4CJVA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
153
structure length
149
Chain Sequence
SSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 55
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cjvA00
4FK4A 2VWKA 3H08A 3KIOA 4CE9A 4C8KA 3L2WA 3LP3A 4DS5A 1XC9A 1YVUA 2RN2A 4EP4A 4JRQA 5KI6A 4DTJA 3SI6A 1SKSA 1WSJA 3I0RA 4K8ZA 5C42A 1EKEA 4CF9A 3AVAA 3TANA 3UIQA 4BE0A 4B8AB 1ZBLA 2DTUA 4O4GA 1CZBA 4DSEA 4DS4A 2RPIA 4CK1A 1QSYA 4BDPA 3L3VA 1X9MA 4QAGA 5KGWA 1HYVA 3KK3A 3HPGA 4OVLA 2YNHA 3DRPA 3I0SA 5FRNA 5FRMA 4CEOA 2OZSA 3NF6A 1J5OA 2F8TA 4OPJA 1IKWA 4JRPA 4N56A 3RRHA 3VQAA 4DTOA 3CFOA 3VQCA 4E89A 4CESA 4CEAA 3M8RA 5HRNA 1LAWA 1JLGA 2IAJA 3DLRA 3V1OA 1RDBA 4BACA 4J2BA 2HHXA 1MU2A 2XY6A 4CEDA 2QKBA 1WN7A 4YNQA 4ZTFA 1XI1A 1HQEA 3KLHA 1TAUA 3LP0A 5CZ1A 4GW6A 4DFPA 1LAVA 4CJEA 4CCHA 4GMJB 3ZSOA 4OLBA 4DLGA 4B9TA 3NGZA 3PO4A 1RCHA 4W5NA 4E3SA 1LWCA 2XRIA 3L2QA 2XY5A 4CJQA 2KTQA 1RT6A 3HJFA 1RT1A 1C1AA 1O1WA 2ETJA 4LSNA 3O3GA 1RNHA 5HP1A 4M3TA 2HVIA 4J2EA 4DQQA 1HRHA 4KHQA 3C94A 3ZSVA 4BE2A 3NGIA 3V4IA 4KV8A 2G8IA 1HMVA 2HNDA 4OKJA 3U3YA 4WE1A 4DWIA 4EZ9A 1XHXA 3EY1A 3AA4A 4YFUA 1NJWA 3HPOA 3LAMA 2OPPA 4DG1A 4GVMA 2YKNA 3WNHA 4CK2A 1HYSA 1WSEA 2GV9A 3LANA 1RBUA 2RKIA 1RTJA 1VSEA 3DI6A 4IG0A 4CJ4A 4W5TA 4W5QA 3SJJA 3OYMA 1T7PA 3OJUA 3L2VA 4DF4A 1RBVA 3FFIA 2GBZA 1HQUA 1HPZA 1TVRA 3CG7A 3OYGA 1TV6A 4CJLA 3OS2A 5J2QA 1F21A 1TAQA 4IBNA 4DF8A 4CEZA 1RBTA 1UOCA 3NF7A 1S1VA 3MECA 3DRRA 5E41A 3PX6A 4FYDA 3KK1A 2E6MA 2P5OA 2FBTA 5JS2A 1C0TA 1U04A 4AHVA 2Y1JA 5J2NA 1TKDA 3LP2A 3D0PA 5CY4A 2VG5A 3K57A 4W5OA 1HJRA 2F8SA 3K5LA 2PZSA 1KVCA 2D0AA 4EP5A 4FLVA 4RW7A 4F3OA 3NHGA 1RTDA 1EXQA 4OKKA 4CHPA 4OKEA 2P5GA 2QK9A 4B8CA 3CFRA 4LY7A 4BWJA 3VQ6A 3OYEA 4J2AA 1KSPA 1A5VA 1RT2A 3KTQA 1GOAA 3EZ5A 5KTQA 5CYQA 4HUGA 3SPYA 4FZXC 4NCAA 2DFHA 4L8RB 3SZ2A 2P1JA 1RT3A 1KFSA 3SUPA 4KRFA 4CFDA 2IC3A 4QOZB 3NBPA 2HHTA 2D0BA 3AA2A 3RMCA 3ZSXA 1TK5A 2FBYA 4QCLA 2O4IA 2ZE2A 1RDCA 1YT3A 1JLQA 2F96A 1NKBA 1N6QA 3RRGA 3NH0A 1A5WA 5J2MA 4CJFA 2KW4A 4NYNA 4CGFA 3SV4A 4LD0A 2WONA 3WNEA 4FZZA 1JLEA 3CFPA 3M8SA 3SUQA 4PA1A 3U3GA 3KJVA 3K58A 3DM2A 1DTTA 3TAEA 3QEPA 3TAGA 4KFBA 3SNNA 3JYTA 1NOZA 1ASUA 2EHGA 1FKOA 2NUBA 5CYMA 1ZYQA 4FJ9A 2DFEA 1BGXT 1LW2A 4CIGA 4AHCA 1T05A 3KLIA 1VRUA 3O4NA 3KD1E 4F2RA 1VSJA 3IRXA 2QKKA 4NCGA 3TWHA 3JSMA 1REVA 1KVAA 1WSIA 1Q8IA 4DFJA 1U45A 3E01A 1RBSA 3IS9A 3KK2A 3P83D 4E7JA 4FJ7A 1BIZA 4M41A 1IH7A 4KHUA 4Z4FA 4DSLA 4F8RA 3S3MA 1Z25A 3LAKA 2KFZA 1CZ9A 3ISNC 2PYLA 3ZSRA 4CHYA 2B5JA 4KHSA 1ITGA 4CGGA 4C8NA 5EU7A 3HVRA 1TKZA 1BI4A 1C0UA 1RTIA 4FM0A 5FDLA 4HUFA 1K6YA 4FLWA 3AVNA 4O55A 1N5YA 4CGIA 3CQ8A 1GOCA 2Z1GA 2Z1HA 3VA3A 1Y97A 2IDOA 3TAQA 1TK8A 1L3VA 4AHSA 3SQ4A 4UQGA 4DU4A 1QHTA 3K2PA 2E6LA 4CERA 4PUOA 4CHNA 4LH4A 4HCCA 4BE1A 2HNZA 3T3FA 4CIEA 4XIUA 1Q9XA 4KO0A 3MXJA 4FJ5A 4M3UA 2HVHA 3M8PA 3QESA 5KRSA 3HP6A 4MFBA 3SCXA 1C1BA 1ZBFA 2A1SA 1VSDA 4E1NA 3PV8A 1NKEA 4CJTA 4KB0A 3BGRA 3AO5A 1QS4A 4CF8A 1FKPA 4LSLA 1FXXA 1RBRA 2HNYA 1NK7A 2PYJA 4EZ6A 3ZT2A 3TARA 1DTQA 4HCBA 3ASMA 3OYLA 3AVGA 4HTUA 3MAQA 3MEDA 3ZSQA 2G8FA 4CF1A 3THVA 4OLAA 1IKVA 3C6TA 3QIOA 3QLHA 4RW6A 2KZZA 1BQMA 1GOBA 4FJJA 3HM9A 3TAPA 3MXIA 3AVCA 2BE2A 1S1TA 4H4OA 1JXEA 4AHTA 3O3HA 3G10A 2IOCA 4CEFA 2IGIA 3HYFA 3OYHA 2PY5A 4CIFA 4Y1DA 2YNFA 2KQ2A 4M3XA 4I2PA 1JLCA 1LWFA 1NK6A 4CJSA 4M3ZA 1J53A 5HRPA 5JS1A 2YHBA 1DLOA 3PX0A 1XHZA 4RG8A 4O5BA 4B08A 1VSLA 3DOKA 1NK9A 4KHWA 4CJUA 3SQ1A 4JLHA 4B9SA 1EX4A 5FROA 3NAEA 3DRSA 3QEVA 4E7LA 2OPRA 3CM6A 3AVHA 3NFAA 3OVNA 2E4LA 3KLGA 3NF8A 4CFCA 5J2PA 4DSFA 4KREA 2OYQA 4DTNA 3TAMA 4CF2A 4FLXA 4Z4CA 1BQNA 4ZTJA 3S9HA 4DLEA 4FJKA 5SWMA 1QE1A 1D8YA 1BL3A 2YNGA 4IFYA 3NE6A 2EX3A 1JL2A 2JLEA 1S9GA 3SUNA 1S5JA 4PY5A 3L3UA 4O0IA 2VG6A 1B9DA 1RILA 4LH5A 2HHSA 4PWDA 3PY8A 3TAFA 1CLQA 1NJZA 4DTMA 3C95A 3S3NA 4OJRA 5HLFA 3OS1A 4FM1A 3T19A 4AILC 5DMRA 3DLHA 1S6QA 3AV9A 3VQ5A 2HMIA 4O44A 2HB5A 2BANA 1QSLA 3PO5A 3AA3A 4CFAA 2B6AA 4DQIA 1HNIA 1NK8A 1XWLA 4NYFA 4DFMA 4CJ3A 1VRTA 2HW3A 1NJXA 1JLFA 4DU1A 4G1QA 1CXQA 1SKRA 1ZBUA 1ASVA 4AH9A 4Q5VA 3V9XA 1KLNA 2G8HA 4DSIA 1RT5A 4CJPA 4FJHA 4FK2A 2Z1IA 3DLBA 1VSHA 4BDZA 1LV5A 1IO2A 1KFDA 3VQBA 3BDPA 1HNVA 4OGCA 3AVMA 3U6FA 4M45A 1SUQA 1U47A 3C6UA 1RT7A 2QXFA 5SZTA 3CYMA 2AJQA 4IFVA 4DTSA 3HSTB 1I39A 2X6SA 4HUEA 4DSJA 4ELUA 3G0ZA 2FBVA 4CHZA 4DQRA 1JLBA 1W9HA 3SYZA 3AO3A 2BDPA 2HHVA 2OPSA 4H8KA 4FVMA 1SL1A 3F73A 2A1RA 3VQ9A 3ULDA 3VQDA 4FJGA 4KHYA 2KZMA 4B9MA 1WNSA 3OY9A 4FCYA 1J9AA 4I7FA 5KGXA 1TL3A 3TI0A 1KRPA 3AA5X 1WLJA 2BGGA 3P5JA 1WAFA 2ATQA 4B9VA 4CJWA 1NK0A 4F2SA 4DMNA 3RWUA 3PUFA 1JKHA 4CEBA 1SL2A 4CGJA 4E7HA 4NCBA 1BCMA 1KTQA 1VSFA 3I8DA 4CJ5A 4AHRA 5KRTA 3QEIA 1X9SA 1UA1A 1LW0A 1B92A 3LWMA 3AVBA 3OS0A 3O3FA 4Y1CA 5C24A 3NCIA 3QO9A 5HROA 3NF9A 4OGEA 3ZT0A 4M3RA 4CJKA 4Z4EA 2G8VA 1X9WA 2ITGA 1S9EA 3F9KA 4O0JA 1ASWA 4RW9A 3ZT4A 3L2RA 2XHBA 3K5OA 3V9ZA 4E7KA 3SUOA 2DY4A 2RF2A 2KFNA 4KKOA 4MQ3A 1ZBHA 4H4MA 4E1MA 3OYKA 1TKTA 3RR7A 4FJMA 3DMJA 3OYJA 1D5AA 1I3AA 3OJSA 1YTUA 4KAZA 3ITHA 2VWJA 1VSKA 2DFFA 3TABA 4C8LA 3L2UA 2OZMA 1A5XA 2P51A 1BHLA 4I2QA 4HVJA 4Z4HA 3SV3A 1SL0A 3AO1A 2YNIA 3KKSA 1UAXA 1TGOA 3QIPA 3VQ4A 1C0MA 4ID5A 1TKXA 2YV0X 1NK5A 2X78A 3TR8A 4N5SA 1J54A 1C6VA 3K59A 4CHQA 4FLZA 4FM2A 4ELVA 3HVTA 1S1WA 3DLEA 1NOYA 3HK2A 3RMBA 1TK0A 4DTXA 4IG3A 3OYDA 4DTRA 1U4BA 4KI6A 3VQPA 1U49A 3NGYA 1S1XA 2G8WA 3CM5A 4KI4A 2Y1IA 4BWMA 4B3OA 4CECA 1Z26A 4KPYA 2FC0A 4KTWA 1YTAA 3ZT3A 5J1EA 1L3UA 1RDAA 3M8QA 2OA8A 1IKYA 4FZYA 1QTMA 1NJYA 4FW2A 4ZHRA 4JS4A 1RTHA 2ZQBA 2B4JA 3MEGA 4CEEA 3HO1A 1KVBA 3OYBA 1BCOA 3ZT1A 3LZJA 1WAJA 4Z0UA 1BI4B 1QQCA 2JGUA 5K14A 4I9LA 3KLFA 3V1QA 4Q0BA 2XY8A 5CZ2A 4M3YA 3DLKA 4TSXA 1CXUA 2I5JA 3QINA 4DU3A 3LWLA 2YKMA 2WOMA 3MXMA 4E0DA 3QNOA 4N41A 3LPTA 3VA0A 3DLGA 2R7YA 2XY7A 2O4GA 4B9LA 1B9FA 1BIUA 1VK0A 4FLYA 4ELTA 3B6PA 1UA0A 3VQ8A 2OPQA 1IKXA 3HXMA 5I42A 3HPHA 2D5RA 3V9WA 1KCFA 4OPKA 3KD5E 4F4KA 3O4QA 1WSFA 3AVKA 4CGHA 2D0CA 3LP1A 3NH2A 3RMDA 4FJIA 4CK3A 4JS5A 2ZD1A 4PQUA 3EYZA 1L5UA 3LALA 3VQQA 4IKFA 4CHOA 4CJVA 4I9QA 1D9DA 4FJ8A 3SQ2A 4W5RA 4FLUA 4KTZA 2VG7A 4HHTA 2Q3SA 5HBMA 1NKCA 2G8KA 4FJLA 3K5MA 3A2FA 2HHWA 4DFKA 3OYAA 3ZSZA 1L3TA 4CJRA 3DYAA 4N47A 3LDSA 4E7IA 3VN5A 3KKRA 3OYCA 4DTUA 3V6DA 3WNGA 4M42A 1HYZA 1G15A 4K8XA 1WSGA 3AVLA 3AVIA 3ZSYA 1U48A 3QETA 1JL1A 5DK5A 1SV5A 4KB1A 3V9SA 3D45A 4AHUA 3QERA 1VSIA 4FLTA 3WNFA 4CGDA 3LZIA 3L8BA 1QSSA 1JXBA 1S6PA 3KLEA 3NH1A 1Q9YA 1BISA 4FW1A 3PX4A 3OYIA 1T03A 3OYNA 1EETA 2LSNA 1W0HA 5HRSA 1VSMA 3ZCMA 1FK9A 3RTVA 3RMAA 3ZSWA 1L3SA 1T8EA 1D9FA 3ALYA 4FXDA 3T1AA 2W42A 3LPUA 3VQEA 2X74A 1UWBA 3AVFA 2G8UA 1SKWA 1ZBIA 1TL1A 2HHUA 3OYFA 3IAYA 4F3TA 2YHAA 4CF0A 1NK4A 4J2DA 1R0AA 5HRRA 3QEXA 4ID1A 5C25A 1C1CA 3V1RA 4R5PA 3P1GA 4Z4GA 4DQSA 1KLMA 2FBXA 3AO2A 4RW4A 1X1PA 4C8OA 4Z4IA 4DTPA 1RDDA 3V81A 5T7BA 1JLAA 5I3UA 3HL8A 4DSKA 4IDKA 3MEEA 4KTQA 3NDKA 3QNNA 2Z1JA 3DOLA 1IG9A 4CFBA 3VQ7A 3HT3A 4BDYA 2GUIA 4RW8A 3SPZA 3S3OA 4B9NA 4C8MA 4FJNA 2HHQA 3RR8A 3AVJA 4ICLA 4E19A 3QEWA 1S1UA 4FJXA 3AO4A 2XO7A 3K5NA 3V9UA 3SQ0A 1LWEA 5D3GA 1RT4A 3HP9A 4N76A 2IS3A 4FK0A 4M3WA 3IG1A 4KHNA 3B6OA 1WSHA 1EP4A 2X6NA 4B9UA 4DQPA 4CEQA
chains in the Genus database with same CATH superfamily
3LP3A 4JD2B 4DS5A 2RN2A 1XC9A 3THWB 4K8ZA 1EKEA 3ENOA 1I94K 4LF4K 2GTDA 2E1ZA 4R79A 4DSEA 2RPIA 3WEEA 3HPGA 1XQSC 1KAZA 2YNHA 1ZC6A 3I0SA 2OZSA 4OPJA 4JRPA 3VQCA 3FZHA 4IDHA 1LAWA 4JKGB 3DLRA 3GG4A 4J2BA 1LOTB 1HNWK 3R9PA 2VQFK 1WN7A 2QKBA 4BRKA 3LP0A 4GW6A 3ZSOA 4DLGA 3CJBA 3UKRA 3U9DA 3CQYA 3SMPA 1LWCA 2KTQA 4CJQA 1RT1A 2HVIA 1RNHA 2P9IA 4H5VA 4XH4A 3NGIA 3V4IA 2VWBA 1NJIO 2HNDA 1IJJA 4WE1A 4IFEA 3EKSA 3O4WA 3M1FA 4BRCA 1NJWA 2OTLN 2GV9A 1RTJA 5HL7L 3EZWA 4IEEA 3BZCA 5MLCQ 1VQPN 1K8AO 1HQUA 1HPZA 3OYGA 4L3QA 1TV6A 5J2QA 1F21A 4IBNA 4DF8A 4A61A 1UOCA 5E41A 2QWNA 4AHVA 1TKDA 4PHTX 3K57A 5GAHP 3O80A 2D0AA 4F3OA 3NHGA 4K42A 4B8CA 2D0PA 3VQ6A 2FSKA 4J2AA 2H3GX 4FWSA 4ISFA 3WQTA 5CYQA 4NCAA 4L8RB 1RT3A 1KFSA 3WXJA 4CFDA 3A5LC 3FZLA 2D0BA 3AA2A 2FBYA 1JLQA 1N6QA 2NRVA 1A5WA 3NH0A 4DHYA 4LD0A 1JLEA 5LJVA 3SUQA 4RCHA 1DTTA 3TAEA 3B8AX 3FZKA 4HTLA 1BO5O 2PFUA 1ASUA 2EHGA 4FJ9A 1BGXT 4CIGA 4BG9A 1VRUA 4FWNA 1VSJA 3IRXA 2OTJN 3TPQA 4JK8A 4M3WA 3KK2A 3P83D 4KHUA 1BIZA 1IH7A 4Z4FA 3ISNC 4K43A 2YHXA 3ZSRA 4KHSA 4C8NA 3H6EA 3VEXA 1YHQN 1N5YA 4CGIA 5EY4A 3Q7BA 3J7YP 3VEZA 1QHTA 3K2PA 3CJCA 3ZYYX 1NMNA 3T3FA 4FJ5A 3M8PA 4DKWA 3QESA 5KRSA 4M63C 3PV8A 4FWRA 4KB0A 3AO5A 5AQPA 4CF8A 2ASPA 1RBRA 1G99A 4LF9K 2QM1A 2Q2RA 4CBWA 3OYLA 1H1VA 3AVGA 3THYA 3MEDA 4A2AA 2G8FA 4CF1A 3QIOA 4RW6A 3QLHA 1CZAN 2QXLA 1BQMA 1N34K 3HM9A 3MXIA 3AVCA 2BE2A 1S1TA 4AHTA 2NRRA 2QWQA 3O3HA 3G10A 4CEFA 2HHHK 5AQWA 4Y1DA 3FFKB 3VF4A 4I2PA 5M1PA 1ATRA 1J53A 3PIPL 1WOQA 3CD6N 2YX6A 1NK9A 4JLHA 4EFHA 1EX4A 