RNFA 2OZSA 3SUNA 3QIOA 1RT6A 4Q43A 4Z4FA 4RW8A 5L1IA 2YNGA 4EO6A 4L8RB 4H4MA 3GQCA 3RMCA 2HMIA 4J2EA 1RTJB 2LSNA 5KG2A 4M3WA 2DTUA 1GX5A 3KLIA 2YNFB 4CF0A 4O0JA 4AHRA 4NYNA 3ZSYA 3LP0B 1Y97A 5JXSA 5DG8A 1BI4B 3V1QA 4IR9A 4ECRA 3VQEA 3T5JA 3C6TB 3NE6A 3KHRA 1FKOA 1S10A 5F8NA 4OJRA 4F4KA 1N5YA 4CIEA 2EHGA 3K5LA 2FJVA 4CIFA 5KFUA 4K4XA 3OYEA 1WSJA 5JS2A 4E7IA 1A5XA 4F8RA 3HKWA 3KK3B 5KFSA 3LP1A 4O44A 4CJVA 1WSHA 4JRPA 4MKBA 3SQ2A 3N6NA 4FLWA 3KLFA 4M95A 1JLFA 3N6MA 3QINA 4N56A 3I0RB 4KAIA 3PR5B 4CJUA 3VQQA 4HCCA 4AHTA 4FYDA 4B9NA 4DF8A 3NDKA 4CJ5A 4RU9A 3BSAA 4DQQA 3SCXA 1XHZA 3K5NA 4B3OA 3TAMB 2X6SA 4CE9A 4DEZA 1QAIA 3SUPA 1C1CA 1NKEA 2IJNA 1S9FA 4ECZA 2A1RA 3ICLA 4WZMA 2RDJA 3TANA 3GIJA 5C42A 3MR2A 4J2AA 3OYMA 3BGRB 5HLFA 3OVNA 3LDSA 4NCAA 3KLEA 4E1NA 3L3VA 3PHEA 2UVWA 1JL1A 4KHNA 4CHOA 2JEJA 1S0MA 4I7FB 4F50A 2F8TA 2I5JB 3B6PA 2HVHA 1S9EA 1QHTA 1C1BA 4NCGB 4DU3A 3IGNA 4C8LA 1VSMA 3KKSA 4URSA 1W9HA 4QWDA 1KLNA 3IRXA 4RNMA 3LP2A 2ASDA 4KREA 4TY9A 5HBMA 3UQSA 2FVSA 4HUFA 1TK8A 1FKPB 4FJLA 3KLGB 4ECYA 4TQRA 2XWYA 1DTQB 1JLGB 3I5AA 3GIMA 2AWZA 2BDPA 3O3HA 2BE2B 1ZBHA 4DL6A 2FJWA 4EO8A 1J5OB 4URGA 4AHCA 1KVCA 1TKXB 3T5HA 3DRPA 1S1WA 3L2WA 2IM3A 3RMBA 3M8SA 2YNHB 2JGUA 3NH2A 1NJWA 3THVA 4ZMMA 4NLRA 5L1KA 1JX4A 3DOKA 2QXFA 4U6PA 3HP9A 1TKTB 4CK2A 3H5SA 3M8QB 3ZSOA 3HPHA 3CJ4A 5DLFA 4Q5VA 3AVJA 1BL3A 5C25B 1RA6A 3OYCA 4TY8B 1SKWA 1VK0A 3TVKA 1C6VA 3LZJA 4I9QA 3DLEB 3S3NA 1JKHB 1K1QA 1HMVA 4M41A 3H4DA 2XY7A 4RW7B 4KPYA 4JV2A 1B92A 1JLBA 4KRFA 4RW4B 4ZVGA 2Z1HA 2VG6B 5DQGA 2ASLA 4I9LA 3LANA 4Z4HA 3RRGA 2HHQA 4FZZA 2WRMA 1TAQA 5JUMA 1Q9YA 3RR8A 3MFHA 1QE1B 4C8KA 4RUCA 3ZT4A 4IH7A 4FS1A 5KFVA 2VA2A 3CYMA 2E6MA 1JLCB 4ED6A 4OKKA 2HNYB 3FQLA 4ZVHA 4EBDA 4FLZA 4H54A 3M8PB 1IG9A 4Q45A 3M8RA 1RDRA 2UVUA 3VQ7A 3QIDA 1QAJA 1GX6A 4HUEA 3L2QA 2OA8A 1N6QA 1UA1A 3RB4A 4FS2A 1N56A 1XC9A 1BHLA 3NKYA 5KT4A 3P5JA 4G1QA 1RT3B 1GOBA 3V6DA 5C24A 3JSMA 3KHHA 4J9RA 1DTTB 1MMLA 1VSLA 4CFAA 5KFPA 2E9TA 5J2MA 1QTMA 4NYZA 1TV6A 4DL7A 2NUBA 3KIOA 3V1RA 4PQUA 4J9NA 2HWHA 3T5LA 4NCBA 1ASWA 2VA3A 2OH2A 3ZSRA 5K14B 1BIUA 1QSYA 5KFKA 4PA1A 3V6KA 2W9AA 1RBVA 1BCOA 4DL4A 4HVJA 4CECA 1KRPA 3EZ5A 4KHSA 5L1JA 3Q8RB 1RT2A 4WFYA 4GMJB 3CDUA 3V9ZA 3EYZA 5D3GA 2AX1A 5KG6A 5KG4A 1CZ9A 1LAWA 3AA2A 2G8UA 3LP3A 4KB7A 4ECSA 4DTUA 2VG5B 4J9LA 3IAYA 4CGDA 3ULDA 4E7KA 4KE5A 2AGQA 3M9NB 1JLEA 2OPSA 4DS5A 2FLLA 3K57A 1KFDA 4DS4A 2A1SA 3ASMA 2IS3A 5FDLA 4B08A 4RUAA 4N76A 2J6UA 4F4ZA 5KT2A 3DM2B 1LWEB 3S9HA 3OYIA 4FZXC 2Z1GA 1IKWB 5L1LA 4NZ0A 4Q0BB 4BE1A 1TL1B 3QLHB 3NBPA 3KLVA 1S6PB 1YTAA 3QGGA 3AVMA 3AO2A 3SJJA 4MFBB 1IKVA 2GC8A 3T5KA 4RW6A 1S1TB 1VSEA 3MECA 5T14A 5KFQA 1LW2A 1C1AA 4CESA 1RT5B 2W9CA 3RBEA 2OPRA 1T03B 1T05B 1S48A 4E7LA 1ZBIA 3DDKA 5KFNA 3LPUA 3AO5A 1YT3A 3TAFA 3NH0A 3KK2B 1C0TA 1S1XA 3V81A 4CF9A 4NRUA 4B9MA 4O4GB 2GIRA 2XY8A 1D0EA 4CJEA 2IM0A 4I2PA 2VWJA 1X1PA 3PW5A 3H5UA 2XRIA 3TI0A 3VN5A 4I2QB 2V4QA 4WYLA 2G8KA 2XCPA 2B6AB 3OYLA 2WOMA 3MEDB 4GC7A 3MEEA 3VQAA 4DQPA 4ED8A 4H8KA 3K2PA 5KFOA 4J9QA 4K4ZA 3SI6A 3KJVA 4PUOB 2ILYA 1XR7A 3H40A 3E01A 4F2RA 4ECWA 4WE1A 4DSLA 1C2PA 1HNIA 5KFBA 3VQBA 3EPGA 4O4RA 5DGBA 5DG7A 2ITGA 3OS2A 1Q9XA 3V4IA 4LQ9A 3Q8SB 4DU4A 5CYQB 1X9WA 2WCXA 3ISNC 4DFMA 4NLVA 4M3RA 1FK9B 3CJ5A 4FLXA 1RTHB 3AO3A 2IM1A 3KLHA 4CEZA 5KFTA 3SPYA 2QE5A 4Y34A 4ECQA 5CZ2A 4DTRA 1RAJA 1HNVB 4GVMA 5J2PA 2OZMA 2WTFA 4RNHA 1LW0A 3IG1B 4KKOA 4DTJA 2OYQA 1SV5A 1RT1A 5KGWA 4MIBA 1RBRA 4AHUA 3LAMA 4CHYA 4DTNA 3CM6A 3AO1A 1MU2A 4IRDA 3L2VA 2R7YA 4DG1B 2IAJA 1EP4B 4WXWA 3O4NA 2FBYA 2F8EX 3BSOA 1NK8A 2XC9A 1J54A 4XO0A 1KVBA 4J2BA 3KK1A 1D9FA 3MR6A 2VG7B 4C8NA 3NF8A 2PYJA 3DYAA 4R5PB 3QETA 3BR9A 3LAKA 1HQUA 1SL2A 1KTQA 1JLQA 1JLAA 2FLNA 3RB3A 5KFCA 4NLDA 2WONA 4BWJA 1RTIB 2YKMA 3QO9A 3QZ7A 1VSIA 3DMJA 5SWMA 1TKZA 3WNHA 4CJSA 4CJTA 4QOZB 3KMSA 1TK0A 4PWDB 3GV7B 1JLFB 1BQNB 4XPCA 4GW6A 3O3GA 1QSLA 1BISA 5HRPA 4CEAA 2BR0A 1X9SA 3OLAA 3DOLA 1IM4A 2R8IA 3ZSQA 3ITHB 4KHQA 3AVBA 4LSLB 1RYSA 4FBUA 4XIUA 3TR8A 2YNIA 1NHUA 4DQIA 3F73A 1S9GA 4KHYA 3RWUA 5KFDA 2GIQA 2R8HA 3MAQA 2WHOA 4CGGA 4H4OA 1T7PA 3AVCA 1JL2A 3OL9A 4NLTA 4EYIB 4LSNB 3E51A 4X2BA 3S3MA 2UUWA 2HHTA 4M3UA 2GV9A 4ICLB 1YVUA 3RB0A 3AVHA 5CY4A 1VRTB 1T94A 4C8OA 4NYFA 4IH5A 1NK4A 5KFEA 1REVA 3CVKA 4R8UA 1GOAA 3BSNA 3SV4A 1EETB 4FJHA 1KLMA 3OS1A 1RT7B 5J2NA 2BANA 3HPGA 3DI6B 4E19A 4CJQA 4IFYB 2JEGA 1SL1A 3QESA 4ED7A 3A2FA 4OPKA 4FJGA 3CFOA 1VRUA 2YKNA 3RAQA 1W0HA 5J1EB 3H5YA 3HVTB 2J6SA 5T7BA 2W9BB 1TGOA 3TAEA 1NK9A 2HNZB 5KFAA 3UDLA 3DRSB 2BQUA 1S97A 4KAZA 1LWCA 2YV0X 3NH1A 4DSIA 3U3YA 4NLOA 1KCFA 5HP1B 1DLOB 4QCLA 4IG3A 4NLWA 3CFPA 4KFBA 2DFFA 3AVGA 2FBXA 4OL8A 4N5SA 4QWCA 3ZSZA 3H5XA 3DLKB 2IDOA 1FXXA 2KW4A 2JEIA 4FW1A 4KSEB 4ZTFA 2X6NA 1R0AB 3KKRA 1RTDA 4J9KA 4CF8A 1RT4A 4KV8A 1IKYB 1RDCA 4FW2A 4TYBA 4J9OA 4K4TA 2OPPA 4EBCA 1TL3A 4KB1A 1RCHA 1BCMA 4EP5A 3GV8B 3DRRB 5I42B 3TQ1A 5KFMA 1WLJA 4YR2A 3V9SA 2HHSA 1WAFA 2DFHA 3MEGB 