1TKXA

Crystal structure of hiv-1 reverse transcriptase in complex with gw490745
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
537
structure length
534
Chain Sequence
SPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Pol polyprotein, Reverse transcriptase, Chain A
publication title Design of non-nucleoside inhibitors of HIV-1 reverse transcriptase with improved drug resistance properties. 2.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 145
structure length 534
sequence length 537
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1tkxA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tkxA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tkxA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tkxA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1tkxA05
1G15A 3C94A 3UIQA 4NLDA 1HYSA 3CIZA 2B5JA 4MQ3A 3K58A 4DTNA 4RZRA 4R8UA 3G6YA 2FBTA 5HLFB 1S1TB 2IM0A 4DLEA 4R5PA 2G8IA 3AA3A 3IRXA 2X74A 4KRFA 4C8LA 3TI0A 3AA2A 1LWCA 2KFNA 4WYLA 4JV2A 4PWDA 1S1WB 3SQ4A 3AVIA 1NKBA 5FDLA 1VRTA 4ECZA 3AVBA 3TAQA 1S9GA 2R2RA 4RW8A 3CFRA 3LP1A 3MXMA 3PR5B 3M9OB 4XPCA 3NGYA 5EUHA 1TKTB 2W9CB 3OYKA 4FJKA 1YVFA 4K4WA 4NLRA 3V81B 1R0AB 2XRIA 2HNYA 1RT4A 5L1LA 3MEGA 1C1CA 3BSCA 3KD1E 3ZT3A 3GIMA 3CM5A 3I0RB 4KHYA 1T03B 1U45A 2UVWA 4Y2AA 3UR0A 2ILYA 2AWZA 4ZP6A 1BI4B 5EWEA 4PA1A 4Q0BB 4DTJA 4B9SA 1K6YA 1QSLA 4LQ9A 3DRSB 4EBDA 3TAPA 3QINA 3TVKA 3I8DA 4CHPA 3IS9B 4DSJA 2BE2B 2GIRA 3KMQA 5D3GA 1LAVA 4IG0B 4ZHRA 2IAJA 3B6PA 2I5JB 2BRKA 2YV0X 3PW7A 4Q43A 4PQUA 2O4IA 2XGPA 5KRTA 3SFGA 5HRRA 3KHGA 2PYJA 2DFEA 1J5OA 4CFBA 3V81A 2OPPA 1IO2A 3VQ8A 1QE1A 3MF5A 4HUFA 3CFPA 3CDUA 2WTFA 1RBTA 3DMJB 5EU7A 4B9LA 1LWFB 5J2NB 5J2QB 1KCFA 1T03A 4M42A 3GV8B 5KFXA 3OS0A 5K14B 3K2PA 4AHSA 4KB7A 2J6SA 2G8UA 2RF2A 3AA4A 3DRSA 3EPIA 5KFBA 2W42A 4RW9A 4FK0A 3OHBA 4I7FB 2JC1A 2G8VA 4NCAA 2Z1IA 1JKHA 2I5JA 4ECRA 2AJQA 2BQRA 4ZVFA 3N6LA 4BDYA 3AVHA 4WYWA 3QEWA 4NYFA 1REVA 2OPSA 5KT7A 4G3IA 2QXFA 4OL8A 4JLHA 1U49A 4M3TA 1ZBHA 1ZBIA 4ECXA 5F8MA 2OA8A 5J2NA 4NZ0A 1KLMB 3K5MA 5K14A 1HYVA 1XHXA 4DL7A 1NKCA 4OLAA 3OYGA 1LWEA 4GVMA 5KT3A 3KK3A 2FLNA 3PW4A 4I7FA 3VQPA 2F8SA 3HP9A 1IKVB 1KSPA 2R8HA 4HHTA 1NOYA 3DRRA 4MK8A 4CJVA 3KHLA 4NLYA 3BGRB 1RNHA 4FJNA 1RBRA 5KRSA 3MXIA 3IGNA 1U48A 2DPJA 4FLYA 1JLBA 4HCBA 3QNOA 4TY8A 3MR5A 1RTIB 1C0MA 4CF0A 4B9TA 1CZ9A 3O4NA 1BGXT 1EP4B 4KV8B 2FC0A 1WSIA 4KKOB 4NLTA 1NJWA 3SUOA 4OKKA 2AGPA 1IKVA 2W7OA 2OH2A 1S6PB 3V4IB 4KFBB 4LD0A 2DFFA 5F8HA 2YNHA 4WFYA 2FJXA 3RBEA 3BGRA 3SUNA 1NK4A 4EO8A 1RTDA 4FLZA 3QZ8A 1S9EA 1K1SA 4Z4FA 3IN5A 2D0CA 2ATQA 1NNDA 4KAIA 4WXWA 3KD5E 2BQ3A 4FJLA 4CJ3A 3KLVA 4TYAA 3VA0A 4FW1A 3FQKA 2GBZA 1BL3A 3DM2A 1VSHA 1EP4A 3H5XA 1QSYA 4LSLB 3Q8PB 3QEVA 3HSTB 2W8LA 1RDAA 3QGGA 2B6AB 4U7CA 3OYLA 3SJJA 3KHRA 3G10A 1S6PA 3FFIA 5KFAA 3RRHA 4MK9A 3H5SA 1S10A 4KO0B 3RMCA 1XI1A 1C0UA 4MK7A 4Z4EA 3ZCMA 5KFQA 1HQUA 1TAUA 1N48A 1ASVA 1WSEA 4CFDA 2OZSA 4CGIA 4ED1A 2FVCA 2GUIA 1MU2A 4IG3B 5EWGA 4F2RA 3RAXA 4O4GA 1TVRB 1BISA 3OYEA 4DU4A 2FVPA 2RDJA 5F8JA 1EXQA 3AO4A 2RKIA 4F50A 3QEPA 5DK5A 3ZSVA 4Z0UA 3Q8QB 3NF6A 3KLHB 4CIFA 1S1XB 3VQDA 4DFPA 3S9HA 4Z4GA 4ID1A 4CGJA 3S3OA 3NDKA 1EETB 2BGGA 1A5XA 4B9MA 4Y1CA 2CJQA 1TL1B 5J1EA 5C42B 3HJFA 3KOAA 2IGIA 5CYMB 1S97A 4IG3A 2GV9A 4W5QA 3O3FA 1NKEA 3K5NA 3GQCA 2FBXA 1S1VB 1F21A 2KZMA 2F96A 2FBYA 4ED7A 3PO4A 4TQRA 4FZYA 3JYTA 2ZD1B 2X6NA 3P5JA 1JLCA 2E9ZA 3KLIA 4EO6A 4HUGA 2Q3SA 3KLFB 5JUMA 1IKXB 1T3NA 2VWKA 4EEYA 1EETA 3V1OA 1QS4A 3I5BA 1Q9YA 3DRPA 1ZTWA 2ETJA 3CJ5A 5C42A 4E7IA 5CYMA 3PX6A 1D5AA 3AO1A 3KK2B 3V6DA 3T5HA 4YNQA 1SL1A 4DS4A 5F8LA 4CEBA 2JEFA 2HHWA 3I5AA 3HKWA 3HP6A 4JRPA 4W5RA 1KVCA 3OYNA 1FXXA 2QE5A 5KT2A 1VSIA 1Q8IA 4FW2A 2ZE2B 2R8IA 1QTMA 4HUEA 3NAEA 3CJ2A 2V4RA 4DTMA 5KT4A 1IKXA 3PO5A 1BQNA 3SQ1A 4DU3A 4MKAA 1QAIA 4DLGA 4AHTA 3BSNA 4IBNA 3AV9A 4WE1B 1EX4A 2IA6A 3OYFA 4YP3A 1RDCA 3KK2A 3U6FA 4F3TA 1J9AA 1MMLA 4YFUA 4I2QA 4TLRA 5KFKA 3CFOA 3NF8A 2D41A 4B9VA 5HROA 4ELUA 4DU1A 3AVNA 1LW0B 1D1UA 5FRMA 4Q44A 2IM3A 1XR6A 3LP2B 1DTTA 4TSXA 2F8EX 1O1WA 3KJVB 4CIGA 3TANA 2HHSA 1SH2A 3TAMA 2YHBA 2PZSA 1WLJA 4K4TA 3HPHA 4KHSA 4WE1A 1WSGA 4QWBA 4DQIA 2C2EA 3HVWA 5I42B 4IFVA 3ZSWA 3RBDA 2HB5A 4RW4A 4CEDA 3TWHA 5CZ2A 4NLPA 4YQWA 2XY6A 4DQPA 4ECTA 1JLQB 4YR3A 4B9NA 3SFUA 4CEEA 4L8RB 1S6QB 3PR4A 4ED6A 3EY1A 4RNOA 4YMEA 2HNZA 4IKFA 3QLHB 1HNVA 4F4WA 1RAJA 2P1JA 5L1KA 3ZSRA 2HMIA 4Z4IA 4CERA 4OLBA 2VG7B 4WFXA 3KLEB 4CJSA 3I0SB 4KTWA 5KGXA 1TV6A 4NLGA 3EYZA 3NBPA 4ICLA 2WHOA 5C5JA 3V9UA 1NJXA 2LSNA 1SKRA 4MFBB 3SCXA 4GW6A 2PY5A 1JLQA 4H8KA 3SNNA 1ZTTA 4FJXA 1NJZA 2A1SA 4B3OB 1Z25A 1C1BB 4K4ZA 3VQ7A 1C0TB 1S0OA 4MKBA 4ED0A 3G6XA 4JV1A 4RUCA 1YVUA 1ZBLA 2FJVA 4FJJA 1JXLA 2ZQBA 4DFKA 1TK8A 4OVLA 1JL1A 3NCIA 4QWCA 3ISNC 5KFZA 4OPJA 3HPOA 4E7KA 4FZXC 3HVAA 4RW7B 3F73A 1EKEA 3LPUA 3SQ0A 5HP1B 4CGGA 2QV6A 4KAZA 4ZVGA 3SUQA 4DTPA 1C0TA 3CDWA 4RW6B 3DYAA 2JEJA 4IKAA 4KBIA 2F8TA 3AVGA 4O0IA 3L8BA 3HHKA 4M94A 3U3YA 3AO3A 4MIAA 2IM2A 3CO9A 3PJWA 3HT3A 5KFCA 3QO9B 4NLQA 1UOCA 1KTQA 4M95A 1GOAA 2XO7A 1LW2B 4K4VA 