5HROA

Structure of hiv-1 reverse transcriptase in complex with a dna aptamer and an alpha-carboxy nucleoside phosphonate inhibitor (alpha-cnp)
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
551
structure length
551
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords HIV-1 REVERSE TRANSCRIPTASE P66 SUBUNIT
publication title Conformational States of HIV-1 Reverse Transcriptase for Nucleotide Incorporation vs Pyrophosphorolysis-Binding of Foscarnet.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate bh10)
total genus 145
structure length 551
sequence length 551
chains with identical sequence C
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2016-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 5hroA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5hroA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5hroA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5hroA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5hroA05
1O1WA 4ED0A 3HHKA 2ATQA 3D0PA 3GIKA 3ITHA 3PJWA 1EX4A 3L2WA 3PZPA 5KG1A 5HRPA 3KLVA 3AA3A 4GMJB 2PYLA 5KT6A 2XI3A 2QV6A 4CHOA 2ZE2A 4TQRA 2AGPA 3DYAB 3V4IA 5KFEA 4B9LA 1BL3A 3UR0A 3Q8PB 4I2QB 3AVHA 3SFGA 3ZSOA 2I5JB 1NJWA 4I9LA 2FVPA 4ZVGA 5KFRA 1LAVA 2FBXA 4O3QA 2W9BA 2RF2B 3EY1A 4Q5VA 4O4RA 4NCAA 3TQ1A 4MKAA 4O0JA 3NF7A 1QE1A 4K4VA 4NRTA 2OPSA 4EYIB 2G8FA 4KHNA 4PWDA 3T5JA 3AA2A 3D5MA 1UWBB 4E3SA 3KMQA 1QS4A 4QWAA 4EZ9A 1B9FA 3BGRA 5DG8A 3IRXA 2ASDA 3BSCA 3DOLB 5DMRA 4J2DA 2BR0A 4RNMA 5F8NA 4O55A 3TAQA 3V1OA 4QWEA 1TKZB 4LSLA 2G8HA 4W5QA 3MECB 4DL4A 4NLVA 1BIUA 4NYFA 1VSLA 1TKXB 3M9NB 3F73A 4KHUA 1SV5B 5J2PB 1TQLA 3OL6A 3K5OA 2HNYA 3AV9A 1ZTWA 4YP3A 4K4WA 1JKHA 4DTNA 4FW2A 1N56A 3RWUA 5F8JA 5HLFB 3RAXA 4NLGA 3TWHA 2WHOA 3AVMA 5DGBA 4FM0A 3UPFA 5KG2A 5KFXA 4FJXA 3O3FA 4GC7A 1XR6A 2CKWA 3OHBA 4X2BA 3CJ3A 4AHRA 1ZBIA 5KFKA 4DTPA 3RR8A 1JLFB 1TL1A 4RW6B 2OPPA 1N6QB 2XY6A 3HKWA 3KLEB 4HUEA 1LW0A 3KK1A 3CG7A 1LWCB 4RW7A 1J5OB 4DQQA 4KTQA 4PQUB 3KNAA 4W5RA 4WFZA 3NAIA 1WLJA 3SNNA 3ITHB 4ICLA 3U3YA 4KRFA 4MK8A 1KHVA 3VQSA 2X6NA 3HPOA 2AWZA 4FYDA 2C28A 4DF8A 1IKYA 2YKNA 4K4XA 4GVMA 1YTUA 1B92A 3C95A 3KIOA 1S1XA 5KG5A 1KLNA 2ZE2B 3V4IB 3VQ5A 3ZSVA 4TXSA 1BHLA 4EP4A 1WSJA 5KFTA 4KAIA 4U7CA 3OYBA 1T3NA 5DLFA 2W9BB 3HT3A 1TV6A 3LALA 4Q0BA 4EYHB 4DSJA 1BI4A 1QE1B 3RAQA 3SPYA 2OPSB 5KGWA 5JUMA 1S1WA 2XWYA 1RA6A 2HAIA 5KFVA 2KZZA 1NOZA 4PWDB 1K6YA 4PA1A 4ZP6A 1HMVA 4OKJA 1SUQA 1HYZA 4QWCA 3OYDA 3SV4A 3BGRB 5CYQA 3IRXB 3VQ4A 4CEOA 1SL2A 4WZMA 4FJMA 4L8RB 4O3OA 3GIMA 3VN5A 4DU1A 4KSEB 4QW8A 3VQPA 4LSLB 5KFPA 4AHVA 2Z1JA 4KO0B 3D28A 4IR9A 1IKVA 2XHBA 4AH9A 2HHTA 1Z26A 1NNDA 2WK4A 4KTZA 4IKFA 2KFNA 2HNYB 4B8AB 1JKHB 2JGUA 3L2RA 2OPRA 3NMAA 3JYTA 3I0SA 4CJ3A 1QUVA 4KHWA 1UAXA 5FDLA 4H4OA 4CHQA 1TKDA 3NHGA 3SJJA 5KT7A 1K1SA 3KTQA 4IBNA 3SQ1A 1EKEA 5DGAA 1HNIA 3WNEA 1IKXA 1TL1B 1D8YA 4RNOA 4R5PB 2OPPB 4CJSA 1D9DA 1S4FA 5C25A 2FJXA 1LW0B 3OJUA 3KK1B 1TP7A 4UQGA 4RW7B 1RT6A 5F8MA 4CK1A 4KHMA 1GOCA 5I3UA 5KFUA 2R2TA 2HMIA 3CWJA 3ZSWA 3QGIA 4CGJA 3V1QA 1JLEA 4TYAA 4HUGA 1JIHA 4DTJA 4DL7A 4ICLB 2E6LA 2QK9A 1HQUA 1RYRA 5FRNA 1NJYA 4KB1A 1QSLA 4F2RA 3CFPA 2PYJA 4F2SA 4IH7A 2YKNB 1ASWA 1SH0A 3KHRA 2A1SA 1FKPA 3AVFA 1S1XB 4FZXC 5J2QA 4KHSA 4JUZA 3MR2A 4KI4A 3PUFA 4M95A 4DU4A 4M3XA 4RUAA 3DLRA 3ISND 2XY8A 2JC1A 4KBIA 1ASVA 3ULDA 1U09A 2AX1A 3L3VA 3IG1A 5EDWA 1TV6B 2FLLA 3U3GA 2DPJA 4Q0BB 4E7IA 4NRUA 1BI4B 1S6QA 3SQ2A 1TAUA 1JLGA 5KFLA 1S1WB 5L1LA 3HK2A 5DQIA 4RU9A 3OYCA 4W5OA 4DTXA 1HMVB 3KOAA 4HUFA 4ED8A 1KCFA 1SUQB 2HNZA 2JEIA 3NF9A 3OL9A 4Z4HA 5CYQB 4FK0A 3NGYA 2E9TA 3LWLA 3OYEA 4IG0A 4Z4FA 2BRLA 4J2EA 4M3UA 1S48A 1IM4A 3PV8A 3GQCA 1KTQA 4AHTA 3TI0A 3DOKB 3BJYA 4IH5A 4CEEA 1IKVB 1BQMB 4JLHA 4HKQA 4LH4A 4LY7A 1N4LA 5KG3A 4C8LA 1CXQA 3QIPA 2GUIA 4C8NA 4EBCA 5EU7A 4BACA 4PY5A 3MR5A 1EXQA 2OPRB 3JYTB 1FKOA 3I0SB 3IGNA 3OL7A 4ECZA 3DLEA 5FDLB 4FZYA 3V9WA 5J2NA 4H4OB 3DRSA 4JRQA 3RMAA 5CY4A 1TK5A 3OYNA 4KAZA 1T05A 4CJQA 4NLQA 1HNIB 1IKXB 5KRTA 4J9NA 3CFRA 1RNHA 3IN5A 5C25B 4CJLA 1RT6B 4O3PA 3OS0A 1YT3A 2X6SA 3EZ5A 4K4SA 4IR1A 2QXFA 4CFBA 5I3UB 3CJ4A 1C1AA 2HMIB 3QZ8A 4WFYA 4CF0A 3QERA 4E89A 4FJIA 4FJJA 1JLEB 3V1RA 3T3FA 2IGIA 1RDRA 3HVWA 3QZ7A 3H2LA 1HQUB 2OZMA 4JV2A 4CFCA 4DLGA 4EO6A 2VG5A 4DSFA 4M3YA 4B8CA 3LP2A 3LPUA 4EBEA 1NOYA 2QE5A 4DL6A 1N48A 1FKPB 2OH2A 4CFAA 5KFBA 5SZTA 2BE2A 5J2QB 4CGHA 3H08A 3TABA 1TVRA 2GC8A 3AVJA 4BE1A 3WNFA 1X9WA 4FJNA 1C0TA 4LH5A 5CYMA 2JC0A 4KHYA 4KV8A 2RKIA 1U45A 3TVKA 2HNDA 4E7LA 5KT2A 4CEQA 1HJRA 4M42A 4FLXA 3IG1B 1D1UA 3HPGA 4WE1A 4G1QA 3B6PA 2AX0A 1XWLA 1RT7A 3VA0A 4B08A 1S6QB 3QGGA 3L2VA 5JXSA 1JLGB 1VSKA 3GIIA 1Q9XA 3ZT0A 5KFGA 3V6DA 3OYIA 4TN2A 2IOCA 3NGZA 1XHXA 2FVRA 3QEXA 1HNVA 4KFBA 5DK5A 2HNZB 4CJEA 2UVWA 1LV5A 2IS3A 4JS4A 4N47A 4O3RA 2AQ4A 4FXDA 2P5GA 4OVLA 3AVAA 2IBKA 4DQSA 3MXIA 1L3VA 1HYVA 3BR9A 5KFYA 1VSDA 3H5XA 4DSEA 3HJFA 4Q8EA 2IC3A 1ASUA 4Z4EA 3HM9A 3RB4A 1K1QA 1XC9A 4NLOA 2X78A 4AHCA 3QIPB 4ECTA 4YQWA 1FK9A 3MEDA 2UVUA 4ED7A 3OYHA 3M8QA 1W25A 1IKWA 5C42A 3RBEA 3LP3A 4CJ4A 3SI8A 1FKOB 3DLEB 1RBVA 5J2NB 