4AHVA

Parallel screening of a low molecular weight compound library: do differences in methodology affect hit identification
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
153
structure length
149
Chain Sequence
b'SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Parallel Screening of Low Molecular Weight Fragment Libraries: Do Differences in Methodology Affect Hit Identification?
pubmed doi rcsb
source organism Human immunodeficiency virus
molecule tags Transferase
total genus 58
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ahvA00
1CZBA 4CEDA 3LANA 4RW8A 2DFHA 4IKFA 4BDZA 2HVHA 1S1XA 1TL3A 3HPHA 1YTAA 5HRNA 4CJEA 4N76A 3KKSA 3NH0A 1LAVA 2QXFA 2E4LA 2Q3SA 4K8XA 3D0PA 4F8RA 4N41A 3OYLA 4FM0A 5JS1A 5J2PA 3L8BA 1BGXT 3HK2A 4PWDA 3NAEA 1HYZA 2D5RA 3G0ZA 4YNQA 1Q8IA 3OYDA 3AO3A 3NHGA 1BL3A 3AVHA 4OJRA 3LZJA 1QSSA 3TABA 4DQPA 3RMDA 3TAMA 2O4GA 4BWMA 4AHUA 3V6DA 3S9HA 4NCBA 4M42A 4M3TA 3ZSVA 1RBTA 4B8CA 1UA1A 1WSJA 3QLHA 4CK1A 1RT6A 5CYQA 2P5GA 1SV5A 3VQ7A 3ZT0A 2DFFA 4I2QA 3TAGA 1DTTA 1NK5A 4O5BA 3HT3A 4RW7A 4W5QA 4J2BA 1C0UA 3OYHA 3U3YA 1Q9YA 1SKRA 4FW1A 4ZHRA 4HUFA 1NK7A 1DLOA 3CFPA 1CZ9A 4O55A 3NF7A 4DSFA 1NKCA 4FZXC 1KCFA 4KTZA 4E89A 1VSEA 3SQ2A 2DTUA 3LP2A 1S5JA 3K5LA 1JL1A 5J2NA 2QKKA 2ATQA 4FK2A 5JS2A 2RKIA 4LH4A 1TKTA 1WSGA 2A1SA 1BIZA 3DOLA 3G10A 4ELVA 2Z1IA 3C6UA 1UWBA 3VQEA 1YT3A 3T1AA 3VQ6A 1IO2A 1C1CA 2GV9A 2PYLA 4C8NA 3QNNA 3DLHA 4WE1A 1TK5A 3HVRA 4AHSA 1T05A 2HMIA 2G8FA 4DTUA 4BE1A 3AVAA 4KHQA 2VG6A 3TANA 2X78A 3KTQA 4FLZA 1VSFA 3HPGA 4CERA 4LSLA 4NCGA 3VQQA 3OYIA 4QOZB 4KRFA 1BCOA 2VG7A 4CF0A 3OYFA 2XY7A 4CIFA 1D8YA 1RDAA 4C8OA 4FJ7A 4OGEA 3CG7A 4RW9A 4OLAA 1JXBA 4CF2A 4FVMA 3K58A 4FJLA 4IG3A 3HP6A 4JRQA 4FJIA 3OYMA 2G8UA 4FJMA 1KVBA 1NK8A 2XY6A 2QK9A 1U45A 2IGIA 3RMBA 4DFPA 3K59A 4W5OA 3DLEA 3QO9A 1LW0A 3KJVA 3TAQA 3CM6A 4FLUA 4OPKA 2OPRA 3RRHA 4O4GA 1X9WA 3E01A 4CGGA 2VWKA 3MXJA 4DQQA 4Y1CA 5KRSA 3V9UA 4J2EA 1NJYA 3TAPA 3QIPA 2FBYA 5CZ1A 5DMRA 3NH2A 4JS5A 4TSXA 3OYAA 2HNYA 5I3UA 4FM2A 2VG5A 3P83D 1TK8A 2OYQA 4CK3A 3JYTA 4AILC 5CZ2A 2ETJA 1NJZA 2X6SA 4DQRA 4KHUA 3C95A 4FW2A 3OJUA 3KLFA 1REVA 2O4IA 1J5OA 3OVNA 3V9ZA 3LALA 4EP5A 4CEEA 3QNOA 4OKJA 3HVTA 3KKRA 3U3GA 4Z4HA 3MAQA 3AVLA 2YNIA 4ZTFA 3RWUA 1FXXA 4G1QA 4Z0UA 4M3YA 1JLFA 1D9FA 1IKYA 1KFDA 4M3RA 2Z1GA 3CQ8A 4O0JA 2HNZA 1C6VA 3I0RA 2LSNA 5KI6A 1CXQA 1KVAA 1B9FA 3SUNA 2OZMA 3AO1A 3AA5X 1ASVA 4FLTA 2G8KA 3AO5A 4Z4IA 3HYFA 4CJVA 4FJKA 4Z4FA 3CFOA 3SQ1A 3ZCMA 1ZBIA 1RBRA 4E1MA 3NDKA 5KGWA 3DOKA 1TV6A 1IKVA 1QQCA 1KSPA 3D45A 4IFYA 3SPYA 4EZ6A 3OS2A 1KRPA 4CFCA 3JSMA 2KQ2A 2XO7A 3ZSQA 2D0CA 3QEIA 2YNFA 4RW4A 4BWJA 2GUIA 2IC3A 3HPOA 4FLXA 2FC0A 3L2WA 1ZBUA 3HXMA 3HO1A 4JS4A 1TKXA 4J2AA 4KI4A 4B3OA 3NF8A 4OLBA 1UAXA 3AA3A 4Q5VA 4FJGA 1I39A 1G15A 4CGFA 3MXIA 1ZBHA 4F3OA 2HHXA 4DTJA 1GOBA 3M8QA 2BE2A 4KHNA 2YV0X 3HP9A 1QE1A 1O1WA 5EU7A 3L2RA 1RTJA 1L3UA 1VSHA 1FK9A 4CE9A 1S9EA 4KHWA 3AVJA 4DSIA 2PY5A 1TKZA 2E6LA 3SPZA 1VSKA 5T7BA 4CGDA 4DLGA 3AA2A 4L8RB 3IAYA 3OYNA 2RN2A 3AVMA 3PX0A 1U47A 4N5SA 3UIQA 5D3GA 3O3FA 4Z4GA 3OYBA 1W0HA 3K5OA 1SKWA 1L3VA 1GOCA 1WSFA 3EYZA 1BCMA 3S3OA 4QCLA 4CF8A 1RTHA 4O0IA 4CGJA 3EY1A 4Z4CA 4JRPA 1XI1A 2P1JA 4HHTA 5KGXA 1HPZA 4NYNA 1S1VA 3K5MA 5FDLA 3B6PA 3HSTB 4DSEA 3RMAA 1IKXA 1SKSA 1TKDA 4CHQA 1HYVA 3RR7A 4K8ZA 3QERA 1J9AA 4J2DA 3U6FA 1WN7A 3OJSA 2IAJA 4OGCA 1WSIA 3KLGA 3ZT1A 1RNHA 1U49A 4HCCA 1T7PA 1Z26A 2BGGA 5FROA 4YFUA 4GVMA 2G8VA 3M8RA 5FRNA 3LPUA 1NOYA 4GW6A 3VA3A 4CEOA 1L5UA 5DK5A 3PO5A 1QS4A 1WAFA 1EX4A 2XY8A 1KFSA 3QIOA 1B9DA 4OKKA 1QSYA 1D9DA 5C42A 3O3GA 1NK6A 1Z25A 3S3MA 1JLEA 3AA4A 3KD1E 4KHYA 4E7HA 1LV5A 1RTIA 3B6OA 4W5RA 4EP4A 4E1NA 4OPJA 4BDPA 1FKOA 1LW2A 1NK0A 3RRGA 1BQNA 1JLCA 3V1RA 2G8HA 4ICLA 2KFNA 1NK9A 2HHSA 1C0TA 1WSHA 3LP3A 4CIEA 4W5NA 1RT7A 5J2QA 2FBTA 3L2UA 2AJQA 1U4BA 4FZZA 2F8SA 1C1BA 3OYJA 1XC9A 5SZTA 1NKBA 3LP1A 3ZSWA 4F4KA 3V1QA 4DF4A 1VRUA 4KB0A 5FRMA 3NGZA 4N56A 2JGUA 3HL8A 4AHTA 3NF6A 4KI6A 1S9GA 2HHVA 4FCYA 1ITGA 4OKEA 3TAFA 3M8SA 3VQCA 3BDPA 4H4MA 4CHOA 2WOMA 4ELUA 3LPTA 3MEGA 4N47A 3OS1A 4DF8A 4DFKA 4E7KA 2A1RA 4W5TA 4DSKA 4B9NA 2B5JA 2OPPA 4DQSA 3SNNA 4CJSA 3H08A 4O44A 4CEBA 5CYMA 4QAGA 1YVUA 2ZD1A 3NFAA 1SUQA 4M3ZA 3ITHA 2P5OA 4HVJA 3OS0A 2OPQA 1EKEA 4KTWA 3DI6A 5HRRA 4DTXA 3OYEA 2XY5A 1F21A 1BISA 4PA1A 3DRRA 1WNSA 1JLAA 4E7JA 1RT5A 4E19A 4AHRA 4CEFA 1LWCA 3ZT4A 3KK1A 3OY9A 4E7LA 2KZMA 2VWJA 3TR8A 4R5PA 3DRPA 1TAQA 3AO2A 1IKWA 3NGYA 3IRXA 3SZ2A 3BGRA 4I9QA 3DM2A 3TWHA 1TVRA 1RILA 1D5AA 3ZT2A 1RT1A 1VSDA 1ZYQA 1ZBFA 1BI4A 5J2MA 4B9LA 2Z1HA 3V9SA 3M8PA 3AVFA 1ASWA 1TAUA 2BDPA 2FBVA 1C1AA 3NH1A 4B9MA 1KLMA 4CJUA 4CIGA 1S1TA 4FK4A 3I0SA 4CJTA 4BDYA 3V81A 4HCBA 2PYJA 4FJ9A 2G8IA 3WNGA 3V1OA 4CJFA 4FLVA 4KV8A 4DMNA 3V4IA 1SL1A 4CECA 3OYGA 2HW3A 2HVIA 2ZE2A 3CYMA 1TL1A 3QEXA 4ZTJA 4FK0A 4FJ8A 3RR8A 1CLQA 1RDCA 2OA8A 5K14A 2XHBA 4M45A 4PY5A 1UA0A 2F96A 4CFAA 4CHZA 3MEDA 3QESA 4KREA 2HB5A 3C6TA 3OYKA 4CJWA 1QHTA 3KK3A 3L2VA 3F73A 4XIUA 4DTSA 1RT3A 1NK4A 2EHGA 4H4OA 4JLHA 4I7FA 4DU1A 4F2SA 1T8EA 3ULDA 1X1PA 1S6PA 3ALYA 4DU4A 3KLEA 3O4QA 4CEZA 4F2RA 1VSJA 1VSLA 3MECA 1JLGA 2B6AA 4GMJB 3SQ4A 3AO4A 3LAKA 3TAEA 5C25A 2YKMA 3DLKA 5C24A 4PUOA 5HRSA 1SL2A 1HNIA 1S1UA 3DLGA 3VQBA 4FLYA 4I2PA 1J54A 3PX6A 3AVIA 4DTRA 3AVBA 4AH9A 3I8DA 2IS3A 4UQGA 4FYDA 4DG1A 1X9SA 4DSJA 2HHUA 1K6YA 4FJJA 4CF9A 5J1EA 4DTNA 1X9MA 3LP0A 2EX3A 4BE2A 4FLWA 2XRIA 1VSIA 3K2PA 1ZBLA 3SI6A 2ITGA 1VK0A 3AV9A 2HHQA 5HRPA 5HLFA 3MEEA 3ZSYA 3KLHA 1N5YA 4I9LA 1QSLA 4EZ9A 1A5VA 3SV4A 1JLBA 2YHAA 3LWLA 3EZ5A 3MXMA 4B9SA 1BHLA 1IH7A 4RW6A 4CGHA 4E3SA 1XHXA 1WAJA 3A2FA 1XHZA 4Z4EA 4CJ4A 3DMJA 1NKEA 1JL2A 3VN5A 5KTQA 2IDOA 1FKPA 2YKNA 3VQPA 5I42A 4C8KA 1GOAA 3VA0A 2OZSA 1J53A 3V9WA 3DLBA 3QINA 4CJLA 4DSLA 3TARA 1HNVA 1BIUA 2D0AA 2FBXA 2YNGA 4CF1A 4CFBA 3LWMA 4CESA 4PQUA 4CEQA 1TGOA 1B92A 1WSEA 3ZSXA 4CJKA 4FJ5A 1BQMA 4AHCA 3K5NA 2HNDA 3SCXA 4IDKA 3CFRA 3WNEA 2JLEA 5SWMA 1RT2A 2HHWA 4CK2A 4M3XA 1KTQA 4FJXA 2PZSA 4DTOA 3HJFA 2OPSA 3QETA 1CXUA 4BE0A 4CJQA 3NE6A 4NCAA 1NJXA 4DQIA 1VSMA 3VQAA 3IS9A 1RCHA 3LZIA 2IOCA 3PV8A 3RMCA 3NBPA 3THVA 2KFZA 3VQ8A 4C8MA 4M41A 3O3HA 3SJJA 4FZYA 2DY4A 1LAWA 3DRSA 4HUEA 4DLEA 3QEPA 4KFBA 1RDBA 2X74A 3L2QA 1Q9XA 4FJHA 3T19A 3LDSA 3VQDA 4FJNA 3AVGA 4NYFA 5KRTA 3PO4A 2X6NA 3SYZA 5HP1A 1ASUA 3V9XA 1QTMA 4B08A 3KD5E 4FM1A 3AVCA 4HTUA 4RG8A 1EXQA 1JXEA 3DYAA 3CM5A 3LAMA 3P5JA 4CJRA 4M3UA 3ZSOA 2RPIA 1EP4A 4F3TA 4IFVA 1UOCA 3L3UA 4AHVA 2R7YA 2KW4A 1EETA 1LWFA 1MU2A 3VQ5A 4KB1A 1S1WA 1N6QA 3NCIA 4H8KA 4M3WA 1RTDA 1SL0A 3QEWA 2DFEA 1JKHA 1RT4A 3ASMA 2BANA 3S3NA 3C94A 3SUQA 1LWEA 1L3SA 4C8LA 2QKBA 3ISNC 2E6MA 1WLJA 4IG0A 3SUPA 1TK0A 1NJWA 4LD0A 4KTQA 2I5JA 4DU3A 3K57A 4KAZA 4DWIA 5CY4A 3OYCA 1R0AA 4CJ3A 4DFJA 3AVKA 3ZT3A 3WNHA 1HQEA 1A5XA 3SV3A 4B9VA 1JLQA 4CCHA 3DLRA 4B8AB 4DTMA 2ZQBA 3WNFA 4FXDA 2KTQA 2NUBA 1Y97A 5E41A 4OVLA 2Y1JA 2D0BA 1HMVA 3HM9A 4DS5A 4HUGA 4Q0BA 2G8WA 4B9UA 3QEVA 2W42A 4LY7A 2HHTA 3KLIA 4CFDA 1HYSA 4CGIA 4LSNA 3NGIA 3PUFA 2GBZA 4E0DA 5HBMA 4CHYA 3TI0A 1YTUA 4KPYA 4CJPA 3VQ4A 4Y1DA 4DS4A 2Z1JA 3SQ0A 1T03A 1A5WA 1HQUA 2YNHA 4IBNA 3NF9A 1RBSA 1BI4B 3FFIA 4MFBA 1L3TA 5HROA 1HRHA 2RF2A 3PX4A 1DTQA 3P1GA 3T3FA 3VQ9A 4B9TA 3PY8A 4ID5A 4KHSA 4CEAA 2P51A 1W9HA 1KVCA 4ELTA 4CHNA 3AVNA 3KIOA 3ZSZA 1U48A 1U04A 4ID1A 2Y1IA 4LH5A 1KLNA 1IG9A 1XWLA 1S6QA 2B4JA 3ZSRA 2F8TA 3IG1A 2KZZA 1C0MA 2WONA 3O4NA 4DFMA 3SUOA 1NOZA 1VRTA 3RTVA 1RBVA 1RBUA 1RDDA 4MQ3A 4DTPA 4CHPA 3L3VA 4E7IA 3F9KA 1HJRA 4BACA 4KO0A 4KKOA 1I3AA 2YHBA 4CJ5A 3KK2A
chains in the Genus database with same CATH superfamily
