2FSJA

Crystal structure of ta0583, an archaeal actin homolog, native data
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
325
structure length
318
Chain Sequence
MVVVGLDVGYGDTKVIGVDGKRIIFPSRWAVTETESWKIPVLSTDGGQTKFIYGKYASGNNIRVPQGDGRLASKEAFPLIAAALWESGIHNPVDLVIGSGTPLGTFDLEVKAAKEALENKVLTVTGPEGEVRQFNITRLIMRPQGVGAALYLLNQGIIEQQPGYGVVIDVGSRTTDVLTINLMDMEPVVELSFSLQIGVGDAISALSRKIAKETGFVVPFDLAQEALSHPVMFRQKQVGGPEVSGPILEDLANRIIENIRLNLRGEVDRVTSLIPVGGGSNLIGDRFEEIAPGTLVKIKPEDLQFANALGYRDAAERS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords hypothetical protein Ta0583
publication title Crystal structure of an archaeal actin homolog
pubmed doi rcsb
source organism Thermoplasma acidophilum
total genus 88
structure length 318
sequence length 325
ec nomenclature
pdb deposition date 2006-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17989 ALP_N Actin like proteins N terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2fsjA02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2fsjA01
3A5LC 4F9OA 1GLCG 1GLJO 3KHYA 2E2OA 3AAQA 2I7NA 1Q18A 1V4TA 3QFPA 1ATNA 1S3XA 3CJ9A 2QWMA 2QWPA 4H0VB 4A62A 3BUZB 5AQVA 4BG8A 3QMLA 1ESVA 2A5XA 1XQSC 3LM2A 3QB0A 3CERA 1NGIA 4CZLA 2A41A 2FSKA 3M1FA 4QS8A 2V51B 1E4GT 1H1VA 4A61A 3SMPA 4H5WA 4MLHA 3VEZA 3VERA 2YJFA 4H0XB 4BRNA 2AA4A 2FXUA 3ULEB 1BA1A 3HSCA 2P9SB 3RSEB 1S22A 3WT0A 3DAWA 1TUYA 1QZ5A 1C0FA 4E1JA 3MMVA 1Z6RA 4I6MA 5AQTA 3SK3A 4BC5A 5FPNA 5BR9A 1BA0A 5AQFA 1HLUA 2W41A 4H0PA 1MDUB 4HTLA 5AQJA 3WQUA 1YVNA 3BF1A 3VPZA 5CE3A 1DGKN 3L4IA 4FWMA 1T6CA 2NRHA 1BDGA 1NGJA 2ZF5O 3ATVA 2NLXA 3O6WA 4WYBA 3UB5A 3SJHA 4WQ4A 4BRAA 3H1QA 4A2BA 2GWKA 3UE5A 1K8KA 3WEEB 3FZKA 2D1KA 3ZX3A 4CZIA 2A42A 3OHRA 5BN9A 3AAPA 1V4SA 5BRFA 2PBDA 3GOIA 2BTFA 1NGEA 4PL8A 3VF2A 3IMXA 3LDNA 2A6AA 4K43A 3VF6A 2E2QA 2HF3A 2CH5A 3FGUA 3QICA 4CBXA 4YDUA 4BR0A 3MN9A 5BN8A 3BP8A 3B8AX 4EHUA 4H0YB 5BRDA 1TUUA 2YHYA 3UKUA 4BG9A 4EHTA 3JS6A 2Q97A 2FF6A 4CBUA 2Q2RA 2VWBA 1CZAN 3QDKA 3DXKB 3R6MA 4JN4A 3ATUA 5AQIA 5AQNA 1ZBSA 5AZJB 3ZEUB 2HMPA 1NGGA 4FPAA 4GNIA 5BRHA 3LDPA 5AQKA 5I9EB 4BGBA 3H3OB 3O4WA 3UKRB 5JICA 3I33A 1MA9B 4IO8A 5AQRA 5FPDA 2FF3B 3O08A 4FO0A 4KBOA 3U8XA 4ISFA 3W0LA 4A2AA 4BRPA 2P9NA 4FWRA 2E20A 1BWFO 4DCHA 4CZMA 3H46O 2NZTA 3MN6A 5E84A 1SZ2A 2FSNA 3WXKA 4Y0WA 4M63C 5AQGA 3HM8A 2UYTA 3GL1A 1NGDA 3ZETA 3IFRA 2KHOA 1JCEA 3F9MA 4H5RA 3FLCO 3VEXA 1NLVA 5AQQA 4YDUC 3HI0A 5AR0A 3FZLA 2Q31A 3CIPA 4I6MB 4FWSA 4FWKA 4K25A 4C23A 4DQ8A 4ISGA 5BPMA 1HPMA 1LOTB 5BPNA 1HX1A 1EQYA 2WUSA 2QXLA 2P9KB 4BVOA 2P9PA 4IXCA 3LL3A 1BG3A 3CJBA 3C0BA 4XH5A 2Q0RA 3P4IA 5AFUH 3VEYA 1P8ZA 1KXPA 5TKYA 2IVPA 5EXWA 3EO3A 5AQMA 4H03B 1K8KB 3D2FA 1U2VA 3O80A 1IJJA 4BQLA 3FZFA 3WXJA 4BC4A 1DKGD 5FPEA 2ASPA 1TYQA 1ATRA 2YHXA 3ENOA 2H3GX 5AQHA 5EY4A 5FPMA 4B1WB 3VEVA 2Q36A 4AM7A 4FPBA 3D2EA 2ZGYA 3GDQA 2V7ZA 1HUXA 3L6QA 1LCUA 5KPTA 5KPZA 2P9UB 3UKUB 2Q1NA 4CI6A 3H3NO 2GUPA 1T44A 3MN7A 1WOQA 3WXIA 5E26A 3H6EA 4CBWA 2F9WA 3VOVA 5F0XA 3L0QA 4JAXA 4EAHD 4FWPA 1HKBA 1HJOA 3VENA 4BR9A 3BEXA 4EIAA 2ZWHA 3DWLA 2E1YA 2IIRA 3VEWA 3U4LA 1BO5O 4B1VA 3VGMA 5KPRA 3DXMA 1XUPO 3ENHA 2E1ZA 2A3ZA 3CI5A 1RGIA 3FE1A 3QFUA 4H5NA 4IWVA 4QS7A 3CJAA 2FLOA 4K42A 5AQLA 4B1UB 1NGHA 2P9LA 2V52B 1T6DA 3EKUA 1NM1A 4DHYA 2ZGZA 4IJAA 4CZEA 5B8HA 4B1ZA 3VGKA 5AQPA 3SMSA 1NWKA 3HZ6A 1Z05A 3ZETB 3M3ZA 1MWMA 3FFKB 3CQXA 3HTVA 3SLCA 2FSJA 4H5TA 3TPQA 4B9QA 3GG4A 3R9PA 3O1BA 4EFHA 2Q0UA 5ADXA 4XH1A 2QWOA 3J8AA 5AQWA 2GEMA 3ID8A 1ZXOA 2QWQA 4RTFD 3KZBA 2ITMA 3M6GA 3CJ1A 1WUAA 3FZHA 3R8EA 3EN9A 1D4XA 1G99A 3DJCA 4BGAA 4FSVA 2QM1A 4CZGA 1SQKA 3A5NC 4BRIA 1OKJA 1NGCA 2P9PB 3C7NA 1XC3A 2J4RA 4LC9B 4M7XA 3QBXA 3U9DA 4CZHA 1BU6O 3ZX2A 3CJ7A 2ASMA 5AQXA 4FWOA 3H1VX 4FWQA 3O1WA 4BREA 4CD1A 4BRDA 1JCGA 3U9ZA 3MDQA 4L3QA 1J6ZA 1NGBA 3D2FB 1U2VB 4J8FA 5LY3A 4JNEA 4BRFA 4BC2A 3HBTA 3LDOA 4MO5A 2D0OA 4RWTA 1X3NA 2CGKA 2CGLA 3CHWA 3KVGA 2ASOA 3EL2A 3FR0A 2HOEA 4BRKA 3D2EB 3DXKA 1GLEG 4CZJA 4JD2A 4O5FA 2HF4A 1IG8A 4CJ7A 5AZJA 4JHDA 2VCPA 4BR7A 3H45C 1HKGA 5AQOA 1E4FT 4IJNA 3UKRA 3TU5A 1QQMA 4BRCA 3IUCA 1YXQA 3MN5A 3A5OC 3CJCA 3FZMA 3O5BA 2GWJA 3VF4A 2E2PA 2PAVA 3MCPA 3O8MA 4HWIA 3D7EO 5EVZA 5F1XA 2QW9A 2E88A 4H0OA 4K41A 1QQNA 3DXMB 1Y64A 5LJWA 1YUWA 2P9IA 4BR2A 2BUPA 3VETA 2IVNA 2QWLA 4BC3A 1NGFA 5F2RA 2F9TA 2YJEA 4WQ5C 5AZIA 5LJVA 5AFUA 3WUHA 2P9LB 4BR4A 1ATSA 4XH4A 4CZKA 5AQUA 1JCFA 4BRQA 1MWKA 2E8AA 5EOYA 2YI1A 5BPLA 2V7YA 5KQ8A 4PKGA 2W40A 2QWRA 1KAXA 2D0PA 2P9KA 1DEJA 4FWLA 4NB4A 2CGJA 4BRLA 1QQOA 3A0IX 1R59O 1X9JA 1U6ZA 4PL7A 1KAYA 3S41A 4MO4A 2IVOA 2P9NB 4FWNA 3ULEA 3LM9A 2E2NA 4PKIA 2D4WA 2P9SA 3RSEA 3QBWA 4BRGA 4QS9A 1NGAA 3C7NB 2OANA 3LDQA 5BREA 3GBTA 3VESA 1BUPA 1BOTO 4H5VA 4B1XB 2DPNA 5ADXH 3IDHA 1GLAG 4H0TB 4XEIA 1YAGA 2GTDA 5ELZA 4AM6A 1ZC6A 1HKCA 3VEOA 4BRHA 3MK6A 3GE1A 5JLHA 5KQDA 3LDLA 2YCHA 2P9UA 4FOEA 3CETA 4RCHA 1QHAA 4CZFA 4CD3A 3BF3A 1C0GA 4Z94A 2VYPA 2YHWA 3WEEA 4JD2B 4BROA 3WQTA 4FOIA 2EWSA 5EX5A 4JHDB 4DB3A 3W3DA 5AQYA 2A40A 1GLBG 4NO7A 5AQSA 4WQ5A 1GLDG 1SAZA 2CH6A 1X3MA 2QWNA 3CQYA 3WXLA 2I7PA 1GLFO 3G25A 1KAZA 5JMVA 4B1YB 4PKHA 4WQ4C 5JLFA 4MLEA 4O8KA 1NBWA 3EKSA 1TYQB 4IZ9A 3A5MC 1RDWX 3JXUA 3AY9A 5AQZA 3ZX0A 1RFQA 4BR5A 4M7YA 3EZWA 4ISEA 1QZ6A 4BVPA 2P9IB 4BRMA 2GELA 1NMDA 3ZEUA 4FL9A 1GLLO 4GY2B 3A8YA 5AZIB 2AP1A 3I8BA 3VGLA 4BQZA 3AARA
chains in the Genus database with same CATH superfamily
4F9OA 1GLJO 4OPAA 1V4TA 1S3XA 2QWMA 1HMVA 1WB9A 4A62A 3BUZB 5AQVA 1XQSC 3LM2A 3QB0A 5FLXO 1NGIA 2BGGA 3L8BA 3M1FA 3T1HK 3NBPA 3SMPA 4BRNA 2F4VK 1YTAA 3DOKA 3RRGA 1Q9YA 1S22A 5GIPA 4DR1K 4CJKA 4M3TA 3VQ5A 3BY5A 3AO1A 2HB5A 4M45A 2W42A 4F3OA 1Z6RA 3MEGA 4CECA 4BC5A 1RBVA 5FPNA 1BA0A 1BQMA 4B08A 5AQJA 1C1CA 3BF1A 1T6CA 2NRHA 3ATVA 1ZBIA 4C8OA 5K14A 5TKWA 2OZSA 3ZT2A 4A2BA 2GWKA 3PLAA 3UE5A 3MEEA 1QSLA 4G1QA 3E66A 3QEXA 4CZIA 3OHRA 4CFCA 3AA2A 2PBDA 4I2PA 3PX4A 1TKDA 1L5UA 1BI4B 3SUPA 4PL8A 2PYJA 3U3YA 3TAMA 5KTQA 4B3RK 2UXDK 1C6VA 3KK1A 4KI4A 3FGUA 4DSEA 4FK0A 1NU0A 1XHZA 4EHUA 1UOCA 5BRDA 1TUUA 3UKUA 3M5RA 4EHTA 3JS6A 3V81A 3OYKA 3MXJA 2Q2RA 3NMUA 4JI2K 3TSQA 4JI8K 3B6OA 4Z4EA 4ICLA 2KLAA 3ATUA 4NCGA 3ZEUB 2HMPA 1NGGA 3HL8A 5BRHA 1VSFA 3LDPA 3L2WA 5I9EB 1NK8A 1NKBA 4LF5K 3VA0A 1JL2A 3U8XA 3W0LA 4CEFA 4Z4IA 4JYAK 2E20A 4DCHA 3CXCM 3K9KA 1Y97A 4DUYK 3ZYYX 3AVLA 4HUEA 2Z1JA 2HBKA 4OKJA 2UXBK 3SBTA 5AQGA 1LW0A 3NH2A 1VK0A 1YHQN 3IFRA 5M1PA 5C25A 1ASUA 4A57A 3QEVA 3DLEA 3FLCO 1NLVA 3E9PA 2WFBA 4JKGB 3O3HA 4FM1A 3O9SA 4FWSA 4JS5A 3DLKA 3PY8A 1HPMA 3S9HA 4LH5A 3I56N 2P9KB 4BVOA 3OYLA 1TK5A 1RT4A 1BG3A 1YITN 1A5VA 3C0BA 4XH5A 4CGDA 1P8ZA 4JKBA 2ZJPL 3BZCA 1NJIO 4DQPA 1RILA 3OW2M 4H03B 1K8KB 1U2VA 4JKDA 3SCXA 4HUGA 4BC4A 3F9KA 1VQKN 1ATRA 4F8RA 3KK3A 1TL1A 3Q7CA 3KWGA 1S72N 3ZSRA 1S1UA 5AQHA 4AHVA 1WSEA 3NVKA 3QINA 1RNHA 1WAJA 4ELUA 5C24A 4IDKA 5KPZA 4NCAA 2P9UB 2VQEK 2Q1NA 4FJLA 4BDPA 3V9XA 3QLHA 2G8IA 1JL1A 4W5NA 3NF9A 5E26A 4DF8A 3K58A 5F0XA 4JK8A 3RR7A 4UQGA 2D0AA 4EIAA 3G4SN 3IG1A 2ZWHA 3VEWA 3OY9A 5M1OA 1J53A 4CJRA 4DV4K 2BANA 2PY5A 3NAEA 2ETJA 3OJUA 3ZSXA 1RGIA 4H5NA 1NK6A 1N8RO 4Y1CA 4IWVA 3D6RA 4DV6K 2FLOA 4FVUA 3O3FA 4BE2A 4FJNA 1NGHA 2V52B 4YFUA 4IEEA 2HVIA 4LSNA 3SAHA 3VQ6A 4B1ZA 5LMNK 4KHNA 3LZJA 3ZETB 3M3ZA 1MWMA 4OLBA 1RTJA 2IC3A 4EFHA 3O1BA 2OPPA 3O9QA 4ILHA 3HP9A 3ID8A 3AVMA 4K8XA 4WE1A 1RBTA 4F2SA 4JI0K 4FJ7A 2IS3A 1WUAA 4IEIA 3FZHA 1G99A 4CZGA 2QM1A 3A5NC 4BRIA 2P9PB 3THWA 3T69A 1KTQA 4M7XA 2QI2A 3QBXA 2UUAK 1ZYQA 1TKXA 1OH6A 2ASMA 5E41A 1KFSA 3AA4A 4B9VA 4X64K 1NOZA 3AVNA 4BREA 4CD1A 4BRDA 3OYMA 4L3QA 3VMFB 2HBMA 4OJRA 1JLAA 5LY3A 3TTDA 1KQSM 3QIPA 4BRFA 3HBTA 4RWTA 3AVIA 4B8CA 4CE9A 3VQEA 3DYAA 4OKKA 4DFKA 3AV9A 3D2EB 3DXKA 4CZJA 4DU3A 2P51A 4K8ZA 5A2QO 3ZCMA 4J2BA 5AZJA 4JHDA 2VCPA 5EU7A 5AQOA 4CJFA 2D0CA 3UKRA 3TU5A 1RCHA 1QQMA 