1TKXA

Crystal structure of hiv-1 reverse transcriptase in complex with gw490745
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
537
structure length
534
Chain Sequence
SPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Design of non-nucleoside inhibitors of HIV-1 reverse transcriptase with improved drug resistance properties. 2.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords Pol polyprotein, Reverse transcriptase, Chain A
total genus 145
structure length 534
sequence length 537
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1tkxA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tkxA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tkxA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tkxA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1tkxA05
1KTQA 2FJVA 3BQ0A 4B8AB 2JEIA 1S1VB 4NYNA 3OYFA 3HVAA 3OL9A 2ZD1A 3SI6A 2R7YA 4KAZA 5KG1A 3D45A 3AA2A 3RWUA 1S0MA 3OYIA 3QEVA 3NFAA 4DWIA 1T05B 1TGOA 4DU4A 2BRLA 3BSOA 2WK4A 1FK9A 3DLEB 4DFJA 1X9MA 1XR7A 3VQEA 4EYHB 3RMDA 3KMSA 5F8HA 3BQ1A 4ED8A 1ASUA 1RT6A 3MXMA 1VRTA 4E7IA 3QZ8A 5EDWA 2DFHA 3D5MA 4CEOA 4CHYA 3K5OA 1LW2B 4BACA 4F4ZA 4RW9B 2DFFA 5CZ2A 3RMAA 2E9TA 1MU2A 5HROA 1VSIA 4FM2A 3AVHA 3AA5X 3SV4A 3KKSA 2YNFA 2WONB 1LWCA 3I5BA 4IR9A 4W5OA 1N5YB 3OL7A 3LP3A 2ILZA 2G8KA 4FK0A 1DTTB 3NGDA 2Z1HA 2XRIA 4CF1A 3DLHA 4MK8A 4OPKA 4FLYA 1JLFB 3GYNA 4YMEA 5HP1B 3RTVA 2XCPA 3CDUA 2QKKA 2UVUA 2HAIA 4F3TA 2W7OA 2B5JA 2ILYA 5F8JA 1C1BA 2P51A 4OKEA 4DS4A 2C28A 4B3OB 3QEWA 2RKIA 3FSIA 2ZE2A 4LQ3A 4FXDA 3NH0A 4I7FA 2D7SA 1HQUA 5KFDA 1ZBUA 3D0PA 1KVCA 4M41A 3PW7A 3LWLA 3KD5E 3RB4A 1JLBA 3LALA 4CGFA 4NLUA 2V4QA 1LAWA 2VA3A 1GOCA 3T5LA 5I42B 4FZYA 4NYFA 1JXEA 4Y1DA 4XO0A 4NLVA 3TAPA 4MIAA 5KRSA 5CYQA 4RU9A 2O4IA 4QWBA 4CIEA 2IC3A 1JLEA 2W8KA 4ELUA 3CDWA 4CJTA 1D8YA 3HL8A 4IFVA 3K5NA 3VQ7A 1RA6A 1RT3A 4R0EA 4ID5B 5FDLB 3TAEA 1TKTB 1S9EA 1L3UA 4ECZA 1S1WA 3I0RB 3SQ2A 4RUAA 5KGWA 2W8LA 1FKPB 3KIOA 2IJFA 3BSAA 4NLPA 4DL7A 4FM0A 5L1LA 3TAMA 4KKOB 1HYSA 3VQ8A 3OYKA 4WXOA 5DG9A 4TY9A 1NKCA 4CECA 3OSPA 1W9HA 2LSNA 3OS2A 2IM2A 4KV8A 4DSJA 3CQ8A 1RDBA 1T7PA 4CEBA 2ZQBA 5I42A 1ASWA 3LP1A 1QSLA 5EUHA 1NKBA 4HUEA 4FLWA 4H4OA 4EYIB 1RBTA 1KRPA 4I7FB 4KHQA 3H08A 3VQ5A 3NAIA 5J2NA 5KFHA 1RTJB 4DQRA 4LD0A 1Q8IA 4B9NA 1VRUA 2BDPA 1GOBA 4TQSA 1D0EA 4ECTA 3CJ5A 4ED1A 3HVTA 3AVJA 4ZHRB 2B5JB 4MIBA 2FVSA 2E9RX 1WSHA 2HNYB 4RNOA 3I0RA 4DFMA 4DTNA 4IRDA 4AHVA 3L2WA 1BQMB 4CJWA 4N56A 4WE1B 3VQCA 1SKRA 4NLYA 4JV1A 5KFLA 2O4GA 4ED2A 1SL2A 3CO9A 4PWDA 1HQEA 4F4XA 1S9GA 2RDIA 1HNVA 5KRTA 1SH2A 1IKYB 2OA8A 1XHXA 2E4LA 3C6TB 4WFXA 2GBZA 2D41A 3O3HA 1LWCB 1RTIA 1EKEA 4CEFA 1B9FA 5HRSA 4ZVHA 3RBEA 1UA1A 1HYSB 2Y1JA 4IG0A 1S1XA 3BQ2A 5DLGA 3MAQA 4HUGA 4C8OA 2G8HA 1TAQA 4ZPBA 4IRCA 4M94A 3DRSB 4Q0BA 4RW7B 4WFYA 4O4GA 1SL0A 3QESA 3MXJA 3AO3A 3CM5A 3KLFB 2OPQA 2QK9A 4Z4GA 1NK9A 1KFSA 3KHLA 2VG5B 2ATLA 3OYBA 3MEEB 4KFBB 4JRQA 2CJQA 3AO2A 3DLEA 3TARA 3DM2B 4ZMMA 1TKZB 4KI6A 4DSLA 1RTIB 3KLEA 3C6TA 1JLCA 1WSEA 3DLKB 3ZSYA 1YT3A 1MMLA 3V4IB 4QW8A 3K5MA 1JX4A 3QNNA 2YNHA 3DMJB 1WNEA 3Q8RB 5KG0A 3T5HA 3FQLA 3AVMA 4PUOA 2W7PA 4FK4A 4WXWA 1KVAA 1IKWB 2EX3A 3KKRA 4CCHA 3V6HA 1SV5A 2OPPA 4I2QB 1R0AA 4OKJA 3NF9A 3MR3A 1NK8A 4B9MA 4XPEA 3QERA 4JLHA 4LSNA 1O1WA 1TL1A 4W5TA 4BE0A 4OLBA 3K2PA 1NK0A 3DOLA 3HKWA 1HRHA 3IG1B 4B9VA 3CFOA 4J9NA 5HRNA 4R8UB 2IM3A 3NH2A 3ZT3A 3NDKA 1JLGA 5KFOA 3O4QA 4KI4A 1NJYA 2KFZA 2V0NA 3HPGA 1S1UA 2IA6A 3TAFA 1XC9A 3WNFA 4DMNA 2OPRA 1DTQA 2IAJA 5KFWA 3PO4A 5KFXA 4FM1A 4KO0A 4QOZB 1RBRA 3LWMA 1S97A 3T3FA 4LY7A 3FFIB 3DRRA 1NJZA 1HNIB 4DSFA 3PVXA 5E41A 4Z4CA 1EP4B 3ULDA 3LANA 4IOBA 3LPUA 4O3OA 4ZP6A 3MECB 1X1PA 3KLFA 3OYNA 3LP2B 3ZSQA 3NKYA 3QINA 4KB7A 2WTFA 2FLPA 3DM2A 1XHZA 5KFFA 5I3UA 2E9ZA 1TKXA 2R8KA 3PW0A 4J9OA 3GV8B 2C2EA 5KFKA 1F21A 2QE5A 4CHPA 3UPFA 4FK2A 5J1EB 5L1IA 4M3YA 3M8QB 2PYLA 4TSXA 2HNDA 3QEPA 3VQ4A 4CHQA 4CE9A 2FVQA 4L8RB 4OKKA 1VSLA 4IFYA 3OYGA 2AQ4A 1S1TA 4CJLA 1J5OB 1FXXA 1XWLA 3KK2A 2UVRA 3QEIA 2YKNB 4DQIA 3TABA 1IG9A 4JS5A 2AU0A 2PYJA 5JS2A 1U47A 3BSCA 3ASMA 1BCOA 3CWJA 4TYAA 4E7KA 1JXLA 1N5YA 1TP7A 4E7HA 1UWBB 3BDPA 3MEDA 3RAQA 3O3GA 4WFZA 5HRRA 3WNGA 3RRHA 4KHNA 5KFTA 3VA0A 2YNIA 4QPXA 3SQ1A 3SZ2A 4FJKA 3JYTB 4KHWA 1RDRA 4BDZA 1RA7A 4HCBA 2HNYA 3OY9A 4B9SA 3H5SA 4J9PA 4TN2A 5J2QB 1KHVA 2JEJA 3SFGA 3HVWA 4BE2A 4ZVEA 2EHGA 3S3MA 2YNHB 3DMJA 1ZTTA 1JLCB 3AA4A 1VSKA 4FCYA 1LAVA 4FVMA 4XPCA 3PW5A 4H4MB 4EBDA 4F2SA 4OLAA 4KV8B 2HHSA 4BDYA 2UUWA 4IKFA 5EWFA 3OYHA 4O3RA 2WB4A 1WAJA 1UOCA 1SUQA 1UAXA 3KJVA 3D28A 4ECSA 4OJRA 5HRPA 3M8PB 3M8SA 4ED6A 4GVMA 3PZPA 1SL1A 4ECXA 2IOCA 4E1NA 4HVJA 4AHRA 2O5DA 3PUFA 1QSSA 3LZIA 3AV9A 1S6PB 4QAGA 4LH5A 3BJYA 1S10A 3OS0A 3OS1A 3NF6A 4Z4FA 3LP2A 2XY6A 1JIHA 3JYTA 1RT7A 1K1SA 4AILC 2RF2A 3V1QA 2HMIA 3QO9B 4DTUA 3T5KA 1EP4A 3T19A 4MFBA 3QGGA 1QSYA 2FLLA 1DTTA 4DL4A 3BREA 4CGDA 3EYZA 3GIIA 1HNVB 1D5AA 5KFRA 2AGOA 4CJ5A 3RMCA 5DGAA 4NCGB 4F2RA 1U45A 1YTUA 1HARA 2JLEA 1LWEB 1HNIA 5F8MA 3CVKA 5HBMA 5KG6A 3KMQA 1KHWA 3MF5A 1OS5A 4KAIA 2C2DA 5KG5A 3V81A 1VSFA 2HNDB 