4AHVA

Parallel screening of a low molecular weight compound library: do differences in methodology affect hit identification
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Parallel Screening of Low Molecular Weight Fragment Libraries: Do Differences in Methodology Affect Hit Identification?
pubmed doi rcsb
source organism Human immunodeficiency virus
molecule tags Transferase
total genus 58
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ahvA00
5CZ2A 4F3OA 4FCYA 3HPHA 4HUGA 3LPTA 1NOYA 5HROA 2QKKA 3SPYA 4HUEA 4IG3A 2IDOA 4BDYA 5HRNA 1JLBA 3DLHA 1KTQA 4KV8A 2VG5A 1RBTA 2YHAA 3C94A 4C8MA 3DOLA 3H08A 1T03A 4M3TA 2XY6A 4C8NA 3K5OA 4I7FA 1QTMA 4FJGA 4KHSA 2X6SA 2E6MA 1TKDA 1LW0A 5FRNA 1WAJA 4Z4HA 3HPGA 4ZHRA 3KK1A 3U3YA 4KPYA 2DFFA 2G8IA 2QKBA 1NOZA 1TKTA 4Z4FA 1IKVA 1LWCA 4GVMA 3NF8A 3IG1A 4DSFA 2BGGA 4CEZA 5JS1A 1RBUA 3AO2A 1CZBA 4J2DA 1ZBIA 1TKXA 3U3GA 1BIUA 3OS2A 3LAMA 1BIZA 3HYFA 3OYLA 4CFCA 4DTOA 4DFKA 3SV3A 4DTUA 4E0DA 1SUQA 1TAUA 4CEDA 2PZSA 1JL1A 5CY4A 4CE9A 3K5NA 3K5LA 3MAQA 4FM2A 1ASWA 1U4BA 1NJWA 2HHWA 1JLQA 4EP5A 3HXMA 4DSLA 4F2SA 3AO4A 3NH1A 4FJXA 1SL0A 1FKOA 3SJJA 1Q9XA 5DMRA 2X6NA 3LP3A 3G0ZA 4M3ZA 4LH5A 2X78A 4DSKA 2D0BA 4B9NA 3AA2A 4KTWA 3QEPA 4DSJA 3P83D 1KFDA 3OS0A 3OYIA 3ZT0A 3L2QA 2WONA 3WNFA 2ETJA 2Z1HA 4O0JA 3V9WA 1WSFA 3ZSOA 3ZSVA 3DYAA 3V9XA 2Z1IA 2D5RA 2DTUA 4W5NA 2HNDA 5FROA 3QLHA 3VQ7A 4ELVA 4CFDA 3JYTA 1TAQA 1LAVA 1RT1A 3BDPA 4CF9A 3VQ5A 1NK8A 5J2QA 4RW6A 4B9LA 3P5JA 4MQ3A 3CFOA 3C95A 4CHQA 5J2PA 4PY5A 3KIOA 1WSEA 5KRTA 3ZSQA 2FBXA 4E89A 1KSPA 2HNYA 4N76A 3OYMA 1C0MA 4E7LA 1BQNA 1JXBA 2E4LA 1JXEA 1A5VA 3TABA 4TSXA 4M3RA 2A1SA 4GW6A 4I2QA 3LP0A 4DTNA 1NKCA 4ZTJA 4KHYA 5D3GA 1IH7A 1NKBA 1ASVA 1BL3A 3QINA 4YFUA 1WSJA 4CJLA 4NYNA 1S9GA 4CGDA 2G8WA 4CJKA 4DWIA 4KHNA 4AHSA 1B9DA 3KLGA 2IAJA 1JLAA 1RCHA 3CM6A 1UA0A 2DY4A 1VSKA 4HCBA 1R0AA 4O4GA 4KREA 3ZT4A 2FBVA 1JLCA 3MEDA 4AHCA 3OYKA 3V1RA 4FLUA 3QESA 1T7PA 4H4MA 4DF8A 3SUOA 3AVHA 3NE6A 3KD1E 4FVMA 1Z26A 3VQQA 4LSLA 4DQSA 4FW2A 3KKSA 2EHGA 3D45A 3SYZA 3AVKA 3I0SA 1SKWA 4KTZA 4O55A 1IG9A 3ZCMA 4FK2A 4H4OA 3VQEA 3TAPA 4PWDA 4C8KA 3LWMA 1B92A 4FLXA 3EYZA 4DTPA 3SQ2A 3TAQA 3SUNA 4KRFA 5I42A 1VSEA 3MXIA 1KLNA 3RTVA 4OGCA 3HPOA 1U47A 4FZYA 1S1XA 3VQPA 4OKKA 4JRQA 2W42A 1BGXT 1QQCA 2NUBA 3OY9A 3RRGA 5J2MA 1QSYA 3RR8A 4FJ9A 4NCBA 1FKPA 1VSJA 3AVJA 1WLJA 3LP2A 3WNEA 5SWMA 3T3FA 4I9LA 3SQ4A 3PY8A 3TAMA 3OJSA 2KFZA 1WSGA 4M3UA 2ITGA 3MEGA 1GOBA 3V1QA 2XY5A 1G15A 1L3TA 3RR7A 1RTHA 4CF1A 3QNOA 3V9ZA 4E7JA 1EKEA 4OGEA 1J54A 1TL1A 4E1MA 4CHPA 3D0PA 3T19A 3LZJA 1NK4A 2OYQA 4E1NA 4OPJA 4AHVA 3KK3A 4FJ7A 1LWFA 5C24A 2RF2A 3QIPA 4QCLA 2HHQA 2B6AA 1ZBHA 1BCMA 3OYAA 1VRTA 2ATQA 5C25A 4FJMA 4L8RB 3NGYA 3OYBA 3M8QA 1UAXA 3NAEA 4CGIA 1TGOA 3KKRA 1BI4A 4C8OA 3M8SA 3DM2A 2IC3A 3CYMA 2KW4A 3L3VA 1WSIA 3V4IA 1ZBLA 2HHSA 5HRSA 2A1RA 4F8RA 3K58A 3ITHA 3DMJA 2YNHA 3LDSA 4FZXC 3NH2A 1S1VA 1KVBA 4OVLA 1HNVA 3V6DA 3DLKA 5E41A 2GV9A 4CK2A 3AO5A 1J5OA 2ZQBA 1RT4A 4CEAA 4ZTFA 2PYJA 3TR8A 2B4JA 3I8DA 3OYDA 3KJVA 2KFNA 1QHTA 2XHBA 2X74A 2FBYA 4CGHA 5EU7A 4CJ5A 1ZYQA 1T8EA 4OKEA 3PX6A 1N5YA 1RTDA 3NF9A 4E7IA 4O5BA 1IO2A 3L3UA 3MECA 4IDKA 2HVHA 3O3GA 1EXQA 4CJFA 1NK6A 2PYLA 4B9MA 1CZ9A 3G10A 1DLOA 5FDLA 4H8KA 5FRMA 4JS4A 2HHUA 4BDZA 5HRPA 2RN2A 1IKWA 4YNQA 3AO1A 1YVUA 3AVFA 4OPKA 3HVTA 3AVMA 3TARA 1L3VA 4QOZB 1C0TA 4Z4EA 3VA0A 2HB5A 2KZMA 4DSEA 4KAZA 4CJPA 3JSMA 3DRSA 4ID1A 1S6QA 1Q9YA 2B5JA 4HHTA 4Z4CA 1BQMA 2OPRA 4KKOA 1KRPA 4CIEA 4F3TA 3ASMA 1CXQA 1TVRA 2GUIA 2DFEA 4FJLA 3ZT3A 4LY7A 2OZSA 3P1GA 4RW8A 1C1AA 2BDPA 3LZIA 2YKNA 3VQBA 1KVCA 4AH9A 1D9DA 4KB0A 4BE2A 4I2PA 4FLZA 3VA3A 3O4NA 3LPUA 1QS4A 2Z1GA 4IFYA 1TK8A 1DTQA 2YKMA 2AJQA 4Y1CA 4BACA 4CJSA 1TK0A 3KD5E 3QEXA 3V9SA 1YT3A 4M41A 4B9SA 2XRIA 1RT7A 2YNFA 3HSTB 2E6LA 4AHRA 4BE0A 3QETA 3AV9A 1U49A 4K8XA 4FK0A 2RPIA 1LWEA 4RW4A 1TV6A 4ID5A 3NBPA 1C0UA 2Q3SA 1NJZA 4CIFA 4CFBA 3IS9A 1J9AA 4KI6A 4CF2A 1HMVA 1RT3A 2HHTA 4CEQA 1ZBFA 3ALYA 3QO9A 3OVNA 4LH4A 5SZTA 1KFSA 4DSIA 4KTQA 4CERA 4OLAA 3MXJA 4JRPA 1EX4A 2G8KA 3C6TA 2G8HA 3THVA 1XHZA 3ISNC 4FJKA 1CXUA 2XO7A 3CFRA 3E01A 4AILC 4E7KA 3DLBA 4FJ5A 1L5UA 2O4GA 3HT3A 3ZT2A 5HP1A 4E3SA 4Z4IA 5KI6A 4CGFA 2VG7A 3TAEA 1L3SA 2P51A 5DK5A 3SV4A 1JLFA 3NF6A 3MXMA 4CF8A 3UIQA 3QEVA 4CK1A 1WAFA 4CEOA 4FM0A 5J2NA 2HNZA 2ZE2A 1QE1A 2D0AA 3I0RA 4NCAA 4DFPA 4M3XA 4PQUA 3L2RA 3TANA 1Z25A 3U6FA 4DU4A 1DTTA 1LW2A 4E7HA 4DF4A 4FJIA 4Q0BA 1Y97A 1S6PA 3ZSXA 2Y1JA 3AVNA 4KHQA 1VSLA 3QEWA 3NHGA 3QEIA 2BE2A 1C6VA 4NYFA 3HL8A 5JS2A 4W5RA 3PV8A 1RDAA 3OYNA 1K6YA 4O44A 4PUOA 4J2AA 1KCFA 1QSLA 3RMBA 1KLMA 3OYCA 4IFVA 4DU3A 2P5OA 4N56A 1I3AA 1TL3A 3LANA 4GMJB 4RG8A 1QSSA 3O3HA 4CGJA 3HM9A 4DMNA 2GBZA 1WNSA 2OA8A 3K2PA 4EZ6A 4KO0A 3PO4A 1BCOA 4DFJA 4FJ8A 3SZ2A 3ZSRA 3S3MA 1F21A 3SUQA 1NK0A 1C1CA 1KVAA 3VQCA 3LAKA 4FJJA 2QK9A 3ZSWA 5KRSA 5KTQA 4B08A 1O1WA 4CJRA 1D9FA 4KI4A 1BHLA 2HW3A 2JGUA 4CHOA 1HNIA 3AO3A 2G8VA 2FC0A 3SPZA 4K8ZA 3KLFA 3SQ1A 4KHWA 3CG7A 4EP4A 3RMCA 4C8LA 4B9UA 4JLHA 3CM5A 1EP4A 2F8TA 4F2RA 5HLFA 3RMAA 3S3NA 1HPZA 1NJYA 1U04A 3ZSZA 1RT6A 3LWLA 3S9HA 3SI6A 2EX3A 4CHYA 2P5GA 4J2BA 4J2EA 3HO1A 3AVAA 4CJTA 4HTUA 3TAFA 1RNHA 1EETA 2XY8A 2Z1JA 3HP9A 3HJFA 3K57A 4HUFA 4CHZA 4DQRA 4EZ9A 2HVIA 1NK9A 1VSDA 3L2VA 3L2UA 2VG6A 3K5MA 1LV5A 2YV0X 4FJNA 4CJEA 4M45A 3OYGA 2OPPA 4N5SA 5KGWA 3NF7A 4BDPA 4FLWA 3QNNA 3LP1A 1WSHA 1XWLA 3NCIA 5CYQA 1UWBA 3F73A 1VSHA 3RRHA 3PO5A 3VQ9A 1HYSA 2KTQA 3NH0A 1I39A 1Q8IA 2IS3A 5KGXA 4Q5VA 3AVCA 2OPSA 1T05A 3OYFA 1JLEA 2DFHA 3O3FA 3QIOA 1X9SA 1UOCA 1JKHA 3PX4A 1RBRA 1GOAA 4DTXA 2YNGA 3M8PA 3DRPA 3SUPA 3TWHA 4DFMA 1N6QA 2YNIA 2XY7A 1BISA 3IAYA 1MU2A 4DQIA 1RDBA 3HK2A 4I9QA 2IGIA 1L3UA 2G8FA 1A5WA 3OJUA 4W5QA 3B6PA 3ULDA 2OZMA 1W9HA 3DLEA 1ITGA 3B6OA 4CJ3A 4ELTA 1X9MA 1RT5A 4G1QA 1ZBUA 4CECA 4DG1A 4ICLA 5K14A 1RT2A 2D0CA 3HP6A 3AA4A 4FLYA 4Z4GA 4O0IA 1B9FA 3ZT1A 3OYHA 2R7YA 1HYZA 4CEFA 3KK2A 4FXDA 1YTAA 3OYJA 3IRXA 4CFAA 3SQ0A 1UA1A 1NJXA 3RMDA 4W5OA 2VWJA 1J53A 3PX0A 2HHVA 3QERA 4OLBA 1YTUA 4F4KA 3O4QA 3HVRA 4JS5A 3C6UA 4FZZA 3FFIA 3V1OA 1U48A 3DI6A 4OKJA 4AHTA 1GOCA 4UQGA 1U45A 1HJRA 3TI0A 4HCCA 3DLGA 3DLRA 3LALA 4FLVA 2O4IA 1S1TA 4WE1A 1VSMA 3OS1A 4IKFA 4CJVA 2LSNA 1LAWA 3AVGA 3K59A 5CYMA 4KHUA 1S5JA 3NFAA 4BWMA 3EZ5A 2Y1IA 3L8BA 2HHXA 3WNHA 2WOMA 4NCGA 2IOCA 2JLEA 3VQAA 4Y1DA 4IBNA 4BE1A 3AVIA 1A5XA 1X9WA 1NK5A 4M42A 1S9EA 4CEBA 1RTIA 1XI1A 1W0HA 1REVA 3AVBA 3VQ6A 3NGIA 1D8YA 4M3YA 2G8UA 5T7BA 4R5PA 3RWUA 4LSNA 4B9VA 4AHUA 1JL2A 1FK9A 3WNGA 3V9UA 2ZD1A 3MEEA 4FW1A 3CQ8A 1VRUA 4BWJA 2FBTA 4CJUA 4CJQA 1IKYA 1HQUA 1SV5A 1VSIA 2F96A 5J1EA 3TAGA 3SNNA 4FYDA 4CEEA 4MFBA 4DU1A 1SKSA 4CF0A 3VQ4A 4B8CA 2KQ2A 5C42A 4CK3A 1S1WA 1SKRA 4M3WA 1C1BA 4FJHA 3NDKA 4FM1A 1X1PA 2P1JA 1TK5A 1TKZA 5I3UA 3L2WA 3KLIA 3DOKA 1ASUA 4Z0UA 4CJ4A 3S3OA 1HRHA 3PUFA 3CFPA 3OYEA 1VSFA 3DRRA 5CZ1A 4E19A 3KLHA 4ELUA 4KB1A 4FK4A 1FXXA 5HBMA 3VQ8A 4XIUA 1S1UA 3SCXA 3KTQA 4OJRA 4DTMA 2I5JA 4HVJA 4DTJA 2VWKA 2HMIA 4DQPA 4RW7A 4CGGA 4B8AB 3M8RA 3EY1A 4DS5A 3ZSYA 1RBSA 1XHXA 1SL1A 1RTJA 2BANA 3AA5X 3V81A 4IG0A 5HRRA 2RKIA 4CHNA 4DLGA 1NK7A 1RILA 4CESA 3F9KA 1BI4B 4N47A 4W5TA 1RDDA 4DTSA 1RBVA 3T1AA 1HYVA 2OPQA 3AVLA 4B9TA 4PA1A 4CJWA 4CIGA 1NKEA 2KZZA 4RW9A 4N41A 2PY5A 3KLEA 4KFBA 1RDCA 4LD0A 4CCHA 1CLQA 1HQEA 1WN7A 4DLEA 3AA3A 2YHBA 2QXFA 3BGRA 1D5AA 4DS4A 2F8SA 1JLGA 3A2FA 3NGZA 4DTRA 4DQQA 3VN5A 1XC9A 1IKXA 4QAGA 4B3OA 3VQDA 4FLTA 1VK0A 1SL2A
chains in the Genus database with same CATH superfamily
5CZ2A 4C1NI 2FSJA 4FCYA 4HUGA 4I6MB 4HUEA 1X9JA 4IG3A 4JKCA 5AR0A 1JLBA 4JKFA 3U4LA 2VG5A 3LM2A 2YHAA 3C94A 5AQWA 4C8MA 2XY6A 4DV4K 2J4RA 4JAXA 1LW0A 4YOVA 1WAJA 3H1VX 3U3YA 5AZIB 2DFFA 1NOZA 5AQUA 1YJWN 1TKTA 4GVMA 3NF8A 2WFBA 3IG1A 3C0BA 1NWKA 4FPBA 3CCLN 4B1ZA 3U3GA 4J2DA 3OYLA 3OS2A 3VGMA 1SUQA 3D2EB 3K5LA 1NJWA 1ASWA 2HHWA 3UB5A 4BREA 4BR0A 4DSLA 2D0OA 3AO4A 3SJJA 2UUBK 5DMRA 3G0ZA 4M3ZA 1SZ2A 1HNZK 1HLUA 5ELZA 4KTWA 3CERA 4BR5A 3P83D 3L2QA 2WONA 4EIAA 2ETJA 4CJ7A 4LF8K 1IG8A 2A41A 2ASPA 2HNDA 1OH8A 2NZTA 4K41A 1LAVA 1RT1A 3MN7A 4BRPA 3CFOA 3C95A 3KIOA 2E5LK 4E7LA 4WCEL 2E4LA 3VEZA 4GW6A 3LP0A 4BRCA 4MLHA 4WFAL 1IH7A 4XH4A 3QINA 4YFUA 3CC2N 1S9GA 3HOTA 4KHNA 4AHSA 1T3VA 1VQ9N 4A57A 1WOQA 1R0AA 5ADXH 1JLCA 4AHCA 4H4MA 3KD1E 1MWMA 3VF6A 3MCPA 4KTZA 4EHUA 2NRWA 2P9IB 1K8KB 1VSEA 3MXIA 3LDPA 3OA9A 3WXIA 1S1XA 4DR2K 2FF6A 1QSYA 3RR8A 3WNEA 4H5NA 1ATSA 3T3FA 3PY8A 2NRTA 4CZGA 3ZYYX 2VQEK 1WSGA 1GOBA 5BRHA 2XY5A 1G15A 1WBBA 4IOXA 4GV3A 2NRHA 2UXCK 1TL1A 3D0PA 1G99A 1HUXA 4E1NA 4F9OA 3KK3A 2V7YA 4JK7A 3E9LA 2W6KA 1IJJA 3DXKA 2B6AA 1VRTA 2ATQA 3K9KA 1EO1A 3VPZA 4H0VB 2IC3A 3L3VA 2PFUA 3AARA 4RCHA 1U2VA 4JI6K 4CK2A 1J5OA 2ZQBA 1RT4A 3I8DA 2VCPA 2ZF5O 5BPNA 5EU7A 1N5YA 4ILHA 4IDKA 5B8HA 2V52B 5FDLA 4H8KA 5FRMA 5HRPA 3AO1A 2RE2A 5FPNA 3VA0A 2HB5A 3DLLL 