1WN7A 4Y2CA 2PZSA 4MK7A 4O3SA 4OKJA 1S1UB 4B9LA 3TWHA 2G8FA 3IN5A 4E1MA 1RTJA 2RF2B 5J2QB 4Q44A 3HO1A 3FRZA 3MFIA 4CJLA 3HT3A 5SZTA 2YNFA 2R2RA 3QEPA 2ZQBA 4Y1CA 4RW9B 2XHBA 1WNSA 3MR3A 3TABA 3LP0A 4FVMA 4ID5B 1BI4A 3FFIB 3G86A 1RYRA 2ZE2B 3BDPA 3GIIA 2AX0A 3V6HA 3C6TA 1CZBA 4IKAA 5HRRA 4FLUA 2FBTA 2AGPA 5I3UB 2GBZA 3OYKA 3OJSA 2UVRA 4K4YA 1WSGA 1UA0A 3L3UA 3JYTB 3KK3A 2W8LA 3OL7A 1RNHA 1ZBUA 4B9TA 1SUQB 3OSPA 3I8DA 2I1RA 2DPJA 2ETJA 4FJXA 4O3NA 3OYBA 1Z26A 4OPJA 4FM2A 2R2TA 4KHWA 3ALYA 1ITGA 1UWBB 4JV0A 1BQMB 4CF2A 3I0RA 3NF6A 5DLGA 3NAEA 5HRSA 1J9AA 4M45A 1KFSA 3F9KA 4FJ5A 4CGFA 4IDKB 4BACA 2R2UA 4FM0A 3K5MA 4KO0B 1ZTTA 2G8WA 1XR5A 3QEWA 4ZHRB 1CSJA 4DL2A 1XHXA 3PVXA 1HYSB 3TAMA 1X9MA 4AHVA 1RILA 1XWLA 1TVRB 3LZIA 4E3SA 3SQ0A 2B5JB 3CFRA 3BGRA 4LH5A 2QK9A 2IC3B 1VSDA 2FVPA 3HPOA 1HPZB 2IJFA 1TP7A 3B6OA 5EDWA 3MXMA 3SFUA 4OGCA 4I7FA 2I5JA 4YR3A 4IFVB 2BGGA 3LWLA 2HHUA 3MXJA 3RB6A 4CHNA 2KTQA 3PW0A 2O5DA 1ASUA 3Q8QB 4MIAA 4DFPA 4NCGA 4MK8A 3AA4A 4IG0B 2KFNA 4EP4A 3BSCA 4EEYA 3CJ3A 1QSSA 1U04A 3QIPB 3SQ4A 4OKEA 3SV3A 1WNEA 3ZSVA 3ZT2A 4CGHA 5DQIA 2KQ2A 4KTWA 3DLRA 2HW3A 3KOAA 4FLTA 1FKPA 2BRLA 3KLGA 3NFAA 2W8KA 5KFWA 2FJXA 3LALA 1CLQA 5DGAA 4M3XA 1I6JA 1DTQA 1J53A 1JLGA 4F3TA 4CJFA 4FM1A 1NKBA 2BE2A 2AQ4A 1J5OA 4M3ZA 2BQRA 4NLPA 4DWIA 3IGVA 4DL3A 2Y1IA 1VSKA 4ED0A 4K4SA 1TKXA 2RN2A 1LWFB 5F8LA 3AVKA 2RKIB 2YNHA 2OPQB 5F8GA 4DLGA 3UR0A 4ELUA 4E89A 2ILZA 3RTVA 4IKFA 2XGQA 1TKTA 3M8QA 3VQDA 1F21A 4IOBA 1NJYA 3VA0A 5C25A 2IM2A 4TY8A 4IH6A 3NGDA 3H2LA 2WB4A 3DLEA 2D0AA 1JKHA 4DSFA 1VSJA 4M94A 4ZP6A 4CF1A 1HQEB 4C8MA 2IA6A 2HNDB 3SQ1A 4RW7A 3CG7A 4BDZA 3CO9A 4RW4A 1KVAA 2VG6A 3V6JA 4DQSA 4DU1A 2DFEA 5L9XA 5KGXA 2QV6A 1L3VA 2VWKA 2DPIA 3IS9B 5F8HA 1QE1A 2E9ZA 1TKDA 1UOCA 4M3YA 1S5JA 3CM5A 1A5VA 4WZQA 1JLCA 2HNYA 1C0UB 3GYNA 3M8PA 4QWBA 3D28A 1YTUA 1ZETA 4NLQA 1IO2A 4F3OA 4FJ9A 4CERA 3SUQA 4DTSA 3SI8A 4CHPA 3L8BA 3RRHA 4ED3A 5EU7A 4CHQA 1RT3A 4K8ZA 4QW9A 3NCIA 3C6UB 3WNGA 2RPIA 4KHRA 1DTTA 1SH3A 5KG1A 4DSKA 4EBEA 3NF7A 2BRKA 1NNDA 2E6LA 3H98A 4FCYA 1HRHA 3NGYA 3VQ5A 5K14A 1ASVA 5KI6A 3I0SB 3OHBA 3CQ8A 1YVFA 3KHLA 2Z1JA 4FXDA 2ZD1B 3U6FA 4WXOA 1S1VB 3ISND 2D3UA 3NAHA 2C2EA 2AU0A 3GV5B 1Z25A 1IKXB 1T3NA 4O0IA 3NGZA 2VG5A 3HVAA 5HROB 4MK9A 3VQSA 4LD0A 2WK4A 4Y2AA 3T3FA 3DLBA 4ED2A 3VQ6A 2XGPA 3DLGA 4K50A 1S6QB 5EWGA 4QAGA 3PX0A 3TAQA 4CJPA 4JS5A 2P5GA 3BREA 5C5JA 3VQPA 5EWEA 3DM2A 1LWEA 1BGXT 1RT6B 4CJRA 4RW8B 1OS5A 2YNGB 2XI2A 1W25A 4B9UA 4WFXA 1QQCA 3K58A 4H4MB 2HMIB 5KRTA 3TAPA 4CFCA 3K59A 4FJ8A 4N41A 1IKWA 1CXUA 3L2UA 4CFDA 3OY9A 2Z1IA 3KLIB 3ZSXA 3RR7A 4YR0A 1WSIA 3CJ2A 4Q0BA 1TL1A 3CWJA 3QLHA 2JC1A 1S6PA 3HYFA 4B9SA 2R8JA 3AVLA 2YHBA 5KFFA 1HARA 1SH2A 4MFBA 4Z4EA 4IRKA 4DTOA 3AO4A 1S1TA 2G8IA 1FKOB 2B43A 2F96A 4Z4CA 1N5YB 1RT5A 4JV1A 1T03A 1T05A 3V1OA 3T1AA 4DF4A 4TXSA 3BJYA 2CKWA 4IQXA 1CXQA 4KTQA 4CIGA 3Q8PB 3LP1B 5CYMA 4O44B 4BE0A 3KK2A 2HAIA 4K4WA 4GC6A 3V9XA 5KFGA 2E4LA 4O4GA 4F4XA 3KLFB 2CJQA 1S49A 3HK2A 3OYFA 3G6XA 4Z4GA 3KHGA 4I2QA 5F8IA 3C95A 4DMNA 2PYLA 2B6AA 3MEDA 3PW4A 1KSPA 4HKQA 3TARA 4YQWA 2EC0A 4CEQA 1D1UA 2HB5A 3NHGA 3MF5A 3UPFA 4PUOA 1Q8IA 4B3OB 3N6LA 4DSJA 3RAXA 3QEXA 1S0NA 1C1CB 4F2SA 4FK4A 1D8YA 1HYZA 4RG8A 1NOZA 5KFHA 3HHKA 4NLGA 2G8VA 1B9FA 4DLEA 5C42B 5CYQA 2IMWP 5HLFB 2XCAA 4J2DA 1VSFA 4M3TA 5F9LA 3BQ0A 3KLEB 1FK9A 2IGIA 4OLAA 3LPTA 1RTHA 3DLHA 5E41A 5KG7A 4CK3A 3V9UA 4JUZA 4CEDA 1S9EB 4HTUA 1HNVA 3NGIA 1U49A 1C1BB 4K8XA 5FRNA 3CDEA 5KG3A 2R8KA 4ECVA 2AJQA 3U3GA 3IG1A 4O55A 4E7JA 3IRXB 3RMDA 3PJXA 3PW2A 3LP2B 5HBMB 2XY6A 4AHSA 4DG1A 4Z4IA 1EP4A 3BQ1A 4CJ4A 2EX3A 3M9MB 1RDDA 3OYAA 3OL6A 1D9DA 3OYNA 4YP3A 2VG7A 1KHVA 4R5PA 3RBDA 5KFIA 3QGHA 4N47A 1RTIA 1WAJA 3PV8A 3DRPB 1S1WB 4KBIA 1K1SA 5F8MA 4CEBA 2D0BA 4O3RA 4PWDA 1BQNA 4IRCA 3DOKB 1RDAA 1U4BA 3SZ2A 3OYGA 4ELVA 3ITHA 4ED1A 4LSLA 4IBNA 2R2SA 4RNOA 5EWFA 1NK6A 3T19A 3D5MA 1HMVB 2P5OA 4ECUA 4F4YA 3G6YA 4FZYA 4LSNA 3PO5A 3AA3A 1NJXA 1JLBB 5DQHA 4HYKA 1QUVA 4ICLA 2RDIA 4YNQA 3HM9A 4DFKA 3OL8A 4B8AB 1VRTA 4Q8FA 2Q3SA 2DY4A 4B9VA 3QZ8A 1D5AA 2W7OA 3L2RA 4B8CA 1EETA 4QPXA 1LAVA 4EZ9A 4W5RA 3KNAA 1RT7A 1U48A 2W7PA 4J9SA 2JLEA 1JXLA 3DI6A 2ASJA 4BE2A 1TK5A 4IFYA 3G0ZA 4AH9A 2UVVA 2X78A 3WNFA 1U45A 1N6QB 4DQRA 3BQ2A 3VQ8A 2HWIA 1TAUA 3D45A 5J1EA 3HVTA 3S3OA 2GUIA 4G1QB 1U09A 4R0EA 2W9BA 3CIZA 3G6VA 3V6DB 5C24B 3K5OA 2HNZA 1SKRA 4KB0A 3DRSA 3JSMB 2FC0A 4JRQA 2HHWA 4FJJA 5J2MB 2V0NA 2KZMA 1TV6B 4PQUB 1ZBLA 5KT7A 5HP1A 4ZP7A 3KD5E 1DLOA 2P1JA 4DTXA 1LV5A 2D5RA 4W5NA 3QYYA 1RA7A 4TYAA 2ATLA 4TQSA 5F8JA 4FK0A 3NMAA 3DLKA 2V4RA 4ECTA 4UQGA 1RT2B 1R0AA 3HVRA 5D3GB 3AV9A 1IKYA 1I39A 2D7SA 5DK5A 1NKCA 1NJZA 4U7CA 4AILC 3AA5X 1S0OA 2X74A 4KI6A 2JEFA 1XR6A 4LH4A 4JLHA 4HHTA 4CGIA 4Y3CA 3DRRA 1XI1A 1JLEB 2OPSB 5I42A 5FDLB 3NL0A 3D0PA 4M42A 1SL0A 5DG9A 2E9RX 3OSNA 1A5WA 3QNOA 4DTPA 3MEGA 1BIZA 3QEVA 3MR5A 4OLBA 1S1UA 4FLYA 4ZVFA 4QW8A 4ELTA 4MH8A 2J6TA 1L3UA 3ZT0A 3SPZA 2RF2A 