3V9WA

Crystal structure of rnase t in complex with a preferred ssdna (tta) with two mg in the active site
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
202
structure length
202
Chain Sequence
b'GLCDRFRGFYPVVIDVETAGFNAKTDALLEIAAITLKMDEQGWLMPDTTLHFHVEPFVGANLQPEALAFNGIDPNDPDRGAVSGYEALHEIFKVVRKGIKASGCNRAIMVAHNANFDHSFMMAAAERASLKRNPFHPFATFDTAALAGLALGQTVLSKACQTAGMDFDSTQAHSALYDTERTAVLFCEIVNRWKRLGGWPLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease T
publication title How an exonuclease decides where to stop in trimming of nucleic acids: crystal structures of RNase T-product complexes
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/dna
total genus 59
structure length 202
sequence length 202
chains with identical sequence B, C, D
ec nomenclature ec 3.1.13.-:
pdb deposition date 2011-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00929 RNase_T Exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3v9wA00
1NOYA 4E7IA 4QCLA 4CJ5A 1NK8A 3P83D 1NJYA 4FJGA 4FZZA 1U49A 3ZSZA 1KVCA 4CJQA 2DFFA 4DSLA 3T19A 1Q9XA 3LWMA 1D8YA 3ZSRA 1NKBA 3K59A 4DF8A 1JLFA 1RBVA 4DFKA 4L8RB 4CJFA 2FBXA 4BACA 4KTQA 1W9HA 1KRPA 4TSXA 4ELVA 4ICLA 4RG8A 4CHNA 3S3MA 2VG5A 5KTQA 1BI4B 4CIFA 3S9HA 1S6PA 2B5JA 3D45A 4GW6A 4K8XA 3C94A 1BI4A 1ZBUA 5CYMA 3AVIA 3CYMA 4CCHA 4JRQA 4F2SA 3VQAA 3MXMA 1T7PA 2YHBA 1TK0A 4PA1A 1JL1A 2Z1JA 4ID5A 3OYLA 4DWIA 1DTQA 5C24A 2BGGA 4CF9A 3P1GA 3A2FA 1IKWA 4E1NA 4KAZA 1F21A 5E41A 5KGWA 1QSYA 2EHGA 1RTHA 4FM2A 2I5JA 2LSNA 2QKBA 4OLBA 4F8RA 3AO1A 4JRPA 4B08A 2GBZA 3ZSQA 1X9MA 3NDKA 4BDZA 1RT6A 2P51A 5KI6A 1RT5A 5J2NA 1NKCA 1WSGA 3DOLA 1I39A 3QIPA 1TK8A 2X6NA 2IC3A 2E4LA 4FK2A 3RTVA 1KLNA 3EZ5A 1S1XA 3G10A 4KI4A 4OGEA 3SQ0A 2FC0A 2OZSA 4IKFA 2QK9A 4FLYA 1RTIA 1C1AA 2DFEA 3DLHA 1U45A 3HK2A 1C6VA 3FFIA 1ASWA 3HVRA 2R7YA 4KHSA 1WSIA 4KFBA 4R5PA 5KRTA 4CHQA 1NOZA 3OYJA 1DTTA 3DI6A 3QEWA 2DFHA 4FLZA 3V4IA 3AVGA 1TKXA 1Y97A 3SQ2A 4BDYA 3DRRA 5J2MA 1JLBA 4DQPA 4FXDA 1IKVA 2X74A 4DQQA 1S1UA 1RDCA 2RF2A 3AVBA 4DF4A 4W5NA 4B3OA 1BQMA 3V9ZA 1FK9A 3QEPA 1RDDA 1BGXT 2G8FA 4FZXC 2BANA 3L8BA 2HHSA 3MEDA 3L3VA 2D0BA 5JS2A 3VA3A 2P1JA 2AJQA 1WSJA 2X6SA 4CJ3A 4CHYA 4HVJA 3KLGA 4CK1A 4DS4A 3HT3A 4W5OA 3V9WA 1TGOA 3SPYA 4OGCA 3MXIA 1NK4A 4NYFA 1VSMA 1ZBHA 4DSIA 3TAEA 3HXMA 4E89A 1TL3A 1VK0A 4DFPA 3L2UA 1UOCA 1WSHA 4H4OA 4O44A 1L3VA 4B9NA 1UA0A 4CF2A 3EY1A 2JLEA 4I9QA 4AH9A 3OYIA 1S1VA 2KTQA 4DTXA 3VQ9A 3OS2A 3TANA 3HL8A 1S5JA 1SKSA 3H08A 3MECA 4DQSA 4FJJA 4CFAA 4CECA 1JXBA 1UWBA 1SV5A 2ZQBA 3NH0A 3PX4A 3QETA 4FM0A 2G8VA 4F2RA 3VQEA 3HM9A 1ZBIA 3TAMA 3LZIA 1SL2A 4C8KA 3DLBA 5D3GA 4E3SA 2G8WA 4HTUA 2O4IA 4KREA 4B9SA 2RPIA 3WNEA 4CEFA 4CGHA 3QEXA 3KK3A 1U04A 1NKEA 1CLQA 3IRXA 1WSFA 1YTUA 1RDAA 4HUFA 4DSEA 3KLFA 4DG1A 4CF0A 3OYGA 4FYDA 2RN2A 1LAWA 3LP2A 5FDLA 3ZSWA 4IFYA 5T7BA 3LWLA 1KLMA 4J2DA 4FK4A 5J2PA 5HBMA 2Y1IA 4DLGA 4FLVA 2FBTA 1JLQA 1KVAA 3V1OA 4YNQA 4DTPA 1J9AA 1JXEA 1NK5A 3ZSOA 2P5GA 3G0ZA 4RW9A 4CGGA 1EKEA 3PX0A 3LP0A 4RW7A 4CJRA 4IFVA 3OYCA 3K5LA 4CJPA 4KHQA 3ULDA 3HPGA 3IG1A 4DQIA 2PZSA 4Z4EA 1RBSA 4O0JA 3CM6A 2FBYA 3HYFA 2HW3A 2OPRA 4CHZA 3NF8A 1RNHA 3NF7A 4NYNA 4HCCA 2HHUA 4DTUA 4B9VA 4O4GA 1TVRA 3I0SA 1VSDA 4DMNA 1ZYQA 4HUEA 4J2AA 1A5VA 4B9TA 1KCFA 2HMIA 3AVMA 5EU7A 4LD0A 2O4GA 4RW4A 4C8LA 4F3TA 1WAFA 2OYQA 3JSMA 1YT3A 4KKOA 2ITGA 3LP3A 3O4QA 1KSPA 1C0MA 3M8QA 1XWLA 2Z1IA 4C8MA 1BISA 1CXUA 3VQPA 2PY5A 3E01A 1WAJA 1RCHA 3WNHA 4LSLA 1L3SA 4ZHRA 3KTQA 3B6PA 1HYSA 3NF6A 4KI6A 1GOBA 4M3XA 4FCYA 3QEIA 3AA5X 1EETA 4FJXA 3DYAA 2E6MA 4BDPA 3ISNC 2XO7A 4BWJA 4ELTA 3ASMA 4CFDA 3NE6A 3TWHA 2FBVA 3V6DA 2XY5A 1LV5A 3OS1A 3TI0A 1UA1A 3M8SA 3TARA 1HNIA 3NH2A 2G8HA 1LAVA 4FJLA 4RW6A 3OYDA 3AO3A 4FLXA 4J2BA 4FJHA 1B92A 4WE1A 1ITGA 3VQQA 1SL0A 2D0AA 3O3GA 3NGZA 1BCOA 3AVJA 3JYTA 2WONA 3I8DA 1CXQA 4E7HA 4KO0A 3K5OA 1VSEA 3LP1A 3ZSVA 2HHTA 1S1TA 3LZJA 3QERA 4Z4IA 4CJEA 4ELUA 3L2QA 3O4NA 1YTAA 1EP4A 1TKTA 5C25A 2F8SA 4N47A 4QOZB 2KQ2A 4FM1A 2XRIA 3DLKA 5I42A 1O1WA 4KB0A 1BHLA 4YFUA 2IGIA 3AVAA 1U48A 4JS4A 3TAFA 4Z4HA 2PYLA 1HMVA 3SPZA 2YNIA 4OJRA 1KVBA 5CZ1A 2XY6A 3AA3A 3LAKA 4LH4A 2D0CA 3C95A 4DU3A 2IS3A 3RMDA 1IH7A 3DRSA 4IDKA 4EP5A 4W5RA 2KW4A 3CQ8A 4AILC 2QXFA 3VQBA 2QKKA 2JGUA 3QESA 1LWFA 3HJFA 4KPYA 2W42A 3C6TA 2YNGA 5HRSA 4E0DA 3THVA 1LWCA 4CF8A 1QS4A 3DLEA 3RMAA 3NFAA 4DU1A 4DSKA 4LY7A 3QNNA 4B9UA 3LPTA 2IOCA 4M3UA 1IKXA 2IAJA 4FJKA 2OZMA 3NBPA 3PO5A 3AVKA 4HHTA 3BDPA 4CHOA 3U6FA 3SQ1A 3EYZA 4PWDA 4B8AB 1QQCA 3RMCA 1B9DA 1XHZA 4KHWA 3KKSA 2Q3SA 4B9LA 3LANA 3SV4A 4OPJA 4DLEA 3SUOA 1FKPA 3OYHA 3VA0A 3SUQA 1T8EA 2YNFA 1HJRA 1D9FA 3AVNA 4CEDA 4FLWA 3TAPA 2DTUA 4CERA 3KLIA 4PQUA 4M42A 2G8IA 1NJZA 3S3NA 5J2QA 4CJVA 3TAGA 3SI6A 1TAQA 3RR7A 1TV6A 1ZBLA 3K5MA 3OY9A 4B8CA 1R0AA 1S6QA 2E6LA 4H4MA 2XHBA 2HHQA 4CGDA 4CJWA 3DM2A 4DFJA 4Z4CA 3LALA 4M3YA 4KHUA 4M3ZA 1GOCA 1BQNA 1DLOA 1JL2A 2YV0X 3OYBA 4KTZA 2YNHA 1VSKA 2D5RA 1SUQA 4FJIA 4Z0UA 1NK0A 4AHVA 3MEGA 3KD1E 1QHTA 1RT1A 3CFPA 5HRRA 5HRNA 1S9GA 1BIZA 3D0PA 3P5JA 2X78A 2YKMA 1IKYA 4FW2A 4CGIA 3NH1A 4H8KA 1HQEA 1UAXA 3OYAA 5FRNA 4Q0BA 3K57A 1T03A 3QEVA 4OVLA 3KIOA 3SCXA 4N41A 1IG9A 3PY8A 3O3FA 1Q9YA 3NAEA 4QAGA 3QIOA 3CFRA 3CFOA 4OKJA 1NK6A 3ZCMA 3ZT4A 1X9WA 5HP1A 1NK9A 3HSTB 3BGRA 3L3UA 3F73A 3TABA 5FRMA 4GMJB 4CJUA 1EX4A 4NCAA 2HB5A 2HNDA 1LW2A 1SL1A 1MU2A 4DTMA 1N6QA 3M8PA 3KLHA 1X9SA 3K2PA 4CJ4A 2G8KA 2A1RA 3KJVA 3PO4A 3HO1A 4ID1A 4NCGA 4M45A 3NGIA 1XHXA 1NK7A 3DRPA 4FK0A 2IDOA 4I7FA 4LSNA 2VG7A 5J1EA 3KD5E 1GOAA 4O0IA 4G1QA 3RMBA 3AVFA 5CZ2A 4CIGA 1C1BA 5CY4A 1FKOA 1HQUA 4GVMA 4DU4A 4FJ7A 4KHNA 4CESA 5FROA 1VSFA 3HPOA 4LH5A 1KTQA 4AHUA 5HROA 4W5QA 4CEZA 4DSJA 4JS5A 4CJKA 3NHGA 1WN7A 3U3GA 1Z25A 3ZSYA 5HLFA 3AO5A 1SKRA 3AVHA 5JS1A 3AO4A 3VQ5A 3VQ7A 1S1WA 1S9EA 4IBNA 3HP6A 2PYJA 3SNNA 3ZSXA 1ASVA 4FW1A 5DK5A 4AHCA 5K14A 2OPPA 1JKHA 1RDBA 4IG0A 3RR8A 4NCBA 1NJXA 1U4BA 4DTJA 1KFDA 2HNYA 4EP4A 2GUIA 4K8ZA 4KV8A 4F4KA 3DLRA 4FJ5A 1Z26A 2XY8A 2XY7A 1SKWA 3I0RA 2KFZA 5HRPA 1N5YA 4DFMA 3RRGA 1C0TA 5CYQA 4Q5VA 3V81A 3AA4A 2RKIA 1KFSA 1VSHA 3VQCA 4FJMA 1G15A 4Z4FA 2KZZA 4N76A 1JLCA 3S3OA 1X1PA 2OA8A 4DSFA 4AHSA 4E1MA 4M3TA 1T05A 3V9SA 1RBRA 5KRSA 4Z4GA 3KKRA 1RBTA 3KK1A 4O5BA 3SQ4A 1JLEA 2BE2A 1HYVA 4C8NA 1QSLA 1ZBFA 2B4JA 4IG3A 1TK5A 4M3RA 3AO2A 2G8UA 2HHVA 2HHWA 2OPQA 1W0HA 4N5SA 3LDSA 3T1AA 1K6YA 4CEEA 3V9UA 4HCBA 4CFBA 4BE2A 3CG7A 2GV9A 2YKNA 3ZT1A 1J53A 3M8RA 1NJWA 4CF1A 3OYNA 4E7JA 3ZT0A 2KFNA 4E7KA 2HVHA 4CHPA 2F96A 2WOMA 4FZYA 4BWMA 2Z1HA 3T3FA 1QE1A 4E7LA 1IO2A 1HPZA 1TKZA 1YVUA 4MQ3A 3OYMA 1J5OA 3LPUA 1L3TA 2BDPA 4FJ8A 4FJNA 1BL3A 1Q8IA 1TL1A 1VRUA 4E19A 2HHXA 3AA2A 1B9FA 3IS9A 1A5WA 2ZE2A 3RRHA 4KB1A 2KZMA 3VN5A 3AVLA 3VQ4A 3OYKA 1J54A 4I9LA 3WNFA 1HYZA 1D9DA 1ASUA 3L2WA 3ITHA 3IAYA 4FJ9A 1TAUA 4FLUA 4BE0A 1FXXA 4B9MA 3UIQA 1C1CA 3WNGA 1HNVA 4I2QA 2VWKA 4I2PA 4AHRA 3DMJA 4CGFA 1XI1A 2P5OA 1CZBA 1LW0A 1RTJA 3AV9A 4OKEA 3VQDA 1RILA 4FVMA 5SWMA 3KK2A 3K5NA 4CJSA 1XC9A 4CIEA 4KTWA 3V1QA 3L2VA 1WLJA 4M41A 4HUGA 1RT4A 3SUNA 3CM5A 3OJSA 3SJJA 3PX6A 5C42A 4J2EA 4CK2A 3OJUA 3NGYA 3HPHA 3MXJA 3SUPA 1JLGA 1I3AA 2VG6A 1A5XA 1VSJA 4CEAA 2EX3A 2VWJA 3O3HA 3PV8A 4CGJA 4XIUA 3KLEA 1VSLA 3OVNA 5I3UA 4OLAA 2Z1GA 3SV3A 4PUOA 2ATQA 4RW8A 4CFCA 2B6AA 4CE9A 4OKKA 2HNZA 3VQ6A 3DOKA 3NF9A 5SZTA 4OPKA 2A1SA 4CJTA 3TR8A 1VRTA 3ZT3A 1BCMA 3PUFA 1RT2A 3DLGA 3V1RA 4ZTJA 3LAMA 1RBUA 1RT7A 1CZ9A 4MFBA 3SYZA 3HP9A 3RWUA 3F9KA 3HVTA 4UQGA 3U3YA 4CEQA 1WNSA 1REVA 3V9XA 1QSSA 4DTOA 1L5UA 4BE1A 1BIUA 2F8TA 3MEEA 3TAQA 2ZD1A 2ETJA 3K58A 1TKDA 2HVIA 4PY5A 2NUBA 4DTNA 4DQRA 4AHTA 4DS5A 3C6UA 5KGXA 3ALYA 1HRHA 4EZ6A 5DMRA 1QTMA 4Y1DA 2Y1JA 3AVCA 3B6OA 4N56A 4ZTFA 3OYFA 3OYEA 4CEBA 3NCIA 1C0UA 4KHYA 1JLAA 3QNOA 4O55A 3QINA 4CJLA 3OS0A 1U47A 4CEOA 4KRFA 4DTSA 1LWEA 4Y1CA 2DY4A 2YHAA 3QLHA 4W5TA 1L3UA 4F3OA 2OPSA 4DTRA 4CK3A 1EXQA 3L2RA 1RTDA 1WSEA 1D5AA 3ZT2A 1RT3A 4FLTA 4JLHA 4C8OA 3VQ8A 1VSIA 3SZ2A 3QO9A 4M3WA 4EZ9A 3MAQA
chains in the Genus database with same CATH superfamily
