4CJVA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
153
structure length
149
Chain Sequence
SSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords INTEGRASE
total genus 55
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cjvA00
4CJ4A 3S3MA 2G8FA 4J2DA 3OYCA 3ZSRA 2HHQA 4CK2A 3DLRA 2BDPA 4FJGA 3LPUA 3HVRA 1EXQA 3DLGA 1FXXA 1GOCA 3I0SA 4R5PA 4NYNA 3LP2A 1L5UA 4KI6A 3QESA 3NCIA 1U45A 4OPJA 1XC9A 1YTUA 2ETJA 4OKKA 3VQEA 5HRSA 3KKSA 2FC0A 5CY4A 3OYIA 3HPOA 2HB5A 1S1XA 4RW6A 2OPQA 2D0CA 3M8QA 2P1JA 4HVJA 1VSHA 4CERA 1B92A 4Q5VA 3RWUA 4FYDA 5J2NA 3AA3A 2WONA 1D9FA 2GUIA 4CE9A 3OYGA 1TL3A 4FVMA 3DLHA 3AVNA 1VRTA 3D45A 3VQQA 4CEEA 4CJ3A 5HP1A 4YFUA 2YNHA 5J2MA 2IAJA 3FFIA 4CEDA 1X9MA 1JXBA 1REVA 4FK0A 1BIZA 1SKRA 1BGXT 1VSEA 4FJHA 3QEWA 3HJFA 3OYEA 4FZYA 2HHSA 1WLJA 4M41A 2HHWA 1X9SA 3OYFA 4ID1A 1L3UA 4KHQA 2P5OA 3ULDA 4DTOA 4IFVA 3M8PA 3HP9A 4E7KA 3OYNA 1D8YA 1DLOA 1HYZA 2X6NA 3HXMA 4ZTFA 1SKWA 3PX0A 3TAQA 3ZT3A 4OPKA 3K5NA 4FLYA 4DSFA 1UOCA 1F21A 1WAJA 1EKEA 1JLQA 1B9FA 3QERA 3NDKA 2VWJA 4CFAA 4I2QA 1NK9A 4DG1A 2IOCA 5T7BA 4PUOA 4CF9A 1DTTA 3D0PA 3PX6A 2AJQA 4KKOA 3AVHA 5FRMA 1S9GA 4E7LA 3CQ8A 1CXQA 4LSLA 1TKTA 3EY1A 3QO9A 3I8DA 4YNQA 4BACA 4M3RA 4W5RA 1NK5A 3P5JA 1VSKA 5J1EA 4WE1A 3PO4A 3U3GA 1ZBLA 2R7YA 3KLEA 3WNGA 3LWLA 3SUNA 2D0AA 3QNOA 3I0RA 5SZTA 2G8VA 4J2BA 3MXMA 1NKEA 3TAFA 4M3TA 3L2UA 4DU1A 4HCBA 3IG1A 4FJ9A 1TAUA 3RMAA 2KZZA 4IBNA 4CJSA 1S1UA 2QXFA 3WNFA 4FJIA 3RRGA 4M3UA 2XY8A 4FW1A 3DI6A 3T19A 4N76A 3SZ2A 3C6TA 1NJYA 4F8RA 3LAKA 4PWDA 3KD5E 4PQUA 1C1AA 2XRIA 1IG9A 3UIQA 4FJ8A 1C0UA 2B4JA 2ATQA 5DMRA 3NBPA 3DRRA 4DLGA 1ASUA 3SQ2A 1LWEA 1NK0A 3C6UA 1RTDA 2PY5A 2QK9A 4CF8A 1BIUA 3V9ZA 1KFSA 1HRHA 1X9WA 1WSGA 4B9NA 1ZBFA 3O4NA 4C8KA 1WNSA 4EP5A 2HHVA 4J2EA 1SV5A 1S1WA 4FZZA 1J53A 3OY9A 4CHOA 4DQRA 2DFHA 4F2SA 4FJ7A 4OLBA 1O1WA 5I42A 1A5XA 1L3VA 1BI4A 3AO3A 4CHPA 4CHQA 1NK8A 4L8RB 2DTUA 1RBTA 1QE1A 3QEPA 3OS0A 4B9UA 2IS3A 1VRUA 3TR8A 3K2PA 1RT6A 4OGEA 4Z4CA 3HL8A 4KTQA 4DFMA 3ZSZA 4O5BA 3NGZA 4DFKA 2KW4A 2A1SA 2YNGA 4CJVA 4FJLA 4Z4IA 1ZBHA 2X74A 4KFBA 3V6DA 4FLWA 4DTUA 3U3YA 1LWFA 4C8MA 4LH5A 3L2WA 1B9DA 3ZT1A 5JS2A 2XHBA 3HYFA 2VWKA 2GV9A 1NJZA 3DM2A 3G0ZA 1U47A 1EETA 4Z4EA 4Z4HA 1BHLA 2YKMA 1MU2A 4I7FA 5KGXA 1NKBA 3P1GA 2FBXA 3OJUA 2VG6A 4H8KA 1C0TA 4CGFA 4CF2A 5J2PA 4DSIA 4H4OA 3DOKA 4E0DA 4FLTA 3HO1A 4KREA 1TV6A 4H4MA 2KZMA 1TGOA 3LAMA 3T1AA 1HPZA 4Z0UA 1KVCA 3F9KA 4CK1A 4FLXA 3CG7A 1G15A 4CECA 4DTJA 1IKWA 4B3OA 1TK5A 1T7PA 4CF1A 4CK3A 3QEXA 1RBRA 1TKXA 3E01A 4CF0A 3TAGA 3L2QA 2BGGA 1IO2A 1NKCA 2QKBA 3OYAA 3SUQA 4AHCA 4DF8A 2HMIA 4OVLA 4BWMA 1JLGA 2HW3A 1QHTA 2P51A 2HNZA 3AO5A 1S1VA 1WSFA 2IGIA 4OJRA 1RT3A 4O44A 2Y1JA 2PYJA 2KTQA 1WSJA 4K8ZA 3P83D 4C8NA 1Z26A 4EZ9A 1LV5A 4CCHA 1VSDA 4CESA 1Y97A 4IFYA 2KFNA 4JLHA 4DTPA 2RPIA 4CIEA 1WSHA 3PUFA 1ZBUA 4CEZA 1J54A 1S9EA 1HYVA 3CM6A 3LP0A 4O55A 3T3FA 2F8TA 4CJPA 4W5QA 4J2AA 3DLBA 1XHXA 3V9UA 3RR7A 2Y1IA 3SQ0A 3TAPA 1RT7A 3KKRA 3MAQA 2DY4A 1LWCA 3KLIA 1FKPA 3QIOA 3OYLA 3SQ4A 3RMCA 2G8KA 1KRPA 5KRSA 1RTIA 5CZ1A 3DLEA 4CJKA 4FJMA 3AA4A 1NJXA 3NHGA 3O3FA 1WAFA 2P5GA 4ELTA 4AH9A 4KO0A 4DTRA 1HYSA 1XHZA 1NK4A 4N5SA 4IG0A 1JLFA 2ZE2A 2D5RA 1K6YA 1EP4A 3TAMA 1IKXA 4CJWA 1U04A 3M8SA 3NF6A 4QAGA 3NAEA 3ALYA 3KK1A 1IH7A 3KTQA 2Z1IA 3KLHA 3NF7A 1BQMA 1L3TA 1HMVA 3OS2A 4JS5A 1ZBIA 2RN2A 2FBVA 4DTNA 3MXJA 4OKEA 3SCXA 4DSLA 1HJRA 4HUFA 3VQCA 5C25A 4E7HA 1D5AA 3VQ5A 4DTXA 1UA1A 1LW2A 1YTAA 4CHNA 1JXEA 3OS1A 1KCFA 4OKJA 3VQ7A 3LZIA 1ITGA 2XY7A 1TK8A 4F4KA 3TANA 1C6VA 3TARA 4FJKA 1JLCA 1SL1A 1RT1A 1T8EA 2YNFA 2EHGA 1EX4A 4M45A 3MEGA 2G8UA 3KLGA 4BDYA 4FJJA 4MQ3A 1BCOA 4DU4A 1RT4A 1DTQA 3ISNC 2XO7A 5KI6A 4Z4GA 1QSSA 4F3TA 4CGGA 1WSEA 3H08A 4PY5A 3AA5X 4CEBA 5HRPA 1S6PA 2NUBA 4JRQA 1RT5A 4EP4A 3PY8A 4NCGA 3ZSQA 3ZT0A 1HQUA 3O3HA 3SI6A 4CEQA 3OYDA 1QQCA 3O3GA 4FCYA 3QETA 3ZSVA 4TSXA 2YHBA 1BCMA 3LP1A 3KJVA 4B8CA 3TWHA 2OYQA 3OVNA 4HCCA 4M3YA 3ZSYA 1HNIA 3B6PA 1J5OA 3OJSA 1U4BA 1U49A 3B6OA 4C8OA 3HT3A 3BDPA 2KQ2A 4N56A 4E7IA 3SPYA 3HPHA 1W0HA 1RDAA 1BL3A 2Z1GA 3HK2A 3MXIA 2W42A 4OLAA 3AVKA 1RNHA 4KAZA 1R0AA 3HP6A 4RW9A 3V1OA 2Q3SA 4CIGA 5J2QA 2OZMA 5EU7A 1KVBA 4G1QA 3JSMA 1NJWA 1NOZA 1S5JA 1KTQA 3IAYA 2HHXA 4ELUA 3CFOA 4ZHRA 4KHUA 4KHYA 1NK7A 4FK4A 1CXUA 1C1CA 3KK3A 1JKHA 3L3UA 4CEAA 2EX3A 2YKNA 3AO2A 3S9HA 4FM0A 4O0JA 3VQAA 2F8SA 4E3SA 1VSFA 4DQIA 4M3WA 3C94A 2X78A 4KHWA 2RF2A 3ITHA 3QINA 4CJUA 2A1RA 4CJFA 4I2PA 4B9VA 5K14A 4GMJB 3K58A 4CEFA 3THVA 2HVIA 4KTWA 1TK0A 3RTVA 1HQEA 4DWIA 1YVUA 3K59A 4FJXA 3AVJA 3S3NA 4CEOA 3NH1A 1ASWA 3AVMA 3OYJA 3K5MA 4HTUA 1RT2A 4BWJA 3ZSOA 2BE2A 3HSTB 3K57A 3VQ4A 3RMBA 3WNEA 3SNNA 5KGWA 4CJTA 3G10A 3K5LA 2HNYA 2PYLA 4KHSA 2O4IA 1HNVA 4DLEA 4GVMA 3LALA 3SV4A 1C1BA 4Y1CA 4EZ6A 4ELVA 4M42A 3V81A 4Y1DA 4JS4A 2GBZA 3QEIA 2IDOA 4OGCA 3VQ9A 4BE2A 1I3AA 4AHVA 2E6MA 5CYQA 4DF4A 1VSMA 3VN5A 3AO4A 3NH0A 2OZSA 3V1RA 3L3VA 3TI0A 4LH4A 1TKDA 4C8LA 4F3OA 2G8IA 1LAVA 1NK6A 1C0MA 3L8BA 1LAWA 4AHSA 1RCHA 2ZQBA 4XIUA 4W5TA 4LSNA 3NE6A 3QEVA 4Z4FA 3K5OA 5FRNA 4CHZA 3CFRA 1RTHA 1SUQA 1Z25A 3IS9A 3AVAA 4AHRA 3TAEA 4CGJA 2G8WA 4FXDA 4UQGA 4DQSA 4F2RA 3HVTA 2D0BA 4B8AB 1GOAA 3NH2A 3JYTA 4IKFA 3LWMA 3V1QA 4HUGA 1VSJA 1CZBA 1TL1A 4B08A 3VQBA 4QCLA 3AVGA 4DSJA 3NF9A 2F96A 5I3UA 3RRHA 4LD0A 1TVRA 1RDDA 3BGRA 1JLEA 1S6QA 1RDCA 1JLBA 3DMJA 3WNHA 4DSEA 2XY5A 3NF8A 3CFPA 3RR8A 1A5WA 5HBMA 3SYZA 1XWLA 4MFBA 2ZD1A 3MEEA 1JL1A 2RKIA 1GOBA 3CYMA 3MECA 4IG3A 3VQ8A 4CGIA 1FK9A 2OPSA 4RG8A 2QKKA 4NCAA 4DTSA 3QIPA 3QNNA 1D9DA 4KB0A 1Q8IA 4CJRA 3AA2A 1QSYA 3OYBA 2G8HA 4CGDA 4DFJA 3O4QA 3ASMA 3SUPA 4DU3A 4NYFA 5FROA 3AO1A 2E6LA 2FBYA 2B6AA 1RBSA 5KTQA 3U6FA 3S3OA 2ITGA 2VG7A 1UAXA 3OYHA 2KFZA 5C42A 4CJEA 1FKOA 1VK0A 3DOLA 4FLVA 1Q9YA 1KVAA 3KK2A 4DQQA 1KSPA 4KI4A 4CFBA 4O0IA 3DRPA 4FJNA 4CFDA 4NCBA 1VSLA 3AVFA 2E4LA 2OPPA 4M3XA 4B9SA 1RBVA 2B5JA 3KD1E 4DS5A 1BISA 3HM9A 1RDBA 3VQPA 5HLFA 4DMNA 2Z1HA 4I9QA 3V9WA 2LSNA 4E19A 1L3SA 3A2FA 1W9HA 3AVCA 4M3ZA 2X6SA 1JLAA 1QS4A 4CJLA 2HHUA 3KLFA 5D3GA 1KFDA 4ZTJA 4FM1A 1BI4B 1VSIA 2OA8A 3NGYA 4FZXC 1QSLA 1SL0A 3SJJA 3PO5A 2DFFA 1CZ9A 4BDZA 3L2VA 4BE1A 1CLQA 1SL2A 1BQNA 3NGIA 4Q0BA 4W5OA 2YV0X 2HNDA 1XI1A 4FJ5A 4LY7A 1TAQA 4B9MA 1X1PA 4FLZA 3LZJA 5FDLA 1S1TA 3QLHA 1YT3A 4KPYA 2YNIA 4RW7A 4CFCA 4DFPA 1IKVA 4N47A 4CHYA 1NOYA 2HHTA 4AHTA 4KV8A 3LP3A 5HRRA 4E1MA 1T03A 4RW4A 4KTZA 4DSKA 3SUOA 4E89A 4I9LA 3SQ1A 2YHAA 1N6QA 3ZT4A 4PA1A 4DTMA 1SKSA 4FM2A 1KLMA 4K8XA 4ICLA 1RILA 3F73A 2O4GA 1ASVA 3ZSXA 5HRNA 1KLNA 1RTJA 4AILC 5E41A 1UA0A 4FK2A 1WSIA 2DFEA 4KRFA 3C95A 3DRSA 3VQDA 4JRPA 3PX4A 3AVIA 2IC3A 3MEDA 3TABA 3M8RA 1QTMA 2JLEA 4E7JA 4CJQA 4W5NA 1LW0A 5HROA 4HHTA 3OYKA 3LDSA 3VA3A 4DS4A 1A5VA 3CM5A 1T05A 2PZSA 1TKZA 4CGHA 3VQ6A 1UWBA 3AVLA 5KRTA 3ZT2A 2BANA 4B9TA 3PV8A 3IRXA 3LPTA 1Q9XA 2HVHA 3OYMA 4FLUA 2JGUA 4O4GA 3EYZA 3V4IA 4QOZB 1I39A 4ID5A 4AHUA 1U48A 5DK5A 2XY6A 1WN7A 2Z1JA 3AVBA 3L2RA 4E1NA 3RMDA 1ZYQA 3ZCMA 3HPGA 2FBTA 2WOMA 4CIFA 4HUEA 3V9SA 3AV9A 3ZSWA 3V9XA 1J9AA 4RW8A 3KIOA 3NFAA 5CYMA 4BE0A 4BDPA 1N5YA 3EZ5A 2VG5A 4DQPA 2OPRA 4GW6A 3SV3A 4N41A 4FW2A 4KHNA 3VA0A 2I5JA 3DYAA 4IDKA 4KB1A 5CZ2A 4CJ5A 3SPZA 1JL2A 3DLKA 1IKYA 5C24A 5JS1A 5SWMA 4B9LA 3LANA 1RBUA
chains in the Genus database with same CATH superfamily
3FGUA 3S3MA 4C23A 5JMVA 3DLRA 3LPUA 3MWPA 3ZX2A 1JCEA 3CQXA 4OPJA 1HUXA 2V52B 3OYIA 4JKHA 4RW6A 2D0CA 5C0YA 3FLCO 3RVCA 5J2NA 2WONA 2GUIA 1TL3A 3DLHA 4PL7A 3AVNA 3D45A 5HP1A 5J2MA 4EFHA 4OPAA 3Q7BA 4BC4A 1REVA 3O9TA 2PBDA 4YORA 2HHSA 2HHWA 4M41A 5BN8A 3OYFA 4ID1A 4KHQA 4DTOA 4IFVA 4M63C 3OYNA 2X6NA 4DHYA 1SKWA 3T69A 3ZT3A 2P9UA 2ZJRL 2NNWA 3T1HK 4K42A 3A8YA 2VWJA 4IOCL 5T7BA 3PLAA 1DTTA 3OHRA 3D0PA 3PX6A 4YOYA 4K41A 1NGAA 4WQ4C 5AJ3K 1XMQK 4FJGA 4W5RA 3QMLA 3PIOL 1ZBLA 4CZHA 1S72N 4J2BA 3ZX0A 4JKAA 3L2UA 3CD6N 1TAUA 2ZM6K 2KZZA 2GUPA 3C7NA 4CJSA 1S1UA 3WNFA 2XY8A 4X65K 3T19A 1D4XA 4FWKA 5AQHA 3C6TA 1NJYA 3LAKA 3M6GA 3VGKA 2PAVA 3KD5E 4PQUA 1C1AA 4DLGA 3DRRA 1XMOK 1LWEA 1ATRA 2PY5A 2QK9A 1BIUA 3V9ZA 3O9QA 2VQFK 2HHVA 3VF4A 4JAXA 3R1XA 4GKKK 5I42A 4GV9A 3AO3A 4L8RB 4YOUA 4B9UA 3K2PA 3VEVA 4WCEL 4DFMA 3NGZA 5GAEP 4BRLA 3VEZA 2A1SA 2X74A 4KFBA 3VOVA 4FLWA 4DTUA 3ULEA 4CBUA 4CI6A 2Q1NA 2A41A 1B9DA 3HYFA 2VWKA 4Z4EA 1EETA 4A2BA 3P1GA 3CCEN 3IUCA 1C0TA 1LCUA 4BGAA 3DWLA 4E0DA 4XH5A 2NRVA 4UY8O 4KREA 2CGJA 1HPZA 4DV2K 3F9KA 3A5OC 1G15A 4CECA 1IKWA 3L6QA 5ADXA 4CF1A 3QEXA 3HI0A 1HKBA 1HX1A 4IJAA 3TAGA 2BGGA 4H5VA 3SUQA 3VGMA 4LF7K 4BRNA 2P51A 4O8UA 4C1NI 2KTQA 4FWNA 4C8NA 4BRIA 4JK9A 4CCHA 1VSDA 2W6LA 3F5TA 4JHDA 4DTPA 1NMNA 4CIEA 1WSHA 2QEXN 3L0QA 1ZBUA 4FWOA 4A5AA 1S9EA 3CCLN 3LP0A 3T3FA 2UXDK 1DGKN 4J2AA 2P9SA 3EN9A 1K73O 1RT7A 1N34K 2UYTA 4MDBA 1JCFA 4I6MB 4JEPA 1KRPA 4H0TB 3DLEA 3ATUA 3ID8A 3HOTA 2A40A 2QWLA 3MWTA 4N5SA 2D5RA 5BPLA 4FOEA 