3V9WA

Crystal structure of rnase t in complex with a preferred ssdna (tta) with two mg in the active site
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
202
structure length
202
Chain Sequence
GLCDRFRGFYPVVIDVETAGFNAKTDALLEIAAITLKMDEQGWLMPDTTLHFHVEPFVGANLQPEALAFNGIDPNDPDRGAVSGYEALHEIFKVVRKGIKASGCNRAIMVAHNANFDHSFMMAAAERASLKRNPFHPFATFDTAALAGLALGQTVLSKACQTAGMDFDSTQAHSALYDTERTAVLFCEIVNRWKRLGGWPLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/dna
molecule keywords Ribonuclease T
publication title How an exonuclease decides where to stop in trimming of nucleic acids: crystal structures of RNase T-product complexes
pubmed doi rcsb
source organism Escherichia coli
total genus 59
structure length 202
sequence length 202
chains with identical sequence B, C, D
ec nomenclature ec 3.1.13.-:
pdb deposition date 2011-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00929 RNase_T Exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3v9wA00
4H4MA 3OS1A 3QO9A 3QEWA 1IG9A 1JLEA 1GOCA 1LWFA 4TSXA 1TL1A 4DQPA 4C8MA 4FJHA 1ZBIA 1NOYA 3MXJA 1VRUA 3HVRA 1HNIA 1RTJA 4AILC 4FLTA 1L3TA 3DLKA 4DQQA 4F4KA 2YKNA 1T8EA 1VSLA 4LSNA 2OPQA 3DLHA 2KTQA 2WOMA 1C0MA 4DS4A 4FJ5A 3ZT4A 5C42A 2D0BA 2E6MA 3VQPA 4DSFA 2ZD1A 5HLFA 1J5OA 4BE1A 4HTUA 4CERA 1CZBA 2OPSA 3WNGA 4ZTFA 2X6SA 3OYFA 4KHNA 4B8AB 3AVHA 3QIPA 3SUNA 3LP2A 3LAKA 4CHYA 4KHQA 2IAJA 4W5QA 1KLNA 2IC3A 4ZHRA 2KFNA 3TANA 3FFIA 4KI4A 4KREA 4B8CA 1LWCA 3NDKA 2G8HA 1C1BA 4JLHA 3NH0A 3F9KA 3AVJA 3HL8A 3QEPA 2BGGA 3OYDA 2KQ2A 2BE2A 4IKFA 5I3UA 3RRHA 1D5AA 2A1SA 1IKYA 1ZBUA 1KVAA 2G8FA 3NHGA 1WSFA 4CECA 3NF7A 4N41A 4B9VA 2HW3A 4RG8A 3G0ZA 4LH4A 4DQIA 3OYNA 1JLAA 1RT2A 4IG3A 5CZ2A 3RR7A 1VSHA 2P1JA 3HO1A 3OY9A 3NAEA 1UA0A 3AVLA 3MXIA 1N6QA 4CHPA 3KLGA 4DTPA 4CF0A 1QSSA 3AVKA 4NCAA 1RTHA 1U49A 1SV5A 3KD5E 4CHOA 4PWDA 4LSLA 2X78A 1RNHA 4B3OA 2EX3A 4DTNA 2KFZA 4DFMA 3ZSOA 4HUGA 3CM6A 3I8DA 4FLYA 1XHZA 1X9MA 1L3VA 1BGXT 4KB1A 4BE2A 3SQ0A 4FK0A 3TARA 2FC0A 4CFDA 5J1EA 3RRGA 3OYCA 3JYTA 4CFBA 4E7LA 1QE1A 4DFKA 4BWMA 1IKVA 4CK1A 2HHQA 2BDPA 4RW9A 4CJ4A 3DRPA 4OKKA 5I42A 1J53A 4J2AA 4FM1A 2WONA 3VN5A 4AHUA 2P5GA 4FJXA 2RKIA 3K5LA 1JL1A 3TWHA 3QNNA 5HP1A 1QSLA 2Q3SA 5K14A 2IGIA 4H8KA 3SZ2A 3MECA 3I0SA 4KHWA 3KLHA 4M3TA 3KD1E 2R7YA 1RDBA 2DY4A 5JS1A 4W5OA 3C94A 4E19A 3VA0A 3LDSA 4KTQA 4CFCA 1WSGA 1WSJA 1KVBA 3HPGA 4CJVA 4OLAA 1NJWA 1TK8A 4HCCA 4IG0A 1ASWA 4CHQA 2KW4A 1UOCA 2ZQBA 3HVTA 1X9SA 1Q9XA 4I9LA 3OYHA 1B9DA 3ISNC 4JS4A 3M8QA 4DS5A 2GUIA 3PV8A 1GOAA 2G8IA 3JSMA 1U04A 5HROA 1EETA 4J2DA 2PYLA 4CF1A 1TKZA 2VG7A 3VQAA 4B9LA 3AVFA 3LZIA 4LD0A 3P83D 1ASUA 1WNSA 3T1AA 4CE9A 4JS5A 1RCHA 3OS0A 4E7HA 2HMIA 4E89A 4KB0A 3NFAA 3SUPA 1WSEA 4M3UA 3DLRA 3AVAA 5HRPA 4BACA 4DTSA 3HXMA 1C1CA 1JKHA 2XY8A 4OJRA 1TV6A 1VSFA 3LWLA 4KHUA 1A5XA 3HYFA 3V9UA 1B9FA 3HT3A 3KLIA 3DLEA 2Z1JA 1LW0A 5J2NA 3T3FA 2HNYA 2RF2A 1XWLA 3G10A 3LANA 4DF4A 3RR8A 4KPYA 3ULDA 3L2VA 2RN2A 4CGIA 4B9NA 1ZBFA 4M45A 3ZCMA 4FW2A 3NH1A 4CHZA 1WAJA 3VQCA 4CGHA 5J2MA 4QOZB 4Q0BA 2ZE2A 2HVHA 3AVCA 1KSPA 5CYQA 4GW6A 1DTTA 2E4LA 5KRTA 4Z4FA 3PX6A 4N5SA 4CGDA 4KHYA 1SL0A 1HJRA 4Z4EA 4Z4GA 4KI6A 4GVMA 1JLBA 1S1XA 2QK9A 3KKSA 4IFVA 3AO4A 1BQMA 1TK0A 4CCHA 4F2SA 4FM2A 4PY5A 2AJQA 2FBTA 4IFYA 3ZSXA 1G15A 2W42A 4DSJA 4N76A 4B9MA 1WN7A 4DSEA 3PX0A 1R0AA 3ZSVA 2P5OA 5D3GA 1U4BA 1F21A 3ALYA 4CJTA 4O55A 1RBRA 1QHTA 3AVNA 4BWJA 3HSTB 4FVMA 5JS2A 1JXEA 4N47A 3KLEA 1HPZA 3KK2A 1SKSA 1L3UA 2B6AA 1UWBA 3B6OA 4FJNA 1N5YA 3VQ8A 4KRFA 3LWMA 5C24A 4CEAA 4HVJA 3OVNA 5EU7A 2HHUA 1LWEA 2O4GA 2YNIA 4Y1DA 4W5TA 4L8RB 4FJGA 4FJKA 2HHTA 4CEBA 1EP4A 4HCBA 4QCLA 2B4JA 1VSDA 2B5JA 1IO2A 3LAMA 4M3YA 2D0CA 3O3FA 1LV5A 1W9HA 3NGZA 3TAPA 2NUBA 3SV3A 3HJFA 3MEGA 3SQ4A 1C1AA 3KK3A 1QSYA 3AVMA 3P1GA 4O4GA 3HPOA 1TL3A 3CG7A 4FJMA 4CJKA 1RT6A 3SCXA 3CM5A 1KLMA 3ZT3A 4CIFA 4CHNA 3AVGA 3L2WA 4DTMA 3U3YA 3PY8A 4ELUA 3TR8A 4E7IA 1T05A 4B9SA 4NYFA 3H08A 4ID1A 2EHGA 1HNVA 3ZSRA 5SWMA 4HHTA 4HUFA 4PUOA 4M42A 1X9WA 2F96A 1RTIA 3S3NA 4CEEA 3CYMA 4FCYA 1TVRA 4OKJA 3SJJA 3S3MA 3V1QA 1U45A 4NCBA 3VQ4A 2KZZA 1SL2A 4ICLA 4KTWA 3D45A 2YHBA 4RW4A 1MU2A 3DM2A 4FLWA 3QEIA 4AHRA 3RMDA 4PQUA 1HQUA 4FLZA 3V9SA 1S6PA 2PY5A 1NK0A 1NKEA 4DLEA 1NK5A 3L2UA 5FDLA 1FK9A 1REVA 3KIOA 4CGGA 4CJUA 3AA3A 3AVIA 3LPUA 4DMNA 1SKWA 4J2EA 1YTAA 2Z1GA 4OPKA 1BCOA 4CEZA 1T03A 1NK9A 3K57A 4DU3A 4BDYA 1D8YA 4CJWA 1BL3A 1I3AA 4DTRA 2ATQA 3C6TA 4Z4IA 1ITGA 1RDCA 2FBXA 4CJSA 5SZTA 1RT7A 3L3UA 4AHVA 3OS2A 1IH7A 4E7JA 1VSKA 5KTQA 3O3HA 1KTQA 2Y1IA 2OYQA 4K8XA 2Y1JA 2JLEA 1CXUA 1VK0A 3AVBA 3RWUA 1A5WA 3V9WA 3ZT2A 4HUEA 3TAGA 3IS9A 3BGRA 3AO1A 4CF8A 3IRXA 3OYMA 4E0DA 1S6QA 4CJLA 4OKEA 1XHXA 4CJFA 4Z0UA 4DU4A 2VG5A 3O4NA 2FBVA 1W0HA 1NOZA 2DTUA 1QS4A 2XY7A 3OYIA 3U3GA 2XY5A 1WLJA 3LP1A 4BDPA 2DFHA 4CGFA 1RBVA 1C0TA 1DTQA 2YHAA 1VSEA 3NE6A 3E01A 1RT5A 2VWKA 4CJQA 5HRRA 3NH2A 5KRSA 1C6VA 4M3RA 4KAZA 3MEEA 3P5JA 4W5NA 3B6PA 3A2FA 3SPYA 2GBZA 4F3TA 3LALA 3OYBA 1TGOA 1NJYA 1ZYQA 3OYLA 3F73A 3SV4A 2ETJA 1HYZA 1S9EA 4AHSA 1Z25A 3ZSZA 4ZTJA 4CF9A 3QEVA 4EP4A 3M8PA 1L5UA 1QTMA 3TI0A 3LZJA 3L2QA 4DLGA 4R5PA 2P51A 5FRNA 4FJ9A 3SPZA 3VQQA 2XO7A 1D9DA 1KFSA 3QIOA 4C8KA 2OPPA 2QXFA 1Q9YA 1D9FA 3K59A 1S5JA 2VG6A 3NF8A 4OLBA 2D5RA 3V1OA 3TAEA 1HRHA 1IKXA 3TAFA 2BANA 3L3VA 4FK2A 3V4IA 1GOBA 3V9XA 3TABA 3ITHA 4E3SA 4FJIA 1O1WA 1U48A 4CEQA 3KTQA 1NK8A 3OYEA 4MFBA 2XHBA 1XC9A 1BQNA 3LP0A 1RILA 1CXQA 3BDPA 4UQGA 4CF2A 4CIEA 1ZBHA 5E41A 4GMJB 3ZT1A 4EZ9A 4CEFA 2JGUA 3NGIA 3DOKA 2QKBA 2Z1IA 4FJ7A 3WNFA 1EX4A 4DF8A 3U6FA 1UA1A 2DFEA 1JL2A 4ID5A 2G8WA 1RT4A 3DRRA 4ELTA 1J9AA 3WNEA 1X1PA 2FBYA 1VSJA 3C6UA 5KI6A 3I0RA 4FW1A 1EKEA 3VQEA 5HRNA 1RDAA 1WAFA 4B9TA 1SUQA 5C25A 1NKCA 1BIUA 5KGXA 2HHXA 2YV0X 3VQ7A 4BDZA 4RW6A 2IOCA 4H4OA 3TAQA 4F8RA 3IG1A 2GV9A 3EYZA 3ZSWA 4O44A 2HB5A 4AHTA 1TKXA 2YNFA 3HPHA 4G1QA 1NK7A 3AA5X 3OJUA 4CJPA 4ELVA 3IAYA 1CZ9A 1RBSA 3NF9A 1VSMA 3OJSA 1QQCA 3K58A 4FLVA 3QERA 2OPRA 3RMBA 4DSKA 1BISA 1S1VA 4IDKA 3K5NA 4FM0A 1JLGA 2ITGA 3NGYA 4LY7A 4BE0A 4CK2A 4JRPA 2XRIA 4CK3A 4DTUA 2F8TA 3MXMA 3VQDA 1NJXA 3RTVA 2VWJA 1FKPA 4DQSA 1WSIA 1BCMA 3M8SA 3MAQA 4Z4CA 3DMJA 2YKMA 2Z1HA 1U47A 4I9QA 1B92A 4E1MA 2E6LA 5FROA 3T19A 3HP9A 4KHSA 1ASVA 1RT3A 4OGEA 3QNOA 3HK2A 2OZSA 4I7FA 1KFDA 1S9GA 3CQ8A 4DFPA 2HHSA 1BHLA 3CFOA 1RTDA 1J54A 4RW7A 1T7PA 2PYJA 1Q8IA 1NK4A 3NCIA 1NKBA 3UIQA 4M41A 5DK5A 3DLGA 4I2PA 4M3ZA 1HMVA 2X6NA 4B08A 3OYKA 3VQ5A 4B9UA 4FXDA 3KLFA 4M3WA 4O5BA 1LAWA 3AV9A 5HRSA 4C8NA 3S9HA 4OPJA 4DTXA 3AA2A 4JRQA 4DSLA 4KFBA 1WSHA 3V6DA 3PO4A 3ZSYA 4M3XA 4CJRA 4FK4A 1HQEA 4FZZA 3DYAA 2HNZA 2IDOA 5DMRA 4E1NA 3QEXA 4FJJA 1TAUA 2OA8A 3AA4A 3DLBA 4FZXC 5CYMA 4CIGA 3D0PA 3SUOA 4XIUA 3K2PA 3HM9A 3SI6A 3DOLA 4Z4HA 3SQ2A 3SUQA 1BI4B 3NBPA 3QINA 1BI4A 3VQBA 4CJ5A 3VQ6A 2I5JA 4CEDA 4KV8A 3CFRA 4E7KA 3OYGA 4N56A 4DTJA 1SKRA 3S3OA 4FJ8A 2A1RA 1DLOA 1S1UA 3EY1A 4DQRA 4DFJA 2O4IA 2G8UA 2D0AA 3PO5A 4KO0A 3V9ZA 1Z26A 3VA3A 3THVA 2X74A 4W5RA 3HP6A 3L8BA 1SL1A 4FLUA 1A5VA 1KRPA 3OYAA 4KKOA 2HHVA 4CEOA 3K5MA 1IKWA 3EZ5A 2HHWA 1I39A 4PA1A 3QESA 2RPIA 1HYVA 4RW8A 3KK1A 1TK5A 2OZMA 4F3OA 3C95A 2XY6A 3RMAA 3DI6A 2IS3A 5T7BA 4O0JA 4MQ3A 2KZMA 3ZSQA 1RT1A 3PUFA 4DTOA 4QAGA 1S1WA 1XI1A 2HNDA 3AO2A 4NCGA 1C0UA 3QLHA 3LPTA 3K5OA 4Q5VA 4CGJA 3RMCA 3M8RA 2G8VA 4FYDA 5CZ1A 3VQ9A 4DSIA 1JXBA 2G8KA 3SYZA 4FJLA 2YNHA 1ZBLA 3OYJA 5FRMA 3KKRA 4C8LA 4DWIA 3L2RA 3CFPA 1TKDA 3O4QA 2LSNA 4AH9A 3PX4A 4NYNA 3SNNA 1CLQA 4F2RA 1YVUA 1FKOA 4IBNA 3MEDA 1EXQA 1JLQA 1VSIA 1JLFA 1KVCA 4OVLA 2DFFA 1TKTA 3V81A 1JLCA 1RBUA 1S1TA 5J2QA 4OGCA 1L3SA 2QKKA 4CJ3A 1YT3A 3ZT0A 4K8ZA 4EZ6A 4YNQA 4CJEA 2HVIA 1LW2A 1BIZA 3QETA 4CESA 1KCFA 4FZYA 3TAMA 4DU1A 4CFAA 4DG1A 3DRSA 3LP3A 4YFUA 2YNGA 1VRTA 3WNHA 1TAQA 5KGWA 4LH5A 4EP5A 4I2QA 2PZSA 3NF6A 4KTZA 1RDDA 4Y1CA 3V1RA 1LAVA 1NJZA 5CY4A 1UAXA 3O3GA 5HBMA 4C8OA 4J2BA 5J2PA 2F8SA 4AHCA 4O0IA 1YTUA 1NK6A 3AO3A 3AO5A 1HYSA 1Y97A 3KJVA 4FLXA 1RBTA 4WE1A 1K6YA 3SQ1A 1FXXA 3ASMA
chains in the Genus database with same CATH superfamily