1NG9A 4G9ZA 3HBTA 5BPMA 5BREA 2E5LK 2QXFA 1N8RO 2HSTA 3D0PA 5J2PA 4FWOA 3L8BA 1BGXT 3HK2A 2VWBA 3G0ZA 5AZJB 3LDOA 3F2KA 3E9PA 1NGBA 5EXWA 3TABA 3RMDA 3TAMA 2O4GA 3V6DA 4DV1K 1RDUA 3O9QA 4M3TA 5JICA 4B8CA 1RT6A 4M7XA 4ISFA 1DTTA 3TAGA 1NK5A 4CBXA 4W5QA 4J2BA 1Z05A 3D2FB 5M1OA 5GAGP 1SKRA 4ZHRA 1NK7A 4B1ZA 3TTDA 4O55A 1GLLO 4FPBA 3J80O 4OO1J 4E89A 3FGUA 1KAXA 1S5JA 3K5LA 2A1SA 3DOLA 2QTDA 3E9LA 3VQ6A 3DLHA 5AQWA 3QNNA 4WE1A 3HVRA 4AHSA 2HMIA 2EWSA 2VG6A 3TANA 4H5RA 5C0YA 3DAWA 3HPGA 4NCGA 4NXMK 3VQQA 4QOZB 2VG7A 4C8OA 3OYFA 2XY7A 4CIFA 1XUPO 4WFBL 4FJLA 3MCPA 4JRQA 1EQYA 2YHWA 5AQFA 3CJ9A 4W5OA 3RRHA 4OPKA 2OPRA 3E66A 4FWSA 4O4GA 2P9KA 5AQXA 3THWB 2YCHA 4PKIA 1HPMA 3TAPA 3QIPA 2FBYA 4ILGB 3KZBA 2HNYA 3C65A 4AILC 3TSUA 3ULEB 2O8BB 2ZGYA 2CH5A 5BRDA 3V9ZA 3LALA 2Q36A 1BU6O 4Z4HA 3RWUA 2P9SA 5KQDA 3H46O 4BC4A 2NRVA 3O4WA 3CERA 4A5BA 3CQ8A 2HNZA 4IOAL 2ZWHA 3SUNA 2NRXA 1B9FA 5ELZA 4A61A 4FLTA 1BA0A 4BR2A 3HYFA 1RFQA 4KH4A 4I6MA 3CFOA 1RBRA 2NZTA 3NDKA 4KH5A 1NWKA 1KSPA 3OS2A 4CFCA 3JSMA 5DM7L 4KH6A 4O8UA 2IC3A 3HPOA 1MWKA 3HXMA 5LJWA 1ZBUA 4FLXA 3HO1A 4KI4A 1HKBA 4B3OA 1UAXA 2FXUA 2I7NA 1GOBA 3M8QA 2BE2A 4FOIA 4KHNA 2YV0X 1O1WA 5EU7A 1XNRK 2IIRA 3LM9A 1RTJA 3L0QA 2GTDA 1L3UA 1FK9A 1Q82O 1E4FT 3H1QA 3DLLL 4JI6K 5KPRA 1D4XA 3VF2A 3F9MA 2E6LA 3SPZA 3UIQA 3EYZA 4CF8A 1RTHA 4O0IA 4CGJA 1J5EK 4BRQA 3K5MA 1YXQA 4OPHA 5FDLA 3TTFA 4CHQA 3ENOA 3U6FA 3NMUA 2FSNA 3LDQA 4BR9A 5BR9A 1HKCA 2D0PA 2A41A 4B3RK 1WSIA 3KLGA 1U49A 5C2DA 4JI8K 1Z26A 3ZYYX 2BGGA 5FROA 4B1UB 3VA3A 3VEZA 3CXCM 3H3OB 3LDNA 1KFSA 2GEMA 2FSJA 3JAMO 3O3GA 2ASMA 1NK6A 2DTUA 1T44A 1RTIA 4W5RA 1KC8O 3HTVA 5GAEP 4K25A 3P39A 3VERA 1C0TA 4W5NA 5J2QA 2W41A 4FZZA 2CGJA 3ZSWA 4JKBA 5GADP 2JGUA 3HL8A 3NF6A 4KI6A 1S9GA 4FCYA 5DM6L 1ITGA 5M1FA 3TAFA 3BDPA 4H4MA 4CHOA 4N47A 4DFKA 3OBWA 3CD6N 3MK6A 1YAGA 4CJSA 3L6QA 4YOXA 3VEWA 4BROA 1YVUA 1SUQA 1OH7A 3LDLA 3LDPA 3MN6A 3OYEA 4PA1A 4DCHA 3THYA 2P9KB 4E7JA 4CEFA 4E1JA 4ISEA 2GUPA 3TR8A 4R5PA 1IKWA 3IRXA 3BGRA 1RILA 4EFHA 2P9IA 4H5WA 5I9EB 1D5AA 1ZYQA 1C0FA 4B9LA 2P9NA 2P9SB 4JEPA 1KLMA 4CJUA 4FK4A 2NRZA 3HM8A 2G8IA 3V1OA 4BC2A 3V4IA 4DMNA 4DHYA 3WQTA 5AQQA 1Q81O 3SLCA 3VEOA 2HW3A 4JKDA 1TL1A 3QEXA 1YITN 4I6MB 5FPMA 1QHAA 4JK9A 4FO0A 5K14A 3O5BA 3CETA 2WBNA 5BR8K 4PY5A 3QFUA 3L2VA 3OYKA 3F73A 4DTSA 1NK4A 5H1SQ 1RT3A 4H4OA 4FVUA 1I94K 3ULDA 2YHYA 3KLEA 3O4QA 3D2EA 3MECA 4JKAA 3UB5A 3AO4A 3LAKA 3TAEA 1HX1A 3CJCA 2YJEA 3G25A 4PUOA 1FJGK 2RHKA 3VQBA 1J54A 4AH9A 4IEEA 1X9SA 3SBTA 1K6YA 4DTNA 3GE1A 4EHTA 3LP0A 3K2PA 2A40A 2E8AA 3SI6A 2HHQA 5HRPA 3CCVN 4DB3A 3RSEA 3LWLA 2NRRA 2A6AA 1BHLA 4E3SA 3A2FA 3DMJA 1JL2A 4GKKK 3VN5A 5I42A 3VA0A 3CCQN 1J53A 3V9WA 3QINA 4CJLA 4DSLA 2WC9A 3M6GA 4OX9K 4MLHA 4CESA 4CEQA 1ILYA 3CHWA 4CJKA 4FJ5A 3K5NA 3SCXA 5TKWA 5FPDA 4X65K 3WNEA 2CGKA 4H0OA 3AAPA 3HJFA 1CXUA 3U9ZA 4B3MK 3R6MA 4DQIA 5C10A 3LZIA 4DV5K 3PV8A 3NBPA 2KFZA 2HF4A 3C0BA 1LAWA 3QEPA 3DXKA 3J81O 4FJHA 5AQTA 2QWPA 4FJNA 3H3NO 5KRTA 5F1XA 3CPEA 1ASUA 4YOUA 5BRHA 4FM1A 3ENBA 2I7PA 4RG8A 4CJRA 3P5JA 3ZSOA 5KPTA 1EP4A 2O8CA 1EETA 2QW9A 3VQ5A 1FW6A 4H8KA 3QEWA 3HI0A 2BANA 4JI2K 1Y64A 1LWEA 2E6MA 1QQNA 4LD0A 3W0LA 3EN9A 4DU3A 5AQYA 3VENA 3CCUN 4CJ3A 3H6EA 3ZT3A 3WNHA 4B9VA 1A5XA 4FXDA 3BUZB 3WNFA 3ZEUA 3THYB 4RCHA 2W6LA 1BUPA 4WFAL 4FWNA 2ASOA 3HM9A 2ZM6K 4BQZA 4Q0BA 3QEVA 2W42A 4OPAA 1ZXOA 4CGIA 1YTUA 1A5WA 5E26A 4IBNA 5CR4A 2P9NB 2RF2A 4YHHK 3P1GA 4JKGA 2Q0UA 5KQ8A 4ID1A 2Y1IA 4IEIA 2F8TA 3ZSRA 1S6QA 1S22A 2KZZA 4AF1A 1YI2N 3RTVA 3SJHA 1RBUA 3OA9A 4JI5K 4H03B 4CHPA 2O8EA 1HJRA 4KO0A 1J6ZA 1HQEA 3KK2A 1K73O 1CZBA 4CEDA 2BUPA 3LANA 2DFHA 4BDZA 5AQSA 4N76A 3KKSA 3NH0A 1LAVA 3D2EB 1WBDA 2Q3SA 1BA1A 4K8XA 4F8RA 1GLDG 4LF5K 3OBYA 5JS1A 2BH1A 4DV4K 1TYQA 2NLXA 4YNQA 5ADXH 3KWGA 1BL3A 3AVHA 4CZIA 3LZJA 3M1FA 3S9HA 1ATNA 4BWMA 4AHUA 4NCBA 4M42A 1VQNN 5CYQA 1SV5A 2DFFA 4I2QA 3ZX3A 1NJIO 3O9TA 3A5LC 3OYHA 4O8KA 3CFPA 4KHPK 3RSEB 1NKCA 1VQ8N 1KCFA 3SQ2A 3PSIA 5AQLA 5CHIA 3PIOL 2RKIA 4BVPA 4ELVA 3FZMA 3VQEA 1YT3A 3HZ6A 3T1AA 2IVOA 4C8NA 1TK5A 1KD1O 2HBLA 4IWVA 3SBGA 2G8FA 4DTUA 4BE1A 4BRCA 1EO1A 4MLEA 2X78A 4A62A 4YORA 3R1XA 2PAVA 4RW9A 2A42A 4IG3A 4FWPA 4FJIA 3OYMA 3DXKB 1KVBA 5AQHA 1YJNN 3EKSA 2IGIA 2IVPA 4DFPA 3K59A 3DLEA 1NGEA 1X9WA 3MXJA 4DQQA 3QBXA 4Y1CA 3SMSA 5DMRA 4JS5A 3PLAA 3P83D 4CK3A 3ATVA 2GWJA 5CZ2A 5FLXO 3F5TA 2KLAA 1RGIA 2X6SA 1VQ9N 2O4IA 1J5OA 4IJNA 5AQPA 1T6DA 4JHDB 3HVTA 3KKRA 1Z6RA 3D6RA 5AQNA 3AVLA 3U3GA 1FXXA 1IKYA 4M3RA 1E4GT 2VYPA 2KTQA 4YOVA 3ZEUB 4FJKA 4DUZK 3CC7N 4Z4FA 1T6CA 1BDGA 5KGWA 1NNEA 1IKVA 1QQCA 3D45A 4IZ9A 3SPYA 4GKJK 2KQ2A 3ZSQA 5C2FA 5A2QO 4JI3K 3Q7BA 1OH6A 4JS4A 1TKXA 4J2AA 4JI4K 1VQ4N 1HUXA 3AA3A 3MXIA 1ZBHA 5BN8A 4CE9A 3FZFA 4LF8K 3E9OA 4B1XB 2JWKA 2PY5A 1R59O 5HL7L 3GG4A 4CGDA 2O8EB 5M1PA 3AA2A 3AAQA 5AFUH 3PX0A 2J4RA 1W0HA 1GOCA 1WSFA 2PBDA 1XI1A 4Z4CA 5KGXA 1HPZA 4NYNA 1D9DA 3B6PA 3HSTB 4DSEA 3RR7A 1HYVA 3A5OC 1J9AA 3TTCA 4J2DA 1VQKN 1TYQB 4B3TK 3OJSA 2IAJA 4RWTA 5BPLA 5M1NA 1T7PA 3CCLN 4GVMA 3M8RA 3VF4A 4GW6A 3VOVA 1WAFA 2XY8A 3QIOA 1B9DA 4OKKA 3SAHA 1QSYA 4CZFA 4KHYA 4U7BA 3KD1E 3VF6A 3FZLA 3B6OA 3ID6A 1LV5A 4E1NA 4L3QA 4BDPA 1LW2A 1NK0A 1BQNA 1JLCA 2G8HA 1RT7A 2AJQA 1U4BA 3MWPA 4BRIA 1WOQA 1NKBA 3OYJA 4J8FA 5SZTA 3LP1A 2JWLA 5FRMA 4BR4A 2HHVA 1YJWN 4UY8O 3LPTA 3OS1A 2NRHA 4DF8A 2E1ZA 3OHRA 4W5TA 4B9NA 3SNNA 4O44A 2ZD1A 5AQIA 3O9RA 4M3ZA 4HVJA 3LM2A 1QQMA 2OPQA 1OH8A 4QS9A 1F21A 1JLAA 1RT5A 2QA4N 4H0YB 3OY9A 4NXNK 2V7ZA 4BG8A 5AQUA 3DRPA 4H5TA 3NGYA 2D4WA 3K9JA 3SZ2A 2QWQA 3NVKA 3DM2A 1WUAA 1VSDA 4WQ4A 1BI4A 4BQLA 2Z1HA 3M8PA 1ASWA 1KXPA 1TAUA 1U2VB 4B9MA 1RDWX 4CJTA 4HCBA 2PYJA 3WNGA 1SL1A 3OYGA 2HVIA 3CYMA 1IBMK 4FK0A 4FJ8A 3RR8A 4WF9L 3UKUA 4Y0WA 4CZGA 4DR6K 1UA0A 1KAZA 2F96A 3VEXA 3KK3A 1QHTA 1W2BM 4XIUA 1S72N 2EHGA 3CC4N 4ILHA 4F2SA 3ALYA 4DU4A 3HOSA 2WUSA 1VSJA 3WXIA 2B6AA 3U8XA 4M7YA 4JKEA 4FWKA 2YKMA 1NGCA 2Q2RA 2YHXA 3ZETA 3ZX0A 5C24A 1NGDA 5HRSA 1S1UA 4I2PA 4PKHA 3AVIA 3AVBA 1C0GA 2F9TA 4FYDA 2HHUA 3O80A 4FJJA 1X9MA 3NVMA 4BE2A 4FLWA 3VMFB 2ITGA 1VK0A 3CIPA 3AV9A 1NLVA 3ZSYA 1N5YA 4I9LA 1JCGA 1JLBA 3EZ5A 3KK7A 3MXMA 1XHXA 1XHZA 3T1YK 3VGLA 3G71N 1FKPA 4C8KA 1IBKK 2QEXN 1HNWK 3DLBA 1IG8A 2D0AA 2FBXA 2YNGA 4CFBA 3VESA 1QQOA 2IVNA 1BO5O 3ZSXA 4IJAA 4WQ4C 2HNDA 4CBUA 1BOTO 5SWMA 1XMOK 1VQ7N 1O13A 1RT2A 2HHWA 2PZSA 3QETA 4NCAA 2NRTA 2YI1A 1NGHA 3RMCA 2IOCA 4WCEL 1ATRA 3VQ8A 3SJJA 2VQFK 3DRSA 4HUEA 1Q18A 4MO5A 4A59A 1RDBA 2X74A 3L2QA 1Q9XA 3LDSA 2X6NA 3SYZA 5HP1A 3V9XA 1SQKA 1QTMA 3KD5E 1XMQK 4HTUA 4M3UA 1EXQA 1JXEA 5ADXA 3CM5A 1WBBA 2UUBK 2ASPA 1W7AA 1UOCA 2CH6A 3GDQA 1ZBSA 1U6ZA 1QZ5A 4DR1K 1MU2A 3B8AX 4KB1A 3NCIA 1GLBG 1JKHA 4C8LA 2QKBA 4IG0A 3CCMN 1TK0A 2I5JA 2E2NA 3K57A 4KAZA 4DWIA 4IO8A 3OYCA 3SV3A 5AR0A 3N4PA 1JLQA 3DLRA 4DTMA 3T7ZA 2NUBA 3EEQA 1Y97A 4OVLA 2Y1JA 2D0BA 1HMVA 4DS5A 4KBOA 4JKHA 2NNWA 3SAFA 3KLIA 4CFDA 1KAYA 2GBZA 4KPYA 1GLJO 3VQ4A 4DS4A 3J8AA 5AQGA 3JS6A 1RBSA 1BI4B 1L3TA 1EWQA 2QWLA 3CJ7A 4C1NK 2YJFA 4PL7A 3P38A 4DKWA 4H0XB 4DR4K 4PKGA 1C0MA 3UKUB 3O4NA 1IBLK 4A57A 4MQ3A 1RDDA 4E7IA 4BACA 3Q7CA 3LPUA 4CEOA 5GIPA 4E0DA 4CJ5A 5IT9O 4RW8A 4IKFA 2HVHA 1YTAA 5HRNA 2E4LA 5EY4A 2F7TA 4N41A 4FM0A 3ZETB 4PWDA 1Q8IA 3OYDA 3TPQA 3SK3A 3G6EN 1NGJA 2WFBA 4XH5A 1QSSA 1HNXK 4DQPA 2O8DA 1NBWA 1K8KA 3T69A 3QLHA 4CK1A 3VQ7A 3HT3A 4RW7A 3U3YA 1Q9YA 4JI0K 3KWIA 4DSJA 1DLOA 4DSFA 3CJAA 5EVZA 2VQEK 3CI5A 3CC2N 1S3XA 4FZXC 4KTZA 1HNZK 4MDAA 2YX6A 2OTJN 3LP2A 4CZKA 1JL1A 2QKKA 1T3VA 2ATQA 4FK2A 2HBJA 1TKTA 1BIZA 3C6HA 1EWRA 2F9WA 3EE8A 3G10A 3R9PA 3BF1A 3C6UA 3CQYA 1IO2A 2PYLA 1OKJA 3AVAA 3KTQA 4CERA 4LSLA 3OYIA 4KRFA 1BCOA 1D8YA 4OGEA 3CG7A 1JJ2M 1CZAN 1VQON 1JXBA 5AFUA 4CF2A 3K58A 3TSPA 3DXMA 2G8UA 1NK8A 4FWMA 2QK9A 1U45A 3QO9A 1LW0A 3KJVA 3CM6A 2VCPA 4FLUA 3E01A 4CGGA 2VWKA 3WQUA 4J2EA 3NH2A 4TSXA 5I3UA 4FM2A 1TK8A 2RE2A 1NJZA 4V19S 2AA4A 4FPAA 4DQRA 1JCEA 1HJOA 3C95A 4FW2A 3KLFA 1REVA 3JXUA 2HMPA 5GINA 2HBKA 4EP5A 3VEVA 3QNOA 4OKJA 2ITMA 3MAQA 4ZTFA 2YNIA 1XQSC 3TSQA 4Z0UA 1D9FA 1KFDA 2OANA 2Z1GA 1M90O 3I0RA 2OZMA 3CMEN 3CJ1A 2P9IB 4Z4IA 1VQ5N 4CJVA 3WT0A 5LMUK 1ZBIA 3BZCA 3L4IA 4E1MA 1NGFA 3DOKA 3O8MA 1TV6A 4AM6A 3R3LA 2XO7A 5LMNK 4LF6K 2YNFA 4RW4A 2GUIA 4HTLA 2Q1NA 3HOTA 1SAZA 2GWKA 4EHUA 4Q5VA 1I39A 1G15A 4PL8A 4CGFA 4FJGA 4C1NI 3HP9A 3WXJA 3J7ZO 3WEEA 3L2RA 1LCUA 1VSHA 4LFCK 4HWIA 4KHWA 4DSIA 4CZEA 1VSKA 4K41A 1DGKN 3J7AP 1X9JA 1DKGD 4L8RB 1U47A 3BY5A 3OYBA 1L3VA 4MO4A 5FPNA 4QCLA 4JRPA 3G4SN 2P1JA 4LC9B 5AQVA 1IKXA 1G99A 1XC3A 2OCEA 4HCCA 1NGGA 4GNIA 1ESVA 4YFUA 1K8KB 2G8VA 3CCSN 5FRNA 4O5FA 1L5UA 2W6KA 5DK5A 1QS4A 1EX4A 1H1VA 4F9OA 3S3MA 1FKOA 3RRGA 4BGBA 3V1RA 4ICLA 2KFNA 1NK9A 2HHSA 3D7EO 1WSHA 3LP3A 4BC3A 4IOCL 2FBTA 1Q7YO 3L2UA 1YVNA 3K0SA 4IO9L 1XC9A 3GL1A 3V1QA 2ZJPL 3BZKA 4DF4A 1VRUA 3NGZA 4N56A 4BR0A 3VQCA 5LL6Z 3VTIA 2WOMA 3U9DA 4ELUA 3MEGA 4E7KA 2A1RA 4JKCA 4FL9A 2B5JA 3H08A 1TUYA 4CEBA 2O8CB 5CYMA 1VQPN 3DXMB 3NFAA 1V4SA 4PHTX 3MN7A 2P5OA 3DI6A 5HRRA 4DR2K 4JI7K 5LJVA 2XY5A 5FPEA 3DRRA 1WNSA 1YUWA 4AHRA 5EX5A 4BRMA 4E7LA 4K0KK 3OTOK 3AO2A 3KVGA 1YF5L 3TWHA 1TVRA 3VTHA 3ZT2A 1ZBFA 1YIJN 2QWMA 3QFPA 4IXCA 2FBVA 5MLCQ 3NH1A 4CIGA 1S1TA 5JLFA 1ATSA 3V81A 4CJFA 4FLVA 4K43A 2ZE2A 3AARA 4H0PA 4YOTA 1BG3A 4ZTJA 1CLQA 4JKGB 2XHBA 4BRFA 4M45A 2V7YA 4CFAA 3MEDA 2E2QA 4KREA 2HB5A 4QS8A 3A8YA 2A5XA 4I7FA 4DR7K 4JK8A 1T8EA 1X1PA 1VAZA 4F2RA 4CEZA 2UYTA 3SQ4A 5C25A 3DLKA 4CI6A 1VHXA 1SL2A 3WEEB 4X64K 4YY3K 2E20A 2ZGZA 4DG1A 3CQXA 1NGIA 5AZIA 4CF9A 2EX3A 3EO3A 1ZBLA 4JD2A 1GLCG 5HLFA 3MEEA 1QSLA 3KLHA 1A5VA 1WB9A 3SV4A 4B9SA 1IH7A 1WAJA 2HBMA 3IMXA 1NKEA 5KTQA 2IDOA 3BF3A 4Z94A 3VQPA 4K42A 2E88A 4DV7K 3TARA 1BIUA 5GAHP 3LWMA 4GV6A 4PQUA 1TGOA 1HKGA 4AHCA 4BRLA 3MN9A 4M3XA 1KTQA 4FJXA 4DTOA 4AQYK 4BE0A 3MMVA 4CJQA 1VSMA 3IS9A 4LF7K 3THVA 4FZYA 4DLEA 4KFBA 4RTFD 3RVCA 3T19A 3VQDA 3VGKA 3AVGA 3WXMB 3PO4A 2FSKA 4JI1K 5F0XA 4IFVA 3FLCO 4X62K 3L3UA 4AHVA 4BRNA 2R7YA 4JYAK 4U67L 1LWFA 5AQJA 1N6QA 3MN5A 1RTDA 3W3DA 3HRGA 3S3NA 3SUQA 3P31A 3ISNC 4NB4A 1WLJA 3SUPA 2UU9K 1NJWA 2QM1A 3SMPA 4WYBA 4B1YB 5CY4A 2VGMA 4YOYA 4CCHA 