2FSJA

Crystal structure of ta0583, an archaeal actin homolog, native data
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
325
structure length
318
Chain Sequence
MVVVGLDVGYGDTKVIGVDGKRIIFPSRWAVTETESWKIPVLSTDGGQTKFIYGKYASGNNIRVPQGDGRLASKEAFPLIAAALWESGIHNPVDLVIGSGTPLGTFDLEVKAAKEALENKVLTVTGPEGEVRQFNITRLIMRPQGVGAALYLLNQGIIEQQPGYGVVIDVGSRTTDVLTINLMDMEPVVELSFSLQIGVGDAISALSRKIAKETGFVVPFDLAQEALSHPVMFRQKQVGGPEVSGPILEDLANRIIENIRLNLRGEVDRVTSLIPVGGGSNLIGDRFEEIAPGTLVKIKPEDLQFANALGYRDAAERS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein Ta0583
publication title Crystal structure of an archaeal actin homolog
pubmed doi rcsb
source organism Thermoplasma acidophilum
molecule tags Structural protein
total genus 88
structure length 318
sequence length 325
ec nomenclature
pdb deposition date 2006-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17989 ALP_N Actin like proteins N terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2fsjA02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2fsjA01
3FGUA 4WQ4C 4M7YA 2J4RA 5BN9A 2ITMA 3VENA 5BRHA 3O4WA 1K8KA 3CJAA 3VGLA 2V7YA 3IMXA 2VWBA 3H45C 4JAXA 5AFUA 1V4TA 5TKYA 3IFRA 2ASMA 3L4IA 1J6ZA 1Y64A 4BR0A 3HTVA 3ATUA 4CBXA 2V52B 3MMVA 4FPAA 4BC4A 3I8BA 3LM9A 1HX1A 1NLVA 2E2NA 2P9KA 5AQHA 3U8XA 2IVNA 5AQGA 2GUPA 3VEWA 2GTDA 4BRQA 2CGJA 2P9PB 4K42A 4O8KA 2E20A 3ULEB 2NRHA 3QBWA 2F9WA 2W40A 4H0TB 5EXWA 4K43A 1XQSC 4J8FA 4BR4A 4EAHD 4FL9A 2NLXA 3FE1A 1HKGA 3JS6A 4DQ8A 2E88A 4MLEA 3MN6A 4FOEA 5AQNA 1BWFO 2A6AA 3SMSA 3BF1A 2A40A 3HZ6A 1P8ZA 5JLFA 2ASOA 2P9IA 4BRNA 3MN7A 3UKRA 4PL7A 2QWPA 3AARA 3AAPA 3WEEB 3DAWA 3H3NO 4BRHA 2P9UB 3A5MC 5AQXA 1GLFO 4A2BA 3C7NA 3U4LA 2ZGZA 4FWKA 4GY2B 4JN4A 5AQVA 2Q2RA 5FPDA 2AP1A 3VEVA 4H5RA 1NGGA 2Q31A 3CHWA 5BPMA 3GBTA 3ZETB 1GLJO 1GLEG 1V4SA 2QM1A 4ISFA 4CBWA 3QB0A 5AQJA 1BDGA 4KBOA 5ADXA 1QQOA 1TUYA 3VF4A 5FPEA 1DKGD 2BTFA 2QWMA 4BRLA 3VGMA 1ZBSA 1TUUA 4BRAA 5AQWA 3JXUA 3H46O 3L6QA 1QQNA 4PL8A 3FZLA 3FZHA 3ENHA 3VEZA 3HI0A 4QS8A 3GG4A 2Q1NA 2P9PA 1MWKA 3VGKA 4BR2A 3R8EA 5AQPA 3ULEA 2A3ZA 3MN5A 3O1BA 4BQZA 5F1XA 4DCHA 1NGAA 1GLDG 2A41A 3D7EO 3DXMB 3M6GA 4PKIA 2A42A 1BG3A 1D4XA 5AQFA 5AQUA 2EWSA 4EIAA 4M63C 5KQ8A 1BUPA 4CZEA 3H3OB 1R59O 3EKUA 3KZBA 4H0PA 3CQXA 3FFKB 3O1WA 3GL1A 5AQTA 5AQQA 4DB3A 2Q0RA 3CJ7A 3LDNA 4NO7A 3WEEA 3A5LC 3LDPA 4Y0WA 3FZMA 3WQUA 4FWMA 2Q0UA 1YUWA 5JLHA 2CGLA 3LDOA 2P9UA 4CZLA 2ASPA 3ZEUB 1NBWA 2P9SA 3A5NC 1QZ6A 5AR0A 3VF2A 5BN8A 1EQYA 3QICA 4FWRA 4WQ5A 2HF3A 1DGKN 3M1FA 5AZIB 3ZETA 3QFPA 2CGKA 1RFQA 2UYTA 1YXQA 4DHYA 1YAGA 3QDKA 2PBDA 3WQTA 2IVPA 5BREA 1JCGA 4WQ4A 1WOQA 1ZXOA 3M3ZA 4MLHA 5EX5A 5AQMA 1Z6RA 2QWQA 4O5FA 5AQOA 2E1ZA 4HWIA 3TPQA 1WUAA 2ZF5O 4FO0A 4H0YB 3D2EB 3VEOA 2ZWHA 3OHRA 1Q18A 4PKHA 4BVPA 1IJJA 2W41A 1XUPO 3KHYA 2FXUA 3B8AX 3ID8A 4BR7A 3LDLA 4H0OA 1LOTB 3IUCA 4I6MB 3A5OC 3DXMA 3ENOA 4NB4A 5AQZA 4MO5A 3LM2A 1JCEA 4K25A 5CE3A 5BRDA 3CQYA 2CH5A 3G25A 5KPZA 3VERA 4WYBA 4CZIA 4EHTA 4H5WA 1TYQB 1GLCG 5BPLA 3AAQA 4JD2B 1MA9B 1DEJA 3EZWA 4BQLA 1MWMA 1U6ZA 3GE1A 1HPMA 3MN9A 3P4IA 2WUSA 3ZEUA 1RDWX 2P9SB 3CETA 3FZKA 2E2PA 4CZJA 5JICA 1HJOA 4BC5A 1QHAA 3TU5A 1SZ2A 1GLLO 1CZAN 2P9LB 2FF6A 5ELZA 5JMVA 4FSVA 5E26A 3DXKB 5AZIA 4RTFD 4BC2A 3EKSA 3CJCA 3A0IX 1NMDA 4IXCA 1IG8A 4XEIA 1KAYA 1KAXA 1NGCA 3AY9A 3C0BA 3HM8A 3R9PA 3BEXA 2KHOA 1QZ5A 2D4WA 5AQYA 4B9QA 1H1VA 3A8YA 2VCPA 3FZFA 3VF6A 1BU6O 5AQKA 5AQLA 3D2EA 4B1YB 3MK6A 4B1WB 2GEMA 2H3GX 3VPZA 1QQMA 3BUZB 5BR9A 5KPRA 4IWVA 3CIPA 3LDQA 4IO8A 4C23A 4CZGA 5BPNA 4LC9B 4FWQA 1ZC6A 2GELA 3WUHA 5KPTA 2D1KA 3W0LA 4CD1A 4I6MA 2YJEA 2V51B 1U2VB 3J8AA 3ZX0A 1HKBA 4CZKA 3FLCO 3ZX2A 4BGAA 3HSCA 3ZX3A 1X3NA 4F9OA 1NGDA 4BRMA 1JCFA 2QW9A 2FF3B 3FR0A 4RWTA 1S22A 1OKJA 4JHDB 4BRDA 2YI1A 3HBTA 1NGHA 1TYQA 2PAVA 5EOYA 2YCHA 3O6WA 4JD2A 2NZTA 1NM1A 1T6CA 3IDHA 1SQKA 1ATRA 2BUPA 3H6EA 4BR5A 5B8HA 3WXJA 2FLOA 1BA0A 2E8AA 2D0PA 4YDUC 2P9LA 2YHWA 4JNEA 3O5BA 4BRFA 4H0XB 3DXKA 2YJFA 3KVGA 3O80A 3CERA 4IJAA 3BF3A 4CI6A 1BOTO 2ZGYA 4FWOA 4BC3A 4FWPA 1XC3A 4PKGA 2OANA 5FPNA 4BRGA 1GLAG 3DJCA 4A61A 2VYPA 1NGFA 3U9ZA 4XH4A 3D2FB 3F9MA 3SJHA 1E4FT 1T6DA 4ISEA 4CZMA 1MDUB 2E2QA 3EL2A 4HTLA 4GNIA 2FSKA 3VOVA 4B1XB 5AZJA 3GOIA 1T44A 2HOEA 5F0XA 3VEXA 2E1YA 4ISGA 1U2VA 3RSEB 1GLBG 4AM7A 3SMPA 2I7NA 3W3DA 3UKUB 4EHUA 3DWLA 2YHYA 5AQIA 5AFUH 1Z05A 4B1ZA 3MCPA 4CZFA 1KXPA 2FSNA 2CH6A 3L0QA 4JHDA 2IVOA 2GWKA 4BRCA 4AM6A 4Z94A 4H5TA 3H1QA 5LJWA 4IJNA 4FOIA 1HLUA 3WXIA 4FWLA 3R6MA 5F2RA 4H5NA 2QWLA 4H03B 5FPMA 4B1VA 3CJBA 3WXKA 4B1UB 2Q97A 5BRFA 5EY4A 4CZHA 2P9NB 4CD3A 4BREA 5AQRA 2QWRA 1HUXA 1ESVA 4CJ7A 2GWJA 3ATVA 4QS9A 4MO4A 4RCHA 3UE5A 4FPBA 4CBUA 3O08A 4K41A 3CI5A 4A62A 2IIRA 5E84A 4L3QA 4A2AA 4BRIA 4BRKA 4H0VB 3S41A 3GDQA 3WXLA 1LCUA 1RGIA 3U9DA 4XH5A 3D2FA 2QWNA 1K8KB 4FWSA 1KAZA 2I7PA 1X3MA 3EO3A 3QMLA 1BO5O 4M7XA 5AZJB 3SK3A 2YHXA 3EN9A 3WT0A 3QFUA 4E1JA 2DPNA 4H5VA 3QBXA 4EFHA 2V7ZA 2HMPA 1SAZA 3RSEA 3CJ9A 2QXLA 1BA1A 3MDQA 2P9KB 1E4GT 3UKUA 4BROA 2HF4A 1ATSA 3CJ1A 5ADXH 1NGBA 4BG8A 1G99A 1C0FA 1X9JA 5EVZA 4BG9A 1YVNA 1ATNA 1HKCA 5LY3A 2FSJA 1C0GA 4XH1A 2QWOA 3VEYA 3VETA 4BR9A 1NWKA 3LL3A 4BRPA 5I9EB 4IZ9A 2P9IB 2A5XA 1NGJA 1NGEA 3UKRB 2P9NA 2Q36A 3BP8A 3VESA 4QS7A 3SLCA 3UB5A 4YDUA 5LJVA 4BVOA 1NGIA 4BGBA 4FWNA 5AQSA 4WQ5C 5KQDA 3O8MA 2AA4A 2E2OA 3C7NB 2F9TA 3I33A 1S3XA 2D0OA 3H1VX
chains in the Genus database with same CATH superfamily
3FGUA 5M1QA 4WQ4C 1B9FA 5BN9A 2ITMA 3VENA 5BRHA 1K8KA 2A1SA 1WSEA 4AQYK 2GBZA 4JAXA 5AFUA 4DWIA 5FLXO 5TKYA 2ASMA 2O8EB 4WFNL 4N56A 3ATUA 1NKEA 2V52B 4KB1A 1C1AA 2I5JA 2E2NA 5AQHA 1Q8IA 4CHZA 3JSMA 2GTDA 1U04A 4K42A 3MEEA 3IKMA 1NK5A 2W40A 4OJRA 4YOWA 3KLIA 3G4SN 4J8FA 3SV4A 1HR0K 4DQ8A 4NXMK 1U47A 4MLEA 4FOEA 4YOXA 1QVFM 4DQQA 3MWTA 3HVRA 1VSKA 3UKRA 4FVUA 1VSHA 3DAWA 4BE0A 4KRFA 3H3NO 1IBKK 4F2SA 4OKKA 2P9UB 3TABA 3SPZA 3J7AP 2Q3SA 4JK9A 1RBTA 4C8LA 4OX9K 5TKWA 2Q2RA 3CHWA 1HMVA 2VQFK 3ZETB 4KHSA 1A5XA 1GLEG 1V4SA 3ITHA 4FM0A 2RPIA 3QB0A 2FBVA 4HTUA 3PY8A 4ZTFA 1TUYA 1ASUA 2BTFA 5CZ2A 3PX0A 3VQAA 3VGMA 1RBRA 3K9KA 4BRAA 3OYBA 4C1NI 3QNNA 3SQ2A 3ZT3A 4CW7B 5I3UA 2X6SA 3DRSA 2AJQA 3VEZA 4Z4EA 2WBNA 2O8CB 3EEQA 4FLUA 2P9PA 3VGKA 4BR2A 1U4BA 3R8EA 4PQUA 3ULEA 1X9WA 4Z4GA 3MN5A 3O1BA 3DXMB 1BIUA 2GV9A 1NK0A 2GUIA 2RE2A 4MFBA 1D4XA 3DLBA 3OYMA 1TKXA 1KCFA 1BGXT 3AVJA 5LMUK 2G8HA 4JI4K 3NGIA 2A1RA 4M63C 4CZEA 3FFKB 4R5PA 4C1NK 5I42A 5JLHA 2CGLA 3LDOA 2KKZA 3ZEUB 1NBWA 4UQGA 3AVCA 1GOBA 5AR0A 1EWQA 3VF2A 3NH2A 2B6AA 1JXBA 4WQ5A 3K5OA 3AGKA 1O1WA 1RFQA 1MU2A 1VQ8N 1C0TA 3HPHA 3QDKA 2PBDA 2IVPA 4JI3K 3SCXA 1VQ4N 5KRSA 1Z6RA 1HYZA 3O4QA 3SUQA 2O8BA 4LSLA 3RR7A 3DLKA 2ZWHA 4DTPA 3OHRA 1IV0A 2W41A 1XUPO 3RMAA 3TI0A 4O0IA 3V1RA 4F2RA 1CLQA 4XIUA 2E4LA 4BR7A 3ID8A 3ZSOA 3HOTA 1LOTB 3OYGA 5AQZA 3ENOA 3O9TA 4MO5A 3LM2A 1JCEA 1VQLN 3PSFA 3MAQA 1YJWN 5CE3A 5BRDA 1VQMN 2CH5A 3G25A 4GKJK 5KPZA 1SKSA 4M42A 3VERA 4WYBA 1TAQA 4EHTA 5T7BA 4GV3A 5CR4A 2NRRA 5KTQA 1DEJA 1YHQN 3BDPA 3C6HA 1U6ZA 4ELVA 4ELUA 4BDPA 1HPMA 4FJGA 4Z0UA 1RDWX 1B92A 1ZBHA 3OYFA 1QHAA 2ZQBA 3TU5A 1SZ2A 1K73O 1XC9A 2HSTA 4O5BA 4X64K 4FSVA 3ZCMA 3DXKB 3ID6A 3ZT0A 4BC2A 3CJCA 1S6PA 4DV2K 1IG8A 4XEIA 3NDKA 1OH6A 3C0BA 4DFKA 3J80O 3KKRA 5GIOA 3THYB 5HP1A 1W7AA 3MK6A 3C95A 3M5RA 2OCEA 4G1QA 4LC9B 2JGUA 5DMRA 3G71N 1ZBFA 4FM2A 5KPTA 3OYDA 4CD1A 1VQON 4PA1A 1SKWA 5C15A 3J8AA 1BCMA 4EZ6A 2Z1IA 4DR1K 1X3NA 1SUQA 3CMAN 1XHXA 2DY4A 1QSSA 2W42A 1OKJA 4JHDB 3G6EN 4DUYK 2YI1A 4GW6A 1NGHA 1TYQA 3O4NA 2HB5A 3P1GA 3TAQA 3KLHA 4FYDA 3QLHA 3RWUA 5EU7A 2O8FA 4E7IA 3WXJA 1Z25A 4YDUC 3PV8A 3TSPA 1BI4B 1S9GA 2Z1HA 3I0RA 3MEGA 2BH1A 2XO7A 1UWBA 4F8RA 1YT3A 3O80A 4K8ZA 2PFUA 4IEEA 3AVMA 1X9SA 3QINA 3LALA 1Q86O 2ZGYA 4FJJA 2OANA 4Q0BA 1NOZA 1YI2N 4FK2A 1NOYA 3KIOA 3KD5E 4DR5K 4XH4A 3O3FA 3D2FB 4LF4K 3NGZA 4FXDA 1JXEA 2ZE2A 4C8OA 3EL2A 2XRIA 3AVKA 1C6VA 4GNIA 1R0AA 3VOVA 3VQ6A 5AZJA 3PSIA 4A5AA 4H4MA 4WFAL 4DV3K 1ILYA 4M3YA 1ASWA 1J9AA 1LWFA 4YY3K 1U2VA 4FLTA 3LANA 1XMQK 3QERA 2JLEA 2E6MA 2Y1JA 3DWLA 1JLCA 3MCPA 4CZFA 4E1NA 3S3MA 3L0QA 1Q9XA 1XNRK 4BRCA 1Q81O 1VQPN 4RW6A 3H1QA 3AO4A 3H08A 3WXIA 4LSNA 3IRXA 3R6MA 4H03B 4KPYA 4LF7K 2NRXA 4KTWA 4DSFA 2QWRA 4FJKA 2OYQA 5M1FA 4NCGA 4CJ7A 3AVIA 1RT2A 5M1PA 4MO4A 3UE5A 4FPBA 1YJ9N 3SPYA 2EX3A 1HPZA 4L3QA 2F96A 3QNOA 1S9EA 2UXCK 3GDQA 3VA3A 4XH5A 2HHUA 4HUGA 4CJVA 1FKPA 1FKOA 3MWPA 2O8DA 1WNSA 1EO1A 3LWMA 4B9TA 3OJSA 4M7XA 5AZJB 4Z4FA 2YHXA 3M8QA 2DPNA 4H5VA 1VRUA 2UUCK 1VSFA 3CXCM 2QEXN 3CJ9A 4FW2A 4FZZA 1E4GT 4KHPK 2KLAA 2HHVA 5JVGL 4FJ5A 3CJ1A 4CEFA 3MXIA 4BG8A 1VAZA 1TK0A 3DM2A 3OVNA 2QWOA 3ZSXA 3VETA 4BR9A 1WLJA 2VQEK 3WNGA 4EP4A 2P9NA 4B3SK 4FCYA 5GAHP 4B9UA 3SLCA 3DRRA 3T7ZA 2LSNA 3T19A 1RBVA 1NGIA 4FWNA 5KGWA 1NK9A 2UUAK 4KHYA 2PYLA 4LY7A 4CF1A 2E2OA 3C7NB 4B3RK 3I33A 2D0OA 4IG0A 4M7YA 3M8SA 3CJAA 3VGLA 2W6KA 3AO5A 1L3UA 3IMXA 4DR2K 4Q5VA 4FJXA 3L4IA 4FJMA 1J6ZA 4Y1CA 3EY1A 3AVBA 3HTVA 1VK0A 4YOUA 4DTUA 2PYJA 3KLFA 3I8BA 3SAGA 2P9KA 3SUPA 5AQGA 5J2NA 2GUPA 5KGXA 4M3XA 4ILGB 1UA0A 4X66K 3TANA 2E20A 4Z4CA 1UA1A 5EXWA 4CJ5A 2HNYA 2ITGA 1J5OA 1YJNN 3RMDA 4BR4A 4FL9A 1HKGA 3JS6A 3DRPA 1OH7A 3SMSA 3BF1A 2A40A 1RDDA 2G8KA 1P8ZA 2HNZA 3OY9A 1LWEA 4BRNA 4DQRA 4JRQA 3ALYA 4H8KA 2W6LA 3NBPA 4CGGA 3OYKA 4CEAA 1T3VA 4CEDA 3AARA 3AAPA 2HHTA 4HCCA 1QE1A 4AHVA 1D5AA 2R7YA 4M41A 1JL2A 4CFBA 4A2BA 2KW4A 3THWB 5FPDA 3U3GA 3Q7CA 2EHGA 2F8TA 3E66A 2WC9A 1KRPA 1Y97A 2Q31A 3L2UA 4B3MK 5BPMA 4KV8A 2QM1A 4DU4A 1I94K 2WFBA 3SBGA 5ADXA 5H1SQ 1QQOA 3SI6A 3KTQA 4MDBA 3VF4A 5FPEA 2O8EA 4BRLA 2ZD1A 1RTDA 1IG9A 2RF2A 3K57A 2G8VA 3H46O 2ETJA 1IBMK 3L6QA 4A59A 4PL8A 3K58A 3FZHA 3DLHA 4JKBA 2UU9K 3GG4A 3O3GA 4OPJA 5AQPA 4CF0A 4JRPA 2DFFA 2NUBA 2A41A 3D7EO 3TAGA 4N5SA 1LV5A 3QIOA 3O9SA 4GVMA 5CHIA 2OPSA 4MQ3A 3NMUA 4PUOA 1S1VA 3H3OB 4H0PA 5AQQA 3D45A 4DB3A 2Q0RA 1JLGA 3A5LC 3OYAA 3HP9A 2FC0A 3WQUA 2Q0UA 3AVFA 4FZYA 1C1BA 2P9UA 3PO5A 3KWGA 4CZLA 1D9DA 3T69A 1NG9A 4CJTA 1C1CA 1TAUA 3EE8A 5C2DA 3ZT4A 5BN8A 2Y1IA 5GINA 2HF3A 5AZIB 3ZETA 1WSGA 4AHUA 4O44A 3RVCA 4DV0K 2QKKA 2UYTA 1YXQA 4DHYA 1YAGA 1D8YA 3C65A 4WQ4A 1KLNA 1ZXOA 3SAFA 4MLHA 4CF8A 5EX5A 3LPUA 4LF9K 3C6TA 4O5FA 3THVA 2E1ZA 1WUAA 3D2EB 3TR8A 3VEOA 4BVPA 1Q18A 4PKHA 3JYTA 4DFJA 2O8CA 3VQ4A 1NK7A 3AVNA 4GV9A 2X78A 3OA9A 3DLEA 4CJ3A 3QEXA 4H0OA 3DXMA 4NB4A 4CEQA 4JK7A 1KFDA 3LP1A 2F4VK 5GIPA 4K25A 3VQCA 4KKOA 1KVBA 3EZ5A 4DR3K 4OVLA 3AAQA 4LH5A 4E7JA 1MA9B 4LFCK 1SKRA 3ZEUA 4CZJA 3CMEN 1HJOA 5KRTA 4BC5A 3N4PA 3C6UA 1GLLO 2P9LB 4ID1A 2ZJPL 1NKBA 1A5WA 4PWDA 5JMVA 1VSEA 1OH8A 5D3GA 3EKSA 3A0IX 4OKJA 3AV9A 1IH7A 2KQ2A 5JS2A 1KAXA 4FK0A 4IEIA 4DTNA 4DF4A 2VWJA 4IOXA 4B9QA 4IFVA 4YFUA 4LH4A 4JYAK 1H1VA 3A8YA 4W5NA 4DTSA 1Q9YA 3L8BA 5AQKA 2G8UA 4HHTA 5AQLA 4BDZA 1VQ5N 3DLGA 4B1WB 4BE1A 4IWVA 1W97L 3E01A 2RN2A 4FWQA 4JKEA 3W0LA 4FZXC 2YJEA 1VSIA 4YHHK 4CK2A 4FM1A 2V51B 1HKBA 4JI7K 3ZYYX 4CZKA 1LW2A 3FLCO 4F9OA 1NGDA 3O9UA 4DS4A 1JCFA 2QW9A 1WAJA 2FF3B 3FR0A 1S22A 4OGCA 4RWTA 3E1YA 3O6WA 2DTUA 1JLFA 1VHXA 1NM1A 2P5GA 1J5EK 3BGRA 2XHBA 4KAZA 2BUPA 4BR5A 3FFIA 1UAXA 4F3OA 4RW9A 2YHWA 4MDAA 2RKIA 2QK9A 4LD0A 3DXKA 5SWMA 3CERA 4IJAA 2OPPA 4YOYA 2WTUA 1U45A 4FWPA 1XC3A 1SV5A 4A61A 3ZLJA 4DV7K 1VRTA 1WSIA 1IKXA 4OLBA 3THYA 3Q7BA 4C8NA 3F2KA 3DMJA 3F9MA 4EP5A 3TAFA 1E4FT 1T6DA 3AVHA 1DTQA 1S1UA 4ISEA 1MDUB 2FSKA 3LZIA 1L5UA 4CJ4A 3CCJN 1T44A 3NHGA 3OYNA 3VEXA 4YORA 3RSEB 1GLBG 4AM7A 3ISNC 3SMPA 3RMBA 4B8AB 5AFUH 3CCMN 1Z05A 4E0DA 3C94A 2FSNA 1EXQA 4JHDA 3VA0A 2IVOA 3RRHA 2GWKA 3KKSA 4AM6A 5C2FA 4H5TA 1K6YA 4IJNA 1HLUA 1X1PA 3P5JA 3WNEA 4CJKA 2YKMA 2FBYA 5FPMA 2D5RA 3CJBA 3DOKA 1QQCA 3QEVA 4YOVA 2Q97A 5BRFA 2VGNA 3L2QA 4B9NA 1J53A 1BI4A 4CZHA 4CD3A 1ASVA 5AQRA 2G8FA 1ESVA 1RT5A 1RDCA 4X62K 4K41A 3CI5A 5LL6Z 3MEDA 5E84A 1KTQA 1P90A 3S3OA 4H0VB 2OZSA 4DTXA 2HHHK 3S41A 3ENBA 5FRNA 3PIPL 3D2FA 3ZSWA 3TSQA 4DV5K 1RTHA 2I7PA 3MXMA 1FXXA 3HP6A 2DFHA 3ULDA 4CJWA 1S72N 4FJNA 1JJ2M 4J2EA 4E1JA 2HHWA 3QBXA 3HT3A 1RBUA 2V7ZA 5C25A 1NJYA 4JI5K 2HMPA 4CGJA 2QXLA 4DTOA 4BROA 4CJQA 3DI6A 1ATSA 2PY5A 4WF9L 1YF5L 3SQ0A 1F21A 1ZYQA 1C0FA 2Z1GA 3AA4A 2YX6A 3T1AA 1YVNA 1ATNA 1NMNA 3QESA 5LY3A 2FSJA 4GV6A 2ZM6K 4FLVA 1W9HA 1NWKA 4BWMA 2BE2A 3LL3A 4KB0A 4DF8A 5I9EB 1XHZA 4M3WA 1BL3A 3HVTA 2P9IB 2A5XA 3A2FA 4CK1A 3P39A 4FJLA 1NGJA 2XY7A 3MX2A 3BP8A 2D0CA 3VESA 3QEWA 4QS7A 4YDUA 2NRVA 1N36K 5KQDA 4CHNA 4JS5A 1YIJN 1HNWK 2NRTA 3TAPA 4DQPA 3O8MA 2AA4A 3OS1A 3TARA 1S3XA 3R3LA 4DQIA 2IDOA 2J4RA 3O4WA 1TGOA 2V7YA 1V4TA 1WN7A 2O4IA 3IFRA 4KI4A 2KZMA 1Y64A 3QETA 4BR0A 3HK2A 3K5NA 1NNEA 2JWKA 2ATQA 3HJFA 4C8MA 3MMVA 3RRGA 4FPAA 1RDBA 4BC4A 4HVJA 3LM9A 4JI6K 1RDAA 3VQQA 3VEWA 2HBMA 2CGJA 3F73A 1QTMA 1TV6A 4I9LA 3V9SA 3DLRA 3CFOA 2F9WA 4DU3A 2F7TA 4G9ZA 4M3ZA 4RW8A 1NU0A 2HMIA 4EAHD 4DSJA 2OTJN 4GMJB 2IOCA 4JI0K 2NLXA 1E3MA 4DR7K 5AQNA 3B6OA 3DYAA 5C12A 3CCQN 1M90O 3HZ6A 3L4QA 3CCUN 3HM9A 4K8XA 2ASOA 1J54A 3LP3A 3MN7A 4IG3A 4DTRA 4PL7A 2QWPA 4E7LA 3WEEB 1N8RO 5C24A 3CC2N 4BRHA 3U6FA 3A5MC 4FJ9A 2HVIA 3N4QA 3C7NA 4FWKA 3HOSA 3AA5X 5AQVA 3KK1A 1N32K 4CJUA 3VEVA 4ZHRA 1BHLA 4H5RA 5BR8K 1NGGA 3B6PA 3OYJA 4DSIA 4ISFA 4BE2A 4KHWA 3J7YP 4KBOA 4BY9C 2HBLA 4KHQA 5GAEP 3SUOA 1DKGD 1CXQA 3CCRN 4FJ7A 3E9OA 3JXUA 4DR6K 4FLWA 4CERA 3KK3A 1YITN 1L3TA 4CIEA 2VWKA 3I55N 1QQNA 1JLQA 3E9PA 3ENHA 1L3SA 4CJLA 4QS8A 5CY4A 4J2DA 3CC7N 1YTUA 4A57A 4BQZA 1GLDG 4C8KA 1EWRA 3M6GA 4OGEA 1KVAA 3CM5A 2A42A 1BG3A 3HL8A 1KQSM 1CZBA 4RW4A 2JWLA 2EWSA 4EIAA 1BUPA 5SZTA 3G10A 3EKUA 3CQXA 3O1WA 3GL1A 3AO1A 1IKWA 4NO7A 3KJVA 4DSKA 4QOZB 4Y0WA 1RNHA 3MXJA 3NH1A 4FWMA 3CG7A 1WSJA 1KD1O 1YUWA 1N5YA 2YNIA 4KO0A 5K14A 3SQ1A 2WOMA 1HNZK 5IT9O 2P9SA 3MCAB 4JI8K 3A5NC 4JK8A 3THWA 4JEPA 3QICA 4FWRA 4YNQA 1DGKN 1SL2A 3O9RA 2CGKA 2WONA 3CQ8A 1VQ6N 1WOQA 2NNWA 2X6NA 4PY5A 5AQMA 2QWQA 4N41A 4E1MA 3P31A 1RT6A 3F5TA 5AQOA 1XMOK 1T7PA 3SV3A 4JI1K 2ZF5O 3SZ2A 4AHRA 3KHYA 3VQ5A 3ZSRA 4DLGA 5HRRA 2FXUA 1HYSA 4IFYA 3CPWM 4I6MB 4HUFA 4ILJA 4CJRA 5JS1A 3IS9A 1SL0A 2Z1JA 4WCEL 3OYIA 3M8RA 3HRGA 1WB9A 1JLEA 4CZIA 1GLCG 5BPLA 4JD2B 4CF2A 3EZWA 4KH6A 1TK8A 1T03A 1MWMA 1HNVA 3GE1A 3P4IA 2WUSA 2P9SB 3CETA 3FZKA 2QXFA 3T1YK 5HLFA 1KC8O 1CZAN 4BWJA 5AZIA 3O3HA 3AGRA 3BY5A 3NF6A 4JV5K 1NMDA 3V81A 5J2MA 1KAYA 4DSLA 2UXDK 1NGCA 3AY9A 3R9PA 3BEXA 5HL7L 2D4WA 1N6QA 1OVYA 3CF5L 4O8UA 4FJHA 2VCPA 1JLBA 3VF6A 1BU6O 3D2EA 3LP0A 5DK5A 1LAWA 4B1YB 2GEMA 2H3GX 3VPZA 3BUZB 3CIPA 4FW1A 2ZJRL 4IO8A 3SUNA 3CCLN 4DKWA 4CVNE 1ZC6A 2D1KA 3SNNA 1EKEA 3V4IA 4NCAA 4CFDA 2PZSA 4GKKK 3ZX0A 5HOOA 3TWHA 1QSLA 3HSCA 3T3FA 2YHBA 4V19S 4BRDA 1TKTA 3VQDA 4QAGA 5EOYA 3O9QA 2YCHA 4W5OA 3K59A 5C42A 3QO9A 5C0YA 3QEIA 4IOAL 1HQUA 3KK2A 3IDHA 1HRHA 1ATRA 3H6EA 1EETA 5HRPA 5B8HA 3AO3A 4DTJA 2E8AA 4FLYA 1CZ9A 2P9LA 1VQ7N 4CGIA 3BZCA 2D0AA 3EE9A 1WBBA 3SYZA 3THXB 1BOTO 1OVQA 1ITGA 4PKGA 3NE6A 1RT4A 4H4OA 4BRGA 4LF5K 1GLAG 3K2PA 4IDHA 1NGFA 1VSDA 3LAMA 2YNGA 4M3RA 3SJHA 3SBTA 4CZMA 1LW0A 3J7ZO 5HBMA 4WFBL 3CYMA 3V6DA 5J2PA 3GOIA 3TAMA 4CHQA 2YNFA 1WAFA 4ISGA 1XNQK 2I7NA 3UKUB 1D9FA 3LZJA 2YHYA 4NCBA 1S6QA 4B9LA 4AHTA 3ZSYA 4JKGB 3ZT2A 4DU1A 3RR8A 1IBLK 4CIFA 4Z94A 4LFAK 5LJWA 3SQ4A 1X9MA 3HO1A 4B1VA 4B1UB 1NJZA 5EY4A 1I39A 1RTIA 4JKCA 1HUXA 4CHYA 2QA4N 2GWJA 3ATVA 4ID5A 3RTVA 1T05A 1JLAA 4BRIA 1NJIO 1ZBUA 1LCUA 3U9DA 3L2RA 1K8KB 1VSLA 4FWSA 1X3MA 3EO3A 1BO5O 4CECA 3EN9A 3QFUA 1KSPA 3WXMB 4EFHA 3PIOL 3RSEA 1EP4A 1BIZA 1SAZA 2X74A 4CEEA 1BA1A 5HRNA 2HF4A 4AHSA 3ZSQA 4DFMA 3OYEA 4KHNA 5ADXH 1NGBA 3VQEA 3CD6N 4N76A 3KLEA 4DFPA 1ZBLA 1G99A 4IKFA 3R1XA 2KTQA 2YV0X 5EVZA 1W2BM 3P38A 4BG9A 1QHTA 2OTLN 2KFZA 1HKCA 3LDSA 3E9LA 4XH1A 4X65K 3VEYA 4J2BA 4KTQA 4AF1A 4I2PA 5IWAK 4BRPA 4KREA 