3O3FA

T. maritima rnase h2 d107n in complex with nucleic acid substrate and magnesium ions
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
222
structure length
222
Chain Sequence
GIDELYKKEFGIVAGVDEAGRGCLAGPVVAAAVVLEKEIEGINDSKQLSPAKRERLLDEIMEKAAVGIGIASPEEIDLYNIFNATKLAMNRALENLSVKPSFVLVNGKGIELSVPGTCLVKGDQKSKLIGAASIVAKVFRDRLMSEFHRMYPQFSFHKHKGYATKEHLNEIRKNGVLPIHRLSFEPVLELLTDDLLREFFEKGLISENRFERILNLLGARKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease HII
publication title Crystal Structures of RNase H2 in Complex with Nucleic Acid Reveal the Mechanism of RNA-DNA Junction Recognition and Cleavage.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase/dna-rna hybrid
total genus 82
structure length 222
sequence length 222
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2010-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01351 RNase_HII Ribonuclease HII
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3o3fA00
4E7KA 4OKJA 4PWDA 4F3TA 1C6VA 1RTIA 2F96A 4IG3A 4CK1A 1C1AA 2HHVA 4H8KA 5D3GA 3V1RA 4CEOA 2DFEA 4RW7A 4B9MA 1RTJA 4NYFA 4UQGA 4BWJA 3SQ0A 1N5YA 2KTQA 1U04A 4CJVA 4Q5VA 1JXEA 4N76A 1WN7A 4CHNA 3D0PA 1NKCA 1TL3A 4DTXA 3RMAA 4IFYA 2P51A 4F3OA 3DOKA 4EP4A 3KTQA 4KHWA 3KLGA 1U4BA 3AA4A 1TVRA 3ZT2A 4Z4FA 3IRXA 3DI6A 3VQ8A 4OPKA 2YKNA 1HJRA 1RCHA 2LSNA 4DTNA 3HK2A 3RMBA 1KLNA 4FJIA 4FXDA 1RT6A 4KKOA 1RDDA 1XI1A 3OYBA 3T3FA 4CFAA 4FW1A 1FXXA 1JLBA 1KVCA 4LH5A 2EHGA 4JRPA 1RT7A 2HW3A 5HP1A 1RNHA 1BIZA 5FRMA 3HT3A 2F8TA 2HB5A 4NYNA 4CJ3A 4DSJA 3V9UA 1VSHA 2P1JA 3CFRA 3KIOA 1RT5A 3CFPA 4YFUA 1TKZA 3M8QA 3V1OA 4AHVA 1JLCA 3QETA 1NK7A 1NK4A 1KFSA 3C95A 3WNHA 5DK5A 4B9LA 4DSKA 2B4JA 2Z1HA 4DSIA 2DY4A 5JS1A 3LAKA 4BDPA 4OJRA 2XY8A 1C0TA 2XRIA 4CESA 5KRSA 1KTQA 2FBVA 2Z1JA 4CIEA 4H4MA 3OYAA 2FBYA 2HHTA 4DU4A 3DOLA 1TKXA 1QSLA 1NK6A 5J2PA 2HHSA 2B5JA 4Y1CA 4Q0BA 4CF1A 1VRTA 4CJRA 3LAMA 3NDKA 4CJ5A 4FJNA 2KQ2A 3OYDA 2VWJA 2X6SA 4I2QA 1MU2A 2Z1GA 4JRQA 1WSHA 4RW9A 3AVGA 2FBXA 1IO2A 5KRTA 3SUOA 1BIUA 3LPTA 3TARA 3CM6A 2HMIA 3RWUA 4J2EA 2GUIA 3HP6A 4N5SA 1VSLA 3MECA 3V1QA 4CF8A 2ATQA 1UA1A 1XHXA 4FJ9A 2QKBA 4CF0A 3DYAA 1BI4B 2G8HA 3NCIA 4L8RB 3S3OA 1NKBA 1J5OA 3O4NA 1RDBA 3TAEA 4ZTJA 1ZBLA 4CEBA 5J2NA 2VG7A 4CGIA 3QESA 3SUQA 2OZSA 3NF6A 4E89A 3KK3A 4C8NA 3K5NA 4HUGA 3HO1A 3IG1A 1IKWA 4FCYA 2BANA 3K5MA 2YNFA 4DS4A 1D9DA 4F2SA 1IG9A 4LSNA 3O4QA 2RF2A 2B6AA 4ZHRA 3OYNA 4E3SA 3KD5E 5KGWA 1JXBA 4C8MA 4BE0A 4FLUA 4HCBA 2OPRA 4NCGA 3NAEA 3L2QA 2QKKA 4FJGA 3CM5A 4O4GA 4HCCA 4CEEA 2EX3A 4CEFA 3O3FA 3QNNA 2IAJA 3ISNC 4E1MA 3PY8A 4FK4A 3K2PA 3C6UA 5CYMA 1WSGA 4FLTA 1TAUA 3TAGA 1KVAA 2IOCA 4JLHA 4AILC 4W5OA 2A1RA 1U49A 2ZE2A 1L3VA 3T1AA 1NK9A 3VQQA 4DTUA 4KAZA 4CJQA 1B9DA 1EKEA 1GOAA 1EXQA 3CG7A 5HRSA 2IS3A 3PV8A 1NJZA 3B6OA 4DQPA 4CHYA 1IKXA 3VQ5A 2GBZA 4Z4IA 1RBTA 1A5VA 4W5NA 3VQAA 3VQPA 1JLQA 3AVFA 4DTJA 4JS5A 3SQ2A 1X9WA 1NK0A 1QSYA 3KK1A 4KHSA 1KRPA 4O5BA 3OS1A 2G8IA 4DSFA 3V9SA 3OJUA 1QSSA 3NF9A 3OYHA 3P1GA 1I39A 2O4GA 3G10A 3AVLA 1HYSA 2DFHA 3EYZA 3CQ8A 3DLHA 5JS2A 3AVMA 4FJXA 4N47A 4AH9A 4CF9A 1RBSA 3DMJA 3NE6A 1GOCA 1S1WA 2ZQBA 3K5LA 4B8CA 1SL1A 3BDPA 1WSIA 3BGRA 2YNHA 4O44A 2D0AA 4E0DA 3LP1A 3MXIA 1TK8A 4M41A 1BCMA 3ASMA 3OYGA 4CHZA 1SL2A 1N6QA 2E6LA 3RR8A 1LAWA 1TGOA 5CY4A 1TL1A 1D9FA 4FW2A 4NCBA 4RW4A 2KFZA 1RDAA 3NH2A 2XY5A 3MXJA 1SKWA 3DLEA 3VQ6A 3LPUA 4CFBA 4DTRA 3AA3A 3AVIA 2VG6A 4ELVA 2YV0X 1IKYA 4AHTA 4IKFA 5FRNA 1W0HA 4OLAA 1RT2A 1UOCA 4CGHA 3G0ZA 4QAGA 3B6PA 2Y1IA 3SUPA 1L5UA 4ID1A 4CGJA 4QOZB 2BE2A 3LALA 3LP3A 3OYKA 3NGIA 1B9FA 4B8AB 2RN2A 2AJQA 3A2FA 3PX6A 3THVA 4PA1A 2XY7A 3VQCA 3OYLA 1LW0A 2OYQA 2R7YA 4KRFA 1A5XA 1RBRA 4CJLA 4F8RA 4DTSA 4CGDA 5HRNA 4YNQA 3NFAA 4DLEA 4KB0A 2OPQA 3AA2A 3QERA 3S3NA 4CFCA 3AO4A 1WAJA 1NJWA 2Z1IA 4CEDA 4OKKA 1SKRA 2Y1JA 2A1SA 2JLEA 4KTWA 4CE9A 1L3UA 1L3TA 1YTAA 3O3GA 3DM2A 4EZ6A 1EETA 2G8VA 4Z4CA 4ICLA 1HRHA 4KO0A 4KTZA 3KLFA 3C94A 4DS5A 3RRHA 5J2MA 1X9SA 1T8EA 3RRGA 1YT3A 4CJKA 2IC3A 4M3TA 1ASVA 1K6YA 2YHBA 3SJJA 3OYIA 4CJSA 2OPSA 3SUNA 3MXMA 3KD1E 4KI4A 2HVIA 4FVMA 4KB1A 5EU7A 4CEQA 3AVJA 3WNGA 4ZTFA 1T05A 3DLKA 3NGZA 1SKSA 1XC9A 4FK0A 1RILA 4FLXA 1LWFA 4F2RA 4DU1A 2HHQA 5C25A 3F9KA 4FJ8A 2YNGA 1KVBA 3HSTB 4AHSA 1ZBFA 2PYJA 2ITGA 4CF2A 4NCAA 4DTOA 2HHXA 3VN5A 3OVNA 3DRRA 2OPPA 4HUEA 1LWEA 4FJLA 4CJWA 3PX4A 3HJFA 1JLGA 1C1BA 1C0UA 1VSMA 3RMDA 1RT1A 1CZ9A 2HNDA 3QEPA 4FJJA 4B9SA 3HVTA 3IAYA 3ZSQA 1RBUA 4HTUA 2D0CA 3VA3A 1TKDA 5C42A 3QEVA 1ITGA 1KCFA 1G15A 4BACA 1Y97A 3KLHA 4M3XA 3ZSXA 4J2AA 3M8RA 1W9HA 4E7HA 3E01A 3ZT1A 3VQDA 4M3ZA 1S9EA 4BE2A 4Z0UA 5C24A 3K59A 1VRUA 3C6TA 4I9LA 3TAMA 1A5WA 4DWIA 3CYMA 3RMCA 3SQ1A 1WSJA 3P5JA 2KZZA 1D5AA 5CYQA 3SNNA 1ZBIA 3SZ2A 3U3GA 1Z25A 2GV9A 1KSPA 1HYZA 3TAPA 5E41A 1IH7A 1LWCA 3V4IA 1C0MA 2QXFA 4G1QA 3LZJA 3UIQA 5CZ1A 4J2DA 4H4OA 1UAXA 2E6MA 5CZ2A 1SV5A 2FC0A 3VQ7A 4CHPA 3KK2A 3HPHA 4Z4GA 5J1EA 1NK8A 3ZSZA 4CJEA 3OYCA 4F4KA 1VSJA 3ZSVA 4RW8A 1BISA 1TAQA 3HPGA 3TI0A 2IGIA 2WOMA 1CXQA 3AVHA 3AV9A 2DFFA 3L2VA 4HUFA 3MAQA 1X9MA 4I9QA 1YTUA 2ZD1A 4CECA 4FZZA 3OS0A 4KFBA 2X74A 4CJFA 4CHOA 1TV6A 3OYJA 4KTQA 1WSEA 4OLBA 4FLZA 3PO5A 1QE1A 4M3RA 4FK2A 4FZXC 1ZBHA 4CJTA 3EY1A 1RTDA 4FYDA 2D5RA 2RKIA 1Z26A 3D45A 4LD0A 2OZMA 3ZSWA 1BHLA 4DMNA 2G8UA 2ETJA 3HP9A 4CHQA 3V6DA 4M3WA 3AVNA 3FFIA 1C1CA 3QIOA 4EP5A 1SL0A 1DLOA 3HYFA 4FM0A 3SPZA 3WNFA 3CFOA 4DFMA 4J2BA 2QK9A 4DF8A 3V9ZA 1BQMA 3I0SA 4O55A 1HPZA 4RG8A 3QO9A 1UA0A 2HVHA 3LWMA 2YHAA 4HVJA 3QEXA 2RPIA 4ELTA 4I7FA 4BWMA 4N56A 4CEAA 3SI6A 1NOYA 1ASUA 2YKMA 4GVMA 2BDPA 3JYTA 4MQ3A 3PUFA 4GMJB 4CK2A 1HNVA 1U45A 1T7PA 4RW6A 5KGXA 4DLGA 4C8KA 4FZYA 4HHTA 4I2PA 4CFDA 4K8XA 4PUOA 5HBMA 4CIGA 4OPJA 1YVUA 4ELUA 2XHBA 4FM1A 4B3OA 1KFDA 1XWLA 3NF7A 4QCLA 3TANA 3ZT3A 4FLWA 4FJHA 1HMVA 1DTQA 1LW2A 1FKOA 1S1XA 1WNSA 1CZBA 3KKSA 3TABA 3P83D 3I8DA 1EX4A 2OA8A 3IS9A 2HHWA 1DTTA 4LY7A 3OYFA 1J54A 4LH4A 2W42A 3QNOA 5HLFA 3ZT4A 1L3SA 3T19A 1U48A 4R5PA 3VA0A 4XIUA 1D8YA 4GW6A 1CLQA 4CJPA 1RT4A 2PZSA 2X6NA 3KLIA 4DSLA 3LP0A 3KLEA 2O4IA 1QTMA 1BI4A 3HM9A 3QINA 4AHRA 2G8FA 3VQEA 4CJ4A 1S1UA 5I3UA 5HRPA 3LDSA 1NJYA 4M45A 1Q8IA 1O1WA 3ITHA 3MEDA 1FKPA 3ZCMA 2IDOA 1R0AA 3SQ4A 2DTUA 4DU3A 1GOBA 4C8LA 1QQCA 5FDLA 4IG0A 3K57A 1CXUA 3HXMA 4E1NA 4B9TA 4DQQA 5KI6A 4DQIA 3RTVA 1TK0A 4DTPA 1BQNA 4PQUA 3OYMA 3SYZA 1T03A 1I3AA 4M3UA 1J53A 3PO4A 2JGUA 5FROA 4CEZA 4B08A 4Y1DA 4DFPA 3HPOA 3L8BA 4DQSA 4N41A 3NBPA 4OGEA 3AA5X 4DTMA 5KTQA 2WONA 2HHUA 5K14A 3SV3A 3SPYA 1BL3A 3JSMA 4CK3A 2P5OA 4FJMA 3SV4A 4M3YA 4FLYA 2NUBA 4E7IA 2XY6A 1BGXT 4IBNA 3L3UA 2G8KA 4FJ7A 4M42A 3L2UA 2VWKA 1LV5A 3DLRA 4OGCA 4BDZA 1Q9XA 2FBTA 4E7JA 4W5QA 4LSLA 3QIPA 4CGGA 5HRRA 4W5RA 3AVBA 1VSEA 3S3MA 4AHCA 1S9GA 1S6QA 4CIFA 2HNYA 4BDYA 3AO2A 1UWBA 4KHNA 3EZ5A 3VQ4A 1QHTA 2I5JA 4K8ZA 3ULDA 1EP4A 3ZSRA 3L2RA 1X1PA 4CGFA 2BGGA 1RTHA 1VSDA 4KHYA 1HQEA 4Z4HA 4KPYA 1NK5A 4O0IA 3NHGA 2Q3SA 2X78A 4DF4A 1FK9A 1S6PA 4IDKA 2HNZA 4WE1A 3AVAA 4E19A 4JS4A 2G8WA 4B9UA 1SUQA 4CCHA 1JL2A 1LAVA 3KJVA 1JLFA 3MEEA 3SCXA 3DLGA 4FJKA 3AO5A 1RDCA 3L2WA 1JLEA 4AHUA 3WNEA 4DSEA 4KREA 1U47A 4MFBA 5T7BA 2VG5A 1TKTA 3LZIA 3TAFA 4FLVA 4ID5A 1HQUA 3DLBA 3V9XA 4Z4EA 3AO3A 1HNIA 3I0RA 4B9VA 1S1TA 3TWHA 3ZSOA 3DRSA 2D0BA 4DFJA 1VSFA 3V9WA 5J2QA 4KHQA 1HYVA 3RR7A 3LP2A 4IFVA 4TSXA 3QEIA 3ZT0A 3LWLA 4BE1A 2P5GA 3AVKA 5I42A 2PYLA 3AVCA 3M8PA 1WLJA 1IKVA 4W5TA 1VK0A 1VSKA 1VSIA 1S1VA 4PY5A 2KZMA 3V81A 1NKEA 1RT3A 3K5OA 3DRPA 4DQRA 3HVRA 4DFKA 4OKEA 4OVLA 4KHUA 2F8SA 1ZBUA 1B92A 1JKHA 3OS2A 1QS4A 3L3VA 1JLAA 4CERA 3OY9A 1WAFA 5SWMA 3QLHA 3F73A 2KFNA 4CJUA 5HROA 3VQBA 1REVA 3TR8A 2XO7A 3KKRA 3OJSA 4KI6A 2YNIA 1NJXA 3U3YA 4EZ9A 3S9HA 3M8SA 2E4LA 3ALYA 4B9NA 1WSFA 3K58A 4FM2A 2PY5A 3ZSYA 5SZTA 3NF8A 4FJ5A 1RBVA 3MEGA 3H08A 1JL1A 1S5JA 4DG1A 1ZYQA 3NH0A 3VQ9A 1Q9YA 3AO1A 4KV8A 3PX0A 3NGYA 4C8OA 4O0JA 3NH1A 3QEWA 1BCOA 3OYEA 3U6FA 3TAQA 5DMRA 1XHZA 3HL8A 1ASWA 4E7LA 1F21A 1NOZA 3O3HA 1J9AA 1KLMA 3LANA 2KW4A 1TK5A
chains in the Genus database with same CATH superfamily