2D3UA 3RMBA 2DY4A 4ECWA 1RTHB 4J9MA 3K57A 1HPZB 3M8SA 2XCAA 5HLFA 4GC6A 1S1TA 3KLGB 4C8NA 2YHAA 3SZ2A 4FK2A 5KG0A 4E7LA 4ZTFA 3V1RA 1GOBA 4RW6A 1XR7A 1ZYQA 4Q8FA 1C6VA 1UA1A 1S1WA 2XY5A 4IFYB 3FRZA 5CYQB 1S0MA 3ICLA 4WXOA 2VA2A 4CJPA 4HKQA 3M8QB 3KK1B 3V9XA 2JC0A 3AO2A 1KVAA 1TKTA 2W9CA 2QKKA 4GC7A 1RA7A 1KLNA 4I2PB 1HPZA 4FBUA 2YNGB 3HK2A 3VQSA 1WSJA 4OGEA 4DSKA 1R0AA 3TQ1A 3HVRA 2IM1A 3MR2A 4ECUA 4CGFA 1RT2B 3K59A 5I3UB 2W9BB 5KFIA 2D0BA 3I0RA 4IR9A 3AVLA 4URQU 4DTRA 3MECB 5CYQA 1JX4A 3L2UA 1BI4A 1BIUA 3L3UA 4Q0BA 3M9NB 1W0HA 5SZTA 3AVMA 3QNNA 4H4MB 2KW4A 4DEZA 1VSDA 3IS9A 2BE2A 4O3NA 1JLEB 4IG0A 1U09A 3RMDA 2AGOA 4DSIA 2E6LA 2AU0A 3H08A 3L2WA 1GX5A 4K8ZA 1RT3B 1JXEA 4NLUA 4ECVA 2FLPA 3UPFA 4CHQA 3PX0A 2R2TA 3DMJA 4KE5A 1LWFA 2C2RA 5J2QA 4N47A 4FJ9A 5DQGA 3VQ4A 3RRGA 4AH9A 1S4FA 3ZSOA 3BQ0A 4B8AB 4QWEA 3T3FA 1Y97A 3QYYA 1T05B 4H4MA 4EZ9A 3GV7B 4O5BA 4F4XA 4CJKA 4AILC 3MXJA 3S3NA 1JLEA 3UQSA 4CJLA 1K1QA 4FJHA 4J9RA 3DLKB 2UVVA 4CHOA 4NYNA 4LQ3A 2JEGA 4PY5A 3CVKA 3C6UB 4DQSA 1CXQA 4CGHA 2OYQA 4FJ8A 5KFGA 5DQIA 3RAQA 2JGUA 4CGDA 1S48A 4BE0A 3OL7A 4N41A 2AGQA 5KFOA 4LH5A 1KLMA 4AHUA 2G8WA 4HCCA 3C6TB 4TYBA 1SV5B 3THVA 1IH7A 1T05A 4WZMA 4O3SA 5CY4A 3PZPA 3F9KA 2ATLA 4DTUA 4KHWA 1J53A 1CZBA 4AHRA 3DLKA 3RR7A 3ASMA 1N6QB 3V9ZA 4NCBA 3QEIA 1VRUB 5KFJA 4CCHA 3ITHB 1TK0A 4F8RA 2XI2A 4FLWA 5KFMA 1IKWB 1TL3B 3ZT2A 1TP7A 2Y1JA 2XY8A 4H54A 1RTJB 2B43A 2D3ZA 1VSJA 3DLBA 4Q8EA 1RTIA 1I6JA 4DWIA 2OPQB 3SUPA 1XC9A 4KV8A 3OJSA 3OYBA 4CJ5A 1NK5A 2ASDA 1A5WA 4KKOA 1FKPB 1B9DA 4IOBA 3PVXA 4J9SA 1U47A 3V4IA 4KFBA 4RUAA 4Q45A 1VRUA 3NFAA 3CM6A 4F4YA 4EZ6A 3ITHA 2KTQA 2Z1JA 5HRSA 2ALZA 3D0PA 4J2BA 3ZSQA 1TL3A 1UAXA 2P51A 3OYCA 4FLTA 4M45A 3I5CA 1JLGB 4YR0A 1X1PA 1RT7B 4DL5A 4CFCA 4DSLA 5C24B 4IH5A 2OPQA 5KTQA 1S49A 1BCOA 2W9AA 3L2QA 4XPEA 3AO5A 4QPXA 3L3VA 4XO0A 4LSLA 3CJ4A 1KHVA 4FK4A 2IS3A 2XWYA 4H4OB 2IJNA 4KPYA 2B6AA 1TKDA 5KFDA 2UUTA 3PW2A 4ZPCA 3DDKA 3NF7A 2V0NA 1FKOB 4IRCA 4KO0A 3LANA 2XGQA 1UWBB 5J2MB 3SPZA 3AA5X 2HHTA 5JS2A 2XHBA 2WCXA 2BR0A 3BJYA 3D5MA 1TVRA 3AVJA 2DFHA 3AVKA 4OPKA 2HAIA 1IG9A 1S9FA 2ITGA 1S1UB 2IBKA 4F3OA 1U04A 1IKYB 3WNHA 4CJEA 2OPRB 3KLHA 1S1XA 4CEQA 2IC3B 2XCPA 5KFRA 3NAHA 4CIEA 2HWIA 3ZSYA 1X9MA 4O3PA 3VQ9A 4BDZA 4DL2A 1JL2A 1FKOA 3AVFA 4IRDA 4C8MA 1TL1A 1UWBA 3CQ8A 4E7JA 5J2MA 1D8YA 1W9HA 5FROA 4J9LA 3NF9A 4FJMA 3HPGA 4G1QB 4KHQA 1NOZA 3OLAA 1SH3A 4HTUA 4CFAA 1S1VA 5KT6A 2JLEA 2ZD1A 3H4DA 4N56A 4K50A 3K5LA 1IKYA 1TKXB 4E0DA 1N4LA 3KTQA 3NL0A 1VSEA 4CJQA 4RNNA 1RBVA 2IC3A 3IG1B 3KLFA 1RDDA 2VG6B 3RMAA 2ASJA 3BQ1A 1A5VA 3OYDA 3HM9A 3H59A 4LY7A 2ILZA 4Y2CA 2G8FA 3LPTA 5KG5A 4BWMA 4RNFA 4E19A 4DG1B 2WOMB 4QWAA 3KIOA 4JV0A 1GOCA 4J9PA 3U3GA 1TQLA 5C25B 4NLWA 3VQAA 4CHYA 3HL8A 1KRPA 5F9LA 3BSAA 4ZPBA 3T5KA 4FCYA 3PV8A 1TKXA 4FJIA 4CK1A 4JS5A 4PUOB 3MFHA 5KFFA 2R2UA 4KI6A 3LP0B 5KFTA 3DLEB 2ZE2A 1ASUA 3TAFA 3H5YA 3SV4A 1NK6A 1ITGA 3QGIA 3C95A 4CEOA 2XY7A 3VQBA 4FS1A 2FBVA 5KG6A 4ZVHA 3PHEA 2WOMA 3RB0A 3OYMA 5F8NA 3Q8SB 1RT1B 4RG8A 4EYIB 4BE1A 1WNSA 2KZZA 3Q8RB 1RBUA 2W7PA 1ZBUA 2IDOA 5DGBA 1U4BA 2DTUA 3SV3A 3D45A 5JS1A 4O0JA 1LW0A 1JLAB 5F8GA 3LP0A 3MEEB 3LP2A 2IOCA 4KREA 4IDKB 1ZBFA 3KJVA 4FLUA 2O4GA 4TY9A 2Z1GA 4O44B 4K8XA 1CXUA 3EZUA 1I3AA 3O3GA 4DTSA 1BQMB 5E41A 3PY8A 4ZP8A 5L9XA 4CF8A 2X78A 3TABA 1L5UA 5I42A 4J9QA 1VSMA 2WONB 1RA6A 3L2VA 4M41A 4CJTA 4NLVA 4CK3A 1WN7A 2XI3A 4FJGA 1JLAA 3T19A 5DLFA 4N5SA 1S6QA 4BDPA 1N5YB 4TXSA 1HMVB 4QW9A 3CWJA 5KFLA 2VWJA 3MEDB 1KFDA 4FZZA 5KFEA 3PW0A 3WNEA 2B5JB 4M3RA 3QLHA 4R8UB 2HHVA 3V9WA 4R5PB 1HRHA 2VG7A 3IRXB 3E51A 3KLEA 3GV5B 4U6PA 1L3VA 2Y1IA 3T5JA 3QGHA 3I0SA 4FBTA 4E89A 1LWCB 4ID5B 4JRQA 3P83D 3QERA 1SKSA 4PWDB 3QIPB 1QHTA 1RDBA 3LP3A 4MFBA 5FDLB 1VRTB 3OSPA 3LDSA 3DOKB 1S9GB 2O5DA 1ASWA 1KVBA 4O3OA 5J2PB 4RW8B 4B3OA 2G8KA 1C1BA 2OZMA 4I9QA 3HXMA 4CE9A 3GIIA 4DL6A 1N5YA 1HMVA 3OYJA 4DL3A 3MEDA 2YNIB 3HO1A 4DF8A 4MIBA 1KHWA 2R8KA 3UDLA 3G6VA 3DLHA 5KG7A 1C1AA 4QOZB 2HNYB 1RT4B 3GYNA 4Z4CA 3OJUA 3M8RA 3MEGB 1SUQB 4ID5A 1C1CB 5KFVA 3OVNA 3ZT4A 3CG7A 3QIPA 3OS2A 2C28A 2GC8A 3DOKA 1N56A 5T7BA 2AQ4A 3QETA 4NRUA 4RW7A 5J2PA 3ISND 5HP1A 4F4ZA 4R0EA 4E1NA 1GX6A 2BANB 1VSLA 1J54A 2D7SA 1D0EA 2YNIA 5KT5A 4DMNA 4CEZA 5D3GB 2X6SA 4FM0A 4ZHRB 2IAJB 3MR6A 4OKEA 4BACA 2I1RA 4PQUB 1BCMA 3H4BA 3ULDA 1J5OB 3H40A 4CEAA 5KG1A 3QO9A 3GIKA 2OPPB 4RU9A 4EP5A 1DLOB 4Z4HA 1LW2A 1QE1B 2V9WA 3LAKA 3QESA 1SUQA 2HW3A 5KG3A 3EPGA 1RTHA 4NRTA 1XWLA 1HYZA 4B8CA 2AX1A 3NGZA 4CESA 5CZ1A 4KTZA 4CJFA 2ASLA 3ZT1A 2NUBA 3TAGA 3KLGA 3CJ3A 4JUZA 2RF2B 3BQ2A 4OJRA 3LAMA 2BANA 3FSIA 1DTQB 4RW9B 3CYMA 3RB3A 4BWJA 4KHUA 2XC9A 1JKHB 4IFYA 1RCHA 3E01B 5FRNA 1JLFB 3QZ7A 5KG2A 2FVRA 1REVB 1W25A 2OPSB 3M8QA 1DLOA 4TN2A 3KK1A 2R7YA 1KFSA 2VG5B 4FM2A 4ELVA 1WSHA 5JXSA 4EYHB 1TKZB 3V9SA 2RN2A 4CECA 3DI6B 2WK4A 1QQCA 4I2PA 2YNGA 2FVSA 4QCLA 3OSNA 4NLOA 1LWEB 5HBMB 3KK3B 4Y1DA 1C2PA 4BE2A 4ECYA 4CF2A 3MAQA 1DTQA 2AX0A 2HHXA 1RT2A 1HARA 5I3UA 2W9BA 3WNGA 3NH0A 4ZP7A 1JIHA 5KGWA 3OY9A 3E01A 1JLFA 3MECA 3BREA 3AVCA 1T7PA 4IRKA 2DPIA 4URGA 3DRRB 2UUWA 1Z4UA 1B92A 