4H4MA 3OS1A 1GOCA 4B1VA 4FJHA 1L3TA 3DLKA 4LSNA 2WOMA 2E6MA 3SMSA 4DSFA 2ZD1A 5JVGL 3WNGA 4ZTFA 2X6SA 5C0YA 2ZJQL 4ILGB 4KHQA 1KLNA 2IC3A 3DLLL 4JV5K 3ID6A 3ZETB 5M1FA 1ATRA 2Q0UA 2HF3A 1LWCA 4RCHA 5LJVA 2DPNA 3MDQA 1QZ5A 2OCEA 4JLHA 2BGGA 1NMDA 1IKYA 1KVAA 4B9VA 2HBMA 2HW3A 3G0ZA 2E88A 3RR7A 4K0KK 3MXIA 4JHDA 4CHPA 4FWPA 5BR8K 1N6QA 3AVKA 1SV5A 2P9LB 3KD5E 4BC5A 2EX3A 4DTNA 2KFZA 4LF8K 3SBTA 3CM6A 1XHZA 2O8BA 4CD1A 1NNEA 4FK0A 3AY9A 5J1EA 3FZHA 4FVUA 5GAHP 3CIPA 4E7LA 3CJBA 3HM8A 1NLVA 4IJAA 3J80O 4DFKA 2NRTA 3G25A 5I42A 4J2AA 4DQ8A 2RKIA 5HP1A 2UUBK 2Q3SA 3VF2A 5JS1A 3C94A 4BVOA 4CFCA 4CJVA 3RSEA 4HCCA 3OYHA 3PV8A 2GUIA 3EKUA 3H1QA 5HROA 1EETA 3BUZB 3VQAA 3OHRA 1NM1A 3LZIA 4CE9A 4E7HA 4B9QA 2HMIA 4E89A 4KB0A 3NFAA 2ASOA 3DLRA 1JKHA 2XY8A 1TV6A 2IIRA 5AQRA 4CJ7A 2PBDA 4DB3A 3VF6A 1A5XA 4AQYK 4L3QA 1JCFA 3HT3A 2QWNA 3O9RA 3KVGA 4BRMA 3DLEA 1LW0A 5J2NA 4V19S 3T3FA 2HNYA 3LANA 2BTFA 4KPYA 3EE8A 5BRFA 1M90O 3L2VA 2RN2A 3G71N 4CZMA 3NH1A 4CHZA 4H0TB 1IBLK 4IO9L 5EXWA 2E4LA 4NXNK 4Z4GA 1JLBA 1KXPA 3KKSA 3TSUA 3DJCA 3W0LA 4MLHA 5C2DA 2W42A 4DSJA 1WN7A 2P5OA 1U4BA 1QHAA 3CHWA 4O55A 1RBRA 5BRHA 1QHTA 4CZGA 2P9NB 1HPZA 3DXMA 1L3UA 1UWBA 4DR6K 5C24A 4B1UB 1LWEA 2O4GA 5E84A 4A5AA 2D0PA 4JI4K 1YIJN 4BRHA 4JD2B 4QCLA 5GIOA 2B5JA 3ULEB 1IO2A 3LAMA 3U9DA 1LV5A 1NGEA 3NGZA 3TAPA 1BDGA 3SQ4A 1C1AA 1QSYA 3AVMA 2HBLA 3UE5A 3HPOA 1TL3A 4JKFA 5BPMA 3IKMA 1KLMA 3AVGA 3EZWA 3PY8A 3D2FA 5KQDA 3ZSRA 5SWMA 2RHKA 4H5RA 3M1FA 5DM7L 3CJ1A 2F7TA 4CEEA 2NRWA 4FCYA 5GINA 3THWB 4BQLA 2Q36A 3FFKB 3K9JA 4RW4A 5C15A 2P9PA 4FLWA 3QEIA 4AHRA 4PQUA 4FLZA 1S6PA 1NK0A 4DLEA 1NK5A 3L2UA 4CZLA 3KIOA 4BY9C 3AA3A 4CEZA 1P8ZA 1D8YA 4JI7K 1I3AA 5AQTA 2ATQA 3L3UA 3O3HA 1CXUA 1VK0A 1A5WA 1V4SA 3G6EN 3IRXA 1S6QA 3CJCA 1N8RO 1XHXA 4H0YB 5EVZA 1XNQK 4FWOA 1NOZA 3VTHA 4C23A 1QS4A 4J8FA 1QVFM 2XY5A 4CGFA 1C0TA 1DTQA 1VSEA 4BR5A 3E01A 5HRRA 1C6VA 2WFBA 4WCEL 3MEEA 3P5JA 3WXLA 2P9UA 1GLCG 3LALA 5AQVA 3VEWA 4LF5K 2QWOA 3O6WA 3F73A 1I94K 2ETJA 1S9EA 2GX9A 4ZTJA 1U2VB 3M8PA 3PLAA 1K8AO 2P51A 4WFBL 1KFSA 1S72N 2OPPA 2QXFA 2QA4N 4IJNA 4QS7A 4OLBA 3H3OB 3SQ1A 3QBWA 3V1OA 4Z94A 3TAFA 1GOBA 2ASMA 1VQMN 3UKRA 3TABA 3ITHA 1YVNA 1R59O 3O8MA 3UKUA 4ISEA 4CEQA 5IWAK 3P38A 1BQNA 4YY3K 2VQEK 4CF2A 1ZBHA 5E41A 1YJ9N 2JGUA 3QMLA 4JKDA 2W6LA 2DFEA 4KH5A 2G8WA 4DTXA 1TUUA 3I0RA 5HRNA 5C25A 1SZ2A 3J7YP 4BDZA 3OW2M 3TU5A 3EYZA 1LOTB 3H45C 3Q7CA 3OJUA 4ELVA 5F2RA 3OJSA 1QQCA 5JMVA 1BISA 3K5NA 4LY7A 4BRFA 5AZIA 1FW6A 1NWKA 3CC2N 3RTVA 1FKPA 3M8SA 4Z4CA 4LF6K 2A3ZA 3DMJA 3WXJA 4I9QA 1QQOA 5FROA 3T19A 3HP9A 4KHSA 2CH6A 5FLXO 2OZSA 4I7FA 4DV1K 3CXCM 3CQ8A 4DFPA 3CFOA 1RTDA 1J54A 3VF4A 3ZX0A 3IFRA 4O5FA 1HKBA 3UIQA 1HMVA 4BRKA 3OYKA 4M3WA 2Q31A 5HRSA 1QVGM 4JKBA 4DSLA 5AQUA 3ZSYA 2ZJPL 4JKGB 1K8KA 1NGCA 2OA8A 2V51B 1VQ4N 3HM9A 3SQ2A 1BI4B 3NBPA 3TTDA 4KV8A 3CFRA 4DV0K 4DTJA 4FJ8A 2CGJA 3EY1A 1Z26A 4CD3A 3ZX2A 1OH6A 1VQPN 2V7YA 3SBGA 1SL1A 4CEOA 3K5MA 4ILHA 4FOEA 3HBTA 3DI6A 5T7BA 4MQ3A 2KZMA 3SLCA 3PUFA 3CCLN 1DT9A 5AZJA 3AO2A 5M1PA 3M8RA 4FJLA 4DSIA 3SYZA 2YNHA 1ZBLA 4BROA 3L2RA 3CFPA 1MA9B 2ZWHA 1NGDA 2UUAK 3SNNA 4FWSA 2HBKA 1YVUA 1FKOA 4IBNA 2QWPA 1JLQA 1KVCA 3LL3A 1S1TA 1WBDA 4CJ3A 3CCUN 4YNQA 2O8DA 4DV6K 4CESA 1KCFA 4FZYA 4NXMK 3LP3A 4YFUA 2O8EB 1TAQA 5KGWA 3QB0A 4CW7B 2PZSA 1LAVA 5CY4A 5HBMA 3R9PA 4AHCA 5EX5A 5LL6Z 1NK6A 3AO3A 3AO5A 4JI1K 1IG8A 3ENBA 2GUPA 3D2EB 4HTLA 4NLBA 4WE1A 4KB1A 1E4GT 3I8BA 3QO9A 1JLEA 1LWFA 3WEEB 1NOYA 3MXJA 3HVRA 4FLTA 2YKNA 4JAXA 3HOSA 3GL1A 1C0FA 3DLHA 5A2QO 4DS4A 4NO7A 3VQPA 5HLFA 3R8EA 1J5OA 4HTUA 2OPSA 3O9SA 4KHNA 1YXQA 2IVNA 3QIPA 3SUNA 2KFNA 2E2NA 3TSPA 4KREA 4PKIA 4DV5K 5DM6L 1C1BA 3NH0A 2BE2A 4WQ4A 3RRHA 3J8AA 1ZBUA 4OPHA 3NHGA 3THYA 1K73O 4N41A 4FPBA 4RG8A 4LH4A 4DQIA 1RT2A 4IG3A 3HO1A 3HTVA 1QSSA 4NCAA 4DTPA 3KLGA 1E3MA 1U49A 2P9LA 4LSLA 1RNHA 4B3OA 4DFMA 4HUGA 1VQLN 1L3VA 3SQ0A 3TARA 1NJIO 3RRGA 1XC3A 4IOAL 1SQKA 1TUYA 4C1NK 4BWMA 2BDPA 3DRPA 1J53A 4FM1A 2WONA 1NGIA 3VN5A 3JXUA 2IGIA 3SZ2A 3KLHA 3FZFA 3KD1E 2R7YA 5H1SQ 4BR9A 3LDSA 1BWFO 1BU6O 4OLAA 3HPGA 4QS8A 2KW4A 1WOQA 2ZQBA 1X9SA 3HVTA 5KQ8A 4I9LA 4DS5A 2G8IA 3THXB 1HJOA 4Y0WA 3JSMA 1U04A 4K42A 4J2DA 4CF1A 3PIPL 1TKZA 2VG7A 3WUHA 3AVFA 4LD0A 3P83D 1T6CA 4BRGA 1WNSA 4EAHD 4JNEA 5ELZA 3T1YK 4M3UA 5HRPA 4DTSA 3HXMA 4OJRA 4LF7K 1CZAN 1KQSM 3HYFA 4YOUA 1VAZA 1N34K 3LM9A 2CGLA 1IV0A 2Z1JA 3RR8A 2RF2A 3MN7A 3C65A 5E26A 3BZCA 1Z05A 1GLLO 2FSKA 3ULDA 4CGIA 1ZBFA 3ZCMA 3SAFA 5J2MA 4IO8A 5AQXA 1RFQA 3AVCA 1KSPA 5CYQA 2JWKA 4BR7A 4CZJA 4KHYA 1NGHA 4M7XA 3CPWM 4PY5A 3I55N 2AJQA 4H5TA 5D3GA 4DSEA 1F21A 1VQKN 3ZX3A 4LF4K 3HSTB 3KLEA 1ZC6A 2P9NA 2KLAA 1GLDG 3CJ9A 3B6OA 3VQ8A 4KRFA 3LWMA 5JICA 5JLFA 5EU7A 2YNIA 3DXKB 2P9SB 4X62K 4X64K 4A2BA 1EP4A 4PL7A 4K43A 3ULEA 4DR5K 3SV3A 3MEGA 3OTOK 4AM7A 3CI5A 3SK3A 3CM5A 3ATVA 3ZEUB 3ZT3A 4CHNA 5BN8A 4B9SA 4HHTA 4IXCA 3ENOA 4HUFA 4M42A 1X9WA 4CZKA 4DR1K 3FGUA 3IMXA 1X3NA 3SJJA 3THWA 1SL2A 2ZF5O 3DM2A 4BRCA 3RMDA 5LY3A 1NKEA 5LMUK 1SKWA 3LPUA 3HZ6A 2GEMA 3VGMA 2RE2A 3FZKA 1NK9A 4DU3A 4DTRA 4E1JA 4X66K 1YJWN 1Q82O 3OS2A 2P9IB 4E7JA 1NMNA 3O80A 1HUXA 1VSKA 2Y1IA 4OO1J 3A5LC 4GV6A 3V9WA 3ZT2A 4HUEA 2QXLA 3IS9A 3AO1A 3OYMA 4JI5K 4CJFA 1GLJO 2GWKA 3AARA 4Z0UA 1WB9A 3E9OA 2D0OA 2FBVA 4YOWA 1JJ2M 1WLJA 3LP1A 2DFHA 3ID8A 1VQ5N 1HNXK 1NGFA 5GADP 2FXUA 4W5NA 2E1YA 3EEQA 4F3TA 4BC2A 4K41A 1V4TA 1TGOA 2QWMA 2FLOA 1Z25A 1U2VA 4H5NA 1L5UA 3VEOA 3TI0A 3L2QA 2I7PA 5HOOA 4FWNA 1HR0K 4JI0K 5FRNA 3VQQA 1OH5A 2E2PA 2A5XA 2D1KA 3KZBA 3QBXA 3LDPA 4ISFA 5BRDA 3K59A 2VG6A 2UXCK 5ADXA 3O1WA 2D5RA 2YI1A 2PFUA 3AAPA 2BANA 3L3VA 4FK2A 3CMAN 4LC9B 3OBYA 5GIPA 2V52B 1U48A 1BG3A 4MFBA 1CXQA 2YHYA 3HOTA 4GMJB 4CEFA 2OANA 2QW9A 3M3ZA 3VMFB 4YOYA 2CGKA 2QKBA 4YHHK 2Z1IA 3WNFA 1EX4A 3U6FA 3E66A 4WYBA 3F2KA 1G99A 5M1QA 2YCHA 4ELTA 1J9AA 3LZJA 3C6UA 3MN5A 3VQEA 1HKGA 1WAFA 1SUQA 4DV2K 4JEPA 2YV0X 3MCAB 3VQ7A 4DHYA 4RW6A 4DUZK 3IG1A 4O44A 2HB5A 4A2AA 4AHTA 1TKXA 2NRXA 2IVPA 3AA5X 4XH4A 4JKHA 3NF9A 1VSMA 3K58A 3E1YA 4FLVA 5TKYA 3QERA 1S1VA 4IDKA 3EN9A 3NGYA 2XRIA 3MXMA 1IJJA 2Z1HA 1U47A 4YORA 3B8AX 1ASVA 3QNOA 2HHSA 2O8FB 4DKWA 1W7AA 1T7PA 2A6AA 2PYJA 1ZXOA 4I6MB 1IBKK 4GKKK 1NK4A 3NCIA 2YX6A 3E9LA 1NKBA 4M3ZA 2HOEA 4B9UA 4ISGA 1N32K 3BF3A 1RDWX 3AV9A 4JHDB 3MCPA 2FF3B 3VEVA 4NLCA 3AA2A 3RVCA 4KFBA 1WSHA 4M3XA 2HMPA 1HQEA 1Q81O 2O8BB 4E1NA 4JKAA 1TAUA 4FZXC 5CYMA 3SUOA 4BRPA 3K2PA 5AQSA 3SUQA 3IUCA 1BI4A 2I5JA 4H03B 1SKRA 3OYGA 4CI6A 2WC9A 1GLAG 2G8UA 4KO0A 2X74A 3A0IX 4X65K 1KRPA 4FLUA 1A5VA 3OYAA 1I39A 4F3OA 2RPIA 1HYVA 3O4WA 2KKZA 2OZMA 2QM1A 2IS3A 3DWLA 2O8CB 4WFAL 4DTOA 5AJ3K 3QLHA 4MDAA 5CZ1A 3OYJA 4DWIA 2AP1A 4LFAK 3PX4A 4PL8A 4XH1A 5JVHL 2BH1A 4OVLA 2QKKA 1JLCA 5J2QA 4OGCA 4H5WA 4F9OA 3GE1A 1LW2A 1BIZA 2KHOA 1Z6RA 4DG1A 3MX5A 1EWRA 3V1RA 4Y1CA 1NJZA 2F8SA 2ZGZA 3WT0A 3I56N 1YTUA 1Q86O 3G4SN 3D2EA 1RBTA 3AGKA 4U67L 1VQ8N 4IFEA 3VETA 3MK6A 3WEEA 1RTJA 1K9MO 3TTFA 4F4KA 1VSLA 1Q7YO 2OPQA 5AQQA 2KTQA 1HPMA 1C0MA 5C42A 5AFUA 4FOIA 4A5BA 4CERA 3EO3A 1CZBA 3DXMB 4JI2K 2HSTA 4QS9A 3TANA 3FFIA 4KI4A 3NDKA 3AAQA 3HL8A 2KQ2A 5I3UA 1D5AA 2A1SA 2G8FA 4CECA 4FSVA 3OYNA 5CZ2A 2EWSA 3C6AA 2P1JA 3OY9A 1UA0A 3D2FB 4CF0A 1RTHA 4CHOA 2X78A 1N33K 3ZSOA 2HBJA 4FWLA 1X9MA 5C12A 4BE2A 4YOVA 2P9PB 3JYTA 1QE1A 3O5BA 3QDKA 1IKVA 4CK1A 2HHQA 4CJ4A 2P5GA 1ILYA 2W6KA 4GVEA 3K5LA 4WFNL 3QNNA 1QSLA 4JI6K 4H8KA 1MWMA 3I0SA 4KHWA 2Q0RA 4M3TA 4W5OA 4E19A 3VA0A 1WSJA 3KWGA 3PSIA 1NJWA 1Y64A 5BREA 1VQON 4IG0A 1ASWA 5C2FA 1UOCA 3L4QA 3QFUA 4PHTX 3M8QA 3THXA 1GOAA 4MLEA 4JN4A 2PYLA 1XMOK 4B9LA 2QWRA 3P4IA 1ASUA 3T1AA 3SAHA 4JS5A 3WQTA 1EQYA 4LF9K 3SUPA 1WSEA 3VPZA 4BACA 1OVQA 3BEXA 3CCQN 1C1CA 3KHYA 2P9UB 3EE9A 5B8HA 3MWTA 5EY4A 3S41A 3NVMA 4ILJA 4KHUA 4A61A 5AQHA 1M1KO 3V9UA 2E2QA 1XWLA 1N36K 4PKHA 1XQSC 4M45A 4PKGA 3VQCA 1YJNN 1VQ9N 2HVHA 3ATUA 3PSFA 4N5SA 4CGDA 3UKUB 1SL0A 5BPLA 4KI6A 4LFBK 1S1XA 1TK0A 1BQMA 4MO5A 4FM2A 2F9WA 4IFYA 1G15A 1MDUB 1QZ6A 4DR4K 4B9MA 3PX0A 3FE1A 1GLBG 1RDUA 5KPTA 3AVNA 4BWJA 3MX2A 4FVMA 1JXEA 5FPMA 5JS2A 3KK2A 2ZM6K 5IT9O 3A8YA 4BREA 5KPZA 5CHIA 4FJNA 1N5YA 4CEAA 2QWQA 5I9EB 2HHTA 4FJKA 3ZETA 2NRZA 4CEBA 3WXIA 5GAEP 1VSDA 4MO4A 1EWQA 1W9HA 4JI8K 3TPQA 4GKJK 3O08A 1T44A 2NRHA 4O4GA 4CVNE 4FJMA 4DV4K 4CIFA 1HX1A 3ZEUA 3L2WA 4DTMA 5LMNK 3U3YA 2WUSA 4ELUA 4E7IA 1T05A 4NYFA 3H08A 2YHXA 3M5RA 1RTIA 3T7ZA 3CYMA 1TVRA 3S3MA 3HSCA 3V1QA 4NCBA 3VQ4A 4ICLA 2YHBA 4B3TK 2D4WA 1HQUA 3V9SA 4YDUC 1FK9A 4CJUA 1C0GA 3AVIA 3ENHA 4IEIA 1YTAA 4O8UA 2Z1GA 1BCOA 1T03A 4BDYA 1XUPO 1BL3A 2CH5A 3C6TA 2FBXA 1RDCA 4CJSA 3AGRA 1RT7A 1IH7A 1K8KB 2ITMA 2A42A 5KTQA 2OYQA 4K8XA 2JLEA 3RWUA 4JK9A 3CCSN 1E4FT 3BGRA 4CF8A 4E0DA 2Q97A 4DU4A 4WQ5C 1W0HA 2A41A 2QTDA 3FZLA 5BPNA 5F1XA 3OYIA 2XY7A 1RBVA 2YHAA 4LFCK 1VQ6N 4CJQA 5KRSA 3FLCO 3A5MC 4M3RA 1T3VA 3IDHA 2IVOA 3B6PA 3A2FA 3SPYA 4R79A 4BRDA 4DV7K 1ZYQA 3OYLA 3SV4A 4FWKA 3L6QA 4AHSA 4CF9A 4CBXA 4EP4A 3QEVA 1QTMA 4R5PA 2E1ZA 1D9DA 3QIOA 5CE3A 5MLCQ 5AQPA 1S5JA 3NF8A 1KD1O 4FPAA 3CC7N 3C0BA 3EKSA 1HRHA 4GV9A 1IKXA 1GLFO 2A40A 4IEEA 3CC4N 4C1NI 1O1WA 2V7ZA 3U8XA 1NK8A 2NRVA 2XHBA 4CZIA 4OX9K 5C10A 3LP0A 1RILA 3F9MA 3BDPA 4UQGA 3CERA 1YAGA 3ZT1A 4EZ9A 1HNWK 4OPAA 2E8AA 3DOKA 4DF8A 4JKEA 4DCHA 5BR9A 3CCMN 4EIAA 3DRRA 5HL7L 3EL2A 3WNEA 1X1PA 4B9TA 3C7NB 1EKEA 5M1KA 1NKCA 1EO1A 1BIUA 2HHXA 1H1VA 3GG4A 5JLHA 4F8RA 2GV9A 4JD2A 2FF6A 3ZSWA 3ZLJA 4G1QA 2YNFA 1BUPA 3GBTA 1NK7A 4CJPA 3R1XA 2OPRA 5AQJA 1DGKN 4FM0A 2ITGA 3CQXA 4CK2A 4JRPA 2F8TA 4DTUA 1NJXA 3DAWA 1YI2N 3T69A 2VWJA 2FSNA 5AQNA 2W41A 3MAQA 3N4PA 3VOVA 1B92A 2E6LA 1RT3A 1KFDA 1S9GA 3WQUA 2O8FA 1D4XA 1Q8IA 3THYB 4I6MA 4CBWA 4UY8O 1S3XA 4M41A 5DK5A 3DLGA 2X6NA 4FXDA 4A59A 4O5BA 1TYQB 5AQLA 4H0PA 4JRQA 4FK4A 3WXKA 1IBMK 4FZZA 3DYAA 2HNZA 5KPRA 2P9KB 2JWLA 4XH5A 