3DRSB 4W5TA 1XHZA 4WFXA 4B9TA 3LP0A 4E1NA 1KVCA 1NK0A 2ITGA 2BGGA 4FM2A 1T05B 3BDPA 1EP4A 4CK3A 4E7HA 3G0ZA 1RBTA 4AHUA 2R2SA 2C22A 4QW9A 4CHZA 3DLHA 4EBDA 3H59A 4B9MA 3CDWA 3VQQA 3H5UA 4XIUA 4E0DA 2IJFA 1JLAA 4FK2A 5SWMA 4QAGA 1N5YA 3QEVA 4RUCA 1IG9A 4CF1A 2HHVA 4J9OA 2VG5B 3CDUA 1JL2A 3QIDA 3C6UA 3LP2B 2G8WA 3AVNA 4IFVA 3OJSA 4QWDA 4ZHRA 2BE2B 3OS1A 2BQUA 4HYKA 4CF2A 3PR5B 1JL1A 1TVRB 1SH2A 3N6LA 1TL3A 1C0TB 5CYMB 1S6PA 4KV8B 5JS1A 1GOAA 2RKIB 2HNDB 3V9XA 3AA4A 3M8PA 1ZTTA 2NUBA 2IDOA 2Y1IA 4WE1B 4G1QB 3ZSZA 3S3MA 4ZPBA 1RT7B 3AVCA 1WSGA 2C2EA 3ZSRA 3PW5A 5KG6A 4XPEA 1J53A 4CJVA 3V6DB 1KHWA 4ECVA 3NL0A 4CJPA 3UQSA 2DFFA 3MEGB 1HNVB 1KLMA 4Y2AA 4ELUA 4KFBB 1RILA 3ISNC 4KO0A 5T14A 2IJNA 3AA5X 3MAQA 2WONA 4K8ZA 2OZSA 1CXUA 1X9SA 3PVXA 3KK3A 3FQKA 4FK4A 4ECRA 2IC3B 2OPQA 4CE9A 1VSMA 4QOZB 3KJVA 4NYZA 3V9SA 1FK9B 3MEDB 1RDCA 4M45A 3MF5A 4O3NA 4OLBA 3KLIA 3M8QB 1IKWB 5CZ1A 3NH2A 1VRUA 5C42B 4FLYA 4HTUA 4FS1A 4R5PA 2XGPA 5KTQA 2XY5A 4MIAA 2R8KA 5KT4A 2D0AA 3NH1A 3OYKA 3LP0B 4TYBA 4FJLA 2DPIA 1RCHA 4Y34A 4DS4A 5HRNA 2RN2A 1ZYQA 1EP4B 3M8SA 3KMSA 1QSYA 4DTSA 1CSJA 4ID5A 5KFCA 1D9FA 3QINA 3MFHA 4M3WA 3QEPA 4DEZA 1RT2A 3VQAA 1C0UA 4CGIA 4J9SA 1WAJA 4N41A 3RBDA 1JLBA 2VG6A 3GYNA 2HHSA 4URSA 2WTFA 1Z4UA 4KI6A 4CJWA 5K14A 1BIZA 1JLAB 3THVA 5KG0A 3AO5A 1U4BA 1N5YB 2HB5A 3VQCA 4GC6A 1RBSA 3E01A 2IM3A 3ZCMA 3C6UB 1S1VA 1S5JA 4ZP9A 3G6YA 4HCBA 4IFVB 3P83D 1S1UA 4ZHRB 3AO3A 4IRKA 4B9SA 2V4RA 3RRHA 1TL3B 3HO1A 3MTKA 4MK9A 1S6PB 3SUQA 3PJXA 1ZBUA 2EX3A 2VA2A 3KKRA 4DSIA 2FBVA 3GILA 3M8PB 1S10A 2JLEA 2KQ2A 3JSMA 1L3UA 1UA0A 1KRPA 2KTQA 2P1JA 1HYSA 3WNHA 4ZVEA 5E41A 4FJHA 4RZRA 3S9HA 1KLMB 1NK9A 2B43A 4NCGA 4NLTA 4BWMA 3DOKA 4RW8A 2DFHA 4MFBA 2W8KA 4I7FA 4Q8FA 1BQMA 2B6AA 3BSAA 1UA1A 3NAEA 4F3OA 1BQNA 2WONB 4IFYA 3NH0A 1XR7A 4Q43A 4DWIA 5KFAA 3KK3B 3QGHA 3MEEA 1HPZA 4O5BA 3EYZA 3DRRA 4FLZA 2ASJA 3AVLA 2OPQB 1LW2A 1RBUA 1NK4A 4ELTA 3KJVB 3OSNA 4TLRA 3KLIB 4BE2A 1RT4A 1VRUB 3SYZA 5KFOA 5L1KA 1LWFA 4B9UA 3FQLA 1XI1A 4DTRA 4MKBA 3PHEA 4CGFA 3V81A 1GX6A 4BWJA 1NK7A 3CVKA 4J9QA 2ALZA 3RMBA 5DQHA 5KFNA 2E4LA 4FJ7A 1WSEA 1IO2A 1S0OA 4ID5B 4IKAA 3CYMA 3L3UA 4Y1DA 4K4YA 4CFDA 1U49A 2UUTA 3U6FA 3OYMA 1RT2B 1VSIA 4WXWA 1C0UB 3RR7A 1C0MA 2F96A 2IMWP 1T8EA 3L2QA 4ZVHA 1JLBB 2VG6B 4NCBA 4RNNA 5K14B 4TQSA 5HRRA 2B5JA 3K59A 5F9NA 4N76A 4FLVA 4ZTFA 1R0AA 2FVCA 4ZPCA 4CEAA 3AO1A 3E01B 4B9VA 3CJ0A 1S1VB 3RTVA 1WNSA 3DLGA 1VSJA 4CIEA 4KHQA 3PW2A 3FFIA 4KB0A 1S1UB 4I2PA 1WSHA 3ALYA 3VQEA 4JRPA 3VQ7A 3DRPA 3SFUA 1LWEB 4XO0A 4OLAA 1G15A 4WXOA 3OVNA 2Z1GA 3CQ8A 2ETJA 4M41A 3BQ0A 4CHPA 1NHVA 3JSMB 3MXMA 4YR2A 3V9ZA 4Z0UA 1RA7A 4Q44A 2HW3A 1HYSB 4Y3CA 1TAQA 2FVSA 3EPGA 3OHAA 4IDKA 3OYGA 1XR5A 2J6TA 1WNEA 2YV0X 3AVKA 4OKEA 4NCGB 1GX5A 1RTDA 4RW8B 3GV7B 1JLCA 4K4TA 4QPXA 2RDJA 4MFBB 4I7FB 1TK0A 1QTMA 2B6AB 1C6VA 3LAKA 5J2MB 1BCOA 2KFZA 4O3SA 1BQNB 1S97A 4YR3A 4IFYB 2LSNA 4K4ZA 3SUNA 1YVUA 4J9MA 4R8UA 3MEEB 3VA3A 4QCLA 2I1RA 4E7JA 1HPZB 1S49A 5KI6A 5I42A 4CGGA 5HRSA 5F8GA 3DRRB 4C8MA 1SKSA 1LW2B 4CECA 3C6TA 5KFFA 3KHGA 4O4GA 1U04A 3Q8QB 3S3NA 2G8IA 2QKBA 1DTTB 1RT3A 1RT4B 3SZ2A 1LWFB 3SQ4A 1Q9YA 2BDPA 4G3IA 4ED6A 4NYNA 3OYFA 5F8LA 1LAWA 1WSIA 5KG4A 3V81B 3TAFA 3K58A 3LZIA 2OYQA 2FLPA 3CM6A 2DTUA 4CIFA 2D41A 4NZ0A 4HCCA 3MR6A 2V4QA 1A5XA 1NK5A 2D3ZA 4MK7A 3ZSXA 3G6VA 4E1MA 3T5KA 4IQXA 2G8KA 2FLNA 4JS5A 3BSNA 4MH8A 3L8BA 3O3GA 2ASLA 2ZQBA 4OPJA 3NDKA 2JEJA 2B5JB 4J2BA 2HHXA 3TAMA 1R0AB 2ILZA 4BDYA 3HP9A 4ED3A 5J1EA 4TSXA 4DSKA 4NLWA 3QLHA 4ZMMA 3OSPA 3DLGB 1TKTA 3TAGA 3FFIB 3TARA 4I2PB 4CGDA 3P1GA 3DDKA 2RDIA 5D3GA 4RW4A 1SH3A 3DRPB 4H54A 3NAHA 4TY8A 5KG7A 4AILC 4WYWA 2E6MA 1HARA 3NE6A 3PR4A 1W0HA 2Z1HA 3MEGA 3IGVA 1RTJA 3T1AA 4O44A 1NJXA 4JV0A 4WZQA 4DG1A 3HSTB 3KLFA 3ZSQA 3ZT4A 3MFIA 1D0EA 4DF4A 1ZETA 4H4MA 3PW0A 3NCIA 3DLKA 3QYYA 3RMCA 4YFUA 2B4JA 4ED2A 2W9AA 5T7BA 4IDKB 4BDPA 4LQ3A 3QETA 2VWKA 3I8DA 2BANA 1RTDB 4FJ8A 1JLCB 4C8KA 4KKOA 2IM2A 4CEZA 3I0RA 3NFAA 2UVRA 3I5CA 3MXJA 2O4IA 3LAMA 2ILYA 2W8LA 1DTQA 3HXMA 3CJ2A 3CJ5A 4J9LA 1JX4A 4R8UB 3H40A 1QAIA 4CJFA 4ELVA 5I42B 2D5RA 2V9WA 5C24A 4IRDA 3LWMA 4DL5A 3T5HA 4F4KA 3C6TB 3M9OB 1JLQA 4RNFA 2EHGA 4O4GB 4NLPA 2R2UA 4URGA 2VWJA 4DQPA 1KVBA 1RT3B 2WB4A 4CESA 3SPZA 4U6PA 4PUOA 4ECQA 3NF6A 2P5OA 2XC9A 1C1CA 4N56A 4R0EA 4FVMA 3ZT2A 3SUPA 1L3SA 4M3RA 1U47A 4F4XA 4ZPAA 2X74A 3HYFA 5KRSA 4CEDA 4J9PA 5HROA 3GIJA 1CZ9A 4YR0A 2WOMA 3B6OA 1Q8IA 1NKCA 3I5AA 3Q8SB 3OYLA 3PX4A 5C5JA 5DQGA 1RT1A 5EWFA 1F21A 3NBPA 2Y1JA 3OS2A 1NHUA 2HHUA 4DLEA 3PW7A 4OGEA 1SKWA 1JXBA 1NJZA 1NKEA 1BGXT 3OY9A 1A5VA 1FXXA 1SL1A 3TAMB 4OGCA 3H5SA 2D0CA 5J1EB 3QIOA 3GV8B 3QLHB 4DQIA 3S3OA 3LDSA 1TKTB 2F8SA 4ECXA 4DFMA 4OL8A 1YTAA 5D3GB 5KFDA 4ZTJA 4RW4B 2O5DA 1C1BA 1T94A 1S1TA 2F8TA 2KZMA 4TY8B 1RT5A 2YHAA 2DY4A 2YNFA 2G8VA 5HP1A 1RTJB 3V6JA 4O44B 2XGQA 2ZKUA 2DFEA 4DG1B 3KLFB 1ZBLA 1TK8A 4OJRA 4RW9A 1VSFA 4H4MB 4IG3A 2YNHA 3DLKB 4J2AA 2YNGA 3O4NA 2E9ZA 2AU0A 3PW4A 1RBRA 2IAJA 3SQ0A 2BANB 1DLOA 4KKOB 1RYSA 1BCMA 1S9FA 3ASMA 4CEBA 5EUHA 3I0RB 4FBTA 4ECSA 4GW6A 1IH7A 1ZBFA 1CLQA 3HL8A 1DTQB 5KFQA 1CZBA 3DLBA 