3NE6A 2KFZA 4FS2A 1NK7A 3D28A 2VG5A 1HNIB 1OS5A 1TKZA 1LAWA 4EP4A 3DI6A 4FLVA 5KFHA 4XIUA 1SL2A 1JLBB 4YR2A 4NLSA 4TY8B 4DF4A 1D9DA 4K4SA 3RWUA 3N6NA 3RTVA 5HBMA 4CF9A 4QWDA 5F8IA 1RT3A 2A1RA 4CJWA 2QKBA 2WB4A 4DSEA 1S0NA 4FM1A 1BIZA 3M9MB 2IMWP 2E4LA 4NCGB 2HVHA 4LH4A 4M3YA 2YNHB 5KFYA 5DGAA 1IM4A 1HNIA 1RTDB 2BDPA 2FVQA 1WNEA 1SL0A 4UQGA 1S9EB 5KFUA 4C8KA 3IGVA 2P5OA 1VK0A 4K4UA 2JEIA 3LZIA 5KI6A 4I9LA 2YKNB 3A2FA 4ED3A 3O4QA 1QAJA 4WZQA 1WAFA 3C6UA 3DM2B 2R8GA 4J9OA 4KTQA 4GMJB 3S3MA 2PYLA 4LSNB 5L1IA 4F2SA 1FK9B 1RT5B 1JXBA 3OLBA 4TQSA 2D5RA 3V6HA 4J9NA 4FYDA 4NCGA 4E7HA 3FFIB 5KFWA 3C6TA 4ZVEA 4NLXA 2J6UA 1SV5A 1C0UB 3V1QA 3DLRA 1HQUB 3KKSA 3LWLA 3O3HA 1LV5A 1HQEB 1YTAA 3B6OA 3L2RA 3EZ5A 3SI8A 1MU2B 4HVJA 1NHUA 4FXDA 5KG4A 4E1MA 4O4GB 4JS4A 3TARA 1L3SA 1N6QA 4IQXA 2YKNA 4ECSA 4FVMA 1RBSA 2FJWA 2RKIB 4X2BA 2GIQA 2ZKUA 4LSNA 3V6JA 4IH6A 5DG8A 1IKWA 3VN5A 4CHNA 3KKRA 1FK9A 3LZJA 1RT5A 2R8JA 2EX3A 4W5OA 4AHCA 3ZSXA 1RTJA 4O3RA 3CDEA 4ZP9A 4J2EA 1XHZA 3ZT0A 4CJUA 5J1EB 3OYAA 4W5NA 3GILA 1FKPA 3NHGA 1HQEA 3FQLA 3OHAA 5DQHA 3IAYA 1UA0A 1WSFA 4DQQA 2BQUA 4O4RA 4K4XA 1T8EA 3PW5A 1TAQA 1YTUA 1RYRA 2YNFB 4KB1A 3JYTB 3NGIA 4ELTA 1JLCB 4CEFA 3MTKA 3KLIB 1B9FA 2W8KA 5DMRA 2D0AA 1JLGA 5KFNA 3LALA 1NJYA 1RT7A 3TAEA 4EBEA 5C24A 3DRPB 3QIDA 1NHVA 1ZETA 5DG7A 3H5UA 4H4OA 4URSA 3PUFA 1T94A 3V6DB 2HWHA 3CJ0A 4KHNA 1VSFA 5T14A 5DG9A 2YNFA 1QSSA 4DFJA 3MR3A 3H98A 4N76A 4KB0A 1YT3A 5DLGA 4M3WA 3G86A 3KNAA 4KI4A 1NK9A 1NK8A 3PJXA 4DS5A 4M3XA 4M3ZA 1BQNB 4FJ7A 2BRLA 2HHUA 2YKMB 3SQ2A 1S1UA 2OPRA 4NYZA 3ALYA 4CJ4A 3VQ6A 3SPYA 4DQRA 2QK9A 4I2QB 3P1GA 2J6TA 3T1AA 4WFZA 3M8PB 3FDSA 4CJRA 1L3TA 5HROB 2HVIA 4J9KA 1I39A 4ED8A 3VA3A 4Y3CA 2UVUA 5SWMA 4IR1A 2KQ2A 5KFSA 3HYFA 5HRPA 4CHZA 3NH1A 4OGCA 3DOLB 4G1QA 3KMSA 1DTTB 3N6MA 3RR8A 4O55A 3JSMB 4ED2A 2RDIA 3TAMB 3T5LA 3G0ZA 3SI6A 2YKMA 3H2LA 3NMAA 4C8OA 1CSJA 3WNFA 2E9RX 2CKWA 3NGDA 3IG1A 4IFVB 5F9NA 2VG6A 3RB4A 2VA3A 5L1JA 1X9WA 1CLQA 3QIOA 4Q5VA 4RW4B 2HNDB 5KFPA 3M8PA 4ZTJA 4EBCA 4KSEB 4DG1A 4E3SA 1TK5A 4J2AA 1SH0A 4MH8A 3SYZA 2WRMA 3DOLA 5C25A 3KHHA 1Z26A 1RT6B 4J2DA 3OYIA 3JSMA 2HNZB 2IJFA 1HNVB 4FLXA 3K5OA 2P5GA 2Z1HA 3HVTB 2HMIB 4KHMA 4PUOA 3BSOA 3OL6A 3V6KA 1X9SA 3DLEA 4RNHA 1L3UA 1TV6B 3VQEA 4K4YA 1WAJA 3NBPB 4ICLB 3OL8A 5EWFA 2HNDA 1S5JA 3MFIA 2E9TA 3OS1A 4KHRA 3OYHA 2UVRA 1RT1A 3QEXA 3RB6A 2EHGA 4Y34A 1RYSA 1RT6A 3AVAA 2G8HA 1TGOA 4FJ5A 1NK0A 4DL4A 4OKJA 4CF1A 3DLGB 5EDWA 2RPIA 4B08A 2E6MA 1Q9XA 4O3QA 2HHQA 3OL9A 4B9UA 3HVTA 2C22A 1D9FA 4DSFA 4ZPAA 1RILA 4IH7A 3GIJA 1VSKA 3MEEA 4IDKA 3NAIA 3NKYA 1HYSB 2EC0A 4DTOA 4CK2A 4O44A 2C2DA 2FLLA 1BHLA 4ZPDA 1HJRA 4ECQA 2V4QA 4HYKA 1XR5A 1BQMA 4QAGA 3VQQA 1RDRA 4W5TA 4AHVA 3BDPA 3ZSZA 5HRNA 2B4JA 3PX4A 3LWMA 3NH2A 4DFMA 2WONA 2R2SA 3DYAB 4RNMA 4DTXA 3DLGA 3VQCA 4M3UA 3VQ5A 4F4KA 4QW8A 1SKWA 3TR8A 1QUVA 4ZMMA 3LP1B 3BR9A
chains in the Genus database with same CATH superfamily
3OFHA 3PG9A 2QZ8A 3BH6B 2E2QA 4DV6J 2A2CA 4RZRA 1A6LA 2EC2A 2IM0A 1N34K 4TNOA 2YWGA 3B4MA 4JV2A 4PWDA 1SBRA 1SZ2A 1NKBA 5FPEA 3A3NB 3TAQA 1S9GA 2R2RA 2Z56B 3T69A 4IZ9A 4XH4A 3GJTB 2G13A 3PR5B 2I0XA 3GL1A 1FRKA 2I38A 4TU8A 4OI6A 3M9OB 3MM5A 2HBQB 2DR9A 5EUHA 3MCSA 4FJKA 2R7RA 4CWBA 1FJGJ 2VBXA 3O8MA 4K4WA 1CQNA 5DDOC 2F4VF 3CULA 3V81B 2HNYA 1RT4A 2VDHA 1EIYB 1BC6A 4L73A 5EGYA 3GIMA 1AA1B 5HJYA 2OI2A 1TFYA 2UVWA 2O8DB 3G87A 3HFKA 1P1LA 5BN9A 2AWZA 4ZP6A 2X3DA 3LPEA 4Q0BB 4B9SA 4NXMF 1TFWA 4BRQA 1K6YA 2QT7A 2RJZA 3OR2B 3TAPA 5C2DA 2V34A 3I8DA 3C7NB 4CHPA 1Y3KA 2PFFB 3DDIA 2ZDPA 3VMFB 3MWTA 2I5JB 3PW7A 4Q43A 4PQUA 5KRTA 5HRRA 4FWMA 1NBEB 2D1KA 3VQ8A 3BH7B 3CDUA 2CQ1A 2GVDA 4I67A 1T03A 3GV8B 5KFXA 5K14B 3CMAS 2UYTA 2RF2A 3AA4A 3TJAA 4NB4A 1HKGA 3H8YA 2C3PA 4RW9A 1WTBA 2O8EB 3ILOA 1FE0A 1JKHA 3ZTRA 4OV1A 3J81Y 2BQRA 3VAMA 3QEWA 5KT7A 2CGKA 3BKFA 4G3IA 2QXFA 4OL8A 1RACB 4X65F 5F8MA 2ADBA 2OA8A 5J2NA 4HACB 2H54B 2CH5A 3TYTA 1KLMB 2RT3A 1XHXA 1NKCA 1XMBA 3WIVA 4GVMA 4M7XA 3N5FA 1PYOB 1RSCA 1GLFO 2MKIA 2P9PA 3PW4A 5HOOA 2HPUA 1FJEB 3Q2SC 1TU0B 1IQZA 3HP9A 3THTA 1IKVB 4CZJA 2JRSA 2GW8A 4RX6A 2ASMA 3KHLA 1WHWA 4NLYA 5IXUA 4JKGB 4FJNA 1YITS 1YIJS 1B0PA 1RBRA 2P9UB 5KRSA 1U48A 3MCNA 1NMNA 1JLBA 4LFAK 1RWVB 2KH9A 4YUDA 4B3TK 1W7AA 1DQ9A 4KV8B 1WSIA 4KKOB 2XWXA 1R31A 3SUOA 3UCUP 4C0BA 3WBZA 2OH2A 3V4IB 4KFBB 3D1HA 2YNHA 4WFYA 2FJDB 5BPLA 3HHLA 4R79A 1H2VZ 2K06A 1HNWJ 4CJ7A 4LFCJ 4LVOP 1Z1ZA 1IBMK 3THWA 4F02A 3PACA 3DJCA 4ZITA 3ZEUB 4Y0WA 4O0NA 3CPEA 3K17A 3KD5E 4FJLA 1FNXH 4FW1A 3BKTA 2GBZA 5AQJA 3BY5A 2PO4A 1YJWS 1B4SA 1HI1A 4EFAC 3CUNA 2A40A 4C23A 2GJFA 3AAPA 2R7TA 3L4BC 4U7CA 2F4FA 3KHRA 1S6PA 3FFIA 5KFAA 2UP1A 2GELA 4KO0B 1IUJA 5B0AA 2MB0B 2C1EB 5G4DA 3MMBA 1ASVA 4CFDA 1K0TA 1KVIA 2OZSA 1WHVA 4IG3B 2D0OA 3C14A 3RAXA 3KDNA 4XTTA 1QAYA 4UW2A 2BE9B 3PJ9A 2OKQA 2FVPA 3EDRB 3Q24A 4O5FA 2ASPA 3PLAA 1HKCA 3W1YC 3BF4A 2OD4A 5DK5A 5JVGL 4CIFA 3UW1A 2O8BA 3S9HA 1Y4ZB 2JWLA 1Y11A 3VEVA 4CGJA 3BPSP 2NUHA 2HVZA 1V6HA 1RWNB 5LMUK 1TL1B 1Q7LB 3HJFA 1GLEG 3HI9A 5CYMB 3SAFA 2O8FA 5CE3A 4W5QA 3R6GB 2FBXA 2KZMA 2F96A 2Z2MA 3IM8A 2FBYA 