1X3MA 3N4QA 4B8AB 2ZQBA 1NU0A 3FZKA 5E41A 4HUGA 2FF3B 3I55N 4NLCA 1VQMN 2E2OA 4LY7A 3THXA 3O1WA 4LSNA 3PUFA 3NGIA 5HBMA 4CHYA 3TI0A 1N32K 2UXCK 4Y1DA 1T03A 3CCJN 1HQUA 5TKYA 1QZ6A 4R79A 5JLHA 3PX4A 1DTQA 3T3FA 3VQ9A 4B9TA 3PY8A 4KHSA 2F4VK 4CEAA 1W9HA 1IJJA 1KVCA 3WXLA 1U04A 1KLNA 1IG9A 1XWLA 2B4JA 1NOZA 3CF5L 1VRTA 1RBVA 2PFUA 4DTPA 3FFKB 4KKOA 1I3AA 2YHBA 1M1KO 4NO7A 1S1XA 1TL3A 4A2BA 5B8HA 3HPHA 5M1QA 4CJEA 3O08A 5BRFA 3VETA 4CJ7A 3T1HK 3OYLA 3C7NA 3GBTA 5BN9A 3IUCA 3NAEA 1HYZA 2D5RA 3AO3A 3NHGA 4OJRA 3L4QA 3ZX2A 3IDHA 3ZSVA 5AZIB 2Q97A 1RBTA 1UA1A 1WSJA 3O1BA 4IDHA 2P5GA 4X66K 4H0VB 3ZT0A 4JD2B 4O5BA 4H0TB 1C0UA 3H1VX 4FW1A 4HUFA 3AGRA 1CZ9A 3NF7A 5JMVA 1BWFO 1VSEA 3U4LA 4WFNL 5J2NA 5JS2A 4LH4A 1WSGA 1HLUA 4DUYK 3A5NC 2Z1IA 1UWBA 2O8FA 1ZC6A 3IFRA 1OH5A 2GX9A 1C1CA 2GV9A 1T05A 5AQMA 4JN4A 1QVFM 4KHQA 1K8AO 2UXDK 4FLZA 1VSFA 4FJ7A 3ENHA 4CF0A 3CMAN 1RDAA 4OLAA 4CZHA 1HR0K 1VQLN 4FVMA 4GY2B 3HP6A 4FJMA 2XY6A 4GV3A 3ID8A 3RMBA 3TAQA 3SAGA 3O9UA 2UUAK 4H5VA 5KRSA 3V9UA 1NJYA 4MDBA 1MWMA 2KHOA 5CZ1A 4B1VA 3FR0A 2ZF5O 3OYAA 2OYQA 2VG5A 4LFBK 3JYTA 2ETJA 4KHUA 3OJUA 4BR7A 3OVNA 2Q0RA 4CEEA 1GLEG 4BY9C 2KKZA 4G1QA 3MX2A 4M3YA 2UXBK 3CCRN 1JLFA 3QDKA 5E84A 2Q31A 4O0JA 4JKFA 2ZJRL 1C6VA 5KI6A 2LSNA 1KVAA 1CXQA 2H3GX 1TUUA 3AA5X 3AO1A 1ASVA 2G8KA 2D1KA 3AO5A 3UE5A 1OVYA 1YHQN 5GIOA 1IV0A 3SQ1A 3ZCMA 3A0IX 3K9KA 2ZJQL 3DJCA 3THXB 4IFYA 4BR5A 4EZ6A 1KRPA 2D0CA 3GOIA 3HSCA 3QEIA 4BWJA 2FC0A 3L2WA 3NF8A 4OLBA 2CGLA 4XEIA 1NMDA 2P9PA 2HHXA 4F3OA 4DTJA 3QB0A 4CZJA 4B3SK 3O6WA 1QE1A 3QBWA 4LF9K 3I33A 5M1KA 1DT9A 1S9EA 4BGAA 2HF3A 3AVJA 2HOEA 1TKZA 2A3ZA 3VGMA 5T7BA 3P4IA 3AGKA 4DLGA 3IAYA 3OYNA 4FSVA 2RN2A 3AVMA 3I56N 5D3GA 4N5SA 4Z4GA 4WQ5A 3O3FA 1SKWA 3K5OA 4FWRA 1BCMA 3S3OA 3EY1A 4DV6K 4HHTA 4JAXA 2UUCK 1S1VA 4BRDA 3RMAA 1SKSA 1TKDA 4K8ZA 4QS7A 3C7NB 4H5NA 3QERA 1KQSM 3UKRA 1WN7A 3MX5A 5KPZA 1GLFO 2QXLA 3AY9A 3BP8A 4OGCA 5CE3A 4GV9A 3ZT1A 1V4TA 1RNHA 3E1YA 4JK7A 5C15A 1NOYA 3PO5A 4GVEA 4DR5K 4DV0K 4M63C 5LY3A 3KHYA 5AJ3K 3FZHA 5C42A 2VGNA 4JV5K 5AQOA 1Z25A 2FF6A 1JLEA 3AA4A 1LOTB 4E7HA 4EP4A 4OPJA 4CD1A 5EOYA 4YDUA 1E3MA 4CIEA 1VQ6N 3S41A 2O8FB 2F8SA 1C1BA 4F4KA 1SZ2A 3MCAB 5BPNA 4KB0A 4AHTA 1MDUB 3MWTA 4OKEA 4CBWA 3M8SA 2DPNA 2P9LA 4DSKA 1MA9B 2OPPA 4DQSA 4QAGA 2P9UA 1GLAG 2OTLN 3ITHA 1NGAA 3OS0A 1EKEA 4KTWA 4DTXA 1BISA 4CW7B 4WQ5C 4DV2K 3CCEN 4E19A 3J7YP 4JHDA 1LWCA 3ZT4A 3KK1A 2KZMA 2VWJA 1TAQA 4DV3K 4I9QA 3EL2A 2AP1A 3ATUA 1RT1A 2E1YA 2GELA 5J2MA 3V9SA 3AVFA 3IKMA 2BDPA 1C1AA 3VEYA 1Q86O 3CJBA 3I0SA 1DEJA 4BDYA 4FJ9A 1N36K 4KV8A 4CECA 1YJ9N 5C12A 2V52B 4A5AA 1RDCA 2OA8A 3BEXA 1W97L 4BRKA 4YDUC 4CHZA 3QESA 3C6TA 4BRAA 2W40A 4CJWA 4DR3K 4FWLA 4XH1A 4JLHA 4DU1A 1S6PA 1VSLA 4GMJB 1JLGA 5JVGL 2P9PB 3DWLA 5AZJA 1HNIA 3DLGA 4FLYA 4BRHA 2D0OA 3PX6A 4DTRA 2HHHK 4B1WB 3I8DA 2IS3A 4B9QA 4UQGA 3MDQA 5AQKA 3O9SA 5J1EA 3EKUA 2QI2A 1VSIA 2XRIA 5AQZA 2NRWA 1P90A 3D2FA 1NMNA 4EAHD 4EZ9A 4FOEA 2YHAA 4EIAA 2O8DB 4AM7A 4CGHA 4C23A 4RW6A 4BRGA 4DQ8A 4CJ4A 4Z4EA 2QWNA 2YKNA 3QICA 4JNEA 1GOAA 1N33K 2OZSA 5HOOA 3UKRB 4BC5A 5AQRA 1HNVA 4CF1A 1B92A 1WSEA 1BQMA 1X3NA 4IDKA 4CD3A 3WXKA 3CFRA 2JLEA 4LF4K 1NM1A 4CK2A 3QMLA 2OPSA 2E2PA 4A2AA 3NE6A 4BRPA 1NJXA 3VQAA 1RCHA 1K9MO 3A5MC 4C8MA 4M41A 3O3HA 2DY4A 3M5RA 3PSFA 4IFEA 4NYFA 4B08A 3AVCA 4XH4A 3THWA 3EZWA 3LAMA 3DYAA 3TU5A 2QWRA 5IWAK 1XNQK 2RPIA 4F3TA 3I8BA 2BTFA 5JVHL 2KW4A 3ULEA 2O8BA 1OVQA 4M3WA 1SL0A 2DFEA 3LL3A 1RT4A 2P9LB 3ASMA 5F2RA 2WTUA 3C94A 4NLBA 1L3SA 4ILJA 3H45C 4KTQA 2P9UB 4IOXA 1R0AA 4DFJA 3AVKA 3ZLJA 1QVGM 3WUHA 3R8EA 1JCFA 4LFAK 4CZLA 1P8ZA 2G8WA 1N34K 4B9UA 2HHTA 1HYSA 1U2VA 4CJPA 2V51B 2FLOA 2Z1JA 3SQ0A 3EE9A 3M3ZA 2YNHA 3NF9A 4MFBA 3FFIA 4FWQA 3OW2M 5HROA 1HRHA 2QWOA 4CVNE 4ID5A 4YOWA 3CPWM 2P51A 4ELTA 4CHNA 3AVNA 3KIOA 4BVOA 3C6AA 3ZSZA 1U48A 4BREA 4LH5A 4CZMA 3IG1A 2WONA 4DFMA 3SUOA 3FE1A 3VPZA 4ISGA 4BG9A 1SS6A 3L3VA 3F9KA 1S1WA 3PIPL
chains in the Genus database with same CATH topology
1CZBA 4CEDA 3LANA 4RW8A 2DFHA 4IKFA 4BDZA 2HVHA 1S1XA 1TL3A 3HPHA 1YTAA 5HRNA 4CJEA 4N76A 3KKSA 3NH0A 1LAVA 2QXFA 2E4LA 2Q3SA 4K8XA 3D0PA 4F8RA 4N41A 3OYLA 4FM0A 5JS1A 5J2PA 3L8BA 1BGXT 3HK2A 4PWDA 3NAEA 1HYZA 2D5RA 3G0ZA 4YNQA 1Q8IA 3OYDA 3AO3A 3NHGA 1BL3A 3AVHA 4OJRA 3LZJA 1QSSA 3TABA 4DQPA 3RMDA 3TAMA 2O4GA 4BWMA 4AHUA 3V6DA 3S9HA 4NCBA 4M42A 4M3TA 3ZSVA 1RBTA 4B8CA 1UA1A 1WSJA 3QLHA 4CK1A 1RT6A 5CYQA 2P5GA 1SV5A 3VQ7A 3ZT0A 2DFFA 4I2QA 3TAGA 1DTTA 1NK5A 4O5BA 3HT3A 4RW7A 4W5QA 4J2BA 1C0UA 3OYHA 3U3YA 1Q9YA 1SKRA 4FW1A 4ZHRA 4HUFA 1NK7A 1DLOA 3CFPA 1CZ9A 4O55A 3NF7A 4DSFA 1NKCA 4FZXC 1KCFA 4KTZA 4E89A 1VSEA 3SQ2A 2DTUA 3LP2A 1S5JA 3K5LA 1JL1A 5J2NA 2QKKA 2ATQA 4FK2A 5JS2A 2RKIA 4LH4A 1TKTA 1WSGA 2A1SA 1BIZA 3DOLA 3G10A 4ELVA 2Z1IA 3C6UA 1UWBA 3VQEA 1YT3A 3T1AA 3VQ6A 1IO2A 1C1CA 2GV9A 2PYLA 4C8NA 3QNNA 3DLHA 4WE1A 1TK5A 3HVRA 4AHSA 1T05A 2HMIA 2G8FA 4DTUA 4BE1A 3AVAA 4KHQA 2VG6A 3TANA 2X78A 3KTQA 4FLZA 1VSFA 3HPGA 4CERA 4LSLA 4NCGA 3VQQA 3OYIA 4QOZB 4KRFA 1BCOA 2VG7A 4CF0A 3OYFA 2XY7A 4CIFA 1D8YA 1RDAA 4C8OA 4FJ7A 4OGEA 3CG7A 4RW9A 4OLAA 1JXBA 4CF2A 4FVMA 3K58A 4FJLA 4IG3A 3HP6A 4JRQA 4FJIA 3OYMA 2G8UA 4FJMA 1KVBA 1NK8A 2XY6A 2QK9A 1U45A 2IGIA 3RMBA 4DFPA 3K59A 4W5OA 3DLEA 3QO9A 1LW0A 3KJVA 3TAQA 3CM6A 4FLUA 4OPKA 2OPRA 3RRHA 4O4GA 1X9WA 3E01A 4CGGA 2VWKA 3MXJA 4DQQA 4Y1CA 5KRSA 3V9UA 4J2EA 1NJYA 3TAPA 3QIPA 2FBYA 5CZ1A 5DMRA 3NH2A 4JS5A 4TSXA 3OYAA 2HNYA 5I3UA 4FM2A 2VG5A 3P83D 1TK8A 2OYQA 4CK3A 3JYTA 4AILC 5CZ2A 2ETJA 1NJZA 2X6SA 4DQRA 4KHUA 3C95A 4FW2A 3OJUA 3KLFA 1REVA 2O4IA 1J5OA 3OVNA 3V9ZA 3LALA 4EP5A 4CEEA 3QNOA 4OKJA 3HVTA 3KKRA 3U3GA 4Z4HA 3MAQA 3AVLA 2YNIA 4ZTFA 3RWUA 1FXXA 4G1QA 4Z0UA 4M3YA 1JLFA 1D9FA 1IKYA 1KFDA 4M3RA 2Z1GA 3CQ8A 4O0JA 2HNZA 1C6VA 3I0RA 2LSNA 5KI6A 1CXQA 1KVAA 1B9FA 3SUNA 2OZMA 3AO1A 3AA5X 1ASVA 4FLTA 2G8KA 3AO5A 4Z4IA 3HYFA 4CJVA 4FJKA 4Z4FA 3CFOA 3SQ1A 3ZCMA 1ZBIA 1RBRA 4E1MA 3NDKA 5KGWA 3DOKA 1TV6A 1IKVA 1QQCA 1KSPA 3D45A 4IFYA 3SPYA 4EZ6A 3OS2A 1KRPA 4CFCA 3JSMA 2KQ2A 2XO7A 3ZSQA 2D0CA 3QEIA 2YNFA 4RW4A 4BWJA 2GUIA 2IC3A 3HPOA 4FLXA 2FC0A 3L2WA 1ZBUA 3HXMA 3HO1A 4JS4A 1TKXA 4J2AA 4KI4A 4B3OA 3NF8A 4OLBA 1UAXA 3AA3A 4Q5VA 4FJGA 1I39A 1G15A 4CGFA 3MXIA 1ZBHA 4F3OA 2HHXA 4DTJA 1GOBA 3M8QA 2BE2A 4KHNA 2YV0X 3HP9A 1QE1A 1O1WA 5EU7A 3L2RA 1RTJA 1L3UA 1VSHA 1FK9A 4CE9A 1S9EA 4KHWA 3AVJA 4DSIA 2PY5A 1TKZA 2E6LA 3SPZA 1VSKA 5T7BA 4CGDA 4DLGA 3AA2A 4L8RB 3IAYA 3OYNA 2RN2A 3AVMA 3PX0A 1U47A 4N5SA 3UIQA 5D3GA 3O3FA 4Z4GA 3OYBA 1W0HA 3K5OA 1SKWA 1L3VA 1GOCA 1WSFA 3EYZA 1BCMA 3S3OA 4QCLA 4CF8A 1RTHA 4O0IA 4CGJA 3EY1A 4Z4CA 4JRPA 1XI1A 2P1JA 4HHTA 5KGXA 1HPZA 4NYNA 1S1VA 3K5MA 5FDLA 3B6PA 3HSTB 4DSEA 3RMAA 1IKXA 1SKSA 1TKDA 4CHQA 1HYVA 3RR7A 4K8ZA 3QERA 1J9AA 4J2DA 3U6FA 1WN7A 3OJSA 2IAJA 4OGCA 1WSIA 3KLGA 3ZT1A 1RNHA 1U49A 4HCCA 1T7PA 1Z26A 2BGGA 5FROA 4YFUA 4GVMA 2G8VA 3M8RA 5FRNA 3LPUA 1NOYA 4GW6A 3VA3A 4CEOA 1L5UA 5DK5A 3PO5A 1QS4A 1WAFA 1EX4A 2XY8A 1KFSA 3QIOA 1B9DA 4OKKA 1QSYA 1D9DA 5C42A 3O3GA 1NK6A 1Z25A 3S3MA 1JLEA 3AA4A 3KD1E 4KHYA 4E7HA 1LV5A 1RTIA 3B6OA 4W5RA 4EP4A 4E1NA 4OPJA 4BDPA 1FKOA 1LW2A 1NK0A 3RRGA 1BQNA 1JLCA 3V1RA 2G8HA 4ICLA 2KFNA 1NK9A 2HHSA 1C0TA 1WSHA 3LP3A 4CIEA 4W5NA 1RT7A 5J2QA 2FBTA 3L2UA 2AJQA 1U4BA 4FZZA 2F8SA 1C1BA 3OYJA 1XC9A 5SZTA 1NKBA 3LP1A 3ZSWA 4F4KA 3V1QA 4DF4A 1VRUA 4KB0A 5FRMA 3NGZA 4N56A 2JGUA 3HL8A 4AHTA 3NF6A 4KI6A 1S9GA 2HHVA 4FCYA 1ITGA 4OKEA 3TAFA 3M8SA 3VQCA 3BDPA 4H4MA 4CHOA 2WOMA 4ELUA 3LPTA 3MEGA 4N47A 3OS1A 4DF8A 4DFKA 4E7KA 2A1RA 4W5TA 4DSKA 4B9NA 2B5JA 2OPPA 4DQSA 3SNNA 4CJSA 3H08A 4O44A 4CEBA 5CYMA 4QAGA 1YVUA 2ZD1A 3NFAA 1SUQA 4M3ZA 3ITHA 2P5OA 4HVJA 3OS0A 2OPQA 1EKEA 4KTWA 3DI6A 5HRRA 4DTXA 3OYEA 2XY5A 1F21A 1BISA 4PA1A 3DRRA 1WNSA 1JLAA 4E7JA 1RT5A 4E19A 4AHRA 4CEFA 1LWCA 3ZT4A 3KK1A 3OY9A 4E7LA 2KZMA 2VWJA 3TR8A 4R5PA 3DRPA 1TAQA 3AO2A 1IKWA 3NGYA 3IRXA 3SZ2A 3BGRA 4I9QA 3DM2A 3TWHA 1TVRA 1RILA 1D5AA 3ZT2A 1RT1A 1VSDA 1ZYQA 1ZBFA 1BI4A 5J2MA 4B9LA 2Z1HA 3V9SA 3M8PA 3AVFA 1ASWA 1TAUA 2BDPA 2FBVA 1C1AA 3NH1A 4B9MA 1KLMA 4CJUA 4CIGA 1S1TA 4FK4A 3I0SA 4CJTA 4BDYA 3V81A 4HCBA 2PYJA 4FJ9A 2G8IA 3WNGA 3V1OA 4CJFA 4FLVA 4KV8A 4DMNA 3V4IA 1SL1A 4CECA 3OYGA 2HW3A 2HVIA 2ZE2A 3CYMA 1TL1A 3QEXA 4ZTJA 4FK0A 4FJ8A 3RR8A 1CLQA 1RDCA 2OA8A 5K14A 2XHBA 4M45A 4PY5A 1UA0A 2F96A 4CFAA 4CHZA 3MEDA 3QESA 4KREA 2HB5A 3C6TA 3OYKA 4CJWA 1QHTA 3KK3A 3L2VA 3F73A 4XIUA 4DTSA 1RT3A 1NK4A 2EHGA 4H4OA 4JLHA 4I7FA 4DU1A 4F2SA 1T8EA 3ULDA 1X1PA 1S6PA 3ALYA 4DU4A 3KLEA 3O4QA 4CEZA 4F2RA 1VSJA 1VSLA 3MECA 1JLGA 2B6AA 4GMJB 3SQ4A 3AO4A 3LAKA 3TAEA 5C25A 2YKMA 3DLKA 5C24A 4PUOA 5HRSA 1SL2A 1HNIA 1S1UA 3DLGA 3VQBA 4FLYA 4I2PA 1J54A 3PX6A 3AVIA 4DTRA 3AVBA 4AH9A 3I8DA 2IS3A 4UQGA 4FYDA 4DG1A 1X9SA 4DSJA 2HHUA 1K6YA 4FJJA 4CF9A 5J1EA 4DTNA 1X9MA 3LP0A 2EX3A 4BE2A 4FLWA 2XRIA 1VSIA 3K2PA 1ZBLA 3SI6A 