5J2QA 2HVIA 3PZPA 1NK7A 3FDSA 3LWMA 3H59A 4BDPA 4ZP9A 3ZT3A 4QWEA 3NBPB 3CDWA 4JS4A 3HXMA 4RW9A 4HCBA 4OVLA 3HSTB 1N48A 4MQ3A 5KFJA 4ID5A 2ATQA 1NK5A 3HL8A 3FFIA 1IKVB 4RW6B 3MECB 2XI3A 2ZE2A 4F4WA 3SYZA 2PY5A 3PJWA 1LW2B 3GIKA 4CJ3A 2XO7A 3OYDA 2W9CB 3OS0A 1Z4UA 4CFBA 1ZYQA 5I3UA 2OPRB 3ZCMA 4ID1A 4FBTA 5KT5A 3VQCA 2Y1JA 5KG5A 3NAIA 1C0TB 1S1XB 4MKAA 3JYTA 3V81B 4K4UA 2QKBA 1SUQA 2FLPA 3CJ0A 4I2PB 3NF9A 1JXEA 1EX4A 3PUFA 5F9NA 5KT6A 3QNNA 1UWBA 1BQMA 4FJIA 4O3OA 3I5BA 3PX6A 2WOMB 3P83D 3KD1E 3MEEB 2FVQA 1KHWA 4YFUA 3HVWA 5KTQA 1TQLA 3VA3A 3FSIA 1EKEA 2R8GA 3M9OB 4IDKA 2JC0A 1N4LA 2ALZA 3PX4A 3KJVB 1HJRA 4KO0A 3E01B 2UUTA 3VQ9A 4DTMA 4FJMA 4ZHRA 4WE1B 4DSEA 4K4VA 1HNIB 5CZ1A 4ZPDA 1WSFA 4NLUA 4TN2A 1ZTWA 1HYSA 3I5CA 1QS4A 3QEIA 1WSEA 4FJ7A 3DLGB 3V4IB 4ZPCA 1HYVA 4ZP8A 4FJKA 1TVRA 3MXIA 3AVFA 2B5JA 3OYHA 1C0MA 4W5QA 2QKKA 4J9PA 5KFZA 2F8SA 3SNNA 2C22A 4WFZA 4WYWA 4CK1A 4CCHA 2D0CA 1RBSA 3ZSWA 2IC3A 5EUHA 3KLHB 1HPZA 1RBUA 1NOYA 4XPEA 4YMEA 4CGJA 4IFVA 5J2PB 3HJFA 3P1GA 1NK0A 4ZPBA 3C94A 1LW0B 1EXQA 4KKOB 1SV5B 1RT1B 1JXBA 4IG0A 4CEOA 4CEEA 4CHZA 2O4IA 2AGOA 4LY7A 3PY8A 3QIPA 1MU2B 2XY5A 5KFRA 2D41A 2IAJB 3KK1B 4KI4A 3UIQA 5KT3A 1VSHA 1RBTA 4FJNA 3DYAB 3WNEA 3ZT1A 1I3AA 1HQUB 2G8HA 1JLQB 1JLAB 4NLSA 5KRSA 3EY1A 2B4JA 4BWMA 4KHUA 2P51A 4DFJA 2WONB 2FVCA 5CYMB 2YKMB 3QO9B 4TLRA 3DMJB 3QGIA 1ZBFA 2FVRA 1TKZB 3AVAA 1LWFA 3OLBA 2RKIA 4NLYA 2KZZA 4NRTA 4URQU 3OYJA 2OPQA 3KMQA 4Y1DA 2IOCA 4J9MA 4E7HA 5JS1A 1SH0A 3DOLB 4PY5A 1T8EA 5HRNA 4Z0UA 2YNIB 1SKSA 4QWAA 3O4QA 4Q8EA 1O1WA 5FROA 1S9GB 5KFXA 2D3ZA 3H08A 4H4OB 4G3IA 3GILA 3EPIA 4ZPAA 3H4BA 2HHVA 2ZKUA 5DMRA 1HQEA 4DL5A 1GOCA 3PW7A 2HNDA 2HHXA 4O3QA 1L5UA 1U47A 4KTZA 3O3FA 3G10A 1REVB 4R8UB 5KG0A 4O3PA 1B9DA 4TSXA 3V9WA 1KLMB 3FQKA 5J2NB 3IS9A 4EZ6A 2BANB 4HUGA 1JIHA 4W5OA 3PO4A 4CJWA 1C0UA 1VRUB 1L3SA 3SFGA 3RMAA 5FRMA 1RDBA 2YKNB 3OJUA 4FK2A 4OGEA 3MTKA 2O4GA 3TAGA 4E0DA 2IBKA 3VQ4A 3SUOA 4FLVA 4RZRA 3AVNA 2C2RA 3KTQA 3HP6A 3EZUA 4ZTJA 1LWCB 4NLXA 3C6UA 2FBVA 4RNNA 4IG3B
chains in the Genus database with same CATH superfamily
1SXLA 3OBIA 5BXIA 5DS7A 3F2KA 2L48A 3RBZA 3MM9A 4BDYA 1JB0C 4KHMA 2B4UA 2BJ8A 3I0SA 4FOEA 4ILMA 2C28A 2A6AA 3IBCB 4KV8B 2AEFA 2WC9A 1KC8O 2OPPB 2VKZG 3AH6A 1NH8A 2W42A 4ECXA 4ZVPB 2E66A 3S1TA 4ZCMA 3K7RA 1K6YA 2QEXS 4EUVA 4I69A 1M5SA 2CZ4A 2UXCJ 4IR1A 2BQ3A 2LQ9A 3FZFA 4ZVEA 2ZHBA 4LQ3A 3D2EA 2OZSA 3W8PA 3PRBA 4ZCLA 2HZCA 4Q43A 4RW8A 1YITS 4L8RB 1RTJB 2UXBJ 5KG2A 2W41A 1NSPA 4CW7B 4PG8A 2FDNA 4P10A 3KLIA 3CJ8A 2RH3A 2OP5A 5JXSA 4B3SF 4DR7F 1HQ2A 1XMOF 1QTNB 1V6HA 3MCMA 4FWMA 3T5JA 3C6TB 3QT6A 4LF5J 4HEA9 5JLFA 1S10A 5F8NA 1BQXA 3OA9A 2H4YB 3K5LA 2FJVA 1V3ZA 3CQYA 4X66J 5KFUA 2AYMA 2UU9J 2NXJA 1UVKA 3HKWA 3D0IE 5KFSA 2DTJA 4JRPA 4MKBA 4G9ZA 3SQ2A 2ZC3A 1VI7A 5CZVA 3W9HA 1VGYA 3GB0A 4P7TA 1ZM9A 4DR6J 1OH8A 4N56A 3PR5B 1K9MO 5FD1A 4HCCA 4AHTA 1HI8A 4B9NA 4DF8A 3NDKA 2KG1A 2ZOFA 2BM0A 3BSAA 1XHZA 2A1BA 3OXFA 2OSQA 4B3OA 2B7BB 4DEZA 3Q2TC 1FFSB 4IOAQ 3W61A 2E1MC 1C1CA 2IJNA 1YHQN 3BN7A 4RBUA 4H0PA 3ICLA 4DV1J 2RJZA 3MR2A 1LFWA 4J2AA 3BGRB 1SI9A 3LDSA 4NCAA 4RWTA 3I32A 3PHEA 1WTBA 2UVWA 3WQUA 2JEJA 4OJ1A 1Y5IB 1YIJN 2I5JB 3NCRA 1K9MT 2EC2A 5A2QO 2HVHA 3P39A 1S9EA 3GTYX 1OY9A 4IOAL 1WC6A 1PC4A 3CCVN 2F1FA 4X4UA 5GAGP 4C8LA 1LOUA 1YWXA 3HHNB 1KLNA 3IRXA 3ZNUA 3AODA 1VQOS 4RNMA 3OTOJ 3LP2A 2B56A 3NMRA 5AQVA 4FJLA 3CMAN 4OI0A 4EGLA 2ZDPA 3PYDA 1GEHA 2BKPA 3GIMA 3NCQA 2BE2B 4DB3A 2FJWA 4ZCKA 2ATCB 1RSCA 1RU2A 3O6WA 4DR2J 4AHCA 4RUHA 2GUPA 1S1WA 2IM3A 2V8VA 2MQLA 2YNHB 2DNGA 1HUXA 1NJWA 4DV3K 4B9QA 3SAGA 1JX4A 3ZX2A 2QWOA 1JJ2M 1OVQA 3M8QB 2B7CB 2BW7A 3H6EA 5C25B 3NS5A 3QFUA 3OYCA 3TVKA 3DLEB 2H9ZA 1K1QA 3MCNA 2H5JB 1N33K 1HMVA 1TZ0A 3H4DA 1R59O 4DV6J 4LMZA 2DR8A 1NXIA 4IOCQ 2C42A 1JQGA 3NWRA 5DQGA 4I9LA 2HHQA 3L7UA 4FZZA 2N7YA 3R5AA 2V69A 5JUMA 2YWFA 3RR8A 2CQHA 3EN9A 2PFDA 5KFVA 4HI1A 4NMXA 4OKKA 3R5BA 3J8AA 1IG9A 4MIWA 1SKUB 1RDRA 2UVUA 3VGUA 2FIUA 4K2JA 3CCLN 1H7WA 3NNHA 4BGBA 5KPZA 2JNJA 3MAAA 5AXNA 1GOBA 2F4VJ 5C24A 3JQMA 1DTTB 4OYZA 1VSLA 1PYTA 4CFAA 1QTMA 4NYZA 4J9NA 1VQON 1BIUA 3E8OA 5KFKA 2M3DA 3UVJA 3NEKA 1MWMA 1X0FA 1KRPA 4KHSA 2XMVA 4GMJB 2NPFA 5D3GA 4A8QA 4OI4A 3ILOA 3D66A 3AA2A 1FJGJ 1LAWA 3W5XA 2HURA 1HHSA 2VG5B 3IAYA 4OPHA 4NWBA 2N3OA 1FHTA 2Q31A 4NB4A 4U7BA 4UOGA 4DS4A 1KFDA 2V2VA 3CGIA 2A1SA 4B08A 2M4MA 1WF1A 5AQTA 2VBWA 1OPZA 2J6UA 5KT2A 2AJ0A 2VFUA 3C3LA 3OYIA 4W4MA 4L6V3 4HHHA 2HZVA 1DQAA 2JJ4D 5L1LA 1D09B 2NRTA 3QBXA 2CJXB 5CZXA 1JJHA 4JI7J 2QFJA 2I38A 2L08A 3CD7A 2QLFB 1S6UA 3DHWC 1YTAA 4DV3F 5DJBA 1V9OA 2ZBQA 2V8PA 2DGQA 4MFBB 1IKVA 4ETXA 1SB6A 3MECA 2D9OA 1C1AA 1LW2A 2AD9A 2NR0A 5D0GA 2Z4PA 1N33F 2P9LA 1BY9A 3K0SA 2LDIA 3IR5B 5KFNA 1XK8A 5AFUA 3AO5A 4F7VA 3NH0A 3KK2B 3I31A 1C0TA 3L9ZA 3HHEA 4B9MA 4O4GB 2GIRA 2PI5A 2Y9HA 5BYSA 4J9UE 4I2PA 4P2XA 2F65A 3PW5A 2XRIA 3ZZOA 3Q8YA 1DT9A 3TI0A 4JI0K 2V4QA 4WYLA 1RWKB 1YRTA 2V5HG 3OYLA 1DJ0A 4FYYB 3VPZA 