3P38A

Crystal structure of the ns1 effector domain w182a mutant from influenza a/vietnam/1203/2004 (h5n1) virus
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
123
structure length
123
Chain Sequence
KMPASRYLTDMTLEEMSRDWFMLMPKQKVAGSLCIKMDQAIMDKTIILKANFSVIFDRLETLILLRAFTEEGAIVGEISPLPSLPGHTGEDVKNAIGVLIGGLEANDNTVRVTETIQRFAWRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nonstructural protein 1
publication title X-ray structures of the NS1 effector domain from highly pathogenic influenza A/Vietnam/1203/2004 (H5N1) virus
rcsb
source organism Influenza a virus
molecule tags Viral protein
total genus 35
structure length 123
sequence length 123
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-10-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.330 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3p38A00
3M5RA 2RHKA 3KWGA 3D6RA 3KWIA 3O9UA 3O9SA 3OA9A 4OPAA 2GX9A 3P31A 3O9RA 2KKZA 3O9QA 3P39A 3F5TA 3L4QA 3RVCA 3O9TA 4OPHA 3EE8A 3P38A 3EE9A
chains in the Genus database with same CATH superfamily
4LD0A 3QFUA 3ISNC 4KH5A 4B9TA 2LSNA 3M1FA 1YF5L 4E7KA 2O8BB 3TSPA 4JKGB 4B1UB 1JLFA 4FW2A 4M45A 4AHUA 1N8RO 4Z4EA 4L8RB 3J81O 4BRLA 4AM6A 5AQPA 4CEFA 3CETA 3O1BA 1RDWX 4LF6K 4KAZA 3AAQA 1XC9A 1BGXT 3WQUA 4BG8A 1WN7A 1MWKA 4RW9A 1BDGA 2HHHK 1VQ6N 4ICLA 5H1SQ 3DAWA 3QFPA 3O9UA 3RMDA 3RWUA 3FZKA 1X9SA 2E2PA 1GLDG 4CF0A 1NJWA 3MN7A 4JI7K 2A1SA 3AVAA 4O8KA 1N34K 2IVPA 5C25A 3AVHA 5FROA 4PL8A 4DQ8A 3KKRA 4H0XB 4GMJB 5FRNA 1VSFA 4DUZK 1VSEA 4Y0WA 3J7ZO 1TAQA 1OKJA 1B92A 4DU1A 1JJ2M 2P9UB 3FE1A 5AQQA 1HR0K 3AVGA 3L0QA 4N47A 3VF6A 2KKZA 1IG9A 3PUFA 1RBUA 3BY5A 4L3QA 4CJPA 4FO0A 4AHVA 3M8RA 4DFKA 3EYZA 4JD2B 2UYTA 1WLJA 4R5PA 4IKFA 4DSIA 2YNIA 2DFFA 3CC2N 3MECA 3CJ9A 4OO1J 2P9SB 4JKFA 4DSJA 3L2WA 5D3GA 1H1VA 2HHVA 5HL7L 3CCLN 4Z94A 3MN9A 4EHTA 1KVBA 4X65K 5M1OA 1QSYA 1RT4A 5BR9A 3SQ2A 4CZFA 1S6QA 2CH5A 5AZJB 3QBWA 4FJMA 1QHTA 2OANA 3RSEB 1U6ZA 2QEXN 4WQ4A 3VF4A 3CCSN 2KZMA 3U6FA 3KWIA 4FWQA 4K8XA 1IBKK 1DLOA 2DPNA 5BREA 4Q0BA 2Q1NA 4IDKA 5C10A 4BY9C 2IOCA 2OCEA 3E9PA 3VGKA 4JK8A 5M1PA 4O55A 2VYPA 3QB0A 2VWJA 4LFBK 2ITMA 1EXQA 3CJ7A 1XUPO 3SI6A 2YHBA 3BGRA 3SPZA 4B9VA 4MDAA 2NUBA 3TTFA 2VGMA 4AH9A 2Y1IA 4PY5A 4QOZB 1C1BA 5AQIA 3MN6A 3HM8A 2VWKA 4IWVA 4M3WA 3HXMA 1NK6A 4DB3A 2NRTA 5BPNA 1T05A 4A2BA 3PIPL 3OJSA 1VQ4N 4CD1A 2QI2A 4C1NK 3K5MA 4BQZA 3DRRA 3L6QA 3H45C 1HYVA 3C0BA 4QCLA 1NGDA 1ATRA 3O6WA 4A5BA 4EP5A 3CCVN 4FLXA 3CQYA 3ZSWA 3MCPA 4DHYA 3CM6A 4MFBA 1S72N 2OPSA 1NLVA 4CHNA 5I9EB 4ZHRA 2HHWA 4CFCA 1F21A 1D9DA 2F8TA 3JXUA 3KK7A 3VGLA 4DMNA 4OKEA 4HWIA 1GLCG 4B9QA 4M3ZA 5J2QA 3AGRA 1OVYA 1L3VA 1WUAA 2ZGYA 3MXIA 3DLGA 5KPTA 1VSIA 1NK7A 5JLHA 1HKGA 4GNIA 3I55N 3AO3A 1P90A 3NFAA 3CF5L 1L3SA 3O9SA 3SQ4A 2CGLA 1HUXA 5FLXO 3A5LC 3DRSA 3FR0A 5C0YA 2X78A 5F1XA 4CGIA 2J4RA 1K73O 4CHZA 4IFEA 2JWKA 2OYQA 5CE3A 4AHTA 5LMNK 3CXCM 5KRTA 5LJVA 3KZBA 1LAWA 3RTVA 2O8FA 4I7FA 3VF2A 4FW1A 4FJNA 4B1WB 4NLBA 3DWLA 4KTWA 4HHTA 3ULEA 3LM2A 2KTQA 5C12A 1B9FA 3NF7A 3NVMA 1NK4A 4IO8A 2E5LK 2ZF5O 3T19A 3HI0A 3MX5A 3G0ZA 4DTSA 3WNHA 4NXNK 3I8BA 3R9PA 3VQBA 4OLAA 2GELA 1M1KO 3ZSRA 4M7XA 3SYZA 1O1WA 3Q7BA 3OYIA 1JKHA 4MO5A 3NH1A 4FJ8A 3TSQA 4BR0A 5M1KA 3S9HA 4H5VA 1CXQA 4PKHA 1HPZA 1UOCA 1TKXA 5DMRA 3RVCA 3CJCA 4FM0A 4I6MA 5AQNA 3K9JA 2E20A 4BVPA 1QHAA 4FWLA 1IBMK 4NO7A 4CJ7A 5M1FA 1YJNN 2XY7A 5KPRA 3SCXA 3ZSQA 2KLAA 2XHBA 4K0KK 1UWBA 4O0IA 1NG9A 4JKDA 5AQSA 1KVAA 4NLCA 3AAPA 4OPAA 3WXLA 3QICA 4CJFA 4CBUA 2ITGA 2HNDA 3PO5A 4V19S 4E7LA 3VA0A 4E0DA 3SQ1A 4OPHA 3WNGA 1WSJA 2FSNA 1QE1A 4LFCK 5KQ8A 2FF3B 4DTUA 1HJOA 4J2EA 4CJEA 4JS5A 2D0OA 4JNEA 3C95A 3EZWA 4PHTX 3G6EN 1BWFO 1NJXA 4AHCA 4F3TA 5HROA 3K5NA 1KTQA 5BPLA 4W5NA 1VQ9N 3O1WA 4CZGA 4IOCL 4BE1A 2W41A 1VK0A 3NGIA 2BANA 4PKIA 3FFKB 3OYEA 5C15A 1FKPA 2X6NA 3W3DA 2HNZA 5KI6A 3V1RA 2P9LB 4FPAA 3CCQN 3SUOA 3ID8A 4E7JA 2W6KA 5I3UA 4CEZA 2YJEA 3FFIA 3O08A 1A5XA 3EKUA 4OGEA 2QWMA 1VSLA 3D2EB 4FWSA 4B3RK 1VAZA 3ZEUA 4FWKA 2F7TA 1ZXOA 5AQWA 4CZJA 3AVKA 4DTMA 4BRHA 1W9HA 1NM1A 3L3UA 2E8AA 3GL1A 4QS8A 1W7AA 4CEBA 5GINA 1NGBA 3TTDA 3IMXA 4H03B 3CPWM 3ZLJA 2DTUA 2EHGA 1BUPA 1S1WA 3GDQA 1VQMN 1TUYA 2P9PA 3PV8A 2OPQA 5FDLA 4GKKK 4CJ5A 2UUBK 4DLEA 3V9SA 1T8EA 1X3MA 2FC0A 4DV6K 4DV3K 4YOXA 4CFDA 3LPTA 1HX1A 1C1CA 3C65A 4H5NA 4GV6A 3QIOA 2NRRA 2QM1A 1Q82O 1BL3A 4CGHA 1NK5A 1BQNA 5C24A 1G15A 1BA1A 4FLUA 4KHNA 1CLQA 1NGEA 3VEZA 2PYJA 1Z6RA 4WF9L 2YKMA 1KFSA 2HOEA 4KTQA 2KQ2A 3G10A 4A61A 1EX4A 1C1AA 1ASUA 3EEQA 4FJHA 4JI3K 5CY4A 2HVHA 3LP3A 4G9ZA 4BRDA 3THWA 2VWBA 2NRHA 5HP1A 4YFUA 1IG8A 1QSLA 4J2AA 3O9QA 4FJ5A 3EO3A 1BCMA 4MO4A 2IGIA 2HMIA 1NGFA 5C2FA 1Q9YA 5TKWA 3CMAN 4B9SA 4CGJA 2QKKA 4CIFA 3HP9A 4FJJA 4GVMA 4PWDA 1S22A 1DGKN 4JKEA 4EFHA 3ZT4A 2HBMA 3VEWA 4LY7A 4H8KA 4K8ZA 4CHPA 4JK7A 4K41A 3O4WA 4OPKA 4DR5K 1LWCA 1S1TA 2A41A 4CF9A 3R1XA 3LAKA 3S3NA 1RBSA 4NYNA 1YT3A 1OH6A 1VRTA 4BDPA 3THXA 4TSXA 1OVQA 1EQYA 1L3TA 3DXKA 2YI1A 3OYNA 1MDUB 1VQKN 2A5XA 1NK8A 4DFJA 3QO9A 3BEXA 4GKJK 3QINA 3DM2A 3AVLA 2A6AA 4KI6A 3H3NO 3NBPA 3OYCA 1NGAA 4O5FA 4M42A 2UUAK 1LW2A 3NF9A 4BR2A 4FJKA 4UQGA 4F4KA 3TWHA 2HW3A 1D8YA 4IDHA 1TVRA 3L2QA 5AQRA 4A62A 4KRFA 3PO4A 2GBZA 3CHWA 4ZTJA 3QETA 4CESA 1V4SA 2JWLA 4DF4A 1KVCA 4RW7A 3PX4A 3E1YA 4KREA 2UXBK 1ZBLA 3NH0A 4DSEA 1BHLA 3M8SA 3AVBA 5BRHA 3KLFA 3RMCA 1SZ2A 3DXMA 3LDOA 3SJHA 2Q0RA 4WFBL 4ELUA 4WCEL 4CERA 4BRPA 3VESA 5AQXA 3CERA 1U48A 1L3UA 3LALA 2W42A 3OYGA 4CZIA 4DU4A 3VQ5A 1N33K 4J2DA 2QK9A 4PQUA 3KD5E 4H0PA 2E6MA 2G8FA 4C8KA 5IWAK 2GWKA 1KQSM 4B3MK 1U49A 4CK1A 4B9LA 5AQFA 1Q7YO 4DQQA 4XH1A 4B9MA 3TANA 3FZLA 3S41A 1OH5A 2FSJA 2UUCK 3K2PA 4BRMA 4Y1CA 4ISGA 3ENHA 3O9RA 4QAGA 2QWNA 5DK5A 3K0SA 1JCFA 3WXMB 2W6LA 2HSTA 4A2AA 3OYDA 4FJLA 2RE2A 3A5NC 3AVCA 5JMVA 2O8FB 5AQOA 1BISA 4FLYA 1JLQA 1TL3A 1J5OA 4DS4A 4H0YB 1U4BA 1VSKA 3HPHA 3S3OA 3V9WA 3ZSVA 3BUZB 5AQYA 4KH6A 3JS6A 1ZYQA 2YNGA 2QWRA 4FZYA 3KK3A 3O4NA 3U9DA 4X66K 4ISFA 4JV5K 3QERA 1LAVA 1NWKA 2V51B 3U4LA 2BTFA 3VEYA 1E3MA 4WYBA 4AHSA 2JLEA 5HRPA 3SJJA 2IAJA 2P9KA 5CR4A 4JI4K 1XQSC 1CZ9A 2BE2A 4A5AA 4H5RA 3PX6A 2I7NA 4FXDA 3CFPA 4ISEA 4BGAA 4FLZA 4AQYK 1R0AA 5F2RA 1VHXA 4GV9A 2A40A 5DM6L 1WOQA 2GUPA 3ITHA 2YHWA 3HTVA 4I6MB 5LJWA 3MXMA 1TKDA 4OLBA 1JXEA 3C94A 2OTJN 3AA5X 3WT0A 2PBDA 5HLFA 4DR6K 3HBTA 1MA9B 2E2NA 4BQLA 3IG1A 3C6HA 3NMUA 4CZKA 2KFZA 2Q36A 3K5OA 5TKYA 4JRPA 4QS7A 3AA2A 3B6OA 4DTOA 3E01A 3EZ5A 2A3ZA 1NGJA 3SAGA 3DLRA 4Z4IA 4RW8A 3FZFA 4WQ4C 1TKZA 4AF1A 1QSSA 