2QXLA 4E7KA 5BPMA 2Q31A 3KWGA 4CK1A 4IG3A 1WUAA 4H8KA 5D3GA 3CCLN 1U2VB 2DFEA 1RTJA 4XH5A 3ZX0A 1DGKN 1U04A 3DJCA 4CJVA 4ISGA 2NRWA 1WN7A 1TL3A 3RMAA 5GINA 4EP4A 3KTQA 3CMEN 1HUXA 4ISEA 1HJRA 4X66K 2HBLA 3HK2A 1RT6A 4KKOA 1RDDA 1XI1A 4CFAA 4JKFA 1JLBA 4LH5A 2EHGA 4K43A 1RT7A 2HW3A 4CJ3A 3A8YA 2P1JA 3CFRA 3KIOA 2QWOA 4YFUA 5H1SQ 1TKZA 3V1OA 1NK4A 1JLCA 3QETA 1NK7A 3F5TA 3D2FA 1KFSA 4DSKA 3U4LA 4BDPA 4OJRA 4CESA 3CJ1A 2FBYA 2HHTA 4DU4A 3DOLA 3UE5A 1NK6A 3OW2M 4Q0BA 4CJRA 3LAMA 3NDKA 3OYDA 1FJGK 2X6SA 4JRQA 1SQKA 1BIUA 3MECA 2QWNA 3V1QA 4CF8A 2QKBA 1XHXA 5AZIB 1NKBA 4WFNL 4ZTJA 3LM2A 2OZSA 4CEBA 3SUQA 5AQJA 1RDWX 3K5NA 1S3XA 3IG1A 1GLBG 3FE1A 2YNFA 2P9UA 4DS4A 4YORA 1D9DA 3O4QA 3OYNA 4A2BA 4ZHRA 1XNRK 1VQNN 3ZEUB 5KGWA 4BE0A 2OPRA 2HBMA 4QS8A 3DXMB 3VEVA 4HCCA 2QWLA 2EX3A 2IAJA 3ISNC 3PY8A 3CD6N 4JI8K 1NGIA 3K2PA 4JI6K 4FLTA 3EKSA 2A1RA 2QEXN 2E2NA 4MLHA 2P9PA 4DTUA 3PV8A 1EXQA 3CG7A 4JK9A 5HRSA 1NJZA 3B6OA 3HRGA 1Q86O 1IKXA 3VQ5A 2GBZA 4BR4A 1A5VA 3VQAA 5AQKA 1X9WA 1QSYA 5AZJB 1KRPA 4O5BA 2A3ZA 4CJ7A 4DSFA 2G8IA 1MA9B 2W41A 3NF9A 3OYHA 3LDNA 3G10A 1HYSA 1P8ZA 4Y0WA 3QMLA 3R9PA 5AQIA 2W40A 4N47A 3DMJA 3NE6A 2Q36A 3MK6A 1HX1A 1SL1A 3BDPA 3VMFB 3LP1A 2Q2RA 2FLOA 5EVZA 4M41A 3OYGA 3DXKB 4CHZA 1SL2A 4U67L 2AA4A 4FWQA 2NRRA 1LAWA 2WUSA 4FW2A 4RW4A 4H0PA 1VQ6N 2QTDA 4CFBA 3HI0A 4DTRA 1IKYA 3EE9A 5C12A 2Y1IA 4QOZB 4ID1A 3LALA 3NGIA 4YOTA 4LF5K 3PX6A 4BG9A 2XY7A 3J7ZO 4F8RA 1RBRA 1MWMA 4CGDA 3NFAA 1TUUA 4DR2K 5AQQA 1NJWA 3G25A 1WAJA 4OKKA 4CE9A 3F2KA 1YTAA 3DM2A 3HM8A 2VWBA 4Z4CA 4KTZA 2DTUA 4OPAA 3W3DA 4CJKA 2IC3A 3ENHA 3SJJA 4H0VB 3SUNA 3VPZA 4DV3K 3MXMA 3KD1E 1YITN 4KI4A 1NGJA 5EU7A 4BVPA 3DLKA 3NGZA 2NRTA 4F2RA 4JEPA 3F9KA 2YNGA 1KVBA 4BR7A 3BZKA 5AQXA 4FJLA 3HJFA 1C1BA 3SMPA 2O8DB 3HVTA 4IEIA 4XEIA 2D0CA 3VA3A 3MX2A 1XUPO 1KCFA 1G15A 1Y97A 4J2AA 4E7HA 3E01A 2V7ZA 3ZT1A 3WT0A 4M3ZA 1S9EA 4Z0UA 4I9LA 1NU0A 1N32K 1NGCA 3WXIA 2P9LA 5M1QA 4BRDA 2FF6A 4FOEA 1KXPA 3EEQA 1KSPA 1LWCA 3V4IA 2QXFA 4H0TB 4FWPA 4A5BA 1UAXA 2E6MA 2FC0A 3VQ7A 4CHPA 3ZSZA 3OYCA 3ZSVA 2O8EB 1BISA 3TI0A 3B8AX 3AV9A 3L2VA 5BR9A 4KFBA 1TV6A 3OYJA 1WSEA 1NG9A 4CJTA 4JI0K 2KHOA 4I6MB 5CR4A 4CZKA 2WTUA 3O9UA 2G8UA 4CHQA 3PSFA 2BTFA 3SPZA 3CFOA 5EX5A 3I0SA 4WCEL 3QO9A 4HVJA 4DR5K 3G4SN 1NOYA 1D4XA 4CEAA 1ASUA 5AQYA 3I8BA 4QS9A 3CERA 3PUFA 1T7PA 4C8KA 4RW6A 3AY9A 1WBBA 4HHTA 4I2PA 4A59A 4CFDA 4PUOA 1VQLN 1DT9A 4ELUA 2XHBA 4B3OA 3NF7A 1HMVA 1FKOA 4AM6A 5M1KA 1WNSA 4DR6K 2OA8A 1DTTA 1J54A 2W42A 5HLFA 3T19A 3VA0A 1GLCG 4GW6A 1CLQA 1W7AA 4Z94A 5ELZA 2X6NA 3LP0A 1ZBSA 1BI4A 1NWKA 3QINA 3O9QA 5HRPA 3GOIA 3FZLA 1FKPA 5AQZA 3U8XA 4C8LA 2P9IA 3R6MA 1QQCA 3K57A 3HXMA 4E1NA 4B9TA 2AP1A 1K8KB 5KI6A 2ZGZA 3VENA 3VF6A 1BQNA 4PQUA 3OYMA 1T03A 2JGUA 4DUZK 1KAYA 4Y1DA 3L8BA 4B9QA 4DQSA 2O8CA 4LC9B 1K8AO 1VHXA 2HHUA 3LDLA 3SV3A 4H5TA 3SPYA 1NGDA 2V7YA 1O13A 3AAQA 4NB4A 4JKGB 4M42A 4AM7A 2VWKA 1W2BM 4BDZA 1Q9XA 5AQOA 4W5QA 4LSLA 3JS6A 3GDQA 2F7TA 4CIFA 1K73O 4GV9A 5AR0A 1QHTA 4IO9L 3CPWM 3MMVA 5AQRA 1BDGA 4O0IA 3Q7BA 4WE1A 4B9UA 4CCHA 4O5FA 4O8UA 1JLFA 3KJVA 1IBMK 2QW9A 1TUYA 1RDCA 2E5LK 3WNEA 4BR2A 4KREA 1U47A 1QQMA 4K0KK 3TSPA 4BRCA 1YAGA 2WFBA 1ESVA 3O5BA 4BGBA 4FOIA 1ATRA 1DEJA 3O80A 2D0BA 3EL2A 1VSFA 3VEYA 1HYVA 1NBWA 3LP2A 3QEIA 3SBGA 3ZT0A 1XNQK 3BZCA 4F9OA 5I42A 1WLJA 2IIRA 1VSKA 4W5TA 4RTFD 1S1VA 4PY5A 1NKEA 3BF3A 3DRPA 3HVRA 4DFKA 1QS4A 3L3VA 3WXLA 3VQBA 3OJSA 4KI6A 1NJXA 3S9HA 3CMAN 3ULEA 2E4LA 1KD1O 5SZTA 1RBVA 1JL1A 2FF3B 1ZYQA 3IMXA 4IWVA 3HBTA 1VQ9N 3NH1A 3QEWA 3OYEA 3T1HK 4LF6K 4E7LA 2HF3A 1NOZA 1WOQA 1WBDA 3ID8A 2VYPA 3A0IX 1SZ2A 4F3TA 2F96A 1C1AA 3IDHA 2YCHA 3V1RA 4G9ZA 4UQGA 2QWPA 2IVNA 4BWJA 4BGAA 3A5NC 5JMVA 3SQ0A 2NZTA 4Q5VA 3D0PA 1NKCA 4F3OA 3DOKA 4FWRA 3KLGA 1EO1A 1IJJA 4DR7K 1TVRA 1YVNA 3O9SA 3R1XA 4WQ4C 3IRXA 3DI6A 1NMNA 1I94K 1T3VA 3RMBA 1KLNA 4NO7A 1FXXA 2H3GX 1HKBA 1X3MA 4JRPA 1BIZA 3HT3A 2HB5A 4JI2K 4H5RA 1VSHA 1Z05A 1N33K 2CH5A 4BC4A 4H5VA 4AHVA 4CBWA 3T7ZA 2Q97A 4B9LA 2BUPA 4CIEA 4M7YA 4JHDA 4CZEA 5AQGA 3Q7CA 2HHSA 2B5JA 3GG4A 4CF1A 3D6RA 3VEZA 3OHRA 2KQ2A 3G6EN 5KRTA 2HOEA 3WQTA 5FPEA 3CM6A 3VETA 2HMIA 4J2EA 4N5SA 1UA1A 3H3OB 3DYAA 3CJ7A 4L8RB 2I7NA 1RDBA 2O8BA 1W97L 3NF6A 3KK3A 3I55N 3THYA 4CW7B 4HUGA 3HO1A 3M3ZA 4BRQA 2BANA 2Q0UA 4CZMA 3VEOA 1IG9A 3MN7A 4LSNA 2E20A 5BR8K 3KHYA 4E3SA 1JXBA 5LY3A 4HCBA 3ZETB 4O4GA 3QNNA 4DR3K 4JD2A 3LDOA 5CYMA 3TAGA 1KVAA 4JLHA 4W5OA 5BRDA 1L3VA 2ZE2A 3VQQA 3O9RA 4CHYA 2ZJQL 1X3NA 2EWSA 4DTJA 3SQ2A 1HNZK 1NK0A 4A61A 1U6ZA 3KK1A 1XMOK 4KHSA 1TYQB 3OBWA 1QSSA 5C15A 3P1GA 1SAZA 4MLEA 2O4GA 3BP8A 1HR0K 1NGHA 1ATSA 3CQ8A 5JS2A 4IXCA 3VTHA 4BRPA 1RBSA 1GOCA 1S1WA 2GUPA 1KAXA 2YNHA 3ZX2A 1BCMA 2P9NA 3ASMA 1N6QA 2E6LA 3I33A 1D9FA 4NCBA 2E2QA 4JI4K 3J81O 2KFZA 3NH2A 3LPUA 3C0BA 4ELVA 4AHTA 5FRNA 2NLXA 5M1NA 1W0HA 4CZIA 1RT2A 4CGHA 1L5UA 1P90A 4CGJA 2BE2A 1B9FA 4KH4A 4X64K 1K9MO 1X9JA 2IVOA 4PA1A 3OYLA 1LW0A 4YNQA 1VQON 2E2PA 4DLEA 3QERA 4CFCA 3BUZB 2Z1IA 4CEDA 2JLEA 3WEEA 2ZJRL 4B1ZA 2VCPA 4EZ6A 1VAZA 3KLFA 5J2MA 3C94A 4CBXA 1YUWA 1FW6A 1K6YA 3OYIA 4KB1A 4ZTFA 4R79A 4YY3K 1RILA 2HHQA 5C25A 2FXUA 1EQYA 5JICA 3HOTA 4FJ8A 3VN5A 2QI2A 3VF2A 1C0UA 1RT1A 4DV5K 3IAYA 3ZSQA 1TKDA 1IBLK 2P9KA 5KQ8A 1JCEA 3KLHA 2O8FA 5AJ3K 3M8RA 2OTLN 1W9HA 4YOYA 3TTDA 3C6TA 5JLHA 3TAMA 3CYMA 2KZZA 3SNNA 3SZ2A 4K41A 1Z25A 3TAPA 5F0XA 1IH7A 1C0MA 4G1QA 4J2DA 3LZJA 5FPDA 2QA4N 4Z4GA 4F4KA 2JWKA 1VSJA 1GLAG 1MWKA 3HPGA 3BY5A 5EY4A 2DFFA 3MAQA 2V51B 1YTUA 2YX6A 3KVGA 2WBNA 2E88A 2E1YA 4BRMA 3J7YP 3VGKA 1RTDA 4FYDA 2D5RA 1Z26A 2OZMA 4DMNA 4RWTA 2ETJA 1ZC6A 3FFIA 1SL0A 3KK7A 4LFCK 3D2FB 1NNEA 4DFMA 5JLFA 3UKRA 4DF8A 1Z6RA 2Q0RA 4FWOA 4RG8A 1HPZA 5EOYA 3VGLA 1YJNN 2HVHA 3CCMN 4N56A 2YKMA 4GVMA 4FZYA 1HNVA 5BN9A 4AQYK 4K8XA 1E4GT 2PFUA 2YHXA 3T1YK 1YVUA 3THWA 5M1OA 1J6ZA 2W6KA 1LW2A 4M7XA 2KLAA 4CD3A 4CI6A 4AF1A 3TU5A 3O1WA 3TABA 3KKSA 3P83D 4BC3A 2GWKA 4EAHD 1EX4A 4ISFA 3CC4N 3QNOA 4LH4A 3ZT4A 2P9UB 5AQMA 4R5PA 4IJAA 4DQ8A 5E26A 3KLIA 4DSLA 3KLEA 2O4IA 4ILGB 3HM9A 3H3NO 1S1UA 5I3UA 3AAPA 3LDSA 4GKJK 1Q8IA 5GIOA 2P9PB 1R0AA 3SQ4A 4DU3A 1CXUA 3EO3A 3LDPA 4DQQA 4FPAA 1C0GA 3SYZA 3CCVN 1JJ2M 1I3AA 3EZWA 1J53A 3WXKA 1R59O 3VOVA 5FROA 3S41A 3NBPA 1HNWK 5AQSA 2WONA 5K14A 1VQ7N 2GELA 2P5OA 3ATVA 3CJCA 1BGXT 4IBNA 3L3UA 5DM7L 4LF4K 5CHIA 2FBTA 3ZYYX 1OVQA 3AVBA 1VSEA 4KHNA 1S9GA 4KH6A 4YOUA 2HNYA 3EZ5A 3E9OA 2I5JA 2GX9A 4O8KA 4A5AA 3ZSRA 3L2RA 2BGGA 3THXA 1VSDA 5M1PA 5BPNA 3NHGA 4DR4K 2Q3SA 4DF4A 1S6PA 4IDKA 2G8WA 1SUQA 1JL2A 1LAVA 5FPNA 3L2WA 4AHUA 1JCFA 4HTLA 3OBYA 4A57A 4JNEA 5T7BA 2VG5A 3VESA 3IKMA 1BOTO 3PIOL 3DLBA 3RSEA 3DWLA 1HNIA 3I0RA 5BN8A 2NNWA 3N4PA 4YOVA 3ZSOA 4KBOA 4BVOA 4JAXA 3A5LC 4BE1A 1M90O 3AVCA 1IKVA 4DV0K 1OH5A 2KZMA 3V81A 4OVLA 2F8SA 1ZBUA 2F9WA 2D1KA 1NLVA 1WAFA 2KFNA 2NRVA 3J80O 4BRHA 4B3MK 3ALYA 4B9NA 3EKUA 5I9EB 3K58A 3ZSYA 4PL8A 3MEGA 4DG1A 3NH0A 2P9LB 5MLCQ 1Q9YA 3AO1A 2DPNA 4KV8A 5LMNK 4K25A 5AQTA 4O0JA 1BCOA 4NLBA 5DMRA 1ASWA 1F21A 4JI3K 3P39A 3K9KA 3O3HA 1J9AA 1KLMA 4EHUA 2KW4A 4DR1K 1LCUA 1HKGA 4OKJA 4PWDA 4JYAK 1RTIA 4RW7A 3G71N 4B9MA 2KTQA 4NYFA 3FR0A 1E4FT 1JXEA 4N76A 1KC8O 4CHNA 2CH6A 1Q18A 3DLLL 4KHWA 2NRXA 1OH6A 3AA4A 3ZT2A 4Z4FA 3HSCA 3L4QA 3CCRN 4OPKA 2LSNA 4DTNA 4DHYA 1V4SA 4FXDA 1V4TA 2A41A 2D4WA 5KPRA 4IJNA 1YIJN 5HP1A 1RNHA 5FRMA 3K9JA 4NYNA 4DSJA 2HBKA 2IVPA 1RT5A 4FWKA 4PKIA 2GWJA 3WQUA 2OTJN 5GAGP 3WNHA 4DSIA 2B4JA 2DY4A 3E66A 3LAKA 3ENOA 2XY8A 5ADXA 2XRIA 5KRSA 2FBVA 2Z1JA 4YDUA 1RDUA 3E1YA 3OYAA 1TKXA 3E9PA 4Y1CA 4C1NK 1VRTA 3C7NA 4FJNA 3D2EA 2VWJA 2UU9K 4IZ9A 1MU2A 2Z1GA 5AQHA 2NRZA 3SUOA 2FBXA 1IO2A 3LPTA 3EE8A 5M1FA 3WXMB 2GUIA 3O6WA 3HP6A 1VSLA 4DV4K 2ATQA 4FJ9A 1BI4B 3NCIA 3O4NA 2F4VK 3QESA 5J2NA 4CGIA 1H1VA 4HWIA 5EXWA 4E89A 1HPMA 4C8NA 4JN4A 1IKWA 4CZLA 4F2SA 2P9IB 2RF2A 4ILJA 4FLUA 4PKGA 4GY2B 3L2QA 2QKKA 2RHKA 5A2QO 4FJGA 4CEEA 3O3FA 4E1MA 4WQ4A 3C6UA 2A42A 2IOCA 2O8CB 1U49A 3T1AA 1NK9A 4KAZA 4CJQA 1B9DA 2IS3A 5GAHP 5BRHA 1JLQA 1G99A 5AQWA 3TTCA 4JS5A 4BRKA 3OJUA 4YDUC 1Q81O 4JI1K 3AVLA 4UY8O 5JVGL 2DFHA 3DLHA 3CIPA 5AQVA 4FJXA 1N34K 4RCHA 3E9LA 3SJHA 3BGRA 3CF5L 4B3RK 4CZFA 2D0AA 3W0LA 4B1VA 3MXIA 3MWPA 1TK8A 3RR8A 5CY4A 1RDAA 3MXJA 3DLEA 3VQ6A 3AVIA 2YV0X 3DAWA 3TPQA 4OLAA 3G0ZA 4QAGA 3B6PA 3SUPA 3T69A 3UKUA 5KPZA 3LP3A 2RN2A 2AJQA 3A2FA 3THVA 1MDUB 3VQCA 5CE3A 5F1XA 4KRFA 1A5XA 4MO5A 1VQMN 2OPQA 3S3NA 3TTFA 2KKZA 4KTWA 3O3GA 4FPBA 1EETA 4ICLA 1SS6A 4KO0A 3RRHA 1X9SA 1YT3A 2CGJA 2I7PA 2FSJA 1GLDG 3NVMA 4FVMA 4FK0A 1T05A 2P9SA 1XC9A 4DV7K 4FLXA 3BF1A 1LWFA 3ULEB 4DU1A 3SAFA 1VQPN 4AHSA 2PYJA 2W6LA 2ITGA 4NCAA 2HHXA 3OVNA 3DRRA 1LWEA 2WC9A 3PX4A 4L3QA 1JLGA 2RE2A 4DV2K 1VSMA 2HBJA 1CZ9A 2HNDA 4HTUA 4WQ5A 5LJVA 4BACA 1XMQK 5C24A 3K59A 3LM9A 5AQFA 1QZ5A 4BRNA 3FZHA 1A5WA 3SQ1A 1WSJA 3P5JA 1D5AA 4IEEA 5CYQA 3CJAA 4IFEA 5E41A 1VQ8N 4H5WA 4BRGA 5CZ1A 1IBKK 3UB5A 3KK2A 1SV5A 1ZXOA 3MN5A 3HPHA 5J1EA 4BR5A 1IG8A 5AFUA 1TAQA 1HNXK 2IGIA 3AVHA 4FWNA 4I9QA 2ZD1A 1QQNA 4CECA 4FZZA 4DV6K 1U2VA 4J8FA 3F9MA 4KTQA 4OLBA 1QE1A 4FK2A 1GLJO 5ADXH 3O4WA 2QM1A 3ZSWA 1BHLA 4B3SK 1BG3A 4H03B 3NMUA 1HLUA 4M3WA 4WF9L 3AVNA 3QIOA 1DLOA 4FSVA 3OTOK 4H0OA 3WNFA 5BREA 2QK9A 4J2BA 3V9ZA 4O55A 5FLXO 3LWMA 1GLLO 3QEXA 4JHDB 4WQ5C 4BWMA 2BDPA 3SI6A 3JYTA 2PBDA 4FO0A 4CK2A 1U45A 4M3TA 4DLGA 3KZBA 5HBMA 4CIGA 4OPJA 1KFDA 2ZWHA 3CJBA 4FWSA 2QWRA 4CD1A 1VQ5N 1DTQA 3FGUA 1YJ9N 1T44A 2QWMA 5C2DA 2O8BB 4IDHA 4IOXA 3I8DA 3THYB 2QWQA 2HMPA 3OYFA 2F9TA 3FLCO 2A5XA 4XIUA 1D8YA 4CJPA 1RT4A 2PZSA 3VGMA 1RGIA 5AZIA 4AHRA 4JD2B 3VQEA 3QFPA 4M45A 1O1WA 3ITHA 3ZCMA 2IDOA 1GLEG 1GOBA 4IO8A 1HJOA 5FDLA 4IG0A 4JI5K 3ZEUA 2FSNA 3DXMA 5LJWA 5LMUK 4PL7A 4CEZA 2JWLA 3WXJA 4C23A 3HPOA 1M1KO 4N41A 4OGEA 3JXUA 4GVEA 4CK3A 4FJMA 3FZFA 2UYTA 4E7IA 2XY6A 3L2UA 5AZJA 2P9NB 3QB0A 3FZMA 2VQEK 