4LC9B 1QZ5A 3LDQA 2AP1A 3CM6A 5J2PA 4DR6K 3NF8A 4BREA 4DSFA 1WBBA 1T6DA 3PSIA 4BC3A 4FJKA 5SWMA 2YNGA 3NE6A 2EX3A 3HOSA 1S5JA 5JLHA 2VYPA 1RILA 1CLQA 1NJZA 4GKJK 4CZKA 5AQVA 3AV9A 3VQ5A 2ZJPL 4PL7A 2HB5A 4BRLA 2B6AA 1NK8A 3G71N 1SS6A 4CJ3A 1JLFA 4DU1A 4G1QA 2G8HA 1ZBUA 3V9XA 2Z1IA 3DLBA 5AZJA 4B1WB 3VQBA 2O8BA 3EN9A 4M45A 3TSPA 2KLAA 1U47A 3SBGA 4K0KK 5BRHA 1RT7A 5C10A 1KC8O 4IFVA 2X6SA 4JD2A 3ZLJA 4DSJA 3IDHA 3D7EO 5AQHA 3THWA 3SLCA 4DR3K 2OPSA 5KPTA 1QZ6A 4CD1A 3D2EA 3MCAB 3OY9A 3OBWA 5JMVA 4A57A 5KGXA 4WFNL 5BR8K 1KRPA 3AA5X 1WLJA 4FPAA 2Q1NA 1WAFA 4JKGA 4B9VA 3NMUA 3H46O 3PUFA 4CEBA 4LF7K 2RE2A 4XH1A 3VOVA 4CJ5A 3QEIA 2QTDA 3J8AA 5KQDA 1X9SA 1LW0A 5EXWA 3AVBA 3FR0A 3I56N 3RSEB 3VEWA 1VQLN 3BUZB 1X9WA 2ITGA 1ASWA 3L2RA 2DY4A 5AFUA 3LM9A 1HKCA 1Q86O 3OYKA 1X9JA 3DMJA 1D5AA 3BEXA 2RHKA 5KPRA 3ITHA 2VWJA 1NM1A 2P51A 4HVJA 3VQ4A 4JI3K 1J5EK 4BRDA 2YV0X 4M3ZA 4JK7A 3ID6A 4N5SA 4B1YB 1C6VA 3K59A 4FLZA 2CGJA 3LDNA 3OYDA 1FJGK 4FWPA 2G8WA 3CM5A 2Y1IA 4BRFA 2NRTA 4CECA 4KTWA 1YTAA 2F9WA 3ZT3A 1RDAA 4BC2A 1IKYA 2ZJQL 1NJYA 3S3MA 2WBNA 1WAJA 2DPNA 3OA9A 3V1QA 2XY8A 5CZ2A 4M3YA 3DLKA 3CCMN 4B1VA 1NWKA 3ATVA 2E2NA 3MXMA 4RWTA 3J81O 1OVYA 2HBLA 3LPTA 5AQIA 3VA0A 2XY7A 3CC7N 1VK0A 1J6ZA 3L0QA 5I42A 1HKBA 1KCFA 4OPKA 4F4KA 1NLVA 2D1KA 2D0CA 4C23A 3NH2A 3CJ9A 1NG9A 3AGRA 4YOUA 2ZD1A 3EYZA 4B3SK 4CZGA 4I9QA 3SAGA 3ZX0A 1D9DA 3SQ2A 4W5RA 3QFUA 5JVHL 1TYQB 4HHTA 4DR7K 3VF2A 4FOIA 4ILHA 4JI1K 4E7IA 1V4SA 3WNGA 5HOOA 1S3XA 4K8XA 1WSGA 3AVLA 1T44A 1D4XA 1K73O 3AGKA 4YOVA 1SV5A 4KB1A 3QERA 3A5MC 4CW7B 5F2RA 3WNFA 3LZIA 4ELVA 2UUAK 2A40A 1DEJA 2QWPA 2GX9A 3PX4A 3RTVA 1W0HA 3O5BA 3ZCMA 1FK9A 2YHWA 5C12A 1D9FA 2E2OA 2QEXN 1SKWA 3IAYA 2YHAA 4CF0A 1NK4A 4IO9L 1C1CA 3V1RA 4R5PA 5GIPA 5KPZA 1KLMA 3AO2A 4RW4A 1WB9A 4Z4IA 5BN9A 3O1BA 3K0SA 5I3UA 3DWLA 4IDKA 3MEEA 2HF4A 3VENA 3T7ZA 1TUUA 3VQ7A 3DXKB 4H0VB 3CQXA 4BDYA 1S72N 4C8MA 3UE5A 3AVJA 4E19A 3RR8A 2Q31A 3K5NA 4U7BA 3BF1A 2ASMA 5BPNA 5D3GA 3HP9A 4N76A 2IS3A 4FK0A 4DUZK 1EP4A 4B9UA 3PIOL 2VWKA 4CE9A 4IJNA 4C8KA 1GLBG 4YOWA 3SI6A 2PBDA 2GUPA 1SKSA 4FL9A 3I0RA 1HR0K 4CF9A 2FF6A 3AVAA 4JI4K 1ZBLA 2DTUA 3HBTA 1CZBA 4BDPA 2F8SA 3KK3A 1HYVA 5FRMA 1EO1A 3OW2M 3C65A 3VQAA 5TKWA 3M8RA 1JLGA 3CIPA 2HHXA 1RDBA 4BVOA 1XI1A 3I8BA 1W7AA 4A5BA 4DFPA 4F9OA 1NGJA 3NGZA 1Z6RA 2F9TA 1RCHA 4W5NA 1QQOA 1C1AA 2ETJA 3O3GA 4AF1A 1S22A 1HRHA 1WUAA 2VGMA 4B1ZA 4DR4K 4DWIA 1X3MA 1XHXA 1LCUA 2OPPA 4GVMA 3CC2N 5LMNK 3WNHA 3L6QA 2RKIA 4IG0A 3WXLA 4CJ4A 3DI6A 4W5TA 3SJJA 1EWRA 4WF9L 1VAZA 3KWIA 2GBZA 3CG7A 2YJFA 2W40A 3OS2A 4CEZA 1RBTA 3NF7A 3OBYA 3MECA 3DRRA 3PX6A 2P9LB 3KZBA 2E6MA 1FW6A 2P5OA 1C0TA 1U04A 3P31A 2VCPA 5LJWA 3K5LA 2PZSA 4WQ4C 4IOAL 4RW7A 1EXQA 4OKKA 1KD1O 4BWJA 3VGMA 2ASOA 1A5VA 1P8ZA 3Q7CA 5DM7L 4A5AA 2IC3A 2NLXA 1TK5A 3G25A 3ZSXA 3J80O 4QCLA 4BRAA 4KBOA 4NYNA 4CGFA 3SV4A 1IBKK 4LF6K 3KJVA 1MWKA 5AQGA 3QEPA 1NGHA 1GLFO 3SNNA 5CYMA 1FKOA 2NUBA 4K41A 3CERA 2DFEA 4GV3A 1LW2A 3KD1E 5AQSA 2A42A 3R6MA 2A6AA 2QKKA 3NVKA 3TWHA 4I6MB 1Q8IA 4FJ7A 4M41A 3H3NO 5AQXA 3LAKA 2KFZA 4CHYA 2B5JA 1SZ2A 3P39A 4CD3A 4FLWA 4MDAA 4DR5K 4O55A 3CQ8A 3VA3A 3TAQA 4CHNA 4HCCA 4XIUA 3ENBA 1Q9XA 3MXJA 4M3UA 1IBLK 2NZTA 4IOCL 3FZFA 3HP6A 4MFBA 1U2VB 1NKEA 2F7TA 3CPEA 1NGBA 1OKJA 5GADP 1FXXA 1RDUA 2HNYA 1NK7A 4EZ6A 3ZEUB 4H5RA 5IT9O 1XNQK 1TYQA 3AAPA 5C15A 4MO5A 1U6ZA 5BN8A 2KZZA 4FJJA 4NB4A 1JXEA 2P9PB 2YNFA 5EX5A 2YHBA 1XUPO 4RG8A 4O5BA 4JNEA 2P9SB 4V19S 5FPEA 3WXKA 3CCQN 1VQ7N 5F1XA 3MCPA 3ZX2A 4E7LA 2OPRA 3NFAA 3UKUB 3KLGA 4CFCA 4ILJA 4KREA 4BR9A 4DTNA 3TAMA 4CF2A 3CCSN 3A8YA 5AQYA 1DGKN 3R8EA 5CHIA 1BL3A 4IFYA 3SUNA 2D4WA 4PY5A 2VG6A 2BUPA 2Q97A 2HHSA 3PY8A 4DTMA 2OANA 5ADXA 5FPDA 3OS1A 3T19A 4AILC 3DLHA 2HMIA 3CPWM 3CCLN 1T6CA 3O9SA 4FO0A 4O44A 2BANA 4UY8O 3PO5A 3AA3A 2O8DB 3DXKA 4DFMA 2HW3A 1NJXA 1QVGM 4AH9A 4FK2A 1GLAG 4DSIA 4JN4A 3O8MA 5LL6Z 1VSHA 4M7YA 1LV5A 1HNVA 4OGCA 1SUQA 2OCEA 3CYMA 3EL2A 4PKGA 4DQ8A 3HSTB 4QS9A 5C2FA 2NRXA 2FBVA 4DQRA 1JLBA 4MO4A 1NU0A 3SYZA 2BDPA 1GLDG 4H5TA 3BY5A 2HHVA 1Q81O 2UYTA 1SL1A 2NRZA 3VQ9A 2KZMA 4KHYA 1QHAA 3BZKA 1BU6O 3BP8A 3TI0A 4IZ9A 1YI2N 4LF8K 3ZETA 2P9NB 5GAEP 4F2SA 4YOYA 4DMNA 4A62A 4E7HA 5ADXH 1KTQA 3SJHA 4BY9C 2VQEK 1B92A 3OS0A 2FLOA 1HX1A 3W3DA 4Y1CA 3T1YK 3QO9A 3ZT0A 4O5FA 2G8VA 4RW9A 2XHBA 3K5OA 4E7KA 3SUOA 3G4SN 2RF2A 4B3MK 3CJAA 4X65K 2KFNA 1TKTA 3OYJA 1YTUA 3M5RA 3DXMB 4KAZA 5LMUK 2DFFA 3TABA 4C8LA 3L2UA 1A5XA 1SL0A 1BHLA 4I2QA 4Z4HA 2YNIA 1UAXA 4CVNE 3HRGA 4FWLA 3HM8A 3H1VX 2HBJA 2X78A 2HHQA 5AR0A 3RMBA 4X66K 4IG3A 4EAHD 4DTRA 2CGLA 4MDBA 1S1XA 2P9LA 4CZMA 4BWMA 4B3OA 4KPYA 2FC0A 4KHPK 4NLCA 1QTMA 3EKUA 4CEEA 2B4JA 3THXB 5H1SQ 1BCOA 3ZT1A 1KXPA 4Z0UA 3OYBA 1BI4B 2JGUA 1JJ2M 1NGGA 5C0YA 3A5OC 4TSXA 1CXUA 3P38A 3QINA 3SAHA 3LWLA 2YKMA 4DV5K 4WQ5C 4N41A 2FSJA 3C6HA 1B9FA 1BIUA 4BC4A 4FLYA 4ELTA 3B6PA 1IKXA 3CI5A 3D2FB 3HPHA 4KH4A 3KD5E 3RMDA 4FJIA 4CK3A 4JS5A 2A5XA 2P9UB 1L5UA 1YF5L 4IKFA 4CHOA 1ZBSA 3CETA 3WXIA 1MDUB 2VG7A 2HHWA 5HBMA 4BR5A 1NKCA 4FJLA 1VQNN 4JI2K 3W0LA 4I6MA 3V6DA 3OYCA 1HYZA 1BG3A 1U48A 2QW9A 3QETA 1JL1A 2ZF5O 4YDUA 4AHUA 1VSIA 4JKFA 3HZ6A 1N33K 3L8BA 1JXBA 5A2QO 1BISA 3F2KA 3QFPA 3OYNA 5AQMA 5HRSA 1VSMA 4DV3K 1HPMA 3RMAA 1T8EA 4FXDA 2W42A 3R1XA 4BRQA 3PSFA 4JHDB 3LPUA 4ISGA 5F0XA 1TL1A 3CXCM 3OYFA 4F3TA 3GL1A 4J2DA 2ZJRL 3EE8A 3QEXA 1JCFA 3ID8A 5C25A 1U2VA 3P1GA 4Z4GA 2FBXA 1X1PA 4C8OA 3U8XA 5T7BA 1DKGD 1JLAA 3ZEUA 3HL8A 4FWMA 4NXNK 5AQFA 1Y64A 1BWFO 3T1HK 1IG9A 3HT3A 4BQZA 4JKAA 3T69A 3I55N 3N4PA 1RDWX 2P9PA 3V9UA 1Q7YO 3IG1A 4KHNA 2X6NA 4CEQA 4FK4A 2P9SA 4DV2K 3L2WA 4EP4A 3J7ZO 1K9MO 1WSJA 5C42A 1OVQA 3UKUA 1SQKA 3VETA 3F9MA 2UXBK 4BE0A 3A0IX 1VQ8N 3CJ7A 1X3NA 3HJFA 1QSYA 1BOTO 4BVPA 1X9MA 4QAGA 5CE3A 3DRPA 4JKDA 5FRNA 2QI2A 1J5OA 5FPNA 4N56A 2O8CB 4E89A 4CEAA 2IAJA 3V1OA 1MU2A 1VQ6N 1HQEA 5BR9A 1LAVA 4CCHA 3TTDA 3VEVA 4X62K 2ZWHA 2QWMA 4K25A 4E3SA 2XRIA 1NGEA 3O9TA 1RT6A 3SAFA 5DM6L 4LSNA 1O1WA 5HP1A 2BH1A 4M3TA 1HNXK 4KHQA 4DUYK 3QMLA 3ZSVA 3DLLL 4BE2A 1T3VA 4KV8A 2G8IA 4OKJA 2E2PA 2HSTA 3U3YA 5JLFA 4EZ9A 3AA4A 5C2DA 4YFUA 3L4QA 3HPOA 3LAMA 4DG1A 1HYSA 1WSEA 3CCVN 1RBUA 1T7PA 3CMAN 4DV4K 4AM7A 4W5QA 3OYMA 3OJUA 3L2VA 3CF5L 4BRPA 4GV9A 1RBVA 3FFIA 3WEEB 5AQZA 4IWVA 3ATUA 2ZGYA 2NRHA 1S1VA 4FYDA 2FBTA 2FSNA 3ENHA 2P9NA 5JS2A 1ATSA 2Y1JA 2YCHA 4U67L 5J2NA 3LP2A 3D0PA 4H5NA 4H0TB 4W5OA 1HJRA 4DV7K 4GKKK 2UUBK 4FOEA 4GV6A 1KVCA 2P9KB 4FLVA 1YIJN 1IBMK 1RTDA 4CHPA 4OKEA 2P5GA 2QK9A 3CFRA 4FVUA 4LY7A 1KSPA 3TTFA 3KTQA 1GOAA 3EZ5A 5KTQA 4FZXC 3SPYA 5M1KA 3CMEN 1YJNN 3SZ2A 4LFAK 3NVMA 3SUPA 4KRFA 5M1OA 3RMCA 2O4IA 1RDCA 3RRGA 2F96A 5BREA 1K8KB 2F4VK 3KK7A 3E1YA 5AQUA 4CJFA 2KW4A 3WNEA 3M8SA 3U3GA 3KVGA 4WFBL 3TAGA 4BG8A 4CZLA 3FLCO 4CBXA 1VQ9N 4G9ZA 1ZYQA 4F2RA 2HOEA 1NNEA 1M90O 3O08A 5AJ3K 1REVA 1KVAA 1WSIA 3FE1A 1U45A 4E7JA 3IS9A 2YHYA 4DSLA 2PYLA 1ITGA 4CGGA 3THXA 5FLXO 3HVRA 1BI4A 1C0UA 1RTIA 4FM0A 4HUFA 1K6YA 2GEMA 3AVNA 2JWLA 2KKZA 4OPHA 2Z1GA 1TK8A 1L3VA 5IWAK 1GLLO 1BA0A 4UQGA 4DU4A 2E6LA 2HNZA 4CIEA 4EIAA 2E8AA 2HVHA 3D2FA 4JKHA 4JI6K 4E1NA 1VSDA 2I7NA 1MWMA 4WFAL 3BGRA 2P9UA 1FKPA 2PYJA 3ZT2A 3TARA 1OH5A 3ASMA 4HTUA 3MAQA 3ZSQA 3GBTA 3THVA 1IKVA 2NRWA 1GOBA 5BRDA 5AZIB 4CZEA 4DR2K 3TAPA 3C6AA 3VESA 2GWJA 2IGIA 3IUCA 4CIFA 4WQ5A 3KWGA 4M3XA 4EHUA 1LWFA 1NK6A 1VQMN 3SMSA 1DLOA 3PX0A 1NGAA 4B08A 3DOKA 3TU5A 4CJUA 3SQ1A 3CHWA 4MLHA 4B9SA 5FROA 3LDOA 3IKMA 3OVNA 2E4LA 2Q0RA 4JHDA 2OYQA 2GELA 2PAVA 1HUXA 4DLEA 1D8YA 1JL2A 1IG8A 3EEQA 3G6EN 4ILGB 3I33A 4LH5A 4PWDA 4H0XB 3TAFA 5HLFA 3S3NA 4OJRA 5DMRA 4RTFD 2D0OA 4ISEA 5AQQA 3VTHA 4CFAA 5E26A 4DQIA 1XWLA 4NYFA 3RSEA 1GLEG 1VRTA 4OPAA 1KLNA 1CXQA 1TUYA 1RT5A 1KFDA 3BDPA 1XMQK 3AVMA 3U6FA 3VEOA 2QXFA 5SZTA 4HUEA 3IFRA 4ELUA 4CHZA 4DR1K 4H8KA 4FVMA 4FJGA 3VQDA 5B8HA 4FCYA 4I7FA 2O8CA 5GIOA 3P5JA 3S41A 4EHTA 5BRFA 4YOTA 3K9KA 1JKHA 1SL2A 1NGIA 4CGJA 1BCMA 4HWIA 4AHRA 4JYAK 4QS7A 4CZFA 4A2BA 3LWMA 3O3FA 1Z05A 5C24A 3AY9A 4OGEA 5JVGL 1S9EA 3ZT4A 5LY3A 4Z94A 3J7AP 1ZBHA 4H4MA 4E1MA 4FJMA 3MN6A 2OZMA 3SV3A 3M3ZA 3MDQA 3AO1A 5M1NA 3HI0A 3KKSA 1TGOA 1NGCA 1M1KO 1TKXA 3TR8A 4FM2A 3VGLA 3DLEA 1NOYA 3HK2A 1TK0A 3D2EB 4DTXA 1NGFA 1U4BA 1U49A 1IV0A 3C0BA 5J1EA 4FZYA 4FW2A 4ZHRA 4JS4A 1RTHA 2ZQBA 4BR0A 3MEGA 1EWQA 3P4IA 1KVBA 3SCXA 2P9KA 3CCRN 1QQCA 1R59O 4I9LA 4Q0BA 4O8KA 3H45C 3MN5A 2WOMA 4E0DA 3QNOA 3DLGA 2R7YA 2O4GA 2O8FB 1UA0A 3VQ8A 3LM2A 3HXMA 5EOYA 4BRIA 2FF3B 3U9ZA 1OH8A 5TKYA 2YJEA 1K8KA 3O4QA 2E1YA 3AVKA 4XH5A 2IVOA 4PQUA 3VQQA 2JWKA 2HMPA 4CJVA 3PLAA 3MN9A 4FJ8A 4KTZA 2G8KA 2Q3SA 3A2FA 3ZSZA 2IIRA 4N47A 3VN5A 3KKRA 4M42A 1YAGA 4E1JA 4B9QA 5EVZA 4M7XA 3WQUA 5GINA 1EQYA 5DK5A 3AAQA 1OH7A 1JCGA 3GDQA 3D45A 4FLTA 2BTFA 1QSSA 1HNZK 4B3TK 1E4GT 1T03A 4KH6A 1EETA 2LSNA 3ZSWA 3RVCA 3ALYA 3DJCA 3R3LA 4JV5K 3VQEA 3AVFA 2E88A 1ZBIA 