3AA4A 3DLBA 4CIGA 3D0PA 5CR4A 4XIUA 3J81O 4CJ5A 4E7KA 4CEDA 2WTUA 2A1RA 4DQRA 3CETA 3VA3A 5GAGP 4CZFA 4W5RA 2PAVA 2HHWA 1IKWA 3EZ5A 3QESA 4RW8A 1TK5A 3C95A 2Q2RA 3R6MA 1ATNA 1KAZA 3ZSQA 4BR2A 2O8CA 1XI1A 2HNDA 2I7NA 4B3MK 1C0UA 3LPTA 3K5OA 4CGJA 2G8VA 3VQ9A 2G8KA 1VQNN 5AQYA 3KKRA 4C8LA 4MDBA 1OKJA 3O4QA 2LSNA 2VYPA 1CLQA 4WF9L 3JAMO 1W2BM 1VSIA 1JLFA 1TKTA 2DFFA 3V81A 1RBUA 4GNIA 3ZT0A 4K8ZA 4EZ6A 3J7ZO 3QETA 1NG9A 3TAMA 1U6ZA 2BUPA 2YNGA 1VRTA 3WNHA 1OVYA 4LH5A 4FWRA 3NF6A 4KTZA 2H3GX 5J2PA 4O0IA 1HYSA 1Y97A 4BG9A 3MWPA 3KJVA 2QEXN 3HPHA 1FXXA 4CFAA 1LCUA 3MMVA 3CCJN 2UXBK 3QEWA 1KC8O 1IG9A 4TSXA 3FZMA 4JK7A 4HWIA 1TL1A 5AR0A 4C8MA 3UB5A 3VEYA 1ZBIA 1VRUA 4AILC 1HNIA 4DQQA 1DKGD 1T8EA 2VQFK 1QQNA 3SJHA 4BGBA 4JYAK 4FJ5A 3ZT4A 3CQYA 1S22A 1SS6A 1BA1A 2D0BA 2UUCK 4BE1A 2F4VK 3OYFA 4BR0A 4B8AB 3AVHA 4RTFD 3LP2A 3LAKA 4CHYA 2IAJA 4BRQA 4W5QA 4ZHRA 3U9ZA 2E5LK 3I33A 4FWQA 4H0OA 1DEJA 4B8CA 4DV3K 2G8HA 3F9KA 3AVJA 4B1XB 3QEPA 3OYDA 3U4LA 4IKFA 4BQZA 1WSFA 3GDQA 3NF7A 4H0VB 3SAGA 1JLAA 1HLUA 1VSHA 3NAEA 1BA0A 2NNWA 3O1BA 3AVLA 2UYTA 3M6GA 4PWDA 4IOCL 1XMQK 3H46O 4FLYA 3I8DA 1J6ZA 1BGXT 4JKGA 2FC0A 4CFDA 4YOXA 2VCPA 3OYCA 5FPDA 4CFBA 4IOXA 2YJEA 4RW9A 4OKKA 1XNRK 2WBNA 4AHUA 4FJXA 5AQKA 3MN9A 3BP8A 1JL1A 3TWHA 5K14A 3O9QA 3MECA 3H3NO 1RDBA 2DY4A 4KTQA 1WSGA 1KVBA 3RSEB 3E9PA 2OTLN 1TK8A 5LJWA 4CHQA 1Q9XA 4EHUA 4JS4A 3HK2A 1B9DA 3ISNC 2VWBA 4CZEA 1J5EK 4DQPA 1RCHA 3OS0A 5AQGA 3AVAA 3VTIA 1VSFA 3LWLA 4IDHA 3KWIA 3CJ7A 1B9FA 3KLIA 4IWVA 4M7YA 1YUWA 2NRRA 2GTDA 2O8EA 1RGIA 3G10A 4DF4A 4B1WB 4B9NA 4FW2A 1WAJA 4CGHA 4QOZB 4Q0BA 2ZE2A 3R3LA 4GW6A 1DTTA 5KRTA 3CCEN 4Z4FA 3PX6A 4Z4EA 1HJRA 1X9JA 3H6EA 4GVMA 2QK9A 4IFVA 3TTCA 3AO4A 4CCHA 3T1HK 4F2SA 2FBTA 3ZSXA 4N76A 1VQ7N 1R0AA 3ZSVA 3LDQA 3ALYA 4CJTA 1YITN 3TSQA 1OH7A 1SKSA 4N47A 3ZYYX 3VGLA 2B6AA 4KH6A 3L0QA 3O9UA 2VGMA 3HI0A 3VEZA 3NVKA 4HVJA 3OVNA 2HHUA 2HHHK 4Y1DA 4W5TA 4L8RB 4BC4A 2E20A 4FJGA 4RWTA 1SAZA 3LDLA 4HCBA 3N4QA 2B4JA 3LM2A 1HKCA 3A5OC 5EOYA 4M3YA 2D0CA 3O3FA 5AQFA 2NUBA 3HJFA 3VEXA 3KK3A 3OA9A 3BF1A 3P1GA 3CG7A 4DUYK 4JKCA 4JI3K 4CJKA 4DR7K 1RT6A 5TKWA 3SCXA 1HNZK 3TR8A 3CD6N 1OH8A 4ID1A 1HNVA 2EHGA 4PUOA 2F96A 4M63C 3S3NA 4OKJA 1U45A 3KK7A 2KZZA 1NU0A 4KTWA 3D45A 1MU2A 4KBOA 2PY5A 2VGNA 5FDLA 1REVA 2YHWA 4CGGA 4DMNA 3FR0A 2ASPA 4J2EA 1GLEG 4OPKA 3K57A 4CJWA 5BN9A 1JCEA 4Z4IA 2ZJRL 1ITGA 5M1NA 5SZTA 4AHVA 4FO0A 4CBUA 1KTQA 2Y1JA 1BO5O 3AVBA 4BGAA 3TAGA 3HRGA 2FSJA 2QI2A 4CJLA 4OKEA 2VG5A 3O4NA 4K25A 3P39A 2DTUA 3U3GA 4CZHA 4BDPA 3NE6A 1QQMA 1RT5A 2VWKA 5ADXH 3QFPA 3NH2A 1YHQN 4KAZA 4A57A 3LDOA 3QICA 2GBZA 3OYBA 1NJYA 4H5VA 1HYZA 1BOTO 3ZSZA 1YF5L 3H1VX 3Q7BA 4DLGA 3VENA 1NGGA 3CCRN 4FJ9A 3SPZA 2XO7A 4C8KA 1Q9YA 3J7AP 1D9FA 4AM6A 3TAEA 2J4RA 2W40A 4YOTA 4BRNA 5AQZA 3V4IA 3UKRB 1O13A 3V9XA 4GY2B 4E3SA 4FJIA 4KHPK 3KTQA 2NZTA 3OYEA 4YDUA 1XC9A 1P90A 4CIEA 3MN6A 3NGIA 4XEIA 1MWKA 4AF1A 4FJ7A 1WBBA 1UA1A 3VGKA 3LDNA 1JL2A 4ID5A 1RT4A 2NLXA 5KI6A 1VSJA 2FBYA 3BY5A 3CF5L 4FW1A 3C7NA 1RDAA 4BR4A 5KGXA 3TAQA 2IOCA 4H4OA 4GV3A 3DXKA 4O8KA 2P9SA 4WQ5A 3C6HA 4KH4A 1Q18A 3IAYA 1CZ9A 1RBSA 4BVPA 1T6DA 3RMBA 3W3DA 4DSKA 1JLGA 4BE0A 5AZIB 1ATSA 4FWMA 1ESVA 4CK3A 3F5TA 3VQDA 2E2OA 5F0XA 4DQSA 1WSIA 1BCMA 4BRAA 2YKMA 4E1MA 4OGEA 1WUAA 1BHLA 1W97L 4RW7A 2Q1NA 3CMEN 1KAXA 3CPEA 3D7EO 4I2PA 4B3RK 4B08A 3VQ5A 4BC3A 3KLFA 3VESA 4IZ9A 4BG8A 1LAWA 3K0SA 4C8NA 3S9HA 3NMUA 2UXDK 1TYQA 5FPEA 4OPJA 3P31A 3V6DA 3PO4A 4CJRA 3CJAA 2IDOA 5DMRA 2P9IA 1NBWA 2P9KA 3QEXA 4FJJA 2UU9K 5AQMA 1NGBA 3DOLA 4Z4HA 3QINA 4DR2K 3K9KA 3VQBA 3SI6A 3VQ6A 1ZBSA 4N56A 2O4IA 3S3OA 1DLOA 1S1UA 4DFJA 2QWLA 4B1YB 2HF4A 2D0AA 3PO5A 3V9ZA 4EFHA 5AQIA 3THVA 3WXMB 3HP6A 3L8BA 1NGAA 3BZKA 2HHVA 4KKOA 4JK8A 4PA1A 3KK1A 2XY6A 3RMAA 2YJFA 5AQWA 4O0JA 3VERA 1RT1A 3D6RA 4QAGA 1S1WA 5AZJB 2AA4A 4FL9A 4NCGA 4Q5VA 4NB4A 4BRLA 3RMCA 4G9ZA 4FYDA 1VHXA 1JXBA 2F9TA 4WQ4C 5FRMA 4A62A 1TKDA 4AH9A 5M1OA 4NYNA 1KAYA 3A5NC 3JS6A 5AQOA 4F2RA 3MEDA 1EXQA 4B3SK 1L3SA 3CCVN 4U7BA 1YT3A 2O8DB 3OBWA 4CJEA 2HVIA 3PIOL 4DU1A 3DRSA 3L4IA 4EP5A 4I2QA 1NGJA 2GWJA 2GELA 1RDDA 4C8OA 5AFUH 4BRIA 1JCGA 1UAXA 3O3GA 4J2BA 1FJGK 5FPNA 3SMPA 2ZGYA 4DR3K 4EHTA 4H0XB 4B1ZA 4FLXA 3O9TA 2OTJN 1K6YA 3GOIA 1X3MA 3ASMA
chains in the Genus database with same CATH topology
4H4MA 3OS1A 3QO9A 3QEWA 1IG9A 1JLEA 1GOCA 1LWFA 4TSXA 1TL1A 4DQPA 4C8MA 4FJHA 1ZBIA 1NOYA 3MXJA 1VRUA 3HVRA 1HNIA 1RTJA 4AILC 4FLTA 1L3TA 3DLKA 4DQQA 4F4KA 2YKNA 1T8EA 1VSLA 4LSNA 2OPQA 3DLHA 2KTQA 2WOMA 1C0MA 4DS4A 4FJ5A 3ZT4A 5C42A 2D0BA 2E6MA 3VQPA 4DSFA 2ZD1A 5HLFA 1J5OA 4BE1A 4HTUA 4CERA 1CZBA 2OPSA 3WNGA 4ZTFA 2X6SA 3OYFA 4KHNA 4B8AB 3AVHA 3QIPA 3SUNA 3LP2A 3LAKA 4CHYA 4KHQA 2IAJA 4W5QA 1KLNA 2IC3A 4ZHRA 2KFNA 3TANA 3FFIA 4KI4A 4KREA 4B8CA 1LWCA 3NDKA 2G8HA 1C1BA 4JLHA 3NH0A 3F9KA 3AVJA 3HL8A 3QEPA 2BGGA 3OYDA 2KQ2A 2BE2A 4IKFA 5I3UA 3RRHA 1D5AA 2A1SA 1IKYA 1ZBUA 1KVAA 2G8FA 3NHGA 1WSFA 4CECA 3NF7A 4N41A 4B9VA 2HW3A 4RG8A 3G0ZA 4LH4A 4DQIA 3OYNA 1JLAA 1RT2A 4IG3A 5CZ2A 3RR7A 1VSHA 2P1JA 3HO1A 3OY9A 3NAEA 1UA0A 3AVLA 3MXIA 1N6QA 4CHPA 3KLGA 4DTPA 4CF0A 1QSSA 3AVKA 4NCAA 1RTHA 1U49A 1SV5A 3KD5E 4CHOA 4PWDA 4LSLA 2X78A 1RNHA 4B3OA 2EX3A 4DTNA 2KFZA 4DFMA 3ZSOA 4HUGA 3CM6A 3I8DA 4FLYA 1XHZA 1X9MA 1L3VA 1BGXT 4KB1A 4BE2A 3SQ0A 4FK0A 3TARA 2FC0A 4CFDA 5J1EA 3RRGA 3OYCA 3JYTA 4CFBA 4E7LA 1QE1A 4DFKA 4BWMA 1IKVA 4CK1A 2HHQA 2BDPA 4RW9A 4CJ4A 3DRPA 4OKKA 5I42A 1J53A 4J2AA 4FM1A 2WONA 3VN5A 4AHUA 2P5GA 4FJXA 2RKIA 3K5LA 1JL1A 3TWHA 3QNNA 5HP1A 1QSLA 2Q3SA 5K14A 2IGIA 4H8KA 3SZ2A 3MECA 3I0SA 4KHWA 3KLHA 4M3TA 3KD1E 2R7YA 1RDBA 2DY4A 5JS1A 4W5OA 3C94A 4E19A 3VA0A 3LDSA 4KTQA 4CFCA 1WSGA 1WSJA 1KVBA 3HPGA 4CJVA 4OLAA 1NJWA 1TK8A 4HCCA 4IG0A 1ASWA 4CHQA 2KW4A 1UOCA 2ZQBA 3HVTA 1X9SA 1Q9XA 4I9LA 3OYHA 1B9DA 3ISNC 4JS4A 3M8QA 4DS5A 2GUIA 3PV8A 1GOAA 2G8IA 3JSMA 1U04A 5HROA 1EETA 4J2DA 2PYLA 4CF1A 1TKZA 2VG7A 3VQAA 4B9LA 3AVFA 3LZIA 4LD0A 3P83D 1ASUA 1WNSA 3T1AA 4CE9A 4JS5A 1RCHA 3OS0A 4E7HA 2HMIA 4E89A 4KB0A 3NFAA 3SUPA 1WSEA 4M3UA 3DLRA 3AVAA 5HRPA 4BACA 4DTSA 3HXMA 1C1CA 1JKHA 2XY8A 4OJRA 1TV6A 1VSFA 3LWLA 4KHUA 1A5XA 3HYFA 3V9UA 1B9FA 3HT3A 3KLIA 3DLEA 2Z1JA 1LW0A 5J2NA 3T3FA 2HNYA 2RF2A 1XWLA 3G10A 3LANA 4DF4A 3RR8A 4KPYA 3ULDA 3L2VA 2RN2A 4CGIA 4B9NA 1ZBFA 4M45A 3ZCMA 4FW2A 3NH1A 4CHZA 1WAJA 3VQCA 4CGHA 5J2MA 4QOZB 4Q0BA 2ZE2A 2HVHA 3AVCA 1KSPA 5CYQA 4GW6A 1DTTA 2E4LA 5KRTA 4Z4FA 3PX6A 4N5SA 4CGDA 4KHYA 1SL0A 1HJRA 4Z4EA 4Z4GA 4KI6A 4GVMA 1JLBA 1S1XA 2QK9A 3KKSA 4IFVA 3AO4A 1BQMA 1TK0A 4CCHA 4F2SA 4FM2A 4PY5A 2AJQA 2FBTA 4IFYA 3ZSXA 1G15A 2W42A 4DSJA 4N76A 4B9MA 1WN7A 4DSEA 3PX0A 1R0AA 3ZSVA 2P5OA 5D3GA 1U4BA 1F21A 3ALYA 4CJTA 4O55A 1RBRA 1QHTA 3AVNA 4BWJA 3HSTB 4FVMA 5JS2A 1JXEA 4N47A 3KLEA 1HPZA 3KK2A 1SKSA 1L3UA 2B6AA 1UWBA 3B6OA 4FJNA 1N5YA 3VQ8A 4KRFA 3LWMA 5C24A 4CEAA 4HVJA 3OVNA 5EU7A 2HHUA 1LWEA 2O4GA 2YNIA 4Y1DA 4W5TA 4L8RB 4FJGA 4FJKA 2HHTA 4CEBA 1EP4A 4HCBA 4QCLA 2B4JA 1VSDA 2B5JA 1IO2A 3LAMA 4M3YA 2D0CA 3O3FA 1LV5A 1W9HA 3NGZA 3TAPA 2NUBA 3SV3A 3HJFA 3MEGA 3SQ4A 1C1AA 3KK3A 1QSYA 3AVMA 3P1GA 4O4GA 3HPOA 1TL3A 3CG7A 4FJMA 4CJKA 1RT6A 3SCXA 3CM5A 1KLMA 3ZT3A 4CIFA 4CHNA 3AVGA 3L2WA 4DTMA 3U3YA 3PY8A 4ELUA 3TR8A 4E7IA 1T05A 4B9SA 4NYFA 3H08A 4ID1A 2EHGA 1HNVA 3ZSRA 5SWMA 4HHTA 4HUFA 4PUOA 4M42A 1X9WA 2F96A 1RTIA 3S3NA 4CEEA 3CYMA 4FCYA 1TVRA 4OKJA 3SJJA 3S3MA 3V1QA 1U45A 4NCBA 3VQ4A 2KZZA 1SL2A 4ICLA 4KTWA 3D45A 2YHBA 4RW4A 1MU2A 3DM2A 4FLWA 3QEIA 4AHRA 3RMDA 4PQUA 1HQUA 4FLZA 3V9SA 1S6PA 2PY5A 1NK0A 1NKEA 4DLEA 1NK5A 3L2UA 5FDLA 1FK9A 1REVA 3KIOA 4CGGA 4CJUA 3AA3A 3AVIA 3LPUA 4DMNA 1SKWA 4J2EA 1YTAA 2Z1GA 4OPKA 1BCOA 4CEZA 1T03A 1NK9A 3K57A 4DU3A 4BDYA 1D8YA 4CJWA 1BL3A 1I3AA 4DTRA 2ATQA 3C6TA 4Z4IA 1ITGA 1RDCA 2FBXA 4CJSA 5SZTA 1RT7A 3L3UA 4AHVA 3OS2A 1IH7A 4E7JA 1VSKA 5KTQA 3O3HA 1KTQA 2Y1IA 2OYQA 4K8XA 2Y1JA 2JLEA 1CXUA 1VK0A 3AVBA 3RWUA 1A5WA 3V9WA 3ZT2A 4HUEA 3TAGA 3IS9A 3BGRA 3AO1A 4CF8A 3IRXA 3OYMA 4E0DA 1S6QA 4CJLA 4OKEA 1XHXA 4CJFA 4Z0UA 4DU4A 2VG5A 3O4NA 2FBVA 1W0HA 1NOZA 2DTUA 1QS4A 2XY7A 3OYIA 3U3GA 2XY5A 1WLJA 3LP1A 4BDPA 2DFHA 4CGFA 1RBVA 1C0TA 1DTQA 2YHAA 1VSEA 3NE6A 3E01A 1RT5A 2VWKA 4CJQA 5HRRA 3NH2A 5KRSA 1C6VA 4M3RA 4KAZA 3MEEA 3P5JA 4W5NA 3B6PA 3A2FA 3SPYA 2GBZA 4F3TA 3LALA 3OYBA 1TGOA 1NJYA 1ZYQA 3OYLA 3F73A 3SV4A 2ETJA 1HYZA 1S9EA 4AHSA 1Z25A 3ZSZA 4ZTJA 4CF9A 3QEVA 4EP4A 3M8PA 1L5UA 1QTMA 3TI0A 3LZJA 3L2QA 4DLGA 4R5PA 2P51A 5FRNA 4FJ9A 3SPZA 3VQQA 2XO7A 1D9DA 1KFSA 3QIOA 4C8KA 2OPPA 2QXFA 1Q9YA 1D9FA 3K59A 1S5JA 2VG6A 3NF8A 4OLBA 2D5RA 3V1OA 3TAEA 1HRHA 1IKXA 3TAFA 2BANA 3L3VA 4FK2A 3V4IA 1GOBA 3V9XA 3TABA 3ITHA 4E3SA 4FJIA 1O1WA 1U48A 4CEQA 3KTQA 1NK8A 3OYEA 4MFBA 2XHBA 1XC9A 1BQNA 3LP0A 1RILA 1CXQA 3BDPA 4UQGA 4CF2A 4CIEA 1ZBHA 5E41A 4GMJB 3ZT1A 4EZ9A 4CEFA 2JGUA 3NGIA 3DOKA 2QKBA 2Z1IA 4FJ7A 3WNFA 1EX4A 4DF8A 3U6FA 1UA1A 2DFEA 1JL2A 4ID5A 2G8WA 1RT4A 3DRRA 4ELTA 