1WBDA 2GX9A 3W3DA 4H5TA 3L4IA 2O8EB 4Z4CA 1BQMA 3ASMA 1CXQA 1VQNN 2E2QA 1C1AA 3RSEA 1D9DA 2HOEA 4I2PA 3O4NA 3W0LA 3LPUA 3OBWA 1DTQA 2AJQA 4Y1CA 3WXJA 4CBUA 1RT7A 2E6LA 2FXUA 4LF4K 4AHRA 4LFCK 3ATUA 3FLCO 3QETA 1GLEG 4IFEA 3NBPA 2Q3SA 1NJZA 2WC9A 3SJHA 3IS9A 4CF2A 2HHTA 4CBWA 3ALYA 3QO9A 3OVNA 1KFSA 1EX4A 3UKRB 1HJOA 3C6TA 1Q82O 3THVA 4PKGA 4DR1K 5HP1A 1MDUB 5JICA 4Z4IA 2VG7A 2P51A 2I7PA 2UU9K 3NF6A 5AQQA 2NRRA 2Q31A 4FM0A 3G6EN 3I0RA 1YUWA 4DFPA 1J5EK 1Z25A 3VGLA 3D2FA 1WUAA 4DV5K 1BDGA 2W41A 2Y1JA 4JI7K 4DV2K 2O8DA 1JCFA 3HL8A 3PV8A 4WQ4C 4O44A 4PUOA 3DWLA 3AY9A 4H0OA 3RMBA 4GMJB 3S41A 2Q2RA 4BRQA 1BCOA 4K42A 3S3MA 3BF3A 3SUQA 3DJCA 4FJJA 4RWTA 2QK9A 1MA9B 1O1WA 4CJRA 1BHLA 3VF4A 1HNIA 2EWSA 3AO3A 2G8VA 3SPZA 1TYQB 3CG7A 4EP4A 3RMCA 3U9ZA 5GINA 5FPMA 4KH4A 1EP4A 1NGJA 1NGFA 5HLFA 3RMAA 3S3NA 3ZSZA 3LWLA 3SI6A 2P5GA 3AVAA 1RNHA 4PHTX 3K57A 4CHZA 4DQRA 1W7AA 2VG6A 2YV0X 1XMQK 3OYGA 5GIOA 5KGWA 4BDPA 1UWBA 2CH6A 3O8MA 3QDKA 5E26A 1HKBA 2NRXA 3T1HK 2HMPA 1I39A 1Q8IA 4Q5VA 3OYFA 2DFHA 1NMNA 4BC3A 5AQKA 3QIOA 4ISGA 1UOCA 2D4WA 5AQRA 2YNGA 5DM7L 5AQZA 1VQ5N 2IVOA 4BRAA 4FPAA 3HK2A 1L3UA 1HNWK 4G1QA 4IO8A 3TPQA 5K14A 4M63C 4CI6A 3HP6A 5EXWA 5LJWA 1HYZA 3OYJA 3O9RA 4IZ9A 4CFAA 3JAMO 1JCEA 4W5OA 3PX0A 3EE9A 4OLBA 1HKGA 4JS5A 4FZZA 3CXCM 4B3RK 4OKJA 3VETA 1GOCA 4BRIA 4BRDA 3KK7A 3CCJN 3CCMN 2ZJQL 1S1TA 3SMSA 4X64K 2P9UB 1LAWA 3K59A 5M1PA 5CYMA 3NFAA 2HHXA 3L8BA 3ZETA 3VQAA 4E7IA 2JLEA 4IBNA 4BE1A 1X9WA 1NK5A 2JWLA 1RTIA 3OHRA 1N33K 3NGIA 2O8FB 4R5PA 4YORA 4B9VA 4WFNL 4AHUA 3V9UA 2ZD1A 3GL1A 3BZCA 3CQ8A 1IKYA 1SV5A 2F96A 5J1EA 3SNNA 2NLXA 2BH1A 5C42A 4FWKA 2AP1A 3NDKA 1X1PA 1TK5A 4Y0WA 3PLAA 3S3OA 3CFPA 4WQ4A 4V19S 1NG9A 3DRRA 3KLHA 4ELUA 4KB1A 4YOUA 4XIUA 2VWKA 4NO7A 3M8RA 3EY1A 1XHXA 5AQVA 3QFPA 5HRRA 1BI4B 2QWOA 3PIPL 2UXBK 4RW9A 2PY5A 3KLEA 4LD0A 1CLQA 4CVNE 1HQEA 1WN7A 3AA3A 1VHXA 1D5AA 4DS4A 1JLGA 2F9WA 3NGZA 3I55N 1XC9A 4H5VA 4QAGA 1GLAG 3FZKA 2Q0RA 3MWTA 3I56N 3MX5A 1VK0A 1SL2A 3BP8A 3CPWM 5LMUK 5HROA 4ILGB 5HRNA 4KV8A 1RBTA 3H08A 4I7FA 3AAQA 2X6SA 2HF4A 3VEWA 3KK1A 2ZJRL 5AZJB 2QKBA 4WYBA 1IKVA 2JWKA 4DSFA 4JEPA 1DKGD 5JS1A 1RBUA 3AO2A 4DR3K 1CZBA 4ILJA 1KQSM 1U47A 4DFKA 4JD2A 1BIZA 3HYFA 2QKKA 4E0DA 1TAUA 4DTUA 2P9KB 3K5NA 1U4BA 3MAQA 3SK3A 3CJ1A 1JLQA 4EP5A 4YDUC 5AQXA 3IMXA 1Q9XA 4JI2K 4LH5A 2YHXA 1ZBSA 4B9NA 4LF5K 3AA2A 1I94K 3THXB 3OYIA 1E3MA 1NU0A 1WSFA 3V9XA 3DYAA 2Z1IA 2D5RA 3F9MA 3VQ7A 2Q1NA 1FW6A 3JYTA 4JHDA 4CF9A 4MQ3A 1R59O 5KRTA 2FBXA 4BRFA 3ULEB 2HNYA 1KSPA 4N76A 1JXBA 1BUPA 1JXEA 2BUPA 3QBWA 4FWSA 4DTNA 1OH7A 2PAVA 4ZTJA 5D3GA 3J7YP 1ASVA 1WSJA 2E8AA 4CJLA 4YOWA 4CGDA 2G8WA 3KLGA 1RCHA 1UA0A 2DY4A 3CM6A 3BUZB 1VSKA 4HCBA 3O5BA 5KQDA 4KREA 4XH1A 3ID8A 5AQPA 4DF8A 1BO5O 3NE6A 5BPMA 1Z26A 3VQQA 1GLDG 3FZLA 4DQSA 3D45A 3SYZA 3UKUB 3AVKA 1T6DA 3ZCMA 3THWB 5KQ8A 2YJEA 3B8AX 3CIPA 4DTPA 3SQ2A 4A2AA 4KRFA 3C7NB 1GLLO 5AQOA 3CC7N 3HBTA 2P9PA 1KLNA 3RTVA 4B1YB 3N4QA 3VQPA 4JRQA 4ISEA 3SQ4A 4I9LA 4BC4A 2E1YA 2KFZA 4C23A 2F9TA 3V1QA 1YJNN 1VQ7N 1L3TA 4DR7K 2D1KA 4CF1A 1N34K 4E7JA 1EKEA 4E1MA 3P31A 3JS6A 3T19A 5C2FA 1NK4A 4LC9B 2OYQA 4OPJA 4AHVA 3TTCA 5C24A 3O08A 2RF2A 3QIPA 4JK8A 5CR4A 5EY4A 2FLOA 4FJMA 1OKJA 2P9SB 3M8QA 3MX2A 1UAXA 4BRNA 3KKRA 4JKBA 2P9LA 2O8BA 2QWNA 1T6CA 1DEJA 3ZEUB 3V4IA 5AQTA 4NXNK 3CCUN 2A1RA 3SAGA 3LDSA 2YNHA 3NH2A 1S1VA 4OVLA 2GV9A 3AO5A 4H03B 3TR8A 4CZLA 3KJVA 5C10A 2KFNA 2XHBA 5AQMA 4CGHA 3MWPA 5BPLA 1T8EA 4OKEA 3PX6A 3R3LA 3H45C 5F2RA 3MECA 4I6MA 3O3GA 1EXQA 1HX1A 5HOOA 3WEEB 2D0PA 5KPRA 4JS4A 3AVFA 1L3VA 3AVMA 3IUCA 4YDUA 4FWOA 3M3ZA 3G25A 1QHAA 3BF1A 5HL7L 3DRSA 5AZIA 2B5JA 2OPRA 1KAYA 2DFEA 3P1GA 2BDPA 3A5NC 3O6WA 3VQBA 4FWQA 3D2EA 2ZGYA 1QS4A 4BACA 3V9SA 4B9SA 2XRIA 2GWJA 4K8XA 4FK0A 2RPIA 3T69A 4RW4A 4ID5A 1C0UA 1CZAN 2IIRA 4CFBA 2E1ZA 4CEQA 5JVGL 4OLAA 5IT9O 1CXUA 2XO7A 4AILC 3E01A 2WBNA 3HT3A 3ZT2A 4MLEA 4E3SA 5KI6A 4CGFA 2ZJPL 1L3SA 3SV4A 4CF8A 1WAFA 1BU6O 4NCAA 5C0YA 5AQFA 4E7HA 2ZWHA 4KHQA 4H0YB 3UE5A 3QEWA 3NMUA 2HBMA 4JI0K 4W5RA 3OYNA 4WFBL 3WT0A 2UXDK 1QSLA 4FWPA 4IFVA 1I3AA 1TL3A 4RG8A 3O3HA 1HKCA 2KKZA 3PSFA 3K2PA 4EZ6A 4KO0A 2W40A 4FJ8A 3SZ2A 3CJCA 3LAKA 1ESVA 4MO4A 5KTQA 4QS7A 2YHWA 1V4SA 2JGUA 2P9IA 4CHOA 1K8KA 4KBOA 4BGBA 3SBTA 3KLFA 3ZX0A 3SBGA 4L3QA 4B9UA 4JLHA 4ISFA 4F2RA 4BR9A 2OCEA 1GLCG 1QQOA 3S9HA 4J2BA 2XY8A 4WQ5C 3D6RA 1YHQN 4EZ9A 2HVIA 1NK9A 4M45A 3VMFB 2OPPA 3FZMA 1XWLA 3NCIA 4YY3K 3EKSA 3JXUA 1HYSA 2KTQA 3NH0A 1VQ6N 2IS3A 1Z05A 1SQKA 5KGXA 2UUAK 2OPSA 1T05A 4FSVA 3CC4N 1EWQA 3D7EO 3SMPA 5TKYA 4DTXA 3CJAA 1BA1A 3HTVA 3DRPA 3NVKA 2XY7A 4DQIA 2A3ZA 4I9QA 2G8FA 4KH6A 1A5WA 1YXQA 4W5QA 3B6PA 4MO5A 2OZMA 1W9HA 3B6OA 1NLVA 4ELTA 1ZBUA 2A40A 2FF3B 3AA4A 4Z4GA 1B9FA 3ZT1A 2R7YA 1NBWA 4CEFA 3KK2A 4FXDA 3SQ0A 1UA1A 1NJXA 1ZC6A 1J53A 3A0IX 3QERA 4DCHA 3HVRA 2BTFA 3C6UA 3FFIA 3V1OA 3HZ6A 3KVGA 4G9ZA 4B1WB 4UQGA 2E2PA 1U45A 3TI0A 4YOYA 2ZGZA 2QWLA 2O4IA 3SAFA 3O9TA 5BN9A 4WE1A 2O8EA 1NJIO 4IKFA 4CJVA 3QFUA 2LSNA 3AVGA 2FSNA 1QVFM 3EZ5A 4NCGA 1NKCA 4O8KA 2F7TA 4Y1DA 3AVIA 1A5XA 3K9JA 1W0HA 2HHHK 1D8YA 4M3YA 2G8UA 2V7ZA 1FK9A 3WNGA 1C0GA 3MEEA 4BWJA 2FBTA 4CJUA 1VSIA 1ATNA 4FYDA 4CEEA 4H0PA 3VQ4A 2KQ2A 4M3WA 4E1JA 1C1BA 4FM1A 4IDHA 2P1JA 4R79A 1OVQA 1TKZA 5I3UA 4Z0UA 2OANA 3PUFA 5A2QO 3OYEA 2GTDA 1VSFA 3Q7CA 2ZM6K 4FOIA 4E19A 5AQNA 4AM7A 3ZLJA 1D4XA 3KWIA 4H0XB 5I9EB 1FXXA 2CGJA 4YHHK 4OJRA 4HTLA 4HVJA 4DTJA 5CE3A 4DS5A 1SL1A 1RTJA 2A5XA 4CHNA 1RILA 1T44A 5AQSA 4N47A 3DXMB 1EWRA 3CHWA 4IEIA 4N41A 3O80A 2YHBA 3EKUA 1E4GT 3VERA 3O4WA 5AFUH 4B1VA 4OPAA 4B3OA 3E9PA 3VQDA 4FLTA 3J81O 1M90O 4F3OA 3HPHA 4WQ5A 3K0SA 3VESA 3SPYA 4JK9A 4BDYA 1XNRK 1KTQA 2ITMA 4BROA 1TYQA 4PKIA 1N8RO 3DOLA 3CMEN 3LDOA 1QTMA 3K5OA 3EZWA 4FJGA 4KHSA 4DB3A 5FRNA 4Z4HA 4ZHRA 2G8IA 3EE8A 3CJBA 3ID6A 5AQYA 1N32K 2BGGA 4C1NK 3LAMA 4CFCA 3LDLA 3SV3A 3L0QA 2PZSA 3NVMA 4BVPA 3HXMA 4F2SA 4YOTA 3NH1A 4K0KK 1SL0A 4PL8A 3T1YK 2X6NA 3H6EA 5GAHP 5AQLA 3C65A 4JKDA 4AM6A 4DSJA 3OS0A 4DV3K 3ZT0A 4CZIA 2HBJA 3WNFA 3FE1A 4O0JA 3VEVA 4JI8K 3BY5A 3QMLA 2Q97A 2DTUA 4W5NA 4FL9A 4U67L 4ELVA 3QLHA 1BG3A 4H5WA 3BDPA 3VQ5A 1WB9A 1U6ZA 3TTFA 4O8UA 3P5JA 1NGDA 4CHQA 5J2PA 4PL7A 4PY5A 1WSEA 5BR8K 3ZSQA 4E89A 3OYMA 1C0MA 2QA4N 1YJ9N 3TABA 4TSXA 4M3RA 4KHYA 2QWMA 2QEXN 4NYNA 3MN9A 1JLAA 4O4GA 3ZT4A 4FLUA 3TTDA 4FW2A 2P9UA 4CZHA 1EQYA 1IG9A 3IKMA 3P4IA 5GADP 4H4OA 4OPHA 4PWDA 4C8KA 3LWMA 1B92A 4FLXA 3Q7BA 3SUNA 2O8FA 4OGCA 4FZYA 4BRGA 5KPTA 2W42A 2NUBA 3OY9A 4GY2B 5J2MA 4FJ9A 1VSJA 1WLJA 3LP2A 3G71N 4IEEA 4JI1K 2E20A 4M3UA 2ITGA 3MEGA 4QS8A 3T7ZA 3CD6N 3F2KA 3RR7A 1RTHA 2VQFK 1QQNA 4IO9L 2O8CB 3LM9A 3QNOA 3MN5A 4JI3K 3WQTA 1J54A 4MDBA 4CD1A 3LZJA 3CCRN 4JKGB 2QW9A 1LWFA 4JI5K 1J6ZA 4FWMA 2OTJN 4A61A 2HHQA 3U8XA 1ZBHA 2HF3A 3OYAA 3CJ7A 4L8RB 5C25A 3NGYA 3O1WA 3OYBA 1IV0A 1TGOA 1BI4A 4C8OA 3M8SA 3OTOK 3DM2A 4JI4K 4Z94A 3CYMA 2HHSA 3SLCA 1Q7YO 1IBMK 1NGBA 3HOSA 2QXLA 3ITHA 3K58A 3DMJA 1KVBA 3V6DA 4JKEA 5E41A 4CEAA 4DKWA 5C15A 2X74A 3H3NO 2P9NB 1ZYQA 4CJ5A 4BR2A 3NF9A 4O5BA 3ZX3A 1IO2A 3L3UA 3PSIA 3CMAN 2HVHA 4CJFA 1OH5A 4B9MA 4M7YA 3G10A 4JKHA 4YNQA 4OPKA 1C0TA 2NNWA 1HPMA 4DSEA 4MDAA 4XH5A 4DR5K 1Q9YA 1S6QA 5AZJA 1QQMA 4HHTA 4JHDB 3FGUA 4NXMK 4CIEA 1TVRA 2IVNA 4FJLA 2OZSA 3BEXA 3IFRA 4KB0A 4DV0K 4NB4A 4BE2A 2P9KA 4FLZA 4K43A 4CJSA 3THYB 4DV7K 1YT3A 4M41A 4AQYK 1VQMN 3BZKA 2YNFA 1KD1O 5BR9A 2E2OA 3MN6A 4BE0A 3M1FA 2FSKA 3THXA 2VWBA 1LWEA 4GVEA 4IJNA 1VQPN 3VGKA 5BREA 4EAHD 1HMVA 5SZTA 1VQON 4DSIA 4KTQA 4CERA 3MXJA 4JRPA 4BC5A 1VQ4N 5F0XA 4FJ5A 3DLBA 4E7KA 1VAZA 5IWAK 4EHTA 5DK5A 5M1OA 4FJIA 3ULEA 4B1XB 3QEVA 5J2NA 3VF2A 4BRKA 1QE1A 5MLCQ 1DTTA 3AVNA 1VSLA 1RDWX 2BE2A 1O13A 4NYFA 5JS2A 3GBTA 1RDAA 4J2AA 1KCFA 5AQIA 3MCAB 2V51B 2P5OA 4CGJA 3HM9A 5C12A 4DMNA 2GBZA 2OA8A 3PO4A 3QBXA 4DFJA 3ZSRA 3UKUA 1C1CA 3THWA 4IXCA 4B08A 2HW3A 4M7XA 3C7NA 1HNXK 3KWGA 1C0FA 2FC0A 3SQ1A 4C8LA 3CM5A 3CJ9A 3HSCA 2EX3A 4CHYA 3HO1A 4HTUA 2ASOA 4IOAL 1E4FT 3GDQA 3L2VA 3K5MA 1TUYA 4PKHA 4LF7K 1XQSC 4FJNA 1BWFO 3NF7A 3QNNA 1DGKN 1WSHA 5CYQA 3RRHA 3PO5A 3TU5A 3J7AP 4JV5K 3CCQN 3AVCA 2P9SA 3EN9A 1JKHA 5M1QA 3PX4A 4RTFD 1RBRA 1GOAA 2QWQA 3ZEUA 2KLAA 1V4TA 2GELA 1LCUA 5FPDA 3AAPA 1NNEA 3SUPA 3TWHA 4DFMA 1N6QA 1MU2A 4DV1K 3OJUA 3E9OA 1ITGA 4DHYA 4CECA 1XUPO 1RT2A 2D0CA 4FLYA 1NGCA 3OYHA 5M1KA 3IRXA 3RMDA 3WEEA 2HHVA 3HM8A 1K73O 3M5RA 1YTUA 1GLFO 3A8YA 5AQGA 3DI6A 2AA4A 3VENA 1KXPA 4HCCA 3CPEA 3DLGA 3DLRA 4FLVA 3H3OB 2CGKA 3J7ZO 4U7BA 3OS1A 1QZ6A 2HBKA 1S72N 1S5JA 3VTHA 2Y1IA 1YVNA 2VYPA 3WNHA 3U9DA 4FM2A 2IOCA 3VEXA 1S9EA 4FWLA 4CZJA 3R8EA 2QTDA 5T7BA 4LSNA 5FLXO 5JLFA 1JL2A 3OW2M 1QVGM 1VRUA 3WXMB 4CJQA 1HQUA 1M1KO 3DAWA 3TAGA 4DU1A 4CK3A 1SKRA 1S1WA 5GIPA 4CZMA 1IBKK 2QI2A 1YI2N 2VGNA 3WXKA 4WF9L 4BG9A 5GAGP 3L2WA 1HRHA 5DM6L 3VQ8A 3SCXA 5TKWA 2I5JA 4DQPA 2QWPA 2HMIA 1RFQA 3DXKB 4RW7A 3G4SN 4GNIA 