3QIPA 4BR0A 4W5RA 3CCUN 3S3MA 4AHCA 4H5NA 1UWBA 3VQ4A 3LDQA 2UUCK 5HL7L 4CGFA 1RTHA 4KHYA 1HQEA 3C6HA 1NK5A 3DXKA 4EHTA 2X78A 2HNZA 4B1YB 3ZLJA 4YOWA 5C10A 2ZGYA 3J7AP 3H1VX 5AQLA 4DV1K 3WEEB 4DSEA 3VEWA 4E1JA 3M5RA 3LZIA 4FLVA 4ID5A 1HQUA 4C1NI 3AGKA 3QICA 1S1TA 4B9VA 3TWHA 4WFAL 4DFJA 3KWIA 3V9WA 4LFAK 2Q1NA 5GAEP 4TSXA 2E2OA 3LWLA 1Y64A 3FZKA 3MX5A 2P5GA 3AVKA 5GADP 3M8PA 1QVGM 1YXQA 1VK0A 1VSIA 4BG8A 3VF4A 4PKHA 4OX9K 4OKEA 4KHUA 4FJJA 3OS2A 3H6EA 4CERA 1JLAA 1NGGA 3OY9A 3F73A 5SWMA 3QLHA 3NVKA 4CJUA 5HROA 1REVA 3TR8A 2P9KB 4GV3A 2A6AA 4PHTX 2O8FB 3WUHA 4QS7A 1WSFA 2PY5A 4BROA 3NF8A 1YHQN 3H08A 1S5JA 2ZJPL 4K42A 2VQFK 1NJIO 3VQ9A 5AFUH 4H0YB 2O8DA 3PX0A 1NGEA 3U6FA 1XHZA 5IWAK 3TAQA 3HL8A 3CPEA 1IV0A 3H45C 3LANA 2E8AA 3QFUA 1HKCA 4B1XB 1QQOA 3R3LA 3C6AA 1C6VA 3ENBA 1J5EK 2HHVA 4CEOA 1N5YA 1KQSM 3IFRA 3FFKB 4DTXA 2UUAK 4IFYA 2P51A 5C0YA 3C65A 4GV6A 1U4BA 2O8EA 1VQ4N 4JKCA 3VQ8A 1XQSC 2YKNA 1RCHA 3GE1A 4V19S 5E84A 4FJIA 4DB3A 3CCEN 3UKRB 3OYBA 3T3FA 4FW1A 1KVCA 2VGMA 2F8TA 4I6MA 4JKDA 3V9UA 3CCQN 3CFPA 4IOAL 4JK7A 3M8QA 1N8RO 4BRFA 3C95A 5JS1A 5DK5A 4X65K 2Z1HA 3THWB 1C0TA 1KTQA 4H0XB 4H4MA 1NMDA 4M63C 3L6QA 1QSLA 5J2PA 4XH1A 2UUBK 3GBTA 4CJ5A 4WFBL 2HHHK 3R8EA 4I2QA 1KAZA 2PAVA 1WSHA 4RW9A 3AVGA 3TSUA 3TARA 3RWUA 1OH7A 1QZ6A 3SAGA 4CF0A 5DM6L 3CC2N 2G8HA 3S3OA 1J5OA 3TAEA 1ZBLA 2VG7A 4FL9A 3L0QA 4A2AA 4FCYA 2V52B 4GKKK 1XC3A 3IUCA 3K5MA 1N36K 1NGAA 2B6AA 3KD5E 4C8MA 4JKHA 4NCGA 3NAEA 3P4IA 3CM5A 4JKEA 1T6CA 4CEFA 4FK4A 1YI2N 5TKYA 2D0PA 1LOTB 3MN9A 1WSGA 1TAUA 4ILHA 4AILC 1QVFM 4FVUA 1EKEA 1GOAA 4DQPA 1T6DA 4JKBA 4Z4IA 3SK3A 4A62A 1RBTA 4W5NA 1K8KA 3VQPA 3AVFA 3A5OC 5KQDA 4X62K 3HOSA 2ZM6K 3OS1A 3V9SA 2UXDK 2GTDA 1I39A 3EYZA 3AVMA 1CZAN 1S22A 4AH9A 4CF9A 2A40A 2ZQBA 3K5LA 4B8CA 3LL3A 1WSIA 4O44A 3THXB 1Q7YO 4JKGA 3PSIA 4E0DA 3RVCA 1NM1A 1TGOA 1BA1A 1TL1A 2XY5A 1SKWA 2NRHA 3HZ6A 3AA3A 2VG6A 4IKFA 1UOCA 2PYLA 1EWQA 3OYKA 1E3MA 4B8AB 3RSEB 4DCHA 2OYQA 3ATUA 2R7YA 4CZGA 4CJLA 4DTSA 5HRNA 4KB0A 4DKWA 1DKGD 3AA2A 1SKRA 3AO4A 4MO4A 3K0SA 2A1SA 2Y1JA 5HOOA 1L3UA 1L3TA 4XH4A 4CVNE 4MDAA 4NXMK 2G8VA 4LF9K 1HRHA 4DS5A 3EN9A 1T8EA 3RRGA 1ASVA 2YHBA 3CJ9A 2J4RA 4CJSA 2OPSA 2HVIA 2HSTA 4BQZA 4CEQA 3AVJA 3WNGA 1SKSA 3CQXA 4JV5K 3HSTB 1ZBFA 4JKAA 4CF2A 4DTOA 3ID6A 2OPPA 4HUEA 4CJWA 2YHWA 2GEMA 3RMDA 5KPTA 1QHAA 3QEPA 4B9SA 3JAMO 1RFQA 1RBUA 2VGNA 5C42A 1ITGA 3QEVA 4M3XA 5AQNA 3ZSXA 3P31A 3ZX3A 2YI1A 4BQLA 4OPHA 3VQDA 3VERA 4BE2A 5GIPA 3PIPL 1VRUA 2YHYA 3A5MC 3QBXA 4DWIA 3PLAA 3RMCA 3CQYA 5AQPA 1ZBIA 3SMSA 3U3GA 2GV9A 1HYZA 1BO5O 3UIQA 4H4OA 5CZ2A 3O08A 1WB9A 1BWFO 1ATNA 3AGRA 4CJEA 2ASPA 1NK8A 4JI7K 4RW8A 4BC5A 1TK0A 2WOMA 1C0FA 1CXQA 4HUFA 1X9MA 3H46O 4GNIA 3OS0A 2X74A 4CJFA 4CHOA 4FLZA 3PO5A 4M3RA 4FZXC 4CZJA 1ZBHA 3EY1A 2RKIA 3SAHA 3D45A 4LD0A 5JVHL 3HP9A 1BU6O 4EIAA 3V6DA 4JK8A 1C1CA 3CC7N 4EP5A 3HYFA 4FM0A 1GLFO 1BQMA 4MDBA 4KH5A 1UA0A 2YHAA 2RPIA 4IOCL 4ELTA 4I7FA 1YJWN 1ILYA 4MQ3A 4GMJB 5KGXA 3C7NB 3D2EB 4KHPK 3I56N 3MDQA 4FM1A 1XWLA 4QCLA 3TANA 3ZT3A 5AQUA 4NLCA 4FLWA 4FJHA 2OANA 1S1XA 4NXNK 1CZBA 3IS9A 2HHWA 4LY7A 4FWLA 4BC2A 1EWRA 1L3SA 5TKWA 1U48A 3O9TA 3OA9A 3GL1A 2UXBK 2CGLA 5FPMA 2ITMA 2ZF5O 1QTMA 3VEXA 2G8FA 4CJ4A 1NJYA 3MEDA 4YOXA 2D0OA 3CI5A 1S72N 3BEXA 1NGFA 3O8MA 3ZETA 4B1UB 3RTVA 4DQIA 4DTPA 1VQKN 3MCAB 2BH1A 4M3UA 3PO4A 3U9DA 3MN6A 4BRIA 5IT9O 4B08A 4DFPA 1JCGA 3MCPA 3AA5X 4DTMA 5KTQA 3CCJN 1BL3A 3U9ZA 3JSMA 5F2RA 3SV4A 4M3YA 1NGBA 2NUBA 4FLYA 5B8HA 2G8KA 4FJ7A 1LV5A 3DLRA 4OGCA 2UXCK 1TYQA 4BRLA 4E7JA 5C2FA 4CGGA 1OVYA 5HRRA 4BDYA 1Q82O 1S6QA 4LF8K 4U7BA 3AO2A 3D7EO 4K8ZA 3ULDA 1EP4A 3UKUB 4BY9C 4EFHA 1X1PA 3TSQA 3AARA 4Z4HA 4KPYA 4YHHK 4B1WB 3O1BA 2OCEA 1FK9A 4E19A 2ASOA 4JS4A 3AVAA 4LF7K 3MEEA 3SCXA 3QDKA 3DLGA 4FJKA 3AO5A 2YJEA 1JLEA 4B3TK 3M6GA 4MFBA 3VTIA 3M1FA 1TKTA 3TAFA 3H1QA 3N4QA 4Z4EA 3V9XA 3AO3A 3CETA 1OH8A 3DRSA 1BUPA 4KHQA 5J2QA 4BRAA 4WYBA 3RR7A 4IFVA 3CCSN 2P9SB 4CBUA 3CXCM 3L4IA 5LL6Z 3J8AA 4CZHA 3HTVA 1BA0A 1RT3A 3K5OA 3SLCA 4DQRA 5BRFA 2CGKA 4LFBK 1B92A 1JKHA 2XO7A 3KKRA 3QBWA 2YNIA 1OKJA 3U3YA 4EZ9A 3M8SA 3SBTA 4DUYK 4FM2A 2FSKA 4BR9A 5BPLA 4FJ5A 3MWTA 2E1ZA 4FWMA 3NGYA 4C8OA 2ASMA 3CHWA 1YF5L 2HF4A 2YJFA 4OO1J 3P38A 1TK5A 4BREA
chains in the Genus database with same CATH topology
4E7KA 4OKJA 4PWDA 4F3TA 1C6VA 1RTIA 2F96A 4IG3A 4CK1A 1C1AA 2HHVA 4H8KA 5D3GA 3V1RA 4CEOA 2DFEA 4RW7A 4B9MA 1RTJA 4NYFA 4UQGA 4BWJA 3SQ0A 1N5YA 2KTQA 1U04A 4CJVA 4Q5VA 1JXEA 4N76A 1WN7A 4CHNA 3D0PA 1NKCA 1TL3A 4DTXA 3RMAA 4IFYA 2P51A 4F3OA 3DOKA 4EP4A 3KTQA 4KHWA 3KLGA 1U4BA 3AA4A 1TVRA 3ZT2A 4Z4FA 3IRXA 3DI6A 3VQ8A 4OPKA 2YKNA 1HJRA 1RCHA 2LSNA 4DTNA 3HK2A 3RMBA 1KLNA 4FJIA 4FXDA 1RT6A 4KKOA 1RDDA 1XI1A 3OYBA 3T3FA 4CFAA 4FW1A 1FXXA 1JLBA 1KVCA 4LH5A 2EHGA 4JRPA 1RT7A 2HW3A 5HP1A 1RNHA 1BIZA 5FRMA 3HT3A 2F8TA 2HB5A 4NYNA 4CJ3A 4DSJA 3V9UA 1VSHA 2P1JA 3CFRA 3KIOA 1RT5A 3CFPA 4YFUA 1TKZA 3M8QA 3V1OA 4AHVA 1JLCA 3QETA 1NK7A 1NK4A 1KFSA 3C95A 3WNHA 5DK5A 4B9LA 4DSKA 2B4JA 2Z1HA 4DSIA 2DY4A 5JS1A 3LAKA 4BDPA 4OJRA 2XY8A 1C0TA 2XRIA 4CESA 5KRSA 1KTQA 2FBVA 2Z1JA 4CIEA 4H4MA 3OYAA 2FBYA 2HHTA 4DU4A 3DOLA 1TKXA 1QSLA 1NK6A 5J2PA 2HHSA 2B5JA 4Y1CA 4Q0BA 4CF1A 1VRTA 4CJRA 3LAMA 3NDKA 4CJ5A 4FJNA 2KQ2A 3OYDA 2VWJA 2X6SA 4I2QA 1MU2A 2Z1GA 4JRQA 1WSHA 4RW9A 3AVGA 2FBXA 1IO2A 5KRTA 3SUOA 1BIUA 3LPTA 3TARA 3CM6A 2HMIA 3RWUA 4J2EA 2GUIA 3HP6A 4N5SA 1VSLA 3MECA 3V1QA 4CF8A 2ATQA 1UA1A 1XHXA 4FJ9A 2QKBA 4CF0A 3DYAA 1BI4B 2G8HA 3NCIA 4L8RB 3S3OA 1NKBA 1J5OA 3O4NA 1RDBA 3TAEA 4ZTJA 1ZBLA 4CEBA 5J2NA 2VG7A 4CGIA 3QESA 3SUQA 2OZSA 3NF6A 4E89A 3KK3A 4C8NA 3K5NA 4HUGA 3HO1A 3IG1A 1IKWA 4FCYA 2BANA 3K5MA 2YNFA 4DS4A 1D9DA 4F2SA 1IG9A 4LSNA 3O4QA 2RF2A 2B6AA 4ZHRA 3OYNA 4E3SA 3KD5E 5KGWA 1JXBA 4C8MA 4BE0A 4FLUA 4HCBA 2OPRA 4NCGA 3NAEA 3L2QA 2QKKA 4FJGA 3CM5A 4O4GA 4HCCA 4CEEA 2EX3A 4CEFA 3O3FA 3QNNA 2IAJA 3ISNC 4E1MA 3PY8A 4FK4A 3K2PA 3C6UA 5CYMA 1WSGA 4FLTA 1TAUA 3TAGA 1KVAA 2IOCA 4JLHA 4AILC 4W5OA 2A1RA 1U49A 2ZE2A 1L3VA 3T1AA 1NK9A 3VQQA 4DTUA 4KAZA 4CJQA 1B9DA 1EKEA 1GOAA 1EXQA 3CG7A 5HRSA 2IS3A 3PV8A 1NJZA 3B6OA 4DQPA 4CHYA 1IKXA 3VQ5A 2GBZA 4Z4IA 1RBTA 1A5VA 4W5NA 3VQAA 3VQPA 1JLQA 3AVFA 4DTJA 4JS5A 3SQ2A 1X9WA 1NK0A 1QSYA 3KK1A 4KHSA 1KRPA 4O5BA 3OS1A 2G8IA 4DSFA 3V9SA 3OJUA 1QSSA 3NF9A 3OYHA 3P1GA 1I39A 2O4GA 3G10A 3AVLA 1HYSA 2DFHA 3EYZA 3CQ8A 3DLHA 5JS2A 3AVMA 4FJXA 4N47A 4AH9A 4CF9A 1RBSA 3DMJA 3NE6A 1GOCA 1S1WA 2ZQBA 3K5LA 4B8CA 1SL1A 3BDPA 1WSIA 3BGRA 2YNHA 4O44A 2D0AA 4E0DA 3LP1A 3MXIA 1TK8A 4M41A 1BCMA 3ASMA 3OYGA 4CHZA 1SL2A 1N6QA 2E6LA 3RR8A 1LAWA 1TGOA 5CY4A 1TL1A 1D9FA 4FW2A 4NCBA 4RW4A 2KFZA 1RDAA 3NH2A 2XY5A 3MXJA 1SKWA 3DLEA 3VQ6A 3LPUA 4CFBA 4DTRA 3AA3A 3AVIA 2VG6A 4ELVA 2YV0X 1IKYA 4AHTA 4IKFA 5FRNA 1W0HA 4OLAA 1RT2A 1UOCA 4CGHA 3G0ZA 4QAGA 3B6PA 2Y1IA 3SUPA 1L5UA 4ID1A 4CGJA 4QOZB 2BE2A 3LALA 3LP3A 3OYKA 3NGIA 1B9FA 4B8AB 2RN2A 2AJQA 3A2FA 3PX6A 3THVA 4PA1A 2XY7A 3VQCA 3OYLA 1LW0A 2OYQA 2R7YA 4KRFA 1A5XA 1RBRA 4CJLA 4F8RA 4DTSA 4CGDA 5HRNA 4YNQA 3NFAA 4DLEA 4KB0A 2OPQA 3AA2A 3QERA 3S3NA 4CFCA 3AO4A 1WAJA 1NJWA 2Z1IA 4CEDA 4OKKA 1SKRA 2Y1JA 2A1SA 2JLEA 4KTWA 4CE9A 1L3UA 1L3TA 1YTAA 3O3GA 3DM2A 4EZ6A 1EETA 2G8VA 4Z4CA 4ICLA 1HRHA 4KO0A 4KTZA 3KLFA 3C94A 4DS5A 3RRHA 5J2MA 1X9SA 1T8EA 3RRGA 1YT3A 4CJKA 2IC3A 4M3TA 1ASVA 1K6YA 2YHBA 3SJJA 3OYIA 4CJSA 2OPSA 3SUNA 3MXMA 3KD1E 4KI4A 2HVIA 4FVMA 4KB1A 5EU7A 4CEQA 3AVJA 3WNGA 4ZTFA 1T05A 3DLKA 3NGZA 1SKSA 1XC9A 4FK0A 1RILA 4FLXA 1LWFA 4F2RA 4DU1A 2HHQA 5C25A 3F9KA 4FJ8A 2YNGA 1KVBA 3HSTB 4AHSA 1ZBFA 2PYJA 2ITGA 4CF2A 4NCAA 4DTOA 2HHXA 3VN5A 3OVNA 3DRRA 2OPPA 4HUEA 1LWEA 4FJLA 4CJWA 3PX4A 3HJFA 1JLGA 1C1BA 1C0UA 1VSMA 3RMDA 1RT1A 1CZ9A 2HNDA 3QEPA 4FJJA 4B9SA 3HVTA 3IAYA 3ZSQA 1RBUA 4HTUA 2D0CA 3VA3A 1TKDA 5C42A 3QEVA 1ITGA 1KCFA 1G15A 4BACA 1Y97A 3KLHA 4M3XA 3ZSXA 4J2AA 3M8RA 1W9HA 4E7HA 3E01A 3ZT1A 3VQDA 4M3ZA 1S9EA 4BE2A 4Z0UA 5C24A 3K59A 1VRUA 3C6TA 4I9LA 3TAMA 1A5WA 4DWIA 3CYMA 3RMCA 3SQ1A 1WSJA 3P5JA 2KZZA 1D5AA 5CYQA 3SNNA 1ZBIA 3SZ2A 3U3GA 1Z25A 2GV9A 1KSPA 1HYZA 3TAPA 5E41A 1IH7A 1LWCA 3V4IA 1C0MA 2QXFA 4G1QA 3LZJA 3UIQA 5CZ1A 4J2DA 4H4OA 1UAXA 2E6MA 5CZ2A 1SV5A 2FC0A 3VQ7A 4CHPA 3KK2A 3HPHA 4Z4GA 5J1EA 1NK8A 3ZSZA 4CJEA 3OYCA 4F4KA 1VSJA 3ZSVA 4RW8A 1BISA 1TAQA 3HPGA 3TI0A 2IGIA 2WOMA 1CXQA 3AVHA 3AV9A 2DFFA 3L2VA 4HUFA 3MAQA 1X9MA 4I9QA 1YTUA 2ZD1A 4CECA 4FZZA 3OS0A 4KFBA 2X74A 4CJFA 4CHOA 1TV6A 3OYJA 4KTQA 1WSEA 4OLBA 4FLZA 3PO5A 1QE1A 4M3RA 4FK2A 4FZXC 1ZBHA 4CJTA 3EY1A 1RTDA 4FYDA 2D5RA 2RKIA 1Z26A 3D45A 4LD0A 2OZMA 3ZSWA 1BHLA 4DMNA 2G8UA 2ETJA 3HP9A 4CHQA 3V6DA 4M3WA 3AVNA 3FFIA 1C1CA 3QIOA 4EP5A 1SL0A 1DLOA 3HYFA 4FM0A 3SPZA 3WNFA 3CFOA 4DFMA 4J2BA 2QK9A 4DF8A 3V9ZA 1BQMA 3I0SA 4O55A 1HPZA 4RG8A 3QO9A 1UA0A 2HVHA 3LWMA 2YHAA 4HVJA 3QEXA 2RPIA 4ELTA 4I7FA 4BWMA 4N56A 4CEAA 3SI6A 1NOYA 1ASUA 2YKMA 4GVMA 2BDPA 3JYTA 4MQ3A 3PUFA 4GMJB 4CK2A 1HNVA 