1J9AA 3WNEA 1X1PA 2FBYA 1VSJA 3C6UA 5KI6A 3I0RA 4FW1A 1EKEA 3VQEA 5HRNA 1RDAA 1WAFA 4B9TA 1SUQA 5C25A 1NKCA 1BIUA 5KGXA 2HHXA 2YV0X 3VQ7A 4BDZA 4RW6A 2IOCA 4H4OA 3TAQA 4F8RA 3IG1A 2GV9A 3EYZA 3ZSWA 4O44A 2HB5A 4AHTA 1TKXA 2YNFA 3HPHA 4G1QA 1NK7A 3AA5X 3OJUA 4CJPA 4ELVA 3IAYA 1CZ9A 1RBSA 3NF9A 1VSMA 3OJSA 1QQCA 3K58A 4FLVA 3QERA 2OPRA 3RMBA 4DSKA 1BISA 1S1VA 4IDKA 3K5NA 4FM0A 1JLGA 2ITGA 3NGYA 4LY7A 4BE0A 4CK2A 4JRPA 2XRIA 4CK3A 4DTUA 2F8TA 3MXMA 3VQDA 1NJXA 3RTVA 2VWJA 1FKPA 4DQSA 1WSIA 1BCMA 3M8SA 3MAQA 4Z4CA 3DMJA 2YKMA 2Z1HA 1U47A 4I9QA 1B92A 4E1MA 2E6LA 5FROA 3T19A 3HP9A 4KHSA 1ASVA 1RT3A 4OGEA 3QNOA 3HK2A 2OZSA 4I7FA 1KFDA 1S9GA 3CQ8A 4DFPA 2HHSA 1BHLA 3CFOA 1RTDA 1J54A 4RW7A 1T7PA 2PYJA 1Q8IA 1NK4A 3NCIA 1NKBA 3UIQA 4M41A 5DK5A 3DLGA 4I2PA 4M3ZA 1HMVA 2X6NA 4B08A 3OYKA 3VQ5A 4B9UA 4FXDA 3KLFA 4M3WA 4O5BA 1LAWA 3AV9A 5HRSA 4C8NA 3S9HA 4OPJA 4DTXA 3AA2A 4JRQA 4DSLA 4KFBA 1WSHA 3V6DA 3PO4A 3ZSYA 4M3XA 4CJRA 4FK4A 1HQEA 4FZZA 3DYAA 2HNZA 2IDOA 5DMRA 4E1NA 3QEXA 4FJJA 1TAUA 2OA8A 3AA4A 3DLBA 4FZXC 5CYMA 4CIGA 3D0PA 3SUOA 4XIUA 3K2PA 3HM9A 3SI6A 3DOLA 4Z4HA 3SQ2A 3SUQA 1BI4B 3NBPA 3QINA 1BI4A 3VQBA 4CJ5A 3VQ6A 2I5JA 4CEDA 4KV8A 3CFRA 4E7KA 3OYGA 4N56A 4DTJA 1SKRA 3S3OA 4FJ8A 2A1RA 1DLOA 1S1UA 3EY1A 4DQRA 4DFJA 2O4IA 2G8UA 2D0AA 3PO5A 4KO0A 3V9ZA 1Z26A 3VA3A 3THVA 2X74A 4W5RA 3HP6A 3L8BA 1SL1A 4FLUA 1A5VA 1KRPA 3OYAA 4KKOA 2HHVA 4CEOA 3K5MA 1IKWA 3EZ5A 2HHWA 1I39A 4PA1A 3QESA 2RPIA 1HYVA 4RW8A 3KK1A 1TK5A 2OZMA 4F3OA 3C95A 2XY6A 3RMAA 3DI6A 2IS3A 5T7BA 4O0JA 4MQ3A 2KZMA 3ZSQA 1RT1A 3PUFA 4DTOA 4QAGA 1S1WA 1XI1A 2HNDA 3AO2A 4NCGA 1C0UA 3QLHA 3LPTA 3K5OA 4Q5VA 4CGJA 3RMCA 3M8RA 2G8VA 4FYDA 5CZ1A 3VQ9A 4DSIA 1JXBA 2G8KA 3SYZA 4FJLA 2YNHA 1ZBLA 3OYJA 5FRMA 3KKRA 4C8LA 4DWIA 3L2RA 3CFPA 1TKDA 3O4QA 2LSNA 4AH9A 3PX4A 4NYNA 3SNNA 1CLQA 4F2RA 1YVUA 1FKOA 4IBNA 3MEDA 1EXQA 1JLQA 1VSIA 1JLFA 1KVCA 4OVLA 2DFFA 1TKTA 3V81A 1JLCA 1RBUA 1S1TA 5J2QA 4OGCA 1L3SA 2QKKA 4CJ3A 1YT3A 3ZT0A 4K8ZA 4EZ6A 4YNQA 4CJEA 2HVIA 1LW2A 1BIZA 3QETA 4CESA 1KCFA 4FZYA 3TAMA 4DU1A 4CFAA 4DG1A 3DRSA 3LP3A 4YFUA 2YNGA 1VRTA 3WNHA 1TAQA 5KGWA 4LH5A 4EP5A 4I2QA 2PZSA 3NF6A 4KTZA 1RDDA 4Y1CA 3V1RA 1LAVA 1NJZA 5CY4A 1UAXA 3O3GA 5HBMA 4C8OA 4J2BA 5J2PA 2F8SA 4AHCA 4O0IA 1YTUA 1NK6A 3AO3A 3AO5A 1HYSA 1Y97A 3KJVA 4FLXA 1RBTA 4WE1A 1K6YA 3SQ1A 1FXXA 3ASMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H4M A;  3OS1 A;  3QO9 A;  3QEW A;  1IG9 A;  1JLE A;  1GOC A;  1LWF A;  4TSX A;  1TL1 A;  4DQP A;  4C8M A;  4FJH A;  1ZBI A;  1NOY A;  3MXJ A;  1VRU A;  3HVR A;  1HNI A;  1RTJ A;  4AIL C;  4FLT A;  1L3T A;  3DLK A;  4DQQ A;  4F4K A;  2YKN A;  1T8E A;  1VSL A;  4LSN A;  2OPQ A;  3DLH A;  2KTQ A;  2WOM A;  1C0M A;  4DS4 A;  4FJ5 A;  3ZT4 A;  5C42 A;  2D0B A;  2E6M A;  3VQP A;  4DSF A;  2ZD1 A;  5HLF A;  1J5O A;  4BE1 A;  4HTU A;  4CER A;  1CZB A;  2OPS A;  3WNG A;  4ZTF A;  2X6S A;  3OYF A;  4KHN A;  4B8A B;  3AVH A;  3QIP A;  3SUN A;  3LP2 A;  3LAK A;  4CHY A;  4KHQ A;  2IAJ A;  4W5Q A;  1KLN A;  2IC3 A;  4ZHR A;  2KFN A;  3TAN A;  3FFI A;  4KI4 A;  4KRE A;  4B8C A;  1LWC A;  3NDK A;  2G8H A;  1C1B A;  4JLH A;  3NH0 A;  3F9K A;  3AVJ A;  3HL8 A;  3QEP A;  2BGG A;  3OYD A;  2KQ2 A;  2BE2 A;  4IKF A;  5I3U A;  3RRH A;  1D5A A;  2A1S A;  1IKY A;  1ZBU A;  1KVA A;  2G8F A;  3NHG A;  1WSF A;  4CEC A;  3NF7 A;  4N41 A;  4B9V A;  2HW3 A;  4RG8 A;  3G0Z A;  4LH4 A;  4DQI A;  3OYN A;  1JLA A;  1RT2 A;  4IG3 A;  5CZ2 A;  3RR7 A;  1VSH A;  2P1J A;  3HO1 A;  3OY9 A;  3NAE A;  1UA0 A;  3AVL A;  3MXI A;  1N6Q A;  4CHP A;  3KLG A;  4DTP A;  4CF0 A;  1QSS A;  3AVK A;  4NCA A;  1RTH A;  1U49 A;  1SV5 A;  3KD5 E;  4CHO A;  4PWD A;  4LSL A;  2X78 A;  1RNH A;  4B3O A;  2EX3 A;  4DTN A;  2KFZ A;  4DFM A;  3ZSO A;  4HUG A;  3CM6 A;  3I8D A;  4FLY A;  1XHZ A;  1X9M A;  1L3V A;  1BGX T;  4KB1 A;  4BE2 A;  3SQ0 A;  4FK0 A;  3TAR A;  2FC0 A;  4CFD A;  5J1E A;  3RRG A;  3OYC A;  3JYT A;  4CFB A;  4E7L A;  1QE1 A;  4DFK A;  4BWM A;  1IKV A;  4CK1 A;  2HHQ A;  2BDP A;  4RW9 A;  4CJ4 A;  3DRP A;  4OKK A;  5I42 A;  1J53 A;  4J2A A;  4FM1 A;  2WON A;  3VN5 A;  4AHU A;  2P5G A;  4FJX A;  2RKI A;  3K5L A;  1JL1 A;  3TWH A;  3QNN A;  5HP1 A;  1QSL A;  2Q3S A;  5K14 A;  2IGI A;  4H8K A;  3SZ2 A;  3MEC A;  3I0S A;  4KHW A;  3KLH A;  4M3T A;  3KD1 E;  2R7Y A;  1RDB A;  2DY4 A;  5JS1 A;  4W5O A;  3C94 A;  4E19 A;  3VA0 A;  3LDS A;  4KTQ A;  4CFC A;  1WSG A;  1WSJ A;  1KVB A;  3HPG A;  4CJV A;  4OLA A;  1NJW A;  1TK8 A;  4HCC A;  4IG0 A;  1ASW A;  4CHQ A;  2KW4 A;  1UOC A;  2ZQB A;  3HVT A;  1X9S A;  1Q9X A;  4I9L A;  3OYH A;  1B9D A;  3ISN C;  4JS4 A;  3M8Q A;  4DS5 A;  2GUI A;  3PV8 A;  1GOA A;  2G8I A;  3JSM A;  1U04 A;  5HRO A;  1EET A;  4J2D A;  2PYL A;  4CF1 A;  1TKZ A;  2VG7 A;  3VQA A;  4B9L A;  3AVF A;  3LZI A;  4LD0 A;  3P83 D;  1ASU A;  1WNS A;  3T1A A;  4CE9 A;  4JS5 A;  1RCH A;  3OS0 A;  4E7H A;  2HMI A;  4E89 A;  4KB0 A;  3NFA A;  3SUP A;  1WSE A;  4M3U A;  3DLR A;  3AVA A;  5HRP A;  4BAC A;  4DTS A;  3HXM A;  1C1C A;  1JKH A;  2XY8 A;  4OJR A;  1TV6 A;  1VSF A;  3LWL A;  4KHU A;  1A5X A;  3HYF A;  3V9U A;  1B9F A;  3HT3 A;  3KLI A;  3DLE A;  2Z1J A;  1LW0 A;  5J2N A;  3T3F A;  2HNY A;  2RF2 A;  1XWL A;  3G10 A;  3LAN A;  4DF4 A;  3RR8 A;  4KPY A;  3ULD A;  3L2V A;  2RN2 A;  4CGI A;  4B9N A;  1ZBF A;  4M45 A;  3ZCM A;  4FW2 A;  3NH1 A;  4CHZ A;  1WAJ A;  3VQC A;  4CGH A;  5J2M A;  4QOZ B;  4Q0B A;  2ZE2 A;  2HVH A;  3AVC A;  1KSP A;  5CYQ A;  4GW6 A;  1DTT A;  2E4L A;  5KRT A;  4Z4F A;  3PX6 A;  4N5S A;  4CGD A;  4KHY A;  1SL0 A;  1HJR A;  4Z4E A;  4Z4G A;  4KI6 A;  4GVM A;  1JLB A;  1S1X A;  2QK9 A;  3KKS A;  4IFV A;  3AO4 A;  1BQM A;  1TK0 A;  4CCH A;  4F2S A;  4FM2 A;  4PY5 A;  2AJQ A;  2FBT A;  4IFY A;  3ZSX A;  1G15 A;  2W42 A;  4DSJ A;  4N76 A;  4B9M A;  1WN7 A;  4DSE A;  3PX0 A;  1R0A A;  3ZSV A;  2P5O A;  5D3G A;  1U4B A;  1F21 A;  3ALY A;  4CJT A;  4O55 A;  1RBR A;  1QHT A;  3AVN A;  4BWJ A;  3HST B;  4FVM A;  5JS2 A;  1JXE A;  4N47 A;  3KLE A;  1HPZ A;  3KK2 A;  1SKS A;  1L3U A;  2B6A A;  1UWB A;  3B6O A;  4FJN A;  1N5Y A;  3VQ8 A;  4KRF A;  3LWM A;  5C24 A;  4CEA A;  4HVJ A;  3OVN A;  5EU7 A;  2HHU A;  1LWE A;  2O4G A;  2YNI A;  4Y1D A;  4W5T A;  4L8R B;  4FJG A;  4FJK A;  2HHT A;  4CEB A;  1EP4 A;  4HCB A;  4QCL A;  2B4J A;  1VSD A;  2B5J A;  1IO2 A;  3LAM A;  4M3Y A;  2D0C A;  3O3F A;  1LV5 A;  1W9H A;  3NGZ A;  3TAP A;  2NUB A;  3SV3 A;  3HJF A;  3MEG A;  3SQ4 A;  1C1A A;  3KK3 A;  1QSY A;  3AVM A;  3P1G A;  4O4G A;  3HPO A;  1TL3 A;  3CG7 A;  4FJM A;  4CJK A;  1RT6 A;  3SCX A;  3CM5 A;  1KLM A;  3ZT3 A;  4CIF A;  4CHN A;  3AVG A;  3L2W A;  4DTM A;  3U3Y A;  3PY8 A;  4ELU A;  3TR8 A;  4E7I A;  1T05 A;  4B9S A;  4NYF A;  3H08 A;  4ID1 A;  2EHG A;  1HNV A;  3ZSR A;  5SWM A;  4HHT A;  4HUF A;  4PUO A;  4M42 A;  1X9W A;  2F96 A;  1RTI A;  3S3N A;  4CEE A;  3CYM A;  4FCY A;  1TVR A;  4OKJ A;  3SJJ A;  3S3M A;  3V1Q A;  1U45 A;  4NCB A;  3VQ4 A;  2KZZ A;  1SL2 A;  4ICL A;  4KTW A;  3D45 A;  2YHB A;  4RW4 A;  1MU2 A;  3DM2 A;  4FLW A;  3QEI A;  4AHR A;  3RMD A;  4PQU A;  1HQU A;  4FLZ A;  3V9S A;  1S6P A;  2PY5 A;  1NK0 A;  1NKE A;  4DLE A;  1NK5 A;  3L2U A;  5FDL A;  1FK9 A;  1REV A;  3KIO A;  4CGG A;  4CJU A;  3AA3 A;  3AVI A;  3LPU A;  4DMN A;  1SKW A;  4J2E A;  1YTA A;  2Z1G A;  4OPK A;  1BCO A;  4CEZ A;  1T03 A;  1NK9 A;  3K57 A;  4DU3 A;  4BDY A;  1D8Y A;  4CJW A;  1BL3 A;  1I3A A;  4DTR A;  2ATQ A;  3C6T A;  4Z4I A;  1ITG A;  1RDC A;  2FBX A;  4CJS A;  5SZT A;  1RT7 A;  3L3U A;  4AHV A;  3OS2 A;  1IH7 A;  4E7J A;  1VSK A;  5KTQ A;  3O3H A;  1KTQ A;  2Y1I A;  2OYQ A;  4K8X A;  2Y1J A;  2JLE A;  1CXU A;  1VK0 A;  3AVB A;  3RWU A;  1A5W A;  3V9W A;  3ZT2 A;  4HUE A;  3TAG A;  3IS9 A;  3BGR A;  3AO1 A;  4CF8 A;  3IRX A;  3OYM A;  4E0D A;  1S6Q A;  4CJL A;  4OKE A;  1XHX A;  4CJF A;  4Z0U A;  4DU4 A;  2VG5 A;  3O4N A;  2FBV A;  1W0H A;  1NOZ A;  2DTU A;  1QS4 A;  2XY7 A;  3OYI A;  3U3G A;  2XY5 A;  1WLJ A;  3LP1 A;  4BDP A;  2DFH A;  4CGF A;  1RBV A;  1C0T A;  1DTQ A;  2YHA A;  1VSE A;  3NE6 A;  3E01 A;  1RT5 A;  2VWK A;  4CJQ A;  5HRR A;  3NH2 A;  5KRS A;  1C6V A;  4M3R A;  4KAZ A;  3MEE A;  3P5J A;  4W5N A;  3B6P A;  3A2F A;  3SPY A;  2GBZ A;  4F3T A;  3LAL A;  3OYB A;  1TGO A;  1NJY A;  1ZYQ A;  3OYL A;  3F73 A;  3SV4 A;  2ETJ A;  1HYZ A;  1S9E A;  4AHS A;  1Z25 A;  3ZSZ A;  4ZTJ A;  4CF9 A;  3QEV A;  4EP4 A;  3M8P A;  1L5U A;  1QTM A;  3TI0 A;  3LZJ A;  3L2Q A;  4DLG A;  4R5P A;  2P51 A;  5FRN A;  4FJ9 A;  3SPZ A;  3VQQ A;  2XO7 A;  1D9D A;  1KFS A;  3QIO A;  4C8K A;  2OPP A;  2QXF A;  1Q9Y A;  1D9F A;  3K59 A;  1S5J A;  2VG6 A;  3NF8 A;  4OLB A;  2D5R A;  3V1O A;  3TAE A;  1HRH A;  1IKX A;  3TAF A;  2BAN A;  3L3V A;  4FK2 A;  3V4I A;  1GOB A;  3V9X A;  3TAB A;  3ITH