2FSJA

Crystal structure of ta0583, an archaeal actin homolog, native data
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
325
structure length
318
Chain Sequence
b'MVVVGLDVGYGDTKVIGVDGKRIIFPSRWAVTETESWKIPVLSTDGGQTKFIYGKYASGNNIRVPQGDGRLASKEAFPLIAAALWESGIHNPVDLVIGSGTPLGTFDLEVKAAKEALENKVLTVTGPEGEVRQFNITRLIMRPQGVGAALYLLNQGIIEQQPGYGVVIDVGSRTTDVLTINLMDMEPVVELSFSLQIGVGDAISALSRKIAKETGFVVPFDLAQEALSHPVMFRQKQVGGPEVSGPILEDLANRIIENIRLNLRGEVDRVTSLIPVGGGSNLIGDRFEEIAPGTLVKIKPEDLQFANALGYRDAAERS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein Ta0583
publication title Crystal structure of an archaeal actin homolog
pubmed doi rcsb
source organism Thermoplasma acidophilum
molecule tags Structural protein
total genus 88
structure length 318
sequence length 325
ec nomenclature
pdb deposition date 2006-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17989 ALP_N Actin like proteins N terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2fsjA02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2fsjA01
3FE1A 3HZ6A 4BRMA 4CD3A 2FXUA 3H3OB 3QFUA 1S22A 5AQOA 2E20A 4DQ8A 5AZJB 3L6QA 4FWLA 4PL8A 3FZMA 5AQQA 4PKIA 1U2VA 3BP8A 3EN9A 4B1YB 3U4LA 1NGBA 2P9NA 3DXMB 5LJVA 4A61A 2EWSA 3HSCA 4BG9A 4NB4A 5AQFA 3CJAA 3A5OC 3ZEUB 1YXQA 2QWPA 2P9IB 4FO0A 1E4GT 2A5XA 1T6CA 2V7YA 3VEXA 1X3MA 2ZGZA 2FSJA 2W40A 1BA1A 2VWBA 5BR9A 3WXJA 1XUPO 3UB5A 1CZAN 2YI1A 4A2BA 4H0TB 3CETA 5AQTA 2P9KB 1SZ2A 1C0GA 1T6DA 5BPLA 4H5TA 3H3NO 1IJJA 1GLCG 3MDQA 4JAXA 4WQ4C 4WQ5C 4GNIA 1C0FA 3VEYA 2E88A 4RCHA 4GY2B 1BG3A 4BR7A 3SMSA 1V4SA 3UKUA 3WEEB 2P9PA 1MDUB 2GWJA 2P9SB 1TUYA 3A5MC 1QZ5A 2P9LA 3EO3A 1ZC6A 3FGUA 3VEVA 5CE3A 4BRFA 3C7NA 3QBXA 2QXLA 3SLCA 4NO7A 4MLEA 3LDLA 3RSEA 3VEZA 4H0VB 1KAXA 3L0QA 4B1WB 3KHYA 1P8ZA 1QHAA 2W41A 4BR4A 2CGKA 4FWQA 5BRFA 5AQIA 5AQKA 4BGBA 5E84A 4M7XA 5BPNA 2E2PA 4JD2A 4QS7A 3WXIA 2H3GX 1WOQA 3MN5A 1T44A 5AQSA 2HF3A 1Z6RA 2FLOA 2BUPA 4XEIA 3FZFA 3QBWA 2D0PA 4H0PA 1S3XA 4BC5A 3O08A 5JLHA 2ZF5O 1XC3A 4DHYA 3OHRA 2QWMA 2PAVA 3D2FA 2J4RA 1MWMA 3CQYA 3H6EA 4CJ7A 4CZIA 1GLDG 5AZIB 3A5LC 3B8AX 3VEWA 2F9WA 2IVOA 4BVOA 1TYQB 2P9UA 3LDPA 3DAWA 1LCUA 5LY3A 3F9MA 5BPMA 5BREA 1BWFO 4K41A 4AM6A 3GOIA 3AARA 4BRCA 3I33A 3CJ9A 3O4WA 4BC3A 4E1JA 1SAZA 4XH4A 1RGIA 3CHWA 5FPNA 3C0BA 4BG8A 5ELZA 2ZWHA 3H1VX 3S41A 1NM1A 2AP1A 4CD1A 2E2NA 4XH5A 2ITMA 3ULEA 1TUUA 3A5NC 5AQYA 4H5NA 3D7EO 4FOEA 5F2RA 4BR9A 3VERA 3ZX2A 2IVNA 3EZWA 5AQLA 1HKCA 2OANA 1HKGA 3J8AA 4H0YB 1LOTB 3BF1A 3LM9A 3LL3A 2QWQA 5F1XA 4FWPA 2YJFA 4A62A 1K8KA 1U2VB 2HF4A 3QMLA 3ATUA 3M1FA 2P9NB 1NLVA 4WYBA 1BA0A 4BREA 1NMDA 1GLAG 3O6WA 3H1QA 3SJHA 3I8BA 3CJ1A 2ZGYA 2KHOA 1HPMA 4DCHA 3DXMA 4I6MA 2QWOA 4CBWA 2Q36A 2QWNA 2E1YA 3WQUA 4QS9A 4LC9B 2YHYA 1ATSA 4IJNA 4QS8A 5AQRA 2YHWA 2FSNA 3EKUA 2GWKA 3G25A 5AFUA 4CZJA 4CZMA 4EFHA 4FWKA 2Q0UA 1ZXOA 5ADXA 4IZ9A 3W0LA 2UYTA 4K25A 2P9KA 4RTFD 2D0OA 4YDUA 2PBDA 1XQSC 2A40A 4CZHA 5KQ8A 4H03B 3U9DA 3SMPA 3H45C 5AQMA 3ZX0A 3UKUB 2P9PB 2VCPA 3MK6A 5FPEA 5TKYA 3LDOA 3WXLA 4CZLA 2P9LB 3DXKA 2NZTA 3BEXA 4CZFA 3VPZA 1HX1A 3O80A 3CJBA 5E26A 3ZX3A 4FPBA 2A41A 2AA4A 4HTLA 4ISEA 2YJEA 3C7NB 4WQ4A 1YAGA 1KAYA 4B1VA 1X3NA 2V51B 3P4IA 2Q97A 1Y64A 1HLUA 3RSEB 1E4FT 4B9QA 1Q18A 3WUHA 5AQNA 3WT0A 2QM1A 4PKHA 2ASOA 5AQHA 3UE5A 4K43A 3WQTA 1DEJA 4JD2B 5F0XA 5JMVA 1ATRA 1BOTO 1H1VA 4BRNA 2HOEA 3LM2A 3CJ7A 1V4TA 4PKGA 5FPMA 4FWSA 5AQJA 1ATNA 3O8MA 4CZGA 1NGCA 2CGLA 3GBTA 4DB3A 3D2EA 2D4WA 1NGFA 1R59O 4H0OA 3DJCA 1NGIA 3U8XA 3UKRA 3VESA 1GLLO 1DGKN 1YVNA 2QW9A 4BVPA 2E2QA 3AAQA 4BC2A 4B1XB 1Z05A 3QICA 1J6ZA 3IMXA 4O5FA 1QQMA 1JCFA 4F9OA 1HUXA 1KXPA 3VF2A 3R8EA 4AM7A 1GLEG 2ASPA 2P9UB 3CERA 3ZETA 2D1KA 5EXWA 2F9TA 5AZIA 2V7ZA 3DWLA 1GLFO 2I7NA 3SK3A 4BRIA 5I9EB 3W3DA 3IUCA 3VF6A 3HI0A 5KPTA 4CBUA 1ZBSA 4JHDA 4BRPA 5JLFA 4MO5A 2ASMA 4RWTA 3FZKA 1HJOA 3AAPA 3U9ZA 4EHTA 1GLJO 3BF3A 4O8KA 5JICA 3ULEB 1MA9B 5FPDA 2WUSA 4C23A 4JN4A 3O5BA 3FLCO 4JNEA 2I7PA 2E2OA 3CI5A 5EOYA 5AR0A 5AQXA 3R9PA 3QB0A 2A6AA 5KQDA 4Y0WA 2Q1NA 5LJWA 4BQZA 4FWRA 5AZJA 2QWRA 3MMVA 5KPRA 3GE1A 3VENA 1K8KB 3FR0A 2BTFA 3A8YA 1HKBA 3FZHA 3VOVA 1IG8A 4FWMA 5BN8A 3ZEUA 2IIRA 1RFQA 2P9IA 4I6MB 3VF4A 2CH5A 4YDUC 2FF6A 4BC4A 3GG4A 3LDNA 1ESVA 3CJCA 5EY4A 2DPNA 4PL7A 4H5WA 1X9JA 3LDQA 3L4IA 1RDWX 3HTVA 4H0XB 3TPQA 2GEMA 1NWKA 3BUZB 3CQXA 4FL9A 1QQOA 4XH1A 4BRLA 4FPAA 3MCPA 3MN6A 3VGLA 3ID8A 1BO5O 4B1ZA 4HWIA 2Q0RA 1DKGD 2A42A 1NBWA 4CZKA 4EIAA 4BROA 1NGHA 3WEEA 2QWLA 4BRQA 1BU6O 2P9SA 3DXKB 3M3ZA 3O1BA 5AQUA 4Z94A 4A2AA 4BR5A 4BR0A 1NGGA 4FWNA 2Q31A 1D4XA 4WQ5A 4BRKA 3EL2A 2NLXA 4BRHA 3IDHA 4CBXA 3ENHA 3QDKA 3HBTA 3VGKA 4H5VA 2YCHA 4ISFA 3VEOA 4FOIA 3MN7A 3WXKA 3CIPA 3O1WA 3IFRA 3QFPA 4BR2A 2GELA 3VGMA 4L3QA 4CZEA 3MN9A 2GTDA 4FSVA 3M6GA 4IWVA 2IVPA 3HM8A 5AQGA 1JCGA 3FFKB 2CH6A 5BRDA 1BDGA 1JCEA 3ENOA 4EHUA 5BRHA 1NGAA 4BRAA 2GUPA 1YUWA 2A3ZA 4M7YA 3TU5A 3D2EB 2E1ZA 3KVGA 5KPZA 5AQPA 5AQVA 5EX5A 5AFUH 3D2FB 1QZ6A 3UKRB 4BRGA 3GDQA 2CGJA 1EQYA 3GL1A 3KZBA 4K42A 2Q2RA 5ADXH 1NGEA 1OKJA 4BQLA 3A0IX 1BUPA 4MLHA 3JS6A 4KBOA 2FF3B 2NRHA 2E8AA 1QQNA 1WUAA 4ISGA 3AY9A 3JXUA 3EKSA 1GLBG 5EVZA 3VETA 1G99A 5AQWA 1TYQA 1NGJA 3ZETB 5AQZA 2FSKA 4J8FA 5BN9A 2V52B 4B1UB 4CI6A 2VYPA 4IXCA 4IJAA 4IO8A 4M63C 4JHDB 4MO4A 1MWKA 3ATVA 1NGDA 1SQKA 4BRDA 3H46O 2YHXA 3R6MA 4FWOA 4H5RA 1KAZA 3FZLA 2HMPA 4BGAA 1U6ZA 4EAHD 5B8HA
chains in the Genus database with same CATH superfamily
4X64K 4BRMA 4DSKA 3AVJA 4CD3A 4BY9C 4CHQA 2X78A 3FZMA 4B1YB 3BP8A 3U4LA 3LP0A 2FBYA 1EX4A 3RMCA 3S3MA 1YXQA 3NVKA 3K5NA 3NF6A 4FO0A 4ILJA 3ZCMA 3J80O 2E4LA 3RMDA 4K8ZA 3NMUA 3U3GA 2UXCK 4QAGA 1T6CA 1VSFA 1U48A 3OYMA 2W40A 3OYNA 3FFIA 4UY8O 2ATQA 3WXJA 2HHXA 3AVCA 4FLTA 2YI1A 4H0TB 3VA0A 3CETA 5AQTA 1L3TA 3O4QA 5EU7A 3TAFA 1C0GA 4H5TA 3H3NO 4JAXA 1KVBA 4GNIA 2D0AA 4FJLA 3T3FA 3DRSA 1S1VA 1RILA 4GY2B 3ASMA 4DS4A 3V9UA 3SMSA 2BGGA 1LAVA 4JKAA 1QZ5A 2QTDA 2GV9A 3OYKA 1RT2A 2EX3A 4CJ4A 2YX6A 1WSIA 1L3VA 2QXLA 4CHPA 3O9RA 2KTQA 3L0QA 3AA4A 3PX4A 3KHYA 2OPPA 2F7TA 1OH5A 4BR4A 4DTPA 1XI1A 3L2RA 4IBNA 1NK5A 4CEAA 2Z1IA 2E2PA 4JD2A 4PHTX 2YNFA 3WXIA 2HHUA 3KLFA 3CCSN 3MN5A 4ZTJA 5AQSA 5M1NA 2WBNA 3FZFA 1W9HA 1S3XA 2PZSA 5JLHA 5DM6L 1XC3A 4EZ9A 3J7ZO 1BHLA 1RDUA 1E3MA 3SV3A 1CLQA 1JL2A 1RTIA 2J4RA 4UQGA 4YFUA 4OJRA 4CJ7A 3A5LC 3O9UA 3B8AX 2F9WA 5AJ3K 3MECA 4O0IA 5I3UA 5BPMA 4C8KA 3QEPA 1BWFO 3P38A 1U4BA 3NGZA 4O44A 3CJ9A 4E19A 1LW2A 4E1JA 4B3SK 1SAZA 4XH4A 4JK7A 3O9SA 4BG8A 4YOWA 1S6QA 1RDCA 3ZSRA 4O0JA 5ELZA 2ZWHA 3H1VX 3S41A 4DV3K 1LWEA 1UA1A 2E2NA 4G1QA 3NF8A 3ULEA 2NNWA 4I2QA 1QVFM 2RE2A 1TUUA 3A5NC 3THYA 4Z4FA 2HNZA 4Z4HA 3KTQA 3D7EO 3SPYA 5FRNA 5FLXO 5M1QA 3VERA 2IVNA 1WBBA 2OANA 5LMUK 1HYVA 3HOSA 3V6DA 1EWRA 4JKGA 2QWQA 1K8KA 1U2VB 2HF4A 3QMLA 3ATUA 4E7IA 4DFJA 4FJNA 4CGIA 3SQ2A 3O6WA 3ZSQA 4DSEA 1BIUA 4U67L 1NG9A 1IV0A 1HPMA 4H8KA 2QWOA 3E66A 2Q36A 2G8UA 2E1YA 3WQUA 4QS9A 2YHYA 1RTJA 5HROA 4QS8A 3B6PA 1SS6A 4CHNA 4CZMA 4CGGA 4GV3A 3SBTA 4LSLA 1RBUA 1QTMA 1ASUA 2XY5A 2UYTA 2HHHK 4K25A 4RTFD 1JLGA 2AJQA 1D9FA 1YIJN 3SMPA 3QEXA 1S72N 1IBLK 1KFSA 2P9PB 2VCPA 5FPEA 4CZLA 4IFEA 2NZTA 3AO4A 3SAFA 4GV6A 2XRIA 1YJWN 1A5XA 4E7JA 3C6TA 3O3GA 4ID1A 1VSHA 4CE9A 2YJEA 3C7NB 4AHSA 4J2AA 4Y1DA 5C24A 1J54A 2YHAA 3AVNA 4I7FA 1HLUA 1GOAA 1S5JA 3RSEB 1E4FT 1VK0A 3VQPA 3THWA 3WUHA 4BE1A 2FC0A 2QM1A 3HRGA 1HNVA 2WONA 1J5EK 3OW2M 4W5QA 2HW3A 1DEJA 1RT7A 5F0XA 5JMVA 1BOTO 3NH1A 4CGHA 4CEOA 1V4TA 5AQJA 5CHIA 4CZGA 3SAHA 1VSJA 1KCFA 1NGIA 3JYTA 1RDAA 3V1QA 1GLLO 1XMOK 3NF9A 4BVPA 4DTOA 4B3OA 3AAQA 3OS1A 3MX5A 4O5FA 3CCRN 3VF2A 3R8EA 2O4IA 3TAEA 1RNHA 3ZETA 3WNHA 4IOXA 3DLKA 3DWLA 4DR1K 2O8DB 3W3DA 4M3YA 5KPTA 4CBUA 3QEIA 1ZBSA 4JHDA 4A5BA 5JLFA 5JVGL 3K9JA 3VQ9A 3FZKA 3RR7A 2E5LK 4CIGA 4O8KA 4J2DA 4ILHA 4B3RK 1MA9B 4B9UA 4C23A 2NRRA 3P83D 4JNEA 2I7PA 1SL0A 