1TKXA

Crystal structure of hiv-1 reverse transcriptase in complex with gw490745
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
537
structure length
534
Chain Sequence
SPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Design of non-nucleoside inhibitors of HIV-1 reverse transcriptase with improved drug resistance properties. 2.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords Pol polyprotein, Reverse transcriptase, Chain A
total genus 145
structure length 534
sequence length 537
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1tkxA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tkxA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tkxA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tkxA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1tkxA05
5HRPA 2R2SA 4O4RA 4F3TA 2BQUA 3RR8A 1RAJA 1RCHA 3MXJA 2V4QA 4ZPBA 4DFJA 1X9MA 1ZBHA 3DRRA 5D3GA 1LWEB 4FBTA 2OPQA 4J9PA 2D5RA 3AA5X 4LQ3A 3K59A 3F73A 4DF4A 1NHUA 1N5YB 1RDBA 2W9AA 1ASVA 3OYEA 2JLEA 3PX4A 4CJUA 3DM2B 2JC1A 1GX5A 1S1XA 5L1LA 4Q44A 2WHOA 3NFAA 4RW7B 2D3ZA 3QO9B 4XIUA 5F8HA 4YNQA 3M8RA 3V6DB 4JRPA 3M9MB 1WSFA 2IBKA 3GV8B 4O0IA 4NLXA 3LP2B 3PHEA 4IG0A 2AQ4A 1RT4B 5HP1B 3QIPB 5DQGA 3M8QA 4F50A 4NLTA 2W9CA 3QEIA 2BANA 4IH7A 1A5WA 1R0AB 4M45A 2QKKA 2AGQA 3KLGB 1IH7A 4RNOA 3SFUA 3P5JA 1T05B 3CDEA 3AA4A 2R8HA 4LSLA 4Q0BA 1ASUA 4FZZA 4ELUA 3SYZA 1CLQA 2YNFB 1WN7A 5KG7A 3V1RA 1Q9XA 3OYGA 3TAGA 4DSIA 1N56A 3KIOA 1TKTA 2GC8A 4F4WA 3V9UA 1WSGA 2I5JB 4I7FB 4O44B 2OPRA 2W9BB 2YNGB 3ITHA 4RW4A 3AVIA 4K4ZA 3BGRA 4I9QA 2OH2A 5C5JA 4U7CA 1XR5A 5KG4A 4GC6A 4PWDB 1RDCA 4DTSA 4JV1A 4JUZA 3AVNA 2OZMA 1TV6B 2IM0A 5L1IA 1X1PA 1QSYA 5JXSA 1FXXA 3FDSA 3AO1A 1SKSA 3MEDB 3L3VA 1HYVA 1Q8IA 2UVWA 4CHZA 1I3AA 3RB0A 5HRNA 1T8EA 3A2FA 3DMJA 3KLHB 4HUGA 3KKSA 3AVHA 2IM3A 2YHAA 3V81A 4KAZA 2WCXA 1RT6B 4J2EA 4KHWA 1W9HA 4K4SA 4K4YA 1KVBA 1G15A 2GIRA 4G1QB 3VA3A 4ZP8A 4CJQA 2IOCA 3AVBA 3H98A 4ID1A 5T7BA 4DTOA 1VSKA 4W5TA 1ZTWA 3IG1A 3L2QA 1VRUA 5FRMA 2UVUA 3DLRA 1NK0A 2AGOA 1CXQA 1KVAA 4M42A 3QO9A 3AVAA 4J2DA 2WRMA 3N6NA 2R7YA 3HPGA 2HHSA 2UVVA 5CYQA 2F8SA 1S49A 3E51A 2GIQA 2IJNA 4AH9A 4EYHB 3DLHA 4CGIA 4NLRA 3AVFA 3P83D 4DU1A 1LWFB 5KT7A 2AX0A 1BL3A 2IM2A 3MFIA 3SUNA 1TL3A 5KFRA 4E1MA 5EUHA 3NAIA 1ZBFA 1XC9A 1JLAA 3PW4A 4FM0A 3HL8A 5KT5A 2RN2A 3KLEA 1CSJA 2R8KA 1VSEA 2FVQA 3TVKA 4CK3A 3IRXA 4M3YA 2E9ZA 2B4JA 3WNFA 4QW9A 1VK0A 4W5OA 1RYSA 2XY7A 3MAQA 2V0NA 1JLFB 4OVLA 1TV6A 5KGWA 4DTJA 4K50A 4YR3A 4R0EA 3MR2A 1QHTA 2XI2A 4KHNA 3GIKA 3AVGA 3CIZA 2BE2A 4C8LA 1IKWB 2YHBA 3QESA 3OS0A 5FDLB 3PJWA 4Z4IA 1A5XA 5J2QA 1S6QB 1KHVA 1XI1A 2R2TA 3SQ2A 4HKQA 4H4OB 2PYLA 3K2PA 2XC9A 4KV8A 2QXFA 4Y34A 5KFIA 4DL6A 3NMAA 4O3PA 3NF6A 5KFZA 2GBZA 1U09A 4KB0A 3OYJA 1J5OB 1D9DA 4RNHA 1FK9A 4CJ4A 4CJFA 5KFVA 3TAQA 3CFRA 2ITGA 3DOKA 3QEXA 4KTZA 3LDSA 4FJJA 2J6SA 1NJXA 3DLKB 4I2QA 3JSMB 3QYYA 4NLYA 5F9NA 4FS2A 4FZYA 3QGGA 2XI3A 1C2PA 4E1NA 4ECYA 2ZD1B 2C22A 3WNHA 4N76A 2HWIA 3HPOA 3ZSOA 1XWLA 1Y97A 2PY5A 4CECA 3AVJA 1KHWA 4RNFA 1BI4B 4F2RA 5C42A 3PVXA 1GOAA 1RDDA 1JL2A 3O3GA 3VQ6A 2BRKA 4DTNA 1EKEA 4ZVFA 2FVPA 1S1WB 3BSCA 2ZE2A 4QWCA 4DSLA 3UR0A 4O4GB 3LWMA 1IKXB 4TY8B 1N5YA 1JX4A 1EP4B 2VG6B 4DLEA 3LPUA 3RWUA 3QIPA 1T03A 4NYNA 4KB7A 3KK2A 4HCBA 4K4TA 5KT3A 2AU0A 1IG9A 4NCBA 4WZQA 2FBVA 3ZT1A 4CEEA 4DMNA 1HQEB 4LD0A 4UQGA 4FJ8A 1S9EB 3HKWA 2VG5A 1K1SA 3NKYA 1JLCA 1L3UA 3QERA 1MU2B 1KLNA 4NRUA 2FC0A 3LAMA 3HM9A 4IRDA 5KFLA 3M8SA 4FJHA 3K5OA 1HNVA 4M95A 5I42A 5F8LA 4E7LA 2XY6A 4DFKA 4O5BA 1RT7B 4DL2A 4OKKA 1RT5B 5I3UA 5DQHA 4ED6A 3S3NA 5KGXA 1SUQA 4CF0A 3NF8A 3DRRB 3H4BA 2ASJA 1WAFA 4JLHA 1WAJA 2RKIB 2B5JA 3KK3A 3MFHA 4FW1A 2WONA 3RB4A 2IAJA 2IC3B 4DTUA 3PX6A 1U49A 5HBMA 2BQ3A 3AVLA 3AVMA 3CDUA 4GMJB 5HROA 5C25A 4CCHA 4LY7A 1NJZA 3PZPA 3BSOA 4O4GA 3M9NB 1W25A 3IGNA 4DWIA 4IRKA 3AVCA 4H4MB 3FSIA 4Y2AA 2C2DA 4Y1DA 4EBEA 2RF2A 5KFAA 3ICLA 5E41A 3RMAA 2HNYA 4IBNA 4FM1A 1RTHA 2AJQA 4DL7A 4N47A 1S1WA 1EXQA 1JLBB 4KI4A 1ZYQA 3F9KA 4RZRA 5KFOA 3LPTA 3H2LA 4ID5B 3KMSA 3RMBA 4EO6A 1B9DA 4H54A 1S9EA 5KI6A 1C0MA 1S10A 5KFPA 4FYDA 3CM5A 4ED7A 1S1VB 4NCAA 1TKTB 3L2WA 1IKXA 4TY8A 3VQ9A 3OVNA 4DSEA 1JKHA 2B6AA 3I5BA 1BGXT 3DOKB 1LW0A 4C8NA 3G6VA 2Z1IA 4IFYB 2DFHA 1QSSA 3KLFA 4CEFA 1NJWA 3HSTB 2VG6A 5K14B 1XHZA 3DLKA 4I2QB 1L3TA 3TAMA 3MR3A 4KHSA 3QEVA 1JIHA 4YQWA 4KHQA 4WXWA 3PUFA 4JV0A 2HNZA 3V4IA 4CERA 2YNIA 2R2RA 1VSJA 4PUOA 3QEWA 4IG0B 4ECSA 1JL1A 2KQ2A 5SZTA 2YKNB 3DOLA 3OYDA 2WK4A 4M41A 4DFMA 2ZD1A 1J9AA 1QE1A 5KG2A 4CIGA 3C6UA 4FLWA 3TR8A 3NAHA 1VSDA 4IFYA 4KREA 3AA2A 2JEJA 5DG7A 4OL8A 3QZ7A 5J2MA 1WSHA 4KTQA 5KT4A 2IA6A 1NK8A 5DG9A 1RBSA 4WXOA 3MXIA 4TN2A 3KK1A 4RU9A 5C25B 4CJLA 4CJTA 3OL6A 4ED1A 4NLOA 5KFNA 3GIJA 4CJEA 2VWJA 2HHVA 3EZ5A 4KKOB 3ZSRA 4DTMA 4NLSA 3SI8A 2HVIA 2YKMA 5DG8A 2E6MA 2IM1A 4FJGA 4HHTA 1RT3A 2QE5A 1RTDB 1K6YA 3CFPA 1RT2A 2Y1IA 4TQRA 3O4NA 5FROA 1NK9A 2V9WA 1IKYB 4W5RA 3FFIA 3ZSQA 3PO4A 3VQQA 2OZSA 3OYNA 1VRTB 3PJXA 4URQU 3QGHA 5J2QB 4Y1CA 1KRPA 4J9OA 1CZ9A 5CYMA 3BQ0A 3QLHB 3OJUA 1NHVA 4ZVGA 2BE2B 4O55A 4KO0A 