1YJNN 3CERA 1HX1A 1NK8A 4FJGA 3VEVA 3A5NC 2FBXA 1W9HA 4WQ5A 1S72N 2NRXA 4ICLA 4RG8A 5C10A 1SZ2A 1S6PA 4GW6A 2OANA 1ZBUA 2UXBK 3MXMA 1R59O 4BRMA 1T7PA 1TK0A 1JL1A 4ID5A 4DWIA 4A2BA 2BGGA 4LC9B 1ATSA 3A2FA 1IKWA 4KAZA 1RFQA 1F21A 1WBDA 1C0GA 2EHGA 1RTHA 4NXNK 2I5JA 2UUAK 4BRLA 4JI5K 4H0YB 3U9ZA 1RT5A 5AFUH 3QICA 1TK8A 1DEJA 4FK2A 1VQKN 3RTVA 1KLNA 1S22A 4CVNE 5TKWA 1TYQA 4OGEA 2FC0A 1RTIA 2WUSA 4IZ9A 1C6VA 3VEWA 3HVRA 4KHSA 4FWLA 3OYJA 2P9UB 3QEWA 1W2BM 1Y97A 3SQ2A 1Q86O 5AQYA 3O9UA 1RDCA 3SBTA 5KQ8A 2HBLA 4DF4A 5E26A 3QEPA 2G8FA 4FZXC 3TSPA 2HHSA 1WSJA 4CHYA 3BDPA 4A62A 3KLGA 3HT3A 3SK3A 4DV2K 3FZLA 1Q82O 3MXIA 3HOTA 1NK4A 1ZBHA 3CXCM 4DSIA 4E89A 1VK0A 3IFRA 2PAVA 4BC4A 4I9QA 1S1VA 1VQ4N 1MDUB 4CECA 1M90O 1HKGA 3CQXA 2G8VA 3HM9A 4C8KA 3K9JA 3DLBA 5D3GA 4E3SA 1LOTB 4KREA 1EWRA 3WNEA 4CGHA 1OVQA 3KK3A 1NNEA 1YTUA 4PKHA 4CF0A 2O8BA 4FYDA 1YITN 3KWGA 1JLQA 1KVAA 4O8UA 4IOAL 4CGGA 4IFVA 3WXKA 4DR7K 3HPGA 3IG1A 3IDHA 2FBYA 4Z94A 2QA4N 2F9TA 4CHZA 1SQKA 3CQYA 3NF8A 4HCCA 5AQNA 2FSNA 3CJ1A 4O4GA 3VTHA 5AQFA 1VSDA 3WT0A 1XC3A 4YORA 4HUEA 4J2AA 4B9TA 2HMIA 4LD0A 4NLBA 3LP3A 3O4QA 4GV3A 5AJ3K 3M8QA 3HI0A 3THWB 2QWRA 3WNHA 3MX2A 4C1NK 3J7AP 1MA9B 1J5EK 2P9PA 3UKUA 4JKAA 3O08A 4BVOA 4QS8A 1EETA 1GLFO 3JAMO 3DYAA 4BDPA 2QWNA 2CGLA 1QQMA 5HL7L 3ASMA 3NE6A 4YHHK 2XY5A 1LV5A 4IWVA 3TI0A 1UA1A 4Y0WA 2G8HA 1LAVA 4FJLA 3AO3A 4FJHA 1ITGA 1RDUA 2D0AA 3O3GA 1BCOA 4LF5K 5KPRA 4E7HA 3K5OA 1VSEA 3ZSVA 2E5LK 3CC2N 4Z4IA 5ADXA 4ELUA 3L2QA 2F8SA 4FM1A 3DLKA 5H1SQ 1O1WA 4IJNA 3WXLA 1U48A 1NGAA 4Z4HA 2F4VK 2PYLA 3SPZA 3W0LA 2ZF5O 3G71N 3CCUN 5GADP 3AA3A 3MN5A 4LH4A 1VQON 1SS6A 3RMDA 3DRSA 3DXMB 4X66K 2QXFA 2ASPA 3VQBA 2QKKA 3O9RA 5AR0A 4KPYA 3THXB 5HRSA 3FE1A 1QHAA 3D2EA 4I6MA 4CF8A 1QS4A 5IWAK 3RMAA 3BF1A 3ZETA 4LY7A 1YIJN 2IOCA 3Q7CA 3AVKA 1NGIA 3BZCA 4DR1K 3SQ1A 4B8AB 3U4LA 3UKRA 4FVUA 4DHYA 3KKSA 2Q3SA 3LANA 4ILJA 3SV4A 3VA0A 4JKCA 2WC9A 1IJJA 4ILHA 2RHKA 2DTUA 4MLEA 3EE8A 4X64K 2ZJPL 5J2QA 4CJVA 2D0PA 3CCVN 2YX6A 2NLXA 3WUHA 3CMAN 2HHQA 4DV6K 4CJWA 1V4SA 5F0XA 4DFJA 4Z4CA 4B1VA 3CCSN 1NGCA 5M1KA 3MWPA 4JD2A 5BRHA 3OYBA 2A3ZA 3FGUA 3A0IX 4FJIA 1NWKA 4DR4K 4MDBA 2P9KA 3CFPA 3KD1E 1K73O 5AZIA 3H1QA 4B3SK 1T03A 1IG9A 1Q9YA 3QIOA 3IMXA 3NMUA 3ZCMA 1O13A 1NK9A 2FLOA 5M1NA 2IVNA 3F73A 3TABA 4K42A 2IVPA 2HNDA 1LW2A 1JCGA 2ZGYA 5C2DA 4MO5A 3KLHA 4IOCL 3O8MA 4FWQA 4YOYA 2FF6A 4NCGA 1XHXA 3DRPA 4FK0A 2IDOA 4JK8A 3HM8A 5J1EA 3O4WA 4FJ7A 5C15A 3OA9A 4BRQA 4W5QA 3LDQA 5AZJB 4E1JA 1X3NA 3AVHA 3VQ5A 3VQ7A 2PYJA 1S1WA 3VF2A 1WUAA 5DK5A 4PHTX 2CGKA 1VQLN 3RR8A 4NCBA 1D4XA 4KV8A 1V4TA 2KFZA 5HRPA 1N5YA 4DFMA 2QM1A 3M5RA 3RRGA 3VTIA 1KFSA 1G15A 4BY9C 1EQYA 3GDQA 3WEEB 1E3MA 4DSFA 4E1MA 3CETA 1YUWA 1RBRA 1EO1A 1RBTA 3KK1A 1QSLA 3L0QA 4JK9A 1TK5A 4M3RA 2HHVA 4BRKA 2HHWA 1HJOA 2GTDA 3LDSA 4B3TK 4HCBA 1G99A 3CCMN 4E7JA 4E7KA 2BH1A 2F96A 4IJAA 4E7LA 1IO2A 3OYMA 2JWKA 1VQ5N 1L3TA 4FJ8A 3LDNA 4FJNA 1QVFM 1BL3A 3RRHA 3VN5A 1Z05A 3OHRA 3VQ4A 3CCJN 1J54A 3C7NB 1ZXOA 3ITHA 4JEPA 4BE0A 3SAHA 1C1CA 3WNGA 4FPBA 4CGFA 1XI1A 1LW0A 3LDOA 2VGMA 5SWMA 3KK2A 1RILA 4CD1A 1HNWK 4CJSA 3V1QA 3L2VA 1U2VB 3SUNA 3OJSA 3SJJA 4K0KK 3SUPA 1I3AA 2EX3A 1BOTO 5I3UA 4WYBA 2NRRA 2Z1GA 3SV3A 2ATQA 4RW8A 1VHXA 4OKKA 3DXKA 4OPKA 4LF6K 4WFBL 1RT2A 3WXIA 3DLGA 4MFBA 5C0YA 4DQ8A 4OX9K 4DTOA 4BE1A 2ETJA 4FSVA 4DTNA 1GLEG 4DQRA 2KLAA 4JN4A 4EZ6A 2Y1JA 1NM1A 3B6OA 2GWJA 2NNWA 4B1WB 3NCIA 4KHYA 4XH1A 4KRFA 1YI2N 4W5TA 4JKEA 4DTRA 4CK3A 4CZGA 1GLDG 1DGKN 4JKBA 1VSIA 3RSEA 1VQ8N 2KHOA 2UYTA 4E7IA 3ZSZA 4CJQA 3H1VX 3J8AA 3LWMA 3K59A 1JLFA 4L8RB 4CJFA 1VQPN 4KTQA 4ELVA 3DAWA 2HBMA 2VWBA 3D45A 4K8XA 5CYMA 5AQZA 4F2SA 1K8KA 5C2FA 4PA1A 2Z1JA 3OYLA 2W6KA 1YAGA 2LSNA 4F8RA 3AO1A 2O8EB 2GBZA 3ZSQA 4BDZA 1RT6A 2P51A 1NKCA 4H5VA 1WSGA 3QIPA 3MWTA 2X6NA 2Q2RA 2E4LA 4WFNL 4ISEA 5A2QO 4B3RK 1GLCG 3FFIA 4CHQA 3DLLL 1DTTA 3I56N 2DFHA 2P9UA 1E4FT 4BDYA 4DQPA 1DKGD 1XNRK 1IKVA 4DQQA 1S1UA 2E1YA 1WB9A 2RF2A 2ZWHA 3V9ZA 2YHXA 1RDDA 2BANA 3L8BA 3ZX2A 4CJ3A 1D9FA 3SPYA 1I94K 1TGOA 4OGCA 1VSMA 3CHWA 3VEXA 3HXMA 3ATVA 4FWSA 1WSHA 4H4OA 4F9OA 1UA0A 3OYIA 2KTQA 4DTXA 3VQ9A 1SKSA 3HL8A 3HSCA 3WQTA 4H0PA 2IVOA 3NH0A 1SV5A 2ZQBA 3BF3A 3QETA 4FM0A 4F2RA 3SMSA 1T6DA 3LZIA 1SL2A 4BRCA 3Q7BA 4H0XB 3QEXA 1U04A 2FXUA 1HPMA 3ZEUA 4HUFA 3OYGA 4CBWA 3ZSWA 4FK4A 4IFYA 5T7BA 2HF4A 5J2PA 4DLGA 3IKMA 4FLVA 3EE9A 4CZLA 3V1OA 4YNQA 5JMVA 4DTPA 3ZSOA 2P5GA 3E9OA 3LP0A 3K5LA 3P31A 3ULDA 4DQIA 4Z4EA 5ELZA 5BR9A 1NG9A 4O0JA 2QI2A 2OPRA 4BRAA 1YVNA 3NF7A 4DTUA 4B9VA 4BRFA 4EFHA 1HR0K 3I0SA 4DMNA 4UY8O 4YDUC 1KCFA 3AVMA 1YT3A 4JV5K 4DUZK 1C0MA 4O5FA 3VETA 3M6GA 2Z1IA 4C8MA 1IBKK 2PY5A 1N8RO 1RDWX 1L3SA 3KK7A 5EOYA 3B6PA 3G25A 5KPZA 3NF6A 1GOBA 3O80A 3AA5X 4RWTA 4FJXA 2XO7A 4FWKA 4EIAA 3CJBA 3F9MA 1E4GT 3OS1A 1K8AO 1BA0A 3TARA 1HNIA 4RW6A 4FWOA 3VQQA 3NGZA 4DV7K 3D2FA 3LP1A 3GE1A 3QERA 4CZJA 2XRIA 3LM2A 5JVGL 4JS4A 3TAFA 3CJCA 4BQZA 1HMVA 2YHWA 2YNIA 3O9SA 4YOVA 2GEMA 5CZ1A 4EHUA 5FPEA 4IEEA 5KPTA 4EP5A 3CQ8A 4AILC 3DXMA 3QESA 3O6WA 5AQVA 3VPZA 3C6TA 4BGAA 1LWCA 2A40A 2QWOA 3THXA 1Q81O 4DSKA 3TTFA 3A5OC 4BR4A 3J7YP 2IAJA 1NGEA 3NBPA 3I33A 1HKBA 3OBYA 4HHTA 4CHOA 3U6FA 2OCEA 1N36K 4PWDA 1CZAN 3RMCA 1B9DA 1XHZA 4KHWA 4CZEA 1Y64A 4B9LA 4OPJA 4DLEA 3ENOA 3OYHA 5BPNA 4CEDA 4FLWA 3RVCA 1T44A 1NJZA 3S3NA 4CZKA 3TAGA 1ZBLA 1NMNA 3OY9A 4B8CA 1R0AA 1S6QA 4H4MA 2Q97A 4CGDA 3T1HK 3LALA 3E1YA 4DV5K 1BQNA 3FLCO 3EZWA 2YV0X 3UB5A 1JCEA 4DV4K 2D5RA 2WBNA 3AGRA 1SUQA 1ILYA 3HBTA 3HZ6A 1QHTA 1RT1A 1Q7YO 1S9GA 4FW2A 1X9JA 3NH1A 1HQEA 1UAXA 3VEZA 4Q0BA 2FSJA 4X65K 3K57A 4DV3K 3QEVA 1YHQN 3KIOA 3SCXA 3PY8A 4YOXA 3CFRA 4OKJA 4JI0K 2YCHA 3BGRA 5FRMA 2HF3A 2RE2A 4NCAA 2HB5A 3EKUA 4BR0A 1N6QA 3M8PA 5BPMA 3K2PA 3QBWA 1VQ7N 2O8FB 3HO1A 3NGIA 4B1YB 4I7FA 4IDHA 3FFKB 5CZ2A 2ZJRL 1ZC6A 5CY4A 1FKOA 4DU4A 4GVMA 1VQNN 4KHNA 5FROA 1VSFA 4IEIA 4LH5A 1KTQA 4AHUA 5HROA 2E2PA 4CEZA 4JS5A 4CJKA 2O8DB 5AQJA 5AZJA 1SKRA 4XEIA 1XMOK 5JS1A 4PKGA 1IG8A 4IBNA 2V52B 3SNNA 5TKYA 1BA1A 3TTCA 1JKHA 4BRNA 3MK6A 1KFDA 2GUIA 2ZGZA 4BRHA 5LMUK 4BR7A 4F4KA 4FJ5A 2XY8A 1SKWA 3MCPA 1QZ5A 4FJMA 3MCAB 1VSHA 2HMPA 4YOUA 2OA8A 3WEEA 4Z4GA 1EWQA 1YF5L 1JLEA 2BE2A 1HYVA 3HOSA 1ZBFA 2B4JA 4AF1A 3AO2A 1W0HA 2F7TA 4N5SA 4CEEA 4CFBA 4C1NI 3CG7A 4BREA 3L4IA 1YJ9N 4CHPA 2WOMA 4FZYA 4BWMA 2Z1HA 3L6QA 1JJ2M 4GY2B 1HPZA 1TKZA 1J5OA 2BDPA 4A5AA 2UUBK 3LPUA 2PFUA 1NGJA 1Q8IA 1NU0A 4IO8A 1A5WA 2ZE2A 5CE3A 5MLCQ 2KZMA 3T69A 3OYKA 2QTDA 3WNFA 3L2WA 1TAUA 3C7NA 4FLUA 1C0FA 4B9MA 3TTDA 4AHRA 3CJ7A 3DMJA 4IFEA 1IBLK 4OKEA 1XC9A 4WQ5C 3PIOL 4M41A 1RT4A 4J2EA 4AQYK 3MXJA 4FO0A 3PV8A 1A5XA 1VSJA 3ZLJA 1VSLA 3FZHA 1MWMA 4PUOA 5AQUA 2B6AA 2HNZA 3DOKA 5SZTA 4H5TA 4DR5K 4GNIA 1S3XA 3C6HA 3EL2A 3JS6A 3V1RA 4ZTJA 2KKZA 5GIOA 1CZ9A 1N34K 3HP9A 3VEOA 4UQGA 3TU5A 1WNSA 3VF4A 5GIPA 3K58A 1TKDA 4FL9A 4GVEA 5KGXA 3VGMA 5DMRA 1QTMA 4Y1DA 3T1YK 4ZTFA 3P4IA 2DY4A 3CPEA 3CMEN 4F3OA 1D5AA 3P39A 2NZTA 1T6CA 4FPAA 4H0TB 4C8OA 3VQ8A 3D6RA 2E20A 3SZ2A 3QO9A 4DV0K 3LDPA 4EZ9A 3SJHA 4H0OA 1NOYA 1ATRA 3HTVA 3P83D 1NJYA 4DSLA 5LJVA 3T19A 3ZSRA 1NKBA 1W7AA 2VGNA 1KRPA 4CHNA 1ESVA 3DJCA 1BI4B 3S9HA 4JRQA 2YHBA 1NGBA 1OVYA 2HOEA 1KQSM 3IUCA 4ISGA 5C24A 4CF9A 3ID8A 5KGWA 4FM2A 3J81O 1QQNA 2H3GX 5AQKA 2QKBA 3TPQA 3PSFA 1X9MA 3NDKA 2O8EA 2E2QA 5J2NA 1BUPA 4H03B 2YJEA 1I39A 3MN6A 3LM9A 3TSQA 3EZ5A 2OZSA 3SQ0A 2E88A 2QK9A 1C1AA 2DFEA 2IIRA 2UXDK 5AQLA 2R7YA 1WSIA 1BO5O 4BR2A 4R5PA 5KRTA 2OTLN 1NOZA 4O8KA 3DI6A 4FLZA 3AVGA 3FZKA 2P9LB 1JLBA 4JAXA 4JI4K 4FXDA 5FLXO 2P9NA 1BQMA 3S41A 4M7YA 4KH6A 3L3VA 2D0BA 5JS2A 4DV1K 2QWLA 2P1JA 2AJQA 4HVJA 5JLFA 4W5OA 1SAZA 3TAEA 4OPHA 4AM7A 1TL3A 4DFPA 4X62K 3H45C 1L3VA 4O44A 2A41A 4NLCA 5M1QA 4C23A 4CBUA 3EY1A 2JLEA 4AH9A 1IV0A 3A8YA 3H08A 2CH6A 2P9IB 2VYPA 3BZKA 4CZMA 2Q31A 4DR2K 4DQSA 4FJJA 1UWBA 3VQEA 1U6ZA 3TAMA 2NRWA 1HKCA 4GV9A 2G8WA 4B9SA 5LL6Z 4CEFA 4A57A 1NKEA 1W97L 1WSFA 1RDAA 4DSEA 3KLFA 4LF7K 4IOXA 1OKJA 5FDLA 3LWLA 3O9QA 4JK7A 5GINA 2YI1A 2Y1IA 5CR4A 1TUYA 4YOWA 1J9AA 2YJFA 3VOVA 1JXEA 4B1ZA 1NK5A 1EKEA 1K9MO 4KHQA 4RW7A 3OYCA 4CJPA 2ZM6K 1HLUA 2PZSA 3CM6A 1GLJO 3O9TA 5LMNK 2HW3A 1RNHA 5LY3A 3BUZB 2NRVA 2O4GA 4RW4A 4JI6K 3R9PA 2ITGA 4MLHA 1VQMN 1KSPA 4KBOA 5C12A 3GBTA 1BISA 1CXUA 3H6EA 2ITMA 4LSLA 3KTQA 3U8XA 5BN9A 1HYSA 4WFAL 4IO9L 1KAXA 4BRGA 4M3XA 3QEIA 5IT9O 3VF6A 5AQRA 2AP1A 2E6MA 3N4QA 4ELTA 5AQSA 4XH4A 4BC2A 3TWHA 3V6DA 3BY5A 3M8SA 3QFPA 4JI1K 3ZX0A 3O1BA 4WE1A 2BTFA 3AVJA 5CHIA 4BR5A 3JYTA 3I8DA 1CXQA 1KC8O 4KO0A 1S1TA 3O4NA 1YTAA 4BRDA 5C25A 4N47A 3KZBA 2KQ2A 4KH4A 5FPNA 1BHLA 3AVAA 1NMDA 3BEXA 5BN8A 4K25A 4OJRA 1KVBA 4WF9L 3F5TA 3LAKA 3C95A 4DU3A 5DM7L 5M1PA 4W5RA 5HOOA 2KW4A 4JKDA 4CZHA 2JGUA 2W42A 3THVA 4JKGB 4JYAK 3NFAA 4B3MK 3G4SN 3H3NO 4DU1A 3LPTA 4M3UA 1IKXA 4FJKA 5F2RA 3EYZA 4HTLA 3CC4N 3NVKA 4EAHD 2PBDA 3E9PA 4MO4A 5BPLA 2E2OA 1FKPA 3SUQA 1HJRA 3O1WA 2Q1NA 2NRHA 3TAPA 1N33K 3KLIA 5F1XA 4BR9A 3SI6A 1TV6A 2E6LA 2XHBA 3VGKA 4CBXA 4LFAK 4M3YA 4KHUA 3UE5A 4M3ZA 1GOCA 1DLOA 2I7PA 3CCRN 4MDAA 4AHVA 3MEGA 3PSIA 5HRNA 1BIZA 1IKYA 5AQQA 4H8KA 3SMPA 4OVLA 4N41A 4JI7K 3AAQA 1GLLO 3O3FA 1X3MA 4QAGA 3CFOA 4WQ4C 1NK6A 3ZT4A 1X9WA 2QEXN 1NGGA 3L3UA 4XH5A 2Q0RA 4GMJB 3ULEB 1EX4A 1XUPO 2ASOA 4DTMA 3K9KA 4JHDB 1TUUA 4ID1A 1BG3A 3AAPA 2O8FA 1DT9A 4LSNA 2VG7A 3THWA 3KD5E 1GOAA 4O0IA 3AVFA 1C1BA 1HQUA 3A5LC 1KAZA 3HPOA 1VAZA 1GLAG 4JI8K 1HUXA 4DSJA 3L4QA 3AO5A 2O8DA 3C65A 1S9EA 4V19S 3F2KA 3ZSXA 4FOIA 4IG0A 4BROA 1K8KB 5AQOA 2HNYA 4DTJA 4CW7B 4K8ZA 3CCEN 3R8EA 5BRFA 3DLRA 4A2AA 1Z26A 5BRDA 3I0RA 2ZJQL 1VQ9N 3EN9A 1C0TA 5CYQA 4R79A 3V81A 3AA4A 2RKIA 3VQCA 5AQMA 3CJ9A 1WBBA 5GAHP 4ILGB 2KZZA 3S3OA 2V7YA 2QXLA 4AHSA 4M3TA 3QFUA 2E2NA 1T05A 5LJWA 3V9SA 5KRSA 3KKRA 4C8NA 1QVGM 2VQFK 3T1AA 2QW9A 1K6YA 3AGKA 4H5NA 3V9UA 2O8CB 1KXPA 3CCQN 3ZT1A 1NJWA 3M8RA 