5EOYA 3KJVA 4YHHK 5KQDA 2A6AA 1N36K 2OZMA 3LPUA 2QA4N 4Y0WA 3TWHA 4F8RA 2OZSA 2QWRA 1HNZK 4DR6K 3VENA 1ZBUA 1K9MO 3VOVA 3E1YA 4CJSA 4CVNE 4ELVA 5BN8A 4JV5K 4OO1J 1RBRA 1RFQA 5KRTA 4JI7K 4JEPA 4MDAA 3VF4A 3LDNA 3M5RA 3CCEN 4PL7A 4H5WA 1X9JA 3LDQA 3L4IA 3D6RA 3F9KA 5M1FA 3TAQA 1RDWX 3HTVA 4CGDA 3NH0A 1VHXA 3BUZB 4IFYA 4BRLA 3KKRA 1W0HA 1S6PA 4JRPA 5CYMA 1LV5A 3MN6A 3ID8A 1BO5O 2Q0RA 5C15A 4N76A 2KKZA 4CZKA 3E9LA 4EIAA 2UUCK 2QWLA 1KLNA 1TKDA 4CCHA 3SZ2A 5AQUA 4Z94A 3OJSA 4A2AA 4BR0A 2Q31A 1NK6A 4WQ5A 3M8QA 4Y1CA 3A2FA 3EL2A 3K5OA 4PWDA 5CZ1A 1LAWA 3LWMA 1L3SA 4CJKA 4YOUA 3HBTA 3VGKA 1JL1A 3I0SA 2YCHA 4ISFA 4FLWA 4X62K 4JKBA 1UA0A 1M90O 4LH5A 1LWFA 4JKHA 3CD6N 4JRQA 4L3QA 5HRSA 3IKMA 3MN9A 4DTMA 1NJIO 1DTQA 3M6GA 4IWVA 2Z1HA 1GOBA 4LY7A 1U47A 1SUQA 2CH6A 4HHTA 2GUPA 4M7YA 3DMJA 2YHBA 3TU5A 3OY9A 3SNNA 1VQ4N 5J2MA 2CGJA 1T03A 1Q8IA 3VQ6A 5CYQA 2OPQA 3KZBA 4WF9L 2O8EB 4KBOA 3PY8A 2E8AA 1QQNA 3CFPA 1S1XA 4F3TA 3TABA 4ISGA 3AY9A 4RG8A 1J5OA 1GLBG 4ZTFA 4DLEA 2IGIA 1N34K 4E89A 4C8LA 3K5MA 4B1UB 4IXCA 5JS1A 4IO8A 4WE1A 1SL1A 4DSLA 3PX0A 1I94K 4E7KA 1NU0A 2G8KA 4CEBA 4BRDA 3UIQA 3H46O 2YHXA 4DUYK 4HTUA 3R6MA 1BL3A 4B9SA 4FJIA 4HUGA 1NKBA 4GKJK 4DR3K 4CJVA 4FJJA 4MFBA 2NRTA 4W5NA 2QKBA 4DQ8A 2VGNA 5AZJB 3QETA 4DKWA 2Y1IA 4FWLA 1U2VA 3EN9A 3HSCA 4CJLA 3CCMN 3CJAA 3HM9A 3L4QA 3ZEUB 3E01A 2P9IB 2G8FA 4FJHA 2A5XA 3VEXA 4KH5A 2ZGZA 3VQ5A 1LWCA 4KHUA 2VWBA 5BR9A 4Q5VA 4V19S 2ZD1A 2HMIA 1CZAN 4OGCA 3KWIA 3B6OA 4FK4A 1SZ2A 4I9LA 1T6DA 5BPLA 4WQ4C 1GLCG 3MDQA 2G8HA 3VEYA 2E88A 3MAQA 1T7PA 2HHTA 5HLFA 3ZT0A 1BG3A 2VWJA 4EZ6A 4C1NI 4BR7A 4IDKA 1RT3A 3NHGA 2P9PA 3T69A 2KLAA 4DTNA 1JLCA 1TAQA 4ICLA 5CE3A 1CZ9A 1EWQA 3M8RA 4OPJA 1Q7YO 2RPIA 3K58A 3C7NA 3QBXA 3HPGA 4DR4K 4BDYA 4MLEA 4DLGA 4B8CA 3T19A 3RSEA 1KAXA 4B1WB 1QHAA 4FJKA 2W41A 3LP3A 4HVJA 2G8WA 2CGKA 4FWQA 1HRHA 5BRFA 4KFBA 2P1JA 3OS0A 5AQKA 4BGBA 5BPNA 4CF2A 3DLEA 3VQBA 1I3AA 3AV9A 1Z6RA 5SZTA 4FZXC 4DQSA 3V1OA 4GV9A 4H0PA 3K2PA 3O08A 1QE1A 2ZF5O 3CCUN 2D0CA 3CCVN 3SPZA 3LP2A 4GVMA 3AA5X 4AHVA 3D2FA 2R7YA 3EYZA 4CHOA 1HNWK 3CCQN 2ETJA 4F4KA 4LF8K 3VEWA 4BVOA 2YKNA 5FRMA 4JKCA 4E1NA 3DAWA 2DFHA 4JKEA 5LY3A 4Z4IA 1WLJA 3F9MA 4LF4K 2Q3SA 4Q0BA 4RW7A 1TK5A 3LZJA 1CXQA 1OVQA 1IKYA 4K41A 4E3SA 3RR8A 3AARA 3I33A 1TK8A 1RGIA 3CHWA 2PYLA 2XY6A 4FVMA 4CFAA 4FJMA 3KLGA 2Z1JA 3MWTA 3VQDA 2AP1A 3TSPA 1OH8A 2ITMA 4KB0A 4H5NA 4N56A 3THVA 4IEEA 4J2EA 3AVMA 3ZX2A 4NYNA 2X6SA 4NCBA 1P90A 4B08A 4W5RA 2KZMA 4DS5A 1LOTB 3BF1A 3LM9A 4IO9L 1O13A 4FWPA 3CFOA 3M1FA 2P9NB 1NLVA 1BA0A 1N32K 4IOCL 2JWLA 3Q7BA 3H1QA 2O8FA 4NCAA 2F8SA 3I8BA 3CJ1A 4KHSA 1Y97A 4DCHA 3DXMA 3OYEA 4LC9B 1YJ9N 5AQRA 4FJ8A 1YITN 1WSEA 2VQFK 2VGMA 3V1RA 4DSFA 3DLRA 4FWKA 1B92A 2Q0UA 2HNYA 4E0DA 3W0LA 1S9EA 3QESA 3SQ4A 2P9KA 1I39A 4YDUA 4IEIA 3CCLN 3U9DA 1Q86O 3NBPA 3NFAA 4DSIA 5A2QO 3E9OA 3UKUB 2O8BB 1QHTA 3BEXA 2O8CB 3TAGA 1YJNN 4ISEA 3AO3A 4B1VA 4KI6A 2Q97A 1RCHA 5DM7L 4B9QA 1Q18A 3CM6A 5GAEP 3MEDA 3WT0A 1KFDA 1WB9A 1HYZA 5JVHL 2ASOA 3SUOA 1XMQK 1ATRA 3BDPA 4Z0UA 1ZYQA 4BRNA 3CJ7A 2JLEA 4N47A 1G15A 3QEVA 5GIPA 4CHZA 1DGKN 3MCAB 2E2QA 3O3HA 2O8EA 3TR8A 3H08A 4B1XB 5GIOA 4QCLA 3QICA 2YKMA 1JCFA 4F9OA 4YOYA 1IKXA 1KXPA 1GLEG 2ASPA 3OYHA 5J2PA 5AZIA 1JLFA 2HBLA 3VN5A 4A57A 5I9EB 1TVRA 2I7NA 1BIZA 2KQ2A 1QQCA 1SL2A 4FLVA 4AILC 3CFRA 3PV8A 3AGRA 3DOKA 3WXMB 4AH9A 3HP9A 4DQQA 3U9ZA 4FK2A 2VG6A 4CJUA 5JICA 4CK3A 1T3VA 4PUOA 3K57A 1JLAA 3FLCO 3NGYA 3RMAA 5CY4A 1RT1A 3CI5A 4KKOA 3R9PA 2Q1NA 3TI0A 4DR7K 1OH7A 3V9ZA 4FWRA 5AZJA 5KPRA 2XO7A 2OYQA 3A8YA 1HKBA 4CJRA 4RW9A 3EE9A 4CEQA 4FWMA 3ZEUA 2P9IA 4I6MB 2FF6A 3PO4A 4BC4A 3L2UA 1JXBA 1ESVA 3ZSOA 4FCYA 4DSJA 3MEGA 2B5JA 4B9TA 1OVYA 2EHGA 3VQAA 4H0XB 2GEMA 1NWKA 4Z4GA 1L5UA 3ZT2A 5KI6A 4XH1A 2ZJQL 4BWMA 1WSHA 4O5BA 4DMNA 4FW1A 4HWIA 2A42A 1NBWA 4BROA 4KH6A 4A59A 2FBVA 4BRQA 2HVIA 5D3GA 3DXKB 3V9XA 1Z26A 4KTZA 1C0UA 2G8VA 3DOLA 1HNXK 2P51A 4I9QA 4HUEA 4DFPA 3QDKA 4DWIA 4H5VA 4CJTA 3WXKA 1NNEA 4BE2A 3IG1A 3O1WA 3ALYA 1RTHA 2VG5A 2GELA 3VGMA 4CZEA 4NYFA 3DLBA 4B9NA 1BQMA 1W2BM 3HM8A 4FM2A 3K0SA 3FFKB 4MQ3A 4DV2K 1WAJA 5C2FA 1BDGA 5IT9O 3ENOA 4DQPA 1U49A 1LW0A 5CZ2A 2UUAK 2A1SA 4BRAA 3HXMA 3L8BA 2A3ZA 2E1ZA 2YNGA 5KPZA 5AQVA 1Q9XA 5AFUH 3D2FB 3UKRB 4BRGA 3J81O 1FJGK 1WNSA 1BI4B 2Q2RA 5ADXH 1NGEA 1OKJA 2GUIA 3A0IX 1BUPA 4BQLA 3JS6A 4DR2K 4LF7K 1TV6A 3TARA 3JXUA 3EKSA 1NGJA 5HOOA 5AQZA 1YT3A 4N41A 1TKZA 1W7AA 3HPHA 2HSTA 5BN9A 4M45A 4KHPK 1XHXA 1JLBA 4IJAA 1N6QA 4MO4A 2E6LA 3V4IA 3CQ8A 1NK7A 4KREA 5IWAK 4FZYA 3HP6A 4H5RA 1KAZA 3FZLA 5GADP 4CGFA 1J9AA 3TAMA 4EAHD 2HBKA 4B8AB 3QO9A 5B8HA 1YVUA 3I8DA 2FXUA 4FLXA 3M8SA 1S22A 5AQOA 2E20A 3TANA 5HP1A 1F21A 1TK0A 3EY1A 2O8FB 4PL8A 3MXIA 4FVUA 4PKIA 2WOMA 1NGBA 2P9NA 3DXMB 4JI4K 1X1PA 4A61A 5LJVA 3OTOK 4NB4A 3SV4A 3F5TA 1KD1O 2QWPA 5LL6Z 4LF6K 4KHYA 3T1YK 2V7YA 4M3XA 1BA1A 3AVGA 3DLHA 1XUPO 3UB5A 3OYIA 2P9KB 2VQEK 3ZT3A 3ID6A 3L3VA 1NMNA 3PIOL 1T05A 1DLOA 4WQ5C 3NH2A 4DF4A 3KK7A 4YOXA 3P5JA 4CESA 2OPRA 1D9DA 4CF9A 1X9MA 1V4SA 3UKUA 3WEEB 2O8BA 1K6YA 1MDUB 2GWJA 2P9SB 1HQEA 3ZSWA 1J53A 2O8CA 1W97L 1IBKK 5M1OA 4BRFA 3SQ0A 5FROA 5HL7L 5C0YA 3DRPA 2UU9K 3THXB 1EXQA 3SLCA 4JS4A 4DU4A 3VEZA 1HJRA 1P8ZA 2F8TA 3TTFA 4F2RA 3R1XA 4CEFA 1BQNA 4MDBA 4CF0A 1QS4A 1UWBA 4M7XA 4QS7A 4JI0K 3HK2A 1VRUA 1T44A 3NDKA 2HF3A 1NJZA 3O9QA 5FDLA 2W6KA 2BUPA 4XEIA 3QBWA 3TTDA 3WNFA 2HHWA 1RT4A 3O9TA 4BC5A 1VRTA 3P1GA 4DHYA 2QWMA 1VQON 3CC2N 2LSNA 1MWMA 4OPAA 1FKOA 3CQYA 4CECA 1TAUA 3ENBA 4CF8A 3LALA 5AZIB 4O55A 4C8OA 3PSIA 1TYQB 3QERA 5SWMA 1LCUA 3KWGA 3S9HA 4CJEA 1MU2A 4AM6A 4K8XA 2WTUA 2YV0X 4BC3A 3QINA 5FPNA 4G9ZA 5JS2A 1VSKA 1WN7A 3RRGA 4JKDA 3AO5A 1KVAA 1NM1A 3SQ1A 4XH5A 3OBYA 4FK0A 3VQCA 1S1UA 4FM0A 4FOEA 4DTXA 3R3LA 3VTIA 4KH4A 2YNHA 4JS5A 4BR9A 4DR5K 2F96A 4X66K 4AF1A 5AQLA 3ZYYX 4FJGA 1HKCA 3SUQA 4QOZB 5CR4A 4RW4A 3SCXA 4GW6A 2DFEA 1VQ7N 3J8AA 3I56N 3C65A 4JLHA 2NRXA 4JI6K 1Z25A 3LL3A 3DLLL 2NRWA 4A62A 2YJFA 1VQ8N 1Q9YA 1YTUA 4BREA 1NMDA 4CHYA 3AA2A 2P5OA 2ZGYA 3KK3A 2KHOA 2XHBA 4I2PA 4CEDA 4I6MA 4FJXA 4FJ7A 2QI2A 1ATSA 3PX6A 3KIOA 2FBTA 2YHWA 4IG3A 3G0ZA 4FXDA 3CF5L 3G6EN 2HBJA 4KTQA 4EFHA 3JAMO 3AVIA 3T1HK 1ZXOA 3VQEA 2IC3A 1ASWA 1N8RO 2D0OA 4CZHA 1XQSC 2A40A 1IBMK 2JGUA 3EE8A 1ZBFA 1BISA 3MK6A 4HCCA 5TKYA 3LDOA 3ULDA 3WXLA 2P9LB 3DXKA 1BGXT 1Q81O 3LDSA 2IS3A 3O80A 3CJBA 5E26A 4FPBA 4KO0A 3CPWM 2A41A 3E9PA 5I42A 4HTLA 4WQ4A 3L2QA 2V51B 3P4IA 4ID5A 4AHTA 4ILGB 2DTUA 4AHRA 1NKEA 4NLCA 4R5PA 2RN2A 4PKHA 3MXJA 1WSFA 3UE5A 3CMAN 3OYJA 3LAMA 4CW7B 4DF8A 4DV4K 3C95A 3Q7CA 3KLHA 3G71N 3N4QA 2HOEA 3KD5E 3LM2A 4PKGA 4FWSA 4R79A 1ATNA 1NGCA 3GBTA 3CC7N 3QIOA 4DB3A 1ZBIA 3SUPA 3LAKA 4OLAA 1O1WA 1NGFA 3UKRA 4O4GA 1YVNA 2QW9A 4AQYK 1BI4A 4JI5K 3AVHA 4CIFA 4FLYA 4BC2A 4GVEA 3MXMA 2O4GA 3IS9A 1B9DA 4LFBK 3IMXA 4JKFA 2ITGA 3DRRA 4JI2K 2P9UB 1VSEA 1HMVA 4E7LA 4M3UA 4BRIA 3KLIA 3IUCA 4CJ5A 3HI0A 1S9GA 1QSYA 4MO5A 2ASMA 4RWTA 3SUNA 1OH6A 4AHCA 3C94A 1JKHA 3OYLA 4EHTA 5C42A 3BF3A 4LFCK 5HBMA 2IOCA 2KW4A 4C8NA 5HRPA 4N5SA 4E7HA 4OKJA 1VSDA 2RF2A 2E2OA 1N5YA 1L3UA 5AR0A 1VSMA 1SV5A 3ZT4A 1HYSA 5LJWA 4M41A 3MMVA 4PY5A 4J2BA 3GE1A 4B3TK 2QXFA 2QEXN 3FZHA 3C6AA 1IG8A 3SAGA 4IOAL 2HVHA 3P39A 2IIRA 1VQKN 4DTSA 1IKWA 1EETA 4YDUC 2Z1GA 4L8RB 3JSMA 3GG4A 4B9LA 3KD1E 3CJCA 4DUZK 2DPNA 1C6VA 3PUFA 3EEQA 3PIPL 3HVTA 1T8EA 1DT9A 4GKKK 1VQ5N 3TPQA 4FL9A 5MLCQ 3S3OA 3M8PA 2HHVA 4B1ZA 2XY8A 3WEEA 1BU6O 3WNGA 4FJ5A 2P9SA 3K9KA 1NOYA 4CFCA 1NGGA 4FWNA 4F3OA 4DTJA 3LWLA 5KGXA 1TGOA 2PFUA 4WFBL 4BACA 1JXEA 4BRHA 3THXA 3IDHA 4CJQA 1SKWA 3I55N 4B9VA 3HPOA 3ENHA 3AO2A 2PY5A 1FW6A 2HHQA 3VEOA 4C1NK 4FW2A 4RW8A 1TL3A 2IDOA 2IAJA 3CIPA 3IFRA 4Z4CA 4YNQA 3HVRA 4IFVA 1C0MA 4JYAK 2IVPA 2ZM6K 5AQGA 4M3WA 3NGIA 1JCGA 4E1MA 1JCEA 2KZZA 3RWUA 1NGAA 3OYAA 1QVGM 2B4JA 3D2EB 5DK5A 5EX5A 1QZ6A 3VMFB 5HRRA 