1TKXA

Crystal structure of hiv-1 reverse transcriptase in complex with gw490745
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
537
structure length
534
Chain Sequence
SPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pol polyprotein, Reverse transcriptase, Chain A
publication title Design of non-nucleoside inhibitors of HIV-1 reverse transcriptase with improved drug resistance properties. 2.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 145
structure length 534
sequence length 537
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1tkxA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tkxA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tkxA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tkxA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1tkxA05
5J2PA 4GC7A 2BE2A 2G8FA 4DL5A 4CHNA 4JV2A 1W0HA 5HROA 1S4FA 4J9QA 5I42B 1RT7B 3N6LA 3TVKA 1ZTWA 2IGIA 3AVJA 2PYLA 5HP1B 2CJQA 4CGIA 4DQSA 3G6VA 4TLRA 2FC0A 3VQEA 2AQ4A 1J54A 4G3IA 3IS9A 4M95A 2P5OA 2VA3A 1GOCA 5KFMA 3TQ1A 4CJRA 4J9KA 3ALYA 3MEDA 2F8TA 3OYCA 3QIOA 3KLGA 1N6QA 3DOLA 2VG6A 3HXMA 1LW0A 3IGNA 2E4LA 1S1UB 4CJLA 1TL3B 4E7IA 2JC1A 3DRSB 4M3WA 3KK1A 2WOMB 3KLHA 1S9FA 1QS4A 3VQ7A 1SUQB 4DTXA 2FBXA 1S1VA 1RTDA 4FZZA 1JXBA 4G1QA 4RG8A 3S3OA 1VRTB 2XY7A 4DFMA 2E9TA 1X9SA 4PWDB 3WNFA 3OYJA 2XY6A 2BANB 3KJVB 1Y97A 3QERA 1Z26A 4U7CA 4ECYA 4ELTA 4Q45A 4DTMA 3KKRA 3HO1A 3M9NB 3TANA 3RTVA 4KO0B 4IRDA 3TAPA 5KFJA 3BGRB 3KLEB 3BSNA 3DLGA 4ID1A 4ED6A 3IRXB 4LQ3A 4ICLB 2OZSA 5KT6A 3M8PA 1KFSA 1SKRA 2IAJB 1L3SA 2IM3A 3OL7A 1RBRA 3OLAA 3BJYA 2HHTA 1VRUA 3MR6A 3HK2A 1HNIA 2RKIB 4GC6A 3SFGA 3L2RA 1RDDA 1U48A 2IOCA 3WNGA 4K4YA 3HYFA 4FM1A 3MFIA 4NLQA 3V81B 1JLFB 2C22A 4BACA 4FK4A 3U3GA 2ZD1A 1SKWA 2DPJA 2XY5A 3NH0A 4O3QA 1RA7A 4MK8A 3IAYA 4I9QA 1S9GB 1KVBA 3ZSVA 2VG5B 5F8HA 4CJTA 2XY8A 3DYAA 1JKHB 1X1PA 4H4OA 3T5LA 4O4RA 1T03A 4CHYA 5E41A 4E3SA 4HUGA 4CCHA 2Z1HA 4F2SA 2OYQA 2C2EA 4H4MB 4F3OA 3V9SA 4CF1A 1RTJA 3E01B 1NK9A 2W9BA 5J1EA 4FJGA 5J2MA 1HQEA 3OYDA 3T1AA 4WZMA 4CEAA 2O5DA 5CYMA 3SCXA 3ZT3A 3TAQA 4Y2AA 2JEFA 4WFZA 4HCCA 1FK9A 5KG4A 5C42B 4WFXA 2FVQA 3I0RB 1KTQA 3H98A 3HPHA 4R5PB 3NMAA 3RMBA 2QV6A 4YP3A 5D3GA 3HM9A 3RWUA 5KG6A 1LW2A 3NFAA 2AGOA 3H5UA 5T7BA 4WZQA 3K2PA 5HBMA 3KLIB 4ID5A 2ILYA 4M41A 4FLXA 3M8QA 1C0MA 1WSHA 2E6MA 5EU7A 2RN2A 5L1IA 1RT5A 5KT3A 4IRCA 3NF6A 5F8IA 4CEZA 1N5YA 3QEPA 1EETB 3O3FA 4NLXA 4KAZA 1KVAA 4FJNA 4JV0A 4ECUA 3L2UA 1QSSA 3KTQA 1KHVA 4IDKB 3H5SA 1FKPB 3KHRA 2G8WA 3VA0A 2IJNA 5KFWA 1RAJA 2OPSB 1K6YA 1NJYA 3OSNA 3VQPA 3LP1A 3PW5A 4KTWA 4JV1A 4DQPA 1S10A 4OPKA 4TQSA 3ZSZA 1NK4A 3MECA 3KOAA 1OS5A 2KTQA 5KFGA 3NL0A 1HYZA 4TYAA 4DU3A 4J9MA 5KGWA 3IG1B 4FVMA 1BQNB 3TAEA 3CDEA 2D3ZA 3LP3A 1TQLA 3I8DA 3BQ1A 1LWEB 3QZ7A 1CXQA 3O4NA 2NUBA 5C24B 4KKOB 4CIFA 1CXUA 4IQXA 3DOKB 1RTHB 1QAIA 4DTSA 2A1SA 1JLQB 4NLVA 1HMVA 4FLTA 1QQCA 2HHVA 4E7JA 2X6SA 1NK5A 4O3PA 4MK7A 1T05B 3QIPB 5KFZA 2BGGA 2HNZA 3I0SB 3GILA 2HVIA 3SUPA 1LWFB 3G6YA 3CJ0A 3E51A 3KMQA 3O3HA 4OPJA 4O44A 3NAHA 4HKQA 3QGGA 1D5AA 3OYGA 4FCYA 1JLEA 4ZHRA 4ZPAA 4TYBA 4NLTA 4Y1DA 4RNMA 3GIJA 5EDWA 3DI6B 3V9UA 3VQ4A 1GX6A 4LSNB 1EXQA 3OYNA 5KFVA 4PY5A 1NJXA 3M9MB 3AVLA 3S3NA 3RBDA 4FLYA 4OKJA 5I42A 1RT7A 2GIQA 2FBTA 4CK3A 5HP1A 1S49A 1HPZB 5L1KA 3DLEA 3VQAA 2OH2A 1I6JA 2IBKA 3SZ2A 4KRFA 3MEGA 2V4QA 4ECVA 1NK7A 3OHAA 2WB4A 5KG1A 1L3UA 3K58A 1WSEA 3BSOA 4NLRA 4ZPCA 5JS2A 1CSJA 1MU2B 4AHRA 5C25A 4FJKA 1S1UA 2R8GA 1TL3A 3D28A 4DTJA 4U6PA 3DRSA 1S48A 3GV7B 1C1AA 1LV5A 1VSKA 2WOMA 1ZBIA 2LSNA 3G0ZA 2IM1A 4XO0A 3L3VA 1RT3B 5JUMA 1UWBB 2HB5A 4EZ6A 4NZ0A 4KE5A 5DGBA 2WONB 3DMJB 1VSFA 3P1GA 3WNHA 4PWDA 4NCGB 4IBNA 4KHUA 4B08A 4Y2CA 2Y1IA 3I5BA 3PO5A 1CLQA 5F8NA 2FVRA 4RW8B 3CM5A 3ZSXA 3D5MA 1GX5A 1DTQB 4B9TA 3SQ4A 4LQ9A 4KO0A 3D0PA 3OYHA 4DQQA 4KHRA 3RB3A 5F9LA 4JRQA 4DFKA 3DLKB 1JLAB 2QKKA 3IRXA 1A5XA 4DF8A 4NCBA 4ICLA 4XIUA 4F3TA 3UR0A 1ASVA 4WE1B 2IMWP 2D3UA 1TKXB 4RU9A 4MFBA 2W42A 4OGCA 3MXJA 4IR9A 2RKIA 1C1CB 4AHVA 1QAJA 4OKEA 1XWLA 3Q8PB 2D0CA 2YKNA 4AHSA 3V81A 4H54A 2D0BA 2QKBA 4QWAA 2I1RA 1VSMA 1QE1B 3OHBA 3U3YA 3RRGA 1VSHA 3IN5A 1TL1B 4BWJA 1S9GA 1TKZB 3OJUA 2VG5A 4ELVA 4IG0B 4Z4GA 1CZBA 4ED1A 3MFHA 4MIBA 1IKVB 4MQ3A 3S3MA 3KD1E 4DWIA 3AVMA 3V1RA 1EKEA 2OPQB 1Q9XA 1EP4A 1RT6A 3E01A 1HNVA 3M9OB 4EP4A 5KFPA 4K50A 4IH7A 2WHOA 2CKWA 3CM6A 5DG7A 4M3TA 2W8LA 3CIZA 4K8XA 4CHQA 2YNIA 5DG9A 1BHLA 5KFYA 4O4GB 4KHMA 1TK8A 1SH0A 1DTTB 3I0RA 5L9XA 4HHTA 4YNQA 1JLCB 4FLVA 2HHQA 4DTNA 4GMJB 2E9ZA 4CGGA 1BIZA 3TAFA 2XGQA 2EHGA 1S0OA 4CJUA 1BCMA 1YTUA 1N4LA 5KFCA 4FJMA 4CHPA 4CEEA 1BL3A 3QGHA 4RUCA 3AVIA 1HQUB 3CDUA 3NAIA 4IH5A 4RW6B 3V9ZA 2AGQA 1EETA 4EZ9A 1RT1B 1C0UB 1IKWB 3FFIB 2C2DA 1KCFA 2UUTA 4B3OB 1FKPA 4DFPA 4OVLA 4CF8A 3SQ2A 3SYZA 4I2PB 2JC0A 2ZE2B 4CF0A 4YQWA 2AX1A 4OLBA 4RW7B 1D9DA 3UPFA 5SWMA 3IG1A 1BQNA 2AGPA 2HNDA 4J9SA 4WYLA 3ISNC 1LWEA 2R7YA 1WSJA 4KKOA 4ECQA 4E1NA 5KFOA 2JGUA 4B9NA 1JIHA 3PW2A 4Z4IA 3DOKA 1RTHA 5J2NB 4MK9A 5FROA 1BQMA 3T3FA 3TWHA 3CFRA 2XHBA 1ZETA 5KFNA 3OYBA 3UIQA 1T05A 1TV6B 3QIPA 4B9LA 