4QS9A 4CF1A 3KWIA 3ZT0A 5AQTA 5E84A 2HVHA 2Q36A 1NJIO 4MQ3A 5GAEP 2HHXA 2I7NA 2QWPA 4LFBK 2CGJA 3E9LA 1B9FA 4J8FA 3AVLA 4A61A 4I9LA 2P9SB 3VENA 1D9DA 1ASUA 1HNZK 4FJ9A 5EVZA 1YXQA 1JCFA 3UIQA 4I2QA 3LL3A 2VWKA 4I2PA 4IKFA 4FVMA 3EKSA 3RWUA 1WLJA 3H46O 4HUGA 3CM5A 5C42A 2CH5A 4CK2A 3NGYA 3HPHA 2JWLA 1JLGA 2VG6A 3J80O 3O3HA 2NRZA 4XIUA 3CPWM 2VQEK 3OVNA 4OLAA 3MN9A 3THYB 4BG9A 4CE9A 4H5RA 3NF9A 3VESA 3ZT3A 1VRTA 4CJTA 3MMVA 3CF5L 3ID6A 3PUFA 3LAMA 1RBUA 3SYZA 3F9KA 3U3YA 1REVA 3ZEUB 3MEEA 3TAQA 2HVIA 2NUBA 1WOQA 3K0SA 3C6UA 1HRHA 3A5MC 4N56A 3OYEA 1C0UA 3ZYYX 1JLAA 4CJLA 1U47A 4CEOA 4LF8K 3N4PA 3G6EN 1MWKA 3L2RA 3R3LA 4OPAA 4GV6A 3U9DA 4FLTA 3VMFB 4M3WA 1J6ZA 3MAQA 2DPNA 3B8AX 4QCLA 4CJ5A 4FZZA 3KHYA 4EHTA 1U49A 1KVCA 2DFFA 1Q9XA 1D8YA 4DF8A 1RBVA 4DFKA 4BACA 4TSXA 4CZIA 3S3MA 2VCPA 2VG5A 5KTQA 4CIFA 5AQIA 2B5JA 4DUYK 3C94A 1BI4A 3AVIA 3CYMA 3ENBA 3VQAA 1DTQA 1XNQK 3P1GA 4OO1J 4E1NA 4B1XB 5E41A 1QSYA 3CJAA 4OLBA 4JRPA 4B08A 4KH5A 5KI6A 2UXCK 3SAFA 3D2FB 3DOLA 2UU9K 2D0OA 2IC3A 4B9QA 3TSUA 1S1XA 1TYQB 3G10A 4KI4A 2ASMA 4CI6A 4FLYA 5GAGP 5B8HA 3DLHA 1U45A 3HK2A 1ASWA 4KFBA 3V4IA 3OW2M 2QWMA 1TKXA 1XQSC 3DRRA 5J2MA 2P9LA 2X74A 3AVBA 4RTFD 4B3OA 4W5NA 1FK9A 1BGXT 4BVPA 3MEDA 1OH7A 3VA3A 3DWLA 2X6SA 4DS4A 1NJXA 4CK1A 4BGBA 5AQPA 3V9WA 4H0VB 2QWQA 4NYFA 1U2VA 1P90A 2J4RA 3L2UA 4HWIA 1UOCA 3FZFA 4A5BA 4B9NA 4CF2A 4LF4K 4L3QA 3CCLN 4FWNA 3TANA 3OS2A 1S5JA 3MECA 4CFAA 1JXBA 2P9IA 3PX4A 3VERA 1ZBIA 1NGHA 3ATUA 2FSKA 2O4IA 4HTUA 3VEYA 3VGLA 4BC3A 2RPIA 1CLQA 3IRXA 2AA4A 3MX5A 2O8BB 4DG1A 2RN2A 1LAWA 3LP2A 4LFCK 1KLMA 4J2DA 5HBMA 2FBTA 5BREA 4K43A 3MDQA 3G0ZA 4RW9A 3PX0A 4FWMA 4CJRA 1IBMK 1RBSA 4K41A 3O5BA 3HYFA 4H5WA 2HHHK 4NYNA 2HHUA 1OH5A 1TVRA 1FW6A 5BR8K 1VQ6N 4BC5A 1NGDA 3P38A 1ZYQA 1A5VA 5EU7A 4ISFA 4C8LA 4F3TA 1WAFA 2OYQA 3JSMA 4KKOA 2OTJN 3EEQA 3CD6N 1XWLA 3OTOK 1Q18A 3VQPA 3E01A 1WAJA 1RCHA 2A42A 2P9PB 3UKUB 4ZHRA 4PL7A 5FPDA 4KI6A 3BP8A 4FCYA 3R1XA 1GLBG 3ISNC 4BWJA 5EX5A 1FJGK 1Z6RA 4CFDA 3PIPL 2FBVA 1ZBSA 4CZFA 3NH2A 3W3DA 4FLXA 3OYDA 3NVMA 4J2BA 5JICA 1B92A 1SL0A 4PL8A 2WONA 3JXUA 2HHTA 3LZJA 4CJEA 1EP4A 1TKTA 4QOZB 2HSTA 5I42A 4JI2K 4KB0A 4U7BA 4YFUA 2IGIA 1KD1O 2GWKA 4JKFA 2XY6A 2D0CA 3OBWA 2NRTA 2IS3A 1RGIA 4JKHA 1IH7A 4IDKA 2W6LA 3WQUA 1LWFA 3HJFA 4WQ4A 4DR3K 3D2EB 4I6MB 2YNGA 5AFUA 3MN7A 4E0DA 4GKJK 3DLEA 3ZETB 1P8ZA 4JKGA 2UUCK 4M63C 4YDUA 1N32K 3QNNA 5DM6L 2GELA 4B9UA 3AARA 2OZMA 3PO5A 5AQWA 3UKRB 1QQCA 5FPMA 3I8BA 1NLVA 3SUOA 4JNEA 1T8EA 2YNFA 1OH6A 3AVNA 3CI5A 4CERA 4PQUA 4M42A 2G8IA 1TAQA 3RR7A 2WTUA 3K5MA 2V7ZA 4PKIA 3DM2A 4JD2B 2HBKA 2E1ZA 1JL2A 2E8AA 2F9WA 4KTZA 2YNHA 1VSKA 2P9KB 4Z0UA 1NK0A 5JLHA 4M7XA 3KVGA 5HRRA 3I55N 3D0PA 3P5JA 2X78A 5AZIB 2YKMA 1BU6O 4KHPK 5FRNA 4CGIA 3OYAA 3E66A 1XMQK 3M1FA 3NAEA 4G9ZA 5AQHA 1QZ6A 4BQLA 3AY9A 4NB4A 5HP1A 4WCEL 3HSTB 1KAYA 1H1VA 2A6AA 4CJUA 3R6MA 3ULEA 1SL1A 1MU2A 1HNXK 1X9SA 2GX9A 4CJ4A 2G8KA 2A1RA 3KJVA 3PO4A 4JHDA 4M45A 4CD3A 1NK7A 3QBXA 2HBJA 2V51B 4G1QA 3RMBA 4CIGA 4CJ7A 1LCUA 4CESA 1YJWN 3NHGA 1WN7A 5M1FA 3U3GA 1Z25A 3CIPA 3ZSYA 5HLFA 2W40A 3ENHA 3AO4A 3HP6A 3FR0A 4QS7A 1ASVA 4NXMK 4FW1A 1NGFA 4IXCA 4AHCA 5K14A 2OPPA 1RDBA 3QB0A 1OH8A 1U4BA 3LDLA 2GUPA 4BRPA 5ADXH 4EP4A 2XY7A 5M1OA 3C0BA 4Q5VA 2W41A 4Z4FA 4N76A 1JLCA 2Q0UA 1ATNA 3CC7N 1X1PA 3C6AA 4DCHA 4O5BA 3SQ4A 4IG3A 2D1KA 5I9EB 2FF3B 2G8UA 3SLCA 2OPQA 3FZMA 4BE2A 2GV9A 4LF9K 2YKNA 4JI3K 1J53A 3SBGA 4DB3A 2O8CA 1NBWA 2BUPA 3OYNA 2KFNA 5EXWA 3T3FA 1QE1A 3GG4A 3T7ZA 1YVUA 3QMLA 5AQGA 5AQXA 3GL1A 1TL1A 2D4WA 1VRUA 4E19A 2EWSA 3AA2A 4FOEA 3IS9A 3WXMB 1M1KO 4RCHA 2P9NB 3D7EO 1HYZA 3IAYA 3SAGA 2P9SA 1FXXA 2WFBA 1HNVA 5KQDA 2P5OA 3WXJA 3VQDA 1CZBA 1RTJA 3AV9A 3K5NA 4CCHA 4A59A 3H3OB 4KTWA 4CIEA 4NO7A 3EO3A 3PLAA 3PX6A 4BRIA 3OJUA 2YHYA 4CEAA 1BDGA 2VWJA 4CGJA 3KLEA 3M3ZA 4B1UB 3DXKB 4CFCA 3THYA 3VQ6A 1T3VA 2A1SA 4FWRA 2A5XA 3TR8A 1BCMA 3ZX3A 1RT7A 4KB1A 4BG8A 4YY3K 3HVTA 4YOTA 4CEQA 3V9XA 1QSSA 1L5UA 2F8TA 1BIUA 4U67L 5EY4A 2ZD1A 4PY5A 4AHTA 4DS5A 4DKWA 3ALYA 3J7ZO 3QDKA 3AVCA 3OYFA 4CEBA 4AM6A 1BWFO 3QNOA 4O55A 3QINA 4FWPA 1QQOA 3OS0A 4DTSA 4DR6K 1LWEA 4Y1CA 5JVHL 2YHAA 3QLHA 1L3UA 3HRGA 2OPSA 1EXQA 4GKKK 1RTDA 3GOIA 1WSEA 3ZT2A 1RT3A 3RSEB 4JLHA
chains in the Genus database with same CATH topology
1NOYA 4E7IA 4QCLA 4CJ5A 1NK8A 3P83D 1NJYA 4FJGA 4FZZA 1U49A 3ZSZA 1KVCA 4CJQA 2DFFA 4DSLA 3T19A 1Q9XA 3LWMA 1D8YA 3ZSRA 1NKBA 3K59A 4DF8A 1JLFA 1RBVA 4DFKA 4L8RB 4CJFA 2FBXA 4BACA 4KTQA 1W9HA 1KRPA 4TSXA 4ELVA 4ICLA 4RG8A 4CHNA 3S3MA 2VG5A 5KTQA 1BI4B 4CIFA 3S9HA 1S6PA 2B5JA 3D45A 4GW6A 4K8XA 3C94A 1BI4A 1ZBUA 5CYMA 3AVIA 3CYMA 4CCHA 4JRQA 4F2SA 3VQAA 3MXMA 1T7PA 2YHBA 1TK0A 4PA1A 1JL1A 2Z1JA 4ID5A 3OYLA 4DWIA 1DTQA 5C24A 2BGGA 4CF9A 3P1GA 3A2FA 1IKWA 4E1NA 4KAZA 1F21A 5E41A 5KGWA 1QSYA 2EHGA 1RTHA 4FM2A 2I5JA 2LSNA 2QKBA 4OLBA 4F8RA 3AO1A 4JRPA 4B08A 2GBZA 3ZSQA 1X9MA 3NDKA 4BDZA 1RT6A 2P51A 5KI6A 1RT5A 5J2NA 1NKCA 1WSGA 3DOLA 1I39A 3QIPA 1TK8A 2X6NA 2IC3A 2E4LA 4FK2A 3RTVA 1KLNA 3EZ5A 1S1XA 3G10A 4KI4A 4OGEA 3SQ0A 2FC0A 2OZSA 4IKFA 2QK9A 4FLYA 1RTIA 1C1AA 2DFEA 3DLHA 1U45A 3HK2A 1C6VA 3FFIA 1ASWA 3HVRA 2R7YA 4KHSA 1WSIA 4KFBA 4R5PA 5KRTA 4CHQA 1NOZA 3OYJA 1DTTA 3DI6A 3QEWA 2DFHA 4FLZA 3V4IA 3AVGA 1TKXA 1Y97A 3SQ2A 4BDYA 3DRRA 5J2MA 1JLBA 4DQPA 4FXDA 1IKVA 2X74A 4DQQA 1S1UA 1RDCA 2RF2A 3AVBA 4DF4A 4W5NA 4B3OA 1BQMA 3V9ZA 1FK9A 3QEPA 1RDDA 1BGXT 2G8FA 4FZXC 2BANA 3L8BA 2HHSA 3MEDA 3L3VA 2D0BA 5JS2A 3VA3A 2P1JA 2AJQA 1WSJA 2X6SA 4CJ3A 4CHYA 4HVJA 3KLGA 4CK1A 4DS4A 3HT3A 4W5OA 3V9WA 1TGOA 3SPYA 4OGCA 3MXIA 1NK4A 4NYFA 1VSMA 1ZBHA 4DSIA 3TAEA 3HXMA 4E89A 1TL3A 1VK0A 4DFPA 3L2UA 1UOCA 1WSHA 4H4OA 4O44A 1L3VA 4B9NA 1UA0A 4CF2A 3EY1A 2JLEA 4I9QA 4AH9A 3OYIA 1S1VA 2KTQA 4DTXA 3VQ9A 3OS2A 3TANA 3HL8A 1S5JA 1SKSA 3H08A 3MECA 4DQSA 4FJJA 4CFAA 4CECA 1JXBA 1UWBA 1SV5A 2ZQBA 3NH0A 3PX4A 3QETA 4FM0A 2G8VA 4F2RA 3VQEA 3HM9A 1ZBIA 3TAMA 3LZIA 1SL2A 4C8KA 3DLBA 5D3GA 4E3SA 2G8WA 4HTUA 2O4IA 4KREA 4B9SA 2RPIA 3WNEA 4CEFA 4CGHA 3QEXA 3KK3A 1U04A 1NKEA 1CLQA 3IRXA 1WSFA 1YTUA 1RDAA 4HUFA 4DSEA 3KLFA 4DG1A 4CF0A 3OYGA 4FYDA 2RN2A 1LAWA 3LP2A 5FDLA 3ZSWA 4IFYA 5T7BA 3LWLA 1KLMA 4J2DA 4FK4A 5J2PA 5HBMA 2Y1IA 4DLGA 4FLVA 2FBTA 1JLQA 1KVAA 3V1OA 4YNQA 4DTPA 1J9AA 1JXEA 1NK5A 3ZSOA 2P5GA 3G0ZA 4RW9A 4CGGA 1EKEA 3PX0A 3LP0A 4RW7A 4CJRA 4IFVA 3OYCA 3K5LA 4CJPA 4KHQA 3ULDA 3HPGA 3IG1A 4DQIA 2PZSA 4Z4EA 1RBSA 4O0JA 3CM6A 2FBYA 3HYFA 2HW3A 2OPRA 4CHZA 3NF8A 1RNHA 3NF7A 4NYNA 4HCCA 2HHUA 4DTUA 4B9VA 4O4GA 1TVRA 3I0SA 1VSDA 4DMNA 1ZYQA 4HUEA 4J2AA 1A5VA 4B9TA 1KCFA 2HMIA 3AVMA 5EU7A 4LD0A 2O4GA 4RW4A 4C8LA 4F3TA 1WAFA 2OYQA 3JSMA 1YT3A 4KKOA 2ITGA 3LP3A 3O4QA 1KSPA 1C0MA 3M8QA 1XWLA 2Z1IA 4C8MA 1BISA 1CXUA 3VQPA 2PY5A 3E01A 1WAJA 1RCHA 3WNHA 4LSLA 1L3SA 4ZHRA 3KTQA 3B6PA 1HYSA 3NF6A 4KI6A 1GOBA 4M3XA 4FCYA 3QEIA 3AA5X 1EETA 4FJXA 3DYAA 2E6MA 4BDPA 3ISNC 2XO7A 4BWJA 4ELTA 3ASMA 4CFDA 3NE6A 3TWHA 2FBVA 3V6DA 2XY5A 1LV5A 3OS1A 3TI0A 1UA1A 3M8SA 3TARA 1HNIA 3NH2A 2G8HA 1LAVA 4FJLA 4RW6A 3OYDA 3AO3A 4FLXA 4J2BA 4FJHA 1B92A 4WE1A 1ITGA 3VQQA 1SL0A 2D0AA 3O3GA 3NGZA 1BCOA 3AVJA 3JYTA 2WONA 3I8DA 1CXQA 4E7HA 4KO0A 3K5OA 1VSEA 3LP1A 3ZSVA 2HHTA 1S1TA 3LZJA 3QERA 4Z4IA 4CJEA 4ELUA 3L2QA 3O4NA 1YTAA 1EP4A 1TKTA 5C25A 2F8SA 4N47A 4QOZB 2KQ2A 4FM1A 2XRIA 3DLKA 5I42A 1O1WA 4KB0A 1BHLA 4YFUA 2IGIA 3AVAA 1U48A 4JS4A 3TAFA 4Z4HA 2PYLA 1HMVA 3SPZA 2YNIA 4OJRA 1KVBA 5CZ1A 2XY6A 3AA3A 3LAKA 4LH4A 2D0CA 3C95A 4DU3A 2IS3A 3RMDA 1IH7A 3DRSA 4IDKA 4EP5A 4W5RA 2KW4A 3CQ8A 4AILC 2QXFA 3VQBA 2QKKA 2JGUA 3QESA 1LWFA 3HJFA 4KPYA 2W42A 3C6TA 2YNGA 5HRSA 4E0DA 3THVA 1LWCA 4CF8A 1QS4A 3DLEA 3RMAA 3NFAA 4DU1A 4DSKA 4LY7A 3QNNA 4B9UA 3LPTA 2IOCA 4M3UA 1IKXA 2IAJA 4FJKA 2OZMA 3NBPA 3PO5A 3AVKA 4HHTA 3BDPA 4CHOA 3U6FA 3SQ1A 3EYZA 4PWDA 4B8AB 1QQCA 3RMCA 1B9DA 1XHZA 4KHWA 3KKSA 2Q3SA 4B9LA 3LANA 3SV4A 4OPJA 4DLEA 3SUOA 1FKPA 3OYHA 3VA0A 3SUQA 1T8EA 2YNFA 1HJRA 1D9FA 3AVNA 4CEDA 4FLWA 3TAPA 2DTUA 4CERA 3KLIA 4PQUA 4M42A 2G8IA 1NJZA 3S3NA 5J2QA 4CJVA 3TAGA 3SI6A 1TAQA 3RR7A 1TV6A 1ZBLA 3K5MA 3OY9A 4B8CA 1R0AA 1S6QA 2E6LA 4H4MA 2XHBA 2HHQA 4CGDA 4CJWA 3DM2A 4DFJA 4Z4CA 3LALA 4M3YA 4KHUA 4M3ZA 1GOCA 1BQNA 1DLOA 1JL2A 2YV0X 3OYBA 4KTZA 2YNHA 1VSKA 2D5RA 1SUQA 4FJIA 4Z0UA 1NK0A 4AHVA 3MEGA 3KD1E 1QHTA 1RT1A 3CFPA 5HRRA 5HRNA 1S9GA 1BIZA 3D0PA 3P5JA 2X78A 2YKMA 1IKYA 4FW2A 4CGIA 3NH1A 4H8KA 1HQEA 1UAXA 3OYAA 5FRNA 4Q0BA 3K57A 1T03A 3QEVA 4OVLA 3KIOA 3SCXA 4N41A 1IG9A 3PY8A 3O3FA 1Q9YA 3NAEA 4QAGA 3QIOA 3CFRA 3CFOA 4OKJA 1NK6A 3ZCMA 3ZT4A 1X9WA 5HP1A 1NK9A 3HSTB 3BGRA 3L3UA 3F73A 3TABA 5FRMA 4GMJB 4CJUA 1EX4A 4NCAA 2HB5A 2HNDA 1LW2A 1SL1A 1MU2A 4DTMA 1N6QA 3M8PA 3KLHA 1X9SA 3K2PA 4CJ4A 2G8KA 2A1RA 3KJVA 3PO4A 3HO1A 4ID1A 4NCGA 4M45A 3NGIA 1XHXA 1NK7A 3DRPA 4FK0A 2IDOA 4I7FA 4LSNA 2VG7A 5J1EA 3KD5E 1GOAA 4O0IA 4G1QA 3RMBA 3AVFA 5CZ2A 4CIGA 1C1BA 5CY4A 1FKOA 1HQUA 4GVMA 4DU4A 4FJ7A 