2I7PA 5EOYA 3PIOL 4FZYA 5LMNJ 2Y8YA 2YBVA 3VAHA 2DY9A 1DBDA 3BEXA 1QDUB 2Q6CA 3RG6A 1UZHA 2VWKA 1W2IA 3V1OA 3I5BA 1TYQB 1OVQA 3DRPA 3CJ5A 1FE4A 5IC4B 2QSWA 3PX6A 2YXLA 2ZH8A 3O1WA 1MWZA 1HW9A 2ALYB 5M1QA 2AYEA 1KVCA 5HAOA 4AXIA 2UXBJ 1Q8IA 4FF1A 3DHXA 3CJ2A 4DTMA 1EWRA 3PO5A 1BA1A 3RUBL 3SQ1A 4DU3A 1Y5NB 3HI0A 1FNMA 4AHTA 5DETA 4IBNA 3AA9A 1PCAA 1D8ZA 2J8SA 2H5JB 3QFUA 2ACYA 3N5BA 1J9AA 1MMLA 4I2QA 4TLRA 4F25A 2DGQA 4CLZA 1NGCA 1UWAA 2CZVC 4B9VA 1K0VA 1OPZA 4FPIA 4I0WA 4W4MA 1XR6A 4F26A 5IT9Y 3TANA 1HLUA 3IA0A 3TAMA 1KQGB 3DXMB 3I82A 1ATNA 2NRZA 1UMJA 1WSGA 4QWBA 2QA4S 2QEXN 3UN3A 2JFKA 5JVGQ 3ZSWA 3RBZA 3TWHA 1JQGA 4YQWA 4ECTA 1GH8A 1DEJA 2NSCA 1YVNA 2OEJA 4KRWA 3AODA 4L8RB 1S6QB 1KWMA 1LCUA 3PR4A 4RU2A 3EY1A 2KXFA 4YEAA 2AMCB 1VQOS 4FWSA 3CMAN 2R4FA 4F4WA 1RAJA 5CABA 3GIRA 3ZSRA 4KBOA 3OBWA 5JLHA 4BG9A 2IRYA 3PIOQ 1FX4A 3BR8A 4O8KA 3C66A 3J7ZO 3W62A 2WHOA 3V9UA 1NJXA 4BR7A 1WSRA 1BUPA 2E2OA 2G0CA 4GW6A 1JLQA 4H8KA 1ZTTA 1T6DA 4JOUA 4EU0A 2WC9A 1NU4A 4LVNP 1NJZA 1RWXB 2FY1A 5AZJA 3P38A 3ET6A 1HWIA 4IUFA 3NOGA 4ED0A 1RGIA 1ZA2B 2PAVA 1UEUA 3WQPA 3HOTA 4BR2A 1S12A 4RUCA 3GCWP 5BR8F 3CIPA 4QYZJ 1N0UA 4USWA 4OVLA 2CPJA 1B0VA 2IJRA 5KFZA 4MKYA 3EE3A 4JI0F 4FZXC 3CCTA 2ZWHA 3LPUA 2DNRA 4CGGA 1N36J 5F3ZA 3M6WA 3S1TA 3QDKA 1EQMA 1YITN 4I6MA 4RWXA 3UNGC 4IKAA 4KBIA 1WHYA 2XMTA 3H6EA 4ZVQB 3HSZA 4K59A 1BU6O 5E3PA 2MZSA 3CO9A 4U8VA 3W2VA 3HT3A 5KFCA 3QO9B 3C15B 2XO7A 3EJMA 4K4VA 3BZQA 2VFSA 4J9MA 2B9EA 1HHTP 2F8MA 2QJ3A 1LK5A 3ETMA 2QWLA 4WP8A 3KLGB 3SLCA 4C8NA 3SZ2A 2BJ3A 3DLJA 1SPBP 1VQ5N 3GFZA 4ZLNA 3MXHP 3KWMA 1SJRA 2VJUA 4IFYB 3FRZA 1UW4A 3VTIA 2R7XA 3ICLA 2ZJQL 2PT0A 3M8QB 1YJWN 2H1YA 3V9XA 2DGXA 3TZYA 3H20A 5HMWA 3NMRA 1MN7A 1X4AA 3M3ZA 4I2PB 4BLGA 4FBUA 4A8YA 4XK8C 1FI4A 3LL3A 4QU7A 2KB2A 3VQSA 4OGEA 4DSKA 1YRUA 2CQ0A 3MR2A 3O80A 4AM6A 3O9SA 3K59A 2W9BB 3VAIA 4QS7A 5BR9A 3KFWX 1AB8A 2J8AA 3K8WA 1Q16B 3CD7A 5T7LA 3CD6S 1W0HA 4WQ4C 2FC8A 3ZZTA 3QNNA 4H4MB 4DEZA 2HZAA 4U96A 3IS9A 1S57A 3W9IA 4O3NA 3NVMA 2X7IA 1U09A 1ITPA 1SJ4P 1O6XA 4DSIA 4JI7J 3TUJC 4B1UB 3H08A 1YQHA 1RISA 1YUWA 3JAMU 1Q81T 1JXEA 2D3OR 1UVMA 3EWGA 3PX0A 4JI2K 2ZH9A 1RQ0A 2DNMA 4KE5A 3JAMO 1LWFA 4B1XB 1LXJA 4CLYA 1S4FA 1BLUA 1HNXJ 3BQ0A 4B8AB 2ZDOA 2I6WA 2MQLA 5FLXY 1FRLA 3P31A 3UDCA 4F4XA 4O5BA 2F63A 3OFGA 1DURA 4OZNA 1K1QA 2B8PA 4BRDA 4FJHA 1IBKK 3DLKB 1XMQJ 2NS1B 2XS2A 2A5XA 3CVKA 4AE5A 4BRFA 2SXLA 1VJWA 3C6UB 4NXNK 4M5KA 1XN9A 1P90A 4FJ8A 5KFGA 5DQIA 3RAQA 3FVYA 4BE0A 1NGJA 2AGQA 4N7TA 5KFOA 4AHUA 2G8WA 5ITHA 2IVFB 4CLLA 3FCHA 1T05A 4GRSA 3U1NA 3UWTA 3GJRB 4ZIWA 1M5OC 3CJ1A 1X7VA 3ADAC 3PZPA 4LRCA 2ATLA 2DH8A 4LF5K 3DOMA 1CZBA 4AHRA 4LF7F 4FVUA 3RR7A 4B3RJ 2V63A 3J7AN 2NR0A 1N32J 1NZ8A 2EK6A 2L9DA 4EMDA 3OVSA 4F8RA 3KZBA 2GMJA 2ZJQQ 5L9NA 1IKWB 3ZT2A 1B64A 3VEOA 1TP7A 1E6YA 3V5RA 4JKHA 4B3SK 4GKJK 2ZITA 2QTDA 1VSJA 4Q8EA 1MW7A 4USVA 2M0GB 3CB4A 4KH4A 4DV5J 3MMCB 4FPRA 1SC6A 3NCQA 5M1FA 5D6GA 3CC2S 3BN4A 4H4KC 4I68A 2B56A 3C16A 1VRUA 2OJ3A 4ILHA 4GKKF 3FZHA 2GQQA 2QA4N 3A12A 1WOQA 1RHMB 2DXDA 2WVCA 4J2BA 1TL3A 4F36A 4RTFD 2MKSA 4M45A 5H9EJ 2LFVA 4ES1A 4USMA 4DCHA 4F0KA 5CHIA 2E44A 3HD2A 4DUZJ 4IH5A 2OPQA 4ZIVA 1BCOA 4LRBA 4XPEA 4B3MF 4LSLA 3CJ4A 1JWWA 4FK4A 2KJVA 2IJNA 2PMWA 3FCVA 2ASOA 2B6AA 3C2PA 3ENOA 3PW2A 1PYTA 1FKOB 2BACA 3EZWA 5ADXA 5ETVA 2F9TA 2XGQA 3EKUA 5I9EB 1LK7A 2AEFA 3OR1A 3A8IA 4OFZA 1YAGA 4DPYA 2XHBA 3E9LA 4FNIA 4CM0A 3QWPA 2HGNA 4H0XB 3JB9k 1VK3A 1IG9A 1S9FA 2ITGA 3G6ES 3WNHA 3THXB 5F41A 2L3MA 2FGCA 2VOOA 1D3WA 1S1XA 2FYXA 4JI6K 5IWAF 2XCPA 3MMAB 1HHSA 1X9MA 4OX7A 4BDZA 1WACA 2B4UA 2BXJA 2YQ1A 4DV2J 2GV1A 1UWBA 1ZH5A 3CQ8A 4E7JA 5F0WA 5J2MA 2LEBA 4J9LA 3NF9A 4FJMA 2C2ZB 2GAHC 4KHQA 1NOZA 2OANA 2GHVC 1TR0A 4CFAA 4MMOA 3U1MA 1N4LA 3MEKA 2VD3A 3WQUA 3QNWB 2V94A 2HZVA 3M32B 3HULA 3B78A 2ILZA 2VFUA 1CULA 4WWSA 4AD6A 3CCVN 4RNFA 4DG1B 2HRYA 4P7VA 1NGHA 4J9PA 3U3GA 4WP9A 5C25B 5L39A 3HL8A 1MWQA 3BSAA 1X5PA 3ZNUA 2YY3A 1R59O 3RJMB 1FDBA 3T5KA 4Y00A 4LF4K 2MLXA 2P9SB 1CBKA 3J7YI 1UZDA 2XB2D 1TKXA 3W3SA 2KM8B 4CK1A 4PUOB 4FYYB 1ASUA 2WTUA 1NK6A 2BABA 2E1CA 1HWJA 2E1RA 1M5KC 3QGIA 1AW0A 4FS1A 3GFYA 3RB0A 1VISA 1RT1B 2GGPB 2ZH6A 4BE1A 3CGIA 4ZN3A 1WNSA 3AY9A 3GPAA 1V3RA 4P2SA 4X66F 4DR7K 1ZBUA 1Y64A 5D0EA 4JK7A 3KJNB 4C9DA 2DNKA 5JS1A 3VEXA 4JI1J 3P39A 1LW0A 2XZWA 4CZFA 3LP0A 2ZUGA 3DXBA 2MKHA 5CYJA 2J5AA 3K7RA 4L76A 1GK8A 3B82A 1MMDA 2EKYA 4DR5K 3CDAA 1OY9A 3JQMA 3CD6N 2F1FA 5E41A 2QFIA 4J7CA 4CF8A 2YKQA 1LEOA 1ZM9A 2KG1A 1NMEB 2WONB 3DXKA 1BA0A 3SMPA 1ZM3A 2NXNA 5GAEI 5AXKA 1JMTA 1HPMA 4CK3A 1WN7A 2XI3A 3HKZD 1X0PA 1JLAA 3AB4B 1J5EJ 4N5SA 1HQ2A 1HMVB 4QW9A 4FWQA 3MEDB 3NCRA 3WNEA 1N33F 4JEPA 1G4CA 2ZM6K 4B1WB 3O1BA 3V9WA 4X4VA 3GV5B 4U6PA 1L3VA 2Y1IA 3QGHA 4CDIA 4E89A 4U7UK 4C6AA 3TJ9A 3P83D 3QERA 2E5LF 4PWDB 3QIPB 5A6WA 1F3VA 2LVWA 3R9LA 5U47A 4B1YB 3LDSA 3DOKB 1S9GB 3FSXA 1QHAA 5HJXA 2IVOA 3TW0A 3HXMA 3GIIA 1R0CB 3MM5B 3OYJA 3HO1A 3IWNC 3W0LA 2X51A 4PG6A 4JI5K 4CLSA 3ZZPA 3CSKA 3WXIA 1C1AA 2FZGB 4QOZB 1VYAA 2HNYB 2V5HG 4MJKA 1RT4B 4KHPF 3TOQA 1PG5B 1TUUA 3OS2A 1WBDA 4YB6A 2GC8A 