5JVHL

The crystal structure large ribosomal subunit (50s) of deinococcus radiodurans in complex with evernimicin
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
104
structure length
104
Chain Sequence
RRKLRTRRKVRTTTAASGRLRLSVYRSSKHIYAQIIDDSRGQTLAAASSAALKSGNKTDTAAAVGKALAAAAAEKGIKQVVFDRGSYKYHGRVKALADAAREGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title Avilamycin and evernimicin induce structural changes in rProteins uL16 and CTC that enhance the inhibition of A-site tRNA binding.
pubmed doi rcsb
molecule tags Ribosome
total genus 17
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2016-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00861 Ribosomal_L18p Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.100 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 5jvhL01
5DM7L 5MLCQ 3CD6N 1QVFM 1VQNN 1KD1O 4U67L 3G71N 1VQLN 4UY8O 5H1SQ 3I55N 1VQ7N 1M1KO 3I56N 3CMEN 1VQ6N 1VQ9N 1VQON 3CF5L 5GADP 5GAEP 1Q7YO 3G4SN 1VQPN 3CXCM 1YITN 1OVYA 3CC7N 1K73O 1VQ4N 3CCMN 1VQ5N 3CCQN 4IOAL 1YJWN 3CCSN 1JJ2M 3CCVN 1K9MO 1N8RO 5GAHP 3CC4N 4IO9L 5DM6L 1YJ9N 2ZJPL 3DLLL 3CC2N 1YHQN 5JVHL 4WF9L 3OW2M 2ZJQL 1YJNN 1KC8O 3CCLN 1VQKN 1VQMN 1VQ8N 4WCEL 5JVGL 1QVGM 3G6EN 1Q86O 1KQSM 2QA4N 2OTLN 3CMAN 1ILYA 3PIOL 1Q82O 2OTJN 3PIPL 4WFNL 4WFBL 5HL7L 1S72N 4WFAL 1Q81O 1M90O 1W2BM 3CCEN 3CCRN 1NJIO 4IOCL 1YI2N 1K8AO 2QEXN 3CPWM 3CCUN 5GAGP 2ZJRL 3J7ZO 1YIJN 3CCJN
chains in the Genus database with same CATH superfamily
4X66K 5AQPA 3ZSWA 5DM7L 1NOYA 5AQNA 2ZF5O 1YXQA 2X6SA 5BN8A 3A5OC 5C0YA 3T19A 5J2PA 3V81A 4JAXA 3MCAB 3FZFA 2E2NA 3ASMA 3LPTA 4F3TA 4OLAA 1BA0A 4FZYA 2HF4A 4CGGA 4CFAA 1VQON 1MA9B 3DRPA 4BWJA 3GBTA 4DQPA 3T69A 4XEIA 3ZSRA 3V1QA 1RNHA 5CZ1A 4DV0K 2A3ZA 1JLEA 1W9HA 3FE1A 2D1KA 4B1ZA 3SV3A 2O8CB 3ULEA 4FVUA 4Z0UA 4EZ9A 4IDKA 4CIGA 3H1QA 4DR6K 4BVOA 4K25A 4AHRA 1S1TA 3K58A 3NGZA 2ZWHA 3HM9A 4YOTA 2ZJPL 1TV6A 3I8BA 2HVHA 4LD0A 3NCIA 4ILHA 3WXIA 2GV9A 3NFAA 3E9OA 4FZXC 1VRUA 4ELTA 3RSEB 3VEOA 4E1JA 3ZEUB 1WOQA 4E7LA 4DQIA 3QIPA 4Q5VA 1NJYA 4K43A 3G10A 4CJRA 1S3XA 4CGHA 1T6DA 2NRVA 3C7NB 5JS2A 4M42A 3NVKA 1CXQA 2QWLA 4JKGB 4BRKA 3U3YA 2P9UB 3TWHA 2FSKA 4JKBA 1RBSA 4WYBA 3AVLA 4ZTJA 4MDBA 2RHKA 1ZC6A 3ZCMA 3NBPA 3HYFA 3SJJA 3IG1A 3KVGA 2O8BB 4KKOA 4XH5A 3BF3A 3GE1A 2WONA 4NO7A 1M90O 5AZIA 3UKUA 3LP0A 3SCXA 4IJNA 3V9UA 3DLRA 5KTQA 1MU2A 1W0HA 1MWKA 3LALA 4O0IA 1TGOA 4RW7A 2HSTA 3LZJA 4E19A 1K8KB 1W7AA 4A61A 3I0RA 4OPHA 3ZX0A 3AA2A 1HMVA 1TVRA 5MLCQ 3AO4A 1C0UA 1NK4A 1HR0K 2WOMA 5H1SQ 3O9TA 4A2AA 4UQGA 4JK8A 3CJ1A 4A5AA 1IBKK 3D2EB 3OA9A 4H0XB 2F9TA 3J7YP 1N6QA 2O4IA 4ISEA 3H45C 2VGNA 4IG0A 5HRSA 4FLYA 1Q7YO 2GELA 4JI3K 4IWVA 4K8XA 2O8DA 3M3ZA 5KRTA 1TUUA 4FPAA 4U7BA 2WBNA 4KTZA 3QO9A 3LDNA 1T05A 2KFNA 3FLCO 4CK2A 3AVIA 3VGMA 4DKWA 1OVQA 1Z26A 5CYQA 4BRFA 5J2NA 4DR4K 1KVAA 1X9SA 5JVGL 4G9ZA 1J6ZA 4A2BA 2QA4N 3BUZB 3WQTA 1N34K 2E1ZA 3EY1A 3KK7A 4B9MA 2UXCK 2HW3A 2QKBA 4WFNL 3ENHA 4WFBL 4BQZA 3O4NA 2XY5A 3OYHA 2OA8A 3TAFA 1Y97A 4JI2K 4WQ4C 3KTQA 4PUOA 5KQDA 1HNWK 3IAYA 4F4KA 4BC2A 4Z4HA 2AP1A 3OS2A 2J4RA 4YOVA 2GUPA 1S6QA 3D2FB 3C94A 3IFRA 2Q31A 4EP5A 4CF8A 1RTIA 5FRMA 4F2SA 3I33A 4PKIA 2ASMA 3THWA 3DLEA 4FJ9A 4N56A 3EZ5A 3EKUA 5AR0A 1YIJN 4FJGA 4DFMA 1H1VA 3QB0A 4RW6A 1YF5L 1QVFM 4OGCA 5DMRA 2G8UA 4PQUA 4CHNA 3VESA 1IG9A 2RN2A 3KLEA 2XRIA 1RT7A 2FF6A 4I2QA 3VQEA 3FR0A 1NGDA 1T03A 4LSLA 1HPZA 3TAPA 4ZTFA 3TR8A 5D3GA 3SAGA 3RR7A 2ITGA 3O1BA 2Q0RA 4FZZA 4CJVA 2G8WA 3ZX2A 4R79A 2I7PA 3DRSA 1SL1A 5J2MA 2A41A 3PSIA 1EX4A 2HNYA 5BRFA 1QSYA 1NGGA 5CY4A 3CCVN 2WC9A 3VQ5A 3QFUA 4OKEA 1A5VA 2P9KB 1RTHA 3ZSZA 3SBGA 1ASUA 4FLTA 4AILC 4KTWA 3UIQA 5DK5A 3OYFA 5HRRA 4EIAA 2HHHK 3L2WA 2KZZA 4BRPA 3R6MA 1NGAA 2DPNA 1ESVA 3VERA 2WTUA 1RGIA 3ZT4A 4FVMA 1S1XA 2XHBA 4N76A 1ITGA 2VGMA 3KLHA 4WQ4A 3KLGA 4F3OA 1TL3A 4DTMA 1TK0A 3KLFA 4FJHA 1WSGA 4YNQA 4FCYA 3K5NA 1YT3A 4C8MA 3K5MA 1NGIA 1X1PA 4GV3A 4OPKA 4NCBA 2W6LA 5CE3A 1L3UA 4YOUA 1ATRA 1TYQB 1NK7A 4JNEA 4FLVA 4BC4A 4DFJA 1KVBA 2HHVA 2YHBA 2Q36A 2KKZA 4CIEA 2VG6A 4B9QA 3SZ2A 3CHWA 3PSFA 1J54A 3DXMA 4YDUC 4N5SA 4DF8A 4HUFA 2CGLA 4BRGA 1U2VA 3NF9A 1QQMA 3JS6A 4H5WA 4CJTA 4ELUA 4Z4FA 3TI0A 4W5QA 5BN9A 1VRTA 3CM6A 1J5OA 4AHVA 4KB0A 4DWIA 3DAWA 1Q18A 3OYAA 4BDPA 2DTUA 4OPAA 4E3SA 4DV4K 3MXMA 3RR8A 3VEVA 5C25A 1IH7A 5C12A 3SUNA 2DFFA 5FPNA 2P9NB 4CGDA 4DF4A 4GKJK 3DMJA 3BZCA 2ATQA 3ID8A 5AZJA 1K73O 1LCUA 5AQLA 2IVPA 4IOAL 1NLVA 2KW4A 4FWRA 3OBWA 2Z1JA 5EOYA 2FBVA 3O4QA 3WQUA 4AQYK 4LY7A 3SJHA 4I2PA 1W97L 4DR5K 3OYLA 1G99A 4CEFA 3MAQA 1NGHA 4CERA 3S3NA 3DXKA 2FLOA 3NH2A 3OS0A 4Q0BA 3LM2A 1QQNA 1RDDA 1S1VA 1NGFA 3G6EN 2YCHA 4LH4A 1KRPA 4EAHD 1N5YA 3D0PA 3VN5A 1QHAA 2VWJA 3JYTA 3VGKA 5M1KA 3HT3A 3MDQA 1BWFO 1JLQA 3CJAA 5M1NA 1OH5A 5AQIA 2GWKA 3VF2A 3J8AA 3QESA 3LP1A 1U47A 4NCAA 4OO1J 2KFZA 4YDUA 3DM2A 3M8SA 2IC3A 3O8MA 4GVEA 3H46O 3OY9A 4BDYA 3NHGA 4H5RA 1RBVA 5HRPA 3VENA 5AQVA 4BGAA 5C2DA 4B08A 3TTFA 4M3WA 4Z4IA 3HSTB 2JGUA 4H0VB 1C0FA 2IS3A 3VTIA 2RF2A 3JAMO 4GV6A 4CZIA 2UXDK 1LAVA 2F96A 1F21A 2HMPA 4IFYA 3I56N 1U49A 3AAQA 3A0IX 4H5TA 4B9LA 3T1AA 2NRRA 1OH8A 2JWKA 4FJJA 1SKWA 1SKSA 1NGEA 2CH6A 3KWIA 3S41A 4JEPA 3QNNA 5GIOA 3QERA 2W42A 4FJIA 4CHZA 3OYIA 4AM7A 1JJ2M 4KBOA 4AHCA 3V1RA 3SUQA 3ZSVA 1KFDA 4G1QA 4B8CA 1D4XA 2AJQA 2FBYA 4NYFA 1LW2A 1YUWA 2KZMA 1VAZA 3KK3A 3CERA 3BP8A 4CGFA 2RKIA 2PAVA 1BOTO 2ZJQL 2F7TA 3C0BA 4DTJA 3AO3A 3NGIA 3O4WA 1ZYQA 4JD2B 3VOVA 4LF5K 1NK0A 1RT3A 4BQLA 2YHYA 3JXUA 1GLFO 1QZ5A 3F9MA 3SQ0A 4CJ3A 4FJ8A 3PY8A 3MN5A 1ILYA 4DTOA 4A57A 1GLDG 3V4IA 2R7YA 1JL2A 2HOEA 1NGBA 3CG7A 4FK4A 4RTFD 4FWNA 4DQQA 3MXIA 3T7ZA 4N41A 2O8EA 4CZJA 2ZGZA 4W5NA 3C95A 2D0OA 4GNIA 1NK5A 4OKJA 4DHYA 2QM1A 4CJSA 4M7YA 5FLXO 4CK3A 4IKFA 1OH7A 4KH4A 2QWPA 3SPYA 4BRMA 5EXWA 2QI2A 3J7ZO 3RMCA 4KHQA 1XI1A 4E7JA 4M7XA 3NF7A 2UUCK 3NVMA 3SMPA 3K59A 2NUBA 3OYNA 3WUHA 1P8ZA 5GINA 2G8KA 2D0PA 4CECA 3QEWA 1BDGA 3N4PA 4CHPA 1L3SA 3BDPA 4AF1A 3LAMA 1BCOA 1KLMA 3SI6A 4CJ7A 2BTFA 2E6MA 3LDLA 4CW7B 2A40A 3VEYA 4KHUA 4IOXA 5EVZA 3THXA 2B5JA 3G4SN 3LL3A 4ISFA 3CXCM 3U8XA 5AQQA 3DJCA 4CK1A 4YHHK 5F0XA 3THYA 1CZAN 3TTDA 4NXNK 3QNOA 1B92A 4CBXA 1YJWN 3DOKA 2X6NA 2ASOA 1TKTA 4ILJA 4JLHA 3O3GA 2D5RA 1WSFA 4OKKA 1IBLK 5JLFA 3HXMA 3L2QA 1O13A 1BQNA 3IRXA 2HBLA 5ADXH 5AFUA 2O8FA 3SLCA 3MCPA 4DTNA 3EE9A 2P9LA 1HYZA 5FDLA 4XIUA 1XHZA 4LF7K 1HNXK 4YY3K 5KRSA 3WEEA 4FYDA 2E2OA 4JS5A 1ZBLA 3M8QA 4BC5A 2OYQA 4PKHA 4KHYA 4WCEL 4BG9A 3R9PA 5FRNA 3ULEB 2BDPA 1MWMA 1IO2A 3P83D 1ZBSA 1D9FA 3SUOA 1HJOA 4FW2A 1XC9A 5M1PA 4IFVA 2IIRA 4CHQA 1EXQA 4KHWA 1KTQA 1BUPA 3O9RA 3BEXA 3T1HK 1S72N 5M1FA 1KAZA 3W3DA 