2FSJA

Crystal structure of ta0583, an archaeal actin homolog, native data
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
325
structure length
318
Chain Sequence
MVVVGLDVGYGDTKVIGVDGKRIIFPSRWAVTETESWKIPVLSTDGGQTKFIYGKYASGNNIRVPQGDGRLASKEAFPLIAAALWESGIHNPVDLVIGSGTPLGTFDLEVKAAKEALENKVLTVTGPEGEVRQFNITRLIMRPQGVGAALYLLNQGIIEQQPGYGVVIDVGSRTTDVLTINLMDMEPVVELSFSLQIGVGDAISALSRKIAKETGFVVPFDLAQEALSHPVMFRQKQVGGPEVSGPILEDLANRIIENIRLNLRGEVDRVTSLIPVGGGSNLIGDRFEEIAPGTLVKIKPEDLQFANALGYRDAAERS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein Ta0583
publication title Crystal structure of an archaeal actin homolog
pubmed doi rcsb
source organism Thermoplasma acidophilum
molecule tags Structural protein
total genus 88
structure length 318
sequence length 325
ec nomenclature
pdb deposition date 2006-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17989 ALP_N Actin like proteins N terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2fsjA02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2fsjA01
1E4GT 5BRHA 3DWLA 2FSKA 5FPEA 3RSEB 5BRDA 5KQ8A 1S22A 2YHYA 3UE5A 1MWKA 1BA0A 2QWMA 5JICA 5KPTA 4FWSA 1QZ6A 4CZKA 3H3OB 2GELA 1YUWA 4IZ9A 4H5VA 4IO8A 3UKRA 4DB3A 2P9UB 4FO0A 4IWVA 2E2OA 3C7NB 3EKUA 1Z05A 4B1YB 4BR2A 4M63C 5AZIB 3LDNA 4QS9A 5AQYA 3D2FA 3ENHA 5AQQA 4CZJA 4H5NA 3HSCA 4JD2A 4KBOA 1C0GA 3KZBA 2V7YA 3M3ZA 3KVGA 1YXQA 1NGEA 2F9WA 1RFQA 2YJEA 5BRFA 5AQHA 5AZJA 4M7XA 2Q97A 3EZWA 2V51B 3P4IA 5AQJA 3H3NO 1ATSA 4FWNA 4RTFD 4BC5A 4PL8A 5AQOA 4B1ZA 3O6WA 4FWPA 1HKCA 3UKUA 4HTLA 3IMXA 2P9NA 2QWNA 1JCGA 2P9SA 3CERA 3O1WA 1LCUA 2A3ZA 3ZEUB 2ASOA 3VEWA 1E4FT 3FZLA 4ISFA 2BTFA 4A2BA 1NGFA 4DCHA 3FZFA 5E84A 3VPZA 1X9JA 3QICA 1WUAA 2P9LA 1NM1A 2A42A 2WUSA 3FR0A 1RGIA 4FWKA 1HKBA 4BRQA 2NLXA 1JCEA 3I33A 3CJ7A 4E1JA 2GTDA 1BO5O 1DKGD 1NGIA 4H03B 4JN4A 4BRLA 5EX5A 2P9PA 3A5LC 2HF3A 4FWMA 4BVPA 4FPAA 1U6ZA 4CBUA 5ELZA 2P9IB 1G99A 1TYQA 3EN9A 3BP8A 4FWQA 2QWLA 4PKGA 5LJWA 1T6CA 2FSNA 5AQLA 2P9KB 4H0VB 1H1VA 2W41A 4BVOA 1KXPA 3SLCA 4BR5A 4PKHA 2E2NA 3GBTA 1HJOA 2CGJA 1OKJA 3ID8A 4MLHA 3SJHA 3C0BA 1BG3A 4YDUA 3ENOA 4BG9A 3CHWA 1XC3A 2ASPA 2BUPA 1C0FA 1NBWA 3JXUA 5BR9A 2ZWHA 3ZX0A 3U9DA 3EL2A 5BREA 3QDKA 1NGAA 4BRAA 1BWFO 1U2VB 3VETA 4BRMA 3CJAA 1NGGA 4A2AA 4BRIA 4ISEA 4O5FA 3AAPA 4BRNA 2FLOA 4FOEA 5JMVA 4FPBA 4K43A 1NGBA 3HI0A 3UB5A 5BPLA 4J8FA 2YHWA 4O8KA 4WQ5C 2PBDA 1K8KB 4BC2A 3LDOA 2QWQA 3MN9A 3JS6A 1DEJA 1GLDG 2Q0RA 2Q2RA 5FPNA 2D4WA 2IVNA 4B9QA 3VESA 4IJAA 2HF4A 1IJJA 3WXKA 4H5RA 1T44A 3L0QA 4H0PA 3MN5A 3H46O 2Q36A 3ULEA 2EWSA 2V52B 4IJNA 4BRCA 1J6ZA 3FZMA 1KAZA 4B1UB 1NLVA 3HZ6A 4EHUA 3DXMB 4FSVA 4XEIA 4H5TA 3LM2A 4NB4A 1YVNA 1SAZA 4MO5A 4CZMA 1HPMA 3O1BA 4B1WB 3EO3A 4WQ5A 2D0PA 5AQFA 5AQRA 3H1QA 1NWKA 2AP1A 3BF1A 4BGAA 3FLCO 4WYBA 1TYQB 3VF2A 5AR0A 3CI5A 4L3QA 4BRFA 3HBTA 1XUPO 2A5XA 3FFKB 5I9EB 3VF6A 3A5NC 5BN8A 1X3NA 2UYTA 4I6MA 4JHDB 3IDHA 5AFUH 3VEZA 3D2EB 3O4WA 3ZETB 1BUPA 2CH6A 3RSEA 1HX1A 1GLJO 4MO4A 5AQKA 2IVPA 1NMDA 3QMLA 3ZX3A 2GWJA 4CBXA 3M6GA 1ZBSA 3QFUA 4CZHA 3WEEB 1X3MA 2P9UA 5FPMA 3BEXA 3C7NA 2FF6A 3IFRA 3DXKA 4CZGA 5JLFA 4WQ4A 3MK6A 4FWRA 4A61A 2F9TA 5AZIA 5LY3A 2FSJA 2I7PA 1NGDA 3R6MA 4BGBA 2I7NA 3G25A 3VEOA 3AARA 5AQUA 3VEYA 5BN9A 4BRHA 3VEXA 3GG4A 1S3XA 2QM1A 3OHRA 5AFUA 3DAWA 4RWTA 3W3DA 1V4TA 3CIPA 3UKRB 3A5MC 3WXLA 5KPRA 2ZGYA 4B1VA 5F0XA 5F2RA 1BA1A 1GLCG 4HWIA 1ATRA 4FWLA 1NGJA 1BU6O 2HMPA 3D2FB 2FXUA 3MN7A 3ATUA 3QFPA 2QXLA 4BREA 4JD2B 3IUCA 1GLEG 4QS7A 1QQOA 4NO7A 2J4RA 1HUXA 3WQUA 3BF3A 5EVZA 5F1XA 5KQDA 3GE1A 5BPNA 3ZEUA 1QHAA 4JAXA 3VERA 2QWOA 1QQNA 5AZJB 4BRKA 1RDWX 4H0OA 3S41A 3TU5A 3WT0A 5AQNA 2E2PA 4H0YB 1ZC6A 3MN6A 1HKGA 5B8HA 3L6QA 1ESVA 2E1YA 2V7ZA 3DJCA 3R8EA 1Q18A 2Q1NA 1ATNA 3UKUB 4B1XB 2HOEA 3J8AA 2P9NB 3F9MA 2VYPA 3CETA 1GLLO 4CBWA 2P9SB 1SZ2A 5KPZA 3FGUA 4LC9B 5EOYA 4H0XB 3SMSA 4H0TB 3B8AX 3TPQA 4CI6A 2H3GX 3M1FA 4F9OA 3MDQA 3D7EO 2P9IA 3LDLA 4BC3A 2D0OA 3CJ1A 3CJBA 3VGLA 4BQLA 2P9LB 5AQMA 2ZF5O 1T6DA 5AQZA 3WUHA 4CZFA 2OANA 1JCFA 3LM9A 1XQSC 3LL3A 2Q0UA 2IIRA 2P9KA 4GNIA 2PAVA 4EHTA 2W40A 4K25A 3QB0A 4BC4A 3VGMA 3VENA 1GLFO 1NGCA 2NZTA 1Z6RA 5AQIA 5ADXH 3AY9A 1GLBG 3DXKB 3I8BA 3GOIA 4FL9A 1TUYA 2ASMA 2P9PB 3H1VX 2KHOA 4QS8A 2GEMA 5AQVA 5AQXA 2ZGZA 4CZIA 1GLAG 1KAYA 4XH1A 1P8ZA 3U9ZA 1QZ5A 5AQTA 2NRHA 4A62A 4BROA 1D4XA 3A8YA 2E20A 3SMPA 1U2VA 3W0LA 3EKSA 2E1ZA 3U4LA 1BDGA 4K42A 3H45C 2A41A 4CZEA 3KHYA 4BQZA 3FZHA 2D1KA 2GUPA 4XH4A 3L4IA 4BG8A 3H6EA 2E88A 3LDQA 3WXJA 4EFHA 4MLEA 2IVOA 4FWOA 1SQKA 1HLUA 4BR0A 2CGLA 1K8KA 5AQWA 3QBXA 5ADXA 4EIAA 2YCHA 1TUUA 3VEVA 2QWRA 1CZAN 4Y0WA 4AM6A 2VCPA 3VOVA 4M7YA 1WOQA 3MCPA 4BR9A 1EQYA 3CJ9A 2YHXA 3ATVA 4BRDA 3O80A 5E26A 4BRPA 2E2QA 1NGHA 1R59O 2YI1A 4JNEA 5EY4A 3DXMA 4PKIA 3CQXA 1MA9B 3CQYA 4YDUC 2FF3B 1LOTB 3A0IX 4CZLA 4EAHD 3LDPA 2E8AA 3CJCA 3O8MA 2GWKA 2A40A 4C23A 2CGKA 1QQMA 1ZXOA 4AM7A 4CD1A 2CH5A 1Y64A 4CD3A 5CE3A 5AQGA 4ISGA 3R9PA 3MMVA 2VWBA 3ULEB 1MDUB 3A5OC 2DPNA 4WQ4C 5JLHA 4BR7A 3WQTA 4FOIA 4JHDA 2AA4A 1MWMA 3U8XA 3BUZB 1KAXA 5AQSA 3VGKA 5BPMA 5FPDA 5LJVA 3D2EA 3FE1A 3GDQA 3ZETA 2ITMA 5AQPA 2A6AA 4CJ7A 4RCHA 1DGKN 3VF4A 4DQ8A 2Q31A 1V4SA 2QW9A 1BOTO 4DHYA 3WXIA 5EXWA 4PL7A 4Z94A 3WEEA 5TKYA 3SK3A 4H5WA 4IXCA 1IG8A 4BR4A 3AAQA 3HM8A 1YAGA 3ZX2A 4K41A 4I6MB 3O5BA 3HTVA 3FZKA 3GL1A 4GY2B 3O08A 4XH5A 2YJFA 3QBWA 4BRGA 2QWPA
chains in the Genus database with same CATH superfamily
3LPTA 2A1SA 3TWHA 2FSKA 3G0ZA 5KQ8A 5GAHP 2ZM6K 5E41A 3AVLA 1B92A 1A5WA 1WSIA 3BZKA 4FO0A 1SL1A 4IWVA 5M1KA 1YT3A 2KFNA 3TAEA 1VQNN 1KTQA 3J81O 1NKCA 4B1YB 4LF4K 4M63C 1JLQA 4W5RA 1HYZA 3DRPA 4QS9A 1XI1A 2IOCA 1BI4A 2HNZA 2X6SA 5KTQA 1C0GA 1NGEA 1I3AA 4I2QA 3O3HA 1Q9XA 1C1CA 1JLGA 3ASMA 3P4IA 4CJPA 1QVGM 2UXCK 5HRSA 4DSEA 3AO3A 4PL8A 2ITGA 4O0JA 3NH0A 3UKUA 1C0UA 3KK3A 2NRWA 4N76A 4JK9A 3CERA 3QEVA 2QTDA 4O44A 5GIPA 1E4FT 1RDUA 1KRPA 4RW4A 3HJFA 4OPHA 3QO9A 5GAEP 1NM1A 2AJQA 1RBUA 5J1EA 4Q5VA 2PYLA 3AO4A 4BRQA 2O8BB 4DR4K 3IG1A 4DTXA 1XHXA 3CJ7A 2OZMA 3KWIA 1NGIA 2A1RA 3KWGA 3PUFA 1ZBIA 5EX5A 3QERA 4FWMA 5T7BA 1U6ZA 1TV6A 3VN5A 3ZSZA 1I94K 5ELZA 3C6AA 1G99A 3F9KA 3HPHA 2IC3A 3HPOA 2QWLA 4PKGA 2X6NA 4JI2K 4KHPK 2W6KA 1T6CA 1YIJN 2P9KB 1N33K 2JLEA 1W2BM 1KXPA 3RMDA 1HJOA 1OKJA 4MLHA 4B8CA 4FK2A 4O8UA 3NDKA 1K9MO 4JKHA 3RMBA 3OYHA 5BR9A 2ZWHA 3ZX0A 1UA0A 2QKBA 5BREA 4FW1A 5MLCQ 4DSIA 1UOCA 3VETA 3AGRA 3AV9A 1Q8IA 4BRMA 4DTPA 4O5BA 3RRHA 1OH5A 1S5JA 3T1HK 4CEEA 2OTLN 3CMAN 4GV9A 4B9LA 3HI0A 1RT5A 5BPLA 4F8RA 3QEIA 2G8KA 2O8CA 5EU7A 2ZD1A 4CW7B 3O4QA 1EWQA 2IVNA 3BY5A 3VESA 4IJAA 2HF4A 4LSLA 3L0QA 3MN5A 4LFBK 3FZMA 4CFAA 1TKXA 4B1UB 1S1VA 1HQUA 3C6HA 4FSVA 4ZTJA 3OYAA 4CJKA 2KZZA 4XEIA 3L2UA 4Z4FA 4CZMA 3HVRA 4FJHA 1JLCA 3BZCA 4WQ5A 1YI2N 1NJIO 5JVGL 5AQRA 1CZ9A 1YJNN 4J2AA 3BF1A 1U49A 4ZHRA 2O8DB 1TYQB 1K73O 3VF2A 4M45A 2XY8A 4BRFA 2ZJQL 1XUPO 4CF9A 1VQKN 3ID6A 4JHDB 1YJ9N 5LMUK 4DV0K 5KRSA 5HOOA 1Z26A 1U4BA 1NMNA 4MDBA 3RSEA 5C25A 5GAGP 3QMLA 4BWMA 2XRIA 4ID1A 4F3TA 4WCEL 5DK5A 2P9UA 3IS9A 1O1WA 2FF6A 3ULDA 2KKZA 3HRGA 3OYKA 2F9TA 3NGZA 4KRFA 3C94A 1NGDA 1BCMA 3TI0A 3AO1A 1JLFA 3R6MA 3G25A 4JS5A 4LFAK 3AA4A 3SUNA 1D5AA 4DSLA 4KB0A 3HP9A 3OHRA 5AFUA 4CGDA 1M90O 3W3DA 1V4TA 4JI3K 4KHNA 3TARA 2ZGYA 3MWTA 4B1VA 4CHZA 1S72N 1D9DA 4FWLA 2HMPA 3MCAB 3OYDA 4CK1A 4QCLA 2RPIA 4BREA 4BE1A 1GLEG 4FJ9A 4NO7A 5FRNA 1HUXA 3BF3A 3TAMA 3ZEUA 3I8DA 4JAXA 3VERA 2QWOA 3T1YK 1YITN 5SZTA 5AQNA 1QSLA 2O8FA 3ITHA 4H0YB 4QOZB 3MN6A 3S3NA 4KTZA 3DLEA 4KHQA 1KD1O 2E1YA 3R1XA 3TABA 3R8EA 1Q18A 2Q1NA 2WC9A 1N6QA 3UKUB 3ZSWA 4CJ5A 1X9SA 3RWUA 4H4MA 2VYPA 3CPWM 4F2RA 4E89A 1SZ2A 3F2KA 5A2QO 3MXMA 3KD5E 3B8AX 4F9OA 1OH6A 4U67L 2P9IA 1QSSA 4B9SA 2D0OA 3CJBA 3VQAA 1HPZA 1XNRK 4WF9L 4ILJA 5AQMA 1IBMK 4M41A 5AQZA 3WUHA 3LL3A 3TR8A 1G15A 1VQPN 1RDAA 1IKYA 2NZTA 4DFKA 