3BF1A 3KK1A 3KTQA 3VTIA 4PHTX 3OS2A 2FLOA 1HJRA 3VQCA 4B1VA 4FWMA 2RE2A 4KBOA 4F4KA 3OS1A 4OKJA 1TK8A 1GLDG 3DLLL 5KQDA 4PL8A 2FSKA 2YNFA 4IJNA 4J8FA 4FL9A 4NXNK 1EX4A 3D2FA 1S3XA 3KLGA 3OBYA 4BDYA 4FJJA 4CW7B 4DU4A 1RT4A 1DTQA 2XO7A 2P9KA 3H08A 4CD1A 4JRQA 3DAWA 3O6WA 3ZSQA 3D2EA 3SI6A 4YOTA 3O3GA 4TSXA 1VQ4N 4M3YA 4HCCA 3CPEA 1HNIA 3CJ7A 5B8HA 3OJSA 1U49A 3LDNA 4DR6K 5AQWA 4C8OA 3HT3A 4U7BA 3SPYA 1W0HA 5AQUA 1RDWX 2W42A 3THWB 1RNHA 4KAZA 2O8EB 2Q3SA 3JSMA 1KVBA 1U6ZA 1NOZA 2AP1A 4GV6A 4JI8K 1S22A 1C1CA 3L3UA 2EX3A 3C65A 1X9JA 4JI1K 3KK7A 3AO2A 3S9HA 5EXWA 2F8SA 4E3SA 5IWAK 3VETA 5HOOA 3THVA 4GKJK 3H6EA 2HVIA 3VENA 3RTVA 4GY2B 3K59A 3AVMA 1WOQA 2YI1A 2A6AA 3UKUA 4JKBA 3VQ4A 3WNEA 1WUAA 5KGWA 5DM6L 2PYLA 2HNYA 1HNVA 2E2NA 3J7YP 5I9EB 3LALA 1C1BA 2IDOA 5CHIA 3SMSA 4BE2A 1I3AA 1VSMA 3L3VA 4LH4A 5AZJB 4W5TA 1RCHA 4XIUA 3QEVA 4YDUC 3K5OA 3VPZA 2VCPA 3CFRA 1OH6A 1SZ2A 1Z25A 3TAEA 4FXDA 2O8EA 3JYTA 4B8AB 3NH2A 4NB4A 1TL1A 3MCPA 4QCLA 3AAQA 1VQ8N 4JYAK 1RDDA 1S6QA 3CFPA 3RR8A 3L4QA 3BUZB 3MEEA 4EZ9A 3CYMA 3VQ8A 1GOBA 4NCAA 4IG3A 4MO5A 3QIPA 2O8DA 3O4QA 5AQJA 1R59O 3SUPA 4GV3A 4NYFA 1ILYA 4WFNL 1Q7YO 2FBYA 2O8BB 5E26A 3U6FA 4AF1A 1NU0A 2ASPA 1VK0A 4FLVA 1KVAA 4KI4A 3CHWA 3J7AP 4JKGB 4KH4A 5MLCQ 4NCBA 3AVFA 4B9SA 2O8FB 1RFQA 2B5JA 3KD1E 2NRWA 2O8DB 4JI2K 3V9WA 3LM2A 1W9HA 4M3ZA 1JLAA 2HHUA 3PSIA 4FM1A 3WEEA 3LDPA 4QS9A 1YXQA 3L4IA 2DFFA 1SL2A 3NGIA 4Q0BA 2BH1A 3BZKA 1TAQA 1X1PA 1GLAG 1YT3A 3CC2N 2YNIA 4DFPA 3UKRA 4CHYA 4AHTA 4KV8A 5EOYA 3LP3A 5JLFA 5AR0A 3SQ1A 1DKGD 3ZT4A 5AQGA 1QVFM 2QWOA 4FM2A 3WXJA 4BY9C 2O4GA 3ZSXA 3C6HA 2Q97A 4L3QA 5HRNA 1RTJA 4AILC 1UA0A 4LF9K 1Q82O 4KRFA 3VQDA 2FSNA 4JRPA 4MDAA 4AQYK 3AVIA 1QZ6A 3MEDA 2Q0UA 4K25A 4E7JA 4CJQA 1LW0A 5HROA 3OYKA 2NRXA 1TKZA 4CGHA 3VQ6A 5KRTA 1DT9A 2D0OA 3IRXA 3SAGA 4QOZB 4AHUA 2UU9K 3FZLA 4B3MK 3AVBA 5CR4A 3EZWA 3MK6A 3OA9A 1HLUA 4FOIA 3NFAA 5CYMA 3CPWM 4BE0A 4DR5K 4FW2A 5M1NA 3DYAA 4KB1A 4OPHA 4CBXA 5C24A 3DJCA 3I8BA 5SWMA 1T3VA 5BRHA 1EO1A 1X3NA 1QQNA 3UE5A 4J2DA 3OYCA 4MO4A 4F9OA 1EXQA 1FXXA 3I0SA 4R5PA 4FPBA 3GOIA 3J81O 4KI6A 3G4SN 1XC9A 4H0OA 5HRSA 3KKSA 5AQLA 5AFUH 3ZETA 4DV4K 3M8QA 4FYDA 1VSHA 4CERA 1B92A 3BY5A 2I7PA 1D9FA 2VWBA 3QBXA 1VRTA 4CJ3A 2F9TA 4NLBA 2IAJA 1X9MA 1JXBA 5BRDA 1QQOA 4IO9L 4FZYA 1WLJA 1X9SA 2P5OA 3ULDA 3M8PA 3HP9A 3FZMA 2WC9A 2O8BA 4ZTFA 4BC2A 3PX0A 1MDUB 5JVGL 4DSFA 2P9LB 1KD1O 1UOCA 1F21A 1JLQA 1B9FA 3QERA 2V51B 1K8KB 3A5MC 4I2QA 3K9KA 4JI3K 4PUOA 3HBTA 3AVHA 4ISFA 5FRMA 1S9GA 2V7ZA 4E7LA 1OVQA 3VTHA 4LSLA 1TKTA 1NGIA 3QO9A 1Q18A 4M3RA 5J1EA 3IFRA 4JI5K 3SUNA 2D0AA 3O9SA 4DR2K 5BR9A 2P9NB 4BR7A 4FJ9A 1T6DA 4IBNA 3ZEUB 4FW1A 3UKRB 4N76A 4BR4A 3WXKA 4PWDA 4F8RA 3BEXA 4FJ8A 3HJFA 1C0UA 2B4JA 1HPMA 4LFAK 1ASUA 1RTDA 1IBMK 1HRHA 3MMVA 4C8KA 3WQUA 1SV5A 4CHOA 2OTLN 4DQRA 2DFHA 4F2SA 1A5XA 2I7NA 1BI4A 1NK8A 1RBTA 4ILHA 1QE1A 3OS0A 2IS3A 1VRUA 3W3DA 3HL8A 4O5BA 4CJVA 4FJLA 3ID6A 3V6DA 4BROA 3THXA 1LWFA 4C8MA 1VQNN 3ZT1A 5JS2A 5DM7L 4QS8A 1NJZA 3G0ZA 4Z4HA 3QBWA 1EWQA 1NKBA 2FBXA 4MLHA 2VG6A 5J2PA 4H4OA 3DOKA 3MN5A 4Z0UA 1GLBG 4B3OA 1T7PA 1RBRA 1TKXA 3L2QA 1P8ZA 4Z94A 3OYAA 4AHCA 2HMIA 2HW3A 4B1WB 1QHTA 3O9UA 1WSFA 4K8ZA 4DCHA 2IVOA 4IFYA 1E4FT 3PUFA 3EKUA 4BQZA 1H1VA 4O55A 3LM9A 1VHXA 4W5QA 4JHDB 2FXUA 3V9UA 3I56N 5KPZA 2DY4A 3KLIA 3RMCA 2G8KA 5KRSA 2AA4A 4FJMA 1ZC6A 1NJXA 1C0GA 3O3FA 4IG0A 1JLFA 2O8CB 4X62K 1K6YA 1EP4A 4DB3A 4A57A 4DV7K 3UKUB 1VQLN 1VQKN 1HMVA 2W40A 2NRRA 1Q86O 4DTNA 4DSLA 3EKSA 4OKEA 4HUFA 4E7HA 4XEIA 3CI5A 3THXB 2XY7A 4FK0A 4FJKA 1JLCA 3BZCA 2EHGA 4M45A 2V7YA 3MEGA 4IEIA 3QICA 4MQ3A 1BCOA 3VF6A 3P31A 1WSEA 5C2DA 5M1OA 1XUPO 1RT5A 4EP4A 4IOXA 3OTOK 3O3HA 3GG4A 4FWRA 4CEQA 4FCYA 1YITN 2YHBA 2P9UB 2OYQA 3TWHA 3I55N 3RSEA 5AZIA 2GTDA 1KXPA 1RDAA 3MXIA 1OVYA 4RW9A 3O8MA 4CIGA 2OZMA 1S5JA 3CC7N 4H5TA 4ELUA 3CFOA 4KHYA 4FK4A 3FE1A 1RGIA 5AZIB 3CXCM 3VQAA 4DQIA 4BGBA 4M3WA 2A1RA 5AQNA 4CJFA 4I2PA 4B9VA 4JD2B 1NMDA 3AVJA 3HTVA 3NH1A 3S3NA 1ASWA 3OYJA 3SLCA 4BWJA 1V4SA 3WEEB 2BE2A 5BR8K 5FPDA 3JXUA 3RMBA 2A42A 1QQMA 5LMUK 3FZFA 4BRAA 2A3ZA 4M42A 3V81A 1HKCA 4CZMA 3EO3A 3VQ9A 2E6MA 5CYQA 2OZSA 3VN5A 1IJJA 3P38A 3C7NB 3V1RA 1MWKA 3TI0A 1TKDA 4C8LA 1LAWA 4LSNA 4Z4FA 4CHZA 3KHYA 1N32K 4DV6K 5BN9A 1KAYA 1V4TA 4DQSA 4B3TK 4HUGA 1VQMN 3CETA 5H1SQ 4B08A 1HR0K 1VQ6N 4DSJA 3NF9A 2F96A 1M1KO 2ZJPL 3RRHA 1JLEA 1RDCA 2XY5A 3NF8A 4IFEA 4H0XB 4MFBA 2PFUA 5KTQA 4H0VB 5EY4A 1D9DA 4KB0A 1HYSA 3OYBA 2G8HA 4DFJA 1BDGA 3ASMA 4DU3A 4NO7A 4BQLA 2CH5A 2QWPA 3SBTA 3S3OA 1FW6A 5CE3A 2GEMA 1UAXA 4IXCA 2KFZA 4CJEA 4M3UA 2EWSA 4EIAA 4CFBA 1YHQN 3AGKA 2E20A 4M3XA 3CCVN 1RBVA 1BISA 5FLXO 2Z1HA 3E1YA 3S41A 4E19A 3A2FA 3MN9A 3AVCA 2CGLA 3KLFA 1VSIA 2OA8A 3NGYA 2Q0RA 3RSEB 3DXMA 3PO5A 4BDZA 3L2VA 4BE1A 1XI1A 3VMFB 4DR3K 2GELA 3LZJA 3NVMA 1M90O 2BTFA 3WXIA 1NGBA 4BRKA 3HM8A 4N47A 2HHTA 3HZ6A 3TTDA 4KTZA 4DSKA 3SUOA 3O4WA 1YI2N 4DTMA 3G71N 4R79A 4DUZK 4K8XA 1BG3A 1RILA 3F73A 5AQSA 4CZLA 3VESA 1KLNA 4CZFA 1MA9B 3OBWA 5KPRA 2DFEA 3U8XA 4BR9A 1TUUA 1QTMA 2JLEA 4W5NA 3CJ1A 4CZIA 1A5VA 5JICA 4DQ8A 5AQPA 1BO5O 1Q9XA 4BREA 4O4GA 3EYZA 1I39A 4ID5A 3R8EA 1U48A 2YHWA 2XY6A 5GAGP 3UB5A 1Z6RA 3L2RA 1XC3A 2FBTA 4CIFA 3V9SA 3AV9A 3O08A 1J9AA 3KIOA 4BDPA 3NMUA 3EZ5A 4DQPA 4GW6A 3SV3A 2CGKA 2E2OA 4E1JA 5CZ2A 1TYQA 1IKYA 3DLKA 4JKGA 3CMAN 3LANA 1RBUA 3JAMO 2G8FA 3ZSRA 4B3RK 1KQSM 3CJCA 4IDHA 4X64K 3HVRA 5M1KA 3DLGA 1GOCA 3LP2A 3QESA 3NCIA 2OCEA 1XNQK 1ATSA 2ETJA 4OKKA 3VQEA 5CY4A 3HPOA 2OPQA 4GVEA 4HVJA 2P1JA 3WQTA 3AA3A 4CE9A 3OYGA 2KLAA 3M3ZA 2JWKA 3CJBA 3EL2A 4YOWA 5AQKA 4CEEA 4JK7A 4YFUA 4Y0WA 5ELZA 4CEDA 5C12A 4BRCA 5IT9O 1BA1A 4BRHA 2P9KB 2QA4N 1BIZA 1SKRA 1Z05A 3OYEA 1L3UA 3CCMN 1VAZA 1YJ9N 3K0SA 4YDUA 3A5NC 4E7KA 1HYZA 2UUBK 3HXMA 2VYPA 2WTUA 3ENOA 1WAJA 1ZXOA 3E9OA 1VQ9N 4CFAA 1GLFO 1NLVA 5AQRA 4KKOA 2KKZA 3MN6A 5C2FA 4BR0A 1CXQA 3EY1A 1Y64A 1G99A 3KWGA 3I8DA 1VSKA 3U3GA 3N4QA 1OH5A 3TTFA 3WNGA 3LWLA 3H45C 3MXMA 1NBWA 2CH6A 3TAFA 3F2KA 4M3TA 4DU1A 3IG1A 2HBMA 2OANA 4FJIA 4XH4A 1BA0A 2XRIA 2ATQA 3NBPA 3CCUN 1NK0A 2WBNA 1X9WA 1WSGA 4B9NA 1WNSA 3LDOA 4EP5A 4FZZA 1S1WA 2A5XA 1J53A 4IEEA 4FJ7A 3U4LA 1O1WA 3GL1A 1L3VA 5HL7L 4CHQA 1NGHA 4Z4CA 1TYQB 1HKGA 3ZSZA 4DFKA 2YNGA 4BRPA 4K43A 4Z4IA 3E9LA 2ITMA 1NGCA 3KZBA 4LH5A 3G6EN 2XHBA 3O1BA 2GV9A 3CCJN 3DM2A 2O8FA 2YJFA 2YKMA 4FWQA 4I7FA 5KGXA 3ENHA 1HNZK 2IVNA 3OJUA 4KH6A 4CF2A 4BRFA 4FLTA 2YCHA 3MX2A 3AAPA 5AQQA 3LAMA 3DXKB 1KVCA 3CG7A 2NLXA 3IKMA 4BG8A 3E01A 4QS7A 4CF0A 1SS6A 1NKCA 2QKBA 2NRHA 3CQYA 4DF8A 4BWMA 1S1VA 2Y1JA 1GLCG 4O44A 5F0XA 1Z26A 1Y97A 1NWKA 3ULEB 2E8AA 3THWA 2F8TA 1IV0A 1NG9A 3E9PA 3RR7A 4LFCK 3SQ0A 2YHXA 3CCQN 3MAQA 1E4GT 3QIOA 1FKPA 3OYLA 1RTIA 4CJKA 3BP8A 4JD2A 3NHGA 4ELTA 3D6RA 4DTRA 4KO0A 1YIJN 1XHZA 1NK4A 2D0PA 2FSJA 4H5NA 1U04A 3M8SA 4QAGA 2UUAK 4I6MA 4NXMK 3DXKA 3KLHA 4DV3K 1BQMA 1L3TA 3FR0A 1ZBIA 2RN2A 2FBVA 3SCXA 4AM7A 3D7EO 4B1UB 4DKWA 3EEQA 5C25A 1VQON 4DTXA 4CBWA 1LW2A 3CCRN 4DV1K 1KCFA 4J2EA 3LZIA 1ITGA 2W6KA 3TANA 1C6VA 1SL1A 1RT1A 1T8EA 5GIOA 2G8UA 1I94K 2OTJN 1SAZA 4F3TA 4CGGA 4PY5A 3AA5X 5HRPA 4C1NK 1S6PA 2HMPA 1BUPA 3ZT0A 3OYDA 1QQCA 1NGFA 3QETA 3KJVA 2P9LA 3C0BA 3OVNA 3MCAB 3Q7CA 3ZSYA 2HSTA 3B6PA 2GX9A 1QZ5A 3B6OA 3BDPA 2KQ2A 3HPHA 1NGEA 2Z1GA 3HK2A 4OLAA 3AVKA 1R0AA 4RTFD 3V1OA 1O13A 4B1XB 5J2QA 5EU7A 1NJWA 4CZKA 3IAYA 2IIRA 1NK7A 4FWPA 5JLHA 3D2FB 3VEXA 3R3LA 2YKNA 4CD3A 4FM0A 4FWSA 2KHOA 1KAZA 2YJEA 1VSFA 1W2BM 4KHWA 1C0FA 2RF2A 4CJUA 3QINA 5K14A 3K58A 1K8KA 5ADXH 2IVPA 2F9WA 1TK0A 1HQEA 4OO1J 4FJXA 4CEOA 1VQPN 3K5MA 3ZSOA 1RT2A 3CCSN 3SMPA 3K57A 4JKCA 3G10A 3K5LA 2O4IA 4KHSA 3T7ZA 3J8AA 4DLEA 2E1YA 1U2VA 4EZ6A 4ELVA 4OX9K 4OGCA 4AHVA 4MLEA 4DF4A 2Q36A 3AO4A 3NH0A 1BU6O 2QWRA 1LAVA 1NK6A 2G8IA 4AHSA 3NE6A 5AQVA 1RTHA 1SUQA 4NLCA 3IS9A 4AHRA 2G8WA 4WFBL 4UQGA 4AM6A 4BG9A 4ISEA 3VQBA 1YUWA 5GIPA 4ILJA 2YHYA 4JI7K 5I3UA 4LD0A 1TVRA 3BGRA 4JKFA 3WNHA 1JLBA 5HBMA 3SYZA 1QVGM 5LJVA 3MECA 2QKKA 1WBBA 4RWTA 2OPSA 4DTSA 4CJRA 3AA2A 1QSYA 2J4RA 3PSFA 1NGGA 5FROA 3A0IX 2E6LA 2B6AA 1RBSA 2VG7A 4ILGB 3OYHA 5FPNA 3DOLA 1GLLO 4CJ7A 1KSPA 4M7YA 3KK2A 2E2QA 4DQQA 4BC3A 4PKHA 4CFDA 1VSLA 2E4LA 2HHHK 2UXBK 2OPPA 3H46O 3H1VX 1ZBSA 5F2RA 3C6AA 4DS5A 2VGMA 3HM9A 5HLFA 4O8KA 4DMNA 5JVHL 1RDUA 4BRDA 1P90A 5D3GA 4KH5A 3QB0A 3VEOA 2ASMA 4JI4K 4W5OA 2HNDA 4JK8A 4LY7A 4BR2A 4B9MA 4FLZA 3HRGA 1S1TA 1T6CA 3QLHA 5M1QA 2UXCK 4WQ5A 2RHKA 4IOAL 4RW7A 3DXMB 1ESVA 1IKVA 4LF6K 5HRRA 1T03A 4RW4A 4E89A 4DR1K 4PA1A 3TSPA 1SKSA 4H0PA 2GWJA 3VF2A 1KLMA 4BRQA 1JJ2M 4ICLA 1HNWK 4FK2A 1WSIA 3EE9A 1GLEG 3C95A 3DRSA 5AQTA 2IC3A 3WUHA 4A5BA 3LDQA 3U9ZA 4LF5K 4HHTA 1T44A 3LDSA 3VA3A 1T05A 4U67L 4X66K 2HBLA 3ZT2A 2BANA 3AY9A 2HVHA 4DR7K 1EQYA 3OYMA 4FLUA 2JGUA 4A61A 3V4IA 1HJOA 4JN4A 3G25A 5M1FA 3RMDA 1ZYQA 1WBDA 2WOMA 4HUEA 2E1ZA 3ZSWA 3V9XA 2ASOA 