3LDNA 5CZXA 2AQ4A 2UUAJ 4FYVB 5J2PA 3VF6A 1XMOJ 2YHXA 4BC4A 2KU7A 1J54A 4DV0F 1BDGA 3PRVA 3DKDA 4FM0A 4BACA 4PQUB 4PKDB 4I56A 4P72A 1N5SA 1CJTA 2CPFA 3Q86A 2CH6A 4EP5A 5ADXH 1LW2A 1FERA 3W63A 1RTHA 1VC5A 2GVDB 4NRTA 2DT9A 4WTOB 2KYXA 3NGZA 3CC2N 5CZ1A 2W4DA 4YB5A 4JN4A 1N52B 4JKDA 1JJHA 1VQYA 1RABB 4DX7A 4JUZA 2RF2B 3BQ2A 2RAQA 1QZ5A 3NS7B 2BANA 2QWQA 1Q5YA 4RW9B 4JYAF 4BWJA 2XC9A 3P5TL 1U1RA 1JKHB 1RCHA 1YBUA 5FRNA 1RWPB 4AQYK 4JI3K 1W25A 2ZOMA 4TN2A 3KK1A 3UD5A 1WSHA 2Q0RA 4EYHB 3V9SA 3TJ8A 4CECA 4DR1F 3OTDA 2JWKA 3OSNA 4ED5A 3PIPL 2M52A 1ZAVA 3CD5A 3JTNA 1C2PA 1OY6A 4CF2A 3IRWP 2P9PB 1HI8A 1N5VA 1YJVA 4CH0S 2I2YA 1RT2A 3WNGA 1U1OA 3E01A 3B8HA 1XEZA 5DZ7A 2QLBB 2BW7A 1NJIT 3CW2C 3MN7A 3ZZZA 2DPIA 4URGA 1IQTA 4BRAA 4K0KJ 2UUWA 3NE6A 3G6EN 2KFZA 4FS2A 3D28A 3MM6B 2B3TB 1SQFA 1HNIB 1TKZA 1LAWA 2FF3B 3DI6A 5IT4A 1JLBB 2QXLA 4NLSA 2FGOA 1D9DA 4K4SA 3RWUA 3O3LA 4OX9J 3FZBA 4CF9A 2P9CA 3QMLA 4CJWA 1KBRA 4FWPA 2EEYA 2F4VK 4GO7X 1GLJO 4UUWA 4NCGB 2HQGA 2HVHA 2XZDB 2Z57B 2RQ4A 2YNHB 2OHDA 3HHLB 5DGAA 5CAAA 3G8TA 1ULRA 1IM4A 3DU6A 1VIXA 1SL0A 4UQGA 1O8BA 4C8KA 2QA4G 4K4UA 2JEIA 2A41A 1WF0A 2CNNB 4ED3A 3O4QA 1QAJA 4WZQA 1DZ5A 2J0WA 3EXCX 2CGJA 2FB0A 3BGUA 3S3MA 2ZHOA 1RT5B 3PYFA 2LXFA 4TQSA 4ANCA 3V6HA 4E7HA 4BC5A 3FFIB 3C6TA 3J81U 2J6UA 3Q83A 3HSGA 3MMBB 3E66A 1S59A 1U1PA 1LV5A 3GDQA 1I94K 4M5HA 3IFEA 5AQGA 2PDAA 4K8RA 2DKOB 3C14B 3TARA 1N6QA 2GZOA 3UNYA 1WD6A 4EHUA 3N4QA 3N28A 2ZKUA 4LSNA 5L38A 4X64J 4WBFA 2FXUA 4FO0A 2O8BB 2VBWA 2Z0GA 1PBUA 5IFMA 1ZAWA 4X65K 1VI7A 3LGNA 2W41A 1KKHA 3PIPQ 3MMVA 3GILA 4Z7CA 1HBNB 2RE2A 1HQEA 2O8FB 4EI2A 4DV1J 4NEZA 4RJVA 4DQQA 1WSFA 4ANEA 4A2BA 1B7YB 3ILJA 2KI2A 2Y1LB 2KRBA 3OTOF 1NDKA 2QLWA 3NGIA 4ELTA 1FJGF 1NH8A 2GWKA 2PMHA 3W8GA 4NMXA 2ROPA 1NJYA 5HI7A 1AUDA 1NSQA 3DRPB 3QIDA 4QIWD 5DG7A 3PUFA 2HHPA 1VHXA 1R6YA 4DMZA 1X60A 1KNZA 3LW5C 2YNFA 1ZM2A 1ESVA 4DFJA 2PC6A 1CQMA 3UCGA 3OVAA 5DJBA 1CVJA 4FF2A 2PMZD 2OTJN 4N76A 4KB0A 1YT3A 3DWLA 3M8WA 4CI0B 4I6YA 3KNAA 1NK9A 1D4XA 1GAOA 2OMOA 1YDLA 2LDIA 3G25A 4PZVA 1R27B 3LPYA 3R5BA 4TU7A 3SQ2A 1S1UA 2LLZA 5I4MA 3N0VA 4K25A 3W65A 2QX0A 3AJ2A 3UE2A 5JJBA 2LXUA 3VQ6A 4AF1A 3SPYA 5FPMA 2FD2A 4AT1B 4I2QB 2J6TA 1ROFA 1WEYA 4CJRA 1Y3JA 3CD0A 2HEKA 2UVUA 1WI6A 3HYFA 5HRPA 4OZ5A 4G1QA 3KMSA 3O6QA 3QQCD 3JSMB 3TAMB 3P96A 2KKZA 2J7WA 4C8OA 2QMXA 3F9MA 3I87A 2E9RX 2CKWA 9ATCB 3NGDA 2A18A 5L1JA 1KXPA 3OXFA 4Q5VA 2ASYA 4AXJA 3IAS9 4DV7J 4EBCA 2LU2A 4K5RA 4J2AA 1IJEB 3GG0A 1F5BA 5ETRA 3VHQA 1N34F 5HVFA 2FJBB 1X5OA 1QLNA 2P5GA 1L3UA 3AAWB 2YVSA 2P9KA 4JKEA 2HNDA 1GXLA 3LQVA 3W61A 3W66A 1F9FA 3C0BA 4BY9C 1QVFR 3BBFA 1KQKA 3CCMS 1TELA 3AVAA 5AZJB 2G8HA 3ET6B 1TGOA 4FJ5A 3D66A 1F60B 2K2PA 4BR0A 3DLGB 3M7VA 2Q36A 2RPIA 1Z2ZA 1Q9XA 5CR4A 3HVTA 1YJ9N 1D9FA 1U0SA 2UZAA 4DSFA 1KAZA 4DU7A 4NZ7A 4J91A 3MPUB 1UPMB 1HX1A 3EGVA 2C2DA 3KYLA 2Q6BA 4HHJA 2V68A 3D0HE 1HJRA 2B9WA 3CDBA 4RCHA 1BQMA 4QAGA 4ILJA 1X4GA 2H48B 4W5TA 3HDSA 4FL9A 1X4HA 7AT1B 5HRNA 3W5XA 2R2SA 2E66A 4RNMA 5IT9U 3VQCA 3EM1A 4JI4J 4QW8A 2HGLA 3MN5A 3TR8A 1QUVA 4HLBA 3LP1B 1Q8LA 3SXLA 3BR9A 3C94A 3FEZA 1KQSR 2V8HA 3FZFA 4DV4J 1HYSA 2B5JA 4MQ3A 4MO4A 3K58A 5B8HA 3G6YA 4JNEA 1WKJA 3NNHA 4DLEA 4R5PA 2V7YA 2HOEA 3TI0A 3US5A 1LWCA 4QBUA 4IJNA 1VRTA 3AGRA 3VQTA 1FFGB 2IYGA 5LL6d 3QJJA 1NUEA 3F44A 4JI8J 3NGYA 1OH6A 2ZGZA 1BMQB 1ZOTA 3TVYA 2EI5A 1U1NA 1YVFA 4N8NA 2JLGA 5LMNF 1RHQB 4CM2A 1YXQA 1P8ZA 5L1LA 2J9DA 4QS8A 5ETOA 1YBAA 3CM5A 2LCWA 1IG8A 4B9QA 1U45A 2QLXA 2BMBA 2CDQA 1P9YA 3MUTP 4PA1A 5CQGA 1QVGR 1K9MT 1QSLA 4LFAF 3DRSB 3QINA 3IS9B 2OGUA 4B3TF 3EE8A 4KGMA 5K8PA 5CA5A 5D3GA 4ZHRA 1VFJA 2GEMA 2YV0X 1TUYA 3VAKA 2HS4A 2DH9A 3SFGA 3KHGA 1IR2A 1J5OA 2XULA 3A8YA 3V81A 4K42A 2OPPA 1HBOA 4CH7A 4YDUC 1Q8KA 4DR6K 1LWXA 1RBTA 3NWGA 5EU7A 1LWFB 1KCFA 4M42A 3EKSA 1IBMF 5BR8K 2O8DA 3ZX3A 3OS0A 2UXDJ 1OWXA 2O67A 3QT6A 1BWFO 4A46A 3R8YA 4RKUC 3EGWB 3C7NA 2W42A 4I7FB 2JC1A 2HFUA 4W90B 2G8VA 1WC6A 2I5JA 2HHHJ 1BD6A 4RPFA 4ECRA 2ABYA 4ZVFA 5HMYA 4CNYA 1REVA 4HL9A 3Q8YA 3SK3A 1LFWA 1YBTA 4CTAA 4FOIA 1ZBHA 3U27A 4WKRA 4ECXA 5K5MA 3D3BJ 3VEZA 5K14A 3OFEA 3UCZP 4OLAA 4LF8F 1G2EA 4ZCIA 3CJSA 1LWEA 5KT3A 3MTJA 1SXLA 3G2XA 2FLNA 2O8EA 4M5GA 1SC4B 2F8SA 3AA8A 4DV3K 1KSPA 2DNOA 2VGMA 4ATNA 2UU9J 4X4NA 1YZ6A 4ERDA 3V2UC 1CZAN 1HNZK 2UUCF 2FZKB 5LMUF 4HACA 2DPJA 3SCKE 1R8CA 2BOPA 4HCBA 5A0YB 4X62F 3OBIA 3QNOA 5D8HB 5EX3A 3S6EA 4B9TA 4ZCLA 2XM3A 1EX8A 1EP4B 5A8KA 2FC0A 3CHWA 2MY8A 2OELA 4NEYA 1IKVA 2W7OA 3VPZA 3HFVA 4BRCA 2DFFA 4KY3A 5F8HA 3NCPA 1AYEA 4Y6IA 4YOEA 3NRBA 3C16B 2HVEA 2V2VA 2D3O1 3RBEA 3E2EA 4EIAA 3SUNA 4EO8A 5E3RA 1RTDA 3QZ8A 2QL9B 2EFGA 4TLQA 3IN5A 3I55S 1YJNS 1NNDA 4WXWA 3BUZB 4CJ3A 3KLVA 3Q2TC 3VA0A 3THYB 2DGOA 4YB7A 4OYPA 4OYWA 1VSHA 4MLEA 3FSYA 1RJJA 5FLXU 4H0TB 4YOTA 3BPDA 1ILYA 4LSLB 3SQOP 2AJ0A 2B6AB 5AQVA 4I6WA 1VC6A 1VBYA 2R3VA 3RRHA 1N36F 3CCJN 1G7CB 3H5SA 4LFBJ 2E1PA 4LF9J 1C0UA 2FJEB 2H9ZA 2HVDA 2I9SA 1TAUA 1HQUA 4CO1A 3OR1B 1WSEA 3QRQA 1WBBA 2FVCA 3VR1A 1MU2A 2ADCA 3ZEUA 4DL0C 3CCQS 1BO5O 3OYEA 1X4BA 2GO9A 2K7JA 5AQSA 2RRNA 2RKIA 4F50A 4I1TA 3QEPA 3CJKA 