3V9WA

Crystal structure of rnase t in complex with a preferred ssdna (tta) with two mg in the active site
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
202
structure length
202
Chain Sequence
GLCDRFRGFYPVVIDVETAGFNAKTDALLEIAAITLKMDEQGWLMPDTTLHFHVEPFVGANLQPEALAFNGIDPNDPDRGAVSGYEALHEIFKVVRKGIKASGCNRAIMVAHNANFDHSFMMAAAERASLKRNPFHPFATFDTAALAGLALGQTVLSKACQTAGMDFDSTQAHSALYDTERTAVLFCEIVNRWKRLGGWPLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease T
publication title How an exonuclease decides where to stop in trimming of nucleic acids: crystal structures of RNase T-product complexes
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/dna
total genus 59
structure length 202
sequence length 202
chains with identical sequence B, C, D
ec nomenclature ec 3.1.13.-:
pdb deposition date 2011-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00929 RNase_T Exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3v9wA00
3MXJA 1KCFA 1BQNA 1Z26A 4KKOA 4PY5A 3QEIA 5C24A 3K5LA 2X6SA 2HMIA 5C42A 4I9QA 3DOKA 3SZ2A 3CM6A 3HT3A 2O4IA 1LWCA 5HRRA 2GBZA 3LP3A 4CK3A 4DSJA 5J2QA 3FFIA 1QSLA 4E7JA 1RDDA 2I5JA 2OA8A 4ZTJA 3OYGA 3OYKA 5J2NA 1CXUA 5DMRA 3SUPA 4QOZB 1JXBA 3CFOA 3DOLA 2OPRA 4HVJA 5HRNA 3SV3A 1TKDA 1ZBIA 4ELTA 4FM2A 2XY6A 1LAWA 3DLKA 4FJHA 4CEQA 2Z1JA 3LZIA 3VQ8A 3L8BA 2D5RA 4M42A 1JKHA 3B6OA 1VSFA 3RMCA 2ETJA 2YHBA 4OGEA 4HCCA 5CZ1A 2P5GA 1IO2A 1S1TA 3T3FA 4DWIA 4M3XA 1CZBA 1C0TA 4CEZA 1VRTA 2HNZA 2KQ2A 1HRHA 4K8XA 3AA3A 1C6VA 1REVA 5HRPA 5I3UA 1HQEA 3OYMA 1U48A 3DLHA 4OLBA 2FC0A 1TAUA 4B9MA 1NK5A 4DFMA 3V9UA 4C8OA 4FJMA 3K2PA 2YHAA 4BDZA 3ZSZA 3PV8A 1VSDA 3S9HA 3HVRA 3DMJA 4CIGA 1HYZA 4CERA 4KV8A 3NH0A 1HNIA 3O3GA 1CXQA 1RT1A 1RTJA 2FBXA 4M3YA 3IRXA 4Z4HA 4DU3A 3BDPA 1G15A 4KI6A 3SYZA 2Z1IA 5DK5A 2B4JA 4O44A 3L2RA 1IKYA 3V9ZA 3QETA 1BGXT 3DM2A 3VQCA 3HPGA 4JLHA 2G8WA 4B08A 3ULDA 4CHOA 1NKCA 3KKSA 3K5OA 3V9XA 1J54A 3QEWA 1NJZA 2X78A 3DRSA 3MEDA 1SKRA 3ZSWA 3NF8A 4Y1CA 3OS1A 1KFSA 4CEEA 3IS9A 1BCMA 4CECA 3VQDA 3QEXA 3U3YA 3I0RA 1DTQA 2ITGA 1BISA 3ZT1A 4CHZA 4QCLA 3HPOA 2P5OA 3S3MA 4O4GA 2E6LA 1JLCA 1T8EA 2RF2A 4N56A 2G8VA 3RRHA 4CGHA 1C1BA 3AVGA 4FJIA 1WSFA 4DS4A 1D8YA 3RMDA 1NK4A 2Z1HA 1DLOA 3PX4A 3NH1A 3LZJA 4Y1DA 1VRUA 3OYDA 3OYEA 1LV5A 4FZYA 1MU2A 1KRPA 1HMVA 1WSGA 4XIUA 1RT6A 1RTHA 3DYAA 3L3UA 4JRPA 4B9UA 2GV9A 4BWMA 3VQPA 3JYTA 1RDCA 3P1GA 1NK0A 1UA1A 4CJRA 1T03A 4DF8A 1JXEA 3EYZA 4DS5A 3U6FA 1XWLA 4MFBA 2IGIA 4FJ9A 4FJGA 4DTSA 4FXDA 1BQMA 1K6YA 3LAMA 4FK0A 2JGUA 1UAXA 3SJJA 5HROA 1S5JA 1EP4A 4I2PA 3VQ6A 4KHYA 3SQ1A 3OYBA 4ID5A 3M8RA 1KLNA 1UWBA 2X6NA 4OGCA 3SQ2A 2VG5A 5KRSA 1W0HA 3BGRA 4O55A 1L5UA 1WSIA 4BWJA 3QO9A 4KB0A 1JL2A 4B3OA 1A5VA 1TAQA 1WLJA 3EZ5A 2G8HA 1FXXA 4NCBA 1KVCA 4FVMA 2QK9A 1KSPA 3OYNA 1WSJA 1WNSA 3CG7A 1CZ9A 4AH9A 3RMAA 1IKVA 4QAGA 5KI6A 3KK2A 4FJ8A 4O0IA 2VG6A 2G8FA 1ITGA 5E41A 1WAFA 4GMJB 3K59A 3S3OA 4IBNA 4PWDA 1QHTA 3AVMA 2DY4A 1YTAA 2XY5A 2A1RA 4I9LA 4F3OA 3WNHA 2O4GA 2XY8A 4M3ZA 4FJ5A 5HRSA 3SUNA 1NJXA 1ASVA 1HPZA 3AVIA 3VQBA 3ZCMA 2KZMA 4AHVA 4DFPA 4IKFA 3HP9A 4CE9A 3OYLA 3SUOA 1R0AA 2PYJA 4C8LA 3TI0A 5KGWA 4B8AB 4IFVA 3PX0A 1U4BA 2G8UA 1X9WA 4LH5A 4KI4A 3QNOA 4J2EA 1KLMA 1QS4A 3PUFA 3K5NA 3DI6A 4NYFA 1NK9A 1SKSA 4CJLA 1L3SA 1GOAA 4OKJA 2E4LA 5CY4A 1RT5A 4AHRA 4FM0A 4F2RA 4M3TA 3IG1A 2P1JA 4M3UA 1UA0A 3HJFA 4IDKA 4O5BA 3VN5A 4EP4A 3ZSQA 1HNVA 4FK4A 4F3TA 1RBSA 1NKBA 1RNHA 4F8RA 3O4NA 3AO2A 1LWEA 2OPQA 4KHWA 1CLQA 3AVJA 4CF8A 3G0ZA 3RWUA 1X9MA 2HNYA 4DFKA 4DTNA 3VA0A 2RKIA 1SUQA 1D5AA 1ZBLA 4FJ7A 3QIPA 4ELUA 1VK0A 2IC3A 2IDOA 3PO4A 1TK5A 4CJVA 2HW3A 4CGFA 1S9GA 4CEAA 3SQ0A 2HHQA 1BL3A 3LDSA 3OYJA 4W5OA 4FCYA 4K8ZA 2KTQA 1KVAA 4RW9A 5I42A 3ZT3A 3D0PA 1NOYA 1C0UA 4RW7A 2Z1GA 3NGYA 3AA4A 1LWFA 4KTWA 4JRQA 4F2SA 3WNEA 4FJXA 3CQ8A 1ASWA 2EHGA 3K5MA 4DTMA 1RTDA 2PZSA 2XO7A 3UIQA 3TAPA 4KHUA 3I0SA 1VSHA 3TAQA 1T7PA 1RDBA 4E19A 1S6PA 2OYQA 4FM1A 2A1SA 4HUEA 4JS5A 4BACA 1ZBFA 4NCAA 4EZ9A 3CFRA 4DMNA 2OZSA 3AVFA 1ZBHA 1RT3A 2QXFA 3SI6A 3ZT2A 3HP6A 3VQQA 4Q0BA 4KHNA 3MEEA 1IKWA 1Z25A 4CFBA 4CIEA 1Q9YA 3HO1A 3TARA 3QNNA 3SV4A 3AV9A 4H4MA 3OS2A 2HHSA 5HP1A 4FK2A 3OYHA 4Z4CA 1L3TA 3V81A 2G8KA 1BCOA 4KREA 2YNIA 3LP2A 4RW6A 4LSNA 3KK1A 5JS1A 2EX3A 1XHXA 4N5SA 3VQAA 3HM9A 4CESA 2AJQA 1S1WA 5J1EA 1D9DA 3MECA 1JLQA 4CGGA 2QKBA 3HVTA 2YNFA 4FLUA 2IS3A 4CGJA 4M3WA 1RDAA 4DQSA 3IAYA 4C8NA 1C1AA 4CEOA 1B92A 4B9SA 4G1QA 4Z4FA 2YV0X 3DLRA 2WONA 1RT7A 1TVRA 2DFEA 2YKNA 2ZD1A 3LAKA 3P5JA 3QIOA 2XHBA 2ZQBA 3QEPA 5D3GA 1XHZA 4KHQA 4HUFA 2B5JA 3O3FA 5KTQA 3SPYA 3AO1A 4PA1A 2X74A 3ZSRA 3NF9A 4E1MA 4ZHRA 1TL1A 4DTXA 4CIFA 2XY7A 3L3VA 4CHQA 3V6DA 3MXMA 3DRRA 4NYNA 3QINA 1RBVA 4FLYA 2Y1JA 4DU1A 1SKWA 1TGOA 3NE6A 4FJLA 1C0MA 1KVBA 3NF6A 3OYCA 3KKRA 1NKEA 1O1WA 1TKTA 1SV5A 4CK1A 4FLWA 3V9WA 1S1UA 2VG7A 4B9LA 3OYIA 3C6TA 1TKZA 4KTZA 1VSKA 2VWJA 4AHSA 3ITHA 1SL0A 1D9FA 4AHCA 3LWLA 4NCGA 3PO5A 3RMBA 3C94A 2JLEA 3NF7A 2F8TA 2KW4A 4CCHA 3M8PA 3L2QA 1L3UA 3LPTA 2F8SA 2HHXA 3SCXA 4TSXA 2YNHA 3QESA 3KLIA 1SL2A 4Z0UA 2KFNA 3M8QA 1DTTA 1JLEA 4DTRA 4W5NA 3KLEA 3KJVA 2DTUA 4AHTA 4OJRA 4LD0A 3V1QA 3OYFA 3NAEA 1VSIA 5T7BA 1BI4A 4HUGA 3S3NA 1IG9A 4FLZA 1QE1A 3OS0A 2F96A 1BHLA 1JLBA 3G10A 1I39A 1WN7A 5CYMA 3HXMA 3KTQA 1RT2A 2XRIA 1QSSA 1NJWA 3KD5E 1S6QA 4B8CA 3NHGA 3OVNA 1WSEA 3VQEA 3NGZA 4M3RA 4CJUA 1A5WA 1JLGA 4E7HA 4CJ3A 3PX6A 4N76A 1Q9XA 2Q3SA 4BDYA 4DTUA 3F9KA 3KLGA 4DTJA 5J2PA 1NK6A 2KZZA 3ZSOA 4AILC 3SNNA 3HPHA 3AVLA 3OJSA 2BE2A 3QEVA 4YFUA 4I2QA 5HBMA 4ZTFA 4KTQA 1U49A 5CYQA 1J53A 4Z4IA 1B9DA 2RN2A 3LP0A 4OPKA 2D0BA 3B6PA 3HL8A 1FKOA 1QSYA 1QTMA 2D0CA 4PUOA 4RG8A 3TABA 4FJNA 3KK3A 4CHNA 1LAVA 4HTUA 4LY7A 4CJWA 3ASMA 3EY1A 4OPJA 1YT3A 4ELVA 1HQUA 3AO3A 4CHPA 4OLAA 2RPIA 4DSIA 2ZE2A 4UQGA 5FDLA 3V1OA 2HNDA 2FBTA 4CJPA 3K58A 4E3SA 1N6QA 4CGDA 1FK9A 3VQ7A 1S9EA 1TKXA 4CJ5A 1X1PA 4CJSA 1S1XA 4Z4GA 3ZSXA 2PYLA 3T19A 3RR8A 4FJJA 3AVKA 3M8SA 2HHVA 2DFHA 4CEBA 1VSJA 4HHTA 3QLHA 4DSFA 4J2DA 4L8RB 3E01A 3P83D 2LSNA 1ASUA 4I7FA 2R7YA 1Q8IA 4BE0A 2HVHA 2YKMA 2Y1IA 1N5YA 3DLEA 4CJKA 4GVMA 3V1RA 3TAFA 1VSEA 2KFZA 1F21A 4ICLA 2OPPA 5J2MA 1EXQA 4DSKA 2YNGA 4MQ3A 2IAJA 3WNGA 1EX4A 4E7IA 4DTPA 1U45A 3SPZA 3WNFA 3KIOA 4DG1A 4DQQA 3O4QA 3TR8A 3ISNC 3VQ5A 1L3VA 5SZTA 4IG0A 5K14A 4LH4A 2VWKA 4B9VA 4KO0A 2HB5A 4DTOA 4F4KA 4J2AA 1EETA 3HYFA 4RW8A 3CFPA 4E7KA 3SUQA 3KLHA 2FBVA 4RW4A 3ZT4A 3ZT0A 4DLGA 4HCBA 4KHSA 2P51A 4CFCA 4DF4A 1UOCA 4BDPA 3AA5X 4Q5VA 4E7LA 3RR7A 4CEDA 1U47A 2BGGA 4CJTA 1C1CA 4EP5A 5EU7A 1ZBUA 1KFDA 1BI4B 4OVLA 5JS2A 3OYAA 4KAZA 4N41A 4DQIA 5FRNA 3V9SA 1SL1A 4KRFA 4CF9A 4CJ4A 4OKKA 3AO5A 4C8KA 3KD1E 5CZ2A 3F73A 4CF2A 3OJUA 4KB1A 4W5RA 4DSLA 1XC9A 1TL3A 5SWMA 5FROA 1Y97A 4DLEA 4R5PA 4E1NA 1J9AA 2FBYA 3VQ9A 1WSHA 3L2UA 4M41A 5FRMA 1XI1A 4CGIA 2DFFA 3L2WA 2HVIA 3PY8A 3MAQA 3NDKA 1YVUA 1HJRA 1TV6A 3CM5A 4JS4A 3AVAA 3TAEA 1S1VA 2W42A 3KLFA 3C6UA 4ID1A 3AVBA 3AVHA 2HHTA 3ALYA 4C8MA 1RBUA 3ZSVA 1QQCA 1RBTA 3O3HA 4FW1A 3I8DA 3VA3A 3QERA 4DQPA 4J2BA 4FZZA 4DU4A 4Z4EA 2OPSA 4CFDA 2D0AA 1A5XA 1BIUA 3MEGA 3HK2A 4FW2A 3TAGA 4FYDA 4PQUA 3DLGA 3JSMA 5C25A 3U3GA 1J5OA 1B9FA 1TK8A 3TAMA 3AVCA 3LPUA 4E89A 3K57A 4H8KA 1NK7A 2HHWA 3RTVA 1BIZA 4CF1A 4OKEA 4FLVA 4KPYA 1U04A 4CJEA 3T1AA 3C95A 1TK0A 2GUIA 3NFAA 4AHUA 1NJYA 1T05A 4DFJA 2ATQA 1RBRA 1RILA 1RTIA 3LP1A 3HSTB 3CYMA 1X9SA 2BANA 1LW2A 1FKPA 2HHUA 3TANA 3AO4A 4W5TA 4N47A 4CFAA 1GOBA 3LWMA 2OZMA 4FJKA 3THVA 3H08A 1VSMA 4CF0A 4CK2A 1JLAA 1VSLA 4FZXC 2WOMA 4LSLA 3DLBA 4O0JA 1NK8A 5HLFA 4B9TA 4YNQA 1ZYQA 4B9NA 4BE2A 2E6MA 4CHYA 1WAJA 4FLXA 4KFBA 3V4IA 3MXIA 2PY5A 3RRGA 4CEFA 4H4OA 1NOZA 1IH7A 2NUBA 4WE1A 1JL1A 1IKXA 1RCHA 3AA2A 2IOCA 3AVNA 4CJQA 2BDPA 4M45A 3A2FA 4BE1A 3L2VA 2B6AA 3OY9A 3TWHA 4E0DA 1KTQA 4GW6A 4DQRA 1HYVA 4W5QA 4IFYA 1YTUA 2QKKA 3NCIA 1EKEA 3NBPA 4CJFA 1JLFA 5KRTA 4DSEA 3SQ4A 1LW0A 3NH2A 3VQ4A 3DRPA 4EZ6A 2G8IA 4IG3A 3ZSYA 3NGIA 3LALA 4FLTA 3LANA 1RT4A 3D45A 1HYSA 1I3AA 1GOCA 5KGXA 1W9HA
chains in the Genus database with same CATH superfamily
