4X66K

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
total genus 28
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4x66K00
4NXMK 4DR2K 1HR0K 4X66K 4CVNE 5BR8K 4DUZK 4JI4K 4JI7K 4LF6K 3J81O 4X64K 4LF4K 1XMQK 3J80O 4V19S 4LFCK 1HNXK 4JI3K 3OTOK 4DR5K 2UUBK 4JYAK 5LMNK 2UUCK 4KHPK 4GKJK 4JI0K 3J7YP 4OX9K 2VQFK 4JV5K 4DV3K 4DR4K 5A2QO 4B3MK 1IBLK 2UUAK 5FLXO 4JI1K 4X62K 4JI5K 4DR1K 1HNZK 4LFBK 4B3SK 5AJ3K 1N33K 4DUYK 1J5EK 2E5LK 2UXCK 4DR6K 1FJGK 4DR3K 4LF9K 3T1YK 1HNWK 4YY3K 4LF8K 4B3TK 5LMUK 1IBMK 2UXBK 2ZM6K 4CW7B 1XNRK 1IBKK 4JI2K 4LF7K 4X65K 1N36K 1I94K 5IWAK 4LF5K 4YHHK 4DR7K 4DV5K 1XNQK 2VQEK 1N32K 4JI6K 4B3RK 4JI8K 5LL6Z 4DV0K 2UXDK 2HHHK 3JAMO 4LFAK 4DV4K 2F4VK 5IT9O 2UU9K 3T1HK 4DV2K 4NXNK 4AQYK 1N34K 3J7AP 4DV1K 4K0KK 1XMOK 4DV6K 4DV7K 4GKKK
chains in the Genus database with same CATH superfamily
3SUQA 3FGUA 1NK8A 1SZ2A 4NB4A 1QS4A 3MWTA 4FJNA 4IOXA 4MO5A 1QSYA 1RTIA 3J81O 4X64K 1T03A 4V19S 5AQLA 4Z4FA 3TWHA 4OO1J 2Y1JA 1HNXK 2ZJQL 1HNIA 3WNGA 1JLEA 1RT6A 2NLXA 3DLRA 4FCYA 4CHYA 4FJXA 5JVGL 1QHAA 1RT4A 3THYA 2UUAK 4J8FA 3SUNA 4IEEA 3WT0A 2GBZA 1NM1A 1T3VA 4Y1CA 3BGRA 1RDCA 3AVFA 4I2PA 5J2PA 3OYAA 4OLBA 3T1YK 1KFSA 3ZT2A 3LDOA 1EWRA 5J2QA 4CJEA 4CJUA 4CF2A 2HHSA 5EXWA 1RT2A 4BRAA 4FW2A 1C0MA 3J7ZO 1LWCA 4FM2A 3V9SA 1S72N 5CY4A 3OJUA 2G8UA 1G99A 5AZJB 3OYNA 3OYLA 1VQ7N 1W9HA 2X74A 4OGCA 1QQNA 3PV8A 1CZAN 1B9FA 1WSHA 1LCUA 2OZSA 3AVKA 4F2SA 1GLBG 1OH6A 1BDGA 2QKBA 2FXUA 4DV0K 1RILA 3EL2A 4BDYA 3PSFA 1T6DA 1T7PA 4FZYA 2WBNA 1BA0A 5HL7L 2F8TA 3H1QA 1ATRA 4AQYK 1E4FT 4WFBL 2FF3B 1T8EA 3S3MA 1YUWA 1WSIA 3H6EA 4G1QA 2YNIA 2OPPA 2OPQA 2YKMA 2F8SA 4Z4HA 3AVJA 3QB0A 2D5RA 4B8CA 3L6QA 5HOOA 1ZYQA 1TVRA 4IWVA 4CFCA 3ZLJA 2CGLA 2KLAA 1ZBHA 4JNEA 5GINA 4QAGA 1YVUA 2O8EB 2HF4A 4AHTA 4NCAA 2PFUA 4CZKA 3QFUA 5M1QA 4KHPK 1T6CA 4FWRA 2WOMA 1JXBA 4BGBA 4IKFA 3HOTA 3SV3A 2O8FA 1DTQA 4DR4K 2VGMA 2W41A 3K5NA 1W0HA 3HSCA 1GLDG 2NRVA 2ZGYA 5FLXO 4CJLA 4I7FA 4G9ZA 2D1KA 3VQPA 3WNHA 1H1VA 4BROA 3HVRA 4FWMA 2HBJA 1XHXA 4DTUA 5CYQA 3G71N 5AJ3K 3VQDA 2Q1NA 1NGBA 4O8UA 4KRFA 5DMRA 4KI4A 3AO3A 5KQDA 4KH4A 2KQ2A 1FK9A 2Q97A 3E01A 4LH5A 5CHIA 3I0SA 1NK5A 3DXKB 4AH9A 5CE3A 3I33A 5BPNA 4CCHA 1EXQA 1R59O 1NKBA 1NJWA 4BRFA 4E7JA 3GOIA 1R0AA 3MX2A 3HL8A 1E3MA 5C42A 1N8RO 2P9UB 4DSEA 4JI8K 1VQNN 1CLQA 4C8MA 1CXUA 3O3HA 1P8ZA 3BZCA 4W5QA 4BVPA 1VSIA 2F9TA 3RMDA 5AQPA 4LC9B 1WUAA 4Q5VA 3A2FA 1C0TA 2JWLA 5FDLA 3K59A 4RG8A 3ZSVA 4JKAA 1SKRA 3CJBA 4IJNA 3VQ9A 3RWUA 5SWMA 4DV7K 4JS4A 4GV9A 3HYFA 3HXMA 4O5FA 3VA0A 2BANA 3C95A 3SQ1A 4PWDA 4JI7K 3OS2A 4EP4A 4JS5A 3HP6A 3KKRA 1YIJN 4CF8A 2EX3A 2V7YA 4ISEA 3VQBA 1NK4A 3OTOK 2P1JA 2D0BA 3G0ZA 1NJYA 4H0XB 3FR0A 3O9UA 3L2QA 3ZX2A 4CEAA 3M8SA 5E41A 4XEIA 4KBOA 4XH5A 1RBSA 4E1JA 3M6GA 2AA4A 4BRQA 2QI2A 2WUSA 2PZSA 2P9IB 5GAHP 3HK2A 3E9LA 3A8YA 4RTFD 5C2DA 1HNZK 1Q18A 1CZ9A 3CJ9A 4E0DA 4CBWA 3QEVA 3QERA 1NGCA 3G10A 3AVHA 4LF9K 1MWKA 3Q7BA 4DLEA 3CD6N 4JHDB 3QBWA 5DM6L 4CJPA 4F8RA 4E7KA 3B8AX 4NLCA 2IDOA 4CERA 3LALA 3VPZA 1RTJA 4DF8A 4N5SA 5KTQA 2ZM6K 1EX4A 2KW4A 1OH8A 5JS1A 1NU0A 4EAHD 2E2QA 4I2QA 4YHHK 2A6AA 3LZIA 4Z4GA 4IOCL 2ZQBA 1BO5O 4C23A 4FZZA 1KLNA 1VSLA 2DFFA 1ITGA 4IG3A 3S3NA 4HWIA 4KFBA 2UU9K 4LD0A 1K8KB 4KREA 4B9QA 3KWIA 3VEOA 5M1NA 4KKOA 1JLBA 3T7ZA 5E26A 4J2BA 3HSTB 3THYB 1YI2N 4NYNA 4O0JA 2BGGA 1KSPA 4FLWA 4Z4EA 1VQ5N 5FPEA 2RN2A 3OYDA 5FPMA 4UY8O 3LP1A 4K42A 3VEXA 1GLEG 2E8AA 3HTVA 3CC7N 2ATQA 3IKMA 1VQPN 4CFBA 4BRDA 4FLTA 5AZJA 3HPGA 4A57A 2OCEA 4FJKA 3DXMB 5MLCQ 2Z1JA 4BQLA 3ALYA 1JL1A 4KAZA 3DM2A 3AO1A 4B08A 2ZGZA 1JLFA 3DRPA 3SPZA 3G6EN 1OH5A 3SAFA 4YY3K 2FSKA 2G8FA 3K9KA 2YJEA 3HRGA 4AHSA 4FK0A 4CJFA 1NGEA 3ISNC 4F2RA 2DY4A 4KTQA 1LWFA 3SUOA 1RGIA 4DCHA 2NRTA 4O44A 1SUQA 3ULEB 2DTUA 1EKEA 4H5VA 3M5RA 4MQ3A 4CEEA 3I8BA 4GY2B 1B92A 1S1WA 4CK2A 3LANA 2HHXA 3VEZA 1VAZA 4OPKA 5C25A 1GOCA 5AQOA 4YOVA 2JGUA 3C65A 4FWSA 3CYMA 1Q82O 2Q0UA 3MCPA 5J2NA 2O4IA 1NBWA 1U49A 3V9ZA 3D2EB 3CMAN 4A62A 3PIOL 1JKHA 5JICA 1NGJA 3SNNA 4ZTJA 4WFNL 2QKKA 3TR8A 1WSEA 2O8FB 4MFBA 1RT7A 4AHCA 3HP9A 3HBTA 3LDNA 1IKYA 3VERA 3QNNA 1HYVA 4ELTA 5EY4A 3AV9A 3E66A 5BR8K 3QEIA 4M3UA 2YCHA 3T19A 3F73A 3DXKA 3WXLA 3VENA 1BWFO 3CJ7A 4JRQA 3WXIA 3VQQA 4KPYA 3MMVA 2HMIA 1VHXA 4M7XA 4CGHA 2NRWA 5LMNK 2XY6A 2UUCK 5J1EA 3EY1A 4AHVA 3QMLA 2KZZA 3QFPA 2YJFA 4BG9A 4YFUA 2GWJA 1D8YA 3R6MA 3A0IX 2E4LA 3QINA 4DQIA 2QM1A 3KLIA 3QLHA 4JI5K 2FBYA 4WFAL 3VETA 1TL3A 4DUYK 3SI6A 1SL0A 3V4IA 4BWMA 1X9SA 1RDUA 2E6LA 4CJ7A 5HRPA 4FVMA 4A61A 2XO7A 3CPWM 3AVIA 3DLHA 3AGRA 4O55A 4CF1A 2IOCA 2OA8A 1Q86O 3AA5X 2P5OA 1XC9A 5AR0A 3IFRA 4JKFA 4B1WB 1RDBA 5AQFA 5KI6A 3VGKA 1YJWN 2JWKA 1Z6RA 2XY7A 2G8VA 3CQ8A 3D45A 3O5BA 1JL2A 1JCEA 1HYSA 3P1GA 1C1CA 4H0OA 3ENHA 3JSMA 4FLXA 4PL7A 4FK4A 2OANA 3MAQA 3L3VA 3P31A 1HKGA 1O13A 2FC0A 3LDSA 3CETA 1UA0A 5J2MA 3ZEUB 4J2AA 5LY3A 4NCGA 