4IFVA

Detecting allosteric sites of hiv-1 reverse transcriptase by x-ray crystallographic fragment screening
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
556
structure length
556
Chain Sequence
MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Exoribonuclease H, p66 RT
publication title Detecting Allosteric Sites of HIV-1 Reverse Transcriptase by X-ray Crystallographic Fragment Screening.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
total genus 167
structure length 556
sequence length 556
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4ifvA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ifvA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ifvA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ifvA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ifvA05
3DLEB 2IM3A 3H5SA 2KZMA 4Y2CA 2Z1IA 2Y1IA 1G15A 3H2LA 3B6OA 3HHKA 4CJ5A 2HNDB 2HNZA 4Q45A 2PYJA 3DLKB 2F8EX 4IRKA 2KTQA 4NZ0A 1JXEA 1RT7B 3U3GA 4AHSA 5HLFA 2YHBA 2RN2A 1S0MA 1VRTA 4DQSA 1NJXA 2KFNA 2XHBA 1S49A 4CJPA 3IGVA 4R0EA 3S9HA 3PW7A 4H4MB 2JEJA 4GMJB 4FK4A 1SUQA 3WNGA 3RMBA 1WAJA 1L3UA 3KK2A 1ASWA 4K50A 3DOLB 3ICLA 3I5CA 1KVCA 4Q44A 1IKYA 4IFVA 2IM2A 3DLEA 4KHQA 4PY5A 4CEZA 3RAQA 4W5QA 3BSCA 3C95A 1T03B 2VA2A 1JX4A 4LQ3A 4MK7A 4DQRA 3RR7A 3JYTA 5KFKA 3OS2A 3V6DB 5SWMA 4MK8A 2HNDA 1SKSA 4F4YA 5CYMA 3DLKA 3VQSA 4J9MA 2UVUA 3LALA 4JRPA 1FKPB 1TKTB 4YNQA 1DTQB 1BCOA 4NLVA 3LAKA 3I8DA 4DSJA 4OKEA 1VSLA 1S1WB 4H4MA 3SCXA 4C8MA 4F2RA 4YR2A 3IG1B 2D3UA 3H5UA 4RW4A 2DY4A 1S0NA 3DOLA 2D0BA 4LSNB 4BE2A 2IAJB 3DMJB 3EPIA 5KFYA 2QV6A 2BANA 1T03A 4LH5A 1UWBB 2IS3A 2OPQA 3UDLA 3EY1A 3AA5X 5L1KA 3OVNA 2XO7A 3ASMA 3RMCA 5HRRA 3V6HA 2XCAA 1TAQA 4ID5A 4O3PA 4I9QA 4E1NA 4CGGA 4FM1A 3FQKA 2XY5A 5KGXA 1FXXA 2AGPA 1FKPA 2DTUA 4KHRA 3PX0A 1TKTA 2AQ4A 1DTQA 4I2PB 2UVVA 4DS5A 4ZVFA 2HHVA 4RW9A 3AVBA 4G1QA 4ECWA 4B9LA 4MKBA 1U47A 3SNNA 3MEEB 1YTUA 4FW2A 2J6SA 2IGIA 4HUFA 4CGFA 3NBPB 1KVAA 5L1LA 5KGWA 2ITGA 3VQCA 3SV3A 2IAJA 1N48A 3DMJA 1IKWB 3DLRA 5CYQB 3K5NA 1Z4UA 3AVAA 3BGRA 3WNEA 5KRSA 4CJ4A 2HNYA 4FZYA 3M9OB 4MFBA 1S1TB 4RW7A 3FFIB 2AX0A 4FJJA 4DEZA 4FJXA 4B3OB 4EBEA 1S4FA 3MTKA 4KSEB 5SZTA 4TY8B 4Z4CA 2GIQA 4IFYB 4IDKA 3Q8RB 5F8LA 3AVFA 3CJ0A 4ZPDA 4DSLA 1HPZB 4KFBB 5K14B 3HPGA 4KPYA 4F3OA 3IS9A 1HNIB 4ZVEA 2W9AA 3MEEA 5FDLA 1TVRB 3NGYA 5JXSA 5JS1A 1N4LA 1XHZA 5KFPA 4E7LA 2AX1A 4KI4A 4KTZA 3OJUA 4HHTA 1JXLA 2BDPA 4ZVHA 3SUPA 1HQEA 3T5LA 3DOKB 3KOAA 2O4IA 2AU0A 5DK5A 4KE5A 2HMIB 2ZD1A 3DDKA 1JL2A 3ALYA 3V9XA 1DTTA 1FK9A 4DL5A 1WAFA 1VSFA 3LPTA 4IFYA 2J6TA 3KLGA 1A5VA 1S6PB 4WE1B 1HPZA 4KFBA 5I42A 4J2AA 3G0ZA 4QWBA 4RNFA 3RB4A 3NF9A 1VSHA 3AVJA 2YNHB 4EYHB 4EO6A 4DTPA 1S10A 1ZBHA 3PX4A 1ZBLA 4KHMA 4DSFA 4GC6A 4DG1B 2ZE2B 5DQGA 4ED3A 3WNHA 5KG5A 1T8EA 4F4KA 5KG7A 4TN2A 1RT5B 4JV1A 2D5RA 1IKXA 1Q9YA 2OPRA 4KV8A 3U3YA 2HMIA 1ITGA 3RRHA 5EU7A 1RTJA 1W0HA 1RYRA 4M41A 4DSIA 3M8QB 3CJ2A 3OHAA 2R2TA 4DL7A 2QKBA 1S6PA 2FBXA 1TGOA 3PR4A 4J9KA 4B9UA 5KT2A 4M3UA 4M3ZA 1S9GA 4O4GB 3VA0A 3TI0A 4CGDA 4H4OB 4ECUA 4NLDA 4JLHA 4Y1DA 4OLAA 2YNHA 1T7PA 1U04A 1LWCB 4CJUA 4EYIB 1RILA 3S3OA 4BE0A 1J5OA 4B08A 3OL6A 1JKHB 4DG1A 2ZE2A 3TAFA 3DLGA 2R8GA 2XY6A 2BGGA 3DLHA 4NLUA 2B43A 3A2FA 4CHNA 5KT4A 1JXBA 5F8IA 4WFYA 1NK6A 3V81A 1RCHA 3DLBA 2X74A 5KFCA 3M8QA 2XI2A 3LAMA 4ZP9A 1TK5A 4LSLB 3MAQA 3RB3A 4CEDA 3AA4A 1BQNB 2Y1JA 1UA0A 4BACA 2PYLA 4O44B 1EETB 1T3NA 2OA8A 4DSKA 3KLFA 2Q3SA 3AVCA 3OY9A 3BSAA 1KHWA 5FRNA 3M9MB 4ECYA 1A5WA 4K4WA 3NAHA 1QTMA 1JKHA 2VG7B 3KK3B 4QW9A 1XR7A 2B5JB 4CGIA 3OYKA 1RT4B 3GIIA 4QWDA 4I2QB 3SQ4A 2UUTA 1S9EB 2VWKA 1S6QB 2E6LA 2G8VA 3K59A 3O3GA 3LP2B 1QSLA 1I6JA 3N6MA 2XC9A 4FK2A 3V9UA 3QZ7A 4NLQA 3GV5B 2IOCA 4ED8A 4YR0A 3O4NA 3IAYA 4CF2A 3KHRA 4LSLA 2IJNA 5DG8A 1QAIA 1ZETA 2PZSA 4Z0UA 4URQU 2WONB 3QGGA 4Q8FA 3ITHB 2DFHA 5HROB 2KW4A 4O3RA 1KTQA 1N56A 4HUEA 4CEOA 2VG7A 3L2VA 2B5JA 4J2DA 4BWMA 4UQGA 1RTDB 1RT4A 4EBCA 1LWFB 4KO0B 4QOZB 1CLQA 3P5JA 5C42B 4J9PA 2CJQA 1LV5A 3K58A 2ATLA 3LP3A 3I5AA 3LP2A 2G8FA 4NRTA 1B9FA 4N41A 3QINA 4CJWA 5HRPA 1RT1B 4HUGA 1BIUA 4DTXA 3MR6A 4KAZA 1D0EA 3NMAA 4O3OA 5J1EA 3VA3A 4PWDB 3HM9A 5KG6A 3H4BA 4ZTJA 2BE2A 3NL0A 3QO9A 2UVWA 1UA1A 3MF5A 3TANA 2WOMB 3HP9A 3RB0A 4IKFA 1O1WA 4OKKA 2IDOA 1RBSA 4AHTA 3C6UB 3KMSA 3H98A 4QWAA 1KLNA 1EX4A 3T5HA 4ICLA 2DFFA 2JC1A 2YV0X 2QK9A 1IG9A 1JLFB 2HNZB 1C6VA 3AA3A 3DYAB 1LWFA 1LWEA 1W25A 3K5OA 4CEFA 1HARA 3LP0A 4KB0A 4W5NA 5HLFB 3E01A 1VRTB 4Z4EA 4W5OA 1X9SA 4IKAA 1IKVB 3IRXA 3CDUA 4DQPA 2W9BA 3OYMA 1S0OA 4DU1A 3KHLA 4PWDA 2Z1GA 1SL2A 2VG5B 1NJWA 1SUQB 3KLHA 4JV2A 4PA1A 3D28A 1JLQA 1IM4A 3CIZA 1IKYB 4IFVB 1NHUA 1YVUA 2GV9A 2A1RA 1X1PA 3IGNA 3AO3A 3C6UA 1WSFA 5KRTA 2G8UA 3HKWA 4CJQA 1RNHA 2HB5A 3JYTB 1ZTWA 3ZSVA 4MH8A 4CJSA 4CK3A 4DU4A 3NDKA 1JLFA 5KI6A 4B8AB 5CYMB 1QUVA 4QPXA 5J2PB 3DYAA 3H40A 2Z1JA 5C5JA 2JEGA 1BI4B 4ZP6A 3TAGA 3OYCA 4E3SA 4DFMA 4EEYA 3DI6A 3RB6A 1JL1A 3SUQA 4R5PA 1QS4A 1IKVA 3KHHA 3AVHA 2QKKA 4DU3A 1TKXB 2VG5A 3NE6A 1RTHA 4RW4B 3G6VA 3ZT1A 2FVPA 3OYAA 3TAEA 2WTFA 4FJMA 2BQ3A 4FJIA 3Q8PB 3EZ5A 3HVWA 