4X66K

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 28
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4x66K00
4X62K 1I94K 4LF9K 4JI1K 1N33K 4X65K 4DV2K 4KHPK 2F4VK 4DV6K 3JAMO 4JI4K 4DV4K 3J80O 4JI5K 4LF8K 2HHHK 1FJGK 4DUYK 3T1YK 4CVNE 4DUZK 1HNXK 5BR8K 1XNRK 1IBKK 4K0KK 4X64K 4LFBK 1J5EK 2E5LK 2UU9K 4B3MK 2UUBK 3J7AP 1HNZK 4AQYK 1HR0K 4NXNK 1XMOK 1XMQK 5LMUK 4JI6K 4YHHK 3J81O 5IT9O 4DV0K 2VQFK 4JI2K 4DV3K 2UUAK 4JI8K 4JI7K 4LFCK 5IWAK 2VQEK 4B3RK 4B3SK 4DR4K 4LF6K 1IBMK 5FLXO 4OX9K 2UXDK 4YY3K 3OTOK 5LMNK 4DV7K 4LF5K 4LF7K 4DV1K 4GKJK 4DR2K 2ZM6K 1HNWK 1N34K 4JI3K 2UUCK 4B3TK 4LFAK 4JI0K 4DR7K 4GKKK 5AJ3K 2UXBK 4NXMK 4X66K 5LL6Z 3T1HK 4LF4K 4DR1K 1N36K 4V19S 3J7YP 4CW7B 4DR6K 2UXCK 4DR5K 4JYAK 5A2QO 4DR3K 4DV5K 1IBLK 1N32K 4JV5K 1XNQK
chains in the Genus database with same CATH superfamily
3G25A 4FJHA 2P9KA 3QEWA 5CYMA 3ZT1A 5KQ8A 4WF9L 5C25A 3L2VA 2HHHK 4FJIA 3E01A 3UKRA 4E19A 3CCUN 1EX4A 3FGUA 3O8MA 2G8VA 1HNXK 3L4QA 2G8IA 2D5RA 1IBKK 1ITGA 1JXEA 1O13A 3PV8A 5JVHL 4DTJA 1RILA 1ATRA 1T6DA 3O3HA 4DS5A 3CPWM 1S6QA 4Y1DA 4QCLA 4AQYK 4CZIA 3V9SA 3RRGA 4CJ3A 3MN6A 5HRNA 4OPHA 1XMQK 4CHOA 4O4GA 1T05A 1SL0A 5IT9O 4CJFA 4IJNA 3MCAB 3TTDA 4IEEA 3FFKB 5JS2A 2FF6A 4CZGA 1TKXA 1NK5A 4DSLA 4YOUA 2GTDA 1P8ZA 4LY7A 4M7XA 1VQ9N 4BRPA 1NWKA 3I33A 4YDUC 5F0XA 4DLEA 3VTHA 4E7HA 3K5MA 3E9LA 2WBNA 4B3RK 4KTWA 4B3SK 3ZEUB 4LF6K 2A1RA 4Z4EA 4CZKA 3QESA 3VPZA 4F3TA 4YY3K 3M8RA 1U04A 4DR2K 4JK8A 3I56N 4J8FA 4U67L 1M90O 2E6MA 4AM6A 1S3XA 1ASWA 4Z94A 4EFHA 3SQ2A 1BQMA 3A0IX 3E9PA 1C0GA 1KFSA 3NF7A 1BO5O 3THYA 2Y1IA 1RFQA 3J7YP 5LJWA 1EKEA 4DR6K 1J6ZA 4BRCA 1NK4A 3VQ6A 3CC7N 4BY9C 3QNNA 3F73A 3DYAA 4CZLA 1QS4A 3BZKA 1VSJA 4EIAA 5F1XA 4FJKA 3CG7A 4AHCA 1U2VA 1HPMA 2HMIA 4JD2A 2GUIA 1RTJA 3O1WA 4FCYA 4E3SA 2KHOA 4IDKA 1EO1A 4B1VA 4KHPK 4B9SA 1QQOA 2P9KB 3TI0A 4H03B 3H1QA 3Q7CA 4DKWA 1MWMA 3QFUA 3KLEA 3UKRB 5AQSA 5KGWA 1HNIA 1IO2A 1X9WA 4KAZA 4LH5A 4Z0UA 1NJYA 2P9UA 4GMJB 2Z1JA 3U3YA 4BR0A 2WC9A 1Q18A 2VWJA 4F9OA 1HYSA 2RN2A 5AQNA 5LJVA 3H46O 3LP2A 1DGKN 1TUYA 5LMUK 5AFUA 3PX4A 3HPHA 4EAHD 1KVCA 3VF6A 3OYCA 1BU6O 1JJ2M 2G8KA 3SPZA 4MO4A 1Q86O 3CCEN 4F2RA 2WFBA 1N6QA 2VWKA 2AP1A 5GIPA 4JI7K 2HBMA 4N76A 2HNZA 1NGHA 1X1PA 3CM5A 3C0BA 4CZJA 3SBTA 4CGIA 1RT5A 2ZE2A 4WCEL 4CEZA 5JLFA 4DFKA 2ZM6K 1WAFA 2O8EA 4FWRA 3QICA 1NK7A 1NGCA 4FOIA 4FLXA 4NLCA 3ZSXA 4JN4A 5AQUA 2IS3A 5CHIA 2QWQA 2ZD1A 3NGZA 3C6HA 4FJGA 2A6AA 4AHVA 2QWOA 4NYFA 3TARA 2YNGA 2O8CB 1DTQA 2V52B 1Q82O 2AA4A 2F8TA 4V19S 2IIRA 4DTSA 3THYB 4OLBA 4QOZB 1RBRA 5BPNA 4BR2A 3TU5A 1VQPN 1DEJA 1HYZA 4DG1A 4E1JA 3TAEA 4C8MA 3L3VA 3VETA 4BRNA 1YIJN 2Z1HA 4CFDA 5BPLA 4DSJA 3CYMA 1QSSA 4YOVA 1D5AA 1U2VB 4PKGA 4PL7A 2E6LA 4I9LA 1GLFO 5AQWA 3GBTA 1I94K 4PWDA 4CFCA 1RBVA 2IVOA 5C24A 4DV2K 1TKZA 4DTRA 2E4LA 2F4VK 1TL3A 2CGJA 2ZWHA 4AHSA 3OYJA 3LZIA 1WOQA 4DU4A 2E8AA 4E1MA 4IOAL 1TKTA 3TAGA 3F9MA 4I2QA 3OJSA 4B3OA 3ZYYX 4CE9A 1U4BA 1GLCG 1IKWA 3AVFA 2OCEA 4FJNA 4WFAL 2YJEA 5HBMA 4FJ5A 4BG9A 2Z1GA 4UQGA 4DMNA 1B9FA 5KI6A 4I6MA 3DLLL 4N47A 4FVUA 4DV0K 5JS1A 4H8KA 2YNIA 3OYLA 4K43A 1N8RO 4DV3K 3DLBA 3D45A 1K9MO 4K8XA 3CIPA 1ASVA 2OZSA 4QS9A 4DR4K 1IG8A 3L2RA 4JRPA 4CF8A 4FOEA 3SAHA 2ITGA 3LDPA 4O5FA 1GLJO 4B9NA 5GAGP 2X74A 3U9DA 2DY4A 2YJFA 4Y1CA 2F9WA 1RBUA 4IO8A 4DQRA 3ZSVA 1LWCA 4CHPA 3NFAA 4O8KA 1BI4B 4QS8A 5AZJA 3SNNA 3F5TA 1WSHA 3V1QA 2ZJQL 5J2MA 3T7ZA 5AQMA 4W5OA 4DHYA 3O1BA 2QXLA 2Q2RA 3VEVA 2A40A 1ATSA 1T44A 5FPMA 4RW7A 1SUQA 2DPNA 3E66A 4CESA 1H1VA 2VGMA 1SZ2A 1KD1O 5A2QO 3TAPA 4IKFA 3VENA 2HBJA 4BVPA 1ESVA 2E1YA 4Z4HA 1LW0A 3HBTA 3MDQA 1KC8O 2BUPA 1VSHA 2D0BA 1JCFA 3P1GA 1HRHA 4IEIA 1NM1A 3VEOA 3HRGA 1P90A 2NRVA 3AVIA 4A62A 2P9NA 4FM1A 2O8DA 4A61A 2QWLA 3LDNA 1S5JA 3FZMA 3OBYA 4EHTA 3ATUA 3GL1A 3E9OA 3ULEA 3RMBA 4CHYA 1HUXA 1NK0A 3AA2A 1Z6RA 3DLRA 1G99A 3I8BA 5C2FA 4FLTA 3THXA 4CCHA 2UU9K 3TWHA 2P9PB 4CGHA 5DMRA 4HVJA 1VQMN 2P5OA 1WBDA 3BY5A 5CZ2A 3P39A 4JKCA 3Q7BA 4I6MB 1BIZA 3LDLA 1ZBHA 2P5GA 4BWJA 1HX1A 3NGYA 1YUWA 1CLQA 3TSPA 5JLHA 1IH7A 4EP5A 1S1WA 4RW6A 4CJKA 1XHZA 3RWUA 3L8BA 3VQDA 4JKFA 5IWAK 3R1XA 1EWRA 4QAGA 1LV5A 3D0PA 1TVRA 1QZ6A 4M3ZA 4H4MA 3AV9A 2UXDK 5LMNK 3HOSA 1BG3A 4LF7K 4KHNA 2E2NA 3G10A 5FRNA 2PYLA 2V7YA 3HOTA 1NOZA 5C10A 4FO0A 3LPUA 3CCQN 3AVKA 4ISEA 5BRDA 4JAXA 4KI6A 5AZJB 4CEAA 3CJCA 3BZCA 1RBSA 3OYDA 3A5OC 3LL3A 3ID8A 1MA9B 2PYJA 1E4GT 3CC4N 3OYEA 4Z4GA 2R7YA 3R9PA 4W5QA 4AH9A 3CCRN 1B92A 3AVAA 1RDBA 3TANA 4B9MA 4CK2A 1IBLK 5HRSA 3S3OA 2W6KA 3NF9A 1C1AA 1MDUB 4YDUA 3VEYA 3CCJN 1NGDA 3RVCA 3MX2A 1A5XA 4G9ZA 3HVRA 4DV4K 3NAEA 2O8DB 3SV3A 1LOTB 4HHTA 5E84A 2GEMA 4DUYK 1HJOA 4FJ9A 2KFNA 4K25A 4EHUA 3CJ9A 1S1VA 3WXMB 3SUOA 3A5LC 3ULEB 2AJQA 1DKGD 4KO0A 3WNGA 2CH5A 3CJ7A 3KHYA 3THXB 3PSIA 4DFMA 5BREA 4DSEA 4BGAA 2QI2A 1IJJA 3J8AA 2FSJA 1TK0A 4NXNK 1UWBA 1NJXA 1RDCA 1EETA 1Q8IA 3HT3A 