4K42A 3BZCA 4H4MA 4MLHA 2NRHA 3BY5A 4LF5K 1XWLA 3F73A 3T1AA 1WUAA 3RTVA 4BE0A 5EVZA 1G99A 1TYQA 4NXNK 3CC4N 2FSKA 4J8FA 2V52B 5HRNA 4CI6A 2VYPA 4M63C 3OYCA 1EO1A 1MWKA 1NGDA 4CJWA 4O8UA 3C6HA 1GOCA 5KRSA 4CFBA 3U3YA 2RHKA 1WAFA 4FWOA 1VQ9N 1N33K 2HB5A 3HL8A 1ASVA 4BGAA 4BDZA 2Y1JA 3FE1A 3HZ6A 2DY4A 3QFUA 3H3OB 4KHNA 1WSJA 2OCEA 4B3MK 3TAPA 4KTWA 2PYJA 2OA8A 3L6QA 4WFAL 5AQQA 2HHSA 2JWKA 2EWSA 3AVBA 4BG9A 5AQFA 3AGKA 3A5OC 1NKCA 3LZIA 4FZZA 3RRHA 5KTQA 1NK4A 1EKEA 1WBDA 3NVMA 4OKKA 5DMRA 1E4GT 2ZQBA 4YOTA 3ITHA 4ZHRA 1X3MA 1UOCA 2NRZA 1XNRK 2FSJA 4KHWA 3HYFA 2YNIA 4A2BA 4DQRA 4CIEA 1IJJA 3OYGA 1C0FA 3OYBA 4RCHA 3OYFA 3G4SN 3MEEA 3NCIA 1RTDA 3SJJA 2UXDK 3DI6A 3NAEA 2G8IA 2BDPA 3A5MC 1TUYA 3P31A 2P9LA 3EO3A 3J7AP 1VSLA 1FKPA 1HQUA 3ZSYA 4WFNL 1ZC6A 3FGUA 3VEVA 4WCEL 1KTQA 1C0TA 1IH7A 4JK8A 3OS2A 1QSLA 1XHZA 2QKKA 3U6FA 4KB1A 1JLEA 4LF9K 4NO7A 4LH4A 3TSUA 3LDLA 2X74A 1SKRA 4H0VB 3QNNA 3AA3A 2NUBA 4H4OA 4Z4EA 3MWPA 4PA1A 4CERA 2GX9A 1RT6A 3AVKA 1SKSA 2QK9A 3V81A 1RDDA 5AQIA 5E84A 1KVCA 4DFMA 2H3GX 4JI3K 4OKEA 1WOQA 5H1SQ 2BANA 2ZE2A 2FLOA 3KKSA 2D0PA 3G10A 3O3FA 5C12A 5M1KA 4CFDA 1NK9A 3VQ7A 3BGRA 3WNEA 3QNOA 3OHRA 3QLHA 2DFFA 2PAVA 4HCBA 2F4VK 4ELTA 1BCMA 3H6EA 4CK2A 4M3RA 3ZT1A 2RKIA 4CZIA 3RMBA 1GLDG 3VQ4A 4M3TA 2IVOA 3BZKA 2P9UA 3LDPA 1TKTA 2W6LA 4IDHA 4CEZA 1KRPA 1ILYA 5BREA 3CMEN 3GOIA 4BRCA 3O4WA 4LFAK 3PLAA 3C0BA 1VQNN 3OBWA 4CD1A 3KK2A 5TKWA 3V9WA 4CK1A 5AQYA 3VQ8A 1VQMN 5F2RA 3KK1A 4RW6A 1NOZA 3EZWA 1HKGA 3OJUA 2KFZA 4H0YB 5F1XA 3CPEA 4DG1A 4FLZA 4DU1A 4WYBA 1GLAG 3SJHA 2VG7A 4AHUA 4CBWA 2QWNA 3PO5A 4IG0A 5C2DA 1RDBA 4IJNA 2FSNA 3SBGA 3EKUA 2GWKA 3G25A 5AFUA 2HNDA 4CZJA 1NJYA 1NK0A 2UUBK 1JLQA 5ADXA 4IZ9A 5C25A 3HO1A 4PQUA 3K59A 2PBDA 5KQ8A 4H03B 1YF5L 3CCJN 3T7ZA 3HSTB 1HR0K 3H45C 1K8AO 5AQMA 3ZX0A 1RT5A 3VQQA 3EZ5A 4DQIA 4CEEA 4CZFA 1CXUA 2KFNA 3VPZA 3QEWA 1HX1A 5LMNK 1M1KO 1XNQK 3ZX3A 2AA4A 3IAYA 3K5LA 4CF1A 4EP5A 1YAGA 1KAYA 1X3NA 1B9FA 2E6MA 1IKVA 1TL1A 3DYAA 1Y64A 4LSNA 1U45A 4KAZA 4DTRA 4BWJA 4NLBA 1C1CA 1EP4A 3HOTA 1IO2A 5AQNA 1A5VA 3L3UA 5BR8K 3S3NA 3F2KA 2D0BA 5AQHA 4CJFA 4K43A 3WQTA 4JD2B 4XIUA 1H1VA 3KLEA 4BDPA 2X6NA 2FBXA 1RBSA 3L2WA 5FPMA 1C1BA 2W42A 3ZSZA 3O8MA 2CGLA 4LD0A 3L2VA 5M1PA 3D2EA 4A5AA 2D4WA 4DV0K 4IKFA 3HJFA 1R59O 4H0OA 3DJCA 3U8XA 4W5TA 3V9SA 3VESA 2P5GA 2BE2A 3D45A 4KV8A 4FLUA 3LANA 4DTUA 1KSPA 1FK9A 5GAHP 1VQLN 3AVFA 2OTLN 1Z05A 1J6ZA 1QQMA 1HUXA 2GBZA 3AO1A 4TSXA 4AM7A 3CERA 2D1KA 5EXWA 2F9TA 2UXBK 2V7ZA 1GLFO 2WC9A 3SK3A 3TSQA 4DV5K 5J2NA 3VF6A 1VSIA 1UAXA 5GINA 4BRPA 3TTCA 1KQSM 2NRVA 3AVAA 1HJOA 3AVLA 4DFKA 5GAGP 3AAPA 2A1RA 3LP1A 4C8MA 1QSSA 1GLJO 4KRFA 4U7BA 2XY7A 3ULEB 3OYDA 3NE6A 3THYB 5FPDA 2WUSA 1S1WA 4JN4A 3O5BA 4X65K 3SI6A 1KC8O 3SYZA 3C6UA 4B9MA 5AQXA 3QB0A 1BCOA 3PSFA 3QIPA 4BQZA 5C10A 2B6AA 4CGJA 1X9WA 4JKGB 1NJXA 1K8KB 3FR0A 2BTFA 3CG7A 1YI2N 3MX2A 1ZBHA 4NXMK 2BH1A 4OVLA 4OLBA 3VTHA 1A5WA 3O4NA 1YTAA 1D8YA 2VWKA 1ZBLA 2CH5A 1K73O 4GMJB 4YORA 5EY4A 4NCGA 4CJPA 4FJ9A 3I0RA 5E41A 4JK9A 1VQ6N 3HT3A 4DU3A 3CQXA 1QQOA 1REVA 3ZSXA 1CZBA 1X9SA 1U04A 1KLMA 4OPHA 4FM1A 4FPAA 3MCPA 3VGLA 3NF7A 5K14A 4M3ZA 1DKGD 5T7BA 1NGHA 1R0AA 3M3ZA 3O1BA 4BR5A 1D4XA 4BRKA 4DV6K 2NLXA 1NJWA 4FYDA 3CXCM 4OGEA 1HPZA 4CBXA 2ZJPL 1DTTA 3DM2A 2ZJRL 2OPSA 4CJ3A 4FOIA 3MN7A 1TKXA 1D5AA 3THWB 3CYMA 3QFPA 4BR2A 2GTDA 3J7YP 4FSVA 4OX9K 1NK8A 3ISNC 4K0KK 4HUFA 3DLGA 3OVNA 5KGWA 1XC9A 5BRDA 4M42A 4EHUA 3RVCA 4OPKA 5BRHA 1RBTA 2I5JA 4KHQA 1Q82O 1YUWA 4DV7K 4W5OA 3KVGA 4JI8K 4KPYA 5AQPA 3ZSVA 3D0PA 3GDQA 1EQYA 3GL1A 1ITGA 2D5RA 3VA3A 1FXXA 2FF3B 3LPTA 2OTJN 3N4PA 4EP4A 4ELUA 4F2SA 1VQPN 3VETA 5AQWA 4DV1K 1C1AA 1S1TA 3ZETB 3OA9A 2HBMA 4YOVA 2WFBA 3CM5A 4JI1K 4JHDB 4YY3K 3ATVA 2O8DA 1SQKA 4KI4A 3ZLJA 1JJ2M 3IRXA 1VAZA 1WSGA 1RBVA 5J2QA 2HMPA 1U6ZA 1YHQN 1IG9A 1HNIA 5J1EA
chains in the Genus database with same CATH topology
3FE1A 3HZ6A 4BRMA 4CD3A 2FXUA 3H3OB 3QFUA 5F1XA 1S22A 5AQOA 2E20A 4DQ8A 2VGNA 5AZJB 4DKWA 4BY9C 3L6QA 4FWLA 4PL8A 4WFAL 3FZMA 5AQQA 4PKIA 1U2VA 3BP8A 3EN9A 4B1YB 4FVUA 3U4LA 1NGBA 2JWKA 2P9NA 3DXMB 4A61A 5LJVA 2EWSA 3HSCA 4BG9A 3CCMN 4NB4A 5AQFA 3AGKA 3CJAA 3F5TA 3A5OC 3L4QA 3ZEUB 1YXQA 1KD1O 3NVKA 2QWPA 2P9IB 3NVMA 4FO0A 1E4GT 4ILJA 4YOTA 3NMUA 2A5XA 1T6CA 2V7YA 4KH5A 1X3MA 2NRZA 2ZGZA 3VEXA 2FSJA 2W40A 1BA1A 2VWBA 5BR9A 4UY8O 3WXJA 1XUPO 3UB5A 1CZAN 2YI1A 4A2BA 4H0TB 3CETA 5AQTA 3KWIA 2P9KB 1SZ2A 1C0GA 3ID6A 1T6DA 3PIOL 5BPLA 4H5TA 3H3NO 1IJJA 1GLCG 3MDQA 4JAXA 4WQ4C 4WQ5C 4GNIA 1C0FA 3VEYA 2E88A 3KK7A 4YOXA 4RCHA 4GY2B 1BG3A 4C1NI 4BR7A 3SMSA 3G4SN 1V4SA 3UKUA 3WEEB 2P9PA 3T69A 1MDUB 2GWJA 2KLAA 1TUYA 2P9SB 3A5MC 3P31A 1QZ5A 2P9LA 3EO3A 4JKAA 2QTDA 1W97L 4WFNL 1ZC6A 3FGUA 3VEVA 4WCEL 5M1OA 4JK8A 4BRFA 5CE3A 2YX6A 1Q7YO 5HL7L 5C0YA 3C7NA 3QBXA 2QXLA 3SLCA 4NO7A 3O9RA 4MLEA 3TSUA 3LDLA 3RSEA 3VEZA 4H0VB 1KAXA 3L0QA 4B1WB 3KHYA 1P8ZA 1QHAA 2W41A 2F7TA 3TTFA 3MWPA 4BR4A 2CGKA 4FWQA 2GX9A 3R1XA 5BRFA 4MDBA 5AQIA 5AQKA 4BGBA 5E84A 4M7XA 5BPNA 2E2PA 4JD2A 4QS7A 4PHTX 3WXIA 2H3GX 1WOQA 5H1SQ 3CCSN 3MN5A 1T44A 5AQSA 2HF3A 3O9QA 5M1NA 2WBNA 1Z6RA 2FLOA 2BUPA 4XEIA 3FZFA 3QBWA 3TTDA 2D0PA 4GV9A 4H0PA 3O9TA 1S3XA 4BC5A 5C12A 5M1KA 3DLLL 3O08A 5JLHA 2ZF5O 5DM6L 1XC3A 4DHYA 3J7ZO 3CCUN 3CCVN 3OHRA 1RDUA 2QWMA 1VQON 2PAVA 3CC2N 3D2FA 2J4RA 1MWMA 4OPAA 3CQYA 3ENBA 3H6EA 3CCQN 4CJ7A 4CZIA 1GLDG 5AZIB 3A5LC 3O9UA 3B8AX 3VEWA 2F9WA 2IVOA 4BVOA 1TYQB 4JKCA 2P9UA 3LDPA 4IDHA 3DAWA 1LCUA 4JKEA 3KWGA 5LY3A 3F9MA 1ILYA 5BPMA 5BREA 3CMEN 1BWFO 3P38A 4K41A 3GOIA 4AM6A 3AARA 4BRCA 3I33A 3CJ9A 3O4WA 4BC3A 4E1JA 1SAZA 4XH4A 1RGIA 3CHWA 4JK7A 3PLAA 5FPNA 3C0BA 3O9SA 4BG8A 4YOWA 1VQNN 4G9ZA 5ELZA 2ZWHA 3H1VX 4JKDA 3S41A 3MWTA 1NM1A 2AP1A 3OBWA 3TSPA 2E2NA 4CD1A 4XH5A 2NNWA 3OBYA 5TKWA 2ITMA 2RE2A 1TUUA 3ULEA 3A5NC 1QVFM 5AQYA 4H5NA 3D7EO 4FOEA 1VQMN 3R3LA 3VTIA 5F2RA 4IEEA 4KH4A 4BR9A 5M1QA 3VERA 3ZX2A 4AF1A 2IVNA 3EZWA 5AQLA 3ZYYX 1HKCA 1P90A 1HKGA 2OANA 5CR4A 1VQ7N 3J8AA 4H0YB 3I56N 3HOSA 3C65A 1LOTB 2NRXA 3BF1A 4JKGA 3LM9A 4IO9L 3LL3A 1O13A 2NRWA 2QWQA 2YJFA 4FWPA 1K8KA 3CPEA 4A62A 1U2VB 2HF4A 3QMLA 3ATUA 3M1FA 1VQ8N 2P9NB 1NLVA 4WYBA 1BA0A 4IOCL 2JWLA 1NMDA 1GLAG 3O6WA 3Q7BA 3H1QA 4BREA 3SJHA 3I8BA 3CJ1A 2ZGYA 4U67L 2KHOA 1HPMA 4DCHA 3DXMA 4I6MA 2QWOA 3E66A 4CBWA 2Q36A 2QWNA 2E1YA 3WQUA 4QS9A 2QI2A 4LC9B 5C2DA 2YHYA 1ATSA 4IJNA 1YJ9N 4QS8A 5AQRA 2YHWA 2FSNA 1SS6A 3SBGA 1YITN 3EKUA 2GWKA 3G25A 2VGMA 5AFUA 4CZJA 4CZMA 3CF5L 3G6EN 2HBJA 4EFHA 4FWKA 3SBTA 4GV3A 2Q0UA 1ZXOA 5ADXA 4IZ9A 3W0LA 2UYTA 4K25A 2P9KA 4RTFD 2D0OA 1N8RO 4YDUA 2PBDA 1XQSC 2A40A 4CZHA 5KQ8A 4H03B 4IEIA 3CCLN 3U9DA 1YF5L 1YIJN 3CCJN 3T7ZA 3EE8A 1Q86O 3SMPA 3H45C 1K8AO 5AQMA 1S72N 3ZX0A 3E9OA 3UKUB 2P9PB 2VCPA 3MK6A 5FPEA 5I9EB 5TKYA 3LDOA 3WXLA 4CZLA 4IFEA 2P9LB 3DXKA 2NZTA 3BEXA 1Q81O 4CZFA 3VPZA 3SAFA 1YJWN 4GV6A 1HX1A 3O80A 1M1KO 3CJBA 5E26A 3ZX3A 4FPBA 3CPWM 2A41A 2AA4A 1YJNN 3E9PA 4HTLA 4ISEA 2YJEA 3C7NB 4WQ4A 1YAGA 1KAYA 4B1VA 1X3NA 2V51B 3P4IA 2Q97A 1Y64A 5DM7L 1HLUA 3RSEB 4NLBA 1E4FT 4ILGB 4B9QA 3HOTA 1Q18A 4NLCA 3WUHA 5GAEP 5AQNA 3WT0A 2QM1A 3HRGA 5JVHL 3F2KA 4PKHA 2ASOA 5AQHA 3UE5A 4K43A 3CMAN 3OW2M 3WQTA 1DEJA 4JD2B 5F0XA 5JMVA 1ATRA 1BOTO 1H1VA 3Q7CA 3G71N 4BRNA 3N4QA 2HOEA 3LM2A 3CJ7A 1V4TA 4PKGA 5FPMA 4FWSA 5AQJA 4R79A 5CHIA 1ATNA 3O8MA 4CZGA 1NGCA 2CGLA 3GBTA 3CC7N 4DB3A 5M1PA 3SAHA 3D2EA 4A5AA 2D4WA 1NGFA 1R59O 4H0OA 3DJCA 1NGIA 3U8XA 3UKRA 3VESA 1GLLO 5GIPA 1DGKN 1YVNA 2QW9A 3MCAB 4BVPA 2E2QA 5GAHP 1VQLN 3AAQA 4BC2A 4GVEA 3MX5A 4B1XB 5GIOA 1Z05A 3QICA 2OTLN 1J6ZA 3IMXA 4O5FA 1QQMA 1JCFA 4JKFA 4F9OA 4YOYA 3CCRN 1HUXA 1KXPA 3VF2A 3R8EA 4AM7A 1GLEG 2ASPA 2P9UB 3CERA 3ZETA 2D1KA 4IOXA 5EXWA 2F9TA 2HBLA 5AZIA 2V7ZA 3DWLA 1GLFO 2I7NA 2WC9A 3SK3A 3TSQA 3W3DA 4A57A 3IUCA 3VF6A 4BRIA 3HI0A 5KPTA 4CBUA 1ZBSA 