4CJVA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
153
structure length
149
Chain Sequence
SSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 55
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cjvA00
3NGZA 5KRSA 4I7FA 3VQPA 4DF4A 3S3OA 4CEQA 4M3YA 1BL3A 4OJRA 4FJ5A 3QETA 1RTJA 3DOKA 5JS1A 2OZSA 3CG7A 2IDOA 2YKMA 1U49A 3RWUA 4NYFA 1JKHA 4FLUA 3V9ZA 3VQ7A 3QERA 1KLMA 5HP1A 3TARA 2QK9A 4KREA 1UOCA 2WOMA 3D0PA 1KRPA 1VSKA 3AO2A 4IFYA 3HVRA 1ZBIA 3E01A 3NH0A 4DFPA 4ELTA 3QLHA 3AVMA 4IDKA 5DK5A 1U47A 3KD5E 1T8EA 3MEDA 2GUIA 3I0SA 4IFVA 3LWLA 4BDPA 3TR8A 1TK5A 3KLEA 1U45A 4FK0A 1TK8A 2XHBA 3KLGA 1JXBA 3SYZA 4AHRA 4M3WA 2HVHA 1S1TA 4C8MA 4NCAA 4KI4A 4KI6A 3HPGA 4CJ3A 4DTRA 1WSGA 3U6FA 4B08A 3RR7A 2B4JA 2ZD1A 3AA2A 3AO5A 2DFFA 5FDLA 3OS0A 3AA3A 4DQQA 1VK0A 3IRXA 4W5OA 2R7YA 4N47A 3SZ2A 3QIPA 4DS4A 2HNDA 5DMRA 4CEBA 1S6QA 4CERA 2XO7A 3SQ4A 3LPTA 4J2EA 1WSFA 3TWHA 1D9DA 2QKKA 2KW4A 3MECA 3TAMA 1DTTA 3KKSA 3VN5A 3OYIA 3TAEA 3AVLA 3TABA 1HYVA 1IKVA 2FBYA 4DTXA 4O0IA 3NGYA 1WSIA 3L2VA 4DTSA 2D0CA 4DSLA 3LZIA 1DTQA 4B8CA 4CEAA 3K5NA 3CFOA 3OVNA 3S3NA 2I5JA 1TAQA 1JXEA 1QS4A 4CEEA 3ZSRA 4KPYA 4M42A 1A5VA 3ALYA 1F21A 3IAYA 4DSJA 2YNFA 3DLGA 3DLEA 4AHVA 3VQQA 5SWMA 3HPOA 4E1MA 1ITGA 2EHGA 4CEDA 4DU3A 4OGCA 1S1WA 2OPPA 3VQ8A 3V9UA 3U3GA 4DTOA 4FJNA 3C6UA 3VQEA 4DQRA 1TAUA 1RT5A 2IOCA 1RT7A 1YTAA 3OS2A 4CJUA 3V4IA 1QSLA 3NCIA 4E7HA 1RDAA 3OYCA 2VG5A 1CZ9A 1RDDA 3VQ6A 3VQ5A 2Y1IA 2B6AA 2EX3A 1NKEA 3K5OA 2XY6A 4FJJA 3K5MA 2JGUA 1JLBA 1WSEA 2RN2A 1SKSA 1RTDA 4DSEA 2VG7A 4KHWA 3A2FA 4ICLA 3V1OA 4CJQA 4LH5A 4N76A 3OYMA 1VSJA 4E7LA 2O4GA 3T1AA 2P51A 5T7BA 4Z4FA 1SKRA 4CGGA 5C25A 3DLBA 4FLWA 1RBSA 1RBUA 1HJRA 3DOLA 5KI6A 1R0AA 1QSSA 1HYZA 1VRTA 5HRSA 3G0ZA 1HQEA 3M8SA 1L3SA 1EKEA 4Z4GA 4I9LA 3SCXA 4CK2A 3LP0A 3V9WA 3OJUA 4YFUA 3QEWA 2HHQA 1VSMA 3P83D 5C42A 1QHTA 1WSJA 4CHYA 4K8XA 3PY8A 4CGJA 1GOCA 4KKOA 4CGFA 3RMAA 3ZSZA 3M8PA 3L2WA 4B9NA 1EX4A 4I9QA 3KK3A 4FJMA 3DRSA 1EXQA 1S9EA 1KVAA 1YT3A 2HNYA 3VQAA 3L2UA 3PV8A 1QSYA 3HK2A 1IO2A 3M8RA 3L2RA 2W42A 1IKYA 1S5JA 1VRUA 4JRPA 3OY9A 4OPJA 3SI6A 4FJLA 4KTWA 4LSNA 3K58A 1NJXA 4B9UA 3VA0A 1C0UA 1YVUA 1C1BA 3K59A 1SL1A 2HHTA 1BQMA 1NK5A 4W5NA 1LAVA 1KVCA 2ZQBA 1A5XA 3VA3A 4RW9A 4F2SA 1RNHA 2Z1JA 4FVMA 3TAPA 4C8OA 1X9WA 4KRFA 3KJVA 4QAGA 4O5BA 1RCHA 3OS1A 4B8AB 1W9HA 4DTJA 3S9HA 4B9LA 1X9MA 1HRHA 4CK3A 3KD1E 3PX6A 3UIQA 4FLYA 1FKOA 3LANA 3SNNA 2YNIA 1WNSA 1T05A 3HP6A 4M3XA 3V81A 3QNOA 4DFJA 3ZT2A 4AHTA 3CYMA 4BWJA 2B5JA 1LW2A 4DTPA 2XRIA 1X1PA 5CY4A 4DU4A 3AVKA 4KFBA 4F3OA 2HW3A 4FJXA 3THVA 2IAJA 4BE0A 3OYJA 3QIOA 4UQGA 3SV4A 4EZ6A 1ZBHA 1KCFA 1RT4A 2ETJA 2VG6A 3FFIA 1ZBUA 2NUBA 3ASMA 4AH9A 3TAGA 1U4BA 4DQIA 4ZTJA 1D5AA 1KVBA 3SUOA 2PYJA 4J2BA 1KLNA 1RBTA 1ZBFA 3DRPA 1A5WA 1JLGA 1TGOA 3L3UA 4CF8A 5CYQA 3RTVA 2QKBA 4OLAA 2KZZA 4QOZB 1VSHA 4KTQA 3NAEA 1CXQA 4HHTA 1QTMA 4ID1A 1XI1A 1LAWA 3SUNA 1NK6A 2YHAA 4CF0A 4OKEA 1UA1A 2G8IA 4JLHA 2D0AA 3TAQA 3ISNC 1XWLA 3TI0A 2OZMA 4BACA 3OYDA 4Z4HA 1K6YA 1I3AA 3RMCA 5I42A 1KSPA 4F4KA 1KFSA 1LW0A 1CXUA 3NDKA 4WE1A 1SV5A 4JRQA 4M41A 1BCMA 1VSIA 4CJPA 2G8KA 1Y97A 4KHNA 2KFZA 2D5RA 4IBNA 3NE6A 3DYAA 3IG1A 3T3FA 1HPZA 1TKDA 4NCGA 5CYMA 1GOAA 3VQCA 1RDCA 1SKWA 4FK4A 5FRMA 3NF9A 1J9AA 4B3OA 1BIZA 4LSLA 4CJTA 3KK2A 1L5UA 3RR8A 4RW6A 3DM2A 5CZ1A 2Q3SA 1NK9A 3OYKA 2HHXA 4H4MA 2O4IA 4M3ZA 4FLVA 3ITHA 3SUPA 3KKRA 4M3RA 3AVCA 1RT3A 3NBPA 4DTUA 2G8UA 4Z4CA 1NJZA 2A1RA 4B9MA 1UAXA 1RT6A 3TANA 3ZT4A 4AILC 1J54A 1RBVA 4Q0BA 3B6OA 3EZ5A 2YNHA 3P5JA 3LP2A 3HT3A 4QCLA 1HMVA 5J2MA 1IKXA 1L3UA 4DSIA 4CEZA 3KLHA 1NK8A 1RT2A 3ZCMA 2ATQA 1RILA 3CFRA 4RW4A 1JLAA 1VSDA 3PX4A 1XHXA 4NCBA 3PO5A 4FYDA 1KFDA 3DLRA 1YTUA 3CM6A 3NFAA 3CM5A 2X6NA 4CJ4A 3SUQA 3LAKA 4I2QA 2WONA 3L3VA 4DLEA 1ZYQA 1HNIA 1Z26A 3AVHA 1FXXA 4CFAA 3NGIA 2DTUA 4KB1A 4MFBA 1U04A 4IG0A 3K57A 2G8FA 1TVRA 2VWKA 5C24A 1TK0A 4DTNA 1FK9A 4KTZA 3AVBA 4Y1CA 3HVTA 3SQ1A 4CF1A 3O3GA 4Y1DA 2RF2A 4NYNA 3LPUA 1Q8IA 3AV9A 2E4LA 4FCYA 1BIUA 4CESA 1WSHA 3MEGA 2G8HA 3VQDA 4E1NA 2RPIA 4FW1A 4CIGA 3SQ2A 3K2PA 4O44A 4CF2A 3K5LA 3RMDA 1C0MA 1D8YA 3CFPA 3RRGA 4I2PA 3OYLA 3QINA 3NF7A 2G8WA 3U3YA 4DFMA 1QE1A 4B9VA 4CJVA 1ASUA 4C8LA 3EYZA 4CFDA 5KGWA 1G15A 1ZBLA 4DSKA 4Z4EA 3O3HA 1BI4A 4PUOA 4BDYA 2RKIA 4FM2A 4FZXC 1S1UA 4FJIA 1C1AA 4Q5VA 2VWJA 4PA1A 4CJRA 3V6DA 4YNQA 1Q9XA 3JYTA 3AVGA 4RW7A 3PO4A 4E7JA 3DRRA 4CEOA 1REVA 1S1VA 1TL3A 5JS2A 5HRPA 3ZT3A 3TAFA 5HROA 4R5PA 2BE2A 4CHPA 1RT1A 2A1SA 3O3FA 1VSFA 3QNNA 2OA8A 1TV6A 1NK4A 4Z0UA 3OYFA 4M45A 4KO0A 2FBXA 3NF8A 2QXFA 3ZSYA 3C95A 4EZ9A 5KTQA 4B9TA 3LP3A 1S9GA 4DQPA 5J2QA 1SUQA 3NHGA 4FZYA 1UWBA 4E7IA 4GVMA 4CFCA 4HTUA 4CGIA 3OYEA 1KTQA 4O0JA 4HCCA 3V1RA 4DTMA 1BCOA 4FW2A 3ZSQA 4FJHA 5HLFA 4CJLA 4EP5A 1Z25A 4KV8A 3LZJA 4RW8A 3C94A 4H8KA 3LWMA 4IKFA 1Q9YA 1CLQA 5D3GA 2DFEA 4BDZA 1LWEA 1I39A 4DQSA 1LV5A 3B6PA 3OYBA 1LWCA 3LDSA 4N56A 3OYGA 2DY4A 5HRNA 4DLGA 4N41A 2FC0A 4CGDA 3WNGA 4HUGA 3AVAA 2AJQA 4BE1A 4F2RA 1C0TA 2HNZA 3AVJA 2JLEA 3F73A 4FJ8A 3SPZA 1S6PA 2PZSA 3LP1A 3HP9A 4DF8A 4CHNA 2IGIA 3MEEA 1NK7A 1RTHA 2Y1JA 3I8DA 3I0RA 3CQ8A 3P1GA 4CE9A 1GOBA 4CHZA 4OPKA 4PWDA 4KHYA 1EP4A 1NJWA 3PX0A 4FJKA 3QEVA 2Z1IA 2HHUA 4CHOA 3NH1A 2ITGA 3SJJA 4J2AA 1BGXT 3F9KA 4DWIA 4M3UA 1BI4B 4KB0A 1MU2A 4HCBA 4F3TA 2YKNA 2HHSA 4DSFA 4DU1A 3SV3A 3RMBA 3VQBA 4XIUA 4OKKA 4CJEA 3SPYA 4H4OA 3KLIA 2BDPA 4FJ9A 4FM0A 3HL8A 2PY5A 1N5YA 2IS3A 2KZMA 3AVFA 1B92A 4W5RA 3HM9A 1N6QA 1O1WA 4CJKA 1WAJA 2HB5A 2ZE2A 3C6TA 4CGHA 2FBVA 3QEIA 1U48A 5K14A 3S3MA 1JLFA 1VSLA 4L8RB 4RG8A 4FXDA 4OKJA 1UA0A 3AA4A 3VQ4A 2E6LA 1BISA 1QQCA 5CZ2A 4CJFA 5J1EA 4IG3A 4FLZA 4FM1A 3RRHA 3QESA 4DFKA 3VQ9A 1L3TA 1FKPA 4DG1A 4LY7A 3AO3A 3O4QA 4KAZA 3NF6A 4BWMA 4KHSA 4MQ3A 2P5GA 2HHVA 1X9SA 2F8TA 2E6MA 3ZT0A 2P5OA 4HVJA 1C6VA 4E89A 2YV0X 4KHUA 1NKBA 1IH7A 1B9FA 1TKZA 3MAQA 2D0BA 1T7PA 3DMJA 1TKXA 3KIOA 3DLKA 3HSTB 4ELUA 1EETA 1S1XA 3D45A 1C1CA 5I3UA 4DMNA 4PY5A 4FLTA 2XY7A 1TKTA 4Z4IA 3HO1A 4CFBA 2XY5A 3M8QA 1XHZA 2IC3A 3AO1A 2DFHA 3HJFA 1T03A 4GMJB 2HVIA 1VSEA 1RDBA 3ZSVA 1DLOA 1JLCA 3EY1A 3G10A 5EU7A 4CJSA 4F8RA 4ZTFA 2OPRA 3AVIA 1ASVA 1TL1A 1WAFA 1NOZA 1HYSA 3QEPA 4KHQA 3O4NA 1NJYA 2BANA 3ZSOA 2X78A 3MXMA 1BHLA 1IG9A 5E41A 1RBRA 2FBTA 3ZSWA 3T19A 4C8KA 2XY8A 3BGRA 2HHWA 4O55A 2GV9A 2BGGA 2X6SA 3ZSXA 3QO9A 4ZHRA 4W5QA 2YNGA 4AHUA 4JS4A 4OLBA 5KGXA 2F96A 3ZT1A 5J2NA 1D9FA 4ELVA 4FZZA 2KTQA 4AHSA 2KQ2A 3KLFA 3WNHA 4FLXA 3KK1A 2Z1HA 1B9DA 3PUFA 4HUEA 4DS5A 4CIFA 3MXJA 4FK2A 3H08A 4LD0A 3OJSA 1SL0A 4M3TA 4CK1A 4PQUA 2LSNA 2P1JA 5FRNA 3LAMA 4CF9A 2OYQA 3NH2A 4O4GA 1JLQA 3V1QA 1NOYA 1XC9A 5FROA 1W0HA 3HXMA 4LH4A 4GW6A 2PYLA 4E7KA 4FJGA 4N5SA 2F8SA 4CCHA 3HPHA 4CJWA 4HUFA 4E0DA 5SZTA 1L3VA 5HBMA 4OVLA 4C8NA 2OPQA 4CJ5A 3QEXA 2KFNA 4CECA 3ULDA 3L2QA 4E3SA 3OYHA 1BQNA 1WN7A 4W5TA 2X74A 1WLJA 4BE2A 4CIEA 3SQ0A 2G8VA 3WNEA 2YHBA 2OPSA 3V9XA 1NK0A 4CHQA 4G1QA 5KRTA 1HNVA 3AVNA 1IKWA 4OGEA 3OYNA 4JS5A 1SL2A 1LWFA 3DI6A 3DLHA 1JL2A 3JSMA 1ASWA 1JL1A 4AHCA 3HYFA 1JLEA 1J5OA 3KTQA 4K8ZA 3V9SA 3LALA 1NKCA 3OYAA 4FJ7A 2HMIA 1RTIA 3L8BA 3BDPA 4CEFA 4TSXA 1CZBA 3MXIA 4J2DA 4ID5A 5HRRA 2Z1GA 2GBZA 4E19A 1HQUA 5J2PA 4EP4A 3AA5X 3AO4A 1J53A 3IS9A 3WNFA 4B9SA
chains in the Genus database with same CATH superfamily
4H0XB 4DF4A 3S3OA 1JCFA 5AQTA 3CG7A 2YKMA 1U49A 3C6AA 5AQHA 2DPNA 4FLUA 1YITN 4DKWA 3D0PA 1KRPA 4IFYA 1ZBIA 3E01A 5AQPA 3NH0A 4PL7A 4DV5K 3KD5E 1T8EA 2GUIA 3I0SA 2OTJN 1Q86O 1TK5A 1MWKA 1YXQA 3KLGA 4M3WA 5AQVA 1S1TA 4C8MA 3U8XA 4NCAA 4KI4A 1XQSC 4B08A 2W6KA 4A62A 3AGKA 3OS0A 3AA3A 3G71N 1VK0A 2JWLA 3THYB 3QIPA 3O9UA 2NLXA 1Z6RA 1Y64A 2FSJA 4DS4A 1H1VA 1V4SA 4IFEA 1D9DA 2P9KA 4IEEA 4JKHA 3KZBA 3VN5A 3EEQA 2P9NA 3TAEA 3TABA 1IBLK 4DTXA 2E5LK 1ATRA 3A8YA 5AZJB 3LM2A 3K9JA 4DQ8A 3H6EA 4B8CA 1VQON 1JXEA 1QS4A 1A5VA 3IAYA 3VQQA 4KHPK 1TYQA 3QB0A 1NBWA 4OGCA 1S1WA 3U3GA 4DTOA 4FJNA 1TAUA 1RT5A 2IOCA 1YTAA 4CJUA 1QSLA 4E7HA 1RDAA 2VG5A 3VQ6A 5TKWA 1KXPA 1NKEA 4CZGA 3K5MA 5C10A 1WSEA 4CZHA 4KHWA 3A2FA 4LH5A 4N76A 3OYMA 4IOXA 4Z4FA 5GIOA 1SKRA 4BQLA 3O6WA 3DOLA 1HJRA 5KQ8A 1QSSA 5CR4A 1VAZA 1EKEA 5AQGA 4FL9A 1GLCG 4CK2A 3ZETB 2HHQA 1HNWK 4CGJA 3RMAA 2YI1A 4B9NA 3F9MA 3IKMA 3BF3A 4FJMA 3DRSA 2NRWA 1YUWA 1EXQA 1KVAA 1YT3A 5LMUK 3THYA 3M8RA 3L2RA 3HK2A 1VRUA 4B9UA 2A3ZA 2HHTA 3VEYA 3C65A 4CD1A 3I33A 1NK5A 1LAVA 4FWOA 4F2SA 3A5MC 1X9WA 1KQSM 4DV2K 4A57A 3OS1A 3MN5A 3S9HA 3UKUB 4H5WA 1HRHA 1QVGM 3PX6A 3UIQA 3SNNA 3LANA 4BRAA 3CC4N 1IG8A 4IO9L 3V81A 3ZT2A 4DTPA 1T05A 1RTDA 2B5JA 4NXNK 3QIOA 2VG6A 3MX2A 1U4BA 2NUBA 3TAGA 3RSEB 3BEXA 4ZTJA 2A5XA 3MCAB 3SUOA 1KLNA 1RBTA 1A5WA 1YJ9N 2KZZA 3PSFA 4QOZB 1VSHA 3NAEA 4LC9B 4H0TB 3SUNA 1NK6A 2YHAA 4KH4A 3VETA 5AQIA 2D0AA 4JKGA 4YOUA 4YORA 2OZMA 4BACA 3OYDA 4Z4HA 1KD1O 1KSPA 4F4KA 3ZLJA 1LW0A 1CXUA 2O8FA 4WE1A 4JRQA 4M41A 2G8KA 2P9PB 