4A2AA 1X3MA 3SBGA 1N5YA 2VG5A 4N41A 5FPMA 4IDKA 2E5LK 3VERA 4CZGA 4CJ5A 3SPZA 1JL2A 4PKGA 5JS1A 1VQ7N 4CJ4A 1W97L 2HHQA 4CK2A 4IO8A 2BDPA 5AQMA 4K0KK 1HNXK 5AQOA 2P9IB 4NYNA 1L5UA 5EX5A 1FJGK 5AQIA 2FC0A 2HB5A 1S1XA 4Q5VA 4BVPA 3RWUA 4FVMA 3VGLA 3VQQA 2YNHA 3FFIA 4DV5K 3O5BA 2P9IA 1SQKA 3TSQA 4EHUA 1BGXT 1VSEA 4FJHA 3QEWA 4WF9L 3TU5A 4PKIA 4WFAL 2F7TA 3FZHA 1D8YA 1DLOA 3VEYA 3TAQA 5F1XA 4OPKA 3K5NA 3W0LA 4FLYA 3MX5A 2W41A 1EKEA 5TKYA 3NDKA 3WXMB 1NK9A 4DG1A 2IOCA 3KVGA 1W7AA 4CF9A 2AJQA 3CQ8A 2P9PA 1NK5A 4YNQA 4BACA 3PO4A 3P5JA 4WE1A 3I33A 2R7YA 3KLEA 3O9RA 3QNOA 4LF4K 3I0RA 5SZTA 2G8VA 1NKEA 3TSUA 3GDQA 4A62A 4BR5A 3F9MA 4HCBA 3RMAA 2QXFA 3RRGA 3DI6A 3SZ2A 4YHHK 1IG9A 3UIQA 5DMRA 1YTUA 3C6UA 4CF8A 2H3GX 1KFSA 1ATNA 3SJHA 1ZBFA 3O4NA 3OY9A 4OLBA 2DTUA 4CHPA 4ISGA 3FFKB 3QEPA 3H1QA 3TR8A 1RT6A 4OGEA 4JNEA 1E3MA 3R9PA 4KTQA 2KW4A 1DEJA 4KHPK 1ZBHA 3U3YA 2E88A 3T1YK 2HF4A 4HTLA 2QXLA 3L2WA 4YY3K 3OW2M 5C10A 4H0YB 5FPEA 1U47A 1BHLA 1MU2A 1OH7A 4GNIA 4H8KA 4CGFA 4DSIA 2KZMA 3HO1A 3ZLJA 1TV6A 4H4MA 3J80O 3CJAA 2D4WA 1TGOA 3T1AA 4CK1A 4FLXA 2WUSA 4DTJA 4DR4K 1TK5A 4CK3A 2F4VK 3QFPA 5C15A 5GADP 1IO2A 1NJIO 2ZWHA 3E66A 4OVLA 1JLGA 2NRTA 2HNZA 2DPNA 3QFUA 3AO5A 4OJRA 2IGIA 1RT3A 5AQFA 2PYJA 4BRMA 1WSJA 3P83D 5AQXA 1LV5A 4CESA 4FWLA 2KFNA 3GE1A 2P9SB 3ZYYX 1IBLK 4JLHA 1NGDA 2RPIA 4CVNE 4HWIA 4JKEA 4CEZA 1J54A 1HYVA 3AARA 3CM6A 3P4IA 5KPTA 4CJPA 1U2VB 3DLBA 1XHXA 1YVNA 3O80A 4WYBA 2Y1IA 3TAPA 3KKRA 1LWCA 3SQ4A 3BF3A 5EVZA 1CZAN 2HOEA 5CZ1A 4BVOA 3AA4A 2P5GA 1WAFA 4AH9A 5LL6Z 1TUYA 3TAMA 2ZE2A 3R6MA 4CJWA 1IKXA 3NF6A 3NAEA 3ALYA 1IH7A 2Z1IA 3NF7A 2ZF5O 4JS5A 3IMXA 3MXJA 4XH1A 5AFUA 1YJNN 1D5AA 3VQ5A 5BPMA 1UA1A 3THYB 1YTAA 4CHNA 1JXEA 1YJWN 3VQ7A 3TARA 3N4PA 1XNRK 4RCHA 3QDKA 3SK3A 3GBTA 3EE8A 3ATVA 3ISNC 4Z4GA 2HF3A 5KI6A 1QSSA 1K9MO 1BOTO 5AQYA 4BC5A 4CEBA 2NUBA 4YOVA 2HBKA 3PY8A 4FO0A 4NCGA 1HQUA 3K9JA 3ZSVA 3LP1A 1BCMA 4B8CA 3ENBA 3ZETB 1J5OA 4CZEA 1U4BA 4EHTA 3HSCA 4N56A 4E7IA 2QW9A 4IZ9A 1BL3A 2QWNA 4A59A 3HP6A 3LDLA 4G1QA 1KTQA 2HHXA 4ZHRA 4KHUA 5AZJA 5A2QO 1CXUA 4LC9B 5GINA 1JKHA 3KK3A 4CEAA 2QI2A 4O5FA 5AQZA 4LF8K 4CZJA 2P9NA 4O0JA 3M1FA 1NGJA 4B3SK 3C94A 2X78A 1JCGA 3TTCA 3ITHA 1Q81O 4GMJB 4CEFA 2QTDA 3LL3A 4KTWA 4JV5K 2FF6A 3H3NO 4DWIA 1YVUA 2JWLA 3NVKA 4HTUA 1KC8O 4WQ4A 2Q2RA 1MWMA 3HSTB 3SNNA 4B1YB 4CJTA 3M5RA 4GVMA 4H5RA 3SV4A 4Y1CA 4BRGA 4YOXA 4M7XA 4Y1DA 4JS4A 2GBZA 3QEIA 1EWRA 2QWMA 5TKWA 3JS6A 4F3OA 3CJ9A 4FPAA 4JI0K 3CMEN 1C0MA 4FSVA 3L8BA 2ZQBA 4WQ5C 5FRNA 2BUPA 3AVAA 3A5LC 4CGJA 1QHAA 4B1ZA 3HVTA 2D0BA 4F2RA 1GOAA 2NZTA 4H5WA 3V1QA 3LWMA 1VSJA 1CZBA 3D2EB 2HBJA 3AVGA 1XQSC 1U45A 3DMJA 4DSEA 5LY3A 1A5WA 1OH8A 1XWLA 2VQEK 2ZD1A 4IKFA 1JL1A 2RKIA 3SQ2A 2VGNA 4CGIA 1FK9A 4RG8A 3QNNA 4I9QA 1Q8IA 4CGDA 2E2PA 3CIPA 2GWKA 2QM1A 4G9ZA 3AO1A 2YX6A 1YAGA 1NNEA 2FF3B 2ITGA 2ZGYA 3U9DA 2UUCK 3SAFA 5C42A 1FKOA 1Q9YA 5LJWA 1KAXA 4O0IA 3DRPA 4FJNA 3P39A 3J7ZO 1YF5L 4FVUA 1BWFO 3CC4N 4H03B 5BRFA 2WFBA 5KQ8A 4JI6K 2O8CA 4JKDA 1RDBA 3VQPA 3CERA 3THYA 2LSNA 1N33K 1L3SA 2X6SA 1QS4A 4CJLA 2Q31A 1KFDA 4ZTJA 1BI4B 4DV0K 4FZXC 1QSLA 1SL0A 3VEWA 3SJJA 3PIPL 2NRZA 3O1WA 2ZJQL 1CZ9A 1CLQA 1BQNA 1WB9A 3TPQA 2YV0X 4FJ5A 3H3OB 5FDLA 4KPYA 1K8AO 3IDHA 4CFCA 1NOYA 1LOTB 3WXLA 4E1MA 2D1KA 4I9LA 2YHAA 1N6QA 3HOSA 3AGRA 4EAHD 1ASVA 3WT0A 1NM1A 5E41A 1J6ZA 3B8AX 5GAHP 3CF5L 3MN7A 5BPNA 3PX4A 3TABA 3M8RA 4LFBK 5E84A 1N8RO 4DS4A 3CM5A 2PZSA 1IBKK 3SAHA 1UWBA 3AVLA 1J5EK 4B9TA 1IG8A 3PV8A 3LPTA 1VQ5N 3MDQA 1N36K 2P9PB 5DK5A 4B9QA 2QWQA 1WN7A 2Z1JA 4E1NA 3ZCMA 3HPGA 3KWIA 3FZKA 4RW8A 5BREA 3ZX3A 4IWVA 5M1PA 2ZGZA 1GLJO 2OPRA 4KHNA 3VA0A 2I5JA 3ZEUA 4V19S 4B9LA 1OKJA 4DUYK 5LMNK
chains in the Genus database with same CATH topology
4CJ4A 3S3MA 2G8FA 4J2DA 3OYCA 3ZSRA 2HHQA 4CK2A 3DLRA 2BDPA 4FJGA 3LPUA 3HVRA 1EXQA 3DLGA 1FXXA 1GOCA 3I0SA 4R5PA 4NYNA 3LP2A 1L5UA 4KI6A 3QESA 3NCIA 1U45A 4OPJA 1XC9A 1YTUA 2ETJA 4OKKA 3VQEA 5HRSA 3KKSA 2FC0A 5CY4A 3OYIA 3HPOA 2HB5A 1S1XA 4RW6A 2OPQA 2D0CA 3M8QA 2P1JA 4HVJA 1VSHA 4CERA 1B92A 4Q5VA 3RWUA 4FYDA 5J2NA 3AA3A 2WONA 1D9FA 2GUIA 4CE9A 3OYGA 1TL3A 4FVMA 3DLHA 3AVNA 1VRTA 3D45A 3VQQA 4CEEA 4CJ3A 5HP1A 4YFUA 2YNHA 5J2MA 2IAJA 3FFIA 4CEDA 1X9MA 1JXBA 1REVA 4FK0A 1BIZA 1SKRA 1BGXT 1VSEA 4FJHA 3QEWA 3HJFA 3OYEA 4FZYA 2HHSA 1WLJA 4M41A 2HHWA 1X9SA 3OYFA 4ID1A 1L3UA 4KHQA 2P5OA 3ULDA 4DTOA 4IFVA 3M8PA 3HP9A 4E7KA 3OYNA 1D8YA 1DLOA 1HYZA 2X6NA 3HXMA 4ZTFA 1SKWA 3PX0A 3TAQA 3ZT3A 4OPKA 3K5NA 4FLYA 4DSFA 1UOCA 1F21A 1WAJA 1EKEA 1JLQA 1B9FA 3QERA 3NDKA 2VWJA 4CFAA 4I2QA 1NK9A 4DG1A 2IOCA 5T7BA 4PUOA 4CF9A 1DTTA 3D0PA 3PX6A 2AJQA 4KKOA 3AVHA 5FRMA 1S9GA 4E7LA 3CQ8A 1CXQA 4LSLA 1TKTA 3EY1A 3QO9A 3I8DA 4YNQA 4BACA 4M3RA 4W5RA 1NK5A 3P5JA 1VSKA 5J1EA 4WE1A 3PO4A 3U3GA 1ZBLA 2R7YA 3KLEA 3WNGA 3LWLA 3SUNA 2D0AA 3QNOA 3I0RA 5SZTA 2G8VA 4J2BA 3MXMA 1NKEA 3TAFA 4M3TA 3L2UA 4DU1A 4HCBA 3IG1A 4FJ9A 1TAUA 3RMAA 2KZZA 4IBNA 4CJSA 1S1UA 2QXFA 3WNFA 4FJIA 3RRGA 4M3UA 2XY8A 4FW1A 3DI6A 3T19A 4N76A 3SZ2A 3C6TA 1NJYA 4F8RA 3LAKA 4PWDA 3KD5E 4PQUA 1C1AA 2XRIA 1IG9A 3UIQA 4FJ8A 1C0UA 2B4JA 2ATQA 5DMRA 3NBPA 3DRRA 4DLGA 1ASUA 3SQ2A 1LWEA 1NK0A 3C6UA 1RTDA 2PY5A 2QK9A 4CF8A 1BIUA 3V9ZA 1KFSA 1HRHA 1X9WA 1WSGA 4B9NA 1ZBFA 3O4NA 4C8KA 1WNSA 4EP5A 2HHVA 4J2EA 1SV5A 1S1WA 4FZZA 1J53A 3OY9A 4CHOA 4DQRA 2DFHA 4F2SA 4FJ7A 4OLBA 1O1WA 5I42A 1A5XA 1L3VA 1BI4A 3AO3A 4CHPA 4CHQA 1NK8A 4L8RB 2DTUA 1RBTA 1QE1A 3QEPA 3OS0A 4B9UA 2IS3A 1VRUA 3TR8A 3K2PA 1RT6A 4OGEA 4Z4CA 3HL8A 4KTQA 4DFMA 3ZSZA 4O5BA 3NGZA 4DFKA 2KW4A 2A1SA 2YNGA 4CJVA 4FJLA 4Z4IA 1ZBHA 2X74A 4KFBA 3V6DA 4FLWA 4DTUA 3U3YA 1LWFA 4C8MA 4LH5A 3L2WA 1B9DA 3ZT1A 5JS2A 2XHBA 3HYFA 2VWKA 2GV9A 1NJZA 3DM2A 3G0ZA 1U47A 1EETA 4Z4EA 4Z4HA 1BHLA 2YKMA 1MU2A 4I7FA 5KGXA 1NKBA 3P1GA 2FBXA 3OJUA 2VG6A 4H8KA 1C0TA 4CGFA 4CF2A 5J2PA 4DSIA 4H4OA 3DOKA 4E0DA 4FLTA 3HO1A 4KREA 1TV6A 4H4MA 2KZMA 1TGOA 3LAMA 3T1AA 1HPZA 4Z0UA 1KVCA 3F9KA 4CK1A 4FLXA 3CG7A 1G15A 4CECA 4DTJA 1IKWA 4B3OA 1TK5A 1T7PA 4CF1A 4CK3A 3QEXA 1RBRA 1TKXA 3E01A 4CF0A 3TAGA 3L2QA 2BGGA 1IO2A 1NKCA 2QKBA 3OYAA 3SUQA 4AHCA 4DF8A 2HMIA 4OVLA 4BWMA 1JLGA 2HW3A 1QHTA 2P51A 2HNZA 3AO5A 1S1VA 1WSFA 2IGIA 4OJRA 1RT3A 4O44A 2Y1JA 2PYJA 2KTQA 1WSJA 4K8ZA 3P83D 4C8NA 1Z26A 4EZ9A 1LV5A 4CCHA 1VSDA 4CESA 1Y97A 4IFYA 2KFNA 4JLHA 4DTPA 2RPIA 4CIEA 1WSHA 3PUFA 1ZBUA 4CEZA 1J54A 1S9EA 1HYVA 3CM6A 3LP0A 4O55A 3T3FA 2F8TA 4CJPA 4W5QA 4J2AA 3DLBA 1XHXA 3V9UA 3RR7A 2Y1IA 3SQ0A 3TAPA 1RT7A 3KKRA 3MAQA 2DY4A 1LWCA 3KLIA 1FKPA 3QIOA 3OYLA 3SQ4A 3RMCA 2G8KA 1KRPA 5KRSA 1RTIA 5CZ1A 3DLEA 4CJKA 4FJMA 3AA4A 1NJXA 3NHGA 3O3FA 1WAFA 2P5GA 4ELTA 4AH9A 4KO0A 4DTRA 1HYSA 1XHZA 1NK4A 4N5SA 4IG0A 1JLFA 2ZE2A 2D5RA 1K6YA 1EP4A 3TAMA 1IKXA 4CJWA 1U04A 3M8SA 3NF6A 4QAGA 3NAEA 3ALYA 3KK1A 1IH7A 3KTQA 2Z1IA 3KLHA 3NF7A 1BQMA 1L3TA 1HMVA 3OS2A 4JS5A 1ZBIA 2RN2A 2FBVA 4DTNA 3MXJA 4OKEA 3SCXA 4DSLA 1HJRA 4HUFA 3VQCA 5C25A 4E7HA 1D5AA 3VQ5A 4DTXA 1UA1A 1LW2A 1YTAA 4CHNA 1JXEA 3OS1A 1KCFA 4OKJA 3VQ7A 3LZIA 1ITGA 2XY7A 1TK8A 4F4KA 3TANA 1C6VA 3TARA 4FJKA 1JLCA 1SL1A 1RT1A 1T8EA 2YNFA 2EHGA 1EX4A 4M45A 3MEGA 2G8UA 3KLGA 4BDYA 4FJJA 4MQ3A 1BCOA 4DU4A 1RT4A 1DTQA 3ISNC 2XO7A 5KI6A 4Z4GA 1QSSA 4F3TA 4CGGA 1WSEA 3H08A 4PY5A 3AA5X 4CEBA 5HRPA 1S6PA 2NUBA 4JRQA 1RT5A 4EP4A 3PY8A 4NCGA 3ZSQA 3ZT0A 1HQUA 3O3HA 3SI6A 4CEQA 3OYDA 1QQCA 3O3GA 4FCYA 3QETA 3ZSVA 4TSXA 2YHBA 1BCMA 3LP1A 3KJVA 4B8CA 3TWHA 2OYQA 3OVNA 4HCCA 4M3YA 3ZSYA 1HNIA 3B6PA 1J5OA 3OJSA 1U4BA 1U49A 3B6OA 4C8OA 3HT3A 3BDPA 2KQ2A 4N56A 4E7IA 3SPYA 3HPHA 1W0HA 1RDAA 1BL3A 2Z1GA 3HK2A 3MXIA 2W42A 4OLAA 3AVKA 1RNHA 4KAZA 1R0AA 3HP6A 4RW9A 3V1OA 2Q3SA 4CIGA 5J2QA 2OZMA 5EU7A 1KVBA 4G1QA 3JSMA 1NJWA 1NOZA 1S5JA 1KTQA 3IAYA 2HHXA 4ELUA 3CFOA 4ZHRA 4KHUA 4KHYA 1NK7A 4FK4A 1CXUA 1C1CA 3KK3A 1JKHA 3L3UA 4CEAA 2EX3A 2YKNA 3AO2A 3S9HA 4FM0A 4O0JA 3VQAA 2F8SA 4E3SA 1VSFA 4DQIA 4M3WA 3C94A 2X78A 4KHWA 2RF2A 3ITHA 3QINA 4CJUA 2A1RA 4CJFA 4I2PA 4B9VA 5K14A 4GMJB 3K58A 4CEFA 3THVA 2HVIA 4KTWA 1TK0A 3RTVA 1HQEA 4DWIA 1YVUA 3K59A 4FJXA 3AVJA 3S3NA 4CEOA 3NH1A 1ASWA 3AVMA 3OYJA 3K5MA 4HTUA 1RT2A 4BWJA 3ZSOA 2BE2A 3HSTB 3K57A 3VQ4A 3RMBA 3WNEA 3SNNA 5KGWA 4CJTA 3G10A 3K5LA 2HNYA 2PYLA 4KHSA 2O4IA 1HNVA 4DLEA 4GVMA 3LALA 3SV4A 1C1BA 4Y1CA 4EZ6A 4ELVA 4M42A 3V81A 4Y1DA 4JS4A 2GBZA 3QEIA 2IDOA 4OGCA 3VQ9A 4BE2A 1I3AA 4AHVA 2E6MA 5CYQA 4DF4A 1VSMA 3VN5A 3AO4A 3NH0A 2OZSA 3V1RA 3L3VA 3TI0A 4LH4A 1TKDA 4C8LA 4F3OA 2G8IA 1LAVA 1NK6A 1C0MA 3L8BA 1LAWA 4AHSA 1RCHA 2ZQBA 4XIUA 4W5TA 4LSNA 3NE6A 3QEVA 4Z4FA 3K5OA 5FRNA 4CHZA 3CFRA 1RTHA 1SUQA 1Z25A 3IS9A 3AVAA 4AHRA 3TAEA 4CGJA 2G8WA 4FXDA 4UQGA 4DQSA 4F2RA 3HVTA 2D0BA 4B8AB 1GOAA 3NH2A 3JYTA 4IKFA 3LWMA 3V1QA 4HUGA 1VSJA 1CZBA 1TL1A 4B08A 3VQBA 4QCLA 3AVGA 4DSJA 3NF9A 2F96A 5I3UA 3RRHA 4LD0A 1TVRA 1RDDA 3BGRA 1JLEA 1S6QA 