3P38A

Crystal structure of the ns1 effector domain w182a mutant from influenza a/vietnam/1203/2004 (h5n1) virus
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
123
structure length
123
Chain Sequence
b'KMPASRYLTDMTLEEMSRDWFMLMPKQKVAGSLCIKMDQAIMDKTIILKANFSVIFDRLETLILLRAFTEEGAIVGEISPLPSLPGHTGEDVKNAIGVLIGGLEANDNTVRVTETIQRFAWRN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nonstructural protein 1
publication title X-ray structures of the NS1 effector domain from highly pathogenic influenza A/Vietnam/1203/2004 (H5N1) virus
rcsb
source organism Influenza a virus
molecule tags Viral protein
total genus 35
structure length 123
sequence length 123
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-10-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.330 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3p38A00
3EE9A 4OPAA 3P31A 3L4QA 3KWIA 3P38A 3F5TA 3O9SA 3RVCA 3EE8A 3O9UA 4OPHA 3O9QA 3D6RA 3O9TA 3O9RA 2RHKA 3P39A 2KKZA 3OA9A 2GX9A 3KWGA 3M5RA
chains in the Genus database with same CATH superfamily
1X9SA 1OH8A 4OLBA 1BDGA 5DM7L 5HP1A 4LY7A 4M3XA 2EHGA 3F9KA 1KVBA 2GWJA 4CK2A 2YNGA 4XH4A 4NCBA 1DT9A 4DV7K 4CHOA 4CEDA 1T6CA 4JI8K 3JXUA 3NGYA 5DM6L 4CZLA 2QA4N 5J2MA 3M1FA 4AHRA 1U2VA 1IKXA 1IO2A 2VG7A 3PY8A 4LFCK 5EY4A 1WSGA 4EAHD 1W0HA 3LDSA 1TKXA 4FJHA 3HSTB 3VGKA 2P9PB 3R8EA 3LDOA 2RN2A 1KC8O 4DS4A 3LM2A 2VG5A 4CIGA 1B9DA 3R9PA 4CEFA 1S1WA 4NYFA 1BWFO 1RBVA 2YHXA 1SL1A 3L2WA 2Z1GA 3CIPA 3QETA 4CGDA 3AVGA 3T1YK 4F3OA 4FL9A 3GG4A 2AJQA 1HNVA 1HX1A 2D5RA 5BR9A 3THYB 4CJTA 3KZBA 2YNFA 1EETA 3PX6A 4H5VA 4AHCA 1I39A 3G25A 5JICA 1VQON 3PO4A 3BUZB 3D2FB 4JI6K 4UY8O 3MN5A 1RNHA 2O8BA 5KI6A 3PUFA 4XIUA 2ZJQL 3ZLJA 4DR2K 3OYKA 1DGKN 4C1NI 1JCFA 2E1YA 4PQUA 4JKBA 4WE1A 1RDUA 3EYZA 1NGCA 1ATNA 3ID6A 1IH7A 5C25A 2JLEA 3KLIA 1BU6O 3V1QA 2DY4A 3ZYYX 2YI1A 4DFMA 3OBYA 3NF7A 4JKCA 4ZTJA 4O8KA 3M8PA 4B08A 2NRZA 5HRPA 1IV0A 4WFAL 4F4KA 1CXUA 4IKFA 3LAKA 5J1EA 1GOBA 1RBRA 1NKBA 3UB5A 1L3TA 4A57A 4BQZA 3LDLA 4HUFA 2ITGA 4M3WA 1S9GA 2FSNA 2NRVA 2QW9A 1VQ8N 3HRGA 3VQDA 4DV4K 3MWTA 3RRGA 4RCHA 1YJNN 4JKEA 2G8KA 4NXNK 3VEVA 3O1WA 3SCXA 3QEIA 3CXCM 1P90A 4JKGB 1RTDA 1XC9A 4MQ3A 1W97L 1ASVA 1Z6RA 2E5LK 5FRMA 3ZT2A 5B8HA 3HP6A 1VSMA 2B4JA 4JKFA 2YV0X 1A5VA 3H3NO 3SK3A 3FZKA 4B9LA 2BANA 5C24A 1ZBUA 4B1YB 4ILJA 3CCMN 4BRAA 2YCHA 1HNIA 1S1VA 1QVGM 3ZSWA 3PIPL 4FXDA 3K5NA 1NKEA 1YVNA 5JLHA 3QEPA 2RF2A 1SS6A 4IZ9A 4MLEA 5C0YA 3SAFA 3EL2A 2KKZA 3AVNA 3AY9A 3OA9A 4PWDA 4CJQA 4KTWA 1A5WA 4B8CA 5AQHA 1QZ6A 3CC7N 3ALYA 4HVJA 3THYA 2W40A 3R1XA 3CI5A 3NH0A 2E4LA 4JI1K 4BROA 3T69A 4AHSA 3P5JA 3SPYA 1NOZA 1J9AA 3A5MC 1IJJA 4LF8K 3S41A 1HKGA 3VQAA 4FCYA 4NLBA 5H1SQ 4MDBA 4I7FA 1Z25A 3SJHA 4WFNL 1TK8A 1VQ6N 2HMIA 1BGXT 1I94K 4KTQA 2YHYA 3H45C 4PA1A 1Z05A 4DR6K 3C0BA 4Q5VA 3W0LA 1RT3A 2QEXN 3OYDA 3AA5X 3CFOA 2KQ2A 2CH5A 3FFIA 1VRUA 3HL8A 3SV3A 4CF1A 3CC2N 3DOKA 3JS6A 4IJNA 2ZJPL 3SUQA 1HR0K 4DFPA 3FGUA 4IWVA 4CEZA 3N4PA 3KK2A 4BRDA 3CHWA 1FW6A 4B9NA 1X3MA 2KFNA 3HM8A 1CZAN 4IDHA 3VPZA 3S3MA 4N47A 3BEXA 3LWLA 4AM6A 1YITN 1L5UA 2JWKA 4FPAA 1Z26A 3QESA 2I7NA 1NMDA 4AH9A 4CZGA 3NGZA 4PL8A 3UKUB 3VQ4A 3WEEB 4BDPA 3BZCA 5C42A 3MXJA 3NF8A 4E7KA 2F96A 5HBMA 1TL1A 4RW9A 2PYLA 2G8VA 4ELTA 3VQ9A 1C0FA 1IKVA 3PO5A 4MDAA 2E6MA 3ASMA 5M1OA 2B6AA 4FWLA 2YNHA 4CE9A 2V7YA 5AZJB 3AO4A 3WXKA 2WBNA 3HOTA 4OLAA 3EEQA 3HPGA 1WAFA 1Q18A 4JKHA 4OKKA 1LWCA 3OJUA 3OHRA 1WSIA 4HUEA 4BRMA 1VQ9N 3ZT3A 4FJ7A 1NGEA 3RTVA 2O4GA 3KK7A 4JI5K 3ATVA 4CF8A 2E2QA 5FRNA 3V1RA 3BGRA 4HTUA 4MLHA 5KPTA 3CCEN 4G9ZA 4B9MA 5E26A 1U04A 3T1HK 3VQEA 3L4QA 2B5JA 3P38A 1RGIA 3T3FA 4ICLA 1TV6A 3CF5L 3SLCA 3DXKA 1VQPN 3AA2A 1J54A 1RBTA 4V19S 1NGDA 4IEEA 3NCIA 2XHBA 4FWQA 1Q9YA 3SUPA 1N32K 4BR9A 1XMOK 1HRHA 3J81O 4E0DA 4KO0A 1ZYQA 4A2BA 4FZZA 5AQQA 1T8EA 1UOCA 2ASMA 3LALA 3M3ZA 1SL0A 3E9OA 1QQMA 5KGWA 3BZKA 3SV4A 4FVUA 5LY3A 1KTQA 2O4IA 1GLEG 4YNQA 2FBTA 5I3UA 1YTAA 4B9SA 4PKGA 3SMPA 4DTPA 2UUAK 3SAGA 2QWRA 2ZJRL 4DTNA 2I5JA 2V7ZA 3C6HA 4KREA 3CJ7A 2HHHK 2O8CA 4BRHA 1U4BA 2P1JA 4FOIA 2HSTA 2UXDK 3P4IA 3MN9A 1NJIO 1RCHA 3RRHA 4XH1A 4GKJK 3NDKA 5AQLA 3RMAA 1WSFA 2YX6A 3L4IA 2EX3A 4CFAA 4FOEA 4CF2A 2Y1IA 3LPUA 3MX5A 3R6MA 1GOCA 1QQNA 3C6TA 2HHUA 4EZ9A 1RBUA 3L2UA 4BR4A 3TAFA 4LC9B 5C2FA 3EN9A 1ZBLA 3C65A 3K9JA 2A6AA 2O8EA 3DLLL 1X1PA 3QLHA 1OH6A 1JLBA 3OYMA 1FKOA 3MN7A 5AZJA 3LDQA 5JMVA 2PYJA 4IEIA 3AVCA 1WOQA 3R3LA 1KAZA 4JI7K 4IO9L 5AFUH 3AA4A 3B6PA 3AVAA 1S3XA 4GVEA 4K42A 1QS4A 5GADP 3LZJA 4MO4A 2XY7A 3L2VA 4J2BA 4M3TA 3HM9A 4LF6K 1U49A 3EE9A 3M6GA 3H1QA 1EXQA 4JHDA 3SAHA 3O80A 3HTVA 3RMDA 1NJWA 4Z0UA 3SMSA 2CGKA 4E3SA 3A5LC 4CHPA 1NK4A 2OTJN 2EWSA 3IAYA 5CYQA 2FBXA 1D9DA 4LFAK 3CD6N 3D2EB 3PSFA 5C2DA 5GIOA 1V4SA 2XY8A 4CJRA 1OVYA 4J8FA 1YVUA 2E2NA 2E88A 1ZXOA 3QO9A 4GMJB 3G10A 4DV1K 1QE1A 5I42A 1RT7A 4B9UA 3AVHA 4LD0A 2VWKA 4DTJA 5AQZA 5BRHA 4CVNE 2A40A 4DUYK 3VEXA 3OJSA 2FSJA 3V4IA 2Z1IA 3HVTA 4O8UA 4KI4A 3AO2A 2QXLA 2WFBA 2GX9A 3SYZA 4GKKK 2BE2A 5BPLA 3HVRA 5CYMA 1MU2A 3HPHA 5I9EB 4FWKA 3THXB 4MO5A 3AA3A 1T44A 1JLGA 4BRCA 4JD2B 4FWMA 1BG3A 5KPZA 1VHXA 2HHWA 3PLAA 4I6MB 4BRQA 2VWBA 1Q82O 1JXEA 4IFYA 5BN8A 3Q7BA 3MK6A 3ZEUA 3TWHA 1IKWA 1K8KB 1Q86O 2BGGA 2IDOA 3MDQA 1WBBA 1OH7A 2VCPA 4GV3A 2HHXA 5KPRA 4BR2A 3IUCA 2Y1JA 4M45A 3ID8A 4JLHA 4AF1A 1W9HA 2F8TA 4CZKA 2ZGYA 3O3FA 4GY2B 3O8MA 1TYQB 2A42A 3NFAA 3RSEA 3J7ZO 3HJFA 5AQFA 1WUAA 4KV8A 5LL6Z 4CK3A 3DYAA 1VQ5N 3JYTA 4YOTA 1EX4A 3CJ9A 4ILGB 4ILHA 5JS2A 2O8FB 3DMJA 4DQRA 4Q0BA 4FJ9A 4HUGA 2P9KB 3MX2A 4KH6A 2NLXA 2FSKA 3ZETB 3L8BA 5CZ2A 4I2QA 5BREA 3L6QA 2NUBA 4JI0K 3QNOA 3DAWA 4WQ5A 4CGHA 1O13A 2F7TA 4A62A 2ASOA 4Z4EA 1O1WA 4YFUA 1WAJA 5AZIB 2RE2A 4H5TA 1BI4A 4FYDA 4JI3K 3U9DA 3WT0A 1BCOA 5HRSA 5AQMA 4BRKA 4CJSA 1CZ9A 2VYPA 5EX5A 3VF4A 2PZSA 3TSQA 1SKSA 4CHZA 3OTOK 1S6QA 4IO8A 1YJ9N 1QHAA 1VSHA 2IC3A 3F73A 2OZSA 1QQOA 4H0YB 2ATQA 3T7ZA 2QWLA 3UE5A 4ZTFA 4LFBK 4OPAA 1M90O 3NBPA 1XNRK 3TR8A 1JLFA 5HRNA 1TAQA 4CZMA 3ZX0A 3QERA 1QSYA 4DKWA 3H6EA 1JXBA 2AA4A 3HI0A 1YUWA 4XEIA 5KGXA 3OYJA 3CFRA 5F1XA 3LZIA 4QS8A 4BC3A 4FWPA 4JD2A 4WQ5C 4BR7A 3WQUA 4H5WA 5JVGL 2J4RA 3ZT1A 2P51A 2ASPA 4DQ8A 4BRFA 4DQPA 4LF9K 4FJ8A 4FK4A 3NGIA 4OPHA 1XI1A 1EP4A 4DU4A 4DF8A 1K8KA 4GNIA 3VQQA 2HOEA 2P9LA 3CQXA 4Z4FA 4RW8A 3SBTA 4FM2A 1SKRA 2PY5A 3LP2A 3CMAN 2OCEA 1RDWX 1TYQA 3IMXA 2GELA 4YDUC 3QIOA 4BACA 1TKZA 4YY3K 4PL7A 1T6DA 3VQ6A 4IFEA 4KFBA 4CJ7A 4O0IA 1V4TA 4BE1A 4FJIA 2E2OA 3RWUA 2P9NB 4C23A 4O55A 3BDPA 3EZWA 