3TAEA 1W9HA 4Z4GA 5C24B 2XRIA 4CERA 4C8OA 1JLQB 4AHSA 5FRMA 1WAFA 3SUOA 1SKRA 3KHLA 1WN7A 3HVAA 3PY8A 4PUOB 2BRKA 1C1CB 4ZPDA 3HP6A 4BDZA 3ICLA 3C94A 4FJKA 3LZJA 1NK6A 2FVQA 1I3AA 5KFMA 1QQCA 5KFZA 5HROB 4CJ5A 3QNOA 3IAYA 4KPYA 4CHNA 2WOMB 3AVBA 1QHTA 4FJGA 3VQBA 2Q3SA 4CIGA 4YNQA 1RT1B 2AJQA 2ATLA 2EC0A 2HHQA 4NLUA 3H4DA 1C2PA 4FBUA 4EP5A 3NBPB 4CJKA 1S0MA 3DM2A 1D5AA 3H5YA 4ECYA 3AO2A 1EETA 2A1RA 3N6MA 3OYAA 3SCXA 3CFOA 4QWBA 2UVVA 3RB6A 4FLUA 3DI6A 3K5NA 2D3UA 5EWEA 4FLTA 2HVIA 4K50A 3OLBA 2YNIA 4CHYA 1LWEA 3A2FA 3G10A 4NLSA 3KK2A 1Y97A 3VQ9A 1I39A 3UIQA 2HHWA 3LP1A 5F9LA 3M8RA 1C1BB 2JEGA 3H98A 3VQ6A 1S1TB 1ZBHA 4DFPA 3HVTA 5KFSA 2PZSA 3KLGA 1RT5B 4DFKA 3FRZA 3LPTA 4Z4CA 2YNFB 2FJWA 3AVIA 5HP1B 2R7YA 1S9EA 4FJ5A 4DMNA 4M3TA 4FCYA 3RRGA 5KFHA 3DMJA 4ZP7A 4URQU 4RW9B 4IG3B 2YNHB 4FJ9A 5J2MA 5KFIA 1UOCA 2YNGB 1VRTA 4KTWA 5KGXA 2J6SA 2VA3A 3HPHA 3KKSA 3KLHA 3SI6A 4J9RA 3KHHA 2IAJB 3TR8A 1L5UA 4IOBA 1DLOB 1L3TA 2OA8A 4LQ9A 4FS2A 5DG9A 1DTTA 1NKBA 3K57A 1J9AA 3M9MB 4KHRA 3HVRA 3PO4A 4DTMA 2W9CA 1RTIA 4DSLA 2W42A 4HVJA 2JEFA 3PX6A 4DU3A 5DG7A 4NLXA 4NLRA 4OKKA 4DTOA 4B3OA 1TGOA 5KFJA 3EPIA 5F8HA 4WYLA 1HQEA 4E19A 4FZZA 2ZD1A 1J54A 1RTHA 1QAJA 1JXLA 3PX0A 4CJUA 2W7PA 3DM2B 2GIQA 4MIBA 2AGQA 2G8UA 3VQ8A 4KB7A 4ID1A 2WCXA 3QESA 1EETB 2GIRA 4FLWA 2HWHA 4CK2A 2VG7A 3WNGA 1IKYB 5KT5A 3DI6B 4K4UA 3RB0A 2HVHA 2YNIB 4CJTA 4HHTA 1VSEA 3KK2B 1T03A 2IM1A 1BISA 4EZ6A 3OLAA 3NKYA 2UUWA 4M94A 4E7KA 4EO8A 2XI2A 3LP1B 2V0NA 3G86A 3BQ2A 3D45A 1T7PA 3HVTB 3KLGB 4B9NA 5F8IA 3NGIA 4ZVFA 2FBTA 2WRMA 4K8XA 1OS5A 1A5WA 4DL3A 2F8EX 1S9GA 4CF9A 1S9EB 3AO4A 3K5MA 3DMJB 1Z25A 3SV3A 3TANA 3V6KA 3MR3A 3CM5A 5DLGA 1X9MA 1VRTB 4IH6A 2KW4A 5HBMA 4KREA 3ZT1A 3KLHB 1MU2A 2XCAA 1KVAA 1REVA 3FSIA 3KD1E 3QNNA 3CIZA 3QO9A 3RMDA 1YVFA 1KFDA 3O4QA 4FM1A 4RNHA 4F4WA 2R8GA 4KE5A 1JXEA 3NF8A 1WSFA 3ZSYA 2W9CB 4Y1CA 4FW1A 3OYJA 4BE0A 1RTIB 5L1JA 2C2DA 5KT3A 2IA6A 4CF8A 3VQDA 2HWIA 3CO9A 2FBYA 5L1IA 4I9QA 2YKMA 3IS9A 4B3OB 3BSOA 4LSNA 2Z1IA 2GV9A 2E9RX 1U48A 4TY9A 4ECWA 2PY5A 3F9KA 4CCHA 2D0BA 4DTUA 3BREA 4J9KA 1HQEB 4CJRA 2RPIA 4NLDA 3KD5E 5KFWA 2R8HA 3I5BA 2ZD1B 3O3HA 1RTHB 2BQ3A 4DFJA 2IM0A 1B9DA 4N5SA 1GOBA 3DYAA 3GV5B 2QKKA 3QEIA 2P51A 4EEYA 4DQRA 2VG7B 4I2QA 2R8JA 2J6UA 4OPKA 5FROA 2I5JA 3FDSA 2O4GA 4F8RA 2RF2A 1SL0A 3BQ1A 4IRCA 4M3ZA 1VSHA 1MMLA 4ZP8A 3V6HA 3RB3A 1T03B 5CZ2A 3P5JA 2C2RA 1RDAA 2XO7A 1I6JA 1RDBA 3V9UA 4DL2A 3TAPA 3L2UA 2XY7A 2XCPA 2R8IA 3K5LA 1UWBA 4DS5A 2W7OA 3DOLA 1HRHA 3G6XA 1S9GB 2R2RA 1KSPA 2BQRA 2FJVA 3K2PA 1RAJA 3CDEA 3QEWA 1TKZA 1VK0A 5JS2A 4F3TA 3MECA 3LANA 3OL8A 4Q45A 4IG0B 1TKXA 1RDDA 5HBMB 3E51A 1MU2B 1SV5A 1NK8A 5J2PA 3N6NA 1KFSA 4YMEA 2YHBA 1REVB 2AGOA 4RG8A 2D7SA 3T19A 4ED1A 5HLFA 3QO9B 4CEFA 4F4YA 1QSSA 1X1PA 4Y2CA 3T5LA 1ITGA 1S0NA 4JV1A 2CJQA 3ZT3A 4W5NA 4F4ZA 4O0IA 4MQ3A 2GBZA 4H8KA 4Z4IA 1JLFA 4NLYA 4RW6A 4XPCA 1N6QA 3NGDA 4ECUA 2FC0A 3KLEA 3AVGA 3EZUA 1LWCA 4LD0A 2YKMB 3IS9B 1J5OA 3PO5A 3UDLA 3Q8RB 4PQUA 5L9XA 5EWGA 4LSNB 3H4BA 4F50A
chains in the Genus database with same CATH superfamily
3HHKA 2VOOA 3QRPA 3PJWA 3FEZA 2QA1A 4A8SA 2EWHA 4A46A 2XLIA 4FYWB 2GX8A 4KR0B 1FRXA 3PYEA 4ISGA 1Z1ZA 3IXQA 3KLVA 2ZH3A 4GMJB 2VKZG 3MAAA 4MT1A 2XI3A 1R59O 1VQ4S 4B1WB 2AGPA 4G1PA 2E5LF 3ZTRA 1KVJA 4YUDA 3AVHA 2F9WA 3SFGA 1EAYC 1Q86T 2VUGA 5BRHA 1AXQA 2FVPA 3SIPB 4O3QA 3DDNA 2W9BA 4GKKF 3EE8A 1F2HA 4JV5K 4NCAA 1CJTB 3TQ1A 1WHXA 4UZCA 2LA6A 2G8FA 4KHNA 3T5JA 2R7TA 4AYBD 3LPEA 3D5MA 1WOSA 3KMQA 2QWQA 2E5GA 3CC4N 4EZ9A 1B9FA 2P9UA 2DISA 3SCIE 2ASDA 3BSCA 5AE3A 4N8NA 4A8FA 1UVLA 3FZLA 4IOAL 2VKRA 5ETMA 3OTDA 3R7BB 4F25A 4DV4K 2MHNA 4O55A 2F40A 3TAQA 3F44A 2ZH4A 4LSLA 1FNMA 3I4HX 4W5QA 3MECB 4DL4A 4NLVA 1VSLA 5E7OB 2YKPA 4KH1B 3W5XA 4YP3A 3EXCX 2HBYB 4K4WA 4B17A 2VASA 5DS7A 2O8EA 4FW2A 1N56A 2Z30B 3RAXA 3GPAA 1T6DA 3I31A 2VCPA 3AVMA 3SQOP 2GTDA 4FJXA 2GJFA 1S3XA 1W2IA 2W2QP 1NGCA 4X2BA 4AHRA 1WORA 2I2YA 2EK1A 3KUEA 4DTPA 3RR8A 5AQFA 2DXDA 4LFCJ 2RJZA 2OPPA 1N6QB 1HNZF 2K06A 3KLEB 5AQJA 2HHHJ 3CG7A 3CJ7A 1LWCB 1J5OB 1HLWA 4DQQA 4NXNF 3QAUA 1Q81O 1RWVB 4OFZA 1YQHA 4DUZJ 5BR9A 2DGSA 4FWNA 1CJKB 3A4TA 1WLJA 3G6ES 3WT0A 4KRFA 4MK8A 2OJ3A 2V9KA 3CB4A 1BA0A 1Y4ZB 2V4JA 2KFYA 4FF3A 2AWZA 4FYDA 3OR2A 2BJ3A 4DF8A 3PLAA 1IKYA 2YKNA 2PA3A 3KIOA 1KLNA 4ZCLA 4JI8F 2F7TA 4E98A 4B02A 1J5EJ 3AJ1A 4O8UA 1HWLA 1Q78A 3OR1B 1T3NA 4DV7K 3VQTA 4KHPF 3HT3A 3L7OA 3LALA 2DHSA 1BI4A 2HIQA 2G2ZA 2EKYA 2OPSB 5JUMA 3FFKB 2MSSA 3S41A 5KFVA 4X4QA 3IR6B 4PWDB 4DR7K 2EWSA 2VC1A 1TL7B 1SUQA 4DJBA 1L3KA 2B9WA 3CCUN 5CYQA 1V3RA 3RZAA 3VQ4A 1U6BA 2DHHA 1T9WA 4J90A 1SL2A 3ATUA 4WZMA 3TRGA 4FJMA 4O3OA 1AZSA 1WTBA 5B0FA 4KSEB 1M90O 3D2EA 2ZITA 2ZNZA 3M1FA 3DRXA 3AH6A 2E5LJ 5AXLA 3N4PA 3EX7B 4C23A 2YKQA 4KO0B 5BYQA 2E1PA 2XHBA 2DB1A 2HHTA 3HHLD 3UN2A 4IKFA 3MM9B 4NLBA 2HNYB 4EHTA 1PBAA 1JKHB 4QYRA 4LF2A 2M88A 5GAEI 4PKGA 3SMSA 1VFJA 1YI2S 1SC6A 1RGVA 4LFBF 4C4WA 3THXB 1APSA 1UVMA 1Q81T 5KQ8A 3KTQA 4P2XA 3FR0A 5DDPC 5IC4B 1NRKA 3IR5B 3WNEA 4YB5A 1TL1B 1D8YA 1TR0A 3HI9A 4RNOA 5A6PA 1UVJA 1SKUB 4J9VA 2PE8A 2IRXA 2V34A 5C25A 1X4CA 4LJMA 3KK1B 1TP7A 