1RDCA 1JLBA 3DMJA 3WNHA 4DSEA 2XY5A 3NF8A 3CFPA 3RR8A 1A5WA 5HBMA 3SYZA 1XWLA 4MFBA 2ZD1A 3MEEA 1JL1A 2RKIA 1GOBA 3CYMA 3MECA 4IG3A 3VQ8A 4CGIA 1FK9A 2OPSA 4RG8A 2QKKA 4NCAA 4DTSA 3QIPA 3QNNA 1D9DA 4KB0A 1Q8IA 4CJRA 3AA2A 1QSYA 3OYBA 2G8HA 4CGDA 4DFJA 3O4QA 3ASMA 3SUPA 4DU3A 4NYFA 5FROA 3AO1A 2E6LA 2FBYA 2B6AA 1RBSA 5KTQA 3U6FA 3S3OA 2ITGA 2VG7A 1UAXA 3OYHA 2KFZA 5C42A 4CJEA 1FKOA 1VK0A 3DOLA 4FLVA 1Q9YA 1KVAA 3KK2A 4DQQA 1KSPA 4KI4A 4CFBA 4O0IA 3DRPA 4FJNA 4CFDA 4NCBA 1VSLA 3AVFA 2E4LA 2OPPA 4M3XA 4B9SA 1RBVA 2B5JA 3KD1E 4DS5A 1BISA 3HM9A 1RDBA 3VQPA 5HLFA 4DMNA 2Z1HA 4I9QA 3V9WA 2LSNA 4E19A 1L3SA 3A2FA 1W9HA 3AVCA 4M3ZA 2X6SA 1JLAA 1QS4A 4CJLA 2HHUA 3KLFA 5D3GA 1KFDA 4ZTJA 4FM1A 1BI4B 1VSIA 2OA8A 3NGYA 4FZXC 1QSLA 1SL0A 3SJJA 3PO5A 2DFFA 1CZ9A 4BDZA 3L2VA 4BE1A 1CLQA 1SL2A 1BQNA 3NGIA 4Q0BA 4W5OA 2YV0X 2HNDA 1XI1A 4FJ5A 4LY7A 1TAQA 4B9MA 1X1PA 4FLZA 3LZJA 5FDLA 1S1TA 3QLHA 1YT3A 4KPYA 2YNIA 4RW7A 4CFCA 4DFPA 1IKVA 4N47A 4CHYA 1NOYA 2HHTA 4AHTA 4KV8A 3LP3A 5HRRA 4E1MA 1T03A 4RW4A 4KTZA 4DSKA 3SUOA 4E89A 4I9LA 3SQ1A 2YHAA 1N6QA 3ZT4A 4PA1A 4DTMA 1SKSA 4FM2A 1KLMA 4K8XA 4ICLA 1RILA 3F73A 2O4GA 1ASVA 3ZSXA 5HRNA 1KLNA 1RTJA 4AILC 5E41A 1UA0A 4FK2A 1WSIA 2DFEA 4KRFA 3C95A 3DRSA 3VQDA 4JRPA 3PX4A 3AVIA 2IC3A 3MEDA 3TABA 3M8RA 1QTMA 2JLEA 4E7JA 4CJQA 4W5NA 1LW0A 5HROA 4HHTA 3OYKA 3LDSA 3VA3A 4DS4A 1A5VA 3CM5A 1T05A 2PZSA 1TKZA 4CGHA 3VQ6A 1UWBA 3AVLA 5KRTA 3ZT2A 2BANA 4B9TA 3PV8A 3IRXA 3LPTA 1Q9XA 2HVHA 3OYMA 4FLUA 2JGUA 4O4GA 3EYZA 3V4IA 4QOZB 1I39A 4ID5A 4AHUA 1U48A 5DK5A 2XY6A 1WN7A 2Z1JA 3AVBA 3L2RA 4E1NA 3RMDA 1ZYQA 3ZCMA 3HPGA 2FBTA 2WOMA 4CIFA 4HUEA 3V9SA 3AV9A 3ZSWA 3V9XA 1J9AA 4RW8A 3KIOA 3NFAA 5CYMA 4BE0A 4BDPA 1N5YA 3EZ5A 2VG5A 4DQPA 2OPRA 4GW6A 3SV3A 4N41A 4FW2A 4KHNA 3VA0A 2I5JA 3DYAA 4IDKA 4KB1A 5CZ2A 4CJ5A 3SPZA 1JL2A 3DLKA 1IKYA 5C24A 5JS1A 5SWMA 4B9LA 3LANA 1RBUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CJ4 A;  3S3M A;  2G8F A;  4J2D A;  3OYC A;  3ZSR A;  2HHQ A;  4CK2 A;  3DLR A;  2BDP A;  4FJG A;  3LPU A;  3HVR A;  1EXQ A;  3DLG A;  1FXX A;  1GOC A;  3I0S A;  4R5P A;  4NYN A;  3LP2 A;  1L5U A;  4KI6 A;  3QES A;  3NCI A;  1U45 A;  4OPJ A;  1XC9 A;  1YTU A;  2ETJ A;  4OKK A;  3VQE A;  5HRS A;  3KKS A;  2FC0 A;  5CY4 A;  3OYI A;  3HPO A;  2HB5 A;  1S1X A;  4RW6 A;  2OPQ A;  2D0C A;  3M8Q A;  2P1J A;  4HVJ A;  1VSH A;  4CER A;  1B92 A;  4Q5V A;  3RWU A;  4FYD A;  5J2N A;  3AA3 A;  2WON A;  1D9F A;  2GUI A;  4CE9 A;  3OYG A;  1TL3 A;  4FVM A;  3DLH A;  3AVN A;  1VRT A;  3D45 A;  3VQQ A;  4CEE A;  4CJ3 A;  5HP1 A;  4YFU A;  2YNH A;  5J2M A;  2IAJ A;  3FFI A;  4CED A;  1X9M A;  1JXB A;  1REV A;  4FK0 A;  1BIZ A;  1SKR A;  1BGX T;  1VSE A;  4FJH A;  3QEW A;  3HJF A;  3OYE A;  4FZY A;  2HHS A;  1WLJ A;  4M41 A;  2HHW A;  1X9S A;  3OYF A;  4ID1 A;  1L3U A;  4KHQ A;  2P5O A;  3ULD A;  4DTO A;  4IFV A;  3M8P A;  3HP9 A;  4E7K A;  3OYN A;  1D8Y A;  1DLO A;  1HYZ A;  2X6N A;  3HXM A;  4ZTF A;  1SKW A;  3PX0 A;  3TAQ A;  3ZT3 A;  4OPK A;  3K5N A;  4FLY A;  4DSF A;  1UOC A;  1F21 A;  1WAJ A;  1EKE A;  1JLQ A;  1B9F A;  3QER A;  3NDK A;  2VWJ A;  4CFA A;  4I2Q A;  1NK9 A;  4DG1 A;  2IOC A;  5T7B A;  4PUO A;  4CF9 A;  1DTT A;  3D0P A;  3PX6 A;  2AJQ A;  4KKO A;  3AVH A;  5FRM A;  1S9G A;  4E7L A;  3CQ8 A;  1CXQ A;  4LSL A;  1TKT A;  3EY1 A;  3QO9 A;  3I8D A;  4YNQ A;  4BAC A;  4M3R A;  4W5R A;  1NK5 A;  3P5J A;  1VSK A;  5J1E A;  4WE1 A;  3PO4 A;  3U3G A;  1ZBL A;  2R7Y A;  3KLE A;  3WNG A;  3LWL A;  3SUN A;  2D0A A;  3QNO A;  3I0R A;  5SZT A;  2G8V A;  4J2B A;  3MXM A;  1NKE A;  3TAF A;  4M3T A;  3L2U A;  4DU1 A;  4HCB A;  3IG1 A;  4FJ9 A;  1TAU A;  3RMA A;  2KZZ A;  4IBN A;  4CJS A;  1S1U A;  2QXF A;  3WNF A;  4FJI A;  3RRG A;  4M3U A;  2XY8 A;  4FW1 A;  3DI6 A;  3T19 A;  4N76 A;  3SZ2 A;  3C6T A;  1NJY A;  4F8R A;  3LAK A;  4PWD A;  3KD5 E;  4PQU A;  1C1A A;  2XRI A;  1IG9 A;  3UIQ A;  4FJ8 A;  1C0U A;  2B4J A;  2ATQ A;  5DMR A;  3NBP A;  3DRR A;  4DLG A;  1ASU A;  3SQ2 A;  1LWE A;  1NK0 A;  3C6U A;  1RTD A;  2PY5 A;  2QK9 A;  4CF8 A;  1BIU A;  3V9Z A;  1KFS A;  1HRH A;  1X9W A;  1WSG A;  4B9N A;  1ZBF A;  3O4N A;  4C8K A;  1WNS A;  4EP5 A;  2HHV A;  4J2E A;  1SV5 A;  1S1W A;  4FZZ A;  1J53 A;  3OY9 A;  4CHO A;  4DQR A;  2DFH A;  4F2S A;  4FJ7 A;  4OLB A;  1O1W A;  5I42 A;  1A5X A;  1L3V A;  1BI4 A;  3AO3 A;  4CHP A;  4CHQ A;  1NK8 A;  4L8R B;  2DTU A;  1RBT A;  1QE1 A;  3QEP A;  3OS0 A;  4B9U A;  2IS3 A;  1VRU A;  3TR8 A;  3K2P A;  1RT6 A;  4OGE A;  4Z4C A;  3HL8 A;  4KTQ A;  4DFM A;  3ZSZ A;  4O5B A;  3NGZ A;  4DFK A;  2KW4 A;  2A1S A;  2YNG A;  4CJV A;  4FJL A;  4Z4I A;  1ZBH A;  2X74 A;  4KFB A;  3V6D A;  4FLW A;  4DTU A;  3U3Y A;  1LWF A;  4C8M A;  4LH5 A;  3L2W A;  1B9D A;  3ZT1 A;  5JS2 A;  2XHB A;  3HYF A;  2VWK A;  2GV9 A;  1NJZ A;  3DM2 A;  3G0Z A;  1U47 A;  1EET A;  4Z4E A;  4Z4H A;  1BHL A;  2YKM A;  1MU2 A;  4I7F A;  5KGX A;  1NKB A;  3P1G A;  2FBX A;  3OJU A;  2VG6 A;  4H8K A;  1C0T A;  4CGF A;  4CF2 A;  5J2P A;  4DSI A;  4H4O A;  3DOK A;  4E0D A;  4FLT A;  3HO1 A;  4KRE A;  1TV6 A;  4H4M A;  2KZM A;  1TGO A;  3LAM A;  3T1A A;  1HPZ A;  4Z0U A;  1KVC A;  3F9K A;  4CK1 A;  4FLX A;  3CG7 A;  1G15 A;  4CEC A;  4DTJ A;  1IKW A;  4B3O A;  1TK5 A;  1T7P A;  4CF1 A;  4CK3 A;  3QEX A;  1RBR A;  1TKX A;  3E01 A;  4CF0 A;  3TAG A;  3L2Q A;  2BGG A;  1IO2 A;  1NKC A;  2QKB A;  3OYA A;  3SUQ A;  4AHC A;  4DF8 A;  2HMI A;  4OVL A;  4BWM A;  1JLG A;  2HW3 A;  1QHT A;  2P51 A;  2HNZ A;  3AO5 A;  1S1V A;  1WSF A;  2IGI A;  4OJR A;  1RT3 A;  4O44 A;  2Y1J A;  2PYJ A;  2KTQ A;  1WSJ A;  4K8Z A;  3P83 D;  4C8N A;  1Z26 A;  4EZ9 A;  1LV5 A;  4CCH A;  1VSD A;  4CES A;  1Y97 A;  4IFY A;  2KFN A;  4JLH A;  4DTP A;  2RPI A;  4CIE A;  1WSH A;  3PUF A;  1ZBU A;  4CEZ A;  1J54 A;  1S9E A;  1HYV A;  3CM6 A;  3LP0 A;  4O55 A;  3T3F A;  2F8T A;  4CJP A;  4W5Q A;  4J2A A;  3DLB A;  1XHX A;  3V9U A;  3RR7 A;  2Y1I A;  3SQ0 A;  3TAP A;  1RT7 A;  3KKR A;  3MAQ A;  2DY4 A;  1LWC A;  3KLI A;  1FKP A;  3QIO A;  3OYL A;  3SQ4 A;  3RMC A;  2G8K A;  1KRP A;  5KRS A;  1RTI A;  5CZ1 A;  3DLE A;  4CJK A;  4FJM A;  3AA4 A;  1NJX A;  3NHG A;  3O3F A;  1WAF A;  2P5G A;  4ELT A;  4AH9 A;  4KO0 A;  4DTR A;  1HYS A;  1XHZ A;  1NK4 A;  4N5S A;  4IG0 A;  1JLF A;  2ZE2 A;  2D5R A;  1K6Y A;  1EP4 A;  3TAM A;  1IKX A;  4CJW A;  1U04 A;  3M8S A;  3NF6 A;  4QAG A;  3NAE A;  3ALY A;  3KK1 A;  1IH7 A;  3KTQ A;  2Z1I A;  3KLH A;  3NF7 A;  1BQM A;  1L3T A;  1HMV A;  3OS2 A;  4JS5 A;  1ZBI A;  2RN2 A;  2FBV A;  4DTN A;  3MXJ A;  4OKE A;  3SCX A;  4DSL A;  1HJR A;  4HUF A;  3VQC A;  5C25 A;  4E7H A;  1D5A A;  3VQ5 A;  4DTX A;  1UA1 A;  1LW2 A;  1YTA A;  4CHN A;  1JXE A;  3OS1 A;  1KCF A;  4OKJ A;  3VQ7 A;  3LZI A;  1ITG A;  2XY7 A;  1TK8 A;  4F4K A;  3TAN A;  1C6V A;  3TAR A;  4FJK A;  1JLC A;  1SL1 A;  1RT1 A;  1T8E A;  2YNF A;  2EHG A;  1EX4 A;  4M45 A;  3MEG A;  2G8U A;  3KLG A;  4BDY A;  4FJJ A;  4MQ3 A;  1BCO A;  4DU4 A;  1RT4 A;  1DTQ A;  3ISN C;  2XO7 A;  5KI6 A;  4Z4G A;  1QSS A;  4F3T A;  4CGG A;  1WSE A;  3H08 A;  4PY5 A;  3AA5 X;  4CEB A;  5HRP A;  1S6P A;  2NUB A;  4JRQ A;  1RT5 A;  4EP4 A;  3PY8 A;  4NCG A;  3ZSQ A;  3ZT0 A;  1HQU A;  3O3H A;  3SI6 A;  4CEQ A;  3OYD A;  1QQC A;  3O3G A;  4FCY A;  3QET A;  3ZSV A;  4TSX A;  2YHB A;  1BCM A;  3LP1 A;  3KJV A;  4B8C A;  3TWH A;  2OYQ A;  3OVN A;  4HCC A;  4M3Y A;  3ZSY A;  1HNI A;  3B6P A;  1J5O A;  3OJS A;  1U4B A;  1U49 A;  3B6O A;  4C8O A;  3HT3 A;  3BDP A;  2KQ2 A;  4N56 A;  4E7I A;  3SPY A;  3HPH A;  1W0H A;  1RDA A;  1BL3 A;  2Z1G A;  3HK2 A;  3MXI A;  2W42 A;  4OLA A;  3AVK A;  1RNH A;  4KAZ A;  1R0A A;  3HP6 A;  4RW9 A;  3V1O A;  2Q3S A;  4CIG A;  5J2Q A;  2OZM A;  5EU7 A;  1KVB A;  4G1Q A;  3JSM A;  1NJW A;  1NOZ A;  1S5J A;  1KTQ A;  3IAY A;  2HHX A;  4ELU A;  3CFO A;  4ZHR A;  4KHU A;  4KHY A;  1NK7 A;  4FK4 A;  1CXU A;  1C1C A;  3KK3 A;  1JKH A;  3L3U A;  4CEA A;  2EX3 A;  2YKN A;  3AO2 A;  3S9H A;  4FM0 A;  4O0J A;  3VQA A;  2F8S A;  4E3S A;  1VSF A;  4DQI A;  4M3W A;  3C94 A;  2X78 A;  4KHW A;  2RF2 A;  3ITH A;  3QIN A;  4CJU A;  2A1R A;  4CJF A;  4I2P A;  4B9V A;  5K14 A;  4GMJ B;  3K58 A;  4CEF A;  3THV A;  2HVI A;  4KTW A;  1TK0 A;  3RTV A;  1HQE A;  4DWI A;  1YVU A;  3K59 A;  4FJX A;  3AVJ A;  3S3N A;  4CEO A;  3NH1 A;  1ASW A;  3AVM A;  3OYJ A;  3K5M A;  4HTU A;  1RT2 A;  4BWJ A;  3ZSO A;  2BE2 A;  3HST B;  3K57 A;  3VQ4 A;  3RMB A;  3WNE A;  3SNN A;  5KGW A;  4CJT A;  3G10 A;  3K5L A;  2HNY A;  2PYL A;  4KHS A;  2O4I A;  1HNV A;  4DLE A;  4GVM A;  3LAL A;  3SV4 A;  1C1B A;  4Y1C A;  4EZ6 A;  4ELV A;  4M42 A;  3V81 A;  4Y1D A;  4JS4 A;  2GBZ A;  3QEI A;  2IDO A;  4OGC A;  3VQ9 A;  