1RT2B 3KLIA 1RBRA 3L2RA 4ED7A 2BANB 3MFHA 1HQUA 3GIKA 1BIZA 3KKRA 1NOYA 1TKZA 2OPQB 4NLWA 4U7CA 5KFZA 3QGHA 1S48A 3L2UA 4O4RA 4NCGA 4X2BA 4ID5B 1RAJA 5J2PA 3B6PA 4MK9A 4ECQA 1KLMB 1BI4A 3Q8QB 4CGHA 3V1OA 3G6XA 4RNMA 1SH0A 1ASVA 1S1UB 2VA3A 4RW9B 2W8KA 5DG7A 4G1QB 3OHBA 3QIDA 4DF4A 1TKXA 2JEFA 1WN7A 3HSTB 2D41A 1Z25A 4KB7A 4BDZA 5KFTA 4K8XA 4RNNA 3TAMA 4Q5VA 4CF0A 4DTMA 5KG3A 5I3UB 4ZHRA 1JLBB 2JC0A 2V0NA 2RKIB 4OGEA 2FLLA 1RT2A 3HVAA 3ZSYA 1QHTA 5JUMA 1VK0A 1TK8A 3BGRB 4WYWA 4J9QA 5J2MB 5F9NA 2HNYB 4J9SA 4M95A 5CY4A 1NKCA 3AV9A 4MFBB 3LWLA 5EWEA 4RW7B 4K4UA 2WCXA 4YP3A 1L3SA 1KLMA 3RTVA 2KFZA 2ZQBA 3QEWA 4CHQA 2YNIA 4M94A 1S1UA 4IDKB 2G8WA 2FLPA 5J2NA 4CJFA 3VQ5A 3CJ4A 1RDRA 4DTUA 3C6TA 3MFIA 4FJNA 3IS9B 2XI3A 3BSNA 3L3UA 5FDLB 1HMVA 3LPUA 2VWJA 3HJFA 2F96A 1C0UA 1T05B 3QETA 5F9LA 1NK4A 1MU2A 5I3UA 3U6FA 1D8YA 1JLBA 1NKBA 2RKIA 5FROA 1RT3A 4XO0A 5DQIA 3LANA 4Z4GA 2R8KA 3JSMA 4NLYA 5J2MA 3NH2A 3QESA 1HQEB 4URSA 1I39A 3AO4A 3DM2A 1SH3A 1XI1A 4K4XA 4FLVA 1RTIA 1NK7A 2ZD1B 5L1IA 4N56A 4F4WA 3SPZA 2D0AA 3RR8A 2F8SA 1DTTB 1FK9B 2HVHA 2R8HA 1K1QA 1CXUA 5KFXA 4ECRA 3KLGB 3OL7A 4NYZA 4CK1A 1RDDA 4JRQA 5KFSA 5I42B 4CE9A 1TAUA 2HHSA 4DQQA 4B9MA 4B9TA 4GVMA 5KFJA 2B4JA 3I5BA 2A1SA 3OYBA 5KFVA 3HL8A 2NUBA 5HP1A 1BL3A 1WSHA 1T05A 5D3GB 4FLZA 1VRUA 4KRFA 2FLNA 3QERA 4MIAA 4K4VA 2UVRA 4FLYA 2G8KA 4FVMA 1U45A 2AGOA 3I0RA 1L3VA 3FSIA 2B6AB 2WB4A 3CDWA 3HT3A 3BR9A 4AILC 1IKXB 2JGUA 1NK0A 4KAIA 1ZBUA 4WXOA 5J2QA 2OPRB 4KV8B 2FVSA 2BQRA 4E19A 4WXWA 4URGA 4J9NA 2ASDA 1RTJB 1UAXA 4CEQA 2OH2A 3DRSA 1W9HA 3BJYA 4XPEA 4RW6A 1U48A 4IH5A 2GBZA 4Z4HA 2X6SA 1K6YA 1S9FA 1S9GB 2HHTA 5CZ2A 1XR5A 1BISA 1MMLA 3G86A 2AWZA 4FLWA 3QNNA 4ECTA 5L9XA 3E51A 4AHCA 1C1CA 1CZBA 5D3GA 1DLOA 3VQ4A 3SQ2A 5DQHA 1J5OB 5FRMA 2XY8A 2HHUA 3MEGA 3K2PA 1BQMA 1JLEA 3OYLA 3DLGB 2B6AA 3QEVA 1XHXA 4JS4A 3PO4A 4OPJA 3V1QA 4CJEA 1ZTTA 1N5YB 3QIPA 2JLEA 2WK4A 3KJVA 1RDAA 4W5RA 5KFHA 3RAXA 3V81B 3MECB 3H08A 5F8MA 3CFRA 2V4RA 1REVB 4O55A 3CFOA 4RZRA 4EO8A 3BDPA 4F2SA 4ZPAA 1IH7A 1ZBFA 3V9SA 2ILZA 2XGPA 4NLTA 4FJLA 3D45A 3T5KA 3OYIA 1KCFA 4RW8A 3OYGA 3KLFB 1R0AA 4QWEA 1L3TA 4H8KA 2FVRA 2AJQA 4ZPCA 3KMQA 1VSDA 1VSJA 1L5UA 4CJTA 4Y2AA 2O5DA 1N5YA 4JV0A 4HCBA 2BRKA 4O0IA 3MXMA 4CEEA 1WSGA 5KFAA 3VQDA 5KT6A 3AVGA 2IJFA 1S5JA 3OS1A 3P1GA 1SV5B 4NLOA 5KFRA 4ELVA 3OLAA 1WSIA 3MECA 4FM2A 2GUIA 1REVA 3V1RA 4IG0A 5C24A 4FM0A 4ZTFA 4K4SA 3AVKA 4FS2A 4ED2A 2W7OA 1TL3B 3HYFA 1JLCA 1QE1A 1S97A 4LQ9A 1JLGA 3H4DA 3T1AA 1K1SA 4CJVA 2IM0A 2E9TA 1KVBA 4FYDA 4CIEA 4AHRA 2YKMB 3ZT4A 2OPSA 3CM5A 3ZSOA 3PW5A 3GILA 1RA7A 3RMDA 4K4ZA 4DTOA 1SV5A 1LW2B 3THVA 2KZZA 3M8SA 3NHGA 5J1EB 3QLHA 3T5JA 2E4LA 5HRNA 3PW2A 3QEXA 4WFXA 4DTSA 1NOZA 2BE2B 3QO9B 3NH0A 4DL3A 1YTAA 4CJRA 4KI6A 4DTRA 1TL3A 4NLSA 2E9RX 4Q8EA 2HVIA 4QCLA 4EZ9A 5T14A 4CF9A 3SI6A 2CKWA 4O3SA 2XWYA 1C1BA 1QAJA 3LDSA 4O5BA 4HYKA 1WSJA 3SUOA 4DQIA 4PUOA 1KRPA 4ICLB 1FKOA 2HHWA 4BWJA 2ZKUA 1SKRA 2YKMA 4KHWA 3NF6A 3PO5A 3VQ7A 4ED1A 1LWEB 3SFUA 1IO2A 2EX3A 4NYNA 4FZXC 2IM1A 3LP0B 4DL6A 3E01B 3OSPA 3CYMA 2R2SA 4DL4A 4CGJA 4J9RA 4KTQA 1C0TB 3TR8A 4DFPA 3SZ2A 2W9CA 4MQ3A 3IRXB 1LW2A 3HXMA 5DMRA 2W9BB 2D3ZA 4CHZA 4CFAA 2VG6B 1HYSB 1UOCA 4ED0A 3BREA 3PW4A 3MR3A 2YNFA 3KLHB 1BGXT 1HYZA 4FJ7A 1RYSA 4Z4IA 3ISNC 1JLQB 4CIFA 1NK8A 3H5YA 4KBIA 2YNGA 1N6QA 4IG3A 2XRIA 3DRPB 2P1JA 4QWCA 1VSEA 3EPGA 3KKSA 4DF8A 3CJ5A 4F4ZA 3CJ3A 3CO9A 3AO1A 4IR9A 1HJRA 4F8RA 4KKOA 3LP1B 4HVJA 5HBMB 3KHGA 2ILYA 3SPYA 2G8HA 2FJWA 4N5SA 3TABA 1RA6A 3ZSXA 1JLAA 4FS1A 2C2DA 4Y34A 4FZZA 4CERA 5DLGA 1RBUA 2FBTA 1C0TA 3DI6B 5KFOA 4IRDA 1EP4A 4R5PB 4JUZA 3O3FA 1JIHA 5KFEA 2IC3A 4Y3CA 4R8UA 5KT3A 2VG6A 1D5AA 1HYSA 2BRLA 3NFAA 4ECXA 4NLXA 5KFBA 1RTHB 4E89A 2E9ZA 1CXQA 5T7BA 4CCHA 4CEAA 2C2EA 4XIUA 1GX6A 4WZMA 3NGZA 3SYZA 3NF8A 3ZSZA 3PZPA 4IOBA 3S3MA 3DRPA 4KHUA 4IH7A 1OS5A 3KLIB 4Q0BB 1U4BA 4BE1A 2AGQA 4M3YA 1HQUB 4EP5A 4KHNA 1TKZB 3DRRA 3BQ2A 3PX6A 3ZSQA 4DFKA 3GYNA 3LP1A 3WNFA 1B9DA 2OPPA 3QYYA 4L8RB 1D9FA 5KFUA 5HBMA 1SH2A 4NCGB 4E7HA 1RBTA 3M8RA 4M45A 2EC0A 1CSJA 1C2PA 1Z26A 3KLVA 3HPHA 4YQWA 1YVFA 3HVTA 4FLTA 4FJ9A 5KFDA 1D1UA 3MR5A 1ASUA 4MIBA 4DS4A 2HHQA 4FBTA 3O3HA 1EKEA 2GIRA 3G10A 5C25A 3NF7A 5KFLA 3NAIA 4Y1CA 4FW1A 1XR6A 3VQ9A 2ASLA 3TAMB 3K5LA 4FJKA 1S1XA 1B92A 4ZHRB 3VQAA 3OL8A 4RUCA 4RNOA 3QIOA 2RF2B 3KNAA 4K4TA 2D7SA 4Q0BA 1TV6A 3CG7A 4FBUA 2X6NA 3GV7B 3QZ8A 1I3AA 4CHPA 3I0SA 1ZYQA 4FJ8A 3H59A 3UQSA 3RRGA 4LD0A 1VSIA 5HRSA 4M3RA 3M8PB 2I5JB 3OL9A 2D0CA 2YNIB 2RDJA 5J2NB 4IRCA 4FK0A 5E41A 3PW0A 4WYLA 3UR0A 3VN5A 1TL1B 3C6TB 4M3XA 1T94A 5DGAA 1TQLA 3FRZA 3D0PA 1HMVB 4FLUA 1RT7A 4IQXA 1C0UB 1MU2B 4J9OA 1KFDA 3SQ1A 2HWIA 3ZSWA 1GX5A 3CQ8A 4DLGA 3CDEA 2WRMA 3RBEA 4NCAA 2RF2A 2IA6A 1RT3B 2DPJA 3OYFA 5F8NA 3MEDB 4B9VA 3JSMB 1RBVA 3ZCMA 1SL1A 3DM2B 1LAVA 2RDIA 5KG2A 4W5TA 1RTIB 4MKAA 3CWJA 3N6NA 2ATQA 1NNDA 4NLRA 3SFGA 2IMWP 2C2RA 3QGIA 3M8PA 2I5JA 4K4YA 3TARA 4GC7A 4TQSA 4KTWA 2FVQA 4FJ5A 3AA2A 3OLBA 3QEIA 3V6DA 3LWMA 3HO1A 3PHEA 2V9WA 4U6PA 3K5MA 4C8KA 3PY8A 2DFEA 2HAIA 1TL1A 4RUAA 5DLFA 5KG1A 3MXJA 4DTNA 4CJLA 1X9MA 4F4XA 