1RT6A 5F8MA 4CK1A 1UEUA 3SSSA 4F9OA 4JYAK 2DNQA 3CWJA 1EKRA 3QGIA 3P4IA 5AXKA 4TYAA 3TYTA 2AHOB 1RP5A 4OI4A 5EX5A 2E6LA 1NJYA 3LA0A 4X66K 5B0EA 2HAFA 2BEFA 4WFBQ 3TEGA 3V4MA 1S1XB 3C2PA 3MR2A 1KS2A 1EIYB 4M95A 4M3XA 4L72B 2VBXA 5BR8F 2D1KA 3QJLA 2JC1A 2J8AA 2LQJA 3ULDA 1HNZJ 1AFIA 2AX1A 3IG1A 5M2UA 5EDWA 2GO8A 4Q0BB 3NGSA 3DHXA 1S6QA 4KY3A 4NXNJ 3OTOF 2KDOA 5DQIA 4FWKA 1M90T 4RU9A 1U8WA 3KOAA 5DM7Q 1VISA 3CCMS 1KCFA 1PO6A 4FVUA 2VBZA 3OL9A 4Z4HA 1N34K 3R5CA 1GTHA 3W61A 3LWLA 1FI4A 2Y8WA 4Z4FA 3CPEA 3BV8A 1S48A 4BR2A 1IM4A 3PV8A 3HJVA 5L39A 1FNOA 4IH5A 4RPFA 1BQMB 4JLHA 2QWLA 1UWAA 2G0CA 1ZOTA 3UWTA 5EU7A 4BACA 2MGZA 1EXQA 3E9LA 2OPRB 3I9ZA 3BKTA 3DLEA 4CZLA 3WDOA 4H4OB 3RMAA 2MKYA 1HKBA 2MLYA 5FPMA 2HF3A 1X5TA 3PKMA 4U67Q 1T05A 2D4WA 4NLQA 5BJRA 5F3ZA 3IO1A 4XEIA 3UDVA 5DZ7A 4J9NA 2NLXA 4GY2B 2CDQA 3B8AX 1MWZA 4OI0A 3A12A 2V8VA 1YT3A 5A2QO 3EZ5A 1ZAWA 1DBDA 3FZBA 3VGTA 5I3UB 4K7QA 3QZ8A 4WFYA 4CF0A 1JLEB 3MDFA 5LOQA 3KWIA 2HEKA 3WX8A 3KUHA 3GDQA 4DSFA 2C3PA 3LP2A 2R3VA 1U0SA 2VPWB 4EBEA 1N48A 4LFBJ 1FKPB 4CFAA 4OI6A 2DCUB 4G9ZA 3K8WA 2HFUA 2EFQA 3AVJA 4BE1A 4FJNA 1CPZA 3WQUA 4KV8A 1NMEB 1TUYA 1U45A 3H0PA 1SPBP 3A5NC 5IS2A 4YDXA 4KGXB 2WBMA 3TTDA 4CEQA 2QC3A 2H3EB 2EBEA 1VC5A 2WSFC 3HPGA 3CT9A 1H74A 4I69A 1XWLA 2AX0A 3LM9A 4C11B 3QGGA 4OYOA 4CZIA 1JLGB 1VSKA 3B6BA 3BO2A 3HHLA 4IO9Q 5KFGA 1IUJA 3QEXA 1HNVA 1IBKF 2X1AA 4OZJA 2UVWA 1HBUB 4HH1A 1LV5A 5F0UA 2AIRB 4N47A 3MCPA 2AQ4A 4JI2K 4FXDA 2IBKA 3EKSA 2PDAA 3MXIA 5AQRA 1RCXB 2GWJA 3HJFA 2YX4A 5EGYA 4Q8EA 2IC3A 1ASUA 5BR8J 5DDOC 4Z4EA 3HM9A 4P72A 3RB4A 2ASMA 4PR6A 5CCLA 3HBTA 4NXMK 3ZX3A 3C3LA 1DQAA 2UVUA 3MEDA 3OYHA 3FC9A 3TNVA 2NXEA 1IKWA 2CVIA 5C42A 3I8BA 4DV2K 2DBBA 4ZOSA 2W2PP 1OVYA 4FOEA 5J2NB 4W5TA 1T9UA 3CC4S 3GJTB 3ZTQA 2DH8A 3PIPL 1NK0A 1FDBA 2ASYA 3AQOA 1EP4A 4CK3A 4E7HA 4YEAA 3HHLC 2QN6B 2QLFB 4AHUA 1BD6A 1YJRA 2VFVA 4LC9B 2X3DA 2C2MB 4DR5J 4PG8A 4DR4F 5H9EJ 1IN0A 4E0DA 4I67A 5A0YA 1WF2A 3CJBA 3NVKA 1AB8A 1EQYA 3IWNC 1EHWA 5EVZA 2M2BA 4OV1A 5CR4A 4C3LA 2KYZA 1JL2A 3VEXA 3C6UA 3AVNA 2P9SB 3ZLJA 5BPMA 4ZHRA 2M9KA 4HYKA 1SH2A 5FJ4A 1P8GA 2VDIA 3AOBA 2UUAF 3CIPA 3TPQA 3N9UC 3W64A 5JS1A 2RKIB 3HZEA 2HNDB 5AQKA 4RWTA 1ZTTA 4OPHA 4ZJOA 2OCEA 4ZPBA 3AVCA 1RADB 4F04B 3JQKA 2E1YA 1ZS6A 1KHWA 1XBWA 4CJPA 3I33A 2DFFA 1NB2A 3MEGB 4ZCIA 1VCTA 4KFBB 2EFNA 1FTRA 5I3QA 2RT3A 1YAGA 5T14A 2VBWA 3D0GE 1JJ4A 2KG1A 3LQVA 1CXUA 5CQGA 3QSYB 5A8WB 4ZJQA 1R6VA 4M63A 2EVZA 1S76D 3FJ2A 1S4EA 2HSEB 3D3BJ 3FCVA 1NGIA 3M2VB 3V9SA 1E6VB 3BKFA 4B3SK 1RDCA 4M45A 4FXVA 3MF5A 3KLIA 4CJ7A 2E20A 5CZ1A 3AAWB 1VRUA 3SXLA 5GAEU 2F9TA 5ETKA 4M8LA 4FLYA 5GAHI 2IJRA 1X4EA 5KOXA 4MIAA 1RHKB 2CQ0A 3GFXA 3PRDA 3UCUP 2QXLA 3OYKA 1R8PA 1IBKJ 5MLCV 3MK6A 3CCUS 2GHPA 4Y34A 3OUYA 4M5IA 1ZYQA 4ID5A 5IC6B 5KFCA 2W40A 5HMZA 1X4GA 5AQYA 4UUWA 4J9SA 1FVSA 2DVIA 2VG6A 3GYNA 2HHSA 4URSA 3IRWP 5K14A 5D6GA 5IT4A 3VGVA 3THVA 1XK8A 3NMUA 4K2JA 1N5YB 3VQCA 4GC6A 3P6YC 2C42A 1Q5YA 3X1LB 3M30B 4LF8J 1X3NA 4M63C 2GJIA 1ILYA 1WWHA 3O1BA 3G6YA 3A13A 4HCBA 2HYIB 1HKCA 3P83D 3O9RA 3AO3A 4IRKA 2O8DA 4BVPA 1GAOA 3PFOA 1RCOB 3AY0A 3RRHA 3SUQA 2CRLA 2VA2A 3KKRA 2NNWA 1NO8A 3D67A 4B1VA 2WAQD 1L3UA 1GMUA 4DR4J 2IRUA 3ZO7A 1HYSA 3WNHA 5JMVA 2VODA 1RWUA 3ONQA 2G2OA 2XS7A 4JI4K 3S9HA 3O2IA 1KLMB 2EXUA 4NCGA 4ZLNA 2DFHA 4MFBA 3VGMA 2B6AA 2DXEA 4F3OA 2WVFA 1BQNA 2KM8B 1M0SA 2ZGYA 2P8IA 4Q43A 4LVOP 5KFAA 1VQ5N 2UUAJ 3CETA 3D7EO 3BZKA 5C2CA 3DCAA 3QRRA 1ZZNA 3BUZB 3VCDA 3R6GB 4FWRA 3KG4A 2ZHAA 3HULA 3J80U 1LWFA 4OYXA 4B9UA 3KFWX 1FD2A 2HGMA 4IOCQ 3SQGB 3IAM9 3PHEA 4OLOA 3SCLE 3V81A 1IJEB 1GX6A 3CVKA 5A6WA 2ALZA 2CNLB 2A41A 2CJKA 2AJFE 2GUPA 4WFAL 2RIJA 2L41A 1IO2A 3DXMA 4M5NA 3ENVA 4A8WA 2PEHA 4CFDA 2QEXN 2CNNB 2UUTA 1VSIA 2B9XA 2AP6A 2ZJQL 2IMWP 3M3ZA 1T8EA 2Q3PA 4ZVHA 2DNRA 1VC6A 3L2QA 1JLBB 3I56N 4RNNA 4Y28C 4TQSA 3BPDA 3AXMA 5F9NA 1PYTA 4ZTFA 2E5IA 4B9VA 3CJ0A 1YK9A 2CQGA 3DLGA 1Q5VA 2ZZTA 1VSJA 5AQNA 2CH6A 3JS9A 4PKHA 2BE9B 1WSHA 3E9OA 4DV6F 4YB1P 1NB7A 3VQEA 4W90B 3DRPA 3GWCA 2CPEA 1JQGA 3OVNA 1KEKA 2Z1GA 3CQ8A 4M41A 5LL6d 1RXOB 1NHVA 3N01A 3JQJA 3TZWA 3MCSA 1NDKA 2FZGB 5ADXA 2HVEA 2HW3A 2VFRA 3GCWP 2V68A 4FPAA 1NSQA 3EPGA 4H4KA 4IDKA 3AVKA 2C2KB 3W66A 2HBLA 4Z94A 1BMQB 4RW8B 4K4TA 4I7FB 4ATNA 1QDUB 2KFZA 3D2WA 3JS6A 1PJ7A 1HD1A 1M5OC 1A9NB 2GMLA 2O8BB 1UKUA 4UF4A 1BWFO 3MEEB 1TUGB 4QCLA 4TVAB 4E7JA 1QZ6A 1S49A 4CGGA 5I42A 5F8GA 3E9PA 3TR5A 1SKSA 1BQXA 4B3MK 2BMBA 4NI2A 2JSXA 1FFGB 1SC3B 4CZEA 2G8IA 3OVAA 1DTTB 1RT4B 4OHYA 3DGPA 2RQKA 5AZJA 1YIJN 2GVDB 4G3IA 4NYNA 5KG4A 1FJGF 3M8WA 2HGNA 2FLPA 2CGLA 3MWBA 2DTUA 5GMDA 4CIFA 3M6WA 3MR6A 2V4QA 4FP9A 2D3ZA 1BUXA 4NX9A 3D2FA 3T5KA 3CUNA 4IQXA 1O0PA 3VAHA 3R8EA 5E33A 2KKHA 5D4LA 1K9MT 3VENA 1NGFA 2MB0B 3CF5L 2HHXA 1J6ZA 3MPYA 3TAMA 3ZZ0A 3W8PA 4OYPA 4TSXA 1KOHA 5LJ3Y 4DSKA 2RHKA 2DGQA 3QLHA 1HR0F 4RUBA 3TAGA 3HT0A 3UFCX 4CIOA 1VQON 4I2PB 4RW4A 2A3JA 1H72C 5LJVA 4JNEA 3MUVP 4WYWA 1S6OA 3CJKA 2E1MC 2X1BA 4K0KJ 4BC5A 2Z1HA 1TMJA 4P9SA 3IGVA 1M1GA 3T1AA 3MCAB 1NJXA 2H65B 1H6KX 5HVFA 4JV0A 4DF4A 4H4MA 3NCIA 4GVLA 3QYYA 4U7UD 2H9ZA 2AMCB 2ZWPA 3TUZC 