4KHNA 4CESA 5FROA 1VSFA 3HPOA 4LH5A 1KTQA 4AHUA 5HROA 4W5QA 4CEZA 4DSJA 4JS5A 4CJKA 3NHGA 1WN7A 3U3GA 1Z25A 3ZSYA 5HLFA 3AO5A 1SKRA 3AVHA 5JS1A 3AO4A 3VQ5A 3VQ7A 1S1WA 1S9EA 4IBNA 3HP6A 2PYJA 3SNNA 3ZSXA 1ASVA 4FW1A 5DK5A 4AHCA 5K14A 2OPPA 1JKHA 1RDBA 4IG0A 3RR8A 4NCBA 1NJXA 1U4BA 4DTJA 1KFDA 2HNYA 4EP4A 2GUIA 4K8ZA 4KV8A 4F4KA 3DLRA 4FJ5A 1Z26A 2XY8A 2XY7A 1SKWA 3I0RA 2KFZA 5HRPA 1N5YA 4DFMA 3RRGA 1C0TA 5CYQA 4Q5VA 3V81A 3AA4A 2RKIA 1KFSA 1VSHA 3VQCA 4FJMA 1G15A 4Z4FA 2KZZA 4N76A 1JLCA 3S3OA 1X1PA 2OA8A 4DSFA 4AHSA 4E1MA 4M3TA 1T05A 3V9SA 1RBRA 5KRSA 4Z4GA 3KKRA 1RBTA 3KK1A 4O5BA 3SQ4A 1JLEA 2BE2A 1HYVA 4C8NA 1QSLA 1ZBFA 2B4JA 4IG3A 1TK5A 4M3RA 3AO2A 2G8UA 2HHVA 2HHWA 2OPQA 1W0HA 4N5SA 3LDSA 3T1AA 1K6YA 4CEEA 3V9UA 4HCBA 4CFBA 4BE2A 3CG7A 2GV9A 2YKNA 3ZT1A 1J53A 3M8RA 1NJWA 4CF1A 3OYNA 4E7JA 3ZT0A 2KFNA 4E7KA 2HVHA 4CHPA 2F96A 2WOMA 4FZYA 4BWMA 2Z1HA 3T3FA 1QE1A 4E7LA 1IO2A 1HPZA 1TKZA 1YVUA 4MQ3A 3OYMA 1J5OA 3LPUA 1L3TA 2BDPA 4FJ8A 4FJNA 1BL3A 1Q8IA 1TL1A 1VRUA 4E19A 2HHXA 3AA2A 1B9FA 3IS9A 1A5WA 2ZE2A 3RRHA 4KB1A 2KZMA 3VN5A 3AVLA 3VQ4A 3OYKA 1J54A 4I9LA 3WNFA 1HYZA 1D9DA 1ASUA 3L2WA 3ITHA 3IAYA 4FJ9A 1TAUA 4FLUA 4BE0A 1FXXA 4B9MA 3UIQA 1C1CA 3WNGA 1HNVA 4I2QA 2VWKA 4I2PA 4AHRA 3DMJA 4CGFA 1XI1A 2P5OA 1CZBA 1LW0A 1RTJA 3AV9A 4OKEA 3VQDA 1RILA 4FVMA 5SWMA 3KK2A 3K5NA 4CJSA 1XC9A 4CIEA 4KTWA 3V1QA 3L2VA 1WLJA 4M41A 4HUGA 1RT4A 3SUNA 3CM5A 3OJSA 3SJJA 3PX6A 5C42A 4J2EA 4CK2A 3OJUA 3NGYA 3HPHA 3MXJA 3SUPA 1JLGA 1I3AA 2VG6A 1A5XA 1VSJA 4CEAA 2EX3A 2VWJA 3O3HA 3PV8A 4CGJA 4XIUA 3KLEA 1VSLA 3OVNA 5I3UA 4OLAA 2Z1GA 3SV3A 4PUOA 2ATQA 4RW8A 4CFCA 2B6AA 4CE9A 4OKKA 2HNZA 3VQ6A 3DOKA 3NF9A 5SZTA 4OPKA 2A1SA 4CJTA 3TR8A 1VRTA 3ZT3A 1BCMA 3PUFA 1RT2A 3DLGA 3V1RA 4ZTJA 3LAMA 1RBUA 1RT7A 1CZ9A 4MFBA 3SYZA 3HP9A 3RWUA 3F9KA 3HVTA 4UQGA 3U3YA 4CEQA 1WNSA 1REVA 3V9XA 1QSSA 4DTOA 1L5UA 4BE1A 1BIUA 2F8TA 3MEEA 3TAQA 2ZD1A 2ETJA 3K58A 1TKDA 2HVIA 4PY5A 2NUBA 4DTNA 4DQRA 4AHTA 4DS5A 3C6UA 5KGXA 3ALYA 1HRHA 4EZ6A 5DMRA 1QTMA 4Y1DA 2Y1JA 3AVCA 3B6OA 4N56A 4ZTFA 3OYFA 3OYEA 4CEBA 3NCIA 1C0UA 4KHYA 1JLAA 3QNOA 4O55A 3QINA 4CJLA 3OS0A 1U47A 4CEOA 4KRFA 4DTSA 1LWEA 4Y1CA 2DY4A 2YHAA 3QLHA 4W5TA 1L3UA 4F3OA 2OPSA 4DTRA 4CK3A 1EXQA 3L2RA 1RTDA 1WSEA 1D5AA 3ZT2A 1RT3A 4FLTA 4JLHA 4C8OA 3VQ8A 1VSIA 3SZ2A 3QO9A 4M3WA 4EZ9A 3MAQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NOY A;  4E7I A;  4QCL A;  4CJ5 A;  1NK8 A;  3P83 D;  1NJY A;  4FJG A;  4FZZ A;  1U49 A;  3ZSZ A;  1KVC A;  4CJQ A;  2DFF A;  4DSL A;  3T19 A;  1Q9X A;  3LWM A;  1D8Y A;  3ZSR A;  1NKB A;  3K59 A;  4DF8 A;  1JLF A;  1RBV A;  4DFK A;  4L8R B;  4CJF A;  2FBX A;  4BAC A;  4KTQ A;  1W9H A;  1KRP A;  4TSX A;  4ELV A;  4ICL A;  4RG8 A;  4CHN A;  3S3M A;  2VG5 A;  5KTQ A;  1BI4 B;  4CIF A;  3S9H A;  1S6P A;  2B5J A;  3D45 A;  4GW6 A;  4K8X A;  3C94 A;  1BI4 A;  1ZBU A;  5CYM A;  3AVI A;  3CYM A;  4CCH A;  4JRQ A;  4F2S A;  3VQA A;  3MXM A;  1T7P A;  2YHB A;  1TK0 A;  4PA1 A;  1JL1 A;  2Z1J A;  4ID5 A;  3OYL A;  4DWI A;  1DTQ A;  5C24 A;  2BGG A;  4CF9 A;  3P1G A;  3A2F A;  1IKW A;  4E1N A;  4KAZ A;  1F21 A;  5E41 A;  5KGW A;  1QSY A;  2EHG A;  1RTH A;  4FM2 A;  2I5J A;  2LSN A;  2QKB A;  4OLB A;  4F8R A;  3AO1 A;  4JRP A;  4B08 A;  2GBZ A;  3ZSQ A;  1X9M A;  3NDK A;  4BDZ A;  1RT6 A;  2P51 A;  5KI6 A;  1RT5 A;  5J2N A;  1NKC A;  1WSG A;  3DOL A;  1I39 A;  3QIP A;  1TK8 A;  2X6N A;  2IC3 A;  2E4L A;  4FK2 A;  3RTV A;  1KLN A;  3EZ5 A;  1S1X A;  3G10 A;  4KI4 A;  4OGE A;  3SQ0 A;  2FC0 A;  2OZS A;  4IKF A;  2QK9 A;  4FLY A;  1RTI A;  1C1A A;  2DFE A;  3DLH A;  1U45 A;  3HK2 A;  1C6V A;  3FFI A;  1ASW A;  3HVR A;  2R7Y A;  4KHS A;  1WSI A;  4KFB A;  4R5P A;  5KRT A;  4CHQ A;  1NOZ A;  3OYJ A;  1DTT A;  3DI6 A;  3QEW A;  2DFH A;  4FLZ A;  3V4I A;  3AVG A;  1TKX A;  1Y97 A;  3SQ2 A;  4BDY A;  3DRR A;  5J2M A;  1JLB A;  4DQP A;  4FXD A;  1IKV A;  2X74 A;  4DQQ A;  1S1U A;  1RDC A;  2RF2 A;  3AVB A;  4DF4 A;  4W5N A;  4B3O A;  1BQM A;  3V9Z A;  1FK9 A;  3QEP A;  1RDD A;  1BGX T;  2G8F A;  4FZX C;  2BAN A;  3L8B A;  2HHS A;  3MED A;  3L3V A;  2D0B A;  5JS2 A;  3VA3 A;  2P1J A;  2AJQ A;  1WSJ A;  2X6S A;  4CJ3 A;  4CHY A;  4HVJ A;  3KLG A;  4CK1 A;  4DS4 A;  3HT3 A;  4W5O A;  3V9W A;  1TGO A;  3SPY A;  4OGC A;  3MXI A;  1NK4 A;  4NYF A;  1VSM A;  1ZBH A;  4DSI A;  3TAE A;  3HXM A;  4E89 A;  1TL3 A;  1VK0 A;  4DFP A;  3L2U A;  1UOC A;  1WSH A;  4H4O A;  4O44 A;  1L3V A;  4B9N A;  1UA0 A;  4CF2 A;  3EY1 A;  2JLE A;  4I9Q A;  4AH9 A;  3OYI A;  1S1V A;  2KTQ A;  4DTX A;  3VQ9 A;  3OS2 A;  3TAN A;  3HL8 A;  1S5J A;  1SKS A;  3H08 A;  3MEC A;  4DQS A;  4FJJ A;  4CFA A;  4CEC A;  1JXB A;  1UWB A;  1SV5 A;  2ZQB A;  3NH0 A;  3PX4 A;  3QET A;  4FM0 A;  2G8V A;  4F2R A;  3VQE A;  3HM9 A;  1ZBI A;  3TAM A;  3LZI A;  1SL2 A;  4C8K A;  3DLB A;  5D3G A;  4E3S A;  2G8W A;  4HTU A;  2O4I A;  4KRE A;  4B9S A;  2RPI A;  3WNE A;  4CEF A;  4CGH A;  3QEX A;  3KK3 A;  1U04 A;  1NKE A;  1CLQ A;  3IRX A;  1WSF A;  1YTU A;  1RDA A;  4HUF A;  4DSE A;  3KLF A;  4DG1 A;  4CF0 A;  3OYG A;  4FYD A;  2RN2 A;  1LAW A;  3LP2 A;  5FDL A;  3ZSW A;  4IFY A;  5T7B A;  3LWL A;  1KLM A;  4J2D A;  4FK4 A;  5J2P A;  5HBM A;  2Y1I A;  4DLG A;  4FLV A;  2FBT A;  1JLQ A;  1KVA A;  3V1O A;  4YNQ A;  4DTP A;  1J9A A;  1JXE A;  1NK5 A;  3ZSO A;  2P5G A;  3G0Z A;  4RW9 A;  4CGG A;  1EKE A;  3PX0 A;  3LP0 A;  4RW7 A;  4CJR A;  4IFV A;  3OYC A;  3K5L A;  4CJP A;  4KHQ A;  3ULD A;  3HPG A;  3IG1 A;  4DQI A;  2PZS A;  4Z4E A;  1RBS A;  4O0J A;  3CM6 A;  2FBY A;  3HYF A;  2HW3 A;  2OPR A;  4CHZ A;  3NF8 A;  1RNH A;  3NF7 A;  4NYN A;  4HCC A;  2HHU A;  4DTU A;  4B9V A;  4O4G A;  1TVR A;  3I0S A;  1VSD A;  4DMN A;  1ZYQ A;  4HUE A;  4J2A A;  1A5V A;  4B9T A;  1KCF A;  2HMI A;  3AVM A;  5EU7 A;  4LD0 A;  2O4G A;  4RW4 A;  4C8L A;  4F3T A;  1WAF A;  2OYQ A;  3JSM A;  1YT3 A;  4KKO A;  2ITG A;  3LP3 A;  3O4Q A;  1KSP A;  1C0M A;  3M8Q A;  1XWL A;  2Z1I A;  4C8M A;  1BIS A;  1CXU A;  3VQP A;  2PY5 A;  3E01 A;  1WAJ A;  1RCH A;  3WNH A;  4LSL A;  1L3S A;  4ZHR A;  3KTQ A;  3B6P A;  1HYS A;  3NF6 A;  4KI6 A;  1GOB A;  4M3X A;  4FCY A;  3QEI A;  3AA5 X;  1EET A;  4FJX A;  3DYA A;  2E6M A;  4BDP A;  3ISN C;  2XO7 A;  4BWJ A;  4ELT A;  3ASM A;  4CFD A;  3NE6 A;  3TWH A;  2FBV A;  3V6D A;  2XY5 A;  1LV5 A;  3OS1 A;  3TI0 A;  1UA1 A;  3M8S A;  3TAR A;  1HNI A;  3NH2 A;  2G8H A;  1LAV A;  4FJL A;  4RW6 A;  3OYD A;  3AO3 A;  4FLX A;  4J2B A;  4FJH A;  1B92 A;  4WE1 A;  1ITG A;  3VQQ A;  1SL0 A;  2D0A A;  3O3G A;  3NGZ A;  1BCO A;  3AVJ A;  3JYT A;  2WON A;  3I8D A;  1CXQ A;  4E7H A;  4KO0 A;  3K5O A;  1VSE A;  3LP1 A;  3ZSV A;  2HHT A;  1S1T A;  3LZJ A;  3QER A;  4Z4I A;  4CJE A;  4ELU A;  3L2Q A;  3O4N A;  1YTA A;  1EP4 A;  1TKT A;  5C25 A;  2F8S A;  4N47 A;  4QOZ B;  2KQ2 A;  4FM1 A;  2XRI A;  3DLK A;  5I42 A;  1O1W A;  4KB0 A;  1BHL A;  4YFU A;  2IGI A;  3AVA A;  1U48 A;  4JS4 A;  3TAF A;  4Z4H A;  2PYL A;  1HMV A;  3SPZ A;  2YNI A;  4OJR A;  1KVB A;  5CZ1 A;  2XY6 A;  3AA3 A;  3LAK A;  4LH4 A;  2D0C A;  3C95 A;  4DU3 A;  2IS3 A;  3RMD A;  1IH7 A;  3DRS A;  4IDK A;  4EP5 A;  4W5R A;  2KW4 A;  3CQ8 A;  4AIL C;  2QXF A;  3VQB A;  2QKK A;  2JGU A;  3QES A;  1LWF A;  3HJF A;  4KPY A;  2W42 A;  3C6T A;  2YNG A;  5HRS A;  4E0D A;  3THV A;  1LWC A;  4CF8 A;  1QS4 A;  3DLE A;  3RMA A;  3NFA A;  4DU1 A;  4DSK A;  4LY7 A;  3QNN A;  4B9U A;  3LPT A;  2IOC A;  4M3U A;  1IKX A;  2IAJ A;  4FJK A;  2OZM A;  3NBP A;  3PO5 A;  3AVK A;  4HHT A;  3BDP A;  4CHO A;  3U6F A;  3SQ1 A;  3EYZ A;  4PWD A;  4B8A B;  1QQC A;  3RMC A;  1B9D A;  1XHZ A;  4KHW A;  3KKS A;  2Q3S A;  4B9L A;  3LAN A;  3SV4 A;  4OPJ A;  4DLE A;  3SUO A;  1FKP A;  3OYH A;  3VA0 A;  3SUQ A;  1T8E A;  2YNF A;  1HJR A;  1D9F A;  3AVN A;  4CED A;  4FLW A;  3TAP A;  2DTU A;  4CER A;  3KLI A;  4PQU A;  4M42 A;  2G8I A;  1NJZ A;  3S3N A;  5J2Q A;  4CJV A;  3TAG A;  3SI6 A;  1TAQ A;  3RR7 A;  1TV6 A;  1ZBL A;  3K5M A;  3OY9 A;  4B8C A;  1R0A A;  1S6Q A;  2E6L A;  4H4M A;  2XHB A;  2HHQ A;  4CGD A;  4CJW A;  3DM2 A;  4DFJ A;  4Z4C A;  3LAL A;  4M3Y A;  4KHU A;  4M3Z A;  1GOC A;  1BQN A;  1DLO A;  1JL2 A;  2YV0 X;  3OYB A;  4KTZ A;  2YNH A;  1VSK A;  2D5R A;  1SUQ A;  4FJI A;  4Z0U A;  1NK0 A;  4AHV A;  3MEG A;  3KD1 E;  1QHT A;  1RT1 A;  3CFP A;  5HRR A;  5HRN A;  1S9G A;  1BIZ A;  3D0P A;  3P5J A;  2X78 A;  2YKM A;  1IKY A;  4FW2 A;  4CGI A;  3NH1 A;  4H8K A;  1HQE A;  1UAX A;  3OYA A;  5FRN A;  4Q0B A;  3K57 A;  1T03 A;  3QEV A;  4OVL A;  3KIO A;  3SCX A;  4N41 A;  1IG9 A;  3PY8 A;  3O3F A;  1Q9Y A;  3NAE A;  4QAG A;  3QIO A;  3CFR A;  3CFO A;  4OKJ A;  1NK6 A;  3ZCM A;  3ZT4 A;  1X9W A;  5HP1 A;  1NK9 A;  3HST B;  3BGR A;  3L3U A;  3F73 A;  3TAB A;  5FRM A;  4GMJ B;  4CJU A;  1EX4 A;  4NCA A;  2HB5 