2VA2A 5F8JA 1S9EB 3OS2A 3VQCA 3I0SA 1U09A 1RDBA 5KRSA 4QW8A 1S6QB 3JSMB 4CE9A 4M3YA 5I3UA 3CVKA 4C8NA 4E89A 3QEIA 3AVFA 4DL3A 4DS5A 2HNYB 5J2QB 5KFXA 4Z0UA 3LPUA 1LWCB 1RDRA 3HT3A 1JX4A 3NGYA 3DI6A 4PQUB 1WAFA 4LSNA 4CF2A 1DLOB 1C1BA 2XGPA 2Z1JA 5DGAA 1NK6A 3NF7A 4WYWA 2E9RX 3H59A 4FXDA 2YNHB 3MTKA 1W25A 3NH1A 4W5NA 1BIUA 4FJXA 5JXSA 1J53A 3O4QA 4FBTA 4OGEA 3MEEB 3EPIA 3N6NA 1ZBLA 1YT3A 5DLFA 3K5LA 1R0AB 5KT7A 1S97A 1RDAA 4B8AB 1QHTA 3GV5B 4FW1A 3D45A 3RB6A 3CJ4A 3AVNA 3SUNA 1B9FA 3V9WA 3AO4A 1U04A 3DLRA 3H4BA 4HYKA 1QTMA 4DLEA 1RBUA 2W7PA 1T94A 2B4JA 3MR3A 4LD0A 3PX6A 3G10A 2VG7B 1KVCA 4FW2A 3LZJA 5KFLA 4FLWA 1UWBA 3DLBA 3JYTB 3KLVA 4KFBB 4FZYA 1XR6A 3MR5A 4J2AA 3HVTB 4KB7A 4DS4A 2WONA 3DMJA 2FLPA 2PY5A 3L2WA 4RW4A 3HL8A 1LAVA 4LH4A 2O4IA 4N76A 3A2FA 4NLYA 2XCAA 1DTQA 3TAMB 4K4WA 3MAQA 3KLFB 2ASJA 2D7SA 3ZT1A 2IS3A 2FVSA 3DLKA 1JLAA 4O5BA 1UAXA 4RNOA 4DSLA 3U6FA 2ATLA 4WE1A 3QINA 3OYFA 1TKXA 4O3RA 4ED3A 3OL6A 4FK0A 3RBEA 4KI6A 2UVWA 1BI4B 4CK2A 4DL7A 2A1RA 1XC9A 4M3XA 3H40A 1TL1A 3ITHA 1TKZA 4DU1A 2RDIA 4IG0A 4DMNA 4XPCA 1ASWA 3KHGA 3CFPA 4MKBA 1I3AA 5CZ2A 4DU4A 1IKVA 4KB0A 2B5JB 4ZVEA 3V6KA 4URSA 4KBIA 4FYDA 3GIMA 2OPPB 5DQGA 2KZMA 2OPQA 4BDPA 4E7HA 4W5QA 1SV5B 2B6AA 2J6SA 3UDLA 1C0TB 3AVAA 5KFRA 2OPRB 4ECZA 3NF8A 4Q0BA 4R8UA 2RF2B 3DRRA 4Z4HA 3QLHB 4IFVB 4NYZA 4O4GA 2YNFA 4K4TA 4DSIA 3G86A 1ZBHA 4IFYB 2W9AA 3V6DA 1K1SA 2HHSA 1A5VA 1IM4A 2G8KA 4J9PA 4ZP9A 1IKXB 3OVNA 3C6UA 3L2QA 4LSLB 4OL8A 5KRTA 3SJJA 4J9NA 2G8UA 4E1MA 4Q8EA 3KK3A 3NAEA 3BSCA 4CJKA 4B9VA 4RZRA 4ED7A 3CJ5A 4AH9A 3VQ9A 4O0JA 3CWJA 5KFDA 1SKSA 2WRMA 2DTUA 5HRRA 3KHHA 3T5KA 4CGDA 1F21A 3AA5X 4CGJA 5EWGA 1WSIA 1HQUA 4E7KA 4Z4EA 3HVAA 4RW6A 1J9AA 4OJRA 4NYFA 4NYNA 4CJVA 2D0AA 5CYQB 1C0UA 3FFIA 4CJQA 3ASMA 4F8RA 2IM0A 4F4YA 4B3OA 2QE5A 2R2RA 2HMIA 4NLWA 2Y1JA 4LH5A 4CEBA 2KZZA 4DSJA 4I2PA 1NJZA 3ZSWA 4QWDA 2ZE2A 3CJ2A 2ZQBA 3SQ1A 2QXFA 2DY4A 1S1WA 5KT4A 5K14A 4RW7A 4KSEB 3PW4A 1YTAA 1RTIB 5KG7A 3AVBA 5FRNA 3LDSA 2YHAA 4GVMA 1S1XA 1KRPA 2KQ2A 5KG5A 3PX4A 4FJ7A 4Q44A 1WAJA 5KI6A 1ZYQA 1D9FA 4ECXA 4YR2A 1RYSA 4NLGA 3LWMA 3N6MA 1CZ9A 2F96A 3EZ5A 4EBEA 4DF4A 4EO8A 3RB4A 1T3NA 4QOZB 3AO3A 1S9EA 3QNOA 3VQSA 3SV4A 2RPIA 3MEDB 3BR9A 3JSMA 3KLGB 1FXXA 4KHSA 3G6XA 1EX4A 3AO2A 1XI1A 2YV0X 3AA3A 4IOBA 3Q8QB 2HHWA 4ZPBA 1W9HA 2HNYA 5J2QA 4ELUA 1LWCA 4C8LA 2IM2A 2GIRA 1RCHA 3QIDA 3KLHB 2R8HA 5KTQA 4PQUA 3VQ8A 2R2TA 2XWYA 2FJVA 4NLDA 1IH7A 1RTDB 3EYZA 3RMAA 2O4GA 2YNHA 4G1QB 4EP5A 4QWBA 1JLGB 2W8KA 4Y1CA 5KFTA 3PJWA 1U45A 1SUQA 4KHWA 4K4SA 1L5UA 1NKEA 4MKAA 4CJWA 3DM2B 3QEXA 2AWZA 1VRTA 4IKAA 3AVCA 3NBPB 3DLGB 5EWFA 4I7FB 2BANA 2R8KA 3KJVA 4H8KA 2I5JB 3L3UA 4BE1A 1SL0A 2VWJA 4RNHA 4Q5VA 4I2QB 3VQ6A 2BRLA 4DL6A 2FLLA 1VSLA 2KW4A 4C8MA 4ZVHA 3BGRA 3KLEA 1VSEA 2RDJA 3VQDA 4FBUA 3PR4A 4GW6A 1VRUB 4JS4A 1HNIB 2G8IA 4DTOA 4YR0A 3NH2A 4J2EA 1X9MA 5HLFB 2VG7A 4F4XA 3CO9A 2IAJA 4NRUA 3JYTA 4K8ZA 2ZD1B 3HVTA 4PUOB 2OA8A 1Q9YA 3OS0A 4YMEA 2GC8A 5HRNA 4K4ZA 4FLUA 4ZPDA 3DYAB 5KGXA 2P51A 4N41A 1JLFA 3LWLA 1B92A 3DLHA 3TI0A 1JL2A 2ILZA 5KFAA 3KLFA 3ZSRA 4CJPA 1TK0A 4FJJA 3OYMA 2B43A 1JKHA 4N47A 4J2BA 5C5JA 1NK0A 4DSKA 1HQEB 4FJ8A 1VSJA 4AHTA 4E0DA 2JLEA 4H4MA 1RT2B 3Q8RB 2J6TA 4M3RA 4J9LA 4CK1A 2AX0A 4HUFA 4CJFA 4RW9B 2YHBA 2IC3B 3AV9A 3HKWA 4FJ9A 1UA0A 1UA1A 4CEFA 3V6HA 2KFNA 3PX0A 4CHZA 4I9LA 5C42A 3QO9B 4DEZA 2ETJA 3SQ0A 2F8SA 4QPXA 5KT5A 2W9CB 2ASDA 3LALA 4R5PA 3PHEA 2OPPA 4M45A 3AA2A 4ID5B 3PW7A 4FJ5A 3VN5A 2YKMB 1GOBA 1G15A 3VA3A 1SV5A 3SV3A 1XR5A 3C94A 1C0TA 4QWEA 3M8SA 5F8GA 3QEVA 4DLGA 3KLIA 1RDCA 4NLPA 2RF2A 4M42A 3FRZA 3QLHA 1SL2A 4IFVA 4ECWA 5DQHA 2FJWA 4CFDA 3KNAA 3AVKA 1IKXA 5F8MA 4ZMMA 4NCAA 4IDKA 3EY1A 1HRHA 1IKYB 4BWMA 2JEJA 2OPSA 1Z4UA 4TQRA 3OL9A 5FRMA 3RRHA 1TVRB 4TSXA 3UQSA 4OLAA 4KREA 4MH8A 2DPIA 1UOCA 3VQBA 3ZSQA 4NRTA 2F8EX 1J5OB 1TAQA 4HTUA 3RR8A 2ALZA 3OL8A 1RILA 5CYQA 3LP0B 5C24A 2HHUA 2DFHA 1REVB 3F73A 4FM2A 3EPGA 3OSPA 3GIKA 3NGIA 4KTQA 1XHXA 1RNHA 4EYHB 1JLQA 5SZTA 2BDPA 3RAQA 2GV9A 3PUFA 5KFBA 4NLUA 1LWFA 4M94A 1RTIA 4K4VA 2HHXA 4O3SA 3P83D 4N5SA 4IH6A 4ED2A 4AILC 2OZMA 3SUQA 4QAGA 4CEDA 1D8YA 4Y3CA 3KMSA 3DLEB 2VWKA 3WNEA 3AA4A 4IR1A 3OLBA 3T5JA 1WSGA 3MEGB 3LP2B 5KFEA 5DQIA 2WK4A 2Z1GA 2R2SA 3AO5A 3TABA 1HPZA 5KFHA 3RR7A 2KFZA 1HYSB 1ASUA 3LPTA 3MXMA 4ECSA 4BDYA 3ICLA 3PR5B 2R8JA 3HPOA 5C25B 4Q43A 4QW9A 1NOYA 4ECTA 1SH2A 1NKCA 4B9SA 4JUZA 4JRPA 2W7OA 4AHCA 3LAKA 3HHKA 4QCLA 1I39A 5KFIA 1XR7A 3FQLA 2FLNA 2DFFA 1MU2A 4CFAA 3QYYA 1XHZA 5KFUA 2QK9A 4O55A 2FVCA 4OKKA 1JLGA 3HP9A 3CQ8A 4C8KA 3OYEA 4ZP8A 1U47A 1RT3A 4K4UA 1S1TB 4AHUA 1L3VA 3S9HA 3PJXA 4CECA 4F50A 3DM2A 1HYVA 3IGVA 4RNNA 3QGIA 1VSDA 1WSFA 3NBPA 4KHNA 3NF9A 1TKDA 3RAXA 4NCGA 4XPEA 4I7FA 3KK2B 4FS2A 2FBYA 2I5JA 4KV8B 1WNEA 4RW8A 2D41A 3OY9A 3NCIA 4I2QA 3SI8A 1TKTB 1B9DA 1RYRA 1U49A 4NLOA 3FDSA 4DSEA 4MFBB 1S6PB 1L3TA 1NK8A 4TY8B 1QUVA 5EUHA 1QSYA 2YKNB 5HLFA 2G8VA 3C6TB 4CIEA 2HWHA 3H4DA 3I5AA 4DG1B 5F8LA 4PUOA 2ATQA 5DK5A 1SL1A 2V4RA 1C1CA 4WXOA 2UVVA 4DQIA 1RBTA 3NGZA 4Z4FA 3SUOA 1JXEA 4DSFA 5L1LA 3L8BA 3K59A 1IO2A 1QE1A 4CESA 5KG3A 