5HROA

Structure of hiv-1 reverse transcriptase in complex with a dna aptamer and an alpha-carboxy nucleoside phosphonate inhibitor (alpha-cnp)
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
551
structure length
551
Chain Sequence
b'PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HIV-1 REVERSE TRANSCRIPTASE P66 SUBUNIT
publication title Conformational States of HIV-1 Reverse Transcriptase for Nucleotide Incorporation vs Pyrophosphorolysis-Binding of Foscarnet.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate bh10)
molecule tags Transferase/transferase inhibitor
total genus 145
structure length 551
sequence length 551
chains with identical sequence C
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2016-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 5hroA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5hroA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5hroA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5hroA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5hroA05
1T05B 2C2EA 3OJSA 3AVFA 4CEDA 3NE6A 1BIZA 3GIMA 1KTQA 1HMVB 3IN5A 1ZTTA 2FVPA 1REVA 3CYMA 3PR5B 1SUQB 3JSMB 4TY8A 2R8JA 4O4RA 5C25B 4ZMMA 1JLQA 1LAVA 2W8LA 5L1LA 4J2BA 5EWFA 4KSEB 1LWEA 2B6AA 2ILYA 4X2BA 1QQCA 1Z4UA 1WSJA 1VRTB 4FW1A 1K6YA 4ED2A 3T5LA 3QLHB 3TAMB 1S9FA 2HW3A 3SPYA 4IKFA 4FZYA 1WAJA 2AX1A 3MTKA 5DLGA 3E01B 2UVVA 2J6TA 2IC3A 4J9NA 1IG9A 4M3YA 4DTXA 1J9AA 2AWZA 2P5OA 4KI6A 2JC1A 4IKAA 4FBUA 4M3UA 4KFBA 4O5BA 1NKEA 1N6QB 2PYJA 3AO3A 5JS2A 1HPZA 3CM5A 3AA4A 2IJFA 3D45A 3S3MA 2Z1IA 3KK1A 2YNHB 4OKJA 4J2DA 3PV8A 1A5WA 5I3UB 3HL8A 4NLUA 3L2VA 3NGIA 1U49A 5HROA 3OL6A 1NJXA 3KKRA 4ID5A 4NCGB 4TQRA 3MXIA 1S1UB 4DSJA 3V9SA 2G8UA 2ZE2B 1TKZB 3BJYA 2HNZA 3KK3A 3LP1A 1C1CB 5FRMA 3BSOA 4K8XA 4DFMA 4DQPA 3D28A 2XO7A 2V4QA 1IO2A 4BE1A 2OPQB 2GIQA 4KHMA 5CYMA 5HBMB 2GC8A 1C0TB 5J1EB 3V9UA 1YTUA 4I7FA 2FLLA 3NAHA 4NRTA 3V9WA 4DTJA 1D8YA 2X74A 3CJ4A 4FZZA 4J9LA 1RTHA 4J9MA 4FK2A 1LW0B 3CIZA 1KVAA 4FLWA 3DRRB 2BGGA 1JIHA 5C42B 3AO2A 4ZTJA 3BSAA 3QZ8A 1RT6B 3AV9A 4AH9A 3QIPB 1NOYA 4I2PA 5KFKA 1TL3A 1C2PA 4Y2CA 5DMRA 2A1SA 3DRSB 5DLFA 2RN2A 1I39A 4AHTA 2FJVA 3KLGA 1UOCA 4CEQA 4AHSA 3C6UB 4O44B 1J54A 4CHZA 5K14A 4BDYA 4E7KA 4IQXA 1WSGA 4DTSA 5EWEA 3HK2A 4EO8A 5FDLB 4DL6A 4HKQA 4ZVFA 2BR0A 1S1TA 1QUVA 4RW6A 2NUBA 5D3GB 4EBEA 1B92A 2VG7A 1S9GA 5J2NA 1IKYA 2W9BB 1IKXB 2O4GA 2YKMB 4WYLA 1SH0A 3FDSA 4TYAA 5KFYA 2P5GA 1CXUA 5C24B 1BQMA 4ICLA 4EYIB 4HCBA 4Q0BB 4CGDA 4RW4A 