5JVHL

The crystal structure large ribosomal subunit (50s) of deinococcus radiodurans in complex with evernimicin
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
104
structure length
104
Chain Sequence
RRKLRTRRKVRTTTAASGRLRLSVYRSSKHIYAQIIDDSRGQTLAAASSAALKSGNKTDTAAAVGKALAAAAAEKGIKQVVFDRGSYKYHGRVKALADAAREGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal RNA
publication title Avilamycin and evernimicin induce structural changes in rProteins uL16 and CTC that enhance the inhibition of A-site tRNA binding.
pubmed doi rcsb
total genus 17
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2016-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00861 Ribosomal_L18p Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.100 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 5jvhL01
4U67L 3G4SN 3CC2N 3CCEN 1Q7YO 5JVHL 1VQMN 3I55N 4UY8O 1YJWN 1N8RO 3CF5L 3CC7N 3CXCM 1KC8O 1OVYA 1QVFM 5GAHP 3CC4N 3DLLL 1QVGM 1Q82O 1YHQN 3PIOL 3CCJN 4WFAL 3CMEN 4IOAL 3I56N 2ZJRL 3CCVN 1ILYA 1VQNN 1VQ5N 4WF9L 1VQ7N 2QEXN 1VQON 4IO9L 1K9MO 3CCSN 1YJ9N 3CCLN 4WCEL 1S72N 5MLCQ 3CPWM 1KQSM 1YIJN 4IOCL 1M1KO 1K8AO 1VQ6N 5GADP 2OTJN 1NJIO 3CCUN 1VQKN 1VQ8N 1VQLN 1YI2N 3J7ZO 1Q81O 1Q86O 5DM7L 2ZJQL 3CCMN 1VQ9N 2OTLN 1M90O 3OW2M 1YJNN 3CCRN 1VQPN 1JJ2M 3CCQN 5H1SQ 5GAGP 3G6EN 5JVGL 3CD6N 2QA4N 3PIPL 1KD1O 5DM6L 5GAEP 1VQ4N 3CMAN 2ZJPL 1W2BM 5HL7L 4WFBL 1YITN 1K73O 4WFNL 3G71N
chains in the Genus database with same CATH superfamily
1WSGA 3RMBA 1X1PA 4KHUA 3OYMA 1IKVA 1N32K 4DUZK 3MN6A 4DV0K 3BGRA 3EY1A 4FJIA 3P38A 3OBWA 3WT0A 3UKUA 1KCFA 2W6KA 3LWLA 3VEVA 4A59A 3E9LA 1X9SA 3AA3A 4B3SK 3AA2A 4RG8A 3MX2A 3TARA 4DUYK 2NZTA 5JICA 3SPYA 3V9ZA 1LW0A 5AQGA 3ZETB 2P5GA 1KVAA 3FZMA 4JKAA 4KH5A 4AM6A 3CJBA 4CHYA 1IG8A 4FJ7A 4BG8A 3QICA 4JN4A 4CJ5A 3RSEB 2F8TA 4YOTA 1TKZA 5CYMA 1GLBG 4BDYA 5E84A 3THXA 2WTUA 3ZT1A 5LY3A 3R3LA 4FLVA 4CK2A 3CCSN 3CHWA 2YJEA 4WCEL 3EKUA 4E0DA 1VSLA 4CZEA 3PLAA 1UAXA 3DOLA 3KHYA 4NYNA 4M7YA 4DSLA 2NRHA 4R5PA 3ID6A 4KTQA 3WXLA 3EYZA 1CLQA 1BISA 4CVNE 5AQFA 1FKPA 2BGGA 2OA8A 4ZTFA 1BHLA 3VTIA 1T03A 4BRMA 3MAQA 2E2PA 5KPRA 1TV6A 1TAQA 3IS9A 3DAWA 2O4GA 3Q7BA 3GDQA 1BGXT 3OS0A 3CCQN 5AZJB 3FE1A 4FLXA 1MU2A 2WONA 1R0AA 2KZZA 4E7KA 4BREA 5JLFA 1A5XA 2IAJA 2QTDA 2W42A 2GUIA 1CZAN 2HMPA 4YDUC 3AVFA 2P9LA 3ZSXA 1NK0A 3G71N 4GVMA 1RT4A 1WAFA 2DTUA 4B3MK 4F4KA 2A3ZA 3SMSA 4JS4A 1XC9A 4CGDA 2HHUA 4V19S 3O9SA 3HOTA 4L8RB 2B4JA 3VGLA 3HXMA 4DTOA 4GNIA 4I9QA 1JXEA 3WXMB 3J81O 3QEIA 1QSLA 4YOXA 1C1CA 3OYKA 3CMEN 1JL1A 3OYCA 1HR0K 2CGLA 4MLEA 3THYB 2KFZA 1GLFO 1Z25A 4CZHA 3KK7A 4DR7K 4FJJA 3CJ1A 3SK3A 3HL8A 2HVHA 4FPAA 5HRNA 3RRHA 3BDPA 3KD1E 1JLGA 2KW4A 3W3DA 3KJVA 2NUBA 4FJNA 1QHTA 4JNEA 4B9LA 4KPYA 2HHSA 4JEPA 1NJZA 5IT9O 3H08A 4KB1A 3WUHA 4OO1J 4FWRA 2HBJA 4CJ7A 4DQQA 2VYPA 2Y1JA 1ITGA 3L4IA 3AO4A 3O9QA 4LH5A 4YHHK 3KD5E 1UWBA 3V9XA 4DR3K 5C2FA 3M1FA 1TL3A 2OYQA 3QBXA 5AQSA 3AA4A 3BUZB 4E1NA 3QMLA 2Q3SA 5HRPA 3RVCA 4DSKA 4OVLA 1SZ2A 4JI6K 4DTXA 3H1VX 3GBTA 4EP4A 3MN9A 4F8RA 4XEIA 4DKWA 1SL0A 1B92A 1U2VB 3SQ1A 1V4SA 4AHTA 4QS7A 1BDGA 2VWJA 3I0RA 1UOCA 3O4WA 1Z05A 1YITN 3KWGA 4RW9A 4AHUA 5ADXA 2P9KA 1C0TA 3AV9A 4CGJA 3SMPA 1XMOK 3SAFA 4HUGA 1DT9A 1S5JA 2YNGA 2WOMA 3IUCA 1KTQA 3I55N 2DFEA 3T69A 5AZJA 1EETA 4UY8O 1RDWX 4JKDA 4JK7A 4CJRA 1KC8O 1HNZK 3MECA 2P9SB 4RWTA 1CXUA 3VQPA 5M1QA 5AQZA 3QEWA 2DY4A 4DTMA 4BRKA 3UB5A 4FCYA 1JLBA 4XH5A 1J54A 3TPQA 4JS5A 1ZBHA 2GUPA 1S9GA 2E6LA 3OYGA 3ZT2A 3OY9A 1Q9YA 3QIOA 5F1XA 1D4XA 4DHYA 4LD0A 4DTSA 2I5JA 3KLGA 3B6PA 2VWBA 2E8AA 3SJJA 5HRRA 1NK8A 1J53A 4BC2A 3MMVA 2V51B 3I0SA 3S3MA 3G25A 4IOCL 3THYA 3HSCA 2BUPA 1EQYA 4H0TB 2VQFK 1NGDA 4JKCA 3CCUN 4HUEA 1IG9A 4BE2A 4JD2B 4KREA 1Z26A 1NKBA 5DM7L 3L0QA 1NU0A 3H3OB 1VQPN 3H6EA 1YVUA 2HSTA 2G8UA 4BRGA 1NK9A 4NYFA 4Z94A 4C1NI 3CD6N 5GIOA 1QHAA 1I3AA 1HJOA 2I7PA 4JI8K 5JS2A 4KTZA 2FSKA 4KHPK 1V4TA 3DXKA 1RBVA 2KQ2A 3M8PA 3AVGA 1GLEG 1S3XA 3E1YA 1BQNA 5AZIA 4KH6A 5HBMA 2FSJA 1FJGK 1HUXA 4CI6A 3MX5A 1KXPA 4A62A 1YUWA 4DLGA 4KV8A 1OVYA 4CZLA 4FXDA 4C8MA 3ZSZA 3HRGA 4ISGA 1QZ5A 3PSIA 5BREA 1BQMA 4F2SA 1IKXA 4OPHA 3SUQA 4GV9A 5TKYA 4JLHA 4PHTX 2P1JA 3NMUA 3DYAA 2HHXA 2O8FA 3E66A 5HOOA 3DLEA 3V1QA 3QNOA 1TL1A 4DFPA 4H0YB 2EWSA 4YOVA 3TWHA 3VF4A 1NGAA 3CJ7A 4NO7A 3O1WA 3E01A 2HOEA 1NOYA 5SWMA 3O4NA 3SQ0A 3HO1A 1C0UA 3EL2A 3P31A 4FOIA 3OYNA 1DTTA 1RBRA 2EX3A 2F9WA 1J5OA 1BI4B 4BVOA 3UKRB 2HNZA 4AH9A 3L6QA 2G8IA 3NHGA 5I9EB 4IDKA 3OYJA 2GEMA 3ULEB 3RRGA 3THWA 2FLOA 1WNSA 3D2FB 3M3ZA 4IFYA 3K5OA 1K8AO 5M1KA 4EZ9A 1HYSA 1N33K 5J1EA 4ZHRA 3P4IA 1BU6O 3LANA 4FJKA 2JWLA 2FF6A 4B1UB 3LDSA 2A41A 4MO5A 2GELA 3T3FA 3OW2M 4E7JA 4AM7A 4RW7A 2XO7A 4MLHA 3AAQA 2XHBA 4BR0A 1NGJA 3ZX3A 4H4MA 1S1UA 1N34K 3PO4A 4CJVA 5FRMA 4CFDA 5FDLA 3LDNA 5DK5A 1XC3A 3HPHA 1LAVA 4QOZB 3ZEUB 4WQ4A 4X66K 2F96A 4PY5A 4QCLA 1Y64A 1TVRA 4KHWA 5JVHL 3ZSVA 3D2EA 4DR2K 3NDKA 3QDKA 1IKWA 1Q8IA 5BN9A 2QWOA 3C0BA 1BIZA 1LWEA 1QVFM 4IO8A 5GAHP 2YNFA 4H0PA 3QEXA 1YHQN 5K14A 4IJAA 3IAYA 4CZIA 1VSHA 1BA0A 3I56N 2HF3A 1VQNN 2FXUA 1S1VA 5AFUH 4AILC 3AVKA 1D9FA 3DRRA 1K8KB 2QWLA 4H4OA 2XY5A 4KHSA 3EKSA 3O6WA 5FLXO 3HVRA 1KAZA 5LMNK 4OLAA 4LF6K 3FFIA 1RT5A 5C0YA 1Z6RA 4BE0A 4JI1K 1BL3A 2P5OA 3B8AX 4F3OA 4B9UA 4J2EA 1RILA 1RT1A 4CF2A 2YNHA 3DRPA 2HBKA 5AQHA 2ZWHA 1NJYA 3S41A 4DV3K 4M3TA 3NVMA 5BPMA 2Z1IA 3LDLA 4YOUA 4KFBA 2QWNA 4FM0A 3RTVA 2IVPA 1RDCA 2O8BB 1U04A 3P1GA 5KPTA 4FZZA 5LJVA 4KI6A 2GX9A 1RFQA 3I8DA 1BI4A 4CFBA 3U9ZA 4DB3A 3A5MC 3I33A 4JI7K 4CHPA 4LFCK 1TYQB 2ATQA 2QKKA 5AR0A 3T7ZA 3AO3A 1JJ2M 3ULEA 1RDAA 4RW8A 5GAGP 3V1RA 4BRFA 3WQUA 2Z1HA 1YAGA 3ISNC 3TAMA 1KD1O 3D2FA 3MXJA 4A5AA 4FJHA 4EIAA 3KKSA 4RCHA 2P51A 5CZ1A 3NCIA 5HLFA 3OYEA 3PO5A 3AVHA 4WFNL 3QO9A 1EKEA 4I2QA 3HYFA 3CC2N 2ZGZA 3CCEN 3IG1A 4DQIA 2WBNA 2E2QA 4H0OA 1REVA 3TR8A 1YJWN 4IBNA 5D3GA 3VQ7A 1VHXA 4W5RA 2R7YA 4M3XA 3DLLL 1QVGM 1DLOA 1VSIA 3LZJA 1JLAA 4FVMA 4DV4K 2ITGA 1S1WA 3MDQA 2O8EB 4EFHA 3TU5A 3ZEUA 1NLVA 3L2QA 4KH4A 4W5OA 3QEVA 4OPKA 3OVNA 3P39A 4JAXA 3ATVA 4R79A 1QQNA 2VGMA 1YTAA 2NRTA 3VEYA 1SAZA 3AVCA 3LP3A 4YORA 1VSEA 4CZFA 4PL8A 3T1AA 1EWRA 3DXMB 1OVQA 1B9FA 3AA5X 4CIFA 3CCLN 4H0XB 5LJWA 1C0GA 4I6MB 4BR5A 1NGHA 4JI5K 1ZBSA 4PKHA 3NGZA 3ENOA 1YIJN 1OH5A 4Z4HA 4BC5A 2D0AA 4DLEA 1K8KA 2A42A 1IKYA 5KGXA 4M3ZA 3K59A 2IVOA 3FZHA 4KAZA 4CZGA 4CE9A 3A5OC 5KTQA 4KHQA 4NXMK 2HB5A 3MEEA 3C6TA 4GY2B 1M90O 1VQ9N 1ASUA 3FZLA 1XQSC 2FC0A 4JI4K 3VN5A 3CCRN 5F2RA 3HM9A 3NVKA 5H1SQ 2PBDA 3S3OA 1ZBUA 3DI6A 4H5RA 1VAZA 2A6AA 2O8DB 1L3SA 2UUAK 3L2WA 4LSLA 1SKWA 4PQUA 3AO5A 4B9VA 4BC3A 2YV0X 3FLCO 3H45C 3R9PA 2D5RA 4LF7K 