4CF9A 2Q3SA 1EP4B 1RT6B 1C6VA 1HNVB 4TY9A 3F9KA 3FQKA 4CFCA 2IDOA 3AVGA 3PY8A 5HRPA 5FDLB 4F4KA 4IRKA 4KI4A 2YNIB 1RT2A 1T7PA 3H08A 1FKOB 3DRPB 1O1WA 3KD5E 4RW9A 2BQ3A 2IC3A 5CZ1A 4O0IA 2G8HA 3SI6A 4NLSA 3THVA 4WFYA 4KHYA 3HP6A 3OYAA 2HVHA 1YVUA 4M3UA 5KFFA 3ZT4A 4TN2A 2GBZA 2XO7A 3QO9A 4KAIA 1DTTA 2W9CA 2D5RA 4CGHA 4C8OA 3ISND 4N56A 1JLCA 3SFUA 1RT4B 4M3ZA 3QETA 5DMRA 2X78A 1S5JA 2JEIA 1S0NA 3EZUA 2YKMA 3GQCA 1RBVA 5KFSA 3H5XA 1JLBB 1ZBUA 4W5RA 2PYJA 3SPZA 4BE0A 4TXSA 4CEOA 4FK2A 3QESA 3K5NA 4DL4A 4CJ5A 4CERA 4FM0A 3NDKA 3PZPA 3QEWA 3BDPA 2AJQA 4IG3B 3BQ2A 2XI2A 1RT1A 3V4IB 1IKWA 2V9WA 3RMCA 2BR0A 5L1JA 1IKYA 1HJRA 2YNGB 4B9UA 5KFQA 4FJIA 3OJSA 1KLMB 1VK0A 2HNDB 2AU0A 1TVRA 1KFDA 5KG0A 1YVFA 5F9NA 3LAMA 3AO1A 3H5YA 3P5JA 2FJXA 5J2PB 3RMDA 2BE2B 1BQMB 4CFBA 3CYMA 3PO4A 4KPYA 5HROB 1J5OA 1NNDA 3LP0A 1ZBFA 1LAWA 1REVA 4CIGA 3IS9B 5I3UB 2XC9A 5J2NA 2XCPA 4ED8A 2PZSA 1BCOA 4ED0A 1TV6A 4W5OA 4QWCA 1S6QA 4JS5A 3SPYA 4E7LA 1N6QB 5KG2A 3DOLB 1C1BB 2VG6B 4IKFA 3LANA 1LW0B 3NKYA 3ZCMA 3KKSA 2FBVA 1NHVA 3C95A 3K5OA 4URQU 3GYNA 3ZT2A 3GIIA 3PVXA 3KK1B 4K4XA 4CHOA 4B9MA 2HWIA 1DLOA 4YR3A 4E19A 4DL2A 1S1VB 5DG8A 4ZP6A 3HVWA 3LP2A 3V9XA 3I5CA 1QSLA 4KB1A 4CGFA 4Z4CA 2X6NA 4Q8FA 2IA6A 5JS1A 2UVRA 4DFJA 3MEEA 3L2VA 4R0EA 1NOZA 3B6OA 1HYSA 1VSIA 4BE2A 1R0AA 1NKBA 4JLHA 1RBSA 3MR2A 4DQRA 4EO6A 1C2PA 4URGA 5CY4A 1A5WA 2HW3A 4CJ4A 4YFUA 4EYIB 1TK5A 3MF5A 4O3OA 4ZTFA 3RB0A 3M8PB 3V1OA 3ZT0A 1D0EA 3KHLA 3PV8A 1N56A 4ZP7A 4RW4B 2V0NA 1S1TA 3HVRA 1MMLA 4KFBA 2GUIA 4PA1A 2BQRA 4EBCA 3V6JA 4DTRA 1SH3A 3KK2A 3NHGA 1BGXT 4H4OB 4KV8A 3CFOA 3KIOA 1TKTA 2BRKA 1T03B 3NE6A 3GV8B 3MXIA 1KLNA 5HRSA 3TAMA 1S6PA 3T19A 1X9WA 1RTJB 2W9BB 4J9OA 4W5TA 5J1EB 3ZSOA 5J2MB 3TR8A 3K57A 1NHUA 4UQGA 4TY8A 3HSTB 3H2LA 4HVJA 2XRIA 2HAIA 4WXWA 2C2RA 5CYMB 1GOAA 3C6TA 4CEQA 2UUWA 5DLGA 4DG1A 2X74A 3ITHB 1FK9B 4J2DA 1BI4A 3V1QA 4ECRA 4CJEA 2R8IA 1JXLA 5D3GB 4RUAA 1ITGA 2B6AB 3DDKA 3CDWA 1WLJA 1Z25A 1LW2B 4EBDA 2B5JA 2JEGA 2P5GA 1K1QA 3CG7A 4B8CA 5HBMB 5FDLA 3M8RA 3SNNA 4Q0BB 2Z1IA 4R8UB 3M8QB 1S0MA 3DRRB 2J6UA 1RT5B 1FKOA 3DRPA 2YNFB 4FLZA 4DTPA 1N5YB 3V6DB 1TAUA 4MIAA 2DFEA 3C6UB 2OPRA 2ITGA 2WTFA 3ZSYA 1JL1A 3BQ0A 3OYIA 4CJ3A 3VQQA 1RA6A 4L8RB 3KK3B 3NGDA 1TGOA 4BDZA 4ZVFA 2ASLA 3LP1B 1U4BA 4IFYA 2R2UA 3LZIA 3PW0A 3TAGA 4HUEA 4ZVGA 1RT4A 3MECB 5T14A 1IG9A 4LSLA 2XI3A 4O3NA 3TARA 2FVPA 2C28A 4ZTJA 1HARA 1JLBA 3O3GA 2BQUA 4CJSA 3ULDA 3B6PA 3VQ5A 1BISA 4FJHA 4RNFA 4J9RA 4DTUA 5EWEA 1Q8IA 2HMIB 4X2BA 1HMVB 3HPGA 4IG3A 2ZKUA 2P1JA 2WCXA 4F4ZA 4LY7A 1KSPA 3HJFA 4KHQA 3OYLA 3AVHA 4Y34A 2HNZB 3V4IA 4F4WA 1WNSA 3QZ8A 1S1WB 4EEYA 5K14B 4FZXC 1T8EA 3FSIA 4F2RA 3K5MA 1WN7A 2YNGA 1D1UA 3BSAA 1TP7A 1N48A 4FJLA 4O44B 1KLMA 4FS1A 3BREA 3Q8SB 1S1XB 5KT2A 2EC0A 3OYKA 1NJWA 2E6LA 1JLEB 4ZHRB 3CJ3A 4HCBA 2UVUA 4KTZA 2IJFA 1ZTTA 3OS1A 5KFKA 1KHWA 3T5HA 3QNNA 2EX3A
chains in the Genus database with same CATH superfamily
4GC7A 2BE2A 2YHYA 4DL5A 4CHNA 1W0HA 5HROA 2ZNYA 5I42B 3TVKA 4YOEA 4ES3A 5HP1B 1S6OA 2CJQA 4DQSA 4Q2MA 3KJQB 1UTAA 4JI4F 4I6MB 4M95A 3E9OA 2ZJPQ 4CO5A 3J80U 4I56A 3BO4A 3Q23A 1P1TA 1HWJA 3TQ1A 2LEAA 3OFHA 3QIOA 4UOGA 3M6GA 1J2VA 4FWOA 2PT0A 5AQOA 3K9KA 2ATCB 4K5RA 5AR0A 2V2KA 2EK6A 4CZIA 1S1UB 1TL3B 1LOTB 1U0HA 2DNGA 4N77A 4M3WA 3KK1A 2WOMB 2EPIA 3JS9A 1S9FA 1QS4A 3VQ7A 1LXNA 4OX6A 4I6WA 1C0GA 3FUYA 4K2XA 3FSXA 4BRFA 4RG8A 3D6TB 2B8PA 4DFMA 2E9TA 4DV0K 4PWDB 2MYFA 1WC4A 1Y97A 1PSDA 2CQBA 4DR3F 1U8WA 4G6VB 3WXLA 4U7CA 1Z1ZA 4LR7A 4L3NA 3HO1A 3VTHA 3RTVA 3TAPA 4ZLLA 5D4PA 1Q95G 2IDLA 3BSNA 3DLGA 2ZM6J 4QPTA 4ED6A 1H2TZ 4R25A 2OZSA 3TRGA 2LLZA 3D4JA 2IM3A 4PYAA 3ELHA 3OLAA 3HK2A 3VGKA 2ZZNA 5HI7A 1RDDA 2MKHA 3G87A 3VF4A 4BLGA 4QIGA 3HYFA 4BC5A 3MFIA 2FSNA 4NLQA 4BACA 3FZKA 1NJIT 1OJ4A 2VFRA 4HACA 3OPKA 5GAHU 2VG5B 3W8PA 4DV7K 3TOQA 1JKHB 1NGHA 2LKZA 4O4RA 3R8EA 4WKRA 5E41A 3TEGA 2Z1HA 3CT9A 4FPBA 1ZZNA 4F3OA 3TO8A 4FJGA 1Q53A 4WFNQ 3RZAA 3OTBA 4WK3A 2ABYA 3T1AA 4WZMA 4X4QA 1OQ3A 4FWKA 5CQGA 4FF2A 1U1NA 2Z8QA 1YZ7A 4WFZA 1SQEA 4FOEA 3GPAA 2OO4A 1SXLA 3I0RB 2CG8A 5KAKA 2J0SD 4CH7A 2G2YA 2H5IB 4R5PB 1H7WA 1G7CB 4YOYA 4A8XA 2HBYB 1RWOB 1UVLA 3P96A 3MM6A 4DX6A 2MZJA 2F9WA 4X4RA 1NPKA 3RWUA 5KG6A 1LW2A 3RAMA 1OH7A 2DCUB 5H1SQ 4WZQA 3K2PA 5HBMA 3KLIB 4M41A 1JXVA 5EU7A 2RN2A 5L1IA 1RT5A 2X3GA 1SJRA 4IRCA 3SXLA 2QA4G 5F8IA 3NF6A 3QEPA 1XIQA 2X1GA 1SPBP 1IJJA 4FJNA 2PEBA 1C4CA 3BKFA 2VQFF 1XBWA 1XK8A 1KHVA 4IDKB 5H1SV 3H5SA 4DV3F 2AEFA 2IJNA 5KFWA 1RAJA 3O4WA 2ZWPA 3OSNA 3VQPA 4JV1A 5AE3A 1F60B 3MECA 3SSQA 1U6BA 4DU3A 4J9MA 1A9NB 1FFSB 3W2WA 4FVMA 3DFEA 2GJFA 2PE8A 1FXDA 1TQLA 3ZZPA 5AQPA 2NUBA 2DK2A 3HZ6A 2O8DA 5F0XA 2F5GA 3N5FA 2CQIA 1VS3A 2KRRA 2A1SA 1HMVA 4X4OA 2LXUA 1GH8A 2X6SA 5CD4H 1U2VB 1IBLJ 5BRDA 4FVUA 5KFZA 3I4HX 2A3JA 1A0OB 3G6YA 2KLAA 2ZJRL 1K8AO 2COLA 4OX9F 3CJCA 2C2KB 3GFXA 3PTWA 1MWMA 4NLTA 5DM6Q 4RNMA 3DHXA 2M8DB 3PYDA 3VQ4A 2EFVA 1B70B 2MQ8A 3SQGA 1NJXA 4IOXA 3AVLA 2QG9B 4OKJA 2E5LK 1TZ0A 3D6HB 2ZH8A 1NDKA 2ZUGA 4CK3A 2CH6A 3A3NB 4LVOP 3DLEA 5EN1A 2QL9B 3WQTA 2IBKA 3SZ2A 2H51B 4ISGA 5GIOA 4H5NA 2AJ1A 