4QS8A 2JWLA 3H1VX 3SAGA 1GLAG 1RCHA 4KH6A 1KAYA 2ATQA 1A5VA 3U9ZA 4CERA 5AQTA 4A62A 3ZT1A 5JS2A 1D4XA 1VSDA 3JAMO 3P5JA 3P38A 3EKSA 1BGXT 4AHUA 4K42A 3V9SA 4CZEA 3KHYA 4IOCL 5C2FA 2F96A 4CJVA 4B9NA 3FZHA 1VRUA 2D1KA 1JL1A 3VQ5A 3H6EA 3WXJA 1S9EA 4I2PA 3K5LA 4EIAA 1TUUA 2QWRA 2O4GA 4Y0WA 1NU0A 1RBSA 1JLEA 3MCPA 3THYA 4BR9A 1BHLA 3ATVA 3IKMA 1JL2A 3C65A 3O80A 4BDZA 4FLWA 3TTFA 1L3VA 3JSMA 4KPYA 2YI1A 4PKIA 3CQXA 2YNGA 2O8CB 4CZLA 4KH5A 3ZSQA 3I0RA 3MEEA 2EX3A 4YOYA 2HNYA 3NF7A 1ZXOA 2B6AA 4AM7A 4CD1A 4U7BA 3PX4A 3WNEA 4DLEA 2XHBA 5AQGA 1N34K 3MMVA 1NKBA 2VWBA 2X74A 3BGRA 3K9KA 3QNNA 4M3UA 2FC0A 2DPNA 4DFJA 3OS0A 3VQ7A 2AA4A 3U8XA 3SJJA 3VGKA 5FPDA 3EY1A 1X9MA 4DV5K 2G8HA 3GDQA 4V19S 3ZETA 2ITMA 4LD0A 4XIUA 3DLHA 1NK9A 3RR7A 3VF4A 2Q31A 1V4SA 4IEIA 4DHYA 2NUBA 4PL7A 4O4GA 2G8IA 1C0TA 3LAKA 4YOVA 2P5OA 4CIEA 4LF9K 3VMFB 3R3LA 4DFMA 1IO2A 3GL1A 4GY2B 3O08A 5HRPA 3PX0A 1T3VA 4NCAA 1WAFA 3QBWA 2YJFA 3PSFA 4WQ4A 1O13A 4FM0A 4JLHA 5C15A 2G8VA 5FPEA 3RSEB 5BRDA 1S22A 4ELTA 3HL8A 1L5UA 3MWPA 4DU3A 5KPTA 4FLYA 1YUWA 4B9MA 4IZ9A 5KI6A 3QETA 2PFUA 2RF2A 2P9UB 4BY9C 2E2OA 3EKUA 3O3GA 3OY9A 1KVCA 3C95A 3F5TA 2HVIA 5KGWA 3LDNA 5AQYA 3PO5A 3ENHA 4A5BA 3OW2M 4CESA 4CF2A 1WBBA 4JD2A 3KZBA 2V7YA 4AHCA 2IS3A 3KVGA 4FK0A 3SCXA 2F9WA 3SBTA 4DU1A 4BDYA 3CYMA 2GBZA 4A5AA 1RBVA 2IGIA 3ZSXA 5AZJA 1YTUA 3EZWA 2V51B 2B5JA 4ELVA 4JKAA 1KVAA 4CEQA 4DS5A 4OPAA 2PZSA 5AQOA 4AH9A 1NG9A 3AVFA 3T3FA 2DTUA 3NVMA 4DV2K 1X1PA 2P9SA 3O1WA 5HBMA 1J9AA 3ZEUB 1VK0A 3QLHA 3VEWA 4ISFA 4W5NA 1GOAA 2BTFA 4A2BA 1NGFA 3H08A 1UA1A 4JKBA 2HHSA 2O8FB 3JYTA 1WUAA 2P9LA 2A42A 3THWA 2WUSA 3FR0A 2YNIA 4GMJB 2HBJA 3M8QA 1JCEA 3I33A 4DG1A 1DKGD 4OKJA 4FJMA 3HK2A 3SQ4A 3C6TA 3HVTA 2FBTA 2P9PA 2HF3A 3SUPA 2XY7A 4FPAA 2YHAA 1R0AA 5J2NA 3I56N 2P9IB 4C8KA 3SQ2A 2HHVA 1TYQA 4N47A 2XO7A 1RDBA 1EETA 5LJWA 1UWBA 3D0PA 1TKTA 4CK2A 2FSNA 3AO2A 4JKFA 3RMCA 4BVOA 4CJ4A 3SLCA 3ID8A 3G10A 3C0BA 1BG3A 5CR4A 3CCLN 1S1UA 3K57A 3Q7CA 4JI0K 2BUPA 3DRSA 1C0FA 3M5RA 4DV3K 3TTDA 2O8EA 2E4LA 4B9VA 3EL2A 3HSTB 4JKGA 3QDKA 1NGAA 4BRAA 3N4PA 1NK0A 4E7JA 4A2AA 4BRIA 4CHQA 2D0CA 2FLOA 1VHXA 5JMVA 4GVEA 2G8UA 2UUBK 3UB5A 1W0HA 1WSJA 2YHWA 4GV3A 1ZYQA 4PWDA 3SNNA 4YFUA 2NRRA 2QWQA 4CK3A 3MN9A 3JS6A 2Q0RA 4I7FA 2YHBA 4JK7A 3THYB 4M3ZA 2NNWA 4H0PA 3THXA 3ULEA 2Q36A 2EWSA 1S1XA 1KAZA 3LWLA 4HVJA 1HNVA 1NLVA 4IFVA 3AVKA 3OJUA 4A59A 3J7ZO 3HOSA 4CGHA 1RT3A 3K2PA 1ASVA 4B8AB 1XHZA 4CECA 2DFEA 1KVBA 4YOXA 3SI6A 1SAZA 4WFBL 4B3RK 3O1BA 3EO3A 1ASUA 1VQ5N 4LFCK 2XY6A 3TAQA 4BGAA 3FLCO 1RT6A 2Z1HA 3MXJA 4WYBA 5IWAK 3LPUA 1KSPA 3HBTA 3CCRN 2XY5A 4CJFA 4E1NA 4FLUA 3FFKB 5I9EB 1HNZK 3CFPA 4BDPA 1X3NA 4I6MA 4ID5A 3VEZA 4KREA 1RNHA 4CFDA 3TAGA 3ZETB 1BUPA 4M3YA 5AQKA 1GLJO 2IVPA 3ZX3A 2F4VK 2E6MA 4FCYA 3PLAA 1NJYA 3QFUA 4CZHA 3V9ZA 3LZIA 5FPMA 4C8NA 3U3YA 3BEXA 4JKDA 3KLGA 4A61A 1QSYA 5AZIA 4RW7A 5LY3A 3NGYA 3OYBA 4DV7K 4I9QA 1KQSM 4BGBA 2I7NA 1VQMN 3SPYA 1HNXK 4AHVA 3GG4A 1S3XA 3K58A 3DAWA 4TSXA 4EP4A 4RWTA 3OYMA 4H8KA 3WXLA 1WSEA 3OTOK 5C10A 1QS4A 4IDHA 1GLCG 4DLGA 3OYGA 4AHRA 1U45A 1NGJA 1BU6O 1L3SA 4G9ZA 3CCEN 2HBLA 4JD2B 2J4RA 5KQDA 4IFEA 3L3VA 1QQNA 5AZJB 1RDWX 4H0OA 3S41A 3O3FA 1JKHA 3WT0A 4X65K 1DTQA 4NCGA 1JLAA 4CGGA 5B8HA 1HMVA 3VA3A 1XMQK 3DLBA 1U48A 4KHYA 3KKRA 1ATNA 4YHHK 4CGIA 5LL6Z 5M1NA 1GLLO 5DM7L 2P9SB 2RKIA 4DV6K 4E7LA 3CC7N 4FZZA 5EOYA 4H0XB 3S9HA 2VGMA 3LP2A 3SMSA 3TPQA 4DR6K 5C24A 4DF8A 3M1FA 4Z0UA 3MDQA 1WB9A 3CJ1A 2P9LB 4FJKA 3THWB 1LAWA 3LM9A 2IIRA 4BWJA 4I9LA 4FJNA 1XC9A 2P5GA 4EHTA 4K25A 3QB0A 3RR8A 1EWRA 3VENA 1GLFO 5M1FA 3V1QA 1Z6RA 3RRGA 1TUYA 2ASMA 2P9PB 3AGKA 3AVNA 4JKEA 3VQCA 4EZ9A 1VAZA 4MDAA 5HRRA 3SPZA 2NRHA 3P1GA 3E1YA 2E20A 3KIOA 3SMPA 4CJRA 3H45C 3LZJA 1BIUA 2BH1A 5JVHL 1VSIA 5D3GA 4FLXA 2GUPA 5HLFA 4FJ7A 3O9UA 3LDQA 4FWOA 4DUYK 4BR0A 3K5MA 2O8EB 1TK5A 5ADXA 4JKGB 3VEVA 3KD1E 3T69A 4M7YA 1FXXA 1W7AA 1JXBA 3E9OA 2YHXA 4E3SA 2IDOA 1L3UA 4RW8A 3SBGA 4DF4A 3E01A 1NGHA 3CCQN 5GIOA 3DXMA 3C6UA 2F8SA 4FM1A 2HBMA 3CQYA 3PX6A 3J7YP 1LOTB 1I39A 1BIZA 1VRTA 3A0IX 1JLBA 4EAHD 2E8AA 3CJCA 1JXEA 3SV3A 1IBKK 1C6VA 1BL3A 4C23A 1SUQA 1IBLK 4ISGA 3R9PA 3ULEB 4PQUA 1TL3A 1LWEA 4DQQA 3L8BA 1W97L 4N41A 4F4KA 3WQTA 4KI4A 2NRXA 1C1AA 1MWMA 3VQ4A 4CJQA 5LJVA 4DSKA 3J7AP 2A6AA 2Z1JA 4OGEA 4RCHA 1DGKN 3L3UA 4CFCA 4ILHA 1IV0A 3SYZA 2G8WA 2QW9A 3AVAA 2GX9A 3DLKA 3WXIA 2HMIA 3WEEA 5TKYA 4IXCA 1IG8A 1RTDA 5I3UA 1LAVA 2HBKA 4BR4A 1K6YA 1U47A 3AAQA 3ZX2A 3LALA 4O55A 4I6MB 4XH5A 4BRGA 3HT3A 5BRHA 3OYCA 3DWLA 4RW9A 3UE5A 2QWMA 5JICA 1QZ6A 4CZKA 2KLAA 4H5VA 3UKRA 4R79A 4DB3A 4B3OA 4DR5K 1N32K 1ILYA 4DQSA 4GKKK 1Z05A 3EE9A 4BR2A 3RVCA 5AZIB 1SKRA 3D2FA 1N5YA 3HSCA 5BR8K 4JKCA 4AHSA 4KBOA 3M3ZA 4KHWA 1YXQA 4JI1K 2YKNA 5BRFA 5AQHA 5I42A 3CF5L 2Y1JA 4YNQA 2VG7A 3MECA 4DU4A 2Q97A 2OCEA 3NVKA 5AJ3K 2FBVA 3EEQA 2DFFA 4DV1K 3H3NO 1ATSA 4FWNA 4RTFD 3THVA 2HHUA 1NK4A 3VQ8A 4HHTA 4B1ZA 5J2MA 3O6WA 4FWPA 2QK9A 1HKCA 4CEBA 4LH5A 4HTLA 3IMXA 2P9NA 3OYFA 4CJEA 4AQYK 1J5EK 3S3OA 2HVHA 2A3ZA 1SV5A 4OJRA 2ASOA 3FZLA 4FM2A 3AVBA 5C42A 2Q3SA 3FZFA 5E84A 3VPZA 1X9JA 4DKWA 4JK8A 4GV6A 4IOAL 4CIFA 4B9TA 1HR0K 3QEWA 4J2BA 3TAPA 2ETJA 2OPQA 3QIPA 2ZJPL 4H4OA 2GTDA 4HCCA 3DYAA 4CJSA 3O4NA 4W5TA 5M1PA 1L3TA 2VG6A 4B3MK 4B08A 3NH1A 4PA1A 3EN9A 3BP8A 4FWQA 1J53A 3LAMA 4H0VB 1FKPA 3A2FA 4BR5A 3GBTA 2CGJA 4KFBA 4N5SA 4BACA 4YDUA 4DQIA 1NK5A 4OLAA 4BG9A 1E3MA 3CHWA 1XC3A 1SS6A 4OKKA 4YY3K 1NBWA 1OVYA 4K8XA 3QINA 3ZT3A 3U6FA 3AVCA 1KLNA 1KLMA 3CMEN 5CY4A 1XMOK 1BWFO 2YV0X 2KQ2A 3CJAA 1NGGA 3PSIA 4ISEA 3AAPA 1TGOA 1EXQA 1QTMA 4FOEA 4C8LA 4FPBA 4K43A 3NGIA 4KB1A 3Q7BA 4J8FA 4WQ5C 3KJVA 3NFAA 1YJWN 5HP1A 4FJ5A 3FFIA 4UQGA 1GLDG 2Q2RA 3D6RA 4WE1A 3WXKA 3LWMA 3HXMA 1T44A 3OS2A 1VQON 1NOZA 3H46O 3L2VA 4BRCA 4FJXA 1J6ZA 3TSUA 3VQDA 3DXMB 2OPRA 2G8FA 3MX5A 3WXMB 4H5TA 1WSGA 3LM2A 4NB4A 4CEDA 1HPMA 2JWKA 3B6OA 4B1WB 3N4QA 4NYNA 2HHTA 2D0PA 4X66K 3ZT2A 3HP6A 2YX6A 3H1QA 1M1KO 4DTOA 5C12A 5AR0A 1FKOA 3NF8A 3SUQA 4IKFA 3CXCM 2A5XA 3VF6A 3P39A 4M42A 3CD6N 1BISA 2UYTA 1T7PA 4FJ8A 3DLRA 5AFUH 3O9QA 2FBYA 3M8SA 3O4WA 3O9RA 3K5NA 2F7TA 4O0IA 1NKEA 1HX1A 4MO4A 4MFBA 3CCSN 1OH8A 1P90A 4DMNA 1ITGA 1RT4A 4CBXA 1SL2A 1BQMA 3M6GA 1QVFM 1ZBSA 5FDLA 3WEEB 3DLGA 4DTMA 1SKWA 4KAZA 4CJ3A 4OLBA 3C7NA 3VQQA 3IFRA 1EKEA 5JLFA 1IKXA 1CZBA 3MK6A 1QHTA 4FWRA 1DT9A 4Z4HA 2I7PA 1SL0A 2VGNA 3AARA 2BGGA 5AQUA 2VG5A 5BN9A 4BRHA 3L2RA 3K0SA 3MAQA 2RHKA 2QM1A 5CZ1A 1F21A 4KH4A 2NRTA 3UKRB 4HUGA 1WAJA 2PYJA 3A5MC 5KPRA 1RILA 3RMAA 5F0XA 5F2RA 1BA1A 3V6DA 1IH7A 1D8YA 4HWIA 1FW6A 4OKEA 1DLOA 3D2FB 2FXUA 3MN7A 3OS1A 1Q82O 4DUZK 3V9XA 2QXLA 3IUCA 3T19A 3ZT4A 4N56A 1QQOA 1OH7A 3WQUA 3GE1A 1IKWA 3OBWA 1QHAA 2JGUA 3VQEA 3TU5A 2YNFA 5HROA 3QEXA 1ZC6A 3AVHA 4JRQA 1ESVA 1VQ6N 1WLJA 2V7ZA 2HSTA 1T03A 3J8AA 2P9NB 2PY5A 4HUEA 4CBWA 4CF0A 1RT2A 1Q86O 4CEZA 1ZBFA 4H0TB 4JI7K 4CI6A 2GV9A 3D7EO 1KCFA 4DQPA 3LDLA 2O4IA 4B3SK 5KGXA 5DM6L 1QE1A 4J2EA 1IKVA 1S6QA 2OANA 1JCFA 1XQSC 4Z4IA 4CHOA 4W5QA 1HRHA 3DMJA 4BC4A 1B9DA 3LP3A 2KZMA 4M3RA 2QKKA 3AY9A 1GLBG 4IEEA 3DXKB 3I8BA 3GOIA 3O9TA 4AHTA 3L2QA 2R7YA 5J2PA 2GEMA 4FW2A 4LSNA 2ZGZA 5AQXA 4CJUA 3NBPA 1TKZA 4CZIA 4CCHA 3G4SN 4XH1A 1P8ZA 4CHNA 1S1WA 3CG7A 4CIGA 1QZ5A 1BCOA 4BROA 3PIPL 1U2VA 2HW3A 3W0LA 2E1ZA 1BDGA 4EZ6A 4BQZA 2ZE2A 3HOTA 3CFOA 1VSKA 2WTUA 4IG3A 4X64K 1XNQK 1EO1A 4MLEA 2IVOA 1SQKA 3OBYA 1HLUA 4DR7K 1K8KA 5AQWA 3QBXA 2YCHA 4LF7K 1DTTA 1CZAN 3PO4A 1CXUA 3VTIA 3VQ6A 2VCPA 3VOVA 4JS4A 4ELUA 2F8TA 5FROA 1WOQA 4W5OA 3CPEA 3TTCA 3KKSA 5E26A 3DOKA 3KTQA 3VTHA 3AVMA 4BRPA 2W6LA 3SAHA 5DMRA 4C1NI 2UXDK 1R59O 4CF8A 4JNEA 5EY4A 4DSFA 1N8RO 1MA9B 1TKDA 4YDUC 3K9JA 2P1JA 3CQ8A 1Y97A 5CYQA 3O8MA 4E1MA 1RBTA 4EP5A 4PHTX 3UIQA 3AVGA 1NNEA 4LH4A 4CE9A 1MDUB 4BE0A 4DR2K 4YOTA 3V1OA 3A5OC 3LP0A 1C1BA 4WQ4C 5JLHA 1HYSA 4BR7A 1XWLA 4FOIA 