3MUVP 4DQPA 4H8KA 4DX5A 3KG0A 1CJUA 5KFOA 4K4ZA 6AT1B 4P2MA 1H2TZ 4F2RA 3E01A 3MX5A 1SJQA 2BJDA 3TSPA 2KKHA 3JSYA 1Q9XA 1CS4A 4DU4A 4FP9A 1FWLA 3NCPA 1MW7A 4PXBA 3EWGA 2YQ3A 2ZH9A 4FLXA 4CT9A 3KLHA 1Y3KA 1UP1A 1CJTB 2QE5A 4PG7A 2G2YA 2O8DA 1H0HB 3QSIA 5E3PA 1B3TA 4HVZA 4V19S 5DZ6A 4ISFA 1FE4A 5AQGA 5J2PA 3T69A 9ATCB 4DUYJ 4FYXB 2MXYA 1TL7B 3UDEA 5ETMA 4A46A 4X65K 3IG1B 2L9NA 1SV5A 2UV8G 3LAMA 4ZVSB 3C6AA 3CIMA 2BJEA 3AO1A 1REGX 1ACMB 5CD4A 1MN9A 5GAHU 2CPYA 2DITA 2IHR1 2NQPA 1X5PA 1NLVA 4DG1B 1B0PA 1UPMB 2GJIA 2FBYA 5IC6B 2F8EX 1KVBA 4J2BA 2V8DA 1IUJA 3HRGA 2QWMA 3DYAA 4R5PB 1SL2A 1JLQA 1APSA 4OHZA 1IBMJ 5KFCA 5KQ8A 2HRUA 2YQ0A 3M4XA 4FWPA 3ZZUA 2YKMA 4FOIA 4HT7A 1TKZA 1U6FA 5CHIA 2C3OA 4C8YA 4CJTA 3THXA 1JJCB 4BC9A 2XG8A 3U9DA 3UKUB 1JLFB 4UUWA 3D6FB 4Y2KA 4DDFA 3CCTA 4CEAA 3GP9A 3OLAA 3DOLA 2R8IA 3ZSQA 4DI6A 2NS1B 4KHQA 1N5SA 1RYSA 2F7VA 4XIUA 1RWMB 4EFAC 1NHUA 2WBNA 3F73A 2HFOA 1T95A 3OFEA 5ADZA 5KFDA 2R8HA 3DRYA 4CZCA 3MAQA 2WHOA 1BO5O 4CGGA 1AFIA 2H3EB 3OL9A 1YRUA 4EYIB 3E51A 3S3MA 2HHTA 2MSTA 4M3UA 4BC2A 3THYA 3MPVA 1YVUA 3RB0A 2ZM6J 2H5EA 1YBUA 1VRTB 2GVDB 3MI7X 2XMUA 1T94A 4C8OA 2L9WA 4NYFA 3G2XA 3KKFA 2FY8A 1EETB 3PNIA 5AQSA 4YOEA 2XLIA 4JI0F 3OS1A 2UZAA 3MOZA 5J2NA 3L4BC 4OYPA 3D7SB 4OYBA 4K42A 4ED7A 2KRRA 4FJGA 3EUNA 3WBZA 1VRUA 5HATA 2YKNA 3RAQA 3FBEA 1BXNA 1W0HA 1QVGR 4DPOA 5AE3A 4E2FB 2BJ1A 5AE2A 1VQMS 4XTTA 3U7JA 2P9SB 1LWCA 2AP1A 2YV0X 2LMIA 2V8HA 2LEAA 4HT5A 2BE7D 1HR0K 5HP1B 4IG3A 2DHHA 1LFPA 3ID8A 2N7CA 2KDOA 2IVPA 4UUXA 4N5SA 4QWCA 3H5XA 2PMHA 3C15A 1HNWK 2KJVA 4FW1A 2V34A 2QIFA 3TVYA 2PEBA 4ZTFA 3VERA 1UTAA 1R0AB 1N34J 3KKRA 5B08A 1RTDA 1Q8LA 1RDCA 3WEEA 4X65F 4FW2A 1WB9A 5GADI 1XTZA 1ZBTA 3M6UA 4RWWA 1BCMA 2X1AA 1LNQA 3GWCA 1A7GE 1B7YB 4IJAA 5KFMA 1WLJA 2VUGA 4QPTA 1OQ3A 1RI7A 5BYRA 3O1BA 5MAOA 3MEGB 2PZSA 2I2YA 4O3SA 2RSQA 4B9LA 1N32K 3MMCA 1XN9A 2G8FA 5J2QB 1WF2A 1A0OB 2J5AA 3KYLA 3OBWA 3F41A 5BN8A 2FJAB 3HT3A 2YNFA 4OPAA 1JCFA 1WNSA 4FVMA 4BRPA 2DT9A 3QJLA 1VIOA 2RMLA 2QGFB 4JAXA 1HA1A 2AX0A 6FD1A 2R3VA 1CZBA 4IKAA 4USMA 1M5PC 2GVZB 5CHCB 5I3UB 4CLSA 2GBZA 4L3QA 2EWHA 5C7PA 3O9UA 4CLKA 3CJ9A 3M30A 1FXLA 3C14B 5M2UA 1Y10A 4KHWA 3ALYA 4K25A 1ITGA 4WPAA 3JAMO 4JV0A 1BQMB 2CPIA 5DLGA 4LF7J 3AD8C 2OGUA 1J9AA 1KFSA 4M45A 3RRKA 4FJ5A 4IDKB 1MROB 3K5MA 3QT5A 5IT4A 4ATNA 1QM9A 3JTOA 1UWAA 2WW8A 4WIQA 4QS9A 1X9MA 2LFVA 4OYIA 4MLEA 5D0HA 3LGMA 2HBMA 2EFNA 3RZAA 1HR0F 3OFGA 1VSDA 1HPZB 5GIPA 2IJFA 2KXFA 2XYGB 3SFUA 2D4WA 3RGIA 3GJTB 4YR3A 2D3OR 1HNWF 4H4KC 3K17A 1N8RT 2E5LJ 2KTQA 2O5DA 1ASUA 2ZGYA 4NCGA 4IG0B 1RAOA 4WCEL 4I56A 3SQ4A 3SV3A 4J8FA 3SCJE 5HQ8A 3MUTP 1WNEA 2R7QA 1XNQK 3ZT2A 3OFFA 4CGHA 2A3ZA 4KTWA 2EBGA 3DFEA 2HW3A 3KOAA 4B1XB 2BRLA 2F4FA 1W97L 2FJXA 3QWUA 1CLQA 4F3TA 3PSIA 4JV5K 1S3XA 2H4WB 1J5OA 4U9RA 1N32F 4NLPA 1FRXA 1YZ7A 2B4VA 2Y1IA 1VHFA 3HX9A 3SMZA 5F8LA 3AVKA 2RQKA 4CIOA 4GKKK 3WIVA 1PGZA 5FPMA 1MMNA 4NXNK 3UR0A 3MHYA 1WSRA 3MMVA 3MCAB 4DKWA 1EX8A 4CI0B 2XGQA 3SEOA 4LF8K 3PFEA 1QZ5A 2HBKA 4TY8A 3NGDA 5BN9A 1JKHA 3SQGA 2CNKB 1URNA 4ISEA 2Q2RA 4BC3A 2HNDB 1SQEA 4RW7A 3SQ1A 1NCLA 4JEPA 1Y7PA 4FYWB 3MPYA 1KVAA 3DXBA 1NM2A 4FPIA 3H45C 2DGXA 4DU1A 5BRHA 4DBQA 5KGXA 4XH4A 4BG8A 5F8HA 1QE1A 5A6PA 4WIIA 1RHJB 1KAYA 2NYHA 1FNMA 2MKKA 2HNYA 1C0UB 3VENA 3GYNA 2MKYA 3P5BP 3F0NA 4F3OA 1IO2A 4JI2K 2DNZA 4CERA 3SUQA 4YDDB 4DTSA 3U1MA 3SI8A 2E1CA 4CZMA 1EKRA 2AZ1A 3CB4A 2CNOB 2XMWA 2IDLA 1WSVA 3D0GE 7AT1B 3QBCA 3JAMY 2IVOA 3UKRA 1OVYA 5KG1A 2BXJA 4DN9A 2UUBK 4DPUA 1Q18A 3MM9B 3JTNA 4M5DA 4L3KA 5K14A 1ASVA 1NGCA 5KI6A 3I0SB 5ETSA 2Z1JA 3ISND 2OFGX 2HGLA 1ZBLA 3FMWA 4IFEA 3GV5B 1HNZJ 1WHVA 1T3NA 4O0IA 2NSCA 4MK9A 3BYPA 1XNQF 5I3QA 3T3FA 3TX8A 4ED2A 3VQ6A 2XGPA 2FTRA 1VAZA 2MY7A 3EKSA 3TAQA 4C23A 3MUMP 2G2ZA 3D2EB 4LF4J 2P5GA 3VZHA 4FN5A 5F3ZA 5EWEA 1TUVA 3IDHA 4DHYA 4RW8B 2O3DA 4JV5F 1KOOA 4OX9J 1W25A 4B9UA 4PXDA 4IEEA 1IBLK 1JWWA 4OYXA 2HRTA 2F40A 1CEZA 4CFCA 4FF2A 4FJ8A 4YOVA 1IXKA 3D2FA 2ZDOA 1YBAA 1M1KO 2Z1IA 3KLIB 3OUYA 2YPZA 3T1HK 3RR7A 2P9KA 4YR0A 1B0VA 3CJ2A 4GKKF 1MWYA 2HFSA 1PO6A 4U7UD 1SC6A 4NXNF 3KHYA 1UW9A 3ET6A 2YHBA 2XB2D 2BOAA 3LPEA 1FVQA 2ZC4A 1HARA 4LF8F 1SZ2A 2PE8A 2LYVA 5IC4B 4IRKA 1S1TA 4Z4CA 3ZX0A 2PSZA 1RT5A 5AZIA 3H1QA 1UW4A 2MQOA 4DF4A 4TXSA 1CXQA 4KTQA 4I1TA 4NI2A 1I1GA 5D4OA 1VQYA 1PG5B 2YY3A 1QVFM 3V9XA 3HZ6A 2ZNYA 3IR6B 3EGWB 1M1KT 1NPRA 2QMXA 2CGKA 3HK2A 5EHHA 3OYFA 4CZEA 3GU0A 3KHGA 2K06A 1DGKN 3LO3A 5BREA 1TL4A 2PYLA 3MEDA 3JXUA 3MM8A 2HAFA 3TARA 1D1UA 2E1AA 4JI2F 1GMVA 4PUOA 3MCSA 1YRXA 4B3OB 4B3SJ 2RUGA 4DR7J 2Y0BB 2CVIA 2PC6A 2DJWA 3RAXA 1XMOJ 1C1CB 4ANEA 2IY5B 3HHKA 2G8VA 2MQMA 2IIRA 1HBMA 5CYQA 1TMMA 2IMWP 3IXQA 3A5LC 5AQFA 3O5TB 2DR9A 2XCAA 3KK7A 1HWJA 4BC7A 2UUBF 4M3TA 3D54A 3BQ0A 5AJ3K 1VS3A 5G0RA 3VGLA 4MO4A 3MPWA 3ZZTA 2EW9A 3TA2A 3W65A 2MLYA 5LJ5Y 2VICA 4CZKA 4OYAA 3ZZZA 1S9EB 2IIHA 2CAJA 2MZJA 1U49A 2RE2A 2ZWOA 3V2UC 2HWTA 2BE9B 5FRNA 5KG3A 3KWGA 4ECVA 1VLOA 4E7JA 