5K8MA 1RXOB 4FOIA 3GG4A 1WSEA 1S76D 4CD1A 4M5HA 2PC6A 3WHIA 4CT8A 2D9PA 1CSJA 2GVZB 5BRHA 2A18A 2BV3A 4LF8F 4FJKA 5CCMA 4J90A 1LV5A 4J5OA 1VSKA 2LSNA 3SCLE 5D8HB 3R5CA 3EVMA 5AQIA 2AKWB 5DGBA 3DMJB 3SSSA 1FD8A 1SC4B 3VEXA 4KHUA 4BCAA 3I5BA 1RLCL 4I6YA 4LF5J 3D5MA 1GX5A 1P27B 2UZAA 4LQ9A 4KO0A 1ZM4A 4M8LA 1RISA 5F9LA 5ELZA 4HTJA 3DLKB 3TPQA 3IRXA 1BQXA 1X4HA 2QWMA 3UR0A 2IMWP 2A6MA 1OY8A 3FKBA 3I31A 1APSA 1FX4A 2W24A 3L4QA 4UUXA 1MNEA 2LECA 2HBMA 4LR8A 1C1CB 3DXMB 1QAJA 4AHVA 3Q8YA 3THTA 3T1YF 3CCQN 2DRDA 2QKBA 3RBZA 1RAGB 4QIFA 5JLHA 3MMAB 1SJFA 2HQCA 1VSHA 1D09B 3IN5A 1TL1B 1S9GA 1TKZB 4ELVA 2XSJA 3OJUA 1DJ0A 4H0XB 1VK8A 4CZCA 2RS8A 3AHPA 4MQ3A 1V5IB 5F41A 1XEZA 1Q81O 4DWIA 4UY8T 3QMLA 4IJNA 2CZ4A 1EKEA 2NSBA 1RDUA 2WVEA 3H45C 3UD5A 2K2PA 4H5TA 4XH4A 5AQHA 3W66A 3ENVA 4DV1J 4O4GB 1TK8A 3BO2A 1MWQA 3ENAA 1DTTB 4XTTA 1QTNB 1N34K 2E9ZA 3UO0A 3R6LB 4QS9A 2VH7A 1QUPA 3J7AN 4YOXA 1E4FT 3S7RA 1WKKA 5E5NA 2N4DA 1NB2A 3O1BA 1N4LA 2A6AA 3G6ES 4RUCA 4NXMJ 3CIPA 2XHWA 4IH5A 4RU2A 4RW6B 1MN9A 2UV8A 2VJVA 1EETA 1SC3B 1C0UB 3FFIB 1HNWK 2K8GA 3CJSA 4GKJJ 2OIHA 2MSTA 4DUZF 4OVLA 5HO4A 4CF8A 3E2EA 1KAYA 2C3OA 2JC0A 2ZE2B 2AX1A 3HF5A 4RW7B 3UPFA 1Q82O 4WFAL 5LSLA 2CQCA 3IG1A 1BQNA 1YLXA 4WJBA 2AGPA 4CBWA 1BC6A 1VQMN 4L76A 3FNNA 4K0KF 4U8YA 4LF9K 1LWEA 1VQON 4KKOA 4EFAC 3CCRN 5J2NB 5FROA 4AYBD 3TWHA 3PRVA 3QIPA 3QBXA 1U09A 1RDBA 1NU4A 3JSMB 3IR6B 4J91A 4M3YA 2LEPA 3CVKA 2HBLA 2WVFA 5B09A 3HHLA 4AQYF 3AVFA 4DS5A 5J2QB 1EQYA 1TYQA 3OUYA 3NGYA 3TNVA 3ZTQA 2BA9A 3P8BB 5AJ3J 1OO0B 4CF2A 4JOUA 4WIQA 2RUGA 2YPYA 3D6MB 4WYWA 4NI2B 4FXDA 3U1MA 1W25A 2CPYA 4FJXA 3ENWA 3MM7A 3O4QA 2DEJA 4B1XB 5FPMA 1YT3A 3K5LA 4MLEA 1AFJA 4B8AB 1N5TA 3OR2A 4FW1A 3D45A 2YKAA 4ED4A 4Y2MA 3AVNA 3SUNA 4LBIA 3GU0A 4MTPA 3V9WA 3DLRA 2V2QA 2M8HA 5BRFA 2L48A 1KQKA 1FVSA 1EO1A 1VQLS 2W7PA 2LU1A 2RS2A 3JQMA 4KY3A 4U7UD 3IFRA 1KQSM 1CLFA 1LCUA 4LD0A 1RI7A 1UCNA 4FW2A 4FLWA 5MLCQ 1UWBA 2DHXA 3JYTB 2VKRA 1NH8A 3MR5A 3HVTB 1CJKA 1UWAA 4KB7A 4DS4A 4FXVA 3CJKA 3L2WA 2RU9A 1KQSR 2VC1A 1LAVA 2F40A 1I51B 1OWXA 2XCAA 5FLXO 3ET6A 5MLCV 1FJGK 5I3PA 1UZDA 1YUWA 2OI2A 4YB6A 1XN9A 1JLAA 2L41A 1VC0A 5IOLA 3R1LA 4DSLA 3U6FA 2ZOMA 4WE1A 3TVZA 3JTPA 2RNEA 2DISA 2Q36A 1YVNA 4HT5A 1OH8A 4DL7A 2QN6B 3ILOA 3TX8A 4FF1A 5ADXA 3H40A 1EAYC 4DU1A 3RSEA 4B3TK 4IG0A 1JMTA 4A61A 4X4PA 3GFHA 2E5JA 4URSA 4KBIA 1RCXB 2IRYA 4FYDA 1CG2A 3ZX0A 1E4GT 4MO4A 1WC5A 2KT2A 3I9ZA 2PO4A 4OX7A 3CMQA 4OHZA 4E7HA 1VMBA 1NWKA 4Z7YA 1C0TB 3AVAA 1NM1A 1ELOA 1P9QC 3GLJA 1YSJA 4OYOA 1VBXA 4IOCL 4R8UA 1GLDG 3DRRA 3PCOB 5B0FA 2P9IA 4NYZA 1M5PC 4K4TA 1FI4A 2PMZD 3ZZRA 5A76A 2W9AA 2HHSA 1A5VA 2G8KA 4Z2XA 3OVNA 1V5VA 1AW0A 4FF3A 3MAAB 4DV2K 1GNKA 3G25A 4Q8EA 2K1RB 2NLXA 2APOA 5CE3A 1VQPS 2IY5B 2LP4A 3QATA 1FNMA 1N32J 2MQMA 2R7OA 4JV5J 4O0JA 4LF6K 4X65K 4GMKA 1QQOA 4MKVA 5BJRA 3AA5X 5GAEI 1NM2A 4Z4EA 3HVAA 4OMFG 5FLXU 4NYFA 5CYQB 1YRUA 4FNHA 1M5KC 4F8RA 2IM0A 2QE5A 1HBOB 5M1PA 4CEBA 2KZZA 4YOWA 1U1OA 3F0NA 3LPYA 3ZSWA 3SQ1A 2N82B 5KT4A 5K14A 2QYCA 2PA3A 2VHGA 1J5EF 1FRMA 4TNOA 3R1XA 3LDSA 3KNGA 2QA4N 3MCMA 2QFIA 1KRPA 4DR5F 2E7WA 5KG5A 3BYRA 4FJ7A 1WAJA 3MMVA 3JAMY 4PKHA 4YR2A 5KQ8A 1P90A 4B1UB 1NAQA 5HMZA 4KC5A 4P7VA 1S9EA 3ZZUA 1YJ9S 3QNOA 2RAQA 3BR9A 1UW4A 3NEKA 2HIQA 2UP1A 4KHSA 2YV0X 5T7LB 3AA3A 4I67A 1B64A 2CWXA 2HNYA 3S1TA 2NCKL 4ELUA 4C8LA 4NZ6A 3ZZOA 2XM3A 1N8RT 1ITPA 3I82A 1V4TA 2Q66A 1HBNB 3QJPA 2YX1A 3VAFA 2R2TA 1U7LA 4NLDA 4Q2LA 3G82A 4CH0S 2O4GA 2RRAA 1BA1A 4EP5A 3PRBA 1G1XA 4Y2IA 1NDCA 4PG6A 4HEA9 1SUQA 4CDIA 4KHWA 3MWTA 4X64F 2F8HA 2YQ1A 1YJUA 3DM2B 3QEXA 2YKOA 4NYOA 2BEFA 4BQLA 3BGFA 2R8KA 3KJVA 1ZH5A 4I2QB 1XNQF 2XG8A 2KW4A 5D0EA 1S77D 3MN6A 3BGRA 3KLEA 1NSKL 1VSEA 3VQDA 4GW6A 2XB2D 1HNIB 2CQ2A 3TSUA 4YR0A 1RBAA 2U2FA 2Z0GA 1EHWA 4DR6K 3GR1A 4F4XA 2XMMA 4NRUA 4K8ZA 1GFWB 4AT1B 2KHDA 4BGAA 2P9KA 4PUOB 2BACA 4AL6A 3OFEA 3E8OA 3PFEA 4ZPDA 1NGEA 3CQXA 1U0SA 1W97L 4WFNL 4PZVA 1UL3A 2E20A 1M5SA 4CYUA 1JL2A 2HBJA 1FFGB 4FN5A 4FJJA 5GADP 1WSVA 3TZXA 2VQEF 3MN9A 1KWMA 3W9HA 3TYTA 2IVFB 4CZKA 3D67A 4RBUA 4IZ9A 2JOQA 2R7SA 1LWXA 4J9LA 2UXBK 3OR1B 3GL1A 2A10A 2QMUB 4RW9B 2YHBA 3DDNA 4KHPF 1H6KX 1F5BA 2J9CA 3AT1B 4CNZA 3V6HA 2KFNA 3PX0A 2IJRA 2WTUA 5LMNK 2DGXA 4ID8A 3MN5A 5C42A 4DEZA 2IA0A 2HQIA 3BGOP 4QPXA 5KT5A 1K44A 2DY1A 1V3SA 4DR1K 4BHQA 4ID5B 3SCKE 5H9FJ 3IO1A 2YKMB 1GOBA 1AUDA 3VA3A 5BN8A 3CC7N 4DUYK 1EKRA 3CC2N 3MK6A 3C94A 4DLGA 4P74A 4M42A 3CW2C 1X0FA 3QLHA 2VF3A 1RAEB 3BBCA 8ATCB 3S6EA 2QYGA 3MM8B 3KJFB 2E44A 4JI0K 1ROFA 2HGLA 2XWXA 1KAXA 2QJ3A 3NRBA 4TQRA 3GFYA 3N5BA 5SUHA 4E98A 4TSXA 3VF2A 1YJRA 2J9DA 2DPIA 1TL7B 5F0UA 2UUBK 4JKGB 4PG5A 4A48A 2JDJA 5B0GA 1WKJA 1AA1B 2RMLA 3RR8A 4LBHA 3AXKA 2E1MC 2ALZA 3K0JA 3WC0A 1HUXA 3CCTA 5FPEA 4BR4A 4JHDB 2POKA 2V4JB 3CCES 4FM2A 5DM6L 4KTQA 1C4AA 2IIHA 4ALZA 4HHHA 1S4EA 4ZCLA 2PGCA 1HBMB 4QR0A 2DR9A 1VYAA 4BR5A 1V9OA 3J7YI 3SSRA 3HHLC 3P83D 4N5SA 3W62A 5E33A 2ZH5A 4K2JA 1X4AA 4IYQA 2OZMA 4E8UA 1CJUB 3C3LA 1Q7LB 1CS4A 1WG4A 2VDIA 1UJ4A 4Y3CA 3KMSA 2FY8A 5ETKA 3WNEA 4IR1A 5GAGI 3FZMA 5BR8K 3MEGB 3AD9C 4EI2A 3LP2B 