4JHDA 5GINA 4BRPA 4A5BA 3AGRA 4MO5A 3TTCA 5JLFA 2ASMA 4RWTA 2NRVA 5JVGL 3K9JA 1KQSM 3FZKA 3WXMB 1HJOA 5GAGP 3AAPA 3U9ZA 4EHTA 1GLJO 3BF3A 4O8KA 4ILHA 5JICA 4U7BA 1T3VA 3ULEB 1MA9B 5FPDA 2WUSA 4C23A 2NRRA 4JN4A 3O5BA 3FLCO 4JNEA 1KC8O 2I7PA 2E2OA 3CI5A 5EOYA 5AR0A 5AQXA 3R9PA 3QB0A 2A6AA 5KQDA 2QA4N 4Y0WA 2Q1NA 5LJWA 4BQZA 4FWRA 5AZJA 2QWRA 3MMVA 5C10A 5KPRA 4JKGB 3GE1A 3VENA 1K9MO 1K8KB 3FR0A 2BTFA 3A8YA 2QEXN 1HKBA 3FZHA 3C6AA 3E1YA 3VOVA 1YI2N 3MX2A 3EE9A 1IG8A 2BH1A 4FWMA 3SAGA 4IOAL 3P39A 5BN8A 3ZEUA 2IIRA 4OO1J 1VQKN 1RFQA 3VTHA 2P9IA 4JEPA 4I6MB 4MDAA 3VF4A 2CH5A 4YDUC 2FF6A 1K73O 4BC4A 4YORA 3GG4A 3LDNA 3M5RA 1ESVA 3CJCA 5EY4A 2DPNA 3CCEN 4PL7A 3PIPL 4H5WA 1X9JA 4JK9A 1OVYA 3LDQA 1VQ6N 1DT9A 3L4IA 3D6RA 5M1FA 1VQ5N 1RDWX 3HTVA 4H0XB 3TPQA 2GEMA 1NWKA 3BUZB 3CQXA 4FL9A 1QQOA 5MLCQ 4XH1A 2ZJQL 4BRLA 4OPHA 4FPAA 3MCPA 3MN6A 3VGLA 3ID8A 1BO5O 4B1ZA 4HWIA 2Q0RA 1DKGD 5C15A 2KKZA 2A42A 1NBWA 4CZKA 3E9LA 4BROA 4EIAA 4KH6A 1NGHA 3WEEA 4A59A 2QWLA 4BRQA 1BU6O 2P9SA 3K9KA 3DXKB 3M3ZA 3O1BA 5AQUA 4Z94A 4A2AA 4BR5A 4BR0A 1NGGA 4FWNA 2Q31A 1D4XA 4WQ5A 4BRKA 2PFUA 4WFBL 3EL2A 2NLXA 4BRHA 3CXCM 3IDHA 3I55N 4CBXA 3ENHA 2ZJPL 3QDKA 4YOUA 3HBTA 3VGKA 4H5VA 2YCHA 2ZJRL 4ISFA 3VEOA 4C1NK 4FOIA 3MN7A 4JKBA 3WXKA 1M90O 3CIPA 3O1WA 4JKHA 3IFRA 3CD6N 3QFPA 4BR2A 2GELA 3VGMA 4L3QA 4CZEA 3IKMA 3MN9A 1NJIO 2GTDA 4FSVA 3M6GA 4IWVA 1W2BM 2IVPA 3HM8A 5AQGA 1JCGA 3FFKB 2CH6A 5BRDA 5C2FA 1BDGA 1JCEA 3ENOA 3RVCA 4EHUA 5BRHA 1NGAA 4BRAA 2GUPA 1QVGM 1Q82O 1YUWA 2A3ZA 4M7YA 3TU5A 3D2EB 2E1ZA 3KVGA 5KPZA 5AQPA 5AQVA 5EX5A 5AFUH 3D2FB 1QZ6A 3VMFB 3UKRB 4BRGA 3GDQA 1VQ4N 2CGJA 1EQYA 3GL1A 3KZBA 4K42A 2Q2RA 4WF9L 5ADXH 1NGEA 1OKJA 4BQLA 3A0IX 1BUPA 4MLHA 3JS6A 4KBOA 2FF3B 2NRHA 2OTJN 2E8AA 1QQNA 3N4PA 1WUAA 4ISGA 3AY9A 3JXUA 1VQPN 3EKSA 1GLBG 5EVZA 3VETA 1G99A 5AQWA 1TYQA 1NGJA 3ZETB 5HOOA 3CC4N 5AQZA 2HSTA 2FSKA 3OA9A 4J8FA 5BN9A 2HBMA 4YOVA 2V52B 2WFBA 4B1UB 2VYPA 4IXCA 4IJAA 4CI6A 4IO8A 4M63C 4JHDB 1EO1A 4MO4A 1MWKA 3ATVA 1NGDA 1SQKA 4BRDA 4O8UA 3C6HA 3H46O 2YHXA 1JJ2M 1VAZA 3R6MA 2RHKA 4FWOA 1VQ9N 4H5RA 1KAZA 3FZLA 5GADP 2HMPA 4BGAA 1U6ZA 4EAHD 1YHQN 2HBKA 2NRTA 5B8HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FE1 A;  3HZ6 A;  4BRM A;  4CD3 A;  2FXU A;  3H3O B;  3QFU A;  1S22 A;  5AQO A;  2E20 A;  4DQ8 A;  5AZJ B;  3L6Q A;  4FWL A;  4PL8 A;  3FZM A;  5AQQ A;  4PKI A;  1U2V A;  3BP8 A;  3EN9 A;  4B1Y B;  3U4L A;  1NGB A;  2P9N A;  3DXM B;  5LJV A;  4A61 A;  2EWS A;  3HSC A;  4BG9 A;  4NB4 A;  5AQF A;  3CJA A;  3A5O C;  3ZEU B;  1YXQ A;  2QWP A;  2P9I B;  4FO0 A;  1E4G T;  2A5X A;  1T6C A;  2V7Y A;  3VEX A;  1X3M A;  2ZGZ A;  2FSJ A;  2W40 A;  1BA1 A;  2VWB A;  5BR9 A;  3WXJ A;  1XUP O;  3UB5 A;  1CZA N;  2YI1 A;  4A2B A;  4H0T B;  3CET A;  5AQT A;  2P9K B;  1SZ2 A;  1C0G A;  1T6D A;  5BPL A;  4H5T A;  3H3N O;  1IJJ A;  1GLC G;  3MDQ A;  4JAX A;  4WQ4 C;  4WQ5 C;  4GNI A;  1C0F A;  3VEY A;  2E88 A;  4RCH A;  4GY2 B;  1BG3 A;  4BR7 A;  3SMS A;  1V4S A;  3UKU A;  3WEE B;  2P9P A;  1MDU B;  2GWJ A;  2P9S B;  1TUY A;  3A5M C;  1QZ5 A;  2P9L A;  3EO3 A;  1ZC6 A;  3FGU A;  3VEV A;  5CE3 A;  4BRF A;  3C7N A;  3QBX A;  2QXL A;  3SLC A;  4NO7 A;  4MLE A;  3LDL A;  3RSE A;  3VEZ A;  4H0V B;  1KAX A;  3L0Q A;  4B1W B;  3KHY A;  1P8Z A;  1QHA A;  2W41 A;  4BR4 A;  2CGK A;  4FWQ A;  5BRF A;  5AQI A;  5AQK A;  4BGB A;  5E84 A;  4M7X A;  5BPN A;  2E2P A;  4JD2 A;  4QS7 A;  3WXI A;  2H3G X;  1WOQ A;  3MN5 A;  1T44 A;  5AQS A;  2HF3 A;  1Z6R A;  2FLO A;  2BUP A;  4XEI A;  3FZF A;  3QBW A;  2D0P A;  4H0P A;  1S3X A;  4BC5 A;  3O08 A;  5JLH A;  2ZF5 O;  1XC3 A;  4DHY A;  3OHR A;  2QWM A;  2PAV A;  3D2F A;  2J4R A;  1MWM A;  3CQY A;  3H6E A;  4CJ7 A;  4CZI A;  1GLD G;  5AZI B;  3A5L C;  3B8A X;  3VEW A;  2F9W A;  2IVO A;  4BVO A;  1TYQ B;  2P9U A;  3LDP A;  3DAW A;  1LCU A;  5LY3 A;  3F9M A;  5BPM A;  5BRE A;  1BWF O;  4K41 A;  4AM6 A;  3GOI A;  3AAR A;  4BRC A;  3I33 A;  3CJ9 A;  3O4W A;  4BC3 A;  4E1J A;  1SAZ A;  4XH4 A;  1RGI A;  3CHW A;  5FPN A;  3C0B A;  4BG8 A;  5ELZ A;  2ZWH A;  3H1V X;  3S41 A;  1NM1 A;  2AP1 A;  4CD1 A;  2E2N A;  4XH5 A;  2ITM A;  3ULE A;  1TUU A;  3A5N C;  5AQY A;  4H5N A;  3D7E O;  4FOE A;  5F2R A;  4BR9 A;  3VER A;  3ZX2 A;  2IVN A;  3EZW A;  5AQL A;  1HKC A;  2OAN A;  1HKG A;  3J8A A;  4H0Y B;  1LOT B;  3BF1 A;  3LM9 A;  3LL3 A;  2QWQ A;  5F1X A;  4FWP A;  2YJF A;  4A62 A;  1K8K A;  1U2V B;  2HF4 A;  3QML A;  3ATU A;  3M1F A;  2P9N B;  1NLV A;  4WYB A;  1BA0 A;  4BRE A;  1NMD A;  1GLA G;  3O6W A;  3H1Q A;  3SJH A;  3I8B A;  3CJ1 A;  2ZGY A;  2KHO A;  1HPM A;  4DCH A;  3DXM A;  4I6M A;  2QWO A;  4CBW A;  2Q36 A;  2QWN A;  2E1Y A;  3WQU A;  4QS9 A;  4LC9 B;  2YHY A;  1ATS A;  4IJN A;  4QS8 A;  5AQR A;  2YHW A;  2FSN A;  3EKU A;  2GWK A;  3G25 A;  5AFU A;  4CZJ A;  4CZM A;  4EFH A;  4FWK A;  2Q0U A;  1ZXO A;  5ADX A;  4IZ9 A;  3W0L A;  2UYT A;  4K25 A;  2P9K A;  4RTF D;  2D0O A;  4YDU A;  2PBD A;  1XQS C;  2A40 A;  4CZH A;  5KQ8 A;  4H03 B;  3U9D A;  3SMP A;  3H45 C;  5AQM A;  3ZX0 A;  3UKU B;  2P9P B;  2VCP A;  3MK6 A;  5FPE A;  5TKY A;  3LDO A;  3WXL A;  4CZL A;  2P9L B;  3DXK A;  2NZT A;  3BEX A;  4CZF A;  3VPZ A;  1HX1 A;  3O80 A;  3CJB A;  5E26 A;  3ZX3 A;  4FPB A;  2A41 A;  2AA4 A;  4HTL A;  4ISE A;  2YJE A;  3C7N B;  4WQ4 A;  1YAG A;  1KAY A;  4B1V A;  1X3N A;  2V51 B;  3P4I A;  2Q97 A;  1Y64 A;  1HLU A;  3RSE B;  1E4F T;  4B9Q A;  1Q18 A;  3WUH A;  5AQN A;  3WT0 A;  2QM1 A;  4PKH A;  2ASO A;  5AQH A;  3UE5 A;  4K43 A;  3WQT A;  1DEJ A;  4JD2 B;  5F0X A;  5JMV A;  1ATR A;  1BOT O;  1H1V A;  4BRN A;  2HOE A;  3LM2 A;  3CJ7 A;  1V4T A;  4PKG A;  5FPM A;  4FWS A;  5AQJ A;  1ATN A;  3O8M A;  4CZG A;  1NGC A;  2CGL A;  3GBT A;  4DB3 A;  3D2E A;  2D4W A;  1NGF A;  1R59 O;  4H0O A;  3DJC A;  1NGI A;  3U8X A;  3UKR A;  3VES A;  1GLL O;  1DGK N;  1YVN A;  2QW9 A;  4BVP A;  2E2Q A;  3AAQ A;  4BC2 A;  4B1X B;  1Z05 A;  3QIC A;  1J6Z A;  3IMX A;  4O5F A;  1QQM A;  1JCF A;  4F9O A;  1HUX A;  1KXP A;  3VF2 A;  3R8E A;  4AM7 A;  1GLE G;  2ASP A;  2P9U B;  3CER A;  3ZET A;  2D1K A;  5EXW A;  2F9T A;  5AZI A;  2V7Z A;  3DWL A;  1GLF O;  2I7N A;  3SK3 A;  4BRI A;  5I9E B;  3W3D A;  3IUC A;  3VF6 A;  3HI0 A;  5KPT A;  4CBU A;  1ZBS A;  4JHD A;  4BRP A;  5JLF A;  4MO5 A;  2ASM A;  4RWT A;  3FZK A;  1HJO A;  3AAP A;  3U9Z A;  4EHT A;  1GLJ O;  3BF3 A;  4O8K A;  5JIC A;  3ULE B;  1MA9 B;  5FPD A;  2WUS A;  4C23 A;  4JN4 A;  3O5B A;  3FLC O;  4JNE A;  2I7P A;  2E2O A;  3CI5 A;  5EOY A;  5AR0 A;  5AQX A;  3R9P A;  3QB0 A;  2A6A A;  5KQD A;  4Y0W A;  2Q1N A;  5LJW A;  4BQZ A;  4FWR A;  5AZJ A;  2QWR A;  3MMV A;  5KPR A;  3GE1 A;  3VEN A;  1K8K B;  3FR0 A;  2BTF A;  3A8Y A;  1HKB A;  3FZH A;  3VOV A;  1IG8 A;  4FWM A;  5BN8 A;  3ZEU A;  2IIR A;  1RFQ A;  2P9I A;  4I6M B;  3VF4 A;  2CH5 A;  4YDU C;  2FF6 A;  4BC4 A;  3GG4 A;  3LDN A;  1ESV A;  3CJC A;  5EY4 A;  2DPN A;  4PL7 A;  4H5W A;  1X9J A;  3LDQ A;  3L4I A;  1RDW X;  3HTV A;  4H0X B;  3TPQ A;  2GEM A;  1NWK A;  3BUZ B;  3CQX A;  4FL9 A;  1QQO A;  4XH1 A;  4BRL A;  4FPA A;  3MCP A;  3MN6 A;  3VGL A;  3ID8 A;  1BO5 O;  4B1Z A;  4HWI A;  2Q0R A;  1DKG D;  2A42 A;  1NBW A;  4CZK A;  4EIA A;  4BRO A;  1NGH A;  3WEE A;  2QWL A;  4BRQ A;  1BU6 O;  2P9S A;  3DXK B;  3M3Z A;  3O1B A;  5AQU A;  4Z94 A;  4A2A A;  4BR5 A;  4BR0 A;  1NGG A;  4FWN A;  2Q31 A;  1D4X A;  4WQ5 A;  4BRK A;  3EL2 A;  2NLX A;  4BRH A;  3IDH A;  4CBX A;  3ENH A;  3QDK A;  3HBT A;  3VGK A;  4H5V A;  2YCH A;  4ISF A;  3VEO A;  4FOI A;  3MN7 A;  3WXK A;  3CIP A;  3O1W A;  3IFR A;  3QFP A;  4BR2 A;  2GEL A;  3VGM A;  4L3Q A;  4CZE A;  3MN9 A;  2GTD A;  4FSV A;  3M6G A;  4IWV A;  2IVP A;  3HM8 A;  5AQG A;  1JCG A;  3FFK B;  2CH6 A;  5BRD A;  1BDG A;  1JCE A;  3ENO A;  4EHU A;  5BRH A;  1NGA A;  4BRA A;  2GUP A;  1YUW A;  2A3Z A;  4M7Y A;  3TU5 A;  3D2E B;  2E1Z A;  3KVG A;  5KPZ A;  5AQP A;  5AQV A;  5EX5 A;  5AFU H;  3D2F B;  1QZ6 A;  3UKR B;  4BRG A;  3GDQ A;  2CGJ A;  1EQY A;  3GL1 A;  3KZB A;  4K42 A;  2Q2R A;  5ADX H;  1NGE A;  1OKJ A;  4BQL A;  3A0I X;  1BUP A;  4MLH A;  3JS6 A;  4KBO A;  2FF3 B;  2NRH A;  2E8A A;  1QQN A;  1WUA A;  4ISG A;  3AY9 A;  3JXU A;  3EKS A;  1GLB G;  5EVZ A;  3VET A;  1G99 A;  5AQW A;  1TYQ A;  1NGJ A;  3ZET B;  5AQZ A;  2FSK A;  4J8F A;  5BN9 A;  2V52 B;  4B1U B;  4CI6 A;  2VYP A;  4IXC A;  4IJA A;  4IO8 A;  4M63 C;  4JHD B;  4MO4 A;  1MWK A;  3ATV A;  1NGD A;  1SQK A;  4BRD A;  3H46 O;  2YHX A;  3R6M A;  4FWO A;  4H5R A;  1KAZ A;  3FZL A;  2HMP A;  4BGA A;  1U6Z A;  4EAH D;  5B8H A; 