2ASPA 4LQ3A 8ATCB 1HL6A 2VWKA 3Q22A 4FJ8A 1JLCB 4DZ6A 4KKOA 2V8PA 3I0RA 3I5CA 2C3UA 4CBWA 2ILYA 4DV6J 3R1XA 4UY8T 1R8BA 3HXMA 3CJ5A 1JX4A 4J9LA 5JVGQ 4R8UB 4CJFA 4ELVA 3LWMA 5B0CA 4CTAB 3C6TB 2YKOA 2XMAA 4QQBA 1JLQA 1RAFB 1R0BG 2RHQB 2YVSA 2LCWA 4CESA 2XS2A 4PUOA 1T11A 5BYRA 5GAGP 3BO4A 5H9FJ 3SUPA 4U9RA 4RR5A 1JNZB 2MQ8A 3CMQA 4C9DA 4M3RA 1U47A 2X74A 3HYFA 3GIJA 4CO2A 1HHTP 4YR0A 2WOMA 1NKCA 3K89A 1VBYA 4OHVA 2RQCA 1OH6A 3MMBA 1O51A 5AE1A 1M5HA 3C6HA 3BBBA 2YQ0A 2YPYA 4DLEA 4OGEA 4I6MB 1BG3A 2AD9A 2CPJA 2NREA 4K5SA 2VJVA 3OY9A 1A5VA 4X4PA 1FXXA 5FPNA 5IV4A 4AM6A 3B54A 1ZAVA 3EICA 2ATCB 3ZX0A 2GVZA 1TKTB 3E3XA 3LDSA 4U8YA 4V19J 2E44A 4DFMA 4OL8A 4JKHA 4LF7K 5LMUF 1TFYA 2F8TA 1RT5A 4PG7A 4DV1F 4R25A 2MMYA 3RJMB 2YNFA 2G8VA 3WIUA 2CPZA 3MM8B 2NRRA 1EQMA 4LFCK 3MHYA 4I6WA 4OJRA 1ROFA 1VSFA 5ETLA 4IG3A 2HHHK 2YNGA 3O4NA 1RBRA 3QQCD 4DUZK 1HIYA 2JLFA 1HR0J 2P5VA 1RYSA 1BCMA 3ASMA 5EUHA 4WWSA 2HSTA 2L48A 2ZH5A 2K1RA 4ECSA 3ENOA 1CLQA 2YWHA 5KFQA 3DLBA 2RD5C 6FD1A 4FPIA 5C24B 3VF6A 1IG8A 4I68A 3AAPA 1HWKA 3GB0A 4AFFA 5E3AA 1J5EK 3KHLA 4RU2A 2FZKB 3HVAA 2BRKA 2A42A 1OPZA 3EVMA 3UD4P 4BDZA 2EK6A 2XNQA 1RISA 3LDLA 1FJ7A 2KXHA 1N33F 3LZJA 1I3AA 5AQSA 2YX1A 2LDYA 1TMMA 4CHNA 2V51B 1S57A 3VQBA 1RT1B 2WTUA 1KWMA 4NLUA 2XG8A 3NBPB 4LF4F 3R5BA 1VQ5S 3Q83A 4FXWA 4LF1A 4BRGA 1EETA 1H7WA 3CJTA 1PJ5A 2UVVA 4YN3B 2BJEA 3RB6A 3DI6A 1YLXA 2E5LK 4FLTA 4K50A 2YNIA 1LWEA 1HJOA 3FMWA 4ENOA 4NLSA 3T9ZA 3KK2A 3TJ9A 4GKKK 1I39A 2P9LB 4CRJA 2PFFB 1C1BB 4ILLA 4J7CA 1QQNA 3JTPA 1P9YA 3FRZA 1PAUB 4Z4CA 2QEXS 1XN9A 4DMZA 1BC6A 2FJWA 1HHQA 1KONA 2LXFA 3I56S 2WB1D 4ZP7A 4RW9B 4YORA 1OH7A 5J2MA 1TFWA 3IM9A 2BOPA 1UOCA 1WC3A 1VRTA 4KTWA 5KGXA 3KKSA 3KLHA 4J9RA 1K44A 2IAJB 1UFWA 3DAWA 4MIWA 2O66A 4IOBA 2IVFB 3VGKA 2DPNA 1L3TA 5HMXA 5IWAF 2F8HA 3MMVA 5LMUJ 1NKBA 3NS6A 2DGXA 3PO4A 4F4AA 3J8AA 4A2AA 2Z57B 4DV1J 2W42A 4HVJA 3PX6A 4DU3A 4DKWA 1TGOA 2CPDA 3R1LA 1B64A 1HNZK 1UFLA 2LP4A 2EI5A 4NXNK 3B78A 2JH3A 3C65A 3GG4A 4AT1B 4E19A 1D3WA 1J54A 2GMHA 3PX0A 2NYHA 4YS2A 4MIBA 2AGQA 4KB7A 2QRRA 3AXKA 1F5CA 1BOTO 5ELZA 2VG7A 4BC4A 3C8YA 2DO4A 5AQIA 5KT5A 4JI8K 1W26A 2QW9A 2X3GA 1WUUA 2V50A 1G6BA 2HVHA 4FWMA 2W41A 4M5JA 1YIJS 2KJVA 4LR7A 1VSEA 2CNKB 2BE7D 3I4PA 2IM1A 4QYZJ 2KXFA 2XMMA 4A5BA 1SJQA 4KHPK 3NKYA 5E3RA 2UUWA 4M94A 1WELA 1N33J 3LP1B 4WCEQ 4H5TA 3HVTB 4OYWA 2QMWA 4LF9F 4PPDA 4X62J 5F8IA 3NGIA 2QWPA 3U02A 1OS5A 3NGUA 4CF9A 2J8SA 3FKBA 4PYAA 1G7CB 3IC1A 2XNRA 3DMJB 3V2UC 4JEPA 5HMWA 2E2PA 3O8MA 1GT8A 2ZH7A 1QM9A 2Y0BB 2ASOA 4IH6A 3ZT1A 1GFWB 1I51B 1RACB 3ILIA 3EXYA 2GNKA 4HI1A 4HHUA 2XMKA 2G13A 3RMDA 4BQZA 3UKUA 4FM1A 2KN4A 4ILHA 2JL9A 2GS8A 4KE5A 2ZUGA 3NF8A 3R3LA 4LFBK 2UUCJ 3ZSYA 4Y1CA 1IJJA 3NNAA 4BE0A 3A3NB 4DV3F 4KJIA 5L1JA 3GL1A 2DH9A 4IEIA 4CF8A 2A10A 4I9QA 4AL6A 4B3OB 3Q89A 2EW9A 4G6VB 4ID8A 1U48A 4TY9A 3GJQB 3F9KA 2R7RA 4DTUA 4WP9A 1X5PA 2Q43A 3D9BA 4P2MA 2LEPA 4CJRA 4DX6A 2HOEA 2ZD1B 3O3HA 1RTHB 2BJDA 2AA4A 4BGBA 1D8ZA 3E66A 2V2QA 5IWAJ 5BYSA 1GOBA 2PMHA 4JI1F 3DYAA 3GV5B 3QEIA 2P51A 3N4QA 4DQRA 1N36J 2J6UA 1GLFO 3GMGA 3DOMA 2I5JA 1VQMN 2MKKA 1YKWA 2O4GA 4ZLPA 1IQZA 3EGZA 5BR8K 3BQ1A 4IRCA 1MROB 4M3ZA 3RB3A 3P5JA 1FE4A 3IMQJ 1I6JA 1LKZA 3TAPA 2V69A 2R9LA 2XCPA 3OTOK 2NRTA 1OPIA 3K5LA 4ZIWA 1MG7A 4YOUA 3QBXA 3UW1A 3G6XA 4ES3A 1ZBSA 1YGYA 1RAJA 8RUCA 3QEWA 1TKZA 4DN9A 3WXMB 2ACMA 2CDRB 3PYDA 1RDDA 4CDIA 1MDUB 3ETOA 1Y7PA 4BQLA 2YHBA 3J80O 3H2UB 3QO9B 1PJ6A 2B4UA 4JI7F 3W3DA 3I9V9 4FWOA 4WQ4C 2CZVC 3ELHA 1GLDG 1DKGD 3ZT3A 1WEYA 4H0OA 2QFJA 4BGAA 4XH5A 3PYGA 3P5TL 3K7RA 3NGDA 4LIRA 3EZUA 2YKMB 3FZMA 4QJVA 3Q8RB 5ETOA 4PQUA 1NPRA 2P2CB 3FBCA 5EWGA 1C4CA 4ED0A 3O1LA 4FF2A 2RRBA 3GIKA 5U47A 1SIZA 1VJQA 3MXHP 3K9KA 2H54B 2PAVA 2VV5A 3L2WA 2A5XA 2W6KA 2PYLA 3JAMU 4WQ5A 5ADZA 1ZAXA 2NXNA 2GA7A 1FO1A 4LFAF 3QJJA 3V4IA 3C46A 5LL6Z 4DV3J 3GR0A 4I9LA 1LAVA 4DCJB 2GO9A 3MM7B 4Q5VA 4O4RA 4MKAA 3NF7A 1QE1A 4XDCA 4EYIB 2GZOA 4AD6A 1U2FA 3A0IX 4E3SA 4QWAA 1NH7A 2GWKA 5HVGA 3W62A 4DI6A 3BGRA 3IRXA 3OFEA 1VQ6N 2QLXA 4CLLA 1QUPA 4JI1J 2JLGA 3V1OA 4QWEA 5D0GA 2DO0A 2ZGZA 2G8HA 2CJ9A 2YWGA 3HRGA 1S5ZA 2NRWA 1TKXB 4I6YA 3UVJA 5FPDA 1R3NA 1YHQN 1VGYA 3RWUA 5HLFB 3TWHA 1S99A 1A7GE 1XMBA 1F2GA 2CQIA 3UPFA 5KG2A 2LQ5A 3G2XA 3CJ3A 4OX8A 1ZBIA 3PHTA 1S59A 5KFKA 3H1VX 1JLFB 2DXFA 2XY6A 4HUEA 4WFNQ 4BCAA 3N28A 3HZGA 2UXCF 4DV4J 2OGUA 3KNAA 2Q2RA 4WFZA 3NAIA 4DR4K 1Q79A 1ESVA 1WKJA 2I6WA 3HPOA 2XMVA 1U1OA 2OHDA 1TUVA 4JI7J 4CO3A 2PFUA 3HMJG 3ENAA 4GVMA 3MAAB 4B1XB 1U1RA 1X7VA 4ER8A 1WI8A 5IT9O 1I3OB 3G96A 3BF4A 2UUAK 4X65F 2W9BB 3HHNB 3MM6A 3ZZYA 3BP8A 3A5OC 5KGWA 1S1WA 2XWYA 1RA6A 5FLXO 3EDQB 3RBZA 1RU2A 1K6YA 3DNCA 4ZP6A 1NWKA 1HMVA 4XK8C 4OKJA 5GADI 5DM6L 2P9UB 2CUYA 2J9CA 1MA9B 3OYDA 4CEOA 2JVRA 4L8RB 1VAZA 3VN5A 1IXKA 4LFAJ 3AJDA 4QW8A 2G1DA 4LSLB 5KFPA 4DPXA 1XNRF 4CZMA 2Z1JA 3D28A 2P9KA 3HFZB 4WTOB 3CJ8A 4AH9A 1DAXA 1NNDA 2WK4A 3DU5A 4KTZA 2KRBA 2KFNA 3QFPA 3L2RA 2O8EB 1ZBTA 1UEKA 3I0SA 1QUVA 1RGIA 3KVGA 3ULEA 5FDLA 2GV1A 2RMLA 1DHMA 5B0AA 3HI0A 4IBNA 2GIFA 4C8ZA 1FRJA 5K8MA 3SQ1A 4ZVOB 3VZHA 3MURP 5DGAA 1HNIA 1U0HA 3NNCA 4P6QA 