3IUCA 1JLGA 2HNYA 4B8AB 2KZZA 3MN5A 4DR2K 1T8EA 1RDCA 2FBTA 3O5BA 1A5XA 1RTHA 4GV6A 4NLBA 3MXMA 4BE0A 4IOXA 1Q7YO 5EVZA 4CFBA 2ZE2A 3Q7BA 4H0OA 4K41A 1QQNA 1Z26A 3DXMB 3OS2A 5LJWA 2VGNA 2P9IA 3VETA 4K0KK 3QETA 1NGFA 5F2RA 2F9TA 2YJEA 5AZIA 3T7ZA 1D9DA 2HW3A 2P9LB 1NK4A 1ATSA 4YOXA 4CGFA 2OTJN 4CZKA 1SL2A 5D3GA 1VAZA 2DFHA 2YI1A 5EOYA 5KQ8A 3VA3A 3QERA 5DM6L 3ULDA 1DEJA 1HRHA 1QQOA 4AHRA 3KLGA 3D0PA 4LF6K 2IVOA 2P9NB 4NCBA 3EY1A 2VG7A 3HVRA 2P9SA 4OPHA 3RSEA 5C0YA 4BRGA 4QS9A 3LWLA 3L2QA 4IFEA 3C7NB 1WBDA 3J80O 3P39A 4AHTA 1VQ6N 3NH1A 3LDQA 4LFBK 1BUPA 1BOTO 4H5VA 5LL6Z 4H0TB 4DSLA 4XEIA 2WC9A 1YAGA 3PIPL 3WNEA 4CCHA 3U3GA 4WFAL 4DV7K 4G9ZA 4DR7K 1HYVA 2F7TA 3NF7A 3VEOA 1S6QA 3GE1A 5JLHA 5KQDA 1YJWN 3KLEA 4FOEA 2X6SA 4JK9A 3KLHA 3CCQN 3S3NA 5KI6A 2HMIA 4RCHA 3EZ5A 1KVAA 2RHKA 2VYPA 4CJ5A 3WEEA 4DLEA 4BROA 3U6FA 5I3UA 3WQTA 3TR8A 3IS9A 4DB3A 2Z1IA 5BR8K 1QVGM 1GLBG 4NO7A 5AQSA 4IG0A 3LPTA 1GLDG 1TAQA 3VQ4A 4HHTA 3CQYA 3S3OA 3F73A 1KAZA 4O5BA 5JMVA 4M3XA 4IBNA 5JLFA 1VQNN 1M90O 4QCLA 1NJZA 3QESA 1FK9A 1CZBA 1TYQB 3DLHA 3L3UA 5AQZA 3CCVN 4B9MA 3AGRA 3T1YK 4OGCA 4FJMA 1WNSA 4DTJA 4BRMA 4GKKK 3LPUA 3KK7A 2JLEA 1VQMN 1NK9A 4NXMK 2AP1A 5CHIA 4GKJK 3AARA 4BDZA 1Q18A 3L3VA 3QFPA 2OPRA 4CK1A 3B6PA 2B6AA 1N32K 2QWPA 4H4OA 3DRPA 3HO1A 3ZSVA 3QMLA 1RBSA 4E1MA 1OH5A 3M8PA 3TAEA 1RT2A 3N4PA 4DTPA 2A41A 4GW6A 4C1NI 2V51B 4YOYA 4A61A 1IKWA 4JRPA 4RW7A 2YNIA 3VERA 2YJFA 4H0XB 2XO7A 3PX0A 1TUYA 2DTUA 1QZ5A 1C0FA 4B3TK 3MMVA 1HNVA 3NE6A 5MLCQ 3P38A 3OYFA 1J54A 4I6MA 1VQON 3SK3A 4RW8A 1JKHA 1HLUA 1MDUB 4HTLA 3TAPA 1VQ7N 3V9ZA 5CE3A 3L4IA 1FXXA 5J1EA 1IO2A 1NGJA 2ZF5O 1YJNN 1XHXA 4WQ4A 1S6PA 4C8LA 1VSEA 4DG1A 4KB0A 3FZKA 1IKXA 5BN9A 4KPYA 1V4SA 4B9SA 3AVFA 3K9JA 3DI6A 4PQUA 1NGEA 1DT9A 4FW1A 3IMXA 5CZ2A 4KHWA 2WBNA 3CCMN 4CHQA 4DV2K 4N76A 3QICA 4CBXA 4BR0A 5BN8A 3V1QA 1VQ4N 4PY5A 1K9MO 5KRSA 4CHNA 2G8WA 4FJGA 3WXMB 5HRPA 2VWBA 4FZZA 2W6LA 1IKVA 1CZAN 4PUOA 3R6MA 4KTQA 1EO1A 1RDBA 5AQIA 4FPAA 3ZSOA 4GNIA 1TAUA 4M3RA 4M42A 4KI6A 3H3OB 2O8CA 3O4WA 3MXIA 3KD5E 2QTDA 2JWKA 2Q3SA 1MA9B 5FPDA 2NRTA 4ISFA 1BCOA 3V9UA 2NRRA 4E1NA 1KSPA 1NNEA 3V6DA 5CR4A 2O8DA 3NF8A 4CZMA 4JI5K 3VQ8A 1WAFA 1SZ2A 1B9FA 1ITGA 2QXFA 1NKCA 3WXKA 1I39A 1TKZA 2EHGA 4ID1A 5GADP 3K5LA 4BWMA 3SNNA 2KFZA 3GL1A 3NVMA 3CCEN 4LF7K 1KLNA 2KTQA 3F9MA 2R7YA 4OLAA 4DV5K 1BIZA 4ZTJA 1VSMA 1HQEA 4JKEA 3HI0A 4R5PA 3DLLL 1O13A 4K25A 4Z0UA 1RDUA 1SKSA 3LP1A 2WUSA 2QXLA 4B9LA 3CJBA 1RTDA 4JKAA 5AFUH 4M3UA 2ZM6K 3CFOA 2IVPA 3K57A 3EO3A 1GOBA 4RW6A 3E9LA 4FLTA 3D2FA 2VWKA 2E5LK 4BQLA 2B5JA 3WXJA 1J5EK 3V4IA 3T19A 4E89A 1X9WA 3QNNA 2HHQA 2H3GX 3VEVA 2Q36A 2YHAA 2ZGYA 3GDQA 4PA1A 3VQBA 3VQ9A 3UKUB 1LWCA 4AHCA 2QKBA 1JLEA 1SL1A 3RMCA 1T05A 1NG9A 4KO0A 1CZ9A 1BIUA 3H6EA 4CJUA 5C12A 3VOVA 3L0QA 3P31A 1S9EA 4EAHD 2I5JA 4FWPA 1ZBHA 1HJOA 2W6KA 4BR9A 3HPHA 1XC9A 2IIRA 4C1NK 3AVKA 4CJVA 3U4LA 3L4QA 5KGWA 4Z4FA 3RTVA 4NYNA 2E1ZA 4U67L 3CI5A 1TKTA 2GV9A 3O4QA 4CW7B 3V9WA 1GOAA 4B3MK 5AQLA 4B1UB 1XMOK 5HOOA 3WNHA 3TABA 1NM1A 2ZGZA 4IJAA 4CZEA 1QVFM 1UWBA 2HNZA 1NWKA 3F5TA 1TK0A 2G8HA 3FFKB 3CQXA 4C8MA 3HTVA 3SLCA 1C1AA 3R9PA 5JVGL 5ADXA 4XH1A 2WTUA 3J8AA 5AQWA 2ITGA 3HJFA 1ZXOA 2GX9A 2ITMA 4HVJA 1W2BM 2XY6A 2IGIA 3EN9A 4E7JA 4B3SK 4DFPA 1D9FA 4LC9B 1OKJA 3U9DA 1HYZA 3SQ1A 1XI1A 5AQXA 1BI4A 4FWQA 3M8RA 4BWJA 3E01A 1JCGA 1REVA 4C8NA 2RKIA 1RDDA 4FLYA 1TK8A 1U2VB 1DTTA 3V1RA 3TAGA 4BC2A 1U04A 2CGKA 3DLRA 3OYJA 3I0SA 2ASOA 2FC0A 4CF8A 1K73O 3PUFA 1WSJA 4FJXA 1CLQA 1GLEG 3HXMA 4O5FA 2HF4A 1QSYA 1B92A 3BGRA 1VRTA 4LF9K 2DFEA 3THYB 4UY8O 3HP6A 4BRCA 4N5SA 4AH9A 4CK3A 2YNFA 3SQ0A 3QO9A 1N5YA 1LAVA 2QK9A 2FBVA 3VF4A 3SUQA 3O9TA 2PAVA 1XWLA 1S1VA 1NMNA 3D7EO 4LSLA 4TSXA 2QW9A 3KJVA 2YNGA 1KLMA 3N4QA 4BC3A 4WQ5C 5AFUA 4HUFA 2DY4A 2PZSA 4JKGA 5AQUA 1JCFA 2HBJA 4NXNK 3WNGA 3TAQA 2VG5A 3NH0A 1Q9XA 1DTQA 4V19S 5BPLA 2V7YA 4PKGA 2QWRA 1KAXA 2P9KA 1HYSA 3H08A 2CGJA 4BRLA 3L2VA 1U6ZA 3MWPA 3OBWA 2ATQA 2VGMA 3C65A 3PV8A 4Q5VA 3ULEA 3I0RA 3OYEA 2E2NA 4GV9A 2D4WA 5C15A 3O3GA 3THWB 3SUOA 1WBBA 3D45A 2OANA 1W9HA 3GBTA 4B1XB 2DPNA 4O4GA 1BHLA 1GLAG 3E1YA 1UA1A 1T7PA 4OO1J 2O8BA 4BY9C 5DM7L 4BRHA 3MK6A 1U49A 4FXDA 1D5AA 2P9UA 4FLWA 1JLBA 2VQFK 1QHAA 3THXB 3SAGA 1HNIA 1SV5A 2YHWA 3ZSQA 3LALA 5GAHP 2ZQBA 4AILC 1C1BA 4FOIA 5EX5A 3HOSA 4JHDB 5JVHL 2KQ2A 1TGOA 3AA5X 1C0UA 3DRSA 3BZKA 2HSTA 1KVCA 1RBUA 2QWNA 3JYTA 3WXLA 5FDLA 3G25A 3BDPA 4HCBA 1TV6A 4CJLA 4B1YB 4PKHA 4OPKA 1LW2A 4JI4K 4MLEA 4DQIA 3SQ4A 4IZ9A 5C2DA 1RDWX 3ZX0A 4BR5A 1RFQA 4DV1K 1NOYA 3HT3A 3CFPA 1QZ6A 3C95A 4KHYA 3VTIA 2P9IB 4DSKA 1NMDA 4FL9A 1RT7A 5AZIB 1Q8IA 3VGLA 2XY7A 1GLCG 4LF4K 3KHYA 4FJHA 2E6MA 1ATNA 1NJXA 2OCEA 4U7BA 4H0VB 4CGIA 4BG8A 1ESVA 1VQ9N 4M41A 2A5XA 4CGGA 2JGUA 3AVCA 4OPJA 4YOUA 4AF1A 4CZLA 2FSKA 3LP0A 4ILJA 5H1SQ 1E4GT 3LAKA 5SZTA 4H5WA 2UU9K 3C6UA 3SPZA 1YF5L 4GVMA 2FXUA 3MAQA 4W5RA 3HSCA 2P9SB 3RSEB 3QNOA 4O8UA 4FM2A 3DAWA 4I7FA 4FJKA 3K59A 3S3MA 4DV0K 3SI6A 5AQTA 4DQQA 4DFMA 3LP3A 3OYAA 4FJ5A 2HHXA 4H0PA 4FLVA 1N36K 4FZYA 3WQUA 4AHUA 3DLGA 4W5OA 3VPZA 2X78A 1DGKN 3AO3A 5GAEP 1C0TA 1ZBUA 3ZT3A 4YOTA 2NRWA 3O6WA 4IOAL 4WYBA 3SJHA 3H1QA 3OYIA 2IDOA 2KZMA 3WEEB 1RT3A 4E7IA 2D1KA 3ZX3A 4DR6K 3DLBA 2A42A 3AAPA 4CEQA 2O8EA 3SUNA 1B9DA 3GOIA 2BTFA 3VF2A 4F4KA 3JSMA 3HVTA 1VSJA 3O9RA 4K43A 3CM6A 3G0ZA 3VF6A 3MN9A 3I55N 4KH6A 3BP8A 3B8AX 2VWJA 4H0YB 1RBRA 3KLFA 2NNWA 4N41A 4BG9A 2GUIA 2Q97A 3PIOL 4CBUA 2QKKA 3G71N 5HBMA 4BE1A 4ELTA 5M1QA 1WN7A 3QDKA 4FM0A 3JAMO 2A1RA 1HQUA 1VSHA 5AQNA 4N47A 1ZBSA 1CXQA 5AQKA 5HRSA 1W97L 1K6YA 4FCYA 3SYZA 3AVBA 4CJWA 4KREA 2NRVA 3HYFA 5M1FA 1WSHA 2FF3B 3O08A 4KBOA 3SQ2A 4BRPA 2P9NA 1NK7A 3VQDA 4FWRA 4JKFA 2RPIA 4IFYA 4DLGA 1RT5A 3MN6A 1YJ9N 3NCIA 5E84A 5GINA 1IBKK 4CK2A 2BH1A 1QHTA 4Y0WA 2WOMA 4M63C 3KKSA 4BACA 3FFIA 3SZ2A 3MX2A 3AVAA 4RW4A 3DMJA 4H5RA 3VEXA 5AQQA 2YV0X 4DSJA 1HJRA 4YDUC 3AA3A 3FZLA 2Q31A 3CIPA 4I6MB 5AR0A 4JI1K 4FWKA 4C23A 3O4NA 3THVA 4ISGA 5BPMA 1LOTB 4A5AA 1HX1A 4B9TA 1IKYA 1EQYA 1VSIA 4DSIA 3KD1E 3CCJN 4L8RB 1XNQK 5JS1A 3G6EN 3ZT0A 1NK0A 3P4IA 3VTHA 1KXPA 2G8UA 3AGKA 5GIOA 2EX3A 4CF0A 3QEPA 3ENBA 3MWTA 1IJJA 4DS4A 3J7AP 1DKGD 5FPEA 4DUZK 1TYQA 2YHXA 4KTZA 4B1WB 4FPBA 1VSDA 4IG3A 1W0HA 2V7ZA 5HRNA 1HUXA 3L6QA 3KLIA 1I3AA 1BCMA 1LCUA 5KPTA 3KIOA 4CI6A 4B3OA 2OZMA 2GUPA 1T44A 5SWMA 4ZHRA 5GAGP 4CBWA 4EP4A 4QOZB 3CYMA 1HKBA 3VENA 2O8FA 4DTUA 2E1YA 2BDPA 2O8CB 1YIJN 3SV4A 1L3UA 1BO5O 3VGMA 1OVQA 5FRNA 5IT9O 1BGXT 5KPRA 4LH4A 3TI0A 2A3ZA 3FE1A 3QFUA 4QS7A 1LWFA 2YKNA 4ELVA 1T6DA 1SKRA 1HNZK 4GV3A 4JK7A 3EEQA 5B8HA 4BDYA 3VGKA 1EX4A 5AQPA 3SMSA 3HZ6A 2FBYA 4O0IA 4B9QA 2FSJA 4H5TA 1HR0K 2P5GA 2Q0UA 4CJPA 1SS6A 1OH7A 4CEEA 4IDHA 2GEMA 4RTFD 2QWQA 3HRGA 3CQ8A 3DM2A 1R0AA 1ILYA 3KZBA 1Q82O 3C94A 4WF9L 5HL7L 3CJ1A 1IV0A 3EYZA 3R8EA 1D4XA 3DJCA 4BGAA 4GVEA 4DTXA 1KVBA 1SQKA 2F8SA 1J9AA 1NGCA 4CZHA 2J4RA 2O4GA 5KGXA 3CJ7A 5J2PA 5CYQA 3SPYA 3ZSWA 3MDQA 1NGBA 3P83D 3D2FB 4J8FA 4YNQA 4N56A 4E7HA 4JKHA 4FLXA 2ZJQL 3LDOA 4CF2A 2HNDA 4W5TA 3CHWA 3KVGA 4NLCA 3EL2A 4KHPK 2HOEA 1CXUA 5I42A 3TARA 1FKOA 4JD2A 4CJ7A 4XIUA 4CFAA 2KKZA 4E7KA 4Z4GA 3H45C 1G15A 1HKGA 4KRFA 4FJ8A 3K0SA 3MX5A 1JXEA 3EE9A 3A5OC 1Q81O 2WONA 4KAZA 2PFUA 3OYBA 4DF4A 3K2PA 3QEIA 3RMAA 1L3TA 3WNFA 3O8MA 2RE2A 2IAJA 5IWAK 3T1AA 5C2FA 2PYLA 4DWIA 2E88A 4Z4CA 3CD6N 4EZ9A 3P1GA 2IVNA 2QWLA 2X6NA 2Z1GA 3CC7N 1IH7A 1WSFA 5LJVA 3OS1A 1OVYA 3ISNC 3TSPA 3C6AA 4BRQA 3DOLA 5FRMA 1MWKA 1KD1O 1YTUA 1D8YA 4KV8A 3TAFA 4DTNA 2X74A 2HVHA 4FWLA 4NB4A 4MQ3A 1LAWA 3CFRA 4YHHK 4CJTA 4MO4A 4FWNA 3LM9A 3VQPA 2HHSA 5BREA 3OYDA 2BE2A 1X9SA 3M8SA 2GTDA 4KKOA 5ELZA 3TTCA 4DTRA 1ZC6A 4A5BA 1LV5A 3RR8A 4Y1DA 4J2DA 3IAYA 2NUBA 4HTUA 1VSKA 3O9UA 3LDLA 2YCHA 4FJIA 1N33K 1K8AO 4CZFA 4ILGB 3NGYA 3G10A 1KCFA 3I8DA 3OJSA 4E0DA 2XHBA 2YKMA 3C6TA 4YY3K 5DK5A 1RT6A 