#chains in the Genus database with same CATH topology
 4X64 K;  4BRM A;  4DSK A;  3AVJ A;  4CD3 A;  4BY9 C;  4CHQ A;  2X78 A;  3FZM A;  4B1Y B;  3BP8 A;  3U4L A;  3LP0 A;  2FBY A;  1EX4 A;  3RMC A;  3S3M A;  1YXQ A;  3NVK A;  3K5N A;  3NF6 A;  4FO0 A;  4ILJ A;  3ZCM A;  3J80 O;  2E4L A;  3RMD A;  4K8Z A;  3NMU A;  3U3G A;  2UXC K;  4QAG A;  1T6C A;  1VSF A;  1U48 A;  3OYM A;  2W40 A;  3OYN A;  3FFI A;  4UY8 O;  2ATQ A;  3WXJ A;  2HHX A;  3AVC A;  4FLT A;  2YI1 A;  4H0T B;  3VA0 A;  3CET A;  5AQT A;  1L3T A;  3O4Q A;  5EU7 A;  3TAF A;  1C0G A;  4H5T A;  3H3N O;  4JAX A;  1KVB A;  4GNI A;  2D0A A;  4FJL A;  3T3F A;  3DRS A;  1S1V A;  1RIL A;  4GY2 B;  3ASM A;  4DS4 A;  3V9U A;  3SMS A;  2BGG A;  1LAV A;  4JKA A;  1QZ5 A;  2QTD A;  2GV9 A;  3OYK A;  1RT2 A;  2EX3 A;  4CJ4 A;  2YX6 A;  1WSI A;  1L3V A;  2QXL A;  4CHP A;  3O9R A;  2KTQ A;  3L0Q A;  3AA4 A;  3PX4 A;  3KHY A;  2OPP A;  2F7T A;  1OH5 A;  4BR4 A;  4DTP A;  1XI1 A;  3L2R A;  4IBN A;  1NK5 A;  4CEA A;  2Z1I A;  2E2P A;  4JD2 A;  4PHT X;  2YNF A;  3WXI A;  2HHU A;  3KLF A;  3CCS N;  3MN5 A;  4ZTJ A;  5AQS A;  5M1N A;  2WBN A;  3FZF A;  1W9H A;  1S3X A;  2PZS A;  5JLH A;  5DM6 L;  1XC3 A;  4EZ9 A;  3J7Z O;  1BHL A;  1RDU A;  1E3M A;  3SV3 A;  1CLQ A;  1JL2 A;  1RTI A;  2J4R A;  4UQG A;  4YFU A;  4OJR A;  4CJ7 A;  3A5L C;  3O9U A;  3B8A X;  2F9W A;  5AJ3 K;  3MEC A;  4O0I A;  5I3U A;  5BPM A;  4C8K A;  3QEP A;  1BWF O;  3P38 A;  1U4B A;  3NGZ A;  4O44 A;  3CJ9 A;  4E19 A;  1LW2 A;  4E1J A;  4B3S K;  1SAZ A;  4XH4 A;  4JK7 A;  3O9S A;  4BG8 A;  4YOW A;  1S6Q A;  1RDC A;  3ZSR A;  4O0J A;  5ELZ A;  2ZWH A;  3H1V X;  3S41 A;  4DV3 K;  1LWE A;  1UA1 A;  2E2N A;  4G1Q A;  3NF8 A;  3ULE A;  2NNW A;  4I2Q A;  1QVF M;  2RE2 A;  1TUU A;  3A5N C;  3THY A;  4Z4F A;  2HNZ A;  4Z4H A;  3KTQ A;  3D7E O;  3SPY A;  5FRN A;  5FLX O;  5M1Q A;  3VER A;  2IVN A;  1WBB A;  2OAN A;  5LMU K;  1HYV A;  3HOS A;  3V6D A;  1EWR A;  4JKG A;  2QWQ A;  1K8K A;  1U2V B;  2HF4 A;  3QML A;  3ATU A;  4E7I A;  4DFJ A;  4FJN A;  4CGI A;  3SQ2 A;  3O6W A;  3ZSQ A;  4DSE A;  1BIU A;  4U67 L;  1NG9 A;  1IV0 A;  1HPM A;  4H8K A;  2QWO A;  3E66 A;  2Q36 A;  2G8U A;  2E1Y A;  3WQU A;  4QS9 A;  2YHY A;  1RTJ A;  5HRO A;  4QS8 A;  3B6P A;  1SS6 A;  4CHN A;  4CZM A;  4CGG A;  4GV3 A;  3SBT A;  4LSL A;  1RBU A;  1QTM A;  1ASU A;  2XY5 A;  2UYT A;  2HHH K;  4K25 A;  4RTF D;  1JLG A;  2AJQ A;  1D9F A;  1YIJ N;  3SMP A;  3QEX A;  1S72 N;  1IBL K;  1KFS A;  2P9P B;  2VCP A;  5FPE A;  4CZL A;  4IFE A;  2NZT A;  3AO4 A;  3SAF A;  4GV6 A;  2XRI A;  1YJW N;  1A5X A;  4E7J A;  3C6T A;  3O3G A;  4ID1 A;  1VSH A;  4CE9 A;  2YJE A;  3C7N B;  4AHS A;  4J2A A;  4Y1D A;  5C24 A;  1J54 A;  2YHA A;  3AVN A;  4I7F A;  1HLU A;  1GOA A;  1S5J A;  3RSE B;  1E4F T;  1VK0 A;  3VQP A;  3THW A;  3WUH A;  4BE1 A;  2FC0 A;  2QM1 A;  3HRG A;  1HNV A;  2WON A;  1J5E K;  3OW2 M;  4W5Q A;  2HW3 A;  1DEJ A;  1RT7 A;  5F0X A;  5JMV A;  1BOT O;  3NH1 A;  4CGH A;  4CEO A;  1V4T A;  5AQJ A;  5CHI A;  4CZG A;  3SAH A;  1VSJ A;  1KCF A;  1NGI A;  3JYT A;  1RDA A;  3V1Q A;  1GLL O;  1XMO K;  3NF9 A;  4BVP A;  4DTO A;  4B3O A;  3AAQ A;  3OS1 A;  3MX5 A;  4O5F A;  3CCR N;  3VF2 A;  3R8E A;  2O4I A;  3TAE A;  1RNH A;  3ZET A;  3WNH A;  4IOX A;  3DLK A;  3DWL A;  4DR1 K;  2O8D B;  3W3D A;  4M3Y A;  5KPT A;  4CBU A;  3QEI A;  1ZBS A;  4JHD A;  4A5B A;  5JLF A;  5JVG L;  3K9J A;  3VQ9 A;  3FZK A;  3RR7 A;  2E5L K;  4CIG A;  4O8K A;  4J2D A;  4ILH A;  4B3R K;  1MA9 B;  4B9U A;  4C23 A;  2NRR A;  3P83 D;  4JNE A;  2I7P A;  1SL0 A;  5EOY A;  3KJV A;  4YHH K;  5KQD A;  2A6A A;  1N36 K;  2OZM A;  3LPU A;  2QA4 N;  4Y0W A;  3TWH A;  4F8R A;  2OZS A;  2QWR A;  1HNZ K;  4DR6 K;  3VEN A;  1ZBU A;  1K9M O;  3VOV A;  3E1Y A;  4CJS A;  4CVN E;  4ELV A;  5BN8 A;  4JV5 K;  4OO1 J;  1RBR A;  1RFQ A;  5KRT A;  4JI7 K;  4JEP A;  4MDA A;  3VF4 A;  3LDN A;  3M5R A;  3CCE N;  4PL7 A;  4H5W A;  1X9J A;  3LDQ A;  3L4I A;  3D6R A;  3F9K A;  5M1F A;  3TAQ A;  1RDW X;  3HTV A;  4CGD A;  3NH0 A;  1VHX A;  3BUZ B;  4IFY A;  4BRL A;  3KKR A;  1W0H A;  1S6P A;  4JRP A;  5CYM A;  1LV5 A;  3MN6 A;  3ID8 A;  1BO5 O;  2Q0R A;  5C15 A;  4N76 A;  2KKZ A;  4CZK A;  3E9L A;  4EIA A;  2UUC K;  2QWL A;  1KLN A;  1TKD A;  4CCH A;  3SZ2 A;  5AQU A;  4Z94 A;  3OJS A;  4A2A A;  4BR0 A;  2Q31 A;  1NK6 A;  4WQ5 A;  3M8Q A;  4Y1C A;  3A2F A;  3EL2 A;  3K5O A;  4PWD A;  5CZ1 A;  1LAW A;  3LWM A;  1L3S A;  4CJK A;  4YOU A;  3HBT A;  3VGK A;  1JL1 A;  3I0S A;  2YCH A;  4ISF A;  4FLW A;  4X62 K;  4JKB A;  1UA0 A;  1M90 O;  4LH5 A;  1LWF A;  4JKH A;  3CD6 N;  4JRQ A;  4L3Q A;  5HRS A;  3IKM A;  3MN9 A;  4DTM A;  1NJI O;  1DTQ A;  3M6G A;  4IWV A;  2Z1H A;  1GOB A;  4LY7 A;  1U47 A;  1SUQ A;  2CH6 A;  4HHT A;  2GUP A;  4M7Y A;  3DMJ A;  2YHB A;  3TU5 A;  3OY9 A;  3SNN A;  1VQ4 N;  5J2M A;  2CGJ A;  1T03 A;  1Q8I A;  3VQ6 A;  5CYQ A;  2OPQ A;  3KZB A;  4WF9 L;  2O8E B;  4KBO A;  3PY8 A;  2E8A A;  1QQN A;  3CFP A;  1S1X A;  4F3T A;  3TAB A;  4ISG A;  3AY9 A;  4RG8 A;  1J5O A;  1GLB G;  4ZTF A;  4DLE A;  2IGI A;  1N34 K;  4E89 A;  4C8L A;  3K5M A;  4B1U B;  4IXC A;  5JS1 A;  4IO8 A;  4WE1 A;  1SL1 A;  4DSL A;  3PX0 A;  1I94 K;  4E7K A;  1NU0 A;  2G8K A;  4CEB A;  4BRD A;  3UIQ A;  3H46 O;  2YHX A;  4DUY K;  4HTU A;  3R6M A;  1BL3 A;  4B9S A;  4FJI A;  4HUG A;  1NKB A;  4GKJ K;  4DR3 K;  4CJV A;  4FJJ A;  4MFB A;  2NRT A;  4W5N A;  2QKB A;  4DQ8 A;  2VGN A;  5AZJ B;  3QET A;  4DKW A;  2Y1I A;  4FWL A;  1U2V A;  3EN9 A;  3HSC A;  4CJL A;  3CCM N;  3CJA A;  3HM9 A;  3L4Q A;  3ZEU B;  3E01 A;  2P9I B;  2G8F A;  4FJH A;  2A5X A;  3VEX A;  4KH5 A;  2ZGZ A;  3VQ5 A;  1LWC A;  4KHU A;  2VWB A;  5BR9 A;  4Q5V A;  4V19 S;  2ZD1 A;  2HMI A;  1CZA N;  4OGC A;  3KWI A;  3B6O A;  4FK4 A;  1SZ2 A;  4I9L A;  1T6D A;  5BPL A;  4WQ4 C;  1GLC G;  3MDQ A;  2G8H A;  3VEY A;  2E88 A;  3MAQ A;  1T7P A;  2HHT A;  5HLF A;  3ZT0 A;  1BG3 A;  2VWJ A;  4EZ6 A;  4C1N I;  4BR7 A;  4IDK A;  1RT3 A;  3NHG A;  2P9P A;  3T69 A;  2KLA A;  4DTN A;  1JLC A;  1TAQ A;  4ICL A;  5CE3 A;  1CZ9 A;  1EWQ A;  3M8R A;  4OPJ A;  1Q7Y O;  2RPI A;  3K58 A;  3C7N A;  3QBX A;  3HPG A;  4DR4 K;  4BDY A;  4MLE A;  4DLG A;  4B8C A;  3T19 A;  3RSE A;  1KAX A;  4B1W B;  1QHA A;  4FJK A;  2W41 A;  3LP3 A;  4HVJ A;  2G8W A;  2CGK A;  4FWQ A;  1HRH A;  5BRF A;  4KFB A;  2P1J A;  3OS0 A;  5AQK A;  4BGB A;  5BPN A;  4CF2 A;  3DLE A;  3VQB A;  1I3A A;  3AV9 A;  1Z6R A;  5SZT A;  4FZX C;  4DQS A;  3V1O A;  4GV9 A;  4H0P A;  3K2P A;  3O08 A;  1QE1 A;  2ZF5 O;  3CCU N;  2D0C A;  3CCV N;  3SPZ A;  3LP2 A;  4GVM A;  3AA5 X;  4AHV A;  3D2F A;  2R7Y A;  3EYZ A;  4CHO A;  1HNW K;  3CCQ N;  2ETJ A;  4F4K A;  4LF8 K;  3VEW A;  4BVO A;  2YKN A;  5FRM A;  4JKC A;  4E1N A;  3DAW A;  2DFH A;  4JKE A;  5LY3 A;  4Z4I A;  1WLJ A;  3F9M A;  