3IRXB 3BPSP 3PW2A 3DCAA 3LP2B 2PA8D 1NDPA 2W25A 1H3DA 4AHSA 4M7XA 1P9QC 2G0CA 4WF9Q 4CO0A 3UCUP 3AAQA 4OJGA 1O13A 2JH3A 4IO9Q 3M9MB 1RDDA 1IWAA 3FEXB 3OYAA 4YP3A 2VG7A 4LBPA 3TPQA 2L41A 1FRLA 3A5MC 2Z2LA 3BF4A 4RKUC 1RWNB 1IBLF 1K73O 1TELA 2HQDA 3GJQB 4N47A 4PYAA 2M70A 4TNOA 1WAJA 1F2HA 1S1WB 5LMNK 5F8MA 5AQJA 2W2PP 5ADXH 3T1HF 1VHIA 4WF9L 4OI6A 4PWDA 4IO9L 1RK8A 5AT1B 4HHUA 4ELVA 2QYGA 3KWIA 4LSLA 4IBNA 2R2SA 1I94K 4F04B 1Q5VA 3I9ZA 4ANCA 2W7AA 2HEKA 2Q1NA 3T19A 3DWLA 3D5MA 1HMVB 3O2IA 4JKDA 3G6YA 3PO5A 4FL9A 1RKJA 3WC2A 3UR3C 1K73T 2RDIA 3OL8A 2VB6A 4B8AB 1UJ5A 3C2PA 1T6DA 3FZKA 4Q8FA 2DGTA 2ACYA 1R8PA 2MLZA 3NGUA 4EZ9A 2CDRB 2BJ3A 2JLEA 3F56A 1TK5A 4IFYA 2M0GB 3CJBA 3D9BA 3FBCA 3G0ZA 1LKZA 2UVVA 2NUUG 2X78A 3O08A 4DQRA 3D45A 1F60B 5M1PA 3S3OA 5IV4A 2VF3A 3R7BB 2GUIA 3MAAB 2W9BA 4WQ5A 4OJ3A 1GLJO 3M6VA 5C24B 5JMVA 3DRSA 3AHPA 2HHWA 4JYAF 2V0NA 1FTCA 1KBRA 4ZP7A 1SIZA 4A8WA 5AJ3F 1ATSA 2ATLA 5EXWA 3UVJB 1NSAA 5F8JA 3DLKA 4X4TA 2DO0A 5E2QA 4ZJLA 5D3GB 3L4QA 2XZWA 2D7SA 5DK5A 3ZZ0A 4NXMK 2DNHA 1SCJB 2ASPA 2NLWA 3CPWM 4Y3CA 3DRRA 1XI1A 2FZCB 4C0HA 4NL5A 5EGYA 1SS6A 4B3MK 2KT3A 5EVZA 4M42A 5A8RA 1SL0A 1A5WA 2QWNA 3BGLA 4CLPA 1U0HA 3BH6B 2EI5A 3CC2N 3QEVA 3PRVA 4DMZA 2J6TA 2ZH8A 1L3UA 4AF1A 3SPZA 5LMNF 2HQ3A 1GLFO 3AJDA 3CDWA 3TQEA 1DY3A 1HWLA 2HQGA 4HCBA 3HSTB 4ID5A 1U26A 5DDPC 1IKVB 3WZ0A 1I94F 3MECB 2ZE2A 2WVEA 1LW2B 3UCZP 2CIMA 2DPNA 1Z4UA 1HI1A 4ED4A 3OPKA 3ZCMA 2P9LB 4FBTA 2O8BA 1U25A 1C0TB 3ILLA 4MKAA 3JYTA 3Q83A 1S7HA 1F6TA 2FLPA 4I2PB 3J7A1 3GIRA 1GLDG 2NCKL 5CCLA 2CNLB 3FRYA 3I5BA 1T3VA 1WACA 2HS3A 3HVWA 3NGTA 2Y8YA 1NGHA 3BY5A 1KKHA 2ZWHA 1CJUB 2DEJA 1N4LA 2BACA 1H38A 2CFXA 1LXJA 1Y4ZB 2GQQA 2MZQA 3E01B 5CA5A 3LDOA 4DV3J 1HL6A 4FJMA 1WSFA 2HBYB 1ZTWA 3I5CA 4A47A 3QEIA 1WSEA 3DLGB 4ZPCA 1CS4B 1OY8A 2LU1A 2C1EB 1H73A 2QC3A 3TZXA 4O8UA 1C0MA 2F8SA 3SNNA 2C22A 1O51A 4C1NI 5LL6Z 4CK1A 1N33J 3ZSWA 3KLHB 5GMKa 2O8DB 4G1PA 4MLHA 3HI0A 5J2PB 3AJ1A 1MA9B 3P1GA 1BLUA 4HTLA 1SV5B 2HFZA 1M5OC 2ZVIA 4NXMF 4KQZA 2AGOA 3VQTA 4LY7A 3PY8A 3QIPA 4CRJA 3OVAA 1ZH5A 1U2RA 2D41A 4ZVRB 4B3MF 2P9NA 3P45B 2GELA 3UIQA 5KT3A 4F0HA 1RBTA 4FJNA 2CDQA 3DYAB 5K8OA 4M5IA 3L09A 1JLQB 4F3MA 4D3GA 3EY1A 2F9DA 4KHUA 2IRYA 1FESA 5GIOA 2YKMB 4NO7A 4TLRA 3G4SS 1TKZB 3THXB 2QWLA 4URQU 1H7XA 4E7HA 3TUZC 3J7ZO 5JS1A 3P4IA 1O0PA 3DOLB 4PY5A 1DQ9A 3PXGa 1RGIA 4Z0UA 4RX6A 2BABA 2OLWA 1SKSA 4QWAA 4Q8EA 3VGSA 2UXCK 1FKAF 5KFXA 4ILHA 2HFUA 4TU9A 1YI2S 4G3IA 4ISGA 3MM7A 1RUSA 4ZVUB 4ZPAA 3Q2SC 4DR5K 4K7QA 1R0CB 3THYB 4O3QA 3J7YI 3CULA 4BR0A 3UFCX 1TYQA 4J91A 1AFJA 3E1YA 1PIEA 1PYOB 5J2NB 3J7ZT 3PO4A 4W5OA 1UVIA 1Q16B 1VRUB 4ES1A 5DRKA 2RRAA 2YKNB 5JVHQ 2AV5A 2O4GA 4E0DA 3SUOA 2ITMA 3R8YA 1WI8A 2C2RA 3HP6A 4ZTJA 1LWCB 1NDKA 4HWIA 1WEYA 5HSPA 2FBVA 1AZSA 4RNNA 2KM8B 4IG3B 4O0NA 5IT9U 3BBBA 1S4FA 2QT7A 4CEFA 3B82A 1GFWB 1FFGB 2POKA 3C15B 1YUWA 4Z7YA 4CLWA 2ZD1A 2KM8C 1RTDB 1S7IA 2QLBB 4PPZA 1GLEG 1T9UA 5KFYA 2V9WA 3WEEB 3GJRB 4JI0J 1CC7A 2R7WA 1G15A 4CJKA 5HROA 2C2DA 3ZTQA 4R0JA 2P2CB 4H0TB 3CERA 1VLYA 2UP1A 4ERDA 3QIOA 1VBXA 1UEUA 1RT6A 2K7KA 4AUKA 3MMCB 3GQCA 4J2EA 4C11A 3FGUA 2LSNA 2X3DA 3AB4B 4RL1A 4M3WA 4ZPVR 2DTUA 2WW4A 3MEKA 4LRFA 5HJYA 2F8HA 2YKPA 1CQNA 2YNFB 4CF0A 1EIYB 4O0JA 1YI2N 3IUCA 1S76D 1Y97A 1KVIA 1TR0A 2AZ3A 4ECRA 2QXLA 3VQEA 2O8CA 4EFHA 3KHRA 5BPNA 2UXCF 1FKOA 2QA1A 4X65J 5C15A 4F4KA 3SXLA 2EHGA 4CIFA 2NNWA 2GX9A 1EQYA 3CHWA 1WSJA 4DR5F 1WKKA 2M88A 1JJ2R 3M30B 3DGPA 2GS8A 1SPBP 3N6NA 4FLWA 2OUGA 4M5MA 1TL5A 1S72S 3N6MA 1UKUA 4AQYK 1NMNA 2QLJB 1E4FT 1NUEA 1RHKB 1UFLA 3WUHA 3ZTSA 3SCXA 4OHXA 1FRIA 3R1XA 3K5NA 2ZBCA 1RGVA 3M8ZA 4DU7A 2EG2A 3MZIA 2MGZA 3OTBA 4U8YA 2X6SA 4CE9A 2KG0A 1QAIA 1WF0A 2A1RA 3G25A 1K8KA 2F9WA 3TANA 2ZHAA 4OV6A 4M5KA 5HLFA 3CMQA 3N4WA 1NGBA 3L3VA 2UUCK 3CMES 4TU8A 4CHOA 3FEZA 4DR6F 1S0MA 2KU7A 3VEYA 1KS2A 3NLCA 1QHTA 2CWXA 3RW7A 1UVMA 3A0IX 4JK8A 2XHCA 4NCGB 4N77A 4DU3A 3FCVA 4BR7A 3MGJA 5EY4A 4QWDA 4UY8O 3J80O 3M7VA 3U1LA 1MWZA 1GT8A 4GO7X 4ECYA 1FXRA 1U1LA 3BEGB 3GZ7A 2JVOA 3F9MA 4FZVA 3O3HA 3WXKA 5E84A 1TFYA 1J5OB 3IRWP 3UI3A 1OH5A 2ZH3A 4URGA 1KVCA 2CXEA 2DKOB 2GJFA 3T5HA 1X4BA 3AQPA 4KH1B 2JGUA 5D77A 3BEXA 3NH2A 3THVA 4ZMMA 3DOKA 3RSEA 4R25A 2NXNA 1HNWJ 3FVYA 1V5VA 3H5SA 1HBNA 4JD2A 2J9DA 4H5NA 2BA9A 3B8HA 3ZSOA 3CJ4A 1DKGD 3HI9A 3MURP 2R7SA 1BL3A 2EFOA 4TY8B 4RTFD 1VK0A 3GG0A 4JKEA 1C6VA 3LZJA 3N5FA 1JKHB 3CD0A 1YG0A 3SQGB 2JZ5A 2PAVA 3W64A 2XY7A 4RW7B 1B92A 5M2PA 1JLBA 3TSUA 3ZETB 3LDPA 1NJIT 5FLXU 4Z4HA 2KVQE 1Q8KA 1KQSM 3MPUB 2E5GA 2KVIA 3SQOP 3MFHA 1QE1B 1N32J 3CIPA 2HG4A 1N36J 3ZT4A 4WKRA 4IH7A 1SC4B 4AQYF 2VA2A 2D69A 4LBIA 2E6MA 2XLJA 2HNYB 4FLZA 1VK8A 3CCUN 3M2VA 4Q45A 2A6OA 1KONA 3QIDA 4HUEA 4ZPTR 3LDNA 3OT9A 1UA1A 3L3CA 3BKTA 4BREA 2XYHB 1BHLA 3P5JA 4NYPA 2KRBA 3M6XA 3P6YC 5GADP 3T6BA 3NXZA 1GXUA 2E7XA 3UKRB 5KFPA 5L39A 3I96A 4KGVB 2W40A 3ONQA 2HWHA 2RUSA 2JOQA 3T5LA 4M5DB 5K14B 2UUCF 1MG7A 2V6AA 3V6KA 1RBVA 4HVJA 2BUPA 