1KLMA 1NK5A 3LL3A 1QSYA 1GLCG 3CG7A 3G4SN 3ZSQA 1TYQA 5BPLA 5TKWA 3PSFA 3P5JA 4AF1A 4YFUA 4OKJA 2E20A 4Z0UA 1LW2A 4B1YB 1X3MA 3ZCMA 2KKZA 4BR4A 4DQSA 3DOKA 2Z1JA 4E7IA 3FGUA 4CEDA 3RMDA 4PUOA 4BQLA 4CZJA 1L3TA 4QAGA 1HKGA 2PZSA 5AQMA 2OZSA 3SUPA 2ITMA 4F3TA 1NOZA 3OYIA 2YHYA 4LH4A 2QK9A 1X9WA 4IFEA 3L2VA 1VQ7N 3LDQA 4W5QA 3VOVA 3DLHA 2G8KA 3HM8A 4AHCA 3CM5A 4CHQA 1ASVA 2BTFA 1KFSA 5AQWA 1NK7A 4CJ3A 4BR9A 4CJUA 2E6MA 1XNQK 1ZXOA 4M41A 1WBBA 2EHGA 2WFBA 5C24A 1Y97A 3TAQA 4E1JA 4O0JA 1HPZA 5KPZA 5LMUK 3KTQA 4TSXA 3O9TA 1WB9A 1BIUA 2E1ZA 4CFAA 4M42A 3VGKA 2RKIA 5AQRA 3K5NA 1TK8A 4HTUA 4K43A 4KB0A 2E4LA 4C1NK 3F73A 4NLCA 3ZSWA 3KLIA 3ZETA 3QINA 4DU1A 3TTCA 2LSNA 4DR1K 5AQQA 3RSEA 3CIPA 3AVNA 4DSFA 5AQIA 3LWMA 2XY7A 2VG7A 1BO5O 3MN5A 4CIEA 4GVEA 1KRPA 3OYHA 3MCPA 4HWIA 2IC3A 4W5TA 1I39A 4CZKA 3TANA 1JLCA 2AP1A 1VQMN 4WQ4C 3GOIA 4NB4A 4CK1A 3HT3A 4RW4A 2IOCA 2NNWA 3CC7N 2OANA 1JLEA 4N47A 2P9NB 2VWKA 1OH7A 4JKGB 1RTDA 4Z4EA 3CI5A 5M1FA 4FWOA 3FZKA 5AJ3K 3VQ4A 4GV3A 3NF6A 4DU4A 3VTHA 4WQ5A 4IOAL 4ILJA 3OYAA 3AGRA 3QB0A 1C1AA 2P9PB 4H03B 3C65A 4LFBK 3K9KA 4K41A 5T7BA 2ASMA 5GIPA 3NH2A 1QSSA 1BOTO 3AO2A 4DF4A 3KWIA 3O3FA 4DSJA 2G8VA 2E5LK 4BRLA 3PY8A 3SNNA 3NFAA 4RTFD 1XI1A 1FXXA 4CJEA 1S72N 5EOYA 3A8YA 4DR5K 1HKBA 2BDPA 2OPQA 4LY7A 4CJPA 4Z4IA 4H5VA 4BROA 1HRHA 1FKOA 5F0XA 3W0LA 3QESA 2UUCK 1C0MA 1SQKA 2VG6A 4DS4A 3HI0A 4FJ9A 4AQYK 5JS1A 3SAGA 2OPPA 2PFUA 1TAUA 4IG3A 2HBLA 5M1OA 4JRQA 3O9UA 1TK5A 1YI2N 3J7ZO 4CBUA 3NF8A 1EO1A 3MEDA 4M7XA 5FPMA 4LF4K 3O08A 4HVJA 1JLFA 3G6EN 4G1QA 2O8CB 2OPRA 3WXIA 4YNQA 4RW6A 4DV2K 4LF5K 1NG9A 3JYTA 4CEZA 3NAEA 1OKJA 4MDAA 3SI6A 4Z4GA 1F21A 2D0PA 3L2RA 5FRNA 1HQUA 1LWCA 3DM2A 3PX6A 1W2BM 3HZ6A 3VEXA 3HBTA 3JAMO 3D45A 4A57A 2DFHA 1W0HA 1U49A 3F9MA 4O0IA 3LP1A 1VRUA 2HNDA 1I94K 3AAPA 1WBDA 3VEZA 2ZM6K 1Q7YO 2QWPA 2F9TA 2G8FA 1QZ6A 4KHYA 4DQPA 3JSMA 1WSFA 4CEAA 4FLZA 1QQCA 1T8EA 2G8WA 1LWFA 3N4QA 1EWQA 1KLNA 1ESVA 4CJSA 4C8NA 3V6DA 1HYVA 1JCFA 2PAVA 4F2RA 1WUAA 3VQ8A 2YHWA 3OYBA 3SBGA 4CEOA 1IJJA 3OYLA 3TTFA 1ATRA 3ZX2A 5IWAK 4GV6A 4KRFA 2GBZA 3IFRA 2ZQBA 5KQ8A 2HW3A 1U2VA 2WUSA 3OJUA 4JKGA 3KK2A 5KRTA 3DJCA 1YJ9N 3Q7CA 5MLCQ 3CPWM 1KVBA 4H5NA 4HCCA 3SBTA 3VEWA 4CHNA 4CEEA 2CGJA 3LDOA 2P9PA 3GG4A 4IDHA 4HHTA 4JKBA 3OS2A 3QIPA 4OKEA 3C6AA 4JI2K 3OS1A 3VETA 3WEEB 1TKTA 1VQKN 1NGCA 1T6CA 1X9MA 3SCXA 2P9SA 1VK0A 2F8SA 2KLAA 3DLBA 3QLHA 2BANA 1CZ9A 1NGIA 5AQJA 2F4VK 2Q97A 2FBTA 3SQ2A 4EHTA 4FYDA 3WXJA 2XY6A 1GOAA 4G9ZA 1W97L 4JV5K 4DQ8A 3RWUA 1XWLA 4BRNA 4FK2A 4WFBL 3HP9A 1ASWA 2D1KA 4E7LA 4CZMA 3TABA 4JHDB 2OPSA 1XMQK 3EO3A 1VSDA 2V7YA 4DR4K 4IEIA 2O4IA 2DFFA 4GKKK 3KIOA 2UXDK 3F5TA 3OJSA 2VQEK 1N8RO 4DTUA 1D9DA 4FLYA 4ELUA 3VQCA 3IRXA 2JGUA 1E4FT 3IDHA 2OZMA 3L4QA 5AQNA 2A40A 3MEGA 3MXIA 4CF1A 1GLAG 3HJFA 4H0VB 4JD2A 1GOCA 1RDDA 4KTWA 2A1RA 5J2QA 2YHBA 4LC9B 2ZE2A 2VG5A 3CCVN 4O8KA 3V4IA 4Q0BA 1RBUA 3HSTB 2RF2A 2GWKA 1HNVA 1MWKA 3S9HA 3CFPA 2JLEA 4O55A 4AHVA 3O3HA 1G15A 4FK4A 4XIUA 1YT3A 1LOTB 4ID5A 3O1BA 1K9MO 3TSUA 3NGIA 1XHXA 1L3VA 5C25A 4LF8K 5LL6Z 3SV3A 4CD1A 1C6VA 4JRPA 2RE2A 3WNFA 3UKUB 3M8RA 2V52B 3CQ8A 2B5JA 4FWSA 4BRPA 4CK3A 3D0PA 4JK9A 3LM9A 3V9UA 5AQKA 1Q18A 4NCGA 3CFRA 1KAYA 4FJ5A 2QM1A 4O5FA 3C7NB 4CBXA 2YKNA 3SAHA 5CR4A 4N5SA 1NJWA 1Q81O 4J2DA 4W5NA 3VMFB 4FM2A 2OTLN 1HMVA 4EHUA 3SPZA 4KBOA 1OH8A 1JCEA 3O8MA 1SUQA 2HBMA 4B1XB 4HCBA 4NCAA 2KHOA 5C42A 4MDBA 3VQ9A 4PWDA 3THXB 4XH1A 4J8FA 2OCEA 5AQYA 4YY3K 2PYLA 1GLLO 3MWTA 2W6LA 3AVJA 1RCHA 4DFKA 3ATUA 3T19A 3TAGA 4B3TK 1EXQA 4CECA 3KLEA 3KLFA 2W40A 2Q1NA 4ISFA 3UKRA 1HNXK 1T44A 4M45A 1KSPA 5KGWA 1KFDA 3VQEA 3R6MA 2HF4A 1KAXA 3O5BA 4CJKA 3TSQA 3K2PA 3M8QA 1SV5A 1K6YA 2IVNA 2X74A 2HHWA 1YTUA 3CXCM 1NKEA 2PYJA 4CJ4A 1HX1A 4DSEA 1UA1A 3A5NC 1N36K 3M8SA 1A5WA 4ELTA 3DLKA 3CQXA 4DFMA 3ZT4A 3AVAA 3V1OA 4FZXC 2YJFA 2NRZA 1NNEA 4H5TA 1L5UA 3ASMA 4JHDA 4O5BA 4BG9A 1CXQA 1ILYA 3ZSRA 4MO4A 2J4RA 4NXNK 4DS5A 1GOBA 3ITHA 4WQ5C 3U3GA 4GMJB 2RN2A 1VQ5N 4FSVA 1C0FA 3T1HK 1JKHA 3SLCA 4YOWA 1HLUA 4PKIA 2Q2RA 2P9LB 2CH6A 4B3OA 2UXCK 3CERA 2D0BA 5JLHA 1O1WA 5ADXH 4FWPA 4GKJK 5KQDA 4QS9A 4A61A 1ZBFA 4N56A 2HHTA 5BR8K 4IOXA 4CESA 3QERA 3D7EO 2Q31A 1XHZA 2QW9A 3OBYA 4IG0A 4BGBA 3WXKA 4OGCA 1TK0A 1Q86O 1QQMA 3AVLA 2W41A 5AQTA 4F9OA 4YOYA 1YJNN 2D4WA 3HPOA 3TTDA 3K9JA 3CPEA 2A1SA 4IKFA 3G10A 1SL2A 3AO1A 5CYQA 1VSMA 2QA4N 3PIPL 5DM6L 3QFUA 1GLDG 1S6PA 2BH1A 4DV7K 2IGIA 3LP2A 1NGGA 1SKSA 4H8KA 2NRVA 5J2NA 3C7NA 1NGFA 1N6QA 1RBTA 5FPNA 1BCMA 4BDZA 3L3VA 4OPAA 4Y1CA 3GE1A 3M6GA 3IMXA 4E19A 1T6DA 4B8CA 4K8ZA 3L3UA 4J2BA 5AQXA 4DU3A 1X9JA 1A5VA 1VSJA 3SZ2A 2AA4A 1H1VA 4B9MA 4M3RA 2V7ZA 3AVMA 3CC4N 2FBYA 2O8BA 1YF5L 3U9DA 2A5XA 1VSKA 4CJQA 3TAPA 4BRQA 3LP0A 4WFAL 4MFBA 3CJCA 1TUUA 3FZFA 4KKOA 4BY9C 3ALYA 2FF3B 5CE3A 1MDUB 1NGBA 3U3YA 2NRXA 4CFCA 4X62K 4DWIA 5EXWA 2QKBA 2QEXN 3ZSYA 4CJFA 3VPZA 1VQON 1ZC6A 4I2PA 2P9KB 3T1YK 2Z1GA 3NH0A 1E4GT 4OX9K 1D5AA 3VESA 4NCBA 4ELVA 4BRAA 3A2FA 1C1BA 2UXBK 3CJ9A 3AVBA 1NKCA 4C23A 2UYTA 1NK4A 5ELZA 3OTOK 3RMCA 1IBLK 1JLQA 3HPGA 3TAFA 1U47A 4BRIA 3ZLJA 3PX0A 4BVPA 1J9AA 3VQQA 4BDPA 1R59O 3CETA 2P9UB 4DF8A 1HPMA 3DLGA 4LSNA 4OPJA 1BCOA 3BP8A 3I8BA 1S1TA 3CQYA 5AFUA 3K58A 2O8EA 3NGYA 4CIGA 2QWMA 4N41A 3RR7A 4NLBA 4CW7B 2FBVA 3R1XA 4BQZA 1VQ4N 3WQTA 5M1NA 3NH1A 1MA9B 1HNIA 3TAEA 3SUNA 1BWFO 4HUFA 1T7PA 2E2NA 3DXMA 1JL2A 1ZBIA 4I6MA 2AJQA 2IS3A 4U7BA 2JWKA 4IZ9A 4BWJA 1S6QA 4QS8A 3QFPA 3FFKB 4B1ZA 5SZTA 1J6ZA 5AQPA 3K5MA 4FWLA 1E3MA 3ID8A 4BRHA 1RTJA 4IFVA 1RT7A 2UUBK 2Q36A 4B1VA 1S1XA 3MWPA 4BRCA 3PIOL 2QXLA 3K5LA 3CCJN 2YHXA 5AQUA 4B9TA 1TKXA 4ID1A 1QS4A 2HHVA 2HHHK 2ZJRL 1WN7A 1MWMA 3P83D 3KLHA 5DMRA 4CGHA 1BG3A 2CGKA 2Q0RA 3E9PA 4DV5K 3PUFA 4BWMA 4DR6K 3SYZA 2O8DA 3DXKB 4FO0A 1U48A 5AZIB 5KI6A 4Z4CA 1HYZA 4KI4A 3ZYYX 1U4BA 2WC9A 1VRTA 4KO0A 1SKRA 3J8AA 1X3NA 4K0KK 4EP5A 3M5RA 4O44A 4CGFA 4CHOA 1NBWA 1M1KO 4Z4FA 3WNGA 1VQ6N 2D0OA 3HVTA 4DTRA 5E26A 3QEPA 1W9HA 1RTIA 4ILHA 2HMIA 1JXBA 4BACA 1DEJA 1ATSA 4DMNA 4DFJA 1J5EK 2ZF5O 3VERA 3SV4A 3WNEA 4K25A 2O8FB 1U45A 1TUYA 2PY5A 1KVCA 5JMVA 5BRHA 4FJXA 3H3NO 1P8ZA 3HOSA 4LFAK 3BEXA 2P9IB 3O4QA 3J7AP 3VQ6A 2Q0UA 1W7AA 2X6NA 1HQEA 3VF6A 3ZX0A 2FSNA 5J2MA 1L3UA 3IKMA 3C6UA 4GW6A 4ZTJA 1LAWA 4CJWA 1ATNA 1RDBA 3J7YP 2I7NA 2P9UA 5AQVA 4CF8A 1Q9XA 3THWB 5EVZA 4U67L 2HHQA 2ASPA 3DMJA 2GTDA 3EZ5A 2Y1IA 4CERA 4C8KA 5EY4A 3OA9A 3AVIA 3MN7A 3LAMA 3VENA 3CF5L 4E3SA 3B6OA 4JKFA 3K57A 3SUOA 4FLTA 5C12A 1B9DA 1LCUA 2RPIA 2DPNA 3EE9A 1QQOA 2QI2A 2QWRA 3VQBA 1IV0A 3VA0A 1GLJO 4DV6K 3VQ5A 2GWJA 4FPBA 3CYMA 2NRRA 2QWQA 4WF9L 3V81A 4BGAA 1U6ZA 1YXQA 3CFOA 4FW2A 4IJNA 4CJTA 3V9SA 