4B8AB 1RBSA 3AA5X 2BANA 3ENOA 1Q18A 3E66A 3CQXA 4DTSA 3MK6A 4OO1J 2OTLN 3T1AA 2OPQA 4BG8A 4B9QA 4CJWA 4JYAK 1U2VB 1NKEA 2KZZA 1RDCA 3EL2A 4DLEA 2QXFA 2E88A 4LF6K 4A59A 1W97L 4DTRA 4DQQA 3VEYA 1IKXA 4H0TB 4FVUA 4OX9K 2HSTA 1NOYA 3LPTA 1RDUA 3FR0A 2IDOA 1K9MO 3O9SA 1TUUA 4BGAA 3DLHA 1VQ8N 4LF9K 1T03A 4M3TA 4C8NA 4DUYK 2E6MA 1TKDA 4FWNA 3HPGA 4KPYA 4JNEA 2CGLA 4Z4FA 1LWCA 1YITN 1NGHA 4CEZA 3RSEB 1TKXA 1ZBIA 1BIUA 1JJ2M 5LMNK 4DTOA 2W6LA 4CEDA 1JL1A 5CY4A 4CE9A 4IWVA 2WUSA 4FJXA 1FKOA 3LP3A 2X78A 4DSKA 2D0BA 1VQLN 4BVOA 3QEPA 1KFDA 4A62A 4O5FA 1XMOK 2Z1HA 4BRHA 5C2DA 3V9WA 3ZSOA 3CI5A 3ZSVA 5FROA 4DR4K 4CFDA 1XC3A 1TAQA 1NK8A 5J2QA 4RW6A 4B9LA 1GLBG 4FO0A 3L6QA 3LDNA 3O1BA 5JMVA 3GE1A 1BQNA 1A5VA 3AGRA 3TSPA 3OBYA 2A1SA 4I2QA 4BRLA 3D2FB 4XEIA 1IBLK 1NKBA 4X62K 1BL3A 5LJVA 1P8ZA 2O8DB 4DWIA 4CJKA 1B9DA 1Y64A 2IAJA 2PBDA 4B3SK 5ADXA 2FBVA 3MEDA 3QESA 3OYKA 2RHKA 3V1RA 1T7PA 3SUOA 4A2BA 3AVHA 4FVMA 1N36K 4LSLA 5LY3A 3KKSA 2EHGA 4DR6K 3I0SA 1SKWA 4B1UB 4O55A 3UKRA 4FK2A 3VQEA 3TAPA 3IDHA 2A42A 3LDQA 3EYZA 3TAQA 5I42A 1S3XA 5FPEA 3HPOA 4OKKA 1BGXT 1QQCA 3RRGA 4NCBA 1FKPA 3AVJA 5SWMA 1RGIA 2E2NA 3TAMA 3OJSA 3QICA 3L4QA 4DQ8A 5E84A 3HI0A 5KPZA 1NGIA 3AGKA 4GKKK 4J8FA 3V9ZA 4OGEA 2YX6A 2GWKA 4BQZA 4CHPA 4FJ7A 1LOTB 1K8AO 3J80O 4QCLA 1P90A 3I8BA 1BCMA 3NAEA 4CGIA 2KW4A 1WSIA 1ZBLA 3DXMA 2UUCK 5HRSA 3CF5L 4FZXC 3QB0A 1BOTO 1HNVA 3DLKA 1KAZA 4ZTFA 2PYJA 4CZFA 1Q81O 2B4JA 3OYDA 4KH5A 1QHTA 2FBYA 2QWRA 1RTDA 3C6HA 3A5OC 4K25A 3P38A 3J8AA 5AQJA 1NK6A 4AF1A 2PYLA 1CZ9A 3P39A 1DLOA 3CCVN 2HHUA 4BDZA 2RN2A 1IKWA 1YVUA 4QOZB 3HVTA 3TARA 4BQLA 4Z4EA 2GUPA 5M1NA 3F5TA 5EVZA 3O9QA 4KAZA 2KZMA 3M6GA 3WQUA 4CJPA 3JSMA 1KAXA 4ID1A 1ILYA 4HWIA 2UYTA 4KKOA 1KRPA 4F3TA 2GUIA 5JVHL 3ZT3A 3VOVA 4LY7A 1Z6RA 2Q36A 4CZEA 4RW8A 3ZETB 3LZIA 2YKNA 1KVCA 4AH9A 1NGGA 3VA3A 4LFAK 3ZX2A 2Z1GA 4IFYA 3VTIA 1TK8A 2YKMA 5GAEP 2VGMA 3KD5E 1TK0A 3QEXA 3HSTB 3LL3A 5BN8A 3R1XA 4DUZK 3AV9A 1U49A 1TV6A 4CIFA 1J9AA 4KI6A 1RT3A 3VEOA 1ZBFA 4LH4A 4B3MK 2G8KA 2G8HA 1YF5L 1XHZA 3ISNC 4FJKA 2H3GX 3CFRA 2QM1A 5LL6Z 2O4GA 1L5UA 1XNQK 3O9UA 3CCEN 1OVYA 2GEMA 1NGAA 3TAEA 1JLFA 3MXMA 1H1VA 4B3TK 3I33A 3UIQA 4CK1A 4CEOA 5AQHA 4F8RA 2HNZA 2ZE2A 3TSUA 2D0AA 4PQUA 4CW7B 4M3XA 3L2RA 3TANA 3U6FA 4DU4A 1LW2A 3A5LC 4DF4A 4Q0BA 1Y97A 2NRVA 1S6PA 3ZSXA 4FWRA 3NHGA 3CCSN 3MMVA 3QEIA 1C6VA 3N4PA 1K6YA 1MWKA 1OH6A 1KLMA 3OYCA 4DU3A 3WXLA 2HBLA 4N56A 3LANA 1YAGA 1QSSA 3HRGA 1WNSA 4CZKA 1F21A 1NK0A 4GV9A 1KVAA 1SS6A 3VQCA 3ZSWA 5KRSA 1D9FA 4KI4A 3FZFA 3ENBA 1DT9A 4IJAA 4K8ZA 4KHWA 3FFKB 5F1XA 3SAHA 2DPNA 3KZBA 2F8TA 3FZHA 1NJYA 1HPZA 3RVCA 1U04A 1BA0A 1RT6A 3EEQA 3WUHA 1S22A 4H5RA 5AFUA 4J2EA 3PIOL 4CJTA 3HJFA 3TAFA 1EETA 2Z1JA 1X3MA 3HP9A 2WTUA 4HUFA 5M1FA 1VSDA 2ASMA 4JD2B 3L2UA 1LV5A 4NLCA 4CJEA 1KC8O 4BR7A 2O8CA 3CQYA 2I7NA 4N5SA 5EOYA 4FLWA 3ENHA 3LP1A 3F73A 2KHOA 4JKGA 1VSHA 5CHIA 3VQ9A 2YCHA 4X66K 1JLEA 4UY8O 4A5AA 3O3FA 2NRZA 1X9SA 1NMDA 1X3NA 4YOXA 3M8PA 1NM1A 2F4VK 2YNIA 3A5MC 1BISA 3IAYA 1RDBA 2IGIA 4BR4A 3ULDA 2CH5A 3DLEA 4CJ3A 1X9MA 1RT5A 4DG1A 4ICLA 2P9NA 1ATRA 4CBXA 4O0IA 2A6AA 3ATVA 1W2BM 1ZXOA 1NGEA 1YTAA 4X65K 1JCGA 2VWJA 4F4KA 3O4QA 4BRMA 4IOCL 1U48A 4AHTA 1HJRA 5BRDA 3LALA 3TSQA 1VSMA 4EFHA 3E1YA 4FOEA 3C6AA 4KHUA 4BWMA 2YJFA 4GV6A 3GG4A 2WOMA 4M42A 4DV6K 4CEBA 3R6MA 5BRFA 1XI1A 1REVA 3AVBA 2P9PB 3KHYA 3VQ6A 4GKJK 4A5BA 3RWUA 5EX5A 3THYA 4FW1A 1SAZA 5H1SQ 4NLBA 5AJ3K 3H46O 4MFBA 1SKSA 4CD3A 4CF0A 4B8CA 3MDQA 4FJHA 3KLIA 3DOKA 1ASUA 4CJ4A 3CETA 2IVPA 5CZ1A 4FK4A 4QS9A 1GLJO 3R9PA 5HBMA 3KTQA 3H1QA 1S1UA 4DTMA 1YIJN 4BC2A 4CGGA 1HR0K 3ZSYA 3GOIA 3V81A 4IG0A 2RKIA 4DLGA 1NK7A 4CESA 3F9KA 1VQKN 4W5TA 2P9LB 2O8BB 4LFBK 1RDDA 3EO3A 1RBVA 1HYVA 3AVLA 4B9TA 4PA1A 4CIGA 5JLHA 2Q0UA 2YHYA 4KFBA 4JKAA 4CCHA 3BGRA 2F8SA 1FJGK 3A2FA 4KHPK 3VN5A 4JN4A 1Q86O 2YI1A 4BY9C 1QZ5A
chains in the Genus database with same CATH topology
5CZ2A 4F3OA 4FCYA 3HPHA 4HUGA 3LPTA 1NOYA 5HROA 2QKKA 3SPYA 4HUEA 4IG3A 2IDOA 4BDYA 5HRNA 1JLBA 3DLHA 1KTQA 4KV8A 2VG5A 1RBTA 2YHAA 3C94A 4C8MA 3DOLA 3H08A 1T03A 4M3TA 2XY6A 4C8NA 3K5OA 4I7FA 1QTMA 4FJGA 4KHSA 2X6SA 2E6MA 1TKDA 1LW0A 5FRNA 1WAJA 4Z4HA 3HPGA 4ZHRA 3KK1A 3U3YA 4KPYA 2DFFA 2G8IA 2QKBA 1NOZA 1TKTA 4Z4FA 1IKVA 1LWCA 4GVMA 3NF8A 3IG1A 4DSFA 2BGGA 4CEZA 5JS1A 1RBUA 3AO2A 1CZBA 4J2DA 1ZBIA 1TKXA 3U3GA 1BIUA 3OS2A 3LAMA 1BIZA 3HYFA 3OYLA 4CFCA 4DTOA 4DFKA 3SV3A 4DTUA 4E0DA 1SUQA 1TAUA 4CEDA 2PZSA 1JL1A 5CY4A 4CE9A 3K5NA 3K5LA 3MAQA 4FM2A 1ASWA 1U4BA 1NJWA 2HHWA 1JLQA 4EP5A 3HXMA 4DSLA 4F2SA 3AO4A 3NH1A 4FJXA 1SL0A 1FKOA 3SJJA 1Q9XA 5DMRA 2X6NA 3LP3A 3G0ZA 4M3ZA 4LH5A 2X78A 4DSKA 2D0BA 4B9NA 3AA2A 4KTWA 3QEPA 4DSJA 3P83D 1KFDA 3OS0A 3OYIA 3ZT0A 3L2QA 2WONA 3WNFA 2ETJA 2Z1HA 4O0JA 3V9WA 1WSFA 3ZSOA 3ZSVA 3DYAA 3V9XA 2Z1IA 2D5RA 2DTUA 4W5NA 2HNDA 5FROA 3QLHA 3VQ7A 4ELVA 4CFDA 3JYTA 1TAQA 1LAVA 1RT1A 3BDPA 4CF9A 3VQ5A 1NK8A 5J2QA 4RW6A 4B9LA 3P5JA 4MQ3A 3CFOA 3C95A 4CHQA 5J2PA 4PY5A 3KIOA 1WSEA 5KRTA 3ZSQA 2FBXA 4E89A 1KSPA 2HNYA 4N76A 3OYMA 1C0MA 4E7LA 1BQNA 1JXBA 2E4LA 1JXEA 1A5VA 3TABA 4TSXA 4M3RA 2A1SA 4GW6A 4I2QA 3LP0A 4DTNA 1NKCA 4ZTJA 4KHYA 5D3GA 1IH7A 1NKBA 1ASVA 1BL3A 3QINA 4YFUA 1WSJA 4CJLA 4NYNA 1S9GA 4CGDA 2G8WA 4CJKA 4DWIA 4KHNA 4AHSA 1B9DA 3KLGA 2IAJA 1JLAA 1RCHA 3CM6A 1UA0A 2DY4A 1VSKA 4HCBA 1R0AA 4O4GA 4KREA 3ZT4A 2FBVA 1JLCA 3MEDA 4AHCA 3OYKA 3V1RA 4FLUA 3QESA 1T7PA 4H4MA 4DF8A 3SUOA 3AVHA 3NE6A 3KD1E 4FVMA 1Z26A 3VQQA 4LSLA 4DQSA 4FW2A 3KKSA 2EHGA 3D45A 3SYZA 3AVKA 3I0SA 1SKWA 4KTZA 4O55A 1IG9A 3ZCMA 4FK2A 4H4OA 3VQEA 3TAPA 4PWDA 4C8KA 3LWMA 1B92A 4FLXA 3EYZA 4DTPA 3SQ2A 3TAQA 3SUNA 4KRFA 5I42A 1VSEA 3MXIA 1KLNA 3RTVA 4OGCA 3HPOA 1U47A 4FZYA 1S1XA 3VQPA 4OKKA 4JRQA 2W42A 1BGXT 1QQCA 2NUBA 3OY9A 3RRGA 5J2MA 1QSYA 3RR8A 4FJ9A 4NCBA 1FKPA 1VSJA 3AVJA 1WLJA 3LP2A 3WNEA 5SWMA 3T3FA 4I9LA 3SQ4A 3PY8A 3TAMA 3OJSA 2KFZA 1WSGA 4M3UA 2ITGA 3MEGA 1GOBA 3V1QA 2XY5A 1G15A 1L3TA 3RR7A 1RTHA 4CF1A 3QNOA 3V9ZA 4E7JA 1EKEA 4OGEA 1J54A 1TL1A 4E1MA 4CHPA 3D0PA 3T19A 3LZJA 1NK4A 2OYQA 4E1NA 4OPJA 4AHVA 3KK3A 4FJ7A 1LWFA 5C24A 2RF2A 3QIPA 4QCLA 2HHQA 2B6AA 1ZBHA 1BCMA 3OYAA 1VRTA 2ATQA 5C25A 4FJMA 4L8RB 3NGYA 3OYBA 3M8QA 1UAXA 3NAEA 4CGIA 1TGOA 3KKRA 1BI4A 4C8OA 3M8SA 3DM2A 2IC3A 3CYMA 2KW4A 3L3VA 1WSIA 3V4IA 1ZBLA 2HHSA 5HRSA 2A1RA 4F8RA 3K58A 3ITHA 3DMJA 2YNHA 3LDSA 4FZXC 3NH2A 1S1VA 1KVBA 4OVLA 1HNVA 3V6DA 3DLKA 5E41A 2GV9A 4CK2A 3AO5A 1J5OA 2ZQBA 1RT4A 4CEAA 4ZTFA 2PYJA 3TR8A 2B4JA 3I8DA 3OYDA 3KJVA 2KFNA 1QHTA 2XHBA 2X74A 2FBYA 4CGHA 5EU7A 4CJ5A 1ZYQA 1T8EA 4OKEA 3PX6A 1N5YA 1RTDA 3NF9A 4E7IA 4O5BA 1IO2A 3L3UA 3MECA 4IDKA 2HVHA 3O3GA 1EXQA 4CJFA 1NK6A 2PYLA 4B9MA 1CZ9A 3G10A 1DLOA 5FDLA 4H8KA 5FRMA 4JS4A 2HHUA 4BDZA 5HRPA 2RN2A 1IKWA 4YNQA 3AO1A 1YVUA 3AVFA 4OPKA 3HVTA 3AVMA 3TARA 1L3VA 4QOZB 1C0TA 4Z4EA 3VA0A 2HB5A 2KZMA 4DSEA 4KAZA 4CJPA 3JSMA 3DRSA 4ID1A 1S6QA 1Q9YA 2B5JA 4HHTA 4Z4CA 1BQMA 2OPRA 4KKOA 1KRPA 4CIEA 4F3TA 3ASMA 1CXQA 1TVRA 2GUIA 2DFEA 4FJLA 3ZT3A 4LY7A 2OZSA 3P1GA 4RW8A 1C1AA 2BDPA 3LZIA 2YKNA 3VQBA 1KVCA 4AH9A 1D9DA 4KB0A 4BE2A 4I2PA 4FLZA 3VA3A 3O4NA 3LPUA 1QS4A 2Z1GA 4IFYA 1TK8A 1DTQA 2YKMA 2AJQA 4Y1CA 4BACA 4CJSA 1TK0A 3KD5E 3QEXA 3V9SA 1YT3A 4M41A 4B9SA 2XRIA 1RT7A 2YNFA 3HSTB 2E6LA 4AHRA 4BE0A 3QETA 3AV9A 1U49A 4K8XA 4FK0A 2RPIA 1LWEA 4RW4A 1TV6A 4ID5A 3NBPA 1C0UA 2Q3SA 1NJZA 4CIFA 4CFBA 3IS9A 1J9AA 4KI6A 4CF2A 1HMVA 1RT3A 2HHTA 4CEQA 1ZBFA 3ALYA 3QO9A 3OVNA 4LH4A 5SZTA 1KFSA 4DSIA 4KTQA 4CERA 4OLAA 3MXJA 4JRPA 1EX4A 2G8KA 3C6TA 2G8HA 3THVA 1XHZA 3ISNC 4FJKA 1CXUA 2XO7A 3CFRA 3E01A 4AILC 4E7KA 3DLBA 4FJ5A 1L5UA 2O4GA 3HT3A 3ZT2A 5HP1A 4E3SA 4Z4IA 5KI6A 4CGFA 2VG7A 3TAEA 1L3SA 2P51A 5DK5A 3SV4A 1JLFA 3NF6A 3MXMA 4CF8A 3UIQA 3QEVA 4CK1A 1WAFA 4CEOA 4FM0A 5J2NA 2HNZA 2ZE2A 1QE1A 2D0AA 3I0RA 4NCAA 4DFPA 4M3XA 4PQUA 3L2RA 3TANA 1Z25A 3U6FA 4DU4A 1DTTA 1LW2A 4E7HA 4DF4A 4FJIA 4Q0BA 1Y97A 1S6PA 3ZSXA 2Y1JA 3AVNA 4KHQA 1VSLA 3QEWA 3NHGA 3QEIA 2BE2A 1C6VA 4NYFA 3HL8A 5JS2A 4W5RA 3PV8A 1RDAA 3OYNA 1K6YA 4O44A 4PUOA 4J2AA 1KCFA 1QSLA 3RMBA 1KLMA 3OYCA 4IFVA 4DU3A 2P5OA 4N56A 1I3AA 1TL3A 3LANA 4GMJB 4RG8A 1QSSA 3O3HA 4CGJA 3HM9A 4DMNA 2GBZA 1WNSA 2OA8A 3K2PA 4EZ6A 4KO0A 3PO4A 1BCOA 4DFJA 4FJ8A 3SZ2A 3ZSRA 3S3MA 1F21A 3SUQA 1NK0A 1C1CA 1KVAA 3VQCA 3LAKA 4FJJA 2QK9A 3ZSWA 5KRSA 5KTQA 4B08A 1O1WA 4CJRA 1D9FA 4KI4A 1BHLA 2HW3A 2JGUA 4CHOA 1HNIA 3AO3A 2G8VA 2FC0A 3SPZA 4K8ZA 3KLFA 3SQ1A 4KHWA 3CG7A 4EP4A 3RMCA 4C8LA 4B9UA 4JLHA 3CM5A 1EP4A 2F8TA 4F2RA 5HLFA 3RMAA 3S3NA 1HPZA 1NJYA 1U04A 3ZSZA 1RT6A 3LWLA 3S9HA 3SI6A 2EX3A 4CHYA 2P5GA 4J2BA 4J2EA 3HO1A 3AVAA 4CJTA 4HTUA 3TAFA 1RNHA 1EETA 2XY8A 2Z1JA 3HP9A 3HJFA 3K57A 4HUFA 4CHZA 4DQRA 4EZ9A 2HVIA 1NK9A 1VSDA 3L2VA 3L2UA 2VG6A 3K5MA 1LV5A 2YV0X 4FJNA 4CJEA 4M45A 3OYGA 2OPPA 4N5SA 5KGWA 3NF7A 4BDPA 4FLWA 3QNNA 3LP1A 1WSHA 1XWLA 3NCIA 5CYQA 