2ITGA 1VK0A 3AV9A 2HHQA 5HRPA 5HLFA 3MEEA 3ZSYA 3KLHA 1N5YA 4I9LA 1QSLA 4EZ9A 1A5VA 3SV4A 1JLBA 2YHAA 3LWLA 3EZ5A 3MXMA 4B9SA 1BHLA 1IH7A 4RW6A 4CGHA 4E3SA 1XHXA 1WAJA 3A2FA 1XHZA 4Z4EA 4CJ4A 3DMJA 1NKEA 1JL2A 3VN5A 5KTQA 2IDOA 1FKPA 2YKNA 3VQPA 5I42A 4C8KA 1GOAA 3VA0A 2OZSA 1J53A 3V9WA 3DLBA 3QINA 4CJLA 4DSLA 3TARA 1HNVA 1BIUA 2D0AA 2FBXA 2YNGA 4CF1A 4CFBA 3LWMA 4CESA 4PQUA 4CEQA 1TGOA 1B92A 1WSEA 3ZSXA 4CJKA 4FJ5A 1BQMA 4AHCA 3K5NA 2HNDA 3SCXA 4IDKA 3CFRA 3WNEA 2JLEA 5SWMA 1RT2A 2HHWA 4CK2A 4M3XA 1KTQA 4FJXA 2PZSA 4DTOA 3HJFA 2OPSA 3QETA 1CXUA 4BE0A 4CJQA 3NE6A 4NCAA 1NJXA 4DQIA 1VSMA 3VQAA 3IS9A 1RCHA 3LZIA 2IOCA 3PV8A 3RMCA 3NBPA 3THVA 2KFZA 3VQ8A 4C8MA 4M41A 3O3HA 3SJJA 4FZYA 2DY4A 1LAWA 3DRSA 4HUEA 4DLEA 3QEPA 4KFBA 1RDBA 2X74A 3L2QA 1Q9XA 4FJHA 3T19A 3LDSA 3VQDA 4FJNA 3AVGA 4NYFA 5KRTA 3PO4A 2X6NA 3SYZA 5HP1A 1ASUA 3V9XA 1QTMA 4B08A 3KD5E 4FM1A 3AVCA 4HTUA 4RG8A 1EXQA 1JXEA 3DYAA 3CM5A 3LAMA 3P5JA 4CJRA 4M3UA 3ZSOA 2RPIA 1EP4A 4F3TA 4IFVA 1UOCA 3L3UA 4AHVA 2R7YA 2KW4A 1EETA 1LWFA 1MU2A 3VQ5A 4KB1A 1S1WA 1N6QA 3NCIA 4H8KA 4M3WA 1RTDA 1SL0A 3QEWA 2DFEA 1JKHA 1RT4A 3ASMA 2BANA 3S3NA 3C94A 3SUQA 1LWEA 1L3SA 4C8LA 2QKBA 3ISNC 2E6MA 1WLJA 4IG0A 3SUPA 1TK0A 1NJWA 4LD0A 4KTQA 2I5JA 4DU3A 3K57A 4KAZA 4DWIA 5CY4A 3OYCA 1R0AA 4CJ3A 4DFJA 3AVKA 3ZT3A 3WNHA 1HQEA 1A5XA 3SV3A 4B9VA 1JLQA 4CCHA 3DLRA 4B8AB 4DTMA 2ZQBA 3WNFA 4FXDA 2KTQA 2NUBA 1Y97A 5E41A 4OVLA 2Y1JA 2D0BA 1HMVA 3HM9A 4DS5A 4HUGA 4Q0BA 2G8WA 4B9UA 3QEVA 2W42A 4LY7A 2HHTA 3KLIA 4CFDA 1HYSA 4CGIA 4LSNA 3NGIA 3PUFA 2GBZA 4E0DA 5HBMA 4CHYA 3TI0A 1YTUA 4KPYA 4CJPA 3VQ4A 4Y1DA 4DS4A 2Z1JA 3SQ0A 1T03A 1A5WA 1HQUA 2YNHA 4IBNA 3NF9A 1RBSA 1BI4B 3FFIA 4MFBA 1L3TA 5HROA 1HRHA 2RF2A 3PX4A 1DTQA 3P1GA 3T3FA 3VQ9A 4B9TA 3PY8A 4ID5A 4KHSA 4CEAA 2P51A 1W9HA 1KVCA 4ELTA 4CHNA 3AVNA 3KIOA 3ZSZA 1U48A 1U04A 4ID1A 2Y1IA 4LH5A 1KLNA 1IG9A 1XWLA 1S6QA 2B4JA 3ZSRA 2F8TA 3IG1A 2KZZA 1C0MA 2WONA 3O4NA 4DFMA 3SUOA 1NOZA 1VRTA 3RTVA 1RBVA 1RBUA 1RDDA 4MQ3A 4DTPA 4CHPA 3L3VA 4E7IA 3F9KA 1HJRA 4BACA 4KO0A 4KKOA 1I3AA 2YHBA 4CJ5A 3KK2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CZB A;  4CED A;  3LAN A;  4RW8 A;  2DFH A;  4IKF A;  4BDZ A;  2HVH A;  1S1X A;  1TL3 A;  3HPH A;  1YTA A;  5HRN A;  4CJE A;  4N76 A;  3KKS A;  3NH0 A;  1LAV A;  2QXF A;  2E4L A;  2Q3S A;  4K8X A;  3D0P A;  4F8R A;  4N41 A;  3OYL A;  4FM0 A;  5JS1 A;  5J2P A;  3L8B A;  1BGX T;  3HK2 A;  4PWD A;  3NAE A;  1HYZ A;  2D5R A;  3G0Z A;  4YNQ A;  1Q8I A;  3OYD A;  3AO3 A;  3NHG A;  1BL3 A;  3AVH A;  4OJR A;  3LZJ A;  1QSS A;  3TAB A;  4DQP A;  3RMD A;  3TAM A;  2O4G A;  4BWM A;  4AHU A;  3V6D A;  3S9H A;  4NCB A;  4M42 A;  4M3T A;  3ZSV A;  1RBT A;  4B8C A;  1UA1 A;  1WSJ A;  3QLH A;  4CK1 A;  1RT6 A;  5CYQ A;  2P5G A;  1SV5 A;  3VQ7 A;  3ZT0 A;  2DFF A;  4I2Q A;  3TAG A;  1DTT A;  1NK5 A;  4O5B A;  3HT3 A;  4RW7 A;  4W5Q A;  4J2B A;  1C0U A;  3OYH A;  3U3Y A;  1Q9Y A;  1SKR A;  4FW1 A;  4ZHR A;  4HUF A;  1NK7 A;  1DLO A;  3CFP A;  1CZ9 A;  4O55 A;  3NF7 A;  4DSF A;  1NKC A;  4FZX C;  1KCF A;  4KTZ A;  4E89 A;  1VSE A;  3SQ2 A;  2DTU A;  3LP2 A;  1S5J A;  3K5L A;  1JL1 A;  5J2N A;  2QKK A;  2ATQ A;  4FK2 A;  5JS2 A;  2RKI A;  4LH4 A;  1TKT A;  1WSG A;  2A1S A;  1BIZ A;  3DOL A;  3G10 A;  4ELV A;  2Z1I A;  3C6U A;  1UWB A;  3VQE A;  1YT3 A;  3T1A A;  3VQ6 A;  1IO2 A;  1C1C A;  2GV9 A;  2PYL A;  4C8N A;  3QNN A;  3DLH A;  4WE1 A;  1TK5 A;  3HVR A;  4AHS A;  1T05 A;  2HMI A;  2G8F A;  4DTU A;  4BE1 A;  3AVA A;  4KHQ A;  2VG6 A;  3TAN A;  2X78 A;  3KTQ A;  4FLZ A;  1VSF A;  3HPG A;  4CER A;  4LSL A;  4NCG A;  3VQQ A;  3OYI A;  4QOZ B;  4KRF A;  1BCO A;  2VG7 A;  4CF0 A;  3OYF A;  2XY7 A;  4CIF A;  1D8Y A;  1RDA A;  4C8O A;  4FJ7 A;  4OGE A;  3CG7 A;  4RW9 A;  4OLA A;  1JXB A;  4CF2 A;  4FVM A;  3K58 A;  4FJL A;  4IG3 A;  3HP6 A;  4JRQ A;  4FJI A;  3OYM A;  2G8U A;  4FJM A;  1KVB A;  1NK8 A;  2XY6 A;  2QK9 A;  1U45 A;  2IGI A;  3RMB A;  4DFP A;  3K59 A;  4W5O A;  3DLE A;  3QO9 A;  1LW0 A;  3KJV A;  3TAQ A;  3CM6 A;  4FLU A;  4OPK A;  2OPR A;  3RRH A;  4O4G A;  1X9W A;  3E01 A;  4CGG A;  2VWK A;  3MXJ A;  4DQQ A;  4Y1C A;  5KRS A;  3V9U A;  4J2E A;  1NJY A;  3TAP A;  3QIP A;  2FBY A;  5CZ1 A;  5DMR A;  3NH2 A;  4JS5 A;  4TSX A;  3OYA A;  2HNY A;  5I3U A;  4FM2 A;  2VG5 A;  3P83 D;  1TK8 A;  2OYQ A;  4CK3 A;  3JYT A;  4AIL C;  5CZ2 A;  2ETJ A;  1NJZ A;  2X6S A;  4DQR A;  4KHU A;  3C95 A;  4FW2 A;  3OJU A;  3KLF A;  1REV A;  2O4I A;  1J5O A;  3OVN A;  3V9Z A;  3LAL A;  4EP5 A;  4CEE A;  3QNO A;  4OKJ A;  3HVT A;  3KKR A;  3U3G A;  4Z4H A;  3MAQ A;  3AVL A;  2YNI A;  4ZTF A;  3RWU A;  1FXX A;  4G1Q A;  4Z0U A;  4M3Y A;  1JLF A;  1D9F A;  1IKY A;  1KFD A;  4M3R A;  2Z1G A;  3CQ8 A;  4O0J A;  2HNZ A;  1C6V A;  3I0R A;  2LSN A;  5KI6 A;  1CXQ A;  1KVA A;  1B9F A;  3SUN A;  2OZM A;  3AO1 A;  3AA5 X;  1ASV A;  4FLT A;  2G8K A;  3AO5 A;  4Z4I A;  3HYF A;  4CJV A;  4FJK A;  4Z4F A;  3CFO A;  3SQ1 A;  3ZCM A;  1ZBI A;  1RBR A;  4E1M A;  3NDK A;  5KGW A;  3DOK A;  1TV6 A;  1IKV A;  1QQC A;  1KSP A;  3D45 A;  4IFY A;  3SPY A;  4EZ6 A;  3OS2 A;  1KRP A;  4CFC A;  3JSM A;  2KQ2 A;  2XO7 A;  3ZSQ A;  2D0C A;  3QEI A;  2YNF A;  4RW4 A;  4BWJ A;  2GUI A;  2IC3 A;  3HPO A;  4FLX A;  2FC0 A;  3L2W A;  1ZBU A;  3HXM A;  3HO1 A;  4JS4 A;  1TKX A;  4J2A A;  4KI4 A;  4B3O A;  3NF8 A;  4OLB A;  1UAX A;  3AA3 A;  4Q5V A;  4FJG A;  1I39 A;  1G15 A;  4CGF A;  3MXI A;  1ZBH A;  4F3O A;  2HHX A;  4DTJ A;  1GOB A;  3M8Q A;  2BE2 A;  4KHN A;  2YV0 X;  3HP9 A;  1QE1 A;  1O1W A;  5EU7 A;  3L2R A;  1RTJ A;  1L3U A;  1VSH A;  1FK9 A;  4CE9 A;  1S9E A;  4KHW A;  3AVJ A;  4DSI A;  2PY5 A;  1TKZ A;  2E6L A;  3SPZ A;  1VSK A;  5T7B A;  4CGD A;  4DLG A;  3AA2 A;  4L8R B;  3IAY A;  3OYN A;  2RN2 A;  3AVM A;  3PX0 A;  1U47 A;  4N5S A;  3UIQ A;  5D3G A;  3O3F A;  4Z4G A;  3OYB A;  1W0H A;  3K5O A;  1SKW A;  1L3V A;  1GOC A;  1WSF A;  3EYZ A;  1BCM A;  3S3O A;  4QCL A;  4CF8 A;  1RTH A;  4O0I A;  4CGJ A;  3EY1 A;  4Z4C A;  4JRP A;  1XI1 A;  2P1J A;  4HHT A;  5KGX A;  1HPZ A;  4NYN A;  1S1V A;  3K5M A;  5FDL A;  3B6P A;  3HST B;  4DSE A;  3RMA A;  1IKX A;  1SKS A;  1TKD A;  4CHQ A;  1HYV A;  3RR7 A;  4K8Z A;  3QER A;  1J9A A;  4J2D A;  3U6F A;  1WN7 A;  3OJS A;  2IAJ A;  4OGC A;  1WSI A;  3KLG A;  3ZT1 A;  1RNH A;  1U49 A;  4HCC A;  1T7P A;  1Z26 A;  2BGG A;  5FRO A;  4YFU A;  4GVM A;  2G8V A;  3M8R A;  5FRN A;  3LPU A;  1NOY A;  4GW6 A;  3VA3 A;  4CEO A;  1L5U A;  5DK5 A;  3PO5 A;  1QS4 A;  1WAF A;  1EX4 A;  2XY8 A;  1KFS A;  3QIO A;  1B9D A;  4OKK A;  1QSY A;  1D9D A;  5C42 A;  3O3G A;  1NK6 A;  1Z25 A;  3S3M A;  1JLE A;  3AA4 A;  3KD1 E;  4KHY A;  4E7H A;  1LV5 A;  1RTI A;  3B6O A;  4W5R A;  4EP4 A;  4E1N A;  4OPJ A;  4BDP A;  1FKO A;  1LW2 A;  1NK0 A;  3RRG A;  1BQN A;  1JLC A;  3V1R A;  2G8H A;  4ICL A;  2KFN A;  1NK9 A;  2HHS A;  1C0T A;  1WSH A;  3LP3 A;  4CIE A;  4W5N A;  1RT7 A;  5J2Q A;  2FBT A;  3L2U A;  2AJQ A;  1U4B A;  4FZZ A;  2F8S A;  1C1B A;  3OYJ A;  1XC9 A;  5SZT A;  1NKB A;  3LP1 A;  3ZSW A;  4F4K A;  3V1Q A;  4DF4 A;  1VRU A;  4KB0 A;  5FRM A;  3NGZ A;  4N56 A;  2JGU A;  3HL8 A;  4AHT A;  3NF6 A;  4KI6 A;  1S9G A;  2HHV A;  4FCY A;  1ITG A;  4OKE A;  3TAF A;  3M8S A;  3VQC A;  3BDP A;  4H4M A;  4CHO A;  2WOM A;  4ELU A;  3LPT A;  3MEG A;  4N47 A;  3OS1 A;  4DF8 A;  4DFK A;  4E7K A;  2A1R A;  4W5T A;  4DSK A;  4B9N A;  2B5J A;  2OPP A;  4DQS A;  3SNN A;  4CJS A;  3H08 A;  4O44 A;  4CEB A;  5CYM A;  4QAG A;  1YVU A;  2ZD1 A;  3NFA A;  1SUQ A;  4M3Z A;  3ITH A;  2P5O A;  4HVJ A;  3OS0 A;  2OPQ A;  1EKE A;  4KTW A;  3DI6 A;  5HRR A;  4DTX A;  3OYE A;  2XY5 A;  1F21 A;  1BIS A;  4PA1 A;  3DRR A;  1WNS A;  1JLA A;  4E7J A;  1RT5 A;  4E19 A;  4AHR A;  4CEF A;  1LWC A;  3ZT4 A;  3KK1 A;  3OY9 A;  4E7L A;  2KZM A;  2VWJ A;  3TR8 A;  4R5P A;  3DRP A;  1TAQ A;  3AO2 A;  1IKW A;  3NGY A;  3IRX A;  3SZ2 A;  3BGR A;  4I9Q A;  3DM2 A;  3TWH A;  1TVR A;  1RIL A;  1D5A A;  3ZT2 A;  1RT1 A;  1VSD A;  1ZYQ A;  1ZBF A;  1BI4 A;  5J2M A;  4B9L A;  2Z1H A;  3V9S A;  3M8P A;  3AVF A;  1ASW A;  1TAU A;  2BDP A;  2FBV A;  1C1A A;  3NH1 A;  4B9M A;  1KLM A;  4CJU A;  4CIG A;  1S1T A;  4FK4 A;  3I0S A;  4CJT A;  4BDY A;  3V81 A;  4HCB A;  2PYJ A;  4FJ9 A;  2G8I A;  3WNG A;  3V1O A;  4CJF A;  4FLV A;  4KV8 A;  4DMN A;  3V4I A;  1SL1 A;  4CEC A;  3OYG A;  2HW3 A;  2HVI A;  2ZE2 A;  3CYM A;  1TL1 A;  3QEX A;  4ZTJ A;  4FK0 A;  4FJ8 A;  3RR8 A;  1CLQ A;  1RDC A;  2OA8 A;  5K14 A;  2XHB A;  4M45 A;  4PY5 A;  1UA0 A;  2F96 A;  4CFA A;  4CHZ A;  3MED A;  3QES A;  4KRE A;  2HB5 A;  3C6T A;  3OYK A;  4CJW A;  1QHT A;  3KK3 A;  3L2V A;  3F73 A;  4XIU A;  4DTS A;  1RT3 A;  1NK4 A;  2EHG A;  4H4O A;  4JLH A;  4I7F A;  4DU1 