2V51B 4PKIA 1KQSM 2E2QA 3LL3A 4IOXA 3F5TA 4YOXA 3JXUA 1BA1A 4B3RK 3L4IA 2V52B 4KTQA 4WCEL 1BDGA 1DT9A 1SAZA 1NGDA 4CFBA 2CGKA 2GUIA 4RW8A 4BR2A 3S3OA 4B9NA 5AZIA 4BRHA 4FJNA 3QEWA 3QDKA 1S1UA 4IXCA 3AO4A 2XO7A 3SQ0A 1LWEA 2HF3A 5M1FA 1WSHA 1ATNA 4DQPA 4BR7A 4PKHA 3MX5A 3H08A 3KIOA 2UXCK 1YVUA 1QQNA 3MWTA 5KI6A 5GAGP 4JRQA 4DTJA 2GWKA 2EWSA 3TANA 3UIQA 3VF6A 4B8AB 4O4GA 2NNWA 4DS4A 4CK1A 5BPLA 3L3VA 5KGWA 2VGNA 4OVLA 4GNIA 5FPMA 4CEOA 2F8TA 3NF6A 1IKWA 4J8FA 3RRHA 4DTOA 4AQYK 3CFOA 4CESA 3VTIA 5HRNA 4BACA 3O9QA 4NO7A 2XY6A 4CEDA 1C0GA 4YNQA 4ZTFA 1TAUA 3KLHA 4DV1K 5CZ1A 4JI5K 4CJEA 4GMJB 4OLBA 4B9TA 1QVFM 3PO4A 2O8EB 3L2QA 2XY5A 5BPMA 1WBDA 1QQMA 1W97L 5AQJA 4J2EA 4DQQA 5AQTA 1W2BM 3C94A 2HBMA 1HMVA 3VMFB 3H1QA 3EY1A 3D6RA 2YKNA 4CK2A 3LANA 1MA9B 3KHYA 1VSEA 3E9OA 3SBTA 4DB3A 4DF4A 1TVRA 4WQ4A 4CJLA 1Q82O 1TAQA 3JS6A 3CCUN 4C1NI 5AQRA 3KK1A 1YXQA 3WUHA 2QWRA 4H0OA 5CY4A 2VG5A 1KAXA 3M6GA 4WYBA 4EP5A 4JK9A 1YITN 2CH6A 2FXUA 3OYEA 1RT2A 1GLCG 4HUGA 4B1XB 4A59A 2DFHA 2P1JA 3E9PA 4QOZB 3NBPA 4B1UB 2HHTA 3HOTA 3DAWA 1YT3A 2ZE2A 3BF3A 3TSUA 1NKBA 4H5WA 4FWOA 5J2MA 5M1QA 2WONA 1ESVA 4FZZA 3CFPA 2A41A 4PA1A 3K58A 3DM2A 5AQKA 1JCEA 4KFBA 2W41A 2YI1A 3JYTA 1NOZA 3E9LA 3A5NC 3UB5A 1T05A 4AHCA 3KLIA 3O4NA 3GE1A 4DCHA 4NCGA 1XMOK 3JSMA 4DFJA 4JI7K 4CZIA 3E01A 1RBSA 4F8RA 1Z25A 4OX9K 3MMVA 3MN7A 1CZ9A 3K9JA 3C7NB 4FWKA 1YJ9N 5EU7A 1TKZA 5FDLA 2ZGZA 4O8UA 2E5LK 1GOCA 2Z1HA 1Y97A 2IDOA 4AHSA 3SQ4A 1HLUA 4CERA 4PUOA 4LH4A 2O8FA 4BE1A 4KO0A 2QWOA 2UU9K 2WTUA 1YUWA 1C1BA 1ZBFA 2A1SA 4CJTA 1N8RO 2HBKA 1QS4A 4LSLA 4H0YB 4HCBA 1ZXOA 4AM6A 1DTQA 2QA4N 3O9RA 2Q0UA 3ZX3A 2O8DA 4MLEA 4OLAA 3C6TA 2UUCK 3ULEB 2Q36A 3WT0A 4H4OA 2KHOA 4JAXA 2W6KA 4LFBK 4KH5A 2IOCA 3OYHA 3HYFA 2PY5A 2KQ2A 3WXMB 3HSCA 1JLCA 4CJSA 5JS1A 5HRPA 1XHZA 3HTVA 4NXMK 1V4TA 2WFBA 1VSLA 4PL8A 4KHWA 3QEVA 3NAEA 3DRSA 4FSVA 1O13A 3AVHA 4IO8A 1HJOA 4CZHA 4FPBA 3JAMO 4FLXA 4Z4CA 4CBUA 1BQNA 4ZTJA 3S9HA 5AFUH 1QE1A 2JLEA 1S9GA 4JKEA 4XEIA 3L3UA 4O0IA 1VQ5N 1B9DA 1GLJO 4C1NK 4GY2B 3C95A 4FM1A 3E66A 1S6QA 4CI6A 3UKRB 4QS8A 1QSLA 1HNIA 1E3MA 1SKRA 1ASVA 1YVNA 3VEYA 4Q5VA 4FJHA 4CJPA 2P9IB 4BDZA 3VPZA 4H03B 1RFQA 1IO2A 2I7PA 3C6UA 3DXMA 2AJQA 4DTSA 1I39A 1VQKN 4YHHK 3G0ZA 4BR4A 1W9HA 2IVNA 4YY3K 3AO3A 4IEIA 4JEPA 3F73A 1N32K 2A1RA 3ULDA 4B9MA 1WNSA 1J9AA 5E84A 1TL3A 2BGGA 2ATQA 3SK3A 4BGBA 4CJWA 1NK0A 3RWUA 2J4RA 4JKBA 4NCBA 1VSFA 3I8DA 2ITMA 5KRTA 2V7YA 4OO1J 1UA1A 4BROA 2O8EA 4DV0K 5JICA 3MX2A 3NCIA 5HROA 4Z4EA 3NF9A 4M3RA 4CJKA 4JI8K 2ZM6K 1BUPA 2V7ZA 3F9KA 4O0JA 3V9ZA 4DV6K 4KKOA 3IMXA 4MQ3A 1VQ4N 3O6WA 3RR7A 1I3AA 3OJSA 3U4LA 1VSKA 3OTOK 3QIPA 3OHRA 1NMDA 5AQNA 1KAYA 4Y0WA 3LDLA 1C0MA 4ID5A 1NK5A 1J54A 3TTCA 4BC5A 4CHQA 4JKCA 3HVTA 4X64K 1S1WA 5I9EB 1NBWA 4KI6A 3N4QA 3FGUA 3NGYA 3VQPA 3MWPA 1XNRK 4KI4A 3AARA 4LF5K 5KQ8A 1Z26A 3ZETB 2WUSA 2WC9A 4JI0K 1L3UA 3M8QA 3MK6A 3GOIA 3LDPA 2OA8A 3VERA 3HO1A 2A3ZA 3LZJA 5K14A 3EE9A 3KLFA 3H3OB 1Q18A 2I5JA 4DU3A 1RGIA 3CJ1A 5AQLA 4H0PA 1YJWN 4B9LA 2OPQA 2D5RA 3V9WA 1WSFA 4YORA 4CGHA 1ILYA 3LP1A 4CZJA 3LALA 1VHXA 4GVEA 3THYB 4IJAA 4FLUA 3K5MA 4DFKA 3OYAA 3CCJN 1L3TA 4CJRA 4CJ7A 3DYAA 3LDSA 5CR4A 3CC4N 4DTUA 1G15A 3AVIA 3ZSYA 2E20A 3C7NA 4FWQA 2W6LA 3V9SA 3QB0A 1C0FA 4CGDA 3CCEN 1S6PA 3KLEA 3NH1A 1Q9YA 4FW1A 3QBWA 3OYIA 5ELZA 1L3SA 5AQOA 3T1AA 2X74A 1UWBA 2AA4A 2IVPA 2G8UA 2HHUA 4BGAA 4YDUC 1HKGA 4NLBA 1R0AA 3QICA 5HRRA 4ID1A 4BQLA 4BRNA 4LFCK 3QBXA 3FZMA 3TSQA 1VQON 4DQSA 1P90A 4BRGA 1E4FT 1RDDA 3O9UA 4DTPA 3V81A 1OH6A 4DSKA 3O1WA 4BRMA 1XC3A 3NDKA 3QNNA 2QWLA 2Z1JA 1N36K 3DOLA 3EO3A 2UXDK 3VGKA 3ULEA 3SPZA 4ICLA 4FJXA 5AZJB 2CH5A 1RT4A 2O8BB 3B6OA
chains in the Genus database with same CATH topology
4FK4A 2VWKA 3H08A 3KIOA 4CE9A 4C8KA 3L2WA 3LP3A 4DS5A 1XC9A 1YVUA 2RN2A 4EP4A 4JRQA 5KI6A 4DTJA 3SI6A 1SKSA 1WSJA 3I0RA 4K8ZA 5C42A 1EKEA 4CF9A 3AVAA 3TANA 3UIQA 4BE0A 4B8AB 1ZBLA 2DTUA 4O4GA 1CZBA 4DSEA 4DS4A 2RPIA 4CK1A 1QSYA 4BDPA 3L3VA 1X9MA 4QAGA 5KGWA 1HYVA 3KK3A 3HPGA 4OVLA 2YNHA 3DRPA 3I0SA 5FRNA 5FRMA 4CEOA 2OZSA 3NF6A 1J5OA 2F8TA 4OPJA 1IKWA 4JRPA 4N56A 3RRHA 3VQAA 4DTOA 3CFOA 3VQCA 4E89A 4CESA 4CEAA 3M8RA 5HRNA 1LAWA 1JLGA 2IAJA 3DLRA 3V1OA 1RDBA 4BACA 4J2BA 2HHXA 1MU2A 2XY6A 4CEDA 2QKBA 1WN7A 4YNQA 4ZTFA 1XI1A 1HQEA 3KLHA 1TAUA 3LP0A 5CZ1A 4GW6A 4DFPA 1LAVA 4CJEA 4CCHA 4GMJB 3ZSOA 4OLBA 4DLGA 4B9TA 3NGZA 3PO4A 1RCHA 4W5NA 4E3SA 1LWCA 2XRIA 3L2QA 2XY5A 4CJQA 2KTQA 1RT6A 3HJFA 1RT1A 1C1AA 1O1WA 2ETJA 4LSNA 3O3GA 1RNHA 5HP1A 4M3TA 2HVIA 4J2EA 4DQQA 1HRHA 4KHQA 3C94A 3ZSVA 4BE2A 3NGIA 3V4IA 4KV8A 2G8IA 1HMVA 2HNDA 4OKJA 3U3YA 4WE1A 4DWIA 4EZ9A 1XHXA 3EY1A 3AA4A 4YFUA 1NJWA 3HPOA 3LAMA 2OPPA 4DG1A 4GVMA 2YKNA 3WNHA 4CK2A 1HYSA 1WSEA 2GV9A 3LANA 1RBUA 2RKIA 1RTJA 1VSEA 3DI6A 4IG0A 4CJ4A 4W5TA 4W5QA 3SJJA 3OYMA 1T7PA 3OJUA 3L2VA 4DF4A 1RBVA 3FFIA 2GBZA 1HQUA 1HPZA 1TVRA 3CG7A 3OYGA 1TV6A 4CJLA 3OS2A 5J2QA 1F21A 1TAQA 4IBNA 4DF8A 4CEZA 1RBTA 1UOCA 3NF7A 1S1VA 3MECA 3DRRA 5E41A 3PX6A 4FYDA 3KK1A 2E6MA 2P5OA 2FBTA 5JS2A 1C0TA 1U04A 4AHVA 2Y1JA 5J2NA 1TKDA 3LP2A 3D0PA 5CY4A 2VG5A 3K57A 4W5OA 1HJRA 2F8SA 3K5LA 2PZSA 1KVCA 2D0AA 4EP5A 4FLVA 4RW7A 4F3OA 3NHGA 1RTDA 1EXQA 4OKKA 4CHPA 4OKEA 2P5GA 2QK9A 4B8CA 3CFRA 4LY7A 4BWJA 3VQ6A 3OYEA 4J2AA 1KSPA 1A5VA 1RT2A 3KTQA 1GOAA 3EZ5A 5KTQA 5CYQA 4HUGA 3SPYA 4FZXC 4NCAA 2DFHA 4L8RB 3SZ2A 2P1JA 1RT3A 1KFSA 3SUPA 4KRFA 4CFDA 2IC3A 4QOZB 3NBPA 2HHTA 2D0BA 3AA2A 3RMCA 3ZSXA 1TK5A 2FBYA 4QCLA 2O4IA 2ZE2A 1RDCA 1YT3A 1JLQA 2F96A 1NKBA 1N6QA 3RRGA 3NH0A 1A5WA 5J2MA 4CJFA 2KW4A 4NYNA 4CGFA 3SV4A 4LD0A 2WONA 3WNEA 4FZZA 1JLEA 3CFPA 3M8SA 3SUQA 4PA1A 3U3GA 3KJVA 3K58A 3DM2A 1DTTA 3TAEA 3QEPA 3TAGA 4KFBA 3SNNA 3JYTA 1NOZA 1ASUA 2EHGA 1FKOA 2NUBA 5CYMA 1ZYQA 4FJ9A 2DFEA 1BGXT 1LW2A 4CIGA 4AHCA 1T05A 3KLIA 1VRUA 3O4NA 3KD1E 4F2RA 1VSJA 3IRXA 2QKKA 4NCGA 3TWHA 3JSMA 1REVA 1KVAA 1WSIA 1Q8IA 4DFJA 1U45A 3E01A 1RBSA 3IS9A 3KK2A 3P83D 4E7JA 4FJ7A 1BIZA 4M41A 1IH7A 4KHUA 4Z4FA 4DSLA 4F8RA 3S3MA 1Z25A 3LAKA 2KFZA 1CZ9A 3ISNC 2PYLA 3ZSRA 4CHYA 2B5JA 4KHSA 1ITGA 4CGGA 4C8NA 5EU7A 3HVRA 1TKZA 1BI4A 1C0UA 1RTIA 4FM0A 5FDLA 4HUFA 1K6YA 4FLWA 3AVNA 4O55A 1N5YA 4CGIA 3CQ8A 1GOCA 2Z1GA 2Z1HA 3VA3A 1Y97A 2IDOA 3TAQA 1TK8A 1L3VA 4AHSA 3SQ4A 4UQGA 4DU4A 1QHTA 3K2PA 2E6LA 4CERA 4PUOA 4CHNA 4LH4A 4HCCA 4BE1A 2HNZA 3T3FA 4CIEA 4XIUA 1Q9XA 4KO0A 3MXJA 4FJ5A 4M3UA 2HVHA 3M8PA 3QESA 5KRSA 3HP6A 4MFBA 3SCXA 1C1BA 1ZBFA 2A1SA 1VSDA 4E1NA 3PV8A 1NKEA 4CJTA 4KB0A 3BGRA 3AO5A 1QS4A 4CF8A 1FKPA 4LSLA 1FXXA 1RBRA 2HNYA 1NK7A 2PYJA 4EZ6A 3ZT2A 3TARA 1DTQA 4HCBA 3ASMA 3OYLA 3AVGA 4HTUA 3MAQA 3MEDA 3ZSQA 2G8FA 4CF1A 3THVA 4OLAA 1IKVA 3C6TA 3QIOA 3QLHA 4RW6A 2KZZA 1BQMA 1GOBA 4FJJA 3HM9A 3TAPA 3MXIA 3AVCA 2BE2A 1S1TA 4H4OA 1JXEA 4AHTA 3O3HA 3G10A 2IOCA 4CEFA 2IGIA 3HYFA 3OYHA 2PY5A 4CIFA 4Y1DA 2YNFA 2KQ2A 4M3XA 4I2PA 1JLCA 1LWFA 1NK6A 4CJSA 4M3ZA 1J53A 5HRPA 5JS1A 2YHBA 1DLOA 3PX0A 1XHZA 4RG8A 4O5BA 4B08A 1VSLA 3DOKA 1NK9A 4KHWA 4CJUA 3SQ1A 4JLHA 4B9SA 1EX4A 5FROA 3NAEA 3DRSA 3QEVA 4E7LA 2OPRA 3CM6A 3AVHA 3NFAA 3OVNA 2E4LA 3KLGA 3NF8A 4CFCA 5J2PA 4DSFA 4KREA 2OYQA 4DTNA 3TAMA 4CF2A 4FLXA 4Z4CA 1BQNA 4ZTJA 3S9HA 4DLEA 4FJKA 5SWMA 1QE1A 1D8YA 1BL3A 2YNGA 4IFYA 3NE6A 2EX3A 1JL2A 2JLEA 1S9GA 3SUNA 1S5JA 4PY5A 3L3UA 4O0IA 2VG6A 1B9DA 1RILA 4LH5A 2HHSA 4PWDA 3PY8A 3TAFA 1CLQA 1NJZA 4DTMA 3C95A 3S3NA 4OJRA 5HLFA 3OS1A 4FM1A 3T19A 4AILC 5DMRA 3DLHA 1S6QA 3AV9A 3VQ5A 2HMIA 4O44A 2HB5A 2BANA 1QSLA 3PO5A 3AA3A 4CFAA 2B6AA 4DQIA 1HNIA 1NK8A 1XWLA 4NYFA 4DFMA 4CJ3A 1VRTA 2HW3A 1NJXA 1JLFA 4DU1A 4G1QA 1CXQA 1SKRA 1ZBUA 1ASVA 4AH9A 4Q5VA 3V9XA 1KLNA 2G8HA 4DSIA 1RT5A 4CJPA 4FJHA 4FK2A 2Z1IA 3DLBA 1VSHA 4BDZA 1LV5A 1IO2A 1KFDA 3VQBA 3BDPA 1HNVA 4OGCA 3AVMA 3U6FA 4M45A 1SUQA 1U47A 3C6UA 1RT7A 2QXFA 5SZTA 3CYMA 2AJQA 4IFVA 4DTSA 3HSTB 1I39A 2X6SA 4HUEA 4DSJA 4ELUA 3G0ZA 2FBVA 4CHZA 4DQRA 1JLBA 1W9HA 3SYZA 3AO3A 2BDPA 2HHVA 2OPSA 4H8KA 4FVMA 1SL1A 3F73A 2A1RA 3VQ9A 3ULDA 3VQDA 4FJGA 4KHYA 2KZMA 4B9MA 1WNSA 3OY9A 4FCYA 1J9AA 4I7FA 5KGXA 1TL3A 3TI0A 1KRPA 3AA5X 1WLJA 2BGGA 3P5JA 1WAFA 2ATQA 4B9VA 4CJWA 1NK0A 4F2SA 4DMNA 3RWUA 3PUFA 1JKHA 4CEBA 1SL2A 4CGJA 4E7HA 4NCBA 1BCMA 1KTQA 1VSFA 3I8DA 4CJ5A 4AHRA 5KRTA 3QEIA 1X9SA 1UA1A 1LW0A 1B92A 3LWMA 3AVBA 3OS0A 3O3FA 4Y1CA 5C24A 3NCIA 3QO9A 5HROA 3NF9A 4OGEA 3ZT0A 4M3RA 4CJKA 4Z4EA 2G8VA 1X9WA 2ITGA 1S9EA 3F9KA 4O0JA 1ASWA 4RW9A 3ZT4A 3L2RA 2XHBA 3K5OA 3V9ZA 4E7KA 3SUOA 2DY4A 2RF2A 2KFNA 4KKOA 4MQ3A 1ZBHA 4H4MA 4E1MA 3OYKA 1TKTA 3RR7A 4FJMA 3DMJA 3OYJA 1D5AA 1I3AA 3OJSA 1YTUA 4KAZA 3ITHA 2VWJA 1VSKA 2DFFA 3TABA 4C8LA 3L2UA 2OZMA 1A5XA 2P51A 1BHLA 4I2QA 4HVJA 4Z4HA 3SV3A 1SL0A 3AO1A 2YNIA 3KKSA 1UAXA 1TGOA 3QIPA 3VQ4A 1C0MA 4ID5A 1TKXA 2YV0X 1NK5A 2X78A 3TR8A 4N5SA 1J54A 1C6VA 3K59A 4CHQA 4FLZA 4FM2A 4ELVA 3HVTA 1S1WA 3DLEA 1NOYA 