1N36K 2BOAA 1NBWA 1S99A 4PKGA 5JVHQ 3V2UC 3HJVA 5KFHA 3RR7A 3FBBA 1HYSB 3LPTA 2J4RA 4WF9L 4FYYB 3PR5B 2GGPA 4RO0A 2QA1A 4P52A 5AXMA 2ZC3A 5I4MA 4WFBL 1NOYA 2WAQD 4BVOA 2RJZA 4OZ0A 3G9CA 2M88A 4JUZA 4JI2F 4QCLA 1RHUB 4QIEA 3QYYA 2QK9A 3IM9A 2FVCA 4JI1F 2GHPA 3JTNA 4OKKA 3R6GB 1JLGA 3D2EA 5BN9A 1FWKA 2QLFB 3OYEA 2V2ZA 3FCWA 2HS0A 1B0PA 3MX2A 1S1TB 4HTIA 2EFOA 3IUCA 3LGHA 1NGFA 1G6BA 3IGVA 1UP1A 1CC8A 3QGIA 3NBPA 3RAXA 4NCGA 4I7FA 2CPXA 4KV8B 2F63A 1WNEA 5CABA 2D41A 3LPEA 3NCIA 3SI8A 4FYXB 4F7VA 3FDSA 2XYGB 4B3SK 3W5YA 2QSWA 4YDXA 3MD1A 3C6TB 4HDGA 3DOMA 2ATQA 3D2FB 4WXOA 3WT0A 4DSFA 4ANCA 1B99A 2DPNA 1QE1A 4CESA 2MB0B 3Q86A 2EWSA 2O8BA 4X84A 1RT6B 3C7NB 3O5BA 2BZ2A 5FD1A 3I9V9 4TY9A 1U2FA 3VEOA 3A8EA 1VJWA 5HMWA 3PY8A 4PAAA 4FWSA 2O8CA 1YJWS 2CWKA 1FKOB 2V6AA 2BQ3A 1AUSL 2QEXS 4IFEA 4L74A 4NLSA 3H8YA 5AT1B 1OPIA 3FZFA 1FRKA 3GWCA 2JX2A 3D3CJ 5KFFA 3TSPA 3KK7A 3QO9A 4BR2A 1R59O 2VBZA 2D69A 4DCJB 1RWKB 4FWPA 4N56A 4KJIA 1QQMA 4DV0J 2JEIA 2VOPA 1S0NA 3M6WA 3A5LC 2GJIA 4F9OA 1JLBB 2YKPA 1ZBUA 4BRPA 4W5RA 4LRDA 3RJMB 1IWAA 5EX3A 4CJ5A 2V8PA 1ZAWA 5IWAK 1URRA 1KP6A 1WWHA 4NA2A 1UMJA 5HAOA 2XI2A 3C15A 1PGZA 1YWXA 2M9KA 3V4IB 2MQLA 3QBCA 2V9WA 3RMCA 2JRSA 1QVGR 3CHWA 2RQMA 3M4XA 1YTYA 4FJIA 3AD8C 2HNDB 2AU0A 2AJFE 4ZN1A 3C0BA 2MY8A 2ZH7A 2J7UA 4ZJLA 5KG0A 1HW9A 1YVFA 2MMYA 2DO4A 5F9NA 1RKJA 2OTJS 1FFWB 1PG5B 4DV7J 5GMKa 3R5AA 4ISFA 2EFNA 2BE2B 4CFBA 3CYMA 3NVKA 4KPYA 5HROB 1J5OA 1NB7A 4DJBA 4PPDA 3CCJN 2MZQA 1NNDA 3CO0P 3LP0A 2OSQA 2QO3A 4CIGA 2XCPA 4U67Q 2AMCB 2ACMA 4YY3F 3KG0A 4DQ8A 2CQ0A 4U7BA 1WELA 3GMGA 4W5OA 4QWCA 4LMZA 4M5KA 3C14A 4JI5F 4GY2B 4E7LA 3U1LA 2MZTA 1C1BB 4IKFA 2DO0A 3VENA 1NHVA 1TL5A 2HLTA 4CZFA 1U0HB 2QC3A 4ZCIA 3KK1B 2A5XA 2RE1A 1BUXA 3J80Y 2HS4A 3O1LA 1HNXK 4E19A 4WTOB 2L9DA 3I5CA 1QSLA 2VCPA 2IA6A 2PMHA 5JS1A 1HHTP 3L2VA 4FXWA 4P2XA 1NOZA 3B6OA 4DV4K 1VSIA 3US5A 1R0AA 4JLHA 2A6OA 4PXDA 4G9ZA 5DO2A 5B0DA 2QXLA 4URGA 5ETRA 5CY4A 4X62K 2HPUA 4PG7A 1WG1A 2FGCA 2NREA 3T7ZA 2E7VA 1QLNA 2MXYA 1BY9A 3I55N 1Z2LA 4OYBA 1Y00A 1YRTA 3HRGA 1JJ2M 1D0EA 3KHLA 4CO4A 2MLYA 2FTRA 2LQBA 3NGRA 1VQ5N 2XS7A 1HKCA 2V0NA 1X3MA 2QFJA 3S41A 2EFGA 4KFBA 1O6XA 3E9LA 4HACB 4DTRA 4USKA 1SH3A 1JJ2R 4OLPA 1X4FA 3NHGA 3HSZA 7AT1B 3FFKB 2MJUA 1TKTA 3TJ9A 3NE6A 4PWWA 1KLNA 3TAMA 3E66A 3NXZA 5GMDA 4YOTA 4LFCF 4J9OA 3ZSOA 4UQGA 2P9LB 4HVJA 4FYWB 2DHAA 4WXWA 2GWJA 2EI5A 2G0JA 1GOAA 2LDIA 1YDLA 5CHCB 2NRVA 4CEQA 5EGYA 4DG1A 3ITHB 3MOZA 2E5LJ 2HBQB 3NCPA 2OEKA 2R8IA 1XNQJ 2FXUA 1HFEL 3L4IA 2EG1A 3MM6B 4KGZB 3DDKA 1LW2B 3K0SA 4K59A 1GAOA 2P5GA 3J7ZO 4B8CA 5HBMB 5FDLA 1V3ZA 1S0MA 2F9JA 3WXMB 1CC7A 1RT5B 1HR0K 4YDUC 2C3UA 2DKOB 1JCFA 3QFPA 1TAUA 2DFEA 4OLOA 2OPRA 4F36A 1JL1A 2MKKA 3OYIA 1NSQA 3KK3B 3NGDA 1TGOA 1PYOB 3OXGA 4OI6A 4ZVFA 4A5AA 2R2UA 3LZIA 3TAGA 1RK8A 5AFUH 1XNRK 2E88A 3MECB 5T14A 1IG9A 4DHVA 3BO3A 3TARA 1VQNN 2A2CA 7FD1A 3W2WB 5IFMA 2FVPA 2GZOA 1ZA1B 1WBDA 2KRBA 4B1YB 2LCWA 2FUG9 4KHPJ 2GQ2A 3UVJB 4A8WA 2O8DB 1NSAA 2OP5A 1M1GA 5EWEA 1JJ4A 4WWSA 1HMVB 3HPGA 5E3CA 4RWTA 3G96A 1KD1T 1LK5A 4F4ZA 4AD6A 3CCMS 4K41A 2HLUA 2A3ZA 5E26A 2BKNA 4FZXC 4UF4A 2AT1B 4OX8A 5D0RA 1KLMA 4KH5A 3ZYYX 4FS1A 2AYBA 3Q8SB 1NJWA 4GRSA 1M90T 2UU9F 3W61A 2CGLA 2IJFA 1D4XA 2P9NA 4FWMA 3PSIA 1KHWA 3T5HA 2DNMA 2EX3A 3ZT4A 1Q16B 3SQGB 2A42A 2G1HA 2ZVSA 1S4FA 2JHEA 2JSXA 3Q2TC 3N6LA 2PYLA 3MOJB 1FWPA 4H0PA 3F5TA 3ISZA 4DR7F 3G6VA 4TLRA 2FC0A 3VQEA 4BRNA 2CJXB 1J54A 2R7UA 1BWEA 4CW7B 4GV6A 5M2UA 2VA3A 5M1NA 2V94A 1GOCA 5KFMA 1IG8A 1FT8A 4CJRA 3ALYA 1N88A 1YKWA 2F8TA 3OYCA 4P10A 3KLGA 1N6QA 3ZETA 3EDQB 3M30B 2VG6A 2HZCA 3HXMA 1LW0A 3JQJA 3R6MA 2LA4A 2JC1A 3O6QA 1VC5A 1TMMA 3T69A 3R9LA 2BW2A 5CD4A 4YHHF 2MHNA 2FBXA 1RTDA 2N4CA 4K25A 4G1QA 2Z58B 1TL4A 3OQ2A 2FHJD 3CD6N 3SDEA 3WNFA 3BF3A 3MCSA 1Z26A 1WHYA 4ECYA 1X5TA 4CVNE 4C0BA 1DZ5A 3LL3A 3R3LA 3TANA 1KC8T 3VESA 3SAFA 4KO0B 1W2IA 3ZO7A 1IR1A 4AM6A 2FLOA 1VQ4S 1HL6A 3IRXB 1WHXA 4ZLJA 5IV4A 5KT6A 2CVIA 1SKRA 2IAJB 2NS1B 4RUHA 2UUAK 1N33F 3OL7A 5FPDA 4K42A 1UW9A 1GMUA 3MR6A 3HSJA 1U6ZA 4A57A 5IS2A 4K4YA 4IOAL 3M2UA 3ADAC 3BN7A 4AXIA 4LF9J 3C65A 2ZD1A 1NH7A 2KM8C 3CUNA 3VGTA 1S9GB 3R5GA 2XSJB 4CJTA 4RKUC 4LVNP 2XY8A 3DYAA 4OYIA 4H4OA 3T5LA 4KR0B 1WDTA 2QWPA 2WW4A 1I1GA 4HUGA 4ILRA 3EE8A 5GMEA 3VAGA 2RQCA 2OYQA 2C2EA 3QQCD 3MGJA 3C6HA 2W9BA 1H3DA 4A8FA 2NRHA 1B0TA 3P31A 1HQEA 3SMPA 3EXCX 1PC4A 3K17A 2O5DA 1WSRA 3SMZA 1ZBTA 1JNRB 4HCCA 5DDQC 4WFXA 2OEJA 1KTQA 1RGVA 4B3SF 3HPHA 1REGX 4LRBA 1RTZA 4JI3K 4YP3A 3BM7A 2DGUA 5D3GA 3KWGA 3NFAA 2EK1A 4ITSA 1OVYA 3B8HA 2HVZA 4ZPVR 5T7BA 4EHTA 2ILYA 2FJAB 3TJAA 2GEMA 3M8QA 3A5MC 4BC3A 2AZ3A 5KT3A 3P5BP 2G0IA 4RL1A 1U1RA 1YJNN 3RG6A 3I6PA 1EETB 4DPTA 4KAZA 1X31C 3G8QA 5BYQA 1WD6A 5AQFA 1QSSA 3VOVA 3L2UA 1GXUA 4ZPTR 4FWRA 5E7OB 5GAEU 1BMQB 1K6YA 5C2CA 1NJYA 4NA3A 2XYHB 3NGUA 1FO1A 3O8WA 4DQPA 2ZGYA 1TELA 3X3UA 4TQSA 4KH4A 5KFGA 1VHFA 4DV5K 3RGIA 1EQ0A 4TYAA 2ADBA 4U8VA 3IG1B 3JTOA 3OVBA 3MX5A 5KGWA 1BQNB 3TAEA 5M1OA 2WVDA 3H6EA 4A8OA 1EIYB 2OAUA 3LP3A 3ILLA 3W0LA 3BQ1A 1FJGJ 1LWEB 3OXFA 5C24B 4KKOB 3VAMA 1CXUA 3TUIC 1QAIA 5JICA 