2EC0A 1S0MA 2XGPA 3HVWA 3OYBA 1TGOA 3OHBA 3V9SA 2HHXA 3KHGA 3GIIA 1DTQA 1T3NA 3VQ7A 4O3OA 1Q9YA 5FRNA 4NLGA 1REVB 2WTFA 3RBDA 3KLIB 3CJ4A 3T5HA 1CXUA 4DEZA 1KLMA 1C1AA 3SUQA 1BISA 4BDPA 3EY1A 2G8IA 4WE1B 4NLDA 3FFIB 4AILC 4FK0A 3H40A 1TKDA 4J2AA 2CKWA 1HMVA 2HHUA 2F8EX 4K4UA 3HHKA 1QAIA 2JEIA 2IC3A 1NK4A 1KFSA 4DQSA 3HVAA 2D41A 4IFVA 1EX4A 3BJYA 2RKIA 4CE9A 1BCMA 1GOCA 3HVTB 2W8LA 3O3FA 4AHTA 1RA7A 4CESA 2PZSA 4FJIA 2V4RA 3I5CA 4XO0A 4MIBA 2XHBA 4K8ZA 1QE1B 3NBPA 3FQLA 4RG8A 4NLWA 4WFZA 2R2UA 4Q8EA 4I7FA 4O44A 4ZMMA 4ECTA 4Z4HA 2ZE2B 3Q8RB 3ZT2A 1EETB 4B8AB 1TVRA 4ZP9A 2XCAA 1IKYA 3K5MA 4QWEA 5C24B 3RBEA 3TAMB 3DLEB 1BI4A 4J9KA 5K14A 3GQCA 2HMIA 4CHNA 2XY5A 2KTQA 4CHQA 5F8NA 1TL1B 4E7HA 1EP4A 1T7PA 5KRSA 3BQ1A 3LP0B 1U48A 1LW0B 1HNIB 3KJVB 3CDWA 1VSFA 1R0AA 4EO8A 4WZMA 3D45A 4C8MA 1N48A 4J9QA 4B3OB 4DL3A 3AO5A 4DG1B 4EBCA 1D9FA 3I0RA 2HNDB 5J2NB 5J2PA 1XR7A 4FW2A 2UVRA 4CEDA 3BQ2A 3MECB 3V1QA 4DTRA 4TY9A 4WYWA 3OHAA 2OPRB 2W9BA 3PV8A 2DPIA 4B9VA 4DS5A 3UQSA 4CEQA 1C0UB 2R8JA 4EP5A 2D0BA 4M3UA 2VG7A 2FVRA 4NLPA 2JGUA 2FLLA 1RTIB 2HNYB 3NF7A 3RRGA 3VQSA 4HTUA 4J9NA 2I5JA 4FJNA 2IS3A 2UUWA 5DMRA 3DDKA 3ZCMA 4FVMA 3D0PA 2E4LA 4YR2A 3AO3A 2P51A 2X74A 5FDLA 3N6LA 2AX1A 2BANB 5KFTA 3MECA 5KFGA 1RBUA 4FXDA 5KFYA 1JLQA 1SH0A 4NCGB 4K8XA 1QAJA 3KLEB 1C0TA 3IS9B 3LZJA 2NUBA 3NL0A 2VA3A 2WONB 1FKPB 4RW9B 3DRSB 1S1TA 5DK5A 4M94A 4OKJA 2VA2A 3M8PA 1FK9B 5F8MA 3L3UA 1JLEB 4E89A 3LANA 2C2EA 2HHWA 1JXBA 3D5MA 2QK9A 1S48A 2D0CA 4TSXA 3NBPB 4KV8B 4Z4CA 4E7JA 4RNMA 5JS2A 1EETA 1KLMB 2W8KA 4IH6A 5L1KA 3CM6A 1UA1A 1A5VA 2KZZA 2I1RA 5KG5A 2QV6A 5KFUA 3UDLA 2J6UA 3NE6A 3QIOA 4EZ6A 4MKBA 3EPGA 3L2RA 4HUEA 1NNDA 4QWBA 2KFZA 3HYFA 1S97A 3SI6A 4RUCA 4WYLA 3HVTA 2JC0A 4MFBB 1JLEA 5KG1A 2DFEA 4AHRA 4IQXA 3VQCA 4RW6A 5EWEA 1C1CB 2X6SA 2JEFA 1MU2A 3NGZA 1U04A 3DMJB 3PY8A 1DTQB 1RTDA 4O0JA 4H8KA 3BR9A 3OYAA 4HUFA 3QEPA 1ITGA 3AV9A 1BHLA 3UIQA 3KK3B 4QWAA 4RW8A 1S0NA 2XGQA 3K57A 4W5QA 4ELVA 1S9FA 4Y2CA 2ATQA 4DS4A 2XCPA 1RA6A 2R8GA 1L5UA 5CYQB 3OYCA 2G8KA 3FQKA 5J1EA 5DLFA 4X2BA 3C94A 4ZVEA 3VQ5A 3KHLA 3ISNC 1DLOA 2BGGA 1B9FA 2HNZB 4RW9A 3DLGB 2FVCA 2X6NA 2Z1GA 2VG5B 2KZMA 1CZBA 3PW5A 1XHXA 1TAQA 1T05A 4QCLA 4F4YA 3QETA 5KFJA 1Z4UA 3DRSA 2FLNA 1HPZA 1YT3A 2GUIA 1F21A 2YNFA 3SQ4A 1X9WA 2EX3A 1YVUA 1IKVA 3TARA 1YTUA 4ECVA 4IKFA 4QAGA 3QGIA 1T94A 3JSMA 1S9GA 4YMEA 3IN5A 1SV5B 4B9LA 4CJKA 4M3XA 2YNGA 2C28A 4BWMA 4KHUA 3DLGA 1HNIA 3I0SB 3SQ0A 1DTTB 4I2PA 4YP3A 3C6UB 4F4KA 1L3SA 3HP6A 2BDPA 4EBDA 3RR7A 5KFEA 3ITHB 1IO2A 1I39A 4FLUA 4FJ5A 3NCIA 4NLVA 5DQIA 1S0OA 4Q8FA 4IDKA 3U3GA 1SL1A 4FK4A 3MTKA 1RBTA 1WSIA 1Z25A 1S1XB 2HHTA 3TI0A 1TP7A 5KFDA 4O3SA 1SV5A 4EYIB 1UWBB 1TK8A 3C95A 5L9XA 3ZSWA 4KRFA 1J5OA 3LP2A 3KLFB 2FBTA 1BQMB 2OPSB 3CO9A 1JKHB 2IAJB 2P5OA 4RW8B 2PYJA 1FKOA 3ZT0A 1C1CA 4NLUA 5KFMA 3OYLA 4EZ9A 2B5JB 2IMWP 3B6OA 4R8UA 2WB4A 4DU3A 4QPXA 4QWDA 3B6PA 5JUMA 3OL9A 3DM2A 3H5SA 4IH5A 1GOBA 2F96A 2B43A 3OYKA 4ID5A 5KG3A 1RNHA 4PQUA 1S6PA 4KFBB 4JRQA 3HXMA 3ZSVA 2FJVA 4ED2A 3T3FA 5KFFA 1KVCA 4RW6B 1JLAB 4CGGA 4IRCA 4BE0A 4Z0UA 3LP3A 4E7IA 2P5GA 4CEOA 4B9SA 1LWFA 2G8WA 1BQNA 3KKRA 4FJKA 3V9WA 4IR9A 3VQPA 2QKBA 3KHHA 3VQEA 5HROB 4CFDA 2XRIA 3G10A 4CIFA 5JS1A 3DRPA 2VWKA 3DYAA 5KG6A 4DU4A 2Y1JA 4B9MA 3VQ8A 4CFBA 3WNGA 3SUOA 3CJ2A 3BREA 3MEGB 1KSPA 3TQ1A 1RT6A 4FM2A 4FCYA 3NF9A 1FKPA 4O3QA 4CEBA 5EDWA 1QTMA 4W5NA 1BQMA 3S9HA 1RT2B 3VN5A 4ICLB 3NH2A 1LAWA 4ZP6A 4NLQA 1BCOA 1J54A 2YKMB 3VQDA 3S3MA 2OPPA 2C2RA 5F8JA 2AGPA 3T1AA 3SV3A 1SUQB 3DRPB 4M3TA 4NRTA 3BSAA 1RDRA 4KFBA 4MK7A 3HO1A 4TQSA 4G1QA 5F8GA 1NKEA 4CIEA 1RTJA 3KTQA 4GC7A 4R8UB 3I5AA 4J9LA 4IG3B 5KT2A 4CGFA 4AHUA 1BIZA 4CK2A 1K1QA 4LQ9A 1VSIA 3ZSYA 3VA0A 4F4ZA 3KHRA 4TYAA 2Z1HA 3OLAA 4N41A 3OLBA 5F8IA 4FJLA 3TABA 3JYTA 1RT3B 1RBVA 4KPYA 3CFOA 3I0RB 4BE2A 4F2SA 1WSEA 1UWBA 3OYFA 2YNIB 3DI6B 4B3OA 3NGIA 5EU7A 3IS9A 1MMLA 4K4WA 2KFNA 2CJQA 3O4QA 3K5LA 3KNAA 1J53A 5HP1A 4CHPA 4IDKB 2HMIB 1X9SA 3RRHA 4CGJA 2J6TA 2HHQA 5KTQA 3H5XA 5KFKA 3NH1A 1SH3A 4KTWA 3KJVA 5EWGA 1NK7A 1TKZA 4H4OA 5SWMA 3V6DA 1LW2A 1S6QA 3CVKA 3LZIA 1JLBA 4ECXA 4CEAA 2EHGA 4CJPA 3TAEA 4O3NA 4HVJA 4FLZA 2UUTA 4M3RA 4LH5A 4LSLB 3NGDA 4FLVA 1SL0A 4N56A 2ETJA 4F3OA 4DFPA 3S3OA 3CJ5A 3SQ1A 1HYSA 4Z4FA 1XR6A 3U6FA 2A1RA 4Q5VA 4K4VA 4BE1A 4CF2A 1ZBUA 4FLXA 3KD1E 3KOAA 1HQUA 4IR1A 3AVKA 3C6TA 1LV5A 3IRXB 3N6MA 2RF2B 1RT4A 4ZPAA 3BDPA 1YVFA 3TWHA 1SKWA 1O1WA 2B6AB 4AHCA 3K58A 5KT6A 3OL7A 2DFFA 2OPPB 3LP1B 3KMQA 2OYQA 3PR4A 1TL1A 1S1VA 3V6KA 4L8RB 3JYTB 1HJRA 3TAFA 4LSNB 4TYBA 4BWJA 5KFXA 3GV7B 4OKEA 4CEZA 5CY4A 4F8RA 2IGIA 3PW2A 4B8CA 1DLOB 3PW7A 3CG7A 4ED3A 3EPIA 5D3GB 2E9TA 2HB5A 4H4MA 1TK0A 4NZ0A 5CYMB 1S1UA 3V9XA 1C1BA 3OYIA 5HLFA 1VRUB 3THVA 2ALZA 5HRRA 1B92A 3G86A 5CZ2A 3P1GA 1WSJA 2F8TA 4NYZA 5I42B 2KW4A 2AWZA 3IAYA 1RT1A 1RILA 4ED0A 3KD5E 3VQAA 4CGHA 4WE1A 4BACA 3SZ2A 2LSNA 1WLJA 3I8DA 1FKOB 3QINA 4J9RA 3SPZA 4URSA 1TK5A 1JLCB 1C0TB 3KLHA 1NOYA 2DTUA 5DGBA 2X78A 3OSPA 3RAXA 1RYRA 5KFWA 4KO0B 4XPCA 4ZTJA 4RNNA 1LWCB 4O3RA 2IDOA 1L3VA 4PY5A 2RDJA 1TAUA 3Q8QB 4MKAA 1ZETA 