3HK2A 3RMBA 1TK0A 4DTXA 4IG3A 3OYDA 4DTRA 1U4BA 4KI6A 3VQPA 1U49A 3NGYA 1S1XA 2G8WA 3CM5A 4KI4A 2Y1IA 4BWMA 4B3OA 4CECA 1Z26A 4KPYA 2FC0A 4KTWA 1YTAA 3ZT3A 5J1EA 1L3UA 1RDAA 3M8QA 2OA8A 1IKYA 4FZYA 1QTMA 1NJYA 4FW2A 4ZHRA 4JS4A 1RTHA 2ZQBA 2B4JA 3MEGA 4CEEA 3HO1A 1KVBA 3OYBA 1BCOA 3ZT1A 3LZJA 1WAJA 4Z0UA 1BI4B 1QQCA 2JGUA 5K14A 4I9LA 3KLFA 3V1QA 4Q0BA 2XY8A 5CZ2A 4M3YA 3DLKA 4TSXA 1CXUA 2I5JA 3QINA 4DU3A 3LWLA 2YKMA 2WOMA 3MXMA 4E0DA 3QNOA 4N41A 3LPTA 3VA0A 3DLGA 2R7YA 2XY7A 2O4GA 4B9LA 1B9FA 1BIUA 1VK0A 4FLYA 4ELTA 3B6PA 1UA0A 3VQ8A 2OPQA 1IKXA 3HXMA 5I42A 3HPHA 2D5RA 3V9WA 1KCFA 4OPKA 3KD5E 4F4KA 3O4QA 1WSFA 3AVKA 4CGHA 2D0CA 3LP1A 3NH2A 3RMDA 4FJIA 4CK3A 4JS5A 2ZD1A 4PQUA 3EYZA 1L5UA 3LALA 3VQQA 4IKFA 4CHOA 4CJVA 4I9QA 1D9DA 4FJ8A 3SQ2A 4W5RA 4FLUA 4KTZA 2VG7A 4HHTA 2Q3SA 5HBMA 1NKCA 2G8KA 4FJLA 3K5MA 3A2FA 2HHWA 4DFKA 3OYAA 3ZSZA 1L3TA 4CJRA 3DYAA 4N47A 3LDSA 4E7IA 3VN5A 3KKRA 3OYCA 4DTUA 3V6DA 3WNGA 4M42A 1HYZA 1G15A 4K8XA 1WSGA 3AVLA 3AVIA 3ZSYA 1U48A 3QETA 1JL1A 5DK5A 1SV5A 4KB1A 3V9SA 3D45A 4AHUA 3QERA 1VSIA 4FLTA 3WNFA 4CGDA 3LZIA 3L8BA 1QSSA 1JXBA 1S6PA 3KLEA 3NH1A 1Q9YA 1BISA 4FW1A 3PX4A 3OYIA 1T03A 3OYNA 1EETA 2LSNA 1W0HA 5HRSA 1VSMA 3ZCMA 1FK9A 3RTVA 3RMAA 3ZSWA 1L3SA 1T8EA 1D9FA 3ALYA 4FXDA 3T1AA 2W42A 3LPUA 3VQEA 2X74A 1UWBA 3AVFA 2G8UA 1SKWA 1ZBIA 1TL1A 2HHUA 3OYFA 3IAYA 4F3TA 2YHAA 4CF0A 1NK4A 4J2DA 1R0AA 5HRRA 3QEXA 4ID1A 5C25A 1C1CA 3V1RA 4R5PA 3P1GA 4Z4GA 4DQSA 1KLMA 2FBXA 3AO2A 4RW4A 1X1PA 4C8OA 4Z4IA 4DTPA 1RDDA 3V81A 5T7BA 1JLAA 5I3UA 3HL8A 4DSKA 4IDKA 3MEEA 4KTQA 3NDKA 3QNNA 2Z1JA 3DOLA 1IG9A 4CFBA 3VQ7A 3HT3A 4BDYA 2GUIA 4RW8A 3SPZA 3S3OA 4B9NA 4C8MA 4FJNA 2HHQA 3RR8A 3AVJA 4ICLA 4E19A 3QEWA 1S1UA 4FJXA 3AO4A 2XO7A 3K5NA 3V9UA 3SQ0A 1LWEA 5D3GA 1RT4A 3HP9A 4N76A 2IS3A 4FK0A 4M3WA 3IG1A 4KHNA 3B6OA 1WSHA 1EP4A 2X6NA 4B9UA 4DQPA 4CEQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FK4 A;  2VWK A;  3H08 A;  3KIO A;  4CE9 A;  4C8K A;  3L2W A;  3LP3 A;  4DS5 A;  1XC9 A;  1YVU A;  2RN2 A;  4EP4 A;  4JRQ A;  5KI6 A;  4DTJ A;  3SI6 A;  1SKS A;  1WSJ A;  3I0R A;  4K8Z A;  5C42 A;  1EKE A;  4CF9 A;  3AVA A;  3TAN A;  3UIQ A;  4BE0 A;  4B8A B;  1ZBL A;  2DTU A;  4O4G A;  1CZB A;  4DSE A;  4DS4 A;  2RPI A;  4CK1 A;  1QSY A;  4BDP A;  3L3V A;  1X9M A;  4QAG A;  5KGW A;  1HYV A;  3KK3 A;  3HPG A;  4OVL A;  2YNH A;  3DRP A;  3I0S A;  5FRN A;  5FRM A;  4CEO A;  2OZS A;  3NF6 A;  1J5O A;  2F8T A;  4OPJ A;  1IKW A;  4JRP A;  4N56 A;  3RRH A;  3VQA A;  4DTO A;  3CFO A;  3VQC A;  4E89 A;  4CES A;  4CEA A;  3M8R A;  5HRN A;  1LAW A;  1JLG A;  2IAJ A;  3DLR A;  3V1O A;  1RDB A;  4BAC A;  4J2B A;  2HHX A;  1MU2 A;  2XY6 A;  4CED A;  2QKB A;  1WN7 A;  4YNQ A;  4ZTF A;  1XI1 A;  1HQE A;  3KLH A;  1TAU A;  3LP0 A;  5CZ1 A;  4GW6 A;  4DFP A;  1LAV A;  4CJE A;  4CCH A;  4GMJ B;  3ZSO A;  4OLB A;  4DLG A;  4B9T A;  3NGZ A;  3PO4 A;  1RCH A;  4W5N A;  4E3S A;  1LWC A;  2XRI A;  3L2Q A;  2XY5 A;  4CJQ A;  2KTQ A;  1RT6 A;  3HJF A;  1RT1 A;  1C1A A;  1O1W A;  2ETJ A;  4LSN A;  3O3G A;  1RNH A;  5HP1 A;  4M3T A;  2HVI A;  4J2E A;  4DQQ A;  1HRH A;  4KHQ A;  3C94 A;  3ZSV A;  4BE2 A;  3NGI A;  3V4I A;  4KV8 A;  2G8I A;  1HMV A;  2HND A;  4OKJ A;  3U3Y A;  4WE1 A;  4DWI A;  4EZ9 A;  1XHX A;  3EY1 A;  3AA4 A;  4YFU A;  1NJW A;  3HPO A;  3LAM A;  2OPP A;  4DG1 A;  4GVM A;  2YKN A;  3WNH A;  4CK2 A;  1HYS A;  1WSE A;  2GV9 A;  3LAN A;  1RBU A;  2RKI A;  1RTJ A;  1VSE A;  3DI6 A;  4IG0 A;  4CJ4 A;  4W5T A;  4W5Q A;  3SJJ A;  3OYM A;  1T7P A;  3OJU A;  3L2V A;  4DF4 A;  1RBV A;  3FFI A;  2GBZ A;  1HQU A;  1HPZ A;  1TVR A;  3CG7 A;  3OYG A;  1TV6 A;  4CJL A;  3OS2 A;  5J2Q A;  1F21 A;  1TAQ A;  4IBN A;  4DF8 A;  4CEZ A;  1RBT A;  1UOC A;  3NF7 A;  1S1V A;  3MEC A;  3DRR A;  5E41 A;  3PX6 A;  4FYD A;  3KK1 A;  2E6M A;  2P5O A;  2FBT A;  5JS2 A;  1C0T A;  1U04 A;  4AHV A;  2Y1J A;  5J2N A;  1TKD A;  3LP2 A;  3D0P A;  5CY4 A;  2VG5 A;  3K57 A;  4W5O A;  1HJR A;  2F8S A;  3K5L A;  2PZS A;  1KVC A;  2D0A A;  4EP5 A;  4FLV A;  4RW7 A;  4F3O A;  3NHG A;  1RTD A;  1EXQ A;  4OKK A;  4CHP A;  4OKE A;  2P5G A;  2QK9 A;  4B8C A;  3CFR A;  4LY7 A;  4BWJ A;  3VQ6 A;  3OYE A;  4J2A A;  1KSP A;  1A5V A;  1RT2 A;  3KTQ A;  1GOA A;  3EZ5 A;  5KTQ A;  5CYQ A;  4HUG A;  3SPY A;  4FZX C;  4NCA A;  2DFH A;  4L8R B;  3SZ2 A;  2P1J A;  1RT3 A;  1KFS A;  3SUP A;  4KRF A;  4CFD A;  2IC3 A;  4QOZ B;  3NBP A;  2HHT A;  2D0B A;  3AA2 A;  3RMC A;  3ZSX A;  1TK5 A;  2FBY A;  4QCL A;  2O4I A;  2ZE2 A;  1RDC A;  1YT3 A;  1JLQ A;  2F96 A;  1NKB A;  1N6Q A;  3RRG A;  3NH0 A;  1A5W A;  5J2M A;  4CJF A;  2KW4 A;  4NYN A;  4CGF A;  3SV4 A;  4LD0 A;  2WON A;  3WNE A;  4FZZ A;  1JLE A;  3CFP A;  3M8S A;  3SUQ A;  4PA1 A;  3U3G A;  3KJV A;  3K58 A;  3DM2 A;  1DTT A;  3TAE A;  3QEP A;  3TAG A;  4KFB A;  3SNN A;  3JYT A;  1NOZ A;  1ASU A;  2EHG A;  1FKO A;  2NUB A;  5CYM A;  1ZYQ A;  4FJ9 A;  2DFE A;  1BGX T;  1LW2 A;  4CIG A;  4AHC A;  1T05 A;  3KLI A;  1VRU A;  3O4N A;  3KD1 E;  4F2R A;  1VSJ A;  3IRX A;  2QKK A;  4NCG A;  3TWH A;  3JSM A;  1REV A;  1KVA A;  1WSI A;  1Q8I A;  4DFJ A;  1U45 A;  3E01 A;  1RBS A;  3IS9 A;  3KK2 A;  3P83 D;  4E7J A;  4FJ7 A;  1BIZ A;  4M41 A;  1IH7 A;  4KHU A;  4Z4F A;  4DSL A;  4F8R A;  3S3M A;  1Z25 A;  3LAK A;  2KFZ A;  1CZ9 A;  3ISN C;  2PYL A;  3ZSR A;  4CHY A;  2B5J A;  4KHS A;  1ITG A;  4CGG A;  4C8N A;  5EU7 A;  3HVR A;  1TKZ A;  1BI4 A;  1C0U A;  1RTI A;  4FM0 A;  5FDL A;  4HUF A;  1K6Y A;  4FLW A;  3AVN A;  4O55 A;  1N5Y A;  4CGI A;  3CQ8 A;  1GOC A;  2Z1G A;  2Z1H A;  3VA3 A;  1Y97 A;  2IDO A;  3TAQ A;  1TK8 A;  1L3V A;  4AHS A;  3SQ4 A;  4UQG A;  4DU4 A;  1QHT A;  3K2P A;  2E6L A;  4CER A;  4PUO A;  4CHN A;  4LH4 A;  4HCC A;  4BE1 A;  2HNZ A;  3T3F A;  4CIE A;  4XIU A;  1Q9X A;  4KO0 A;  3MXJ A;  4FJ5 A;  4M3U A;  2HVH A;  3M8P A;  3QES A;  5KRS A;  3HP6 A;  4MFB A;  3SCX A;  1C1B A;  1ZBF A;  2A1S A;  1VSD A;  4E1N A;  3PV8 A;  1NKE A;  4CJT A;  4KB0 A;  3BGR A;  3AO5 A;  1QS4 A;  4CF8 A;  1FKP A;  4LSL A;  1FXX A;  1RBR A;  2HNY A;  1NK7 A;  2PYJ A;  4EZ6 A;  3ZT2 A;  3TAR A;  1DTQ A;  4HCB A;  3ASM A;  3OYL A;  3AVG A;  4HTU A;  3MAQ A;  3MED A;  3ZSQ A;  2G8F A;  4CF1 A;  3THV A;  4OLA A;  1IKV A;  3C6T A;  3QIO A;  3QLH A;  4RW6 A;  2KZZ A;  1BQM A;  1GOB A;  4FJJ A;  3HM9 A;  3TAP A;  3MXI A;  3AVC A;  2BE2 A;  1S1T A;  4H4O A;  1JXE A;  4AHT A;  3O3H A;  3G10 A;  2IOC A;  4CEF A;  2IGI A;  3HYF A;  3OYH A;  2PY5 A;  4CIF A;  4Y1D A;  2YNF A;  2KQ2 A;  4M3X A;  4I2P A;  1JLC A;  1LWF A;  1NK6 A;  4CJS A;  4M3Z A;  1J53 A;  5HRP A;  5JS1 A;  2YHB A;  1DLO A;  3PX0 A;  1XHZ A;  4RG8 A;  4O5B A;  4B08 A;  1VSL A;  3DOK A;  1NK9 A;  4KHW A;  4CJU A;  3SQ1 A;  4JLH A;  4B9S A;  1EX4 A;  5FRO A;  3NAE A;  3DRS A;  3QEV A;  4E7L A;  2OPR A;  3CM6 A;  3AVH A;  3NFA A;  3OVN A;  2E4L A;  3KLG A;  3NF8 A;  4CFC A;  5J2P A;  4DSF A;  4KRE A;  2OYQ A;  4DTN A;  3TAM A;  4CF2 A;  4FLX A;  4Z4C A;  1BQN A;  4ZTJ A;  3S9H A;  4DLE A;  4FJK A;  5SWM A;  1QE1 A;  1D8Y A;  1BL3 A;  2YNG A;  4IFY A;  3NE6 A;  2EX3 A;  1JL2 A;  2JLE A;  1S9G A;  3SUN A;  1S5J A;  4PY5 A;  3L3U A;  4O0I A;  2VG6 A;  1B9D A;  1RIL A;  4LH5 A;  2HHS A;  4PWD A;  3PY8 A;  3TAF A;  1CLQ A;  1NJZ A;  4DTM A;  3C95 A;  3S3N A;  4OJR A;  5HLF A;  3OS1 A;  4FM1 A;  3T19 A;  4AIL C;  5DMR A;  3DLH A;  1S6Q A;  3AV9 A;  3VQ5 A;  2HMI A;  4O44 A;  2HB5 A;  2BAN A;  1QSL A;  3PO5 A;  3AA3 A;  4CFA A;  2B6A A;  4DQI A;  1HNI A;  1NK8 A;  1XWL A;  4NYF A;  4DFM A;  4CJ3 A;  1VRT A;  2HW3 A;  1NJX A;  1JLF A;  4DU1 A;  4G1Q A;  1CXQ A;  1SKR A;  1ZBU A;  1ASV A;  4AH9 A;  4Q5V A;  3V9X A;  1KLN A;  2G8H A;  4DSI A;  1RT5 A;  4CJP A;  4FJH A;  4FK2 A;  2Z1I A;  3DLB A;  1VSH A;  4BDZ A;  1LV5 A;  1IO2 A;  1KFD A;  3VQB A;  3BDP A;  1HNV A;  4OGC A;  3AVM A;  3U6F A;  4M45 A;  1SUQ A;  1U47 A;  3C6U A;  1RT7 A;  2QXF A;  5SZT A;  3CYM A;  2AJQ A;  4IFV A;  4DTS A;  3HST B;  1I39 A;  2X6S A;  4HUE A;  4DSJ A;  4ELU A;  3G0Z A;  2FBV A;  4CHZ A;  4DQR A;  1JLB A;  1W9H A;  3SYZ A;  3AO3 A;  2BDP A;  2HHV A;  2OPS A;  4H8K A;  4FVM A;  1SL1 A;  3F73 A;  2A1R A;  3VQ9 A;  3ULD A;  3VQD A;  4FJG A;  4KHY A;  2KZM A;  4B9M A;  1WNS A;  3OY9 A;  4FCY A;  1J9A A;  4I7F A;  5KGX A;  1TL3 A;  3TI0 A;  1KRP A;  3AA5 X;  1WLJ A;  2BGG A;  3P5J A;  1WAF A;  2ATQ A;  4B9V A;  4CJW A;  1NK0 A;  4F2S A;  4DMN A;  3RWU A;  3PUF A;  1JKH A;  4CEB A;  1SL2 A;  4CGJ A;  4E7H A;  4NCB A;  1BCM A;  1KTQ A;  1VSF A;  3I8D A;  4CJ5 A;  4AHR A;  5KRT A;  3QEI A;  1X9S A;  1UA1 A;  1LW0 A;  1B92 A;  3LWM A;  3AVB A;  3OS0 A;  3O3F A;  4Y1C A;  5C24 A;  3NCI A;  3QO9 A;  5HRO A;  3NF9 A;  4OGE A;  3ZT0 