4G1IA 1WD6A 2OPPB 4CJSA 3AB2B 1LEOA 1D9DA 4NZ7A 1NGJA 4P73A 1EWQA 3CO0P 2MQOA 5AQGA 1S79A 4KHMA 1GOCA 2ZBIA 2HMIA 4IOAQ 3LW5C 4MMOA 1JIHA 3D1HA 2RUGA 1U2CA 4KQZA 3SDEA 2V4JB 4JI0F 2PYJA 4F2SA 3OR2B 9RUBA 2U1AA 3LGHA 4AF1A 4IH7A 2YKNB 1ASWA 2K3IA 3KHRA 2F9DA 1SAZA 2AKWB 4J91A 4JUZA 5CZVA 1KNZA 3PUFA 5C7PA 3W2VA 4RUAA 3DLRA 1ZXOA 2XY8A 2WUSA 3J81U 2DNOA 3L3VA 3R5AA 3FCHA 4W4MA 3AOAA 1VQSA 3U27A 1LK5A 1BI4B 3SQ2A 2UV8A 2UXCJ 3OHRA 5B08A 4DCPB 2ZH8A 3M4XA 4LRBA 3CCLN 1CULA 1GXLA 4JYAJ 5AQZA 4N7TA 1SUQB 2HNZA 4RWWA 2G2YA 1BUPA 5DZ6A 2JEIA 3MCNA 5CYQB 4YOWA 4FK0A 3NGYA 4FL9A 3UE2A 4OZNA 4UW2A 1AZSB 2MQPA 2AT1B 1HKGA 1SB6A 3D2EB 1KTQA 4PHTX 3DOKB 1VQMS 5B8HA 4HKQA 2ABYA 4QIFA 5KG3A 1CXQA 1QLNA 3QIPA 3UCGA 4X65J 2GUIA 4EBCA 3OVSA 2DNZA 1VHIA 4OZ0A 3OL7A 1FKOA 3H42A 4C3MA 3OFFA 5D4NA 4FZYA 3V9WA 3DRSA 4JRQA 2VICA 3OW2R 5AE2A 5I3PA 4CJQA 4BHQA 4DX8H 2XQCA 2IHR1 4MLHA 3Q7CA 2QYGA 1N34J 1RNHA 3CFRA 5C25B 3QJPA 3EGNA 4CZCA 2XZDB 1RT6B 4O3PA 2WC9A 2X6SA 3L7PA 1XNRJ 1NGDA 1FCAA 2BXJA 4Y0FA 3EUNA 3C6AA 2QXFA 4CFBA 3CJ4A 1C1AA 4FJIA 3QERA 2AZ1A 4DPWA 3HVWA 2J9DA 3H2LA 2CJAA 2KXNB 1KQSR 2MYFA 4JV2A 1V9OA 2NZ4A 4EO6A 4Y2KA 5ETNA 2QWOA 1Z6RA 4CLFA 2VWBA 2DR6A 5A8RA 4AXJA 3LPUA 4YOEA 2N4CA 3BS9A 1YITN 2FZCB 2M0GB 2OH2A 2GC8A 3WNFA 1C0TA 4Z7YA 5CYMA 2JC0A 2HBKA 1DRZA 4BG8A 2XB2D 3US5A 2O1PA 4DV6K 4E7LA 1KC8O 2OTJN 2DNHA 3P5BP 2VH7A 1HJRA 4FLXA 3EWGA 2AEMA 3QFWA 3IG1B 4G1QA 3WEEA 1X8DA 1S6QB 1H1VA 2MLXA 5JXSA 4FYVB 4H5VA 4RBUA 1MN7A 1NMNA 3V6DA 3QFHA 1ZM2A 2FVRA 3O44A 2K2PA 4DUYF 4OJ1A 5E0OA 4JI0J 4ZN1A 2VC0A 4DX5A 1SJ3P 1GLJO 3F5TA 1T02A 3AVAA 5DETA 2A2CA 2KB2A 1HYVA 3MUMP 3BR9A 5KFYA 1VSDA 2VFSA 3H5XA 4C0OC 2YHYA 1I5OB 3NGTA 1DURA 3WQPA 2AEJA 1Q8BA 1K1QA 3GP9A 2X78A 4AHCA 1Q7LB 3MWTA 2L9NA 2YQ3A 4I64A 4ED7A 2DY9A 2MGZB 3M8QA 3B8HA 5BRFA 3SI8A 4UTGA 2HZVA 3GJRB 3DLEB 5C2GA 1N5SA 2YJFA 4QIWD 3H25A 5J1NA 2KVQE 4WFXA 4E1NA 1G3OA 1GLBG 2H51B 2ITGA 1RAGB 3D6RA 1Q53A 3O9TA 1CLFA 2KJWA 1T05B 3THPA 3BDPA 3JTNA 2LECA 1VQ6S 1FJGK 1RBTA 3CCSN 2DR9A 3H6EA 4HTJA 2QG9B 5LJWA 1FRIA 3DLHA 3CERA 2W2MP 3BZCA 3H59A 2J7KA 3O9QA 3LO3A 4B9MA 2KHCA 4PABA 3CDWA 3H5UA 2XLKA 2YXLA 2XSJA 1PKUA 4QAGA 1YHQS 3D7SB 4CF1A 4J9OA 2X7IA 1FVQA 2HBJA 5GAEP 3QIDA 3LP2B 5AQTA 4PXCA 2YHXA 4IFVA 1IM6A 3ZTPA 4CWBA 3OS1A 4CF2A 1RZMA 2ZBPA 1LFWA 1HR0K 1TL3A 4M5MA 2V94A 4K2XA 1S6PA 2RE2A 4KV8B 2MEWA 2KLAA 1GOAA 3QRQA 3CJ1A 2DNKA 2OELA 4ZPVR 2CPHA 3M8PA 2NUBA 2IDOA 3VAMA 2KHOA 3DXKA 4IXCA 1RWNB 3Q2SC 1WSGA 3ZSRA 3PW5A 3HHLB 5M1OA 3KG1A 1ITPA 1XJWB 2ZFHA 3NL0A 3UQSA 1HNVB 3ILOA 1RILA 4FNHA 4DU8A 2JFDA 1Q7YT 4JI4F 4KO0A 4K8ZA 2WONA 2X1FA 1AT1B 2N7YA 1H3DA 3KK3A 3WBZA 3FQKA 2YI1A 2AP1A 3F9MA 2IC3B 3HLUA 2OPQA 3CQXA 1VSMA 2P9IA 3KJVA 2CQ2A 3H2VE 1FFSB 3MEDB 4OLBA 1IKWB 1PGZA 3NH2A 1WI6A 5C42B 1FXRA 1WHWA 4HTUA 1IR0A 2MLZA 4FS1A 3HHEA 5KTQA 2XY5A 4DV5F 2RU9A 2R8KA 2D0AA 1RAAB 2M8HA 4TYBA 4DUYJ 4WF9L 2DPIA 2I7PA 1P8ZA 3VHQA 1VIOA 1WC1A 1EP4B 3U4LA 4HLBA 4RL1A 1VBKA 3GSDA 4DTSA 3THWA 3WXLA 4UOCA 1D9FA 1J2VA 1BA1A 3IAS9 3VQAA 2N7CA 4CGIA 4N41A 2ZOMA 2WTFA 3K2YA 1FTCA 1TELA 2FTRA 5A0YB 1V3ZA 3K8VA 3N5FA 3BM7A 1NDLA 4BRIA 3VEYA 3BYRA 1RBSA 3KYLA 3Q8VA 4A48A 1SQFA 2IM3A 1QQOA 4HDGA 3MMJA 3ZCMA 3C6UB 1S1VA 1E6YB 1RHJB 3EMTA 1T9TA 1S5JA 3IDHA 2JRSA 1S1UA 4ZHRB 2IDLA 1B0PA 2DGWA 3W9HA 2QLJB 1QAYA 3HO1A 3MTKA 2Y3YA 3PJXA 1ZBUA 3NY0A 2EX3A 1DJ0A 4NA1A 3GILA 5LMUK 2I7NA 3THYA 2EFOA 3GCXP 2JLEA 2KQ2A 1KAYA 5LSLA 3DGVA 1W7WA 4DV1K 1KRPA 4PG6A 3D6FB 3ILLA 2RAQA 3BF1A 4QS9A 2CPFA 4ZVEA 5E41A 1WG4A 5CA5A 5K8PA 2HQGA 3C14A 1NK9A 4FPBA 4NLTA 2B8PA 4I1TA 1KQSM 4FOIA 3P96A 4B3TF 1BQMA 3NAEA 4IFYA 4Y00A 4DWIA 4LF5F 4AXIA 3G8QA 2R7UA 1HPZA 2IFXA 4FLZA 2ASJA 2IY5B 4C48A 4YHHF 2HRTA 2G1HA 1NK4A 4ELTA 2HBRB 3KLIB 2Z8QA 2GJ2A 2P6SA 1VRUB 3SYZA 4CYUA 9ATCB 4B9QA 5IZHA 3CCLS 1GLLO 3C7NA 3M6VA 4QS7A 4LRDA 4EHUA 5BN9A 2L08A 4QYZK 4EU0A 5DQHA 3OUYB 4JI4J 1WC4A 1N33K 4FJ7A 5E84A 2E5JA 4ID5B 4IKAA 1X4DA 4Y1DA 3ID6A 3OYMA 5B7WA 2YH1A 2FPHX 2V2VA 1RWXB 2VG6B 3ZYYX 2XMTA 2WVCA 4NCBA 4LF4K 5K14B 4M5DA 2B5JA 1PYOB 2QA4G 3NLCA 4DZDA 3CSKA 3T6JA 2FVCA 2BYCA 4CEAA 2FHOB 3RTVA 3CJRA 4DV5J 4KHQA 3PIOL 3FFIA 4QU7A 2O8DB 3ALYA 4OX7A 4TU7A 4WXOA 1Y0HA 2DNNA 2QZ8A 1UVIA 3QFUA 2OMOA 3BBCA 2M52A 3BQ0A 2ZH9A 2KI2A 3S8SA 4YR2A 4Z0UA 1RA7A 2C1EB 4Q44A 2M70A 1NM2A 3W65A 1HYSB 4Y3CA 2RNEA 3OYGA 1XR5A 3BN4A 1WNEA 4OKEA 4NCGB 4J9UE 1RTDA 1H38A 4QPXA 2RDJA 4MFBB 1XUPO 1YITS 4OI3A 3JTOA 2B6AB 1BCOA 2N4DA 1BQNB 2WSEC 4OHXA 1XNQF 2I1RA 1SS6A 4YOYA 4Y2MA 3SAFA 1OY6A 4CECA 5IWAK 4JI3F 5KFFA 3KHGA 4O4GA 3PRBA 1U04A 2FHKA 4QR2A 3Q8QB 4X64K 3FK4A 1RT3A 2J9EA 4JKCA 5IXUA 1LWFB 4OX9F 3OYFA 5F8LA 3V81B 2H48B 1FDDA 5E3QA 3D54A 5AQXA 2OYQA 1FWPA 1YBUA 2O8FA 2D41A 1RSCA 4NZ0A 2KKZA 4HCCA 2CQ1A 3W2WA 1NK5A 3KZBA 4B3TJ 2IVNA 2Z58B 3DXMB 4E1MA 1QVGR 1WC5A 4PRFA 2G8KA 4ZJLA 2YBVA 3EE9A 3BSNA 4JS5A 4MH8A 3MPDA 4DOZA 4YHHJ 3NDKA 4CW7B 4ILMA 3OBWA 2ILZA 4BDYA 4ED3A 2OD6A 1ZM4A 5J1EA 2JNJA 1X4AA 2LXIA 3HSDA 4ZMMA 2XMUA 2V6AA 3Q86A 3DLGB 3TW0A 3P1GA 4QPTA 2RDIA 1KBRA 1UEVA 2V7YA 3DRPB 3DLLL 3CCSS 1HARA 3KJFB 3NE6A 4O0NA 4FO0A 