1TKXA

Crystal structure of hiv-1 reverse transcriptase in complex with gw490745
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
537
structure length
534
Chain Sequence
SPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Design of non-nucleoside inhibitors of HIV-1 reverse transcriptase with improved drug resistance properties. 2.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords Pol polyprotein, Reverse transcriptase, Chain A
total genus 145
structure length 534
sequence length 537
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1tkxA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tkxA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tkxA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tkxA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1tkxA05
3MEDA 3NGYA 2X6SA 2HHXA 2RKIB 3BDPA 1TV6A 1BCOA 2OPRB 3GV7B 2UUWA 1HRHA 1DTTA 4EEYA 3KNAA 4B9LA 1DTQA 1ASWA 5KT4A 4CHZA 2B6AB 3ISNC 3E01B 4DQIA 1JLBB 5F9NA 4CJ5A 1HNIB 3MR3A 4DG1B 3DRRA 2WOMB 2BQRA 2IM0A 4ZVEA 5I3UA 2Z1GA 1RBVA 1BI4B 1VK0A 3TARA 5DG7A 1ZTWA 4LSLB 4E7KA 2V0NA 4HVJA 1NJXA 4Y3CA 4FBUA 1JKHB 1JLAB 1CSJA 1R0AA 5KFBA 4QAGA 3SNNA 1ZBUA 4KB0A 3WNGA 3HHKA 1T3NA 4QWAA 3EZ5A 3K58A 2AGQA 4O3PA 3KLEB 1RILA 3M9OB 1UA1A 1NK9A 4JLHA 5C42A 3OHAA 4ECQA 2CKWA 2WRMA 1S10A 2IMWP 5KFHA 3GV8B 3U3GA 2D7SA 4EO6A 4KTQA 4TY8A 3OYAA 5I42B 4FK2A 3OYGA 2I5JA 1TAUA 1XWLA 2XI3A 3RAXA 2ETJA 3OY9A 4FJMA 4ZVFA 3K5LA 3RBEA 4MFBA 1HQUA 4DQSA 1WSJA 4ECSA 2CJQA 1NNDA 3T19A 2V9WA 1VSLA 3NF8A 4CIFA 4G1QA 4LQ3A 1FK9B 1RTIB 1QQCA 2HWHA 3DYAA 4ZP7A 4EZ6A 1RT1B 4CJEA 4H4MB 1NKEA 1N6QA 4DTSA 2BANB 4I2PB 5KFPA 1ASUA 4CK2A 3D28A 1RT5B 1EKEA 2OH2A 4WFYA 4K4XA 1RA6A 3LZIA 1GOAA 3CG7A 3MFIA 2ASJA 2HMIB 3NF6A 3NGIA 5I3UB 1NHVA 4UQGA 5E41A 4FK4A 4O5BA 5KFTA 4NLSA 2FBVA 2J6TA 4QWDA 1LW2A 5KI6A 5DQIA 4FJJA 3TQ1A 3QO9A 3NAIA 3AO4A 3OS2A 3QNNA 3AA2A 2WHOA 1DLOA 2O5DA 3L2WA 1REVB 5KG5A 2HHUA 2FJVA 1LWFA 3JYTA 3QEPA 4E7JA 4M3TA 4TLRA 4CECA 2XY5A 2FBYA 4FJGA 4F4WA 3OS0A 1U49A 5T14A 4ED8A 4CHQA 2XY6A 4IQXA 5K14B 1OS5A 1RTDB 1HPZA 5L1LA 3H59A 3PW7A 3NL0A 2BGGA 4TY8B 5F8LA 4M3WA 2RF2B 3DLKB 3CJ0A 1SV5A 3K5OA 4ZHRA 2VWJA 2AU0A 4O4RA 3FDSA 3GILA 4MKBA 4FXDA 1HQUB 4CFBA 3IRXB 2R2UA 4F50A 5D3GB 4CHPA 5KFIA 4BWMA 4O4GA 5KFEA 4I2QA 2J6UA 3OYLA 1IM4A 4K4YA 2HNYB 1FKOA 2YNIA 1ZBLA 4FJKA 4CERA 5JS2A 3M8QA 1ZBIA 4H4MA 4TXSA 4E7IA 5J1EA 3LP2B 1K1SA 3TANA 4EP5A 3SQ4A 1QTMA 1RTHB 4RW7A 2V4RA 2C28A 4ECYA 3HVWA 1IKVA 3TAPA 3ASMA 1HMVB 3H5YA 1L5UA 4B9UA 4Q8EA 4FLXA 2FBXA 2R8GA 2FJWA 5JS1A 4WFZA 3PZPA 1U45A 5KFXA 2KQ2A 4EBEA 1KLMA 2XO7A 2A1SA 3KHRA 4IBNA 3VN5A 1RT2A 5J2PB 1K1QA 1C1BB 4OLBA 1T03A 4YNQA 4ED3A 3PO4A 3K5MA 4FS2A 1IKXB 3PX4A 3E51A 1S9EA 5F8HA 3FQKA 3RR8A 2YHAA 2FBTA 3KLHB 4H8KA 1HJRA 1W25A 5KFQA 2XHBA 3GQCA 4KHNA 2IS3A 4ID1A 4LH4A 2VG5B 4K4UA 4FW2A 4EZ9A 2Z1IA 4R5PA 4AH9A 3BGRA 4MFBB 2X74A 1SH0A 4DFMA 2KFNA 3RMBA 3NBPB 3LP1A 5KT7A 4BACA 2F8SA 3AA3A 3IRXA 4EBCA 1S1XB 1KCFA 4E7HA 2HHTA 3OYBA 1XHXA 3BREA 2QK9A 1FK9A 2X6NA 4J9RA 1NK7A 2B5JB 3ZSQA 2E9ZA 4ED1A 4NLVA 4W5QA 1TK8A 2OPRA 1RDDA 2I1RA 5KG4A 2KW4A 1RT1A 1RT5A 3AVHA 4CFCA 3HVAA 1XI1A 4K4TA 4HTUA 4DL2A 2GIQA 3NF7A 1XC9A 4FYDA 4PWDB 3Q8SB 1N56A 3V6DB 2HNZA 5KFRA 2OYQA 5HROA 1TKDA 4DF8A 4Z4FA 1LW2B 3V6JA 3CJ3A 2OPSA 2W9BB 1X9WA 1Q8IA 3GIMA 3KMQA 1RCHA 1TKZA 3CM6A 2IAJA 4CHNA 1TL1A 4K4SA 1ZTTA 2IJNA 3IAYA 2IOCA 2JC0A 4NLPA 4TYBA 3M9MB 3VQ8A 1L3VA 3SPZA 3OL6A 4DTOA 1WSGA 4FJ7A 3Q8QB 3ZT1A 4URQU 3RWUA 2Z1HA 5KG2A 3LP3A 1HPZB 3T5HA 3UIQA 4O3SA 1S9EB 5K14A 3OS1A 4XPCA 4C8LA 3N6LA 1TAQA 3OYEA 3ZT3A 3BSNA 5FDLB 3TVKA 3AVFA 1RYRA 4E19A 3NF9A 3MECA 5FROA 4DTPA 4FJ8A 4F2SA 3IGNA 4Q8FA 3OL8A 3TAEA 4O3NA 1IKWA 3V9WA 3H2LA 4I2QB 1HNVA 2UVVA 4NLWA 3UQSA 1U48A 1B9FA 2P5OA 4LSNB 4TSXA 3NCIA 4DS4A 3ZSVA 2OPPA 3MF5A 5KT5A 1G15A 4X2BA 3SPYA 2P1JA 5J1EB 5KFAA 1IH7A 3CJ2A 1BIUA 2D0BA 1NOZA 3PJWA 4O44B 3RB0A 4CFDA 3FRZA 1N48A 2XRIA 3LPUA 4OKJA 3HM9A 2UUTA 3KK3A 4M3RA 4OVLA 3DDKA 2F96A 1S48A 4URGA 3TABA 4JRPA 3WNEA 4BWJA 3V4IB 3AVKA 3AVJA 4J9QA 2DTUA 1KLMB 2XCPA 3AVMA 3KKRA 4J9KA 2HHSA 1D0EA 4ZPDA 4N56A 4G3IA 1JLFB 2G8UA 1C1BA 1TKZB 4IOBA 4J9OA 5HP1B 4ZP6A 4NYZA 3PX6A 1LWFB 3D5MA 2AGPA 3EZUA 3KJVA 1Z4UA 2BDPA 4GW6A 1S6QA 3V9SA 4CEOA 3MR6A 3PW4A 3KLFB 5EWFA 3G10A 1RDRA 5SZTA 1ZETA 3HK2A 4CF8A 1C1CB 2ASDA 4IRKA 3VQ9A 4LH5A 3WNHA 3IGVA 4FLUA 2B43A 2JEIA 3L2QA 4AHSA 3HL8A 1U47A 3CDWA 4PQUA 4KHQA 2R2SA 4QWBA 2JEFA 3V9ZA 4CE9A 4LD0A 2D3UA 1IO2A 1N4LA 3WNFA 4DL6A 4TYAA 3TWHA 4IR1A 4ELTA 4CJFA 2D3ZA 4CCHA 1RTJB 4KTZA 1NK4A 3C6TB 3RTVA 3I0RB 4CGIA 1S1XA 4HCCA 4FJNA 1I3AA 1VSIA 1NKBA 4I7FA 4ZTJA 3T5JA 4B9VA 5KFVA 2OPQB 3RMCA 4DTUA 5DG8A 3ICLA 1TV6B 2R8HA 4FZYA 3SJJA 2JEJA 1S0MA 2AX1A 3CO9A 3LDSA 4CJSA 2OZSA 3MXMA 1WLJA 4J9MA 3HP9A 5CZ2A 2PZSA 3SUQA 1TKTB 3DRSA 4J9LA 2KTQA 2YNHA 1HMVA 3DOLA 3QIOA 5C25A 2OPSB 2W9BA 2YHBA 1SH3A 1RT6B 1MU2A 3ITHA 3AVGA 1EP4A 3H4DA 4NLDA 1CXUA 4OKEA 4NCBA 1WNEA 3K59A 1IKYB 3G86A 4WXWA 4RU9A 1JLCA 3KMSA 3SQ2A 3PUFA 1LWCB 3DOKA 4K4VA 4O3QA 4ZPBA 3VQAA 4J9PA 3MTKA 2V4QA 4F8RA 1JIHA 