A;  4M3R A;  4CJK A;  4Z4E A;  2G8V A;  1X9W A;  2ITG A;  1S9E A;  3F9K A;  4O0J A;  1ASW A;  4RW9 A;  3ZT4 A;  3L2R A;  2XHB A;  3K5O A;  3V9Z A;  4E7K A;  3SUO A;  2DY4 A;  2RF2 A;  2KFN A;  4KKO A;  4MQ3 A;  1ZBH A;  4H4M A;  4E1M A;  3OYK A;  1TKT A;  3RR7 A;  4FJM A;  3DMJ A;  3OYJ A;  1D5A A;  1I3A A;  3OJS A;  1YTU A;  4KAZ A;  3ITH A;  2VWJ A;  1VSK A;  2DFF A;  3TAB A;  4C8L A;  3L2U A;  2OZM A;  1A5X A;  2P51 A;  1BHL A;  4I2Q A;  4HVJ A;  4Z4H A;  3SV3 A;  1SL0 A;  3AO1 A;  2YNI A;  3KKS A;  1UAX A;  1TGO A;  3QIP A;  3VQ4 A;  1C0M A;  4ID5 A;  1TKX A;  2YV0 X;  1NK5 A;  2X78 A;  3TR8 A;  4N5S A;  1J54 A;  1C6V A;  3K59 A;  4CHQ A;  4FLZ A;  4FM2 A;  4ELV A;  3HVT A;  1S1W A;  3DLE A;  1NOY A;  3HK2 A;  3RMB A;  1TK0 A;  4DTX A;  4IG3 A;  3OYD A;  4DTR A;  1U4B A;  4KI6 A;  3VQP A;  1U49 A;  3NGY A;  1S1X A;  2G8W A;  3CM5 A;  4KI4 A;  2Y1I A;  4BWM A;  4B3O A;  4CEC A;  1Z26 A;  4KPY A;  2FC0 A;  4KTW A;  1YTA A;  3ZT3 A;  5J1E A;  1L3U A;  1RDA A;  3M8Q A;  2OA8 A;  1IKY A;  4FZY A;  1QTM A;  1NJY A;  4FW2 A;  4ZHR A;  4JS4 A;  1RTH A;  2ZQB A;  2B4J A;  3MEG A;  4CEE A;  3HO1 A;  1KVB A;  3OYB A;  1BCO A;  3ZT1 A;  3LZJ A;  1WAJ A;  4Z0U A;  1BI4 B;  1QQC A;  2JGU A;  5K14 A;  4I9L A;  3KLF A;  3V1Q A;  4Q0B A;  2XY8 A;  5CZ2 A;  4M3Y A;  3DLK A;  4TSX A;  1CXU A;  2I5J A;  3QIN A;  4DU3 A;  3LWL A;  2YKM A;  2WOM A;  3MXM A;  4E0D A;  3QNO A;  4N41 A;  3LPT A;  3VA0 A;  3DLG A;  2R7Y A;  2XY7 A;  2O4G A;  4B9L A;  1B9F A;  1BIU A;  1VK0 A;  4FLY A;  4ELT A;  3B6P A;  1UA0 A;  3VQ8 A;  2OPQ A;  1IKX A;  3HXM A;  5I42 A;  3HPH A;  2D5R A;  3V9W A;  1KCF A;  4OPK A;  3KD5 E;  4F4K A;  3O4Q A;  1WSF A;  3AVK A;  4CGH A;  2D0C A;  3LP1 A;  3NH2 A;  3RMD A;  4FJI A;  4CK3 A;  4JS5 A;  2ZD1 A;  4PQU A;  3EYZ A;  1L5U A;  3LAL A;  3VQQ A;  4IKF A;  4CHO A;  4CJV A;  4I9Q A;  1D9D A;  4FJ8 A;  3SQ2 A;  4W5R A;  4FLU A;  4KTZ A;  2VG7 A;  4HHT A;  2Q3S A;  5HBM A;  1NKC A;  2G8K A;  4FJL A;  3K5M A;  3A2F A;  2HHW A;  4DFK A;  3OYA A;  3ZSZ A;  1L3T A;  4CJR A;  3DYA A;  4N47 A;  3LDS A;  4E7I A;  3VN5 A;  3KKR A;  3OYC A;  4DTU A;  3V6D A;  3WNG A;  4M42 A;  1HYZ A;  1G15 A;  4K8X A;  1WSG A;  3AVL A;  3AVI A;  3ZSY A;  1U48 A;  3QET A;  1JL1 A;  5DK5 A;  1SV5 A;  4KB1 A;  3V9S A;  3D45 A;  4AHU A;  3QER A;  1VSI A;  4FLT A;  3WNF A;  4CGD A;  3LZI A;  3L8B A;  1QSS A;  1JXB A;  1S6P A;  3KLE A;  3NH1 A;  1Q9Y A;  1BIS A;  4FW1 A;  3PX4 A;  3OYI A;  1T03 A;  3OYN A;  1EET A;  2LSN A;  1W0H A;  5HRS A;  1VSM A;  3ZCM A;  1FK9 A;  3RTV A;  3RMA A;  3ZSW A;  1L3S A;  1T8E A;  1D9F A;  3ALY A;  4FXD A;  3T1A A;  2W42 A;  3LPU A;  3VQE A;  2X74 A;  1UWB A;  3AVF A;  2G8U A;  1SKW A;  1ZBI A;  1TL1 A;  2HHU A;  3OYF A;  3IAY A;  4F3T A;  2YHA A;  4CF0 A;  1NK4 A;  4J2D A;  1R0A A;  5HRR A;  3QEX A;  4ID1 A;  5C25 A;  1C1C A;  3V1R A;  4R5P A;  3P1G A;  4Z4G A;  4DQS A;  1KLM A;  2FBX A;  3AO2 A;  4RW4 A;  1X1P A;  4C8O A;  4Z4I A;  4DTP A;  1RDD A;  3V81 A;  5T7B A;  1JLA A;  5I3U A;  3HL8 A;  4DSK A;  4IDK A;  3MEE A;  4KTQ A;  3NDK A;  3QNN A;  2Z1J A;  3DOL A;  1IG9 A;  4CFB A;  3VQ7 A;  3HT3 A;  4BDY A;  2GUI A;  4RW8 A;  3SPZ A;  3S3O A;  4B9N A;  4C8M A;  4FJN A;  2HHQ A;  3RR8 A;  3AVJ A;  4ICL A;  4E19 A;  3QEW A;  1S1U A;  4FJX A;  3AO4 A;  2XO7 A;  3K5N A;  3V9U A;  3SQ0 A;  1LWE A;  5D3G A;  1RT4 A;  3HP9 A;  4N76 A;  2IS3 A;  4FK0 A;  4M3W A;  3IG1 A;  4KHN A;  3B6O A;  1WSH A;  1EP4 A;  2X6N A;  4B9U A;  4DQP A;  4CEQ A; 
#chains in the Genus database with same CATH topology
 3LP3 A;  4JD2 B;  4DS5 A;  2RN2 A;  1XC9 A;  3THW B;  4K8Z A;  1EKE A;  3ENO A;  1I94 K;  4LF4 K;  2GTD A;  2E1Z A;  4R79 A;  4DSE A;  2RPI A;  3WEE A;  3HPG A;  1XQS C;  1KAZ A;  2YNH A;  1ZC6 A;  3I0S A;  2OZS A;  4OPJ A;  4JRP A;  3VQC A;  3FZH A;  4IDH A;  1LAW A;  4JKG B;  3DLR A;  3GG4 A;  4J2B A;  1LOT B;  1HNW K;  3R9P A;  2VQF K;  1WN7 A;  2QKB A;  4BRK A;  3LP0 A;  4GW6 A;  3ZSO A;  4DLG A;  3CJB A;  3UKR A;  3U9D A;  3CQY A;  3SMP A;  1LWC A;  2KTQ A;  4CJQ A;  1RT1 A;  2HVI A;  1RNH A;  2P9I A;  4H5V A;  4XH4 A;  3NGI A;  3V4I A;  2VWB A;  1NJI O;  2HND A;  1IJJ A;  4WE1 A;  4IFE A;  3EKS A;  3O4W A;  3M1F A;  4BRC A;  1NJW A;  2OTL N;  2GV9 A;  1RTJ A;  5HL7 L;  3EZW A;  4IEE A;  3BZC A;  5MLC Q;  1VQP N;  1K8A O;  1HQU A;  1HPZ A;  3OYG A;  4L3Q A;  1TV6 A;  5J2Q A;  1F21 A;  4IBN A;  4DF8 A;  4A61 A;  1UOC A;  5E41 A;  2QWN A;  4AHV A;  1TKD A;  4PHT X;  3K57 A;  5GAH P;  3O80 A;  2D0A A;  4F3O A;  3NHG A;  4K42 A;  4B8C A;  2D0P A;  3VQ6 A;  2FSK A;  4J2A A;  2H3G X;  4FWS A;  4ISF A;  3WQT A;  5CYQ A;  4NCA A;  4L8R B;  1RT3 A;  1KFS A;  3WXJ A;  4CFD A;  3A5L C;  3FZL A;  2D0B A;  3AA2 A;  2FBY A;  1JLQ A;  1N6Q A;  2NRV A;  1A5W A;  3NH0 A;  4DHY A;  4LD0 A;  1JLE A;  5LJV A;  3SUQ A;  4RCH A;  1DTT A;  3TAE A;  3B8A X;  3FZK A;  4HTL A;  1BO5 O;  2PFU A;  1ASU A;  2EHG A;  4FJ9 A;  1BGX T;  4CIG A;  4BG9 A;  1VRU A;  4FWN A;  1VSJ A;  3IRX A;  2OTJ N;  3TPQ A;  4JK8 A;  4M3W A;  3KK2 A;  3P83 D;  4KHU A;  1BIZ A;  1IH7 A;  4Z4F A;  3ISN C;  4K43 A;  2YHX A;  3ZSR A;  4KHS A;  4C8N A;  3H6E A;  3VEX A;  1YHQ N;  1N5Y A;  4CGI A;  5EY4 A;  3Q7B A;  3J7Y P;  3VEZ A;  1QHT A;  3K2P A;  3CJC A;  3ZYY X;  1NMN A;  3T3F A;  4FJ5 A;  3M8P A;  4DKW A;  3QES A;  5KRS A;  4M63 C;  3PV8 A;  4FWR A;  4KB0 A;  3AO5 A;  5AQP A;  4CF8 A;  2ASP A;  1RBR A;  1G99 A;  4LF9 K;  2QM1 A;  2Q2R A;  4CBW A;  3OYL A;  1H1V A;  3AVG A;  3THY A;  3MED A;  4A2A A;  2G8F A;  4CF1 A;  3QIO A;  4RW6 A;  3QLH A;  1CZA N;  2QXL A;  1BQM A;  1N34 K;  3HM9 A;  3MXI A;  3AVC A;  2BE2 A;  1S1T A;  4AHT A;  2NRR A;  2QWQ A;  3O3H A;  3G10 A;  4CEF A;  2HHH K;  5AQW A;  4Y1D A;  3FFK B;  3VF4 A;  4I2P A;  5M1P A;  1ATR A;  1J53 A;  3PIP L;  1WOQ A;  3CD6 N;  2YX6 A;  1NK9 A;  4JLH A;  4EFH A;  1EX4 A;  4LC9 B;  1QZ5 A;  3LDQ A;  2AP1 A;  3CM6 A;  5J2P A;  4DR6 K;  3NF8 A;  4BRE A;  4DSF A;  1WBB A;  1T6D A;  3PSI A;  4BC3 A;  4FJK A;  5SWM A;  2YNG A;  3NE6 A;  2EX3 A;  3HOS A;  1S5J A;  5JLH A;  2VYP A;  1RIL A;  1CLQ A;  1NJZ A;  4GKJ K;  4CZK A;  5AQV A;  3AV9 A;  3VQ5 A;  2ZJP L;  4PL7 A;  2HB5 A;  4BRL A;  2B6A A;  1NK8 A;  3G71 N;  1SS6 A;  4CJ3 A;  1JLF A;  4DU1 A;  4G1Q A;  2G8H A;  1ZBU A;  3V9X A;  2Z1I A;  3DLB A;  5AZJ A;  4B1W B;  3VQB A;  2O8B A;  3EN9 A;  4M45 A;  3TSP A;  2KLA A;  1U47 A;  3SBG A;  4K0K K;  5BRH A;  1RT7 A;  5C10 A;  1KC8 O;  4IFV A;  2X6S A;  4JD2 A;  3ZLJ A;  4DSJ A;  3IDH A;  3D7E O;  5AQH A;  3THW A;  3SLC A;  4DR3 K;  2OPS A;  5KPT A;  1QZ6 A;  4CD1 A;  3D2E A;  3MCA B;  3OY9 A;  3OBW A;  5JMV A;  4A57 A;  5KGX A;  4WFN L;  5BR8 K;  1KRP A;  3AA5 X;  1WLJ A;  4FPA A;  2Q1N A;  1WAF A;  4JKG A;  4B9V A;  3NMU A;  3H46 O;  3PUF A;  4CEB A;  4LF7 K;  2RE2 A;  4XH1 A;  3VOV A;  4CJ5 A;  3QEI A;  2QTD A;  3J8A A;  5KQD A;  1X9S A;  1LW0 A;  5EXW A;  3AVB A;  3FR0 A;  3I56 N;  3RSE B;  3VEW A;  1VQL N;  3BUZ B;  1X9W A;  2ITG A;  1ASW A;  3L2R A;  2DY4 A;  5AFU A;  3LM9 A;  1HKC A;  1Q86 O;  3OYK A;  1X9J A;  3DMJ A;  1D5A A;  3BEX A;  2RHK A;  5KPR A;  3ITH A;  2VWJ A;  1NM1 A;  2P51 A;  4HVJ A;  3VQ4 A;  4JI3 K;  1J5E K;  4BRD A;  2YV0 X;  4M3Z A;  4JK7 A;  3ID6 A;  4N5S A;  4B1Y B;  1C6V A;  3K59 A;  4FLZ A;  2CGJ A;  3LDN A;  3OYD A;  1FJG K;  4FWP A;  2G8W A;  3CM5 A;  2Y1I A;  4BRF A;  2NRT A;  4CEC A;  4KTW A;  1YTA A;  2F9W A;  3ZT3 A;  1RDA A;  4BC2 A;  1IKY A;  2ZJQ L;  1NJY A;  3S3M A;  2WBN A;  1WAJ A;  2DPN A;  3OA9 A;  3V1Q A;  2XY8 A;  5CZ2 A;  4M3Y A;  3DLK A;  3CCM N;  4B1V A;  1NWK A;  3ATV A;  2E2N A;  3MXM A;  4RWT A;  3J81 O;  1OVY A;  2HBL A;  3LPT A;  5AQI A;  3VA0 A;  2XY7 A;  3CC7 N;  1VK0 A;  1J6Z A;  3L0Q A;  5I42 A;  1HKB A;  1KCF A;  4OPK A;  4F4K A;  1NLV A;  2D1K A;  2D0C A;  4C23 A;  3NH2 A;  3CJ9 A;  1NG9 A;  3AGR A;  4YOU A;  2ZD1 A;  3EYZ A;  4B3S K;  4CZG A;  4I9Q A;  3SAG A;  3ZX0 A;  1D9D A;  3SQ2 A;  4W5R A;  3QFU A;  5JVH L;  1TYQ B;  4HHT A;  4DR7 K;  3VF2 A;  4FOI A;  4ILH A;  4JI1 K;  4E7I A;  1V4S A;  3WNG A;  5HOO A;  1S3X A;  4K8X A;  1WSG A;  3AVL A;  1T44 A;  1D4X A;  1K73 O;  3AGK A;  4YOV A;  1SV5 A;  4KB1 A;  3QER A;  3A5M C;  4CW7 B;  5F2R A;  3WNF A;  3LZI A;  4ELV A;  2UUA K;  2A40 A;  1DEJ A;  2QWP A;  2GX9 A;  3PX4 A;  3RTV A;  1W0H A;  3O5B A;  3ZCM A;  1FK9 A;  2YHW A;  5C12 A;  1D9F A;  2E2O A;  2QEX N;  1SKW A;  3IAY A;  2YHA A;  4CF0 A;  1NK4 A;  4IO9 L;  1C1C A;  3V1R A;  4R5P A;  5GIP A;  5KPZ A;  1KLM A;  3AO2 A;  4RW4 A;  1WB9 A;  4Z4I A;  5BN9 A;  3O1B A;  3K0S A;  5I3U A;  3DWL A;  4IDK A;  3MEE A;  2HF4 A;  3VEN A;  3T7Z A;  1TUU A;  3VQ7 A;  3DXK B;  4H0V