3KLIA 5BPMA 3O8MA 2GUIA 3LP0A 4M3RA 5J2NA 4N41A 3O4QA 3V1OA 3HZ6A 3O3GA 2E2QA 3MK6A 4BWJA 3AO1A 4WFAL 1I94K 1KXPA 4DR2K 4HUFA 1N36K 3OBWA 1ZBUA 3M3ZA 3AV9A 3MWPA 4IG0A 4F2SA 1J54A 2ASPA 3E9OA 5AQMA 3K59A 1EWRA 4B3OA 3H3OB 3N4PA 1YTUA 2P9IA 5KRSA 2OA8A 1QZ6A 5HBMA 5DM7L 4WFNL 1E4FT 5CHIA 3ZEUB 4FJ9A 3TTCA 4E1JA 4IEEA 3PX0A 3VENA 3LDPA 3QEIA 5AZIA 4CI6A 1VQ8N 3MAQA 1VQPN 1LOTB 2Z1IA 2HVIA 1DTQA 1K6YA 4CJKA 5CZ2A 4FM2A 1HNXK 2HMPA 1NKEA 2QA4N 4KHSA 1KFDA 3FZHA 2P9PB 1IKXA 4HUGA 3M6GA 3AY9A 5C2DA 1U2VA 1J9AA 4ID1A 2R7YA 4DWIA 4FVUA 2Q31A 1VSHA 4CIGA 3P38A 4DTNA 1ZBFA 2P5OA 2HB5A 4PKGA 3CCRN 3OYMA 4CEAA 2BH1A 3MMVA 4Z4GA 3KK1A 1VSJA 3B8AX 4HCBA 3MEDA 4JYAK 3KLEA 3NCIA 4KHQA 1C0UA 4M63C 1HNWK 3VQEA 1C0MA 1Q18A 1D4XA 5HRNA 1WSHA 4BVOA 2FXUA 3ZSOA 2NLXA 3P4IA 1U47A 3OYJA 1FXXA 1RDDA 3VEVA 3THWB 1S1XA 1RTJA 4KI4A 1JL2A 3OYLA 1IJJA 3BF1A 1SL2A 1W0HA 3DMJA 4CEDA 2UU9K 1QQMA 5HRSA 4KH4A 1SQKA 4DFMA 3OY9A 1GOBA 1GLEG 4C8NA 4CW7B 1TYQA 1SS6A 3RMAA 3SMPA 4K43A 4KBOA 3U3YA 2RHKA 4LF9K 3VTHA 4FOIA 4DV7K 2QXFA 3H08A 3AA3A 4XEIA 5K14A 3THXB 3RR7A 3TR8A 3LDQA 4FYDA 3DXKB 1XC3A 2NZTA 4CJ4A 4DR7K 3CPEA 1WSFA 3HM9A 2CGKA 2OPPA 3OW2M 3QNOA 1KLNA 5GAEP 1VQNN 1C0FA 3DLEA 4FPBA 4BR9A 1NKCA 4B3TK 1KCFA 3PSIA 4BRFA 4C1NI 2VG5A 4H0OA 1FK9A 2E88A 3PIOL 4FSVA 3U3GA 3V9UA 2OZSA 3SV4A 3KVGA 4CJRA 3ZX0A 3SZ2A 3OBYA 2YV0X 1TK8A 3THYB 1Q9XA 3IAYA 2KZZA 4FWMA 4FM1A 3LL3A 4JI0K 1JL1A 1JLCA 3FLCO 2QWQA 4CJVA 1ASWA 4AHRA 4O0JA 2IC3A 4FVMA 3BDPA 4DQIA 2HF3A 4DR4K 2E4LA 3I33A 1NGHA 2DY4A 3GG4A 1NGGA 4H4MA 3WXJA 4BRAA 3TAQA 3V1QA 1NNEA 2E1YA 3DXMB 1RCHA 2O4IA 1GLAG 4OKJA 5M1NA 4CHOA 3EKSA 3CYMA 3T69A 1NK9A 3VQQA 4CZLA 1ESVA 5AQTA 4CBWA 3SV3A 3SPYA 4BRQA 3O3FA 3M5RA 5FPDA 3PY8A 4KHYA 3HOTA 1YJWN 3LP1A 1RNHA 1K8KA 4BR7A 3I56N 1ASVA 3NGZA 4RTFD 3V81A 2G8KA 4B08A 4B1YB 1WB9A 4JI1K 4PA1A 3LZJA 3DOKA 3W0LA 1RT1A 1VRUA 3MN5A 3HJFA 4Q5VA 3SNNA 3SUNA 4GW6A 1WSGA 4YHHK 1HNIA 4AM7A 3HSTB 1L5UA 3VQAA 1IKYA 1JLEA 2G8HA 3AVIA 4IOXA 4H0TB 1RBVA 2D0CA 3TAFA 2OTLN 4GVEA 4I9QA 1UA0A 2VQEK 2RPIA 1BI4A 2ZD1A 1C6VA 3CCUN 4R79A 1WBBA 2PY5A 2HHQA 4IFYA 5ADXH 1RGIA 5CYQA 1CZBA 2YNFA 3WXIA 5AQGA 1QTMA 5AQJA 3AA4A 2B6AA 4OKKA 1RDBA 1T7PA 1HKBA 2P9KB 3LDNA 4GV3A 3HT3A 3UB5A 4AILC 4MLEA 3VTIA 1GLBG 4BDZA 2O8DA 3AVMA 5GIPA 1SL0A 3T1AA 2Q97A 4W5OA 4FLVA 4CK3A 4M3YA 3CMEN 3TPQA 1YUWA 2Q3SA 4K25A 2FBXA 5J1EA 1T6DA 3J80O 2AA4A 4CD3A 2F9TA 4IZ9A 5AQKA 4CFBA 2I5JA 1MWMA 4B8AB 3L8BA 4JRQA 3CM5A 5GAHP 4FWRA 1IV0A 4B8CA 1RBRA 3K58A 1TGOA 3O5BA 4BDYA 4DV1K 1K9MO 2FF6A 4JI2K 2OPRA 1TL1A 4BROA 3RR8A 2ASMA 1U45A 1W97L 4IXCA 4IG3A 2FSKA 4LH5A 4ILJA 4DTXA 2X6SA 1XI1A 4M3XA 2G8VA 4C23A 1KC8O 3KLHA 1TUUA 4BE2A 4U67L 4JI5K 1QVFM 3CI5A 3I0RA 3LZIA 1U04A 1S1UA 3RRGA 2DFHA 3HOSA 4YOVA 4IFVA 4MQ3A 1JXBA 3LP2A 1BA0A 4YOWA 4X62K 1NMNA 5CZ1A 3R8EA 3LWMA 2WFBA 2D4WA 1XNRK 1GOCA 1DEJA 2E6LA 4DV2K 1ATNA 4CF8A 4OGCA 4KPYA 5KPZA 3IUCA 3C6UA 1FJGK 5M1QA 3JYTA 3SLCA 3T3FA 2B4JA 1KD1O 2V7ZA 1NGIA 2P9IB 5AJ3K 5GIOA 3OS2A 3E9LA 2KW4A 2YHYA 3CFOA 5JICA 1RDAA 4BRNA 4O4GA 3MXJA 3KD1E 2ZWHA 5AZIB 3PSFA 4RW4A 2P9NA 1Q8IA 4CJTA 4E7IA 3WEEA 1HJRA 4CJ3A 5FPEA 3QLHA 4OJRA 5IT9O 2H3GX 4KV8A 3ID6A 3NE6A 4NXMK 1S9GA 2IVNA 2QWOA 3WNFA 2ZM6K 2F8SA 4M3UA 3ENOA 1DKGD 2VG7A 2BDPA 1U2VB 2ZQBA 3ZT2A 1ILYA 4BRGA 1VQ5N 4DLGA 3DLLL 1T6CA 3CG7A 4N76A 1RTIA 1JLBA 4CGFA 2IS3A 3DYAA 3KJVA 3UKRA 2NNWA 3J8AA 3QMLA 3PLAA 1RT2A 2NRVA 3BF3A 1R59O 5ELZA 4C8OA 3WUHA 2WBNA 1G99A 3VEOA 3LM9A 4EHUA 1QS4A 4DCHA 2RKIA 4A59A 4LFAK 3VQ6A 1REVA 4HTLA 3DRPA 4BRCA 3OHRA 3G4SN 1XHZA 1T03A 2VGNA 3A2FA 3MWTA 3UKUA 1GLJO 5KGXA 3VA3A 4KFBA 1BCOA 5AQLA 1IKWA 3HVRA 2JGUA 4N5SA 4DTRA 4K42A 3C6TA 1VQ7N 4LF4K 1M90O 4IO9L 1IH7A 5A2QO 2P1JA 4DSKA 1BO5O 2YKNA 1LWEA 4DV0K 1TYQB 2QXLA 1GOAA 1RTDA 5HRRA 5ADXA 3K57A 4F2RA 3OYHA 2GV9A 3ULEB 3IRXA 4CEEA 2ZJQL 3D45A 2GWJA 4LH4A 2D0PA 1NJZA 4JLHA 4W5TA 1LCUA 3D6RA 2O8EA 3P31A 1SKSA 4DV4K 5EVZA 1HPMA 1X9WA 4GY2B 1YI2N 1LW0A 1WSIA 3TI0A 5KTQA 1A5VA 4DUYK 1YHQN 4HUEA 3MDQA 3ENBA 4WQ5C 4WE1A 4JS4A 3NH2A 1HRHA 3K9KA 4PL7A 5CYMA 3V4IA 4NCBA 4EZ6A 4HTUA 1Y64A 3KHYA 5EU7A 1ZBSA 3QBXA 1N6QA 4FOEA 2Y1JA 2O8CA 5E84A 2KHOA 1N32K 4YOTA 3IDHA 3KTQA 1OH7A 4B9NA 3LDSA 1GLLO 3OS0A 1YVNA 4NCGA 3AO4A 4NB4A 1S6PA 4ID5A 3MCAB 1YIJN 1SL1A 1OH8A 1RFQA 3HP6A 4IJAA 4CJSA 2PYLA 4JK9A 2XY6A 4WQ5A 3VQ4A 2ZJPL 5JVGL 5GADP 4Z4FA 1YITN 5AQZA 1Y97A 1QQCA 3DOLA 3DI6A 1WNSA 4JKCA 1HMVA 3V9XA 5BRFA 4CK2A 1C0TA 4IOAL 4CCHA 3IKMA 3VMFB 5AQHA 3SMSA 1QQNA 1K8KB 3T1HK 1YTAA 5LL6Z 4ILHA 4I9LA 3NF8A 3C7NA 2HBLA 3OTOK 2Q0UA 4KHPK 5E41A 1HKCA 5MLCQ 3O9TA 1NU0A 2E2OA 2IDOA 3F73A 3ZSZA 1VQON 1IBLK 3FGUA 4CECA 4E89A 1HQUA 4CZEA 4DR3K 3TAEA 2RF2A 4FLTA 2HBKA 4B3SK 3H46O 2FLOA 4CJWA 2ASOA 3OA9A 2DFEA 4CF1A 1ZBHA 1BI4B 3F5TA 3G25A 4E1NA 1IKVA 1LWFA 3OJUA 1E4GT 3U9ZA 1J5EK 1BG3A 2FBTA 3CC7N 5AFUH 2X74A 3TSUA 4BWMA 3I0SA 1K8AO 1SKWA 4J2BA 5BR8K 2NRWA 4FCYA 4FZZA 4XH4A 5JS1A 2YX6A 3D2FA 2V52B 2Z1JA 4JI6K 2W40A 4LF8K 2O8DB 2ATQA 2YHXA 2QWLA 3QEXA 3ZETA 2WTUA 1DT9A 1KLMA 3BP8A 1T3VA 3M8QA 2E1ZA 3VERA 3SAHA 3OYFA 1YAGA 4BRIA 3IS9A 2Q2RA 3VPZA 4IBNA 4BE0A 1XMQK 3J7AP 4JEPA 1N5YA 4NCAA 4BACA 3ZX2A 4B1ZA 4H0VB 1J53A 4CF2A 1JLGA 3ATUA 1KRPA 5KGWA 2QWPA 3NVKA 1B9DA 3HL8A 3MX2A 4DF8A 4M7YA 2D1KA 1A5WA 1S9EA 3VQDA 3AO2A 1RDCA 2QTDA 4J8FA 3CJ1A 3KLGA 1GLFO 3F9KA 3HYFA 5BRDA 1WBDA 4H5WA 2PZSA 3F9MA 1HNZK 2CH6A 3EL2A 2NRXA 3P39A 1RT6A 4FJIA 2EWSA 3WXKA 4DS5A 3CC4N 2WC9A 1NK0A 4DQPA 2YJFA 3CIPA 4FZXC 2F4VK 1D5AA 3ZYYX 4FJ7A 4JHDA 3CQ8A 3V9ZA 4O8UA 1QQOA 4DFPA 2F96A 5AR0A 3BZCA 1VSMA 4IJNA 1Z26A 4BGBA 3U8XA 2B5JA 3O80A 4EIAA 4BR5A 1RDUA 2V7YA 4W5QA 4JKHA 1HLUA 3H6EA 3R6MA 4YOUA 3JSMA 3WQTA 1JCGA 3VEXA 4BC2A 4HCCA 3VQ7A 2ZE2A 4LF5K 3ZT0A 4YY3K 1WAFA 4F3OA 3OVNA 3S3MA 1EP4A 2AJQA 4EAHD 4MDBA 1YVUA 3BZKA 4KB1A 3VN5A 2P9NB 4CVNE 1S5JA 2O4GA 3WEEB 3LWLA 3RMBA 1ZC6A 3SBTA 2O8BA 4JKGA 3L2RA 1P8ZA 5EXWA 4CGDA 2D0BA 1KAXA 1EKEA 3NDKA 4NYFA 4BC4A 3CFRA 5J2MA 1HYSA 1XWLA 1D9FA 4DU3A 3E66A 5C42A 3JAMO 1C0GA 4C8MA 1HYZA 4Y1DA 2YHAA 1WAJA 1RBTA 1XHXA 2AP1A 1XNQK 4FWOA 3P83D 1NJIO 2ZGZA 4CZHA 1TAUA 3UKRB 3CCEN 4UY8O 3UE5A 5BN9A 5AQVA 4ILGB 1QVGM 3ATVA 3NF6A 3HPOA 2VQFK 4DV5K 5LMUK 3A5MC 3HO1A 2XY5A 4E19A 3ZX3A 3CD6N 1KAYA 2P5GA 3VGMA 3QESA 3QEPA 1NOYA 1HQEA 4CZMA 3OS1A 1NOZA 2A1RA 2GX9A 5EY4A 4CJQA 3UKUB 3SUPA 4ZTFA 2YCHA 2P9UA 4E3SA 3CJBA 1UA1A 1MU2A 2CGJA 4FWNA 4Z4CA 3OYKA 4FK4A 4DSLA 1ZBIA 4DR1K 4JD2A 4EP4A 4CBXA 4EZ9A 2GTDA 4KHUA 3LPUA 2XRIA 4YDUC 3KKSA 