1UWBA 3F73A 1VSHA 3RRHA 3PO5A 3VQ9A 1HYSA 2KTQA 3NH0A 1I39A 1Q8IA 2IS3A 5KGXA 4Q5VA 3AVCA 2OPSA 1T05A 3OYFA 1JLEA 2DFHA 3O3FA 3QIOA 1X9SA 1UOCA 1JKHA 3PX4A 1RBRA 1GOAA 4DTXA 2YNGA 3M8PA 3DRPA 3SUPA 3TWHA 4DFMA 1N6QA 2YNIA 2XY7A 1BISA 3IAYA 1MU2A 4DQIA 1RDBA 3HK2A 4I9QA 2IGIA 1L3UA 2G8FA 1A5WA 3OJUA 4W5QA 3B6PA 3ULDA 2OZMA 1W9HA 3DLEA 1ITGA 3B6OA 4CJ3A 4ELTA 1X9MA 1RT5A 4G1QA 1ZBUA 4CECA 4DG1A 4ICLA 5K14A 1RT2A 2D0CA 3HP6A 3AA4A 4FLYA 4Z4GA 4O0IA 1B9FA 3ZT1A 3OYHA 2R7YA 1HYZA 4CEFA 3KK2A 4FXDA 1YTAA 3OYJA 3IRXA 4CFAA 3SQ0A 1UA1A 1NJXA 3RMDA 4W5OA 2VWJA 1J53A 3PX0A 2HHVA 3QERA 4OLBA 1YTUA 4F4KA 3O4QA 3HVRA 4JS5A 3C6UA 4FZZA 3FFIA 3V1OA 1U48A 3DI6A 4OKJA 4AHTA 1GOCA 4UQGA 1U45A 1HJRA 3TI0A 4HCCA 3DLGA 3DLRA 3LALA 4FLVA 2O4IA 1S1TA 4WE1A 1VSMA 3OS1A 4IKFA 4CJVA 2LSNA 1LAWA 3AVGA 3K59A 5CYMA 4KHUA 1S5JA 3NFAA 4BWMA 3EZ5A 2Y1IA 3L8BA 2HHXA 3WNHA 2WOMA 4NCGA 2IOCA 2JLEA 3VQAA 4Y1DA 4IBNA 4BE1A 3AVIA 1A5XA 1X9WA 1NK5A 4M42A 1S9EA 4CEBA 1RTIA 1XI1A 1W0HA 1REVA 3AVBA 3VQ6A 3NGIA 1D8YA 4M3YA 2G8UA 5T7BA 4R5PA 3RWUA 4LSNA 4B9VA 4AHUA 1JL2A 1FK9A 3WNGA 3V9UA 2ZD1A 3MEEA 4FW1A 3CQ8A 1VRUA 4BWJA 2FBTA 4CJUA 4CJQA 1IKYA 1HQUA 1SV5A 1VSIA 2F96A 5J1EA 3TAGA 3SNNA 4FYDA 4CEEA 4MFBA 4DU1A 1SKSA 4CF0A 3VQ4A 4B8CA 2KQ2A 5C42A 4CK3A 1S1WA 1SKRA 4M3WA 1C1BA 4FJHA 3NDKA 4FM1A 1X1PA 2P1JA 1TK5A 1TKZA 5I3UA 3L2WA 3KLIA 3DOKA 1ASUA 4Z0UA 4CJ4A 3S3OA 1HRHA 3PUFA 3CFPA 3OYEA 1VSFA 3DRRA 5CZ1A 4E19A 3KLHA 4ELUA 4KB1A 4FK4A 1FXXA 5HBMA 3VQ8A 4XIUA 1S1UA 3SCXA 3KTQA 4OJRA 4DTMA 2I5JA 4HVJA 4DTJA 2VWKA 2HMIA 4DQPA 4RW7A 4CGGA 4B8AB 3M8RA 3EY1A 4DS5A 3ZSYA 1RBSA 1XHXA 1SL1A 1RTJA 2BANA 3AA5X 3V81A 4IG0A 5HRRA 2RKIA 4CHNA 4DLGA 1NK7A 1RILA 4CESA 3F9KA 1BI4B 4N47A 4W5TA 1RDDA 4DTSA 1RBVA 3T1AA 1HYVA 2OPQA 3AVLA 4B9TA 4PA1A 4CJWA 4CIGA 1NKEA 2KZZA 4RW9A 4N41A 2PY5A 3KLEA 4KFBA 1RDCA 4LD0A 4CCHA 1CLQA 1HQEA 1WN7A 4DLEA 3AA3A 2YHBA 2QXFA 3BGRA 1D5AA 4DS4A 2F8SA 1JLGA 3A2FA 3NGZA 4DTRA 4DQQA 3VN5A 1XC9A 1IKXA 4QAGA 4B3OA 3VQDA 4FLTA 1VK0A 1SL2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CZ2 A;  4F3O A;  4FCY A;  3HPH A;  4HUG A;  3LPT A;  1NOY A;  5HRO A;  2QKK A;  3SPY A;  4HUE A;  4IG3 A;  2IDO A;  4BDY A;  5HRN A;  1JLB A;  3DLH A;  1KTQ A;  4KV8 A;  2VG5 A;  1RBT A;  2YHA A;  3C94 A;  4C8M A;  3DOL A;  3H08 A;  1T03 A;  4M3T A;  2XY6 A;  4C8N A;  3K5O A;  4I7F A;  1QTM A;  4FJG A;  4KHS A;  2X6S A;  2E6M A;  1TKD A;  1LW0 A;  5FRN A;  1WAJ A;  4Z4H A;  3HPG A;  4ZHR A;  3KK1 A;  3U3Y A;  4KPY A;  2DFF A;  2G8I A;  2QKB A;  1NOZ A;  1TKT A;  4Z4F A;  1IKV A;  1LWC A;  4GVM A;  3NF8 A;  3IG1 A;  4DSF A;  2BGG A;  4CEZ A;  5JS1 A;  1RBU A;  3AO2 A;  1CZB A;  4J2D A;  1ZBI A;  1TKX A;  3U3G A;  1BIU A;  3OS2 A;  3LAM A;  1BIZ A;  3HYF A;  3OYL A;  4CFC A;  4DTO A;  4DFK A;  3SV3 A;  4DTU A;  4E0D A;  1SUQ A;  1TAU A;  4CED A;  2PZS A;  1JL1 A;  5CY4 A;  4CE9 A;  3K5N A;  3K5L A;  3MAQ A;  4FM2 A;  1ASW A;  1U4B A;  1NJW A;  2HHW A;  1JLQ A;  4EP5 A;  3HXM A;  4DSL A;  4F2S A;  3AO4 A;  3NH1 A;  4FJX A;  1SL0 A;  1FKO A;  3SJJ A;  1Q9X A;  5DMR A;  2X6N A;  3LP3 A;  3G0Z A;  4M3Z A;  4LH5 A;  2X78 A;  4DSK A;  2D0B A;  4B9N A;  3AA2 A;  4KTW A;  3QEP A;  4DSJ A;  3P83 D;  1KFD A;  3OS0 A;  3OYI A;  3ZT0 A;  3L2Q A;  2WON A;  3WNF A;  2ETJ A;  2Z1H A;  4O0J A;  3V9W A;  1WSF A;  3ZSO A;  3ZSV A;  3DYA A;  3V9X A;  2Z1I A;  2D5R A;  2DTU A;  4W5N A;  2HND A;  5FRO A;  3QLH A;  3VQ7 A;  4ELV A;  4CFD A;  3JYT A;  1TAQ A;  1LAV A;  1RT1 A;  3BDP A;  4CF9 A;  3VQ5 A;  1NK8 A;  5J2Q A;  4RW6 A;  4B9L A;  3P5J A;  4MQ3 A;  3CFO A;  3C95 A;  4CHQ A;  5J2P A;  4PY5 A;  3KIO A;  1WSE A;  5KRT A;  3ZSQ A;  2FBX A;  4E89 A;  1KSP A;  2HNY A;  4N76 A;  3OYM A;  1C0M A;  4E7L A;  1BQN A;  1JXB A;  2E4L A;  1JXE A;  1A5V A;  3TAB A;  4TSX A;  4M3R A;  2A1S A;  4GW6 A;  4I2Q A;  3LP0 A;  4DTN A;  1NKC A;  4ZTJ A;  4KHY A;  5D3G A;  1IH7 A;  1NKB A;  1ASV A;  1BL3 A;  3QIN A;  4YFU A;  1WSJ A;  4CJL A;  4NYN A;  1S9G A;  4CGD A;  2G8W A;  4CJK A;  4DWI A;  4KHN A;  4AHS A;  1B9D A;  3KLG A;  2IAJ A;  1JLA A;  1RCH A;  3CM6 A;  1UA0 A;  2DY4 A;  1VSK A;  4HCB A;  1R0A A;  4O4G A;  4KRE A;  3ZT4 A;  2FBV A;  1JLC A;  3MED A;  4AHC A;  3OYK A;  3V1R A;  4FLU A;  3QES A;  1T7P A;  4H4M A;  4DF8 A;  3SUO A;  3AVH A;  3NE6 A;  3KD1 E;  4FVM A;  1Z26 A;  3VQQ A;  4LSL A;  4DQS A;  4FW2 A;  3KKS A;  2EHG A;  3D45 A;  3SYZ A;  3AVK A;  3I0S A;  1SKW A;  4KTZ A;  4O55 A;  1IG9 A;  3ZCM A;  4FK2 A;  4H4O A;  3VQE A;  3TAP A;  4PWD A;  4C8K A;  3LWM A;  1B92 A;  4FLX A;  3EYZ A;  4DTP A;  3SQ2 A;  3TAQ A;  3SUN A;  4KRF A;  5I42 A;  1VSE A;  3MXI A;  1KLN A;  3RTV A;  4OGC A;  3HPO A;  1U47 A;  4FZY A;  1S1X A;  3VQP A;  4OKK A;  4JRQ A;  2W42 A;  1BGX T;  1QQC A;  2NUB A;  3OY9 A;  3RRG A;  5J2M A;  1QSY A;  3RR8 A;  4FJ9 A;  4NCB A;  1FKP A;  1VSJ A;  3AVJ A;  1WLJ A;  3LP2 A;  3WNE A;  5SWM A;  3T3F A;  4I9L A;  3SQ4 A;  3PY8 A;  3TAM A;  3OJS A;  2KFZ A;  1WSG A;  4M3U A;  2ITG A;  3MEG A;  1GOB A;  3V1Q A;  2XY5 A;  1G15 A;  1L3T A;  3RR7 A;  1RTH A;  4CF1 A;  3QNO A;  3V9Z A;  4E7J A;  1EKE A;  4OGE A;  1J54 A;  1TL1 A;  4E1M A;  4CHP A;  3D0P A;  3T19 A;  3LZJ A;  1NK4 A;  2OYQ A;  4E1N A;  4OPJ A;  4AHV A;  3KK3 A;  4FJ7 A;  1LWF A;  5C24 A;  2RF2 A;  3QIP A;  4QCL A;  2HHQ A;  2B6A A;  1ZBH A;  1BCM A;  3OYA A;  1VRT A;  2ATQ A;  5C25 A;  4FJM A;  4L8R B;  3NGY A;  3OYB A;  3M8Q A;  1UAX A;  3NAE A;  4CGI A;  1TGO A;  3KKR A;  1BI4 A;  4C8O A;  3M8S A;  3DM2 A;  2IC3 A;  3CYM A;  2KW4 A;  3L3V A;  1WSI A;  3V4I A;  1ZBL A;  2HHS A;  5HRS A;  2A1R A;  4F8R A;  3K58 A;  3ITH A;  3DMJ A;  2YNH A;  3LDS A;  4FZX C;  3NH2 A;  1S1V A;  1KVB A;  4OVL A;  1HNV A;  3V6D A;  3DLK A;  5E41 A;  2GV9 A;  4CK2 A;  3AO5 A;  1J5O A;  2ZQB A;  1RT4 A;  4CEA A;  4ZTF A;  2PYJ A;  3TR8 A;  2B4J A;  3I8D A;  3OYD A;  3KJV A;  2KFN A;  1QHT A;  2XHB A;  2X74 A;  2FBY A;  4CGH A;  5EU7 A;  4CJ5 A;  1ZYQ A;  1T8E A;  4OKE A;  3PX6 A;  1N5Y A;  1RTD A;  3NF9 A;  4E7I A;  4O5B A;  1IO2 A;  3L3U A;  3MEC A;  4IDK A;  2HVH A;  3O3G A;  1EXQ A;  4CJF A;  1NK6 A;  2PYL A;  4B9M A;  1CZ9 A;  3G10 A;  1DLO A;  5FDL A;  4H8K A;  5FRM A;  4JS4 A;  2HHU A;  4BDZ A;  5HRP A;  2RN2 A;  1IKW A;  4YNQ A;  3AO1 A;  1YVU A;  3AVF A;  4OPK A;  3HVT A;  3AVM A;  3TAR A;  1L3V A;  4QOZ B;  1C0T A;  4Z4E A;  3VA0 A;  2HB5 A;  2KZM A;  4DSE A;  4KAZ A;  4CJP A;  3JSM A;  3DRS A;  4ID1 A;  1S6Q A;  1Q9Y A;  2B5J A;  4HHT A;  4Z4C A;  1BQM A;  2OPR A;  4KKO A;  1KRP A;  4CIE A;  4F3T A;  3ASM A;  1CXQ A;  1TVR A;  2GUI A;  2DFE A;  4FJL A;  3ZT3 A;  4LY7 A;  2OZS A;  3P1G A;  4RW8 A;  1C1A A;  2BDP A;  3LZI A;  2YKN A;  3VQB A;  1KVC A;  4AH9 A;  1D9D A;  4KB0 A;  4BE2 A;  4I2P A;  4FLZ A;  3VA3 A;  3O4N A;  3LPU A;  1QS4 A;  2Z1G A;  4IFY A;  1TK8 A;  1DTQ A;  2YKM A;  2AJQ A;  4Y1C A;  4BAC A;  4CJS A;  1TK0 A;  3KD5 E;  3QEX A;  3V9S A;  1YT3 A;  4M41 A;  4B9S A;  2XRI A;  1RT7 A;  2YNF A;  3HST B;  2E6L A;  4AHR A;  4BE0 A;  3QET A;  3AV9 A;  1U49 A;  4K8X A;  4FK0 A;  2RPI A;  1LWE A;  4RW4 A;  1TV6 A;  4ID5 A;  3NBP A;  1C0U A;  2Q3S A;  1NJZ A;  4CIF A;  4CFB A;  3IS9 A;  1J9A A;  4KI6 A;  4CF2 A;  1HMV A;  1RT3 A;  2HHT A;  4CEQ A;  1ZBF A;  3ALY A;  3QO9 A;  3OVN A;  4LH4 A;  5SZT A;  1KFS A;  4DSI A;  4KTQ A;  4CER A;  4OLA A;  3MXJ A;  4JRP A;  1EX4 A;  2G8K A;  3C6T A;  2G8H A;  3THV A;  1XHZ A;  3ISN C;  4FJK A;  1CXU A;  2XO7 A;  3CFR A;  3E01 A;  4AIL C;  4E7K A;  3DLB A;  4FJ5 A;  1L5U A;  2O4G A;  3HT3 A;  3ZT2 A;  5HP1 A;  4E3S A;  4Z4I A;  5KI6 A;  4CGF A;  2VG7 A;  3TAE A;  1L3S A;  2P51 A;  5DK5 A;  3SV4 A;  1JLF A;  3NF6 A;  3MXM A;  4CF8 A;  3UIQ A;  3QEV A;  4CK1 A;  1WAF A;  4CEO A;  4FM0 A;  5J2N A;  2HNZ A;  2ZE2 A;  1QE1 A;  2D0A A;  3I0R A;  4NCA A;  4DFP A;  4M3X A;  4PQU A;  3L2R A;  3TAN A;  1Z25 A;  3U6F A;  4DU4 A;  1DTT A;  1LW2 A;  4E7H A;  4DF4 A;  4FJI A;  4Q0B A;  1Y97 A;  1S6P A;  3ZSX A;  2Y1J A;  3AVN A;  4KHQ A;  1VSL A;  3QEW A;  3NHG A;  3QEI A;  2BE2 A;  1C6V A;  4NYF A;  3HL8 A;  5JS2 A;  4W5R A;  3PV8 A;  1RDA A;  3OYN A;  1K6Y A;  4O44 A;  4PUO A;  4J2A A;  1KCF A;  1QSL A;  3RMB A;  1KLM A;  3OYC A;  4IFV A;  4DU3 A;  2P5O A;  4N56 A;  1I3A A;  1TL3 A;  3LAN A;  4GMJ B;  4RG8 A;  1QSS A;  3O3H A;  4CGJ A;  3HM9 A;  4DMN A;  2GBZ A;  1WNS A;  2OA8 A;  3K2P A;  4EZ6 A;  4KO0 A;  3PO4 A;  1BCO A;  4DFJ A;  4FJ8 A;  3SZ2 A;  3ZSR A;  3S3M A;  1F21 A;  3SUQ A;  1NK0 A;  1C1C A;  1KVA A;  3VQC A;  3LAK A;  4FJJ A;  2QK9 A;  3ZSW A;  5KRS A;  5KTQ A;  4B08 A;  1O1W A;  4CJR A;  1D9F A;  4KI4 A;  1BHL A;  2HW3 A;  2JGU A;  4CHO A;  1HNI A;  3AO3 A;  2G8V A;  2FC0 A;  3SPZ A;  4K8Z A;  3KLF A;  3SQ1 A;  