1BQNA 2KTQA 3BUZB 1KAXA 4YORA 5AQSA 3D2EA 3PIOL 4FJLA 1FK9A 5AQPA 5CYMA 4CJ7A 4CJLA 4M3XA 2D0AA 4IBNA 3CCMN 1OVQA 5GINA 4FJGA 4DQ8A 5EXWA 4Z94A 3SK3A 4H5WA 4UY8O 3SQ1A 3WNHA 1S1TA 3HM8A 1YAGA 4K41A 3FZKA 3I55N 4IDKA 4C8OA 4OPKA 4CEAA 1E4GT 3OYNA 4E19A 1WNSA 4Z4CA 2YHYA 4IG0A 1VQ9N 1MWKA 1BA0A 4KV8A 4FWSA 3H3OB 3F73A 2GELA 3OA9A 3V81A 4IO8A 4CJTA 1WBDA 3QEPA 3C7NB 3M8PA 2VWKA 1SKSA 3QESA 3SZ2A 4CJWA 5AQQA 3OYJA 1RBRA 4H5NA 4CZJA 2OTJN 5C2DA 3IRXA 3WNGA 1YTAA 3ZCMA 3V9WA 3KK7A 1Z25A 2DFHA 1RFQA 2YJEA 4CGFA 1NJWA 4M7XA 2OYQA 4IO9L 5M1OA 4KTWA 3MEDA 5AQJA 1RTHA 4AILC 4CEFA 4BC5A 3CCUN 4HTUA 4E7KA 3E9LA 5CHIA 4E0DA 3ZSYA 4OO1J 4OGCA 1HNWK 2QWNA 1JCGA 1T05A 1LCUA 1LWCA 4DCHA 3NF9A 3QICA 3DLLL 4NXMK 3NHGA 3T1AA 4IFYA 1RGIA 3LANA 4FWKA 1HKBA 4IOXA 3ENBA 4C8MA 5TKWA 2NLXA 4KI6A 4FVMA 2HHHK 1VSEA 3CM5A 2HHQA 4E1JA 3LDSA 1BO5O 4H03B 1NK8A 4R5PA 4JN4A 4BRLA 4NLBA 4AF1A 5K14A 3A5LC 4NYFA 4BVPA 2YKMA 4CBUA 3THXB 4DV4K 3K5OA 1EP4A 4GVMA 3E9PA 3OYIA 3CC4N 2E6LA 4JI5K 5AQLA 4DTRA 1WSHA 2D5RA 4CHYA 4MQ3A 4LY7A 1H1VA 2W41A 4YOUA 4PKHA 2E2NA 3SJHA 3VQ9A 3T7ZA 3ENOA 4JI6K 1HJRA 2ASPA 1S9GA 3JXUA 2NRVA 5HL7L 3U9DA 1BI4B 3PV8A 4F2SA 3HPGA 1U2VB 3DI6A 4DFPA 3TSQA 3CCVN 4O5FA 1TVRA 4BRNA 1J5OA 3IAYA 3U3GA 1NGBA 1TK8A 3ZT0A 5M1QA 1VSLA 1J54A 3ALYA 1KFSA 2P51A 3NF6A 4O8KA 2PBDA 1K8KB 4OVLA 4BC2A 3LDOA 3MXIA 4QAGA 3VQPA 3SUOA 1DEJA 3AA2A 5GADP 3ZYYX 3WNFA 2YNHA 2D4WA 5FPNA 1YHQN 4B9QA 4FXDA 1UAXA 3NAEA 1IJJA 4H5RA 4KKOA 2UXBK 5LMNK 4DSJA 1ZBUA 4JI8K 2V52B 4CHPA 4IJNA 4ZTFA 2RE2A 2EHGA 4EHUA 3HZ6A 4CF1A 3NH2A 2UUAK 1NK6A 1IG9A 4NLCA 4BE2A 4DWIA 2HNDA 1YVNA 3L4QA 4MO5A 3EYZA 3TANA 4NXNK 2FBXA 2QI2A 4NCBA 2HHWA 5AQFA 4A57A 1NWKA 4M3TA 2AP1A 2B4JA 3QIOA 4DR1K 3G71N 4GKJK 1RTIA 5IT9O 1VQ8N 3CI5A 4L3QA 3SAFA 4HCBA 1REVA 3BDPA 4JEPA 2QEXN 4OPJA 4K8ZA 3A5NC 1KFDA 3RTVA 5BN8A 3ZSRA 3IDHA 2OA8A 3D2EB 3DOLA 2CH6A 5CZ2A 3DM2A 1WN7A 4LF8K 4DQRA 1GOBA 1NMDA 4GW6A 1RTJA 4PUOA 1Q7YO 2GWJA 1HQEA 2I5JA 2KW4A 1X3MA 1NJXA 4OX9K 2UUCK 3DXKA 4CZGA 4B9UA 2RN2A 4CGJA 3HM9A 1ASWA 2HB5A 1ZBHA 2FSJA 3M8RA 1LWFA 3VEOA 1X9WA 3VEYA 5SWMA 4Y1CA 3OYLA 3VEXA 4Z4GA 1LW2A 4WFNL 3VQBA 5J2QA 3CIPA 2UU9K 4KHSA 1VSFA 4Q0BA 1TL1A 2ZQBA 3AVIA 1ATRA 1EX4A 1YVUA 2WFBA 4CEOA 3KLHA 2GUIA 2OPSA 3ATUA 3QFPA 3AA3A 3KK1A 4QS7A 5F1XA 5EVZA 1KC8O 4CVNE 4FZXC 5BPNA 1TAQA 1LW0A 3P31A 4BRKA 3SQ0A 1GOCA 4FK4A 2E2PA 2KFZA 1HKGA 4G1QA 4JI4K 3L6QA 4Y1DA 1Q81O 4DR3K 1S6PA 3DJCA 2ZJRL 2BDPA 1WSFA 3L2WA 2O8BA 3TAFA 3ZLJA 1A5XA 4B1XB 2HOEA 5KRTA 4FJJA 3NMUA 3KLIA 3F9MA 3CETA 5H1SQ 3CCJN 4B3TK 3ZSVA 5KPZA 3FGUA 4LC9B 4ICLA 4X62K 4LF5K 4E7IA 1TAUA 3MX2A 2H3GX 4DTJA 4LF6K 2WONA 3AVJA 4C1NK 4BC3A 3VGLA 1RT1A 3EE8A 4BQLA 1RT7A 3SV4A 2ZF5O 1T6DA 2WBNA 3TSPA 3QNOA 4CZFA 4JV5K 3P83D 2Q0UA 2BE2A 4FLTA 2P9KA 3O9SA 4GNIA 4FZYA 2PAVA 1ZBLA 2W40A 3HYFA 3DRRA 1RDCA 3VGMA 1NGCA 4F3OA 5AQIA 5ADXH 5C0YA 1N36K 4FL9A 5AQVA 4E7HA 4DTSA 1VQLN 2KHOA 1CXQA 3AO5A 2W42A 5HRNA 4FLVA 3V1RA 3KLFA 5FLXO 4KO0A 1HNIA 4M3WA 3OJSA 4KTQA 3A8YA 4DTNA 2Y1IA 1Q9YA 3U4LA 3G6EN 3S3MA 3OYEA 2A41A 2D0BA 3D45A 1B9FA 4L8RB 1NJZA 1VSHA 3EZ5A 4HUFA 4XH4A 3L4IA 4BG8A 4YOWA 3K59A 4EFHA 2E88A 2VQEK 2DY4A 4ILGB 3CM6A 1VSJA 3LP1A 1VSMA 2CGLA 4FJIA 3E66A 3V9UA 2VWJA 4FYDA 1JJ2M 4AM6A 1EQYA 1K8AO 1VQ4N 3CJ9A 4FLZA 3MEGA 4RG8A 4BRDA 4PY5A 2Z1GA 3B6PA 3VA0A 2E2QA 3ZSOA 4JYAK 4DTUA 1NOYA 1TK0A 2FF3B 1CLQA 4JRPA 2VQFK 2E5LK 1T8EA 4Z4EA 3LDPA 3I0SA 2NRZA 4WFAL 2GWKA 2A40A 2WOMA 2CGKA 1QQMA 3J80O 3HO1A 2CH5A 1Y64A 4CD3A 5CE3A 2BANA 2O8DA 2QXFA 1LV5A 2IAJA 2QA4N 2OZSA 1RDDA 4FVUA 2LSNA 1U04A 1VQ7N 3PY8A 4CFBA 3KK2A 4JHDA 5BPMA 3NE6A 1FJGK 3FE1A 4K0KK 1YF5L 4J2DA 1NK7A 2HHXA 3V4IA 5FRMA 4KHUA 1BOTO 1W9HA 2Z1IA 1C0MA 1HYVA 3OVNA 1D9FA 1MU2A 1QQCA 4DS4A 4RW6A 2OPPA 5JS1A 3ISNC 3AA5X 3O5BA 3HTVA 3NCIA 3CFRA 2X78A 2QWPA 3CC2N 3KLEA
chains in the Genus database with same CATH topology
1E4GT 5BRHA 5C15A 3DWLA 2FSKA 5FPEA 3RSEB 5BRDA 5KQ8A 1S22A 5GAHP 2YHYA 1VQ9N 3UE5A 1MWKA 1BA0A 3MWPA 2QWMA 5JICA 5KPTA 4FWSA 1QZ6A 4CZKA 3H3OB 2GELA 1YUWA 3OA9A 4FL9A 4IZ9A 2KLAA 4H5VA 4IO8A 2PFUA 3UKRA 4DB3A 4R79A 2P9UB 4FO0A 4BY9C 4IWVA 2E2OA 1ILYA 3C7NB 5M1KA 3EKUA 1VQNN 3F5TA 1Z05A 4B1YB 3EE9A 4BR2A 4M63C 3RVCA 5AZIB 3LDNA 4QS9A 5AQYA 3D2FA 3ENHA 5AQQA 4CZJA 4H5NA 4A5BA 3OW2M 3HSCA 4JKCA 2OTJN 5C2DA 4JD2A 4KBOA 1C0GA 3KZBA 2V7YA 3M3ZA 3KVGA 1YXQA 3KK7A 1NGEA 2F9WA 3SBTA 1RFQA 2YJEA 5BRFA 5AQHA 3CF5L 4A5AA 5AZJA 4M7XA 2Q97A 3EZWA 3NVKA 4IO9L 5M1OA 2V51B 3P4IA 1QVGM 5AQJA 3H3NO 1ATSA 4JKAA 4FWNA 4OPAA 4RTFD 4BC5A 4PL8A 3CCUN 5AQOA 4B1ZA 3O6WA 4FWPA 1HKCA 3UKUA 3E9LA 4HTLA 5CHIA 2NRWA 3IMXA 3NVMA 2P9NA 4OO1J 4JK9A 2QWNA 1JCGA 2P9SA 3CERA 3O1WA 2QTDA 1LCUA 2A3ZA 5GIPA 3ZEUB 2ASOA 3VEWA 1E4FT 3FZLA 4ISFA 2BTFA 4A2BA 1NGFA 4DCHA 1RDUA 3FZFA 5E84A 4JKBA 1X9JA 3QICA 3VPZA 4DKWA 3DLLL 4OPHA 4JK8A 4GV6A 5GAEP 1WUAA 2P9LA 1NM1A 4IOAL 2A42A 2WUSA 3FR0A 1RGIA 2HBJA 1HKBA 4FWKA 4IOXA 3ENBA 4BRQA 5TKWA 2NLXA 1JCEA 3I33A 3CJ7A 4E1JA 2ZJPL 3KWIA 2GTDA 1BO5O 1DKGD 1NGIA 4H03B 4JN4A 4BRLA 3KWGA 5M1PA 4NLBA 4AF1A 5EX5A 2P9PA 3A5LC 2HF3A 4FWMA 4BVPA 4FPAA 1U6ZA 4CBUA 3I56N 5ELZA 2P9IB 3C6AA 1G99A 1TYQA 3EN9A 3E9PA 3BP8A 4FWQA 2QWLA 3CC4N 4PKGA 5LJWA 1T6CA 2FSNA 5AQLA 1YIJN 2P9KB 4H0VB 1H1VA 2W41A 4JKFA 4BVOA 1W2BM 1KXPA 4YOUA 3SLCA 4BR5A 4PKHA 2E2NA 3GBTA 1HJOA 2CGJA 1OKJA 3ID8A 4MLHA 3SJHA 3C0BA 1BG3A 4YDUA 5CR4A 3T7ZA 3ENOA 3CCLN 3Q7CA 4BG9A 3CHWA 1XC3A 1SS6A 4O8UA 2ASPA 2BUPA 1K9MO 4JKHA 1C0FA 1NBWA 3JXUA 3M5RA 1OVYA 5BR9A 2NRVA 3TTDA 2ZWHA 3ZX0A 3U9DA 5HL7L 3EL2A 5BREA 3CMEN 4JKGA 3QDKA 5MLCQ 1NGAA 4BRAA 1BWFO 3N4PA 1U2VB 3VETA 3AGRA 4BRMA 3CJAA 1NGGA 4A2AA 4BRIA 4ISEA 3TSQA 3CCVN 4O5FA 3AAPA 4BRNA 2FLOA 4FOEA 2OTLN 4GV9A 3CMAN 5JMVA 4GVEA 4FPBA 4K43A 1NGBA 3Q7BA 3HI0A 3UB5A 5M1QA 5BPLA 4J8FA 2YHWA 4GV3A 4O8KA 4WQ5C 2PBDA 1K8KB 4BC2A 3LDOA 1YJWN 2NRRA 2QWQA 3MN9A 3JS6A 1DEJA 1GLDG 2Q0RA 2Q2RA 5GADP 3ZYYX 3D6RA 5FPNA 2D4WA 1YHQN 2IVNA 4B9QA 3VESA 4JK7A 4IJAA 2HF4A 1IJJA 2NNWA 3WXKA 4H5RA 1T44A 3L0QA 4H0PA 3MN5A 1VQON 3H46O 2Q36A 3ULEA 2EWSA 2V52B 4IJNA 4BRCA 1J6ZA 3FZMA 1KAZA 3TSUA 2RE2A 4B1UB 1NLVA 3C6HA 3HZ6A 4EHUA 3DXMB 4FSVA 4A59A 3MX5A 3J7ZO 3HOSA 3WXMB 4NLCA 4XEIA 4H5TA 3LM2A 4NB4A 4YOXA 1YVNA 3L4QA 1SAZA 4MO5A 4CZMA 1HPMA 4WFBL 2JWKA 3O1BA 4B1WB 3EO3A 3N4QA 4WQ5A 1YI2N 2D0PA 2QI2A 1NJIO 1VQ5N 5JVGL 2YX6A 5AQFA 5AQRA 3H1QA 4A57A 1NWKA 1YJNN 2AP1A 3BF1A 4BGAA 3FLCO 1M1KO 4WYBA 3G71N 1TYQB 5C12A 3VF2A 5AR0A 1K73O 3CI5A 1VQ8N 4L3QA 3SAFA 4BRFA 3HBTA 2ZJQL 3CCRN 1XUPO 3CXCM 4JEPA 2A5XA 2QEXN 3FFKB 5I9EB 1VQKN 3VF6A 3P39A 3A5NC 5BN8A 3CD6N 1X3NA 2UYTA 3ID6A 4I6MA 4JHDB 3IDHA 1YJ9N 5AFUH 3VEZA 3O9QA 3D2EB 3O4WA 3O9RA 5HOOA 3ZETB 1BUPA 2CH6A 2F7TA 4MDBA 3RSEA 1HX1A 1GLJO 4MO4A 5AQKA 2IVPA 5GAGP 1NMDA 3QMLA 3ZX3A 3CCSN 1Q7YO 1P90A 3PLAA 2GWJA 4CBXA 3M6GA 1QVFM 1ZBSA 3QFUA 4CZHA 3WEEB 1X3MA 4WCEL 2P9UA 5FPMA 3BEXA 3C7NA 2FF6A 3IFRA 4JKDA 3DXKA 2KKZA 4CZGA 5JLFA 4WQ4A 3HRGA 3MK6A 4FWRA 4A61A 1DT9A 2F9TA 5AZIA 5LY3A 2FSJA 2I7PA 1NGDA 1KQSM 2VGNA 3R6MA 4BGBA 2I7NA 3G25A 3VEOA 3AARA 1VQMN 5AQUA 3VEYA 5BN9A 4BRHA 3VEXA 3GG4A 1S3XA 2QM1A 2RHKA 3OHRA 5AFUA 4WFNL 3DAWA 4KH4A 1M90O 4RWTA 2NRTA 3W3DA 1V4TA 3CIPA 3UKRB 3A5MC 3WXLA 5KPRA 2ZGYA 3MWTA 4B1VA 5F0XA 5F2RA 5C10A 1BA1A 4IDHA 1GLCG 1S72N 4HWIA 1ATRA 2WFBA 4FWLA 1NGJA 1BU6O 4G9ZA 2HMPA 3D2FB 2FXUA 3MN7A 3ATUA 3MCAB 1Q82O 3CCEN 3QFPA 2HBLA 2QXLA 4BREA 4JD2B 3IUCA 1GLEG 4QS7A 1QQOA 4NO7A 2J4RA 1HUXA 3WQUA 3BF3A 5EVZA 5F1XA 5KQDA 3GE1A 4IFEA 5BPNA 1KC8O 3ZEUA 3OBWA 1QHAA 3P31A 4JAXA 2QWOA 3VERA 1QQNA 5AZJB 4BRKA 1YITN 1RDWX 4H0OA 3S41A 3TU5A 3WT0A 5AQNA 2E2PA 4H0YB 1ZC6A 3MN6A 1HKGA 5B8HA 3L6QA 1Q81O 1ESVA 1KD1O 1VQ6N 2E1YA 2V7ZA 3DJCA 3R1XA 2ZJRL 3R8EA 1Q18A 2Q1NA 2WC9A 1ATNA 3UKUB 2HSTA 4B1XB 2HOEA 3NMUA 3J8AA 2P9NB 3F9MA 2VYPA 