2JWKA 1KCFA 5C24A 3IKMA 2X6SA 3K5LA 3SZ2A 5LJVA 1S3XA 4WF9L 3LP3A 4CK3A 2YHYA 3HOSA 2I5JA 1R59O 2OA8A 3OYKA 4FPBA 1JXBA 3DOLA 1NGGA 4FOEA 3SV3A 1S22A 4ELTA 4FJHA 3LDOA 4CEQA 2Z1JA 3THXA 4B1YB 1VSFA 3CQXA 5CZ1A 3WEEA 1IO2A 4FVUA 4CEZA 1VRTA 2P9KB 1C6VA 3DLHA 3OYMA 3MX5A 1NK5A 3E1YA 2QWQA 2YHAA 4BDZA 3PV8A 4JK7A 2QWRA 3DMJA 1HYZA 2Q36A 4CERA 5KPZA 3M6GA 3NH0A 4NLBA 1CXQA 3AAQA 2FBXA 4M3YA 4Z4HA 3BDPA 3SYZA 2Z1IA 1VQ5N 3CCUN 1BGXT 1TYQA 3LDPA 4IJNA 2G8WA 1NG9A 3ULDA 2NRHA 4B9QA 3K5OA 4J8FA 3ZSWA 4KH4A 3I0RA 3EL2A 5KQDA 1C1BA 2YHWA 4DV1K 4OPHA 1D8YA 3HBTA 3U9ZA 4FZYA 1MU2A 1KRPA 1HMVA 4JRPA 4ISGA 3CJ1A 2NLXA 3FZLA 3JYTA 1W7AA 4BG8A 4DF8A 4M7XA 3CCSN 3SMSA 1XWLA 4FJ9A 2IGIA 3P38A 3ZYYX 4FOIA 4FK0A 3M3ZA 1ATRA 1CZAN 3OBWA 4I2PA 2PAVA 3O9UA 2Q31A 3OYBA 3M8RA 5KRSA 4H0PA 1W0HA 3BGRA 1L5UA 1WSIA 4BWJA 3CJCA 1EWQA 1WLJA 2G8HA 1KVCA 3CG7A 1CZ9A 4QAGA 3FFKB 4O5FA 2G8FA 2BTFA 2DY4A 2A1RA 4NXNK 4F3OA 2O4GA 3NMUA 4FJ5A 3SUNA 4IO8A 3VQBA 3O4WA 3J8AA 3OYLA 2PYJA 4IFVA 2UUAK 4GV6A 5AQNA 4JNEA 4KHPK 4J2EA 1KLMA 3C6HA 1SKSA 4PKHA 4OKJA 5CY4A 3RSEA 1U2VA 3IG1A 5GIOA 3HJFA 4IDKA 4O5BA 3QDKA 3VN5A 1MWMA 4CZJA 3O08A 1T44A 2UXBK 4FK4A 4F3TA 1RBSA 1NKBA 1RNHA 3O4NA 2O8BB 1LWEA 4DFKA 4FJ7A 3U9DA 3QIPA 3O9SA 2HW3A 3SQ0A 3THYB 3HTVA 2HHQA 5BPLA 4FCYA 4K8ZA 2FF3B 3QBWA 5I42A 2A6AA 3ID8A 1ZC6A 4AQYK 3D0PA 4RW7A 2Z1GA 3DXKB 5HOOA 3AA4A 3EN9A 4IOXA 1TUUA 1ASWA 2WUSA 3TAPA 3FE1A 1E4FT 1EQYA 2CGLA 4H0OA 1T7PA 4E19A 4BVOA 3WQTA 4HUEA 1U6ZA 1ZBFA 4NCAA 5AQMA 3CFRA 4DR1K 2OZSA 1ZBHA 4JK9A 1KXPA 1IKWA 1YJNN 1W97L 2D0OA 3SV4A 1C0FA 2QWPA 4A5BA 1NLVA 4Z4CA 2VQEK 2YNIA 3KK1A 5JS1A 2EX3A 3G25A 4WFAL 3TPQA 4N5SA 4BC2A 5J1EA 4FLUA 4DQSA 3ZETA 4G1QA 2YV0X 2WONA 3QIOA 1M90O 4KHQA 1N36K 4YORA 2B5JA 4XH5A 3O3FA 3AO1A 4CZKA 4CZMA 1GLEG 4E1MA 2XY7A 2W40A 3H3OB 4CD3A 3MXMA 4CZIA 1OKJA 3NE6A 3OYCA 4I6MB 3KKRA 2WBNA 3V9WA 1SV5A 3L4QA 3K9KA 2QEXN 2IIRA 4KTZA 4WYBA 1QVFM 2ITMA 4FWLA 1D9FA 3LWLA 5AZIB 3PO5A 4FL9A 2JLEA 3M8PA 3WXMB 5C15A 2HHXA 5TKYA 3H6EA 3SCXA 2KFNA 3P39A 4W5NA 3C7NA 3KLEA 2E88A 2DTUA 4OJRA 3HOTA 3J7AP 5T7BA 1BI4A 4FLZA 2F96A 1VQKN 3G10A 1WN7A 5CYMA 3SAGA 4WCEL 1QSSA 5BR9A 1S6QA 5TKWA 3KD5E 3OVNA 1IBLK 3VQEA 4BC4A 4FWQA 4CJUA 1A5WA 4CJ3A 3I8BA 1Q9XA 4BDYA 1X3NA 5J2PA 4AILC 3AVLA 4YFUA 3CIPA 5HBMA 4A57A 3WQUA 1XQSC 4ZTFA 3QMLA 2RN2A 3LP0A 1QZ5A 5BN8A 3HL8A 3IMXA 2NRRA 3CMAN 4ELVA 1YT3A 3AO3A 4B3RK 4CHPA 4XEIA 2RPIA 4CVNE 1NMDA 1N6QA 4CGDA 1FK9A 3CCMN 4V19S 3M8SA 3MN5A 2DFHA 4KH6A 4DSFA 4J2DA 4BE0A 2LSNA 1SQKA 3TTCA 3TAFA 1JCGA 3A5LC 3MN6A 4ICLA 5J2MA 1EXQA 2HBKA 4MQ3A 3WNGA 3WXKA 3WNFA 3KIOA 4FWNA 3TR8A 1EWRA 3ISNC 5SZTA 4MDBA 4LH4A 2QI2A 4DTOA 1EETA 1XUPO 4MO5A 4RW8A 2D0PA 4E7KA 4HCBA 2FBVA 3ZT0A 1FJGK 2P9UA 3MDQA 4DF4A 2E2OA 3AA5X 4IOCL 1V4TA 1U47A 1C1CA 1ZBUA 4N41A 2WFBA 3V9SA 3S41A 3SBGA 3KD1E 1YVNA 4JEPA 3F73A 4DSLA 1TL3A 5M1OA 4R5PA 1J9AA 3VQ9A 5BRHA 1XI1A 3PY8A 3MAQA 3JS6A 3UKRB 1HJRA 3AVAA 3TAEA 2ZM6K 3KLFA 3C6UA 4C8MA 3O3HA 3F2KA 3VA3A 4J2BA 3HK2A 1HLUA 5C10A 3OW2M 4FYDA 4FW2A 3TAGA 3AARA 1KC8O 3JSMA 4BG9A 2O8DA 5FLXO 3AVCA 4H8KA 2ASOA 1GLDG 2HHWA 3BP8A 4FLVA 4KPYA 4CJEA 3CD6N 1TK0A 3NFAA 4AHUA 2ATQA 1DEJA 3J7YP 3FGUA 1RILA 1X9SA 2BANA 1LW2A 3R6MA 4A62A 3P4IA 2HHUA 4OO1J 2OZMA 3H08A 1VSMA 3R9PA 1JLAA 3WEEB 4FZXC 2F7TA 1VQMN 3HSCA 1NK8A 4B9TA 2ZJQL 4B9NA 2IVPA 2E6MA 1WAJA 4JYAK 3L4IA 4H4OA 4FWSA 2NUBA 4WE1A 5H1SQ 2IOCA 4RWTA 2GUPA 5F0XA 4BE1A 3EO3A 3TSPA 3OY9A 2OANA 4GW6A 4W5QA 1BA0A 2CGJA 2QKKA 3TTFA 3NCIA 1EKEA 5KRTA 4DSEA 4GV3A 2ASPA 3QFPA 4ISEA 1RT4A 1TYQB 3CCQN 4BR7A 1GOCA 3SAFA 2GEMA 2UUBK 3SAHA 1Z26A 3PSIA 4KKOA 5C42A 2O4IA 1RGIA 5HRRA 2ZF5O 1ATSA 1RDDA 4ZTJA 4YY3K 5J2NA 1HUXA 3SUPA 3QICA 4HVJA 1ZBIA 1E4GT 2HBLA 2XY6A 2QWOA 1LAWA 1J5EK 3ATVA 2D5RA 4H5RA 4M42A 1JKHA 3RMCA 2YHBA 4HCCA 1TUYA 2QTDA 3T3FA 2A3ZA 5EVZA 1REVA 1HQEA 3V9UA 3K2PA 5AQPA 2AA4A 4CIGA 4LF9K 2YJEA 5B8HA 1RT1A 1RTJA 3T7ZA 4KI6A 2ZWHA 3V9ZA 3QETA 4DR5K 1T6DA 2CH6A 1WBDA 4YOVA 3I33A 3QEWA 3E66A 2X78A 3MEDA 4H0TB 3NF8A 4CEEA 3IS9A 4CECA 3VQDA 4WFBL 2VGNA 1DTQA 3HPOA 2E6LA 1OH6A 1V4SA 5M1KA 1DLOA 1D4XA 1GLFO 5E26A 2FF6A 3OYDA 1LV5A 2HF4A 3OYEA 4YHHK 1RTHA 3L3UA 2VQFK 4BRDA 3RSEB 5E84A 3VESA 4CJRA 1T03A 1JXEA 1T3VA 3EYZA 3U6FA 4FJGA 3DXMA 4JI0K 1K6YA 3LAMA 2JGUA 3H45C 1S5JA 1NGHA 5JVGL 4H5TA 3SQ1A 2BH1A 4ID5A 1MA9B 3SQ2A 2VG5A 5DM6L 3CPWM 1YJWN 4O55A 3QO9A 3FZFA 3I55N 1A5VA 2E2PA 4FVMA 2QK9A 4FJ8A 1IKVA 4WQ4A 5GIPA 4O0IA 4CZHA 5BR8K 4IBNA 4PWDA 1QHTA 3ZX0A 4H5NA 3WNHA 4MDAA 1NJXA 1ASVA 1HPZA 3AVIA 2GELA 2HHHK 2F9WA 4ILGB 3UKUA 4AHVA 4DFPA 3SUOA 1R0AA 3VGKA 3IDHA 3PUFA 4FWPA 3K5NA 4BRQA 4H0XB 4F2RA 2GTDA 4FM0A 2NRWA 1DT9A 3H1VX 4JI1K 3ZETB 1NWKA 1WUAA 3MK6A 2WC9A 3LM9A 2OPQA 3E9LA 1KQSM 3CCRN 5HL7L 3G0ZA 4LC9B 3RWUA 2HNYA 2OCEA 3MN7A 1YAGA 1SUQA 4EAHD 1ZBLA 5GADP 4CBXA 2IDOA 1TK5A 4HTLA 3VF2A 4YDUC 4CGFA 4X62K 1BL3A 2QWMA 3LDSA 1HKCA 3C0BA 2KTQA 3OTOK 1HNWK 4IDHA 1NOYA 1BO5O 3SBTA 3NGYA 3R3LA 4BR0A 3D2FA 1W2BM 5AQRA 3CQ8A 2EHGA 2PZSA 1KAZA 2I7NA 3KWGA 4KHUA 5GAEP 1VSHA 3TAQA 3THWA 1RDBA 1S6PA 3C7NB 4MLEA 5EX5A 4JS5A 4BACA 4RCHA 4A5AA 3HP6A 5C2DA 3MEEA 3TARA 3QNNA 3OS2A 2HHSA 2UYTA 4KREA 3CI5A 3V81A 2G8KA 4QS7A 1OVYA 3LP2A 2HSTA 1XHXA 3ID6A 5ELZA 3HM9A 2AJQA 1S1WA 5AZJB 1JLQA 4FSVA 1O13A 3HVTA 2IS3A 1J6ZA 1X3MA 4CGJA 4CEOA 2YJFA 4Z4FA 2O8CA 1RT7A 2YKNA 3VGLA 2YHXA 2ZQBA 1VAZA 2NRXA 3SPYA 3ZSRA 1RBVA 4DU1A 2VYPA 4ILHA 4H5VA 3QBXA 1WOQA 4CZGA 1NKEA 4DB3A 4DV2K 1OH8A 4B1UB 3C6TA 1TKZA 2OTJN 3SJHA 5AQIA 3CC7N 2GWKA 1SL0A 4NCGA 3RMBA 1IBMK 3DAWA 1SL2A 4GNIA 4Z0UA 5DM7L 1JLEA 1T6CA 4AHTA 1NU0A 4QS8A 1VSIA 2P9UB 4BC5A 1IG9A 3GOIA 1JLBA 3KTQA 3DJCA 4JKCA 1RT2A 2XRIA 2YCHA 3VEYA 1NJWA 4LF5K 1WSEA 5AQVA 3H3NO 4YOWA 4E7HA 3VEXA 3F9KA 4DTJA 1NK6A 3SNNA 2IVNA 1YIJN 3O1BA 4I2QA 4DV7K 1U49A 2F4VK 1J53A 3MCAB 2D0BA 1FKOA 5LMUK 4PUOA 4RG8A 3HM8A 1LAVA 4JHDA 4HTUA 4OPJA 5LMNK 2E5LK 4OLAA 2E1ZA 4BR2A 5FDLA 4IJAA 5BREA 3VOVA 1S9EA 1TKXA 3VQ7A 1LOTB 4CJSA 2O8DB 4FJJA 5IT9O 2HHVA 2RE2A 1VSJA 4EIAA 3E01A 3KVGA 5IWAK 2YKMA 1IJJA 4CJKA 4GVMA 3V1RA 4E7IA 1DKGD 3O4QA 2O8FB 4C23A 4KO0A 4F4KA 3T69A 3SUQA 3KLHA 4RW4A 2IVOA 5M1PA 2P51A 4CFCA 4JAXA 3WXIA 3G4SN 3RR7A 4BDPA 2BGGA 1IBKK 4CJTA 3O9TA 1KFDA 3BZKA 3OYAA 4KRFA 2QA4N 1XMOK 4CF2A 5AQFA 3C6AA 2E2QA 4IEIA 4E1NA 3VERA 5FRMA 4K41A 2DFFA 4CGIA 3L2WA 5BN9A 1P8ZA 1TV6A 5AQUA 4JS4A 4DV0K 3CPEA 2W42A 3ALYA 4BRIA 4BRNA 4JI5K 4DQPA 4Z4EA 1XC3A 4AF1A 4CFDA 1BIUA 1ZBSA 1TK8A 2HF3A 3LPUA 5AQOA 3K57A 3I56N 5AFUA 1NK7A 1BIZA 2D4WA 3BF1A 2GUIA 1YXQA 2P9LB 3U4LA 3NVMA 3LP1A 4H5WA 1FKPA 4CW7B 4IZ9A 3AO4A 4CFAA 1GOBA 4FJKA 2P9KA 3THVA 1VSLA 4JI3K 3E9PA 4LSLA 3DLBA 1X9JA 3TU5A 5AJ3K 5HLFA 4YNQA 4BE2A 4CHYA 2NRTA 4FLXA 3MXIA 4PL8A 3MCPA 3GBTA 3K0SA 1NOZA 1K9MO 5EXWA 4OX9K 3AVNA 3CJ9A 3DLLL 4BGAA 4PKGA 3D6RA 1K8AO 5ADXA 4DR3K 1YTUA 2P9IB 1HNZK 1JLFA 3VQ4A 2G8IA 4IG3A 2ASMA 2FXUA 3NGIA 4FLTA 2Q0UA 1HYSA 1I3AA 1BU6O 3MXJA 4NXMK 4I9QA 2HMIA 3DOKA 3HI0A 3CM6A 3HT3A 1LWCA 4CBWA 2GBZA 1RFQA 3NVKA 3VEZA 4E7JA 4YOUA 4DCHA 4DV3K 3MWPA 5DMRA 3CMEN 3CCEN 1TKDA 4FM2A 5AQKA 1NGCA 3VQ8A 3L8BA 4FWOA 5AQYA 3B6OA 5BRDA 3K9JA 1S1TA 3VENA 4DWIA 4M3XA 1CZBA 1C0TA 1HRHA 4K8XA 5HRPA 2BUPA 1U48A 4Z94A 3FZKA 3W0LA 4B9MA 4DFMA 3WXLA 4C8OA 3KHYA 4FJMA 1VSDA 3KWIA 3HVRA 1NGEA 3QFUA 1QQOA 3O3GA 4CBUA 3CHWA 4DU3A 3CQYA 1G15A 2B4JA 4B1WB 4O44A 3L2RA 1IKYA 2GX9A 3VQCA 1HKGA 2W6KA 2D1KA 1IG8A 4BRKA 4JLHA 1NKCA 4JD2A 4BREA 1J54A 1YHQN 5BPMA 1SKRA 1P90A 1Z05A 1KFSA 4Y1CA 3BF3A 1BCMA 5LJWA 2ITGA 1BISA 3ZT1A 4IOAL 2P5OA 2Q1NA 3S3MA 1JLCA 2RF2A 3UKUB 4N56A 3BEXA 3AVGA 3CJBA 3IUCA 3RMDA 2Z1HA 3PX4A 2KHOA 3EZWA 3NH1A 4Y1DA 1VRUA 5LL6Z 1WSGA 4XIUA 3DYAA 4B9UA 2QXLA 2V7YA 5KPTA 1RDCA 3P1GA 3LM2A 2PFUA 1UA1A 3THXB 5AQGA 4FWKA 4WFNL 4DS5A 4MFBA 3ZX2A 4LF7K 4XH4A 5HROA 4GKKK 3LDNA 4KHYA 2F9TA 4BRAA 1G99A 3TSUA 1KLNA 1NGAA 1UWBA 2X6NA 4OGCA 4KB0A 3DXKA 4FPAA 1TAQA 3EZ5A 2ZGZA 4DHYA 1Y64A 1SZ2A 1KSPA 1WNSA 1S72N 3D2FB 4QS9A 5EOYA 4AH9A 3RMAA 3KK2A 2VG6A 5A2QO 1ILYA 1ITGA 5E41A 3LDQA 3AGRA 3AY9A 1NGIA 3K59A 3S3OA 1Z6RA 2YI1A 3THWB 1YTAA 2XY5A 4I9LA 1JCEA 2XY8A 4M3ZA 5EY4A 5HRSA 4BVPA 5CHIA 3ZCMA 4IKFA 2FSNA 3HP9A 4C8LA 5KGWA 4JKAA 3PX0A 1NNEA 3O8MA 4KI4A 3QNOA 1NK9A 4C1NK 1GOAA 1RT5A 1NJIO 5JLFA 4R79A 2P1JA 4M3UA 3MN9A 1UA0A 4JI2K 3ZSQA 2ZGYA 5BRFA 2O8CB 2FSJA 4KHWA 4CF8A 1VQ8N 3WT0A 4DTNA 3VA0A 1HPMA 2P9PA 2RKIA 1D5AA 5CE3A 3T1YK 1VK0A 4CJVA 1VQ4N 4CEAA 2QWNA 3R8EA 3U8XA 3PIPL 4B3TK 5F2RA 5LY3A 4W5OA 5GINA 4RW9A 3ZT3A 2JWLA 1LWFA 4JRQA 3WNEA 4FJXA 3K5MA 3MMVA 2XO7A 3UIQA 3FLCO 3CC4N 3O6WA 2OYQA 2A1SA 2KKZA 4EZ9A 4DMNA 1RT3A 2QXFA 2NZTA 4KHNA 3HO1A 4CFBA 1KAYA 3AV9A 4F9OA 4FK2A 2P9NA 3OYHA 1L3TA 1BCOA 1BOTO 2UU9K 5C12A 1JJ2M 3VQAA 2QWLA 1N33K 4DR4K 1D9DA 3MECA 2QKBA 2YNFA 3AGKA 3ENBA 1C1AA 4YOYA 3DLRA 1U2VB 1DGKN 1TVRA 2DFEA 2ZD1A 3LAKA 5D3GA 3PSFA 2XHBA 3O5BA 4JKGA 5M1QA 2PBDA 4BRPA 1VQON 3NF9A 4ZHRA 2WTUA 4CIFA 3V6DA 3DRRA 3QINA 3M1FA 1SKWA 1TGOA 4FJLA 1C0MA 3NF6A 1TKTA 4CK1A 1NGJA 4FLWA 1S1UA 4KBOA 3H46O 5AQHA 5AR0A 4AHCA 2F8TA 2KW4A 4CCHA 3L2QA 2VGMA 1N32K 4TSXA 3QESA 3KLIA 3M8QA 3G6EN 3KJVA 3HZ6A 4BY9C 2CGKA 3S3NA 4H0YB 1QE1A 3OS0A 3IFRA 4B8CA 3NGZA 4M3RA 3MX2A 1JLGA 4N76A 4GVEA 2Q3SA 4DTUA 3KLGA 4JKBA 2KZZA 3HPHA 2BE2A 4IWVA 3UKRA 5FPEA 3QEVA 1N8RO 4KTQA 5CYQA 4BR4A 1B9DA 1QSYA 4OPKA 1QTMA 2D0CA 4X64K 3KK3A 3ZX3A 3EE8A 3EY1A 4FWMA 1H1VA 1HQUA 4DSIA 2ZE2A 4BGBA 4CJPA 4DKWA 2O8EA 4K43A 3ENOA 1X1PA 4Z4GA 1QZ6A 3ZSXA 5JMVA 2PYLA 4WQ5C 3RR8A 3AVKA 3EKUA 2YX6A 1Q82O 4FXDA 4HHTA 5M1NA 3P83D 4I7FA 1ASUA 3H1QA 4PL7A 1Q8IA 2R7YA 2HVHA 2Y1IA 1N5YA 4EHUA 3DLEA 3CJ7A 2KFZA 2OPPA 4DSKA 3TSQA 2IAJA 1EX4A 4O8UA 4DTPA 1U45A 4BC3A 4CD1A 1E3MA 4IG0A 2VWKA 4X65K 4B9VA 2VWBA 2HB5A 1YI2N 4BR9A 3CFPA 5M1FA 4DLGA 4Q5VA 3EEQA 4CEDA 1M1KO 4EP5A 5EU7A 4IXCA 1BI4B 4KAZA 