4KHW A;  3CG7 A;  4EP4 A;  3RMC A;  4C8L A;  4B9U A;  4JLH A;  3CM5 A;  1EP4 A;  2F8T A;  4F2R A;  5HLF A;  3RMA A;  3S3N A;  1HPZ A;  1NJY A;  1U04 A;  3ZSZ A;  1RT6 A;  3LWL A;  3S9H A;  3SI6 A;  2EX3 A;  4CHY A;  2P5G A;  4J2B A;  4J2E A;  3HO1 A;  3AVA A;  4CJT A;  4HTU A;  3TAF A;  1RNH A;  1EET A;  2XY8 A;  2Z1J A;  3HP9 A;  3HJF A;  3K57 A;  4HUF A;  4CHZ A;  4DQR A;  4EZ9 A;  2HVI A;  1NK9 A;  1VSD A;  3L2V A;  3L2U A;  2VG6 A;  3K5M A;  1LV5 A;  2YV0 X;  4FJN A;  4CJE A;  4M45 A;  3OYG A;  2OPP A;  4N5S A;  5KGW A;  3NF7 A;  4BDP A;  4FLW A;  3QNN A;  3LP1 A;  1WSH A;  1XWL A;  3NCI A;  5CYQ A;  1UWB A;  3F73 A;  1VSH A;  3RRH A;  3PO5 A;  3VQ9 A;  1HYS A;  2KTQ A;  3NH0 A;  1I39 A;  1Q8I A;  2IS3 A;  5KGX A;  4Q5V A;  3AVC A;  2OPS A;  1T05 A;  3OYF A;  1JLE A;  2DFH A;  3O3F A;  3QIO A;  1X9S A;  1UOC A;  1JKH A;  3PX4 A;  1RBR A;  1GOA A;  4DTX A;  2YNG A;  3M8P A;  3DRP A;  3SUP A;  3TWH A;  4DFM A;  1N6Q A;  2YNI A;  2XY7 A;  1BIS A;  3IAY A;  1MU2 A;  4DQI A;  1RDB A;  3HK2 A;  4I9Q A;  2IGI A;  1L3U A;  2G8F A;  1A5W A;  3OJU A;  4W5Q A;  3B6P A;  3ULD A;  2OZM A;  1W9H A;  3DLE A;  1ITG A;  3B6O A;  4CJ3 A;  4ELT A;  1X9M A;  1RT5 A;  4G1Q A;  1ZBU A;  4CEC A;  4DG1 A;  4ICL A;  5K14 A;  1RT2 A;  2D0C A;  3HP6 A;  3AA4 A;  4FLY A;  4Z4G A;  4O0I A;  1B9F A;  3ZT1 A;  3OYH A;  2R7Y A;  1HYZ A;  4CEF A;  3KK2 A;  4FXD A;  1YTA A;  3OYJ A;  3IRX A;  4CFA A;  3SQ0 A;  1UA1 A;  1NJX A;  3RMD A;  4W5O A;  2VWJ A;  1J53 A;  3PX0 A;  2HHV A;  3QER A;  4OLB A;  1YTU A;  4F4K A;  3O4Q A;  3HVR A;  4JS5 A;  3C6U A;  4FZZ A;  3FFI A;  3V1O A;  1U48 A;  3DI6 A;  4OKJ A;  4AHT A;  1GOC A;  4UQG A;  1U45 A;  1HJR A;  3TI0 A;  4HCC A;  3DLG A;  3DLR A;  3LAL A;  4FLV A;  2O4I A;  1S1T A;  4WE1 A;  1VSM A;  3OS1 A;  4IKF A;  4CJV A;  2LSN A;  1LAW A;  3AVG A;  3K59 A;  5CYM A;  4KHU A;  1S5J A;  3NFA A;  4BWM A;  3EZ5 A;  2Y1I A;  3L8B A;  2HHX A;  3WNH A;  2WOM A;  4NCG A;  2IOC A;  2JLE A;  3VQA A;  4Y1D A;  4IBN A;  4BE1 A;  3AVI A;  1A5X A;  1X9W A;  1NK5 A;  4M42 A;  1S9E A;  4CEB A;  1RTI A;  1XI1 A;  1W0H A;  1REV A;  3AVB A;  3VQ6 A;  3NGI A;  1D8Y A;  4M3Y A;  2G8U A;  5T7B A;  4R5P A;  3RWU A;  4LSN A;  4B9V A;  4AHU A;  1JL2 A;  1FK9 A;  3WNG A;  3V9U A;  2ZD1 A;  3MEE A;  4FW1 A;  3CQ8 A;  1VRU A;  4BWJ A;  2FBT A;  4CJU A;  4CJQ A;  1IKY A;  1HQU A;  1SV5 A;  1VSI A;  2F96 A;  5J1E A;  3TAG A;  3SNN A;  4FYD A;  4CEE A;  4MFB A;  4DU1 A;  1SKS A;  4CF0 A;  3VQ4 A;  4B8C A;  2KQ2 A;  5C42 A;  4CK3 A;  1S1W A;  1SKR A;  4M3W A;  1C1B A;  4FJH A;  3NDK A;  4FM1 A;  1X1P A;  2P1J A;  1TK5 A;  1TKZ A;  5I3U A;  3L2W A;  3KLI A;  3DOK A;  1ASU A;  4Z0U A;  4CJ4 A;  3S3O A;  1HRH A;  3PUF A;  3CFP A;  3OYE A;  1VSF A;  3DRR A;  5CZ1 A;  4E19 A;  3KLH A;  4ELU A;  4KB1 A;  4FK4 A;  1FXX A;  5HBM A;  3VQ8 A;  4XIU A;  1S1U A;  3SCX A;  3KTQ A;  4OJR A;  4DTM A;  2I5J A;  4HVJ A;  4DTJ A;  2VWK A;  2HMI A;  4DQP A;  4RW7 A;  4CGG A;  4B8A B;  3M8R A;  3EY1 A;  4DS5 A;  3ZSY A;  1RBS A;  1XHX A;  1SL1 A;  1RTJ A;  2BAN A;  3AA5 X;  3V81 A;  4IG0 A;  5HRR A;  2RKI A;  4CHN A;  4DLG A;  1NK7 A;  1RIL A;  4CES A;  3F9K A;  1BI4 B;  4N47 A;  4W5T A;  1RDD A;  4DTS A;  1RBV A;  3T1A A;  1HYV A;  2OPQ A;  3AVL A;  4B9T A;  4PA1 A;  4CJW A;  4CIG A;  1NKE A;  2KZZ A;  4RW9 A;  4N41 A;  2PY5 A;  3KLE A;  4KFB A;  1RDC A;  4LD0 A;  4CCH A;  1CLQ A;  1HQE A;  1WN7 A;  4DLE A;  3AA3 A;  2YHB A;  2QXF A;  3BGR A;  1D5A A;  4DS4 A;  2F8S A;  1JLG A;  3A2F A;  3NGZ A;  4DTR A;  4DQQ A;  3VN5 A;  1XC9 A;  1IKX A;  4QAG A;  4B3O A;  3VQD A;  4FLT A;  1VK0 A;  1SL2 A; 
#chains in the Genus database with same CATH topology
 5CZ2 A;  4C1N I;  2FSJ A;  4FCY A;  4HUG A;  4I6M B;  4HUE A;  1X9J A;  4IG3 A;  4JKC A;  5AR0 A;  1JLB A;  4JKF A;  3U4L A;  2VG5 A;  3LM2 A;  2YHA A;  3C94 A;  5AQW A;  4C8M A;  2XY6 A;  4DV4 K;  2J4R A;  4JAX A;  1LW0 A;  4YOV A;  1WAJ A;  3H1V X;  3U3Y A;  5AZI B;  2DFF A;  1NOZ A;  5AQU A;  1YJW N;  1TKT A;  4GVM A;  3NF8 A;  2WFB A;  3IG1 A;  3C0B A;  1NWK A;  4FPB A;  3CCL N;  4B1Z A;  3U3G A;  4J2D A;  3OYL A;  3OS2 A;  3VGM A;  1SUQ A;  3D2E B;  3K5L A;  1NJW A;  1ASW A;  2HHW A;  3UB5 A;  4BRE A;  4BR0 A;  4DSL A;  2D0O A;  3AO4 A;  3SJJ A;  2UUB K;  5DMR A;  3G0Z A;  4M3Z A;  1SZ2 A;  1HNZ K;  1HLU A;  5ELZ A;  4KTW A;  3CER A;  4BR5 A;  3P83 D;  3L2Q A;  2WON A;  4EIA A;  2ETJ A;  4CJ7 A;  4LF8 K;  1IG8 A;  2A41 A;  2ASP A;  2HND A;  1OH8 A;  2NZT A;  4K41 A;  1LAV A;  1RT1 A;  3MN7 A;  4BRP A;  3CFO A;  3C95 A;  3KIO A;  2E5L K;  4E7L A;  4WCE L;  2E4L A;  3VEZ A;  4GW6 A;  3LP0 A;  4BRC A;  4MLH A;  4WFA L;  1IH7 A;  4XH4 A;  3QIN A;  4YFU A;  3CC2 N;  1S9G A;  3HOT A;  4KHN A;  4AHS A;  1T3V A;  1VQ9 N;  4A57 A;  1WOQ A;  1R0A A;  5ADX H;  1JLC A;  4AHC A;  4H4M A;  3KD1 E;  1MWM A;  3VF6 A;  3MCP A;  4KTZ A;  4EHU A;  2NRW A;  2P9I B;  1K8K B;  1VSE A;  3MXI A;  3LDP A;  3OA9 A;  3WXI A;  1S1X A;  4DR2 K;  2FF6 A;  1QSY A;  3RR8 A;  3WNE A;  4H5N A;  1ATS A;  3T3F A;  3PY8 A;  2NRT A;  4CZG A;  3ZYY X;  2VQE K;  1WSG A;  1GOB A;  5BRH A;  2XY5 A;  1G15 A;  1WBB A;  4IOX A;  4GV3 A;  2NRH A;  2UXC K;  1TL1 A;  3D0P A;  1G99 A;  1HUX A;  4E1N A;  4F9O A;  3KK3 A;  2V7Y A;  4JK7 A;  3E9L A;  2W6K A;  1IJJ A;  3DXK A;  2B6A A;  1VRT A;  2ATQ A;  3K9K A;  1EO1 A;  3VPZ A;  4H0V B;  2IC3 A;  3L3V A;  2PFU A;  3AAR A;  4RCH A;  1U2V A;  4JI6 K;  4CK2 A;  1J5O A;  2ZQB A;  1RT4 A;  3I8D A;  2VCP A;  2ZF5 O;  5BPN A;  5EU7 A;  1N5Y A;  4ILH A;  4IDK A;  5B8H A;  2V52 B;  5FDL A;  4H8K A;  5FRM A;  5HRP A;  3AO1 A;  2RE2 A;  5FPN A;  3VA0 A;  2HB5 A;  3DLL L;  1WBD A;  2GX9 A;  3W3D A;  4H5T A;  3L4I A;  2O8E B;  4Z4C A;  1BQM A;  3ASM A;  1CXQ A;  1VQN N;  2E2Q A;  1C1A A;  3RSE A;  1D9D A;  2HOE A;  4I2P A;  3O4N A;  3W0L A;  3LPU A;  3OBW A;  1DTQ A;  2AJQ A;  4Y1C A;  3WXJ A;  4CBU A;  1RT7 A;  2E6L A;  2FXU A;  4LF4 K;  4AHR A;  4LFC K;  3ATU A;  3FLC O;  3QET A;  1GLE G;  4IFE A;  3NBP A;  2Q3S A;  1NJZ A;  2WC9 A;  3SJH A;  3IS9 A;  4CF2 A;  2HHT A;  4CBW A;  3ALY A;  3QO9 A;  3OVN A;  1KFS A;  1EX4 A;  3UKR B;  1HJO A;  3C6T A;  1Q82 O;  3THV A;  4PKG A;  4DR1 K;  5HP1 A;  1MDU B;  5JIC A;  4Z4I A;  2VG7 A;  2P51 A;  2I7P A;  2UU9 K;  3NF6 A;  5AQQ A;  2NRR A;  2Q31 A;  4FM0 A;  3G6E N;  3I0R A;  1YUW A;  4DFP A;  1J5E K;  1Z25 A;  3VGL A;  3D2F A;  1WUA A;  4DV5 K;  1BDG A;  2W41 A;  2Y1J A;  4JI7 K;  4DV2 K;  2O8D A;  1JCF A;  3HL8 A;  3PV8 A;  4WQ4 C;  4O44 A;  4PUO A;  3DWL A;  3AY9 A;  4H0O A;  3RMB A;  4GMJ B;  3S41 A;  2Q2R A;  4BRQ A;  1BCO A;  4K42 A;  3S3M A;  3BF3 A;  3SUQ A;  3DJC A;  4FJJ A;  4RWT A;  2QK9 A;  1MA9 B;  1O1W A;  4CJR A;  1BHL A;  3VF4 A;  1HNI A;  2EWS A;  3AO3 A;  2G8V A;  3SPZ A;  1TYQ B;  3CG7 A;  4EP4 A;  3RMC A;  3U9Z A;  5GIN A;  5FPM A;  4KH4 A;  1EP4 A;  1NGJ A;  1NGF A;  5HLF A;  3RMA A;  3S3N A;  3ZSZ A;  3LWL A;  3SI6 A;  2P5G A;  3AVA A;  1RNH A;  4PHT X;  3K57 A;  4CHZ A;  4DQR A;  1W7A A;  2VG6 A;  2YV0 X;  1XMQ K;  3OYG A;  5GIO A;  5KGW A;  4BDP A;  1UWB A;  2CH6 A;  3O8M A;  3QDK A;  5E26 A;  1HKB A;  2NRX A;  3T1H K;  2HMP A;  1I39 A;  1Q8I A;  4Q5V A;  3OYF A;  2DFH A;  1NMN A;  4BC3 A;  5AQK A;  3QIO A;  4ISG A;  1UOC A;  2D4W A;  5AQR A;  2YNG A;  5DM7 L;  5AQZ A;  1VQ5 N;  2IVO A;  4BRA A;  4FPA A;  3HK2 A;  1L3U A;  1HNW K;  4G1Q A;  4IO8 A;  3TPQ A;  5K14 A;  4M63 C;  4CI6 A;  3HP6 A;  5EXW A;  5LJW A;  1HYZ A;  3OYJ A;  3O9R A;  4IZ9 A;  4CFA A;  3JAM O;  1JCE A;  4W5O A;  3PX0 A;  3EE9 A;  4OLB A;  1HKG A;  4JS5 A;  4FZZ A;  3CXC M;  4B3R K;  4OKJ A;  3VET A;  1GOC A;  4BRI A;  4BRD A;  3KK7 A;  3CCJ N;  3CCM N;  2ZJQ L;  1S1T A;  3SMS A;  4X64 K;  2P9U B;  1LAW A;  3K59 A;  5M1P A;  5CYM A;  3NFA A;  2HHX A;  3L8B A;  3ZET A;  3VQA A;  4E7I A;  2JLE A;  4IBN A;  4BE1 A;  1X9W A;  1NK5 A;  2JWL A;  1RTI A;  3OHR A;  1N33 K;  3NGI A;  2O8F B;  4R5P A;  4YOR A;  4B9V A;  4WFN L;  4AHU A;  3V9U A;  2ZD1 A;  3GL1 A;  3BZC A;  3CQ8 A;  1IKY A;  1SV5 A;  2F96 A;  5J1E A;  3SNN A;  2NLX A;  2BH1 A;  5C42 A;  4FWK A;  2AP1 A;  3NDK A;  1X1P A;  1TK5 A;  4Y0W A;  3PLA A;  3S3O A;  3CFP A;  4WQ4 A;  4V19 S;  1NG9 A;  3DRR A;  3KLH A;  4ELU A;  4KB1 A;  4YOU A;  4XIU A;  2VWK A;  4NO7 A;  3M8R A;  3EY1 A;  1XHX A;  5AQV A;  3QFP A;  5HRR A;  1BI4 B;  2QWO A;  3PIP L;  2UXB K;  4RW9 A;  2PY5 A;  3KLE A;  4LD0 A;  1CLQ A;  4CVN E;  1HQE A;  1WN7 A;  3AA3 A;  1VHX A;  1D5A A;  4DS4 A;  1JLG A;  2F9W A;  3NGZ A;  3I55 N;  1XC9 A;  4H5V A;  4QAG A;  1GLA G;  3FZK A;  2Q0R A;  3MWT A;  3I56 N;  3MX5 A;  1VK0 A;  1SL2 A;  3BP8 A;  3CPW M;  5LMU K;  5HRO A;  4ILG B;  5HRN A;  4KV8 A;  1RBT A;  