4LF4 K;  2Q3S A;  4Q0B A;  4RW7 A;  1TK5 A;  3LZJ A;  1CXQ A;  1OVQ A;  1IKY A;  4K41 A;  4E3S A;  3RR8 A;  3AAR A;  3I33 A;  1TK8 A;  1RGI A;  3CHW A;  2PYL A;  2XY6 A;  4FVM A;  4CFA A;  4FJM A;  3KLG A;  2Z1J A;  3MWT A;  3VQD A;  2AP1 A;  3TSP A;  1OH8 A;  2ITM A;  4KB0 A;  4H5N A;  4N56 A;  3THV A;  4IEE A;  4J2E A;  3AVM A;  3ZX2 A;  4NYN A;  2X6S A;  4NCB A;  1P90 A;  4B08 A;  4W5R A;  2KZM A;  4DS5 A;  1LOT B;  3BF1 A;  3LM9 A;  4IO9 L;  1O13 A;  4FWP A;  3CFO A;  3M1F A;  2P9N B;  1NLV A;  1BA0 A;  1N32 K;  4IOC L;  2JWL A;  3Q7B A;  3H1Q A;  2O8F A;  4NCA A;  2F8S A;  3I8B A;  3CJ1 A;  4KHS A;  1Y97 A;  4DCH A;  3DXM A;  3OYE A;  4LC9 B;  1YJ9 N;  5AQR A;  4FJ8 A;  1YIT N;  1WSE A;  2VQF K;  2VGM A;  3V1R A;  4DSF A;  3DLR A;  4FWK A;  1B92 A;  2Q0U A;  2HNY A;  4E0D A;  3W0L A;  1S9E A;  3QES A;  3SQ4 A;  2P9K A;  1I39 A;  4YDU A;  4IEI A;  3CCL N;  3U9D A;  1Q86 O;  3NBP A;  3NFA A;  4DSI A;  5A2Q O;  3E9O A;  3UKU B;  2O8B B;  1QHT A;  3BEX A;  2O8C B;  3TAG A;  1YJN N;  4ISE A;  3AO3 A;  4B1V A;  4KI6 A;  2Q97 A;  1RCH A;  5DM7 L;  4B9Q A;  1Q18 A;  3CM6 A;  5GAE P;  3MED A;  3WT0 A;  1KFD A;  1WB9 A;  1HYZ A;  5JVH L;  2ASO A;  3SUO A;  1XMQ K;  1ATR A;  3BDP A;  4Z0U A;  1ZYQ A;  4BRN A;  3CJ7 A;  2JLE A;  4N47 A;  1G15 A;  3QEV A;  5GIP A;  4CHZ A;  1DGK N;  3MCA B;  2E2Q A;  3O3H A;  2O8E A;  3TR8 A;  3H08 A;  4B1X B;  5GIO A;  4QCL A;  3QIC A;  2YKM A;  1JCF A;  4F9O A;  4YOY A;  1IKX A;  1KXP A;  1GLE G;  2ASP A;  3OYH A;  5J2P A;  5AZI A;  1JLF A;  2HBL A;  3VN5 A;  4A57 A;  5I9E B;  1TVR A;  2I7N A;  1BIZ A;  2KQ2 A;  1QQC A;  1SL2 A;  4FLV A;  4AIL C;  3CFR A;  3PV8 A;  3AGR A;  3DOK A;  3WXM B;  4AH9 A;  3HP9 A;  4DQQ A;  3U9Z A;  4FK2 A;  2VG6 A;  4CJU A;  5JIC A;  4CK3 A;  1T3V A;  4PUO A;  3K57 A;  1JLA A;  3FLC O;  3NGY A;  3RMA A;  5CY4 A;  1RT1 A;  3CI5 A;  4KKO A;  3R9P A;  2Q1N A;  3TI0 A;  4DR7 K;  1OH7 A;  3V9Z A;  4FWR A;  5AZJ A;  5KPR A;  2XO7 A;  2OYQ A;  3A8Y A;  1HKB A;  4CJR A;  4RW9 A;  3EE9 A;  4CEQ A;  4FWM A;  3ZEU A;  2P9I A;  4I6M B;  2FF6 A;  3PO4 A;  4BC4 A;  3L2U A;  1JXB A;  1ESV A;  3ZSO A;  4FCY A;  4DSJ A;  3MEG A;  2B5J A;  4B9T A;  1OVY A;  2EHG A;  3VQA A;  4H0X B;  2GEM A;  1NWK A;  4Z4G A;  1L5U A;  3ZT2 A;  5KI6 A;  4XH1 A;  2ZJQ L;  4BWM A;  1WSH A;  4O5B A;  4DMN A;  4FW1 A;  4HWI A;  2A42 A;  1NBW A;  4BRO A;  4KH6 A;  4A59 A;  2FBV A;  4BRQ A;  2HVI A;  5D3G A;  3DXK B;  3V9X A;  1Z26 A;  4KTZ A;  1C0U A;  2G8V A;  3DOL A;  1HNX K;  2P51 A;  4I9Q A;  4HUE A;  4DFP A;  3QDK A;  4DWI A;  4H5V A;  4CJT A;  3WXK A;  1NNE A;  4BE2 A;  3IG1 A;  3O1W A;  3ALY A;  1RTH A;  2VG5 A;  2GEL A;  3VGM A;  4CZE A;  4NYF A;  3DLB A;  4B9N A;  1BQM A;  1W2B M;  3HM8 A;  4FM2 A;  3K0S A;  3FFK B;  4MQ3 A;  4DV2 K;  1WAJ A;  5C2F A;  1BDG A;  5IT9 O;  3ENO A;  4DQP A;  1U49 A;  1LW0 A;  5CZ2 A;  2UUA K;  2A1S A;  4BRA A;  3HXM A;  3L8B A;  2A3Z A;  2E1Z A;  2YNG A;  5KPZ A;  5AQV A;  1Q9X A;  5AFU H;  3D2F B;  3UKR B;  4BRG A;  3J81 O;  1FJG K;  1WNS A;  1BI4 B;  2Q2R A;  5ADX H;  1NGE A;  1OKJ A;  2GUI A;  3A0I X;  1BUP A;  4BQL A;  3JS6 A;  4DR2 K;  4LF7 K;  1TV6 A;  3TAR A;  3JXU A;  3EKS A;  1NGJ A;  5HOO A;  5AQZ A;  1YT3 A;  4N41 A;  1TKZ A;  1W7A A;  3HPH A;  2HST A;  5BN9 A;  4M45 A;  4KHP K;  1XHX A;  1JLB A;  4IJA A;  1N6Q A;  4MO4 A;  2E6L A;  3V4I A;  3CQ8 A;  1NK7 A;  4KRE A;  5IWA K;  4FZY A;  3HP6 A;  4H5R A;  1KAZ A;  3FZL A;  5GAD P;  4CGF A;  1J9A A;  3TAM A;  4EAH D;  2HBK A;  4B8A B;  3QO9 A;  5B8H A;  1YVU A;  3I8D A;  2FXU A;  4FLX A;  3M8S A;  1S22 A;  5AQO A;  2E20 A;  3TAN A;  5HP1 A;  1F21 A;  1TK0 A;  3EY1 A;  2O8F B;  4PL8 A;  3MXI A;  4FVU A;  4PKI A;  2WOM A;  1NGB A;  2P9N A;  3DXM B;  4JI4 K;  1X1P A;  4A61 A;  5LJV A;  3OTO K;  4NB4 A;  3SV4 A;  3F5T A;  1KD1 O;  2QWP A;  5LL6 Z;  4LF6 K;  4KHY A;  3T1Y K;  2V7Y A;  4M3X A;  1BA1 A;  3AVG A;  3DLH A;  1XUP O;  3UB5 A;  3OYI A;  2P9K B;  2VQE K;  3ZT3 A;  3ID6 A;  3L3V A;  1NMN A;  3PIO L;  1T05 A;  1DLO A;  4WQ5 C;  3NH2 A;  4DF4 A;  3KK7 A;  4YOX A;  3P5J A;  4CES A;  2OPR A;  1D9D A;  4CF9 A;  1X9M A;  1V4S A;  3UKU A;  3WEE B;  2O8B A;  1K6Y A;  1MDU B;  2GWJ A;  2P9S B;  1HQE A;  3ZSW A;  1J53 A;  2O8C A;  1W97 L;  1IBK K;  5M1O A;  4BRF A;  3SQ0 A;  5FRO A;  5HL7 L;  5C0Y A;  3DRP A;  2UU9 K;  3THX B;  1EXQ A;  3SLC A;  4JS4 A;  4DU4 A;  3VEZ A;  1HJR A;  1P8Z A;  2F8T A;  3TTF A;  4F2R A;  3R1X A;  4CEF A;  1BQN A;  4MDB A;  4CF0 A;  1QS4 A;  1UWB A;  4M7X A;  4QS7 A;  4JI0 K;  3HK2 A;  1VRU A;  1T44 A;  3NDK A;  2HF3 A;  1NJZ A;  3O9Q A;  5FDL A;  2W6K A;  2BUP A;  4XEI A;  3QBW A;  3TTD A;  3WNF A;  2HHW A;  1RT4 A;  3O9T A;  4BC5 A;  1VRT A;  3P1G A;  4DHY A;  2QWM A;  1VQO N;  3CC2 N;  2LSN A;  1MWM A;  4OPA A;  1FKO A;  3CQY A;  4CEC A;  1TAU A;  3ENB A;  4CF8 A;  3LAL A;  5AZI B;  4O55 A;  4C8O A;  3PSI A;  1TYQ B;  3QER A;  5SWM A;  1LCU A;  3KWG A;  3S9H A;  4CJE A;  1MU2 A;  4AM6 A;  4K8X A;  2WTU A;  2YV0 X;  4BC3 A;  3QIN A;  5FPN A;  4G9Z A;  5JS2 A;  1VSK A;  1WN7 A;  3RRG A;  4JKD A;  3AO5 A;  1KVA A;  1NM1 A;  3SQ1 A;  4XH5 A;  3OBY A;  4FK0 A;  3VQC A;  1S1U A;  4FM0 A;  4FOE A;  4DTX A;  3R3L A;  3VTI A;  4KH4 A;  2YNH A;  4JS5 A;  4BR9 A;  4DR5 K;  2F96 A;  4X66 K;  4AF1 A;  5AQL A;  3ZYY X;  4FJG A;  1HKC A;  3SUQ A;  4QOZ B;  5CR4 A;  4RW4 A;  3SCX A;  4GW6 A;  2DFE A;  1VQ7 N;  3J8A A;  3I56 N;  3C65 A;  4JLH A;  2NRX A;  4JI6 K;  1Z25 A;  3LL3 A;  3DLL L;  2NRW A;  4A62 A;  2YJF A;  1VQ8 N;  1Q9Y A;  1YTU A;  4BRE A;  1NMD A;  4CHY A;  3AA2 A;  2P5O A;  2ZGY A;  3KK3 A;  2KHO A;  2XHB A;  4I2P A;  4CED A;  4I6M A;  4FJX A;  4FJ7 A;  2QI2 A;  1ATS A;  3PX6 A;  3KIO A;  2FBT A;  2YHW A;  4IG3 A;  3G0Z A;  4FXD A;  3CF5 L;  3G6E N;  2HBJ A;  4KTQ A;  4EFH A;  3JAM O;  3AVI A;  3T1H K;  1ZXO A;  3VQE A;  2IC3 A;  1ASW A;  1N8R O;  2D0O A;  4CZH A;  1XQS C;  2A40 A;  1IBM K;  2JGU A;  3EE8 A;  1ZBF A;  1BIS A;  3MK6 A;  4HCC A;  5TKY A;  3LDO A;  3ULD A;  3WXL A;  2P9L B;  3DXK A;  1BGX T;  1Q81 O;  3LDS A;  2IS3 A;  3O80 A;  3CJB A;  5E26 A;  4FPB A;  4KO0 A;  3CPW M;  2A41 A;  3E9P A;  5I42 A;  4HTL A;  4WQ4 A;  3L2Q A;  2V51 B;  3P4I A;  4ID5 A;  4AHT A;  4ILG B;  2DTU A;  4AHR A;  1NKE A;  4NLC A;  4R5P A;  2RN2 A;  4PKH A;  3MXJ A;  1WSF A;  3UE5 A;  3CMA N;  3OYJ A;  3LAM A;  4CW7 B;  4DF8 A;  4DV4 K;  3C95 A;  3Q7C A;  3KLH A;  3G71 N;  3N4Q A;  2HOE A;  3KD5 E;  3LM2 A;  4PKG A;  4FWS A;  4R79 A;  1ATN A;  1NGC A;  3GBT A;  3CC7 N;  3QIO A;  4DB3 A;  1ZBI A;  3SUP A;  3LAK A;  4OLA A;  1O1W A;  1NGF A;  3UKR A;  4O4G A;  1YVN A;  2QW9 A;  4AQY K;  1BI4 A;  4JI5 K;  3AVH A;  4CIF A;  4FLY A;  4BC2 A;  4GVE A;  3MXM A;  2O4G A;  3IS9 A;  1B9D A;  4LFB K;  3IMX A;  4JKF A;  2ITG A;  3DRR A;  4JI2 K;  2P9U B;  1VSE A;  1HMV A;  4E7L A;  4M3U A;  4BRI A;  3KLI A;  3IUC A;  4CJ5 A;  3HI0 A;  1S9G A;  1QSY A;  4MO5 A;  2ASM A;  4RWT A;  3SUN A;  1OH6 A;  4AHC A;  3C94 A;  1JKH A;  3OYL A;  4EHT A;  5C42 A;  3BF3 A;  4LFC K;  5HBM A;  2IOC A;  2KW4 A;  4C8N A;  5HRP A;  4N5S A;  4E7H A;  4OKJ A;  1VSD A;  2RF2 A;  2E2O A;  1N5Y A;  1L3U A;  5AR0 A;  1VSM A;  1SV5 A;  3ZT4 A;  1HYS A;  5LJW A;  4M41 A;  3MMV A;  4PY5 A;  4J2B A;  3GE1 A;  4B3T K;  2QXF A;  2QEX N;  3FZH A;  3C6A A;  1IG8 A;  3SAG A;  4IOA L;  2HVH A;  3P39 A;  2IIR A;  1VQK N;  4DTS A;  1IKW A;  1EET A;  4YDU C;  2Z1G A;  4L8R B;  3JSM A;  3GG4 A;  4B9L A;  3KD1 E;  3CJC A;  4DUZ K;  2DPN A;  1C6V A;  3PUF A;  3EEQ A;  3PIP L;  3HVT A;  1T8E A;  1DT9 A;  4GKK K;  1VQ5 N;  3TPQ A;  4FL9 A;  5MLC Q;  3S3O A;  3M8P A;  2HHV A;  4B1Z A;  2XY8 A;  3WEE A;  1BU6 O;  3WNG A;  4FJ5 