4Y1DA 1EP4A 4OLBA 3LAKA 4FWQA 4K42A 4FWNA 4M63C 4BR7A 5B8HA 1WLJA 1WSHA 3OYFA 3QETA 3S3NA 1KQSM 4X65K 2YCHA 4JKEA 2NLXA 3D2EB 3BF3A 4XH4A 4CD3A 4CBWA 4PKGA 5CZ2A 4WYBA 3LZIA 4DQRA 3UE5A 3AARA 4FZYA 5EU7A 1NJXA 4DSIA 1FK9A 2BE2A 1OH6A 1VQ8N 3UIQA 1NWKA 1VQLN 1T3VA 3ZT0A 2P9NA 2E88A 3SJHA 4O8UA 4CJLA 3RMAA 5HRSA 5BR9A 2KTQA 4A2BA 3VF2A 4CF9A 2HVIA 2GV9A 1TGOA 1XUPO 1QTMA 3HK2A 3SQ4A 3EN9A 5HROA 2IIRA 4IWVA 3KK3A 4YDUA 1RTHA 3WNHA 1O13A 2H3GX 1S22A 4FLUA 4DTJA 4B3RK 1RT6A 4LF9K 1HKCA 4FOEA 2HNYA 4CEBA 2NRWA 5AQLA 4J2AA 2IDOA 2E1YA 3O3GA 4BC4A 1IH7A 3VEOA 2YX6A 1RDUA 2QXFA 3BF1A 1RNHA 4K8XA 4FVUA 3U4LA 3KZBA 2X78A 1UA0A 3THVA 2ZGYA 3J80O 4A5BA 4I7FA 2RHKA 3VGMA 3A5LC 4FWKA 3ZSOA 2P9IA 3KVGA 4EZ6A 5M1PA 4B1WB 3JXUA 3KK1A 2XY8A 5BN8A 1HJRA 1Q82O 4CEFA 3C6HA 1RBSA 4C8LA 4OJRA 3K0SA 5KRSA 3CJAA 4OKKA 1QE1A 2E2OA 4E7HA 4PL7A 4E1MA 3EE8A 5HP1A 1S9EA 4BE1A 3C95A 3VQDA 5FPDA 2O8CA 1NGEA 4X64K 4IO9L 1NMDA 3L2UA 3V9WA 5AQOA 1WOQA 3O9RA 1FW6A 4KHNA 4IEEA 4M3WA 1RGIA 4B08A 4C8OA 4Q5VA 3E9OA 1VSFA 3PV8A 4CGIA 3RR8A 2ETJA 4JK8A 3TI0A 1N5YA 1G99A 3ULDA 5BRFA 3NF7A 2UU9K 3BZKA 4H5WA 3BY5A 1NJIO 1WSIA 5BRDA 3QNNA 5FPEA 1RT3A 5E41A 1DKGD 3U8XA 3O80A 4JYAK 3CCMN 3LM2A 4FW1A 4AHSA 2D0CA 4I9LA 4HTLA 4B9QA 3MCAB 5JVGL 3N4PA 3NF9A 1WAJA 1JCGA 3H46O 1SS6A 4ICLA 3TSPA 2X6SA 5GAEP 4N76A 1DGKN 1NM1A 2ZJPL 2F7TA 3F9KA 1NMNA 3MK6A 5BPNA 4JKHA 4ISEA 5I42A 2XRIA 3OHRA 1XNRK 1WSEA 2FBXA 4FLWA 3KKRA 4IXCA 3NE6A 3F2KA 1IO2A 4DG1A 4B9SA 4FL9A 5C2DA 5GINA 3L8BA 1ZYQA 4CCHA 1NK6A 4FJLA 3WEEA 4FJMA 2CH5A 4CGGA 3JS6A 4O4GA 4DV1K 5CHIA 3HP6A 2VGNA 3PX4A 3DRSA 4L3QA 2ASOA 3ENBA 4EAHD 4B9NA 1SL1A 5J2PA 3BZCA 3ZT3A 4ILGB 4CHZA 1BA1A 4OGEA 3DLRA 1YVNA 3NBPA 4FK0A 3HTVA 3DWLA 5EX5A 3G0ZA 3R8EA 1WSJA 4WE1A 3H1QA 4Y0WA 1LV5A 2YNIA 2G8HA 2YHAA 4E89A 3LPTA 3EZWA 2YKMA 5I3UA 1P90A 3D6RA 3LALA 1BUPA 4DTPA 3LPUA 3C94A 1ZBLA 1RT2A 3MXMA 1D8YA 1HNWK 1EX4A 4FJ8A 4DCHA 1CZBA 1T05A 5GADP 2OTJN 3VQAA 1TKDA 2KZMA 5FROA 1IBKK 4CF0A 3A0IX 2ZJQL 4JI0K 2ZD1A 4PA1A 4B8AB 4FJGA 4DTNA 4M3YA 3U6FA 4M3UA 3LDPA 4FM1A 1IBMK 3AGKA 4AHRA 3ENHA 3GL1A 3QBWA 2KFNA 5CY4A 1DTQA 2B6AA 4MQ3A 4BRDA 5A2QO 4BR2A 3CM6A 2YI1A 3CMAN 4CEQA 3EEQA 3FR0A 5C10A 4UQGA 3VA3A 5C15A 5HL7L 4A2AA 4FWMA 1K73O 4JI3K 3OYDA 3AY9A 2VCPA
chains in the Genus database with same CATH topology
3NMUA 3AAPA 3VEZA 4I6MA 4U7BA 1Y64A 2JWKA 4IZ9A 1Q7YO 3MN6A 5JVHL 2QWPA 2F9TA 3D2EA 1QZ6A 3P38A 3OBWA 3QDKA 5BN9A 3UKUA 3WT0A 4QS8A 2QWOA 3VEVA 4A59A 3QFPA 3FFKB 4B1ZA 3C0BA 1J6ZA 3E9LA 5AQPA 4FWLA 3ID8A 4BRHA 1QVFM 3MX2A 4IO8A 5GAHP 3N4QA 2NZTA 5JICA 4H0PA 2Q36A 4B1VA 1ESVA 1YHQN 3MWPA 5AQGA 3ZETB 2QXLA 4IJAA 4BRCA 3PIOL 3FZMA 4CZIA 4JKAA 1JCFA 3CCJN 2YHXA 4KH5A 2PAVA 5AQUA 4AM6A 3CJBA 1BA0A 3I56N 1WUAA 1IG8A 4BG8A 2ZJRL 3QICA 2HF3A 2YHWA 4JN4A 1VQNN 1MWMA 2FXUA 3SBGA 1IJJA 5AFUH 1BG3A 1K8KB 2QWLA 3TTFA 1ATRA 2CGKA 3EKSA 3RSEB 3ZX2A 4GV6A 3O6WA 2Q0RA 4YOTA 3IFRA 1KAZA 3E9PA 1GLBG 5KQ8A 5E84A 1U2VA 2WUSA 5LY3A 3DXKB 3R3LA 4JKGA 5C0YA 1Z6RA 3CCSN 4FO0A 3DJCA 1YJ9N 3CHWA 3Q7CA 2YJEA 5AZIB 4WCEL 3EKUA 5MLCQ 3CPWM 3B8AX 3ZYYX 4CZEA 2WC9A 4H5NA 3PLAA 3KHYA 3SBTA 3VEWA 5AQHA 2HBKA 2ZWHA 3J8AA 2CGJA 4M7YA 1X3NA 3LDOA 3S41A 2P9PA 3GG4A 3M5RA 4IDHA 1NBWA 2NRHA 4JKBA 3NVMA 3C6AA 3ID6A 3LDLA 4YOUA 5BPMA 1M1KO 3WXLA 2QWNA 3VETA 2D0OA 3WEEB 1VQ6N 2IVPA 5E26A 1NGCA 1T6CA 5AQFA 1VQKN 5KPTA 2P9SA 4ILHA 5LJVA 3VTIA 2GX9A 1RFQA 2KLAA 4BRMA 1DEJA 1ATSA 3U9ZA 4DB3A 2ZF5O 1NGIA 2E2PA 3A5MC 3I33A 5AQJA 3VERA 5KPRA 4K25A 3DAWA 1TYQB 3Q7BA 1TUYA 3GDQA 5AR0A 3T7ZA 2Q97A 3ULEA 1JJ2M 5JMVA 5BRHA 3CCQN 5GAGP 5AZJB 3FE1A 3H3NO 1P8ZA 4BRFA 4EHTA 3WQUA 3HOSA 4BREA 1YAGA 3WXJA 1KD1O 3D2FA 3BEXA 5JLFA 2P9IB 4A5AA 2QTDA 4G9ZA 2Q0UA 1W97L 4RCHA 4EIAA 3VF6A 4DQ8A 3ZX0A 2FSNA 1CZAN 4BRNA 2HMPA 3IKMA 4WFBL 2D1KA 4YDUC 4WFNL 1ATNA 2P9LA 2I7NA 2P9UA 5AQVA 4CZMA 3G71N 4JHDB 5EVZA 4U67L 3EO3A 3CC2N 2ASPA 2V7YA 2ZGZA 3CCEN 4IEIA 2GTDA 2WBNA 2A3ZA 3SMSA 2E2QA 4H0OA 3F5TA 5EY4A 3OA9A 1YJWN 1N8RO 3MN7A 3CF5L 3VENA 3O9SA 3HOTA 3VGLA 4JKFA 4GNIA 1E4FT 3IDHA 3DLLL 3L4QA 5AQNA 2A40A 5C12A 1QVGM 3WXMB 1LCUA 1GLAG 4YOXA 4H0VB 4JD2A 3MDQA 2DPNA 4EFHA 3CMEN 3TU5A 3ZEUA 1NLVA 1QQOA 3EE9A 4LC9B 2CGLA 4MLEA 2QI2A 2QWRA 4O8KA 3CCVN 1GLFO 4KH4A 2GWKA 4CZHA 3KK7A 1MWKA 1GLJO 3P39A 2GWJA 4JAXA 4FPBA 3CJ1A 2NRRA 2QWQA 3ATVA 3SK3A 4WF9L 4R79A 1QQNA 4FPAA 4BGAA 1U6ZA 1YXQA 4IJNA 2VGMA 3VEYA 2NRTA 1LOTB 1SAZA 4YORA 4CZFA 3O1BA 4PL8A 1K9MO 3DXMB 3W3DA 4FWQA 4K42A 3TSUA 4FWNA 3CCLN 4H0XB 4M63C 5LJWA 4JNEA 1C0GA 4I6MB 4BR7A 5B8HA 4JEPA 4BR5A 1KQSM 1NGHA 3WUHA 2YCHA 4JKEA 4OO1J 4CD1A 4FWRA 2NLXA 1ZBSA 2HBJA 3BF3A 3D2EB 4PKHA 2VYPA 3ENOA 4PKGA 2RE2A 4XH4A 3UKUB 4CBWA 2V52B 1YIJN 4WYBA 4BC5A 1K8KA 3L4IA 3O9QA 3AARA 3UE5A 2A42A 4FWSA 4BRPA 5C2FA 4JK9A 3LM9A 1VQ8N 2IVOA 1NWKA 1VQLN 5AQKA 1T3VA 1Q18A 3FZHA 3M1FA 2P9NA 2E88A 1KAYA 4CZGA 3SJHA 2QM1A 3A5OC 3QBXA 3C7NB 4O8UA 4O5FA 4CBXA 5BR9A 3SAHA 5CR4A 5AQSA 1Q81O 3VMFB 3VF2A 4A2BA 1VQ9N 2OTLN 1M90O 4GY2B 3BUZB 4EHUA 3QMLA 3FZLA 4KBOA 3RVCA 4CJ7A 1XQSC 3NVKA 3CCRN 1SZ2A 1XUPO 5F2RA 1JCEA 3H1VX 3O8MA 3GBTA 5H1SQ 2HBMA 2PBDA 4B1XB 3EN9A 3MN9A 2KHOA 4XEIA 4MDBA 4H5RA 2IIRA 4IWVA 4DKWA 1VAZA 4YDUA 4XH1A 2A6AA 1U2VB 4J8FA 5AQYA 2H3GX 1O13A 1S22A 1V4SA 1BDGA 1GLLO 3O4WA 3MWTA 4QS7A 1Z05A 3ATUA 1HKCA 4FOEA 1YITN 3KWGA 2NRWA 5AQLA 5ADXA 2P9KA 2E1YA 4BC3A 3FLCO 3H45C 4BC4A 3VEOA 2YX6A 2W40A 2Q1NA 3R9PA 1RDUA 4ISFA 3SMPA 3UKRA 3LL3A 3SAFA 1T44A 1GLCG 3BF1A 3G4SN 1DT9A 4FVUA 1TYQA 3U4LA 3KZBA 3IUCA 3R6MA 2HF4A 1KAXA 3O5BA 5TKWA 5BPLA 2ZGYA 3I55N 4A5BA 3T69A 4AF1A 5AZJA 4UY8O 2RHKA 1RDWX 4JKDA 3TSQA 4JK7A 3A5LC 4FWKA 3VGMA 2IVNA 2E20A 3CXCM 1KC8O 1HX1A 2P9IA 2P9SB 4RWTA 3KVGA 3A5NC 5M1PA 5M1QA 3JXUA 1X3MA 4B1YB 4B1WB 4BR4A 2KKZA 5AQZA 5BN8A 3FGUA 3CQXA 1Q82O 4BQLA 4BRKA 3UB5A 4CZJA 4XH5A 3C6HA 2YJFA 2NRZA 1HKGA 3CJAA 4H5TA 4JHDA 5AQMA 2E2OA 3TPQA 4PL7A 4BG9A 1ILYA 2ITMA 3EE8A 4MO4A 2J4RA 2GUPA 2YHYA 4WQ5C 1VQ5N 4IFEA 5FPDA 3LDQA 4FSVA 5F1XA 1VQ7N 1C0FA 1NGEA 1D4XA 4DHYA 3SLCA 3VOVA 4YOWA 1HLUA 4PKIA 2Q2RA 4IO9L 2P9LB 3HM8A 2CH6A 2VWBA 1NMDA 2E8AA 3CERA 5AQOA 5JLHA 1WOQA 2BTFA 4BC2A 3MMVA 3O9RA 5AQWA 5ADXH 4FWPA 4BR9A 2V51B 5KQDA 4IEEA 1ZXOA 1RGIA 4QS9A 3G25A 4IOCL 2WFBA 3HSCA 2BUPA 4A61A 3E9OA 4E1JA 1EQYA 4IOXA 4JK8A 5KPZA 3D7EO 1G99A 4H0TB 2Q31A 1NGDA 3O9TA 4CD3A 5BRFA 2E1ZA 2QW9A 3OBYA 4H5WA 4JKCA 1NJIO 3CCUN 3VGKA 4BGBA 5AQRA 5BRDA 4JD2B 4K43A 3WXKA 5FPEA 1DKGD 3U8XA 1Q86O 4C1NK 3O80A 5DM7L 1QQMA 3LM2A 2W41A 4NLCA 5AQTA 4F9OA 3ZETA 4YOYA 2D4WA 3CCMN 1YJNN 3TTDA 3L0QA 3K9JA 3CPEA 3TTCA 3H3OB 4HTLA 1VQPN 3H6EA 4B9QA 2HSTA 4BRGA 3MCAB 5JVGL 