A;  4F2S A;  1T8E A;  3ULD A;  1X1P A;  1S6P A;  3ALY A;  4DU4 A;  3KLE A;  3O4Q A;  4CEZ A;  4F2R A;  1VSJ A;  1VSL A;  3MEC A;  1JLG A;  2B6A A;  4GMJ B;  3SQ4 A;  3AO4 A;  3LAK A;  3TAE A;  5C25 A;  2YKM A;  3DLK A;  5C24 A;  4PUO A;  5HRS A;  1SL2 A;  1HNI A;  1S1U A;  3DLG A;  3VQB A;  4FLY A;  4I2P A;  1J54 A;  3PX6 A;  3AVI A;  4DTR A;  3AVB A;  4AH9 A;  3I8D A;  2IS3 A;  4UQG A;  4FYD A;  4DG1 A;  1X9S A;  4DSJ A;  2HHU A;  1K6Y A;  4FJJ A;  4CF9 A;  5J1E A;  4DTN A;  1X9M A;  3LP0 A;  2EX3 A;  4BE2 A;  4FLW A;  2XRI A;  1VSI A;  3K2P A;  1ZBL A;  3SI6 A;  2ITG A;  1VK0 A;  3AV9 A;  2HHQ A;  5HRP A;  5HLF A;  3MEE A;  3ZSY A;  3KLH A;  1N5Y A;  4I9L A;  1QSL A;  4EZ9 A;  1A5V A;  3SV4 A;  1JLB A;  2YHA A;  3LWL A;  3EZ5 A;  3MXM A;  4B9S A;  1BHL A;  1IH7 A;  4RW6 A;  4CGH A;  4E3S A;  1XHX A;  1WAJ A;  3A2F A;  1XHZ A;  4Z4E A;  4CJ4 A;  3DMJ A;  1NKE A;  1JL2 A;  3VN5 A;  5KTQ A;  2IDO A;  1FKP A;  2YKN A;  3VQP A;  5I42 A;  4C8K A;  1GOA A;  3VA0 A;  2OZS A;  1J53 A;  3V9W A;  3DLB A;  3QIN A;  4CJL A;  4DSL A;  3TAR A;  1HNV A;  1BIU A;  2D0A A;  2FBX A;  2YNG A;  4CF1 A;  4CFB A;  3LWM A;  4CES A;  4PQU A;  4CEQ A;  1TGO A;  1B92 A;  1WSE A;  3ZSX A;  4CJK A;  4FJ5 A;  1BQM A;  4AHC A;  3K5N A;  2HND A;  3SCX A;  4IDK A;  3CFR A;  3WNE A;  2JLE A;  5SWM A;  1RT2 A;  2HHW A;  4CK2 A;  4M3X A;  1KTQ A;  4FJX A;  2PZS A;  4DTO A;  3HJF A;  2OPS A;  3QET A;  1CXU A;  4BE0 A;  4CJQ A;  3NE6 A;  4NCA A;  1NJX A;  4DQI A;  1VSM A;  3VQA A;  3IS9 A;  1RCH A;  3LZI A;  2IOC A;  3PV8 A;  3RMC A;  3NBP A;  3THV A;  2KFZ A;  3VQ8 A;  4C8M A;  4M41 A;  3O3H A;  3SJJ A;  4FZY A;  2DY4 A;  1LAW A;  3DRS A;  4HUE A;  4DLE A;  3QEP A;  4KFB A;  1RDB A;  2X74 A;  3L2Q A;  1Q9X A;  4FJH A;  3T19 A;  3LDS A;  3VQD A;  4FJN A;  3AVG A;  4NYF A;  5KRT A;  3PO4 A;  2X6N A;  3SYZ A;  5HP1 A;  1ASU A;  3V9X A;  1QTM A;  4B08 A;  3KD5 E;  4FM1 A;  3AVC A;  4HTU A;  4RG8 A;  1EXQ A;  1JXE A;  3DYA A;  3CM5 A;  3LAM A;  3P5J A;  4CJR A;  4M3U A;  3ZSO A;  2RPI A;  1EP4 A;  4F3T A;  4IFV A;  1UOC A;  3L3U A;  4AHV A;  2R7Y A;  2KW4 A;  1EET A;  1LWF A;  1MU2 A;  3VQ5 A;  4KB1 A;  1S1W A;  1N6Q A;  3NCI A;  4H8K A;  4M3W A;  1RTD A;  1SL0 A;  3QEW A;  2DFE A;  1JKH A;  1RT4 A;  3ASM A;  2BAN A;  3S3N A;  3C94 A;  3SUQ A;  1LWE A;  1L3S A;  4C8L A;  2QKB A;  3ISN C;  2E6M A;  1WLJ A;  4IG0 A;  3SUP A;  1TK0 A;  1NJW A;  4LD0 A;  4KTQ A;  2I5J A;  4DU3 A;  3K57 A;  4KAZ A;  4DWI A;  5CY4 A;  3OYC A;  1R0A A;  4CJ3 A;  4DFJ A;  3AVK A;  3ZT3 A;  3WNH A;  1HQE A;  1A5X A;  3SV3 A;  4B9V A;  1JLQ A;  4CCH A;  3DLR A;  4B8A B;  4DTM A;  2ZQB A;  3WNF A;  4FXD A;  2KTQ A;  2NUB A;  1Y97 A;  5E41 A;  4OVL A;  2Y1J A;  2D0B A;  1HMV A;  3HM9 A;  4DS5 A;  4HUG A;  4Q0B A;  2G8W A;  4B9U A;  3QEV A;  2W42 A;  4LY7 A;  2HHT A;  3KLI A;  4CFD A;  1HYS A;  4CGI A;  4LSN A;  3NGI A;  3PUF A;  2GBZ A;  4E0D A;  5HBM A;  4CHY A;  3TI0 A;  1YTU A;  4KPY A;  4CJP A;  3VQ4 A;  4Y1D A;  4DS4 A;  2Z1J A;  3SQ0 A;  1T03 A;  1A5W A;  1HQU A;  2YNH A;  4IBN A;  3NF9 A;  1RBS A;  1BI4 B;  3FFI A;  4MFB A;  1L3T A;  5HRO A;  1HRH A;  2RF2 A;  3PX4 A;  1DTQ A;  3P1G A;  3T3F A;  3VQ9 A;  4B9T A;  3PY8 A;  4ID5 A;  4KHS A;  4CEA A;  2P51 A;  1W9H A;  1KVC A;  4ELT A;  4CHN A;  3AVN A;  3KIO A;  3ZSZ A;  1U48 A;  1U04 A;  4ID1 A;  2Y1I A;  4LH5 A;  1KLN A;  1IG9 A;  1XWL A;  1S6Q A;  2B4J A;  3ZSR A;  2F8T A;  3IG1 A;  2KZZ A;  1C0M A;  2WON A;  3O4N A;  4DFM A;  3SUO A;  1NOZ A;  1VRT A;  3RTV A;  1RBV A;  1RBU A;  1RDD A;  4MQ3 A;  4DTP A;  4CHP A;  3L3V A;  4E7I A;  3F9K A;  1HJR A;  4BAC A;  4KO0 A;  4KKO A;  1I3A A;  2YHB A;  4CJ5 A;  3KK2 A; 
#chains in the Genus database with same CATH topology
 1NG9 A;  4G9Z A;  3HBT A;  5BPM A;  5BRE A;  2E5L K;  2QXF A;  1N8R O;  2HST A;  3D0P A;  5J2P A;  4FWO A;  3L8B A;  1BGX T;  3HK2 A;  2VWB A;  3G0Z A;  5AZJ B;  3LDO A;  3F2K A;  3E9P A;  1NGB A;  5EXW A;  3TAB A;  3RMD A;  3TAM A;  2O4G A;  3V6D A;  4DV1 K;  1RDU A;  3O9Q A;  4M3T A;  5JIC A;  4B8C A;  1RT6 A;  4M7X A;  4ISF A;  1DTT A;  3TAG A;  1NK5 A;  4CBX A;  4W5Q A;  4J2B A;  1Z05 A;  3D2F B;  5M1O A;  5GAG P;  1SKR A;  4ZHR A;  1NK7 A;  4B1Z A;  3TTD A;  4O55 A;  1GLL O;  4FPB A;  3J80 O;  4OO1 J;  4E89 A;  3FGU A;  1KAX A;  1S5J A;  3K5L A;  2A1S A;  3DOL A;  2QTD A;  3E9L A;  3VQ6 A;  3DLH A;  5AQW A;  3QNN A;  4WE1 A;  3HVR A;  4AHS A;  2HMI A;  2EWS A;  2VG6 A;  3TAN A;  4H5R A;  5C0Y A;  3DAW A;  3HPG A;  4NCG A;  4NXM K;  3VQQ A;  4QOZ B;  2VG7 A;  4C8O A;  3OYF A;  2XY7 A;  4CIF A;  1XUP O;  4WFB L;  4FJL A;  3MCP A;  4JRQ A;  1EQY A;  2YHW A;  5AQF A;  3CJ9 A;  4W5O A;  3RRH A;  4OPK A;  2OPR A;  3E66 A;  4FWS A;  4O4G A;  2P9K A;  5AQX A;  3THW B;  2YCH A;  4PKI A;  1HPM A;  3TAP A;  3QIP A;  2FBY A;  4ILG B;  3KZB A;  2HNY A;  3C65 A;  4AIL C;  3TSU A;  3ULE B;  2O8B B;  2ZGY A;  2CH5 A;  5BRD A;  3V9Z A;  3LAL A;  2Q36 A;  1BU6 O;  4Z4H A;  3RWU A;  2P9S A;  5KQD A;  3H46 O;  4BC4 A;  2NRV A;  3O4W A;  3CER A;  4A5B A;  3CQ8 A;  2HNZ A;  4IOA L;  2ZWH A;  3SUN A;  2NRX A;  1B9F A;  5ELZ A;  4A61 A;  4FLT A;  1BA0 A;  4BR2 A;  3HYF A;  1RFQ A;  4KH4 A;  4I6M A;  3CFO A;  1RBR A;  2NZT A;  3NDK A;  4KH5 A;  1NWK A;  1KSP A;  3OS2 A;  4CFC A;  3JSM A;  5DM7 L;  4KH6 A;  4O8U A;  2IC3 A;  3HPO A;  1MWK A;  3HXM A;  5LJW A;  1ZBU A;  4FLX A;  3HO1 A;  4KI4 A;  1HKB A;  4B3O A;  1UAX A;  2FXU A;  2I7N A;  1GOB A;  3M8Q A;  2BE2 A;  4FOI A;  4KHN A;  2YV0 X;  1O1W A;  5EU7 A;  1XNR K;  2IIR A;  3LM9 A;  1RTJ A;  3L0Q A;  2GTD A;  1L3U A;  1FK9 A;  1Q82 O;  1E4F T;  3H1Q A;  3DLL L;  4JI6 K;  5KPR A;  1D4X A;  3VF2 A;  3F9M A;  2E6L A;  3SPZ A;  3UIQ A;  3EYZ A;  4CF8 A;  1RTH A;  4O0I A;  4CGJ A;  1J5E K;  4BRQ A;  3K5M A;  1YXQ A;  4OPH A;  5FDL A;  3TTF A;  4CHQ A;  3ENO A;  3U6F A;  3NMU A;  2FSN A;  3LDQ A;  4BR9 A;  5BR9 A;  1HKC A;  2D0P A;  2A41 A;  4B3R K;  1WSI A;  3KLG A;  1U49 A;  5C2D A;  4JI8 K;  1Z26 A;  3ZYY X;  2BGG A;  5FRO A;  4B1U B;  3VA3 A;  3VEZ A;  3CXC M;  3H3O B;  3LDN A;  1KFS A;  2GEM A;  2FSJ A;  3JAM O;  3O3G A;  2ASM A;  1NK6 A;  2DTU A;  1T44 A;  1RTI A;  4W5R A;  1KC8 O;  3HTV A;  5GAE P;  4K25 A;  3P39 A;  3VER A;  1C0T A;  4W5N A;  5J2Q A;  2W41 A;  4FZZ A;  2CGJ A;  3ZSW A;  4JKB A;  5GAD P;  2JGU A;  3HL8 A;  3NF6 A;  4KI6 A;  1S9G A;  4FCY A;  5DM6 L;  1ITG A;  5M1F A;  3TAF A;  3BDP A;  4H4M A;  4CHO A;  4N47 A;  4DFK A;  3OBW A;  3CD6 N;  3MK6 A;  1YAG A;  4CJS A;  3L6Q A;  4YOX A;  3VEW A;  4BRO A;  1YVU A;  1SUQ A;  1OH7 A;  3LDL A;  3LDP A;  3MN6 A;  3OYE A;  4PA1 A;  4DCH A;  3THY A;  2P9K B;  4E7J A;  4CEF A;  4E1J A;  4ISE A;  2GUP A;  3TR8 A;  4R5P A;  1IKW A;  3IRX A;  3BGR A;  1RIL A;  4EFH A;  2P9I A;  4H5W A;  5I9E B;  1D5A A;  1ZYQ A;  1C0F A;  4B9L A;  2P9N A;  2P9S B;  4JEP A;  1KLM A;  4CJU A;  4FK4 A;  2NRZ A;  3HM8 A;  2G8I A;  3V1O A;  4BC2 A;  3V4I A;  4DMN A;  4DHY A;  3WQT A;  5AQQ A;  1Q81 O;  3SLC A;  3VEO A;  2HW3 A;  4JKD A;  1TL1 A;  3QEX A;  1YIT N;  4I6M B;  5FPM A;  1QHA A;  4JK9 A;  4FO0 A;  5K14 A;  3O5B A;  3CET A;  2WBN A;  5BR8 K;  4PY5 A;  3QFU A;  3L2V A;  3OYK A;  3F73 A;  4DTS A;  1NK4 A;  5H1S Q;  1RT3 A;  4H4O A;  4FVU A;  1I94 K;  3ULD A;  2YHY A;  3KLE A;  3O4Q A;  3D2E A;  3MEC A;  4JKA A;  3UB5 A;  3AO4 A;  3LAK A;  3TAE A;  1HX1 A;  3CJC A;  2YJE A;  3G25 A;  4PUO A;  1FJG K;  2RHK A;  3VQB A;  1J54 A;  4AH9 A;  4IEE A;  1X9S A;  3SBT A;  1K6Y A;  4DTN A;  3GE1 A;  4EHT A;  3LP0 A;  3K2P A;  2A40 A;  2E8A A;  3SI6 A;  2HHQ A;  5HRP A;  3CCV N;  4DB3 A;  3RSE A;  3LWL A;  2NRR A;  2A6A A;  1BHL A;  4E3S A;  3A2F A;  3DMJ A;  1JL2 A;  4GKK K;  3VN5 A;  5I42 A;  3VA0 A;  3CCQ N;  1J53 A;  3V9W A;  3QIN A;  4CJL A;  4DSL A;  2WC9 A;  3M6G A;  4OX9 K;  4MLH A;  4CES A;  4CEQ A;  1ILY A;  3CHW A;  4CJK A;  4FJ5 A;  3K5N A;  3SCX A;  5TKW A;  5FPD A;  4X65 K;  3WNE A;  2CGK A;  4H0O A;  3AAP A;  3HJF A;  1CXU A;  3U9Z A;  4B3M K;  3R6M A;  4DQI A;  5C10 A;  3LZI A;  4DV5 K;  3PV8 A;  3NBP A;  2KFZ A;  2HF4 A;  3C0B A;  1LAW A;  3QEP A;  3DXK A;  3J81 O;  4FJH A;  5AQT A;  2QWP A;  4FJN A;  3H3N O;  5KRT A;  5F1X A;  3CPE A;  1ASU A;  4YOU A;  5BRH A;  4FM1 A;  3ENB A;  2I7P A;  4RG8 A;  4CJR A;  3P5J A;  3ZSO A;  5KPT A;  1EP4 A;  2O8C A;  1EET A;  2QW9 A;  3VQ5 A;  1FW6 A;  4H8K A;  3QEW A;  3HI0 A;  2BAN A;  4JI2 K;  1Y64 A;  1LWE A;  2E6M A;  1QQN A;  4LD0 A;  3W0L A;  3EN9 A;  4DU3 A;  5AQY A;  3VEN A;  3CCU N;  4CJ3 A;  3H6E A;  3ZT3 A;  3WNH A;  4B9V A;  1A5X A;  4FXD A;  3BUZ B;  3WNF A;  3ZEU A;  3THY B;  4RCH A;  2W6L A;  1BUP A;  4WFA L;  4FWN A;  2ASO A;  3HM9 A;  2ZM6 K;  4BQZ A;  4Q0B A;  3QEV A;  2W42 A;  