3Q7CA 3EZ5A 3Q8RB 3TYTA 3V9ZA 3CJRA 4DCJB 5RUBA 2J7UA 3UE2A 5KG4A 2G8UA 3NWGA 3LP3A 2XMKA 3B8AX 3ULDA 5HK4A 4XH5A 2JLFA 3MD1A 3M9NB 3QFPA 3VETA 4Y2IA 2IS3A 3ASMA 1X0PA 2AW0A 4RUAA 4N76A 2CPHA 1IJJA 2IBOA 2ZUAA 3VAGA 2XSJA 1X4CA 2CQ3A 3IR7B 1B4SA 1ZPWX 2MZTA 4PKDB 3CXCM 3D2FB 2HVEA 3OUYB 4P9SA 2P9KB 1Y00A 4NZ0A 4USHA 4BE1A 2YI1A 2PA3A 2FHMA 3ET6B 4IXCA 5DM7Q 4UT4A 4QYZK 3SJJA 1OH7A 4MYUA 2C3PA 4BBYA 4FWNA 2WBMA 1R3NA 2D9PA 1O5JA 1S1TB 1VSEA 4QR2A 3ILJA 2OO4A 1RT5B 2LECA 1U8SA 1YJWS 5AZIB 3RBEA 3I56N 3CJKA 2OPRA 2FXUA 5DZ7A 4WK1A 3DDKA 2Q3PA 3VVTA 4NI2B 1PKUA 5DM7L 3TAFA 4DUZK 3VF6A 2J7KA 2XY8A 1D0EA 3TP2A 2IM0A 2DVIA 2KHDA 3H5UA 4KGXB 4A61A 4JV5J 5ETQA 1S99A 3VN5A 4OX8A 4P2FA 1U8WA 3MEDB 2LLZA 3MM8B 1X3NA 3VQAA 4FPAA 3K2PA 2WVCA 4GKKJ 3SAHA 4J9QA 3KJVA 4PUOB 4CO2A 2ILYA 3H40A 4NXNJ 1X4DA 1NHKL 5HMWA 2DR7A 4DSLA 2WSFC 3PRDA 1WOPA 2ZOGA 3EPGA 2EFPA 1RISA 5DGBA 4LF8J 4PXCA 3V4IA 4LQ9A 3Q8SB 1HBMB 4A62A 5CYQB 2IRXA 1CC8A 2DRDA 3ISNC 4NLVA 2VFVA 4QIFA 3CJ5A 4XEIA 4BR2A 5G0RB 3AA8A 3AO3A 2IM1A 3VEVA 5KFTA 1D4XA 3SPYA 1LK7A 4EWTA 1WC0A 2YH0A 5M1QA 4NMLA 3ETOA 4GVMA 2P8IA 2WB1D 2WTFA 4RNHA 3DDNA 3OXGA 4KKOA 4DTJA 1Y5NB 2EBEA 1HD1A 4BRHA 4AHUA 2APOA 3CM6A 2E2PA 1VQ7S 4I0WA 1RDWX 2R7YA 1NGAA 2IAJA 4WXWA 1Q81O 4Z94A 4XO0A 4JI2J 1D9FA 2NRWA 2VG7B 1G7CB 3U9ZA 4ZITA 4QU6A 3BR9A 3N5BA 5CH7B 1HQUA 1KTQA 1ULRA 5E3QA 3RB3A 4NLDA 1PJ5A 3VF4A 4BWJA 4DX7A 1YJUA 4ZJQA 2WVBA 2UUBJ 4OZLA 4PWDB 3GV7B 1QSLA 3NVKA 4XPCA 4K0KK 4ZN3A 4USKA 5HRPA 1VQ5S 1QJHA 1BG3A 2W1BA 4JI1J 3AVBA 4LSLB 3OQ2A 2BV3A 3TR8A 2YNIA 1FD8A 3LH2S 5L38A 4M8LA 2GIQA 1PJ7A 1YJRA 2AJ1A 4WP3A 1T7PA 3AVCA 1JL2A 1IG8A 3C6HA 1HX1A 2GV9A 2QM1A 1W2BM 3PKYA 2C2ZB 1TU0B 4DUZF 3DXKA 5CY4A 4I67A 1HHTP 1N5TA 4YDUA 2RRNA 4IH5A 5LMUJ 5CAAA 1REVA 2FZKB 2KYZA 1ELOA 2LXFA 1ILYA 2P6TA 3BSNA 1IBLJ 2CJKA 5B0CA 4FJHA 1KLMA 2R9LA 2QN6B 4GO5X 3HPGA 2FC8A 4IFYB 1SL1A 2CUYA 3T1HJ 1XQSC 5JICA 2EPIA 3HOSA 3C8YA 2RNEA 2DD8S 1RAGB 2W9BB 3TAEA 4CJ7A 5KFAA 3UDLA 3DRSB 4OMFG 1S97A 4KAZA 3P4UB 1DZ5A 2KB2A 1W2IA 5KOXA 2XWXA 2Q36A 3CCRN 4DV5K 4I6MA 1KCFA 4QCLA 2B9WA 4NLWA 4BRFA 4KFBA 3SLCA 2VU5A 1WC3A 3DLKB 4LF7K 3A1YG 2JEIA 2XSFA 2X6NA 4FWSA 4CBUA 1XBWA 4J9KA 4CF8A 3E9LA 5HI7A 5E3AA 4J9OA 4ILJA 3C7NA 4C4WA 2VJVA 4EBCA 4EU0A 1RCHA 3DRRB 1K8AO 1B64A 3CE8A 2AF6A 2R7VA 3TQ1A 5J1PA 5A8RB 4ES3A 4A59A 4FYVB 1HKCA 2ZH7A 1U0HB 1WAFA 3POTA 4AM7A 2DFHA 2PBDA 2BZ2A 2AYEA 2PEHA 4G1IA 3Q22A 1U1MA 1RWUA 4Q7AA 2C2KB 4X4QA 2Z2YB 2W2QP 2HVZA 4GV3A 3FRZA 2IJRA 3MFIA 2VONA 2XZTB 1GQEA 2R2RA 1YSJA 5AJ3J 2LQBA 4Y1CA 1YQHA 4K0KF 5K8PA 1WHXA 4ID5B 1BI4A 1RCXB 1VC6A 3G86A 2ZE2B 5MLCQ 3BDPA 3GIIA 1BD6A 2FC9A 1NG9A 4CO3A 1P1TA 2F9JA 2UVRA 4K4YA 1RWOB 2O8BB 1WSGA 4BQLA 3JYTB 1RNHA 3NMUA 4MKVA 3OL7A 1ZBUA 4M5LA 3OSPA 2I1RA 2ZZNA 4WFNQ 5AQRA 3DOMA 3K5PA 4EAHD 4CF2A 3I0RA 2DGOA 4FKXA 3NAEA 2J8SA 4R79A 3C16A 3EM1A 5B8HA 1U1OA 3F9KA 1TUYA 5LMNJ 3R2DJ 4BACA 3W9IA 4FSVA 2KT2A 5AQYA 2R2UA 2G8WA 2MQQA 4DL2A 3CJSA 2CQPA 2VPYB 2B0GA 4ZIWA 4WFNL 3TAMA 5B0EA 4AHVA 4OQJA 3QJJA 2J4RA 2XMJA 1J5EK 3VZIA 1FD2A 4QZVB 4UZCA 5I3PA 4ZK7M 4LH5A 1CJKA 1RZMA 3HOTA 3HPOA 5D0RA 4ZS6A 3B6OA 5HVGA 1VQKN 1NB2A 4OHVA 1VQ4S 4LF7F 4I7FA 2B9EA 5AQMA 3RB6A 2LXUA 1E6YA 2DR6A 3AA4A 4EP4A 3BSCA 4DX6A 3FNNA 4CD1A 3IWNC 3CJ3A 1QSSA 1U04A 3QIPB 1T9WA 3ZFVA 2HBQB 2B4OA 2AKWB 2P9NB 3L95X 3DLRA 2QFIA 3CC7S 1FKPA 4V19J 3KLGA 3NFAA 5F2RA 4QIWD 3LALA 4M3XA 5K9FA 3CCEN 4NLBA 3GPAA 1J53A 1JLGA 2JLGA 1NKBA 3ZC4A 3FFKB 2E7VA 4P75A 2MTLA 3UDCA 2BQRA 1Y64A 4DWIA 3IGVA 3LW5C 1VSKA 4FVCA 1WUUA 1RDUA 3DHXA 2BKNA 2P9PA 5ETNA 5F8GA 2HZAA 1URRA 1GNKA 2H1YA 4X84A 4ELUA 4E89A 2ILZA 3RTVA 4P52A 1IN0A 2E44A 2FZGB 2DNLA 3SSRA 2IM2A 2CH5A 3WXMB 2A40A 4IH6A 3H2LA 2WB4A 4NXMJ 3T7ZA 1KEKA 3MM7B 2JSXA 1DEJA 4DSFA 1VSJA 2E5IA 4O23A 4ZP6A 1LCUA 3OXLA 4AT1B 3CG7A 4BDZA 4B3MJ 4RW4A 2RILA 1TYQB 4A8XA 4DQSA 2G1DA 2DFEA 4Y0WA 3GE9A 3ENHA 2QV6A 4F4AA 1L3VA 4YN3B 4OYWA 4FDFA 1TKDA 2GW8A 4M3YA 1SQKA 1S5JA 4P72A 5M1FA 4WZQA 1JLCA 3ENAA 3D28A 1YTUA 1ZETA 4NLQA 4FJ9A 4CHPA 4Q2LA 5GMDA 4H0XB 3L8BA 4ED3A 1U2VA 5BRFA 4CHQA 1RT3A 4K8ZA 5BPMA 4JI3K 5CXTA 1X8DA 4RU2A 1YJNN 1J5EF 1Z6RA 2HBLA 1F3VA 5AXKA 1DBDA 2E6LA 1NRKA 1U02A 3GFHA 4FCYA 4Y00A 2GTDA 1YVFA 4LBHA 1Y0HA 4FXDA 2ZD1B 3CC7N 2D3UA 1K47A 3NAHA 5LL6d 2AU0A 4RBTA 3GDQA 1Z25A 4ZLLA 4BGAA 1WC1A 3NGZA 3HVAA 5HROB 3MWBA 4LD0A 4YOUA 2FB0A 3H25A 4Y2AA 2VC1A 2CQ2A 4K50A 2DNKA 3PX0A 4CJPA 4JS5A 3P31A 3WXLA 4WP8A 5AZJA 1EB0A 3BREA 3VQPA 3DM2A 1LWEA 1RT6B 2ZJRL 2YWKA 2KN4A 2XI2A 2DIUA 2VYPA 4CI6A 2RU9A 1NPPA 4C11B 3LOUA 9RUBA 3Q0AA 2RQCA 4DCHA 2QWRA 1IKWA 4BR9A 3D0HE 1HD0A 4CFDA 3OY9A 4HTJA 4K59A 1RHUB 1TL1A 3QLHA 4FNHA 2JC1A 3O1WA 1ZZNA 1S6PA 4HDHA 4B9SA 3HYFA 4G6VB 3AVLA 3FMBA 2ROEA 2RDDA 1S79A 2O8CB 2V50A 4O8KA 4DTOA 5HOOA 3AO4A 2G8IA 3HMJG 2H48B 1FKOB 2F96A 1H72C 3CF5Q 4NEYA 4H03B 1T05A 4L73A 4XDDA 5CYMA 5HMYA 2MMYA 3UDVA 2HAIA 3DGPB 1Q82T 3M32A 5KFGA 5IT9Y 1Y3JA 2ADBA 3FCWA 