2QE5A 5HP1B 4TSXA 2GC8A 4B9NA 1VRUB 2RPIA 1LW0B 5KT5A 4CK2A 3NCIA 2Z1HA 4ZVGA 3BSOA 4E1MA 4NCBA 3I0RB 3RBDA 3T19A 4OVLA 3MEDA 1S1WA 3PVXA 1VSMA 2ASJA 1WNEA 3IG1A 4AH9A 4DMNA 5J2QB 3TQ1A 4LSNA 1A5XA 4BDPA 3KD5E 3LZJA 2XY7A 3DRSB 3P83D 4ELTA 1UWBA 4RW6B 3OYNA 2G8IA 3OYEA 3HVRA 2JEIA 4C8OA 4CESA 3SI8A 3KTQA 3GV8B 3OYJA 3ZSRA 2XGQA 3TWHA 2R2UA 3AVLA 1Q8IA 1C1CB 1WSEA 3H5XA 4KHYA 2QXFA 4I2PA 1DLOB 4J2EA 1LW0A 4RNHA 1NJYA 3HP6A 4HKQA 4IR1A 3MEGB 1BQMB 1JLEB 3SJJA 3PR5B 1TK0A 3FDSA 4KB1A 5DGBA 4F50A 1GOBA 1SKWA 4KHSA 3ULDA 3QIPB 3NBPA 4DLEA 3KJVB 2R8IA 3AVNA 3PV8A 3KLEB 4EP4A 4YFUA 1IKWA 4CHYA 1YT3A 1GOAA 4CJ3A 5CYQA 5KFMA 3ZT3A 3KD1E 3MXIA 3OYHA 4NLGA 1SL0A 4Q43A 4TYAA 2IBKA 4LY7A 4GW6A 4ECZA 2P5GA 1S1TA 3FFIA 4B3OA 2YKNB 3RMAA 3GIMA 4CF8A 3GQCA 1HYVA 4TY8A 3D5MA 4RW8B 1R0AB 2O4GA 2J6UA 4FXDA 3UIQA 1QSSA 4ID1A 4KREA 4PQUB 5K14A 4QAGA 5KFWA 4TXSA 5KG4A 1HNIA 4E0DA 1TVRA 3NGIA 1LAWA 1KSPA 2FBYA 4HCCA 2BQUA 4YMEA 3KLEA 1C1AA 2R7YA 3SUNA 4DTJA 4C8LA 2OZSA 4EZ6A 3AVIA 2UUWA 4IG0B 3EZUA 5C24B 3DOKA 3SQ0A 3VQ6A 4ZPBA 1J54A 1QQCA 1S1VB 1JLCB 5KTQA 2YKNA 3AVMA 4J9LA 3CM6A 1QE1B 3L3VA 4ZMMA 3LZIA 1JLGB 3TAQA 3AO2A 5KFIA 3VQEA 4WE1A 3BQ0A 1BHLA 3V4IB 4PQUA 4B9SA 3KK1B 4FJHA 4ZP8A 4CEBA 4NRUA 2OPSB 4N76A 2E6MA 3V6JA 4IBNA 4M3WA 2XCPA 3RWUA 4K8ZA 4CIGA 3G6YA 1GOCA 3V9ZA 4M3TA 3BQ1A 5EUHA 4O3NA 1WLJA 1HNVB 2FBVA 4DFJA 4DL2A 3QLHB 2PY5A 3HPOA 1J9AA 1RT5A 2R8JA 2HW3A 4AHVA 3Q8SB 4LH4A 1NHVA 3TAPA 2WHOA 1BCMA 1S1VA 4RU9A 3VQ8A 2FJVA 1C1BB 2LSNA 4CFCA 4HTUA 2KQ2A 5KFFA 2ETJA 4PUOB 2W7PA 1U49A 1FKOB 4ED6A 2C28A 5CZ1A 3V4IA 2P51A 4O4GA 3KK1A 4CJKA 3V6KA 3L2WA 3OSNA 1NKEA 1Q9XA 4H4OA 2X78A 4OKJA 3N6LA 5EDWA 5KT7A 1KFSA 3O4QA 4E7IA 4FCYA 5DG9A 1LWCA 3IN5A 1XC9A 1TKDA 2HHXA 2V4QA 3T3FA 2W9CB 3NGDA 4FLXA 1KHVA 4ECSA 3ISND 5KFNA 3VQQA 1HNVA 4IH6A 4TQRA 2YNFB 3GIJA 3OJSA 1TP7A 1D9DA 1NK5A 4M42A 4OJRA 4ZP7A 2YNGB 1N6QB 2I1RA 4IG3B 4CHOA 3VQPA 1EXQA 4G3IA 2BR0A 4CFBA 4TY9A 3OS0A 4KKOB 1QSYA 1NK9A 2C22A 2HWHA 3C94A 3S3NA 1BQNA 4O44A 1EETA 4NYFA 4BDYA 4F3TA 1JLAB 2FVCA 4E7JA 2YHAA 1HRHA 4I7FB 4EBDA 1EP4B 4OL8A 5KFQA 3KK3A 1VSKA 4TYBA 2IC3B 3ZT2A 5L1JA 4R8UB 4ELUA 4OGCA 4OPKA 4I2QA 3EYZA 2OZMA 1S9EA 4FJGA 4ECVA 1RT6B 3MR2A 4C8NA 1S6QA 5EWFA 4J2BA 3NAEA 2W42A 1XWLA 4DWIA 3NKYA 3SV4A 4B8CA 4CFDA 4XPCA 4WFZA 2OYQA 3F73A 4DSEA 2FC0A 2DPIA 4AHUA 3OYDA 2EHGA 4TLRA 4RG8A 1CZ9A 3DRRB 3QEPA 5F8HA 2OPPB 3ZT0A 1C0MA 1Y97A 3AO5A 5KG0A 2WONA 4JS5A 4QW8A 3ITHA 2R2RA 4E7KA 5HROA 2P5OA 1J53A 3V9WA 3PJWA 4O3QA 4N47A 3HVTB 5KFGA 3CFPA 3NH1A 4OLBA 4I7FA 4CECA 4Z4FA 3PUFA 1RDBA 1F21A 1U09A 3TVKA 1RTDA 3UPFA 5C25B 3M9NB 4O0JA 4KO0A 3PJXA 5JS2A 5C42A 1RT6A 4H54A 1ZBIA 4CF1A 5EWGA 3CVKA 3FQLA 5F8GA 1S1XB 2ALZA 4YR3A 2FJXA 3HK2A 2W8LA 1RDCA 1RT1A 3F9KA 4WZQA 3L8BA 5F8JA 3VQBA 1NJZA 1TV6B 3KIOA 3K57A 1WNSA 2F8TA 3KK2B 3I0SB 3QNOA 4NLPA 2WOMA 3L2QA 1X9WA 4I9LA
chains in the Genus database with same CATH superfamily
3H5SA 4WBFA 2VFSA 4C6AA 4WIIA 3AODA 2BJ8A 2UXCF 3MWBA 4L6V3 4UOGA 4JK8A 4CJ5A 2HNDB 1VC6A 3SIPB 2F8EX 4TU8A 2B8PA 3M32B 1URNA 4NZ0A 4G1PA 4PXCA 4AHSA 5HLFA 1Q79A 1O5JA 4KIAA 3UDVA 5AXKA 3OW2M 1NJXA 2Q1LA 2HLUA 1XC3A 5C2DA 1IJEB 4HT7A 2KYXA 4R0EA 4AYBD 5IS2A 4H4MB 2JEJA 1Y64A 2E5LJ 2MYFA 2NYHA 1SUQA 3WNGA 1L3UA 2GMJA 1KQSM 3RW6A 3DOLB 4BQLA 3I5CA 2UXCK 3J81U 4Q44A 1IKYA 2FGCA 4KHQA 2IVOA 1NCLA 4CEZA 2VASA 3IDHA 4XEIA 2X3DA 2O8EB 4CD1A 3BSCA 4W5QA 1HA1A 2OIHA 2IVYA 1Q8LA 2G4BA 1UP1A 2F9TA 1RBOB 2BV3A 4F02A 1V5VA 3VQSA 5F3TA 3LALA 4JRPA 1FKPB 5HVGA 2E5GA 2DEJA 1DTQB 1RFQA 3I8DA 1M5HA 3B8HA 1T9YA 4OKEA 1QY7A 2YX1A 4C8MA 2ASYA 4DV3J 4F2RA 3QBWA 4YR2A 3K0JA 3IG1B 4JKGA 4AUKA 4RW4A 5DDOC 2AEMA 4GMKA 3D7SB 5IXUA 4OO1J 2D0BA 2HQFA 2NZTA 4OQJA 2F65A 4FXWA 4LF9J 2QV6A 1AYEA 3SDEB 2D9PA 1UWBB 1WC0A 1Q0NA 1OKJA 4NXMJ 2AA4A 1NDPA 2XO7A 3RMCA 5HRRA 1IR2A 4N8OA 4O3PA 4I9QA 2WTUA 2P9EA 3MGJA 2DNGA 2I9SA 2ABYA 3FQKA 4NXNF 1PIEA 3HSDA 5KGXA 3AHPA 4QIVA 3UN2A 2QA4G 3D2EB 1TKTA 2AQ4A 2IPOB 5GAHI 3AA8A 4G1QA 4ECWA 3CD6S 4BC3A 3FFKB 3O2IA 1SBRA 4FF4A 1KONA 3PTWA 5HMXA 1U47A 1MNEA 1ZM3A 3UKRB 2W4CA 5BPNA 5D4LA 1X7VA 1KVAA 5LMUF 3PJ9A 2VKZG 1CLFA 1BUXA 1KXPA 4ZPWR 4JKHA 5BR9A 5HMWA 1FHTA 2QWRA 3Q8VA 2YHXA 1R59O 3WNEA 4CJ4A 1YJWS 4FZYA 4MFBA 2VICA 3FFIB 2AX0A 5KOXA 2CPYA 4B3OB 4IXCA 3MWTA 4HDHA 3AY0A 3M30A 4OJHA 2HEKA 5AR0A 3UKUB 2DTJA 3QAUA 5F8LA 3AVFA 4DSLA 5LMUK 1D4XA 4KFBB 1GMWD 3QT6A 2Z2LA 4F3OA 4ZVEA 1TVRB 3ISZA 3KDNA 2CQGA 3R5AA 1N4LA 2QWOA 3H2UB 2PO4A 4M5KA 1ATNA 2QTDA 1TUUA 4N77A 1EKSA 2CJAA 1JXLA 5IFMA 3R1LA 1WELA 2G9OA 5A8WB 2FB0A 3N5FA 3ALYA 3DLJA 1RDWX 4DL5A 1HQ2A 1A5VA 5AQMA 4JB8B 2GA7A 3MCSA 2LVWA 3FGUA 5I42A 2DHSA 4QWBA 3HD1A 4PPDA 4RNFA 3RB4A 1C0GA 1Q81O 3AVJA 2YNHB 1HW8A 5JVGL 4EYHB 4EO6A 2GHWA 1WEYA 2E5HA 2XLJA 3PX4A 3ULHA 4KHMA 2WVDA 4DSFA 2QT7A 2M8DB 2ZNZA 3WNHA 3THTA 1BC6A 1A7GE 1DRZA 5LL6d 3MM5A 4ZJQA 1ZA1B 3U3YA 1ITGA 3L4QA 4LREA 2ERRA 5EU7A 1RYRA 3CXCM 2NXNA 2KFYA 1GLEG 4ZDNA 1S6PA 3M1VA 2M2BA 2FBXA 3AJ1A 3PR4A 5KT2A 1HFEL 3IM9A 1S9GA 4O4GB 1FWPA 3Q89A 1CJVA 4CGDA 4DJBA 2COLA 4EHUA 4OLAA 1YJ9S 2YBVA 1LWCB 