3QIPA 2Q31A 1EWQA 3THWA 3O4WA 3HSCA 1L3TA 2VQFK 3SBGA 4CZMA 2X6NA 3SMPA 4ELVA 1IV0A 1BA0A 2YHYA 1TV6A 3M5RA 3VN5A 1OH7A 4DTUA 3QNOA 5FRMA 3ZSOA 1TK8A 4HTUA 5EXWA 3VQ4A 3TSQA 2XRIA 4GKJK 3WXKA 3UIQA 3EKSA 4JK7A 4DSIA 3NVKA 4PL8A 3V1RA 4CZFA 5KPRA 4O8UA 4OGCA 3TAQA 3VQ7A 3TAFA 3LM9A 1W9HA 3AVLA 5BN8A 1VSDA 4JS4A 1NJZA 1YT3A 1JKHA 5AQKA 3VF2A 3RMDA 5D3GA 3D2FA 1JLAA 2WONA 2B4JA 4HUGA 3RRHA 3QLHA 4WQ5C 3VMFB 3SK3A 2YV0X 4HCCA 3N4QA 3CF5L 3R6MA 3AO3A 2Q0RA 2KKZA 3NF8A 1Z26A 3T19A 4FWOA 4ZTJA 1W97L 1NK8A 4CEOA 4GV3A 1JLGA 1VQ4N 4DWIA 4M3WA 3DOLA 1YJWN 3CMEN 2CH6A 1RT2A 1K6YA 4F8RA 3MN7A 5TKWA 5CZ1A 3GG4A 2KLAA 1ZBSA 4FZXC 4BRLA 1WBBA 1F21A 3A2FA 3CC2N 1VQ7N 2F96A 4JKEA 5FPNA 4JHDA 4LC9B 3ZX3A 3GDQA 2EHGA 3EE9A 3L2UA 1WLJA 4LFBK 1K8KB 5KTQA 1K73O 3DRPA 3SMSA 3AA5X 2DFEA 1HNZK 2P1JA 4CIGA 3QBWA 1WSEA 1X3MA 3MMVA 1W7AA 1X9SA 1QSLA 1GLLO 2P9IA 3ID6A 4IJAA 4JKDA 3RSEA 4HUEA 3THWB 4NCAA 2VGNA 4FJJA 5HROA 1BGXT 4PA1A 2H3GX 4AHUA 3K5LA 3KKSA 3ZT0A 1NG9A 1OVQA 5GINA 4M3XA 1QZ5A 3OHRA 3V4IA 3O9QA 3ZETA 3W3DA 1W0HA 5GIOA 3PIPL 1EQYA 4AHRA 3LP1A 4CJPA 3ULDA 2BDPA 1HNWK 4N5SA 2Q36A 5ADXH 3C6UA 4FLVA 1YVUA 3BDPA 2UXBK 3A5NC 4DFJA 2ZF5O 1D9FA 2KZZA 2O4IA 4E1NA 1SS6A 3NDKA 2PAVA 3N4PA 2IC3A 4H0OA 2BANA 2FXUA 4BRHA 3WEEA 1Q9XA 3HTVA 4CF2A 2OTJN 4MLHA 2UXCK 3C94A 1RTDA 3NBPA 2BGGA 1HQUA 4GVEA 3HO1A 4GY2B 4OKEA 1VSEA 1J5OA 4MDBA 1JLCA 4LD0A 1X9JA 4KB0A 4LSNA 2HHWA 5F2RA 4X65K 3KK7A 1SV5A 2FBYA 4H0YB 1HJRA 4ILHA 1NK6A 3PLAA 3VQ5A 2OPPA 3WQUA 1FJGK 4R79A 2HF4A 2UYTA 1S72N 3QEPA 3K0SA 4IFVA 1C0FA 3DRSA 1L3VA 5EVZA 5BR8K 1EXQA 4MQ3A 2D0PA 1X3NA 4BDZA 3UKUA 1S1XA 5AQQA 2UUBK 3ZX0A 5DM7L 1NJWA 1OKJA 5AQYA 1HR0K 3ZSRA 3OYKA 1ZBLA 2P9IB 4WFBL 3J81O 3RSEB 1SL2A 1TAQA 3MEGA 4CGFA 3VQ8A 3M6GA 4ID5A 4CERA 3G6EN 3LP0A 3VQEA 3SUPA 4M7YA 1FKOA 4KBOA 3HXMA 1WN7A 1EP4A 2VG7A 4WFNL 4JKAA 3ZT2A 4H0VB 3IAYA 4CEBA 3CETA 3O5BA 3OTOK 1VQKN 2P51A 5HL7L 1S1TA 5I9EB 4RCHA 3OYHA 3VF4A 3ZT4A 1XC9A 1NGAA 3DLGA 4CFAA 3M3ZA 4KHWA 3LP3A 1BWFO 4CIEA 4H4OA 1VRTA 3DLEA 4ZTFA 4R5PA 3H1VX 4ELTA 3D2EA 3OS1A 3WT0A 3IFRA 2HHUA 4C8KA 3CMAN 1QQCA 4AM7A 2X78A 2ASPA 4M45A 3O3GA 3G0ZA 3AVMA 3SPYA 3VESA 1NMNA 2HBLA 3I0SA 3KLHA 4A59A 1GLEG 4EZ6A 4CECA 2YHAA 4EZ9A 4CK3A 3K2PA 1U49A 1SKWA 5FDLA 4FW1A 4OPKA 1BISA 5EU7A 4FL9A 2JWKA 1YF5L 1NGBA 4RG8A 3FZHA 1A5VA 3SQ1A 4BRMA 2QM1A 1GLDG 3TTCA 3RR8A 4QS7A 3MXMA 2QWNA 1XNRK 3O08A 3ALYA 4JD2B 1TUUA 2E5LK 3UKUB 3OW2M 1VQON 2Q1NA 4BRKA 1BL3A 3M8QA 4FPBA 3MECA 5M1QA 3P38A 4NYNA 1WSFA 3HP6A 1VRUA 3LDOA 3BF1A 4B1WB 5BRHA 4YHHK 3H3OB 4FJLA 3RMCA 1VQ5N 4IG0A 2BTFA 1X9MA 3DXMA 1VSMA 4BDPA 4MO5A 3IMXA 1T3VA 1ZYQA 1RT7A 1WSIA 1CZBA 2YX6A 3F2KA 1YXQA 1ZC6A 3D6RA 2VQEK 1BCOA 2P9UB 4KI4A 1JCGA 3DJCA 3SJJA 3MWPA 2F7TA 4OPAA 3M8SA 4WQ4C 4ISGA 4BRGA 2ZJPL 1Q81O 1L3SA 5AZIA 1BCMA 3VGLA 1GOAA 2HVHA 3G71N 2NNWA 1U45A 2QKKA 5M1OA 2W40A 1JLEA 1I39A 4LF4K 4M63C 4FJ7A 4F2SA 1R59O 2HHVA 3LANA 3WNEA 3RR7A 3IRXA 3KKRA 3D2EB 3H6EA 3B8AX 2RE2A 4CW7B 3FZFA 3LWMA 4NB4A 4MLEA 4FLZA 1D4XA 3WXJA 5M1NA 5GAHP 2O8EB 1VK0A 1YJNN 1ILYA 1OH6A 1ASUA 2FBVA 1NKBA 4KH4A 2E1ZA 3HL8A 4DV5K 1N32K 3NH0A 1QQNA 1OH5A 1N33K 4J2DA 1KVAA 4B08A 3KWGA 4KRFA 2WTUA 1LW2A 4FSVA 5J2QA 1NGEA 4FWSA 3EE8A 3KVGA 1TAUA 4BE0A 3P31A 3T1YK 4CBXA 1SL1A 1C0UA 3DOKA 1HKBA 3AO1A 4DUZK 4B9VA 3LAMA 4ZHRA 3QMLA 1J5EK 3AO4A 3EZWA 3EL2A 3J7AP 4JK9A 5C0YA 1JCEA 4K41A 2QKBA 4FZZA 4BRQA 3S9HA 1ZBUA 3AA4A 3HYFA 3NCIA 2GV9A 3DXKA 1XUPO 4FM2A 3HZ6A 1XC3A 4JI2K 2IAJA 4NCGA 4FYDA 4M3UA 4FWNA 3EKUA 4LFCK 1E4FT 3C65A 3EYZA 2F8SA 1S9GA 2LSNA 4DU3A 2E2PA 1WSGA 4OX9K 3OS0A 4IOCL 1NKEA 4E0DA 4BRDA 1NGGA 4BR7A 1GOBA 1N34K 5KRTA 1Z25A 2HSTA 4KFBA 3O3FA 2DTUA 3L3UA 3THVA 2I7PA 2D1KA 3FZKA 5FPEA 3CXCM 4FXDA 2HHQA 2XY5A 1BA1A 1RT1A 4M41A 3VA3A 1HKGA 1DLOA 3O80A 1NKCA 4C1NI 3O6WA 4J2AA 4C1NK 1KCFA 4G1QA 2DFHA 1ZBIA 4CJTA 1OVYA 2A1SA 3OYFA 1VHXA 3B6PA 4XH1A 3NE6A 5AQVA 1KFDA 1S6PA 5J2PA 3BEXA 5SWMA 2KFZA 4F3OA 5BR9A 3VEZA 3QO9A 4IOXA 4A5BA 1IKYA 3KK3A 4X62K 1E3MA 1NJIO 4H5RA 3C95A 1LWFA 1QVGM 4NCBA 3HVTA 3AGRA 4DQQA 3J7ZO 2VG6A 4H5NA 5AQHA 1MU2A 4PQUA 1D8YA 1NMDA 4O0IA 4DCHA 1QE1A 2PFUA 4IO9L 3K5NA 1SQKA 4CHQA 3QEXA 4CJRA 4NO7A 2HF3A 1RDWX 4LSLA 5FPDA 3QIOA 3QEIA 4BG8A 1KVBA 1T03A 4OO1J 3U9ZA 1I3AA 1RDDA 1CXUA 2I7NA 5GAEP 4E89A 2RHKA 3AVHA 3SAFA 1WAJA 3OYNA 3CERA 1KTQA 2X6SA 2P9NB 1RDAA 3OBWA 4RW9A 3DXKB 2HOEA 3MN9A 5CYQA 3VQQA 1W2BM 3OYIA 1XWLA 3SI6A 1U47A 2ZQBA 2YHXA 2UUAK 4DQPA 4DTPA 4DQ8A 4CHZA 1L3UA 3I8DA 3M1FA 2FSKA 4JLHA 4CF1A 1HYVA 4OKJA 2NRZA 4OVLA 5I42A 2P9LA 2YHWA 3EO3A 1QQMA 4JI3K 2Z1IA 2HBKA 1HKCA 3HI0A 4X66K 3T1HK 4Y0WA 2P9SA 4PKIA 4KHYA 3EY1A 4B8AB 4C8NA 4KPYA 3ZSQA 2OPSA 3HM9A 3HJFA 1REVA 4UY8O 3L2QA 1FW6A 2VWBA 5JICA 2G8HA 3V9WA 4M42A 2EX3A 3DLKA 4DF4A 1ATNA 3O4QA 3S41A 4DTMA 1IG9A 4K8ZA 3P4IA 2VYPA 3BF3A 5E26A 3LAKA 2QWRA 2WOMA 1U6ZA 2VG5A 4H0XB 