2P9SA 3SUQA 4CE9A 4RG8A 4U7BA 3L4QA 5JLFA 2BUPA 1RT3A 4HVJA 4YNQA 5JVHL 5I42A 2IIRA 3AVFA 1JLAA 4RW6A 5AFUA 3ASMA 1YJ9N 3KK2A 4KKOA 5AZJA 5F0XA 2I7PA 4W5RA 3NGYA 1EETA 4F9OA 2GEMA 3DLHA 2O8EB 3AVNA 1O13A 3RSEA 4FJXA 3NHGA 4BRKA 1S1VA 1S3XA 1X9JA 3P1GA 4I2PA 4YDUA 4FK0A 1X1PA 5J2PA 3A5OC 5SZTA 3O3HA 4MLHA 4Z4HA 4H5TA 5T7BA 4ELTA 2A42A 3A8YA 1T44A 3QEWA 3QEVA 2HHTA 3L2VA 1J6ZA 3AGKA 4I2QA 3GOIA 1KAZA 2QW9A 3NAEA 4CHQA 2O8CB 3L2UA 1TV6A 4M41A 3TAGA 2BGGA 3VQ8A 3VQPA 1VQLN 3AVJA 4LC9B 4RCHA 4FJGA 4B9UA 3LDLA 5FRMA 1ITGA 3OYAA 1V4TA 4JKBA 3L4IA 4E7HA 3DLBA 3SAFA 4DTJA 2HBJA 3KWGA 4LF7K 1QZ5A 1NKBA 3EN9A 4KO0A 3ZSXA 4M3TA 1KSPA 3VETA 2ZJRL 4C8LA 1VSDA 3DJCA 1YXQA 3M8PA 2HHXA 2FBVA 2G8IA 1RTHA 4KHWA 1TK5A 2UXCK 1SUQA 1HNVA 2KFNA 4YOYA 1RT5A 1EWQA 2WONA 3P5JA 1BQMA 3H1QA 1NJYA 4CJUA 2WUSA 2Z1HA 3K5LA 3C7NB 4OX9K 4DTPA 2HF4A 3KIOA 1FKOA 3LAMA 4BREA 3H1VX 4G1QA 3QIPA 1SV5A 1Z05A 2EX3A 4IEIA 3CJAA 3D7EO 4PUOA 3ZT3A 3GBTA 3QDKA 5EOYA 1CZAN 2XO7A 4Z0UA 1RILA 4LSNA 2PFUA 2WOMA 1NGCA 5E26A 4B1XB 4DKWA 4FK2A 1I39A 1I3AA 4RWTA 5GAGP 3WNEA 3R3LA 3ZT1A 4FWPA 3C6AA 4YORA 4E1MA 3HRGA 3LANA 3MEGA 1BIUA 4QS9A 4BR4A 3AARA 2VCPA 3TU5A 4DSFA 2HHUA 2D5RA 2UXDK 2YNHA 2IVOA 3D0PA 4JAXA 1FW6A 1NMDA 3L3VA 3V6DA 4B1VA 2D0AA 4BG9A 1IO2A 4OVLA 3VQCA 5BN8A 4LSLA 4DG1A 1JCEA 3D2FB 2NRZA 3CCJN 1SAZA 3J7YP 4DQRA 3VQ9A 3TAMA 2ETJA 3HPGA 4O5BA 3TARA 5EX5A 3ZETB 4CEQA 3SK3A 2FBYA 4DQSA 1WSEA 5B8HA 5FPNA 3AO5A 3EE8A 1UAXA 3N4QA 4BC3A 4OPJA 4H4OA 1BOTO 1Q86O 1RT7A 4JKAA 2HHSA 4X64K 3THYA 3UIQA 3HK2A 4O44A 3THVA 3SBGA 4N56A 3IFRA 3VOVA 3TABA 2VG6A 3F2KA 1TKTA 4CJLA 2HNYA 1BIZA 1SKRA 3ALYA 4CIEA 4KB0A 4A57A 3EY1A 1NBWA 3QNNA 3OYBA 1Q81O 4CFAA 3TAPA 2F9WA 1TK0A 3CQXA 3ULDA 4JI8K 1ATSA 3T7ZA 3FZMA 4F8RA 4JN4A 1Z25A 3G71N 5KQDA 2G8WA 4FL9A 4BC5A 5AQUA 1X9MA 3MEEA 1XMOK 1W2BM 1EO1A 1DTTA 3ZCMA 2QKBA 2RN2A 5HOOA 3DLKA 3CCMN 1LV5A 3RRHA 2P51A 5LY3A 3HVTA 4JHDB 3ZSYA 3A0IX 1CXUA 3EE9A 3B6PA 2P9LA 5JS2A 4XH5A 3I8DA 4XIUA 3Q7CA 2XY8A 3HSCA 2G8UA 4CHYA 4FLWA 3T1YK 4KTZA 1X3NA 4CGGA 3GE1A 4CEOA 3SQ0A 2Z1GA 5FPMA 5SWMA 3D2EA 4ELVA 1BU6O 2PAVA 2OZMA
chains in the Genus database with same CATH topology
3VERA 3SAHA 3QFUA 1YAGA 4BRQA 4BRIA 4KH5A 2Q2RA 1S22A 1DGKN 4JKEA 3VPZA 4EFHA 3M5RA 3M1FA 2HBMA 3VEWA 4JEPA 5FPDA 1YF5L 3HOTA 1YJWN 3TSPA 4JKGB 4B1UB 4JK7A 4K41A 3O4WA 1N8RO 3ZX2A 4B1ZA 4H0VB 2A41A 1K8KA 3R1XA 4BR7A 3I56N 3ATUA 4BRLA 4RTFD 4AM6A 5AQPA 3CETA 4B1YB 2QWPA 3O1BA 3NVKA 1RDWX 3W0LA 3AAQA 3MN5A 3MX2A 3WQUA 4M7YA 1EQYA 2D1KA 4BG8A 3DXKA 1MWKA 2YI1A 2QTDA 4J8FA 1MDUB 1BDGA 4AM7A 3CJ1A 1VQ6N 5H1SQ 1VQKN 2A5XA 1GLFO 5BRDA 4H5WA 3DAWA 3QFPA 3O9UA 4IOXA 3F9MA 3BEXA 4H0TB 3FZKA 2CH6A 3EL2A 2NRXA 2E2PA 1GLDG 2OTLN 4GVEA 3P39A 3MN7A 2A6AA 2EWSA 3H3NO 1NGAA 4O5FA 4O8KA 3WXKA 3CC4N 2WC9A 4BR2A 2IVPA 3CCUN 2YJFA 3CIPA 4PL8A 4DQ8A 4R79A 4H0XB 4IDHA 3ZYYX 5ADXH 1RGIA 4JHDA 4Y0WA 4O8UA 1QQOA 5AQRA 4A62A 1OKJA 3J7ZO 3WXIA 5AQGA 1JJ2M 5AR0A 5AQJA 3CHWA 2P9UB 4IJNA 3FE1A 1V4SA 5AQQA 1HKBA 3L0QA 3VF6A 4BGBA 2JWLA 2P9KB 2KKZA 3LDNA 3U8XA 4GV3A 3E1YA 4L3QA 4FO0A 3O80A 3UB5A 4BR5A 4EIAA 4MLEA 1RDUA 3VTIA 1GLBG 2V7YA 4JD2B 2UYTA 5BRHA 5GIPA 4JKHA 1HLUA 3H6EA 3R6MA 1SZ2A 4YOUA 3DXMA 2Q97A 3LDOA 3WQTA 1JCGA 3SJHA 3CC2N 2Q0RA 3CJ9A 3VEXA 4BC2A 4WFBL 4OO1J 3CMEN 4WCEL 3TPQA 2P9SB 1YUWA 4JKFA 4K25A 4BRPA 3VESA 5AQXA 1H1VA 3CERA 1T6DA 4EAHD 4MDBA 5HL7L 3CCLN 4CZIA 4Z94A 2AA4A 2P9NB 3MN9A 3WEEB 4CD3A 4EHTA 1ZC6A 2F9TA 4IZ9A 5AQKA 3SBTA 4JKGA 5M1OA 1MWMA 5BR9A 4CZFA 2CH5A 5AZJB 3QBWA 4H0PA 1P8ZA 5GAHP 4FWRA 5EXWA 3O5BA 2GWKA 1K9MO 1KAXA 1KQSM 2OANA 2FF6A 5AQFA 3RSEB 4BROA 4XH1A 1Q7YO 1U6ZA 4BC4A 2QEXN 2ASMA 1W97L 3E66A 4IXCA 3FZLA 4WQ4A 3S41A 1C0GA 3VF4A 3CCSN 2FSJA 3KWIA 4FWQA 2FSKA 2AP1A 4BRMA 4ILJA 3ENHA 2DPNA 3O9RA 4FWOA 2QWNA 4ISGA 5BREA 1NJIO 1JCFA 2ZGZA 3WXMB 4A2AA 2HSTA 4CZHA 2Q1NA 5C10A 2RE2A 3A5NC 4BY9C 3E9PA 5JMVA 3VGKA 4JK8A 3UKRB 5AQOA 5M1PA 4C23A 1KC8O 3CCEN 1TUUA 4UY8O 3UE5A 4U67L 5BN9A 2VYPA 5AQVA 4H0YB 3QB0A 4ILGB 2ITMA 1QVFM 1QVGM 3BUZB 3CI5A 3ATVA 5AQYA 4KH6A 3JS6A 3CJ7A 3A5MC 1XUPO 3HOSA 4YOVA 2QWRA 3ZX3A 3CD6N 1BA0A 3U9DA 4YOWA 1KAYA 4ISFA 4MDAA 3TTFA 3VGMA 2VGMA 3R8EA 5AQIA 1NWKA 2V51B 3MN6A 3U4LA 4CZMA 2GX9A 3HM8A 2WFBA 2D4WA 4IWVA 5EY4A 3UKUB 2BTFA 2YCHA 1DEJA 1ATNA 3VEYA 2P9UA 2NRTA 4WYBA 4DB3A 5KPZA 3CJBA 3IUCA 5BPNA 4A2BA 3PIPL 2CGJA 2P9KA 5CR4A 5M1QA 1VQ4N 4FWNA 1XQSC 4CD1A 2QI2A 3SLCA 4C1NK 4BQZA 4A5AA 1KD1O 3L6QA 2V7ZA 3H45C 4H5RA 4JD2A 2I7NA 3C0BA 4CBXA 1NGIA 1NGDA 2P9IB 1ATRA 4ISEA 4BGAA 3O6WA 4A5BA 3E9LA 5GIOA 3CCVN 2GTDA 3CQYA 2YHYA 3MCPA 4DHYA 5F2RA 1S72N 4YDUC 4GV9A 5JICA 1NLVA 2P9SA 5I9EB 4BRNA 2A40A 5DM6L 1WOQA 2GUPA 4I6MB 2YHWA 2ZWHA 3HTVA 5AZIB 5LJWA 4U7BA 3L4QA 5JLFA 2BUPA 2P9NA 3JXUA 3KK7A 3VGLA 3WEEA 2OTJN 5FPEA 4HWIA 3WT0A 1GLCG 2PBDA 4B9QA 5JVHL 2IIRA 3AGRA 1OVYA 3HBTA 5AFUA 1WUAA 2H3GX 1YJ9N 1MA9B 3ID6A 2ZGYA 2E2NA 5AZJA 5F0XA 2I7PA 4BQLA 4F9OA 2IVNA 2QWOA 2GEMA 5KPTA 3C6HA 3NMUA 5JLHA 1HKGA 4GNIA 3ENOA 4CZKA 3I55N 1P90A 1DKGD 3CF5L 1O13A 3RSEA 3O9SA 2Q36A 1U2VB 2CGLA 1HUXA 5TKYA 4BRKA 1ILYA 3A5LC 4BRGA 3FR0A 4QS7A 5C0YA 1VQ5N 5F1XA 1X9JA 1S3XA 2J4RA 1K73O 4YDUA 4IFEA 3DLLL 1T6CA 2JWKA 5CE3A 2A3ZA 3CXCM 5LJVA 1NGJA 3A5OC 3KZBA 4MLHA 3UKRA 2NNWA 3J8AA 4H5TA 3SAGA 3QMLA 3PLAA 3VF2A 2NRVA 3FZFA 3BF3A 1R59O 4WQ4C 5ELZA 4B1WB 3A8YA 2A42A 4NLBA 1T44A 3WUHA 2WBNA 1G99A 3DWLA 3VEOA 4AF1A 3LM9A 4EHUA 3ULEA 4DCHA 5BPMA 4A59A 3O8MA 1J6ZA 3AGKA 3GOIA 3LM2A 4HTLA 5C12A 3HZ6A 1KAZA 2QW9A 4BRCA 2E2QA 3NVMA 3MK6A 3OHRA 4WFAL 3G4SN 4IO8A 2ZF5O 1KXPA 3HI0A 3MX5A 3OBWA 2VGNA 3MWTA 3UKUA 3I8BA 3M3ZA 3R9PA 1VQLN 3MWPA 4LC9B 2GELA 4RCHA 1M1KO 1GLJO 3LDLA 4M7XA 2ASPA 1V4TA 3E9OA 5AQLA 4JKBA 3L4IA 5AQMA 3Q7BA 3SAFA 4K42A 2HBJA 1VQ7N 1M90O 3H3OB 3N4PA 4MO5A 3KWGA 2P9IA 4IO9L 1QZ5A 3TSQA 1BO5O 1QZ6A 4BR0A 5DM7L 5M1KA 3EN9A 4WFNL 1E4FT 4H5VA 3ZEUB 5CHIA 4PKHA 3TTCA 4E1JA 1TYQB 4IEEA 3VETA 2ZJRL 3VENA 3DJCA 3LDPA 1YXQA 3RVCA 2QXLA 3CJCA 4I6MA 5AZIA 4CI6A 1VQ8N 1VQPN 5AQNA 3K9JA 1LOTB 2E20A 4BVPA 1QHAA 4FWLA 5ADXA 4NO7A 4CJ7A 5M1FA 4YOYA 3ULEB 1YJNN 5KPRA 3H1QA 2ZJQL 2KLAA 2GWJA 2HMPA 2WUSA 2D0PA 3C7NB 2QA4N 4JKDA 3FZHA 1LCUA 3D6RA 2HF4A 5AQSA 2P9PB 4NLCA 3AAPA 4OPAA 3P31A 3M6GA 4BREA 3WXLA 3QICA 3AY9A 3H1VX 1Z05A 5EVZA 1HPMA 4GY2B 4IEIA 4CBUA 3CJAA 3D7EO 5C2DA 1YI2N 1U2VA 4OPHA 3GBTA 3QDKA 2FSNA 1CZAN 5EOYA 4FVUA 2PFUA 2Q31A 3P38A 5KQ8A 1YHQN 1NGCA 5E26A 2FF3B 4PKGA 3CCRN 1HJOA 4B1XB 2BH1A 4DKWA 3MDQA 2D0OA 3ENBA 