3N4PA 4Z94A 4C1NI 3CD6N 2QA4N 5GIOA 1QHAA 5AQQA 3PIPL 2I7PA 1HJOA 1JCGA 3H46O 1SS6A 3TSPA 3RSEA 5DM6L 5GAEP 3QFUA 1GLDG 2FSKA 1DGKN 2BH1A 3CIPA 1NM1A 1V4TA 5AQIA 2ZJPL 2F7TA 1BO5O 3MN5A 3MK6A 1NGGA 3DXKA 4GVEA 5BPNA 2NRVA 4JKHA 3MCPA 4ISEA 4HWIA 3C7NA 1NGFA 1GLEG 3OHRA 1S3XA 3E1YA 5FPNA 5AZIA 4KH6A 4OPAA 4CZKA 3GE1A 2FSJA 1HUXA 2AP1A 4IXCA 1VQMN 3M6GA 3IMXA 4WQ4C 3GOIA 3F2KA 1T6DA 4NB4A 5AQXA 4CI6A 1KXPA 1X9JA 2NNWA 3MX5A 2AA4A 1YUWA 2OANA 1H1VA 4FL9A 4A62A 5C2DA 5GINA 3CC7N 1OVYA 2P9NB 4JKGB 4CZLA 2V7ZA 3WEEA 3CC4N 3CI5A 5M1FA 4FWOA 3FZKA 1YF5L 2A5XA 3HRGA 2CH5A 4ISGA 1QZ5A 3JS6A 3U9DA 4GV3A 5BREA 5CHIA 4BRQA 4OPHA 4WFAL 3VTHA 3CJCA 4WQ5A 4GV9A 4IOAL 2VGNA 4ILJA 1TUUA 3AGRA 3FZFA 4L3QA 5TKYA 4BY9C 2ASOA 3ENBA 4EAHD 2FF3B 3QB0A 4PHTX 1MDUB 2P9PB 1NGBA 4H03B 3C65A 5CE3A 3K9KA 3E66A 4K41A 5HOOA 2NRXA 4ILGB 1BA1A 5EXWA 2ASMA 4H0YB 2EWSA 5GIPA 4YOVA 3VF4A 1NGAA 3CJ7A 4NO7A 2QEXN 1YVNA 3O1WA 1BOTO 2HOEA 3KWIA 1ZC6A 3VPZA 1VQON 3HTVA 3DWLA 3EL2A 3P31A 4FOIA 5EX5A 3R8EA 4BRLA 2F9WA 2P9KB 3H1QA 4Y0WA 1E4GT 3VESA 4RTFD 4BVOA 3UKRB 4BRAA 1S72N 5EOYA 3A8YA 3L6QA 1HKBA 5I9EB 3EZWA 2GEMA 3ULEB 1P90A 3D6RA 4H5VA 4BROA 1BUPA 3CJ9A 2FLOA 5F0XA 4C23A 3W0LA 2UYTA 5ELZA 3D2FB 3M3ZA 1SQKA 1K8AO 4DCHA 3HI0A 5M1KA 3SAGA 4BRIA 2PFUA 5GADP 2OTJN 4BVPA 2HBLA 1BU6O 3P4IA 3O9UA 5M1OA 1R59O 2FF6A 2JWLA 4B1UB 3CETA 2A41A 1YI2N 2P9UB 3J7ZO 3A0IX 1HPMA 4MO5A 4CBUA 2ZJQL 2GELA 1EO1A 3OW2M 4AM7A 4M7XA 3BP8A 5FPMA 3I8BA 3CQYA 3O08A 5AFUA 3LDPA 4MLHA 3AAQA 3AGKA 2QWMA 4BR0A 3G6EN 3ENHA 1NGJA 3GL1A 3QBWA 4NLBA 3ZX3A 3WXIA 4BRDA 4BR2A 3R1XA 4BQZA 1OKJA 4MDAA 1VQ4N 3WQTA 2YI1A 5M1NA 3CMAN 2D0PA 3FR0A 5C10A 1W2BM 1MA9B 5C15A 3HZ6A 5HL7L 4A2AA 3VEXA 3HBTA 3LDNA 1XC3A 4A57A 1BWFO 4FWMA 1K73O 2E2NA 3DXMA 3F9MA 3ZEUB 4WQ4A 3AY9A 2VCPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U67 L;  3G4S N;  3CC2 N;  3CCE N;  1Q7Y O;  5JVH L;  1VQM N;  3I55 N;  4UY8 O;  1YJW N;  1N8R O;  3CF5 L;  3CC7 N;  3CXC M;  1KC8 O;  1OVY A;  1QVF M;  5GAH P;  3CC4 N;  3DLL L;  1QVG M;  1Q82 O;  1YHQ N;  3PIO L;  3CCJ N;  4WFA L;  3CME N;  4IOA L;  3I56 N;  2ZJR L;  3CCV N;  1ILY A;  1VQN N;  1VQ5 N;  4WF9 L;  1VQ7 N;  2QEX N;  1VQO N;  4IO9 L;  1K9M O;  3CCS N;  1YJ9 N;  3CCL N;  4WCE L;  1S72 N;  5MLC Q;  3CPW M;  1KQS M;  1YIJ N;  4IOC L;  1M1K O;  1K8A O;  1VQ6 N;  5GAD P;  2OTJ N;  1NJI O;  3CCU N;  1VQK N;  1VQ8 N;  1VQL N;  1YI2 N;  3J7Z O;  1Q81 O;  1Q86 O;  5DM7 L;  2ZJQ L;  3CCM N;  1VQ9 N;  2OTL N;  1M90 O;  3OW2 M;  1YJN N;  3CCR N;  1VQP N;  1JJ2 M;  3CCQ N;  5H1S Q;  5GAG P;  3G6E N;  5JVG L;  3CD6 N;  2QA4 N;  3PIP L;  1KD1 O;  5DM6 L;  5GAE P;  1VQ4 N;  3CMA N;  2ZJP L;  1W2B M;  5HL7 L;  4WFB L;  1YIT N;  1K73 O;  4WFN L;  3G71 N; 
#chains in the Genus database with same CATH topology
 1WSG A;  3RMB A;  1X1P A;  4KHU A;  3OYM A;  1IKV A;  1N32 K;  4DUZ K;  3MN6 A;  4DV0 K;  3BGR A;  3EY1 A;  4FJI A;  3P38 A;  3OBW A;  3WT0 A;  3UKU A;  1KCF A;  2W6K A;  3LWL A;  3VEV A;  4A59 A;  3E9L A;  1X9S A;  3AA3 A;  4B3S K;  3AA2 A;  4RG8 A;  3MX2 A;  3TAR A;  4DUY K;  2NZT A;  5JIC A;  3SPY A;  3V9Z A;  1LW0 A;  5AQG A;  3ZET B;  2P5G A;  1KVA A;  3FZM A;  4JKA A;  4KH5 A;  4AM6 A;  3CJB A;  4CHY A;  1IG8 A;  4FJ7 A;  4BG8 A;  3QIC A;  4JN4 A;  4CJ5 A;  3RSE B;  2F8T A;  4YOT A;  1TKZ A;  5CYM A;  1GLB G;  4BDY A;  5E84 A;  3THX A;  2WTU A;  3ZT1 A;  5LY3 A;  3R3L A;  4FLV A;  4CK2 A;  3CCS N;  3CHW A;  2YJE A;  4WCE L;  3EKU A;  4E0D A;  1VSL A;  4CZE A;  3PLA A;  1UAX A;  3DOL A;  3KHY A;  4NYN A;  4M7Y A;  4DSL A;  2NRH A;  4R5P A;  3ID6 A;  4KTQ A;  3WXL A;  3EYZ A;  1CLQ A;  1BIS A;  4CVN E;  5AQF A;  1FKP A;  2BGG A;  2OA8 A;  4ZTF A;  1BHL A;  3VTI A;  1T03 A;  4BRM A;  3MAQ A;  2E2P A;  5KPR A;  1TV6 A;  1TAQ A;  3IS9 A;  3DAW A;  2O4G A;  3Q7B A;  3GDQ A;  1BGX T;  3OS0 A;  3CCQ N;  5AZJ B;  3FE1 A;  4FLX A;  1MU2 A;  2WON A;  1R0A A;  2KZZ A;  4E7K A;  4BRE A;  5JLF A;  1A5X A;  2IAJ A;  2QTD A;  2W42 A;  2GUI A;  1CZA N;  2HMP A;  4YDU C;  3AVF A;  2P9L A;  3ZSX A;  1NK0 A;  3G71 N;  4GVM A;  1RT4 A;  1WAF A;  2DTU A;  4B3M K;  4F4K A;  2A3Z A;  3SMS A;  4JS4 A;  1XC9 A;  4CGD A;  2HHU A;  4V19 S;  3O9S A;  3HOT A;  4L8R B;  2B4J A;  3VGL A;  3HXM A;  4DTO A;  4GNI A;  4I9Q A;  1JXE A;  3WXM B;  3J81 O;  3QEI A;  1QSL A;  4YOX A;  1C1C A;  3OYK A;  3CME N;  1JL1 A;  3OYC A;  1HR0 K;  2CGL A;  4MLE A;  3THY B;  2KFZ A;  1GLF O;  1Z25 A;  4CZH A;  3KK7 A;  4DR7 K;  4FJJ A;  3CJ1 A;  3SK3 A;  3HL8 A;  2HVH A;  4FPA A;  5HRN A;  3RRH A;  3BDP A;  3KD1 E;  1JLG A;  2KW4 A;  3W3D A;  3KJV A;  2NUB A;  4FJN A;  1QHT A;  4JNE A;  4B9L A;  4KPY A;  2HHS A;  4JEP A;  1NJZ A;  5IT9 O;  3H08 A;  4KB1 A;  3WUH A;  4OO1 J;  4FWR A;  2HBJ A;  4CJ7 A;  4DQQ A;  2VYP A;  2Y1J A;  1ITG A;  3L4I A;  3AO4 A;  3O9Q A;  4LH5 A;  4YHH K;  3KD5 E;  1UWB A;  3V9X A;  4DR3 K;  5C2F A;  3M1F A;  1TL3 A;  2OYQ A;  3QBX A;  5AQS A;  3AA4 A;  3BUZ B;  4E1N A;  3QML A;  2Q3S A;  5HRP A;  3RVC A;  4DSK A;  4OVL A;  1SZ2 A;  4JI6 K;  4DTX A;  3H1V X;  3GBT A;  4EP4 A;  3MN9 A;  4F8R A;  4XEI A;  4DKW A;  1SL0 A;  1B92 A;  1U2V B;  3SQ1 A;  1V4S A;  4AHT A;  4QS7 A;  1BDG A;  2VWJ A;  3I0R A;  1UOC A;  3O4W A;  1Z05 A;  1YIT N;  3KWG A;  4RW9 A;  4AHU A;  5ADX A;  2P9K A;  1C0T A;  3AV9 A;  4CGJ A;  3SMP A;  1XMO K;  3SAF A;  4HUG A;  1DT9 A;  1S5J A;  2YNG A;  2WOM A;  3IUC A;  1KTQ A;  3I55 N;  2DFE A;  3T69 A;  5AZJ A;  1EET A;  4UY8 O;  1RDW X;  4JKD A;  4JK7 A;  4CJR A;  1KC8 O;  1HNZ K;  3MEC A;  2P9S B;  4RWT A;  1CXU A;  3VQP A;  5M1Q A;  5AQZ A;  3QEW A;  2DY4 A;  4DTM A;  4BRK A;  3UB5 A;  4FCY A;  1JLB A;  4XH5 A;  1J54 A;  3TPQ A;  4JS5 A;  1ZBH A;  2GUP A;  1S9G A;  2E6L A;  3OYG A;  3ZT2 A;  3OY9 A;  1Q9Y A;  3QIO A;  5F1X A;  1D4X A;  4DHY A;  4LD0 A;  4DTS A;  2I5J A;  3KLG A;  3B6P A;  2VWB A;  2E8A A;  3SJJ A;  5HRR A;  1NK8 A;  1J53 A;  4BC2 A;  3MMV A;  2V51 B;  3I0S A;  3S3M A;  3G25 A;  4IOC L;  3THY A;  3HSC A;  2BUP A;  1EQY A;  4H0T B;  2VQF K;  1NGD A;  4JKC A;  3CCU N;  4HUE A;  1IG9 A;  4BE2 A;  4JD2 B;  4KRE A;  1Z26 A;  1NKB A;  5DM7 L;  3L0Q A;  1NU0 A;  3H3O B;  1VQP N;  3H6E A;  1YVU A;  2HST A;  2G8U A;  4BRG A;  1NK9 A;  4NYF A;  4Z94 A;  4C1N I;  3CD6 N;  5GIO A;  1QHA A;  1I3A A;  1HJO A;  2I7P A;  4JI8 K;  5JS2 A;  4KTZ A;  2FSK A;  4KHP K;  1V4T A;  3DXK A;  1RBV A;  2KQ2 A;  3M8P A;  3AVG A;  1GLE G;  1S3X A;  3E1Y A;  1BQN A;  5AZI A;  4KH6 A;  5HBM A;  2FSJ A;  1FJG K;  1HUX A;  4CI6 A;  3MX5 A;  1KXP A;  4A62 A;  