5BN9A 5M1FA 1C0MA 4BVOA 1CZ9A 3ATVA 3EEQA 4KHUA 3V9UA 3ZSWA 1XI1A 3D7EO 3FFIA 4FWLA 3CD6N 4DLGA 2O4GA 3WNFA 3ZLJA 4GV9A 1RT4A 2ZGZA 3QINA 3VTIA 3CCMN 3KK2A 3OJUA 4XH5A 5HOOA 1QHTA 3SQ0A 2PY5A 1S22A 3PUFA 1RDUA 4CJ4A 3UE5A 2YNFA 4PKHA 4BR5A 4CJUA 4OPJA 2A3ZA 4IG3A 2NRXA 4YNQA 2A5XA 3CFPA 1UAXA 1DTTA 3RMAA 5AFUH 3CQXA 1A5WA 4C23A 3L6QA 2IVNA 4B1UB 2D0AA 3S3MA 1YHQN 3I55N 1T7PA 1RNHA 5AQOA 4ILJA 4FLUA 1VQ6N 2E2QA 4YOTA 1S1UA 1VSLA 4JKBA 4M3RA 3QDKA 4CEDA 1TYQA 3EN9A 4FWKA 1KSPA 2Q0UA 4FK2A 2XY6A 4B3TK 3K58A 4ISFA 1NNEA 4KHQA 4GKKK 4HCBA 3OVNA 4CZHA 2ZGYA 4Z4CA 2YI1A 5TKYA 2O8FA 4TSXA 2P9SB 1BQNA 2Q3SA 4IZ9A 3AO2A 3B6OA 1YVNA 2IGIA 3VGMA 3AVBA 3JS6A 3QBXA 4AILC 2NRRA 1KAXA 3L0QA 3KLIA 3FE1A 2HHSA 4B1XB 3CQ8A 3H08A 4C8LA 4DR5K 4Q5VA 3OYMA 3K57A 1Y64A 4BE1A 3PO4A 2ASMA 3IUCA 5AQZA 3H3NO 2XO7A 5M1KA 3FZLA 3ZSZA 4YFUA 4IXCA 3KZBA 3P83D 3SUQA 3CQYA 3D2FB 3V9ZA 4FJ8A 3VEXA 2HNYA 3V9XA 3CCLN 4KTQA 1RBTA 1U48A 5CE3A 1HLUA 4CD3A 4BGBA 4WQ4A 4CEQA 3O4NA 4CJVA 1NLVA 3SV4A 1TKDA 3LPTA 4CVNE 2GWKA 1LWEA 1YJ9N 3KWIA 3U8XA 3CJBA 4IFEA 5GADP 3ITHA 3AVNA 1V4SA 4IBNA 3DI6A 3OA9A 1C0TA 2YNHA 3AAPA 1GOCA 5HRRA 3MN5A 3AARA 5EX5A 1Q9YA 4C8OA 1M1KO 3PO5A 1FKPA 4FWQA 2OZMA 1CZAN 2NRTA 1FK9A 5C12A 2YKNA 2HHTA 3VQBA 4JHDB 1YITN 2O8CA 1OH8A 4CGGA 3AO5A 3JXUA 2NRHA 3HM8A 2GUPA 5MLCQ 3VQCA 1XQSC 4N56A 3U4LA 3NH1A 2HW3A 1BIUA 3SAGA 4BR4A 2YHBA 4LF5K 1TYQB 2KQ2A 2XY8A 4RW8A 3WXIA 1G15A 3BP8A 4FWMA 2KTQA 4CK1A 4NLBA 3W0LA 3RTVA 1LAWA 1LCUA 4KH5A 3HSTB 3KD1E 2I5JA 3GOIA 4H0PA 4BRIA 2YKMA 2O8FB 3KK1A 3CJ1A 1VSFA 3PIOL 3QERA 3WQTA 4KV8A 3ISNC 3UB5A 3C7NA 1K8AO 3K5OA 3NVMA 3R8EA 3TR8A 1RCHA 2FBTA 3VEWA 3BGRA 5DM6L 5JVGL 3ZETB 1NGIA 4YOWA 4IWVA 2ITMA 3AA3A 2GX9A 3OYGA 4DTXA 3SCXA 1NGJA 5AQGA 1KRPA 3DWLA 3ZX2A 1T8EA 4KB1A 3FR0A 2NZTA 3LM2A 4FZYA 3O9TA 3EZ5A 4LF9K 4MDAA 3MCPA 2RPIA 3VERA 1HNVA 4FJXA 1FXXA 2QXFA 2KW4A 3JAMO 1KLNA 3VOVA 4JI4K 2Y1JA 4FJMA 1Q7YO 4HWIA 3WEEB 1DT9A 1JL1A 1JLFA 1SKSA 3C6AA 4B9QA 2F9TA 1GLBG 4FW2A 3SLCA 2FSNA 3MK6A 4BROA 1HPZA 4K0KK 1VSKA 3V81A 2JLEA 3S3NA 4E7KA 4I2PA 4XEIA 4CF0A 4CBUA 1WUAA 3LDQA 5DK5A 4KHSA 1V4TA 2QWPA 3ZSYA 1RTHA 3C6TA 3NH2A 4A2BA 2JWLA 2HB5A 5CY4A 3T1AA 3MWTA 1BI4A 3DLHA 3AVJA 2HNDA 5AQFA 2WUSA 5B8HA 3WXLA 1NU0A 3U3GA 4A57A 2HHXA 1IKXA 1T6CA 3R3LA 3MEEA 1QVFM 5FROA 1YTUA 5ADXA 2NLXA 4B9TA 3KJVA 2UUCK 4LFAK 4JI0K 1WB9A 1JL2A 4BWMA 2BH1A 3O9UA 4KKOA 3VA0A 4CGDA 2W41A 3K9KA 2D4WA 4BRFA 1L5UA 2HMPA 4OKKA 1KAYA 3LWLA 3KLGA 3C7NB 3AVGA 3IG1A 4JS5A 1Y97A 3CJAA 3U6FA 3OYAA 3SQ4A 4PY5A 1JLQA 5ELZA 3IDHA 2E88A 4GNIA 3O9SA 3I0RA 1J53A 2IVPA 3P5JA 4Z4IA 4BC5A 4YOXA 4OGEA 3TABA 4CJ7A 4DR3K 3KTQA 5CR4A 3K59A 1QHAA 2P9PA 5LY3A 2V51B 4H5TA 3WNHA 2FF3B 5AQJA 1SKRA 2A42A 4DV6K 3AY9A 4U7BA 3J80O 4DSKA 4WYBA 3TAMA 1C1CA 1TK5A 4ILGB 3LZJA 4RWTA 3ENBA 4DU1A 2V7ZA 2CGLA 3NGIA 4E7IA 4RW4A 4KREA 4X64K 3NF6A 2Q97A 4PUOA 2A41A 1J54A 3VQ9A 3JYTA 4B3MK 2D0CA 4DTNA 2XY7A 4B8CA 3HK2A 2QW9A 2E20A 5AQPA 3OS2A 1BDGA 2EWSA 4OJRA 5BPMA 4F4KA 2QA4N 4HTLA 3QETA 4FK4A 3ZT3A 3PX6A 3CM6A 3ASMA 4Q0BA 1KXPA 4JKGA 4CEEA 1BOTO 4M3YA 4JI8K 1ZXOA 2FLOA 3CPEA 4BQLA 4FVMA 4JNEA 4FLWA 3V6DA 2GBZA 1BUPA 2E2OA 3L4IA 3AGKA 2B6AA 4BC4A 1IBMK 4CBWA 4BACA 3CHWA 3MAQA 4DV7K 4I9QA 1VQ8N 5HP1A 4CGJA 3T3FA 4JRQA 4WQ5A 5KGXA 4YOYA 1RT6A 3DXMB 4A2AA 4ICLA 5E41A 1QTMA 3QEVA 3MEDA 1ZBFA 5SZTA 3DM2A 1LAVA 1N36K 4CJWA 3A8YA 3CCVN 2KZMA 5K14A 3G4SN 1R0AA 1N5YA 1WNSA 5AQLA 4HUFA 3MXIA 5EOYA 3QB0A 5AQTA 4W5NA 3F9KA 3TTFA 1D9DA 4AHTA 5AZIB 4CZEA 2QWMA 1RT3A 1TGOA 4ELUA 2FBXA 4DQIA 5KQDA 1WSJA 4JI1K 4K42A 2G8UA 5KPZA 1UOCA 3DMJA 5M1PA 3KD5E 4CJ5A 4JEPA 3MX5A 4JKHA 2PBDA 4BE2A 4JI5K 3O9RA 2JGUA 4IFYA 5HLFA 3SUNA 3CFOA 1YTAA 1JLBA 4LH4A 5J1EA 1TL1A 1MWKA 3CI5A 3IS9A 2ATQA 3QFPA 2OA8A 1NGFA 2CGKA 1VQNN 2BE2A 3KIOA 4CF9A 4XH4A 1J9AA 1XMOK 2O8BA 4BC3A 4DF8A 1GLAG 2RF2A 4JI6K 3SZ2A 1YI2N 2YCHA 3TPQA 2HVIA 3WUHA 3TSUA 3FLCO 4RTFD 4JKGB 4O44A 2ETJA 3E1YA 3K9JA 4B1ZA 4AF1A 3HPGA 1VAZA 3SYZA 1O1WA 5FLXO 2W42A 4H5WA 4OLAA 1SAZA 2B5JA 4CI6A 2OTLN 5KRSA 5AJ3K 5HRPA 3HPOA 1IKVA 3V1OA 4B9LA 4CD1A 2IOCA 5JMVA 4DR1K 4WE1A 3CCSN 2W6LA 2J4RA 4E7LA 1Z05A 4B9UA 3ZCMA 4KTZA 4M3TA 4FM0A 4GW6A 3SJHA 1KAZA 3DAWA 4FLYA 3IKMA 2ASOA 3MXJA 4E7JA 4BR9A 2OPRA 1K8KA 2NUBA 1UA1A 4JV5K 4CJQA 4FPAA 3H45C 4CIFA 3VGKA 1KQSM 4W5TA 4CHNA 3M8PA 2GELA 3JSMA 1UA0A 4LF8K 5J2NA 4CJEA 2PZSA 1S9EA 1C6VA 4DFPA 5C15A 4YORA 1YAGA 1VSIA 4XIUA 3DRRA 5C2DA 4CFBA 1QSYA 4BREA 5C42A 5AQIA 4B1YB 2OPQA 1NBWA 1XHXA 1NOYA 3AAQA 5T7BA 3NMUA 3LALA 2D0OA 4J2EA 4Z4FA 2O8BB 3GE1A 2QEXN 3PX0A 4KH6A 2OYQA 3VQAA 3L2WA 4EP4A 4DSFA 1HQEA 3BUZB 4IDHA 3A5MC 2GWJA 4CEFA 2VCPA 2G8WA 4H0TB 4BRAA 4DTOA 1HMVA 3ZEUA 2DFFA 1BHLA 3PY8A 3VQPA 4DS4A 4N41A 4BQZA 2XHBA 5EY4A 3CFRA 4O0JA 4CJSA 4A5AA 2G8FA 5AR0A 3ENOA 4DV1K 4J2BA 3T69A 4MFBA 3LDSA 2OANA 4H5VA 1C1BA 5H1SQ 3HP9A 4FWPA 4DQSA 4DR7K 4L3QA 5AQXA 4FK0A 4GV6A 1RTIA 3NHGA 1JXBA 1NK9A 3PSFA 4DB3A 4NXMK 5LL6Z 3KLFA 3OY9A 4CJLA 5AQRA 5KPTA 2IDOA 4BDYA 4ID1A 2ZJRL 1VQLN 2QK9A 4I7FA 4O5BA 4L8RB 3ENHA 3OYBA 4O55A 2P9LB 4BC2A 5I3UA 2NRWA 1B9DA 2FC0A 4JYAK 2RKIA 4PHTX 1RGIA 4W5RA 4GVMA 1CXQA 1KLMA 2QTDA 1XNQK 3AVCA 5BRFA