A;  4E3S A;  4FJI A;  1O1W A;  1U48 A;  4CEQ A;  3KTQ A;  1NK8 A;  3OYE A;  4MFB A;  2XHB A;  1XC9 A;  1BQN A;  3LP0 A;  1RIL A;  1CXQ A;  3BDP A;  4UQG A;  4CF2 A;  4CIE A;  1ZBH A;  5E41 A;  4GMJ B;  3ZT1 A;  4EZ9 A;  4CEF A;  2JGU A;  3NGI A;  3DOK A;  2QKB A;  2Z1I A;  4FJ7 A;  3WNF A;  1EX4 A;  4DF8 A;  3U6F A;  1UA1 A;  2DFE A;  1JL2 A;  4ID5 A;  2G8W A;  1RT4 A;  3DRR A;  4ELT A;  1J9A A;  3WNE A;  1X1P A;  2FBY A;  1VSJ A;  3C6U A;  5KI6 A;  3I0R A;  4FW1 A;  1EKE A;  3VQE A;  5HRN A;  1RDA A;  1WAF A;  4B9T A;  1SUQ A;  5C25 A;  1NKC A;  1BIU A;  5KGX A;  2HHX A;  2YV0 X;  3VQ7 A;  4BDZ A;  4RW6 A;  2IOC A;  4H4O A;  3TAQ A;  4F8R A;  3IG1 A;  2GV9 A;  3EYZ A;  3ZSW A;  4O44 A;  2HB5 A;  4AHT A;  1TKX A;  2YNF A;  3HPH A;  4G1Q A;  1NK7 A;  3AA5 X;  3OJU A;  4CJP A;  4ELV A;  3IAY A;  1CZ9 A;  1RBS A;  3NF9 A;  1VSM A;  3OJS A;  1QQC A;  3K58 A;  4FLV A;  3QER A;  2OPR A;  3RMB A;  4DSK A;  1BIS A;  1S1V A;  4IDK A;  3K5N A;  4FM0 A;  1JLG A;  2ITG A;  3NGY A;  4LY7 A;  4BE0 A;  4CK2 A;  4JRP A;  2XRI A;  4CK3 A;  4DTU A;  2F8T A;  3MXM A;  3VQD A;  1NJX A;  3RTV A;  2VWJ A;  1FKP A;  4DQS A;  1WSI A;  1BCM A;  3M8S A;  3MAQ A;  4Z4C A;  3DMJ A;  2YKM A;  2Z1H A;  1U47 A;  4I9Q A;  1B92 A;  4E1M A;  2E6L A;  5FRO A;  3T19 A;  3HP9 A;  4KHS A;  1ASV A;  1RT3 A;  4OGE A;  3QNO A;  3HK2 A;  2OZS A;  4I7F A;  1KFD A;  1S9G A;  3CQ8 A;  4DFP A;  2HHS A;  1BHL A;  3CFO A;  1RTD A;  1J54 A;  4RW7 A;  1T7P A;  2PYJ A;  1Q8I A;  1NK4 A;  3NCI A;  1NKB A;  3UIQ A;  4M41 A;  5DK5 A;  3DLG A;  4I2P A;  4M3Z A;  1HMV A;  2X6N A;  4B08 A;  3OYK A;  3VQ5 A;  4B9U A;  4FXD A;  3KLF A;  4M3W A;  4O5B A;  1LAW A;  3AV9 A;  5HRS A;  4C8N A;  3S9H A;  4OPJ A;  4DTX A;  3AA2 A;  4JRQ A;  4DSL A;  4KFB A;  1WSH A;  3V6D A;  3PO4 A;  3ZSY A;  4M3X A;  4CJR A;  4FK4 A;  1HQE A;  4FZZ A;  3DYA A;  2HNZ A;  2IDO A;  5DMR A;  4E1N A;  3QEX A;  4FJJ A;  1TAU A;  2OA8 A;  3AA4 A;  3DLB A;  4FZX C;  5CYM A;  4CIG A;  3D0P A;  3SUO A;  4XIU A;  3K2P A;  3HM9 A;  3SI6 A;  3DOL A;  4Z4H A;  3SQ2 A;  3SUQ A;  1BI4 B;  3NBP A;  3QIN A;  1BI4 A;  3VQB A;  4CJ5 A;  3VQ6 A;  2I5J A;  4CED A;  4KV8 A;  3CFR A;  4E7K A;  3OYG A;  4N56 A;  4DTJ A;  1SKR A;  3S3O A;  4FJ8 A;  2A1R A;  1DLO A;  1S1U A;  3EY1 A;  4DQR A;  4DFJ A;  2O4I A;  2G8U A;  2D0A A;  3PO5 A;  4KO0 A;  3V9Z A;  1Z26 A;  3VA3 A;  3THV A;  2X74 A;  4W5R A;  3HP6 A;  3L8B A;  1SL1 A;  4FLU A;  1A5V A;  1KRP A;  3OYA A;  4KKO A;  2HHV A;  4CEO A;  3K5M A;  1IKW A;  3EZ5 A;  2HHW A;  1I39 A;  4PA1 A;  3QES A;  2RPI A;  1HYV A;  4RW8 A;  3KK1 A;  1TK5 A;  2OZM A;  4F3O A;  3C95 A;  2XY6 A;  3RMA A;  3DI6 A;  2IS3 A;  5T7B A;  4O0J A;  4MQ3 A;  2KZM A;  3ZSQ A;  1RT1 A;  3PUF A;  4DTO A;  4QAG A;  1S1W A;  1XI1 A;  2HND A;  3AO2 A;  4NCG A;  1C0U A;  3QLH A;  3LPT A;  3K5O A;  4Q5V A;  4CGJ A;  3RMC A;  3M8R A;  2G8V A;  4FYD A;  5CZ1 A;  3VQ9 A;  4DSI A;  1JXB A;  2G8K A;  3SYZ A;  4FJL A;  2YNH A;  1ZBL A;  3OYJ A;  5FRM A;  3KKR A;  4C8L A;  4DWI A;  3L2R A;  3CFP A;  1TKD A;  3O4Q A;  2LSN A;  4AH9 A;  3PX4 A;  4NYN A;  3SNN A;  1CLQ A;  4F2R A;  1YVU A;  1FKO A;  4IBN A;  3MED A;  1EXQ A;  1JLQ A;  1VSI A;  1JLF A;  1KVC A;  4OVL A;  2DFF A;  1TKT A;  3V81 A;  1JLC A;  1RBU A;  1S1T A;  5J2Q A;  4OGC A;  1L3S A;  2QKK A;  4CJ3 A;  1YT3 A;  3ZT0 A;  4K8Z A;  4EZ6 A;  4YNQ A;  4CJE A;  2HVI A;  1LW2 A;  1BIZ A;  3QET A;  4CES A;  1KCF A;  4FZY A;  3TAM A;  4DU1 A;  4CFA A;  4DG1 A;  3DRS A;  3LP3 A;  4YFU A;  2YNG A;  1VRT A;  3WNH A;  1TAQ A;  5KGW A;  4LH5 A;  4EP5 A;  4I2Q A;  2PZS A;  3NF6 A;  4KTZ A;  1RDD A;  4Y1C A;  3V1R A;  1LAV A;  1NJZ A;  5CY4 A;  1UAX A;  3O3G A;  5HBM A;  4C8O A;  4J2B A;  5J2P A;  2F8S A;  4AHC A;  4O0I A;  1YTU A;  1NK6 A;  3AO3 A;  3AO5 A;  1HYS A;  1Y97 A;  3KJV A;  4FLX A;  1RBT A;  4WE1 A;  1K6Y A;  3SQ1 A;  1FXX A;  3ASM A; 
#chains in the Genus database with same CATH topology
 4H4M A;  3OS1 A;  1GOC A;  4B1V A;  4FJH A;  1L3T A;  3DLK A;  4LSN A;  2WOM A;  2E6M A;  3SMS A;  4DSF A;  2ZD1 A;  5JVG L;  3WNG A;  4ZTF A;  2X6S A;  5C0Y A;  2ZJQ L;  4ILG B;  4KHQ A;  1KLN A;  2IC3 A;  3DLL L;  4JV5 K;  3ID6 A;  3ZET B;  5M1F A;  1ATR A;  2Q0U A;  2HF3 A;  1LWC A;  4RCH A;  5LJV A;  2DPN A;  3MDQ A;  1QZ5 A;  2OCE A;  4JLH A;  2BGG A;  1NMD A;  1IKY A;  1KVA A;  4B9V A;  2HBM A;  2HW3 A;  3G0Z A;  2E88 A;  3RR7 A;  4K0K K;  3MXI A;  4JHD A;  4CHP A;  4FWP A;  5BR8 K;  1N6Q A;  3AVK A;  1SV5 A;  2P9L B;  3KD5 E;  4BC5 A;  2EX3 A;  4DTN A;  2KFZ A;  4LF8 K;  3SBT A;  3CM6 A;  1XHZ A;  2O8B A;  4CD1 A;  1NNE A;  4FK0 A;  3AY9 A;  5J1E A;  3FZH A;  4FVU A;  5GAH P;  3CIP A;  4E7L A;  3CJB A;  3HM8 A;  1NLV A;  4IJA A;  3J80 O;  4DFK A;  2NRT A;  3G25 A;  5I42 A;  4J2A A;  4DQ8 A;  2RKI A;  5HP1 A;  2UUB K;  2Q3S A;  3VF2 A;  5JS1 A;  3C94 A;  4BVO A;  4CFC A;  4CJV A;  3RSE A;  4HCC A;  3OYH A;  3PV8 A;  2GUI A;  3EKU A;  3H1Q A;  5HRO A;  1EET A;  3BUZ B;  3VQA A;  3OHR A;  1NM1 A;  3LZI A;  4CE9 A;  4E7H A;  4B9Q A;  2HMI A;  4E89 A;  4KB0 A;  3NFA A;  2ASO A;  3DLR A;  1JKH A;  2XY8 A;  1TV6 A;  2IIR A;  5AQR A;  4CJ7 A;  2PBD A;  4DB3 A;  3VF6 A;  1A5X A;  4AQY K;  4L3Q A;  1JCF A;  3HT3 A;  2QWN A;  3O9R A;  3KVG A;  4BRM A;  3DLE A;  1LW0 A;  5J2N A;  4V19 S;  3T3F A;  2HNY A;  3LAN A;  2BTF A;  4KPY A;  3EE8 A;  5BRF A;  1M90 O;  3L2V A;  2RN2 A;  3G71 N;  4CZM A;  3NH1 A;  4CHZ A;  4H0T B;  1IBL K;  4IO9 L;  5EXW A;  2E4L A;  4NXN K;  4Z4G A;  1JLB A;  1KXP A;  3KKS A;  3TSU A;  3DJC A;  3W0L A;  4MLH A;  5C2D A;  2W42 A;  4DSJ A;  1WN7 A;  2P5O A;  1U4B A;  1QHA A;  3CHW A;  4O55 A;  1RBR A;  5BRH A;  1QHT A;  4CZG A;  2P9N B;  1HPZ A;  3DXM A;  1L3U A;  1UWB A;  4DR6 K;  5C24 A;  4B1U B;  1LWE A;  2O4G A;  5E84 A;  4A5A A;  2D0P A;  4JI4 K;  1YIJ N;  4BRH A;  4JD2 B;  4QCL A;  5GIO A;  2B5J A;  3ULE B;  1IO2 A;  3LAM A;  3U9D A;  1LV5 A;  1NGE A;  3NGZ A;  3TAP A;  1BDG A;  3SQ4 A;  1C1A A;  1QSY A;  3AVM A;  2HBL A;  3UE5 A;  3HPO A;  1TL3 A;  4JKF A;  5BPM A;  3IKM A;  1KLM A;  3AVG A;  3EZW A;  3PY8 A;  3D2F A;  5KQD A;  3ZSR A;  5SWM A;  2RHK A;  4H5R A;  3M1F A;  5DM7 L;  3CJ1 A;  2F7T A;  4CEE A;  2NRW A;  4FCY A;  5GIN A;  3THW B;  4BQL A;  2Q36 A;  3FFK B;  3K9J A;  4RW4 A;  5C15 A;  2P9P A;  4FLW A;  3QEI A;  4AHR A;  4PQU A;  4FLZ A;  1S6P A;  1NK0 A;  4DLE A;  1NK5 A;  3L2U A;  4CZL A;  3KIO A;  4BY9 C;  3AA3 A;  4CEZ A;  1P8Z A;  1D8Y A;  4JI7 K;  1I3A A;  5AQT A;  2ATQ A;  3L3U A;  3O3H A;  1CXU A;  1VK0 A;  1A5W A;  1V4S A;  3G6E N;  3IRX A;  1S6Q A;  3CJC A;  1N8R O;  1XHX A;  4H0Y B;  5EVZ A;  1XNQ K;  4FWO A;  1NOZ A;  3VTH A;  4C23 A;  1QS4 A;  4J8F A;  1QVF M;  2XY5 A;  4CGF A;  1C0T A;  1DTQ A;  1VSE A;  4BR5 A;  3E01 A;  5HRR A;  1C6V A;  2WFB A;  4WCE L;  3MEE A;  3P5J A;  3WXL A;  2P9U A;  1GLC G;  3LAL A;  5AQV A;  3VEW A;  4LF5 K;  2QWO A;  3O6W A;  3F73 A;  1I94 K;  2ETJ A;  1S9E A;  2GX9 A;  4ZTJ A;  1U2V B;  3M8P A;  3PLA A;  1K8A O;  2P51 A;  4WFB L;  1KFS A;  1S72 N;  2OPP A;  2QXF A;  2QA4 N;  4IJN A;  4QS7 A;  4OLB A;  3H3O B;  3SQ1 A;  3QBW A;  3V1O A;  4Z94 A;  3TAF A;  1GOB A;  2ASM A;  1VQM N;  3UKR A;  3TAB A;  3ITH A;  1YVN A;  1R59 O;  3O8M A;  3UKU A;  4ISE A;  4CEQ A;  5IWA K;  3P38 A;  1BQN A;  4YY3 K;  2VQE K;  4CF2 A;  1ZBH A;  5E41 A;  1YJ9 N;  2JGU A;  3QML A;  4JKD A;  2W6L A;  2DFE A;  4KH5 A;  2G8W A;  4DTX A;  1TUU A;  3I0R A;  5HRN A;  5C25 A;  1SZ2 A;  3J7Y P;  4BDZ A;  3OW2 M;  3TU5 A;  3EYZ A;  1LOT B;  3H45 C;  3Q7C A;  3OJU A;  4ELV A;  5F2R A;  3OJS A;  1QQC A;  5JMV A;  1BIS A;  3K5N A;  4LY7 A;  4BRF A;  5AZI A;  1FW6 A;  1NWK A;  3CC2 N;  3RTV A;  1FKP A;  3M8S A;  4Z4C A;  4LF6 K;  2A3Z A;  3DMJ A;  3WXJ A;  4I9Q A;  1QQO A;  5FRO A;  3T19 A;  3HP9 A;  4KHS A;  2CH6 A;  5FLX O;  2OZS A;  4I7F A;  4DV1 K;  3CXC M;  3CQ8 A;  4DFP A;  3CFO A;  1RTD A;  1J54 A;  3VF4 A;  3ZX0 A;  3IFR A;  4O5F A;  1HKB A;  3UIQ A;  1HMV A;  4BRK A;  3OYK A;  4M3W A;  2Q31 A;  5HRS A;  1QVG M;  4JKB A;  4DSL A;  5AQU A;  3ZSY A;  2ZJP L;  4JKG B;  1K8K A;  1NGC A;  2OA8 A;  2V51 B;  1VQ4 N;  3HM9 A;  3SQ2 A;  1BI4 B;  3NBP A;  3TTD A;  4KV8 A;  3CFR A;  4DV0 K;  4DTJ A;  4FJ8 A;  2CGJ A;  3EY1 A;  1Z26 A;  4CD3 A;  3ZX2 A;  1OH6 A;  1VQP N;  2V7Y A;  3SBG A;  1SL1 A;  4CEO A;  3K5M A;  4ILH A;  4FOE A;  3HBT A;  3DI6 A;  5T7B A;  4MQ3 A;  2KZM A;  3SLC A;  3PUF A;  3CCL N;  1DT9 A;  5AZJ A;  3AO2 A;  5M1P A;  3M8R A;  4FJL A;  4DSI A;  3SYZ A;  2YNH A;  1ZBL A;  4BRO A;  3L2R A;  3CFP A;  1MA9 B;  2ZWH A;  1NGD A;  2UUA K;  3SNN A;  4FWS A;  2HBK A;  1YVU A;  1FKO A;  4IBN A;  2QWP A;  1JLQ A;  1KVC A;  3LL3 A;  1S1T A;  1WBD A;  4CJ3 A;  3CCU N;  4YNQ A;  2O8D A;  4DV6 K;  4CES A;  1KCF A;  4FZY