4QW9A 3UDLA 2FBTA 4CIGA 2YNIB 5KFZA 1K1QA 4DTMA 5J2PA 1YVFA 1GOAA 2HHUA 4NLXA 2G8WA 1TL3B 1RBSA 4BDPA 4ECWA 1XR5A 2Z1GA 3N6NA 4EBEA 4G3IA 3ICLA 1BIZA 3CJ4A 1HYZA 3MR6A 1IKVB 1NOZA 2R2SA 4I9LA 4EO8A 1B9DA 2W9CB 2AGPA 3HM9A 3U6FA 3AO4A 1ITGA 1S5JA 1VSHA 4CJKA 3N6MA 4DG1B 5KT6A 4GC7A 4CF0A 3AA3A 4KHRA 4FJIA 4ECQA 1LW0A 4KB1A 2WONA 4KHUA 3HPHA 3C6UB 3IRXA 3FFIA 2ASJA 2R2UA 3H40A 2YHBA 4RW6B 1KSPA 2BANA 1RNHA 3BGRA 1WSIA 4Z4EA 1TKTA 3IS9A 3NBPB 2ASLA 3ITHB 3DLRA 1C0UB 4K4SA 2FJXA 3KJVB 4Z4HA 2BE2B 1L3TA 1RAJA 3IN5A 3OHAA 2GUIA 4CGHA 4IBNA 1NJWA 2VG7B 2IMWP 2KQ2A 3SQ0A 3S3NA 2VG5A 1C2PA 3SFUA 4FJHA 4ID1A 2X6SA 4GC6A 2HWHA 4DTSA 1HQUB 3JSMB 4NLTA 3KHHA 2D0BA 3ALYA 4J2DA 2RKIB 5D3GA 2D0AA 3NGYA 2R8JA 4G1QA 3OYLA 2HHXA 1W0HA 2VG6A 1HYVA 1REVA 1KLMB 3G6VA 1JKHA 4YNQA 2QKBA 3PHEA 5C25A 2UUTA 2G8UA 1S49A 3AVGA 3KLGB 3Q8PB 1IKWA 4ZTJA 4IRKA 3HPOA 3HK2A 3LP0A 4KREA 1IKYA 4ZP9A 5DGBA 4MFBB 5DQIA 1CXUA 4RZRA 4JRPA 4B9LA 4Y2AA 3I5AA 1BQNB 1N56A 2ALZA 2A1RA 2P1JA 4FS1A 1JL1A 2JC0A 4PA1A 3Q8QB 3CYMA 4RW4A 1S0NA 3AVBA 1RT4A 2VA2A 4IH6A 2RDJA 2VG6B 2D5RA 3MTKA 3GILA 2PZSA 1T3NA 4RW8A 1N6QA 4F8RA 2OPQB 3S3OA 1SKWA 4YR2A 3EY1A 1CLQA 1MU2B 5HROB 4ZHRA 4UQGA 3F73A 3MEGB 4FW2A 3H98A 4NLQA 2FLNA 4ED3A 1Z4UA 5D3GB 2F8EX 4CFAA 4K4TA 4K8XA 3C95A 3DLGB 1GX5A 5KFIA 3M9OB 2WRMA 3M9MB 5KG7A 5DQGA 3KHGA 3AVIA 5JXSA 4Z0UA 3CM6A 4NZ0A 4KFBA 4KTQA 5KT5A 3AVCA 2BE2A 3OYMA 5J2MB 3L2VA 2BQ3A 1JL2A 3OYEA 1QTMA 3ZSWA 1L5UA 4Q44A 4URQU 3DOKB 1S4FA 3KLIB 1EXQA 5KFPA 1A5XA 1ZBLA 1BQMA 1S1WB 5KFMA 3HYFA 4DTRA 4KPYA 4ZP7A 4U6PA 1Q9XA 2W42A 2P5GA 2XI3A 3HO1A 1X9SA 4DQPA 4ECVA 3O3FA 2ETJA 3N6LA 4DG1A 4J9SA 4TYBA 1KFDA 4F50A 1C6VA 1LW0B 1D9DA 2YKMA 4MK9A 2AX1A 1G15A 1S9GB 4K4WA 5L9XA 3LAKA 3ZCMA 4KE5A 2BQUA 3QNOA 3SPYA 4GMJB 4H4OB 4M3RA 3HXMA 2IDOA 3QIPB 4ZP8A 3VQQA 1S1TB 2R8IA 3KLHA 1BQNA 4YP3A 4IQXA 3VQAA 1TL3A 4YR0A 3QEXA 3KOAA 4CJ3A 1TV6B 2OZSA 3OJUA 4LSLA 1KLNA 4NYZA 3CJ2A 3P1GA 4Q8EA 4FS2A 3HSTB 4W5RA 2AX0A 4E3SA 3HVTB 3MXIA 4G1QB 2DFEA 2C22A 1Z25A 2OPPB 3ZSZA 4NCGA 3L2UA 3BSNA 2BQRA 3F9KA 5L1JA 4KTZA 2XCAA 1QE1B 2HVHA 4EBCA 4FJ9A 1ZBFA 3DYAA 3V9WA 3V9XA 3H5YA 3V4IA 4K8ZA 5I3UB 3DOLB 3A2FA 3NE6A 2WHOA 4WZQA 4LSNB 2IC3B 2GIQA 4OGEA 4CK1A 3ZSVA 2VWJA 4Y1CA 3SNNA 4ZPDA 4CGGA 3H5UA 3MECA 3SPZA 2V4RA 2VG7A 4IDKB 2HNZA 3DRPB 3SYZA 2YKMB 1BGXT 1S48A 4CEQA 2W9BA 1C0UA 2HHWA 2BGGA 2JEFA 3CFRA 3KK3A 4NLRA 4CGJA 2X6NA 4HCCA 1S1UB 1XR6A 3M8PA 1VK0A 4JUZA 2I5JB 2OYQA 4IG0B 3H4DA 5KFAA 1JLEB 3H2LA 4O3QA 1BI4A 2DPJA 4M3WA 4F4KA 4W5QA 4Q45A 3ISND 3L8BA 4N76A 1VRTB 3E51A 5F8GA 5C24B 5J2MA 1WSJA 4B9TA 4CFCA 3RMBA 4O55A 1HQEB 2X74A 3OVNA 2AWZA 5C42A 3WNHA 4DL5A 3AVAA 5CYMB 4O4RA 2R2TA 5K14A 2W9BB 3WNEA 2HWIA 3CDEA 4C8KA 5J2QA 3VQ9A 4O0JA 2IM1A 5JS1A 3ISNC 2DPIA 3RB6A 2YNGA 2JGUA 3DLKA 3PY8A 2UVVA 1NJXA 4FJJA 1X9WA 3KLVA 1QAJA 4J9QA 5KFEA 5DLFA 4J9KA 4C8NA 4NLOA 5KFVA 1TQLA 4J2EA 2OZMA 4CJ4A 1TVRA 4KHMA 3V9ZA 3TVKA 3TAQA 4K4ZA 4ZVGA 3KLGA 4AHTA 5HLFB 2XY7A 3L3UA 4ED7A 5KGXA 4QWDA 3CJ3A 4F3OA 1RT2B 1RDAA 2XI2A 3M8QA 4YR3A 4DTPA 3RR8A 3V81B 3HVRA 2XHBA 3RB3A 2ASDA 4RUCA 5KFUA 3KLHB 3OYCA 4RNHA 5J1EA 4DSKA 1HMVB 2HVIA 4NRTA 3PW4A 1B92A 2B4JA 2ATQA 1RILA 4B8CA 4DEZA 1BIUA 4CIFA 1TK0A 3QIOA 3OYAA 5DG8A 3KK1A 5KFBA 4NRUA 3EPGA 4IG3A 2KW4A 4EO6A 4CGIA 2J6UA 1T03B 1U48A 4RNFA 3LAMA 1FKOA 1Q9YA 4CERA 2GIRA 2RPIA 5KG2A 3IAYA 3H5XA 1S9FA 4CEDA 1D9FA 1QHTA 4DU1A 3PX0A 1CXQA 5KTQA 4XIUA 3K5LA 2WOMA 3GIMA 1RTHA 1NOYA 4RW8B 2I1RA 1RBVA 4HHTA 4N47A 4Q5VA 5J2NB 5KG4A 2F8SA 3FDSA 2DTUA 4AHSA 2KZZA 5K14B 4C8LA 2VWKA 3OL6A 3PO5A 4I9QA 4CHNA 4ELTA 5FRNA 2OPSA 4NLWA 2HHVA 4R5PB 3I5CA 3GIKA 4CJQA 3HT3A 1I6JA 1J5OA 3QLHA 4C8MA 4MQ3A 3NAHA 4DTXA 3ZT4A 1N48A 4DQSA 1NK7A 1D1UA 3TQ1A 1TL1B 3KK2B 1C0MA 5C5JA 2YNFB 1N4LA 1LWEA 5F9NA 1I39A 3V6JA 1SH0A 4FLVA 2PY5A 4M3TA 4PQUA 4I2QA 3NGIA 5KFYA 1RDDA 1CSJA 5T7BA 4M3UA 4IFVB 4MK7A 1WNSA 4H8KA 5DQHA 1J54A 1XI1A 1NKEA 4M3ZA 5HBMB 1J9AA 1I3AA 4Y3CA 5F9LA 3B6PA 3VA3A 3E01B 3MR5A 2Z1IA 4E19A 5CYQB 2KTQA 2IBKA 3P83D 2P5OA 4OL8A 4CK2A 4ECYA 4CF2A 3K59A 3DRRB 3NHGA 3HJFA 3V1OA 5SZTA 4IG3B 4O5BA 3PR5B 4MKBA 4FJLA 3DLGA 1VSDA 4PQUB 4FJ5A 5JUMA 4DSEA 4QWEA 1IKXB 3UR0A 2FJWA 3TWHA 4QCLA 3ZT0A 1TK5A 3OHBA 3P5JA 1U49A 1HMVA 3V6KA 4M45A 3JSMA 3KNAA 4CFDA 4O4GB 4AHUA 2UVWA 3KTQA 2YV0X 5KFQA 2W9CA 1RT4B 1IKVA 2HB5A 3L3VA 3PJXA 4O44B 1JLAA 4OPJA 4HTUA 4H4MA 3RBDA 3LZJA 4IH5A 2ZD1B 1JLQB 4N5SA 1A5VA 5KT2A 4Q8FA 3V9SA 5F8LA 3L2QA 3U3YA 2ZKUA 3RB0A 4DL3A 3CG7A 3SI8A 1EX4A 2KFNA 4EZ6A 3HHKA 4WZMA 3H59A 3IGNA 1GX6A 1ZETA 5KFJA 3HP6A 4DTJA 5DG7A 4IH7A 1NK4A 4KBIA 5KFCA 4CJVA 4KHSA 4X2BA 2XGQA 2A1SA 1WN7A 1VSEA 1Z26A 4KTWA 4RW4B 4O0IA 1FKOB 1HPZA 5C42B 2FBVA 3EZ5A 2FC0A 5L1KA 3KLEB 4R5PA 4W5NA 3C94A 3KLIA 4K4VA 4KHYA 4CFBA 4O44A 5EWEA 4K50A 1RT6B 4DFPA 2V9WA 2XY8A 3V9UA 3QLHB 4OVLA 1DLOB 2FVCA 2D3UA 2OH2A 1LWFB 4J9MA 3T5JA 5C24A 4CEAA 3CFPA 2FBXA 1L3SA 3G10A 2RF2B 3MFIA 4FJGA 3LP1B 3DLBA 4FJXA 4CJEA 3AVKA 1ZYQA 2G8FA 4Y2CA 2F96A 1QAIA 1C1AA 1RYRA 4ZTFA 2Y1IA 1L3VA 3BR9A 1U04A 4FBUA 4CJUA 2GC8A 4LH4A 4J2AA 4DF4A 2EC0A 2R2RA 