4BE2 A;  1I3A A;  4AHV A;  2E6M A;  5CYQ A;  4DF4 A;  1VSM A;  3VN5 A;  3AO4 A;  3NH0 A;  2OZS A;  3V1R A;  3L3V A;  3TI0 A;  4LH4 A;  1TKD A;  4C8L A;  4F3O A;  2G8I A;  1LAV A;  1NK6 A;  1C0M A;  3L8B A;  1LAW A;  4AHS A;  1RCH A;  2ZQB A;  4XIU A;  4W5T A;  4LSN A;  3NE6 A;  3QEV A;  4Z4F A;  3K5O A;  5FRN A;  4CHZ A;  3CFR A;  1RTH A;  1SUQ A;  1Z25 A;  3IS9 A;  3AVA A;  4AHR A;  3TAE A;  4CGJ A;  2G8W A;  4FXD A;  4UQG A;  4DQS A;  4F2R A;  3HVT A;  2D0B A;  4B8A B;  1GOA A;  3NH2 A;  3JYT A;  4IKF A;  3LWM A;  3V1Q A;  4HUG A;  1VSJ A;  1CZB A;  1TL1 A;  4B08 A;  3VQB A;  4QCL A;  3AVG A;  4DSJ A;  3NF9 A;  2F96 A;  5I3U A;  3RRH A;  4LD0 A;  1TVR A;  1RDD A;  3BGR A;  1JLE A;  1S6Q A;  1RDC A;  1JLB A;  3DMJ A;  3WNH A;  4DSE A;  2XY5 A;  3NF8 A;  3CFP A;  3RR8 A;  1A5W A;  5HBM A;  3SYZ A;  1XWL A;  4MFB A;  2ZD1 A;  3MEE A;  1JL1 A;  2RKI A;  1GOB A;  3CYM A;  3MEC A;  4IG3 A;  3VQ8 A;  4CGI A;  1FK9 A;  2OPS A;  4RG8 A;  2QKK A;  4NCA A;  4DTS A;  3QIP A;  3QNN A;  1D9D A;  4KB0 A;  1Q8I A;  4CJR A;  3AA2 A;  1QSY A;  3OYB A;  2G8H A;  4CGD A;  4DFJ A;  3O4Q A;  3ASM A;  3SUP A;  4DU3 A;  4NYF A;  5FRO A;  3AO1 A;  2E6L A;  2FBY A;  2B6A A;  1RBS A;  5KTQ A;  3U6F A;  3S3O A;  2ITG A;  2VG7 A;  1UAX A;  3OYH A;  2KFZ A;  5C42 A;  4CJE A;  1FKO A;  1VK0 A;  3DOL A;  4FLV A;  1Q9Y A;  1KVA A;  3KK2 A;  4DQQ A;  1KSP A;  4KI4 A;  4CFB A;  4O0I A;  3DRP A;  4FJN A;  4CFD A;  4NCB A;  1VSL A;  3AVF A;  2E4L A;  2OPP A;  4M3X A;  4B9S A;  1RBV A;  2B5J A;  3KD1 E;  4DS5 A;  1BIS A;  3HM9 A;  1RDB A;  3VQP A;  5HLF A;  4DMN A;  2Z1H A;  4I9Q A;  3V9W A;  2LSN A;  4E19 A;  1L3S A;  3A2F A;  1W9H A;  3AVC A;  4M3Z A;  2X6S A;  1JLA A;  1QS4 A;  4CJL A;  2HHU A;  3KLF A;  5D3G A;  1KFD A;  4ZTJ A;  4FM1 A;  1BI4 B;  1VSI A;  2OA8 A;  3NGY A;  4FZX C;  1QSL A;  1SL0 A;  3SJJ A;  3PO5 A;  2DFF A;  1CZ9 A;  4BDZ A;  3L2V A;  4BE1 A;  1CLQ A;  1SL2 A;  1BQN A;  3NGI A;  4Q0B A;  4W5O A;  2YV0 X;  2HND A;  1XI1 A;  4FJ5 A;  4LY7 A;  1TAQ A;  4B9M A;  1X1P A;  4FLZ A;  3LZJ A;  5FDL A;  1S1T A;  3QLH A;  1YT3 A;  4KPY A;  2YNI A;  4RW7 A;  4CFC A;  4DFP A;  1IKV A;  4N47 A;  4CHY A;  1NOY A;  2HHT A;  4AHT A;  4KV8 A;  3LP3 A;  5HRR A;  4E1M A;  1T03 A;  4RW4 A;  4KTZ A;  4DSK A;  3SUO A;  4E89 A;  4I9L A;  3SQ1 A;  2YHA A;  1N6Q A;  3ZT4 A;  4PA1 A;  4DTM A;  1SKS A;  4FM2 A;  1KLM A;  4K8X A;  4ICL A;  1RIL A;  3F73 A;  2O4G A;  1ASV A;  3ZSX A;  5HRN A;  1KLN A;  1RTJ A;  4AIL C;  5E41 A;  1UA0 A;  4FK2 A;  1WSI A;  2DFE A;  4KRF A;  3C95 A;  3DRS A;  3VQD A;  4JRP A;  3PX4 A;  3AVI A;  2IC3 A;  3MED A;  3TAB A;  3M8R A;  1QTM A;  2JLE A;  4E7J A;  4CJQ A;  4W5N A;  1LW0 A;  5HRO A;  4HHT A;  3OYK A;  3LDS A;  3VA3 A;  4DS4 A;  1A5V A;  3CM5 A;  1T05 A;  2PZS A;  1TKZ A;  4CGH A;  3VQ6 A;  1UWB A;  3AVL A;  5KRT A;  3ZT2 A;  2BAN A;  4B9T A;  3PV8 A;  3IRX A;  3LPT A;  1Q9X A;  2HVH A;  3OYM A;  4FLU A;  2JGU A;  4O4G A;  3EYZ A;  3V4I A;  4QOZ B;  1I39 A;  4ID5 A;  4AHU A;  1U48 A;  5DK5 A;  2XY6 A;  1WN7 A;  2Z1J A;  3AVB A;  3L2R A;  4E1N A;  3RMD A;  1ZYQ A;  3ZCM A;  3HPG A;  2FBT A;  2WOM A;  4CIF A;  4HUE A;  3V9S A;  3AV9 A;  3ZSW A;  3V9X A;  1J9A A;  4RW8 A;  3KIO A;  3NFA A;  5CYM A;  4BE0 A;  4BDP A;  1N5Y A;  3EZ5 A;  2VG5 A;  4DQP A;  2OPR A;  4GW6 A;  3SV3 A;  4N41 A;  4FW2 A;  4KHN A;  3VA0 A;  2I5J A;  3DYA A;  4IDK A;  4KB1 A;  5CZ2 A;  4CJ5 A;  3SPZ A;  1JL2 A;  3DLK A;  1IKY A;  5C24 A;  5JS1 A;  5SWM A;  4B9L A;  3LAN A;  1RBU A; 
#chains in the Genus database with same CATH topology
 3FGU A;  3S3M A;  4C23 A;  5JMV A;  3DLR A;  3LPU A;  3MWP A;  3ZX2 A;  1JCE A;  3CQX A;  4OPJ A;  1HUX A;  2V52 B;  3OYI A;  4JKH A;  4RW6 A;  2D0C A;  5C0Y A;  3FLC O;  3RVC A;  5J2N A;  2WON A;  2GUI A;  1TL3 A;  3DLH A;  4PL7 A;  3AVN A;  3D45 A;  5HP1 A;  5J2M A;  4EFH A;  4OPA A;  3Q7B A;  4BC4 A;  1REV A;  3O9T A;  2PBD A;  4YOR A;  2HHS A;  2HHW A;  4M41 A;  5BN8 A;  3OYF A;  4ID1 A;  4KHQ A;  4DTO A;  4IFV A;  4M63 C;  3OYN A;  2X6N A;  4DHY A;  1SKW A;  3T69 A;  3ZT3 A;  2P9U A;  2ZJR L;  2NNW A;  3T1H K;  4K42 A;  3A8Y A;  2VWJ A;  4IOC L;  5T7B A;  3PLA A;  1DTT A;  3OHR A;  3D0P A;  3PX6 A;  4YOY A;  4K41 A;  1NGA A;  4WQ4 C;  5AJ3 K;  1XMQ K;  4FJG A;  4W5R A;  3QML A;  3PIO L;  1ZBL A;  4CZH A;  1S72 N;  4J2B A;  3ZX0 A;  4JKA A;  3L2U A;  3CD6 N;  1TAU A;  2ZM6 K;  2KZZ A;  2GUP A;  3C7N A;  4CJS A;  1S1U A;  3WNF A;  2XY8 A;  4X65 K;  3T19 A;  1D4X A;  4FWK A;  5AQH A;  3C6T A;  1NJY A;  3LAK A;  3M6G A;  3VGK A;  2PAV A;  3KD5 E;  4PQU A;  1C1A A;  4DLG A;  3DRR A;  1XMO K;  1LWE A;  1ATR A;  2PY5 A;  2QK9 A;  1BIU A;  3V9Z A;  3O9Q A;  2VQF K;  2HHV A;  3VF4 A;  4JAX A;  3R1X A;  4GKK K;  5I42 A;  4GV9 A;  3AO3 A;  4L8R B;  4YOU A;  4B9U A;  3K2P A;  3VEV A;  4WCE L;  4DFM A;  3NGZ A;  5GAE P;  4BRL A;  3VEZ A;  2A1S A;  2X74 A;  4KFB A;  3VOV A;  4FLW A;  4DTU A;  3ULE A;  4CBU A;  4CI6 A;  2Q1N A;  2A41 A;  1B9D A;  3HYF A;  2VWK A;  4Z4E A;  1EET A;  4A2B A;  3P1G A;  3CCE N;  3IUC A;  1C0T A;  1LCU A;  4BGA A;  3DWL A;  4E0D A;  4XH5 A;  2NRV A;  4UY8 O;  4KRE A;  2CGJ A;  1HPZ A;  4DV2 K;  3F9K A;  3A5O C;  1G15 A;  4CEC A;  1IKW A;  3L6Q A;  5ADX A;  4CF1 A;  3QEX A;  3HI0 A;  1HKB A;  1HX1 A;  4IJA A;  3TAG A;  2BGG A;  4H5V A;  3SUQ A;  3VGM A;  4LF7 K;  4BRN A;  2P51 A;  4O8U A;  4C1N I;  2KTQ A;  4FWN A;  4C8N A;  4BRI A;  4JK9 A;  4CCH A;  1VSD A;  2W6L A;  3F5T A;  4JHD A;  4DTP A;  1NMN A;  4CIE A;  1WSH A;  2QEX N;  3L0Q A;  1ZBU A;  4FWO A;  4A5A A;  1S9E A;  3CCL N;  3LP0 A;  3T3F A;  2UXD K;  1DGK N;  4J2A A;  2P9S A;  3EN9 A;  1K73 O;  1RT7 A;  1N34 K;  2UYT A;  4MDB A;  1JCF A;  4I6M B;  4JEP A;  1KRP A;  4H0T B;  3DLE A;  3ATU A;  3ID8 A;  3HOT A;  2A40 A;  2QWL A;  3MWT A;  4N5S A;  2D5R A;  5BPL A;  4FOE A;  3BF1 A;  3KK1 A;  3KTQ A;  3VTI A;  4PHT X;  3OS2 A;  2FLO A;  1HJR A;  3VQC A;  4B1V A;  4FWM A;  2RE2 A;  4KBO A;  4F4K A;  3OS1 A;  4OKJ A;  1TK8 A;  1GLD G;  3DLL L;  5KQD A;  4PL8 A;  2FSK A;  2YNF A;  4IJN A;  4J8F A;  4FL9 A;  4NXN K;  1EX4 A;  3D2F A;  1S3X A;  3KLG A;  3OBY A;  4BDY A;  4FJJ A;  4CW7 B;  4DU4 A;  1RT4 A;  1DTQ A;  2XO7 A;  2P9K A;  3H08 A;  4CD1 A;  4JRQ A;  3DAW A;  3O6W A;  3ZSQ A;  3D2E A;  3SI6 A;  4YOT A;  3O3G A;  4TSX A;  1VQ4 N;  4M3Y A;  4HCC A;  3CPE A;  1HNI A;  3CJ7 A;  5B8H A;  3OJS A;  1U49 A;  3LDN A;  4DR6 K;  5AQW A;  4C8O A;  3HT3 A;  4U7B A;  3SPY A;  1W0H A;  5AQU A;  1RDW X;  2W42 A;  3THW B;  1RNH A;  4KAZ A;  2O8E B;  2Q3S A;  3JSM A;  1KVB A;  1U6Z A;  1NOZ A;  2AP1 A;  4GV6 A;  4JI8 K;  1S22 A;  1C1C A;  3L3U A;  2EX3 A;  3C65 A;  1X9J A;  4JI1 K;  3KK7 A;  3AO2 A;  3S9H A;  5EXW A;  2F8S A;  4E3S A;  5IWA K;  3VET A;  5HOO A;  3THV A;  4GKJ K;  3H6E A;  2HVI A;  3VEN A;  3RTV A;  4GY2 B;  3K59 A;  3AVM A;  1WOQ A;  2YI1 A;  2A6A A;  3UKU A;  4JKB A;  3VQ4 A;  3WNE A;  1WUA A;  5KGW A;  5DM6 L;  2PYL A;  2HNY A;  1HNV A;  2E2N A;  3J7Y P;  5I9E B;  3LAL A;  1C1B A;  2IDO A;  5CHI A;  3SMS A;  4BE2 A;  1I3A A;  1VSM A;  3L3V A;  4LH4 A;  5AZJ B;  4W5T A;  1RCH A;  4XIU A;  3QEV A;  4YDU C;  3K5O A;  3VPZ A;  2VCP A;  3CFR A;  1OH6 A;  1SZ2 A;  1Z25 A;  3TAE A;  4FXD A;  2O8E A;  3JYT A;  4B8A B;  3NH2 A;  4NB4 A;  1TL1 A;  3MCP A;  4QCL A;  3AAQ A;  1VQ8 N;  4JYA K;  1RDD A;  1S6Q A;  3CFP A;  3RR8 A;  3L4Q A;  3BUZ B;  3MEE A;  4EZ9 A;  3CYM A;  3VQ8 A;  1GOB A;  4NCA A;  4IG3 A;  4MO5 A;  3QIP A;  2O8D A;  3O4Q A;  5AQJ A;  1R59 O;  3SUP A;  4GV3 A;  4NYF A;  1ILY A;  4WFN L;  1Q7Y O;  2FBY A;  2O8B B;  5E26 A;  3U6F A;  4AF1 A;  1NU0 A;  2ASP A;  1VK0 A;  4FLV A;  1KVA A;  4KI4 A;  3CHW A;  3J7A P;  4JKG B;  4KH4 A;  5MLC Q;  4NCB A;  3AVF A;  4B9S A;  2O8F B;  1RFQ A;  2B5J A;  3KD1 E;  2NRW A;  2O8D B;  4JI2 K;  3V9W A;  3LM2 A;  1W9H A;  4M3Z A;  1JLA A;  2HHU A;  3PSI A;  4FM1 A;  3WEE A;  3LDP A;  4QS9 A;  1YXQ A;  3L4I A;  2DFF A;  1SL2 A;  3NGI A;  4Q0B A;  2BH1 A;  3BZK A;  1TAQ A;  1X1P A;  1GLA G;  1YT3 A;  3CC2 N;  2YNI A;  4DFP A;  3UKR A;  4CHY A;  4AHT A;  4KV8 A;  5EOY A;  3LP3 A;  5JLF A;  5AR0 A;  3SQ1 A;  1DKG D;  3ZT4 A;  5AQG A;  1QVF M;  2QWO A;  4FM2 A;  3WXJ A;  4BY9 C;  2O4G A;  3ZSX A;  3C6H A;  2Q97 A;  4L3Q A;  5HRN A;  1RTJ A;  4AIL C;  1UA0 A;  4LF9 K;  1Q82 O;  4KRF A;  3VQD A;  2FSN A;  4JRP A;  4MDA A;  4AQY K;  3AVI A;  1QZ6 A;  3MED A;  2Q0U A;  4K25 A;  4E7J A;  4CJQ A;  1LW0 A;  5HRO A;  3OYK A;  2NRX A;  1TKZ A;  4CGH A;  3VQ6 A;  5KRT A;  1DT9 A;  2D0O A;  3IRX A;  3SAG A;  4QOZ B;  4AHU A;  2UU9 K;  3FZL A;  4B3M K;  3AVB A;  5CR4 A;  3EZW A;  3MK6 A;  3OA9 A;  1HLU A;  4FOI A;  3NFA A;  