3IG1B 1JLQB 1RT7A 3C6TB 3ALYA 4C8KA 5C42B 5CZ1A 3OYHA 4DTPA 4FLTA 3L8BA 1JXLA 2VG7B 2FBYA 4Z4GA 1YTAA 3MXMA 3H08A 4DL4A 4PWDA 4E0DA 3V4IB 4OLBA 1DTTA 3V1OA 3MR5A 2HAIA 1OS5A 4RUAA 1QUVA 4OPJA 4FJ7A 2BR0A 4DL5A 1UOCA 2GV9A 3UPFA 2FVSA 1N6QB 3WNEA 3LALA 4IKAA 3NH0A 4OPKA 2HWHA 1ZBLA 4DQQA 3OSNA 1TKZB 3PW0A 4J2BA 1JLGB 5J2MB 1S4FA 4FS1A 4G3IA 1SKRA 1HRHA 1HYSB 3EZUA 4GVMA 3LP0A 3DI6A 1S9GB 1KCFA 2WOMB 3CJ3A 1U47A 4C8OA 4J9SA 3T5JA 4CF1A 1HARA 1TQLA 1N6QA 3VQ4A 2WOMA 4Q45A 4DTXA 4RW4B 2W42A 2ATLA 1VSMA 5KG0A 1HPZB 1JLGA 4MQ3A 1N4LA 1RDAA 3RMCA 3O3HA 3PX0A 1RBRA 3GILA 3OY9A 4I9LA 3SJJA 4PA1A 4KBIA 4MH8A 3EYZA 4AHSA 1IKWA 2D0AA 3D28A 5KFSA 3OJSA 5KFHA 4ZPDA 3SNNA 4IG3A 4DG1A 5F9LA 4CJ3A 1SH2A 3NGYA 1JLFA 3GIMA 4CF9A 1ZBIA 1GX6A 3SUPA 4J9MA 4E19A 3IGVA 4DSFA 2G8UA 1QS4A 4F4XA 1NOZA 3E01B 4KHMA 2OPQB 3ASMA 4WFYA 4ZVHA 4QOZB 5C24A 4FJMA 4MK8A 4ECRA 4B9UA 4ED8A 4DQIA 3HVRA 4IFVB 5DLGA 2RPIA 1S5JA 4Y3CA 2Q3SA 4CGDA 4DQRA 4CHYA 4OGEA 3RMDA 3M9OB 3ZSXA 1C6VA 5HBMB 3HP9A 2FBXA 3KLVA 4Q43A 3G6XA 3DLEA 1D1UA 5KFCA 1JXEA 3ISND 1D5AA 3NAEA 3CYMA 3TAPA 4OGCA 4FK2A 2A1SA 3QLHA 1NK6A 1ZTTA 4AHVA 3PO5A 2G8VA 3Q8SB 1TKXA 4R5PB 4TXSA 3FRZA 4E3SA 1IM4A 3HT3A 4ELTA 2ASLA 4NYFA 4ZTFA 4PQUB 4BDYA 4CJVA 1C1BB 4KHYA 1TKXB 4R5PA 3ZSZA 1NJYA 1BIUA 3MF5A 4KAIA 3V6JA 2XO7A 4E7KA 1D8YA 3H4DA 3CQ8A 4ZHRB 2BRLA 4GW6A 4WFXA 1VSLA 1S1TB 3LP1A 1S6PB 1RT1B 1U45A 4ICLA 5T14A 4CFAA 3LAKA 1REVA 4CJWA 1HMVB 3SCXA 2OA8A 3HK2A 3OS1A 3G6YA 5KFBA 1UA0A 3KK1B 3ULDA 2ZKUA 3VQBA 1BQNB 3MEGA 4ZHRA 4DLGA 5KFQA 4Z4EA 3ZT4A 5DGAA 4MFBA 3T5LA 3AO4A 4KKOA 4MK9A 3DYAB 4MIAA 4FZXC 3MR6A 5I3UB 4KI6A 1T03B 1UAXA 2YNHB 1HQUB 3QIDA 4U6PA 2YKNA 3DOLB 3V9ZA 4LSNA 1S1UB 1SL2A 1HNVB 3T19A 4HYKA 4PUOB 4B9TA 2FLPA 1VRTA 3OL8A 4DSJA 4I2PB 4CFCA 3DLBA 3I0SA 3V81B 2ILZA 3BGRB 3HPHA 2G8HA 3PR5B 3HJFA 4NCGA 3Q8PB 3QNOA 3AO2A 4M3ZA 1HQEA 3M8PB 3CJ0A 2ILYA 1NKCA 3MEDA 3RB3A 1LAVA 1HYZA 4LH4A 1I6JA 4IOBA 5L1JA 3OS2A 3KK2B 3E01A 4ECUA 4EP4A 2W7PA 2Z1JA 2R8IA 5J2PB 2IJFA 4DQPA 4QW8A 4FBUA 1IKVB 1RTIA 4FLYA 2ZQBA 3AA3A 2D7SA 2P1JA 1VSHA 4M3WA 1QSLA 4ZP7A 1C0UA 1NK5A 1TVRB 3OYMA 3L2VA 4BDZA 1ASWA 1RTHB 5HRSA 4FJXA 2YV0X 5J1EB 2O4GA 1KFDA 4KE5A 1WNSA 4XPEA 3G0ZA 2O5DA 1W0HA 3NHGA 4FJ9A 1QQCA 4CK1A 1LW2B 4CJ5A 4RW7A 2XY8A 4HCCA 4CJRA 3U3YA 3M8QB 2E9RX 2YNHA 4Q0BB 4ECZA 4B08A 2HNDA 5J2NA 3K5NA 4EEYA 1LWEA 4N5SA 3KLGA 4KSEB 4OLAA 4CJSA 3H5YA 1Z26A 5EWFA 2HW3A 2W9CB 2DY4A 3SPYA 4K4XA 4CHOA 3RTVA 2D3UA 3SV4A 4JS4A 4CF8A 2FJWA 4ECWA 1TL3B 3TANA 3KLIA 2W7OA 3RAQA 3SFGA 3H5UA 2DPJA 4KHRA 4ZPCA 1RT5A 5HLFB 3NDKA 4OJRA 1D0EA 2FJXA 3MEEB 2HVHA 4JV2A 1RTJB 3LWLA 1LWCA 2JEGA 3MEEA 4DSKA 2E6LA 2BQRA 3GYNA 4B9NA 3CWJA 4YFUA 3T5KA 3BSNA 3QZ8A 3QNNA 1WNEA 4JS5A 2O4IA 3GV5B 5KRTA 3H59A 4TLRA 1KTQA 2RDIA 2XWYA 4KB1A 3L2UA 4ECQA 2ASDA 3RB6A 4DF8A 1NKBA 2G8FA 1U4BA 3ZT3A 4YR0A 4URGA 3V6HA 2OPSA
chains in the Genus database with same CATH superfamily
3B8HA 4F3TA 1RAJA 3A8IA 2B4PA 3CI5A 2V4QA 5LJVA 2MKIA 4DFJA 3J7YI 2FYXA 4HHJA 4JI7J 5D3GA 1T11A 4ZOSA 1YAGA 2V51B 3WHIA 1V9OA 3TRGA 2D5RA 4LQ3A 3UD5A 1N5YB 4LIRA 1FXRA 2J0QD 4CJUA 1VQOS 2JC1A 3SSSA 3LUYA 3AB2B 3M30A 3M8RA 4R25A 4JRPA 2MQ8A 3GV8B 3ZTOA 2EFQA 2E5GA 4CLTA 3PHEA 1XQIA 1S7IA 5DQGA 4ZVRB 3M8QA 2O8EB 2N3OA 4GVBB 4X4PA 1A5WA 4M45A 3GE9A 3K0JA 2QKKA 2Q1NA 4C48A 4RNOA 3P5JA 3BZQA 4KH1B 1T05B 3IXQA 2R8HA 1Q78A 1ASUA 4Y0WA 1F5CA 3SSQA 3BY5A 1C4CA 1WN7A 5LM7E 5ETKA 1BA0A 1M5HA 3TAGA 3ETOA 4QJVA 1BY9A 3SBMA 2YWKA 3CDAA 4O44B 3VESA 2W9BB 4E98A 2YNGB 3FMBA 3AB4B 4ZVOB 3ITHA 1TMJA 4I9QA 2OH2A 4WCEL 2AKWB 1N34J 1ZS6A 3CMES 1DFDA 1RDCA 4IO9L 4DTSA 2UXCF 1HNXF 4JUZA 2RE1A 2OZMA 1C0GA 3E1YA 3OW2R 3AO1A 4U67L 2P9KB 4JV5F 2CGLA 4GMKA 4CHZA 5HRNA 3QMLA 3CXCR 2DISA 3A0IX 3R7NB 1VQYA 3DMJA 1FO1A 2PMWA 3AVHA 1H2UX 2DHSA 4KAZA 2ADBA 4CNYA 3R6LB 1PYSB 3R9LA 3CF5Q 4K4YA 3OFGA 4AQYK 4CBXA 5F0UA 2MY7A 2VODA 2QM1A 2YPYA 5T7BA 4X62F 4MO4A 3GFZA 1ZTWA 2ZC4A 1HPMA 1VRUA 1SKUB 3OTOK 1YJTA 1KVAA 4XK8C 4M42A 2ASYA 3J7A1 5B0DA 1PGZA 2V68A 1RU2A 2WRMA 5CH7B 3N6NA 2R7YA 1OH6A 1N34K 3HPGA 2ZUGA 1VQ6S 1S49A 4OYBA 3E51A 4BRFA 4EYHB 5IT4A 1OYDA 4DQ8A 5L39A 5EX0A 1LWFB 2IJRA 2AX0A 5GAGU 5K5MA 1BL3A 5KT7A 1BWVA 3WC2A 4QPTA 2OFHX 3NAIA 2VBZA 2CPHA 2VJVA 4FM0A 3HL8A 3LF0A 2CDQA 4OJ3A 2MQOA 3UKRB 4JYAF 2R8KA 1A9NB 4DV7J 2H5JB 1Q86O 3AAPA 4ITSA 2YKAA 1IBKJ 3AAQA 4JI6K 4QW9A 3ZO7A 5CCMA 1RYSA 1NPKA 1JLFB 4OVLA 4TU8A 2RQMA 4IOAQ 4K50A 3MR2A 4KHNA 1UVIA 4FXWA 3CIZA 1IKWB 2HRYA 3QESA 3PJWA 3GSDA 3THXB 2YJEA 1A5XA 4W90B 5J2QA 1S6QB 5ETLA 1XI1A 4HKQA 4JI0J 2PYLA 2XC9A 2XQCA 5THWA 2QXFA 4DV0J 1XNRF 2J0XA 4YHHK 4O3PA 2ZNYA 2QT7A 2NSBA 4KB0A 1F2GA 4HWIA 2XMUA 2YKQA 4TU7A 4CJFA 5HN0A 2DXEA 1S76D 4M5DB 1FW6A 4KTZA 1Y10A 4A8YA 4IOCL 5IT9O 5LMUK 4LF5K 4NLYA 5F9NA 1Z05A 3G82A 2CQ4A 1C2PA 4E1NA 2QL7B 1PSDA 3HM8A 1Y97A 1V3ZA 4OX9F 2RHKA 3CD6S 4CECA 1KHWA 4YY3F 4JKBA 2YY3A 5M1NA 2M2BA 5A2QO 3J7AN 5C42A 1GOAA 1U2RA 1HI0P 1V3SA 2CQIA 3LGHA 2BEFA 3Q2TC 2CRLA 2E20A 3MPWA 1EAYC 4DN0A 3BSCA 3DKDA 2HPUA 4QWCA 3JSYA 5ETQA 4DSLA 1T9YA 4O4GB 4JAXA 3LWMA 3GLJA 2A2DA 1ZC6A 