3MMVA 4JNEA 4WQ5C 4RWTA 4PHTX 3EZWA 5GAGP 3G6EN 1BWFO 3R3LA 4FWPA 3C6AA 3B8AX 4YORA 3HRGA 3K9KA 5BPLA 4PL7A 1VQ9N 3O1WA 1Y64A 4CZGA 4IOCL 2W41A 4M63C 4QS9A 3KHYA 4BR4A 3AARA 4PKIA 1ZBSA 3FFKB 2VCPA 5C15A 3TU5A 3QBXA 4FOEA 1Q18A 2KHOA 5E84A 4YOTA 3IDHA 1D4XA 3W3DA 2IVOA 4JAXA 1NMDA 1GLLO 4BVOA 4B1VA 2P9LB 1YVNA 2FXUA 4FPAA 4BG9A 3CCQN 4NB4A 5BN8A 2NLXA 3P4IA 3MCAB 3ID8A 1YIJN 1JCEA 3VEVA 3D2FB 2NRZA 3CCJN 1SAZA 1RFQA 1IJJA 3BF1A 4IJAA 4JK9A 2YJEA 1QQMA 4WQ5A 5JVGL 3O08A 2ZJPL 5GADP 3EKUA 4KH4A 1YITN 5EX5A 5AQZA 1SQKA 3ZETB 2QWMA 3D2EB 1GLEG 3SK3A 4FWSA 1VAZA 5B8HA 3ZEUA 4FWKA 5FPNA 1TYQA 2F7TA 3EE8A 4JKCA 3N4QA 1ZXOA 5AQWA 4BC3A 4CZJA 1SS6A 1BOTO 1Q86O 5BRFA 4BRHA 4JKAA 4IOAL 1NM1A 3SMPA 3IKMA 4K43A 3VMFB 2E8AA 4KBOA 3GL1A 4QS8A 5AQHA 3SMSA 1QQNA 5GINA 1K8KB 2RHKA 1NGBA 3SBGA 3IFRA 3TTDA 3IMXA 4H03B 3VOVA 3F2KA 4ILHA 3VTHA 4FOIA 3CPWM 3C7NA 2HBLA 4XEIA 1BUPA 3GDQA 1VQMN 1TUYA 2P9PA 2Q0UA 3LDQA 1HKCA 5MLCQ 3O9TA 4A57A 3DXKB 1NBWA 1X3MA 1XC3A 2NZTA 3CPEA 2E2OA 1Q81O 4YOXA 2F9WA 1VQON 3FGUA 3CQXA 1HX1A 3C65A 4H5NA 4CZEA 4GV6A 2NRRA 2QM1A 1ATSA 2HBKA 2CGKA 3OW2M 3T7ZA 3FZMA 1Q82O 3H46O 5GAEP 1VQNN 1C0FA 4FPBA 4JN4A 4BR9A 2FLOA 3G71N 5KQDA 2ASOA 4BRFA 4C1NI 3OA9A 4FL9A 4BC5A 4H0OA 5AQUA 1BA1A 2E88A 3PIOL 4FSVA 3F5TA 1W2BM 3G25A 1NGEA 3VEZA 1EO1A 5HOOA 3KVGA 3CCMN 3ZX0A 1Z6RA 4WF9L 1E4GT 3U9ZA 1BG3A 2HOEA 3OBYA 3CC7N 5LY3A 4JHDB 4A61A 5AFUH 3A0IX 3TSUA 3EE9A 4FWMA 3LL3A 1K8AO 3FLCO 2QWQA 2P9LA 2NRWA 4XH5A 3Q7CA 4G9ZA 4BRDA 4XH4A 3HSCA 2YX6A 3D2FA 2VWBA 2HF3A 2NRHA 1X3NA 3I33A 1IG8A 1NGHA 2V52B 3GG4A 1NGGA 3GE1A 3O9QA 3WXJA 2W40A 4BRAA 3EO3A 4MO4A 2YHXA 2E1YA 1NGFA 2QWLA 3DXMB 5C2FA 1GLAG 5TKWA 3ZETA 3CMAN 5FPMA 3D2EA 5M1NA 3EKSA 1DT9A 3BP8A 1BU6O 3T69A 1T3VA 2PAVA 4CZLA 1ESVA 5AQTA 4CBWA 2E1ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M5R A;  2RHK A;  3KWG A;  3D6R A;  3KWI A;  3O9U A;  3O9S A;  3OA9 A;  4OPA A;  2GX9 A;  3P31 A;  3O9R A;  2KKZ A;  3O9Q A;  3P39 A;  3F5T A;  3L4Q A;  3RVC A;  3O9T A;  4OPH A;  3EE8 A;  3P38 A;  3EE9 A; 
#chains in the Genus database with same CATH topology
 4LD0 A;  3QFU A;  3ISN C;  4KH5 A;  4B9T A;  2LSN A;  3M1F A;  1YF5 L;  4E7K A;  2O8B B;  3TSP A;  4JKG B;  4B1U B;  1JLF A;  4FW2 A;  4M45 A;  4AHU A;  1N8R O;  4Z4E A;  4L8R B;  3J81 O;  4BRL A;  4AM6 A;  5AQP A;  4CEF A;  3CET A;  3O1B A;  1RDW X;  4LF6 K;  4KAZ A;  3AAQ A;  1XC9 A;  1BGX T;  3WQU A;  4BG8 A;  1WN7 A;  1MWK A;  4RW9 A;  1BDG A;  2HHH K;  1VQ6 N;  4ICL A;  5H1S Q;  3DAW A;  3QFP A;  3O9U A;  3RMD A;  3RWU A;  3FZK A;  1X9S A;  2E2P A;  1GLD G;  4CF0 A;  1NJW A;  3MN7 A;  4JI7 K;  2A1S A;  3AVA A;  4O8K A;  1N34 K;  2IVP A;  5C25 A;  3AVH A;  5FRO A;  4PL8 A;  4DQ8 A;  3KKR A;  4H0X B;  4GMJ B;  5FRN A;  1VSF A;  4DUZ K;  1VSE A;  4Y0W A;  3J7Z O;  1TAQ A;  1OKJ A;  1B92 A;  4DU1 A;  1JJ2 M;  2P9U B;  3FE1 A;  5AQQ A;  1HR0 K;  3AVG A;  3L0Q A;  4N47 A;  3VF6 A;  2KKZ A;  1IG9 A;  3PUF A;  1RBU A;  3BY5 A;  4L3Q A;  4CJP A;  4FO0 A;  4AHV A;  3M8R A;  4DFK A;  3EYZ A;  4JD2 B;  2UYT A;  1WLJ A;  4R5P A;  4IKF A;  4DSI A;  2YNI A;  2DFF A;  3CC2 N;  3MEC A;  3CJ9 A;  4OO1 J;  2P9S B;  4JKF A;  4DSJ A;  3L2W A;  5D3G A;  1H1V A;  2HHV A;  5HL7 L;  3CCL N;  4Z94 A;  3MN9 A;  4EHT A;  1KVB A;  4X65 K;  5M1O A;  1QSY A;  1RT4 A;  5BR9 A;  3SQ2 A;  4CZF A;  1S6Q A;  2CH5 A;  5AZJ B;  3QBW A;  4FJM A;  1QHT A;  2OAN A;  3RSE B;  1U6Z A;  2QEX N;  4WQ4 A;  3VF4 A;  3CCS N;  2KZM A;  3U6F A;  3KWI A;  4FWQ A;  4K8X A;  1IBK K;  1DLO A;  2DPN A;  5BRE A;  4Q0B A;  2Q1N A;  4IDK A;  5C10 A;  4BY9 C;  2IOC A;  2OCE A;  3E9P A;  3VGK A;  4JK8 A;  5M1P A;  4O55 A;  2VYP A;  3QB0 A;  2VWJ A;  4LFB K;  2ITM A;  1EXQ A;  3CJ7 A;  1XUP O;  3SI6 A;  2YHB A;  3BGR A;  3SPZ A;  4B9V A;  4MDA A;  2NUB A;  3TTF A;  2VGM A;  4AH9 A;  2Y1I A;  4PY5 A;  4QOZ B;  1C1B A;  5AQI A;  3MN6 A;  3HM8 A;  2VWK A;  4IWV A;  4M3W A;  3HXM A;  1NK6 A;  4DB3 A;  2NRT A;  5BPN A;  1T05 A;  4A2B A;  3PIP L;  3OJS A;  1VQ4 N;  4CD1 A;  2QI2 A;  4C1N K;  3K5M A;  4BQZ A;  3DRR A;  3L6Q A;  3H45 C;  1HYV A;  3C0B A;  4QCL A;  1NGD A;  1ATR A;  3O6W A;  4A5B A;  4EP5 A;  3CCV N;  4FLX A;  3CQY A;  3ZSW A;  3MCP A;  4DHY A;  3CM6 A;  4MFB A;  1S72 N;  2OPS A;  1NLV A;  4CHN A;  5I9E B;  4ZHR A;  2HHW A;  4CFC A;  1F21 A;  1D9D A;  2F8T A;  3JXU A;  3KK7 A;  3VGL A;  4DMN A;  4OKE A;  4HWI A;  1GLC G;  4B9Q A;  4M3Z A;  5J2Q A;  3AGR A;  1OVY A;  1L3V A;  1WUA A;  2ZGY A;  3MXI A;  3DLG A;  5KPT A;  1VSI A;  1NK7 A;  5JLH A;  1HKG A;  4GNI A;  3I55 N;  3AO3 A;  1P90 A;  3NFA A;  3CF5 L;  1L3S A;  3O9S A;  3SQ4 A;  2CGL A;  1HUX A;  5FLX O;  3A5L C;  3DRS A;  3FR0 A;  5C0Y A;  2X78 A;  5F1X A;  4CGI A;  2J4R A;  1K73 O;  4CHZ A;  4IFE A;  2JWK A;  2OYQ A;  5CE3 A;  4AHT A;  5LMN K;  3CXC M;  5KRT A;  5LJV A;  3KZB A;  1LAW A;  3RTV A;  2O8F A;  4I7F A;  3VF2 A;  4FW1 A;  4FJN A;  4B1W B;  4NLB A;  3DWL A;  4KTW A;  4HHT A;  3ULE A;  3LM2 A;  2KTQ A;  5C12 A;  1B9F A;  3NF7 A;  3NVM A;  1NK4 A;  4IO8 A;  2E5L K;  2ZF5 O;  3T19 A;  3HI0 A;  3MX5 A;  3G0Z A;  4DTS A;  3WNH A;  4NXN K;  3I8B A;  3R9P A;  3VQB A;  4OLA A;  2GEL A;  1M1K O;  3ZSR A;  4M7X A;  3SYZ A;  1O1W A;  3Q7B A;  3OYI A;  1JKH A;  4MO5 A;  3NH1 A;  4FJ8 A;  3TSQ A;  4BR0 A;  5M1K A;  3S9H A;  4H5V A;  1CXQ A;  4PKH A;  1HPZ A;  1UOC A;  1TKX A;  5DMR A;  3RVC A;  3CJC A;  4FM0 A;  4I6M A;  5AQN A;  3K9J A;  2E20 A;  4BVP A;  1QHA A;  4FWL A;  1IBM K;  4NO7 A;  4CJ7 A;  5M1F A;  1YJN N;  2XY7 A;  5KPR A;  3SCX A;  3ZSQ A;  2KLA A;  2XHB A;  4K0K K;  1UWB A;  4O0I A;  1NG9 A;  4JKD A;  5AQS A;  1KVA A;  4NLC A;  3AAP A;  4OPA A;  3WXL A;  3QIC A;  4CJF A;  4CBU A;  2ITG A;  2HND A;  3PO5 A;  4V19 S;  4E7L A;  3VA0 A;  4E0D A;  3SQ1 A;  4OPH A;  3WNG A;  1WSJ A;  2FSN A;  1QE1 A;  4LFC K;  5KQ8 A;  2FF3 B;  4DTU A;  1HJO A;  4J2E A;  4CJE A;  4JS5 A;  2D0O A;  4JNE A;  3C95 A;  3EZW A;  4PHT X;  3G6E N;  1BWF O;  1NJX A;  4AHC A;  4F3T A;  5HRO A;  3K5N A;  1KTQ A;  5BPL A;  4W5N A;  1VQ9 N;  3O1W A;  4CZG A;  4IOC L;  4BE1 A;  2W41 A;  1VK0 A;  3NGI A;  2BAN A;  4PKI A;  3FFK B;  3OYE A;  5C15 A;  1FKP A;  2X6N A;  3W3D A;  2HNZ A;  5KI6 A;  3V1R A;  2P9L B;  4FPA A;  3CCQ N;  3SUO A;  3ID8 A;  4E7J A;  2W6K A;  5I3U A;  4CEZ A;  2YJE A;  3FFI A;  3O08 A;  1A5X A;  3EKU A;  4OGE A;  2QWM A;  1VSL A;  3D2E B;  4FWS A;  4B3R K;  1VAZ A;  3ZEU A;  4FWK A;  2F7T A;  1ZXO A;  5AQW A;  4CZJ A;  3AVK A;  4DTM A;  4BRH A;  1W9H A;  1NM1 A;  3L3U A;  2E8A A;  3GL1 A;  4QS8 A;  1W7A A;  4CEB A;  5GIN A;  1NGB A;  3TTD A;  3IMX A;  4H03 B;  3CPW M;  3ZLJ A;  2DTU A;  2EHG A;  1BUP A;  1S1W A;  3GDQ A;  1VQM N;  1TUY A;  2P9P A;  3PV8 A;  2OPQ A;  5FDL A;  4GKK K;  4CJ5 A;  2UUB K;  4DLE A;  3V9S A;  1T8E A;  1X3M A;  2FC0 A;  4DV6 K;  4DV3 K;  4YOX A;  4CFD A;  3LPT A;  1HX1 A;  1C1C A;  3C65 A;  4H5N A;  4GV6 A;  3QIO A;  2NRR A;  2QM1 A;  1Q82 O;  1BL3 A;  4CGH A;  1NK5 A;  1BQN A;  5C24 A;  1G15 A;  1BA1 A;  4FLU A;  4KHN A;  1CLQ A;  1NGE A;  3VEZ A;  2PYJ A;  1Z6R A;  4WF9 L;  2YKM A;  1KFS A;  2HOE A;  4KTQ A;  2KQ2 A;  3G10 A;  4A61 A;  1EX4 A;  1C1A A;  1ASU A;  3EEQ A;  4FJH A;  4JI3 K;  5CY4 A;  2HVH A;  3LP3 A;  4G9Z A;  4BRD A;  3THW A;  2VWB A;  2NRH A;  5HP1 A;  4YFU A;  1IG8 A;  1QSL A;  4J2A A;  3O9Q A;  4FJ5 A;  3EO3 A;  1BCM A;  4MO4 A;  2IGI A;  2HMI A;  1NGF A;  5C2F A;  1Q9Y A;  5TKW A;  3CMA N;  4B9S A;  4CGJ A;  2QKK A;  4CIF A;  3HP9 A;  4FJJ A;  4GVM A;  4PWD A;  1S22 A;  1DGK N;  4JKE A;  4EFH A;  3ZT4 A;  2HBM A;  3VEW A;  4LY7 A;  4H8K A;  4K8Z A;  4CHP A;  4JK7 A;  4K41 A;  3O4W A;  4OPK A;  4DR5 K;  1LWC A;  1S1T A;  2A41 A;  4CF9 A;  3R1X A;  3LAK A;  3S3N A;  1RBS A;  4NYN A;  1YT3 A;  1OH6 A;  1VRT A;  4BDP A;  3THX A;  4TSX A;  1OVQ A;  1EQY A;  1L3T A;  3DXK A;  2YI1 A;  3OYN A;  1MDU B;  1VQK N;  2A5X A;  1NK8 A;  4DFJ A;  3QO9 A;  3BEX A;  4GKJ K;  3QIN A;  3DM2 A;  3AVL A;  2A6A A;  4KI6 A;  3H3N O;  3NBP A;  3OYC A;  1NGA A;  4O5F A;  4M42 A;  2UUA K;  1LW2 A;  3NF9 A;  4BR2 A;  4FJK A;  4UQG A;  4F4K A;  3TWH A;  2HW3 A;  1D8Y A;  4IDH A;  1TVR A;  3L2Q A;  5AQR A;  4A62 A;  4KRF A;  3PO4 A;  2GBZ A;  3CHW A;  4ZTJ A;  3QET A;  4CES A;  1V4S A;  2JWL A;  4DF4 A;  1KVC A;  4RW7 A;  3PX4 A;  3E1Y A;  4KRE A;  2UXB K;  1ZBL A;  3NH0 A;  4DSE A;  1BHL A;  3M8S A;  3AVB A;  5BRH A;  3KLF A;  3RMC A;  1SZ2 A;  3DXM A;  3LDO A;  3SJH A;  2Q0R A;  4WFB L;  4ELU A;  4WCE L;  4CER A;  4BRP A;  3VES A;  5AQX A;  3CER A;  1U48 A;  1L3U A;  3LAL A;  2W42 A;  3OYG A;  4CZI A;  4DU4 A;  3VQ5 A;  1N33 K;  4J2D A;  2QK9 A;  4PQU A;  3KD5 E;  4H0P A;  2E6M A;  2G8F A;  4C8K A;  5IWA K;  2GWK A;  1KQS M;  4B3M K;  1U49 A;  4CK1 A;  4B9L A;  5AQF A;  1Q7Y O;  4DQQ A;  4XH1 A;  4B9M A;  3TAN A;  3FZL A;  3S41 A;  1OH5 A;  2FSJ A;  2UUC K;  3K2P A;  4BRM A;  4Y1C A;  4ISG A;  3ENH A;  3O9R A;  4QAG A;  2QWN A;  5DK5 A;  3K0S A;  1JCF A;  3WXM B;  2W6L A;  2HST A;  4A2A A;  3OYD A;  4FJL A;  2RE2 A;  3A5N C;  3AVC A;  5JMV A;  2O8F B;  5AQO A;  1BIS A;  4FLY A;  1JLQ A;  1TL3 A;  1J5O A;  4DS4 A;  4H0Y B;  1U4B A;  1VSK A;  3HPH A;  3S3O A;  3V9W A;  3ZSV A;  3BUZ B;  5AQY A;  4KH6 A;  3JS6 A;  1ZYQ A;  2YNG A;  2QWR A;  4FZY A;  3KK3 A;  3O4N A;  3U9D A;  4X66 K;  4ISF A;  4JV5 K;  3QER A;  1LAV A;  1NWK A;  2V51 B;  3U4L A;  2BTF A;  3VEY A;  1E3M A;  4WYB A;  4AHS A;  2JLE A;  5HRP A;  3SJJ A;  2IAJ A;  2P9K A;  5CR4 A;  4JI4 K;  1XQS C;  1CZ9 A;  2BE2 A;  4A5A A;  4H5R A;  3PX6 A;  2I7N A;  4FXD A;  3CFP A;  4ISE A;  4BGA A;  4FLZ A;  4AQY K;  1R0A A;  5F2R A;  1VHX A;  4GV9 A;  2A40 A;  5DM6 L;  1WOQ A;  2GUP A;  3ITH A;  2YHW A;  3HTV A;  4I6M B;  5LJW A;  3MXM A;  1TKD A;  4OLB A;  1JXE A;  3C94 A;  2OTJ N;  3AA5 X;  3WT0 A;  2PBD A;  5HLF A;  4DR6 K;  3HBT A;  1MA9 B;  2E2N A;  4BQL A;  3IG1 A;  3C6H A;  3NMU A;  4CZK A;  2KFZ A;  2Q36 A;  3K5O A;  5TKY A;  4JRP A;  4QS7 A;  3AA2 A;  3B6O A;  4DTO A;  3E01 A;  3EZ5 A;  2A3Z A;  1NGJ A;  3SAG A;  3DLR A;  4Z4I A;  4RW8 A;  3FZF A;  4WQ4 C;  1TKZ A;  4AF1 A;  1QSS A;  3KLI A;  5BPM A;  3O8M A;  2GUI A;  3LP0 A;  4M3R A;  5J2N A;  4N41 A;  3O4Q A;  3V1O A;  3HZ6 A;  3O3G A;  2E2Q A;  3MK6 A;  4BWJ A;  3AO1 A;  4WFA L;  1I94 K;  1KXP A;  4DR2 K;  4HUF A;  1N36 K;  3OBW A;  1ZBU A;  3M3Z A;  3AV9 A;  3MWP A;  4IG0 A;  4F2S A;  1J54 A;  2ASP A;  3E9O A;  5AQM A;  3K59 A;  1EWR A;  4B3O A;  3H3O B;  3N4P A;  1YTU A;  2P9I A;  5KRS A;  2OA8 A;  1QZ6 A;  5HBM A;  5DM7 L;  4WFN L;  1E4F T;  5CHI A;  3ZEU B;  4FJ9 A;  3TTC A;  4E1J A;  4IEE A;  3PX0 A;  3VEN A;  3LDP A;  3QEI A;  5AZI A;  4CI6 A;  1VQ8 N;  3MAQ A;  1VQP N;  1LOT B;  2Z1I A;  2HVI A;  1DTQ A;  1K6Y A;  4CJK A;  5CZ2 A;  4FM2 A;  1HNX K;  2HMP A;  1NKE A;  2QA4 N;  4KHS A;  1KFD A;  3FZH A;  2P9P B;  1IKX A;  4HUG A;  3M6G A;  3AY9 A;  5C2D A;  1U2V A;  1J9A A;  4ID1 A;  2R7Y A;  4DWI A;  4FVU A;  2Q31 A;  1VSH A;  4CIG A;  3P38 A;  4DTN A;  1ZBF A;  2P5O A;  2HB5 A;  4PKG A;  3CCR N;  3OYM A;  4CEA A;  2BH1 A;  3MMV A;  4Z4G A;  3KK1 A;  1VSJ A;  3B8A X;  4HCB A;  3MED A;  4JYA K;  3KLE A;  3NCI A;  4KHQ A;  1C0U A;  4M63 C;  1HNW K;  3VQE A;  1C0M A;  1Q18 A;  1D4X A;  5HRN A;  1WSH A;  4BVO A;  2FXU A;  3ZSO A;  2NLX A;  3P4I A;  1U47 A;  3OYJ A;  1FXX A;  1RDD A;  3VEV A;  3THW B;  1S1X A;  1RTJ A;  4KI4 A;  1JL2 A;  3OYL A;  1IJJ A;  3BF1 A;  1SL2 A;  1W0H A;  3DMJ A;  4CED A;  2UU9 K;  1QQM A;  5HRS A;  4KH4 A;  1SQK A;  4DFM A;  3OY9 A;  1GOB A;  1GLE G;  4C8N A;  4CW7 B;  1TYQ A;  1SS6 A;  3RMA A;  3SMP A;  4K43 A;  4KBO A;  3U3Y A;  2RHK A;  4LF9 K;  3VTH A;  4FOI A;  4DV7 K;  2QXF A;  3H08 A;  3AA3 A;  4XEI A;  5K14 A;  3THX B;  3RR7 A;  3TR8 A;  3LDQ A;  4FYD A;  3DXK B;  1XC3 A;  2NZT A;  4CJ4 A;  4DR7 K;  3CPE A;  1WSF A;  3HM9 A;  2CGK A;  2OPP A;  3OW2 M;  3QNO A;  1KLN A;  5GAE P;  1VQN N;  1C0F A;  3DLE A;  4FPB A;  4BR9 A;  1NKC A;  4B3T K;  1KCF A;  3PSI A;  4BRF A;  4C1N I;  2VG5 A;  4H0O A;  1FK9 A;  2E88 A;  3PIO L;  4FSV A;  3U3G A;  3V9U A;  2OZS A;  3SV4 A;  3KVG A;  4CJR A;  3ZX0 A;  3SZ2 A;  3OBY A;  2YV0 X;  1TK8 A;  3THY B;  1Q9X A;  3IAY A;  2KZZ A;  4FWM A;  4FM1 A;  3LL3 A;  4JI0 K;  1JL1 A;  1JLC A;  3FLC O;  2QWQ A;  4CJV A;  1ASW A;  4AHR A;  4O0J A;  2IC3 A;  4FVM A;  3BDP A;  4DQI A;  2HF3 A;  4DR4 K;  2E4L A;  3I33 A;  1NGH A;  2DY4 A;  3GG4 A;  1NGG A;  4H4M A;  3WXJ A;  4BRA A;  3TAQ A;  3V1Q A;  1NNE A;  2E1Y A;  3DXM B;  1RCH A;  2O4I A;  1GLA G;  4OKJ A;  5M1N A;  4CHO A;  3EKS A;  3CYM A;  3T69 A;  1NK9 A;  3VQQ A;  4CZL A;  1ESV A;  5AQT A;  4CBW A;  3SV3 A;  3SPY A;  4BRQ A;  3O3F A;  3M5R A;  5FPD A;  3PY8 A;  4KHY A;  3HOT A;  1YJW N;  3LP1 A;  1RNH A;  1K8K A;  4BR7 A;  3I56 N;  1ASV A;  3NGZ A;  4RTF D;  3V81 A;  