3H08 A;  4I7F A;  3AAQ A;  2X6S A;  2HF4 A;  3VEW A;  3KK1 A;  2ZJR L;  5AZJ B;  2QKB A;  4WYB A;  1IKV A;  2JWK A;  4DSF A;  4JEP A;  1DKG D;  5JS1 A;  1RBU A;  3AO2 A;  4DR3 K;  1CZB A;  4ILJ A;  1KQS M;  1U47 A;  4DFK A;  4JD2 A;  1BIZ A;  3HYF A;  2QKK A;  4E0D A;  1TAU A;  4DTU A;  2P9K B;  3K5N A;  1U4B A;  3MAQ A;  3SK3 A;  3CJ1 A;  1JLQ A;  4EP5 A;  4YDU C;  5AQX A;  3IMX A;  1Q9X A;  4JI2 K;  4LH5 A;  2YHX A;  1ZBS A;  4B9N A;  4LF5 K;  3AA2 A;  1I94 K;  3THX B;  3OYI A;  1E3M A;  1NU0 A;  1WSF A;  3V9X A;  3DYA A;  2Z1I A;  2D5R A;  3F9M A;  3VQ7 A;  2Q1N A;  1FW6 A;  3JYT A;  4JHD A;  4CF9 A;  4MQ3 A;  1R59 O;  5KRT A;  2FBX A;  4BRF A;  3ULE B;  2HNY A;  1KSP A;  4N76 A;  1JXB A;  1BUP A;  1JXE A;  2BUP A;  3QBW A;  4FWS A;  4DTN A;  1OH7 A;  2PAV A;  4ZTJ A;  5D3G A;  3J7Y P;  1ASV A;  1WSJ A;  2E8A A;  4CJL A;  4YOW A;  4CGD A;  2G8W A;  3KLG A;  1RCH A;  1UA0 A;  2DY4 A;  3CM6 A;  3BUZ B;  1VSK A;  4HCB A;  3O5B A;  5KQD A;  4KRE A;  4XH1 A;  3ID8 A;  5AQP A;  4DF8 A;  1BO5 O;  3NE6 A;  5BPM A;  1Z26 A;  3VQQ A;  1GLD G;  3FZL A;  4DQS A;  3D45 A;  3SYZ A;  3UKU B;  3AVK A;  1T6D A;  3ZCM A;  3THW B;  5KQ8 A;  2YJE A;  3B8A X;  3CIP A;  4DTP A;  3SQ2 A;  4A2A A;  4KRF A;  3C7N B;  1GLL O;  5AQO A;  3CC7 N;  3HBT A;  2P9P A;  1KLN A;  3RTV A;  4B1Y B;  3N4Q A;  3VQP A;  4JRQ A;  4ISE A;  3SQ4 A;  4I9L A;  4BC4 A;  2E1Y A;  2KFZ A;  4C23 A;  2F9T A;  3V1Q A;  1YJN N;  1VQ7 N;  1L3T A;  4DR7 K;  2D1K A;  4CF1 A;  1N34 K;  4E7J A;  1EKE A;  4E1M A;  3P31 A;  3JS6 A;  3T19 A;  5C2F A;  1NK4 A;  4LC9 B;  2OYQ A;  4OPJ A;  4AHV A;  3TTC A;  5C24 A;  3O08 A;  2RF2 A;  3QIP A;  4JK8 A;  5CR4 A;  5EY4 A;  2FLO A;  4FJM A;  1OKJ A;  2P9S B;  3M8Q A;  3MX2 A;  1UAX A;  4BRN A;  3KKR A;  4JKB A;  2P9L A;  2O8B A;  2QWN A;  1T6C A;  1DEJ A;  3ZEU B;  3V4I A;  5AQT A;  4NXN K;  3CCU N;  2A1R A;  3SAG A;  3LDS A;  2YNH A;  3NH2 A;  1S1V A;  4OVL A;  2GV9 A;  3AO5 A;  4H03 B;  3TR8 A;  4CZL A;  3KJV A;  5C10 A;  2KFN A;  2XHB A;  5AQM A;  4CGH A;  3MWP A;  5BPL A;  1T8E A;  4OKE A;  3PX6 A;  3R3L A;  3H45 C;  5F2R A;  3MEC A;  4I6M A;  3O3G A;  1EXQ A;  1HX1 A;  5HOO A;  3WEE B;  2D0P A;  5KPR A;  4JS4 A;  3AVF A;  1L3V A;  3AVM A;  3IUC A;  4YDU A;  4FWO A;  3M3Z A;  3G25 A;  1QHA A;  3BF1 A;  5HL7 L;  3DRS A;  5AZI A;  2B5J A;  2OPR A;  1KAY A;  2DFE A;  3P1G A;  2BDP A;  3A5N C;  3O6W A;  3VQB A;  4FWQ A;  3D2E A;  2ZGY A;  1QS4 A;  4BAC A;  3V9S A;  4B9S A;  2XRI A;  2GWJ A;  4K8X A;  4FK0 A;  2RPI A;  3T69 A;  4RW4 A;  4ID5 A;  1C0U A;  1CZA N;  2IIR A;  4CFB A;  2E1Z A;  4CEQ A;  5JVG L;  4OLA A;  5IT9 O;  1CXU A;  2XO7 A;  4AIL C;  3E01 A;  2WBN A;  3HT3 A;  3ZT2 A;  4MLE A;  4E3S A;  5KI6 A;  4CGF A;  2ZJP L;  1L3S A;  3SV4 A;  4CF8 A;  1WAF A;  1BU6 O;  4NCA A;  5C0Y A;  5AQF A;  4E7H A;  2ZWH A;  4KHQ A;  4H0Y B;  3UE5 A;  3QEW A;  3NMU A;  2HBM A;  4JI0 K;  4W5R A;  3OYN A;  4WFB L;  3WT0 A;  2UXD K;  1QSL A;  4FWP A;  4IFV A;  1I3A A;  1TL3 A;  4RG8 A;  3O3H A;  1HKC A;  2KKZ A;  3PSF A;  3K2P A;  4EZ6 A;  4KO0 A;  2W40 A;  4FJ8 A;  3SZ2 A;  3CJC A;  3LAK A;  1ESV A;  4MO4 A;  5KTQ A;  4QS7 A;  2YHW A;  1V4S A;  2JGU A;  2P9I A;  4CHO A;  1K8K A;  4KBO A;  4BGB A;  3SBT A;  3KLF A;  3ZX0 A;  3SBG A;  4L3Q A;  4B9U A;  4JLH A;  4ISF A;  4F2R A;  4BR9 A;  2OCE A;  1GLC G;  1QQO A;  3S9H A;  4J2B A;  2XY8 A;  4WQ5 C;  3D6R A;  1YHQ N;  4EZ9 A;  2HVI A;  1NK9 A;  4M45 A;  3VMF B;  2OPP A;  3FZM A;  1XWL A;  3NCI A;  4YY3 K;  3EKS A;  3JXU A;  1HYS A;  2KTQ A;  3NH0 A;  1VQ6 N;  2IS3 A;  1Z05 A;  1SQK A;  5KGX A;  2UUA K;  2OPS A;  1T05 A;  4FSV A;  3CC4 N;  1EWQ A;  3D7E O;  3SMP A;  5TKY A;  4DTX A;  3CJA A;  1BA1 A;  3HTV A;  3DRP A;  3NVK A;  2XY7 A;  4DQI A;  2A3Z A;  4I9Q A;  2G8F A;  4KH6 A;  1A5W A;  1YXQ A;  4W5Q A;  3B6P A;  4MO5 A;  2OZM A;  1W9H A;  3B6O A;  1NLV A;  4ELT A;  1ZBU A;  2A40 A;  2FF3 B;  3AA4 A;  4Z4G A;  1B9F A;  3ZT1 A;  2R7Y A;  1NBW A;  4CEF A;  3KK2 A;  4FXD A;  3SQ0 A;  1UA1 A;  1NJX A;  1ZC6 A;  1J53 A;  3A0I X;  3QER A;  4DCH A;  3HVR A;  2BTF A;  3C6U A;  3FFI A;  3V1O A;  3HZ6 A;  3KVG A;  4G9Z A;  4B1W B;  4UQG A;  2E2P A;  1U45 A;  3TI0 A;  4YOY A;  2ZGZ A;  2QWL A;  2O4I A;  3SAF A;  3O9T A;  5BN9 A;  4WE1 A;  2O8E A;  1NJI O;  4IKF A;  4CJV A;  3QFU A;  2LSN A;  3AVG A;  2FSN A;  1QVF M;  3EZ5 A;  4NCG A;  1NKC A;  4O8K A;  2F7T A;  4Y1D A;  3AVI A;  1A5X A;  3K9J A;  1W0H A;  2HHH K;  1D8Y A;  4M3Y A;  2G8U A;  2V7Z A;  1FK9 A;  3WNG A;  1C0G A;  3MEE A;  4BWJ A;  2FBT A;  4CJU A;  1VSI A;  1ATN A;  4FYD A;  4CEE A;  4H0P A;  3VQ4 A;  2KQ2 A;  4M3W A;  4E1J A;  1C1B A;  4FM1 A;  4IDH A;  2P1J A;  4R79 A;  1OVQ A;  1TKZ A;  5I3U A;  4Z0U A;  2OAN A;  3PUF A;  5A2Q O;  3OYE A;  2GTD A;  1VSF A;  3Q7C A;  2ZM6 K;  4FOI A;  4E19 A;  5AQN A;  4AM7 A;  3ZLJ A;  1D4X A;  3KWI A;  4H0X B;  5I9E B;  1FXX A;  2CGJ A;  4YHH K;  4OJR A;  4HTL A;  4HVJ A;  4DTJ A;  5CE3 A;  4DS5 A;  1SL1 A;  1RTJ A;  2A5X A;  4CHN A;  1RIL A;  1T44 A;  5AQS A;  4N47 A;  3DXM B;  1EWR A;  3CHW A;  4IEI A;  4N41 A;  3O80 A;  2YHB A;  3EKU A;  1E4G T;  3VER A;  3O4W A;  5AFU H;  4B1V A;  4OPA A;  4B3O A;  3E9P A;  3VQD A;  4FLT A;  3J81 O;  1M90 O;  4F3O A;  3HPH A;  4WQ5 A;  3K0S A;  3VES A;  3SPY A;  4JK9 A;  4BDY A;  1XNR K;  1KTQ A;  2ITM A;  4BRO A;  1TYQ A;  4PKI A;  1N8R O;  3DOL A;  3CME N;  3LDO A;  1QTM A;  3K5O A;  3EZW A;  4FJG A;  4KHS A;  4DB3 A;  5FRN A;  4Z4H A;  4ZHR A;  2G8I A;  3EE8 A;  3CJB A;  3ID6 A;  5AQY A;  1N32 K;  2BGG A;  4C1N K;  3LAM A;  4CFC A;  3LDL A;  3SV3 A;  3L0Q A;  2PZS A;  3NVM A;  4BVP A;  3HXM A;  4F2S A;  4YOT A;  3NH1 A;  4K0K K;  1SL0 A;  4PL8 A;  3T1Y K;  2X6N A;  3H6E A;  5GAH P;  5AQL A;  3C65 A;  4JKD A;  4AM6 A;  4DSJ A;  3OS0 A;  4DV3 K;  3ZT0 A;  4CZI A;  2HBJ A;  3WNF A;  3FE1 A;  4O0J A;  3VEV A;  4JI8 K;  3BY5 A;  3QML A;  2Q97 A;  2DTU A;  4W5N A;  4FL9 A;  4U67 L;  4ELV A;  3QLH A;  1BG3 A;  4H5W A;  3BDP A;  3VQ5 A;  1WB9 A;  1U6Z A;  3TTF A;  4O8U A;  3P5J A;  1NGD A;  4CHQ A;  5J2P A;  4PL7 A;  4PY5 A;  1WSE A;  5BR8 K;  3ZSQ A;  4E89 A;  3OYM A;  1C0M A;  2QA4 N;  1YJ9 N;  3TAB A;  4TSX A;  4M3R A;  4KHY A;  2QWM A;  2QEX N;  4NYN A;  3MN9 A;  1JLA A;  4O4G A;  3ZT4 A;  4FLU A;  3TTD A;  4FW2 A;  2P9U A;  4CZH A;  1EQY A;  1IG9 A;  3IKM A;  3P4I A;  5GAD P;  4H4O A;  4OPH A;  4PWD A;  4C8K A;  3LWM A;  1B92 A;  4FLX A;  3Q7B A;  3SUN A;  2O8F A;  4OGC A;  4FZY A;  4BRG A;  5KPT A;  2W42 A;  2NUB A;  3OY9 A;  4GY2 B;  5J2M A;  4FJ9 A;  1VSJ A;  1WLJ A;  3LP2 A;  3G71 N;  4IEE A;  4JI1 K;  2E20 A;  4M3U A;  2ITG A;  3MEG A;  4QS8 A;  3T7Z A;  3CD6 N;  3F2K A;  3RR7 A;  1RTH A;  2VQF K;  1QQN A;  4IO9 L;  2O8C B;  3LM9 A;  3QNO A;  3MN5 A;  4JI3 K;  3WQT A;  1J54 A;  4MDB A;  4CD1 A;  3LZJ A;  3CCR N;  4JKG B;  2QW9 A;  1LWF A;  4JI5 K;  1J6Z A;  4FWM A;  2OTJ N;  4A61 A;  2HHQ A;  3U8X A;  1ZBH A;  2HF3 A;  3OYA A;  3CJ7 A;  4L8R B;  5C25 A;  3NGY A;  3O1W A;  3OYB A;  1IV0 A;  1TGO A;  1BI4 A;  4C8O A;  3M8S A;  3OTO K;  3DM2 A;  4JI4 K;  4Z94 A;  3CYM A;  2HHS A;  3SLC A;  1Q7Y O;  1IBM K;  1NGB A;  3HOS A;  2QXL A;  3ITH A;  3K58 A;  3DMJ A;  1KVB A;  3V6D A;  4JKE A;  5E41 A;  4CEA A;  4DKW A;  5C15 A;  2X74 A;  3H3N O;  2P9N B;  1ZYQ A;  4CJ5 A;  4BR2 A;  3NF9 A;  4O5B A;  3ZX3 A;  1IO2 A;  3L3U A;  3PSI A;  3CMA N;  2HVH A;  4CJF A;  1OH5 A;  4B9M A;  4M7Y A;  3G10 A;  4JKH A;  4YNQ A;  4OPK A;  1C0T A;  2NNW A;  1HPM A;  4DSE A;  4MDA A;  4XH5 A;  4DR5 K;  1Q9Y A;  1S6Q A;  5AZJ A;  1QQM A;  4HHT A;  4JHD B;  3FGU A;  4NXM K;  4CIE A;  1TVR A;  2IVN A;  4FJL A;  2OZS A;  3BEX A;  3IFR A;  4KB0 A;  4DV0 K;  4NB4 A;  4BE2 A;  2P9K A;  4FLZ A;  4K43 A;  4CJS A;  3THY B;  4DV7 K;  1YT3 A;  4M41 A;  4AQY K;  1VQM N;  3BZK A;  2YNF A;  1KD1 O;  5BR9 A;  2E2O A;  3MN6 A;  4BE0 A;  3M1F A;  2FSK A;  3THX A;  2VWB A;  1LWE A;  4GVE A;  4IJN A;  1VQP N;  3VGK A;  5BRE A;  4EAH D;  1HMV A;  5SZT A;  1VQO N;  4DSI A;  4KTQ A;  4CER A;  3MXJ A;  4JRP A;  4BC5 A;  1VQ4 N;  5F0X A;  4FJ5 A;  3DLB A;  4E7K A;  1VAZ A;  5IWA K;  4EHT A;  5DK5 A;  5M1O A;  4FJI A;  3ULE A;  4B1X B;  3QEV A;  5J2N A;  3VF2 A;  4BRK A;  1QE1 A;  5MLC Q;  1DTT A;  3AVN A;  1VSL A;  1RDW X;  2BE2 A;  1O13 A;  4NYF A;  5JS2 A;  3GBT A;  1RDA A;  4J2A A;  1KCF A;  5AQI A;  3MCA B;  2V51 B;  2P5O A;  4CGJ A;  3HM9 A;  5C12 A;  4DMN A;  2GBZ A;  2OA8 A;  3PO4 A;  3QBX A;  4DFJ A;  3ZSR A;  3UKU A;  1C1C A;  3THW A;  4IXC A;  4B08 A;  2HW3 A;  4M7X A;  3C7N A;  1HNX K;  3KWG A;  1C0F A;  2FC0 A;  3SQ1 A;  4C8L A;  3CM5 A;  3CJ9 A;  3HSC A;  2EX3 A;  4CHY A;  3HO1 A;  4HTU A;  2ASO A;  4IOA L;  1E4F T;  3GDQ A;  3L2V