1YUW A;  4DLG A;  4KV8 A;  1OVY A;  4CZL A;  4FXD A;  4C8M A;  3ZSZ A;  3HRG A;  4ISG A;  1QZ5 A;  3PSI A;  5BRE A;  1BQM A;  4F2S A;  1IKX A;  4OPH A;  3SUQ A;  4GV9 A;  5TKY A;  4JLH A;  4PHT X;  2P1J A;  3NMU A;  3DYA A;  2HHX A;  2O8F A;  3E66 A;  5HOO A;  3DLE A;  3V1Q A;  3QNO A;  1TL1 A;  4DFP A;  4H0Y B;  2EWS A;  4YOV A;  3TWH A;  3VF4 A;  1NGA A;  3CJ7 A;  4NO7 A;  3O1W A;  3E01 A;  2HOE A;  1NOY A;  5SWM A;  3O4N A;  3SQ0 A;  3HO1 A;  1C0U A;  3EL2 A;  3P31 A;  4FOI A;  3OYN A;  1DTT A;  1RBR A;  2EX3 A;  2F9W A;  1J5O A;  1BI4 B;  4BVO A;  3UKR B;  2HNZ A;  4AH9 A;  3L6Q A;  2G8I A;  3NHG A;  5I9E B;  4IDK A;  3OYJ A;  2GEM A;  3ULE B;  3RRG A;  3THW A;  2FLO A;  1WNS A;  3D2F B;  3M3Z A;  4IFY A;  3K5O A;  1K8A O;  5M1K A;  4EZ9 A;  1HYS A;  1N33 K;  5J1E A;  4ZHR A;  3P4I A;  1BU6 O;  3LAN A;  4FJK A;  2JWL A;  2FF6 A;  4B1U B;  3LDS A;  2A41 A;  4MO5 A;  2GEL A;  3T3F A;  3OW2 M;  4E7J A;  4AM7 A;  4RW7 A;  2XO7 A;  4MLH A;  3AAQ A;  2XHB A;  4BR0 A;  1NGJ A;  3ZX3 A;  4H4M A;  1S1U A;  1N34 K;  3PO4 A;  4CJV A;  5FRM A;  4CFD A;  5FDL A;  3LDN A;  5DK5 A;  1XC3 A;  3HPH A;  1LAV A;  4QOZ B;  3ZEU B;  4WQ4 A;  4X66 K;  2F96 A;  4PY5 A;  4QCL A;  1Y64 A;  1TVR A;  4KHW A;  5JVH L;  3ZSV A;  3D2E A;  4DR2 K;  3NDK A;  3QDK A;  1IKW A;  1Q8I A;  5BN9 A;  2QWO A;  3C0B A;  1BIZ A;  1LWE A;  1QVF M;  4IO8 A;  5GAH P;  2YNF A;  4H0P A;  3QEX A;  1YHQ N;  5K14 A;  4IJA A;  3IAY A;  4CZI A;  1VSH A;  1BA0 A;  3I56 N;  2HF3 A;  1VQN N;  2FXU A;  1S1V A;  5AFU H;  4AIL C;  3AVK A;  1D9F A;  3DRR A;  1K8K B;  2QWL A;  4H4O A;  2XY5 A;  4KHS A;  3EKS A;  3O6W A;  5FLX O;  3HVR A;  1KAZ A;  5LMN K;  4OLA A;  4LF6 K;  3FFI A;  1RT5 A;  5C0Y A;  1Z6R A;  4BE0 A;  4JI1 K;  1BL3 A;  2P5O A;  3B8A X;  4F3O A;  4B9U A;  4J2E A;  1RIL A;  1RT1 A;  4CF2 A;  2YNH A;  3DRP A;  2HBK A;  5AQH A;  2ZWH A;  1NJY A;  3S41 A;  4DV3 K;  4M3T A;  3NVM A;  5BPM A;  2Z1I A;  3LDL A;  4YOU A;  4KFB A;  2QWN A;  4FM0 A;  3RTV A;  2IVP A;  1RDC A;  2O8B B;  1U04 A;  3P1G A;  5KPT A;  4FZZ A;  5LJV A;  4KI6 A;  2GX9 A;  1RFQ A;  3I8D A;  1BI4 A;  4CFB A;  3U9Z A;  4DB3 A;  3A5M C;  3I33 A;  4JI7 K;  4CHP A;  4LFC K;  1TYQ B;  2ATQ A;  2QKK A;  5AR0 A;  3T7Z A;  3AO3 A;  1JJ2 M;  3ULE A;  1RDA A;  4RW8 A;  5GAG P;  3V1R A;  4BRF A;  3WQU A;  2Z1H A;  1YAG A;  3ISN C;  3TAM A;  1KD1 O;  3D2F A;  3MXJ A;  4A5A A;  4FJH A;  4EIA A;  3KKS A;  4RCH A;  2P51 A;  5CZ1 A;  3NCI A;  5HLF A;  3OYE A;  3PO5 A;  3AVH A;  4WFN L;  3QO9 A;  1EKE A;  4I2Q A;  3HYF A;  3CC2 N;  2ZGZ A;  3CCE N;  3IG1 A;  4DQI A;  2WBN A;  2E2Q A;  4H0O A;  1REV A;  3TR8 A;  1YJW N;  4IBN A;  5D3G A;  3VQ7 A;  1VHX A;  4W5R A;  2R7Y A;  4M3X A;  3DLL L;  1QVG M;  1DLO A;  1VSI A;  3LZJ A;  1JLA A;  4FVM A;  4DV4 K;  2ITG A;  1S1W A;  3MDQ A;  2O8E B;  4EFH A;  3TU5 A;  3ZEU A;  1NLV A;  3L2Q A;  4KH4 A;  4W5O A;  3QEV A;  4OPK A;  3OVN A;  3P39 A;  4JAX A;  3ATV A;  4R79 A;  1QQN A;  2VGM A;  1YTA A;  2NRT A;  3VEY A;  1SAZ A;  3AVC A;  3LP3 A;  4YOR A;  1VSE A;  4CZF A;  4PL8 A;  3T1A A;  1EWR A;  3DXM B;  1OVQ A;  1B9F A;  3AA5 X;  4CIF A;  3CCL N;  4H0X B;  5LJW A;  1C0G A;  4I6M B;  4BR5 A;  1NGH A;  4JI5 K;  1ZBS A;  4PKH A;  3NGZ A;  3ENO A;  1YIJ N;  1OH5 A;  4Z4H A;  4BC5 A;  2D0A A;  4DLE A;  1K8K A;  2A42 A;  1IKY A;  5KGX A;  4M3Z A;  3K59 A;  2IVO A;  3FZH A;  4KAZ A;  4CZG A;  4CE9 A;  3A5O C;  5KTQ A;  4KHQ A;  4NXM K;  2HB5 A;  3MEE A;  3C6T A;  4GY2 B;  1M90 O;  1VQ9 N;  1ASU A;  3FZL A;  1XQS C;  2FC0 A;  4JI4 K;  3VN5 A;  3CCR N;  5F2R A;  3HM9 A;  3NVK A;  5H1S Q;  2PBD A;  3S3O A;  1ZBU A;  3DI6 A;  4H5R A;  1VAZ A;  2A6A A;  2O8D B;  1L3S A;  2UUA K;  3L2W A;  4LSL A;  1SKW A;  4PQU A;  3AO5 A;  4B9V A;  4BC3 A;  2YV0 X;  3FLC O;  3H45 C;  3R9P A;  2D5R A;  4LF7 K;  1KLM A;  1NK5 A;  3LL3 A;  1QSY A;  1GLC G;  3CG7 A;  3G4S N;  3ZSQ A;  1TYQ A;  5BPL A;  5TKW A;  3PSF A;  3P5J A;  4AF1 A;  4YFU A;  4OKJ A;  2E20 A;  4Z0U A;  1LW2 A;  4B1Y B;  1X3M A;  3ZCM A;  2KKZ A;  4BR4 A;  4DQS A;  3DOK A;  2Z1J A;  4E7I A;  3FGU A;  4CED A;  3RMD A;  4PUO A;  4BQL A;  4CZJ A;  1L3T A;  4QAG A;  1HKG A;  2PZS A;  5AQM A;  2OZS A;  3SUP A;  2ITM A;  4F3T A;  1NOZ A;  3OYI A;  2YHY A;  4LH4 A;  2QK9 A;  1X9W A;  4IFE A;  3L2V A;  1VQ7 N;  3LDQ A;  4W5Q A;  3VOV A;  3DLH A;  2G8K A;  3HM8 A;  4AHC A;  3CM5 A;  4CHQ A;  1ASV A;  2BTF A;  1KFS A;  5AQW A;  1NK7 A;  4CJ3 A;  4BR9 A;  4CJU A;  2E6M A;  1XNQ K;  1ZXO A;  4M41 A;  1WBB A;  2EHG A;  2WFB A;  5C24 A;  1Y97 A;  3TAQ A;  4E1J A;  4O0J A;  1HPZ A;  5KPZ A;  5LMU K;  3KTQ A;  4TSX A;  3O9T A;  1WB9 A;  1BIU A;  2E1Z A;  4CFA A;  4M42 A;  3VGK A;  2RKI A;  5AQR A;  3K5N A;  1TK8 A;  4HTU A;  4K43 A;  4KB0 A;  2E4L A;  4C1N K;  3F73 A;  4NLC A;  3ZSW A;  3KLI A;  3ZET A;  3QIN A;  4DU1 A;  3TTC A;  2LSN A;  4DR1 K;  5AQQ A;  3RSE A;  3CIP A;  3AVN A;  4DSF A;  5AQI A;  3LWM A;  2XY7 A;  2VG7 A;  1BO5 O;  3MN5 A;  4CIE A;  4GVE A;  1KRP A;  3OYH A;  3MCP A;  4HWI A;  2IC3 A;  4W5T A;  1I39 A;  4CZK A;  3TAN A;  1JLC A;  2AP1 A;  1VQM N;  4WQ4 C;  3GOI A;  4NB4 A;  4CK1 A;  3HT3 A;  4RW4 A;  2IOC A;  2NNW A;  3CC7 N;  2OAN A;  1JLE A;  4N47 A;  2P9N B;  2VWK A;  1OH7 A;  4JKG B;  1RTD A;  4Z4E A;  3CI5 A;  5M1F A;  4FWO A;  3FZK A;  5AJ3 K;  3VQ4 A;  4GV3 A;  3NF6 A;  4DU4 A;  3VTH A;  4WQ5 A;  4IOA L;  4ILJ A;  3OYA A;  3AGR A;  3QB0 A;  1C1A A;  2P9P B;  4H03 B;  3C65 A;  4LFB K;  3K9K A;  4K41 A;  5T7B A;  2ASM A;  5GIP A;  3NH2 A;  1QSS A;  1BOT O;  3AO2 A;  4DF4 A;  3KWI A;  3O3F A;  4DSJ A;  2G8V A;  2E5L K;  4BRL A;  3PY8 A;  3SNN A;  3NFA A;  4RTF D;  1XI1 A;  1FXX A;  4CJE A;  1S72 N;  5EOY A;  3A8Y A;  4DR5 K;  1HKB A;  2BDP A;  2OPQ A;  4LY7 A;  4CJP A;  4Z4I A;  4H5V A;  4BRO A;  1HRH A;  1FKO A;  5F0X A;  3W0L A;  3QES A;  2UUC K;  1C0M A;  1SQK A;  2VG6 A;  4DS4 A;  3HI0 A;  4FJ9 A;  4AQY K;  5JS1 A;  3SAG A;  2OPP A;  2PFU A;  1TAU A;  4IG3 A;  2HBL A;  5M1O A;  4JRQ A;  3O9U A;  1TK5 A;  1YI2 N;  3J7Z O;  4CBU A;  3NF8 A;  1EO1 A;  3MED A;  4M7X A;  5FPM A;  4LF4 K;  3O08 A;  4HVJ A;  1JLF A;  3G6E N;  4G1Q A;  2O8C B;  2OPR A;  3WXI A;  4YNQ A;  4RW6 A;  4DV2 K;  4LF5 K;  1NG9 A;  3JYT A;  4CEZ A;  3NAE A;  1OKJ A;  4MDA A;  3SI6 A;  4Z4G A;  1F21 A;  2D0P A;  3L2R A;  5FRN A;  1HQU A;  1LWC A;  3DM2 A;  3PX6 A;  1W2B M;  3HZ6 A;  3VEX A;  3HBT A;  3JAM O;  3D45 A;  4A57 A;  2DFH A;  1W0H A;  1U49 A;  3F9M A;  4O0I A;  3LP1 A;  1VRU A;  2HND A;  1I94 K;  3AAP A;  1WBD