1S49A 3ENOA 2HIYA 2WZ1A 3N4QA 5M1OA 3CF5L 2ALYB 2YXLA 2B6AA 2YH1A 4ED5A 4BQZA 3PW4A 1YHQS 1XMQK 5AQKA 3NHGA 3WQTA 4RWXA 2MGZB 3G96A 4YHHK 1Y11A 1UVLA 4FXVA 3R2CJ 4QOTA 1HYZA 1YIJS 4RG8A 1K8KB 4JI3F 5KFHA 4NLGA 4J90A 5HAOA 1B9FA 5L46A 3QAUA 3CCVS 5HLFB 2B9XA 3P96A 1WHYA 4HLBA 5ETOA 2BW2A 4GV9A 3U8XA 1JCEA 1FK9A 2I7NA 3AY9A 4I6AA 1RTHA 1Q7LB 4DR5J 4OX6A 3QT7A 3V9UA 1FW6A 4JUZA 4CEDA 1R8CA 3SDEA 4CP5A 3DGVA 3CMAS 1VYAA 3CDEA 2AJQA 3FZLA 3U3GA 4O55A 3TUPA 4A8SA 3BQ1A 4WU2A 1D9DA 3IKMA 1D3WA 1PSDA 2EXUA 2RS8A 1NM1A 1J27A 3QGHA 3CPWR 3MTJA 4JNEA 2E1PA 4LF9K 3EVWA 1EWRA 4KBIA 4CT8A 3TZWA 1H2VZ 1C4AA 4CLYA 3J7YP 2LQ5A 1N54B 4IRCA 3DOKB 3CJTA 3RSEB 2DRBA 1RFQA 3QRPA 3SZ2A 4G65A 3OYGA 3CJAA 3MK6A 3ITHA 4JD2B 1HBNB 1K0VA 1YTYA 3FGVA 1S6OA 8AT1B 4X4SA 1NK6A 3OR1A 2DEIA 2XNQA 4USIA 2G13A 4XDCA 1F9FA 3UN2A 2V2ZA 4M1KA 1GAOA 5BR9A 4LSNA 1JLBB 3R5CA 5DQHA 4HYKA 1QUVA 4IO8A 4ICLA 4YNQA 4DFKA 2AJ2A 3M3ZA 3KVGA 2DY4A 2F63A 3SSQA 2OELA 3CCLS 2W7OA 4FWKA 3L2RA 2FSJA 4QR0A 3BB5A 2IVMA 4DV4J 4QPXA 1SQGA 1KQFB 1JXLA 5E33A 4KHPK 1T9TA 4I68A 3M2VB 5IQQA 1XMQF 4YORA 4JHDA 3VQ8A 3FJ2A 2DY1A 5J1EA 5F0UA 3T9NA 4YHHF 1U09A 4R0EA 4KB0A 2DXEA 1QDUB 3K89A 3FR0A 3CCJS 3CCMS 2ACMA 1RTZA 5IZHA 4YOXA 1DLOA 2P1JA 2MJNA 2K7JA 2NZCA 2PMWA 3UD3P 1SJRA 3BBCA 2V4RA 1F3FA 4BRGA 4ECTA 5FIIA 4BRKA 3NOGA 3ZXWA 2ASOA 2CQGA 3MWTA 1YX2A 2RHQB 3EGZA 3AV9A 1IKYA 2DGUA 1BWFO 4PABA 1NJZA 4U7CA 4AILC 4JKHA 2XEXA 3AA5X 3NNCA 2X74A 4KI6A 1XR6A 2VD3A 2HPUA 2PN6A 2KL8A 3AB2B 4AQYJ 3BKFA 3O8WA 1YJVA 3NGRA 4B1UB 3E2EA 4AXIA 1N5QA 2V7YA 2GNKA 2XSJB 5TKWA 2MHNA 3O9SA 2CQ4A 4OLBA 5ETLA 4FLYA 3MDFA 4QW8A 3R3LA 4LF9F 3R9LA 4QIVA 3FDSA 1Q95G 3UW1A 3ELHA 2W4CA 1IR0A 1PILA 2UUCJ 3J7AP 4RW9A 4OVLA 1N48A 3E66A 3O4WA 3BO2A 2ATQA 1NK5A 3HL8A 4LSZB 2B9YA 3A12A 2PGCA 2DNPA 2KYXA 2PY5A 3GIKA 3AA9A 2ZH1A 1FJCA 3K9JA 4IOCL 1N88A 1WELA 1YKWA 2MQ8A 5IT0A 4H5TA 1P1LA 3CJKB 2OPRB 3US5A 3M8YA 5ETRA 2QL7B 1NBWA 2CPDA 5KG5A 1WBDA 3R9PA 3CC4N 2Q97A 4K4UA 2QKBA 1SUQA 2I8EA 1EX4A 3GLJA 5KT6A 2BJ9A 3Q24A 1UWBA 4FJIA 3VAKA 3IAS9 1VC5A 1KHWA 3BO4A 4FPBA 2OEKA 1IV0A 4KHPF 3CCJN 3CCMN 2W6KA 3RJMB 2R8GA 4LF6K 3GONA 3WIUA 5AQNA 3PX4A 2CPZA 3KJVB 3O6QA 4RO0A 3U4LA 5CZ1A 4ZPDA 4TN2A 1HYSA 1QD1A 5A2QU 3V4IB 5LSOA 5F0XA 3MXIA 1CQMA 3JQJA 4OV1A 2B5JA 3OYHA 4W5QA 1YF5L 1MN7A 1G6BA 3ZNJ1 4F36A 3A3OB 3K8WA 2JRSA 3D6HB 4OIXA 4W98A 2IC3A 3EZWA 5EUHA 3J81j 3PYGA 1NOYA 2F3JA 2KH9A 1VQSA 3AFGA 4CTAA 4CGJA 2N4CA 5H9FK 4IFVA 2QLXA 2MSSA 3VAIA 1EXQA 4KKOB 3RG6A 5A8KA 1JXBA 2YKAA 3MM5A 3TJAA 4PQAA 2VDIA 1SAZA 3QQCD 4J7CA 2N4DA 3W8GA 2VFRA 4GVBA 1BWEA 2IAJB 2K2PA 2A18A 1YJTA 3NGKA 4KI4A 4OYOA 2XMMA 3VF2A 1HNXK 3WNEA 2HS4A 1HQUB 1NMDA 5KRSA 2J9EA 2FVCA 5GAGU 4QR1A 1LWFA 2VQFK 5HN0A 2P9EA 2KZZA 4NLYA 4O5FA 3OYJA 1ZC6A 4RLEA 2IOCA 5AXMA 2H5IB 4PAAA 5HRNA 2QL9B 1HFEL 2JWLA 2YNIB 3TJ8A 3NNAA 5FROA 5HANA 3A8YA 2XULA 2D3ZA 3H08A 2ASYA 3TEHB 5BYQA 2ZKUA 2G0JA 3T1YJ 3ZZPA 2HHXA 4JI5K 1RBLA 3BGUA 3DXKB 1L5UA 4KTZA 3G10A 1REVB 5KG0A 1VQ6S 3R7NB 4O3PA 1B9DA 2DGSA 1KLMB 4YDUC 2FSNA 1JIHA 3QATA 4NASA 2XMAA 5TKYA 4CJWA 3SK3A 4LF6F 3N01A 3O8MA 3SFGA 3RMAA 2G4BA 3EL2A 3OV7A 4OGEA 3B78A 3H2VE 5IM0A 5AXLA 2IBKA 3VQ4A 3QPIA 3HKZD 4GRSA 4WTOB 4QYZJ 3O5BA 3AVNA 3KTQA 2KI2A 4FF3A 3B6BA 2R4FA 3C6UA 3KNGA 2QI2A 1VK3A 1NGJA 4OZ3A 1FF2A 4I6MB 4DCOB 2HK3A 4KGMA 3MR7A 4KFBB 1X4GA 2YHAA 4AM6A 1N52B 3C46A 5FPEA 4YY3K 3QERA 3MOJB 1SVDA 4DUZJ 2FF6A 4BHQA 4DQ8A 3ETMA 4ES2A 3PR4A 1L3TA 1S1VA 3JS6A 1MNEA 3TUIC 4L3NA 2GIFA 4MMOA 4WQ4A 3C7NB 1WKJA 1NHVA 1VJQA 4IWVA 3P38A 5EOYA 1FDAA 3AVIA 2GHWA 3MWPA 4EYHB 2VODA 2M52A 4O5BA 2EFQA 3O80A 1S6QA 4ZA1A 2OTLN 2QL5B 3OHAA 4DR1K 1HNXF 2GV1A 3SUNA 3POTB 5HVHA 2O01C 1BE4A 3VOVA 1RWXB 5L1IA 1NPKA 2YNGA 1K44A 4EO6A 4A8FA 2RU3A 4F0MA 3OHRA 1Z2LA 2AMCB 1P27B 2VFTA 2VQFF 4J9VA 2VPXB 2WTUA 3PIPQ 4ZN1A 3MM6A 3IFRA 3CNQP 4EIAA 5DG8A 1BI4B 3K8VA 2NXUA 1UL3A 3GE1A 1R31A 2L3MA 4GY2B 4OJRA 1VQ6N 2ZEJA 1N5YA 4MYTA 5BPLA 3OYEA 1IVZA 5JS2A 2ZF5O 4BR4A 4BRMA 4RPFA 3PIPL 5LOQA 1M5VC 5A0YA 3IWLA 4BVOA 2QTWA 2ASMA 5AFUH 4JI5F 4UF4A 5KAKA 1XJWB 2DXDA 4O44A 4AFFA 4CJVA 2F7TA 1F5AA 3EVOA 1WKLA 2WUSA 1XNRK 3DOMB 2YHXA 4M95A 1JLFA 1FDNA 3I0RB 2E1RA 5H9EJ 3C16B 5F3TA 2Z56B 4PL7A 4FYDA 1C0FA 4F9OA 3G71N 4CJ5A 2MJUA 4RU9A 4X64K 5AQQA 1SJ1A 4QS7A 4K0KJ 1S0VA 4U67Q 4JKAA 1KQSR 3TAMB 3SUPA 1NKEA 1S9FA 4ECZA 2NUHA 4WZMA 2RDJA 2KT5A 3GIJA 4X4VA 1CJKB 1JXVA 3V4MA 5B0DA 4K41A 3D6TB 2Q0UA 1FXDA 3LF0A 1F5BA 4E1NA 4OJHA 1TUWA 1SC1B 2FHKA 1VIXA 1IM6A 4KHNA 4U67L 4YY3F 4FXWA 4I7FB 2E29A 2F8TA 5THWA 1N36K 3WC0A 5FJ4A 4U95A 1UZHA 4HDGA 4LC9B 1E6YB 1L3KA 1A9NB 3KKSA 2ZBIA 1W9HA 4W92B 1WJ9A 2V9KA 3TU5A 3BUZB 4KREA 2MKSA 1HLUA 3W63A 1VQ9N 4P74A 3UQSA 2FVSA 4HUFA 1PBAA 1FKPB 2YHYA 2AEJA 1SC3B 3KLGB 2V67A 4DR1F 3MMJA 4A8YA 1RLCL 1JLGB 3I5AA 4A4JA 2BDPA 4UQTA 3I55S 4W90B 3SMPA 1O6XA 5ETTA 3WX4A 4JI6K 1WC4A 4JB8B 3MDQA 2Y8WA 1T9XA 4ALZA 4OZJA 3L2WA 4DV5J 3J81O 2P9PB 2KXNB 4KH5A 