chains in the Genus database with same CATH topology
4X62K 1I94K 4LF9K 4JI1K 1N33K 4X65K 4DV2K 4KHPK 2F4VK 4DV6K 3JAMO 4JI4K 4DV4K 3J80O 4JI5K 4LF8K 2HHHK 1FJGK 4DUYK 3T1YK 4CVNE 4DUZK 1HNXK 5BR8K 1XNRK 1IBKK 4K0KK 4X64K 4LFBK 1J5EK 2E5LK 2UU9K 4B3MK 2UUBK 3J7AP 1HNZK 4AQYK 1HR0K 4NXNK 1XMOK 1XMQK 5LMUK 4JI6K 4YHHK 3J81O 5IT9O 4DV0K 2VQFK 4JI2K 4DV3K 2UUAK 4JI8K 4JI7K 4LFCK 5IWAK 2VQEK 4B3RK 4B3SK 4DR4K 4LF6K 1IBMK 5FLXO 4OX9K 2UXDK 4YY3K 3OTOK 5LMNK 4DV7K 4LF5K 4LF7K 4DV1K 4GKJK 4DR2K 2ZM6K 1HNWK 1N34K 4JI3K 2UUCK 4B3TK 4LFAK 4JI0K 4DR7K 4GKKK 5AJ3K 2UXBK 4NXMK 4X66K 5LL6Z 3T1HK 4LF4K 4DR1K 1N36K 4V19S 3J7YP 4CW7B 4DR6K 2UXCK 4DR5K 4JYAK 5A2QO 4DR3K 4DV5K 1IBLK 1N32K 4JV5K 1XNQK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X62 K;  1I94 K;  4LF9 K;  4JI1 K;  1N33 K;  4X65 K;  4DV2 K;  4KHP K;  2F4V K;  4DV6 K;  3JAM O;  4JI4 K;  4DV4 K;  3J80 O;  4JI5 K;  4LF8 K;  2HHH K;  1FJG K;  4DUY K;  3T1Y K;  4CVN E;  4DUZ K;  1HNX K;  5BR8 K;  1XNR K;  1IBK K;  4K0K K;  4X64 K;  4LFB K;  1J5E K;  2E5L K;  2UU9 K;  4B3M K;  2UUB K;  3J7A P;  1HNZ K;  4AQY K;  1HR0 K;  4NXN K;  1XMO K;  1XMQ K;  5LMU K;  4JI6 K;  4YHH K;  3J81 O;  5IT9 O;  4DV0 K;  2VQF K;  4JI2 K;  4DV3 K;  2UUA K;  4JI8 K;  4JI7 K;  4LFC K;  5IWA K;  2VQE K;  4B3R K;  4B3S K;  4DR4 K;  4LF6 K;  1IBM K;  5FLX O;  4OX9 K;  2UXD K;  4YY3 K;  3OTO K;  5LMN K;  4DV7 K;  4LF5 K;  4LF7 K;  4DV1 K;  4GKJ K;  4DR2 K;  2ZM6 K;  1HNW K;  1N34 K;  4JI3 K;  2UUC K;  4B3T K;  4LFA K;  4JI0 K;  4DR7 K;  4GKK K;  5AJ3 K;  2UXB K;  4NXM K;  4X66 K;  5LL6 Z;  3T1H K;  4LF4 K;  4DR1 K;  1N36 K;  4V19 S;  3J7Y P;  4CW7 B;  4DR6 K;  2UXC K;  4DR5 K;  4JYA K;  5A2Q O;  4DR3 K;  4DV5 K;  1IBL K;  1N32 K;  4JV5 K;  1XNQ K; 
#chains in the Genus database with same CATH topology
 3G25 A;  4FJH A;  2P9K A;  3QEW A;  5CYM A;  3ZT1 A;  5KQ8 A;  4WF9 L;  5C25 A;  3L2V A;  2HHH K;  4FJI A;  3E01 A;  3UKR A;  4E19 A;  3CCU N;  1EX4 A;  3FGU A;  3O8M A;  2G8V A;  1HNX K;  3L4Q A;  2G8I A;  2D5R A;  1IBK K;  1ITG A;  1JXE A;  1O13 A;  3PV8 A;  5JVH L;  4DTJ A;  1RIL A;  1ATR A;  1T6D A;  3O3H A;  4DS5 A;  3CPW M;  1S6Q A;  4Y1D A;  4QCL A;  4AQY K;  4CZI A;  3V9S A;  3RRG A;  4CJ3 A;  3MN6 A;  5HRN A;  4OPH A;  1XMQ K;  4CHO A;  4O4G A;  1T05 A;  1SL0 A;  5IT9 O;  4CJF A;  4IJN A;  3MCA B;  3TTD A;  4IEE A;  3FFK B;  5JS2 A;  2FF6 A;  4CZG A;  1TKX A;  1NK5 A;  4DSL A;  4YOU A;  2GTD A;  1P8Z A;  4LY7 A;  4M7X A;  1VQ9 N;  4BRP A;  1NWK A;  3I33 A;  4YDU C;  5F0X A;  4DLE A;  3VTH A;  4E7H A;  3K5M A;  3E9L A;  2WBN A;  4B3R K;  4KTW A;  4B3S K;  3ZEU B;  4LF6 K;  2A1R A;  4Z4E A;  4CZK A;  3QES A;  3VPZ A;  4F3T A;  4YY3 K;  3M8R A;  1U04 A;  4DR2 K;  4JK8 A;  3I56 N;  4J8F A;  4U67 L;  1M90 O;  2E6M A;  4AM6 A;  1S3X A;  1ASW A;  4Z94 A;  4EFH A;  3SQ2 A;  1BQM A;  3A0I X;  3E9P A;  1C0G A;  1KFS A;  3NF7 A;  1BO5 O;  3THY A;  2Y1I A;  1RFQ A;  3J7Y P;  5LJW A;  1EKE A;  4DR6 K;  1J6Z A;  4BRC A;  1NK4 A;  3VQ6 A;  3CC7 N;  4BY9 C;  3QNN A;  3F73 A;  3DYA A;  4CZL A;  1QS4 A;  3BZK A;  1VSJ A;  4EIA A;  5F1X A;  4FJK A;  3CG7 A;  4AHC A;  1U2V A;  1HPM A;  2HMI A;  4JD2 A;  2GUI A;  1RTJ A;  3O1W A;  4FCY A;  4E3S A;  2KHO A;  4IDK A;  1EO1 A;  4B1V A;  4KHP K;  4B9S A;  1QQO A;  2P9K B;  3TI0 A;  4H03 B;  3H1Q A;  3Q7C A;  4DKW A;  1MWM A;  3QFU A;  3KLE A;  3UKR B;  5AQS A;  5KGW A;  1HNI A;  1IO2 A;  1X9W A;  4KAZ A;  4LH5 A;  4Z0U A;  1NJY A;  2P9U A;  4GMJ B;  2Z1J A;  3U3Y A;  4BR0 A;  2WC9 A;  1Q18 A;  2VWJ A;  4F9O A;  1HYS A;  2RN2 A;  5AQN A;  5LJV A;  3H46 O;  3LP2 A;  1DGK N;  1TUY A;  5LMU K;  5AFU A;  3PX4 A;  3HPH A;  4EAH D;  1KVC A;  3VF6 A;  3OYC A;  1BU6 O;  1JJ2 M;  2G8K A;  3SPZ A;  4MO4 A;  1Q86 O;  3CCE N;  4F2R A;  2WFB A;  1N6Q A;  2VWK A;  2AP1 A;  5GIP A;  4JI7 K;  2HBM A;  4N76 A;  2HNZ A;  1NGH A;  1X1P A;  3CM5 A;  3C0B A;  4CZJ A;  3SBT A;  4CGI A;  1RT5 A;  2ZE2 A;  4WCE L;  4CEZ A;  5JLF A;  4DFK A;  2ZM6 K;  1WAF A;  2O8E A;  4FWR A;  3QIC A;  1NK7 A;  1NGC A;  4FOI A;  4FLX A;  4NLC A;  3ZSX A;  4JN4 A;  5AQU A;  2IS3 A;  5CHI A;  2QWQ A;  2ZD1 A;  3NGZ A;  3C6H A;  4FJG A;  2A6A A;  4AHV A;  2QWO A;  4NYF A;  3TAR A;  2YNG A;  2O8C B;  1DTQ A;  2V52 B;  1Q82 O;  2AA4 A;  2F8T A;  4V19 S;  2IIR A;  4DTS A;  3THY B;  4OLB A;  4QOZ B;  1RBR A;  5BPN A;  4BR2 A;  3TU5 A;  1VQP N;  1DEJ A;  1HYZ A;  4DG1 A;  4E1J A;  3TAE A;  4C8M A;  3L3V A;  3VET A;  4BRN A;  1YIJ N;  2Z1H A;  4CFD A;  