4BDZA 1EXQA 4CEZA 1LWEA 2OA8A 4QWCA 4MQ3A 1VSJA 3MEGB 2Y1IA 5KFMA 4KFBA 1CLQA 4ECXA 1JXLA 4O0IA 3OL7A 3HJFA 4EYHB 3I0SA 1FXXA 2ITGA 4L8RB 3LP1B 4N5SA 2AX0A 2UVRA 5L1KA 2DPIA 1IKWB 2OZMA 1ZYQA 1C6VA 4IFYB 1RTJA 5KFZA 3U3YA 1XR5A 3AA4A 1GX6A 1BQMB 1HNVB 1WSFA 3LPTA 3TAQA 4LSNA 3DM2B 2VA3A 3LZJA 2YKMB 4WYLA 4TQSA 3K2PA 1UAXA 4ZPCA 1DTQB 3VQSA 2BANA 5EDWA 2D0CA 4CJ4A 1BL3A 1HQEB 3E01A 1KHVA 4E0DA 1DTTB 4FJ9A 1HNIA 4JS5A 1WNSA 1TQLA 1Q9XA 4IKAA 1Z26A 4O44A 3S9HA 1C0UA 2WCXA 3PR4A 3ZT2A 3KK3B 5KFLA 1NHUA 3I5AA 3RR7A 3L2RA 2QKKA 1SKSA 4E3SA 1GX5A 4BDPA 2BRKA 5HRSA 3AO5A 3PW0A 3HPHA 3ALYA 3LAMA 5FRNA 5J2QA 1TVRB 4RW9A 3BR9A 2HB5A 3EYZA 5HP1A 4I9QA 2YKNB 4DSKA 3OVNA 5HLFA 4K4ZA 5DK5A 5F8IA 1R0AB 3SV3A 4RW6B 3T3FA 3VQBA 4DL4A 1RYSA 1HYVA 1REVA 4ECWA 4O55A 3H5UA 1KRPA 3BSAA 4E1MA 3ZSRA 1WAFA 4DU1A 5KG6A 5DQGA 1A5WA 5L1IA 3QEWA 3ZT0A 3P5JA 4IRCA 2E9TA 3BJYA 3PR5B 1LAVA 2VG7B 5DMRA 1NKCA 4KB1A 1I39A 4AHUA 4KFBB 1ZBFA 4ICLB 1YTAA 3O4QA 2BQ3A 2AJQA 1SKRA 5CYMB 4PQUB 1XHZA 3OYHA 2G8HA 1WAJA 2O4IA 1RBTA 3N6NA 3I0RA 4FLWA 1B92A 1EETB 3OSNA 4KSEB 3GIKA 1FKPA 4DWIA 3FFIB 1U09A 3PO5A 5C24B 4BE0A 4JUZA 3PVXA 3JSMB 3CM5A 3LANA 3GIIA 4FK0A 1U04A 2R7YA 2HVHA 1JLBA 1TKTA 1S4FA 4CJLA 3AA5X 5L1JA 2YNGB 3NKYA 3LP2A 3V1QA 3MFHA 3DMJA 2XGPA 1SKWA 3V4IA 4WZQA 2XGQA 3AVIA 1JLAA 3I5BA 2IBKA 4FBTA 1EP4B 4ED2A 1JLCB 4ZVGA 2C2EA 2YKNA 3NAEA 4DLGA 5HLFB 3SUOA 1IKYA 2BE2B 4B3OA 3B6OA 3VQQA 3AVLA 4RW6A 4DL5A 4KHYA 1LW0A 3DOKB 5KG1A 4Y1DA 3TAFA 3OHBA 3IG1B 1BIZA 4M3YA 4BDYA 1X9MA 3PJXA 4GC6A 2FVQA 2J6SA 4KKOB 4HYKA 4F2RA 1W0HA 3QZ8A 5KG3A 3NAHA 1RBRA 1HYZA 2W8KA 4KHRA 4CIEA 4CEBA 3PHEA 3NH2A 1SV5B 2ASLA 4HUGA 1RT3A 2E4LA 5J2NA 3MAQA 3FSIA 4IFVA 3TAGA 1YVUA 4F3TA 4J2DA 3CYMA 4OGCA 4CJRA 3LAKA 4NZ0A 4IFYA 4DL3A 3OYJA 1JLEA 4I2PA 1D8YA 2YKMA 3OYIA 3C95A 1WN7A 4WXOA 3ZCMA 3N6MA 5DLFA 4IRDA 4CJUA 1J5OA 1JX4A 1QAIA 3NFAA 4FM1A 1B9DA 3HVTA 4F4YA 3OJSA 3T5LA 4RW7B 5HBMA 1RT6A 1QAJA 2BQUA 1IKVB 2DFFA 4DS5A 4CJPA 1BQNB 3KK2B 4DTMA 4TN2A 1KFSA 4FLYA 4WYWA 2JGUA 5J2PA 1DLOB 3SFGA 3OLBA 4AHTA 4RW9B 3BQ1A 4KB7A 1TL1B 1J9AA 3KHGA 2F8TA 4RG8A 4CGFA 4H54A 3AVCA 5CYQB 1C0TB 1S9GA 3KK1A 4I9LA 1LWEB 1U4BA 3KLVA 1VSEA 3KLHA 5KFGA 4E1NA 2IM1A 1N5YB 1CXQA 2RN2A 1VRUB 1RDAA 1A5XA 4DFKA 4NLRA 3EY1A 2R8JA 1QSYA 3DLKA 3D45A 4Z4CA 4R5PB 4NLGA 1WSHA 4J9SA 3QIPB 3QGHA 4O3OA 4B9NA 1NJZA 5KT2A 4AILC 4U6PA 4ID5B 4FJIA 5CZ1A 1Q9YA 3FFIA 4AHCA 2AWZA 4FS1A 3OLAA 4DSEA 3OYCA 3DM2A 1EETA 1MMLA 1RDCA 2ZQBA 5JUMA 2FLNA 4DQRA 1JLEB 1FKPB 2OPPB 4Q43A 3NE6A 3S3NA 2FLPA 1I6JA 3CQ8A 1S1VA 3CFOA 4PWDA 2IJFA 3SUPA 1VSMA 2WOMA 4DU3A 4KHMA 3DMJB 3DLEA 2JC1A 1RBUA 4B9TA 2B4JA 2A1RA 3HSTB 3QGGA 5KFOA 2E6LA 2IAJB 4AHRA 3H98A 2HHQA 4LY7A 1NJWA 2R8IA 2ILZA 2BE2A 4B3OB 3LWLA 4YFUA 1C0TA 1S9GB 3KK1B 3T1AA 5KFCA 4Q44A 5DGAA 3B6PA 4FLVA 2EHGA 3HT3A 4OLAA 2GUIA 1C1AA 2AQ4A 3AVBA 4NCGA 1S0NA 5KG0A 3BSCA 1S49A 3SV4A 4O3RA 1SH2A 1L3TA 3KTQA 3VA3A 3DLGA 4M3XA 4ICLA 3Q8PB 3MR2A 3MXJA 3VQEA 3BGRB 3NDKA 1LV5A 4RNNA 5FDLA 2RDJA 2D0AA 4CGHA 1NK0A 1SL0A 3V81A 4DLEA 4AHVA 5DGBA 1JLQB 3PY8A 1RT3B 3NMAA 2FLLA 4W5RA 5KFJA 2C2DA 4BE2A 2IC3B 1S97A 3QEXA 1S6PB 4W5OA 4ECRA 3C6UA 4K4WA 3KIOA 5J2NB 3VQ6A 5KFYA 4QWEA 1TP7A 4KTWA 4KHUA 4F4XA 4ZTFA 4MK7A 3JSMA 4R8UA 2YNFB 1KTQA 1NOYA 1J5OB 1SUQB 4M3ZA 1K6YA 3HPOA 2HHVA 5KFSA 1X1PA 1S0OA 2IDOA 3T5KA 4FLTA 2HNZB 4Y2CA 5HBMB 4C8NA 3ZSWA 3HVTB 3KD5E 4OPKA 3LWMA 4RUCA 4WE1B 4CJWA 4IG3A 4LSLA 4EBDA 3KHHA 3ZSZA 2QXFA 1QSSA 2HW3A 5HRNA 3O3FA 1RT7A 2IM3A 2GC8A 4OGEA 2G8IA 3OSPA 2PY5A 4MIBA 5CYQA 1S1UA 5T7BA 5KGWA 1S1TA 4CK3A 3AVNA 5KFWA 3HO1A 1T05B 2F8EX 4JV1A 3TAMB 4GC7A 3L2VA 2X78A 3V6KA 1BISA 3OJUA 4DFJA 4ELUA 2I5JB 3L2UA 4KPYA 4DL7A 4FM2A 2O4GA 2NUBA 2WK4A 3O3GA 4Q45A 3V81B 2C22A 3C6TA 5KFFA 4QW8A 3PW5A 4EP4A 4PY5A 4NLOA 4O4GB 3NH1A 1BGXT 2XY7A 4KO0B 4F3OA 4FM0A 1D9DA 1UA0A 4FZXC 1NJYA 5KGXA 3D0PA 3SI6A 3SCXA 1QSLA 2R2RA 4CEEA 2VG6A 1C2PA 1S1VB 3DLRA 4KHWA 1S1WB 1SUQA 3TR8A 2QV6A 5F8NA 3CDUA 4PA1A 1VSFA 2KZZA 3ZSOA 3SI8A 2HMIA 3A2FA 3DRSB 3OYFA 3H40A 4ELVA 2RDIA 1BQNA 3KK2A 4Y1CA 5KRSA 3DOLB 4YR3A 5CY4A 3DRPA 1YTUA 4NLYA 1JKHA 5HRRA 2P5GA 1QS4A 2FC0A 4WE1A 3OYMA 4RNOA 3CWJA 3ZT4A 4CHYA 4FJ5A 3PW2A 4ZP8A 4CFAA 1CZBA 3ZSXA 1XR7A 2C2RA 3ISND 3AV9A 4NCAA 1RT2B 1S6QB 2P51A 4MH8A 3DLHA 1J53A 3JYTB 1S9FA 3HXMA 1RTDA 1BCMA 2IGIA 2YV0X 4DU4A 5I42A 4QW9A 3QLHB 1A5VA 3O3HA 2EX3A 1T05A 2WONB 4OPJA 3L8BA 3I0SB 3HPGA 4ZHRB 2ATQA 3I8DA 1TK0A 5L9XA 2KZMA 3RAQA 3CFPA 4RNFA 5KRTA 4CF9A 3HKWA 4CHOA 4KV8A 3G6YA 4B8CA 4N41A 2EC0A 3L3UA 1QE1B 4DSLA 2VA2A 2IC3A 4CEQA 4G1QB 2HHWA 1JLQA 3L3VA 4JS4A 3IS9A 4TQRA 3AO3A 1RTIA 1T7PA 3PX0A 3K57A 4RW4B 2HNYA 1S6PA 3G6XA 1BQMA 4RW8B 1KVAA 3G6VA 2R2TA 3RMDA 4Z4EA 5KFUA 1ITGA 2YNFA 2B5JA 1RNHA 1FKOB 4EYIB 4HCBA 2FVRA 3NHGA 4TY9A 1KFDA 3KKSA 4NLQA 4GMJB 3Q8RB 4R8UB 1T8EA 1GOCA 3PV8A 2PYJA 3V6HA 2GIRA 4FJHA 1HQEA 1RT4B 4LQ9A 5JXSA 4DEZA 4MIAA 1S1WA 2DPJA 2YNHB 3C94A 4RNHA 4NLXA 2YNGA 3BQ0A 4MK8A 4DFPA 1RTHA 3DLEB 4ED6A 5KTQA 1C0UB 3FQLA 1MU2B 3ITHB 3H5SA 4URSA 3V6DA 5J2QB 1JL1A 4NLTA 2IA6A 1KVCA 5KT3A 1TKXA 3DRPB 