4CJPA 4KHNA 1Y97A 3CCUN 3WT0A 3VGKA 1IBKK 4NCGA 3VQCA 1Q82O 5KPZA 3NF9A 1EO1A 3TTCA 4BRPA 2HHXA 4FLVA 3VEZA 3O9TA 1VQ9N 4FPBA 3TANA 2A6AA 1XUPO 3DXMA 3GL1A 3EZ5A 3KWGA 3WEEA 3LP2A 3N4QA 5J2MA 1IKXA 4YDUA 2GWJA 1NK8A 3HOSA 1RILA 3GOIA 4RW4A 4X62K 3PX4A 3MN6A 4NCBA 3CM6A 3CM5A 2X6NA 3LAKA 1SAZA 2WONA 4DLEA 3K9KA 3THWA 4DR7K 3K57A 1TVRA 2VWKA 1TK0A 4Y1DA 4E1JA 4NYNA 1V4TA 1Q8IA 4JKFA 2E4LA 5JLHA 1BIUA 2A42A 3QDKA 5AQWA 4FW1A 3K2PA 1I94K 3K5LA 3RMDA 4CZIA 5M1KA 1D8YA 3M6GA 3MK6A 2O8DA 5M1PA 2G8WA 3U3YA 1ZC6A 5AQOA 4DFMA 5BR9A 5BR8K 4JKBA 3EYZA 4CFDA 1T3VA 3CF5L 2WFBA 3O3HA 1HX1A 4FZXC 1NGHA 1C1AA 4YNQA 2VYPA 4E7JA 4CEOA 3MN9A 3LL3A 3TAFA 5HROA 3H46O 3O3FA 3QNNA 2GX9A 3R1XA 2RE2A 4Z0UA 3J81O 3SK3A 3ZEUA 2FBXA 5I9EB 1MWMA 3ZSYA 4EZ9A 5AQRA 4HTLA 5J2QA 1SUQA 4FZYA 1OH6A 4FSVA 2P9SA 4BRDA 4O0JA 4JKDA 3V1RA 5F2RA 4FW2A 4JD2A 4FJHA 1N32K 4GY2B 4RW8A 3C94A 4H8KA 5M1QA 1CLQA 3VTIA 4ISGA 1LV5A 1LWCA 4BRGA 3KK7A 3WNGA 3AVAA 1NGCA 1TUUA 3Q7BA 5GINA 1YHQN 1S6PA 4JKEA 5BN8A 3TSQA 4CHNA 2IGIA 3MEEA 4CJ7A 3I0RA 3P1GA 4CE9A 1NJWA 3PX0A 5GAHP 4NO7A 1GLBG 4CHOA 1BGXT 3F9KA 4KH6A 1BI4B 1FW6A 4BROA 1K8KB 4DU1A 4BR0A 3VQBA 4XIUA 1N5YA 2O8EA 2KZMA 4BREA 3CCJN 1N6QA 5CE3A 2ZE2A 2FBVA 4BRIA 1JLFA 2V7ZA 1UA0A 5F0XA 3VQ4A 2E6LA 1QQCA 1YF5L 2PAVA 4IG3A 4LFCK 5AR0A 4DG1A 3AO3A 2E8AA 3TSUA 4B3SK 3NF6A 1X9SA 5JVGL 2P5OA 4HVJA 1C6VA 3M5RA 4KHUA 2ASOA 2YV0X 1NKBA 1IH7A 1GLEG 1NGAA 3MAQA 1VQMN 3SMPA 5I3UA 1JJ2M 4DMNA 5GAGP 1DKGD 1TKTA 1N8RO 4FO0A 5AQZA 2QWRA 3WQUA 2IC3A 3AO1A 1VSEA 1RDBA 5EU7A 3QFPA 4ZTFA 5MLCQ 1ASVA 4AF1A 1HKBA 3VOVA 1GLAG 3JS6A 3ZSWA 4ILJA 1MDUB 4C8KA 2XY8A 3BGRA 2UXBK 4O55A 2HHWA 1JCEA 4W5QA 4AHUA 5KGXA 4B3MK 3ZT1A 4ELVA 3A5LC 2KQ2A 1NU0A 3MN7A 1YIJN 4LD0A 3OJSA 4FK2A 1SL0A 4PQUA 4ISFA 2LSNA 2OYQA 3TPQA 1JLQA 4BG8A 1NOYA 2NRVA 4GW6A 4CJWA 5AFUH 1VQKN 3E1YA 5C2FA 4BE2A 2QWPA 2G8VA 3WNEA 2OPSA 4G1QA 3CI5A 1HNVA 1IKWA 3OYNA 4YOVA 3E66A 4AHCA 3KTQA 3ZYYX 3OYAA 1NM1A 1D4XA 2HMIA 3L8BA 4WQ5A 4TSXA 4CZJA 2V51B 4DV3K 4ID5A 2GBZA 2QA4N 4OO1J 5E84A 4PKGA 1E4FT 1J53A 4YOWA 4JS4A 3VF2A 3T1HK 4B9SA 4F9OA 3CMEN 4I7FA 2QTDA 3VQPA 5AQJA 1X3MA 4CEQA 3ENOA 4OJRA 3DXKA 4FJ5A 4H0PA 1RTJA 5JS1A 4AM7A 4O5FA 2IDOA 3RWUA 4NYFA 3V9ZA 1KLMA 4BC4A 2QK9A 1BA1A 4FOEA 2BH1A 1VQNN 1O13A 1DT9A 1VSKA 5JMVA 4DFPA 4JHDA 2PBDA 1J6ZA 2I7PA 3QLHA 5DK5A 4IDKA 1U47A 3LWLA 3TR8A 3KLEA 4FK0A 1TK8A 2E1ZA 4AHRA 2HVHA 2CH6A 4CBUA 3HPGA 4CJ3A 3L0QA 4GKJK 2DFFA 3H1VX 4LF9K 4N47A 3SZ2A 1NMDA 5C15A 2VGMA 2HNDA 4JI4K 4CERA 3E9OA 3SQ4A 4C23A 3MECA 2HBMA 4XH1A 2UXDK 3OYIA 2BTFA 3AVLA 1IKVA 1G99A 4CZLA 4FWPA 4BRCA 2UUCK 4JI0K 5DM7L 4JI3K 3S3NA 3OVNA 2VQEK 4KPYA 3MDQA 2ITMA 4DSJA 3DLGA 3HPOA 4GV6A 4E1MA 4PKHA 1ITGA 1ATSA 2EHGA 4CEDA 4DU3A 2OPPA 4A5AA 3VQEA 3OS2A 3V4IA 1RT7A 3H1QA 3NCIA 1W2BM 3OYCA 4JK9A 4BRKA 2B6AA 4U67L 4FJJA 2XY6A 1QQOA 2Q2RA 4DHYA 2UXCK 2P9LA 3TU5A 1BDGA 4ICLA 4CW7B 3ATUA 1HNXK 2O4GA 3T7ZA 4YOYA 5C25A 3DLBA 4FWLA 1RBUA 1R0AA 5KI6A 1OKJA 1HYZA 1HQEA 3CJ9A 2Q1NA 3LP0A 3H3NO 4YHHK 3V9WA 1VSMA 3P83D 4CHYA 4K8XA 1WSJA 1YJWN 4JI7K 1XNRK 3PY8A 3M8PA 1MA9B 5M1FA 3SAGA 3L2WA 2P9KB 3R3LA 2P9NB 3RVCA 1S9EA 1QSYA 1HUXA 5HL7L 2A41A 2V7YA 3CCVN 1S5JA 4FJLA 4OPJA 4FWRA 1E4GT 4LSNA 1C0UA 1YVUA 4QS7A 3G6EN 1BQMA 2YJFA 2ZQBA 3CJ1A 3FZMA 1N36K 1XMQK 4C8OA 2AP1A 4KRFA 1TYQB 3KJVA 2NZTA 4RTFD 3THXA 1W9HA 1FKOA 2O8CA 4M3XA 3I55N 2F9WA 4AHTA 1X1PA 4DU4A 1VQ5N 4K41A 2IAJA 4BE0A 4EZ6A 3MX5A 1ZBHA 1NK0A 4DQIA 3ASMA 1D5AA 5FPMA 4J2BA 4CF8A 1TGOA 1W7AA 2QKBA 1RDUA 4KTQA 1CXQA 4DUYK 1WBBA 1UA1A 3TAQA 3CCEN 1EWQA 3ISNC 1RDWX 1K6YA 1I3AA 4O8UA 5I42A 3HI0A 2FSNA 1VSIA 2KFZA 2D5RA 3NE6A 3DYAA 3U9ZA 3BZCA 2W40A 3EO3A 4B3OA 1RDCA 4LSLA 3RR8A 4RW6A 5CZ1A 3BY5A 1NK9A 4H4MA 2O4IA 2BUPA 2FSKA 4H5TA 3KKRA 1NG9A 2IVOA 5FLXO 1RT3A 3NBPA 4DTUA 2GUPA 3J8AA 2GWKA 4AILC 1J54A 1RBVA 2QW9A 4DSIA 1RT2A 1VSDA 1XHXA 3ULEA 3PO5A 1KFDA 3DLRA 1R59O 1YTUA 3SUQA 4I2QA 1ZYQA 1HNIA 1Z26A 3QICA 4I6MA 1N33K 1U2VA 4DTNA 1FK9A 4KTZA 4Y1CA 5EXWA 3W0LA 2RF2A 1IBMK 3DJCA 5TKYA 3LPUA 5GAEP 3MEGA 4JKGB 3TTDA 3SQ2A 4IXCA 4CF2A 1OVYA 3QINA 2O8FB 4BRFA 2HHHK 1QE1A 3ID6A 4CJVA 1ASUA 4C8LA 5KGWA 1G15A 1Q18A 2RKIA 4FM2A 4BR2A 4GNIA 4CJRA 4JKCA 4DR2K 3JYTA 3AVGA 3DRRA 1REVA 1TL3A 4R5PA 2BE2A 5GADP 2ZWHA 3AY9A 3IDHA 5E26A 2A1SA 3EN9A 2OA8A 5IT9O 1TV6A 1NK4A 3DXMB 3WEEB 3TSPA 2UYTA 3C95A 5KTQA 4B9TA 2NRHA 1S9GA 1T44A 5FPNA 1UWBA 4CGIA 2W6LA 3ZSQA 2YX6A 4KV8A 3LWMA 3THWB 5AQFA 1Q9YA 4BDZA 1LWEA 1I39A 2E2PA 2ZJPL 4DQSA 4H5RA 4N56A 3OYGA 5HRNA 2FC0A 4HUGA 4BE1A 4F2RA 1QZ6A 4B9QA 3AVJA 2JLEA 4FJ8A 1YI2N 1QZ5A 4PHTX 3SPZA 3LP1A 4YOXA 3EL2A 1NK7A 2O8DB 3CQXA 4OPKA 4PWDA 1EP4A 4IWVA 1WBDA 2IVNA 2QWLA 3HTVA 4M3UA 3O4WA 3A5NC 4JI6K 2QEXN 3SV3A 1GLDG 2WUSA 4CJEA 3I56N 3SPYA 2BDPA 3UE5A 3AVFA 4CGHA 2D0OA 3HSCA 3QEIA 3ZEUB 1VSLA 2QI2A 4FXDA 2VCPA 4HWIA 4XEIA 3ZX0A 3D2EA 3CC7N 3NVMA 5CZ2A 3U6FA 3RRHA 1L3TA 2P9SB 4KAZA 3O4QA 4JD2B 4MQ3A 2HHVA 2FF3B 1P8ZA 4E89A 4H03B 1T6CA 1B9FA 3NMUA 4NLCA 1Q81O 3DLKA 2I7NA 2VWBA 3ZX3A 4FLTA 2P9UA 5M1OA 2XY5A 3M8QA 1N34K 5AJ3K 3ZSVA 1DLOA 1JLCA 2OPRA 1IJJA 4FVUA 1NOZA 1HYSA 4KHQA 4BR9A 3O4NA 3QFUA 2BANA 3MXMA 3HOTA 5E41A 2FBTA 4IOCL 2CGLA 2BGGA 1NMNA 2NRRA 4BRHA 4ZHRA 2YNGA 4OLBA 3UKRA 5J2NA 1D9FA 4DUZK 2O8EB 2KTQA 4B1WB 4BR5A 2ZGYA 1B9DA 4HUEA 3FZKA 3ID8A 4DS5A 5AFUA 4IEIA 2HBKA 5ELZA 4CF9A 3H3OB 1P90A 5LY3A 2FF6A 3VGMA 4O4GA 2NRZA 4BGBA 2QWOA 2A40A 4E7KA 3WXIA 1NWKA 3QMLA 5HBMA 5BPMA 3QEXA 5BREA 4H0OA 3OYHA 1BQNA 1WN7A 4BR4A 4JS5A 3VENA 1VHXA 3AVNA 5KRTA 4J2DA 1HNZK 4K0KK 3MXIA 3O1WA 4E19A 3AA5X 3AO4A 3IS9A 3WNFA 1CZAN 5KRSA 1KAZA 5AQYA 1BL3A 4FOIA 2ZF5O 3TARA 3VQ7A 3QERA 5HP1A 4KREA 1UOCA 2D4WA 2HBJA 3HVRA 4UY8O 5EY4A 2F4VK 4ELTA 3MEDA 4LFAK 4EHUA 3DWLA 3C7NA 2XHBA 1NGEA 3HBTA 4B3RK 1YJNN 1VQ4N 2VGNA 4BG9A 3RR7A 2KLAA 3GG4A 1SS6A 3AA2A 3O5BA 5FDLA 4DQQA 3KWIA 3ENBA 4Y0WA 4CEBA 3BP8A 3LPTA 4J2EA 1WSFA 4PKIA 4BQZA 3TWHA 2QKKA 1HJOA 3TAMA 2GELA 1DTTA 1HYVA 2FBYA 4WYBA 4O0IA 3NGYA 3FFKB 5DM6L 4LF6K 3CETA 4DSLA 4C1NK 3BUZB 3K5NA 3DXKB 2I5JA 2Q97A 3ZSRA 4M7YA 1F21A 4AQYK 2YNFA 3DLEA 4AHVA 2CGJA 3CMAN 3VERA 4DQRA 4YOTA 4LF5K 5FPDA 2D0PA 2HSTA 4JHDB 4BRMA 3K5OA 3A5OC 1JLBA 4FWMA 5HOOA 1SKSA 4DSEA 3LDQA 1GLJO 1NNEA 1QQNA 3V1OA 4CJQA 4A59A 1VSJA 3C0BA 3CXCM 2Q36A 1J5EK 1SZ2A 4EHTA 1VRTA 3G0ZA 4Z4GA 3M8SA 2E2NA 2E88A 1L3SA 1M90O 4I9LA 2QWMA 3WXMB 4K25A 4YFUA 4DV7K 4U7BA 1QHTA 1GOCA 1W97L 3ZSZA 5AQSA 4I9QA 1HKCA 3KK3A 3FR0A 2HNYA 4JKAA 3VQAA 3L2UA 1Z05A 5C2DA 3K58A 3O9QA 3VA0A 1C1BA 3AARA 3LDPA 1KVCA 3L4QA 4CZFA 3VA3A 4FVMA 3P4IA 3TAPA 1ILYA 3O08A 3SBGA 4O8KA 1RCHA 4DTJA 4OPHA 1X9MA 3R8EA 4FLYA 2HBLA 2YNIA 3E9PA 1WNSA 4BRLA 3HP6A 2AA4A 3QNOA 2OZSA 3CYMA 2G8FA 1LW2A 2XRIA 1HKGA 3AVKA 4KFBA 4CZKA 2P9LB 3THVA 5LJVA 1BO5O 3SV4A 4UQGA 3D2FA 3VPZA 1ZBUA 3E9LA 2QWNA 2UUBK 1ZBFA 3RTVA 3L3UA 4JYAK 4OLAA 4IOAL 4HHTA 1QTMA 1LAWA 4X65K 4DV1K 1WB9A 4OKEA 2G8IA 1XWLA 1U6ZA 3EE8A 3ZX2A 3I8BA 1NGFA 3F2KA 1BCMA 3D6RA 4H0VB 3J7YP 3CQYA 5BRDA 3T3FA 3VEXA 1QHAA 5CYMA 4FK4A 3IMXA 1J9AA 4KH5A 1BIZA 3KK2A 1L5UA 5KPRA 3GE1A 3U4LA 5AQLA 1NLVA 3OYKA 4PL8A 4EFHA 4M3ZA 3ITHA 1WUAA 4JAXA 3THXB 3SUPA 3AVCA 5JVHL 4IJNA 2G8UA 2A1RA 2ZGZA 4DV6K 4B9MA 2O8CB 3BZKA 4R79A 3B6OA 3P5JA 2EWSA 4DB3A 1HMVA 4CEZA 3KLHA 3ZCMA 4ILHA 3CFRA 4DCHA 2O8BA 3OTOK 4FYDA 2FLOA 4CJ4A 2UU9K 2YCHA 3L3VA 3AVHA 4EAHD 4KB1A 4MFBA 1U04A 4IG0A 5C24A 4MDAA 2KHOA 2WC9A 4CF1A 1K8AO 2Q31A 4FCYA 3JAMO 3VQDA 3AAPA 2HF4A 2RPIA 5EVZA 3CFPA 3NF7A 3CPEA 5LL6Z 4B9VA 2E2OA 3P38A 1BOTO 1RFQA 2E1YA 5AQKA 4Z4EA 4PUOA 5EOYA 4WCEL 4FJIA 3AGRA 4A61A 4Q5VA 2VWJA 4DV0K 1Q9XA 1QVFM 4RW7A 3PO4A 3CC2N 2NRXA 1KAXA 1S1VA 3WXJA 3ZT3A 5FPEA 4CHPA 3J7AP 1RT1A 3OYFA 2QXFA 2YHWA 3K0SA 3NHGA 4BR7A 5AQQA 3ULEB 4MO5A 1KTQA 4HCCA 4DTMA 1BCOA 5HLFA 2E20A 1Z25A 4I6MB 4IKFA 1U2VB 4LF7K 5ADXH 4WF9L 3B6PA 3OYBA 3LDSA 3BF1A 4DLGA 4N41A 4IJAA 1C0TA 2HNZA 1Q7YO 2PZSA 1LCUA 4FPAA 1OH8A 3HP9A 3CQ8A 4KHYA 3O9RA 2ITGA 4J2AA 4Z94A 2FXUA 3ENHA 4KB0A 1MU2A 2YKNA 2RHKA 3R9PA 2HHSA 3FE1A 4DSFA 5LJWA 3WXLA 4OKKA 4H4OA 4FJ9A 1RGIA 2IS3A 1B92A 4W5RA 3HM9A 1VQ7N 1O1WA 4C1NI 1WAJA 4CJKA 2HB5A 1NGJA 4B1VA 4BVOA 3OW2M 1U48A 5K14A 4BC5A 3S3MA 4L8RB 4GV9A 2GEMA 4BY9C 4FM1A 2HF3A 5J1EA 3QESA 4M7XA 4YDUC 3A0IX 4MO4A 1ZXOA 5C12A 4KHSA 4BWMA 3VEWA 3U9DA 4BGAA 4K42A 4B3TK 1S72N 2HOEA 2F8TA 2E6MA 3DLLL 2D0BA 2PFUA 1T7PA 3DMJA 1TKXA 3HSTB 3D45A 2OTLN 2P9IA 4Z4IA 2XY7A 3H45C 1XC3A 3FZHA 4CFBA 2JWKA 3CJAA 3HJFA 5AQXA 3EY1A 5JICA 3G10A 4F8RA 1TL1A 4JN4A 1NJYA 3ZSOA 1BHLA 1IG9A 4DR3K 4FWSA 3T19A 4FWNA 3VTHA 2X6SA 2WBNA 3P39A 3QO9A 3LDNA 5AQMA 4M63C 3CJBA 3WNHA 4FLXA 3T1YK 3KK1A 2CH5A 3WXKA 3LM9A 4CIFA 3MXJA 3H08A 1KAYA 5FRNA 3LAMA 4EIAA 4CZEA 5H1SQ 3NH2A 3D2EB 1XC9A 2KKZA 5FROA 1W0HA 4GV3A 4CCHA 5BRHA 1T6DA 4E0DA 3SAFA 5CHIA 4OVLA 3L4IA 4C8NA 3L2QA 4E3SA 3FZLA 