A;  2P9S A;  3K9K A;  1NOY A;  4CFC A;  1NGG A;  4FWN A;  4F3O A;  4DTJ A;  3LWL A;  5KGX A;  1TGO A;  2PFU A;  4WFB L;  4BAC A;  1JXE A;  4BRH A;  3THX A;  3IDH A;  4CJQ A;  1SKW A;  3I55 N;  4B9V A;  3HPO A;  3ENH A;  3AO2 A;  2PY5 A;  1FW6 A;  2HHQ A;  3VEO A;  4C1N K;  4FW2 A;  4RW8 A;  1TL3 A;  2IDO A;  2IAJ A;  3CIP A;  3IFR A;  4Z4C A;  4YNQ A;  3HVR A;  4IFV A;  1C0M A;  4JYA K;  2IVP A;  2ZM6 K;  5AQG A;  4M3W A;  3NGI A;  1JCG A;  4E1M A;  1JCE A;  2KZZ A;  3RWU A;  1NGA A;  3OYA A;  1QVG M;  2B4J A;  3D2E B;  5DK5 A;  5EX5 A;  1QZ6 A;  3VMF B;  5HRR A;  4K42 A;  3BZC A;  4H4M A;  4MLH A;  2NRH A;  3BY5 A;  4LF5 K;  1XWL A;  3F73 A;  3T1A A;  1WUA A;  3RTV A;  4BE0 A;  5EVZ A;  1G99 A;  1TYQ A;  4NXN K;  3CC4 N;  2FSK A;  4J8F A;  2V52 B;  5HRN A;  4CI6 A;  2VYP A;  4M63 C;  3OYC A;  1EO1 A;  1MWK A;  1NGD A;  4CJW A;  4O8U A;  3C6H A;  1GOC A;  5KRS A;  4CFB A;  3U3Y A;  2RHK A;  1WAF A;  4FWO A;  1VQ9 N;  1N33 K;  2HB5 A;  3HL8 A;  1ASV A;  4BGA A;  4BDZ A;  2Y1J A;  3FE1 A;  3HZ6 A;  2DY4 A;  3QFU A;  3H3O B;  4KHN A;  1WSJ A;  2OCE A;  4B3M K;  3TAP A;  4KTW A;  2PYJ A;  2OA8 A;  3L6Q A;  4WFA L;  5AQQ A;  2HHS A;  2JWK A;  2EWS A;  3AVB A;  4BG9 A;  5AQF A;  3AGK A;  3A5O C;  1NKC A;  3LZI A;  4FZZ A;  3RRH A;  5KTQ A;  1NK4 A;  1EKE A;  1WBD A;  3NVM A;  4OKK A;  5DMR A;  1E4G T;  2ZQB A;  4YOT A;  3ITH A;  4ZHR A;  1X3M A;  1UOC A;  2NRZ A;  1XNR K;  2FSJ A;  4KHW A;  3HYF A;  2YNI A;  4A2B A;  4DQR A;  4CIE A;  1IJJ A;  3OYG A;  1C0F A;  3OYB A;  4RCH A;  3OYF A;  3G4S N;  3MEE A;  3NCI A;  1RTD A;  3SJJ A;  2UXD K;  3DI6 A;  3NAE A;  2G8I A;  2BDP A;  3A5M C;  1TUY A;  3P31 A;  2P9L A;  3EO3 A;  3J7A P;  1VSL A;  1FKP A;  1HQU A;  3ZSY A;  4WFN L;  1ZC6 A;  3FGU A;  3VEV A;  4WCE L;  1KTQ A;  1C0T A;  1IH7 A;  4JK8 A;  3OS2 A;  1QSL A;  1XHZ A;  2QKK A;  3U6F A;  4KB1 A;  1JLE A;  4LF9 K;  4NO7 A;  4LH4 A;  3TSU A;  3LDL A;  2X74 A;  1SKR A;  4H0V B;  3QNN A;  3AA3 A;  2NUB A;  4H4O A;  4Z4E A;  3MWP A;  4PA1 A;  4CER A;  2GX9 A;  1RT6 A;  3AVK A;  1SKS A;  2QK9 A;  3V81 A;  1RDD A;  5AQI A;  5E84 A;  1KVC A;  4DFM A;  2H3G X;  4JI3 K;  4OKE A;  1WOQ A;  5H1S Q;  2BAN A;  2ZE2 A;  2FLO A;  3KKS A;  2D0P A;  3G10 A;  3O3F A;  5C12 A;  5M1K A;  4CFD A;  1NK9 A;  3VQ7 A;  3BGR A;  3WNE A;  3QNO A;  3OHR A;  3QLH A;  2DFF A;  2PAV A;  4HCB A;  2F4V K;  4ELT A;  1BCM A;  3H6E A;  4CK2 A;  4M3R A;  3ZT1 A;  2RKI A;  4CZI A;  3RMB A;  1GLD G;  3VQ4 A;  4M3T A;  2IVO A;  3BZK A;  2P9U A;  3LDP A;  1TKT A;  2W6L A;  4IDH A;  4CEZ A;  1KRP A;  1ILY A;  5BRE A;  3CME N;  3GOI A;  4BRC A;  3O4W A;  4LFA K;  3PLA A;  3C0B A;  1VQN N;  3OBW A;  4CD1 A;  3KK2 A;  5TKW A;  3V9W A;  4CK1 A;  5AQY A;  3VQ8 A;  1VQM N;  5F2R A;  3KK1 A;  4RW6 A;  1NOZ A;  3EZW A;  1HKG A;  3OJU A;  2KFZ A;  4H0Y B;  5F1X A;  3CPE A;  4DG1 A;  4FLZ A;  4DU1 A;  4WYB A;  1GLA G;  3SJH A;  2VG7 A;  4AHU A;  4CBW A;  2QWN A;  3PO5 A;  4IG0 A;  5C2D A;  1RDB A;  4IJN A;  2FSN A;  3SBG A;  3EKU A;  2GWK A;  3G25 A;  5AFU A;  2HND A;  4CZJ A;  1NJY A;  1NK0 A;  2UUB K;  1JLQ A;  5ADX A;  4IZ9 A;  5C25 A;  3HO1 A;  4PQU A;  3K59 A;  2PBD A;  5KQ8 A;  4H03 B;  1YF5 L;  3CCJ N;  3T7Z A;  3HST B;  1HR0 K;  3H45 C;  1K8A O;  5AQM A;  3ZX0 A;  1RT5 A;  3VQQ A;  3EZ5 A;  4DQI A;  4CEE A;  4CZF A;  1CXU A;  2KFN A;  3VPZ A;  3QEW A;  1HX1 A;  5LMN K;  1M1K O;  1XNQ K;  3ZX3 A;  2AA4 A;  3IAY A;  3K5L A;  4CF1 A;  4EP5 A;  1YAG A;  1KAY A;  1X3N A;  1B9F A;  2E6M A;  1IKV A;  1TL1 A;  3DYA A;  1Y64 A;  4LSN A;  1U45 A;  4KAZ A;  4DTR A;  4BWJ A;  4NLB A;  1C1C A;  1EP4 A;  3HOT A;  1IO2 A;  5AQN A;  1A5V A;  3L3U A;  5BR8 K;  3S3N A;  3F2K A;  2D0B A;  5AQH A;  4CJF A;  4K43 A;  3WQT A;  4JD2 B;  4XIU A;  1H1V A;  3KLE A;  4BDP A;  2X6N A;  2FBX A;  1RBS A;  3L2W A;  5FPM A;  1C1B A;  2W42 A;  3ZSZ A;  3O8M A;  2CGL A;  4LD0 A;  3L2V A;  5M1P A;  3D2E A;  4A5A A;  2D4W A;  4DV0 K;  4IKF A;  3HJF A;  1R59 O;  4H0O A;  3DJC A;  3U8X A;  4W5T A;  3V9S A;  3VES A;  2P5G A;  2BE2 A;  3D45 A;  4KV8 A;  4FLU A;  3LAN A;  4DTU A;  1KSP A;  1FK9 A;  5GAH P;  1VQL N;  3AVF A;  2OTL N;  1Z05 A;  1J6Z A;  1QQM A;  1HUX A;  2GBZ A;  3AO1 A;  4TSX A;  4AM7 A;  3CER A;  2D1K A;  5EXW A;  2F9T A;  2UXB K;  2V7Z A;  1GLF O;  2WC9 A;  3SK3 A;  3TSQ A;  4DV5 K;  5J2N A;  3VF6 A;  1VSI A;  1UAX A;  5GIN A;  4BRP A;  3TTC A;  1KQS M;  2NRV A;  3AVA A;  1HJO A;  3AVL A;  4DFK A;  5GAG P;  3AAP A;  2A1R A;  3LP1 A;  4C8M A;  1QSS A;  1GLJ O;  4KRF A;  4U7B A;  2XY7 A;  3ULE B;  3OYD A;  3NE6 A;  3THY B;  5FPD A;  2WUS A;  1S1W A;  4JN4 A;  3O5B A;  4X65 K;  3SI6 A;  1KC8 O;  3SYZ A;  3C6U A;  4B9M A;  5AQX A;  3QB0 A;  1BCO A;  3PSF A;  3QIP A;  4BQZ A;  5C10 A;  2B6A A;  4CGJ A;  1X9W A;  4JKG B;  1NJX A;  1K8K B;  3FR0 A;  2BTF A;  3CG7 A;  1YI2 N;  3MX2 A;  1ZBH A;  4NXM K;  2BH1 A;  4OVL A;  4OLB A;  3VTH A;  1A5W A;  3O4N A;  1YTA A;  1D8Y A;  2VWK A;  1ZBL A;  2CH5 A;  1K73 O;  4GMJ B;  4YOR A;  5EY4 A;  4NCG A;  4CJP A;  4FJ9 A;  3I0R A;  5E41 A;  4JK9 A;  1VQ6 N;  3HT3 A;  4DU3 A;  3CQX A;  1QQO A;  1REV A;  3ZSX A;  1CZB A;  1X9S A;  1U04 A;  1KLM A;  4OPH A;  4FM1 A;  4FPA A;  3MCP A;  3VGL A;  3NF7 A;  5K14 A;  4M3Z A;  1DKG D;  5T7B A;  1NGH A;  1R0A A;  3M3Z A;  3O1B A;  4BR5 A;  1D4X A;  4BRK A;  4DV6 K;  2NLX A;  1NJW A;  4FYD A;  3CXC M;  4OGE A;  1HPZ A;  4CBX A;  2ZJP L;  1DTT A;  3DM2 A;  2ZJR L;  2OPS A;  4CJ3 A;  4FOI A;  3MN7 A;  1TKX A;  1D5A A;  3THW B;  3CYM A;  3QFP A;  4BR2 A;  2GTD A;  3J7Y P;  4FSV A;  4OX9 K;  1NK8 A;  3ISN C;  4K0K K;  4HUF A;  3DLG A;  3OVN A;  5KGW A;  1XC9 A;  5BRD A;  4M42 A;  4EHU A;  3RVC A;  4OPK A;  5BRH A;  1RBT A;  2I5J A;  4KHQ A;  1Q82 O;  1YUW A;  4DV7 K;  4W5O A;  3KVG A;  4JI8 K;  4KPY A;  5AQP A;  3ZSV A;  3D0P A;  3GDQ A;  1EQY A;  3GL1 A;  1ITG A;  2D5R A;  3VA3 A;  1FXX A;  2FF3 B;  3LPT A;  2OTJ N;  3N4P A;  4EP4 A;  4ELU A;  4F2S A;  1VQP N;  3VET A;  5AQW A;  4DV1 K;  1C1A A;  1S1T A;  3ZET B;  3OA9 A;  2HBM A;  4YOV A;  2WFB A;  3CM5 A;  4JI1 K;  4JHD B;  4YY3 K;  3ATV A;  2O8D A;  1SQK A;  4KI4 A;  3ZLJ A;  1JJ2 M;  3IRX A;  1VAZ A;  1WSG A;  1RBV A;  5J2Q A;  2HMP A;  1U6Z A;  1YHQ N;  1IG9 A;  1HNI A;  5J1E A; 
#chains in the Genus database with same CATH homology
 3FE1 A;  3HZ6 A;  4BRM A;  4CD3 A;  2FXU A;  3H3O B;  3QFU A;  5F1X A;  1S22 A;  5AQO A;  2E20 A;  4DQ8 A;  2VGN A;  5AZJ B;  4DKW A;  4BY9 C;  3L6Q A;  4FWL A;  4PL8 A;  4WFA L;  3FZM A;  5AQQ A;  4PKI A;  1U2V A;  3BP8 A;  3EN9 A;  4B1Y B;  4FVU A;  3U4L A;  1NGB A;  2JWK A;  2P9N A;  3DXM B;  4A61 A;  5LJV A;  2EWS A;  3HSC A;  4BG9 A;  3CCM N;  4NB4 A;  5AQF A;  3AGK A;  3CJA A;  3F5T A;  3A5O C;  3L4Q A;  3ZEU B;  1YXQ A;  1KD1 O;  3NVK A;  2QWP A;  2P9I B;  3NVM A;  4FO0 A;  1E4G T;  4ILJ A;  4YOT A;  3NMU A;  2A5X A;  1T6C A;  2V7Y A;  4KH5 A;  1X3M A;  2NRZ A;  2ZGZ A;  3VEX A;  2FSJ A;  2W40 A;  1BA1 A;  2VWB A;  5BR9 A;  4UY8 O;  3WXJ A;  1XUP O;  3UB5 A;  1CZA N;  2YI1 A;  4A2B A;  4H0T B;  3CET A;  5AQT A;  3KWI A;  2P9K B;  1SZ2 A;  1C0G A;  3ID6 A;  1T6D A;  3PIO L;  5BPL A;  4H5T A;  3H3N O;  1IJJ A;  1GLC G;  3MDQ A;  4JAX A;  4WQ4 C;  4WQ5 C;  4GNI A;  1C0F A;  3VEY A;  2E88 A;  3KK7 A;  4YOX A;  4RCH A;  4GY2 B;  1BG3 A;  4C1N I;  4BR7 A;  3SMS A;  3G4S N;  1V4S A;  3UKU A;  3WEE B;  2P9P A;  3T69 A;  1MDU B;  2GWJ A;  2KLA A;  1TUY A;  2P9S B;  3A5M C;  3P31 A;  1QZ5 A;  2P9L A;  3EO3 A;  4JKA A;  2QTD A;  1W97 L;  4WFN L;  1ZC6 A;  3FGU A;  3VEV A;  4WCE L;  5M1O A;  4JK8 A;  4BRF A;  5CE3 A;  2YX6 A;  1Q7Y O;  5HL7 L;  5C0Y A;  3C7N A;  3QBX A;  2QXL A;  3SLC A;  4NO7 A;  3O9R A;  4MLE