1U45A 1T7PA 4RW6A 5KGXA 4DLGA 4C8KA 4FZYA 4HHTA 4I2PA 4CFDA 4K8XA 4PUOA 5HBMA 4CIGA 4OPJA 1YVUA 4ELUA 2XHBA 4FM1A 4B3OA 1KFDA 1XWLA 3NF7A 4QCLA 3TANA 3ZT3A 4FLWA 4FJHA 1HMVA 1DTQA 1LW2A 1FKOA 1S1XA 1WNSA 1CZBA 3KKSA 3TABA 3P83D 3I8DA 1EX4A 2OA8A 3IS9A 2HHWA 1DTTA 4LY7A 3OYFA 1J54A 4LH4A 2W42A 3QNOA 5HLFA 3ZT4A 1L3SA 3T19A 1U48A 4R5PA 3VA0A 4XIUA 1D8YA 4GW6A 1CLQA 4CJPA 1RT4A 2PZSA 2X6NA 3KLIA 4DSLA 3LP0A 3KLEA 2O4IA 1QTMA 1BI4A 3HM9A 3QINA 4AHRA 2G8FA 3VQEA 4CJ4A 1S1UA 5I3UA 5HRPA 3LDSA 1NJYA 4M45A 1Q8IA 1O1WA 3ITHA 3MEDA 1FKPA 3ZCMA 2IDOA 1R0AA 3SQ4A 2DTUA 4DU3A 1GOBA 4C8LA 1QQCA 5FDLA 4IG0A 3K57A 1CXUA 3HXMA 4E1NA 4B9TA 4DQQA 5KI6A 4DQIA 3RTVA 1TK0A 4DTPA 1BQNA 4PQUA 3OYMA 3SYZA 1T03A 1I3AA 4M3UA 1J53A 3PO4A 2JGUA 5FROA 4CEZA 4B08A 4Y1DA 4DFPA 3HPOA 3L8BA 4DQSA 4N41A 3NBPA 4OGEA 3AA5X 4DTMA 5KTQA 2WONA 2HHUA 5K14A 3SV3A 3SPYA 1BL3A 3JSMA 4CK3A 2P5OA 4FJMA 3SV4A 4M3YA 4FLYA 2NUBA 4E7IA 2XY6A 1BGXT 4IBNA 3L3UA 2G8KA 4FJ7A 4M42A 3L2UA 2VWKA 1LV5A 3DLRA 4OGCA 4BDZA 1Q9XA 2FBTA 4E7JA 4W5QA 4LSLA 3QIPA 4CGGA 5HRRA 4W5RA 3AVBA 1VSEA 3S3MA 4AHCA 1S9GA 1S6QA 4CIFA 2HNYA 4BDYA 3AO2A 1UWBA 4KHNA 3EZ5A 3VQ4A 1QHTA 2I5JA 4K8ZA 3ULDA 1EP4A 3ZSRA 3L2RA 1X1PA 4CGFA 2BGGA 1RTHA 1VSDA 4KHYA 1HQEA 4Z4HA 4KPYA 1NK5A 4O0IA 3NHGA 2Q3SA 2X78A 4DF4A 1FK9A 1S6PA 4IDKA 2HNZA 4WE1A 3AVAA 4E19A 4JS4A 2G8WA 4B9UA 1SUQA 4CCHA 1JL2A 1LAVA 3KJVA 1JLFA 3MEEA 3SCXA 3DLGA 4FJKA 3AO5A 1RDCA 3L2WA 1JLEA 4AHUA 3WNEA 4DSEA 4KREA 1U47A 4MFBA 5T7BA 2VG5A 1TKTA 3LZIA 3TAFA 4FLVA 4ID5A 1HQUA 3DLBA 3V9XA 4Z4EA 3AO3A 1HNIA 3I0RA 4B9VA 1S1TA 3TWHA 3ZSOA 3DRSA 2D0BA 4DFJA 1VSFA 3V9WA 5J2QA 4KHQA 1HYVA 3RR7A 3LP2A 4IFVA 4TSXA 3QEIA 3ZT0A 3LWLA 4BE1A 2P5GA 3AVKA 5I42A 2PYLA 3AVCA 3M8PA 1WLJA 1IKVA 4W5TA 1VK0A 1VSKA 1VSIA 1S1VA 4PY5A 2KZMA 3V81A 1NKEA 1RT3A 3K5OA 3DRPA 4DQRA 3HVRA 4DFKA 4OKEA 4OVLA 4KHUA 2F8SA 1ZBUA 1B92A 1JKHA 3OS2A 1QS4A 3L3VA 1JLAA 4CERA 3OY9A 1WAFA 5SWMA 3QLHA 3F73A 2KFNA 4CJUA 5HROA 3VQBA 1REVA 3TR8A 2XO7A 3KKRA 3OJSA 4KI6A 2YNIA 1NJXA 3U3YA 4EZ9A 3S9HA 3M8SA 2E4LA 3ALYA 4B9NA 1WSFA 3K58A 4FM2A 2PY5A 3ZSYA 5SZTA 3NF8A 4FJ5A 1RBVA 3MEGA 3H08A 1JL1A 1S5JA 4DG1A 1ZYQA 3NH0A 3VQ9A 1Q9YA 3AO1A 4KV8A 3PX0A 3NGYA 4C8OA 4O0JA 3NH1A 3QEWA 1BCOA 3OYEA 3U6FA 3TAQA 5DMRA 1XHZA 3HL8A 1ASWA 4E7LA 1F21A 1NOZA 3O3HA 1J9AA 1KLMA 3LANA 2KW4A 1TK5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E7K A;  4OKJ A;  4PWD A;  4F3T A;  1C6V A;  1RTI A;  2F96 A;  4IG3 A;  4CK1 A;  1C1A A;  2HHV A;  4H8K A;  5D3G A;  3V1R A;  4CEO A;  2DFE A;  4RW7 A;  4B9M A;  1RTJ A;  4NYF A;  4UQG A;  4BWJ A;  3SQ0 A;  1N5Y A;  2KTQ A;  1U04 A;  4CJV A;  4Q5V A;  1JXE A;  4N76 A;  1WN7 A;  4CHN A;  3D0P A;  1NKC A;  1TL3 A;  4DTX A;  3RMA A;  4IFY A;  2P51 A;  4F3O A;  3DOK A;  4EP4 A;  3KTQ A;  4KHW A;  3KLG A;  1U4B A;  3AA4 A;  1TVR A;  3ZT2 A;  4Z4F A;  3IRX A;  3DI6 A;  3VQ8 A;  4OPK A;  2YKN A;  1HJR A;  1RCH A;  2LSN A;  4DTN A;  3HK2 A;  3RMB A;  1KLN A;  4FJI A;  4FXD A;  1RT6 A;  4KKO A;  1RDD A;  1XI1 A;  3OYB A;  3T3F A;  4CFA A;  4FW1 A;  1FXX A;  1JLB A;  1KVC A;  4LH5 A;  2EHG A;  4JRP A;  1RT7 A;  2HW3 A;  5HP1 A;  1RNH A;  1BIZ A;  5FRM A;  3HT3 A;  2F8T A;  2HB5 A;  4NYN A;  4CJ3 A;  4DSJ A;  3V9U A;  1VSH A;  2P1J A;  3CFR A;  3KIO A;  1RT5 A;  3CFP A;  4YFU A;  1TKZ A;  3M8Q A;  3V1O A;  4AHV A;  1JLC A;  3QET A;  1NK7 A;  1NK4 A;  1KFS A;  3C95 A;  3WNH A;  5DK5 A;  4B9L A;  4DSK A;  2B4J A;  2Z1H A;  4DSI A;  2DY4 A;  5JS1 A;  3LAK A;  4BDP A;  4OJR A;  2XY8 A;  1C0T A;  2XRI A;  4CES A;  5KRS A;  1KTQ A;  2FBV A;  2Z1J A;  4CIE A;  4H4M A;  3OYA A;  2FBY A;  2HHT A;  4DU4 A;  3DOL A;  1TKX A;  1QSL A;  1NK6 A;  5J2P A;  2HHS A;  2B5J A;  4Y1C A;  4Q0B A;  4CF1 A;  1VRT A;  4CJR A;  3LAM A;  3NDK A;  4CJ5 A;  4FJN A;  2KQ2 A;  3OYD A;  2VWJ A;  2X6S A;  4I2Q A;  1MU2 A;  2Z1G A;  4JRQ A;  1WSH A;  4RW9 A;  3AVG A;  2FBX A;  1IO2 A;  5KRT A;  3SUO A;  1BIU A;  3LPT A;  3TAR A;  3CM6 A;  2HMI A;  3RWU A;  4J2E A;  2GUI A;  3HP6 A;  4N5S A;  1VSL A;  3MEC A;  3V1Q A;  4CF8 A;  2ATQ A;  1UA1 A;  1XHX A;  4FJ9 A;  2QKB A;  4CF0 A;  3DYA A;  1BI4 B;  2G8H A;  3NCI A;  4L8R B;  3S3O A;  1NKB A;  1J5O A;  3O4N A;  1RDB A;  3TAE A;  4ZTJ A;  1ZBL A;  4CEB A;  5J2N A;  2VG7 A;  4CGI A;  3QES A;  3SUQ A;  2OZS A;  3NF6 A;  4E89 A;  3KK3 A;  4C8N A;  3K5N A;  4HUG A;  3HO1 A;  3IG1 A;  1IKW A;  4FCY A;  2BAN A;  3K5M A;  2YNF A;  4DS4 A;  1D9D A;  4F2S A;  1IG9 A;  4LSN A;  3O4Q A;  2RF2 A;  2B6A A;  4ZHR A;  3OYN A;  4E3S A;  3KD5 E;  5KGW A;  1JXB A;  4C8M A;  4BE0 A;  4FLU A;  4HCB A;  2OPR A;  4NCG A;  3NAE A;  3L2Q A;  2QKK A;  4FJG A;  3CM5 A;  4O4G A;  4HCC A;  4CEE A;  2EX3 A;  4CEF A;  3O3F A;  3QNN A;  2IAJ A;  3ISN C;  4E1M A;  3PY8 A;  4FK4 A;  3K2P A;  3C6U A;  5CYM A;  1WSG A;  4FLT A;  1TAU A;  3TAG A;  1KVA A;  2IOC A;  4JLH A;  4AIL C;  4W5O A;  2A1R A;  1U49 A;  2ZE2 A;  1L3V A;  3T1A A;  1NK9 A;  3VQQ A;  4DTU A;  4KAZ A;  4CJQ A;  1B9D A;  1EKE A;  1GOA A;  1EXQ A;  3CG7 A;  5HRS A;  2IS3 A;  3PV8 A;  1NJZ A;  3B6O A;  4DQP A;  4CHY A;  1IKX A;  3VQ5 A;  2GBZ A;  4Z4I A;  1RBT A;  1A5V A;  4W5N A;  3VQA A;  3VQP A;  1JLQ A;  3AVF A;  4DTJ A;  4JS5 A;  3SQ2 A;  1X9W A;  1NK0 A;  1QSY A;  3KK1 A;  4KHS A;  1KRP A;  4O5B A;  3OS1 A;  2G8I A;  4DSF A;  3V9S A;  3OJU A;  1QSS A;  3NF9 A;  3OYH A;  3P1G A;  1I39 A;  2O4G A;  3G10 A;  3AVL A;  1HYS A;  2DFH A;  3EYZ A;  3CQ8 A;  3DLH A;  5JS2 A;  3AVM A;  4FJX A;  4N47 A;  4AH9 A;  4CF9 A;  1RBS A;  3DMJ A;  3NE6 A;  1GOC A;  1S1W A;  2ZQB A;  3K5L A;  4B8C A;  1SL1 A;  3BDP A;  1WSI A;  3BGR A;  2YNH A;  4O44 A;  2D0A A;  4E0D A;  3LP1 A;  3MXI A;  1TK8 A;  4M41 A;  1BCM A;  3ASM A;  3OYG A;  4CHZ A;  1SL2 A;  1N6Q A;  2E6L A;  3RR8 A;  1LAW A;  1TGO A;  5CY4 A;  1TL1 A;  1D9F A;  4FW2 A;  4NCB A;  4RW4 A;  2KFZ A;  1RDA A;  3NH2 A;  2XY5 A;  3MXJ A;  1SKW A;  3DLE A;  3VQ6 A;  3LPU A;  4CFB A;  4DTR A;  3AA3 A;  3AVI A;  2VG6 A;  4ELV A;  2YV0 X;  1IKY A;  4AHT A;  4IKF A;  5FRN A;  1W0H A;  4OLA A;  1RT2 A;  1UOC A;  4CGH A;  3G0Z A;  4QAG A;  3B6P A;  2Y1I A;  3SUP A;  1L5U A;  4ID1 A;  4CGJ A;  4QOZ B;  2BE2 A;  3LAL A;  3LP3 A;  3OYK A;  3NGI A;  1B9F A;  4B8A B;  2RN2 A;  2AJQ A;  3A2F A;  3PX6 A;  3THV A;  4PA1 A;  2XY7 A;  3VQC A;  3OYL A;  1LW0 A;  2OYQ A;  2R7Y A;  4KRF A;  1A5X A;  1RBR A;  4CJL A;  4F8R A;  4DTS A;  4CGD A;  5HRN A;  4YNQ A;  3NFA A;  4DLE A;  4KB0 A;  2OPQ A;  3AA2 A;  3QER A;  3S3N A;  4CFC A;  3AO4 A;  1WAJ A;  1NJW A;  2Z1I A;  4CED A;  4OKK A;  1SKR A;  2Y1J A;  2A1S A;  2JLE A;  4KTW A;  4CE9 A;  1L3U A;  1L3T A;  1YTA A;  3O3G A;  3DM2 A;  4EZ6 A;  1EET A;  2G8V A;  4Z4C A;  4ICL A;  1HRH A;  4KO0 A;  4KTZ A;  3KLF A;  3C94 A;  4DS5 A;  3RRH A;  5J2M A;  1X9S A;  1T8E A;  3RRG A;  1YT3 A;  4CJK A;  2IC3 A;  4M3T A;  1ASV A;  1K6Y A;  2YHB A;  3SJJ A;  3OYI A;  4CJS A;  2OPS A;  3SUN A;  3MXM A;  3KD1 E;  4KI4 A;  2HVI A;  4FVM A;  4KB1 A;  5EU7 A;  4CEQ A;  3AVJ A;  3WNG A;  4ZTF A;  1T05 A;  3DLK A;  3NGZ A;  1SKS A;  1XC9 A;  4FK0 A;  1RIL A;  4FLX A;  1LWF A;  4F2R A;  4DU1 A;  2HHQ A;  5C25 A;  3F9K A;  4FJ8 A;  2YNG A;  1KVB A;  3HST B;  4AHS A;  1ZBF A;  2PYJ A;  2ITG A;  4CF2 A;  4NCA A;  4DTO A;  2HHX A;  3VN5 A;  3OVN A;  3DRR A;  2OPP A;  4HUE A;  1LWE A;  4FJL A;  4CJW A;  3PX4 A;  3HJF A;  1JLG A;  1C1B A;  1C0U A;  1VSM A;  3RMD A;  1RT1 A;  1CZ9 A;  2HND A;  3QEP A;  4FJJ A;  4B9S A;  3HVT A;  3IAY A;  3ZSQ A;  1RBU A;  4HTU A;  2D0C A;  3VA3 A;  1TKD A;  5C42 A;  3QEV A;  1ITG A;  1KCF A;  1G15 A;  4BAC A;  1Y97 A;  3KLH A;  4M3X A;  3ZSX A;  4J2A A;  3M8R A;  1W9H A;  4E7H A;  3E01 A;  3ZT1 A;  3VQD A;  4M3Z A;  1S9E A;  4BE2 A;  4Z0U A;  5C24 A;  3K59 A;  1VRU A;  3C6T A;  4I9L A;  3TAM A;  1A5W A;  4DWI A;  3CYM A;  3RMC A;  3SQ1 A;  1WSJ A;  3P5J A;  2KZZ A;  1D5A A;  5CYQ A;  3SNN A;  1ZBI A;  3SZ2 A;  3U3G A;  1Z25 A;  2GV9 A;  1KSP A;  1HYZ A;  3TAP A;  5E41 A;  1IH7 A;  1LWC A;  3V4I A;  1C0M A;  2QXF A;  4G1Q A;  3LZJ A;  3UIQ A;  5CZ1 A;  4J2D A;  4H4O A;  1UAX A;  2E6M A;  5CZ2 A;  1SV5 A;  2FC0 A;  3VQ7 A;  4CHP A;  3KK2 A;  3HPH A;  4Z4G A;  5J1E A;  1NK8 A;  3ZSZ A;  4CJE A;  3OYC A;  4F4K A;  1VSJ A;  3ZSV A;  4RW8 A;  1BIS A;  1TAQ A;  3HPG A;  3TI0 A;  2IGI A;  2WOM A;  1CXQ A;  3AVH A;  3AV9 A;  2DFF A;  3L2V A;  4HUF A;  3MAQ A;  1X9M A;  4I9Q A;  1YTU A;  2ZD1 A;  4CEC A;  4FZZ A;  3OS0 A;  4KFB A;  2X74 A;  4CJF A;  4CHO A;  1TV6 A;  3OYJ A;  4KTQ A;  1WSE A;  4OLB A;  4FLZ A;  3PO5 A;  1QE1 A;  4M3R A;  4FK2 A;  4FZX C;  1ZBH A;  4CJT A;  3EY1 A;  1RTD A;  4FYD A;  2D5R A;  2RKI A;  1Z26 A;  3D45 A;  4LD0 A;  2OZM A;  3ZSW A;  1BHL A;  4DMN A;  2G8U A;  2ETJ A;  3HP9 A;  4CHQ A;  3V6D A;  4M3W A;  3AVN A;  3FFI A;  1C1C A;  