1IKVA 1NGEA 4L8RB 3UKRB 2YNHA 3VQ8A 4JKFA 3PX6A 1KVCA 1OH5A 2KZZA 4BVOA 1TVRA 3BZKA 1U49A 4WQ5C 4NYFA 4IDKA 4KFBA 4CJSA 1Z26A 2F9TA 3VQ9A 3CM6A 3H1VX 1NJXA 3P83D 4CK3A 3NF9A 4O4GA 1O13A 2IS3A 2VWBA 3H45C 4OPHA 5FROA 4B9MA 4LFBK 2O4GA 5HRSA 1QSYA 4CBXA 2OPRA 1HX1A 1NLVA 3U8XA 1VQNN 2IVNA 4DLEA 4F4KA 4GVEA 4BRQA 2P9PB 3UIQA 4O0JA 3OJUA 4O8KA 3ULEB 2NRHA 3QBWA 3V1QA 4H0TB 3LP2A 4K43A 4HUEA 1XQSC 4B3TK 1VQ9N 2OZMA 3ZT1A 4EZ9A 4CGHA 5A2QO 3FE1A 4U7BA 3AVGA 2E88A 4ICLA 3MN6A 4CGFA 1BWFO 2A6AA 4FJ8A 5JLFA 2P9IA 3S9HA 2HHSA 3HSTB 2B5JA 3SJJA 4DR4K 2G8WA 1NK4A 4IBNA 4CHPA 3QIPA 4TSXA 3NVMA 4RG8A 5AQXA 1GLFO 1IKYA 3U4LA 2ZGZA 1EX4A 2F8SA 4GY2B 4JN4A 3TTCA 1NK6A 3VTIA 2AP1A 4CIGA 4CHOA 3I0SA 3GBTA 5MLCQ 1GLJO 4I2QA 2BGGA 4CBWA 2DFEA 5AQJA 4KI6A 1BDGA 1Q7YO 2QWMA 1TL1A 3CFPA 1ZBSA 1QVGM 4I7FA 2VG5A 1TUUA 2P1JA 4E19A 5AQWA 4BDYA 3LAKA 4BACA 2O8BB 1M1KO 4I9QA 3HYFA 3FZLA 3OTOK 1WSHA 3HI0A 4CFCA 2Q1NA 3AVAA 1WBDA 1MWKA 1K9MO 2A3ZA 2FBXA 1TKZA 5F1XA 4DCHA 2HW3A 1NGAA 1LAVA 1BQMA 4PKIA 3PO4A 2XY5A 3T1HK 3KK7A 5AQFA 5AQUA 1RILA 3HPOA 4N47A 1SL1A 5KQ8A 3K5LA 4DV1K 1R59O 3KZBA 3L2VA 4OO1J 4LF6K 5AQTA 3CJ7A 3LDNA 3WEEA 3TTDA 3LDPA 3NFAA 3FZMA 4DTMA 1XWLA 1VSMA 1HQEA 2E6LA 5DM7L 2ASPA 3VTHA 1A5VA 2QTDA 4AHCA 1NKCA 3V9ZA 1QZ6A 1DT9A 1EQYA 3OBWA 3MECA 1KFSA 3M1FA 3QFPA 1HNIA 3AA3A 3WQTA 3OS2A 5BREA 1JCGA 2QI2A 2IGIA 3M3ZA 1DLOA 3IAYA 4R79A 4HWIA 1T8EA 3TPQA 3KD1E 4FO0A 4H0YB 1RT3A 3NGYA 4FLZA 4E7HA 3NF8A 3M8PA 1IJJA 1S1TA 4IFEA 3B8AX 3LDLA 3IUCA 1HNXK 3A5OC 4CEOA 2XY6A 2IC3A 1TL3A 1IO2A 4W5RA 1TK5A 4DMNA 4Z4IA 5HROA 4KTZA 1S1WA 3CQYA 3TTFA 1BCOA 3VMFB 4NLBA 4B9SA 3OYLA 1TKDA 4H5WA 1TYQB 4JS4A 4Z4HA 1VQKN 1JKHA 1G15A 3AO2A 4BQLA 3MN9A 5JICA 4PHTX 2E2PA 2O8FB 2UUBK 3HXMA 1DTTA 3AA2A 3I8DA 3L3UA 2FF6A 5ELZA 4NLCA 2NRWA 4E89A 5E26A 5KI6A 4JLHA 4RTFD 2RHKA 4IXCA 3EYZA 4WE1A 4W5TA 3L3VA 3HM8A 4J2AA 2KHOA 1QZ5A 5AQYA 2QKBA 3L2WA 2YHAA 3FZFA 1S5JA 1KLMA 3LPTA 4B9VA 4AH9A 4UY8O 4F3TA 2UXBK 1QQMA 5BR9A 4DS5A 5KPRA 2HNDA 3RMCA 3CCEN 3LDQA 3NCIA 3F9KA 4C23A 1VSJA 4CZGA 3JAMO 4KH5A 5BPNA 5M1NA 4CJFA 1RBSA 3CCVN 4LF8K 1C0UA 2GELA 3WUHA 3J81O 2D0BA 1ZBIA 3TAEA 4I6MA 3OYHA 4FK4A 4KH4A 1U2VB 1N34K 3DOLA 4CFAA 1RT7A 3OW2M 1WSFA 4JKDA 5CZ1A 3ZX2A 4BGAA 3ZX3A 1GOAA 1S1XA 2OPQA 3V1OA 4BRMA 1YVUA 3V9UA 3OS0A 1U48A 3HBTA 2PAVA 1HYVA 4JD2A 2P5OA 2NZTA 4CJPA 5M1KA 1T6CA 3K9JA 4B08A 1XI1A 1SQKA 3TSUA 2HHQA 4IO9L 3G0ZA 1W0HA 1FK9A 5C10A 2FLOA 1BA0A 2D0PA 2GX9A 4JNEA 3NH0A 3O5BA 4M3UA 4DQSA 4BRFA 4FVMA 2BANA 4H0XB 3U3YA 2YJFA 3KVGA 2VG6A 4A5BA 3BF3A 3ZSVA 3KWIA 4CI6A 3IG1A 4FWOA 4BC3A 3QEPA 1JL1A 5FPNA 3SAHA 3DJCA 1RCHA 5FDLA 2VYPA 5CYQA 3U9ZA 4YOTA 3CCSN 4CCHA 2E2QA 4HTLA 4KHUA 4ILHA 2O8DB 4M3TA 3KLGA 4B1XB 4QCLA 3PLAA 1K8AO 1BQNA 3D6RA 1GOCA 3VQPA 2HOEA 3CFRA 4JKHA 5F0XA 3C6AA 2E1YA 1SS6A 1RDUA 3VQBA 3PUFA 4HCBA 5J1EA 3NF7A 4U67L 3W3DA 4EHUA 4Y1DA 3WNFA 5AQIA 5AJ3K 2NRZA 5FRMA 4FJIA 5GADP 4B1ZA 1KXPA 2CH6A 3AVLA 4IOCL 3K5MA 4W5QA 1BISA 1YTAA 4FOIA 2E5LK 1RT1A 4CGDA 1C0MA 4FWLA 5F2RA 4H5NA 2QWLA 3LWLA 2KFNA 3OYCA 4NXNK 3WXKA 2YKNA 4ZTJA 4OLAA 4OKEA 2P9NB 4BREA 4CJEA 1Q82O 3CC4N 5CYMA 1N33K 4QS9A 4CESA 3D0PA 4E7KA 4RCHA 3THXA 4OPKA 3WNHA 4CBUA 3K0SA 3O08A 4RW7A 4CEZA 3PX4A 4A62A 3S3NA 2IIRA 3V9XA 2OA8A 4NYNA 4A2AA 4DV6K 4BRKA 1QS4A 2P51A 4OPAA 5DM6L 3WXLA 1RGIA 5JVHL 4E3SA 1REVA 2VGMA 2QWNA 1KAZA 3HPGA 1I3AA 3QMLA 3SK3A 2XY8A 3WT0A 3V9WA 2BDPA 5J2QA 2B4JA 4JI2K 4CF9A 4ELTA 1LWCA 2ZJQL 3MDQA 4O55A 4DUZK 2P9KB 3UKUA 3ASMA 2HBKA 4CEBA 1B9DA 4FLXA 2FBTA 4JKGA 4CE9A 2HBJA 3VN5A 3OBYA 1X9JA 1CXUA 1RTJA 3VQ7A 3I56N 4B8CA 1FW6A 4B3OA 4AILC 2G8IA 3DLLL 3NVKA 1C0GA 5M1OA 4DG1A 3ZSZA 2HHXA 3CPEA 2VG7A 4DSEA 4IZ9A 3MX5A 2Q36A 4K0KK 3NAEA 1NJWA 2IAJA 4M45A 1HJRA 5LMNK 2HVHA 5LJVA 5E41A 3UB5A 4DV4K 4BGBA 5AQSA 4JKAA 1NK8A 1UOCA 1FJGK 5GAGP 1L3VA
chains in the Genus database with same CATH topology
3FGUA 5M1QA 4WQ4C 4M7YA 2J4RA 5BN9A 2ITMA 3VENA 5BRHA 3O4WA 1K8KA 3CJAA 3VGLA 2V7YA 3IMXA 1O13A 2VWBA 4OPHA 3H45C 4JAXA 5AFUA 1V4TA 5TKYA 3IFRA 2ASMA 3L4IA 1J6ZA 1Y64A 4WFNL 4BR0A 3HTVA 3ATUA 2JWKA 4CBXA 4YOUA 2V52B 3MMVA 4FPAA 4BC4A 3I8BA 3LM9A 1HX1A 1NLVA 2E2NA 2P9KA 5AQHA 3U8XA 3SAGA 1VQNN 2IVNA 5AQGA 2GUPA 3VEWA 2GTDA 4GVEA 2HBMA 2CGJA 2P9PB 4ILGB 4BRQA 4K42A 4O8KA 2E20A 3IKMA 3ULEB 2NRHA 3QBWA 2F9WA 2W40A 4H0TB 5EXWA 4K43A 4YOWA 3G4SN 1XQSC 2F7TA 4J8FA 1YJNN 4G9ZA 1VQ9N 4BR4A 4EAHD 4FL9A 2OTJN 2NLXA 3FE1A 1HKGA 3JS6A 4DQ8A 4U7BA 2E88A 4MLEA 3MN6A 4FOEA 5AQNA 1BWFO 2A6AA 3SMSA 3BF1A 5C12A 2A40A 3CCQN 3HZ6A 3L4QA 1M90O 4YOXA 3CCUN 1QVFM 1P8ZA 5JLFA 2ASOA 2P9IA 3MWTA 4BRNA 3MN7A 3UKRA 4FVUA 4PL7A 1T3VA 2QWPA 3AARA 3AAPA 3WEEB 3DAWA 3H3NO 1N8RO 3CC2N 4BRHA 2P9UB 3NVMA 3A5MC 5AQXA 1GLFO 4JK9A 4A2BA 3N4QA 3C7NA 3U4LA 2ZGZA 4FWKA 4GY2B 4JN4A 5AQVA 5TKWA 3TTCA 2Q2RA 3VTIA 5FPDA 3HOSA 3Q7CA 2AP1A 3E66A 2WC9A 3VEVA 4H5RA 1NGGA 2Q31A 3CHWA 5BPMA 3GBTA 3ZETB 1GLJO 5MLCQ 1GLEG 1V4SA 2QM1A 4ISFA 4CBWA 3QB0A 5AQJA 1BDGA 2WFBA 4KBOA 3SBGA 5ADXA 1QQOA 2HBLA 5H1SQ 1TUYA 4MDBA 5GAEP 3VF4A 5FPEA 1Q7YO 1DKGD 2BTFA 2QWMA 4BRLA 3CCRN 3VGMA 1ZBSA 1QVGM 1TUUA 3K9KA 3E9OA 5AQWA 3JXUA 4BRAA 3H46O 4C1NI 1YITN 3L6QA 4A59A 1M1KO 3I55N 1QQNA 4PL8A 3FZLA 3E9PA 3FZHA 3ENHA 2WBNA 3VEZA 3HI0A 4JKBA 4BY9C 4QS8A 3GG4A 2Q1NA 2P9PA 1MWKA 1K9MO 3VGKA 4BR2A 3CC7N 3R8EA 5AQPA 3ULEA 2A3ZA 4A57A 3MN5A 3O1BA 4BQZA 5F1XA 4DCHA 1NGAA 1GLDG 2A41A 3D7EO 3DXMB 3M6GA 4PKIA 2A42A 1BG3A 1KQSM 2RE2A 3O9SA 1D4XA 2JWLA 5CHIA 3KK7A 5AQFA 5AQUA 2EWSA 4EIAA 3NMUA 4M63C 5KQ8A 1BUPA 4CZEA 3H3OB 1R59O 3EKUA 3KZBA 4OO1J 4H0PA 3CQXA 3FFKB 3O1WA 3GL1A 5AQTA 5AQQA 4DB3A 2Q0RA 3CJ7A 3LDNA 4NO7A 3WEEA 3A5LC 3TTDA 3LDPA 4Y0WA 4C1NK 3FZMA 3WQUA 4FWMA 1KD1O 2Q0UA 1YUWA 5JLHA 2CGLA 3LDOA 2P9UA 5DM7L 3KWGA 4CZLA 2KKZA 2ASPA 3T69A 3ZEUB 3VTHA 1NBWA 2P9SA 3MCAB 2QTDA 3A5NC 4JK8A 1QZ6A 1DT9A 5AR0A 3EE8A 3VF2A 5C2DA 4JEPA 5BN8A 1EQYA 3QICA 4FWRA 3OBWA 4WQ5A 3AGKA 5GINA 2HF3A 1DGKN 3M1FA 5AZIB 3ZETA 3QFPA 3O9RA 2CGKA 1RFQA 3RVCA 2UYTA 1YXQA 1VQ8N 4DHYA 1VQ6N 1YAGA 3QDKA 2PBDA 3WQTA 2IVPA 5BREA 1JCGA 2QI2A 3C65A 4WQ4A 1WOQA 2NNWA 1ZXOA 3SAFA 1VQ4N 3M3ZA 4MLHA 4R79A 5EX5A 5AQMA 1Z6RA 2QWQA 4O5FA 3P31A 3F5TA 2E1ZA 5AQOA 4HWIA 3TPQA 1WUAA 2ZF5O 4FO0A 4H0YB 3D2EB 3VEOA 2ZWHA 3OHRA 1Q18A 4PKHA 4BVPA 1IJJA 2W41A 1XUPO 3KHYA 4IFEA 4GV9A 3OA9A 2FXUA 3B8AX 3ID8A 4BR7A 3HOTA 3CPWM 3LDLA 4H0OA 1LOTB 3IUCA 4I6MB 3A5OC 3DXMA 3ENOA 3O9TA 4JK7A 4NB4A 5AQZA 4ILJA 4MO5A 5GIPA 3LM2A 1JCEA 1VQLN 1YJWN 4K25A 5CE3A 5BRDA 1VQMN 4WCEL 3CQYA 2CH5A 3TTFA 3G25A 3HRGA 5KPZA 3VERA 4WYBA 3VMFB 4CZIA 4NLBA 4EHTA 4H5WA 4GV3A 1TYQB 1GLCG 5CR4A 2NRRA 3AAQA 4JD2B 5BPLA 1MA9B 1VQKN 1DEJA 1YHQN 3EZWA 4KH6A 3C6HA 4BQLA 1MWMA 1U6ZA 3GE1A 1HPMA 3MN9A 3P4IA 2WUSA 3ZEUA 1RDWX 2P9SB 3CETA 3FZKA 2E2PA 4CZJA 4PHTX 5JICA 1HJOA 3CMEN 4BC5A 3N4PA 1QHAA 3TU5A 1KC8O 1SZ2A 1K73O 2P9LB 1GLLO 1CZAN 2ZJPL 2HSTA 2FF6A 5ELZA 4NLCA 5JMVA 4FSVA 2NRWA 5E26A 3DXKB 3ID6A 4RTFD 5AZIA 3AGRA 3EKSA 4BC2A 3CJCA 2RHKA 1NMDA 3A0IX 4IXCA 1IG8A 4XEIA 1KAYA 1KAXA 1NGCA 3AY9A 3C0BA 3HM8A 4IEIA 3BEXA 3R9PA 2KHOA 5HL7L 1QZ5A 4IOXA 2D4WA 5AQYA 4B9QA 1OVYA 3CF5L 4O8UA 1H1VA 3A8YA 5GIOA 2VCPA 3FZFA 3VF6A 1BU6O 5AQKA 5AQLA 1VQ5N 3D2EA 4B1YB 4UY8O 3MK6A 4B1WB 2GEMA 2H3GX 3VPZA 1QQMA 3BUZB 5BR9A 5KPRA 3CCEN 4IWVA 3CIPA 3M5RA 3LDQA 2ZJRL 4IO8A 1W97L 4C23A 4CZGA 5M1NA 4KH5A 5BPNA 3CCVN 3CCLN 4LC9B 4FWQA 4DKWA 3G71N 1ZC6A 2GELA 3WUHA 5KPTA 2D1KA 4JKEA 3W0LA 4CD1A 4I6MA 1VQON 2YJEA 5C15A 2V51B 4KH4A 1U2VB 3J8AA 3ZX0A 5HOOA 1HKBA 3OW2M 4JKDA 3ZYYX 4CZKA 3FLCO 3ZX2A 4BGAA 3HSCA 3ZX3A 1X3NA 4F9OA 1NGDA 3CMAN 3O9UA 4BRMA 1JCFA 2QW9A 2FF3B 3FR0A 4RWTA 1S22A 1OKJA 4JHDB 3G6EN 4BRDA 2YI1A 3HBTA 1NGHA 1TYQA 2PAVA 3E1YA 5EOYA 3O9QA 2YCHA 3O6WA 4JD2A 2NZTA 5M1KA 5C0YA 1NM1A 1T6CA 3K9JA 4IOAL 3IDHA 1SQKA 3TSUA 1ATRA 2BUPA 