5M1NA 3CETA 1GLLO 5H1SQ 4CBWA 5DM7L 2P9SB 3CPWM 3CCJN 1SZ2A 3F2KA 3CC7N 5KPZA 3FGUA 4LC9B 1Q86O 5EOYA 4H0XB 2VGMA 3MX2A 4H0TB 3B8AX 3SMSA 3TPQA 4CI6A 2H3GX 3M1FA 4F9OA 3MDQA 4C1NK 3D7EO 2P9IA 4U67L 3LDLA 4BC3A 2D0OA 3CJ1A 3CJBA 3VGLA 3EE8A 5DM6L 4WF9L 4ILJA 4BQLA 2P9LB 5AQMA 2ZF5O 1T6DA 2WBNA 3TSPA 5AQZA 3WUHA 4CZFA 2OANA 1JCFA 3LM9A 1XQSC 3LL3A 2Q0UA 2IIRA 2P9KA 3O9SA 4GNIA 2PAVA 4EHTA 2W40A 4K25A 3QB0A 4BC4A 1VQPN 3VGMA 3VENA 1GLFO 1NGCA 2NZTA 5M1FA 1Z6RA 5AQIA 5ADXH 5C0YA 3AY9A 1GLBG 4IEEA 3DXKB 3I8BA 3GOIA 3O9TA 1TUYA 2ASMA 2JWLA 2P9PB 2KHOA 3H1VX 2GEMA 3AGKA 4QS8A 2ZGZA 5AQXA 3SAGA 1VQLN 4CZIA 1GLAG 3G4SN 4KH6A 1KAYA 4XH1A 4JKEA 1P8ZA 3U9ZA 1VAZA 4MDAA 1QZ5A 5AQTA 2NRHA 4A62A 4BROA 1D4XA 3E1YA 3A8YA 2E20A 3PIPL 3SMPA 1U2VA 3W0LA 3P38A 3EKSA 2E1ZA 3U4LA 3G6EN 1BDGA 4K42A 3H45C 2A41A 4CZEA 3KHYA 4BQZA 4IOCL 2BH1A 3HOTA 5JVHL 5C2FA 3FZHA 2D1KA 2GUPA 4XH4A 3L4IA 4BG8A 3O9UA 4YOWA 3H6EA 2E88A 3LDQA 3WXJA 4EFHA 4ILGB 4MLEA 1EO1A 2IVOA 4FWOA 1SQKA 3OBYA 1HLUA 4BR0A 2CGLA 1K8KA 5AQWA 3QBXA 5ADXA 3E66A 4EIAA 2YCHA 1TUUA 4JKGB 3VEVA 2QWRA 1JJ2M 1CZAN 4Y0WA 3VTIA 4AM6A 2VCPA 3VOVA 3T69A 4M7YA 1WOQA 3MCPA 4BR9A 1EQYA 3CPEA 1K8AO 3E9OA 1VQ4N 3CJ9A 2YHXA 3ATVA 3TTCA 3IKMA 3O80A 3C65A 5E26A 4BRDA 3VTHA 3TTFA 3SBGA 4BRPA 3SAHA 4C1NI 2E2QA 1NGHA 1R59O 2YI1A 3CCQN 4JNEA 5EY4A 3DXMA 5GIOA 4PKIA 3CQXA 1N8RO 1MA9B 2HBMA 3CQYA 4YDUC 3K9JA 2FF3B 1LOTB 3A0IX 4CZLA 4KH5A 3LDPA 4EAHD 2E8AA 3CJCA 2NRZA 3O8MA 4WFAL 2GWKA 2A40A 4C23A 4YOYA 2CGKA 1QQMA 1ZXOA 4AM7A 4CD1A 2CH5A 4PHTX 4U7BA 1Y64A 4CD3A 5CE3A 5AQGA 4ISGA 3R9PA 3MMVA 2VWBA 3ULEB 5AQVA 1MDUB 2QA4N 3K9KA 1W97L 4YOTA 4FVUA 3A5OC 2DPNA 4WQ4C 1VQ7N 5JLHA 4BR7A 3WQTA 4FOIA 4JHDA 2AA4A 1MWMA 2NRXA 3U8XA 3BUZB 1KAXA 4YORA 5AQSA 3VGKA 5BPMA 5FPDA 5LJVA 3D2EA 3FE1A 3PIOL 3GDQA 1YF5L 3ZETA 2ITMA 5AQPA 2A6AA 4CJ7A 4RCHA 1DGKN 3CCMN 4ILHA 3VF4A 5GINA 4DQ8A 2Q31A 1V4SA 4IEIA 2QW9A 1BOTO 2GX9A 4DHYA 3WXIA 5EXWA 4PL7A 4Z94A 3WEEA 5TKYA 3SK3A 4H5WA 4IXCA 1IG8A 4UY8O 2HBKA 4BR4A 4YOVA 3AAQA 3HM8A 1YAGA 3ZX2A 4K41A 4I6MB 3O5BA 3HTVA 3R3LA 3VMFB 3FZKA 3GL1A 4GY2B 3O08A 4XH5A 3I55N 1T3VA 2YJFA 3QBWA 4BRGA 2QWPA 3CC2N 1O13A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E4G T;  5BRH A;  3DWL A;  2FSK A;  5FPE A;  3RSE B;  5BRD A;  5KQ8 A;  1S22 A;  2YHY A;  3UE5 A;  1MWK A;  1BA0 A;  2QWM A;  5JIC A;  5KPT A;  4FWS A;  1QZ6 A;  4CZK A;  3H3O B;  2GEL A;  1YUW A;  4IZ9 A;  4H5V A;  4IO8 A;  3UKR A;  4DB3 A;  2P9U B;  4FO0 A;  4IWV A;  2E2O A;  3C7N B;  3EKU A;  1Z05 A;  4B1Y B;  4BR2 A;  4M63 C;  5AZI B;  3LDN A;  4QS9 A;  5AQY A;  3D2F A;  3ENH A;  5AQQ A;  4CZJ A;  4H5N A;  3HSC A;  4JD2 A;  4KBO A;  1C0G A;  3KZB A;  2V7Y A;  3M3Z A;  3KVG A;  1YXQ A;  1NGE A;  2F9W A;  1RFQ A;  2YJE A;  5BRF A;  5AQH A;  5AZJ A;  4M7X A;  2Q97 A;  3EZW A;  2V51 B;  3P4I A;  5AQJ A;  3H3N O;  1ATS A;  4FWN A;  4RTF D;  4BC5 A;  4PL8 A;  5AQO A;  4B1Z A;  3O6W A;  4FWP A;  1HKC A;  3UKU A;  4HTL A;  3IMX A;  2P9N A;  2QWN A;  1JCG A;  2P9S A;  3CER A;  3O1W A;  1LCU A;  2A3Z A;  3ZEU B;  2ASO A;  3VEW A;  1E4F T;  3FZL A;  4ISF A;  2BTF A;  4A2B A;  1NGF A;  4DCH A;  3FZF A;  5E84 A;  3VPZ A;  1X9J A;  3QIC A;  1WUA A;  2P9L A;  1NM1 A;  2A42 A;  2WUS A;  3FR0 A;  1RGI A;  4FWK A;  1HKB A;  4BRQ A;  2NLX A;  1JCE A;  3I33 A;  3CJ7 A;  4E1J A;  2GTD A;  1BO5 O;  1DKG D;  1NGI A;  4H03 B;  4JN4 A;  4BRL A;  5EX5 A;  2P9P A;  3A5L C;  2HF3 A;  4FWM A;  4BVP A;  4FPA A;  1U6Z A;  4CBU A;  5ELZ A;  2P9I B;  1G99 A;  1TYQ A;  3EN9 A;  3BP8 A;  4FWQ A;  2QWL A;  4PKG A;  5LJW A;  1T6C A;  2FSN A;  5AQL A;  2P9K B;  4H0V B;  1H1V A;  2W41 A;  4BVO A;  1KXP A;  3SLC A;  4BR5 A;  4PKH A;  2E2N A;  3GBT A;  1HJO A;  2CGJ A;  1OKJ A;  3ID8 A;  4MLH A;  3SJH A;  3C0B A;  1BG3 A;  4YDU A;  3ENO A;  4BG9 A;  3CHW A;  1XC3 A;  2ASP A;  2BUP A;  1C0F A;  1NBW A;  3JXU A;  5BR9 A;  2ZWH A;  3ZX0 A;  3U9D A;  3EL2 A;  5BRE A;  3QDK A;  1NGA A;  4BRA A;  1BWF O;  1U2V B;  3VET A;  4BRM A;  3CJA A;  1NGG A;  4A2A A;  4BRI A;  4ISE A;  4O5F A;  3AAP A;  4BRN A;  2FLO A;  4FOE A;  5JMV A;  4FPB A;  4K43 A;  1NGB A;  3HI0 A;  3UB5 A;  5BPL A;  4J8F A;  2YHW A;  4O8K A;  4WQ5 C;  2PBD A;  1K8K B;  4BC2 A;  3LDO A;  2QWQ A;  3MN9 A;  3JS6 A;  1DEJ A;  1GLD G;  2Q0R A;  2Q2R A;  5FPN A;  2D4W A;  2IVN A;  4B9Q A;  3VES A;  4IJA A;  2HF4 A;  1IJJ A;  3WXK A;  4H5R A;  1T44 A;  3L0Q A;  4H0P A;  3MN5 A;  3H46 O;  2Q36 A;  3ULE A;  2EWS A;  2V52 B;  4IJN A;  4BRC A;  1J6Z A;  3FZM A;  1KAZ A;  4B1U B;  1NLV A;  3HZ6 A;  4EHU A;  3DXM B;  4FSV A;  4XEI A;  4H5T A;  3LM2 A;  4NB4 A;  1YVN A;  1SAZ A;  4MO5 A;  4CZM A;  1HPM A;  3O1B A;  4B1W B;  3EO3 A;  4WQ5 A;  2D0P A;  5AQF A;  5AQR A;  3H1Q A;  1NWK A;  2AP1 A;  3BF1 A;  4BGA A;  3FLC O;  4WYB A;  1TYQ B;  3VF2 A;  5AR0 A;  3CI5 A;  4L3Q A;  4BRF A;  3HBT A;  1XUP O;  2A5X A;  3FFK B;  5I9E B;  3VF6 A;  3A5N C;  5BN8 A;  1X3N A;  2UYT A;  4I6M A;  4JHD B;  3IDH A;  5AFU H;  3VEZ A;  3D2E B;  3O4W A;  3ZET B;  1BUP A;  2CH6 A;  3RSE A;  1HX1 A;  1GLJ O;  4MO4 A;  5AQK A;  2IVP A;  1NMD A;  3QML A;  3ZX3 A;  2GWJ A;  4CBX A;  3M6G A;  1ZBS A;  3QFU A;  4CZH A;  3WEE B;  1X3M A;  2P9U A;  5FPM A;  3BEX A;  3C7N A;  2FF6 A;  3IFR A;  3DXK A;  4CZG A;  5JLF A;  4WQ4 A;  3MK6 A;  4FWR A;  4A61 A;  2F9T A;  5AZI A;  5LY3 A;  2FSJ A;  2I7P A;  1NGD A;  3R6M A;  4BGB A;  2I7N A;  3G25 A;  3VEO A;  3AAR A;  5AQU A;  3VEY A;  5BN9 A;  4BRH A;  3VEX A;  3GG4 A;  1S3X A;  2QM1 A;  3OHR A;  5AFU A;  3DAW A;  4RWT A;  3W3D A;  1V4T A;  3CIP A;  3UKR B;  3A5M C;  3WXL A;  5KPR A;  2ZGY A;  4B1V A;  5F0X A;  5F2R A;  1BA1 A;  1GLC G;  4HWI A;  1ATR A;  4FWL A;  1NGJ A;  1BU6 O;  2HMP A;  3D2F B;  2FXU A;  3MN7 A;  3ATU A;  3QFP A;  2QXL A;  4BRE A;  4JD2 B;  3IUC A;  1GLE G;  4QS7 A;  1QQO A;  4NO7 A;  2J4R A;  1HUX A;  3WQU A;  3BF3 A;  5EVZ A;  5F1X A;  5KQD A;  3GE1 A;  5BPN A;  3ZEU A;  1QHA A;  4JAX A;  3VER A;  2QWO A;  1QQN A;  5AZJ B;  4BRK A;  1RDW X;  4H0O A;  3S41 A;  3TU5 A;  3WT0 A;  5AQN A;  2E2P A;  4H0Y B;  1ZC6 A;  3MN6 A;  1HKG A;  5B8H A;  3L6Q A;  1ESV A;  2E1Y A;  2V7Z A;  3DJC A;  3R8E A;  1Q18 A;  2Q1N A;  1ATN A;  3UKU B;  4B1X B;  2HOE A;  3J8A A;  2P9N B;  3F9M A;  2VYP A;  3CET A;  1GLL O;  4CBW A;  2P9S B;  1SZ2 A;  5KPZ A;  3FGU A;  4LC9 B;  5EOY A;  4H0X B;  3SMS A;  4H0T B;  3B8A X;  3TPQ A;  4CI6 A;  2H3G X;  3M1F A;  4F9O A;  3MDQ A;  3D7E O;  2P9I A;  3LDL A;  4BC3 A;  2D0O A;  3CJ1 A;  3CJB A;  3VGL A;  4BQL A;  2P9L B;  5AQM A;  2ZF5 O;  1T6D A;  5AQZ A;  3WUH A;  4CZF A;  2OAN A;  1JCF A;  3LM9 A;  1XQS C;  3LL3 A;  2Q0U A;  2IIR A;  2P9K A;  4GNI A;  2PAV A;  4EHT A;  2W40 A;  4K25 A;  3QB0 A;  4BC4 A;  3VGM A;  3VEN A;  1GLF O;  1NGC A;  2NZT A;  1Z6R A;  5AQI A;  5ADX H;  3AY9 A;  1GLB G;  3DXK B;  3I8B A;  3GOI A;  4FL9 A;  1TUY A;  2ASM A;  2P9P B;  3H1V X;  2KHO A;  4QS8 A;  2GEM A;  5AQV A;  5AQX A;  2ZGZ A;  4CZI A;  1GLA G;  1KAY A;  4XH1 A;  1P8Z A;  3U9Z A;  1QZ5 A;  5AQT A;  2NRH A;  4A62 A;  4BRO A;  1D4X A;  3A8Y A;  2E20 A;  3SMP A;  1U2V A;  3W0L A;  3EKS A;  2E1Z A;  3U4L A;  1BDG A;  4K42 A;  3H45 C;  2A41 A;  4CZE A;  3KHY A;  4BQZ A;  3FZH A;  2D1K A;  2GUP A;  4XH4 A;  3L4I A;  4BG8 A;  3H6E A;  2E88 A;  3LDQ A;  3WXJ A;  4EFH A;  4MLE A;  2IVO A;  4FWO A;  1SQK A;  1HLU A;  4BR0 A;  2CGL A;  1K8K A;  5AQW A;  3QBX A;  5ADX A;  4EIA A;  2YCH A;  1TUU A;  3VEV A;  2QWR A;  1CZA N;  4Y0W A;  4AM6 A;  2VCP A;  3VOV A;  4M7Y A;  1WOQ A;  3MCP A;  4BR9 A;  1EQY A;  3CJ9 A;  2YHX A;  3ATV A;  4BRD A;  3O80 A;  5E26 A;  4BRP A;  2E2Q A;  1NGH A;  1R59 O;  2YI1 A;  4JNE A;  5EY4 A;  3DXM A;  4PKI A;  3CQX A;  1MA9 B;  3CQY A;  4YDU C;  2FF3 B;  1LOT B;  3A0I X;  4CZL A;  4EAH D;  3LDP A;  2E8A A;  3CJC A;  3O8M A;  2GWK A;  2A40 A;  4C23 A;  2CGK A;  1QQM A;  1ZXO A;  4AM7 A;  4CD1 A;  2CH5 A;  1Y64 A;  4CD3 A;  5CE3 A;  5AQG A;  4ISG A;  3R9P A;  3MMV A;  2VWB A;  3ULE B;  1MDU B;  3A5O C;  2DPN A;  4WQ4 C;  5JLH A;  4BR7 A;  3WQT A;  4FOI A;  4JHD A;  2AA4 A;  1MWM A;  3U8X A;  3BUZ B;  1KAX A;  5AQS A;  3VGK A;  5BPM A;  5FPD A;  5LJV A;  3D2E A;  3FE1 A;  3GDQ A;  3ZET A;  2ITM A;  5AQP A;  2A6A A;  4CJ7 A;  4RCH A;  1DGK N;  3VF4 A;  4DQ8 A;  2Q31 A;  1V4S A;  2QW9 A;  1BOT O;  4DHY A;  3WXI A;  5EXW A;  4PL7 A;  4Z94 A;  3WEE A;  5TKY A;  3SK3 A;  4H5W A;  4IXC A;  1IG8 A;  4BR4 A;  3AAQ A;  3HM8 A;  1YAG A;  3ZX2 A;  4K41 A;  4I6M B;  3O5B A;  3HTV A;  3FZK A;  3GL1 A;  4GY2 B;  3O08 A;  4XH5 A;  2YJF A;  3QBW A;  4BRG A;  2QWP A; 