2G8K A;  4B08 A;  4B1Y B;  1WB9 A;  4JI1 K;  4PA1 A;  3LZJ A;  3DOK A;  3W0L A;  1RT1 A;  1VRU A;  3MN5 A;  3HJF A;  4Q5V A;  3SNN A;  3SUN A;  4GW6 A;  1WSG A;  4YHH K;  1HNI A;  4AM7 A;  3HST B;  1L5U A;  3VQA A;  1IKY A;  1JLE A;  2G8H A;  3AVI A;  4IOX A;  4H0T B;  1RBV A;  2D0C A;  3TAF A;  2OTL N;  4GVE A;  4I9Q A;  1UA0 A;  2VQE K;  2RPI A;  1BI4 A;  2ZD1 A;  1C6V A;  3CCU N;  4R79 A;  1WBB A;  2PY5 A;  2HHQ A;  4IFY A;  5ADX H;  1RGI A;  5CYQ A;  1CZB A;  2YNF A;  3WXI A;  5AQG A;  1QTM A;  5AQJ A;  3AA4 A;  2B6A A;  4OKK A;  1RDB A;  1T7P A;  1HKB A;  2P9K B;  3LDN A;  4GV3 A;  3HT3 A;  3UB5 A;  4AIL C;  4MLE A;  3VTI A;  1GLB G;  4BDZ A;  2O8D A;  3AVM A;  5GIP A;  1SL0 A;  3T1A A;  2Q97 A;  4W5O A;  4FLV A;  4CK3 A;  4M3Y A;  3CME N;  3TPQ A;  1YUW A;  2Q3S A;  4K25 A;  2FBX A;  5J1E A;  1T6D A;  3J80 O;  2AA4 A;  4CD3 A;  2F9T A;  4IZ9 A;  5AQK A;  4CFB A;  2I5J A;  1MWM A;  4B8A B;  3L8B A;  4JRQ A;  3CM5 A;  5GAH P;  4FWR A;  1IV0 A;  4B8C A;  1RBR A;  3K58 A;  1TGO A;  3O5B A;  4BDY A;  4DV1 K;  1K9M O;  2FF6 A;  4JI2 K;  2OPR A;  1TL1 A;  4BRO A;  3RR8 A;  2ASM A;  1U45 A;  1W97 L;  4IXC A;  4IG3 A;  2FSK A;  4LH5 A;  4ILJ A;  4DTX A;  2X6S A;  1XI1 A;  4M3X A;  2G8V A;  4C23 A;  1KC8 O;  3KLH A;  1TUU A;  4BE2 A;  4U67 L;  4JI5 K;  1QVF M;  3CI5 A;  3I0R A;  3LZI A;  1U04 A;  1S1U A;  3RRG A;  2DFH A;  3HOS A;  4YOV A;  4IFV A;  4MQ3 A;  1JXB A;  3LP2 A;  1BA0 A;  4YOW A;  4X62 K;  1NMN A;  5CZ1 A;  3R8E A;  3LWM A;  2WFB A;  2D4W A;  1XNR K;  1GOC A;  1DEJ A;  2E6L A;  4DV2 K;  1ATN A;  4CF8 A;  4OGC A;  4KPY A;  5KPZ A;  3IUC A;  3C6U A;  1FJG K;  5M1Q A;  3JYT A;  3SLC A;  3T3F A;  2B4J A;  1KD1 O;  2V7Z A;  1NGI A;  2P9I B;  5AJ3 K;  5GIO A;  3OS2 A;  3E9L A;  2KW4 A;  2YHY A;  3CFO A;  5JIC A;  1RDA A;  4BRN A;  4O4G A;  3MXJ A;  3KD1 E;  2ZWH A;  5AZI B;  3PSF A;  4RW4 A;  2P9N A;  1Q8I A;  4CJT A;  4E7I A;  3WEE A;  1HJR A;  4CJ3 A;  5FPE A;  3QLH A;  4OJR A;  5IT9 O;  2H3G X;  4KV8 A;  3ID6 A;  3NE6 A;  4NXM K;  1S9G A;  2IVN A;  2QWO A;  3WNF A;  2ZM6 K;  2F8S A;  4M3U A;  3ENO A;  1DKG D;  2VG7 A;  2BDP A;  1U2V B;  2ZQB A;  3ZT2 A;  1ILY A;  4BRG A;  1VQ5 N;  4DLG A;  3DLL L;  1T6C A;  3CG7 A;  4N76 A;  1RTI A;  1JLB A;  4CGF A;  2IS3 A;  3DYA A;  3KJV A;  3UKR A;  2NNW A;  3J8A A;  3QML A;  3PLA A;  1RT2 A;  2NRV A;  3BF3 A;  1R59 O;  5ELZ A;  4C8O A;  3WUH A;  2WBN A;  1G99 A;  3VEO A;  3LM9 A;  4EHU A;  1QS4 A;  4DCH A;  2RKI A;  4A59 A;  4LFA K;  3VQ6 A;  1REV A;  4HTL A;  3DRP A;  4BRC A;  3OHR A;  3G4S N;  1XHZ A;  1T03 A;  2VGN A;  3A2F A;  3MWT A;  3UKU A;  1GLJ O;  5KGX A;  3VA3 A;  4KFB A;  1BCO A;  5AQL A;  1IKW A;  3HVR A;  2JGU A;  4N5S A;  4DTR A;  4K42 A;  3C6T A;  1VQ7 N;  4LF4 K;  1M90 O;  4IO9 L;  1IH7 A;  5A2Q O;  2P1J A;  4DSK A;  1BO5 O;  2YKN A;  1LWE A;  4DV0 K;  1TYQ B;  2QXL A;  1GOA A;  1RTD A;  5HRR A;  5ADX A;  3K57 A;  4F2R A;  3OYH A;  2GV9 A;  3ULE B;  3IRX A;  4CEE A;  2ZJQ L;  3D45 A;  2GWJ A;  4LH4 A;  2D0P A;  1NJZ A;  4JLH A;  4W5T A;  1LCU A;  3D6R A;  2O8E A;  3P31 A;  1SKS A;  4DV4 K;  5EVZ A;  1HPM A;  1X9W A;  4GY2 B;  1YI2 N;  1LW0 A;  1WSI A;  3TI0 A;  5KTQ A;  1A5V A;  4DUY K;  1YHQ N;  4HUE A;  3MDQ A;  3ENB A;  4WQ5 C;  4WE1 A;  4JS4 A;  3NH2 A;  1HRH A;  3K9K A;  4PL7 A;  5CYM A;  3V4I A;  4NCB A;  4EZ6 A;  4HTU A;  1Y64 A;  3KHY A;  5EU7 A;  1ZBS A;  3QBX A;  1N6Q A;  4FOE A;  2Y1J A;  2O8C A;  5E84 A;  2KHO A;  1N32 K;  4YOT A;  3IDH A;  3KTQ A;  1OH7 A;  4B9N A;  3LDS A;  1GLL O;  3OS0 A;  1YVN A;  4NCG A;  3AO4 A;  4NB4 A;  1S6P A;  4ID5 A;  3MCA B;  1YIJ N;  1SL1 A;  1OH8 A;  1RFQ A;  3HP6 A;  4IJA A;  4CJS A;  2PYL A;  4JK9 A;  2XY6 A;  4WQ5 A;  3VQ4 A;  2ZJP L;  5JVG L;  5GAD P;  4Z4F A;  1YIT N;  5AQZ A;  1Y97 A;  1QQC A;  3DOL A;  3DI6 A;  1WNS A;  4JKC A;  1HMV A;  3V9X A;  5BRF A;  4CK2 A;  1C0T A;  4IOA L;  4CCH A;  3IKM A;  3VMF B;  5AQH A;  3SMS A;  1QQN A;  1K8K B;  3T1H K;  1YTA A;  5LL6 Z;  4ILH A;  4I9L A;  3NF8 A;  3C7N A;  2HBL A;  3OTO K;  2Q0U A;  4KHP K;  5E41 A;  1HKC A;  5MLC Q;  3O9T A;  1NU0 A;  2E2O A;  2IDO A;  3F73 A;  3ZSZ A;  1VQO N;  1IBL K;  3FGU A;  4CEC A;  4E89 A;  1HQU A;  4CZE A;  4DR3 K;  3TAE A;  2RF2 A;  4FLT A;  2HBK A;  4B3S K;  3H46 O;  2FLO A;  4CJW A;  2ASO A;  3OA9 A;  2DFE A;  4CF1 A;  1ZBH A;  1BI4 B;  3F5T A;  3G25 A;  4E1N A;  1IKV A;  1LWF A;  3OJU A;  1E4G T;  3U9Z A;  1J5E K;  1BG3 A;  2FBT A;  3CC7 N;  5AFU H;  2X74 A;  3TSU A;  4BWM A;  3I0S A;  1K8A O;  1SKW A;  4J2B A;  5BR8 K;  2NRW A;  4FCY A;  4FZZ A;  4XH4 A;  5JS1 A;  2YX6 A;  3D2F A;  2V52 B;  2Z1J A;  4JI6 K;  2W40 A;  4LF8 K;  2O8D B;  2ATQ A;  2YHX A;  2QWL A;  3QEX A;  3ZET A;  2WTU A;  1DT9 A;  1KLM A;  3BP8 A;  1T3V A;  3M8Q A;  2E1Z A;  3VER A;  3SAH A;  3OYF A;  1YAG A;  4BRI A;  3IS9 A;  2Q2R A;  3VPZ A;  4IBN A;  4BE0 A;  1XMQ K;  3J7A P;  4JEP A;  1N5Y A;  4NCA A;  4BAC A;  3ZX2 A;  4B1Z A;  4H0V B;  1J53 A;  4CF2 A;  1JLG A;  3ATU A;  1KRP A;  5KGW A;  2QWP A;  3NVK A;  1B9D A;  3HL8 A;  3MX2 A;  4DF8 A;  4M7Y A;  2D1K A;  1A5W A;  1S9E A;  3VQD A;  3AO2 A;  1RDC A;  2QTD A;  4J8F A;  3CJ1 A;  3KLG A;  1GLF O;  3F9K A;  3HYF A;  5BRD A;  1WBD A;  4H5W A;  2PZS A;  3F9M A;  1HNZ K;  2CH6 A;  3EL2 A;  2NRX A;  3P39 A;  1RT6 A;  4FJI A;  2EWS A;  3WXK A;  4DS5 A;  3CC4 N;  2WC9 A;  1NK0 A;  4DQP A;  2YJF A;  3CIP A;  4FZX C;  2F4V K;  1D5A A;  3ZYY X;  4FJ7 A;  4JHD A;  3CQ8 A;  3V9Z A;  4O8U A;  1QQO A;  4DFP A;  2F96 A;  5AR0 A;  3BZC A;  1VSM A;  4IJN A;  1Z26 A;  4BGB A;  3U8X A;  2B5J A;  3O80 A;  4EIA A;  4BR5 A;  1RDU A;  2V7Y A;  4W5Q A;  4JKH A;  1HLU A;  3H6E A;  3R6M A;  4YOU A;  3JSM A;  3WQT A;  1JCG A;  3VEX A;  4BC2 A;  4HCC A;  3VQ7 A;  2ZE2 A;  4LF5 K;  3ZT0 A;  4YY3 K;  1WAF A;  4F3O A;  3OVN A;  3S3M A;  1EP4 A;  2AJQ A;  4EAH D;  4MDB A;  1YVU A;  3BZK A;  4KB1 A;  3VN5 A;  2P9N B;  4CVN E;  1S5J A;  2O4G A;  3WEE B;  3LWL A;  3RMB A;  1ZC6 A;  3SBT A;  2O8B A;  4JKG A;  3L2R A;  1P8Z A;  5EXW A;  4CGD A;  2D0B A;  1KAX A;  1EKE A;  3NDK A;  4NYF A;  4BC4 A;  3CFR A;  5J2M A;  1HYS A;  1XWL A;  1D9F A;  4DU3 A;  3E66 A;  5C42 A;  3JAM O;  1C0G A;  4C8M A;  1HYZ A;  4Y1D A;  2YHA A;  1WAJ A;  1RBT A;  1XHX A;  2AP1 A;  1XNQ K;  4FWO A;  3P83 D;  1NJI O;  2ZGZ A;  4CZH A;  1TAU A;  3UKR B;  3CCE N;  4UY8 O;  3UE5 A;  5BN9 A;  5AQV A;  4ILG