2UXCJ 4ILRA 3ZSVA 1PJ7A 4JI2J 3HBTA 1UL3A 1S1XB 1WJ9A 4YORA 4DQ8A 3NDKA 2BGGA 1A5XA 4FWRA 4Y1CA 2CJQA 1YJTA 1IR0A 3LUYA 3KOAA 2IGIA 1HBUA 4L3QA 1IBKJ 4IG3A 3O3FA 5D77A 3NG8A 2PFDA 2F40A 3GJSB 2Q97A 2MGZA 1Q95G 4LR7A 1FNOA 4YHHJ 3AH6A 4NXNJ 1UFKA 3PO4A 3DDNA 3PHTA 3AOBA 4LF7K 2NRRA 2OFHX 2BVZA 2E9ZA 3KLIA 4HUGA 3CC4S 3GWCA 2HBKA 4OLPA 4EEYA 3NNAA 3KXDA 4AYBD 1CULB 1QS4A 1ZC6A 2HURA 5BRHA 4A59A 3A5LC 1ZPVA 2F7TA 4LF1A 5CYMA 2AYMA 1NGAA 1D5AA 1N5TA 3AO1A 1YK9A 2MMYA 3KK2B 4IYQA 1NPPA 4YNQA 1SL1A 5F8LA 4CEBA 3HKWA 3HP6A 2VZ9A 5FD1A 4W5RA 3OYNA 2QE5A 5KT2A 1C0GA 4FW2A 2Z8QA 4HUEA 4JI7F 3FZLA 4GKKK 4JKBA 3AY0A 2A42A 4MKAA 4UUXA 4DLGA 1GLLO 3AXKA 3BSNA 4WE1B 3OYFA 1YLXA 2M5YA 1RDCA 3VGSA 1HR0F 2IIHA 4LMZA 4F3TA 1HNXF 4YFUA 1NZAA 5KFKA 3U02A 2CQ2A 3CFOA 4CLUA 3CCSS 1Y7PA 4G1PA 3LOUA 5HROA 1VRQC 4ELUA 2BYCA 4DU1A 1LW0B 1D1UA 2IM3A 3CJQA 3JXOA 3TSPA 3SDEB 2ATCB 4TSXA 1O1WA 2HHSA 3VENA 4C1NK 3I33A 1RWUA 2YHBA 4IO9L 1URRA 4K4TA 2NXUA 3TP2A 1GXUA 3CCLN 1D9AA 2JOQA 4DQIA 3M6UA 4DR2J 5D15A 4IFVA 1GEHA 4IQMA 2HB5A 1YRTA 2VQFK 2FLOA 1WC3A 3JQJA 4WIIA 5CZVA 1UJ6A 1X31C 4NLPA 2YKOA 4ZJOA 4DQPA 2AF6A 4Y2MA 4YR3A 3CCWA 3UKUA 3SFUA 2AD9A 2ROGA 2EFQA 3T6JA 4YMEA 2QWRA 1S7IA 3H1VX 2LQBA 4IKFA 3ONQA 2P1JA 2U1AA 1S6UA 3MD3A 3C6AA 2FDNA 1J27A 4KQZA 3MCOA 3P45B 4NLGA 3FFKB 1H7XA 4ICLA 3OBYA 4NPOA 1XERA 2CNLB 2KKHA 3AFGA 1NDCA 1NSPA 4K43A 1MNEA 2IY5B 3ID6A 3VAJA 4DV5F 3W3DA 4C3MA 4FJXA 4ZA1A 5D78A 4EHTA 2DR6A 3CERA 3SCIE 4MKBA 1PSDA 1HKBA 2QN6B 3PRDA 3G6XA 4PKGA 3MWPA 3MUMP 3D4JA 2VPXB 3NMUA 3D2EA 3W64A 3R7BB 4DPWA 3MOJB 4FJJA 1JXLA 1N54B 4G65A 4QWCA 3ISNC 4XDDA 4BROA 4E7KA 3F73A 2YKAA 3H7HB 4LT6A 4U7UD 1RE1B 1RADB 4DTPA 3CDWA 1V4TA 3RW7A 4RW6B 4YN3B 2JEJA 4O0IA 3L8BA 1NJIO 4M94A 2PGCA 3U3YA 2DR7A 4MIAA 2IM2A 3QBCA 1CJTB 4X66K 2JHEA 3VESA 1GOAA 3R5JB 1LW2B 5LJWA 1X4CA 3K57A 1RTHB 4ECWA 2W2PP 3U7JA 3VVUA 1HPZB 2DRBA 3QRRA 1NM2A 1JCGA 5HLFA 4H5VA 1S1TA 4OHWA 3JAMY 4IO9Q 1HKAA 2ITMA 3V1RA 1XR7A 2VYPA 3I55N 1ZYQA 2HRTA 1UA1A 1S1WA 2XY5A 5AQNA 5CYQB 1R43A 2AT1B 1Z6RA 5BYRA 5HVGA 3KK1B 1PGZA 2WVFA 3ENHA 3AO2A 2HQFA 1KVAA 2CADA 4GC7A 1VQMS 4P75A 1NGGA 1BXNA 1WSJA 1R0AA 4ECUA 2RH3A 1RT2B 5EXWA 2PN6A 2D0PA 2C2OB 2K8GA 3FUYA 2W6LA 3L2UA 2HFVA 2Z30B 2ZC4A 4GKJF 1BIUA 5SZTA 4OJGA 2VFVA 3KK7A 4ID8A 1VSDA 4ZCMA 2BE2A 1JLEB 4OZ2A 4D3GA 1ZA1B 1WKLA 2COLA 4HDHA 3O6WA 2QMUB 2HFZA 4PWWA 1GX5A 4CZCA 2DGUA 2YTCA 4ECVA 2ZGYA 4OYOA 3T1HK 1YRXA 1D09B 4WF9L 2C2RA 5J2QA 4N47A 5DQGA 3VQ4A 1WEXA 4AH9A 2ZBQA 4KHPK 3J7AP 1S76D 1JCFA 1HLWA 4BRHA 3CCRN 4A5BA 1YHQN 4H4MA 4EZ9A 1P6TA 4CJKA 5AE2A 5M1PA 3CC4N 3ZZOA 4IO8A 3LF0A 4CJLA 2MQ8A 1WKKA 2UVVA 3H25A 4CHOA 4JI1F 1DJ0A 4DV0K 3OA9A 4S0MA 1HWLA 1K8AT 2HQCA 4LIWA 3KJFB 4CGDA 3VGTA 1OIAA 1R8AA 4HCCA 3CCZA 2ZHBA 4LF6F 3C6TB 4TYBA 2Y9HA 2W2MP 2OAUA 3A3OB 4FKYA 1WOSA 4IWVA 4WZMA 2MYFA 3F9KA 1NGEA 4OI2A 4DTUA 3DLKA 2HBZB 1MA9B 1N6QB 4Z2XA 1CJVA 4NCBA 3D7EO 3V9ZA 4JI6F 3QEIA 4JYAK 5F3TA 1TK0A 2XI2A 3MAHA 1BWVA 1T9XA 4DR3J 1T02A 4WFBL 4K2JA 3D2WA 2HLTA 3CCSN 3F2KA 1RTIA 1MG7A 1I6JA 4KC5A 4DR1K 3OYBA 2ASDA 2M2BA 4DX6A 1B9DA 4IOBA 1ZS6A 2AZ1A 4J9SA 1U47A 5HO4A 4TKTA 1H2UX 3IMQJ 4AQYJ 4RUAA 2NQPA 4PKIA 3CM6A 4F4YA 2KTQA 2ZOGA 4NE9C 2ALZA 2UUBJ 2XMKA 4BRMA 2ZZTA 2GTDA 1Q79A 1ZPWX 1WOPA 2IIRA 5MLCQ 3OPKA 2W25A 3AD7C 1M5HA 5AQPA 3TPQA 2ZFHA 5KTQA 2HBLA 5M1OA 3AO5A 3L3VA 2VGNA 4A8MP 4LF4F 2JNJA 1WI8A 2XNQA 4KPYA 1VJQA 5KFDA 3UDEA 2MJNA 2H65B 4I4BA 3D6RA 2N4DA 5HQ8A 3OXLA 1UFWA 2DY1A 3Q22A 3PNIA 3M2UA 2CQCA 2HWTA 2WVEA 3T1YJ 4H0PA 3SPZA 3QRPA 3AA5X 4M1KA 5BPMA 1OVYA 5B0FA 2QC3A 3D5MA 3AVKA 2MEWA 1Y5LB 2HAIA 1S1UB 1XNQF 1U04A 2V67A 4CJEA 1Q8BA 3PRBA 3KLHA 4E1JA 2AYBA 2HF4A 2N7YA 4CIEA 1BUXA 3R5DA 1FKOA 1F0XA 2MY7A 3AVFA 1SJQA 1X8DA 5B0BA 3HSJA 4KPCA 4C8MA 1VQKN 4DR5F 1D8YA 2EG2A 1X5TA 3HPGA 4G1QB 4NXMJ 5LOQA 3KWGA 1S1VA 2APOA 5M1NA 1VGYA 2L9WA 2XYPB 2ZWPA 3ZYYX 4FPAA 4N56A 3VF0B 3EICA 1OY8A 3K5LA 1NPKA 4M63C 1VSEA 4CJQA 3LDQA 2N3LA 2O66A 3TTFA 1RDDA 4P10A 4WFBQ 2NXEA 3HM9A 3BQ1A 4LY7A 1QTNB 4DV6K 2G8FA 3LPTA 1F9EB 5KG5A 4E19A 4QWAA 2NZCA 4EUVA 2ZM6F 4KH6A 5GADP 3VF2A 4NLWA 1Q18A 1S99A 4EAHD 1Y0HA 4CHYA 4K0KF 1B70B 5IC6B 1YGYA 1WC1A 2V8PA 3OTEA 2XS7A 4KI6A 4U95A 2V50A 2ZE2A 2Q79A 3TAFA 2IPOB 2QFJA 4DUYJ 3MGJA 4CLKA 1ITGA 2XZTB 2P9KB 2AP6A 2GFFA 3C95A 4CEOA 5GINA 1FJGK 3VQBA 2FBVA 3PHEA 4A2AA 4JD2B 3RVCA 3OYMA 3CF5L 2C3OA 3HHEA 2CPHA 2BKPA 2M8DB 3Q8RB 1VQMN 1RBUA 2W7PA 2HSTA 3SSSA 2EXUA 5G0RA 5BN8A 5DGBA 2DTUA 2P9SA 4QIEA 4O0JA 2P9LA 2VFTA 2DISA 2IOCA 3LP2A 1VBXA 4DXLA 3T7ZA 4FLUA 2Z1GA 5E2QA 1CXUA 3EZUA 1FFWB 3O3GA 4DTSA 1BQMB 3PY8A 4ZP8A 4WCEL 2FHMA 5I42A 3TUPA 2Y0BB 2ZBIA 3OD2A 3THPA 4M41A 2OSRA 3I32A 1K9MO 4WKYA 2LU1A 3JSRA 2DNLA 3GR1A 5DLFA 1FKAF 1N5YB 2Y0SD 5F1XA 2HK2A 5KFLA 3I8BA 4X4SA 3ZX2A 4W92B 2B5JB 3ETOA 3AXMA 2HHVA 3UE5A 2QGFB 4X64F 1UJ4A 8AT1B 4LR8A 4R5PB 3TTDA 3KLEA 2ROEA 4FBTA 4ANDA 4JI3F 1LWCB 3K9JA 2WBMA 3HX9A 3SBGA 1SKSA 4MT1A 1CJKA 1YX2A 4OZ1A 5MLCV 4OYIA 3C19A 5D0GA 4MFBA 1VRTB 5C2CA 3EEQA 4B3OA 2FHOB 2G8KA 4PHTX 4I9QA 1SB6A 4OZ0A 2KVQE 3D3CJ 1HMVA 3MEDA 4UOFA 