2HHQA 1RT2A 4DLEA 3AO1A 2I5JA 4FLUA 3ZT2A 4FZXC 4IDKA 1YTAA 2YHAA 1TKXB 3NGZA 1C1CA 4B9UA 4Z4IA 3I8DA 1RYSA 4AH9A 3SUQA 1WLJA 4JV0A 5KI6A 3Q8SB 4LQ9A 3VQPA 3GIJA 3DDKA 3OYJA 4E89A 3UIQA 1YVUA 4M3XA 4YQWA 3IGVA 4E0DA 1NHVA 4CHOA 3KK1B 2YNGB 3OJSA 2OPRB 4RW6A 3MFHA 4WE1A 3QYYA 3MEGA 4FW1A 4DL2A 1QE1A 1U09A 3SUPA 2BR0A 4TY8A 4FJ7A 5HLFA 3ZSXA 4ICLB 2ZE2B 1EETA 1CZBA 2IAJB 3LDSA 3OLAA 4NCAA 1WAFA 3I0SB 4LSLB 4JV2A 1JLFA 4CJPA 4CHZA 4FLZA 4RNNA 3KD1E 1UWBA 3V6DB 4CK3A 2OPSB 1NK6A 2J6TA 1SH3A 3M9NB 3TANA 4J9LA 1WSFA 4DF8A 4URSA 1VSJA 3NF8A 2R8HA 1C0TA 3QIPA 2BRKA 4TLRA 3QO9A 2QXFA 4H54A 1HJRA 4KB0A 4KKOA 3LPTA 3I0SA 3SQ4A 2GV9A 4TXSA 1EETB 4NLGA 4ED0A 5EU7A 5KFGA 4TY8B 3S9HA 3OSNA 4FJNA 3IS9B 3NBPA 4ZVFA 3OYDA 3AVFA 3BGRB 1TKDA 4DSIA 1T03A 2RN2A 2X78A 2IGIA 3U3GA 2E6LA 4E7JA 3NH1A 2DY4A 1RTJA 3GV7B 1RT1A 4ZPCA 3VQSA 4E7LA 4FYDA 1TKZA 5KT4A 2JEGA 1RT5A 3ZSOA 2WCXA 1BI4B 1JLBB 4EP5A 4CEEA 2CKWA 4FLXA 4OGCA 3TR8A 4O3SA 3RRGA 4HUFA 1T05A 1RBUA 5DK5A 4DS5A 1TAUA 3QGIA 3G86A 1FK9B 3DRSA 3ZSRA 2G8IA 1J53A 4B3OA 3G0ZA 4IKAA 3TAMB 1WSGA 1S1VA 4QWCA 4CF9A 5T14A 1W25A 4CJSA 2Z1JA 3QETA 4BWJA 2G8VA 1NNDA 1DTQB 1BL3A 4J2BA 5FRMA 1NK5A 1TV6A 3KK3B 3K57A 4NLDA 2D0CA 1LV5A 1IKXA 2XO7A 1A5WA 4DQQA 2R8GA 4I2PA 3T1AA 3NAEA 4KSEB 4K4YA 3DRPA 4R8UA 1CZ9A 5CY4A 1RT5B 4PWDB 2FVPA 1JXBA 4EP4A 3QGHA 4DLGA 2HW3A 4MH8A 1TVRB 5HP1A 1JLQA 2XC9A 4K4UA 1NHUA 1S0OA 2E6MA 4FBTA 4ECUA 1SKSA 1HPZB 3LP0B 4CJFA 5KG3A 3ZT1A 1ZTWA 3PW2A 3RAXA 3SUNA 2FBYA 2FVRA 2IM0A 4KRFA 4O3NA 4ICLA 4HYKA 1U4BA 1JKHB 5KFSA 3DOKA 4PUOB 5C25B 3OL8A 1TK8A 2QV6A 3AO5A 2C2RA 1VRUB 3EZUA 3SUOA 4F4WA 1C0TB 4QWAA 4ECRA 3H4BA 3V1RA 3DI6A 4J9RA 4IR1A 2IS3A 4BE1A 1LW2A 3OLBA 1ZBIA 1QS4A 2YKNA 4Q43A 1BHLA 1JLAB 5DMRA 1SUQB 5FROA 1RT1B 4BWMA 2HMIB 2NUBA 2F8TA 3QZ7A 3KHRA 4RNMA 1FKPA 1QQCA 4DL6A 3GQCA 1RCHA 1SV5B 3RR7A 2IJNA 5F8IA 1S6QB 5EWGA 1KVBA 2XY5A 1BISA 4WYLA 5FDLA 5KFNA 4DU3A 2AJQA 3ITHA 3G6XA 1N6QB 4Q0BB 4K4XA 1RT3B 2BANB 4FLTA 4FZZA 3SJJA 3FQKA 2HNZB 3C6UA 3IRXB 1S1XB 1IH7A 3VQDA 1S6QA 1K6YA 3NF7A 3THVA 1T94A 4M42A 4RW9A 4DTOA 3TAGA 2JC1A 3G6YA 3M8RA 1ZBHA 4CEZA 4B08A 4E1MA 2B43A 3O4NA 3NMAA 4EEYA 1JLGB 3E01A 3PR4A 3MEEA 3MEDB 3DI6B 3DYAB 4F4YA 3PV8A 1Y97A 1IO2A 4PY5A 4HKQA 4URGA 2W9AA 4WYWA 3V6DA 3L2RA 1KCFA 4KO0B 2AGQA 4EZ9A 3HP9A 1T8EA 5J2PB 1RTDB 1KLMA 4O3PA 4IFYB 3FRZA 3B6OA 3K58A 2KZMA 3PX4A 4FJMA 3SV3A 3NCIA 3CIZA 4TQRA 2D3ZA 3SCXA 1RDCA 2WOMB 2B6AA 1QUVA 5KT3A 1BCMA 4CF8A 1IM4A 4CJRA 1VSMA 3VQBA 1C1BB 4NLSA 3VN5A 4GW6A 2J6SA 5F8NA 2ITGA 1LWFA 2XGPA 3QIDA 2XWYA 4N41A 1DLOA 4Y34A 5KT7A 4ZPAA 3IG1A 4MKAA 4CESA 5CZ1A 3GV5B 4JS4A 3UQSA 3TI0A 5SWMA 4FJ8A 4YFUA 2Q3SA 3PJWA 4AHCA 3AVNA 4M95A 3CJ0A 4DFKA 1R0AB 4RG8A 3EPIA 2HHTA 4I2PB 3NL0A 1RT7B 2B6AB 1RTHB 1C1CB 1UA0A 3PX6A 4NCBA 1S9EB 5CYMA 4U7CA 1ASVA 4ELVA 4RW7A 3MR2A 1S6PA 3AVLA 1RTDA 3VQ6A 1REVB 4ID5A
chains in the Genus database with same CATH superfamily
1WHXA 2UXBF 1ZBSA 2U1AA 3HD2A 4M5DA 3K8VA 2BM1A 3HVAA 2G2OA 1GXLA 3LL3A 3NFAA 2LXUA 4C7QA 1ATSA 5C10A 2FSJA 1QM9A 1X9MA 2LDIA 3NCPA 3KMSA 5F8HA 3BQ1A 1P27B 2G1DA 2O66A 5B7WA 2OTJN 3MXMA 4K41A 1B3TA 3QZ8A 2CJYB 2XNRA 5EDWA 4BR2A 4CEOA 1NGCA 4CHYA 5HMYA 1NDCA 4BACA 4MMOA 2H5EA 4RW9B 3EDQB 2QL7B 2ZJPQ 3IMXA 3U8XA 2U2FA 5T7LB 1MLAA 3D0GE 3AA5X 6AT1B 1SJFA 3J7YP 1UEKA 4JI1J 3KKSA 4LF2A 5BN8A 1T9YA 5HAOA 4IR9A 3D1HA 2PSZA 3W0LA 3L6QA 1N5YB 3R1XA 4PKGA 3OL7A 3OPKA 5EX5A 1A0OB 1VI7A 3WC2A 2I8EA 3CCJN 2ZWPA 5ETVA 3QRPA 2HQDA 4FLYA 1QVFR 1JLFB 4P9SA 3GYNA 3MMBB 2RQKA 4DR6J 4YMEA 5AFUH 3UDEA 1H2UX 4JBCA 5AQLA 4JI0K 2PBDA 3CCTA 1FA0A 4F3TA 2W7OA 2V4JA 3AODA 1C1BA 2QRRA 2KJWA 5LJVA 2DHHA 1F5CA 2DKOB 1IQZA 4Y2KA 4C3KA 4AQYJ 4KGXB 3I55N 2ALYB 1IR2A 2E7XA 1H72C 1ZBUA 3W65A 3RYLA 3PW7A 4M41A 3LWLA 3RB4A 5L39A 4CGFA 2LQ8A 4NLUA 1FDAA 1LAWA 2WBNA 3J81Y 3T5LA 5I42B 4FZYA 3O9UA 1E6YB 3PEHA 3R5JB 3H46O 2MQ8A 2FYXA 2O4IA 3CCEN 2OCEA 4DV7J 4CJTA 3HL8A 1BC6A 2PMWA 4I67A 4M8LA 3SLCA 4IXCA 3TAEA 3NGSA 1S9EA 4EMDA 1TL4A 5SUHA 1KOHA 1N36F 1L3UA 4ECZA 1S1WA 3ETOA 1NGGA 2RJZA 4I69A 1U26A 4G6VB 2HBJA 1NKCA 1F3FA 2YHXA 2RRBA 5GAEU 3OS2A 3M7VA 3CQ8A 2CPDA 4K2JA 1O8BA 1XK8A 3VR1A 3LP1A 3U02A 4HDHA 2IA0A 4U7BA 4HUEA 2AZ3A 4H4OA 3QMQA 2W40A 2BW2A 2XZDB 1K8KB 4IJAA 4I7FB 1YHQS 5FPNA 3NAIA 3QDKA 5J2NA 2P9IB 1B0VA 3VAJA 2QLWA 4C48A 1Q8IA 1Q8LA 3CJ5A 1S5ZA 5E7OB 4LF4J 2B5JB 3KJFB 1WDTA 1WG5A 3MPDA 2FVSA 3E9OA 1RAEB 5T7LA 1WSHA 3M6GA 4UZBA 5FPDA 5BXIA 3L2WA 4TNOA 4LF9J 4WE1B 4BR5A 1VQ9S 3PIPL 4KH4A 2O4GA 3CO9A 1RCXB 4PWDA 5IXUA 2E5HA 2JWNA 4F4XA 1R6VA 3DKDA 4PXEA 2RDIA 1SH2A 5E3QA 2OA8A 3I9ZA 2GBZA 1UFLA 1WBBA 1HYSB 2Y1JA 4IG0A 4DB3A 1BMQB 5DLGA 1MWMA 4HUGA 3IAM9 3JQJA 1TAQA 2ZHBA 1VMBA 3MM9A 4M1KA 1FRLA 2NSCA 3A8YA 1MDUB 1GQEA 3OR2A 4GVBB 2QK9A 4Z4GA 1NJIO 3LDNA 2GIFA 3GU0A 1KFSA 2PT0A 3OYBA 4F02A 1HUXA 3R5AA 1SIZA 4ZMMA 2YHWA 1PC5A 2DNKA 2CWXA 1HNWF 2VQFK 2EWSA 3C6TA 1WSEA 3DLKB 1ZPWX 3M2UB 2V2ZA 2BZ2A 5BREA 2WBRA 3DMJB 3KXDA 4X64J 3TZXA 1VS3A 5KG0A 5H1SV 4J9VA 2HFOA 4YOYA 2XMVA 4CCHA 4WTYA 4BR7A 4CO0A 1SV5A 3TTFA 5LJ5Y 2F40A 3RGIA 3CCSN 4NA2A 1WC6A 