5A2QO 4JI5K 4GKKK 3QBXA 4W5TA 1WLJA 3CHWA 4CIEA 2V52B 3V9XA 4OGEA 2UUAK 1ASWA 1JL1A 3HYFA 2P9UB 1OVQA 3LALA 1NKCA 4FJ7A 4XH5A 3WUHA 3BDPA 4CEFA 1CZBA 3M3ZA 4JI2K 1HQUA 4J8FA 5J2PA 4EP4A 3DAWA 5AZJA 3NGZA 2ASMA 3N4PA 4M3YA 4OX9K 3OBWA 1OH5A 3QETA 3DOKA 1JKHA 3UKRB 1ESVA 2ZM6K 3G25A 2WOMA 5AZIB 3AO2A 2OCEA 1VQ6N 4B1ZA 3NVKA 5B8HA 3AVMA 4BDPA 4IFVA 1VQPN 1S3XA 1U45A 4CD3A 1JXBA 2F7TA 3SYZA 4BC3A 3HZ6A 3MWPA 4KI6A 1HLUA 4DTRA 1HR0K 1WSGA 2B4JA 2ZD1A 3VEVA 3AO5A 3UB5A 3IRXA 4W5OA 2R7YA 1JCGA 3ZETA 5DMRA 1S6QA 3Q7CA 2XO7A 1GLLO 2KW4A 2YHYA 4JK8A 4CI6A 3KKSA 1BU6O 1WSIA 3L2VA 4DTSA 5AQUA 2D0CA 4FWQA 3LZIA 1DTQA 4CEAA 3CFOA 3VEOA 1TAQA 4CEEA 3TTFA 4M42A 3ALYA 2E2QA 5SWMA 3O80A 3O8MA 3V9UA 3VQ8A 4H5NA 4OPAA 4JNEA 3UKUA 3C6UA 5GIPA 2W41A 2Y1IA 1CZ9A 1RDDA 3VQ5A 2EX3A 2JGUA 2RN2A 2VG7A 4NLBA 4BRQA 3MCPA 1BUPA 3C7NB 2QWQA 4G9ZA 5AZIA 4E7LA 4IDHA 3T1AA 2P51A 3CJ7A 3RSEA 5T7BA 1KC8O 4CGGA 4FLWA 1RBSA 4K43A 3MWTA 1M1KO 1EQYA 5HRSA 3SJHA 3SCXA 5KQDA 4CZMA 5F1XA 3OJUA 3QEWA 5BPLA 4A2BA 5C42A 5KPTA 4KKOA 4CGFA 1EX4A 3SAHA 3PV8A 4WQ5C 1IO2A 2W42A 1IKYA 2P9PA 4JRPA 3SI6A 3OY9A 4KTWA 5IWAK 1NJXA 4MLHA 3K59A 3C6HA 1SL1A 4B1UB 4DR5K 1FJGK 1A5XA 4RW9A 1RNHA 2Z1JA 4KBOA 4BRNA 3EE9A 1QQMA 1BA0A 4QAGA 4O5BA 4H0YB 4B8AB 3CJCA 4B9LA 4NB4A 4CK3A 3KD1E 5BPNA 3LDLA 4DFJA 2G8HA 4BWJA 5JLFA 4W5NA 3OA9A 4F3OA 1BWFO 5CY4A 3O9SA 2NRTA 3KVGA 3T69A 4FJXA 2HW3A 4XH4A 2ZJRL 3OYJA 1NGGA 3VESA 1NGBA 3P31A 1KCFA 1RT4A 2ETJA 3FFIA 3IUCA 4B1XB 4AH9A 5LMNK 1XMOK 3IFRA 1KVBA 1ZBSA 2PYJA 3QBWA 1X9JA 1JLGA 3DRPA 5CYQA 3EZWA 1ATNA 4CBXA 1EWRA 2D1KA 4ID1A 1XI1A 4CF0A 4H5VA 4JLHA 5BN9A 3TI0A 4IO8A 4A5BA 3RMCA 4RWTA 1KFSA 3NDKA 1SV5A 3VGLA 1TKDA 4IBNA 3IG1A 1HPZA 2CGKA 1GOAA 1SKWA 5FRMA 5EX5A 2QM1A 4WFAL 4CJTA 1YAGA 3DM2A 3SLCA 2Q3SA 4RCHA 4WQ4C 1WOQA 4AM6A 4M3RA 4ILGB 2VQFK 4V19S 3MMVA 4Z4CA 3CCQN 1NJZA 3S41A 1UAXA 1RT6A 3ZT4A 4Q0BA 2YNHA 4QCLA 1C0GA 1L3UA 2ATQA 3ATVA 1JLAA 3D2FB 3NFAA 3D7EO 2WTUA 3LDOA 2GTDA 2DTUA 4CFAA 1FXXA 3NGIA 3CERA 4DR4K 3AVBA 2J4RA 3HVTA 3SQ1A 1LOTB 3O3GA 4LF4K 3AV9A 3AAQA 4CESA 1WSHA 4E1NA 4CIGA 4O44A 4JV5K 1C0MA 3RRGA 4I2PA 3OYLA 2ZJQL 3CPWM 2YHXA 3L6QA 3GDQA 1ZBLA 4DSKA 4CBWA 1BI4A 4A2AA 3O1BA 4BDYA 1OH7A 1S1UA 5BRFA 1VQLN 1K8KA 4PA1A 3V6DA 5JS2A 5HRPA 3HRGA 4YY3K 1VSFA 1C0FA 4M45A 4L3QA 4KO0A 3NF8A 3CCSN 1NGDA 5ADXA 3LP3A 4DQPA 4JEPA 3B8AX 4E7IA 2O8BB 4GVMA 4NXMK 4CFCA 1XNQK 4HTUA 3OYEA 2YJEA 1K73O 4CJLA 4MDBA 4EP5A 3LZJA 3KHYA 5D3GA 2DFEA 2DY4A 5M1NA 3W3DA 3M1FA 4CGDA 2AJQA 3F73A 2HMPA 4DF8A 3R6MA 1RTHA 3GBTA 2Y1JA 2F9TA 3I8DA 1GOBA 4CHZA 1GLFO 4FJKA 3QEVA 2Z1IA 1DGKN 2HHUA 4JI8K 3J7ZO 3NH1A 3SJJA 3HM8A 4DWIA 4HCBA 4F3TA 4DR6K 4BC2A 3RMBA 4ISEA 2QXLA 3KLIA 4FM0A 3HL8A 2PY5A 3CCRN 1S22A 4CVNE 3C6TA 3WQTA 3PIOL 4JI1K 4RG8A 4GVEA 4OKJA 4IZ9A 3VF4A 3AA4A 3SBTA 3PIPL 1BISA 1TUYA 5AQNA 4FLZA 4CJFA 2OANA 3VQ9A 4DFKA 1FKPA 3VF6A 4LY7A 1K9MO 5C0YA 3EKUA 2P5GA 3CCLN 3ZT0A 1TKZA 3KIOA 3J80O 4ELUA 1EETA 1S1XA 4WFBL 1C1CA 2Q0UA 4PY5A 4DR1K 3FGUA 3HO1A 4WFNL 1XHZA 4LF8K 3PLAA 2H3GX 2DFHA 4WQ4A 1T03A 4GMJB 2HVIA 2IIRA 1IV0A 2IVPA 4CJSA 3AVIA 1WAFA 3QEPA 2X78A 1RBRA 3CD6N 4LFBK 2GV9A 4JK7A 4MLEA 1YVNA 3JXUA 3ZSXA 3CIPA 2F96A 3FLCO 3SMSA 4B1YB 4FZZA 4AHSA 3KLFA 1VQ8N 1E3MA 2Z1HA 3EKSA 3PUFA 3G4SN 4M3TA 4CK1A 2P1JA 1NGIA 1SQKA 1X3NA 4FWKA 3V1QA 3HXMA 4LH4A 2ASPA 2PYLA 4FJGA 4QS8A 4N5SA 2F8SA 3OBYA 3HPHA 4HUFA 5SZTA 1L3VA 4QS9A 2OPQA 4CJ5A 2KFNA 4CECA 3ULDA 3OHRA 2X74A 4X66K 1BG3A 4BVPA 3SQ0A 2NNWA 2YHBA 4CHQA 3CCMN 1SL2A 3DLHA 1LWFA 3DI6A 1JL2A 2P9IB 3JSMA 1J5OA 1JLEA 4K8ZA 3V9SA 4X64K 3VMFB 3FZFA 1RTIA 3F5TA 1DEJA 4DV4K 5HRRA 2Z1GA 1HPMA 1NJIO 3PSIA 3HT3A 2Q0RA
chains in the Genus database with same CATH topology
3NGZA 5KRSA 4I7FA 3VQPA 4DF4A 3S3OA 4CEQA 4M3YA 1BL3A 4OJRA 4FJ5A 3QETA 1RTJA 3DOKA 5JS1A 2OZSA 3CG7A 2IDOA 2YKMA 1U49A 3RWUA 4NYFA 1JKHA 4FLUA 3V9ZA 3VQ7A 3QERA 1KLMA 5HP1A 3TARA 2QK9A 4KREA 1UOCA 2WOMA 3D0PA 1KRPA 1VSKA 3AO2A 4IFYA 3HVRA 1ZBIA 3E01A 3NH0A 4DFPA 4ELTA 3QLHA 3AVMA 4IDKA 5DK5A 1U47A 3KD5E 1T8EA 3MEDA 2GUIA 3I0SA 4IFVA 3LWLA 4BDPA 3TR8A 1TK5A 3KLEA 1U45A 4FK0A 1TK8A 2XHBA 3KLGA 1JXBA 3SYZA 4AHRA 4M3WA 2HVHA 1S1TA 4C8MA 4NCAA 4KI4A 4KI6A 3HPGA 4CJ3A 4DTRA 1WSGA 3U6FA 4B08A 3RR7A 2B4JA 2ZD1A 3AA2A 3AO5A 2DFFA 5FDLA 3OS0A 3AA3A 4DQQA 1VK0A 3IRXA 4W5OA 2R7YA 4N47A 3SZ2A 3QIPA 4DS4A 2HNDA 5DMRA 4CEBA 1S6QA 4CERA 2XO7A 3SQ4A 3LPTA 4J2EA 1WSFA 3TWHA 1D9DA 2QKKA 2KW4A 3MECA 3TAMA 1DTTA 3KKSA 3VN5A 3OYIA 3TAEA 3AVLA 3TABA 1HYVA 1IKVA 2FBYA 4DTXA 4O0IA 3NGYA 1WSIA 3L2VA 4DTSA 2D0CA 4DSLA 3LZIA 1DTQA 4B8CA 4CEAA 3K5NA 3CFOA 3OVNA 3S3NA 2I5JA 1TAQA 1JXEA 1QS4A 4CEEA 3ZSRA 4KPYA 4M42A 1A5VA 3ALYA 1F21A 3IAYA 4DSJA 2YNFA 3DLGA 3DLEA 4AHVA 3VQQA 5SWMA 3HPOA 4E1MA 1ITGA 2EHGA 4CEDA 4DU3A 4OGCA 1S1WA 2OPPA 3VQ8A 3V9UA 3U3GA 4DTOA 4FJNA 3C6UA 3VQEA 4DQRA 1TAUA 1RT5A 2IOCA 1RT7A 1YTAA 3OS2A 4CJUA 3V4IA 1QSLA 3NCIA 4E7HA 1RDAA 3OYCA 2VG5A 1CZ9A 1RDDA 3VQ6A 3VQ5A 2Y1IA 2B6AA 2EX3A 1NKEA 3K5OA 2XY6A 4FJJA 3K5MA 2JGUA 1JLBA 1WSEA 2RN2A 1SKSA 1RTDA 4DSEA 2VG7A 4KHWA 3A2FA 4ICLA 3V1OA 4CJQA 4LH5A 4N76A 3OYMA 1VSJA 4E7LA 2O4GA 3T1AA 2P51A 5T7BA 4Z4FA 1SKRA 4CGGA 5C25A 3DLBA 4FLWA 1RBSA 1RBUA 1HJRA 3DOLA 5KI6A 1R0AA 1QSSA 1HYZA 1VRTA 5HRSA 3G0ZA 1HQEA 3M8SA 1L3SA 1EKEA 4Z4GA 4I9LA 3SCXA 4CK2A 3LP0A 3V9WA 3OJUA 4YFUA 3QEWA 2HHQA 1VSMA 3P83D 5C42A 1QHTA 1WSJA 4CHYA 4K8XA 3PY8A 4CGJA 1GOCA 4KKOA 4CGFA 3RMAA 3ZSZA 3M8PA 3L2WA 4B9NA 1EX4A 4I9QA 3KK3A 4FJMA 3DRSA 1EXQA 1S9EA 1KVAA 1YT3A 2HNYA 3VQAA 3L2UA 3PV8A 1QSYA 3HK2A 1IO2A 3M8RA 3L2RA 2W42A 1IKYA 1S5JA 1VRUA 4JRPA 3OY9A 4OPJA 3SI6A 4FJLA 4KTWA 4LSNA 3K58A 1NJXA 4B9UA 3VA0A 1C0UA 1YVUA 1C1BA 3K59A 1SL1A 2HHTA 1BQMA 1NK5A 4W5NA 1LAVA 1KVCA 2ZQBA 1A5XA 3VA3A 4RW9A 4F2SA 1RNHA 2Z1JA 4FVMA 3TAPA 4C8OA 1X9WA 4KRFA 3KJVA 4QAGA 4O5BA 1RCHA 3OS1A 4B8AB 1W9HA 4DTJA 3S9HA 4B9LA 1X9MA 1HRHA 4CK3A 3KD1E 3PX6A 3UIQA 4FLYA 1FKOA 3LANA 3SNNA 2YNIA 1WNSA 1T05A 3HP6A 4M3XA 3V81A 3QNOA 4DFJA 3ZT2A 4AHTA 3CYMA 4BWJA 2B5JA 1LW2A 4DTPA 2XRIA 1X1PA 5CY4A 4DU4A 3AVKA 4KFBA 4F3OA 2HW3A 4FJXA 3THVA 2IAJA 4BE0A 3OYJA 3QIOA 4UQGA 3SV4A 4EZ6A 1ZBHA 1KCFA 1RT4A 2ETJA 2VG6A 3FFIA 1ZBUA 2NUBA 3ASMA 4AH9A 3TAGA 1U4BA 4DQIA 4ZTJA 1D5AA 1KVBA 3SUOA 2PYJA 4J2BA 1KLNA 1RBTA 1ZBFA 3DRPA 1A5WA 1JLGA 1TGOA 3L3UA 4CF8A 5CYQA 3RTVA 2QKBA 4OLAA 2KZZA 4QOZB 1VSHA 4KTQA 3NAEA 1CXQA 4HHTA 1QTMA 4ID1A 1XI1A 1LAWA 3SUNA 1NK6A 2YHAA 4CF0A 4OKEA 1UA1A 2G8IA 4JLHA 2D0AA 3TAQA 3ISNC 1XWLA 3TI0A 2OZMA 4BACA 3OYDA 4Z4HA 1K6YA 1I3AA 3RMCA 5I42A 1KSPA 4F4KA 1KFSA 1LW0A 1CXUA 3NDKA 4WE1A 1SV5A 4JRQA 4M41A 1BCMA 1VSIA 4CJPA 2G8KA 1Y97A 4KHNA 2KFZA 2D5RA 4IBNA 3NE6A 3DYAA 3IG1A 3T3FA 1HPZA 1TKDA 4NCGA 5CYMA 1GOAA 3VQCA 1RDCA 1SKWA 4FK4A 5FRMA 3NF9A 1J9AA 4B3OA 1BIZA 4LSLA 4CJTA 3KK2A 1L5UA 3RR8A 4RW6A 3DM2A 5CZ1A 2Q3SA 1NK9A 3OYKA 2HHXA 4H4MA 2O4IA 4M3ZA 4FLVA 3ITHA 3SUPA 3KKRA 4M3RA 3AVCA 1RT3A 3NBPA 4DTUA 2G8UA 4Z4CA 1NJZA 2A1RA 4B9MA 1UAXA 1RT6A 3TANA 3ZT4A 4AILC 1J54A 1RBVA 4Q0BA 3B6OA 3EZ5A 2YNHA 3P5JA 3LP2A 3HT3A 4QCLA 1HMVA 5J2MA 1IKXA 1L3UA 4DSIA 4CEZA 3KLHA 1NK8A 1RT2A 3ZCMA 2ATQA 1RILA 3CFRA 4RW4A 1JLAA 1VSDA 3PX4A 1XHXA 4NCBA 3PO5A 4FYDA 1KFDA 3DLRA 1YTUA 3CM6A 3NFAA 3CM5A 2X6NA 4CJ4A 3SUQA 3LAKA 4I2QA 2WONA 3L3VA 4DLEA 1ZYQA 1HNIA 1Z26A 3AVHA 1FXXA 4CFAA 3NGIA 2DTUA 4KB1A 4MFBA 1U04A 4IG0A 3K57A 2G8FA 1TVRA 2VWKA 5C24A 1TK0A 4DTNA 1FK9A 4KTZA 3AVBA 4Y1CA 3HVTA 3SQ1A 4CF1A 3O3GA 4Y1DA 2RF2A 4NYNA 3LPUA 1Q8IA 3AV9A 2E4LA 4FCYA 1BIUA 4CESA 1WSHA 3MEGA 2G8HA 3VQDA 4E1NA 2RPIA 4FW1A 4CIGA 3SQ2A 3K2PA 4O44A 4CF2A 3K5LA 3RMDA 1C0MA 1D8YA 3CFPA 3RRGA 4I2PA 3OYLA 3QINA 3NF7A 2G8WA 3U3YA 4DFMA 1QE1A 4B9VA 4CJVA 1ASUA 4C8LA 3EYZA 4CFDA 5KGWA 1G15A 1ZBLA 4DSKA 4Z4EA 3O3HA 1BI4A 4PUOA 4BDYA 2RKIA 4FM2A 4FZXC 1S1UA 4FJIA 1C1AA 4Q5VA 2VWJA 4PA1A 4CJRA 3V6DA 4YNQA 1Q9XA 3JYTA 3AVGA 4RW7A 3PO4A 4E7JA 3DRRA 4CEOA 1REVA 1S1VA 1TL3A 5JS2A 5HRPA 3ZT3A 3TAFA 5HROA 4R5PA 2BE2A 4CHPA 1RT1A 2A1SA 3O3FA 1VSFA 3QNNA 2OA8A 1TV6A 1NK4A 4Z0UA 3OYFA 4M45A 4KO0A 2FBXA 3NF8A 2QXFA 3ZSYA 3C95A 4EZ9A 5KTQA 4B9TA 3LP3A 1S9GA 4DQPA 5J2QA 1SUQA 3NHGA 4FZYA 1UWBA 4E7IA 4GVMA 4CFCA 4HTUA 4CGIA 3OYEA 1KTQA 4O0JA 4HCCA 3V1RA 4DTMA 1BCOA 4FW2A 3ZSQA 4FJHA 5HLFA 4CJLA 4EP5A 1Z25A 4KV8A 3LZJA 4RW8A 3C94A 4H8KA 3LWMA 4IKFA 1Q9YA 1CLQA 5D3GA 2DFEA 4BDZA 1LWEA 1I39A 4DQSA 1LV5A 3B6PA 3OYBA 1LWCA 3LDSA 4N56A 3OYGA 2DY4A 5HRNA 4DLGA 4N41A 2FC0A 4CGDA 3WNGA 4HUGA 3AVAA 2AJQA 4BE1A 4F2RA 1C0TA 2HNZA 3AVJA 2JLEA 3F73A 4FJ8A 3SPZA 1S6PA 2PZSA 3LP1A 3HP9A 4DF8A 4CHNA 2IGIA 3MEEA 1NK7A 1RTHA 2Y1JA 3I8DA 3I0RA 3CQ8A 3P1GA 4CE9A 1GOBA 4CHZA 4OPKA 4PWDA 4KHYA 1EP4A 1NJWA 3PX0A 4FJKA 3QEVA 2Z1IA 2HHUA 4CHOA 3NH1A 2ITGA 3SJJA 4J2AA 1BGXT 3F9KA 4DWIA 4M3UA 1BI4B 4KB0A 1MU2A 4HCBA 4F3TA 2YKNA 2HHSA 4DSFA 4DU1A 3SV3A 