5LJWA 2D1KA 4CEBA 4LSLA 3B8AX 5E41A 3EKUA 4H5RA 2I7PA 2HF4A 3H3OB 3MEDA 4NCAA 4IFVA 3K0SA 3ZETA 1IG8A 3KD5E 1TGOA 4RW4A 3WNGA 5KQ8A 5IWAK 1RTIA 4NO7A 4BQLA 4FLVA 4O4GA 5A2QO 3AVBA 1NK5A 4DTMA 4DSFA 1XWLA 2OPPA 4B3MK 4MFBA 3MMVA 4J2EA 5AZIA 5TKYA 2FXUA 1NJXA 3A5NC 3A2FA 5M1KA 3TI0A 4CF9A 3KTQA 2QK9A 2GWKA 4U7BA 3OYCA 4JNEA 4N41A 1Y97A 1IG9A 5AQVA 4IOCL 4DF4A 2HW3A 3I33A 3E1YA 1NGBA 3K57A 2P5GA 3C7NB 5FPEA 4DSEA 3FR0A 1NK7A 1N33K 4FW1A 4DWIA 1SAZA 1NK6A 3FE1A 1VK0A 3OVNA 4KI6A 2P9PA 4XH5A 3V9ZA 2A5XA 3VF6A 1D5AA 3Q7CA 4DR5K 4AM7A 3KLFA 5ADXH 3AARA 4BVPA 2Q36A 1K8AO 4IOXA 2AP1A 4DU1A 1NBWA 3CCRN 3QICA 1GLLO 1VQ4N 5AQOA 2Q0UA 1X9MA 4FZXC 2Q31A 1GOAA 4M41A 3VOVA 4EFHA 3CCJN 1ILYA 3ZT0A 4DU3A 3WNFA 1DLOA 3AGRA 3OBWA 2A1RA 4BE0A 1G15A 4W5NA 2QWPA 1I3AA 4X62K 1BA0A 2X78A 4BC5A 4KB0A 1KVCA 3HO1A 2D0OA 2ZD1A 4C8OA 1LW2A 2RKIA 3D2FA 3VA0A 3QIPA 5J2PA 1UA1A 3V9UA 3O9TA 1R0AA 3GBTA 3TTFA 4CHQA 4K8XA 4LH4A 2QWOA 4EHTA 4RG8A 4FWSA 3DWLA 1OKJA 1J5EK 4DV5K 4FWNA 1D4XA 3I8DA 4RTFD 3ITHA 2UU9K 3O6WA 2ZF5O 2OYQA 4L3QA 1VSEA 5LJVA 2GUIA 5LMNK 3V81A 2BH1A 3SBGA 2QKBA 2A1SA 2QTDA 4FM1A 1J5OA 1KFSA 5AQSA 4A5BA 5FLXO 1K73O 2KZMA 4DTUA 1C1BA 3CERA 4BVOA 3QEVA 4ID1A 4IJAA 3K5LA 1XHXA 4B9QA 1RT6A 4DSKA 3V9SA 3PX0A 5FPDA 4FLTA 1MWKA 4CJEA 2HNDA 4B8AB 1R59O 1SV5A 3HP9A 4JKGA 1NK0A 2NRTA 3ZSXA 2P9IB 1DTTA 3SI6A 4DSLA 3SQ0A 1D8YA 4C1NK 1C0GA 2OANA 2YHAA 3H08A 3VTIA 2F8SA 4F9OA 1N6QA 1EWQA 4NB4A 4OKJA 1LWEA 1NGFA 4CGJA 3BF1A 4BDYA 4RW7A 3MXMA 4NXMK 3C6UA 1SKWA 3UIQA 3VQ5A 3NVKA 5IT9O 4B1UB 1VSFA 4FSVA 4CJLA 1VSKA 4YOYA 2V52B 1MWMA 5TKWA 2VWJA 3VN5A 3QBWA 1HPMA 3OS0A 2IIRA 3CYMA 1NJYA 4F8RA 1KCFA 1RT5A 2F9TA 2BUPA 3ZSYA 4OJRA 1VRTA 2O8DB 1C1AA 3CPWM 3ZSQA 1FXXA 3TANA 2CH6A 2WOMA 4ISEA 3DXMB 2WUSA 1S6PA 2KHOA 4ELVA 3CFPA 2V51B 4ELUA 2FBVA 3ULEB 3OS2A 1BCMA 5M1PA 4E7LA 4BRGA 5JLFA 1YIJN 1LAVA 4Z4GA 4FJXA 5AQKA 1E3MA 2Q2RA 3QEWA 1TL3A 2NNWA 5CR4A 1J6ZA 2NRWA 1NMNA 2W41A 3CPEA 2YJFA 1NGGA 1ATSA 1RTJA 1DTQA 4B9TA 3FFKB 1ZBSA 1K9MO 2P9UB 4DFJA 1RDCA 3EO3A 4FJMA 3J8AA 2XY5A 3DLEA 1L3UA 1S1XA 4CEQA 3AV9A 4FVMA 5BR8K 3OYGA 4DMNA 4CD3A 1QVFM 5F0XA 4C8NA 3N4QA 1JLAA 1RDDA 2GV9A 2OTLN 4DSIA 3VENA 4B3SK 4DB3A 3I55N 1FJGK 2LSNA 4RWTA 3DLKA 4E7IA 1NLVA 1N5YA 3U3GA 3MCPA 4B1XB 2H3GX 3UKUA 4KHUA 3WEEA 2DFHA 4M3RA 3P83D 2WTUA 2YKMA 4JI4K 1NGAA 1F21A 3NAEA 3U6FA 4LF5K 4A2AA 1KAYA 3DRSA 4OGCA 1C0MA 2IOCA 4U67L 4QS9A 1IKYA 1EO1A 5AQPA 3VERA 3QBXA 4Z4IA 3NHGA 2PFUA 3CJBA 1KD1O 2HNYA 2A41A 3VQPA 4B1WB 4DS5A 3NH2A 1HJRA 4HCBA 1HLUA 2HBMA 3KWGA 3ZCMA 1HJOA 4WF9L 3OS1A 5AQTA 4LH5A 2W42A 4OVLA 4BRNA 4IG0A 5AQNA 4X65K 4I2PA 4DV2K 1A5XA 2VQEK 4ISFA 3LWMA 5HROA 2HB5A 1KLNA 4JEPA 4B3OA 1HKCA 4CEEA 3CG7A 3J7YP 1TVRA 4JK7A 4DTXA 5M1QA 4H0VB 2KTQA 1JL2A 3KJVA 2OPSA 4C8MA 3QINA 4WQ4C 4CFBA 3KD1E 1HNWK 3THVA 2NRHA 2G8IA 1SL2A 2FF3B 3ZX3A 3ZSVA 1L3SA 4KB1A 5AQRA 5BRFA 3VETA 1W7AA 2WONA 4DQSA 4R5PA 4CGGA 4BRLA 3TAPA 3IFRA 3L3UA 3C6AA 4DTSA 4CGIA 4Y1CA 3QFUA 1KRPA 1TK0A 1HMVA 2PBDA 4ID5A 1HPZA 1UAXA 4BY9C 3RMBA 1CXQA 4N5SA 2QWMA 3A0IX 2DFEA 4DHYA 2E2PA 4FJJA 4Z4CA 2G8WA 3TU5A 3DOLA 5GIPA 3SNNA 5GAHP 3CC4N 2ZGZA 1SZ2A 4H0XB 4CHYA 4PY5A 2IGIA 3C95A 3DRRA 1VAZA 4BGAA 3M8RA 4HCCA 4L8RB 1UWBA 1C0TA 1NGIA 2NZTA 3AAPA 2IS3A 2YKNA 3FZLA 1WSHA 2VGMA 3CM6A 2CGLA 3HXMA 1TAUA 1VSLA 5FPNA 4HWIA 4AQYK 3DM2A 1LV5A 3HOSA 3G71N 4K8ZA 4IDKA 1GLCG 4CJKA 4OPKA 2QXFA 1EKEA 4CJFA 1W2BM 4QAGA 1RT1A 4FJ5A 2UXBK 1KSPA 3GOIA 4C8KA 1YHQN 1RT2A 3HSCA 4FZYA 4CZEA 4H8KA 1VQMN 2FF6A 2ETJA 4IXCA 1RFQA 1XNQK 4EP5A 2BTFA 2QWQA 5MLCQ 4HTLA 4KHQA 2OA8A 4FJNA 3L2RA 4HHTA 2D4WA 1JCGA 1Y64A 3CCLN 2W6KA 3AO3A 3BY5A 3KLHA 3FZHA 4FLZA 5D3GA 1KAXA 4OO1J 5AQJA 1ATRA 1U45A 2IVNA 4G1QA 1X3NA 4BG9A 1K6YA 3HBTA 4CBXA 3O5BA 1NGHA 2KZZA 1KXPA 1HUXA 4I9LA 1HYSA 3KHYA 1CLQA 4WFBL 4JK8A 1N34K 2R7YA 3LPTA 3CJ1A 4KH5A 3D2EA 5KRSA 4QOZB 1OH5A 4CFCA 5AR0A 4GW6A 5KTQA 2Z1JA 4PUOA 3VQBA 1YJWN 3LDNA 3AVLA 3LP0A 4ZHRA 4O5FA 4K0KK 4TSXA 3MXIA 1U6ZA 2ZE2A 4AILC 1BISA 4M42A 1CZBA 1KQSM 1HNZK 3WQTA 4W5QA 2OZMA 1RT4A 2UXCK 1IBMK 4YDUA 4BC2A 3WXMB 1FKPA 4M7XA 4FJLA 5C15A 4YOWA 4OKEA 3D6RA 4QCLA 3T19A 1NOYA 4KRFA 1FK9A 4PKHA 2GUPA 3THXA 4AHVA 4EHUA 2JGUA 4IG3A 3QB0A 3G6EN 1Q8IA 3CQ8A 3U9ZA 1SQKA 5FROA 3MN6A 3VA3A 2HBKA 1OVQA 3TAQA 2X74A 3KWIA 3TAGA 3TSUA 4I6MA 4E1NA 4CK1A 3TABA 1E4FT 1M1KO 4KHWA 4CJWA 5T7BA 3KK3A 3AO5A 3EY1A 3A5OC 4M3YA 3SJJA 5HLFA 4O5BA 5HOOA 4CEAA 4BREA 3MEEA 5J2NA 5HRRA 3NF6A 5JS1A 1RDBA 2XRIA 4DQIA 2BDPA 4H5NA 1BQMA 4CFDA 4DR3K 3P1GA 3ZSOA 3RR8A 4K25A 5CZ1A 3U8XA 5M1FA 4F2SA 4JN4A 3BP8A 1XUPO 1KLMA 1BQNA 3EE8A 4OGEA 3NF9A 3TAEA 2JWLA 4FO0A 4NYNA 1BIUA 4A5AA 3VGLA 4B9VA 1U47A 3VTHA 1QTMA 4KBOA 1SUQA 3CM5A 2P5OA 4DG1A 1HKBA 2O8FA 3CCQN 1C6VA 1T3VA 1TUYA 2ZM6K 1YT3A 3LDPA 1DEJA 2CGJA 4OX9K 2X6NA 1YI2N 2HNZA 2P9KA 3WXLA 4O0JA 3M8SA 4CIEA 3U4LA 3FZFA 4DV6K 2HHTA 3ZSZA 3A8YA 5C12A 3I0SA 4EP4A 4W5RA 3K5MA 3NMUA 1ESVA 1NGJA 5J2QA 1N8RO 2D0CA 3LM9A 3O4NA 1QZ5A 4BE2A 3JAMO 4KPYA 1WN7A 1KFDA 2QI2A 3KKSA 1HYZA 2VQFK 2FLOA 4KHPK 1YAGA 2UYTA 2WC9A 4JAXA 4BG8A 2HVHA 1LOTB 3ULDA 3C94A 2X6SA 3SQ2A 4X66K 3W3DA 2IVPA 3L2QA 3M8QA 3GDQA 4NCGA 3DI6A 3ENHA 3GE1A 4DTRA 2F4VK 1S72N 4FK0A 1G99A 3DRPA 3IRXA 2HBJA 3TAMA 3E9PA 1RTHA 1VQNN 4CJUA 4UQGA 4B1ZA 4BRIA 4J2DA 1MA9B 4H4OA 1BHLA 1NG9A 4FLUA 4DUZK 3P31A 4H03B 2Q97A 4QS7A 4CEOA 1VSJA 3AGKA 3U3YA 2UUCK 2XY6A 4N76A 5JVHL 1LAWA 4EIAA 3OYHA 1VQ7N 3VMFB 4BR5A 4A59A 3TSPA 1L3VA 4A61A 1JLEA 3G4SN 3ZX2A 5AFUA 1KVAA 5K14A 4EZ6A 2QM1A 1HQEA 3V1OA 4H0TB 1IBLK 3JSMA 2RPIA 5DK5A 1ZC6A 1QHTA 5SZTA 5AQGA 1WSEA 3OYNA 3K58A 2G8HA 1Q81O 4DR7K 3AVMA 3DXKB 5AQUA 4M3ZA 4CECA 5AJ3K 1LCUA 3M5RA 5CY4A 1BA1A 1DKGD 4FLWA 2NRRA 3KLGA 3IG1A 5BPMA 3LP1A 5M1NA 1NU0A 4AHUA 1J53A 3F5TA 3OYEA 3TARA 5C10A 2OPRA 1ITGA 3SQ4A 3VF2A 2P9NA 3THWB 4Z94A 3TTCA 3P39A 4BRPA 1JKHA 3DLHA 1RILA 1VSIA 2Z1HA 1HNXK 2DFFA 4FPBA 3NH1A 5EVZA 4NLCA 4KHSA 1GLJO 4H4MA 1RDAA 1RBSA 2O8CB 1VSDA 2E1ZA 4JK9A 2A3ZA 2ZQBA 3ATUA 4DLGA 1ZBHA 3IS9A 4YOVA 1ASUA 1NK8A 1N36K 1TKDA 3AVKA 3ZT4A 4DR4K 3CJCA 4CJVA 4CJ4A 2D0BA 4R79A 4DQQA 1ZBIA 4YORA 1WNSA 1JLCA 4CZHA 4CERA 3C7NA 3MAQA 5GINA 1JLQA 3RMCA 2O8EB 1BIZA 1X9JA 3O1BA 1GLAG 2OPQA 4YHHK 1ASWA 1NNEA 3VESA 2HHVA 3O4QA 3LP3A 3FZMA 4DFKA 5GAEP 3EKSA 5KRTA 5FDLA 1QQCA 2F9WA 1VQLN 3OYFA 2GBZA 4I9QA 3CJAA 1T7PA 2G8FA 3I8BA 1WLJA 2KLAA 1T05A 1HQUA 1XC3A 4YOXA 4YOUA 2IAJA 1BOTO 5AQIA 4O44A 1HYVA 3OW2M 3NVMA 1B9FA 4OPJA 4JHDB 4M3UA 3ENOA 3LAMA 2YHWA 3UKRB 1B92A 2D0PA 