3ZSYA 4IG3B 4NLUA 1X9SA 1TVRA 2E9RX 4DSFA 4KRFA 4M95A 1ZBHA 1VSHA 1IKXA 3ULDA 2FVSA 3O4NA 3LALA 1S1UB 1RT7B 4JV2A 4KAIA 5KT6A 1S1TB 4WZMA 2WTFA 2D41A 1VSDA 4JRQA 4FJXA 4Z4IA 1UOCA 2VG7A 4Y34A 3DLGB 1UWBB 2FJXA 2UVUA 4IKFA 1D1UA 2VG5A 4E89A 2RF2A 4IG0B 3AO2A 2W7PA 3VQ5A 2WONA 4DTJA 5FRMA 4R0EA 2AGOA 4K50A 5DLGA 1S5JA 3NBPA 4MK9A 4KV8B 2VWKA 5EWEA 2FVPA 1KVBA 4F4ZA 3VQCA 2Y1JA 3DI6B 3U6FA 2LSNA 4IH5A 2YNIB 3QZ7A 5KFDA 2XI2A 3S3MA 4HUEA 3M8QB 4YQWA 4M45A 3QIDA 3TI0A 5DG9A 3H4BA 5C24A 3HYFA 4KO0A 4NRTA 4DTNA 4FVMA 3H08A 1KHWA 4Y2AA 1O1WA 2G8FA 1VRTB 4DTXA 4OL8A 4QCLA 4J2EA 1JXEA 2ZKUA 3UR0A 5EU7A 2VG6B 3M8RA 3SYZA 3H5XA 2BRLA 2W9CB 2ZE2B 3QNOA 3RB6A 4N47A 4Z0UA 1Z25A 4HUFA 4KI6A 4Q5VA 4C8OA 1BI4A 4RUAA 4H4OB 1Y97A 4K8XA 4B8AB 5F8JA 3RRGA 4ED0A 3S3OA 4FW1A 4Q0BB 1TKXB 4XO0A 4F4KA 2ZD1A 1HYSA 4YR0A 4CF2A 2ILYA 3VQDA 3MEEA 4CGGA 1SL1A 3KJVB 2FVCA 3QYYA 4J2BA 5KFNA 1YVFA 4B08A 2DFHA 5J2MB 4ECVA 1LW0B 2RPIA 3TAMA 4XIUA 3SFUA 2JEGA 4QPXA 4CJTA 1N5YA 3KLGA 4CEDA 4FZZA 2BR0A 3HVRA 4NYFA 1TL3A 3CIZA 4KKOA 4DF4A 3MECB 1D9FA 1JLGB 3M8PB 3NGDA 4CESA 4M42A 4DTRA 3EPGA 4C8KA 3CVKA 2Q3SA 4ZMMA 2XWYA 4KAZA 1L3UA 3IS9B 3SQ1A 3M9NB 1TGOA 1QE1A 1QUVA 4C8MA 4RW8A 3V9XA 3RB3A 3THVA 4CF0A 3RBDA 4RW4A 2D5RA 3GIJA 1CZ9A 4JV0A 1L3SA 5F8GA 4DMNA 3VQ7A 3DYAB 2XY8A 3MEDB 2GBZA 3CFRA 3QGIA 4CJQA 4B9MA 3AVAA 4J2AA 5HRPA 4W5TA 4U7CA 3GYNA 3BSOA 2B6AA 2OPQA 1RT4A 1HARA 3VA0A 3DRRB 4B9SA 4OJRA 3KD1E 4PUOA 5HROB 3KLIA 1D5AA 3OYNA 4DG1A 3HP6A 2XCAA 2ZE2A 2GV9A 2DFEA 2W8LA 4CIGA 3F9KA 3GV5B 4DSIA 5F9LA 4H4OA 4W5NA 1KSPA 2JLEA 1NK6A 4CK1A 3M8SA 1WSEA 4CEFA 3RMAA 3SZ2A 4IDKB 1SL2A 4CJ3A 4RZRA 5EWGA 3QERA 4HHTA 2IM2A 3KHLA 3V1RA 2DY4A 4RNMA 3I5CA 4N76A 3IG1A 1LWCA 4MKAA 4CGDA 4K8ZA 1RDBA 1C1CA 1KLNA 2QKBA 5C42B 4M94A 4OKKA 4KI4A 3KLFA 3QLHA 1GOBA 3QEIA 4Z4GA 2HNDB 4DQPA 1RBSA 1UWBA 3BQ2A 2KFZA 4CEAA 3AO1A 3MR5A 2Z1JA 4ZP9A 4DQQA 4ECTA 3KOAA 5C5JA 3RB4A 4IFVB 1WSIA 3QIPA 2W7OA 1XR6A 3CDEA 1F21A 3LP0A 4IR9A 3QETA 3SUNA 3DI6A 3V1OA 2QE5A 5DQHA 4NRUA 2RKIA 3P83D 3QEVA 3OYKA 1J54A 1JL2A 1VRTA 3VQ4A 4I7FB 1N6QB 4YR2A 1LAWA 4CJVA 3MXIA 5EUHA 1YT3A 3P1GA 4IH6A 2UVWA 3VQPA 3F73A 4CF1A 1VSKA 3RRHA 2PYLA 4ZPAA 5KFKA 2R8KA 1C0MA 4PUOB 5KG7A 2HVIA 2W9CA 3KLIB 3G0ZA 4DSJA 3V9UA 4M3UA 2HWIA 5C25B 3QO9B 4Q0BA 4ED7A 4YMEA 5F8MA 1JLFA 2WB4A 3NGZA 2ZD1B 1HYSB 2HAIA 4KHSA 2E6MA 1TK5A 3MEEB 4BE1A 4GVMA 3KLEA 3IN5A 3NH0A 1JXBA 4CGJA 5SWMA 4M41A 4IDKA 1T03B 5J2MA 4Z4HA 1W9HA 2G8VA 3OL9A 4KBIA 4YP3A 4IH7A 3QESA 2G8KA 2XC9A 4WFXA 3EPIA 3MEGA 4EO8A 1RA7A 1VRUA 4ZVHA 1EX4A 4E7LA 2W42A 3QINA 1NK8A 4QOZB 2ATLA 4NYNA 2G8WA 4NCGB 1TL3B 2HNDA 3SQ0A 4IG0A 1ASVA 3DLBA 3K5NA 1JLGA 3M8PA 4KE5A 4FLZA 3KLGB 1RAJA 1QHTA 1NK5A 3CJ4A 4ECUA 4CJKA 1IG9A 4HKQA 1BHLA 5D3GA 4O0JA 4ID5A 5CYMA 4J9NA 4ECZA 3OYDA 3UDLA 4FCYA 3CJ5A 1T94A 2ALZA 2W9AA 4XPEA 4FJLA 4KREA 3UPFA 3C6UB 3LP0B
chains in the Genus database with same CATH superfamily
3MEDA 2FQQB 1W97L 2VQEJ 2X6SA 4YB7A 3MM9A 2HHXA 2RKIB 1FWKA 1H2VZ 1QVFR 1IQZA 1HRHA 1DTTA 2LA6A 2QFIA 3KNAA 4B9LA 1ASWA 2CFXA 1SVDA 2B6AB 4DQIA 4DPTA 5F9NA 2EK1A 3LPYA 5BPNA 4P9SA 2Z1GA 2CQ3A 4JHDB 1BI4B 4B02A 2LXIA 3QFPA 2NZTA 3TTFA 4USHA 4E7KA 2QA1A 3KHYA 3BZQA 4ES3A 1JLAB 1NWKA 3HJVA 2ZJRQ 1U6BA 1HBMA 4CLYA 3OXFA 4JKDA 1PAEX 4FYYB 3T1YJ 4F67A 3WNGA 1Q8LA 3UCZP 3Q8VA 4FKYA 2MQNA 3BUZB 4O3PA 3VEWA 5AQOA 2YKOA 1AT1B 1UA1A 4XH1A 2BJ8A 4ECQA 4HTJA 2IMWP 2AEJA 2F4VJ 1MWYA 3QATA 4BGAA 2V2ZA 2IPOB 3BB5A 3OYAA 2RDDA 5I42B 4KH0B 3FEZA 2GO9A 1TAUA 1XWLA 2XI3A 3T1YF 3RAXA 2ETJA 3CJ9A 4HWIA 2B0GA 4MFBA 1GTHA 4YUDA 5GADI 3GR1A 4AE5A 2V9WA 3E1YA 4CIFA 4G1QA 4LQ3A 2XQCA 2ASYA 2ZOFA 1BOTO 4JI7F 1M5HA 2HWHA 3DYAA 5ETSA 3NCRA 4GKJF 4J5OA 4I6WA 1QAXA 3N28A 2HBMA 4QYZK 3ILIA 1EKEA 2WUSA 1V3RA 3AA9A 4V19X 3CJKB 3HI0A 1RA6A 2V8DA 1GOAA 4JI7J 2PMHA 3NF6A 1NZAA 3NGIA 1N88A 1NHVA 4UQGA 1N32K 4FN5A 1D9AA 3DKDA 4QWDA 3FCWA 3TQ1A 4JI0F 1T6DA 1TL7A 3VWSA 5M2RA 2WHOA 2O5DA 1VQ6N 2BMBA 2LEBA 1LWFA 1SQGA 2B4UA 3TUZC 4CECA 3AJ1A 2UXBJ 4FJGA 4F4WA 5CHIA 3OS0A 1QAYA 4XTTA 4M7XA 3UKRB 5KPTA 4CHQA 3HCXA 4F0KA 1FXLA 2VHGA 4DR1K 2D0OA 2GIFA 4FNIA 4B3RF 3GJSB 1CJKB 2HBJA 4K2XA 3FUYA 4ZHRA 4XDCA 3TYTA 1N0VC 3WIVA 2CNNB 1KD1O 1HQUB 2UXBF 2AJ1A 2XSJA 2HRUA 4OHYA 3QFHA 4I2QA 1RWUA 1NO8A 2J6UA 2MHEA 5CCLA 4K4YA 2YNIA 3G82A 2Q3PA 3C14B 3M8QA 3FC9A 5JS2A 1NGAA 3CCLN 1OSDA 1VQ4S 1FF2A 1ZBIA 2BBEA 4H4MA 4TXSA 2C1EB 3QBCA 3W3SA 2IVOA 2EFVA 5J1EA 2XHWA 2D74B 3UN3A 2NNWA 2OANA 3SQ4A 3IA0A 2V4RA 2FJDB 4ECYA 1IKVA 4LSZB 1HR0F 2HYIB 3U1NA 3I8BA 2R8GA 4DU8A 3MXHP 5B0FA 7AT1B 3GWCA 5EXWA 3AD9C 5CCMA 3KHRA 1RT2A 3LDNA 2HWTA 5CR4A 1T03A 4JI8K 4ED3A 3CJTA 4OV1A 2CGJA 4BROA 2V5HG 3E51A 4UOCA 5F8HA 2XMAA 1CC8A 3C16B 1P90A 3MCAB 2FBTA 3KLHB 4LF7J 2DGSA 2QYCA 3N4WA 2KXHA 2KG1A 4NXMF 2J76E 2IS3A 4ID1A 2LECA 4R5PA 1PJ5A 3BGRA 1YI2S 1OY9A 3K2YA 3LP1A 5KT7A 3IRXA 3P49B 3MM8A 4IO1A 1KCFA 1XHXA 1FK9A 1YITS 4I64A 4J9RA 1B70B 2PEBA 3A13A 3GONA 2E9ZA 1E4FT 3ZSQA 1IBLK 5IWAF 4NLVA 4OIXA 2N7YA 1TK8A 1FJEB 5H9FK 5KOXA 5AZJA 3OTOF 1X8DA 4X64J 4CIOA 4ILJA 2O8DA 1AFJA 3P4UB 4HTUA 3ETMA 