5HATA 2A0FB 4BE0A 1J5OA 3OT9A 1XTZA 1VQSA 2ZUAA 4DG1A 2ZE2A 3IM8A 4Y0WA 4LF7J 1V3SA 1JNRB 2FJAB 2BGGA 4NLUA 2UXDF 1TMJA 2XMMA 3A2FA 1LXNA 2E1RA 1SS6A 2YQ0A 1WACA 2VCPA 1Q16B 4QR1A 1JXBA 1NK6A 3BN4A 5BXIA 1RCHA 3DLBA 4U67Q 1BA0A 3M8QA 2ZJRQ 2W2MP 3F9MA 4KH6A 2HRYA 3WQTA 2EFGA 2FIUA 4IZ9A 4CEDA 1UA0A 1LK7A 3ULEB 3W60A 3KLFA 4DV6F 4P72A 3K17A 3BSAA 5FRNA 5IWAJ 1A5WA 3NAHA 2C3MA 2UXDK 3KK3B 3OFGA 3BKFA 3CJBA 2AF6A 2IVNA 4ZLLA 5B0FA 1ILYA 3SQ4A 1T0TV 2DNOA 1T9TA 2VONA 2X3GA 5MAOA 2A40A 3A4TA 5E5NA 1AFJA 5KOWA 2RQCA 4USHA 3BBCA 4YOYA 1PYOB 2IOCA 4FO0A 2CGKA 3RBZA 1REGX 5C15A 4PL7A 1VQ4S 4DV6K 4ZVRB 1JCFA 3OVBA 3R6LB 3KXDA 3J7A1 2KW4A 1KTQA 2PA3A 2FQQB 3I9ZA 3G2XA 2IMOA 3CPWM 2CXEA 1RT4A 5K8PA 4EBCA 1DEJA 4KO0B 4USIA 1CLQA 2DR6A 2CJQA 3K58A 3W66A 3I5AA 4QYZK 2A18A 2G8FA 2BYCA 4NRTA 1TFYA 4JYAJ 1GT8A 1RT1B 1BIUA 3PM9A 3K7RA 3CJAA 4PKHA 4KAZA 3NMAA 4O3OA 4PWDB 2ZBPA 3HM9A 4Y00A 2ZZTA 3I4PA 1VBXA 3GFYA 3RB0A 5M1NA 2KJWA 4BC4A 1RBAA 4AHTA 1WG4A 2QRRA 1WJ9A 1T6CA 3CC7S 1NH8A 1JJ2M 4BQZA 3R9LA 1EX4A 4ICLA 2DFFA 5D78A 4L76A 2MQNA 2NSBA 2R7SA 4HT5A 1TL7A 3AA3A 3ENBA 3SMPA 4CEFA 4BG9A 2G1DA 4W5NA 2LA6A 3KUHA 4DN9A 3BO4A 1OSCA 2DHXA 2PA8D 5K8OA 1NGBA 4WU2A 1ZPVA 3ENHA 4PXBA 3MTJA 3TUZC 3VGMA 2B56A 1J5EF 2V6AA 1NJWA 5AJ3F 4OV6A 3KLHA 4DV7F 5G0RB 4JV2A 2D4WA 3IAM9 4PG8A 3U9ZA 3GP9A 3CIZA 3IGNA 2QWNA 1BD6A 4DV4J 2UU9F 1RWKB 4CJQA 3JYTB 3ZSVA 5ETSA 4YB5A 2J9DE 4BG8A 2Z2MA 2VKRA 5CYMB 1Y9OA 3UCUP 4H03B 4DCOB 1P8ZA 5C5JA 4C11A 1BI4B 2MJUA 2FUG9 1TMMA 1J5EK 5AJ3K 3DI6A 3RB6A 4DV7K 2QG9B 4CO4A 1IKVA 3AVHA 2QKKA 4MO4A 4J9VA 5BPLA 2F9DA 4RCHA 3NE6A 4ILRA 3ZT1A 2UU9K 1MROB 3EKUA 2W2NP 3E9LA 1KOHA 1IQTA 1YDLA 2JJ4D 2BQ3A 3GCWP 3EZ5A 3HVWA 2L08A 3ZZYA 3KLIA 4PRFA 1RBRA 4IO9L 3L2RA 3FMWA 3QT8A 3C0BA 2MZJA 4KHPF 4LF6J 2BE9B 1BIZA 1NOYA 2OPQB 1HR0F 3NY0A 5KFZA 3CE8A 4PQAA 4O4RA 1M5PC 4NCGA 4JI6F 4ID5B 3QBXA 5J2PA 4F7VA 1KLMB 2Q43A 1VIXA 1HI1A 5GAGP 3Q8QB 2B51A 1G1XA 3H6EA 3V1OA 2JNJA 2QC3A 2A2DA 1SH0A 4YDXA 1IBMJ 4RW9B 3W2VA 4LMZA 3KWMA 5EX0A 3SCJE 2GWKA 3GDQA 3KVGA 2ROGA 2ZH6A 3HSTB 2GO8A 2Z2ZA 1W26A 4ES3A 4RNNA 2Y0BB 3D6MB 4CF0A 1FVSA 5I3UB 4G9ZA 2F9WA 1HR0K 2V0NA 2KRBA 3D4JA 2HBRB 2Q6BA 3H2VE 1RAIB 2QLBB 4UF4A 1T3VA 2FLLA 4XDCA 4OGEA 1RT2A 3HVAA 4JI6K 5JUMA 5CE3A 1TK8A 1FWLA 1NU0A 3C7NA 3BGRB 2R7XA 4DL0C 4J9SA 5L9NA 3AV9A 2NRVA 4RW7B 1CQMA 2WCXA 5EX3A 2J0QD 3WXMB 1E3MA 3F56A 2J9CA 4R79A 2KFZA 5ADZA 4X4NA 5B0EA 4ISEA 3QMQA 3K0SA 4M94A 1S1UA 3TA2A 5JVHL 2V50A 1WKJA 2J0WA 2E1YA 1QDUB 2BW2A 4DTUA 4RPFA 3BSNA 3IBCB 3R1HA 3HHLD 1HMVA 2FLOA 3LPUA 2VWJA 3VV2B 1T05B 3QETA 3MAAA 4OYIA 4ZIWA 3KHYA 3U6FA 1OH6A 3OXFA 4P7TA 2J7KA 4C9DA 4XO0A 4DUZF 1WOSA 2EKNA 2R8KA 5D0HA 2IVFB 3SCIE 1BWFO 4NLYA 2EEYA 2CUYA 3NH2A 1I39A 3HOTA 3DXSX 2DNRA 2MQMA 1H1VA 4K4XA 3AAPA 1RTIA 1YK9A 1NK7A 3SPZA 2D0AA 1DTTB 3R7SB 2WFBA 2HVHA 3LGNA 5KFXA 3OL7A 2FZGB 2CQIA 1WOOA 2DHAA 1TAUA 4DQQA 2A6MA 4B9MA 3EDQB 3I5BA 1Y3KA 2NUBA 3GJTB 1WSHA 1UEUA 4MIAA 4K4VA 2UVRA 2CZ9A 4K5RA 1N0UA 4HTIA 4CYUA 4LF5K 2WB4A 3I9V9 3HT3A 1DQ9A 1KP6A 3LQVA 4X4PA 1IKXB 4WXOA 2FVSA 4IO9Q 5H9FK 4E19A 1SI9A 4URGA 1YQHA 2DJWA 4DR3J 2I6WA 4XPEA 2K2PA 1CC7A 4KY3A 4H4KA 2GBZA 4YDUA 4ZVQB 1OY6A 5CZ2A 1BISA 5AQUA 9RUBA 3PFOA 3B78A 1VQOS 2EXUA 5A2QY 2X1BA 5DETA 5L9XA 3DLLL 5D3GA 2C2NA 1R6YA 3BDEA 2ZDPA 3SQ2A 2MQLA 4DR7F 4OHZA 3VAFA 2B6AA 3QEVA 2B7CB 4A8OA 4X64F 4JS4A 1HNWF 3V1QA 4CJEA 5GAEP 1YJTA 2O01C 3VGUA 2JLEA 3MM7B 1RHJB 2OFHX 3VZIA 1UJ4A 2CPHA 4JI5J 5KFHA 1J27A 2C3OA 3V81B 1IR0A 1ZAWA 2CQ3A 4GV3A 1YI2N 2GMHA 2DNYA 4BHQA 4PG5A 4EO8A 2HFZA 1FVQA 3CF5Q 4DR7K 2KT5A 1ZAXA 2ILZA 4N7TA 4NLTA 1VAZA 3FR0A 5AFUH 2AJ2A 4RW8A 2V4JA 2XSJA 2ZOMA 1R0AA 3OYGA 1G4CA 2H54B 2JLFA 4X64K 1HNWK 2GQCA 4RUBA 4H8KA 4OX7A 3W61A 4JI0K 1FRHA 1U8SA 4ZPCA 1KVIA 4OHWA 4Y2AA 2O5DA 1G3OA 3IRWP 3MX5A 1N5YA 3C16B 1R0BG 5KT6A 2Z2YB 5KFRA 3OLAA 2P9CA 1CULA 4B1XB 1WSIA 4ZPVR 2U1AA 1NDLA 2KKHA 4ZTFA 2EKYA 4K4SA 2EFOA 3AVKA 1NPPA 4PKGA 3CJQA 1TL3B 1NJIO 1W97L 2DGVA 3LDNA 3G71S 5AZIB 2AW0A 3BO2A 3HFVA 3OXGA 2ZH4A 3T1AA 5JLHA 4CJVA 2IM0A 2IRXA 3BZKA 3DU5A 4FYDA 3EWGA 1V9OA 1UW4A 3CM5A 4HVZA 3KJNB 3I55N 5AQNA 2OD6A 2UXBJ 1SJ3P 3RMDA 4LRBA 1SV5A 1MA9B 3TPQA 2EBGA 5J1EB 3AH6A 3J80Y 3PW2A 2C2KB 3KG4A 3TOQA 3IFEA 3RYLA 3NH0A 1VQNN 4R0JA 1T3OA 3EZWA 2CH6A 2W01A 2CKWA 3MMAB 3NMRA 2XWYA 3LDSA 3MXHP 1MN9A 2AEFA 2XWXA 1ZBTA 2F40A 3RJMB 3LM9A 3WX4A 4DQIA 2W2PP 4PUOA 1KRPA 1FKOA 3CC4N 1TZ0A 3G9CA 1FT8A 1JNZB 3BKUA 2VGMA 3N5BA 3DLLQ 3VQ7A 2CRLA 3H46O 2EX3A 3I4HX 4FZXC 2DNQA 4WTYA 2NXJA 1F0XA 2RUSA 4JI3J 4EU0A 4L75A 4ITSA 3CYMA 3ZC4A 3ET6B 2G1HA 4J9RA 3A8IA 4KTQA 4CGJA 3TR8A 4DUTA 3IRXB 1LW2A 3HXMA 3C14B 1X3MA 2IVMA 5K8MA 3LH2S 2VG6B 1UOCA 1KBRA 3N4QA 4CI6A 1R43A 3J7YI 1FXLA 1VSEA 3QSYB 3AB4B 2YJFA 3DGVA 4M63C 2EWHA 1R31A 4IR9A 2KH9A 4KKOA 2ZBCA 3A13A 1OJ4A 3TABA 3HCXA 1VR6A 1F60B 3EGWB 3LDOA 2JDJA 1M90T 4BRFA 2V67A 1T9VA 4CM0A 2FBTA 5L8RC 5KFOA 3ZTOA 4B02A 2FHKA 3KFWX 5JJBA 2VHGA 3IUCA 1UPPA 3AARA 2LQ5A 1HYSA 1YJRA 1EO1A 4NLXA 4IOCL 3J7YU 4CO1A 4XIUA 2A5XA 1NM2A 3ZSZA 5HVHA 2H3EB 2QYGA 3DRPA 1OS5A 1WHVA 2XEXA 