3W3DA 4FLUA 1BQNA 5AQYA 2NRZA 1UAXA 2CH6A 4JI6K 1X3MA 4DTMA 2I7PA 1GLFO 1EKEA 3C6HA 3VQQA 4JI7K 3RWUA 4WQ4C 4CGHA 3NGIA 4O8KA 3EKSA 4YOVA 3A2FA 3OVNA 4KHSA 3JXUA 4YOWA 1WSGA 4M7YA 2UUCK 3TSUA 4DS5A 2HBLA 3LAMA 4DMNA 4BVPA 4GMJB 4EP5A 3ZEUA 3L2UA 1JLCA 1GLLO 3SBGA 3ZSYA 1EP4A 3I8BA 3HM9A 1Z25A 2UXCK 4KFBA 3KKRA 4CF1A 5T7BA 3L2RA 3A5LC 4AHSA 2E2OA 3AAQA 5CY4A 2I7NA 3QIOA 4MDAA 3VQ7A 3K5MA 4Q0BA 2A1SA 1J5OA 3CJ9A 4J2AA 3CPEA 1W7AA 4CHPA 3CERA 1E3MA 4QS8A 4CEAA 1H1VA 4E3SA 2Y1JA 4CJ3A 4MLHA 3VEZA 2AA4A 4JEPA 3ULEB 2IOCA 4DU4A 1BA1A 4CEZA 2P1JA 4DR3K 3WT0A 2B4JA 3ZT4A 3NGZA 4OX9K 4E1JA 4PWDA 5JS2A 3ASMA 4CGJA 1JXBA 1QS4A 4QAGA 4MDBA 4KH5A 5BR9A 5AQFA 4I2QA 2W41A 1QQCA 2FBXA 4FJ9A 1F21A 1YVNA 2O8BB 4I9LA 4DSFA 5FROA 4FWMA 2XRIA 2ZJRL 3PO5A 1BDGA 4W5QA 2NLXA 1SL0A 3UB5A 4BRAA 3LWMA 3THYA 2D5RA 4CEDA 4CEBA 4JKCA 1S1XA 1K8KA 1WLJA 1L3SA 1KRPA 3MEDA 5BRFA 3V9SA 1HNXK 5M1NA 1IG9A 3LDNA 2A6AA 4E7LA 1EWRA 2E2QA 2HF3A 2CH5A 3R1XA 1U45A 4YDUA 1YVUA 1P90A 3OYHA 3CCRN 3CCLN 4DTSA 2YHYA 4E19A 4WFNL 4JLHA 4WCEL 2FF6A 2ZD1A 3SJJA 3DXKB 4JN4A 4CIFA 3CMEN 4PHTX 3VQAA 1U47A 4KHQA 5AZJB 2Z1HA 4KTWA 4A59A 3ZT1A 4LY7A 4BGBA 3K5OA 3KK2A 3UKRB 4CEOA 4FK4A 5JICA 3I33A 4IO8A 2YHBA 5AQRA 3MECA 4FO0A 4IKFA 4EZ6A 4A2AA 1X9MA 3HPOA 4DQSA 1UA0A 1BWFO 4CJQA 1Q86O 4CJSA 1EXQA 5CZ1A 1XMQK 3H46O 2NZTA 4FK2A 1EETA 2YNHA 4LD0A 2Y1IA 3NDKA 2FSNA 3HOTA 1RT1A 3NF6A 1NKEA 3MCAB 2XY8A 3AVHA 1QTMA 3HM8A 2UYTA 2G8KA 1NGDA 4X66K 3ZETA 3CMAN 2F8TA 2KHOA 4RW9A 3LP2A 1JCEA 4ID5A 2VG6A 4CF9A 3CF5L 4IFVA 3KTQA 5HLFA 4JI3K 1EWQA 1VSLA 3OA9A 2KW4A 3THXA 4DQ8A 1KFDA 3AVGA 5BPNA 1N6QA 4CFDA 1VQLN 4O44A 1RTIA 2P9PA 4IXCA 3LL3A 4NYFA 2RF2A 1QE1A 3R3LA 4M3WA 2Q0RA 3VEYA 5TKYA 1ASVA 1RDAA 5EXWA 1KC8O 5AQMA 4F3TA 2F96A 1T3VA 3O80A 3AO4A 3AO2A 2O8EB 2LSNA 3FZFA 4RG8A 2E6LA 3IRXA 1HNWK 4AQYK 2ASPA 4DQRA 3ENOA 5EY4A 4OVLA 1JLQA 1S1TA 5FPMA 4AM7A 4H4MA 3D2EA 4FVMA 1VQ5N 1FKPA 2DFFA 3OTOK 3DRRA 1I94K 1S1WA 4JS4A 1YI2N 2OPSA 4CIEA 3H3NO 4C8KA 3MN7A 3OYCA 1WOQA 3WXIA 3J81O 1GOCA 3QEWA 3CCUN 2F9WA 1FW6A 2JWLA 2OPQA 3NHGA 4JAXA 4DFJA 3BEXA 3KWIA 4OGEA 4B9NA 3OYGA 1ZBFA 3DWLA 4X62K 3TANA 2AJQA 3CPWM 4LF8K 3NFAA 4B1VA 5KRTA 1JLFA 1VHXA 3DXMA 2KFNA 3UIQA 1XUPO 4Z4HA 3ENHA 2P5OA 3ALYA 5J2QA 3CJAA 3J7ZO 4LFAK 4K42A 1A5WA 3PO4A 2OYQA 4ZTFA 4FJJA 2P9LA 2D0BA 3EKUA 3CCSN 2XY5A 4DHYA 1TL3A 4CHOA 3CM5A 3VN5A 3CC4N 1Z05A 4DR4K 3T3FA 1OH8A 3TTFA 3TPQA 3GG4A 1VQPN 1X1PA 2QWOA 1DLOA 4CIGA 3EE8A 4DTOA 2UUBK 3M6GA 4CJ4A 2NRXA 4YORA 1IBLK 1QSSA 4FSVA 3ZLJA 3C7NA 3IKMA 1XC3A 2QEXN 1BU6O 3ZX2A 4FWOA 5AJ3K 3H1VX 3ITHA 3O1WA 5M1KA 4DR5K 3U9ZA 1U4BA 1J6ZA 4DV3K 1M1KO 4KHUA 4JNEA 5DMRA 4DKWA 4IO9L 4MO5A 2D0OA 1X3NA 5LMUK 2CGLA 2HHTA 3LDSA 3FR0A 4B9UA 3SV3A 3OS0A 2E4LA 4BRKA 1NK5A 5J2NA 1U48A 5CYMA 1IG8A 1ASWA 1MU2A 1O1WA 4BR7A 3ZSZA 3V1OA 2O4IA 1E4FT 3J7YP 4IJNA 4CJEA 1YXQA 1JJ2M 4FLZA 3CJCA 3FZMA 2GWJA 2O8FB 2E2PA 2OTLN 3MCPA 4HWIA 1HPZA 3OYNA 4FW2A 5F1XA 2GBZA 3PSIA 1Y64A 1YUWA 4BR2A 5J2MA 2BUPA 2G8FA 3WUHA 3CC2N 1SKWA 1C0MA 4BR4A 3ID6A 4MFBA 4XH4A 2YX6A 2E8AA 3F2KA 3LZIA 4FYDA 2W40A 4R79A 4J2EA 2D0PA 2HHHK 3A0IX 4CERA 1R59O 1X9JA 3RMDA 4WFBL 4PL7A 3RRHA 1KAYA 3S41A 4FZXC 4PKIA 4JV5K 5HRRA 2O8DB 4CVNE 3QBWA 5C42A 1NGAA 3RMBA 1VRUA 3E9OA 1XNRK 3VESA 4CESA 4O55A 1T03A 2HHWA 5ADXH 3IDHA 1NJWA 4M3ZA 3LANA 4IOCL 1N34K 4F2RA 4KB1A 4LFCK 3CG7A 3M8QA 4AM6A 1HKCA 2HHVA 4X65K 3SAFA 1BL3A 1TVRA 1ZBLA 4I9QA 1YT3A 1S5JA 3AVJA 4JRQA 4CHYA 1BISA 3CETA 4O0JA 3BF3A 4CD3A 1IBMK 1C0GA 4Z94A 3PX6A 1FJGK 4JD2B 3RVCA 4M3YA 2HHUA 1L3VA 2EWSA 3VQCA 2A40A 3HSTB 4CHZA 4H8KA 2OA8A 4WQ5A 1SAZA 2RN2A 3P5JA 3K5NA 3HK2A 4HCCA 4DU1A 3TWHA 5C10A 1S9GA 3AO5A 1NBWA 2QA4N 3OBYA 5HP1A 3A5MC 1LWEA 3AY9A 1NJYA 4OKEA 3EZWA 4ISEA 1WSIA 5HROA 3PSFA 2GELA 4GY2B 1SUQA 3A8YA 4KH4A 2G8VA 1VQ8N 4BQZA 3HPGA
chains in the Genus database with same CATH topology
3A5LC 4F9OA 1GLCG 1GLJO 3KHYA 2E2OA 3AAQA 2I7NA 4MDAA 1Q18A 1V4TA 4OPAA 3QFPA 1ATNA 1S3XA 3CJ9A 2QWMA 2QWPA 4H0VB 4A62A 4U7BA 3BUZB 3CPEA 5AQVA 4BG8A 3QMLA 1ESVA 1VQ9N 2A5XA 1XQSC 3LM2A 3QB0A 3CERA 4YOUA 1NGIA 3N4PA 4AF1A 4CZLA 2A41A 2FSKA 3M1FA 4ILJA 4QS8A 4C1NI 2V51B 5H1SQ 4YOYA 1E4GT 1H1VA 4A61A 3SMPA 4H5WA 4MLHA 3VEZA 3VERA 1YF5L 2YJFA 4H0XB 4BRNA 2AA4A 2FXUA 4JEPA 3ULEB 1BA1A 3HSCA 2P9SB 3RSEB 4O8UA 1S22A 5GIPA 3WT0A 3DAWA 1TUYA 1QZ5A 1C0FA 4E1JA 3MMVA 5MLCQ 3P38A 1Z6RA 4I6MA 5AQTA 1VQON 3SK3A 4MDBA 4KH5A 4BC5A 5FPNA 5BR9A 1BA0A 5AQFA 1HLUA 2W41A 4H0PA 1MDUB 4HTLA 5AQJA 3WQUA 1YVNA 1VQ7N 3BF1A 3VPZA 5CE3A 1DGKN 3L4IA 5GAEP 4FWMA 1T6CA 2ZJRL 2NRHA 1BDGA 4YOTA 1NGJA 2NRWA 2ZF5O 2NLXA 3ATVA 3O6WA 4WYBA 3SJHA 4WQ4A 3UB5A 4BRAA 1YJNN 5TKWA 3H1QA 4A2BA 2GWKA 3PLAA 4JKCA 3UE5A 1K8KA 3WEEB 3FZKA 2D1KA 3ZX3A 3E66A 4CZIA 2A42A 3OHRA 5BN9A 3AAPA 1V4SA 5BRFA 3K9JA 2PBDA 3GOIA 2BTFA 1NGEA 4PL8A 3VF2A 5M1NA 1DT9A 3IMXA 3LDNA 2WBNA 3CCMN 2A6AA 3O9RA 4K43A 3VF6A 2E2QA 2HF3A 2CH5A 3FGUA 3QICA 3R1XA 4YDUA 4BR0A 4CBXA 1P90A 3MN9A 5BN8A 4KH6A 3I55N 3CCRN 3CCLN 3BP8A 3B8AX 4EHUA 4H0YB 5BRDA 2NNWA 1VQ4N 1TUUA 2YHYA 3UKUA 4BG9A 4WFNL 1K9MO 3M5RA 4WCEL 4EHTA 3JS6A 2Q97A 3PIOL 3WXMB 2FF6A 4CBUA 2Q2RA 2VWBA 3G71N 3NMUA 5M1QA 1CZAN 3TSQA 3QDKA 3DXKB 3R6MA 4JN4A 2KLAA 3ATUA 3CMEN 1EO1A 5AQIA 4PHTX 5AQNA 1ZBSA 5AZJB 3ZEUB 2HMPA 1NGGA 4FPAA 4GNIA 4A59A 5BRHA 3LDPA 5AQKA 5I9EB 4BGBA 1W97L 3H3OB 3O4WA 2NRVA 2QTDA 3UKRB 2JWKA 5JICA 3I33A 1MA9B 4IO8A 5AQRA 5FPDA 5M1FA 2NRTA 2FF3B 3O08A 4FO0A 4KBOA 3U8XA 4ISFA 3W0LA 4A2AA 4BRPA 2P9NA 2NRRA 4FWRA 4CZHA 4JKFA 5CR4A 2E20A 1BWFO 4DCHA 3K9KA 3CXCM 1Q86O 4CZMA 3ZYYX 3H46O 2NZTA 3MN6A 1YJ9N 5E84A 5GINA 2HBKA 1SZ2A 2FSNA 3HOTA 2BH1A 3WXKA 4Y0WA 3MCAB 3SBTA 4M63C 5AQGA 5GADP 3HM8A 2UYTA 3GL1A 3NVMA 1NGDA 3CCEN 3ZETA 3CMAN 1YHQN 3IFRA 3MX2A 5M1PA 2KHOA 4A57A 1JCEA 3F9MA 4H5RA 3FLCO 3VEXA 1NLVA 5AQQA 3E9PA 3CF5L 2WFBA 4JKEA 4JKGB 3HI0A 4YDUC 5AR0A 3FZLA 2Q31A 3CIPA 3O9SA 4I6MB 3OA9A 4FWSA 3DLLL 4FWKA 1O13A 4K25A 4C23A 4DQ8A 1RDUA 4ISGA 5BPMA 1HPMA 1LOTB 5BPNA 4A5AA 1VQLN 1HX1A 1EQYA 2WUSA 3I56N 2QXLA 2P9KB 4BVOA 2P9PA 3CCJN 4IXCA 3LL3A 1BG3A 3CJBA 1YITN 3G6EN 3C0BA 4XH5A 3R3LA 2Q0RA 4JKAA 3P4IA 5AFUH 3VEYA 1P8ZA 4JKBA 1KXPA 5TKYA 2IVPA 3VTHA 2ZJPL 3AGKA 5EXWA 3EO3A 1NJIO 1KC8O 5AQMA 5GIOA 3OW2M 4H03B 1K8KB 3E9LA 3D2FA 3ENBA 1U2VA 4JKDA 1T3VA 3O80A 3MWTA 1IJJA 4BQLA 3FZFA 3WXJA 4BC4A 1DKGD 5FPEA 2ASPA 1TYQA 1ATRA 1VQKN 3Q7CA 3KWGA 1S72N 2YHXA 3ENOA 2H3GX 5AQHA 5EY4A 5FPMA 4B1WB 3VEVA 2Q36A 3NVKA 4AM7A 4FPBA 3D2EA 2ZGYA 3GDQA 1VQ5N 2V7ZA 1HUXA 3L6QA 1LCUA 5KPTA 5KPZA 2P9UB 3UKUB 1YI2N 2Q1NA 4CI6A 3H3NO 2GUPA 1T44A 3MN7A 1WOQA 3WXIA 3CCUN 5GAGP 5E26A 3H6EA 4CBWA 5C12A 2F9WA 3VOVA 5F0XA 2JWLA 4JK8A 3L0QA 4JAXA 3P31A 4EAHD 4FWPA 1HKBA 1HJOA 3VENA 4BR9A 3BEXA 4EIAA 3KWIA 3G4SN 2ZWHA 3DWLA 2E1YA 2IIRA 3VEWA 3CPWM 5M1OA 4C1NK 1YIJN 3U4LA 1BO5O 4B1VA 3L4QA 3VGMA 5KPRA 3DXMA 1XUPO 3ENHA 2E1ZA 4U67L 2A3ZA 1RGIA 3CI5A 3FE1A 3QFUA 4H5NA 4IWVA 4QS7A 1N8RO 3CJAA 3D6RA 3J7ZO 2FLOA 4K42A 4FVUA 5AQLA 4B1UB 1NGHA 2P9LA 2V52B 5HOOA 1T6DA 4GV3A 4IEEA 3EKUA 3CCSN 1NM1A 4DHYA 4JK7A 2ZGZA 4IJAA 4CZEA 1QVFM 5B8HA 3SAHA 4B1ZA 3VGKA 3CC4N 5AQPA 3SMSA 1NWKA 3F5TA 3HZ6A 1Z05A 3ZETB 3M3ZA 1MWMA 3FFKB 3CQXA 3HTVA 3SLCA 2FSJA 4H5TA 3TPQA 3TTFA 3GG4A 3R9PA 3O1BA 4B9QA 4EFHA 1VQPN 5JVGL 2Q0UA 3O9QA 5ADXA 1SS6A 4XH1A 4ILHA 2QWOA 3J8AA 5AQWA 2GEMA 3ID8A 1ZXOA 2QWQA 3HRGA 4IDHA 4RTFD 2GX9A 1ILYA 3KZBA 3EE8A 2ITMA 1Q82O 1W2BM 3M6GA 4WF9L 5HL7L 3CJ1A 1WUAA 2NRXA 4IEIA 3FZHA 4YORA 3R8EA 3EN9A 1D4XA 1G99A 3DJCA 4BGAA 4FSVA 2QM1A 4GVEA 1SQKA 4CZGA 3A5NC 4BRIA 1OKJA 1NGCA 2P9PB 3C7NA 1XC3A 2J4RA 3IKMA 4LC9B 2QI2A 3QBXA 4M7XA 1BU6O 3T69A 2QEXN 3ZX2A 3CJ7A 2ASMA 5AQXA 4FWOA 3H1VX 4FWQA 3O1WA 5M1KA 4BREA 4CD1A 4BRDA 1JCGA 3U9ZA 3MDQA 4L3QA 1J6ZA 1NGBA 3VMFB 1M1KO 2HBMA 3D2FB 1U2VB 4J8FA 4JKHA 5LY3A 