4NLVA 5LXRA 4OZ2A 1E6YA 4C6AA 4DR4K 1NLKL 4DU8A 1NK5A 1VR6A 4KBOA 2O8EA 3QIPB 2WZ1A 3VHQA 4LFAF 3GILA 2HOEA 2HQFA 3SUPA 1LWFB 1H98A 1WI8A 4OPJA 3TA0A 3HHLB 4O44A 3ENHA 3QGGA 2EBGA 4FCYA 2J8AA 4ZHRA 1TYQB 3GIJA 4B3TJ 3O44A 1RWPB 3UNGC 5EDWA 5D77A 4PKIA 5JVHL 2DR7A 2FZGB 3A3PB 4EIAA 1T6DA 3S3NA 3EKSA 1RT7A 2GIQA 2FBTA 3MMJA 1X5OA 3GG1A 3BV8A 2HHHF 3VQAA 4WU2A 1I6JA 4DI6A 4KRFA 2V4QA 2V34A 4AUKA 2C3YA 4EWTA 1NO8A 3OR2B 2JLFA 2FJDB 5KG1A 4W4MA 3K58A 3BSOA 1K8KA 3JXOA 3HKZD 3NNHA 1SKUB 4YB5A 2AIRB 4P9SA 4Y0FA 4AHRA 4JI8K 5C25A 5HN0A 3UDCA 3CCLN 3KVGA 4DV2J 4BC2A 4M5NA 2ZBCA 1E6VA 3O08A 3D28A 4U6PA 5JVGL 2HRUA 3G0ZA 4XO0A 1H73A 1RT3B 5JUMA 1UWBB 3FZ2A 4LF6J 2CADA 4EZ6A 4X65J 4RCHA 4KE5A 1CJKB 4ILHA 3CJKB 3J81U 1FXRA 4B08A 4PCQA 4Y2CA 3PO5A 2FVRA 4RW8B 4WQ4A 4H0YB 2BUNA 3UDVA 2O8FA 3B4MA 4B9TA 3FEXB 3SQ4A 2XBPA 2QT7A 3D0PA 2YCHA 4DQQA 3D54A 4O8KA 4OJHA 1JLAB 1FEHA 4ICLA 1QZ6A 1UEUA 2XSFA 4WE1B 4M63A 2HQ3A 2UUCK 4RU9A 1R0BG 2GQCA 2RKIA 2DNQA 2YKNA 4LF4K 3NGSA 4CZGA 1VSMA 2I1RA 2MQPA 3FLCO 1YBTA 2K06A 1PYSB 4IG0B 1S0VA 4Z4GA 3NWGA 3WC2A 2QSFA 4QYZK 1OQ6A 3L7UA 3MFHA 2N7CA 3U1NA 4B1WB 1X60A 1ZPVA 3AVMA 1Q9XA 2V50A 3NMRA 3GYXB 1W7WA 4DX5A 4FKXA 1HNVA 3W63A 2RT3A 4K50A 2ZOFA 4IEEA 2CKWA 1DQAA 2J9DE 1HNZF 5DG7A 4CHQA 1WKLA 1BHLA 3FR0A 4F3QA 2P9IB 5L9XA 3MPYA 1JLCB 3H1QA 4FLVA 4DTNA 4GMJB 3ONQA 3C2PA 3FGVA 1BIZA 3TU5A 2RUSA 2XGQA 5DJBA 4LRAA 5A8KA 1BCMA 1MMNA 1BUPA 3LQVA 5ADZA 1P9YA 1F5CA 1R3NA 2RE2A 1UJ6A 3ATVA 3K8VA 2B9EA 1XJWB 2B4UA 2FGOA 3VEWA 5IM0A 2NZ4A 3VMFB 3CDUA 3NAIA 3NCRA 4LF7K 1RT1B 2HFVA 1WF0A 2ZZTA 3CXCR 3GCXP 1KCFA 1FKPA 4DR6J 2R7QA 4CLPA 3CCQS 5AE2A 3SYZA 3VGSA 3EX7B 1H1VA 2DNKA 4KGVB 3RVCA 4YB7A 2XQCA 4J9UE 5FLXY 3W7BA 3W3SA 5AQXA 4WYLA 3D68A 1ZC6A 2CGKA 4Y2KA 4RTFD 1BWVA 4A8MP 1WSJA 4XEIA 3JQKA 2C2NA 3VAIA 2JGUA 1JIHA 3B6BA 3J7YU 2FYXA 4MK9A 3HFVA 3CFRA 1Q79A 5EX0A 4M7XA 5KFNA 3UIQA 4KH6A 1T05A 4B9LA 2VA2A 5F8JA 1S9EB 5GAGP 3VQCA 3I0SA 1HI1A 4QW8A 1S6QB 2UXBJ 1FF2A 3MCAB 5I3UA 2J0WA 4FPRA 4DL3A 3MD3A 2HNYB 4ZLPA 2IVOA 3A8YA 2ZM6F 2ZJRQ 1N52B 4LSNA 1H0HB 2VBYA 5IQ6A 3KWMA 2XGPA 2Z1JA 2Z2YB 1NK6A 2XS2A 2E9RX 3DGPB 4W5NA 4NXNK 2P9SA 1IR0A 3SQOP 4HTLA 3I33A 4PXCA 3MEEB 3EPIA 4DUYJ 1RDWX 5E3PA 5KT7A 1S97A 1RDAA 5BPNA 4A4JA 2LXFA 1K8AT 2UU9J 5ETNA 2X3DA 3AO4A 1U04A 1HHSA 4CI6A 4NYPA 4CZEA 4JI0J 2GWKA 2OTLS 2Y8YA 4GVBA 1YXQA 4QR2A 5C15A 1DAXA 3PX6A 1L3KA 4FZYA 1XR6A 4R0JA 2UUBJ 1VQOS 5AQRA 2P9KB 1RHMB 2VUGA 5JLFA 2WONA 1BHNA 1UPPA 2LQJA 3BF1A 2YX4A 1GK8A 2O4IA 4CIOA 4OZLA 4B02A 3A2FA 4NLYA 2KKHA 1DTQA 4CYUB 2QLBB 4PHTX 1W26A 2D3O1 3HBTA 2D7SA 1UAXA 2E29A 5E3AA 3O8MA 3HZEA 2ATLA 4BVPA 3QINA 3OYFA 5A8RA 4H5VA 4ED3A 2HZAA 3OL6A 3T1HK 5CZXA 3FBEA 4QYRA 2EVZA 2D1CA 3H42A 4CQ1A 4C9DA 2RDIA 4OZ1A 2YI1A 2P5VA 2NXJA 5BR8J 1N36J 3JSBA 1KN6A 4P71A 5CZ2A 4IUFA 2AYEA 1MA9B 1ICEB 1Z6RA 3R5DA 3GIMA 2XYPB 1WACA 2KZMA 1R27B 4ATNA 2B6AA 1NRKA 3C66A 4J7CA 2X1BA 3P5TL 2LMIA 1IQZA 1ZOTA 1SQGA 1PCAA 3AOAA 3QLHB 2YNFA 1IBLF 4IFYB 1K1SA 3C6UA 3ULEA 4LSLB 3SJJA 2G8UA 3SMSA 3NAEA 3BSCA 4DPYA 3D66A 2OMOA 1Q81T 4MKYA 1RSCA 4RZRA 4AH9A 1P1LA 3Q7CA 1SKSA 3T5KA 1WC6A 1FDDA 1FX2A 5EWGA 3FBFA 5EXWA 3MMBA 3D2WA 1PJ7A 2HFSA 4OJRA 1KVKA 2D0AA 2Q6BA 2CJAA 2MKJA 4B3SJ 4OJ3A 4CJQA 3H20A 1GLAG 2QTWA 4B3OA 1GXTA 1S5ZA 3CJRA 2D0OA 4NLWA 2Y1JA 4LH5A 2ALYB 1OSDA 4JKBA 2CPHA 4KSEB 1IBMK 3I8BA 2LQ9A 1YITN 3QRPA 1DGKN 4DR2K 2P9CA 1NMEB 3W5ZA 2H9ZA 2WVBA 1S1XA 4OHYA 3UN5A 3PX4A 3A1YG 3GSIA 3RYLA 1CS4B 1ZYQA 5KI6A 1N0VC 3C16B 1RYSA 3LWMA 1CZ9A 2F96A 3OW2M 2V8DA 4EO8A 2LXIA 4IO9L 3AO3A 3LGNA 3WXKA 3MEDB 1LFPA 4EU0A 2VIHA 1FXXA 4I6MA 2ZHAA 1QM9A 3G6XA 5M1FA 1EX4A 5K5MA 5LM7E 3TX0A 1XI1A 4IOBA 2GGPB 4OI4A 4WIIA 6FD1A 2HHWA 4ZPBA 1W9HA 1Q82T 2GIRA 4OI1A 3QIDA 1OSCA 1S57A 1RLDA 3KLHB 2R8HA 3VQ8A 2XWYA 1IH7A 2BVZA 3EYZA 1FVQA 5J1NA 4QWBA 5A8WA 3LGMA 1JLGB 2W8KA 2MGZA 2Z2LA 1L5UA 4OYWA 3NS7B 3RRKA 1T44A 3DKDA 3ZTSA 3W64A 1RAAB 2EWHA 2B7CB 5E2QA 5IWAJ 4PR6A 3NBPB 4OIXA 4I7FB 1IQTA 4H5WA 4H8KA 2NXNA 1N54B 4M5IA 4WQ4C 3VQ6A 2FLLA 2FZKB 4UZBA 2R7TA 1QQNA 2X51A 4JS4A 1VRUB 1X9MA 3F9MA 2VG7A 1F9FA 2JJ4D 2DXFA 5HANA 4DV1F 3DOMB 4DU7A 2DGQA 1Q9YA 4K5SA 2GC8A 1F2HA 5KGXA 2W4PA 1YG0A 3QJLA 4ENOA 4DDFA 4A8YA 3CCSS 2FZCB 3DLHA 4DUTA 5ETVA 3TI0A 2O8BB 3AQOA 3KLFA 3ZSRA 4CJPA 3CC4N 3IKMA 2DR8A 1JKHA 4PWUA 4J2BA 5C5JA 1NK0A 4LT6A 4Z37A 3L3CA 4FJ8A 4AHTA 5LJ5Y 1I3OB 2PFDA 2KL8A 2O8CB 1D8ZA 1IBKK 4NXMF 2J6TA 2IVNA 2AV5A 3AV9A 4WP8A 3V5RA 1WC3A 1UA0A 5A0YA 4GKJF 1R89A 4ZKAA 4CHZA 2U1AA 4I9LA 1HNXJ 3QO9B 2CAJA 3SQ0A 4IXCA 2G4BA 4R5PA 2Q31A 2OPPA 3FCVA 4FJ5A 4DV4J 2H48B 1BDGA 1G15A 3FZLA 1SV5A 2FD2A 1XR5A 1B3TA 5FPNA 4C11A 5B0EA 4X62J 1IV0A 5B8HA 3AA8A 3KLIA 4CNYA 3H90A 1B0VA 4XK8C 4JI7F 2RF2A 2OD4A 3M8ZA 1SL2A 2E2NA 2KDOA 4DN0A 2FJWA 2V67A 3KNAA 3F2KA 3C15B 5G0RA 3AVKA 5HOOA 1IKXA 4XDDA 1MLAA 4BR7A 4NCAA 4IDKA 3EY1A 4Y28C 4BWMA 2VC0A 2JEJA 2QWRA 5C2FA 4DN9A 1MW7A 3KUEA 3DLJA 5FRMA 3H7HB 1SI9A 1LXJA 4KREA 2ROEA 1VQLN 2AHOB 5AJ3F 3VQBA 3ZSQA 2MLZA 2F8EX 5BREA 1J5OB 1TAQA 1EB0A 3LW5C 4C3MA 3OL8A 3K89A 1CBKA 4CLUA 3OTOK 3LP0B 2YWKA 