4BR0A 2VG6B 3RWUA 4K0KK 1WOSA 1RP5A 4LF6K 3KK2A 4HCBA 4K43A 4DV0F 2B8QA 3PRVA 3WC0A 2CJAA 3ZT1A 4DV4F 3Q8YA 4EK2A 3ENOA 2Q6BA 1OVQA 2RQKA 4C4WA 3HOSA 3KUHA 1JCEA 4H0XB 4FJ8A 1F60B 4YB5A 2JFDA 3PIOL 1KLNA 4LIWA 2FC0A 4JEPA 1BA1A 1U25A 4IRDA 5KFLA 3M8SA 3EX7B 5HK4A 2B51A 3K5OA 1HNVA 4M95A 1UW4A 3J81U 2HQFA 2MB0B 4YDUC 2JOQA 2P9IA 2F40A 1N33F 4PR6A 2BMBA 3TUPA 4P72A 3DRRB 4GO7X 1TU0B 3PHTA 2CA9A 3KK3A 4G6VB 4DHYA 4P7TA 3MFHA 2LKZA 1OY8A 4G1PA 1NM1A 5AQTA 3QDKA 2JNJA 5HBMA 3AVLA 4UOHA 5C25A 3K5PA 3NNCA 4CCHA 4LY7A 2VQFJ 3FUYA 3M9NB 3QGPA 5H9EK 2ZOGA 2PEBA 4LFCJ 4ZVTB 4EBEA 3T41A 4RBUA 3RMAA 2HNYA 2DCUB 2QSFA 5CHCB 4LRCA 3BO3A 1RWWB 4N47A 4C23A 3D6MB 3K8WA 1NHKL 3H2LA 5C7PA 4ID5B 1NSAA 3WIUA 7FDRA 3RMBA 1YHQS 4DV3F 4ZA1A 2CQ0A 4E8UA 2E2NA 1B9DA 2CPJA 1X4AA 2LQJA 1C0MA 1IBLF 2KVQE 2V63A 4DSEA 4L6V3 4FPRA 1BGXT 4IO8A 1OSCA 1RXOB 5IC4B 3H6EA 4L73A 2WW4A 2IYGA 5K14B 4I2QB 4DV5F 2MQMA 4JBCA 2PFFB 3QEVA 2IBOA 2HNZA 1DQAA 2EXUA 1YHQN 2R2RA 1QJHA 3HHLA 3R5DA 4Y2KA 2KQ2A 5SZTA 5AQSA 3DOLA 2WK4A 3TJAA 1H2VZ 1QE1A 1IBMJ 4CIGA 4OI4A 5M1QA 2VQFK 4B9QA 3CC2S 5E7OB 4FYXB 5IQQA 2JEJA 3UO0A 3EXCX 5FPDA 1WELA 2YQ3A 2AIRB 1IWAA 2IA6A 3GFYA 1D9AA 3MXIA 5CZVA 4RU9A 5AXNA 5C25B 1S72S 4CJTA 5D78A 4ED1A 4NLOA 4WFBQ 3CO0P 4KKOB 5DRKA 4NLSA 2FHKA 2E6MA 2BKOA 4N8OA 2IM1A 2BH1A 1RT3A 3ZTSA 1RTDB 4OYIA 3CFPA 3W8PA 2GQ2A 3O4NA 4I67A 1IKYB 4W5RA 3FFIA 3MXHP 2WBMA 3PO4A 4WQ4A 4I6YA 2COLA 3PJXA 1RHQB 1DAXA 4F4AA 3QT6A 4AXIA 2XLJA 5CABA 4J9OA 3BQ0A 5CZXA 3T1HF 2ZWHA 1IBCB 4DUYK 4A8WA 1VQ4N 2EC0A 2WBRA 1S0MA 2XGPA 3OYBA 3OHBA 2GTDA 3GIIA 3VQ7A 5FRNA 4NLGA 3BBCA 3KLIB 2VFSA 2VFVA 3GTYX 3CJ4A 1XMQF 1WHYA 2BJEA 1Q53A 1UVKA 1Q81O 2M88A 1QM9A 1RHKB 4NLDA 3J80O 5D0RA 4AE5A 1RK8A 1KN6A 4AILC 4FK0A 3O8MA 2CKWA 1HMVA 1R0CB 1UZDA 2IC3A 3BKFA 2DPNA 4ZK7M 5AQFA 2E7WA 3K8VA 2WVBA 1TFYA 1H38A 4CQ1A 3SMPA 3P39A 3T1YF 4AT1B 4PQAA 2HEKA 4F36A 1VHIA 2A42A 2W8LA 4CESA 2MLZA 3BGUA 4QYZJ 4B1UB 3LGNA 3NRBA 2DITA 4RG8A 3FQLA 2RU9A 2R2UA 4ECTA 3JSBA 4PL7A 3Q8RB 3RBXA 3ZT2A 1IR1A 1EETB 4OZ0A 3R6GB 3AFGA 1BO5O 4DR1J 3IM9A 3A13A 5LMNJ 2QWLA 4WTOB 3QFWA 2NRZA 2AYEA 4J9KA 5AZIB 4LT6A 2XY5A 1RCXB 3DGPB 4CIOA 2Y0SD 1R8CA 1HNIB 2MQNA 5GIOA 1VSFA 4LFBK 4USWA 3PACA 1N48A 4BREA 4H5NA 4DL3A 3AO5A 4DG1B 2BOAA 4P6QA 1D9FA 2UUBJ 5J2PA 4FW2A 2UVRA 4CEDA 4FP9A 3FFKB 4DTRA 1WI6A 2A5XA 1SVDA 3MGJA 3UQSA 4CEQA 2AJ1A 1C0UB 3G87A 4QR0A 4PRFA 2UUBK 4ZPVR 3AXMA 5HOOA 4O0NA 3CJAA 4WP3A 2XBPA 3EZWA 3RSEA 3Q23A 1O51A 2FLLA 2HHPA 1RTIB 1N32J 1GLDG 4F9OA 2DNKA 4JI5F 1IR0A 4J9NA 2PAVA 2I5JA 3QB0A 3M32A 3TU5A 5A76A 2E4LA 3A1YG 1GTHA 2P51A 2X74A 3N6LA 3SCLE 2BANB 1VQNS 5KFGA 4FXDA 4NCGB 4WWSA 3B4MA 3QAUA 4EMDA 4RWWA 5IOLA 3IS9B 4P73A 2QFJA 1FKPB 3DRSB 1S1TA 5DK5A 4M94A 3G6EN 3M8PA 2RD5C 3M2UB 1P1TA 3W66A 3PEJA 2UUCK 3ADAC 3AT1B 4A2AA 5ETOA 3TA0A 3BO4A 4HH0A 1K8AO 4BC2A 1GLLO 4ILLA 1VS3A 2XSFA 5DM7Q 1YJNS 2ZOFA 3BF4A 4Z4CA 2HURA 2ZJQL 3KUEA 1AYEA 1KLMB 3VAFA 1UA1A 2KZZA 3DXMA 3JXUA 5KFUA 5H1SQ 3NE6A 1X5SA 2ACMA 5AQNA 4MKBA 5D4LA 1WOPA 2OHDA 4J91A 5C12A 1RAEB 1JNZB 3SI6A 5LJ3Y 4RUCA 2JC0A 3ZZRA 3UE2A 1JLEA 3NEKA 2HVZA 1RLDA 2BXJA 2PA8D 1WBBA 1X3MA 1H73A 2JEFA 4NYOA 2J0SD 1NLKL 2R7TA 3CCEN 3PY8A 1GLCG 2GELA 3MPYA 1WSRA 5K8MA 1ITGA 4Z2XA 2G2YA 4M63A 2M3DA 3MR7A 2JX2A 4CP5A 1S0NA 4GKKJ 5ADXA 3K57A 4W5QA 2XEXA 2IVYA 1HNWJ 4MLEA 2CQ3A 3RG6A 4DV1K 2UU9K 4X2BA 5DLFA 3G2XA 1Y5IB 2EPIA 1ZM3A 1DLOA 5A0YB 3A8YA 2Q1LA 2FY1A 2HNZB 1WDDA 1GXTA 1RKJA 4OJ1A 5RUBA 2Z1GA 2MHNA 2VG5B 2KZMA 3PW5A 1IBLK 1HBMB 1VISA 2DD8S 5ETPA 2R42A 4A8FA 2GUIA 3H1QA 4CLLA 3SQ4A 2EX3A 3N5FA 2ZF5O 3ZEUB 1Q16B 4WFAQ 4IKFA 4M5KA 3E2EA 5LOQA 1W97L 3ENQA 1SV5B 3HX9A 2R7WA 4CJKA 3TTDA 4ZJQA 4KHUA 1HNIA 3I0SB 1DTTB 5IM0B 2B7CB 3U9DA 1CC8A 1G4CA 3FBFA 1U24A 1UL3A 3RR7A 3EXYA 1IO2A 1I39A 5F2RA 3UDCA 2BUNA 2YX1A 1HIYA 5AFUH 5FJ4A 2NRXA 1P6TA 2A10A 3TX8A 1RBTA 1WSIA 1Z25A 1ZPVA 2J5AA 5FLXY 1S0VA 4C3MA 5KFDA 4FWPA 4UOFA 1TUUA 1J5OA 3NXZA 1IJJA 3W62A 4MKVA 1NDKA 2YHYA 3I87A 1WTFA 1BQMB 2OPSB 1JKHB 4B3TJ 1BWFO 2P5OA 3LDLA 2XYGB 3ZT0A 1C1CA 1VI7A 4B1YB 5KFMA 3DXKA 3OYLA 2UXCK 2LU2A 4KGMA 4EZ9A 3HD2A 2WB4A 4DU3A 2FSJA 3OL9A 3J81O 5KPZA 1OQ3A 2HVDA 2F96A 2B43A 3OYKA 4ID5A 3UNGC 2HHHF 1RNHA 4WU3A 1S6PA 2W2PP 2FJVA 4A61A 3FRYA 4IRCA 1JXVA 2DNMA 3OPKA 3LP3A 4E7IA 2DVIA 1HBUB 4B9SA 4MYTA 1BQNA 4FJKA 2YXLA 3MMVA 4DR3J 1Y9OA 3VQEA 2XRIA 3TTCA 3G10A 4CIFA 2YX4A 4AL7A 4DU4A 3VEZA 2A40A 1YI2S 1M1HA 4CFBA 3VGLA 3CCLS 1QY7A 3CJ2A 1HLUA 3W61A 2UXDJ 4EUVA 3JTOA 4FM2A 3PNIA 3CHWA 3NF9A 4O3QA 1BQMA 1RT2B 3GR0A 1E4GT 3PG9A 1J54A 1QQNA 3DXKB 5D4PA 3QPIA 4QR2A 2GJ2A 2OPPA 4YOTA 3SV3A 2DGOA 1DY3A 4NRTA 2FPHX 1RDRA 5CXTA 4MK7A 3PLAA 3NG8A 5L8RC 3UD4P 3GJRB 7FD1A 2VQFF 1NKEA 3KTQA 4CIEA 5C2FA 1Q8KA 1FRIA 1UWAA 4GC7A 2WBNA 4H0YB 4I4BA 4RUBA 4CGFA 2AMCB 4AHUA 1KVJA 4F3QA 4LQ9A 4NX9A 4GV9A 1A7GE 4IWVA 5G0RA 4TYAA 1RFQA 2FDNA 2ZHOA 2XMAA 2KM8C 3TABA 1RT3B 3CFOA 2R9LA 1UWBA 3OYFA 3DI6B 1A0OB 3ZNUA 3CTRA 1MMLA 4I0WA 1T44A 1GLFO 3K5LA 2LQBA 3MM6A 5HP1A 4C98A 3EE3A 2HMIB 3NOCA 2J6TA 2HHQA 3H5XA 3MUMP 1FFSB 5KFKA 4OO1J 4CH7A 3KJVA 