3F5TA 4ISGA 2QTDA 3VQCA 2QXFA 4FJ5A 2PYJA 5AQVA 4GKKK 3SQ0A 1YAGA 4DTPA 3RRGA 3D7EO 2XY5A 3E9OA 1ASWA 3UB5A 4FJMA 2HBLA 3P5JA 4PKIA 3ULDA 3AVAA 4H4MA 4XIUA 3OBWA 1FXXA 1VRTA 3WQUA 3LM2A 4WQ4C 4DU3A 4GW6A 3UE5A 4CJ5A 4CJ3A 4JK9A 4XH4A 4R79A 4BDPA 3AVGA 5BRFA 3ASMA 2LSNA 1M90O 3J7YP 4CBUA 4WQ5C 3LL3A 2GELA 3ENBA 3U9ZA 3NAEA 3SMSA 4DSIA 4CJWA 4OKKA 4YOYA 3HT3A 4JI1K 4MLHA 4CFAA 4XH1A 3ZSRA 4QCLA 3QESA 1O1WA 4AILC 1ZBFA 4QS7A 5AQWA 4I9QA 1SL2A 1K8KA 3CCVN 1Q81O 4IEIA 3BF3A 1LOTB 2IVPA 4M3WA 3KIOA 5SZTA 1IBMK 4KTWA 4OGEA 4H5RA 2HHUA 1S1VA 3V6DA 2YHBA 1DLOA 3VQ6A 3HM9A 5KPTA 1QQCA 4C8NA 5LJVA 1TGOA 1I94K 2KZMA 2ZWHA 4K41A 5FRMA 3NFAA 2IAJA 2QWOA 1SL1A 3VQ4A 4DR7K 4CZIA 2W42A 1QSLA 2YNGA 2V7ZA 4FJGA 1J9AA 3K5MA 3H08A 1NG9A 3DOKA 1ESVA 3SCXA 3TAEA 3OYFA 1QQMA 3SBGA 5AQQA 2HHHK 3JAMO 1S22A 3CXCM 4DV4K 3DXMA 3E1YA 3EZWA 3BEXA 1RBVA 4BGAA 4BR7A 3FZHA 1HUXA 4B1YB 4F3TA 1HLUA 4E1NA 1KVCA 3CCQN 1K9MO 4DSJA 3TAMA 2HB5A 2O4GA 1JXEA 4DV6K 1BOTO 3IMXA 4B9LA 3L4QA 3H46O 3V1OA 2HNYA 4CZEA 3SJHA 4LH4A 1X3MA 4BC3A 1RBTA 1DT9A 4FW1A 4K25A 3LDPA 4BR0A 3AARA 4B1VA 3CCSN 1GLAG 4CZHA 2NZTA 1KAYA 1VQON 1D4XA 4DF4A 1X9WA 2VG6A 3PY8A 3CFOA 4FPAA 1EO1A 2UUBK 1A5VA 3ULEA 3CCRN 4HUFA 4ILJA 3OJSA 3H1VX 3M8RA 4PQUA 5HRRA 1WAFA 2P9PB 4JKHA 3D6RA 3P39A 2NNWA 4CHNA 1MDUB 3OVNA 1SS6A 1UOCA 2GEMA 3KLHA 3QNOA 1WSGA 2OZMA 1SQKA 4KB1A 2DPNA 2A5XA 4E7IA 4YORA 4B9TA 1U2VB 4FO0A 4JKGB 4E7LA 1NLVA 3C6TA 5AQJA 2OYQA 5AQRA 4B9SA 3PSIA 3D2EA 2WFBA 2XHBA 3ZT4A 2KHOA 5JLFA 4FJHA 4ILGB 5AQSA 2QWPA 1J53A 4IFYA 3VTHA 2FSJA 3MN5A 4PHTX 4O5BA 2FSNA 3ZSQA 3LDLA 5HRNA 1RTDA 2Q36A 4CBXA 3VOVA 3B6PA 4BC4A 3CG7A 4X65K 1ASVA 2HSTA 2Z1GA 1HNVA 1EETA 3VEVA 1WNSA 1QQOA 1YF5L 4YDUC 3TPQA 4RW9A 4KI6A 4BC2A 2OPSA 3KHYA 4DV5K 1C0UA 4Z4CA 4CJKA 1QVGM 4JI6K 2G8IA 4ICLA 1WBBA 1RDWX 1P90A 1VSMA 3EYZA 4BRPA 4OLAA 3PO4A 2O8CA 1S9GA 4HTUA 5GIPA 4IFVA 3EE8A 2IVOA 1L3VA 4QS9A 1HRHA 1YVNA 3C94A 3KTQA 3EEQA 3NE6A 3GE1A 5AQIA 4K0KK 4CHPA 1HJOA 5CZ1A 4CD1A 3WNFA 5DM7L 4DSLA 2D0CA 3TTFA 3CC4N 4NXMK 4DS4A 3FFIA 4ZHRA 3EKUA 3NBPA 4B9NA 4M3RA 4FM0A 3P83D 3ID6A 4E89A 1VK0A 4HVJA 4LFCK 3ZX0A 2VWBA 3AVLA 4Q0BA 3O1BA 5T7BA 4JI3K 3CJ1A 4K8XA 3V81A 4NYFA 4OPJA 1K8AO 3LZJA 4KHWA 5I3UA 3H3OB 3WXKA 1Y64A 3AO4A 4CFDA 5C2FA 4CJRA 5KQ8A 1TYQB 3P38A 1HJRA 4OPHA 3HJFA 3O3GA 2HOEA 3CERA 2NRXA 4PUOA 1YT3A 3U3GA 3RR7A 3CJCA 4N41A 4IDKA 3OYIA 3OS1A 4CZGA 2QW9A 5EU7A 3ZEUA 4FM1A 3GG4A 3NH2A 4KHNA 4GV6A 4IZ9A 3THXB 2BE2A 1OVQA 1MU2A 2F7TA 1DKGD 4I6MB 3ZSWA 3KK3A 4MO4A 1ATNA 5C15A 1VRUA 3HVTA 4CW7B 4WF9L 5M1FA 1IBKK 4JI2K 2KTQA 3TARA 3MXIA 2NUBA 1X1PA 5GAGP 3E9PA 2W40A 1NGGA 1REVA 3FZMA 4Y1DA 5I42A 2BTFA 2VQEK 2RKIA 1YTAA 3CF5L 1N32K 2RF2A 3OY9A 1SAZA 3W0LA 3K5LA 4ID5A 1NK7A 1IG9A 3CMEN 4DFPA 4FJJA 2F4VK 1NMNA 2YHWA 3U9DA 1D9DA 2E1ZA 1K73O 1JLGA 4ID1A 4GNIA 1N6QA 1QTMA 1FW6A 3MXMA 5E84A 2HHQA 1C0GA 4K43A 1NOYA 4H5NA 4AHRA 2QWRA 4FSVA 3DYAA 4CVNE 1MWMA 5AQHA 3VN5A 2QWQA 4DUZK 1VSFA 4FJ8A 4KHYA 3NF8A 3SQ2A 1WN7A 3SAGA 4FWOA 2P9NA 1XMQK 1IKWA 4BRIA 3KLGA 5LJWA 3C7NB 2OPRA 3V9UA 4J2DA 3NDKA 1WSFA 3DOLA 3O6WA 4EP5A 1TL1A 2ETJA 4OX9K 2WONA 4DQSA 3NF9A 3VQEA 1DEJA 2D0OA 3AA4A 3QIOA 1LWEA 2P5GA 1J54A 3LWLA 4IDHA 2BUPA 1NNEA 1BIZA 4IJAA 1I3AA 2QWNA 2GWKA 3VMFB 4JKBA 4B9MA 4H8KA 2B4JA 3C6HA 3RRHA 1ZBLA 2WTUA 3CM6A 4PKHA 3MN7A 4B1ZA 2ZF5O 4CEBA 3F2KA 1MA9B 2E6MA 5LMUK 5C10A 2UXBK 4H0PA 4BRNA 2A3ZA 1YTUA 3LPTA 5F2RA 1NMDA 3VTIA 4EZ6A 1QVFM 4BRKA 1U4BA 1BHLA 1TV6A 4RW7A 1B9DA 3ATVA 4DSKA 1EQYA 3PIPL 3CCLN 2GX9A 5KGWA 4ZTFA 4LF5K 4RW6A 4BRMA 2QA4N 4YOWA 4EZ9A 3R8EA 5K14A 3K0SA 2D0PA 3N4QA 3V1RA 4YOTA 3OYMA 2QWMA 2UXDK 4U7BA 4F9OA 3L4IA 4DTSA 2A1RA 5GIOA 3PLAA 5AQTA 3G4SN 2P9PA 2HVHA 4OKEA 4JRPA 2I7PA 1RDAA 2A42A 4CGDA 1NGIA 3ZSZA 3OBYA 3IS9A 2A41A 4AM6A 3SZ2A 3ZETB 3HI0A 1U47A 3MWPA 3R9PA 1U2VA 1BISA 4JKGA 1X9JA 1L3UA 3WQTA 2HW3A 1LW2A 3VF4A 4YNQA 4X66K 4DQQA 3CI5A 1YXQA 4DKWA 4YOXA 2X6NA 2Y1IA 1HMVA 4CECA 4FOIA 1ZBIA 1GOBA 3MECA 4DLGA 3C0BA 5CR4A 4HCCA 4BDZA 3OYCA 1A5WA 3AAPA 3SBTA 4BRLA 1Q8IA 4JYAK 1Q9XA 4N47A 2FLOA 3FZKA 4JI0K 3K58A 1RDDA 2PYLA 5JS2A 5AQMA 1QZ5A 3WNEA 3BP8A 3T1AA 3UKRB 4RWTA 4OKJA 1IO2A 3OA9A 5HBMA 4CHQA 3DLBA 1L3SA 3CCEN 3O9TA 2E5LK 4EFHA 2E20A 3MN6A 1BL3A 1VSEA 1SV5A 3JS6A 1TUYA 5JMVA 4FOEA 1NKCA 3AVMA 2O8CB 4H03B 5TKWA 4FL9A 4C8LA 1YJNN 4CIGA 3TTCA 3NH1A 4WE1A 1NKEA 1XNRK 3U4LA 4KO0A 4CHZA 2DFHA 1E4GT 2E2OA 1BU6O 1D5AA 4LF7K 2RHKA 5KPZA 3WEEA 1EP4A 2YHYA 4E7HA 1N36K 3GDQA 3L2UA 4ILHA 1DGKN 3AA2A 4CK1A 3NCIA 4LSNA 4IO9L 4M42A 5HROA 1J6ZA 5AZIB 3OYGA 3JYTA 3SUPA 3IDHA 2X6SA 5EVZA 1IG8A 1KRPA 4H5WA 4LFAK 4MLEA 4M41A 2CH5A 1S5JA 3KLFA 3DLKA 3UKUB 3O9QA 1TYQA 1BI4B 3VF6A 4B9VA 1S3XA 1LAWA 1SKWA 5BPLA 2VG5A 2NRZA 3SV4A 1U45A 4JLHA 4B3OA 2W6KA 1TKDA 2YV0X 1SKSA 3THXA 3O3FA 2P9SB 4B8AB 4CEOA 4LF6K 3DMJA 3ZSXA 1S1TA 4O8KA 4W5RA 4I6MA 2XY8A 