4OKJA 2QMXA 3A8IA 3EWGA 2D1KA 2NYIA 4F0KA 2ZZNA 4XPEA 3DNCA 1VBYA 2Z58B 2KHOA 3TZZA 2HK2A 4LSNA 4JLHA 4BE0A 1LNQA 4BRKA 3VF4A 3QRRA 4B9VA 1YJTA 3DGVA 4BRQA 2UUBF 3TYTA 2C2MB 4YOXA 3PSIA 4XEIA 2ABYA 5KPZA 3O4QA 2E5GA 2EC2A 3B54A 3P45B 4B3RF 4Y00A 3LOUA 1S1UA 4ZS6A 3AAQA 1HKAA 4LRAA 2OPRA 1M1HA 1XMOK 1HBOA 2D3OR 1LK7A 3PO4A 2CNNB 2C3UA 4KO0A 2CQ0A 3GFXA 1RBRA 3LWMA 4LY7A 2QWQA 1NJZA 1N32F 1FJGJ 1HNIB 3PVXA 3LANA 3VEYA 3SBGA 3GSDA 1M90T 2Z8QA 3UVJB 1X1PA 4OHWA 3QINA 1OVQA 2A42A 2UU9J 1XHZA 1Q18A 5KFFA 1NPPA 4CT9A 2E9ZA 1MW7A 3S41A 2DR7A 1S72S 3QQCD 2ZOMA 2JFKA 1FO1A 4J9OA 3EE3A 4WFBQ 3GV8B 2C2EA 1P90A 2HHHJ 1F21A 2ZH6A 4FK2A 5BYQA 1GLCG 2CAJA 3VQ4A 4CE9A 3O4WA 3BF3A 1S1TA 1J5OB 2ZGZA 2W25A 3WX4A 1XWLA 5D0HA 4GKJF 3QEIA 4DQIA 2MYFA 1IG9A 2P9SB 2NYHA 4X4UA 2AU0A 3E1YA 4D3GA 5JS2A 2PYJA 3BSCA 3ASMA 2DHXA 3M8ZA 1QVFM 1T9WA 3TRGA 5KFTA 4QPXA 1B99A 3SZ2A 2E2QA 1RDRA 1CBKA 3MXHP 4FWKA 4J9PA 4A8KA 1F9EB 2CVEA 4TN2A 1KHVA 5E26A 4LIRA 3BM7A 3SFGA 3HVWA 4USKA 4BE2A 1TL7B 1RWUA 4ZVEA 2YNHB 1EQMA 4FCYA 4F04B 4XPCA 4P2XA 1SJQA 4GV6A 1W97L 4H4MB 2VQEJ 3GFZA 3UDVA 2EVZA 4ZLNA 2UUWA 4IKFA 2RNEA 4FP9A 5GMDA 2MQNA 1UOCA 1UAXA 4DUYK 3D28A 1Q81T 4ED6A 2PMZD 4A8SA 3OFFA 5D0GA 1RHMB 3RW7A 4CNZA 2GQQA 4GO5X 1BU6O 4FPIA 3KFWX 2HQGA 5KPRA 3AV9A 1NSKL 2YWHA 5L46A 3VTHA 1S10A 3MD1A 3NF6A 3LP2A 4BRGA 1RT7A 1R27B 1U1NA 4AILC 3CI5A 2HKEA 2A2CA 3KDOA 4FPRA 1VR6A 2HBMA 4DTUA 1KQFB 2UV8A 1RWMB 4FXVA 5M2PA 1DT9A 2ZVIA 2HFZA 3R7NB 2R7WA 3EYZA 2QI2A 5KFRA 4CJ5A 5DGAA 2QZ8A 2RUGA 5HBMA 2F4VJ 3KMQA 4WQ4C 3MF5A 2RHQB 1OS5A 5FJ4A 1F5AA 2CQ1A 3NNCA 4KHPK 3V81A 1VSFA 2HNDB 4QW9A 2W24A 5HMZA 4ZVQB 4LUBA 2FBTA 4DCOB 5KFZA 5AXKA 4QYRA 4DTMA 3I8BA 1XIQA 4DKWA 3CE8A 4LFBJ 2YX4A 2G8WA 4BDPA 5K8OA 5AQMA 5DETA 3AQOA 3EX7B 4JI8K 2MKCA 1YI2S 1ZM4A 3D2EB 3MR6A 5MAOA 1IKVB 4F0HA 3CSKA 4EO8A 4WQ5C 1B9DA 4DR2K 2AGPA 4NXMJ 1ITGA 4RL1A 4OLOA 1VSHA 5KT6A 3SDEB 1MWQA 3AA3A 1Q95G 4KHRA 4FJIA 2ZNZA 4ZVSB 2DGSA 4KHUA 3Q86A 4IQMA 3EMTA 1YZ6A 5IQQA 3H40A 1VJQA 4Z4EA 5D0RA 2XSFA 4LFCK 2Q6BA 2GWJA 3ZYYX 1RLCL 2ASLA 1VHIA 5CABA 1J6ZA 4K4SA 1Q8BA 4YOUA 4Z4HA 4DV1F 4U7UD 5IFMA 2GUIA 1NJWA 2BA9A 3D2EA 3SFUA 5K8PA 4GC6A 4DTSA 5G0RA 4CZMA 4DV7F 4NLTA 3QB0A 2Z57B 3AB2B 5D3GA 2ZOFA 1G3OA 2L41A 4CLYA 4OI0A 4OI3A 1KLMB 1CS4A 1S4EA 1JKHA 2GGPA 5C25A 4DN0A 5BYSA 2LKZA 2HF4A 2G8UA 1VQ6N 3O3LA 3K5PA 1S49A 3AVGA 3P3DA 3KLGB 4ZTJA 2BUNA 3HK2A 2NPFA 1WF1A 3UKRA 2UUCK 3T1HK 2UP1A 4KREA 1IKYA 3OVBA 5DGBA 4PG4A 3SMZA 2DR5A 2BJ9A 3DWLA 4RZRA 1M5SA 3M6XA 1BQNB 1PBAA 1H7WA 4UF4A 3R7BB 3AARA 2YPZA 2P1JA 3LTOA 3Q8QB 4QR0A 2VV5A 2XLKA 4HH0A 2D5RA 4J9UE 4OLPA 4RW8A 1N6QA 4F8RA 2OPQB 4Z94A 1VGYA 5F0WA 1VQMS 3CEDA 5HROB 2QWLA 4ZHRA 1Q81O 3F73A 4ED3A 4RX6A 2F8EX 4K4TA 3HHEA 4JI7J 3MPUB 3M5RA 3IBWA 1GX5A 2VH7A 2WRMA 4K5RA 5KG7A 1P6TA 3NRBA 3M3ZA 1FNMA 3ENWA 4NZ0A 3VGSA 3R5BA 3AVCA 5J2MB 3M2VB 1QTMA 1WBDA 2UU9K 4Q44A 4URQU 1NGAA 3KLIB 3TA0A 1A5XA 1UWAA 1BQMA 3W7BA 4CO3A 1BG3A 2YJFA 2W2PP 2E44A 5LY3A 4NEYA 4KC5A 3PTWA 4P2SA 1X9SA 1DARA 3O3FA 5A2QU 4KHPJ 2ETJA 4J9SA 3CDAA 4JV5J 2DBBA 1C6VA 4X84A 4CD1A 2ASOA 3A4TA 3IR7B 2YCHA 3U27A 2AX1A 1S9GB 3FBFA 3VQTA 2QA4N 3ZCMA 1KBRA 1LQ9A 2QW9A 2QTWA 1O0PA 1NXIA 1BUPA 2QIFA 2M8HA 5E5NA 1JNRB 3MWPA 5AZJA 1TL3A 4JKEA 1NG9A 3NGUA 3KOAA 1RWPB 2YVSA 3OJUA 4DV5K 3Q8UA 2R7SA 1KLNA 3P1GA 4Q8EA 2AX0A 3MPVA 5D4LA 8ATCB 5A6PA 3TA1A 4AM6A 4DL0C 3P4IA 4G1QB 2DFEA 2C22A 3V5RA 2CNKB 1NB2A 4A8OA 4NCGA 2D69A 4CO5A 2PE8A 2AA4A 2J0WA 2BQRA 3R1LA 1KXPA 4QPTA 5AZJB 4KTZA 2XCAA 3BGFA 1QE1B 2HVHA 3IKMA 4EBCA 2QWMA 4HEA9 3V9XA 3PSFA 2F9WA 3Q2SC 4LSNB 4F26A 4AXIA 2DH8A 2E1AA 3P38A 5AQQA 1HD1A 3H5UA 2UU9F 3BZKA 2PEHA 3MOJB 2HNZA 4OZ1A 2I0XA 2YKMB 1BGXT 2VC1A 3MMAB 4FNIA 1S48A 2PFDA 4DR5F 3VEZA 4CEQA 1GLAG 2VQFJ 1YTYA 1C0UA 2HHWA 2ERRA 1GLEG 2X6NA 1XR6A 3M8PA 2NXNA 2LXFA 4JUZA 1J5EK 3UNGC 2C42A 1YJ7A 2I5JB 2OYQA 3A8EA 4I6YA 2DY1A 4QZVB 2DPJA 4Q45A 3ISND 4JHDA 3CCZA 3UW1A 3R2CJ 2YH0A 1S79A 1ZC6A 1HQEB 3IRWP 1Y9OA 4C4WA 1Z2LA 4OX9F 1RGVA 1OH8A 5C42A 1NGIA 5KQ8A 3AVAA 2EW9A 4F67A 1WJ9A 4PHTX 3F44A 4JI4J 4O4RA 4KH5A 2Z2MA 1U0HB 5AR0A 3FZ2A 3CDEA 4C8KA 4O0JA 5JS1A 5ADZA 2I6WA 3LDLA 1VQ4N 3KK7A 2JGUA 1GXUA 2GQCA 3PY8A 1PYSB 1X9WA 3KLVA 1QAJA 4J9QA 3M8YA 3J7Z5 3K7RA 3EVMA 3WQUA 3MWBA 1MN7A 1TQLA 4J2EA 3MAAB 1TVRA 4KHMA 4K4ZA 1BY9A 2AHOB 3KLGA 1Q86T 2XY7A 4IO8A 3UKUB 4ED7A 1EO1A 1VQNN 3O44A 2B9YA 1RDAA 3M8QA 2EFNA 1VQ7S 4NA1A 2RDDA 1N52B 1I51B 4DCPB 3C6AA 3OYCA 2R7QA 3VCDA 2B8QA 3KG0A 1H3DA 3H25A 1XNRJ 3ID6A 3S1TA 1KS2A 4U96A 3QT7A 3KK1A 4X4SA 1R31A 2MZ1A 3VGLA 2KW4A 4LRFA 4DV0K 2J6UA 4DV1K 3J80Y 3QBXA 4NOHA 4WFNQ 3QT6A 2VKZG 1Q9YA 3SIPB 3Q7BA 2FQQB 2GIRA 2RPIA 1C4CA 5AQKA 3ZXWA 4DU1A 3PX0A 4XIUA 3GIMA 3DGPB 1WDDA 3KVGA 2I1RA 1RBVA 4FVCA 1YF5L 5M1NA 2GVZA 5KG4A 4DV1J 3GR1A 5IC4B 2VWKA 3OL6A 1N88A 4AFFA 4RBVA 3GIKA 1FVSA 2OO4A 4WIQA 3VF6A 5IT9O 3D7EO 5ETSA 2ROGA 2EK1A 3QLHA 4C8MA 2X51A 4WWSA 3OBWA 3ZT4A 6FDRA 4JI6F 2WSEC 5CHCB 1HWKA 3L9ZA 2RQ4A 4GKKJ 1TL1B 3BN7A 2GJFA 3H1QA 1FJGK 3CC2S 3ISZA 2YNFB 4IOXA 4CM0A 4H4KA 2G0JA 3PHTA 2IIHA 1SH0A 4WKYA 4ZN3A 