1NK7A 3CCSS 1NBEB 3QT7A 4H4OA 1S6QA 3MMBA 4J5OA 4ECXA 1RQ0A 4CEAA 3OBWA 3TAEA 3PEHA 3NMUA 2PO4A 4FLZA 2UUTA 1N54B 4B3TF 2ETJA 1FDAA 4CZMA 3CJ5A 1FJGF 2LP4A 1CQNA 1FESA 4FOIA 3HOTA 3BB5A 1XR6A 3U6FA 1N8RT 4Q5VA 4MYUA 4K4VA 3M3ZA 3IBFB 1ZBUA 5BXIA 5B0EA 4IR1A 3NLCA 5DZ6A 3R7SB 1HKCA 3E8OA 2IVFB 2NPFA 2X7IA 1DZ5A 1GMUA 1YQHA 3H8YA 2ZH2A 3N4WA 3UFCX 4C0BA 3D6RA 4LRBA 2KYZA 5DDOC 1TL1A 4RTFD 2DNPA 3TAFA 1S4EA 1T95A 3OVAA 4RU2A 4BWJA 3L4QA 3TJ9A 5I4MA 4CLFA 4CEZA 4QR1A 2QWNA 5D4OA 4B8CA 3PW7A 4M5LA 1OPIA 4ED3A 5D3GB 2E9TA 4H4MA 4UOCA 2HK2A 4AXJA 1M90O 3V9XA 1EJ7L 3VF6A 1VBYA 1RZMA 4I1TA 3THVA 2ALZA 1YBTA 1E6VA 1GT8A 3CD7A 4K0KF 1DKGD 1UZHA 2F8TA 2KW4A 2E88A 2AWZA 3HI0A 4AL6A 3WXKA 1CPZA 2F1FA 1WLJA 3I8DA 3DC2A 1CBKA 5HMZA 4J9RA 2KRBA 1PILA 3SPZA 1JLCB 4L3NA 1NOYA 5DGBA 1TYQB 3OSPA 3OR2A 3RAXA 4CZFA 4W98A 4IO9Q 2MJNA 3CJ1A 4KO0B 4CVNE 4RNNA 2Y1LB 3ZZPA 4OHWA 3SDEB 4PY5A 1GMVA 5AXLA 1TAUA 1NLVA 1E4FT 5DDPC 3CMQA 3IG1B 3WQTA 2V2QA 2D1CA 1KC8T 5H9FK 5A6WA 4AQYF 4IUFA 5CZ1A 3PIPQ 3OYHA 3T1YK 1NH7A 3L8BA 3O1BA 3EWGA 2VG7B 5IT9Y 2FBYA 3O9TA 3MXMA 2QA4S 4KH6A 3H08A 3UKUB 4RCHA 1B99A 2B7BB 4ZVUB 4E0DA 4K0KJ 1DTTA 2V6AA 3V1OA 1ZA2B 2HAIA 1OS5A 3U27A 2K1RA 3MM5B 3ZTRA 4FJ7A 1FA0A 2BR0A 2DR8A 4LMZA 1UOCA 2FVSA 3VAHA 3CQYA 5JJBA 2Q0UA 3GE1A 3WNEA 4BRHA 1Q82O 1CJUB 4IKAA 1NG9A 3NH0A 2A2CA 1TKZB 1S4FA 3LP0A 4C8YA 3CJ3A 2IFXA 4J9SA 1YJWS 2HAFA 3FJ2A 5FPNA 2HKEA 1HARA 3LGMA 1N6QA 1UVLA 4K42A 3EVOA 4Q45A 1TUGB 1H7WA 2ATLA 3OFEA 1RDAA 4NA1A 3PX0A 1S12A 3O3HA 3CC4N 1ZAWA 2UXBF 3LW5C 2VC1A 2ACYA 3PRDA 3EYZA 2D0AA 3D28A 4BQLA 4ZPDA 2BABA 2H65B 3LH2S 1XMBA 1PO6A 1SH2A 3NGYA 3O9UA 4NMXA 4DV4K 1XEZA 2UXDF 4MJKA 4CF9A 5B7WA 4J9MA 4C0HA 2LXIA 3AXKA 2FZGB 1NOZA 1GQEA 1YRUA 3E01B 2QI2A 2OPQB 2ZM6F 4WFYA 4ZVHA 3HULA 4EFHA 2M8HA 1SPBP 4DQIA 2O8BA 4DR6J 4IFVB 5DLGA 2RPIA 4MIWA 1TUYA 4I56A 2OI2A 2HIYA 3DGPA 3N01A 3RMDA 1C6VA 4WFBL 3HP9A 2FBXA 3KLVA 4XH5A 4Q43A 3CJRA 4H0TB 4ILGB 1JXEA 4C11A 3DAWA 3LM9A 3QLHA 5GAGI 1VQ5S 3QBCA 4QS9A 2QTDA 3Q8SB 1O8BA 4R5PB 4TXSA 1HWUA 4NEZA 4NYFA 1XNQF 4J9UE 4F3MA 1U8SA 2J7KA 1N0UA 2OTLS 2FTRA 1GLBG 3M1VB 1BIUA 3TEGA 3MF5A 3V6JA 2XO7A 4E7KA 2GHVC 3H4DA 3F2KA 2MGZA 4ZDNA 1QAXA 2E1PA 1VSLA 1GFWB 4OZ5A 3LP1A 1RT1B 1U45A 2ZWPA 1HMVB 3RW6A 3VGUA 2OA8A 1BOTO 2HF3A 3G6YA 2ABYA 1VMBA 5KFBA 1UA0A 2F5GA 2ZKUA 3ULDA 3J81j 3MEGA 2NUHA 1SXLA 4Z4EA 3ZT4A 3GMGA 2KHCA 2G4BA 2KT2A 4DUZK 2VKZG 2RUSA 2HRUA 4P75A 3DYAB 3Q22A 1S72N 3D9BA 5I3UB 1UAXA 4O8UA 1HQUB 3OHRA 3QIDA 4U6PA 3DOLB 3FC9A 1S1UB 1SL2A 4HYKA 2BVZA 1ZZFA 1CJTA 4PUOB 1AW0A 1F9FA 4B9TA 5BR9A 1VBKA 4HT7A 4CFCA 3V81B 2G0IA 2ZH6A 3BGRB 4UF4A 4X66F 2L3MA 4DR3F 4JK9A 2LQ9A 2ZJPL 1RE1B 4WTYA 2FLOA 3AO2A 3WIVA 1N36K 1Y4ZB 5U47A 3VAIA 2ALYB 4BCAA 1KDNA 2W2NP 1FE4A 3UCZP 3SAFA 1N8RO 4LH4A 2R7VA 3SJHA 1YGYA 4LVOP 5FPEA 4FPBA 3KK2B 2CQHA 2GQQA 3R2DJ 4ZLLA 4WF9Q 3LOUA 5J2PB 1KAYA 4FBUA 1Q7LB 3CULA 3AA3A 2DNLA 2D0OA 4ZP7A 2CVEA 4QZVB 3QRQA 1C0UA 1NK5A 3OYMA 4KH0B 2C3MA 1M5SA 1MMDA 4JKCA 1WKJA 4BDZA 5AQMA 2A18A 2HZAA 1NGIA 3D66A 1Z2LA 2Z8QA 3AA8A 3NHGA 3V4MA 4CJ5A 1RWVB 2QJ3A 5ETRA 4WBFA 4B3MK 4B1XB 2HQDA 5C10A 2HBLA 2E9RX 4K7QA 1WKLA 2ZDPA 3L95X 3K5NA 1VC6A 3FZ2A 1FNXH 1R8BA 2M0GB 2CWKA 1HBNA 1V3RA 3I56N 5EWFA 1YIJN 2DY4A 1RHRB 5A0YA 3SPYA 3RTVA 2D3UA 3SV4A 4JS4A 1HWLA 2Q79A 3M2VA 3OR2B 4AFFA 4ECWA 3SFGA 4B1VA 2NRTA 4KHRA 1LXJA 2KT5A 4L74A 4ZPCA 2F9TA 1E6YB 1U2VA 1DGKN 2FJXA 2KO1A 4JV2A 2I8EA 5LMNK 1YTYA 3PYFA 1F0XA 2YX7A 1EZZB 3EICA 1WG5A 3VWSA 4YFUA 2CPYA 3EDQB 2VUGA 3BSNA 3GWCA 4ANCA 1WNEA 4JS5A 3GYXB 4ENOA 3GV5B 1HKBA 4UT4A 3CT9A 3GJSB 3GDQA 2MEWA 4TLRA 2RDIA 2MJUA 3ILLA 4AYBD 4KB1A 3QFPA 4KGXB 5HVGA 3PJ9A 4B3SF 4ECQA 2YI1A 4IFEA 4JI2J 1U4BA 2VV5A 2JDJA 2B56A 3VTHA 3MMJA 3CJ7A 2V2VA 3RR8A 2DGXA 4DV2F 3C15B 2BW7A 2ROPA 2UXBJ 1SJ4P 4CO3A 3IA0A 1FJ7A 5M1FA 4BROA 3IR5B 4DF4A 2HIQA 3R1HA 1NHUA 4LF4K 1ASVA 5LL6Z 4ISGA 1GX5A 1S1XA 1T02A 3BKTA 5L1LA 4Q44A 3MN9A 2FY8A 4RW7B 5H9EJ 1RLCL 1QAYA 2QL9B 4YNQA 4JKEA 5EVZA 2QWPA 5GADI 2U1AA 4GRSA 2PSZA 1MSWD 1TFWA 5AZJA 4O0IA 1R8HA 2K2PA 3LP2B 2AQ4A 4JN4A 2XWXA 5HP1B 3V5RA 5LMNF 1UAWA 2VASA 2CGKA 2W9CA 2QWRA 2Y1RI 2NPIA 2AP6A 4IH7A 1R0AB 3JAMU 2EWSA 4X84A 3MMAB 2A6OA 2O8EA 3KLGB 3SFUA 2V8VA 1YK9A 2QWOA 4A62A 4LSLA 5F41A 4Q0BA 3AA9A 4FZZA 2CJBA 2EFVA 1CLQA 5KG7A 1PAEX 4X4UA 3CGIA 3RYLA 1Q9XA 4X62K 3DLLL 1VHFA 2KU7A 1TKTA 1C0FA 3KZBA 2FC8A 2QW9A 3V9UA 1WSGA 1V5VA 2I5JB 3HHLD 4I7FB 1BC6A 3CCTA 5EN1A 2W01A 4UZCA 4RW4A 4LFBJ 4F25A 3G82B 3R1LA 4CLSA 4PWDB 4HTIA 4PG8A 2XZWA 5L1IA 3NS5A 1QSYA 1FXXA 1NGFA 3MEDB 3L3VA 1NCLA 1T8EA 2XLKA 3P6YC 1NDPA 5A8RA 3KUGA 3KKSA 3R6MA 2YHAA 4C8ZA 1AFIA 3AHPA 2WCXA 4F0KA 2JWLA 1W9HA 4K4SA 2V94A 2P9LA 1JK9B 4G1QB 3R8EA 3IRWP 2KVIA 4M63C 4ZP8A 4CJQA 2IOCA 2OMOA 3AOBA 4DTOA 4W5TA 3IG1A 3MMCB 2Q31A 3DLRA 3VR1A 1CXQA 1KOOA 3AVAA 2GX8A 2H4WB 4U96A 2EK6A 6FD1A 2HHSA 5AQIA 4KHPK 2F8SA 5GINA 4CGIA 4WFNL 4NLRA 3AVFA 3GFXA 3UN5A 2IM2A 4E1MA 1PAUB 1XC9A 1UETA 1JLAA 2LYVA 1MWYA 2NRRA 2QTWA 2IY5B 2JZ5A 5KT5A 4N7TA 2VPYB 3KLEA 5BN9A 1CSJA 4H5VA 1XJWB 1VSEA 2VCPA 3JXOA 5D6GA 1YZ7A 