3V9WA

Crystal structure of rnase t in complex with a preferred ssdna (tta) with two mg in the active site
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
202
structure length
202
Chain Sequence
GLCDRFRGFYPVVIDVETAGFNAKTDALLEIAAITLKMDEQGWLMPDTTLHFHVEPFVGANLQPEALAFNGIDPNDPDRGAVSGYEALHEIFKVVRKGIKASGCNRAIMVAHNANFDHSFMMAAAERASLKRNPFHPFATFDTAALAGLALGQTVLSKACQTAGMDFDSTQAHSALYDTERTAVLFCEIVNRWKRLGGWPLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title How an exonuclease decides where to stop in trimming of nucleic acids: crystal structures of RNase T-product complexes
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/dna
molecule keywords Ribonuclease T
total genus 59
structure length 202
sequence length 202
chains with identical sequence B, C, D
ec nomenclature ec 3.1.13.-:
pdb deposition date 2011-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00929 RNase_T Exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3v9wA00
4CGFA 3L2UA 4BWJA 4FM0A 3QETA 4KHWA 3LPUA 3DRSA 1B92A 3DLGA 1RDAA 4FJLA 3L2WA 3K2PA 1J54A 4M42A 1VRUA 3L3VA 2IGIA 1VSDA 4DS4A 1D9FA 1XWLA 4J2DA 5I3UA 1SL1A 3NH2A 1SL0A 4FK0A 5EU7A 2B4JA 3SPZA 4JS4A 4FM2A 1L3SA 2DY4A 1WAFA 4E89A 3HPOA 3OY9A 3DLHA 1J5OA 4ELVA 3T1AA 2HVHA 3NGZA 3IRXA 4FK2A 4DQQA 1BL3A 2VG5A 2HHQA 4I9QA 3VQEA 4BE2A 2G8IA 3VQ6A 4PA1A 4OKEA 4Y1DA 4FLZA 2ZQBA 3NAEA 1X9MA 2FBTA 3MEEA 4FYDA 4E7KA 3VQ4A 4FJMA 3NHGA 4M3TA 1D9DA 4CCHA 4FJXA 4W5TA 2BANA 3IG1A 1IKVA 4B9UA 4AH9A 4CIEA 2IC3A 2P5OA 4LY7A 2B6AA 1NKBA 4FW1A 2XY6A 3SV3A 3CFPA 4DU4A 2QK9A 4G1QA 2O4IA 2OPRA 3LDSA 2JLEA 1ASWA 3EZ5A 1NKCA 4ELUA 4BDZA 4IKFA 2XHBA 1JLEA 4O44A 3HO1A 1HPZA 4AHUA 3ULDA 3KD5E 4ID1A 2D0CA 2KFNA 4C8LA 4I2PA 3KLGA 3K57A 1S5JA 3RMDA 2D0BA 1ZBLA 1JLFA 3C95A 1TL1A 2P1JA 3K5MA 3MXIA 4CEOA 4I2QA 4BE1A 4K8XA 3QO9A 4KREA 2Q3SA 2G8FA 4B8CA 4KB0A 3BDPA 4Z4IA 3M8QA 4RW4A 2HHUA 4FJHA 4PUOA 1UOCA 5HRRA 2HNYA 1EP4A 3SQ0A 5HROA 1DTTA 3F73A 1L3UA 4CJUA 1SUQA 3ZSZA 1NOZA 4CJEA 3NE6A 3K58A 1I3AA 3MEGA 2VWJA 2VG7A 3VQAA 4B9TA 3RR8A 4CE9A 4Q0BA 4KTWA 4CF1A 2GBZA 1CXUA 1JXBA 3HPGA 2EX3A 4KI4A 4M3UA 3AVLA 4RW8A 1HQEA 3HVRA 3CM6A 2KW4A 1UA0A 1T8EA 3NGIA 4Z4FA 3PX6A 1S9GA 4CJRA 3PX4A 2Z1JA 3VQ7A 4CERA 3OYEA 1EKEA 1NKEA 5JS1A 1GOAA 2ZE2A 1O1WA 2YHAA 3ZSVA 5KGXA 1VSLA 3O3HA 4F3TA 1KFSA 3ALYA 2E6MA 3AO1A 4KTZA 4DSLA 4FCYA 1C1CA 1LWFA 1JLBA 5CZ2A 4EZ6A 4DTPA 4I9LA 1FKPA 1HRHA 3DLEA 4NYFA 5JS2A 2DFFA 1KCFA 2X74A 4CK1A 3HXMA 1WLJA 2GV9A 1RBVA 1C6VA 3QNOA 3NH1A 3CQ8A 4FZXC 1VK0A 3SQ1A 4DFKA 1Q9YA 4RG8A 3SCXA 2B5JA 3AVHA 3FFIA 1TL3A 3QEWA 1ASUA 1NK8A 1ASVA 3C6TA 3PY8A 4DTUA 1T7PA 4XIUA 3QEIA 3QEPA 1ZBHA 1LW2A 1JKHA 4CHOA 2ITGA 1KFDA 3AVBA 3AA2A 3HPHA 3AA4A 3OYMA 3VQDA 5HP1A 1KVBA 3SUOA 2W42A 4HUEA 5HLFA 4ZTJA 1JLGA 3AO3A 3F9KA 1RBSA 3VQCA 3NCIA 4J2AA 1N5YA 3OYBA 1S1WA 4DTSA 1U47A 4H4OA 2XRIA 2OPSA 2IDOA 2VWKA 3MEDA 2AJQA 4CEDA 1VSHA 4OGEA 1RILA 3ZSYA 4DQRA 3SPYA 2O4GA 2E6LA 3TAPA 3C94A 4F2RA 1IKWA 1JL2A 3QIOA 5HRPA 3S3OA 1EETA 3E01A 4OJRA 3VA3A 3TWHA 4QAGA 3HJFA 1Z26A 5SZTA 1S1TA 1CZ9A 2I5JA 2YV0X 4CHQA 4QCLA 1RBUA 4W5QA 3OYJA 1JXEA 4B9NA 4CJLA 4FJNA 1C0TA 2YKMA 4O55A 4CFBA 2EHGA 1CZBA 4IDKA 3NF7A 3OS1A 3KTQA 4FJ5A 3P5JA 4J2EA 4NCBA 2LSNA 3U3GA 3BGRA 1JLAA 3ZT3A 4E19A 4CHYA 2DFHA 1T03A 3AVKA 1QSLA 4CESA 3V9XA 4DSJA 3RMBA 3DYAA 4CJ3A 4ZHRA 3D0PA 4BWMA 4IBNA 4CIGA 1G15A 3LALA 4OGCA 3VQ5A 4B8AB 3LZIA 3H08A 1Q9XA 4E7IA 1VSFA 1X1PA 3VQPA 3KLEA 3S3MA 2P5GA 3AVMA 5FRMA 1Q8IA 4JS5A 1CLQA 1TKZA 1S9EA 1K6YA 2IS3A 1BCOA 3SUNA 4DG1A 1VSEA 4H4MA 4EP5A 1IKYA 4DF4A 2DTUA 3VQBA 3DLKA 3NBPA 1NJYA 2YHBA 1WNSA 3ISNC 4KFBA 3P1GA 4M3ZA 1QS4A 2F96A 3OYNA 5FDLA 3PX0A 1WSEA 4PQUA 3ZT1A 1VRTA 4DFPA 4N47A 1LAWA 1WSFA 3ZT2A 3KK2A 3TAGA 4W5NA 2QKKA 3CYMA 4GMJB 3AA5X 3AVJA 2ZD1A 3TAEA 1QE1A 4CEBA 3KLHA 4B08A 3CFRA 4CFAA 3V1RA 3CFOA 3TARA 4DSEA 4FJIA 4O4GA 2Y1JA 2YNGA 4DLGA 4KI6A 2HW3A 4CJKA 1RBRA 4KKOA 4GVMA 4ZTFA 1BQNA 1NJXA 1F21A 4O0JA 4CGGA 4UQGA 1KLMA 4R5PA 1TKTA 1NK5A 1S1XA 1TK8A 3DOLA 3ITHA 3OYGA 5C25A 1SV5A 3QIPA 4YNQA 1NK7A 1C1BA 5KRSA 3V1OA 4OPKA 3TANA 2GUIA 1U48A 4B9LA 4DQSA 4DQIA 1L3VA 1HYZA 1FXXA 5KI6A 3ZSRA 4FW2A 3OYDA 1NOYA 1WSGA 4E1NA 4Q5VA 3SUQA 4FJ9A 4NYNA 3U6FA 3EY1A 2QXFA 3LPTA 4O0IA 3L2QA 3HM9A 4M3YA 3OYIA 2F8SA 4IG3A 3WNEA 4NCGA 3RRGA 3ZSOA 4GW6A 5SWMA 2RF2A 3AVNA 5CZ1A 4FZZA 4KPYA 4BDYA 1WSHA 4KHUA 3V9WA 4DU1A 3NF9A 3SYZA 3OYCA 3TI0A 3O4NA 4AHVA 3A2FA 4KHSA 2FBXA 2HHWA 1U45A 4ELTA 2P51A 1HNIA 3LP3A 4KHYA 3KIOA 3T19A 1RTJA 2WONA 3K5LA 3WNHA 4M3WA 1XI1A 4DQPA 1ITGA 4DTMA 1YTAA 1UA1A 2X6SA 1HYVA 1DTQA 3DI6A 2HHTA 1IH7A 1NJZA 1R0AA 1FKOA 1SKWA 2Z1GA 1QTMA 3HSTB 1KSPA 3ZSQA 1TV6A 3JYTA 4KTQA 4DTNA 5J2QA 1GOBA 4OKJA 1TK5A 2F8TA 1B9FA 4HVJA 1BHLA 1NJWA 4KV8A 1SKRA 4AHCA 3OYAA 1TAUA 1RBTA 4JRQA 5J2PA 3DLRA 1RT1A 3K5OA 3V9SA 4E7LA 4FLXA 3KJVA 3HT3A 2YKNA 3KLIA 4CJPA 1SL2A 3C6UA 4B9VA 1VSIA 3SV4A 3AO2A 2KTQA 4RW7A 1LV5A 4RW9A 4CJVA 1KVCA 4CEEA 3L2VA 4FZYA 1UAXA 1A5XA 1S6QA 3AA3A 4LH4A 4O5BA 5J2MA 5J2NA 3MXMA 4M45A 1RT7A 2X78A 4CGHA 3LWLA 4DTJA 2XY5A 1X9WA 3IS9A 1YTUA 1RT5A 3LP1A 5DK5A 5I42A 4TSXA 4N41A 4AHRA 1YVUA 3LP2A 4CFCA 3AO5A 3PO4A 3LANA 2HHSA 4LSLA 4F8RA 1EXQA 1GOCA 1W0HA 3QEXA 1IKXA 1RT2A 3DRRA 4M3RA 1LW0A 3HL8A 1LWEA 3HYFA 4EP4A 4CF2A 3M8PA 3KK1A 3AVGA 2NUBA 5HRSA 2OZSA 4OLBA 4FM1A 4FLYA 1Z25A 3DM2A 2HMIA 4DFMA 5CY4A 5DMRA 1ZBFA 4YFUA 3TAFA 1XHXA 4DSKA 4Z4GA 4C8MA 1S6PA 1ZBUA 4E7HA 1RDBA 1S1UA 3KD1E 4QOZB 3G0ZA 4KRFA 1A5VA 1FK9A 3OYFA 4E3SA 2Y1IA 2A1RA 3OYLA 4DSFA 4CF9A 1NK6A 3NGYA 2XY7A 3TR8A 4CJTA 4BE0A 4FK4A 3AVCA 3RR7A 1HQUA 4DTRA 1NK9A 4CEFA 2OA8A 1U49A 4FXDA 4W5RA 4NCAA 2HHXA 1RDDA 3D45A 4CJFA 3LZJA 2RN2A 4IFVA 4OVLA 4DS5A 3L2RA 4CJSA 1NK4A 1IG9A 4KHQA 5HBMA 5C24A 1T05A 2KFZA 3I0SA 3U3YA 4Y1CA 4CJ4A 3B6OA 3LAMA 3LWMA 1TAQA 4HUGA 4IG0A 3O3GA 2A1SA 2YNHA 5D3GA 3RMAA 5CYQA 4FLTA 4FJ8A 4OKKA 2R7YA 1ZBIA 4C8OA 3QLHA 4CHPA 1MU2A 1BISA 3DMJA 1WN7A 4IFYA 4K8ZA 1BI4B 1BGXT 4I7FA 1TGOA 4Z4CA 3KKRA 1JLQA 2HVIA 3ZSXA 5C42A 3NH0A 4MFBA 4DWIA 2KQ2A 1LAVA 3SNNA 2IOCA 4CK2A 2G8WA 1U04A 3VN5A 4AHTA 4JRPA 1I39A 4C8KA 3QERA 3KKSA 3QEVA 3VQQA 3NF6A 4CHNA 4CGDA 4Z4EA 3NF8A 3WNGA 4Z0UA 3RMCA 2WOMA 4M3XA 1BIZA 3S9HA 3NFAA 3OJSA 1DLOA 1WAJA 3QINA 4CGIA 3K5NA 2HHVA 4HHTA 3HP9A 5KRTA 1BCMA 1RT3A 4WE1A 3SI6A 4F2SA 3M8SA 5KGWA 1KRPA 4W5OA 2JGUA 1WSJA 4B9MA 5K14A 4OLAA 2Z1HA 1L3TA 4LSNA 4HUFA 4CK3A 3LP0A 3THVA 1BIUA 3MXJA 4FJGA 1IO2A 1HYSA 3EYZA 4CIFA 4HCBA 4CEQA 3OS2A 4F3OA 1C0UA 1NK0A 4KB1A 1J9AA 3OS0A 4E7JA 1XHZA 3V9ZA 1REVA 1RTIA 2E4LA 2PYJA 4CGJA 1QQCA 4BACA 2HNZA 4MQ3A 3RWUA 3HVTA 3OVNA 4DTXA 1XC9A 5HRNA 4N76A 1U4BA 2FBVA 3LAKA 3PV8A 1L5UA 1CXQA 3HP6A 4DU3A 4FJKA 2YNIA 1RT6A 4B3OA 3VQ9A 4N5SA 4HTUA 3VA0A 2OPQA 3V6DA 2FBYA 4H8KA 1RTHA 4ICLA 3ZT0A 4DTOA 2G8HA 2RKIA 2BGGA 2G8KA 1KLNA 4HCCA 1A5WA 4CJWA 2ATQA 4LD0A 1B9DA 4CEZA 3ASMA 3RRHA 1N6QA 5E41A 1TKXA 1QHTA 1TVRA 2QKBA 2ETJA 3B6PA 1HMVA 3TAMA 3KK3A 1D8YA 3AVAA 1RDCA 4DFJA 2D0AA 2X6NA 4FJJA 1C1AA 4CF8A 3PO5A 3VQ8A 4FJ7A 1J53A 1S1VA 3TAQA 4DMNA 4EZ9A 1RT4A 3ZSWA 3T3FA 2IAJA 1KTQA 1TK0A 1D5AA 1HJRA 4J2BA 3V81A 4L8RB 2XO7A 1JLCA 2OPPA 3DOKA 1HNVA 3V4IA 3OYKA 4CJ5A 3QNNA 5J1EA 1W9HA 3QESA 2KZMA 4JLHA 3ZT4A 4BDPA 4E1MA 1BQMA 4LH5A 4PY5A 3JSMA 4CECA 2DFEA 2FC0A 3OJUA 2KZZA 3TABA 1RNHA 1ZYQA 2HB5A 1VSMA 5FROA 2BE2A 3DRPA 4M41A 3UIQA 3MECA 3AO4A 4C8NA 3WNFA 3PUFA 4DF8A 4AHSA 1SKSA 2XY8A 3AV9A 2VG6A 3V1QA 2Z1IA 1RCHA 2OYQA 4KHNA 4KO0A 3O4QA 3I0RA 3SUPA 1WSIA 3SJJA 3AVIA 1KVAA 2YNFA 3SQ2A 1RTDA 1QSSA 3CG7A 3IAYA 3ZCMA 1EX4A 3HK2A 4E0DA 3MAQA 3G10A 4OPJA 4FVMA 4CHZA 3I8DA 1Y97A 4FLUA 4DLEA 1YT3A 4Z4HA 2PZSA 3NDKA 4CF0A 4KAZA 4FLVA 4PWDA 2HNDA 1C0MA 1JL1A 2RPIA 1BI4A 1UWBA 5KTQA 3OYHA 3RTVA 3CM5A 2OZMA 4CJQA 4B9SA 2D5RA 3KLFA 4CEAA 1LWCA 3SZ2A 3L8BA 1VSKA 1X9SA 3M8RA 4CFDA 4RW6A 4N56A 3AVFA 3SQ4A 4ID5A 3O3FA 4FLWA 4AILC 1QSYA 3S3NA 2BDPA 1VSJA 3DLBA 4F4KA 5FRNA 1TKDA 2PYLA 3P83D 3L3UA 5CYMA 5T7BA 3K59A 2G8UA 2PY5A 4DSIA 2G8VA 3V9UA
chains in the Genus database with same CATH superfamily