4WF9L 4M3TA 3Q0AA 4C98A 1CSJA 5T7BA 4OO1J 1RACB 3W66A 2B56A 1RAAB 1OQ3A 3MMBA 1XI1A 1VQKN 1I3AA 4Y3CA 4C9DA 5F9LA 5D78A 3TZWA 3VA3A 3MR5A 2BM0A 4FZVA 2E1PA 1Y10A 3O5TB 4B3TF 4CO2A 1OQ6A 1IJJA 3EGZA 2P5OA 2O8DA 4OL8A 3K59A 3DRRB 5SZTA 2J0QD 2DIVA 1SC1B 3DHWC 1VSDA 4PQUB 2HG4A 5JUMA 4DSEA 1IKXB 3UR0A 4ZCKA 3TWHA 4QCLA 3ZT0A 4BQLA 3NOGA 2W6KA 4OYBA 4KH6A 3MN5A 1CULB 4DR4J 1HMVA 5AQPA 3VGMA 2NNWA 4AD6A 1VQLS 1ZZFA 2UVWA 2YWEA 2LYVA 3MPYA 1E4FT 4O44B 3ZTRA 4H4MA 2H4YB 4H0PA 3RBDA 1RDWX 2VQEK 2F9JA 4MT1A 2VUGA 3J7YU 4CDIA 3DXMB 5C7PA 1YJUA 2YKPA 1EX4A 2P9PB 4EZ6A 4YDUC 3HHKA 2NRRA 1ZETA 1QJHA 3HP6A 1KQGB 2WVFA 2RE1A 1H7XA 4L75A 4CYUA 4QOTA 3C46A 4X2BA 3DXKB 4QS8A 3H2UB 2E5LJ 3MN7A 3P49B 4KTWA 1S77D 4RW4B 4O0IA 3UR3C 1FKOB 1HPZA 2DNLA 2VCPA 5C42B 2Y3YA 2H4WB 4XTTA 2GHPA 3ILJA 2LU2A 4ETXA 3FGUA 4KHYA 2EG2A 5EWEA 3SAGA 2XY8A 2P9SA 3QLHB 2VPXB 2E2OA 4NI2B 2YXLA 3T5JA 3CFPA 2FBXA 3MFIA 2HLTA 4CJEA 3AVKA 5LMNJ 2G8FA 3D54A 1RYRA 1F2GA 1NZAA 2Y1IA 3BR9A 1U04A 4CJUA 2HGMA 3WUHA 4DF4A 2KXNB 3UWTA 2V67A 1YDLA 4FF3A 5BRHA 2EPIA 1YTAA 2DGXA 3NGZA 2I2YA 3GPAA 1RYSA 4AH9A 4HDGA 3SUQA 1IUJA 4OYWA 4JV0A 1Q82T 5KI6A 5D15A 3CMEN 1VQSA 4P2FA 2QGFB 1YJ9S 4E89A 4YQWA 1U1RA 4E0DA 2ZITA 1HNXK 4CHOA 3U4LA 2CQ3A 3KK1B 1DY3A 4ZVTB 3KG1A 3DRXA 1IBKK 2OPRB 3FZHA 3MFHA 2YX7A 3QYYA 3C0BA 2FHKA 1NGFA 1QHAA 3MEGA 2A5XA 4FW1A 1QD1A 2P6SA 1T9XA 1OVYA 3QNWB 4ICLB 2RHKA 4OYZA 1CZBA 4JYAK 2DRDA 3LDSA 3D0IE 5AZIA 5GAGU 1U2VB 2DNRA 3I0SB 2XSJB 3T1HF 4JV2A 4CJPA 2QFJA 2CPJA 1X5TA 4UW2A 4FLZA 4RNNA 1UWBA 3V6DB 3W3DA 1FERA 1FRHA 1X0FA 2J6TA 1WC5A 2V8PA 1VSJA 2AYBA 1E6VB 3QIPA 2DCUB 2BRKA 4TLRA 5AQZA 3QO9A 1HJRA 1SS6A 3GR0A 3HLUA 4KB0A 5AQJA 3I0SA 5JVGL 3TQEA 4PG7A 1KWMA 4TXSA 2VQFF 4ED0A 1HNWK 2IVPA 2CQ2A 3HSGA 3S9HA 4F4AA 2HS0A 5ADXA 3NBPA 1FDDA 4AQYK 1XEZA 2VB6A 2RUSA 1ZM2A 2CG8A 2F4FA 1T03A 2HIQA 2F9DA 2HBZB 3NH1A 1LWXA 1RT1A 2CJBA 3VQSA 3R8EA 2KG1A 3MAHA 4KR0B 3ZSOA 2AJFE 2MQOA 4LF7K 4EP5A 4M5IA 9ATCB 3HSZA 4DUYF 3TR8A 3RRGA 4HUFA 1HBNA 4IOCQ 5DK5A 2DGUA 3ZSRA 1JNZB 2DEJA 4B3OA 3R3TA 4IKAA 3TAMB 2DNGA 4CF9A 4QQBA 4UUXA 2P9UB 1YKWA 4GY2B 1BL3A 3FKBA 4KQZA 2VOPA 1FJEB 4ILMA 4J2BA 1TV6A 3K57A 4NLDA 4FYYB 2NLWA 3T1AA 3W9IA 1FW6A 4K4YA 1CZ9A 3OQ2A 1RT5B 5D6GA 4PWDB 3MM6A 2HMPA 4MH8A 5AQRA 1X5PA 5HP1A 2E1RA 3PYDA 3UKRB 4NZ7A 4ER8A 2BABA 4NE9C 4K4UA 4BG9A 1NHUA 3DLLQ 4FBTA 3JAMY 1HPZB 3LP0B 4B3MJ 4CJFA 3KG4A 3ZX3A 1ZTWA 3AT1B 1TUGB 3RAXA 2FVRA 2IM0A 2ZJRQ 2FBYA 4O3NA 3Q23A 5AXMA 4ICLA 3DOMA 4HYKA 1WUUA 1U4BA 3LH2S 5KFSA 3DOKA 2GHWA 4PUOB 1K8KA 3OL8A 2E88A 1TK8A 1GAOA 1ILYA 2QV6A 3AO5A 4H5TA 4A61A 2C2RA 1VRUB 3DC2A 1C0TB 4BREA 3NWRA 1QQNA 3V1RA 3DI6A 4J9RA 1AYEA 4DR6F 2IS3A 2B4VA 2C2OB 5IZHA 3NCRA 1BHLA 4MTPA 1SUQB 2C3YA 4FYXB 5BN9A 4USUA 3N5BA 4LSZB 1IBLJ 5K9FA 3BEXA 3MCOA 3QZ7A 3KHRA 4RNMA 4M63A 3GYGA 2XMTA 1YRUA 2ATCB 2J8AA 3SK3A 1KVBA 5KFNA 4DU3A 4Q0BB 2HEKA 2A3JA 2NSBA 4DV0J 4FLTA 3KHYA 1XERA 2O67A 3C6UA 2E7VA 3THVA 3NF7A 2UUAK 4JI7K 1NH8A 2O01C 4B1XB 2IFXA 2B43A 3UFCX 3J81O 2QEXS 2RT3A 3MEEA 2ZBPA 3VEOA 5IT4A 3PV8A 1Y97A 2XMJA 3ZZZA 2W9AA 1RISA 4USHA 5U47A 3L2RA 3FE1A 1UTAA 3CUNA 4CI0B 3SSSA 4O3PA 2PI5A 2MB0B 3AOBA 5ELZA 2YQ0A 1FNXH 3PX4A 3AJ1A 3SV3A 4BCAA 3SCXA 2WOMB 1BCMA 4CJRA 2FSKA 1N54B 3VN5A 3F5TA 4GW6A 2ITGA 4OPAA 1HBUA 1V3ZA 3D4JA 4K25A 2VICA 1YSJA 1MROB 4AL6A 3CPWR 1U7LA 1U1KA 3CMQA 5SWMA 4FJ8A 2Q3SA 3CJQA 4AHCA 5BR8K 3VENA 4M95A 4DFKA 2IRXA 1AUDA 2H51B 1GMWD 3ZFVA 4I2PB 4Z37A 2B6AB 1N36J 2B9WA 1X3MA 1UA0A 1UL3A 4A2AA 3O9TA 5CYMA 4DPTA 1ASVA 1CLFA 4RW7A 2FHOB 5D0EA 3MR2A 1EQ0A 4C8ZA 5AFUA 4ID5A 2DHSA 3HKZD 1KTQA 4ZITA 3BQ0A 2JEIA 4NYNA 1HNXJ 4DPUA 3OYFA 4IEIA 4GNIA 3SI6A 2KVIA 4KAZA 3D45A 3RWUA 1ZPVA 4CH0S 5DM6Q 1S0MA 4F36A 3QEVA 1FJ7A 1T05B 3C6HA 4DU4A 1RWVB 2D9PA 3OXLA 3MCNA 3DLEB 3CC4N 2CJ9A 1UW4A 2ZBQA 1Q7LB 4OZLA 1X5SA 1RT6A 1VRTA 3G8SA 3MN6A 3JAMO 1MMDA 4YOEA 1LW2B 2P2CB 2QN6B 2ZBRA 2HVEA 3CNQP 2MLXA 5CZ2A 1CQNA 2ACYA 3RMAA 2E9TA 1MU2A 1FHTA 2F3JA 3GTYX 4Y2MA 4PXDA 1JQGA 2B4PA 2PA8D 3LM2A 1RKJA 2YNFA 2F7TA 1WORA 1PJ6A 2FF6A 1LWCA 1NB7A 1HLUA 1QVGM 3FRYA 3HFZB 4YY3K 2ILZA 2G8KA 1DTTB 4L3KA 3NGDA 5CE3A 3VTIA 2VFTA 3G9CA 4CF1A 3DLHA 2ZF5O 1NUEA 2E29A 5ETTA 4OYOA 3GB0A 3GE1A 2FJBB 2AYGA 3TNVA 5LMUJ 2UVUA 2P9CA 2QG9B 2ZJPL 3PYEA 1U24A 4RJVA 2E8AA 1LOUA 4OKEA 5F0XA 3FZMA 4K2XA 2CADA 4B3OB 2GA7A 1U1PA 3CCUN 2KT3A 2YQ3A 3M1VB 8AT1B 1FEEA 4LBHA 4PL7A 2ZE2A 4ZLJA 4CNYA 2B9EA 3DLJA 1AA1B 3J8AA 3WXIA 3BUZB 1Y00A 2Y1RI 3UDCA 2E1CA 1HQUA 5KFDA 1N36K 4BRCA 2YJEA 3KD5E 3LALA 1FT8A 1WEYA 2V4QA 4CBXA 2VA3A 4YDDB 3IDHA 1RHQB 4NYFA 4LF9K 3TAPA 2ZUAA 3JS9A 1RQ0A 3GMGA 4QWBA 1QAYA 2RU3A 2W8KA 2XMKA 1SXLA 1SVDA 1YBAA 1RA6A 2E5LK 4LF5F 5E0OA 4E2FB 1TKTB 3RJMB 4CP5A 2G1HA 3R8YA 1N33J 4PWUA 1Y64A 3SQ2A 5BPMA 3K2YA 3EO3A 4O0NA 4DX8H 2GVDB 2HBRB 1CJKA 4NLPA 3VQ8A 3CCRS 1X8DA 1Z2ZA 4WXOA 4IO9L 4CECA 1SB6A 2HFSA 4KV8A 2OP5A 4DSJA 1RDBA 3UD5A 3Q2TC 1Q7YT 1G99A 2OHDA 3OA9A 4NPOA 5IQ6A 1ASWA 1JB0C 4WK1A 3ZLJA 5EUHA 1FX4A 1NKBA 1GXTA 4FLWA 1AZSA 4EYIB 1RBTA 1KRPA 1VQ6S 4IJNA 4LFAK 1RTJB 1T02A 3CB4A 1IBMF 4LD0A 1NMDA 