4DSJA 1LWFA 2DTUA 3S3OA 3WXJA 2GTDA 3F2KA 1XHZA 4GV6A 4BC4A 3CETA 3DJCA 3I0RA 1X9WA 4DCHA 3DLRA 3DLGA 4Z4HA 4KH4A 5FPMA 3NE6A 1TK5A 3GL1A 4WCEL 4F3TA 4CCHA 2NRXA 3CQYA 3PX4A 1QSLA 3THWA 4AHTA 3T1AA 3V6DA 1S1TA 3O4WA 2D0AA 2ITMA 3VQ8A 3AO1A 1QSSA 3G0ZA 3HYFA 4J2AA 4JV5K 4IOAL 1D9FA 2E6LA 3PIOL 1BUPA 4LSNA 2UUBK 2VG6A 3DLBA 3FLCO 3B6OA 1T03A 3HT3A 3VEWA 3CCUN 4DTOA 4BGBA 3CCVN 3SZ2A 4BWJA 1NJZA 1E4GT 2HBLA 3QMLA 4E1MA 1LW0A 3D45A 4CJPA 4CHNA 4GVMA 4PHTX 3CCSN 4WQ4A 3O08A 5SWMA 3VQCA 3ZEUB 4B3TK 2GEMA 3LL3A 3H46O 2P9SB 2P9IA 3MCAB 5F2RA 4CD1A 3HK2A 4Y1DA 4CJ3A 3J80O 4KHYA 3KIOA 3K5OA 3TPQA 1JL1A 5BN9A 3WNEA 3KKRA 1TKTA 2Q0RA 4RW6A 4JS4A 4M63C 4FM0A 4CF0A 1NM1A 1YTUA 4JRPA 3RSEB 4BDZA 3SQ1A 4E1JA 1H1VA 4JS5A 5EXWA 4FW2A 3QEXA 3OYIA 2IVOA 4W5TA 3V9XA 5GAGP 1C1CA 1BL3A 3IDHA 5AQWA 4FLYA 5KQDA 2W6LA 1U48A 3AAQA 2KW4A 3KLEA 3WXIA 3V9WA 3O9SA 3O9UA 3OY9A 2ZWHA 5BPNA 4C8LA 1MDUB 2O8DA 2HMPA 1NWKA 3BF3A 4CBWA 3OYAA 3WNHA 4FJKA 2RHKA 3DXMA 3EZ5A 4E19A 3ULEA 1YF5L 5BRDA 4FK2A 4KKOA 5EOYA 4N56A 4FWOA 5AQXA 2YJEA 3SUNA 3UKRA 4CZJA 4K41A 2XO7A 4CZFA 2DPNA 3K2PA 1S1UA 4FWRA 3QFPA 3ISNC 1BI4B 1VQKN 1S5JA 3AVFA 3L3VA 4CIFA 3HPOA 3D0PA 3VEYA 3MWPA 4E7HA 3O9RA 5CHIA 3CMEN 3K59A 1EQYA 3S3NA 2E8AA 3F9MA 4E89A 5HL7L 4X64K 2E20A 1U2VB 3PSIA 2P9UA 4ISGA 3WUHA 2PAVA 2VGNA 5ELZA 3AVJA 2Q1NA 2HHSA 5E84A 1GLFO 2Q3SA 4JKAA 3SUOA 3SPZA 1GLDG 4FLXA 3O9QA 1BO5O 3J7AP 1WBDA 4F2RA 2HF3A 1P8ZA 5ADXA 3E66A 2FBYA 4WYBA 4BWMA 1EWRA 3O3GA 2HHQA 3VQ7A 4LF4K 1REVA 4FJGA 1YXQA 3ENBA 5EU7A 1WB9A 3MECA 3S9HA 4CBUA 3O3HA 3PV8A 1WSJA 3H1VX 4KHNA 4DR1K 1XQSC 2FC0A 4IBNA 5CE3A 3OYBA 1C0UA 3VGMA 3KK1A 2P9SA 3QDKA 2P9LB 3TTDA 4CI6A 1IBKK 1JJ2M 4W5OA 1S9EA 1NK9A 2O8BB 2G8UA 3MEGA 3OYLA 2YHBA 4KAZA 5DMRA 4B1VA 3RR7A 4M7YA 4LF7K 4B3RK 3I56N 2KFZA 1JCEA 1NKCA 4KTZA 3AVIA 4CW7B 2YNIA 3L0QA 1UA0A 4PKIA 4CZIA 3K9KA 4H0PA 1TUUA 2HVIA 3LANA 4BR0A 3E01A 1XMQK 4K43A 4DV3K 1S22A 3KVGA 4DLEA 3HZ6A 4Y0WA 4JKDA 3D7EO 4CGFA 3QNNA 3IKMA 5AQYA 1GLBG 4JYAK 3VEOA 3ZSRA 4GV9A 3RVCA 4CJ5A 4JRQA 4DV0K 4CESA 3VEZA 5LMUK 2QKKA 1Q7YO 4E7JA 1Q9XA 4H0OA 4JI2K 1ZBFA 2QWNA 3E9LA
chains in the Genus database with same CATH topology
1G99A 2HBJA 4YOYA 1BDGA 3E9PA 1VQNN 3EE9A 5DM7L 3M6GA 2V52B 4B1ZA 4BRIA 3H1QA 1MWMA 4JHDA 1MA9B 5TKWA 3O80A 3SAHA 2GWJA 4XH4A 1DT9A 3HTVA 3P31A 4H03B 3QBWA 1HPMA 1T6CA 2Q97A 4QS7A 3SMSA 3AGKA 3JXUA 2CGKA 2IIRA 3A5LC 4CZLA 5DM6L 2F9TA 2OTJN 5JVHL 2EWSA 2QA4N 2BUPA 4EIAA 1VQ7N 3CD6N 3M1FA 3D2EB 3VMFB 5C2DA 4BR5A 5GIOA 1U2VA 3CPWM 1V4SA 2CH6A 4A59A 3TSPA 4ISEA 4A61A 3DXMB 2WUSA 1OVYA 2KHOA 5EY4A 4J8FA 3G4SN 2E2NA 2E88A 4EAHD 2V51B 3ULEB 3ZX2A 5AFUA 1ZXOA 3VGKA 5M1PA 2QM1A 2P9PB 3R8EA 4H0TB 4BRGA 5JLFA 1YIJN 5AQZA 3LDOA 1KC8O 3LM2A 1ZC6A 5BRHA 2A40A 3VEXA 5AQKA 5AQGA 2Q2RA 3R9PA 2FSJA 1Q81O 4O8UA 2NNWA 1BWFO 3DXKB 5AQUA 5CR4A 1J6ZA 2YHXA 2NRWA 1LCUA 2QXLA 2WFBA 2GX9A 2W41A 3CIPA 3CPEA 3M5RA 2YJFA 1NGGA 5BPLA 1ATSA 1BA1A 4FL9A 3GG4A 1HX1A 5I9EB 4FWKA 3FFKB 1DKGD 4MO5A 1ZBSA 5BR9A 2NRRA 1K9MO 1T44A 4BRCA 2P9UB 5BPMA 4JD2B 3EO3A 4FWMA 1BG3A 3J8AA 3KZBA 5KPZA 5M1NA 3F5TA 5C10A 4H5VA 3PLAA 3G25A 5JICA 4I6MB 4BRQA 1VQON 2VWBA 1Q82O 3BUZB 5BN8A 3VF2A 3Q7BA 2P9NA 4Z94A 3TTCA 4CD3A 1QVFM 3D2FB 5F0XA 3MK6A 3P39A 3ZEUA 4UY8O 3MN5A 4BRPA 3N4QA 1K8KB 1Q86O 3MDQA 4FPBA 2OTLN 2VCPA 5EVZA 4GV3A 3VENA 5KPRA 4NLCA 4BR2A 4DB3A 3IUCA 2ZJQL 3I55N 4RWTA 1NLVA 3ID8A 1GLJO 3MCPA 1DGKN 4AF1A 2H3GX 3UKUA 4B1XB 4C1NI 3WEEA 1JCFA 2ZGYA 2E1YA 4CZKA 4GY2B 3O8MA 1TYQB 2A42A 4JKBA 2E1ZA 4JK9A 3RSEA 2A3ZA 3J7ZO 1RDUA 3ATUA 5AQFA 1NGAA 1WUAA 4A2AA 4YOVA 1VQ5N 1KAYA 1NGCA 4YOTA 1ATNA 3ID6A 4U67L 3CJ9A 4ILGB 4QS9A 1BU6O 4ILHA 1EO1A 5AQPA 3ZYYX 2YI1A 3CJCA 3OBYA 3VERA 3QBXA 4R79A 4JKCA 2PFUA 3CJBA 4O8KA 4YORA 1KD1O 2NRZA 2P9KB 3MX2A 4CZHA 4KH6A 4WFAL 2NLXA 2A41A 4B1WB 2FSKA 3ZETB 3C7NA 5GINA 3UB5A 4A57A 4BQZA 3LDLA 1HLUA 5BREA 3L6QA 1X9JA 2HBMA 1GLAG 3DAWA 3KWGA 3O1BA 4WQ5A 1O13A 1HJOA 2FSNA 2NRVA 2F7TA 2QW9A 4A62A 3HRGA 4WF9L 1VQ8N 5AQTA 2ASOA 3MWTA 3VESA 4RCHA 4BRNA 1YJNN 4JKEA 5AQNA 3VEVA 3FZMA 3O1WA 5AZIB 2RE2A 4H5TA 3CXCM 4ISFA 1P90A 4JKGB 3EKSA 5GAEP 4JEPA 3U9DA 3WT0A 2F9WA 1HKCA 1W97L 1VQLN 5AQMA 4CD1A 4BRKA 2VYPA 5EX5A 3VF4A 1Z6RA 3CJAA 4JK7A 3TSQA 5M1QA 4H0VB 5B8HA 3I8BA 2KLAA 4IO8A 1YJ9N 1QHAA 1XC3A 4JKFA 4YOXA 3H3NO 4WQ4C 4YOUA 3SK3A 3FZKA 1QQOA 4H0YB 1BOTO 5AQIA 3T7ZA 4B1YB 2NRHA 2QWLA 4ILJA 3UE5A 3CCMN 4OPAA 2FF3B 4BRAA 1M90O 3OW2M 3ZX3A 2YCHA 3NVMA 5AQRA 5BRFA 4JHDB 1QVGM 3VETA 3ENOA 3PIPL 2YHWA 3UKRB 4CZMA 3ZX0A 1YVNA 2D0PA 4DKWA 5JLHA 3WXJA 2GTDA 1SS6A 4IZ9A 3F2KA 4BRLA 4GV6A 3H6EA 3IFRA 4MLEA 2AA4A 3HI0A 3C6AA 1YUWA 4BC4A 5C0YA 3CETA 3DJCA 3QFUA 4XEIA 3SAFA 3EL2A 2PBDA 2KKZA 3AY9A 3OA9A 4DCHA 5F1XA 4BY9C 4KH4A 4QS8A 5FPMA 5AQHA 1QZ6A 4BC3A 4FWPA 4JD2A 4WQ5C 4BR7A 3CC7N 2W40A 2QWMA 3A0IX 3CI5A 3R1XA 2E2PA 4H5WA 3WQUA 3GL1A 4DHYA 5JVGL 4BROA 3T69A 3TU5A 4WCEL 2J4RA 5GIPA 5GAHP 3CC4N 2ZGZA 1SZ2A 4H0XB 3A5MC 2NRXA 3CQYA 2ASPA 1IJJA 3S41A 4DQ8A 1HKGA 1VAZA 4BRFA 4BGAA 4NLBA 4OPHA 5H1SQ 4MDBA 1K8KA 4GNIA 3SJHA 4WFNL 3O4WA 1VQ6N 1NGIA 2HOEA 2P9LA 2NZTA 3AAPA 3CQXA 2ITMA 3SBTA 3FZLA 2VGMA 2CGLA 2YHYA 3H45C 4IOAL 1Z05A 5FPNA 3C0BA 4HWIA 3W0LA 3PIOL 1BUPA 2QEXN 3CMAN 3HOSA 1RDWX 3FLCO 3G71N 1TYQA 3IMXA 1GLCG 2GELA 2CH5A 3VEWA 3CC2N 3JS6A 4IJNA 4YDUC 2ZJPL 3CCUN 4BGBA 1W2BM 4PL7A 3CCVN 1T6DA 3FGUA 4IWVA 4IFEA 3N4PA 1E4GT 2HBLA 4CJ7A 1V4TA 3QMLA 3GOIA 4BRDA 3CHWA 2E2OA 1YHQN 1X3MA 2P9NB 3HSCA 4C23A 4PHTX 4CZEA 4WQ4A 3HM8A 1CZAN 3O08A 4IDHA 2FF6A 3VPZA 3CCSN 1VQMN 3ZEUB 3EZWA 5LJWA 2D1KA 2GEMA 3BEXA 4IXCA 3LL3A 4AM6A 1YITN 2JWKA 3H46O 1RFQA 2P9SB 2P9IA 3MCAB 3B8AX 2BTFA 2QWQA 4FPAA 3EKUA 4H5RA 4HTLA 5MLCQ 2I7PA 2HF4A 3H3OB 3TPQA 3ZETA 5BN9A 1IG8A 2I7NA 1NMDA 2Q0RA 2D4WA 1JCGA 1Y64A 4M63C 4CZGA 4PL8A 3UKUB 3CCLN 5KQ8A 3WEEB 4NO7A 4BQLA 1NM1A 3FZHA 3RSEB 4E1JA 1H1VA 1KAXA 5EXWA 1C0FA 4OO1J 3MMVA 2IVOA 4MDAA 5AZIA 5TKYA 2FXUA 5GAGP 5AQJA 3A5NC 5M1OA 1ATRA 4FWLA 5M1KA 2IVNA 3IDHA 5AQWA 1X3NA 2V7YA 5AZJB 5KQDA 3AAQA 4BG9A 3WXKA 2WBNA 3HBTA 3WXIA 4CBXA 3HOTA 3O5BA 1NGHA 2GWKA 4U7BA 3O9SA 4JNEA 1Q18A 1KXPA 1HUXA 3KHYA 4JKHA 4WFBL 4JK8A 3O9UA 2ZWHA 5AQVA 3CJ1A 4KH5A 1MDUB 5BPNA 4IOCL 3D2EA 2HMPA 3OHRA 1NWKA 3I33A 3E1YA 3BF3A 1NGBA 4BRMA 4CBWA 1VQ9N 2RHKA 1NGEA 3DXMA 5AR0A 3C7NB 5FPEA 3FR0A 3KK7A 1YJWN 3ULEA 1YF5L 3ATVA 3LDNA 5BRDA 2E2QA 4O5FA 1SAZA 3FE1A 5EOYA 4MLHA 1U6ZA 2P9PA 4XH5A 2A5XA 4FWOA 3VF6A 5AQXA 2YJEA 5KPTA 3CCEN 4G9ZA 3Q7CA 3UKRA 1KQSM 5E26A 