#chains in the Genus database with same CATH topology
 3LPT A;  2A1S A;  3TWH A;  2FSK A;  3G0Z A;  5KQ8 A;  5GAH P;  2ZM6 K;  5E41 A;  3AVL A;  1B92 A;  1A5W A;  1WSI A;  3BZK A;  4FO0 A;  1SL1 A;  4IWV A;  5M1K A;  1YT3 A;  2KFN A;  3TAE A;  1VQN N;  1KTQ A;  3J81 O;  1NKC A;  4B1Y B;  4LF4 K;  4M63 C;  1JLQ A;  4W5R A;  1HYZ A;  3DRP A;  4QS9 A;  1XI1 A;  2IOC A;  1BI4 A;  2HNZ A;  2X6S A;  5KTQ A;  1C0G A;  1NGE A;  1I3A A;  4I2Q A;  3O3H A;  1Q9X A;  1C1C A;  1JLG A;  3ASM A;  3P4I A;  4CJP A;  1QVG M;  2UXC K;  5HRS A;  4DSE A;  3AO3 A;  4PL8 A;  2ITG A;  4O0J A;  3NH0 A;  3UKU A;  1C0U A;  3KK3 A;  2NRW A;  4N76 A;  4JK9 A;  3CER A;  3QEV A;  2QTD A;  4O44 A;  5GIP A;  1E4F T;  1RDU A;  1KRP A;  4RW4 A;  3HJF A;  4OPH A;  3QO9 A;  5GAE P;  1NM1 A;  2AJQ A;  1RBU A;  5J1E A;  4Q5V A;  2PYL A;  3AO4 A;  4BRQ A;  2O8B B;  4DR4 K;  3IG1 A;  4DTX A;  1XHX A;  3CJ7 A;  2OZM A;  3KWI A;  1NGI A;  2A1R A;  3KWG A;  3PUF A;  1ZBI A;  5EX5 A;  3QER A;  4FWM A;  5T7B A;  1U6Z A;  1TV6 A;  3VN5 A;  3ZSZ A;  1I94 K;  5ELZ A;  3C6A A;  1G99 A;  3F9K A;  3HPH A;  2IC3 A;  3HPO A;  2QWL A;  4PKG A;  2X6N A;  4JI2 K;  4KHP K;  2W6K A;  1T6C A;  1YIJ N;  2P9K B;  1N33 K;  2JLE A;  1W2B M;  1KXP A;  3RMD A;  1HJO A;  1OKJ A;  4MLH A;  4B8C A;  4FK2 A;  4O8U A;  3NDK A;  1K9M O;  4JKH A;  3RMB A;  3OYH A;  5BR9 A;  2ZWH A;  3ZX0 A;  1UA0 A;  2QKB A;  5BRE A;  4FW1 A;  5MLC Q;  4DSI A;  1UOC A;  3VET A;  3AGR A;  3AV9 A;  1Q8I A;  4BRM A;  4DTP A;  4O5B A;  3RRH A;  1OH5 A;  1S5J A;  3T1H K;  4CEE A;  2OTL N;  3CMA N;  4GV9 A;  4B9L A;  3HI0 A;  1RT5 A;  5BPL A;  4F8R A;  3QEI A;  2G8K A;  2O8C A;  5EU7 A;  2ZD1 A;  4CW7 B;  3O4Q A;  1EWQ A;  2IVN A;  3BY5 A;  3VES A;  4IJA A;  2HF4 A;  4LSL A;  3L0Q A;  3MN5 A;  4LFB K;  3FZM A;  4CFA A;  1TKX A;  4B1U B;  1S1V A;  1HQU A;  3C6H A;  4FSV A;  4ZTJ A;  3OYA A;  4CJK A;  2KZZ A;  4XEI A;  3L2U A;  4Z4F A;  4CZM A;  3HVR A;  4FJH A;  1JLC A;  3BZC A;  4WQ5 A;  1YI2 N;  1NJI O;  5JVG L;  5AQR A;  1CZ9 A;  1YJN N;  4J2A A;  3BF1 A;  1U49 A;  4ZHR A;  2O8D B;  1TYQ B;  1K73 O;  3VF2 A;  4M45 A;  2XY8 A;  4BRF A;  2ZJQ L;  1XUP O;  4CF9 A;  1VQK N;  3ID6 A;  4JHD B;  1YJ9 N;  5LMU K;  4DV0 K;  5KRS A;  5HOO A;  1Z26 A;  1U4B A;  1NMN A;  4MDB A;  3RSE A;  5C25 A;  5GAG P;  3QML A;  4BWM A;  2XRI A;  4ID1 A;  4F3T A;  4WCE L;  5DK5 A;  2P9U A;  3IS9 A;  1O1W A;  2FF6 A;  3ULD A;  2KKZ A;  3HRG A;  3OYK A;  2F9T A;  3NGZ A;  4KRF A;  3C94 A;  1NGD A;  1BCM A;  3TI0 A;  3AO1 A;  1JLF A;  3R6M A;  3G25 A;  4JS5 A;  4LFA K;  3AA4 A;  3SUN A;  1D5A A;  4DSL A;  4KB0 A;  3HP9 A;  3OHR A;  5AFU A;  4CGD A;  1M90 O;  3W3D A;  1V4T A;  4JI3 K;  4KHN A;  3TAR A;  2ZGY A;  3MWT A;  4B1V A;  4CHZ A;  1S72 N;  1D9D A;  4FWL A;  2HMP A;  3MCA B;  3OYD A;  4CK1 A;  4QCL A;  2RPI A;  4BRE A;  4BE1 A;  1GLE G;  4FJ9 A;  4NO7 A;  5FRN A;  1HUX A;  3BF3 A;  3TAM A;  3ZEU A;  3I8D A;  4JAX A;  3VER A;  2QWO A;  3T1Y K;  1YIT N;  5SZT A;  5AQN A;  1QSL A;  2O8F A;  3ITH A;  4H0Y B;  4QOZ B;  3MN6 A;  3S3N A;  4KTZ A;  3DLE A;  4KHQ A;  1KD1 O;  2E1Y A;  3R1X A;  3TAB A;  3R8E A;  1Q18 A;  2Q1N A;  2WC9 A;  1N6Q A;  3UKU B;  3ZSW A;  4CJ5 A;  1X9S A;  3RWU A;  4H4M A;  2VYP A;  3CPW M;  4F2R A;  4E89 A;  1SZ2 A;  3F2K A;  5A2Q O;  3MXM A;  3KD5 E;  3B8A X;  4F9O A;  1OH6 A;  4U67 L;  2P9I A;  1QSS A;  4B9S A;  2D0O A;  3CJB A;  3VQA A;  1HPZ A;  1XNR K;  4WF9 L;  4ILJ A;  5AQM A;  1IBM K;  4M41 A;  5AQZ A;  3WUH A;  3LL3 A;  3TR8 A;  1G15 A;  1VQP N;  1RDA A;  1IKY A;  2NZT A;  4DFK A;  4QS8 A;  2JWL A;  3H1V X;  3SAG A;  1GLA G;  1RCH A;  4KH6 A;  1KAY A;  2ATQ A;  1A5V A;  3U9Z A;  4CER A;  5AQT A;  4A62 A;  3ZT1 A;  5JS2 A;  1D4X A;  1VSD A;  3JAM O;  3P5J A;  3P38 A;  3EKS A;  1BGX T;  4AHU A;  4K42 A;  3V9S A;  4CZE A;  3KHY A;  4IOC L;  5C2F A;  2F96 A;  4CJV A;  4B9N A;  3FZH A;  1VRU A;  2D1K A;  1JL1 A;  3VQ5 A;  3H6E A;  3WXJ A;  1S9E A;  4I2P A;  3K5L A;  4EIA A;  1TUU A;  2QWR A;  2O4G A;  4Y0W A;  1NU0 A;  1RBS A;  1JLE A;  3MCP A;  3THY A;  4BR9 A;  1BHL A;  3ATV A;  3IKM A;  1JL2 A;  3C65 A;  3O80 A;  4BDZ A;  4FLW A;  3TTF A;  1L3V A;  3JSM A;  4KPY A;  2YI1 A;  4PKI A;  3CQX A;  2YNG A;  2O8C B;  4CZL A;  4KH5 A;  3ZSQ A;  3I0R A;  3MEE A;  2EX3 A;  4YOY A;  2HNY A;  3NF7 A;  1ZXO A;  2B6A A;  4AM7 A;  4CD1 A;  4U7B A;  3PX4 A;  3WNE A;  4DLE A;  2XHB A;  5AQG A;  1N34 K;  3MMV A;  1NKB A;  2VWB A;  2X74 A;  3BGR A;  3K9K A;  3QNN A;  4M3U A;  2FC0 A;  2DPN A;  4DFJ A;  3OS0 A;  3VQ7 A;  2AA4 A;  3U8X A;  3SJJ A;  3VGK A;  5FPD A;  3EY1 A;  1X9M A;  4DV5 K;  2G8H A;  3GDQ A;  4V19 S;  3ZET A;  2ITM A;  4LD0 A;  4XIU A;  3DLH A;  1NK9 A;  3RR7 A;  3VF4 A;  2Q31 A;  1V4S A;  4IEI A;  4DHY A;  2NUB A;  4PL7 A;  4O4G A;  2G8I A;  1C0T A;  3LAK A;  4YOV A;  2P5O A;  4CIE A;  4LF9 K;  3VMF B;  3R3L A;  4DFM A;  1IO2 A;  3GL1 A;  4GY2 B;  3O08 A;  5HRP A;  3PX0 A;  1T3V A;  4NCA A;  1WAF A;  3QBW A;  2YJF A;  3PSF A;  4WQ4 A;  1O13 A;  4FM0 A;  4JLH A;  5C15 A;  2G8V A;  5FPE A;  3RSE B;  5BRD A;  1S22 A;  4ELT A;  3HL8 A;  1L5U A;  3MWP A;  4DU3 A;  5KPT A;  4FLY A;  1YUW A;  4B9M A;  4IZ9 A;  5KI6 A;  3QET A;  2PFU A;  2RF2 A;  2P9U B;  4BY9 C;  2E2O A;  3EKU A;  3O3G A;  3OY9 A;  1KVC A;  3C95 A;  3F5T A;  2HVI A;  5KGW A;  3LDN A;  5AQY A;  3PO5 A;  3ENH A;  4A5B A;  3OW2 M;  4CES A;  4CF2 A;  1WBB A;  4JD2 A;  3KZB A;  2V7Y A;  4AHC A;  2IS3 A;  3KVG A;  4FK0 A;  3SCX A;  2F9W A;  3SBT A;  4DU1 A;  4BDY A;  3CYM A;  2GBZ A;  4A5A A;  1RBV A;  2IGI A;  3ZSX A;  5AZJ A;  1YTU A;  3EZW A;  2V51 B;  2B5J A;  4ELV A;  4JKA A;  1KVA A;  4CEQ A;  4DS5 A;  4OPA A;  2PZS A;  5AQO A;  4AH9 A;  1NG9 A;  3AVF A;  3T3F A;  2DTU A;  3NVM A;  4DV2 K;  1X1P A;  2P9S A;  3O1W A;  5HBM A;  1J9A A;  3ZEU B;  1VK0 A;  3QLH A;  3VEW A;  4ISF A;  4W5N A;  1GOA A;  2BTF A;  4A2B A;  1NGF A;  3H08 A;  1UA1 A;  4JKB A;  2HHS A;  2O8F B;  3JYT A;  1WUA A;  2P9L A;  2A42 A;  3THW A;  2WUS A;  3FR0 A;  2YNI A;  4GMJ B;  2HBJ A;  3M8Q A;  1JCE A;  3I33 A;  4DG1 A;  1DKG D;  4OKJ A;  4FJM A;  3HK2 A;  3SQ4 A;  3C6T A;  3HVT A;  2FBT A;  2P9P A;  2HF3 A;  3SUP A;  2XY7 A;  4FPA A;  2YHA A;  1R0A A;  5J2N A;  3I56 N;  2P9I B;  4C8K A;  3SQ2 A;  2HHV A;  1TYQ A;  4N47 A;  2XO7 A;  1RDB A;  1EET A;  5LJW A;  1UWB A;  3D0P A;  1TKT A;  4CK2 A;  2FSN A;  3AO2 A;  4JKF A;  3RMC A;  4BVO A;  4CJ4 A;  3SLC A;  3ID8 A;  3G10 A;  3C0B A;  1BG3 A;  5CR4 A;  3CCL N;  1S1U A;  3K57 A;  3Q7C A;  4JI0 K;  2BUP A;  3DRS A;  1C0F A;  3M5R A;  4DV3 K;  3TTD A;  2O8E A;  2E4L A;  4B9V A;  3EL2 A;  3HST B;  4JKG A;  3QDK A;  1NGA A;  4BRA A;  3N4P A;  1NK0 A;  4E7J A;  4A2A A;  4BRI A;  4CHQ A;  2D0C A;  2FLO A;  1VHX A;  5JMV A;  4GVE A;  2G8U A;  2UUB K;  3UB5 A;  1W0H A;  1WSJ A;  2YHW A;  4GV3 A;  