1SL1A 5AQSA 1QQNA 4LF8K 4OKKA 4C8KA 4NLCA 4W5RA 5SWMA 5FROA 4CZEA 3GL1A 5AQTA 2FBYA 5FPNA 2KLAA 4IO9L 1Q86O 2A40A 3CM5A 1VHXA 1RBUA 3BZCA 3SMPA 3ZSVA 1RBTA 2A41A 4FW1A 3I8DA 3CF5L 1OH5A 4FZZA 2GWJA 1K8KA 4DU4A 3N4PA 4LF4K 4PQUA 3DLGA 3VMFB 5C25A 2CH5A 1B9FA 1J5OA 5AQZA 3TAMA 3RVCA 4E89A 2E8AA 3VTHA 3ZEUA 3RTVA 4CF1A 1BUPA 3T1AA 1MWKA 1NJYA 1T05A 4DFJA 3CYMA 5AQXA 3FZMA 4IFEA 1ESVA 4IEEA 4N47A 1WB9A 3LWMA 1ZXOA 4CF0A 4CK2A 3KZBA 2WOMA 4O0JA 4B1ZA 3CCLN 4GKJK 4KFBA 2PY5A 4CEFA 2E1YA 1JL1A 1IKXA 3AA2A 4EHTA 2UXCK 2BDPA 4M45A 3L2VA 2B6AA 3M5RA 4AM7A 1KTQA 4A2BA 4IFYA 4C1NI 4CJFA 1VQ7N 4UY8O 2V7ZA 3SQ4A 1LW0A 3DRPA 4PHTX 3C65A 3LALA 1GLBG 3D45A 4CJ7A 4LFAK 5KGXA 3P31A 1BQNA 4JD2B 4E1JA 4PY5A 3QEIA 1YF5L 3ULEA 4DSJA 1KAXA 3A5OC 5J2QA 3FFIA 1QSLA 5C2FA 2J4RA 4K42A 3VETA 1Q7YO 3OYGA 3O1WA 2OTLN 1CXUA 4QOZB 3CFOA 5HRNA 2OPRA 3PIOL 3DLKA 3LZIA 4JI7K 3D2EA 3HRGA 2ETJA 4K25A 4OGEA 2AP1A 3ZLJA 4YOTA 2P5GA 3LL3A 4DUYK 2P9SA 2HMPA 2NRZA 2HNZA 2KQ2A 3AA3A 4H03B 2VCPA 3CERA 4OLBA 4WQ4C 5I3UA 1TAUA 2FC0A 3CC2N 3ZSZA 3S9HA 4RTFD 1OH7A 1VQPN 3A5NC 3N4QA 4KV8A 4HWIA 1HNIA 3IRXA 1I94K 3R1XA 5AFUH 1BG3A 5DK5A 3DM2A 3HPGA 1FW6A 4B08A 4CHOA 1IV0A 3D7EO 3KKSA 1VQ6N 3GG4A 3V9XA 1NJZA 3DRSA 3OS1A 3QEXA 3JXUA 3U3YA 2W6LA 4JKFA 4CHZA 3E9OA 4QCLA 4O4GA 1T8EA 4EFHA 2G8VA 3RRHA 4CGHA 4FJIA 1WSFA 4JI4K 4DS4A 5KQ8A 2Q0RA 1NK4A 1NGDA 3LZJA 5ADXH 1RT6A 3CETA 2GV9A 4BWMA 3VGMA 3VQPA 1NK0A 4B3SK 4FO0A 1HR0K 4DTSA 1BQMA 1UAXA 3SJJA 2NNWA 1XNQK 1EP4A 5GAHP 3VQ6A 2P9PB 4CI6A 3WXJA 1RDUA 4BRGA 4PKIA 1HKBA 3CCJN 1GLCG 5FPMA 3J7ZO 1GLAG 1JL2A 4B3OA 3VEOA 2V52B 1FXXA 5AQLA 4NCBA 3OYNA 1WSJA 5AQQA 3BUZB 5KI6A 1XMQK 1WAFA 4GMJB 3SLCA 4JKHA 3AVMA 3F9MA 1KD1O 4B1XB 4A59A 1QHAA 2KZMA 2Q2RA 4CE9A 1MDUB 3A5MC 4LFBK 3JAMO 3TI0A 1C0GA 4U7BA 3TTDA 4M63C 4B8AB 1HX1A 5I9EB 2P9NB 5AZJA 1U4BA 2G8UA 1X9WA 4LH5A 1QS4A 3DI6A 4NYFA 3OA9A 4CJLA 1L3SA 2E4LA 4M7YA 4M3TA 4AHRA 4NO7A 3A0IX 4XH1A 3FZHA 2I7PA 5GAGP 1Q18A 1SS6A 4EP4A 1HJOA 1HNVA 4F8RA 3AO2A 1CLQA 3GDQA 3AVJA 4DV4K 4JKGB 1X9MA 4JKEA 3DXMB 3OBYA 1Q81O 2NRVA 4ELUA 2IC3A 3J81O 3PO4A 1S9GA 4FWRA 2HOEA 4BRFA 3OYJA 4BRHA 1KVAA 3A8YA 2ZJPL 1C0UA 3CXCM 4GV9A 4F2SA 4KTWA 1RTDA 4DTMA 3I0SA 4G9ZA 4L3QA 1VQNN 4FM1A 4DR7K 4BROA 5JICA 3AVFA 3FR0A 3SI6A 3ZT2A 3VQQA 4Q0BA 1Z25A 4CIEA 3J80O 1Q9YA 3AAPA 1K73O 4H4MA 5HP1A 4DUZK 1NBWA 4RW6A 4LSNA 4H0VB 4CESA 3ENHA 4CGGA 4M3WA 1RDAA 1JCFA 3KK7A 3IAYA 4C8NA 1B92A 5JVHL 4B9SA 3VPZA 3GE1A 2Q97A 4K0KK 3P5JA 4JKDA 2O8BA 2V51B 3QEPA 1XHZA 4HUFA 5KTQA 4PA1A 2X74A 4DTXA 1TL1A 3L3VA 4CHQA 4BR5A 4FLYA 4NYNA 1RDWX 2Y1JA 4CZLA 2O8EB 4BRMA 3THYA 3UE5A 1KVBA 1O1WA 5MLCQ 1YITN 2RHKA 2VG7A 4B9LA 3OYIA 4DR2K 1VSKA 2ZJRL 2VWJA 2O8FA 4AHSA 3ITHA 4JK8A 3C94A 3NF7A 4JI8K 1L3UA 3LPTA 2F8SA 1NM1A 4MLHA 2YNHA 1DTTA 4DTRA 4WQ5A 1ATNA 4LD0A 3V1QA 3OYFA 4YDUA 3NAEA 4HUGA 4A61A 1GLLO 1BHLA 1I39A 3HXMA 4MO4A 3NHGA 4JN4A 3DWLA 3PX6A 2QW9A 3O9RA 4Y0WA 3ZSOA 3OHRA 4ISFA 3UB5A 3OJSA 4O8KA 4X66K 2UXDK 4Z4IA 3B6PA 1NMNA 3EE9A 3TABA 4FJNA 1QQMA 3MWTA 2HBJA 4CHNA 4LY7A 3ATUA 3ASMA 4CJWA 3WUHA 1HNXK 5AQWA 4UQGA 1K8KB 3W3DA 3V1OA 2FSKA 2HNDA 2FBTA 3K58A 4E3SA 4CJ5A 3G71N 1S1XA 3T19A 2DPNA 4I6MA 2P9LA 3ZEUB 1BWFO 4CEBA 3QLHA 4L8RB 4LF6K 4YOXA 3LDLA 3O9QA 2FLOA 1VSEA 1F21A 2HBMA 5AZIA 2YNGA 3SPZA 4A2AA 4DG1A 4DQQA 3VQ5A 3Q7CA 4NB4A 1L3VA 1N34K 5K14A 4ILJA 4J2AA 3F5TA 3HYFA 3ZT4A 3B8AX 4KHSA 1UOCA 1VQLN 4E7LA 1BA1A 1OVQA 1NGBA 1LCUA 1YUWA 4OVLA 5JS2A 4DQIA 5FRNA 4CF9A 5C0YA 4CJ4A 2P9IA 4OPAA 3AO5A 5CZ2A 3OJUA 4KB1A 5FPDA 1XC9A 1EO1A 5AQJA 3VEWA 1Y97A 2EWSA 4DLEA 4CZFA 4AM6A 3VF4A 1WSHA 3L2UA 4M41A 1QVGM 2HVIA 1BDGA 3NDKA 1YVUA 1S1VA 5BPNA 5KPRA 4LFCK 4ID1A 3AVBA 3AVHA 3BY5A 2HHTA 2W41A 4DV6K 2UUCK 5JLHA 1QQCA 4BQLA 5CR4A 3VTIA 3QERA 3L6QA 3Q7BA 4JHDB 4BRLA 2OPSA 2D0AA 1A5XA 3MEGA 3ULEB 1NGFA 3VF6A 2H3GX 3U3GA 4B3MK 3L0QA 3VEVA 4GY2B 4OKEA 1U04A 3CCVN 3T1HK 3C95A 2E20A 4KH5A 1RBRA 3PLAA 4JV5K 2A42A 4JI6K 1RTIA 4BRCA 3HSTB 5F1XA 4DQ8A 3TANA 4W5TA 3D2EB 1GLJO 1VQ9N 2P9SB 2QM1A 1ZYQA 3RRGA 3V4IA 4DR6K 3EKSA 1IH7A 1RCHA 4CJQA 1WBBA 3A2FA 2A5XA 1SAZA 4BQZA 3O80A 4B1VA 3TWHA 4E0DA 4U67L 4DQRA 1HYVA 3SK3A 3QB0A 3NBPA 3NH2A 4EZ6A 3ZSYA 4DV5K 1YJ9N 3LANA 2E2NA 1XNRK 3CJAA 1W9HA
chains in the Genus database with same CATH topology
3MXJA 1KCFA 1BQNA 1Z26A 4KKOA 4PY5A 3QEIA 5C24A 3K5LA 2X6SA 2HMIA 5C42A 4I9QA 3DOKA 3SZ2A 3CM6A 3HT3A 2O4IA 1LWCA 5HRRA 2GBZA 3LP3A 4CK3A 4DSJA 5J2QA 3FFIA 1QSLA 4E7JA 1RDDA 2I5JA 2OA8A 4ZTJA 3OYGA 3OYKA 5J2NA 1CXUA 5DMRA 3SUPA 4QOZB 1JXBA 3CFOA 3DOLA 2OPRA 4HVJA 5HRNA 3SV3A 1TKDA 1ZBIA 4ELTA 4FM2A 2XY6A 1LAWA 3DLKA 4FJHA 4CEQA 2Z1JA 3LZIA 3VQ8A 3L8BA 2D5RA 4M42A 1JKHA 3B6OA 1VSFA 3RMCA 2ETJA 2YHBA 4OGEA 4HCCA 5CZ1A 2P5GA 1IO2A 1S1TA 3T3FA 4DWIA 4M3XA 1CZBA 1C0TA 4CEZA 1VRTA 2HNZA 2KQ2A 1HRHA 4K8XA 3AA3A 1C6VA 1REVA 5HRPA 5I3UA 1HQEA 3OYMA 1U48A 3DLHA 4OLBA 2FC0A 1TAUA 4B9MA 1NK5A 4DFMA 3V9UA 4C8OA 4FJMA 3K2PA 2YHAA 4BDZA 3ZSZA 3PV8A 1VSDA 3S9HA 3HVRA 3DMJA 4CIGA 1HYZA 4CERA 4KV8A 3NH0A 1HNIA 3O3GA 1CXQA 1RT1A 1RTJA 2FBXA 4M3YA 3IRXA 4Z4HA 4DU3A 3BDPA 1G15A 4KI6A 3SYZA 2Z1IA 5DK5A 2B4JA 4O44A 3L2RA 1IKYA 3V9ZA 3QETA 1BGXT 3DM2A 3VQCA 3HPGA 4JLHA 2G8WA 4B08A 3ULDA 4CHOA 1NKCA 3KKSA 3K5OA 3V9XA 1J54A 3QEWA 1NJZA 2X78A 3DRSA 3MEDA 1SKRA 3ZSWA 3NF8A 4Y1CA 3OS1A 1KFSA 4CEEA 3IS9A 1BCMA 4CECA 3VQDA 3QEXA 3U3YA 3I0RA 1DTQA 2ITGA 1BISA 3ZT1A 4CHZA 4QCLA 3HPOA 2P5OA 3S3MA 4O4GA 2E6LA 1JLCA 1T8EA 2RF2A 4N56A 2G8VA 3RRHA 4CGHA 1C1BA 3AVGA 4FJIA 1WSFA 4DS4A 1D8YA 3RMDA 1NK4A 2Z1HA 1DLOA 3PX4A 3NH1A 3LZJA 4Y1DA 1VRUA 3OYDA 3OYEA 1LV5A 4FZYA 1MU2A 1KRPA 1HMVA 1WSGA 4XIUA 1RT6A 1RTHA 3DYAA 3L3UA 4JRPA 4B9UA 2GV9A 4BWMA 3VQPA 3JYTA 1RDCA 3P1GA 1NK0A 1UA1A 4CJRA 1T03A 4DF8A 1JXEA 3EYZA 4DS5A 3U6FA 1XWLA 4MFBA 2IGIA 4FJ9A 4FJGA 4DTSA 4FXDA 1BQMA 1K6YA 3LAMA 4FK0A 2JGUA 1UAXA 3SJJA 5HROA 1S5JA 1EP4A 4I2PA 3VQ6A 4KHYA 3SQ1A 3OYBA 4ID5A 3M8RA 1KLNA 1UWBA 2X6NA 4OGCA 3SQ2A 2VG5A 5KRSA 1W0HA 3BGRA 4O55A 1L5UA 1WSIA 4BWJA 3QO9A 4KB0A 1JL2A 4B3OA 1A5VA 1TAQA 1WLJA 3EZ5A 2G8HA 1FXXA 4NCBA 1KVCA 4FVMA 2QK9A 1KSPA 3OYNA 1WSJA 1WNSA 3CG7A 1CZ9A 4AH9A 3RMAA 1IKVA 4QAGA 5KI6A 3KK2A 4FJ8A 4O0IA 2VG6A 2G8FA 1ITGA 5E41A 1WAFA 4GMJB 3K59A 3S3OA 4IBNA 4PWDA 1QHTA 3AVMA 2DY4A 1YTAA 2XY5A 2A1RA 4I9LA 4F3OA 3WNHA 2O4GA 2XY8A 4M3ZA 4FJ5A 5HRSA 3SUNA 1NJXA 1ASVA 1HPZA 3AVIA 3VQBA 3ZCMA 2KZMA 4AHVA 4DFPA 4IKFA 3HP9A 4CE9A 3OYLA 3SUOA 1R0AA 2PYJA 4C8LA 3TI0A 5KGWA 4B8AB 4IFVA 3PX0A 1U4BA 2G8UA 1X9WA 4LH5A 4KI4A 3QNOA 4J2EA 1KLMA 1QS4A 3PUFA 3K5NA 3DI6A 4NYFA 1NK9A 1SKSA 4CJLA 1L3SA 1GOAA 4OKJA 2E4LA 5CY4A 1RT5A 4AHRA 4FM0A 4F2RA 4M3TA 3IG1A 2P1JA 4M3UA 1UA0A 3HJFA 4IDKA 4O5BA 3VN5A 4EP4A 3ZSQA 1HNVA 4FK4A 4F3TA 1RBSA 1NKBA 1RNHA 4F8RA 3O4NA 3AO2A 1LWEA 2OPQA 4KHWA 1CLQA 3AVJA 4CF8A 3G0ZA 3RWUA 1X9MA 2HNYA 4DFKA 4DTNA 3VA0A 2RKIA 1SUQA 1D5AA 1ZBLA 4FJ7A 3QIPA 4ELUA 1VK0A 2IC3A 2IDOA 3PO4A 1TK5A 4CJVA 2HW3A 4CGFA 1S9GA 4CEAA 3SQ0A 2HHQA 1BL3A 3LDSA 3OYJA 4W5OA 4FCYA 4K8ZA 2KTQA 1KVAA 4RW9A 5I42A 3ZT3A 3D0PA 1NOYA 1C0UA 4RW7A 2Z1GA 3NGYA 3AA4A 1LWFA 4KTWA 4JRQA 4F2SA 3WNEA 4FJXA 3CQ8A 1ASWA 2EHGA 3K5MA 4DTMA 1RTDA 2PZSA 2XO7A 3UIQA 3TAPA 4KHUA 3I0SA 1VSHA 3TAQA 1T7PA 1RDBA 4E19A 1S6PA 2OYQA 4FM1A 2A1SA 4HUEA 4JS5A 4BACA 1ZBFA 4NCAA 4EZ9A 3CFRA 4DMNA 2OZSA 3AVFA 1ZBHA 1RT3A 2QXFA 3SI6A 3ZT2A 3HP6A 3VQQA 4Q0BA 4KHNA 3MEEA 1IKWA 1Z25A 4CFBA 4CIEA 1Q9YA 3HO1A 3TARA 3QNNA 3SV4A 3AV9A 4H4MA 3OS2A 2HHSA 5HP1A 4FK2A 3OYHA 4Z4CA 1L3TA 3V81A 2G8KA 1BCOA 4KREA 2YNIA 3LP2A 4RW6A 4LSNA 3KK1A 5JS1A 2EX3A 1XHXA 4N5SA 3VQAA 3HM9A 4CESA 2AJQA 1S1WA 5J1EA 1D9DA 3MECA 1JLQA 4CGGA 2QKBA 3HVTA 2YNFA 4FLUA 2IS3A 4CGJA 4M3WA 1RDAA 4DQSA 3IAYA 4C8NA 1C1AA 4CEOA 1B92A 4B9SA 4G1QA 4Z4FA 2YV0X 3DLRA 2WONA 1RT7A 1TVRA 2DFEA 2YKNA 2ZD1A 3LAKA 3P5JA 3QIOA 2XHBA 2ZQBA 3QEPA 5D3GA 1XHZA 4KHQA 4HUFA 2B5JA 3O3FA 5KTQA 3SPYA 3AO1A 4PA1A 2X74A 3ZSRA 3NF9A 4E1MA 4ZHRA 1TL1A 4DTXA 4CIFA 2XY7A 3L3VA 4CHQA 3V6DA 3MXMA 3DRRA 4NYNA 3QINA 1RBVA 4FLYA 2Y1JA 4DU1A 1SKWA 1TGOA 3NE6A 4FJLA 1C0MA 1KVBA 3NF6A 3OYCA 3KKRA 1NKEA 1O1WA 1TKTA 1SV5A 4CK1A 4FLWA 3V9WA 1S1UA 2VG7A 4B9LA 3OYIA 3C6TA 1TKZA 4KTZA 1VSKA 2VWJA 4AHSA 3ITHA 1SL0A 1D9FA 4AHCA 3LWLA 4NCGA 3PO5A 3RMBA 3C94A 2JLEA 3NF7A 2F8TA 2KW4A 4CCHA 3M8PA 3L2QA 1L3UA 3LPTA 2F8SA 2HHXA 3SCXA 4TSXA 2YNHA 3QESA 3KLIA 1SL2A 4Z0UA 2KFNA 3M8QA 1DTTA 1JLEA 4DTRA 4W5NA 3KLEA 3KJVA 2DTUA 4AHTA 4OJRA 4LD0A 3V1QA 3OYFA 3NAEA 1VSIA 5T7BA 1BI4A 4HUGA 3S3NA 1IG9A 4FLZA 1QE1A 3OS0A 2F96A 1BHLA 1JLBA 3G10A 1I39A 1WN7A 5CYMA 3HXMA 3KTQA 1RT2A 2XRIA 1QSSA 1NJWA 3KD5E 1S6QA 4B8CA 3NHGA 3OVNA 1WSEA 3VQEA 3NGZA 4M3RA 4CJUA 1A5WA 1JLGA 4E7HA 4CJ3A 3PX6A 4N76A 1Q9XA 2Q3SA 4BDYA 4DTUA 3F9KA 3KLGA 4DTJA 5J2PA 1NK6A 2KZZA 3ZSOA 4AILC 3SNNA 3HPHA 3AVLA 3OJSA 2BE2A 3QEVA 4YFUA 4I2QA 5HBMA 4ZTFA 4KTQA 1U49A 5CYQA 1J53A 4Z4IA 1B9DA 2RN2A 3LP0A 4OPKA 2D0BA 3B6PA 3HL8A 1FKOA 