A;  2HND A;  1LW2 A;  1SL1 A;  1MU2 A;  4DTM A;  1N6Q A;  3M8P A;  3KLH A;  1X9S A;  3K2P A;  4CJ4 A;  2G8K A;  2A1R A;  3KJV A;  3PO4 A;  3HO1 A;  4ID1 A;  4NCG A;  4M45 A;  3NGI A;  1XHX A;  1NK7 A;  3DRP A;  4FK0 A;  2IDO A;  4I7F A;  4LSN A;  2VG7 A;  5J1E A;  3KD5 E;  1GOA A;  4O0I A;  4G1Q A;  3RMB A;  3AVF A;  5CZ2 A;  4CIG A;  1C1B A;  5CY4 A;  1FKO A;  1HQU A;  4GVM A;  4DU4 A;  4FJ7 A;  4KHN A;  4CES A;  5FRO A;  1VSF A;  3HPO A;  4LH5 A;  1KTQ A;  4AHU A;  5HRO A;  4W5Q A;  4CEZ A;  4DSJ A;  4JS5 A;  4CJK A;  3NHG A;  1WN7 A;  3U3G A;  1Z25 A;  3ZSY A;  5HLF A;  3AO5 A;  1SKR A;  3AVH A;  5JS1 A;  3AO4 A;  3VQ5 A;  3VQ7 A;  1S1W A;  1S9E A;  4IBN A;  3HP6 A;  2PYJ A;  3SNN A;  3ZSX A;  1ASV A;  4FW1 A;  5DK5 A;  4AHC A;  5K14 A;  2OPP A;  1JKH A;  1RDB A;  4IG0 A;  3RR8 A;  4NCB A;  1NJX A;  1U4B A;  4DTJ A;  1KFD A;  2HNY A;  4EP4 A;  2GUI A;  4K8Z A;  4KV8 A;  4F4K A;  3DLR A;  4FJ5 A;  1Z26 A;  2XY8 A;  2XY7 A;  1SKW A;  3I0R A;  2KFZ A;  5HRP A;  1N5Y A;  4DFM A;  3RRG A;  1C0T A;  5CYQ A;  4Q5V A;  3V81 A;  3AA4 A;  2RKI A;  1KFS A;  1VSH A;  3VQC A;  4FJM A;  1G15 A;  4Z4F A;  2KZZ A;  4N76 A;  1JLC A;  3S3O A;  1X1P A;  2OA8 A;  4DSF A;  4AHS A;  4E1M A;  4M3T A;  1T05 A;  3V9S A;  1RBR A;  5KRS A;  4Z4G A;  3KKR A;  1RBT A;  3KK1 A;  4O5B A;  3SQ4 A;  1JLE A;  2BE2 A;  1HYV A;  4C8N A;  1QSL A;  1ZBF A;  2B4J A;  4IG3 A;  1TK5 A;  4M3R A;  3AO2 A;  2G8U A;  2HHV A;  2HHW A;  2OPQ A;  1W0H A;  4N5S A;  3LDS A;  3T1A A;  1K6Y A;  4CEE A;  3V9U A;  4HCB A;  4CFB A;  4BE2 A;  3CG7 A;  2GV9 A;  2YKN A;  3ZT1 A;  1J53 A;  3M8R A;  1NJW A;  4CF1 A;  3OYN A;  4E7J A;  3ZT0 A;  2KFN A;  4E7K A;  2HVH A;  4CHP A;  2F96 A;  2WOM A;  4FZY A;  4BWM A;  2Z1H A;  3T3F A;  1QE1 A;  4E7L A;  1IO2 A;  1HPZ A;  1TKZ A;  1YVU A;  4MQ3 A;  3OYM A;  1J5O A;  3LPU A;  1L3T A;  2BDP A;  4FJ8 A;  4FJN A;  1BL3 A;  1Q8I A;  1TL1 A;  1VRU A;  4E19 A;  2HHX A;  3AA2 A;  1B9F A;  3IS9 A;  1A5W A;  2ZE2 A;  3RRH A;  4KB1 A;  2KZM A;  3VN5 A;  3AVL A;  3VQ4 A;  3OYK A;  1J54 A;  4I9L A;  3WNF A;  1HYZ A;  1D9D A;  1ASU A;  3L2W A;  3ITH A;  3IAY A;  4FJ9 A;  1TAU A;  4FLU A;  4BE0 A;  1FXX A;  4B9M A;  3UIQ A;  1C1C A;  3WNG A;  1HNV A;  4I2Q A;  2VWK A;  4I2P A;  4AHR A;  3DMJ A;  4CGF A;  1XI1 A;  2P5O A;  1CZB A;  1LW0 A;  1RTJ A;  3AV9 A;  4OKE A;  3VQD A;  1RIL A;  4FVM A;  5SWM A;  3KK2 A;  3K5N A;  4CJS A;  1XC9 A;  4CIE A;  4KTW A;  3V1Q A;  3L2V A;  1WLJ A;  4M41 A;  4HUG A;  1RT4 A;  3SUN A;  3CM5 A;  3OJS A;  3SJJ A;  3PX6 A;  5C42 A;  4J2E A;  4CK2 A;  3OJU A;  3NGY A;  3HPH A;  3MXJ A;  3SUP A;  1JLG A;  1I3A A;  2VG6 A;  1A5X A;  1VSJ A;  4CEA A;  2EX3 A;  2VWJ A;  3O3H A;  3PV8 A;  4CGJ A;  4XIU A;  3KLE A;  1VSL A;  3OVN A;  5I3U A;  4OLA A;  2Z1G A;  3SV3 A;  4PUO A;  2ATQ A;  4RW8 A;  4CFC A;  2B6A A;  4CE9 A;  4OKK A;  2HNZ A;  3VQ6 A;  3DOK A;  3NF9 A;  5SZT A;  4OPK A;  2A1S A;  4CJT A;  3TR8 A;  1VRT A;  3ZT3 A;  1BCM A;  3PUF A;  1RT2 A;  3DLG A;  3V1R A;  4ZTJ A;  3LAM A;  1RBU A;  1RT7 A;  1CZ9 A;  4MFB A;  3SYZ A;  3HP9 A;  3RWU A;  3F9K A;  3HVT A;  4UQG A;  3U3Y A;  4CEQ A;  1WNS A;  1REV A;  3V9X A;  1QSS A;  4DTO A;  1L5U A;  4BE1 A;  1BIU A;  2F8T A;  3MEE A;  3TAQ A;  2ZD1 A;  2ETJ A;  3K58 A;  1TKD A;  2HVI A;  4PY5 A;  2NUB A;  4DTN A;  4DQR A;  4AHT A;  4DS5 A;  3C6U A;  5KGX A;  3ALY A;  1HRH A;  4EZ6 A;  5DMR A;  1QTM A;  4Y1D A;  2Y1J A;  3AVC A;  3B6O A;  4N56 A;  4ZTF A;  3OYF A;  3OYE A;  4CEB A;  3NCI A;  1C0U A;  4KHY A;  1JLA A;  3QNO A;  4O55 A;  3QIN A;  4CJL A;  3OS0 A;  1U47 A;  4CEO A;  4KRF A;  4DTS A;  1LWE A;  4Y1C A;  2DY4 A;  2YHA A;  3QLH A;  4W5T A;  1L3U A;  4F3O A;  2OPS A;  4DTR A;  4CK3 A;  1EXQ A;  3L2R A;  1RTD A;  1WSE A;  1D5A A;  3ZT2 A;  1RT3 A;  4FLT A;  4JLH A;  4C8O A;  3VQ8 A;  1VSI A;  3SZ2 A;  3QO9 A;  4M3W A;  4EZ9 A;  3MAQ A; 
#chains in the Genus database with same CATH topology
 1YJN N;  3CER A;  1HX1 A;  1NK8 A;  4FJG A;  3VEV A;  3A5N C;  2FBX A;  1W9H A;  4WQ5 A;  1S72 N;  2NRX A;  4ICL A;  4RG8 A;  5C10 A;  1SZ2 A;  1S6P A;  4GW6 A;  2OAN A;  1ZBU A;  2UXB K;  3MXM A;  1R59 O;  4BRM A;  1T7P A;  1TK0 A;  1JL1 A;  4ID5 A;  4DWI A;  4A2B A;  2BGG A;  4LC9 B;  1ATS A;  3A2F A;  1IKW A;  4KAZ A;  1RFQ A;  1F21 A;  1WBD A;  1C0G A;  2EHG A;  1RTH A;  4NXN K;  2I5J A;  2UUA K;  4BRL A;  4JI5 K;  4H0Y B;  3U9Z A;  1RT5 A;  5AFU H;  3QIC A;  1TK8 A;  1DEJ A;  4FK2 A;  1VQK N;  3RTV A;  1KLN A;  1S22 A;  4CVN E;  5TKW A;  1TYQ A;  4OGE A;  2FC0 A;  1RTI A;  2WUS A;  4IZ9 A;  1C6V A;  3VEW A;  3HVR A;  4KHS A;  4FWL A;  3OYJ A;  2P9U B;  3QEW A;  1W2B M;  1Y97 A;  3SQ2 A;  1Q86 O;  5AQY A;  3O9U A;  1RDC A;  3SBT A;  5KQ8 A;  2HBL A;  4DF4 A;  5E26 A;  3QEP A;  2G8F A;  4FZX C;  3TSP A;  2HHS A;  1WSJ A;  4CHY A;  3BDP A;  4A62 A;  3KLG A;  3HT3 A;  3SK3 A;  4DV2 K;  3FZL A;  1Q82 O;  3MXI A;  3HOT A;  1NK4 A;  1ZBH A;  3CXC M;  4DSI A;  4E89 A;  1VK0 A;  3IFR A;  2PAV A;  4BC4 A;  4I9Q A;  1S1V A;  1VQ4 N;  1MDU B;  4CEC A;  1M90 O;  1HKG A;  3CQX A;  2G8V A;  3HM9 A;  4C8K A;  3K9J A;  3DLB A;  5D3G A;  4E3S A;  1LOT B;  4KRE A;  1EWR A;  3WNE A;  4CGH A;  1OVQ A;  3KK3 A;  1NNE A;  1YTU A;  4PKH A;  4CF0 A;  2O8B A;  4FYD A;  1YIT N;  3KWG A;  1JLQ A;  1KVA A;  4O8U A;  4IOA L;  4CGG A;  4IFV A;  3WXK A;  4DR7 K;  3HPG A;  3IG1 A;  3IDH A;  2FBY A;  4Z94 A;  2QA4 N;  2F9T A;  4CHZ A;  1SQK A;  3CQY A;  3NF8 A;  4HCC A;  5AQN A;  2FSN A;  3CJ1 A;  4O4G A;  3VTH A;  5AQF A;  1VSD A;  3WT0 A;  1XC3 A;  4YOR A;  4HUE A;  4J2A A;  4B9T A;  2HMI A;  4LD0 A;  4NLB A;  3LP3 A;  3O4Q A;  4GV3 A;  5AJ3 K;  3M8Q A;  3HI0 A;  3THW B;  2QWR A;  3WNH A;  3MX2 A;  4C1N K;  3J7A P;  1MA9 B;  1J5E K;  2P9P A;  3UKU A;  4JKA A;  3O08 A;  4BVO A;  4QS8 A;  1EET A;  1GLF O;  3JAM O;  3DYA A;  4BDP A;  2QWN A;  2CGL A;  1QQM A;  5HL7 L;  3ASM A;  3NE6 A;  4YHH K;  2XY5 A;  1LV5 A;  4IWV A;  3TI0 A;  1UA1 A;  4Y0W A;  2G8H A;  1LAV A;  4FJL A;  3AO3 A;  4FJH A;  1ITG A;  1RDU A;  2D0A A;  3O3G A;  1BCO A;  4LF5 K;  5KPR A;  4E7H A;  3K5O A;  1VSE A;  3ZSV A;  2E5L K;  3CC2 N;  4Z4I A;  5ADX A;  4ELU A;  3L2Q A;  2F8S A;  4FM1 A;  3DLK A;  5H1S Q;  1O1W A;  4IJN A;  3WXL A;  1U48 A;  1NGA A;  4Z4H A;  2F4V K;  2PYL A;  3SPZ A;  3W0L A;  2ZF5 O;  3G71 N;  3CCU N;  5GAD P;  3AA3 A;  3MN5 A;  4LH4 A;  1VQO N;  1SS6 A;  3RMD A;  3DRS A;  3DXM B;  4X66 K;  2QXF A;  2ASP A;  3VQB A;  2QKK A;  3O9R A;  5AR0 A;  4KPY A;  3THX B;  5HRS A;  3FE1 A;  1QHA A;  3D2E A;  4I6M A;  4CF8 A;  1QS4 A;  5IWA K;  3RMA A;  3BF1 A;  3ZET A;  4LY7 A;  1YIJ N;  2IOC A;  3Q7C A;  3AVK A;  1NGI A;  3BZC A;  4DR1 K;  3SQ1 A;  4B8A B;  3U4L A;  3UKR A;  4FVU A;  4DHY A;  3KKS A;  2Q3S A;  3LAN A;  4ILJ A;  3SV4 A;  3VA0 A;  4JKC A;  2WC9 A;  1IJJ A;  4ILH A;  2RHK A;  2DTU A;  4MLE A;  3EE8 A;  4X64 K;  2ZJP L;  5J2Q A;  4CJV A;  2D0P A;  3CCV N;  2YX6 A;  2NLX A;  3WUH A;  3CMA N;  2HHQ A;  4DV6 K;  4CJW A;  1V4S A;  5F0X A;  4DFJ A;  4Z4C A;  4B1V A;  3CCS N;  1NGC A;  5M1K A;  3MWP A;  4JD2 A;  5BRH A;  3OYB A;  2A3Z A;  3FGU A;  3A0I X;  4FJI A;  1NWK A;  4DR4 K;  4MDB A;  2P9K A;  3CFP A;  3KD1 E;  1K73 O;  5AZI A;  3H1Q A;  4B3S K;  1T03 A;  1IG9 A;  1Q9Y A;  3QIO A;  3IMX A;  3NMU A;  3ZCM A;  1O13 A;  1NK9 A;  2FLO A;  5M1N A;  2IVN A;  3F73 A;  3TAB A;  4K42 A;  2IVP A;  2HND A;  1LW2 A;  1JCG A;  2ZGY A;  5C2D A;  4MO5 A;  3KLH A;  4IOC L;  3O8M A;  4FWQ A;  4YOY A;  2FF6 A;  4NCG A;  1XHX A;  3DRP A;  4FK0 A;  2IDO A;  4JK8 A;  3HM8 A;  5J1E A;  3O4W A;  4FJ7 A;  5C15 A;  3OA9 A;  4BRQ A;  4W5Q A;  3LDQ A;  5AZJ B;  4E1J A;  1X3N A;  3AVH A;  3VQ5 A;  3VQ7 A;  2PYJ A;  1S1W A;  3VF2 A;  1WUA A;  5DK5 A;  4PHT X;  2CGK A;  1VQL N;  3RR8 A;  4NCB A;  1D4X A;  4KV8 A;  1V4T A;  2KFZ A;  5HRP A;  1N5Y A;  4DFM A;  2QM1 A;  3M5R A;  3RRG A;  3VTI A;  1KFS A;  1G15 A;  4BY9 C;  1EQY A;  3GDQ A;  3WEE B;  1E3M A;  4DSF A;  4E1M A;  3CET A;  1YUW A;  1RBR A;  1EO1 A;  1RBT A;  3KK1 A;  1QSL A;  3L0Q A;  4JK9 A;  1TK5 A;  4M3R A;  2HHV A;  4BRK A;  2HHW A;  1HJO A;  2GTD A;  3LDS A;  4B3T K;  4HCB A;  1G99 A;  3CCM N;  4E7J A;  4E7K A;  2BH1 A;  2F96 A;  4IJA A;  4E7L A;  1IO2 A;  3OYM A;  2JWK A;  1VQ5 N;  1L3T A;  4FJ8 A;  3LDN A;  4FJN A;  1QVF M;  1BL3 A;  3RRH A;  3VN5 A;  1Z05 A;  3OHR A;  3VQ4 A;  3CCJ N;  1J54 A;  3C7N B;  1ZXO A;  3ITH A;  4JEP A;  4BE0 A;  3SAH A;  1C1C A;  3WNG A;  4FPB A;  4CGF A;  1XI1 A;  1LW0 A;  3LDO A;  2VGM A;  5SWM A;  3KK2 A;  1RIL A;  4CD1 A;  1HNW K;  4CJS A;  3V1Q A;  3L2V A;  1U2V B;  3SUN A;  3OJS A;  3SJJ A;  4K0K K;  3SUP A;  1I3A A;  2EX3 A;  1BOT O;  5I3U A;  4WYB A;  2NRR A;  2Z1G A;  3SV3 A;  2ATQ A;  4RW8 A;  1VHX A;  4OKK A;  3DXK A;  4OPK A;  4LF6 