2ZE2A 4C8KA 3HPGA 4CEEA 4M3TA 1RDBA 5AQUA 3AO2A 4BRAA 1ATNA 1NGCA 1B9FA 2LSNA 4O55A 3MMVA 3H08A 1LWCA 4CGJA 1RBTA 1C1BA 4BRNA 2ZD1A 5AQGA 5AQKA 1KCFA 2XY8A 2BGGA 4DB3A 1E4FT 1EO1A 4CCHA 1RBRA 5AZIB 3UKUB 1QSSA 3IUCA 1XWLA 2HNZA 2I7NA 1EWQA 5J2QA 3AGRA 1JLGA 2QW9A 2W40A 2P9IA 5C10A 1YTUA 1GLLO 4O4GA 4BRHA 4B1VA 1OKJA 4MO5A 3C6HA 2P51A 3OVNA 4O0JA 4FOIA 3HP6A 1GOBA 4CZFA 4KPYA 3CFPA 4CI6A 1DT9A 1IJJA 4DR1K 1RILA 1VQ4N 1VQ5N 4CZMA 3CCSN 5BPLA 5LMNK 4LF9K 1EETA 4DTUA 4KI4A 2VG5A 1XMOK 3FZKA 3HI0A 4B1YB 3HL8A 4XH1A 4B3OA 3AVAA 5AQJA 5K14A 5BR8K 2V51B 5FPMA 5AFUH 2WUSA 2HHWA 5AQXA 3LZIA 1JLCA 2Q3SA 2O8DB 4IO8A 3O08A 2P9SA 1IG8A 3CQYA 3VF4A 4JRPA 3ZT0A 3WNEA 4E7HA 2V7ZA 4CEQA 3U9ZA 4M63C 4CHOA 2A1RA 3LP3A 4IZ9A 4CFCA 4QAGA 4FWPA 2D0AA 4CEAA 4O44A 4B9SA 3SQ1A 4DTXA 5HL7L 3VQ6A 3CJBA 3CQ8A 2HHQA 1FXXA 3L2VA 1GLCG 3C6AA 2HHXA 3ID6A 3WNGA 1UA1A 2Y1JA 4JI6K 3PUFA 4XH4A 2W6KA 2OPPA 3AVGA 4HHTA 1TL1A 1RT1A 4PHTX 4FWMA 4MO4A 3TARA 1HYVA 3AV9A 4RCHA 2E2QA 4JKAA 3CD6N 4JI4K 2P1JA 4EP4A 3DLKA 2ASPA 4YOYA 1QHTA 5E84A 4E89A 4PL7A 4BC3A 4DQRA 4JN4A 4BWMA 4FK2A 1VQ9N 2OPQA 4KHNA 3ATVA 3RRHA 1IKVA 1RFQA 4DMNA 3THWB 1KVCA 1TKZA 3P38A 5KQ8A 1VQPN 2E2PA 4HVJA 1LV5A 5AQRA 4IBNA 4DSFA 4IJAA 3FZMA 3O1WA 1T7PA 4BR7A 5KPZA 1LAWA 3QEVA 4IG3A 3SNNA 1Z25A 4I9LA 3TTCA 5AQZA 2D4WA 2A5XA 1T3VA 2QWQA 1SUQA 3WXLA 1VSHA 3HVTA 3DLGA 4DTPA 3L4IA 3OJSA 1C0GA 4FWKA 2YV0X 4V19S 4E1MA 1U6ZA 3E66A 1YJNN 4KI6A 3GG4A 4I7FA 3V6DA 3L3VA 4FL9A 2O4GA 3MWPA 3OYJA 3WNFA 3UB5A 4B3SK 2VCPA 3AAPA 3VTHA 4YORA 4C23A 5KPTA 1C0TA 2Q97A 3OBYA 3OYDA 3HRGA 2QTDA 3O5BA 1Q8IA 1V4SA 3TAEA 2VG7A 4MFBA 1RT5A 1Q82O 4AH9A 3VQPA 2BUPA 3KK2A 1WAJA 3LP2A 2GWJA 4OLBA 4RW8A 3JSMA 4Z4GA 4WFAL 3IS9A 3BY5A 2HBJA 4Z94A 3BF1A 4BR0A 1JCGA 3RRGA 3NGYA 2YI1A 4DV3K 3PLAA 4JHDA 3L2RA 3KK1A 2G8IA 3BGRA 2ZQBA 4OJRA 5BR9A 2HB5A 5BRDA 4ICLA 3K0SA 4DU4A 1RDCA 4JI0K 1BA1A 3SAHA 4B9VA 4J2AA 2FBXA 4EZ6A 1MDUB 1KD1O 4LF8K 2VYPA 5LJWA 1TAUA 2DFHA 3THVA 3VGLA 1R0AA 4CZHA 4RG8A 2P5OA 3QBWA 4E0DA 4CJQA 3HO1A 3R3LA 3RMAA 4ELVA 4WQ5C 2VWBA 3CMEN 4H4MA 3U4LA 1VQ6N 4A5BA 4DSEA 4FM1A 4DFPA 4CJUA 3F73A 2YX6A 5E26A 3K5LA 1YAGA 4A62A 3CJ7A 4ID5A 4FSVA 3WXKA 1NJZA 1I39A 2QWMA 3DXMB 4LFCK 1KAYA 3P39A 3LWLA 1U2VB 1XNQK 4CD1A 4J2DA 5JLHA 1NJWA 1VSJA 4CZGA 1E4GT 1VK0A 3P4IA 2D0CA 3FGUA 5GAHP 3HJFA 1I94K 1WSJA 3A2FA 5AQTA 4C8LA 1YHQN 4NCGA 1QTMA 4M3ZA 3NF6A 3ZSXA 3A5NC 3PO5A 3LANA 4H03B 4H5VA 2X78A 1Z05A 3HBTA 4JK7A 3QEIA 4DSJA 3CCLN 1DTTA 1RCHA 5BRHA 1HNVA 1QS4A 4GKKK 5AZJB 2GEMA 3AA5X 4ID1A 3OS1A 2KQ2A 2W41A 4JV5K 1ZXOA 3QDKA 1SV5A 4W5RA 3CMAN 2YJFA 2P9PA 1IBMK 2QXLA 5AQFA 3HK2A 3WXJA 4CBUA 1HUXA 4I6MA 1YTAA 1BL3A 4X65K 2E20A 1RDUA 1CXUA 4CF1A 1FK9A 1QE1A 4HUGA 3NAEA 1ZBUA 4BROA 1D9DA 3DXKB 4O5BA 2QKKA 2G8FA 1WUAA 3DI6A 3HVRA 4FWQA 1X3NA 4DUYK 4FJLA 5HROA 2X74A 4FOEA 3EYZA 4QOZB 1NU0A 4WQ5A 3P5JA 4LH5A 1S9EA 4RW4A 4B8AB 3LAKA 4CFBA 4M3RA 4BRDA 3IKMA 1YVNA 5HP1A 3WT0A 1QZ6A 1NK6A 3VQQA 1WBDA 5AQYA 4CVNE 1LOTB 2VQFK 1D5AA 1HLUA 2HBMA 3FZLA 3QETA 4BY9C 2OZMA 1I3AA 2OPRA 3D6RA 4DR7K 5GAEP 1JKHA 3S3MA 3AO1A 3VETA 3GDQA 5KGWA 1OVYA 5A2QO 3TSQA 1ATSA 1HRHA 3ZYYX 1JLFA 1K9MO 1NMDA 2F8SA 3OYEA 2A1SA 4BRIA 2E8AA 2RE2A 4DV2K 4BACA 2VWKA 3NMUA 3KJVA 4DQ8A 4FJKA 3TANA 4FJ5A 3EKSA 4E1NA 3Q7BA 2E6LA 1X9MA 2BANA 1XNRK 3KD5E 3UKRA 4CEZA 1KC8O 3TPQA 4LFBK 3E9PA 4GMJB 3L6QA 3DWLA 5BPNA 3OYKA 4MQ3A 1NOZA 4FJMA 5ADXA 4B1WB 3DYAA 4JYAK 3ZSOA 3PV8A 3AY9A 4CF0A 4CFDA 4JI1K 2FC0A 5J1EA 1RTJA 4FLXA 4H0PA 4IXCA 3EL2A 4NXMK 5FPEA 1TAQA 4JI5K 1SS6A 3TSPA 3AVBA 2A42A 3M8PA 4KHSA 3AVCA 4CBWA 1RT2A 2DFEA 3PX4A 4JKFA 5LL6Z 4H5NA 1S6PA 2YHXA 3O3HA 3CCUN 1HKGA 4EHUA 4LFAK 1DGKN 4CD3A 3B8AX 5I9EB 5C42A 3CCJN 1OH6A 1X3MA 3E9LA 1VQNN 3AVJA 3FFKB 3ZETA 4U67L 3I55N 4DLEA 4BR5A 4DTRA 4YOWA 1SQKA 1X9WA 2O8EB 1S1WA 4DG1A 3O9UA 3KZBA 4CJ4A 3RWUA 2E4LA 1XQSC 4DUZK 1BI4A 3CF5L 4M3YA 4CZLA 3RMBA 1O1WA 2ETJA 4L8RB 1Q9XA 1WSHA 2V7YA 1K6YA 5AQMA 4FJNA 5CZ2A 4H0OA 1QSLA 3M5RA 1T44A 1ZBHA 3V9ZA 4YOXA 1NNEA 4KHPK 5KI6A 2NZTA 2E1YA 1SZ2A 1XHXA 3LWMA 4DSKA 4FWLA 3EZWA 4HTUA 2OPSA 4KFBA 4HUEA 1R59O 4Y0WA 3TSUA 5IWAK 1SKRA 3HPOA 4M3XA 3AA3A 3THXB 2KLAA 3S3OA 3GOIA 4JRQA 3VQDA 3H3NO 2CGKA 1E3MA 3THYB 1N32K 2GBZA 1D8YA 3W0LA 1HNIA 5FPDA 3CETA 1J5EK 3H6EA 2F4VK 3MECA 2O8FB 4EHTA 4B9UA 3V9SA 2FF3B 2EWSA 4A59A 2P9LB 4DR2K 2QWOA 3TAQA 1W2BM 2F8TA 3WEEB 1NJIO 4NYNA 1KFSA 4B1UB 1LWFA 4BR2A 3ZT3A 4LSNA 1QQCA 5B8HA 5EX5A 4X64K 4CF2A 3DOLA 4CJFA 3J80O 5JMVA 4Z4EA 4O8UA 3K5OA 1Q81O 2O8CA 2I5JA 4CJLA 1KLNA 4B3MK 4PY5A 2G8VA 2VQEK 3L2UA 1IV0A 1VQLN 1WLJA 3MEGA 3HM8A 3K57A 2Z1IA 5JICA 2YHAA 1EKEA 2FSNA 4B9NA 3IMXA 3AO5A 1KAXA 1RDWX 3RSEA 3V9WA 3O3FA 2YJEA 2PY5A 3ZEUA 3VQ8A 3AVFA 5GADP 3C65A 3C7NA 1VHXA 4HCCA 2ITMA 1NKEA 3QBXA 3AVNA 3CFOA 4JKGA 2P9UA 3E01A 4GY2B 5AQWA 3ZSQA 1U48A 4FM2A 1TK5A 3OJUA 1C1AA 1YJ9N 3SQ4A 3LDQA 3K9KA 4DSIA 3ZSYA 4QCLA 2O8BA 3MEEA 4R5PA 3V1OA 2H3GX 3CYMA 4BVPA 1S5JA 4FLZA 4I9QA 3VQ4A 4CGIA 2P9IB 1NGJA 1CZBA 4KRFA 3VA0A 2JLEA 1G15A 4X62K 3U9DA 2XO7A 4L3QA 4DS5A 2HHTA 3N4QA 4DU3A 1K8KA 4CJ5A 3CQXA 1IKXA 1HQUA 3AA4A 1JLBA 2YNHA 4Z4CA 3P1GA 4CZKA 2Y1IA 1WNSA 1GOAA 4EFHA 3EN9A 2A6AA 4W5OA 3VEXA 1UWBA 5F2RA 3TAGA 4BE1A 4AHUA 1TUYA 5CR4A 1WN7A 2QXFA 4FXDA 3CCRN 3D2EA 3MEDA 5F1XA 1YI2N 2HBKA 3OTOK 1K8AO 3HZ6A 4FPBA 5CHIA 4FO0A 2RPIA 1HPMA 3DRRA 4H0YB 2XY7A 4JKHA 2NRWA 2P9SB 2YNFA 3ITHA 2QWRA 3CCEN 3ZT1A 3G0ZA 1A5XA 4ZHRA 3S9HA 5TKYA 1VQ7N 4M3UA 3F5TA 4QS8A 1XUPO 4C8NA 4KV8A 3O6WA 1BIZA 1VSDA 2OANA 4H0TB 2BE2A 3VQCA 3I8DA 5SZTA 1WSIA 4DV6K 5AQSA 2GTDA 1REVA 1FKPA 1VSIA 1Y64A 4GW6A 2G8HA 1HKCA 2PYLA 2XY6A 3F9KA 1BIUA 5GIPA 3M8RA 4H4OA 4CJKA 1NJXA 3NE6A 5AJ3K 3PX0A 1BHLA 3LDPA 4E7IA 5AQOA 1QQOA 1HQEA 4FJXA 4B1XB 3CCQN 3U6FA 4BG8A 3R1XA 3A8YA 3D7EO 1S9GA 4KH6A 2UYTA 1NWKA 4CESA 5HRNA 4E7KA 1UOCA 3L8BA 1LW0A 4JKDA 2NRTA 3HP9A 3O9QA 2NNWA 3MXJA 3QFPA 1LWEA 4Y1CA 3C6TA 3D2FA 4F8RA 4ILGB 3VA3A 2UXBK 1J9AA 4QS9A 4W5TA 2IOCA 5KPRA 3KWGA 1NM1A 3OYMA 3MK6A 1TK8A 4BE2A 2GX9A 4KREA 1FKOA 2KHOA 2OTLN 1GLAG 3U3GA 1NKCA 1S22A 3CIPA 1HJRA 2P5GA 3LDOA 3O9SA 3AVHA 3RMDA 5AQHA 4LF6K 3QEPA 1BCMA 3M6GA 4FK0A 1U4BA 2YHWA 4CIFA 2HHUA 4JS4A 4KH5A 3PO4A 3OYGA 1FW6A 2V52B 2YNGA 3NH0A 1SAZA 3EEQA 2OCEA 2QEXN 3BZKA 3ZX3A 3B6PA 3AARA 4QS7A 1FJGK 3CI5A 2B4JA 4BGBA 4N47A 1C0MA 2FSJA 3HOSA 2EHGA 3SMSA 3E1YA 2Q1NA 4NLCA 1P90A 1SL2A 2AA4A 3MN7A 2P9KA 4CEOA 2PFUA 4PWDA 4LC9B 3EE8A 5LJVA 1RTDA 3G25A 4CJEA 2YNIA 3WNHA 4IDHA 3VQ7A 4BDZA 4JHDB 1WBBA 4B9TA 2IDOA 4WE1A 3F2KA 1NK8A 4CJPA 1VSKA 1C6VA 1TKDA 2WFBA 4CF9A 4F2RA 3KKRA 1NG9A 1YITN 1IKWA 1JL1A 4DV7K 3CC7N 3CCMN 3RTVA 3RVCA 4FWOA 3GL1A 