A;  3VEZ A;  2ZM6 K;  1Q7Y O;  2QWP A;  2F9T A;  2G8F A;  1QZ6 A;  4KHY A;  4DQP A;  3JSM A;  1WSF A;  4CEA A;  4FLZ A;  1QQC A;  1T8E A;  2G8W A;  1LWF A;  3N4Q A;  1EWQ A;  1KLN A;  1ESV A;  4CJS A;  4C8N A;  3V6D A;  1HYV A;  1JCF A;  2PAV A;  4F2R A;  1WUA A;  3VQ8 A;  2YHW A;  3OYB A;  3SBG A;  4CEO A;  1IJJ A;  3OYL A;  3TTF A;  1ATR A;  3ZX2 A;  5IWA K;  4GV6 A;  4KRF A;  2GBZ A;  3IFR A;  2ZQB A;  5KQ8 A;  2HW3 A;  1U2V A;  2WUS A;  3OJU A;  4JKG A;  3KK2 A;  5KRT A;  3DJC A;  1YJ9 N;  3Q7C A;  5MLC Q;  3CPW M;  1KVB A;  4H5N A;  4HCC A;  3SBT A;  3VEW A;  4CHN A;  4CEE A;  2CGJ A;  3LDO A;  2P9P A;  3GG4 A;  4IDH A;  4HHT A;  4JKB A;  3OS2 A;  3QIP A;  4OKE A;  3C6A A;  4JI2 K;  3OS1 A;  3VET A;  3WEE B;  1TKT A;  1VQK N;  1NGC A;  1T6C A;  1X9M A;  3SCX A;  2P9S A;  1VK0 A;  2F8S A;  2KLA A;  3DLB A;  3QLH A;  2BAN A;  1CZ9 A;  1NGI A;  5AQJ A;  2F4V K;  2Q97 A;  2FBT A;  3SQ2 A;  4EHT A;  4FYD A;  3WXJ A;  2XY6 A;  1GOA A;  4G9Z A;  1W97 L;  4JV5 K;  4DQ8 A;  3RWU A;  1XWL A;  4BRN A;  4FK2 A;  4WFB L;  3HP9 A;  1ASW A;  2D1K A;  4E7L A;  4CZM A;  3TAB A;  4JHD B;  2OPS A;  1XMQ K;  3EO3 A;  1VSD A;  2V7Y A;  4DR4 K;  4IEI A;  2O4I A;  2DFF A;  4GKK K;  3KIO A;  2UXD K;  3F5T A;  3OJS A;  2VQE K;  1N8R O;  4DTU A;  1D9D A;  4FLY A;  4ELU A;  3VQC A;  3IRX A;  2JGU A;  1E4F T;  3IDH A;  2OZM A;  3L4Q A;  5AQN A;  2A40 A;  3MEG A;  3MXI A;  4CF1 A;  1GLA G;  3HJF A;  4H0V B;  4JD2 A;  1GOC A;  1RDD A;  4KTW A;  2A1R A;  5J2Q A;  2YHB A;  4LC9 B;  2ZE2 A;  2VG5 A;  3CCV N;  4O8K A;  3V4I A;  4Q0B A;  1RBU A;  3HST B;  2RF2 A;  2GWK A;  1HNV A;  1MWK A;  3S9H A;  3CFP A;  2JLE A;  4O55 A;  4AHV A;  3O3H A;  1G15 A;  4FK4 A;  4XIU A;  1YT3 A;  1LOT B;  4ID5 A;  3O1B A;  1K9M O;  3TSU A;  3NGI A;  1XHX A;  1L3V A;  5C25 A;  4LF8 K;  5LL6 Z;  3SV3 A;  4CD1 A;  1C6V A;  4JRP A;  2RE2 A;  3WNF A;  3UKU B;  3M8R A;  2V52 B;  3CQ8 A;  2B5J A;  4FWS A;  4BRP A;  4CK3 A;  3D0P A;  4JK9 A;  3LM9 A;  3V9U A;  5AQK A;  1Q18 A;  4NCG A;  3CFR A;  1KAY A;  4FJ5 A;  2QM1 A;  4O5F A;  3C7N B;  4CBX A;  2YKN A;  3SAH A;  5CR4 A;  4N5S A;  1NJW A;  1Q81 O;  4J2D A;  4W5N A;  3VMF B;  4FM2 A;  2OTL N;  1HMV A;  4EHU A;  3SPZ A;  4KBO A;  1OH8 A;  1JCE A;  3O8M A;  1SUQ A;  2HBM A;  4B1X B;  4HCB A;  4NCA A;  2KHO A;  5C42 A;  4MDB A;  3VQ9 A;  4PWD A;  3THX B;  4XH1 A;  4J8F A;  2OCE A;  5AQY A;  4YY3 K;  2PYL A;  1GLL O;  3MWT A;  2W6L A;  3AVJ A;  1RCH A;  4DFK A;  3ATU A;  3T19 A;  3TAG A;  4B3T K;  1EXQ A;  4CEC A;  3KLE A;  3KLF A;  2W40 A;  2Q1N A;  4ISF A;  3UKR A;  1HNX K;  1T44 A;  4M45 A;  1KSP A;  5KGW A;  1KFD A;  3VQE A;  3R6M A;  2HF4 A;  1KAX A;  3O5B A;  4CJK A;  3TSQ A;  3K2P A;  3M8Q A;  1SV5 A;  1K6Y A;  2IVN A;  2X74 A;  2HHW A;  1YTU A;  3CXC M;  1NKE A;  2PYJ A;  4CJ4 A;  1HX1 A;  4DSE A;  1UA1 A;  3A5N C;  1N36 K;  3M8S A;  1A5W A;  4ELT A;  3DLK A;  3CQX A;  4DFM A;  3ZT4 A;  3AVA A;  3V1O A;  4FZX C;  2YJF A;  2NRZ A;  1NNE A;  4H5T A;  1L5U A;  3ASM A;  4JHD A;  4O5B A;  4BG9 A;  1CXQ A;  1ILY A;  3ZSR A;  4MO4 A;  2J4R A;  4NXN K;  4DS5 A;  1GOB A;  3ITH A;  4WQ5 C;  3U3G A;  4GMJ B;  2RN2 A;  1VQ5 N;  4FSV A;  1C0F A;  3T1H K;  1JKH A;  3SLC A;  4YOW A;  1HLU A;  4PKI A;  2Q2R A;  2P9L B;  2CH6 A;  4B3O A;  2UXC K;  3CER A;  2D0B A;  5JLH A;  1O1W A;  5ADX H;  4FWP A;  4GKJ K;  5KQD A;  4QS9 A;  4A61 A;  1ZBF A;  4N56 A;  2HHT A;  5BR8 K;  4IOX A;  4CES A;  3QER A;  3D7E O;  2Q31 A;  1XHZ A;  2QW9 A;  3OBY A;  4IG0 A;  4BGB A;  3WXK A;  4OGC A;  1TK0 A;  1Q86 O;  1QQM A;  3AVL A;  2W41 A;  5AQT A;  4F9O A;  4YOY A;  1YJN N;  2D4W A;  3HPO A;  3TTD A;  3K9J A;  3CPE A;  2A1S A;  4IKF A;  3G10 A;  1SL2 A;  3AO1 A;  5CYQ A;  1VSM A;  2QA4 N;  3PIP L;  5DM6 L;  3QFU A;  1GLD G;  1S6P A;  2BH1 A;  4DV7 K;  2IGI A;  3LP2 A;  1NGG A;  1SKS A;  4H8K A;  2NRV A;  5J2N A;  3C7N A;  1NGF A;  1N6Q A;  1RBT A;  5FPN A;  1BCM A;  4BDZ A;  3L3V A;  4OPA A;  4Y1C A;  3GE1 A;  3M6G A;  3IMX A;  4E19 A;  1T6D A;  4B8C A;  4K8Z A;  3L3U A;  4J2B A;  5AQX A;  4DU3 A;  1X9J A;  1A5V A;  1VSJ A;  3SZ2 A;  2AA4 A;  1H1V A;  4B9M A;  4M3R A;  2V7Z A;  3AVM A;  3CC4 N;  2FBY A;  2O8B A;  1YF5 L;  3U9D A;  2A5X A;  1VSK A;  4CJQ A;  3TAP A;  4BRQ A;  3LP0 A;  4WFA L;  4MFB A;  3CJC A;  1TUU A;  3FZF A;  4KKO A;  4BY9 C;  3ALY A;  2FF3 B;  5CE3 A;  1MDU B;  1NGB A;  3U3Y A;  2NRX A;  4CFC A;  4X62 K;  4DWI A;  5EXW A;  2QKB A;  2QEX N;  3ZSY A;  4CJF A;  3VPZ A;  1VQO N;  1ZC6 A;  4I2P A;  2P9K B;  3T1Y K;  2Z1G A;  3NH0 A;  1E4G T;  4OX9 K;  1D5A A;  3VES A;  4NCB A;  4ELV A;  4BRA A;  3A2F A;  1C1B A;  2UXB K;  3CJ9 A;  3AVB A;  1NKC A;  4C23 A;  2UYT A;  1NK4 A;  5ELZ A;  3OTO K;  3RMC A;  1IBL K;  1JLQ A;  3HPG A;  3TAF A;  1U47 A;  4BRI A;  3ZLJ A;  3PX0 A;  4BVP A;  1J9A A;  3VQQ A;  4BDP A;  1R59 O;  3CET A;  2P9U B;  4DF8 A;  1HPM A;  3DLG A;  4LSN A;  4OPJ A;  1BCO A;  3BP8 A;  3I8B A;  1S1T A;  3CQY A;  5AFU A;  3K58 A;  2O8E A;  3NGY A;  4CIG A;  2QWM A;  4N41 A;  3RR7 A;  4NLB A;  4CW7 B;  2FBV A;  3R1X A;  4BQZ A;  1VQ4 N;  3WQT A;  5M1N A;  3NH1 A;  1MA9 B;  1HNI A;  3TAE A;  3SUN A;  1BWF O;  4HUF A;  1T7P A;  2E2N A;  3DXM A;  1JL2 A;  1ZBI A;  4I6M A;  2AJQ A;  2IS3 A;  4U7B A;  2JWK A;  4IZ9 A;  4BWJ A;  1S6Q A;  4QS8 A;  3QFP A;  3FFK B;  4B1Z A;  5SZT A;  1J6Z A;  5AQP A;  3K5M A;  4FWL A;  1E3M A;  3ID8 A;  4BRH A;  1RTJ A;  4IFV A;  1RT7 A;  2UUB K;  2Q36 A;  4B1V A;  1S1X A;  3MWP A;  4BRC A;  3PIO L;  2QXL A;  3K5L A;  3CCJ N;  2YHX A;  5AQU A;  4B9T A;  1TKX A;  4ID1 A;  1QS4 A;  2HHV A;  2HHH K;  2ZJR L;  1WN7 A;  1MWM A;  3P83 D;  3KLH A;  5DMR A;  4CGH A;  1BG3 A;  2CGK A;  2Q0R A;  3E9P A;  4DV5 K;  3PUF A;  4BWM A;  4DR6 K;  3SYZ A;  2O8D A;  3DXK B;  4FO0 A;  1U48 A;  5AZI B;  5KI6 A;  4Z4C A;  1HYZ A;  4KI4 A;  3ZYY X;  1U4B A;  2WC9 A;  1VRT A;  4KO0 A;  1SKR A;  3J8A A;  1X3N A;  4K0K K;  4EP5 A;  3M5R A;  4O44 A;  4CGF A;  4CHO A;  1NBW A;  1M1K O;  4Z4F A;  3WNG A;  1VQ6 N;  2D0O A;  3HVT A;  4DTR A;  5E26 A;  3QEP A;  1W9H A;  1RTI A;  4ILH A;  2HMI A;  1JXB A;  4BAC A;  1DEJ A;  1ATS A;  4DMN A;  4DFJ A;  1J5E K;  2ZF5 O;  3VER A;  3SV4 A;  3WNE A;  4K25 A;  2O8F B;  1U45 A;  1TUY A;  2PY5 A;  1KVC A;  5JMV A;  5BRH A;  4FJX A;  3H3N O;  1P8Z A;  3HOS A;  4LFA K;  3BEX A;  2P9I B;  3O4Q A;  3J7A P;  3VQ6 A;  2Q0U A;  1W7A A;  2X6N A;  1HQE A;  3VF6 A;  3ZX0 A;  2FSN A;  5J2M A;  1L3U A;  3IKM A;  3C6U A;  4GW6 A;  4ZTJ A;  1LAW A;  4CJW A;  1ATN A;  1RDB A;  