3F0NA 1VRUA 1GOBA 2N4CA 3SCJE 4ED1A 3VERA 3FSYA 3BP8A 4H5NA 3ZNJ1 4MIBA 3K0JA 5HOOA 3QICA 1KDNA 5FD1A 3T1YF 4RNOA 2WSCC 3I0RA 3E3XA 5CR4A 4DTNA 1FJGF 4AHVA 2XMWA 5I4MA 4R25A 3CCES 4CD3A 2K06A 2OUGA 2FB0A 4JV1A 2LEAA 1HQEA 4CLTA 2MMYA 4OYXA 1S9GA 2J76E 1HNVA 5KRTA 2E4LA 3FZLA 2JFDA 5AXNA 3O3HA 3VV2B 4HTIA 4CEFA 3P4UB 2Q43A 2HS4A 5LMUF 4ZVHA 4LFBK 1AROP 2OTLS 2DEIA 2ZNYA 2G8HA 3TWZA 4ZPBA 2HZCA 4IRCA 4M94A 3DRSB 4LF7J 4RWTA 4O4GA 4I1TA 3MXJA 2DB1A 2BACA 3POTA 1PC4A 3CM5A 3MCPA 4YHHF 2VU5A 1NK9A 3KHLA 2VG5B 2MZJA 2ATLA 4LF8J 5DDOC 4JRQA 3A3OB 2HBLA 4MIWA 1N32K 4QIEA 3QMLA 4USTA 4FF1A 4HL9A 4DSLA 1P1LA 2P9LA 3A5MC 1JLCA 3ZSYA 2IVMA 1RLDA 1JX4A 1HFEL 4OX8A 1WNEA 3Q8RB 3T5HA 4ZDNA 4LF5J 3AVMA 4C3MA 4A2BA 5E3CA 1KVAA 1IKWB 2EX3A 2Y8YA 1OWXA 2HHHF 2H65B 3QFWA 3HHLB 4Y2IA 4I2QB 3ENOA 1R0AA 2HGLA 1KAYA 1J27A 2N3OA 2QL5B 2E66A 1VQLN 3D67A 3HKWA 1HRHA 1RP5A 2P8IA 5B0DA 2GFFA 4ISEA 4R8UB 1PIEA 3W61A 3NH2A 3THYA 4RTFD 1JLGA 4WU3A 4LFAF 4OJGA 2V0NA 3THTA 3WIUA 3MMVA 3FLCO 3TAFA 1XC9A 5AQOA 4DMNA 1DTQA 1GLLO 2FHJA 2LP4A 1TUVA 1PJ5A 3LDPA 3CXCM 3DRRA 1T3VA 2M8DB 5E41A 4ILRA 4O3OA 3M2VA 3Q83A 5IWAJ 3MECB 4ANCA 3B78A 1YXQA 1TTHB 3KLFA 3OYNA 3NKYA 2WTFA 1X7VA 4NXNJ 2BJDA 3M32B 3AAWB 1KP6A 1WF2A 4H4KC 5A2QO 5KFKA 2CQGA 2QE5A 2H9ZA 5TKYA 2BKNA 3HCXA 1ZS6A 3MDFA 4ENOA 3NS6A 5J1EB 2RRNA 1EZZB 1RABB 3QEPA 2GNKA 4CHQA 3N0VA 1RBLA 2AQ4A 2GHVC 3G82B 1FXXA 2NRTA 3KK2A 2UVRA 3O1BA 2GTDA 1KQKA 5CCMA 3TJAA 2FUG9 3BB5A 3TABA 1FESA 5F2RA 1BCOA 4GRSA 2VDIA 1N5YA 1JXLA 3JS6A 1R8HA 4PKDB 3PDNA 4WFZA 3WNGA 4FF4A 4KHNA 2FPHX 3NS5A 2NREA 4JI0J 2V8DA 2CWKA 3JYTB 2PO4A 3R6LB 3BYPA 3G4SS 4HCBA 3NY0A 4KPCA 5J2QB 5A8RB 4FWSA 2E2PA 3N4QA 2EKNA 1QZ6A 1LAVA 3PW5A 3GG0A 1WELA 4K0KF 4M7YA 4EBDA 4B1WB 4HI1A 3KYLA 2QLFB 3T41A 2B4OA 3OYHA 4O3RA 2WB4A 3THXA 1WAJA 3DU5A 2BUPA 3LUYA 1P9YA 4OJRA 2EFPA 3TSPA 2WSFC 5HRPA 5HVFA 3MGJA 4BHQA 3M8SA 4JI5F 2JX2A 3ZZYA 1SL1A 4ECXA 4E1NA 1KVJA 4AHRA 3MX2A 2OEMA 3PUFA 3OTCA 3LZIA 3UKUA 1CULA 2HIYA 4LH5A 4QIFA 2HWTA 3BJYA 3OS1A 3P8BB 5K8NA 2CJKA 4FL9A 3JYTA 2UUBK 1K1SA 2RF2A 4OI1A 3SCIE 2HMIA 4CZLA 5BR8J 4JKGA 1QSYA 2J5AA 2FLLA 4DL4A 3BREA 2V7ZA 4CGDA 2L9NA 5AQTA 1UJ4A 3LW5C 2IYGA 2ZFHA 3RMCA 4F2RA 1YTUA 1LFWA 3VWSA 2ZM6K 5F8MA 2CUYA 4P75A 4KAIA 1RI7A 3NLCA 3RSEB 5KG5A 3TUPA 4I56A 4BROA 1V3SA 2CVIA 2NRXA 4EU0A 3I56N 1VQ9N 4I64A 1JMTA 4GV3A 2LEPA 4H0XB 2HBKA 1S7HA 1T0TV 4JAXA 1FCAA 5ETLA 1A9NB 1YVFA 1UVNA 1GOAA 3P31A 1DJ0A 4NLXA 2CXEA 5GAEP 1R7IA 2KB2A 4ECWA 3BO2A 2ZH4A 3N6NA 6FD1A 3BBFA 1KNZA 4JEPA 2CRLA 1HWIA 2XTJP 1BIZA 3CJ4A 1HYZA 2MLYA 3UN2A 2X1FA 2OGUA 2NUUG 2W9CB 3AO4A 4QJVA 1NLKL 3L0QA 4CJKA 4GKKF 4AE5A 4HLBA 2Q3PA 1LW0A 4DR7F 1UZDA 3C6UB 4OX6A 2ASJA 3ONQA 3F2KA 3BGRA 1WSIA 1RAOA 3ILLA 3IS9A 4CI6A 2FY8A 1J5EF 1ZH5A 3CD7A 5H9EK 2FJXA 2V2QA 3DDNA 2WW4A 4KH1B 2BE2B 3IN5A 3BKUA 4CGHA 4IBNA 3CCSS 1GTHA 3WHIA 2KQ2A 3SQ0A 2VG5A 4FJHA 4ID1A 2P9NB 3O6WA 4GMKA 4PXBA 1B0TA 1P1TA 3JSMB 2HQIA 1IWGA 2D0BA 3ALYA 2RKIB 3H1VX 3BGOP 2M7SA 2R8JA 4G1QA 3P5TL 1OSDA 1W0HA 4WP9A 1X0PA 3G6VA 4YB6A 1WACA 2IYIA 3NGRA 5DRKA 3CJKA 2V7YA 1IKWA 3OVSA 1ZAWA 1S0VA 3QBWA 3LP0A 1GMVA 4ZP9A 2ZHAA 2FF3B 4MFBB 5DQIA 1CXUA 4JRPA 3OW2R 2ADBA 4DR2F 4LF4K 1NGEA 3ZZRA 3TVZA 5GADI 1JL1A 4PA1A 4RBTA 1WUAA 1WHVA 1NDPA 1FXRA 2EG1A 3C3LA 1S0NA 3AVBA 4OPHA 4YUDA 5AQGA 3P5BP 3ZZPA 3EZWA 3MZIA 4YR2A 3EY1A 3D9BA 4B1VA 4NLQA 2M3DA 2XWXA 4J90A 2XBPA 4CFAA 2NXJA 1I94K 4QR1A 4EUVA 4K8XA 3DLGB 2VBWA 3C66A 5B0GA 1SQGA 3D6FB 5DQGA 3KHGA 3CM6A 1K73T 2YY3A 3OYMA 2R9LA 1JL2A 2AV5A 2XS7A 1L5UA 5D4OA 4HWIA 2L48A 3CTRA 1EXQA 5KFPA 2G2YA 2HQFA 4NWBA 3OUYB 4DTRA 4KPYA 2A1BA 3CD5A 4O8UA 1WB9A 5GAHI 1BHNA 3QRQA 3UNYA 2P5GA 2P9EA 2LECA 3RBXA 4X4TA 3OXGA 3FVYA 4I6WA 4ECVA 1GK8A 2Y0SD 3N6LA 4DG1A 2DR6A 2JHEA 4F50A 1N34K 1UVLA 5D4PA 2YKMA 3CERA 1VK8A 1Z1ZA 3RUBL 3J81j 4K4WA 1HL6A 2BE9B 5L9XA 5DM7L 4KE5A 2BQUA 3QNOA 4JK9A 4A59A 1AZSB 5GMEA 3QIPB 3EVOA 1R0CB 4YP3A 1Q78A 4KY3A 3CPEA 1LK5A 4JI3K 1ROFA 4CJ3A 2M52A 4FS2A 2F1FA 1NM2A 5K8MA 3MM7A 1HQ2A 2FXUA 1Z25A 4P7TA 4TU8A 1V9OA 1DZ5A 3RZAA 1FDBA 1O5JA 5L1JA 2FY1A 4FJ9A 1ZBFA 5GAEI 4PEOA 2H1YA 2BV3A 5I3UB 1VQ8N 2QYGA 3N79A 5HO4A 3ZO7A 2D3O1 4A62A 2WHOA 3B8HA 1VQPN 2WUSA 4CK1A 2VWJA 2KU7A 4Y1CA 3SNNA 3CW2C 1NCLA 5IV3A 1OYDA 3C15A 5ETNA 1KN6A 4GKJK 4FYWB 2AIRB 3CDBA 4LT6A 2RU9A 3X1LB 2JEFA 3KNGA 4NLRA 3HZ6A 1UAWA 1WC4A 3AXKA 3GE9A 2FC8A 2J9EA 3M1VA 3GJQB 2WBMA 4XH1A 2QEXN 1HWLA 4A57A 4IG0B 3H4DA 2I9SA 2QO3A 3H2LA 3M8WA 1BI4A 5LT5A 3I87A 3FFKB 4CJ7A 5J2MA 4KGZB 4CFCA 4O55A 1IM6A 3NVMA 2FTRA 1K44A 3CJBA 2KL8A 1LFPA 1M5HA 3PKMA 5CYMB 3AJ2A 5K14A 3MI7X 2W9BB 3WNEA 3G96A 2V2KA 1TELA 2XMUA 1NZ8A 2RMLA 1SQKA 4NB4A 3AA9A 2IPOB 2UXDK 1H73A 3CCRN 3C8YA 1NJXA 1V5IB 3L09A 3LGHA 3G71N 1H74A 3C16A 4BRDA 3WT0A 5GADP 5AQFA 2MKYA 4J9KA 1TMJA 2ZM6F 3VAHA 1XQIA 4NLOA 5KFVA 2ZZTA 3SSRA 2KRRA 3V9ZA 2A0FB 3TVKA 3TAQA 2DNHA 4ZVGA 5A2QY 3CIPA 5HLFB 1N5VA 2IHR1 2E5LF 2YTCA 3PXGa 3T6JA 5H9EJ 2F7VA 5KGXA 2D1CA 3CJ3A 4ZKAA 1RT2B 3CJRA 2XI2A 4UUWA 1NDKA 3RR8A 5KFUA 4LF9F 3KLHB 4RNHA 4DSKA 1HMVB 4LVOP 3MPWA 2HVIA 4NRTA 