5CYM A;  3CPW M;  4BE0 A;  4DR5 K;  4FW2 A;  5M1N A;  3DYA A;  4KB1 A;  4OPH A;  4CBX A;  5C24 A;  3DJC A;  3I8B A;  5SWM A;  1T3V A;  5BRH A;  1EO1 A;  1X3N A;  1QQN A;  3UE5 A;  4J2D A;  3OYC A;  4MO4 A;  4F9O A;  1EXQ A;  1FXX A;  3I0S A;  4R5P A;  4FPB A;  3GOI A;  3J81 O;  4KI6 A;  3G4S N;  1XC9 A;  4H0O A;  5HRS A;  3KKS A;  5AQL A;  5AFU H;  3ZET A;  4DV4 K;  3M8Q A;  4FYD A;  1VSH A;  4CER A;  1B92 A;  3BY5 A;  2I7P A;  1D9F A;  2VWB A;  3QBX A;  1VRT A;  4CJ3 A;  2F9T A;  4NLB A;  2IAJ A;  1X9M A;  1JXB A;  5BRD A;  1QQO A;  4IO9 L;  4FZY A;  1WLJ A;  1X9S A;  2P5O A;  3ULD A;  3M8P A;  3HP9 A;  3FZM A;  2WC9 A;  2O8B A;  4ZTF A;  4BC2 A;  3PX0 A;  1MDU B;  5JVG L;  4DSF A;  2P9L B;  1KD1 O;  1UOC A;  1F21 A;  1JLQ A;  1B9F A;  3QER A;  2V51 B;  1K8K B;  3A5M C;  4I2Q A;  3K9K A;  4JI3 K;  4PUO A;  3HBT A;  3AVH A;  4ISF A;  5FRM A;  1S9G A;  2V7Z A;  4E7L A;  1OVQ A;  3VTH A;  4LSL A;  1TKT A;  1NGI A;  3QO9 A;  1Q18 A;  4M3R A;  5J1E A;  3IFR A;  4JI5 K;  3SUN A;  2D0A A;  3O9S A;  4DR2 K;  5BR9 A;  2P9N B;  4BR7 A;  4FJ9 A;  1T6D A;  4IBN A;  3ZEU B;  4FW1 A;  3UKR B;  4N76 A;  4BR4 A;  3WXK A;  4PWD A;  4F8R A;  3BEX A;  4FJ8 A;  3HJF A;  1C0U A;  2B4J A;  1HPM A;  4LFA K;  1ASU A;  1RTD A;  1IBM K;  1HRH A;  3MMV A;  4C8K A;  3WQU A;  1SV5 A;  4CHO A;  2OTL N;  4DQR A;  2DFH A;  4F2S A;  1A5X A;  2I7N A;  1BI4 A;  1NK8 A;  1RBT A;  4ILH A;  1QE1 A;  3OS0 A;  2IS3 A;  1VRU A;  3W3D A;  3HL8 A;  4O5B A;  4CJV A;  4FJL A;  3ID6 A;  3V6D A;  4BRO A;  3THX A;  1LWF A;  4C8M A;  1VQN N;  3ZT1 A;  5JS2 A;  5DM7 L;  4QS8 A;  1NJZ A;  3G0Z A;  4Z4H A;  3QBW A;  1EWQ A;  1NKB A;  2FBX A;  4MLH A;  2VG6 A;  5J2P A;  4H4O A;  3DOK A;  3MN5 A;  4Z0U A;  1GLB G;  4B3O A;  1T7P A;  1RBR A;  1TKX A;  3L2Q A;  1P8Z A;  4Z94 A;  3OYA A;  4AHC A;  2HMI A;  2HW3 A;  4B1W B;  1QHT A;  3O9U A;  1WSF A;  4K8Z A;  4DCH A;  2IVO A;  4IFY A;  1E4F T;  3PUF A;  3EKU A;  4BQZ A;  1H1V A;  4O55 A;  3LM9 A;  1VHX A;  4W5Q A;  4JHD B;  2FXU A;  3V9U A;  3I56 N;  5KPZ A;  2DY4 A;  3KLI A;  3RMC A;  2G8K A;  5KRS A;  2AA4 A;  4FJM A;  1ZC6 A;  1NJX A;  1C0G A;  3O3F A;  4IG0 A;  1JLF A;  2O8C B;  4X62 K;  1K6Y A;  1EP4 A;  4DB3 A;  4A57 A;  4DV7 K;  3UKU B;  1VQL N;  1VQK N;  1HMV A;  2W40 A;  2NRR A;  1Q86 O;  4DTN A;  4DSL A;  3EKS A;  4OKE A;  4HUF A;  4E7H A;  4XEI A;  3CI5 A;  3THX B;  2XY7 A;  4FK0 A;  4FJK A;  1JLC A;  3BZC A;  2EHG A;  4M45 A;  2V7Y A;  3MEG A;  4IEI A;  3QIC A;  4MQ3 A;  1BCO A;  3VF6 A;  3P31 A;  1WSE A;  5C2D A;  5M1O A;  1XUP O;  1RT5 A;  4EP4 A;  4IOX A;  3OTO K;  3O3H A;  3GG4 A;  4FWR A;  4CEQ A;  4FCY A;  1YIT N;  2YHB A;  2P9U B;  2OYQ A;  3TWH A;  3I55 N;  3RSE A;  5AZI A;  2GTD A;  1KXP A;  1RDA A;  3MXI A;  1OVY A;  4RW9 A;  3O8M A;  4CIG A;  2OZM A;  1S5J A;  3CC7 N;  4H5T A;  4ELU A;  3CFO A;  4KHY A;  4FK4 A;  3FE1 A;  1RGI A;  5AZI B;  3CXC M;  3VQA A;  4DQI A;  4BGB A;  4M3W A;  2A1R A;  5AQN A;  4CJF A;  4I2P A;  4B9V A;  4JD2 B;  1NMD A;  3AVJ A;  3HTV A;  3NH1 A;  3S3N A;  1ASW A;  3OYJ A;  3SLC A;  4BWJ A;  1V4S A;  3WEE B;  2BE2 A;  5BR8 K;  5FPD A;  3JXU A;  3RMB A;  2A42 A;  1QQM A;  5LMU K;  3FZF A;  4BRA A;  2A3Z A;  4M42 A;  3V81 A;  1HKC A;  4CZM A;  3EO3 A;  3VQ9 A;  2E6M A;  5CYQ A;  2OZS A;  3VN5 A;  1IJJ A;  3P38 A;  3C7N B;  3V1R A;  1MWK A;  3TI0 A;  1TKD A;  4C8L A;  1LAW A;  4LSN A;  4Z4F A;  4CHZ A;  3KHY A;  1N32 K;  4DV6 K;  5BN9 A;  1KAY A;  1V4T A;  4DQS A;  4B3T K;  4HUG A;  1VQM N;  3CET A;  5H1S Q;  4B08 A;  1HR0 K;  1VQ6 N;  4DSJ A;  3NF9 A;  2F96 A;  1M1K O;  2ZJP L;  3RRH A;  1JLE A;  1RDC A;  2XY5 A;  3NF8 A;  4IFE A;  4H0X B;  4MFB A;  2PFU A;  5KTQ A;  4H0V B;  5EY4 A;  1D9D A;  4KB0 A;  1HYS A;  3OYB A;  2G8H A;  4DFJ A;  1BDG A;  3ASM A;  4DU3 A;  4NO7 A;  4BQL A;  2CH5 A;  2QWP A;  3SBT A;  3S3O A;  1FW6 A;  5CE3 A;  2GEM A;  1UAX A;  4IXC A;  2KFZ A;  4CJE A;  4M3U A;  2EWS A;  4EIA A;  4CFB A;  1YHQ N;  3AGK A;  2E20 A;  4M3X A;  3CCV N;  1RBV A;  1BIS A;  5FLX O;  2Z1H A;  3E1Y A;  3S41 A;  4E19 A;  3A2F A;  3MN9 A;  3AVC A;  2CGL A;  3KLF A;  1VSI A;  2OA8 A;  3NGY A;  2Q0R A;  3RSE B;  3DXM A;  3PO5 A;  4BDZ A;  3L2V A;  4BE1 A;  1XI1 A;  3VMF B;  4DR3 K;  2GEL A;  3LZJ A;  3NVM A;  1M90 O;  2BTF A;  3WXI A;  1NGB A;  4BRK A;  3HM8 A;  4N47 A;  2HHT A;  3HZ6 A;  3TTD A;  4KTZ A;  4DSK A;  3SUO A;  3O4W A;  1YI2 N;  4DTM A;  3G71 N;  4R79 A;  4DUZ K;  4K8X A;  1BG3 A;  1RIL A;  3F73 A;  5AQS A;  4CZL A;  3VES A;  1KLN A;  4CZF A;  1MA9 B;  3OBW A;  5KPR A;  2DFE A;  3U8X A;  4BR9 A;  1TUU A;  1QTM A;  2JLE A;  4W5N A;  3CJ1 A;  4CZI A;  1A5V A;  5JIC A;  4DQ8 A;  5AQP A;  1BO5 O;  1Q9X A;  4BRE A;  4O4G A;  3EYZ A;  1I39 A;  4ID5 A;  3R8E A;  1U48 A;  2YHW A;  2XY6 A;  5GAG P;  3UB5 A;  1Z6R A;  3L2R A;  1XC3 A;  2FBT A;  4CIF A;  3V9S A;  3AV9 A;  3O08 A;  1J9A A;  3KIO A;  4BDP A;  3NMU A;  3EZ5 A;  4DQP A;  4GW6 A;  3SV3 A;  2CGK A;  2E2O A;  4E1J A;  5CZ2 A;  1TYQ A;  1IKY A;  3DLK A;  4JKG A;  3CMA N;  3LAN A;  1RBU A;  3JAM O;  2G8F A;  3ZSR A;  4B3R K;  1KQS M;  3CJC A;  4IDH A;  4X64 K;  3HVR A;  5M1K A;  3DLG A;  1GOC A;  3LP2 A;  3QES A;  3NCI A;  2OCE A;  1XNQ K;  1ATS A;  2ETJ A;  4OKK A;  3VQE A;  5CY4 A;  3HPO A;  2OPQ A;  4GVE A;  4HVJ A;  2P1J A;  3WQT A;  3AA3 A;  4CE9 A;  3OYG A;  2KLA A;  3M3Z A;  2JWK A;  3CJB A;  3EL2 A;  4YOW A;  5AQK A;  4CEE A;  4JK7 A;  4YFU A;  4Y0W A;  5ELZ A;  4CED A;  5C12 A;  4BRC A;  5IT9 O;  1BA1 A;  4BRH A;  2P9K B;  2QA4 N;  1BIZ A;  1SKR A;  1Z05 A;  3OYE A;  1L3U A;  3CCM N;  1VAZ A;  1YJ9 N;  3K0S A;  4YDU A;  3A5N C;  4E7K A;  1HYZ A;  2UUB K;  3HXM A;  2VYP A;  2WTU A;  3ENO A;  1WAJ A;  1ZXO A;  3E9O A;  1VQ9 N;  4CFA A;  1GLF O;  1NLV A;  5AQR A;  4KKO A;  2KKZ A;  3MN6 A;  5C2F A;  4BR0 A;  1CXQ A;  3EY1 A;  1Y64 A;  1G99 A;  3KWG A;  3I8D A;  1VSK A;  3U3G A;  3N4Q A;  1OH5 A;  3TTF A;  3WNG A;  3LWL A;  3H45 C;  3MXM A;  1NBW A;  2CH6 A;  3TAF A;  3F2K A;  4M3T A;  4DU1 A;  3IG1 A;  2HBM A;  2OAN A;  4FJI A;  4XH4 A;  1BA0 A;  2XRI A;  2ATQ A;  3NBP A;  3CCU N;  1NK0 A;  2WBN A;  1X9W A;  1WSG A;  4B9N A;  1WNS A;  3LDO A;  4EP5 A;  4FZZ A;  1S1W A;  2A5X A;  1J53 A;  4IEE A;  4FJ7 A;  3U4L A;  1O1W A;  3GL1 A;  1L3V A;  5HL7 L;  4CHQ A;  1NGH A;  4Z4C A;  1TYQ B;  1HKG A;  3ZSZ A;  4DFK A;  2YNG A;  4BRP A;  4K43 A;  4Z4I A;  3E9L A;  2ITM A;  1NGC A;  3KZB A;  4LH5 A;  3G6E N;  2XHB A;  3O1B A;  2GV9 A;  3CCJ N;  3DM2 A;  2O8F A;  2YJF A;  2YKM A;  4FWQ A;  4I7F A;  5KGX A;  3ENH A;  1HNZ K;  2IVN A;  3OJU A;  4KH6 A;  4CF2 A;  4BRF A;  4FLT A;  2YCH A;  3MX2 A;  3AAP A;  5AQQ A;  3LAM A;  3DXK B;  1KVC A;  3CG7 A;  2NLX A;  3IKM A;  4BG8 A;  3E01 A;  4QS7 A;  4CF0 A;  1SS6 A;  1NKC A;  2QKB A;  2NRH A;  3CQY A;  4DF8 A;  4BWM A;  1S1V A;  2Y1J A;  1GLC G;  4O44 A;  5F0X A;  1Z26 A;  1Y97 A;  1NWK A;  3ULE B;  2E8A A;  3THW A;  2F8T A;  1IV0 A;  1NG9 A;  3E9P A;  3RR7 A;  4LFC K;  3SQ0 A;  2YHX A;  3CCQ N;  3MAQ A;  1E4G T;  3QIO A;  1FKP A;  3OYL A;  1RTI A;  4CJK A;  3BP8 A;  4JD2 A;  3NHG A;  4ELT A;  3D6R A;  4DTR A;  4KO0 A;  1YIJ N;  1XHZ A;  1NK4 A;  2D0P A;  2FSJ A;  4H5N A;  1U04 A;  3M8S A;  4QAG A;  2UUA K;  4I6M A;  4NXM K;  3DXK A;  3KLH A;  4DV3 K;  1BQM A;  1L3T A;  3FR0 A;  1ZBI A;  2RN2 A;  2FBV A;  3SCX A;  4AM7 A;  3D7E O;  4B1U B;  4DKW A;  3EEQ A;  5C25 A;  1VQO N;  4DTX A;  4CBW A;  1LW2 A;  3CCR N;  4DV1 K;  1KCF A;  4J2E A;  3LZI A;  1ITG A;  2W6K A;  3TAN A;  1C6V A;  1SL1 A;  1RT1 A;  1T8E A;  5GIO A;  2G8U A;  1I94 K;  2OTJ N;  1SAZ A;  4F3T A;  4CGG A;  4PY5 A;  3AA5 X;  5HRP A;  4C1N K;  1S6P A;  2HMP A;  1BUP A;  3ZT0 A;  3OYD A;  1QQC A;  1NGF A;  3QET A;  3KJV A;  2P9L A;  3C0B A;  3OVN A;  3MCA B;  3Q7C A;  3ZSY A;  2HST A;  3B6P A;  2GX9 A;  1QZ5 A;  3B6O A;  3BDP A;  2KQ2 A;  3HPH A;  1NGE A;  2Z1G A;  3HK2 A;  4OLA A;  3AVK A;  1R0A A;  4RTF D;  3V1O A;  1O13 A;  4B1X B;  5J2Q A;  5EU7 A;  1NJW A;  4CZK A;  3IAY A;  2IIR A;  1NK7 A;  4FWP A;  5JLH A;  3D2F B;  3VEX A;  3R3L A;  2YKN A;  4CD3 A;  4FM0 A;  4FWS A;  2KHO A;  1KAZ A;  2YJE A;  1VSF A;  1W2B M;  4KHW A;  1C0F A;  2RF2 A;  4CJU A;  3QIN A;  5K14 A;  3K58 A;  1K8K A;  5ADX H;  2IVP A;  2F9W A;  1TK0 A;  1HQE A;  4OO1 J;  4FJX A;  4CEO A;  1VQP N;  3K5M A;  3ZSO A;  1RT2 A;  3CCS N;  3SMP A;  3K57 A;  4JKC A;  3G10 A;  3K5L A;  2O4I A;  4KHS A;  3T7Z A;  3J8A A;  4DLE A;  2E1Y A;  1U2V A;  4EZ6 A;  4ELV A;  4OX9 K;  4OGC A;  4AHV A;  4MLE A;  4DF4 A;  2Q36 A;  3AO4 A;  3NH0 A;  1BU6 O;  2QWR A;  1LAV A;  1NK6 A;  2G8I A;  4AHS A;  3NE6 A;  5AQV A;  1RTH A;  1SUQ A;  4NLC A;  3IS9 A;  4AHR A;  2G8W A;  4WFB