5BPL A;  4DSJ A;  3CYM A;  1QSS A;  4YOV A;  1D5A A;  1U2V B;  4PKG A;  4PL7 A;  2E6L A;  4I9L A;  1GLF O;  5AQW A;  3GBT A;  1I94 K;  4PWD A;  4CFC A;  1RBV A;  2IVO A;  5C24 A;  4DV2 K;  1TKZ A;  4DTR A;  2E4L A;  2F4V K;  1TL3 A;  2CGJ A;  2ZWH A;  4AHS A;  3OYJ A;  3LZI A;  1WOQ A;  4DU4 A;  2E8A A;  4E1M A;  4IOA L;  1TKT A;  3TAG A;  3F9M A;  4I2Q A;  3OJS A;  4B3O A;  3ZYY X;  4CE9 A;  1U4B A;  1GLC G;  1IKW A;  3AVF A;  2OCE A;  4FJN A;  4WFA L;  2YJE A;  5HBM A;  4FJ5 A;  4BG9 A;  2Z1G A;  4UQG A;  4DMN A;  1B9F A;  5KI6 A;  4I6M A;  3DLL L;  4N47 A;  4FVU A;  4DV0 K;  5JS1 A;  4H8K A;  2YNI A;  3OYL A;  4K43 A;  1N8R O;  4DV3 K;  3DLB A;  3D45 A;  1K9M O;  4K8X A;  3CIP A;  1ASV A;  2OZS A;  4QS9 A;  4DR4 K;  1IG8 A;  3L2R A;  4JRP A;  4CF8 A;  4FOE A;  3SAH A;  2ITG A;  3LDP A;  4O5F A;  1GLJ O;  4B9N A;  5GAG P;  2X74 A;  3U9D A;  2DY4 A;  2YJF A;  4Y1C A;  2F9W A;  1RBU A;  4IO8 A;  4DQR A;  3ZSV A;  1LWC A;  4CHP A;  3NFA A;  4O8K A;  1BI4 B;  4QS8 A;  5AZJ A;  3SNN A;  3F5T A;  1WSH A;  3V1Q A;  2ZJQ L;  5J2M A;  3T7Z A;  5AQM A;  4W5O A;  4DHY A;  3O1B A;  2QXL A;  2Q2R A;  3VEV A;  2A40 A;  1ATS A;  1T44 A;  5FPM A;  4RW7 A;  1SUQ A;  2DPN A;  3E66 A;  4CES A;  1H1V A;  2VGM A;  1SZ2 A;  1KD1 O;  5A2Q O;  3TAP A;  4IKF A;  3VEN A;  2HBJ A;  4BVP A;  1ESV A;  2E1Y A;  4Z4H A;  1LW0 A;  3HBT A;  3MDQ A;  1KC8 O;  2BUP A;  1VSH A;  2D0B A;  1JCF A;  3P1G A;  1HRH A;  4IEI A;  1NM1 A;  3VEO A;  3HRG A;  1P90 A;  2NRV A;  3AVI A;  4A62 A;  2P9N A;  4FM1 A;  2O8D A;  4A61 A;  2QWL A;  3LDN A;  1S5J A;  3FZM A;  3OBY A;  4EHT A;  3ATU A;  3GL1 A;  3E9O A;  3ULE A;  3RMB A;  4CHY A;  1HUX A;  1NK0 A;  3AA2 A;  1Z6R A;  3DLR A;  1G99 A;  3I8B A;  5C2F A;  4FLT A;  3THX A;  4CCH A;  2UU9 K;  3TWH A;  2P9P B;  4CGH A;  5DMR A;  4HVJ A;  1VQM N;  2P5O A;  1WBD A;  3BY5 A;  5CZ2 A;  3P39 A;  4JKC A;  3Q7B A;  4I6M B;  1BIZ A;  3LDL A;  1ZBH A;  2P5G A;  4BWJ A;  1HX1 A;  3NGY A;  1YUW A;  1CLQ A;  3TSP A;  5JLH A;  1IH7 A;  4EP5 A;  1S1W A;  4RW6 A;  4CJK A;  1XHZ A;  3RWU A;  3L8B A;  3VQD A;  4JKF A;  5IWA K;  3R1X A;  1EWR A;  4QAG A;  1LV5 A;  3D0P A;  1TVR A;  1QZ6 A;  4M3Z A;  4H4M A;  3AV9 A;  2UXD K;  5LMN K;  3HOS A;  1BG3 A;  4LF7 K;  4KHN A;  2E2N A;  3G10 A;  5FRN A;  2PYL A;  2V7Y A;  3HOT A;  1NOZ A;  5C10 A;  4FO0 A;  3LPU A;  3CCQ N;  3AVK A;  4ISE A;  5BRD A;  4JAX A;  4KI6 A;  5AZJ B;  4CEA A;  3CJC A;  3BZC A;  1RBS A;  3OYD A;  3A5O C;  3LL3 A;  3ID8 A;  1MA9 B;  2PYJ A;  1E4G T;  3CC4 N;  3OYE A;  4Z4G A;  2R7Y A;  3R9P A;  4W5Q A;  4AH9 A;  3CCR N;  1B92 A;  3AVA A;  1RDB A;  3TAN A;  4B9M A;  4CK2 A;  1IBL K;  5HRS A;  3S3O A;  2W6K A;  3NF9 A;  1C1A A;  1MDU B;  4YDU A;  3VEY A;  3CCJ N;  1NGD A;  3RVC A;  3MX2 A;  1A5X A;  4G9Z A;  3HVR A;  4DV4 K;  3NAE A;  2O8D B;  3SV3 A;  1LOT B;  4HHT A;  5E84 A;  2GEM A;  4DUY K;  1HJO A;  4FJ9 A;  2KFN A;  4K25 A;  4EHU A;  3CJ9 A;  1S1V A;  3WXM B;  3SUO A;  3A5L C;  3ULE B;  2AJQ A;  1DKG D;  4KO0 A;  3WNG A;  2CH5 A;  3CJ7 A;  3KHY A;  3THX B;  3PSI A;  4DFM A;  5BRE A;  4DSE A;  4BGA A;  2QI2 A;  1IJJ A;  3J8A A;  2FSJ A;  1TK0 A;  4NXN K;  1UWB A;  1NJX A;  1RDC A;  1EET A;  1Q8I A;  3HT3 A;  3QIP A;  2Q31 A;  1EWQ A;  3THW A;  3O4W A;  3HSC A;  1L3T A;  2VQF K;  3SBG A;  4CZM A;  2X6N A;  3SMP A;  4ELV A;  1IV0 A;  1BA0 A;  2YHY A;  1TV6 A;  3M5R A;  3VN5 A;  1OH7 A;  4DTU A;  3QNO A;  5FRM A;  3ZSO A;  1TK8 A;  4HTU A;  5EXW A;  3VQ4 A;  3TSQ A;  2XRI A;  4GKJ K;  3WXK A;  3UIQ A;  3EKS A;  4JK7 A;  4DSI A;  3NVK A;  4PL8 A;  3V1R A;  4CZF A;  5KPR A;  4O8U A;  4OGC A;  3TAQ A;  3VQ7 A;  3TAF A;  3LM9 A;  1W9H A;  3AVL A;  5BN8 A;  1VSD A;  4JS4 A;  1NJZ A;  1YT3 A;  1JKH A;  5AQK A;  3VF2 A;  3RMD A;  5D3G A;  3D2F A;  1JLA A;  2WON A;  2B4J A;  4HUG A;  3RRH A;  3QLH A;  4WQ5 C;  3VMF B;  3SK3 A;  2YV0 X;  4HCC A;  3N4Q A;  3CF5 L;  3R6M A;  3AO3 A;  2Q0R A;  2KKZ A;  3NF8 A;  1Z26 A;  3T19 A;  4FWO A;  4ZTJ A;  1W97 L;  1NK8 A;  4CEO A;  4GV3 A;  1JLG A;  1VQ4 N;  4DWI A;  4M3W A;  3DOL A;  1YJW N;  3CME N;  2CH6 A;  1RT2 A;  1K6Y A;  4F8R A;  3MN7 A;  5TKW A;  5CZ1 A;  3GG4 A;  2KLA A;  1ZBS A;  4FZX C;  4BRL A;  1WBB A;  1F21 A;  3A2F A;  3CC2 N;  1VQ7 N;  2F96 A;  4JKE A;  5FPN A;  4JHD A;  4LC9 B;  3ZX3 A;  3GDQ A;  2EHG A;  3EE9 A;  3L2U A;  1WLJ A;  4LFB K;  1K8K B;  5KTQ A;  1K73 O;  3DRP A;  3SMS A;  3AA5 X;  2DFE A;  1HNZ K;  2P1J A;  4CIG A;  3QBW A;  1WSE A;  1X3M A;  3MMV A;  1W7A A;  1X9S A;  1QSL A;  1GLL O;  2P9I A;  3ID6 A;  4IJA A;  4JKD A;  3RSE A;  4HUE A;  3THW B;  4NCA A;  2VGN A;  4FJJ A;  5HRO A;  1BGX T;  4PA1 A;  2H3G X;  4AHU A;  3K5L A;  3KKS A;  3ZT0 A;  1NG9 A;  1OVQ A;  5GIN A;  4M3X A;  1QZ5 A;  3OHR A;  3V4I A;  3O9Q A;  3ZET A;  