4BWJA 3DRSA 1B92A 3DLGA 1RDAA 4B1YB 1J54A 5LL6Z 1D9FA 2NRVA 5I3UA 2W41A 1SL0A 1KD1O 4FK0A 1T3VA 4FM2A 2DY4A 3CCMN 5LJWA 1J5OA 3FFKB 2GUPA 1KAYA 3TSPA 3A8YA 1IJJA 2HHQA 3VQEA 4CVNE 3VQ6A 4FLZA 4OKEA 2ZQBA 3EO3A 3MEEA 3K0SA 3CXCM 3VERA 4AH9A 3OTOK 4JV5K 5F0XA 2P5OA 2B6AA 4FW1A 2XY6A 3SV3A 4CZEA 3CFPA 2QK9A 1N32K 2VQFK 3M3ZA 2F9WA 4ELUA 4BDZA 3KD5E 4ID1A 2HF4A 4XH1A 3FZLA 4C8LA 4RCHA 2D0BA 5AQXA 1JLFA 5IT9O 2P1JA 3L4QA 4PKIA 3MXIA 4I2QA 4WQ5C 5AR0A 3HOTA 2Q3SA 2G8FA 3Q7CA 3CQYA 3SMPA 2ASPA 5HROA 1VQ7N 3ZSZA 3NE6A 4B9TA 3MEGA 4CE9A 3TTFA 1FJGK 4CZMA 5F2RA 2PBDA 3WQUA 4Z4FA 1MDUB 3GOIA 3OYEA 4JYAK 3O3HA 2ZE2A 4CZLA 3WT0A 2NRHA 5AQWA 3CC7N 3A0IX 4FCYA 1LWFA 1QHAA 4DTPA 4I9LA 3DLEA 4CK1A 3HXMA 1ATSA 1N34K 4FZXC 4BRDA 2P9UB 4H0OA 4QS9A 2E8AA 3LDOA 1ZBHA 3ENHA 3QEIA 3NMUA 1LW2A 1JKHA 4B3RK 3AA4A 2WTUA 4HUEA 3F2KA 3AO3A 3UKUB 3CCUN 3F9KA 1RBSA 3NCIA 1S1WA 3ZX0A 4H4OA 4BRCA 3A5LC 3MEDA 3P4IA 3O9TA 5C12A 1VSHA 3AGKA 3EKSA 4FWPA 4YORA 4F2RA 1JL2A 3VA3A 1Z26A 4CZFA 1S1TA 3CJCA 4PL8A 4QCLA 1Q82O 4FJNA 4IEEA 1JXEA 4B9NA 4CJLA 4O55A 3KTQA 4IDKA 3EE8A 4FJ5A 1YTUA 4OLBA 4CHYA 1T03A 2OTLN 1VQKN 3V9XA 1T44A 2I7NA 4ZHRA 2QM1A 3LALA 4OGCA 4ISGA 3O4WA 4E7IA 3VQPA 2P5GA 3AVMA 1CLQA 1S9EA 1YF5L 1BCOA 2P9NB 4WQ5A 3CC4N 4V19S 4H4MA 5GAEP 3H3NO 4DF4A 3EL2A 3VQBA 2FSNA 2YHBA 4LF8K 3ISNC 4A61A 3P1GA 4JKBA 4M3ZA 4GNIA 4BQZA 5CHIA 1NMDA 3CI5A 1XMQK 3WXJA 1WSEA 3O9QA 3ZT1A 1VRTA 4N47A 1LAWA 5KPZA 3CYMA 4DUZK 2ZD1A 3KLHA 4Z94A 2YNGA 4CJKA 1NJXA 4CGGA 2ASMA 4F9OA 4FWKA 5JLHA 4JEPA 3QIPA 1NU0A 3TANA 3V1OA 4B9LA 3U8XA 3ZSRA 1NOYA 3SUQA 4NYNA 3U6FA 2FSKA 4JKCA 5ADXA 4BRAA 4O0IA 2F8SA 3BUZB 2JWLA 1IBKK 1T6DA 5CZ1A 4FZZA 4KPYA 4BR7A 4BDYA 3OYCA 1HKGA 3HSCA 4BVOA 2YJFA 2HHWA 4ELTA 1HNIA 4LC9B 4EAHD 4C23A 3KIOA 3T19A 3K5LA 1XI1A 4DTMA 1P90A 2HHTA 2KLAA 1FKOA 1SKWA 2Z1GA 1QTMA 3ZSQA 1TV6A 4OKJA 1TK5A 1B9FA 4HVJA 1BHLA 4G9ZA 3E9PA 2WBNA 4BRGA 1TAUA 4BR2A 4X66K 3OW2M 3DLRA 3K5OA 3V9SA 4CJPA 1SL2A 2NLXA 5AQPA 5ADXH 4RW7A 5H1SQ 4BG8A 3L2VA 4FZYA 1A5XA 1NGJA 5AJ3K 1ILYA 1RT5A 3LP1A 4N41A 1YVUA 2ZF5O 3PO4A 3LANA 3J81O 1IKXA 1RT2A 4YDUC 4GV3A 4EIAA 5DM7L 1BG3A 3KWIA 2BH1A 1WOQA 4BREA 5HRSA 2OZSA 4NLBA 1Z25A 2HMIA 4YFUA 5AQHA 4KRFA 1ATRA 3FZFA 2Y1IA 3C7NB 4H0PA 4I6MA 1NK6A 3TR8A 4BE0A 4YOVA 4FK4A 1NMNA 2IVOA 1NK9A 2O8CB 3QICA 2AA4A 3BP8A 3LZJA 4DS5A 3I55N 4B1XB 4CJSA 1IG9A 4JK9A 5HBMA 3C7NA 3U3YA 5EXWA 5AQJA 4FWNA 3LAMA 1XC3A 1J5EK 2Q0RA 5D3GA 2YNHA 3RMAA 5CYQA 4FWRA 4DR3K 2P9SA 4FLTA 3THYB 3QLHA 2D4WA 4LF6K 1MU2A 4NO7A 1QZ6A 1WN7A 4IFYA 4DB3A 1BI4B 1U6ZA 3Q7BA 1NGCA 3I56N 4M7XA 4DWIA 2KQ2A 1LAVA 3BF1A 3EKUA 3L6QA 1U04A 3VN5A 1I39A 3QEVA 3VQQA 4Z4EA 4O8KA 3NF8A 3RMCA 4M3XA 2QI2A 1DLOA 4CGIA 4HHTA 3SI6A 3VESA 5KGWA 1KRPA 2JGUA 4B9MA 5K14A 1L3TA 4HUFA 3LP0A 1OVYA 4HCBA 3OS2A 4F3OA 4KB1A 1XHZA 3RSEA 2NZTA 2E4LA 2PYJA 4BACA 3SAHA 3HVTA 3OVNA 5EOYA 4DTXA 1NBWA 1QQOA 3HP6A 1X3MA 2FF3B 2OPQA 4H8KA 3R3LA 4DTOA 4IXCA 1BO5O 5FPNA 1KLNA 4HCCA 2P9LA 4CJWA 2ATQA 4LD0A 1B9DA 1K9MO 3ASMA 4RWTA 5AQGA 1TKXA 3B6PA 3TAMA 3JAMO 3AVAA 3F5TA 4YOUA 1C1AA 2Q1NA 2ZJPL 3TAQA 4EZ9A 1KTQA 1HJRA 4KBOA 5EVZA 1JLCA 2OPPA 2BUPA 3OYKA 4AQYK 1W9HA 3CHWA 4WF9L 4BQLA 2KZZA 3JSMA 4CECA 2DFEA 2FC0A 2E88A 1K8AO 5FROA 3UIQA 2YHXA 3I8BA 3WNFA 3PUFA 5I9EB 2VG6A 2OYQA 4KO0A 2HHXA 1VQ8N 3AVIA 3SQ2A 3ZCMA 4E0DA 2CH6A 4BC3A 2PZSA 1YT3A 1YI2N 3KHYA 1E4FT 2HNDA 1BI4A 5ELZA 1UWBA 5KTQA 4B9SA 4DQ8A 3KLFA 3VEVA 1LWCA 3SZ2A 5FPEA 4RW6A 4ID5A 3HZ6A 1QSYA 4GY2B 2A6AA 3K59A 1RFQA 1YIJN 4CGFA 1IV0A 5AQSA 3L2WA 3K2PA 4H0XB 1VRUA 3W0LA 2IGIA 5C15A 1ATNA 1VSDA 1BU6O 1SL1A 3SPZA 1WAFA 4E89A 4LF9K 3HPOA 3OY9A 3DLHA 2UXCK 5JMVA 3IRXA 4DQQA 2VG5A 1KAXA 4I9QA 4BE2A 1NLVA 2G8IA 1X9MA 4DUYK 2FBTA 4E7KA 3NHGA 4DR7K 4FOEA 2QWMA 3IG1A 1NGDA 3HI0A 3MN6A 4O8UA 4BGAA 1NKBA 4B3TK 2GWKA 4DU4A 4G1QA 2YHWA 2O4IA 2OPRA 4IWVA 2JLEA 1ASWA 4IKFA 2E2QA 1JLEA 4JI7K 3VTIA 1DEJA 3OA9A 3K57A 4CD3A 1U2VA 3C95A 5DM6L 4EHUA 4KREA 4XEIA 3D2FA 3KVGA 4WFBL 4RW4A 1S72N 3H1QA 4PHTX 2KHOA 4WQ4C 3DXMB 3EN9A 3SQ0A 4DHYA 1DTTA 1L3UA 3K58A 2HW3A 1I3AA 3WXIA 3RR8A 1VQ6N 4CF1A 3HPGA 2ZGZA 1HQEA 3HVRA 3IKMA 1T8EA 3AGRA 1T6CA 1S9GA 3U9DA 5JS1A 1OH5A 1HKBA 5AQNA 1O1WA 4ISFA 3ZSVA 4A2BA 1VSLA 1TYQB 4B1WB 5AQTA 3O9SA 2P9UA 1NGBA 3QFPA 3G25A 3DXMA 3THWA 1C0GA 3U4LA 3CCJN 1HRHA 5JS2A 1HLUA 1C6VA 1HJOA 3MWPA 4BR9A 3E66A 4ILHA 3SQ1A 5M1PA 4DFKA 2O8BB 3CCLN 3SCXA 2B5JA 3AVHA 3QBWA 2GTDA 1TL3A 2HSTA 1ASVA 3C6TA 5MLCQ 3PY8A 4XIUA 4H5WA 4CHOA 1RDUA 1KVBA 2NNWA 5HLFA 3PLAA 3QDKA 4H0YB 2HBJA 3MX5A 3VGMA 3CF5L 4J2AA 1N5YA 4DTSA 2CGLA 2OPSA 1R59O 1OH6A 2HBKA 4CEDA 4OGEA 3SBGA 3TAPA 1EETA 3C6AA 4OJRA 4JK7A 5SZTA 1CZ9A 2I5JA 4CHQA 3IMXA 2YKMA 5CR4A 2EHGA 4CFBA 3TTCA 3OS1A 2NRTA 3P5JA 2V52B 3ZT3A 4CESA 3DXKA 4J8FA 4CJ3A 4C1NK 3B8AX 3LZIA 4DV1K 3A5OC 3H08A 3MN5A 3FE1A 2E5LK 3KLEA 4H5VA 1TKZA 3SAGA 4JKFA 2IS3A 1VSEA 3IUCA 1N33K 2QWLA 4EHTA 2UXDK 3DLKA 4MLHA 1HPMA 1WNSA 3GDQA 4FPBA 3MN9A 5C2FA 2FSJA 5AQQA 2E20A 1WSFA 2QKKA 3LM9A 5CE3A 3AA5X 4FO0A 2F4VK 1QVGM 3TAEA 1QE1A 3CFRA 3V1RA 3CFOA 3SMSA 4DSEA 3VEYA 1V4SA 4PL7A 3CCEN 1BQNA 4O0JA 1KLMA 5BRHA 3MDQA 1S1XA 4OPAA 1U48A 3HOSA 1C1BA 5KRSA 2GUIA 5LMUK 2QWPA 3OYDA 1M90O 1WSGA 1XNRK 4FJ9A 3EY1A 3KWGA 4B1ZA 3L2QA 4M3YA 2ZWHA 3OYIA 4NCGA 3RRGA 3ZSOA 4GW6A 3UKRB 3EE9A 2RF2A 4AM6A 2I7PA 1QQNA 3SYZA 2V7ZA 3O4NA 4AHVA 4KHSA 2QWNA 1U45A 2WONA 3WNHA 3NVKA 2FXUA 2E1YA 1YTAA 1HYVA 3DI6A 2IIRA 3C65A 4H03B 3HM8A 5BR9A 1KSPA 4FWMA 3JYTA 4KTQA 3VEWA 3BEXA 1GOBA 1YJNN 4BRFA 3CMEN 1JCGA 3VF4A 1RBTA 1H1VA 1RT1A 5BRDA 3KJVA 4L3QA 5B8HA 3C6UA 4B9VA 3VENA 2ZGYA 3SV4A 3AO2A 1LOTB 4K0KK 1LV5A 2PFUA 4CJVA 1KVCA 4CEEA 1X9JA 1S6QA 4LH4A 4O5BA 2UUAK 1RT7A 3O9UA 3TPQA 4CGHA 2XY5A 4JI3K 4JK8A 3CCQN 5GIOA 4JKAA 4AHRA 3LP2A 4B1UB 2HHSA 4LSLA 4F8RA 3D6RA 3QEXA 3ID6A 3CC2N 1KQSM 1BOTO 2F7TA 3TSQA 4KHPK 3M8PA 5GADP 3CCRN 3THWB 3AVGA 4BR0A 4DR2K 4FM1A 1MWKA 1XHXA 4MDAA 2IVPA 4K25A 4QOZB 4GVEA 3ZEUB 3KD1E 5AQUA 1WB9A 4E3SA 1KC8O 4HTLA 5M1NA 3OYLA 4DSFA 4JD2B 4CF9A 1Y64A 3NGYA 2O8CA 3VMFB 3AVCA 1HQUA 3SK3A 4DTRA 2HBMA 2OA8A 3R8EA 3WUHA 3T1YK 4YOWA 2QWQA 2NRXA 2RN2A 4OVLA 4KHQA 3R9PA 3WXMB 5FLXO 1BA1A 3S41A 3MK6A 2E2NA 4CBWA 4BROA 1ZBIA 4CHPA 1BISA 1V4TA 4K8ZA 3KKRA 5C42A 3NH0A 5AQKA 3O08A 3SNNA 2IOCA 1OH8A 4AHTA 3KKSA 2V51B 4NLCA 3WNGA 4Z0UA 2WOMA 4YDUA 3S9HA 2HBLA 3CJBA 3ZETA 3HP9A 5KRTA 4F2SA 3M8SA 3RVCA 4CK3A 3MXJA 4FJGA 3G6EN 1C0UA 1NK0A 1J9AA 2JWKA 4E7JA 3V9ZA 1REVA 1RTIA 4CGJA 4GKKK 1XC9A 5HRNA 1U4BA 3CETA 1RT6A 3VQ9A 3ULEB 2QXLA 4ICLA 2G8HA 2BGGA 4PKHA 3ENBA 4FOIA 4K43A 3M6GA 3KK3A 2HHHK 5JVHL 4DFJA 4FSVA 3R6MA 4JKGB 4B3MK 3VQ8A 4X65K 3T3FA 1TK0A 2IAJA 1D5AA 4BG9A 1ZBSA 3DOKA 2QTDA 3QNNA 4JLHA 3ZT4A 2UXBK 1BQMA 3DWLA 2RHKA 3CJ9A 1RNHA 5HOOA 2BE2A 3MECA 4DCHA 1SKSA 4NXNK 3AV9A 4IEIA 2Z1IA 1WSIA 2D0PA 2YNFA 1QSSA 4A62A 3CG7A 4WFNL 1MA9B 4PKGA 1EX4A 1M1KO 4FVMA 3I8DA 3NDKA 4FLVA 3NVMA 1JL1A 2OZMA 3RTVA 1C0FA 3MCPA 2D5RA 4CEAA 5E84A 2Q31A 3BZKA 3M8RA 1NGIA 3SQ4A 4CD1A 3KK7A 1VSJA 2HOEA 4DSIA 4DV7K 3QETA 4KHWA 3LPUA 1IBLK 1EWRA 3L3VA 4BRNA 4J2DA 3GG4A 1ZXOA 2B4JA 1L3SA 3T1AA 4FK2A 2YCHA 3GL1A 4IJAA 1GLAG 2ZJQL 1BL3A 3EEQA 3DXKB 1DT9A 3OBYA 2CH5A 4Y1DA 3NAEA 1Q81O 2QEXN 3VQ4A 3D7EO 5TKWA 4M3TA 3UKRA 1IKVA 4B9UA 3WQTA 3AAQA 4CIEA 2IC3A 1YVNA 4JN4A 4LY7A 3TSUA 3EZ5A 2KKZA 1HPZA 2P9NA 2O8FA 2D0CA 5BPMA 1NM1A 2KFNA 2PAVA 1S5JA 5IWAK 3ID8A 1ZBLA 4LFBK 1E4GT 4K8XA 4CEOA 4BE1A 3QO9A 3BDPA 3M8QA 3TTDA 2HHUA 4ILJA 2HNYA 4JI8K 1EP4A 4O5FA 4CJUA 3QB0A 2NRRA 2VWBA 4CJEA 4Q0BA 2VWJA 3VQAA 3O6WA 4KTWA 4JKGA 3ULEA 4LF7K 2GBZA 1CXUA 2ZJRL 2EX3A 3O9RA 4KI4A 3AVLA 4M3UA 4X64K 2P9SB 4DV6K 4BC5A 2Z1JA 4CERA 4JI6K 1EKEA 4ILGB 1GOAA 4DR1K 4F3TA 5KGXA 4BRKA 5M1KA 4JI1K 1KFSA 2E6MA 3G4SN 3VOVA 1ESVA 1JLBA 5C0YA 3BY5A 1FKPA 4DV0K 4U7BA 2DFFA 1WLJA 3CQ8A 1VK0A 2YJEA 4JKHA 1OKJA 4RG8A 1HKCA 2AP1A 3FFIA 3QEWA 1NK8A 1ASUA 3H46O 4DTUA 4PQUA 1QVFM 1KFDA 3AVBA 5GAGP 1JCEA 5LY3A 3SUOA 2W42A 1VQPN 4ZTJA 3LDQA 1G99A 3WEEA 1EO1A 4A5BA 4H0TB 3A5MC 3N4QA 1BDGA 2XRIA 2P9LB 4WQ4A 4JAXA 2IDOA 3ZX2A 3DLLL 2OANA 2P9KA 3JS6A 4DQRA 3SPYA 3C94A 3ZYYX 3S3OA 3QIOA 3E01A 4QAGA 3HJFA 2YV0X 1NGAA 3UB5A 1RBUA 4W5QA 2A41A 2IVNA 3WXLA 4NCBA 3U3GA 4QS7A 3BGRA 1JLAA 4GV6A 4E1JA 3AVKA 3M5RA 3IDHA 3RMBA 3D2EB 4CIGA 4A2AA 4LFCK 1G15A 1SQKA 3VQ5A 3QFUA 4B9QA 1Q9XA 1X1PA 1Z05A 3S3MA 3C6HA 5FRMA 2HF3A 3T7ZA 2VCPA 3D2FB 2ITMA 4EP5A 1NJIO 2DTUA 4JD2A 3NBPA 5GIPA 1NJYA 4KFBA 1HX1A 4JI2K 3OYNA 5FDLA 2OTJN 2NRZA 3PX0A 5JVGL 3ENOA 1YITN 4DFPA 1D4XA 3ZT2A 3E9LA 4GMJB 3AVJA 1VAZA 2WUSA 3J7YP 4CFAA 3TARA 4FJIA 2Y1JA 2A42A 4BC2A 4DLGA 4KI6A 4YOXA 5AQIA 4GVMA 1NNEA 3WEEB 4UQGA 2ZM6K 1NK5A 1JJ2M 5AQRA 1VQ5N 1TK8A 3DOLA 3FZHA 3OYGA 5AQFA 1SV5A 1NK7A 4OPKA 4DQSA 1HYZA 3O1BA 5KI6A 4Q5VA 3SAFA 2QXFA 3HM9A 5SWMA 4B3SK 3V9WA 4DU1A 3TI0A 3V9UA 2FBXA 2P51A 5AQVA 1RTJA 3ZETB 4M3WA 1ITGA 3WXKA 1ZC6A 2GEMA 1UA1A 3QBXA 2X6SA 1DTQA 5KQ8A 1IH7A 1NJZA 1R0AA 2P9KB 3BZCA 3PSFA 5AQMA 5BRFA 2P9PA 4A59A 4DTNA 2F8TA 1NJWA 4KV8A 3K9KA 2DPNA 4AHCA 3OYAA 4R79A 1N8RO 5J2PA 2FLOA 4OX9K 4CI6A 4OO1J 3KLIA 4IO9L 4RW9A 4HWIA 1W7AA 3AA3A 3O1WA 5J2MA 5J2NA 3MXMA 4M45A 1WBDA 2X78A 3VGKA 3LWLA 2O8FB 1X9WA 4BRIA 2O8EA 5DK5A 2O8DB 5I42A 4TSXA 1VQ9N 3AO5A 3J80O 1CZAN 1GOCA 4CF2A 3AARA 3KK1A 4FWQA 2H3GX 2HMPA 5A2QO 3MX2A 4DFMA 1ZBFA 2P9IB 4AF1A 3TAFA 1JCFA 3EZWA 4IDHA 1NGHA 1S6PA 4E7HA 1HNWK 1RDBA 3LDNA 1EQYA 3OYFA 2A1RA 2Q0UA 2NRWA 4MDBA 4OPHA 3OBWA 4MO5A 3VTHA 3RR7A 1TUYA 4BVPA 5KQDA 4CEFA 1U49A 4FXDA 4NCAA 3SLCA 4IFVA 4MLEA 1NK4A 5C24A 3ATUA 3I0SA 4C1NI 4Y1CA 3C0BA 3PIPL 2A1SA 1RDWX 4FJ8A 2R7YA 1YUWA 1BGXT 2EWSA 2E2PA 3LDPA 4AM7A 4Z4CA 4BR5A 1JLQA 3FZMA 4MFBA 3SJHA 4K41A 4CK2A 3RSEB 2D0OA 1Q86O 3E1YA 2G8WA 4JRPA 4C8KA 4CHNA 3OHRA 2VGMA 4CGDA 3CPWM 4BRMA 3NFAA 3OJSA 2O8BA 3QINA 3K5NA 2HHVA 1BCMA 