4JNEA 3TTDA 1KQSM 4BRFA 4DKWA 4BC2A 4IO9L 2ZJQL 3HBTA 3LDOA 4MO5A 2D0OA 4RWTA 1X3NA 2CGKA 2CGLA 3CHWA 3KVGA 4NLCA 2ASOA 3EL2A 3FR0A 1K73O 4IOAL 2HOEA 4BRKA 3D2EB 3DXKA 1GLEG 4CZJA 4JD2A 4O5FA 2HF4A 1IG8A 4CJ7A 5AZJA 4JHDA 2VCPA 2KKZA 4BR7A 3H45C 1HKGA 5AQOA 1E4FT 4UY8O 4IJNA 3MX5A 3UKRA 3TU5A 1QQMA 4BRCA 3IUCA 1YXQA 1JJ2M 3MN5A 3EE9A 3A5OC 1Q81O 3CJCA 3FZMA 3O5BA 2GWJA 2PFUA 4GV6A 4NLBA 3VF4A 3O9TA 2E2PA 2PAVA 2OTLN 3MCPA 3O8MA 4HWIA 2RE2A 4IOXA 1Q7YO 3D7EO 5EVZA 5C2FA 5F1XA 2QW9A 2E88A 3Q7BA 4H0OA 4K41A 1QQNA 3CD6N 3DXMB 1Y64A 5LJWA 1YUWA 2P9IA 2VGNA 3N4QA 4BR2A 2BUPA 3VETA 2IVNA 2QWLA 3CC7N 4BC3A 1NGFA 5F2RA 2F9TA 2YJEA 4WQ5C 5AZIA 3T7ZA 5LJVA 5AFUA 3WUHA 3CC2N 2P9LB 4BR4A 1OVYA 1ATSA 4YOXA 3ID6A 4JKGA 4XH4A 2OTJN 3TSPA 4CZKA 3C6AA 5AQUA 1JCFA 4BRQA 2HBJA 1MWKA 2YX6A 1KD1O 2E8AA 3F2KA 1VAZA 2YI1A 5EOYA 2V7YA 5BPLA 4PKGA 5KQ8A 2W40A 4R79A 5DM6L 2QWRA 1KAXA 2D0PA 2P9KA 1DEJA 4FWLA 4NB4A 2CGJA 4BRLA 1QQOA 3A0IX 1R59O 1X9JA 1U6ZA 4WFBL 3MWPA 4PL7A 1KAYA 3OBWA 3S41A 4MO4A 2VGMA 3C65A 2IVOA 2P9NB 4FWNA 3ULEA 3LM9A 2E2NA 4PKIA 2D4WA 4GV9A 2P9SA 4OPHA 3RSEA 5C15A 3QBWA 4BRGA 5C0YA 4QS9A 1NGAA 3C7NB 4IFEA 3P39A 1VQ6N 2OANA 3E9OA 3LDQA 5BREA 3GBTA 3VESA 1BUPA 1BOTO 4H5VA 4B1XB 2DPNA 5ADXH 3IDHA 1GLAG 4H0TB 4IOCL 4XEIA 2WC9A 1YAGA 2GTDA 5ELZA 3TTCA 3PIPL 4AM6A 4WFAL 1ZC6A 1HKCA 3E1YA 4A5BA 4OO1J 4G9ZA 3VEOA 2F7TA 4BY9C 5DM7L 4BRHA 3MK6A 3GE1A 5JLHA 3O9UA 5KQDA 3SAFA 1YJWN 3LDLA 2YCHA 2P9UA 4FOEA 1K8AO 4JK9A 3CCQN 3CETA 4RCHA 1QHAA 4CZFA 4CD3A 3BF3A 3SAGA 1C0GA 4Z94A 4ILGB 2RHKA 2VYPA 2YHWA 3WEEA 4JD2B 3RVCA 4BROA 5GAHP 3WQTA 4FOIA 2EWSA 5EX5A 3HOSA 4JHDB 5JVHL 4DB3A 3W3DA 5AQYA 1QVGM 2A40A 1GLBG 4NO7A 2NRZA 5AQSA 4WQ5A 1GLDG 1SAZA 2CH6A 2HSTA 1X3MA 2QWNA 3CQYA 3WXLA 2I7PA 1GLFO 3C6HA 3G25A 1KAZA 5JMVA 4B1YB 4PKHA 4WQ4C 5JLFA 1VQNN 4MLEA 5C10A 1M90O 4O8KA 1NBWA 3EKSA 2QA4N 4YOVA 1TYQB 3OBYA 4IZ9A 3A5MC 5C2DA 1RDWX 3JXUA 3AY9A 5AQZA 3ZX0A 1RFQA 4BR5A 4YOWA 4M7YA 3AGRA 3CCVN 3EZWA 3TSUA 4ISEA 1QZ6A 2HBLA 4BVPA 3U9DA 3VTIA 2P9IB 4BRMA 2GELA 1NMDA 3KK7A 3ZEUA 1VQMN 4FL9A 1GLLO 4GY2B 3A8YA 3SBGA 5AZIB 2AP1A 4KH4A 3I8BA 5CHIA 3VGLA 1VQ8N 4BQZA 3AARA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A5L C;  4F9O A;  1GLC G;  1GLJ O;  3KHY A;  2E2O A;  3AAQ A;  2I7N A;  1Q18 A;  1V4T A;  3QFP A;  1ATN A;  1S3X A;  3CJ9 A;  2QWM A;  2QWP A;  4H0V B;  4A62 A;  3BUZ B;  5AQV A;  4BG8 A;  3QML A;  1ESV A;  2A5X A;  1XQS C;  3LM2 A;  3QB0 A;  3CER A;  1NGI A;  4CZL A;  2A41 A;  2FSK A;  3M1F A;  4QS8 A;  2V51 B;  1E4G T;  1H1V A;  4A61 A;  3SMP A;  4H5W A;  4MLH A;  3VEZ A;  3VER A;  2YJF A;  4H0X B;  4BRN A;  2AA4 A;  2FXU A;  3ULE B;  1BA1 A;  3HSC A;  2P9S B;  3RSE B;  1S22 A;  3WT0 A;  3DAW A;  1TUY A;  1QZ5 A;  1C0F A;  4E1J A;  3MMV A;  1Z6R A;  4I6M A;  5AQT A;  3SK3 A;  4BC5 A;  5FPN A;  5BR9 A;  1BA0 A;  5AQF A;  1HLU A;  2W41 A;  4H0P A;  1MDU B;  4HTL A;  5AQJ A;  3WQU A;  1YVN A;  3BF1 A;  3VPZ A;  5CE3 A;  1DGK N;  3L4I A;  4FWM A;  1T6C A;  2NRH A;  1BDG A;  1NGJ A;  2ZF5 O;  3ATV A;  2NLX A;  3O6W A;  4WYB A;  3UB5 A;  3SJH A;  4WQ4 A;  4BRA A;  3H1Q A;  4A2B A;  2GWK A;  3UE5 A;  1K8K A;  3WEE B;  3FZK A;  2D1K A;  3ZX3 A;  4CZI A;  2A42 A;  3OHR A;  5BN9 A;  3AAP A;  1V4S A;  5BRF A;  2PBD A;  3GOI A;  2BTF A;  1NGE A;  4PL8 A;  3VF2 A;  3IMX A;  3LDN A;  2A6A A;  4K43 A;  3VF6 A;  2E2Q A;  2HF3 A;  2CH5 A;  3FGU A;  3QIC A;  4CBX A;  4YDU A;  4BR0 A;  3MN9 A;  5BN8 A;  3BP8 A;  3B8A X;  4EHU A;  4H0Y B;  5BRD A;  1TUU A;  2YHY A;  3UKU A;  4BG9 A;  4EHT A;  3JS6 A;  2Q97 A;  2FF6 A;  4CBU A;  2Q2R A;  2VWB A;  1CZA N;  3QDK A;  3DXK B;  3R6M A;  4JN4 A;  3ATU A;  5AQI A;  5AQN A;  1ZBS A;  5AZJ B;  3ZEU B;  2HMP A;  1NGG A;  4FPA A;  4GNI A;  5BRH A;  3LDP A;  5AQK A;  5I9E B;  4BGB A;  3H3O B;  3O4W A;  3UKR B;  5JIC A;  3I33 A;  1MA9 B;  4IO8 A;  5AQR A;  5FPD A;  2FF3 B;  3O08 A;  4FO0 A;  4KBO A;  3U8X A;  4ISF A;  3W0L A;  4A2A A;  4BRP A;  2P9N A;  4FWR A;  2E20 A;  1BWF O;  4DCH A;  4CZM A;  3H46 O;  2NZT A;  3MN6 A;  5E84 A;  1SZ2 A;  2FSN A;  3WXK A;  4Y0W A;  4M63 C;  5AQG A;  3HM8 A;  2UYT A;  3GL1 A;  1NGD A;  3ZET A;  3IFR A;  2KHO A;  1JCE A;  3F9M A;  4H5R A;  3FLC O;  3VEX A;  1NLV A;  5AQQ A;  4YDU C;  3HI0 A;  5AR0 A;  3FZL A;  2Q31 A;  3CIP A;  4I6M B;  4FWS A;  4FWK A;  4K25 A;  4C23 A;  4DQ8 A;  4ISG A;  5BPM A;  1HPM A;  1LOT B;  5BPN A;  1HX1 A;  1EQY A;  2WUS A;  2QXL A;  2P9K B;  4BVO A;  2P9P A;  4IXC A;  3LL3 A;  1BG3 A;  3CJB A;  3C0B A;  4XH5 A;  2Q0R A;  3P4I A;  5AFU H;  3VEY A;  1P8Z A;  1KXP A;  5TKY A;  2IVP A;  5EXW A;  3EO3 A;  5AQM A;  4H03 B;  1K8K B;  3D2F A;  1U2V A;  3O80 A;  1IJJ A;  4BQL A;  3FZF A;  3WXJ A;  4BC4 A;  1DKG D;  5FPE A;  2ASP A;  1TYQ A;  1ATR A;  2YHX A;  3ENO A;  2H3G X;  5AQH A;  5EY4 A;  5FPM A;  4B1W B;  3VEV A;  2Q36 A;  4AM7 A;  4FPB A;  3D2E A;  2ZGY A;  3GDQ A;  2V7Z A;  1HUX A;  3L6Q A;  1LCU A;  5KPT A;  5KPZ A;  2P9U B;  3UKU B;  2Q1N A;  4CI6 A;  3H3N O;  2GUP A;  1T44 A;  3MN7 A;  1WOQ A;  3WXI A;  5E26 A;  3H6E A;  4CBW A;  2F9W A;  3VOV A;  5F0X A;  3L0Q A;  4JAX A;  4EAH D;  4FWP A;  1HKB A;  1HJO A;  3VEN A;  4BR9 A;  3BEX A;  4EIA A;  2ZWH A;  3DWL A;  2E1Y A;  2IIR A;  3VEW A;  3U4L A;  1BO5 O;  4B1V A;  3VGM A;  5KPR A;  3DXM A;  1XUP O;  3ENH A;  2E1Z A;  2A3Z A;  3CI5 A;  1RGI A;  3FE1 A;  3QFU A;  4H5N A;  4IWV A;  4QS7 A;  3CJA A;  2FLO A;  4K42 A;  5AQL A;  4B1U B;  1NGH A;  2P9L A;  2V52 B;  1T6D A;  3EKU A;  1NM1 A;  4DHY A;  2ZGZ A;  4IJA A;  4CZE A;  5B8H A;  4B1Z A;  3VGK A;  5AQP A;  3SMS A;  1NWK A;  3HZ6 A;  1Z05 A;  3ZET B;  3M3Z A;  1MWM A;  3FFK B;  3CQX A;  3HTV A;  3SLC A;  2FSJ A;  4H5T A;  3TPQ A;  4B9Q A;  3GG4 A;  3R9P A;  3O1B A;  4EFH A;  2Q0U A;  5ADX A;  4XH1 A;  2QWO A;  3J8A A;  5AQW A;  2GEM A;  3ID8 A;  1ZXO A;  2QWQ A;  4RTF D;  3KZB A;  2ITM A;  3M6G A;  3CJ1 A;  1WUA A;  3FZH A;  3R8E A;  3EN9 A;  1D4X A;  1G99 A;  3DJC A;  4BGA A;  4FSV A;  2QM1 A;  4CZG A;  1SQK A;  3A5N C;  4BRI A;  1OKJ A;  1NGC A;  2P9P B;  3C7N A;  1XC3 A;  2J4R A;  4LC9 B;  4M7X A;  3QBX A;  3U9D A;  4CZH A;  1BU6 O;  3ZX2 A;  3CJ7 A;  2ASM A;  5AQX A;  4FWO A;  3H1V X;  4FWQ A;  3O1W A;  4BRE A;  4CD1 A;  4BRD A;  1JCG A;  3U9Z A;  3MDQ A;  4L3Q A;  1J6Z A;  1NGB A;  3D2F B;  1U2V B;  4J8F A;  5LY3 A;  4JNE A;  4BRF A;  4BC2 A;  3HBT A;  3LDO A;  4MO5 A;  2D0O A;  4RWT A;  1X3N A;  2CGK A;  2CGL A;  3CHW A;  3KVG A;  2ASO A;  3EL2 A;  3FR0 A;  2HOE A;  4BRK A;  3D2E B;  3DXK A;  1GLE G;  4CZJ A;  4JD2 A;  4O5F A;  2HF4 A;  1IG8 A;  4CJ7 A;  5AZJ A;  4JHD A;  2VCP A;  4BR7 A;  3H45 C;  1HKG A;  5AQO A;  1E4F T;  4IJN A;  3UKR A;  3TU5 A;  1QQM A;  4BRC A;  3IUC A;  1YXQ A;  3MN5 A;  3A5O C;  3CJC A;  3FZM A;  3O5B A;  2GWJ A;  3VF4 A;  2E2P A;  2PAV A;  3MCP A;  3O8M A;  4HWI A;  3D7E O;  5EVZ A;  5F1X A;  2QW9 A;  2E88 A;  4H0O A;  4K41 A;  1QQN A;  3DXM B;  1Y64 A;  5LJW A;  1YUW A;  2P9I A;  4BR2 A;  2BUP A;  3VET A;  2IVN A;  2QWL A;  4BC3 A;  1NGF A;  5F2R A;  2F9T A;  2YJE A;  4WQ5 C;  5AZI A;  5LJV A;  5AFU A;  3WUH A;  2P9L B;  4BR4 A;  1ATS A;  4XH4 A;  4CZK A;  5AQU A;  1JCF A;  4BRQ A;  1MWK A;  2E8A A;  5EOY A;  2YI1 A;  5BPL A;  2V7Y A;  5KQ8 A;  4PKG A;  2W40 A;  2QWR A;  1KAX A;  2D0P A;  2P9K A;  1DEJ A;  4FWL A;  4NB4 A;  2CGJ A;  4BRL A;  1QQO A;  3A0I X;  1R59 O;  1X9J A;  1U6Z A;  4PL7 A;  1KAY A;  3S41 A;  4MO4 A;  2IVO A;  2P9N B;  4FWN A;  3ULE A;  3LM9 A;  2E2N A;  4PKI A;  2D4W A;  2P9S A;  3RSE A;  3QBW A;  4BRG A;  4QS9 A;  1NGA A;  3C7N B;  2OAN A;  3LDQ A;  5BRE A;  3GBT A;  3VES A;  1BUP A;  1BOT O;  4H5V A;  4B1X B;  2DPN A;  5ADX H;  3IDH A;  1GLA G;  4H0T B;  4XEI A;  1YAG A;  2GTD A;  5ELZ A;  4AM6 A;  1ZC6 A;  1HKC A;  3VEO A;  4BRH A;  3MK6 A;  3GE1 A;  5JLH A;  5KQD A;  3LDL A;  2YCH A;  2P9U A;  4FOE A;  3CET A;  4RCH A;  1QHA A;  4CZF A;  4CD3 A;  3BF3 A;  1C0G A;  4Z94 A;  2VYP A;  2YHW A;  3WEE A;  4JD2 B;  4BRO A;  3WQT A;  4FOI A;  2EWS A;  5EX5 A;  4JHD B;  4DB3 A;  3W3D A;  5AQY A;  2A40 A;  1GLB G;  4NO7 A;  5AQS A;  4WQ5 A;  1GLD G;  1SAZ A;  2CH6 A;  1X3M A;  2QWN A;  3CQY A;  3WXL A;  2I7P A;  1GLF O;  3G25 A;  1KAZ A;  5JMV A;  4B1Y B;  4PKH A;  4WQ4 C;  5JLF A;  4MLE A;  4O8K A;  1NBW A;  3EKS A;  1TYQ B;  4IZ9 A;  3A5M C;  1RDW X;  3JXU A;  3AY9 A;  5AQZ A;  3ZX0 A;  1RFQ A;  4BR5 A;  4M7Y A;  3EZW A;  4ISE A;  1QZ6 A;  4BVP A;  2P9I B;  4BRM A;  2GEL A;  1NMD A;  3ZEU A;  4FL9 A;  1GLL O;  4GY2 B;  3A8Y A;  5AZI B;  2AP1 A;  3I8B A;  3VGL A;  4BQZ A;  3AAR A; 