1VC5A 4M3YA 2XHCA 3OQ2A 5GAHU 1VK0A 3MAQA 4DX7A 3THTA 2HZVA 2IRUA 2D9PA 2R7XA 3J7Z5 1NNEA 2YHBA 3OS0A 4P10A 3GJQB 4FZVA 1XMQJ 2R2TA 5AQRA 3SQ2A 1MLAA 3K2PA 2AYMA 1UJ4A 5HVHA 3VAKA 3TZYA 5KFZA 1VQPS 1U09A 2ROGA 3FZLA 3W2WB 3OYJA 2ZH8A 1FK9A 1H0HB 2NXNA 2HFNA 4PKDB 5KFVA 5A8WB 2ZEJA 3TAQA 1B3TA 4X4QA 4M5MA 3MAAB 2MXYA 2F65A 2J0WA 3QEXA 1VCTA 4LF8J 2UUAF 1NJXA 3ULEB 5CHIA 4FWOA 3QYYA 3W60A 2W2QP 3I31A 1WOQA 4ECYA 1PG5B 3WNHA 2HWIA 1K9MO 4JI8F 4RL1A 2JHEA 1EKRA 4X62J 2IDLA 2PY5A 2O8DB 4ZPWR 4WKRA 5BYRA 1NUEA 3M30B 2CNLB 2MKHA 4CD3A 3FK4A 3UR3C 3W9IA 4ILHA 3PVXA 1SI9A 2DNNA 1RDDA 1X5TA 5EHHA 2HQCA 3O3GA 2BRKA 4ZVFA 2BM0A 4RBTA 2FVPA 1XNQJ 1S1WB 3C16A 1G2EA 3L4IA 1CC7A 3T69A 4CZCA 3UR0A 1N5YA 4YN3B 2FC9A 3QIPA 2XG8A 3MDFA 1T03A 1WEXA 1N5TA 1N33J 2RHSB 2AU0A 1IG9A 2QIFA 1WHWA 2KKHA 4IEIA 1RAFB 3NVMA 3LDPA 3W5ZA 2XS7A 1XUPO 3E66A 4PXBA 1CEZA 3HJVA 4DR6F 3KWGA 1U7LA 4CO2A 3EEQA 2V2KA 4YDDB 4NRUA 2ZVSA 3LAMA 3CC2N 1WC6A 1HLWA 2CZ9A 3C7NB 1AZSA 5AT1B 2HBZB 2YVSA 3ENWA 4OKKA 1RT5B 4J9VA 4YOXA 4WF9L 2WZ1A 2VPWB 3CMAN 2ASJA 2QO3A 3MCAB 4JLHA 1ITPA 4FW1A 3G4SS 3FBBA 3RB4A 1WOOA 1IM6A 1Z1ZA 2IC3B 1YJUA 1WD6A 4DTUA 3PX6A 2KLAA 2BQ3A 2W40A 4A2BA 2P2CB 5GMEA 4PAAA 1CS4B 3BEGB 2F8MA 1NJZA 1FF2A 4TKTA 1WC5A 5E26A 1NH8A 3BSOA 5IQ6A 3IGNA 4IRKA 2YWWA 3L7OA 4H4MB 1F6TA 4LRAA 4USTA 3FSIA 3DCAA 2IIRA 4Y2AA 2C2DA 3OXGA 3D0GE 3M6VA 2O01C 4Y1DA 2QLBB 2RF2A 3RGIA 2GAHC 1S57A 3ICLA 1XC3A 4IBNA 4JI8K 1RTHA 3A5OC 4DL7A 1YITN 1JLBB 1TL7A 4KI4A 1Y00A 1ZYQA 4BR4A 2F9JA 3GZ7A 2AA4A 3LPTA 3NOGA 3CCUS 3KMSA 3PIPL 2X1FA 4EO6A 1BQXA 4GV6A 3KG0A 4CLYA 3M2UA 1S1VB 3VQ9A 2QL5B 2M8DB 3VMFB 1EWQA 2MKYA 1LW0A 4ZIVA 4C8NA 2DFHA 2H4YB 4BQZA 3D6HB 1NU4A 1NJWA 2O8FB 3DLKA 1VQMN 5T41A 5C2CA 1YF5L 1JIHA 3D6FB 4QS8A 1PC4A 3V4IA 2NLXA 2RILA 1VSJA 1APSA 1X4HA 4OX8A 4IG0B 2V67A 4DFMA 1J9AA 3BN7A 3POTB 1CVJA 3C6UA 2SXLA 3TQEA 3TR8A 3FZBA 5BRHA 2CIMA 4IFYA 2G0CA 4KREA 3O3LA 5DG7A 4OL8A 3W5XA 4P7VA 5KT4A 5DG9A 4X4VA 1Q8BA 4WXOA 4TN2A 3K17A 3KK1A 1F3VA 2MQPA 4PG7A 4YY3J 4OLOA 4OJGA 2NLWA 1Q5VA 4PXDA 1KOHA 2E5HA 3CQXA 1Q7YO 2HVIA 4KHPF 1U2FA 4OQJA 3UI3A 2QE5A 1RT2A 2Y1IA 1NK9A 2M52A 2NSCA 3HZ6A 1AUDA 1FVSA 4HVZA 5HMWA 3OYNA 3ZZZA 3QGHA 3SMZA 4Y1CA 4NPOA 1CZ9A 4C9DA 5CYMA 1KKHA 3QLHB 2ZBQA 4MMOA 1VQ9N 2EBGA 2NNWA 4HL9A 1FJGJ 2N3LA 4AM6A 1ZAVA 4O3OA 4ZVQB 3RBDA 3U1NA 3Q24A 4IQMA 3EY1A 2G8IA 1WC0A 4WE1B 4LR7A 1G99A 4DDFA 4K41A 2CPZA 2HOEA 1TYQA 2UXCJ 3Q89A 3R97A 2BM1A 3M1VA 5E3PA 3MCPA 3HHKA 1NK4A 1KFSA 3WEEA 3PKMA 4WFAL 2F63A 1BG3A 5AQJA 1AZSB 1EX4A 4CE9A 1AA1B 3QFHA 1BCMA 1KNZA 3VZHA 4FJIA 1X4EA 3AQPA 1X3NA 4ED5A 4MLHA 5F3ZA 3C6AA 1QE1B 2YWEA 5H1SV 3NBPA 2ZBCA 4WFZA 5LSLA 1NB2A 6AT1B 1K44A 4ZMMA 2ZE2B 4FO0A 4B8AB 4X64K 1TVRA 3ZZOA 4ZP9A 1VQSA 2OGUA 2B4VA 2KG0A 3K5MA 4XEIA 5C24B 1VQLS 4EFAC 5K14A 2VF3A 4DMZA 2KTQA 2AD9A 5F8NA 1KAXA 4E7HA 2Z30B 4JI0K 3LP0B 3RJMB 4CLKA 3VF2A 4HR2A 2Z2ZA 3CDWA 4EO8A 4WZMA 4YOUA 4C8MA 4E2FB 5DM6Q 4J9QA 1NZAA 4JI8J 2V8DA 2FJAB 3I0RA 5J2NB 2QN6B 1XR7A 2KHOA 2I7NA 4HACA 3O44A 2M5YA 3FSXA 4LF9J 4TY9A 4OYMA 2W9BA 3C65A 3PV8A 2DR6A 1KEKA 2DXFA 4ANEA 4USMA 4B9VA 3AAWB 4GY2B 4JI7F 2R8JA 3CJ8A 1Z6RA 2NZCA 2X1BA 3PM9A 3W7BA 2JFKA 3HDSA 4PWWA 4GV3A 3VQSA 4HTUA 5TKWA 2BV3A 2VGMA 4L75A 4GVEA 2MKCA 2FF6A 2P9PB 2DNZA 3AQOA 2L9NA 2XMMA 2AJFE 4FVMA 2FD2A 2AX1A 5KFTA 3MECA 3WXLA 2ZBRA 4PXEA 1EQYA 1UFWA 3NCRA 1SH0A 4BRKA 3DLLQ 3D4JA 1XMOK 1QAJA 3U1LA 2BW2A 3KLEB 1JB0C 1GNKA 3LZJA 2NUBA 3W3DA 2VA3A 2DGSA 4RW9B 4LF2A 1RJJA 4FN5A 4H4KC 5HMXA 2D3O1 3T1HJ 5GMKa 1Y5LB 4A8XA 4IZ9A 3F41A 1FJCA 4E89A 2C2EA 2CG8A 4TSXA 4I6MB 1ATNA 2L9WA 4KJIA 1KR4A 3OUYB 4NO7A 4RNMA 2MGZB 1EETA 2W8KA 4IH6A 5L1KA 4NLBA 1OH8A 1Q81T 3LL3A 2CZ4A 2I1RA 2YBVA 5KG5A 2J6UA 1DT9A 3QIOA 1OKJA 4EZ6A 3EPGA 3L2RA 1NNDA 3HYFA 5KG1A 2DFEA 3M2RB 1WDTA 3Q7CA 4UZBA 3VQCA 2GJIA 2DHHA 3GG0A 1C1CB 2X6SA 4JNEA 1U0HA 4OV6A 3VCDA 1U04A 2G2OA 2HSEB 3MDQA 1ZBTA 1RTDA 4OYOA 3QICA 3BR9A 3OYAA 3PFEA 3QEPA 2KFYA 5IXUA 5J1NA 4QWAA 3T1YJ 5CAAA 4RW8A 3B8AX 4DN9A 2XGQA 5I3PA 4QQBA 3ILIA 2DH7A 2DTJA 1S9FA 3KKFA 4Y2CA 2RJZA 1RA6A 1L5UA 2R8GA 5CYQB 3OYCA 3C94A 3N79A 3X1LB 2P9LB 4HEA9 5D8HB 2KL8A 3KHLA 2R4FA 2BGGA 1NPPA 2ADCA 2R7QA 3MMCA 4RW9A 2NUUG 3DLGB 1WI8A 1IBLJ 1DBDA 2O8CB 1WF1A 1K9MT 2AT1B 1XHXA 2G1DA 4M8LA 1B4SA 3HHLB 1IR2A 5KFJA 3DRSA 3W0LA 4KGVB 1HPZA 1YT3A 4A46A 1D4XA 3PYDA 2I38A 3TARA 1M90T 1B70B 2UU9J 4BR9A 4DR6K 3O9QA 3JSMA 3IN5A 2HQIA 3MMAA 2YTCA 1OYEA 3QSYB 3Q2SC 3UVJA 3CCES 1R3NA 3UCGA 4CZKA 2V8GA 4F4KA 2DNGA 4ES3A 2GA7A 4YOWA 5KFEA 1HR0J 3KDOA 4O23A 3NCIA 3NGKA 3IDHA 4B3MF 3UN3A 2F7VA 5DQIA 3E3XA 1QZ6A 3SXLA 4JI2K 4FK4A 3EZOA 1WBDA 3ZZUA 4MDBA 2H1YA 4EYIB 2RE2A 4LBHA 3ZSWA 1UVNA 5KOWA 1QVFM 2DJWA 1U6BA 3VVUA 2CNKB 4JI3F 2IAJB 4RW8B 1LFPA 2C3PA 3OBIA 9ATCB 2FB0A 2B5JB 4LFCK 2B9YA 2DGVA 2L41A 3TSQA 3DM2A 4DUYJ 1GOBA 4DXLA 5KG3A 4PQUA 3ZSVA 5KFFA 4ILMA 4Z0UA 1AB8A 4B3SJ 2OMLA 2NCKL 3GL1A 2G8WA 5GVQA 2J8SA 2LEPA 4DV4J 3J7ZO 2CDRB 3A5NC 3V9WA 4IR9A 3C15A 5HROB 4JKAA 4TLQA 3DYAA 2OTJN 1NRKA 3F5TA 1XERA 4KGZB 4KH5A 2VBYA 1MROA 3SUOA 3HMJG 1I94F 4RKUC 1FKPA 