4OPA A;  1ZXO A;  4CGI A;  1YTU A;  1A5W A;  5E26 A;  4IBN A;  5CR4 A;  2P9N B;  2RF2 A;  4YHH K;  3P1G A;  4JKG A;  2Q0U A;  5KQ8 A;  4ID1 A;  2Y1I A;  4IEI A;  2F8T A;  3ZSR A;  1S6Q A;  1S22 A;  2KZZ A;  4AF1 A;  1YI2 N;  3RTV A;  3SJH A;  1RBU A;  3OA9 A;  4JI5 K;  4H03 B;  4CHP A;  2O8E A;  1HJR A;  4KO0 A;  1J6Z A;  1HQE A;  3KK2 A;  1K73 O;  1CZB A;  4CED A;  2BUP A;  3LAN A;  2DFH A;  4BDZ A;  5AQS A;  4N76 A;  3KKS A;  3NH0 A;  1LAV A;  3D2E B;  1WBD A;  2Q3S A;  1BA1 A;  4K8X A;  4F8R A;  1GLD G;  4LF5 K;  3OBY A;  5JS1 A;  2BH1 A;  4DV4 K;  1TYQ A;  2NLX A;  4YNQ A;  5ADX H;  3KWG A;  1BL3 A;  3AVH A;  4CZI A;  3LZJ A;  3M1F A;  3S9H A;  1ATN A;  4BWM A;  4AHU A;  4NCB A;  4M42 A;  1VQN N;  5CYQ A;  1SV5 A;  2DFF A;  4I2Q A;  3ZX3 A;  1NJI O;  3O9T A;  3A5L C;  3OYH A;  4O8K A;  3CFP A;  4KHP K;  3RSE B;  1NKC A;  1VQ8 N;  1KCF A;  3SQ2 A;  3PSI A;  5AQL A;  5CHI A;  3PIO L;  2RKI A;  4BVP A;  4ELV A;  3FZM A;  3VQE A;  1YT3 A;  3HZ6 A;  3T1A A;  2IVO A;  4C8N A;  1TK5 A;  1KD1 O;  2HBL A;  4IWV A;  3SBG A;  2G8F A;  4DTU A;  4BE1 A;  4BRC A;  1EO1 A;  4MLE A;  2X78 A;  4A62 A;  4YOR A;  3R1X A;  2PAV A;  4RW9 A;  2A42 A;  4IG3 A;  4FWP A;  4FJI A;  3OYM A;  3DXK B;  1KVB A;  5AQH A;  1YJN N;  3EKS A;  2IGI A;  2IVP A;  4DFP A;  3K59 A;  3DLE A;  1NGE A;  1X9W A;  3MXJ A;  4DQQ A;  3QBX A;  4Y1C A;  3SMS A;  5DMR A;  4JS5 A;  3PLA A;  3P83 D;  4CK3 A;  3ATV A;  2GWJ A;  5CZ2 A;  5FLX O;  3F5T A;  2KLA A;  1RGI A;  2X6S A;  1VQ9 N;  2O4I A;  1J5O A;  4IJN A;  5AQP A;  1T6D A;  4JHD B;  3HVT A;  3KKR A;  1Z6R A;  3D6R A;  5AQN A;  3AVL A;  3U3G A;  1FXX A;  1IKY A;  4M3R A;  1E4G T;  2VYP A;  2KTQ A;  4YOV A;  3ZEU B;  4FJK A;  4DUZ K;  3CC7 N;  4Z4F A;  1T6C A;  1BDG A;  5KGW A;  1NNE A;  1IKV A;  1QQC A;  3D45 A;  4IZ9 A;  3SPY A;  4GKJ K;  2KQ2 A;  3ZSQ A;  5C2F A;  5A2Q O;  4JI3 K;  3Q7B A;  1OH6 A;  4JS4 A;  1TKX A;  4J2A A;  4JI4 K;  1VQ4 N;  1HUX A;  3AA3 A;  3MXI A;  1ZBH A;  5BN8 A;  4CE9 A;  3FZF A;  4LF8 K;  3E9O A;  4B1X B;  2JWK A;  2PY5 A;  1R59 O;  5HL7 L;  3GG4 A;  4CGD A;  2O8E B;  5M1P A;  3AA2 A;  3AAQ A;  5AFU H;  3PX0 A;  2J4R A;  1W0H A;  1GOC A;  1WSF A;  2PBD A;  1XI1 A;  4Z4C A;  5KGX A;  1HPZ A;  4NYN A;  1D9D A;  3B6P A;  3HST B;  4DSE A;  3RR7 A;  1HYV A;  3A5O C;  1J9A A;  3TTC A;  4J2D A;  1VQK N;  1TYQ B;  4B3T K;  3OJS A;  2IAJ A;  4RWT A;  5BPL A;  5M1N A;  1T7P A;  3CCL N;  4GVM A;  3M8R A;  3VF4 A;  4GW6 A;  3VOV A;  1WAF A;  2XY8 A;  3QIO A;  1B9D A;  4OKK A;  3SAH A;  1QSY A;  4CZF A;  4KHY A;  4U7B A;  3KD1 E;  3VF6 A;  3FZL A;  3B6O A;  3ID6 A;  1LV5 A;  4E1N A;  4L3Q A;  4BDP A;  1LW2 A;  1NK0 A;  1BQN A;  1JLC A;  2G8H A;  1RT7 A;  2AJQ A;  1U4B A;  3MWP A;  4BRI A;  1WOQ A;  1NKB A;  3OYJ A;  4J8F A;  5SZT A;  3LP1 A;  2JWL A;  5FRM A;  4BR4 A;  2HHV A;  1YJW N;  4UY8 O;  3LPT A;  3OS1 A;  2NRH A;  4DF8 A;  2E1Z A;  3OHR A;  4W5T A;  4B9N A;  3SNN A;  4O44 A;  2ZD1 A;  5AQI A;  3O9R A;  4M3Z A;  4HVJ A;  3LM2 A;  1QQM A;  2OPQ A;  1OH8 A;  4QS9 A;  1F21 A;  1JLA A;  1RT5 A;  2QA4 N;  4H0Y B;  3OY9 A;  4NXN K;  2V7Z A;  4BG8 A;  5AQU A;  3DRP A;  4H5T A;  3NGY A;  2D4W A;  3K9J A;  3SZ2 A;  2QWQ A;  3NVK A;  3DM2 A;  1WUA A;  1VSD A;  4WQ4 A;  1BI4 A;  4BQL A;  2Z1H A;  3M8P A;  1ASW A;  1KXP A;  1TAU A;  1U2V B;  4B9M A;  1RDW X;  4CJT A;  4HCB A;  2PYJ A;  3WNG A;  1SL1 A;  3OYG A;  2HVI A;  3CYM A;  1IBM K;  4FK0 A;  4FJ8 A;  3RR8 A;  4WF9 L;  3UKU A;  4Y0W A;  4CZG A;  4DR6 K;  1UA0 A;  1KAZ A;  2F96 A;  3VEX A;  3KK3 A;  1QHT A;  1W2B M;  4XIU A;  1S72 N;  2EHG A;  3CC4 N;  4ILH A;  4F2S A;  3ALY A;  4DU4 A;  3HOS A;  2WUS A;  1VSJ A;  3WXI A;  2B6A A;  3U8X A;  4M7Y A;  4JKE A;  4FWK A;  2YKM A;  1NGC A;  2Q2R A;  2YHX A;  3ZET A;  3ZX0 A;  5C24 A;  1NGD A;  5HRS A;  1S1U A;  4I2P A;  4PKH A;  3AVI A;  3AVB A;  1C0G A;  2F9T A;  4FYD A;  2HHU A;  3O80 A;  4FJJ A;  1X9M A;  3NVM A;  4BE2 A;  4FLW A;  3VMF B;  2ITG A;  1VK0 A;  3CIP A;  3AV9 A;  1NLV A;  3ZSY A;  1N5Y A;  4I9L A;  1JCG A;  1JLB A;  3EZ5 A;  3KK7 A;  3MXM A;  1XHX A;  1XHZ A;  3T1Y K;  3VGL A;  3G71 N;  1FKP A;  4C8K A;  1IBK K;  2QEX N;  1HNW K;  3DLB A;  1IG8 A;  2D0A A;  2FBX A;  2YNG A;  4CFB A;  3VES A;  1QQO A;  2IVN A;  1BO5 O;  3ZSX A;  4IJA A;  4WQ4 C;  2HND A;  4CBU A;  1BOT O;  5SWM A;  1XMO K;  1VQ7 N;  1O13 A;  1RT2 A;  2HHW A;  2PZS A;  3QET A;  4NCA A;  2NRT A;  2YI1 A;  1NGH A;  3RMC A;  2IOC A;  4WCE L;  1ATR A;  3VQ8 A;  3SJJ A;  2VQF K;  3DRS A;  4HUE A;  1Q18 A;  4MO5 A;  4A59 A;  1RDB A;  2X74 A;  3L2Q A;  1Q9X A;  3LDS A;  2X6N A;  3SYZ A;  5HP1 A;  3V9X A;  1SQK A;  1QTM A;  3KD5 E;  1XMQ K;  4HTU A;  4M3U A;  1EXQ A;  1JXE A;  5ADX A;  3CM5 A;  1WBB A;  2UUB K;  2ASP A;  1W7A A;  1UOC A;  2CH6 A;  3GDQ A;  1ZBS A;  1U6Z A;  1QZ5 A;  4DR1 K;  1MU2 A;  3B8A X;  4KB1 A;  3NCI A;  1GLB G;  1JKH A;  4C8L A;  2QKB A;  4IG0 A;  3CCM N;  1TK0 A;  2I5J A;  2E2N A;  3K57 A;  4KAZ A;  4DWI A;  4IO8 A;  3OYC A;  3SV3 A;  5AR0 A;  3N4P A;  1JLQ A;  3DLR A;  4DTM A;  3T7Z A;  2NUB A;  3EEQ A;  1Y97 A;  4OVL A;  2Y1J A;  2D0B A;  1HMV A;  4DS5 A;  4KBO A;  4JKH A;  2NNW A;  3SAF A;  3KLI A;  4CFD A;  1KAY A;  2GBZ A;  4KPY A;  1GLJ O;  3VQ4 A;  4DS4 A;  3J8A A;  5AQG A;  3JS6 A;  1RBS A;  1BI4 B;  1L3T A;  1EWQ A;  2QWL A;  3CJ7 A;  4C1N K;  2YJF A;  4PL7 A;  3P38 A;  4DKW A;  4H0X B;  4DR4 K;  4PKG A;  1C0M A;  3UKU B;  3O4N A;  1IBL K;  4A57 A;  4MQ3 A;  1RDD A;  4E7I A;  4BAC A;  3Q7C A;  3LPU A;  4CEO A;  5GIP A;  4E0D A;  4CJ5 A;  5IT9 O;  4RW8 A;  4IKF A;  2HVH A;  1YTA A;  5HRN A;  2E4L A;  5EY4 A;  2F7T A;  4N41 A;  4FM0 A;  3ZET B;  4PWD A;  1Q8I A;  3OYD A;  3TPQ A;  3SK3 A;  3G6E N;  1NGJ A;  2WFB A;  4XH5 A;  1QSS A;  1HNX K;  4DQP A;  2O8D A;  1NBW A;  1K8K A;  3T69 A;  3QLH A;  4CK1 A;  3VQ7 A;  3HT3 A;  4RW7 A;  3U3Y A;  1Q9Y A;  4JI0 K;  3KWI A;  4DSJ A;  1DLO A;  4DSF A;  3CJA A;  5EVZ A;  2VQE K;  3CI5 A;  3CC2 N;  1S3X A;  4FZX C;  4KTZ A;  1HNZ K;  4MDA A;  2YX6 A;  2OTJ N;  3LP2 A;  4CZK A;  1JL1 A;  2QKK A;  1T3V A;  2ATQ A;  4FK2 A;  2HBJ A;  1TKT A;  1BIZ A;  3C6H A;  1EWR A;  2F9W A;  3EE8 A;  3G10 A;  3R9P A;  3BF1 A;  3C6U A;  3CQY A;  1IO2 A;  2PYL A;  1OKJ A;  3AVA A;  3KTQ A;  4CER A;  4LSL A;  3OYI A;  4KRF A;  1BCO A;  1D8Y A;  4OGE A;  3CG7 A;  1JJ2 M;  1CZA N;  1VQO N;  1JXB A;  5AFU A;  4CF2 A;  3K58 A;  3TSP A;  3DXM A;  2G8U A;  1NK8 A;  4FWM A;  2QK9 A;  1U45 A;  3QO9 A;  1LW0 A;  3KJV A;  3CM6 A;  2VCP A;  4FLU A;  3E01 A;  4CGG A;  2VWK A;  3WQU A;  4J2E A;  3NH2 A;  4TSX A;  5I3U A;  4FM2 A;  1TK8 A;  2RE2 A;  1NJZ A;  4V19 S;  2AA4 A;  4FPA A;  4DQR A;  1JCE A;  1HJO A;  3C95 A;  4FW2 A;  3KLF A;  1REV A;  3JXU A;  2HMP A;  5GIN A;  2HBK A;  4EP5 A;  3VEV A;  3QNO A;  4OKJ A;  2ITM A;  3MAQ A;  4ZTF A;  2YNI A;  1XQS C;  3TSQ A;  4Z0U A;  1D9F A;  1KFD A;  2OAN A;  2Z1G A;  1M90 O;  3I0R A;  2OZM A;  3CME N;  3CJ1 A;  2P9I B;  4Z4I A;  1VQ5 N;  4CJV A;  3WT0 A;  5LMU K;  1ZBI A;  3BZC A;  3L4I A;  4E1M A;  1NGF A;  3DOK A;  3O8M A;  1TV6 A;  4AM6 A;  3R3L A;  2XO7 A;  5LMN K;  4LF6 K;  2YNF A;  4RW4 A;  2GUI A;  4HTL A;  2Q1N A;  3HOT A;  1SAZ A;  2GWK A;  4EHU A;  4Q5V A;  1I39 A;  1G15 A;  4PL8 A;  4CGF A;  4FJG A;  4C1N I;  3HP9 A;  3WXJ A;  3J7Z O;  3WEE A;  3L2R A;  1LCU A;  1VSH A;  4LFC K;  4HWI A;  4KHW A;  4DSI A;  4CZE A;  1VSK A;  4K41 A;  1DGK N;  3J7A P;  1X9J A;  1DKG D;  4L8R B;  1U47 A;  3BY5 A;  3OYB A;  1L3V A;  4MO4 A;  5FPN A;  4QCL A;  4JRP A;  3G4S N;  2P1J A;  4LC9 B;  5AQV A;  1IKX A;  1G99 A;  1XC3 A;  2OCE A;  4HCC A;  1NGG A;  4GNI A;  1ESV A;  4YFU A;  1K8K B;  2G8V A;  3CCS N;  5FRN A;  4O5F A;  1L5U A;  2W6K A;  5DK5 A;  1QS4 A;  1EX4 A;  1H1V A;  4F9O A;  3S3M A;  1FKO A;  3RRG A;  4BGB A;  3V1R A;  4ICL A;  2KFN A;  1NK9 A;  2HHS A;  3D7E O;  1WSH A;  3LP3 A;  4BC3 A;  4IOC L;  2FBT A;  1Q7Y O;  3L2U A;  1YVN A;  3K0S A;  4IO9 L;  1XC9 A;  3GL1 A;  3V1Q A;  2ZJP L;  3BZK A;  4DF4 A;  1VRU A;  3NGZ A;  4N56 A;  4BR0 A;  3VQC A;  5LL6 Z;  3VTI A;  2WOM A;  3U9D A;  4ELU A;  3MEG A;  4E7K A;  2A1R A;  4JKC A;  4FL9 A;  2B5J A;  3H08 A;  1TUY A;  4CEB A;  2O8C B;  5CYM A;  1VQP N;  3DXM B;  3NFA A;  1V4S A;  4PHT X;  3MN7 A;  2P5O A;  3DI6 A;  5HRR A;  4DR2 K;  4JI7 K;  5LJV A;  2XY5 A;  5FPE A;  3DRR A;  1WNS A;  1YUW A;  4AHR A;  5EX5 A;  4BRM A;  4E7L A;  4K0K K;  3OTO K;  3AO2 A;  3KVG A;  1YF5 L;  3TWH A;  1TVR A;  3VTH A;  3ZT2 A;  1ZBF A;  1YIJ N;  2QWM A;  3QFP A;  4IXC A;  2FBV A;  5MLC Q;  3NH1 A;  4CIG A;  1S1T A;  5JLF A;  1ATS A;  3V81 A;  4CJF A;  4FLV A;  4K43 A;  2ZE2 A;  3AAR A;  4H0P A;  4YOT A;  1BG3 A;  4ZTJ A;  1CLQ A;  4JKG B;  2XHB A;  4BRF