A;  4NXM K;  3LP3 A;  4YFU A;  2O8E B;  1TAQ A;  5KGW A;  3QB0 A;  4CW7 B;  2PZS A;  1LAV A;  5CY4 A;  5HBM A;  3R9P A;  4AHC A;  5EX5 A;  5LL6 Z;  1NK6 A;  3AO3 A;  3AO5 A;  4JI1 K;  1IG8 A;  3ENB A;  2GUP A;  3D2E B;  4HTL A;  4NLB A;  4WE1 A;  4KB1 A;  1E4G T;  3I8B A;  3QO9 A;  1JLE A;  1LWF A;  3WEE B;  1NOY A;  3MXJ A;  3HVR A;  4FLT A;  2YKN A;  4JAX A;  3HOS A;  3GL1 A;  1C0F A;  3DLH A;  5A2Q O;  4DS4 A;  4NO7 A;  3VQP A;  5HLF A;  3R8E A;  1J5O A;  4HTU A;  2OPS A;  3O9S A;  4KHN A;  1YXQ A;  2IVN A;  3QIP A;  3SUN A;  2KFN A;  2E2N A;  3TSP A;  4KRE A;  4PKI A;  4DV5 K;  5DM6 L;  1C1B A;  3NH0 A;  2BE2 A;  4WQ4 A;  3RRH A;  3J8A A;  1ZBU A;  4OPH A;  3NHG A;  3THY A;  1K73 O;  4N41 A;  4FPB A;  4RG8 A;  4LH4 A;  4DQI A;  1RT2 A;  4IG3 A;  3HO1 A;  3HTV A;  1QSS A;  4NCA A;  4DTP A;  3KLG A;  1E3M A;  1U49 A;  2P9L A;  4LSL A;  1RNH A;  4B3O A;  4DFM A;  4HUG A;  1VQL N;  1L3V A;  3SQ0 A;  3TAR A;  1NJI O;  3RRG A;  1XC3 A;  4IOA L;  1SQK A;  1TUY A;  4C1N K;  4BWM A;  2BDP A;  3DRP A;  1J53 A;  4FM1 A;  2WON A;  1NGI A;  3VN5 A;  3JXU A;  2IGI A;  3SZ2 A;  3KLH A;  3FZF A;  3KD1 E;  2R7Y A;  5H1S Q;  4BR9 A;  3LDS A;  1BWF O;  1BU6 O;  4OLA A;  3HPG A;  4QS8 A;  2KW4 A;  1WOQ A;  2ZQB A;  1X9S A;  3HVT A;  5KQ8 A;  4I9L A;  4DS5 A;  2G8I A;  3THX B;  1HJO A;  4Y0W A;  3JSM A;  1U04 A;  4K42 A;  4J2D A;  4CF1 A;  3PIP L;  1TKZ A;  2VG7 A;  3WUH A;  3AVF A;  4LD0 A;  3P83 D;  1T6C A;  4BRG A;  1WNS A;  4EAH D;  4JNE A;  5ELZ A;  3T1Y K;  4M3U A;  5HRP A;  4DTS A;  3HXM A;  4OJR A;  4LF7 K;  1CZA N;  1KQS M;  3HYF A;  4YOU A;  1VAZ A;  1N34 K;  3LM9 A;  2CGL A;  1IV0 A;  2Z1J A;  3RR8 A;  2RF2 A;  3MN7 A;  3C65 A;  5E26 A;  3BZC A;  1Z05 A;  1GLL O;  2FSK A;  3ULD A;  4CGI A;  1ZBF A;  3ZCM A;  3SAF A;  5J2M A;  4IO8 A;  5AQX A;  1RFQ A;  3AVC A;  1KSP A;  5CYQ A;  2JWK A;  4BR7 A;  4CZJ A;  4KHY A;  1NGH A;  4M7X A;  3CPW M;  4PY5 A;  3I55 N;  2AJQ A;  4H5T A;  5D3G A;  4DSE A;  1F21 A;  1VQK N;  3ZX3 A;  4LF4 K;  3HST B;  3KLE A;  1ZC6 A;  2P9N A;  2KLA A;  1GLD G;  3CJ9 A;  3B6O A;  3VQ8 A;  4KRF A;  3LWM A;  5JIC A;  5JLF A;  5EU7 A;  2YNI A;  3DXK B;  2P9S B;  4X62 K;  4X64 K;  4A2B A;  1EP4 A;  4PL7 A;  4K43 A;  3ULE A;  4DR5 K;  3SV3 A;  3MEG A;  3OTO K;  4AM7 A;  3CI5 A;  3SK3 A;  3CM5 A;  3ATV A;  3ZEU B;  3ZT3 A;  4CHN A;  5BN8 A;  4B9S A;  4HHT A;  4IXC A;  3ENO A;  4HUF A;  4M42 A;  1X9W A;  4CZK A;  4DR1 K;  3FGU A;  3IMX A;  1X3N A;  3SJJ A;  3THW A;  1SL2 A;  2ZF5 O;  3DM2 A;  4BRC A;  3RMD A;  5LY3 A;  1NKE A;  5LMU K;  1SKW A;  3LPU A;  3HZ6 A;  2GEM A;  3VGM A;  2RE2 A;  3FZK A;  1NK9 A;  4DU3 A;  4DTR A;  4E1J A;  4X66 K;  1YJW N;  1Q82 O;  3OS2 A;  2P9I B;  4E7J A;  1NMN A;  3O80 A;  1HUX A;  1VSK A;  2Y1I A;  4OO1 J;  3A5L C;  4GV6 A;  3V9W A;  3ZT2 A;  4HUE A;  2QXL A;  3IS9 A;  3AO1 A;  3OYM A;  4JI5 K;  4CJF A;  1GLJ O;  2GWK A;  3AAR A;  4Z0U A;  1WB9 A;  3E9O A;  2D0O A;  2FBV A;  4YOW A;  1JJ2 M;  1WLJ A;  3LP1 A;  2DFH A;  3ID8 A;  1VQ5 N;  1HNX K;  1NGF A;  5GAD P;  2FXU A;  4W5N A;  2E1Y A;  3EEQ A;  4F3T A;  4BC2 A;  4K41 A;  1V4T A;  1TGO A;  2QWM A;  2FLO A;  1Z25 A;  1U2V A;  4H5N A;  1L5U A;  3VEO A;  3TI0 A;  3L2Q A;  2I7P A;  5HOO A;  4FWN A;  1HR0 K;  4JI0 K;  5FRN A;  3VQQ A;  1OH5 A;  2E2P A;  2A5X A;  2D1K A;  3KZB A;  3QBX A;  3LDP A;  4ISF A;  5BRD A;  3K59 A;  2VG6 A;  2UXC K;  5ADX A;  3O1W A;  2D5R A;  2YI1 A;  2PFU A;  3AAP A;  2BAN A;  3L3V A;  4FK2 A;  3CMA N;  4LC9 B;  3OBY A;  5GIP A;  2V52 B;  1U48 A;  1BG3 A;  4MFB A;  1CXQ A;  2YHY A;  3HOT A;  4GMJ B;  4CEF A;  2OAN A;  2QW9 A;  3M3Z A;  3VMF B;  4YOY A;  2CGK A;  2QKB A;  4YHH K;  2Z1I A;  3WNF A;  1EX4 A;  3U6F A;  3E66 A;  4WYB A;  3F2K A;  1G99 A;  5M1Q A;  2YCH A;  4ELT A;  1J9A A;  3LZJ A;  3C6U A;  3MN5 A;  3VQE A;  1HKG A;  1WAF A;  1SUQ A;  4DV2 K;  4JEP A;  2YV0 X;  3MCA B;  3VQ7 A;  4DHY A;  4RW6 A;  4DUZ K;  3IG1 A;  4O44 A;  2HB5 A;  4A2A A;  4AHT A;  1TKX A;  2NRX A;  2IVP A;  3AA5 X;  4XH4 A;  4JKH A;  3NF9 A;  1VSM A;  3K58 A;  3E1Y A;  4FLV A;  5TKY A;  3QER A;  1S1V A;  4IDK A;  3EN9 A;  3NGY A;  2XRI A;  3MXM A;  1IJJ A;  2Z1H A;  1U47 A;  4YOR A;  3B8A X;  1ASV A;  3QNO A;  2HHS A;  2O8F B;  4DKW A;  1W7A A;  1T7P A;  2A6A A;  2PYJ A;  1ZXO A;  4I6M B;  1IBK K;  4GKK K;  1NK4 A;  3NCI A;  2YX6 A;  3E9L A;  1NKB A;  4M3Z A;  2HOE A;  4B9U A;  4ISG A;  1N32 K;  3BF3 A;  1RDW X;  3AV9 A;  4JHD B;  3MCP A;  2FF3 B;  3VEV A;  4NLC A;  3AA2 A;  3RVC A;  4KFB A;  1WSH A;  4M3X A;  2HMP A;  1HQE A;  1Q81 O;  2O8B B;  4E1N A;  4JKA A;  1TAU A;  4FZX C;  5CYM A;  3SUO A;  4BRP A;  3K2P A;  5AQS A;  3SUQ A;  3IUC A;  1BI4 A;  2I5J A;  4H03 B;  1SKR A;  3OYG A;  4CI6 A;  2WC9 A;  1GLA G;  2G8U A;  4KO0 A;  2X74 A;  3A0I X;  4X65 K;  1KRP A;  4FLU A;  1A5V A;  3OYA A;  1I39 A;  4F3O A;  2RPI A;  1HYV A;  3O4W A;  2KKZ A;  2OZM A;  2QM1 A;  2IS3 A;  3DWL A;  2O8C B;  4WFA L;  4DTO A;  5AJ3 K;  3QLH A;  4MDA A;  5CZ1 A;  3OYJ A;  4DWI A;  2AP1 A;  4LFA K;  3PX4 A;  4PL8 A;  4XH1 A;  5JVH L;  2BH1 A;  4OVL A;  2QKK A;  1JLC A;  5J2Q A;  4OGC A;  4H5W A;  4F9O A;  3GE1 A;  1LW2 A;  1BIZ A;  2KHO A;  1Z6R A;  4DG1 A;  3MX5 A;  1EWR A;  3V1R A;  4Y1C A;  1NJZ A;  2F8S A;  2ZGZ A;  3WT0 A;  3I56 N;  1YTU A;  1Q86 O;  3G4S N;  3D2E A;  1RBT A;  3AGK A;  4U67 L;  1VQ8 N;  4IFE A;  3VET A;  3MK6 A;  3WEE A;  1RTJ A;  1K9M O;  3TTF A;  4F4K A;  1VSL A;  1Q7Y O;  2OPQ A;  5AQQ A;  2KTQ A;  1HPM A;  1C0M A;  5C42 A;  5AFU A;  4FOI A;  4A5B A;  4CER A;  3EO3 A;  1CZB A;  3DXM B;  4JI2 K;  2HST A;  4QS9 A;  3TAN A;  3FFI A;  4KI4 A;  3NDK A;  3AAQ A;  3HL8 A;  2KQ2 A;  5I3U A;  1D5A A;  2A1S A;  2G8F A;  4CEC A;  4FSV A;  3OYN A;  5CZ2 A;  2EWS A;  3C6A A;  2P1J A;  3OY9 A;  1UA0 A;  3D2F B;  4CF0 A;  1RTH A;  4CHO A;  2X78 A;  1N33 K;  3ZSO A;  2HBJ A;  4FWL A;  1X9M A;  5C12 A;  4BE2 A;  4YOV A;  2P9P B;  3JYT A;  1QE1 A;  3O5B A;  3QDK A;  1IKV A;  4CK1 A;  2HHQ A;  4CJ4 A;  2P5G A;  1ILY A;  2W6K A;  4GVE A;  3K5L A;  4WFN L;  3QNN A;  1QSL A;  4JI6 K;  4H8K A;  1MWM A;  3I0S A;  4KHW A;  2Q0R A;  4M3T A;  4W5O A;  4E19 A;  3VA0 A;  1WSJ A;  3KWG A;  3PSI A;  1NJW A;  1Y64 A;  5BRE A;  1VQO N;  4IG0 A;  1ASW A;  5C2F A;  1UOC A;  3L4Q A;  3QFU A;  4PHT X;  3M8Q A;  3THX A;  1GOA A;  4MLE A;  4JN4 A;  2PYL A;  1XMO K;  4B9L A;  2QWR A;  3P4I A;  1ASU A;  3T1A A;  3SAH A;  4JS5 A;  3WQT A;  1EQY A;  4LF9 K;  3SUP A;  1WSE A;  3VPZ A;  4BAC A;  1OVQ A;  3BEX A;  3CCQ N;  1C1C A;  3KHY A;  2P9U B;  3EE9 A;  5B8H A;  3MWT A;  5EY4 A;  3S41 A;  3NVM A;  4ILJ A;  4KHU A;  4A61 A;  5AQH A;  1M1K O;  3V9U A;  2E2Q A;  1XWL A;  1N36 K;  4PKH A;  1XQS C;  4M45 A;  4PKG A;  3VQC A;  1YJN N;  1VQ9 N;  2HVH A;  3ATU A;  3PSF A;  4N5S A;  4CGD A;  3UKU B;  1SL0 A;  5BPL A;  4KI6 A;  4LFB K;  1S1X A;  1TK0 A;  1BQM A;  4MO5 A;  4FM2 A;  2F9W A;  4IFY A;  1G15 A;  1MDU B;  1QZ6 A;  4DR4 K;  4B9M A;  3PX0 A;  3FE1 A;  1GLB G;  1RDU A;  5KPT A;  3AVN A;  4BWJ A;  3MX2 A;  4FVM A;  1JXE A;  5FPM A;  5JS2 A;  3KK2 A;  2ZM6 K;  5IT9 O;  3A8Y A;  4BRE A;  5KPZ A;  5CHI A;  4FJN A;  1N5Y A;  4CEA A;  2QWQ A;  5I9E B;  2HHT A;  4FJK A;  3ZET A;  2NRZ A;  4CEB A;  3WXI A;  5GAE P;  1VSD A;  4MO4 A;  1EWQ A;  1W9H A;  4JI8 K;  3TPQ A;  4GKJ K;  3O08 A;  1T44 A;  2NRH A;  4O4G A;  4CVN E;  4FJM A;  4DV4 K;  4CIF A;  1HX1 A;  3ZEU A;  3L2W A;  4DTM A;  5LMN K;  3U3Y A;  2WUS A;  4ELU A;  4E7I A;  1T05 A;  4NYF A;  3H08 A;  2YHX A;  3M5R A;  1RTI A;  3T7Z A;  3CYM A;  1TVR A;  3S3M A;  3HSC A;  3V1Q A;  4NCB A;  3VQ4 A;  4ICL A;  2YHB A;  4B3T K;  2D4W A;  1HQU A;  3V9S A;  4YDU C;  1FK9 A;  4CJU A;  1C0G A;  3AVI A;  3ENH A;  4IEI A;  1YTA A;  4O8U A;  2Z1G A;  1BCO A;  1T03 A;  4BDY A;  1XUP O;  1BL3 A;  2CH5 A;  3C6T A;  2FBX A;  1RDC A;  4CJS A;  3AGR A;  1RT7 A;  1IH7 A;  1K8K B;  2ITM A;  2A42 A;  5KTQ A;  2OYQ A;  4K8X A;  2JLE A;  3RWU A;  4JK9 A;  3CCS N;  1E4F T;  3BGR A;  4CF8 A;  4E0D A;  2Q97 A;  4DU4 A;  4WQ5 C;  1W0H A;  2A41 A;  2QTD A;  3FZL A;  5BPN A;  5F1X A;  3OYI A;  2XY7 A;  1RBV A;  2YHA A;  4LFC K;  1VQ6 N;  4CJQ A;  5KRS A;  3FLC O;  3A5M C;  4M3R A;  1T3V A;  3IDH A;  2IVO A;  3B6P A;  3A2F A;  3SPY A;  4R79 A;  4BRD A;  4DV7 K;  1ZYQ A;  3OYL A;  3SV4 A;  4FWK A;  3L6Q A;  4AHS A;  4CF9 A;  4CBX A;  4EP4 A;  3QEV A;  1QTM A;  4R5P A;  2E1Z A;  1D9D A;  3QIO A;  5CE3 A;  5MLC Q;  5AQP A;  1S5J A;  3NF8 A;  1KD1 O;  4FPA A;  3CC7 N;  3C0B A;  3EKS A;  1HRH A;  4GV9 A;  1IKX A;  1GLF O;  2A40 A;  4IEE A;  3CC4 N;  4C1N I;  1O1W A;  2V7Z A;  3U8X A;  1NK8 A;  2NRV A;  2XHB A;  4CZI A;  4OX9 K;  5C10 A;  3LP0 A;  1RIL A;  3F9M A;  3BDP A;  4UQG A;  3CER A;  1YAG A;  3ZT1 A;  4EZ9 A;  1HNW K;  4OPA A;  2E8A