1QSYA 1QTMA 2D0CA 4PUOA 4RG8A 3TABA 4FJNA 3KK3A 4CHNA 1LAVA 4HTUA 4LY7A 4CJWA 3ASMA 3EY1A 4OPJA 1YT3A 4ELVA 1HQUA 3AO3A 4CHPA 4OLAA 2RPIA 4DSIA 2ZE2A 4UQGA 5FDLA 3V1OA 2HNDA 2FBTA 4CJPA 3K58A 4E3SA 1N6QA 4CGDA 1FK9A 3VQ7A 1S9EA 1TKXA 4CJ5A 1X1PA 4CJSA 1S1XA 4Z4GA 3ZSXA 2PYLA 3T19A 3RR8A 4FJJA 3AVKA 3M8SA 2HHVA 2DFHA 4CEBA 1VSJA 4HHTA 3QLHA 4DSFA 4J2DA 4L8RB 3E01A 3P83D 2LSNA 1ASUA 4I7FA 2R7YA 1Q8IA 4BE0A 2HVHA 2YKMA 2Y1IA 1N5YA 3DLEA 4CJKA 4GVMA 3V1RA 3TAFA 1VSEA 2KFZA 1F21A 4ICLA 2OPPA 5J2MA 1EXQA 4DSKA 2YNGA 4MQ3A 2IAJA 3WNGA 1EX4A 4E7IA 4DTPA 1U45A 3SPZA 3WNFA 3KIOA 4DG1A 4DQQA 3O4QA 3TR8A 3ISNC 3VQ5A 1L3VA 5SZTA 4IG0A 5K14A 4LH4A 2VWKA 4B9VA 4KO0A 2HB5A 4DTOA 4F4KA 4J2AA 1EETA 3HYFA 4RW8A 3CFPA 4E7KA 3SUQA 3KLHA 2FBVA 4RW4A 3ZT4A 3ZT0A 4DLGA 4HCBA 4KHSA 2P51A 4CFCA 4DF4A 1UOCA 4BDPA 3AA5X 4Q5VA 4E7LA 3RR7A 4CEDA 1U47A 2BGGA 4CJTA 1C1CA 4EP5A 5EU7A 1ZBUA 1KFDA 1BI4B 4OVLA 5JS2A 3OYAA 4KAZA 4N41A 4DQIA 5FRNA 3V9SA 1SL1A 4KRFA 4CF9A 4CJ4A 4OKKA 3AO5A 4C8KA 3KD1E 5CZ2A 3F73A 4CF2A 3OJUA 4KB1A 4W5RA 4DSLA 1XC9A 1TL3A 5SWMA 5FROA 1Y97A 4DLEA 4R5PA 4E1NA 1J9AA 2FBYA 3VQ9A 1WSHA 3L2UA 4M41A 5FRMA 1XI1A 4CGIA 2DFFA 3L2WA 2HVIA 3PY8A 3MAQA 3NDKA 1YVUA 1HJRA 1TV6A 3CM5A 4JS4A 3AVAA 3TAEA 1S1VA 2W42A 3KLFA 3C6UA 4ID1A 3AVBA 3AVHA 2HHTA 3ALYA 4C8MA 1RBUA 3ZSVA 1QQCA 1RBTA 3O3HA 4FW1A 3I8DA 3VA3A 3QERA 4DQPA 4J2BA 4FZZA 4DU4A 4Z4EA 2OPSA 4CFDA 2D0AA 1A5XA 1BIUA 3MEGA 3HK2A 4FW2A 3TAGA 4FYDA 4PQUA 3DLGA 3JSMA 5C25A 3U3GA 1J5OA 1B9FA 1TK8A 3TAMA 3AVCA 3LPUA 4E89A 3K57A 4H8KA 1NK7A 2HHWA 3RTVA 1BIZA 4CF1A 4OKEA 4FLVA 4KPYA 1U04A 4CJEA 3T1AA 3C95A 1TK0A 2GUIA 3NFAA 4AHUA 1NJYA 1T05A 4DFJA 2ATQA 1RBRA 1RILA 1RTIA 3LP1A 3HSTB 3CYMA 1X9SA 2BANA 1LW2A 1FKPA 2HHUA 3TANA 3AO4A 4W5TA 4N47A 4CFAA 1GOBA 3LWMA 2OZMA 4FJKA 3THVA 3H08A 1VSMA 4CF0A 4CK2A 1JLAA 1VSLA 4FZXC 2WOMA 4LSLA 3DLBA 4O0JA 1NK8A 5HLFA 4B9TA 4YNQA 1ZYQA 4B9NA 4BE2A 2E6MA 4CHYA 1WAJA 4FLXA 4KFBA 3V4IA 3MXIA 2PY5A 3RRGA 4CEFA 4H4OA 1NOZA 1IH7A 2NUBA 4WE1A 1JL1A 1IKXA 1RCHA 3AA2A 2IOCA 3AVNA 4CJQA 2BDPA 4M45A 3A2FA 4BE1A 3L2VA 2B6AA 3OY9A 3TWHA 4E0DA 1KTQA 4GW6A 4DQRA 1HYVA 4W5QA 4IFYA 1YTUA 2QKKA 3NCIA 1EKEA 3NBPA 4CJFA 1JLFA 5KRTA 4DSEA 3SQ4A 1LW0A 3NH2A 3VQ4A 3DRPA 4EZ6A 2G8IA 4IG3A 3ZSYA 3NGIA 3LALA 4FLTA 3LANA 1RT4A 3D45A 1HYSA 1I3AA 1GOCA 5KGXA 1W9HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MXJ A;  1KCF A;  1BQN A;  1Z26 A;  4KKO A;  4PY5 A;  3QEI A;  5C24 A;  3K5L A;  2X6S A;  2HMI A;  5C42 A;  4I9Q A;  3DOK A;  3SZ2 A;  3CM6 A;  3HT3 A;  2O4I A;  1LWC A;  5HRR A;  2GBZ A;  3LP3 A;  4CK3 A;  4DSJ A;  5J2Q A;  3FFI A;  1QSL A;  4E7J A;  1RDD A;  2I5J A;  2OA8 A;  4ZTJ A;  3OYG A;  3OYK A;  5J2N A;  1CXU A;  5DMR A;  3SUP A;  4QOZ B;  1JXB A;  3CFO A;  3DOL A;  2OPR A;  4HVJ A;  5HRN A;  3SV3 A;  1TKD A;  1ZBI A;  4ELT A;  4FM2 A;  2XY6 A;  1LAW A;  3DLK A;  4FJH A;  4CEQ A;  2Z1J A;  3LZI A;  3VQ8 A;  3L8B A;  2D5R A;  4M42 A;  1JKH A;  3B6O A;  1VSF A;  3RMC A;  2ETJ A;  2YHB A;  4OGE A;  4HCC A;  5CZ1 A;  2P5G A;  1IO2 A;  1S1T A;  3T3F A;  4DWI A;  4M3X A;  1CZB A;  1C0T A;  4CEZ A;  1VRT A;  2HNZ A;  2KQ2 A;  1HRH A;  4K8X A;  3AA3 A;  1C6V A;  1REV A;  5HRP A;  5I3U A;  1HQE A;  3OYM A;  1U48 A;  3DLH A;  4OLB A;  2FC0 A;  1TAU A;  4B9M A;  1NK5 A;  4DFM A;  3V9U A;  4C8O A;  4FJM A;  3K2P A;  2YHA A;  4BDZ A;  3ZSZ A;  3PV8 A;  1VSD A;  3S9H A;  3HVR A;  3DMJ A;  4CIG A;  1HYZ A;  4CER A;  4KV8 A;  3NH0 A;  1HNI A;  3O3G A;  1CXQ A;  1RT1 A;  1RTJ A;  2FBX A;  4M3Y A;  3IRX A;  4Z4H A;  4DU3 A;  3BDP A;  1G15 A;  4KI6 A;  3SYZ A;  2Z1I A;  5DK5 A;  2B4J A;  4O44 A;  3L2R A;  1IKY A;  3V9Z A;  3QET A;  1BGX T;  3DM2 A;  3VQC A;  3HPG A;  4JLH A;  2G8W A;  4B08 A;  3ULD A;  4CHO A;  1NKC A;  3KKS A;  3K5O A;  3V9X A;  1J54 A;  3QEW A;  1NJZ A;  2X78 A;  3DRS A;  3MED A;  1SKR A;  3ZSW A;  3NF8 A;  4Y1C A;  3OS1 A;  1KFS A;  4CEE A;  3IS9 A;  1BCM A;  4CEC A;  3VQD A;  3QEX A;  3U3Y A;  3I0R A;  1DTQ A;  2ITG A;  1BIS A;  3ZT1 A;  4CHZ A;  4QCL A;  3HPO A;  2P5O A;  3S3M A;  4O4G A;  2E6L A;  1JLC A;  1T8E A;  2RF2 A;  4N56 A;  2G8V A;  3RRH A;  4CGH A;  1C1B A;  3AVG A;  4FJI A;  1WSF A;  4DS4 A;  1D8Y A;  3RMD A;  1NK4 A;  2Z1H A;  1DLO A;  3PX4 A;  3NH1 A;  3LZJ A;  4Y1D A;  1VRU A;  3OYD A;  3OYE A;  1LV5 A;  4FZY A;  1MU2 A;  1KRP A;  1HMV A;  1WSG A;  4XIU A;  1RT6 A;  1RTH A;  3DYA A;  3L3U A;  4JRP A;  4B9U A;  2GV9 A;  4BWM A;  3VQP A;  3JYT A;  1RDC A;  3P1G A;  1NK0 A;  1UA1 A;  4CJR A;  1T03 A;  4DF8 A;  1JXE A;  3EYZ A;  4DS5 A;  3U6F A;  1XWL A;  4MFB A;  2IGI A;  4FJ9 A;  4FJG A;  4DTS A;  4FXD A;  1BQM A;  1K6Y A;  3LAM A;  4FK0 A;  2JGU A;  1UAX A;  3SJJ A;  5HRO A;  1S5J A;  1EP4 A;  4I2P A;  3VQ6 A;  4KHY A;  3SQ1 A;  3OYB A;  4ID5 A;  3M8R A;  1KLN A;  1UWB A;  2X6N A;  4OGC A;  3SQ2 A;  2VG5 A;  5KRS A;  1W0H A;  3BGR A;  4O55 A;  1L5U A;  1WSI A;  4BWJ A;  3QO9 A;  4KB0 A;  1JL2 A;  4B3O A;  1A5V A;  1TAQ A;  1WLJ A;  3EZ5 A;  2G8H A;  1FXX A;  4NCB A;  1KVC A;  4FVM A;  2QK9 A;  1KSP A;  3OYN A;  1WSJ A;  1WNS A;  3CG7 A;  1CZ9 A;  4AH9 A;  3RMA A;  1IKV A;  4QAG A;  5KI6 A;  3KK2 A;  4FJ8 A;  4O0I A;  2VG6 A;  2G8F A;  1ITG A;  5E41 A;  1WAF A;  4GMJ B;  3K59 A;  3S3O A;  4IBN A;  4PWD A;  1QHT A;  3AVM A;  2DY4 A;  1YTA A;  2XY5 A;  2A1R A;  4I9L A;  4F3O A;  3WNH A;  2O4G A;  2XY8 A;  4M3Z A;  4FJ5 A;  5HRS A;  3SUN A;  1NJX A;  1ASV A;  1HPZ A;  3AVI A;  3VQB A;  3ZCM A;  2KZM A;  4AHV A;  4DFP A;  4IKF A;  3HP9 A;  4CE9 A;  3OYL A;  3SUO A;  1R0A A;  2PYJ A;  4C8L A;  3TI0 A;  5KGW A;  4B8A B;  4IFV A;  3PX0 A;  1U4B A;  2G8U A;  1X9W A;  4LH5 A;  4KI4 A;  3QNO A;  4J2E A;  1KLM A;  1QS4 A;  3PUF A;  3K5N A;  3DI6 A;  4NYF A;  1NK9 A;  1SKS A;  4CJL A;  1L3S A;  1GOA A;  4OKJ A;  2E4L A;  5CY4 A;  1RT5 A;  4AHR A;  4FM0 A;  4F2R A;  4M3T A;  3IG1 A;  2P1J A;  4M3U A;  1UA0 A;  3HJF A;  4IDK A;  4O5B A;  3VN5 A;  4EP4 A;  3ZSQ A;  1HNV A;  4FK4 A;  4F3T A;  1RBS A;  1NKB A;  1RNH A;  4F8R A;  3O4N A;  3AO2 A;  1LWE A;  2OPQ A;  4KHW A;  1CLQ A;  3AVJ A;  4CF8 A;  3G0Z A;  3RWU A;  1X9M A;  2HNY A;  4DFK A;  4DTN A;  3VA0 A;  2RKI A;  1SUQ A;  1D5A A;  1ZBL A;  4FJ7 A;  3QIP A;  4ELU A;  1VK0 A;  2IC3 A;  2IDO A;  3PO4 A;  1TK5 A;  4CJV A;  2HW3 A;  4CGF A;  1S9G A;  4CEA A;  3SQ0 A;  2HHQ A;  1BL3 A;  3LDS A;  3OYJ A;  4W5O A;  4FCY A;  4K8Z A;  2KTQ A;  1KVA A;  4RW9 A;  5I42 A;  3ZT3 A;  3D0P A;  1NOY A;  1C0U A;  4RW7 A;  2Z1G A;  3NGY A;  3AA4 A;  1LWF A;  4KTW A;  4JRQ A;  4F2S A;  3WNE A;  4FJX A;  3CQ8 A;  1ASW A;  2EHG A;  3K5M A;  4DTM A;  1RTD A;  2PZS A;  2XO7 A;  3UIQ A;  3TAP A;  4KHU A;  3I0S A;  1VSH A;  3TAQ A;  1T7P A;  1RDB A;  4E19 A;  1S6P A;  2OYQ A;  4FM1 A;  2A1S A;  4HUE A;  4JS5 A;  4BAC A;  1ZBF A;  4NCA A;  4EZ9 A;  3CFR A;  4DMN A;  2OZS A;  3AVF A;  1ZBH A;  1RT3 A;  2QXF A;  3SI6 A;  3ZT2 A;  3HP6 A;  3VQQ A;  4Q0B A;  4KHN A;  3MEE A;  1IKW A;  1Z25 A;  4CFB A;  4CIE A;  1Q9Y A;  3HO1 A;  3TAR A;  3QNN A;  3SV4 A;  3AV9 A;  4H4M A;  3OS2 A;  2HHS A;  5HP1 A;  4FK2 A;  3OYH A;  4Z4C A;  1L3T A;  3V81 A;  2G8K A;  1BCO A;  4KRE A;  2YNI A;  3LP2 A;  4RW6 A;  4LSN A;  3KK1 A;  5JS1 A;  2EX3 A;  1XHX A;  4N5S A;  3VQA A;  3HM9 A;  4CES A;  2AJQ A;  1S1W A;  5J1E A;  1D9D A;  3MEC A;  1JLQ A;  4CGG A;  2QKB A;  3HVT A;  2YNF A;  4FLU A;  2IS3 A;  4CGJ A;  4M3W A;  1RDA A;  4DQS A;  3IAY A;  4C8N A;  1C1A A;  4CEO A;  1B92 A;  4B9S A;  4G1Q A;  4Z4F A;  2YV0 X;  3DLR A;  2WON A;  1RT7 A;  1TVR A;  2DFE A;  2YKN A;  2ZD1 A;  3LAK A;  3P5J A;  3QIO A;  2XHB A;  2ZQB A;  3QEP A;  5D3G A;  1XHZ A;  4KHQ A;  4HUF A;  2B5J A;  3O3F A;  5KTQ A;  3SPY A;  3AO1 A;  4PA1 A;  2X74 A;  3ZSR A;  3NF9 A;  4E1M A;  4ZHR A;  1TL1 A;  4DTX A;  4CIF A;  2XY7 A;  3L3V A;  4CHQ A;  3V6D A;  3MXM A;  3DRR A;  4NYN A;  3QIN A;  1RBV A;  4FLY A;  2Y1J A;  4DU1 A;  1SKW A;  1TGO A;  3NE6 A;  4FJL A;  1C0M A;  1KVB A;  3NF6 A;  3OYC A;  3KKR A;  1NKE A;  1O1W A;  1TKT A;  1SV5 A;  4CK1 A;  4FLW A;  3V9W A;  1S1U A;  2VG7 A;  4B9L A;  3OYI A;  3C6T A;  1TKZ A;  4KTZ A;  1VSK A;  2VWJ A;  4AHS A;  3ITH A;  1SL0 A;  1D9F A;  4AHC A;  3LWL A;  4NCG A;  3PO5 A;  3RMB A;  3C94 A;  2JLE A;  3NF7 A;  2F8T A;  2KW4 A;  4CCH A;  3M8P A;  3L2Q A;  1L3U A;  3LPT A;  2F8S A;  2HHX A;  3SCX A;  4TSX A;  2YNH A;  3QES A;  3KLI A;  1SL2 A;  4Z0U A;  2KFN A;  3M8Q A;  1DTT A;  1JLE A;  4DTR A;  4W5N A;  3KLE A;  3KJV A;  2DTU A;  4AHT A;  4OJR A;  4LD0 A;  3V1Q A;  3OYF A;  3NAE A;  1VSI A;  5T7B A;  1BI4 A;  4HUG A;  3S3N A;  1IG9 A;  4FLZ A;  1QE1 A;  3OS0 A;  2F96 A;  1BHL A;  1JLB A;  3G10 A;  1I39 A;  1WN7 A;  5CYM A;  3HXM A;  3KTQ A;  1RT2 A;  2XRI A;  1QSS A;  1NJW A;  3KD5 E;  1S6Q A;  4B8C A;  3NHG A;  3OVN A;  1WSE A;  3VQE