2YVSA 1QD1A 2AGQA 1UVNA 4FYVB 5C0YA 4HTJA 3T9ZA 4EP5A 4KHNA 2V2VA 3BQ2A 4DFKA 3LP1A 3TTDA 1NU4A 2OPPA 3QYYA 1B9DA 3VGKA 1SH2A 2OGUA 1URRA 1VLYA 3RGIA 5FLXY 3EX7B 1Z26A 3DOMA 1YVFA 5B09A 1JJ4A 4USVA 3OFHA 3WC0A 2ZH7A 1HBOB 4PG7A 4RU2A 5C25A 3NF7A 2PMZD 3MMCB 3KWGA 3M6VA 4IOXA 1CJKA 3DXBA 3K5LA 3VQAA 4RUCA 3QIOA 3D68A 3WXKA 2RF2B 5CCLA 2H65B 1NXIA 5AQLA 4B3SJ 4B1UB 3FEXB 1ZZFA 2NPFA 3VVUA 2ASPA 1BUPA 3U1NA 3CCMN 2GJIA 1ZYQA 3UD3P 4FJ8A 3U1LA 3A0IX 4KGKA 2IBOA 1NJIT 2RILA 2HBZB 3FBCA 2CNLB 1VYAA 3M8PB 2QL9B 2NLXA 3IA0A 5J2NB 4IRCA 5E41A 4LR9A 3UR0A 2IRUA 4UZBA 1T94A 2RHQB 4FVUA 5DGAA 1TQLA 3FRZA 2ALYB 1XQSC 1MU2B 4OYZA 4J9OA 1WF0A 1KFDA 1GX5A 4L3QA 4JI2F 3O6WA 4K59A 3LM2A 2NREA 4B9VA 2OEMA 5A8KA 2HS3A 2HZCA 2LEAA 3AGRA 4PHTX 2EFQA 2CYYA 4RLEA 2MHNA 1S7HA 3CWJA 3JSBA 1GLCG 3BZQA 4GKJF 4FWKA 4YDDB 2YQ3A 2C2RA 2DXDA 3QGIA 5CCMA 1YZ6A 4K4YA 3FNNA 2EBEA 4TQSA 1HWKA 5A0YB 3V6DA 1M1KO 1GXUA 5AQOA 4C8KA 2CGLA 3PY8A 2DFEA 1TL1A 4RUAA 3MXJA 4K8RA 4JI2K 4H0OA 4KGMA 4F4XA 5EX5A 2GC8A 3G87A 3J7ZO 1VRUB 1UFLA 1FFWB 1HWLA 3CQXA 3AA9A 1VQ7N 3W5YA 2VGNA 5GVQA 3NCIA 2HZVA 1J6ZA 4IOCQ 3I0RB 1RTZA 4C3MA 3D3CJ 3TU5A 2P9IA 1N88A 3EDRB 2CQPA 3B4MA 3CCQN 3R8EA 4OIXA 2DR7A 4LSNA 4BDPA 3KD5E 2V7YA 1M5VC 3BGLA 3FEZA 2GFFA 4RW6B 4BRDA 1CZAN 2HBQB 3OYEA 1R8HA 2RAQA 4C8OA 4CESA 1Y4ZB 2ZJQL 2R2UA 4TKTA 5HMYA 2ZVIA 3O5BA 1MWZA 3K8WA 1OO0B 1C1CB 1X5SA 3H5XA 1DLOB 1ZS6A 3CIMA 1NUEA 3EUNA 3LO3A 1PILA 3SJJA 1E6VB 2QO3A 4KB1A 1PYSB 1HWUA 2ZF5O 5DGBA 1SKWA 1GOBA 2ZEJA 3CCJN 2ZHBA 2LEBA 3KJVB 4F26A 3KUEA 2IIHA 2HGMA 2Q0UA 3B4DA 1F3VA 3ZTSA 1NGCA 4JI4F 3AAQA 5BRHA 4RL1A 3MXIA 3R7NB 3QNWB 4Q43A 2IBKA 3RSEA 4NMXA 4CZCA 2YH0A 1S1TA 3PFEA 3TJ8A 5A76A 1I3OB 2YKNB 4TY8A 5LMUJ 2Q1NA 2O4GA 2MKHA 3UN3A 1SB6A 1SJQA 5C2CA 2BE7D 3DDNA 4KREA 1WC3A 1PCAA 4I67A 4JI4K 3M2UB 3NGIA 1KSPA 2BOAA 3FUYA 2RHSB 3CCLN 4NWBA 4DTJA 4C8LA 3THXA 4DV2F 2KJVA 4EZ6A 1FNMA 4IG0B 1VI7A 4PR6A 5C24B 1VMBA 2AD9A 3C15A 2P9PA 1D9AA 2W4DA 4FOEA 1HNZF 5IQ6A 4C4WA 3K89A 1JCEA 2E8AA 4HTLA 2B4VA 1WKLA 4BR4A 1S1VB 3P38A 1JLCB 4J9LA 3D6TB 5D4OA 1U2FA 3O9TA 3L3VA 3GG4A 3LZIA 3GBTA 3TAQA 3AO2A 5KFIA 2FZCB 2VH7A 2DNZA 2Z30B 3CC2N 3BQ0A 2NZ4A 1SCJB 3V4IB 4CEBA 5ETVA 2KDOA 3V6JA 2E6MA 4IBNA 2XCPA 4DV2K 4A8SA 3DXMA 3NGUA 4USJC 3MD3A 3V9ZA 2BW7A 1HNZK 1XMBA 4M3TA 4LFBF 5EUHA 3W5XA 3MPWA 1LEOA 1Y00A 4DFJA 3HJVA 2PY5A 1BOTO 2N82B 2DIUA 1Y0HA 1NGIA 5D4NA 1DURA 4RU9A 2I0XA 1C1BB 4FF1A 3UI3A 1M5KC 3PKMA 4ZOSA 5KFFA 2ETJA 5HQ8A 4M5GA 2WVFA 3GMGA 2P51A 3V6KA 1M1KT 2X78A 4FPBA 2HF3A 4DX8H 5KT7A 3CJ1A 4OX8A 4LFBK 3O4QA 4E7IA 1XNQF 2HIQA 5IM0B 4J7CA 2W9CB 1RKIA 4UY85 3BPDA 4ZA1A 4DBQA 3Q0AA 3A1YG 5A8RB 1RHQB 5KFNA 3G8QA 2R7QA 2DK2A 2HKEA 4FF3A 3M8ZA 2P9NA 1WC1A 2YNFB 2OSQA 4Y65A 2V7ZA 1YG0A 2MB0B 1RAGB 3GIJA 2ZC4A 3OJSA 3EL2A 1D9DA 4M42A 4OJRA 4ZP7A 2IYGA 3SSRA 1P1LA 4G3IA 4CFBA 3OS0A 3R6MA 1F5AA 1XNQK 2C22A 3KZBA 2M7SA 1BQNA 1A0OB 4O44A 4NYFA 2C1EB 4BDYA 4F3TA 5GADI 2UXDJ 1JLAB 5AQFA 3JXUA 3O08A 2YHAA 2RB7A 1FESA 1IBKK 2H5JB 4FNIA 2FY1A 1HRHA 4I7FB 3M5RA 3W65A 1VSKA 2AYGA 1RWVB 4R8UB 4ELUA 1P8GA 2J8AA 3MPUB 4OGCA 4OPKA 1DJ0A 3MR2A 3LUYA 1S6QA 4J2BA 3SV4A 3TO8A 2XMVA 4CFDA 4P73A 1RWNB 4IEEA 3TR5A 4AHUA 3OYDA 2NRXA 2DGOA 2MKKA 4HI1A 2DVIA 1CZ9A 5EY4A 3DRRB 3QEPA 1Q8KA 2MLXA 3A3PB 5KG0A 2OTJN 2HGLA 5HROA 3IWNC 4OJ3A 3WXIA 3I33A 1X5OA 1U0SA 3O9RA 3MPDA 3HVTB 3CFPA 1WB9A 3VAIA 4OLBA 3VMFB 4CECA 1RDBA 1Q4RA 3C6HA 1U09A 4ZPTR 4E2FB 2W24A 2WW4A 4QYZJ 3M9NB 3PJXA 3CCVN 5C42A 4CF1A 5EWGA 3TSPA 1JJCB 1S1XB 2FJXA 2ZBQA 3P96A 3HK2A 2W8LA 3F9KA 2NRTA 3L8BA 1TV6B 4OV1A 3VHQA 1U02A 1VFJA 3KIOA 4YY3F 3K57A 1WNSA 1NWKA 3KK2B 4Y0FA 3L2QA 2F1FA 1X9WA 4I9LA 3TUIC 4BRPA 2IM3A 3VR1A 2XLKA 1B0TA 2DGTA 5SUHA 4Y2CA 2Y1IA 3WBZA 2UV8A 3HHKA 1WHWA 4CO3A 2PYJA 1JXEA 1RT7B 1W7WA 3U3GA 2YHBA 4YY3K 4B1VA 5DDRC 4JI7F 1EZZB 1X31C 1S49A 2QJ3A 4A2AA 3WX8A 2P9SA 3S9HA 4GMJB 4EFHA 1IWGA 4M7XA 5AE2A 4ZCKA 1ASWA 4K50A 1UVJA 1KVCA 4PY5A 4Z37A 4CTAB 2E1ZA 3SMZA 2KHDA 1KVJA 1VRQC 3VESA 1T03B 4LQ3A 2HLTA 3OHRA 3OS2A 4MK8A 2HNDA 4DX5A 4F0MA 3NOGA 4JI7K 2UVUA 3M32A 5AJ3J 4DV7J 4GV6A 1PYTA 2X7IA 2VYPA 5FD1A 3PIPL 3LAKA 3OA9A 3AD7C 3CCZA 2UU9J 3UDEA 1X4BA 1S1WB 4H4MA 4ETZA 4U7BA 2M52A 3TTCA 2JX2A 3M2RA 3DOLA 2K3KA 3JTPA 2ROEA 2IAJB 2MHEA 3HT0A 3DMJB 3EPIA 4GRSA 2O8EA 2BANA 4KBOA 2ZH3A 4DPUA 3UDLA 3GL1A 3AA5X 5L1KA 2BM1A 3QB0A 3V6HA 1TAQA 3P5TL 4E1NA 4CGGA 5HI7A 3OPKA 2HYIB 1R0CB 2AGPA 1FKPA 1V3RA 4ZN3A 2DTUA 4KHRA 2MSSA 1RE1B 2MQPA 2A42A 4J9UE 1DTQA 1S5ZA 2E5JA 3D66A 4ZVFA 2HHVA 1HL6A 2P8IA 3KYLA 3OFFA 4HI2A 3RBXA 4IOAL 4MKBA 5AZJB 1HR0J 1QUPA 4KYZA 4Z2XA 3MEEB 1YTUA 2J6SA 2IGIA 4CGFA 3E9PA 3OD2A 3QWPA 4JI6J 5KGWA 4ISGA 5FPEA 1N48A 1IKWB 3DAWA 4NLBA 1YI2S 2ZVSA 5CYQB 3SDEA 3FEYB 4ZCLA 3M9OB 2BJEA 1IBLF 2YKQA 4L73A 1D8ZA 4EAHD 3MM6B 3KK7A 2PMWA 2V2ZA 4KSEB 5SZTA 1RSCA 1V6HA 4BRKA 2PGCA 1ZPWX 2EWSA 2H48B 3AD9C 4W98A 3CJ0A 3HPGA 2WSEC 4WFNL 1DT9A 1TL4A 5JXSA 3CJKA 5FPDA 1JWWA 3DWLA 4ISFA 2AX1A 2MKCA 2O8BA 1R8AA 3C19A 3M6UA 4KTZA 2MZQA 1FRMA 1IBLK 3SQGB 1HNXF 4DV0F 4FOIA 2VPZB 3SUPA 3CI5A 1HD1A 1HQEA 3T5LA 