1ZYQ A;  4PWD A;  3SNN A;  4YFU A;  2NRR A;  2QWQ A;  4CK3 A;  3MN9 A;  3JS6 A;  2Q0R A;  4I7F A;  2YHB A;  4JK7 A;  3THY B;  4M3Z A;  2NNW A;  4H0P A;  3THX A;  3ULE A;  2Q36 A;  2EWS A;  1S1X A;  1KAZ A;  3LWL A;  4HVJ A;  1HNV A;  1NLV A;  4IFV A;  3AVK A;  3OJU A;  4A59 A;  3J7Z O;  3HOS A;  4CGH A;  1RT3 A;  3K2P A;  1ASV A;  4B8A B;  1XHZ A;  4CEC A;  2DFE A;  1KVB A;  4YOX A;  3SI6 A;  1SAZ A;  4WFB L;  4B3R K;  3O1B A;  3EO3 A;  1ASU A;  1VQ5 N;  4LFC K;  2XY6 A;  3TAQ A;  4BGA A;  3FLC O;  1RT6 A;  2Z1H A;  3MXJ A;  4WYB A;  5IWA K;  3LPU A;  1KSP A;  3HBT A;  3CCR N;  2XY5 A;  4CJF A;  4E1N A;  4FLU A;  3FFK B;  5I9E B;  1HNZ K;  3CFP A;  4BDP A;  1X3N A;  4I6M A;  4ID5 A;  3VEZ A;  4KRE A;  1RNH A;  4CFD A;  3TAG A;  3ZET B;  1BUP A;  4M3Y A;  5AQK A;  1GLJ O;  2IVP A;  3ZX3 A;  2F4V K;  2E6M A;  4FCY A;  3PLA A;  1NJY A;  3QFU A;  4CZH A;  3V9Z A;  3LZI A;  5FPM A;  4C8N A;  3U3Y A;  3BEX A;  4JKD A;  3KLG A;  4A61 A;  1QSY A;  5AZI A;  4RW7 A;  5LY3 A;  3NGY A;  3OYB A;  4DV7 K;  4I9Q A;  1KQS M;  4BGB A;  2I7N A;  1VQM N;  3SPY A;  1HNX K;  4AHV A;  3GG4 A;  1S3X A;  3K58 A;  3DAW A;  4TSX A;  4EP4 A;  4RWT A;  3OYM A;  4H8K A;  3WXL A;  1WSE A;  3OTO K;  5C10 A;  1QS4 A;  4IDH A;  1GLC G;  4DLG A;  3OYG A;  4AHR A;  1U45 A;  1NGJ A;  1BU6 O;  1L3S A;  4G9Z A;  3CCE N;  2HBL A;  4JD2 B;  2J4R A;  5KQD A;  4IFE A;  3L3V A;  1QQN A;  5AZJ B;  1RDW X;  4H0O A;  3S41 A;  3O3F A;  1JKH A;  3WT0 A;  4X65 K;  1DTQ A;  4NCG A;  1JLA A;  4CGG A;  5B8H A;  1HMV A;  3VA3 A;  1XMQ K;  3DLB A;  1U48 A;  4KHY A;  3KKR A;  1ATN A;  4YHH K;  4CGI A;  5LL6 Z;  5M1N A;  1GLL O;  5DM7 L;  2P9S B;  2RKI A;  4DV6 K;  4E7L A;  3CC7 N;  4FZZ A;  5EOY A;  4H0X B;  3S9H A;  2VGM A;  3LP2 A;  3SMS A;  3TPQ A;  4DR6 K;  5C24 A;  4DF8 A;  3M1F A;  4Z0U A;  3MDQ A;  1WB9 A;  3CJ1 A;  2P9L B;  4FJK A;  3THW B;  1LAW A;  3LM9 A;  2IIR A;  4BWJ A;  4I9L A;  4FJN A;  1XC9 A;  2P5G A;  4EHT A;  4K25 A;  3QB0 A;  3RR8 A;  1EWR A;  3VEN A;  1GLF O;  5M1F A;  3V1Q A;  1Z6R A;  3RRG A;  1TUY A;  2ASM A;  2P9P B;  3AGK A;  3AVN A;  4JKE A;  3VQC A;  4EZ9 A;  1VAZ A;  4MDA A;  5HRR A;  3SPZ A;  2NRH A;  3P1G A;  3E1Y A;  2E20 A;  3KIO A;  3SMP A;  4CJR A;  3H45 C;  3LZJ A;  1BIU A;  2BH1 A;  5JVH L;  1VSI A;  5D3G A;  4FLX A;  2GUP A;  5HLF A;  4FJ7 A;  3O9U A;  3LDQ A;  4FWO A;  4DUY K;  4BR0 A;  3K5M A;  2O8E B;  1TK5 A;  5ADX A;  4JKG B;  3VEV A;  3KD1 E;  3T69 A;  4M7Y A;  1FXX A;  1W7A A;  1JXB A;  3E9O A;  2YHX A;  4E3S A;  2IDO A;  1L3U A;  4RW8 A;  3SBG A;  4DF4 A;  3E01 A;  1NGH A;  3CCQ N;  5GIO A;  3DXM A;  3C6U A;  2F8S A;  4FM1 A;  2HBM A;  3CQY A;  3PX6 A;  3J7Y P;  1LOT B;  1I39 A;  1BIZ A;  1VRT A;  3A0I X;  1JLB A;  4EAH D;  2E8A A;  3CJC A;  1JXE A;  3SV3 A;  1IBK K;  1C6V A;  1BL3 A;  4C23 A;  1SUQ A;  1IBL K;  4ISG A;  3R9P A;  3ULE B;  4PQU A;  1TL3 A;  1LWE A;  4DQQ A;  3L8B A;  1W97 L;  4N41 A;  4F4K A;  3WQT A;  4KI4 A;  2NRX A;  1C1A A;  1MWM A;  3VQ4 A;  4CJQ A;  5LJV A;  4DSK A;  3J7A P;  2A6A A;  2Z1J A;  4OGE A;  4RCH A;  1DGK N;  3L3U A;  4CFC A;  4ILH A;  1IV0 A;  3SYZ A;  2G8W A;  2QW9 A;  3AVA A;  2GX9 A;  3DLK A;  3WXI A;  2HMI A;  3WEE A;  5TKY A;  4IXC A;  1IG8 A;  1RTD A;  5I3U A;  1LAV A;  2HBK A;  4BR4 A;  1K6Y A;  1U47 A;  3AAQ A;  3ZX2 A;  3LAL A;  4O55 A;  4I6M B;  4XH5 A;  4BRG A;  3HT3 A;  5BRH A;  3OYC A;  3DWL A;  4RW9 A;  3UE5 A;  2QWM A;  5JIC A;  1QZ6 A;  4CZK A;  2KLA A;  4H5V A;  3UKR A;  4R79 A;  4DB3 A;  4B3O A;  4DR5 K;  1N32 K;  1ILY A;  4DQS A;  4GKK K;  1Z05 A;  3EE9 A;  4BR2 A;  3RVC A;  5AZI B;  1SKR A;  3D2F A;  1N5Y A;  3HSC A;  5BR8 K;  4JKC A;  4AHS A;  4KBO A;  3M3Z A;  4KHW A;  1YXQ A;  4JI1 K;  2YKN A;  5BRF A;  5AQH A;  5I42 A;  3CF5 L;  2Y1J A;  4YNQ A;  2VG7 A;  3MEC A;  4DU4 A;  2Q97 A;  2OCE A;  3NVK A;  5AJ3 K;  2FBV A;  3EEQ A;  2DFF A;  4DV1 K;  3H3N O;  1ATS A;  4FWN A;  4RTF D;  3THV A;  2HHU A;  1NK4 A;  3VQ8 A;  4HHT A;  4B1Z A;  5J2M A;  3O6W A;  4FWP A;  2QK9 A;  1HKC A;  4CEB A;  4LH5 A;  4HTL A;  3IMX A;  2P9N A;  3OYF A;  4CJE A;  4AQY K;  1J5E K;  3S3O A;  2HVH A;  2A3Z A;  1SV5 A;  4OJR A;  2ASO A;  3FZL A;  4FM2 A;  3AVB A;  5C42 A;  2Q3S A;  3FZF A;  5E84 A;  3VPZ A;  1X9J A;  4DKW A;  4JK8 A;  4GV6 A;  4IOA L;  4CIF A;  4B9T A;  1HR0 K;  3QEW A;  4J2B A;  3TAP A;  2ETJ A;  2OPQ A;  3QIP A;  2ZJP L;  4H4O A;  2GTD A;  4HCC A;  3DYA A;  4CJS A;  3O4N A;  4W5T A;  5M1P A;  1L3T A;  2VG6 A;  4B3M K;  4B08 A;  3NH1 A;  4PA1 A;  3EN9 A;  3BP8 A;  4FWQ A;  1J53 A;  3LAM A;  4H0V B;  1FKP A;  3A2F A;  4BR5 A;  3GBT A;  2CGJ A;  4KFB A;  4N5S A;  4BAC A;  4YDU A;  4DQI A;  1NK5 A;  4OLA A;  4BG9 A;  1E3M A;  3CHW A;  1XC3 A;  1SS6 A;  4OKK A;  4YY3 K;  1NBW A;  1OVY A;  4K8X A;  3QIN A;  3ZT3 A;  3U6F A;  3AVC A;  1KLN A;  1KLM A;  3CME N;  5CY4 A;  1XMO K;  1BWF O;  2YV0 X;  2KQ2 A;  3CJA A;  1NGG A;  3PSI A;  4ISE A;  3AAP A;  1TGO A;  1EXQ A;  1QTM A;  4FOE A;  4C8L A;  4FPB A;  4K43 A;  3NGI A;  4KB1 A;  3Q7B A;  4J8F A;  4WQ5 C;  3KJV A;  3NFA A;  1YJW N;  5HP1 A;  4FJ5 A;  3FFI A;  4UQG A;  1GLD G;  2Q2R A;  3D6R A;  4WE1 A;  3WXK A;  3LWM A;  3HXM A;  1T44 A;  3OS2 A;  1VQO N;  1NOZ A;  3H46 O;  3L2V A;  4BRC A;  4FJX A;  1J6Z A;  3TSU A;  3VQD A;  3DXM B;  2OPR A;  2G8F A;  3MX5 A;  3WXM B;  4H5T A;  1WSG A;  3LM2 A;  4NB4 A;  4CED A;  1HPM A;  2JWK A;  3B6O A;  4B1W B;  3N4Q A;  4NYN A;  2HHT A;  2D0P A;  4X66 K;  3ZT2 A;  3HP6 A;  2YX6 A;  3H1Q A;  1M1K O;  4DTO A;  5C12 A;  5AR0 A;  1FKO A;  3NF8 A;  3SUQ A;  4IKF A;  3CXC M;  2A5X A;  3VF6 A;  3P39 A;  4M42 A;  3CD6 N;  1BIS A;  2UYT A;  1T7P A;  4FJ8 A;  3DLR A;  5AFU H;  3O9Q A;  2FBY A;  3M8S A;  3O4W A;  3O9R A;  3K5N A;  2F7T A;  4O0I A;  1NKE A;  1HX1 A;  4MO4 A;  4MFB A;  3CCS N;  1OH8 A;  1P90 A;  4DMN A;  1ITG A;  1RT4 A;  4CBX A;  1SL2 A;  1BQM A;  3M6G A;  1QVF M;  1ZBS A;  5FDL A;  3WEE B;  3DLG A;  4DTM A;  1SKW A;  4KAZ A;  4CJ3 A;  4OLB A;  3C7N A;  3VQQ A;  3IFR A;  1EKE A;  5JLF A;  1IKX A;  1CZB A;  3MK6 A;  1QHT A;  4FWR A;  1DT9 A;  4Z4H A;  2I7P A;  1SL0 A;  2VGN A;  3AAR A;  2BGG A;  5AQU A;  2VG5 A;  5BN9 A;  4BRH A;  3L2R A;  3K0S A;  3MAQ A;  2RHK A;  2QM1 A;  5CZ1 A;  1F21 A;  4KH4 A;  2NRT A;  3UKR B;  4HUG A;  1WAJ A;  2PYJ A;  3A5M C;  5KPR A;  1RIL A;  3RMA A;  5F0X A;  5F2R A;  1BA1 A;  3V6D A;  1IH7 A;  1D8Y A;  4HWI A;  1FW6 A;  4OKE A;  1DLO A;  3D2F B;  2FXU A;  3MN7 A;  3OS1 A;  1Q82 O;  4DUZ K;  3V9X A;  2QXL A;  3IUC A;  3T19 A;  3ZT4 A;  4N56 A;  1QQO A;  1OH7 A;  3WQU A;  3GE1 A;  1IKW A;  3OBW A;  1QHA A;  2JGU A;  3VQE A;  3TU5 A;  2YNF A;  5HRO A;  3QEX A;  1ZC6 A;  3AVH A;  4JRQ A;  1ESV A;  1VQ6 N;  1WLJ A;  2V7Z A;  2HST A;  1T03 A;  3J8A A;  2P9N B;  2PY5 A;  4HUE A;  4CBW A;  4CF0 A;  1RT2 A;  1Q86 O;  4CEZ A;  1ZBF A;  4H0T B;  4JI7 K;  4CI6 A;  2GV9 A;  3D7E O;  1KCF A;  4DQP A;  3LDL A;  2O4I A;  4B3S K;  5KGX A;  5DM6 L;  1QE1 A;  4J2E A;  1IKV A;  1S6Q A;  2OAN A;  1JCF A;  1XQS C;  4Z4I A;  4CHO A;  4W5Q A;  1HRH A;  3DMJ A;  4BC4 A;  1B9D A;  3LP3 A;  2KZM A;  4M3R A;  2QKK A;  3AY9 A;  1GLB G;  4IEE A;  3DXK B;  3I8B A;  3GOI A;  3O9T A;  4AHT A;  3L2Q A;  2R7Y A;  5J2P A;  2GEM A;  4FW2 A;  4LSN A;  2ZGZ A;  5AQX A;  4CJU A;  3NBP A;  1TKZ A;  4CZI A;  4CCH A;  3G4S N;  4XH1 A;  1P8Z A;  4CHN A;  1S1W A;  3CG7 A;  4CIG A;  1QZ5 A;  1BCO A;  4BRO A;  3PIP L;  1U2V A;  2HW3 A;  3W0L A;  2E1Z A;  1BDG A;  4EZ6 A;  4BQZ A;  2ZE2 A;  3HOT A;  3CFO A;  1VSK A;  2WTU A;  4IG3 A;  4X64 K;  1XNQ K;  1EO1 A;  4MLE A;  2IVO A;  1SQK A;  3OBY A;  1HLU A;  4DR7 K;  1K8K A;  5AQW A;  3QBX A;  2YCH A;  4LF7 K;  1DTT A;  1CZA N;  3PO4 