A;  3K5M A;  1TUY A;  4PKH A;  4LF7 K;  1XQS C;  4FJN A;  1BWF O;  3NF7 A;  3QNN A;  1DGK N;  1WSH A;  5CYQ A;  3RRH A;  3PO5 A;  3TU5 A;  3J7A P;  4JV5 K;  3CCQ N;  3AVC A;  2P9S A;  3EN9 A;  1JKH A;  5M1Q A;  3PX4 A;  4RTF D;  1RBR A;  1GOA A;  2QWQ A;  3ZEU A;  2KLA A;  1V4T A;  2GEL A;  1LCU A;  5FPD A;  3AAP A;  1NNE A;  3SUP A;  3TWH A;  4DFM A;  1N6Q A;  1MU2 A;  4DV1 K;  3OJU A;  3E9O A;  1ITG A;  4DHY A;  4CEC A;  1XUP O;  1RT2 A;  2D0C A;  4FLY A;  1NGC A;  3OYH A;  5M1K A;  3IRX A;  3RMD A;  3WEE A;  2HHV A;  3HM8 A;  1K73 O;  3M5R A;  1YTU A;  1GLF O;  3A8Y A;  5AQG A;  3DI6 A;  2AA4 A;  3VEN A;  1KXP A;  4HCC A;  3CPE A;  3DLG A;  3DLR A;  4FLV A;  3H3O B;  2CGK A;  3J7Z O;  4U7B A;  3OS1 A;  1QZ6 A;  2HBK A;  1S72 N;  1S5J A;  3VTH A;  2Y1I A;  1YVN A;  2VYP A;  3WNH A;  3U9D A;  4FM2 A;  2IOC A;  3VEX A;  1S9E A;  4FWL A;  4CZJ A;  3R8E A;  2QTD A;  5T7B A;  4LSN A;  5FLX O;  5JLF A;  1JL2 A;  3OW2 M;  1QVG M;  1VRU A;  3WXM B;  4CJQ A;  1HQU A;  1M1K O;  3DAW A;  3TAG A;  4DU1 A;  4CK3 A;  1SKR A;  1S1W A;  5GIP A;  4CZM A;  1IBK K;  2QI2 A;  1YI2 N;  2VGN A;  3WXK A;  4WF9 L;  4BG9 A;  5GAG P;  3L2W A;  1HRH A;  5DM6 L;  3VQ8 A;  3SCX A;  5TKW A;  2I5J A;  4DQP A;  2QWP A;  2HMI A;  1RFQ A;  3DXK B;  4RW7 A;  3G4S N;  4GNI A;  4B8A B;  1RBS A;  3AA5 X;  2BAN A;  3ENO A;  1Q18 A;  3E66 A;  3CQX A;  4DTS A;  3MK6 A;  4OO1 J;  2OTL N;  3T1A A;  2OPQ A;  4BG8 A;  4B9Q A;  4CJW A;  4JYA K;  1U2V B;  1NKE A;  2KZZ A;  1RDC A;  3EL2 A;  4DLE A;  2QXF A;  2E88 A;  4LF6 K;  4A59 A;  1W97 L;  4DTR A;  4DQQ A;  3VEY A;  1IKX A;  4H0T B;  4FVU A;  4OX9 K;  2HST A;  1NOY A;  3LPT A;  1RDU A;  3FR0 A;  2IDO A;  1K9M O;  3O9S A;  1TUU A;  4BGA A;  3DLH A;  1VQ8 N;  4LF9 K;  1T03 A;  4M3T A;  4C8N A;  4DUY K;  2E6M A;  1TKD A;  4FWN A;  3HPG A;  4KPY A;  4JNE A;  2CGL A;  4Z4F A;  1LWC A;  1YIT N;  1NGH A;  4CEZ A;  3RSE B;  1TKX A;  1ZBI A;  1BIU A;  1JJ2 M;  5LMN K;  4DTO A;  2W6L A;  4CED A;  1JL1 A;  5CY4 A;  4CE9 A;  4IWV A;  2WUS A;  4FJX A;  1FKO A;  3LP3 A;  2X78 A;  4DSK A;  2D0B A;  1VQL N;  4BVO A;  3QEP A;  1KFD A;  4A62 A;  4O5F A;  1XMO K;  2Z1H A;  4BRH A;  5C2D A;  3V9W A;  3ZSO A;  3CI5 A;  3ZSV A;  5FRO A;  4DR4 K;  4CFD A;  1XC3 A;  1TAQ A;  1NK8 A;  5J2Q A;  4RW6 A;  4B9L A;  1GLB G;  4FO0 A;  3L6Q A;  3LDN A;  3O1B A;  5JMV A;  3GE1 A;  1BQN A;  1A5V A;  3AGR A;  3TSP A;  3OBY A;  2A1S A;  4I2Q A;  4BRL A;  3D2F B;  4XEI A;  1IBL K;  1NKB A;  4X62 K;  1BL3 A;  5LJV A;  1P8Z A;  2O8D B;  4DWI A;  4CJK A;  1B9D A;  1Y64 A;  2IAJ A;  2PBD A;  4B3S K;  5ADX A;  2FBV A;  3MED A;  3QES A;  3OYK A;  2RHK A;  3V1R A;  1T7P A;  3SUO A;  4A2B A;  3AVH A;  4FVM A;  1N36 K;  4LSL A;  5LY3 A;  3KKS A;  2EHG A;  4DR6 K;  3I0S A;  1SKW A;  4B1U B;  4O55 A;  3UKR A;  4FK2 A;  3VQE A;  3TAP A;  3IDH A;  2A42 A;  3LDQ A;  3EYZ A;  3TAQ A;  5I42 A;  1S3X A;  5FPE A;  3HPO A;  4OKK A;  1BGX T;  1QQC A;  3RRG A;  4NCB A;  1FKP A;  3AVJ A;  5SWM A;  1RGI A;  2E2N A;  3TAM A;  3OJS A;  3QIC A;  3L4Q A;  4DQ8 A;  5E84 A;  3HI0 A;  5KPZ A;  1NGI A;  3AGK A;  4GKK K;  4J8F A;  3V9Z A;  4OGE A;  2YX6 A;  2GWK A;  4BQZ A;  4CHP A;  4FJ7 A;  1LOT B;  1K8A O;  3J80 O;  4QCL A;  1P90 A;  3I8B A;  1BCM A;  3NAE A;  4CGI A;  2KW4 A;  1WSI A;  1ZBL A;  3DXM A;  2UUC K;  5HRS A;  3CF5 L;  4FZX C;  3QB0 A;  1BOT O;  1HNV A;  3DLK A;  1KAZ A;  4ZTF A;  2PYJ A;  4CZF A;  1Q81 O;  2B4J A;  3OYD A;  4KH5 A;  1QHT A;  2FBY A;  2QWR A;  1RTD A;  3C6H A;  3A5O C;  4K25 A;  3P38 A;  3J8A A;  5AQJ A;  1NK6 A;  4AF1 A;  2PYL A;  1CZ9 A;  3P39 A;  1DLO A;  3CCV N;  2HHU A;  4BDZ A;  2RN2 A;  1IKW A;  1YVU A;  4QOZ B;  3HVT A;  3TAR A;  4BQL A;  4Z4E A;  2GUP A;  5M1N A;  3F5T A;  5EVZ A;  3O9Q A;  4KAZ A;  2KZM A;  3M6G A;  3WQU A;  4CJP A;  3JSM A;  1KAX A;  4ID1 A;  1ILY A;  4HWI A;  2UYT A;  4KKO A;  1KRP A;  4F3T A;  2GUI A;  5JVH L;  3ZT3 A;  3VOV A;  4LY7 A;  1Z6R A;  2Q36 A;  4CZE A;  4RW8 A;  3ZET B;  3LZI A;  2YKN A;  1KVC A;  4AH9 A;  1NGG A;  3VA3 A;  4LFA K;  3ZX2 A;  2Z1G A;  4IFY A;  3VTI A;  1TK8 A;  2YKM A;  5GAE P;  2VGM A;  3KD5 E;  1TK0 A;  3QEX A;  3HST B;  3LL3 A;  5BN8 A;  3R1X A;  4DUZ K;  3AV9 A;  1U49 A;  1TV6 A;  4CIF A;  1J9A A;  4KI6 A;  1RT3 A;  3VEO A;  1ZBF A;  4LH4 A;  4B3M K;  2G8K A;  2G8H A;  1YF5 L;  1XHZ A;  3ISN C;  4FJK A;  2H3G X;  3CFR A;  2QM1 A;  5LL6 Z;  2O4G A;  1L5U A;  1XNQ K;  3O9U A;  3CCE N;  1OVY A;  2GEM A;  1NGA A;  3TAE A;  1JLF A;  3MXM A;  1H1V A;  4B3T K;  3I33 A;  3UIQ A;  4CK1 A;  4CEO A;  5AQH A;  4F8R A;  2HNZ A;  2ZE2 A;  3TSU A;  2D0A A;  4PQU A;  4CW7 B;  4M3X A;  3L2R A;  3TAN A;  3U6F A;  4DU4 A;  1LW2 A;  3A5L C;  4DF4 A;  4Q0B A;  1Y97 A;  2NRV A;  1S6P A;  3ZSX A;  4FWR A;  3NHG A;  3CCS N;  3MMV A;  3QEI A;  1C6V A;  3N4P A;  1K6Y A;  1MWK A;  1OH6 A;  1KLM A;  3OYC A;  4DU3 A;  3WXL A;  2HBL A;  4N56 A;  3LAN A;  1YAG A;  1QSS A;  3HRG A;  1WNS A;  4CZK A;  1F21 A;  1NK0 A;  4GV9 A;  1KVA A;  1SS6 A;  3VQC A;  3ZSW A;  5KRS A;  1D9F A;  4KI4 A;  3FZF A;  3ENB A;  1DT9 A;  4IJA A;  4K8Z A;  4KHW A;  3FFK B;  5F1X A;  3SAH A;  2DPN A;  3KZB A;  2F8T A;  3FZH A;  1NJY A;  1HPZ A;  3RVC A;  1U04 A;  1BA0 A;  1RT6 A;  3EEQ A;  3WUH A;  1S22 A;  4H5R A;  5AFU A;  4J2E A;  3PIO L;  4CJT A;  3HJF A;  3TAF A;  1EET A;  2Z1J A;  1X3M A;  3HP9 A;  2WTU A;  4HUF A;  5M1F A;  1VSD A;  2ASM A;  4JD2 B;  3L2U A;  1LV5 A;  4NLC A;  4CJE A;  1KC8 O;  4BR7 A;  2O8C A;  3CQY A;  2I7N A;  4N5S A;  5EOY A;  4FLW A;  3ENH A;  3LP1 A;  3F73 A;  2KHO A;  4JKG A;  1VSH A;  5CHI A;  3VQ9 A;  2YCH A;  4X66 K;  1JLE A;  4UY8 O;  4A5A A;  3O3F A;  2NRZ A;  1X9S A;  1NMD A;  1X3N A;  4YOX A;  3M8P A;  1NM1 A;  2F4V K;  2YNI A;  3A5M C;  1BIS A;  3IAY A;  1RDB A;  2IGI A;  4BR4 A;  3ULD A;  2CH5 A;  3DLE A;  4CJ3 A;  1X9M A;  1RT5 A;  4DG1 A;  4ICL A;  2P9N A;  1ATR A;  4CBX A;  4O0I A;  2A6A A;  3ATV A;  1W2B M;  1ZXO A;  1NGE A;  1YTA A;  4X65 K;  1JCG A;  2VWJ A;  4F4K A;  3O4Q A;  4BRM A;  4IOC L;  1U48 A;  4AHT A;  1HJR A;  5BRD A;  3LAL A;  3TSQ A;  1VSM A;  4EFH A;  3E1Y A;  4FOE A;  3C6A A;  4KHU A;  4BWM A;  2YJF A;  4GV6 A;  3GG4 A;  2WOM A;  4M42 A;  4DV6 K;  4CEB A;  3R6M A;  5BRF A;  1XI1 A;  1REV A;  3AVB A;  2P9P B;  3KHY A;  3VQ6 A;  4GKJ K;  4A5B A;  3RWU A;  5EX5 A;  3THY A;  4FW1 A;  1SAZ A;  5H1S Q;  4NLB A;  5AJ3 K;  3H46 O;  4MFB A;  1SKS A;  4CD3 A;  4CF0 A;  4B8C A;  3MDQ A;  4FJH A;  3KLI A;  3DOK A;  1ASU A;  4CJ4 A;  3CET A;  2IVP A;  5CZ1 A;  4FK4 A;  4QS9 A;  1GLJ O;  3R9P A;  5HBM A;  3KTQ A;  3H1Q A;  1S1U A;  4DTM A;  1YIJ N;  4BC2 A;  4CGG A;  1HR0 K;  3ZSY A;  3GOI A;  3V81 A;  4IG0 A;  2RKI A;  4DLG A;  1NK7 A;  4CES A;  3F9K A;  1VQK N;  4W5T A;  2P9L B;  2O8B B;  4LFB K;  1RDD A;  3EO3 A;  1RBV A;  1HYV A;  3AVL A;  4B9T A;  4PA1 A;  4CIG A;  5JLH A;  2Q0U A;  2YHY A;  4KFB A;  4JKA A;  4CCH A;  3BGR A;  2F8S A;  1FJG K;  3A2F A;  4KHP K;  3VN5 A;  4JN4 A;  1Q86 O;  2YI1 A;  4BY9 C;  1QZ5 A; 
#chains in the Genus database with same CATH homology
 5CZ2 A;  4F3O A;  4FCY A;  3HPH A;  4HUG A;  3LPT A;  1NOY A;  5HRO A;  2QKK A;  3SPY A;  4HUE A;  4IG3 A;  2IDO A;  4BDY A;  5HRN A;  1JLB A;  3DLH A;  1KTQ A;  4KV8 A;  2VG5 A;  1RBT A;  2YHA A;  3C94 A;  4C8M A;  3DOL A;  3H08 A;  1T03 A;  4M3T A;  2XY6 A;  4C8N A;  3K5O A;  4I7F A;  1QTM A;  4FJG A;  4KHS A;  2X6S A;  2E6M A;  1TKD A;  1LW0 A;  5FRN A;  1WAJ A;  4Z4H A;  3HPG A;  4ZHR A;  3KK1 A;  3U3Y A;  4KPY A;  2DFF A;  2G8I A;  2QKB A;  1NOZ A;  1TKT A;  4Z4F A;  1IKV A;  1LWC A;  4GVM A;  3NF8 A;  3IG1 A;  4DSF A;  2BGG A;  4CEZ A;  5JS1 A;  1RBU A;  3AO2 A;  1CZB A;  4J2D A;  1ZBI A;  1TKX A;  3U3G A;  1BIU A;  3OS2 A;  3LAM A;  1BIZ A;  3HYF A;  3OYL A;  4CFC A;  4DTO A;  4DFK A;  3SV3 A;  4DTU A;  4E0D A;  1SUQ A;  1TAU A;  4CED A;  2PZS A;  1JL1 A;  5CY4 A;  4CE9 A;  3K5N A;  3K5L A;  3MAQ A;  4FM2 A;  1ASW A;  1U4B A;  1NJW A;  2HHW A;  1JLQ A;  4EP5 A;  3HXM A;  4DSL A;  4F2S A;  3AO4 A;  3NH1 A;  4FJX A;  1SL0 A;  1FKO A;  3SJJ A;  1Q9X A;  5DMR A;  2X6N A;  3LP3 A;  3G0Z A;  4M3Z A;  4LH5 A;  2X78 A;  4DSK A;  2D0B A;  4B9N A;  3AA2 A;  4KTW A;  3QEP A;  4DSJ A;  3P83 D;  1KFD A;  3OS0 A;  3OYI A;  3ZT0 A;  3L2Q A;  2WON A;  3WNF A;  2ETJ A;  2Z1H A;  4O0J A;  3V9W A;  1WSF A;  3ZSO A;  3ZSV A;  3DYA A;  3V9X A;  2Z1I A;  2D5R A;  2DTU A;  4W5N A;  2HND A;  5FRO A;  3QLH A;  3VQ7 A;  4ELV A;  4CFD A;  3JYT A;  1TAQ A;  1LAV A;  1RT1 A;  3BDP A;  4CF9 A;  3VQ5 A;  1NK8 A;  5J2Q A;  4RW6 A;  4B9L A;  3P5J A;  4MQ3 A;  3CFO A;  3C95 A;  4CHQ A;  5J2P A;  4PY5 A;  3KIO A;  1WSE A;  5KRT A;  3ZSQ A;  2FBX A;  4E89 A;  1KSP A;  2HNY A;  4N76 