3HFZB 5CZVA 4USUA 3EPGA 3OSPA 3GIKA 2IVMA 3NGIA 3VQTA 3N0VA 5I9EB 3O3LA 3G71N 3D0GE 2BDPA 4RX6A 3A8IA 1T9TA 5LSRA 3RAQA 4NLUA 3C14B 3NLCA 1RTIA 2BJ7A 3AH6A 2F4VK 4MO5A 1UKUA 3S01A 4IH6A 4AL7A 1JCGA 3T6JA 4QAGA 3UKRA 4CEDA 3U9DA 4RUBA 1Y0HA 3WXIA 2FHOB 3AA4A 3CC7S 3CC2S 2Z2ZA 2GJ2A 3J8AA 4FO0A 2ZBQA 2WK4A 2X7IA 4UUWA 2Z1GA 3M6UA 3ZC4A 4IQMA 3TABA 3CCWA 2YH1A 1HR0J 1ASUA 2Q97A 4ECSA 3ICLA 4OYAA 1RWUA 4Q43A 4ECTA 1NKCA 4B9SA 3TR5A 3E1YA 3TZZA 3BP8A 5HQ8A 5KFIA 2FLNA 1XNRJ 3CJTA 3AARA 2UXCK 1HLUA 5A6PA 3BF4A 3BYPA 3MUVP 4QIWD 2QMWA 4C4WA 4DCHA 3AAQA 4TU8A 5HQLA 1FERA 4BG8A 1UFWA 4C3LA 3S9HA 3AJDA 2AJ4A 2BE9B 4RNNA 3D7EO 3R27A 2MY7A 1TKDA 4XPEA 2FBYA 1VQPN 2I5JA 1TKTB 1VGYA 3CIMA 4MFBB 4F4AA 3P4IA 2Q43A 3RU0A 1FE0A 4CWBA 4DV6F 1QSYA 5HLFA 2UXDK 4CIEA 5GAHI 4DG1B 1OIAA 5F8LA 4P6QA 3MCPA 1C1CA 3DXMA 3NGZA 1XMQK 3SUOA 1JXEA 5L1LA 2DT9A 5KG3A 2Y3YA 2ZFHA 2CPIA 3MMAA 4CF9A 2KG0A 1EP4B 4DHYA 2ZHOA 1Q5YA 1N32F 4BR0A 3HHEA 2KHOA 4JV5F 2ZH6A 3UI3A 3FC9A 1WHVA 3WX4A 1WOSA 3F9KA 3AVGA 3VCDA 3I32A 4F67A 5FDLB 4JI6F 4F4KA 4KI4A 2YNIB 3P6YC 3DC2A 1HD1A 1RKIA 3PIPQ 1SJ3P 2DXDA 2G8HA 1K0TA 3SI6A 3GFZA 4KHYA 3HP6A 3LDNA 3Q22A 3OYAA 2PMWA 1YVUA 3GSDA 3K8WA 2CIMA 1YX2A 4WQ5A 2GBZA 5L39A 2C1EB 1DTTA 4CGHA 1DFDA 3CJ9A 4C8OA 2ASOA 2B9XA 1R7IA 3VETA 3KFWX 2D74B 4M3ZA 5DMRA 2CPEA 4BRHA 3QWPA 3FE1A 3EZUA 3GJTB 1RBVA 5KFSA 1FRHA 3BZKA 4NZ7A 4TXSA 1SBRA 4FK2A 4DL4A 2XHCA 1Q7YO 5KQDA 3NOCA 3QEWA 4DCOB 3OTEA 4F02A 2WW8A 2AJQA 5LY3A 2CRLA 3NVMA 4LF5K 4BREA 5AE1A 1PC5A 4O0NA 3PXGa 4M7YA 2BR0A 3PFOA 1GLCG 1IKYA 1OY9A 3ID6A 5DS7A 1KLMB 1TR0A 1M5OC 4QQBA 1KFDA 5LMUK 1YBUA 2CJBA 4H5RA 2P9NB 4U96A 1TUYA 2XS5A 1BQMB 2DGSA 1NZ8A 3IBWA 3WIVA 2FJBB 5A2QO 2GTDA 2B9YA 1KNZA 3P3DA 1KEKA 4X4UA 1YIJS 1LAWA 4HWIA 5J2NA 5AFUA 2LQ5A 1BCOA 2XLKA 3DN9A 3EVOA 2ZOGA 4HI2A 4WCEL 3SPYA 2VU5A 1N6QB 4B3RK 3ZETB 4DZDA 2RILA 1GMVA 4KGXB 2VG6B 4A46A 3LANA 1LW0B 3H46O 3ZCMA 3KKSA 4JI3J 3D1HA 5HQMA 4URQU 1FD2A 3ID8A 4K4XA 1QZ5A 1LEOA 2DXEA 1TFYA 5ITHA 2HYIB 4NI2A 4HDHA 4KB1A 4Q8FA 4CBUA 2UVRA 4DFJA 3SDEB 4JYAK 2VL1A 2DCLA 2H4YB 3D3BJ 2KYXA 3MR2A 4EO6A 3ENQA 3IBCB 3HSGA 2HW3A 4WF9Q 1VK3A 4PXEA 4EYIB 5ADXH 1TK5A 4WFBQ 2BJ3A 4ZTFA 3V1OA 2QLWA 5K8NA 4DV5J 4X66K 4ZPWR 3B8AX 1CQNA 3UD4P 1HI8A 3PV8A 3CJAA 4V1Ak 4RW4B 2DIVA 4B3MF 3THXA 3CCJS 4BQZA 3AGRA 3CD5A 5AQYA 1MWKA 2CNNB 2EFQA 4IEIA 3TP2A 1O51A 1LNQA 4DR4J 4H4OB 4W90B 3CFOA 2UV8G 2BRKA 1HBUA 5A2QU 3TSQA 3GDQA 3MXIA 4DPXA 5HRSA 4ZITA 2HSTA 1S6PA 3T19A 2J5AA 2BTFA 1MWYA 4FYVB 1LFWA 2W9BB 4A62A 4OYPA 1NHUA 4ZLNA 4HH0A 4XH5A 3HZGA 3H2LA 2XRIA 1RABB 4BRLA 5IV3A 2FHJA 2J8SA 4BRKA 2K7JA 1HKBA 2OSRA 1F9HA 3O6WA 3WEEA 2CH5A 4CJEA 3D6FB 4CBXA 3THWB 2RRBA 1RHRB 2L08A 2HK3A 5D3GB 1VQ7N 3CDWA 1RCOB 3MMCB 3AOCA 4G1IA 1RWNB 3EXYA 5ETPA 1K1QA 3AA9A 2H3EB 4RR5A 4Q0BB 5B0AA 3M8QB 3OFGA 4EGLA 2J6UA 4DOZA 1NDLA 5GINA 4JI8J 4DTPA 3I55S 3V6DB 4MIAA 3K5PA 2LU2A 3D1QA 2W6LA 5K9FA 3VQQA 1RA6A 4L8RB 3DRXA 1VQ5S 2QTDA 4NWBA 2ASLA 1IBKF 5HSPA 8AT1B 2F9DA 5E84A 2XULA 3PW0A 3FK4A 4LJMA 2NRZA 3VV2B 1MWZA 3MAAA 2R3VA 3OBYA 2K1RA 2JL9A 2MKYA 3JB9k 2AYMA 2C28A 1YI2S 4JI4K 2P8IA 1GT8A 1RACB 2C2MB 4KH1B 3O3GA 2BQUA 4CJSA 3CDAA 3B6PA 3VQ5A 3EGZA 3TA1A 4C8YA 4FJHA 1HWIA 4J9RA 1T9UA 1Q8IA 2HMIB 2XMUA 3OFFA 2ZKUA 2WCXA 4KHQA 5BYRA 2O8EB 3DJCA 3AVHA 4K43A 4LFBK 3QZ8A 1Q0NA 1S1WB 4EEYA 2X1FA 1T8EA 3WUHA 2C3PA 1I94F 1AZSA 3BSAA 4JKEA 1HBOA 4PG8A 3UN2A 4O44B 4OJGA 3NNCA 3NP5A 1MROA 3BREA 3MURP 5KT2A 2EC0A 2J7WA 2E6LA 4NO7A 4ZHRB 2UVUA 4KTZA 3J81j 2PI4A 1ZTTA 4KRWA 3OS1A 1WOQA 5KFKA 1U1LA 3IWNC 3U7JA 4QYZJ 4BGBA 2H5JB 2GUPA 4JI7J 4JV2A 2YWEA 4C23A 3AVJA 1RT7B 2IGIA 4DR3K 1ZTWA 3J7AP 4BRDA 2RHQB 4CGIA 3AOBA 1RHJB 2ZF5O 4JN4A 4G3IA 1FCAA 2YVSA 1DT9A 3FEZA 4RWXA 4C0OC 4GV9A 2DTJA 1GLEG 4MYUA 1TFWA 1K8KB 3BEXA 1QVFM 2F4FA 3ZLJA 2P6SA 1PIEA 1IR2A 3FBCA 2E4LA 1E6VB 1VQNS 4E7IA 1HBNA 4PQAA 5F1XA 1AROP 5KOWA 4DTXA 2A2DA 2QEXN 5DM7L 1VBKA 1JXBA 3SJHA 5BR9A 1HA1A 1VRTB 4W92B 3FCHA 1X4EA 1X9SA 2JWKA 4FPIA 2K3IA 2XY6A 1EWRA 3OYJA 2BANB 1RJJA 3IR5B 3EE9A 3SAGA 1WJ9A 4ELTA 2XLJA 4Q45A 1K9MO 4DTMA 3ZZYA 4LF7J 2GS8A 3M1FA 3M9NB 3QDKA 4IRDA 2E2PA 3TZYA 1FESA 2EKNA 4A8KA 2DJWA 2QZ8A 1UFKA 4ICLB 4MDAA 3M8PA 1L3SA 3J81Y 2HHTA 1HNIA 2RKIB 1XERA 4C0HA 4GC6A 3SFGA 3L2RA 4L3KA 3IM8A 3WNGA 5CA5A 1JLFB 4FK4A 2FY1A 1SKWA 2DPJA 2XY5A 4GVLA 4JKFA 1RA7A 4MK8A 3IAYA 1KVBA 3ZSVA 5F8HA 5IXUA 1X1PA 1RUSA 1X5SA 3GJRB 5G4DA 4DV0F 4CHYA 3VALA 4E3SA 2V63A 4C8ZA 4F2SA 4H0VB 4H4MB 1RTJA 1NK9A 2OMLA 4I4BA 5J1EA 3ZNUA 2VQFK 3OYDA 1TU0B 4U7UK 3EN9A 2WSCC 4DV3K 3F56A 4CEAA 5CYMA 3SCXA 2LYVA 2P9GA 1M0SA 2B8QA 1WTBA 4NASA 5DDRC 3M32A 5KG4A 3Q8VA 2NR0A 2QWNA 3H98A 3THYA 4NXNJ 3NMAA 2IRUA 2QV6A 2UXDF 1VOMA 4ZVOB 3RW7A 5B0CA 3DDIA 4WQ5C 4LR9A 4XDCA 3C6AA 1U25A 5D78A 2JFKA 4CLKA 2HKEA 4DV6J 2F9TA 4DV7F 2AGOA 3H5UA 3DGVA 2DNHA 4ID5A 2ROGA 2L9WA 1C0MA 1WSHA 2E6MA 1DBDA 3EJMA 3N28A 4BRAA 1N5YA 3FJ2A 1KVAA 4I69A 3BBFA 3G8TA 4JV0A 1S12A 4OX9K 3KTQA 1FKPB 4X4SA 3KHRA 3I96A 3VA0A 2OPSB 2E2OA 4AE5A 3N4QA 3LP1A 2M5YA 1ATNA 2N3LA 1DQ9A 1S10A 4CJ7A 3ZSZA 1NHKL 2BABA 1NK4A 