3RMBA 3VQBA 4XIUA 4OKKA 4CJEA 3SPYA 4H4OA 3KLIA 2BDPA 4FJ9A 4FM0A 3HL8A 2PY5A 1N5YA 2IS3A 2KZMA 3AVFA 1B92A 4W5RA 3HM9A 1N6QA 1O1WA 4CJKA 1WAJA 2HB5A 2ZE2A 3C6TA 4CGHA 2FBVA 3QEIA 1U48A 5K14A 3S3MA 1JLFA 1VSLA 4L8RB 4RG8A 4FXDA 4OKJA 1UA0A 3AA4A 3VQ4A 2E6LA 1BISA 1QQCA 5CZ2A 4CJFA 5J1EA 4IG3A 4FLZA 4FM1A 3RRHA 3QESA 4DFKA 3VQ9A 1L3TA 1FKPA 4DG1A 4LY7A 3AO3A 3O4QA 4KAZA 3NF6A 4BWMA 4KHSA 4MQ3A 2P5GA 2HHVA 1X9SA 2F8TA 2E6MA 3ZT0A 2P5OA 4HVJA 1C6VA 4E89A 2YV0X 4KHUA 1NKBA 1IH7A 1B9FA 1TKZA 3MAQA 2D0BA 1T7PA 3DMJA 1TKXA 3KIOA 3DLKA 3HSTB 4ELUA 1EETA 1S1XA 3D45A 1C1CA 5I3UA 4DMNA 4PY5A 4FLTA 2XY7A 1TKTA 4Z4IA 3HO1A 4CFBA 2XY5A 3M8QA 1XHZA 2IC3A 3AO1A 2DFHA 3HJFA 1T03A 4GMJB 2HVIA 1VSEA 1RDBA 3ZSVA 1DLOA 1JLCA 3EY1A 3G10A 5EU7A 4CJSA 4F8RA 4ZTFA 2OPRA 3AVIA 1ASVA 1TL1A 1WAFA 1NOZA 1HYSA 3QEPA 4KHQA 3O4NA 1NJYA 2BANA 3ZSOA 2X78A 3MXMA 1BHLA 1IG9A 5E41A 1RBRA 2FBTA 3ZSWA 3T19A 4C8KA 2XY8A 3BGRA 2HHWA 4O55A 2GV9A 2BGGA 2X6SA 3ZSXA 3QO9A 4ZHRA 4W5QA 2YNGA 4AHUA 4JS4A 4OLBA 5KGXA 2F96A 3ZT1A 5J2NA 1D9FA 4ELVA 4FZZA 2KTQA 4AHSA 2KQ2A 3KLFA 3WNHA 4FLXA 3KK1A 2Z1HA 1B9DA 3PUFA 4HUEA 4DS5A 4CIFA 3MXJA 4FK2A 3H08A 4LD0A 3OJSA 1SL0A 4M3TA 4CK1A 4PQUA 2LSNA 2P1JA 5FRNA 3LAMA 4CF9A 2OYQA 3NH2A 4O4GA 1JLQA 3V1QA 1NOYA 1XC9A 5FROA 1W0HA 3HXMA 4LH4A 4GW6A 2PYLA 4E7KA 4FJGA 4N5SA 2F8SA 4CCHA 3HPHA 4CJWA 4HUFA 4E0DA 5SZTA 1L3VA 5HBMA 4OVLA 4C8NA 2OPQA 4CJ5A 3QEXA 2KFNA 4CECA 3ULDA 3L2QA 4E3SA 3OYHA 1BQNA 1WN7A 4W5TA 2X74A 1WLJA 4BE2A 4CIEA 3SQ0A 2G8VA 3WNEA 2YHBA 2OPSA 3V9XA 1NK0A 4CHQA 4G1QA 5KRTA 1HNVA 3AVNA 1IKWA 4OGEA 3OYNA 4JS5A 1SL2A 1LWFA 3DI6A 3DLHA 1JL2A 3JSMA 1ASWA 1JL1A 4AHCA 3HYFA 1JLEA 1J5OA 3KTQA 4K8ZA 3V9SA 3LALA 1NKCA 3OYAA 4FJ7A 2HMIA 1RTIA 3L8BA 3BDPA 4CEFA 4TSXA 1CZBA 3MXIA 4J2DA 4ID5A 5HRRA 2Z1GA 2GBZA 4E19A 1HQUA 5J2PA 4EP4A 3AA5X 3AO4A 1J53A 3IS9A 3WNFA 4B9SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NGZ A;  5KRS A;  4I7F A;  3VQP A;  4DF4 A;  3S3O A;  4CEQ A;  4M3Y A;  1BL3 A;  4OJR A;  4FJ5 A;  3QET A;  1RTJ A;  3DOK A;  5JS1 A;  2OZS A;  3CG7 A;  2IDO A;  2YKM A;  1U49 A;  3RWU A;  4NYF A;  1JKH A;  4FLU A;  3V9Z A;  3VQ7 A;  3QER A;  1KLM A;  5HP1 A;  3TAR A;  2QK9 A;  4KRE A;  1UOC A;  2WOM A;  3D0P A;  1KRP A;  1VSK A;  3AO2 A;  4IFY A;  3HVR A;  1ZBI A;  3E01 A;  3NH0 A;  4DFP A;  4ELT A;  3QLH A;  3AVM A;  4IDK A;  5DK5 A;  1U47 A;  3KD5 E;  1T8E A;  3MED A;  2GUI A;  3I0S A;  4IFV A;  3LWL A;  4BDP A;  3TR8 A;  1TK5 A;  3KLE A;  1U45 A;  4FK0 A;  1TK8 A;  2XHB A;  3KLG A;  1JXB A;  3SYZ A;  4AHR A;  4M3W A;  2HVH A;  1S1T A;  4C8M A;  4NCA A;  4KI4 A;  4KI6 A;  3HPG A;  4CJ3 A;  4DTR A;  1WSG A;  3U6F A;  4B08 A;  3RR7 A;  2B4J A;  2ZD1 A;  3AA2 A;  3AO5 A;  2DFF A;  5FDL A;  3OS0 A;  3AA3 A;  4DQQ A;  1VK0 A;  3IRX A;  4W5O A;  2R7Y A;  4N47 A;  3SZ2 A;  3QIP A;  4DS4 A;  2HND A;  5DMR A;  4CEB A;  1S6Q A;  4CER A;  2XO7 A;  3SQ4 A;  3LPT A;  4J2E A;  1WSF A;  3TWH A;  1D9D A;  2QKK A;  2KW4 A;  3MEC A;  3TAM A;  1DTT A;  3KKS A;  3VN5 A;  3OYI A;  3TAE A;  3AVL A;  3TAB A;  1HYV A;  1IKV A;  2FBY A;  4DTX A;  4O0I A;  3NGY A;  1WSI A;  3L2V A;  4DTS A;  2D0C A;  4DSL A;  3LZI A;  1DTQ A;  4B8C A;  4CEA A;  3K5N A;  3CFO A;  3OVN A;  3S3N A;  2I5J A;  1TAQ A;  1JXE A;  1QS4 A;  4CEE A;  3ZSR A;  4KPY A;  4M42 A;  1A5V A;  3ALY A;  1F21 A;  3IAY A;  4DSJ A;  2YNF A;  3DLG A;  3DLE A;  4AHV A;  3VQQ A;  5SWM A;  3HPO A;  4E1M A;  1ITG A;  2EHG A;  4CED A;  4DU3 A;  4OGC A;  1S1W A;  2OPP A;  3VQ8 A;  3V9U A;  3U3G A;  4DTO A;  4FJN A;  3C6U A;  3VQE A;  4DQR A;  1TAU A;  1RT5 A;  2IOC A;  1RT7 A;  1YTA A;  3OS2 A;  4CJU A;  3V4I A;  1QSL A;  3NCI A;  4E7H A;  1RDA A;  3OYC A;  2VG5 A;  1CZ9 A;  1RDD A;  3VQ6 A;  3VQ5 A;  2Y1I A;  2B6A A;  2EX3 A;  1NKE A;  3K5O A;  2XY6 A;  4FJJ A;  3K5M A;  2JGU A;  1JLB A;  1WSE A;  2RN2 A;  1SKS A;  1RTD A;  4DSE A;  2VG7 A;  4KHW A;  3A2F A;  4ICL A;  3V1O A;  4CJQ A;  4LH5 A;  4N76 A;  3OYM A;  1VSJ A;  4E7L A;  2O4G A;  3T1A A;  2P51 A;  5T7B A;  4Z4F A;  1SKR A;  4CGG A;  5C25 A;  3DLB A;  4FLW A;  1RBS A;  1RBU A;  1HJR A;  3DOL A;  5KI6 A;  1R0A A;  1QSS A;  1HYZ A;  1VRT A;  5HRS A;  3G0Z A;  1HQE A;  3M8S A;  1L3S A;  1EKE A;  4Z4G A;  4I9L A;  3SCX A;  4CK2 A;  3LP0 A;  3V9W A;  3OJU A;  4YFU A;  3QEW A;  2HHQ A;  1VSM A;  3P83 D;  5C42 A;  1QHT A;  1WSJ A;  4CHY A;  4K8X A;  3PY8 A;  4CGJ A;  1GOC A;  4KKO A;  4CGF A;  3RMA A;  3ZSZ A;  3M8P A;  3L2W A;  4B9N A;  1EX4 A;  4I9Q A;  3KK3 A;  4FJM A;  3DRS A;  1EXQ A;  1S9E A;  1KVA A;  1YT3 A;  2HNY A;  3VQA A;  3L2U A;  3PV8 A;  1QSY A;  3HK2 A;  1IO2 A;  3M8R A;  3L2R A;  2W42 A;  1IKY A;  1S5J A;  1VRU A;  4JRP A;  3OY9 A;  4OPJ A;  3SI6 A;  4FJL A;  4KTW A;  4LSN A;  3K58 A;  1NJX A;  4B9U A;  3VA0 A;  1C0U A;  1YVU A;  1C1B A;  3K59 A;  1SL1 A;  2HHT A;  1BQM A;  1NK5 A;  4W5N A;  1LAV A;  1KVC A;  2ZQB A;  1A5X A;  3VA3 A;  4RW9 A;  4F2S A;  1RNH A;  2Z1J A;  4FVM A;  3TAP A;  4C8O A;  1X9W A;  4KRF A;  3KJV A;  4QAG A;  4O5B A;  1RCH A;  3OS1 A;  4B8A B;  1W9H A;  4DTJ A;  3S9H A;  4B9L A;  1X9M A;  1HRH A;  4CK3 A;  3KD1 E;  3PX6 A;  3UIQ A;  4FLY A;  1FKO A;  3LAN A;  3SNN A;  2YNI A;  1WNS A;  1T05 A;  3HP6 A;  4M3X A;  3V81 A;  3QNO A;  4DFJ A;  3ZT2 A;  4AHT A;  3CYM A;  4BWJ A;  2B5J A;  1LW2 A;  4DTP A;  2XRI A;  1X1P A;  5CY4 A;  4DU4 A;  3AVK A;  4KFB A;  4F3O A;  2HW3 A;  4FJX A;  3THV A;  2IAJ A;  4BE0 A;  3OYJ A;  3QIO A;  4UQG A;  3SV4 A;  4EZ6 A;  1ZBH A;  1KCF A;  1RT4 A;  2ETJ A;  2VG6 A;  3FFI A;  1ZBU A;  2NUB A;  3ASM A;  4AH9 A;  3TAG A;  1U4B A;  4DQI A;  4ZTJ A;  1D5A A;  1KVB A;  3SUO A;  2PYJ A;  4J2B A;  1KLN A;  1RBT A;  1ZBF A;  3DRP A;  1A5W A;  1JLG A;  1TGO A;  3L3U A;  4CF8 A;  5CYQ A;  3RTV A;  2QKB A;  4OLA A;  2KZZ A;  4QOZ B;  1VSH A;  4KTQ A;  3NAE A;  1CXQ A;  4HHT A;  1QTM A;  4ID1 A;  1XI1 A;  1LAW A;  3SUN A;  1NK6 A;  2YHA A;  4CF0 A;  4OKE A;  1UA1 A;  2G8I A;  4JLH A;  2D0A A;  3TAQ A;  3ISN C;  1XWL A;  3TI0 A;  2OZM A;  4BAC A;  3OYD A;  4Z4H A;  1K6Y A;  1I3A A;  3RMC A;  5I42 A;  1KSP A;  4F4K A;  1KFS A;  1LW0 A;  1CXU A;  3NDK A;  4WE1 A;  1SV5 A;  4JRQ A;  4M41 A;  1BCM A;  1VSI A;  4CJP A;  2G8K A;  1Y97 A;  4KHN A;  2KFZ A;  2D5R A;  4IBN A;  3NE6 A;  3DYA A;  3IG1 A;  3T3F A;  1HPZ A;  1TKD A;  4NCG A;  5CYM A;  1GOA A;  3VQC A;  1RDC A;  1SKW A;  4FK4 A;  5FRM A;  3NF9 A;  1J9A A;  4B3O A;  1BIZ A;  4LSL A;  4CJT A;  3KK2 A;  1L5U A;  3RR8 A;  4RW6 A;  3DM2 A;  5CZ1 A;  2Q3S A;  1NK9 A;  3OYK A;  2HHX A;  4H4M A;  2O4I A;  4M3Z A;  4FLV A;  3ITH A;  3SUP A;  3KKR A;  4M3R A;  3AVC A;  1RT3 A;  3NBP A;  4DTU A;  2G8U A;  4Z4C A;  1NJZ A;  2A1R A;  4B9M A;  1UAX A;  1RT6 A;  3TAN A;  3ZT4 A;  4AIL C;  1J54 A;  1RBV A;  4Q0B A;  3B6O A;  3EZ5 A;  2YNH A;  3P5J A;  3LP2 A;  3HT3 A;  4QCL A;  1HMV A;  5J2M A;  1IKX A;  1L3U A;  4DSI A;  4CEZ A;  3KLH A;  1NK8 A;  1RT2 A;  3ZCM A;  2ATQ A;  1RIL A;  3CFR A;  4RW4 A;  1JLA A;  1VSD A;  3PX4 A;  1XHX A;  4NCB A;  3PO5 A;  4FYD A;  1KFD A;  3DLR A;  1YTU A;  3CM6 A;  3NFA A;  3CM5 A;  2X6N A;  4CJ4 A;  3SUQ A;  3LAK A;  4I2Q A;  2WON A;  3L3V A;  4DLE A;  1ZYQ A;  1HNI A;  1Z26 A;  3AVH A;  1FXX A;  4CFA A;  3NGI A;  2DTU A;  4KB1 A;  4MFB A;  1U04 A;  4IG0 A;  3K57 A;  2G8F A;  1TVR A;  2VWK A;  5C24 A;  1TK0 A;  4DTN A;  1FK9 A;  4KTZ A;  3AVB A;  4Y1C A;  3HVT A;  3SQ1 A;  4CF1 A;  3O3G A;  4Y1D A;  2RF2 A;  4NYN A;  3LPU A;  1Q8I A;  3AV9 A;  2E4L A;  4FCY A;  1BIU A;  4CES A;  1WSH A;  3MEG A;  2G8H A;  3VQD A;  4E1N A;  2RPI A;  4FW1 A;  4CIG A;  3SQ2 A;  3K2P A;  4O44 A;  4CF2 A;  3K5L A;  3RMD A;  1C0M A;  1D8Y A;  3CFP A;  3RRG A;  4I2P A;  3OYL A;  3QIN A;  3NF7 A;  2G8W A;  3U3Y A;  4DFM A;  1QE1 A;  4B9V A;  4CJV A;  1ASU A;  4C8L A;  3EYZ A;  4CFD A;  5KGW A;  1G15 A;  1ZBL A;  4DSK A;  4Z4E A;  3O3H A;  1BI4 A;  4PUO A;  4BDY A;  2RKI A;  4FM2 A;  4FZX C;  1S1U A;  4FJI A;  1C1A A;  4Q5V A;  2VWJ A;  4PA1 A;  4CJR A;  3V6D A;  4YNQ A;  1Q9X A;  3JYT A;  3AVG A;  4RW7 A;  3PO4 A;  4E7J A;  3DRR A;  4CEO A;  1REV A;  1S1V A;  1TL3 A;  5JS2 A;  5HRP A;  3ZT3 A;  3TAF A;  5HRO A;  4R5P A;  2BE2 A;  4CHP A;  1RT1 A;  2A1S A;  3O3F A;  1VSF A;  3QNN A;  2OA8 A;  1TV6 A;  1NK4 A;  4Z0U A;  3OYF A;  4M45 A;  4KO0 A;  2FBX A;  3NF8 A;  2QXF A;  3ZSY A;  3C95 A;  4EZ9 A;  5KTQ A;  4B9T A;  3LP3 A;  1S9G A;  4DQP A;  5J2Q A;  1SUQ A;  3NHG A;  4FZY A;  1UWB A;  4E7I A;  4GVM A;  4CFC A;  4HTU A;  4CGI A;  3OYE A;  1KTQ A;  4O0J A;  4HCC A;  3V1R A;  4DTM A;  1BCO A;  4FW2 A;  3ZSQ A;  4FJH A;  5HLF A;  4CJL A;  4EP5 A;  1Z25 A;  4KV8 A;  3LZJ A;  4RW8 A;  3C94 A;  4H8K A;  3LWM A;  4IKF A;  1Q9Y A;  1CLQ A;  5D3G A;  2DFE A;  4BDZ A;  1LWE A;  1I39 A;  4DQS A;  1LV5 A;  3B6P A;  3OYB A;  1LWC A;  3LDS A;  4N56 A;  3OYG A;  2DY4 A;  5HRN A;  4DLG A;  4N41 A;  2FC0 A;  4CGD A;  3WNG A;  4HUG A;  3AVA A;  2AJQ A;  4BE1 A;  4F2R A;  1C0T A;  2HNZ A;  3AVJ A;  2JLE A;  3F73 A;  4FJ8 A;  3SPZ A;  1S6P A;  2PZS A;  3LP1 A;  3HP9 A;  4DF8 A;  4CHN A;  2IGI A;  3MEE A;  1NK7 A;  1RTH A;  2Y1J A;  3I8D A;  3I0R A;  3CQ8 A;  3P1G A;  4CE9 A;  1GOB A;  4CHZ A;  4OPK A;  4PWD A;  4KHY A;  1EP4 A;  1NJW A;  3PX0 A;  4FJK A;  3QEV A;  2Z1I A;  2HHU A;  4CHO A;  3NH1 A;  2ITG A;  3SJJ A;  4J2A A;  1BGX T;  3F9K A;  4DWI A;  4M3U A;  1BI4 B;  4KB0 A;  1MU2 A;  4HCB A;  4F3T A;  2YKN A;  2HHS A;  4DSF A;  4DU1 A;  3SV3 A;  3RMB A;  3VQB A;  4XIU A;  4OKK A;  4CJE A;  3SPY A;  4H4O A;  3KLI A;  2BDP A;  4FJ9 A;  4FM0 A;  3HL8 A;  2PY5 A;  1N5Y A;  2IS3 A;  2KZM A;  3AVF A;  1B92 A;  4W5R A;  3HM9 A;  1N6Q A;  1O1W A;  4CJK A;  1WAJ A;  2HB5 A;  2ZE2 A;  3C6T A;  4CGH A;  2FBV A;  3QEI A;  1U48 A;  5K14 A;  3S3M A;  1JLF A;  1VSL A;  4L8R B;  4RG8 A;  4FXD A;  4OKJ A;  1UA0 A;  3AA4 A;  3VQ4 A;  2E6L A;  1BIS A;  1QQC A;  5CZ2 A;  4CJF A;  5J1E A;  4IG3 A;  4FLZ A;  4FM1 A;  3RRH A;  3QES A;  4DFK A;  3VQ9 A;  1L3T A;  1FKP A;  4DG1 A;  4LY7 A;  3AO3 A;  3O4Q A;  4KAZ A;  3NF6 A;  4BWM A;  4KHS A;  4MQ3 A;  2P5G A;  2HHV A;  1X9S A;  2F8T A;  2E6M A;  3ZT0 A;  2P5O A;  4HVJ A;  1C6V A;  4E89 A;  2YV0 X;  4KHU A;  1NKB A;  1IH7 A;  1B9F A;  1TKZ A;  3MAQ A;  2D0B A;  1T7P A;  3DMJ A;  1TKX A;  3KIO A;  3DLK A;  3HST B;  4ELU A;  1EET A;  1S1X A;  3D45 A;  1C1C A;  5I3U A;  4DMN A;  4PY5 A;  4FLT A;  2XY7 A;  1TKT A;  4Z4I A;  3HO1 A;  4CFB A;  2XY5 A;  3M8Q A;  1XHZ A;  2IC3 A;  3AO1 A;  2DFH A;  3HJF A;  1T03 A;  4GMJ B;  2HVI A;  1VSE A;  1RDB A;  3ZSV A;  1DLO A;  1JLC A;  3EY1 A;  3G10 A;  5EU7 A;  4CJS A;  4F8R A;  4ZTF A;  2OPR A;  3AVI A;  1ASV A;  1TL1 A;  1WAF A;  1NOZ A;  1HYS A;  3QEP A;  4KHQ A;  3O4N A;  1NJY A;  2BAN A;  3ZSO A;  2X78 A;  3MXM A;  1BHL A;  1IG9 A;  5E41 A;  1RBR A;  2FBT A;  3ZSW A;  3T19 A;  4C8K A;  2XY8 A;  3BGR A;  2HHW A;  4O55 A;  2GV9 A;  2BGG A;  2X6S A;  3ZSX A;  3QO9 A;  4ZHR A;  4W5Q A;  2YNG A;  4AHU A;  4JS4 A;  4OLB A;  5KGX A;  2F96 A;  3ZT1 A;  5J2N A;  1D9F A;  4ELV A;  4FZZ A;  2KTQ A;  4AHS A;  2KQ2 A;  3KLF A;  3WNH A;  4FLX A;  3KK1 A;  2Z1H A;  1B9D A;  3PUF A;  4HUE A;  4DS5 A;  4CIF A;  3MXJ A;  4FK2 A;  3H08 A;  4LD0 A;  3OJS A;  1SL0 A;  4M3T A;  4CK1 A;  4PQU A;  2LSN A;  2P1J A;  5FRN A;  3LAM A;  4CF9 A;  2OYQ A;  3NH2 A;  4O4G A;  1JLQ A;  3V1Q A;  1NOY A;  1XC9 A;  5FRO A;  1W0H A;  3HXM A;  4LH4 A;  4GW6 A;  2PYL A;  4E7K A;  4FJG A;  4N5S A;  2F8S A;  4CCH A;  3HPH A;  4CJW A;  4HUF A;  4E0D A;  5SZT A;  1L3V A;  5HBM A;  4OVL A;  4C8N A;  2OPQ A;  4CJ5 A;  3QEX A;  2KFN A;  4CEC A;  3ULD A;  3L2Q A;  4E3S A;  3OYH A;  1BQN A;  1WN7 A;  4W5T A;  2X74 A;  1WLJ A;  4BE2 A;  4CIE A;  3SQ0 A;  2G8V A;  3WNE A;  2YHB A;  2OPS A;  3V9X A;  1NK0 A;  4CHQ A;  4G1Q A;  5KRT A;  1HNV A;  3AVN A;  1IKW A;  4OGE A;  3OYN A;  4JS5 A;  1SL2 A;  1LWF A;  3DI6 A;  3DLH A;  1JL2 A;  3JSM A;  1ASW A;  1JL1 A;  4AHC A;  3HYF A;  1JLE A;  1J5O A;  3KTQ A;  4K8Z A;  3V9S A;  3LAL A;  1NKC A;  3OYA A;  4FJ7 A;  2HMI A;  1RTI A;  3L8B A;  3BDP A;  4CEF A;  4TSX A;  1CZB A;  3MXI A;  4J2D A;  4ID5 A;  5HRR A;  2Z1G A;  2GBZ A;  4E19 A;  1HQU A;  5J2P A;  4EP4 A;  3AA5 X;  3AO4 A;  1J53 A;  3IS9 A;  3WNF A;  4B9S A; 
#chains in the Genus database with same CATH topology
 4H0X B;  4DF4 A;  3S3O A;  1JCF A;  5AQT A;  3CG7 A;  2YKM A;  1U49 A;  3C6A A;  5AQH A;  2DPN A;  4FLU A;  1YIT N;  4DKW A;  3D0P A;  1KRP A;  4IFY A;  1ZBI A;  3E01 A;  5AQP A;  3NH0 A;  4PL7 A;  4DV5 K;  3KD5 E;  1T8E A;  2GUI A;  3I0S A;  2OTJ N;  1Q86 O;  1TK5 A;  1MWK A;  1YXQ A;  3KLG A;  4M3W A;  5AQV A;  1S1T A;  4C8M A;  3U8X A;  4NCA A;  4KI4 A;  1XQS C;  4B08 A;  2W6K A;  4A62 A;  3AGK A;  3OS0 A;  3AA3 A;  3G71 N;  1VK0 A;  2JWL A;  3THY B;  3QIP A;  3O9U A;  2NLX A;  1Z6R A;  1Y64 A;  2FSJ A;  4DS4 A;  1H1V A;  1V4S A;  4IFE A;  1D9D A;  2P9K A;  4IEE A;  4JKH A;  3KZB A;  3VN5 A;  3EEQ A;  2P9N A;  3TAE A;  3TAB A;  1IBL K;  4DTX A;  2E5L K;  1ATR A;  3A8Y A;  5AZJ B;  3LM2 A;  3K9J A;  4DQ8 A;  3H6E A;  4B8C A;  1VQO N;  1JXE A;  1QS4 A;  1A5V A;  3IAY A;  3VQQ A;  4KHP K;  1TYQ A;  3QB0 A;  1NBW A;  4OGC A;  1S1W A;  3U3G A;  4DTO A;  4FJN A;  1TAU A;  1RT5 A;  2IOC A;  1YTA A;  4CJU A;  1QSL A;  4E7H A;  1RDA A;  2VG5 A;  3VQ6 A;  5TKW A;  1KXP A;  1NKE A;  4CZG A;  3K5M A;  5C10 A;  1WSE A;  4CZH A;  4KHW A;  3A2F A;  4LH5 A;  4N76 A;  3OYM A;  4IOX A;  4Z4F A;  5GIO A;  1SKR A;  4BQL A;  3O6W A;  3DOL A;  1HJR A;  5KQ8 A;  1QSS A;  5CR4 A;  1VAZ A;  1EKE A;  5AQG A;  4FL9 A;  1GLC G;  4CK2 A;  3ZET B;  2HHQ A;  1HNW K;  4CGJ A;  3RMA A;  2YI1 A;  4B9N A;  3F9M A;  3IKM A;  3BF3 A;  4FJM A;  3DRS A;  2NRW A;  1YUW A;  1EXQ A;  1KVA A;  1YT3 A;  5LMU K;  3THY A;  3M8R A;  3L2R A;  3HK2 A;  1VRU A;  4B9U A;  2A3Z A;  2HHT A;  3VEY A;  3C65 A;  4CD1 A;  3I33 A;  1NK5 A;  1LAV A;  4FWO A;  4F2S A;  3A5M C;  1X9W A;  1KQS M;  4DV2 K;  4A57 A;  3OS1 A;  3MN5 A;  3S9H A;  3UKU B;  4H5W A;  1HRH A;  1QVG M;  3PX6 A;  3UIQ A;  3SNN A;  3LAN A;  4BRA A;  3CC4 N;  1IG8 A;  4IO9 L;  3V81 A;  3ZT2 A;  4DTP A;  1T05 A;  1RTD A;  2B5J A;  4NXN K;  3QIO A;  2VG6 A;  3MX2 A;  1U4B A;  2NUB A;  3TAG A;  3RSE B;  3BEX A;  4ZTJ A;  2A5X A;  3MCA B;  3SUO A;  1KLN A;  1RBT A;  1A5W A;  1YJ9 N;  2KZZ A;  3PSF A;  4QOZ B;  1VSH A;  3NAE A;  4LC9 B;  4H0T B;  3SUN A;  1NK6 A;  2YHA A;  4KH4 A;  3VET A;  5AQI A;  2D0A A;  4JKG A;  4YOU A;  4YOR A;  2OZM A;  4BAC A;  3OYD A;  4Z4H A;  1KD1 O;  1KSP A;  4F4K A;  3ZLJ A;  1LW0 A;  1CXU A;  2O8F A;  4WE1 A;  4JRQ A;  4M41 A;  2G8K A;  2P9P B;  4CJP A;  4KHN A;  1Y97 A;  3CCU N;  3WT0 A;  3VGK A;  1IBK K;  4NCG A;  3VQC A;  1Q82 O;  5KPZ A;  3NF9 A;  1EO1 A;  3TTC A;  4BRP A;  2HHX A;  4FLV A;  3VEZ A;  3O9T A;  1VQ9 N;  4FPB A;  3TAN A;  2A6A A;  1XUP O;  3DXM A;  3GL1 A;  3EZ5 A;  3KWG A;  3WEE A;  3LP2 A;  3N4Q A;  5J2M A;  1IKX A;  4YDU A;  2GWJ A;  1NK8 A;  3HOS A;  1RIL A;  3GOI A;  4RW4 A;  4X62 K;  3PX4 A;  3MN6 A;  4NCB A;  3CM6 A;  3CM5 A;  2X6N A;  3LAK A;  1SAZ A;  2WON A;  4DLE A;  3K9K A;  3THW A;  4DR7 K;  3K57 A;  1TVR A;  2VWK A;  1TK0 A;  4Y1D A;  4E1J A;  4NYN A;  1V4T A;  1Q8I A;  4JKF A;  2E4L A;  5JLH A;  1BIU A;  2A42 A;  3QDK A;  5AQW A;  4FW1 A;  3K2P A;  1I94 K;  3K5L A;  3RMD A;  4CZI A;  5M1K A;  1D8Y A;  3M6G A;  3MK6 A;  2O8D A;  5M1P A;  2G8W A;  3U3Y A;  1ZC6 A;  5AQO A;  4DFM A;  5BR9 A;  5BR8 K;  4JKB A;  3EYZ A;  4CFD A;  1T3V A;  3CF5 L;  2WFB A;  3O3H A;  1HX1 A;  4FZX C;  1NGH A;  1C1A A;  4YNQ A;  2VYP A;  4E7J A;  4CEO A;  3MN9 A;  3LL3 A;  3TAF A;  5HRO A;  3H46 O;  3O3F A;  3QNN A;  2GX9 A;  3R1X A;  2RE2 A;  4Z0U A;  3J81 O;  3SK3 A;  3ZEU A;  2FBX A;  5I9E B;  1MWM A;  3ZSY A;  4EZ9 A;  5AQR A;  4HTL A;  5J2Q A;  1SUQ A;  4FZY A;  1OH6 A;  4FSV A;  2P9S A;  4BRD A;  4O0J A;  4JKD A;  3V1R A;  5F2R A;  4FW2 A;  4JD2 A;  4FJH A;  1N32 K;  4GY2 B;  4RW8 A;  3C94 A;  4H8K A;  5M1Q A;  1CLQ A;  3VTI A;  4ISG A;  1LV5 A;  1LWC A;  4BRG A;  3KK7 A;  3WNG A;  3AVA A;  1NGC A;  1TUU A;  3Q7B A;  5GIN A;  1YHQ N;  1S6P A;  4JKE A;  5BN8 A;  3TSQ A;  4CHN A;  2IGI A;  3MEE A;  4CJ7 A;  3I0R A;  3P1G A;  4CE9 A;  1NJW A;  3PX0 A;  5GAH P;  4NO7 A;  1GLB G;  4CHO A;  1BGX T;  3F9K A;  4KH6 A;  1BI4 B;  1FW6 A;  4BRO A;  1K8K B;  4DU1 A;  4BR0 A;  3VQB A;  4XIU A;  1N5Y A;  2O8E A;  2KZM A;  4BRE A;  3CCJ N;  1N6Q A;  5CE3 A;  2ZE2 A;  2FBV A;  4BRI A;  1JLF A;  2V7Z A;  1UA0 A;  5F0X A;  3VQ4 A;  2E6L A;  1QQC A;  1YF5 L;  2PAV A;  4IG3 A;  4LFC K;  5AR0 A;  4DG1 A;  3AO3 A;  2E8A A;  3TSU A;  4B3S K;  3NF6 A;  1X9S A;  5JVG L;  2P5O A;  4HVJ A;  1C6V A;  3M5R A;  4KHU A;  2ASO A;  2YV0 X;  1NKB A;  1IH7 A;  1GLE G;  1NGA A;  3MAQ A;  1VQM N;  3SMP A;  5I3U A;  1JJ2 M;  4DMN A;  5GAG P;  1DKG D;  1TKT A;  1N8R O;  4FO0 A;  5AQZ A;  2QWR A;  3WQU A;  2IC3 A;  3AO1 A;  1VSE A;  1RDB A;  5EU7 A;  3QFP A;  4ZTF A;  5MLC Q;  1ASV A;  4AF1 A;  1HKB A;  3VOV A;  1GLA G;  3JS6 A;  3ZSW A;  4ILJ A;  1MDU B;  4C8K A;  2XY8 A;  3BGR A;  2UXB K;  4O55 A;  2HHW A;  1JCE A;  4W5Q A;  4AHU A;  5KGX A;  4B3M K;  3ZT1 A;  4ELV A;  3A5L C;  2KQ2 A;  1NU0 A;  3MN7 A;  1YIJ N;  4LD0 A;  3OJS A;  4FK2 A;  1SL0 A;  4PQU A;  4ISF A;  2LSN A;  2OYQ A;  3TPQ A;  1JLQ A;  4BG8 A;  1NOY A;  2NRV A;  4GW6 A;  4CJW A;  5AFU H;  1VQK N;  3E1Y A;  5C2F A;  4BE2 A;  2QWP A;  2G8V A;  3WNE A;  2OPS