1RT3A 4WE1A 5BN9A 4H0VB 4W5OA 4LSNA 3THVA 1BIUA 1IO2A 1HYSA 1LCUA 5M1FA 4CIFA 4CEQA 4CZJA 5E26A 3LL3A 4A5AA 1U2VB 3ATVA 4DV4K 1QQCA 2QW9A 1YHQN 4N76A 1SS6A 4MQ3A 3RWUA 4NB4A 1L5UA 1CXQA 4DU3A 1TUUA 2YNIA 4B3OA 3O5BA 1S3XA 4N5SA 4M7YA 4HTUA 3VA0A 3L0QA 2FBYA 4KH4A 1GLJO 2G8KA 1A5WA 4FL9A 3J8AA 1OVQA 4BRHA 3RRHA 3CJ7A 5E41A 1VQON 1TVRA 1WUAA 1N36K 1D8YA 2QA4N 1RDCA 2D0AA 4CF8A 4FJ7A 4DMNA 1RT4A 5GINA 3VF6A 4L8RB 2XO7A 3V4IA 3QMLA 5J1EA 3QESA 2KZMA 3ZLJA 4LH5A 4PY5A 3THYA 3TABA 1ZYQA 2HB5A 1VSMA 4M41A 2YX6A 5BPLA 1HR0K 1HUXA 3AO4A 4C8NA 4DF8A 4AHSA 1GLDG 1DGKN 1E3MA 3V1QA 4KHNA 1GLCG 1W97L 3I0RA 3O4QA 3VPZA 5BN8A 1IBMK 3HK2A 3MAQA 3G10A 4CHZA 4FLUA 2E1ZA 1Y97A 4DLEA 1YAGA 4KAZA 4PWDA 1C0MA 1GLBG 3OYHA 2VYPA 1W2BM 4CJQA 2Q2RA 4X62K 3CPEA 1XMOK 1Q18A 4JKDA 4H5NA 4CFDA 4N56A 3AVFA 3O3FA 3DLBA 4F4KA 3S3NA 2PYLA 5CYMA 5T7BA 1BWFO 2PY5A 2G8VA 5AQZA 3L2UA 4FM0A 3PIOL 4FJLA 4M42A 3TU5A 3FGUA 4DS4A 1XWLA 3NH2A 5EU7A 2UUBK 4JS4A 2W6KA 4GV9A 3CJAA 4MO4A 4ELVA 2VGNA 1XQSC 3NGZA 2HVHA 4A57A 3P31A 4PA1A 4FYDA 5AQLA 1VQNN 4FJMA 2VQEK 1D9DA 4CCHA 4FJXA 4W5TA 2BANA 3T69A 1I94K 4B1VA 4IZ9A 3LDSA 4U67L 1NKCA 3D2EA 2XHBA 4O44A 2Q97A 3HO1A 2YI1A 4AHUA 3ULDA 4JI5K 3DAWA 4I2PA 3KLGA 3RMDA 1TL1A 2W6LA 3K5MA 3FLCO 4JKEA 4IFEA 1P8ZA 4B8CA 4KB0A 3HBTA 2O8EB 4Z4IA 4FJHA 4PUOA 1UOCA 5HRRA 4CZHA 3VF2A 3F73A 1SUQA 1NOZA 5FRNA 2VG7A 1BUPA 1NG9A 1JXBA 4QS8A 5AZIA 4RW8A 4LF4K 3CM6A 2KW4A 2V7YA 1UA0A 2YHYA 3NGIA 3PX6A 4CJRA 3PX4A 3VQ7A 3MCAB 1QQMA 1NKEA 4KH6A 4XH4A 3I33A 2YHAA 3ALYA 4DV5K 2J4RA 3AO1A 4KTZA 4BC4A 4DSLA 1C1CA 5CZ2A 4EZ6A 1K73O 4NYFA 1KCFA 2X74A 2GV9A 1RBVA 3LM2A 3QNOA 3NH1A 4YY3K 1GLFO 1Q9YA 5M1OA 1VHXA 4W5NA 4EFHA 1T7PA 3QEPA 2ITGA 3AA2A 3HPHA 3OYMA 5HP1A 3VQDA 4JI0K 1JLGA 4Y0WA 2BTFA 5EX5A 3VQCA 2P9PB 3VEOA 1WBBA 3OYBA 1U47A 4CW7B 1HNZK 1KXPA 3VGLA 3HRGA 2VWKA 5KPTA 2AJQA 4IOAL 1RILA 3ZSYA 4YHHK 2O4GA 2E6LA 4BRQA 2UUCK 4JNEA 1IKWA 1K8KB 3M1FA 5HRPA 3KZBA 3TWHA 5BPNA 3OYJA 1C0TA 1CZBA 3NF7A 4J2EA 1RGIA 2LSNA 3CCSN 4CBUA 4E19A 2DFHA 1QSLA 4DSJA 4NXMK 3DYAA 3D0PA 4LFAK 4BWMA 4IBNA 4YOTA 3JXUA 1GLLO 4H5TA 4B8AB 3P39A 1VSFA 2UU9K 4WFAL 1Q8IA 4H5RA 4JS5A 1K6YA 3SBTA 3SUNA 3A5NC 4DG1A 1IKYA 3K9JA 1XUPO 4CZIA 3MN7A 1NGGA 1QS4A 3MMVA 2F96A 4KH5A 2GWJA 4FPAA 1MWMA 3KK2A 3TAGA 4JHDA 4FWOA 4CEBA 1VQ4N 4B08A 4O4GA 1RBRA 3GE1A 4KKOA 2CGJA 4ZTFA 4FVUA 1F21A 2CGKA 2QWRA 4R5PA 1TKTA 2A5XA 2WC9A 3O80A 4FWLA 5AZJB 3ITHA 5C25A 4YNQA 4CZKA 4ISEA 4IO8A 4DQIA 1L3VA 1FXXA 4FW2A 2Q36A 4E1NA 3IFRA 1YXQA 3LPTA 4IG3A 3WNEA 4BY9C 1DKGD 4IOCL 3AVNA 1WSHA 4DR5K 4KHUA 3NF9A 4DKWA 1BA0A 4I6MB 3A2FA 1YJWN 4KHYA 3LP3A 1TYQA 3CERA 4DQPA 5HL7L 1XNQK 3E9OA 5F1XA 3J7ZO 1NGEA 1OH7A 1SAZA 5AQOA 3HSTB 3H1VX 3H6EA 5J2QA 5LJVA 2FF6A 1SKRA 4IOXA 1J6ZA 3T1HK 5EY4A 4JRQA 2F9TA 4E7LA 1Z6RA 4FLXA 3HT3A 2YKNA 2ASOA 3PSIA 1VSIA 2W40A 2KTQA 1X3NA 4WYBA 1UAXA 1K8KA 2WFBA 4DTJA 3IS9A 5BREA 3AY9A 4CFCA 5AFUA 3J7AP 1EXQA 1W0HA 2UYTA 4LF5K 3DRRA 4M3RA 1LW0A 3HL8A 1LWEA 3HYFA 4EP4A 4GKJK 2NUBA 2A3ZA 4FLYA 3DM2A 5CY4A 4CZGA 5DMRA 4DSKA 4Z4GA 3FZKA 4C8MA 1ZBUA 1S1UA 3G0ZA 1A5VA 4JI4K 1FK9A 3AAPA 1YJ9N 5LMNK 2XY7A 3G71N 4CJTA 2E2OA 5GAHP 3MWTA 4CJ7A 3W3DA 1KAZA 3THXB 4W5RA 1RDDA 3D45A 4CJFA 3L2RA 1NWKA 1T05A 2KFZA 4CJ4A 3CQXA 4FWSA 3B6OA 3LWMA 1TAQA 2P9IA 4HUGA 4IG0A 3O3GA 3H45C 3ZEUA 4OKKA 4C8OA 3R1XA 3VEXA 3DMJA 4BGBA 4I7FA 4UY8O 1GLEG 1TGOA 5JLFA 3UKUA 2HVIA 3ZSXA 1VQMN 5AQYA 5FPDA 3QERA 3NF6A 1S22A 1HNXK 1BIZA 1WAJA 5FPMA 4BR4A 2GELA 1WSJA 4OLAA 2Z1HA 1NGFA 3EYZA 3VEZA 2GX9A 4YOYA 4K42A 3OS0A 1EWQA 5BR8K 3HTVA 5C10A 2HNZA 1Q7YO 4WCEL 3GBTA 3CIPA 2FBVA 3LAKA 5C2DA 5JICA 3PV8A 4FJKA 1FW6A 3V6DA 1O13A 3CJ1A 4DR4K 1RTHA 3ZT0A 2RKIA 1QZ5A 3LDLA 4CEZA 4IJNA 3CD6N 1N6QA 1QHTA 2QKBA 3P38A 3CMAN 2ETJA 1HMVA 2X6NA 4FJJA 3PO5A 1J53A 1S1VA 5TKYA 3UE5A 3O8MA 3VETA 4DV2K 3ZSWA 4J2BA 3ZX3A 4XH5A 3V81A 3N4PA 1HNVA 3F9MA 3CCVN 4CJ5A 4DV3K 4BDPA 4E1MA 2D1KA 5AFUH 2RE2A 3OJUA 4M63C 2O8DA 3DRPA 4RTFD 2XY8A 2A40A 5KPRA 1RCHA 3SUPA 5AZJA 3SJJA 1RTDA 1KVAA 3IAYA 4BRPA 3THXA 1IG8A 3L4IA 4DR6K 4OPJA 4Z4HA 5AZIB 4CF0A 3BF3A 2RPIA 3FR0A 3DJCA 3CM5A 4JHDB 4BRLA 5M1QA 1VQLN 1SZ2A 2QWOA 1VSKA 3U9ZA 3L8BA 1X9SA 4CBXA 4FLWA 4AILC 2BDPA 1TKDA 3P83D 3L3UA 2G8UA 2OCEA 3H3OB
chains in the Genus database with same CATH topology
4CGFA 3L2UA 4BWJA 4FM0A 3QETA 4KHWA 3LPUA 3DRSA 1B92A 3DLGA 1RDAA 4FJLA 3L2WA 3K2PA 1J54A 4M42A 1VRUA 3L3VA 2IGIA 1VSDA 4DS4A 1D9FA 1XWLA 4J2DA 5I3UA 1SL1A 3NH2A 1SL0A 4FK0A 5EU7A 2B4JA 3SPZA 4JS4A 4FM2A 1L3SA 2DY4A 1WAFA 4E89A 3HPOA 3OY9A 3DLHA 1J5OA 4ELVA 3T1AA 2HVHA 3NGZA 3IRXA 4FK2A 4DQQA 1BL3A 2VG5A 2HHQA 4I9QA 3VQEA 4BE2A 2G8IA 3VQ6A 4PA1A 4OKEA 4Y1DA 4FLZA 2ZQBA 3NAEA 1X9MA 2FBTA 3MEEA 4FYDA 4E7KA 3VQ4A 4FJMA 3NHGA 4M3TA 1D9DA 4CCHA 4FJXA 4W5TA 2BANA 3IG1A 1IKVA 4B9UA 4AH9A 4CIEA 2IC3A 2P5OA 4LY7A 2B6AA 1NKBA 4FW1A 2XY6A 3SV3A 3CFPA 4DU4A 2QK9A 4G1QA 2O4IA 2OPRA 3LDSA 2JLEA 1ASWA 3EZ5A 1NKCA 4ELUA 4BDZA 4IKFA 2XHBA 1JLEA 4O44A 3HO1A 1HPZA 4AHUA 3ULDA 3KD5E 4ID1A 2D0CA 2KFNA 4C8LA 4I2PA 3KLGA 3K57A 1S5JA 3RMDA 2D0BA 1ZBLA 1JLFA 3C95A 1TL1A 2P1JA 3K5MA 3MXIA 4CEOA 4I2QA 4BE1A 4K8XA 3QO9A 4KREA 2Q3SA 2G8FA 4B8CA 4KB0A 3BDPA 4Z4IA 3M8QA 4RW4A 2HHUA 4FJHA 4PUOA 1UOCA 5HRRA 2HNYA 1EP4A 3SQ0A 5HROA 1DTTA 3F73A 1L3UA 4CJUA 1SUQA 3ZSZA 1NOZA 4CJEA 3NE6A 3K58A 1I3AA 3MEGA 2VWJA 2VG7A 3VQAA 4B9TA 3RR8A 4CE9A 4Q0BA 4KTWA 4CF1A 2GBZA 1CXUA 1JXBA 3HPGA 2EX3A 4KI4A 4M3UA 3AVLA 4RW8A 1HQEA 3HVRA 3CM6A 2KW4A 1UA0A 1T8EA 3NGIA 4Z4FA 3PX6A 1S9GA 4CJRA 3PX4A 2Z1JA 3VQ7A 4CERA 3OYEA 1EKEA 1NKEA 5JS1A 1GOAA 2ZE2A 1O1WA 2YHAA 3ZSVA 5KGXA 1VSLA 3O3HA 4F3TA 1KFSA 3ALYA 2E6MA 3AO1A 4KTZA 4DSLA 4FCYA 1C1CA 1LWFA 1JLBA 5CZ2A 4EZ6A 4DTPA 4I9LA 1FKPA 1HRHA 3DLEA 4NYFA 5JS2A 2DFFA 1KCFA 2X74A 4CK1A 3HXMA 1WLJA 2GV9A 1RBVA 1C6VA 3QNOA 3NH1A 3CQ8A 4FZXC 1VK0A 3SQ1A 4DFKA 1Q9YA 4RG8A 3SCXA 2B5JA 3AVHA 3FFIA 1TL3A 3QEWA 1ASUA 1NK8A 1ASVA 3C6TA 3PY8A 4DTUA 1T7PA 4XIUA 3QEIA 3QEPA 1ZBHA 1LW2A 1JKHA 4CHOA 2ITGA 1KFDA 3AVBA 3AA2A 3HPHA 3AA4A 3OYMA 3VQDA 5HP1A 1KVBA 3SUOA 2W42A 4HUEA 5HLFA 4ZTJA 1JLGA 3AO3A 3F9KA 1RBSA 3VQCA 3NCIA 4J2AA 1N5YA 3OYBA 1S1WA 4DTSA 1U47A 4H4OA 2XRIA 2OPSA 2IDOA 2VWKA 3MEDA 2AJQA 4CEDA 1VSHA 4OGEA 1RILA 3ZSYA 4DQRA 3SPYA 2O4GA 2E6LA 3TAPA 3C94A 4F2RA 1IKWA 1JL2A 3QIOA 5HRPA 3S3OA 1EETA 3E01A 4OJRA 3VA3A 3TWHA 4QAGA 3HJFA 1Z26A 5SZTA 1S1TA 1CZ9A 2I5JA 2YV0X 4CHQA 4QCLA 1RBUA 4W5QA 3OYJA 1JXEA 4B9NA 4CJLA 4FJNA 1C0TA 2YKMA 4O55A 4CFBA 2EHGA 1CZBA 4IDKA 3NF7A 3OS1A 3KTQA 4FJ5A 3P5JA 4J2EA 4NCBA 2LSNA 3U3GA 3BGRA 1JLAA 3ZT3A 4E19A 4CHYA 2DFHA 1T03A 3AVKA 1QSLA 4CESA 3V9XA 4DSJA 3RMBA 3DYAA 4CJ3A 4ZHRA 3D0PA 4BWMA 4IBNA 4CIGA 1G15A 3LALA 4OGCA 3VQ5A 4B8AB 3LZIA 3H08A 1Q9XA 4E7IA 1VSFA 1X1PA 3VQPA 3KLEA 3S3MA 2P5GA 3AVMA 5FRMA 1Q8IA 4JS5A 1CLQA 1TKZA 1S9EA 1K6YA 2IS3A 1BCOA 3SUNA 4DG1A 1VSEA 4H4MA 4EP5A 1IKYA 4DF4A 2DTUA 3VQBA 3DLKA 3NBPA 1NJYA 2YHBA 1WNSA 3ISNC 4KFBA 3P1GA 4M3ZA 1QS4A 2F96A 3OYNA 5FDLA 3PX0A 1WSEA 4PQUA 3ZT1A 1VRTA 4DFPA 4N47A 1LAWA 1WSFA 3ZT2A 3KK2A 3TAGA 4W5NA 2QKKA 3CYMA 4GMJB 3AA5X 3AVJA 2ZD1A 3TAEA 1QE1A 4CEBA 3KLHA 4B08A 3CFRA 4CFAA 3V1RA 3CFOA 3TARA 4DSEA 4FJIA 4O4GA 2Y1JA 2YNGA 4DLGA 4KI6A 2HW3A 4CJKA 1RBRA 4KKOA 4GVMA 4ZTFA 1BQNA 1NJXA 1F21A 4O0JA 4CGGA 4UQGA 1KLMA 4R5PA 1TKTA 1NK5A 1S1XA 1TK8A 3DOLA 3ITHA 3OYGA 5C25A 1SV5A 3QIPA 4YNQA 1NK7A 1C1BA 5KRSA 3V1OA 4OPKA 3TANA 2GUIA 1U48A 4B9LA 4DQSA 4DQIA 1L3VA 1HYZA 1FXXA 5KI6A 3ZSRA 4FW2A 3OYDA 1NOYA 1WSGA 4E1NA 4Q5VA 3SUQA 4FJ9A 4NYNA 3U6FA 3EY1A 2QXFA 3LPTA 4O0IA 3L2QA 3HM9A 4M3YA 3OYIA 2F8SA 4IG3A 3WNEA 4NCGA 3RRGA 3ZSOA 4GW6A 5SWMA 2RF2A 3AVNA 5CZ1A 4FZZA 4KPYA 4BDYA 1WSHA 4KHUA 3V9WA 4DU1A 3NF9A 3SYZA 3OYCA 3TI0A 3O4NA 4AHVA 3A2FA 4KHSA 2FBXA 2HHWA 1U45A 4ELTA 2P51A 1HNIA 3LP3A 4KHYA 3KIOA 3T19A 1RTJA 2WONA 3K5LA 3WNHA 4M3WA 1XI1A 4DQPA 1ITGA 4DTMA 1YTAA 1UA1A 2X6SA 1HYVA 1DTQA 3DI6A 2HHTA 1IH7A 1NJZA 1R0AA 1FKOA 1SKWA 2Z1GA 1QTMA 3HSTB 1KSPA 3ZSQA 1TV6A 3JYTA 4KTQA 4DTNA 5J2QA 1GOBA 4OKJA 1TK5A 2F8TA 1B9FA 4HVJA 1BHLA 1NJWA 4KV8A 1SKRA 4AHCA 3OYAA 1TAUA 1RBTA 4JRQA 5J2PA 3DLRA 1RT1A 3K5OA 3V9SA 4E7LA 4FLXA 3KJVA 3HT3A 2YKNA 3KLIA 4CJPA 1SL2A 3C6UA 4B9VA 1VSIA 3SV4A 3AO2A 2KTQA 4RW7A 1LV5A 4RW9A 4CJVA 1KVCA 4CEEA 3L2VA 4FZYA 1UAXA 1A5XA 1S6QA 3AA3A 4LH4A 4O5BA 5J2MA 5J2NA 3MXMA 4M45A 1RT7A 2X78A 4CGHA 3LWLA 4DTJA 2XY5A 1X9WA 3IS9A 1YTUA 1RT5A 3LP1A 5DK5A 5I42A 4TSXA 4N41A 4AHRA 1YVUA 3LP2A 4CFCA 3AO5A 3PO4A 3LANA 2HHSA 4LSLA 4F8RA 1EXQA 1GOCA 1W0HA 3QEXA 1IKXA 1RT2A 3DRRA 4M3RA 1LW0A 3HL8A 1LWEA 3HYFA 4EP4A 4CF2A 3M8PA 3KK1A 3AVGA 2NUBA 5HRSA 2OZSA 4OLBA 4FM1A 4FLYA 1Z25A 3DM2A 2HMIA 4DFMA 5CY4A 5DMRA 1ZBFA 4YFUA 3TAFA 1XHXA 4DSKA 4Z4GA 4C8MA 1S6PA 1ZBUA 4E7HA 1RDBA 1S1UA 3KD1E 4QOZB 3G0ZA 4KRFA 1A5VA 1FK9A 3OYFA 4E3SA 2Y1IA 2A1RA 3OYLA 4DSFA 4CF9A 1NK6A 3NGYA 2XY7A 3TR8A 4CJTA 4BE0A 4FK4A 3AVCA 3RR7A 1HQUA 4DTRA 1NK9A 4CEFA 2OA8A 1U49A 4FXDA 4W5RA 4NCAA 2HHXA 1RDDA 3D45A 4CJFA 3LZJA 2RN2A 4IFVA 4OVLA 4DS5A 3L2RA 4CJSA 1NK4A 1IG9A 4KHQA 5HBMA 5C24A 1T05A 2KFZA 3I0SA 3U3YA 4Y1CA 4CJ4A 3B6OA 3LAMA 3LWMA 1TAQA 4HUGA 4IG0A 3O3GA 2A1SA 2YNHA 5D3GA 3RMAA 5CYQA 4FLTA 4FJ8A 4OKKA 2R7YA 1ZBIA 4C8OA 3QLHA 4CHPA 1MU2A 1BISA 3DMJA 1WN7A 4IFYA 4K8ZA 1BI4B 1BGXT 4I7FA 1TGOA 4Z4CA 3KKRA 1JLQA 2HVIA 3ZSXA 5C42A 3NH0A 4MFBA 4DWIA 2KQ2A 1LAVA 3SNNA 2IOCA 4CK2A 2G8WA 1U04A 3VN5A 4AHTA 4JRPA 1I39A 4C8KA 3QERA 3KKSA 3QEVA 3VQQA 3NF6A 4CHNA 4CGDA 4Z4EA 3NF8A 3WNGA 4Z0UA 3RMCA 2WOMA 4M3XA 1BIZA 3S9HA 3NFAA 3OJSA 1DLOA 1WAJA 3QINA 4CGIA 3K5NA 2HHVA 4HHTA 3HP9A 5KRTA 1BCMA 1RT3A 4WE1A 3SI6A 4F2SA 3M8SA 5KGWA 1KRPA 4W5OA 2JGUA 1WSJA 4B9MA 5K14A 4OLAA 2Z1HA 1L3TA 4LSNA 4HUFA 4CK3A 3LP0A 3THVA 1BIUA 3MXJA 4FJGA 1IO2A 1HYSA 3EYZA 4CIFA 4HCBA 4CEQA 3OS2A 4F3OA 1C0UA 1NK0A 4KB1A 1J9AA 3OS0A 4E7JA 1XHZA 3V9ZA 1REVA 1RTIA 2E4LA 2PYJA 4CGJA 1QQCA 4BACA 2HNZA 4MQ3A 3RWUA 3HVTA 3OVNA 4DTXA 1XC9A 5HRNA 4N76A 1U4BA 2FBVA 3LAKA 3PV8A 1L5UA 1CXQA 3HP6A 4DU3A 4FJKA 2YNIA 1RT6A 4B3OA 3VQ9A 4N5SA 4HTUA 3VA0A 2OPQA 3V6DA 2FBYA 4H8KA 1RTHA 4ICLA 3ZT0A 4DTOA 2G8HA 2RKIA 2BGGA 2G8KA 1KLNA 4HCCA 1A5WA 4CJWA 2ATQA 4LD0A 1B9DA 4CEZA 3ASMA 3RRHA 1N6QA 5E41A 1TKXA 1QHTA 1TVRA 2QKBA 2ETJA 3B6PA 1HMVA 3TAMA 3KK3A 1D8YA 3AVAA 1RDCA 4DFJA 2D0AA 2X6NA 4FJJA 1C1AA 4CF8A 3PO5A 3VQ8A 4FJ7A 1J53A 1S1VA 3TAQA 4DMNA 4EZ9A 1RT4A 3ZSWA 3T3FA 2IAJA 1KTQA 1TK0A 1D5AA 1HJRA 4J2BA 3V81A 4L8RB 2XO7A 1JLCA 2OPPA 3DOKA 1HNVA 3V4IA 3OYKA 4CJ5A 3QNNA 5J1EA 1W9HA 3QESA 2KZMA 4JLHA 3ZT4A 4BDPA 4E1MA 1BQMA 4LH5A 4PY5A 3JSMA 4CECA 2DFEA 2FC0A 3OJUA 2KZZA 3TABA 1RNHA 1ZYQA 2HB5A 1VSMA 5FROA 2BE2A 3DRPA 4M41A 3UIQA 3MECA 3AO4A 4C8NA 3WNFA 3PUFA 4DF8A 4AHSA 1SKSA 2XY8A 3AV9A 2VG6A 3V1QA 2Z1IA 1RCHA 2OYQA 4KHNA 4KO0A 3O4QA 3I0RA 3SUPA 1WSIA 3SJJA 3AVIA 1KVAA 2YNFA 3SQ2A 1RTDA 1QSSA 3CG7A 3IAYA 3ZCMA 1EX4A 3HK2A 4E0DA 3MAQA 3G10A 4OPJA 4FVMA 4CHZA 3I8DA 1Y97A 4FLUA 4DLEA 1YT3A 4Z4HA 2PZSA 3NDKA 4CF0A 4KAZA 4FLVA 4PWDA 2HNDA 1C0MA 1JL1A 2RPIA 1BI4A 1UWBA 5KTQA 3OYHA 3RTVA 3CM5A 2OZMA 4CJQA 4B9SA 2D5RA 3KLFA 4CEAA 1LWCA 3SZ2A 3L8BA 1VSKA 1X9SA 3M8RA 4CFDA 4RW6A 4N56A 3AVFA 3SQ4A 4ID5A 3O3FA 4FLWA 4AILC 1QSYA 3S3NA 2BDPA 1VSJA 3DLBA 4F4KA 5FRNA 1TKDA 2PYLA 3P83D 3L3UA 5CYMA 5T7BA 3K59A 2G8UA 2PY5A 4DSIA 2G8VA 3V9UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CGF A;  3L2U A;  4BWJ A;  4FM0 A;  3QET A;  4KHW A;  3LPU A;  3DRS A;  1B92 A;  3DLG A;  1RDA A;  4FJL A;  3L2W A;  3K2P A;  1J54 A;  4M42 A;  1VRU A;  3L3V A;  2IGI A;  1VSD A;  4DS4 A;  1D9F A;  1XWL A;  4J2D A;  5I3U A;  1SL1 A;  3NH2 A;  1SL0 A;  4FK0 A;  5EU7 A;  2B4J A;  3SPZ A;  4JS4 A;  4FM2 A;  1L3S A;  2DY4 A;  1WAF A;  4E89 A;  3HPO A;  3OY9 A;  3DLH A;  1J5O A;  4ELV A;  3T1A A;  2HVH A;  3NGZ A;  3IRX A;  4FK2 A;  4DQQ A;  1BL3 A;  2VG5 A;  2HHQ A;  4I9Q A;  3VQE A;  4BE2 A;  2G8I A;  3VQ6 A;  4PA1 A;  4OKE A;  4Y1D A;  4FLZ A;  2ZQB A;  3NAE A;  1X9M A;  2FBT A;  3MEE A;  4FYD A;  4E7K A;  3VQ4 A;  4FJM A;  3NHG A;  4M3T A;  1D9D A;  4CCH A;  4FJX A;  4W5T A;  2BAN A;  3IG1 A;  1IKV A;  4B9U A;  4AH9 A;  4CIE A;  2IC3 A;  2P5O A;  4LY7 A;  2B6A A;  1NKB A;  4FW1 A;  2XY6 A;  3SV3 A;  3CFP A;  4DU4 A;  2QK9 A;  4G1Q A;  2O4I A;  2OPR A;  3LDS A;  2JLE A;  1ASW A;  3EZ5 A;  1NKC A;  4ELU A;  4BDZ A;  4IKF A;  2XHB A;  1JLE A;  4O44 A;  3HO1 A;  1HPZ A;  4AHU A;  3ULD A;  3KD5 E;  4ID1 A;  2D0C A;  2KFN A;  4C8L A;  4I2P A;  3KLG A;  3K57 A;  1S5J A;  3RMD A;  2D0B A;  1ZBL A;  1JLF A;  3C95 A;  1TL1 A;  2P1J A;  3K5M A;  3MXI A;  4CEO A;  4I2Q A;  4BE1 A;  4K8X A;  3QO9 A;  4KRE A;  2Q3S A;  2G8F A;  4B8C A;  4KB0 A;  3BDP A;  4Z4I A;  3M8Q A;  4RW4 A;  2HHU A;  4FJH A;  4PUO A;  1UOC A;  5HRR A;  2HNY A;  1EP4 A;  3SQ0 A;  5HRO A;  1DTT A;  3F73 A;  1L3U A;  4CJU A;  1SUQ A;  3ZSZ A;  1NOZ A;  4CJE A;  3NE6 A;  3K58 A;  1I3A A;  3MEG A;  2VWJ A;  2VG7 A;  3VQA A;  4B9T A;  3RR8 A;  4CE9 A;  4Q0B A;  4KTW A;  4CF1 A;  2GBZ A;  1CXU A;  1JXB A;  3HPG A;  2EX3 A;  4KI4 A;  4M3U A;  3AVL A;  4RW8 A;  1HQE A;  3HVR A;  3CM6 A;  2KW4 A;  1UA0 A;  1T8E A;  3NGI A;  4Z4F A;  3PX6 A;  1S9G A;  4CJR A;  3PX4 A;  2Z1J A;  3VQ7 A;  4CER A;  3OYE A;  1EKE A;  1NKE A;  5JS1 A;  1GOA A;  2ZE2 A;  1O1W A;  2YHA A;  3ZSV A;  5KGX A;  1VSL A;  3O3H A;  4F3T A;  1KFS A;  3ALY A;  2E6M A;  3AO1 A;  4KTZ A;  4DSL A;  4FCY A;  1C1C A;  1LWF A;  1JLB A;  5CZ2 A;  4EZ6 A;  4DTP A;  4I9L A;  1FKP A;  1HRH A;  3DLE A;  4NYF A;  5JS2 A;  2DFF A;  1KCF A;  2X74 A;  4CK1 A;  3HXM A;  1WLJ A;  2GV9 A;  1RBV A;  1C6V A;  3QNO A;  3NH1 A;  3CQ8 A;  4FZX C;  1VK0 A;  3SQ1 A;  4DFK A;  1Q9Y A;  4RG8 A;  3SCX A;  2B5J A;  3AVH A;  3FFI A;  1TL3 A;  3QEW A;  1ASU A;  1NK8 A;  1ASV A;  3C6T A;  3PY8 A;  4DTU A;  1T7P A;  4XIU A;  3QEI A;  3QEP A;  1ZBH A;  1LW2 A;  1JKH A;  4CHO A;  2ITG A;  1KFD A;  3AVB A;  3AA2 A;  3HPH A;  3AA4 A;  3OYM A;  3VQD A;  5HP1 A;  1KVB A;  3SUO A;  2W42 A;  4HUE A;  5HLF A;  4ZTJ A;  1JLG A;  3AO3 A;  3F9K A;  1RBS A;  3VQC A;  3NCI A;  4J2A A;  1N5Y A;  3OYB A;  1S1W A;  4DTS A;  1U47 A;  4H4O A;  2XRI A;  2OPS A;  2IDO A;  2VWK A;  3MED A;  2AJQ A;  4CED A;  1VSH A;  4OGE A;  1RIL A;  3ZSY A;  4DQR A;  3SPY A;  2O4G A;  2E6L A;  3TAP A;  3C94 A;  4F2R A;  1IKW A;  1JL2 A;  3QIO A;  5HRP A;  3S3O A;  1EET A;  3E01 A;  4OJR A;  3VA3 A;  3TWH A;  4QAG A;  3HJF A;  1Z26 A;  5SZT A;  1S1T A;  1CZ9 A;  2I5J A;  2YV0 X;  4CHQ A;  4QCL A;  1RBU A;  4W5Q A;  3OYJ A;  1JXE A;  4B9N A;  4CJL A;  4FJN A;  1C0T A;  2YKM A;  4O55 A;  4CFB A;  2EHG A;  1CZB A;  4IDK A;  3NF7 A;  3OS1 A;  3KTQ A;  4FJ5 A;  3P5J A;  4J2E A;  4NCB A;  2LSN A;  3U3G A;  3BGR A;  1JLA A;  3ZT3 A;  4E19 A;  4CHY A;  2DFH A;  1T03 A;  3AVK A;  1QSL A;  4CES A;  3V9X A;  4DSJ A;  3RMB A;  3DYA A;  4CJ3 A;  4ZHR A;  3D0P A;  4BWM A;  4IBN A;  4CIG A;  1G15 A;  3LAL A;  4OGC A;  3VQ5 A;  4B8A B;  3LZI A;  3H08 A;  1Q9X A;  4E7I A;  1VSF A;  1X1P A;  3VQP A;  3KLE A;  3S3M A;  2P5G A;  3AVM A;  5FRM A;  1Q8I A;  4JS5 A;  1CLQ A;  1TKZ A;  1S9E A;  1K6Y A;  2IS3 A;  1BCO A;  3SUN A;  4DG1 A;  1VSE A;  4H4M A;  4EP5 A;  1IKY A;  4DF4 A;  2DTU A;  3VQB A;  3DLK A;  3NBP A;  1NJY A;  2YHB A;  1WNS A;  3ISN C;  4KFB A;  3P1G A;  4M3Z A;  1QS4 A;  2F96 A;  3OYN A;  5FDL A;  3PX0 A;  1WSE A;  4PQU A;  3ZT1 A;  1VRT A;  4DFP A;  4N47 A;  1LAW A;  1WSF A;  3ZT2 A;  3KK2 A;  3TAG A;  4W5N A;  2QKK A;  3CYM A;  4GMJ B;  3AA5 X;  3AVJ A;  2ZD1 A;  3TAE A;  1QE1 A;  4CEB A;  3KLH A;  4B08 A;  3CFR A;  4CFA A;  3V1R A;  3CFO A;  3TAR A;  4DSE A;  4FJI A;  4O4G A;  2Y1J A;  2YNG A;  4DLG A;  4KI6 A;  2HW3 A;  4CJK A;  1RBR A;  4KKO A;  4GVM A;  4ZTF A;  1BQN A;  1NJX A;  1F21 A;  4O0J A;  4CGG A;  4UQG A;  1KLM A;  4R5P A;  1TKT A;  1NK5 A;  1S1X A;  1TK8 A;  3DOL A;  3ITH A;  3OYG A;  5C25 A;  1SV5 A;  3QIP A;  4YNQ A;  1NK7 A;  1C1B A;  5KRS A;  3V1O A;  4OPK A;  3TAN A;  2GUI A;  1U48 A;  4B9L A;  4DQS A;  4DQI A;  1L3V A;  1HYZ A;  1FXX A;  5KI6 A;  3ZSR A;  4FW2 A;  3OYD A;  1NOY A;  1WSG A;  4E1N A;  4Q5V A;  3SUQ A;  4FJ9 A;  4NYN A;  3U6F A;  3EY1 A;  2QXF A;  3LPT A;  4O0I A;  3L2Q A;  3HM9 A;  4M3Y A;  3OYI A;  2F8S A;  4IG3 A;  3WNE A;  4NCG A;  3RRG A;  3ZSO A;  4GW6 A;  5SWM A;  2RF2 A;  3AVN A;  5CZ1 A;  4FZZ A;  4KPY A;  4BDY A;  1WSH A;  4KHU A;  3V9W A;  4DU1 A;  3NF9 A;  3SYZ A;  3OYC A;  3TI0 A;  3O4N A;  4AHV A;  3A2F A;  4KHS A;  2FBX A;  2HHW A;  1U45 A;  4ELT A;  2P51 A;  1HNI A;  3LP3 A;  4KHY A;  3KIO A;  3T19 A;  1RTJ A;  2WON A;  3K5L A;  3WNH A;  4M3W A;  1XI1 A;  4DQP A;  1ITG A;  4DTM A;  1YTA A;  1UA1 A;  2X6S A;  1HYV A;  1DTQ A;  3DI6 A;  2HHT A;  1IH7 A;  1NJZ A;  1R0A A;  1FKO A;  1SKW A;  2Z1G A;  1QTM A;  3HST B;  1KSP A;  3ZSQ A;  1TV6 A;  3JYT A;  4KTQ A;  4DTN A;  5J2Q A;  1GOB A;  4OKJ A;  1TK5 A;  2F8T A;  1B9F A;  4HVJ A;  1BHL A;  1NJW A;  4KV8 A;  1SKR A;  4AHC A;  3OYA A;  1TAU A;  1RBT A;  4JRQ A;  5J2P A;  3DLR A;  1RT1 A;  3K5O A;  3V9S A;  4E7L A;  4FLX A;  3KJV A;  3HT3 A;  2YKN A;  3KLI A;  4CJP A;  1SL2 A;  3C6U A;  4B9V A;  1VSI A;  3SV4 A;  3AO2 A;  2KTQ A;  4RW7 A;  1LV5 A;  4RW9 A;  4CJV A;  1KVC A;  4CEE A;  3L2V A;  4FZY A;  1UAX A;  1A5X A;  1S6Q A;  3AA3 A;  4LH4 A;  4O5B A;  5J2M A;  5J2N A;  3MXM A;  4M45 A;  1RT7 A;  2X78 A;  4CGH A;  3LWL A;  4DTJ A;  2XY5 A;  1X9W A;  3IS9 A;  1YTU A;  1RT5 A;  3LP1 A;  5DK5 A;  5I42 A;  4TSX A;  4N41 A;  4AHR A;  1YVU A;  3LP2 A;  4CFC A;  3AO5 A;  3PO4 A;  3LAN A;  2HHS A;  4LSL A;  4F8R A;  1EXQ A;  1GOC A;  1W0H A;  3QEX A;  1IKX A;  1RT2 A;  3DRR A;  4M3R A;  1LW0 A;  3HL8 A;  1LWE A;  3HYF A;  4EP4 A;  4CF2 A;  3M8P A;  3KK1 A;  3AVG A;  2NUB A;  5HRS A;  2OZS A;  4OLB A;  4FM1 A;  4FLY A;  1Z25 A;  