4LF4K 2WC9A 4CGGA 4CZFA 1OH7A 3VQAA 4DFKA 3CCJN 3O9SA 1N5YA 3TTDA 3DRRA 1I39A 2J4RA 1C6VA 4CJ4A 1BCOA 1ZXOA 3S41A 1NJIO 4BE1A 2W6LA 3SK3A 3LP2A 4JV5K 5JVHL 4PY5A 4A5AA 3KLEA 3B6OA 4F3OA 3VQ7A 1TKXA 3CPEA 1Y97A 5JLHA 4W5TA 4B3MK 1IBLK 1Z26A 2HBKA 3TAQA 1NK6A 2GTDA 1L5UA 4Z94A 3O1WA 4GVMA 5CYMA 4GVEA 4IBNA 4X62K 5AFUA 3OHRA 1XWLA 4B3SK 2YX6A 2ASMA 1FKOA 3QEXA 2UXCK 1VSDA 2GUIA 4DR6K 3EO3A 2ASOA 4KHUA 1HNWK 1OVYA 1KQSM 1RT1A 1BCMA 1C0FA 1TK5A 5AQNA 4EIAA 4FLUA 2E2PA 3CFPA 1T44A 3HPOA 2O8DB 3A5MC 3V1QA 4KV8A 3RSEB 4WQ4A 4JEPA 4B9UA 3NH0A 4JN4A 4CJVA 1UA1A 3AY9A 4CEFA 1HYZA 3MEDA 3L0QA 4C8OA 3BZKA 3O80A 3M8QA 2H3GX 3C7NA 3JXUA 4WQ5A 3RVCA 4JAXA 2P9NB 3R3LA 2KFZA 3DLEA 2E1YA 2QXLA 3SLCA 3I8DA 1TKZA 4CEQA 4DS5A 3TI0A 2DFEA 4FJ9A 3M8PA 3L3UA 5F1XA 3AO2A 1Q7YO 4CF9A 3J7AP 5AFUH 4DV1K 3T3FA 2Q0RA 4HUEA 1NGAA 2R7YA 3S9HA 1BGXT 4BVOA 3F9MA 4L8RB 3AAQA 1QSSA 3NVMA 3QEWA 3LDQA 1W7AA 3DWLA 1XHZA 3A5NC 3K5OA 2F96A 4PA1A 3THWB 4AF1A 1BQMA 1KLMA 2E88A 1F21A 4JD2B 1GOAA 5AQXA 1VSJA 2HF3A 1JLCA 1HPMA 3MK6A 4DR5K 3O08A 3CC2N 3BY5A 1KAZA 4DB3A 2OTJN 2BH1A 3NGYA 4M45A 1WSJA 3SJJA 1YITN 1KFDA 4LY7A 3MDQA 2PY5A 4FPBA 3RR8A 1Z25A 1KXPA 1HPZA 4IXCA 3FE1A 3L2VA 5BREA 3TSPA 5TKYA 1KAXA 1ZBUA 1V4SA 5EOYA 3IUCA 4CGFA 2CH6A 2YKNA 3BF1A 4FWLA 3ZETA 1ASUA 3S3OA 2HMPA 5KGXA 4FJ7A 3H45C 4DFMA 3VF2A 1XC3A 4BRCA 4QOZB 3KK1A 4MDAA 3LAMA 5IWAK 4FVUA 5FPNA 4U67L 4KTZA 4JK8A 3DAWA 1L3TA 4BRHA 4R5PA 4B1XB 1BG3A 3SQ4A 1S9EA 2Q3SA 1VQKN 4ELUA 1IJJA 4FK2A 5AQYA 1NGDA 2AP1A 4CHOA 4FJIA 5IT9O 4CF0A 3KK2A 1XI1A 3KZBA 5KRTA 3ZT1A 3UKRA 4C1NI 5M1OA 1WBDA 2IIRA 4EHTA 2YNFA 3KD1E 1JLAA 4KHSA 1HX1A 2V52B 3QDKA 4Z4IA 1IKXA 2P51A 3FZLA 1C1BA 4N56A 3W3DA 4FLZA 3RMAA 3AA3A 3D2FA 1TK0A 3FFKB 1WB9A 1CXQA 4CIEA 3HM8A 3J80O 1QHTA 2Q31A 2P9LA 1BQNA 4DU1A 4RW8A 1DTTA 1HQEA 4YDUA 1ATSA 2A1SA 1RNHA 3V9XA 3ZSYA 1GLLO 4H0TB 4DFJA 3VEYA 5BN8A 3A5OC 4BR5A 4DTXA 3I0RA 3WEEB 2EHGA 3ZSOA 4AM7A 2OTLN 3MEEA 5KPRA 4UQGA 5AZIA 2D0AA 4WYBA 3KJVA 2RPIA 3K9JA 5CZ2A 3TAGA 2FF6A 4H0VB 3UKUA 3QO9A 3MN9A 2X78A 1BI4A 3V9WA 3U3YA 4CD3A 5M1KA 4B3TK 4JKEA 5AQUA 1GLJO 4NCBA 4L3QA 4FYDA 2ASPA 2G8HA 3D0PA 1YHQN 4FZXC 3PX6A 4M63C 3ITHA 3QICA 3MEGA 1YJ9N 1GLFO 1IV0A 1HKCA 3TAPA 2P9SA 5M1PA 1VSKA 3VESA 1RFQA 1LAVA 5HLFA 3TSUA 2KKZA 1VQ4N 1XNQK 1M1KO 3RTVA 4FXDA 2QEXN 1S1UA 1C1AA 1WAJA 2NRHA 3PX0A 5EX5A 5D3GA 4NO7A 4ELVA 1NGFA 2PBDA 4BQZA 1S6PA 4CJQA 5GADP 4ISFA 3K57A 4FWPA 3THVA 4LSLA 4IG0A 3CIPA 3ZX3A 3C6AA 4PKGA 3KK7A 2FBXA 4HTLA 4BG8A 1TKTA 3QETA 5BPMA 4DHYA 3DLGA 2HHTA 4FJLA 2B6AA 1OKJA 3CJAA 4FLYA 3WXJA 3NHGA 1JCFA 4C8KA 4B1UB 3FZFA 3VQ8A 3HOSA 1NGHA 4M3YA 2CGJA 3TABA 3SMPA 1HR0K 1GLCG 2P9KB 2KFNA 3O4QA 4JI4K 4DQ8A 1T05A 3R1XA 3GBTA 2VCPA 5DK5A 3LAKA 2ZJPL 3CCMN 3H3NO 4BR9A 1A5XA 2O8DA 4GV3A 4OJRA 1JCGA 4H4OA 2V51B 2HHWA 5I9EB 3RSEA 1IH7A 3PX4A 4KH6A 2O8BB 2G8KA 2I7NA 1VQLN 3VA3A 3O4NA 2UYTA 2YNHA 3DI6A 5C24A 4KB0A 3DJCA 1NJXA 4FWQA 2F9WA 5FRNA 1TK8A 2YI1A 4JKDA 4LFBK 1KC8O 4DTRA 2IS3A 2YHAA 4CZMA 3ZT0A 4M3XA 2HVIA 1VQ6N 4DWIA 3GL1A 3VGMA 4WCEL 4HUGA 4BWJA 4J2EA 1JJ2M 2IGIA 1CZBA 3LP0A 3J8AA 1V4TA 1VQ8N 3LM9A 3NF7A 1ZBSA 1FKPA 3SPYA 3M1FA 3AO5A 4A59A 2VG7A 3N4PA 3HO1A 4Y0WA 4BR2A 1U04A 1KTQA 3OYBA 4DSFA 3I55N 3EE9A 3KWGA 3THWA 1HKBA 3TSQA 4CZLA 1NOZA 4BE2A 4JD2A 4B3RK 4KH5A 4O4GA 5LL6Z 3O8MA 5HRSA 2D4WA 4OVLA 4QS8A 3LP3A 4E3SA 4E19A 3C6UA 4A5BA 4TSXA 5C0YA 1KCFA 3T1HK 4MDBA 2GUPA 3CM5A 4FWNA 2VYPA 1NK0A 4DV2K 1TAQA 1KD1O 4NXNK 1XUPO 4BREA 1N34K 1LW0A 2RE2A 2FBVA 2AJQA 3EKSA 3WXMB 4CEDA 2ZE2A 4C1NK 2G8WA 2FBTA 3PUFA 4W5NA 3AVNA 1WLJA 3ATUA 2VWJA 2QWLA 3U6FA 3NGZA 1IKVA 2IC3A 5BRHA 1TUUA 4IOAL 3RMBA 1LV5A 3PO5A 3EZ5A 1KVAA 4M7YA 4CGIA 3DLLL 5AQZA 1X3NA 4FLVA 4GKJK 4IFEA 4F4KA 1VQMN 2VQFK 2E2NA 3K2PA 4HCBA 1NWKA 4CK3A 1X9MA 4BR4A 3ENOA 4NLBA 1RCHA 1EWQA 3HZ6A 2BDPA 3MCAB 3SYZA 3HPHA 2HBMA 4DR1K 2ITGA 3IRXA 3KKSA 2NRRA 2GV9A 1RBRA 1FJGK 1ILYA 4DR3K 1RBUA 5F0XA 3TANA 3U8XA 4LF8K 3QBXA 4CEZA 2O8EA 3T69A 4BRGA 3EN9A 1UAXA 3FLCO 3L2WA 3TAFA 3KVGA 4DTOA 3SAHA 3CCUN 5AQGA 1JLQA 4A2BA 4RW4A 4K8ZA 3QEPA 4DTNA 3MXJA 4GMJB 1WOQA 2Q2RA 4AHUA 1W97L 4CJTA 3O9RA 1VSHA 1RT3A 3D2FB 5ADXA 3A5LC 3BUZB 4CE9A 2PAVA 4CESA 3MX5A 4BC5A 4FWKA 2ZJRL 5H1SQ 3CQYA 2P9LB 2ZD1A 2XRIA 4RCHA 3M3ZA 5ELZA 3ZT3A 4DQPA 2VGNA 2YHXA 1XMOK 1TAUA 4DQRA 4BY9C 1KVBA 4DR2K 4O0IA 4DU4A 5BR9A 1D9FA 4KHQA 2P9UA 5BN9A 5B8HA 5KRSA 3G25A 1Z05A 3VQ5A 4OPAA 4HHTA 3CQXA 4W5OA 1G15A 4YOUA 3OYJA 3F9KA 3P4IA 5HP1A 2CGKA 4IO8A 4CGJA 3OYKA 4BE0A 1NJZA 2Z1IA 1BIUA 4E1MA 3NVKA 1NK9A 2Z1HA 3NF6A 4M3ZA 4DMNA 3Q7CA 1UWBA 4DV3K 3OYEA 3VGLA 5A2QO 2QK9A 3KD5E 1RT5A 3DRSA 5ADXH 3LPUA 3OW2M 3L2RA 4CZJA 2HHVA 3OS0A 3UIQA 2JLEA 3RMCA 1J5EK 1N33K 3ZCMA 3VEWA 4BACA 4DTMA 4M3TA 1XQSC 3NMUA 2HNZA 5GAEP 3BDPA 1VQ9N 3I56N 2A40A 3AGKA 1U48A 4N76A 4JK7A 4PL8A 3CHWA 1HQUA 1W2BM 4H5TA 3AVBA 4CIFA 1J5OA 4EHUA 2P9KA 1U6ZA 1S1XA 4A2AA 4H0YB 3QIPA 2P9IA 2IVNA 3CFRA 5BRDA 4JKCA 1RTHA 5FPDA 3OYHA 2HNDA 5C12A 3IG1A 4CJSA 3O4WA 1S6QA 1BA1A 2EWSA 4JHDA 4DG1A 1BUPA 2ITMA 4I9LA 3TU5A 1ZC6A 1Q9YA 2O8BA 2B5JA 3ZYYX 1QZ6A 3ID8A 3AVCA 2I5JA 3LWMA 4Z0UA 3NGIA 3WUHA 4DTJA 3IAYA 1K6YA 1QE1A 2VWKA 5FROA 4CI6A 3L8BA 5AQKA