#chains in the Genus database with same CATH topology
 4F9O A;  1GLJ O;  4OPA A;  1V4T A;  1S3X A;  2QWM A;  1HMV A;  1WB9 A;  4A62 A;  3BUZ B;  5AQV A;  1XQS C;  3LM2 A;  3QB0 A;  5FLX O;  1NGI A;  2BGG A;  3L8B A;  3M1F A;  3T1H K;  3NBP A;  3SMP A;  4BRN A;  2F4V K;  1YTA A;  3DOK A;  3RRG A;  1Q9Y A;  1S22 A;  5GIP A;  4DR1 K;  4CJK A;  4M3T A;  3VQ5 A;  3BY5 A;  3AO1 A;  2HB5 A;  4M45 A;  2W42 A;  4F3O A;  1Z6R A;  3MEG A;  4CEC A;  4BC5 A;  1RBV A;  5FPN A;  1BA0 A;  1BQM A;  4B08 A;  5AQJ A;  1C1C A;  3BF1 A;  1T6C A;  2NRH A;  3ATV A;  1ZBI A;  4C8O A;  5K14 A;  5TKW A;  2OZS A;  3ZT2 A;  4A2B A;  2GWK A;  3PLA A;  3UE5 A;  3MEE A;  1QSL A;  4G1Q A;  3E66 A;  3QEX A;  4CZI A;  3OHR A;  4CFC A;  3AA2 A;  2PBD A;  4I2P A;  3PX4 A;  1TKD A;  1L5U A;  1BI4 B;  3SUP A;  4PL8 A;  2PYJ A;  3U3Y A;  3TAM A;  5KTQ A;  4B3R K;  2UXD K;  1C6V A;  3KK1 A;  4KI4 A;  3FGU A;  4DSE A;  4FK0 A;  1NU0 A;  1XHZ A;  4EHU A;  1UOC A;  5BRD A;  1TUU A;  3UKU A;  3M5R A;  4EHT A;  3JS6 A;  3V81 A;  3OYK A;  3MXJ A;  2Q2R A;  3NMU A;  4JI2 K;  3TSQ A;  4JI8 K;  3B6O A;  4Z4E A;  4ICL A;  2KLA A;  3ATU A;  4NCG A;  3ZEU B;  2HMP A;  1NGG A;  3HL8 A;  5BRH A;  1VSF A;  3LDP A;  3L2W A;  5I9E B;  1NK8 A;  1NKB A;  4LF5 K;  3VA0 A;  1JL2 A;  3U8X A;  3W0L A;  4CEF A;  4Z4I A;  4JYA K;  2E20 A;  4DCH A;  3CXC M;  3K9K A;  1Y97 A;  4DUY K;  3ZYY X;  3AVL A;  4HUE A;  2Z1J A;  2HBK A;  4OKJ A;  2UXB K;  3SBT A;  5AQG A;  1LW0 A;  3NH2 A;  1VK0 A;  1YHQ N;  3IFR A;  5M1P A;  5C25 A;  1ASU A;  4A57 A;  3QEV A;  3DLE A;  3FLC O;  1NLV A;  3E9P A;  2WFB A;  4JKG B;  3O3H A;  4FM1 A;  3O9S A;  4FWS A;  4JS5 A;  3DLK A;  3PY8 A;  1HPM A;  3S9H A;  4LH5 A;  3I56 N;  2P9K B;  4BVO A;  3OYL A;  1TK5 A;  1RT4 A;  1BG3 A;  1YIT N;  1A5V A;  3C0B A;  4XH5 A;  4CGD A;  1P8Z A;  4JKB A;  2ZJP L;  3BZC A;  1NJI O;  4DQP A;  1RIL A;  3OW2 M;  4H03 B;  1K8K B;  1U2V A;  4JKD A;  3SCX A;  4HUG A;  4BC4 A;  3F9K A;  1VQK N;  1ATR A;  4F8R A;  3KK3 A;  1TL1 A;  3Q7C A;  3KWG A;  1S72 N;  3ZSR A;  1S1U A;  5AQH A;  4AHV A;  1WSE A;  3NVK A;  3QIN A;  1RNH A;  1WAJ A;  4ELU A;  5C24 A;  4IDK A;  5KPZ A;  4NCA A;  2P9U B;  2VQE K;  2Q1N A;  4FJL A;  4BDP A;  3V9X A;  3QLH A;  2G8I A;  1JL1 A;  4W5N A;  3NF9 A;  5E26 A;  4DF8 A;  3K58 A;  5F0X A;  4JK8 A;  3RR7 A;  4UQG A;  2D0A A;  4EIA A;  3G4S N;  3IG1 A;  2ZWH A;  3VEW A;  3OY9 A;  5M1O A;  1J53 A;  4CJR A;  4DV4 K;  2BAN A;  2PY5 A;  3NAE A;  2ETJ A;  3OJU A;  3ZSX A;  1RGI A;  4H5N A;  1NK6 A;  1N8R O;  4Y1C A;  4IWV A;  3D6R A;  4DV6 K;  2FLO A;  4FVU A;  3O3F A;  4BE2 A;  4FJN A;  1NGH A;  2V52 B;  4YFU A;  4IEE A;  2HVI A;  4LSN A;  3SAH A;  3VQ6 A;  4B1Z A;  5LMN K;  4KHN A;  3LZJ A;  3ZET B;  3M3Z A;  1MWM A;  4OLB A;  1RTJ A;  2IC3 A;  4EFH A;  3O1B A;  2OPP A;  3O9Q A;  4ILH A;  3HP9 A;  3ID8 A;  3AVM A;  4K8X A;  4WE1 A;  1RBT A;  4F2S A;  4JI0 K;  4FJ7 A;  2IS3 A;  1WUA A;  4IEI A;  3FZH A;  1G99 A;  4CZG A;  2QM1 A;  3A5N C;  4BRI A;  2P9P B;  3THW A;  3T69 A;  1KTQ A;  4M7X A;  2QI2 A;  3QBX A;  2UUA K;  1ZYQ A;  1TKX A;  1OH6 A;  2ASM A;  5E41 A;  1KFS A;  3AA4 A;  4B9V A;  4X64 K;  1NOZ A;  3AVN A;  4BRE A;  4CD1 A;  4BRD A;  3OYM A;  4L3Q A;  3VMF B;  2HBM A;  4OJR A;  1JLA A;  5LY3 A;  3TTD A;  1KQS M;  3QIP A;  4BRF A;  3HBT A;  4RWT A;  3AVI A;  4B8C A;  4CE9 A;  3VQE A;  3DYA A;  4OKK A;  4DFK A;  3AV9 A;  3D2E B;  3DXK A;  4CZJ A;  4DU3 A;  2P51 A;  4K8Z A;  5A2Q O;  3ZCM A;  4J2B A;  5AZJ A;  4JHD A;  2VCP A;  5EU7 A;  5AQO A;  4CJF A;  2D0C A;  3UKR A;  3TU5 A;  1RCH A;  1QQM A;  3IUC A;  1JLG A;  2HNY A;  4B8A B;  2KZZ A;  3MN5 A;  4DR2 K;  1T8E A;  1RDC A;  2FBT A;  3O5B A;  1A5X A;  1RTH A;  4GV6 A;  4NLB A;  3MXM A;  4BE0 A;  4IOX A;  1Q7Y O;  5EVZ A;  4CFB A;  2ZE2 A;  3Q7B A;  4H0O A;  4K41 A;  1QQN A;  1Z26 A;  3DXM B;  3OS2 A;  5LJW A;  2VGN A;  2P9I A;  3VET A;  4K0K K;  3QET A;  1NGF A;  5F2R A;  2F9T A;  2YJE A;  5AZI A;  3T7Z A;  1D9D A;  2HW3 A;  2P9L B;  1NK4 A;  1ATS A;  4YOX A;  4CGF A;  2OTJ N;  4CZK A;  1SL2 A;  5D3G A;  1VAZ A;  2DFH A;  2YI1 A;  5EOY A;  5KQ8 A;  3VA3 A;  3QER A;  5DM6 L;  3ULD A;  1DEJ A;  1HRH A;  1QQO A;  4AHR A;  3KLG A;  3D0P A;  4LF6 K;  2IVO A;  2P9N B;  4NCB A;  3EY1 A;  2VG7 A;  3HVR A;  2P9S A;  4OPH A;  3RSE A;  5C0Y A;  4BRG A;  4QS9 A;  3LWL A;  3L2Q A;  4IFE A;  3C7N B;  1WBD A;  3J80 O;  3P39 A;  4AHT A;  1VQ6 N;  3NH1 A;  3LDQ A;  4LFB K;  1BUP A;  1BOT O;  4H5V A;  5LL6 Z;  4H0T B;  4DSL A;  4XEI A;  2WC9 A;  1YAG A;  3PIP L;  3WNE A;  4CCH A;  3U3G A;  4WFA L;  4DV7 K;  4G9Z A;  4DR7 K;  1HYV A;  2F7T A;  3NF7 A;  3VEO A;  1S6Q A;  3GE1 A;  5JLH A;  5KQD A;  1YJW N;  3KLE A;  4FOE A;  2X6S A;  4JK9 A;  3KLH A;  3CCQ N;  3S3N A;  5KI6 A;  2HMI A;  4RCH A;  3EZ5 A;  1KVA A;  2RHK A;  2VYP A;  4CJ5 A;  3WEE A;  4DLE A;  4BRO A;  3U6F A;  5I3U A;  3WQT A;  3TR8 A;  3IS9 A;  4DB3 A;  2Z1I A;  5BR8 K;  1QVG M;  1GLB G;  4NO7 A;  5AQS A;  4IG0 A;  3LPT A;  1GLD G;  1TAQ A;  3VQ4 A;  4HHT A;  3CQY A;  3S3O A;  3F73 A;  1KAZ A;  4O5B A;  5JMV A;  4M3X A;  4IBN A;  5JLF A;  1VQN N;  1M90 O;  4QCL A;  1NJZ A;  3QES A;  1FK9 A;  1CZB A;  1TYQ B;  3DLH A;  3L3U A;  5AQZ A;  3CCV N;  4B9M A;  3AGR A;  3T1Y K;  4OGC A;  4FJM A;  1WNS A;  4DTJ A;  4BRM A;  4GKK K;  3LPU A;  3KK7 A;  2JLE A;  1VQM N;  1NK9 A;  4NXM K;  2AP1 A;  5CHI A;  4GKJ K;  3AAR A;  4BDZ A;  1Q18 A;  3L3V A;  3QFP A;  2OPR A;  4CK1 A;  3B6P A;  2B6A A;  1N32 K;  2QWP A;  4H4O A;  3DRP A;  3HO1 A;  3ZSV A;  3QML A;  1RBS A;  4E1M A;  1OH5 A;  3M8P A;  3TAE A;  1RT2 A;  3N4P A;  4DTP A;  2A41 A;  4GW6 A;  4C1N I;  2V51 B;  4YOY A;  4A61 A;  1IKW A;  4JRP A;  4RW7 A;  2YNI A;  3VER A;  2YJF A;  4H0X B;  2XO7 A;  3PX0 A;  1TUY A;  2DTU A;  1QZ5 A;  1C0F A;  4B3T K;  3MMV A;  1HNV A;  3NE6 A;  5MLC Q;  3P38 A;  3OYF A;  1J54 A;  4I6M A;  1VQO N;  3SK3 A;  4RW8 A;  1JKH A;  1HLU A;  1MDU B;  4HTL A;  3TAP A;  1VQ7 N;  3V9Z A;  5CE3 A;  3L4I A;  1FXX A;  5J1E A;  1IO2 A;  1NGJ A;  2ZF5 O;  1YJN N;  1XHX A;  4WQ4 A;  1S6P A;  4C8L A;  1VSE A;  4DG1 A;  4KB0 A;  3FZK A;  1IKX A;  5BN9 A;  4KPY A;  1V4S A;  4B9S A;  3AVF A;  3K9J A;  3DI6 A;  4PQU A;  1NGE A;  1DT9 A;  4FW1 A;  3IMX A;  5CZ2 A;  4KHW A;  2WBN A;  3CCM N;  4CHQ A;  4DV2 K;  4N76 A;  3QIC A;  4CBX A;  4BR0 A;  5BN8 A;  3V1Q A;  1VQ4 N;  4PY5 A;  1K9M O;  5KRS A;  4CHN A;  2G8W A;  4FJG A;  3WXM B;  5HRP A;  2VWB A;  4FZZ A;  2W6L A;  1IKV A;  1CZA N;  4PUO A;  3R6M A;  4KTQ A;  1EO1 A;  1RDB A;  5AQI A;  4FPA A;  3ZSO A;  4GNI A;  1TAU A;  4M3R A;  4M42 A;  4KI6 A;  3H3O B;  2O8C A;  3O4W A;  3MXI A;  3KD5 E;  2QTD A;  2JWK A;  2Q3S A;  1MA9 B;  5FPD A;  2NRT A;  4ISF A;  1BCO A;  3V9U A;  2NRR A;  4E1N A;  1KSP A;  1NNE A;  3V6D A;  5CR4 A;  2O8D A;  3NF8 A;  4CZM A;  4JI5 K;  3VQ8 