3J7Y P;  2I7N A;  2P9U A;  5AQV A;  4CF8 A;  1Q9X A;  3THW B;  5EVZ A;  4U67 L;  2HHQ A;  2ASP A;  3DMJ A;  2GTD A;  3EZ5 A;  2Y1I A;  4CER A;  4C8K A;  5EY4 A;  3OA9 A;  3AVI A;  3MN7 A;  3LAM A;  3VEN A;  3CF5 L;  4E3S A;  3B6O A;  4JKF A;  3K57 A;  3SUO A;  4FLT A;  5C12 A;  1B9D A;  1LCU A;  2RPI A;  2DPN A;  3EE9 A;  1QQO A;  2QI2 A;  2QWR A;  3VQB A;  1IV0 A;  3VA0 A;  1GLJ O;  4DV6 K;  3VQ5 A;  2GWJ A;  4FPB A;  3CYM A;  2NRR A;  2QWQ A;  4WF9 L;  3V81 A;  4BGA A;  1U6Z A;  1YXQ A;  3CFO A;  4FW2 A;  4IJN A;  4CJT A;  3V9S A;  4Y1D A;  1EP4 A;  4OLB A;  3LAK A;  4FWQ A;  4K42 A;  4FWN A;  4M63 C;  4BR7 A;  5B8H A;  1WLJ A;  1WSH A;  3OYF A;  3QET A;  3S3N A;  1KQS M;  4X65 K;  2YCH A;  4JKE A;  2NLX A;  3D2E B;  3BF3 A;  4XH4 A;  4CD3 A;  4CBW A;  4PKG A;  5CZ2 A;  4WYB A;  3LZI A;  4DQR A;  3UE5 A;  3AAR A;  4FZY A;  5EU7 A;  1NJX A;  4DSI A;  1FK9 A;  2BE2 A;  1OH6 A;  1VQ8 N;  3UIQ A;  1NWK A;  1VQL N;  1T3V A;  3ZT0 A;  2P9N A;  2E88 A;  3SJH A;  4O8U A;  4CJL A;  3RMA A;  5HRS A;  5BR9 A;  2KTQ A;  4A2B A;  3VF2 A;  4CF9 A;  2HVI A;  2GV9 A;  1TGO A;  1XUP O;  1QTM A;  3HK2 A;  3SQ4 A;  3EN9 A;  5HRO A;  2IIR A;  4IWV A;  3KK3 A;  4YDU A;  1RTH A;  3WNH A;  1O13 A;  2H3G X;  1S22 A;  4FLU A;  4DTJ A;  4B3R K;  1RT6 A;  4LF9 K;  1HKC A;  4FOE A;  2HNY A;  4CEB A;  2NRW A;  5AQL A;  4J2A A;  2IDO A;  2E1Y A;  3O3G A;  4BC4 A;  1IH7 A;  3VEO A;  2YX6 A;  1RDU A;  2QXF A;  3BF1 A;  1RNH A;  4K8X A;  4FVU A;  3U4L A;  3KZB A;  2X78 A;  1UA0 A;  3THV A;  2ZGY A;  3J80 O;  4A5B A;  4I7F A;  2RHK A;  3VGM A;  3A5L C;  4FWK A;  3ZSO A;  2P9I A;  3KVG A;  4EZ6 A;  5M1P A;  4B1W B;  3JXU A;  3KK1 A;  2XY8 A;  5BN8 A;  1HJR A;  1Q82 O;  4CEF A;  3C6H A;  1RBS A;  4C8L A;  4OJR A;  3K0S A;  5KRS A;  3CJA A;  4OKK A;  1QE1 A;  2E2O A;  4E7H A;  4PL7 A;  4E1M A;  3EE8 A;  5HP1 A;  1S9E A;  4BE1 A;  3C95 A;  3VQD A;  5FPD A;  2O8C A;  1NGE A;  4X64 K;  4IO9 L;  1NMD A;  3L2U A;  3V9W A;  5AQO A;  1WOQ A;  3O9R A;  1FW6 A;  4KHN A;  4IEE A;  4M3W A;  1RGI A;  4B08 A;  4C8O A;  4Q5V A;  3E9O A;  1VSF A;  3PV8 A;  4CGI A;  3RR8 A;  2ETJ A;  4JK8 A;  3TI0 A;  1N5Y A;  1G99 A;  3ULD A;  5BRF A;  3NF7 A;  2UU9 K;  3BZK A;  4H5W A;  3BY5 A;  1NJI O;  1WSI A;  5BRD A;  3QNN A;  5FPE A;  1RT3 A;  5E41 A;  1DKG D;  3U8X A;  3O80 A;  4JYA K;  3CCM N;  3LM2 A;  4FW1 A;  4AHS A;  2D0C A;  4I9L A;  4HTL A;  4B9Q A;  3MCA B;  5JVG L;  3N4P A;  3NF9 A;  1WAJ A;  1JCG A;  3H46 O;  1SS6 A;  4ICL A;  3TSP A;  2X6S A;  5GAE P;  4N76 A;  1DGK N;  1NM1 A;  2ZJP L;  2F7T A;  3F9K A;  1NMN A;  3MK6 A;  5BPN A;  4JKH A;  4ISE A;  5I42 A;  2XRI A;  3OHR A;  1XNR K;  1WSE A;  2FBX A;  4FLW A;  3KKR A;  4IXC A;  3NE6 A;  3F2K A;  1IO2 A;  4DG1 A;  4B9S A;  4FL9 A;  5C2D A;  5GIN A;  3L8B A;  1ZYQ A;  4CCH A;  1NK6 A;  4FJL A;  3WEE A;  4FJM A;  2CH5 A;  4CGG A;  3JS6 A;  4O4G A;  4DV1 K;  5CHI A;  3HP6 A;  2VGN A;  3PX4 A;  3DRS A;  4L3Q A;  2ASO A;  3ENB A;  4EAH D;  4B9N A;  1SL1 A;  5J2P A;  3BZC A;  3ZT3 A;  4ILG B;  4CHZ A;  1BA1 A;  4OGE A;  3DLR A;  1YVN A;  3NBP A;  4FK0 A;  3HTV A;  3DWL A;  5EX5 A;  3G0Z A;  3R8E A;  1WSJ A;  4WE1 A;  3H1Q A;  4Y0W A;  1LV5 A;  2YNI A;  2G8H A;  2YHA A;  4E89 A;  3LPT A;  3EZW A;  2YKM A;  5I3U A;  1P90 A;  3D6R A;  3LAL A;  1BUP A;  4DTP A;  3LPU A;  3C94 A;  1ZBL A;  1RT2 A;  3MXM A;  1D8Y A;  1HNW K;  1EX4 A;  4FJ8 A;  4DCH A;  1CZB A;  1T05 A;  5GAD P;  2OTJ N;  3VQA A;  1TKD A;  2KZM A;  5FRO A;  1IBK K;  4CF0 A;  3A0I X;  2ZJQ L;  4JI0 K;  2ZD1 A;  4PA1 A;  4B8A B;  4FJG A;  4DTN A;  4M3Y A;  3U6F A;  4M3U A;  3LDP A;  4FM1 A;  1IBM K;  3AGK A;  4AHR A;  3ENH A;  3GL1 A;  3QBW A;  2KFN A;  5CY4 A;  1DTQ A;  2B6A A;  4MQ3 A;  4BRD A;  5A2Q O;  4BR2 A;  3CM6 A;  2YI1 A;  3CMA N;  4CEQ A;  3EEQ A;  3FR0 A;  5C10 A;  4UQG A;  3VA3 A;  5C15 A;  5HL7 L;  4A2A A;  4FWM A;  1K73 O;  4JI3 K;  3OYD A;  3AY9 A;  2VCP A; 
#chains in the Genus database with same CATH homology
 3NMU A;  3AAP A;  3VEZ A;  4I6M A;  4U7B A;  1Y64 A;  2JWK A;  4IZ9 A;  1Q7Y O;  3MN6 A;  5JVH L;  2QWP A;  2F9T A;  3D2E A;  1QZ6 A;  3P38 A;  3OBW A;  3QDK A;  5BN9 A;  3UKU A;  3WT0 A;  4QS8 A;  2QWO A;  3VEV A;  4A59 A;  3QFP A;  3FFK B;  4B1Z A;  3C0B A;  1J6Z A;  3E9L A;  5AQP A;  4FWL A;  3ID8 A;  4BRH A;  1QVF M;  3MX2 A;  4IO8 A;  5GAH P;  3N4Q A;  2NZT A;  5JIC A;  4H0P A;  2Q36 A;  4B1V A;  1ESV A;  1YHQ N;  3MWP A;  5AQG A;  3ZET B;  2QXL A;  4IJA A;  4BRC A;  3PIO L;  3FZM A;  4CZI A;  4JKA A;  1JCF A;  3CCJ N;  2YHX A;  4KH5 A;  2PAV A;  5AQU A;  4AM6 A;  3CJB A;  1BA0 A;  3I56 N;  1WUA A;  1IG8 A;  4BG8 A;  2ZJR L;  3QIC A;  2HF3 A;  2YHW A;  4JN4 A;  1VQN N;  1MWM A;  2FXU A;  3SBG A;  1IJJ A;  5AFU H;  1BG3 A;  1K8K B;  2QWL A;  3TTF A;  1ATR A;  2CGK A;  3EKS A;  3RSE B;  3ZX2 A;  4GV6 A;  3O6W A;  2Q0R A;  4YOT A;  3IFR A;  1KAZ A;  3E9P A;  1GLB G;  5KQ8 A;  5E84 A;  1U2V A;  2WUS A;  5LY3 A;  3DXK B;  3R3L A;  4JKG A;  5C0Y A;  1Z6R A;  3CCS N;  4FO0 A;  3DJC A;  1YJ9 N;  3CHW A;  3Q7C A;  2YJE A;  5AZI B;  4WCE L;  3EKU A;  5MLC Q;  3CPW M;  3B8A X;  3ZYY X;  4CZE A;  2WC9 A;  4H5N A;  3PLA A;  3KHY A;  3SBT A;  3VEW A;  5AQH A;  2HBK A;  2ZWH A;  3J8A A;  2CGJ A;  4M7Y A;  1X3N A;  3LDO A;  3S41 A;  2P9P A;  3GG4 A;  3M5R A;  4IDH A;  1NBW A;  2NRH A;  4JKB A;  3NVM A;  3C6A A;  3ID6 A;  3LDL A;  4YOU A;  5BPM A;  1M1K O;  3WXL A;  2QWN A;  3VET A;  2D0O A;  3WEE B;  1VQ6 N;  2IVP A;  5E26 A;  1NGC A;  1T6C A;  5AQF A;  1VQK N;  5KPT A;  2P9S A;  4ILH A;  5LJV A;  3VTI A;  2GX9 A;  1RFQ A;  2KLA A;  4BRM A;  1DEJ A;  1ATS A;  3U9Z A;  4DB3 A;  2ZF5 O;  1NGI A;  2E2P A;  3A5M C;  3I33 A;  5AQJ A;  3VER A;  5KPR A;  4K25 A;  3DAW A;  1TYQ B;  3Q7B A;  1TUY A;  3GDQ A;  5AR0 A;  3T7Z A;  2Q97 A;  3ULE A;  1JJ2 M;  5JMV A;  5BRH A;  3CCQ N;  5GAG P;  5AZJ B;  3FE1 A;  3H3N O;  1P8Z A;  4BRF A;  4EHT A;  3WQU A;  3HOS A;  4BRE A;  1YAG A;  3WXJ A;  1KD1 O;  3D2F A;  3BEX A;  5JLF A;  2P9I B;  4A5A A;  2QTD A;  4G9Z A;  2Q0U A;  1W97 L;  4RCH A;  4EIA A;  3VF6 A;  4DQ8 A;  3ZX0 A;  2FSN A;  1CZA N;  4BRN A;  2HMP A;  3IKM A;  4WFB L;  2D1K A;  4YDU C;  4WFN L;  1ATN A;  2P9L A;  2I7N A;  2P9U A;  5AQV A;  4CZM A;  3G71 N;  4JHD B;  5EVZ A;  4U67 L;  3EO3 A;  3CC2 N;  2ASP A;  2V7Y A;  2ZGZ A;  3CCE N;  4IEI A;  2GTD A;  2WBN A;  2A3Z A;  3SMS A;  2E2Q A;  4H0O A;  3F5T A;  5EY4 A;  3OA9 A;  1YJW N;  1N8R O;  3MN7 A;  3CF5 L;  3VEN A;  3O9S A;  3HOT A;  3VGL A;  4JKF A;  4GNI A;  1E4F T;  3IDH