K;  4WFB L;  1RT2 A;  3WXI A;  3DLG A;  4MFB A;  5C0Y A;  4DQ8 A;  4OX9 K;  4DTO A;  4BE1 A;  2ETJ A;  4FSV A;  4DTN A;  1GLE G;  4DQR A;  2KLA A;  4JN4 A;  4EZ6 A;  2Y1J A;  1NM1 A;  3B6O A;  2GWJ A;  2NNW A;  4B1W B;  3NCI A;  4KHY A;  4XH1 A;  4KRF A;  1YI2 N;  4W5T A;  4JKE A;  4DTR A;  4CK3 A;  4CZG A;  1GLD G;  1DGK N;  4JKB A;  1VSI A;  3RSE A;  1VQ8 N;  2KHO A;  2UYT A;  4E7I A;  3ZSZ A;  4CJQ A;  3H1V X;  3J8A A;  3LWM A;  3K59 A;  1JLF A;  4L8R B;  4CJF A;  1VQP N;  4KTQ A;  4ELV A;  3DAW A;  2HBM A;  2VWB A;  3D45 A;  4K8X A;  5CYM A;  5AQZ A;  4F2S A;  1K8K A;  5C2F A;  4PA1 A;  2Z1J A;  3OYL A;  2W6K A;  1YAG A;  2LSN A;  4F8R A;  3AO1 A;  2O8E B;  2GBZ A;  3ZSQ A;  4BDZ A;  1RT6 A;  2P51 A;  1NKC A;  4H5V A;  1WSG A;  3QIP A;  3MWT A;  2X6N A;  2Q2R A;  2E4L A;  4WFN L;  4ISE A;  5A2Q O;  4B3R K;  1GLC G;  3FFI A;  4CHQ A;  3DLL L;  1DTT A;  3I56 N;  2DFH A;  2P9U A;  1E4F T;  4BDY A;  4DQP A;  1DKG D;  1XNR K;  1IKV A;  4DQQ A;  1S1U A;  2E1Y A;  1WB9 A;  2RF2 A;  2ZWH A;  3V9Z A;  2YHX A;  1RDD A;  2BAN A;  3L8B A;  3ZX2 A;  4CJ3 A;  1D9F A;  3SPY A;  1I94 K;  1TGO A;  4OGC A;  1VSM A;  3CHW A;  3VEX A;  3HXM A;  3ATV A;  4FWS A;  1WSH A;  4H4O A;  4F9O A;  1UA0 A;  3OYI A;  2KTQ A;  4DTX A;  3VQ9 A;  1SKS A;  3HL8 A;  3HSC A;  3WQT A;  4H0P A;  2IVO A;  3NH0 A;  1SV5 A;  2ZQB A;  3BF3 A;  3QET A;  4FM0 A;  4F2R A;  3SMS A;  1T6D A;  3LZI A;  1SL2 A;  4BRC A;  3Q7B A;  4H0X B;  3QEX A;  1U04 A;  2FXU A;  1HPM A;  3ZEU A;  4HUF A;  3OYG A;  4CBW A;  3ZSW A;  4FK4 A;  4IFY A;  5T7B A;  2HF4 A;  5J2P A;  4DLG A;  3IKM A;  4FLV A;  3EE9 A;  4CZL A;  3V1O A;  4YNQ A;  5JMV A;  4DTP A;  3ZSO A;  2P5G A;  3E9O A;  3LP0 A;  3K5L A;  3P31 A;  3ULD A;  4DQI A;  4Z4E A;  5ELZ A;  5BR9 A;  1NG9 A;  4O0J A;  2QI2 A;  2OPR A;  4BRA A;  1YVN A;  3NF7 A;  4DTU A;  4B9V A;  4BRF A;  4EFH A;  1HR0 K;  3I0S A;  4DMN A;  4UY8 O;  4YDU C;  1KCF A;  3AVM A;  1YT3 A;  4JV5 K;  4DUZ K;  1C0M A;  4O5F A;  3VET A;  3M6G A;  2Z1I A;  4C8M A;  1IBK K;  2PY5 A;  1N8R O;  1RDW X;  1L3S A;  3KK7 A;  5EOY A;  3B6P A;  3G25 A;  5KPZ A;  3NF6 A;  1GOB A;  3O80 A;  3AA5 X;  4RWT A;  4FJX A;  2XO7 A;  4FWK A;  4EIA A;  3CJB A;  3F9M A;  1E4G T;  3OS1 A;  1K8A O;  1BA0 A;  3TAR A;  1HNI A;  4RW6 A;  4FWO A;  3VQQ A;  3NGZ A;  4DV7 K;  3D2F A;  3LP1 A;  3GE1 A;  3QER A;  4CZJ A;  2XRI A;  3LM2 A;  5JVG L;  4JS4 A;  3TAF A;  3CJC A;  4BQZ A;  1HMV A;  2YHW A;  2YNI A;  3O9S A;  4YOV A;  2GEM A;  5CZ1 A;  4EHU A;  5FPE A;  4IEE A;  5KPT A;  4EP5 A;  3CQ8 A;  4AIL C;  3DXM A;  3QES A;  3O6W A;  5AQV A;  3VPZ A;  3C6T A;  4BGA A;  1LWC A;  2A40 A;  2QWO A;  3THX A;  1Q81 O;  4DSK A;  3TTF A;  3A5O C;  4BR4 A;  3J7Y P;  2IAJ A;  1NGE A;  3NBP A;  3I33 A;  1HKB A;  3OBY A;  4HHT A;  4CHO A;  3U6F A;  2OCE A;  1N36 K;  4PWD A;  1CZA N;  3RMC A;  1B9D A;  1XHZ A;  4KHW A;  4CZE A;  1Y64 A;  4B9L A;  4OPJ A;  4DLE A;  3ENO A;  3OYH A;  5BPN A;  4CED A;  4FLW A;  3RVC A;  1T44 A;  1NJZ A;  3S3N A;  4CZK A;  3TAG A;  1ZBL A;  1NMN A;  3OY9 A;  4B8C A;  1R0A A;  1S6Q A;  4H4M A;  2Q97 A;  4CGD A;  3T1H K;  3LAL A;  3E1Y A;  4DV5 K;  1BQN A;  3FLC O;  3EZW A;  2YV0 X;  3UB5 A;  1JCE A;  4DV4 K;  2D5R A;  2WBN A;  3AGR A;  1SUQ A;  1ILY A;  3HBT A;  3HZ6 A;  1QHT A;  1RT1 A;  1Q7Y O;  1S9G A;  4FW2 A;  1X9J A;  3NH1 A;  1HQE A;  1UAX A;  3VEZ A;  4Q0B A;  2FSJ A;  4X65 K;  3K57 A;  4DV3 K;  3QEV A;  1YHQ N;  3KIO A;  3SCX A;  3PY8 A;  4YOX A;  3CFR A;  4OKJ A;  4JI0 K;  2YCH A;  3BGR A;  5FRM A;  2HF3 A;  2RE2 A;  4NCA A;  2HB5 A;  3EKU A;  4BR0 A;  1N6Q A;  3M8P A;  5BPM A;  3K2P A;  3QBW A;  1VQ7 N;  2O8F B;  3HO1 A;  3NGI A;  4B1Y B;  4I7F A;  4IDH A;  3FFK B;  5CZ2 A;  2ZJR L;  1ZC6 A;  5CY4 A;  1FKO A;  4DU4 A;  4GVM A;  1VQN N;  4KHN A;  5FRO A;  1VSF A;  4IEI A;  4LH5 A;  1KTQ A;  4AHU A;  5HRO A;  2E2P A;  4CEZ A;  4JS5 A;  4CJK A;  2O8D B;  5AQJ A;  5AZJ A;  1SKR A;  4XEI A;  1XMO K;  5JS1 A;  4PKG A;  1IG8 A;  4IBN A;  2V52 B;  3SNN A;  5TKY A;  1BA1 A;  3TTC A;  1JKH A;  4BRN A;  3MK6 A;  1KFD A;  2GUI A;  2ZGZ A;  4BRH A;  5LMU K;  4BR7 A;  4F4K A;  4FJ5 A;  2XY8 A;  1SKW A;  3MCP A;  1QZ5 A;  4FJM A;  3MCA B;  1VSH A;  2HMP A;  4YOU A;  2OA8 A;  3WEE A;  4Z4G A;  1EWQ A;  1YF5 L;  1JLE A;  2BE2 A;  1HYV A;  3HOS A;  1ZBF A;  2B4J A;  4AF1 A;  3AO2 A;  1W0H A;  2F7T A;  4N5S A;  4CEE A;  4CFB A;  4C1N I;  3CG7 A;  4BRE A;  3L4I A;  1YJ9 N;  4CHP A;  2WOM A;  4FZY A;  4BWM A;  2Z1H A;  3L6Q A;  1JJ2 M;  4GY2 B;  1HPZ A;  1TKZ A;  1J5O A;  2BDP A;  4A5A A;  2UUB K;  3LPU A;  2PFU A;  1NGJ A;  1Q8I A;  1NU0 A;  4IO8 A;  1A5W A;  2ZE2 A;  5CE3 A;  5MLC Q;  2KZM A;  3T69 A;  3OYK A;  2QTD A;  3WNF A;  3L2W A;  1TAU A;  3C7N A;  4FLU A;  1C0F A;  4B9M A;  3TTD A;  4AHR A;  3CJ7 A;  3DMJ A;  4IFE A;  1IBL K;  4OKE A;  1XC9 A;  4WQ5 C;  3PIO L;  4M41 A;  1RT4 A;  4J2E A;  4AQY K;  3MXJ A;  4FO0 A;  3PV8 A;  1A5X A;  1VSJ A;  3ZLJ A;  1VSL A;  3FZH A;  1MWM A;  4PUO A;  5AQU A;  2B6A A;  2HNZ A;  3DOK A;  5SZT A;  4H5T A;  4DR5 K;  4GNI A;  1S3X A;  3C6H A;  3EL2 A;  3JS6 A;  3V1R A;  4ZTJ A;  2KKZ A;  5GIO A;  1CZ9 A;  1N34 K;  3HP9 A;  3VEO A;  4UQG A;  3TU5 A;  1WNS A;  3VF4 A;  5GIP A;  3K58 A;  1TKD A;  4FL9 A;  4GVE A;  5KGX A;  3VGM A;  5DMR A;  1QTM A;  4Y1D A;  3T1Y K;  4ZTF A;  3P4I A;  2DY4 A;  3CPE A;  3CME N;  4F3O A;  1D5A A;  3P39 A;  2NZT A;  1T6C A;  4FPA A;  4H0T B;  4C8O A;  3VQ8 A;  3D6R A;  2E20 A;  3SZ2 A;  3QO9 A;  4DV0 K;  3LDP A;  4EZ9 A;  3SJH A;  4H0O A;  1NOY A;  1ATR A;  3HTV A;  3P83 D;  1NJY A;  4DSL A;  5LJV A;  3T19 A;  3ZSR A;  1NKB A;  1W7A A;  2VGN A;  1KRP A;  4CHN A;  1ESV A;  3DJC A;  1BI4 B;  3S9H A;  4JRQ A;  2YHB A;  1NGB A;  1OVY A;  2HOE A;  1KQS M;  3IUC A;  4ISG A;  5C24 A;  4CF9 A;  3ID8 A;  5KGW A;  4FM2 A;  3J81 O;  1QQN A;  2H3G X;  5AQK A;  2QKB A;  3TPQ A;  3PSF A;  1X9M A;  3NDK A;  2O8E A;  2E2Q A;  5J2N A;  1BUP A;  4H03 B;  2YJE A;  1I39 A;  3MN6 A;  3LM9 A;  3TSQ A;  3EZ5 A;  2OZS A;  3SQ0 A;  2E88 A;  2QK9 A;  1C1A A;  2DFE A;  2IIR A;  2UXD K;  5AQL A;  2R7Y A;  1WSI A;  1BO5 O;  4BR2 A;  4R5P A;  5KRT A;  2OTL N;  1NOZ A;  4O8K A;  3DI6 A;  4FLZ A;  3AVG A;  3FZK A;  2P9L B;  1JLB A;  4JAX A;  4JI4 K;  4FXD A;  5FLX O;  2P9N A;  1BQM A;  3S41 A;  4M7Y A;  4KH6 A;  3L3V A;  2D0B A;  5JS2 A;  4DV1 K;  2QWL A;  2P1J A;  2AJQ A;  4HVJ A;  5JLF A;  4W5O A;  1SAZ A;  3TAE A;  4OPH A;  4AM7 A;  1TL3 A;  4DFP A;  4X62 K;  3H45 C;  1L3V A;  4O44 A;  2A41 A;  4NLC A;  5M1Q A;  4C23 A;  4CBU A;  3EY1 A;  2JLE A;  4AH9 A;  1IV0 A;  3A8Y A;  3H08 A;  2CH6 A;  2P9I B;  2VYP A;  3BZK A;  4CZM A;  2Q31 A;  4DR2 K;  4DQS A;  4FJJ A;  1UWB A;  3VQE A;  1U6Z A;  3TAM A;  2NRW A;  1HKC A;  4GV9 A;  2G8W A;  4B9S A;  5LL6 Z;  4CEF A;  4A57 A;  1NKE A;  1W97 L;  1WSF A;  1RDA A;  4DSE A;  3KLF A;  4LF7 K;  4IOX A;  1OKJ A;  5FDL A;  3LWL A;  3O9Q A;  4JK7 A;  5GIN A;  2YI1 A;  2Y1I A;  5CR4 A;  1TUY A;  4YOW A;  1J9A A;  2YJF A;  3VOV A;  1JXE A;  4B1Z A;  1NK5 A;  1EKE A;  1K9M O;  4KHQ A;  4RW7 A;  3OYC A;  4CJP A;  2ZM6 K;  1HLU A;  2PZS A;  3CM6 A;  1GLJ O;  3O9T A;  5LMN K;  2HW3 A;  1RNH A;  5LY3 A;  3BUZ B;  2NRV A;  2O4G A;  4RW4 A;  4JI6 K;  3R9P A;  2ITG A;  4MLH A;  1VQM N;  1KSP A;  4KBO A;  5C12 A;  3GBT A;  1BIS A;  1CXU A;  3H6E A;  2ITM A;  4LSL A;  3KTQ A;  3U8X A;  5BN9 A;  1HYS A;  4WFA L;  4IO9 L;  1KAX A;  4BRG A;  4M3X A;  3QEI A;  5IT9 O;  3VF6 A;  5AQR A;  2AP1 A;  2E6M A;  3N4Q A;  4ELT A;  5AQS A;  4XH4 A;  4BC2 A;  3TWH A;  3V6D A;  3BY5 A;  3M8S A;  3QFP A;  4JI1 K;  3ZX0 A;  3O1B A;  4WE1 A;  2BTF A;  3AVJ A;  5CHI A;  4BR5 A;  3JYT A;  3I8D A;  1CXQ A;  1KC8 O;  4KO0 A;  1S1T A;  3O4N A;  1YTA A;  4BRD A;  5C25 A;  4N47 A;  3KZB A;  2KQ2 A;  4KH4 A;  5FPN A;  1BHL A;  3AVA A;  1NMD A;  3BEX A;  5BN8 A;  4K25 A;  4OJR A;  1KVB A;  4WF9 L;  3F5T A;  3LAK A;  3C95 A;  4DU3 A;  5DM7 L;  5M1P A;  4W5R A;  5HOO A;  2KW4 A;  4JKD A;  4CZH A;  2JGU A;  2W42 A;  3THV A;  4JKG B;  4JYA K;  3NFA A;  4B3M K;  3G4S N;  3H3N O;  4DU1 A;  3LPT A;  4M3U A;  1IKX A;  4FJK A;  5F2R A;  3EYZ A;  4HTL A;  3CC4 N;  3NVK A;  4EAH D;  2PBD A;  3E9P A;  4MO4 A;  5BPL A;  2E2O A;  1FKP A;  3SUQ A;  1HJR A;  3O1W A;  2Q1N A;  2NRH A;  3TAP A;  1N33 K;  3KLI A;  5F1X A;  4BR9 A;  3SI6 A;  1TV6 A;  2E6L A;  2XHB A;  3VGK A;  4CBX A;  4LFA K;  4M3Y A;  4KHU A;  3UE5 A;  4M3Z A;  1GOC A;  1DLO A;  2I7P A;  3CCR N;  4MDA A;  4AHV A;  3MEG A;  3PSI A;  5HRN A;  1BIZ A;  1IKY A;  5AQQ A;  4H8K A;  3SMP A;  4OVL A;  4N41 A;  4JI7 K;  3AAQ A;  1GLL O;  3O3F A;  1X3M A;  4QAG A;  3CFO A;  4WQ4 C;  1NK6 A;  3ZT4 A;  1X9W A;  2QEX N;  1NGG A;  3L3U A;  4XH5 A;  2Q0R A;  4GMJ B;  3ULE B;  1EX4 A;  1XUP O;  