4CZJA 4K41A 4AM7A 3WQTA 5ADXH 4CZFA 3AARA 3L4QA 2DPNA 4BVPA 4FWRA 3P38A 2Q36A 1RGIA 4YDUA 3QFPA 4BC2A 3WXMB 1K8AO 4M7XA 1VQKN 4IOXA 2AP1A 3CF5L 1NBWA 5C15A 3CCRN 4YOWA 3QICA 3SLCA 1GLLO 1VQ4N 3DXKA 5AQOA 2Q0UA 3D6RA 3MWPA 3VEYA 1VQPN 2Q31A 3O9RA 5CHIA 3CMEN 1NGDA 3VOVA 4IEEA 1EQYA 4EFHA 2E8AA 3F9MA 5HL7L 3CCJN 1ILYA 4PKHA 4FWQA 2E20A 2GUPA 4EHUA 1U2VB 3AGRA 3OBWA 4BR9A 3QB0A 2P9UA 3G6EN 2QWPA 4ISGA 1BA0A 3U9ZA 4BC5A 3WUHA 1SQKA 2PAVA 2VGNA 3MN6A 5ELZA 2HBKA 2Q1NA 4A2BA 3KWIA 3TSUA 5AQQA 4I6MA 2D0OA 2ASMA 1E4FT 3M3ZA 5E84A 1GLFO 4JKAA 1M1KO 3E9OA 1QQMA 1GLDG 3D2FA 3O9QA 1BO5O 4FVUA 5LY3A 3A5OC 3O9TA 1GLEG 2HF3A 5HOOA 1P8ZA 3GBTA 4BREA 5ADXA 3TTFA 3E66A 4PKGA 3SMPA 4WYBA 2QWOA 3SAGA 2QWRA 4H5NA 2ZJRL 4EHTA 4FWSA 3DWLA 4K25A 2V7ZA 3C6HA 3U8XA 1OKJA 5M1FA 3CJ7A 4JN4A 4FWNA 3BP8A 1D4XA 1YXQA 3ENBA 4BRHA 1XUPO 4RTFD 4FOIA 2HSTA 4CBUA 3O6WA 3P4IA 2ZF5O 3EE8A 3MN9A 5F2RA 4L3QA 5LJVA 1NJIO 2JWLA 3H1VX 4FO0A 1XQSC 4A5AA 5CE3A 4XH1A 2BH1A 3SBGA 3VGLA 2QTDA 3VGMA 3VTHA 5AQLA 2P9SA 4KBOA 5AQSA 3QDKA 4A5BA 2P9LB 1HKBA 3TTDA 4CI6A 3CCQN 1T3VA 1JJ2M 1TUYA 2YX6A 3L4IA 1DEJA 2CGJA 3LDPA 1K73O 4FOEA 3MX5A 1YI2N 2P9KA 3R6MA 3CERA 4BVOA 4B1VA 1QQNA 3WXLA 4M7YA 3U4LA 3FZFA 4BR4A 3I56N 4IJAA 3A8YA 4LC9B 1JCEA 5C12A 3EN9A 4B9QA 5C2FA 3C65A 3K9JA 2A6AA 3NMUA 3L0QA 1ESVA 1NGJA 4PKIA 4CZIA 3K9KA 3DLLL 4H0PA 5FPDA 1N8RO 1TUUA 3LM9A 1QZ5A 3MN7A 4BR0A 5AZJA 3LDQA 1MWKA 2QI2A 5JMVA 4K43A 2FLOA 1R59O 1S22A 1YAGA 3KVGA 2UYTA 4IEIA 2WC9A 3HZ6A 4JKGA 4JKDA 4JAXA 2NRTA 4Y0WA 2P9IB 4BG8A 3D7EO 1WOQA 3R3LA 1LOTB 1KAZA 3IKMA 4C1NK 1C0GA 2OANA 5AQYA 1GLBG 3VTIA 4IO9L 3W3DA 3VEOA 4F9OA 4GV9A 3RVCA 2IVPA 5AFUH 4NB4A 3GDQA 1NGFA 3VEZA 3BF1A 3ENHA 3GE1A 1Q7YO 1S3XA 4GVEA 4K42A 5GADP 3NVKA 4H0OA 4MO4A 1S72N 4B1UB 2QWNA 3E9LA 4FSVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EE9 A;  4OPA A;  3P31 A;  3L4Q A;  3KWI A;  3P38 A;  3F5T A;  3O9S A;  3RVC A;  3EE8 A;  3O9U A;  4OPH A;  3O9Q A;  3D6R A;  3O9T A;  3O9R A;  2RHK A;  3P39 A;  2KKZ A;  3OA9 A;  2GX9 A;  3KWG A;  3M5R A; 
#chains in the Genus database with same CATH topology
 1X9S A;  1OH8 A;  4OLB A;  1BDG A;  5DM7 L;  5HP1 A;  4LY7 A;  4M3X A;  2EHG A;  3F9K A;  1KVB A;  2GWJ A;  4CK2 A;  2YNG A;  4XH4 A;  4NCB A;  1DT9 A;  4DV7 K;  4CHO A;  4CED A;  1T6C A;  4JI8 K;  3JXU A;  3NGY A;  5DM6 L;  4CZL A;  2QA4 N;  5J2M A;  3M1F A;  4AHR A;  1U2V A;  1IKX A;  1IO2 A;  2VG7 A;  3PY8 A;  4LFC K;  5EY4 A;  1WSG A;  4EAH D;  1W0H A;  3LDS A;  1TKX A;  4FJH A;  3HST B;  3VGK A;  2P9P B;  3R8E A;  3LDO A;  2RN2 A;  1KC8 O;  4DS4 A;  3LM2 A;  2VG5 A;  4CIG A;  1B9D A;  3R9P A;  4CEF A;  1S1W A;  4NYF A;  1BWF O;  1RBV A;  2YHX A;  1SL1 A;  3L2W A;  2Z1G A;  3CIP A;  3QET A;  4CGD A;  3AVG A;  3T1Y K;  4F3O A;  4FL9 A;  3GG4 A;  2AJQ A;  1HNV A;  1HX1 A;  2D5R A;  5BR9 A;  3THY B;  4CJT A;  3KZB A;  2YNF A;  1EET A;  3PX6 A;  4H5V A;  4AHC A;  1I39 A;  3G25 A;  5JIC A;  1VQO N;  3PO4 A;  3BUZ B;  3D2F B;  4JI6 K;  4UY8 O;  3MN5 A;  1RNH A;  2O8B A;  5KI6 A;  3PUF A;  4XIU A;  2ZJQ L;  3ZLJ A;  4DR2 K;  3OYK A;  1DGK N;  4C1N I;  1JCF A;  2E1Y A;  4PQU A;  4JKB A;  4WE1 A;  1RDU A;  3EYZ A;  1NGC A;  1ATN A;  3ID6 A;  1IH7 A;  5C25 A;  2JLE A;  3KLI A;  1BU6 O;  3V1Q A;  2DY4 A;  3ZYY X;  2YI1 A;  4DFM A;  3OBY A;  3NF7 A;  4JKC A;  4ZTJ A;  4O8K A;  3M8P A;  4B08 A;  2NRZ A;  5HRP A;  1IV0 A;  4WFA L;  4F4K A;  1CXU A;  4IKF A;  3LAK A;  5J1E A;  1GOB A;  1RBR A;  1NKB A;  3UB5 A;  1L3T A;  4A57 A;  4BQZ A;  3LDL A;  4HUF A;  2ITG A;  4M3W A;  1S9G A;  2FSN A;  2NRV A;  2QW9 A;  1VQ8 N;  3HRG A;  3VQD A;  4DV4 K;  3MWT A;  3RRG A;  4RCH A;  1YJN N;  4JKE A;  2G8K A;  4NXN K;  3VEV A;  3O1W A;  3SCX A;  3QEI A;  3CXC M;  1P90 A;  4JKG B;  1RTD A;  1XC9 A;  4MQ3 A;  1W97 L;  1ASV A;  1Z6R A;  2E5L K;  5FRM A;  3ZT2 A;  5B8H A;  3HP6 A;  1VSM A;  2B4J A;  4JKF A;  2YV0 X;  1A5V A;  3H3N O;  3SK3 A;  3FZK A;  4B9L A;  2BAN A;  5C24 A;  1ZBU A;  4B1Y B;  4ILJ A;  3CCM N;  4BRA A;  2YCH A;  1HNI A;  1S1V A;  1QVG M;  3ZSW A;  3PIP L;  4FXD A;  3K5N A;  1NKE A;  1YVN A;  5JLH A;  3QEP A;  2RF2 A;  1SS6 A;  4IZ9 A;  4MLE A;  5C0Y A;  3SAF A;  3EL2 A;  2KKZ A;  3AVN A;  3AY9 A;  3OA9 A;  4PWD A;  4CJQ A;  4KTW A;  1A5W A;  4B8C A;  5AQH A;  1QZ6 A;  3CC7 N;  3ALY A;  4HVJ A;  3THY A;  2W40 A;  3R1X A;  3CI5 A;  3NH0 A;  2E4L A;  4JI1 K;  4BRO A;  3T69 A;  4AHS A;  3P5J A;  3SPY A;  1NOZ A;  1J9A A;  3A5M C;  1IJJ A;  4LF8 K;  3S41 A;  1HKG A;  3VQA A;  4FCY A;  4NLB A;  5H1S Q;  4MDB A;  4I7F A;  1Z25 A;  3SJH A;  4WFN L;  1TK8 A;  1VQ6 N;  2HMI A;  1BGX T;  1I94 K;  4KTQ A;  2YHY A;  3H45 C;  4PA1 A;  1Z05 A;  4DR6 K;  3C0B A;  4Q5V A;  3W0L A;  1RT3 A;  2QEX N;  3OYD A;  3AA5 X;  3CFO A;  2KQ2 A;  2CH5 A;  3FFI A;  1VRU A;  3HL8 A;  3SV3 A;  4CF1 A;  3CC2 N;  3DOK A;  3JS6 A;  4IJN A;  2ZJP L;  3SUQ A;  1HR0 K;  4DFP A;  3FGU A;  4IWV A;  4CEZ A;  3N4P A;  3KK2 A;  4BRD A;  3CHW A;  1FW6 A;  4B9N A;  1X3M A;  2KFN A;  3HM8 A;  1CZA N;  4IDH A;  3VPZ A;  3S3M A;  4N47 A;  3BEX A;  3LWL A;  4AM6 A;  1YIT N;  1L5U A;  2JWK A;  4FPA A;  1Z26 A;  3QES A;  2I7N A;  1NMD A;  4AH9 A;  4CZG A;  3NGZ A;  4PL8 A;  3UKU B;  3VQ4 A;  3WEE B;  4BDP A;  3BZC A;  5C42 A;  3MXJ A;  3NF8 A;  4E7K A;  2F96 A;  5HBM A;  1TL1 A;  4RW9 A;  2PYL A;  2G8V A;  4ELT A;  3VQ9 A;  1C0F A;  1IKV A;  3PO5 A;  4MDA A;  2E6M A;  3ASM A;  5M1O A;  2B6A A;  4FWL A;  2YNH A;  4CE9 A;  2V7Y A;  5AZJ B;  3AO4 A;  3WXK A;  2WBN A;  3HOT A;  4OLA A;  3EEQ A;  3HPG A;  1WAF A;  1Q18 A;  4JKH A;  4OKK A;  1LWC A;  3OJU A;  3OHR A;  1WSI A;  4HUE A;  4BRM A;  1VQ9 N;  3ZT3 A;  4FJ7 A;  1NGE A;  3RTV A;  2O4G A;  3KK7 A;  4JI5 K;  3ATV A;  4CF8 A;  2E2Q A;  5FRN A;  3V1R A;  3BGR A;  4HTU A;  4MLH A;  5KPT A;  3CCE N;  4G9Z A;  4B9M A;  5E26 A;  1U04 A;  3T1H K;  3VQE A;  3L4Q A;  2B5J A;  3P38 A;  1RGI A;  3T3F A;  4ICL A;  1TV6 A;  3CF5 L;  3SLC A;  3DXK A;  1VQP N;  3AA2 A;  1J54 A;  1RBT A;  4V19 S;  1NGD A;  4IEE A;  3NCI A;  2XHB A;  4FWQ A;  1Q9Y A;  3SUP A;  1N32 K;  4BR9 A;  1XMO K;  1HRH A;  3J81 O;  4E0D A;  4KO0 A;  1ZYQ A;  4A2B A;  4FZZ A;  5AQQ A;  1T8E A;  1UOC A;  2ASM A;  3LAL A;  3M3Z A;  1SL0 A;  3E9O A;  1QQM A;  5KGW A;  3BZK A;  3SV4 A;  4FVU A;  5LY3 A;  1KTQ A;  2O4I A;  1GLE G;  4YNQ A;  2FBT A;  5I3U A;  1YTA A;  4B9S A;  4PKG A;  3SMP A;  4DTP A;  2UUA K;  3SAG A;  