A;  3TSU A;  3LDL A;  3RSE A;  3VEZ A;  4H0V B;  1KAX A;  3L0Q A;  4B1W B;  3KHY A;  1P8Z A;  1QHA A;  2W41 A;  2F7T A;  3TTF A;  3MWP A;  4BR4 A;  2CGK A;  4FWQ A;  2GX9 A;  3R1X A;  5BRF A;  4MDB A;  5AQI A;  5AQK A;  4BGB A;  5E84 A;  4M7X A;  5BPN A;  2E2P A;  4JD2 A;  4QS7 A;  4PHT X;  3WXI A;  2H3G X;  1WOQ A;  5H1S Q;  3CCS N;  3MN5 A;  1T44 A;  5AQS A;  2HF3 A;  3O9Q A;  5M1N A;  2WBN A;  1Z6R A;  2FLO A;  2BUP A;  4XEI A;  3FZF A;  3QBW A;  3TTD A;  2D0P A;  4GV9 A;  4H0P A;  3O9T A;  1S3X A;  4BC5 A;  5C12 A;  5M1K A;  3DLL L;  3O08 A;  5JLH A;  2ZF5 O;  5DM6 L;  1XC3 A;  4DHY A;  3J7Z O;  3CCU N;  3CCV N;  3OHR A;  1RDU A;  2QWM A;  1VQO N;  2PAV A;  3CC2 N;  3D2F A;  2J4R A;  1MWM A;  4OPA A;  3CQY A;  3ENB A;  3H6E A;  3CCQ N;  4CJ7 A;  4CZI A;  1GLD G;  5AZI B;  3A5L C;  3O9U A;  3B8A X;  3VEW A;  2F9W A;  2IVO A;  4BVO A;  1TYQ B;  4JKC A;  2P9U A;  3LDP A;  4IDH A;  3DAW A;  1LCU A;  4JKE A;  3KWG A;  5LY3 A;  3F9M A;  1ILY A;  5BPM A;  5BRE A;  3CME N;  1BWF O;  3P38 A;  4K41 A;  3GOI A;  4AM6 A;  3AAR A;  4BRC A;  3I33 A;  3CJ9 A;  3O4W A;  4BC3 A;  4E1J A;  1SAZ A;  4XH4 A;  1RGI A;  3CHW A;  4JK7 A;  3PLA A;  5FPN A;  3C0B A;  3O9S A;  4BG8 A;  4YOW A;  1VQN N;  4G9Z A;  5ELZ A;  2ZWH A;  3H1V X;  4JKD A;  3S41 A;  3MWT A;  1NM1 A;  2AP1 A;  3OBW A;  3TSP A;  2E2N A;  4CD1 A;  4XH5 A;  2NNW A;  3OBY A;  5TKW A;  2ITM A;  2RE2 A;  1TUU A;  3ULE A;  3A5N C;  1QVF M;  5AQY A;  4H5N A;  3D7E O;  4FOE A;  1VQM N;  3R3L A;  3VTI A;  5F2R A;  4IEE A;  4KH4 A;  4BR9 A;  5M1Q A;  3VER A;  3ZX2 A;  4AF1 A;  2IVN A;  3EZW A;  5AQL A;  3ZYY X;  1HKC A;  1P90 A;  1HKG A;  2OAN A;  5CR4 A;  1VQ7 N;  3J8A A;  4H0Y B;  3I56 N;  3HOS A;  3C65 A;  1LOT B;  2NRX A;  3BF1 A;  4JKG A;  3LM9 A;  4IO9 L;  3LL3 A;  1O13 A;  2NRW A;  2QWQ A;  2YJF A;  4FWP A;  1K8K A;  3CPE A;  4A62 A;  1U2V B;  2HF4 A;  3QML A;  3ATU A;  3M1F A;  1VQ8 N;  2P9N B;  1NLV A;  4WYB A;  1BA0 A;  4IOC L;  2JWL A;  1NMD A;  1GLA G;  3O6W A;  3Q7B A;  3H1Q A;  4BRE A;  3SJH A;  3I8B A;  3CJ1 A;  2ZGY A;  4U67 L;  2KHO A;  1HPM A;  4DCH A;  3DXM A;  4I6M A;  2QWO A;  3E66 A;  4CBW A;  2Q36 A;  2QWN A;  2E1Y A;  3WQU A;  4QS9 A;  2QI2 A;  4LC9 B;  5C2D A;  2YHY A;  1ATS A;  4IJN A;  1YJ9 N;  4QS8 A;  5AQR A;  2YHW A;  2FSN A;  1SS6 A;  3SBG A;  1YIT N;  3EKU A;  2GWK A;  3G25 A;  2VGM A;  5AFU A;  4CZJ A;  4CZM A;  3CF5 L;  3G6E N;  2HBJ A;  4EFH A;  4FWK A;  3SBT A;  4GV3 A;  2Q0U A;  1ZXO A;  5ADX A;  4IZ9 A;  3W0L A;  2UYT A;  4K25 A;  2P9K A;  4RTF D;  2D0O A;  1N8R O;  4YDU A;  2PBD A;  1XQS C;  2A40 A;  4CZH A;  5KQ8 A;  4H03 B;  4IEI A;  3CCL N;  3U9D A;  1YF5 L;  1YIJ N;  3CCJ N;  3T7Z A;  3EE8 A;  1Q86 O;  3SMP A;  3H45 C;  1K8A O;  5AQM A;  1S72 N;  3ZX0 A;  3E9O A;  3UKU B;  2P9P B;  2VCP A;  3MK6 A;  5FPE A;  5I9E B;  5TKY A;  3LDO A;  3WXL A;  4CZL A;  4IFE A;  2P9L B;  3DXK A;  2NZT A;  3BEX A;  1Q81 O;  4CZF A;  3VPZ A;  3SAF A;  1YJW N;  4GV6 A;  1HX1 A;  3O80 A;  1M1K O;  3CJB A;  5E26 A;  3ZX3 A;  4FPB A;  3CPW M;  2A41 A;  2AA4 A;  1YJN N;  3E9P A;  4HTL A;  4ISE A;  2YJE A;  3C7N B;  4WQ4 A;  1YAG A;  1KAY A;  4B1V A;  1X3N A;  2V51 B;  3P4I A;  2Q97 A;  1Y64 A;  5DM7 L;  1HLU A;  3RSE B;  4NLB A;  1E4F T;  4ILG B;  4B9Q A;  3HOT A;  1Q18 A;  4NLC A;  3WUH A;  5GAE P;  5AQN A;  3WT0 A;  2QM1 A;  3HRG A;  5JVH L;  3F2K A;  4PKH A;  2ASO A;  5AQH A;  3UE5 A;  4K43 A;  3CMA N;  3OW2 M;  3WQT A;  1DEJ A;  4JD2 B;  5F0X A;  5JMV A;  1ATR A;  1BOT O;  1H1V A;  3Q7C A;  3G71 N;  4BRN A;  3N4Q A;  2HOE A;  3LM2 A;  3CJ7 A;  1V4T A;  4PKG A;  5FPM A;  4FWS A;  5AQJ A;  4R79 A;  5CHI A;  1ATN A;  3O8M A;  4CZG A;  1NGC A;  2CGL A;  3GBT A;  3CC7 N;  4DB3 A;  5M1P A;  3SAH A;  3D2E A;  4A5A A;  2D4W A;  1NGF A;  1R59 O;  4H0O A;  3DJC A;  1NGI A;  3U8X A;  3UKR A;  3VES A;  1GLL O;  5GIP A;  1DGK N;  1YVN A;  2QW9 A;  3MCA B;  4BVP A;  2E2Q A;  5GAH P;  1VQL N;  3AAQ A;  4BC2 A;  4GVE A;  3MX5 A;  4B1X B;  5GIO A;  1Z05 A;  3QIC A;  2OTL N;  1J6Z A;  3IMX A;  4O5F A;  1QQM A;  1JCF A;  4JKF A;  4F9O A;  4YOY A;  3CCR N;  1HUX A;  1KXP A;  3VF2 A;  3R8E A;  4AM7 A;  1GLE G;  2ASP A;  2P9U B;  3CER A;  3ZET A;  2D1K A;  4IOX A;  5EXW A;  2F9T A;  2HBL A;  5AZI A;  2V7Z A;  3DWL A;  1GLF O;  2I7N A;  2WC9 A;  3SK3 A;  3TSQ A;  3W3D A;  4A57 A;  3IUC A;  3VF6 A;  4BRI A;  3HI0 A;  5KPT A;  4CBU A;  1ZBS A;  4JHD A;  5GIN A;  4BRP A;  4A5B A;  3AGR A;  4MO5 A;  3TTC A;  5JLF A;  2ASM A;  4RWT A;  2NRV A;  5JVG L;  3K9J A;  1KQS M;  3FZK A;  3WXM B;  1HJO A;  5GAG P;  3AAP A;  3U9Z A;  4EHT A;  1GLJ O;  3BF3 A;  4O8K A;  4ILH A;  5JIC A;  4U7B A;  1T3V A;  3ULE B;  1MA9 B;  5FPD A;  2WUS A;  4C23 A;  2NRR A;  4JN4 A;  3O5B A;  3FLC O;  4JNE A;  1KC8 O;  2I7P A;  2E2O A;  3CI5 A;  5EOY A;  5AR0 A;  5AQX A;  3R9P A;  3QB0 A;  2A6A A;  5KQD A;  2QA4 N;  4Y0W A;  2Q1N A;  5LJW A;  4BQZ A;  4FWR A;  5AZJ A;  2QWR A;  3MMV A;  5C10 A;  5KPR A;  4JKG B;  3GE1 A;  3VEN A;  1K9M O;  1K8K B;  3FR0 A;  2BTF A;  3A8Y A;  2QEX N;  1HKB A;  3FZH A;  3C6A A;  3E1Y A;  3VOV A;  1YI2 N;  3MX2 A;  3EE9 A;  1IG8 A;  2BH1 A;  4FWM A;  3SAG A;  4IOA L;  3P39 A;  5BN8 A;  3ZEU A;  2IIR A;  4OO1 J;  1VQK N;  1RFQ A;  3VTH A;  2P9I A;  4JEP A;  4I6M B;  4MDA A;  3VF4 A;  2CH5 A;  4YDU C;  2FF6 A;  1K73 O;  4BC4 A;  4YOR A;  3GG4 A;  3LDN A;  3M5R A;  1ESV A;  3CJC A;  5EY4 A;  2DPN A;  3CCE N;  4PL7 A;  3PIP L;  4H5W A;  1X9J A;  4JK9 A;  1OVY A;  3LDQ A;  1VQ6 N;  1DT9 A;  3L4I A;  3D6R A;  5M1F A;  1VQ5 N;  1RDW X;  3HTV A;  4H0X B;  3TPQ A;  2GEM A;  1NWK A;  3BUZ B;  3CQX A;  4FL9 A;  1QQO A;  5MLC Q;  4XH1 A;  2ZJQ L;  4BRL A;  4OPH A;  4FPA A;  3MCP A;  3MN6 A;  3VGL A;  3ID8 A;  1BO5 O;  4B1Z A;  4HWI A;  2Q0R A;  1DKG D;  5C15 A;  2KKZ A;  2A42 A;  1NBW A;  4CZK A;  3E9L A;  4BRO A;  4EIA A;  4KH6 A;  1NGH A;  3WEE A;  4A59 A;  2QWL A;  4BRQ A;  1BU6 O;  2P9S A;  3K9K A;  3DXK B;  3M3Z A;  3O1B A;  5AQU A;  4Z94 A;  4A2A A;  4BR5 A;  4BR0 A;  1NGG A;  4FWN A;  2Q31 A;  1D4X A;  4WQ5 A;  4BRK A;  2PFU A;  4WFB L;  3EL2 A;  2NLX A;  4BRH A;  3CXC M;  3IDH A;  3I55 N;  4CBX A;  3ENH A;  2ZJP L;  3QDK A;  4YOU A;  3HBT A;  3VGK A;  4H5V A;  2YCH A;  2ZJR L;  4ISF A;  3VEO A;  4C1N K;  4FOI A;  3MN7 A;  4JKB A;  3WXK A;  1M90 O;  3CIP A;  3O1W A;  4JKH A;  3IFR A;  3CD6 N;  3QFP A;  4BR2 A;  2GEL A;  3VGM A;  4L3Q A;  4CZE A;  3IKM A;  3MN9 A;  1NJI O;  2GTD A;  4FSV A;  3M6G A;  4IWV A;  1W2B M;  2IVP A;  3HM8 A;  5AQG A;  1JCG A;  3FFK B;  2CH6 A;  5BRD A;  5C2F A;  1BDG A;  1JCE A;  3ENO A;  3RVC A;  4EHU A;  5BRH A;  1NGA A;  4BRA A;  2GUP A;  1QVG M;  1Q82 O;  1YUW A;  2A3Z A;  4M7Y A;  3TU5 A;  3D2E B;  2E1Z A;  3KVG A;  5KPZ A;  5AQP A;  5AQV A;  5EX5 A;  5AFU H;  3D2F B;  1QZ6 A;  3VMF B;  3UKR B;  4BRG A;  3GDQ A;  1VQ4 N;  2CGJ A;  1EQY A;  3GL1 A;  3KZB A;  4K42 A;  2Q2R A;  4WF9 L;  5ADX H;  1NGE A;  1OKJ A;  4BQL A;  3A0I X;  1BUP A;  4MLH A;  3JS6 A;  4KBO A;  2FF3 B;  2NRH A;  2OTJ N;  2E8A A;  1QQN A;  3N4P A;  1WUA A;  4ISG A;  3AY9 A;  3JXU A;  1VQP N;  3EKS A;  1GLB G;  5EVZ A;  3VET A;  1G99 A;  5AQW A;  1TYQ A;  1NGJ A;  3ZET B;  5HOO A;  3CC4 N;  5AQZ A;  2HST A;  2FSK A;  3OA9 A;  4J8F A;  5BN9 A;  2HBM A;  4YOV A;  2V52 B;  2WFB A;  4B1U B;  2VYP A;  4IXC A;  4IJA A;  4CI6 A;  4IO8 A;  4M63 C;  4JHD B;  1EO1 A;  4MO4 A;  1MWK A;  3ATV A;  1NGD A;  1SQK A;  4BRD A;  4O8U A;  3C6H A;  3H46 O;  2YHX A;  1JJ2 M;  1VAZ A;  3R6M A;  2RHK A;  4FWO A;  1VQ9 N;  4H5R A;  1KAZ A;  3FZL A;  5GAD P;  2HMP A;  4BGA A;  1U6Z A;  4EAH D;  1YHQ N;  2HBK A;  2NRT A;  5B8H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...