A;  4G1Q A;  3CI5 A;  1HNV A;  1IKW A;  3OYN A;  4YOV A;  3E66 A;  4AHC A;  3KTQ A;  3ZYY X;  3OYA A;  1NM1 A;  1D4X A;  2HMI A;  3L8B A;  4WQ5 A;  4TSX A;  4CZJ A;  2V51 B;  4DV3 K;  4ID5 A;  2GBZ A;  2QA4 N;  4OO1 J;  5E84 A;  4PKG A;  1E4F T;  1J53 A;  4YOW A;  4JS4 A;  3VF2 A;  3T1H K;  4B9S A;  4F9O A;  3CME N;  4I7F A;  2QTD A;  3VQP A;  5AQJ A;  1X3M A;  4CEQ A;  3ENO A;  4OJR A;  3DXK A;  4FJ5 A;  4H0P A;  1RTJ A;  5JS1 A;  4AM7 A;  4O5F A;  2IDO A;  3RWU A;  4NYF A;  3V9Z A;  1KLM A;  4BC4 A;  2QK9 A;  1BA1 A;  4FOE A;  2BH1 A;  1VQN N;  1O13 A;  1DT9 A;  1VSK A;  5JMV A;  4DFP A;  4JHD A;  2PBD A;  1J6Z A;  2I7P A;  3QLH A;  5DK5 A;  4IDK A;  1U47 A;  3LWL A;  3TR8 A;  3KLE A;  4FK0 A;  1TK8 A;  2E1Z A;  4AHR A;  2HVH A;  2CH6 A;  4CBU A;  3HPG A;  4CJ3 A;  3L0Q A;  4GKJ K;  2DFF A;  3H1V X;  4LF9 K;  4N47 A;  3SZ2 A;  1NMD A;  5C15 A;  2VGM A;  2HND A;  4JI4 K;  4CER A;  3E9O A;  3SQ4 A;  4C23 A;  3MEC A;  2HBM A;  4XH1 A;  2UXD K;  3OYI A;  2BTF A;  3AVL A;  1IKV A;  1G99 A;  4CZL A;  4FWP A;  4BRC A;  2UUC K;  4JI0 K;  5DM7 L;  4JI3 K;  3S3N A;  3OVN A;  2VQE K;  4KPY A;  3MDQ A;  2ITM A;  4DSJ A;  3DLG A;  3HPO A;  4GV6 A;  4E1M A;  4PKH A;  1ITG A;  1ATS A;  2EHG A;  4CED A;  4DU3 A;  2OPP A;  4A5A A;  3VQE A;  3OS2 A;  3V4I A;  1RT7 A;  3H1Q A;  3NCI A;  1W2B M;  3OYC A;  4JK9 A;  4BRK A;  2B6A A;  4U67 L;  4FJJ A;  2XY6 A;  1QQO A;  2Q2R A;  4DHY A;  2UXC K;  2P9L A;  3TU5 A;  1BDG A;  4ICL A;  4CW7 B;  3ATU A;  1HNX K;  2O4G A;  3T7Z A;  4YOY A;  5C25 A;  3DLB A;  4FWL A;  1RBU A;  1R0A A;  5KI6 A;  1OKJ A;  1HYZ A;  1HQE A;  3CJ9 A;  2Q1N A;  3LP0 A;  3H3N O;  4YHH K;  3V9W A;  1VSM A;  3P83 D;  4CHY A;  4K8X A;  1WSJ A;  1YJW N;  4JI7 K;  1XNR K;  3PY8 A;  3M8P A;  1MA9 B;  5M1F A;  3SAG A;  3L2W A;  2P9K B;  3R3L A;  2P9N B;  3RVC A;  1S9E A;  1QSY A;  1HUX A;  5HL7 L;  2A41 A;  2V7Y A;  3CCV N;  1S5J A;  4FJL A;  4OPJ A;  4FWR A;  1E4G T;  4LSN A;  1C0U A;  1YVU A;  4QS7 A;  3G6E N;  1BQM A;  2YJF A;  2ZQB A;  3CJ1 A;  3FZM A;  1N36 K;  1XMQ K;  4C8O A;  2AP1 A;  4KRF A;  1TYQ B;  3KJV A;  2NZT A;  4RTF D;  3THX A;  1W9H A;  1FKO A;  2O8C A;  4M3X A;  3I55 N;  2F9W A;  4AHT A;  1X1P A;  4DU4 A;  1VQ5 N;  4K41 A;  2IAJ A;  4BE0 A;  4EZ6 A;  3MX5 A;  1ZBH A;  1NK0 A;  4DQI A;  3ASM A;  1D5A A;  5FPM A;  4J2B A;  4CF8 A;  1TGO A;  1W7A A;  2QKB A;  1RDU A;  4KTQ A;  1CXQ A;  4DUY K;  1WBB A;  1UA1 A;  3TAQ A;  3CCE N;  1EWQ A;  3ISN C;  1RDW X;  1K6Y A;  1I3A A;  4O8U A;  5I42 A;  3HI0 A;  2FSN A;  1VSI A;  2KFZ A;  2D5R A;  3NE6 A;  3DYA A;  3U9Z A;  3BZC A;  2W40 A;  3EO3 A;  4B3O A;  1RDC A;  4LSL A;  3RR8 A;  4RW6 A;  5CZ1 A;  3BY5 A;  1NK9 A;  4H4M A;  2O4I A;  2BUP A;  2FSK A;  4H5T A;  3KKR A;  1NG9 A;  2IVO A;  5FLX O;  1RT3 A;  3NBP A;  4DTU A;  2GUP A;  3J8A A;  2GWK A;  4AIL C;  1J54 A;  1RBV A;  2QW9 A;  4DSI A;  1RT2 A;  1VSD A;  1XHX A;  3ULE A;  3PO5 A;  1KFD A;  3DLR A;  1R59 O;  1YTU A;  3SUQ A;  4I2Q A;  1ZYQ A;  1HNI A;  1Z26 A;  3QIC A;  4I6M A;  1N33 K;  1U2V A;  4DTN A;  1FK9 A;  4KTZ A;  4Y1C A;  5EXW A;  3W0L A;  2RF2 A;  1IBM K;  3DJC A;  5TKY A;  3LPU A;  5GAE P;  3MEG A;  4JKG B;  3TTD A;  3SQ2 A;  4IXC A;  4CF2 A;  1OVY A;  3QIN A;  2O8F B;  4BRF A;  2HHH K;  1QE1 A;  3ID6 A;  4CJV A;  1ASU A;  4C8L A;  5KGW A;  1G15 A;  1Q18 A;  2RKI A;  4FM2 A;  4BR2 A;  4GNI A;  4CJR A;  4JKC A;  4DR2 K;  3JYT A;  3AVG A;  3DRR A;  1REV A;  1TL3 A;  4R5P A;  2BE2 A;  5GAD P;  2ZWH A;  3AY9 A;  3IDH A;  5E26 A;  2A1S A;  3EN9 A;  2OA8 A;  5IT9 O;  1TV6 A;  1NK4 A;  3DXM B;  3WEE B;  3TSP A;  2UYT A;  3C95 A;  5KTQ A;  4B9T A;  2NRH A;  1S9G A;  1T44 A;  5FPN A;  1UWB A;  4CGI A;  2W6L A;  3ZSQ A;  2YX6 A;  4KV8 A;  3LWM A;  3THW B;  5AQF A;  1Q9Y A;  4BDZ A;  1LWE A;  1I39 A;  2E2P A;  2ZJP L;  4DQS A;  4H5R A;  4N56 A;  3OYG A;  5HRN A;  2FC0 A;  4HUG A;  4BE1 A;  4F2R A;  1QZ6 A;  4B9Q A;  3AVJ A;  2JLE A;  4FJ8 A;  1YI2 N;  1QZ5 A;  4PHT X;  3SPZ A;  3LP1 A;  4YOX A;  3EL2 A;  1NK7 A;  2O8D B;  3CQX A;  4OPK A;  4PWD A;  1EP4 A;  4IWV A;  1WBD A;  2IVN A;  2QWL A;  3HTV A;  4M3U A;  3O4W A;  3A5N C;  4JI6 K;  2QEX N;  3SV3 A;  1GLD G;  2WUS A;  4CJE A;  3I56 N;  3SPY A;  2BDP A;  3UE5 A;  3AVF A;  4CGH A;  2D0O A;  3HSC A;  3QEI A;  3ZEU B;  1VSL A;  2QI2 A;  4FXD A;  2VCP A;  4HWI A;  4XEI A;  3ZX0 A;  3D2E A;  3CC7 N;  3NVM A;  5CZ2 A;  3U6F A;  3RRH A;  1L3T A;  2P9S B;  4KAZ A;  3O4Q A;  4JD2 B;  4MQ3 A;  2HHV A;  2FF3 B;  1P8Z A;  4E89 A;  4H03 B;  1T6C A;  1B9F A;  3NMU A;  4NLC A;  1Q81 O;  3DLK A;  2I7N A;  2VWB A;  3ZX3 A;  4FLT A;  2P9U A;  5M1O A;  2XY5 A;  3M8Q A;  1N34 K;  5AJ3 K;  3ZSV A;  1DLO A;  1JLC A;  2OPR A;  1IJJ A;  4FVU A;  1NOZ A;  1HYS A;  4KHQ A;  4BR9 A;  3O4N A;  3QFU A;  2BAN A;  3MXM A;  3HOT A;  5E41 A;  2FBT A;  4IOC L;  2CGL A;  2BGG A;  1NMN A;  2NRR A;  4BRH A;  4ZHR A;  2YNG A;  4OLB A;  3UKR A;  5J2N A;  1D9F A;  4DUZ K;  2O8E B;  2KTQ A;  4B1W B;  4BR5 A;  2ZGY A;  1B9D A;  4HUE A;  3FZK A;  3ID8 A;  4DS5 A;  5AFU A;  4IEI A;  2HBK A;  5ELZ A;  4CF9 A;  3H3O B;  1P90 A;  5LY3 A;  2FF6 A;  3VGM A;  4O4G A;  2NRZ A;  4BGB A;  2QWO A;  2A40 A;  4E7K A;  3WXI A;  1NWK A;  3QML A;  5HBM A;  5BPM A;  3QEX A;  5BRE A;  4H0O A;  3OYH A;  1BQN A;  1WN7 A;  4BR4 A;  4JS5 A;  3VEN A;  1VHX A;  3AVN A;  5KRT A;  4J2D A;  1HNZ K;  4K0K K;  3MXI A;  3O1W A;  4E19 A;  3AA5 X;  3AO4 A;  3IS9 A;  3WNF A;  1CZA N;  5KRS A;  1KAZ A;  5AQY A;  1BL3 A;  4FOI A;  2ZF5 O;  3TAR A;  3VQ7 A;  3QER A;  5HP1 A;  4KRE A;  1UOC A;  2D4W A;  2HBJ A;  3HVR A;  4UY8 O;  5EY4 A;  2F4V K;  4ELT A;  3MED A;  4LFA K;  4EHU A;  3DWL A;  3C7N A;  2XHB A;  1NGE A;  3HBT A;  4B3R K;  1YJN N;  1VQ4 N;  2VGN A;  4BG9 A;  3RR7 A;  2KLA A;  3GG4 A;  1SS6 A;  3AA2 A;  3O5B A;  5FDL A;  4DQQ A;  3KWI A;  3ENB A;  4Y0W A;  4CEB A;  3BP8 A;  3LPT A;  4J2E A;  1WSF A;  4PKI A;  4BQZ A;  3TWH A;  2QKK A;  1HJO A;  3TAM A;  2GEL A;  1DTT A;  1HYV A;  2FBY A;  4WYB A;  4O0I A;  3NGY A;  3FFK B;  5DM6 L;  4LF6 K;  3CET A;  4DSL A;  4C1N K;  3BUZ B;  3K5N A;  3DXK B;  2I5J A;  2Q97 A;  3ZSR A;  4M7Y A;  1F21 A;  4AQY K;  2YNF A;  3DLE A;  4AHV A;  2CGJ A;  3CMA N;  3VER A;  4DQR A;  4YOT A;  4LF5 K;  5FPD A;  2D0P A;  2HST A;  4JHD B;  4BRM A;  3K5O A;  3A5O C;  1JLB A;  4FWM A;  5HOO A;  1SKS A;  4DSE A;  3LDQ A;  1GLJ O;  1NNE A;  1QQN A;  3V1O A;  4CJQ A;  4A59 A;  1VSJ A;  3C0B A;  3CXC M;  2Q36 A;  1J5E K;  1SZ2 A;  4EHT A;  1VRT A;  3G0Z A;  4Z4G A;  3M8S A;  2E2N A;  2E88 A;  1L3S A;  1M90 O;  4I9L A;  2QWM A;  3WXM B;  4K25 A;  4YFU A;  4DV7 K;  4U7B A;  1QHT A;  1GOC A;  1W97 L;  3ZSZ A;  5AQS A;  4I9Q A;  1HKC A;  3KK3 A;  3FR0 A;  2HNY A;  4JKA A;  3VQA A;  3L2U A;  1Z05 A;  5C2D A;  3K58 A;  3O9Q A;  3VA0 A;  1C1B A;  3AAR A;  3LDP A;  1KVC A;  3L4Q A;  4CZF A;  3VA3 A;  4FVM A;  3P4I A;  3TAP A;  1ILY A;  3O08 A;  3SBG A;  4O8K A;  1RCH A;  4DTJ A;  4OPH A;  1X9M A;  3R8E A;  4FLY A;  2HBL A;  2YNI A;  3E9P A;  1WNS A;  4BRL A;  3HP6 A;  2AA4 A;  3QNO A;  2OZS A;  3CYM A;  2G8F A;  1LW2 A;  2XRI A;  1HKG A;  3AVK A;  4KFB A;  4CZK A;  2P9L B;  3THV A;  5LJV A;  1BO5 O;  3SV4 A;  4UQG A;  3D2F A;  3VPZ A;  1ZBU A;  3E9L A;  2QWN A;  2UUB K;  1ZBF A;  3RTV A;  3L3U A;  4JYA K;  4OLA A;  4IOA L;  4HHT A;  1QTM A;  1LAW A;  4X65 K;  4DV1 K;  1WB9 A;  4OKE A;  2G8I A;  1XWL A;  1U6Z A;  3EE8 A;  3ZX2 A;  3I8B A;  1NGF A;  3F2K A;  1BCM A;  3D6R A;  4H0V B;  3J7Y P;  3CQY A;  5BRD A;  3T3F A;  3VEX A;  1QHA A;  5CYM A;  4FK4 A;  3IMX A;  1J9A A;  4KH5 A;  1BIZ A;  3KK2 A;  1L5U A;  5KPR A;  3GE1 A;  3U4L A;  5AQL A;  1NLV A;  3OYK A;  4PL8 A;  4EFH A;  4M3Z A;  3ITH A;  1WUA A;  4JAX A;  3THX B;  3SUP A;  3AVC A;  5JVH L;  4IJN A;  2G8U A;  2A1R A;  2ZGZ A;  4DV6 K;  4B9M A;  2O8C B;  3BZK A;  4R79 A;  3B6O A;  3P5J A;  2EWS A;  4DB3 A;  1HMV A;  4CEZ A;  3KLH A;  3ZCM A;  4ILH A;  3CFR A;  4DCH A;  2O8B A;  3OTO K;  4FYD A;  2FLO A;  4CJ4 A;  2UU9 K;  2YCH A;  3L3V A;  3AVH A;  4EAH D;  4KB1 A;  4MFB A;  1U04 A;  4IG0 A;  5C24 A;  4MDA A;  2KHO A;  2WC9 A;  4CF1 A;  1K8A O;  2Q31 A;  4FCY A;  3JAM O;  3VQD A;  3AAP A;  2HF4 A;  2RPI A;  5EVZ A;  3CFP A;  3NF7 A;  3CPE A;  5LL6 Z;  4B9V A;  2E2O A;  3P38 A;  1BOT O;  1RFQ A;  2E1Y A;  5AQK A;  4Z4E A;  4PUO A;  5EOY A;  4WCE L;  4FJI A;  3AGR A;  4A61 A;  4Q5V A;  2VWJ A;  4DV0 K;  1Q9X A;  1QVF M;  4RW7 A;  3PO4 A;  3CC2 N;  2NRX A;  1KAX A;  1S1V A;  3WXJ A;  3ZT3 A;  5FPE A;  4CHP A;  3J7A P;  1RT1 A;  3OYF A;  2QXF A;  2YHW A;  3K0S A;  3NHG A;  4BR7 A;  5AQQ A;  3ULE B;  4MO5 A;  1KTQ A;  4HCC A;  4DTM A;  1BCO A;  5HLF A;  2E20 A;  