2ASO A;  4DTM A;  3K9K A;  4JHD B;  1TUU A;  4ID1 A;  1BG3 A;  3AAP A;  2O8F A;  1DT9 A;  4LSN A;  2VG7 A;  3THW A;  3KD5 E;  1GOA A;  4O0I A;  3AVF A;  1C1B A;  1HQU A;  3A5L C;  1KAZ A;  3HPO A;  1VAZ A;  1GLA G;  4JI8 K;  1HUX A;  4DSJ A;  3L4Q A;  3AO5 A;  2O8D A;  3C65 A;  1S9E A;  4V19 S;  3F2K A;  3ZSX A;  4FOI A;  4IG0 A;  4BRO A;  1K8K B;  5AQO A;  2HNY A;  4DTJ A;  4CW7 B;  4K8Z A;  3CCE N;  3R8E A;  5BRF A;  3DLR A;  4A2A A;  1Z26 A;  5BRD A;  3I0R A;  2ZJQ L;  1VQ9 N;  3EN9 A;  1C0T A;  5CYQ A;  4R79 A;  3V81 A;  3AA4 A;  2RKI A;  3VQC A;  5AQM A;  3CJ9 A;  1WBB A;  5GAH P;  4ILG B;  2KZZ A;  3S3O A;  2V7Y A;  2QXL A;  4AHS A;  4M3T A;  3QFU A;  2E2N A;  1T05 A;  5LJW A;  3V9S A;  5KRS A;  3KKR A;  4C8N A;  1QVG M;  2VQF K;  3T1A A;  2QW9 A;  1K6Y A;  3AGK A;  4H5N A;  3V9U A;  2O8C B;  1KXP A;  3CCQ N;  3ZT1 A;  1NJW A;  3M8R A;  4QS9 A;  4CF1 A;  3KWI A;  3ZT0 A;  5AQT A;  5E84 A;  2HVH A;  2Q36 A;  1NJI O;  4MQ3 A;  5GAE P;  2HHX A;  2I7N A;  2QWP A;  4LFB K;  2CGJ A;  3E9L A;  1B9F A;  4J8F A;  3AVL A;  4A61 A;  4I9L A;  2P9S B;  3VEN A;  1D9D A;  1ASU A;  1HNZ K;  4FJ9 A;  5EVZ A;  1YXQ A;  1JCF A;  3UIQ A;  4I2Q A;  3LL3 A;  2VWK A;  4I2P A;  4IKF A;  4FVM A;  3EKS A;  3RWU A;  1WLJ A;  3H46 O;  4HUG A;  3CM5 A;  5C42 A;  2CH5 A;  4CK2 A;  3NGY A;  3HPH A;  2JWL A;  1JLG A;  2VG6 A;  3J80 O;  3O3H A;  2NRZ A;  4XIU A;  3CPW M;  2VQE K;  3OVN A;  4OLA A;  3MN9 A;  3THY B;  4BG9 A;  4CE9 A;  4H5R A;  3NF9 A;  3VES A;  3ZT3 A;  1VRT A;  4CJT A;  3MMV A;  3CF5 L;  3ID6 A;  3PUF A;  3LAM A;  1RBU A;  3SYZ A;  3F9K A;  3U3Y A;  1REV A;  3ZEU B;  3MEE A;  3TAQ A;  2HVI A;  2NUB A;  1WOQ A;  3K0S A;  3C6U A;  1HRH A;  3A5M C;  4N56 A;  3OYE A;  1C0U A;  3ZYY X;  1JLA A;  4CJL A;  1U47 A;  4CEO A;  4LF8 K;  3N4P A;  3G6E N;  1MWK A;  3L2R A;  3R3L A;  4OPA A;  4GV6 A;  3U9D A;  4FLT A;  3VMF B;  4M3W A;  1J6Z A;  3MAQ A;  2DPN A;  3B8A X;  4QCL A;  4CJ5 A;  4FZZ A;  3KHY A;  4EHT A;  1U49 A;  1KVC A;  2DFF A;  1Q9X A;  1D8Y A;  4DF8 A;  1RBV A;  4DFK A;  4BAC A;  4TSX A;  4CZI A;  3S3M A;  2VCP A;  2VG5 A;  5KTQ A;  4CIF A;  5AQI A;  2B5J A;  4DUY K;  3C94 A;  1BI4 A;  3AVI A;  3CYM A;  3ENB A;  3VQA A;  1DTQ A;  1XNQ K;  3P1G A;  4OO1 J;  4E1N A;  4B1X B;  5E41 A;  1QSY A;  3CJA A;  4OLB A;  4JRP A;  4B08 A;  4KH5 A;  5KI6 A;  2UXC K;  3SAF A;  3D2F B;  3DOL A;  2UU9 K;  2D0O A;  2IC3 A;  4B9Q A;  3TSU A;  1S1X A;  1TYQ B;  3G10 A;  4KI4 A;  2ASM A;  4CI6 A;  4FLY A;  5GAG P;  5B8H A;  3DLH A;  1U45 A;  3HK2 A;  1ASW A;  4KFB A;  3V4I A;  3OW2 M;  2QWM A;  1TKX A;  1XQS C;  3DRR A;  5J2M A;  2P9L A;  2X74 A;  3AVB A;  4RTF D;  4B3O A;  4W5N A;  1FK9 A;  1BGX T;  4BVP A;  3MED A;  1OH7 A;  3VA3 A;  3DWL A;  2X6S A;  4DS4 A;  1NJX A;  4CK1 A;  4BGB A;  5AQP A;  3V9W A;  4H0V B;  2QWQ A;  4NYF A;  1U2V A;  1P90 A;  2J4R A;  3L2U A;  4HWI A;  1UOC A;  3FZF A;  4A5B A;  4B9N A;  4CF2 A;  4LF4 K;  4L3Q A;  3CCL N;  4FWN A;  3TAN A;  3OS2 A;  1S5J A;  3MEC A;  4CFA A;  1JXB A;  2P9I A;  3PX4 A;  3VER A;  1ZBI A;  1NGH A;  3ATU A;  2FSK A;  2O4I A;  4HTU A;  3VEY A;  3VGL A;  4BC3 A;  2RPI A;  1CLQ A;  3IRX A;  2AA4 A;  3MX5 A;  2O8B B;  4DG1 A;  2RN2 A;  1LAW A;  3LP2 A;  4LFC K;  1KLM A;  4J2D A;  5HBM A;  2FBT A;  5BRE A;  4K43 A;  3MDQ A;  3G0Z A;  4RW9 A;  3PX0 A;  4FWM A;  4CJR A;  1IBM K;  1RBS A;  4K41 A;  3O5B A;  3HYF A;  4H5W A;  2HHH K;  4NYN A;  2HHU A;  1OH5 A;  1TVR A;  1FW6 A;  5BR8 K;  1VQ6 N;  4BC5 A;  1NGD A;  3P38 A;  1ZYQ A;  1A5V A;  5EU7 A;  4ISF A;  4C8L A;  4F3T A;  1WAF A;  2OYQ A;  3JSM A;  4KKO A;  2OTJ N;  3EEQ A;  3CD6 N;  1XWL A;  3OTO K;  1Q18 A;  3VQP A;  3E01 A;  1WAJ A;  1RCH A;  2A42 A;  2P9P B;  3UKU B;  4ZHR A;  4PL7 A;  5FPD A;  4KI6 A;  3BP8 A;  4FCY A;  3R1X A;  1GLB G;  3ISN C;  4BWJ A;  5EX5 A;  1FJG K;  1Z6R A;  4CFD A;  3PIP L;  2FBV A;  1ZBS A;  4CZF A;  3NH2 A;  3W3D A;  4FLX A;  3OYD A;  3NVM A;  4J2B A;  5JIC A;  1B92 A;  1SL0 A;  4PL8 A;  2WON A;  3JXU A;  2HHT A;  3LZJ A;  4CJE A;  1EP4 A;  1TKT A;  4QOZ B;  2HST A;  5I42 A;  4JI2 K;  4KB0 A;  4U7B A;  4YFU A;  2IGI A;  1KD1 O;  2GWK A;  4JKF A;  2XY6 A;  2D0C A;  3OBW A;  2NRT A;  2IS3 A;  1RGI A;  4JKH A;  1IH7 A;  4IDK A;  2W6L A;  3WQU A;  1LWF A;  3HJF A;  4WQ4 A;  4DR3 K;  3D2E B;  4I6M B;  2YNG A;  5AFU A;  3MN7 A;  4E0D A;  4GKJ K;  3DLE A;  3ZET B;  1P8Z A;  4JKG A;  2UUC K;  4M63 C;  4YDU A;  1N32 K;  3QNN A;  5DM6 L;  2GEL A;  4B9U A;  3AAR A;  2OZM A;  3PO5 A;  5AQW A;  3UKR B;  1QQC A;  5FPM A;  3I8B A;  1NLV A;  3SUO A;  4JNE A;  1T8E A;  2YNF A;  1OH6 A;  3AVN A;  3CI5 A;  4CER A;  4PQU A;  4M42 A;  2G8I A;  1TAQ A;  3RR7 A;  2WTU A;  3K5M A;  2V7Z A;  4PKI A;  3DM2 A;  4JD2 B;  2HBK A;  2E1Z A;  1JL2 A;  2E8A A;  2F9W A;  4KTZ A;  2YNH A;  1VSK A;  2P9K B;  4Z0U A;  1NK0 A;  5JLH A;  4M7X A;  3KVG A;  5HRR A;  3I55 N;  3D0P A;  3P5J A;  2X78 A;  5AZI B;  2YKM A;  1BU6 O;  4KHP K;  5FRN A;  4CGI A;  3OYA A;  3E66 A;  1XMQ K;  3M1F A;  3NAE A;  4G9Z A;  5AQH A;  1QZ6 A;  4BQL A;  3AY9 A;  4NB4 A;  5HP1 A;  4WCE L;  3HST B;  1KAY A;  1H1V A;  2A6A A;  4CJU A;  3R6M A;  3ULE A;  1SL1 A;  1MU2 A;  1HNX K;  1X9S A;  2GX9 A;  4CJ4 A;  2G8K A;  2A1R A;  3KJV A;  3PO4 A;  4JHD A;  4M45 A;  4CD3 A;  1NK7 A;  3QBX A;  2HBJ A;  2V51 B;  4G1Q A;  3RMB A;  4CIG A;  4CJ7 A;  1LCU A;  4CES A;  1YJW N;  3NHG A;  1WN7 A;  5M1F A;  3U3G A;  1Z25 A;  3CIP A;  3ZSY A;  5HLF A;  2W40 A;  3ENH A;  3AO4 A;  3HP6 A;  3FR0 A;  4QS7 A;  1ASV A;  4NXM K;  4FW1 A;  1NGF A;  4IXC A;  4AHC A;  5K14 A;  2OPP A;  1RDB A;  3QB0 A;  1OH8 A;  1U4B A;  3LDL A;  2GUP A;  4BRP A;  5ADX H;  4EP4 A;  2XY7 A;  5M1O A;  3C0B A;  4Q5V A;  2W41 A;  4Z4F A;  4N76 A;  1JLC A;  2Q0U A;  1ATN A;  3CC7 N;  1X1P A;  3C6A A;  4DCH A;  4O5B A;  3SQ4 A;  4IG3 A;  2D1K A;  5I9E B;  2FF3 B;  2G8U A;  3SLC A;  2OPQ A;  3FZM A;  4BE2 A;  2GV9 A;  4LF9 K;  2YKN A;  4JI3 K;  1J53 A;  3SBG A;  4DB3 A;  2O8C A;  1NBW A;  2BUP A;  3OYN A;  2KFN A;  5EXW A;  3T3F A;  1QE1 A;  3GG4 A;  3T7Z A;  1YVU A;  3QML A;  5AQG A;  5AQX A;  3GL1 A;  1TL1 A;  2D4W A;  1VRU A;  4E19 A;  2EWS A;  3AA2 A;  4FOE A;  3IS9 A;  3WXM B;  1M1K O;  4RCH A;  2P9N B;  3D7E O;  1HYZ A;  3IAY A;  3SAG A;  2P9S A;  1FXX A;  2WFB A;  1HNV A;  5KQD A;  2P5O A;  3WXJ A;  3VQD A;  1CZB A;  1RTJ A;  3AV9 A;  3K5N A;  4CCH A;  4A59 A;  3H3O B;  4KTW A;  4CIE A;  4NO7 A;  3EO3 A;  3PLA A;  3PX6 A;  4BRI A;  3OJU A;  2YHY A;  4CEA A;  1BDG A;  2VWJ A;  4CGJ A;  3KLE A;  3M3Z A;  4B1U B;  3DXK B;  4CFC A;  3THY A;  3VQ6 A;  1T3V A;  2A1S A;  4FWR A;  2A5X A;  3TR8 A;  1BCM A;  3ZX3 A;  1RT7 A;  4KB1 A;  4BG8 A;  4YY3 K;  3HVT A;  4YOT A;  4CEQ A;  3V9X A;  1QSS A;  1L5U A;  2F8T A;  1BIU A;  4U67 L;  5EY4 A;  2ZD1 A;  4PY5 A;  4AHT A;  4DS5 A;  4DKW A;  3ALY A;  3J7Z O;  3QDK A;  3AVC A;  3OYF A;  4CEB A;  4AM6 A;  1BWF O;  3QNO A;  4O55 A;  3QIN A;  4FWP A;  1QQO A;  3OS0 A;  4DTS A;  4DR6 K;  1LWE A;  4Y1C A;  5JVH L;  2YHA A;  3QLH A;  1L3U A;  3HRG A;  2OPS A;  1EXQ A;  4GKK K;  1RTD A;  3GOI A;  1WSE A;  3ZT2 A;  1RT3 A;  3RSE B;  4JLH A; 
#chains in the Genus database with same CATH homology
 1NOY A;  4E7I A;  4QCL A;  4CJ5 A;  1NK8 A;  3P83 D;  1NJY A;  4FJG A;  4FZZ A;  1U49 A;  3ZSZ A;  1KVC A;  4CJQ A;  2DFF A;  4DSL A;  3T19 A;  1Q9X A;  3LWM A;  1D8Y A;  3ZSR A;  1NKB A;  3K59 A;  4DF8 A;  1JLF A;  1RBV A;  4DFK A;  4L8R B;  4CJF A;  2FBX A;  4BAC A;  4KTQ A;  1W9H A;  1KRP A;  4TSX A;  4ELV A;  4ICL A;  4RG8 A;  4CHN A;  3S3M A;  2VG5 A;  5KTQ A;  1BI4 B;  4CIF A;  3S9H A;  1S6P A;  2B5J A;  3D45 A;  4GW6 A;  4K8X A;  3C94 A;  1BI4 A;  1ZBU A;  5CYM A;  3AVI A;  3CYM A;  4CCH A;  4JRQ A;  4F2S A;  3VQA A;  3MXM A;  1T7P A;  2YHB A;  1TK0 A;  4PA1 A;  1JL1 A;  2Z1J A;  4ID5 A;  3OYL A;  4DWI A;  1DTQ A;  5C24 A;  2BGG A;  4CF9 A;  3P1G A;  3A2F A;  1IKW A;  4E1N A;  4KAZ A;  1F21 A;  5E41 A;  5KGW A;  1QSY A;  2EHG A;  1RTH A;  4FM2 A;  2I5J A;  2LSN A;  2QKB A;  4OLB A;  4F8R A;  3AO1 A;  4JRP A;  4B08 A;  2GBZ A;  3ZSQ A;  1X9M A;  3NDK A;  4BDZ A;  1RT6 A;  2P51 A;  5KI6 A;  1RT5 A;  5J2N A;  1NKC A;  1WSG A;  3DOL A;  1I39 A;  3QIP A;  1TK8 A;  2X6N A;  2IC3 A;  2E4L A;  4FK2 A;  3RTV A;  1KLN A;  3EZ5 A;  1S1X A;  3G10 A;  4KI4 A;  4OGE A;  3SQ0 A;  2FC0 A;  2OZS A;  4IKF A;  2QK9 A;  4FLY A;  1RTI A;  1C1A A;  2DFE A;  3DLH A;  1U45 A;  3HK2 A;  1C6V A;  3FFI A;  1ASW A;  3HVR A;  2R7Y A;  4KHS A;  1WSI A;  4KFB A;  4R5P A;  5KRT A;  4CHQ A;  1NOZ A;  3OYJ A;  1DTT A;  3DI6 A;  3QEW A;  2DFH A;  4FLZ A;  3V4I A;  3AVG A;  1TKX A;  1Y97 A;  3SQ2 A;  4BDY A;  3DRR A;  5J2M A;  1JLB A;  4DQP A;  4FXD A;  1IKV A;  2X74 A;  4DQQ A;  1S1U A;  1RDC A;  2RF2 A;  3AVB A;  4DF4 A;  