1P9YA 5CA5A 4DL2A 1KP6A 3QGPA 2K2PA 4OX7A 4Z7YA 1YIJS 1N56A 5M2PA 5LMUJ 2J8AA 5KQ8A 4DF8A 2LQJA 4CZKA 2ZJRL 3CJ3A 2H5JB 1I5OB 3GIMA 3KMQA 4WU3A 2EKYA 2IAJA 2RUGA 4CHNA 4CYUA 2ZH6A 3DLLQ 4CLZA 2UUCF 2MQMA 4O0NA 1L3VA 1R6YA 3EKUA 3AODA 3Q8QB 3ZT1A 2W2QP 3N4QA 3K0SA 2H5EA 1HPZB 1WACA 5CD4H 2YHXA 3T5HA 4N77A 2BUNA 1G3OA 1S9EB 1QD1A 2P5VA 5GAHU 1TAQA 3ZT3A 2DXDA 2MTLA 3GFHA 5FDLB 2QXLA 4ZK7M 3O4WA 1RYRA 4E19A 2CPYA 3UD3P 4ISGA 2HK3A 1URRA 2MPUA 2J9DE 3A12A 2P9SB 1GLFO 3ENQA 2DHGA 3UQSA 2CWKA 1U48A 1B9FA 4LSNB 2E1MC 4PYDA 4DS4A 4K43A 4UOFA 2NYHA 3KWIA 3T41A 1K8AT 1VQOS 2GO8A 1Q81T 3KKFA 2D0BA 1NOZA 3PJWA 4CFDA 3LPUA 4P6QA 3HM9A 2UUTA 2E88A 4LIRA 3LW5C 1X31C 2X1GA 1F1BB 1X5TA 2HZAA 4JRPA 4ZVRB 5GAEP 3AVKA 2DTUA 1KLMB 3WEEA 3JAMO 1D0EA 2OD6A 1JLFB 1AB8A 1M90O 1C1BA 1TKZB 1MROB 3GR0A 3PX6A 2AGPA 2BJ9A 1HBNA 1ICEB 3LOUA 4HHJA 3DDNA 2BDPA 3TZZA 4HH0A 3HI9A 1Z2ZA 3W0LA 5SZTA 1RDRA 2ZH9A 1FJGJ 1YDLA 1UFLA 3FZBA 3WNHA 3FGUA 2GCFA 1TUVA 3VAJA 4C98A 1KOOA 2JEIA 3L2QA 2FTRA 3J81Y 4FVUA 1U47A 1N34F 3AOBA 2KYZA 2YTCA 5GAGP 2AV5A 4QWBA 4CE9A 1YJVA 3ZTOA 2D3UA 4B17A 2HFNA 2BX6A 4ISFA 2CQPA 3TWHA 4ELTA 4CJFA 2D3ZA 4P74A 1RTJB 3R9LA 4KTZA 5E3QA 1SJ3P 2QO3A 4U8YA 4ZVTB 2RE2A 1W7WA 1VSIA 1YJTA 2WSCC 4EGLA 3TPQA 4AL6A 1GMUA 5KFVA 3RMCA 4DTUA 3NOCA 4FXWA 2HIQA 5GMKa 2R8HA 2PDAA 1FVSA 1RBAA 1YJRA 1WLJA 4J9MA 5CZ2A 1YQHA 4QR0A 2X51A 4BRMA 3TX0A 1P9QC 1HMVA 3V2UC 2QYGA 2OPSB 2YHBA 2YXLA 5LMUK 2BEFA 1Y64A 1LCUA 2GQQA 1RT6B 3R5JB 2ZOMA 3J80O 4NLDA 1NRKA 4OKEA 1BDGA 2Z2ZA 2XS2A 2V63A 1VQ7S 1IKYB 1HKBA 1MWZA 3G86A 2KDOA 3J7ZT 4RU9A 3KMSA 1WSRA 4ZN3A 4OV6A 2V67A 2MKSA 1R43A 2P9NA 2JLGA 1RWXB 3G71N 1EXQA 1LWEA 1WF1A 4QWCA 4EWTA 4MQ3A 3MEGB 3JQMA 1X3NA 2A3ZA 1CS4B 4KFBA 4GY2B 4BRFA 1B7FA 2NRRA 4M5LA 3Q0AA 3HJFA 4M5DA 3MMBA 4ZPTR 3I56S 2UVRA 2HF3A 1X4BA 5L1KA 2DPIA 3CCMN 1C6VA 3DXKB 2DNKA 4DPXA 3ENWA 3U3YA 2FZCB 2ASOA 1M5VC 1GFWB 4ALZA 1TUWA 2UV8A 3J80Y 3VAGA 2YKMB 3QSIA 3NEKA 4WYLA 4WWSA 1UAXA 4OMFG 4CJ4A 1HBOB 1HQEB 4B3SK 1UP1A 1N32F 3D7EO 4FPAA 4FF3A 1J5EF 1Z26A 4O44A 5FLXO 4NO7A 4H0OA 5KFLA 3VALA 2OI2A 4LJMA 3I5AA 2A42A 3L2RA 4LF8K 5C15A 1SKSA 3QMLA 4NMXA 3D0HE 3AO5A 3ALYA 3I56N 2HB5A 3VGLA 4I9QA 1UWAA 5AR0A 4DSKA 2FHMA 4RW6B 1DQ9A 4PAAA 5F41A 4X66F 3AGRA 4YY3K 2X3DA 3PEJA 2WAQD 4DU1A 5D4OA 1L3KA 1X4DA 5L1IA 4IFEA 2E9TA 1LAVA 1H72C 4O8KA 4HLBA 4JI1F 1YTAA 2WC9A 2VQFF 5K8OA 6FD1A 1SKRA 2QGFB 3BGFA 1XHZA 2NUHA 3RVCA 3BBBA 2O4IA 1KDNA 4KC5A 3QT5A 1WDTA 2ZBCA 3N6NA 3I0RA 3NGTA 1K9MT 1EB0A 3BKTA 5M1OA 4Y6IA 1B92A 1EETB 3FRYA 5B0GA 1BU6O 2XMTA 2DNNA 2WSFC 3EVMA 2YCHA 1U09A 1KONA 5C24B 4JUZA 1O51A 2DBBA 3GIIA 2IVNA 1NSKL 1O6XA 2R7YA 4JI2J 3H1VX 4CJLA 2OHDA 3OT9A 1WTFA 3NKYA 2A2CA 4OPAA 1YWXA 1CEZA 5K9FA 3OVAA 3V4IA 4CLTA 3T1HF 1VFJA 3M1VB 4X65K 2G0CA 1JLAA 3HZ6A 4LFBK 3I5BA 2Q1NA 2IBKA 4LF9J 2SXLA 4ED2A 2XS5A 2C2EA 2YKNA 2YY3A 4DLGA 3SUOA 5KPZA 3S6EA 3LDPA 2MLYA 2U2FA 3AVLA 1IBKF 3TQEA 1ZH5A 2J7UA 4DL5A 1LW0A 4Y1DA 3TAFA 3IG1B 4UOHA 3O2IA 3PJXA 3H0PA 2H4WB 2DNPA 2JH3A 2KRBA 4HT7A 4PQAA 5BR9A 5KG3A 3N5BA 3ENAA 2CGLA 1HYZA 1SC4B 2DNRA 2XLIA 4KHRA 4CIEA 2QA4N 1SV5B 1VLOA 3HSZA 1M5KC 4ZIVA 3W1YC 3C65A 3P39A 1YVUA 2RMLA 4WIIA 3MM8B 4J2DA 3CCQS 4OGCA 4DL3A 2CQDA 1ATRA 3SDEB 2F9TA 1LK5A 2YQ1A 3LTOA 3ZCMA 3U9ZA 1B0PA 4IRDA 2I6WA 2BJEA 2O8CB 1QAIA 3AOCA 2XNRA 5ADXH 4JKGB 4F4YA 2NLXA 2M3DA 3GP9A 1ROFA 2MY8A 2DNZA 3BKUA 4F0HA 4IQMA 1PIEA 3QBXA 1VDHA 4DN9A 3KK2B 8ATCB 4FLYA 5JVGL 1N33K 3M30B 1K73O 1VQ8N 2MLXA 3SFGA 3OLBA 2FJBB 3BQ1A 4KB7A 2FHOB 4CYUB 1DQ8A 4Z37A 2F8TA 2MB0B 3GJTB 4RG8A 3ZZTA 4CGFA 2UUAF 3DCAA 2VZ9A 3UR3C 4NXNF 1I51B 1P8GA 2EFGA 4B1UB 4E1NA 4AXJA 3MCSA 1CXQA 3ETOA 3RBXA 2M2BA 2HG4A 1ZS6A 4DFKA 2MGZA 2R8JA 3M2UB 3S8SA 2V2VA 4LF5F 1FW6A 1LXJA 2DRAA 2VFSA 4NLGA 3VOVA 2B9WA 1VYAA 1UVJA 2DNGA 2RQKA 5KT2A 4ID5B 2ZH5A 1AFIA 3FFIA 4DV5F 3DLJA 4FS1A 3OLAA 4DSEA 3DM2A 3I96A 1MMLA 1S76D 1IXKA 1MMNA 1RDCA 3M1FA 2FLNA 3I31A 5SUHA 3OFFA 2CPFA 4P2MA 4DR6J 2U1AA 1XK8A 1LWXA 3IBCB 2RVJA 4Q43A 3THXA 3CQ8A 8RUCA 4PWDA 2CYYA 4WYBA 2JX2A 1R0CB 5M1PA 4DU3A 4KHMA 1K0VA 2JC1A 1YI2N 1SXLA 2LFVA 1CULB 4B9TA 4FWSA 1RWMB 3BYPA 3SEOA 5EN1A 2BACA 3AFGA 3QGGA 1VQKN 3KUGA 4LMZA 3HTVA 5KAKA 1NJWA 4IOCL 2HLTA 1P1LA 4B3OB 3LWLA 3HFZB 3R5GA 5A0YA 1JMTA 3KK1B 2X3GA 1VC0A 1N8RO 5DGAA 5KFCA 3HT3A 4QIWD 4OLAA 3A3PB 1NDKA 5KG0A 3SV4A 5AQFA 1VBZA 2Z8QA 3KTQA 3E66A 3MXJA 3ILOA 4WFAQ 3BGRB 1VK8A 2PE8A 2KJWA 1SL0A 2KM8C 4AHVA 1RT3B 4H0PA 4DR5J 4QIFA 2FLLA 4JI2K 2C2DA 4BE2A 1S97A 4ECRA 4LR8A 5J2NB 1HX1A 2QC3A 1U6FA 5D8HB 4QWEA 1TP7A 4USJC 3X3UA 3LM9A 1C0GA 1XNRJ 2YQ3A 4CNYA 2FJEB 1NOYA 3FZLA 3CJQA 1O8BA 1KD1T 2UP1A 1X5OA 3VGSA 3LWMA 4DV2F 4RUCA 1OKJA 4WE1B 4B3RJ 1YJWN 3VQTA 4EBDA 1ZBSA 1WKKA 3ZSZA 2RIJA 3ZLJA 3ZZZA 2IM3A 2OO4A 2P6SA 5HMZA 2DGUA 2GC8A 5FPEA 3CCUN 1YXQA 4MIBA 4BLGA 1A7GE 2NQPA 2F8EX 4JV1A 3TJAA 4AQYJ 4A8KA 2X78A 4G65A 3FCVA 2B9EA 2NUBA 3SMPA 3MPWA 4NA3A 1EO1A 3CCES 4YOTA 4Q45A 4YOUA 2P9SA 3D1OA 4U8VA 3CCVN 4X4VA 1N5QA 3CCMS 4IO8A 1BGXT 2XY7A 3L09A 4PPDA 2RRBA 4F3OA 4ILLA 3VV2B 1UA0A 3WQPA 2FC8A 3GZ7A 2A10A 4FZXC 3HOTA 