4G65A 2O4IA 1IQZA 4FWNA 3A8KA 2HMIB 3D54A 2ZD1A 3MCPA 1FK9A 3QATA 1WAFA 1VSFA 3OR2B 2Q3PA 3UKUA 2LXUA 3AQPA 4MLEA 4KFBA 4WIQA 3G0ZA 3I55S 1FF2A 1HNXK 4DV0K 1VSHA 3PIPQ 1P6TA 2BJ7A 4DTPA 4LF5J 4JNEA 1ZBLA 3WEEB 1Z2LA 3TSQA 5KG5A 3CJ7A 1VQNS 1RT5B 2D5RA 2LFVA 3DHWC 1Q9YA 2PIIA 4A47A 4CZJA 2CAJA 3RRHA 5IWAF 4EGLA 2C3YA 3CC4S 3MCAB 4RBVA 4M3UA 2O8FB 1RI7A 2YWKA 3TI0A 2K7JA 5HK4A 4H4OB 1EX8A 4ECUA 4GVBB 1ZXOA 3R5DA 5AQYA 2YNHA 2PFUA 1MMDA 1T7PA 1JMTA 4CJUA 4EYIB 4OZJA 3PIOL 1U2RA 2GMLA 4M5LA 4HACA 4JKDA 1NBEB 1KAYA 1RHUB 3GIRA 5IWAK 2JVOA 4NEZA 2XY6A 1N8RO 4KH0B 3DLHA 3O1LA 2NSCA 3M1FA 5F8IA 5IV3A 5KFCA 1VIOA 2YKAA 3C65A 1XMOF 1Q5VA 4QZVB 3A5OC 3W1YC 4ZP9A 3I87A 3RB3A 1QVGM 4X64J 2Y1JA 1HNWJ 4DV1F 1RCXB 5CHIA 1UFWA 2J9DA 3G8TA 2CPEA 4DSKA 4JI0J 2XS2A 3OY9A 2GVZB 4ZVSB 3AOBA 3M9MB 2RS8A 2G2ZA 3P4UB 4FZVA 4V19J 1XR7A 2B5JB 4WFNQ 2VC0A 4CGIA 1DGKN 3A3NB 5C10A 1VQKN 4QWDA 1UAWA 1YITN 2UUTA 4Z7YA 2E6LA 2P9UB 2G8VA 2BOPA 1CJUB 1XMOK 1TELA 2WBMA 3LP2B 1I6JA 3L9ZA 4LBHA 4FWLA 4FK2A 3HRGA 3V9UA 2CDRB 3DNCA 4NLQA 4DV1K 3KHRA 2IJNA 2O3DA 3EGZA 3NNAA 3QGGA 2FXUA 8AT1B 1KD1O 4O3RA 3HOSA 3LGHA 4HUEA 1PKUA 1YSJA 4KGVB 4CEOA 1DZ5A 4KC5A 3L2VA 2H5EA 4BWMA 1RTDB 1WBBA 4B9QA 1LWFB 5DZ7A 4QOZB 3WHIA 1R8BA 4J9PA 1G7CB 3LP3A 4DV4F 3P5BP 3FCWA 1B9FA 3QINA 4CJWA 5B0GA 4HUGA 3MR6A 1D0EA 4B3MF 3CCMS 3VA3A 1FXDA 5AQHA 5KG6A 2J5AA 3GFZA 1AA1B 2BE2A 3NL0A 3QO9A 2P6TA 2IYIA 3MF5A 2E7XA 2WOMB 2I8EA 4IKFA 1O1WA 3C6UB 4FYXB 4WP8A 2ZH9A 2DNKA 4QWAA 3T5HA 1UZHA 3SCKE 1X5PA 1Z1ZA 1IG9A 2CQ4A 2FF6A 2XM3A 3DYAB 1LWEA 1W25A 3IBFB 3K5OA 1HARA 3LP0A 5HLFB 2QWMA 4B3MK 4Y2KA 1H74A 3K9JA 4WCEL 2AYBA 5THWA 4IKAA 2W9BA 3VF4A 3SBTA 2NXEA 4WQ4A 3QFHA 1R8CA 4PWDA 2J0SD 3AXMA 1SUQB 3KG0A 1V4TA 1W2IA 5HJXA 1IKYB 1NHUA 3C8YA 4X4UA 1NO8A 4CT8A 1KAXA 3FBEA 1RAHB 2G8UA 3HKWA 4OFZA 2HB5A 1ZTWA 3U1MA 5GAGI 3VAGA 5BPMA 4AM6A 5M2RA 1ATRA 4FNHA 4B8AB 4CH7A 4QPXA 2KYZA 3H40A 1VQ9N 2Z1JA 4PXDA 2RMLA 4ZP6A 5AXLA 1VQ7S 1X5TA 3TAGA 2MLYA 3CT9A 4E3SA 1EWQA 2MKSA 1JL1A 1FRLA 2CQ2A 1NGGA 4DU3A 2YKPA 1TKXB 4ES2A 3CCQS 4P74A 4JKGB 4M5IA 4RW4B 4QQBA 4BROA 1N8RT 4JKBA 3FCHA 3FSYA 4FJMA 2F7TA 4BR5A 1U25A 1Q7LB 4ED7A 1RHMB 3W2WA 1HQUA 2CGJA 2F63A 1VOMA 2AJFE 4EMDA 2FHJA 4U7CA 1BMQB 3QGHA 4X4VA 5TKWA 3L2UA 3W5ZA 3IWLA 4X2BA 3DHXA 1RAJA 3B6PA 2EW9A 2VZ9A 1BI4A 1EQMA 4RNMA 3M05A 4PWUA 4G1QB 3FZBA 3J81O 3QIDA 4LF1A 4CZEA 3MMJA 3ZFVA 4DF4A 4NB4A 1C4CA 3L7PA 3CCJS 4USWA 2JEFA 2D41A 1S4EA 4BDZA 3VALA 5B0CA 3ZZZA 2W4PA 5E3CA 1MWYA 3TAMA 1X4AA 1JLBB 3IP0A 2JC0A 2BH1A 2RKIB 5A2QU 3ZSYA 4F4AA 1O8BA 4QYRA 2QL5B 2GQ2A 4WYWA 4CZHA 4J9QA 5F9NA 4CZLA 5CY4A 1NKCA 4MFBB 1MWKA 5EWEA 3OTEA 1KLMA 2ZQBA 3DXKA 1P27B 2RD5C 4O5FA 1K9MO 3M30B 2YNIA 2R7TA 2X1GA 2IIRA 1E4FT 5CQGA 3MFIA 5B0BA 2LQ9A 2J0XA 1IVZA 2JWNA 4WCEQ 4ILJA 3H20A 1C0UA 2ZOGA 3CCLS 1NK4A 4DR3F 5I3UA 3ETMA 3PRDA 1HBMA 2OI2A 1NZAA 1U2CA 4Z4GA 1N33J 3JSMA 1D3WA 3GWCA 1X60A 4URSA 1H7WA 4I6MA 1I51B 4D3GA 3DM2A 1SH3A 3MI7X 4FWMA 4CZGA 4FLVA 3CC2S 3PEHA 5BREA 4ECRA 4CK1A 3GOIA 4JI2J 2DKOB 2R7VA 5I42B 4CE9A 5E3PA 1NDCA 2HHSA 3LDQA 3BF4A 2BJDA 4B9TA 4CNYA 2A1SA 3OYBA 5GAHP 3HL8A 3H25A 5HL7Q 1S22A 1WEXA 3A8JA 1BL3A 1T05A 4UOFA 3KJFB 2R9LA 3W9IA 3J8AA 3HHLC 2MZSA 4F9OA 3D6HB 3FSIA 3D67A 3CDWA 4AILC 2HVZA 1FDNA 1NK0A 3HHLB 5J2QA 3MM5B 3EJMA 4WXWA 1RUSA 4J9NA 1FW6A 3DRSA 2ZDOA 2L3MA 4YOUA 2LA4A 1W9HA 2YQ1A 4IH5A 2BACA 3FZFA 2OKQA 3D2FB 3DKDA 3H1QA 1S9FA 3IMQJ 1S9GB 1OPZA 1XR5A 3G86A 2OJ3A 4FLWA 1PSDA 3T1YF 4LR7A 6AT1B 4ECTA 3CULA 1AUDA 3EKSA 3J80U 3E51A 4AHCA 3B54A 4MDBA 2XBPA 3VZHA 2YY3A 5GAEU 7FD1A 1SZ2A 3QJLA 1J5OB 2DT9A 2OMOA 2ADCA 9ATCB 1BQMA 3OYLA 2CPZA 2BVZA 3RW7A 2RU3A 2NQPA 1ZTTA 1Q86T 3QIPA 2J9EA 4AQYF 1P9QC 4W5RA 3UR3C 3H0PA 3PYGA 2AYEA 4NO7A 1UJ6A 1SVDA 2XULA 4W90B 2H4YB 5CZVA 3MECB 3H08A 5F8MA 2HVEA 3T1YK 4O55A 2GCFA 3BDPA 2QLFB 4CLSA 2RQ4A 4F2SA 2AZ1A 1EB0A 4HH0A 1ROFA 3EGVA 5CABA 5LXRA 3DCAA 4FJLA 3T5KA 4GKKF 3OYIA 2HOEA 4DMZA 3KLFB 5AQSA 3L4BC 4DR6F 5AE1A 4AQYK 1HBUB 2VDIA 1X4EA 2V8HA 1L5UA 1QQOA 1VSJA 4CZFA 2PFDA 2GX8A 4FPAA 3MMVA 3NS7B 4JV0A 5LMNF 4CEEA 4UUXA 3O80A 5ETNA 1W7AA 1G6BA 1VJQA 1S5JA 3P1GA 2CQBA 4A8QA 4NLOA 4ELVA 4C97A 3V1RA 4GKKK 3JQJA 2OTJS 2JLGA 1OSDA 2C2OB 5I9EB 5TKYA 3HYFA 2RVJA 3O8WA 4DR6K 4WQ5C 1QE1A 3G96A 1SQEA 2BJ3A 4NA3A 1K1SA 1WD6A 2C2ZB 2R7OA 1HLUA 2VDHA 5LMNK 3MM8A 4AHRA 4DV2J 3CCVS 2YKMB 1GH8A 2J7WA 1FWKA 2VPXB 3GILA 1HNZJ 2ZH2A 1RK8A 1N5TA 5JMVA 4DTOA 1RABB 1NB2A 2XMAA 2KZZA 3M8SA 4OHVA 3NHGA 2XYHB 3T5JA 4WFXA 4DTSA 1NOZA 2L48A 1SAZA 2WAQD 4B3RJ 1YTAA 1TL3A 2E9RX 4ZK7M 5K20B 2EI5A 4CF9A 4O3SA 3D7EO 3OV7A 2NNWA 3MHYA 4O5BA 4HYKA 1WSJA 5AZIA 1VC5A 3TRGA 3HBTA 1YTYA 1S76D 4ICLB 1NGJA 3A8YA 2UUBF 2FSJA 1RAOA 2ZKUA 1B0VA 4LFBJ 2EFVA 3D0HE 1PC4A 2ZH1A 4ED1A 4A46A 3QFPA 1ICEB 4AL5A 4TU9A 1OH7A 3OSPA 2OELA 4DL4A 4USUA 2V69A 4X66F 4MQ3A 1MWMA 1N5SA 2D3ZA 4CHZA 2FHJD 2NRRA 3MR3A 1PAEX 3KLHB 1BGXT 2GWJA 1HYZA 4A2BA 4E8UA 1NK8A 4CIFA 2MQ8A 2UUBK 1BWEA 3D6FB 3MMAA 2YNGA 1N6QA 2ZH5A 1GQEA 2XRIA 3J7AN 2P1JA 1XNQJ 4AL7A 3CJ3A 3CO9A 1G99A 1BY9A 4A59A 4EWTA 3BF1A 4A8FA 1WUUA 3KHGA 