3W3D A;  1W0H A;  5GIO A;  3PIP L;  1EQY A;  4AHR A;  3LP1 A;  4CJP A;  3ULD A;  2BDP A;  1HNW K;  4N5S A;  2Q36 A;  5ADX H;  3C6U A;  4FLV A;  1YVU A;  3BDP A;  2UXB K;  3A5N C;  4DFJ A;  2ZF5 O;  1D9F A;  2KZZ A;  2O4I A;  4E1N A;  1SS6 A;  3NDK A;  2PAV A;  3N4P A;  2IC3 A;  4H0O A;  2BAN A;  2FXU A;  4BRH A;  3WEE A;  1Q9X A;  3HTV A;  4CF2 A;  2OTJ N;  4MLH A;  2UXC K;  3C94 A;  1RTD A;  3NBP A;  2BGG A;  1HQU A;  4GVE A;  3HO1 A;  4GY2 B;  4OKE A;  1VSE A;  1J5O A;  4MDB A;  1JLC A;  4LD0 A;  1X9J A;  4KB0 A;  4LSN A;  2HHW A;  5F2R A;  4X65 K;  3KK7 A;  1SV5 A;  2FBY A;  4H0Y B;  1HJR A;  4ILH A;  1NK6 A;  3PLA A;  3VQ5 A;  2OPP A;  3WQU A;  1FJG K;  4R79 A;  2HF4 A;  2UYT A;  1S72 N;  3QEP A;  3K0S A;  4IFV A;  1C0F A;  3DRS A;  1L3V A;  5EVZ A;  5BR8 K;  1EXQ A;  4MQ3 A;  2D0P A;  1X3N A;  4BDZ A;  3UKU A;  1S1X A;  5AQQ A;  2UUB K;  3ZX0 A;  5DM7 L;  1NJW A;  1OKJ A;  5AQY A;  1HR0 K;  3ZSR A;  3OYK A;  1ZBL A;  2P9I B;  4WFB L;  3J81 O;  3RSE B;  1SL2 A;  1TAQ A;  3MEG A;  4CGF A;  3VQ8 A;  3M6G A;  4ID5 A;  4CER A;  3G6E N;  3LP0 A;  3VQE A;  3SUP A;  4M7Y A;  1FKO A;  4KBO A;  3HXM A;  1WN7 A;  1EP4 A;  2VG7 A;  4WFN L;  4JKA A;  3ZT2 A;  4H0V B;  3IAY A;  4CEB A;  3CET A;  3O5B A;  3OTO K;  1VQK N;  2P51 A;  5HL7 L;  1S1T A;  5I9E B;  4RCH A;  3OYH A;  3VF4 A;  3ZT4 A;  1XC9 A;  1NGA A;  3DLG A;  4CFA A;  3M3Z A;  4KHW A;  3LP3 A;  1BWF O;  4CIE A;  4H4O A;  1VRT A;  3DLE A;  4ZTF A;  4R5P A;  3H1V X;  4ELT A;  3D2E A;  3OS1 A;  3WT0 A;  3IFR A;  2HHU A;  4C8K A;  3CMA N;  1QQC A;  4AM7 A;  2X78 A;  2ASP A;  4M45 A;  3O3G A;  3G0Z A;  3AVM A;  3SPY A;  3VES A;  1NMN A;  2HBL A;  3I0S A;  3KLH A;  4A59 A;  1GLE G;  4EZ6 A;  4CEC A;  2YHA A;  4EZ9 A;  4CK3 A;  3K2P A;  1U49 A;  1SKW A;  5FDL A;  4FW1 A;  4OPK A;  1BIS A;  5EU7 A;  4FL9 A;  2JWK A;  1YF5 L;  1NGB A;  4RG8 A;  3FZH A;  1A5V A;  3SQ1 A;  4BRM A;  2QM1 A;  1GLD G;  3TTC A;  3RR8 A;  4QS7 A;  3MXM A;  2QWN A;  1XNR K;  3O08 A;  3ALY A;  4JD2 B;  1TUU A;  2E5L K;  3UKU B;  3OW2 M;  1VQO N;  2Q1N A;  4BRK A;  1BL3 A;  3M8Q A;  4FPB A;  3MEC A;  5M1Q A;  3P38 A;  4NYN A;  1WSF A;  3HP6 A;  1VRU A;  3LDO A;  3BF1 A;  4B1W B;  5BRH A;  4YHH K;  3H3O B;  4FJL A;  3RMC A;  1VQ5 N;  4IG0 A;  2BTF A;  1X9M A;  3DXM A;  1VSM A;  4BDP A;  4MO5 A;  3IMX A;  1T3V A;  1ZYQ A;  1RT7 A;  1WSI A;  1CZB A;  2YX6 A;  3F2K A;  1YXQ A;  1ZC6 A;  3D6R A;  2VQE K;  1BCO A;  2P9U B;  4KI4 A;  1JCG A;  3DJC A;  3SJJ A;  3MWP A;  2F7T A;  4OPA A;  3M8S A;  4WQ4 C;  4ISG A;  4BRG A;  2ZJP L;  1Q81 O;  1L3S A;  5AZI A;  1BCM A;  3VGL A;  1GOA A;  2HVH A;  3G71 N;  2NNW A;  1U45 A;  2QKK A;  5M1O A;  2W40 A;  1JLE A;  1I39 A;  4LF4 K;  4M63 C;  4FJ7 A;  4F2S A;  1R59 O;  2HHV A;  3LAN A;  3WNE A;  3RR7 A;  3IRX A;  3KKR A;  3D2E B;  3H6E A;  3B8A X;  2RE2 A;  4CW7 B;  3FZF A;  3LWM A;  4NB4 A;  4MLE A;  4FLZ A;  1D4X A;  3WXJ A;  5M1N A;  5GAH P;  2O8E B;  1VK0 A;  1YJN N;  1ILY A;  1OH6 A;  1ASU A;  2FBV A;  1NKB A;  4KH4 A;  2E1Z A;  3HL8 A;  4DV5 K;  1N32 K;  3NH0 A;  1QQN A;  1OH5 A;  1N33 K;  4J2D A;  1KVA A;  4B08 A;  3KWG A;  4KRF A;  2WTU A;  1LW2 A;  4FSV A;  5J2Q A;  1NGE A;  4FWS A;  3EE8 A;  3KVG A;  1TAU A;  4BE0 A;  3P31 A;  3T1Y K;  4CBX A;  1SL1 A;  1C0U A;  3DOK A;  1HKB A;  3AO1 A;  4DUZ K;  4B9V A;  3LAM A;  4ZHR A;  3QML A;  1J5E K;  3AO4 A;  3EZW A;  3EL2 A;  3J7A P;  4JK9 A;  5C0Y A;  1JCE A;  4K41 A;  2QKB A;  4FZZ A;  4BRQ A;  3S9H A;  1ZBU A;  3AA4 A;  3HYF A;  3NCI A;  2GV9 A;  3DXK A;  1XUP O;  4FM2 A;  3HZ6 A;  1XC3 A;  4JI2 K;  2IAJ A;  4NCG A;  4FYD A;  4M3U A;  4FWN A;  3EKU A;  4LFC K;  1E4F T;  3C65 A;  3EYZ A;  2F8S A;  1S9G A;  2LSN A;  4DU3 A;  2E2P A;  1WSG A;  4OX9 K;  3OS0 A;  4IOC L;  1NKE A;  4E0D A;  4BRD A;  1NGG A;  4BR7 A;  1GOB A;  1N34 K;  5KRT A;  1Z25 A;  2HST A;  4KFB A;  3O3F A;  2DTU A;  3L3U A;  3THV A;  2I7P A;  2D1K A;  3FZK A;  5FPE A;  3CXC M;  4FXD A;  2HHQ A;  2XY5 A;  1BA1 A;  1RT1 A;  4M41 A;  3VA3 A;  1HKG A;  1DLO A;  3O80 A;  1NKC A;  4C1N I;  3O6W A;  4J2A A;  4C1N K;  1KCF A;  4G1Q A;  2DFH A;  1ZBI A;  4CJT A;  1OVY A;  2A1S A;  3OYF A;  1VHX A;  3B6P A;  4XH1 A;  3NE6 A;  5AQV A;  1KFD A;  1S6P A;  5J2P A;  3BEX A;  5SWM A;  2KFZ A;  4F3O A;  5BR9 A;  3VEZ A;  3QO9 A;  4IOX A;  4A5B A;  1IKY A;  3KK3 A;  4X62 K;  1E3M A;  1NJI O;  4H5R A;  3C95 A;  1LWF A;  1QVG M;  4NCB A;  3HVT A;  3AGR A;  4DQQ A;  3J7Z O;  2VG6 A;  4H5N A;  5AQH A;  1MU2 A;  4PQU A;  1D8Y A;  1NMD A;  4O0I A;  4DCH A;  1QE1 A;  2PFU A;  4IO9 L;  3K5N A;  1SQK A;  4CHQ A;  3QEX A;  4CJR A;  4NO7 A;  2HF3 A;  1RDW X;  4LSL A;  5FPD A;  3QIO A;  3QEI A;  4BG8 A;  1KVB A;  1T03 A;  4OO1 J;  3U9Z A;  1I3A A;  1RDD A;  1CXU A;  2I7N A;  5GAE P;  4E89 A;  2RHK