1M1KO 3D0PA 2CQHA 3PYEA 5AQTA 4CEEA 2DR7A 2VG6A 1S1VB 4KHWA 3DLLL 1SUQA 2KO1A 4PA1A 2VUGA 2BW2A 3A2FA 5BYQA 2PBDA 1DGKN 3H40A 1JJ2M 5TKWA 1NSAA 1NH7A 3VZIA 3BKFA 2LXUA 3DRPA 1YTUA 4NLYA 1JKHA 4FPRA 3CD0A 4LFAF 1G2EA 1QS4A 1SJQA 1H6KX 4YY3F 1CZBA 2UUBF 1VQLN 1YRTA 1PJ6A 3AV9A 1BMQB 4NCAA 3VTIA 4PL7A 4JYAK 3PSIA 3CDBA 3JS6A 2W25A 1OMSA 2DR6A 2GVZA 2H9ZA 1BCMA 2IGIA 3V4MA 3WX8A 1FDDA 2K7KA 4QW9A 2Q6CA 3PACA 3R9PA 2VL1A 2I8EA 1M1GA 3R6LB 2LP4A 1VBKA 4X4SA 4ZJQA 1TK0A 3W3DA 3RAQA 3CFPA 1NDCA 1PO6A 3G6YA 4CZGA 3ENBA 5MLCV 3CCEN 4N41A 2EC0A 2L9WA 5LXRA 4CI6A 2PFUA 2QMWA 2HHWA 4JS4A 3F56A 3K57A 4WQ5C 1S6PA 2WZ1A 3G6XA 5B0AA 4B3TJ 2UU9K 3TUPA 3B54A 5ETQA 1WUUA 1VISA 4KGXB 4TY9A 3R27A 3AY9A 4R8UB 1XNRK 2EFNA 2R42A 2DR9A 5E84A 3V6HA 4FJHA 3GSDA 4A59A 4DEZA 1N36K 3LUYA 2F7TA 2MY7A 3EDQB 3VAIA 4EFHA 2D9PA 3E9LA 1OO0B 1SBRA 3FQLA 1B4SA 3V6DA 2EI5A 5J2QB 1TUGB 1T0TV 3M1VA 2JFKA 3ZSYA 3ZZUA 3H3NO 3OFEA 1WC1A 3NCQA 5AQUA 1HLWA 4OHZA 1F9EB 3U1MA 2QWQA 1ZBHA 1WDDA 3ET6A 1IKXA 1UJ4A 2FVSA 3O4NA 2P9NB 3LALA 3D2WA 3W65A 1G6BA 1HI0P 2ZFHA 4KAIA 5KT6A 2WTFA 1VSDA 3TTCA 2VQFJ 3ID8A 2VG7A 1EIYB 1UWBB 2FJXA 1I94K 1U2RA 3EGNA 3O44A 2G2ZA 3FBEA 1NPPA 4DTJA 2W41A 1Q7YT 1IWAA 2L41A 3NBPA 1EZZB 1KVBA 3DI6B 1UVMA 2MQPA 3BO3A 2AYMA 2XI2A 4YDXA 3OTOJ 5IQ6A 4M45A 1YJNS 3H4BA 2MZTA 4KO0A 5AE1A 4DTNA 3GJRB 4FVMA 2VODA 3H08A 3C8YA 4Y2AA 1FX4A 2O8FA 1YX2A 4N8NA 1N5TA 1JXEA 3UR0A 1VQKS 3IWNC 3WQTA 5EU7A 1KQSR 3M8RA 1YK9A 3SYZA 2PAVA 3H5XA 2O8CA 4M8LA 2LKZA 3QNOA 1OYEA 4CW7B 4LRCA 2O8BA 4KI6A 3VGMA 2C3UA 5F8JA 3RRGA 2IHR1 3S3OA 4Q0BB 4JYAJ 1UMJA 2PGCA 1IBMF 4JKHA 4H5TA 3QRPA 3MOZA 1SL1A 4LF6J 3ZXWA 3KJVB 2FVCA 1FRLA 2LCWA 5KFNA 2J7WA 5BR8K 5HMWA 3MX2A 3NVKA 4C2MA 3SFUA 2DGTA 2B9YA 1E6VB 5A8KA 3KLGA 1Q82O 2K3KA 1NSQA 3FSXA 3GCWP 3OXGA 4KKOA 5EY4A 1JLGB 1YRUA 3NGDA 2UUBJ 3O6QA 3EXYA 3R97A 2VBYA 2ADBA 3IS9B 2BVZA 2X1AA 3MCPA 3G6ES 3PSFA 5EX5A 1QE1A 2CWXA 1UJ6A 3E2EA 1IR2A 3V9XA 2R7TA 1TYQB 3RB3A 4XEIA 4RW4A 1PGZA 2ZDPA 2D5RA 1CZ9A 4CO3A 4PXEA 4JV0A 5F8GA 1NPKA 3PCOB 1HFEL 3UVJB 1R6VA 4S0MA 4B9MA 2M9KA 4JN4A 5JICA 4H0VB 3VEOA 3GYNA 3GB0A 3KK7A 2OPQA 2XLKA 2CG8A 4M1KA 2C3PA 2GX9A 2VF3A 3QJPA 1BC6A 1HLUA 3W8GA 5D6GA 3OR1B 5HROB 1RWVB 2HGMA 3KLIA 3AXMA 4GKKF 3HP6A 4ILMA 2XCAA 3TA2A 2ZE2A 3DU6A 4IEEA 1O5JA 1S22A 4UOGA 2W8LA 3D7SB 1S0VA 3F9KA 5L38A 2BUPA 4NYOA 4H4OA 1KSPA 1RAGB 3WEEB 1NK6A 3OTBA 4CK1A 5DDQC 1IJEB 3O3LA 1O13A 2KVIA 4LF6F 2VCPA 1BA1A 2Y1RI 2V52B 2IM2A 3AA8A 3GFXA 3T1HJ 1WOPA 2BJDA 3V1RA 3IG1A 4MDAA 2A2DA 4DR2J 2QFJA 5C42B 3QEIA 4NEYA 4C1NI 4JI2F 1UVLA 2KFZA 4CEAA 3D3CJ 2Z1JA 1AW0A 3H20A 4J90A 3DWLA 2A6OA 3KOAA 2KRRA 3DGPA 1ESVA 5TKYA 2PO4A 5B08A 4JI6J 3LM2A 2E5JA 1FE0A 2A3JA 2MZSA 2QE5A 3EUNA 2CNKB 2VWBA 1VRTA 1ZZNA 1WJ9A 2LMIA 1YT3A 2UVWA 3GFYA 4M5GA 2CQBA 3W2WA 4IJNA 4X4QA 4NEZA 2PYLA 3NCPA 5HSPA 1C0MA 2HVIA 5AXLA 4QOTA 2W9CA 3G0ZA 3V9UA 4DI6A 1KR4A 4JI5K 5HN0A 2MKYA 5EX0A 3NGZA 1NEEA 2ZD1B 5HK4A 2E1ZA 2E6MA 4YS2A 1Q86T 4BE1A 1HHSA 3AQOA 9ATCB 2HZCA 2DPNA 5J2MA 4Z4HA 2LQBA 3PFOA 4MO4A 3OL9A 3QESA 4UUXA 3VAFA 3P96A 4JKBA 4WFXA 3W63A 3EPIA 4ZVHA 2MZRA 4AUKA 4UZCA 2ATLA 4NYNA 1S12A 4RJVA 4NCGB 4YDUA 1TMMA 1X3MA 4DR1F 2QL5B 1ASVA 2KHOA 4FLZA 1RAJA 1RZMA 3BBCA 3CW2C 1T6CA 4QS7A 3NS7B 3N9UC 2ZC4A 1X4FA 2LVWA 1RCXB 2XBPA 4ID5A 3A3NB 1XNQF 2Y0SD 3KUHA 2V6AA 1HNXJ 2ALZA 3ZZOA 4DV3F 2W9AA 2DH7A 4KREA 2RNEA 3LDOA 2W01A 3C6UB 2PMWA 3LP0B 5IV4A 4RPFA 1QDUB 3NGYA 4WQ4A 2HS0A 3VVTA 1WOOA 3R2DJ 2OTJN 2ZBPA 5G0RA 1BCOA 3IAS9 2UUWA 1UVKA 4EEYA 5GAHP 4DV4F 5L9NA 4OX9F 5LMUF 1HNWF 4CHZA 3UNYA 4DDFA 1GTEA 3ISNC 5I3PA 2CDRB 1JLBB 4CJ5A 4DG1B 3DRRA 4ZVEA 1NNEA 3PFEA 3IFEA 1RBVA 1VK0A 2NR0A 3W62A 4QYRA 2CJBA 3FR0A 3TTDA 4H5VA 5C2GA 1HNZF 2MKIA 4HVJA 4Y3CA 4FBUA 1JKHB 3BZKA 2CJYB 1R0AA 5KFBA 4CD1A 3SNNA 4DR3J 4KB0A 1Q7LB 1Q18A 3K58A 4DR2K 3KLEB 2ALYB 1RWPB 1NK9A 3OHAA 5JMVA 5ETKA 3D4JA 4LF9F 2YKPA 5CAAA 3DFEA 3MMCA 4TY8A 3J7A1 2YPZA 2I5JA 2PEHA 4F9OA 4FJMA 4ZVFA 5LXYA 3GYGA 4ECSA 3FNNA 3Q2SC 1RWWB 4IOAQ 2DNOA 1YITN 2HBQB 2Z56B 3DOMB 1NKEA 1J5EK 1N6QA 3I32A 2OMOA 5KFPA 5IWAK 5T7LA 2NREA 4CK2A 3F5TA 3UD5A 1SQFA 3ZETA 4C8ZA 4BC5A 2FY1A 3FBFA 2FF3B 4WFYA 4K4XA 2V68A 2PA8D 1QVGR 3MFIA 3A5LC 3PIPQ 2HMIB 1FTCA 5E41A 4NLSA 2UU9J 2V7YA 1Y3KA 1UTAA 4DUZF 4PWUA 4UW2A 3NAIA 4WFNQ 3OS2A 3QNNA 2F9JA 1DLOA 5CH7B 4RKUC 1PC5A 3TVYA 1RWNB 1EKRA 3JYTA 1X4GA 2IBOA 3H45C 4TLRA 4QBUA 2GEMA 1U49A 4CLWA 1RAEB 2XY6A 4YDDB 4DU7A 5K14B 2XSFA 3CXCR 4JI6K 3R1HA 1XMQF 4I1TA 5AQXA 1TFYA 1PCAA 2MJUA 2BJ7A 2CZ4A 2QLWA 3NL0A 2BGGA 3CJSA 5F8LA 3G25A 1GMWD 2VWJA 4JI7K 3LQVA 2R2UA 1W2IA 5C12A 5D3GB 1U1OA 2KL8A 5AQQA 5LSRA 1IM4A 4ED4A 1ZBLA 2A6MA 4CERA 5I4MA 1S99A 2AP1A 4WTYA 3KJFB 5DO2A 4OI0A 4FWQA 4DUYF 3TANA 4LF7F 1HWIA 4RW7A 1NDPA 2C28A 1T44A 3HVWA 2PT0A 3CMQA 1MSWD 3OTCA 4B9UA 1VQPS 3DRYA 3MCOA 4DZDA 3NMUA 4A8QA 4P7VA 1U45A 5KFXA 4EBEA 3VMFB 2QG9B 2XO7A 4CZHA 1TL7B 1K1QA 4DOZA 4ZPWR 4OLBA 5D15A 1R7IA 3PX4A 1HNXK 4JKFA 3RR8A 5GADU 3UKRA 4CT8A 1K47A 3AHPA 3AOAA 3TNVA 4DL0C 3M6UA 1E6VA 5H9EK 2MGZB 2NXUA 2YJFA 1N34K 1KC8T 1V5IB 4ISEA 2E5LF 4BR4A 