3H6EA 4BR5A 4IO9L 5B8HA 3WXJA 5C10A 2FLOA 1BA0A 2E8AA 2D0PA 4YDUC 2P9LA 2GX9A 2YHWA 4JNEA 3TSPA 3O5BA 4MDAA 4BRFA 1VQ7N 4H0XB 2BH1A 3DXKA 2YJFA 3KVGA 3O80A 3CERA 4IJAA 2PFUA 4IEEA 4YOYA 3EE9A 4A5BA 3BF3A 3KWIA 4CI6A 1BOTO 1Q86O 2ZGYA 4FWOA 4BC3A 4FWPA 1XC3A 4PKGA 2OANA 5FPNA 4BRGA 3SAHA 1GLAG 3DJCA 4A61A 1YI2N 4IDHA 2VYPA 1NGFA 3U9ZA 4YOTA 3CCSN 3Q7BA 4XH4A 3D2FB 3F2KA 3F9MA 3SJHA 1E4FT 1T6DA 4ISEA 3SBTA 4CZMA 1MDUB 2E2QA 3EL2A 4HTLA 4ILHA 3J7ZO 4GNIA 2FSKA 4WFBL 3VOVA 4B1XB 3PLAA 5AZJA 1K8AO 3CCJN 4A5AA 3GOIA 4WFAL 1T44A 1ILYA 3D6RA 2HOEA 4JKHA 5F0XA 3C6AA 3VEXA 2E1YA 1SS6A 1RDUA 4ISGA 4YORA 1U2VA 3RSEB 1GLBG 4U67L 4AM7A 3SMPA 2I7NA 3W3DA 3UKUB 4EHUA 3DWLA 2YHYA 5AQIA 2NRZA 5AFUH 3CCMN 4JKGB 1Z05A 5GADP 4B1ZA 3MCPA 4CZFA 1KXPA 2FSNA 2CH6A 3L0QA 4JHDA 2IVOA 2GWKA 4IOCL 4BRCA 1Q81O 4AM6A 1VQPN 4Z94A 5C2FA 4H5TA 3H1QA 5LJWA 4IJNA 4FOIA 1HLUA 3WXIA 4FWLA 3R6MA 5F2RA 4H5NA 2QWLA 4H03B 5FPMA 4B1VA 3CJBA 3WXKA 4B1UB 4YOVA 2Q97A 5BRFA 2VGNA 5EY4A 4CZHA 2P9NB 2NRXA 4CD3A 4BREA 5AQRA 2QWRA 4JKCA 1HUXA 5M1FA 2QA4N 1ESVA 1Q82O 4CJ7A 2GWJA 3ATVA 3CC4N 4QS9A 5M1PA 4MO4A 4RCHA 3UE5A 4FPBA 4CBUA 3O08A 4K41A 1YJ9N 3CI5A 4A62A 2IIRA 5E84A 4L3QA 1P90A 4A2AA 4BRIA 4BRKA 1NJIO 4H0VB 3S41A 3ENBA 3GDQA 4OPAA 5DM6L 3PIPL 3WXLA 1LCUA 1RGIA 3U9DA 5JVHL 4XH5A 3D2FA 2VGMA 2QWNA 1K8KB 3TSQA 4FWSA 1KAZA 2I7PA 3MWPA 1X3MA 3EO3A 1EO1A 3QMLA 1S72N 1BO5O 4M7XA 5AZJB 3SK3A 2YHXA 3EN9A 3WT0A 1JJ2M 3QFUA 4E1JA 2DPNA 4H5VA 3QBXA 3WXMB 4EFHA 2V7ZA 3PIOL 2HMPA 1SAZA 3RSEA 3CXCM 3CJ9A 2QEXN 2ZJQL 2QXLA 1BA1A 3MDQA 2P9KB 1E4GT 3UKUA 4BROA 2HF4A 1ATSA 2HBKA 2KLAA 4JKGA 4WF9L 3CJ1A 5JVGL 5ADXH 1NGBA 1YF5L 4BG8A 3CD6N 2HBJA 1G99A 3R1XA 1C0FA 3OBYA 1X9JA 1VAZA 5EVZA 1W2BM 2YX6A 3P38A 3I56N 4BG9A 1YVNA 2OTLN 1ATNA 1HKCA 5LY3A 2FSJA 3DLLL 1C0GA 3NVKA 4GV6A 5M1OA 3E9LA 4XH1A 2QWOA 3VEYA 3VETA 4BR9A 1NWKA 4AF1A 3LL3A 3CPEA 4BRPA 5I9EB 4IZ9A 2P9IB 2A5XA 3MX5A 3P39A 1NGJA 1NGEA 3UKRB 2P9NA 2Q36A 3MX2A 3BP8A 3VESA 4JKFA 5GAHP 4QS7A 3SLCA 3UB5A 4YDUA 5LJVA 3T7ZA 4BVOA 2NRVA 1NGIA 4BGBA 4FWNA 5AQSA 4WQ5C 5KQDA 1YIJN 2NRTA 3O8MA 2AA4A 2E2OA 3C7NB 4JKAA 2F9TA 3I33A 1S3XA 3R3LA 2D0OA 5GAGP 3H1VX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FGU A;  4WQ4 C;  4M7Y A;  2J4R A;  5BN9 A;  2ITM A;  3VEN A;  5BRH A;  3O4W A;  1K8K A;  3CJA A;  3VGL A;  2V7Y A;  3IMX A;  2VWB A;  3H45 C;  4JAX A;  5AFU A;  1V4T A;  5TKY A;  3IFR A;  2ASM A;  3L4I A;  1J6Z A;  1Y64 A;  4BR0 A;  3HTV A;  3ATU A;  4CBX A;  2V52 B;  3MMV A;  4FPA A;  4BC4 A;  3I8B A;  3LM9 A;  1HX1 A;  1NLV A;  2E2N A;  2P9K A;  5AQH A;  3U8X A;  2IVN A;  5AQG A;  2GUP A;  3VEW A;  2GTD A;  4BRQ A;  2CGJ A;  2P9P B;  4K42 A;  4O8K A;  2E20 A;  3ULE B;  2NRH A;  3QBW A;  2F9W A;  2W40 A;  4H0T B;  5EXW A;  4K43 A;  1XQS C;  4J8F A;  4BR4 A;  4EAH D;  4FL9 A;  2NLX A;  3FE1 A;  1HKG A;  3JS6 A;  4DQ8 A;  2E88 A;  4MLE A;  3MN6 A;  4FOE A;  5AQN A;  1BWF O;  2A6A A;  3SMS A;  3BF1 A;  2A40 A;  3HZ6 A;  1P8Z A;  5JLF A;  2ASO A;  2P9I A;  4BRN A;  3MN7 A;  3UKR A;  4PL7 A;  2QWP A;  3AAR A;  3AAP A;  3WEE B;  3DAW A;  3H3N O;  4BRH A;  2P9U B;  3A5M C;  5AQX A;  1GLF O;  4A2B A;  3C7N A;  3U4L A;  2ZGZ A;  4FWK A;  4GY2 B;  4JN4 A;  5AQV A;  2Q2R A;  5FPD A;  2AP1 A;  3VEV A;  4H5R A;  1NGG A;  2Q31 A;  3CHW A;  5BPM A;  3GBT A;  3ZET B;  1GLJ O;  1GLE G;  1V4S A;  2QM1 A;  4ISF A;  4CBW A;  3QB0 A;  5AQJ A;  1BDG A;  4KBO A;  5ADX A;  1QQO A;  1TUY A;  3VF4 A;  5FPE A;  1DKG D;  2BTF A;  2QWM A;  4BRL A;  3VGM A;  1ZBS A;  1TUU A;  4BRA A;  5AQW A;  3JXU A;  3H46 O;  3L6Q A;  1QQN A;  4PL8 A;  3FZL A;  3FZH A;  3ENH A;  3VEZ A;  3HI0 A;  4QS8 A;  3GG4 A;  2Q1N A;  2P9P A;  1MWK A;  3VGK A;  4BR2 A;  3R8E A;  5AQP A;  3ULE A;  2A3Z A;  3MN5 A;  3O1B A;  4BQZ A;  5F1X A;  4DCH A;  1NGA A;  1GLD G;  2A41 A;  3D7E O;  3DXM B;  3M6G A;  4PKI A;  2A42 A;  1BG3 A;  1D4X A;  5AQF A;  5AQU A;  2EWS A;  4EIA A;  4M63 C;  5KQ8 A;  1BUP A;  4CZE A;  3H3O B;  1R59 O;  3EKU A;  3KZB A;  4H0P A;  3CQX A;  3FFK B;  3O1W A;  3GL1 A;  5AQT A;  5AQQ A;  4DB3 A;  2Q0R A;  3CJ7 A;  3LDN A;  4NO7 A;  3WEE A;  3A5L C;  3LDP A;  4Y0W A;  3FZM A;  3WQU A;  4FWM A;  2Q0U A;  1YUW A;  5JLH A;  2CGL A;  3LDO A;  2P9U A;  4CZL A;  2ASP A;  3ZEU B;  1NBW A;  2P9S A;  3A5N C;  1QZ6 A;  5AR0 A;  3VF2 A;  5BN8 A;  1EQY A;  3QIC A;  4FWR A;  4WQ5 A;  2HF3 A;  1DGK N;  3M1F A;  5AZI B;  3ZET A;  3QFP A;  2CGK A;  1RFQ A;  2UYT A;  1YXQ A;  4DHY A;  1YAG A;  3QDK A;  2PBD A;  3WQT A;  2IVP A;  5BRE A;  1JCG A;  4WQ4 A;  1WOQ A;  1ZXO A;  3M3Z A;  4MLH A;  5EX5 A;  5AQM A;  1Z6R A;  2QWQ A;  4O5F A;  5AQO A;  2E1Z A;  4HWI A;  3TPQ A;  1WUA A;  2ZF5 O;  4FO0 A;  4H0Y B;  3D2E B;  3VEO A;  2ZWH A;  3OHR A;  1Q18 A;  4PKH A;  4BVP A;  1IJJ A;  2W41 A;  1XUP O;  3KHY A;  2FXU A;  3B8A X;  3ID8 A;  4BR7 A;  3LDL A;  4H0O A;  1LOT B;  3IUC A;  4I6M B;  3A5O C;  3DXM A;  3ENO A;  4NB4 A;  5AQZ A;  4MO5 A;  3LM2 A;  1JCE A;  4K25 A;  5CE3 A;  5BRD A;  3CQY A;  2CH5 A;  3G25 A;  5KPZ A;  3VER A;  4WYB A;  4CZI A;  4EHT A;  4H5W A;  1TYQ B;  1GLC G;  5BPL A;  3AAQ A;  4JD2 B;  1MA9 B;  1DEJ A;  3EZW A;  4BQL A;  1MWM A;  1U6Z A;  3GE1 A;  1HPM A;  3MN9 A;  3P4I A;  2WUS A;  3ZEU A;  1RDW X;  2P9S B;  3CET A;  3FZK A;  2E2P A;  4CZJ A;  5JIC A;  1HJO A;  4BC5 A;  1QHA A;  3TU5 A;  1SZ2 A;  1GLL O;  1CZA N;  2P9L B;  2FF6 A;  5ELZ A;  5JMV A;  4FSV A;  5E26 A;  3DXK B;  5AZI A;  4RTF D;  4BC2 A;  3EKS A;  3CJC A;  3A0I X;  1NMD A;  4IXC A;  1IG8 A;  4XEI A;  1KAY A;  1KAX A;  1NGC A;  3AY9 A;  3C0B A;  3HM8 A;  3R9P A;  3BEX A;  2KHO A;  1QZ5 A;  2D4W A;  5AQY A;  4B9Q A;  1H1V A;  3A8Y A;  2VCP A;  3FZF A;  3VF6 A;  1BU6 O;  5AQK A;  5AQL A;  3D2E A;  4B1Y B;  3MK6 A;  4B1W B;  2GEM A;  2H3G X;  3VPZ A;  1QQM A;  3BUZ B;  5BR9 A;  5KPR A;  4IWV A;  3CIP A;  3LDQ A;  4IO8 A;  4C23 A;  4CZG A;  5BPN A;  4LC9 B;  4FWQ A;  1ZC6 A;  2GEL A;  3WUH A;  5KPT A;  2D1K A;  3W0L A;  4CD1 A;  4I6M A;  2YJE A;  2V51 B;  1U2V B;  3J8A A;  3ZX0 A;  1HKB A;  4CZK A;  3FLC O;  3ZX2 A;  4BGA A;  3HSC A;  3ZX3 A;  1X3N A;  4F9O A;  1NGD A;  4BRM A;  1JCF A;  2QW9 A;  2FF3 B;  3FR0 A;  4RWT A;  1S22 A;  1OKJ A;  4JHD B;  4BRD A;  2YI1 A;  3HBT A;  1NGH A;  1TYQ A;  2PAV A;  5EOY A;  2YCH A;  3O6W A;  4JD2 A;  2NZT A;  1NM1 A;  1T6C A;  3IDH A;  1SQK A;  1ATR A;  2BUP A;  3H6E A;  4BR5 A;  5B8H A;  3WXJ A;  2FLO A;  1BA0 A;  2E8A A;  2D0P A;  4YDU C;  2P9L A;  2YHW A;  4JNE A;  3O5B A;  4BRF A;  4H0X B;  3DXK A;  2YJF A;  3KVG A;  3O80 A;  3CER A;  4IJA A;  3BF3 A;  4CI6 A;  1BOT O;  2ZGY A;  4FWO A;  4BC3 A;  4FWP A;  1XC3 A;  4PKG A;  2OAN A;  5FPN A;  4BRG A;  1GLA G;  3DJC A;  4A61 A;  2VYP A;  1NGF A;  3U9Z A;  4XH4 A;  3D2F B;  3F9M A;  3SJH A;  1E4F T;  1T6D A;  4ISE A;  4CZM A;  1MDU B;  2E2Q A;  3EL2 A;  4HTL A;  4GNI A;  2FSK A;  3VOV A;  4B1X B;  5AZJ A;  3GOI A;  1T44 A;  2HOE A;  5F0X A;  3VEX A;  2E1Y A;  4ISG A;  1U2V A;  3RSE B;  1GLB G;  4AM7 A;  3SMP A;  2I7N A;  3W3D A;  3UKU B;  4EHU A;  3DWL A;  2YHY A;  5AQI A;  5AFU H;  1Z05 A;  4B1Z A;  3MCP A;  4CZF A;  1KXP A;  2FSN A;  2CH6 A;  3L0Q A;  4JHD A;  2IVO A;  2GWK A;  4BRC A;  4AM6 A;  4Z94 A;  4H5T A;  3H1Q A;  5LJW A;  4IJN A;  4FOI A;  1HLU A;  3WXI A;  4FWL A;  3R6M A;  5F2R A;  4H5N A;  2QWL A;  4H03 B;  5FPM A;  4B1V A;  3CJB A;  3WXK A;  4B1U B;  2Q97 A;  5BRF A;  5EY4 A;  4CZH A;  2P9N B;  4CD3 A;  4BRE A;  5AQR A;  2QWR A;  1HUX A;  1ESV A;  4CJ7 A;  2GWJ A;  3ATV A;  4QS9 A;  4MO4 A;  4RCH A;  3UE5 A;  4FPB A;  4CBU A;  3O08 A;  4K41 A;  3CI5 A;  4A62 A;  2IIR A;  5E84 A;  4L3Q A;  4A2A A;  4BRI A;  4BRK A;  4H0V B;  3S41 A;  3GDQ A;  3WXL A;  1LCU A;  1RGI A;  3U9D A;  4XH5 A;  3D2F A;  2QWN A;  1K8K B;  4FWS A;  1KAZ A;  2I7P A;  1X3M A;  3EO3 A;  3QML A;  1BO5 O;  4M7X A;  5AZJ B;  3SK3 A;  2YHX A;  3EN9 A;  3WT0 A;  3QFU A;  4E1J A;  2DPN A;  4H5V A;  3QBX A;  4EFH A;  2V7Z A;  2HMP A;  1SAZ A;  3RSE A;  3CJ9 A;  2QXL A;  1BA1 A;  3MDQ A;  2P9K B;  1E4G T;  3UKU A;  4BRO A;  2HF4 A;  1ATS A;  3CJ1 A;  5ADX H;  1NGB A;  4BG8 A;  1G99 A;  1C0F A;  1X9J A;  5EVZ A;  4BG9 A;  1YVN A;  1ATN A;  1HKC A;  5LY3 A;  2FSJ A;  1C0G A;  4XH1 A;  2QWO A;  3VEY A;  3VET A;  4BR9 A;  1NWK A;  3LL3 A;  4BRP A;  5I9E B;  4IZ9 A;  2P9I B;  2A5X A;  1NGJ A;  1NGE A;  3UKR B;  2P9N A;  2Q36 A;  3BP8 A;  3VES A;  4QS7 A;  3SLC A;  3UB5 A;  4YDU A;  5LJV A;  4BVO A;  1NGI A;  4BGB A;  4FWN A;  5AQS A;  4WQ5 C;  5KQD A;  3O8M A;  2AA4 A;  2E2O A;  3C7N B;  2F9T A;  3I33 A;  1S3X A;  2D0O A;  3H1V X; 