A;  3DOK A;  4DF8 A;  4JKE A;  4DCH A;  5BR9 A;  3CCM N;  4EIA A;  3DRR A;  5HL7 L;  3EL2 A;  3WNE A;  1X1P A;  4B9T A;  3C7N B;  1EKE A;  5M1K A;  1NKC A;  1EO1 A;  1BIU A;  2HHX A;  1H1V A;  3GG4 A;  5JLH A;  4F8R A;  2GV9 A;  4JD2 A;  2FF6 A;  3ZSW A;  3ZLJ A;  4G1Q A;  2YNF A;  1BUP A;  3GBT A;  1NK7 A;  4CJP A;  3R1X A;  2OPR A;  5AQJ A;  1DGK N;  4FM0 A;  2ITG A;  3CQX A;  4CK2 A;  4JRP A;  2F8T A;  4DTU A;  1NJX A;  3DAW A;  1YI2 N;  3T69 A;  2VWJ A;  2FSN A;  5AQN A;  2W41 A;  3MAQ A;  3N4P A;  3VOV A;  1B92 A;  2E6L A;  1RT3 A;  1KFD A;  1S9G A;  3WQU A;  2O8F A;  1D4X A;  1Q8I A;  3THY B;  4I6M A;  4CBW A;  4UY8 O;  1S3X A;  4M41 A;  5DK5 A;  3DLG A;  2X6N A;  4FXD A;  4A59 A;  4O5B A;  1TYQ B;  5AQL A;  4H0P A;  4JRQ A;  4FK4 A;  3WXK A;  1IBM K;  4FZZ A;  3DYA A;  2HNZ A;  5KPR A;  2P9K B;  2JWL A;  4XH5 A;  3AA4 A;  3DLB A;  4CIG A;  3D0P A;  5CR4 A;  4XIU A;  3J81 O;  4CJ5 A;  4E7K A;  4CED A;  2WTU A;  2A1R A;  4DQR A;  3CET A;  3VA3 A;  5GAG P;  4CZF A;  4W5R A;  2PAV A;  2HHW A;  1IKW A;  3EZ5 A;  3QES A;  4RW8 A;  1TK5 A;  3C95 A;  2Q2R A;  3R6M A;  1ATN A;  1KAZ A;  3ZSQ A;  4BR2 A;  2O8C A;  1XI1 A;  2HND A;  2I7N A;  4B3M K;  1C0U A;  3LPT A;  3K5O A;  4CGJ A;  2G8V A;  3VQ9 A;  2G8K A;  1VQN N;  5AQY A;  3KKR A;  4C8L A;  4MDB A;  1OKJ A;  3O4Q A;  2LSN A;  2VYP A;  1CLQ A;  4WF9 L;  3JAM O;  1W2B M;  1VSI A;  1JLF A;  1TKT A;  2DFF A;  3V81 A;  1RBU A;  4GNI A;  3ZT0 A;  4K8Z A;  4EZ6 A;  3J7Z O;  3QET A;  1NG9 A;  3TAM A;  1U6Z A;  2BUP A;  2YNG A;  1VRT A;  3WNH A;  1OVY A;  4LH5 A;  4FWR A;  3NF6 A;  4KTZ A;  2H3G X;  5J2P A;  4O0I A;  1HYS A;  1Y97 A;  4BG9 A;  3MWP A;  3KJV A;  2QEX N;  3HPH A;  1FXX A;  4CFA A;  1LCU A;  3MMV A;  3CCJ N;  2UXB K;  3QEW A;  1KC8 O;  1IG9 A;  4TSX A;  3FZM A;  4JK7 A;  4HWI A;  1TL1 A;  5AR0 A;  4C8M A;  3UB5 A;  3VEY A;  1ZBI A;  1VRU A;  4AIL C;  1HNI A;  4DQQ A;  1DKG D;  1T8E A;  2VQF K;  1QQN A;  3SJH A;  4BGB A;  4JYA K;  4FJ5 A;  3ZT4 A;  3CQY A;  1S22 A;  1SS6 A;  1BA1 A;  2D0B A;  2UUC K;  4BE1 A;  2F4V K;  3OYF A;  4BR0 A;  4B8A B;  3AVH A;  4RTF D;  3LP2 A;  3LAK A;  4CHY A;  2IAJ A;  4BRQ A;  4W5Q A;  4ZHR A;  3U9Z A;  2E5L K;  3I33 A;  4FWQ A;  4H0O A;  1DEJ A;  4B8C A;  4DV3 K;  2G8H A;  3F9K A;  3AVJ A;  4B1X B;  3QEP A;  3OYD A;  3U4L A;  4IKF A;  4BQZ A;  1WSF A;  3GDQ A;  3NF7 A;  4H0V B;  3SAG A;  1JLA A;  1HLU A;  1VSH A;  3NAE A;  1BA0 A;  2NNW A;  3O1B A;  3AVL A;  2UYT A;  3M6G A;  4PWD A;  4IOC L;  1XMQ K;  3H46 O;  4FLY A;  3I8D A;  1J6Z A;  1BGX T;  4JKG A;  2FC0 A;  4CFD A;  4YOX A;  2VCP A;  3OYC A;  5FPD A;  4CFB A;  4IOX A;  2YJE A;  4RW9 A;  4OKK A;  1XNR K;  2WBN A;  4AHU A;  4FJX A;  5AQK A;  3MN9 A;  3BP8 A;  1JL1 A;  3TWH A;  5K14 A;  3O9Q A;  3MEC A;  3H3N O;  1RDB A;  2DY4 A;  4KTQ A;  1WSG A;  1KVB A;  3RSE B;  3E9P A;  2OTL N;  1TK8 A;  5LJW A;  4CHQ A;  1Q9X A;  4EHU A;  4JS4 A;  3HK2 A;  1B9D A;  3ISN C;  2VWB A;  4CZE A;  1J5E K;  4DQP A;  1RCH A;  3OS0 A;  5AQG A;  3AVA A;  3VTI A;  1VSF A;  3LWL A;  4IDH A;  3KWI A;  3CJ7 A;  1B9F A;  3KLI A;  4IWV A;  4M7Y A;  1YUW A;  2NRR A;  2GTD A;  2O8E A;  1RGI A;  3G10 A;  4DF4 A;  4B1W B;  4B9N A;  4FW2 A;  1WAJ A;  4CGH A;  4QOZ B;  4Q0B A;  2ZE2 A;  3R3L A;  4GW6 A;  1DTT A;  5KRT A;  3CCE N;  4Z4F A;  3PX6 A;  4Z4E A;  1HJR A;  1X9J A;  3H6E A;  4GVM A;  2QK9 A;  4IFV A;  3TTC A;  3AO4 A;  4CCH A;  3T1H K;  4F2S A;  2FBT A;  3ZSX A;  4N76 A;  1VQ7 N;  1R0A A;  3ZSV A;  3LDQ A;  3ALY A;  4CJT A;  1YIT N;  3TSQ A;  1OH7 A;  1SKS A;  4N47 A;  3ZYY X;  3VGL A;  2B6A A;  4KH6 A;  3L0Q A;  3O9U A;  2VGM A;  3HI0 A;  3VEZ A;  3NVK A;  4HVJ A;  3OVN A;  2HHU A;  2HHH K;  4Y1D A;  4W5T A;  4L8R B;  4BC4 A;  2E20 A;  4FJG A;  4RWT A;  1SAZ A;  3LDL A;  4HCB A;  3N4Q A;  2B4J A;  3LM2 A;  1HKC A;  3A5O C;  5EOY A;  4M3Y A;  2D0C A;  3O3F A;  5AQF A;  2NUB A;  3HJF A;  3VEX A;  3KK3 A;  3OA9 A;  3BF1 A;  3P1G A;  3CG7 A;  4DUY K;  4JKC A;  4JI3 K;  4CJK A;  4DR7 K;  1RT6 A;  5TKW A;  3SCX A;  1HNZ K;  3TR8 A;  3CD6 N;  1OH8 A;  4ID1 A;  1HNV A;  2EHG A;  4PUO A;  2F96 A;  4M63 C;  3S3N A;  4OKJ A;  1U45 A;  3KK7 A;  2KZZ A;  1NU0 A;  4KTW A;  3D45 A;  1MU2 A;  4KBO A;  2PY5 A;  2VGN A;  5FDL A;  1REV A;  2YHW A;  4CGG A;  4DMN A;  3FR0 A;  2ASP A;  4J2E A;  1GLE G;  4OPK A;  3K57 A;  4CJW A;  5BN9 A;  1JCE A;  4Z4I A;  2ZJR L;  1ITG A;  5M1N A;  5SZT A;  4AHV A;  4FO0 A;  4CBU A;  1KTQ A;  2Y1J A;  1BO5 O;  3AVB A;  4BGA A;  3TAG A;  3HRG A;  2FSJ A;  2QI2 A;  4CJL A;  4OKE A;  2VG5 A;  3O4N A;  4K25 A;  3P39 A;  2DTU A;  3U3G A;  4CZH A;  4BDP A;  3NE6 A;  1QQM A;  1RT5 A;  2VWK A;  5ADX H;  3QFP A;  3NH2 A;  1YHQ N;  4KAZ A;  4A57 A;  3LDO A;  3QIC A;  2GBZ A;  3OYB A;  1NJY A;  4H5V A;  1HYZ A;  1BOT O;  3ZSZ A;  1YF5 L;  3H1V X;  3Q7B A;  4DLG A;  3VEN A;  1NGG A;  3CCR N;  4FJ9 A;  3SPZ A;  2XO7 A;  4C8K A;  1Q9Y A;  3J7A P;  1D9F A;  4AM6 A;  3TAE A;  2J4R A;  2W40 A;  4YOT A;  4BRN A;  5AQZ A;  3V4I A;  3UKR B;  1O13 A;  3V9X A;  4GY2 B;  4E3S A;  4FJI A;  4KHP K;  3KTQ A;  2NZT A;  3OYE A;  4YDU A;  1XC9 A;  1P90 A;  4CIE A;  3MN6 A;  3NGI A;  4XEI A;  1MWK A;  4AF1 A;  4FJ7 A;  1WBB A;  1UA1 A;  3VGK A;  3LDN A;  1JL2 A;  4ID5 A;  1RT4 A;  2NLX A;  5KI6 A;  1VSJ A;  2FBY A;  3BY5 A;  3CF5 L;  4FW1 A;  3C7N A;  1RDA A;  4BR4 A;  5KGX A;  3TAQ A;  2IOC A;  4H4O A;  4GV3 A;  3DXK A;  4O8K A;  2P9S A;  4WQ5 A;  3C6H A;  4KH4 A;  1Q18 A;  3IAY A;  1CZ9 A;  1RBS A;  4BVP A;  1T6D A;  3RMB A;  3W3D A;  4DSK A;  1JLG A;  4BE0 A;  5AZI B;  1ATS A;  4FWM A;  1ESV A;  4CK3 A;  3F5T A;  3VQD A;  2E2O A;  5F0X A;  4DQS A;  1WSI A;  1BCM A;  4BRA A;  2YKM A;  4E1M A;  4OGE A;  1WUA A;  1BHL A;  1W97 L;  4RW7 A;  2Q1N A;  3CME N;  1KAX A;  3CPE A;  3D7E O;  4I2P A;  4B3R K;  4B08 A;  3VQ5 A;  4BC3 A;  3KLF A;  3VES A;  4IZ9 A;  4BG8 A;  1LAW A;  3K0S A;  4C8N A;  3S9H A;  3NMU A;  2UXD K;  1TYQ A;  5FPE A;  4OPJ A;  3P31 A;  3V6D A;  3PO4 A;  4CJR A;  3CJA A;  2IDO A;  5DMR A;  2P9I A;  1NBW A;  2P9K A;  3QEX A;  4FJJ A;  2UU9 K;  5AQM A;  1NGB A;  3DOL A;  4Z4H A;  3QIN A;  4DR2 K;  3K9K A;  3VQB A;  3SI6 A;  3VQ6 A;  1ZBS A;  4N56 A;  2O4I A;  3S3O A;  1DLO A;  1S1U A;  4DFJ A;  2QWL A;  4B1Y B;  2HF4 A;  2D0A A;  3PO5 A;  3V9Z A;  4EFH A;  5AQI A;  3THV A;  3WXM B;  3HP6 A;  3L8B A;  1NGA A;  3BZK A;  2HHV A;  4KKO A;  4JK8 A;  4PA1 A;  3KK1 A;  2XY6 A;  3RMA A;  2YJF A;  5AQW A;  4O0J A;  3VER A;  1RT1 A;  3D6R A;  4QAG A;  1S1W A;  5AZJ B;  2AA4 A;  4FL9 A;  4NCG A;  4Q5V A;  4NB4 A;  4BRL A;  3RMC A;  4G9Z A;  4FYD A;  1VHX A;  1JXB A;  2F9T A;  4WQ4 C;  5FRM A;  4A62 A;  1TKD A;  4AH9 A;  5M1O A;  4NYN A;  1KAY A;  3A5N C;  3JS6 A;  5AQO A;  4F2R A;  3MED A;  1EXQ A;  4B3S K;  1L3S A;  3CCV N;  4U7B A;  1YT3 A;  2O8D B;  3OBW A;  4CJE A;  2HVI A;  3PIO L;  4DU1 A;  3DRS A;  3L4I A;  4EP5 A;  4I2Q A;  1NGJ A;  2GWJ A;  2GEL A;  1RDD A;  4C8O A;  5AFU H;  4BRI A;  1JCG A;  1UAX A;  3O3G A;  4J2B A;  1FJG K;  5FPN A;  3SMP A;  2ZGY A;  4DR3 K;  4EHT A;  4H0X B;  4B1Z A;  4FLX A;  3O9T A;  2OTJ N;  1K6Y A;  3GOI A;  1X3M A;  3ASM A; 
#chains in the Genus database with same CATH homology
 4H4M A;  3OS1 A;  3QO9 A;  3QEW A;  1IG9 A;  1JLE A;  1GOC A;  1LWF A;  4TSX A;  1TL1 A;  4DQP A;  4C8M A;  4FJH A;  1ZBI A;  1NOY A;  3MXJ A;  1VRU A;  3HVR A;  1HNI A;  1RTJ A;  4AIL C;  4FLT A;  1L3T A;  3DLK A;  4DQQ A;  4F4K A;  2YKN A;  1T8E A;  1VSL A;  4LSN A;  2OPQ A;  3DLH A;  2KTQ A;  2WOM A;  1C0M A;  4DS4 A;  4FJ5 A;  3ZT4 A;  5C42 A;  2D0B A;  2E6M A;  3VQP A;  4DSF A;  2ZD1 A;  5HLF A;  1J5O A;  4BE1 A;  4HTU A;  4CER A;  1CZB A;  2OPS A;  3WNG A;  4ZTF A;  2X6S A;  3OYF A;  4KHN A;  4B8A B;  3AVH A;  3QIP A;  3SUN A;  3LP2 A;  3LAK A;  4CHY A;  4KHQ A;  2IAJ A;  4W5Q A;  1KLN A;  2IC3 A;  4ZHR A;  2KFN A;  3TAN A;  3FFI A;  4KI4 A;  4KRE A;  4B8C A;  1LWC A;  3NDK A;  2G8H A;  1C1B A;  4JLH A;  3NH0 A;  3F9K A;  3AVJ A;  3HL8 A;  3QEP A;  2BGG A;  3OYD A;  2KQ2 A;  2BE2 A;  4IKF A;  5I3U A;  3RRH A;  1D5A A;  2A1S A;  1IKY A;  1ZBU A;  1KVA A;  2G8F A;  3NHG A;  1WSF A;  4CEC A;  3NF7 A;  4N41 A;  4B9V A;  2HW3 A;  4RG8 A;  3G0Z A;  4LH4 A;  4DQI A;  3OYN A;  1JLA A;  1RT2 A;  4IG3 A;  5CZ2 A;  3RR7 A;  1VSH A;  2P1J A;  3HO1 A;  3OY9 A;  3NAE A;  1UA0 A;  3AVL A;  3MXI A;  1N6Q A;  4CHP A;  3KLG A;  4DTP A;  4CF0 A;  1QSS A;  3AVK A;  4NCA A;  1RTH A;  1U49 A;  1SV5 A;  3KD5 E;  4CHO A;  4PWD A;  4LSL A;  2X78 A;  1RNH A;  4B3O A;  2EX3 A;  4DTN A;  2KFZ A;  4DFM A;  3ZSO A;  4HUG A;  3CM6 A;  3I8D A;  4FLY A;  1XHZ A;  1X9M A;  1L3V A;  1BGX T;  4KB1 A;  4BE2 A;  3SQ0 A;  4FK0 A;  3TAR A;  2FC0 A;  4CFD A;  5J1E A;  3RRG A;  3OYC A;  3JYT A;  4CFB A;  4E7L A;  1QE1 A;  4DFK