3VMFB 2GUIA 1L3TA 1JXBA 3DLLL 5JVHL 4GV9A 4AM6A 2DY4A 3VQAA 2IAJA 1L5UA 1CLQA 4TSXA 1ASWA 1VSLA 3J7AP 4K41A 2HNDA 1TYQA 3I0SA 2Q2RA 1VQ8N 2B6AA 1HYSA 3NDKA 3K9JA 4RWTA 4CJWA 4K0KK 4JK9A 4DSLA 3KLIA 1C1CA 4FJ7A 4HCBA 4CZEA 1KSPA 1WAFA 3DLBA 3VEZA 2FXUA 1J53A 3P31A 5C2FA 5HOOA 3SPZA 2NRHA 1WSEA 4CEBA 4J8FA 3VEWA 5I42A 1NBWA 5LY3A 1BO5O 4OGEA 1T8EA 1HKBA 1S1UA 3K2PA 4IOCL 5M1OA 1EWRA 3T1YK 5LMUK 3ISNC 2P9NA 3SUPA 1RT6A 2ZJRL 3H3OB 2Z1GA 4OX9K 4JI8K 2IGIA 1VSMA 3QIOA 3OYCA 3EO3A 2P9PB 1B9DA 2UUBK 3VQ9A 1JCEA 1JXEA 4F9OA 4I6MB 4K42A 4BREA 1DLOA 2CH5A 1M1KO 4JKEA 1VSFA 3ZLJA 3A5LC 4FWSA 5IT9O 3VQBA 4LF4K 5T7BA 5CYMA 4C1NI 4MLHA 2NRXA 1X9JA 4BR9A 5HLFA 2JWLA 4J2EA 4B3RK 1XMQK 2CGJA 1RDAA 1JCFA 4RW9A 1T6CA 4C1NK 2EX3A 3NF8A 5BREA 3O80A 4FLUA 5BPMA 5KGXA 3OHRA 3SYZA 3M1FA 4CEDA 4C8OA 2UUAK 5DM6L 2F9WA 3B6OA 4M41A 1Z6RA 1SL0A 4FW1A 5JS1A 1IKYA 3V9XA 4WF9L 3MX2A 3QICA 4KAZA 2QK9A 1HNZK 4JKCA 3KD1E 3HOTA 4HWIA 4AHSA 3WXMB 1VQKN 1N33K 4FM0A 1NK9A 1V4TA 3SAFA 1TKXA 4B3TK 1A5WA 1RT4A 2D0BA 1CZ9A 3C6UA 2YKNA 4CHYA 4YFUA 3CFRA 4DLGA 2OTJN 2UU9K 1ZBIA 3KIOA 3H1VX 3AGKA 5EU7A 3A5MC 4BRQA 4DS4A 5TKWA 3VF6A 3TAMA 3FFIA 4MLEA 1N36K 4AHTA 1BQMA 1ZBFA 4KO0A 5HBMA 3MX5A 3UKRB 1U04A 3NH1A 1NKBA 1GLBG 3KHYA 3QLHA 3ZT2A 1U45A 3VPZA 3AVKA 1WB9A 3IDHA 4PL8A 5GAGP 5M1QA 2PZSA 3HSCA 4GVMA 2PYJA 1NMNA 2HHSA 4HTLA 3MN9A 4KTQA 5C24A 3SV4A 3AVMA 3SQ2A 3SBTA 5E41A 2KTQA 4H8KA 1EQYA 3G71N 4UY8O 3Q7CA 1BGXT 1DTQA 4OVLA 4IEIA 5C15A 4NLBA 4DFKA 5I3UA 4DTSA 1HX1A 1XC3A 3QMLA 3LM9A 5ELZA 2IVOA 4J2BA 5EY4A 2HF3A 4Y1DA 4DV1K 2Z1HA 2YKMA 3QINA 4PA1A 3L3UA 1YVUA 3FZHA 4JD2A 4CE9A 4BE0A 1UA0A 4KB1A 2FBTA 2PBDA 2OZSA 3CJ9A 3ZETB 1GLEG 2ZM6K 1DEJA 3SK3A 1KXPA 3KKSA 4BRLA 3LDSA 4FLWA 4MDAA 4DV5K 3ENOA 1N8RO 1BG3A 3CC4N 4IO9L 2NRZA 3CC2N 4IFEA 3R8EA 1VSEA 1UAXA 1BI4B 5SWMA 3OW2M 1BU6O 4JI7K 3L0QA 4O5FA 2ZGYA 1DKGD 2HMIA 2E88A 4DR3K 3MN6A 4ISGA 1RBUA 1VQMN 3TABA 2QWNA 3HTVA 1QVGM 2IVNA 3T3FA 1Q86O 4K8ZA 1KQSM 4DQSA 2HVIA 2BH1A 3CJCA 4PKGA 1JLAA 3PIOL 3PIPL 4BR4A 3ULDA 3TU5A 5FROA 3UE5A 3D45A 4NB4A 3J81O 3MWTA 4BRCA 1L3VA 1GOCA 3LPUA 3ATUA 2Q0UA 3QEXA 3CPEA 3DLHA 2NLXA 4O8KA 3ENBA 1Q9YA 3L4QA 2E5LK 3PX6A 3CPWM 3HPHA 4OPJA 4IEEA 4DU1A 1GLJO 1EP4A 3CM5A 1BISA 1ASVA 4M45A 4DCHA 3OYBA 3ALYA
chains in the Genus database with same CATH topology
5AQPA 5DM7L 5AQNA 4H0VB 1MDUB 2ZF5O 1C0FA 1YXQA 3VTIA 1KD1O 5BN8A 2VYPA 5LJWA 3A5OC 4GV6A 5C0YA 4CZIA 3VGLA 5TKYA 4CZHA 1VQ7N 3F5TA 3QBWA 2HMPA 4JAXA 4QS8A 3R3LA 1XUPO 3I56N 3AAQA 4WQ5C 3MCAB 2VWBA 3FZFA 3O6WA 3CMEN 2OANA 2E2NA 4H0TB 3A0IX 4H5TA 3U4LA 4A5BA 1BA0A 1VQ6N 2HF4A 2NRRA 5AQSA 2GTDA 1VQON 2YX6A 5E26A 1MA9B 1YAGA 2JWKA 1Y64A 4A62A 3GBTA 1HKCA 3CJ7A 1NGEA 3T69A 4FSVA 2CH6A 3KWIA 3S41A 4JEPA 4XEIA 3WXKA 5GIPA 3DXMB 2QWMA 2A3ZA 5GIOA 1KAYA 3FE1A 3P39A 2D1KA 4B1ZA 1U2VB 3ULEA 3LDPA 4CD1A 5AQOA 1QQOA 4FVUA 5JLHA 4B1XB 3CCQN 4CZGA 4BG8A 3H1QA 4AM7A 1E4GT 4BVOA 1JJ2M 4K25A 3R1XA 3A8YA 3D7EO 3P4IA 4KBOA 3FGUA 4KH6A 2ZWHA 2UYTA 5GAHP 1NWKA 4YOTA 1D4XA 5AQTA 2ZJPL 1YHQN 3I8BA 4ILHA 1YUWA 3WXIA 4JKDA 2NRTA 3E9OA 3A5NC 3O9QA 2NNWA 1VAZA 3CERA 4H03B 3BP8A 4H5VA 3RSEB 3VEOA 1Z05A 1BOTO 2PAVA 4E1JA 2ZJQL 3QFPA 3ZEUB 1WOQA 2F7TA 3HBTA 3C0BA 4JK7A 3D2FA 4K43A 3CCLN 1S3XA 4ILGB 1T6DA 2NRVA 3C7NB 3O4WA 4QS9A 5BRHA 5KPRA 4JD2B 3NVKA 3VOVA 3KWGA 1NM1A 2QWLA 4JKGB 3MK6A 5AZJB 2GEMA 4BRKA 2P9UB 4BQLA 2FSKA 1QVGM 2W41A 2YHYA 3JXUA 4JKBA 1GLFO 1QZ5A 1ZXOA 2GX9A 2KHOA 3F9MA 3QDKA 4WYBA 1GLAG 2OTLN 3CMAN 2YJFA 1S22A 2P9PA 3MN5A 4MDBA 3CIPA 1ILYA 2QXLA 5AQFA 2RHKA 1ZC6A 4A57A 3LDOA 3O9SA 1GLDG 3WXJA 4CBUA 1HUXA 4I6MA 2HOEA 1NGBA 5AQHA 4RTFD 4FWNA 3KVGA 3M6GA 3T7ZA 2E20A 1RDUA 2YHWA 4XH5A 3BF3A 3GE1A 4NO7A 1M90O 5AZIA 3UKUA 4CZJA 4KH5A 4BROA 4IJNA 2ZGZA 4GNIA 2D0OA 3DXKB 2V52B 1SAZA 4DHYA 1MWKA 2QM1A 1WUAA 2QEXN 4M7YA 2HSTA 4FWQA 1X3NA 4KH4A 2QWPA 3ZX3A 1K8KB 2QI2A 5EXWA 4BRMA 4FOEA 3J7ZO 4A61A 3AARA 4QS7A 4OPHA 3CI5A 3ZX0A 4M7XA 5MLCQ 4WQ5A 4BGBA 3NVMA 2FSJA 3HOSA 3SMPA 3SMSA 3E1YA 2Q1NA 4NLCA 1P90A 3WUHA 5H1SQ 1P8ZA 4BRDA 2AA4A 5GINA 3MN7A 2D0PA 2P9KA 3O9TA 4A2AA 3IKMA 1YVNA 1BDGA 3N4PA 4JK8A 2PFUA 4LC9B 3EE8A 3WT0A 5LJVA 4AF1A 3G25A 1QZ6A 3CJ1A 4A5AA 3D2EB 3OA9A 4H0XB 2F9TA 4IDHA 4CJ7A 4ISEA 2BTFA 4JHDB 3H45C 3LDLA 5AQYA 1LOTB 2A40A 1HLUA 2HBMA 2VGNA 3FZLA 4BY9C 3F2KA 3VEYA 3D6RA 4IOXA 5EVZA 5GAEP 1Q7YO 2GELA 2WFBA 3LL3A 4ISFA 4IWVA 3G4SN 3VETA 3GDQA 3CXCM 1YITN 3U8XA 5AQQA 3DJCA 3M3ZA 5F0XA 1OVYA 1CZAN 3TTDA 3CC7N 3TSQA 1TUUA 1ATSA 3CCMN 4FPAA 4CBXA 3ZYYX 3RVCA 4U7BA 1YJWN 1K9MO 4FWOA 1NMDA 2WBNA 2ASOA 4ILJA 3GL1A 3LDNA 4BRIA 2E8AA 2RE2A 3VMFB 5JLFA 3DLLL 1O13A 5JVHL 3NMUA 4GV9A 4AM6A 3FLCO 2HBLA 5ADXH 4DQ8A 5AFUA 3SLCA 3MCPA 3EKSA 3Q7BA 3EE9A 2P9LA 3VGMA 4DKWA 3UKRA 4BRFA 3WEEA 4K41A 1KC8O 3TPQA 2E2OA 3E9PA 1TYQA 4BC5A 4PKHA 3L6QA 2Q2RA 3DWLA 1VQ8N 4WCEL 5JVGL 4BG9A 3R9PA 4G9ZA 5BPNA 1J6ZA 3K9JA 3ULEB 4RWTA 1MWMA 1ZBSA 5ADXA 4A2BA 4B1WB 2QA4N 3BUZB 3WQTA 4JK9A 1HJOA 2E1ZA 5M1PA 3AY9A 2IIRA 4CZEA 3KK7A 3VEZA 2FXUA 1BUPA 3O9RA 4H0PA 4IXCA 3P31A 3BEXA 3EL2A 4WFNL 5C2FA 5HOOA 2NRHA 5FPEA 3ENHA 4WFBL 4BQZA 1SS6A 1S72N 4J8FA 5M1FA 3TSPA 3VEWA 1NBWA 2A42A 4WQ4C 5LY3A 1BO5O 5KQDA 1KAZA 4BC2A 2AP1A 1HKBA 2J4RA 4YOVA 2GUPA 4CBWA 3W3DA 3D2FB 4IOCL 5M1OA 4JKFA 3IFRA 2Q31A 4H5NA 5AQUA 2YHXA 3I33A 4PKIA 2ASMA 2P9NA 4BRAA 1HKGA 3CCUN 1ATNA 1NGCA 2ZJRL 3H3OB 4EHUA 1DGKN 4CD3A 3B8AX 3EKUA 3MMVA 5AR0A 5I9EB 3CCJN 3EO3A 1YIJN 1H1VA 1X3MA 4BRNA 3QB0A 2P9PB 1QVFM 1YF5L 5AQGA 3E9LA 1JCEA 1VQNN 5AQKA 3ZETA 3FFKB 4U67L 4F9OA 4I6MB 4K42A 3VESA 4BREA 3I55N 2CH5A 4DB3A 1M1KO 2FF6A 4JKEA 3FR0A 4BR5A 1E4FT 1NGDA 1EO1A 3A5LC 4FWSA 1SQKA 4YOWA 5AZIB 3UKUB 3O9UA 3KZBA 4C1NI 3IUCA 4MLHA 2NRXA 1X9JA 4BR9A 2I7NA 1XQSC 3CF5L 2JWLA 4CZLA 3AGRA 3SAGA 2QW9A 2CGJA 2P9IA 2W40A 5C10A 1GLLO 4BRHA 3O1BA 4B1VA 2Q0RA 1OKJA 4MO5A 1JCFA 3C6HA 1T6CA 4C1NK 3ZX2A 2V7YA 4FOIA 2I7PA 4R79A 5AQMA 2A41A 4CZFA 4H0OA 4CI6A 1DT9A 1IJJA 3M5RA 5BREA 5BRFA 1VQ4N 1T44A 3O80A 1VQ5N 1NGGA 4YOXA 4CZMA 5BPMA 3CCSN 3OHRA 3CCVN 2WC9A 3M1FA 3QFUA 2NZTA 2E1YA 5BPLA 2P9KB 1SZ2A 5DM6L 2F9WA 3SBGA 4FWLA 1Z6RA 3EZWA 3FZKA 3HI0A 4WF9L 4B1YB 3MX2A 3QICA 1R59O 4XH1A 4Y0WA 3TSUA 4EIAA 4JKCA 5AQJA 4BRPA 3R6MA 3HOTA 2V51B 5FPMA 5AFUH 2WUSA 4HWIA 1NGAA 5AQXA 2DPNA 1ESVA 3VERA 3WXMB 1VQKN 2KLAA 3GOIA 1RGIA 4IO8A 3O08A 2P9SA 1IG8A 3CQYA 2CGKA 3H3NO 3VF4A 1V4TA 3SAFA 2V7ZA 2VGMA 3U9ZA 3W0LA 4M63C 5FPDA 4WQ4A 4IZ9A 2OTJN 4FWPA 3H1VX 3AGKA 3CETA 3H6EA 4BRQA 3A5MC 5TKWA 3VF6A 5HL7L 4EHTA 4MLEA 3CJBA 2FF3B 1NGIA 2EWSA 4A59A 2P9LB 4GV3A 2QWOA 3MX5A 3UKRB 1GLCG 1GLBG 3C6AA 3KHYA 5CE3A 1W2BM 3ID6A 4YOUA 3WEEB 