chains in the Genus database with same CATH topology
4NXMK 4DR2K 1HR0K 4X66K 4CVNE 5BR8K 4DUZK 4JI4K 4JI7K 4LF6K 3J81O 4X64K 4LF4K 1XMQK 3J80O 4V19S 4LFCK 1HNXK 4JI3K 3OTOK 4DR5K 2UUBK 4JYAK 5LMNK 2UUCK 4KHPK 4GKJK 4JI0K 3J7YP 4OX9K 2VQFK 4JV5K 4DV3K 4DR4K 5A2QO 4B3MK 1IBLK 2UUAK 5FLXO 4JI1K 4X62K 4JI5K 4DR1K 1HNZK 4LFBK 4B3SK 5AJ3K 1N33K 4DUYK 1J5EK 2E5LK 2UXCK 4DR6K 1FJGK 4DR3K 4LF9K 3T1YK 1HNWK 4YY3K 4LF8K 4B3TK 5LMUK 1IBMK 2UXBK 2ZM6K 4CW7B 1XNRK 1IBKK 4JI2K 4LF7K 4X65K 1N36K 1I94K 5IWAK 4LF5K 4YHHK 4DR7K 4DV5K 1XNQK 2VQEK 1N32K 4JI6K 4B3RK 4JI8K 5LL6Z 4DV0K 2UXDK 2HHHK 3JAMO 4LFAK 4DV4K 2F4VK 5IT9O 2UU9K 3T1HK 4DV2K 4NXNK 4AQYK 1N34K 3J7AP 4DV1K 4K0KK 1XMOK 4DV6K 4DV7K 4GKKK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NXM K;  4DR2 K;  1HR0 K;  4X66 K;  4CVN E;  5BR8 K;  4DUZ K;  4JI4 K;  4JI7 K;  4LF6 K;  3J81 O;  4X64 K;  4LF4 K;  1XMQ K;  3J80 O;  4V19 S;  4LFC K;  1HNX K;  4JI3 K;  3OTO K;  4DR5 K;  2UUB K;  4JYA K;  5LMN K;  2UUC K;  4KHP K;  4GKJ K;  4JI0 K;  3J7Y P;  4OX9 K;  2VQF K;  4JV5 K;  4DV3 K;  4DR4 K;  5A2Q O;  4B3M K;  1IBL K;  2UUA K;  5FLX O;  4JI1 K;  4X62 K;  4JI5 K;  4DR1 K;  1HNZ K;  4LFB K;  4B3S K;  5AJ3 K;  1N33 K;  4DUY K;  1J5E K;  2E5L K;  2UXC K;  4DR6 K;  1FJG K;  4DR3 K;  4LF9 K;  3T1Y K;  1HNW K;  4YY3 K;  4LF8 K;  4B3T K;  5LMU K;  1IBM K;  2UXB K;  2ZM6 K;  4CW7 B;  1XNR K;  1IBK K;  4JI2 K;  4LF7 K;  4X65 K;  1N36 K;  1I94 K;  5IWA K;  4LF5 K;  4YHH K;  4DR7 K;  4DV5 K;  1XNQ K;  2VQE K;  1N32 K;  4JI6 K;  4B3R K;  4JI8 K;  5LL6 Z;  4DV0 K;  2UXD K;  2HHH K;  3JAM O;  4LFA K;  4DV4 K;  2F4V K;  5IT9 O;  2UU9 K;  3T1H K;  4DV2 K;  4NXN K;  4AQY K;  1N34 K;  3J7A P;  4DV1 K;  4K0K K;  1XMO K;  4DV6 K;  4DV7 K;  4GKK K; 
#chains in the Genus database with same CATH topology
 3SUQ A;  3FGU A;  1NK8 A;  1SZ2 A;  4NB4 A;  1QS4 A;  3MWT A;  4FJN A;  4IOX A;  4MO5 A;  1QSY A;  1RTI A;  3J81 O;  4X64 K;  1T03 A;  4V19 S;  5AQL A;  4Z4F A;  3TWH A;  4OO1 J;  2Y1J A;  1HNX K;  2ZJQ L;  1HNI A;  3WNG A;  1JLE A;  1RT6 A;  2NLX A;  3DLR A;  4FCY A;  4CHY A;  4FJX A;  5JVG L;  1QHA A;  1RT4 A;  3THY A;  2UUA K;  4J8F A;  3SUN A;  4IEE A;  3WT0 A;  2GBZ A;  1NM1 A;  1T3V A;  4Y1C A;  3BGR A;  1RDC A;  3AVF A;  4I2P A;  5J2P A;  3OYA A;  4OLB A;  3T1Y K;  1KFS A;  3ZT2 A;  3LDO A;  1EWR A;  5J2Q A;  4CJE A;  4CJU A;  4CF2 A;  2HHS A;  5EXW A;  1RT2 A;  4BRA A;  4FW2 A;  1C0M A;  3J7Z O;  1LWC A;  4FM2 A;  3V9S A;  1S72 N;  5CY4 A;  3OJU A;  2G8U A;  1G99 A;  5AZJ B;  3OYN A;  3OYL A;  1VQ7 N;  1W9H A;  2X74 A;  4OGC A;  1QQN A;  3PV8 A;  1CZA N;  1B9F A;  1WSH A;  1LCU A;  2OZS A;  3AVK A;  4F2S A;  1GLB G;  1OH6 A;  1BDG A;  2QKB A;  2FXU A;  4DV0 K;  1RIL A;  3EL2 A;  4BDY A;  3PSF A;  1T6D A;  1T7P A;  4FZY A;  2WBN A;  1BA0 A;  5HL7 L;  2F8T A;  3H1Q A;  1ATR A;  4AQY K;  1E4F T;  4WFB L;  2FF3 B;  1T8E A;  3S3M A;  1YUW A;  1WSI A;  3H6E A;  4G1Q A;  2YNI A;  2OPP A;  2OPQ A;  2YKM A;  2F8S A;  4Z4H A;  3AVJ A;  3QB0 A;  2D5R A;  4B8C A;  3L6Q A;  5HOO A;  1ZYQ A;  1TVR A;  4IWV A;  4CFC A;  3ZLJ A;  2CGL A;  2KLA A;  1ZBH A;  4JNE A;  5GIN A;  4QAG A;  1YVU A;  2O8E B;  2HF4 A;  4AHT A;  4NCA A;  2PFU A;  4CZK A;  3QFU A;  5M1Q A;  4KHP K;  1T6C A;  4FWR A;  2WOM A;  1JXB A;  4BGB A;  4IKF A;  3HOT A;  3SV3 A;  2O8F A;  1DTQ A;  4DR4 K;  2VGM A;  2W41 A;  3K5N A;  1W0H A;  3HSC A;  1GLD G;  2NRV A;  2ZGY A;  5FLX O;  4CJL A;  4I7F A;  4G9Z A;  2D1K A;  3VQP A;  3WNH A;  1H1V A;  4BRO A;  3HVR A;  4FWM A;  2HBJ A;  1XHX A;  4DTU A;  5CYQ A;  3G71 N;  5AJ3 K;  3VQD A;  2Q1N A;  1NGB A;  4O8U A;  4KRF A;  5DMR A;  4KI4 A;  3AO3 A;  5KQD A;  4KH4 A;  2KQ2 A;  1FK9 A;  2Q97 A;  3E01 A;  4LH5 A;  5CHI A;  3I0S A;  1NK5 A;  3DXK B;  4AH9 A;  5CE3 A;  3I33 A;  5BPN A;  4CCH A;  1EXQ A;  1R59 O;  1NKB A;  1NJW A;  4BRF A;  4E7J A;  3GOI A;  1R0A A;  3MX2 A;  3HL8 A;  1E3M A;  5C42 A;  1N8R O;  2P9U B;  4DSE A;  4JI8 K;  1VQN N;  1CLQ A;  4C8M A;  1CXU A;  3O3H A;  1P8Z A;  3BZC A;  4W5Q A;  4BVP A;  1VSI A;  2F9T A;  3RMD A;  5AQP A;  4LC9 B;  1WUA A;  4Q5V A;  3A2F A;  1C0T A;  2JWL A;  5FDL A;  3K59 A;  4RG8 A;  3ZSV A;  4JKA A;  1SKR A;  3CJB A;  4IJN A;  3VQ9 A;  3RWU A;  5SWM A;  4DV7 K;  4JS4 A;  4GV9 A;  3HYF A;  3HXM A;  4O5F A;  3VA0 A;  2BAN A;  3C95 A;  3SQ1 A;  4PWD A;  4JI7 K;  3OS2 A;  4EP4 A;  4JS5 A;  3HP6 A;  3KKR A;  1YIJ N;  4CF8 A;  2EX3 A;  2V7Y A;  4ISE A;  3VQB A;  1NK4 A;  3OTO K;  2P1J A;  2D0B