A;  3AVH A;  3SAF A;  1WAJ A;  3OYN A;  3CER A;  1KTQ A;  2X6S A;  2P9N B;  1RDA A;  3OBW A;  4RW9 A;  3DXK B;  2HOE A;  3MN9 A;  5CYQ A;  3VQQ A;  1W2B M;  3OYI A;  1XWL A;  3SI6 A;  1U47 A;  2ZQB A;  2YHX A;  2UUA K;  4DQP A;  4DTP A;  4DQ8 A;  4CHZ A;  1L3U A;  3I8D A;  3M1F A;  2FSK A;  4JLH A;  4CF1 A;  1HYV A;  4OKJ A;  2NRZ A;  4OVL A;  5I42 A;  2P9L A;  2YHW A;  3EO3 A;  1QQM A;  4JI3 K;  2Z1I A;  2HBK A;  1HKC A;  3HI0 A;  4X66 K;  3T1H K;  4Y0W A;  2P9S A;  4PKI A;  4KHY A;  3EY1 A;  4B8A B;  4C8N A;  4KPY A;  3ZSQ A;  2OPS A;  3HM9 A;  3HJF A;  1REV A;  4UY8 O;  3L2Q A;  1FW6 A;  2VWB A;  5JIC A;  2G8H A;  3V9W A;  4M42 A;  2EX3 A;  3DLK A;  4DF4 A;  1ATN A;  3O4Q A;  3S41 A;  4DTM A;  1IG9 A;  4K8Z A;  3P4I A;  2VYP A;  3BF3 A;  5E26 A;  3LAK A;  2QWR A;  2WOM A;  1U6Z A;  2VG5 A;  4H0X B;  5BN9 A;  5M1F A;  1C0M A;  4BVO A;  1CZ9 A;  3ATV A;  3EEQ A;  4KHU A;  3V9U A;  3ZSW A;  1XI1 A;  3D7E O;  3FFI A;  4FWL A;  3CD6 N;  4DLG A;  2O4G A;  3WNF A;  3ZLJ A;  4GV9 A;  1RT4 A;  2ZGZ A;  3QIN A;  3VTI A;  3CCM N;  3KK2 A;  3OJU A;  4XH5 A;  5HOO A;  1QHT A;  3SQ0 A;  2PY5 A;  1S22 A;  3PUF A;  1RDU A;  4CJ4 A;  3UE5 A;  2YNF A;  4PKH A;  4BR5 A;  4CJU A;  4OPJ A;  2A3Z A;  4IG3 A;  2NRX A;  4YNQ A;  2A5X A;  3CFP A;  1UAX A;  1DTT A;  3RMA A;  5AFU H;  3CQX A;  1A5W A;  4C23 A;  3L6Q A;  2IVN A;  4B1U B;  2D0A A;  3S3M A;  1YHQ N;  3I55 N;  1T7P A;  1RNH A;  5AQO A;  4ILJ A;  4FLU A;  1VQ6 N;  2E2Q A;  4YOT A;  1S1U A;  1VSL A;  4JKB A;  4M3R A;  3QDK A;  4CED A;  1TYQ A;  3EN9 A;  4FWK A;  1KSP A;  2Q0U A;  4FK2 A;  2XY6 A;  4B3T K;  3K58 A;  4ISF A;  1NNE A;  4KHQ A;  4GKK K;  4HCB A;  3OVN A;  4CZH A;  2ZGY A;  4Z4C A;  2YI1 A;  5TKY A;  2O8F A;  4TSX A;  2P9S B;  1BQN A;  2Q3S A;  4IZ9 A;  3AO2 A;  3B6O A;  1YVN A;  2IGI A;  3VGM A;  3AVB A;  3JS6 A;  3QBX A;  4AIL C;  2NRR A;  1KAX A;  3L0Q A;  3KLI A;  3FE1 A;  2HHS A;  4B1X B;  3CQ8 A;  3H08 A;  4C8L A;  4DR5 K;  4Q5V A;  3OYM A;  3K57 A;  1Y64 A;  4BE1 A;  3PO4 A;  2ASM A;  3IUC A;  5AQZ A;  3H3N O;  2XO7 A;  5M1K A;  3FZL A;  3ZSZ A;  4YFU A;  4IXC A;  3KZB A;  3P83 D;  3SUQ A;  3CQY A;  3D2F B;  3V9Z A;  4FJ8 A;  3VEX A;  2HNY A;  3V9X A;  3CCL N;  4KTQ A;  1RBT A;  1U48 A;  5CE3 A;  1HLU A;  4CD3 A;  4BGB A;  4WQ4 A;  4CEQ A;  3O4N A;  4CJV A;  1NLV A;  3SV4 A;  1TKD A;  3LPT A;  4CVN E;  2GWK A;  1LWE A;  1YJ9 N;  3KWI A;  3U8X A;  3CJB A;  4IFE A;  5GAD P;  3ITH A;  3AVN A;  1V4S A;  4IBN A;  3DI6 A;  3OA9 A;  1C0T A;  2YNH A;  3AAP A;  1GOC A;  5HRR A;  3MN5 A;  3AAR A;  5EX5 A;  1Q9Y A;  4C8O A;  1M1K O;  3PO5 A;  1FKP A;  4FWQ A;  2OZM A;  1CZA N;  2NRT A;  1FK9 A;  5C12 A;  2YKN A;  2HHT A;  3VQB A;  4JHD B;  1YIT N;  2O8C A;  1OH8 A;  4CGG A;  3AO5 A;  3JXU A;  2NRH A;  3HM8 A;  2GUP A;  5MLC Q;  3VQC A;  1XQS C;  4N56 A;  3U4L A;  3NH1 A;  2HW3 A;  1BIU A;  3SAG A;  4BR4 A;  2YHB A;  4LF5 K;  1TYQ B;  2KQ2 A;  2XY8 A;  4RW8 A;  3WXI A;  1G15 A;  3BP8 A;  4FWM A;  2KTQ A;  4CK1 A;  4NLB A;  3W0L A;  3RTV A;  1LAW A;  1LCU A;  4KH5 A;  3HST B;  3KD1 E;  2I5J A;  3GOI A;  4H0P A;  4BRI A;  2YKM A;  2O8F B;  3KK1 A;  3CJ1 A;  1VSF A;  3PIO L;  3QER A;  3WQT A;  4KV8 A;  3ISN C;  3UB5 A;  3C7N A;  1K8A O;  3K5O A;  3NVM A;  3R8E A;  3TR8 A;  1RCH A;  2FBT A;  3VEW A;  3BGR A;  5DM6 L;  5JVG L;  3ZET B;  1NGI A;  4YOW A;  4IWV A;  2ITM A;  3AA3 A;  2GX9 A;  3OYG A;  4DTX A;  3SCX A;  1NGJ A;  5AQG A;  1KRP A;  3DWL A;  3ZX2 A;  1T8E A;  4KB1 A;  3FR0 A;  2NZT A;  3LM2 A;  4FZY A;  3O9T A;  3EZ5 A;  4LF9 K;  4MDA A;  3MCP A;  2RPI A;  3VER A;  1HNV A;  4FJX A;  1FXX A;  2QXF A;  2KW4 A;  3JAM O;  1KLN A;  3VOV A;  4JI4 K;  2Y1J A;  4FJM A;  1Q7Y O;  4HWI A;  3WEE B;  1DT9 A;  1JL1 A;  1JLF A;  1SKS A;  3C6A A;  4B9Q A;  2F9T A;  1GLB G;  4FW2 A;  3SLC A;  2FSN A;  3MK6 A;  4BRO A;  1HPZ A;  4K0K K;  1VSK A;  3V81 A;  2JLE A;  3S3N A;  4E7K A;  4I2P A;  4XEI A;  4CF0 A;  4CBU A;  1WUA A;  3LDQ A;  5DK5 A;  4KHS A;  1V4T A;  2QWP A;  3ZSY A;  1RTH A;  3C6T A;  3NH2 A;  4A2B A;  2JWL A;  2HB5 A;  5CY4 A;  3T1A A;  3MWT A;  1BI4 A;  3DLH A;  3AVJ A;  2HND A;  5AQF A;  2WUS A;  5B8H A;  3WXL A;  1NU0 A;  3U3G A;  4A57 A;  2HHX A;  1IKX A;  1T6C A;  3R3L A;  3MEE A;  1QVF M;  5FRO A;  1YTU A;  5ADX A;  2NLX A;  4B9T A;  3KJV A;  2UUC K;  4LFA K;  4JI0 K;  1WB9 A;  1JL2 A;  4BWM A;  2BH1 A;  3O9U A;  4KKO A;  3VA0 A;  4CGD A;  2W41 A;  3K9K A;  2D4W A;  4BRF A;  1L5U A;  2HMP A;  4OKK A;  1KAY A;  3LWL A;  3KLG A;  3C7N B;  3AVG A;  3IG1 A;  4JS5 A;  1Y97 A;  3CJA A;  3U6F A;  3OYA A;  3SQ4 A;  4PY5 A;  1JLQ A;  5ELZ A;  3IDH A;  2E88 A;  4GNI A;  3O9S A;  3I0R A;  1J53 A;  2IVP A;  3P5J A;  4Z4I A;  4BC5 A;  4YOX A;  4OGE A;  3TAB A;  4CJ7 A;  4DR3 K;  3KTQ A;  5CR4 A;  