B;  3CQX A;  4BDY A;  1S72 N;  4C8M A;  3UE5 A;  3AVJ A;  4E19 A;  3RR8 A;  2Q31 A;  3K5N A;  4U7B A;  3BF1 A;  2ASM A;  5BPN A;  5D3G A;  3HP9 A;  4N76 A;  2IS3 A;  4FK0 A;  4DUZ K;  1EP4 A;  4B9U A;  3PIO L;  2VWK A;  4CE9 A;  4IJN A;  4C8K A;  1GLB G;  4YOW A;  3SI6 A;  2PBD A;  2GUP A;  1SKS A;  4FL9 A;  3I0R A;  1HR0 K;  4CF9 A;  2FF6 A;  3AVA A;  4JI4 K;  1ZBL A;  2DTU A;  3HBT A;  1CZB A;  4BDP A;  2F8S A;  3KK3 A;  1HYV A;  5FRM A;  1EO1 A;  3OW2 M;  3C65 A;  3VQA A;  5TKW A;  3M8R A;  1JLG A;  3CIP A;  2HHX A;  1RDB A;  4BVO A;  1XI1 A;  3I8B A;  1W7A A;  4A5B A;  4DFP A;  4F9O A;  1NGJ A;  3NGZ A;  1Z6R A;  2F9T A;  1RCH A;  4W5N A;  1QQO A;  1C1A A;  2ETJ A;  3O3G A;  4AF1 A;  1S22 A;  1HRH A;  1WUA A;  2VGM A;  4B1Z A;  4DR4 K;  4DWI A;  1X3M A;  1XHX A;  1LCU A;  2OPP A;  4GVM A;  3CC2 N;  5LMN K;  3WNH A;  3L6Q A;  2RKI A;  4IG0 A;  3WXL A;  4CJ4 A;  3DI6 A;  4W5T A;  3SJJ A;  1EWR A;  4WF9 L;  1VAZ A;  3KWI A;  2GBZ A;  3CG7 A;  2YJF A;  2W40 A;  3OS2 A;  4CEZ A;  1RBT A;  3NF7 A;  3OBY A;  3MEC A;  3DRR A;  3PX6 A;  2P9L B;  3KZB A;  2E6M A;  1FW6 A;  2P5O A;  1C0T A;  1U04 A;  3P31 A;  2VCP A;  5LJW A;  3K5L A;  2PZS A;  4WQ4 C;  4IOA L;  4RW7 A;  1EXQ A;  4OKK A;  1KD1 O;  4BWJ A;  3VGM A;  2ASO A;  1A5V A;  1P8Z A;  3Q7C A;  5DM7 L;  4A5A A;  2IC3 A;  2NLX A;  1TK5 A;  3G25 A;  3ZSX A;  3J80 O;  4QCL A;  4BRA A;  4KBO A;  4NYN A;  4CGF A;  3SV4 A;  1IBK K;  4LF6 K;  3KJV A;  1MWK A;  5AQG A;  3QEP A;  1NGH A;  1GLF O;  3SNN A;  5CYM A;  1FKO A;  2NUB A;  4K41 A;  3CER A;  2DFE A;  4GV3 A;  1LW2 A;  3KD1 E;  5AQS A;  2A42 A;  3R6M A;  2A6A A;  2QKK A;  3NVK A;  3TWH A;  4I6M B;  1Q8I A;  4FJ7 A;  4M41 A;  3H3N O;  5AQX A;  3LAK A;  2KFZ A;  4CHY A;  2B5J A;  1SZ2 A;  3P39 A;  4CD3 A;  4FLW A;  4MDA A;  4DR5 K;  4O55 A;  3CQ8 A;  3VA3 A;  3TAQ A;  4CHN A;  4HCC A;  4XIU A;  3ENB A;  1Q9X A;  3MXJ A;  4M3U A;  1IBL K;  2NZT A;  4IOC L;  3FZF A;  3HP6 A;  4MFB A;  1U2V B;  1NKE A;  2F7T A;  3CPE A;  1NGB A;  1OKJ A;  5GAD P;  1FXX A;  1RDU A;  2HNY A;  1NK7 A;  4EZ6 A;  3ZEU B;  4H5R A;  5IT9 O;  1XNQ K;  1TYQ A;  3AAP A;  5C15 A;  4MO5 A;  1U6Z A;  5BN8 A;  2KZZ A;  4FJJ A;  4NB4 A;  1JXE A;  2P9P B;  2YNF A;  5EX5 A;  2YHB A;  1XUP O;  4RG8 A;  4O5B A;  4JNE A;  2P9S B;  4V19 S;  5FPE A;  3WXK A;  3CCQ N;  1VQ7 N;  5F1X A;  3MCP A;  3ZX2 A;  4E7L A;  2OPR A;  3NFA A;  3UKU B;  3KLG A;  4CFC A;  4ILJ A;  4KRE A;  4BR9 A;  4DTN A;  3TAM A;  4CF2 A;  3CCS N;  3A8Y A;  5AQY A;  1DGK N;  3R8E A;  5CHI A;  1BL3 A;  4IFY A;  3SUN A;  2D4W A;  4PY5 A;  2VG6 A;  2BUP A;  2Q97 A;  2HHS A;  3PY8 A;  4DTM A;  2OAN A;  5ADX A;  5FPD A;  3OS1 A;  3T19 A;  4AIL C;  3DLH A;  2HMI A;  3CPW M;  3CCL N;  1T6C A;  3O9S A;  4FO0 A;  4O44 A;  2BAN A;  4UY8 O;  3PO5 A;  3AA3 A;  2O8D B;  3DXK A;  4DFM A;  2HW3 A;  1NJX A;  1QVG M;  4AH9 A;  4FK2 A;  1GLA G;  4DSI A;  4JN4 A;  3O8M A;  5LL6 Z;  1VSH A;  4M7Y A;  1LV5 A;  1HNV A;  4OGC A;  1SUQ A;  2OCE A;  3CYM A;  3EL2 A;  4PKG A;  4DQ8 A;  3HST B;  4QS9 A;  5C2F A;  2NRX A;  2FBV A;  4DQR A;  1JLB A;  4MO4 A;  1NU0 A;  3SYZ A;  2BDP A;  1GLD G;  4H5T A;  3BY5 A;  2HHV A;  1Q81 O;  2UYT A;  1SL1 A;  2NRZ A;  3VQ9 A;  2KZM A;  4KHY A;  1QHA A;  3BZK A;  1BU6 O;  3BP8 A;  3TI0 A;  4IZ9 A;  1YI2 N;  4LF8 K;  3ZET A;  2P9N B;  5GAE P;  4F2S A;  4YOY A;  4DMN A;  4A62 A;  4E7H A;  5ADX H;  1KTQ A;  3SJH A;  4BY9 C;  2VQE K;  1B92 A;  3OS0 A;  2FLO A;  1HX1 A;  3W3D A;  4Y1C A;  3T1Y K;  3QO9 A;  3ZT0 A;  4O5F A;  2G8V A;  4RW9 A;  2XHB A;  3K5O A;  4E7K A;  3SUO A;  3G4S N;  2RF2 A;  4B3M K;  3CJA A;  4X65 K;  2KFN A;  1TKT A;  3OYJ A;  1YTU A;  3M5R A;  3DXM B;  4KAZ A;  5LMU K;  2DFF A;  3TAB A;  4C8L A;  3L2U A;  1A5X A;  1SL0 A;  1BHL A;  4I2Q A;  4Z4H A;  2YNI A;  1UAX A;  4CVN E;  3HRG A;  4FWL A;  3HM8 A;  3H1V X;  2HBJ A;  2X78 A;  2HHQ A;  5AR0 A;  3RMB A;  4X66 K;  4IG3 A;  4EAH D;  4DTR A;  2CGL A;  4MDB A;  1S1X A;  2P9L A;  4CZM A;  4BWM A;  4B3O A;  4KPY A;  2FC0 A;  4KHP K;  4NLC A;  1QTM A;  3EKU A;  4CEE A;  2B4J A;  3THX B;  5H1S Q;  1BCO A;  3ZT1 A;  1KXP A;  4Z0U A;  3OYB A;  1BI4 B;  2JGU A;  1JJ2 M;  1NGG A;  5C0Y A;  3A5O C;  4TSX A;  1CXU A;  3P38 A;  3QIN A;  3SAH A;  3LWL A;  2YKM A;  4DV5 K;  4WQ5 C;  4N41 A;  2FSJ A;  3C6H A;  1B9F A;  1BIU A;  4BC4 A;  4FLY A;  4ELT A;  3B6P A;  1IKX A;  3CI5 A;  3D2F B;  3HPH A;  4KH4 A;  3KD5 E;  3RMD A;  4FJI A;  4CK3 A;  4JS5 A;  2A5X A;  2P9U B;  1L5U A;  1YF5 L;  4IKF A;  4CHO A;  1ZBS A;  3CET A;  3WXI A;  1MDU B;  2VG7 A;  2HHW A;  5HBM A;  4BR5 A;  1NKC A;  4FJL A;  1VQN N;  4JI2 K;  3W0L A;  4I6M A;  3V6D A;  3OYC A;  1HYZ A;  1BG3 A;  1U48 A;  2QW9 A;  3QET A;  1JL1 A;  2ZF5 O;  4YDU A;  4AHU A;  1VSI A;  4JKF A;  3HZ6 A;  1N33 K;  3L8B A;  1JXB A;  5A2Q O;  1BIS A;  3F2K A;  3QFP A;  3OYN A;  5AQM A;  5HRS A;  1VSM A;  4DV3 K;  1HPM A;  3RMA A;  1T8E A;  4FXD A;  2W42 A;  3R1X A;  4BRQ A;  3PSF A;  4JHD B;  3LPU A;  4ISG A;  5F0X A;  1TL1 A;  3CXC M;  3OYF A;  4F3T A;  3GL1 A;  4J2D A;  2ZJR L;  3EE8 A;  3QEX A;  1JCF A;  3ID8 A;  5C25 A;  1U2V A;  3P1G A;  4Z4G A;  2FBX A;  1X1P A;  4C8O A;  3U8X A;  5T7B A;  1DKG D;  1JLA A;  3ZEU A;  3HL8 A;  4FWM A;  4NXN K;  5AQF A;  1Y64 A;  1BWF O;  3T1H K;  1IG9 A;  3HT3 A;  4BQZ A;  4JKA A;  3T69 A;  3I55 N;  3N4P A;  1RDW X;  2P9P A;  3V9U A;  1Q7Y O;  3IG1 A;  4KHN A;  2X6N A;  4CEQ A;  4FK4 A;  2P9S A;  4DV2 K;  3L2W A;  4EP4 A;  3J7Z O;  1K9M O;  1WSJ A;  5C42 A;  1OVQ A;  3UKU A;  1SQK A;  3VET A;  3F9M A;  2UXB K;  4BE0 A;  3A0I X;  1VQ8 N;  3CJ7 A;  1X3N A;  3HJF A;  1QSY A;  1BOT O;  4BVP A;  1X9M A;  4QAG A;  5CE3 A;  3DRP A;  4JKD A;  5FRN A;  2QI2 A;  1J5O A;  5FPN A;  4N56 A;  2O8C B;  4E89 A;  4CEA A;  2IAJ A;  3V1O A;  1MU2 A;  1VQ6 N;  1HQE A;  5BR9 A;  1LAV A;  4CCH A;  3TTD A;  3VEV A;  4X62 K;  2ZWH A;  2QWM A;  4K25 A;  4E3S A;  2XRI A;  1NGE A;  3O9T A;  1RT6 A;  3SAF A;  5DM6 L;  4LSN A;  1O1W A;  5HP1 A;  2BH1 A;  4M3T A;  1HNX K;  4KHQ A;  4DUY K;  3QML A;  3ZSV A;  3DLL L;  4BE2 A;  1T3V A;  4KV8 A;  2G8I A;  4OKJ A;  2E2P A;  2HST A;  3U3Y A;  5JLF A;  4EZ9 A;  3AA4 A;  5C2D A;  4YFU A;  3L4Q A;  3HPO A;  3LAM A;  4DG1 A;  1HYS A;  1WSE A;  3CCV N;  1RBU A;  1T7P A;  3CMA N;  4DV4 K;  4AM7 A;  4W5Q A;  3OYM A;  3OJU A;  3L2V A;  3CF5 L;  4BRP A;  4GV9 A;  1RBV A;  3FFI A;  3WEE B;  5AQZ A;  4IWV A;  3ATU A;  2ZGY A;  2NRH A;  1S1V A;  4FYD A;  2FBT A;  2FSN A;  3ENH A;  2P9N A;  5JS2 A;  1ATS A;  2Y1J A;  2YCH A;  4U67 L;  5J2N A;  3LP2 A;  3D0P A;  4H5N A;  4H0T B;  4W5O A;  1HJR A;  4DV7 K;  4GKK K;  2UUB K;  4FOE A;  4GV6 A;  1KVC A;  2P9K B;  4FLV A;  1YIJ N;  1IBM K;  1RTD A;  4CHP A;  4OKE A;  2P5G A;  2QK9 A;  3CFR A;  4FVU A;  4LY7 A;  1KSP A;  3TTF A;  3KTQ A;  1GOA A;  3EZ5 A;  5KTQ A;  4FZX C;  3SPY A;  5M1K A;  3CME N;  1YJN N;  3SZ2 A;  4LFA K;  3NVM A;  3SUP A;  4KRF A;  5M1O A;  3RMC A;  2O4I A;  1RDC A;  3RRG A;  2F96 A;  5BRE A;  1K8K B;  2F4V K;  3KK7 A;  3E1Y A;  5AQU A;  4CJF A;  2KW4 A;  3WNE A;  3M8S A;  3U3G A;  3KVG A;  4WFB L;  3TAG A;  4BG8 A;  4CZL A;  3FLC O;  4CBX A;  1VQ9 N;  4G9Z A;  1ZYQ A;  4F2R A;  2HOE A;  1NNE A;  1M90 O;  3O08 A;  5AJ3 K;  1REV A;  1KVA A;  1WSI A;  3FE1 A;  1U45 A;  4E7J A;  3IS9 A;  2YHY A;  4DSL A;  2PYL A;  1ITG A;  4CGG A;  3THX A;  5FLX O;  3HVR A;  1BI4 A;  1C0U A;  1RTI A;  4FM0 A;  4HUF A;  1K6Y A;  2GEM A;  3AVN A;  2JWL A;  2KKZ A;  4OPH A;  2Z1G A;  1TK8 A;  1L3V A;  5IWA K;  1GLL O;  1BA0 A;  4UQG A;  4DU4 A;  2E6L A;  2HNZ A;  4CIE A;  4EIA A;  2E8A A;  2HVH A;  3D2F A;  4JKH A;  4JI6 K;  4E1N A;  1VSD A;  2I7N A;  1MWM A;  4WFA L;  3BGR A;  2P9U A;  1FKP A;  2PYJ A;  3ZT2 A;  3TAR A;  1OH5 A;  3ASM A;  4HTU A;  3MAQ A;  3ZSQ A;  3GBT A;  3THV A;  1IKV A;  2NRW A;  1GOB A;  5BRD A;  5AZI B;  4CZE A;  4DR2 K;  3TAP A;  3C6A A;  3VES A;  2GWJ A;  2IGI A;  3IUC A;  4CIF A;  4WQ5 A;  3KWG A;  4M3X A;  4EHU A;  1LWF A;  1NK6 A;  1VQM N;  3SMS A;  1DLO A;  3PX0 A;  1NGA A;  4B08 A;  3DOK A;  3TU5 A;  4CJU A;  3SQ1 A;  3CHW A;  4MLH A;  4B9S A;  5FRO A;  3LDO A;  3IKM A;  3OVN A;  2E4L A;  2Q0R A;  4JHD A;  2OYQ A;  2GEL A;  2PAV A;  1HUX A;  4DLE A;  1D8Y A;  1JL2 A;  1IG8 A;  3EEQ A;  3G6E N;  4ILG B;  3I33 A;  4LH5 A;  4PWD A;  4H0X B;  3TAF A;  5HLF A;  3S3N A;  4OJR A;  5DMR A;  4RTF D;  2D0O A;  4ISE A;  5AQQ A;  3VTH A;  4CFA A;  5E26 A;  4DQI A;  1XWL A;  4NYF A;  3RSE A;  1GLE G;  1VRT A;  4OPA A;  1KLN A;  1CXQ A;  1TUY A;  1RT5 A;  1KFD A;  3BDP A;  1XMQ K;  3AVM A;  3U6F A;  3VEO A;  2QXF A;  5SZT A;  4HUE A;  3IFR A;  4ELU A;  4CHZ A;  4DR1 K;  4H8K A;  4FVM A;  