#chains in the Genus database with same CATH topology
 3FGU A;  5M1Q A;  4WQ4 C;  1B9F A;  5BN9 A;  2ITM A;  3VEN A;  5BRH A;  1K8K A;  2A1S A;  1WSE A;  4AQY K;  2GBZ A;  4JAX A;  5AFU A;  4DWI A;  5FLX O;  5TKY A;  2ASM A;  2O8E B;  4WFN L;  4N56 A;  3ATU A;  1NKE A;  2V52 B;  4KB1 A;  1C1A A;  2I5J A;  2E2N A;  5AQH A;  1Q8I A;  4CHZ A;  3JSM A;  2GTD A;  1U04 A;  4K42 A;  3MEE A;  3IKM A;  1NK5 A;  2W40 A;  4OJR A;  4YOW A;  3KLI A;  3G4S N;  4J8F A;  3SV4 A;  1HR0 K;  4DQ8 A;  4NXM K;  1U47 A;  4MLE A;  4FOE A;  4YOX A;  1QVF M;  4DQQ A;  3MWT A;  3HVR A;  1VSK A;  3UKR A;  4FVU A;  1VSH A;  3DAW A;  4BE0 A;  4KRF A;  3H3N O;  1IBK K;  4F2S A;  4OKK A;  2P9U B;  3TAB A;  3SPZ A;  3J7A P;  2Q3S A;  4JK9 A;  1RBT A;  4C8L A;  4OX9 K;  5TKW A;  2Q2R A;  3CHW A;  1HMV A;  2VQF K;  3ZET B;  4KHS A;  1A5X A;  1GLE G;  1V4S A;  3ITH A;  4FM0 A;  2RPI A;  3QB0 A;  2FBV A;  4HTU A;  3PY8 A;  4ZTF A;  1TUY A;  1ASU A;  2BTF A;  5CZ2 A;  3PX0 A;  3VQA A;  3VGM A;  1RBR A;  3K9K A;  4BRA A;  3OYB A;  4C1N I;  3QNN A;  3SQ2 A;  3ZT3 A;  4CW7 B;  5I3U A;  2X6S A;  3DRS A;  2AJQ A;  3VEZ A;  4Z4E A;  2WBN A;  2O8C B;  3EEQ A;  4FLU A;  2P9P A;  3VGK A;  4BR2 A;  1U4B A;  3R8E A;  4PQU A;  3ULE A;  1X9W A;  4Z4G A;  3MN5 A;  3O1B A;  3DXM B;  1BIU A;  2GV9 A;  1NK0 A;  2GUI A;  2RE2 A;  4MFB A;  1D4X A;  3DLB A;  3OYM A;  1TKX A;  1KCF A;  1BGX T;  3AVJ A;  5LMU K;  2G8H A;  4JI4 K;  3NGI A;  2A1R A;  4M63 C;  4CZE A;  3FFK B;  4R5P A;  4C1N K;  5I42 A;  5JLH A;  2CGL A;  3LDO A;  2KKZ A;  3ZEU B;  1NBW A;  4UQG A;  3AVC A;  1GOB A;  5AR0 A;  1EWQ A;  3VF2 A;  3NH2 A;  2B6A A;  1JXB A;  4WQ5 A;  3K5O A;  3AGK A;  1O1W A;  1RFQ A;  1MU2 A;  1VQ8 N;  1C0T A;  3HPH A;  3QDK A;  2PBD A;  2IVP A;  4JI3 K;  3SCX A;  1VQ4 N;  5KRS A;  1Z6R A;  1HYZ A;  3O4Q A;  3SUQ A;  2O8B A;  4LSL A;  3RR7 A;  3DLK A;  2ZWH A;  4DTP A;  3OHR A;  1IV0 A;  2W41 A;  1XUP O;  3RMA A;  3TI0 A;  4O0I A;  3V1R A;  4F2R A;  1CLQ A;  4XIU A;  2E4L A;  4BR7 A;  3ID8 A;  3ZSO A;  3HOT A;  1LOT B;  3OYG A;  5AQZ A;  3ENO A;  3O9T A;  4MO5 A;  3LM2 A;  1JCE A;  1VQL N;  3PSF A;  3MAQ A;  1YJW N;  5CE3 A;  5BRD A;  1VQM N;  2CH5 A;  3G25 A;  4GKJ K;  5KPZ A;  1SKS A;  4M42 A;  3VER A;  4WYB A;  1TAQ A;  4EHT A;  5T7B A;  4GV3 A;  5CR4 A;  2NRR A;  5KTQ A;  1DEJ A;  1YHQ N;  3BDP A;  3C6H A;  1U6Z A;  4ELV A;  4ELU A;  4BDP A;  1HPM A;  4FJG A;  4Z0U A;  1RDW X;  1B92 A;  1ZBH A;  3OYF A;  1QHA A;  2ZQB A;  3TU5 A;  1SZ2 A;  1K73 O;  1XC9 A;  2HST A;  4O5B A;  4X64 K;  4FSV A;  3ZCM A;  3DXK B;  3ID6 A;  3ZT0 A;  4BC2 A;  3CJC A;  1S6P A;  4DV2 K;  1IG8 A;  4XEI A;  3NDK A;  1OH6 A;  3C0B A;  4DFK A;  3J80 O;  3KKR A;  5GIO A;  3THY B;  5HP1 A;  1W7A A;  3MK6 A;  3C95 A;  3M5R A;  2OCE A;  4G1Q A;  4LC9 B;  2JGU A;  5DMR A;  3G71 N;  1ZBF A;  4FM2 A;  5KPT A;  3OYD A;  4CD1 A;  1VQO N;  4PA1 A;  1SKW A;  5C15 A;  3J8A A;  1BCM A;  4EZ6 A;  2Z1I A;  4DR1 K;  1X3N A;  1SUQ A;  3CMA N;  1XHX A;  2DY4 A;  1QSS A;  2W42 A;  1OKJ A;  4JHD B;  3G6E N;  4DUY K;  2YI1 A;  4GW6 A;  1NGH A;  1TYQ A;  3O4N A;  2HB5 A;  3P1G A;  3TAQ A;  3KLH A;  4FYD A;  3QLH A;  3RWU A;  5EU7 A;  2O8F A;  4E7I A;  3WXJ A;  1Z25 A;  4YDU C;  3PV8 A;  3TSP A;  1BI4 B;  1S9G A;  2Z1H A;  3I0R A;  3MEG A;  2BH1 A;  2XO7 A;  1UWB A;  4F8R A;  1YT3 A;  3O80 A;  4K8Z A;  2PFU A;  4IEE A;  3AVM A;  1X9S A;  3QIN A;  3LAL A;  1Q86 O;  2ZGY A;  4FJJ A;  2OAN A;  4Q0B A;  1NOZ A;  1YI2 N;  4FK2 A;  1NOY A;  3KIO A;  3KD5 E;  4DR5 K;  4XH4 A;  3O3F A;  3D2F B;  4LF4 K;  3NGZ A;  4FXD A;  1JXE A;  2ZE2 A;  4C8O A;  3EL2 A;  2XRI A;  3AVK A;  1C6V A;  4GNI A;  1R0A A;  3VOV A;  3VQ6 A;  5AZJ A;  3PSI A;  4A5A A;  4H4M A;  4WFA L;  4DV3 K;  1ILY A;  4M3Y A;  1ASW A;  1J9A A;  1LWF A;  4YY3 K;  1U2V A;  4FLT A;  3LAN A;  1XMQ K;  3QER A;  2JLE A;  2E6M A;  2Y1J A;  3DWL A;  1JLC A;  3MCP A;  4CZF A;  4E1N A;  3S3M A;  3L0Q A;  1Q9X A;  1XNR K;  4BRC A;  1Q81 O;  1VQP N;  4RW6 A;  3H1Q A;  3AO4 A;  3H08 A;  3WXI A;  4LSN A;  3IRX A;  3R6M A;  4H03 B;  4KPY A;  4LF7 K;  2NRX A;  4KTW A;  4DSF A;  2QWR A;  4FJK A;  2OYQ A;  5M1F A;  4NCG A;  4CJ7 A;  3AVI A;  1RT2 A;  5M1P A;  4MO4 A;  3UE5 A;  4FPB A;  1YJ9 N;  3SPY A;  2EX3 A;  1HPZ A;  4L3Q A;  2F96 A;  3QNO A;  1S9E A;  2UXC K;  3GDQ A;  3VA3 A;  4XH5 A;  2HHU A;  4HUG A;  4CJV A;  1FKP A;  1FKO A;  3MWP A;  2O8D A;  1WNS A;  1EO1 A;  3LWM A;  4B9T A;  3OJS A;  4M7X A;  5AZJ B;  4Z4F A;  2YHX A;  3M8Q A;  2DPN A;  4H5V A;  1VRU A;  2UUC K;  1VSF A;  3CXC M;  2QEX N;  3CJ9 A;  4FW2 A;  4FZZ A;  1E4G T;  4KHP K;  2KLA A;  2HHV A;  5JVG L;  4FJ5 A;  3CJ1 A;  4CEF A;  3MXI A;  4BG8 A;  1VAZ A;  1TK0 A;  3DM2 A;  3OVN A;  2QWO A;  3ZSX A;  3VET A;  4BR9 A;  1WLJ A;  2VQE K;  3WNG A;  4EP4 A;  2P9N A;  4B3S K;  4FCY A;  5GAH P;  4B9U A;  3SLC A;  3DRR A;  3T7Z A;  2LSN A;  3T19 A;  1RBV A;  1NGI A;  4FWN A;  5KGW A;  1NK9 A;  2UUA K;  4KHY A;  2PYL A;  4LY7 A;  4CF1 A;  2E2O A;  3C7N B;  4B3R K;  3I33 A;  2D0O A;  4IG0 A;  4M7Y A;  3M8S A;  3CJA A;  3VGL A;  2W6K A;  3AO5 A;  1L3U A;  3IMX A;  4DR2 K;  4Q5V A;  4FJX A;  3L4I A;  4FJM A;  1J6Z A;  4Y1C A;  3EY1 A;  3AVB A;  3HTV A;  1VK0 A;  4YOU A;  4DTU A;  2PYJ A;  3KLF A;  3I8B A;  3SAG A;  2P9K A;  3SUP A;  5AQG A;  5J2N A;  2GUP A;  5KGX A;  4M3X A;  4ILG B;  1UA0 A;  4X66 K;  3TAN A;  2E20 A;  4Z4C A;  1UA1 A;  5EXW A;  4CJ5 A;  2HNY A;  2ITG A;  1J5O A;  1YJN N;  3RMD A;  4BR4 A;  4FL9 A;  1HKG A;  3JS6 A;  3DRP A;  1OH7 A;  3SMS A;  3BF1 A;  2A40 A;  1RDD A;  2G8K A;  1P8Z A;  2HNZ A;  3OY9 A;  1LWE A;  4BRN A;  4DQR A;  4JRQ A;  3ALY A;  4H8K A;  2W6L A;  3NBP A;  4CGG A;  3OYK A;  4CEA A;  1T3V A;  4CED A;  3AAR A;  3AAP A;  2HHT A;  4HCC A;  1QE1 A;  4AHV A;  1D5A A;  2R7Y A;  4M41 A;  1JL2 A;  4CFB A;  4A2B A;  2KW4 A;  3THW B;  5FPD A;  3U3G A;  3Q7C A;  2EHG A;  2F8T A;  3E66 A;  2WC9 A;  1KRP A;  1Y97 A;  2Q31 A;  3L2U A;  4B3M K;  5BPM A;  4KV8 A;  2QM1 A;  4DU4 A;  1I94 K;  2WFB A;  3SBG A;  5ADX A;  5H1S Q;  1QQO A;  3SI6 A;  3KTQ A;  4MDB A;  3VF4 A;  5FPE A;  2O8E A;  4BRL A;  2ZD1 A;  1RTD A;  1IG9 A;  2RF2 A;  3K57 A;  2G8V A;  3H46 O;  2ETJ A;  1IBM K;  3L6Q A;  4A59 A;  4PL8 A;  3K58 A;  3FZH A;  3DLH A;  4JKB A;  2UU9 K;  3GG4 A;  3O3G A;  4OPJ A;  5AQP A;  4CF0 A;  4JRP A;  2DFF A;  2NUB A;  2A41 A;  3D7E O;  3TAG A;  4N5S A;  1LV5 A;  3QIO A;  3O9S A;  4GVM A;  5CHI A;  2OPS A;  4MQ3 A;  3NMU A;  4PUO A;  1S1V A;  3H3O B;  4H0P A;  5AQQ A;  3D45 A;  4DB3 A;  2Q0R A;  1JLG A;  3A5L C;  3OYA A;  3HP9 A;  2FC0 A;  3WQU A;  2Q0U A;  3AVF A;  4FZY A;  1C1B A;  2P9U A;  3PO5 A;  3KWG A;  4CZL A;  1D9D A;  3T69 A;  1NG9 A;  4CJT A;  1C1C A;  1TAU A;  3EE8 A;  5C2D A;  3ZT4 A;  5BN8 A;  2Y1I A;  5GIN A;  2HF3 A;  5AZI B;  3ZET A;  1WSG A;  4AHU A;  4O44 