3K59 A;  1QHA A;  2P9P A;  5LY3 A;  2V51 B;  4H5T A;  3WNH A;  2FF3 B;  5AQJ A;  1SKR A;  2A42 A;  4DV6 K;  3AY9 A;  4U7B A;  3J80 O;  4DSK A;  4WYB A;  3TAM A;  1C1C A;  1TK5 A;  4ILG B;  3LZJ A;  4RWT A;  3ENB A;  4DU1 A;  2V7Z A;  2CGL A;  3NGI A;  4E7I A;  4RW4 A;  4KRE A;  4X64 K;  3NF6 A;  2Q97 A;  4PUO A;  2A41 A;  1J54 A;  3VQ9 A;  3JYT A;  4B3M K;  2D0C A;  4DTN A;  2XY7 A;  4B8C A;  3HK2 A;  2QW9 A;  2E20 A;  5AQP A;  3OS2 A;  1BDG A;  2EWS A;  4OJR A;  5BPM A;  4F4K A;  2QA4 N;  4HTL A;  3QET A;  4FK4 A;  3ZT3 A;  3PX6 A;  3CM6 A;  3ASM A;  4Q0B A;  1KXP A;  4JKG A;  4CEE A;  1BOT O;  4M3Y A;  4JI8 K;  1ZXO A;  2FLO A;  3CPE A;  4BQL A;  4FVM A;  4JNE A;  4FLW A;  3V6D A;  2GBZ A;  1BUP A;  2E2O A;  3L4I A;  3AGK A;  2B6A A;  4BC4 A;  1IBM K;  4CBW A;  4BAC A;  3CHW A;  3MAQ A;  4DV7 K;  4I9Q A;  1VQ8 N;  5HP1 A;  4CGJ A;  3T3F A;  4JRQ A;  4WQ5 A;  5KGX A;  4YOY A;  1RT6 A;  3DXM B;  4A2A A;  4ICL A;  5E41 A;  1QTM A;  3QEV A;  3MED A;  1ZBF A;  5SZT A;  3DM2 A;  1LAV A;  1N36 K;  4CJW A;  3A8Y A;  3CCV N;  2KZM A;  5K14 A;  3G4S N;  1R0A A;  1N5Y A;  1WNS A;  5AQL A;  4HUF A;  3MXI A;  5EOY A;  3QB0 A;  5AQT A;  4W5N A;  3F9K A;  3TTF A;  1D9D A;  4AHT A;  5AZI B;  4CZE A;  2QWM A;  1RT3 A;  1TGO A;  4ELU A;  2FBX A;  4DQI A;  5KQD A;  1WSJ A;  4JI1 K;  4K42 A;  2G8U A;  5KPZ A;  1UOC A;  3DMJ A;  5M1P A;  3KD5 E;  4CJ5 A;  4JEP A;  3MX5 A;  4JKH A;  2PBD A;  4BE2 A;  4JI5 K;  3O9R A;  2JGU A;  4IFY A;  5HLF A;  3SUN A;  3CFO A;  1YTA A;  1JLB A;  4LH4 A;  5J1E A;  1TL1 A;  1MWK A;  3CI5 A;  3IS9 A;  2ATQ A;  3QFP A;  2OA8 A;  1NGF A;  2CGK A;  1VQN N;  2BE2 A;  3KIO A;  4CF9 A;  4XH4 A;  1J9A A;  1XMO K;  2O8B A;  4BC3 A;  4DF8 A;  1GLA G;  2RF2 A;  4JI6 K;  3SZ2 A;  1YI2 N;  2YCH A;  3TPQ A;  2HVI A;  3WUH A;  3TSU A;  3FLC O;  4RTF D;  4JKG B;  4O44 A;  2ETJ A;  3E1Y A;  3K9J A;  4B1Z A;  4AF1 A;  3HPG A;  1VAZ A;  3SYZ A;  1O1W A;  5FLX O;  2W42 A;  4H5W A;  4OLA A;  1SAZ A;  2B5J A;  4CI6 A;  2OTL N;  5KRS A;  5AJ3 K;  5HRP A;  3HPO A;  1IKV A;  3V1O A;  4B9L A;  4CD1 A;  2IOC A;  5JMV A;  4DR1 K;  4WE1 A;  3CCS N;  2W6L A;  2J4R A;  4E7L A;  1Z05 A;  4B9U A;  3ZCM A;  4KTZ A;  4M3T A;  4FM0 A;  4GW6 A;  3SJH A;  1KAZ A;  3DAW A;  4FLY A;  3IKM A;  2ASO A;  3MXJ A;  4E7J A;  4BR9 A;  2OPR A;  1K8K A;  2NUB A;  1UA1 A;  4JV5 K;  4CJQ A;  4FPA A;  3H45 C;  4CIF A;  3VGK A;  1KQS M;  4W5T A;  4CHN A;  3M8P A;  2GEL A;  3JSM A;  1UA0 A;  4LF8 K;  5J2N A;  4CJE A;  2PZS A;  1S9E A;  1C6V A;  4DFP A;  5C15 A;  4YOR A;  1YAG A;  1VSI A;  4XIU A;  3DRR A;  5C2D A;  4CFB A;  1QSY A;  4BRE A;  5C42 A;  5AQI A;  4B1Y B;  2OPQ A;  1NBW A;  1XHX A;  1NOY A;  3AAQ A;  5T7B A;  3NMU A;  3LAL A;  2D0O A;  4J2E A;  4Z4F A;  2O8B B;  3GE1 A;  2QEX N;  3PX0 A;  4KH6 A;  2OYQ A;  3VQA A;  3L2W A;  4EP4 A;  4DSF A;  1HQE A;  3BUZ B;  4IDH A;  3A5M C;  2GWJ A;  4CEF A;  2VCP A;  2G8W A;  4H0T B;  4BRA A;  4DTO A;  1HMV A;  3ZEU A;  2DFF A;  1BHL A;  3PY8 A;  3VQP A;  4DS4 A;  4N41 A;  4BQZ A;  2XHB A;  5EY4 A;  3CFR A;  4O0J A;  4CJS A;  4A5A A;  2G8F A;  5AR0 A;  3ENO A;  4DV1 K;  4J2B A;  3T69 A;  4MFB A;  3LDS A;  2OAN A;  4H5V A;  1C1B A;  5H1S Q;  3HP9 A;  4FWP A;  4DQS A;  4DR7 K;  4L3Q A;  5AQX A;  4FK0 A;  4GV6 A;  1RTI A;  3NHG A;  1JXB A;  1NK9 A;  3PSF A;  4DB3 A;  4NXM K;  5LL6 Z;  3KLF A;  3OY9 A;  4CJL A;  5AQR A;  5KPT A;  2IDO A;  4BDY A;  4ID1 A;  2ZJR L;  1VQL N;  2QK9 A;  4I7F A;  4O5B A;  4L8R B;  3ENH A;  3OYB A;  4O55 A;  2P9L B;  4BC2 A;  5I3U A;  2NRW A;  1B9D A;  2FC0 A;  4JYA K;  2RKI A;  4PHT X;  1RGI A;  4W5R A;  4GVM A;  1CXQ A;  1KLM A;  2QTD A;  1XNQ K;  3AVC A;  5BRF A; 
#chains in the Genus database with same CATH homology
 4X62 K;  1I94 K;  4LF9 K;  4JI1 K;  1N33 K;  4X65 K;  4DV2 K;  4KHP K;  2F4V K;  4DV6 K;  3JAM O;  4JI4 K;  4DV4 K;  3J80 O;  4JI5 K;  4LF8 K;  2HHH K;  1FJG K;  4DUY K;  3T1Y K;  4CVN E;  4DUZ K;  1HNX K;  5BR8 K;  1XNR K;  1IBK K;  4K0K K;  4X64 K;  4LFB K;  1J5E K;  2E5L K;  2UU9 K;  4B3M K;  2UUB K;  3J7A P;  1HNZ K;  4AQY K;  1HR0 K;  4NXN K;  1XMO K;  1XMQ K;  5LMU K;  4JI6 K;  4YHH K;  3J81 O;  5IT9 O;  4DV0 K;  2VQF K;  4JI2 K;  4DV3 K;  2UUA K;  4JI8 K;  4JI7 K;  4LFC K;  5IWA K;  2VQE K;  4B3R K;  4B3S K;  4DR4 K;  4LF6 K;  1IBM K;  5FLX O;  4OX9 K;  2UXD K;  4YY3 K;  3OTO K;  5LMN K;  4DV7 K;  4LF5 K;  4LF7 K;  4DV1 K;  4GKJ K;  4DR2 K;  2ZM6 K;  1HNW K;  1N34 K;  4JI3 K;  2UUC K;  4B3T K;  4LFA K;  4JI0 K;  4DR7 K;  4GKK K;  5AJ3 K;  2UXB K;  4NXM K;  4X66 K;  5LL6 Z;  3T1H K;  4LF4 K;  4DR1 K;  1N36 K;  4V19 S;  3J7Y P;  4CW7 B;  4DR6 K;  2UXC K;  4DR5 K;  4JYA K;  5A2Q O;  4DR3 K;  4DV5 K;  1IBL K;  1N32 K;  4JV5 K;  1XNQ K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...