2QWR A;  2ZJR L;  4DTN A;  2I5J A;  2V7Z A;  3C6H A;  4KRE A;  3CJ7 A;  2HHH K;  2O8C A;  4BRH A;  1U4B A;  2P1J A;  4FOI A;  2HST A;  2UXD K;  3P4I A;  3MN9 A;  1NJI O;  1RCH A;  3RRH A;  4XH1 A;  4GKJ K;  3NDK A;  5AQL A;  3RMA A;  1WSF A;  2YX6 A;  3L4I A;  2EX3 A;  4CFA A;  4FOE A;  4CF2 A;  2Y1I A;  3LPU A;  3MX5 A;  3R6M A;  1GOC A;  1QQN A;  3C6T A;  2HHU A;  4EZ9 A;  1RBU A;  3L2U A;  4BR4 A;  3TAF A;  4LC9 B;  5C2F A;  3EN9 A;  1ZBL A;  3C65 A;  3K9J A;  2A6A A;  2O8E A;  3DLL L;  1X1P A;  3QLH A;  1OH6 A;  1JLB A;  3OYM A;  1FKO A;  3MN7 A;  5AZJ A;  3LDQ A;  5JMV A;  2PYJ A;  4IEI A;  3AVC A;  1WOQ A;  3R3L A;  1KAZ A;  4JI7 K;  4IO9 L;  5AFU H;  3AA4 A;  3B6P A;  3AVA A;  1S3X A;  4GVE A;  4K42 A;  1QS4 A;  5GAD P;  3LZJ A;  4MO4 A;  2XY7 A;  3L2V A;  4J2B A;  4M3T A;  3HM9 A;  4LF6 K;  1U49 A;  3EE9 A;  3M6G A;  3H1Q A;  1EXQ A;  4JHD A;  3SAH A;  3O80 A;  3HTV A;  3RMD A;  1NJW A;  4Z0U A;  3SMS A;  2CGK A;  4E3S A;  3A5L C;  4CHP A;  1NK4 A;  2OTJ N;  2EWS A;  3IAY A;  5CYQ A;  2FBX A;  1D9D A;  4LFA K;  3CD6 N;  3D2E B;  3PSF A;  5C2D A;  5GIO A;  1V4S A;  2XY8 A;  4CJR A;  1OVY A;  4J8F A;  1YVU A;  2E2N A;  2E88 A;  1ZXO A;  3QO9 A;  4GMJ B;  3G10 A;  4DV1 K;  1QE1 A;  5I42 A;  1RT7 A;  4B9U A;  3AVH A;  4LD0 A;  2VWK A;  4DTJ A;  5AQZ A;  5BRH A;  4CVN E;  2A40 A;  4DUY K;  3VEX A;  3OJS A;  2FSJ A;  3V4I A;  2Z1I A;  3HVT A;  4O8U A;  4KI4 A;  3AO2 A;  2QXL A;  2WFB A;  2GX9 A;  3SYZ A;  4GKK K;  2BE2 A;  5BPL A;  3HVR A;  5CYM A;  1MU2 A;  3HPH A;  5I9E B;  4FWK A;  3THX B;  4MO5 A;  3AA3 A;  1T44 A;  1JLG A;  4BRC A;  4JD2 B;  4FWM A;  1BG3 A;  5KPZ A;  1VHX A;  2HHW A;  3PLA A;  4I6M B;  4BRQ A;  2VWB A;  1Q82 O;  1JXE A;  4IFY A;  5BN8 A;  3Q7B A;  3MK6 A;  3ZEU A;  3TWH A;  1IKW A;  1K8K B;  1Q86 O;  2BGG A;  2IDO A;  3MDQ A;  1WBB A;  1OH7 A;  2VCP A;  4GV3 A;  2HHX A;  5KPR A;  4BR2 A;  3IUC A;  2Y1J A;  4M45 A;  3ID8 A;  4JLH A;  4AF1 A;  1W9H A;  2F8T A;  4CZK A;  2ZGY A;  3O3F A;  4GY2 B;  3O8M A;  1TYQ B;  2A42 A;  3NFA A;  3RSE A;  3J7Z O;  3HJF A;  5AQF A;  1WUA A;  4KV8 A;  5LL6 Z;  4CK3 A;  3DYA A;  1VQ5 N;  3JYT A;  4YOT A;  1EX4 A;  3CJ9 A;  4ILG B;  4ILH A;  5JS2 A;  2O8F B;  3DMJ A;  4DQR A;  4Q0B A;  4FJ9 A;  4HUG A;  2P9K B;  3MX2 A;  4KH6 A;  2NLX A;  2FSK A;  3ZET B;  3L8B A;  5CZ2 A;  4I2Q A;  5BRE A;  3L6Q A;  2NUB A;  4JI0 K;  3QNO A;  3DAW A;  4WQ5 A;  4CGH A;  1O13 A;  2F7T A;  4A62 A;  2ASO A;  4Z4E A;  1O1W A;  4YFU A;  1WAJ A;  5AZI B;  2RE2 A;  4H5T A;  1BI4 A;  4FYD A;  4JI3 K;  3U9D A;  3WT0 A;  1BCO A;  5HRS A;  5AQM A;  4BRK A;  4CJS A;  1CZ9 A;  2VYP A;  5EX5 A;  3VF4 A;  2PZS A;  3TSQ A;  1SKS A;  4CHZ A;  3OTO K;  1S6Q A;  4IO8 A;  1YJ9 N;  1QHA A;  1VSH A;  2IC3 A;  3F73 A;  2OZS A;  1QQO A;  4H0Y B;  2ATQ A;  3T7Z A;  2QWL A;  3UE5 A;  4ZTF A;  4LFB K;  4OPA A;  1M90 O;  3NBP A;  1XNR K;  3TR8 A;  1JLF A;  5HRN A;  1TAQ A;  4CZM A;  3ZX0 A;  3QER A;  1QSY A;  4DKW A;  3H6E A;  1JXB A;  2AA4 A;  3HI0 A;  1YUW A;  4XEI A;  5KGX A;  3OYJ A;  3CFR A;  5F1X A;  3LZI A;  4QS8 A;  4BC3 A;  4FWP A;  4JD2 A;  4WQ5 C;  4BR7 A;  3WQU A;  4H5W A;  5JVG L;  2J4R A;  3ZT1 A;  2P51 A;  2ASP A;  4DQ8 A;  4BRF A;  4DQP A;  4LF9 K;  4FJ8 A;  4FK4 A;  3NGI A;  4OPH A;  1XI1 A;  1EP4 A;  4DU4 A;  4DF8 A;  1K8K A;  4GNI A;  3VQQ A;  2HOE A;  2P9L A;  3CQX A;  4Z4F A;  4RW8 A;  3SBT A;  4FM2 A;  1SKR A;  2PY5 A;  3LP2 A;  3CMA N;  2OCE A;  1RDW X;  1TYQ A;  3IMX A;  2GEL A;  4YDU C;  3QIO A;  4BAC A;  1TKZ A;  4YY3 K;  4PL7 A;  1T6D A;  3VQ6 A;  4IFE A;  4KFB A;  4CJ7 A;  4O0I A;  1V4T A;  4BE1 A;  4FJI A;  2E2O A;  3RWU A;  2P9N B;  4C23 A;  4O55 A;  3BDP A;  3EZW A;  5LJW A;  2D1K A;  4CEB A;  4LSL A;  3B8A X;  5E41 A;  3EKU A;  4H5R A;  2I7P A;  2HF4 A;  3H3O B;  3MED A;  4NCA A;  4IFV A;  3K0S A;  3ZET A;  1IG8 A;  3KD5 E;  1TGO A;  4RW4 A;  3WNG A;  5KQ8 A;  5IWA K;  1RTI A;  4NO7 A;  4BQL A;  4FLV A;  4O4G A;  5A2Q O;  3AVB A;  1NK5 A;  4DTM A;  4DSF A;  1XWL A;  2OPP A;  4B3M K;  4MFB A;  3MMV A;  4J2E A;  5AZI A;  5TKY A;  2FXU A;  1NJX A;  3A5N C;  3A2F A;  5M1K A;  3TI0 A;  4CF9 A;  3KTQ A;  2QK9 A;  2GWK A;  4U7B A;  3OYC A;  4JNE A;  4N41 A;  1Y97 A;  1IG9 A;  5AQV A;  4IOC L;  4DF4 A;  2HW3 A;  3I33 A;  3E1Y A;  1NGB A;  3K57 A;  2P5G A;  3C7N B;  5FPE A;  4DSE A;  3FR0 A;  1NK7 A;  1N33 K;  4FW1 A;  4DWI A;  1SAZ A;  1NK6 A;  3FE1 A;  1VK0 A;  3OVN A;  4KI6 A;  2P9P A;  4XH5 A;  3V9Z A;  2A5X A;  3VF6 A;  1D5A A;  3Q7C A;  4DR5 K;  4AM7 A;  3KLF A;  5ADX H;  3AAR A;  4BVP A;  2Q36 A;  1K8A O;  4IOX A;  2AP1 A;  4DU1 A;  1NBW A;  3CCR N;  3QIC A;  1GLL O;  1VQ4 N;  5AQO A;  2Q0U A;  1X9M A;  4FZX C;  2Q31 A;  1GOA A;  4M41 A;  3VOV A;  4EFH A;  3CCJ N;  1ILY A;  3ZT0 A;  4DU3 A;  3WNF A;  1DLO A;  3AGR A;  3OBW A;  2A1R A;  4BE0 A;  1G15 A;  4W5N A;  2QWP A;  1I3A A;  4X62 K;  1BA0 A;  2X78 A;  4BC5 A;  4KB0 A;  1KVC A;  3HO1 A;  2D0O A;  2ZD1 A;  4C8O A;  1LW2 A;  2RKI A;  3D2F A;  3VA0 A;  3QIP A;  5J2P A;  1UA1 A;  3V9U A;  3O9T A;  1R0A A;  3GBT A;  3TTF A;  4CHQ A;  4K8X A;  4LH4 A;  2QWO A;  4EHT A;  4RG8 A;  4FWS A;  3DWL A;  1OKJ A;  1J5E K;  4DV5 K;  4FWN A;  1D4X A;  3I8D A;  4RTF D;  3ITH A;  2UU9 K;  3O6W A;  2ZF5 O;  2OYQ A;  4L3Q A;  1VSE A;  5LJV A;  2GUI A;  5LMN K;  3V81 A;  2BH1 A;  3SBG A;  2QKB A;  2A1S A;  2QTD A;  4FM1 A;  1J5O A;  1KFS A;  5AQS A;  4A5B A;  5FLX O;  1K73 O;  2KZM A;  4DTU A;  1C1B A;  3CER A;  4BVO A;  3QEV A;  4ID1 A;  4IJA A;  3K5L A;  1XHX A;  4B9Q A;  1RT6 A;  4DSK A;  3V9S A;  3PX0 A;  5FPD A;  4FLT A;  1MWK A;  4CJE A;  2HND A;  4B8A B;  1R59 O;  1SV5 A;  3HP9 A;  4JKG A;  1NK0 A;  2NRT A;  3ZSX A;  2P9I B;  1DTT A;  3SI6 A;  4DSL A;  3SQ0 A;  1D8Y A;  4C1N K;  1C0G A;  2OAN A;  2YHA A;  3H08 A;  3VTI A;  2F8S A;  4F9O A;  1N6Q A;  1EWQ A;  4NB4 A;  4OKJ A;  1LWE A;  1NGF A;  4CGJ A;  3BF1 A;  4BDY A;  4RW7 A;  3MXM A;  4NXM K;  3C6U A;  1SKW A;  3UIQ A;  3VQ5 A;  3NVK A;  5IT9 O;  4B1U B;  1VSF A;  4FSV A;  4CJL A;  1VSK A;  4YOY A;  2V52 B;  1MWM A;  5TKW A;  2VWJ A;  3VN5 A;  3QBW A;  1HPM A;  3OS0 A;  2IIR A;  3CYM A;  1NJY A;  4F8R A;  1KCF A;  1RT5 A;  2F9T A;  2BUP A;  3ZSY A;  4OJR A;  1VRT A;  2O8D B;  1C1A A;  3CPW M;  3ZSQ A;  1FXX A;  3TAN A;  2CH6 A;  2WOM A;  4ISE A;  3DXM B;  2WUS A;  1S6P A;  2KHO A;  4ELV A;  3CFP A;  2V51 B;  4ELU A;  2FBV A;  