A;  3G0Z A;  1NJY A;  4H0X B;  3FR0 A;  3O9U A;  3L2Q A;  3ZX2 A;  4CEA A;  3M8S A;  5E41 A;  4XEI A;  4KBO A;  4XH5 A;  1RBS A;  4E1J A;  3M6G A;  2AA4 A;  4BRQ A;  2QI2 A;  2WUS A;  2PZS A;  2P9I B;  5GAH P;  3HK2 A;  3E9L A;  3A8Y A;  4RTF D;  5C2D A;  1HNZ K;  1Q18 A;  1CZ9 A;  3CJ9 A;  4E0D A;  4CBW A;  3QEV A;  3QER A;  1NGC A;  3G10 A;  3AVH A;  4LF9 K;  1MWK A;  3Q7B A;  4DLE A;  3CD6 N;  4JHD B;  3QBW A;  5DM6 L;  4CJP A;  4F8R A;  4E7K A;  3B8A X;  4NLC A;  2IDO A;  4CER A;  3LAL A;  3VPZ A;  1RTJ A;  4DF8 A;  4N5S A;  5KTQ A;  2ZM6 K;  1EX4 A;  2KW4 A;  1OH8 A;  5JS1 A;  1NU0 A;  4EAH D;  2E2Q A;  4I2Q A;  4YHH K;  2A6A A;  3LZI A;  4Z4G A;  4IOC L;  2ZQB A;  1BO5 O;  4C23 A;  4FZZ A;  1KLN A;  1VSL A;  2DFF A;  1ITG A;  4IG3 A;  3S3N A;  4HWI A;  4KFB A;  2UU9 K;  4LD0 A;  1K8K B;  4KRE A;  4B9Q A;  3KWI A;  3VEO A;  5M1N A;  4KKO A;  1JLB A;  3T7Z A;  5E26 A;  4J2B A;  3HST B;  3THY B;  1YI2 N;  4NYN A;  4O0J A;  2BGG A;  1KSP A;  4FLW A;  4Z4E A;  1VQ5 N;  5FPE A;  2RN2 A;  3OYD A;  5FPM A;  4UY8 O;  3LP1 A;  4K42 A;  3VEX A;  1GLE G;  2E8A A;  3HTV A;  3CC7 N;  2ATQ A;  3IKM A;  1VQP N;  4CFB A;  4BRD A;  4FLT A;  5AZJ A;  3HPG A;  4A57 A;  2OCE A;  4FJK A;  3DXM B;  5MLC Q;  2Z1J A;  4BQL A;  3ALY A;  1JL1 A;  4KAZ A;  3DM2 A;  3AO1 A;  4B08 A;  2ZGZ A;  1JLF A;  3DRP A;  3SPZ A;  3G6E N;  1OH5 A;  3SAF A;  4YY3 K;  2FSK A;  2G8F A;  3K9K A;  2YJE A;  3HRG A;  4AHS A;  4FK0 A;  4CJF A;  1NGE A;  3ISN C;  4F2R A;  2DY4 A;  4KTQ A;  1LWF A;  3SUO A;  1RGI A;  4DCH A;  2NRT A;  4O44 A;  1SUQ A;  3ULE B;  2DTU A;  1EKE A;  4H5V A;  3M5R A;  4MQ3 A;  4CEE A;  3I8B A;  4GY2 B;  1B92 A;  1S1W A;  4CK2 A;  3LAN A;  2HHX A;  3VEZ A;  1VAZ A;  4OPK A;  5C25 A;  1GOC A;  5AQO A;  4YOV A;  2JGU A;  3C65 A;  4FWS A;  3CYM A;  1Q82 O;  2Q0U A;  3MCP A;  5J2N A;  2O4I A;  1NBW A;  1U49 A;  3V9Z A;  3D2E B;  3CMA N;  4A62 A;  3PIO L;  1JKH A;  5JIC A;  1NGJ A;  3SNN A;  4ZTJ A;  4WFN L;  2QKK A;  3TR8 A;  1WSE A;  2O8F B;  4MFB A;  1RT7 A;  4AHC A;  3HP9 A;  3HBT A;  3LDN A;  1IKY A;  3VER A;  3QNN A;  1HYV A;  4ELT A;  5EY4 A;  3AV9 A;  3E66 A;  5BR8 K;  3QEI A;  4M3U A;  2YCH A;  3T19 A;  3F73 A;  3DXK A;  3WXL A;  3VEN A;  1BWF O;  3CJ7 A;  4JRQ A;  3WXI A;  3VQQ A;  4KPY A;  3MMV A;  2HMI A;  1VHX A;  4M7X A;  4CGH A;  2NRW A;  5LMN K;  2XY6 A;  2UUC K;  5J1E A;  3EY1 A;  4AHV A;  3QML A;  2KZZ A;  3QFP A;  2YJF A;  4BG9 A;  4YFU A;  2GWJ A;  1D8Y A;  3R6M A;  3A0I X;  2E4L A;  3QIN A;  4DQI A;  2QM1 A;  3KLI A;  3QLH A;  4JI5 K;  2FBY A;  4WFA L;  3VET A;  1TL3 A;  4DUY K;  3SI6 A;  1SL0 A;  3V4I A;  4BWM A;  1X9S A;  1RDU A;  2E6L A;  4CJ7 A;  5HRP A;  4FVM A;  4A61 A;  2XO7 A;  3CPW M;  3AVI A;  3DLH A;  3AGR A;  4O55 A;  4CF1 A;  2IOC A;  2OA8 A;  1Q86 O;  3AA5 X;  2P5O A;  1XC9 A;  5AR0 A;  3IFR A;  4JKF A;  4B1W B;  1RDB A;  5AQF A;  5KI6 A;  3VGK A;  1YJW N;  2JWK A;  1Z6R A;  2XY7 A;  2G8V A;  3CQ8 A;  3D45 A;  3O5B A;  1JL2 A;  1JCE A;  1HYS A;  3P1G A;  1C1C A;  4H0O A;  3ENH A;  3JSM A;  4FLX A;  4PL7 A;  4FK4 A;  2OAN A;  3MAQ A;  3L3V A;  3P31 A;  1HKG A;  1O13 A;  2FC0 A;  3LDS A;  3CET A;  1UA0 A;  5J2M A;  3ZEU B;  4J2A A;  5LY3 A;  4NCG A;  3F5T A;  4ISG A;  2QTD A;  3VQC A;  2QXF A;  4FJ5 A;  2PYJ A;  5AQV A;  4GKK K;  3SQ0 A;  1YAG A;  4DTP A;  3RRG A;  3D7E O;  2XY5 A;  3E9O A;  1ASW A;  3UB5 A;  4FJM A;  2HBL A;  3P5J A;  4PKI A;  3ULD A;  3AVA A;  4H4M A;  4XIU A;  3OBW A;  1FXX A;  1VRT A;  3WQU A;  3LM2 A;  4WQ4 C;  4DU3 A;  4GW6 A;  3UE5 A;  4CJ5 A;  4CJ3 A;  4JK9 A;  4XH4 A;  4R79 A;  4BDP A;  3AVG A;  5BRF A;  3ASM A;  2LSN A;  1M90 O;  3J7Y P;  4CBU A;  4WQ5 C;  3LL3 A;  2GEL A;  3ENB A;  3U9Z A;  3NAE A;  3SMS A;  4DSI A;  4CJW A;  4OKK A;  4YOY A;  3HT3 A;  4JI1 K;  4MLH A;  4CFA A;  4XH1 A;  3ZSR A;  4QCL A;  3QES A;  1O1W A;  4AIL C;  1ZBF A;  4QS7 A;  5AQW A;  4I9Q A;  1SL2 A;  1K8K A;  3CCV N;  1Q81 O;  4IEI A;  3BF3 A;  1LOT B;  2IVP A;  4M3W A;  3KIO A;  5SZT A;  1IBM K;  4KTW A;  4OGE A;  4H5R A;  2HHU A;  1S1V A;  3V6D A;  2YHB A;  1DLO A;  3VQ6 A;  3HM9 A;  5KPT A;  1QQC A;  4C8N A;  5LJV A;  1TGO A;  1I94 K;  2KZM A;  2ZWH A;  4K41 A;  5FRM A;  3NFA A;  2IAJ A;  2QWO A;  1SL1 A;  3VQ4 A;  4DR7 K;  4CZI A;  2W42 A;  1QSL A;  2YNG A;  2V7Z A;  4FJG A;  1J9A A;  3K5M A;  3H08 A;  1NG9 A;  3DOK A;  1ESV A;  3SCX A;  3TAE A;  3OYF A;  1QQM A;  3SBG A;  5AQQ A;  2HHH K;  3JAM O;  1S22 A;  3CXC M;  4DV4 K;  3DXM A;  3E1Y A;  3EZW A;  3BEX A;  1RBV A;  4BGA A;  4BR7 A;  3FZH A;  1HUX A;  4B1Y B;  4F3T A;  1HLU A;  4E1N A;  1KVC A;  3CCQ N;  1K9M O;  4DSJ A;  3TAM A;  2HB5 A;  2O4G A;  1JXE A;  4DV6 K;  1BOT O;  3IMX A;  4B9L A;  3L4Q A;  3H46 O;  3V1O A;  2HNY A;  4CZE A;  3SJH A;  4LH4 A;  1X3M A;  4BC3 