A;  3DLL L;  3L4Q A;  5AQN A;  2A40 A;  5C12 A;  1QVG M;  3WXM B;  1LCU A;  1GLA G;  4YOX A;  4H0V B;  4JD2 A;  3MDQ A;  2DPN A;  4EFH A;  3CME N;  3TU5 A;  3ZEU A;  1NLV A;  1QQO A;  3EE9 A;  4LC9 B;  2CGL A;  4MLE A;  2QI2 A;  2QWR A;  4O8K A;  3CCV N;  1GLF O;  4KH4 A;  2GWK A;  4CZH A;  3KK7 A;  1MWK A;  1GLJ O;  3P39 A;  2GWJ A;  4JAX A;  4FPB A;  3CJ1 A;  2NRR A;  2QWQ A;  3ATV A;  3SK3 A;  4WF9 L;  4R79 A;  1QQN A;  4FPA A;  4BGA A;  1U6Z A;  1YXQ A;  4IJN A;  2VGM A;  3VEY A;  2NRT A;  1LOT B;  1SAZ A;  4YOR A;  4CZF A;  3O1B A;  4PL8 A;  1K9M O;  3DXM B;  3W3D A;  4FWQ A;  4K42 A;  3TSU A;  4FWN A;  3CCL N;  4H0X B;  4M63 C;  5LJW A;  4JNE A;  1C0G A;  4I6M B;  4BR7 A;  5B8H A;  4JEP A;  4BR5 A;  1KQS M;  1NGH A;  3WUH A;  2YCH A;  4JKE A;  4OO1 J;  4CD1 A;  4FWR A;  2NLX A;  1ZBS A;  2HBJ A;  3BF3 A;  3D2E B;  4PKH A;  2VYP A;  3ENO A;  4PKG A;  2RE2 A;  4XH4 A;  3UKU B;  4CBW A;  2V52 B;  1YIJ N;  4WYB A;  4BC5 A;  1K8K A;  3L4I A;  3O9Q A;  3AAR A;  3UE5 A;  2A42 A;  4FWS A;  4BRP A;  5C2F A;  4JK9 A;  3LM9 A;  1VQ8 N;  2IVO A;  1NWK A;  1VQL N;  5AQK A;  1T3V A;  1Q18 A;  3FZH A;  3M1F A;  2P9N A;  2E88 A;  1KAY A;  4CZG A;  3SJH A;  2QM1 A;  3A5O C;  3QBX A;  3C7N B;  4O8U A;  4O5F A;  4CBX A;  5BR9 A;  3SAH A;  5CR4 A;  5AQS A;  1Q81 O;  3VMF B;  3VF2 A;  4A2B A;  1VQ9 N;  2OTL N;  1M90 O;  4GY2 B;  3BUZ B;  4EHU A;  3QML A;  3FZL A;  4KBO A;  3RVC A;  4CJ7 A;  1XQS C;  3NVK A;  3CCR N;  1SZ2 A;  1XUP O;  5F2R A;  1JCE A;  3H1V X;  3O8M A;  3GBT A;  5H1S Q;  2HBM A;  2PBD A;  4B1X B;  3EN9 A;  3MN9 A;  2KHO A;  4XEI A;  4MDB A;  4H5R A;  2IIR A;  4IWV A;  4DKW A;  1VAZ A;  4YDU A;  4XH1 A;  2A6A A;  1U2V B;  4J8F A;  5AQY A;  2H3G X;  1O13 A;  1S22 A;  1V4S A;  1BDG A;  1GLL O;  3O4W A;  3MWT A;  4QS7 A;  1Z05 A;  3ATU A;  1HKC A;  4FOE A;  1YIT N;  3KWG A;  2NRW A;  5AQL A;  5ADX A;  2P9K A;  2E1Y A;  4BC3 A;  3FLC O;  3H45 C;  4BC4 A;  3VEO A;  2YX6 A;  2W40 A;  2Q1N A;  3R9P A;  1RDU A;  4ISF A;  3SMP A;  3UKR A;  3LL3 A;  3SAF A;  1T44 A;  1GLC G;  3BF1 A;  3G4S N;  1DT9 A;  4FVU A;  1TYQ A;  3U4L A;  3KZB A;  3IUC A;  3R6M A;  2HF4 A;  1KAX A;  3O5B A;  5TKW A;  5BPL A;  2ZGY A;  3I55 N;  4A5B A;  3T69 A;  4AF1 A;  5AZJ A;  4UY8 O;  2RHK A;  1RDW X;  4JKD A;  3TSQ A;  4JK7 A;  3A5L C;  4FWK A;  3VGM A;  2IVN A;  2E20 A;  3CXC M;  1KC8 O;  1HX1 A;  2P9I A;  2P9S B;  4RWT A;  3KVG A;  3A5N C;  5M1P A;  5M1Q A;  3JXU A;  1X3M A;  4B1Y B;  4B1W B;  4BR4 A;  2KKZ A;  5AQZ A;  5BN8 A;  3FGU A;  3CQX A;  1Q82 O;  4BQL A;  4BRK A;  3UB5 A;  4CZJ A;  4XH5 A;  3C6H A;  2YJF A;  2NRZ A;  1HKG A;  3CJA A;  4H5T A;  4JHD A;  5AQM A;  2E2O A;  3TPQ A;  4PL7 A;  4BG9 A;  1ILY A;  2ITM A;  3EE8 A;  4MO4 A;  2J4R A;  2GUP A;  2YHY A;  4WQ5 C;  1VQ5 N;  4IFE A;  5FPD A;  3LDQ A;  4FSV A;  5F1X A;  1VQ7 N;  1C0F A;  1NGE A;  1D4X A;  4DHY A;  3SLC A;  3VOV A;  4YOW A;  1HLU A;  4PKI A;  2Q2R A;  4IO9 L;  2P9L B;  3HM8 A;  2CH6 A;  2VWB A;  1NMD A;  2E8A A;  3CER A;  5AQO A;  5JLH A;  1WOQ A;  2BTF A;  4BC2 A;  3MMV A;  3O9R A;  5AQW A;  5ADX H;  4FWP A;  4BR9 A;  2V51 B;  5KQD A;  4IEE A;  1ZXO A;  1RGI A;  4QS9 A;  3G25 A;  4IOC L;  2WFB A;  3HSC A;  2BUP A;  4A61 A;  3E9O A;  4E1J A;  1EQY A;  4IOX A;  4JK8 A;  5KPZ A;  3D7E O;  1G99 A;  4H0T B;  2Q31 A;  1NGD A;  3O9T A;  4CD3 A;  5BRF A;  2E1Z A;  2QW9 A;  3OBY A;  4H5W A;  4JKC A;  1NJI O;  3CCU N;  3VGK A;  4BGB A;  5AQR A;  5BRD A;  4JD2 B;  4K43 A;  3WXK A;  5FPE A;  1DKG D;  3U8X A;  1Q86 O;  4C1N K;  3O80 A;  5DM7 L;  1QQM A;  3LM2 A;  2W41 A;  4NLC A;  5AQT A;  4F9O A;  3ZET A;  4YOY A;  2D4W A;  3CCM N;  1YJN N;  3TTD A;  3L0Q A;  3K9J A;  3CPE A;  3TTC A;  3H3O B;  4HTL A;  1VQP N;  3H6E A;  4B9Q A;  2HST A;  4BRG A;  3MCA B;  5JVG L;  3N4P A;  4Z94 A;  4C1N I;  3CD6 N;  2QA4 N;  5GIO A;  1QHA A;  5AQQ A;  3PIP L;  2I7P A;  1HJO A;  1JCG A;  3H46 O;  1SS6 A;  3TSP A;  3RSE A;  5DM6 L;  5GAE P;  3QFU A;  1GLD G;  2FSK A;  1DGK N;  2BH1 A;  3CIP A;  1NM1 A;  1V4T A;  5AQI A;  2ZJP L;  2F7T A;  1BO5 O;  3MN5 A;  3MK6 A;  1NGG A;  3DXK A;  4GVE A;  5BPN A;  2NRV A;  4JKH A;  3MCP A;  4ISE A;  4HWI A;  3C7N A;  1NGF A;  1GLE G;  3OHR A;  1S3X A;  3E1Y A;  5FPN A;  5AZI A;  4KH6 A;  4OPA A;  4CZK A;  3GE1 A;  2FSJ A;  1HUX A;  2AP1 A;  4IXC A;  1VQM N;  3M6G A;  3IMX A;  4WQ4 C;  3GOI A;  3F2K A;  1T6D A;  4NB4 A;  5AQX A;  4CI6 A;  1KXP A;  1X9J A;  2NNW A;  3MX5 A;  2AA4 A;  1YUW A;  2OAN A;  1H1V A;  4FL9 A;  4A62 A;  5C2D A;  5GIN A;  3CC7 N;  1OVY A;  2P9N B;  4JKG B;  4CZL A;  2V7Z A;  3WEE A;  3CC4 N;  3CI5 A;  5M1F A;  4FWO A;  3FZK A;  1YF5 L;  2A5X A;  3HRG A;  2CH5 A;  4ISG A;  1QZ5 A;  3JS6 A;  3U9D A;  4GV3 A;  5BRE A;  5CHI A;  4BRQ A;  4OPH A;  4WFA L;  3VTH A;  3CJC A;  4WQ5 A;  4GV9 A;  4IOA L;  2VGN A;  4ILJ A;  1TUU A;  3AGR A;  3FZF A;  4L3Q A;  5TKY A;  4BY9 C;  2ASO A;  3ENB A;  4EAH D;  2FF3 B;  3QB0 A;  4PHT X;  1MDU B;  2P9P B;  1NGB A;  4H03 B;  3C65 A;  5CE3 A;  3K9K A;  3E66 A;  4K41 A;  5HOO A;  2NRX A;  4ILG B;  1BA1 A;  5EXW A;  2ASM A;  4H0Y B;  2EWS A;  5GIP A;  4YOV A;  3VF4 A;  1NGA A;  3CJ7 A;  4NO7 A;  2QEX N;  1YVN A;  3O1W A;  1BOT O;  2HOE A;  3KWI A;  1ZC6 A;  3VPZ A;  1VQO N;  3HTV A;  3DWL A;  3EL2 A;  3P31 A;  4FOI A;  5EX5 A;  3R8E A;  4BRL A;  2F9W A;  2P9K B;  3H1Q A;  4Y0W A;  1E4G T;  3VES A;  4RTF D;  4BVO A;  3UKR B;  4BRA A;  1S72 N;  5EOY A;  3A8Y A;  3L6Q A;  1HKB A;  5I9E B;  3EZW A;  2GEM A;  3ULE B;  1P90 A;  3D6R A;  4H5V A;  4BRO A;  1BUP A;  3CJ9 A;  2FLO A;  5F0X A;  4C23 A;  3W0L A;  2UYT A;  5ELZ A;  3D2F B;  3M3Z A;  1SQK A;  1K8A O;  4DCH A;  3HI0 A;  5M1K A;  3SAG A;  4BRI A;  2PFU A;  5GAD P;  2OTJ N;  4BVP A;  2HBL A;  1BU6 O;  3P4I A;  3O9U A;  5M1O A;  1R59 O;  2FF6 A;  2JWL A;  4B1U B;  3CET A;  2A41 A;  1YI2 N;  2P9U B;  3J7Z O;  3A0I X;  1HPM A;  4MO5 A;  4CBU A;  2ZJQ L;  2GEL A;  1EO1 A;  3OW2 M;  4AM7 A;  4M7X A;  3BP8 A;  5FPM A;  3I8B A;  3CQY A;  3O08 A;  5AFU A;  3LDP A;  4MLH A;  3AAQ A;  3AGK A;  2QWM A;  4BR0 A;  3G6E N;  3ENH A;  1NGJ A;  3GL1 A;  3QBW A;  4NLB A;  3ZX3 A;  3WXI A;  4BRD A;  4BR2 A;  3R1X A;  4BQZ A;  1OKJ A;  4MDA A;  1VQ4 N;  3WQT A;  2YI1 A;  5M1N A;  3CMA N;  2D0P A;  3FR0 A;  5C10 A;  1W2B M;  1MA9 B;  5C15 A;  3HZ6 A;  5HL7 L;  4A2A A;  3VEX A;  3HBT A;  3LDN A;  1XC3 A;  4A57 A;  1BWF O;  4FWM A;  1K73 O;  2E2N A;  3DXM A;  3F9M A;  3ZEU B;  4WQ4 A;  3AY9 A;  2VCP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...