3ULE B;  3OS2 A;  1BCM A;  5M1P A;  4E7L A;  4BRG A;  5JLF A;  1YIJ N;  1LAV A;  4Z4G A;  4FJX A;  5AQK A;  1E3M A;  2Q2R A;  3QEW A;  1TL3 A;  2NNW A;  5CR4 A;  1J6Z A;  2NRW A;  1NMN A;  2W41 A;  3CPE A;  2YJF A;  1NGG A;  1ATS A;  1RTJ A;  1DTQ A;  4B9T A;  3FFK B;  1ZBS A;  1K9M O;  2P9U B;  4DFJ A;  1RDC A;  3EO3 A;  4FJM A;  3J8A A;  2XY5 A;  3DLE A;  1L3U A;  1S1X A;  4CEQ A;  3AV9 A;  4FVM A;  5BR8 K;  3OYG A;  4DMN A;  4CD3 A;  1QVF M;  5F0X A;  4C8N A;  3N4Q A;  1JLA A;  1RDD A;  2GV9 A;  2OTL N;  4DSI A;  3VEN A;  4B3S K;  4DB3 A;  3I55 N;  1FJG K;  2LSN A;  4RWT A;  3DLK A;  4E7I A;  1NLV A;  1N5Y A;  3U3G A;  3MCP A;  4B1X B;  2H3G X;  3UKU A;  4KHU A;  3WEE A;  2DFH A;  4M3R A;  3P83 D;  2WTU A;  2YKM A;  4JI4 K;  1NGA A;  1F21 A;  3NAE A;  3U6F A;  4LF5 K;  4A2A A;  1KAY A;  3DRS A;  4OGC A;  1C0M A;  2IOC A;  4U67 L;  4QS9 A;  1IKY A;  1EO1 A;  5AQP A;  3VER A;  3QBX A;  4Z4I A;  3NHG A;  2PFU A;  3CJB A;  1KD1 O;  2HNY A;  2A41 A;  3VQP A;  4B1W B;  4DS5 A;  3NH2 A;  1HJR A;  4HCB A;  1HLU A;  2HBM A;  3KWG A;  3ZCM A;  1HJO A;  4WF9 L;  3OS1 A;  5AQT A;  4LH5 A;  2W42 A;  4OVL A;  4BRN A;  4IG0 A;  5AQN A;  4X65 K;  4I2P A;  4DV2 K;  1A5X A;  2VQE K;  4ISF A;  3LWM A;  5HRO A;  2HB5 A;  1KLN A;  4JEP A;  4B3O A;  1HKC A;  4CEE A;  3CG7 A;  3J7Y P;  1TVR A;  4JK7 A;  4DTX A;  5M1Q A;  4H0V B;  2KTQ A;  1JL2 A;  3KJV A;  2OPS A;  4C8M A;  3QIN A;  4WQ4 C;  4CFB A;  3KD1 E;  1HNW K;  3THV A;  2NRH A;  2G8I A;  1SL2 A;  2FF3 B;  3ZX3 A;  3ZSV A;  1L3S A;  4KB1 A;  5AQR A;  5BRF A;  3VET A;  1W7A A;  2WON A;  4DQS A;  4R5P A;  4CGG A;  4BRL A;  3TAP A;  3IFR A;  3L3U A;  3C6A A;  4DTS A;  4CGI A;  4Y1C A;  3QFU A;  1KRP A;  1TK0 A;  1HMV A;  2PBD A;  4ID5 A;  1HPZ A;  1UAX A;  4BY9 C;  3RMB A;  1CXQ A;  4N5S A;  2QWM A;  3A0I X;  2DFE A;  4DHY A;  2E2P A;  4FJJ A;  4Z4C A;  2G8W A;  3TU5 A;  3DOL A;  5GIP A;  3SNN A;  5GAH P;  3CC4 N;  2ZGZ A;  1SZ2 A;  4H0X B;  4CHY A;  4PY5 A;  2IGI A;  3C95 A;  3DRR A;  1VAZ A;  4BGA A;  3M8R A;  4HCC A;  4L8R B;  1UWB A;  1C0T A;  1NGI A;  2NZT A;  3AAP A;  2IS3 A;  2YKN A;  3FZL A;  1WSH A;  2VGM A;  3CM6 A;  2CGL A;  3HXM A;  1TAU A;  1VSL A;  5FPN A;  4HWI A;  4AQY K;  3DM2 A;  1LV5 A;  3HOS A;  3G71 N;  4K8Z A;  4IDK A;  1GLC G;  4CJK A;  4OPK A;  2QXF A;  1EKE A;  4CJF A;  1W2B M;  4QAG A;  1RT1 A;  4FJ5 A;  2UXB K;  1KSP A;  3GOI A;  4C8K A;  1YHQ N;  1RT2 A;  3HSC A;  4FZY A;  4CZE A;  4H8K A;  1VQM N;  2FF6 A;  2ETJ A;  4IXC A;  1RFQ A;  1XNQ K;  4EP5 A;  2BTF A;  2QWQ A;  5MLC Q;  4HTL A;  4KHQ A;  2OA8 A;  4FJN A;  3L2R A;  4HHT A;  2D4W A;  1JCG A;  1Y64 A;  3CCL N;  2W6K A;  3AO3 A;  3BY5 A;  3KLH A;  3FZH A;  4FLZ A;  5D3G A;  1KAX A;  4OO1 J;  5AQJ A;  1ATR A;  1U45 A;  2IVN A;  4G1Q A;  1X3N A;  4BG9 A;  1K6Y A;  3HBT A;  4CBX A;  3O5B A;  1NGH A;  2KZZ A;  1KXP A;  1HUX A;  4I9L A;  1HYS A;  3KHY A;  1CLQ A;  4WFB L;  4JK8 A;  1N34 K;  2R7Y A;  3LPT A;  3CJ1 A;  4KH5 A;  3D2E A;  5KRS A;  4QOZ B;  1OH5 A;  4CFC A;  5AR0 A;  4GW6 A;  5KTQ A;  2Z1J A;  4PUO A;  3VQB A;  1YJW N;  3LDN A;  3AVL A;  3LP0 A;  4ZHR A;  4O5F A;  4K0K K;  4TSX A;  3MXI A;  1U6Z A;  2ZE2 A;  4AIL C;  1BIS A;  4M42 A;  1CZB A;  1KQS M;  1HNZ K;  3WQT A;  4W5Q A;  2OZM A;  1RT4 A;  2UXC K;  1IBM K;  4YDU A;  4BC2 A;  3WXM B;  1FKP A;  4M7X A;  4FJL A;  5C15 A;  4YOW A;  4OKE A;  3D6R A;  4QCL A;  3T19 A;  1NOY A;  4KRF A;  1FK9 A;  4PKH A;  2GUP A;  3THX A;  4AHV A;  4EHU A;  2JGU A;  4IG3 A;  3QB0 A;  3G6E N;  1Q8I A;  3CQ8 A;  3U9Z A;  1SQK A;  5FRO A;  3MN6 A;  3VA3 A;  2HBK A;  1OVQ A;  3TAQ A;  2X74 A;  3KWI A;  3TAG A;  3TSU A;  4I6M A;  4E1N A;  4CK1 A;  3TAB A;  1E4F T;  1M1K O;  4KHW A;  4CJW A;  5T7B A;  3KK3 A;  3AO5 A;  3EY1 A;  3A5O C;  4M3Y A;  3SJJ A;  5HLF A;  4O5B A;  5HOO A;  4CEA A;  4BRE A;  3MEE A;  5J2N A;  5HRR A;  3NF6 A;  5JS1 A;  1RDB A;  2XRI A;  4DQI A;  2BDP A;  4H5N A;  1BQM A;  4CFD A;  4DR3 K;  3P1G A;  3ZSO A;  3RR8 A;  4K25 A;  5CZ1 A;  3U8X A;  5M1F A;  4F2S A;  4JN4 A;  3BP8 A;  1XUP O;  1KLM A;  1BQN A;  3EE8 A;  4OGE A;  3NF9 A;  3TAE A;  2JWL A;  4FO0 A;  4NYN A;  1BIU A;  4A5A A;  3VGL A;  4B9V A;  1U47 A;  3VTH A;  1QTM A;  4KBO A;  1SUQ A;  3CM5 A;  2P5O A;  4DG1 A;  1HKB A;  2O8F A;  3CCQ N;  1C6V A;  1T3V A;  1TUY A;  2ZM6 K;  1YT3 A;  3LDP A;  1DEJ A;  2CGJ A;  4OX9 K;  2X6N A;  1YI2 N;  2HNZ A;  2P9K A;  3WXL A;  4O0J A;  3M8S A;  4CIE A;  3U4L A;  3FZF A;  4DV6 K;  2HHT A;  3ZSZ A;  3A8Y A;  5C12 A;  3I0S A;  4EP4 A;  4W5R A;  3K5M A;  3NMU A;  1ESV A;  1NGJ A;  5J2Q A;  1N8R O;  2D0C A;  3LM9 A;  3O4N A;  1QZ5 A;  4BE2 A;  3JAM O;  4KPY A;  1WN7 A;  1KFD A;  2QI2 A;  3KKS A;  1HYZ A;  2VQF K;  2FLO A;  4KHP K;  1YAG A;  2UYT A;  2WC9 A;  4JAX A;  4BG8 A;  2HVH A;  1LOT B;  3ULD A;  3C94 A;  2X6S A;  3SQ2 A;  4X66 K;  3W3D A;  2IVP A;  3L2Q A;  3M8Q A;  3GDQ A;  4NCG A;  3DI6 A;  3ENH A;  3GE1 A;  4DTR A;  2F4V K;  1S72 N;  4FK0 A;  1G99 A;  3DRP A;  3IRX A;  2HBJ A;  3TAM A;  3E9P A;  1RTH A;  1VQN N;  4CJU A;  4UQG A;  4B1Z A;  4BRI A;  4J2D A;  1MA9 B;  4H4O A;  1BHL A;  1NG9 A;  4FLU A;  4DUZ K;  3P31 A;  4H03 B;  2Q97 A;  4QS7 A;  4CEO A;  1VSJ A;  3AGK A;  3U3Y A;  2UUC K;  2XY6 A;  4N76 A;  5JVH L;  1LAW A;  4EIA A;  3OYH A;  1VQ7 N;  3VMF B;  4BR5 A;  4A59 A;  3TSP A;  1L3V A;  4A61 A;  1JLE A;  3G4S N;  3ZX2 A;  5AFU A;  1KVA A;  5K14 A;  4EZ6 A;  2QM1 A;  1HQE A;  3V1O A;  4H0T B;  1IBL K;  3JSM A;  2RPI A;  5DK5 A;  1ZC6 A;  1QHT A;  5SZT A;  5AQG A;  1WSE A;  3OYN A;  3K58 A;  2G8H A;  1Q81 O;  4DR7 K;  3AVM A;  3DXK B;  5AQU A;  4M3Z A;  4CEC A;  5AJ3 K;  1LCU A;  3M5R A;  5CY4 A;  1BA1 A;  1DKG D;  4FLW A;  2NRR A;  3KLG A;  3IG1 A;  5BPM A;  3LP1 A;  5M1N A;  1NU0 A;  4AHU A;  1J53 A;  3F5T A;  3OYE A;  3TAR A;  5C10 A;  2OPR A;  1ITG A;  3SQ4 A;  3VF2 A;  2P9N A;  3THW B;  4Z94 A;  3TTC A;  3P39 A;  4BRP A;  1JKH A;  3DLH A;  1RIL A;  1VSI A;  2Z1H A;  1HNX K;  2DFF A;  4FPB A;  3NH1 A;  5EVZ A;  4NLC A;  4KHS A;  1GLJ O;  4H4M A;  1RDA A;  1RBS A;  2O8C B;  1VSD A;  2E1Z A;  4JK9 A;  2A3Z A;  2ZQB A;  3ATU A;  4DLG A;  1ZBH A;  3IS9 A;  4YOV A;  1ASU A;  1NK8 A;  1N36 K;  1TKD A;  3AVK A;  3ZT4 A;  4DR4 K;  3CJC A;  4CJV A;  4CJ4 A;  2D0B A;  4R79 A;  4DQQ A;  1ZBI A;  4YOR A;  1WNS A;  1JLC A;  4CZH A;  4CER A;  3C7N A;  3MAQ A;  5GIN A;  1JLQ A;  3RMC