B;  1QVG M;  3ATV A;  3NF6 A;  3HPO A;  2VQF K;  4DV5 K;  5LMU K;  3A5M C;  3HO1 A;  2XY5 A;  4E19 A;  3ZX3 A;  3CD6 N;  1KAY A;  2P5G A;  3VGM A;  3QES A;  3QEP A;  1NOY A;  1HQE A;  4CZM A;  3OS1 A;  1NOZ A;  2A1R A;  2GX9 A;  5EY4 A;  4CJQ A;  3UKU B;  3SUP A;  4ZTF A;  2YCH A;  2P9U A;  4E3S A;  3CJB A;  1UA1 A;  1MU2 A;  2CGJ A;  4FWN A;  4Z4C A;  3OYK A;  4FK4 A;  4DSL A;  1ZBI A;  4DR1 K;  4JD2 A;  4EP4 A;  4CBX A;  4EZ9 A;  2GTD A;  4KHU A;  3LPU A;  2XRI A;  4YDU C;  3KKS A;  2P9S A;  3SUQ A;  4CE9 A;  4RG8 A;  4U7B A;  3L4Q A;  5JLF A;  2BUP A;  1RT3 A;  4HVJ A;  4YNQ A;  5JVH L;  5I42 A;  2IIR A;  3AVF A;  1JLA A;  4RW6 A;  5AFU A;  3ASM A;  1YJ9 N;  3KK2 A;  4KKO A;  5AZJ A;  5F0X A;  2I7P A;  4W5R A;  3NGY A;  1EET A;  4F9O A;  2GEM A;  3DLH A;  2O8E B;  3AVN A;  1O13 A;  3RSE A;  4FJX A;  3NHG A;  4BRK A;  1S1V A;  1S3X A;  1X9J A;  3P1G A;  4I2P A;  4YDU A;  4FK0 A;  1X1P A;  5J2P A;  3A5O C;  5SZT A;  3O3H A;  4MLH A;  4Z4H A;  4H5T A;  5T7B A;  4ELT A;  2A42 A;  3A8Y A;  1T44 A;  3QEW A;  3QEV A;  2HHT A;  3L2V A;  1J6Z A;  3AGK A;  4I2Q A;  3GOI A;  1KAZ A;  2QW9 A;  3NAE A;  4CHQ A;  2O8C B;  3L2U A;  1TV6 A;  4M41 A;  3TAG A;  2BGG A;  3VQ8 A;  3VQP A;  1VQL N;  3AVJ A;  4LC9 B;  4RCH A;  4FJG A;  4B9U A;  3LDL A;  5FRM A;  1ITG A;  3OYA A;  1V4T A;  4JKB A;  3L4I A;  4E7H A;  3DLB A;  3SAF A;  4DTJ A;  2HBJ A;  3KWG A;  4LF7 K;  1QZ5 A;  1NKB A;  3EN9 A;  4KO0 A;  3ZSX A;  4M3T A;  1KSP A;  3VET A;  2ZJR L;  4C8L A;  1VSD A;  3DJC A;  1YXQ A;  3M8P A;  2HHX A;  2FBV A;  2G8I A;  1RTH A;  4KHW A;  1TK5 A;  2UXC K;  1SUQ A;  1HNV A;  2KFN A;  4YOY A;  1RT5 A;  1EWQ A;  2WON A;  3P5J A;  1BQM A;  3H1Q A;  1NJY A;  4CJU A;  2WUS A;  2Z1H A;  3K5L A;  3C7N B;  4OX9 K;  4DTP A;  2HF4 A;  3KIO A;  1FKO A;  3LAM A;  4BRE A;  3H1V X;  4G1Q A;  3QIP A;  1SV5 A;  1Z05 A;  2EX3 A;  4IEI A;  3CJA A;  3D7E O;  4PUO A;  3ZT3 A;  3GBT A;  3QDK A;  5EOY A;  1CZA N;  2XO7 A;  4Z0U A;  1RIL A;  4LSN A;  2PFU A;  2WOM A;  1NGC A;  5E26 A;  4B1X B;  4DKW A;  4FK2 A;  1I39 A;  1I3A A;  4RWT A;  5GAG P;  3WNE A;  3R3L A;  3ZT1 A;  4FWP A;  3C6A A;  4YOR A;  4E1M A;  3HRG A;  3LAN A;  3MEG A;  1BIU A;  4QS9 A;  4BR4 A;  3AAR A;  2VCP A;  3TU5 A;  4DSF A;  2HHU A;  2D5R A;  2UXD K;  2YNH A;  2IVO A;  3D0P A;  4JAX A;  1FW6 A;  1NMD A;  3L3V A;  3V6D A;  4B1V A;  2D0A A;  4BG9 A;  1IO2 A;  4OVL A;  3VQC A;  5BN8 A;  4LSL A;  4DG1 A;  1JCE A;  3D2F B;  2NRZ A;  3CCJ N;  1SAZ A;  3J7Y P;  4DQR A;  3VQ9 A;  3TAM A;  2ETJ A;  3HPG A;  4O5B A;  3TAR A;  5EX5 A;  3ZET B;  4CEQ A;  3SK3 A;  2FBY A;  4DQS A;  1WSE A;  5B8H A;  5FPN A;  3AO5 A;  3EE8 A;  1UAX A;  3N4Q A;  4BC3 A;  4OPJ A;  4H4O A;  1BOT O;  1Q86 O;  1RT7 A;  4JKA A;  2HHS A;  4X64 K;  3THY A;  3UIQ A;  3HK2 A;  4O44 A;  3THV A;  3SBG A;  4N56 A;  3IFR A;  3VOV A;  3TAB A;  2VG6 A;  3F2K A;  1TKT A;  4CJL A;  2HNY A;  1BIZ A;  1SKR A;  3ALY A;  4CIE A;  4KB0 A;  4A57 A;  3EY1 A;  1NBW A;  3QNN A;  3OYB A;  1Q81 O;  4CFA A;  3TAP A;  2F9W A;  1TK0 A;  3CQX A;  3ULD A;  4JI8 K;  1ATS A;  3T7Z A;  3FZM A;  4F8R A;  4JN4 A;  1Z25 A;  3G71 N;  5KQD A;  2G8W A;  4FL9 A;  4BC5 A;  5AQU A;  1X9M A;  3MEE A;  1XMO K;  1W2B M;  1EO1 A;  1DTT A;  3ZCM A;  2QKB A;  2RN2 A;  5HOO A;  3DLK A;  3CCM N;  1LV5 A;  3RRH A;  2P51 A;  5LY3 A;  3HVT A;  4JHD B;  3ZSY A;  3A0I X;  1CXU A;  3EE9 A;  3B6P A;  2P9L A;  5JS2 A;  4XH5 A;  3I8D A;  4XIU A;  3Q7C A;  2XY8 A;  3HSC A;  2G8U A;  4CHY A;  4FLW A;  3T1Y K;  4KTZ A;  1X3N A;  4CGG A;  3GE1 A;  4CEO A;  3SQ0 A;  2Z1G A;  5FPM A;  5SWM A;  3D2E A;  4ELV A;  1BU6 O;  2PAV A;  2OZM A; 
#chains in the Genus database with same CATH homology
 3VER A;  3SAH A;  3QFU A;  1YAG A;  4BRQ A;  4BRI A;  4KH5 A;  2Q2R A;  1S22 A;  1DGK N;  4JKE A;  3VPZ A;  4EFH A;  3M5R A;  3M1F A;  2HBM A;  3VEW A;  4JEP A;  5FPD A;  1YF5 L;  3HOT A;  1YJW N;  3TSP A;  4JKG B;  4B1U B;  4JK7 A;  4K41 A;  3O4W A;  1N8R O;  3ZX2 A;  4B1Z A;  4H0V B;  2A41 A;  1K8K A;  3R1X A;  4BR7 A;  3I56 N;  3ATU A;  4BRL A;  4RTF D;  4AM6 A;  5AQP A;  3CET A;  4B1Y B;  2QWP A;  3O1B A;  3NVK A;  1RDW X;  3W0L A;  3AAQ A;  3MN5 A;  3MX2 A;  3WQU A;  4M7Y A;  1EQY A;  2D1K A;  4BG8 A;  3DXK A;  1MWK A;  2YI1 A;  2QTD A;  4J8F A;  1MDU B;  1BDG A;  4AM7 A;  3CJ1 A;  1VQ6 N;  5H1S Q;  1VQK N;  2A5X A;  1GLF O;  5BRD A;  4H5W A;  3DAW A;  3QFP A;  3O9U A;  4IOX A;  3F9M A;  3BEX A;  4H0T B;  3FZK A;  2CH6 A;  3EL2 A;  2NRX A;  2E2P A;  1GLD G;  2OTL N;  4GVE A;  3P39 A;  3MN7 A;  2A6A A;  2EWS A;  3H3N O;  1NGA A;  4O5F A;  4O8K A;  3WXK A;  3CC4 N;  2WC9 A;  4BR2 A;  2IVP A;  3CCU N;  2YJF A;  3CIP A;  4PL8 A;  4DQ8 A;  4R79 A;  4H0X B;  4IDH A;  3ZYY X;  5ADX H;  1RGI A;  4JHD A;  4Y0W A;  4O8U A;  1QQO A;  5AQR A;  4A62 A;  1OKJ A;  3J7Z O;  3WXI A;  5AQG A;  1JJ2 M;  5AR0 A;  5AQJ A;  3CHW A;  2P9U B;  4IJN A;  3FE1 A;  1V4S A;  5AQQ A;  1HKB A;  3L0Q A;  3VF6 A;  4BGB A;  2JWL A;  2P9K B;  2KKZ A;  3LDN A;  3U8X A;  4GV3 A;  3E1Y A;  4L3Q A;  4FO0 A;  3O80 A;  3UB5 A;  4BR5 A;  4EIA A;  4MLE A;  1RDU A;  3VTI A;  1GLB G;  2V7Y A;  4JD2 B;  2UYT A;  5BRH A;  5GIP A;  4JKH A;  1HLU A;  3H6E A;  3R6M A;  1SZ2 A;  4YOU A;  3DXM A;  2Q97 A;  3LDO A;  3WQT A;  1JCG A;  3SJH A;  3CC2 N;  2Q0R A;  3CJ9 A;  3VEX A;  4BC2 A;  4WFB L;  4OO1 J;  3CME N;  4WCE L;  3TPQ A;  2P9S B;  1YUW A;  4JKF A;  4K25 A;  4BRP A;  3VES A;  5AQX A;  1H1V A;  3CER A;  1T6D A;  4EAH D;  4MDB A;  5HL7 L;  3CCL N;  4CZI A;  4Z94 A;  2AA4 A;  2P9N B;  3MN9 A;  3WEE B;  4CD3 A;  4EHT A;  1ZC6 A;  2F9T A;  4IZ9 A;  5AQK A;  3SBT A;  4JKG A;  5M1O A;  1MWM A;  5BR9 A;  4CZF A;  2CH5 A;  5AZJ B;  3QBW A;  4H0P A;  1P8Z A;  5GAH P;  4FWR A;  5EXW A;  3O5B A;  2GWK A;  1K9M O;  1KAX A;  1KQS M;  2OAN A;  2FF6 A;  5AQF A;  3RSE B;  4BRO A;  4XH1 A;  1Q7Y O;  1U6Z A;  4BC4 A;  2QEX N;  2ASM A;  1W97 L;  3E66 A;  4IXC A;  3FZL A;  4WQ4 A;  3S41 A;  1C0G A;  3VF4 A;  3CCS N;  2FSJ A;  3KWI A;  4FWQ A;  2FSK A;  2AP1 A;  4BRM A;  4ILJ A;  3ENH A;  2DPN A;  3O9R A;  4FWO A;  2QWN A;  4ISG A;  5BRE A;  1NJI O;  1JCF A;  2ZGZ A;  3WXM B;  4A2A A;  2HST A;  4CZH A;  2Q1N A;  5C10 A;  2RE2 A;  3A5N C;  4BY9 C;  3E9P A;  5JMV A;  3VGK A;  4JK8 A;  3UKR B;  5AQO A;  5M1P A;  4C23 A;  1KC8 O;  3CCE N;  1TUU A;  4UY8 O;  3UE5 A;  4U67 L;  5BN9 A;  2VYP A;  5AQV A;  