3DM2 A;  2HMI A;  4DFM A;  5CY4 A;  5DMR A;  1ZBF A;  4YFU A;  3TAF A;  1XHX A;  4DSK A;  4Z4G A;  4C8M A;  1S6P A;  1ZBU A;  4E7H A;  1RDB A;  1S1U A;  3KD1 E;  4QOZ B;  3G0Z A;  4KRF A;  1A5V A;  1FK9 A;  3OYF A;  4E3S A;  2Y1I A;  2A1R A;  3OYL A;  4DSF A;  4CF9 A;  1NK6 A;  3NGY A;  2XY7 A;  3TR8 A;  4CJT A;  4BE0 A;  4FK4 A;  3AVC A;  3RR7 A;  1HQU A;  4DTR A;  1NK9 A;  4CEF A;  2OA8 A;  1U49 A;  4FXD A;  4W5R A;  4NCA A;  2HHX A;  1RDD A;  3D45 A;  4CJF A;  3LZJ A;  2RN2 A;  4IFV A;  4OVL A;  4DS5 A;  3L2R A;  4CJS A;  1NK4 A;  1IG9 A;  4KHQ A;  5HBM A;  5C24 A;  1T05 A;  2KFZ A;  3I0S A;  3U3Y A;  4Y1C A;  4CJ4 A;  3B6O A;  3LAM A;  3LWM A;  1TAQ A;  4HUG A;  4IG0 A;  3O3G A;  2A1S A;  2YNH A;  5D3G A;  3RMA A;  5CYQ A;  4FLT A;  4FJ8 A;  4OKK A;  2R7Y A;  1ZBI A;  4C8O A;  3QLH A;  4CHP A;  1MU2 A;  1BIS A;  3DMJ A;  1WN7 A;  4IFY A;  4K8Z A;  1BI4 B;  1BGX T;  4I7F A;  1TGO A;  4Z4C A;  3KKR A;  1JLQ A;  2HVI A;  3ZSX A;  5C42 A;  3NH0 A;  4MFB A;  4DWI A;  2KQ2 A;  1LAV A;  3SNN A;  2IOC A;  4CK2 A;  2G8W A;  1U04 A;  3VN5 A;  4AHT A;  4JRP A;  1I39 A;  4C8K A;  3QER A;  3KKS A;  3QEV A;  3VQQ A;  3NF6 A;  4CHN A;  4CGD A;  4Z4E A;  3NF8 A;  3WNG A;  4Z0U A;  3RMC A;  2WOM A;  4M3X A;  1BIZ A;  3S9H A;  3NFA A;  3OJS A;  1DLO A;  1WAJ A;  3QIN A;  4CGI A;  3K5N A;  2HHV A;  4HHT A;  3HP9 A;  5KRT A;  1BCM A;  1RT3 A;  4WE1 A;  3SI6 A;  4F2S A;  3M8S A;  5KGW A;  1KRP A;  4W5O A;  2JGU A;  1WSJ A;  4B9M A;  5K14 A;  4OLA A;  2Z1H A;  1L3T A;  4LSN A;  4HUF A;  4CK3 A;  3LP0 A;  3THV A;  1BIU A;  3MXJ A;  4FJG A;  1IO2 A;  1HYS A;  3EYZ A;  4CIF A;  4HCB A;  4CEQ A;  3OS2 A;  4F3O A;  1C0U A;  1NK0 A;  4KB1 A;  1J9A A;  3OS0 A;  4E7J A;  1XHZ A;  3V9Z A;  1REV A;  1RTI A;  2E4L A;  2PYJ A;  4CGJ A;  1QQC A;  4BAC A;  2HNZ A;  4MQ3 A;  3RWU A;  3HVT A;  3OVN A;  4DTX A;  1XC9 A;  5HRN A;  4N76 A;  1U4B A;  2FBV A;  3LAK A;  3PV8 A;  1L5U A;  1CXQ A;  3HP6 A;  4DU3 A;  4FJK A;  2YNI A;  1RT6 A;  4B3O A;  3VQ9 A;  4N5S A;  4HTU A;  3VA0 A;  2OPQ A;  3V6D A;  2FBY A;  4H8K A;  1RTH A;  4ICL A;  3ZT0 A;  4DTO A;  2G8H A;  2RKI A;  2BGG A;  2G8K A;  1KLN A;  4HCC A;  1A5W A;  4CJW A;  2ATQ A;  4LD0 A;  1B9D A;  4CEZ A;  3ASM A;  3RRH A;  1N6Q A;  5E41 A;  1TKX A;  1QHT A;  1TVR A;  2QKB A;  2ETJ A;  3B6P A;  1HMV A;  3TAM A;  3KK3 A;  1D8Y A;  3AVA A;  1RDC A;  4DFJ A;  2D0A A;  2X6N A;  4FJJ A;  1C1A A;  4CF8 A;  3PO5 A;  3VQ8 A;  4FJ7 A;  1J53 A;  1S1V A;  3TAQ A;  4DMN A;  4EZ9 A;  1RT4 A;  3ZSW A;  3T3F A;  2IAJ A;  1KTQ A;  1TK0 A;  1D5A A;  1HJR A;  4J2B A;  3V81 A;  4L8R B;  2XO7 A;  1JLC A;  2OPP A;  3DOK A;  1HNV A;  3V4I A;  3OYK A;  4CJ5 A;  3QNN A;  5J1E A;  1W9H A;  3QES A;  2KZM A;  4JLH A;  3ZT4 A;  4BDP A;  4E1M A;  1BQM A;  4LH5 A;  4PY5 A;  3JSM A;  4CEC A;  2DFE A;  2FC0 A;  3OJU A;  2KZZ A;  3TAB A;  1RNH A;  1ZYQ A;  2HB5 A;  1VSM A;  5FRO A;  2BE2 A;  3DRP A;  4M41 A;  3UIQ A;  3MEC A;  3AO4 A;  4C8N A;  3WNF A;  3PUF A;  4DF8 A;  4AHS A;  1SKS A;  2XY8 A;  3AV9 A;  2VG6 A;  3V1Q A;  2Z1I A;  1RCH A;  2OYQ A;  4KHN A;  4KO0 A;  3O4Q A;  3I0R A;  3SUP A;  1WSI A;  3SJJ A;  3AVI A;  1KVA A;  2YNF A;  3SQ2 A;  1RTD A;  1QSS A;  3CG7 A;  3IAY A;  3ZCM A;  1EX4 A;  3HK2 A;  4E0D A;  3MAQ A;  3G10 A;  4OPJ A;  4FVM A;  4CHZ A;  3I8D A;  1Y97 A;  4FLU A;  4DLE A;  1YT3 A;  4Z4H A;  2PZS A;  3NDK A;  4CF0 A;  4KAZ A;  4FLV A;  4PWD A;  2HND A;  1C0M A;  1JL1 A;  2RPI A;  1BI4 A;  1UWB A;  5KTQ A;  3OYH A;  3RTV A;  3CM5 A;  2OZM A;  4CJQ A;  4B9S A;  2D5R A;  3KLF A;  4CEA A;  1LWC A;  3SZ2 A;  3L8B A;  1VSK A;  1X9S A;  3M8R A;  4CFD A;  4RW6 A;  4N56 A;  3AVF A;  3SQ4 A;  4ID5 A;  3O3F A;  4FLW A;  4AIL C;  1QSY A;  3S3N A;  2BDP A;  1VSJ A;  3DLB A;  4F4K A;  5FRN A;  1TKD A;  2PYL A;  3P83 D;  3L3U A;  5CYM A;  5T7B A;  3K59 A;  2G8U A;  2PY5 A;  4DSI A;  2G8V A;  3V9U A; 
#chains in the Genus database with same CATH topology
 4BWJ A;  3DRS A;  1B92 A;  3DLG A;  1RDA A;  4B1Y B;  1J54 A;  5LL6 Z;  1D9F A;  2NRV A;  5I3U A;  2W41 A;  1SL0 A;  1KD1 O;  4FK0 A;  1T3V A;  4FM2 A;  2DY4 A;  3CCM N;  5LJW A;  1J5O A;  3FFK B;  2GUP A;  1KAY A;  3TSP A;  3A8Y A;  1IJJ A;  2HHQ A;  3VQE A;  4CVN E;  3VQ6 A;  4FLZ A;  4OKE A;  2ZQB A;  3EO3 A;  3MEE A;  3K0S A;  3CXC M;  3VER A;  4AH9 A;  3OTO K;  4JV5 K;  5F0X A;  2P5O A;  2B6A A;  4FW1 A;  2XY6 A;  3SV3 A;  4CZE A;  3CFP A;  2QK9 A;  1N32 K;  2VQF K;  3M3Z A;  2F9W A;  4ELU A;  4BDZ A;  3KD5 E;  4ID1 A;  2HF4 A;  4XH1 A;  3FZL A;  4C8L A;  4RCH A;  2D0B A;  5AQX A;  1JLF A;  5IT9 O;  2P1J A;  3L4Q A;  4PKI A;  3MXI A;  4I2Q A;  4WQ5 C;  5AR0 A;  3HOT A;  2Q3S A;  2G8F A;  3Q7C A;  3CQY A;  3SMP A;  2ASP A;  5HRO A;  1VQ7 N;  3ZSZ A;  3NE6 A;  4B9T A;  3MEG A;  4CE9 A;  3TTF A;  1FJG K;  4CZM A;  5F2R A;  2PBD A;  3WQU A;  4Z4F A;  1MDU B;  3GOI A;  3OYE A;  4JYA K;  3O3H A;  2ZE2 A;  4CZL A;  3WT0 A;  2NRH A;  5AQW A;  3CC7 N;  3A0I X;  4FCY A;  1LWF A;  1QHA A;  4DTP A;  4I9L A;  3DLE A;  4CK1 A;  3HXM A;  1ATS A;  1N34 K;  4FZX C;  4BRD A;  2P9U B;  4H0O A;  4QS9 A;  2E8A A;  3LDO A;  1ZBH A;  3ENH A;  3QEI A;  3NMU A;  1LW2 A;  1JKH A;  4B3R K;  3AA4 A;  2WTU A;  4HUE A;  3F2K A;  3AO3 A;  3UKU B;  3CCU N;  3F9K A;  1RBS A;  3NCI A;  1S1W A;  3ZX0 A;  4H4O A;  4BRC A;  3A5L C;  3MED A;  3P4I A;  3O9T A;  5C12 A;  1VSH A;  3AGK A;  3EKS A;  4FWP A;  4YOR A;  4F2R A;  1JL2 A;  3VA3 A;  1Z26 A;  4CZF A;  1S1T A;  3CJC A;  4PL8 A;  4QCL A;  1Q82 O;  4FJN A;  4IEE A;  1JXE A;  4B9N A;  4CJL A;  4O55 A;  3KTQ A;  4IDK A;  3EE8 A;  4FJ5 A;  1YTU A;  4OLB A;  4CHY A;  1T03 A;  2OTL N;  1VQK N;  3V9X A;  1T44 A;  2I7N A;  4ZHR A;  2QM1 A;  3LAL A;  4OGC A;  4ISG A;  3O4W A;  4E7I A;  3VQP A;  2P5G A;  3AVM A;  1CLQ A;  1S9E A;  1YF5 L;  1BCO A;  2P9N B;  4WQ5 A;  3CC4 N;  4V19 S;  4H4M A;  5GAE P;  3H3N O;  4DF4 A;  3EL2 A;  3VQB A;  2FSN A;  2YHB A;  4LF8 K;  3ISN C;  4A61 A;  3P1G A;  4JKB A;  4M3Z A;  4GNI A;  4BQZ A;  5CHI A;  1NMD A;  3CI5 A;  1XMQ K;  3WXJ A;  1WSE A;  3O9Q A;  3ZT1 A;  1VRT A;  4N47 A;  1LAW A;  5KPZ A;  3CYM A;  4DUZ K;  2ZD1 A;  3KLH A;  4Z94 A;  2YNG A;  4CJK A;  1NJX A;  4CGG A;  2ASM A;  4F9O A;  4FWK A;  5JLH A;  4JEP A;  3QIP A;  1NU0 A;  3TAN A;  3V1O A;  4B9L A;  3U8X A;  3ZSR A;  1NOY A;  3SUQ A;  4NYN A;  3U6F A;  2FSK A;  4JKC A;  5ADX A;  4BRA A;  4O0I A;  2F8S A;  3BUZ B;  2JWL A;  1IBK K;  1T6D A;  5CZ1 A;  4FZZ A;  4KPY A;  4BR7 A;  4BDY A;  3OYC A;  1HKG A;  3HSC A;  4BVO A;  2YJF A;  2HHW A;  4ELT A;  1HNI A;  4LC9 B;  4EAH D;  4C23 A;  3KIO A;  3T19 A;  3K5L A;  1XI1 A;  4DTM A;  1P90 A;  2HHT A;  2KLA A;  1FKO A;  1SKW A;  2Z1G A;  1QTM A;  3ZSQ A;  1TV6 A;  4OKJ A;  1TK5 A;  1B9F A;  4HVJ A;  1BHL A;  4G9Z A;  3E9P A;  2WBN A;  4BRG A;  1TAU A;  4BR2 A;  4X66 K;  3OW2 M;  3DLR A;  3K5O A;  3V9S A;  4CJP A;  1SL2 A;  2NLX A;  5AQP A;  5ADX H;  4RW7 A;  5H1S Q;  4BG8 A;  3L2V A;  4FZY A;  1A5X A;  1NGJ A;  5AJ3 K;  1ILY A;  1RT5 A;  3LP1 A;  4N41 A;  1YVU A;  2ZF5 O;  3PO4 A;  3LAN A;  3J81 O;  1IKX A;  1RT2 A;  4YDU C;  4GV3 A;  4EIA A;  5DM7 L;  1BG3 A;  3KWI A;  2BH1 A;  1WOQ A;  4BRE A;  5HRS A;  2OZS A;  4NLB A;  1Z25 A;  2HMI A;  4YFU A;  5AQH A;  4KRF A;  1ATR A;  3FZF A;  2Y1I A;  3C7N B;  4H0P A;  4I6M A;  1NK6 A;  3TR8 A;  4BE0 A;  4YOV A;  4FK4 A;  1NMN A;  2IVO A;  1NK9 A;  2O8C B;  3QIC A;  2AA4 A;  3BP8 A;  3LZJ A;  4DS5 A;  3I55 N;  4B1X B;  4CJS A;  1IG9 A;  4JK9 A;  5HBM A;  3C7N A;  3U3Y A;  5EXW A;  5AQJ A;  4FWN A;  3LAM A;  1XC3 A;  1J5E K;  2Q0R A;  5D3G A;  2YNH A;  3RMA A;  5CYQ A;  4FWR A;  4DR3 K;  2P9S A;  4FLT A;  3THY B;  3QLH A;  2D4W A;  4LF6 K;  1MU2 A;  4NO7 A;  1QZ6 A;  1WN7 A;  4IFY A;  4DB3 A;  1BI4 B;  1U6Z A;  3Q7B A;  1NGC A;  3I56 N;  4M7X A;  4DWI A;  2KQ2 A;  1LAV A;  3BF1 A;  3EKU A;  3L6Q A;  1U04 A;  3VN5 A;  1I39 A;  3QEV A;  3VQQ A;  4Z4E A;  4O8K A;  3NF8 A;  3RMC A;  4M3X A;  2QI2 A;  1DLO A;  4CGI A;  4HHT A;  3SI6 A;  3VES A;  5KGW A;  1KRP A;  2JGU A;  4B9M A;  5K14 A;  1L3T A;  4HUF A;  3LP0 A;  1OVY A;  4HCB A;  3OS2 A;  4F3O A;  4KB1 A;  1XHZ A;  3RSE A;  2NZT A;  2E4L A;  2PYJ A;  4BAC A;  3SAH A;  3HVT A;  3OVN A;  5EOY A;  4DTX A;  1NBW A;  1QQO A;  3HP6 A;  1X3M A;  2FF3 B;  2OPQ A;  4H8K A;  3R3L A;  4DTO A;  4IXC A;  1BO5 O;  5FPN A;  1KLN A;  4HCC A;  2P9L A;  4CJW A;  2ATQ A;  4LD0 A;  1B9D A;  1K9M O;  3ASM A;  4RWT A;  5AQG A;  1TKX A;  3B6P A;  3TAM A;  3JAM O;  3AVA A;  3F5T A;  4YOU A;  1C1A A;  2Q1N A;  2ZJP L;  3TAQ A;  4EZ9 A;  1KTQ A;  1HJR A;  4KBO A;  5EVZ A;  1JLC A;  2OPP A;  2BUP A;  3OYK A;  4AQY K;  1W9H A;  3CHW A;  4WF9 L;  4BQL A;  2KZZ A;  3JSM A;  4CEC A;  2DFE A;  2FC0 A;  2E88 A;  1K8A O;  5FRO A;  3UIQ A;  2YHX A;  3I8B A;  