A;  1RBT A;  1DT9 A;  4FW1 A;  4K25 A;  3LDP A;  4BR0 A;  3AAR A;  4B1V A;  3CCS N;  1GLA G;  4CZH A;  2NZT A;  1KAY A;  1VQO N;  1D4X A;  4DF4 A;  1X9W A;  2VG6 A;  3PY8 A;  3CFO A;  4FPA A;  1EO1 A;  2UUB K;  1A5V A;  3ULE A;  3CCR N;  4HUF A;  4ILJ A;  3OJS A;  3H1V X;  3M8R A;  4PQU A;  5HRR A;  1WAF A;  2P9P B;  4JKH A;  3D6R A;  3P39 A;  2NNW A;  4CHN A;  1MDU B;  3OVN A;  1SS6 A;  1UOC A;  2GEM A;  3KLH A;  3QNO A;  1WSG A;  2OZM A;  1SQK A;  4KB1 A;  2DPN A;  2A5X A;  4E7I A;  4YOR A;  4B9T A;  1U2V B;  4FO0 A;  4JKG B;  4E7L A;  1NLV A;  3C6T A;  5AQJ A;  2OYQ A;  5AQR A;  4B9S A;  3PSI A;  3D2E A;  2WFB A;  2XHB A;  3ZT4 A;  2KHO A;  5JLF A;  4FJH A;  4ILG B;  5AQS A;  2QWP A;  1J53 A;  4IFY A;  3VTH A;  2FSJ A;  3MN5 A;  4PHT X;  4O5B A;  2FSN A;  3ZSQ A;  3LDL A;  5HRN A;  1RTD A;  2Q36 A;  4CBX A;  3VOV A;  3B6P A;  4BC4 A;  3CG7 A;  4X65 K;  1ASV A;  2HST A;  2Z1G A;  1HNV A;  1EET A;  3VEV A;  1WNS A;  1QQO A;  1YF5 L;  4YDU C;  3TPQ A;  4RW9 A;  4KI6 A;  4BC2 A;  2OPS A;  3KHY A;  4DV5 K;  1C0U A;  4Z4C A;  4CJK A;  1QVG M;  4JI6 K;  2G8I A;  4ICL A;  1WBB A;  1RDW X;  1P90 A;  1VSM A;  3EYZ A;  4BRP A;  4OLA A;  3PO4 A;  2O8C A;  1S9G A;  4HTU A;  5GIP A;  4IFV A;  3EE8 A;  2IVO A;  1L3V A;  4QS9 A;  1HRH A;  1YVN A;  3C94 A;  3KTQ A;  3EEQ A;  3NE6 A;  3GE1 A;  5AQI A;  4K0K K;  4CHP A;  1HJO A;  5CZ1 A;  4CD1 A;  3WNF A;  5DM7 L;  4DSL A;  2D0C A;  3TTF A;  3CC4 N;  4NXM K;  4DS4 A;  3FFI A;  4ZHR A;  3EKU A;  3NBP A;  4B9N A;  4M3R A;  4FM0 A;  3P83 D;  3ID6 A;  4E89 A;  1VK0 A;  4HVJ A;  4LFC K;  3ZX0 A;  2VWB A;  3AVL A;  4Q0B A;  3O1B A;  5T7B A;  4JI3 K;  3CJ1 A;  4K8X A;  3V81 A;  4NYF A;  4OPJ A;  1K8A O;  3LZJ A;  4KHW A;  5I3U A;  3H3O B;  3WXK A;  1Y64 A;  3AO4 A;  4CFD A;  5C2F A;  4CJR A;  5KQ8 A;  1TYQ B;  3P38 A;  1HJR A;  4OPH A;  3HJF A;  3O3G A;  2HOE A;  3CER A;  2NRX A;  4PUO A;  1YT3 A;  3U3G A;  3RR7 A;  3CJC A;  4N41 A;  4IDK A;  3OYI A;  3OS1 A;  4CZG A;  2QW9 A;  5EU7 A;  3ZEU A;  4FM1 A;  3GG4 A;  3NH2 A;  4KHN A;  4GV6 A;  4IZ9 A;  3THX B;  2BE2 A;  1OVQ A;  1MU2 A;  2F7T A;  1DKG D;  4I6M B;  3ZSW A;  3KK3 A;  4MO4 A;  1ATN A;  5C15 A;  1VRU A;  3HVT A;  4CW7 B;  4WF9 L;  5M1F A;  1IBK K;  4JI2 K;  2KTQ A;  3TAR A;  3MXI A;  2NUB A;  1X1P A;  5GAG P;  3E9P A;  2W40 A;  1NGG A;  1REV A;  3FZM A;  4Y1D A;  5I42 A;  2BTF A;  2VQE K;  2RKI A;  1YTA A;  3CF5 L;  1N32 K;  2RF2 A;  3OY9 A;  1SAZ A;  3W0L A;  3K5L A;  4ID5 A;  1NK7 A;  1IG9 A;  3CME N;  4DFP A;  4FJJ A;  2F4V K;  1NMN A;  2YHW A;  3U9D A;  1D9D A;  2E1Z A;  1K73 O;  1JLG A;  4ID1 A;  4GNI A;  1N6Q A;  1QTM A;  1FW6 A;  3MXM A;  5E84 A;  2HHQ A;  1C0G A;  4K43 A;  1NOY A;  4H5N A;  4AHR A;  2QWR A;  4FSV A;  3DYA A;  4CVN E;  1MWM A;  5AQH A;  3VN5 A;  2QWQ A;  4DUZ K;  1VSF A;  4FJ8 A;  4KHY A;  3NF8 A;  3SQ2 A;  1WN7 A;  3SAG A;  4FWO A;  2P9N A;  1XMQ K;  1IKW A;  4BRI A;  3KLG A;  5LJW A;  3C7N B;  2OPR A;  3V9U A;  4J2D A;  3NDK A;  1WSF A;  3DOL A;  3O6W A;  4EP5 A;  1TL1 A;  2ETJ A;  4OX9 K;  2WON A;  4DQS A;  3NF9 A;  3VQE A;  1DEJ A;  2D0O A;  3AA4 A;  3QIO A;  1LWE A;  2P5G A;  1J54 A;  3LWL A;  4IDH A;  2BUP A;  1NNE A;  1BIZ A;  4IJA A;  1I3A A;  2QWN A;  2GWK A;  3VMF B;  4JKB A;  4B9M A;  4H8K A;  2B4J A;  3C6H A;  3RRH A;  1ZBL A;  2WTU A;  3CM6 A;  4PKH A;  3MN7 A;  4B1Z A;  2ZF5 O;  4CEB A;  3F2K A;  1MA9 B;  2E6M A;  5LMU K;  5C10 A;  2UXB K;  4H0P A;  4BRN A;  2A3Z A;  1YTU A;  3LPT A;  5F2R A;  1NMD A;  3VTI A;  4EZ6 A;  1QVF M;  4BRK A;  1U4B A;  1BHL A;  1TV6 A;  4RW7 A;  1B9D A;  3ATV A;  4DSK A;  1EQY A;  3PIP L;  3CCL N;  2GX9 A;  5KGW A;  4ZTF A;  4LF5 K;  4RW6 A;  4BRM A;  2QA4 N;  4YOW A;  4EZ9 A;  3R8E A;  5K14 A;  3K0S A;  2D0P A;  3N4Q A;  3V1R A;  4YOT A;  3OYM A;  2QWM A;  2UXD K;  4U7B A;  4F9O A;  3L4I A;  4DTS A;  2A1R A;  5GIO A;  3PLA A;  5AQT A;  3G4S N;  2P9P A;  2HVH A;  4OKE A;  4JRP A;  2I7P A;  1RDA A;  2A42 A;  4CGD A;  1NGI A;  3ZSZ A;  3OBY A;  3IS9 A;  2A41 A;  4AM6 A;  3SZ2 A;  3ZET B;  3HI0 A;  1U47 A;  3MWP A;  3R9P A;  1U2V A;  1BIS A;  4JKG A;  1X9J A;  1L3U A;  3WQT A;  2HW3 A;  1LW2 A;  3VF4 A;  4YNQ A;  4X66 K;  4DQQ A;  3CI5 A;  1YXQ A;  4DKW A;  4YOX A;  2X6N A;  2Y1I A;  1HMV A;  4CEC A;  4FOI A;  1ZBI A;  1GOB A;  3MEC A;  4DLG A;  3C0B A;  5CR4 A;  4HCC A;  4BDZ A;  3OYC A;  1A5W A;  3AAP A;  3SBT A;  4BRL A;  1Q8I A;  4JYA K;  1Q9X A;  4N47 A;  2FLO A;  3FZK A;  4JI0 K;  3K58 A;  1RDD A;  2PYL A;  5JS2 A;  5AQM A;  1QZ5 A;  3WNE A;  3BP8 A;  3T1A A;  3UKR B;  4RWT A;  4OKJ A;  1IO2 A;  3OA9 A;  5HBM A;  4CHQ A;  3DLB A;  1L3S A;  3CCE N;  3O9T A;  2E5L K;  4EFH A;  2E20 A;  3MN6 A;  1BL3 A;  1VSE A;  1SV5 A;  3JS6 A;  1TUY A;  5JMV A;  4FOE A;  1NKC A;  3AVM A;  2O8C B;  