1Z25 A;  4I6M B;  4IKF A;  1U2V B;  4LF7 K;  5ADX H;  4WF9 L;  3B6P A;  3OYB A;  3LDS A;  3BF1 A;  4DLG A;  4N41 A;  4IJA A;  1C0T A;  2HNZ A;  1Q7Y O;  2PZS A;  1LCU A;  4FPA A;  1OH8 A;  3HP9 A;  3CQ8 A;  4KHY A;  3O9R A;  2ITG A;  4J2A A;  4Z94 A;  2FXU A;  3ENH A;  4KB0 A;  1MU2 A;  2YKN A;  2RHK A;  3R9P A;  2HHS A;  3FE1 A;  4DSF A;  5LJW A;  3WXL A;  4OKK A;  4H4O A;  4FJ9 A;  1RGI A;  2IS3 A;  1B92 A;  4W5R A;  3HM9 A;  1VQ7 N;  1O1W A;  4C1N I;  1WAJ A;  4CJK A;  2HB5 A;  1NGJ A;  4B1V A;  4BVO A;  3OW2 M;  1U48 A;  5K14 A;  4BC5 A;  3S3M A;  4L8R B;  4GV9 A;  2GEM A;  4BY9 C;  4FM1 A;  2HF3 A;  5J1E A;  3QES A;  4M7X A;  4YDU C;  3A0I X;  4MO4 A;  1ZXO A;  5C12 A;  4KHS A;  4BWM A;  3VEW A;  3U9D A;  4BGA A;  4K42 A;  4B3T K;  1S72 N;  2HOE A;  2F8T A;  2E6M A;  3DLL L;  2D0B A;  2PFU A;  1T7P A;  3DMJ A;  1TKX A;  3HST B;  3D45 A;  2OTL N;  2P9I A;  4Z4I A;  2XY7 A;  3H45 C;  1XC3 A;  3FZH A;  4CFB A;  2JWK A;  3CJA A;  3HJF A;  5AQX A;  3EY1 A;  5JIC A;  3G10 A;  4F8R A;  1TL1 A;  4JN4 A;  1NJY A;  3ZSO A;  1BHL A;  1IG9 A;  4DR3 K;  4FWS A;  3T19 A;  4FWN A;  3VTH A;  2X6S A;  2WBN A;  3P39 A;  3QO9 A;  3LDN A;  5AQM A;  4M63 C;  3CJB A;  3WNH A;  4FLX A;  3T1Y K;  3KK1 A;  2CH5 A;  3WXK A;  3LM9 A;  4CIF A;  3MXJ A;  3H08 A;  1KAY A;  5FRN A;  3LAM A;  4EIA A;  4CZE A;  5H1S Q;  3NH2 A;  3D2E B;  1XC9 A;  2KKZ A;  5FRO A;  1W0H A;  4GV3 A;  4CCH A;  5BRH A;  1T6D A;  4E0D A;  3SAF A;  5CHI A;  4OVL A;  3L4I A;  4C8N A;  3L2Q A;  4E3S A;  3FZL A;  5A2Q O;  4JI5 K;  4GKK K;  3QBX A;  4W5T A;  1WLJ A;  3CHW A;  4CIE A;  2V52 B;  3V9X A;  4OGE A;  2UUA K;  1ASW A;  1JL1 A;  3HYF A;  2P9U B;  1OVQ A;  3LAL A;  1NKC A;  4FJ7 A;  4XH5 A;  3WUH A;  3BDP A;  4CEF A;  1CZB A;  3M3Z A;  4JI2 K;  1HQU A;  4J8F A;  5J2P A;  4EP4 A;  3DAW A;  5AZJ A;  3NGZ A;  2ASM A;  3N4P A;  4M3Y A;  4OX9 K;  3OBW A;  1OH5 A;  3QET A;  3DOK A;  1JKH A;  3UKR B;  1ESV A;  2ZM6 K;  3G25 A;  2WOM A;  5AZI B;  3AO2 A;  2OCE A;  1VQ6 N;  4B1Z A;  3NVK A;  5B8H A;  3AVM A;  4BDP A;  4IFV A;  1VQP N;  1S3X A;  1U45 A;  4CD3 A;  1JXB A;  2F7T A;  3SYZ A;  4BC3 A;  3HZ6 A;  3MWP A;  4KI6 A;  1HLU A;  4DTR A;  1HR0 K;  1WSG A;  2B4J A;  2ZD1 A;  3VEV A;  3AO5 A;  3UB5 A;  3IRX A;  4W5O A;  2R7Y A;  1JCG A;  3ZET A;  5DMR A;  1S6Q A;  3Q7C A;  2XO7 A;  1GLL O;  2KW4 A;  2YHY A;  4JK8 A;  4CI6 A;  3KKS A;  1BU6 O;  1WSI A;  3L2V A;  4DTS A;  5AQU A;  2D0C A;  4FWQ A;  3LZI A;  1DTQ A;  4CEA A;  3CFO A;  3VEO A;  1TAQ A;  4CEE A;  3TTF A;  4M42 A;  3ALY A;  2E2Q A;  5SWM A;  3O80 A;  3O8M A;  3V9U A;  3VQ8 A;  4H5N A;  4OPA A;  4JNE A;  3UKU A;  3C6U A;  5GIP A;  2W41 A;  2Y1I A;  1CZ9 A;  1RDD A;  3VQ5 A;  2EX3 A;  2JGU A;  2RN2 A;  2VG7 A;  4NLB A;  4BRQ A;  3MCP A;  1BUP A;  3C7N B;  2QWQ A;  4G9Z A;  5AZI A;  4E7L A;  4IDH A;  3T1A A;  2P51 A;  3CJ7 A;  3RSE A;  5T7B A;  1KC8 O;  4CGG A;  4FLW A;  1RBS A;  4K43 A;  3MWT A;  1M1K O;  1EQY A;  5HRS A;  3SJH A;  3SCX A;  5KQD A;  4CZM A;  5F1X A;  3OJU A;  3QEW A;  5BPL A;  4A2B A;  5C42 A;  5KPT A;  4KKO A;  4CGF A;  1EX4 A;  3SAH A;  3PV8 A;  4WQ5 C;  1IO2 A;  2W42 A;  1IKY A;  2P9P A;  4JRP A;  3SI6 A;  3OY9 A;  4KTW A;  5IWA K;  1NJX A;  4MLH A;  3K59 A;  3C6H A;  1SL1 A;  4B1U B;  4DR5 K;  1FJG K;  1A5X A;  4RW9 A;  1RNH A;  2Z1J A;  4KBO A;  4BRN A;  3EE9 A;  1QQM A;  1BA0 A;  4QAG A;  4O5B A;  4H0Y B;  4B8A B;  3CJC A;  4B9L A;  4NB4 A;  4CK3 A;  3KD1 E;  5BPN A;  3LDL A;  4DFJ A;  2G8H A;  4BWJ A;  5JLF A;  4W5N A;  3OA9 A;  4F3O A;  1BWF O;  5CY4 A;  3O9S A;  2NRT A;  3KVG A;  3T69 A;  4FJX A;  2HW3 A;  4XH4 A;  2ZJR L;  3OYJ A;  1NGG A;  3VES A;  1NGB A;  3P31 A;  1KCF A;  1RT4 A;  2ETJ A;  3FFI A;  3IUC A;  4B1X B;  4AH9 A;  5LMN K;  1XMO K;  3IFR A;  1KVB A;  1ZBS A;  2PYJ A;  3QBW A;  1X9J A;  1JLG A;  3DRP A;  5CYQ A;  3EZW A;  1ATN A;  4CBX A;  1EWR A;  2D1K A;  4ID1 A;  1XI1 A;  4CF0 A;  4H5V A;  4JLH A;  5BN9 A;  3TI0 A;  4IO8 A;  4A5B A;  3RMC A;  4RWT A;  1KFS A;  3NDK A;  1SV5 A;  3VGL A;  1TKD A;  4IBN A;  3IG1 A;  1HPZ A;  2CGK A;  1GOA A;  1SKW A;  5FRM A;  5EX5 A;  2QM1 A;  4WFA L;  4CJT A;  1YAG A;  3DM2 A;  3SLC A;  2Q3S A;  4RCH A;  4WQ4 C;  1WOQ A;  4AM6 A;  4M3R A;  4ILG B;  2VQF K;  4V19 S;  3MMV A;  4Z4C A;  3CCQ N;  1NJZ A;  3S41 A;  1UAX A;  1RT6 A;  3ZT4 A;  4Q0B A;  2YNH A;  4QCL A;  1C0G A;  1L3U A;  2ATQ A;  3ATV A;  1JLA A;  3D2F B;  3NFA A;  3D7E O;  2WTU A;  3LDO A;  2GTD A;  2DTU A;  4CFA A;  1FXX A;  3NGI A;  3CER A;  4DR4 K;  3AVB A;  2J4R A;  3HVT A;  3SQ1 A;  1LOT B;  3O3G A;  4LF4 K;  3AV9 A;  3AAQ A;  4CES A;  1WSH A;  4E1N A;  4CIG A;  4O44 A;  4JV5 K;  1C0M A;  3RRG A;  4I2P A;  3OYL A;  2ZJQ L;  3CPW M;  2YHX A;  3L6Q A;  3GDQ A;  1ZBL A;  4DSK A;  4CBW A;  1BI4 A;  4A2A A;  3O1B A;  4BDY A;  1OH7 A;  1S1U A;  5BRF A;  1VQL N;  1K8K A;  4PA1 A;  3V6D A;  5JS2 A;  5HRP A;  3HRG A;  4YY3 K;  1VSF A;  1C0F A;  4M45 A;  4L3Q A;  4KO0 A;  3NF8 A;  3CCS N;  1NGD A;  5ADX A;  3LP3 A;  4DQP A;  4JEP A;  3B8A X;  4E7I A;  2O8B B;  4GVM A;  4NXM K;  4CFC A;  1XNQ K;  4HTU A;  3OYE A;  2YJE A;  1K73 O;  4CJL A;  4MDB A;  4EP5 A;  3LZJ A;  3KHY A;  5D3G A;  2DFE A;  2DY4 A;  5M1N A;  3W3D A;  3M1F A;  4CGD A;  2AJQ A;  3F73 A;  2HMP A;  4DF8 A;  3R6M A;  1RTH A;  3GBT A;  2Y1J A;  2F9T A;  3I8D A;  1GOB A;  4CHZ A;  1GLF O;  4FJK A;  3QEV A;  2Z1I A;  1DGK N;  2HHU A;  4JI8 K;  3J7Z O;  3NH1 A;  3SJJ A;  3HM8 A;  4DWI A;  4HCB A;  4F3T A;  4DR6 K;  4BC2 A;  3RMB A;  4ISE A;  2QXL A;  3KLI A;  4FM0 A;  3HL8 A;  2PY5 A;  3CCR N;  1S22 A;  4CVN E;  3C6T A;  3WQT A;  3PIO L;  4JI1 K;  4RG8 A;  4GVE A;  4OKJ A;  4IZ9 A;  3VF4 A;  3AA4 A;  3SBT A;  3PIP L;  1BIS A;  1TUY A;  5AQN A;  4FLZ A;  4CJF A;  2OAN A;  3VQ9 A;  4DFK A;  1FKP A;  3VF6 A;  4LY7 A;  1K9M O;  5C0Y A;  3EKU A;  2P5G A;  3CCL N;  3ZT0 A;  1TKZ A;  3KIO A;  3J80 O;  4ELU A;  1EET A;  1S1X A;  4WFB L;  1C1C A;  2Q0U A;  4PY5 A;  4DR1 K;  3FGU A;  3HO1 A;  4WFN L;  1XHZ A;  4LF8 K;  3PLA A;  2H3G X;  2DFH A;  4WQ4 A;  1T03 A;  4GMJ B;  2HVI A;  2IIR A;  1IV0 A;  2IVP A;  4CJS A;  3AVI A;  1WAF A;  3QEP A;  2X78 A;  1RBR A;  3CD6 N;  4LFB K;  2GV9 A;  4JK7 A;  4MLE A;  1YVN A;  3JXU A;  3ZSX A;  3CIP A;  2F96 A;  3FLC O;  3SMS A;  4B1Y B;  4FZZ A;  4AHS A;  3KLF A;  1VQ8 N;  1E3M A;  2Z1H A;  3EKS A;  3PUF A;  3G4S N;  4M3T A;  4CK1 A;  2P1J A;  1NGI A;  1SQK A;  1X3N A;  4FWK A;  3V1Q A;  3HXM A;  4LH4 A;  2ASP A;  2PYL A;  4FJG A;  4QS8 A;  4N5S A;  2F8S A;  3OBY A;  3HPH A;  4HUF A;  5SZT A;  1L3V A;  4QS9 A;  2OPQ A;  4CJ5 A;  2KFN A;  4CEC A;  3ULD A;  3OHR A;  2X74 A;  4X66 K;  1BG3 A;  4BVP A;  3SQ0 A;  2NNW A;  2YHB A;  4CHQ A;  3CCM N;  1SL2 A;  3DLH A;  1LWF A;  3DI6 A;  1JL2 A;  2P9I B;  3JSM A;  1J5O A;  1JLE A;  4K8Z A;  3V9S A;  4X64 K;  3VMF B;  3FZF A;  1RTI A;  3F5T A;  1DEJ A;  4DV4 K;  5HRR A;  2Z1G A;  1HPM A;  1NJI O;  3PSI A;  3HT3 A;  2Q0R A; 
#chains in the Genus database with same CATH homology
 3NGZ A;  5KRS A;  4I7F A;  3VQP A;  4DF4 A;  3S3O A;  4CEQ A;  4M3Y A;  1BL3 A;  4OJR A;  4FJ5 A;  3QET A;  1RTJ A;  3DOK A;  5JS1 A;  2OZS A;  3CG7 A;  2IDO A;  2YKM A;  1U49 A;  3RWU A;  4NYF A;  1JKH A;  4FLU A;  3V9Z A;  3VQ7 A;  3QER A;  1KLM A;  5HP1 A;  3TAR A;  2QK9 A;  4KRE A;  1UOC A;  2WOM A;  3D0P A;  1KRP A;  1VSK A;  3AO2 A;  4IFY A;  3HVR A;  1ZBI A;  3E01 A;  3NH0 A;  4DFP A;  4ELT A;  3QLH A;  3AVM A;  4IDK A;  5DK5 A;  1U47 A;  3KD5 E;  1T8E A;  3MED A;  2GUI A;  3I0S A;  4IFV A;  3LWL A;  4BDP A;  3TR8 A;  1TK5 A;  3KLE A;  1U45 A;  4FK0 A;  1TK8 A;  2XHB A;  3KLG A;  1JXB A;  3SYZ A;  4AHR A;  4M3W A;  2HVH A;  1S1T A;  4C8M A;  4NCA A;  4KI4 A;  4KI6 A;  3HPG A;  4CJ3 A;  4DTR A;  1WSG A;  3U6F A;  4B08 A;  3RR7 A;  2B4J A;  2ZD1 A;  3AA2 A;  3AO5 A;  2DFF A;  5FDL A;  3OS0 A;  3AA3 A;  4DQQ A;  1VK0 A;  3IRX A;  4W5O A;  2R7Y A;  4N47 A;  3SZ2 A;  3QIP A;  4DS4 A;  2HND A;  5DMR A;  4CEB A;  1S6Q A;  4CER A;  2XO7 A;  3SQ4 A;  3LPT A;  4J2E A;  1WSF A;  3TWH A;  1D9D A;  2QKK A;  2KW4 A;  3MEC A;  3TAM A;  1DTT A;  3KKS A;  3VN5 A;  3OYI A;  3TAE A;  3AVL A;  3TAB A;  1HYV A;  1IKV A;  2FBY A;  4DTX A;  4O0I A;  3NGY A;  1WSI A;  3L2V A;  4DTS A;  2D0C A;  4DSL A;  3LZI A;  1DTQ A;  4B8C A;  4CEA A;  3K5N A;  3CFO A;  3OVN A;  3S3N A;  2I5J A;  1TAQ A;  1JXE A;  1QS4 A;  4CEE A;  3ZSR A;  4KPY A;  4M42 A;  1A5V A;  3ALY A;  1F21 A;  3IAY A;  4DSJ A;  2YNF A;  3DLG A;  3DLE A;  4AHV A;  3VQQ A;  5SWM A;  3HPO A;  4E1M A;  1ITG A;  2EHG A;  4CED A;  4DU3 A;  4OGC A;  1S1W A;  2OPP A;  3VQ8 A;  3V9U A;  3U3G A;  4DTO A;  4FJN A;  3C6U A;  3VQE A;  4DQR A;  1TAU A;  