A;  1WAF A;  1SZ2 A;  1B9F A;  1ITG A;  2QXF A;  1NKC A;  3WXK A;  1I39 A;  1TKZ A;  2EHG A;  4ID1 A;  5GAD P;  3K5L A;  4BWM A;  3SNN A;  2KFZ A;  3GL1 A;  3NVM A;  3CCE N;  4LF7 K;  1KLN A;  2KTQ A;  3F9M A;  2R7Y A;  4OLA A;  4DV5 K;  1BIZ A;  4ZTJ A;  1VSM A;  1HQE A;  4JKE A;  3HI0 A;  4R5P A;  3DLL L;  1O13 A;  4K25 A;  4Z0U A;  1RDU A;  1SKS A;  3LP1 A;  2WUS A;  2QXL A;  4B9L A;  3CJB A;  1RTD A;  4JKA A;  5AFU H;  4M3U A;  2ZM6 K;  3CFO A;  2IVP A;  3K57 A;  3EO3 A;  1GOB A;  4RW6 A;  3E9L A;  4FLT A;  3D2F A;  2VWK A;  2E5L K;  4BQL A;  2B5J A;  3WXJ A;  1J5E K;  3V4I A;  3T19 A;  4E89 A;  1X9W A;  3QNN A;  2HHQ A;  2H3G X;  3VEV A;  2Q36 A;  2YHA A;  2ZGY A;  3GDQ A;  4PA1 A;  3VQB A;  3VQ9 A;  3UKU B;  1LWC A;  4AHC A;  2QKB A;  1JLE A;  1SL1 A;  3RMC A;  1T05 A;  1NG9 A;  4KO0 A;  1CZ9 A;  1BIU A;  3H6E A;  4CJU A;  5C12 A;  3VOV A;  3L0Q A;  3P31 A;  1S9E A;  4EAH D;  2I5J A;  4FWP A;  1ZBH A;  1HJO A;  2W6K A;  4BR9 A;  3HPH A;  1XC9 A;  2IIR A;  4C1N K;  3AVK A;  4CJV A;  3U4L A;  3L4Q A;  5KGW A;  4Z4F A;  3RTV A;  4NYN A;  2E1Z A;  4U67 L;  3CI5 A;  1TKT A;  2GV9 A;  3O4Q A;  4CW7 B;  3V9W A;  1GOA A;  4B3M K;  5AQL A;  4B1U B;  1XMO K;  5HOO A;  3WNH A;  3TAB A;  1NM1 A;  2ZGZ A;  4IJA A;  4CZE A;  1QVF M;  1UWB A;  2HNZ A;  1NWK A;  3F5T A;  1TK0 A;  2G8H A;  3FFK B;  3CQX A;  4C8M A;  3HTV A;  3SLC A;  1C1A A;  3R9P A;  5JVG L;  5ADX A;  4XH1 A;  2WTU A;  3J8A A;  5AQW A;  2ITG A;  3HJF A;  1ZXO A;  2GX9 A;  2ITM A;  4HVJ A;  1W2B M;  2XY6 A;  2IGI A;  3EN9 A;  4E7J A;  4B3S K;  4DFP A;  1D9F A;  4LC9 B;  1OKJ A;  3U9D A;  1HYZ A;  3SQ1 A;  1XI1 A;  5AQX A;  1BI4 A;  4FWQ A;  3M8R A;  4BWJ A;  3E01 A;  1JCG A;  1REV A;  4C8N A;  2RKI A;  1RDD A;  4FLY A;  1TK8 A;  1U2V B;  1DTT A;  3V1R A;  3TAG A;  4BC2 A;  1U04 A;  2CGK A;  3DLR A;  3OYJ A;  3I0S A;  2ASO A;  2FC0 A;  4CF8 A;  1K73 O;  3PUF A;  1WSJ A;  4FJX A;  1CLQ A;  1GLE G;  3HXM A;  4O5F A;  2HF4 A;  1QSY A;  1B92 A;  3BGR A;  1VRT A;  4LF9 K;  2DFE A;  3THY B;  4UY8 O;  3HP6 A;  4BRC A;  4N5S A;  4AH9 A;  4CK3 A;  2YNF A;  3SQ0 A;  3QO9 A;  1N5Y A;  1LAV A;  2QK9 A;  2FBV A;  3VF4 A;  3SUQ A;  3O9T A;  2PAV A;  1XWL A;  1S1V A;  1NMN A;  3D7E O;  4LSL A;  4TSX A;  2QW9 A;  3KJV A;  2YNG A;  1KLM A;  3N4Q A;  4BC3 A;  4WQ5 C;  5AFU A;  4HUF A;  2DY4 A;  2PZS A;  4JKG A;  5AQU A;  1JCF A;  2HBJ A;  4NXN K;  3WNG A;  3TAQ A;  2VG5 A;  3NH0 A;  1Q9X A;  1DTQ A;  4V19 S;  5BPL A;  2V7Y A;  4PKG A;  2QWR A;  1KAX A;  2P9K A;  1HYS A;  3H08 A;  2CGJ A;  4BRL A;  3L2V A;  1U6Z A;  3MWP A;  3OBW A;  2ATQ A;  2VGM A;  3C65 A;  3PV8 A;  4Q5V A;  3ULE A;  3I0R A;  3OYE A;  2E2N A;  4GV9 A;  2D4W A;  5C15 A;  3O3G A;  3THW B;  3SUO A;  1WBB A;  3D45 A;  2OAN A;  1W9H A;  3GBT A;  4B1X B;  2DPN A;  4O4G A;  1BHL A;  1GLA G;  3E1Y A;  1UA1 A;  1T7P A;  4OO1 J;  2O8B A;  4BY9 C;  5DM7 L;  4BRH A;  3MK6 A;  1U49 A;  4FXD A;  1D5A A;  2P9U A;  4FLW A;  1JLB A;  2VQF K;  1QHA A;  3THX B;  3SAG A;  1HNI A;  1SV5 A;  2YHW A;  3ZSQ A;  3LAL A;  5GAH P;  2ZQB A;  4AIL C;  1C1B A;  4FOI A;  5EX5 A;  3HOS A;  4JHD B;  5JVH L;  2KQ2 A;  1TGO A;  3AA5 X;  1C0U A;  3DRS A;  3BZK A;  2HST A;  1KVC A;  1RBU A;  2QWN A;  3JYT A;  3WXL A;  5FDL A;  3G25 A;  3BDP A;  4HCB A;  1TV6 A;  4CJL A;  4B1Y B;  4PKH A;  4OPK A;  1LW2 A;  4JI4 K;  4MLE A;  4DQI A;  3SQ4 A;  4IZ9 A;  5C2D A;  1RDW X;  3ZX0 A;  4BR5 A;  1RFQ A;  4DV1 K;  1NOY A;  3HT3 A;  3CFP A;  1QZ6 A;  3C95 A;  4KHY A;  3VTI A;  2P9I B;  4DSK A;  1NMD A;  4FL9 A;  1RT7 A;  5AZI B;  1Q8I A;  3VGL A;  2XY7 A;  1GLC G;  4LF4 K;  3KHY A;  4FJH A;  2E6M A;  1ATN A;  1NJX A;  2OCE A;  4U7B A;  4H0V B;  4CGI A;  4BG8 A;  1ESV A;  1VQ9 N;  4M41 A;  2A5X A;  4CGG A;  2JGU A;  3AVC A;  4OPJ A;  4YOU A;  4AF1 A;  4CZL A;  2FSK A;  3LP0 A;  4ILJ A;  5H1S Q;  1E4G T;  3LAK A;  5SZT A;  4H5W A;  2UU9 K;  3C6U A;  3SPZ A;  1YF5 L;  4GVM A;  2FXU A;  3MAQ A;  4W5R A;  3HSC A;  2P9S B;  3RSE B;  3QNO A;  4O8U A;  4FM2 A;  3DAW A;  4I7F A;  4FJK A;  3K59 A;  3S3M A;  4DV0 K;  3SI6 A;  5AQT A;  4DQQ A;  4DFM A;  3LP3 A;  3OYA A;  4FJ5 A;  2HHX A;  4H0P A;  4FLV A;  1N36 K;  4FZY A;  3WQU A;  4AHU A;  3DLG A;  4W5O A;  3VPZ A;  2X78 A;  1DGK N;  3AO3 A;  5GAE P;  1C0T A;  1ZBU A;  3ZT3 A;  4YOT A;  2NRW A;  3O6W A;  4IOA L;  4WYB A;  3SJH A;  3H1Q A;  3OYI A;  2IDO A;  2KZM A;  3WEE B;  1RT3 A;  4E7I A;  2D1K A;  3ZX3 A;  4DR6 K;  3DLB A;  2A42 A;  3AAP A;  4CEQ A;  2O8E A;  3SUN A;  1B9D A;  3GOI A;  2BTF A;  3VF2 A;  4F4K A;  3JSM A;  3HVT A;  1VSJ A;  3O9R A;  4K43 A;  3CM6 A;  3G0Z A;  3VF6 A;  3MN9 A;  3I55 N;  4KH6 A;  3BP8 A;  3B8A X;  2VWJ A;  4H0Y B;  1RBR A;  3KLF A;  2NNW A;  4N41 A;  4BG9 A;  2GUI A;  2Q97 A;  3PIO L;  4CBU A;  2QKK A;  3G71 N;  5HBM A;  4BE1 A;  4ELT A;  5M1Q A;  1WN7 A;  3QDK A;  4FM0 A;  3JAM O;  2A1R A;  1HQU A;  1VSH A;  5AQN A;  4N47 A;  1ZBS A;  1CXQ A;  5AQK A;  5HRS A;  1W97 L;  1K6Y A;  4FCY A;  3SYZ A;  3AVB A;  4CJW A;  4KRE A;  2NRV A;  3HYF A;  5M1F A;  1WSH A;  2FF3 B;  3O08 A;  4KBO A;  3SQ2 A;  4BRP A;  2P9N A;  1NK7 A;  3VQD A;  4FWR A;  4JKF A;  2RPI A;  4IFY A;  4DLG A;  1RT5 A;  3MN6 A;  1YJ9 N;  3NCI A;  5E84 A;  5GIN A;  1IBK K;  4CK2 A;  2BH1 A;  1QHT A;  4Y0W A;  2WOM A;  4M63 C;  3KKS A;  4BAC A;  3FFI A;  3SZ2 A;  3MX2 A;  3AVA A;  4RW4 A;  3DMJ A;  4H5R A;  3VEX A;  5AQQ A;  2YV0 X;  4DSJ A;  1HJR A;  4YDU C;  3AA3 A;  3FZL A;  2Q31 A;  3CIP A;  4I6M B;  5AR0 A;  4JI1 K;  4FWK A;  4C23 A;  3O4N A;  3THV A;  4ISG A;  5BPM A;  1LOT B;  4A5A A;  1HX1 A;  4B9T A;  1IKY A;  1EQY A;  1VSI A;  4DSI A;  3KD1 E;  3CCJ N;  4L8R B;  1XNQ K;  5JS1 A;  3G6E N;  3ZT0 A;  1NK0 A;  3P4I A;  3VTH A;  1KXP A;  2G8U A;  3AGK A;  5GIO A;  2EX3 A;  4CF0 A;  3QEP A;  3ENB A;  3MWT A;  1IJJ A;  4DS4 A;  3J7A P;  1DKG D;  5FPE A;  4DUZ K;  1TYQ A;  2YHX A;  4KTZ A;  4B1W B;  4FPB A;  1VSD A;  4IG3 A;  1W0H A;  2V7Z A;  5HRN A;  1HUX A;  3L6Q A;  3KLI A;  1I3A A;  1BCM A;  1LCU A;  5KPT A;  3KIO A;  4CI6 A;  4B3O A;  2OZM A;  2GUP A;  1T44 A;  5SWM A;  4ZHR A;  5GAG P;  4CBW A;  4EP4 A;  4QOZ B;  3CYM A;  1HKB A;  3VEN A;  2O8F A;  4DTU A;  2E1Y A;  2BDP A;  2O8C B;  1YIJ N;  3SV4 A;  1L3U A;  1BO5 O;  3VGM A;  1OVQ A;  5FRN A;  5IT9 O;  1BGX T;  5KPR A;  4LH4 A;  3TI0 A;  2A3Z A;  3FE1 A;  3QFU A;  4QS7 A;  1LWF A;  2YKN A;  4ELV A;  1T6D A;  1SKR A;  1HNZ K;  4GV3 A;  4JK7 A;  3EEQ A;  5B8H A;  4BDY A;  3VGK A;  1EX4 A;  5AQP A;  3SMS A;  3HZ6 A;  2FBY A;  4O0I A;  4B9Q A;  2FSJ A;  4H5T A;  1HR0 K;  2P5G A;  2Q0U A;  4CJP A;  1SS6 A;  1OH7 A;  4CEE A;  4IDH A;  2GEM A;  4RTF D;  2QWQ A;  3HRG A;  3CQ8 A;  3DM2 A;  1R0A A;  1ILY A;  3KZB A;  1Q82 O;  3C94 A;  4WF9 L;  5HL7 L;  3CJ1 A;  1IV0 A;  3EYZ A;  3R8E A;  1D4X A;  3DJC A;  4BGA A;  4GVE A;  4DTX A;  1KVB A;  1SQK A;  2F8S A;  1J9A A;  1NGC A;  4CZH A;  2J4R A;  2O4G A;  5KGX A;  3CJ7 A;  5J2P A;  5CYQ A;  3SPY A;  3ZSW A;  3MDQ A;  1NGB A;  3P83 D;  3D2F B;  4J8F A;  4YNQ A;  4N56 A;  4E7H A;  4JKH A;  4FLX A;  2ZJQ L;  3LDO A;  4CF2 A;  2HND A;  4W5T A;  3CHW A;  3KVG A;  4NLC A;  3EL2 A;  4KHP K;  2HOE A;  1CXU A;  5I42 A;  3TAR A;  1FKO A;  4JD2 A;  4CJ7 A;  4XIU A;  4CFA A;  2KKZ A;  4E7K A;  4Z4G A;  3H45 C;  1G15 A;  1HKG A;  4KRF A;  4FJ8 A;  3K0S A;  3MX5 A;  1JXE A;  3EE9 A;  3A5O C;  1Q81 O;  2WON A;  4KAZ A;  2PFU A;  3OYB A;  4DF4 A;  3K2P A;  3QEI A;  3RMA A;  1L3T A;  3WNF A;  3O8M A;  2RE2 A;  2IAJ A;  5IWA K;  3T1A A;  5C2F A;  2PYL A;  4DWI A;  2E88 A;  4Z4C A;  3CD6 N;  4EZ9 A;  3P1G A;  2IVN A;  2QWL A;  2X6N A;  2Z1G A;  3CC7 N;  1IH7 A;  1WSF A;  5LJV A;  3OS1 A;  1OVY A;  3ISN C;  3TSP