A;  3RVC A;  4DV0 K;  2QKK A;  2UYT A;  1YXQ A;  4DHY A;  1YAG A;  1D8Y A;  3C65 A;  4WQ4 A;  1KLN A;  1ZXO A;  3SAF A;  4MLH A;  4CF8 A;  5EX5 A;  3LPU A;  4LF9 K;  3C6T A;  4O5F A;  3THV A;  2E1Z A;  1WUA A;  3D2E B;  3TR8 A;  3VEO A;  4BVP A;  1Q18 A;  4PKH A;  3JYT A;  4DFJ A;  2O8C A;  3VQ4 A;  1NK7 A;  3AVN A;  4GV9 A;  2X78 A;  3OA9 A;  3DLE A;  4CJ3 A;  3QEX A;  4H0O A;  3DXM A;  4NB4 A;  4CEQ A;  4JK7 A;  1KFD A;  3LP1 A;  2F4V K;  5GIP A;  4K25 A;  3VQC A;  4KKO A;  1KVB A;  3EZ5 A;  4DR3 K;  4OVL A;  3AAQ A;  4LH5 A;  4E7J A;  1MA9 B;  4LFC K;  1SKR A;  3ZEU A;  4CZJ A;  3CME N;  1HJO A;  5KRT A;  4BC5 A;  3N4P A;  3C6U A;  1GLL O;  2P9L B;  4ID1 A;  2ZJP L;  1NKB A;  1A5W A;  4PWD A;  5JMV A;  1VSE A;  1OH8 A;  5D3G A;  3EKS A;  3A0I X;  4OKJ A;  3AV9 A;  1IH7 A;  2KQ2 A;  5JS2 A;  1KAX A;  4FK0 A;  4IEI A;  4DTN A;  4DF4 A;  2VWJ A;  4IOX A;  4B9Q A;  4IFV A;  4YFU A;  4LH4 A;  4JYA K;  1H1V A;  3A8Y A;  4W5N A;  4DTS A;  1Q9Y A;  3L8B A;  5AQK A;  2G8U A;  4HHT A;  5AQL A;  4BDZ A;  1VQ5 N;  3DLG A;  4B1W B;  4BE1 A;  4IWV A;  1W97 L;  3E01 A;  2RN2 A;  4FWQ A;  4JKE A;  3W0L A;  4FZX C;  2YJE A;  1VSI A;  4YHH K;  4CK2 A;  4FM1 A;  2V51 B;  1HKB A;  4JI7 K;  3ZYY X;  4CZK A;  1LW2 A;  3FLC O;  4F9O A;  1NGD A;  3O9U A;  4DS4 A;  1JCF A;  2QW9 A;  1WAJ A;  2FF3 B;  3FR0 A;  1S22 A;  4OGC A;  4RWT A;  3E1Y A;  3O6W A;  2DTU A;  1JLF A;  1VHX A;  1NM1 A;  2P5G A;  1J5E K;  3BGR A;  2XHB A;  4KAZ A;  2BUP A;  4BR5 A;  3FFI A;  1UAX A;  4F3O A;  4RW9 A;  2YHW A;  4MDA A;  2RKI A;  2QK9 A;  4LD0 A;  3DXK A;  5SWM A;  3CER A;  4IJA A;  2OPP A;  4YOY A;  2WTU A;  1U45 A;  4FWP A;  1XC3 A;  1SV5 A;  4A61 A;  3ZLJ A;  4DV7 K;  1VRT A;  1WSI A;  1IKX A;  4OLB A;  3THY A;  3Q7B A;  4C8N A;  3F2K A;  3DMJ A;  3F9M A;  4EP5 A;  3TAF A;  1E4F T;  1T6D A;  3AVH A;  1DTQ A;  1S1U A;  4ISE A;  1MDU B;  2FSK A;  3LZI A;  1L5U A;  4CJ4 A;  3CCJ N;  1T44 A;  3NHG A;  3OYN A;  3VEX A;  4YOR A;  3RSE B;  1GLB G;  4AM7 A;  3ISN C;  3SMP A;  3RMB A;  4B8A B;  5AFU H;  3CCM N;  1Z05 A;  4E0D A;  3C94 A;  2FSN A;  1EXQ A;  4JHD A;  3VA0 A;  2IVO A;  3RRH A;  2GWK A;  3KKS A;  4AM6 A;  5C2F A;  4H5T A;  1K6Y A;  4IJN A;  1HLU A;  1X1P A;  3P5J A;  3WNE A;  4CJK A;  2YKM A;  2FBY A;  5FPM A;  2D5R A;  3CJB A;  3DOK A;  1QQC A;  3QEV A;  4YOV A;  2Q97 A;  5BRF A;  2VGN A;  3L2Q A;  4B9N A;  1J53 A;  1BI4 A;  4CZH A;  4CD3 A;  1ASV A;  5AQR A;  2G8F A;  1ESV A;  1RT5 A;  1RDC A;  4X62 K;  4K41 A;  3CI5 A;  5LL6 Z;  3MED A;  5E84 A;  1KTQ A;  1P90 A;  3S3O A;  4H0V B;  2OZS A;  4DTX A;  2HHH K;  3S41 A;  3ENB A;  5FRN A;  3PIP L;  3D2F A;  3ZSW A;  3TSQ A;  4DV5 K;  1RTH A;  2I7P A;  3MXM A;  1FXX A;  3HP6 A;  2DFH A;  3ULD A;  4CJW A;  1S72 N;  4FJN A;  1JJ2 M;  4J2E A;  4E1J A;  2HHW A;  3QBX A;  3HT3 A;  1RBU A;  2V7Z A;  5C25 A;  1NJY A;  4JI5 K;  2HMP A;  4CGJ A;  2QXL A;  4DTO A;  4BRO A;  4CJQ A;  3DI6 A;  1ATS A;  2PY5 A;  4WF9 L;  1YF5 L;  3SQ0 A;  1F21 A;  1ZYQ A;  1C0F A;  2Z1G A;  3AA4 A;  2YX6 A;  3T1A A;  1YVN A;  1ATN A;  1NMN A;  3QES A;  5LY3 A;  2FSJ A;  4GV6 A;  2ZM6 K;  4FLV A;  1W9H A;  1NWK A;  4BWM A;  2BE2 A;  3LL3 A;  4KB0 A;  4DF8 A;  5I9E B;  1XHZ A;  4M3W A;  1BL3 A;  3HVT A;  2P9I B;  2A5X A;  3A2F A;  4CK1 A;  3P39 A;  4FJL A;  1NGJ A;  2XY7 A;  3MX2 A;  3BP8 A;  2D0C A;  3VES A;  3QEW A;  4QS7 A;  4YDU A;  2NRV A;  1N36 K;  5KQD A;  4CHN A;  4JS5 A;  1YIJ N;  1HNW K;  2NRT A;  3TAP A;  4DQP A;  3O8M A;  2AA4 A;  3OS1 A;  3TAR A;  1S3X A;  3R3L A;  4DQI A;  2IDO A;  2J4R A;  3O4W A;  1TGO A;  2V7Y A;  1V4T A;  1WN7 A;  2O4I A;  3IFR A;  4KI4 A;  2KZM A;  1Y64 A;  3QET A;  4BR0 A;  3HK2 A;  3K5N A;  1NNE A;  2JWK A;  2ATQ A;  3HJF A;  4C8M A;  3MMV A;  3RRG A;  4FPA A;  1RDB A;  4BC4 A;  4HVJ A;  3LM9 A;  4JI6 K;  1RDA A;  3VQQ A;  3VEW A;  2HBM A;  2CGJ A;  3F73 A;  1QTM A;  1TV6 A;  4I9L A;  3V9S A;  3DLR A;  3CFO A;  2F9W A;  4DU3 A;  2F7T A;  4G9Z A;  4M3Z A;  4RW8 A;  1NU0 A;  2HMI A;  4EAH D;  4DSJ A;  2OTJ N;  4GMJ B;  2IOC A;  4JI0 K;  2NLX A;  1E3M A;  4DR7 K;  5AQN A;  3B6O A;  3DYA A;  5C12 A;  3CCQ N;  1M90 O;  3HZ6 A;  3L4Q A;  3CCU N;  3HM9 A;  4K8X A;  2ASO A;  1J54 A;  3LP3 A;  3MN7 A;  4IG3 A;  4DTR A;  4PL7 A;  2QWP A;  4E7L A;  3WEE B;  1N8R O;  5C24 A;  3CC2 N;  4BRH A;  3U6F A;  3A5M C;  4FJ9 A;  2HVI A;  3N4Q A;  3C7N A;  4FWK A;  3HOS A;  3AA5 X;  5AQV A;  3KK1 A;  1N32 K;  4CJU A;  3VEV A;  4ZHR A;  1BHL A;  4H5R A;  5BR8 K;  1NGG A;  3B6P A;  3OYJ A;  4DSI A;  4ISF A;  4BE2 A;  4KHW A;  3J7Y P;  4KBO A;  4BY9 C;  2HBL A;  4KHQ A;  5GAE P;  3SUO A;  1DKG D;  1CXQ A;  3CCR N;  4FJ7 A;  3E9O A;  3JXU A;  4DR6 K;  4FLW A;  4CER A;  3KK3 A;  1YIT N;  1L3T A;  4CIE A;  2VWK A;  3I55 N;  1QQN A;  1JLQ A;  3E9P A;  3ENH A;  1L3S A;  4CJL A;  4QS8 A;  5CY4 A;  4J2D A;  3CC7 N;  1YTU A;  4A57 A;  4BQZ A;  1GLD G;  4C8K A;  1EWR A;  3M6G A;  4OGE A;  1KVA A;  3CM5 A;  2A42 A;  1BG3 A;  3HL8 A;  1KQS M;  1CZB A;  4RW4 A;  2JWL A;  2EWS A;  4EIA A;  1BUP A;  5SZT A;  3G10 A;  3EKU A;  3CQX A;  3O1W A;  3GL1 A;  3AO1 A;  1IKW A;  4NO7 A;  3KJV A;  4DSK A;  4QOZ B;  4Y0W A;  1RNH A;  3MXJ A;  3NH1 A;  4FWM A;  3CG7 A;  1WSJ A;  1KD1 O;  1YUW A;  1N5Y A;  2YNI A;  4KO0 A;  5K14 A;  3SQ1 A;  2WOM A;  1HNZ K;  5IT9 O;  2P9S A;  3MCA B;  4JI8 K;  3A5N C;  4JK8 A;  3THW A;  4JEP A;  3QIC A;  4FWR A;  4YNQ A;  1DGK N;  1SL2 A;  3O9R A;  2CGK A;  2WON A;  3CQ8 A;  1VQ6 N;  1WOQ A;  2NNW A;  2X6N A;  4PY5 A;  5AQM A;  2QWQ A;  4N41 A;  4E1M A;  3P31 A;  1RT6 A;  3F5T A;  5AQO A;  1XMO K;  1T7P A;  3SV3 A;  4JI1 K;  2ZF5 O;  3SZ2 A;  4AHR A;  3KHY A;  3VQ5 A;  3ZSR A;  4DLG A;  5HRR A;  2FXU A;  1HYS A;  4IFY A;  3CPW M;  4I6M B;  4HUF A;  4ILJ A;  4CJR A;  5JS1 A;  3IS9 A;  1SL0 A;  2Z1J A;  4WCE L;  3OYI A;  3M8R A;  3HRG A;  1WB9 A;  1JLE A;  4CZI A;  1GLC G;  5BPL A;  4JD2 B;  4CF2 A;  3EZW A;  4KH6 A;  1TK8 A;  1T03 A;  1MWM A;  1HNV A;  3GE1 A;  3P4I A;  2WUS A;  2P9S B;  3CET A;  3FZK A;  2QXF A;  3T1Y K;  5HLF A;  1KC8 O;  1CZA N;  4BWJ A;  5AZI A;  3O3H A;  3AGR A;  3BY5 A;  3NF6 A;  4JV5 K;  1NMD A;  3V81 A;  5J2M A;  1KAY A;  4DSL A;  2UXD K;  1NGC A;  3AY9 A;  3R9P A;  3BEX A;  5HL7 L;  2D4W A;  1N6Q A;  1OVY A;  3CF5 L;  4O8U A;  4FJH A;  2VCP A;  1JLB A;  3VF6 A;  1BU6 O;  3D2E A;  3LP0 A;  5DK5 A;  1LAW A;  4B1Y B;  2GEM A;  2H3G X;  3VPZ A;  3BUZ B;  3CIP A;  4FW1 A;  2ZJR L;  4IO8 A;  3SUN A;  3CCL N;  4DKW A;  4CVN E;  1ZC6 A;  2D1K A;  3SNN A;  1EKE A;  3V4I A;  4NCA A;  4CFD A;  2PZS A;  4GKK K;  3ZX0 A;  5HOO A;  3TWH A;  1QSL A;  3HSC A;  3T3F A;  2YHB A;  4V19 S;  4BRD A;  1TKT A;  3VQD A;  4QAG A;  5EOY A;  3O9Q A;  2YCH A;  4W5O A;  3K59 A;  5C42 A;  3QO9 A;  5C0Y A;  3QEI A;  4IOA L;  1HQU A;  3KK2 A;  3IDH A;  1HRH A;  1ATR A;  3H6E A;  1EET A;  5HRP A;  5B8H A;  3AO3 A;  4DTJ A;  2E8A A;  4FLY A;  1CZ9 A;  2P9L A;  1VQ7 N;  4CGI A;  3BZC A;  2D0A A;  3EE9 A;  1WBB A;  3SYZ A;  3THX B;  1BOT O;  1OVQ A;  1ITG A;  4PKG A;  3NE6 A;  1RT4 A;  4H4O A;  4BRG A;  4LF5 K;  1GLA G;  3K2P A;  4IDH A;  1NGF A;  1VSD A;  3LAM A;  2YNG A;  4M3R A;  3SJH A;  3SBT A;  4CZM A;  1LW0 A;  3J7Z O;  5HBM A;  4WFB L;  3CYM A;  3V6D A;  5J2P A;  3GOI A;  3TAM A;  4CHQ A;  2YNF A;  1WAF A;  4ISG A;  1XNQ K;  2I7N A;  3UKU B;  1D9F A;  3LZJ A;  2YHY A;  4NCB A;  1S6Q A;  4B9L A;  4AHT A;  3ZSY A;  4JKG B;  3ZT2 A;  4DU1 A;  3RR8 A;  1IBL K;  4CIF A;  4Z94 A;  4LFA K;  5LJW A;  3SQ4 A;  1X9M A;  3HO1 A;  4B1V A;  4B1U B;  1NJZ A;  5EY4 A;  1I39 A;  1RTI A;  4JKC A;  1HUX A;  4CHY A;  2QA4 N;  2GWJ A;  3ATV A;  4ID5 A;  3RTV A;  1T05 A;  1JLA A;  4BRI A;  1NJI O;  1ZBU