4DV5F 3I32A 1CC8A 2G8HA 2FJWA 4X66K 1IBKJ 4RBTA 4FS1A 2C2DA 3BB5A 1IWAA 2N4DA 3SAGA 5DLGA 3ET6A 2E2NA 3DI6B 4IRDA 3A5MC 4JUZA 3GU0A 1JIHA 5KFEA 2IC3A 3GG1A 4Y3CA 5EN1A 2VG6A 5KFBA 3VGLA 4CEAA 3MDQA 2HAFA 1GX6A 2PDAA 3SYZA 1UVIA 3TZXA 4IOBA 3RG6A 3PZPA 3S3MA 4OLPA 3KLIB 3VAJA 4Q0BB 4DV5K 1U4BA 3MN9A 3CO0P 4M3YA 5E3QA 3VTIA 1OH8A 3H3NO 1O13A 1XUPO 2OEKA 4DPTA 5B0AA 4L8RB 4RO0A 1U1QA 3NWGA 2YX4A 4NCGB 4LF4J 4M63A 3I6PA 4YQWA 4FJ9A 3U02A 3W2VB 2W6LA 3CSKA 3Q86A 2FD2A 2M70A 2HHQA 4F3QA 4FBTA 1EKEA 2GIRA 1RWXB 3AOCA 1HLWA 4X4QA 3VQ9A 2MZRA 1RP5A 2K7KA 2W40A 3KNAA 2RNEA 2HQDA 5FIIA 1KAZA 1U6FA 3ZEUA 2B9XA 3EICA 3AFGA 4FKYA 4LBIA 2K06A 1JXVA 3QZ8A 3CJSA 3CCEN 3I0SA 3H59A 4AXIA 1U1RA 3RRGA 5A6WA 1VSIA 2N4CA 1ZC6A 4CLLA 5HRSA 2RDJA 4P2MA 5ITHA 3FSXA 1HBOA 2O8DA 3NP5A 3QSIA 4M3XA 2QW9A 4YY3J 1RCOB 1HMVB 1WTBA 2WVEA 4IQXA 3R5BA 1B7YB 5IT9Y 3MAAB 1QLNA 3SQ1A 2HWIA 3ZSWA 2M9KA 4F0HA 3CQ8A 1TUWA 2WRMA 4NCAA 2RF2A 2ZITA 1UPMB 1K73O 1EWRA 2IA6A 3P31A 3VGVA 3OYFA 4WP3A 3HF5A 4MTPA 5F8NA 3MEDB 1NZ8A 5ETPA 2GQQA 2RDIA 5KG2A 3IKMA 1EQ0A 1RTIB 2QFJA 3SFGA 4NLRA 1AT1B 5L39A 1EHWA 3M8PA 1QZ6A 2FVQA 1W2BM 4JI7J 3AA2A 4ZIVA 3PHEA 1CBKA 5DLFA 1ZM9A 4QJVA 1KOOA 1J2VA 4CJLA 1H6KX 1X9MA 2QE5A 1T44A 1UW9A 4DR2F 4B9NA 2CJ9A 3GLJA 4AE5A 2RPIA 2CJYB 3VEZA 1S0VA 4CK2A 5H9EJ 1SJ4P 2M4MA 2Z1HA 1ZAVA 4CYUB 3RBDA 4K41A 4A61A 3FMBA 2V94A 4A4JA 4QU7A 1HHSA 4H4KC 4YDUC 2QTWA 2QFIA 3HI9A 4DMNA 3TQ1A 4UY8T 1PC5A 4PZVA 4U67L 2HFUA 2VPYB 4KH5A 4DR2K 3QT5A 2ZJRL 4QS8A 3ZSRA 3HHEA 3TWHA 4JN4A 1M5OC 2E66A 4YS2A 1Q8IA 4I2PA 1H73A 1O51A 4RNHA 3HP6A 4IQMA 1IG8A 4IR1A 4QBUA 3ID8A 4A5BA 4LVNP 4WFBQ 1WBDA 2XS5A 4GO5X 5LJWA 3ULDA 1N32F 3NBPA 4OZNA 4DLEA 4O8KA 3DU6A 2I7PA 3PV8A 1UZDA 3BKTA 4RKUC 2BA9A 3ZT3A 4C3LA 3PNIA 4I6YA 4DCJB 5F3ZA 3W3DA 1WC5A 1ZBSA 2VU5A 2FC8A 1GLJO 4GW6A 1YXQA 4UOHA 4USTA 2ROPA 2N3LA 3N9UC 1HUXA 2CPXA 2M88A 3D5MA 4RW8B 2XSJB 1R0AB 3BN7A 2OCEA 1PBUA 1QSSA 2MKIA 1N32K 4ID1A 3R5CA 1N5VA 5K14A 4QAGA 5KFWA 1VQKS 4TXSA 4OYXA 1H38A 1YITS 1OWXA 1YX2A 1HNIA 3JAMO 3TQEA 4E0DA 1SIWB 1IBLJ 1N0VC 3GJSB 1ZA2B 1QAYA 2BQUA 1RHRB 2R7YA 4DU7A 2BZ2A 3SUNA 4ZLJA 3C2PA 3R3TA 2MZTA 2DGSA 1QHAA 3JTNA 2UUWA 2GVDB 2Q0RA 3DOKA 2MXYA 4H5NA 3VQ6A 3TZYA 1J54A 2CQDA 2P9KA 3M6WA 4JKEA 2YKNA 1Y11A 3RVCA 4KJIA 2Q31A 4CLPA 1OQ6A 1FDDA 4WE1A 1HNXJ 4DV0J 1BHLA 3T41A 4B9SA 2LDYA 3KK1B 1Q95G 4ZP8A 1MDUB 3IWXA 4NRUA 1SJ1A 4M3WA 1RKJA 3RWUA 1CEZA 4K8ZA 1K8KA 4CIGA 3G6YA 3MCMA 4GV9A 2FBVA 4FWQA 4ES1A 1PGZA 1WSVA 2I38A 3AY9A 1ESVA 1XERA 4LH4A 2BKNA 1NHVA 3TAPA 1S1VA 3WIVA 1DY3A 3ZTQA 2H4WB 3SSQA 3TUPA 2KQ2A 4PUOB 1U49A 1FKOB 4ED6A 2OTLN 3V4IA 3CD0A 1NKEA 1Q9XA 5T41A 1R6VA 1SPBP 3N6LA 2LMIA 4OX6A 2QA4N 3PCOB 3CHWA 2CQ1A 1YLXA 2CNOB 1XC9A 4FPRA 2UUCF 1S3XA 1FX4A 3TW0A 3VEXA 4FLXA 2BMBA 1KHVA 4DKWA 4IH6A 2HG4A 1T6DA 2JWKA 4LRAA 4NEYA 4J8FA 1Q53A 2DBBA 1TP7A 1X4GA 1RAFB 4CQ1A 2NXCA 1EXQA 2DPNA 3P45B 3GCXP 2BR0A 4M5MA 4TY9A 4KKOB 1QSYA 3EN9A 1NK9A 1VQ9S 3O9UA 4L72B 2W25A 3OTOF 2F8MA 2UUCK 4HH1A 1SC3B 4ZLNA 1EETA 1ZM4A 2YWWA 2MY7A 4IYQA 4E7JA 2OLWA 3LPYA 3HM8A 5IM0A 2OAUA 1IR1A 5KFQA 3IR6B 1BE4A 1RAEB 2H51B 3ZT2A 2DXFA 1XMOJ 4RWXA 3DFEA 2XNRA 4I2QA 2UP1A 1S9EA 4FJGA 4ECVA 1RT6B 4C8NA 5EWFA 4OZ1A 2W42A 4DWIA 2QLXA 3NKYA 1T11A 4B8CA 4XPCA 4NL5A 4DV1J 4RX6A 5BJRA 1FRKA 2MZ1A 4MO5A 2ZBIA 2DPIA 3OTOK 1FKAF 4JKAA 1F2HA 4RG8A 1D09B 2CJBA 3VF0B 2YTCA 2OPPB 3CB4A 1C0MA 1Y97A 1WOPA 2WONA 3R3LA 3WQUA 4JS5A 3ITHA 1J53A 3CCUN 4P9SA 3DOMB 3MOJB 3MD1A 5KFGA 2LYVA 3G25A 4I7FA 4Z4FA 3TVKA 5C25B 3ZTRA 4O0JA 3QICA 1FA0A 1YIJN 1ZBIA 4DUYJ 3CVKA 1Q81T 2EK1A 3LW5C 3GYGA 5D4PA 4YB1P 4WZQA 4C98A 1CJTA 4A8WA 4GVLA 4ZITA 3ETOA 1FDAA 2GUPA 1VQ4N 3DLEB 5G4DA 1FE4A 3HSZA 2Z1IA 2HRUA 3A3OB 1G15A 3H45C 4FL9A 2ZHOA 4MJKA 4L74A 2CPFA 4Q7AA 2HNZA 4RJVA 3DLKB 2O8CB 4B3MJ 1VQLN 2M3DA 4IRKA 2KTQA 2QSWA 3IFRA 2KLAA 1GEHA 1S0MA 1VRTA 4FXVA 3UCZP 3EVWA 2YXLA 3THWB 3IGVA 4K7QA 2V2QA 4LFCF 5A8KB 3M4XA 1HHQA 1WAJA 3RMBA 3KK2A 3ENWA 4PAAA 3NVMA 3ICLA 2JVRA 1R7IA 3O4WA 4IFVA 4I6AA 2QA1A 3RAQA 2L9WA 3C95A 1JX4A 3G4SN 4DQRA 3RR7A 3QFWA 5KFKA 3D2WA 3V6DB 2HGNA 3B82A 4J9MA 3SCLE 3HHDA 5M1QA 3X3UA 4LFCK 3F5TA 3G6EN 3GG0A 1GFWB 1EARA 4C0HA 1I94F 1B70B 3JQMA 3PG9A 2FSNA 1VSLA 3ILLA 4ZKAA 1TTHB 1R27B 4F25A 2D3UA 3H5UA 2CNKB 3QBCA 2MY8A 3ZZOA 2ZC3A 1NDKA 4LSNB 1ELOA 4CTAA 5KFYA 3HSJA 4B1ZA 1T03A 2APOA 4LH5A 1I1GA 2IS3A 2LCWA 1YRTA 2M0GB 1X4CA 3ASMA 1GLFO 2PMHA 3M2VA 4FM1A 2XY5A 1I94K 3CF5L 1FXXA 1XJWB 2UVVA 4DS5A 3E3XA 2KN4A 3U8XA 3P4IA 2IVPA 3O6QA 4OPHA 2Y8YA 4M5DB 1TYQA 3BBFA 1UTAA 3TTFA 1Z05A 1IJJA 4OJGA 3VQCA 3SV3A 2IAJA 1T9WA 3DMJA 5E84A 3K5NA 2ZOFA 3V5RA 1WI8A 3O5TB 1MW7A 1H2TZ 5KRSA 2HNYA 2AKWB 1E6YA 4UZCA 5B7WA 3EO3A 1S1TB 2SXLA 4P7VA 4LF5F 4EBEA 3FBFA 3AGKA 3N4WA 2OUGA 2F8HA 5LJ5Y 4TY8B 3WUHA 2GIQA 1VC0A 4IFYB 4IDKA 4L3KA 3Q8RB 3VEYA 3O1BA 4JAXA 5K5MA 1HPZB 3IS9A 1UETA 5AZJA 2W9AA 3MEEA 5FDLA 2L9DA 3NGYA 5JS1A 3T69A 1LNQA 3MK6A 4OYBA 4E7LA 2DD8S 3TX8A 1DQ8A 1ATSA 3O44A 4C0BA 5BN9A 3OJUA 2BDPA 1HBNB 4ZVHA 3PKYA 3BPSP 2P9PB 1F5CA 2GELA 2CZ4A 2AU0A 3ENAA 1L3KA 1EKRA 4KE5A 3DDKA 