1NJIO 4B1UB 1ATRA 3VPZA 1TYQB 4JNEA 4BR2A 4BC4A 4XH4A 5B8HA 5EX5A 3IDHA 2Q36A 2KKZA 4PL8A 5GAGP 5M1QA 4B9QA 3HSCA 3CHWA 5JMVA 3DXMA 4O8UA 4YDUC 4PHTX 4FWMA 4HTLA 1Q81O 4MO4A 3MN9A 2CGLA 4RCHA 4BRGA 1U2VA 2E2QA 4JKAA 3CD6N 1QQMA 3JS6A 4H5WA 3SBTA 1EQYA 3G71N 1VQLN 3Q7CA 4UY8O 2ASPA 4IEIA 3HM8A 5C15A 5BN9A 4NLBA 4YOYA 5E84A 5JICA 4PL7A 4BC3A 1HX1A 3DAWA 1Q18A 1XC3A 4JN4A 2FSNA 3QMLA 3IMXA 4OPAA 3LM9A 1VQ9N 1KAXA 5ELZA 2IVOA 1RDWX 5EY4A 3RSEA 3VEVA 2YJEA 3ATVA 3ZEUA 1RFQA 2HF3A 5C12A 5FPNA 5GADP 2P9NB 3C65A 3P38A 3C7NA 5KQ8A 2E2PA 1VQPN 5AQRA 2ITMA 3FZHA 3ID8A 4JD2A 3QBXA 4IJAA 4JKGA 5AZJA 3FZMA 3O1WA 2P9UA 4BR7A 1K73O 5KPZA 1LCUA 2IVPA 5AQLA 2PBDA 4GY2B 3CJ9A 1NLVA 1GLEG 5AQWA 1DEJA 3SK3A 1KXPA 3ZETB 4BRLA 4FWRA 3OBWA 5EOYA 5AQZA 4MDAA 3TTCA 3ENOA 1N8RO 2D4WA 2A5XA 1T3VA 2QWQA 1BG3A 3WXLA 3CC4N 4IO9L 2NRZA 3WQUA 1YJ9N 3LDQA 3K9KA 3SJHA 3CC2N 3L4IA 4IFEA 1W97L 1C0GA 3R8EA 4FWKA 2H3GX 4BVPA 3OW2M 1BU6O 1G99A 1NGHA 3L0QA 4O5FA 2P9IB 1U6ZA 1NGJA 1DKGD 2FLOA 2ZGYA 3DXKA 3E66A 1YJNN 2E88A 3GG4A 3MN6A 4ISGA 4FL9A 3U9DA 3LM2A 1QQNA 3MWPA 1VQMN 4L3QA 3UB5A 2VCPA 2QWNA 3AAPA 3HTVA 3N4QA 1NGFA 4YORA 3VTHA 2IVNA 2YCHA 1K8KA 4C23A 5KPTA 3G6EN 2Q97A 1Q86O 3CQXA 1KQSM 2BH1A 3CJCA 4PKGA 3OBYA 4EAHD 3HRGA 2QTDA 3O5BA 1V4SA 1QHAA 4CZKA 3VGKA 3PIOL 1Q82O 5M1KA 2BUPA 3PIPL 4BR4A 4EFHA 3EN9A 3MDQA 1BWFO 2GWJA 3CJAA 5M1NA 2A6AA 5AQIA 3TU5A 3UE5A 2GWKA 4NB4A 3VEXA 3VF2A 4WFAL 3J8AA 3MWTA 4BRCA 5F2RA 4Z94A 2HBJA 3BF1A 4BR0A 4OO1J 1JCGA 3ATUA 1TUYA 2Q0UA 4YDUA 5CR4A 2YI1A 3CCRN 3CPEA 3D2EA 5F1XA 2NLXA 3O8MA 4GVEA 4O8KA 4JHDA 3ENBA 1YI2N 2HBKA 3PLAA 3H46O 3HZ6A 3L4QA 4FPBA 1K8AO 5CHIA 4FO0A 3CPWM 4IOAL 1HPMA 4H0YB 4H5RA 4JKHA 2NRWA 2P9SB 4IEEA 1GLJO 5BR9A 5BRDA 3VENA 5AQVA 4BGAA 5C2DA 4DCHA 2QWRA 1BA1A 3TTFA 3SAHA 3CCEN
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DM7 L;  5MLC Q;  3CD6 N;  1QVF M;  1VQN N;  1KD1 O;  4U67 L;  3G71 N;  1VQL N;  4UY8 O;  5H1S Q;  3I55 N;  1VQ7 N;  1M1K O;  3I56 N;  3CME N;  1VQ6 N;  1VQ9 N;  1VQO N;  3CF5 L;  5GAD P;  5GAE P;  1Q7Y O;  3G4S N;  1VQP N;  3CXC M;  1YIT N;  1OVY A;  3CC7 N;  1K73 O;  1VQ4 N;  3CCM N;  1VQ5 N;  3CCQ N;  4IOA L;  1YJW N;  3CCS N;  1JJ2 M;  3CCV N;  1K9M O;  1N8R O;  5GAH P;  3CC4 N;  4IO9 L;  5DM6 L;  1YJ9 N;  2ZJP L;  3DLL L;  3CC2 N;  1YHQ N;  5JVH L;  4WF9 L;  3OW2 M;  2ZJQ L;  1YJN N;  1KC8 O;  3CCL N;  1VQK N;  1VQM N;  1VQ8 N;  4WCE L;  5JVG L;  1QVG M;  3G6E N;  1Q86 O;  1KQS M;  2QA4 N;  2OTL N;  3CMA N;  1ILY A;  3PIO L;  1Q82 O;  2OTJ N;  3PIP L;  4WFN L;  4WFB L;  5HL7 L;  1S72 N;  4WFA L;  1Q81 O;  1M90 O;  1W2B M;  3CCE N;  3CCR N;  1NJI O;  4IOC L;  1YI2 N;  1K8A O;  2QEX N;  3CPW M;  3CCU N;  5GAG P;  2ZJR L;  3J7Z O;  1YIJ N;  3CCJ N; 
#chains in the Genus database with same CATH topology
 4X66 K;  5AQP A;  3ZSW A;  5DM7 L;  1NOY A;  5AQN A;  2ZF5 O;  1YXQ A;  2X6S A;  5BN8 A;  3A5O C;  5C0Y A;  3T19 A;  5J2P A;  3V81 A;  4JAX A;  3MCA B;  3FZF A;  2E2N A;  3ASM A;  3LPT A;  4F3T A;  4OLA A;  1BA0 A;  4FZY A;  2HF4 A;  4CGG A;  4CFA A;  1VQO N;  1MA9 B;  3DRP A;  4BWJ A;  3GBT A;  4DQP A;  3T69 A;  4XEI A;  3ZSR A;  3V1Q A;  1RNH A;  5CZ1 A;  4DV0 K;  2A3Z A;  1JLE A;  1W9H A;  3FE1 A;  2D1K A;  4B1Z A;  3SV3 A;  2O8C B;  3ULE A;  4FVU A;  4Z0U A;  4EZ9 A;  4IDK A;  4CIG A;  3H1Q A;  4DR6 K;  4BVO A;  4K25 A;  4AHR A;  1S1T A;  3K58 A;  3NGZ A;  2ZWH A;  3HM9 A;  4YOT A;  2ZJP L;  1TV6 A;  3I8B A;  2HVH A;  4LD0 A;  3NCI A;  4ILH A;  3WXI A;  2GV9 A;  3NFA A;  3E9O A;  4FZX C;  1VRU A;  4ELT A;  3RSE B;  3VEO A;  4E1J A;  3ZEU B;  1WOQ A;  4E7L A;  4DQI A;  3QIP A;  4Q5V A;  1NJY A;  4K43 A;  3G10 A;  4CJR A;  1S3X A;  4CGH A;  1T6D A;  2NRV A;  3C7N B;  5JS2 A;  4M42 A;  3NVK A;  1CXQ A;  2QWL A;  4JKG B;  4BRK A;  3U3Y A;  2P9U B;  3TWH A;  2FSK A;  4JKB A;  1RBS A;  4WYB A;  3AVL A;  4ZTJ A;  4MDB A;  2RHK A;  1ZC6 A;  3ZCM A;  3NBP A;  3HYF A;  3SJJ A;  3IG1 A;  3KVG A;  2O8B B;  4KKO A;  4XH5 A;  3BF3 A;  3GE1 A;  2WON A;  4NO7 A;  1M90 O;  5AZI A;  3UKU A;  3LP0 A;  3SCX A;  4IJN A;  3V9U A;  3DLR A;  5KTQ A;  1MU2 A;  1W0H A;  1MWK A;  3LAL A;  4O0I A;  1TGO A;  4RW7 A;  2HST A;  3LZJ A;  4E19 A;  1K8K B;  1W7A A;  4A61 A;  3I0R A;  4OPH A;  3ZX0 A;  3AA2 A;  1HMV A;  1TVR A;  5MLC Q;  3AO4 A;  1C0U A;  1NK4 A;  1HR0 K;  2WOM A;  5H1S Q;  3O9T A;  4A2A A;  4UQG A;  4JK8 A;  3CJ1 A;  4A5A A;  1IBK K;  3D2E B;  3OA9 A;  4H0X B;  2F9T A;  3J7Y P;  1N6Q A;  2O4I A;  4ISE A;  3H45 C;  2VGN A;  4IG0 A;  5HRS A;  4FLY A;  1Q7Y O;  2GEL A;  4JI3 K;  4IWV A;  4K8X A;  2O8D A;  3M3Z A;  5KRT A;  1TUU A;  4FPA A;  4U7B A;  2WBN A;  4KTZ A;  3QO9 A;  3LDN A;  1T05 A;  2KFN A;  3FLC O;  4CK2 A;  3AVI A;  3VGM A;  4DKW A;  1OVQ A;  1Z26 A;  5CYQ A;  4BRF A;  5J2N A;  4DR4 K;  1KVA A;  1X9S A;  5JVG L;  4G9Z A;  1J6Z A;  4A2B A;  2QA4 N;  3BUZ B;  3WQT A;  1N34 K;  2E1Z A;  3EY1 A;  3KK7 A;  4B9M A;  2UXC K;  2HW3 A;  2QKB A;  4WFN L;  3ENH A;  4WFB L;  4BQZ A;  3O4N A;  2XY5 A;  3OYH A;  2OA8 A;  3TAF A;  1Y97 A;  4JI2 K;  4WQ4 C;  3KTQ A;  4PUO A;  5KQD A;  1HNW K;  3IAY A;  4F4K A;  4BC2 A;  4Z4H A;  2AP1 A;  3OS2 A;  2J4R A;  4YOV A;  2GUP A;  1S6Q A;  3D2F B;  3C94 A;  3IFR A;  2Q31 A;  4EP5 A;  4CF8 A;  1RTI A;  5FRM A;  4F2S A;  3I33 A;  4PKI A;  2ASM A;  3THW A;  3DLE A;  4FJ9 A;  4N56 A;  3EZ5 A;  3EKU A;  5AR0 A;  1YIJ N;  4FJG A;  4DFM A;  1H1V A;  3QB0 A;  4RW6 A;  1YF5 L;  1QVF M;  4OGC A;  5DMR A;  2G8U A;  4PQU A;  4CHN A;  3VES A;  1IG9 A;  2RN2 A;  3KLE A;  2XRI A;  1RT7 A;  2FF6 A;  4I2Q A;  3VQE A;  3FR0 A;  1NGD A;  1T03 A;  4LSL A;  1HPZ A;  3TAP A;  4ZTF A;  3TR8 A;  5D3G A;  3SAG A;  3RR7 A;  2ITG A;  3O1B A;  2Q0R A;  4FZZ A;  4CJV A;  2G8W A;  3ZX2 A;  4R79 A;  2I7P A;  3DRS A;  1SL1 A;  5J2M A;  2A41 A;  3PSI A;  1EX4 A;  2HNY A;  5BRF A;  1QSY A;  1NGG A;  5CY4 A;  3CCV N;  2WC9 A;  3VQ5 A;  3QFU A;  4OKE A;  1A5V A;  2P9K B;  1RTH A;  3ZSZ A;  3SBG A;  1ASU A;  4FLT A;  4AIL C;  4KTW A;  3UIQ A;  5DK5 A;  3OYF A;  5HRR A;  4EIA A;  2HHH K;  3L2W A;  2KZZ A;  4BRP A;  3R6M A;  1NGA A;  2DPN A;  1ESV A;  3VER A;  2WTU A;  1RGI A;  3ZT4 A;  4FVM A;  1S1X A;  2XHB A;  4N76 A;  1ITG A;  2VGM A;  3KLH A;  4WQ4 A;  3KLG A;  4F3O A;  1TL3 A;  4DTM A;  1TK0 A;  3KLF A;  4FJH A;  1WSG A;  4YNQ A;  4FCY A;  3K5N A;  1YT3 A;  4C8M A;  3K5M A;  1NGI A;  1X1P A;  4GV3 A;  4OPK A;  4NCB A;  2W6L A;  5CE3 A;  1L3U A;  4YOU A;  1ATR A;  1TYQ B;  1NK7 A;  4JNE A;  4FLV A;  4BC4 A;  4DFJ A;  1KVB A;  2HHV A;  2YHB A;  2Q36 A;  