A;  3C6A A;  4BRQ A;  3DOL A;  5FRM A;  1MWK A;  1KD1 O;  1YTU A;  1D8Y A;  4KV8 A;  3TAF A;  4DTN A;  2X74 A;  2HVH A;  4FWL A;  4NB4 A;  4MQ3 A;  1LAW A;  3CFR A;  4YHH K;  4CJT A;  4MO4 A;  4FWN A;  3LM9 A;  3VQP A;  2HHS A;  5BRE A;  3OYD A;  2BE2 A;  1X9S A;  3M8S A;  2GTD A;  4KKO A;  5ELZ A;  3TTC A;  4DTR A;  1ZC6 A;  4A5B A;  1LV5 A;  3RR8 A;  4Y1D A;  4J2D A;  3IAY A;  2NUB A;  4HTU A;  1VSK A;  3O9U A;  3LDL A;  2YCH A;  4FJI A;  1N33 K;  1K8A O;  4CZF A;  4ILG B;  3NGY A;  3G10 A;  1KCF A;  3I8D A;  3OJS A;  4E0D A;  2XHB A;  2YKM A;  3C6T A;  4YY3 K;  5DK5 A;  1RT6 A;  3W3D A;  4FLU A;  1BQN A;  5AQY A;  2NRZ A;  1UAX A;  2CH6 A;  4JI6 K;  1X3M A;  4DTM A;  2I7P A;  1GLF O;  1EKE A;  3C6H A;  3VQQ A;  4JI7 K;  3RWU A;  4WQ4 C;  4CGH A;  3NGI A;  4O8K A;  3EKS A;  4YOV A;  3A2F A;  3OVN A;  4KHS A;  3JXU A;  4YOW A;  1WSG A;  4M7Y A;  2UUC K;  3TSU A;  4DS5 A;  2HBL A;  3LAM A;  4DMN A;  4BVP A;  4GMJ B;  4EP5 A;  3ZEU A;  3L2U A;  1JLC A;  1GLL O;  3SBG A;  3ZSY A;  1EP4 A;  3I8B A;  3HM9 A;  1Z25 A;  2UXC K;  4KFB A;  3KKR A;  4CF1 A;  5T7B A;  3L2R A;  3A5L C;  4AHS A;  2E2O A;  3AAQ A;  5CY4 A;  2I7N A;  3QIO A;  4MDA A;  3VQ7 A;  3K5M A;  4Q0B A;  2A1S A;  1J5O A;  3CJ9 A;  4J2A A;  3CPE A;  1W7A A;  4CHP A;  3CER A;  1E3M A;  4QS8 A;  4CEA A;  1H1V A;  4E3S A;  2Y1J A;  4CJ3 A;  4MLH A;  3VEZ A;  2AA4 A;  4JEP A;  3ULE B;  2IOC A;  4DU4 A;  1BA1 A;  4CEZ A;  2P1J A;  4DR3 K;  3WT0 A;  2B4J A;  3ZT4 A;  3NGZ A;  4OX9 K;  4E1J A;  4PWD A;  5JS2 A;  3ASM A;  4CGJ A;  1JXB A;  1QS4 A;  4QAG A;  4MDB A;  4KH5 A;  5BR9 A;  5AQF A;  4I2Q A;  2W41 A;  1QQC A;  2FBX A;  4FJ9 A;  1F21 A;  1YVN A;  2O8B B;  4I9L A;  4DSF A;  5FRO A;  4FWM A;  2XRI A;  2ZJR L;  3PO5 A;  1BDG A;  4W5Q A;  2NLX A;  1SL0 A;  3UB5 A;  4BRA A;  3LWM A;  3THY A;  2D5R A;  4CED A;  4CEB A;  4JKC A;  1S1X A;  1K8K A;  1WLJ A;  1L3S A;  1KRP A;  3MED A;  5BRF A;  3V9S A;  1HNX K;  5M1N A;  1IG9 A;  3LDN A;  2A6A A;  4E7L A;  1EWR A;  2E2Q A;  2HF3 A;  2CH5 A;  3R1X A;  1U45 A;  4YDU A;  1YVU A;  1P90 A;  3OYH A;  3CCR N;  3CCL N;  4DTS A;  2YHY A;  4E19 A;  4WFN L;  4JLH A;  4WCE L;  2FF6 A;  2ZD1 A;  3SJJ A;  3DXK B;  4JN4 A;  4CIF A;  3CME N;  4PHT X;  3VQA A;  1U47 A;  4KHQ A;  5AZJ B;  2Z1H A;  4KTW A;  4A59 A;  3ZT1 A;  4LY7 A;  4BGB A;  3K5O A;  3KK2 A;  3UKR B;  4CEO A;  4FK4 A;  5JIC A;  3I33 A;  4IO8 A;  2YHB A;  5AQR A;  3MEC A;  4FO0 A;  4IKF A;  4EZ6 A;  4A2A A;  1X9M A;  3HPO A;  4DQS A;  1UA0 A;  1BWF O;  4CJQ A;  1Q86 O;  4CJS A;  1EXQ A;  5CZ1 A;  1XMQ K;  3H46 O;  2NZT A;  4FK2 A;  1EET A;  2YNH A;  4LD0 A;  2Y1I A;  3NDK A;  2FSN A;  3HOT A;  1RT1 A;  3NF6 A;  1NKE A;  3MCA B;  2XY8 A;  3AVH A;  1QTM A;  3HM8 A;  2UYT A;  2G8K A;  1NGD A;  4X66 K;  3ZET A;  3CMA N;  2F8T A;  2KHO A;  4RW9 A;  3LP2 A;  1JCE A;  4ID5 A;  2VG6 A;  4CF9 A;  3CF5 L;  4IFV A;  3KTQ A;  5HLF A;  4JI3 K;  1EWQ A;  1VSL A;  3OA9 A;  2KW4 A;  3THX A;  4DQ8 A;  1KFD A;  3AVG A;  5BPN A;  1N6Q A;  4CFD A;  1VQL N;  4O44 A;  1RTI A;  2P9P A;  4IXC A;  3LL3 A;  4NYF A;  2RF2 A;  1QE1 A;  3R3L A;  4M3W A;  2Q0R A;  3VEY A;  5TKY A;  1ASV A;  1RDA A;  5EXW A;  1KC8 O;  5AQM A;  4F3T A;  2F96 A;  1T3V A;  3O80 A;  3AO4 A;  3AO2 A;  2O8E B;  2LSN A;  3FZF A;  4RG8 A;  2E6L A;  3IRX A;  1HNW K;  4AQY K;  2ASP A;  4DQR A;  3ENO A;  5EY4 A;  4OVL A;  1JLQ A;  1S1T A;  5FPM A;  4AM7 A;  4H4M A;  3D2E A;  4FVM A;  1VQ5 N;  1FKP A;  2DFF A;  3OTO K;  3DRR A;  1I94 K;  1S1W A;  4JS4 A;  1YI2 N;  2OPS A;  4CIE A;  3H3N O;  4C8K A;  3MN7 A;  3OYC A;  1WOQ A;  3WXI A;  3J81 O;  1GOC A;  3QEW A;  3CCU N;  2F9W A;  1FW6 A;  2JWL A;  2OPQ A;  3NHG A;  4JAX A;  4DFJ A;  3BEX A;  3KWI A;  4OGE A;  4B9N A;  3OYG A;  1ZBF A;  3DWL A;  4X62 K;  3TAN A;  2AJQ A;  3CPW M;  4LF8 K;  3NFA A;  4B1V A;  5KRT A;  1JLF A;  1VHX A;  3DXM A;  2KFN A;  3UIQ A;  1XUP O;  4Z4H A;  3ENH A;  2P5O A;  3ALY A;  5J2Q A;  3CJA A;  3J7Z O;  4LFA K;  4K42 A;  1A5W A;  3PO4 A;  2OYQ A;  4ZTF A;  4FJJ A;  2P9L A;  2D0B A;  3EKU A;  3CCS N;  2XY5 A;  4DHY A;  1TL3 A;  4CHO A;  3CM5 A;  3VN5 A;  3CC4 N;  1Z05 A;  4DR4 K;  3T3F A;  1OH8 A;  3TTF A;  3TPQ A;  3GG4 A;  1VQP N;  1X1P A;  2QWO A;  1DLO A;  4CIG A;  3EE8 A;  4DTO A;  2UUB K;  3M6G A;  4CJ4 A;  2NRX A;  4YOR A;  1IBL K;  1QSS A;  4FSV A;  3ZLJ A;  3C7N A;  3IKM A;  1XC3 A;  2QEX N;  1BU6 O;  3ZX2 A;  4FWO A;  5AJ3 K;  3H1V X;  3ITH A;  3O1W A;  5M1K A;  4DR5 K;  3U9Z A;  1U4B A;  1J6Z A;  4DV3 K;  1M1K O;  4KHU A;  4JNE A;  5DMR A;  4DKW A;  4IO9 L;  4MO5 A;  2D0O A;  1X3N A;  5LMU K;  2CGL A;  2HHT A;  3LDS A;  3FR0 A;  4B9U A;  3SV3 A;  3OS0 A;  2E4L A;  4BRK A;  1NK5 A;  5J2N A;  1U48 A;  5CYM A;  1IG8 A;  1ASW A;  1MU2 A;  1O1W A;  4BR7 A;  3ZSZ A;  3V1O A;  2O4I A;  1E4F T;  3J7Y P;  4IJN A;  4CJE A;  1YXQ A;  1JJ2 M;  4FLZ A;  3CJC A;  3FZM A;  2GWJ A;  2O8F B;  2E2P A;  2OTL N;  3MCP A;  4HWI A;  1HPZ A;  3OYN A;  4FW2 A;  5F1X A;  2GBZ A;  3PSI A;  1Y64 A;  1YUW A;  4BR2 A;  5J2M A;  2BUP A;  2G8F A;  3WUH A;  3CC2 N;  1SKW A;  1C0M A;  4BR4 A;  3ID6 A;  4MFB A;  4XH4 A;  2YX6 A;  2E8A A;  3F2K A;  3LZI A;  4FYD A;  2W40 A;  4R79 A;  4J2E A;  2D0P A;  2HHH K;  3A0I X;  4CER A;  1R59 O;  1X9J A;  3RMD A;  4WFB L;  4PL7 A;  3RRH A;  1KAY A;  3S41 A;  4FZX C;  4PKI A;  4JV5 K;  5HRR A;  2O8D B;  4CVN E;  3QBW A;  5C42 A;  1NGA A;  3RMB A;  1VRU A;  3E9O A;  1XNR K;  3VES A;  4CES A;  4O55 A;  1T03 A;  2HHW A;  5ADX H;  3IDH A;  1NJW A;  4M3Z A;  3LAN A;  4IOC L;  1N34 K;  4F2R A;  4KB1 A;  4LFC K;  3CG7 A;  3M8Q A;  4AM6 A;  1HKC A;  2HHV A;  4X65 K;  3SAF A;  1BL3 A;  1TVR A;  1ZBL A;  4I9Q A;  1YT3 A;  1S5J A;  3AVJ A;  4JRQ A;  4CHY A;  1BIS A;  3CET A;  4O0J A;  3BF3 A;  4CD3 A;  1IBM K;  1C0G A;  4Z94 A;  3PX6 A;  1FJG K;  4JD2 B;  3RVC A;  4M3Y A;  2HHU A;  1L3V A;  2EWS A;  3VQC A;  2A40 A;  3HST B;  4CHZ A;  4H8K A;  2OA8 A;  4WQ5 A;  1SAZ A;  2RN2 A;  3P5J A;  3K5N A;  3HK2 A;  4HCC A;  4DU1 A;  3TWH A;  5C10 A;  1S9G A;  3AO5 A;  1NBW A;  2QA4 N;  3OBY A;  5HP1 A;  3A5M C;  1LWE A;  3AY9 A;  1NJY A;  4OKE A;  3EZW A;  4ISE A;  1WSI A;  5HRO A;  3PSF A;  2GEL A;  4GY2 B;  1SUQ A;  3A8Y A;  4KH4 A;  2G8V A;  1VQ8 N;  4BQZ A;  3HPG A; 
#chains in the Genus database with same CATH homology
 3A5L C;  4F9O A;  1GLC G;  1GLJ O;  3KHY A;  2E2O A;  3AAQ A;  2I7N A;  4MDA A;  1Q18 A;  1V4T A;  4OPA A;  3QFP A;  1ATN A;  1S3X A;  3CJ9 A;  2QWM A;  2QWP A;  4H0V B;  4A62 A;  4U7B A;  3BUZ B;  3CPE A;  5AQV A;  4BG8 A;  3QML A;  1ESV A;  1VQ9 N;  2A5X A;  1XQS C;  3LM2 A;  3QB0 A;  3CER A;  4YOU A;  1NGI A;  3N4P A;  4AF1 A;  4CZL A;  2A41 A;  2FSK A;  3M1F A;  4ILJ A;  4QS8 A;  4C1N I;  2V51 B;  5H1S Q;  4YOY A;  1E4G T;  1H1V A;  4A61 A;  3SMP A;  4H5W A;  4MLH A;  3VEZ A;  3VER A;  1YF5 L;  2YJF A;  4H0X B;  4BRN A;  2AA4 A;  2FXU A;  4JEP A;  3ULE B;  1BA1 A;  3HSC A;  2P9S B;  3RSE B;  4O8U A;  1S22 A;  5GIP A;  3WT0 A;  3DAW A;  1TUY A;  1QZ5 A;  1C0F A;  4E1J A;  3MMV A;  5MLC Q;  3P38 A;  1Z6R A;  4I6M A;  5AQT A;  1VQO N;  3SK3 A;  4MDB A;  4KH5 A;  4BC5 A;  5FPN A;  5BR9 A;  1BA0 A;  5AQF A;  1HLU A;  2W41 A;  4H0P A;  1MDU B;  4HTL A;  5AQJ A;  3WQU A;  1YVN A;  1VQ7 N;  3BF1 A;  3VPZ A;  5CE3 A;  1DGK N;  3L4I A;  5GAE P;  4FWM A;  1T6C A;  2ZJR L;  2NRH A;  1BDG A;  4YOT A;  1NGJ A;  2NRW A;  2ZF5 O;  2NLX A;  3ATV A;  3O6W A;  4WYB A;  3SJH A;  4WQ4 A;  3UB5 A;  4BRA A;  1YJN N;  5TKW A;  3H1Q A;  4A2B A;  2GWK A;  3PLA A;  4JKC A;  3UE5 A;  1K8K A;  3WEE B;  3FZK A;  2D1K A;  3ZX3 A;  3E66 A;  4CZI A;  2A42 A;  3OHR A;  5BN9 A;  3AAP A;  1V4S A;  5BRF A;  3K9J A;  2PBD A;  3GOI A;  2BTF