2OEJA 4LF7F 3AY9A 1W0HA 3ZEUA 3MEGA 3EDRB 3QT8A 4LF9K 2YY3A 4WZQA 4GRSA 4OHWA 3FEXB 1D0EA 4WFAQ 1ZETA 3PW0A 1XERA 3H45C 3RMCA 4YFUA 2B4JA 4BRLA 1SVDA 2XTJP 2Q31A 3Q0AA 3D0IE 4IDKB 2H4YB 2FLOA 4C8KA 3NFAA 3CW2C 3N79A 3LAMA 1EQ0A 1DTQA 2WZ1A 2BJ9A 2Z2LA 1FKAF 3H40A 5I42B 2D5RA 1BU6O 4DL5A 2Q6BA 3T5HA 4NI2B 2MKCA 4ED4A 1U1QA 3CI5A 1KVBA 1B0TA 2QL7B 2LYVA 4PAAA 1CZAN 3SPZA 4DV3K 2F8MA 3DGPB 4DPTA 5AZJB 2XC9A 4N56A 1PAEX 3MUTP 3G8SA 1YRTA 3ZT2A 1L3SA 2YH0A 5KRSA 4CEDA 3TZYA 3B82A 3Q24A 3CJAA 1YG0A 3I5AA 3Q8SB 3PX4A 5C2DA 1HWIA 3QT5A 3D2FB 4ZS6A 5EWFA 2CPYA 2Y1JA 5M2RA 4K8RA 1XNQJ 2GAGC 3M30A 1NHUA 2HHUA 3NGRA 1YJ7A 1RJJA 1OVQA 1NJZA 2CWXA 4JI3J 1BGXT 4JI1K 2ROGA 3TAMB 3H5SA 3QIOA 3PG9A 2DIUA 3QLHB 2ZM6F 2MQMA 5DJBA 2LQ9A 1JJ2R 2CH5A 3G4SS 5KFDA 4RW4B 2O5DA 2C2OB 1S1TA 2KZMA 1MLAA 4X4UA 2W2NP 1B0VA 2YHAA 3CJKB 1JJHA 4PXBA 1URNA 1H73A 1ATNA 4FYYB 3W0LA 3QB0A 2PMWA 1SQEA 1U1KA 2XGQA 4F26A 2ZKUA 3K0SA 2DFEA 4NA3A 5ETVA 3R7SB 4H4MB 2YNHA 1RAOA 2CQDA 2F3JA 4J2AA 1BHNA 2E9ZA 3M05A 2AU0A 4YOVA 4KKOB 3I0RB 4F3QA 3CF5Q 4DPYA 3LGNA 3G8TA 3NGKA 4L73A 4JI7K 2HK2A 4LF7J 2XM3A 2H5IB 2XHWA 1JLQB 5D0RA 3SUOA 2B4PA 2NSBA 3HZ6A 4XDDA 5EXWA 3PY8A 4PUOB 4C0HA 1CS4A 2PBDA 4ZPDA 5CABA 3HP6A 3VAJA 4MO4A 4LBPA 3P38A 1YRXA 4KPYA 2WOMB 3M2RA 1QHTA 3DXSX 1R43A 2Q3SA 2ATLA 3MMBB 1C2PA 3H4DA 3DM2A 3U8XA 1K73O 3CFOA 4OJHA 4NO7A 1RTZA 4LFAK 3W9JA 1ICEB 1SC1B 3D6MB 2AYMA 1NZAA 1OQ6A 1SBRA 5HANA 3TJAA 1KP6A 1O8BA 5AQWA 2VDHA 2GVZB 2XZTB 1VQKN 2MSTA 1PILA 2ZUAA 2HHWA 3CDBA 1W2BM 3M8RA 3TJ8A 3H98A 3GBTA 1ZBHA 4DFPA 2IYGA 4S0MA 3KLGA 2HPUA 2HQIA 1RT5B 3HSGA 2H5JB 4B3RK 2YNFB 3AVIA 1S9EA 2FXUA 4DMNA 4M3TA 2CZ4A 1I94F 2BJ1A 2HFVA 4IG3B 1FXDA 2PC6A 2AV5A 2HRYA 5KFIA 2YNGB 4FWPA 2VA3A 3HPHA 3KHHA 5DO2A 1NUEA 2J5AA 3FMBA 5AXNA 2ZM6J 2K1RB 2CQHA 2E1RA 4C97A 2V2ZA 2OA8A 4LQ9A 1YSJA 1F9HA 4GKKJ 1DTTA 4EK2A 4PL8A 3HVRA 2DIVA 2W9CA 3IFEA 2CYYA 1V5IB 3CJCA 5DG7A 2PEBA 2C3MA 4OKKA 2GGPA 4DR1F 4F0KA 2QLWA 4GKJF 3OFHA 4GO5X 5KFJA 3EPIA 4ZVSB 3MDQA 1KAZA 1RHRB 2OEKA 1HNXK 2M4MA 2UXCK 4BC7A 1XC3A 1HQEA 4FZZA 3PDNA 2MKHA 4CI0B 1QAJA 3HF5A 3MEKA 4CJUA 3G87A 3AA8A 2GIQA 4ID1A 2WCXA 4CH1A 1EETB 4KGKA 2GIRA 2JJ4D 3R27A 2OSQA 2ZOFA 3DI6B 1F3FA 3LUYA 5E26A 2YNIB 3MAHA 3CHWA 4HHTA 1UZDA 3KK2B 5LM7E 1KN6A 1BISA 4X65K 2LMIA 4E7KA 3BH7B 4BRDA 2V0NA 3G86A 1H98A 4JKEA 4L3QA 2NXCA 4B9NA 4CM0A 4JKAA 4ZVFA 4WKRA 2IVMA 4K8XA 3L95X 1SJ1A 1VJWA 3HDSA 1TUUA 2FDNA 3PEJA 1S9GA 3HOSA 2R4FA 2B8QA 3AO4A 2V63A 3TANA 2CZ9A 3PFEA 2ZZMA 5LT5A 2ZF5O 1VRTB 2KW4A 3UB5A 1PG5B 1ATSA 3KLHB 1KKHA 2BABA 1XNRK 4ISFA 1KVAA 4JI8J 3QNNA 2J7UA 3CIZA 1RE1B 3ULHA 1ZC6A 1AUDA 4H0XB 5AQVA 2AJ1A 4UOGA 4KHPJ 2R8GA 4OI2A 4CH0S 1JJ2M 4KH5A 3NOCA 1TYQA 3SAHA 3D6HB 1M5VC 4PCQA 3OYJA 1QJHA 5KT3A 4ETXA 3VQDA 2PA8D 1I94J 2WVDA 1FT8A 5H1SV 2ZH6A 2A2DA 4CLKA 5HN0A 1DY3A 3L4IA 2DK2A 2XYGB 2Z1IA 2M7SA 4LBHA 2Q97A 1VHFA 2E9RX 4I56A 3VOVA 4AE5A 2D0BA 5A76A 4J9KA 3I96A 3O5BA 1Z2ZA 2MKIA 2RPIA 1NEEA 3H90A 5KFWA 2R8HA 3C16A 2FC9A 4DFJA 5JVHL 1PCAA 2DKOB 2IM0A 4JI0K 2LVWA 2MKSA 4N5SA 2LEAA 3WXIA 4NE9C 4P74A 3GYXB 1EARA 2VG7B 4I2QA 2R8JA 1NPKA 3EN9A 4P7TA 1TL5A 4DX7A 4ZITA 4LRFA 3NCQA 4FN5A 4H5NA 2RF2A 4FZVA 4G65A 1WC6A 1SL0A 3V6HA 3MD1A 4DR1J 3S7RA 2C2RA 4GKJJ 1WDTA 1UJ5A 4ILJA 3V9UA 4DL2A 1N52B 3VF4A 2C2ZB 3ZZRA 1O5JA 1UWBA 3MM8A 5LXYA 1N0UA 3FGVA 3QMQA 2W7OA 2VGNA 1BXNA 4CZJA 3DOLA 4YY3F 2R2RA 3H20A 3TZXA 5IM0A 3SSQA 2BOAA 3LANA 2ZVIA 4H0TB 1VQNN 1Y3KA 4IG0B 3SLCA 3CIMA 2KYXA 1SV5A 5J2PA 1KFSA 2CXEA 4YMEA 3CQYA 4RG8A 1VRQC 1Q0NA 4CEFA 1QSSA 1Q4RA 3T5LA 3UKUB 3W60A 1ITGA 3HSZA 2QFIA 2CJQA 4W5NA 2CQ3A 3CE8A 5LXRA 4X4NA 3F2KA 3OTOJ 4H8KA 4RW6A 4HDHA 3VAIA 3VVUA 1XMOF 2XYHB 1T44A 1GLCG 3UDLA 3M5RA 2A18A 2A6OA 4EAHD 4M5HA 1WEZA 1O1WA 5F1XA 1RDUA 3D0PA 1T95A 3OT9A 1URRA 3ITHA 3AHPA 1LNQA 1XMQF 1EX4A 4H0YB 4PG4A 3QSIA 4KRWA 5EHHA 3PZPA 5KG1A 2ZWOA 4KH0B 1Q8KA 3AA3A 2MJUA 1GTEA 3GLJA 2BKPA 2QV6A 1NGGA 4IJAA 2ZE2A 4TQRA 1T9XA 3DYAB 1NLVA 4XTTA 3QPIA 2L9WA 2ZJRL 3UR0A 4JOUA 3DOMB 2I5JB 4AQYF 1FD8A 3RG6A 2FBXA 5CXTA 2IIRA 3EY1A 2AW0A 4GNIA 3O80A 4O0JA 3PEHA 3M6XA 4NRTA 4M5KA 2Y9HA 2RQMA 1U1PA 2DR7A 1CC8A 4B1YB 3QWPA 3CD6N 2GQCA 2KU7A 1UVKA 4P7VA 5DG8A 3X3UA 3M6GA 4DUYK 1VDHA 1GMWD 4YOTA 2HRUA 3S6EA 2BR0A 4RNMA 5F8NA 1TKZB 3CDAA 2W01A 2W4DA 1BIUA 5AFUA 3R9PA 4NYFA 3NXZA 3M9NB 3F73A 4KHUA 3OL6A 4H5RA 3K5OA 3HCXA 3AV9A 4MAKA 4DTNA 3T1HF 1UETA 5F8JA 3GFZA 1VQKS 4HR2A 5DGBA 1UW4A 4CD3A 3RAMA 2YX6A 5KFXA 1KAXA 3Q8UA 3O3FA 3POTA 3D68A 1XR6A 4EFAC 1UJ6A 2V67A 3A8IA 1MSWD 3OHBA 2H5EA 3AD9C 3D1OA 2FGCA 3GIRA 2F65A 3A3OB 1LW0A 4RW7A 3CCZA 4JKDA 4PQUB 2E1CA 2ACYA 4W5RA 3EE3A 2HS0A 1PC5A 3J7Z5 2DHAA 4ICLA 4GVBA 5HI7A 5A2QU 5TKWA 3P4UB 2ITMA 5A8KA 3RRKA 3C95A 2PI5A 4Q2MA 1HBOA 3V4IB 4BBYA 3VQ5A 4U7UK 4TXSA 1BHLA 3ENBA 3UDEA 3TZZA 1WSJA 4F0MA 4U7CA 3OYBA 1XMOJ 5DLFA 2Z2YB 1TV6A 4OYAA 2D3OR 1GXTA 1QE1B 3VMFB 3RU0A 4JBCA 5HJXA 2KZZA 4FF1A 4PA1A 3QWUA 2FJDB 1XMQJ 2JZ5A 1HYZA 3FRYA 4QWCA 3RYLA 3HFVA 3BGRB 1HD0A 3IRXB 2R7VA 1I1GA 2CG8A 2I0XA 3GIMA 4JHDA 3HOTA 2EFGA 3VQPA 4AHVA 3GR1A 4IR9A 2E8AA 1IKVA 4Y2IA 4AQYJ 4CT8A 