A;  1LCU A;  3U9D A;  3L2R A;  1K8K B;  1VSL A;  4FWS A;  1X3M A;  3EO3 A;  1BO5 O;  4CEC A;  3EN9 A;  3QFU A;  1KSP A;  3WXM B;  4EFH A;  3PIO L;  3RSE A;  1EP4 A;  1BIZ A;  1SAZ A;  2X74 A;  4CEE A;  1BA1 A;  5HRN A;  2HF4 A;  4AHS A;  3ZSQ A;  4DFM A;  3OYE A;  4KHN A;  5ADX H;  1NGB A;  3VQE A;  3CD6 N;  4N76 A;  3KLE A;  4DFP A;  1ZBL A;  1G99 A;  4IKF A;  3R1X A;  2KTQ A;  2YV0 X;  5EVZ A;  1W2B M;  3P38 A;  4BG9 A;  1QHT A;  2OTL N;  2KFZ A;  1HKC A;  3LDS A;  3E9L A;  4XH1 A;  4X65 K;  3VEY A;  4J2B A;  4KTQ A;  4AF1 A;  4I2P A;  5IWA K;  4BRP A;  4KRE A;  1IKV A;  1NGE A;  4L8R B;  3UKR B;  2YNH A;  3VQ8 A;  4JKF A;  3PX6 A;  1KVC A;  1OH5 A;  2KZZ A;  4BVO A;  1TVR A;  3BZK A;  1U49 A;  4WQ5 C;  4NYF A;  4IDK A;  4KFB A;  4CJS A;  1Z26 A;  2F9T A;  3VQ9 A;  3CM6 A;  3H1V X;  1NJX A;  3P83 D;  4CK3 A;  3NF9 A;  4O4G A;  1O13 A;  2IS3 A;  2VWB A;  3H45 C;  4OPH A;  5FRO A;  4B9M A;  4LFB K;  2O4G A;  5HRS A;  1QSY A;  4CBX A;  2OPR A;  1HX1 A;  1NLV A;  3U8X A;  1VQN N;  2IVN A;  4DLE A;  4F4K A;  4GVE A;  4BRQ A;  2P9P B;  3UIQ A;  4O0J A;  3OJU A;  4O8K A;  3ULE B;  2NRH A;  3QBW A;  3V1Q A;  4H0T B;  3LP2 A;  4K43 A;  4HUE A;  1XQS C;  4B3T K;  1VQ9 N;  2OZM A;  3ZT1 A;  4EZ9 A;  4CGH A;  5A2Q O;  3FE1 A;  4U7B A;  3AVG A;  2E88 A;  4ICL A;  3MN6 A;  4CGF A;  1BWF O;  2A6A A;  4FJ8 A;  5JLF A;  2P9I A;  3S9H A;  2HHS A;  3HST B;  2B5J A;  3SJJ A;  4DR4 K;  2G8W A;  1NK4 A;  4IBN A;  4CHP A;  3QIP A;  4TSX A;  3NVM A;  4RG8 A;  5AQX A;  1GLF O;  1IKY A;  3U4L A;  2ZGZ A;  1EX4 A;  2F8S A;  4GY2 B;  4JN4 A;  3TTC A;  1NK6 A;  3VTI A;  2AP1 A;  4CIG A;  4CHO A;  3I0S A;  3GBT A;  5MLC Q;  1GLJ O;  4I2Q A;  2BGG A;  4CBW A;  2DFE A;  5AQJ A;  4KI6 A;  1BDG A;  1Q7Y O;  2QWM A;  1TL1 A;  3CFP A;  1ZBS A;  1QVG M;  4I7F A;  2VG5 A;  1TUU A;  2P1J A;  4E19 A;  5AQW A;  4BDY A;  3LAK A;  4BAC A;  2O8B B;  1M1K O;  4I9Q A;  3HYF A;  3FZL A;  3OTO K;  1WSH A;  3HI0 A;  4CFC A;  2Q1N A;  3AVA A;  1WBD A;  1MWK A;  1K9M O;  2A3Z A;  2FBX A;  1TKZ A;  5F1X A;  4DCH A;  2HW3 A;  1NGA A;  1LAV A;  1BQM A;  4PKI A;  3PO4 A;  2XY5 A;  3T1H K;  3KK7 A;  5AQF A;  5AQU A;  1RIL A;  3HPO A;  4N47 A;  1SL1 A;  5KQ8 A;  3K5L A;  4DV1 K;  1R59 O;  3KZB A;  3L2V A;  4OO1 J;  4LF6 K;  5AQT A;  3CJ7 A;  3LDN A;  3WEE A;  3TTD A;  3LDP A;  3NFA A;  3FZM A;  4DTM A;  1XWL A;  1VSM A;  1HQE A;  2E6L A;  5DM7 L;  2ASP A;  3VTH A;  1A5V A;  2QTD A;  4AHC A;  1NKC A;  3V9Z A;  1QZ6 A;  1DT9 A;  1EQY A;  3OBW A;  3MEC A;  1KFS A;  3M1F A;  3QFP A;  1HNI A;  3AA3 A;  3WQT A;  3OS2 A;  5BRE A;  1JCG A;  2QI2 A;  2IGI A;  3M3Z A;  1DLO A;  3IAY A;  4R79 A;  4HWI A;  1T8E A;  3TPQ A;  3KD1 E;  4FO0 A;  4H0Y B;  1RT3 A;  3NGY A;  4FLZ A;  4E7H A;  3NF8 A;  3M8P A;  1IJJ A;  1S1T A;  4IFE A;  3B8A X;  3LDL A;  3IUC A;  1HNX K;  3A5O C;  4CEO A;  2XY6 A;  2IC3 A;  1TL3 A;  1IO2 A;  4W5R A;  1TK5 A;  4DMN A;  4Z4I A;  5HRO A;  4KTZ A;  1S1W A;  3CQY A;  3TTF A;  1BCO A;  3VMF B;  4NLB A;  4B9S A;  3OYL A;  1TKD A;  4H5W A;  1TYQ B;  4JS4 A;  4Z4H A;  1VQK N;  1JKH A;  1G15 A;  3AO2 A;  4BQL A;  3MN9 A;  5JIC A;  4PHT X;  2E2P A;  2O8F B;  2UUB K;  3HXM A;  1DTT A;  3AA2 A;  3I8D A;  3L3U A;  2FF6 A;  5ELZ A;  4NLC A;  2NRW A;  4E89 A;  5E26 A;  5KI6 A;  4JLH A;  4RTF D;  2RHK A;  4IXC A;  3EYZ A;  4WE1 A;  4W5T A;  3L3V A;  3HM8 A;  4J2A A;  2KHO A;  1QZ5 A;  5AQY A;  2QKB A;  3L2W A;  2YHA A;  3FZF A;  1S5J A;  1KLM A;  3LPT A;  4B9V A;  4AH9 A;  4UY8 O;  4F3T A;  2UXB K;  1QQM A;  5BR9 A;  4DS5 A;  5KPR A;  2HND A;  3RMC A;  3CCE N;  3LDQ A;  3NCI A;  3F9K A;  4C23 A;  1VSJ A;  4CZG A;  3JAM O;  4KH5 A;  5BPN A;  5M1N A;  4CJF A;  1RBS A;  3CCV N;  4LF8 K;  1C0U A;  2GEL A;  3WUH A;  3J81 O;  2D0B A;  1ZBI A;  3TAE A;  4I6M A;  3OYH A;  4FK4 A;  4KH4 A;  1U2V B;  1N34 K;  3DOL A;  4CFA A;  1RT7 A;  3OW2 M;  1WSF A;  4JKD A;  5CZ1 A;  3ZX2 A;  4BGA A;  3ZX3 A;  1GOA A;  1S1X A;  2OPQ A;  3V1O A;  4BRM A;  1YVU A;  3V9U A;  3OS0 A;  1U48 A;  3HBT A;  2PAV A;  1HYV A;  4JD2 A;  2P5O A;  2NZT A;  4CJP A;  5M1K A;  1T6C A;  3K9J A;  4B08 A;  1XI1 A;  1SQK A;  3TSU A;  2HHQ A;  4IO9 L;  3G0Z A;  1W0H A;  1FK9 A;  5C10 A;  2FLO A;  1BA0 A;  2D0P A;  2GX9 A;  4JNE A;  3NH0 A;  3O5B A;  4M3U A;  4DQS A;  4BRF A;  4FVM A;  2BAN A;  4H0X B;  3U3Y A;  2YJF A;  3KVG A;  2VG6 A;  4A5B A;  3BF3 A;  3ZSV A;  3KWI A;  4CI6 A;  3IG1 A;  4FWO A;  4BC3 A;  3QEP A;  1JL1 A;  5FPN A;  3SAH A;  3DJC A;  1RCH A;  5FDL A;  2VYP A;  5CYQ A;  3U9Z A;  4YOT A;  3CCS N;  4CCH A;  2E2Q A;  4HTL A;  4KHU A;  4ILH A;  2O8D B;  4M3T A;  3KLG A;  4B1X B;  4QCL A;  3PLA A;  1K8A O;  1BQN A;  3D6R A;  1GOC A;  3VQP A;  2HOE A;  3CFR A;  4JKH A;  5F0X A;  3C6A A;  2E1Y A;  1SS6 A;  1RDU A;  3VQB A;  3PUF A;  4HCB A;  5J1E A;  3NF7 A;  4U67 L;  3W3D A;  4EHU A;  4Y1D A;  3WNF A;  5AQI A;  5AJ3 K;  2NRZ A;  5FRM A;  4FJI A;  5GAD P;  4B1Z A;  1KXP A;  2CH6 A;  3AVL A;  4IOC L;  3K5M A;  4W5Q A;  1BIS A;  1YTA A;  4FOI A;  2E5L K;  1RT1 A;  4CGD A;  1C0M A;  4FWL A;  5F2R A;  4H5N A;  2QWL A;  3LWL A;  2KFN A;  3OYC A;  4NXN K;  3WXK A;  2YKN A;  4ZTJ A;  4OLA A;  4OKE A;  2P9N B;  4BRE A;  4CJE A;  1Q82 O;  3CC4 N;  5CYM A;  1N33 K;  4QS9 A;  4CES A;  3D0P A;  4E7K A;  4RCH A;  3THX A;  4OPK A;  3WNH A;  4CBU A;  3K0S A;  3O08 A;  4RW7 A;  4CEZ A;  3PX4 A;  4A62 A;  3S3N A;  2IIR A;  3V9X A;  2OA8 A;  4NYN A;  4A2A A;  4DV6 K;  4BRK A;  1QS4 A;  2P51 A;  4OPA A;  5DM6 L;  3WXL A;  1RGI A;  5JVH L;  4E3S A;  1REV A;  2VGM A;  2QWN A;  1KAZ A;  3HPG A;  1I3A A;  3QML A;  3SK3 A;  2XY8 A;  3WT0 A;  3V9W A;  2BDP A;  5J2Q A;  2B4J A;  4JI2 K;  4CF9 A;  4ELT A;  1LWC A;  2ZJQ L;  3MDQ A;  4O55 A;  4DUZ K;  2P9K B;  3UKU A;  3ASM A;  2HBK A;  4CEB A;  1B9D A;  4FLX A;  2FBT A;  4JKG A;  4CE9 A;  2HBJ A;  3VN5 A;  3OBY A;  1X9J A;  1CXU A;  1RTJ A;  3VQ7 A;  3I56 N;  4B8C A;  1FW6 A;  4B3O A;  4AIL C;  2G8I A;  3DLL L;  3NVK A;  1C0G A;  5M1O A;  4DG1 A;  3ZSZ A;  2HHX A;  3CPE A;  2VG7 A;  4DSE A;  4IZ9 A;  3MX5 A;  2Q36 A;  4K0K K;  3NAE A;  1NJW A;  2IAJ A;  4M45 A;  1HJR A;  5LMN K;  2HVH A;  5LJV A;  5E41 A;  3UB5 A;  4DV4 K;  4BGB A;  5AQS A;  4JKA A;  1NK8 A;  1UOC A;  1FJG K;  5GAG P;  1L3V A; 
#chains in the Genus database with same CATH homology
 3FGU A;  5M1Q A;  4WQ4 C;  4M7Y A;  2J4R A;  5BN9 A;  2ITM A;  3VEN A;  5BRH A;  3O4W A;  1K8K A;  3CJA A;  3VGL A;  2V7Y A;  3IMX A;  1O13 A;  2VWB A;  4OPH A;  3H45 C;  4JAX A;  5AFU A;  1V4T A;  5TKY A;  3IFR A;  2ASM A;  3L4I A;  1J6Z A;  1Y64 A;  4WFN L;  4BR0 A;  3HTV A;  3ATU A;  2JWK A;  4CBX A;  4YOU A;  2V52 B;  3MMV A;  4FPA A;  4BC4 A;  3I8B A;  3LM9 A;  1HX1 A;  1NLV A;  2E2N A;  2P9K A;  5AQH A;  3U8X A;  3SAG A;  1VQN N;  2IVN A;  5AQG A;  2GUP A;  3VEW A;  2GTD A;  4GVE A;  2HBM A;  2CGJ A;  2P9P B;  4ILG B;  4BRQ A;  4K42 A;  4O8K A;  2E20 A;  3IKM A;  3ULE B;  2NRH A;  3QBW A;  2F9W A;  2W40 A;  4H0T B;  5EXW A;  4K43 A;  4YOW A;  3G4S N;  1XQS C;  2F7T A;  4J8F A;  1YJN N;  4G9Z A;  1VQ9 N;  4BR4 A;  4EAH D;  4FL9 A;  2OTJ N;  2NLX A;  3FE1 A;  1HKG A;  3JS6 A;  4DQ8 A;  4U7B A;  2E88 A;  4MLE A;  3MN6 A;  4FOE A;  5AQN A;  1BWF O;  2A6A A;  3SMS A;  3BF1 A;  5C12 A;  2A40 A;  3CCQ N;  3HZ6 A;  3L4Q A;  1M90 O;  4YOX A;  3CCU N;  1QVF M;  1P8Z A;  5JLF A;  2ASO A;  2P9I A;  3MWT A;  4BRN A;  3MN7 A;  3UKR A;  4FVU A;  4PL7 A;  1T3V A;  2QWP A;  3AAR A;  3AAP A;  3WEE B;  3DAW A;  3H3N O;  1N8R O;  3CC2 N;  4BRH A;  2P9U B;  3NVM A;  3A5M C;  5AQX A;  1GLF O;  4JK9 A;  4A2B A;  3N4Q A;  3C7N A;  3U4L A;  2ZGZ A;  4FWK A;  4GY2 B;  4JN4 A;  5AQV A;  5TKW A;  3TTC A;  2Q2R A;  3VTI A;  5FPD