3WNF A;  3PUF A;  5I9E B;  2VG6 A;  2OYQ A;  4KO0 A;  2HHX A;  1VQ8 N;  3AVI A;  3SQ2 A;  3ZCM A;  4E0D A;  2CH6 A;  4BC3 A;  2PZS A;  1YT3 A;  1YI2 N;  3KHY A;  1E4F T;  2HND A;  1BI4 A;  5ELZ A;  1UWB A;  5KTQ A;  4B9S A;  4DQ8 A;  3KLF A;  3VEV A;  1LWC A;  3SZ2 A;  5FPE A;  4RW6 A;  4ID5 A;  3HZ6 A;  1QSY A;  4GY2 B;  2A6A A;  3K59 A;  1RFQ A;  1YIJ N;  4CGF A;  1IV0 A;  5AQS A;  3L2W A;  3K2P A;  4H0X B;  1VRU A;  3W0L A;  2IGI A;  5C15 A;  1ATN A;  1VSD A;  1BU6 O;  1SL1 A;  3SPZ A;  1WAF A;  4E89 A;  4LF9 K;  3HPO A;  3OY9 A;  3DLH A;  2UXC K;  5JMV A;  3IRX A;  4DQQ A;  2VG5 A;  1KAX A;  4I9Q A;  4BE2 A;  1NLV A;  2G8I A;  1X9M A;  4DUY K;  2FBT A;  4E7K A;  3NHG A;  4DR7 K;  4FOE A;  2QWM A;  3IG1 A;  1NGD A;  3HI0 A;  3MN6 A;  4O8U A;  4BGA A;  1NKB A;  4B3T K;  2GWK A;  4DU4 A;  4G1Q A;  2YHW A;  2O4I A;  2OPR A;  4IWV A;  2JLE A;  1ASW A;  4IKF A;  2E2Q A;  1JLE A;  4JI7 K;  3VTI A;  1DEJ A;  3OA9 A;  3K57 A;  4CD3 A;  1U2V A;  3C95 A;  5DM6 L;  4EHU A;  4KRE A;  4XEI A;  3D2F A;  3KVG A;  4WFB L;  4RW4 A;  1S72 N;  3H1Q A;  4PHT X;  2KHO A;  4WQ4 C;  3DXM B;  3EN9 A;  3SQ0 A;  4DHY A;  1DTT A;  1L3U A;  3K58 A;  2HW3 A;  1I3A A;  3WXI A;  3RR8 A;  1VQ6 N;  4CF1 A;  3HPG A;  2ZGZ A;  1HQE A;  3HVR A;  3IKM A;  1T8E A;  3AGR A;  1T6C A;  1S9G A;  3U9D A;  5JS1 A;  1OH5 A;  1HKB A;  5AQN A;  1O1W A;  4ISF A;  3ZSV A;  4A2B A;  1VSL A;  1TYQ B;  4B1W B;  5AQT A;  3O9S A;  2P9U A;  1NGB A;  3QFP A;  3G25 A;  3DXM A;  3THW A;  1C0G A;  3U4L A;  3CCJ N;  1HRH A;  5JS2 A;  1HLU A;  1C6V A;  1HJO A;  3MWP A;  4BR9 A;  3E66 A;  4ILH A;  3SQ1 A;  5M1P A;  4DFK A;  2O8B B;  3CCL N;  3SCX A;  2B5J A;  3AVH A;  3QBW A;  2GTD A;  1TL3 A;  2HST A;  1ASV A;  3C6T A;  5MLC Q;  3PY8 A;  4XIU A;  4H5W A;  4CHO A;  1RDU A;  1KVB A;  2NNW A;  5HLF A;  3PLA A;  3QDK A;  4H0Y B;  2HBJ A;  3MX5 A;  3VGM A;  3CF5 L;  4J2A A;  1N5Y A;  4DTS A;  2CGL A;  2OPS A;  1R59 O;  1OH6 A;  2HBK A;  4CED A;  4OGE A;  3SBG A;  3TAP A;  1EET A;  3C6A A;  4OJR A;  4JK7 A;  5SZT A;  1CZ9 A;  2I5J A;  4CHQ A;  3IMX A;  2YKM A;  5CR4 A;  2EHG A;  4CFB A;  3TTC A;  3OS1 A;  2NRT A;  3P5J A;  2V52 B;  3ZT3 A;  4CES A;  3DXK A;  4J8F A;  4CJ3 A;  4C1N K;  3B8A X;  3LZI A;  4DV1 K;  3A5O C;  3H08 A;  3MN5 A;  3FE1 A;  2E5L K;  3KLE A;  4H5V A;  1TKZ A;  3SAG A;  4JKF A;  2IS3 A;  1VSE A;  3IUC A;  1N33 K;  2QWL A;  4EHT A;  2UXD K;  3DLK A;  4MLH A;  1HPM A;  1WNS A;  3GDQ A;  4FPB A;  3MN9 A;  5C2F A;  2FSJ A;  5AQQ A;  2E20 A;  1WSF A;  2QKK A;  3LM9 A;  5CE3 A;  3AA5 X;  4FO0 A;  2F4V K;  1QVG M;  3TAE A;  1QE1 A;  3CFR A;  3V1R A;  3CFO A;  3SMS A;  4DSE A;  3VEY A;  1V4S A;  4PL7 A;  3CCE N;  1BQN A;  4O0J A;  1KLM A;  5BRH A;  3MDQ A;  1S1X A;  4OPA A;  1U48 A;  3HOS A;  1C1B A;  5KRS A;  2GUI A;  5LMU K;  2QWP A;  3OYD A;  1M90 O;  1WSG A;  1XNR K;  4FJ9 A;  3EY1 A;  3KWG A;  4B1Z A;  3L2Q A;  4M3Y A;  2ZWH A;  3OYI A;  4NCG A;  3RRG A;  3ZSO A;  4GW6 A;  3UKR B;  3EE9 A;  2RF2 A;  4AM6 A;  2I7P A;  1QQN A;  3SYZ A;  2V7Z A;  3O4N A;  4AHV A;  4KHS A;  2QWN A;  1U45 A;  2WON A;  3WNH A;  3NVK A;  2FXU A;  2E1Y A;  1YTA A;  1HYV A;  3DI6 A;  2IIR A;  3C65 A;  4H03 B;  3HM8 A;  5BR9 A;  1KSP A;  4FWM A;  3JYT A;  4KTQ A;  3VEW A;  3BEX A;  1GOB A;  1YJN N;  4BRF A;  3CME N;  1JCG A;  3VF4 A;  1RBT A;  1H1V A;  1RT1 A;  5BRD A;  3KJV A;  4L3Q A;  5B8H A;  3C6U A;  4B9V A;  3VEN A;  2ZGY A;  3SV4 A;  3AO2 A;  1LOT B;  4K0K K;  1LV5 A;  2PFU A;  4CJV A;  1KVC A;  4CEE A;  1X9J A;  1S6Q A;  4LH4 A;  4O5B A;  2UUA K;  1RT7 A;  3O9U A;  3TPQ A;  4CGH A;  2XY5 A;  4JI3 K;  4JK8 A;  3CCQ N;  5GIO A;  4JKA A;  4AHR A;  3LP2 A;  4B1U B;  2HHS A;  4LSL A;  4F8R A;  3D6R A;  3QEX A;  3ID6 A;  3CC2 N;  1KQS M;  1BOT O;  2F7T A;  3TSQ A;  4KHP K;  3M8P A;  5GAD P;  3CCR N;  3THW B;  3AVG A;  4BR0 A;  4DR2 K;  4FM1 A;  1MWK A;  1XHX A;  4MDA A;  2IVP A;  4K25 A;  4QOZ B;  4GVE A;  3ZEU B;  3KD1 E;  5AQU A;  1WB9 A;  4E3S A;  1KC8 O;  4HTL A;  5M1N A;  3OYL A;  4DSF A;  4JD2 B;  4CF9 A;  1Y64 A;  3NGY A;  2O8C A;  3VMF B;  3AVC A;  1HQU A;  3SK3 A;  4DTR A;  2HBM A;  2OA8 A;  3R8E A;  3WUH A;  3T1Y K;  4YOW A;  2QWQ A;  2NRX A;  2RN2 A;  4OVL A;  4KHQ A;  3R9P A;  3WXM B;  5FLX O;  1BA1 A;  3S41 A;  3MK6 A;  2E2N A;  4CBW A;  4BRO A;  1ZBI A;  4CHP A;  1BIS A;  1V4T A;  4K8Z A;  3KKR A;  5C42 A;  3NH0 A;  5AQK A;  3O08 A;  3SNN A;  2IOC A;  1OH8 A;  4AHT A;  3KKS A;  2V51 B;  4NLC A;  3WNG A;  4Z0U A;  2WOM A;  4YDU A;  3S9H A;  2HBL A;  3CJB A;  3ZET A;  3HP9 A;  5KRT A;  4F2S A;  3M8S A;  3RVC A;  4CK3 A;  3MXJ A;  4FJG A;  3G6E N;  1C0U A;  1NK0 A;  1J9A A;  2JWK A;  4E7J A;  3V9Z A;  1REV A;  1RTI A;  4CGJ A;  4GKK K;  1XC9 A;  5HRN A;  1U4B A;  3CET A;  1RT6 A;  3VQ9 A;  3ULE B;  2QXL A;  4ICL A;  2G8H A;  2BGG A;  4PKH A;  3ENB A;  4FOI A;  4K43 A;  3M6G A;  3KK3 A;  2HHH K;  5JVH L;  4DFJ A;  4FSV A;  3R6M A;  4JKG B;  4B3M K;  3VQ8 A;  4X65 K;  3T3F A;  1TK0 A;  2IAJ A;  1D5A A;  4BG9 A;  1ZBS A;  3DOK A;  2QTD A;  3QNN A;  4JLH A;  3ZT4 A;  2UXB K;  1BQM A;  3DWL A;  2RHK A;  3CJ9 A;  1RNH A;  5HOO A;  2BE2 A;  3MEC A;  4DCH A;  1SKS A;  4NXN K;  3AV9 A;  4IEI A;  2Z1I A;  1WSI A;  2D0P A;  2YNF A;  1QSS A;  4A62 A;  3CG7 A;  4WFN L;  1MA9 B;  4PKG A;  1EX4 A;  1M1K O;  4FVM A;  3I8D A;  3NDK A;  4FLV A;  3NVM A;  1JL1 A;  2OZM A;  3RTV A;  1C0F A;  3MCP A;  2D5R A;  4CEA A;  5E84 A;  2Q31 A;  3BZK A;  3M8R A;  1NGI A;  3SQ4 A;  4CD1 A;  3KK7 A;  1VSJ A;  2HOE A;  4DSI A;  4DV7 K;  3QET A;  4KHW A;  3LPU A;  1IBL K;  1EWR A;  3L3V A;  4BRN A;  4J2D A;  3GG4 A;  1ZXO A;  2B4J A;  1L3S A;  3T1A A;  4FK2 A;  2YCH A;  3GL1 A;  4IJA A;  1GLA G;  2ZJQ L;  1BL3 A;  3EEQ A;  3DXK B;  1DT9 A;  3OBY A;  2CH5 A;  4Y1D A;  3NAE A;  1Q81 O;  2QEX N;  3VQ4 A;  3D7E O;  5TKW A;  4M3T A;  3UKR A;  1IKV A;  4B9U A;  3WQT A;  3AAQ A;  4CIE A;  2IC3 A;  1YVN A;  4JN4 A;  4LY7 A;  3TSU A;  3EZ5 A;  2KKZ A;  1HPZ A;  2P9N A;  2O8F A;  2D0C A;  5BPM A;  1NM1 A;  2KFN A;  2PAV A;  1S5J A;  5IWA K;  3ID8 A;  1ZBL A;  4LFB K;  1E4G T;  4K8X A;  4CEO A;  4BE1 A;  3QO9 A;  3BDP A;  3M8Q A;  3TTD A;  2HHU A;  4ILJ A;  2HNY A;  4JI8 K;  1EP4 A;  4O5F A;  4CJU A;  3QB0 A;  2NRR A;  2VWB A;  4CJE A;  4Q0B A;  2VWJ A;  3VQA A;  3O6W A;  4KTW A;  4JKG A;  3ULE A;  4LF7 K;  2GBZ A;  1CXU A;  2ZJR L;  2EX3 A;  3O9R A;  4KI4 A;  3AVL A;  4M3U A;  4X64 K;  2P9S B;  4DV6 K;  4BC5 A;  2Z1J A;  4CER A;  4JI6 K;  1EKE A;  4ILG B;  1GOA A;  4DR1 K;  4F3T A;  5KGX A;  4BRK A;  5M1K A;  4JI1 K;  1KFS A;  2E6M A;  3G4S N;  3VOV A;  1ESV A;  1JLB A;  5C0Y A;  3BY5 A;  1FKP A;  4DV0 K;  4U7B A;  2DFF A;  1WLJ A;  3CQ8 A;  1VK0 A;  2YJE A;  4JKH A;  1OKJ A;  4RG8 A;  1HKC A;  2AP1 A;  3FFI A;  3QEW A;  1NK8 A;  1ASU A;  3H46 O;  4DTU A;  4PQU A;  1QVF M;  1KFD A;  3AVB A;  5GAG P;  1JCE A;  5LY3 A;  3SUO A;  2W42 A;  1VQP N;  4ZTJ A;  3LDQ A;  1G99 A;  3WEE A;  1EO1 A;  4A5B A;  4H0T B;  3A5M C;  3N4Q A;  1BDG A;  2XRI A;  2P9L B;  4WQ4 A;  4JAX A;  2IDO A;  3ZX2 A;  3DLL L;  2OAN A;  2P9K A;  3JS6 A;  4DQR A;  3SPY A;  3C94 A;  3ZYY X;  3S3O A;  3QIO A;  3E01 A;  4QAG A;  3HJF A;  2YV0 X;  1NGA A;  3UB5 A;  1RBU A;  4W5Q A;  2A41 A;  2IVN A;  3WXL A;  4NCB A;  3U3G A;  4QS7 A;  3BGR A;  1JLA A;  4GV6 A;  4E1J A;  3AVK A;  3M5R A;  3IDH A;  3RMB A;  3D2E B;  4CIG A;  4A2A A;  4LFC K;  1G15 A;  1SQK A;  3VQ5 A;  3QFU A;  4B9Q A;  1Q9X A;  1X1P A;  1Z05 A;  3S3M A;  3C6H A;  5FRM A;  2HF3 A;  3T7Z A;  2VCP A;  3D2F B;  2ITM A;  4EP5 A;  1NJI O;  2DTU A;  4JD2 A;  3NBP A;  5GIP A;  1NJY A;  4KFB A;  1HX1 A;  4JI2 K;  3OYN A;  5FDL A;  2OTJ N;  2NRZ A;  3PX0 A;  5JVG L;  3ENO A;  1YIT N;  4DFP A;  1D4X A;  3ZT2 A;  3E9L A;  4GMJ B;  3AVJ A;  1VAZ A;  2WUS A;  3J7Y P;  4CFA A;  3TAR A;  4FJI A;  2Y1J A;  2A42 A;  4BC2 A;  4DLG A;  4KI6 A;  4YOX A;  5AQI A;  4GVM A;  1NNE A;  3WEE B;  4UQG A;  2ZM6 K;  1NK5 A;  1JJ2 M;  5AQR A;  1VQ5 N;  1TK8 A;  3DOL A;  3FZH A;  3OYG A;  5AQF A;  1SV5 A;  1NK7 A;  4OPK A;  4DQS A;  1HYZ A;  3O1B A;  5KI6 A;  4Q5V A;  3SAF A;  2QXF A;  3HM9 A;  5SWM A;  4B3S K;  3V9W A;  4DU1 A;  3TI0 A;  3V9U A;  2FBX A;  2P51 A;  5AQV A;  1RTJ A;  3ZET B;  4M3W A;  1ITG A;  3WXK A;  1ZC6 A;  2GEM A;  1UA1 A;  3QBX A;  2X6S A;  1DTQ A;  5KQ8 A;  1IH7 A;  1NJZ A;  1R0A A;  2P9K B;  3BZC A;  3PSF A;  5AQM A;  5BRF A;  2P9P A;  4A59 A;  4DTN A;  2F8T A;  1NJW A;  4KV8 A;  3K9K A;  2DPN A;  4AHC A;  3OYA A;  4R79 A;  1N8R O;  5J2P A;  2FLO A;  4OX9 K;  4CI6 A;  4OO1 J;  3KLI A;  4IO9 L;  4RW9 A;  4HWI A;  1W7A A;  3AA3 A;  3O1W A;  5J2M A;  5J2N A;  3MXM A;  4M45 A;  1WBD A;  2X78 A;  3VGK A;  3LWL A;  2O8F B;  1X9W A;  4BRI A;  2O8E A;  5DK5 A;  2O8D B;  5I42 A;  4TSX A;  1VQ9 N;  