4W5N A;  4B3O A;  1BQM A;  3V9Z A;  1FK9 A;  3QEP A;  1RDD A;  1BGX T;  2G8F A;  4FZX C;  2BAN A;  3L8B A;  2HHS A;  3MED A;  3L3V A;  2D0B A;  5JS2 A;  3VA3 A;  2P1J A;  2AJQ A;  1WSJ A;  2X6S A;  4CJ3 A;  4CHY A;  4HVJ A;  3KLG A;  4CK1 A;  4DS4 A;  3HT3 A;  4W5O A;  3V9W A;  1TGO A;  3SPY A;  4OGC A;  3MXI A;  1NK4 A;  4NYF A;  1VSM A;  1ZBH A;  4DSI A;  3TAE A;  3HXM A;  4E89 A;  1TL3 A;  1VK0 A;  4DFP A;  3L2U A;  1UOC A;  1WSH A;  4H4O A;  4O44 A;  1L3V A;  4B9N A;  1UA0 A;  4CF2 A;  3EY1 A;  2JLE A;  4I9Q A;  4AH9 A;  3OYI A;  1S1V A;  2KTQ A;  4DTX A;  3VQ9 A;  3OS2 A;  3TAN A;  3HL8 A;  1S5J A;  1SKS A;  3H08 A;  3MEC A;  4DQS A;  4FJJ A;  4CFA A;  4CEC A;  1JXB A;  1UWB A;  1SV5 A;  2ZQB A;  3NH0 A;  3PX4 A;  3QET A;  4FM0 A;  2G8V A;  4F2R A;  3VQE A;  3HM9 A;  1ZBI A;  3TAM A;  3LZI A;  1SL2 A;  4C8K A;  3DLB A;  5D3G A;  4E3S A;  2G8W A;  4HTU A;  2O4I A;  4KRE A;  4B9S A;  2RPI A;  3WNE A;  4CEF A;  4CGH A;  3QEX A;  3KK3 A;  1U04 A;  1NKE A;  1CLQ A;  3IRX A;  1WSF A;  1YTU A;  1RDA A;  4HUF A;  4DSE A;  3KLF A;  4DG1 A;  4CF0 A;  3OYG A;  4FYD A;  2RN2 A;  1LAW A;  3LP2 A;  5FDL A;  3ZSW A;  4IFY A;  5T7B A;  3LWL A;  1KLM A;  4J2D A;  4FK4 A;  5J2P A;  5HBM A;  2Y1I A;  4DLG A;  4FLV A;  2FBT A;  1JLQ A;  1KVA A;  3V1O A;  4YNQ A;  4DTP A;  1J9A A;  1JXE A;  1NK5 A;  3ZSO A;  2P5G A;  3G0Z A;  4RW9 A;  4CGG A;  1EKE A;  3PX0 A;  3LP0 A;  4RW7 A;  4CJR A;  4IFV A;  3OYC A;  3K5L A;  4CJP A;  4KHQ A;  3ULD A;  3HPG A;  3IG1 A;  4DQI A;  2PZS A;  4Z4E A;  1RBS A;  4O0J A;  3CM6 A;  2FBY A;  3HYF A;  2HW3 A;  2OPR A;  4CHZ A;  3NF8 A;  1RNH A;  3NF7 A;  4NYN A;  4HCC A;  2HHU A;  4DTU A;  4B9V A;  4O4G A;  1TVR A;  3I0S A;  1VSD A;  4DMN A;  1ZYQ A;  4HUE A;  4J2A A;  1A5V A;  4B9T A;  1KCF A;  2HMI A;  3AVM A;  5EU7 A;  4LD0 A;  2O4G A;  4RW4 A;  4C8L A;  4F3T A;  1WAF A;  2OYQ A;  3JSM A;  1YT3 A;  4KKO A;  2ITG A;  3LP3 A;  3O4Q A;  1KSP A;  1C0M A;  3M8Q A;  1XWL A;  2Z1I A;  4C8M A;  1BIS A;  1CXU A;  3VQP A;  2PY5 A;  3E01 A;  1WAJ A;  1RCH A;  3WNH A;  4LSL A;  1L3S A;  4ZHR A;  3KTQ A;  3B6P A;  1HYS A;  3NF6 A;  4KI6 A;  1GOB A;  4M3X A;  4FCY A;  3QEI A;  3AA5 X;  1EET A;  4FJX A;  3DYA A;  2E6M A;  4BDP A;  3ISN C;  2XO7 A;  4BWJ A;  4ELT A;  3ASM A;  4CFD A;  3NE6 A;  3TWH A;  2FBV A;  3V6D A;  2XY5 A;  1LV5 A;  3OS1 A;  3TI0 A;  1UA1 A;  3M8S A;  3TAR A;  1HNI A;  3NH2 A;  2G8H A;  1LAV A;  4FJL A;  4RW6 A;  3OYD A;  3AO3 A;  4FLX A;  4J2B A;  4FJH A;  1B92 A;  4WE1 A;  1ITG A;  3VQQ A;  1SL0 A;  2D0A A;  3O3G A;  3NGZ A;  1BCO A;  3AVJ A;  3JYT A;  2WON A;  3I8D A;  1CXQ A;  4E7H A;  4KO0 A;  3K5O A;  1VSE A;  3LP1 A;  3ZSV A;  2HHT A;  1S1T A;  3LZJ A;  3QER A;  4Z4I A;  4CJE A;  4ELU A;  3L2Q A;  3O4N A;  1YTA A;  1EP4 A;  1TKT A;  5C25 A;  2F8S A;  4N47 A;  4QOZ B;  2KQ2 A;  4FM1 A;  2XRI A;  3DLK A;  5I42 A;  1O1W A;  4KB0 A;  1BHL A;  4YFU A;  2IGI A;  3AVA A;  1U48 A;  4JS4 A;  3TAF A;  4Z4H A;  2PYL A;  1HMV A;  3SPZ A;  2YNI A;  4OJR A;  1KVB A;  5CZ1 A;  2XY6 A;  3AA3 A;  3LAK A;  4LH4 A;  2D0C A;  3C95 A;  4DU3 A;  2IS3 A;  3RMD A;  1IH7 A;  3DRS A;  4IDK A;  4EP5 A;  4W5R A;  2KW4 A;  3CQ8 A;  4AIL C;  2QXF A;  3VQB A;  2QKK A;  2JGU A;  3QES A;  1LWF A;  3HJF A;  4KPY A;  2W42 A;  3C6T A;  2YNG A;  5HRS A;  4E0D A;  3THV A;  1LWC A;  4CF8 A;  1QS4 A;  3DLE A;  3RMA A;  3NFA A;  4DU1 A;  4DSK A;  4LY7 A;  3QNN A;  4B9U A;  3LPT A;  2IOC A;  4M3U A;  1IKX A;  2IAJ A;  4FJK A;  2OZM A;  3NBP A;  3PO5 A;  3AVK A;  4HHT A;  3BDP A;  4CHO A;  3U6F A;  3SQ1 A;  3EYZ A;  4PWD A;  4B8A B;  1QQC A;  3RMC A;  1B9D A;  1XHZ A;  4KHW A;  3KKS A;  2Q3S A;  4B9L A;  3LAN A;  3SV4 A;  4OPJ A;  4DLE A;  3SUO A;  1FKP A;  3OYH A;  3VA0 A;  3SUQ A;  1T8E A;  2YNF A;  1HJR A;  1D9F A;  3AVN A;  4CED A;  4FLW A;  3TAP A;  2DTU A;  4CER A;  3KLI A;  4PQU A;  4M42 A;  2G8I A;  1NJZ A;  3S3N A;  5J2Q A;  4CJV A;  3TAG A;  3SI6 A;  1TAQ A;  3RR7 A;  1TV6 A;  1ZBL A;  3K5M A;  3OY9 A;  4B8C A;  1R0A A;  1S6Q A;  2E6L A;  4H4M A;  2XHB A;  2HHQ A;  4CGD A;  4CJW A;  3DM2 A;  4DFJ A;  4Z4C A;  3LAL A;  4M3Y A;  4KHU A;  4M3Z A;  1GOC A;  1BQN A;  1DLO A;  1JL2 A;  2YV0 X;  3OYB A;  4KTZ A;  2YNH A;  1VSK A;  2D5R A;  1SUQ A;  4FJI A;  4Z0U A;  1NK0 A;  4AHV A;  3MEG A;  3KD1 E;  1QHT A;  1RT1 A;  3CFP A;  5HRR A;  5HRN A;  1S9G A;  1BIZ A;  3D0P A;  3P5J A;  2X78 A;  2YKM A;  1IKY A;  4FW2 A;  4CGI A;  3NH1 A;  4H8K A;  1HQE A;  1UAX A;  3OYA A;  5FRN A;  4Q0B A;  3K57 A;  1T03 A;  3QEV A;  4OVL A;  3KIO A;  3SCX A;  4N41 A;  1IG9 A;  3PY8 A;  3O3F A;  1Q9Y A;  3NAE A;  4QAG A;  3QIO A;  3CFR A;  3CFO A;  4OKJ A;  1NK6 A;  3ZCM A;  3ZT4 A;  1X9W A;  5HP1 A;  1NK9 A;  3HST B;  3BGR A;  3L3U A;  3F73 A;  3TAB A;  5FRM A;  4GMJ B;  4CJU A;  1EX4 A;  4NCA A;  2HB5 A;  2HND A;  1LW2 A;  1SL1 A;  1MU2 A;  4DTM A;  1N6Q A;  3M8P A;  3KLH A;  1X9S A;  3K2P A;  4CJ4 A;  2G8K A;  2A1R A;  3KJV A;  3PO4 A;  3HO1 A;  4ID1 A;  4NCG A;  4M45 A;  3NGI A;  1XHX A;  1NK7 A;  3DRP A;  4FK0 A;  2IDO A;  4I7F A;  4LSN A;  2VG7 A;  5J1E A;  3KD5 E;  1GOA A;  4O0I A;  4G1Q A;  3RMB A;  3AVF A;  5CZ2 A;  4CIG A;  1C1B A;  5CY4 A;  1FKO A;  1HQU A;  4GVM A;  4DU4 A;  4FJ7 A;  4KHN A;  4CES A;  5FRO A;  1VSF A;  3HPO A;  4LH5 A;  1KTQ A;  4AHU A;  5HRO A;  4W5Q A;  4CEZ A;  4DSJ A;  4JS5 A;  4CJK A;  3NHG A;  1WN7 A;  3U3G A;  1Z25 A;  3ZSY A;  5HLF A;  3AO5 A;  1SKR A;  3AVH A;  5JS1 A;  3AO4 A;  3VQ5 A;  3VQ7 A;  1S1W A;  1S9E A;  4IBN A;  3HP6 A;  2PYJ A;  3SNN A;  3ZSX A;  1ASV A;  4FW1 A;  5DK5 A;  4AHC A;  5K14 A;  2OPP A;  1JKH A;  1RDB A;  4IG0 A;  3RR8 A;  4NCB A;  1NJX A;  1U4B A;  4DTJ A;  1KFD A;  2HNY A;  4EP4 A;  2GUI A;  4K8Z A;  4KV8 A;  4F4K A;  3DLR A;  4FJ5 A;  1Z26 A;  2XY8 A;  2XY7 A;  1SKW A;  3I0R A;  2KFZ A;  5HRP A;  1N5Y A;  4DFM A;  3RRG A;  1C0T A;  5CYQ A;  4Q5V A;  3V81 A;  3AA4 A;  2RKI A;  1KFS A;  1VSH A;  3VQC A;  4FJM A;  1G15 A;  4Z4F A;  2KZZ A;  4N76 A;  1JLC A;  3S3O A;  1X1P A;  2OA8 A;  4DSF A;  4AHS A;  4E1M A;  4M3T A;  1T05 A;  3V9S A;  1RBR A;  5KRS A;  4Z4G A;  3KKR A;  1RBT A;  3KK1 A;  4O5B A;  3SQ4 A;  1JLE A;  2BE2 A;  1HYV A;  4C8N A;  1QSL A;  1ZBF A;  2B4J A;  4IG3 A;  1TK5 A;  4M3R A;  3AO2 A;  2G8U A;  2HHV A;  2HHW A;  2OPQ A;  1W0H A;  4N5S A;  3LDS A;  3T1A A;  1K6Y A;  4CEE A;  3V9U A;  4HCB A;  4CFB A;  4BE2 A;  3CG7 A;  2GV9 A;  2YKN A;  3ZT1 A;  1J53 A;  3M8R A;  1NJW A;  4CF1 A;  3OYN A;  4E7J A;  3ZT0 A;  2KFN A;  4E7K A;  2HVH A;  4CHP A;  2F96 A;  2WOM A;  4FZY A;  4BWM A;  2Z1H A;  3T3F A;  1QE1 A;  4E7L A;  1IO2 A;  1HPZ A;  1TKZ A;  1YVU A;  4MQ3 A;  3OYM A;  1J5O A;  3LPU A;  1L3T A;  2BDP A;  4FJ8 A;  4FJN A;  1BL3 A;  1Q8I A;  1TL1 A;  1VRU A;  4E19 A;  2HHX A;  3AA2 A;  1B9F A;  3IS9 A;  1A5W A;  2ZE2 A;  3RRH A;  4KB1 A;  2KZM A;  3VN5 A;  3AVL A;  3VQ4 A;  3OYK A;  1J54 A;  4I9L A;  3WNF A;  1HYZ A;  1D9D A;  1ASU A;  3L2W A;  3ITH A;  3IAY A;  4FJ9 A;  1TAU A;  4FLU A;  4BE0 A;  1FXX A;  4B9M A;  3UIQ A;  1C1C A;  3WNG A;  1HNV A;  4I2Q A;  2VWK A;  4I2P A;  4AHR A;  3DMJ A;  4CGF A;  1XI1 A;  2P5O A;  1CZB A;  1LW0 A;  1RTJ A;  3AV9 A;  4OKE A;  3VQD A;  1RIL A;  4FVM A;  5SWM A;  3KK2 A;  3K5N A;  4CJS A;  1XC9 A;  4CIE A;  4KTW A;  3V1Q A;  3L2V A;  1WLJ A;  4M41 A;  4HUG A;  1RT4 A;  3SUN A;  3CM5 A;  3OJS A;  3SJJ A;  3PX6 A;  5C42 A;  4J2E A;  4CK2 A;  3OJU A;  3NGY A;  3HPH A;  3MXJ A;  3SUP A;  1JLG A;  1I3A A;  2VG6 A;  1A5X A;  1VSJ A;  4CEA A;  2EX3 A;  2VWJ A;  3O3H A;  3PV8 A;  4CGJ A;  4XIU A;  3KLE A;  1VSL A;  3OVN A;  5I3U A;  4OLA A;  2Z1G A;  3SV3 A;  4PUO A;  2ATQ A;  4RW8 A;  4CFC A;  2B6A A;  4CE9 A;  4OKK A;  2HNZ A;  3VQ6 A;  3DOK A;  3NF9 A;  5SZT A;  4OPK A;  2A1S A;  4CJT A;  3TR8 A;  1VRT A;  3ZT3 A;  1BCM A;  3PUF A;  1RT2 A;  3DLG A;  3V1R A;  4ZTJ A;  3LAM A;  1RBU A;  1RT7 A;  1CZ9 A;  4MFB A;  3SYZ A;  3HP9 A;  3RWU A;  3F9K A;  3HVT A;  4UQG A;  3U3Y A;  4CEQ A;  1WNS A;  1REV A;  3V9X A;  1QSS A;  4DTO A;  1L5U A;  4BE1 A;  1BIU A;  2F8T A;  3MEE A;  3TAQ A;  2ZD1 A;  2ETJ A;  3K58 A;  1TKD A;  2HVI A;  4PY5 A;  2NUB A;  4DTN A;  4DQR A;  4AHT A;  4DS5 A;  3C6U A;  5KGX A;  3ALY A;  1HRH A;  4EZ6 A;  5DMR A;  1QTM A;  4Y1D A;  2Y1J A;  3AVC A;  3B6O A;  4N56 A;  4ZTF A;  3OYF A;  3OYE A;  4CEB A;  3NCI A;  1C0U A;  4KHY A;  1JLA A;  3QNO A;  4O55 A;  3QIN A;  4CJL A;  3OS0 A;  1U47 A;  4CEO A;  4KRF A;  4DTS A;  1LWE A;  4Y1C A;  2DY4 A;  2YHA A;  3QLH A;  4W5T A;  1L3U A;  4F3O A;  2OPS A;  4DTR A;  4CK3 A;  1EXQ A;  3L2R A;  1RTD A;  1WSE A;  1D5A A;  3ZT2 A;  1RT3 A;  4FLT A;  4JLH A;  4C8O A;  3VQ8 A;  1VSI A;  3SZ2 A;  3QO9 A;  4M3W A;  4EZ9 A;  3MAQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...