A;  3NGZ A;  4M3R A;  4CJU A;  1A5W A;  1JLG A;  4E7H A;  4CJ3 A;  3PX6 A;  4N76 A;  1Q9X A;  2Q3S A;  4BDY A;  4DTU A;  3F9K A;  3KLG A;  4DTJ A;  5J2P A;  1NK6 A;  2KZZ A;  3ZSO A;  4AIL C;  3SNN A;  3HPH A;  3AVL A;  3OJS A;  2BE2 A;  3QEV A;  4YFU A;  4I2Q A;  5HBM A;  4ZTF A;  4KTQ A;  1U49 A;  5CYQ A;  1J53 A;  4Z4I A;  1B9D A;  2RN2 A;  3LP0 A;  4OPK A;  2D0B A;  3B6P A;  3HL8 A;  1FKO A;  1QSY A;  1QTM A;  2D0C A;  4PUO A;  4RG8 A;  3TAB A;  4FJN A;  3KK3 A;  4CHN A;  1LAV A;  4HTU A;  4LY7 A;  4CJW A;  3ASM A;  3EY1 A;  4OPJ A;  1YT3 A;  4ELV A;  1HQU A;  3AO3 A;  4CHP A;  4OLA A;  2RPI A;  4DSI A;  2ZE2 A;  4UQG A;  5FDL A;  3V1O A;  2HND A;  2FBT A;  4CJP A;  3K58 A;  4E3S A;  1N6Q A;  4CGD A;  1FK9 A;  3VQ7 A;  1S9E A;  1TKX A;  4CJ5 A;  1X1P A;  4CJS A;  1S1X A;  4Z4G A;  3ZSX A;  2PYL A;  3T19 A;  3RR8 A;  4FJJ A;  3AVK A;  3M8S A;  2HHV A;  2DFH A;  4CEB A;  1VSJ A;  4HHT A;  3QLH A;  4DSF A;  4J2D A;  4L8R B;  3E01 A;  3P83 D;  2LSN A;  1ASU A;  4I7F A;  2R7Y A;  1Q8I A;  4BE0 A;  2HVH A;  2YKM A;  2Y1I A;  1N5Y A;  3DLE A;  4CJK A;  4GVM A;  3V1R A;  3TAF A;  1VSE A;  2KFZ A;  1F21 A;  4ICL A;  2OPP A;  5J2M A;  1EXQ A;  4DSK A;  2YNG A;  4MQ3 A;  2IAJ A;  3WNG A;  1EX4 A;  4E7I A;  4DTP A;  1U45 A;  3SPZ A;  3WNF A;  3KIO A;  4DG1 A;  4DQQ A;  3O4Q A;  3TR8 A;  3ISN C;  3VQ5 A;  1L3V A;  5SZT A;  4IG0 A;  5K14 A;  4LH4 A;  2VWK A;  4B9V A;  4KO0 A;  2HB5 A;  4DTO A;  4F4K A;  4J2A A;  1EET A;  3HYF A;  4RW8 A;  3CFP A;  4E7K A;  3SUQ A;  3KLH A;  2FBV A;  4RW4 A;  3ZT4 A;  3ZT0 A;  4DLG A;  4HCB A;  4KHS A;  2P51 A;  4CFC A;  4DF4 A;  1UOC A;  4BDP A;  3AA5 X;  4Q5V A;  4E7L A;  3RR7 A;  4CED A;  1U47 A;  2BGG A;  4CJT A;  1C1C A;  4EP5 A;  5EU7 A;  1ZBU A;  1KFD A;  1BI4 B;  4OVL A;  5JS2 A;  3OYA A;  4KAZ A;  4N41 A;  4DQI A;  5FRN A;  3V9S A;  1SL1 A;  4KRF A;  4CF9 A;  4CJ4 A;  4OKK A;  3AO5 A;  4C8K A;  3KD1 E;  5CZ2 A;  3F73 A;  4CF2 A;  3OJU A;  4KB1 A;  4W5R A;  4DSL A;  1XC9 A;  1TL3 A;  5SWM A;  5FRO A;  1Y97 A;  4DLE A;  4R5P A;  4E1N A;  1J9A A;  2FBY A;  3VQ9 A;  1WSH A;  3L2U A;  4M41 A;  5FRM A;  1XI1 A;  4CGI A;  2DFF A;  3L2W A;  2HVI A;  3PY8 A;  3MAQ A;  3NDK A;  1YVU A;  1HJR A;  1TV6 A;  3CM5 A;  4JS4 A;  3AVA A;  3TAE A;  1S1V A;  2W42 A;  3KLF A;  3C6U A;  4ID1 A;  3AVB A;  3AVH A;  2HHT A;  3ALY A;  4C8M A;  1RBU A;  3ZSV A;  1QQC A;  1RBT A;  3O3H A;  4FW1 A;  3I8D A;  3VA3 A;  3QER A;  4DQP A;  4J2B A;  4FZZ A;  4DU4 A;  4Z4E A;  2OPS A;  4CFD A;  2D0A A;  1A5X A;  1BIU A;  3MEG A;  3HK2 A;  4FW2 A;  3TAG A;  4FYD A;  4PQU A;  3DLG A;  3JSM A;  5C25 A;  3U3G A;  1J5O A;  1B9F A;  1TK8 A;  3TAM A;  3AVC A;  3LPU A;  4E89 A;  3K57 A;  4H8K A;  1NK7 A;  2HHW A;  3RTV A;  1BIZ A;  4CF1 A;  4OKE A;  4FLV A;  4KPY A;  1U04 A;  4CJE A;  3T1A A;  3C95 A;  1TK0 A;  2GUI A;  3NFA A;  4AHU A;  1NJY A;  1T05 A;  4DFJ A;  2ATQ A;  1RBR A;  1RIL A;  1RTI A;  3LP1 A;  3HST B;  3CYM A;  1X9S A;  2BAN A;  1LW2 A;  1FKP A;  2HHU A;  3TAN A;  3AO4 A;  4W5T A;  4N47 A;  4CFA A;  1GOB A;  3LWM A;  2OZM A;  4FJK A;  3THV A;  3H08 A;  1VSM A;  4CF0 A;  4CK2 A;  1JLA A;  1VSL A;  4FZX C;  2WOM A;  4LSL A;  3DLB A;  4O0J A;  1NK8 A;  5HLF A;  4B9T A;  4YNQ A;  1ZYQ A;  4B9N A;  4BE2 A;  2E6M A;  4CHY A;  1WAJ A;  4FLX A;  4KFB A;  3V4I A;  3MXI A;  2PY5 A;  3RRG A;  4CEF A;  4H4O A;  1NOZ A;  1IH7 A;  2NUB A;  4WE1 A;  1JL1 A;  1IKX A;  1RCH A;  3AA2 A;  2IOC A;  3AVN A;  4CJQ A;  2BDP A;  4M45 A;  3A2F A;  4BE1 A;  3L2V A;  2B6A A;  3OY9 A;  3TWH A;  4E0D A;  1KTQ A;  4GW6 A;  4DQR A;  1HYV A;  4W5Q A;  4IFY A;  1YTU A;  2QKK A;  3NCI A;  1EKE A;  3NBP A;  4CJF A;  1JLF A;  5KRT A;  4DSE A;  3SQ4 A;  1LW0 A;  3NH2 A;  3VQ4 A;  3DRP A;  4EZ6 A;  2G8I A;  4IG3 A;  3ZSY A;  3NGI A;  3LAL A;  4FLT A;  3LAN A;  1RT4 A;  3D45 A;  1HYS A;  1I3A A;  1GOC A;  5KGX A;  1W9H A; 
#chains in the Genus database with same CATH topology
 2JWK A;  1KCF A;  5C24 A;  3IKM A;  2X6S A;  3K5L A;  3SZ2 A;  5LJV A;  1S3X A;  4WF9 L;  3LP3 A;  4CK3 A;  2YHY A;  3HOS A;  2I5J A;  1R59 O;  2OA8 A;  3OYK A;  4FPB A;  1JXB A;  3DOL A;  1NGG A;  4FOE A;  3SV3 A;  1S22 A;  4ELT A;  4FJH A;  3LDO A;  4CEQ A;  2Z1J A;  3THX A;  4B1Y B;  1VSF A;  3CQX A;  5CZ1 A;  3WEE A;  1IO2 A;  4FVU A;  4CEZ A;  1VRT A;  2P9K B;  1C6V A;  3DLH A;  3OYM A;  3MX5 A;  1NK5 A;  3E1Y A;  2QWQ A;  2YHA A;  4BDZ A;  3PV8 A;  4JK7 A;  2QWR A;  3DMJ A;  1HYZ A;  2Q36 A;  4CER A;  5KPZ A;  3M6G A;  3NH0 A;  4NLB A;  1CXQ A;  3AAQ A;  2FBX A;  4M3Y A;  4Z4H A;  3BDP A;  3SYZ A;  2Z1I A;  1VQ5 N;  3CCU N;  1BGX T;  1TYQ A;  3LDP A;  4IJN A;  2G8W A;  1NG9 A;  3ULD A;  2NRH A;  4B9Q A;  3K5O A;  4J8F A;  3ZSW A;  4KH4 A;  3I0R A;  3EL2 A;  5KQD A;  1C1B A;  2YHW A;  4DV1 K;  4OPH A;  1D8Y A;  3HBT A;  3U9Z A;  4FZY A;  1MU2 A;  1KRP A;  1HMV A;  4JRP A;  4ISG A;  3CJ1 A;  2NLX A;  3FZL A;  3JYT A;  1W7A A;  4BG8 A;  4DF8 A;  4M7X A;  3CCS N;  3SMS A;  1XWL A;  4FJ9 A;  2IGI A;  3P38 A;  3ZYY X;  4FOI A;  4FK0 A;  3M3Z A;  1ATR A;  1CZA N;  3OBW A;  4I2P A;  2PAV A;  3O9U A;  2Q31 A;  3OYB A;  3M8R A;  5KRS A;  4H0P A;  1W0H A;  3BGR A;  1L5U A;  1WSI A;  4BWJ A;  3CJC A;  1EWQ A;  1WLJ A;  2G8H A;  1KVC A;  3CG7 A;  1CZ9 A;  4QAG A;  3FFK B;  4O5F A;  2G8F A;  2BTF A;  2DY4 A;  2A1R A;  4NXN K;  4F3O A;  2O4G A;  3NMU A;  4FJ5 A;  3SUN A;  4IO8 A;  3VQB A;  3O4W A;  3J8A A;  3OYL A;  2PYJ A;  4IFV A;  2UUA K;  4GV6 A;  5AQN A;  4JNE A;  4KHP K;  4J2E A;  1KLM A;  3C6H A;  1SKS A;  4PKH A;  4OKJ A;  5CY4 A;  3RSE A;  1U2V A;  3IG1 A;  5GIO A;  3HJF A;  4IDK A;  4O5B A;  3QDK A;  3VN5 A;  1MWM A;  4CZJ A;  3O08 A;  1T44 A;  2UXB K;  4FK4 A;  4F3T A;  1RBS A;  1NKB A;  1RNH A;  3O4N A;  2O8B B;  1LWE A;  4DFK A;  4FJ7 A;  3U9D A;  3QIP A;  3O9S A;  2HW3 A;  3SQ0 A;  3THY B;  3HTV A;  2HHQ A;  5BPL A;  4FCY A;  4K8Z A;  2FF3 B;  3QBW A;  5I42 A;  2A6A A;  3ID8 A;  1ZC6 A;  4AQY K;  3D0P A;  4RW7 A;  2Z1G A;  3DXK B;  5HOO A;  3AA4 A;  3EN9 A;  4IOX A;  1TUU A;  1ASW A;  2WUS A;  3TAP A;  3FE1 A;  1E4F T;  1EQY A;  2CGL A;  4H0O A;  1T7P A;  4E19 A;  4BVO A;  3WQT A;  4HUE A;  1U6Z A;  1ZBF A;  4NCA A;  5AQM A;  3CFR A;  4DR1 K;  2OZS A;  1ZBH A;  4JK9 A;  1KXP A;  1IKW A;  1YJN N;  1W97 L;  2D0O A;  3SV4 A;  1C0F A;  2QWP A;  4A5B A;  1NLV A;  4Z4C A;  2VQE K;  2YNI A;  3KK1 A;  5JS1 A;  2EX3 A;  3G25 A;  4WFA L;  3TPQ A;  4N5S A;  4BC2 A;  5J1E A;  4FLU A;  4DQS A;  3ZET A;  4G1Q A;  2YV0 X;  2WON A;  3QIO A;  1M90 O;  4KHQ A;  1N36 K;  4YOR A;  2B5J A;  4XH5 A;  3O3F A;  3AO1 A;  4CZK A;  4CZM A;  1GLE G;  4E1M A;  2XY7 A;  2W40 A;  3H3O B;  4CD3 A;  3MXM A;  4CZI A;  1OKJ A;  3NE6 A;  3OYC A;  4I6M B;  3KKR A;  2WBN A;  3V9W A;  1SV5 A;  3L4Q A;  3K9K A;  2QEX N;  2IIR A;  4KTZ A;  4WYB A;  1QVF M;  2ITM A;  4FWL A;  1D9F A;  3LWL A;  5AZI B;  3PO5 A;  4FL9 A;  2JLE A;  3M8P A;  3WXM B;  5C15 A;  2HHX A;  5TKY A;  3H6E A;  3SCX A;  2KFN A;  3P39 A;  4W5N A;  3C7N A;  3KLE A;  2E88 A;  2DTU A;  4OJR A;  3HOT A;  3J7A P;  5T7B A;  1BI4 A;  4FLZ A;  2F96 A;  1VQK N;  3G10 A;  1WN7 A;  5CYM A;  3SAG A;  4WCE L;  1QSS A;  5BR9 A;  1S6Q A;  5TKW A;  3KD5 E;  3OVN A;  1IBL K;  3VQE A;  4BC4 A;  4FWQ A;  4CJU A;  1A5W A;  4CJ3 A;  3I8B A;  1Q9X A;  4BDY A;  1X3N A;  5J2P A;  4AIL C;  3AVL A;  4YFU A;  3CIP A;  5HBM A;  4A57 A;  3WQU A;  1XQS C;  4ZTF A;  3QML A;  2RN2 A;  3LP0 A;  1QZ5 A;  5BN8 A;  3HL8 A;  3IMX A;  2NRR A;  3CMA N;  4ELV A;  1YT3 A;  3AO3 A;  4B3R K;  4CHP A;  4XEI A;  2RPI A;  4CVN E;  1NMD A;  1N6Q A;  4CGD A;  1FK9 A;  3CCM N;  4V19 S;  3M8S A;  3MN5 A;  2DFH A;  4KH6 A;  4DSF A;  4J2D A;  4BE0 A;  2LSN A;  1SQK A;  3TTC A;  3TAF A;  1JCG A;  3A5L C;  3MN6 A;  4ICL A;  5J2M A;  1EXQ A;  2HBK A;  4MQ3 A;  3WNG A;  3WXK A;  3WNF A;  3KIO A;  4FWN A;  3TR8 A;  1EWR A;  3ISN C;  5SZT A;  4MDB A;  4LH4 A;  2QI2 A;  4DTO A;  1EET A;  1XUP O;  4MO5 A;  4RW8 A;  2D0P A;  4E7K A;  4HCB A;  2FBV A;  3ZT0 A;  1FJG K;  2P9U A;  3MDQ A;  4DF4 A;  2E2O A;  3AA5 X;  4IOC L;  1V4T A;  1U47 A;  1C1C A;  1ZBU A;  4N41 A;  2WFB A;  3V9S A;  3S41 A;  3SBG A;  3KD1 E;  1YVN A;  4JEP A;  3F73 A;  4DSL A;  1TL3 A;  5M1O A;  4R5P A;  1J9A A;  3VQ9 A;  5BRH A;  1XI1 A;  3PY8 A;  3MAQ A;  3JS6 A;  3UKR B;  1HJR A;  3AVA A;  3TAE A;  2ZM6 K;  3KLF A;  3C6U A;  4C8M A;  3O3H A;  3F2K A;  3VA3 A;  4J2B A;  3HK2 A;  1HLU A;  5C10 A;  3OW2 M;  4FYD A;  4FW2 A;  3TAG A;  3AAR A;  1KC8 O;  3JSM A;  4BG9 A;  2O8D A;  5FLX O;  3AVC A;  4H8K A;  2ASO A;  1GLD G;  2HHW A;  3BP8 A;  4FLV A;  4KPY A;  4CJE A;  3CD6 N;  1TK0 A;  3NFA A;  4AHU A;  2ATQ A;  1DEJ A;  3J7Y P;  3FGU A;  1RIL A;  1X9S A;  2BAN A;  1LW2 A;  3R6M A;  4A62 A;  3P4I A;  2HHU A;  4OO1 J;  2OZM A;  3H08 