2KKZ A;  4CIE A;  2VG6 A;  4B9Q A;  3SZ2 A;  3CHW A;  3PSF A;  1J54 A;  3DXM A;  4YDU C;  4N5S A;  4DF8 A;  4HUF A;  2CGL A;  4BRG A;  1U2V A;  3NF9 A;  1QQM A;  3JS6 A;  4H5W A;  4CJT A;  4ELU A;  4Z4F A;  3TI0 A;  4W5Q A;  5BN9 A;  1VRT A;  3CM6 A;  1J5O A;  4AHV A;  4KB0 A;  4DWI A;  3DAW A;  1Q18 A;  3OYA A;  4BDP A;  2DTU A;  4OPA A;  4E3S A;  4DV4 K;  3MXM A;  3RR8 A;  3VEV A;  5C25 A;  1IH7 A;  5C12 A;  3SUN A;  2DFF A;  5FPN A;  2P9N B;  4CGD A;  4DF4 A;  4GKJ K;  3DMJ A;  3BZC A;  2ATQ A;  3ID8 A;  5AZJ A;  1K73 O;  1LCU A;  5AQL A;  2IVP A;  4IOA L;  1NLV A;  2KW4 A;  4FWR A;  3OBW A;  2Z1J A;  5EOY A;  2FBV A;  3O4Q A;  3WQU A;  4AQY K;  4LY7 A;  3SJH A;  4I2P A;  1W97 L;  4DR5 K;  3OYL A;  1G99 A;  4CEF A;  3MAQ A;  1NGH A;  4CER A;  3S3N A;  3DXK A;  2FLO A;  3NH2 A;  3OS0 A;  4Q0B A;  3LM2 A;  1QQN A;  1RDD A;  1S1V A;  1NGF A;  3G6E N;  2YCH A;  4LH4 A;  1KRP A;  4EAH D;  1N5Y A;  3D0P A;  3VN5 A;  1QHA A;  2VWJ A;  3JYT A;  3VGK A;  5M1K A;  3HT3 A;  3MDQ A;  1BWF O;  1JLQ A;  3CJA A;  5M1N A;  1OH5 A;  5AQI A;  2GWK A;  3VF2 A;  3J8A A;  3QES A;  3LP1 A;  1U47 A;  4NCA A;  4OO1 J;  2KFZ A;  4YDU A;  3DM2 A;  3M8S A;  2IC3 A;  3O8M A;  4GVE A;  3H46 O;  3OY9 A;  4BDY A;  3NHG A;  4H5R A;  1RBV A;  5HRP A;  3VEN A;  5AQV A;  4BGA A;  5C2D A;  4B08 A;  3TTF A;  4M3W A;  4Z4I A;  3HST B;  2JGU A;  4H0V B;  1C0F A;  2IS3 A;  3VTI A;  2RF2 A;  3JAM O;  4GV6 A;  4CZI A;  2UXD K;  1LAV A;  2F96 A;  1F21 A;  2HMP A;  4IFY A;  3I56 N;  1U49 A;  3AAQ A;  3A0I X;  4H5T A;  4B9L A;  3T1A A;  2NRR A;  1OH8 A;  2JWK A;  4FJJ A;  1SKW A;  1SKS A;  1NGE A;  2CH6 A;  3KWI A;  3S41 A;  4JEP A;  3QNN A;  5GIO A;  3QER A;  2W42 A;  4FJI A;  4CHZ A;  3OYI A;  4AM7 A;  1JJ2 M;  4KBO A;  4AHC A;  3V1R A;  3SUQ A;  3ZSV A;  1KFD A;  4G1Q A;  4B8C A;  1D4X A;  2AJQ A;  2FBY A;  4NYF A;  1LW2 A;  1YUW A;  2KZM A;  1VAZ A;  3KK3 A;  3CER A;  3BP8 A;  4CGF A;  2RKI A;  2PAV A;  1BOT O;  2ZJQ L;  2F7T A;  3C0B A;  4DTJ A;  3AO3 A;  3NGI A;  3O4W A;  1ZYQ A;  4JD2 B;  3VOV A;  4LF5 K;  1NK0 A;  1RT3 A;  4BQL A;  2YHY A;  3JXU A;  1GLF O;  1QZ5 A;  3F9M A;  3SQ0 A;  4CJ3 A;  4FJ8 A;  3PY8 A;  3MN5 A;  1ILY A;  4DTO A;  4A57 A;  1GLD G;  3V4I A;  2R7Y A;  1JL2 A;  2HOE A;  1NGB A;  3CG7 A;  4FK4 A;  4RTF D;  4FWN A;  4DQQ A;  3MXI A;  3T7Z A;  4N41 A;  2O8E A;  4CZJ A;  2ZGZ A;  4W5N A;  3C95 A;  2D0O A;  4GNI A;  1NK5 A;  4OKJ A;  4DHY A;  2QM1 A;  4CJS A;  4M7Y A;  5FLX O;  4CK3 A;  4IKF A;  1OH7 A;  4KH4 A;  2QWP A;  3SPY A;  4BRM A;  5EXW A;  2QI2 A;  3J7Z O;  3RMC A;  4KHQ A;  1XI1 A;  4E7J A;  4M7X A;  3NF7 A;  2UUC K;  3NVM A;  3SMP A;  3K59 A;  2NUB A;  3OYN A;  3WUH A;  1P8Z A;  5GIN A;  2G8K A;  2D0P A;  4CEC A;  3QEW A;  1BDG A;  3N4P A;  4CHP A;  1L3S A;  3BDP A;  4AF1 A;  3LAM A;  1BCO A;  1KLM A;  3SI6 A;  4CJ7 A;  2BTF A;  2E6M A;  3LDL A;  4CW7 B;  2A40 A;  3VEY A;  4KHU A;  4IOX A;  5EVZ A;  3THX A;  2B5J A;  3G4S N;  3LL3 A;  4ISF A;  3CXC M;  3U8X A;  5AQQ A;  3DJC A;  4CK1 A;  4YHH K;  5F0X A;  3THY A;  1CZA N;  3TTD A;  4NXN K;  3QNO A;  1B92 A;  4CBX A;  1YJW N;  3DOK A;  2X6N A;  2ASO A;  1TKT A;  4ILJ A;  4JLH A;  3O3G A;  2D5R A;  1WSF A;  4OKK A;  1IBL K;  5JLF A;  3HXM A;  3L2Q A;  1O13 A;  1BQN A;  3IRX A;  2HBL A;  5ADX H;  5AFU A;  2O8F A;  3SLC A;  3MCP A;  4DTN A;  3EE9 A;  2P9L A;  1HYZ A;  5FDL A;  4XIU A;  1XHZ A;  4LF7 K;  1HNX K;  4YY3 K;  5KRS A;  3WEE A;  4FYD A;  2E2O A;  4JS5 A;  1ZBL A;  3M8Q A;  4BC5 A;  2OYQ A;  4PKH A;  4KHY A;  4WCE L;  4BG9 A;  3R9P A;  5FRN A;  3ULE B;  2BDP A;  1MWM A;  1IO2 A;  3P83 D;  1ZBS A;  1D9F A;  3SUO A;  1HJO A;  4FW2 A;  1XC9 A;  5M1P A;  4IFV A;  2IIR A;  4CHQ A;  1EXQ A;  4KHW A;  1KTQ A;  1BUP A;  3O9R A;  3BEX A;  3T1H K;  1S72 N;  5M1F A;  1KAZ A;  3W3D A;  2ZE2 A;  4C8K A;  3HPG A;  4CEE A;  4M3T A;  1RDB A;  5AQU A;  3AO2 A;  4BRA A;  1ATN A;  1NGC A;  1B9F A;  2LSN A;  4O55 A;  3MMV A;  3H08 A;  1LWC A;  4CGJ A;  1RBT A;  1C1B A;  4BRN A;  2ZD1 A;  5AQG A;  5AQK A;  1KCF A;  2XY8 A;  2BGG A;  4DB3 A;  1E4F T;  1EO1 A;  4CCH A;  1RBR A;  5AZI B;  3UKU B;  1QSS A;  3IUC A;  1XWL A;  2HNZ A;  2I7N A;  1EWQ A;  5J2Q A;  3AGR A;  1JLG A;  2QW9 A;  2W40 A;  2P9I A;  5C10 A;  1YTU A;  1GLL O;  4O4G A;  4BRH A;  4B1V A;  1OKJ A;  4MO5 A;  3C6H A;  2P51 A;  3OVN A;  4O0J A;  4FOI A;  3HP6 A;  1GOB A;  4CZF A;  4KPY A;  3CFP A;  4CI6 A;  1DT9 A;  1IJJ A;  4DR1 K;  1RIL A;  1VQ4 N;  1VQ5 N;  4CZM A;  3CCS N;  5BPL A;  5LMN K;  4LF9 K;  1EET A;  4DTU A;  4KI4 A;  2VG5 A;  1XMO K;  3FZK A;  3HI0 A;  4B1Y B;  3HL8 A;  4XH1 A;  4B3O A;  3AVA A;  5AQJ A;  5K14 A;  5BR8 K;  2V51 B;  5FPM A;  5AFU H;  2WUS A;  2HHW A;  5AQX A;  3LZI A;  1JLC A;  2Q3S A;  2O8D B;  4IO8 A;  3O08 A;  2P9S A;  1IG8 A;  3CQY A;  3VF4 A;  4JRP A;  3ZT0 A;  3WNE A;  4E7H A;  2V7Z A;  4CEQ A;  3U9Z A;  4M63 C;  4CHO A;  2A1R A;  3LP3 A;  4IZ9 A;  4CFC A;  4QAG A;  4FWP A;  2D0A A;  4CEA A;  4O44 A;  4B9S A;  3SQ1 A;  4DTX A;  5HL7 L;  3VQ6 A;  3CJB A;  3CQ8 A;  2HHQ A;  1FXX A;  3L2V A;  1GLC G;  3C6A A;  2HHX A;  3ID6 A;  3WNG A;  1UA1 A;  2Y1J A;  4JI6 K;  3PUF A;  4XH4 A;  2W6K A;  2OPP A;  3AVG A;  4HHT A;  1TL1 A;  1RT1 A;  4PHT X;  4FWM A;  4MO4 A;  3TAR A;  1HYV A;  3AV9 A;  4RCH A;  2E2Q A;  4JKA A;  3CD6 N;  4JI4 K;  2P1J A;  4EP4 A;  3DLK A;  2ASP A;  4YOY A;  1QHT A;  5E84 A;  4E89 A;  4PL7 A;  4BC3 A;  4DQR A;  4JN4 A;  4BWM A;  4FK2 A;  1VQ9 N;  2OPQ A;  4KHN A;  3ATV A;  3RRH A;  1IKV A;  1RFQ A;  4DMN A;  3THW B;  1KVC A;  1TKZ A;  3P38 A;  5KQ8 A;  1VQP N;  2E2P A;  4HVJ A;  1LV5 A;  5AQR A;  4IBN A;  4DSF A;  4IJA A;  3FZM A;  3O1W A;  1T7P A;  4BR7 A;  5KPZ A;  1LAW A;  3QEV A;  4IG3 A;  3SNN A;  1Z25 A;  4I9L A;  3TTC A;  5AQZ A;  2D4W A;  2A5X A;  1T3V A;  2QWQ A;  1SUQ A;  3WXL A;  1VSH A;  3HVT A;  3DLG A;  4DTP A;  3L4I A;  3OJS A;  1C0G A;  4FWK A;  2YV0 X;  4V19 S;  4E1M A;  1U6Z A;  3E66 A;  1YJN N;  4KI6 A;  3GG4 A;  4I7F A;  3V6D A;  3L3V A;  4FL9 A;  2O4G A;  3MWP A;  3OYJ A;  3WNF A;  3UB5 A;  4B3S K;  2VCP A;  3AAP A;  3VTH A;  4YOR A;  4C23 A;  5KPT A;  1C0T A;  2Q97 A;  3OBY A;  3OYD A;  3HRG A;  2QTD A;  3O5B A;  1Q8I A;  1V4S A;  3TAE A;  2VG7 A;  4MFB A;  1RT5 A;  1Q82 O;  4AH9 A;  3VQP A;  2BUP A;  3KK2 A;  1WAJ A;  3LP2 A;  2GWJ A;  4OLB A;  4RW8 A;  3JSM A;  4Z4G A;  4WFA L;  3IS9 A;  3BY5 A;  2HBJ A;  4Z94 A;  3BF1 A;  4BR0 A;  1JCG A;  3RRG A;  3NGY A;  2YI1 A;  4DV3 K;  3PLA A;  4JHD A;  3L2R A;  3KK1 A;  2G8I A;  3BGR