A;  1NGE A;  4PL8 A;  3VF2 A;  5M1N A;  1DT9 A;  3IMX A;  3LDN A;  2WBN A;  3CCM N;  2A6A A;  3O9R A;  4K43 A;  3VF6 A;  2E2Q A;  2HF3 A;  2CH5 A;  3FGU A;  3QIC A;  3R1X A;  4YDU A;  4BR0 A;  4CBX A;  1P90 A;  3MN9 A;  5BN8 A;  4KH6 A;  3I55 N;  3CCR N;  3CCL N;  3BP8 A;  3B8A X;  4EHU A;  4H0Y B;  5BRD A;  2NNW A;  1VQ4 N;  1TUU A;  2YHY A;  3UKU A;  4BG9 A;  4WFN L;  1K9M O;  3M5R A;  4WCE L;  4EHT A;  3JS6 A;  2Q97 A;  3PIO L;  3WXM B;  2FF6 A;  4CBU A;  2Q2R A;  2VWB A;  3G71 N;  3NMU A;  5M1Q A;  1CZA N;  3TSQ A;  3QDK A;  3DXK B;  3R6M A;  4JN4 A;  2KLA A;  3ATU A;  3CME N;  1EO1 A;  5AQI A;  4PHT X;  5AQN A;  1ZBS A;  5AZJ B;  3ZEU B;  2HMP A;  1NGG A;  4FPA A;  4GNI A;  4A59 A;  5BRH A;  3LDP A;  5AQK A;  5I9E B;  4BGB A;  1W97 L;  3H3O B;  3O4W A;  2NRV A;  2QTD A;  3UKR B;  2JWK A;  5JIC A;  3I33 A;  1MA9 B;  4IO8 A;  5AQR A;  5FPD A;  5M1F A;  2NRT A;  2FF3 B;  3O08 A;  4FO0 A;  4KBO A;  3U8X A;  4ISF A;  3W0L A;  4A2A A;  4BRP A;  2P9N A;  2NRR A;  4FWR A;  4CZH A;  4JKF A;  5CR4 A;  2E20 A;  1BWF O;  4DCH A;  3K9K A;  3CXC M;  1Q86 O;  4CZM A;  3ZYY X;  3H46 O;  2NZT A;  3MN6 A;  1YJ9 N;  5E84 A;  5GIN A;  2HBK A;  1SZ2 A;  2FSN A;  3HOT A;  2BH1 A;  3WXK A;  4Y0W A;  3MCA B;  3SBT A;  4M63 C;  5AQG A;  5GAD P;  3HM8 A;  2UYT A;  3GL1 A;  3NVM A;  1NGD A;  3CCE N;  3ZET A;  3CMA N;  1YHQ N;  3IFR A;  3MX2 A;  5M1P A;  2KHO A;  4A57 A;  1JCE A;  3F9M A;  4H5R A;  3FLC O;  3VEX A;  1NLV A;  5AQQ A;  3E9P A;  3CF5 L;  2WFB A;  4JKE A;  4JKG B;  3HI0 A;  4YDU C;  5AR0 A;  3FZL A;  2Q31 A;  3CIP A;  3O9S A;  4I6M B;  3OA9 A;  4FWS A;  3DLL L;  4FWK A;  1O13 A;  4K25 A;  4C23 A;  4DQ8 A;  1RDU A;  4ISG A;  5BPM A;  1HPM A;  1LOT B;  5BPN A;  4A5A A;  1VQL N;  1HX1 A;  1EQY A;  2WUS A;  3I56 N;  2QXL A;  2P9K B;  4BVO A;  2P9P A;  3CCJ N;  4IXC A;  3LL3 A;  1BG3 A;  3CJB A;  1YIT N;  3G6E N;  3C0B A;  4XH5 A;  3R3L A;  2Q0R A;  4JKA A;  3P4I A;  5AFU H;  3VEY A;  1P8Z A;  4JKB A;  1KXP A;  5TKY A;  2IVP A;  3VTH A;  2ZJP L;  3AGK A;  5EXW A;  3EO3 A;  1NJI O;  1KC8 O;  5AQM A;  5GIO A;  3OW2 M;  4H03 B;  1K8K B;  3E9L A;  3D2F A;  3ENB A;  1U2V A;  4JKD A;  1T3V A;  3O80 A;  3MWT A;  1IJJ A;  4BQL A;  3FZF A;  3WXJ A;  4BC4 A;  1DKG D;  5FPE A;  2ASP A;  1TYQ A;  1ATR A;  1VQK N;  3Q7C A;  3KWG A;  1S72 N;  2YHX A;  3ENO A;  2H3G X;  5AQH A;  5EY4 A;  5FPM A;  4B1W B;  3VEV A;  2Q36 A;  3NVK A;  4AM7 A;  4FPB A;  3D2E A;  2ZGY A;  3GDQ A;  1VQ5 N;  2V7Z A;  1HUX A;  3L6Q A;  1LCU A;  5KPT A;  5KPZ A;  2P9U B;  3UKU B;  1YI2 N;  2Q1N A;  4CI6 A;  3H3N O;  2GUP A;  1T44 A;  3MN7 A;  1WOQ A;  3WXI A;  3CCU N;  5GAG P;  5E26 A;  3H6E A;  4CBW A;  5C12 A;  2F9W A;  3VOV A;  5F0X A;  2JWL A;  4JK8 A;  3L0Q A;  4JAX A;  3P31 A;  4EAH D;  4FWP A;  1HKB A;  1HJO A;  3VEN A;  4BR9 A;  3BEX A;  4EIA A;  3KWI A;  3G4S N;  2ZWH A;  3DWL A;  2E1Y A;  2IIR A;  3VEW A;  3CPW M;  5M1O A;  4C1N K;  1YIJ N;  3U4L A;  1BO5 O;  4B1V A;  3L4Q A;  3VGM A;  5KPR A;  3DXM A;  1XUP O;  3ENH A;  2E1Z A;  4U67 L;  2A3Z A;  1RGI A;  3CI5 A;  3FE1 A;  3QFU A;  4H5N A;  4IWV A;  4QS7 A;  1N8R O;  3CJA A;  3D6R A;  3J7Z O;  2FLO A;  4K42 A;  4FVU A;  5AQL A;  4B1U B;  1NGH A;  2P9L A;  2V52 B;  5HOO A;  1T6D A;  4GV3 A;  4IEE A;  3EKU A;  3CCS N;  1NM1 A;  4DHY A;  4JK7 A;  2ZGZ A;  4IJA A;  4CZE A;  1QVF M;  5B8H A;  3SAH A;  4B1Z A;  3VGK A;  3CC4 N;  5AQP A;  3SMS A;  1NWK A;  3F5T A;  3HZ6 A;  1Z05 A;  3ZET B;  3M3Z A;  1MWM A;  3FFK B;  3CQX A;  3HTV A;  3SLC A;  2FSJ A;  4H5T A;  3TPQ A;  3TTF A;  3GG4 A;  3R9P A;  3O1B A;  4B9Q A;  4EFH A;  1VQP N;  5JVG L;  2Q0U A;  3O9Q A;  5ADX A;  1SS6 A;  4XH1 A;  4ILH A;  2QWO A;  3J8A A;  5AQW A;  2GEM A;  3ID8 A;  1ZXO A;  2QWQ A;  3HRG A;  4IDH A;  4RTF D;  2GX9 A;  1ILY A;  3KZB A;  3EE8 A;  2ITM A;  1Q82 O;  1W2B M;  3M6G A;  4WF9 L;  5HL7 L;  3CJ1 A;  1WUA A;  2NRX A;  4IEI A;  3FZH A;  4YOR A;  3R8E A;  3EN9 A;  1D4X A;  1G99 A;  3DJC A;  4BGA A;  4FSV A;  2QM1 A;  4GVE A;  1SQK A;  4CZG A;  3A5N C;  4BRI A;  1OKJ A;  1NGC A;  2P9P B;  3C7N A;  1XC3 A;  2J4R A;  3IKM A;  4LC9 B;  2QI2 A;  3QBX A;  4M7X A;  1BU6 O;  3T69 A;  2QEX N;  3ZX2 A;  3CJ7 A;  2ASM A;  5AQX A;  4FWO A;  3H1V X;  4FWQ A;  3O1W A;  5M1K A;  4BRE A;  4CD1 A;  4BRD A;  1JCG A;  3U9Z A;  3MDQ A;  4L3Q A;  1J6Z A;  1NGB A;  3VMF B;  1M1K O;  2HBM A;  3D2F B;  1U2V B;  4J8F A;  4JKH A;  5LY3 A;  4JNE A;  3TTD A;  1KQS M;  4BRF A;  4DKW A;  4BC2 A;  4IO9 L;  2ZJQ L;  3HBT A;  3LDO A;  4MO5 A;  2D0O A;  4RWT A;  1X3N A;  2CGK A;  2CGL A;  3CHW A;  3KVG A;  4NLC A;  2ASO A;  3EL2 A;  3FR0 A;  1K73 O;  4IOA L;  2HOE A;  4BRK A;  3D2E B;  3DXK A;  1GLE G;  4CZJ A;  4JD2 A;  4O5F A;  2HF4 A;  1IG8 A;  4CJ7 A;  5AZJ A;  4JHD A;  2VCP A;  2KKZ A;  4BR7 A;  3H45 C;  1HKG A;  5AQO A;  1E4F T;  4UY8 O;  4IJN A;  3MX5 A;  3UKR A;  3TU5 A;  1QQM A;  4BRC A;  3IUC A;  1YXQ A;  1JJ2 M;  3MN5 A;  3EE9 A;  3A5O C;  1Q81 O;  3CJC A;  3FZM A;  3O5B A;  2GWJ A;  2PFU A;  4GV6 A;  4NLB A;  3VF4 A;  3O9T A;  2E2P A;  2PAV A;  2OTL N;  3MCP A;  3O8M A;  4HWI A;  2RE2 A;  4IOX A;  1Q7Y O;  3D7E O;  5EVZ A;  5C2F A;  5F1X A;  2QW9 A;  2E88 A;  3Q7B A;  4H0O A;  4K41 A;  1QQN A;  3CD6 N;  3DXM B;  1Y64 A;  5LJW A;  1YUW A;  2P9I A;  2VGN A;  3N4Q A;  4BR2 A;  2BUP A;  3VET A;  2IVN A;  2QWL A;  3CC7 N;  4BC3 A;  1NGF A;  5F2R A;  2F9T A;  2YJE A;  4WQ5 C;  5AZI A;  3T7Z A;  5LJV A;  5AFU A;  3WUH A;  3CC2 N;  2P9L B;  4BR4 A;  1OVY A;  1ATS A;  4YOX A;  3ID6 A;  4JKG A;  4XH4 A;  2OTJ N;  3TSP A;  4CZK A;  3C6A A;  5AQU A;  1JCF A;  4BRQ A;  2HBJ A;  1MWK A;  2YX6 A;  1KD1 O;  2E8A A;  3F2K A;  1VAZ A;  2YI1 A;  5EOY A;  2V7Y A;  5BPL A;  4PKG A;  5KQ8 A;  2W40 A;  4R79 A;  5DM6 L;  2QWR A;  1KAX A;  2D0P A;  2P9K A;  1DEJ A;  4FWL A;  4NB4 A;  2CGJ A;  4BRL A;  1QQO A;  3A0I X;  1R59 O;  1X9J A;  1U6Z A;  4WFB L;  3MWP A;  4PL7 A;  1KAY A;  3OBW A;  3S41 A;  4MO4 A;  2VGM A;  3C65 A;  2IVO A;  2P9N B;  4FWN A;  3ULE A;  3LM9 A;  2E2N A;  4PKI A;  2D4W A;  4GV9 A;  2P9S A;  4OPH A;  3RSE A;  5C15 A;  3QBW A;  4BRG A;  5C0Y A;  4QS9 A;  1NGA A;  3C7N B;  4IFE A;  3P39 A;  1VQ6 N;  2OAN A;  3E9O A;  3LDQ A;  5BRE A;  3GBT A;  3VES A;  1BUP A;  1BOT O;  4H5V A;  4B1X B;  2DPN A;  5ADX H;  3IDH A;  1GLA G;  4H0T B;  4IOC L;  4XEI A;  2WC9 A;  1YAG A;  2GTD A;  5ELZ A;  3TTC A;  3PIP L;  4AM6 A;  4WFA L;  1ZC6 A;  1HKC A;  3E1Y A;  4A5B A;  4OO1 J;  4G9Z A;  3VEO A;  2F7T A;  4BY9 C;  5DM7 L;  4BRH A;  3MK6 A;  3GE1 A;  5JLH A;  3O9U A;  5KQD A;  3SAF A;  1YJW N;  3LDL A;  2YCH A;  2P9U A;  4FOE A;  1K8A O;  4JK9 A;  3CCQ N;  3CET A;  4RCH A;  1QHA A;  4CZF A;  4CD3 A;  3BF3 A;  3SAG A;  1C0G A;  4Z94 A;  4ILG B;  2RHK A;  2VYP A;  2YHW A;  3WEE A;  4JD2 B;  3RVC A;  4BRO A;  5GAH P;  3WQT A;  4FOI A;  2EWS A;  5EX5 A;  3HOS A;  4JHD B;  5JVH L;  4DB3 A;  3W3D A;  5AQY A;  1QVG M;  2A40 A;  1GLB G;  4NO7 A;  2NRZ A;  5AQS A;  4WQ5 A;  1GLD G;  1SAZ A;  2CH6 A;  2HST A;  1X3M A;  2QWN A;  3CQY A;  3WXL A;  2I7P A;  1GLF O;  3C6H A;  3G25 A;  1KAZ A;  5JMV A;  4B1Y B;  4PKH A;  4WQ4 C;  5JLF A;  1VQN N;  4MLE A;  5C10 A;  1M90 O;  4O8K A;  1NBW A;  3EKS A;  2QA4 N;  4YOV A;  1TYQ B;  3OBY A;  4IZ9 A;  3A5M C;  5C2D A;  1RDW X;  3JXU A;  3AY9 A;  5AQZ A;  3ZX0 A;  1RFQ A;  4BR5 A;  4YOW A;  4M7Y A;  3AGR A;  3CCV N;  3EZW A;  3TSU A;  4ISE A;  1QZ6 A;  2HBL A;  4BVP A;  3U9D A;  3VTI A;  2P9I B;  4BRM A;  2GEL A;  1NMD A;  3KK7 A;  3ZEU A;  1VQM N;  4FL9 A;  1GLL O;  4GY2 B;  3A8Y A;  3SBG A;  5AZI B;  2AP1 A;  4KH4 A;  3I8B A;  5CHI A;  3VGL A;  1VQ8 N;  4BQZ A;  3AAR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...