4CEBA 4HI1A 3S9HA 3VN5A 3ZX2A 1HNXK 3NH2A 4ISEA 1G6BA 5IWAJ 7AT1B 3CUNA 1WORA 2AW0A 2DIUA 1SQKA 1VRQC 2X3DA 3SSRA 2AGPA 3RVCA 1XMQK 1CULA 3DRPB 4ZCKA 1FEHA 4Y00A 3BSAA 3CC7N 1VHXA 5CA5A 3HSCA 2E2QA 3DOMB 3TWZA 3IR7B 4Z7CA 2PN6A 3I32A 2N7YA 2X1GA 4GO5X 3HO1A 4XDDA 1V6HA 5F8GA 4FPAA 4PABA 2CNOB 1RTJA 2UXDK 1T6CA 2C3YA 4LF7K 4OX6A 1VQ9S 1UW9A 4IJNA 3HFKA 3G9CA 5FD1A 5KT2A 5HAOA 2P9SB 2Q3PA 1X7VA 2V9KA 1VSIA 3ZSYA 2V7YA 4CO1A 2ZM6K 3KHRA 3OLBA 4FJLA 1GMWD 3BGLA 3JYTA 4HT5A 4KPYA 1RBVA 1M1GA 2F9WA 1Q95G 1WSEA 3K0SA 2YNIB 3A8KA 4OHZA 1UEVA 4B3SK 3A5LC 3CC7S 2R7SA 3NGIA 4K8RA 1YLXA 3O4QA 3CCLN 3BKUA 4WU2A 1J53A 4CHPA 3ID6A 4RR5A 4DPUA 4CGJA 4CZLA 5KTQA 4C1NI 4DR2K 2MLXA 3NH1A 1SH3A 2APOA 4NXMK 3MX2A 1U1PA 5SWMA 2LXUA 4JI1F 2HSTA 3CVKA 3JAMY 3LZIA 3D0HE 3D3BJ 4CJPA 2CQBA 2CQGA 1SJQA 3KWIA 3GPAA 1EQ0A 4LH5A 2QC3A 5B0FA 4LSLB 3NGDA 4FLVA 3SCKE 4LR9A 3UNYA 3SQ1A 4Z4FA 2QA2A 3QT8A 2YHWA 1W2BM 2A3ZA 3AVKA 3C6TA 4X65J 2RF2B 1RT4A 1YJWN 3BDPA 2GMJA 3HRGA 1FRJA 1YVFA 3ZEUA 4EU0A 1ATSA 1SKWA 1OMSA 3CPWR 4P74A 1UJ6A 3K58A 2DFFA 3OL7A 2OPPB 3KMQA 4A57A 3M6GA 4CZJA 1IWGA 2J9CA 1S1VA 3GB0A 1XN9A 1VLYA 4LC9B 1HJRA 4M5JA 5JMNA 2RSQA 5JVHQ 4OKEA 4ZLPA 4IDHA 5CY4A 4F8RA 3PW2A 3O9RA 2BBEA 5IV3A 1QHAA 3IR6B 3CG7A 3BV8A 1NGJA 2GVDB 3MM9B 1U02A 3QATA 1MWQA 3CCSN 2QZ8A 1R43A 2Z2YB 4NE9C 4XAKA 3G86A 3IMXA 4JI0F 2Z0GA 3VEWA 4CH1A 1ZPWX 3DFEA 3JQJA 4K25A 1TMMA 3B4DA 3DU5A 3GSIA 4KR0B 2HQGA 3VEOA 4XPCA 3A8EA 1NJIO 1LWCB 3ZTQA 5CE3A 2CVIA 3MUVP 2BJ8A 2XS5A 1E6YA 4OMFG 1ZETA 1JLQB 1T9TA 5D0HA 3RBZA 3C6TB 1X0PA 5C42B 5HQLA 4FLTA 2M7SA 1JXLA 4FPIA 4DR2F 1FWLA 4Z4GA 1YTAA 3O4WA 1HKAA 1FDBA 3JQKA 4P52A 3MR5A 4K59A 3O6WA 1H7XA 1RHMB 2MKJA 3HCXA 1HNZK 4DL5A 2GV9A 1PIEA 5CR4A 2KXHA 4OYZA 2HWHA 4DQQA 3OSNA 1BE4A 3PW0A 3HHNB 1MNEA 2RHQB 3MWPA 4BC9A 2BE7D 2BJ3A 1HYSB 3EZUA 1LFWA 4U8VA 5AQLA 1KCFA 4C8OA 1FCAA 3ZXWA 3T5JA 2Z58B 3T9ZA 3KYLA 2KN4A 4DTXA 3LPYA 5E3AA 3BYRA 2V4JA 1KAZA 1N0VC 4DZDA 1N4LA 1HQ2A 3H2VE 2KJVA 5GAEU 2P9PA 3CCJS 4PHTX 2KDOA 4Q2LA 4I9LA 3SJJA 1FXDA 2QMXA 4AHSA 3BBFA 5KFSA 1IQZA 3WBZA 3OJSA 3ETMA 2WAQD 2UV8A 1TZ0A 4GNIA 4IG3A 2DH9A 4DG1A 3HF5A 2CYYA 1GXLA 3SIPB 1JLFA 1RAAB 2XMWA 1H2TZ 1ZBIA 3NGTA 3SUPA 5CYJA 3QAEA 4E19A 4DSFA 3CMAS 2G8UA 1QS4A 1IBMK 4F4XA 3VALA 3VEYA 5M2UA 3O1LA 4CBWA 3AOCA 4RWTA 2DXDA 1IG8A 3VGSA 5C24A 2DGQA 2DR9A 4MK8A 4FJMA 2CQDA 1JJ2M 2G0JA 1S5JA 4Y3CA 2Q3SA 4CGDA 5HJXA 4DV6J 3JS9A 4OGEA 2HK3A 2MZJA 5HBMB 1Y5NB 4F7VA 1BUPA 3G6XA 1D1UA 2K7JA 4M5NA 1BXNA 3KDNA 3GBTA 3AD8C 2W2OP 2VQEF 3ISND 1D5AA 4U8YA 3WT0A 2XM3A 5JMVA 1MW7A 2AJ0A 4C97A 4DV6K 2QLXA 4FK2A 5DDQC 4R0JA 1W26A 1ZTTA 1VQ7N 3FMWA 2G8VA 2B9WA 3OV7A 3QSIA 3NGUA 1TKXA 4FNIA 3FRZA 3HT3A 4ELTA 1ULRA 2QLWA 4ZTFA 4BDYA 3OA9A 2BOPA 1C1BB 4KHYA 4R5PA 3CCJN 1NJYA 1DURA 3W64A 1ACMB 2I9SA 4ZHRB 2PEHA 4DCJB 4KHPJ 4DR3K 5M1PA 2A6AA 1FTRA 4CFAA 3J80Y 3AODA 3FBCA 3SCXA 1LXNA 1K73O 3OS1A 1YJVA 4LF7F 2NS1B 5BPLA 3Q8VA 3R3LA 4X65F 2MZRA 2EFPA 1NWKA 4MFBA 4MK9A 3TA1A 3VGTA 5DM7L 1X4DA 4FZXC 4KI6A 4BHQA 1F5AA 1VAZA 2N4DA 2CG4A 4LSNA 1TL5A 2NR0A 3T19A 3PSFA 1HD0A 1PBAA 2K06A 1JJHA 1VRTA 3O2IA 4I2PB 3DLBA 5LT5A 4PZVA 4OI2A 3HPHA 4OZ1A 3F0NA 1NB7A 3MTJA 4DR4J 1UKUA 4BRGA 3HJFA 3DWLA 3QNOA 1HQEA 3M8PB 1FKAF 3EMTA 3O9SA 5IC6B 1HYZA 1X4GA 4UY8T 1UPMB 5L1JA 4ECUA 3FZKA 2Z1JA 2IJFA 4DQPA 2BJ7A 2GX9A 1OSDA 1IKVB 4ZCIA 4RO0A 3C66A 4DV7F 4FLYA 1LCUA 1BMQB 4YB1P 2P1JA 4V19J 3M5RA 3VGKA 2ATCB 4M3WA 1QSLA 2JRSA 1TVRB 3R27A 5KQ8A 1HBMA 1KVKA 3L2VA 4QBUA 2I7PA 2YV0X 8ATCB 5J1EB 2CWXA 1KFDA 3P4IA 1U6FA 2EC2A 1W0HA 2GWKA 2NQPA 3HHDA 4CK1A 3C2PA 1LW2B 2E5LF 2ZKTA 2XY8A 4HCCA 2VPXB 4CJRA 3C6HA 5M1OA 3VOVA 2V4JB 5A8WA 4Q0BB 3TJ8A 5J2NA 3SCIE 3AJ2A 4Q7AA 5I3QA 4OLAA 2FJBB 4KGKA 4DR7J 1UEKA 3BO2A 3FCHA 4K4XA 3ET6B 2HS4A 2H3EB 3CF5L 4JI3K 1N33K 3M7VA 2JVRA 3PSIA 1X8DA 5CD4A 5HLFB 1LNQA 4OJRA 1D0EA 3FLCO 1I3OB 2HVHA 4OV1A 4LF9K 2D3OR 1RTJB 1LWCA 3JS6A 4AF1A 3TNVA 3H3NO 4B3TK 4DSKA 3GYNA 4DUZJ 2DIVA 5KRTA 4BR5A 1KTQA 2HQ3A 3RB6A 1R59O 2GCFA 1NKBA 3R5AA 3WEEB 3A5MC 4YR0A 4URGA 1F5BA 4O4RA 3BF1A 2BQUA 2I6WA 4CM0A 1KTVA 1X4FA 2GV1A 3MXJA 3OR1B 1VQ8N 1SQEA 4UW2A 2F8HA 5E2QA 4ZPBA 1X9MA 1ZBHA 3DRRA 1NSQA 4DBQA 2DNRA 1LWEB 1SIWB 2OPQA 2R3VA 1S6OA 4J9PA 3TTFA 3AA5X 3K59A 1D09B 5E3QA 2HFSA 3L0QA 1RDBA 4DKWA 2W9AA 3OYEA 2QGFB 4K2JA 5AQPA 3DM2B 3A3OB 1P27B 2IVPA 2Z56B 2WHOA 1O6XA 2D3ZA 3QO9B 4ANDA 2BE9B 4XIUA 5F8HA 2QRRA 4JKGB 3V6DB 2GVZB 1WSFA 2IBKA 1N36F 4FWNA 3M8YA 2GAGC 2XMTA 2ZZTA 2ASOA 3I9V9 2P6TA 1LEOA 4NLXA 4G9ZA 4IG0A 3GFHA 1RT4B 4FKYA 5DS7A 2UU9F 2ZHBA 4F50A 4BS2A 4NLTA 4CZIA 3QEIA 2BANA 3KJQB 3VQTA 4LF8F 5DO2A 3KJNB 1IH7A 5GAEI 4CTAA 1BDGA 1ZM2A 3CDEA 4QYRA 2J9EA 3IAS9 4ELUA 9RUBA 3V1RA 3TOQA 2E66A 3OYGA 1T9UA 4NYPA 5GAHP 2F9DA 1CJTB 4F4WA 4USJC 4GKJK 2OPRA 2GJFA 2NRWA 3D2FA 2BJDA 3AVIA 3BGRA 2P9UA 2XB2D 3J7YU 4U7CA 1P90A 4GC6A 3MM6B 1WEZA 4JKGA 4JV1A 3AVNA 1SB6A 3MAHA 4LSZB 2IM0A 1X1PA 4J90A 3FDSA 3MAAA 1RGIA 3ZZYA 3CW2C 1M0SA 1TUWA 3FZFA 4CLZA 1I3AA 3RB0A 3MN6A 3LO3A 4NEYA 4USKA 3H20A 2VIHA 3UE5A 5LY3A 4OYWA 2XS2A 1A6LA 2Y9HA 3BS9A 3FZHA 3V81A 