4FJG A;  3VQD A;  5B8H A;  4FCY A;  4I7F A;  2O8C A;  5GIO A;  3P5J A;  3S41 A;  4EHT A;  5BRF A;  4YOT A;  3K9K A;  1JKH A;  1SL2 A;  1NGI A;  4CGJ A;  1BCM A;  4HWI A;  4AHR A;  4JYA K;  4QS7 A;  4CZF A;  4A2B A;  3LWM A;  3O3F A;  1Z05 A;  5C24 A;  3AY9 A;  4OGE A;  5JVG L;  1S9E A;  3ZT4 A;  5LY3 A;  4Z94 A;  3J7A P;  1ZBH A;  4H4M A;  4E1M A;  4FJM A;  3MN6 A;  2OZM A;  3SV3 A;  3M3Z A;  3MDQ A;  3AO1 A;  5M1N A;  3HI0 A;  3KKS A;  1TGO A;  1NGC A;  1M1K O;  1TKX A;  3TR8 A;  4FM2 A;  3VGL A;  3DLE A;  1NOY A;  3HK2 A;  1TK0 A;  3D2E B;  4DTX A;  1NGF A;  1U4B A;  1U49 A;  1IV0 A;  3C0B A;  5J1E A;  4FZY A;  4FW2 A;  4ZHR A;  4JS4 A;  1RTH A;  2ZQB A;  4BR0 A;  3MEG A;  1EWQ A;  3P4I A;  1KVB A;  3SCX A;  2P9K A;  3CCR N;  1QQC A;  1R59 O;  4I9L A;  4Q0B A;  4O8K A;  3H45 C;  3MN5 A;  2WOM A;  4E0D A;  3QNO A;  3DLG A;  2R7Y A;  2O4G A;  2O8F B;  1UA0 A;  3VQ8 A;  3LM2 A;  3HXM A;  5EOY A;  4BRI A;  2FF3 B;  3U9Z A;  1OH8 A;  5TKY A;  2YJE A;  1K8K A;  3O4Q A;  2E1Y A;  3AVK A;  4XH5 A;  2IVO A;  4PQU A;  3VQQ A;  2JWK A;  2HMP A;  4CJV A;  3PLA A;  3MN9 A;  4FJ8 A;  4KTZ A;  2G8K A;  2Q3S A;  3A2F A;  3ZSZ A;  2IIR A;  4N47 A;  3VN5 A;  3KKR A;  4M42 A;  1YAG A;  4E1J A;  4B9Q A;  5EVZ A;  4M7X A;  3WQU A;  5GIN A;  1EQY A;  5DK5 A;  3AAQ A;  1OH7 A;  1JCG A;  3GDQ A;  3D45 A;  4FLT A;  2BTF A;  1QSS A;  1HNZ K;  4B3T K;  1E4G T;  1T03 A;  4KH6 A;  1EET A;  2LSN A;  3ZSW A;  3RVC A;  3ALY A;  3DJC A;  3R3L A;  4JV5 K;  3VQE A;  3AVF A;  2E88 A;  1ZBI A;  2V51 B;  4PKI A;  1KQS M;  2E2Q A;  3LL3 A;  4IOX A;  3F5T A;  4YOX A;  3JXU A;  1BA1 A;  4B3R K;  3L4I A;  2V52 B;  4KTQ A;  4WCE L;  1BDG A;  1DT9 A;  1SAZ A;  1NGD A;  4CFB A;  2CGK A;  2GUI A;  4RW8 A;  4BR2 A;  3S3O A;  4B9N A;  5AZI A;  4BRH A;  4FJN A;  3QEW A;  3QDK A;  1S1U A;  4IXC A;  3AO4 A;  2XO7 A;  3SQ0 A;  1LWE A;  2HF3 A;  5M1F A;  1WSH A;  1ATN A;  4DQP A;  4BR7 A;  4PKH A;  3MX5 A;  3H08 A;  3KIO A;  2UXC K;  1YVU A;  1QQN A;  3MWT A;  5KI6 A;  5GAG P;  4JRQ A;  4DTJ A;  2GWK A;  2EWS A;  3TAN A;  3UIQ A;  3VF6 A;  4B8A B;  4O4G A;  2NNW A;  4DS4 A;  4CK1 A;  5BPL A;  3L3V A;  5KGW A;  2VGN A;  4OVL A;  4GNI A;  5FPM A;  4CEO A;  2F8T A;  3NF6 A;  1IKW A;  4J8F A;  3RRH A;  4DTO A;  4AQY K;  3CFO A;  4CES A;  3VTI A;  5HRN A;  4BAC A;  3O9Q A;  4NO7 A;  2XY6 A;  4CED A;  1C0G A;  4YNQ A;  4ZTF A;  1TAU A;  3KLH A;  4DV1 K;  5CZ1 A;  4JI5 K;  4CJE A;  4GMJ B;  4OLB A;  4B9T A;  1QVF M;  3PO4 A;  2O8E B;  3L2Q A;  2XY5 A;  5BPM A;  1WBD A;  1QQM A;  1W97 L;  5AQJ A;  4J2E A;  4DQQ A;  5AQT A;  1W2B M;  3C94 A;  2HBM A;  1HMV A;  3VMF B;  3H1Q A;  3EY1 A;  3D6R A;  2YKN A;  4CK2 A;  3LAN A;  1MA9 B;  3KHY A;  1VSE A;  3E9O A;  3SBT A;  4DB3 A;  4DF4 A;  1TVR A;  4WQ4 A;  4CJL A;  1Q82 O;  1TAQ A;  3JS6 A;  3CCU N;  4C1N I;  5AQR A;  3KK1 A;  1YXQ A;  3WUH A;  2QWR A;  4H0O A;  5CY4 A;  2VG5 A;  1KAX A;  3M6G A;  4WYB A;  4EP5 A;  4JK9 A;  1YIT N;  2CH6 A;  2FXU A;  3OYE A;  1RT2 A;  1GLC G;  4HUG A;  4B1X B;  4A59 A;  2DFH A;  2P1J A;  3E9P A;  4QOZ B;  3NBP A;  4B1U B;  2HHT A;  3HOT A;  3DAW A;  1YT3 A;  2ZE2 A;  3BF3 A;  3TSU A;  1NKB A;  4H5W A;  4FWO A;  5J2M A;  5M1Q A;  2WON A;  1ESV A;  4FZZ A;  3CFP A;  2A41 A;  4PA1 A;  3K58 A;  3DM2 A;  5AQK A;  1JCE A;  4KFB A;  2W41 A;  2YI1 A;  3JYT A;  1NOZ A;  3E9L A;  3A5N C;  3UB5 A;  1T05 A;  4AHC A;  3KLI A;  3O4N A;  3GE1 A;  4DCH A;  4NCG A;  1XMO K;  3JSM A;  4DFJ A;  4JI7 K;  4CZI A;  3E01 A;  1RBS A;  4F8R A;  1Z25 A;  4OX9 K;  3MMV A;  3MN7 A;  1CZ9 A;  3K9J A;  3C7N B;  4FWK A;  1YJ9 N;  5EU7 A;  1TKZ A;  5FDL A;  2ZGZ A;  4O8U A;  2E5L K;  1GOC A;  2Z1H A;  1Y97 A;  2IDO A;  4AHS A;  3SQ4 A;  1HLU A;  4CER A;  4PUO A;  4LH4 A;  2O8F A;  4BE1 A;  4KO0 A;  2QWO A;  2UU9 K;  2WTU A;  1YUW A;  1C1B A;  1ZBF A;  2A1S A;  4CJT A;  1N8R O;  2HBK A;  1QS4 A;  4LSL A;  4H0Y B;  4HCB A;  1ZXO A;  4AM6 A;  1DTQ A;  2QA4 N;  3O9R A;  2Q0U A;  3ZX3 A;  2O8D A;  4MLE A;  4OLA A;  3C6T A;  2UUC K;  3ULE B;  2Q36 A;  3WT0 A;  4H4O A;  2KHO A;  4JAX A;  2W6K A;  4LFB K;  4KH5 A;  2IOC A;  3OYH A;  3HYF A;  2PY5 A;  2KQ2 A;  3WXM B;  3HSC A;  1JLC A;  4CJS A;  5JS1 A;  5HRP A;  1XHZ A;  3HTV A;  4NXM K;  1V4T A;  2WFB A;  1VSL A;  4PL8 A;  4KHW A;  3QEV A;  3NAE A;  3DRS A;  4FSV A;  1O13 A;  3AVH A;  4IO8 A;  1HJO A;  4CZH A;  4FPB A;  3JAM O;  4FLX A;  4Z4C A;  4CBU A;  1BQN A;  4ZTJ A;  3S9H A;  5AFU H;  1QE1 A;  2JLE A;  1S9G A;  4JKE A;  4XEI A;  3L3U A;  4O0I A;  1VQ5 N;  1B9D A;  1GLJ O;  4C1N K;  4GY2 B;  3C95 A;  4FM1 A;  3E66 A;  1S6Q A;  4CI6 A;  3UKR B;  4QS8 A;  1QSL A;  1HNI A;  1E3M A;  1SKR A;  1ASV A;  1YVN A;  3VEY A;  4Q5V A;  4FJH A;  4CJP A;  2P9I B;  4BDZ A;  3VPZ A;  4H03 B;  1RFQ A;  1IO2 A;  2I7P A;  3C6U A;  3DXM A;  2AJQ A;  4DTS A;  1I39 A;  1VQK N;  4YHH K;  3G0Z A;  4BR4 A;  1W9H A;  2IVN A;  4YY3 K;  3AO3 A;  4IEI A;  4JEP A;  3F73 A;  1N32 K;  2A1R A;  3ULD A;  4B9M A;  1WNS A;  1J9A A;  5E84 A;  1TL3 A;  2BGG A;  2ATQ A;  3SK3 A;  4BGB A;  4CJW A;  1NK0 A;  3RWU A;  2J4R A;  4JKB A;  4NCB A;  1VSF A;  3I8D A;  2ITM A;  5KRT A;  2V7Y A;  4OO1 J;  1UA1 A;  4BRO A;  2O8E A;  4DV0 K;  5JIC A;  3MX2 A;  3NCI A;  5HRO A;  4Z4E A;  3NF9 A;  4M3R A;  4CJK A;  4JI8 K;  2ZM6 K;  1BUP A;  2V7Z A;  3F9K A;  4O0J A;  3V9Z A;  4DV6 K;  4KKO A;  3IMX A;  4MQ3 A;  1VQ4 N;  3O6W A;  3RR7 A;  1I3A A;  3OJS A;  3U4L A;  1VSK A;  3OTO K;  3QIP A;  3OHR A;  1NMD A;  5AQN A;  1KAY A;  4Y0W A;  3LDL A;  1C0M A;  4ID5 A;  1NK5 A;  1J54 A;  3TTC A;  4BC5 A;  4CHQ A;  4JKC A;  3HVT A;  4X64 K;  1S1W A;  5I9E B;  1NBW A;  4KI6 A;  3N4Q A;  3FGU A;  3NGY A;  3VQP A;  3MWP A;  1XNR K;  4KI4 A;  3AAR A;  4LF5 K;  5KQ8 A;  1Z26 A;  3ZET B;  2WUS A;  2WC9 A;  4JI0 K;  1L3U A;  3M8Q A;  3MK6 A;  3GOI A;  3LDP A;  2OA8 A;  3VER A;  3HO1 A;  2A3Z A;  3LZJ A;  5K14 A;  3EE9 A;  3KLF A;  3H3O B;  1Q18 A;  2I5J A;  4DU3 A;  1RGI A;  3CJ1 A;  5AQL A;  4H0P A;  1YJW N;  4B9L A;  2OPQ A;  2D5R A;  3V9W A;  1WSF A;  4YOR A;  4CGH A;  1ILY A;  3LP1 A;  4CZJ A;  3LAL A;  1VHX A;  4GVE A;  3THY B;  4IJA A;  4FLU A;  3K5M A;  4DFK A;  3OYA A;  3CCJ N;  1L3T A;  4CJR A;  4CJ7 A;  3DYA A;  3LDS A;  5CR4 A;  3CC4 N;  4DTU A;  1G15 A;  3AVI A;  3ZSY A;  2E20 A;  3C7N A;  4FWQ A;  2W6L A;  3V9S A;  3QB0 A;  1C0F A;  4CGD A;  3CCE N;  1S6P A;  3KLE A;  3NH1 A;  1Q9Y A;  4FW1 A;  3QBW A;  3OYI A;  5ELZ A;  1L3S A;  5AQO A;  3T1A A;  2X74 A;  1UWB A;  2AA4 A;  2IVP A;  2G8U A;  2HHU A;  4BGA A;  4YDU C;  1HKG A;  4NLB A;  1R0A A;  3QIC A;  5HRR A;  4ID1 A;  4BQL A;  4BRN A;  4LFC K;  3QBX A;  3FZM A;  3TSQ A;  1VQO N;  4DQS A;  1P90 A;  4BRG A;  1E4F T;  1RDD A;  3O9U A;  4DTP A;  3V81 A;  1OH6 A;  4DSK A;  3O1W A;  4BRM A;  1XC3 A;  3NDK A;  3QNN A;  2QWL A;  2Z1J A;  1N36 K;  3DOL A;  3EO3 A;  2UXD K;  3VGK A;  3ULE A;  3SPZ A;  4ICL A;  4FJX A;  5AZJ B;  2CH5 A;  1RT4 A;  2O8B B;  3B6O A; 
#chains in the Genus database with same CATH homology
 4FK4 A;  2VWK A;  3H08 A;  3KIO A;  4CE9 A;  4C8K A;  3L2W A;  3LP3 A;  4DS5 A;  1XC9 A;  1YVU A;  2RN2 A;  4EP4 A;  4JRQ A;  5KI6 A;  4DTJ A;  3SI6 A;  1SKS A;  1WSJ A;  3I0R A;  4K8Z A;  5C42 A;  1EKE A;  4CF9 A;  3AVA A;  3TAN A;  3UIQ A;  4BE0 A;  4B8A B;  1ZBL A;  2DTU A;  4O4G A;  1CZB A;  4DSE A;  4DS4 A;  2RPI A;  4CK1 A;  1QSY A;  4BDP A;  3L3V A;  1X9M A;  4QAG A;  5KGW A;  1HYV A;  3KK3 A;  3HPG A;  4OVL A;  2YNH A;  3DRP A;  3I0S A;  5FRN A;  5FRM A;  4CEO A;  2OZS A;  3NF6 A;  1J5O A;  2F8T A;  4OPJ A;  1IKW A;  4JRP A;  4N56 A;  3RRH A;  3VQA A;  4DTO A;  3CFO A;  3VQC A;  4E89 A;  4CES A;  4CEA A;  3M8R A;  5HRN A;  1LAW A;  1JLG A;  2IAJ A;  3DLR A;  3V1O A;  1RDB A;  4BAC A;  4J2B A;  2HHX A;  1MU2 A;  2XY6 A;  4CED A;  2QKB A;  1WN7 A;  4YNQ A;  4ZTF A;  1XI1 A;  1HQE A;  3KLH A;  1TAU A;  3LP0 A;  5CZ1 A;  4GW6 A;  4DFP A;  1LAV A;  4CJE A;  4CCH A;  4GMJ B;  3ZSO A;  4OLB A;  4DLG A;  4B9T A;  3NGZ A;  3PO4 A;  1RCH A;  4W5N A;  4E3S A;  1LWC A;  2XRI A;  3L2Q A;  2XY5 A;  4CJQ A;  2KTQ A;  1RT6 A;  3HJF A;  1RT1 A;  1C1A A;  1O1W A;  2ETJ A;  4LSN A;  3O3G A;  1RNH A;  5HP1 A;  4M3T A;  2HVI A;  4J2E A;  4DQQ A;  1HRH A;  4KHQ A;  3C94 A;  3ZSV A;  4BE2 A;  3NGI A;  3V4I A;  4KV8 A;  2G8I A;  1HMV A;  2HND A;  4OKJ A;  3U3Y A;  4WE1 A;  4DWI A;  4EZ9 A;  1XHX A;  3EY1 A;  3AA4 A;  4YFU A;  1NJW A;  3HPO A;  3LAM A;  2OPP A;  4DG1 A;  4GVM A;  2YKN A;  3WNH A;  4CK2 A;  1HYS A;  1WSE A;  2GV9 A;  3LAN A;  1RBU A;  2RKI A;  1RTJ A;  1VSE A;  3DI6 A;  4IG0 A;  4CJ4 A;  4W5T A;  4W5Q A;  3SJJ A;  3OYM A;  1T7P A;  3OJU A;  3L2V A;  4DF4 A;  1RBV A;  3FFI A;  2GBZ A;  