5M1KA 5JLFA 2ATQA 1RILA 4B8CA 4DEZA 2ZC3A 4UOFA 2WVDA 3IR5B 3QIOA 2A10A 4H0TB 4PPZA 3EPGA 5ETRA 4CGIA 1BXNA 1U2RA 4J5OA 1T95A 1YBTA 1MROA 3LAMA 2KKZA 1XMQJ 5KG2A 3IAYA 1HBUB 4C3LA 4K7QA 4YB5A 1D9FA 3T6BA 1QHTA 1CXQA 2WOMA 1OSCA 3EGVA 1RTHA 3VAFA 3D68A 4JI5K 3E9LA 2GELA 3QAEA 1D09B 1N0UA 1NMNA 3HTVA 2KZZA 5K14B 4C8LA 1IR1A 3SDEA 1FXLA 4ED4A 1IBCB 4FWPA 2HHVA 1UMJA 3L7PA 2Q97A 3BH7B 2XEXA 4LF6K 1I6JA 1J5OA 5E3AA 3NAHA 4DTXA 3R5DA 1K8AO 1W7AA 3QSIA 3KZBA 1ITPA 2A2DA 4LR7A 1NK7A 1D1UA 4OYAA 2XLJA 4QYZK 4OYIA 3KK2B 4ZK7M 3EICA 1C0MA 1C0FA 2YHYA 1T6DA 4X62F 3NMRA 4JYAF 4EHUA 2J9DA 5A6WA 4C1NI 5D4NA 4H03B 1I39A 3V6JA 3MEKA 3L4IA 2LDYA 1RDDA 4IFVB 4PYDA 4MK7A 3GLJA 5DQHA 5HBMB 5DM6L 2MJUA 1HW9A 3SAHA 1K0VA 3B6PA 2GZOA 1YHQN 3A3NB 2NRZA 3KDNA 5CYQB 2HFNA 3FGVA 3P83D 2RH3A 3BKTA 1XMQK 3JTOA 2CPIA 4CK2A 3VGVA 2B8PA 3TTDA 4CF2A 1RWNB 3HJFA 3NHGA 3AGKA 3V1OA 3VGTA 3ZNUA 4MKBA 4FJLA 4H5RA 5EX0A 2F5GA 2FJWA 2P9UA 1PJ7A 2XB2D 3LGNA 4FVUA 2KM8B 2CH5A 3OHBA 3K89A 4X64F 3U1NA 5CHIA 4A8QA 3OBIA 1GMWA 3R3LA 4IFEA 2LXIA 1YJRA 3NEKA 3KTQA 2YV0X 4LFCF 1RT4B 4ETZA 4HTUA 2KXHA 1M0SA 3LZJA 2JNJA 1T3OA 5KT2A 3V9SA 1CJTA 2J0XA 2VD3A 2ZKUA 2K7KA 3RB0A 4DL3A 5CQGA 1EX8A 2KFNA 2JWKA 4WZMA 2DNZA 1GX6A 2OANA 2OJ3A 4DTJA 5DG7A 4ZA1A 4CJVA 2NLXA 5KFCA 1F2HA 4X66K 4FWNA 4OV6A 2A1SA 2DCLA 3N01A 1VSEA 3CQXA 4ZPTR 2VJVA 2MTLA 3UCGA 2FBVA 3EZ5A 2M0GB 1WD6A 1AUSL 4R5PA 3C94A 1NU0A 5B0CA 3IC1A 3V9UA 4DHYA 1DLOB 5ETPA 2D3UA 1VQ5S 3J7ZT 2J4RA 4B3MK 4LRCA 5B0BA 3DLBA 4FJXA 3VF0B 4PG6A 1ZYQA 4ZTFA 2Q79A 3C14A 3ATUA 1BQXA 2GC8A 4WK3A 4LH4A 4J2AA 2EC0A 3GJRB 4X62J 2HHQA 3AO1A 2I5JA 2JL9A 1YQHA 2P9KB 5A0YA 2Q2RA 5FPEA 4IDKA 2YHAA 1TKXB 4DR6K 1OY6A 4EI2A 1WLJA 4ZVRB 3RW6A 2H54B 1N33K 3GIJA 2RQCA 4M3XA 4PRFA 1NHVA 1RBOB 2EKYA 2YNGB 2Z2ZA 1NMEB 1PG5B 3OJSA 2ASMA 1Q82O 4NXMK 3O08A 2IMOA 2YKAA 1QE1A 1U09A 4O5FA 4TY8A 4QIGA 3ZSXA 3QBCA 4B1ZA 3JQMA 1EETA 2IBOA 2BX6A 3OLAA 4NCAA 3H42A 1WAFA 4U7UK 5C2CA 4KHPF 2DXDA 1QVGR 3C14B 3NMUA 3EJMA 2UXDJ 2R42A 4WKRA 3ZEUB 4CK3A 3IBFB 2CGLA 4WQ5A 4OYPA 5AQVA 3TANA 1WSFA 4DF8A 2R8HA 5D77A 3OTOF 4H54A 4GVEA 3MMJA 2QWNA 1B7YB 2GV9A 3MR7A 4DV3F 1TFYA 3D2WA 2OTJS 4DHVA 1R8CA 3ZTOA 2MGZA 3IS9B 1JJHA 4ZVFA 1CJKB 3BGRB 3PRVA 2P9PA 4JI2K 2X78A 3VEXA 2KH9A 4UY8O 3U1MA 4E7JA 2DY4A 1RTJA 3GV7B 2RILA 1UW9A 1TL5A 4ZPCA 4WTOB 4FYDA 5KT4A 2WFBA 2JEGA 2UXCK 2QA4S 1VJWA 2P9GA 3CF5Q 3JXOA 2HZAA 2VPZB 4CEEA 3QJLA 5CD4H 1WC0A 4XDCA 1RBUA 2LMIA 1TAUA 4TU9A 4DR1K 1FK9B 4F7VA 3W64A 2JSXA 1YIJN 2WAQD 3ZTSA 1FRKA 3ZZ0A 5GIPA 3HHLC 3A0IX 4DR5J 1WSGA 1S1VA 1LXNA 7AT1B 4ZCIA 2Z1JA 5A8KA 3WIVA 2BTFA 1NK5A 3KK3B 1BDGA 2FIUA 2DGWA 1EWQA 1K9MO 2R8GA 1O51A 3U9ZA 4KSEB 3DRPA 4PYAA 2FVPA 4WFBL 1JXBA 2CPYA 3A13A 4DLGA 5AQIA 3BBBA 2HSTA 2HW3A 2XC9A 2V68A 3PYGA 2BJEA 1N5QA 2HRUA 3LO3A 4IWVA 1ULRA 3CC7N 3ZT1A 3PW2A 3IWNC 3SUNA 1RXOB 2E1ZA 4YY3F 3D66A 3PACA 1JKHB 1UJ5A 5C25B 4H0VB 4MKVA 3RRKA 3A8KA 5GAGI 4QWAA 4ECRA 3H4BA 2CFXA 3ENBA 1LW2A 1BE4A 2MKIA 1HNXF 3C19A 4Q43A 5G0RB 1VBXA 4WQ4A 3TSUA 2F8MA 1FRXA 2GJ2A 3IWXA 2HMIB 3HI9A 4I68A 2NUBA 2G2ZA 2ADCA 1DRZA 2FGOA 1R43A 2DO0A 1QQCA 3GQCA 1RCHA 4BR9A 4A8FA 5F8IA 1S7IA 1KAXA 4DV3J 2CQDA 2XY5A 1JJCB 4WYLA 5FDLA 3G6XA 5KQDA 2A6OA 1RT3B 2G0CA 2CZ9A 2OSRA 4FZZA 4OHVA 1ESVA 4QBUA 3OVAA 1S1XB 4M42A 4DTOA 3G6YA 5C0YA 4B3TJ 1RFQA 1YI2N 5M1QA 5G4DA 4AUKA 3VZIA 1ZOTA 1HNZK 3PR4A 3DI6B 3GSIA 3IA0A 4PY5A 4HKQA 4GKKK 3KWMA 2JZ5A 3CC7S 2M4MA 5D8HB 2HF3A 1XMQF 5B0FA 4M5MA 4V1Ak 3MM7B 4OIXA 2V63A 3G82A 1T8EA 4HACA 2G0IA 3GZ7A 2KZMA 4ZIWA 1OKJA 4FJMA 4YDUA 3H7HB 3CIZA 4I4BA 4O23A 4DR3K 4OZ2A 2B6AA 5KT3A 1FWPA 3OTEA 1C1BB 2M70A 1LWFA 3IMQJ 2XWYA 4N41A 4Y34A 5KT7A 4BR4A 2MZTA 1KTVA 5IT0A 4B3SJ 1IVZA 1VHXA 4UY8T 4ISFA 1KR4A 3O2IA 3GV5B 2D0PA 3AVNA 3N4WA 1FE4A 3CJ0A 3CJ1A 1KD1O 3GFHA 4BC5A 1R0AB 1RT7B 3PNIA 5GADU 1C1CB 1B7FA 1K73O 2QSWA 5C15A 3PX6A 4NCBA 2VYPA 4BC2A 4CLLA 4CZKA 4ELVA 2RS8A 3N5FA 3QFPA 1NAQA 1GTEA 2DNOA 4B8AB 1S1VB 3JAMU 3OL9A 2ZD1A 3TR5A 3T9ZA 3Q24A 3OYIA 1HR0K 2DH9A 4DWIA 5BYRA 1TGOA 2X1BA 2BRLA 3BSOA 4JV5F 2PAVA 2K1RB 4ZJLA 1FK9A 4DFJA 1XR7A 3VQEA 3CJTA 4EYHB 2K8GA 3RMDA 2JLFA 2ACMA 4N77A 5IM0B 4ED8A 1H38A 1AW0A 4WFAQ 1RU2A 4E7IA 4PR6A 3D5MA 1R59O 4F4ZA 3NS7B 3BF1A 1HX1A 3TX8A 4G65A 2MKJA 4O8KA 2J7KA 1TL7A 4OMFG 4ILJA 3AXMA 1CC8A 5HMXA 2WONB 3I5BA 3H6EA 1KVIA 1RB0A 2XNQA 1FTCA 3UD3P 1OIAA 3LP3A 2ITMA 4FK0A 2HHHK 1V4TA 3WXLA 2Z1HA 2XRIA 3FMWA 2APOA 4MK8A 1JJ4A 5LL6Z 3UE5A 1VQOS 1ZXOA 2AEMA 3PFEA 1K0TA 3JQKA 2V5HG 3MURP 5T41A 5HP1B 3LQVA 3RTVA 2XCPA 1FRIA 2QKKA 2HAIA 1KQSM 3GCWP 3IP0A 1ELOA 2P51A 3IUCA 4XH5A 5KOXA 2OIHA 1T9VA 2RKIA 5GAGP 3FSIA 5K20B 4RPFA 4FXDA 3NH0A 2LEBA 1WI8A 4LBPA 1T9TA 5DJBA 3D0PA 5B08A 5HSPA 1E3MA 3MMAA 3QFHA 2DD8S 2M9KA 1GOCA 1U6ZA 4Y1DA 4XO0A 4NLVA 4NA3A 2AYEA 4BRFA 3FEXB 2JVOA 2K2PA 4RU9A 4FKXA 4H0OA 4CIEA 2C2KB 2W1BA 1JLEA 4ELUA 2P5VA 3CDWA 1D8YA 4IFVA 3K5NA 3KKFA 4R0EA 5HVGA 3SCKE 3NGKA 3FNNA 4FWRA 3I0RB 5KGWA 1FKPB 2J9CA 2P6TA 2X7IA 3KIOA 3BSAA 1QUPA 2CDRB 4DL7A 4FM0A 3TAMA 4KKOB 1VK3A 2Y8WA 4YHHJ 1UVKA 4TY9A 2RRAA 3OSPA 1W9HA 3VZHA 3CC4S 