L;  4UQG A;  4AM6 A;  4BG9 A;  4ISE A;  3VQB A;  1YUW A;  5GIP A;  4ILJ A;  2YHY A;  4JI7 K;  5I3U A;  4LD0 A;  1TVR A;  3BGR A;  4JKF A;  3WNH A;  1JLB A;  5HBM A;  3SYZ A;  1QVG M;  5LJV A;  3MEC A;  2QKK A;  1WBB A;  4RWT A;  2OPS A;  4DTS A;  4CJR A;  3AA2 A;  1QSY A;  2J4R A;  3PSF A;  1NGG A;  5FRO A;  3A0I X;  2E6L A;  2B6A A;  1RBS A;  2VG7 A;  4ILG B;  3OYH A;  5FPN A;  3DOL A;  1GLL O;  4CJ7 A;  1KSP A;  4M7Y A;  3KK2 A;  2E2Q A;  4DQQ A;  4BC3 A;  4PKH A;  4CFD A;  1VSL A;  2E4L A;  2HHH K;  2UXB K;  2OPP A;  3H46 O;  3H1V X;  1ZBS A;  5F2R A;  3C6A A;  4DS5 A;  2VGM A;  3HM9 A;  5HLF A;  4O8K A;  4DMN A;  5JVH L;  1RDU A;  4BRD A;  1P90 A;  5D3G A;  4KH5 A;  3QB0 A;  3VEO A;  2ASM A;  4JI4 K;  4W5O A;  2HND A;  4JK8 A;  4LY7 A;  4BR2 A;  4B9M A;  4FLZ A;  3HRG A;  1S1T A;  1T6C A;  3QLH A;  5M1Q A;  2UXC K;  4WQ5 A;  2RHK A;  4IOA L;  4RW7 A;  3DXM B;  1ESV A;  1IKV A;  4LF6 K;  5HRR A;  1T03 A;  4RW4 A;  4E89 A;  4DR1 K;  4PA1 A;  3TSP A;  1SKS A;  4H0P A;  2GWJ A;  3VF2 A;  1KLM A;  4BRQ A;  1JJ2 M;  4ICL A;  1HNW K;  4FK2 A;  1WSI A;  3EE9 A;  1GLE G;  3C95 A;  3DRS A;  5AQT A;  2IC3 A;  3WUH A;  4A5B A;  3LDQ A;  3U9Z A;  4LF5 K;  4HHT A;  1T44 A;  3LDS A;  3VA3 A;  1T05 A;  4U67 L;  4X66 K;  2HBL A;  3ZT2 A;  2BAN A;  3AY9 A;  2HVH A;  4DR7 K;  1EQY A;  3OYM A;  4FLU A;  2JGU A;  4A61 A;  3V4I A;  1HJO A;  4JN4 A;  3G25 A;  5M1F A;  3RMD A;  1ZYQ A;  1WBD A;  2WOM A;  4HUE A;  2E1Z A;  3ZSW A;  3V9X A;  2ASO A;  4A2A A;  1X3M A;  3SBG A;  1N5Y A;  2VG5 A;  4N41 A;  5FPM A;  4IDK A;  2E5L K;  3VER A;  4CZG A;  4CJ5 A;  3SPZ A;  1JL2 A;  4PKG A;  5JS1 A;  1VQ7 N;  4CJ4 A;  1W97 L;  2HHQ A;  4CK2 A;  4IO8 A;  2BDP A;  5AQM A;  4K0K K;  1HNX K;  5AQO A;  2P9I B;  4NYN A;  1L5U A;  5EX5 A;  1FJG K;  5AQI A;  2FC0 A;  2HB5 A;  1S1X A;  4Q5V A;  4BVP A;  3RWU A;  4FVM A;  3VGL A;  3VQQ A;  2YNH A;  3FFI A;  4DV5 K;  3O5B A;  2P9I A;  1SQK A;  3TSQ A;  4EHU A;  1BGX T;  1VSE A;  4FJH A;  3QEW A;  4WF9 L;  3TU5 A;  4PKI A;  4WFA L;  2F7T A;  3FZH A;  1D8Y A;  1DLO A;  3VEY A;  3TAQ A;  5F1X A;  4OPK A;  3K5N A;  3W0L A;  4FLY A;  3MX5 A;  2W41 A;  1EKE A;  5TKY A;  3NDK A;  3WXM B;  1NK9 A;  4DG1 A;  2IOC A;  3KVG A;  1W7A A;  4CF9 A;  2AJQ A;  3CQ8 A;  2P9P A;  1NK5 A;  4YNQ A;  4BAC A;  3PO4 A;  3P5J A;  4WE1 A;  3I33 A;  2R7Y A;  3KLE A;  3O9R A;  3QNO A;  4LF4 K;  3I0R A;  5SZT A;  2G8V A;  1NKE A;  3TSU A;  3GDQ A;  4A62 A;  4BR5 A;  3F9M A;  4HCB A;  3RMA A;  2QXF A;  3RRG A;  3DI6 A;  3SZ2 A;  4YHH K;  1IG9 A;  3UIQ A;  5DMR A;  1YTU A;  3C6U A;  4CF8 A;  2H3G X;  1KFS A;  1ATN A;  3SJH A;  1ZBF A;  3O4N A;  3OY9 A;  4OLB A;  2DTU A;  4CHP A;  4ISG A;  3FFK B;  3QEP A;  3H1Q A;  3TR8 A;  1RT6 A;  4OGE A;  4JNE A;  1E3M A;  3R9P A;  4KTQ A;  2KW4 A;  1DEJ A;  4KHP K;  1ZBH A;  3U3Y A;  2E88 A;  3T1Y K;  2HF4 A;  4HTL A;  2QXL A;  3L2W A;  4YY3 K;  3OW2 M;  5C10 A;  4H0Y B;  5FPE A;  1U47 A;  1BHL A;  1MU2 A;  1OH7 A;  4GNI A;  4H8K A;  4CGF A;  4DSI A;  2KZM A;  3HO1 A;  3ZLJ A;  1TV6 A;  4H4M A;  3J80 O;  3CJA A;  2D4W A;  1TGO A;  3T1A A;  4CK1 A;  4FLX A;  2WUS A;  4DTJ A;  4DR4 K;  1TK5 A;  4CK3 A;  2F4V K;  3QFP A;  5C15 A;  5GAD P;  1IO2 A;  1NJI O;  2ZWH A;  3E66 A;  4OVL A;  1JLG A;  2NRT A;  2HNZ A;  2DPN A;  3QFU A;  3AO5 A;  4OJR A;  2IGI A;  1RT3 A;  5AQF A;  2PYJ A;  4BRM A;  1WSJ A;  3P83 D;  5AQX A;  1LV5 A;  4CES A;  4FWL A;  2KFN A;  3GE1 A;  2P9S B;  3ZYY X;  1IBL K;  4JLH A;  1NGD A;  2RPI A;  4CVN E;  4HWI A;  4JKE A;  4CEZ A;  1J54 A;  1HYV A;  3AAR A;  3CM6 A;  3P4I A;  5KPT A;  4CJP A;  1U2V B;  3DLB A;  1XHX A;  1YVN A;  3O80 A;  4WYB A;  2Y1I A;  3TAP A;  3KKR A;  1LWC A;  3SQ4 A;  3BF3 A;  5EVZ A;  1CZA N;  2HOE A;  5CZ1 A;  4BVO A;  3AA4 A;  2P5G A;  1WAF A;  4AH9 A;  5LL6 Z;  1TUY A;  3TAM A;  2ZE2 A;  3R6M A;  4CJW A;  1IKX A;  3NF6 A;  3NAE A;  3ALY A;  1IH7 A;  2Z1I A;  3NF7 A;  2ZF5 O;  4JS5 A;  3IMX A;  3MXJ A;  4XH1 A;  5AFU A;  1YJN N;  1D5A A;  3VQ5 A;  5BPM A;  1UA1 A;  3THY B;  1YTA A;  4CHN A;  1JXE A;  1YJW N;  3VQ7 A;  3TAR A;  3N4P A;  1XNR K;  4RCH A;  3QDK A;  3SK3 A;  3GBT A;  3EE8 A;  3ATV A;  3ISN C;  4Z4G A;  2HF3 A;  5KI6 A;  1QSS A;  1K9M O;  1BOT O;  5AQY A;  4BC5 A;  4CEB A;  2NUB A;  4YOV A;  2HBK A;  3PY8 A;  4FO0 A;  4NCG A;  1HQU A;  3K9J A;  3ZSV A;  3LP1 A;  1BCM A;  4B8C A;  3ENB A;  3ZET B;  1J5O A;  4CZE A;  1U4B A;  4EHT A;  3HSC A;  4N56 A;  4E7I A;  2QW9 A;  4IZ9 A;  1BL3 A;  2QWN A;  4A59 A;  3HP6 A;  3LDL A;  4G1Q A;  1KTQ A;  2HHX A;  4ZHR A;  4KHU A;  5AZJ A;  5A2Q O;  1CXU A;  4LC9 B;  5GIN A;  1JKH A;  3KK3 A;  4CEA A;  2QI2 A;  4O5F A;  5AQZ A;  4LF8 K;  4CZJ A;  2P9N A;  4O0J A;  3M1F A;  1NGJ A;  4B3S K;  3C94 A;  2X78 A;  1JCG A;  3TTC A;  3ITH A;  1Q81 O;  4GMJ B;  4CEF A;  2QTD A;  3LL3 A;  4KTW A;  4JV5 K;  2FF6 A;  3H3N O;  4DWI A;  1YVU A;  2JWL A;  3NVK A;  4HTU A;  1KC8 O;  4WQ4 A;  2Q2R A;  1MWM A;  3HST B;  3SNN A;  4B1Y B;  4CJT A;  3M5R A;  4GVM A;  4H5R A;  3SV4 A;  4Y1C A;  4BRG A;  4YOX A;  4M7X A;  4Y1D A;  4JS4 A;  2GBZ A;  3QEI A;  1EWR A;  2QWM A;  5TKW A;  3JS6 A;  4F3O A;  3CJ9 A;  4FPA A;  4JI0 K;  3CME N;  1C0M A;  4FSV A;  3L8B A;  2ZQB A;  4WQ5 C;  5FRN A;  2BUP A;  3AVA A;  3A5L C;  4CGJ A;  1QHA A;  4B1Z A;  3HVT A;  2D0B A;  4F2R A;  1GOA A;  2NZT A;  4H5W A;  3V1Q A;  3LWM A;  1VSJ A;  1CZB A;  3D2E B;  2HBJ A;  3AVG A;  1XQS C;  1U45 A;  3DMJ A;  4DSE A;  5LY3 A;  1A5W A;  1OH8 A;  1XWL A;  2VQE K;  2ZD1 A;  4IKF A;  1JL1 A;  2RKI A;  3SQ2 A;  2VGN A;  4CGI A;  1FK9 A;  4RG8 A;  3QNN A;  4I9Q A;  1Q8I A;  4CGD A;  2E2P A;  3CIP A;  2GWK A;  2QM1 A;  4G9Z A;  3AO1 A;  2YX6 A;  1YAG A;  1NNE A;  2FF3 B;  2ITG A;  2ZGY A;  3U9D A;  2UUC K;  3SAF A;  5C42 A;  1FKO A;  1Q9Y A;  5LJW A;  1KAX A;  4O0I A;  3DRP A;  4FJN A;  3P39 A;  3J7Z O;  1YF5 L;  4FVU A;  1BWF O;  3CC4 N;  4H03 B;  5BRF A;  2WFB A;  5KQ8 A;  4JI6 K;  2O8C A;  4JKD A;  1RDB A;  3VQP A;  3CER A;  3THY A;  2LSN A;  1N33 K;  1L3S A;  2X6S A;  1QS4 A;  4CJL A;  2Q31 A;  1KFD A;  4ZTJ A;  1BI4 B;  4DV0 K;  4FZX C;  1QSL A;  1SL0 A;  3VEW A;  3SJJ A;  3PIP L;  2NRZ A;  3O1W A;  2ZJQ L;  1CZ9 A;  1CLQ A;  1BQN A;  1WB9 A;  3TPQ A;  2YV0 X;  4FJ5 A;  3H3O B;  5FDL A;  4KPY A;  1K8A O;  3IDH A;  4CFC A;  1NOY A;  1LOT B;  3WXL A;  4E1M A;  2D1K A;  4I9L A;  2YHA A;  1N6Q A;  3HOS A;  3AGR A;  4EAH D;  1ASV A;  3WT0 A;  1NM1 A;  5E41 A;  1J6Z A;  3B8A X;  5GAH P;  3CF5 L;  3MN7 A;  5BPN A;  3PX4 A;  3TAB A;  3M8R A;  4LFB K;  5E84 A;  1N8R O;  4DS4 A;  3CM5 A;  2PZS A;  1IBK K;  3SAH A;  1UWB A;  3AVL A;  1J5E K;  4B9T A;  1IG8 A;  3PV8 A;  3LPT A;  1VQ5 N;  3MDQ A;  1N36 K;  2P9P B;  5DK5 A;  4B9Q A;  2QWQ A;  1WN7 A;  2Z1J A;  4E1N A;  3ZCM A;  3HPG A;  3KWI A;  3FZK A;  4RW8 A;  5BRE A;  3ZX3 A;  4IWV A;  5M1P A;  2ZGZ A;  1GLJ O;  2OPR A;  4KHN A;  3VA0 A;  2I5J A;  3ZEU A;  4V19 S;  4B9L A;  1OKJ A;  4DUY K;  5LMN K; 
#chains in the Genus database with same CATH homology
 4CJ4 A;  3S3M A;  2G8F A;  4J2D A;  3OYC A;  3ZSR A;  2HHQ A;  4CK2 A;  3DLR A;  2BDP A;  4FJG A;  3LPU A;  3HVR A;  1EXQ A;  3DLG A;  1FXX A;  1GOC A;  3I0S A;  4R5P A;  4NYN A;  3LP2 A;  1L5U A;  4KI6 A;  3QES A;  3NCI A;  1U45 A;  4OPJ A;  1XC9 A;  1YTU A;  2ETJ A;  4OKK A;  3VQE A;  5HRS A;  3KKS A;  2FC0 A;  5CY4 A;  3OYI A;  3HPO A;  2HB5 A;  1S1X A;  4RW6 A;  2OPQ A;  2D0C A;  3M8Q A;  2P1J A;  4HVJ A;  1VSH A;  4CER A;  1B92 A;  4Q5V A;  3RWU A;  4FYD A;  5J2N A;  3AA3 A;  2WON A;  1D9F A;  2GUI A;  4CE9 A;  3OYG A;  1TL3 A;  4FVM A;  3DLH A;  3AVN A;  1VRT A;  3D45 A;  3VQQ A;  4CEE A;  4CJ3 A;  5HP1 A;  4YFU A;  2YNH A;  5J2M A;  2IAJ A;  3FFI A;  4CED A;  1X9M A;  1JXB A;  1REV A;  4FK0 A;  1BIZ A;  1SKR A;  1BGX T;  1VSE A;  4FJH A;  3QEW A;  3HJF A;  3OYE A;  4FZY A;  2HHS A;  1WLJ A;  4M41 A;  2HHW A;  1X9S A;  3OYF A;  4ID1 A;  1L3U A;  4KHQ A;  2P5O A;  3ULD A;  4DTO A;  4IFV A;  3M8P A;  3HP9 A;  4E7K A;  3OYN A;  1D8Y A;  1DLO A;  1HYZ A;  2X6N A;  3HXM A;  4ZTF A;  1SKW A;  3PX0 A;  3TAQ A;  3ZT3 A;  4OPK A;  3K5N A;  4FLY A;  4DSF A;  1UOC A;  1F21 A;  1WAJ A;  1EKE A;  1JLQ A;  1B9F A;  3QER A;  3NDK A;  2VWJ A;  4CFA A;  4I2Q A;  1NK9 A;  4DG1 A;  2IOC A;  5T7B A;  4PUO A;  4CF9 A;  1DTT A;  3D0P A;  3PX6 A;  2AJQ A;  4KKO A;  3AVH A;  5FRM A;  1S9G A;  4E7L A;  3CQ8 A;  1CXQ A;  4LSL A;  1TKT A;  3EY1 A;  3QO9 A;  3I8D A;  4YNQ A;  4BAC A;  4M3R A;  4W5R A;  1NK5 A;  3P5J A;  1VSK A;  5J1E A;  4WE1 A;  3PO4 A;  3U3G A;  1ZBL A;  2R7Y A;  3KLE A;  3WNG A;  3LWL A;  3SUN A;  2D0A A;  3QNO A;  3I0R A;  5SZT A;  2G8V A;  4J2B A;  3MXM A;  1NKE A;  3TAF A;  4M3T