A;  1CXU A;  3VTI A;  3VQ6 A;  2VCP A;  3VOV A;  4JS4 A;  4ELU A;  2F8T A;  5FRO A;  1WOQ A;  4W5O A;  3CPE A;  3TTC A;  3KKS A;  5E26 A;  3DOK A;  3KTQ A;  3VTH A;  3AVM A;  4BRP A;  2W6L A;  3SAH A;  5DMR A;  4C1N I;  2UXD K;  1R59 O;  4CF8 A;  4JNE A;  5EY4 A;  4DSF A;  1N8R O;  1MA9 B;  1TKD A;  4YDU C;  3K9J A;  2P1J A;  3CQ8 A;  1Y97 A;  5CYQ A;  3O8M A;  4E1M A;  1RBT A;  4EP5 A;  4PHT X;  3UIQ A;  3AVG A;  1NNE A;  4LH4 A;  4CE9 A;  1MDU B;  4BE0 A;  4DR2 K;  4YOT A;  3V1O A;  3A5O C;  3LP0 A;  1C1B A;  4WQ4 C;  5JLH A;  1HYS A;  4BR7 A;  1XWL A;  4FOI A;  1BQN A;  2KTQ A;  3BUZ B;  1KAX A;  4YOR A;  5AQS A;  3D2E A;  3PIO L;  4FJL A;  1FK9 A;  5AQP A;  5CYM A;  4CJ7 A;  4CJL A;  4M3X A;  2D0A A;  4IBN A;  3CCM N;  1OVQ A;  5GIN A;  4FJG A;  4DQ8 A;  5EXW A;  4Z94 A;  3SK3 A;  4H5W A;  4UY8 O;  3SQ1 A;  3WNH A;  1S1T A;  3HM8 A;  1YAG A;  4K41 A;  3FZK A;  3I55 N;  4IDK A;  4C8O A;  4OPK A;  4CEA A;  1E4G T;  3OYN A;  4E19 A;  1WNS A;  4Z4C A;  2YHY A;  4IG0 A;  1VQ9 N;  1MWK A;  1BA0 A;  4KV8 A;  4FWS A;  3H3O B;  3F73 A;  2GEL A;  3OA9 A;  3V81 A;  4IO8 A;  4CJT A;  1WBD A;  3QEP A;  3C7N B;  3M8P A;  2VWK A;  1SKS A;  3QES A;  3SZ2 A;  4CJW A;  5AQQ A;  3OYJ A;  1RBR A;  4H5N A;  4CZJ A;  2OTJ N;  5C2D A;  3IRX A;  3WNG A;  1YTA A;  3ZCM A;  3V9W A;  3KK7 A;  1Z25 A;  2DFH A;  1RFQ A;  2YJE A;  4CGF A;  1NJW A;  4M7X A;  2OYQ A;  4IO9 L;  5M1O A;  4KTW A;  3MED A;  5AQJ A;  1RTH A;  4AIL C;  4CEF A;  4BC5 A;  3CCU N;  4HTU A;  4E7K A;  3E9L A;  5CHI A;  4E0D A;  3ZSY A;  4OO1 J;  4OGC A;  1HNW K;  2QWN A;  1JCG A;  1T05 A;  1LCU A;  1LWC A;  4DCH A;  3NF9 A;  3QIC A;  3DLL L;  4NXM K;  3NHG A;  3T1A A;  4IFY A;  1RGI A;  3LAN A;  4FWK A;  1HKB A;  4IOX A;  3ENB A;  4C8M A;  5TKW A;  2NLX A;  4KI6 A;  4FVM A;  2HHH K;  1VSE A;  3CM5 A;  2HHQ A;  4E1J A;  3LDS A;  1BO5 O;  4H03 B;  1NK8 A;  4R5P A;  4JN4 A;  4BRL A;  4NLB A;  4AF1 A;  5K14 A;  3A5L C;  4NYF A;  4BVP A;  2YKM A;  4CBU A;  3THX B;  4DV4 K;  3K5O A;  1EP4 A;  4GVM A;  3E9P A;  3OYI A;  3CC4 N;  2E6L A;  4JI5 K;  5AQL A;  4DTR A;  1WSH A;  2D5R A;  4CHY A;  4MQ3 A;  4LY7 A;  1H1V A;  2W41 A;  4YOU A;  4PKH A;  2E2N A;  3SJH A;  3VQ9 A;  3T7Z A;  3ENO A;  4JI6 K;  1HJR A;  2ASP A;  1S9G A;  3JXU A;  2NRV A;  5HL7 L;  3U9D A;  1BI4 B;  3PV8 A;  4F2S A;  3HPG A;  1U2V B;  3DI6 A;  4DFP A;  3TSQ A;  3CCV N;  4O5F A;  1TVR A;  4BRN A;  1J5O A;  3IAY A;  3U3G A;  1NGB A;  1TK8 A;  3ZT0 A;  5M1Q A;  1VSL A;  1J54 A;  3ALY A;  1KFS A;  2P51 A;  3NF6 A;  4O8K A;  2PBD A;  1K8K B;  4OVL A;  4BC2 A;  3LDO A;  3MXI A;  4QAG A;  3VQP A;  3SUO A;  1DEJ A;  3AA2 A;  5GAD P;  3ZYY X;  3WNF A;  2YNH A;  2D4W A;  5FPN A;  1YHQ N;  4B9Q A;  4FXD A;  1UAX A;  3NAE A;  1IJJ A;  4H5R A;  4KKO A;  2UXB K;  5LMN K;  4DSJ A;  1ZBU A;  4JI8 K;  2V52 B;  4CHP A;  4IJN A;  4ZTF A;  2RE2 A;  2EHG A;  4EHU A;  3HZ6 A;  4CF1 A;  3NH2 A;  2UUA K;  1NK6 A;  1IG9 A;  4NLC A;  4BE2 A;  4DWI A;  2HND A;  1YVN A;  3L4Q A;  4MO5 A;  3EYZ A;  3TAN A;  4NXN K;  2FBX A;  2QI2 A;  4NCB A;  2HHW A;  5AQF A;  4A57 A;  1NWK A;  4M3T A;  2AP1 A;  2B4J A;  3QIO A;  4DR1 K;  3G71 N;  4GKJ K;  1RTI A;  5IT9 O;  1VQ8 N;  3CI5 A;  4L3Q A;  3SAF A;  4HCB A;  1REV A;  3BDP A;  4JEP A;  2QEX N;  4OPJ A;  4K8Z A;  3A5N C;  1KFD A;  3RTV A;  5BN8 A;  3ZSR A;  3IDH A;  2OA8 A;  3D2E B;  3DOL A;  2CH6 A;  5CZ2 A;  3DM2 A;  1WN7 A;  4LF8 K;  4DQR A;  1GOB A;  1NMD A;  4GW6 A;  1RTJ A;  4PUO A;  1Q7Y O;  2GWJ A;  1HQE A;  2I5J A;  2KW4 A;  1X3M A;  1NJX A;  4OX9 K;  2UUC K;  3DXK A;  4CZG A;  4B9U A;  2RN2 A;  4CGJ A;  3HM9 A;  1ASW A;  2HB5 A;  1ZBH A;  2FSJ A;  3M8R A;  1LWF A;  3VEO A;  1X9W A;  3VEY A;  5SWM A;  4Y1C A;  3OYL A;  3VEX A;  4Z4G A;  1LW2 A;  4WFN L;  3VQB A;  5J2Q A;  3CIP A;  2UU9 K;  4KHS A;  1VSF A;  4Q0B A;  1TL1 A;  2ZQB A;  3AVI A;  1ATR A;  1EX4 A;  1YVU A;  2WFB A;  4CEO A;  3KLH A;  2GUI A;  2OPS A;  3ATU A;  3QFP A;  3AA3 A;  3KK1 A;  4QS7 A;  5F1X A;  5EVZ A;  1KC8 O;  4CVN E;  4FZX C;  5BPN A;  1TAQ A;  1LW0 A;  3P31 A;  4BRK A;  3SQ0 A;  1GOC A;  4FK4 A;  2E2P A;  2KFZ A;  1HKG A;  4G1Q A;  4JI4 K;  3L6Q A;  4Y1D A;  1Q81 O;  4DR3 K;  1S6P A;  3DJC A;  2ZJR L;  2BDP A;  1WSF A;  3L2W A;  2O8B A;  3TAF A;  3ZLJ A;  1A5X A;  4B1X B;  2HOE A;  5KRT A;  4FJJ A;  3NMU A;  3KLI A;  3F9M A;  3CET A;  5H1S Q;  3CCJ N;  4B3T K;  3ZSV A;  5KPZ A;  3FGU A;  4LC9 B;  4ICL A;  4X62 K;  4LF5 K;  4E7I A;  1TAU A;  3MX2 A;  2H3G X;  4DTJ A;  4LF6 K;  2WON A;  3AVJ A;  4C1N K;  4BC3 A;  3VGL A;  1RT1 A;  3EE8 A;  4BQL A;  1RT7 A;  3SV4 A;  2ZF5 O;  1T6D A;  2WBN A;  3TSP A;  3QNO A;  4CZF A;  4JV5 K;  3P83 D;  2Q0U A;  2BE2 A;  4FLT A;  2P9K A;  3O9S A;  4GNI A;  4FZY A;  2PAV A;  1ZBL A;  2W40 A;  3HYF A;  3DRR A;  1RDC A;  3VGM A;  1NGC A;  4F3O A;  5AQI A;  5ADX H;  5C0Y A;  1N36 K;  4FL9 A;  5AQV A;  4E7H A;  4DTS A;  1VQL N;  2KHO A;  1CXQ A;  3AO5 A;  2W42 A;  5HRN A;  4FLV A;  3V1R A;  3KLF A;  5FLX O;  4KO0 A;  1HNI A;  4M3W A;  3OJS A;  4KTQ A;  3A8Y A;  4DTN A;  2Y1I A;  1Q9Y A;  3U4L A;  3G6E N;  3S3M A;  3OYE A;  2A41 A;  2D0B A;  3D45 A;  1B9F A;  4L8R B;  1NJZ A;  1VSH A;  3EZ5 A;  4HUF A;  4XH4 A;  3L4I A;  4BG8 A;  4YOW A;  3K59 A;  4EFH A;  2E88 A;  2VQE K;  2DY4 A;  4ILG B;  3CM6 A;  1VSJ A;  3LP1 A;  1VSM A;  2CGL A;  4FJI A;  3E66 A;  3V9U A;  2VWJ A;  4FYD A;  1JJ2 M;  4AM6 A;  1EQY A;  1K8A O;  1VQ4 N;  3CJ9 A;  4FLZ A;  3MEG A;  4RG8 A;  4BRD A;  4PY5 A;  2Z1G A;  3B6P A;  3VA0 A;  2E2Q A;  3ZSO A;  4JYA K;  4DTU A;  1NOY A;  1TK0 A;  2FF3 B;  1CLQ A;  4JRP A;  2VQF K;  2E5L K;  1T8E A;  4Z4E A;  3LDP A;  3I0S A;  2NRZ A;  4WFA L;  2GWK A;  2A40 A;  2WOM A;  2CGK A;  1QQM A;  3J80 O;  3HO1 A;  2CH5 A;  1Y64 A;  4CD3 A;  5CE3 A;  2BAN A;  2O8D A;  2QXF A;  1LV5 A;  2IAJ A;  2QA4 N;  2OZS A;  1RDD A;  4FVU A;  2LSN A;  1U04 A;  1VQ7 N;  3PY8 A;  4CFB A;  3KK2 A;  4JHD A;  5BPM A;  3NE6 A;  1FJG K;  3FE1 A;  4K0K K;  1YF5 L;  4J2D A;  1NK7 A;  2HHX A;  3V4I A;  5FRM A;  4KHU A;  1BOT O;  1W9H A;  2Z1I A;  1C0M A;  1HYV A;  3OVN A;  1D9F A;  1MU2 A;  1QQC A;  4DS4 A;  4RW6 A;  2OPP A;  5JS1 A;  3ISN C;  3AA5 X;  3O5B A;  3HTV A;  3NCI A;  3CFR A;  2X78 A;  2QWP A;  3CC2 N;  3KLE A; 
#chains in the Genus database with same CATH homology
 1E4G T;  5BRH A;  5C15 A;  3DWL A;  2FSK A;  5FPE A;  3RSE B;  5BRD A;  5KQ8 A;  1S22 A;  5GAH P;  2YHY A;  1VQ9 N;  3UE5 A;  1MWK A;  1BA0 A;  3MWP A;  2QWM A;  5JIC A;  5KPT A;  4FWS A;  1QZ6 A;  4CZK A;  3H3O B;  2GEL A;  1YUW A;  3OA9 A;  4FL9 A;  4IZ9 A;  2KLA A;  4H5V A;  4IO8 A;  2PFU A;  3UKR A;  4DB3 A;  4R79 A;  2P9U B;  4FO0 A;  4BY9 C;  4IWV A;  2E2O A;  1ILY A;  3C7N B;  5M1K A;  3EKU A;  1VQN N;  3F5T A;  1Z05 A;  4B1Y B;  3EE9 A;  4BR2 A;  4M63 C;  3RVC A;  5AZI B;  3LDN A;  4QS9 A;  5AQY A;  3D2F A;  3ENH A;  5AQQ A;  4CZJ A;  4H5N A;  4A5B A;  3OW2 M;  3HSC A;  4JKC A;  2OTJ N;  5C2D A;  4JD2 A;  4KBO A;  1C0G A;  3KZB A;  2V7Y A;  3M3Z A;  3KVG A;  1YXQ A;  3KK7 A;  1NGE A;  2F9W A;  3SBT A;  1RFQ A;  2YJE A;  5BRF A;  5AQH A;  3CF5 L;  4A5A A;  5AZJ A;  4M7X A;  2Q97 A;  3EZW A;  3NVK A;  4IO9 L;  5M1O A;  2V51 B;  3P4I A;  1QVG M;  5AQJ A;  3H3N O;  1ATS A;  4JKA A;  4FWN A;  4OPA A;  4RTF D;  4BC5 A;  4PL8 A;  3CCU N;  5AQO A;  4B1Z A;  3O6W A;  4FWP A;  1HKC A;  3UKU A;  3E9L A;  4HTL A;  5CHI A;  2NRW A;  3IMX A;  3NVM A;  2P9N A;  4OO1 J;  4JK9 A;  2QWN A;  1JCG A;  2P9S A;  3CER A;  3O1W A;  2QTD A;  1LCU A;  2A3Z A;  5GIP A;  3ZEU B;  2ASO A;  3VEW A;  1E4F T;  3FZL A;  4ISF A;  2BTF A;  4A2B A;  1NGF A;  4DCH A;  1RDU A;  3FZF A;  5E84 A;  4JKB A;  1X9J A;  3QIC A;  3VPZ A;  4DKW