5KQDA 4EHUA 2OCEA 3X1LB 5L1KA 2QXFA 1V5IB 3G8SA 1N8RO 3HP9A 3HF5A 4H0OA 4CK2A 1IJEB 3W1YC 3CXCR 3HPHA 1FX2A 1JNZB 4Q5VA 5DLFA 4NPOA 1RA6A 3D1QA 2A2DA 1PAUB 4I9QA 3S3NA 5T7LA 2O1PA 1M5HA 2OKQA 3FLCO 5HJXA 4M41A 4FWOA 4KPYA 4JV2A 5HQMA 4KRFA 4RW4B 3JB9k 1UAWA 1HW9A 3W2WA 4CH0S 3LANA 1B0TA 1X5OA 2DHXA 1WOQA 1XNRF 4WP9A 2CG4A 2GO9A 3PCOB 1Q9YA 1RWPB 1EKSA 2BM1A 4FS1A 3ZEUA 1JLCB 4ED6A 1KTVA 4EBDA 3H1VX 4DXLA 2VGNA 3R6GB 3M8RA 4X64F 1QAJA 1GX6A 3L2QA 4BRQA 3M1VA 1N56A 2DIVA 5AQIA 1U2VB 3NKYA 2VV5A 3NGSA 4G1QA 1RT3B 2DNQA 3V6DA 4RJVA 4FWQA 2V2QA 4J9RA 2LVWA 1MMLA 2E9TA 3V1RA 2NUBA 3KIOA 1MSWD 3TTCA 1S4EA 3QT8A 2VA3A 2FJEB 4UOHA 4K5RA 4S0MA 1QSYA 4PA1A 2BVZA 2W9AA 1BCOA 4DL4A 2YJFA 4ID8A 5HVFA 3WHIA 1RU1A 1N36F 2VOOA 2W6LA 5LXYA 1CZAN 2VH7A 4WFYA 2CRLA 3TX0A 3D7EO 5GINA 3EYZA 2MKJA 4C3LA 3I55N 4KB7A 3R8EA 2HHHK 3B4DA 3IAM9 3FE1A 1WWHA 2BMBA 2OPSA 2G9OA 3K57A 2FLLA 3LL3A 3D1HA 3A8JA 2LKZA 1AXQA 2CJYB 2MEWA 5AZJB 2ZNZA 2F8MA 3EVMA 1KVJA 3DM2B 1LWEB 1LOTB 5IWAK 2BOPA 5FPNA 4FZXC 4HI2A 3CCSS 2SXLA 3BN4A 5LJWA 1IKWB 2OHDA 1J5EJ 4JI6F 2NXEA 2RAQA 1TL1B 3QLHB 4WBFA 3OTCA 2DXFA 1S6PB 4CYUA 3EKUA 3AO2A 3AJ2A 2I6WA 2U1AA 1SJFA 2Z57B 3KZBA 2GC8A 4IJNA 4CLUA 1OKJA 2EVZA 4F25A 2W2OP 3JAMU 4CESA 3G82A 2EKYA 1WC5A 1T05B 1S48A 3VTIA 3TZYA 3J81Y 4FWLA 1YT3A 4KRWA 3JTPA 1X5TA 2J7WA 3FSYA 2A0FB 3V81A 4CF9A 3M32B 4NRUA 1Q7YO 2QWPA 1VQNS 1KN6A 2K1RA 4CJEA 2VWJA 1X1PA 1HKGA 3FC9A 1RAAB 3VTHA 1E4GT 2XCPA 2B6AB 2GQ2A 1W2BR 4JI1K 1ESVA 3MEEA 4PXEA 2VWBA 1AA1B 2YWHA 2A3JA 1VJWA 4ECWA 2FHJA 4WE1A 1C2PA 1HNIA 5IFMA 5KFBA 5GAEU 3VQBA 4BC4A 4JBCA 5DG7A 2XM3A 3OS2A 3QJPA 2CQIA 1R8AA 1YBTA 1Q7YT 2WCXA 3A13A 5LMUK 5F0WA 1OMSA 3QFHA 4M3RA 1FK9B 1RTHB 2L9DA 4CEZA 3R3TA 4CLLA 4KPCA 4Y34A 1TUUA 2CPJA 1VQLN 5CZ2A 2HGNA 3SDEB 2OZMA 3A5NC 2VZ9A 4KY3A 4A57A 1KOHA 1OYEA 1LW0A 5M1NA 2OYQA 3ULEA 2AEMA 1RBRA 3E9PA 3THPA 4FF4A 4DTNA 1QUPA 2CZ9A 2HHHF 1MU2A 3CCSN 3OW2M 3L2VA 2JHEA 1NK8A 2UYTA 1FFWB 4H5WA 3NF8A 2PYJA 3FZBA 1VBKA 5C12A 3LAKA 3ATUA 3I82A 5GVQA 2FLNA 5IWAF 3CETA 3MMAA 3HDSA 4JI3J 2WONA 5BRDA 2RIJA 3QZ7A 1VSIA 1YZ6A 3UN3A 3W0LA 3VEOA 3WNHA 3WDOA 1KVKA 1SJ4P 3NS7B 2A6MA 5CQGA 3ULHA 3H2UB 4DZ6A 2BR0A 1IM4A 3ITHB 4FBUA 3HSJA 4LREA 4LT6A 1RHRB 1VQNN 4OHWA 4L76A 2V68A 1E6VA 1YJ7A 3OR1B 4KHYA 3CO0P 3GG1A 3L4IA 4DV0J 4KH6A 1WG5A 2E1ZA 4E8UA 4H4OA 3NS6A 3VGKA 4LSNB 2E2QA 3NOCA 2UUWA 3Q7BA 4ICLB 3DU5A 2E2OA 5LSRA 4ZPWR 4Y0FA 1NK4A 5KFEA 5I9EB 3HM8A 2RT3A 1GOAA 4WYBA 2ZH2A 1BDGA 1KC8T 2ZBPA 1QZ6A 3D67A 4JI1F 2AP6A 4M63A 3SMSA 4CJQA 4YB5A 1RCOB 4OPKA 3T6JA 1GLBG 3CFOA 4JHDB 2RE1A 4YUDA 1PJ6A 5J1EB 2H54B 3MXHP 5F1XA 3CJ7A 2BQUA 2M2BA 4JKCA 3RW6A 3ZZRA 4BRAA 4MAKA 2RHKA 2V94A 2HS0A 3U3YA 4PEOA 1EZZB 1DLOB 4UZBA 5LMUF 4M5JA 4OZ2A 3O9TA 2VHGA 3CFPA 3AVGA 2FBXA 3EMTA 4OL8A 5ETVA 2LU2A 4CLFA 4KSEB 2JX2A 1RT4A 3JSRA 1IKYB 3VV2B 2GZOA 3A3NB 3CC2S 1TL3A 2ROGA 3GV8B 3DDIA 2HGMA 3GG4A 5AQXA 1XMQJ 4YB7A 4DV7J 1N0UA 4M5NA 2UUAK 2MZ1A 1QY7A 2OMOA 2MY8A 4YHHJ 2DGVA 1WN7A 1RABB 4MK7A 4OKJA 3TWHA 3ADAC 2BKOA 3IN5A 2QEXN 2ZH6A 1FNXH 2YTCA 4ZLJA 4Q44A 4PHTX 2C2OB 3NG8A 4CLTA 1S5ZA 4CJLA 1UCNA 3THTA 2YPYA 2VIHA 3QEPA 5H1SQ 2G2OA 2X51A 4HL9A 4RW9B 2LEPA 4USTA 3DLJA 3MR3A 3LP0A 1YITN 4OLPA 3KXDA 4OI2A 1ZXOA 1RYRA 1EQMA 1GMWD 2GFFA 3V6HA 4C8ZA 5HRRA 4FLUA 2FBTA 5B0FA 4BLGA 5DDQC 2Y3YA 3OYKA 3FZHA 2R7XA 2MDAA 4JKFA 2N82B 3F5TA 3KK3A 4B9TA 3TO8A 1SUQB 3I8DA 2DPJA 2Q66A 2ETJA 3FKBA 4FJXA 1RADB 4OPJA 4FM2A 6FDRA 2WFBA 1UWBB 3NF6A 4LF9J 4MJKA 3BR8A 4PG5A 1DRZA 3MN5A 1ZTTA 1FO1A 1XR5A 3QEWA 1CSJA 1XHXA 3A8EA 2DO4A 3PVXA 3QB0A 1HYSB 3W60A 3RVCA 1RILA 2OI2A 3KWMA 5AQPA 3PM9A 3LZIA 4E3SA 3SQ0A 5MLCV 2B5JB 4HTIA 3LGHA 3DXMA 5GAHP 4RCHA 2QK9A 1AUSL 1NBEB 2IC3B 1TP7A 1G99A 2PO4A 5EDWA 4BS2A 4CTAB 3NVMA 5M2RA 4IFVB 2AJ4A 2WSCC 3KJQB 3L7OA 2BGGA 2HHUA 1FDBA 4CHNA 3TJ9A 1N0VC 3Q8QB 4DFPA 2PFFB 4MK8A 5A8KB 4PKIA 5LSLA 3U02A 2XS2A 4EEYA 3MM5B 5A8WA 2MLXA 4BRNA 4GV6A 4OKEA 3HFKA 3UWTA 2YBVA 3GFXA 4PWUA 3ZSVA 4GVBB 2P6SA 3DNCA 2KQ2A 4KHPJ 2GMJA 4C7QA 4FLTA 1IBKK 5KFWA 2UUAF 4DOZA 1I6JA 1DTQA 2FD2A 3ZZYA 3SBGA 3SSSA 3KFWX 1SIWB 1GMWA 4LFBK 3ZO7A 3LM9A 3M6GA 4CWBA 2W2MP 5B0AA 4DL3A 4ED0A 1TKXA 1LWFB 1FCAA 1NSKL 4I6YA 2CGJA 1VR6A 4DLGA 1RHMB 2XO6A 3B4MA 1EWQA 2JDJA 3SAFA 3QWPA 1EHWA 3H42A 2CPXA 1TKTA 2BTFA 4ILGB 1WD6A 3UCGA 4YS2A 1KNZA 4Z2XA 4WJBA 3PFOA 4LIRA 3IA0A 2DNRA 2Z30B 4B3RJ 2ZUGA 4GNIA 4M94A 5A2QY 2M7SA 4CF1A 4ZVOB 4C8MA 2IA6A 3OVSA 2MQNA 1NU0A 1ZM2A 3CO9A 4CVNE 2CH6A 3GMGA 1YJ9S 3FK4A 2VG6A 3V6JA 2IFXA 1WEXA 5L9XA 1U2CA 4NX9A 1LWXA 4USUA 1LK5A 2DPIA 2DB1A 2E9ZA 3R5JB 2YQ1A 1HBOA 1AB8A 1A5VA 3CM5A 3S6EA 2NLXA 1NGFA 4DX8H 3M8PA 2I9SA 4QWBA 3QBWA 1VMBA 3QMQA 5IM0B 2O8EA 1WI6A 3RRHA 4H0VB 5EU7A 2I7PA 4NA1A 4QW9A 3NCIA 3C6UB 3WNGA 4A8KA 2RPIA 4ZOSA 3VAFA 4M5HA 4DSKA 2BRKA 2IPOB 4YOYA 3W5YA 1W26A 4QQBA 4JI8K 2GAGC 3W62A 3VF0B 2KJWA 1UETA 1KR4A 4I64A 3KHLA 3U6FA 4WXOA 1S1VB 2ZGZA 3D3BJ 2ZJPQ 2YKQA 2OANA 1QQNA 3PSFA 1WOOA