1JL2A 2IDEA 3A5LC 3QWUA 3JAMU 5GMDA 3LOUA 3LPTA 4CZMA 2C2MB 4HL9A 2J6TA 3KLGA 1NMEB 4TNOA 4OZLA 1RQ0A 4J2AA 2WZ1A 1WI6A 1KQKA 2NR0A 3DXMB 3L7UA 4GC6A 3CJTA 5DQGA 1LXJA 1AFIA 5KG7A 4TN2A 3ENVA 4JV1A 1ITPA 1CQNA 4JI0F 4YHHJ 1S6UA 2EFPA 2OPRA 4KV8A 4NE9C 2RH3A 2HMIA 2HS4A 3ENOA 2XS7A 3UE5A 1RTJA 3I31A 3MUVP 4DSIA 3OHAA 4DL7A 2QKBA 1SJRA 4J9KA 3L7OA 4M3ZA 5AT1B 3VA0A 3EE9A 5DRKA 4NLDA 2N7CA 4AF1A 3FBBA 4BRLA 3BO3A 1WKKA 2EG1A 3SXLA 1U04A 1F6TA 1OVYA 3JTOA 1RILA 4BRNA 3S3OA 2MKYA 3UCGA 1C0FA 4B08A 4I1TA 1JKHB 3C3LA 2FZKB 1GXTA 3TAFA 3DLGA 1M5SA 3IXQA 4PCQA 3S6EA 2R8GA 4UW2A 3BYRA 3OBYA 3HZ6A 2BJ1A 1P9YA 2D0OA 3NVKA 1N34F 2LQBA 5KT4A 4WFYA 3T1YJ 4X84A 2HQIA 2K1RA 4LRFA 5A6PA 5E7OB 4QIFA 5DDPC 5AQVA 1B99A 4LSLB 3UDCA 1TK5A 3MAQA 1Q5YA 1DKGD 1EIYB 4DB3A 4CM2A 3MN6A 1BQNB 2RHKA 4BACA 3OVAA 2PYLA 1KN6A 1MLAA 4O44B 3MPYA 1T3NA 2OA8A 4FKXA 4AQYJ 2Q3SA 1NH7A 2FDNA 4BCAA 1KHWA 1NLKL 4K4WA 1QTMA 2VG7B 3W8GA 2OANA 4FWRA 1N34K 3JSRA 2DGQA 3GIIA 2VUGA 2VWKA 1S6QB 1CS4A 3O3GA 4K0KF 2FF3B 2BEFA 3MUMP 5LL6Z 1QSLA 1KTVA 3POTA 2RRAA 2Y1LB 4GKKJ 5HJYA 3N6MA 2XC9A 3QGPA 4W92B 3G82A 3GV5B 5EOYA 4ED8A 4IUFA 3O4NA 3IAYA 4IFEA 4DR6J 1QAIA 2UUAF 4LF2A 2CA9A 4URQU 5HROB 1SC4B 4BY9C 4NI2B 3M6XA 2WUSA 2GJ2A 1GTEA 4U96A 5LMNJ 2GVZA 2AJ1A 3ZZ0A 1OYDA 3A5NC 1DFDA 4K0KK 2B5JA 5BRFA 1A9NB 5T7LA 3TNVA 5E2QA 1YZ7A 2DHGA 3FGVA 3RZAA 3P5JA 5C42B 1LV5A 2P9UA 4ETXA 2ATLA 4ZCIA 4WKRA 1APSA 1CJUA 1FRIA 5AQTA 4YOVA 2O66A 3LP2A 3UVJB 1U1LA 4IDHA 3HZGA 4N41A 5HRPA 2UUAK 3HFKA 4DTXA 4OJ1A 3CCES 4I0WA 2Y1RI 1FO1A 1UA1A 3NNCA 3KUGA 3HP9A 2ATCB 4OKKA 3FJ2A 4EUVA 4HHJA 1AB8A 3PEJA 4NPOA 3OR1B 1KLNA 2F5GA 2DNNA 2RSQA 2YX6A 4WK3A 3FE1A 2JC1A 2YV0X 3TVZA 1VQ8N 1JLFB 5KQ8A 3CCRN 5GADP 3DJCA 2F4FA 2E7VA 1WHYA 1LWFA 4ANDA 5ADXH 4K25A 2VJVA 2Q97A 5IT9O 4KB0A 3LPEA 3E01A 4G6VB 1X9SA 1BU6O 5EVZA 4DQPA 3CPEA 3QRPA 3OYMA 4OZ0A 2DRAA 4DU1A 4PG6A 2P9SB 3VCDA 2UUBJ 2VG5B 4P2XA 2GS8A 4PA1A 3D28A 4BC2A 1JLQA 3ILIA 4CO2A 1IM4A 2HSEB 1YVUA 1BG3A 4ID8A 3AO3A 3C6UA 1SC6A 2RE2A 1WSFA 5KRTA 2LEPA 2EC2A 1RNHA 4X66J 2KG0A 4MH8A 5H1SV 2Z58B 4CK3A 1NGDA 5KI6A 2VQEF 3D1OA 3DYAA 2AZ3A 4C8YA 3Q24A 2JEGA 5HSPA 1HKGA 2HFVA 4DFMA 3F0NA 4R5PA 8ATCB 1QS4A 4DPXA 1LK5A 1B4SA 2W7AA 1WC6A 1NHKL 2WC9A 3ZETA 2DO0A 1RTHA 4JHDB 3M2RB 2HVDA 4DV5J 3OYAA 2WTFA 3SAFA 3LDPA 4DXLA 2VBWA 1U1KA 4E1JA 3Q8PB 2BANB 2VQEK 3MFHA 1GMVA 4JP8A 2DY9A 3GIKA 1AUSL 1TKZA 1B7FA 4ZS6A 2KXFA 2VFRA 3E2EA 3QDKA 4A8XA 2RU9A 2FHOB 2VODA 2YHWA 1FCAA 4JD2A 3DRYA 1N33F 5I3QA 2W8KA 2Y3YA 4TVAB 2D3O1 2A3JA 4X65F 3CNQP 3OHBA 1Y10A 1Y5LB 2UZAA 1TKXA 1WN7A 1Z25A 3CCWA 1UEKA 1FX2A 4DTMA 5DM7Q 5KG3A 4ZHRA 2WBNA 2VIHA 3CQYA 1QHTA 4KGXB 2E2OA 3BGFA 1HKBA 5J2MB 1OMSA 4DPYA 2V34A 4M95A 3D0IE 2Y0SD 2V63A 1N33K 1UFKA 2HK2A 4X65K 2NS1B 5DM6L 3ZNUA 3AJ2A 2NRHA 3L0QA 1YBAA 2B4PA 4YUDA 2G0CA 5CXTA 4CJFA 5AXMA 3VQ5A 3CJ4A 1RDRA 2R7RA 3MUTP 3C6TA 4CBXA 3T6JA 3L3UA 2DIVA 4LC9B 3HJFA 4GO7X 3BS9A 2IDLA 3CJKB 3MURP 1QVFM 1S72N 1D8YA 1JLBA 2LQ8A 4A57A 3GFHA 3GR1A 2O8BB 1H98A 2RKIA 4DR1F 1RT3A 4MT1A 4S0MA 4LIWA 1OY8A 3C46A 4Z94A 1XNRF 3CDAA 1XMQF 3QPIA 4NXNK 2DH8A 3QESA 1HQEB 3AJDA 1EJ7L 1EAYC 2JHEA 1XI1A 2AMCB 2ZD1B 3RR8A 2F8SA 3CJCA 1FK9B 3QAEA 3IC1A 2LXIA 2R8HA 1K1QA 1CXUA 5GAHU 1A6LA 2CJKA 1RDDA 3NXZA 5KFSA 5BR8F 4OLOA 1FTCA 3MMBA 1RWMB 4DX7A 4ZVPB 1TFWA 1HD0A 4DR1K 4GVMA 2B4JA 3ADAC 4OZ5A 2Z57B 1XN9A 4YN3B 5HP1A 4YOTA 1QQNA 4FLZA 5AQKA 4BC9A 1XNRK 1XMQK 3R6GB 2P2CB 4CBUA 2XZTB 3N28A 1U45A 2R7WA 4B3TF 1L3VA 1GLAG 2AT1B 2VL1A 3BR9A 5HQMA 2JGUA 4I56A 3Q8YA 1EQYA 1BHNA 1FI4A 2BQRA 3R27A 5JLFA 5BR8K 3JSYA 3SSSA 2ASDA 4DR2J 4CEQA 2OTLS 1UJ5A 2MQQA 3V2UC 1U48A 5IT4A 4Z4HA 2X6SA 3CMQA 3GSDA 5M2UA 3MM9B 2RT3A 4MAKA 2HHTA 3ILJA 4CT9A 4BGAA 2AWZA 2QA4S 4WKYA 2W1BA 3TJ9A 3QNNA 4B3TK 2EG2A 3OUYB 1VQ6N 4X4SA 2ITMA 2HBKA 3VQ4A 2QLJB 5DQHA 2AYMA 5FRMA 2XY8A 4HACB 2RDDA 3MEGA 3K2PA 1JLEA 5BN8A 1U8WA 4LUBA 5AQQA 4I68A 3HHLA 2WK4A 4EIAA 1RDAA 2ZM6F 4DX6A 3OW2R 2GV1A 1HPMA 1MN7A 1VK3A 4JI1F 3SQOP 3PRVA 2VV5A 3CFRA 2V4RA 1REVB 4KPCA 3CFOA 3R2DJ 3D2FA 3UWTA 1KQSR 1IN0A 5DM6Q 2B3TB 1IH7A 1M1HA 1ZBFA 4J37A 1IJFB 4AD6A 4IJNA 2E1MC 2XGPA 4R25A 1N32J 5D6GA 3D45A 1GLDG 4QWEA 3NNHA 2J4RA 4AXJA 4ZLPA 2FVRA 7AT1B 5CH7B 4B3RF 3W0LA 1TUVA 3RRKA 3KMQA 2E2QA 2ZM6K 1VSDA 4CJTA 2ZWPA 4JI1K 4LSZB 2BRKA 4O0IA 4OI1A 2WSCC 2ZWHA 2PFFB 3AVGA 2AP6A 2IJFA 3CDBA 1WEZA 3OS1A 1H0HB 5CAAA 3MECA 1LCUA 4FM2A 2GUIA 1VDHA 1VCTA 2CWXA 5C2FA 4FM0A 1X8DA 2AP1A 4PEOA 2PBDA 2VBYA 3CCUS 1QTNB 5F2RA 1F2GA 3BGOP 1S97A 4B3RK 3S1TA 4LQ9A 1JLGA 2OMLA 1W2BR 2DISA 1AZSB 1U2VB 5LJVA 1HBUA 4CIEA 3QMLA 1HIYA 1YIJS 3ZT4A 3NCQA 2OPSA 1V3ZA 3ZSOA 1WG1A 3PW5A 1WTFA 2GGPB 3J7ZT 2GIFA 4XH5A 2F4VF 4EHTA 1ZOTA 3ZZTA 2FC9A 5E3AA 2BBEA 1S77D 1VQYA 2GAHC 3QLHA 2E4LA 1IBKF 3QEXA 2BE2B 3QO9B 1U0HA 5E0OA 2DGWA 4DL3A 4NLSA 4Q8EA 4QCLA 4EZ9A 5T14A 3SI6A 1PG5B 3O1WA 3MN5A 1QAJA 3D3BJ 3SUOA 1X0FA 3BEXA 3ONQA 4JK9A 2HHWA 4BWJA 1RAAB 1UVMA 2RQMA 2V51B 1VQLS 3A12A 2DRDA 1SKRA 3VENA 5JVGQ 2YKMA 4WQ5A 4KHWA 2F4VK 3GFXA 2CVEA 3NF6A 3PO5A 3BH6B 1LWEB 2QWLA 4NYNA 4WQ4C 2W41A 2IM1A 3LP0B 4FDFA