A;  3DLL L;  4OPH A;  4JK8 A;  4GV6 A;  5GAE P;  1WUA A;  2P9L A;  1NM1 A;  4IOA L;  2A42 A;  2WUS A;  3FR0 A;  1RGI A;  2HBJ A;  1HKB A;  4FWK A;  4IOX A;  3ENB A;  4BRQ A;  5TKW A;  2NLX A;  1JCE A;  3I33 A;  3CJ7 A;  4E1J A;  2ZJP L;  3KWI A;  2GTD A;  1BO5 O;  1DKG D;  1NGI A;  4H03 B;  4JN4 A;  4BRL A;  3KWG A;  5M1P A;  4NLB A;  4AF1 A;  5EX5 A;  2P9P A;  3A5L C;  2HF3 A;  4FWM A;  4BVP A;  4FPA A;  1U6Z A;  4CBU A;  3I56 N;  5ELZ A;  2P9I B;  3C6A A;  1G99 A;  1TYQ A;  3EN9 A;  3E9P A;  3BP8 A;  4FWQ A;  2QWL A;  3CC4 N;  4PKG A;  5LJW A;  1T6C A;  2FSN A;  5AQL A;  1YIJ N;  2P9K B;  4H0V B;  1H1V A;  2W41 A;  4JKF A;  4BVO A;  1W2B M;  1KXP A;  4YOU A;  3SLC A;  4BR5 A;  4PKH A;  2E2N A;  3GBT A;  1HJO A;  2CGJ A;  1OKJ A;  3ID8 A;  4MLH A;  3SJH A;  3C0B A;  1BG3 A;  4YDU A;  5CR4 A;  3T7Z A;  3ENO A;  3CCL N;  3Q7C A;  4BG9 A;  3CHW A;  1XC3 A;  1SS6 A;  4O8U A;  2ASP A;  2BUP A;  1K9M O;  4JKH A;  1C0F A;  1NBW A;  3JXU A;  3M5R A;  1OVY A;  5BR9 A;  2NRV A;  3TTD A;  2ZWH A;  3ZX0 A;  3U9D A;  5HL7 L;  3EL2 A;  5BRE A;  3CME N;  4JKG A;  3QDK A;  5MLC Q;  1NGA A;  4BRA A;  1BWF O;  3N4P A;  1U2V B;  3VET A;  3AGR A;  4BRM A;  3CJA A;  1NGG A;  4A2A A;  4BRI A;  4ISE A;  3TSQ A;  3CCV N;  4O5F A;  3AAP A;  4BRN A;  2FLO A;  4FOE A;  2OTL N;  4GV9 A;  3CMA N;  5JMV A;  4GVE A;  4FPB A;  4K43 A;  1NGB A;  3Q7B A;  3HI0 A;  3UB5 A;  5M1Q A;  5BPL A;  4J8F A;  2YHW A;  4GV3 A;  4O8K A;  4WQ5 C;  2PBD A;  1K8K B;  4BC2 A;  3LDO A;  1YJW N;  2NRR A;  2QWQ A;  3MN9 A;  3JS6 A;  1DEJ A;  1GLD G;  2Q0R A;  2Q2R A;  5GAD P;  3ZYY X;  3D6R A;  5FPN A;  2D4W A;  1YHQ N;  2IVN A;  4B9Q A;  3VES A;  4JK7 A;  4IJA A;  2HF4 A;  1IJJ A;  2NNW A;  3WXK A;  4H5R A;  1T44 A;  3L0Q A;  4H0P A;  3MN5 A;  1VQO N;  3H46 O;  2Q36 A;  3ULE A;  2EWS A;  2V52 B;  4IJN A;  4BRC A;  1J6Z A;  3FZM A;  1KAZ A;  3TSU A;  2RE2 A;  4B1U B;  1NLV A;  3C6H A;  3HZ6 A;  4EHU A;  3DXM B;  4FSV A;  4A59 A;  3MX5 A;  3J7Z O;  3HOS A;  3WXM B;  4NLC A;  4XEI A;  4H5T A;  3LM2 A;  4NB4 A;  4YOX A;  1YVN A;  3L4Q A;  1SAZ A;  4MO5 A;  4CZM A;  1HPM A;  4WFB L;  2JWK A;  3O1B A;  4B1W B;  3EO3 A;  3N4Q A;  4WQ5 A;  1YI2 N;  2D0P A;  2QI2 A;  1NJI O;  1VQ5 N;  5JVG L;  2YX6 A;  5AQF A;  5AQR A;  3H1Q A;  4A57 A;  1NWK A;  1YJN N;  2AP1 A;  3BF1 A;  4BGA A;  3FLC O;  1M1K O;  4WYB A;  3G71 N;  1TYQ B;  5C12 A;  3VF2 A;  5AR0 A;  1K73 O;  3CI5 A;  1VQ8 N;  4L3Q A;  3SAF A;  4BRF A;  3HBT A;  2ZJQ L;  3CCR N;  1XUP O;  3CXC M;  4JEP A;  2A5X A;  2QEX N;  3FFK B;  5I9E B;  1VQK N;  3VF6 A;  3P39 A;  3A5N C;  5BN8 A;  3CD6 N;  1X3N A;  2UYT A;  3ID6 A;  4I6M A;  4JHD B;  3IDH A;  1YJ9 N;  5AFU H;  3VEZ A;  3O9Q A;  3D2E B;  3O4W A;  3O9R A;  5HOO A;  3ZET B;  1BUP A;  2CH6 A;  2F7T A;  4MDB A;  3RSE A;  1HX1 A;  1GLJ O;  4MO4 A;  5AQK A;  2IVP A;  5GAG P;  1NMD A;  3QML A;  3ZX3 A;  3CCS N;  1Q7Y O;  1P90 A;  3PLA A;  2GWJ A;  4CBX A;  3M6G A;  1QVF M;  1ZBS A;  3QFU A;  4CZH A;  3WEE B;  1X3M A;  4WCE L;  2P9U A;  5FPM A;  3BEX A;  3C7N A;  2FF6 A;  3IFR A;  4JKD A;  3DXK A;  2KKZ A;  4CZG A;  5JLF A;  4WQ4 A;  3HRG A;  3MK6 A;  4FWR A;  4A61 A;  1DT9 A;  2F9T A;  5AZI A;  5LY3 A;  2FSJ A;  2I7P A;  1NGD A;  1KQS M;  2VGN A;  3R6M A;  4BGB A;  2I7N A;  3G25 A;  3VEO A;  3AAR A;  1VQM N;  5AQU A;  3VEY A;  5BN9 A;  4BRH A;  3VEX A;  3GG4 A;  1S3X A;  2QM1 A;  2RHK A;  3OHR A;  5AFU A;  4WFN L;  3DAW A;  4KH4 A;  1M90 O;  4RWT A;  2NRT A;  3W3D A;  1V4T A;  3CIP A;  3UKR B;  3A5M C;  3WXL A;  5KPR A;  2ZGY A;  3MWT A;  4B1V A;  5F0X A;  5F2R A;  5C10 A;  1BA1 A;  4IDH A;  1GLC G;  1S72 N;  4HWI A;  1ATR A;  2WFB A;  4FWL A;  1NGJ A;  1BU6 O;  4G9Z A;  2HMP A;  3D2F B;  2FXU A;  3MN7 A;  3ATU A;  3MCA B;  1Q82 O;  3CCE N;  3QFP A;  2HBL A;  2QXL A;  4BRE A;  4JD2 B;  3IUC A;  1GLE G;  4QS7 A;  1QQO A;  4NO7 A;  2J4R A;  1HUX A;  3WQU A;  3BF3 A;  5EVZ A;  5F1X A;  5KQD A;  3GE1 A;  4IFE A;  5BPN A;  1KC8 O;  3ZEU A;  3OBW A;  1QHA A;  3P31 A;  4JAX A;  2QWO A;  3VER A;  1QQN A;  5AZJ B;  4BRK A;  1YIT N;  1RDW X;  4H0O A;  3S41 A;  3TU5 A;  3WT0 A;  5AQN A;  2E2P A;  4H0Y B;  1ZC6 A;  3MN6 A;  1HKG A;  5B8H A;  3L6Q A;  1Q81 O;  1ESV A;  1KD1 O;  1VQ6 N;  2E1Y A;  2V7Z A;  3DJC A;  3R1X A;  2ZJR L;  3R8E A;  1Q18 A;  2Q1N A;  2WC9 A;  1ATN A;  3UKU B;  2HST A;  4B1X B;  2HOE A;  3NMU A;  3J8A A;  2P9N B;  3F9M A;  2VYP A;  5M1N A;  3CET A;  1GLL O;  5H1S Q;  4CBW A;  5DM7 L;  2P9S B;  3CPW M;  3CCJ N;  1SZ2 A;  3F2K A;  3CC7 N;  5KPZ A;  3FGU A;  4LC9 B;  1Q86 O;  5EOY A;  4H0X B;  2VGM A;  3MX2 A;  4H0T B;  3B8A X;  3SMS A;  3TPQ A;  4CI6 A;  2H3G X;  3M1F A;  4F9O A;  3MDQ A;  4C1N K;  3D7E O;  2P9I A;  4U67 L;  3LDL A;  4BC3 A;  2D0O A;  3CJ1 A;  3CJB A;  3VGL A;  3EE8 A;  5DM6 L;  4WF9 L;  4ILJ A;  4BQL A;  2P9L B;  5AQM A;  2ZF5 O;  1T6D A;  2WBN A;  3TSP A;  5AQZ A;  3WUH A;  4CZF A;  2OAN A;  1JCF A;  3LM9 A;  1XQS C;  3LL3 A;  2Q0U A;  2IIR A;  2P9K A;  3O9S A;  4GNI A;  2PAV A;  4EHT A;  2W40 A;  4K25 A;  3QB0 A;  4BC4 A;  1VQP N;  3VGM A;  3VEN A;  1GLF O;  1NGC A;  2NZT A;  5M1F A;  1Z6R A;  5AQI A;  5ADX H;  5C0Y A;  3AY9 A;  1GLB G;  4IEE A;  3DXK B;  3I8B A;  3GOI A;  3O9T A;  1TUY A;  2ASM A;  2JWL A;  2P9P B;  2KHO A;  3H1V X;  2GEM A;  3AGK A;  4QS8 A;  2ZGZ A;  5AQX A;  3SAG A;  1VQL N;  4CZI A;  1GLA G;  3G4S N;  4KH6 A;  1KAY A;  4XH1 A;  4JKE A;  1P8Z A;  3U9Z A;  1VAZ A;  4MDA A;  1QZ5 A;  5AQT A;  2NRH A;  4A62 A;  4BRO A;  1D4X A;  3E1Y A;  3A8Y A;  2E20 A;  3PIP L;  3SMP A;  1U2V A;  3W0L A;  3P38 A;  3EKS A;  2E1Z A;  3U4L A;  3G6E N;  1BDG A;  4K42 A;  3H45 C;  2A41 A;  4CZE A;  3KHY A;  4BQZ A;  4IOC L;  2BH1 A;  3HOT A;  5JVH L;  5C2F A;  3FZH A;  2D1K A;  2GUP A;  4XH4 A;  3L4I A;  4BG8 A;  3O9U A;  4YOW A;  3H6E A;  2E88 A;  3LDQ A;  3WXJ A;  4EFH A;  4ILG B;  4MLE A;  1EO1 A;  2IVO A;  4FWO A;  1SQK A;  3OBY A;  1HLU A;  4BR0 A;  2CGL A;  1K8K A;  5AQW A;  3QBX A;  5ADX A;  3E66 A;  4EIA A;  2YCH A;  1TUU A;  4JKG B;  3VEV A;  2QWR A;  1JJ2 M;  1CZA N;  4Y0W A;  3VTI A;  4AM6 A;  2VCP A;  3VOV A;  3T69 A;  4M7Y A;  1WOQ A;  3MCP A;  4BR9 A;  1EQY A;  3CPE A;  1K8A O;  3E9O A;  1VQ4 N;  3CJ9 A;  2YHX A;  3ATV A;  3TTC A;  3IKM A;  3O80 A;  3C65 A;  5E26 A;  4BRD A;  3VTH A;  3TTF A;  3SBG A;  4BRP A;  3SAH A;  4C1N I;  2E2Q A;  1NGH A;  1R59 O;  2YI1 A;  3CCQ N;  4JNE A;  5EY4 A;  3DXM A;  5GIO A;  4PKI A;  3CQX A;  1N8R O;  1MA9 B;  2HBM A;  3CQY A;  4YDU C;  3K9J A;  2FF3 B;  1LOT B;  3A0I X;  4CZL A;  4KH5 A;  3LDP A;  4EAH D;  2E8A A;  3CJC A;  2NRZ A;  3O8M A;  4WFA L;  2GWK A;  2A40 A;  4C23 A;  4YOY A;  2CGK A;  1QQM A;  1ZXO A;  4AM7 A;  4CD1 A;  2CH5 A;  4PHT X;  4U7B A;  1Y64 A;  4CD3 A;  5CE3 A;  5AQG A;  4ISG A;  3R9P A;  3MMV A;  2VWB A;  3ULE B;  5AQV A;  1MDU B;  2QA4 N;  3K9K A;  1W97 L;  4YOT A;  4FVU A;  3A5O C;  2DPN A;  4WQ4 C;  1VQ7 N;  5JLH A;  4BR7 A;  3WQT A;  4FOI A;  4JHD A;  2AA4 A;  1MWM A;  2NRX A;  3U8X A;  3BUZ B;  1KAX A;  4YOR A;  5AQS A;  3VGK A;  5BPM A;  5FPD A;  5LJV A;  3D2E A;  3FE1 A;  3PIO L;  3GDQ A;  1YF5 L;  3ZET A;  2ITM A;  5AQP A;  2A6A A;  4CJ7 A;  4RCH A;  1DGK N;  3CCM N;  4ILH A;  3VF4 A;  5GIN A;  4DQ8 A;  2Q31 A;  1V4S A;  4IEI A;  2QW9 A;  1BOT O;  2GX9 A;  4DHY A;  3WXI A;  5EXW A;  4PL7 A;  4Z94 A;  3WEE A;  5TKY A;  3SK3 A;  4H5W A;  4IXC A;  1IG8 A;  4UY8 O;  2HBK A;  4BR4 A;  4YOV A;  3AAQ A;  3HM8 A;  1YAG A;  3ZX2 A;  4K41 A;  4I6M B;  3O5B A;  3HTV A;  3R3L A;  3VMF B;  3FZK A;  3GL1 A;  4GY2 B;  3O08 A;  4XH5 A;  3I55 N;  1T3V A;  2YJF A;  3QBW A;  4BRG A;  2QWP A;  3CC2 N;  1O13 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...