1GLJO 5D15A 2VGNA 3HD1A 4J2EA 4DCPB 1J2VA 4ZN3A 2MQLA 2J4RA 3BEXA 4FWQA 4JI4J 4ID1A 4PKHA 1VSKA 3L2QA 3AJ1A 5M2PA 5FRMA 2UVUA 4GKJJ 4PG4A 2AGOA 3SCJE 4J2DA 2FJEB 1Y7PA 3R7BB 2OKQA 3TUIC 2UVVA 5LMUJ 2IJNA 4AH9A 3C19A 3DLHA 2ZBPA 3P83D 3SQOP 1B7YB 5HL7Q 3MFIA 3SUNA 3T6BA 1ZBFA 3PW4A 1MDUB 4X4TA 6FDRA 2F3JA 2VBXA 2RN2A 2W2MP 3P49B 4C1NK 4H0PA 2FVQA 1U8WA 4DB3A 2UV8G 1UVJA 2B4JA 3WNFA 4J37A 4W5OA 2XY7A 3SQGA 2KB2A 4CT8A 3C16B 5KGWA 2DY9A 4DTJA 3OTOJ 4YR3A 4N77A 4R0EA 1VR6A 2KXFA 1QHTA 3GIKA 3AVGA 2H3GX 5EX5A 5BR8J 2UYTA 1SJ3P 1Q86T 5FDLB 2NREA 2J76E 4X4SA 1KHVA 1HHTP 4H4OB 2PD1A 3O6QA 3IWXA 2O3DA 5KFIA 4DL6A 3NMAA 5HATA 2D74B 3LDNA 4Y6IA 4AUKA 3KG4A 1J5OB 1D9DA 2ZWOA 4RNHA 4CJ4A 1QVGM 1WACA 2V34A 5MAOA 2VU5A 3CJ9A 1U6ZA 5LJWA 3Q0AA 4H5RA 1LK5A 4HI2A 4I2QA 3PKYA 2WTUA 3JSMB 1WTBA 3UCUP 4IOAL 4FS2A 4FZYA 3GIRA 3WXIA 3QGGA 1YUWA 2JWNA 1UFKA 4N76A 3HPOA 1Q82T 1EO1A 1M1KT 4OHVA 4Y0FA 3CCQN 1XWLA 4EHUA 2QYCA 5EX3A 5B0CA 3AVJA 3TA2A 2Z2LA 3GG1A 2CXEA 1FRHA 1LKZA 1NPRA 3GCWP 3VQ6A 2LDYA 3IBWA 3CJSA 1EKEA 5H9FJ 1VJQA 2CH5A 5AE1A 2ZE2A 2PIIA 5D0EA 2ZH7A 1HBOA 1FDDA 4CM2A 2DGUA 3CIPA 3OVSA 1IKXB 3FSYA 4TY8B 2O8FA 3LPUA 3D6TB 4K4TA 4FL9A 4WZQA 1SCJB 4NA2A 3G8SA 1CLFA 4O8KA 4DR7K 2WSCC 2ROEA 3M05A 2VG5A 1CZAN 1JLCA 1UPPA 1KS2A 3P5TL 4M5HA 3QERA 2OFGX 1IV0A 1WC3A 2CQPA 5F8LA 2XY6A 4BRAA 3ZTPA 3W63A 4O5BA 4DL2A 4ED6A 1U1RA 3S3NA 3HSGA 2VICA 4J8FA 1K47A 1SUQA 3DXMB 4WFNQ 4NWBA 3P96A 3CJBA 1ZH5A 1WAJA 2RKIB 1I1GA 1TR0A 2HBRB 2VOOA 4JI6F 4WK1A 1QQOA 3MPUB 3AY0A 1B7FA 2BA9A 3THYB 4Z94A 4OX9J 3VTIA 3AVMA 2LA4A 4GMJB 5HROA 4RX6A 2E1CA 5EXWA 4UQTA 4L72B 1MA9B 3C3LA 4O4GA 1RISA 1FWKA 1R8AA 1X4CA 5HSPA 3BZCA 4DWIA 2ZH3A 1YDLA 3I9ZA 5L46A 3AVCA 1HBNB 1NEEA 4BRMA 5A8RB 3JSRA 4U95A 2ZOMA 4CZHA 2PT0A 4FYYB 2AJQA 1S1WA 3OD2A 3N28A 4RZRA 5KFOA 3FBEA 3M4XA 2UUAK 2JWKA 4X4OA 4HDGA 2N7CA 4FSVA 4H54A 1XMOF 5KI6A 1S10A 4FYDA 4ED7A 2E2OA 1TKTB 4PPDA 3L2WA 3OVNA 4HDHA 1HJOA 3DOKB 5HVFA 1HHSA 3GR1A 4PEOA 3I4HX 4Y28C 3HSTB 3TSPA 2CUYA 1XHZA 3OW2M 1GTEA 3MR3A 1RTZA 2E44A 3O5BA 4KHSA 4YQWA 4KHQA 4GVBA 2VC0A 3D1QA 3CCUN 3ZZTA 2YNIA 1VBZA 1GXUA 3N5BA 1JL1A 3HI9A 4F26A 2YKNB 2VB6A 4M41A 5KG2A 1I5OB 3UN2A 2QFIA 2LCWA 5L9NA 2QLFB 3ZX0A 1NSKL 2MYFA 1YJ9N 3NAHA 1VSDA 2WC9A 2ZH1A 4CYUA 3QZ7A 4E1JA 4LF9F 4Q2MA 1WSHA 3HBTA 3FR0A 3THWA 1RBSA 4Y2MA 1WSVA 3NGRA 3OL6A 1T0TV 3GIJA 4XTTA 1QDUB 2VWJA 2HHVA 3EZ5A 3NNAA 5JVGQ 3TEHB 3ZSRA 3S6EA 1JJ4A 2YKMA 5DG8A 3G25A 2V2ZA 3S8SA 4FJGA 4HHTA 1K6YA 4HHHA 1S6UA 4TQRA 5FROA 1Q0NA 2F4VF 1YRXA 2DCLA 3VQQA 2CQ1A 3CJKB 2OZSA 3F9MA 4URQU 3R3TA 2LFVA 1KRPA 2GMHA 3U9ZA 4U9RA 4USIA 3VF0B 1OJ4A 1NGDA 1SQFA 3RW7A 3OR1A 3K89A 1XNQK 1HI8A 1VQ6N 2HHXA 1QVGR 3KHGA 1REVB 2W6KA 2MSTA 2GQCA 4DL0C 3T5HA 1CXUA 4DEZA 1C1AA 1BISA 4BDPA 3MEKA 3BPDA 1GEHA 3NP5A 1VJWA 1CJVA 3FFIB 1YJ9S 4TNOA 3H40A 1TKDA 2F4FA 3TP2A 4J2AA 2HHUA 3V2UC 2F8EX 3I55S 1QAIA 3Q83A 4KC5A 3LDOA 2NYIA 4PPZA 2EFOA 2D41A 4IFVA 2RKIA 1RAHB 2XULA 2GVDA 1OY6A 5ETMA 5IZHA 3NCQA 4CWBA 3O3FA 4AHTA 1RA7A 4AD6A 3IUCA 4ZCLA 4I6AA 4MIBA 2XHBA 3K7RA 1KQKA 2F4VJ 2HG4A 2XO6A 1SC3B 3NNHA 1QTNB 5K8PA 3D2FB 4Q8EA 2VDHA 4O44A 3FZMA 1K8KA 1SC4B 5E0OA 2FGCA 2FHOB 2VKRA 4RWXA 1IKYA 2MTLA 3NS7B 1U1KA 3RBEA 3LDQA 1RWKB 3TAMB 3DLEB 4OI1A 3GQCA 2RNEA 2HMIA 4C3LA 4CHQA 1EP4A 1T7PA 1U48A 3KJVB 1R0AA 3HZEA 2ZHAA 3G4SN 3F56A 1NBWA 3H42A 1Q18A 3OXFA 3AH6A 3QQCD 1KONA 4IOXA 2ZNZA 8AT1B 2E8AA 1RWXB 4YHHF 3BUZB 3TYTA 3NMRA 2DGWA 1B64A 1IXKA 2JH3A 3N4PA 2CQCA 2DPIA 2QMWA 4LF8K 2MSSA 5G4DA 3FE1A 4YOVA 4EP5A 2HFUA 2VG7A 2FVRA 3FEXB 4NLPA 3ZX3A 3SK3A 2HNYB 3NF7A 1P8ZA 3RRGA 4JKFA 3B6BA 1HFEL 4FJNA 2IS3A 3OFFA 2P9SA 3TPQA 3ZCMA 3D0PA 5BJRA 4YR2A 1LK7A 3D1HA 2DB1A 4L76A 4EHTA 4NMLA 3PFOA 2JLGA 1RBLA 2Z4PA 2W24A 4DR4F 4K8XA 1ZM4A 3GCXP 1C0TA 2NRVA 3NL0A 3MD1A 2VA2A 2RIJA 4P2SA 4A8MP 3H3OB 3ENVA 4CD1A 1FK9B 1JLEB 1QZ5A 4G65A 3W65A 3LANA 4USHA 2HHWA 3T1HK 1JXBA 4WQ5A 3D5MA 2QK9A 1B0PA 2RQCA 2D0CA 3NBPB 5HMYA 1S59A 3I96A 5JS2A 4ZJLA 5KPTA 3PYGA 3CM6A 4NZ7A 2G1HA 2QV6A 2DHXA 5F0XA 3N0VA 3UDLA 5KQDA 3L9ZA 4HUEA 5D4NA 4QWBA 3D2WA 2KFZA 4ILRA 4NASA 2CPXA 1S97A 3EN9A 3HVTA 4MFBB 2E7VA 2ZJPQ 4MTPA 4IQXA 3OTBA 5BRFA 1FRKA 1WWHA 1WF0A 4YOYA 4H5WA 1AXQA 3ZLJA 1MU2A 3HHLC 4YDUA 2OEKA 3AGRA 3NVKA 1T9VA 3DMJB 1S77D 5BR8K 2D69A 1AUSL 2ZJQQ 4OYAA 4C3KA 2YH1A 2ZUAA 3AJDA 4H8KA 4HUFA 4A5BA 3UIQA 3KK3B 4FF4A 3MCMA 1NGEA 1H3DA 5ETSA 4DS4A 1UEUA 3DLJA 2XCPA 2DR7A 2ZZMA 2G8KA 5AXMA 4ZVEA 1HW8A 1VQ5N 2NXCA 2RT3A 3ISNC 3P45B 1FJGK 3IAM9 3ILJA 3CC4S 1N34F 2FVCA 1GH8A 4DV1J 2P9NA 2R7UA 4DUYF 2X6NA 1KQGB 4HACB 1VLOA 4PCQA 3BH7B 4F4YA 2E1YA 4ZS6A 4U7UK 1F9EB 2FLNA 2XSJA 2E2PA 3BGFA 1F21A 2PFDA 2YNFA 1KXPA 3CPWM 4DV7K 4CI0B 1YVUA 1IKVA 4ECVA 4WJBA 1Q1KA 3CMEN 1KP6A 1T94A 5A2QU 4YMEA 1HNWK 4B9LA 5F0WA 1HBOB 1CJKB 3DHXA 4LFAF 4C7QA 4UY85 3SQ0A 4RUHA 5AQOA 8RUCA 1HR0F 4FLUA 4OX7A 1YG0A 4NLVA 4DR1F 2R7RA 3ZZ0A 4FWMA 2A1BA 5JICA 1KQFB 3MTKA 4U7UD 3ZNJ1 1Y11A 2HHTA 1SV5A 4F67A 1JJ2R 1TK8A 3TVZA 3C95A 5L9XA 4QU6A 3L6QA 3LP2A 3KLFB 3KJFB 5A8KB 3K2YA 3CO9A 4IOCQ 2PYJA 2Y0BB 4JI7K 3LTOA 1FKOA 4WK3A