A;  1VSM A;  3R9P A;  1JLA A;  3WEE B;  4FZX C;  2F7T A;  1VQM N;  3HSC A;  1NK8 A;  4B9T A;  2ZJQ L;  4B9N A;  2IVP A;  2E6M A;  1WAJ A;  4JYA K;  3L4I A;  4H4O A;  4FWS A;  2NUB A;  4WE1 A;  5H1S Q;  2IOC A;  4RWT A;  2GUP A;  5F0X A;  4BE1 A;  3EO3 A;  3TSP A;  3OY9 A;  2OAN A;  4GW6 A;  4W5Q A;  1BA0 A;  2CGJ A;  2QKK A;  3TTF A;  3NCI A;  1EKE A;  5KRT A;  4DSE A;  4GV3 A;  2ASP A;  3QFP A;  4ISE A;  1RT4 A;  1TYQ B;  3CCQ N;  4BR7 A;  1GOC A;  3SAF A;  2GEM A;  2UUB K;  3SAH A;  1Z26 A;  3PSI A;  4KKO A;  5C42 A;  2O4I A;  1RGI A;  5HRR A;  2ZF5 O;  1ATS A;  1RDD A;  4ZTJ A;  4YY3 K;  5J2N A;  1HUX A;  3SUP A;  3QIC A;  4HVJ A;  1ZBI A;  1E4G T;  2HBL A;  2XY6 A;  2QWO A;  1LAW A;  1J5E K;  3ATV A;  2D5R A;  4H5R A;  4M42 A;  1JKH A;  3RMC A;  2YHB A;  4HCC A;  1TUY A;  2QTD A;  3T3F A;  2A3Z A;  5EVZ A;  1REV A;  1HQE A;  3V9U A;  3K2P A;  5AQP A;  2AA4 A;  4CIG A;  4LF9 K;  2YJE A;  5B8H A;  1RT1 A;  1RTJ A;  3T7Z A;  4KI6 A;  2ZWH A;  3V9Z A;  3QET A;  4DR5 K;  1T6D A;  2CH6 A;  1WBD A;  4YOV A;  3I33 A;  3QEW A;  3E66 A;  2X78 A;  3MED A;  4H0T B;  3NF8 A;  4CEE A;  3IS9 A;  4CEC A;  3VQD A;  4WFB L;  2VGN A;  1DTQ A;  3HPO A;  2E6L A;  1OH6 A;  1V4S A;  5M1K A;  1DLO A;  1D4X A;  1GLF O;  5E26 A;  2FF6 A;  3OYD A;  1LV5 A;  2HF4 A;  3OYE A;  4YHH K;  1RTH A;  3L3U A;  2VQF K;  4BRD A;  3RSE B;  5E84 A;  3VES A;  4CJR A;  1T03 A;  1JXE A;  1T3V A;  3EYZ A;  3U6F A;  4FJG A;  3DXM A;  4JI0 K;  1K6Y A;  3LAM A;  2JGU A;  3H45 C;  1S5J A;  1NGH A;  5JVG L;  4H5T A;  3SQ1 A;  2BH1 A;  4ID5 A;  1MA9 B;  3SQ2 A;  2VG5 A;  5DM6 L;  3CPW M;  1YJW N;  4O55 A;  3QO9 A;  3FZF A;  3I55 N;  1A5V A;  2E2P A;  4FVM A;  2QK9 A;  4FJ8 A;  1IKV A;  4WQ4 A;  5GIP A;  4O0I A;  4CZH A;  5BR8 K;  4IBN A;  4PWD A;  1QHT A;  3ZX0 A;  4H5N A;  3WNH A;  4MDA A;  1NJX A;  1ASV A;  1HPZ A;  3AVI A;  2GEL A;  2HHH K;  2F9W A;  4ILG B;  3UKU A;  4AHV A;  4DFP A;  3SUO A;  1R0A A;  3VGK A;  3IDH A;  3PUF A;  4FWP A;  3K5N A;  4BRQ A;  4H0X B;  4F2R A;  2GTD A;  4FM0 A;  2NRW A;  1DT9 A;  3H1V X;  4JI1 K;  3ZET B;  1NWK A;  1WUA A;  3MK6 A;  2WC9 A;  3LM9 A;  2OPQ A;  3E9L A;  1KQS M;  3CCR N;  5HL7 L;  3G0Z A;  4LC9 B;  3RWU A;  2HNY A;  2OCE A;  3MN7 A;  1YAG A;  1SUQ A;  4EAH D;  1ZBL A;  5GAD P;  4CBX A;  2IDO A;  1TK5 A;  4HTL A;  3VF2 A;  4YDU C;  4CGF A;  4X62 K;  1BL3 A;  2QWM A;  3LDS A;  1HKC A;  3C0B A;  2KTQ A;  3OTO K;  1HNW K;  4IDH A;  1NOY A;  1BO5 O;  3SBT A;  3NGY A;  3R3L A;  4BR0 A;  3D2F A;  1W2B M;  5AQR A;  3CQ8 A;  2EHG A;  2PZS A;  1KAZ A;  2I7N A;  3KWG A;  4KHU A;  5GAE P;  1VSH A;  3TAQ A;  3THW A;  1RDB A;  1S6P A;  3C7N B;  4MLE A;  5EX5 A;  4JS5 A;  4BAC A;  4RCH A;  4A5A A;  3HP6 A;  5C2D A;  3MEE A;  3TAR A;  3QNN A;  3OS2 A;  2HHS A;  2UYT A;  4KRE A;  3CI5 A;  3V81 A;  2G8K A;  4QS7 A;  1OVY A;  3LP2 A;  2HST A;  1XHX A;  3ID6 A;  5ELZ A;  3HM9 A;  2AJQ A;  1S1W A;  5AZJ B;  1JLQ A;  4FSV A;  1O13 A;  3HVT A;  2IS3 A;  1J6Z A;  1X3M A;  4CGJ A;  4CEO A;  2YJF A;  4Z4F A;  2O8C A;  1RT7 A;  2YKN A;  3VGL A;  2YHX A;  2ZQB A;  1VAZ A;  2NRX A;  3SPY A;  3ZSR A;  1RBV A;  4DU1 A;  2VYP A;  4ILH A;  4H5V A;  3QBX A;  1WOQ A;  4CZG A;  1NKE A;  4DB3 A;  4DV2 K;  1OH8 A;  4B1U B;  3C6T A;  1TKZ A;  2OTJ N;  3SJH A;  5AQI A;  3CC7 N;  2GWK A;  1SL0 A;  4NCG A;  3RMB A;  1IBM K;  3DAW A;  1SL2 A;  4GNI A;  4Z0U A;  5DM7 L;  1JLE A;  1T6C A;  4AHT A;  1NU0 A;  4QS8 A;  1VSI A;  2P9U B;  4BC5 A;  1IG9 A;  3GOI A;  1JLB A;  3KTQ A;  3DJC A;  4JKC A;  1RT2 A;  2XRI A;  2YCH A;  3VEY A;  1NJW A;  4LF5 K;  1WSE A;  5AQV A;  3H3N O;  4YOW A;  4E7H A;  3VEX A;  3F9K A;  4DTJ A;  1NK6 A;  3SNN A;  2IVN A;  1YIJ N;  3O1B A;  4I2Q A;  4DV7 K;  1U49 A;  2F4V K;  1J53 A;  3MCA B;  2D0B A;  1FKO A;  5LMU K;  4PUO A;  4RG8 A;  3HM8 A;  1LAV A;  4JHD A;  4HTU A;  4OPJ A;  5LMN K;  2E5L K;  4OLA A;  2E1Z A;  4BR2 A;  5FDL A;  4IJA A;  5BRE A;  3VOV A;  1S9E A;  1TKX A;  3VQ7 A;  1LOT B;  4CJS A;  2O8D B;  4FJJ A;  5IT9 O;  2HHV A;  2RE2 A;  1VSJ A;  4EIA A;  3E01 A;  3KVG A;  5IWA K;  2YKM A;  1IJJ A;  4CJK A;  4GVM A;  3V1R A;  4E7I A;  1DKG D;  3O4Q A;  2O8F B;  4C23 A;  4KO0 A;  4F4K A;  3T69 A;  3SUQ A;  3KLH A;  4RW4 A;  2IVO A;  5M1P A;  2P51 A;  4CFC A;  4JAX A;  3WXI A;  3G4S N;  3RR7 A;  4BDP A;  2BGG A;  1IBK K;  4CJT A;  3O9T A;  1KFD A;  3BZK A;  3OYA A;  4KRF A;  2QA4 N;  1XMO K;  4CF2 A;  5AQF A;  3C6A A;  2E2Q A;  4IEI A;  4E1N A;  3VER A;  5FRM A;  4K41 A;  2DFF A;  4CGI A;  3L2W A;  5BN9 A;  1P8Z A;  1TV6 A;  5AQU A;  4JS4 A;  4DV0 K;  3CPE A;  2W42 A;  3ALY A;  4BRI A;  4BRN A;  4JI5 K;  4DQP A;  4Z4E A;  1XC3 A;  4AF1 A;  4CFD A;  1BIU A;  1ZBS A;  1TK8 A;  2HF3 A;  3LPU A;  5AQO A;  3K57 A;  3I56 N;  5AFU A;  1NK7 A;  1BIZ A;  2D4W A;  3BF1 A;  2GUI A;  1YXQ A;  2P9L B;  3U4L A;  3NVM A;  3LP1 A;  4H5W A;  1FKP A;  4CW7 B;  4IZ9 A;  3AO4 A;  4CFA A;  1GOB A;  4FJK A;  2P9K A;  3THV A;  1VSL A;  4JI3 K;  3E9P A;  4LSL A;  3DLB A;  1X9J A;  3TU5 A;  5AJ3 K;  5HLF A;  4YNQ A;  4BE2 A;  4CHY A;  2NRT A;  4FLX A;  3MXI A;  4PL8 A;  3MCP A;  3GBT A;  3K0S A;  1NOZ A;  1K9M O;  5EXW A;  4OX9 K;  3AVN A;  3CJ9 A;  3DLL L;  4BGA A;  4PKG A;  3D6R A;  1K8A O;  5ADX A;  4DR3 K;  1YTU A;  2P9I B;  1HNZ K;  1JLF A;  3VQ4 A;  2G8I A;  4IG3 A;  2ASM A;  2FXU A;  3NGI A;  4FLT A;  2Q0U A;  1HYS A;  1I3A A;  1BU6 O;  3MXJ A;  4NXM K;  4I9Q A;  2HMI A;  3DOK A;  3HI0 A;  3CM6 A;  3HT3 A;  1LWC A;  4CBW A;  2GBZ A;  1RFQ A;  3NVK A;  3VEZ A;  4E7J A;  4YOU A;  4DCH A;  4DV3 K;  3MWP A;  5DMR A;  3CME N;  3CCE N;  1TKD A;  4FM2 A;  5AQK A;  1NGC A;  3VQ8 A;  3L8B A;  4FWO A;  5AQY A;  3B6O A;  5BRD A;  3K9J A;  1S1T A;  3VEN A;  4DWI A;  4M3X A;  1CZB A;  1C0T A;  1HRH A;  4K8X A;  5HRP A;  2BUP A;  1U48 A;  4Z94 A;  3FZK A;  3W0L A;  4B9M A;  4DFM A;  3WXL A;  4C8O A;  3KHY A;  4FJM A;  1VSD A;  3KWI A;  3HVR A;  1NGE A;  3QFU A;  1QQO A;  3O3G A;  4CBU A;  3CHW A;  4DU3 A;  3CQY A;  1G15 A;  2B4J A;  4B1W B;  4O44 A;  3L2R A;  1IKY A;  2GX9 A;  3VQC A;  1HKG A;  2W6K A;  2D1K A;  1IG8 A;  4BRK A;  4JLH A;  1NKC A;  4JD2 A;  4BRE A;  1J54 A;  1YHQ N;  5BPM A;  1SKR A;  1P90 A;  1Z05 A;  1KFS A;  4Y1C A;  3BF3 A;  1BCM A;  5LJW A;  2ITG A;  1BIS A;  3ZT1 A;  4IOA L;  2P5O A;  2Q1N A;  3S3M A;  1JLC A;  2RF2 A;  3UKU B;  4N56 A;  3BEX A;  3AVG A;  3CJB A;  3IUC A;  3RMD A;  2Z1H A;  3PX4 A;  2KHO A;  3EZW A;  3NH1 A;  4Y1D A;  1VRU A;  5LL6 Z;  1WSG A;  4XIU A;  3DYA A;  4B9U A;  2QXL A;  2V7Y A;  5KPT A;  1RDC A;  3P1G A;  3LM2 A;  2PFU A;  1UA1 A;  3THX B;  5AQG A;  4FWK A;  4WFN L;  4DS5 A;  4MFB A;  3ZX2 A;  4LF7 K;  4XH4 A;  5HRO A;  4GKK K;  3LDN A;  4KHY A;  2F9T A;  4BRA A;  1G99 A;  3TSU A;  1KLN A;  1NGA A;  1UWB A;  2X6N A;  4OGC A;  4KB0 A;  3DXK A;  4FPA A;  1TAQ A;  3EZ5 A;  2ZGZ A;  4DHY A;  1Y64 A;  1SZ2 A;  1KSP A;  1WNS A;  1S72 N;  3D2F B;  4QS9 A;  5EOY A;  4AH9 A;  3RMA A;  3KK2 A;  2VG6 A;  5A2Q O;  1ILY A;  1ITG A;  5E41 A;  3LDQ A;  3AGR A;  3AY9 A;  1NGI A;  3K59 A;  3S3O A;  1Z6R A;  2YI1 A;  3THW B;  1YTA A;  2XY5 A;  4I9L A;  1JCE A;  2XY8 A;  4M3Z A;  5EY4 A;  5HRS A;  4BVP A;  5CHI A;  3ZCM A;  4IKF A;  2FSN A;  3HP9 A;  4C8L A;  5KGW A;  4JKA A;  3PX0 A;  1NNE A;  3O8M A;  4KI4 A;  3QNO A;  1NK9 A;  4C1N K;  1GOA A;  1RT5 A;  1NJI O;  5JLF A;  4R79 A;  2P1J A;  4M3U A;  3MN9 A;  1UA0 A;  4JI2 K;  3ZSQ A;  2ZGY A;  5BRF A;  2O8C B;  2FSJ A;  4KHW A;  4CF8 A;  1VQ8 N;  3WT0 A;  4DTN A;  3VA0 A;  1HPM A;  2P9P A;  2RKI A;  1D5A A;  5CE3 A;  3T1Y K;  1VK0 A;  4CJV A;  1VQ4 N;  4CEA A;  2QWN A;  3R8E A;  3U8X A;  3PIP L;  4B3T K;  5F2R A;  5LY3 A;  4W5O A;  5GIN A;  4RW9 A;  3ZT3 A;  2JWL A;  1LWF A;  4JRQ A;  3WNE A;  4FJX A;  3K5M A;  3MMV A;  2XO7 A;  3UIQ A;  3FLC O;  3CC4 N;  3O6W A;  2OYQ A;  2A1S A;  2KKZ A;  4EZ9 A;  4DMN A;  1RT3 A;  2QXF A;  2NZT A;  4KHN A;  3HO1 A;  4CFB A;  1KAY A;  3AV9 A;  4F9O A;  4FK2 A;  2P9N A;  3OYH A;  1L3T A;  1BCO A;  1BOT O;  2UU9 K;  5C12 A;  1JJ2 M;  3VQA A;  2QWL A;  1N33 K;  4DR4 K;  1D9D A;  3MEC A;  2QKB A;  2YNF A;  3AGK A;  3ENB A;  1C1A A;  4YOY A;  3DLR A;  1U2V B;  1DGK N;  1TVR A;  2DFE A;  2ZD1 A;  3LAK A;  5D3G A;  3PSF A;  2XHB A;  3O5B A;  4JKG A;  5M1Q A;  2PBD A;  4BRP A;  1VQO N;  3NF9 A;  4ZHR A;  2WTU A;  4CIF A;  3V6D A;  3DRR A;  3QIN A;  3M1F A;  1SKW A;  1TGO A;  4FJL A;  1C0M A;  3NF6 A;  1TKT A;  4CK1 A;  1NGJ A;  4FLW A;  1S1U A;  4KBO A;  3H46 O;  5AQH A;  5AR0 A;  4AHC A;  2F8T A;  2KW4 A;  4CCH A;  3L2Q A;  2VGM A;  1N32 K;  4TSX A;  3QES A;  3KLI A;  3M8Q A;  3G6E N;  3KJV A;  3HZ6 A;  4BY9 C;  2CGK A;  3S3N A;  4H0Y B;  1QE1 A;  3OS0 A;  3IFR A;  4B8C A;  3NGZ A;  4M3R A;  3MX2 A;  1JLG A;  4N76 A;  4GVE A;  2Q3S A;  