A;  3OYM A;  1C0M A;  4E7L A;  1BQN A;  1JXB A;  2E4L A;  1JXE A;  1A5V A;  3TAB A;  4TSX A;  4M3R A;  2A1S A;  4GW6 A;  4I2Q A;  3LP0 A;  4DTN A;  1NKC A;  4ZTJ A;  4KHY A;  5D3G A;  1IH7 A;  1NKB A;  1ASV A;  1BL3 A;  3QIN A;  4YFU A;  1WSJ A;  4CJL A;  4NYN A;  1S9G A;  4CGD A;  2G8W A;  4CJK A;  4DWI A;  4KHN A;  4AHS A;  1B9D A;  3KLG A;  2IAJ A;  1JLA A;  1RCH A;  3CM6 A;  1UA0 A;  2DY4 A;  1VSK A;  4HCB A;  1R0A A;  4O4G A;  4KRE A;  3ZT4 A;  2FBV A;  1JLC A;  3MED A;  4AHC A;  3OYK A;  3V1R A;  4FLU A;  3QES A;  1T7P A;  4H4M A;  4DF8 A;  3SUO A;  3AVH A;  3NE6 A;  3KD1 E;  4FVM A;  1Z26 A;  3VQQ A;  4LSL A;  4DQS A;  4FW2 A;  3KKS A;  2EHG A;  3D45 A;  3SYZ A;  3AVK A;  3I0S A;  1SKW A;  4KTZ A;  4O55 A;  1IG9 A;  3ZCM A;  4FK2 A;  4H4O A;  3VQE A;  3TAP A;  4PWD A;  4C8K A;  3LWM A;  1B92 A;  4FLX A;  3EYZ A;  4DTP A;  3SQ2 A;  3TAQ A;  3SUN A;  4KRF A;  5I42 A;  1VSE A;  3MXI A;  1KLN A;  3RTV A;  4OGC A;  3HPO A;  1U47 A;  4FZY A;  1S1X A;  3VQP A;  4OKK A;  4JRQ A;  2W42 A;  1BGX T;  1QQC A;  2NUB A;  3OY9 A;  3RRG A;  5J2M A;  1QSY A;  3RR8 A;  4FJ9 A;  4NCB A;  1FKP A;  1VSJ A;  3AVJ A;  1WLJ A;  3LP2 A;  3WNE A;  5SWM A;  3T3F A;  4I9L A;  3SQ4 A;  3PY8 A;  3TAM A;  3OJS A;  2KFZ A;  1WSG A;  4M3U A;  2ITG A;  3MEG A;  1GOB A;  3V1Q A;  2XY5 A;  1G15 A;  1L3T A;  3RR7 A;  1RTH A;  4CF1 A;  3QNO A;  3V9Z A;  4E7J A;  1EKE A;  4OGE A;  1J54 A;  1TL1 A;  4E1M A;  4CHP A;  3D0P A;  3T19 A;  3LZJ A;  1NK4 A;  2OYQ A;  4E1N A;  4OPJ A;  4AHV A;  3KK3 A;  4FJ7 A;  1LWF A;  5C24 A;  2RF2 A;  3QIP A;  4QCL A;  2HHQ A;  2B6A A;  1ZBH A;  1BCM A;  3OYA A;  1VRT A;  2ATQ A;  5C25 A;  4FJM A;  4L8R B;  3NGY A;  3OYB A;  3M8Q A;  1UAX A;  3NAE A;  4CGI A;  1TGO A;  3KKR A;  1BI4 A;  4C8O A;  3M8S A;  3DM2 A;  2IC3 A;  3CYM A;  2KW4 A;  3L3V A;  1WSI A;  3V4I A;  1ZBL A;  2HHS A;  5HRS A;  2A1R A;  4F8R A;  3K58 A;  3ITH A;  3DMJ A;  2YNH A;  3LDS A;  4FZX C;  3NH2 A;  1S1V A;  1KVB A;  4OVL A;  1HNV A;  3V6D A;  3DLK A;  5E41 A;  2GV9 A;  4CK2 A;  3AO5 A;  1J5O A;  2ZQB A;  1RT4 A;  4CEA A;  4ZTF A;  2PYJ A;  3TR8 A;  2B4J A;  3I8D A;  3OYD A;  3KJV A;  2KFN A;  1QHT A;  2XHB A;  2X74 A;  2FBY A;  4CGH A;  5EU7 A;  4CJ5 A;  1ZYQ A;  1T8E A;  4OKE A;  3PX6 A;  1N5Y A;  1RTD A;  3NF9 A;  4E7I A;  4O5B A;  1IO2 A;  3L3U A;  3MEC A;  4IDK A;  2HVH A;  3O3G A;  1EXQ A;  4CJF A;  1NK6 A;  2PYL A;  4B9M A;  1CZ9 A;  3G10 A;  1DLO A;  5FDL A;  4H8K A;  5FRM A;  4JS4 A;  2HHU A;  4BDZ A;  5HRP A;  2RN2 A;  1IKW A;  4YNQ A;  3AO1 A;  1YVU A;  3AVF A;  4OPK A;  3HVT A;  3AVM A;  3TAR A;  1L3V A;  4QOZ B;  1C0T A;  4Z4E A;  3VA0 A;  2HB5 A;  2KZM A;  4DSE A;  4KAZ A;  4CJP A;  3JSM A;  3DRS A;  4ID1 A;  1S6Q A;  1Q9Y A;  2B5J A;  4HHT A;  4Z4C A;  1BQM A;  2OPR A;  4KKO A;  1KRP A;  4CIE A;  4F3T A;  3ASM A;  1CXQ A;  1TVR A;  2GUI A;  2DFE A;  4FJL A;  3ZT3 A;  4LY7 A;  2OZS A;  3P1G A;  4RW8 A;  1C1A A;  2BDP A;  3LZI A;  2YKN A;  3VQB A;  1KVC A;  4AH9 A;  1D9D A;  4KB0 A;  4BE2 A;  4I2P A;  4FLZ A;  3VA3 A;  3O4N A;  3LPU A;  1QS4 A;  2Z1G A;  4IFY A;  1TK8 A;  1DTQ A;  2YKM A;  2AJQ A;  4Y1C A;  4BAC A;  4CJS A;  1TK0 A;  3KD5 E;  3QEX A;  3V9S A;  1YT3 A;  4M41 A;  4B9S A;  2XRI A;  1RT7 A;  2YNF A;  3HST B;  2E6L A;  4AHR A;  4BE0 A;  3QET A;  3AV9 A;  1U49 A;  4K8X A;  4FK0 A;  2RPI A;  1LWE A;  4RW4 A;  1TV6 A;  4ID5 A;  3NBP A;  1C0U A;  2Q3S A;  1NJZ A;  4CIF A;  4CFB A;  3IS9 A;  1J9A A;  4KI6 A;  4CF2 A;  1HMV A;  1RT3 A;  2HHT A;  4CEQ A;  1ZBF A;  3ALY A;  3QO9 A;  3OVN A;  4LH4 A;  5SZT A;  1KFS A;  4DSI A;  4KTQ A;  4CER A;  4OLA A;  3MXJ A;  4JRP A;  1EX4 A;  2G8K A;  3C6T A;  2G8H A;  3THV A;  1XHZ A;  3ISN C;  4FJK A;  1CXU A;  2XO7 A;  3CFR A;  3E01 A;  4AIL C;  4E7K A;  3DLB A;  4FJ5 A;  1L5U A;  2O4G A;  3HT3 A;  3ZT2 A;  5HP1 A;  4E3S A;  4Z4I A;  5KI6 A;  4CGF A;  2VG7 A;  3TAE A;  1L3S A;  2P51 A;  5DK5 A;  3SV4 A;  1JLF A;  3NF6 A;  3MXM A;  4CF8 A;  3UIQ A;  3QEV A;  4CK1 A;  1WAF A;  4CEO A;  4FM0 A;  5J2N A;  2HNZ A;  2ZE2 A;  1QE1 A;  2D0A A;  3I0R A;  4NCA A;  4DFP A;  4M3X A;  4PQU A;  3L2R A;  3TAN A;  1Z25 A;  3U6F A;  4DU4 A;  1DTT A;  1LW2 A;  4E7H A;  4DF4 A;  4FJI A;  4Q0B A;  1Y97 A;  1S6P A;  3ZSX A;  2Y1J A;  3AVN A;  4KHQ A;  1VSL A;  3QEW A;  3NHG A;  3QEI A;  2BE2 A;  1C6V A;  4NYF A;  3HL8 A;  5JS2 A;  4W5R A;  3PV8 A;  1RDA A;  3OYN A;  1K6Y A;  4O44 A;  4PUO A;  4J2A A;  1KCF A;  1QSL A;  3RMB A;  1KLM A;  3OYC A;  4IFV A;  4DU3 A;  2P5O A;  4N56 A;  1I3A A;  1TL3 A;  3LAN A;  4GMJ B;  4RG8 A;  1QSS A;  3O3H A;  4CGJ A;  3HM9 A;  4DMN A;  2GBZ A;  1WNS A;  2OA8 A;  3K2P A;  4EZ6 A;  4KO0 A;  3PO4 A;  1BCO A;  4DFJ A;  4FJ8 A;  3SZ2 A;  3ZSR A;  3S3M A;  1F21 A;  3SUQ A;  1NK0 A;  1C1C A;  1KVA A;  3VQC A;  3LAK A;  4FJJ A;  2QK9 A;  3ZSW A;  5KRS A;  5KTQ A;  4B08 A;  1O1W A;  4CJR A;  1D9F A;  4KI4 A;  1BHL A;  2HW3 A;  2JGU A;  4CHO A;  1HNI A;  3AO3 A;  2G8V A;  2FC0 A;  3SPZ A;  4K8Z A;  3KLF A;  3SQ1 A;  4KHW A;  3CG7 A;  4EP4 A;  3RMC A;  4C8L A;  4B9U A;  4JLH A;  3CM5 A;  1EP4 A;  2F8T A;  4F2R A;  5HLF A;  3RMA A;  3S3N A;  1HPZ A;  1NJY A;  1U04 A;  3ZSZ A;  1RT6 A;  3LWL A;  3S9H A;  3SI6 A;  2EX3 A;  4CHY A;  2P5G A;  4J2B A;  4J2E A;  3HO1 A;  3AVA A;  4CJT A;  4HTU A;  3TAF A;  1RNH A;  1EET A;  2XY8 A;  2Z1J A;  3HP9 A;  3HJF A;  3K57 A;  4HUF A;  4CHZ A;  4DQR A;  4EZ9 A;  2HVI A;  1NK9 A;  1VSD A;  3L2V A;  3L2U A;  2VG6 A;  3K5M A;  1LV5 A;  2YV0 X;  4FJN A;  4CJE A;  4M45 A;  3OYG A;  2OPP A;  4N5S A;  5KGW A;  3NF7 A;  4BDP A;  4FLW A;  3QNN A;  3LP1 A;  1WSH A;  1XWL A;  3NCI A;  5CYQ A;  1UWB A;  3F73 A;  1VSH A;  3RRH A;  3PO5 A;  3VQ9 A;  1HYS A;  2KTQ A;  3NH0 A;  1I39 A;  1Q8I A;  2IS3 A;  5KGX A;  4Q5V A;  3AVC A;  2OPS A;  1T05 A;  3OYF A;  1JLE A;  2DFH A;  3O3F A;  3QIO A;  1X9S A;  1UOC A;  1JKH A;  3PX4 A;  1RBR A;  1GOA A;  4DTX A;  2YNG A;  3M8P A;  3DRP A;  3SUP A;  3TWH A;  4DFM A;  1N6Q A;  2YNI A;  2XY7 A;  1BIS A;  3IAY A;  1MU2 A;  4DQI A;  1RDB A;  3HK2 A;  4I9Q A;  2IGI A;  1L3U A;  2G8F A;  1A5W A;  3OJU A;  4W5Q A;  3B6P A;  3ULD A;  2OZM A;  1W9H A;  3DLE A;  1ITG A;  3B6O A;  4CJ3 A;  4ELT A;  1X9M A;  1RT5 A;  4G1Q A;  1ZBU A;  4CEC A;  4DG1 A;  4ICL A;  5K14 A;  1RT2 A;  2D0C A;  3HP6 A;  3AA4 A;  4FLY A;  4Z4G A;  4O0I A;  1B9F A;  3ZT1 A;  3OYH A;  2R7Y A;  1HYZ A;  4CEF A;  3KK2 A;  4FXD A;  1YTA A;  3OYJ A;  3IRX A;  4CFA A;  3SQ0 A;  1UA1 A;  1NJX A;  3RMD A;  4W5O A;  2VWJ A;  1J53 A;  3PX0 A;  2HHV A;  3QER A;  4OLB A;  1YTU A;  4F4K A;  3O4Q A;  3HVR A;  4JS5 A;  3C6U A;  4FZZ A;  3FFI A;  3V1O A;  1U48 A;  3DI6 A;  4OKJ A;  4AHT A;  1GOC A;  4UQG A;  1U45 A;  1HJR A;  3TI0 A;  4HCC A;  3DLG A;  3DLR A;  3LAL A;  4FLV A;  2O4I A;  1S1T A;  4WE1 A;  1VSM A;  3OS1 A;  4IKF A;  4CJV A;  2LSN A;  1LAW A;  3AVG A;  3K59 A;  5CYM A;  4KHU A;  1S5J A;  3NFA A;  4BWM A;  3EZ5 A;  2Y1I A;  3L8B A;  2HHX A;  3WNH A;  2WOM A;  4NCG A;  2IOC A;  2JLE A;  3VQA A;  4Y1D A;  4IBN A;  4BE1 A;  3AVI A;  1A5X A;  1X9W A;  1NK5 A;  4M42 A;  1S9E A;  4CEB A;  1RTI A;  1XI1 A;  1W0H A;  1REV A;  3AVB A;  3VQ6 A;  3NGI A;  1D8Y A;  4M3Y A;  2G8U A;  5T7B A;  4R5P A;  3RWU A;  4LSN A;  4B9V A;  4AHU A;  1JL2 A;  1FK9 A;  3WNG A;  3V9U A;  2ZD1 A;  3MEE A;  4FW1 A;  3CQ8 A;  1VRU A;  4BWJ A;  2FBT A;  4CJU A;  4CJQ A;  1IKY A;  1HQU A;  1SV5 A;  1VSI A;  2F96 A;  5J1E A;  3TAG A;  3SNN A;  4FYD A;  4CEE A;  4MFB A;  4DU1 A;  1SKS A;  4CF0 A;  3VQ4 A;  4B8C A;  2KQ2 A;  5C42 A;  4CK3 A;  1S1W A;  1SKR A;  4M3W A;  1C1B A;  4FJH A;  3NDK A;  4FM1 A;  1X1P A;  2P1J A;  1TK5 A;  1TKZ A;  5I3U A;  3L2W A;  3KLI A;  3DOK A;  1ASU A;  4Z0U A;  4CJ4 A;  3S3O A;  1HRH A;  3PUF A;  3CFP A;  3OYE A;  1VSF A;  3DRR A;  5CZ1 A;  4E19 A;  3KLH A;  4ELU A;  4KB1 A;  4FK4 A;  1FXX A;  5HBM A;  3VQ8 A;  4XIU A;  1S1U A;  3SCX A;  3KTQ A;  4OJR A;  4DTM A;  2I5J A;  4HVJ A;  4DTJ A;  2VWK A;  2HMI A;  4DQP A;  4RW7 A;  4CGG A;  4B8A B;  3M8R A;  3EY1 A;  4DS5 A;  3ZSY A;  1RBS A;  1XHX A;  1SL1 A;  1RTJ A;  2BAN A;  3AA5 X;  3V81 A;  4IG0 A;  5HRR A;  2RKI A;  4CHN A;  4DLG A;  1NK7 A;  1RIL A;  4CES A;  3F9K A;  1BI4 B;  4N47 A;  4W5T A;  1RDD A;  4DTS A;  1RBV A;  3T1A A;  1HYV A;  2OPQ A;  3AVL A;  4B9T A;  4PA1 A;  4CJW A;  4CIG A;  1NKE A;  2KZZ A;  4RW9 A;  4N41 A;  2PY5 A;  3KLE A;  4KFB A;  1RDC A;  4LD0 A;  4CCH A;  1CLQ A;  1HQE A;  1WN7 A;  4DLE A;  3AA3 A;  2YHB A;  2QXF A;  3BGR A;  1D5A A;  4DS4 A;  2F8S A;  1JLG A;  3A2F A;  3NGZ A;  4DTR A;  4DQQ A;  3VN5 A;  1XC9 A;  1IKX A;  4QAG A;  4B3O A;  3VQD A;  4FLT A;  1VK0 A;  1SL2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...