4H03 B;  5TKW A;  4FL9 A;  4C8L A;  1YJN N;  4CIG A;  3TTC A;  3NH1 A;  4WE1 A;  1NKE A;  1XNR K;  3U4L A;  4KO0 A;  4CHZ A;  2DFH A;  1E4G T;  2E2O A;  1BU6 O;  1D5A A;  4LF7 K;  2RHK A;  5KPZ A;  3WEE A;  1EP4 A;  2YHY A;  4E7H A;  1N36 K;  3GDQ A;  3L2U A;  4ILH A;  1DGK N;  3AA2 A;  4CK1 A;  3NCI A;  4LSN A;  4IO9 L;  4M42 A;  5HRO A;  1J6Z A;  5AZI B;  3OYG A;  3JYT A;  3SUP A;  3IDH A;  2X6S A;  5EVZ A;  1IG8 A;  1KRP A;  4H5W A;  4LFA K;  4MLE A;  4M41 A;  2CH5 A;  1S5J A;  3KLF A;  3DLK A;  3UKU B;  3O9Q A;  1TYQ A;  1BI4 B;  3VF6 A;  4B9V A;  1S3X A;  1LAW A;  1SKW A;  5BPL A;  2VG5 A;  2NRZ A;  3SV4 A;  1U45 A;  4JLH A;  4B3O A;  2W6K A;  1TKD A;  2YV0 X;  1SKS A;  3THX A;  3O3F A;  2P9S B;  4B8A B;  4CEO A;  4LF6 K;  3DMJ A;  3ZSX A;  1S1T A;  4O8K A;  4W5R A;  4I6M A;  2XY8 A;  4LF4 K;  2WC9 A;  4CGG A;  4CZF A;  1OH7 A;  3VQA A;  4DFK A;  3CCJ N;  3O9S A;  1N5Y A;  3TTD A;  3DRR A;  1I39 A;  2J4R A;  1C6V A;  4CJ4 A;  1BCO A;  1ZXO A;  3S41 A;  1NJI O;  4BE1 A;  2W6L A;  3SK3 A;  3LP2 A;  4JV5 K;  5JVH L;  4PY5 A;  4A5A A;  3KLE A;  3B6O A;  4F3O A;  3VQ7 A;  1TKX A;  3CPE A;  1Y97 A;  5JLH A;  4W5T A;  4B3M K;  1IBL K;  1Z26 A;  2HBK A;  3TAQ A;  1NK6 A;  2GTD A;  1L5U A;  4Z94 A;  3O1W A;  4GVM A;  5CYM A;  4GVE A;  4IBN A;  4X62 K;  5AFU A;  3OHR A;  1XWL A;  4B3S K;  2YX6 A;  2ASM A;  1FKO A;  3QEX A;  2UXC K;  1VSD A;  2GUI A;  4DR6 K;  3EO3 A;  2ASO A;  4KHU A;  1HNW K;  1OVY A;  1KQS M;  1RT1 A;  1BCM A;  1C0F A;  1TK5 A;  5AQN A;  4EIA A;  4FLU A;  2E2P A;  3CFP A;  1T44 A;  3HPO A;  2O8D B;  3A5M C;  3V1Q A;  4KV8 A;  3RSE B;  4WQ4 A;  4JEP A;  4B9U A;  3NH0 A;  4JN4 A;  4CJV A;  1UA1 A;  3AY9 A;  4CEF A;  1HYZ A;  3MED A;  3L0Q A;  4C8O A;  3BZK A;  3O80 A;  3M8Q A;  2H3G X;  3C7N A;  3JXU A;  4WQ5 A;  3RVC A;  4JAX A;  2P9N B;  3R3L A;  2KFZ A;  3DLE A;  2E1Y A;  2QXL A;  3SLC A;  3I8D A;  1TKZ A;  4CEQ A;  4DS5 A;  3TI0 A;  2DFE A;  4FJ9 A;  3M8P A;  3L3U A;  5F1X A;  3AO2 A;  1Q7Y O;  4CF9 A;  3J7A P;  5AFU H;  4DV1 K;  3T3F A;  2Q0R A;  4HUE A;  1NGA A;  2R7Y A;  3S9H A;  1BGX T;  4BVO A;  3F9M A;  4L8R B;  3AAQ A;  1QSS A;  3NVM A;  3QEW A;  3LDQ A;  1W7A A;  3DWL A;  1XHZ A;  3A5N C;  3K5O A;  2F96 A;  4PA1 A;  3THW B;  4AF1 A;  1BQM A;  1KLM A;  2E88 A;  1F21 A;  4JD2 B;  1GOA A;  5AQX A;  1VSJ A;  2HF3 A;  1JLC A;  1HPM A;  3MK6 A;  4DR5 K;  3O08 A;  3CC2 N;  3BY5 A;  1KAZ A;  4DB3 A;  2OTJ N;  2BH1 A;  3NGY A;  4M45 A;  1WSJ A;  3SJJ A;  1YIT N;  1KFD A;  4LY7 A;  3MDQ A;  2PY5 A;  4FPB A;  3RR8 A;  1Z25 A;  1KXP A;  1HPZ A;  4IXC A;  3FE1 A;  3L2V A;  5BRE A;  3TSP A;  5TKY A;  1KAX A;  1ZBU A;  1V4S A;  5EOY A;  3IUC A;  4CGF A;  2CH6 A;  2YKN A;  3BF1 A;  4FWL A;  3ZET A;  1ASU A;  3S3O A;  2HMP A;  5KGX A;  4FJ7 A;  3H45 C;  4DFM A;  3VF2 A;  1XC3 A;  4BRC A;  4QOZ B;  3KK1 A;  4MDA A;  3LAM A;  5IWA K;  4FVU A;  5FPN A;  4U67 L;  4KTZ A;  4JK8 A;  3DAW A;  1L3T A;  4BRH A;  4R5P A;  4B1X B;  1BG3 A;  3SQ4 A;  1S9E A;  2Q3S A;  1VQK N;  4ELU A;  1IJJ A;  4FK2 A;  5AQY A;  1NGD A;  2AP1 A;  4CHO A;  4FJI A;  5IT9 O;  4CF0 A;  3KK2 A;  1XI1 A;  3KZB A;  5KRT A;  3ZT1 A;  3UKR A;  4C1N I;  5M1O A;  1WBD A;  2IIR A;  4EHT A;  2YNF A;  3KD1 E;  1JLA A;  4KHS A;  1HX1 A;  2V52 B;  3QDK A;  4Z4I A;  1IKX A;  2P51 A;  3FZL A;  1C1B A;  4N56 A;  3W3D A;  4FLZ A;  3RMA A;  3AA3 A;  3D2F A;  1TK0 A;  3FFK B;  1WB9 A;  1CXQ A;  4CIE A;  3HM8 A;  3J80 O;  1QHT A;  2Q31 A;  2P9L A;  1BQN A;  4DU1 A;  4RW8 A;  1DTT A;  1HQE A;  4YDU A;  1ATS A;  2A1S A;  1RNH A;  3V9X A;  3ZSY A;  1GLL O;  4H0T B;  4DFJ A;  3VEY A;  5BN8 A;  3A5O C;  4BR5 A;  4DTX A;  3I0R A;  3WEE B;  2EHG A;  3ZSO A;  4AM7 A;  2OTL N;  3MEE A;  5KPR A;  4UQG A;  5AZI A;  2D0A A;  4WYB A;  3KJV A;  2RPI A;  3K9J A;  5CZ2 A;  3TAG A;  2FF6 A;  4H0V B;  3UKU A;  3QO9 A;  3MN9 A;  2X78 A;  1BI4 A;  3V9W A;  3U3Y A;  4CD3 A;  5M1K A;  4B3T K;  4JKE A;  5AQU A;  1GLJ O;  4NCB A;  4L3Q A;  4FYD A;  2ASP A;  2G8H A;  3D0P A;  1YHQ N;  4FZX C;  3PX6 A;  4M63 C;  3ITH A;  3QIC A;  3MEG A;  1YJ9 N;  1GLF O;  1IV0 A;  1HKC A;  3TAP A;  2P9S A;  5M1P A;  1VSK A;  3VES A;  1RFQ A;  1LAV A;  5HLF A;  3TSU A;  2KKZ A;  1VQ4 N;  1XNQ K;  1M1K O;  3RTV A;  4FXD A;  2QEX N;  1S1U A;  1C1A A;  1WAJ A;  2NRH A;  3PX0 A;  5EX5 A;  5D3G A;  4NO7 A;  4ELV A;  1NGF A;  2PBD A;  4BQZ A;  1S6P A;  4CJQ A;  5GAD P;  4ISF A;  3K57 A;  4FWP A;  3THV A;  4LSL A;  4IG0 A;  3CIP A;  3ZX3 A;  3C6A A;  4PKG A;  3KK7 A;  2FBX A;  4HTL A;  4BG8 A;  1TKT A;  3QET A;  5BPM A;  4DHY A;  3DLG A;  2HHT A;  4FJL A;  2B6A A;  1OKJ A;  3CJA A;  4FLY A;  3WXJ A;  3NHG A;  1JCF A;  4C8K A;  4B1U B;  3FZF A;  3VQ8 A;  3HOS A;  1NGH A;  4M3Y A;  2CGJ A;  3TAB A;  3SMP A;  1HR0 K;  1GLC G;  2P9K B;  