1FTRA 3MPWA 1P27B 4MIBA 2ZJRL 1DT9A 1VQ8N 2W2NP 2O01C 3CETA 4DHYA 3MX2A 3G6VA 2VQEF 1AROP 1GMVA 3DLHA 5KG7A 3D0GE 2KM8C 4H5NA 3J81j 2XMVA 3M8RA 1VQ9S 1SUQB 3OVNA 3ZT4A 3M6XA 4WTYA 3MPYA 3QIPA 2YX7A 4EFHA 1IVZA 3DOKA 4NRUA 4XDCA 2RQCA 2OEKA 2CG8A 3EXYA 4F4ZA 1M0SA 2EK1A 3CO0P 1VSLA 3MURP 3CF5Q 5KT5A 3A1YG 1G1XA 2QWMA 4CEZA 5D3GB 2X6SA 4ZHRB 4X4OA 2I1RA 4GV9A 2DNPA 3ULDA 1RWOB 2C3UA 1J5OB 3H40A 3R5GA 2OPPB 4RU9A 1DLOB 1HBOB 2V9WA 1HNWK 3LAKA 1DQAA 3OUYA 2KFYA 5LXRA 5KG3A 1XWLA 2J0SD 4YB1P 4CESA 1TL4A 2FJAB 4DN0A 4M5JA 1S7HA 3M05A 4M5NA 2ASLA 4IDHA 2NUBA 2YPZA 1K8KA 2HGMA 1X4FA 4CI6A 4OJRA 3LAMA 2V8GA 3H2VE 1DTQB 4WCEQ 1HFEL 3CYMA 3RB3A 2KXHA 2H51B 4UY85 1HL6A 4WQ5A 1JLFB 1KD1T 1FRMA 1FWKA 1OH7A 3QZ7A 4BC2A 3CCES 2E5IA 3A4TA 1REVB 1W97L 4UT4A 2YCHA 2VB6A 4CTAB 5E0OA 2RN2A 2G2ZA 1QQCA 2GJ2A 1NB2A 3SMSA 2DCUB 2FVSA 4QCLA 1B3TA 1I94F 4NLOA 2CJXB 2JX2A 1LWEB 5HBMB 2ZBCA 1X4DA 3MI7X 2YHYA 2Q3PA 3X3UA 3NH0A 1KAXA 4ZP7A 4DV7F 1JIHA 3BREA 1T11A 3AVCA 2MTLA 4IRKA 4CT9A 5AQQA 4HWIA 5M2PA 1OS5A 3BKUA 4H5TA 4EP4A 4K41A 1SL2A 3DAWA 3D2FA 2ZJRQ 2HF3A 3R6MA 2DHGA 2VUGA 1U25A 5F8IA 3M1FA 1RT3A 1T9UA 2A1RA 5A8KB 5LMNK 2QKBA 2WB4A 4DSEA 5B0EA 2FSKA 2PA8D 4J9VA 2L48A 2IMWP 1QVFM 2OSQA 2CFXA 4LH4A 1HA1A 1H74A 1NHKL 3D68A 4WU3A 3MM6A 3IR6B 3NNCA 2MDAA 1HNIA 3BF1A 1RTDB 2BDPA 2IVPA 2HS0A 4X4UA 5KFUA 2P5OA 3A5NC 2IMOA 4ZS6A 4CO3A 2ZBRA 2YKNB 2GVZA 3FGVA 1V5IB 2R8GA 4KTQA 3SQGA 4GMJB 2DNGA 4DOZA 3PFEA 4FYXB 1UETA 1FK9B 3CCUN 2UXBK 4FYDA 4J9NA 4NCGA 3LM2A 3PYEA 1FX2A 2DHAA 5LJ3Y 4NLXA 1YF5L 1C0UB 3VZHA 1KS2A 1I1GA 1HQUB 5AJ3F 2V2ZA 3KKSA 3O3HA 1MU2B 3GJQB 5A76A 1ZZNA 3P3DA 1NHUA 1YKWA 5FPDA 5KG4A 1L3SA 1KQSM 4IQXA 1RHUB 4C1NI 2CQGA 4BR5A 4FVMA 2OO4A 5JMNA 2Q66A 4DV4F 2RKIB 3CJKB 4Y65A 3V6JA 5DG8A 3RSEA 2GIFA 3TRGA 2VPYB 3LZJA 5BR8J 1RT5A 2CJYB 4KJIA 1RTJA 2IVYA 4ZP9A 4BC3A 4K2XA 3ZT0A 4OZLA 4JI0J 4L72B 3OYAA 4W5NA 3TA2A 3FQLA 3OHAA 1HBUB 3UDVA 4C8ZA 4LF8K 3IAYA 1UA0A 5ETNA 2MGZB 1T8EA 4K4XA 1RAIB 2QM1A 1YTUA 4OYMA 4JI8F 5HSPA 3H3NO 2RU9A 3PFOA 3SSRA 2JZ5A 3DRYA 3KLIB 2CVIA 2IRXA 2W8KA 5KFNA 3LALA 3M6GA 2GUPA 4EBEA 4LRDA 2HG4A 5C2GA 2UUCK 5C24A 4CIOA 1ZETA 4DX5A 4X62K 4PG8A 3L4IA 1HBNA 3CE8A 5T41A 1T94A 4KHNA 4HT7A 1QVGM 1SIWB 3C46A 5T14A 2BUPA 3TWZA 1QSSA 3HHLC 4A57A 5DDRC 3MR3A 2OUGA 3H98A 3WC0A 2BJ7A 1WG4A 2GJIA 2GQCA 1WDTA 4M3WA 5DLGA 3O5TB 3NS6A 3LH2S 4KR0B 1NK8A 4UY8T 4DS5A 4M3ZA 3ZNJ1 4FJ7A 1GQEA 2W2QP 2FSNA 4HT5A 1Y00A 2OPRA 3ALYA 2VJVA 3FGUA 4CJ4A 1OPIA 4DQRA 4QYZK 2Q1NA 2UXDF 1G6BA 1ZBSA 2QK9A 1Q78A 3P1GA 4H5WA 3T1AA 2WFBA 5KPTA 4WFZA 1L3TA 3FDSA 5HROB 3D1QA 4J9KA 3R9PA 2VF3A 2LEPA 2KQ2A 2KXNB 4CHZA 3GYXB 4OGCA 1MSWD 1VQ9N 1N36K 2H4WB 3N6MA 5HK4A 2G0JA 1XK8A 2RSQA 2NZ4A 3AT1B 1T44A 1FW6A 2QYCA 3NEKA 3SI6A 4RLEA 5CCLA 4P2MA 1BG3A 2B9YA 3QICA 4PXCA 2OTLS 2F9JA 4BVOA 1H0HB 1RUSA 2KDOA 2DD8S 1NSAA 2XYHB 4M5DA 3L09A 4IFVB 5F9NA 3RB4A 4JKFA 2VA3A 2MKYA 1X9WA 5CCMA 4HI1A 2CJAA 4MKVA 2AA4A 1GLDG 2LDYA 2N7CA 4A8OA 4KSEB 1Q5VA 4F67A 2BJ8A 3C3LA 4E3SA 2PEHA 1TK5A 4BC9A 3UKUB 4BQZA 2WRMA 3L3CA 1RU2A 2XHWA 3TU5A 1WF1A 3JSMA 1JCEA 2UU9F 5BYQA 3AGKA 5E3CA 4NA3A 3ELHA 3K5OA 4KHMA 4USUA 1YJRA 1PJ6A 3DLEA 3G96A 5LY3A 3VQEA 4K4YA 2RRAA 4ICLB 6AT1B 1S5JA 3MFIA 3QBXA 3CCEN 4FOEA 2K3KA 3E9PA 2QA1A 1EHWA 4A47A 4PYDA 2EG1A 3RB6A 2A6AA 2EHGA 1S3XA 1RYSA 3D54A 3T41A 4U7BA 2H5EA 2OD6A 3FC9A 1S6OA 4CF1A 4O3QA 3CJBA 2HHQA 4BVPA 3OL9A 4B9UA 2C22A 2Z4PA 4XH1A 3P5BP 3ZO7A 1K73O 3D2EB 4IDKA 3NAIA 1RDUA 4PPDA 2EC0A 2AEJA 3L7OA 2FLLA 2RS2A 4ZPDA 4ECQA 5DZ6A 1AXQA 1WF2A 3DC2A 4JI7K 1KVJA 4ZJQA 2DGTA 1RDRA 3BDPA 4AHVA 4OO1J 3JTOA 2KT2A 2XQCA 4DFMA 1MDUB 3CI5A 4LF9F 4GVEA 1SC1B 3DLGA 2MZJA 5GAHP 4DR6F 4OI0A 2IHR1 4CW7B 1SKWA 1HR0K 1HNXK 2B51A 5LL6Z 1MN9A 4ZMMA 1G15A 3UIQA 4BR4A 4DZ6A 4HH1A 4OMFG 5A2QO 3CIZA 2Y1RI 4YOYA 1ATRA 3MX5A 2F9WA 2V8VA 1C4CA 2AJ1A 1Q0NA 2GQ2A 2UXCF 4DTNA 2FBTA 1V5VA 5HLFB 1XMQK 1S1TB 2G8IA 4QR2A 3IRXA 2X74A 2LA4A 1YIJN 2M9KA 3LDPA 4CP5A 2G2YA 1S1WB 2VPZB 4B3MJ 3SQ4A 3OTBA 3AVIA 2HFSA 4NLBA 4BRKA 4ECZA 2DR8A 3AVBA 1OJ4A 2KT3A 2LECA 4M5LA 3CFRA 3LP1A 3NGRA 4PABA 1OKJA 2ERRA 1OH5A 3QJPA 4YHHF 1IJFB 5DM6L 4NLCA 3WXJA 3OYKA 3CC7S 3O4WA 1WWHA 4P6QA 1SI9A 3GYGA 4NLRA 3R8EA 1K8AO 1R0AB 3VAGA 4DV3F 2I8EA 2QG9B 4ALZA 1C1CA 4FWLA 1VBKA 4BGBA 2DIVA 4HHHA 1ZAXA 1HNZF 5IWAJ 1DQ8A 4NMLA 1UTAA 4O8UA 4DTJA 2DNZA 2CXEA 4EBDA 1M5VC 4FDFA 5AQXA 2BE2B 4DV5K 2GIRA 1FDAA 2KHCA 1LAVA 2IAJA 2PI4A 3B6PA 1S72S 2RHKA 2O4IA 2CPDA 3UI3A 2PYJA 4YOXA 5K8MA 1FVQA 1QE1A 1S77D 4HUFA 1E6VA 4ZOSA 2QTWA 3CFPA 2E1MC 1F2GA 3TTCA 4AUKA 5DO2A 5J2QB 5GADU 2VH7A 2RNEA 2JSXA 5H9EK 4AHSA 4KB7A 2G8UA 4DUZK 3MR7A 3DRSA 5KFBA 4FK0A 1TZ0A 4NCAA 3F0NA 2AJQA 4BRPA 3IXQA 2VKRA 4OYZA 3N6LA 3WDOA 4BDYA 4WYWA 3UN5A 4NYFA 3WXKA 5ETKA 2OPSA 4JLHA 3PM9A 2YJEA 3UKRA 4M3TA 4Y2KA 3J80Y 4PG4A 1YZ7A 3KG1A 2NLWA 2G4BA 2ZC3A 3K5MA 1HYVA 4ZLLA 4ZVSB 4UQTA 3RZAA 4DR2F 3OYGA 1RBAA 5A6PA 3KK3A 2YX4A 1C0FA 2MQPA 4I7FA 2DK2A 3VQPA 5LJVA 2CNKB 4WJBA 3RGIA 1V3SA 2LEAA 5IOLA 4HHTA 1CJVB 4KH0B 3FMBA 4X66J 1B0TA 3SEOA 4CJVA 2POKA 3BGRB 4ZJLA 4DV2K 1JNZB 2QI2A 