A;  2ZQB A;  4OJR A;  5BR9 A;  2HB5 A;  5BRD A;  4ICL A;  3K0S A;  4DU4 A;  1RDC A;  4JI0 K;  1BA1 A;  3SAH A;  4B9V A;  4J2A A;  2FBX A;  4EZ6 A;  1MDU B;  1KD1 O;  4LF8 K;  2VYP A;  5LJW A;  1TAU A;  2DFH A;  3THV A;  3VGL A;  1R0A A;  4CZH A;  4RG8 A;  2P5O A;  3QBW A;  4E0D A;  4CJQ A;  3HO1 A;  3R3L A;  3RMA A;  4ELV A;  4WQ5 C;  2VWB A;  3CME N;  4H4M A;  3U4L A;  1VQ6 N;  4A5B A;  4DSE A;  4FM1 A;  4DFP A;  4CJU A;  3F73 A;  2YX6 A;  5E26 A;  3K5L A;  1YAG A;  4A62 A;  3CJ7 A;  4ID5 A;  4FSV A;  3WXK A;  1NJZ A;  1I39 A;  2QWM A;  3DXM B;  4LFC K;  1KAY A;  3P39 A;  3LWL A;  1U2V B;  1XNQ K;  4CD1 A;  4J2D A;  5JLH A;  1NJW A;  1VSJ A;  4CZG A;  1E4G T;  1VK0 A;  3P4I A;  2D0C A;  3FGU A;  5GAH P;  3HJF A;  1I94 K;  1WSJ A;  3A2F A;  5AQT A;  4C8L A;  1YHQ N;  4NCG A;  1QTM A;  4M3Z A;  3NF6 A;  3ZSX A;  3A5N C;  3PO5 A;  3LAN A;  4H03 B;  4H5V A;  2X78 A;  1Z05 A;  3HBT A;  4JK7 A;  3QEI A;  4DSJ A;  3CCL N;  1DTT A;  1RCH A;  5BRH A;  1HNV A;  1QS4 A;  4GKK K;  5AZJ B;  2GEM A;  3AA5 X;  4ID1 A;  3OS1 A;  2KQ2 A;  2W41 A;  4JV5 K;  1ZXO A;  3QDK A;  1SV5 A;  4W5R A;  3CMA N;  2YJF A;  2P9P A;  1IBM K;  2QXL A;  5AQF A;  3HK2 A;  3WXJ A;  4CBU A;  1HUX A;  4I6M A;  1YTA A;  1BL3 A;  4X65 K;  2E20 A;  1RDU A;  1CXU A;  4CF1 A;  1FK9 A;  1QE1 A;  4HUG A;  3NAE A;  1ZBU A;  4BRO A;  1D9D A;  3DXK B;  4O5B A;  2QKK A;  2G8F A;  1WUA A;  3DI6 A;  3HVR A;  4FWQ A;  1X3N A;  4DUY K;  4FJL A;  5HRO A;  2X74 A;  4FOE A;  3EYZ A;  4QOZ B;  1NU0 A;  4WQ5 A;  3P5J A;  4LH5 A;  1S9E A;  4RW4 A;  4B8A B;  3LAK A;  4CFB A;  4M3R A;  4BRD A;  3IKM A;  1YVN A;  5HP1 A;  3WT0 A;  1QZ6 A;  1NK6 A;  3VQQ A;  1WBD A;  5AQY A;  4CVN E;  1LOT B;  2VQF K;  1D5A A;  1HLU A;  2HBM A;  3FZL A;  3QET A;  4BY9 C;  2OZM A;  1I3A A;  2OPR A;  3D6R A;  4DR7 K;  5GAE P;  1JKH A;  3S3M A;  3AO1 A;  3VET A;  3GDQ A;  5KGW A;  1OVY A;  5A2Q O;  3TSQ A;  1ATS A;  1HRH A;  3ZYY X;  1JLF A;  1K9M O;  1NMD A;  2F8S A;  3OYE A;  2A1S A;  4BRI A;  2E8A A;  2RE2 A;  4DV2 K;  4BAC A;  2VWK A;  3NMU A;  3KJV A;  4DQ8 A;  4FJK A;  3TAN A;  4FJ5 A;  3EKS A;  4E1N A;  3Q7B A;  2E6L A;  1X9M A;  2BAN A;  1XNR K;  3KD5 E;  3UKR A;  4CEZ A;  1KC8 O;  3TPQ A;  4LFB K;  3E9P A;  4GMJ B;  3L6Q A;  3DWL A;  5BPN A;  3OYK A;  4MQ3 A;  1NOZ A;  4FJM A;  5ADX A;  4B1W B;  3DYA A;  4JYA K;  3ZSO A;  3PV8 A;  3AY9 A;  4CF0 A;  4CFD A;  4JI1 K;  2FC0 A;  5J1E A;  1RTJ A;  4FLX A;  4H0P A;  4IXC A;  3EL2 A;  4NXM K;  5FPE A;  1TAQ A;  4JI5 K;  1SS6 A;  3TSP A;  3AVB A;  2A42 A;  3M8P A;  4KHS A;  3AVC A;  4CBW A;  1RT2 A;  2DFE A;  3PX4 A;  4JKF A;  5LL6 Z;  4H5N A;  1S6P A;  2YHX A;  3O3H A;  3CCU N;  1HKG A;  4EHU A;  4LFA K;  1DGK N;  4CD3 A;  3B8A X;  5I9E B;  5C42 A;  3CCJ N;  1OH6 A;  1X3M A;  3E9L A;  1VQN N;  3AVJ A;  3FFK B;  3ZET A;  4U67 L;  3I55 N;  4DLE A;  4BR5 A;  4DTR A;  4YOW A;  1SQK A;  1X9W A;  2O8E B;  1S1W A;  4DG1 A;  3O9U A;  3KZB A;  4CJ4 A;  3RWU A;  2E4L A;  1XQS C;  4DUZ K;  1BI4 A;  3CF5 L;  4M3Y A;  4CZL A;  3RMB A;  1O1W A;  2ETJ A;  4L8R B;  1Q9X A;  1WSH A;  2V7Y A;  1K6Y A;  5AQM A;  4FJN A;  5CZ2 A;  4H0O A;  1QSL A;  3M5R A;  1T44 A;  1ZBH A;  3V9Z A;  4YOX A;  1NNE A;  4KHP K;  5KI6 A;  2NZT A;  2E1Y A;  1SZ2 A;  1XHX A;  3LWM A;  4DSK A;  4FWL A;  3EZW A;  4HTU A;  2OPS A;  4KFB A;  4HUE A;  1R59 O;  4Y0W A;  3TSU A;  5IWA K;  1SKR A;  3HPO A;  4M3X A;  3AA3 A;  3THX B;  2KLA A;  3S3O A;  3GOI A;  4JRQ A;  3VQD A;  3H3N O;  2CGK A;  1E3M A;  3THY B;  1N32 K;  2GBZ A;  1D8Y A;  3W0L A;  1HNI A;  5FPD A;  3CET A;  1J5E K;  3H6E A;  2F4V K;  3MEC A;  2O8F B;  4EHT A;  4B9U A;  3V9S A;  2FF3 B;  2EWS A;  4A59 A;  2P9L B;  4DR2 K;  2QWO A;  3TAQ A;  1W2B M;  2F8T A;  3WEE B;  1NJI O;  4NYN A;  1KFS A;  4B1U B;  1LWF A;  4BR2 A;  3ZT3 A;  4LSN A;  1QQC A;  5B8H A;  5EX5 A;  4X64 K;  4CF2 A;  3DOL A;  4CJF A;  3J80 O;  5JMV A;  4Z4E A;  4O8U A;  3K5O A;  1Q81 O;  2O8C A;  2I5J A;  4CJL A;  1KLN A;  4B3M K;  4PY5 A;  2G8V A;  2VQE K;  3L2U A;  1IV0 A;  1VQL N;  1WLJ A;  3MEG A;  3HM8 A;  3K57 A;  2Z1I A;  5JIC A;  2YHA A;  1EKE A;  2FSN A;  4B9N A;  3IMX A;  3AO5 A;  1KAX A;  1RDW X;  3RSE A;  3V9W A;  3O3F A;  2YJE A;  2PY5 A;  3ZEU A;  3VQ8 A;  3AVF A;  5GAD P;  3C65 A;  3C7N A;  1VHX A;  4HCC A;  2ITM A;  1NKE A;  3QBX A;  3AVN A;  3CFO A;  4JKG A;  2P9U A;  3E01 A;  4GY2 B;  5AQW A;  3ZSQ A;  1U48 A;  4FM2 A;  1TK5 A;  3OJU A;  1C1A A;  1YJ9 N;  3SQ4 A;  3LDQ A;  3K9K A;  4DSI A;  3ZSY A;  4QCL A;  2O8B A;  3MEE A;  4R5P A;  3V1O A;  2H3G X;  3CYM A;  4BVP A;  1S5J A;  4FLZ A;  4I9Q A;  3VQ4 A;  4CGI A;  2P9I B;  1NGJ A;  1CZB A;  4KRF A;  3VA0 A;  2JLE A;  1G15 A;  4X62 K;  3U9D A;  2XO7 A;  4L3Q A;  4DS5 A;  2HHT A;  3N4Q A;  4DU3 A;  1K8K A;  4CJ5 A;  3CQX A;  1IKX A;  1HQU A;  3AA4 A;  1JLB A;  2YNH A;  4Z4C A;  3P1G A;  4CZK A;  2Y1I A;  1WNS A;  1GOA A;  4EFH A;  3EN9 A;  2A6A A;  4W5O A;  3VEX A;  1UWB A;  5F2R A;  3TAG A;  4BE1 A;  4AHU A;  1TUY A;  5CR4 A;  1WN7 A;  2QXF A;  4FXD A;  3CCR N;  3D2E A;  3MED A;  5F1X A;  1YI2 N;  2HBK A;  3OTO K;  1K8A O;  3HZ6 A;  4FPB A;  5CHI A;  4FO0 A;  2RPI A;  1HPM A;  3DRR A;  4H0Y B;  2XY7 A;  4JKH A;  2NRW A;  2P9S B;  2YNF A;  3ITH A;  2QWR A;  3CCE N;  3ZT1 A;  3G0Z A;  1A5X A;  4ZHR A;  3S9H A;  5TKY A;  1VQ7 N;  4M3U A;  3F5T A;  4QS8 A;  1XUP O;  4C8N A;  4KV8 A;  3O6W A;  1BIZ A;  1VSD A;  2OAN A;  4H0T B;  2BE2 A;  3VQC A;  3I8D A;  5SZT A;  1WSI A;  4DV6 K;  5AQS A;  2GTD A;  1REV A;  1FKP A;  1VSI A;  1Y64 A;  4GW6 A;  2G8H A;  1HKC A;  2PYL A;  2XY6 A;  3F9K A;  1BIU A;  5GIP A;  3M8R A;  4H4O A;  4CJK A;  1NJX A;  3NE6 A;  5AJ3 K;  3PX0 A;  1BHL A;  3LDP A;  4E7I A;  5AQO A;  1QQO A;  1HQE A;  4FJX A;  4B1X B;  3CCQ N;  3U6F A;  4BG8 A;  3R1X A;  3A8Y A;  3D7E O;  1S9G A;  4KH6 A;  2UYT A;  1NWK A;  4CES A;  5HRN A;  4E7K A;  1UOC A;  3L8B A;  1LW0 A;  4JKD A;  2NRT A;  3HP9 A;  3O9Q A;  2NNW A;  3MXJ A;  3QFP A;  1LWE A;  4Y1C A;  3C6T A;  3D2F A;  4F8R A;  4ILG B;  3VA3 A;  2UXB K;  1J9A A;  4QS9 A;  4W5T A;  2IOC A;  5KPR A;  3KWG A;  1NM1 A;  3OYM A;  3MK6 A;  1TK8 A;  4BE2 A;  2GX9 A;  4KRE A;  1FKO A;  2KHO A;  2OTL N;  1GLA G;  3U3G A;  1NKC A;  1S22 A;  3CIP A;  1HJR A;  2P5G A;  3LDO A;  3O9S A;  3AVH A;  3RMD A;  5AQH A;  4LF6 K;  3QEP A;  1BCM A;  3M6G A;  4FK0 A;  1U4B A;  2YHW A;  4CIF A;  2HHU A;  4JS4 A;  4KH5 A;  3PO4 A;  3OYG A;  1FW6 A;  2V52 B;  2YNG A;  3NH0 A;  1SAZ A;  3EEQ A;  2OCE A;  2QEX N;  3BZK A;  3ZX3 A;  3B6P A;  