2KFN A;  3O4Q A;  4JI4 K;  4DQ8 A;  1T05 A;  3R1X A;  3GBT A;  2VCP A;  5DK5 A;  3LAK A;  2ZJP L;  3CCM N;  3H3N O;  4BR9 A;  1A5X A;  2O8D A;  4GV3 A;  4OJR A;  1JCG A;  4H4O A;  2V51 B;  2HHW A;  5I9E B;  3RSE A;  1IH7 A;  3PX4 A;  4KH6 A;  2O8B B;  2G8K A;  2I7N A;  1VQL N;  3VA3 A;  3O4N A;  2UYT A;  2YNH A;  3DI6 A;  5C24 A;  4KB0 A;  3DJC A;  1NJX A;  4FWQ A;  2F9W A;  5FRN A;  1TK8 A;  2YI1 A;  4JKD A;  4LFB K;  1KC8 O;  4DTR A;  2IS3 A;  2YHA A;  4CZM A;  3ZT0 A;  4M3X A;  2HVI A;  1VQ6 N;  4DWI A;  3GL1 A;  3VGM A;  4WCE L;  4HUG A;  4BWJ A;  4J2E A;  1JJ2 M;  2IGI A;  1CZB A;  3LP0 A;  3J8A A;  1V4T A;  1VQ8 N;  3LM9 A;  3NF7 A;  1ZBS A;  1FKP A;  3SPY A;  3M1F A;  3AO5 A;  4A59 A;  2VG7 A;  3N4P A;  3HO1 A;  4Y0W A;  4BR2 A;  1U04 A;  1KTQ A;  3OYB A;  4DSF A;  3I55 N;  3EE9 A;  3KWG A;  3THW A;  1HKB A;  3TSQ A;  4CZL A;  1NOZ A;  4BE2 A;  4JD2 A;  4B3R K;  4KH5 A;  4O4G A;  5LL6 Z;  3O8M A;  5HRS A;  2D4W A;  4OVL A;  4QS8 A;  3LP3 A;  4E3S A;  4E19 A;  3C6U A;  4A5B A;  4TSX A;  5C0Y A;  1KCF A;  3T1H K;  4MDB A;  2GUP A;  3CM5 A;  4FWN A;  2VYP A;  1NK0 A;  4DV2 K;  1TAQ A;  1KD1 O;  4NXN K;  1XUP O;  4BRE A;  1N34 K;  1LW0 A;  2RE2 A;  2FBV A;  2AJQ A;  3EKS A;  3WXM B;  4CED A;  2ZE2 A;  4C1N K;  2G8W A;  2FBT A;  3PUF A;  4W5N A;  3AVN A;  1WLJ A;  3ATU A;  2VWJ A;  2QWL A;  3U6F A;  3NGZ A;  1IKV A;  2IC3 A;  5BRH A;  1TUU A;  4IOA L;  3RMB A;  1LV5 A;  3PO5 A;  3EZ5 A;  1KVA A;  4M7Y A;  4CGI A;  3DLL L;  5AQZ A;  1X3N A;  4FLV A;  4GKJ K;  4IFE A;  4F4K A;  1VQM N;  2VQF K;  2E2N A;  3K2P A;  4HCB A;  1NWK A;  4CK3 A;  1X9M A;  4BR4 A;  3ENO A;  4NLB A;  1RCH A;  1EWQ A;  3HZ6 A;  2BDP A;  3MCA B;  3SYZ A;  3HPH A;  2HBM A;  4DR1 K;  2ITG A;  3IRX A;  3KKS A;  2NRR A;  2GV9 A;  1RBR A;  1FJG K;  1ILY A;  4DR3 K;  1RBU A;  5F0X A;  3TAN A;  3U8X A;  4LF8 K;  3QBX A;  4CEZ A;  2O8E A;  3T69 A;  4BRG A;  3EN9 A;  1UAX A;  3FLC O;  3L2W A;  3TAF A;  3KVG A;  4DTO A;  3SAH A;  3CCU N;  5AQG A;  1JLQ A;  4A2B A;  4RW4 A;  4K8Z A;  3QEP A;  4DTN A;  3MXJ A;  4GMJ B;  1WOQ A;  2Q2R A;  4AHU A;  1W97 L;  4CJT A;  3O9R A;  1VSH A;  1RT3 A;  3D2F B;  5ADX A;  3A5L C;  3BUZ B;  4CE9 A;  2PAV A;  4CES A;  3MX5 A;  4BC5 A;  4FWK A;  2ZJR L;  5H1S Q;  3CQY A;  2P9L B;  2ZD1 A;  2XRI A;  4RCH A;  3M3Z A;  5ELZ A;  3ZT3 A;  4DQP A;  2VGN A;  2YHX A;  1XMO K;  1TAU A;  4DQR A;  4BY9 C;  1KVB A;  4DR2 K;  4O0I A;  4DU4 A;  5BR9 A;  1D9F A;  4KHQ A;  2P9U A;  5BN9 A;  5B8H A;  5KRS A;  3G25 A;  1Z05 A;  3VQ5 A;  4OPA A;  4HHT A;  3CQX A;  4W5O A;  1G15 A;  4YOU A;  3OYJ A;  3F9K A;  3P4I A;  5HP1 A;  2CGK A;  4IO8 A;  4CGJ A;  3OYK A;  4BE0 A;  1NJZ A;  2Z1I A;  1BIU A;  4E1M A;  3NVK A;  1NK9 A;  2Z1H A;  3NF6 A;  4M3Z A;  4DMN A;  3Q7C A;  1UWB A;  4DV3 K;  3OYE A;  3VGL A;  5A2Q O;  2QK9 A;  3KD5 E;  1RT5 A;  3DRS A;  5ADX H;  3LPU A;  3OW2 M;  3L2R A;  4CZJ A;  2HHV A;  3OS0 A;  3UIQ A;  2JLE A;  3RMC A;  1J5E K;  1N33 K;  3ZCM A;  3VEW A;  4BAC A;  4DTM A;  4M3T A;  1XQS C;  3NMU A;  2HNZ A;  5GAE P;  3BDP A;  1VQ9 N;  3I56 N;  2A40 A;  3AGK A;  1U48 A;  4N76 A;  4JK7 A;  4PL8 A;  3CHW A;  1HQU A;  1W2B M;  4H5T A;  3AVB A;  4CIF A;  1J5O A;  4EHU A;  2P9K A;  1U6Z A;  1S1X A;  4A2A A;  4H0Y B;  3QIP A;  2P9I A;  2IVN A;  3CFR A;  5BRD A;  4JKC A;  1RTH A;  5FPD A;  3OYH A;  2HND A;  5C12 A;  3IG1 A;  4CJS A;  3O4W A;  1S6Q A;  1BA1 A;  2EWS A;  4JHD A;  4DG1 A;  1BUP A;  2ITM A;  4I9L A;  3TU5 A;  1ZC6 A;  1Q9Y A;  2O8B A;  2B5J A;  3ZYY X;  1QZ6 A;  3ID8 A;  3AVC A;  2I5J A;  3LWM A;  4Z0U A;  3NGI A;  3WUH A;  4DTJ A;  3IAY A;  1K6Y A;  1QE1 A;  2VWK A;  5FRO A;  4CI6 A;  3L8B A;  5AQK A; 
#chains in the Genus database with same CATH homology
 4NXM K;  4DR2 K;  1HR0 K;  4X66 K;  4CVN E;  5BR8 K;  4DUZ K;  4JI4 K;  4JI7 K;  4LF6 K;  3J81 O;  4X64 K;  4LF4 K;  1XMQ K;  3J80 O;  4V19 S;  4LFC K;  1HNX K;  4JI3 K;  3OTO K;  4DR5 K;  2UUB K;  4JYA K;  5LMN K;  2UUC K;  4KHP K;  4GKJ K;  4JI0 K;  3J7Y P;  4OX9 K;  2VQF K;  4JV5 K;  4DV3 K;  4DR4 K;  5A2Q O;  4B3M K;  1IBL K;  2UUA K;  5FLX O;  4JI1 K;  4X62 K;  4JI5 K;  4DR1 K;  1HNZ K;  4LFB K;  4B3S K;  5AJ3 K;  1N33 K;  4DUY K;  1J5E K;  2E5L K;  2UXC K;  4DR6 K;  1FJG K;  4DR3 K;  4LF9 K;  3T1Y K;  1HNW K;  4YY3 K;  4LF8 K;  4B3T K;  5LMU K;  1IBM K;  2UXB K;  2ZM6 K;  4CW7 B;  1XNR K;  1IBK K;  4JI2 K;  4LF7 K;  4X65 K;  1N36 K;  1I94 K;  5IWA K;  4LF5 K;  4YHH K;  4DR7 K;  4DV5 K;  1XNQ K;  2VQE K;  1N32 K;  4JI6 K;  4B3R K;  4JI8 K;  5LL6 Z;  4DV0 K;  2UXD K;  2HHH K;  3JAM O;  4LFA K;  4DV4 K;  2F4V K;  5IT9 O;  2UU9 K;  3T1H K;  4DV2 K;  4NXN K;  4AQY K;  1N34 K;  3J7A P;  4DV1 K;  4K0K K;  1XMO K;  4DV6 K;  4DV7 K;  4GKK K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...