A;  3HOS A;  3Q7C A;  2AP1 A;  3E66 A;  2WC9 A;  3VEV A;  4H5R A;  1NGG A;  2Q31 A;  3CHW A;  5BPM A;  3GBT A;  3ZET B;  1GLJ O;  5MLC Q;  1GLE G;  1V4S A;  2QM1 A;  4ISF A;  4CBW A;  3QB0 A;  5AQJ A;  1BDG A;  2WFB A;  4KBO A;  3SBG A;  5ADX A;  1QQO A;  2HBL A;  5H1S Q;  1TUY A;  4MDB A;  5GAE P;  3VF4 A;  5FPE A;  1Q7Y O;  1DKG D;  2BTF A;  2QWM A;  4BRL A;  3CCR N;  3VGM A;  1ZBS A;  1QVG M;  1TUU A;  3K9K A;  3E9O A;  5AQW A;  3JXU A;  4BRA A;  3H46 O;  4C1N I;  1YIT N;  3L6Q A;  4A59 A;  1M1K O;  3I55 N;  1QQN A;  4PL8 A;  3FZL A;  3E9P A;  3FZH A;  3ENH A;  2WBN A;  3VEZ A;  3HI0 A;  4JKB A;  4BY9 C;  4QS8 A;  3GG4 A;  2Q1N A;  2P9P A;  1MWK A;  1K9M O;  3VGK A;  4BR2 A;  3CC7 N;  3R8E A;  5AQP A;  3ULE A;  2A3Z A;  4A57 A;  3MN5 A;  3O1B A;  4BQZ A;  5F1X A;  4DCH A;  1NGA A;  1GLD G;  2A41 A;  3D7E O;  3DXM B;  3M6G A;  4PKI A;  2A42 A;  1BG3 A;  1KQS M;  2RE2 A;  3O9S A;  1D4X A;  2JWL A;  5CHI A;  3KK7 A;  5AQF A;  5AQU A;  2EWS A;  4EIA A;  3NMU A;  4M63 C;  5KQ8 A;  1BUP A;  4CZE A;  3H3O B;  1R59 O;  3EKU A;  3KZB A;  4OO1 J;  4H0P A;  3CQX A;  3FFK B;  3O1W A;  3GL1 A;  5AQT A;  5AQQ A;  4DB3 A;  2Q0R A;  3CJ7 A;  3LDN A;  4NO7 A;  3WEE A;  3A5L C;  3TTD A;  3LDP A;  4Y0W A;  4C1N K;  3FZM A;  3WQU A;  4FWM A;  1KD1 O;  2Q0U A;  1YUW A;  5JLH A;  2CGL A;  3LDO A;  2P9U A;  5DM7 L;  3KWG A;  4CZL A;  2KKZ A;  2ASP A;  3T69 A;  3ZEU B;  3VTH A;  1NBW A;  2P9S A;  3MCA B;  2QTD A;  3A5N C;  4JK8 A;  1QZ6 A;  1DT9 A;  5AR0 A;  3EE8 A;  3VF2 A;  5C2D A;  4JEP A;  5BN8 A;  1EQY A;  3QIC A;  4FWR A;  3OBW A;  4WQ5 A;  3AGK A;  5GIN A;  2HF3 A;  1DGK N;  3M1F A;  5AZI B;  3ZET A;  3QFP A;  3O9R A;  2CGK A;  1RFQ A;  3RVC A;  2UYT A;  1YXQ A;  1VQ8 N;  4DHY A;  1VQ6 N;  1YAG A;  3QDK A;  2PBD A;  3WQT A;  2IVP A;  5BRE A;  1JCG A;  2QI2 A;  3C65 A;  4WQ4 A;  1WOQ A;  2NNW A;  1ZXO A;  3SAF A;  1VQ4 N;  3M3Z A;  4MLH A;  4R79 A;  5EX5 A;  5AQM A;  1Z6R A;  2QWQ A;  4O5F A;  3P31 A;  3F5T A;  2E1Z A;  5AQO A;  4HWI A;  3TPQ A;  1WUA A;  2ZF5 O;  4FO0 A;  4H0Y B;  3D2E B;  3VEO A;  2ZWH A;  3OHR A;  1Q18 A;  4PKH A;  4BVP A;  1IJJ A;  2W41 A;  1XUP O;  3KHY A;  4IFE A;  4GV9 A;  3OA9 A;  2FXU A;  3B8A X;  3ID8 A;  4BR7 A;  3HOT A;  3CPW M;  3LDL A;  4H0O A;  1LOT B;  3IUC A;  4I6M B;  3A5O C;  3DXM A;  3ENO A;  3O9T A;  4JK7 A;  4NB4 A;  5AQZ A;  4ILJ A;  4MO5 A;  5GIP A;  3LM2 A;  1JCE A;  1VQL N;  1YJW N;  4K25 A;  5CE3 A;  5BRD A;  1VQM N;  4WCE L;  3CQY A;  2CH5 A;  3TTF A;  3G25 A;  3HRG A;  5KPZ A;  3VER A;  4WYB A;  3VMF B;  4CZI A;  4NLB A;  4EHT A;  4H5W A;  4GV3 A;  1TYQ B;  1GLC G;  5CR4 A;  2NRR A;  3AAQ A;  4JD2 B;  5BPL A;  1MA9 B;  1VQK N;  1DEJ A;  1YHQ N;  3EZW A;  4KH6 A;  3C6H A;  4BQL A;  1MWM A;  1U6Z A;  3GE1 A;  1HPM A;  3MN9 A;  3P4I A;  2WUS A;  3ZEU A;  1RDW X;  2P9S B;  3CET A;  3FZK A;  2E2P A;  4CZJ A;  4PHT X;  5JIC A;  1HJO A;  3CME N;  4BC5 A;  3N4P A;  1QHA A;  3TU5 A;  1KC8 O;  1SZ2 A;  1K73 O;  2P9L B;  1GLL O;  1CZA N;  2ZJP L;  2HST A;  2FF6 A;  5ELZ A;  4NLC A;  5JMV A;  4FSV A;  2NRW A;  5E26 A;  3DXK B;  3ID6 A;  4RTF D;  5AZI A;  3AGR A;  3EKS A;  4BC2 A;  3CJC A;  2RHK A;  1NMD A;  3A0I X;  4IXC A;  1IG8 A;  4XEI A;  1KAY A;  1KAX A;  1NGC A;  3AY9 A;  3C0B A;  3HM8 A;  4IEI A;  3BEX A;  3R9P A;  2KHO A;  5HL7 L;  1QZ5 A;  4IOX A;  2D4W A;  5AQY A;  4B9Q A;  1OVY A;  3CF5 L;  4O8U A;  1H1V A;  3A8Y A;  5GIO A;  2VCP A;  3FZF A;  3VF6 A;  1BU6 O;  5AQK A;  5AQL A;  1VQ5 N;  3D2E A;  4B1Y B;  4UY8 O;  3MK6 A;  4B1W B;  2GEM A;  2H3G X;  3VPZ A;  1QQM A;  3BUZ B;  5BR9 A;  5KPR A;  3CCE N;  4IWV A;  3CIP A;  3M5R A;  3LDQ A;  2ZJR L;  4IO8 A;  1W97 L;  4C23 A;  4CZG A;  5M1N A;  4KH5 A;  5BPN A;  3CCV N;  3CCL N;  4LC9 B;  4FWQ A;  4DKW A;  3G71 N;  1ZC6 A;  2GEL A;  3WUH A;  5KPT A;  2D1K A;  4JKE A;  3W0L A;  4CD1 A;  4I6M A;  1VQO N;  2YJE A;  5C15 A;  2V51 B;  4KH4 A;  1U2V B;  3J8A A;  3ZX0 A;  5HOO A;  1HKB A;  3OW2 M;  4JKD A;  3ZYY X;  4CZK A;  3FLC O;  3ZX2 A;  4BGA A;  3HSC A;  3ZX3 A;  1X3N A;  4F9O A;  1NGD A;  3CMA N;  3O9U A;  4BRM A;  1JCF A;  2QW9 A;  2FF3 B;  3FR0 A;  4RWT A;  1S22 A;  1OKJ A;  4JHD B;  3G6E N;  4BRD A;  2YI1 A;  3HBT A;  1NGH A;  1TYQ A;  2PAV A;  3E1Y A;  5EOY A;  3O9Q A;  2YCH A;  3O6W A;  4JD2 A;  2NZT A;  5M1K A;  5C0Y A;  1NM1 A;  1T6C A;  3K9J A;  4IOA L;  3IDH A;  1SQK A;  3TSU A;  1ATR A;  2BUP A;  3H6E A;  4BR5 A;  4IO9 L;  5B8H A;  3WXJ A;  5C10 A;  2FLO A;  1BA0 A;  2E8A A;  2D0P A;  4YDU C;  2P9L A;  2GX9 A;  2YHW A;  4JNE A;  3TSP A;  3O5B A;  4MDA A;  4BRF A;  1VQ7 N;  4H0X B;  2BH1 A;  3DXK A;  2YJF A;  3KVG A;  3O80 A;  3CER A;  4IJA A;  2PFU A;  4IEE A;  4YOY A;  3EE9 A;  4A5B A;  3BF3 A;  3KWI A;  4CI6 A;  1BOT O;  1Q86 O;  2ZGY A;  4FWO A;  4BC3 A;  4FWP A;  1XC3 A;  4PKG A;  2OAN A;  5FPN A;  4BRG A;  3SAH A;  1GLA G;  3DJC A;  4A61 A;  1YI2 N;  4IDH A;  2VYP A;  1NGF A;  3U9Z A;  4YOT A;  3CCS N;  3Q7B A;  4XH4 A;  3D2F B;  3F2K A;  3F9M A;  3SJH A;  1E4F T;  1T6D A;  4ISE A;  3SBT A;  4CZM A;  1MDU B;  2E2Q A;  3EL2 A;  4HTL A;  4ILH A;  3J7Z O;  4GNI A;  2FSK A;  4WFB L;  3VOV A;  4B1X B;  3PLA A;  5AZJ A;  1K8A O;  3CCJ N;  4A5A A;  3GOI A;  4WFA L;  1T44 A;  1ILY A;  3D6R A;  2HOE A;  4JKH A;  5F0X A;  3C6A A;  3VEX A;  2E1Y A;  1SS6 A;  1RDU A;  4ISG A;  4YOR A;  1U2V A;  3RSE B;  1GLB G;  4U67 L;  4AM7 A;  3SMP A;  2I7N A;  3W3D A;  3UKU B;  4EHU A;  3DWL A;  2YHY A;  5AQI A;  2NRZ A;  5AFU H;  3CCM N;  4JKG B;  1Z05 A;  5GAD P;  4B1Z A;  3MCP A;  4CZF A;  1KXP A;  2FSN A;  2CH6 A;  3L0Q A;  4JHD A;  2IVO A;  2GWK A;  4IOC L;  4BRC A;  1Q81 O;  4AM6 A;  1VQP N;  4Z94 A;  5C2F A;  4H5T A;  3H1Q A;  5LJW A;  4IJN A;  4FOI A;  1HLU A;  3WXI A;  4FWL A;  3R6M A;  5F2R A;  4H5N A;  2QWL A;  4H03 B;  5FPM A;  4B1V A;  3CJB A;  3WXK A;  4B1U B;  4YOV A;  2Q97 A;  5BRF A;  2VGN A;  5EY4 A;  4CZH A;  2P9N B;  2NRX A;  4CD3 A;  4BRE A;  5AQR A;  2QWR A;  4JKC A;  1HUX A;  5M1F A;  2QA4 N;  1ESV A;  1Q82 O;  4CJ7 A;  2GWJ A;  3ATV A;  3CC4 N;  4QS9 A;  5M1P A;  4MO4 A;  4RCH A;  3UE5 A;  4FPB A;  4CBU A;  3O08 A;  4K41 A;  1YJ9 N;  3CI5 A;  4A62 A;  2IIR A;  5E84 A;  4L3Q A;  1P90 A;  4A2A A;  4BRI A;  4BRK A;  1NJI O;  4H0V B;  3S41 A;  3ENB A;  3GDQ A;  4OPA A;  5DM6 L;  3PIP L;  3WXL A;  1LCU A;  1RGI A;  3U9D A;  5JVH L;  4XH5 A;  3D2F A;  2VGM A;  2QWN A;  1K8K B;  3TSQ A;  4FWS A;  1KAZ A;  2I7P A;  3MWP A;  1X3M A;  3EO3 A;  1EO1 A;  3QML A;  1S72 N;  1BO5 O;  4M7X A;  5AZJ B;  3SK3 A;  2YHX A;  3EN9 A;  3WT0 A;  1JJ2 M;  3QFU A;  4E1J A;  2DPN A;  4H5V A;  3QBX A;  3WXM B;  4EFH A;  2V7Z A;  3PIO L;  2HMP A;  1SAZ A;  3RSE A;  3CXC M;  3CJ9 A;  2QEX N;  2ZJQ L;  2QXL A;  1BA1 A;  3MDQ A;  2P9K B;  1E4G T;  3UKU A;  4BRO A;  2HF4 A;  1ATS A;  2HBK A;  2KLA A;  4JKG A;  4WF9 L;  3CJ1 A;  5JVG L;  5ADX H;  1NGB A;  1YF5 L;  4BG8 A;  3CD6 N;  2HBJ A;  1G99 A;  3R1X A;  1C0F A;  3OBY A;  1X9J A;  1VAZ A;  5EVZ A;  1W2B M;  2YX6 A;  3P38 A;  3I56 N;  4BG9 A;  1YVN A;  2OTL N;  1ATN A;  1HKC A;  5LY3 A;  2FSJ A;  3DLL L;  1C0G A;  3NVK A;  4GV6 A;  5M1O A;  3E9L A;  4XH1 A;  2QWO A;  3VEY A;  3VET A;  4BR9 A;  1NWK A;  4AF1 A;  3LL3 A;  3CPE A;  4BRP A;  5I9E B;  4IZ9 A;  2P9I B;  2A5X A;  3MX5 A;  3P39 A;  1NGJ A;  1NGE A;  3UKR B;  2P9N A;  2Q36 A;  3MX2 A;  3BP8 A;  3VES A;  4JKF A;  5GAH P;  4QS7 A;  3SLC A;  3UB5 A;  4YDU A;  5LJV A;  3T7Z A;  4BVO A;  2NRV A;  1NGI A;  4BGB A;  4FWN A;  5AQS A;  4WQ5 C;  5KQD A;  1YIJ N;  2NRT A;  3O8M A;  2AA4 A;  2E2O A;  3C7N B;  4JKA A;  2F9T A;  3I33 A;  1S3X A;  3R3L A;  2D0O A;  5GAG P;  3H1V X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...