4DTU A;  3KLG A;  4JKB A;  2KZZ A;  3HPH A;  2BE2 A;  4IWV A;  3UKR A;  5FPE A;  3QEV A;  1N8R O;  4KTQ A;  5CYQ A;  4BR4 A;  1B9D A;  1QSY A;  4OPK A;  1QTM A;  2D0C A;  4X64 K;  3KK3 A;  3ZX3 A;  3EE8 A;  3EY1 A;  4FWM A;  1H1V A;  1HQU A;  4DSI A;  2ZE2 A;  4BGB A;  4CJP A;  4DKW A;  2O8E A;  4K43 A;  3ENO A;  1X1P A;  4Z4G A;  1QZ6 A;  3ZSX A;  5JMV A;  2PYL A;  4WQ5 C;  3RR8 A;  3AVK A;  3EKU A;  2YX6 A;  1Q82 O;  4FXD A;  4HHT A;  5M1N A;  3P83 D;  4I7F A;  1ASU A;  3H1Q A;  4PL7 A;  1Q8I A;  2R7Y A;  2HVH A;  2Y1I A;  1N5Y A;  4EHU A;  3DLE A;  3CJ7 A;  2KFZ A;  2OPP A;  4DSK A;  3TSQ A;  2IAJ A;  1EX4 A;  4O8U A;  4DTP A;  1U45 A;  4BC3 A;  4CD1 A;  1E3M A;  4IG0 A;  2VWK A;  4X65 K;  4B9V A;  2VWB A;  2HB5 A;  1YI2 N;  4BR9 A;  3CFP A;  5M1F A;  4DLG A;  4Q5V A;  3EEQ A;  4CED A;  1M1K O;  4EP5 A;  5EU7 A;  4IXC A;  1BI4 B;  4KAZ A;  1SL1 A;  5AQS A;  1QQN A;  4LF8 K;  4OKK A;  4C8K A;  4NLC A;  4W5R A;  5SWM A;  5FRO A;  4CZE A;  3GL1 A;  5AQT A;  2FBY A;  5FPN A;  2KLA A;  4IO9 L;  1Q86 O;  2A40 A;  3CM5 A;  1VHX A;  1RBU A;  3BZC A;  3SMP A;  3ZSV A;  1RBT A;  2A41 A;  4FW1 A;  3I8D A;  3CF5 L;  1OH5 A;  4FZZ A;  2GWJ A;  1K8K A;  4DU4 A;  3N4P A;  4LF4 K;  4PQU A;  3DLG A;  3VMF B;  5C25 A;  2CH5 A;  1B9F A;  1J5O A;  5AQZ A;  3TAM A;  3RVC A;  4E89 A;  2E8A A;  3VTH A;  3ZEU A;  3RTV A;  4CF1 A;  1BUP A;  3T1A A;  1MWK A;  1NJY A;  1T05 A;  4DFJ A;  3CYM A;  5AQX A;  3FZM A;  4IFE A;  1ESV A;  4IEE A;  4N47 A;  1WB9 A;  3LWM A;  1ZXO A;  4CF0 A;  4CK2 A;  3KZB A;  2WOM A;  4O0J A;  4B1Z A;  3CCL N;  4GKJ K;  4KFB A;  2PY5 A;  4CEF A;  2E1Y A;  1JL1 A;  1IKX A;  3AA2 A;  4EHT A;  2UXC K;  2BDP A;  4M45 A;  3L2V A;  2B6A A;  3M5R A;  4AM7 A;  1KTQ A;  4A2B A;  4IFY A;  4C1N I;  4CJF A;  1VQ7 N;  4UY8 O;  2V7Z A;  3SQ4 A;  1LW0 A;  3DRP A;  4PHT X;  3C65 A;  3LAL A;  1GLB G;  3D45 A;  4CJ7 A;  4LFA K;  5KGX A;  3P31 A;  1BQN A;  4JD2 B;  4E1J A;  4PY5 A;  3QEI A;  1YF5 L;  3ULE A;  4DSJ A;  1KAX A;  3A5O C;  5J2Q A;  3FFI A;  1QSL A;  5C2F A;  2J4R A;  4K42 A;  3VET A;  1Q7Y O;  3OYG A;  3O1W A;  2OTL N;  1CXU A;  4QOZ B;  3CFO A;  5HRN A;  2OPR A;  3PIO L;  3DLK A;  3LZI A;  4JI7 K;  3D2E A;  3HRG A;  2ETJ A;  4K25 A;  4OGE A;  2AP1 A;  3ZLJ A;  4YOT A;  2P5G A;  3LL3 A;  4DUY K;  2P9S A;  2HMP A;  2NRZ A;  2HNZ A;  2KQ2 A;  3AA3 A;  4H03 B;  2VCP A;  3CER A;  4OLB A;  4WQ4 C;  5I3U A;  1TAU A;  2FC0 A;  3CC2 N;  3ZSZ A;  3S9H A;  4RTF D;  1OH7 A;  1VQP N;  3A5N C;  3N4Q A;  4KV8 A;  4HWI A;  1HNI A;  3IRX A;  1I94 K;  3R1X A;  5AFU H;  1BG3 A;  5DK5 A;  3DM2 A;  3HPG A;  1FW6 A;  4B08 A;  4CHO A;  1IV0 A;  3D7E O;  3KKS A;  1VQ6 N;  3GG4 A;  3V9X A;  1NJZ A;  3DRS A;  3OS1 A;  3QEX A;  3JXU A;  3U3Y A;  2W6L A;  4JKF A;  4CHZ A;  3E9O A;  4QCL A;  4O4G A;  1T8E A;  4EFH A;  2G8V A;  3RRH A;  4CGH A;  4FJI A;  1WSF A;  4JI4 K;  4DS4 A;  5KQ8 A;  2Q0R A;  1NK4 A;  1NGD A;  3LZJ A;  5ADX H;  1RT6 A;  3CET A;  2GV9 A;  4BWM A;  3VGM A;  3VQP A;  1NK0 A;  4B3S K;  4FO0 A;  1HR0 K;  4DTS A;  1BQM A;  1UAX A;  3SJJ A;  2NNW A;  1XNQ K;  1EP4 A;  5GAH P;  3VQ6 A;  2P9P B;  4CI6 A;  3WXJ A;  1RDU A;  4BRG A;  4PKI A;  1HKB A;  3CCJ N;  1GLC G;  5FPM A;  3J7Z O;  1GLA G;  1JL2 A;  4B3O A;  3VEO A;  2V52 B;  1FXX A;  5AQL A;  4NCB A;  3OYN A;  1WSJ A;  5AQQ A;  3BUZ B;  5KI6 A;  1XMQ K;  1WAF A;  4GMJ B;  3SLC A;  4JKH A;  3AVM A;  3F9M A;  1KD1 O;  4B1X B;  4A59 A;  1QHA A;  2KZM A;  2Q2R A;  4CE9 A;  1MDU B;  3A5M C;  4LFB K;  3JAM O;  3TI0 A;  1C0G A;  4U7B A;  3TTD A;  4M63 C;  4B8A B;  1HX1 A;  5I9E B;  2P9N B;  5AZJ A;  1U4B A;  2G8U A;  1X9W A;  4LH5 A;  1QS4 A;  3DI6 A;  4NYF A;  3OA9 A;  4CJL A;  1L3S A;  2E4L A;  4M7Y A;  4M3T A;  4AHR A;  4NO7 A;  3A0I X;  4XH1 A;  3FZH A;  2I7P A;  5GAG P;  1Q18 A;  1SS6 A;  4EP4 A;  1HJO A;  1HNV A;  4F8R A;  3AO2 A;  1CLQ A;  3GDQ A;  3AVJ A;  4DV4 K;  4JKG B;  1X9M A;  4JKE A;  3DXM B;  3OBY A;  1Q81 O;  2NRV A;  4ELU A;  2IC3 A;  3J81 O;  3PO4 A;  1S9G A;  4FWR A;  2HOE A;  4BRF A;  3OYJ A;  4BRH A;  1KVA A;  3A8Y A;  2ZJP L;  1C0U A;  3CXC M;  4GV9 A;  4F2S A;  4KTW A;  1RTD A;  4DTM A;  3I0S A;  4G9Z A;  4L3Q A;  1VQN N;  4FM1 A;  4DR7 K;  4BRO A;  5JIC A;  3AVF A;  3FR0 A;  3SI6 A;  3ZT2 A;  3VQQ A;  4Q0B A;  1Z25 A;  4CIE A;  3J80 O;  1Q9Y A;  3AAP A;  1K73 O;  4H4M A;  5HP1 A;  4DUZ K;  1NBW A;  4RW6 A;  4LSN A;  4H0V B;  4CES A;  3ENH A;  4CGG A;  4M3W A;  1RDA A;  1JCF A;  3KK7 A;  3IAY A;  4C8N A;  1B92 A;  5JVH L;  4B9S A;  3VPZ A;  3GE1 A;  2Q97 A;  4K0K K;  3P5J A;  4JKD A;  2O8B A;  2V51 B;  3QEP A;  1XHZ A;  4HUF A;  5KTQ A;  4PA1 A;  2X74 A;  4DTX A;  1TL1 A;  3L3V A;  4CHQ A;  4BR5 A;  4FLY A;  4NYN A;  1RDW X;  2Y1J A;  4CZL A;  2O8E B;  4BRM A;  3THY A;  3UE5 A;  1KVB A;  1O1W A;  5MLC Q;  1YIT N;  2RHK A;  2VG7 A;  4B9L A;  3OYI A;  4DR2 K;  1VSK A;  2ZJR L;  2VWJ A;  2O8F A;  4AHS A;  3ITH A;  4JK8 A;  3C94 A;  3NF7 A;  4JI8 K;  1L3U A;  3LPT A;  2F8S A;  1NM1 A;  4MLH A;  2YNH A;  1DTT A;  4DTR A;  4WQ5 A;  1ATN A;  4LD0 A;  3V1Q A;  3OYF A;  4YDU A;  3NAE A;  4HUG A;  4A61 A;  1GLL O;  1BHL A;  1I39 A;  3HXM A;  4MO4 A;  3NHG A;  4JN4 A;  3DWL A;  3PX6 A;  2QW9 A;  3O9R A;  4Y0W A;  3ZSO A;  3OHR A;  4ISF A;  3UB5 A;  3OJS A;  4O8K A;  4X66 K;  2UXD K;  4Z4I A;  3B6P A;  1NMN A;  3EE9 A;  3TAB A;  4FJN A;  1QQM A;  3MWT A;  2HBJ A;  4CHN A;  4LY7 A;  3ATU A;  3ASM A;  4CJW A;  3WUH A;  1HNX K;  5AQW A;  4UQG A;  1K8K B;  3W3D A;  3V1O A;  2FSK A;  2HND A;  2FBT A;  3K58 A;  4E3S A;  4CJ5 A;  3G71 N;  1S1X A;  3T19 A;  2DPN A;  4I6M A;  2P9L A;  3ZEU B;  1BWF O;  4CEB A;  3QLH A;  4L8R B;  4LF6 K;  4YOX A;  3LDL A;  3O9Q A;  2FLO A;  1VSE A;  1F21 A;  2HBM A;  5AZI A;  2YNG A;  3SPZ A;  4A2A A;  4DG1 A;  4DQQ A;  3VQ5 A;  3Q7C A;  4NB4 A;  1L3V A;  1N34 K;  5K14 A;  4ILJ A;  4J2A A;  3F5T A;  3HYF A;  3ZT4 A;  3B8A X;  4KHS A;  1UOC A;  1VQL N;  4E7L A;  1BA1 A;  1OVQ A;  1NGB A;  1LCU A;  1YUW A;  4OVL A;  5JS2 A;  4DQI A;  5FRN A;  4CF9 A;  5C0Y A;  4CJ4 A;  2P9I A;  4OPA A;  3AO5 A;  5CZ2 A;  3OJU A;  4KB1 A;  5FPD A;  1XC9 A;  1EO1 A;  5AQJ A;  3VEW A;  1Y97 A;  2EWS A;  4DLE A;  4CZF A;  4AM6 A;  3VF4 A;  1WSH A;  3L2U A;  4M41 A;  1QVG M;  2HVI A;  1BDG A;  3NDK A;  1YVU A;  1S1V A;  5BPN A;  5KPR A;  4LFC K;  4ID1 A;  3AVB A;  3AVH A;  3BY5 A;  2HHT A;  2W41 A;  4DV6 K;  2UUC K;  5JLH A;  1QQC A;  4BQL A;  5CR4 A;  3VTI A;  3QER A;  3L6Q A;  3Q7B A;  4JHD B;  4BRL A;  2OPS A;  2D0A A;  1A5X A;  3MEG A;  3ULE B;  1NGF A;  3VF6 A;  2H3G X;  3U3G A;  4B3M K;  3L0Q A;  3VEV A;  4GY2 B;  4OKE A;  1U04 A;  3CCV N;  3T1H K;  3C95 A;  2E20 A;  4KH5 A;  1RBR A;  3PLA A;  4JV5 K;  2A42 A;  4JI6 K;  1RTI A;  4BRC A;  3HST B;  5F1X A;  4DQ8 A;  3TAN A;  4W5T A;  3D2E B;  1GLJ O;  1VQ9 N;  2P9S B;  2QM1 A;  1ZYQ A;  3RRG A;  3V4I A;  4DR6 K;  3EKS A;  1IH7 A;  1RCH A;  4CJQ A;  1WBB A;  3A2F A;  2A5X A;  1SAZ A;  4BQZ A;  3O80 A;  4B1V A;  3TWH A;  4E0D A;  4U67 L;  4DQR A;  1HYV A;  3SK3 A;  3QB0 A;  3NBP A;  3NH2 A;  4EZ6 A;  3ZSY A;  4DV5 K;  1YJ9 N;  3LAN A;  2E2N A;  1XNR K;  3CJA A;  1W9H A; 
#chains in the Genus database with same CATH homology
 3MXJ A;  1KCF A;  1BQN A;  1Z26 A;  4KKO A;  4PY5 A;  3QEI A;  5C24 A;  3K5L A;  2X6S A;  2HMI A;  5C42 A;  4I9Q A;  3DOK A;  3SZ2 A;  3CM6 A;  3HT3 A;  2O4I A;  1LWC A;  5HRR A;  2GBZ A;  3LP3 A;  4CK3 A;  4DSJ A;  5J2Q A;  3FFI A;  1QSL A;  4E7J A;  1RDD A;  2I5J A;  2OA8 A;  4ZTJ A;  3OYG A;  3OYK A;  5J2N A;  1CXU A;  5DMR A;  3SUP A;  4QOZ B;  1JXB A;  3CFO A;  3DOL A;  2OPR A;  4HVJ A;  5HRN A;  3SV3 A;  1TKD A;  1ZBI A;  4ELT A;  4FM2 A;  2XY6 A;  1LAW A;  3DLK A;  4FJH A;  4CEQ A;  2Z1J A;  3LZI A;  3VQ8 A;  3L8B A;  2D5R A;  4M42 A;  1JKH A;  3B6O A;  1VSF A;  3RMC A;  2ETJ A;  2YHB A;  4OGE A;  4HCC A;  5CZ1 A;  2P5G A;  1IO2 A;  1S1T A;  3T3F A;  4DWI A;  4M3X A;  1CZB A;  1C0T A;  4CEZ A;  1VRT A;  2HNZ A;  2KQ2 A;  1HRH A;  4K8X A;  3AA3 A;  1C6V A;  1REV A;  5HRP A;  5I3U A;  1HQE A;  3OYM A;  1U48 A;  3DLH A;  4OLB A;  2FC0 A;  1TAU A;  4B9M A;  1NK5 A;  4DFM A;  3V9U A;  4C8O A;  4FJM A;  3K2P A;  2YHA A;  4BDZ A;  3ZSZ A;  3PV8 A;  1VSD A;  3S9H A;  3HVR A;  3DMJ A;  4CIG A;  1HYZ A;  4CER A;  4KV8 A;  3NH0 A;  1HNI A;  3O3G A;  1CXQ A;  1RT1 A;  1RTJ A;  2FBX A;  4M3Y A;  3IRX A;  4Z4H A;  4DU3 A;  3BDP A;  1G15 A;  4KI6 A;  3SYZ A;  2Z1I A;  5DK5 A;  2B4J A;  4O44 A;  3L2R A;  1IKY A;  3V9Z A;  3QET A;  1BGX T;  3DM2 A;  3VQC A;  3HPG A;  4JLH A;  2G8W A;  4B08 A;  3ULD A;  4CHO A;  1NKC A;  3KKS A;  3K5O A;  3V9X A;  1J54 A;  3QEW A;  1NJZ A;  2X78 A;  3DRS A;  3MED A;  1SKR A;  3ZSW A;  3NF8 A;  4Y1C A;  3OS1 A;  1KFS A;  4CEE A;  3IS9 A;  1BCM A;  4CEC A;  3VQD A;  3QEX A;  