3AO5 A;  3J80 O;  1CZA N;  1GOC A;  4CF2 A;  3AAR A;  3KK1 A;  4FWQ A;  2H3G X;  2HMP A;  5A2Q O;  3MX2 A;  4DFM A;  1ZBF A;  2P9I B;  4AF1 A;  3TAF A;  1JCF A;  3EZW A;  4IDH A;  1NGH A;  1S6P A;  4E7H A;  1HNW K;  1RDB A;  3LDN A;  1EQY A;  3OYF A;  2A1R A;  2Q0U A;  2NRW A;  4MDB A;  4OPH A;  3OBW A;  4MO5 A;  3VTH A;  3RR7 A;  1TUY A;  4BVP A;  5KQD A;  4CEF A;  1U49 A;  4FXD A;  4NCA A;  3SLC A;  4IFV A;  4MLE A;  1NK4 A;  5C24 A;  3ATU A;  3I0S A;  4C1N I;  4Y1C A;  3C0B A;  3PIP L;  2A1S A;  1RDW X;  4FJ8 A;  2R7Y A;  1YUW A;  1BGX T;  2EWS A;  2E2P A;  3LDP A;  4AM7 A;  4Z4C A;  4BR5 A;  1JLQ A;  3FZM A;  4MFB A;  3SJH A;  4K41 A;  4CK2 A;  3RSE B;  2D0O A;  1Q86 O;  3E1Y A;  2G8W A;  4JRP A;  4C8K A;  4CHN A;  3OHR A;  2VGM A;  4CGD A;  3CPW M;  4BRM A;  3NFA A;  3OJS A;  2O8B A;  3QIN A;  3K5N A;  2HHV A;  1BCM A;  1RT3 A;  4WE1 A;  5BN9 A;  4H0V B;  4W5O A;  4LSN A;  3THV A;  1BIU A;  1IO2 A;  1HYS A;  1LCU A;  5M1F A;  4CIF A;  4CEQ A;  4CZJ A;  5E26 A;  3LL3 A;  4A5A A;  1U2V B;  3ATV A;  4DV4 K;  1QQC A;  2QW9 A;  1YHQ N;  4N76 A;  1SS6 A;  4MQ3 A;  3RWU A;  4NB4 A;  1L5U A;  1CXQ A;  4DU3 A;  1TUU A;  2YNI A;  4B3O A;  3O5B A;  1S3X A;  4N5S A;  4M7Y A;  4HTU A;  3VA0 A;  3L0Q A;  2FBY A;  4KH4 A;  1GLJ O;  2G8K A;  1A5W A;  4FL9 A;  3J8A A;  1OVQ A;  4BRH A;  3RRH A;  3CJ7 A;  5E41 A;  1VQO N;  1TVR A;  1WUA A;  1N36 K;  1D8Y A;  2QA4 N;  1RDC A;  2D0A A;  4CF8 A;  4FJ7 A;  4DMN A;  1RT4 A;  5GIN A;  3VF6 A;  4L8R B;  2XO7 A;  3V4I A;  3QML A;  5J1E A;  3QES A;  2KZM A;  3ZLJ A;  4LH5 A;  4PY5 A;  3THY A;  3TAB A;  1ZYQ A;  2HB5 A;  1VSM A;  4M41 A;  2YX6 A;  5BPL A;  1HR0 K;  1HUX A;  3AO4 A;  4C8N A;  4DF8 A;  4AHS A;  1GLD G;  1DGK N;  1E3M A;  3V1Q A;  4KHN A;  1GLC G;  1W97 L;  3I0R A;  3O4Q A;  3VPZ A;  5BN8 A;  1IBM K;  3HK2 A;  3MAQ A;  3G10 A;  4CHZ A;  4FLU A;  2E1Z A;  1Y97 A;  4DLE A;  1YAG A;  4KAZ A;  4PWD A;  1C0M A;  1GLB G;  3OYH A;  2VYP A;  1W2B M;  4CJQ A;  2Q2R A;  4X62 K;  3CPE A;  1XMO K;  1Q18 A;  4JKD A;  4H5N A;  4CFD A;  4N56 A;  3AVF A;  3O3F A;  3DLB A;  4F4K A;  3S3N A;  2PYL A;  5CYM A;  5T7B A;  1BWF O;  2PY5 A;  2G8V A;  5AQZ A;  3L2U A;  4FM0 A;  3PIO L;  4FJL A;  4M42 A;  3TU5 A;  3FGU A;  4DS4 A;  1XWL A;  3NH2 A;  5EU7 A;  2UUB K;  4JS4 A;  2W6K A;  4GV9 A;  3CJA A;  4MO4 A;  4ELV A;  2VGN A;  1XQS C;  3NGZ A;  2HVH A;  4A57 A;  3P31 A;  4PA1 A;  4FYD A;  5AQL A;  1VQN N;  4FJM A;  2VQE K;  1D9D A;  4CCH A;  4FJX A;  4W5T A;  2BAN A;  3T69 A;  1I94 K;  4B1V A;  4IZ9 A;  3LDS A;  4U67 L;  1NKC A;  3D2E A;  2XHB A;  4O44 A;  2Q97 A;  3HO1 A;  2YI1 A;  4AHU A;  3ULD A;  4JI5 K;  3DAW A;  4I2P A;  3KLG A;  3RMD A;  1TL1 A;  2W6L A;  3K5M A;  3FLC O;  4JKE A;  4IFE A;  1P8Z A;  4B8C A;  4KB0 A;  3HBT A;  2O8E B;  4Z4I A;  4FJH A;  4PUO A;  1UOC A;  5HRR A;  4CZH A;  3VF2 A;  3F73 A;  1SUQ A;  1NOZ A;  5FRN A;  2VG7 A;  1BUP A;  1NG9 A;  1JXB A;  4QS8 A;  5AZI A;  4RW8 A;  4LF4 K;  3CM6 A;  2KW4 A;  2V7Y A;  1UA0 A;  2YHY A;  3NGI A;  3PX6 A;  4CJR A;  3PX4 A;  3VQ7 A;  3MCA B;  1QQM A;  1NKE A;  4KH6 A;  4XH4 A;  3I33 A;  2YHA A;  3ALY A;  4DV5 K;  2J4R A;  3AO1 A;  4KTZ A;  4BC4 A;  4DSL A;  1C1C A;  5CZ2 A;  4EZ6 A;  1K73 O;  4NYF A;  1KCF A;  2X74 A;  2GV9 A;  1RBV A;  3LM2 A;  3QNO A;  3NH1 A;  4YY3 K;  1GLF O;  1Q9Y A;  5M1O A;  1VHX A;  4W5N A;  4EFH A;  1T7P A;  3QEP A;  2ITG A;  3AA2 A;  3HPH A;  3OYM A;  5HP1 A;  3VQD A;  4JI0 K;  1JLG A;  4Y0W A;  2BTF A;  5EX5 A;  3VQC A;  2P9P B;  3VEO A;  1WBB A;  3OYB A;  1U47 A;  4CW7 B;  1HNZ K;  1KXP A;  3VGL A;  3HRG A;  2VWK A;  5KPT A;  2AJQ A;  4IOA L;  1RIL A;  3ZSY A;  4YHH K;  2O4G A;  2E6L A;  4BRQ A;  2UUC K;  4JNE A;  1IKW A;  1K8K B;  3M1F A;  5HRP A;  3KZB A;  3TWH A;  5BPN A;  3OYJ A;  1C0T A;  1CZB A;  3NF7 A;  4J2E A;  1RGI A;  2LSN A;  3CCS N;  4CBU A;  4E19 A;  2DFH A;  1QSL A;  4DSJ A;  4NXM K;  3DYA A;  3D0P A;  4LFA K;  4BWM A;  4IBN A;  4YOT A;  3JXU A;  1GLL O;  4H5T A;  4B8A B;  3P39 A;  1VSF A;  2UU9 K;  4WFA L;  1Q8I A;  4H5R A;  4JS5 A;  1K6Y A;  3SBT A;  3SUN A;  3A5N C;  4DG1 A;  1IKY A;  3K9J A;  1XUP O;  4CZI A;  3MN7 A;  1NGG A;  1QS4 A;  3MMV A;  2F96 A;  4KH5 A;  2GWJ A;  4FPA A;  1MWM A;  3KK2 A;  3TAG A;  4JHD A;  4FWO A;  4CEB A;  1VQ4 N;  4B08 A;  4O4G A;  1RBR A;  3GE1 A;  4KKO A;  2CGJ A;  4ZTF A;  4FVU A;  1F21 A;  2CGK A;  2QWR A;  4R5P A;  1TKT A;  2A5X A;  2WC9 A;  3O80 A;  4FWL A;  5AZJ B;  3ITH A;  5C25 A;  4YNQ A;  4CZK A;  4ISE A;  4IO8 A;  4DQI A;  1L3V A;  1FXX A;  4FW2 A;  2Q36 A;  4E1N A;  3IFR A;  1YXQ A;  3LPT A;  4IG3 A;  3WNE A;  4BY9 C;  1DKG D;  4IOC L;  3AVN A;  1WSH A;  4DR5 K;  4KHU A;  3NF9 A;  4DKW A;  1BA0 A;  4I6M B;  3A2F A;  1YJW N;  4KHY A;  3LP3 A;  1TYQ A;  3CER A;  4DQP A;  5HL7 L;  1XNQ K;  3E9O A;  5F1X A;  3J7Z O;  1NGE A;  1OH7 A;  1SAZ A;  5AQO A;  3HST B;  3H1V X;  3H6E A;  5J2Q A;  5LJV A;  2FF6 A;  1SKR A;  4IOX A;  1J6Z A;  3T1H K;  5EY4 A;  4JRQ A;  2F9T A;  4E7L A;  1Z6R A;  4FLX A;  3HT3 A;  2YKN A;  2ASO A;  3PSI A;  1VSI A;  2W40 A;  2KTQ A;  1X3N A;  4WYB A;  1UAX A;  1K8K A;  2WFB A;  4DTJ A;  3IS9 A;  5BRE A;  3AY9 A;  4CFC A;  5AFU A;  3J7A P;  1EXQ A;  1W0H A;  2UYT A;  4LF5 K;  3DRR A;  4M3R A;  1LW0 A;  3HL8 A;  1LWE A;  3HYF A;  4EP4 A;  4GKJ K;  2NUB A;  2A3Z A;  4FLY A;  3DM2 A;  5CY4 A;  4CZG A;  5DMR A;  4DSK A;  4Z4G A;  3FZK A;  4C8M A;  1ZBU A;  1S1U A;  3G0Z A;  1A5V A;  4JI4 K;  1FK9 A;  3AAP A;  1YJ9 N;  5LMN K;  2XY7 A;  3G71 N;  4CJT A;  2E2O A;  5GAH P;  3MWT A;  4CJ7 A;  3W3D A;  1KAZ A;  3THX B;  4W5R A;  1RDD A;  3D45 A;  4CJF A;  3L2R A;  1NWK A;  1T05 A;  2KFZ A;  4CJ4 A;  3CQX A;  4FWS A;  3B6O A;  3LWM A;  1TAQ A;  2P9I A;  4HUG A;  4IG0 A;  3O3G A;  3H45 C;  3ZEU A;  4OKK A;  4C8O A;  3R1X A;  3VEX A;  3DMJ A;  4BGB A;  4I7F A;  4UY8 O;  1GLE G;  1TGO A;  5JLF A;  3UKU A;  2HVI A;  3ZSX A;  1VQM N;  5AQY A;  5FPD A;  3QER A;  3NF6 A;  1S22 A;  1HNX K;  1BIZ A;  1WAJ A;  5FPM A;  4BR4 A;  2GEL A;  1WSJ A;  4OLA A;  2Z1H A;  1NGF A;  3EYZ A;  3VEZ A;  2GX9 A;  4YOY A;  4K42 A;  3OS0 A;  1EWQ A;  5BR8 K;  3HTV A;  5C10 A;  2HNZ A;  1Q7Y O;  4WCE L;  3GBT A;  3CIP A;  2FBV A;  3LAK A;  5C2D A;  5JIC A;  3PV8 A;  4FJK A;  1FW6 A;  3V6D A;  1O13 A;  3CJ1 A;  4DR4 K;  1RTH A;  3ZT0 A;  2RKI A;  1QZ5 A;  3LDL A;  4CEZ A;  4IJN A;  3CD6 N;  1N6Q A;  1QHT A;  2QKB A;  3P38 A;  3CMA N;  2ETJ A;  1HMV A;  2X6N A;  4FJJ A;  3PO5 A;  1J53 A;  1S1V A;  5TKY A;  3UE5 A;  3O8M A;  3VET A;  4DV2 K;  3ZSW A;  4J2B A;  3ZX3 A;  4XH5 A;  3V81 A;  3N4P A;  1HNV A;  3F9M A;  3CCV N;  4CJ5 A;  4DV3 K;  4BDP A;  4E1M A;  2D1K A;  5AFU H;  2RE2 A;  3OJU A;  4M63 C;  2O8D A;  3DRP A;  4RTF D;  2XY8 A;  2A40 A;  5KPR A;  1RCH A;  3SUP A;  5AZJ A;  3SJJ A;  1RTD A;  1KVA A;  3IAY A;  4BRP A;  3THX A;  1IG8 A;  3L4I A;  4DR6 K;  4OPJ A;  4Z4H A;  5AZI B;  4CF0 A;  3BF3 A;  2RPI A;  3FR0 A;  3DJC A;  3CM5 A;  4JHD B;  4BRL A;  5M1Q A;  1VQL N;  1SZ2 A;  2QWO A;  1VSK A;  3U9Z A;  3L8B A;  1X9S A;  4CBX A;  4FLW A;  4AIL C;  2BDP A;  1TKD A;  3P83 D;  3L3U A;  2G8U A;  2OCE A;  3H3O B; 
#chains in the Genus database with same CATH homology
 4CGF A;  3L2U A;  4BWJ A;  4FM0 A;  3QET A;  4KHW A;  3LPU A;  3DRS A;  1B92 A;  3DLG A;  1RDA A;  4FJL A;  3L2W A;  3K2P A;  1J54 A;  4M42 A;  1VRU A;  3L3V A;  2IGI A;  1VSD A;  4DS4 A;  1D9F A;  1XWL A;  4J2D A;  5I3U A;  1SL1 A;  3NH2 A;  1SL0 A;  4FK0 A;  5EU7 A;  2B4J A;  3SPZ A;  4JS4 A;  4FM2 A;  1L3S A;  2DY4 A;  1WAF A;  4E89 A;  3HPO A;  3OY9 A;  3DLH A;  1J5O A;  4ELV A;  3T1A A;  2HVH A;  3NGZ A;  3IRX A;  4FK2 A;  4DQQ A;  1BL3 A;  2VG5 A;  2HHQ A;  4I9Q A;  3VQE A;  4BE2 A;  2G8I A;  3VQ6 A;  4PA1 A;  4OKE A;  4Y1D A;  4FLZ A;  2ZQB A;  3NAE A;  1X9M A;  2FBT A;  3MEE A;  4FYD A;  4E7K A;  3VQ4 A;  4FJM A;  3NHG A;  4M3T A;  1D9D A;  4CCH A;  4FJX A;  4W5T A;  2BAN A;  3IG1 A;  1IKV A;  4B9U A;  4AH9 A;  4CIE A;  2IC3 A;  2P5O A;  4LY7 A;  2B6A A;  1NKB A;  4FW1 A;  2XY6 A;  3SV3 A;  3CFP A;  4DU4 A;  2QK9 A;  4G1Q A;  2O4I A;  2OPR A;  3LDS A;  2JLE A;  1ASW A;  3EZ5 A;  1NKC A;  4ELU A;  4BDZ A;  4IKF A;  2XHB A;  1JLE A;  4O44 A;  3HO1 A;  1HPZ A;  4AHU A;  3ULD A;  3KD5 E;  4ID1 A;  2D0C A;  2KFN A;  4C8L A;  4I2P A;  3KLG A;  3K57 A;  1S5J A;  3RMD A;  2D0B A;  1ZBL A;  1JLF A;  3C95 A;  1TL1 A;  2P1J A;  3K5M A;  3MXI A;  4CEO A;  4I2Q A;  4BE1 A;  4K8X A;  3QO9 A;  4KRE A;  2Q3S A;  2G8F A;  4B8C A;  4KB0 A;  3BDP A;  4Z4I A;  3M8Q A;  4RW4 A;  2HHU A;  4FJH A;  4PUO A;  1UOC A;  5HRR A;  2HNY A;  1EP4 A;  3SQ0 A;  5HRO A;  1DTT A;  3F73 A;  1L3U A;  4CJU A;  1SUQ A;  3ZSZ A;  1NOZ A;  4CJE A;  3NE6 A;  3K58 A;  1I3A A;  3MEG A;  2VWJ A;  2VG7 A;  3VQA A;  4B9T A;  3RR8 