2OFGX 3ZTQA 3MXIA 3O9RA 3IGNA 2W40A 2EFPA 2FUG9 4C3LA 2JFDA 5H9FK 3MAAB 3MR5A 1RTIB 1C0MA 4CF0A 1CZ9A 3O4NA 5B0DA 3I9ZA 2GS8A 4Y0FA 2FQQB 3BO3A 1PILA 3H46O 2J4RA 2QWPA 3TZZA 2AGPA 4DX8H 2RHQB 2YKPA 1R3NA 3DRXA 2OTLN 1PKUA 2EFVA 3D6MB 3A0IX 2LQ8A 5IV3A 3N4PA 4Z4FA 2O8CB 2D0CA 2E7WA 4NOHA 2ATQA 2RQMA 4KAIA 1XQIA 5A0YA 2BQ3A 2JDJA 4TYAA 1LNQA 4ZVUB 1BL3A 3DM2A 1UEVA 1N33J 1EP4A 2R7QA 3H5XA 2ZZMA 4ER8A 4DR4J 3HSTB 3L7UA 2VCPA 1RDAA 3QGGA 1BWEA 3G10A 4DPXA 4CYUB 2DRAA 3HJVA 1S10A 3RMCA 1LOTB 2E5LJ 1XI1A 3M2UB 5C0YA 1KQFB 4Z4EA 5AQHA 2ZWOA 4FPBA 2QL7B 1W7WA 2ZUAA 4CGIA 2GUIA 5EWGA 2X1FA 1H3DA 4F2RA 4O4GA 3THYA 4L3KA 4PL8A 3MCAB 2RDJA 2EVZA 5AT1B 3AO4A 3CJTA 4B1ZA 1F2HA 3Q8QB 4JI1K 3NF6A 3KLHB 1B7FA 4C97A 4HI2A 2XNRA 3R3TA 4DFPA 5DDQC 3ZZUA 4Z4GA 1FO1A 1VQON 2NUUG 1XNRF 4QOTA 3D1OA 1EETB 3BBBA 4IJAA 3IM9A 4B9MA 5J1EA 5C42B 1MWYA 4LF6K 4J37A 1P9QC 4LIRA 2M7SA 2DXEA 1S1VB 3GB0A 3R7NB 1DY3A 4ED7A 4TQRA 3JYTA 4ENOA 4CZGA 2VQFF 2X6NA 3PEJA 2ZEJA 1JLCA 3FBFA 1O0PA 4ED4A 4UOCA 2Q3SA 1IKXB 1T3NA 4BQLA 1U02A 2CWXA 2CQBA 2X1GA 4OI4A 4J90A 5HVHA 2DNNA 2ETJA 1OQ6A 2CYYA 3R7SB 4JKCA 8ATCB 4E7IA 1U1MA 1FXDA 3FMWA 1BQXA 2RU3A 2HQIA 3V6DA 1GXTA 2X3GA 4DS4A 3O9UA 3R2CJ 3DU5A 3GG1A 3AAQA 1FRJA 4E98A 4JRPA 3DGVA 3O5BA 1FXXA 1VQPS 1EB0A 2ZE2B 2R8IA 3M2RA 3M30B 5KT4A 1AZSA 1M5SA 3TNVA 2BE7D 1BQNA 9RUBA 1Q4RA 3NXZA 3ZTOA 3AV9A 1M1KT 1EX4A 4JAXA 4YP3A 3KK2A 3U6FA 3CC7N 3E8OA 5G0RB 3EX7B 3VGUA 2WBNA 2P9LB 2UUAK 3AVNA 5FRMA 3VGVA 1XMOK 4ES3A 3LP2B 1DTTA 2YH0A 3CPWR 2F8EX 1XIQA 4CIGA 3LDLA 1SH2A 2HIYA 2NCKL 2IVMA 2N82B 4WE1A 4AFFA 3HVWA 2JL9A 4CZHA 4B02A 5I42B 3RBDA 4HTLA 1XNQK 4FWNA 1S72N 4C3KA 4A8XA 1RTZA 2CPZA 2DIUA 3SDEA 3TZWA 4ED6A 1QQMA 2DHXA 2HNZA 4PXBA 4ZLPA 3R3LA 3D0IE 3VVTA 4FWOA 4AL7A 4DR3F 2HMIA 4Z4IA 1RCXB 4CERA 2QO3A 1EWQA 1CS4A 2Q43A 3KLEB 4GO5X 4DCPB 2MZ1A 4CJSA 4OPHA 5KGXA 3SCJE 3EYZA 5C5JA 2BEFA 1CJKB 2LSNA 1IBCB 4MFBB 2WSCC 2VHGA 2PY5A 4X4PA 4HR2A 4Z7YA 3D6FB 1APSA 2A1SA 4B3OB 4NO7A 4OIXA 1Z25A 2V4JA 3FZMA 4K4ZA 1C0TB 2RIJA 1KD1O 3CJCA 4OZJA 2UUBF 4JV1A 1JXVA 4BG8A 5BREA 1QY7A 1RLDA 3WX8A 1YVUA 4K0KK 3HD1A 1ZBLA 2UV8A 3W5ZA 2FJVA 4G9ZA 1HBMA 2ZQBA 4DFKA 2R7SA 4RWWA 3AOCA 3O8WA 4DB3A 4OPJA 3KJQB 3HPOA 3MOZA 1TTHB 3JTPA 1HUXA 1EKEA 3SQ0A 1OYDA 4OX9K 3EVOA 4ZVGA 3SUQA 3WQTA 2KJWA 4QR0A 1HIYA 1CEZA 3AVGA 2QWNA 2EBEA 1N88A 3T1HF 3T1YF 3AO3A 2ZBPA 3G8SA 4YY3F 1UOCA 1KTQA 1NEEA 5D4PA 2GO8A 3A8EA 3OUYB 5AQRA 3OTOJ 5HL7L 3RMBA 2DY4A 1GLBG 2DNHA 3CMQA 3WX4A 4UTGA 3OW2R 4CZKA 3M8SA 1V9OA 4WK3A 2ZH1A 2XCAA 1K8KB 2V7ZA 1WG5A 2YHAA 4YOVA 5KG0A 3JQKA 4ZK7M 2YH1A 3VWSA 4ZTFA 4PAAA 1GOBA 3CEDA 4RW6A 1C6VA 4V19S 1FXLA 2H4YB 1JJ2R 2VPWB 1NAQA 2HBJA 2VA2A 4HKQA 5D0HA 5EVZA 2Q31A 2JC0A 3DLLL 5J1PA 2QEXS 3OTCA 2DXFA 1TKTA 2W9CA 1RA7A 1KLNA 2B4VA 1HPZA 3T9NA 4GVBA 3LO3A 3E1YA 5LSOA 3M8YA 1BY9A 3UB5A 2A1BA 3SAGA 4NZ6A 2CG4A 1IBLJ 2IM1A 4Y28C 2NNWA 4CGFA 3FKBA 5HMZA 1F5AA 1FTCA 5KFIA 4X64K 3I0RA 3AVLA 4DTRA 5CYQA 1PO6A 1VQSA 3F5TA 2VBYA 4JP8A 1JX4A 2BTFA 4PQAA 3GLJA 1BI4A 1OO0B 4RBUA 4JV5J 3M9NB 3AVMA 2HQDA 2KW4A 2MQMA 4MYTA 4IG0A 3EGNA 1YTYA 3GSIA 2KLAA 4DV1K 3POTB 3D2FB 2E6LA 2AU0A 4DPTA 3L2WA 1H72C 4FKXA 1RT3B 2E7XA 2VU5A 4NLUA 4DUYF 2FLPA 4C98A 4FF3A 3OQ2A 2VQEK 4WFNL 5B0GA 3DMJA 1AT1B 3ZSOA 1PC4A 2F8HA 1VQ6S 1U1KA 3JS6A 3T3FA 4CLFA 1IN0A 4JBCA 1JLEA 1GNKA 3KUHA 3UQSA 4J9RA 2AJ4A 2F9DA 3H42A 1NSKL 2WB1D 2JEGA 2BJDA 3Q8VA 4OYAA 1N34J 2GVZB 4ZPTR 4H5RA 3SQGB 1XTZA 1CXQA 2OYQA 3O9QA 2JGUA 2DGWA 2E8AA 5ELZA 4N41A 5F0UA 5HL7Q 4LH5A 3TVZA 4BS2A 2P9NA 2EFNA 1RDWX 2WSEC 4H03B 5IS2A 2AP1A 2B4OA 1OH8A 2XSJA 3THVA 1IH7A 3W2WA 3QSYB 1VQPN 3G82A 1RCOB 1DAXA 2JWNA 2L9NA 2RDDA 3IDHA 1YI2S 4KHWA 1MWMA 2EWSA 2PBDA 3ITHB 2VC0A 1H73A 4BR9A 1VQ5S 3RSEB 2Y1JA 3FEXB 1SJ3P 3DLLQ 4UY8O 4GV6A 4H54A 1RWKB 1RTJB 3TUZC 3X1LB 4QU6A 3LDOA 3HCXA 4DPUA 2D3ZA 3DLBA 3CQYA 5GAHU 4A61A 2FF6A 2R9LA 1WC5A 3OJSA 1A5WA 3D67A 5JICA 2AIRB 1EJ7L 3MM8A 1ATSA 5BYSA 2EWHA 4DV7K 2Z1JA 1K47A 3D0PA 1E4FT 3ZSQA 1UAXA 4DV6F 3CXCR 3MN9A 2RVJA 3LA0A 3GONA 5I3PA 2KO1A 4DL5A 1CC8A 5C24B 3M5RA 1S49A 2W9AA 1DRZA 4QPXA 4OHVA 5GAGP 1O5JA 3B54A 2DNQA 3H90A 4IO1A 4WFNQ 1QZ6A 4ZPCA 2PIIA 2V6AA 3MCPA 3NF7A 2RILA 1FDDA 3LANA 2G9OA 2YQ0A 4XH5A 3HHDA 3L95X 4M8LA 5AE1A 3ATUA 3IMXA 3GMGA 4PXDA 3K9KA 2BR0A 3BJYA 1TVRA 3AVJA 2DFHA 4RUBA 1X4EA 4OPKA 2WUSA 2VODA 2IBKA 1IKYB 1NPRA 2OPRB 4CEQA 2IC3B 4OHXA 3NAHA 2HWIA 2KVIA 2EFOA 2P9EA 3VQ9A 2MLZA 4DL2A 1NGDA 4UZCA 1JL2A 1K44A 2DYAA 4IRDA 5MAOA 2OP5A 3AB2B 2CPYA 1WDDA 3T9ZA 4ZVTB 1RB0A 1W9HA 1FRIA 4CH1A 3QT5A 2XO6A 4LFAJ 3OLAA 1SH3A 4C11A 3AHPA 2CDRB 2C2NA 5KT6A 4B3TJ 3GOIA 3M4XA 3BS9A 5AJ3K 2ZD1A 1NLVA 3Q89A 4JI4K 4E0DA 3KTQA 3W60A 3HHLD 4IFEA 4M5DB 3KLFA 1VC0A 2VWBA 3OYDA 4I69A 4DV4K 3H59A 2Y8WA 1HJOA 1UEKA 3CJRA 2H3EB 4BWMA 3P49B 1M1HA 1IBMJ 2WOMB 2CIMA 3KIOA 1VCTA 4JV0A 4RBTA 5AXNA 3OT9A 2WBRA 1TQLA 3KDOA 1MROA 1KRPA 5F9LA 2MKJA 2CQDA 2VDIA 2J7KA 3P4UB 3LGMA 4ZPBA 1Q86T 1T95A 1GMUA 1FHTA 3MFHA 2R2UA 5AE3A 3KUEA 3DLEB 4PL7A 3H5YA 2Y3YA 4ZPWR 4JI8K 3DNCA 4UOHA 2PE8A 4MIWA 4ZVHA 2M8HA 4U9RA 3Q8SB 5A8RA 4LF8J