A;  2O8E B;  1BIZ A;  1X9J A;  3O1B A;  1GLA G;  2OPQ A;  4YHH K;  1ASW A;  1NNE A;  3VES A;  2HHV A;  3O4Q A;  3LP3 A;  3FZM A;  4DFK A;  5GAE P;  3EKS A;  5KRT A;  5FDL A;  1QQC A;  2F9W A;  1VQL N;  3OYF A;  2GBZ A;  4I9Q A;  3CJA A;  1T7P A;  2G8F A;  3I8B A;  1WLJ A;  2KLA A;  1T05 A;  1HQU A;  1XC3 A;  4YOX A;  4YOU A;  2IAJ A;  1BOT O;  5AQI A;  4O44 A;  1HYV A;  3OW2 M;  3NVM A;  1B9F A;  4OPJ A;  4JHD B;  4M3U A;  3ENO A;  3LAM A;  2YHW A;  3UKR B;  1B92 A;  2D0P A;  4DSJ A;  1LWF A;  2DTU A;  3S3O A;  3WXJ A;  2GTD A;  3F2K A;  1XHZ A;  4GV6 A;  4BC4 A;  3CET A;  3DJC A;  3I0R A;  1X9W A;  4DCH A;  3DLR A;  3DLG A;  4Z4H A;  4KH4 A;  5FPM A;  3NE6 A;  1TK5 A;  3GL1 A;  4WCE L;  4F3T A;  4CCH A;  2NRX A;  3CQY A;  3PX4 A;  1QSL A;  3THW A;  4AHT A;  3T1A A;  3V6D A;  1S1T A;  3O4W A;  2D0A A;  2ITM A;  3VQ8 A;  3AO1 A;  1QSS A;  3G0Z A;  3HYF A;  4J2A A;  4JV5 K;  4IOA L;  1D9F A;  2E6L A;  3PIO L;  1BUP A;  4LSN A;  2UUB K;  2VG6 A;  3DLB A;  3FLC O;  3B6O A;  1T03 A;  3HT3 A;  3VEW A;  3CCU N;  4DTO A;  4BGB A;  3CCV N;  3SZ2 A;  4BWJ A;  1NJZ A;  1E4G T;  2HBL A;  3QML A;  4E1M A;  1LW0 A;  3D45 A;  4CJP A;  4CHN A;  4GVM A;  4PHT X;  3CCS N;  4WQ4 A;  3O08 A;  5SWM A;  3VQC A;  3ZEU B;  4B3T K;  2GEM A;  3LL3 A;  3H46 O;  2P9S B;  2P9I A;  3MCA B;  5F2R A;  4CD1 A;  3HK2 A;  4Y1D A;  4CJ3 A;  3J80 O;  4KHY A;  3KIO A;  3K5O A;  3TPQ A;  1JL1 A;  5BN9 A;  3WNE A;  3KKR A;  1TKT A;  2Q0R A;  4RW6 A;  4JS4 A;  4M63 C;  4FM0 A;  4CF0 A;  1NM1 A;  1YTU A;  4JRP A;  3RSE B;  4BDZ A;  3SQ1 A;  4E1J A;  1H1V A;  4JS5 A;  5EXW A;  4FW2 A;  3QEX A;  3OYI A;  2IVO A;  4W5T A;  3V9X A;  5GAG P;  1C1C A;  1BL3 A;  3IDH A;  5AQW A;  4FLY A;  5KQD A;  2W6L A;  1U48 A;  3AAQ A;  2KW4 A;  3KLE A;  3WXI A;  3V9W A;  3O9S A;  3O9U A;  3OY9 A;  2ZWH A;  5BPN A;  4C8L A;  1MDU B;  2O8D A;  2HMP A;  1NWK A;  3BF3 A;  4CBW A;  3OYA A;  3WNH A;  4FJK A;  2RHK A;  3DXM A;  3EZ5 A;  4E19 A;  3ULE A;  1YF5 L;  5BRD A;  4FK2 A;  4KKO A;  5EOY A;  4N56 A;  4FWO A;  5AQX A;  2YJE A;  3SUN A;  3UKR A;  4CZJ A;  4K41 A;  2XO7 A;  4CZF A;  2DPN A;  3K2P A;  1S1U A;  4FWR A;  3QFP A;  3ISN C;  1BI4 B;  1VQK N;  1S5J A;  3AVF A;  3L3V A;  4CIF A;  3HPO A;  3D0P A;  3VEY A;  3MWP A;  4E7H A;  3O9R A;  5CHI A;  3CME N;  3K59 A;  1EQY A;  3S3N A;  2E8A A;  3F9M A;  4E89 A;  5HL7 L;  4X64 K;  2E20 A;  1U2V B;  3PSI A;  2P9U A;  4ISG A;  3WUH A;  2PAV A;  2VGN A;  5ELZ A;  3AVJ A;  2Q1N A;  2HHS A;  5E84 A;  1GLF O;  2Q3S A;  4JKA A;  3SUO A;  3SPZ A;  1GLD G;  4FLX A;  3O9Q A;  1BO5 O;  3J7A P;  1WBD A;  4F2R A;  2HF3 A;  1P8Z A;  5ADX A;  3E66 A;  2FBY A;  4WYB A;  4BWM A;  1EWR A;  3O3G A;  2HHQ A;  3VQ7 A;  4LF4 K;  1REV A;  4FJG A;  1YXQ A;  3ENB A;  5EU7 A;  1WB9 A;  3MEC A;  3S9H A;  4CBU A;  3O3H A;  3PV8 A;  1WSJ A;  3H1V X;  4KHN A;  4DR1 K;  1XQS C;  2FC0 A;  4IBN A;  5CE3 A;  3OYB A;  1C0U A;  3VGM A;  3KK1 A;  2P9S A;  3QDK A;  2P9L B;  3TTD A;  4CI6 A;  1IBK K;  1JJ2 M;  4W5O A;  1S9E A;  1NK9 A;  2O8B B;  2G8U A;  3MEG A;  3OYL A;  2YHB A;  4KAZ A;  5DMR A;  4B1V A;  3RR7 A;  4M7Y A;  4LF7 K;  4B3R K;  3I56 N;  2KFZ A;  1JCE A;  1NKC A;  4KTZ A;  3AVI A;  4CW7 B;  2YNI A;  3L0Q A;  1UA0 A;  4PKI A;  4CZI A;  3K9K A;  4H0P A;  1TUU A;  2HVI A;  3LAN A;  4BR0 A;  3E01 A;  1XMQ K;  4K43 A;  4DV3 K;  1S22 A;  3KVG A;  4DLE A;  3HZ6 A;  4Y0W A;  4JKD A;  3D7E O;  4CGF A;  3QNN A;  3IKM A;  5AQY A;  1GLB G;  4JYA K;  3VEO A;  3ZSR A;  4GV9 A;  3RVC A;  4CJ5 A;  4JRQ A;  4DV0 K;  4CES A;  3VEZ A;  5LMU K;  2QKK A;  1Q7Y O;  4E7J A;  1Q9X A;  4H0O A;  4JI2 K;  1ZBF A;  2QWN A;  3E9L A; 
#chains in the Genus database with same CATH homology
 1G99 A;  2HBJ A;  4YOY A;  1BDG A;  3E9P A;  1VQN N;  3EE9 A;  5DM7 L;  3M6G A;  2V52 B;  4B1Z A;  4BRI A;  3H1Q A;  1MWM A;  4JHD A;  1MA9 B;  5TKW A;  3O80 A;  3SAH A;  2GWJ A;  4XH4 A;  1DT9 A;  3HTV A;  3P31 A;  4H03 B;  3QBW A;  1HPM A;  1T6C A;  2Q97 A;  4QS7 A;  3SMS A;  3AGK A;  3JXU A;  2CGK A;  2IIR A;  3A5L C;  4CZL A;  5DM6 L;  2F9T A;  2OTJ N;  5JVH L;  2EWS A;  2QA4 N;  2BUP A;  4EIA A;  1VQ7 N;  3CD6 N;  3M1F A;  3D2E B;  3VMF B;  5C2D A;  4BR5 A;  5GIO A;  1U2V A;  3CPW M;  1V4S A;  2CH6 A;  4A59 A;  3TSP A;  4ISE A;  4A61 A;  3DXM B;  2WUS A;  1OVY A;  2KHO A;  5EY4 A;  4J8F A;  3G4S N;  2E2N A;  2E88 A;  4EAH D;  2V51 B;  3ULE B;  3ZX2 A;  5AFU A;  1ZXO A;  3VGK A;  5M1P A;  2QM1 A;  2P9P B;  3R8E A;  4H0T B;  4BRG A;  5JLF A;  1YIJ N;  5AQZ A;  3LDO A;  1KC8 O;  3LM2 A;  1ZC6 A;  5BRH A;  2A40 A;  3VEX A;  5AQK A;  5AQG A;  2Q2R A;  3R9P A;  2FSJ A;  1Q81 O;  4O8U A;  2NNW A;  1BWF O;  3DXK B;  5AQU A;  5CR4 A;  1J6Z A;  2YHX A;  2NRW A;  1LCU A;  2QXL A;  2WFB A;  2GX9 A;  2W41 A;  3CIP A;  3CPE A;  3M5R A;  2YJF A;  1NGG A;  5BPL A;  1ATS A;  1BA1 A;  4FL9 A;  3GG4 A;  1HX1 A;  5I9E B;  4FWK A;  3FFK B;  1DKG D;  4MO5 A;  1ZBS A;  5BR9 A;  2NRR A;  1K9M O;  1T44 A;  4BRC A;  2P9U B;  5BPM A;  4JD2 B;  3EO3 A;  4FWM A;  1BG3 A;  3J8A A;  3KZB A;  5KPZ A;  5M1N A;  3F5T A;  5C10 A;  4H5V A;  3PLA A;  3G25 A;  5JIC A;  4I6M B;  4BRQ A;  1VQO N;  2VWB A;  1Q82 O;  3BUZ B;  5BN8 A;  3VF2 A;  3Q7B A;  2P9N A;  4Z94 A;  3TTC A;  4CD3 A;  1QVF M;  3D2F B;  5F0X A;  3MK6 A;  3P39 A;  3ZEU A;  4UY8 O;  3MN5 A;  4BRP A;  3N4Q A;  1K8K B;  1Q86 O;  3MDQ A;  4FPB A;  2OTL N;  2VCP A;  5EVZ A;  4GV3 A;  3VEN A;  5KPR A;  4NLC A;  4BR2 A;  4DB3 A;  3IUC A;  2ZJQ L;  3I55 N;  4RWT A;  1NLV A;  3ID8 A;  1GLJ O;  3MCP A;  1DGK N;  4AF1 A;  2H3G X;  3UKU A;  4B1X B;  4C1N I;  3WEE A;  1JCF A;  2ZGY A;  2E1Y A;  4CZK A;  4GY2 B;  3O8M A;  1TYQ B;  2A42 A;  4JKB A;  2E1Z A;  4JK9 A;  3RSE A;  2A3Z A;  3J7Z O;  1RDU A;  3ATU A;  5AQF A;  1NGA A;  1WUA A;  4A2A A;  4YOV A;  1VQ5 N;  1KAY A;  1NGC A;  4YOT A;  1ATN A;  3ID6 A;  4U67 L;  3CJ9 A;  4ILG B;  4QS9 A;  1BU6 O;  4ILH A;  1EO1 A;  5AQP A;  3ZYY X;  2YI1 A;  3CJC A;  3OBY A;  3VER A;  3QBX A;  4R79 A;  4JKC A;  2PFU A;  3CJB A;  4O8K A;  4YOR A;  1KD1 O;  2NRZ A;  2P9K B;  3MX2 A;  4CZH A;  4KH6 A;  4WFA L;  2NLX A;  2A41 A;  4B1W B;  2FSK A;  3ZET B;  3C7N A;  5GIN A;  3UB5 A;  4A57 A;  4BQZ A;  3LDL A;  1HLU A;  5BRE A;  3L6Q A;  1X9J A;  2HBM A;  1GLA G;  3DAW A;  3KWG A;  3O1B A;  4WQ5 A;  1O13 A;  1HJO A;  2FSN A;  2NRV A;  2F7T A;  2QW9 A;  4A62 A;  3HRG A;  4WF9 L;  1VQ8 N;  