4J37A 3UVJB 3FBFA 4WPAA 3NEKA 3VAFA 4B8AB 1VQPN 1S22A 2HFZA 4D3GA 3NMAA 2CJXB 3JYTA 2U2FA 3OTEA 5CAAA 2MQLA 4CJ3A 4LMZA 1TKDA 4CHQA 5M1KA 2XYPB 2ROEA 3PSIA 3FLCO 4DV5K 5KPRA 1EKEA 4V1Ak 1IKXA 4X4TA 4R5PB 1IBMF 3TVZA 1S4FA 2FJXA 3OJUA 3DU6A 4UQGA 2CFXA 4BRFA 3VAGA 2D74B 2Z0GA 1MWKA 3T41A 3CCVN 1IV0A 2R2TA 4M7XA 3ZSWA 4CGJA 3V1QA 1NGBA 4DTJA 2QK9A 1HQUA 1HNWF 1QSLA 4F2RA 3T1HJ 3CFPA 3JSYA 2YTCA 3O3LA 1SH0A 2A1SA 2R7OA 1DQ9A 2IMOA 5J2QA 1RAIB 1MROA 4KI4A 1VIXA 4DU4A 2ZBRA 3UN5A 2Z4PA 2CJBA 3ISND 4ZLJA 4U95A 1K8KA 4IO1A 1U09A 2X51A 3MM6B 2FLLA 3U3GA 2BW7A 2RRNA 1TAUA 2GELA 3F56A 5KFLA 2DCLA 1S1WB 2YKAA 5L1LA 3HK2A 3LH2S 4AM7A 2WSCC 2B0GA 2KT5A 3OYCA 1BWEA 2DRBA 5K8OA 4DTXA 1HMVB 2LA4A 3L9ZA 5AQMA 4BR0A 2PIIA 4CO4A 1K0TA 2EFPA 3OYEA 2BRLA 4J2EA 2PFDA 4M3UA 3HFKA 4B3TK 2HKEA 4IDHA 3TI0A 2JWNA 2MZRA 1TTHB 2P9KB 3ZTSA 3W63A 4LF5K 3BY5A 1PC4A 4K41A 4GVEA 4C8LA 4WTYA 4C8NA 1OSDA 3FEYB 1GH8A 3R2DJ 4YHHK 3BF3A 4FYXB 4EMDA 3ILJA 3I0SB 1H0HB 4ECZA 2DY1A 3VWSA 3CPWR 5FDLB 3ULEB 5HL7L 3A8EA 4FF4A 3OYNA 4BLGA 2NR0A 3WIVA 4MJKA 4KAZA 1HNIB 1U0HB 5CCMA 1JK9B 4BRCA 2DYAA 1B7YB 1VLYA 4C7QA 1JB0C 4DV0F 2MDAA 2RS8A 3EM1A 7FDRA 3OS0A 5DM6Q 1Y11A 4A47A 1U2VB 1VQLN 4K4SA 1VQNS 4IR1A 3NOGA 3H46O 7AT1B 4CO1A 3EVWA 2HMIB 1NAQA 4E89A 4USUA 4FJJA 3WHIA 2IGIA 1RDRA 5LSOA 1ZPVA 3SDEB 2VG5A 2QO3A 4M3YA 1DT9A 1Y00A 1NOYA 2QE5A 5KFBA 2BE2A 5C10A 4CGHA 3TABA 1TVRA 1X9WA 5M1FA 1GXUA 4L74A 3W2VB 3CCES 1U1NA 2NXJA 2P6TA 3TX0A 1FRHA 1IBMJ 4M42A 1QAXA 4WE1A 1RT7A 3VESA 1Q86O 3VA0A 3L2VA 4J5OA 3LDQA 3GIIA 2JWKA 3OV7A 3ZT0A 3OYIA 1CULB 3NGZA 2OO4A 2XMJA 1N5QA 3BR8A 2HNZB 1HNWJ 4CJEA 1FEEA 1MWMA 1GEHA 4JS4A 1HI8A 2UU9F 1E4GT 3O9UA 3HX9A 3R3TA 4ZVUB 5HQMA 4F0HA 4DQSA 1L3VA 2MZTA 1T3VA 4DSEA 4RX6A 2NZTA 1OKJA 4GO7X 4Q7AA 4X4RA 3J7AP 2K3KA 1XC9A 1XNQK 3VV2B 3QIPB 1OWXA 4YQWA 1FK9A 6AT1B 2LFVA 2B3TB 1W25A 4JI3K 2UXBK 3RBEA 4PG5A 3LP3A 1PBUA 2FSNA 1FKOB 4JKGA 3DRSB 1B7FA 3M32A 4B9TA 2R7WA 3LP0A 3CD6S 1KVCA 4O23A 2F4VK 4OX9K 2WVBA 2BGGA 5GAHU 3QT6A 3G0ZA 5KQDA 4LBIA 2R2SA 3OQ2A 3A8KA 4CHZA 2QA4N 2LU1A 1NSPA 1UJ4A 3O5TB 2DD8S 4O8KA 3ZFVA 4KT0C 2KRRA 3VQQA 1JLAA 1KQFB 1NCLA 2NSCA 5E3CA 2Y1RI 2HK3A 3U1LA 3QEVA 4RUCA 4QIGA 1O6XA 4E8UA 2HHVA 3KUGA 2LDIA 2QL5B 2G8WA 5A8RB 2YWFA 2WBNA 5LMNF 1E3MA 3E1YA 4DR2F 1H2VZ 2BQUA 2RILA 3BBFA 1JL1A 2LQBA 3N6LA 2LEBA 1C0TB 5CYMB 3QBWA 3OBYA 4K43A 1PSDA 3V9XA 2X1GA 4DV0J 2IA0A 1U24A 2HURA 1FJGJ 1VC0A 2Y1IA 2GAHC 4OMFG 1WJ9A 4G1QB 3WEEB 3S3MA 1V4TA 3CJSA 3VGUA 2P9PA 1SJFA 4XPEA 1OY8A 4CJVA 3V6DB 4ECVA 2CG4A 2RRAA 2OTLN 2KVIA 3J80Y 4Y2AA 4F7VA 1FERA 4QR0A 4UOHA 3ISNC 4QIVA 1EX8A 2IJNA 2HBMA 3MAQA 3BH6B 3BYPA 1X9SA 4ECRA 1HX1A 4BC2A 2GMJA 1C0FA 3AODA 1YX2A 2A6AA 2W2OP 1CC7A 2BVZA 2MPUA 3IUCA 4CE9A 1FW6A 4QOZB 2VQFF 2OD4A 4TKTA 4RCHA 5MLCQ 1VLOA 3M8QB 3MM5A 2G0JA 1P1TA 3CD0A 3WC0A 2XGPA 4IEEA 3NH1A 2CQ4A 4LRCA 5HMYA 4EI2A 5F2RA 4GV6A 3AGRA 1RCHA 1HUXA 5HRNA 3TEHB 3J7YI 2N3LA 2UU9J 1LXNA 1CSJA 2B4OA 1IR2A 5ETPA 3QINA 2L3MA 2Q66A 5M1NA 3MFHA 4M3WA 4HACA 1RT2A 4K42A 1C0UA 3VF0B 2YWKA 1WAJA 4A62A 3RBDA 1Y5IB 3MCOA 4FWQA 3SBGA 1Z4UA 4KI6A 4CJWA 1BIZA 5KG0A 2IVOA 1BWVA 2XSJB 1VQPS 2O01C 3GTYX 4FDFA 4M1KA 1REGX 5AQPA 4MYTA 2G9OA 1JCGA 1Y3JA 3E01A 4A8YA 3MMAA 3NCPA 2EFVA 4KGMA 4UOFA 3QAEA 4ZP9A 2QIFA 2HQDA 4IFVB 2ADBA 1RWPB 1R27B 2EPIA 3CPWM 1EZZB 2V4RA 3QMLA 1CJUB 3CC2N 3J7AN 1TL3B 2ZM6K 1S6PB 2OEMA 1WOPA 1FA0A 1KQKA 4WIIA 4OYBA 3M8PB 1SXLA 1WSVA 3SEOA 3JSMA 4WYBA 3DXKB 3CCVS 4CZFA 1MMDA 2O8CA 5D15A 3M1VA 4FVCA 4FJHA 1WG1A 4L3NA 2DNPA 3DOKA 4NOHA 3ETMA 4PYDA 1LOTB 1UA1A 5LMNJ 2B56A 2RU3A 1Y5NB 2WONB 1M1HA 1YJWN 4DR2J 5T7LA 4ZVRB 4WK3A 1XR7A 2KH9A 3TP2A 3KK3B 4Y6IA 1AROP 2XLJA 3QGHA 4O5BA 1FX4A 1N54B 2IDEA 3EYZA 3DRRA 5L38A 1BY9A 3AVLA 3H1QA 2ZJPL 2OPQB 2HWTA 4BS2A 1LW2A 3FBEA 1G99A 2P9IB 3KJVB 3IA0A 3OSNA 3QATA 3I32A 2ZVSA 1B3TA 3AB4B 3NWRA 2MZJA 2FUG9 5L1KA 4X64F 1OJ4A 3FQLA 4DTRA 4MKBA 4CGFA 1IBLF 4BWJA 3UCZP 3M8YA 1VS3A 2BUPA 3RMBA 4TNOA 1P27B 2Z56B 2NQPA 1GK8A 2E4LA 1FFWB 3THWB 2LQ8A 3HM8A 3L3UA 4K4YA 5AR0A 1HI1A 3RR7A 1C0MA 1LXJA 5IT9Y 3VEWA 3EKUA 4BRKA 1KDNA 4KGZB 3K0JA 4LVNP 3K59A 2VQFJ 4N76A 4FLVA 1R0AA 5BN8A 1YJVA 3AO1A 3L4QA 5FLXY 3GE9A 3R7NB 1HWJA 1S1VB 4TU9A 4OO1J 1IWAA 3PW2A 3CJQA 3UKRA 4KB0A 1S1UB 1DQ8A 1NSAA 3SK3A 4USTA 2A40A 3D66A 4JRPA 3VQ7A 1VK8A 4XO0A 4RTFD 4OLAA 2VPXB 4CHPA 1CJVA 2JX2A 3THYB 5G4DA 4WF9Q 3MXMA 1VQLS 1ZZFA 4BC3A 5MAOA 3P39A 1ZM3A 1TAQA 2HQCA 2W4CA 1I94K 2H1YA 3C14B 2HVDA 4LF4J 4HL9A 2YCHA 2YV0X 4DR5F 3W7BA 3GV7B 4AL5A 2R7QA 1T6CA 1C6VA 3LAKA 1CG2A 4O3SA 2DTJA 4IFYB 2COLA 2LSNA 1F0XA 3MN5A 4JN4A 5IOLA 1YVUA 4J9MA 1HPZB 4C8MA 2R42A 1SQGA 2BUNA 2K7KA 3TWZA 3M2UA 2ZWHA 1F9FA 3H8YA 3AJ2A 4USHA 4CYUB 4XH4A 3KJQB 3SQ4A 4ED6A 2V8HA 1JCEA 3SMZA 3C7NB 3TAFA 3K58A 1HWUA 2RB7A 4JK9A 4DR1K 4CI6A 1QVFR 5HSPA 4BREA 2PSZA 5TKYA 4GKJK 3AARA 3MN6A 2W25A 2N3OA 1R0CB 1A5XA 4MK7A 5D0HA 3ZSXA 3OVBA 1F5AA 4A8MP 4DCHA 1Y9OA 2FLNA 2EBGA 1X5OA 2ASLA 2ZQBA 4M5DB 4CBXA 1JCFA 5GIOA 2JEJA 2B5JB 4OZ3A 1U7LA 2P9CA 3CXCR 1W7AA 1DARA 3TX8A 5D4PA 3M6UA 4X64J 4N77A 1UTAA 3OSPA 4UQTA 1NHKL 3FFIB 1IBLJ 4CGDA