3QIO A;  4EP5 A;  1SL0 A;  1DLO A;  3HYF A;  4FM0 A;  3SPZ A;  3WNF A;  3CFO A;  4DFM A;  4J2B A;  2QK9 A;  4DF8 A;  3V9Z A;  1BQM A;  3I0S A;  4O55 A;  1HPZ A;  4RG8 A;  3QO9 A;  1UA0 A;  2HVH A;  3LWM A;  2YHA A;  4HVJ A;  3QEX A;  2RPI A;  4ELT A;  4I7F A;  4BWM A;  4N56 A;  4CEA A;  3SI6 A;  1NOY A;  1ASU A;  2YKM A;  4GVM A;  2BDP A;  3JYT A;  4MQ3 A;  3PUF A;  4GMJ B;  4CK2 A;  1HNV A;  1U45 A;  1T7P A;  4RW6 A;  5KGX A;  4DLG A;  4C8K A;  4FZY A;  4HHT A;  4I2P A;  4CFD A;  4K8X A;  4PUO A;  5HBM A;  4CIG A;  4OPJ A;  1YVU A;  4ELU A;  2XHB A;  4FM1 A;  4B3O A;  1KFD A;  1XWL A;  3NF7 A;  4QCL A;  3TAN A;  3ZT3 A;  4FLW A;  4FJH A;  1HMV A;  1DTQ A;  1LW2 A;  1FKO A;  1S1X A;  1WNS A;  1CZB A;  3KKS A;  3TAB A;  3P83 D;  3I8D A;  1EX4 A;  2OA8 A;  3IS9 A;  2HHW A;  1DTT A;  4LY7 A;  3OYF A;  1J54 A;  4LH4 A;  2W42 A;  3QNO A;  5HLF A;  3ZT4 A;  1L3S A;  3T19 A;  1U48 A;  4R5P A;  3VA0 A;  4XIU A;  1D8Y A;  4GW6 A;  1CLQ A;  4CJP A;  1RT4 A;  2PZS A;  2X6N A;  3KLI A;  4DSL A;  3LP0 A;  3KLE A;  2O4I A;  1QTM A;  1BI4 A;  3HM9 A;  3QIN A;  4AHR A;  2G8F A;  3VQE A;  4CJ4 A;  1S1U A;  5I3U A;  5HRP A;  3LDS A;  1NJY A;  4M45 A;  1Q8I A;  1O1W A;  3ITH A;  3MED A;  1FKP A;  3ZCM A;  2IDO A;  1R0A A;  3SQ4 A;  2DTU A;  4DU3 A;  1GOB A;  4C8L A;  1QQC A;  5FDL A;  4IG0 A;  3K57 A;  1CXU A;  3HXM A;  4E1N A;  4B9T A;  4DQQ A;  5KI6 A;  4DQI A;  3RTV A;  1TK0 A;  4DTP A;  1BQN A;  4PQU A;  3OYM A;  3SYZ A;  1T03 A;  1I3A A;  4M3U A;  1J53 A;  3PO4 A;  2JGU A;  5FRO A;  4CEZ A;  4B08 A;  4Y1D A;  4DFP A;  3HPO A;  3L8B A;  4DQS A;  4N41 A;  3NBP A;  4OGE A;  3AA5 X;  4DTM A;  5KTQ A;  2WON A;  2HHU A;  5K14 A;  3SV3 A;  3SPY A;  1BL3 A;  3JSM A;  4CK3 A;  2P5O A;  4FJM A;  3SV4 A;  4M3Y A;  4FLY A;  2NUB A;  4E7I A;  2XY6 A;  1BGX T;  4IBN A;  3L3U A;  2G8K A;  4FJ7 A;  4M42 A;  3L2U A;  2VWK A;  1LV5 A;  3DLR A;  4OGC A;  4BDZ A;  1Q9X A;  2FBT A;  4E7J A;  4W5Q A;  4LSL A;  3QIP A;  4CGG A;  5HRR A;  4W5R A;  3AVB A;  1VSE A;  3S3M A;  4AHC A;  1S9G A;  1S6Q A;  4CIF A;  2HNY A;  4BDY A;  3AO2 A;  1UWB A;  4KHN A;  3EZ5 A;  3VQ4 A;  1QHT A;  2I5J A;  4K8Z A;  3ULD A;  1EP4 A;  3ZSR A;  3L2R A;  1X1P A;  4CGF A;  2BGG A;  1RTH A;  1VSD A;  4KHY A;  1HQE A;  4Z4H A;  4KPY A;  1NK5 A;  4O0I A;  3NHG A;  2Q3S A;  2X78 A;  4DF4 A;  1FK9 A;  1S6P A;  4IDK A;  2HNZ A;  4WE1 A;  3AVA A;  4E19 A;  4JS4 A;  2G8W A;  4B9U A;  1SUQ A;  4CCH A;  1JL2 A;  1LAV A;  3KJV A;  1JLF A;  3MEE A;  3SCX A;  3DLG A;  4FJK A;  3AO5 A;  1RDC A;  3L2W A;  1JLE A;  4AHU A;  3WNE A;  4DSE A;  4KRE A;  1U47 A;  4MFB A;  5T7B A;  2VG5 A;  1TKT A;  3LZI A;  3TAF A;  4FLV A;  4ID5 A;  1HQU A;  3DLB A;  3V9X A;  4Z4E A;  3AO3 A;  1HNI A;  3I0R A;  4B9V A;  1S1T A;  3TWH A;  3ZSO A;  3DRS A;  2D0B A;  4DFJ A;  1VSF A;  3V9W A;  5J2Q A;  4KHQ A;  1HYV A;  3RR7 A;  3LP2 A;  4IFV A;  4TSX A;  3QEI A;  3ZT0 A;  3LWL A;  4BE1 A;  2P5G A;  3AVK A;  5I42 A;  2PYL A;  3AVC A;  3M8P A;  1WLJ A;  1IKV A;  4W5T A;  1VK0 A;  1VSK A;  1VSI A;  1S1V A;  4PY5 A;  2KZM A;  3V81 A;  1NKE A;  1RT3 A;  3K5O A;  3DRP A;  4DQR A;  3HVR A;  4DFK A;  4OKE A;  4OVL A;  4KHU A;  2F8S A;  1ZBU A;  1B92 A;  1JKH A;  3OS2 A;  1QS4 A;  3L3V A;  1JLA A;  4CER A;  3OY9 A;  1WAF A;  5SWM A;  3QLH A;  3F73 A;  2KFN A;  4CJU A;  5HRO A;  3VQB A;  1REV A;  3TR8 A;  2XO7 A;  3KKR A;  3OJS A;  4KI6 A;  2YNI A;  1NJX A;  3U3Y A;  4EZ9 A;  3S9H A;  3M8S A;  2E4L A;  3ALY A;  4B9N A;  1WSF A;  3K58 A;  4FM2 A;  2PY5 A;  3ZSY A;  5SZT A;  3NF8 A;  4FJ5 A;  1RBV A;  3MEG A;  3H08 A;  1JL1 A;  1S5J A;  4DG1 A;  1ZYQ A;  3NH0 A;  3VQ9 A;  1Q9Y A;  3AO1 A;  4KV8 A;  3PX0 A;  3NGY A;  4C8O A;  4O0J A;  3NH1 A;  3QEW A;  1BCO A;  3OYE A;  3U6F A;  3TAQ A;  5DMR A;  1XHZ A;  3HL8 A;  1ASW A;  4E7L A;  1F21 A;  1NOZ A;  3O3H A;  1J9A A;  1KLM A;  3LAN A;  2KW4 A;  1TK5 A; 
#chains in the Genus database with same CATH topology
 2QXL A;  4E7K A;  5BPM A;  2Q31 A;  3KWG A;  4CK1 A;  4IG3 A;  1WUA A;  4H8K A;  5D3G A;  3CCL N;  1U2V B;  2DFE A;  1RTJ A;  4XH5 A;  3ZX0 A;  1DGK N;  1U04 A;  3DJC A;  4CJV A;  4ISG A;  2NRW A;  1WN7 A;  1TL3 A;  3RMA A;  5GIN A;  4EP4 A;  3KTQ A;  3CME N;  1HUX A;  4ISE A;  1HJR A;  4X66 K;  2HBL A;  3HK2 A;  1RT6 A;  4KKO A;  1RDD A;  1XI1 A;  4CFA A;  4JKF A;  1JLB A;  4LH5 A;  2EHG A;  4K43 A;  1RT7 A;  2HW3 A;  4CJ3 A;  3A8Y A;  2P1J A;  3CFR A;  3KIO A;  2QWO A;  4YFU A;  5H1S Q;  1TKZ A;  3V1O A;  1NK4 A;  1JLC A;  3QET A;  1NK7 A;  3F5T A;  3D2F A;  1KFS A;  4DSK A;  3U4L A;  4BDP A;  4OJR A;  4CES A;  3CJ1 A;  2FBY A;  2HHT A;  4DU4 A;  3DOL A;  3UE5 A;  1NK6 A;  3OW2 M;  4Q0B A;  4CJR A;  3LAM A;  3NDK A;  3OYD A;  1FJG K;  2X6S A;  4JRQ A;  1SQK A;  1BIU A;  3MEC A;  2QWN A;  3V1Q A;  4CF8 A;  2QKB A;  1XHX A;  5AZI B;  1NKB A;  4WFN L;  4ZTJ A;  3LM2 A;  2OZS A;  4CEB A;  3SUQ A;  5AQJ A;  1RDW X;  3K5N A;  1S3X A;  3IG1 A;  1GLB G;  3FE1 A;  2YNF A;  2P9U A;  4DS4 A;  4YOR A;  1D9D A;  3O4Q A;  3OYN A;  4A2B A;  4ZHR A;  1XNR K;  1VQN N;  3ZEU B;  5KGW A;  4BE0 A;  2OPR A;  2HBM A;  4QS8 A;  3DXM B;  3VEV A;  4HCC A;  2QWL A;  2EX3 A;  2IAJ A;  3ISN C;  3PY8 A;  3CD6 N;  4JI8 K;  1NGI A;  3K2P A;  4JI6 K;  4FLT A;  3EKS A;  2A1R A;  2QEX N;  2E2N A;  4MLH A;  2P9P A;  4DTU A;  3PV8 A;  1EXQ A;  3CG7 A;  4JK9 A;  5HRS A;  1NJZ A;  3B6O A;  3HRG A;  1Q86 O;  1IKX A;  3VQ5 A;  2GBZ A;  4BR4 A;  1A5V A;  3VQA A;  5AQK A;  1X9W A;  1QSY A;  5AZJ B;  1KRP A;  4O5B A;  2A3Z A;  4CJ7 A;  4DSF A;  2G8I A;  1MA9 B;  2W41 A;  3NF9 A;  3OYH A;  3LDN A;  3G10 A;  1HYS A;  1P8Z A;  4Y0W A;  3QML A;  3R9P A;  5AQI A;  2W40 A;  4N47 A;  3DMJ A;  3NE6 A;  2Q36 A;  3MK6 A;  1HX1 A;  1SL1 A;  3BDP A;  3VMF B;  3LP1 A;  2Q2R A;  2FLO A;  5EVZ A;  4M41 A;  3OYG A;  3DXK B;  4CHZ A;  1SL2 A;  4U67 L;  2AA4 A;  4FWQ A;  2NRR A;  1LAW A;  2WUS A;  4FW2 A;  4RW4 A;  4H0P A;  1VQ6 N;  2QTD A;  4CFB A;  3HI0 A;  4DTR A;  1IKY A;  3EE9 A;  5C12 A;  2Y1I A;  4QOZ B;  4ID1 A;  3LAL A;  3NGI A;  4YOT A;  4LF5 K;  3PX6 A;  4BG9 A;  2XY7 A;  3J7Z O;  4F8R A;  1RBR A;  1MWM A;  4CGD A;  3NFA A;  1TUU A;  4DR2 K;  5AQQ A;  1NJW A;  3G25 A;  1WAJ A;  4OKK A;  4CE9 A;  3F2K A;  1YTA A;  3DM2 A;  3HM8 A;  2VWB A;  4Z4C A;  4KTZ A;  2DTU A;  4OPA A;  3W3D A;  4CJK A;  2IC3 A;  3ENH A;  3SJJ A;  4H0V B;  3SUN A;  3VPZ A;  4DV3 K;  3MXM A;  3KD1 E;  1YIT N;  4KI4 A;  1NGJ A;  5EU7 A;  4BVP A;  3DLK A;  3NGZ A;  2NRT A;  4F2R A;  4JEP A;  3F9K A;  2YNG A;  1KVB A;  4BR7 A;  3BZK A;  5AQX A;  4FJL A;  3HJF A;  1C1B A;  3SMP A;  2O8D B;  3HVT A;  4IEI A;  4XEI A;  2D0C A;  3VA3 A;  3MX2 A;  1XUP O;  1KCF A;  1G15 A;  1Y97 A;  4J2A A;  4E7H A;  3E01 A;  2V7Z A;  3ZT1 A;  3WT0 A;  4M3Z A;  1S9E A;  4Z0U A;  4I9L A;  1NU0 A;  1N32 K;  1NGC A;  3WXI A;  2P9L A;  5M1Q A;  4BRD A;  2FF6 A;  4FOE A;  1KXP A;  3EEQ A;  1KSP A;  1LWC A;  3V4I A;  2QXF A;  4H0T B;  4FWP A;  4A5B A;  1UAX A;  2E6M A;  2FC0 A;  3VQ7 A;  4CHP A;  3ZSZ A;  3OYC A;  3ZSV A;  2O8E B;  1BIS A;  3TI0 A;  3B8A X;  3AV9 A;  3L2V A;  5BR9 A;  4KFB A;  1TV6 A;  3OYJ A;  1WSE A;  1NG9 A;  4CJT A;  4JI0 K;  2KHO A;  4I6M B;  5CR4 A;  4CZK A;  2WTU A;  3O9U A;  2G8U A;  4CHQ A;  3PSF A;  2BTF A;  3SPZ A;  3CFO A;  5EX5 A;  3I0S A;  4WCE L;  3QO9 A;  4HVJ A;  4DR5 K;  3G4S N;  1NOY A;  1D4X A;  4CEA A;  1ASU A;  5AQY A;  3I8B A;  4QS9 A;  3CER A;  3PUF A;  1T7P A;  4C8K A;  4RW6 A;  3AY9 A;  1WBB A;  4HHT A;  4I2P A;  4A59 A;  4CFD A;  4PUO A;  1VQL N;  1DT9 A;  4ELU A;  2XHB A;  4B3O A;  3NF7 A;  1HMV A;  1FKO A;  4AM6 A;  5M1K A;  1WNS A;  4DR6 K;  2OA8 A;  1DTT A;  1J54 A;  2W42 A;  5HLF A;  3T19 A;  3VA0 A;  1GLC G;  4GW6 A;  1CLQ A;  1W7A A;  4Z94 A;  5ELZ A;  2X6N A;  3LP0 A;  1ZBS A;  1BI4 A;  1NWK A;  3QIN A;  3O9Q A;  5HRP A;  3GOI A;  3FZL A;  1FKP A;  5AQZ A;  3U8X A;  4C8L A;  2P9I A;  3R6M A;  1QQC A;  3K57 A;  3HXM A;  4E1N A;  4B9T A;  2AP1 A;  1K8K B;  5KI6 A;  2ZGZ A;  3VEN A;  3VF6 A;  1BQN A;  4PQU A;  3OYM A;  1T03 A;  2JGU A;  4DUZ K;  1KAY A;  4Y1D A;  3L8B A;  4B9Q A;  4DQS A;  2O8C A;  4LC9 B;  1K8A O;  1VHX A;  2HHU A;  3LDL A;  3SV3 A;  4H5T A;  3SPY A;  1NGD A;  2V7Y A;  1O13 A;  3AAQ A;  4NB4 A;  4JKG B;  4M42 A;  4AM7 A;  2VWK A;  1W2B M;  4BDZ A;  1Q9X A;  5AQO A;  4W5Q A;  4LSL A;  3JS6 A;  3GDQ A;  2F7T A;  4CIF A;  1K73 O;  4GV9 A;  5AR0 A;  1QHT A;  4IO9 L;  3CPW M;  3MMV A;  5AQR A;  1BDG A;  4O0I A;  3Q7B A;  4WE1 A;  4B9U A;  4CCH A;  4O5F A;  4O8U A;  1JLF A;  3KJV A;  1IBM K;  2QW9 A;  1TUY A;  1RDC A;  2E5L K;  3WNE A;  4BR2 A;  4KRE A;  1U47 A;  1QQM A;  4K0K K;  3TSP A;  4BRC A;  1YAG A;  2WFB A;  1ESV A;  3O5B A;  4BGB A;  4FOI A;  1ATR A;  1DEJ A;  3O80 A;  2D0B A;  3EL2 A;  1VSF A;  3VEY A;  