1HQU A;  1HPZ A;  1TVR A;  3CG7 A;  3OYG A;  1TV6 A;  4CJL A;  3OS2 A;  5J2Q A;  1F21 A;  1TAQ A;  4IBN A;  4DF8 A;  4CEZ A;  1RBT A;  1UOC A;  3NF7 A;  1S1V A;  3MEC A;  3DRR A;  5E41 A;  3PX6 A;  4FYD A;  3KK1 A;  2E6M A;  2P5O A;  2FBT A;  5JS2 A;  1C0T A;  1U04 A;  4AHV A;  2Y1J A;  5J2N A;  1TKD A;  3LP2 A;  3D0P A;  5CY4 A;  2VG5 A;  3K57 A;  4W5O A;  1HJR A;  2F8S A;  3K5L A;  2PZS A;  1KVC A;  2D0A A;  4EP5 A;  4FLV A;  4RW7 A;  4F3O A;  3NHG A;  1RTD A;  1EXQ A;  4OKK A;  4CHP A;  4OKE A;  2P5G A;  2QK9 A;  4B8C A;  3CFR A;  4LY7 A;  4BWJ A;  3VQ6 A;  3OYE A;  4J2A A;  1KSP A;  1A5V A;  1RT2 A;  3KTQ A;  1GOA A;  3EZ5 A;  5KTQ A;  5CYQ A;  4HUG A;  3SPY A;  4FZX C;  4NCA A;  2DFH A;  4L8R B;  3SZ2 A;  2P1J A;  1RT3 A;  1KFS A;  3SUP A;  4KRF A;  4CFD A;  2IC3 A;  4QOZ B;  3NBP A;  2HHT A;  2D0B A;  3AA2 A;  3RMC A;  3ZSX A;  1TK5 A;  2FBY A;  4QCL A;  2O4I A;  2ZE2 A;  1RDC A;  1YT3 A;  1JLQ A;  2F96 A;  1NKB A;  1N6Q A;  3RRG A;  3NH0 A;  1A5W A;  5J2M A;  4CJF A;  2KW4 A;  4NYN A;  4CGF A;  3SV4 A;  4LD0 A;  2WON A;  3WNE A;  4FZZ A;  1JLE A;  3CFP A;  3M8S A;  3SUQ A;  4PA1 A;  3U3G A;  3KJV A;  3K58 A;  3DM2 A;  1DTT A;  3TAE A;  3QEP A;  3TAG A;  4KFB A;  3SNN A;  3JYT A;  1NOZ A;  1ASU A;  2EHG A;  1FKO A;  2NUB A;  5CYM A;  1ZYQ A;  4FJ9 A;  2DFE A;  1BGX T;  1LW2 A;  4CIG A;  4AHC A;  1T05 A;  3KLI A;  1VRU A;  3O4N A;  3KD1 E;  4F2R A;  1VSJ A;  3IRX A;  2QKK A;  4NCG A;  3TWH A;  3JSM A;  1REV A;  1KVA A;  1WSI A;  1Q8I A;  4DFJ A;  1U45 A;  3E01 A;  1RBS A;  3IS9 A;  3KK2 A;  3P83 D;  4E7J A;  4FJ7 A;  1BIZ A;  4M41 A;  1IH7 A;  4KHU A;  4Z4F A;  4DSL A;  4F8R A;  3S3M A;  1Z25 A;  3LAK A;  2KFZ A;  1CZ9 A;  3ISN C;  2PYL A;  3ZSR A;  4CHY A;  2B5J A;  4KHS A;  1ITG A;  4CGG A;  4C8N A;  5EU7 A;  3HVR A;  1TKZ A;  1BI4 A;  1C0U A;  1RTI A;  4FM0 A;  5FDL A;  4HUF A;  1K6Y A;  4FLW A;  3AVN A;  4O55 A;  1N5Y A;  4CGI A;  3CQ8 A;  1GOC A;  2Z1G A;  2Z1H A;  3VA3 A;  1Y97 A;  2IDO A;  3TAQ A;  1TK8 A;  1L3V A;  4AHS A;  3SQ4 A;  4UQG A;  4DU4 A;  1QHT A;  3K2P A;  2E6L A;  4CER A;  4PUO A;  4CHN A;  4LH4 A;  4HCC A;  4BE1 A;  2HNZ A;  3T3F A;  4CIE A;  4XIU A;  1Q9X A;  4KO0 A;  3MXJ A;  4FJ5 A;  4M3U A;  2HVH A;  3M8P A;  3QES A;  5KRS A;  3HP6 A;  4MFB A;  3SCX A;  1C1B A;  1ZBF A;  2A1S A;  1VSD A;  4E1N A;  3PV8 A;  1NKE A;  4CJT A;  4KB0 A;  3BGR A;  3AO5 A;  1QS4 A;  4CF8 A;  1FKP A;  4LSL A;  1FXX A;  1RBR A;  2HNY A;  1NK7 A;  2PYJ A;  4EZ6 A;  3ZT2 A;  3TAR A;  1DTQ A;  4HCB A;  3ASM A;  3OYL A;  3AVG A;  4HTU A;  3MAQ A;  3MED A;  3ZSQ A;  2G8F A;  4CF1 A;  3THV A;  4OLA A;  1IKV A;  3C6T A;  3QIO A;  3QLH A;  4RW6 A;  2KZZ A;  1BQM A;  1GOB A;  4FJJ A;  3HM9 A;  3TAP A;  3MXI A;  3AVC A;  2BE2 A;  1S1T A;  4H4O A;  1JXE A;  4AHT A;  3O3H A;  3G10 A;  2IOC A;  4CEF A;  2IGI A;  3HYF A;  3OYH A;  2PY5 A;  4CIF A;  4Y1D A;  2YNF A;  2KQ2 A;  4M3X A;  4I2P A;  1JLC A;  1LWF A;  1NK6 A;  4CJS A;  4M3Z A;  1J53 A;  5HRP A;  5JS1 A;  2YHB A;  1DLO A;  3PX0 A;  1XHZ A;  4RG8 A;  4O5B A;  4B08 A;  1VSL A;  3DOK A;  1NK9 A;  4KHW A;  4CJU A;  3SQ1 A;  4JLH A;  4B9S A;  1EX4 A;  5FRO A;  3NAE A;  3DRS A;  3QEV A;  4E7L A;  2OPR A;  3CM6 A;  3AVH A;  3NFA A;  3OVN A;  2E4L A;  3KLG A;  3NF8 A;  4CFC A;  5J2P A;  4DSF A;  4KRE A;  2OYQ A;  4DTN A;  3TAM A;  4CF2 A;  4FLX A;  4Z4C A;  1BQN A;  4ZTJ A;  3S9H A;  4DLE A;  4FJK A;  5SWM A;  1QE1 A;  1D8Y A;  1BL3 A;  2YNG A;  4IFY A;  3NE6 A;  2EX3 A;  1JL2 A;  2JLE A;  1S9G A;  3SUN A;  1S5J A;  4PY5 A;  3L3U A;  4O0I A;  2VG6 A;  1B9D A;  1RIL A;  4LH5 A;  2HHS A;  4PWD A;  3PY8 A;  3TAF A;  1CLQ A;  1NJZ A;  4DTM A;  3C95 A;  3S3N A;  4OJR A;  5HLF A;  3OS1 A;  4FM1 A;  3T19 A;  4AIL C;  5DMR A;  3DLH A;  1S6Q A;  3AV9 A;  3VQ5 A;  2HMI A;  4O44 A;  2HB5 A;  2BAN A;  1QSL A;  3PO5 A;  3AA3 A;  4CFA A;  2B6A A;  4DQI A;  1HNI A;  1NK8 A;  1XWL A;  4NYF A;  4DFM A;  4CJ3 A;  1VRT A;  2HW3 A;  1NJX A;  1JLF A;  4DU1 A;  4G1Q A;  1CXQ A;  1SKR A;  1ZBU A;  1ASV A;  4AH9 A;  4Q5V A;  3V9X A;  1KLN A;  2G8H A;  4DSI A;  1RT5 A;  4CJP A;  4FJH A;  4FK2 A;  2Z1I A;  3DLB A;  1VSH A;  4BDZ A;  1LV5 A;  1IO2 A;  1KFD A;  3VQB A;  3BDP A;  1HNV A;  4OGC A;  3AVM A;  3U6F A;  4M45 A;  1SUQ A;  1U47 A;  3C6U A;  1RT7 A;  2QXF A;  5SZT A;  3CYM A;  2AJQ A;  4IFV A;  4DTS A;  3HST B;  1I39 A;  2X6S A;  4HUE A;  4DSJ A;  4ELU A;  3G0Z A;  2FBV A;  4CHZ A;  4DQR A;  1JLB A;  1W9H A;  3SYZ A;  3AO3 A;  2BDP A;  2HHV A;  2OPS A;  4H8K A;  4FVM A;  1SL1 A;  3F73 A;  2A1R A;  3VQ9 A;  3ULD A;  3VQD A;  4FJG A;  4KHY A;  2KZM A;  4B9M A;  1WNS A;  3OY9 A;  4FCY A;  1J9A A;  4I7F A;  5KGX A;  1TL3 A;  3TI0 A;  1KRP A;  3AA5 X;  1WLJ A;  2BGG A;  3P5J A;  1WAF A;  2ATQ A;  4B9V A;  4CJW A;  1NK0 A;  4F2S A;  4DMN A;  3RWU A;  3PUF A;  1JKH A;  4CEB A;  1SL2 A;  4CGJ A;  4E7H A;  4NCB A;  1BCM A;  1KTQ A;  1VSF A;  3I8D A;  4CJ5 A;  4AHR A;  5KRT A;  3QEI A;  1X9S A;  1UA1 A;  1LW0 A;  1B92 A;  3LWM A;  3AVB A;  3OS0 A;  3O3F A;  4Y1C A;  5C24 A;  3NCI A;  3QO9 A;  5HRO A;  3NF9 A;  4OGE A;  3ZT0 A;  4M3R A;  4CJK A;  4Z4E A;  2G8V A;  1X9W A;  2ITG A;  1S9E A;  3F9K A;  4O0J A;  1ASW A;  4RW9 A;  3ZT4 A;  3L2R A;  2XHB A;  3K5O A;  3V9Z A;  4E7K A;  3SUO A;  2DY4 A;  2RF2 A;  2KFN A;  4KKO A;  4MQ3 A;  1ZBH A;  4H4M A;  4E1M A;  3OYK A;  1TKT A;  3RR7 A;  4FJM A;  3DMJ A;  3OYJ A;  1D5A A;  1I3A A;  3OJS A;  1YTU A;  4KAZ A;  3ITH A;  2VWJ A;  1VSK A;  2DFF A;  3TAB A;  4C8L A;  3L2U A;  2OZM A;  1A5X A;  2P51 A;  1BHL A;  4I2Q A;  4HVJ A;  4Z4H A;  3SV3 A;  1SL0 A;  3AO1 A;  2YNI A;  3KKS A;  1UAX A;  1TGO A;  3QIP A;  3VQ4 A;  1C0M A;  4ID5 A;  1TKX A;  2YV0 X;  1NK5 A;  2X78 A;  3TR8 A;  4N5S A;  1J54 A;  1C6V A;  3K59 A;  4CHQ A;  4FLZ A;  4FM2 A;  4ELV A;  3HVT A;  1S1W A;  3DLE A;  1NOY A;  3HK2 A;  3RMB A;  1TK0 A;  4DTX A;  4IG3 A;  3OYD A;  4DTR A;  1U4B A;  4KI6 A;  3VQP A;  1U49 A;  3NGY A;  1S1X A;  2G8W A;  3CM5 A;  4KI4 A;  2Y1I A;  4BWM A;  4B3O A;  4CEC A;  1Z26 A;  4KPY A;  2FC0 A;  4KTW A;  1YTA A;  3ZT3 A;  5J1E A;  1L3U A;  1RDA A;  3M8Q A;  2OA8 A;  1IKY A;  4FZY A;  1QTM A;  1NJY A;  4FW2 A;  4ZHR A;  4JS4 A;  1RTH A;  2ZQB A;  2B4J A;  3MEG A;  4CEE A;  3HO1 A;  1KVB A;  3OYB A;  1BCO A;  3ZT1 A;  3LZJ A;  1WAJ A;  4Z0U A;  1BI4 B;  1QQC A;  2JGU A;  5K14 A;  4I9L A;  3KLF A;  3V1Q A;  4Q0B A;  2XY8 A;  5CZ2 A;  4M3Y A;  3DLK A;  4TSX A;  1CXU A;  2I5J A;  3QIN A;  4DU3 A;  3LWL A;  2YKM A;  2WOM A;  3MXM A;  4E0D A;  3QNO A;  4N41 A;  3LPT A;  3VA0 A;  3DLG A;  2R7Y A;  2XY7 A;  2O4G A;  4B9L A;  1B9F A;  1BIU A;  1VK0 A;  4FLY A;  4ELT A;  3B6P A;  1UA0 A;  3VQ8 A;  2OPQ A;  1IKX A;  3HXM A;  5I42 A;  3HPH A;  2D5R A;  3V9W A;  1KCF A;  4OPK A;  3KD5 E;  4F4K A;  3O4Q A;  1WSF A;  3AVK A;  4CGH A;  2D0C A;  3LP1 A;  3NH2 A;  3RMD A;  4FJI A;  4CK3 A;  4JS5 A;  2ZD1 A;  4PQU A;  3EYZ A;  1L5U A;  3LAL A;  3VQQ A;  4IKF A;  4CHO A;  4CJV A;  4I9Q A;  1D9D A;  4FJ8 A;  3SQ2 A;  4W5R A;  4FLU A;  4KTZ A;  2VG7 A;  4HHT A;  2Q3S A;  5HBM A;  1NKC A;  2G8K A;  4FJL A;  3K5M A;  3A2F A;  2HHW A;  4DFK A;  3OYA A;  3ZSZ A;  1L3T A;  4CJR A;  3DYA A;  4N47 A;  3LDS A;  4E7I A;  3VN5 A;  3KKR A;  3OYC A;  4DTU A;  3V6D A;  3WNG A;  4M42 A;  1HYZ A;  1G15 A;  4K8X A;  1WSG A;  3AVL A;  3AVI A;  3ZSY A;  1U48 A;  3QET A;  1JL1 A;  5DK5 A;  1SV5 A;  4KB1 A;  3V9S A;  3D45 A;  4AHU A;  3QER A;  1VSI A;  4FLT A;  3WNF A;  4CGD A;  3LZI A;  3L8B A;  1QSS A;  1JXB A;  1S6P A;  3KLE A;  3NH1 A;  1Q9Y A;  1BIS A;  4FW1 A;  3PX4 A;  3OYI A;  1T03 A;  3OYN A;  1EET A;  2LSN A;  1W0H A;  5HRS A;  1VSM A;  3ZCM A;  1FK9 A;  3RTV A;  3RMA A;  3ZSW A;  1L3S A;  1T8E A;  1D9F A;  3ALY A;  4FXD A;  3T1A A;  2W42 A;  3LPU A;  3VQE A;  2X74 A;  1UWB A;  3AVF A;  2G8U A;  1SKW A;  1ZBI A;  1TL1 A;  2HHU A;  3OYF A;  3IAY A;  4F3T A;  2YHA A;  4CF0 A;  1NK4 A;  4J2D A;  1R0A A;  5HRR A;  3QEX A;  4ID1 A;  5C25 A;  1C1C A;  3V1R A;  4R5P A;  3P1G A;  4Z4G A;  4DQS A;  1KLM A;  2FBX A;  3AO2 A;  4RW4 A;  1X1P A;  4C8O A;  4Z4I A;  4DTP A;  1RDD A;  3V81 A;  5T7B A;  1JLA A;  5I3U A;  3HL8 A;  4DSK A;  4IDK A;  3MEE A;  4KTQ A;  3NDK A;  3QNN A;  2Z1J A;  3DOL A;  1IG9 A;  4CFB A;  3VQ7 A;  3HT3 A;  4BDY A;  2GUI A;  4RW8 A;  3SPZ A;  3S3O A;  4B9N A;  4C8M A;  4FJN A;  2HHQ A;  3RR8 A;  3AVJ A;  4ICL A;  4E19 A;  3QEW A;  1S1U A;  4FJX A;  3AO4 A;  2XO7 A;  3K5N A;  3V9U A;  3SQ0 A;  1LWE A;  5D3G A;  1RT4 A;  3HP9 A;  4N76 A;  2IS3 A;  4FK0 A;  4M3W A;  3IG1 A;  4KHN A;  3B6O A;  1WSH A;  1EP4 A;  2X6N A;  4B9U A;  4DQP A;  4CEQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...