3U3Y A;  3I0R A;  1DTQ A;  2ITG A;  1BIS A;  3ZT1 A;  4CHZ A;  4QCL A;  3HPO A;  2P5O A;  3S3M A;  4O4G A;  2E6L A;  1JLC A;  1T8E A;  2RF2 A;  4N56 A;  2G8V A;  3RRH A;  4CGH A;  1C1B A;  3AVG A;  4FJI A;  1WSF A;  4DS4 A;  1D8Y A;  3RMD A;  1NK4 A;  2Z1H A;  1DLO A;  3PX4 A;  3NH1 A;  3LZJ A;  4Y1D A;  1VRU A;  3OYD A;  3OYE A;  1LV5 A;  4FZY A;  1MU2 A;  1KRP A;  1HMV A;  1WSG A;  4XIU A;  1RT6 A;  1RTH A;  3DYA A;  3L3U A;  4JRP A;  4B9U A;  2GV9 A;  4BWM A;  3VQP A;  3JYT A;  1RDC A;  3P1G A;  1NK0 A;  1UA1 A;  4CJR A;  1T03 A;  4DF8 A;  1JXE A;  3EYZ A;  4DS5 A;  3U6F A;  1XWL A;  4MFB A;  2IGI A;  4FJ9 A;  4FJG A;  4DTS A;  4FXD A;  1BQM A;  1K6Y A;  3LAM A;  4FK0 A;  2JGU A;  1UAX A;  3SJJ A;  5HRO A;  1S5J A;  1EP4 A;  4I2P A;  3VQ6 A;  4KHY A;  3SQ1 A;  3OYB A;  4ID5 A;  3M8R A;  1KLN A;  1UWB A;  2X6N A;  4OGC A;  3SQ2 A;  2VG5 A;  5KRS A;  1W0H A;  3BGR A;  4O55 A;  1L5U A;  1WSI A;  4BWJ A;  3QO9 A;  4KB0 A;  1JL2 A;  4B3O A;  1A5V A;  1TAQ A;  1WLJ A;  3EZ5 A;  2G8H A;  1FXX A;  4NCB A;  1KVC A;  4FVM A;  2QK9 A;  1KSP A;  3OYN A;  1WSJ A;  1WNS A;  3CG7 A;  1CZ9 A;  4AH9 A;  3RMA A;  1IKV A;  4QAG A;  5KI6 A;  3KK2 A;  4FJ8 A;  4O0I A;  2VG6 A;  2G8F A;  1ITG A;  5E41 A;  1WAF A;  4GMJ B;  3K59 A;  3S3O A;  4IBN A;  4PWD A;  1QHT A;  3AVM A;  2DY4 A;  1YTA A;  2XY5 A;  2A1R A;  4I9L A;  4F3O A;  3WNH A;  2O4G A;  2XY8 A;  4M3Z A;  4FJ5 A;  5HRS A;  3SUN A;  1NJX A;  1ASV A;  1HPZ A;  3AVI A;  3VQB A;  3ZCM A;  2KZM A;  4AHV A;  4DFP A;  4IKF A;  3HP9 A;  4CE9 A;  3OYL A;  3SUO A;  1R0A A;  2PYJ A;  4C8L A;  3TI0 A;  5KGW A;  4B8A B;  4IFV A;  3PX0 A;  1U4B A;  2G8U A;  1X9W A;  4LH5 A;  4KI4 A;  3QNO A;  4J2E A;  1KLM A;  1QS4 A;  3PUF A;  3K5N A;  3DI6 A;  4NYF A;  1NK9 A;  1SKS A;  4CJL A;  1L3S A;  1GOA A;  4OKJ A;  2E4L A;  5CY4 A;  1RT5 A;  4AHR A;  4FM0 A;  4F2R A;  4M3T A;  3IG1 A;  2P1J A;  4M3U A;  1UA0 A;  3HJF A;  4IDK A;  4O5B A;  3VN5 A;  4EP4 A;  3ZSQ A;  1HNV A;  4FK4 A;  4F3T A;  1RBS A;  1NKB A;  1RNH A;  4F8R A;  3O4N A;  3AO2 A;  1LWE A;  2OPQ A;  4KHW A;  1CLQ A;  3AVJ A;  4CF8 A;  3G0Z A;  3RWU A;  1X9M A;  2HNY A;  4DFK A;  4DTN A;  3VA0 A;  2RKI A;  1SUQ A;  1D5A A;  1ZBL A;  4FJ7 A;  3QIP A;  4ELU A;  1VK0 A;  2IC3 A;  2IDO A;  3PO4 A;  1TK5 A;  4CJV A;  2HW3 A;  4CGF A;  1S9G A;  4CEA A;  3SQ0 A;  2HHQ A;  1BL3 A;  3LDS A;  3OYJ A;  4W5O A;  4FCY A;  4K8Z A;  2KTQ A;  1KVA A;  4RW9 A;  5I42 A;  3ZT3 A;  3D0P A;  1NOY A;  1C0U A;  4RW7 A;  2Z1G A;  3NGY A;  3AA4 A;  1LWF A;  4KTW A;  4JRQ A;  4F2S A;  3WNE A;  4FJX A;  3CQ8 A;  1ASW A;  2EHG A;  3K5M A;  4DTM A;  1RTD A;  2PZS A;  2XO7 A;  3UIQ A;  3TAP A;  4KHU A;  3I0S A;  1VSH A;  3TAQ A;  1T7P A;  1RDB A;  4E19 A;  1S6P A;  2OYQ A;  4FM1 A;  2A1S A;  4HUE A;  4JS5 A;  4BAC A;  1ZBF A;  4NCA A;  4EZ9 A;  3CFR A;  4DMN A;  2OZS A;  3AVF A;  1ZBH A;  1RT3 A;  2QXF A;  3SI6 A;  3ZT2 A;  3HP6 A;  3VQQ A;  4Q0B A;  4KHN A;  3MEE A;  1IKW A;  1Z25 A;  4CFB A;  4CIE A;  1Q9Y A;  3HO1 A;  3TAR A;  3QNN A;  3SV4 A;  3AV9 A;  4H4M A;  3OS2 A;  2HHS A;  5HP1 A;  4FK2 A;  3OYH A;  4Z4C A;  1L3T A;  3V81 A;  2G8K A;  1BCO A;  4KRE A;  2YNI A;  3LP2 A;  4RW6 A;  4LSN A;  3KK1 A;  5JS1 A;  2EX3 A;  1XHX A;  4N5S A;  3VQA A;  3HM9 A;  4CES A;  2AJQ A;  1S1W A;  5J1E A;  1D9D A;  3MEC A;  1JLQ A;  4CGG A;  2QKB A;  3HVT A;  2YNF A;  4FLU A;  2IS3 A;  4CGJ A;  4M3W A;  1RDA A;  4DQS A;  3IAY A;  4C8N A;  1C1A A;  4CEO A;  1B92 A;  4B9S A;  4G1Q A;  4Z4F A;  2YV0 X;  3DLR A;  2WON A;  1RT7 A;  1TVR A;  2DFE A;  2YKN A;  2ZD1 A;  3LAK A;  3P5J A;  3QIO A;  2XHB A;  2ZQB A;  3QEP A;  5D3G A;  1XHZ A;  4KHQ A;  4HUF A;  2B5J A;  3O3F A;  5KTQ A;  3SPY A;  3AO1 A;  4PA1 A;  2X74 A;  3ZSR A;  3NF9 A;  4E1M A;  4ZHR A;  1TL1 A;  4DTX A;  4CIF A;  2XY7 A;  3L3V A;  4CHQ A;  3V6D A;  3MXM A;  3DRR A;  4NYN A;  3QIN A;  1RBV A;  4FLY A;  2Y1J A;  4DU1 A;  1SKW A;  1TGO A;  3NE6 A;  4FJL A;  1C0M A;  1KVB A;  3NF6 A;  3OYC A;  3KKR A;  1NKE A;  1O1W A;  1TKT A;  1SV5 A;  4CK1 A;  4FLW A;  3V9W A;  1S1U A;  2VG7 A;  4B9L A;  3OYI A;  3C6T A;  1TKZ A;  4KTZ A;  1VSK A;  2VWJ A;  4AHS A;  3ITH A;  1SL0 A;  1D9F A;  4AHC A;  3LWL A;  4NCG A;  3PO5 A;  3RMB A;  3C94 A;  2JLE A;  3NF7 A;  2F8T A;  2KW4 A;  4CCH A;  3M8P A;  3L2Q A;  1L3U A;  3LPT A;  2F8S A;  2HHX A;  3SCX A;  4TSX A;  2YNH A;  3QES A;  3KLI A;  1SL2 A;  4Z0U A;  2KFN A;  3M8Q A;  1DTT A;  1JLE A;  4DTR A;  4W5N A;  3KLE A;  3KJV A;  2DTU A;  4AHT A;  4OJR A;  4LD0 A;  3V1Q A;  3OYF A;  3NAE A;  1VSI A;  5T7B A;  1BI4 A;  4HUG A;  3S3N A;  1IG9 A;  4FLZ A;  1QE1 A;  3OS0 A;  2F96 A;  1BHL A;  1JLB A;  3G10 A;  1I39 A;  1WN7 A;  5CYM A;  3HXM A;  3KTQ A;  1RT2 A;  2XRI A;  1QSS A;  1NJW A;  3KD5 E;  1S6Q A;  4B8C A;  3NHG A;  3OVN A;  1WSE A;  3VQE A;  3NGZ A;  4M3R A;  4CJU A;  1A5W A;  1JLG A;  4E7H A;  4CJ3 A;  3PX6 A;  4N76 A;  1Q9X A;  2Q3S A;  4BDY A;  4DTU A;  3F9K A;  3KLG A;  4DTJ A;  5J2P A;  1NK6 A;  2KZZ A;  3ZSO A;  4AIL C;  3SNN A;  3HPH A;  3AVL A;  3OJS A;  2BE2 A;  3QEV A;  4YFU A;  4I2Q A;  5HBM A;  4ZTF A;  4KTQ A;  1U49 A;  5CYQ A;  1J53 A;  4Z4I A;  1B9D A;  2RN2 A;  3LP0 A;  4OPK A;  2D0B A;  3B6P A;  3HL8 A;  1FKO A;  1QSY A;  1QTM A;  2D0C A;  4PUO A;  4RG8 A;  3TAB A;  4FJN A;  3KK3 A;  4CHN A;  1LAV A;  4HTU A;  4LY7 A;  4CJW A;  3ASM A;  3EY1 A;  4OPJ A;  1YT3 A;  4ELV A;  1HQU A;  3AO3 A;  4CHP A;  4OLA A;  2RPI A;  4DSI A;  2ZE2 A;  4UQG A;  5FDL A;  3V1O A;  2HND A;  2FBT A;  4CJP A;  3K58 A;  4E3S A;  1N6Q A;  4CGD A;  1FK9 A;  3VQ7 A;  1S9E A;  1TKX A;  4CJ5 A;  1X1P A;  4CJS A;  1S1X A;  4Z4G A;  3ZSX A;  2PYL A;  3T19 A;  3RR8 A;  4FJJ A;  3AVK A;  3M8S A;  2HHV A;  2DFH A;  4CEB A;  1VSJ A;  4HHT A;  3QLH A;  4DSF A;  4J2D A;  4L8R B;  3E01 A;  3P83 D;  2LSN A;  1ASU A;  4I7F A;  2R7Y A;  1Q8I A;  4BE0 A;  2HVH A;  2YKM A;  2Y1I A;  1N5Y A;  3DLE A;  4CJK A;  4GVM A;  3V1R A;  3TAF A;  1VSE A;  2KFZ A;  1F21 A;  4ICL A;  2OPP A;  5J2M A;  1EXQ A;  4DSK A;  2YNG A;  4MQ3 A;  2IAJ A;  3WNG A;  1EX4 A;  4E7I A;  4DTP A;  1U45 A;  3SPZ A;  3WNF A;  3KIO A;  4DG1 A;  4DQQ A;  3O4Q A;  3TR8 A;  3ISN C;  3VQ5 A;  1L3V A;  5SZT A;  4IG0 A;  5K14 A;  4LH4 A;  2VWK A;  4B9V A;  4KO0 A;  2HB5 A;  4DTO A;  4F4K A;  4J2A A;  1EET A;  3HYF A;  4RW8 A;  3CFP A;  4E7K A;  3SUQ A;  3KLH A;  2FBV A;  4RW4 A;  3ZT4 A;  3ZT0 A;  4DLG A;  4HCB A;  4KHS A;  2P51 A;  4CFC A;  4DF4 A;  1UOC A;  4BDP A;  3AA5 X;  4Q5V A;  4E7L A;  3RR7 A;  4CED A;  1U47 A;  2BGG A;  4CJT A;  1C1C A;  4EP5 A;  5EU7 A;  1ZBU A;  1KFD A;  1BI4 B;  4OVL A;  5JS2 A;  3OYA A;  4KAZ A;  4N41 A;  4DQI A;  5FRN A;  3V9S A;  1SL1 A;  4KRF A;  4CF9 A;  4CJ4 A;  4OKK A;  3AO5 A;  4C8K A;  3KD1 E;  5CZ2 A;  3F73 A;  4CF2 A;  3OJU A;  4KB1 A;  4W5R A;  4DSL A;  1XC9 A;  1TL3 A;  5SWM A;  5FRO A;  1Y97 A;  4DLE A;  4R5P A;  4E1N A;  1J9A A;  2FBY A;  3VQ9 A;  1WSH A;  3L2U A;  4M41 A;  5FRM A;  1XI1 A;  4CGI A;  2DFF A;  3L2W A;  2HVI A;  3PY8 A;  3MAQ A;  3NDK A;  1YVU A;  1HJR A;  1TV6 A;  3CM5 A;  4JS4 A;  3AVA A;  3TAE A;  1S1V A;  2W42 A;  3KLF A;  3C6U A;  4ID1 A;  3AVB A;  3AVH A;  2HHT A;  3ALY A;  4C8M A;  1RBU A;  3ZSV A;  1QQC A;  1RBT A;  3O3H A;  4FW1 A;  3I8D A;  3VA3 A;  3QER A;  4DQP A;  4J2B A;  4FZZ A;  4DU4 A;  4Z4E A;  2OPS A;  4CFD A;  2D0A A;  1A5X A;  1BIU A;  3MEG A;  3HK2 A;  4FW2 A;  3TAG A;  4FYD A;  4PQU A;  3DLG A;  3JSM A;  5C25 A;  3U3G A;  1J5O A;  1B9F A;  1TK8 A;  3TAM A;  3AVC A;  3LPU A;  4E89 A;  3K57 A;  4H8K A;  1NK7 A;  2HHW A;  3RTV A;  1BIZ A;  4CF1 A;  4OKE A;  4FLV A;  4KPY A;  1U04 A;  4CJE A;  3T1A A;  3C95 A;  1TK0 A;  2GUI A;  3NFA A;  4AHU A;  1NJY A;  1T05 A;  4DFJ A;  2ATQ A;  1RBR A;  1RIL A;  1RTI A;  3LP1 A;  3HST B;  3CYM A;  1X9S A;  2BAN A;  1LW2 A;  1FKP A;  2HHU A;  3TAN A;  3AO4 A;  4W5T A;  4N47 A;  4CFA A;  1GOB A;  3LWM A;  2OZM A;  4FJK A;  3THV A;  3H08 A;  1VSM A;  4CF0 A;  4CK2 A;  1JLA A;  1VSL A;  4FZX C;  2WOM A;  4LSL A;  3DLB A;  4O0J A;  1NK8 A;  5HLF A;  4B9T A;  4YNQ A;  1ZYQ A;  4B9N A;  4BE2 A;  2E6M A;  4CHY A;  1WAJ A;  4FLX A;  4KFB A;  3V4I A;  3MXI A;  2PY5 A;  3RRG A;  4CEF A;  4H4O A;  1NOZ A;  1IH7 A;  2NUB A;  4WE1 A;  1JL1 A;  1IKX A;  1RCH A;  3AA2 A;  2IOC A;  3AVN A;  4CJQ A;  2BDP A;  4M45 A;  3A2F A;  4BE1 A;  3L2V A;  2B6A A;  3OY9 A;  3TWH A;  4E0D A;  1KTQ A;  4GW6 A;  4DQR A;  1HYV A;  4W5Q A;  4IFY A;  1YTU A;  2QKK A;  3NCI A;  1EKE A;  3NBP A;  4CJF A;  1JLF A;  5KRT A;  4DSE A;  3SQ4 A;  1LW0 A;  3NH2 A;  3VQ4 A;  3DRP A;  4EZ6 A;  2G8I A;  4IG3 A;  3ZSY A;  3NGI A;  3LAL A;  4FLT A;  3LAN A;  1RT4 A;  3D45 A;  1HYS A;  1I3A A;  1GOC A;  5KGX A;  1W9H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...