3VEXA 2OCEA 4BACA 3Q22A 2OFGX 4FWRA 2YH0A 3JTPA 3FBCA 4JD2A 3C2PA 2QWPA 1RKIA 2VPYB 1NK7A 2H48B 4ED1A 3KDNA 4YHHF 4ZJOA 1RDDA 5G4DA 1RHQB 2KW4A 1RT1A 4ETXA 3AVHA 3MPDA 3HVAA 4CFCA 1A6LA 2HVZA 1XI1A 4LF2A 4B1XB 4K4TA 3TR5A 5BYRA 2X1BA 3O08A 3A8YA 1FXDA 4HH1A 4U96A 2Y3YA 4FF4A 4C1NK 4NASA 2GIQA 3AGKA 2C2NA 4UY8O 2DEJA 4JHDA 4A2AA 4PWDB 4ZKAA 3EKSA 3V6DB 5BXIA 3PKYA 5HROA 4JV5J 4Z4FA 1MWMA 1M5SA 3V6JA 3AB2B 1Q8IA 3CM6A 4NXNK 1TL1A 4DCPB 2CPHA 3C15B 2PA3A 4DV1K 4NA2A 2HBLA 3W9JA 1OSCA 4X64K 3VQ8A 5JVHQ 4DTOA 1WSGA 1CJVA 2Q79A 2Z1HA 4B1ZA 2VFUA 3TVZA 3ZFVA 3UIQA 2VPXB 2UXCF 3OS1A 4XPCA 2YJEA 2ZBRA 3N6LA 1S4EA 3OYEA 4CRJA 1KTVA 3UKUA 3TVKA 3BH6B 4L3QA 3NF9A 3MECA 2ROGA 5FROA 3CCJN 4MLEA 3IGNA 4Q8FA 1RABB 2W4PA 4FYVB 5FPMA 3MN5A 4OZ2A 1IKWA 1OYDA 3V9WA 2IRXA 3A0IX 4X62J 1F9HA 3C14A 1MMDA 2UXDK 5A76A 3SXLA 3NCIA 2GJFA 3QWPA 3MF5A 2DGOA 1VQMS 3BYRA 5KT5A 3TA1A 2P1JA 5J1EB 2QSFA 5KFAA 2CZ9A 1PILA 1GXTA 3MN9A 2LQ8A 2XMVA 3RB0A 2XRIA 1OVYA 4DR4F 4M3RA 3ULEB 3THWB 4PRFA 3OXLA 3KDOA 3EZWA 2CH5A 4URGA 2HGLA 3FZMA 2J0XA 1NGIA 4RBVA 4BWJA 1H73A 3CERA 3AVJA 2XCPA 1VBYA 3PYGA 5A6WA 3KKRA 3CC7N 3CQXA 2E66A 4J9KA 3IXQA 2FUG9 4ZPDA 4G3IA 3W61A 3X1LB 4ZP6A 4RBTA 1LWFB 1ZPWX 3KJVA 2NRTA 1Z4UA 2R7UA 2RJZA 4OFZA 3D2EB 2RAQA 1FA0A 2Q66A 1C1CB 2ASDA 4E2FB 4LC9B 4IRKA 3Q7CA 3VQ9A 2MXYA 3IGVA 1UEVA 3BP8A 2ATCB 2YPYA 4FWPA 3J8AA 3M5RA 4C0BA 4A5AA 1RSCA 2JEFA 3V9ZA 2W2OP 5HANA 4CM2A 1IO2A 3C7NA 2OTLS 1N4LA 4DL6A 4CO5A 2YWEA 3FLCO 1Q8BA 1U0HA 3BBFA 4DHYA 2PI4A 3M6XA 3G82B 1NGJA 4H0YB 1S1XA 3OFHA 4ZCLA 3BEXA 4DR7J 1I3AA 2CG4A 4YHHJ 3PRBA 1NU0A 4ZTJA 3CCRN 4TNOA 3K8VA 4CT9A 3T5JA 4B9VA 4ZCKA 2OPQB 3GG0A 4Z7CA 1AUDA 5M2UA 3ICLA 5G0RB 5HI7A 1S0MA 5C0YA 2DYAA 3CO9A 4YOXA 3MXMA 1AZSB 2E5LJ 3R7BB 3SUQA 3R3LA 4J9LA 1KAXA 1EJ7L 2YNHA 4OZ0A 3DOLA 1Y4ZB 1NGBA 3VHQA 1OVQA 4CVNE 2ZH2A 3ITHA 4ZITA 1EP4A 1OQ3A 2YWGA 3CC4N 4DN0A 4DQ8A 3TSQA 1VOMA 2Q0RA 1JLCA 3SQ2A 4P2FA 2DKOB 1IVZA 5E0OA 4H4KC 1HWKA 1CJUB 2CIMA 5HO4A 3MTKA 2V4QA 2VJVA 1JIHA 3ISZA 2JWLA 3CE8A 1X4EA 1UFWA 2L08A 1B0TA 5KFMA 1BE4A 4ECXA 4O0IA 2DH8A 3OL7A 1UPPA 2APOA 1N5SA 4EYHB 2R7WA 1JQGA 1FXXA 3LP1B 3T9ZA 3CD6S 1SAZA 5D77A 2NUUG 2OZMA 2CPXA 1CPZA 2VIHA 1S7IA 1RTJA 2F63A 3ID6A 2QWMA 1HNVB 3LPTA 3TAQA 1UW9A 4KGKA 2RILA 4RUBA 3SIPB 5EDWA 4G6VB 4E0DA 1DTTB 3HSCA 2AJ0A 5ETOA 4JS5A 3L9ZA 1WNSA 4PKHA 3L7PA 2ZM6F 2GMJA 4MDBA 4I67A 5LMNJ 2N3LA 3KK3B 3L4BC 4A8FA 2HBYB 2BOPA 4M63A 4C11B 5J2QA 4RW9A 5A2QO 4LBPA 1WHYA 3SCLE 3OVNA 1HBNB 3WHIA 2EG2A 1XMQK 1S72S 1HYVA 4Y2MA 3ZSRA 1RAHB 1A5WA 1AROP 5DQGA 4LF5J 2DHSA 2VYPA 2B7BB 3BJYA 3PR5B 5DMRA 2VG7B 4J9UE 1Y5NB 1OH5A 5IQQA 1HWLA 1PKUA 1I39A 4AHUA 4KFBB 1HI8A 2O8EA 2BQ3A 1FHTA 4PQUB 3OYHA 3L7OA 2QA4S 4IZ9A 2G8HA 2ZJQQ 1WAJA 2RE1A 4GVBA 2W2NP 2Q2RA 2Q97A 4GV6A 3D54A 3J7AN 4OZLA 3IDHA 3OSNA 1NM2A 4B3SF 2ZVSA 3CCQN 2G9OA 3EN9A 3ZTQA 1NB7A 1FKPA 1JNZB 1RDWX 2L9DA 3BF1A 5GAEI 3LANA 1JLBA 2PSZA 4BQLA 2XEXA 3AA5X 3CEDA 3VF4A 3CD7A 3S1TA 1FNOA 3QNWB 3SJHA 3ZNUA 5DM7L 4ILRA 4CWBA 5D78A 1U1QA 2HSEB 3HHLB 5IM0B 4JI3F 1KAYA 3QMQA 2F4VF 1LOUA 3O6WA 3MTJA 5GAEU 2Y9HA 4FPBA 4C97A 2F5GA 1NSPA 4RW6A 2UUCK 5KPRA 3IM9A 2R4FA 3O9QA 3DOKB 5KG1A 2E7XA 2CA9A 3DAWA 4F0MA 3VTHA 1CS4A 3WXKA 3MMCB 4WFAL 3ULHA 4GC6A 4RWWA 3G2XA 4F2RA 1T9XA 3QZ8A 1N52B 1VIOA 4WF9L 1RBRA 5LL6d 2LEAA 3R2CJ 3TW0A 2W8KA 4NMLA 1U2VB 3GSIA 3PHEA 2EFPA 2BE9B 2ASLA 3G96A 2E4LA 2HBKA 4L75A 4PXCA 3DOMA 3HLUA 4OYIA 2IVMA 3LAKA 4IFYA 3B8AX 2ROPA 5LJWA 4DXLA 4AF1A 1GK8A 2YKMA 3DU5A 1IG8A 1WN7A 2H65B 1HBOA 1RAAB 3N01A 1Y7PA 1J5OA 1JX4A 2VPZB 4MIWA 4X65F 3SBTA 3NFAA 4FM1A 5BN8A 2R7QA 4CNZA 4JI0K 4JI4F 3T5LA 1IBMK 1RT6A 4Y2KA 1WG1A 1IKVB 2DFFA 2FZGB 5DZ6A 1YJWS 1ZOTA 4B1VA 1BQNB 4DTMA 3E3XA 3TZXA 4WYWA 2JGUA 1DLOB 4AHTA 3KG4A 1RHKB 1TL1B 1J9AA 3KHGA 1VAZA 2NPIA 4H54A 2DO4A 3AVCA 1S9GA 4ZOSA 2QTWA 1LWEB 4DR7K 3ADAC 3TRGA 3WXIA 3VR1A 3I9ZA 5DDPC 1N5YB 4NPOA 4USVA 2A6AA 2CAJA 1TUUA 2CQ2A 1RDAA 2VC0A 4NLRA 3D45A 5HVHA 5M1NA 4WQ4C 2BW7A 3ENOA 2J9CA 4O3OA 4B9NA 4DV5J 3I4PA 2Z2MA 3CGIA 3QRRA 4HACB 1Q9YA 4AHCA 2AWZA 3PIOL 4ANDA 2J8SA 1E3MA 2ACMA 4I6MB 5JUMA 5A2QY 2EWHA 3DN9A 2D9OA 1Q8KA 4OX9J 5B0EA 2ZWPA 1HR0J 2KI2A 4OJGA 4BVPA 1LKZA 2QL9B 3CMAS 3NE6A 4DHVA 3U8XA 1I6JA 1H38A 5DDRC 1RTZA 2IJFA 3HZGA 2Q0UA 3FEXB 4P52A 3SUPA 2CJ9A 1VSMA 2WOMA 2MQQA 4MO5A 3DMJB 2UZAA 1VQ9S 3DLEA 1YG0A 4DV0K 2ZBIA 2FDNA 2GTDA 1RBUA 4KQZA 2J4RA 1GT8A 1EARA 1NDLA 5H9EJ 3ZZPA 5KFOA 2E6LA 3MHYA 2IAJB 1FEEA 4AHRA 3O1LA 1SI9A 1N34J 4PKGA 3CJCA 4LY7A 5C7PA 4JK9A 5AT1B 2BE2A 3CCUS 4Q44A 2W4CA 3B6PA 3T1AA 4HDGA 2GJIA 2DVIA 2AQ4A 1S49A 4EUVA 4UY85 1R3NA 3VAHA 3A3OB 3Q8PB 3VQEA 2WB1D 4LF4F 4DR3K 3NDKA 1LV5A 4RNNA 3W8PA 2AA4A 5FDLA 2D0AA 2V7ZA 1NK0A 5DGBA 1JLQB 1IBLF 1S59A 3NMAA 2IC3B 3QJLA 2QWRA 3QEXA 2P9KA 1LQ9A 4CH7A 1R59O 1HHQA 3VQ6A 2AP6A 4FDFA 1Z1ZA 4KR0B 3O9TA 3VF0B 2NRXA 4F4XA 4MK7A 3SMZA 1A0OB 2YNFB 5FPNA 1ZA1B 2QA4G 3J81j 1AUSL 1K6YA 3W9IA 1NMNA 3MPUB 1X1PA 3THXB 3CUNA 2IDOA 1EX8A 1X4AA 3L0QA 3LF0A 3U7JA 2GQCA 1AZSA 2V51B 3EICA 3HVTB 1WUAA 3FJ2A 4TU7A 3KD5E 4OPKA 4A62A 1NLVA 4CJWA 4BRKA 3CCWA 