1HYV A;  1NBW A;  3LP2 A;  3QEI A;  3SBG A;  3ZT0 A;  1XNQ K;  3BZC A;  4F9O A;  5I42 A;  1WLJ A;  2IIR A;  1VSK A;  4W5T A;  4RTF D;  1S1V A;  4PY5 A;  1NKE A;  3BF3 A;  3DRP A;  3HVR A;  4DFK A;  1QS4 A;  3L3V A;  3WXL A;  3VQB A;  3OJS A;  4KI6 A;  1NJX A;  3S9H A;  3CMA N;  3ULE A;  2E4L A;  1KD1 O;  5SZT A;  1RBV A;  1JL1 A;  2FF3 B;  1ZYQ A;  3IMX A;  4IWV A;  3HBT A;  1VQ9 N;  3NH1 A;  3QEW A;  3OYE A;  3T1H K;  4LF6 K;  4E7L A;  2HF3 A;  1NOZ A;  1WOQ A;  1WBD A;  3ID8 A;  2VYP A;  3A0I X;  1SZ2 A;  4F3T A;  2F96 A;  1C1A A;  3IDH A;  2YCH A;  3V1R A;  4G9Z A;  4UQG A;  2QWP A;  2IVN A;  4BWJ A;  4BGA A;  3A5N C;  5JMV A;  3SQ0 A;  2NZT A;  4Q5V A;  3D0P A;  1NKC A;  4F3O A;  3DOK A;  4FWR A;  3KLG A;  1EO1 A;  1IJJ A;  4DR7 K;  1TVR A;  1YVN A;  3O9S A;  3R1X A;  4WQ4 C;  3IRX A;  3DI6 A;  1NMN A;  1I94 K;  1T3V A;  3RMB A;  1KLN A;  4NO7 A;  1FXX A;  2H3G X;  1HKB A;  1X3M A;  4JRP A;  1BIZ A;  3HT3 A;  2HB5 A;  4JI2 K;  4H5R A;  1VSH A;  1Z05 A;  1N33 K;  2CH5 A;  4BC4 A;  4H5V A;  4AHV A;  4CBW A;  3T7Z A;  2Q97 A;  4B9L A;  2BUP A;  4CIE A;  4M7Y A;  4JHD A;  4CZE A;  5AQG A;  3Q7C A;  2HHS A;  2B5J A;  3GG4 A;  4CF1 A;  3D6R A;  3VEZ A;  3OHR A;  2KQ2 A;  3G6E N;  5KRT A;  2HOE A;  3WQT A;  5FPE A;  3CM6 A;  3VET A;  2HMI A;  4J2E A;  4N5S A;  1UA1 A;  3H3O B;  3DYA A;  3CJ7 A;  4L8R B;  2I7N A;  1RDB A;  2O8B A;  1W97 L;  3NF6 A;  3KK3 A;  3I55 N;  3THY A;  4CW7 B;  4HUG A;  3HO1 A;  3M3Z A;  4BRQ A;  2BAN A;  2Q0U A;  4CZM A;  3VEO A;  1IG9 A;  3MN7 A;  4LSN A;  2E20 A;  5BR8 K;  3KHY A;  4E3S A;  1JXB A;  5LY3 A;  4HCB A;  3ZET B;  4O4G A;  3QNN A;  4DR3 K;  4JD2 A;  3LDO A;  5CYM A;  3TAG A;  1KVA A;  4JLH A;  4W5O A;  5BRD A;  1L3V A;  2ZE2 A;  3VQQ A;  3O9R A;  4CHY A;  2ZJQ L;  1X3N A;  2EWS A;  4DTJ A;  3SQ2 A;  1HNZ K;  1NK0 A;  4A61 A;  1U6Z A;  3KK1 A;  1XMO K;  4KHS A;  1TYQ B;  3OBW A;  1QSS A;  5C15 A;  3P1G A;  1SAZ A;  4MLE A;  2O4G A;  3BP8 A;  1HR0 K;  1NGH A;  1ATS A;  3CQ8 A;  5JS2 A;  4IXC A;  3VTH A;  4BRP A;  1RBS A;  1GOC A;  1S1W A;  2GUP A;  1KAX A;  2YNH A;  3ZX2 A;  1BCM A;  2P9N A;  3ASM A;  1N6Q A;  2E6L A;  3I33 A;  1D9F A;  4NCB A;  2E2Q A;  4JI4 K;  3J81 O;  2KFZ A;  3NH2 A;  3LPU A;  3C0B A;  4ELV A;  4AHT A;  5FRN A;  2NLX A;  5M1N A;  1W0H A;  4CZI A;  1RT2 A;  4CGH A;  1L5U A;  1P90 A;  4CGJ A;  2BE2 A;  1B9F A;  4KH4 A;  4X64 K;  1K9M O;  1X9J A;  2IVO A;  4PA1 A;  3OYL A;  1LW0 A;  4YNQ A;  1VQO N;  2E2P A;  4DLE A;  3QER A;  4CFC A;  3BUZ B;  2Z1I A;  4CED A;  2JLE A;  3WEE A;  2ZJR L;  4B1Z A;  2VCP A;  4EZ6 A;  1VAZ A;  3KLF A;  5J2M A;  3C94 A;  4CBX A;  1YUW A;  1FW6 A;  1K6Y A;  3OYI A;  4KB1 A;  4ZTF A;  4R79 A;  4YY3 K;  1RIL A;  2HHQ A;  5C25 A;  2FXU A;  1EQY A;  5JIC A;  3HOT A;  4FJ8 A;  3VN5 A;  2QI2 A;  3VF2 A;  1C0U A;  1RT1 A;  4DV5 K;  3IAY A;  3ZSQ A;  1TKD A;  1IBL K;  2P9K A;  5KQ8 A;  1JCE A;  3KLH A;  2O8F A;  5AJ3 K;  3M8R A;  2OTL N;  1W9H A;  4YOY A;  3TTD A;  3C6T A;  5JLH A;  3TAM A;  3CYM A;  2KZZ A;  3SNN A;  3SZ2 A;  4K41 A;  1Z25 A;  3TAP A;  5F0X A;  1IH7 A;  1C0M A;  4G1Q A;  4J2D A;  3LZJ A;  5FPD A;  2QA4 N;  4Z4G A;  4F4K A;  2JWK A;  1VSJ A;  1GLA G;  1MWK A;  3HPG A;  3BY5 A;  5EY4 A;  2DFF A;  3MAQ A;  2V51 B;  1YTU A;  2YX6 A;  3KVG A;  2WBN A;  2E88 A;  2E1Y A;  4BRM A;  3J7Y P;  3VGK A;  1RTD A;  4FYD A;  2D5R A;  1Z26 A;  2OZM A;  4DMN A;  4RWT A;  2ETJ A;  1ZC6 A;  3FFI A;  1SL0 A;  3KK7 A;  4LFC K;  3D2F B;  1NNE A;  4DFM A;  5JLF A;  3UKR A;  4DF8 A;  1Z6R A;  2Q0R A;  4FWO A;  4RG8 A;  1HPZ A;  5EOY A;  3VGL A;  1YJN N;  2HVH A;  3CCM N;  4N56 A;  2YKM A;  4GVM A;  4FZY A;  1HNV A;  5BN9 A;  4AQY K;  4K8X A;  1E4G T;  2PFU A;  2YHX A;  3T1Y K;  1YVU A;  3THW A;  5M1O A;  1J6Z A;  2W6K A;  1LW2 A;  4M7X A;  2KLA A;  4CD3 A;  4CI6 A;  4AF1 A;  3TU5 A;  3O1W A;  3TAB A;  3KKS A;  3P83 D;  4BC3 A;  2GWK A;  4EAH D;  1EX4 A;  4ISF A;  3CC4 N;  3QNO A;  4LH4 A;  3ZT4 A;  2P9U B;  5AQM A;  4R5P A;  4IJA A;  4DQ8 A;  5E26 A;  3KLI A;  4DSL A;  3KLE A;  2O4I A;  4ILG B;  3HM9 A;  3H3N O;  1S1U A;  5I3U A;  3AAP A;  3LDS A;  4GKJ K;  1Q8I A;  5GIO A;  2P9P B;  1R0A A;  3SQ4 A;  4DU3 A;  1CXU A;  3EO3 A;  3LDP A;  4DQQ A;  4FPA A;  1C0G A;  3SYZ A;  3CCV N;  1JJ2 M;  1I3A A;  3EZW A;  1J53 A;  3WXK A;  1R59 O;  3VOV A;  5FRO A;  3S41 A;  3NBP A;  1HNW K;  5AQS A;  2WON A;  5K14 A;  1VQ7 N;  2GEL A;  2P5O A;  3ATV A;  3CJC A;  1BGX T;  4IBN A;  3L3U A;  5DM7 L;  4LF4 K;  5CHI A;  2FBT A;  3ZYY X;  1OVQ A;  3AVB A;  1VSE A;  4KHN A;  1S9G A;  4KH6 A;  4YOU A;  2HNY A;  3EZ5 A;  3E9O A;  2I5J A;  2GX9 A;  4O8K A;  4A5A A;  3ZSR A;  3L2R A;  2BGG A;  3THX A;  1VSD A;  5M1P A;  5BPN A;  3NHG A;  4DR4 K;  2Q3S A;  4DF4 A;  1S6P A;  4IDK A;  2G8W A;  1SUQ A;  1JL2 A;  1LAV A;  5FPN A;  3L2W A;  4AHU A;  1JCF A;  4HTL A;  3OBY A;  4A57 A;  4JNE A;  5T7B A;  2VG5 A;  3VES A;  3IKM A;  1BOT O;  3PIO L;  3DLB A;  3RSE A;  3DWL A;  1HNI A;  3I0R A;  5BN8 A;  2NNW A;  3N4P A;  4YOV A;  3ZSO A;  4KBO A;  4BVO A;  4JAX A;  3A5L C;  4BE1 A;  1M90 O;  3AVC A;  1IKV A;  4DV0 K;  1OH5 A;  2KZM A;  3V81 A;  4OVL A;  2F8S A;  1ZBU A;  2F9W A;  2D1K A;  1NLV A;  1WAF A;  2KFN A;  2NRV A;  3J80 O;  4BRH A;  4B3M K;  3ALY A;  4B9N A;  3EKU A;  5I9E B;  3K58 A;  3ZSY A;  4PL8 A;  3MEG A;  4DG1 A;  3NH0 A;  2P9L B;  5MLC Q;  1Q9Y A;  3AO1 A;  2DPN A;  4KV8 A;  5LMN K;  4K25 A;  5AQT A;  4O0J A;  1BCO A;  4NLB A;  5DMR A;  1ASW A;  1F21 A;  4JI3 K;  3P39 A;  3K9K A;  3O3H A;  1J9A A;  1KLM A;  4EHU A;  2KW4 A;  4DR1 K;  1LCU A;  1HKG A;  4OKJ A;  4PWD A;  4JYA K;  1RTI A;  4RW7 A;  3G71 N;  4B9M A;  2KTQ A;  4NYF A;  3FR0 A;  1E4F T;  1JXE A;  4N76 A;  1KC8 O;  4CHN A;  2CH6 A;  1Q18 A;  3DLL L;  4KHW A;  2NRX A;  1OH6 A;  3AA4 A;  3ZT2 A;  4Z4F A;  3HSC A;  3L4Q A;  3CCR N;  4OPK A;  2LSN A;  4DTN A;  4DHY A;  1V4S A;  4FXD A;  1V4T A;  2A41 A;  2D4W A;  5KPR A;  4IJN A;  1YIJ N;  5HP1 A;  1RNH A;  5FRM A;  3K9J A;  4NYN A;  4DSJ A;  2HBK A;  2IVP A;  1RT5 A;  4FWK A;  4PKI A;  2GWJ A;  3WQU A;  2OTJ N;  5GAG P;  3WNH A;  4DSI A;  2B4J A;  2DY4 A;  3E66 A;  3LAK A;  3ENO A;  2XY8 A;  5ADX A;  2XRI A;  5KRS A;  2FBV A;  2Z1J A;  4YDU A;  1RDU A;  3E1Y A;  3OYA A;  1TKX A;  3E9P A;  4Y1C A;  4C1N K;  1VRT A;  3C7N A;  4FJN A;  3D2E A;  2VWJ A;  2UU9 K;  4IZ9 A;  1MU2 A;  2Z1G A;  5AQH A;  2NRZ A;  3SUO A;  2FBX A;  1IO2 A;  3LPT A;  3EE8 A;  5M1F A;  3WXM B;  2GUI A;  3O6W A;  3HP6 A;  1VSL A;  4DV4 K;  2ATQ A;  4FJ9 A;  1BI4 B;  3NCI A;  3O4N A;  2F4V K;  3QES A;  5J2N A;  4CGI A;  1H1V A;  4HWI A;  5EXW A;  4E89 A;  1HPM A;  4C8N A;  4JN4 A;  1IKW A;  4CZL A;  4F2S A;  2P9I B;  2RF2 A;  4ILJ A;  4FLU A;  4PKG A;  4GY2 B;  3L2Q A;  2QKK A;  2RHK A;  5A2Q O;  4FJG A;  4CEE A;  3O3F A;  4E1M A;  4WQ4 A;  3C6U A;  2A42 A;  2IOC A;  2O8C B;  1U49 A;  3T1A A;  1NK9 A;  4KAZ A;  4CJQ A;  1B9D A;  2IS3 A;  5GAH P;  5BRH A;  1JLQ A;  1G99 A;  5AQW A;  3TTC A;  4JS5 A;  4BRK A;  3OJU A;  4YDU C;  1Q81 O;  4JI1 K;  3AVL A;  4UY8 O;  5JVG L;  2DFH A;  3DLH A;  3CIP A;  5AQV A;  4FJX A;  1N34 K;  4RCH A;  3E9L A;  3SJH A;  3BGR A;  3CF5 L;  4B3R K;  4CZF A;  2D0A A;  3W0L A;  4B1V A;  3MXI A;  3MWP A;  1TK8 A;  3RR8 A;  5CY4 A;  1RDA A;  3MXJ A;  3DLE A;  3VQ6 A;  3AVI A;  2YV0 X;  3DAW A;  3TPQ A;  4OLA A;  3G0Z A;  4QAG A;  3B6P A;  3SUP A;  3T69 A;  3UKU A;  5KPZ A;  3LP3 A;  2RN2 A;  2AJQ A;  3A2F A;  3THV A;  1MDU B;  3VQC A;  5CE3 A;  5F1X A;  4KRF A;  1A5X A;  4MO5 A;  1VQM N;  2OPQ A;  3S3N A;  3TTF A;  2KKZ A;  4KTW A;  3O3G A;  4FPB A;  1EET A;  4ICL A;  1SS6 A;  4KO0 A;  3RRH A;  1X9S A;  1YT3 A;  2CGJ A;  2I7P A;  2FSJ A;  1GLD G;  3NVM A;  4FVM A;  4FK0 A;  1T05 A;  2P9S A;  1XC9 A;  4DV7 K;  4FLX A;  3BF1 A;  1LWF A;  3ULE B;  4DU1 A;  3SAF A;  1VQP N;  4AHS A;  2PYJ A;  2W6L A;  2ITG A;  4NCA A;  2HHX A;  3OVN A;  3DRR A;  1LWE A;  2WC9 A;  3PX4 A;  4L3Q A;  1JLG A;  2RE2 A;  4DV2 K;  1VSM A;  2HBJ A;  1CZ9 A;  2HND A;  4HTU A;  4WQ5 A;  5LJV A;  4BAC A;  1XMQ K;  5C24 A;  3K59 A;  3LM9 A;  5AQF A;  1QZ5 A;  4BRN A;  3FZH A;  1A5W A;  3SQ1 A;  1WSJ A;  3P5J A;  1D5A A;  4IEE A;  5CYQ A;  3CJA A;  4IFE A;  5E41 A;  1VQ8 N;  4H5W A;  4BRG A;  5CZ1 A;  1IBK K;  3UB5 A;  3KK2 A;  1SV5 A;  1ZXO A;  3MN5 A;  3HPH A;  5J1E A;  4BR5 A;  1IG8 A;  5AFU A;  1TAQ A;  1HNX K;  2IGI A;  3AVH A;  4FWN A;  4I9Q A;  2ZD1 A;  1QQN A;  4CEC A;  4FZZ A;  4DV6 K;  1U2V A;  4J8F A;  3F9M A;  4KTQ A;  4OLB A;  1QE1 A;  4FK2 A;  1GLJ O;  5ADX H;  3O4W A;  2QM1 A;  3ZSW A;  1BHL A;  4B3S K;  1BG3 A;  4H03 B;  3NMU A;  1HLU A;  4M3W A;  4WF9 L;  3AVN A;  3QIO A;  1DLO A;  4FSV A;  3OTO K;  4H0O A;  3WNF A;  5BRE A;  2QK9 A;  4J2B A;  3V9Z A;  4O55 A;  5FLX O;  3LWM A;  