A;  4M45 A;  2V7Y A;  4CFA A;  3MED A;  2E2Q A;  4KRE A;  2HB5 A;  4QS8 A;  3A8Y A;  2A5X A;  4I7F A;  4DR7 K;  4JK8 A;  1T8E A;  1X1P A;  1VAZ A;  4F2R A;  4CEZ A;  2UYT A;  3SQ4 A;  5C25 A;  3DLK A;  4CI6 A;  1VHX A;  1SL2 A;  3WEE B;  4X64 K;  4YY3 K;  2E20 A;  2ZGZ A;  4DG1 A;  3CQX A;  1NGI A;  5AZI A;  4CF9 A;  2EX3 A;  3EO3 A;  1ZBL A;  4JD2 A;  1GLC G;  5HLF A;  3MEE A;  1QSL A;  3KLH A;  1A5V A;  1WB9 A;  3SV4 A;  4B9S A;  1IH7 A;  1WAJ A;  2HBM A;  3IMX A;  1NKE A;  5KTQ A;  2IDO A;  3BF3 A;  4Z94 A;  3VQP A;  4K42 A;  2E88 A;  4DV7 K;  3TAR A;  1BIU A;  5GAH P;  3LWM A;  4GV6 A;  4PQU A;  1TGO A;  1HKG A;  4AHC A;  4BRL A;  3MN9 A;  4M3X A;  1KTQ A;  4FJX A;  4DTO A;  4AQY K;  4BE0 A;  3MMV A;  4CJQ A;  1VSM A;  3IS9 A;  4LF7 K;  3THV A;  4FZY A;  4DLE A;  4KFB A;  4RTF D;  3RVC A;  3T19 A;  3VQD A;  3VGK A;  3AVG A;  3WXM B;  3PO4 A;  2FSK A;  4JI1 K;  5F0X A;  4IFV A;  3FLC O;  4X62 K;  3L3U A;  4AHV A;  4BRN A;  2R7Y A;  4JYA K;  4U67 L;  1LWF A;  5AQJ A;  1N6Q A;  3MN5 A;  1RTD A;  3W3D A;  3HRG A;  3S3N A;  3SUQ A;  3P31 A;  3ISN C;  4NB4 A;  1WLJ A;  3SUP A;  2UU9 K;  1NJW A;  2QM1 A;  3SMP A;  4WYB A;  4B1Y B;  5CY4 A;  2VGM A;  4YOY A;  4CCH A;  1X3M A;  3N4Q A;  4B8A B;  2ZQB A;  1NU0 A;  3FZK A;  5E41 A;  4HUG A;  2FF3 B;  3I55 N;  4NLC A;  1VQM N;  2E2O A;  4LY7 A;  3THX A;  3O1W A;  4LSN A;  3PUF A;  3NGI A;  5HBM A;  4CHY A;  3TI0 A;  1N32 K;  2UXC K;  4Y1D A;  1T03 A;  3CCJ N;  1HQU A;  5TKY A;  1QZ6 A;  4R79 A;  5JLH A;  3PX4 A;  1DTQ A;  3T3F A;  3VQ9 A;  4B9T A;  3PY8 A;  4KHS A;  2F4V K;  4CEA A;  1W9H A;  1IJJ A;  1KVC A;  3WXL A;  1U04 A;  1KLN A;  1IG9 A;  1XWL A;  2B4J A;  1NOZ A;  3CF5 L;  1VRT A;  1RBV A;  2PFU A;  4DTP A;  3FFK B;  4KKO A;  1I3A A;  2YHB A;  1M1K O;  4NO7 A;  1S1X A;  1TL3 A;  4A2B A;  5B8H A;  3HPH A;  5M1Q A;  4CJE A;  3O08 A;  5BRF A;  3VET A;  4CJ7 A;  3T1H K;  3OYL A;  3C7N A;  3GBT A;  5BN9 A;  3IUC A;  3NAE A;  1HYZ A;  2D5R A;  3AO3 A;  3NHG A;  4OJR A;  3L4Q A;  3ZX2 A;  3IDH A;  3ZSV A;  5AZI B;  2Q97 A;  1RBT A;  1UA1 A;  1WSJ A;  3O1B A;  4IDH A;  2P5G A;  4X66 K;  4H0V B;  3ZT0 A;  4JD2 B;  4O5B A;  4H0T B;  1C0U A;  3H1V X;  4FW1 A;  4HUF A;  3AGR A;  1CZ9 A;  3NF7 A;  5JMV A;  1BWF O;  1VSE A;  3U4L A;  4WFN L;  5J2N A;  5JS2 A;  4LH4 A;  1WSG A;  1HLU A;  4DUY K;  3A5N C;  2Z1I A;  1UWB A;  2O8F A;  1ZC6 A;  3IFR A;  1OH5 A;  2GX9 A;  1C1C A;  2GV9 A;  1T05 A;  5AQM A;  4JN4 A;  1QVF M;  4KHQ A;  1K8A O;  2UXD K;  4FLZ A;  1VSF A;  4FJ7 A;  3ENH A;  4CF0 A;  3CMA N;  1RDA A;  4OLA A;  4CZH A;  1HR0 K;  1VQL N;  4FVM A;  4GY2 B;  3HP6 A;  4FJM A;  2XY6 A;  4GV3 A;  3ID8 A;  3RMB A;  3TAQ A;  3SAG A;  3O9U A;  2UUA K;  4H5V A;  5KRS A;  3V9U A;  1NJY A;  4MDB A;  1MWM A;  2KHO A;  5CZ1 A;  4B1V A;  3FR0 A;  2ZF5 O;  3OYA A;  2OYQ A;  2VG5 A;  4LFB K;  3JYT A;  2ETJ A;  4KHU A;  3OJU A;  4BR7 A;  3OVN A;  2Q0R A;  4CEE A;  1GLE G;  4BY9 C;  2KKZ A;  4G1Q A;  3MX2 A;  4M3Y A;  2UXB K;  3CCR N;  1JLF A;  3QDK A;  5E84 A;  2Q31 A;  4O0J A;  4JKF A;  2ZJR L;  1C6V A;  5KI6 A;  2LSN A;  1KVA A;  1CXQ A;  2H3G X;  1TUU A;  3AA5 X;  3AO1 A;  1ASV A;  2G8K A;  2D1K A;  3AO5 A;  3UE5 A;  1OVY A;  1YHQ N;  5GIO A;  1IV0 A;  3SQ1 A;  3ZCM A;  3A0I X;  3K9K A;  2ZJQ L;  3DJC A;  3THX B;  4IFY A;  4BR5 A;  4EZ6 A;  1KRP A;  2D0C A;  3GOI A;  3HSC A;  3QEI A;  4BWJ A;  2FC0 A;  3L2W A;  3NF8 A;  4OLB A;  2CGL A;  4XEI A;  1NMD A;  2P9P A;  2HHX A;  4F3O A;  4DTJ A;  3QB0 A;  4CZJ A;  4B3S K;  3O6W A;  1QE1 A;  3QBW A;  4LF9 K;  3I33 A;  5M1K A;  1DT9 A;  1S9E A;  4BGA A;  2HF3 A;  3AVJ A;  2HOE A;  1TKZ A;  2A3Z A;  3VGM A;  5T7B A;  3P4I A;  3AGK A;  4DLG A;  3IAY A;  3OYN A;  4FSV A;  2RN2 A;  3AVM A;  3I56 N;  5D3G A;  4N5S A;  4Z4G A;  4WQ5 A;  3O3F A;  1SKW A;  3K5O A;  4FWR A;  1BCM A;  3S3O A;  3EY1 A;  4DV6 K;  4HHT A;  4JAX A;  2UUC K;  1S1V A;  4BRD A;  3RMA A;  1SKS A;  1TKD A;  4K8Z A;  4QS7 A;  3C7N B;  4H5N A;  3QER A;  1KQS M;  3UKR A;  1WN7 A;  3MX5 A;  5KPZ A;  1GLF O;  2QXL A;  3AY9 A;  3BP8 A;  4OGC A;  5CE3 A;  4GV9 A;  3ZT1 A;  1V4T A;  1RNH A;  3E1Y A;  4JK7 A;  5C15 A;  1NOY A;  3PO5 A;  4GVE A;  4DR5 K;  4DV0 K;  4M63 C;  5LY3 A;  3KHY A;  5AJ3 K;  3FZH A;  5C42 A;  2VGN A;  4JV5 K;  5AQO A;  1Z25 A;  2FF6 A;  1JLE A;  3AA4 A;  1LOT B;  4E7H A;  4EP4 A;  4OPJ A;  4CD1 A;  5EOY A;  4YDU A;  1E3M A;  4CIE A;  1VQ6 N;  3S41 A;  2O8F B;  2F8S A;  1C1B A;  4F4K A;  1SZ2 A;  3MCA B;  5BPN A;  4KB0 A;  4AHT A;  1MDU B;  3MWT A;  4OKE A;  4CBW A;  3M8S A;  2DPN A;  2P9L A;  4DSK A;  1MA9 B;  2OPP A;  4DQS A;  4QAG A;  2P9U A;  1GLA G;  2OTL N;  3ITH A;  1NGA A;  3OS0 A;  1EKE A;  4KTW A;  4DTX A;  1BIS A;  4CW7 B;  4WQ5 C;  4DV2 K;  3CCE N;  4E19 A;  3J7Y P;  4JHD A;  1LWC A;  3ZT4 A;  3KK1 A;  2KZM A;  2VWJ A;  1TAQ A;  4DV3 K;  4I9Q A;  3EL2 A;  2AP1 A;  3ATU A;  1RT1 A;  2E1Y A;  2GEL A;  5J2M A;  3V9S A;  3AVF A;  3IKM A;  2BDP A;  1C1A A;  3VEY A;  1Q86 O;  3CJB A;  3I0S A;  1DEJ A;  4BDY A;  4FJ9 A;  1N36 K;  4KV8 A;  4CEC A;  1YJ9 N;  5C12 A;  2V52 B;  4A5A A;  1RDC A;  2OA8 A;  3BEX A;  1W97 L;  4BRK A;  4YDU C;  4CHZ A;  3QES A;  3C6T A;  4BRA A;  2W40 A;  4CJW A;  4DR3 K;  4FWL A;  4XH1 A;  4JLH A;  4DU1 A;  1S6P A;  1VSL A;  4GMJ B;  1JLG A;  5JVG L;  2P9P B;  3DWL A;  5AZJ A;  1HNI A;  3DLG A;  4FLY A;  4BRH A;  2D0O A;  3PX6 A;  4DTR A;  2HHH K;  4B1W B;  3I8D A;  2IS3 A;  4B9Q A;  4UQG A;  3MDQ A;  5AQK A;  3O9S A;  5J1E A;  3EKU A;  2QI2 A;  1VSI A;  2XRI A;  5AQZ A;  2NRW A;  1P90 A;  3D2F A;  1NMN A;  4EAH D;  4EZ9 A;  4FOE A;  2YHA A;  4EIA A;  2O8D B;  4AM7 A;  4CGH A;  4C23 A;  4RW6 A;  4BRG A;  4DQ8 A;  4CJ4 A;  4Z4E A;  2QWN A;  2YKN A;  3QIC A;  4JNE A;  1GOA A;  1N33 K;  2OZS A;  5HOO A;  3UKR B;  4BC5 A;  5AQR A;  1HNV A;  4CF1 A;  1B92 A;  1WSE A;  1BQM A;  1X3N A;  4IDK A;  4CD3 A;  3WXK A;  3CFR A;  2JLE A;  4LF4 K;  1NM1 A;  4CK2 A;  3QML A;  2OPS A;  2E2P A;  4A2A A;  3NE6 A;  4BRP A;  1NJX A;  3VQA A;  1RCH A;  1K9M O;  3A5M C;  4C8M A;  4M41 A;  3O3H A;  2DY4 A;  3M5R A;  3PSF A;  4IFE A;  4NYF A;  4B08 A;  3AVC A;  4XH4 A;  3THW A;  3EZW A;  3LAM A;  3DYA A;  3TU5 A;  2QWR A;  5IWA K;  1XNQ K;  2RPI A;  4F3T A;  3I8B A;  2BTF A;  5JVH L;  2KW4 A;  3ULE A;  2O8B A;  1OVQ A;  4M3W A;  1SL0 A;  2DFE A;  3LL3 A;  1RT4 A;  2P9L B;  3ASM A;  5F2R A;  2WTU A;  3C94 A;  4NLB A;  1L3S A;  4ILJ A;  3H45 C;  4KTQ A;  2P9U B;  4IOX A;  1R0A A;  4DFJ A;  3AVK A;  3ZLJ A;  1QVG M;  3WUH A;  3R8E A;  1JCF A;  4LFA K;  4CZL A;  1P8Z A;  2G8W A;  1N34 K;  4B9U A;  2HHT A;  1HYS A;  1U2V A;  4CJP A;  2V51 B;  2FLO A;  2Z1J A;  3SQ0 A;  3EE9 A;  3M3Z A;  2YNH A;  3NF9 A;  4MFB A;  3FFI A;  4FWQ A;  3OW2 M;  5HRO A;  1HRH A;  2QWO A;  4CVN E;  4ID5 A;  4YOW A;  3CPW M;  2P51 A;  4ELT A;  4CHN A;  3AVN A;  3KIO A;  4BVO A;  3C6A A;  3ZSZ A;  1U48 A;  4BRE A;  4LH5 A;  4CZM A;  3IG1 A;  2WON A;  4DFM A;  3SUO A;  3FE1 A;  3VPZ A;  4ISG A;  4BG9 A;  1SS6 A;  3L3V A;  3F9K A;  1S1W A;  3PIP L; 
#chains in the Genus database with same CATH homology
 1CZB A;  4CED A;  3LAN A;  4RW8 A;  2DFH A;  4IKF A;  4BDZ A;  2HVH A;  1S1X A;  1TL3 A;  3HPH A;  1YTA A;  5HRN A;  4CJE A;  4N76 A;  3KKS A;  3NH0 A;  1LAV A;  2QXF A;  2E4L A;  2Q3S A;  4K8X A;  3D0P A;  4F8R A;  4N41 A;  3OYL A;  4FM0 A;  5JS1 A;  5J2P A;  3L8B A;  1BGX T;  3HK2 A;  4PWD A;  3NAE A;  1HYZ A;  2D5R A;  3G0Z A;  4YNQ A;  1Q8I A;  3OYD A;  3AO3 A;  3NHG A;  1BL3 A;  3AVH A;  4OJR A;  3LZJ A;  1QSS A;  3TAB A;  4DQP A;  3RMD A;  3TAM A;  2O4G A;  4BWM A;  4AHU A;  3V6D A;  3S9H A;  4NCB A;  4M42 A;  4M3T A;  3ZSV A;  1RBT A;  4B8C A;  1UA1 A;  1WSJ A;  3QLH A;  4CK1 A;  1RT6 A;  5CYQ A;  2P5G A;  1SV5 A;  3VQ7 A;  3ZT0 A;  2DFF A;  4I2Q A;  3TAG A;  1DTT A;  1NK5 A;  4O5B A;  3HT3 A;  4RW7 A;  4W5Q A;  4J2B A;  1C0U A;  3OYH A;  3U3Y A;  1Q9Y A;  1SKR A;  4FW1 A;  4ZHR A;  4HUF A;  1NK7 A;  1DLO A;  3CFP A;  1CZ9 A;  4O55 A;  3NF7 A;  4DSF A;  1NKC A;  4FZX C;  1KCF A;  4KTZ A;  4E89 A;  1VSE A;  3SQ2 A;  2DTU A;  3LP2 A;  1S5J A;  3K5L A;  1JL1 A;  5J2N A;  2QKK A;  2ATQ A;  4FK2 A;  5JS2 A;  2RKI A;  4LH4 A;  1TKT A;  1WSG A;  2A1S A;  1BIZ A;  3DOL A;  3G10 A;  4ELV A;  2Z1I A;  3C6U A;  1UWB A;  3VQE A;  1YT3 A;  3T1A A;  3VQ6 A;  1IO2 A;  1C1C A;  2GV9 A;  2PYL A;  4C8N A;  3QNN A;  3DLH A;  4WE1 A;  1TK5 A;  3HVR A;  4AHS A;  1T05 A;  2HMI A;  2G8F A;  4DTU A;  4BE1 A;  3AVA A;  4KHQ A;  2VG6 A;  3TAN A;  2X78 A;  3KTQ A;  4FLZ A;  1VSF A;  3HPG A;  4CER A;  4LSL A;  4NCG A;  3VQQ A;  3OYI A;  4QOZ B;  4KRF A;  1BCO A;  2VG7 A;  4CF0 A;  3OYF A;  2XY7 A;  4CIF A;  1D8Y A;  1RDA A;  4C8O A;  4FJ7 A;  4OGE A;  3CG7 A;  