3GDQA 3D0GE 4OYWA 3P45B 4OZNA 3GG4A 4OZ5A 3LO3A 1F3VA 1PSDA 1QSSA 1OWXA 1OIAA 1S77D 4DB3A 3O3FA 2DO0A 1U7LA 4BC7A 2QWNA 3VESA 2G8IA 2PY5A 3UW1A 3K9KA 5CYQA 3CJ8A 5ETLA 1N0UA 3CD6N 5A0YB 1LFPA 1S1TA 1QM9A 3TAMB 1N32J 2FHJA 4GC7A 4U67Q 3G9CA 3CF5L 3V6KA 4NI2B 2BKPA 4ELUA 2I5JB 1CJTA 1GLJO 4FM2A 5THWA 2E7VA 4K8RA 1Q5VA 2DIVA 5BRFA 4FKXA 2C22A 3OA9A 1NCLA 5KFFA 3PW5A 4EP4A 1OH6A 4ETZA 4ZIWA 4WJBA 2K7JA 4ZPVR 4PL8A 4O4GB 2ZUAA 3NRBA 3I82A 5MAOA 4OX9K 3HULA 4FM0A 2BZ2A 3A8JA 4QIGA 2O1PA 1NJYA 5KGXA 2EBGA 2F1FA 2G1HA 2R2RA 5K5MA 1C2PA 1S1WB 4I68A 3THPA 5F8NA 1CQNA 1ZM4A 2VU5A 4YOYA 1VSFA 5BPLA 2KZZA 1VI7A 3MM6B 4USWA 1UFKA 3OYFA 5IFMA 1UZDA 5BJRA 3KK2A 3SQGB 4Y1CA 4OLPA 5KRSA 3NNAA 4YR3A 1QQOA 4L72B 3RAMA 5I3QA 3D6FB 4MLHA 1K44A 1MG7A 4MKVA 4WE1A 4UY8T 2ZJPL 5DS7A 3PW2A 2XZWA 4ZP8A 4CFAA 4IDHA 2OP5A 1PYTA 3D2EA 4WKRA 3AD7C 4MH8A 3DLHA 2G0JA 3JYTB 1FFSB 4BVOA 3D67A 3HXMA 1RTDA 2M7SA 4DV7K 1RWKB 2HURA 2YV0X 4DU4A 3PYDA 4ZLPA 1BWFO 4ZDNA 2EX3A 1X0FA 3O9SA 3L8BA 2E7WA 3HPGA 3C7NB 2KZMA 3HKWA 4CHOA 4JI0J 4M5DB 2K1RB 2HVDA 3L3VA 3AO3A 1RTIA 2HNYA 1UZHA 3G6VA 2HGNA 3BN7A 4Z4EA 1ITGA 5IT9O 4DV0J 2LXFA 5LSLA 4KHPK 4EYIB 5AQPA 4HCBA 3VGKA 1KFDA 3K17A 5B0CA 1T8EA 1GOCA 1GXLA 4CZJA 3PV8A 3TUIC 1HQEA 3WBZA 1RT4B 4LQ9A 4CTAA 4J9VA 4MIAA 1N5VA 2DPJA 2YNHB 5EGYA 2ZZMA 3LL3A 2RB7A 3ZTPA 5B09A 3WC0A 4MK8A 1RWOB 5F0UA 4P73A 3ITHB 4URSA 4BC3A 2MHNA 2Y8WA 1JL1A 5HATA 3DRPB 2DY1A 3NG8A 1W2BM 4IG3B 4NLUA 4BGBA 2HIYA 4ILHA 1ILYA 3SQOP 4JI6F 2AJ2A 4BBYA 4DV3J 1VSHA 3ULDA 1RT7B 1T9WA 2XLJA 2QLXA 4OX6A 4JV2A 5FIIA 2H3GX 4AM6A 4FJXA 4Z4IA 1UOCA 4C6AA 3F41A 2UVUA 2OSRA 3C66A 1D1UA 4BC4A 2VG5A 2RF2A 2R3VA 4Y28C 1F5CA 3NXZA 2GZOA 3AH6A 4K50A 2OGUA 5DLGA 1S5JA 2VWKA 1U2VA 7FDRA 4F4ZA 2GHVC 2IYGA 3U6FA 1C4CA 1RU2A 2ERRA 2LSNA 4IH5A 3QZ7A 5ETVA 1RHRB 1FRHA 1YIJN 1RLDA 3S3MA 5HL7L 3HZEA 3TSUA 2O3DA 3QIDA 3TI0A 3LH2S 4PCQA 1R8HA 1YJ7A 1KHWA 2YBVA 1HL6A 2G8FA 3J81O 4QCLA 2L3MA 3N5FA 4ES1A 3CMES 1IUJA 4B3MK 3D0IE 4K0KF 2BKOA 3MGJA 1VQ7N 2KKHA 3THTA 3A5OC 4N47A 1FJ7A 4HUFA 4K7QA 3R6MA 4C8OA 2VQEK 4C11A 4K8XA 3SCIE 4MJKA 4ED0A 4YB5A 4XO0A 2QI2A 5AQVA 3JAMY 2RD5C 2QSWA 1WG5A 5HAOA 4WQ5A 1DURA 4ZLNA 4WFBL 2KU7A 3Q7BA 3PG9A 3ZZ0A 1U1MA 2MQOA 3AAQA 3QYYA 2MZQA 4QJVA 1CJVB 4ECVA 1LW0B 2RPIA 3JQKA 2I9SA 3NNCA 4CJTA 1TMJA 1N5YA 2GGPA 5A8WA 3CCSS 2M0GB 1X0PA 2FSJA 2BR0A 4FZZA 3RSEB 1TL3A 1FERA 3CIZA 2AYGA 2HVEA 1IJJA 3M8PB 4CESA 4M42A 4DTRA 3CNQP 1SIWB 4C8KA 4KAZA 2LLZA 4XAKA 1L3UA 4LRBA 5GAHI 5GVQA 4JAXA 2DGXA 5HJYA 2ZNZA 1H7XA 3KJQB 3RBDA 1NGDA 3MM9B 1M1KT 2R7VA 2XY8A 3L95X 4NLCA 2GBZA 3CFRA 4M5HA 2W7AA 3CCLS 3FEYB 3EXCX 2B6AA 2FLOA 3T1HK 2GJ2A 1NH8A 4GKKJ 3MM5B 3VA0A 1BD6A 3UO0A 2BA9A 4PUOA 1D5AA 2ZWHA 1JNRB 1X60A 5ETNA 5GIPA 1ATSA 2EFOA 4C3LA 4B1WB 4CIGA 3GU0A 5F9LA 4P72A 2Y0BB 4OHWA 2A41A 2C2MB 1WSEA 4I0WA 1SL2A 4IDKB 3QJJA 4RZRA 2H51B 5EWGA 5E2QA 2XULA 4AQYF 1VQ9N 3I5CA 1LWCA 1RDBA 4DR3F 4LF4K 1B99A 2XG8A 3H2UB 3HHLC 4YB6A 3VENA 4KI4A 4Z4GA 3QT8A 4DQPA 1WBDA 1RBSA 2K3IA 2GVDA 4KHPJ 2CPIA 2VKRA 2I38A 2KB2A 3AO1A 2QW9A 4ZP9A 4HHHA 4ECTA 2M8HA 1KS2A 2R9LA 2ZGZA 2P9UA 1T9TA 1RHJB 3GBTA 4BG9A 2W7OA 3W2VA 1RFQA 3D6RA 3SBGA 1UKUA 3SUNA 5D0HA 5KOWA 3FVYA 1OH8A 3DNCA 5DQHA 1PYSB 3W9HA 3MK6A 4FWLA 1TTHB 3UVJA 2FGCA 3HBTA 3N0VA 5CZVA 4BRHA 4GVEA 4ZVSB 3HHDA 3GJQB 2B7CB 3VQPA 4CF1A 5IZHA 1VSKA 1YJNN 1KBRA 2OMLA 3RRHA 1Q86O 4JBCA 2DJWA 2R8KA 4NX9A 4Y2IA 1UCNA 3RRKA 5KG7A 3KLIB 3PKMA 4DSJA 4UUWA 4M3UA 4LFCK 1H0HB 4Q0BA 2D0PA 3I87A 5AQYA 4W92B 5DJBA 2HAIA 2XMJA 1FJCA 1EQYA 2X1FA 3IR5B 5AQJA 3A5NC 4GVMA 3TJ9A 3OPKA 4BR9A 5C2FA 3M05A 2OTJS 3LDLA 3NY0A 2G8VA 4KBIA 4YP3A 4DV6F 1WF2A 2XC9A 1QHAA 3EGWB 1U2FA 1CJUA 2MJNA 1EX4A 2W42A 1MW7A 2G8WA 1BO5O 2HQDA 3K5NA 1KOHA 1JLGA 2IYIA 3MX5A 2V8VA 4C3MA 1BHLA 2AHOB 3UDLA 2C3MA 2CJAA 1T94A 3VPZA 3C6HA 3SAFA 4XPEA 4FJLA 2Q36A 3UPFA 5D4LA 4UZBA 1J6ZA 3RJMB 1VJQA 4JNEA 1DQAA 3MUMP 2HZVA 2KG0A 2NXJA 2ZDOA 3I9V9 3PRDA 4ZN1A 1TV6A 4J37A 2OPRB 4OHVA 3ZTRA 1MWKA 4LRDA 1FO1A 2ZJQL 1FRKA 1XNRF 1GLBG 3IFRA 1BUXA 3MR3A 1HKAA 4ANEA 2WOMB 2HFUA 2IM0A 2QL7B 2GMHA 5I3UA 1Y3JA 4F02A 3QAUA 2DHHA 2KT5A 4BS2A 2V0NA 1ZM9A 3K7RA 1F6TA 1FRIA 3ZX0A 2RH3A 5HMXA 1CSJA 1ZBUA 1RAOA 3FZFA 4HEA9 3RG6A 1T3NA 1Q81O 4H5RA 1JK9B 1YJ9N 2AGQA 3E9PA 4QU6A 2QA2A 3M9OB 3VERA 4AL5A 4FVCA 5DM7Q 4DR5K 5CE3A 4JLHA 5C42A 3BR8A 3CT9A 2OLWA 2RS8A 2WRMA 1EWQA 3O9RA 5KFHA 3GV8B 2J9DA 3U3GA 3MAHA 3T69A 1RGIA 4PG6A 2E1AA 3CPWR 4KTQA 3TEHB 4FK2A 3P8BB 3U9DA 3O1WA 3OY9A 2CRLA 2HPUA 1FWLA 3RBEA 4FPIA 4DQSA 3QICA 2O8EB 4IOAL 4JI1K 1WSJA 2RQMA 4HDHA 2VQFK 1NNDA 4OYAA 1VSLA 2CQIA 3AJ2A 2HFOA 2F7VA 1FK9B 1RTIB 2VBWA 1QQCA 2YHYA 4ZP7A 4EZ6A 5H9FJ 4CJEA 2ZM6K 4U9RA 4I2PB 3TSPA 2JWKA 4DV2J 2XMUA 2QN6B 1RT5B 5GMEA 1IBCB 1ELOA 4FOEA 2I7PA 4P2XA 2OH2A 5B0DA 3ENVA 4CH1A 3LZIA 3CG7A 4LF4J 1HBUA 2QX0A 1NXIA 1GLDG 4FK4A 4O5BA 5KFTA 2FBVA 2L48A 4DV1J 3CC2S 5KI6A 1LW2A 1GEHA 4FJJA 3QO9A 3AO4A 4W4MA 4CM0A 1WC3A 3KJNB 4A8XA 3AA2A 3CO0P 2XMMA 3L2WA 1REVB 1FWPA 5KG5A 2HHUA 3HD1A 4JKAA 3QPIA 4MYTA 4R79A 2FBYA 3BV8A 2A0FB 5T14A 4EFAC 1WORA 3RUBL 3OHRA 