2IM2A 2N7CA 4PL8A 2ZQBA 4FPBA 3DDIA 4FO0A 4WIIA 1M1KO 3H08A 3VQ5A 1IXKA 2W4PA 3W2WB 4M5LA 4IEEA 4C0OC 4B9NA 1W2BR 4XH4A 4K59A 2BDPA 4FN5A 1DBDA 4TQSA 3CCUS 1D0EA 4OX9K 4X4QA 1G2EA 1RAIB 1RHJB 1Y5IB 4I6AA 3AVJA 5MLCQ 1WI6A 2DYAA 2HNYB 3DXMA 1BO5O 4DFMA 1SJ4P 2KT2A 4IRDA 1BQMB 4CJWA 3JTPA 4L3QA 2BJ7A 4NLYA 2B3TB 4ZVUB 1FTRA 5KFLA 3W5YA 1CJTB 4ED2A 1SL2A 1YJ9N 3M2UA 3E9PA 1IKYB 1XHXA 2XO6A 3C6TB 2K1RA 1LWCB 1EKEA 4QIVA 4QIWD 4WU2A 2QXLA 1HHSA 2V34A 1R8AA 1B9FA 5HRSA 1UA1A 3DXSX 8RUCA 2XSJA 1S1XA 3BQ2A 4C8OA 1PO6A 4A8XA 3JXUA 4M5GA 1T6CA 4HTLA 4DUZK 1B4SA 1S6OA 2RVJA 3AD9C 1SL0A 1HIYA 4Z2XA 1AB8A 3A3PB 4K0KJ 2DH7A 1UKUA 1N34F 4UTGA 2OPQA 2B7CB 2FJAB 3THXB 2AP6A 2DNMA 3AHPA 4KFBB 1P8GA 1ATNA 2CJQA 3AO2A 3DLEA 2V8VA 5ETMA 3TARA 2FJEB 2YX1A 4C0BA 4TLQA 2L08A 4FYVB 4IUFA 1FD8A 1UEUA 1TKZB 2AEFA 4MYTA 2FZCB 3V4IB 4QW8A 1TUWA 4DJBA 3QNNA 3NNAA 2PIIA 3OTOK 3FQLA 1VC5A 2W7PA 4JI6J 5A8RA 4ALZA 3KKRA 2Z2LA 1IWAA 3MMCA 5F3TA 5TKWA 5AQYA 4BRNA 4X4NA 5JVGQ 5EVZA 3MR3A 2WZ1A 2LQBA 2F8HA 2JH3A 2X1AA 3QERA 2PEBA 5HATA 2HPUA 4OLBA 4LF6F 1O1WA 4W5TA 1NK0A 3DOLA 1SJ3P 4YDXA 5B09A 3G6EN 3PJ9A 4NI2A 5IC6B 1SKUB 3B4MA 3NDKA 3SJHA 3BGLA 2IIRA 3AY9A 5KFOA 3DXBA 4AYBD 2KFZA 3I6PA 3HPGA 3R6GB 1PCAA 3ENHA 2IA6A 1HBMA 1U02A 2V69A 2BJ3A 2AJ4A 2IAJA 3QFUA 2AD9A 5KFWA 1VQ8S 5C2DA 3O8WA 2ASPA 2ZKTA 1IBLK 4QOZB 1JCEA 1S97A 4DR1F 3T3FA 2MQQA 4WBFA 2HYIB 5EN1A 4DSFA 4A8YA 3EM1A 5H1SQ 4AL7A 1T9UA 3ULDA 4IOBA 3LPUA 2YH1A 1U8SA 4PKIA 1XQSC 3F56A 1EHWA 1G6BA 4JKGB 5FLXY 4HH1A 5CZVA 3LP2B 2Y0BB 3M6UA 1NBWA 3ID8A 3ZSQA 3HSJA 4P74A 2FLPA 3DM2A 2KM8C 1UFKA 2MDAA 3MN9A 4BRAA 3G2XA 4DI6A 2VFRA 1JCFA 1SQFA 4ZPVR 1Q7YO 4AF1A 4IZ9A 5L1IA 1M5KC 1GLDG 2HNDA 2FVQA 4FWMA 1CVJA 3I31A 1VSLA 4OKKA 2E1MC 2ZWOA 3OYGA 4RWXA 4MO4A 3THYB 4B3RK 4DUTA 1QAXA 2O8FA 4CLWA 3LDOA 4K43A 2V4JB 4KGVB 2FD2A 1VQMN 2E20A 2Y9HA 3I56S 3CWJA 4TYAA 4E7KA 1TP7A 4KT0C 3BDPA 3RAQA 3O3GA 3VA0A 3CIMA 3N28A 4ZIVA 2PI4A 3GCXP 1U6FA 2F4VF 5ETKA 4BDZA 1Q86O 3OY9A 3C7NA 3NOCA 4B9SA 3H5SA 1O6XA 3HDSA 4B1UB 1QTNB 5A8KB 4DR7J 5C2FA 3MMCB 2EHGA 3JSYA 1JLCB 2ZH1A 5M1FA 4FVMA 4P7VA 1RWOB 4F2SA 4OLAA 3ZEUA 1WOSA 3WXJA 2HHSA 5J1NA 3OR1A 1J2VA 2GO9A 1URNA 4ATNA 3BPDA 5ETQA 1SUQA 1YVNA 3CO0P 2BEFA 4ANDA 3M8PB 1UP1A 4JKAA 3PZPA 1HNWJ 1FXDA 2AKWB 3R5GA 1RWXB 2HBQB 2KVQE 1F6TA 2IOCA 3CJSA 1SJRA 1WOPA 1JCGA 1QSSA 3DGPA 5FLXO 4QAGA 1VBZA 4A8WA 1V3RA 4F0MA 3OS0A 1RE1B 2ZC4A 4Z4FA 1U1QA 2XY6A 2DRBA 1N8RO 2O8CA 1NSPA 4EGLA 3W1YC 1MSWD 3FCHA 3E2EA 2ROEA 2DIUA 4MFBA 3K17A 2UYTA 3D6HB 3GIIA 4CRJA 2Q31A 1MA9B 4ZLLA 4NCGB 2OI2A 1U45A 2Q1LA 1R6YA 3O9QA 1LWEB 2OKQA 2PA3A 3L4QA 2C2DA 2ZGYA 3GONA 4DZDA 2MLZA 2ZBCA 5FLXU 4UOGA 1NPKA 4CIGA 2YNIB 2IVNA 1K1QA 2MSSA 5GAHU 1VQ4S 1RSCA 4AM7A 4N8NA 2HHUA 2YWWA 1IN0A 3QJPA 1S57A 5JMNA 4DV6F 1SCJB 2RS2A 1D3WA 2LQJA 3MCSA 4P72A 1F60B 2JJ4D 3M2RB 1CJVA 2R7RA 2R2SA 1I1GA 4FOEA 3U6FA 3J7YI 1HR0F 2H3GX 1S5JA 4I6MA 3N6MA 3HOSA 4DG1B 3CCQS 4GC7A 1X5OA 1VFJA 1XUPO 4ECQA 4KB1A 4L76A 2GV1A 3HPHA 3ENAA 4OZ0A 3CCWA 1KSPA 3WXMB 5AJ3K 1TKTA 2O1PA 3TUZC 1YJWN 1PKUA 5IV4A 3NBPB 4B02A 2VQEF 5L9NA 1MMNA 1UVJA 2GAHC 2NXEA 4ITSA 1DQ9A 1C0UB 3DFEA 4JI7F 3DLRA 2C1EB 3KJVB 2BW7A 1RAJA 3OHAA 4LF5K 2AJ0A 5JVHL 4W92B 5HK4A 1Q4RA 1SJ1A 1CJVB 2ZDPA 3VAMA 2IMWP 5AE3A 4GKJJ 3W8GA 1S76D 4M5JA 5E84A 1FJCA 1HQUB 2GX9A 1XNRK 3BV8A 4JHDB 3KHHA 3GL1A 1YZ7A 2D0AA 3MCMA 3TEHB 4FSVA 4BVPA 4FKYA 2HHXA 3OYLA 2UZAA 4QS9A 1XTZA 1REVA 4DCJB 3T69A 2W2NP 1FFSB 4PPDA 2XYGB 2QKBA 3PHEA 4AXJA 2L9WA 2MZSA 2UUTA 3Q8PB 3VVTA 3HPOA 5RUBA 1EIYB 1RTZA 1X4BA 1IG8A 1G4CA 1PILA 2KJVA 4B9LA 3A5LC 3I5AA 2CYYA 2ZH7A 1IBKF 3HHLD 2ALZA 1LEOA 1Z05A 2A1RA 4FS1A 4JB8B 3IWLA 2VJUA 3IM8A 4I0WA 1N8RT 3FSXA 3O6QA 4RW4A 2NZCA 1RT4A 2VA2A 4IH6A 1RHKB 3CJKB 3MTKA 4AL5A 3LA0A 1YITN 4GVBA 2PDAA 4DV7K 3S3OA 1SKWA 3AH6A 1MU2B 4LF1A 4UQGA 3MEGB 4EHTA 4FW2A 5M2UA 1S3XA 2FLNA 1FWLA 3A5OC 1RHRB 2OMOA 1Z4UA 3NNHA 1VQNS 1G1XA 4NXNK 3TJ9A 2ZJRL 2ROPA 3I4PA 3SEOA 3M9MB 3OBYA 2OEKA 5JXSA 4Z0UA 3EE9A 4LREA 4LFAJ 1GT8A 1HNZF 4KTQA 1WOQA 4C0HA 5KT5A 2BE2A 1SQEA 2FDNA 2JOQA 2BQ3A 3OYEA 2A18A 1YRXA 4JI1K 1FFGB 3UD4P 1ZBLA 1S1WB 3GP9A 3I82A 3HYFA 2CNLB 2HHPA 4JOUA 1H98A 4ZP7A 2ZH3A 4U6PA 4LF7F 3HFKA 3TOQA 1WF0A 2L3MA 3AJDA 2QA4G 1GFWB 3HO1A 4DQPA 1X3NA 1LW0B 4WFAL 1KC8T 2B7BB 5LMNK 1EQYA 4MK9A 5CZXA 1KD1T 5AQUA 1D8ZA 3IM9A 1Q16B 3TUIC 2GO8A 4RO0A 3SPYA 4GMJB 4H4OB 2GJIA 2KFYA 2IDOA 2FZGB 4ZP8A 3VQQA 1VQKS 2HOEA 3KLHA 2BJ8A 1BQNA 3VQAA 4ID8A 4LSLA 1RCOB 3HSTB 4E3SA 2MHNA 3HVTB 2W4CA 2A3ZA 5CXTA 2OPPB 2MPUA 1C0GA 3RSEA 3RBZA 1F1BB 3F9KA 4DX5A 3OXFA 1VCTA 2O3DA 1GLJO 4EIAA 3O1WA 2J9DE 3H5YA 2V94A 4YORA 3DOLB 3A2FA 3T9NA 4WZQA 4OGEA 5LJ3Y 4NLBA 3ZSVA 4ZPDA 2GW8A 4CGGA 5LSRA 2QWRA 3GYXB 5DO2A 3ILOA 2AF6A 1URRA 2W9BA 5AQHA 4MO5A 2BGGA 3SBMA 3CFRA 4CGJA 3OD2A 4HCCA 5BRFA 1W26A 4BRIA 2IVYA 2RE2A 1FNOA 2MKKA 5KFAA 3AY0A 3OTBA 1T44A 4F4KA 4W5QA 3L8BA 1YRTA 3TUJC 1VRTB 2EFQA 4DV2K 1Y5LB 4PAAA 3WX8A 1WSJA 5H9FK 4HVZA 2AWZA 4BRPA 3VGKA 2O8EB 3ELHA 5HL7L 4CZEA 1O13A 2HGNA 2R2TA 3BR8A 2EI5A 3D3CJ 3G87A 1NSQA 1NSAA 2HWIA 1HKGA 4P10A