1RT5 A;  2IOC A;  1RT7 A;  1YTA A;  3OS2 A;  4CJU A;  3V4I A;  1QSL A;  3NCI A;  4E7H A;  1RDA A;  3OYC A;  2VG5 A;  1CZ9 A;  1RDD A;  3VQ6 A;  3VQ5 A;  2Y1I A;  2B6A A;  2EX3 A;  1NKE A;  3K5O A;  2XY6 A;  4FJJ A;  3K5M A;  2JGU A;  1JLB A;  1WSE A;  2RN2 A;  1SKS A;  1RTD A;  4DSE A;  2VG7 A;  4KHW A;  3A2F A;  4ICL A;  3V1O A;  4CJQ A;  4LH5 A;  4N76 A;  3OYM A;  1VSJ A;  4E7L A;  2O4G A;  3T1A A;  2P51 A;  5T7B A;  4Z4F A;  1SKR A;  4CGG A;  5C25 A;  3DLB A;  4FLW A;  1RBS A;  1RBU A;  1HJR A;  3DOL A;  5KI6 A;  1R0A A;  1QSS A;  1HYZ A;  1VRT A;  5HRS A;  3G0Z A;  1HQE A;  3M8S A;  1L3S A;  1EKE A;  4Z4G A;  4I9L A;  3SCX A;  4CK2 A;  3LP0 A;  3V9W A;  3OJU A;  4YFU A;  3QEW A;  2HHQ A;  1VSM A;  3P83 D;  5C42 A;  1QHT A;  1WSJ A;  4CHY A;  4K8X A;  3PY8 A;  4CGJ A;  1GOC A;  4KKO A;  4CGF A;  3RMA A;  3ZSZ A;  3M8P A;  3L2W A;  4B9N A;  1EX4 A;  4I9Q A;  3KK3 A;  4FJM A;  3DRS A;  1EXQ A;  1S9E A;  1KVA A;  1YT3 A;  2HNY A;  3VQA A;  3L2U A;  3PV8 A;  1QSY A;  3HK2 A;  1IO2 A;  3M8R A;  3L2R A;  2W42 A;  1IKY A;  1S5J A;  1VRU A;  4JRP A;  3OY9 A;  4OPJ A;  3SI6 A;  4FJL A;  4KTW A;  4LSN A;  3K58 A;  1NJX A;  4B9U A;  3VA0 A;  1C0U A;  1YVU A;  1C1B A;  3K59 A;  1SL1 A;  2HHT A;  1BQM A;  1NK5 A;  4W5N A;  1LAV A;  1KVC A;  2ZQB A;  1A5X A;  3VA3 A;  4RW9 A;  4F2S A;  1RNH A;  2Z1J A;  4FVM A;  3TAP A;  4C8O A;  1X9W A;  4KRF A;  3KJV A;  4QAG A;  4O5B A;  1RCH A;  3OS1 A;  4B8A B;  1W9H A;  4DTJ A;  3S9H A;  4B9L A;  1X9M A;  1HRH A;  4CK3 A;  3KD1 E;  3PX6 A;  3UIQ A;  4FLY A;  1FKO A;  3LAN A;  3SNN A;  2YNI A;  1WNS A;  1T05 A;  3HP6 A;  4M3X A;  3V81 A;  3QNO A;  4DFJ A;  3ZT2 A;  4AHT A;  3CYM A;  4BWJ A;  2B5J A;  1LW2 A;  4DTP A;  2XRI A;  1X1P A;  5CY4 A;  4DU4 A;  3AVK A;  4KFB A;  4F3O A;  2HW3 A;  4FJX A;  3THV A;  2IAJ A;  4BE0 A;  3OYJ A;  3QIO A;  4UQG A;  3SV4 A;  4EZ6 A;  1ZBH A;  1KCF A;  1RT4 A;  2ETJ A;  2VG6 A;  3FFI A;  1ZBU A;  2NUB A;  3ASM A;  4AH9 A;  3TAG A;  1U4B A;  4DQI A;  4ZTJ A;  1D5A A;  1KVB A;  3SUO A;  2PYJ A;  4J2B A;  1KLN A;  1RBT A;  1ZBF A;  3DRP A;  1A5W A;  1JLG A;  1TGO A;  3L3U A;  4CF8 A;  5CYQ A;  3RTV A;  2QKB A;  4OLA A;  2KZZ A;  4QOZ B;  1VSH A;  4KTQ A;  3NAE A;  1CXQ A;  4HHT A;  1QTM A;  4ID1 A;  1XI1 A;  1LAW A;  3SUN A;  1NK6 A;  2YHA A;  4CF0 A;  4OKE A;  1UA1 A;  2G8I A;  4JLH A;  2D0A A;  3TAQ A;  3ISN C;  1XWL A;  3TI0 A;  2OZM A;  4BAC A;  3OYD A;  4Z4H A;  1K6Y A;  1I3A A;  3RMC A;  5I42 A;  1KSP A;  4F4K A;  1KFS A;  1LW0 A;  1CXU A;  3NDK A;  4WE1 A;  1SV5 A;  4JRQ A;  4M41 A;  1BCM A;  1VSI A;  4CJP A;  2G8K A;  1Y97 A;  4KHN A;  2KFZ A;  2D5R A;  4IBN A;  3NE6 A;  3DYA A;  3IG1 A;  3T3F A;  1HPZ A;  1TKD A;  4NCG A;  5CYM A;  1GOA A;  3VQC A;  1RDC A;  1SKW A;  4FK4 A;  5FRM A;  3NF9 A;  1J9A A;  4B3O A;  1BIZ A;  4LSL A;  4CJT A;  3KK2 A;  1L5U A;  3RR8 A;  4RW6 A;  3DM2 A;  5CZ1 A;  2Q3S A;  1NK9 A;  3OYK A;  2HHX A;  4H4M A;  2O4I A;  4M3Z A;  4FLV A;  3ITH A;  3SUP A;  3KKR A;  4M3R A;  3AVC A;  1RT3 A;  3NBP A;  4DTU A;  2G8U A;  4Z4C A;  1NJZ A;  2A1R A;  4B9M A;  1UAX A;  1RT6 A;  3TAN A;  3ZT4 A;  4AIL C;  1J54 A;  1RBV A;  4Q0B A;  3B6O A;  3EZ5 A;  2YNH A;  3P5J A;  3LP2 A;  3HT3 A;  4QCL A;  1HMV A;  5J2M A;  1IKX A;  1L3U A;  4DSI A;  4CEZ A;  3KLH A;  1NK8 A;  1RT2 A;  3ZCM A;  2ATQ A;  1RIL A;  3CFR A;  4RW4 A;  1JLA A;  1VSD A;  3PX4 A;  1XHX A;  4NCB A;  3PO5 A;  4FYD A;  1KFD A;  3DLR A;  1YTU A;  3CM6 A;  3NFA A;  3CM5 A;  2X6N A;  4CJ4 A;  3SUQ A;  3LAK A;  4I2Q A;  2WON A;  3L3V A;  4DLE A;  1ZYQ A;  1HNI A;  1Z26 A;  3AVH A;  1FXX A;  4CFA A;  3NGI A;  2DTU A;  4KB1 A;  4MFB A;  1U04 A;  4IG0 A;  3K57 A;  2G8F A;  1TVR A;  2VWK A;  5C24 A;  1TK0 A;  4DTN A;  1FK9 A;  4KTZ A;  3AVB A;  4Y1C A;  3HVT A;  3SQ1 A;  4CF1 A;  3O3G A;  4Y1D A;  2RF2 A;  4NYN A;  3LPU A;  1Q8I A;  3AV9 A;  2E4L A;  4FCY A;  1BIU A;  4CES A;  1WSH A;  3MEG A;  2G8H A;  3VQD A;  4E1N A;  2RPI A;  4FW1 A;  4CIG A;  3SQ2 A;  3K2P A;  4O44 A;  4CF2 A;  3K5L A;  3RMD A;  1C0M A;  1D8Y A;  3CFP A;  3RRG A;  4I2P A;  3OYL A;  3QIN A;  3NF7 A;  2G8W A;  3U3Y A;  4DFM A;  1QE1 A;  4B9V A;  4CJV A;  1ASU A;  4C8L A;  3EYZ A;  4CFD A;  5KGW A;  1G15 A;  1ZBL A;  4DSK A;  4Z4E A;  3O3H A;  1BI4 A;  4PUO A;  4BDY A;  2RKI A;  4FM2 A;  4FZX C;  1S1U A;  4FJI A;  1C1A A;  4Q5V A;  2VWJ A;  4PA1 A;  4CJR A;  3V6D A;  4YNQ A;  1Q9X A;  3JYT A;  3AVG A;  4RW7 A;  3PO4 A;  4E7J A;  3DRR A;  4CEO A;  1REV A;  1S1V A;  1TL3 A;  5JS2 A;  5HRP A;  3ZT3 A;  3TAF A;  5HRO A;  4R5P A;  2BE2 A;  4CHP A;  1RT1 A;  2A1S A;  3O3F A;  1VSF A;  3QNN A;  2OA8 A;  1TV6 A;  1NK4 A;  4Z0U A;  3OYF A;  4M45 A;  4KO0 A;  2FBX A;  3NF8 A;  2QXF A;  3ZSY A;  3C95 A;  4EZ9 A;  5KTQ A;  4B9T A;  3LP3 A;  1S9G A;  4DQP A;  5J2Q A;  1SUQ A;  3NHG A;  4FZY A;  1UWB A;  4E7I A;  4GVM A;  4CFC A;  4HTU A;  4CGI A;  3OYE A;  1KTQ A;  4O0J A;  4HCC A;  3V1R A;  4DTM A;  1BCO A;  4FW2 A;  3ZSQ A;  4FJH A;  5HLF A;  4CJL A;  4EP5 A;  1Z25 A;  4KV8 A;  3LZJ A;  4RW8 A;  3C94 A;  4H8K A;  3LWM A;  4IKF A;  1Q9Y A;  1CLQ A;  5D3G A;  2DFE A;  4BDZ A;  1LWE A;  1I39 A;  4DQS A;  1LV5 A;  3B6P A;  3OYB A;  1LWC A;  3LDS A;  4N56 A;  3OYG A;  2DY4 A;  5HRN A;  4DLG A;  4N41 A;  2FC0 A;  4CGD A;  3WNG A;  4HUG A;  3AVA A;  2AJQ A;  4BE1 A;  4F2R A;  1C0T A;  2HNZ A;  3AVJ A;  2JLE A;  3F73 A;  4FJ8 A;  3SPZ A;  1S6P A;  2PZS A;  3LP1 A;  3HP9 A;  4DF8 A;  4CHN A;  2IGI A;  3MEE A;  1NK7 A;  1RTH A;  2Y1J A;  3I8D A;  3I0R A;  3CQ8 A;  3P1G A;  4CE9 A;  1GOB A;  4CHZ A;  4OPK A;  4PWD A;  4KHY A;  1EP4 A;  1NJW A;  3PX0 A;  4FJK A;  3QEV A;  2Z1I A;  2HHU A;  4CHO A;  3NH1 A;  2ITG A;  3SJJ A;  4J2A A;  1BGX T;  3F9K A;  4DWI A;  4M3U A;  1BI4 B;  4KB0 A;  1MU2 A;  4HCB A;  4F3T A;  2YKN A;  2HHS A;  4DSF A;  4DU1 A;  3SV3 A;  3RMB A;  3VQB A;  4XIU A;  4OKK A;  4CJE A;  3SPY A;  4H4O A;  3KLI A;  2BDP A;  4FJ9 A;  4FM0 A;  3HL8 A;  2PY5 A;  1N5Y A;  2IS3 A;  2KZM A;  3AVF A;  1B92 A;  4W5R A;  3HM9 A;  1N6Q A;  1O1W A;  4CJK A;  1WAJ A;  2HB5 A;  2ZE2 A;  3C6T A;  4CGH A;  2FBV A;  3QEI A;  1U48 A;  5K14 A;  3S3M A;  1JLF A;  1VSL A;  4L8R B;  4RG8 A;  4FXD A;  4OKJ A;  1UA0 A;  3AA4 A;  3VQ4 A;  2E6L A;  1BIS A;  1QQC A;  5CZ2 A;  4CJF A;  5J1E A;  4IG3 A;  4FLZ A;  4FM1 A;  3RRH A;  3QES A;  4DFK A;  3VQ9 A;  1L3T A;  1FKP A;  4DG1 A;  4LY7 A;  3AO3 A;  3O4Q A;  4KAZ A;  3NF6 A;  4BWM A;  4KHS A;  4MQ3 A;  2P5G A;  2HHV A;  1X9S A;  2F8T A;  2E6M A;  3ZT0 A;  2P5O A;  4HVJ A;  1C6V A;  4E89 A;  2YV0 X;  4KHU A;  1NKB A;  1IH7 A;  1B9F A;  1TKZ A;  3MAQ A;  2D0B A;  1T7P A;  3DMJ A;  1TKX A;  3KIO A;  3DLK A;  3HST B;  4ELU A;  1EET A;  1S1X A;  3D45 A;  1C1C A;  5I3U A;  4DMN A;  4PY5 A;  4FLT A;  2XY7 A;  1TKT A;  4Z4I A;  3HO1 A;  4CFB A;  2XY5 A;  3M8Q A;  1XHZ A;  2IC3 A;  3AO1 A;  2DFH A;  3HJF A;  1T03 A;  4GMJ B;  2HVI A;  1VSE A;  1RDB A;  3ZSV A;  1DLO A;  1JLC A;  3EY1 A;  3G10 A;  5EU7 A;  4CJS A;  4F8R A;  4ZTF A;  2OPR A;  3AVI A;  1ASV A;  1TL1 A;  1WAF A;  1NOZ A;  1HYS A;  3QEP A;  4KHQ A;  3O4N A;  1NJY A;  2BAN A;  3ZSO A;  2X78 A;  3MXM A;  1BHL A;  1IG9 A;  5E41 A;  1RBR A;  2FBT A;  3ZSW A;  3T19 A;  4C8K A;  2XY8 A;  3BGR A;  2HHW A;  4O55 A;  2GV9 A;  2BGG A;  2X6S A;  3ZSX A;  3QO9 A;  4ZHR A;  4W5Q A;  2YNG A;  4AHU A;  4JS4 A;  4OLB A;  5KGX A;  2F96 A;  3ZT1 A;  5J2N A;  1D9F A;  4ELV A;  4FZZ A;  2KTQ A;  4AHS A;  2KQ2 A;  3KLF A;  3WNH A;  4FLX A;  3KK1 A;  2Z1H A;  1B9D A;  3PUF A;  4HUE A;  4DS5 A;  4CIF A;  3MXJ A;  4FK2 A;  3H08 A;  4LD0 A;  3OJS A;  1SL0 A;  4M3T A;  4CK1 A;  4PQU A;  2LSN A;  2P1J A;  5FRN A;  3LAM A;  4CF9 A;  2OYQ A;  3NH2 A;  4O4G A;  1JLQ A;  3V1Q A;  1NOY A;  1XC9 A;  5FRO A;  1W0H A;  3HXM A;  4LH4 A;  4GW6 A;  2PYL A;  4E7K A;  4FJG A;  4N5S A;  2F8S A;  4CCH A;  3HPH A;  4CJW A;  4HUF A;  4E0D A;  5SZT A;  1L3V A;  5HBM A;  4OVL A;  4C8N A;  2OPQ A;  4CJ5 A;  3QEX A;  2KFN A;  4CEC A;  3ULD A;  3L2Q A;  4E3S A;  3OYH A;  1BQN A;  1WN7 A;  4W5T A;  2X74 A;  1WLJ A;  4BE2 A;  4CIE A;  3SQ0 A;  2G8V A;  3WNE A;  2YHB A;  2OPS A;  3V9X A;  1NK0 A;  4CHQ A;  4G1Q A;  5KRT A;  1HNV A;  3AVN A;  1IKW A;  4OGE A;  3OYN A;  4JS5 A;  1SL2 A;  1LWF A;  3DI6 A;  3DLH A;  1JL2 A;  3JSM A;  1ASW A;  1JL1 A;  4AHC A;  3HYF A;  1JLE A;  1J5O A;  3KTQ A;  4K8Z A;  3V9S A;  3LAL A;  1NKC A;  3OYA A;  4FJ7 A;  2HMI A;  1RTI A;  3L8B A;  3BDP A;  4CEF A;  4TSX A;  1CZB A;  3MXI A;  4J2D A;  4ID5 A;  5HRR A;  2Z1G A;  2GBZ A;  4E19 A;  1HQU A;  5J2P A;  4EP4 A;  3AA5 X;  3AO4 A;  1J53 A;  3IS9 A;  3WNF A;  4B9S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...