3AAR A;  4QS7 A;  1FJG K;  3CI5 A;  2B4J A;  4BGB A;  4N47 A;  1C0M A;  2FSJ A;  3HOS A;  2EHG A;  3SMS A;  3E1Y A;  2Q1N A;  4NLC A;  1P90 A;  1SL2 A;  2AA4 A;  3MN7 A;  2P9K A;  4CEO A;  2PFU A;  4PWD A;  4LC9 B;  3EE8 A;  5LJV A;  1RTD A;  3G25 A;  4CJE A;  2YNI A;  3WNH A;  4IDH A;  3VQ7 A;  4BDZ A;  4JHD B;  1WBB A;  4B9T A;  2IDO A;  4WE1 A;  3F2K A;  1NK8 A;  4CJP A;  1VSK A;  1C6V A;  1TKD A;  2WFB A;  4CF9 A;  4F2R A;  3KKR A;  1NG9 A;  1YIT N;  1IKW A;  1JL1 A;  4DV7 K;  3CC7 N;  3CCM N;  3RTV A;  3RVC A;  4FWO A;  3GL1 A;  3VMF B;  2GUI A;  1L3T A;  1JXB A;  3DLL L;  5JVH L;  4GV9 A;  4AM6 A;  2DY4 A;  3VQA A;  2IAJ A;  1L5U A;  1CLQ A;  4TSX A;  1ASW A;  1VSL A;  3J7A P;  4K41 A;  2HND A;  1TYQ A;  3I0S A;  2Q2R A;  1VQ8 N;  2B6A A;  1HYS A;  3NDK A;  3K9J A;  4RWT A;  4CJW A;  4K0K K;  4JK9 A;  4DSL A;  3KLI A;  1C1C A;  4FJ7 A;  4HCB A;  4CZE A;  1KSP A;  1WAF A;  3DLB A;  3VEZ A;  2FXU A;  1J53 A;  3P31 A;  5C2F A;  5HOO A;  3SPZ A;  2NRH A;  1WSE A;  4CEB A;  4J8F A;  3VEW A;  5I42 A;  1NBW A;  5LY3 A;  1BO5 O;  4OGE A;  1T8E A;  1HKB A;  1S1U A;  3K2P A;  4IOC L;  5M1O A;  1EWR A;  3T1Y K;  5LMU K;  3ISN C;  2P9N A;  3SUP A;  1RT6 A;  2ZJR L;  3H3O B;  2Z1G A;  4OX9 K;  4JI8 K;  2IGI A;  1VSM A;  3QIO A;  3OYC A;  3EO3 A;  2P9P B;  1B9D A;  2UUB K;  3VQ9 A;  1JCE A;  1JXE A;  4F9O A;  4I6M B;  4K42 A;  4BRE A;  1DLO A;  2CH5 A;  1M1K O;  4JKE A;  1VSF A;  3ZLJ A;  3A5L C;  4FWS A;  5IT9 O;  3VQB A;  4LF4 K;  5T7B A;  5CYM A;  4C1N I;  4MLH A;  2NRX A;  1X9J A;  4BR9 A;  5HLF A;  2JWL A;  4J2E A;  4B3R K;  1XMQ K;  2CGJ A;  1RDA A;  1JCF A;  4RW9 A;  1T6C A;  4C1N K;  2EX3 A;  3NF8 A;  5BRE A;  3O80 A;  4FLU A;  5BPM A;  5KGX A;  3OHR A;  3SYZ A;  3M1F A;  4CED A;  4C8O A;  2UUA K;  5DM6 L;  2F9W A;  3B6O A;  4M41 A;  1Z6R A;  1SL0 A;  4FW1 A;  5JS1 A;  1IKY A;  3V9X A;  4WF9 L;  3MX2 A;  3QIC A;  4KAZ A;  2QK9 A;  1HNZ K;  4JKC A;  3KD1 E;  3HOT A;  4HWI A;  4AHS A;  3WXM B;  1VQK N;  1N33 K;  4FM0 A;  1NK9 A;  1V4T A;  3SAF A;  1TKX A;  4B3T K;  1A5W A;  1RT4 A;  2D0B A;  1CZ9 A;  3C6U A;  2YKN A;  4CHY A;  4YFU A;  3CFR A;  4DLG A;  2OTJ N;  2UU9 K;  1ZBI A;  3KIO A;  3H1V X;  3AGK A;  5EU7 A;  3A5M C;  4BRQ A;  4DS4 A;  5TKW A;  3VF6 A;  3TAM A;  3FFI A;  4MLE A;  1N36 K;  4AHT A;  1BQM A;  1ZBF A;  4KO0 A;  5HBM A;  3MX5 A;  3UKR B;  1U04 A;  3NH1 A;  1NKB A;  1GLB G;  3KHY A;  3QLH A;  3ZT2 A;  1U45 A;  3VPZ A;  3AVK A;  1WB9 A;  3IDH A;  4PL8 A;  5GAG P;  5M1Q A;  2PZS A;  3HSC A;  4GVM A;  2PYJ A;  1NMN A;  2HHS A;  4HTL A;  3MN9 A;  4KTQ A;  5C24 A;  3SV4 A;  3AVM A;  3SQ2 A;  3SBT A;  5E41 A;  2KTQ A;  4H8K A;  1EQY A;  3G71 N;  4UY8 O;  3Q7C A;  1BGX T;  1DTQ A;  4OVL A;  4IEI A;  5C15 A;  4NLB A;  4DFK A;  5I3U A;  4DTS A;  1HX1 A;  1XC3 A;  3QML A;  3LM9 A;  5ELZ A;  2IVO A;  4J2B A;  5EY4 A;  2HF3 A;  4Y1D A;  4DV1 K;  2Z1H A;  2YKM A;  3QIN A;  4PA1 A;  3L3U A;  1YVU A;  3FZH A;  4JD2 A;  4CE9 A;  4BE0 A;  1UA0 A;  4KB1 A;  2FBT A;  2PBD A;  2OZS A;  3CJ9 A;  3ZET B;  1GLE G;  2ZM6 K;  1DEJ A;  3SK3 A;  1KXP A;  3KKS A;  4BRL A;  3LDS A;  4FLW A;  4MDA A;  4DV5 K;  3ENO A;  1N8R O;  1BG3 A;  3CC4 N;  4IO9 L;  2NRZ A;  3CC2 N;  4IFE A;  3R8E A;  1VSE A;  1UAX A;  1BI4 B;  5SWM A;  3OW2 M;  1BU6 O;  4JI7 K;  3L0Q A;  4O5F A;  2ZGY A;  1DKG D;  2HMI A;  2E88 A;  4DR3 K;  3MN6 A;  4ISG A;  1RBU A;  1VQM N;  3TAB A;  2QWN A;  3HTV A;  1QVG M;  2IVN A;  3T3F A;  1Q86 O;  4K8Z A;  1KQS M;  4DQS A;  2HVI A;  2BH1 A;  3CJC A;  4PKG A;  1JLA A;  3PIO L;  3PIP L;  4BR4 A;  3ULD A;  3TU5 A;  5FRO A;  3UE5 A;  3D45 A;  4NB4 A;  3J81 O;  3MWT A;  4BRC A;  1L3V A;  1GOC A;  3LPU A;  3ATU A;  2Q0U A;  3QEX A;  3CPE A;  3DLH A;  2NLX A;  4O8K A;  3ENB A;  1Q9Y A;  3L4Q A;  2E5L K;  3PX6 A;  3CPW M;  3HPH A;  4OPJ A;  4IEE A;  4DU1 A;  1GLJ O;  1EP4 A;  3CM5 A;  1BIS A;  1ASV A;  4M45 A;  4DCH A;  3OYB A;  3ALY A; 
#chains in the Genus database with same CATH homology
 5AQP A;  5DM7 L;  5AQN A;  4H0V B;  1MDU B;  2ZF5 O;  1C0F A;  1YXQ A;  3VTI A;  1KD1 O;  5BN8 A;  2VYP A;  5LJW A;  3A5O C;  4GV6 A;  5C0Y A;  4CZI A;  3VGL A;  5TKY A;  4CZH A;  1VQ7 N;  3F5T A;  3QBW A;  2HMP A;  4JAX A;  4QS8 A;  3R3L A;  1XUP O;  3I56 N;  3AAQ A;  4WQ5 C;  3MCA B;  2VWB A;  3FZF A;  3O6W A;  3CME N;  2OAN A;  2E2N A;  4H0T B;  3A0I X;  4H5T A;  3U4L A;  4A5B A;  1BA0 A;  1VQ6 N;  2HF4 A;  2NRR A;  5AQS A;  2GTD A;  1VQO N;  2YX6 A;  5E26 A;  1MA9 B;  1YAG A;  2JWK A;  1Y64 A;  4A62 A;  3GBT A;  1HKC A;  3CJ7 A;  1NGE A;  3T69 A;  4FSV A;  2CH6 A;  3KWI A;  3S41 A;  4JEP A;  4XEI A;  3WXK A;  5GIP A;  3DXM B;  2QWM A;  2A3Z A;  5GIO A;  1KAY A;  3FE1 A;  3P39 A;  2D1K A;  4B1Z A;  1U2V B;  3ULE A;  3LDP A;  4CD1 A;  5AQO A;  1QQO A;  4FVU A;  5JLH A;  4B1X B;  3CCQ N;  4CZG A;  4BG8 A;  3H1Q A;  4AM7 A;  1E4G T;  4BVO A;  1JJ2 M;  4K25 A;  3R1X A;  3A8Y A;  3D7E O;  3P4I A;  4KBO A;  3FGU A;  4KH6 A;  2ZWH A;  2UYT A;  5GAH P;  1NWK A;  4YOT A;  1D4X A;  5AQT A;  2ZJP L;  1YHQ N;  3I8B A;  4ILH A;  1YUW A;  3WXI A;  4JKD A;  2NRT A;  3E9O A;  3A5N C;  3O9Q A;  2NNW A;  1VAZ A;  3CER A;  4H03 B;  3BP8 A;  4H5V A;  3RSE B;  3VEO A;  1Z05 A;  1BOT O;  2PAV A;  4E1J A;  2ZJQ L;  3QFP A;  3ZEU B;  1WOQ A;  2F7T A;  3HBT A;  3C0B A;  4JK7 A;  3D2F A;  4K43 A;  3CCL N;  1S3X A;  4ILG B;  1T6D A;  2NRV A;  3C7N B;  3O4W A;  4QS9 A;  5BRH A;  5KPR A;  4JD2 B;  3NVK A;  3VOV A;  3KWG A;  1NM1 A;  2QWL A;  4JKG B;  3MK6 A;  5AZJ B;  2GEM A;  4BRK A;  2P9U B;  4BQL A;  2FSK A;  1QVG M;  2W41 A;  2YHY A;  3JXU A;  4JKB A;  1GLF O;  1QZ5 A;  1ZXO A;  2GX9 A;  2KHO A;  3F9M A;  3QDK A;  4WYB A;  1GLA G;  2OTL N;  3CMA N;  2YJF A;  1S22 A;  2P9P A;  3MN5 A;  4MDB A;  3CIP A;  1ILY A;  2QXL A;  5AQF A;  2RHK A;  1ZC6 A;  4A57 A;  3LDO A;  3O9S A;  1GLD G;  3WXJ A;  4CBU A;  1HUX A;  4I6M A;  2HOE A;  1NGB A;  5AQH A;  4RTF D;  4FWN A;  3KVG A;  3M6G A;  3T7Z A;  2E20 A;  1RDU A;  2YHW A;  4XH5 A;  3BF3 A;  3GE1 A;  4NO7 A;  1M90 O;  5AZI A;  3UKU A;  4CZJ A;  4KH5 A;  4BRO A;  4IJN A;  2ZGZ A;  4GNI A;  2D0O A;  3DXK B;  2V52 B;  1SAZ A;  4DHY A;  1MWK A;  2QM1 A;  1WUA A;  2QEX N;  4M7Y A;  2HST A;  4FWQ A;  1X3N A;  4KH4 A;  2QWP A;  3ZX3 A;  1K8K B;  2QI2 A;  5EXW A;  4BRM A;  4FOE A;  3J7Z O;  4A61 A;  3AAR A;  4QS7 A;  4OPH A;  3CI5 A;  3ZX0 A;  4M7X A;  5MLC Q;  4WQ5 A;  4BGB A;  3NVM A;  2FSJ A;  3HOS A;  3SMP A;  3SMS A;  3E1Y A;  2Q1N A;  4NLC A;  1P90 A;  3WUH A;  5H1S Q;  1P8Z A;  4BRD A;  2AA4 