A;  3L2U A;  4DU1 A;  4HCB A;  3IG1 A;  4FJ9 A;  1TAU A;  3RMA A;  2KZZ A;  4IBN A;  4CJS A;  1S1U A;  2QXF A;  3WNF A;  4FJI A;  3RRG A;  4M3U A;  2XY8 A;  4FW1 A;  3DI6 A;  3T19 A;  4N76 A;  3SZ2 A;  3C6T A;  1NJY A;  4F8R A;  3LAK A;  4PWD A;  3KD5 E;  4PQU A;  1C1A A;  2XRI A;  1IG9 A;  3UIQ A;  4FJ8 A;  1C0U A;  2B4J A;  2ATQ A;  5DMR A;  3NBP A;  3DRR A;  4DLG A;  1ASU A;  3SQ2 A;  1LWE A;  1NK0 A;  3C6U A;  1RTD A;  2PY5 A;  2QK9 A;  4CF8 A;  1BIU A;  3V9Z A;  1KFS A;  1HRH A;  1X9W A;  1WSG A;  4B9N A;  1ZBF A;  3O4N A;  4C8K A;  1WNS A;  4EP5 A;  2HHV A;  4J2E A;  1SV5 A;  1S1W A;  4FZZ A;  1J53 A;  3OY9 A;  4CHO A;  4DQR A;  2DFH A;  4F2S A;  4FJ7 A;  4OLB A;  1O1W A;  5I42 A;  1A5X A;  1L3V A;  1BI4 A;  3AO3 A;  4CHP A;  4CHQ A;  1NK8 A;  4L8R B;  2DTU A;  1RBT A;  1QE1 A;  3QEP A;  3OS0 A;  4B9U A;  2IS3 A;  1VRU A;  3TR8 A;  3K2P A;  1RT6 A;  4OGE A;  4Z4C A;  3HL8 A;  4KTQ A;  4DFM A;  3ZSZ A;  4O5B A;  3NGZ A;  4DFK A;  2KW4 A;  2A1S A;  2YNG A;  4CJV A;  4FJL A;  4Z4I A;  1ZBH A;  2X74 A;  4KFB A;  3V6D A;  4FLW A;  4DTU A;  3U3Y A;  1LWF A;  4C8M A;  4LH5 A;  3L2W A;  1B9D A;  3ZT1 A;  5JS2 A;  2XHB A;  3HYF A;  2VWK A;  2GV9 A;  1NJZ A;  3DM2 A;  3G0Z A;  1U47 A;  1EET A;  4Z4E A;  4Z4H A;  1BHL A;  2YKM A;  1MU2 A;  4I7F A;  5KGX A;  1NKB A;  3P1G A;  2FBX A;  3OJU A;  2VG6 A;  4H8K A;  1C0T A;  4CGF A;  4CF2 A;  5J2P A;  4DSI A;  4H4O A;  3DOK A;  4E0D A;  4FLT A;  3HO1 A;  4KRE A;  1TV6 A;  4H4M A;  2KZM A;  1TGO A;  3LAM A;  3T1A A;  1HPZ A;  4Z0U A;  1KVC A;  3F9K A;  4CK1 A;  4FLX A;  3CG7 A;  1G15 A;  4CEC A;  4DTJ A;  1IKW A;  4B3O A;  1TK5 A;  1T7P A;  4CF1 A;  4CK3 A;  3QEX A;  1RBR A;  1TKX A;  3E01 A;  4CF0 A;  3TAG A;  3L2Q A;  2BGG A;  1IO2 A;  1NKC A;  2QKB A;  3OYA A;  3SUQ A;  4AHC A;  4DF8 A;  2HMI A;  4OVL A;  4BWM A;  1JLG A;  2HW3 A;  1QHT A;  2P51 A;  2HNZ A;  3AO5 A;  1S1V A;  1WSF A;  2IGI A;  4OJR A;  1RT3 A;  4O44 A;  2Y1J A;  2PYJ A;  2KTQ A;  1WSJ A;  4K8Z A;  3P83 D;  4C8N A;  1Z26 A;  4EZ9 A;  1LV5 A;  4CCH A;  1VSD A;  4CES A;  1Y97 A;  4IFY A;  2KFN A;  4JLH A;  4DTP A;  2RPI A;  4CIE A;  1WSH A;  3PUF A;  1ZBU A;  4CEZ A;  1J54 A;  1S9E A;  1HYV A;  3CM6 A;  3LP0 A;  4O55 A;  3T3F A;  2F8T A;  4CJP A;  4W5Q A;  4J2A A;  3DLB A;  1XHX A;  3V9U A;  3RR7 A;  2Y1I A;  3SQ0 A;  3TAP A;  1RT7 A;  3KKR A;  3MAQ A;  2DY4 A;  1LWC A;  3KLI A;  1FKP A;  3QIO A;  3OYL A;  3SQ4 A;  3RMC A;  2G8K A;  1KRP A;  5KRS A;  1RTI A;  5CZ1 A;  3DLE A;  4CJK A;  4FJM A;  3AA4 A;  1NJX A;  3NHG A;  3O3F A;  1WAF A;  2P5G A;  4ELT A;  4AH9 A;  4KO0 A;  4DTR A;  1HYS A;  1XHZ A;  1NK4 A;  4N5S A;  4IG0 A;  1JLF A;  2ZE2 A;  2D5R A;  1K6Y A;  1EP4 A;  3TAM A;  1IKX A;  4CJW A;  1U04 A;  3M8S A;  3NF6 A;  4QAG A;  3NAE A;  3ALY A;  3KK1 A;  1IH7 A;  3KTQ A;  2Z1I A;  3KLH A;  3NF7 A;  1BQM A;  1L3T A;  1HMV A;  3OS2 A;  4JS5 A;  1ZBI A;  2RN2 A;  2FBV A;  4DTN A;  3MXJ A;  4OKE A;  3SCX A;  4DSL A;  1HJR A;  4HUF A;  3VQC A;  5C25 A;  4E7H A;  1D5A A;  3VQ5 A;  4DTX A;  1UA1 A;  1LW2 A;  1YTA A;  4CHN A;  1JXE A;  3OS1 A;  1KCF A;  4OKJ A;  3VQ7 A;  3LZI A;  1ITG A;  2XY7 A;  1TK8 A;  4F4K A;  3TAN A;  1C6V A;  3TAR A;  4FJK A;  1JLC A;  1SL1 A;  1RT1 A;  1T8E A;  2YNF A;  2EHG A;  1EX4 A;  4M45 A;  3MEG A;  2G8U A;  3KLG A;  4BDY A;  4FJJ A;  4MQ3 A;  1BCO A;  4DU4 A;  1RT4 A;  1DTQ A;  3ISN C;  2XO7 A;  5KI6 A;  4Z4G A;  1QSS A;  4F3T A;  4CGG A;  1WSE A;  3H08 A;  4PY5 A;  3AA5 X;  4CEB A;  5HRP A;  1S6P A;  2NUB A;  4JRQ A;  1RT5 A;  4EP4 A;  3PY8 A;  4NCG A;  3ZSQ A;  3ZT0 A;  1HQU A;  3O3H A;  3SI6 A;  4CEQ A;  3OYD A;  1QQC A;  3O3G A;  4FCY A;  3QET A;  3ZSV A;  4TSX A;  2YHB A;  1BCM A;  3LP1 A;  3KJV A;  4B8C A;  3TWH A;  2OYQ A;  3OVN A;  4HCC A;  4M3Y A;  3ZSY A;  1HNI A;  3B6P A;  1J5O A;  3OJS A;  1U4B A;  1U49 A;  3B6O A;  4C8O A;  3HT3 A;  3BDP A;  2KQ2 A;  4N56 A;  4E7I A;  3SPY A;  3HPH A;  1W0H A;  1RDA A;  1BL3 A;  2Z1G A;  3HK2 A;  3MXI A;  2W42 A;  4OLA A;  3AVK A;  1RNH A;  4KAZ A;  1R0A A;  3HP6 A;  4RW9 A;  3V1O A;  2Q3S A;  4CIG A;  5J2Q A;  2OZM A;  5EU7 A;  1KVB A;  4G1Q A;  3JSM A;  1NJW A;  1NOZ A;  1S5J A;  1KTQ A;  3IAY A;  2HHX A;  4ELU A;  3CFO A;  4ZHR A;  4KHU A;  4KHY A;  1NK7 A;  4FK4 A;  1CXU A;  1C1C A;  3KK3 A;  1JKH A;  3L3U A;  4CEA A;  2EX3 A;  2YKN A;  3AO2 A;  3S9H A;  4FM0 A;  4O0J A;  3VQA A;  2F8S A;  4E3S A;  1VSF A;  4DQI A;  4M3W A;  3C94 A;  2X78 A;  4KHW A;  2RF2 A;  3ITH A;  3QIN A;  4CJU A;  2A1R A;  4CJF A;  4I2P A;  4B9V A;  5K14 A;  4GMJ B;  3K58 A;  4CEF A;  3THV A;  2HVI A;  4KTW A;  1TK0 A;  3RTV A;  1HQE A;  4DWI A;  1YVU A;  3K59 A;  4FJX A;  3AVJ A;  3S3N A;  4CEO A;  3NH1 A;  1ASW A;  3AVM A;  3OYJ A;  3K5M A;  4HTU A;  1RT2 A;  4BWJ A;  3ZSO A;  2BE2 A;  3HST B;  3K57 A;  3VQ4 A;  3RMB A;  3WNE A;  3SNN A;  5KGW A;  4CJT A;  3G10 A;  3K5L A;  2HNY A;  2PYL A;  4KHS A;  2O4I A;  1HNV A;  4DLE A;  4GVM A;  3LAL A;  3SV4 A;  1C1B A;  4Y1C A;  4EZ6 A;  4ELV A;  4M42 A;  3V81 A;  4Y1D A;  4JS4 A;  2GBZ A;  3QEI A;  2IDO A;  4OGC A;  3VQ9 A;  4BE2 A;  1I3A A;  4AHV A;  2E6M A;  5CYQ A;  4DF4 A;  1VSM A;  3VN5 A;  3AO4 A;  3NH0 A;  2OZS A;  3V1R A;  3L3V A;  3TI0 A;  4LH4 A;  1TKD A;  4C8L A;  4F3O A;  2G8I A;  1LAV A;  1NK6 A;  1C0M A;  3L8B A;  1LAW A;  4AHS A;  1RCH A;  2ZQB A;  4XIU A;  4W5T A;  4LSN A;  3NE6 A;  3QEV A;  4Z4F A;  3K5O A;  5FRN A;  4CHZ A;  3CFR A;  1RTH A;  1SUQ A;  1Z25 A;  3IS9 A;  3AVA A;  4AHR A;  3TAE A;  4CGJ A;  2G8W A;  4FXD A;  4UQG A;  4DQS A;  4F2R A;  3HVT A;  2D0B A;  4B8A B;  1GOA A;  3NH2 A;  3JYT A;  4IKF A;  3LWM A;  3V1Q A;  4HUG A;  1VSJ A;  1CZB A;  1TL1 A;  4B08 A;  3VQB A;  4QCL A;  3AVG A;  4DSJ A;  3NF9 A;  2F96 A;  5I3U A;  3RRH A;  4LD0 A;  1TVR A;  1RDD A;  3BGR A;  1JLE A;  1S6Q A;  1RDC A;  1JLB A;  3DMJ A;  3WNH A;  4DSE A;  2XY5 A;  3NF8 A;  3CFP A;  3RR8 A;  1A5W A;  5HBM A;  3SYZ A;  1XWL A;  4MFB A;  2ZD1 A;  3MEE A;  1JL1 A;  2RKI A;  1GOB A;  3CYM A;  3MEC A;  4IG3 A;  3VQ8 A;  4CGI A;  1FK9 A;  2OPS A;  4RG8 A;  2QKK A;  4NCA A;  4DTS A;  3QIP A;  3QNN A;  1D9D A;  4KB0 A;  1Q8I A;  4CJR A;  3AA2 A;  1QSY A;  3OYB A;  2G8H A;  4CGD A;  4DFJ A;  3O4Q A;  3ASM A;  3SUP A;  4DU3 A;  4NYF A;  5FRO A;  3AO1 A;  2E6L A;  2FBY A;  2B6A A;  1RBS A;  5KTQ A;  3U6F A;  3S3O A;  2ITG A;  2VG7 A;  1UAX A;  3OYH A;  2KFZ A;  5C42 A;  4CJE A;  1FKO A;  1VK0 A;  3DOL A;  4FLV A;  1Q9Y A;  1KVA A;  3KK2 A;  4DQQ A;  1KSP A;  4KI4 A;  4CFB A;  4O0I A;  3DRP A;  4FJN A;  4CFD A;  4NCB A;  1VSL A;  3AVF A;  2E4L A;  2OPP A;  4M3X A;  4B9S A;  1RBV A;  2B5J A;  3KD1 E;  4DS5 A;  1BIS A;  3HM9 A;  1RDB A;  3VQP A;  5HLF A;  4DMN A;  2Z1H A;  4I9Q A;  3V9W A;  2LSN A;  4E19 A;  1L3S A;  3A2F A;  1W9H A;  3AVC A;  4M3Z A;  2X6S A;  1JLA A;  1QS4 A;  4CJL A;  2HHU A;  3KLF A;  5D3G A;  1KFD A;  4ZTJ A;  4FM1 A;  1BI4 B;  1VSI A;  2OA8 A;  3NGY A;  4FZX C;  1QSL A;  1SL0 A;  3SJJ A;  3PO5 A;  2DFF A;  1CZ9 A;  4BDZ A;  3L2V A;  4BE1 A;  1CLQ A;  1SL2 A;  1BQN A;  3NGI A;  4Q0B A;  4W5O A;  2YV0 X;  2HND A;  1XI1 A;  4FJ5 A;  4LY7 A;  1TAQ A;  4B9M A;  1X1P A;  4FLZ A;  3LZJ A;  5FDL A;  1S1T A;  3QLH A;  1YT3 A;  4KPY A;  2YNI A;  4RW7 A;  4CFC A;  4DFP A;  1IKV A;  4N47 A;  4CHY A;  1NOY A;  2HHT A;  4AHT A;  4KV8 A;  3LP3 A;  5HRR A;  4E1M A;  1T03 A;  4RW4 A;  4KTZ A;  4DSK A;  3SUO A;  4E89 A;  4I9L A;  3SQ1 A;  2YHA A;  1N6Q A;  3ZT4 A;  4PA1 A;  4DTM A;  1SKS A;  4FM2 A;  1KLM A;  4K8X A;  4ICL A;  1RIL A;  3F73 A;  2O4G A;  1ASV A;  3ZSX A;  5HRN A;  1KLN A;  1RTJ A;  4AIL C;  5E41 A;  1UA0 A;  4FK2 A;  1WSI A;  2DFE A;  4KRF A;  3C95 A;  3DRS A;  3VQD A;  4JRP A;  3PX4 A;  3AVI A;  2IC3 A;  3MED A;  3TAB A;  3M8R A;  1QTM A;  2JLE A;  4E7J A;  4CJQ A;  4W5N A;  1LW0 A;  5HRO A;  4HHT A;  3OYK A;  3LDS A;  3VA3 A;  4DS4 A;  1A5V A;  3CM5 A;  1T05 A;  2PZS A;  1TKZ A;  4CGH A;  3VQ6 A;  1UWB A;  3AVL A;  5KRT A;  3ZT2 A;  2BAN A;  4B9T A;  3PV8 A;  3IRX A;  3LPT A;  1Q9X A;  2HVH A;  3OYM A;  4FLU A;  2JGU A;  4O4G A;  3EYZ A;  3V4I A;  4QOZ B;  1I39 A;  4ID5 A;  4AHU A;  1U48 A;  5DK5 A;  2XY6 A;  1WN7 A;  2Z1J A;  3AVB A;  3L2R A;  4E1N A;  3RMD A;  1ZYQ A;  3ZCM A;  3HPG A;  2FBT A;  2WOM A;  4CIF A;  4HUE A;  3V9S A;  3AV9 A;  3ZSW A;  3V9X A;  1J9A A;  4RW8 A;  3KIO A;  3NFA A;  5CYM A;  4BE0 A;  4BDP A;  1N5Y A;  3EZ5 A;  2VG5 A;  4DQP A;  2OPR A;  4GW6 A;  3SV3 A;  4N41 A;  4FW2 A;  4KHN A;  3VA0 A;  2I5J A;  3DYA A;  4IDK A;  4KB1 A;  5CZ2 A;  4CJ5 A;  3SPZ A;  1JL2 A;  3DLK A;  1IKY A;  5C24 A;  5JS1 A;  5SWM A;  4B9L A;  3LAN A;  1RBU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...