A;  4BWM A;  1IKV A;  4CK1 A;  2HHQ A;  2BDP A;  4RW9 A;  4CJ4 A;  3DRP A;  4OKK A;  5I42 A;  1J53 A;  4J2A A;  4FM1 A;  2WON A;  3VN5 A;  4AHU A;  2P5G A;  4FJX A;  2RKI A;  3K5L A;  1JL1 A;  3TWH A;  3QNN A;  5HP1 A;  1QSL A;  2Q3S A;  5K14 A;  2IGI A;  4H8K A;  3SZ2 A;  3MEC A;  3I0S A;  4KHW A;  3KLH A;  4M3T A;  3KD1 E;  2R7Y A;  1RDB A;  2DY4 A;  5JS1 A;  4W5O A;  3C94 A;  4E19 A;  3VA0 A;  3LDS A;  4KTQ A;  4CFC A;  1WSG A;  1WSJ A;  1KVB A;  3HPG A;  4CJV A;  4OLA A;  1NJW A;  1TK8 A;  4HCC A;  4IG0 A;  1ASW A;  4CHQ A;  2KW4 A;  1UOC A;  2ZQB A;  3HVT A;  1X9S A;  1Q9X A;  4I9L A;  3OYH A;  1B9D A;  3ISN C;  4JS4 A;  3M8Q A;  4DS5 A;  2GUI A;  3PV8 A;  1GOA A;  2G8I A;  3JSM A;  1U04 A;  5HRO A;  1EET A;  4J2D A;  2PYL A;  4CF1 A;  1TKZ A;  2VG7 A;  3VQA A;  4B9L A;  3AVF A;  3LZI A;  4LD0 A;  3P83 D;  1ASU A;  1WNS A;  3T1A A;  4CE9 A;  4JS5 A;  1RCH A;  3OS0 A;  4E7H A;  2HMI A;  4E89 A;  4KB0 A;  3NFA A;  3SUP A;  1WSE A;  4M3U A;  3DLR A;  3AVA A;  5HRP A;  4BAC A;  4DTS A;  3HXM A;  1C1C A;  1JKH A;  2XY8 A;  4OJR A;  1TV6 A;  1VSF A;  3LWL A;  4KHU A;  1A5X A;  3HYF A;  3V9U A;  1B9F A;  3HT3 A;  3KLI A;  3DLE A;  2Z1J A;  1LW0 A;  5J2N A;  3T3F A;  2HNY A;  2RF2 A;  1XWL A;  3G10 A;  3LAN A;  4DF4 A;  3RR8 A;  4KPY A;  3ULD A;  3L2V A;  2RN2 A;  4CGI A;  4B9N A;  1ZBF A;  4M45 A;  3ZCM A;  4FW2 A;  3NH1 A;  4CHZ A;  1WAJ A;  3VQC A;  4CGH A;  5J2M A;  4QOZ B;  4Q0B A;  2ZE2 A;  2HVH A;  3AVC A;  1KSP A;  5CYQ A;  4GW6 A;  1DTT A;  2E4L A;  5KRT A;  4Z4F A;  3PX6 A;  4N5S A;  4CGD A;  4KHY A;  1SL0 A;  1HJR A;  4Z4E A;  4Z4G A;  4KI6 A;  4GVM A;  1JLB A;  1S1X A;  2QK9 A;  3KKS A;  4IFV A;  3AO4 A;  1BQM A;  1TK0 A;  4CCH A;  4F2S A;  4FM2 A;  4PY5 A;  2AJQ A;  2FBT A;  4IFY A;  3ZSX A;  1G15 A;  2W42 A;  4DSJ A;  4N76 A;  4B9M A;  1WN7 A;  4DSE A;  3PX0 A;  1R0A A;  3ZSV A;  2P5O A;  5D3G A;  1U4B A;  1F21 A;  3ALY A;  4CJT A;  4O55 A;  1RBR A;  1QHT A;  3AVN A;  4BWJ A;  3HST B;  4FVM A;  5JS2 A;  1JXE A;  4N47 A;  3KLE A;  1HPZ A;  3KK2 A;  1SKS A;  1L3U A;  2B6A A;  1UWB A;  3B6O A;  4FJN A;  1N5Y A;  3VQ8 A;  4KRF A;  3LWM A;  5C24 A;  4CEA A;  4HVJ A;  3OVN A;  5EU7 A;  2HHU A;  1LWE A;  2O4G A;  2YNI A;  4Y1D A;  4W5T A;  4L8R B;  4FJG A;  4FJK A;  2HHT A;  4CEB A;  1EP4 A;  4HCB A;  4QCL A;  2B4J A;  1VSD A;  2B5J A;  1IO2 A;  3LAM A;  4M3Y A;  2D0C A;  3O3F A;  1LV5 A;  1W9H A;  3NGZ A;  3TAP A;  2NUB A;  3SV3 A;  3HJF A;  3MEG A;  3SQ4 A;  1C1A A;  3KK3 A;  1QSY A;  3AVM A;  3P1G A;  4O4G A;  3HPO A;  1TL3 A;  3CG7 A;  4FJM A;  4CJK A;  1RT6 A;  3SCX A;  3CM5 A;  1KLM A;  3ZT3 A;  4CIF A;  4CHN A;  3AVG A;  3L2W A;  4DTM A;  3U3Y A;  3PY8 A;  4ELU A;  3TR8 A;  4E7I A;  1T05 A;  4B9S A;  4NYF A;  3H08 A;  4ID1 A;  2EHG A;  1HNV A;  3ZSR A;  5SWM A;  4HHT A;  4HUF A;  4PUO A;  4M42 A;  1X9W A;  2F96 A;  1RTI A;  3S3N A;  4CEE A;  3CYM A;  4FCY A;  1TVR A;  4OKJ A;  3SJJ A;  3S3M A;  3V1Q A;  1U45 A;  4NCB A;  3VQ4 A;  2KZZ A;  1SL2 A;  4ICL A;  4KTW A;  3D45 A;  2YHB A;  4RW4 A;  1MU2 A;  3DM2 A;  4FLW A;  3QEI A;  4AHR A;  3RMD A;  4PQU A;  1HQU A;  4FLZ A;  3V9S A;  1S6P A;  2PY5 A;  1NK0 A;  1NKE A;  4DLE A;  1NK5 A;  3L2U A;  5FDL A;  1FK9 A;  1REV A;  3KIO A;  4CGG A;  4CJU A;  3AA3 A;  3AVI A;  3LPU A;  4DMN A;  1SKW A;  4J2E A;  1YTA A;  2Z1G A;  4OPK A;  1BCO A;  4CEZ A;  1T03 A;  1NK9 A;  3K57 A;  4DU3 A;  4BDY A;  1D8Y A;  4CJW A;  1BL3 A;  1I3A A;  4DTR A;  2ATQ A;  3C6T A;  4Z4I A;  1ITG A;  1RDC A;  2FBX A;  4CJS A;  5SZT A;  1RT7 A;  3L3U A;  4AHV A;  3OS2 A;  1IH7 A;  4E7J A;  1VSK A;  5KTQ A;  3O3H A;  1KTQ A;  2Y1I A;  2OYQ A;  4K8X A;  2Y1J A;  2JLE A;  1CXU A;  1VK0 A;  3AVB A;  3RWU A;  1A5W A;  3V9W A;  3ZT2 A;  4HUE A;  3TAG A;  3IS9 A;  3BGR A;  3AO1 A;  4CF8 A;  3IRX A;  3OYM A;  4E0D A;  1S6Q A;  4CJL A;  4OKE A;  1XHX A;  4CJF A;  4Z0U A;  4DU4 A;  2VG5 A;  3O4N A;  2FBV A;  1W0H A;  1NOZ A;  2DTU A;  1QS4 A;  2XY7 A;  3OYI A;  3U3G A;  2XY5 A;  1WLJ A;  3LP1 A;  4BDP A;  2DFH A;  4CGF A;  1RBV A;  1C0T A;  1DTQ A;  2YHA A;  1VSE A;  3NE6 A;  3E01 A;  1RT5 A;  2VWK A;  4CJQ A;  5HRR A;  3NH2 A;  5KRS A;  1C6V A;  4M3R A;  4KAZ A;  3MEE A;  3P5J A;  4W5N A;  3B6P A;  3A2F A;  3SPY A;  2GBZ A;  4F3T A;  3LAL A;  3OYB A;  1TGO A;  1NJY A;  1ZYQ A;  3OYL A;  3F73 A;  3SV4 A;  2ETJ A;  1HYZ A;  1S9E A;  4AHS A;  1Z25 A;  3ZSZ A;  4ZTJ A;  4CF9 A;  3QEV A;  4EP4 A;  3M8P A;  1L5U A;  1QTM A;  3TI0 A;  3LZJ A;  3L2Q A;  4DLG A;  4R5P A;  2P51 A;  5FRN A;  4FJ9 A;  3SPZ A;  3VQQ A;  2XO7 A;  1D9D A;  1KFS A;  3QIO A;  4C8K A;  2OPP A;  2QXF A;  1Q9Y A;  1D9F A;  3K59 A;  1S5J A;  2VG6 A;  3NF8 A;  4OLB A;  2D5R A;  3V1O A;  3TAE A;  1HRH A;  1IKX A;  3TAF A;  2BAN A;  3L3V A;  4FK2 A;  3V4I A;  1GOB A;  3V9X A;  3TAB A;  3ITH A;  4E3S A;  4FJI A;  1O1W A;  1U48 A;  4CEQ A;  3KTQ A;  1NK8 A;  3OYE A;  4MFB A;  2XHB A;  1XC9 A;  1BQN A;  3LP0 A;  1RIL A;  1CXQ A;  3BDP A;  4UQG A;  4CF2 A;  4CIE A;  1ZBH A;  5E41 A;  4GMJ B;  3ZT1 A;  4EZ9 A;  4CEF A;  2JGU A;  3NGI A;  3DOK A;  2QKB A;  2Z1I A;  4FJ7 A;  3WNF A;  1EX4 A;  4DF8 A;  3U6F A;  1UA1 A;  2DFE A;  1JL2 A;  4ID5 A;  2G8W A;  1RT4 A;  3DRR A;  4ELT A;  1J9A A;  3WNE A;  1X1P A;  2FBY A;  1VSJ A;  3C6U A;  5KI6 A;  3I0R A;  4FW1 A;  1EKE A;  3VQE A;  5HRN A;  1RDA A;  1WAF A;  4B9T A;  1SUQ A;  5C25 A;  1NKC A;  1BIU A;  5KGX A;  2HHX A;  2YV0 X;  3VQ7 A;  4BDZ A;  4RW6 A;  2IOC A;  4H4O A;  3TAQ A;  4F8R A;  3IG1 A;  2GV9 A;  3EYZ A;  3ZSW A;  4O44 A;  2HB5 A;  4AHT A;  1TKX A;  2YNF A;  3HPH A;  4G1Q A;  1NK7 A;  3AA5 X;  3OJU A;  4CJP A;  4ELV A;  3IAY A;  1CZ9 A;  1RBS A;  3NF9 A;  1VSM A;  3OJS A;  1QQC A;  3K58 A;  4FLV A;  3QER A;  2OPR A;  3RMB A;  4DSK A;  1BIS A;  1S1V A;  4IDK A;  3K5N A;  4FM0 A;  1JLG A;  2ITG A;  3NGY A;  4LY7 A;  4BE0 A;  4CK2 A;  4JRP A;  2XRI A;  4CK3 A;  4DTU A;  2F8T A;  3MXM A;  3VQD A;  1NJX A;  3RTV A;  2VWJ A;  1FKP A;  4DQS A;  1WSI A;  1BCM A;  3M8S A;  3MAQ A;  4Z4C A;  3DMJ A;  2YKM A;  2Z1H A;  1U47 A;  4I9Q A;  1B92 A;  4E1M A;  2E6L A;  5FRO A;  3T19 A;  3HP9 A;  4KHS A;  1ASV A;  1RT3 A;  4OGE A;  3QNO A;  3HK2 A;  2OZS A;  4I7F A;  1KFD A;  1S9G A;  3CQ8 A;  4DFP A;  2HHS A;  1BHL A;  3CFO A;  1RTD A;  1J54 A;  4RW7 A;  1T7P A;  2PYJ A;  1Q8I A;  1NK4 A;  3NCI A;  1NKB A;  3UIQ A;  4M41 A;  5DK5 A;  3DLG A;  4I2P A;  4M3Z A;  1HMV A;  2X6N A;  4B08 A;  3OYK A;  3VQ5 A;  4B9U A;  4FXD A;  3KLF A;  4M3W A;  4O5B A;  1LAW A;  3AV9 A;  5HRS A;  4C8N A;  3S9H A;  4OPJ A;  4DTX A;  3AA2 A;  4JRQ A;  4DSL A;  4KFB A;  1WSH A;  3V6D A;  3PO4 A;  3ZSY A;  4M3X A;  4CJR A;  4FK4 A;  1HQE A;  4FZZ A;  3DYA A;  2HNZ A;  2IDO A;  5DMR A;  4E1N A;  3QEX A;  4FJJ A;  1TAU A;  2OA8 A;  3AA4 A;  3DLB A;  4FZX C;  5CYM A;  4CIG A;  3D0P A;  3SUO A;  4XIU A;  3K2P A;  3HM9 A;  3SI6 A;  3DOL A;  4Z4H A;  3SQ2 A;  3SUQ A;  1BI4 B;  3NBP A;  3QIN A;  1BI4 A;  3VQB A;  4CJ5 A;  3VQ6 A;  2I5J A;  4CED A;  4KV8 A;  3CFR A;  4E7K A;  3OYG A;  4N56 A;  4DTJ A;  1SKR A;  3S3O A;  4FJ8 A;  2A1R A;  1DLO A;  1S1U A;  3EY1 A;  4DQR A;  4DFJ A;  2O4I A;  2G8U A;  2D0A A;  3PO5 A;  4KO0 A;  3V9Z A;  1Z26 A;  3VA3 A;  3THV A;  2X74 A;  4W5R A;  3HP6 A;  3L8B A;  1SL1 A;  4FLU A;  1A5V A;  1KRP A;  3OYA A;  4KKO A;  2HHV A;  4CEO A;  3K5M A;  1IKW A;  3EZ5 A;  2HHW A;  1I39 A;  4PA1 A;  3QES A;  2RPI A;  1HYV A;  4RW8 A;  3KK1 A;  1TK5 A;  2OZM A;  4F3O A;  3C95 A;  2XY6 A;  3RMA A;  3DI6 A;  2IS3 A;  5T7B A;  4O0J A;  4MQ3 A;  2KZM A;  3ZSQ A;  1RT1 A;  3PUF A;  4DTO A;  4QAG A;  1S1W A;  1XI1 A;  2HND A;  3AO2 A;  4NCG A;  1C0U A;  3QLH A;  3LPT A;  3K5O A;  4Q5V A;  4CGJ A;  3RMC A;  3M8R A;  2G8V A;  4FYD A;  5CZ1 A;  3VQ9 A;  4DSI A;  1JXB A;  2G8K A;  3SYZ A;  4FJL A;  2YNH A;  1ZBL A;  3OYJ A;  5FRM A;  3KKR A;  4C8L A;  4DWI A;  3L2R A;  3CFP A;  1TKD A;  3O4Q A;  2LSN A;  4AH9 A;  3PX4 A;  4NYN A;  3SNN A;  1CLQ A;  4F2R A;  1YVU A;  1FKO A;  4IBN A;  3MED A;  1EXQ A;  1JLQ A;  1VSI A;  1JLF A;  1KVC A;  4OVL A;  2DFF A;  1TKT A;  3V81 A;  1JLC A;  1RBU A;  1S1T A;  5J2Q A;  4OGC A;  1L3S A;  2QKK A;  4CJ3 A;  1YT3 A;  3ZT0 A;  4K8Z A;  4EZ6 A;  4YNQ A;  4CJE A;  2HVI A;  1LW2 A;  1BIZ A;  3QET A;  4CES A;  1KCF A;  4FZY A;  3TAM A;  4DU1 A;  4CFA A;  4DG1 A;  3DRS A;  3LP3 A;  4YFU A;  2YNG A;  1VRT A;  3WNH A;  1TAQ A;  5KGW A;  4LH5 A;  4EP5 A;  4I2Q A;  2PZS A;  3NF6 A;  4KTZ A;  1RDD A;  4Y1C A;  3V1R A;  1LAV A;  1NJZ A;  5CY4 A;  1UAX A;  3O3G A;  5HBM A;  4C8O A;  4J2B A;  5J2P A;  2F8S A;  4AHC A;  4O0I A;  1YTU A;  1NK6 A;  3AO3 A;  3AO5 A;  1HYS A;  1Y97 A;  3KJV A;  4FLX A;  1RBT A;  4WE1 A;  1K6Y A;  3SQ1 A;  1FXX A;  3ASM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...