A;  5GIN A;  3MN7 A;  2D0P A;  2P9K A;  3O9T A;  4A2A A;  3IKM A;  1YVN A;  1BDG A;  3N4P A;  4JK8 A;  2PFU A;  4LC9 B;  3EE8 A;  3WT0 A;  5LJV A;  4AF1 A;  3G25 A;  1QZ6 A;  3CJ1 A;  4A5A A;  3D2E B;  3OA9 A;  4H0X B;  2F9T A;  4IDH A;  4CJ7 A;  4ISE A;  2BTF A;  4JHD B;  3H45 C;  3LDL A;  5AQY A;  1LOT B;  2A40 A;  1HLU A;  2HBM A;  2VGN A;  3FZL A;  4BY9 C;  3F2K A;  3VEY A;  3D6R A;  4IOX A;  5EVZ A;  5GAE P;  1Q7Y O;  2GEL A;  2WFB A;  3LL3 A;  4ISF A;  4IWV A;  3G4S N;  3VET A;  3GDQ A;  3CXC M;  1YIT N;  3U8X A;  5AQQ A;  3DJC A;  3M3Z A;  5F0X A;  1OVY A;  1CZA N;  3TTD A;  3CC7 N;  3TSQ A;  1TUU A;  1ATS A;  3CCM N;  4FPA A;  4CBX A;  3ZYY X;  3RVC A;  4U7B A;  1YJW N;  1K9M O;  4FWO A;  1NMD A;  2WBN A;  2ASO A;  4ILJ A;  3GL1 A;  3LDN A;  4BRI A;  2E8A A;  2RE2 A;  3VMF B;  5JLF A;  3DLL L;  1O13 A;  5JVH L;  3NMU A;  4GV9 A;  4AM6 A;  3FLC O;  2HBL A;  5ADX H;  4DQ8 A;  5AFU A;  3SLC A;  3MCP A;  3EKS A;  3Q7B A;  3EE9 A;  2P9L A;  3VGM A;  4DKW A;  3UKR A;  4BRF A;  3WEE A;  4K41 A;  1KC8 O;  3TPQ A;  2E2O A;  3E9P A;  1TYQ A;  4BC5 A;  4PKH A;  3L6Q A;  2Q2R A;  3DWL A;  1VQ8 N;  4WCE L;  5JVG L;  4BG9 A;  3R9P A;  4G9Z A;  5BPN A;  1J6Z A;  3K9J A;  3ULE B;  4RWT A;  1MWM A;  1ZBS A;  5ADX A;  4A2B A;  4B1W B;  2QA4 N;  3BUZ B;  3WQT A;  4JK9 A;  1HJO A;  2E1Z A;  5M1P A;  3AY9 A;  2IIR A;  4CZE A;  3KK7 A;  3VEZ A;  2FXU A;  1BUP A;  3O9R A;  4H0P A;  4IXC A;  3P31 A;  3BEX A;  3EL2 A;  4WFN L;  5C2F A;  5HOO A;  2NRH A;  5FPE A;  3ENH A;  4WFB L;  4BQZ A;  1SS6 A;  1S72 N;  4J8F A;  5M1F A;  3TSP A;  3VEW A;  1NBW A;  2A42 A;  4WQ4 C;  5LY3 A;  1BO5 O;  5KQD A;  1KAZ A;  4BC2 A;  2AP1 A;  1HKB A;  2J4R A;  4YOV A;  2GUP A;  4CBW A;  3W3D A;  3D2F B;  4IOC L;  5M1O A;  4JKF A;  3IFR A;  2Q31 A;  4H5N A;  5AQU A;  2YHX A;  3I33 A;  4PKI A;  2ASM A;  2P9N A;  4BRA A;  1HKG A;  3CCU N;  1ATN A;  1NGC A;  2ZJR L;  3H3O B;  4EHU A;  1DGK N;  4CD3 A;  3B8A X;  3EKU A;  3MMV A;  5AR0 A;  5I9E B;  3CCJ N;  3EO3 A;  1YIJ N;  1H1V A;  1X3M A;  4BRN A;  3QB0 A;  2P9P B;  1QVF M;  1YF5 L;  5AQG A;  3E9L A;  1JCE A;  1VQN N;  5AQK A;  3ZET A;  3FFK B;  4U67 L;  4F9O A;  4I6M B;  4K42 A;  3VES A;  4BRE A;  3I55 N;  2CH5 A;  4DB3 A;  1M1K O;  2FF6 A;  4JKE A;  3FR0 A;  4BR5 A;  1E4F T;  1NGD A;  1EO1 A;  3A5L C;  4FWS A;  1SQK A;  4YOW A;  5AZI B;  3UKU B;  3O9U A;  3KZB A;  4C1N I;  3IUC A;  4MLH A;  2NRX A;  1X9J A;  4BR9 A;  2I7N A;  1XQS C;  3CF5 L;  2JWL A;  4CZL A;  3AGR A;  3SAG A;  2QW9 A;  2CGJ A;  2P9I A;  2W40 A;  5C10 A;  1GLL O;  4BRH A;  3O1B A;  4B1V A;  2Q0R A;  1OKJ A;  4MO5 A;  1JCF A;  3C6H A;  1T6C A;  4C1N K;  3ZX2 A;  2V7Y A;  4FOI A;  2I7P A;  4R79 A;  5AQM A;  2A41 A;  4CZF A;  4H0O A;  4CI6 A;  1DT9 A;  1IJJ A;  3M5R A;  5BRE A;  5BRF A;  1VQ4 N;  1T44 A;  3O80 A;  1VQ5 N;  1NGG A;  4YOX A;  4CZM A;  5BPM A;  3CCS N;  3OHR A;  3CCV N;  2WC9 A;  3M1F A;  3QFU A;  2NZT A;  2E1Y A;  5BPL A;  2P9K B;  1SZ2 A;  5DM6 L;  2F9W A;  3SBG A;  4FWL A;  1Z6R A;  3EZW A;  3FZK A;  3HI0 A;  4WF9 L;  4B1Y B;  3MX2 A;  3QIC A;  1R59 O;  4XH1 A;  4Y0W A;  3TSU A;  4EIA A;  4JKC A;  5AQJ A;  4BRP A;  3R6M A;  3HOT A;  2V51 B;  5FPM A;  5AFU H;  2WUS A;  4HWI A;  1NGA A;  5AQX A;  2DPN A;  1ESV A;  3VER A;  3WXM B;  1VQK N;  2KLA A;  3GOI A;  1RGI A;  4IO8 A;  3O08 A;  2P9S A;  1IG8 A;  3CQY A;  2CGK A;  3H3N O;  3VF4 A;  1V4T A;  3SAF A;  2V7Z A;  2VGM A;  3U9Z A;  3W0L A;  4M63 C;  5FPD A;  4WQ4 A;  4IZ9 A;  2OTJ N;  4FWP A;  3H1V X;  3AGK A;  3CET A;  3H6E A;  4BRQ A;  3A5M C;  5TKW A;  3VF6 A;  5HL7 L;  4EHT A;  4MLE A;  3CJB A;  2FF3 B;  1NGI A;  2EWS A;  4A59 A;  2P9L B;  4GV3 A;  2QWO A;  3MX5 A;  3UKR B;  1GLC G;  1GLB G;  3C6A A;  3KHY A;  5CE3 A;  1W2B M;  3ID6 A;  4YOU A;  3WEE B;  1NJI O;  4B1U B;  1ATR A;  3VPZ A;  1TYQ B;  4JNE A;  4BR2 A;  4BC4 A;  4XH4 A;  5B8H A;  5EX5 A;  3IDH A;  2Q36 A;  2KKZ A;  4PL8 A;  5GAG P;  5M1Q A;  4B9Q A;  3HSC A;  3CHW A;  5JMV A;  3DXM A;  4O8U A;  4YDU C;  4PHT X;  4FWM A;  4HTL A;  1Q81 O;  4MO4 A;  3MN9 A;  2CGL A;  4RCH A;  4BRG A;  1U2V A;  2E2Q A;  4JKA A;  3CD6 N;  1QQM A;  3JS6 A;  4H5W A;  3SBT A;  1EQY A;  3G71 N;  1VQL N;  3Q7C A;  4UY8 O;  2ASP A;  4IEI A;  3HM8 A;  5C15 A;  5BN9 A;  4NLB A;  4YOY A;  5E84 A;  5JIC A;  4PL7 A;  4BC3 A;  1HX1 A;  3DAW A;  1Q18 A;  1XC3 A;  4JN4 A;  2FSN A;  3QML A;  3IMX A;  4OPA A;  3LM9 A;  1VQ9 N;  1KAX A;  5ELZ A;  2IVO A;  1RDW X;  5EY4 A;  3RSE A;  3VEV A;  2YJE A;  3ATV A;  3ZEU A;  1RFQ A;  2HF3 A;  5C12 A;  5FPN A;  5GAD P;  2P9N B;  3C65 A;  3P38 A;  3C7N A;  5KQ8 A;  2E2P A;  1VQP N;  5AQR A;  2ITM A;  3FZH A;  3ID8 A;  4JD2 A;  3QBX A;  4IJA A;  4JKG A;  5AZJ A;  3FZM A;  3O1W A;  2P9U A;  4BR7 A;  1K73 O;  5KPZ A;  1LCU A;  2IVP A;  5AQL A;  2PBD A;  4GY2 B;  3CJ9 A;  1NLV A;  1GLE G;  5AQW A;  1DEJ A;  3SK3 A;  1KXP A;  3ZET B;  4BRL A;  4FWR A;  3OBW A;  5EOY A;  5AQZ A;  4MDA A;  3TTC A;  3ENO A;  1N8R O;  2D4W A;  2A5X A;  1T3V A;  2QWQ A;  1BG3 A;  3WXL A;  3CC4 N;  4IO9 L;  2NRZ A;  3WQU A;  1YJ9 N;  3LDQ A;  3K9K A;  3SJH A;  3CC2 N;  3L4I A;  4IFE A;  1W97 L;  1C0G A;  3R8E A;  4FWK A;  2H3G X;  4BVP A;  3OW2 M;  1BU6 O;  1G99 A;  1NGH A;  3L0Q A;  4O5F A;  2P9I B;  1U6Z A;  1NGJ A;  1DKG D;  2FLO A;  2ZGY A;  3DXK A;  3E66 A;  1YJN N;  2E88 A;  3GG4 A;  3MN6 A;  4ISG A;  4FL9 A;  3U9D A;  3LM2 A;  1QQN A;  3MWP A;  1VQM N;  4L3Q A;  3UB5 A;  2VCP A;  2QWN A;  3AAP A;  3HTV A;  3N4Q A;  1NGF A;  4YOR A;  3VTH A;  2IVN A;  2YCH A;  1K8K A;  4C23 A;  5KPT A;  3G6E N;  2Q97 A;  1Q86 O;  3CQX A;  1KQS M;  2BH1 A;  3CJC A;  4PKG A;  3OBY A;  4EAH D;  3HRG A;  2QTD A;  3O5B A;  1V4S A;  1QHA A;  4CZK A;  3VGK A;  3PIO L;  1Q82 O;  5M1K A;  2BUP A;  3PIP L;  4BR4 A;  4EFH A;  3EN9 A;  3MDQ A;  1BWF O;  2GWJ A;  3CJA A;  5M1N A;  2A6A A;  5AQI A;  3TU5 A;  3UE5 A;  2GWK A;  4NB4 A;  3VEX A;  3VF2 A;  4WFA L;  3J8A A;  3MWT A;  4BRC A;  5F2R A;  4Z94 A;  2HBJ A;  3BF1 A;  4BR0 A;  4OO1 J;  1JCG A;  3ATU A;  1TUY A;  2Q0U A;  4YDU A;  5CR4 A;  2YI1 A;  3CCR N;  3CPE A;  3D2E A;  5F1X A;  2NLX A;  3O8M A;  4GVE A;  4O8K A;  4JHD A;  3ENB A;  1YI2 N;  2HBK A;  3PLA A;  3H46 O;  3HZ6 A;  3L4Q A;  4FPB A;  1K8A O;  5CHI A;  4FO0 A;  3CPW M;  4IOA L;  1HPM A;  4H0Y B;  4H5R A;  4JKH A;  2NRW A;  2P9S B;  4IEE A;  1GLJ O;  5BR9 A;  5BRD A;  3VEN A;  5AQV A;  4BGA A;  5C2D A;  4DCH A;  2QWR A;  1BA1 A;  3TTF A;  3SAH A;  3CCE N; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...