1OS5A 2KTQA 2WBNA 3GG0A 4PL8A 3NL0A 1HYZA 3JXUA 4JI6J 2ZVIA 3UDEA 3J7ZT 2B9WA 3CDEA 2D3ZA 2XZWA 1U1MA 3LO3A 1CXQA 1RP5A 4JKGA 3LA0A 1AYEA 4LRFA 4IQXA 4BY9C 1JLQB 1VAZA 4E7JA 4MK7A 4UTGA 1T05B 2KH9A 1WF2A 3R2CJ 2BGGA 2DBBA 4JAXA 3CJ7A 3I0SB 1Q4RA 3T1HJ 2HVIA 2V4JA 3CJ0A 4LF8K 3UR3C 4TU7A 5CCLA 3NAHA 3LH2S 5ETOA 2M3DA 1D5AA 3OYGA 2HRYA 5EX5A 2I6WA 4Y1DA 3VTIA 2MTLA 3V9UA 3CJ8A 4WTYA 4LSNB 5BPMA 3OYNA 4PY5A 1HHQA 3DCAA 3M9MB 1J27A 1JWWA 1X8DA 1CJUA 2P9SB 3OBIA 1S49A 1HPZB 4LSZB 5L1KA 2OH2A 4MLHA 5JMNA 5DZ7A 3MEGA 4ECVA 2WB4A 2EFPA 5L9NA 2OANA 3VEZA 5IC4B 1LK7A 4QIVA 1MSWD 4JP8A 4BRMA 3NNAA 4ED5A 1VQ6N 4TLQA 1BWFO 1UVJA 1MU2B 1XQIA 4YB1P 1Y5LB 2OELA 3CCZA 4KH0B 4GVBB 4EAHD 3T1YK 3DRSA 1S48A 3GV7B 3GZ7A 1ZBIA 3OHRA 2IM1A 3WX8A 1IM6A 2F1FA 2V8VA 2H3GX 2HB5A 3O2IA 2JZ5A 2YHXA 1X9JA 4OHVA 4NZ0A 2FB0A 3HLUA 2WONB 3OTCA 1VSFA 2IFXA 3P1GA 4WK1A 3WNHA 1QJHA 4IBNA 4LBPA 2E5LF 2Y1IA 1CLQA 5F8NA 4CLYA 3T6BA 1G2EA 2CDQA 4UT4A 1DTQB 2DIUA 3EO3A 5FJ4A 5KPRA 3OYHA 4KHRA 2MEWA 3RB3A 4OYXA 2YKQA 3MM5A 3BUZB 3ILJA 2QKKA 2HG4A 4DF8A 4NCBA 2H5EA 2CA9A 4F3TA 2IMOA 1ASVA 5B08A 3HULA 2D3UA 1IBMJ 4A5BA 5A8RB 4OGCA 3MXJA 4IR9A 4DR2J 2RSQA 1WUAA 3Q8PB 1R8PA 3VF6A 4AHSA 3V81A 2RIJA 1IJEB 4QS7A 3OHBA 2ZKTA 3RRGA 1HWKA 2RH3A 3L0QA 4BWJA 3D2FA 4IOAQ 1XTZA 1CZBA 2BJ1A 3ZFVA 5HK4A 1YJ7A 3KD1E 4ZVPB 3PIPL 5GADU 1K0VA 4KT0C 1RT6A 3E01A 3QICA 4EP4A 5KFPA 2MZSA 3EWGA 4IH7A 2WHOA 3IAS9 1NNEA 1T3VA 3CM6A 1S22A 2YH0A 4DUZK 2W8LA 3CIZA 4B3MJ 5DG9A 2Q3PA 2ZWOA 3CDBA 5KFYA 1SH0A 1TUUA 5AQJA 4Q7AA 4YNQA 2HHQA 1NXIA 5HMXA 3Q7BA 4NL5A 4K0KK 5AQSA 4HI1A 3TAFA 4ANDA 1VC6A 4YDUA 3GONA 2EHGA 2BM0A 2RDDA 1S0OA 3BDEA 5D0HA 1AXQA 1E3MA 5LJWA 4ZIVA 2FQQB 3EGVA 4C1NI 5KFCA 4W98A 5J1PA 4CHPA 2GHVC 2PDAA 3AODA 3AVIA 2GO8A 3MMBB 1DQ8A 2KHCA 1FDAA 1RHKB 2I38A 3V9ZA 2DNYA 1X4BA 2P2CB 1KOHA 4FL9A 4AQYK 1IKWB 1YBAA 2C2DA 2GMJA 2UUTA 2ZH1A 4WU3A 4B3OB 1M1HA 4DFPA 1HKAA 1JK9B 1W2BM 4QS8A 2QWQA 4OLBA 1PBAA 1X7VA 1VQ4N 3W3DA 3CNQP 1D9AA 2HNDA 2CQGA 3TA2A 1N34F 2HFZA 4OO1J 3ISNC 2VPWB 4UOFA 3FGUA 2EKYA 3DXKA 4E1NA 1PO6A 5KFOA 2MHEA 3PW2A 2HF4A 3AQPA 4Z4IA 3DOKA 1RTHA 3T3FA 2O67A 1NMDA 3TVYA 1Q1KA 4ZDNA 1TV6B 3M2VA 1IBKJ 4HH1A 3OS2A 4CE9A 1NMNA 3ILIA 4C8NA 4E89A 3QEIA 2DGWA 3WIUA 1HNWF 1UETA 5KFXA 2VZ9A 1ACMB 3HT3A 4YOVA 3KDNA 3CMEN 3RW6A 3DI6A 1BLUA 2JH3A 4LFBF 3AY9A 1WAFA 1DLOB 1C1BA 2B3TB 3CF5Q 5DGAA 3IR7B 3LDLA 3NF7A 2ZBPA 3H59A 3NH1A 3MTKA 1BIUA 5A8WB 4CD3A 5JXSA 2MGZB 1J53A 3T9ZA 3UCGA 4ER8A 2EEYA 4LF9F 5DLFA 2ZWHA 1I94J 1NEEA 1Q8BA 3MAHA 3POTB 1QHTA 3M3ZA 1F1BB 2B4OA 4CO1A 1VQ8N 2RQKA 1CJVA 5B0BA 1B9FA 3W2VB 2DHGA 1GLLO 2CG4A 3GIRA 3H4BA 2R7WA 3M1VB 1RAFB 4NLBA 1QTMA 1XMOK 1RBUA 3W9IA 4J9VA 4M5MA 1R8AA 4ZA1A 2ZGZA 1GMWD 1ZS6A 3VAHA 3MR3A 3QSYB 2W2NP 3RUBL 1F0XA 2VG7B 2HEKA 5KFLA 3GB0A 1CULA 3DLBA 3BY5A 5JVGQ 4J2AA 3UKUA 4DXLA 3R9PA 1Y4ZB 2D4WA 2PY5A 2MZRA 2ZDPA 4KGMA 2DHHA 5GAHP 2BM1A 3OTOJ 4EMDA 2DGOA 3BZCA 2CQ4A 5IT9Y 3G8SA 3MAQA 4K4WA 3KLFB 2V5HG 3Q89A 3MM9A 3P45B 2FVSA 4O5BA 1GTEA 4HHUA 1MMDA 1DEJA 1TKXA 4C1NK 1ZPWX 1EZZB 1R6YA 2F4VJ 4O5FA 2CPZA 1WBBA 3VWSA 1U02A 3IRWP 2V52B 2P9LA 4KI6A 2UVWA 1O8BA 1BI4B 4ISEA 2A1RA 2CVEA 5A0YB 3TQEA 4M3XA 3ITHA 3O5TB 1AFIA 3EL2A 1YHQN 4FWNA 4XPCA 1ASWA 5AQNA 4H4KA 3PEHA 1RWXB 4HLBA 2AW0A 4MKBA 1I3AA 1IKVA 4KB0A 2B5JB 4ZVEA 3V6KA 2OPPB 5DQGA 3DU6A 2OPQA 4BDPA 4IO8A 5C12A 1Q5VA 2FC9A 4W5QA 1SV5B 4DZ6A 2J6SA 3UDLA 2V9KA 1FJGF 4ES1A 3ZTRA 2XZDB 4C11B 2CQ3A 2VWBA 2A0FB 4B1ZA 3U8XA 2RF2B 4CI0B 4Z4HA 2KXFA 4YDDB 4QBUA 3IAM9 4DSIA 1K73O 1ZBHA 3MCOA 2UXCJ 4K8RA 5G0RB 2AJ0A 1J5EK 4J9PA 4ZP9A 1IKXB 1SQFA 2QMXA 4OL8A 4DR5K 5KRTA 4J9NA 3KK3A 4Z94A 3IFEA 2XMKA 1J6ZA 1UPMB 4CJKA 4B9VA 1Y11A 4B3TF 4RPFA 3DHWC 2DTUA 5HRRA 4LREA 2FF6A 4CGDA 1YZ6A 4CGJA 4O8UA 2NNWA 5AZJA 1HQUA 3VGMA 1T0TV 2WSFC 4ZVUB 4L3QA 4NYNA 4CJVA 3UVJA 1LOUA 3ASMA 4DPWA 4F4YA 2UXDJ 2HURA 2W40A 2DH8A 4DSJA 4I2PA 3KG1A 1PKUA 2ZQBA 2QIFA 3M2RA 3SCIE 3E3XA 3PW4A 1RTIB 1XMQJ 4JKCA 5KG7A 1O13A 3AVBA 2VBXA 4FKYA 2DNZA 4DV2F 2E1AA 5GIPA 1NZAA 2CXEA 4QU6A 3K9JA 1Q8LA 4NE9C 1O0PA 4X64K 3UKRB 1R31A 4CH1A 3BR8A 4ECXA 4I6AA 1P8GA 5C10A 4NLGA 4LUBA 3W65A 4LF6F 3KHYA 2F7VA 3N6MA 2WBRA 4X65F 2DH9A 3EZ5A 4EBEA 1JQGA 4DF4A 3RB4A 1MN7A 4NB4A 4BC4A 2ASYA 1XNQK 2OD6A 3LDOA 2CJ9A 3L7OA 2DNPA 4D3GA 3R8YA 3AO2A 1FJEB 2D0PA 5D6GA 1EX8A 2HQDA 1PJ5A 1LWCA 2QW9A 5L46A 4ETZA 1NU0A 4BBYA 3VEVA 1RWWB 4PQUA 2ZBRA 2FJVA 3AAPA 3ZX3A 3M30A 3ATUA 4LC9B 2Y9HA 4MAKA 3RMAA 2YNHA 3WQUA 1NGJA 1I5OB 2R4FA 4Y1CA 1NPPA 5KFTA 4YUDA 1FDNA 2PN6A 2KJVA 5E3RA 4CJWA 2AJ2A 1WEXA 2AWZA 3VPZA 1S3XA 1SVDA 4IKAA 4CM2A 2VQEK 3DLGB 1BD6A 2Y0BB 3NGKA 2I5JB 1ZXOA 1SL0A 3L3UA 2VWJA 4BE1A 4RNHA 4Q5VA 4DL6A 2PAVA 4ZN3A 1VSLA 3SCJE 4C8MA 2B51A 4KHPK 4FBUA 1YITS 3D6RA 1Q86O 1FTRA 5CR4A 2G8IA 2PI5A 3PKMA 5HLFB 3R7BB 1KTVA 3R5BA 4RWWA 5LMUJ 5IC6B 2IAJA 2HVEA 2I2YA 4P75A 2XEXA 2V7YA 2YWGA 4U95A 5HRNA 2YWFA 1SIZA 2AEMA 2P51A 3D0HE 4N41A 2ACYA 2P6TA 4O23A 2ILZA 3QB0A 1SS6A 3GTYX 3OYMA 3A4TA 4DSKA 2GFFA 2NZCA 3L09A 2VB6A 1VSJA 1ULRA 4CTAA 4UOCA 3QJJA 3CGIA 2JLEA 3T41A 4B3RJ 3UFCX 4M3RA 3IBFB