4H0Y B;  3QB0 A;  4ILG B;  2ITM A;  1QVF M;  1QVG M;  3BUZ B;  3CI5 A;  3ATV A;  5AQY A;  4KH6 A;  3JS6 A;  3CJ7 A;  3A5M C;  1XUP O;  3HOS A;  4YOV A;  2QWR A;  3ZX3 A;  3CD6 N;  1BA0 A;  3U9D A;  4YOW A;  1KAY A;  4ISF A;  4MDA A;  3TTF A;  3VGM A;  2VGM A;  3R8E A;  5AQI A;  1NWK A;  2V51 B;  3MN6 A;  3U4L A;  4CZM A;  2GX9 A;  3HM8 A;  2WFB A;  2D4W A;  4IWV A;  5EY4 A;  3UKU B;  2BTF A;  2YCH A;  1DEJ A;  1ATN A;  3VEY A;  2P9U A;  2NRT A;  4WYB A;  4DB3 A;  5KPZ A;  3CJB A;  3IUC A;  5BPN A;  4A2B A;  3PIP L;  2CGJ A;  2P9K A;  5CR4 A;  5M1Q A;  1VQ4 N;  4FWN A;  1XQS C;  4CD1 A;  2QI2 A;  3SLC A;  4C1N K;  4BQZ A;  4A5A A;  1KD1 O;  3L6Q A;  2V7Z A;  3H45 C;  4H5R A;  4JD2 A;  2I7N A;  3C0B A;  4CBX A;  1NGI A;  1NGD A;  2P9I B;  1ATR A;  4ISE A;  4BGA A;  3O6W A;  4A5B A;  3E9L A;  5GIO A;  3CCV N;  2GTD A;  3CQY A;  2YHY A;  3MCP A;  4DHY A;  5F2R A;  1S72 N;  4YDU C;  4GV9 A;  5JIC A;  1NLV A;  2P9S A;  5I9E B;  4BRN A;  2A40 A;  5DM6 L;  1WOQ A;  2GUP A;  4I6M B;  2YHW A;  2ZWH A;  3HTV A;  5AZI B;  5LJW A;  4U7B A;  3L4Q A;  5JLF A;  2BUP A;  2P9N A;  3JXU A;  3KK7 A;  3VGL A;  3WEE A;  2OTJ N;  5FPE A;  4HWI A;  3WT0 A;  1GLC G;  2PBD A;  4B9Q A;  5JVH L;  2IIR A;  3AGR A;  1OVY A;  3HBT A;  5AFU A;  1WUA A;  2H3G X;  1YJ9 N;  1MA9 B;  3ID6 A;  2ZGY A;  2E2N A;  5AZJ A;  5F0X A;  2I7P A;  4BQL A;  4F9O A;  2IVN A;  2QWO A;  2GEM A;  5KPT A;  3C6H A;  3NMU A;  5JLH A;  1HKG A;  4GNI A;  3ENO A;  4CZK A;  3I55 N;  1P90 A;  1DKG D;  3CF5 L;  1O13 A;  3RSE A;  3O9S A;  2Q36 A;  1U2V B;  2CGL A;  1HUX A;  5TKY A;  4BRK A;  1ILY A;  3A5L C;  4BRG A;  3FR0 A;  4QS7 A;  5C0Y A;  1VQ5 N;  5F1X A;  1X9J A;  1S3X A;  2J4R A;  1K73 O;  4YDU A;  4IFE A;  3DLL L;  1T6C A;  2JWK A;  5CE3 A;  2A3Z A;  3CXC M;  5LJV A;  1NGJ A;  3A5O C;  3KZB A;  4MLH A;  3UKR A;  2NNW A;  3J8A A;  4H5T A;  3SAG A;  3QML A;  3PLA A;  3VF2 A;  2NRV A;  3FZF A;  3BF3 A;  1R59 O;  4WQ4 C;  5ELZ A;  4B1W B;  3A8Y A;  2A42 A;  4NLB A;  1T44 A;  3WUH A;  2WBN A;  1G99 A;  3DWL A;  3VEO A;  4AF1 A;  3LM9 A;  4EHU A;  3ULE A;  4DCH A;  5BPM A;  4A59 A;  3O8M A;  1J6Z A;  3AGK A;  3GOI A;  3LM2 A;  4HTL A;  5C12 A;  3HZ6 A;  1KAZ A;  2QW9 A;  4BRC A;  2E2Q A;  3NVM A;  3MK6 A;  3OHR A;  4WFA L;  3G4S N;  4IO8 A;  2ZF5 O;  1KXP A;  3HI0 A;  3MX5 A;  3OBW A;  2VGN A;  3MWT A;  3UKU A;  3I8B A;  3M3Z A;  3R9P A;  1VQL N;  3MWP A;  4LC9 B;  2GEL A;  4RCH A;  1M1K O;  1GLJ O;  3LDL A;  4M7X A;  2ASP A;  1V4T A;  3E9O A;  5AQL A;  4JKB A;  3L4I A;  5AQM A;  3Q7B A;  3SAF A;  4K42 A;  2HBJ A;  1VQ7 N;  1M90 O;  3H3O B;  3N4P A;  4MO5 A;  3KWG A;  2P9I A;  4IO9 L;  1QZ5 A;  3TSQ A;  1BO5 O;  1QZ6 A;  4BR0 A;  5DM7 L;  5M1K A;  3EN9 A;  4WFN L;  1E4F T;  4H5V A;  3ZEU B;  5CHI A;  4PKH A;  3TTC A;  4E1J A;  1TYQ B;  4IEE A;  3VET A;  2ZJR L;  3VEN A;  3DJC A;  3LDP A;  1YXQ A;  3RVC A;  2QXL A;  3CJC A;  4I6M A;  5AZI A;  4CI6 A;  1VQ8 N;  1VQP N;  5AQN A;  3K9J A;  1LOT B;  2E20 A;  4BVP A;  1QHA A;  4FWL A;  5ADX A;  4NO7 A;  4CJ7 A;  5M1F A;  4YOY A;  3ULE B;  1YJN N;  5KPR A;  3H1Q A;  2ZJQ L;  2KLA A;  2GWJ A;  2HMP A;  2WUS A;  2D0P A;  3C7N B;  2QA4 N;  4JKD A;  3FZH A;  1LCU A;  3D6R A;  2HF4 A;  5AQS A;  2P9P B;  4NLC A;  3AAP A;  4OPA A;  3P31 A;  3M6G A;  4BRE A;  3WXL A;  3QIC A;  3AY9 A;  3H1V X;  1Z05 A;  5EVZ A;  1HPM A;  4GY2 B;  4IEI A;  4CBU A;  3CJA A;  3D7E O;  5C2D A;  1YI2 N;  1U2V A;  4OPH A;  3GBT A;  3QDK A;  2FSN A;  1CZA N;  5EOY A;  4FVU A;  2PFU A;  2Q31 A;  3P38 A;  5KQ8 A;  1YHQ N;  1NGC A;  5E26 A;  2FF3 B;  4PKG A;  3CCR N;  1HJO A;  4B1X B;  2BH1 A;  4DKW A;  3MDQ A;  2D0O A;  3ENB A;  3MMV A;  4JNE A;  4WQ5 C;  4RWT A;  4PHT X;  3EZW A;  5GAG P;  3G6E N;  1BWF O;  3R3L A;  4FWP A;  3C6A A;  3B8A X;  4YOR A;  3HRG A;  3K9K A;  5BPL A;  4PL7 A;  1VQ9 N;  3O1W A;  1Y64 A;  4CZG A;  4IOC L;  2W41 A;  4M63 C;  4QS9 A;  3KHY A;  4BR4 A;  3AAR A;  4PKI A;  1ZBS A;  3FFK B;  2VCP A;  5C15 A;  3TU5 A;  3QBX A;  4FOE A;  1Q18 A;  2KHO A;  5E84 A;  4YOT A;  3IDH A;  1D4X A;  3W3D A;  2IVO A;  4JAX A;  1NMD A;  1GLL O;  4BVO A;  4B1V A;  2P9L B;  1YVN A;  2FXU A;  4FPA A;  4BG9 A;  3CCQ N;  4NB4 A;  5BN8 A;  2NLX A;  3P4I A;  3MCA B;  3ID8 A;  1YIJ N;  1JCE A;  3VEV A;  3D2F B;  2NRZ A;  3CCJ N;  1SAZ A;  1RFQ A;  1IJJ A;  3BF1 A;  4IJA A;  4JK9 A;  2YJE A;  1QQM A;  4WQ5 A;  5JVG L;  3O08 A;  2ZJP L;  5GAD P;  3EKU A;  4KH4 A;  1YIT N;  5EX5 A;  5AQZ A;  1SQK A;  3ZET B;  2QWM A;  3D2E B;  1GLE G;  3SK3 A;  4FWS A;  1VAZ A;  5B8H A;  3ZEU A;  4FWK A;  5FPN A;  1TYQ A;  2F7T A;  3EE8 A;  4JKC A;  3N4Q A;  1ZXO A;  5AQW A;  4BC3 A;  4CZJ A;  1SS6 A;  1BOT O;  1Q86 O;  5BRF A;  4BRH A;  4JKA A;  4IOA L;  1NM1 A;  3SMP A;  3IKM A;  4K43 A;  3VMF B;  2E8A A;  4KBO A;  3GL1 A;  4QS8 A;  5AQH A;  3SMS A;  1QQN A;  5GIN A;  1K8K B;  2RHK A;  1NGB A;  3SBG A;  3IFR A;  3TTD A;  3IMX A;  4H03 B;  3VOV A;  3F2K A;  4ILH A;  3VTH A;  4FOI A;  3CPW M;  3C7N A;  2HBL A;  4XEI A;  1BUP A;  3GDQ A;  1VQM N;  1TUY A;  2P9P A;  2Q0U A;  3LDQ A;  1HKC A;  5MLC Q;  3O9T A;  4A57 A;  3DXK B;  1NBW A;  1X3M A;  1XC3 A;  2NZT A;  3CPE A;  2E2O A;  1Q81 O;  4YOX A;  2F9W A;  1VQO N;  3FGU A;  3CQX A;  1HX1 A;  3C65 A;  4H5N A;  4CZE A;  4GV6 A;  2NRR A;  2QM1 A;  1ATS A;  2HBK A;  2CGK A;  3OW2 M;  3T7Z A;  3FZM A;  1Q82 O;  3H46 O;  5GAE P;  1VQN N;  1C0F A;  4FPB A;  4JN4 A;  4BR9 A;  2FLO A;  3G71 N;  5KQD A;  2ASO A;  4BRF A;  4C1N I;  3OA9 A;  4FL9 A;  4BC5 A;  4H0O A;  5AQU A;  1BA1 A;  2E88 A;  3PIO L;  4FSV A;  3F5T A;  1W2B M;  3G25 A;  1NGE A;  3VEZ A;  1EO1 A;  5HOO A;  3KVG A;  3CCM N;  3ZX0 A;  1Z6R A;  4WF9 L;  1E4G T;  3U9Z A;  1BG3 A;  2HOE A;  3OBY A;  3CC7 N;  5LY3 A;  4JHD B;  4A61 A;  5AFU H;  3A0I X;  3TSU A;  3EE9 A;  4FWM A;  3LL3 A;  1K8A O;  3FLC O;  2QWQ A;  2P9L A;  2NRW A;  4XH5 A;  3Q7C A;  4G9Z A;  4BRD A;  4XH4 A;  3HSC A;  2YX6 A;  3D2F A;  2VWB A;  2HF3 A;  2NRH A;  1X3N A;  3I33 A;  1IG8 A;  1NGH A;  2V52 B;  3GG4 A;  1NGG A;  3GE1 A;  3O9Q A;  3WXJ A;  2W40 A;  4BRA A;  3EO3 A;  4MO4 A;  2YHX A;  2E1Y A;  1NGF A;  2QWL A;  3DXM B;  5C2F A;  1GLA G;  5TKW A;  3ZET A;  3CMA N;  5FPM A;  3D2E A;  5M1N A;  3EKS A;  1DT9 A;  3BP8 A;  1BU6 O;  3T69 A;  1T3V A;  2PAV A;  4CZL A;  1ESV A;  5AQT A;  4CBW A;  2E1Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...