1GLL O;  3QEX A;  4JHD B;  4WQ5 C;  4BWM A;  2BDP A;  3SI6 A;  3JYT A;  2PBD A;  4FO0 A;  4CK2 A;  1U45 A;  4M3T A;  4DLG A;  3KZB A;  5HBM A;  4CIG A;  4OPJ A;  1KFD A;  2ZWH A;  3CJB A;  4FWS A;  2QWR A;  4CD1 A;  1VQ5 N;  1DTQ A;  3FGU A;  1YJ9 N;  1T44 A;  2QWM A;  5C2D A;  2O8B B;  4IDH A;  4IOX A;  3I8D A;  3THY B;  2QWQ A;  2HMP A;  3OYF A;  2F9T A;  3FLC O;  2A5X A;  4XIU A;  1D8Y A;  4CJP A;  1RT4 A;  2PZS A;  3VGM A;  1RGI A;  5AZI A;  4AHR A;  4JD2 B;  3VQE A;  3QFP A;  4M45 A;  1O1W A;  3ITH A;  3ZCM A;  2IDO A;  1GLE G;  1GOB A;  4IO8 A;  1HJO A;  5FDL A;  4IG0 A;  4JI5 K;  3ZEU A;  2FSN A;  3DXM A;  5LJW A;  5LMU K;  4PL7 A;  4CEZ A;  2JWL A;  3WXJ A;  4C23 A;  3HPO A;  1M1K O;  4N41 A;  4OGE A;  3JXU A;  4GVE A;  4CK3 A;  4FJM A;  3FZF A;  2UYT A;  4E7I A;  2XY6 A;  3L2U A;  5AZJ A;  2P9N B;  3QB0 A;  3FZM A;  2VQE K;  3QIP A;  4BR0 A;  4W5R A;  3CCU N;  3S3M A;  4AHC A;  4H5N A;  1UWB A;  3VQ4 A;  3LDQ A;  2UUC K;  5HL7 L;  4CGF A;  1RTH A;  4KHY A;  1HQE A;  3C6H A;  1NK5 A;  3DXK A;  4EHT A;  2X78 A;  2HNZ A;  4B1Y B;  3ZLJ A;  4YOW A;  5C10 A;  2ZGY A;  3J7A P;  3H1V X;  5AQL A;  4DV1 K;  3WEE B;  4DSE A;  3VEW A;  4E1J A;  3M5R A;  3LZI A;  4FLV A;  4ID5 A;  1HQU A;  4C1N I;  3AGK A;  3QIC A;  1S1T A;  4B9V A;  3TWH A;  4WFA L;  4DFJ A;  3KWI A;  3V9W A;  4LFA K;  2Q1N A;  5GAE P;  4TSX A;  2E2O A;  3LWL A;  1Y64 A;  3FZK A;  3MX5 A;  2P5G A;  3AVK A;  5GAD P;  3M8P A;  1QVG M;  1YXQ A;  1VK0 A;  1VSI A;  4BG8 A;  3VF4 A;  4PKH A;  4OX9 K;  4OKE A;  4KHU A;  4FJJ A;  3OS2 A;  3H6E A;  4CER A;  1JLA A;  1NGG A;  3OY9 A;  3F73 A;  5SWM A;  3QLH A;  3NVK A;  4CJU A;  5HRO A;  1REV A;  3TR8 A;  2P9K B;  4GV3 A;  2A6A A;  4PHT X;  2O8F B;  3WUH A;  4QS7 A;  1WSF A;  2PY5 A;  4BRO A;  3NF8 A;  1YHQ N;  3H08 A;  1S5J A;  2ZJP L;  4K42 A;  2VQF K;  1NJI O;  3VQ9 A;  5AFU H;  4H0Y B;  2O8D A;  3PX0 A;  1NGE A;  3U6F A;  1XHZ A;  5IWA K;  3TAQ A;  3HL8 A;  3CPE A;  1IV0 A;  3H45 C;  3LAN A;  2E8A A;  3QFU A;  1HKC A;  4B1X B;  1QQO A;  3R3L A;  3C6A A;  1C6V A;  3ENB A;  1J5E K;  2HHV A;  4CEO A;  1N5Y A;  1KQS M;  3IFR A;  3FFK B;  4DTX A;  2UUA K;  4IFY A;  2P51 A;  5C0Y A;  3C65 A;  4GV6 A;  1U4B A;  2O8E A;  1VQ4 N;  4JKC A;  3VQ8 A;  1XQS C;  2YKN A;  1RCH A;  3GE1 A;  4V19 S;  5E84 A;  4FJI A;  4DB3 A;  3CCE N;  3UKR B;  3OYB A;  3T3F A;  4FW1 A;  1KVC A;  2VGM A;  2F8T A;  4I6M A;  4JKD A;  3V9U A;  3CCQ N;  3CFP A;  4IOA L;  4JK7 A;  3M8Q A;  1N8R O;  4BRF A;  3C95 A;  5JS1 A;  5DK5 A;  4X65 K;  2Z1H A;  3THW B;  1C0T A;  1KTQ A;  4H0X B;  4H4M A;  1NMD A;  4M63 C;  3L6Q A;  1QSL A;  5J2P A;  4XH1 A;  2UUB K;  3GBT A;  4CJ5 A;  4WFB L;  2HHH K;  3R8E A;  4I2Q A;  1KAZ A;  2PAV A;  1WSH A;  4RW9 A;  3AVG A;  3TSU A;  3TAR A;  3RWU A;  1OH7 A;  1QZ6 A;  3SAG A;  4CF0 A;  5DM6 L;  3CC2 N;  2G8H A;  3S3O A;  1J5O A;  3TAE A;  1ZBL A;  2VG7 A;  4FL9 A;  3L0Q A;  4A2A A;  4FCY A;  2V52 B;  4GKK K;  1XC3 A;  3IUC A;  3K5M A;  1N36 K;  1NGA A;  2B6A A;  3KD5 E;  4C8M A;  4JKH A;  4NCG A;  3NAE A;  3P4I A;  3CM5 A;  4JKE A;  1T6C A;  4CEF A;  4FK4 A;  1YI2 N;  5TKY A;  2D0P A;  1LOT B;  3MN9 A;  1WSG A;  1TAU A;  4ILH A;  4AIL C;  1QVF M;  4FVU A;  1EKE A;  1GOA A;  4DQP A;  1T6D A;  4JKB A;  4Z4I A;  3SK3 A;  4A62 A;  1RBT A;  4W5N A;  1K8K A;  3VQP A;  3AVF A;  3A5O C;  5KQD A;  4X62 K;  3HOS A;  2ZM6 K;  3OS1 A;  3V9S A;  2UXD K;  2GTD A;  1I39 A;  3EYZ A;  3AVM A;  1CZA N;  1S22 A;  4AH9 A;  4CF9 A;  2A40 A;  2ZQB A;  3K5L A;  4B8C A;  3LL3 A;  1WSI A;  4O44 A;  3THX B;  1Q7Y O;  4JKG A;  3PSI A;  4E0D A;  3RVC A;  1NM1 A;  1TGO A;  1BA1 A;  1TL1 A;  2XY5 A;  1SKW A;  2NRH A;  3HZ6 A;  3AA3 A;  2VG6 A;  4IKF A;  1UOC A;  2PYL A;  1EWQ A;  3OYK A;  1E3M A;  4B8A B;  3RSE B;  4DCH A;  2OYQ A;  3ATU A;  2R7Y A;  4CZG A;  4CJL A;  4DTS A;  5HRN A;  4KB0 A;  4DKW A;  1DKG D;  3AA2 A;  1SKR A;  3AO4 A;  4MO4 A;  3K0S A;  2A1S A;  2Y1J A;  5HOO A;  1L3U A;  1L3T A;  4XH4 A;  4CVN E;  4MDA A;  4NXM K;  2G8V A;  4LF9 K;  1HRH A;  4DS5 A;  3EN9 A;  1T8E A;  3RRG A;  1ASV A;  2YHB A;  3CJ9 A;  2J4R A;  4CJS A;  2OPS A;  2HVI A;  2HST A;  4BQZ A;  4CEQ A;  3AVJ A;  3WNG A;  1SKS A;  3CQX A;  4JV5 K;  3HST B;  1ZBF A;  4JKA A;  4CF2 A;  4DTO A;  3ID6 A;  2OPP A;  4HUE A;  4CJW A;  2YHW A;  2GEM A;  3RMD A;  5KPT A;  1QHA A;  3QEP A;  4B9S A;  3JAM O;  1RFQ A;  1RBU A;  2VGN A;  5C42 A;  1ITG A;  3QEV A;  4M3X A;  5AQN A;  3ZSX A;  3P31 A;  3ZX3 A;  2YI1 A;  4BQL A;  4OPH A;  3VQD A;  3VER A;  4BE2 A;  5GIP A;  3PIP L;  1VRU A;  2YHY A;  3A5M C;  3QBX A;  4DWI A;  3PLA A;  3RMC A;  3CQY A;  5AQP A;  1ZBI A;  3SMS A;  3U3G A;  2GV9 A;  1HYZ A;  1BO5 O;  3UIQ A;  4H4O A;  5CZ2 A;  3O08 A;  1WB9 A;  1BWF O;  1ATN A;  3AGR A;  4CJE A;  2ASP A;  1NK8 A;  4JI7 K;  4RW8 A;  4BC5 A;  1TK0 A;  2WOM A;  1C0F A;  1CXQ A;  4HUF A;  1X9M A;  3H46 O;  4GNI A;  3OS0 A;  2X74 A;  4CJF A;  4CHO A;  4FLZ A;  3PO5 A;  4M3R A;  4FZX C;  4CZJ A;  1ZBH A;  3EY1 A;  2RKI A;  3SAH A;  3D45 A;  4LD0 A;  5JVH L;  3HP9 A;  1BU6 O;  4EIA A;  3V6D A;  4JK8 A;  1C1C A;  3CC7 N;  4EP5 A;  3HYF A;  4FM0 A;  1GLF O;  1BQM A;  4MDB A;  4KH5 A;  1UA0 A;  2YHA A;  2RPI A;  4IOC L;  4ELT A;  4I7F A;  1YJW N;  1ILY A;  4MQ3 A;  4GMJ B;  5KGX A;  3C7N B;  3D2E B;  4KHP K;  3I56 N;  3MDQ A;  4FM1 A;  1XWL A;  4QCL A;  3TAN A;  3ZT3 A;  5AQU A;  4NLC A;  4FLW A;  4FJH A;  2OAN A;  1S1X A;  4NXN K;  1CZB A;  3IS9 A;  2HHW A;  4LY7 A;  4FWL A;  4BC2 A;  1EWR A;  1L3S A;  5TKW A;  1U48 A;  3O9T A;  3OA9 A;  3GL1 A;  2UXB K;  2CGL A;  5FPM A;  2ITM A;  2ZF5 O;  1QTM A;  3VEX A;  2G8F A;  4CJ4 A;  1NJY A;  3MED A;  4YOX A;  2D0O A;  3CI5 A;  1S72 N;  3BEX A;  1NGF A;  3O8M A;  3ZET A;  4B1U B;  3RTV A;  4DQI A;  4DTP A;  1VQK N;  3MCA B;  2BH1 A;  4M3U A;  3PO4 A;  3U9D A;  3MN6 A;  4BRI A;  5IT9 O;  4B08 A;  4DFP A;  1JCG A;  3MCP A;  3AA5 X;  4DTM A;  5KTQ A;  3CCJ N;  1BL3 A;  3U9Z A;  3JSM A;  5F2R A;  3SV4 A;  4M3Y A;  1NGB A;  2NUB A;  4FLY A;  5B8H A;  2G8K A;  4FJ7 A;  1LV5 A;  3DLR A;  4OGC A;  2UXC K;  1TYQ A;  4BRL A;  4E7J A;  5C2F A;  4CGG A;  1OVY A;  5HRR A;  4BDY A;  1Q82 O;  1S6Q A;  4LF8 K;  4U7B A;  3AO2 A;  3D7E O;  4K8Z A;  3ULD A;  1EP4 A;  3UKU B;  4BY9 C;  4EFH A;  1X1P A;  3TSQ A;  3AAR A;  4Z4H A;  4KPY A;  4YHH K;  4B1W B;  3O1B A;  2OCE A;  1FK9 A;  4E19 A;  2ASO A;  4JS4 A;  3AVA A;  4LF7 K;  3MEE A;  3SCX A;  3QDK A;  3DLG A;  4FJK A;  3AO5 A;  2YJE A;  1JLE A;  4B3T K;  3M6G A;  4MFB A;  3VTI A;  3M1F A;  1TKT A;  3TAF A;  3H1Q A;  3N4Q A;  4Z4E A;  3V9X A;  3AO3 A;  3CET A;  1OH8 A;  3DRS A;  1BUP A;  4KHQ A;  5J2Q A;  4BRA A;  4WYB A;  3RR7 A;  4IFV A;  3CCS N;  2P9S B;  4CBU A;  3CXC M;  3L4I A;  5LL6 Z;  3J8A A;  4CZH A;  3HTV A;  1BA0 A;  1RT3 A;  3K5O A;  3SLC A;  4DQR A;  5BRF A;  2CGK A;  4LFB K;  1B92 A;  1JKH A;  2XO7 A;  3KKR A;  3QBW A;  2YNI A;  1OKJ A;  3U3Y A;  4EZ9 A;  3M8S A;  3SBT A;  4DUY K;  4FM2 A;  2FSK A;  4BR9 A;  5BPL A;  4FJ5 A;  3MWT A;  2E1Z A;  4FWM A;  3NGY A;  4C8O A;  2ASM A;  3CHW A;  1YF5 L;  2HF4 A;  2YJF A;  4OO1 J;  3P38 A;  1TK5 A;  4BRE A; 
#chains in the Genus database with same CATH homology
 4E7K A;  4OKJ A;  4PWD A;  4F3T A;  1C6V A;  1RTI A;  2F96 A;  4IG3 A;  4CK1 A;  1C1A A;  2HHV A;  4H8K A;  5D3G A;  3V1R A;  4CEO A;  2DFE A;  4RW7 A;  4B9M A;  1RTJ A;  4NYF A;  4UQG A;  4BWJ A;  3SQ0 A;  1N5Y A;  2KTQ A;  1U04 A;  4CJV A;  4Q5V A;  1JXE A;  4N76 A;  1WN7 A;  4CHN A;  3D0P A;  1NKC A;  1TL3 A;  4DTX A;  3RMA A;  4IFY A;  2P51 A;  4F3O A;  3DOK A;  4EP4 A;  3KTQ A;  4KHW A;  3KLG A;  1U4B A;  3AA4 A;  1TVR A;  3ZT2 A;  4Z4F A;  3IRX A;  3DI6 A;  3VQ8 A;  4OPK A;  2YKN A;  1HJR A;  1RCH A;  2LSN A;  4DTN A;  3HK2 A;  3RMB A;  1KLN A;  4FJI A;  4FXD A;  1RT6 A;  4KKO A;  1RDD A;  1XI1 A;  3OYB A;  3T3F A;  4CFA A;  4FW1 A;  1FXX A;  1JLB A;  1KVC A;  4LH5 A;  2EHG A;  4JRP A;  1RT7 A;  2HW3 A;  5HP1 A;  1RNH A;  1BIZ A;  5FRM A;  3HT3 A;  2F8T A;  2HB5 A;  4NYN A;  4CJ3 A;  4DSJ A;  3V9U A;  1VSH A;  2P1J A;  3CFR A;  3KIO A;  1RT5 A;  3CFP A;  4YFU A;  1TKZ A;  3M8Q A;  3V1O A;  4AHV A;  1JLC A;  3QET A;  1NK7 A;  1NK4 A;  1KFS A;  3C95 A;  3WNH A;  5DK5 A;  4B9L A;  4DSK A;  2B4J A;  2Z1H A;  4DSI A;  2DY4 A;  5JS1 A;  3LAK A;  4BDP A;  4OJR A;  2XY8 A;  1C0T A;  2XRI A;  4CES A;  5KRS A;  1KTQ A;  2FBV A;  2Z1J A;  4CIE A;  4H4M A;  3OYA A;  2FBY A;  2HHT A;  4DU4 A;  3DOL A;  1TKX A;  1QSL A;  1NK6 A;  5J2P A;  2HHS A;  2B5J A;  4Y1C A;  4Q0B A;  4CF1 A;  1VRT A;  4CJR A;  3LAM A;  3NDK A;  4CJ5 A;  4FJN A;  2KQ2 A;  3OYD A;  2VWJ A;  2X6S A;  4I2Q A;  1MU2 A;  2Z1G A;  4JRQ A;  1WSH A;  4RW9 A;  3AVG A;  2FBX A;  1IO2 A;  5KRT A;  3SUO A;  1BIU A;  3LPT A;  3TAR A;  3CM6 