5L1LA 1U0SA 4CLFA 3QRQA 3H59A 5J1NA 2WW8A 5BRHA 3PW7A 3OVBA 3MM7A 3F0NA 4YOVA 5F3ZA 3KG1A 4TY8B 2GHWA 3VCDA 2HRYA 2RF2B 3DLKB 3CJ0A 4UF4A 5AXKA 1FFGB 3FDSA 3GILA 4MKBA 4FXDA 1VQON 5KFIA 4BWMA 4O4GA 1K8KA 3CC7S 5KFEA 2W6KA 4ITSA 5JLHA 4OZ1A 2FF6A 1FKOA 1DRZA 4FJKA 3J81U 3A8EA 4K0KK 1U1RA 1P6TA 4DMZA 1Q5YA 5ADXA 5K8PA 5GADP 1T11A 4JKEA 5B7WA 3N79A 2N82B 2Z30B 1EHWA 2ZGYA 3SAGA 4U7UD 2HFZA 2GNKA 4EP5A 4ER8A 2A5XA 1QTMA 4DUZK 1UAWA 4DR4K 3ASMA 2IY5B 2KFYA 3H5YA 1L5UA 1F2HA 3FZKA 4O8UA 3IBFB 2FJWA 2DT9A 3PZPA 1HR0K 4LR7A 1YHQN 1BWEA 1ZPVA 3LA0A 2ZWOA 2KXFA 3CCSN 1F60B 5C10A 1BUPA 3IWXA 4YNQA 4GV3A 3U27A 1IKXB 2CPEA 5AE3A 1EQ0A 1CQMA 3D2FA 3FQKA 4WK3A 4NXMK 1IN0A 3OVSA 2ROEA 2YHAA 4ZVQB 3JXOA 1HJRA 1K9MO 2XHBA 3GQCA 1JCEA 4KHNA 1CC7A 4LH4A 3ATVA 4FW2A 4EZ9A 3IUCA 2Z1IA 4AH9A 1FI4A 1MWQA 4MFBB 2IIRA 1WHWA 3DDIA 4JI3J 1TZ0A 4B9QA 3NBPB 2F8SA 2CQ0A 1WEXA 3K8WA 4WP3A 2HHTA 2LEPA 1FE4A 2X6NA 2QK9A 4QYZJ 2G0IA 3OTOK 1SIZA 4W5QA 3NWGA 5T7LB 4CP5A 3R6GB 2I1RA 5KG4A 5ELZA 3BZCA 1WTBA 1VGYA 4CO2A 2VBXA 4QS9A 1XERA 4RLEA 3QSYB 4DJBA 1WI8A 5F0WA 1XC9A 4FYDA 2HNZA 5KFRA 2OYQA 2NZ4A 1M5PC 4KH5A 1Y5LB 2DNQA 2W9BB 1X9WA 2VICA 1RCOB 1OY6A 3Q23A 5BYSA 4K4SA 2IJNA 4A8SA 3OTDA 3IAYA 2J0SD 1MA9B 1ZC6A 5L8RC 5HJXA 3OL6A 2ZHAA 3RWUA 4RCHA 3EGVA 1Q53A 4EHTA 4USKA 2HOEA 4C8LA 1D3WA 2VFVA 3BSNA 3MN7A 1RISA 2NSCA 3L4IA 4IOXA 3BDEA 4FJ8A 4F2SA 1NU4A 3OL8A 4DCJB 4O3NA 1NUEA 1IBKJ 3AD8C 2XSJB 3AAWB 4I2QB 2AIRB 2UVVA 4NLWA 2GAHC 4FWNA 1IM6A 4TSXA 3M6WA 3D1QA 2V94A 4K0KJ 1YSJA 3KVGA 1RADB 3SPYA 3CJ2A 3VGVA 4O44B 2CNLB 3FRZA 1N48A 5RUBA 3DDKA 3MMAB 2FB0A 1Q7YO 2F96A 1S48A 3PRVA 4RWXA 2GELA 3OQ2A 4QR1A 3LGNA 1WG4A 3HFKA 4X64F 2E29A 2OELA 4J9QA 4OO1J 3AVMA 3EE3A 4CDIA 2P2CB 4F26A 4OYBA 2MQ8A 2HHSA 4N56A 4GMKA 5HP1B 1TL4A 4NYZA 3MMVA 3D5MA 1QVFM 5GINA 3UN5A 1ATNA 2UXDJ 3BY5A 1VHXA 4CEOA 3PW4A 5EWFA 1ZETA 1FJGF 3NGSA 4CF8A 3I4HX 2DNHA 5LJ3Y 3CB4A 4LF9K 4AHSA 5CYJA 5HQMA 2M4MA 3VF2A 3J7YP 4KHQA 4LD0A 3Q2TC 2J7KA 4DV6J 3SLCA 4X4OA 3MN6A 3TZWA 2Y1LB 3M8WA 3RTVA 3W7BA 1CLFA 2W40A 3M2RB 1DKGD 4JKCA 4FJNA 4ZCMA 1F3FA 1NKBA 1RU1A 4ANCA 1Q95G 3R8YA 4Q2LA 3O80A 2HFVA 1TV6B 3EM1A 4YOWA 4LRAA 2AX1A 3LDSA 4CJSA 3UE5A 3HP9A 2PZSA 1TKTB 3DRSA 5ETTA 3HT0A 2KTQA 2NXNA 3MM6A 4OJ1A 1U6ZA 1RB0A 5AQSA 5C25A 3ULEA 3Q83A 2DGWA 4OJ3A 4LF6K 4NXMJ 3AVGA 2FHKA 1QQMA 4C4WA 1CXUA 5ETRA 4OI1A 4NOHA 1U1PA 4NCBA 1S57A 3K59A 3H3OB 3PHTA 5C2CA 1DBDA 2J9EA 3BS9A 3HSDA 1VHFA 4LFAJ 1LWCB 4K4VA 4GO7X 3M32B 4O3QA 4ZPBA 3VQAA 2WW4A 4BDZA 4CEZA 2OA8A 2RU3A 3G6EN 2GVDB 1FRJA 2Y1IA 1YKWA 1IR0A 1JXLA 3UKUB 1SCJB 5ETPA 1R8PA 2P9UB 3NWRA 2EC2A 1HJOA 1NMEB 2AX0A 2BE7D 3U1LA 2B9XA 1HNZJ 4A46A 1IKWB 4ED5A 4JD2B 2K1RA 3NNHA 3BGOP 1VMBA 1K8AO 2ZKTA 1PYOB 5DM6Q 3KFWX 5AFUA 5DDOC 3H8YA 4F4AA 1KWMA 4LSNA 5D0GA 2VA3A 2UU9F 1GNKA 3WQUA 1DHMA 4L73A 4ZPCA 1DTQB 3VQSA 4P71A 3E01A 1KHVA 5LJ5Y 4LIWA 4FJ9A 1HNIA 1J5EJ 1Q9XA 4IKAA 2G1DA 4ATNA 1V4SA 1BLUA 5IWAJ 3S9HA 1C0UA 2DRDA 1JB0C 1BQXA 4LF7K 3PR4A 3ZT2A 3KYLA 2VONA 3M30A 4E3SA 1GX5A 4BDPA 2BRKA 4L76A 5HRSA 1XNQJ 2O67A 2AT1B 4FYWB 3T9NA 3HPHA 5FRNA 3C15A 1TVRB 3BR9A 3EYZA 2DD8S 3G8TA 4B3MJ 3KWGA 2DNLA 5HLFA 4DV7F 5A6PA 2A40A 5DK5A 5F8IA 1R0AB 3G87A 3SV3A 3T3FA 1S6OA 1NGHA 1RYSA 3UCUP 1REVA 4ECWA 1T9VA 2COLA 1KRPA 4X4PA 3FBBA 1WAFA 5AJ3J 5KG6A 1H74A 3QEWA 4Z94A 3ZT0A 3PXGa 4C23A 4NA1A 3M8ZA 4CLPA 1NKCA 4PKIA 2BM1A 4KB1A 2OD4A 1LEOA 2ZZTA 3A8KA 2EPIA 4ICLB 4EI2A 3O4QA 5DZ7A 4BR7A 2DRBA 2GS8A 2F3JA 3QDKA 1U26A 3L3CA 1AXQA 2YX1A 1RBTA 3UWTA 4FLWA 3D9BA 3QT7A 4GKJK 3S7RA 1XTZA 1HHTP 1Q4RA 2UV8G 4KSEB 5F2RA 4DWIA 1ITPA 4DX8H 3RW7A 3PO5A 4BE0A 4X62F 3JSMB 1S5ZA 2FSNA 2HVHA 3OW2R 1S4FA 4OYOA 5L1JA 2NRWA 2YNGB 5AFUH 1HNWJ 3MFHA 2VDHA 2XGPA 1SKWA 2E1CA 4PG4A 4UQTA 1GH8A 4WZQA 3POTA 3EWGA 3NS6A 4B1YB 4K2JA 2HHPA 4HT5A 1JLCB 4ZVGA 1OQ6A 3TP2A 2MYFA 1IKYA 4B3OA 2QWLA 3VVUA 4ENOA 2EW9A 4FNHA 3G4SS 3OHBA 4NWBA 1BIZA 4M3YA 4CZEA 4BDYA 1X9MA 2D3O1 2J6SA 4WIQA 4DPWA 3ELHA 2CDQA 5IT4A 4HYKA 4WFNL 1APSA 1PC4A 3NAHA 1YBTA 2HS3A 1CBKA 2IJRA 3N4PA 3KZBA 4CEBA 3NH2A 3MMBB 3OUYA 5AXMA 1VC5A 5J2NA 3JSRA 3MAQA 2Q31A 4KH6A 2BJ3A 3TAGA 4F3TA 1G99A 3OYJA 1JLEA 4CBUA 4I2PA 3OYIA 4HR2A 2B4VA 1IQTA 3G71S 3N6MA 1YBUA 1UVNA 2PD1A 1WEYA 2DR5A 4YB1P 2HK2A 2VBZA 4JI3K 1B9DA 3RYLA 1V3SA 3OJSA 3MURP 4RW7B 5HBMA 3J7AP 3RBZA 2BQUA 5D4PA 1WSVA 4CJPA 2QZ8A 2AKWB 1H1VA 4TN2A 1KFSA 1MN7A 3WUHA 1NB2A 2J5AA 5J2PA 3WXLA 4USMA 1YBAA 2VDIA 3NOGA 1UEUA 2XHCA 1W2BR 1C0TB 4BR5A 1U4BA 3KLVA 5JVHL 2IM1A 2Y8YA 1VRUB 1A5XA 1EWRA 1FKAF 3EY1A 4LF5K 2ZUGA 1QSYA 3DLKA 4Z4CA 1KQSM 2UXCJ 1VLYA 3M2VB 4DR6F 3B82A 3ZZRA 2F4FA 1WSHA 4R0JA 4ZVPB 3QIPB 3QGHA 1NJZA 4AILC 5MLCQ 2ZH4A 4FJIA 4DUYJ 3MAAB 3W2VB 3EVOA 2VOPA 3ENHA 1X5SA 3OYCA 1EETA 2ZQBA 2V2KA 1WOSA 1YZ6A 2GA7A 1SC6A 4HVZA 1RACB 2ASMA 4CLSA 2FPHX 2MEWA 3KXDA 4WCEQ 2R7XA 1XMOJ 3MMAA 3NMRA 1E6YB 2EKNA 3NGRA 1XQSC 4BQZA 4OYZA 2B4JA 5B0BA 2A18A 4KYZA 4KBOA 3W5YA 3MD1A 5AZIB 5CZXA 2ILZA 1NG9A 4YFUA 1S9GB 2EFQA 4FLVA 1GXUA 4DPUA 3W5ZA 1C1AA 3AVBA 1S0NA 3Q8YA 3BSCA 4H03B 1Y5IB 1ZAWA 4CO4A 1L3TA 5F1XA 1VQNN 1IV0A 3DLGA