4RW9 A;  4OLA A;  1JXB A;  4CF2 A;  4FVM A;  3K58 A;  4FJL A;  4IG3 A;  3HP6 A;  4JRQ A;  4FJI A;  3OYM A;  2G8U A;  4FJM A;  1KVB A;  1NK8 A;  2XY6 A;  2QK9 A;  1U45 A;  2IGI A;  3RMB A;  4DFP A;  3K59 A;  4W5O A;  3DLE A;  3QO9 A;  1LW0 A;  3KJV A;  3TAQ A;  3CM6 A;  4FLU A;  4OPK A;  2OPR A;  3RRH A;  4O4G A;  1X9W A;  3E01 A;  4CGG A;  2VWK A;  3MXJ A;  4DQQ A;  4Y1C A;  5KRS A;  3V9U A;  4J2E A;  1NJY A;  3TAP A;  3QIP A;  2FBY A;  5CZ1 A;  5DMR A;  3NH2 A;  4JS5 A;  4TSX A;  3OYA A;  2HNY A;  5I3U A;  4FM2 A;  2VG5 A;  3P83 D;  1TK8 A;  2OYQ A;  4CK3 A;  3JYT A;  4AIL C;  5CZ2 A;  2ETJ A;  1NJZ A;  2X6S A;  4DQR A;  4KHU A;  3C95 A;  4FW2 A;  3OJU A;  3KLF A;  1REV A;  2O4I A;  1J5O A;  3OVN A;  3V9Z A;  3LAL A;  4EP5 A;  4CEE A;  3QNO A;  4OKJ A;  3HVT A;  3KKR A;  3U3G A;  4Z4H A;  3MAQ A;  3AVL A;  2YNI A;  4ZTF A;  3RWU A;  1FXX A;  4G1Q A;  4Z0U A;  4M3Y A;  1JLF A;  1D9F A;  1IKY A;  1KFD A;  4M3R A;  2Z1G A;  3CQ8 A;  4O0J A;  2HNZ A;  1C6V A;  3I0R A;  2LSN A;  5KI6 A;  1CXQ A;  1KVA A;  1B9F A;  3SUN A;  2OZM A;  3AO1 A;  3AA5 X;  1ASV A;  4FLT A;  2G8K A;  3AO5 A;  4Z4I A;  3HYF A;  4CJV A;  4FJK A;  4Z4F A;  3CFO A;  3SQ1 A;  3ZCM A;  1ZBI A;  1RBR A;  4E1M A;  3NDK A;  5KGW A;  3DOK A;  1TV6 A;  1IKV A;  1QQC A;  1KSP A;  3D45 A;  4IFY A;  3SPY A;  4EZ6 A;  3OS2 A;  1KRP A;  4CFC A;  3JSM A;  2KQ2 A;  2XO7 A;  3ZSQ A;  2D0C A;  3QEI A;  2YNF A;  4RW4 A;  4BWJ A;  2GUI A;  2IC3 A;  3HPO A;  4FLX A;  2FC0 A;  3L2W A;  1ZBU A;  3HXM A;  3HO1 A;  4JS4 A;  1TKX A;  4J2A A;  4KI4 A;  4B3O A;  3NF8 A;  4OLB A;  1UAX A;  3AA3 A;  4Q5V A;  4FJG A;  1I39 A;  1G15 A;  4CGF A;  3MXI A;  1ZBH A;  4F3O A;  2HHX A;  4DTJ A;  1GOB A;  3M8Q A;  2BE2 A;  4KHN A;  2YV0 X;  3HP9 A;  1QE1 A;  1O1W A;  5EU7 A;  3L2R A;  1RTJ A;  1L3U A;  1VSH A;  1FK9 A;  4CE9 A;  1S9E A;  4KHW A;  3AVJ A;  4DSI A;  2PY5 A;  1TKZ A;  2E6L A;  3SPZ A;  1VSK A;  5T7B A;  4CGD A;  4DLG A;  3AA2 A;  4L8R B;  3IAY A;  3OYN A;  2RN2 A;  3AVM A;  3PX0 A;  1U47 A;  4N5S A;  3UIQ A;  5D3G A;  3O3F A;  4Z4G A;  3OYB A;  1W0H A;  3K5O A;  1SKW A;  1L3V A;  1GOC A;  1WSF A;  3EYZ A;  1BCM A;  3S3O A;  4QCL A;  4CF8 A;  1RTH A;  4O0I A;  4CGJ A;  3EY1 A;  4Z4C A;  4JRP A;  1XI1 A;  2P1J A;  4HHT A;  5KGX A;  1HPZ A;  4NYN A;  1S1V A;  3K5M A;  5FDL A;  3B6P A;  3HST B;  4DSE A;  3RMA A;  1IKX A;  1SKS A;  1TKD A;  4CHQ A;  1HYV A;  3RR7 A;  4K8Z A;  3QER A;  1J9A A;  4J2D A;  3U6F A;  1WN7 A;  3OJS A;  2IAJ A;  4OGC A;  1WSI A;  3KLG A;  3ZT1 A;  1RNH A;  1U49 A;  4HCC A;  1T7P A;  1Z26 A;  2BGG A;  5FRO A;  4YFU A;  4GVM A;  2G8V A;  3M8R A;  5FRN A;  3LPU A;  1NOY A;  4GW6 A;  3VA3 A;  4CEO A;  1L5U A;  5DK5 A;  3PO5 A;  1QS4 A;  1WAF A;  1EX4 A;  2XY8 A;  1KFS A;  3QIO A;  1B9D A;  4OKK A;  1QSY A;  1D9D A;  5C42 A;  3O3G A;  1NK6 A;  1Z25 A;  3S3M A;  1JLE A;  3AA4 A;  3KD1 E;  4KHY A;  4E7H A;  1LV5 A;  1RTI A;  3B6O A;  4W5R A;  4EP4 A;  4E1N A;  4OPJ A;  4BDP A;  1FKO A;  1LW2 A;  1NK0 A;  3RRG A;  1BQN A;  1JLC A;  3V1R A;  2G8H A;  4ICL A;  2KFN A;  1NK9 A;  2HHS A;  1C0T A;  1WSH A;  3LP3 A;  4CIE A;  4W5N A;  1RT7 A;  5J2Q A;  2FBT A;  3L2U A;  2AJQ A;  1U4B A;  4FZZ A;  2F8S A;  1C1B A;  3OYJ A;  1XC9 A;  5SZT A;  1NKB A;  3LP1 A;  3ZSW A;  4F4K A;  3V1Q A;  4DF4 A;  1VRU A;  4KB0 A;  5FRM A;  3NGZ A;  4N56 A;  2JGU A;  3HL8 A;  4AHT A;  3NF6 A;  4KI6 A;  1S9G A;  2HHV A;  4FCY A;  1ITG A;  4OKE A;  3TAF A;  3M8S A;  3VQC A;  3BDP A;  4H4M A;  4CHO A;  2WOM A;  4ELU A;  3LPT A;  3MEG A;  4N47 A;  3OS1 A;  4DF8 A;  4DFK A;  4E7K A;  2A1R A;  4W5T A;  4DSK A;  4B9N A;  2B5J A;  2OPP A;  4DQS A;  3SNN A;  4CJS A;  3H08 A;  4O44 A;  4CEB A;  5CYM A;  4QAG A;  1YVU A;  2ZD1 A;  3NFA A;  1SUQ A;  4M3Z A;  3ITH A;  2P5O A;  4HVJ A;  3OS0 A;  2OPQ A;  1EKE A;  4KTW A;  3DI6 A;  5HRR A;  4DTX A;  3OYE A;  2XY5 A;  1F21 A;  1BIS A;  4PA1 A;  3DRR A;  1WNS A;  1JLA A;  4E7J A;  1RT5 A;  4E19 A;  4AHR A;  4CEF A;  1LWC A;  3ZT4 A;  3KK1 A;  3OY9 A;  4E7L A;  2KZM A;  2VWJ A;  3TR8 A;  4R5P A;  3DRP A;  1TAQ A;  3AO2 A;  1IKW A;  3NGY A;  3IRX A;  3SZ2 A;  3BGR A;  4I9Q A;  3DM2 A;  3TWH A;  1TVR A;  1RIL A;  1D5A A;  3ZT2 A;  1RT1 A;  1VSD A;  1ZYQ A;  1ZBF A;  1BI4 A;  5J2M A;  4B9L A;  2Z1H A;  3V9S A;  3M8P A;  3AVF A;  1ASW A;  1TAU A;  2BDP A;  2FBV A;  1C1A A;  3NH1 A;  4B9M A;  1KLM A;  4CJU A;  4CIG A;  1S1T A;  4FK4 A;  3I0S A;  4CJT A;  4BDY A;  3V81 A;  4HCB A;  2PYJ A;  4FJ9 A;  2G8I A;  3WNG A;  3V1O A;  4CJF A;  4FLV A;  4KV8 A;  4DMN A;  3V4I A;  1SL1 A;  4CEC A;  3OYG A;  2HW3 A;  2HVI A;  2ZE2 A;  3CYM A;  1TL1 A;  3QEX A;  4ZTJ A;  4FK0 A;  4FJ8 A;  3RR8 A;  1CLQ A;  1RDC A;  2OA8 A;  5K14 A;  2XHB A;  4M45 A;  4PY5 A;  1UA0 A;  2F96 A;  4CFA A;  4CHZ A;  3MED A;  3QES A;  4KRE A;  2HB5 A;  3C6T A;  3OYK A;  4CJW A;  1QHT A;  3KK3 A;  3L2V A;  3F73 A;  4XIU A;  4DTS A;  1RT3 A;  1NK4 A;  2EHG A;  4H4O A;  4JLH A;  4I7F A;  4DU1 A;  4F2S A;  1T8E A;  3ULD A;  1X1P A;  1S6P A;  3ALY A;  4DU4 A;  3KLE A;  3O4Q A;  4CEZ A;  4F2R A;  1VSJ A;  1VSL A;  3MEC A;  1JLG A;  2B6A A;  4GMJ B;  3SQ4 A;  3AO4 A;  3LAK A;  3TAE A;  5C25 A;  2YKM A;  3DLK A;  5C24 A;  4PUO A;  5HRS A;  1SL2 A;  1HNI A;  1S1U A;  3DLG A;  3VQB A;  4FLY A;  4I2P A;  1J54 A;  3PX6 A;  3AVI A;  4DTR A;  3AVB A;  4AH9 A;  3I8D A;  2IS3 A;  4UQG A;  4FYD A;  4DG1 A;  1X9S A;  4DSJ A;  2HHU A;  1K6Y A;  4FJJ A;  4CF9 A;  5J1E A;  4DTN A;  1X9M A;  3LP0 A;  2EX3 A;  4BE2 A;  4FLW A;  2XRI A;  1VSI A;  3K2P A;  1ZBL A;  3SI6 A;  2ITG A;  1VK0 A;  3AV9 A;  2HHQ A;  5HRP A;  5HLF A;  3MEE A;  3ZSY A;  3KLH A;  1N5Y A;  4I9L A;  1QSL A;  4EZ9 A;  1A5V A;  3SV4 A;  1JLB A;  2YHA A;  3LWL A;  3EZ5 A;  3MXM A;  4B9S A;  1BHL A;  1IH7 A;  4RW6 A;  4CGH A;  4E3S A;  1XHX A;  1WAJ A;  3A2F A;  1XHZ A;  4Z4E A;  4CJ4 A;  3DMJ A;  1NKE A;  1JL2 A;  3VN5 A;  5KTQ A;  2IDO A;  1FKP A;  2YKN A;  3VQP A;  5I42 A;  4C8K A;  1GOA A;  3VA0 A;  2OZS A;  1J53 A;  3V9W A;  3DLB A;  3QIN A;  4CJL A;  4DSL A;  3TAR A;  1HNV A;  1BIU A;  2D0A A;  2FBX A;  2YNG A;  4CF1 A;  4CFB A;  3LWM A;  4CES A;  4PQU A;  4CEQ A;  1TGO A;  1B92 A;  1WSE A;  3ZSX A;  4CJK A;  4FJ5 A;  1BQM A;  4AHC A;  3K5N A;  2HND A;  3SCX A;  4IDK A;  3CFR A;  3WNE A;  2JLE A;  5SWM A;  1RT2 A;  2HHW A;  4CK2 A;  4M3X A;  1KTQ A;  4FJX A;  2PZS A;  4DTO A;  3HJF A;  2OPS A;  3QET A;  1CXU A;  4BE0 A;  4CJQ A;  3NE6 A;  4NCA A;  1NJX A;  4DQI A;  1VSM A;  3VQA A;  3IS9 A;  1RCH A;  3LZI A;  2IOC A;  3PV8 A;  3RMC A;  3NBP A;  3THV A;  2KFZ A;  3VQ8 A;  4C8M A;  4M41 A;  3O3H A;  3SJJ A;  4FZY A;  2DY4 A;  1LAW A;  3DRS A;  4HUE A;  4DLE A;  3QEP A;  4KFB A;  1RDB A;  2X74 A;  3L2Q A;  1Q9X A;  4FJH A;  3T19 A;  3LDS A;  3VQD A;  4FJN A;  3AVG A;  4NYF A;  5KRT A;  3PO4 A;  2X6N A;  3SYZ A;  5HP1 A;  1ASU A;  3V9X A;  1QTM A;  4B08 A;  3KD5 E;  4FM1 A;  3AVC A;  4HTU A;  4RG8 A;  1EXQ A;  1JXE A;  3DYA A;  3CM5 A;  3LAM A;  3P5J A;  4CJR A;  4M3U A;  3ZSO A;  2RPI A;  1EP4 A;  4F3T A;  4IFV A;  1UOC A;  3L3U A;  4AHV A;  2R7Y A;  2KW4 A;  1EET A;  1LWF A;  1MU2 A;  3VQ5 A;  4KB1 A;  1S1W A;  1N6Q A;  3NCI A;  4H8K A;  4M3W A;  1RTD A;  1SL0 A;  3QEW A;  2DFE A;  1JKH A;  1RT4 A;  3ASM A;  2BAN A;  3S3N A;  3C94 A;  3SUQ A;  1LWE A;  1L3S A;  4C8L A;  2QKB A;  3ISN C;  2E6M A;  1WLJ A;  4IG0 A;  3SUP A;  1TK0 A;  1NJW A;  4LD0 A;  4KTQ A;  2I5J A;  4DU3 A;  3K57 A;  4KAZ A;  4DWI A;  5CY4 A;  3OYC A;  1R0A A;  4CJ3 A;  4DFJ A;  3AVK A;  3ZT3 A;  3WNH A;  1HQE A;  1A5X A;  3SV3 A;  4B9V A;  1JLQ A;  4CCH A;  3DLR A;  4B8A B;  4DTM A;  2ZQB A;  3WNF A;  4FXD A;  2KTQ A;  2NUB A;  1Y97 A;  5E41 A;  4OVL A;  2Y1J A;  2D0B A;  1HMV A;  3HM9 A;  4DS5 A;  4HUG A;  4Q0B A;  2G8W A;  4B9U A;  3QEV A;  2W42 A;  4LY7 A;  2HHT A;  3KLI A;  4CFD A;  1HYS A;  4CGI A;  4LSN A;  3NGI A;  3PUF A;  2GBZ A;  4E0D A;  5HBM A;  4CHY A;  3TI0 A;  1YTU A;  4KPY A;  4CJP A;  3VQ4 A;  4Y1D A;  4DS4 A;  2Z1J A;  3SQ0 A;  1T03 A;  1A5W A;  1HQU A;  2YNH A;  4IBN A;  3NF9 A;  1RBS A;  1BI4 B;  3FFI A;  4MFB A;  1L3T A;  5HRO A;  1HRH A;  2RF2 A;  3PX4 A;  1DTQ A;  3P1G A;  3T3F A;  3VQ9 A;  4B9T A;  3PY8 A;  4ID5 A;  4KHS A;  4CEA A;  2P51 A;  1W9H A;  1KVC A;  4ELT A;  4CHN A;  3AVN A;  3KIO A;  3ZSZ A;  1U48 A;  1U04 A;  4ID1 A;  2Y1I A;  4LH5 A;  1KLN A;  1IG9 A;  1XWL A;  1S6Q A;  2B4J A;  3ZSR A;  2F8T A;  3IG1 A;  2KZZ A;  1C0M A;  2WON A;  3O4N A;  4DFM A;  3SUO A;  1NOZ A;  1VRT A;  3RTV A;  1RBV A;  1RBU A;  1RDD A;  4MQ3 A;  4DTP A;  4CHP A;  3L3V A;  4E7I A;  3F9K A;  1HJR A;  4BAC A;  4KO0 A;  4KKO A;  1I3A A;  2YHB A;  4CJ5 A;  3KK2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...