A;  2HMI A;  3RWU A;  4J2E A;  2GUI A;  3HP6 A;  4N5S A;  1VSL A;  3MEC A;  3V1Q A;  4CF8 A;  2ATQ A;  1UA1 A;  1XHX A;  4FJ9 A;  2QKB A;  4CF0 A;  3DYA A;  1BI4 B;  2G8H A;  3NCI A;  4L8R B;  3S3O A;  1NKB A;  1J5O A;  3O4N A;  1RDB A;  3TAE A;  4ZTJ A;  1ZBL A;  4CEB A;  5J2N A;  2VG7 A;  4CGI A;  3QES A;  3SUQ A;  2OZS A;  3NF6 A;  4E89 A;  3KK3 A;  4C8N A;  3K5N A;  4HUG A;  3HO1 A;  3IG1 A;  1IKW A;  4FCY A;  2BAN A;  3K5M A;  2YNF A;  4DS4 A;  1D9D A;  4F2S A;  1IG9 A;  4LSN A;  3O4Q A;  2RF2 A;  2B6A A;  4ZHR A;  3OYN A;  4E3S A;  3KD5 E;  5KGW A;  1JXB A;  4C8M A;  4BE0 A;  4FLU A;  4HCB A;  2OPR A;  4NCG A;  3NAE A;  3L2Q A;  2QKK A;  4FJG A;  3CM5 A;  4O4G A;  4HCC A;  4CEE A;  2EX3 A;  4CEF A;  3O3F A;  3QNN A;  2IAJ A;  3ISN C;  4E1M A;  3PY8 A;  4FK4 A;  3K2P A;  3C6U A;  5CYM A;  1WSG A;  4FLT A;  1TAU A;  3TAG A;  1KVA A;  2IOC A;  4JLH A;  4AIL C;  4W5O A;  2A1R A;  1U49 A;  2ZE2 A;  1L3V A;  3T1A A;  1NK9 A;  3VQQ A;  4DTU A;  4KAZ A;  4CJQ A;  1B9D A;  1EKE A;  1GOA A;  1EXQ A;  3CG7 A;  5HRS A;  2IS3 A;  3PV8 A;  1NJZ A;  3B6O A;  4DQP A;  4CHY A;  1IKX A;  3VQ5 A;  2GBZ A;  4Z4I A;  1RBT A;  1A5V A;  4W5N A;  3VQA A;  3VQP A;  1JLQ A;  3AVF A;  4DTJ A;  4JS5 A;  3SQ2 A;  1X9W A;  1NK0 A;  1QSY A;  3KK1 A;  4KHS A;  1KRP A;  4O5B A;  3OS1 A;  2G8I A;  4DSF A;  3V9S A;  3OJU A;  1QSS A;  3NF9 A;  3OYH A;  3P1G A;  1I39 A;  2O4G A;  3G10 A;  3AVL A;  1HYS A;  2DFH A;  3EYZ A;  3CQ8 A;  3DLH A;  5JS2 A;  3AVM A;  4FJX A;  4N47 A;  4AH9 A;  4CF9 A;  1RBS A;  3DMJ A;  3NE6 A;  1GOC A;  1S1W A;  2ZQB A;  3K5L A;  4B8C A;  1SL1 A;  3BDP A;  1WSI A;  3BGR A;  2YNH A;  4O44 A;  2D0A A;  4E0D A;  3LP1 A;  3MXI A;  1TK8 A;  4M41 A;  1BCM A;  3ASM A;  3OYG A;  4CHZ A;  1SL2 A;  1N6Q A;  2E6L A;  3RR8 A;  1LAW A;  1TGO A;  5CY4 A;  1TL1 A;  1D9F A;  4FW2 A;  4NCB A;  4RW4 A;  2KFZ A;  1RDA A;  3NH2 A;  2XY5 A;  3MXJ A;  1SKW A;  3DLE A;  3VQ6 A;  3LPU A;  4CFB A;  4DTR A;  3AA3 A;  3AVI A;  2VG6 A;  4ELV A;  2YV0 X;  1IKY A;  4AHT A;  4IKF A;  5FRN A;  1W0H A;  4OLA A;  1RT2 A;  1UOC A;  4CGH A;  3G0Z A;  4QAG A;  3B6P A;  2Y1I A;  3SUP A;  1L5U A;  4ID1 A;  4CGJ A;  4QOZ B;  2BE2 A;  3LAL A;  3LP3 A;  3OYK A;  3NGI A;  1B9F A;  4B8A B;  2RN2 A;  2AJQ A;  3A2F A;  3PX6 A;  3THV A;  4PA1 A;  2XY7 A;  3VQC A;  3OYL A;  1LW0 A;  2OYQ A;  2R7Y A;  4KRF A;  1A5X A;  1RBR A;  4CJL A;  4F8R A;  4DTS A;  4CGD A;  5HRN A;  4YNQ A;  3NFA A;  4DLE A;  4KB0 A;  2OPQ A;  3AA2 A;  3QER A;  3S3N A;  4CFC A;  3AO4 A;  1WAJ A;  1NJW A;  2Z1I A;  4CED A;  4OKK A;  1SKR A;  2Y1J A;  2A1S A;  2JLE A;  4KTW A;  4CE9 A;  1L3U A;  1L3T A;  1YTA A;  3O3G A;  3DM2 A;  4EZ6 A;  1EET A;  2G8V A;  4Z4C A;  4ICL A;  1HRH A;  4KO0 A;  4KTZ A;  3KLF A;  3C94 A;  4DS5 A;  3RRH A;  5J2M A;  1X9S A;  1T8E A;  3RRG A;  1YT3 A;  4CJK A;  2IC3 A;  4M3T A;  1ASV A;  1K6Y A;  2YHB A;  3SJJ A;  3OYI A;  4CJS A;  2OPS A;  3SUN A;  3MXM A;  3KD1 E;  4KI4 A;  2HVI A;  4FVM A;  4KB1 A;  5EU7 A;  4CEQ A;  3AVJ A;  3WNG A;  4ZTF A;  1T05 A;  3DLK A;  3NGZ A;  1SKS A;  1XC9 A;  4FK0 A;  1RIL A;  4FLX A;  1LWF A;  4F2R A;  4DU1 A;  2HHQ A;  5C25 A;  3F9K A;  4FJ8 A;  2YNG A;  1KVB A;  3HST B;  4AHS A;  1ZBF A;  2PYJ A;  2ITG A;  4CF2 A;  4NCA A;  4DTO A;  2HHX A;  3VN5 A;  3OVN A;  3DRR A;  2OPP A;  4HUE A;  1LWE A;  4FJL A;  4CJW A;  3PX4 A;  3HJF A;  1JLG A;  1C1B A;  1C0U A;  1VSM A;  3RMD A;  1RT1 A;  1CZ9 A;  2HND A;  3QEP A;  4FJJ A;  4B9S A;  3HVT A;  3IAY A;  3ZSQ A;  1RBU A;  4HTU A;  2D0C A;  3VA3 A;  1TKD A;  5C42 A;  3QEV A;  1ITG A;  1KCF A;  1G15 A;  4BAC A;  1Y97 A;  3KLH A;  4M3X A;  3ZSX A;  4J2A A;  3M8R A;  1W9H A;  4E7H A;  3E01 A;  3ZT1 A;  3VQD A;  4M3Z A;  1S9E A;  4BE2 A;  4Z0U A;  5C24 A;  3K59 A;  1VRU A;  3C6T A;  4I9L A;  3TAM A;  1A5W A;  4DWI A;  3CYM A;  3RMC A;  3SQ1 A;  1WSJ A;  3P5J A;  2KZZ A;  1D5A A;  5CYQ A;  3SNN A;  1ZBI A;  3SZ2 A;  3U3G A;  1Z25 A;  2GV9 A;  1KSP A;  1HYZ A;  3TAP A;  5E41 A;  1IH7 A;  1LWC A;  3V4I A;  1C0M A;  2QXF A;  4G1Q A;  3LZJ A;  3UIQ A;  5CZ1 A;  4J2D A;  4H4O A;  1UAX A;  2E6M A;  5CZ2 A;  1SV5 A;  2FC0 A;  3VQ7 A;  4CHP A;  3KK2 A;  3HPH A;  4Z4G A;  5J1E A;  1NK8 A;  3ZSZ A;  4CJE A;  3OYC A;  4F4K A;  1VSJ A;  3ZSV A;  4RW8 A;  1BIS A;  1TAQ A;  3HPG A;  3TI0 A;  2IGI A;  2WOM A;  1CXQ A;  3AVH A;  3AV9 A;  2DFF A;  3L2V A;  4HUF A;  3MAQ A;  1X9M A;  4I9Q A;  1YTU A;  2ZD1 A;  4CEC A;  4FZZ A;  3OS0 A;  4KFB A;  2X74 A;  4CJF A;  4CHO A;  1TV6 A;  3OYJ A;  4KTQ A;  1WSE A;  4OLB A;  4FLZ A;  3PO5 A;  1QE1 A;  4M3R A;  4FK2 A;  4FZX C;  1ZBH A;  4CJT A;  3EY1 A;  1RTD A;  4FYD A;  2D5R A;  2RKI A;  1Z26 A;  3D45 A;  4LD0 A;  2OZM A;  3ZSW A;  1BHL A;  4DMN A;  2G8U A;  2ETJ A;  3HP9 A;  4CHQ A;  3V6D A;  4M3W A;  3AVN A;  3FFI A;  1C1C A;  3QIO A;  4EP5 A;  1SL0 A;  1DLO A;  3HYF A;  4FM0 A;  3SPZ A;  3WNF A;  3CFO A;  4DFM A;  4J2B A;  2QK9 A;  4DF8 A;  3V9Z A;  1BQM A;  3I0S A;  4O55 A;  1HPZ A;  4RG8 A;  3QO9 A;  1UA0 A;  2HVH A;  3LWM A;  2YHA A;  4HVJ A;  3QEX A;  2RPI A;  4ELT A;  4I7F A;  4BWM A;  4N56 A;  4CEA A;  3SI6 A;  1NOY A;  1ASU A;  2YKM A;  4GVM A;  2BDP A;  3JYT A;  4MQ3 A;  3PUF A;  4GMJ B;  4CK2 A;  1HNV A;  1U45 A;  1T7P A;  4RW6 A;  5KGX A;  4DLG A;  4C8K A;  4FZY A;  4HHT A;  4I2P A;  4CFD A;  4K8X A;  4PUO A;  5HBM A;  4CIG A;  4OPJ A;  1YVU A;  4ELU A;  2XHB A;  4FM1 A;  4B3O A;  1KFD A;  1XWL A;  3NF7 A;  4QCL A;  3TAN A;  3ZT3 A;  4FLW A;  4FJH A;  1HMV A;  1DTQ A;  1LW2 A;  1FKO A;  1S1X A;  1WNS A;  1CZB A;  3KKS A;  3TAB A;  3P83 D;  3I8D A;  1EX4 A;  2OA8 A;  3IS9 A;  2HHW A;  1DTT A;  4LY7 A;  3OYF A;  1J54 A;  4LH4 A;  2W42 A;  3QNO A;  5HLF A;  3ZT4 A;  1L3S A;  3T19 A;  1U48 A;  4R5P A;  3VA0 A;  4XIU A;  1D8Y A;  4GW6 A;  1CLQ A;  4CJP A;  1RT4 A;  2PZS A;  2X6N A;  3KLI A;  4DSL A;  3LP0 A;  3KLE A;  2O4I A;  1QTM A;  1BI4 A;  3HM9 A;  3QIN A;  4AHR A;  2G8F A;  3VQE A;  4CJ4 A;  1S1U A;  5I3U A;  5HRP A;  3LDS A;  1NJY A;  4M45 A;  1Q8I A;  1O1W A;  3ITH A;  3MED A;  1FKP A;  3ZCM A;  2IDO A;  1R0A A;  3SQ4 A;  2DTU A;  4DU3 A;  1GOB A;  4C8L A;  1QQC A;  5FDL A;  4IG0 A;  3K57 A;  1CXU A;  3HXM A;  4E1N A;  4B9T A;  4DQQ A;  5KI6 A;  4DQI A;  3RTV A;  1TK0 A;  4DTP A;  1BQN A;  4PQU A;  3OYM A;  3SYZ A;  1T03 A;  1I3A A;  4M3U A;  1J53 A;  3PO4 A;  2JGU A;  5FRO A;  4CEZ A;  4B08 A;  4Y1D A;  4DFP A;  3HPO A;  3L8B A;  4DQS A;  4N41 A;  3NBP A;  4OGE A;  3AA5 X;  4DTM A;  5KTQ A;  2WON A;  2HHU A;  5K14 A;  3SV3 A;  3SPY A;  1BL3 A;  3JSM A;  4CK3 A;  2P5O A;  4FJM A;  3SV4 A;  4M3Y A;  4FLY A;  2NUB A;  4E7I A;  2XY6 A;  1BGX T;  4IBN A;  3L3U A;  2G8K A;  4FJ7 A;  4M42 A;  3L2U A;  2VWK A;  1LV5 A;  3DLR A;  4OGC A;  4BDZ A;  1Q9X A;  2FBT A;  4E7J A;  4W5Q A;  4LSL A;  3QIP A;  4CGG A;  5HRR A;  4W5R A;  3AVB A;  1VSE A;  3S3M A;  4AHC A;  1S9G A;  1S6Q A;  4CIF A;  2HNY A;  4BDY A;  3AO2 A;  1UWB A;  4KHN A;  3EZ5 A;  3VQ4 A;  1QHT A;  2I5J A;  4K8Z A;  3ULD A;  1EP4 A;  3ZSR A;  3L2R A;  1X1P A;  4CGF A;  2BGG A;  1RTH A;  1VSD A;  4KHY A;  1HQE A;  4Z4H A;  4KPY A;  1NK5 A;  4O0I A;  3NHG A;  2Q3S A;  2X78 A;  4DF4 A;  1FK9 A;  1S6P A;  4IDK A;  2HNZ A;  4WE1 A;  3AVA A;  4E19 A;  4JS4 A;  2G8W A;  4B9U A;  1SUQ A;  4CCH A;  1JL2 A;  1LAV A;  3KJV A;  1JLF A;  3MEE A;  3SCX A;  3DLG A;  4FJK A;  3AO5 A;  1RDC A;  3L2W A;  1JLE A;  4AHU A;  3WNE A;  4DSE A;  4KRE A;  1U47 A;  4MFB A;  5T7B A;  2VG5 A;  1TKT A;  3LZI A;  3TAF A;  4FLV A;  4ID5 A;  1HQU A;  3DLB A;  3V9X A;  4Z4E A;  3AO3 A;  1HNI A;  3I0R A;  4B9V A;  1S1T A;  3TWH A;  3ZSO A;  3DRS A;  2D0B A;  4DFJ A;  1VSF A;  3V9W A;  5J2Q A;  4KHQ A;  1HYV A;  3RR7 A;  3LP2 A;  4IFV A;  4TSX A;  3QEI A;  3ZT0 A;  3LWL A;  4BE1 A;  2P5G A;  3AVK A;  5I42 A;  2PYL A;  3AVC A;  3M8P A;  1WLJ A;  1IKV A;  4W5T A;  1VK0 A;  1VSK A;  1VSI A;  1S1V A;  4PY5 A;  2KZM A;  3V81 A;  1NKE A;  1RT3 A;  3K5O A;  3DRP A;  4DQR A;  3HVR A;  4DFK A;  4OKE A;  4OVL A;  4KHU A;  2F8S A;  1ZBU A;  1B92 A;  1JKH A;  3OS2 A;  1QS4 A;  3L3V A;  1JLA A;  4CER A;  3OY9 A;  1WAF A;  5SWM A;  3QLH A;  3F73 A;  2KFN A;  4CJU A;  5HRO A;  3VQB A;  1REV A;  3TR8 A;  2XO7 A;  3KKR A;  3OJS A;  4KI6 A;  2YNI A;  1NJX A;  3U3Y A;  4EZ9 A;  3S9H A;  3M8S A;  2E4L A;  3ALY A;  4B9N A;  1WSF A;  3K58 A;  4FM2 A;  2PY5 A;  3ZSY A;  5SZT A;  3NF8 A;  4FJ5 A;  1RBV A;  3MEG A;  3H08 A;  1JL1 A;  1S5J A;  4DG1 A;  1ZYQ A;  3NH0 A;  3VQ9 A;  1Q9Y A;  3AO1 A;  4KV8 A;  3PX0 A;  3NGY A;  4C8O A;  4O0J A;  3NH1 A;  3QEW A;  1BCO A;  3OYE A;  3U6F A;  3TAQ A;  5DMR A;  1XHZ A;  3HL8 A;  1ASW A;  4E7L A;  1F21 A;  1NOZ A;  3O3H A;  1J9A A;  1KLM A;  3LAN A;  2KW4 A;  1TK5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...