A;  4CE9 A;  4Q0B A;  4KTW A;  4CF1 A;  2GBZ A;  1CXU A;  1JXB A;  3HPG A;  2EX3 A;  4KI4 A;  4M3U A;  3AVL A;  4RW8 A;  1HQE A;  3HVR A;  3CM6 A;  2KW4 A;  1UA0 A;  1T8E A;  3NGI A;  4Z4F A;  3PX6 A;  1S9G A;  4CJR A;  3PX4 A;  2Z1J A;  3VQ7 A;  4CER A;  3OYE A;  1EKE A;  1NKE A;  5JS1 A;  1GOA A;  2ZE2 A;  1O1W A;  2YHA A;  3ZSV A;  5KGX A;  1VSL A;  3O3H A;  4F3T A;  1KFS A;  3ALY A;  2E6M A;  3AO1 A;  4KTZ A;  4DSL A;  4FCY A;  1C1C A;  1LWF A;  1JLB A;  5CZ2 A;  4EZ6 A;  4DTP A;  4I9L A;  1FKP A;  1HRH A;  3DLE A;  4NYF A;  5JS2 A;  2DFF A;  1KCF A;  2X74 A;  4CK1 A;  3HXM A;  1WLJ A;  2GV9 A;  1RBV A;  1C6V A;  3QNO A;  3NH1 A;  3CQ8 A;  4FZX C;  1VK0 A;  3SQ1 A;  4DFK A;  1Q9Y A;  4RG8 A;  3SCX A;  2B5J A;  3AVH A;  3FFI A;  1TL3 A;  3QEW A;  1ASU A;  1NK8 A;  1ASV A;  3C6T A;  3PY8 A;  4DTU A;  1T7P A;  4XIU A;  3QEI A;  3QEP A;  1ZBH A;  1LW2 A;  1JKH A;  4CHO A;  2ITG A;  1KFD A;  3AVB A;  3AA2 A;  3HPH A;  3AA4 A;  3OYM A;  3VQD A;  5HP1 A;  1KVB A;  3SUO A;  2W42 A;  4HUE A;  5HLF A;  4ZTJ A;  1JLG A;  3AO3 A;  3F9K A;  1RBS A;  3VQC A;  3NCI A;  4J2A A;  1N5Y A;  3OYB A;  1S1W A;  4DTS A;  1U47 A;  4H4O A;  2XRI A;  2OPS A;  2IDO A;  2VWK A;  3MED A;  2AJQ A;  4CED A;  1VSH A;  4OGE A;  1RIL A;  3ZSY A;  4DQR A;  3SPY A;  2O4G A;  2E6L A;  3TAP A;  3C94 A;  4F2R A;  1IKW A;  1JL2 A;  3QIO A;  5HRP A;  3S3O A;  1EET A;  3E01 A;  4OJR A;  3VA3 A;  3TWH A;  4QAG A;  3HJF A;  1Z26 A;  5SZT A;  1S1T A;  1CZ9 A;  2I5J A;  2YV0 X;  4CHQ A;  4QCL A;  1RBU A;  4W5Q A;  3OYJ A;  1JXE A;  4B9N A;  4CJL A;  4FJN A;  1C0T A;  2YKM A;  4O55 A;  4CFB A;  2EHG A;  1CZB A;  4IDK A;  3NF7 A;  3OS1 A;  3KTQ A;  4FJ5 A;  3P5J A;  4J2E A;  4NCB A;  2LSN A;  3U3G A;  3BGR A;  1JLA A;  3ZT3 A;  4E19 A;  4CHY A;  2DFH A;  1T03 A;  3AVK A;  1QSL A;  4CES A;  3V9X A;  4DSJ A;  3RMB A;  3DYA A;  4CJ3 A;  4ZHR A;  3D0P A;  4BWM A;  4IBN A;  4CIG A;  1G15 A;  3LAL A;  4OGC A;  3VQ5 A;  4B8A B;  3LZI A;  3H08 A;  1Q9X A;  4E7I A;  1VSF A;  1X1P A;  3VQP A;  3KLE A;  3S3M A;  2P5G A;  3AVM A;  5FRM A;  1Q8I A;  4JS5 A;  1CLQ A;  1TKZ A;  1S9E A;  1K6Y A;  2IS3 A;  1BCO A;  3SUN A;  4DG1 A;  1VSE A;  4H4M A;  4EP5 A;  1IKY A;  4DF4 A;  2DTU A;  3VQB A;  3DLK A;  3NBP A;  1NJY A;  2YHB A;  1WNS A;  3ISN C;  4KFB A;  3P1G A;  4M3Z A;  1QS4 A;  2F96 A;  3OYN A;  5FDL A;  3PX0 A;  1WSE A;  4PQU A;  3ZT1 A;  1VRT A;  4DFP A;  4N47 A;  1LAW A;  1WSF A;  3ZT2 A;  3KK2 A;  3TAG A;  4W5N A;  2QKK A;  3CYM A;  4GMJ B;  3AA5 X;  3AVJ A;  2ZD1 A;  3TAE A;  1QE1 A;  4CEB A;  3KLH A;  4B08 A;  3CFR A;  4CFA A;  3V1R A;  3CFO A;  3TAR A;  4DSE A;  4FJI A;  4O4G A;  2Y1J A;  2YNG A;  4DLG A;  4KI6 A;  2HW3 A;  4CJK A;  1RBR A;  4KKO A;  4GVM A;  4ZTF A;  1BQN A;  1NJX A;  1F21 A;  4O0J A;  4CGG A;  4UQG A;  1KLM A;  4R5P A;  1TKT A;  1NK5 A;  1S1X A;  1TK8 A;  3DOL A;  3ITH A;  3OYG A;  5C25 A;  1SV5 A;  3QIP A;  4YNQ A;  1NK7 A;  1C1B A;  5KRS A;  3V1O A;  4OPK A;  3TAN A;  2GUI A;  1U48 A;  4B9L A;  4DQS A;  4DQI A;  1L3V A;  1HYZ A;  1FXX A;  5KI6 A;  3ZSR A;  4FW2 A;  3OYD A;  1NOY A;  1WSG A;  4E1N A;  4Q5V A;  3SUQ A;  4FJ9 A;  4NYN A;  3U6F A;  3EY1 A;  2QXF A;  3LPT A;  4O0I A;  3L2Q A;  3HM9 A;  4M3Y A;  3OYI A;  2F8S A;  4IG3 A;  3WNE A;  4NCG A;  3RRG A;  3ZSO A;  4GW6 A;  5SWM A;  2RF2 A;  3AVN A;  5CZ1 A;  4FZZ A;  4KPY A;  4BDY A;  1WSH A;  4KHU A;  3V9W A;  4DU1 A;  3NF9 A;  3SYZ A;  3OYC A;  3TI0 A;  3O4N A;  4AHV A;  3A2F A;  4KHS A;  2FBX A;  2HHW A;  1U45 A;  4ELT A;  2P51 A;  1HNI A;  3LP3 A;  4KHY A;  3KIO A;  3T19 A;  1RTJ A;  2WON A;  3K5L A;  3WNH A;  4M3W A;  1XI1 A;  4DQP A;  1ITG A;  4DTM A;  1YTA A;  1UA1 A;  2X6S A;  1HYV A;  1DTQ A;  3DI6 A;  2HHT A;  1IH7 A;  1NJZ A;  1R0A A;  1FKO A;  1SKW A;  2Z1G A;  1QTM A;  3HST B;  1KSP A;  3ZSQ A;  1TV6 A;  3JYT A;  4KTQ A;  4DTN A;  5J2Q A;  1GOB A;  4OKJ A;  1TK5 A;  2F8T A;  1B9F A;  4HVJ A;  1BHL A;  1NJW A;  4KV8 A;  1SKR A;  4AHC A;  3OYA A;  1TAU A;  1RBT A;  4JRQ A;  5J2P A;  3DLR A;  1RT1 A;  3K5O A;  3V9S A;  4E7L A;  4FLX A;  3KJV A;  3HT3 A;  2YKN A;  3KLI A;  4CJP A;  1SL2 A;  3C6U A;  4B9V A;  1VSI A;  3SV4 A;  3AO2 A;  2KTQ A;  4RW7 A;  1LV5 A;  4RW9 A;  4CJV A;  1KVC A;  4CEE A;  3L2V A;  4FZY A;  1UAX A;  1A5X A;  1S6Q A;  3AA3 A;  4LH4 A;  4O5B A;  5J2M A;  5J2N A;  3MXM A;  4M45 A;  1RT7 A;  2X78 A;  4CGH A;  3LWL A;  4DTJ A;  2XY5 A;  1X9W A;  3IS9 A;  1YTU A;  1RT5 A;  3LP1 A;  5DK5 A;  5I42 A;  4TSX A;  4N41 A;  4AHR A;  1YVU A;  3LP2 A;  4CFC A;  3AO5 A;  3PO4 A;  3LAN A;  2HHS A;  4LSL A;  4F8R A;  1EXQ A;  1GOC A;  1W0H A;  3QEX A;  1IKX A;  1RT2 A;  3DRR A;  4M3R A;  1LW0 A;  3HL8 A;  1LWE A;  3HYF A;  4EP4 A;  4CF2 A;  3M8P A;  3KK1 A;  3AVG A;  2NUB A;  5HRS A;  2OZS A;  4OLB A;  4FM1 A;  4FLY A;  1Z25 A;  3DM2 A;  2HMI A;  4DFM A;  5CY4 A;  5DMR A;  1ZBF A;  4YFU A;  3TAF A;  1XHX A;  4DSK A;  4Z4G A;  4C8M A;  1S6P A;  1ZBU A;  4E7H A;  1RDB A;  1S1U A;  3KD1 E;  4QOZ B;  3G0Z A;  4KRF A;  1A5V A;  1FK9 A;  3OYF A;  4E3S A;  2Y1I A;  2A1R A;  3OYL A;  4DSF A;  4CF9 A;  1NK6 A;  3NGY A;  2XY7 A;  3TR8 A;  4CJT A;  4BE0 A;  4FK4 A;  3AVC A;  3RR7 A;  1HQU A;  4DTR A;  1NK9 A;  4CEF A;  2OA8 A;  1U49 A;  4FXD A;  4W5R A;  4NCA A;  2HHX A;  1RDD A;  3D45 A;  4CJF A;  3LZJ A;  2RN2 A;  4IFV A;  4OVL A;  4DS5 A;  3L2R A;  4CJS A;  1NK4 A;  1IG9 A;  4KHQ A;  5HBM A;  5C24 A;  1T05 A;  2KFZ A;  3I0S A;  3U3Y A;  4Y1C A;  4CJ4 A;  3B6O A;  3LAM A;  3LWM A;  1TAQ A;  4HUG A;  4IG0 A;  3O3G A;  2A1S A;  2YNH A;  5D3G A;  3RMA A;  5CYQ A;  4FLT A;  4FJ8 A;  4OKK A;  2R7Y A;  1ZBI A;  4C8O A;  3QLH A;  4CHP A;  1MU2 A;  1BIS A;  3DMJ A;  1WN7 A;  4IFY A;  4K8Z A;  1BI4 B;  1BGX T;  4I7F A;  1TGO A;  4Z4C A;  3KKR A;  1JLQ A;  2HVI A;  3ZSX A;  5C42 A;  3NH0 A;  4MFB A;  4DWI A;  2KQ2 A;  1LAV A;  3SNN A;  2IOC A;  4CK2 A;  2G8W A;  1U04 A;  3VN5 A;  4AHT A;  4JRP A;  1I39 A;  4C8K A;  3QER A;  3KKS A;  3QEV A;  3VQQ A;  3NF6 A;  4CHN A;  4CGD A;  4Z4E A;  3NF8 A;  3WNG A;  4Z0U A;  3RMC A;  2WOM A;  4M3X A;  1BIZ A;  3S9H A;  3NFA A;  3OJS A;  1DLO A;  1WAJ A;  3QIN A;  4CGI A;  3K5N A;  2HHV A;  4HHT A;  3HP9 A;  5KRT A;  1BCM A;  1RT3 A;  4WE1 A;  3SI6 A;  4F2S A;  3M8S A;  5KGW A;  1KRP A;  4W5O A;  2JGU A;  1WSJ A;  4B9M A;  5K14 A;  4OLA A;  2Z1H A;  1L3T A;  4LSN A;  4HUF A;  4CK3 A;  3LP0 A;  3THV A;  1BIU A;  3MXJ A;  4FJG A;  1IO2 A;  1HYS A;  3EYZ A;  4CIF A;  4HCB A;  4CEQ A;  3OS2 A;  4F3O A;  1C0U A;  1NK0 A;  4KB1 A;  1J9A A;  3OS0 A;  4E7J A;  1XHZ A;  3V9Z A;  1REV A;  1RTI A;  2E4L A;  2PYJ A;  4CGJ A;  1QQC A;  4BAC A;  2HNZ A;  4MQ3 A;  3RWU A;  3HVT A;  3OVN A;  4DTX A;  1XC9 A;  5HRN A;  4N76 A;  1U4B A;  2FBV A;  3LAK A;  3PV8 A;  1L5U A;  1CXQ A;  3HP6 A;  4DU3 A;  4FJK A;  2YNI A;  1RT6 A;  4B3O A;  3VQ9 A;  4N5S A;  4HTU A;  3VA0 A;  2OPQ A;  3V6D A;  2FBY A;  4H8K A;  1RTH A;  4ICL A;  3ZT0 A;  4DTO A;  2G8H A;  2RKI A;  2BGG A;  2G8K A;  1KLN A;  4HCC A;  1A5W A;  4CJW A;  2ATQ A;  4LD0 A;  1B9D A;  4CEZ A;  3ASM A;  3RRH A;  1N6Q A;  5E41 A;  1TKX A;  1QHT A;  1TVR A;  2QKB A;  2ETJ A;  3B6P A;  1HMV A;  3TAM A;  3KK3 A;  1D8Y A;  3AVA A;  1RDC A;  4DFJ A;  2D0A A;  2X6N A;  4FJJ A;  1C1A A;  4CF8 A;  3PO5 A;  3VQ8 A;  4FJ7 A;  1J53 A;  1S1V A;  3TAQ A;  4DMN A;  4EZ9 A;  1RT4 A;  3ZSW A;  3T3F A;  2IAJ A;  1KTQ A;  1TK0 A;  1D5A A;  1HJR A;  4J2B A;  3V81 A;  4L8R B;  2XO7 A;  1JLC A;  2OPP A;  3DOK A;  1HNV A;  3V4I A;  3OYK A;  4CJ5 A;  3QNN A;  5J1E A;  1W9H A;  3QES A;  2KZM A;  4JLH A;  3ZT4 A;  4BDP A;  4E1M A;  1BQM A;  4LH5 A;  4PY5 A;  3JSM A;  4CEC A;  2DFE A;  2FC0 A;  3OJU A;  2KZZ A;  3TAB A;  1RNH A;  1ZYQ A;  2HB5 A;  1VSM A;  5FRO A;  2BE2 A;  3DRP A;  4M41 A;  3UIQ A;  3MEC A;  3AO4 A;  4C8N A;  3WNF A;  3PUF A;  4DF8 A;  4AHS A;  1SKS A;  2XY8 A;  3AV9 A;  2VG6 A;  3V1Q A;  2Z1I A;  1RCH A;  2OYQ A;  4KHN A;  4KO0 A;  3O4Q A;  3I0R A;  3SUP A;  1WSI A;  3SJJ A;  3AVI A;  1KVA A;  2YNF A;  3SQ2 A;  1RTD A;  1QSS A;  3CG7 A;  3IAY A;  3ZCM A;  1EX4 A;  3HK2 A;  4E0D A;  3MAQ A;  3G10 A;  4OPJ A;  4FVM A;  4CHZ A;  3I8D A;  1Y97 A;  4FLU A;  4DLE A;  1YT3 A;  4Z4H A;  2PZS A;  3NDK A;  4CF0 A;  4KAZ A;  4FLV A;  4PWD A;  2HND A;  1C0M A;  1JL1 A;  2RPI A;  1BI4 A;  1UWB A;  5KTQ A;  3OYH A;  3RTV A;  3CM5 A;  2OZM A;  4CJQ A;  4B9S A;  2D5R A;  3KLF A;  4CEA A;  1LWC A;  3SZ2 A;  3L8B A;  1VSK A;  1X9S A;  3M8R A;  4CFD A;  4RW6 A;  4N56 A;  3AVF A;  3SQ4 A;  4ID5 A;  3O3F A;  4FLW A;  4AIL C;  1QSY A;  3S3N A;  2BDP A;  1VSJ A;  3DLB A;  4F4K A;  5FRN A;  1TKD A;  2PYL A;  3P83 D;  3L3U A;  5CYM A;  5T7B A;  3K59 A;  2G8U A;  2PY5 A;  4DSI A;  2G8V A;  3V9U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...