5AQT A;  2ASO A;  3MWT A;  3VES A;  4RCH A;  4BRN A;  1YJN N;  4JKE A;  5AQN A;  3VEV A;  3FZM A;  3O1W A;  5AZI B;  2RE2 A;  4H5T A;  3CXC M;  4ISF A;  1P90 A;  4JKG B;  3EKS A;  5GAE P;  4JEP A;  3U9D A;  3WT0 A;  2F9W A;  1HKC A;  1W97 L;  1VQL N;  5AQM A;  4CD1 A;  4BRK A;  2VYP A;  5EX5 A;  3VF4 A;  1Z6R A;  3CJA A;  4JK7 A;  3TSQ A;  5M1Q A;  4H0V B;  5B8H A;  3I8B A;  2KLA A;  4IO8 A;  1YJ9 N;  1QHA A;  1XC3 A;  4JKF A;  4YOX A;  3H3N O;  4WQ4 C;  4YOU A;  3SK3 A;  3FZK A;  1QQO A;  4H0Y B;  1BOT O;  5AQI A;  3T7Z A;  4B1Y B;  2NRH A;  2QWL A;  4ILJ A;  3UE5 A;  3CCM N;  4OPA A;  2FF3 B;  4BRA A;  1M90 O;  3OW2 M;  3ZX3 A;  2YCH A;  3NVM A;  5AQR A;  5BRF A;  4JHD B;  1QVG M;  3VET A;  3ENO A;  3PIP L;  2YHW A;  3UKR B;  4CZM A;  3ZX0 A;  1YVN A;  2D0P A;  4DKW A;  5JLH A;  3WXJ A;  2GTD A;  1SS6 A;  4IZ9 A;  3F2K A;  4BRL A;  4GV6 A;  3H6E A;  3IFR A;  4MLE A;  2AA4 A;  3HI0 A;  3C6A A;  1YUW A;  4BC4 A;  5C0Y A;  3CET A;  3DJC A;  3QFU A;  4XEI A;  3SAF A;  3EL2 A;  2PBD A;  2KKZ A;  3AY9 A;  3OA9 A;  4DCH A;  5F1X A;  4BY9 C;  4KH4 A;  4QS8 A;  5FPM A;  5AQH A;  1QZ6 A;  4BC3 A;  4FWP A;  4JD2 A;  4WQ5 C;  4BR7 A;  3CC7 N;  2W40 A;  2QWM A;  3A0I X;  3CI5 A;  3R1X A;  2E2P A;  4H5W A;  3WQU A;  3GL1 A;  4DHY A;  5JVG L;  4BRO A;  3T69 A;  3TU5 A;  4WCE L;  2J4R A;  5GIP A;  5GAH P;  3CC4 N;  2ZGZ A;  1SZ2 A;  4H0X B;  3A5M C;  2NRX A;  3CQY A;  2ASP A;  1IJJ A;  3S41 A;  4DQ8 A;  1HKG A;  1VAZ A;  4BRF A;  4BGA A;  4NLB A;  4OPH A;  5H1S Q;  4MDB A;  1K8K A;  4GNI A;  3SJH A;  4WFN L;  3O4W A;  1VQ6 N;  1NGI A;  2HOE A;  2P9L A;  2NZT A;  3AAP A;  3CQX A;  2ITM A;  3SBT A;  3FZL A;  2VGM A;  2CGL A;  2YHY A;  3H45 C;  4IOA L;  1Z05 A;  5FPN A;  3C0B A;  4HWI A;  3W0L A;  3PIO L;  1BUP A;  2QEX N;  3CMA N;  3HOS A;  1RDW X;  3FLC O;  3G71 N;  1TYQ A;  3IMX A;  1GLC G;  2GEL A;  2CH5 A;  3VEW A;  3CC2 N;  3JS6 A;  4IJN A;  4YDU C;  2ZJP L;  3CCU N;  4BGB A;  1W2B M;  4PL7 A;  3CCV N;  1T6D A;  3FGU A;  4IWV A;  4IFE A;  3N4P A;  1E4G T;  2HBL A;  4CJ7 A;  1V4T A;  3QML A;  3GOI A;  4BRD A;  3CHW A;  2E2O A;  1YHQ N;  1X3M A;  2P9N B;  3HSC A;  4C23 A;  4PHT X;  4CZE A;  4WQ4 A;  3HM8 A;  1CZA N;  3O08 A;  4IDH A;  2FF6 A;  3VPZ A;  3CCS N;  1VQM N;  3ZEU B;  3EZW A;  5LJW A;  2D1K A;  2GEM A;  3BEX A;  4IXC A;  3LL3 A;  4AM6 A;  1YIT N;  2JWK A;  3H46 O;  1RFQ A;  2P9S B;  2P9I A;  3MCA B;  3B8A X;  2BTF A;  2QWQ A;  4FPA A;  3EKU A;  4H5R A;  4HTL A;  5MLC Q;  2I7P A;  2HF4 A;  3H3O B;  3TPQ A;  3ZET A;  5BN9 A;  1IG8 A;  2I7N A;  1NMD A;  2Q0R A;  2D4W A;  1JCG A;  1Y64 A;  4M63 C;  4CZG A;  4PL8 A;  3UKU B;  3CCL N;  5KQ8 A;  3WEE B;  4NO7 A;  4BQL A;  1NM1 A;  3FZH A;  3RSE B;  4E1J A;  1H1V A;  1KAX A;  5EXW A;  1C0F A;  4OO1 J;  3MMV A;  2IVO A;  4MDA A;  5AZI A;  5TKY A;  2FXU A;  5GAG P;  5AQJ A;  3A5N C;  5M1O A;  1ATR A;  4FWL A;  5M1K A;  2IVN A;  3IDH A;  5AQW A;  1X3N A;  2V7Y A;  5AZJ B;  5KQD A;  3AAQ A;  4BG9 A;  3WXK A;  2WBN A;  3HBT A;  3WXI A;  4CBX A;  3HOT A;  3O5B A;  1NGH A;  2GWK A;  4U7B A;  3O9S A;  4JNE A;  1Q18 A;  1KXP A;  1HUX A;  3KHY A;  4JKH A;  4WFB L;  4JK8 A;  3O9U A;  2ZWH A;  5AQV A;  3CJ1 A;  4KH5 A;  1MDU B;  5BPN A;  4IOC L;  3D2E A;  2HMP A;  3OHR A;  1NWK A;  3I33 A;  3E1Y A;  3BF3 A;  1NGB A;  4BRM A;  4CBW A;  1VQ9 N;  2RHK A;  1NGE A;  3DXM A;  5AR0 A;  3C7N B;  5FPE A;  3FR0 A;  3KK7 A;  1YJW N;  3ULE A;  1YF5 L;  3ATV A;  3LDN A;  5BRD A;  2E2Q A;  4O5F A;  1SAZ A;  3FE1 A;  5EOY A;  4MLH A;  1U6Z A;  2P9P A;  4XH5 A;  2A5X A;  4FWO A;  3VF6 A;  5AQX A;  2YJE A;  5KPT A;  3CCE N;  4G9Z A;  3Q7C A;  3UKR A;  1KQS M;  5E26 A;  4CZJ A;  4K41 A;  4AM7 A;  3WQT A;  5ADX H;  4CZF A;  3AAR A;  3L4Q A;  2DPN A;  4BVP A;  4FWR A;  3P38 A;  2Q36 A;  1RGI A;  4YDU A;  3QFP A;  4BC2 A;  3WXM B;  1K8A O;  4M7X A;  1VQK N;  4IOX A;  2AP1 A;  3CF5 L;  1NBW A;  5C15 A;  3CCR N;  4YOW A;  3QIC A;  3SLC A;  1GLL O;  1VQ4 N;  3DXK A;  5AQO A;  2Q0U A;  3D6R A;  3MWP A;  3VEY A;  1VQP N;  2Q31 A;  3O9R A;  5CHI A;  3CME N;  1NGD A;  3VOV A;  4IEE A;  1EQY A;  4EFH A;  2E8A A;  3F9M A;  5HL7 L;  3CCJ N;  1ILY A;  4PKH A;  4FWQ A;  2E20 A;  2GUP A;  4EHU A;  1U2V B;  3AGR A;  3OBW A;  4BR9 A;  3QB0 A;  2P9U A;  3G6E N;  2QWP A;  4ISG A;  1BA0 A;  3U9Z A;  4BC5 A;  3WUH A;  1SQK A;  2PAV A;  2VGN A;  3MN6 A;  5ELZ A;  2HBK A;  2Q1N A;  4A2B A;  3KWI A;  3TSU A;  5AQQ A;  4I6M A;  2D0O A;  2ASM A;  1E4F T;  3M3Z A;  5E84 A;  1GLF O;  4JKA A;  1M1K O;  3E9O A;  1QQM A;  1GLD G;  3D2F A;  3O9Q A;  1BO5 O;  4FVU A;  5LY3 A;  3A5O C;  3O9T A;  1GLE G;  2HF3 A;  5HOO A;  1P8Z A;  3GBT A;  4BRE A;  5ADX A;  3TTF A;  3E66 A;  4PKG A;  3SMP A;  4WYB A;  2QWO A;  3SAG A;  2QWR A;  4H5N A;  2ZJR L;  4EHT A;  4FWS A;  3DWL A;  4K25 A;  2V7Z A;  3C6H A;  3U8X A;  1OKJ A;  5M1F A;  3CJ7 A;  4JN4 A;  4FWN A;  3BP8 A;  1D4X A;  1YXQ A;  3ENB A;  4BRH A;  1XUP O;  4RTF D;  4FOI A;  2HST A;  4CBU A;  3O6W A;  3P4I A;  2ZF5 O;  3EE8 A;  3MN9 A;  5F2R A;  4L3Q A;  5LJV A;  1NJI O;  2JWL A;  3H1V X;  4FO0 A;  1XQS C;  4A5A A;  5CE3 A;  4XH1 A;  2BH1 A;  3SBG A;  3VGL A;  2QTD A;  3VGM A;  3VTH A;  5AQL A;  2P9S A;  4KBO A;  5AQS A;  3QDK A;  4A5B A;  2P9L B;  1HKB A;  3TTD A;  4CI6 A;  3CCQ N;  1T3V A;  1JJ2 M;  1TUY A;  2YX6 A;  3L4I A;  1DEJ A;  2CGJ A;  3LDP A;  1K73 O;  4FOE A;  3MX5 A;  1YI2 N;  2P9K A;  3R6M A;  3CER A;  4BVO A;  4B1V A;  1QQN A;  3WXL A;  4M7Y A;  3U4L A;  3FZF A;  4BR4 A;  3I56 N;  4IJA A;  3A8Y A;  4LC9 B;  1JCE A;  5C12 A;  3EN9 A;  4B9Q A;  5C2F A;  3C65 A;  3K9J A;  2A6A A;  3NMU A;  3L0Q A;  1ESV A;  1NGJ A;  4PKI A;  4CZI A;  3K9K A;  3DLL L;  4H0P A;  5FPD A;  1N8R O;  1TUU A;  3LM9 A;  1QZ5 A;  3MN7 A;  4BR0 A;  5AZJ A;  3LDQ A;  1MWK A;  2QI2 A;  5JMV A;  4K43 A;  2FLO A;  1R59 O;  1S22 A;  1YAG A;  3KVG A;  2UYT A;  4IEI A;  2WC9 A;  3HZ6 A;  4JKG A;  4JKD A;  4JAX A;  2NRT A;  4Y0W A;  2P9I B;  4BG8 A;  3D7E O;  1WOQ A;  3R3L A;  1LOT B;  1KAZ A;  3IKM A;  4C1N K;  1C0G A;  2OAN A;  5AQY A;  1GLB G;  3VTI A;  4IO9 L;  3W3D A;  3VEO A;  4F9O A;  4GV9 A;  3RVC A;  2IVP A;  5AFU H;  4NB4 A;  3GDQ A;  1NGF A;  3VEZ A;  3BF1 A;  3ENH A;  3GE1 A;  1Q7Y O;  1S3X A;  4GVE A;  4K42 A;  5GAD P;  3NVK A;  4H0O A;  4MO4 A;  1S72 N;  4B1U B;  2QWN A;  3E9L A;  4FSV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...