5KFOA 3NH1A 5EUHA 3KLEB 3LDSA 5JXSA 2OPPB 1RDBA 1JLBA 3VQ6A 3DM2B 2W9AA 5HP1A 1D1UA 4IH7A 2X78A 3SUQA 2RKIB 1FKOB 1G15A 3IS9B 1QAJA 4YR2A 1KFSA 1JKHA 1QE1B 3AVHA 5DGAA 1K1SA 3KLIB 5J2PB 3HHKA 3G0ZA 5CZ2A 4FLVA 3B6PA 3U3YA 3T3FA 2DFFA 3MFIA 1C0MA 5FROA 2JLEA 3CO9A 1QAIA 2BQUA 4ZHRB 2W8KA 3I5CA 4TLRA 4RW7A 2FLPA 4GW6A 4ZPBA 4JV1A 1HYSA 4K8ZA 2ZD1B 4IG3B 3KMQA 2X6NA 3I8DA 3PX4A 1NK0A 1S0NA 1RBTA 4KKOA 1R0AA 5T14A 1N5YB 3KHGA 3LP2A 3Q8RB 1HQUA 2FBYA 4CGFA 4W5NA 4CEFA 4L8RB 5F8GA 4IRKA 4QWBA 1SH2A 1JLEA 1U48A 2BE2A 4M3WA 1GX5A 3UIQA 4FXDA 2OPRA 3VQ5A 2BRLA 3P5JA 2HHVA 1NKCA 3AA3A 5KFBA 2RF2A 4WFZA 1S0OA 4M42A 1RTIB 4NYZA 3M8PB 1CLQA 1XHZA 3DI6B 1TVRB 4UQGA 3K5NA 4LSNA 2HNDA 1TAUA 2GBZA 4BWJA 4ECTA 4HUFA 1BQNB 1JLFB 3OY9A 2XWYA 4CK1A 2XGPA 3SI8A 4QW9A 1B9FA 3IGVA 5DGBA 2OH2A 1BL3A 4CJKA 3CDEA 4DMNA 5KG7A 3Q8QB 1CZ9A 5J2QA 3I5BA 1X9SA 4DSKA 4IFVA 4NLYA 2HHQA 2BQRA 3HVTA 1OS5A 1TKDA 1DLOB 4HUGA 2WOMB 1JL1A 4IFYB 4K50A 4YFUA 4XPEA 3VQBA 1ZBHA 3SUPA 4EYHB 4Q44A 3QINA 2YV0X 4IH5A 4ELVA 2O4IA 3PW0A 3PUFA 1NJYA 4K4SA 3I0SA 4EBCA 4WE1B 3O4NA 1QTMA 4Y34A 3F73A 4CIEA 1LW2A 4C8KA 4KAIA 4DTMA 3OYEA 5DQIA 4MK9A 1JLGA 4TXSA 3OYAA 2FVCA 4F3OA 4H4OA 1KLMB 1KVBA 4B08A 1N56A 3PY8A 4KBIA 3O4QA 4J9QA 4KV8A 1TK8A 4ZP9A 3OYDA 2XI2A 4OKEA 1XC9A 3MEDB 4DFPA 4NLXA 4WZMA 1S1WB 3DRPB 1BI4A 4NLVA 3DOKB 1TV6A 2VWJA 5KFPA 4CEOA 4DTNA 3ZT2A 4KTWA 3VQ8A 2WONB 1LWFA 4J9SA 4KHRA 4YMEA 3M9OB 4H4MA 4W5QA 2Z1GA 2YNGA 4ZP7A 1SKSA 5KFZA 1RT7B 1IKWA 1BISA 4I2QB 3P1GA 5KT5A 4TYBA 2OZMA 4NCAA 3TANA 3ZSVA 4OVLA 1L3SA 3NBPA 4JV0A 3GQCA 3RBDA 3CDUA 4TY9A 1RDCA 4DQSA 4B8CA 3K2PA 3DLKB 1RTDB 5L1KA 3NMAA 3NF9A 3PX6A 3RMBA 4OL8A 4DL3A 2FVSA 3DOLA 4JRPA 4Z4CA 3OS1A 4KHSA 4KREA 2FJXA 3QGIA 4OPJA 3VQQA 1U04A 3NKYA 1JLAA 3OLAA 3M8SA 2YNFB 4DEZA 4KO0A 1C0UA 4DFJA 5KFMA 3WNHA 3THVA 1RT1B 3KJVB 2VG5B 4KPYA 4G1QA 3ZT0A 3CFRA 4RU9A 3A2FA 4HUEA 2PY5A 2WTFA 5SZTA 2WCXA 1SKWA 1WNSA 2DFHA 1RYRA 3S3NA 4JS5A 2D41A 4LQ9A 1RT5B 4DL5A 1VSKA 4B9TA 3G6XA 4DG1A 1RT3B 1TP7A 4DSEA 3MFHA 4EP4A 1RTJA 3CVKA 3SZ2A 4PQUB 4MQ3A 3V81B 5I42B 5KFEA 2VA2A 5KFGA 3PJWA 4K4XA 1O1WA 2UVWA 4CHOA 3PW4A 1S5JA 3DLGB 4R0EA 2QV6A 2O5DA 4DL4A 4OGEA 5L9XA 3C6TA 2IA6A 4CF1A 4CFDA 4O0IA 3SCXA 5HRSA 5L1JA 3KLFB 4ECUA 4IG0A 3RB4A 4CJRA 1UWBA 4YQWA 5KGXA 3K57A 4N76A 3DLEB 4HVJA 4NLPA 4N47A 3FFIB 4IOBA 5KFWA 4DLGA 1FKPA 2KZZA 4DL2A 3SUOA 4WYWA 4ED8A 2HHSA 1WSEA 4FYDA 4ED1A 2HNYB 4C8OA 1T05A 1Z25A 1C1BA 3Q8PB 4FLZA 4Z4HA 1HMVA 4Y1CA 1LV5A 4KHWA 1LWCB 3UR0A 1SUQA 4H8KA 5C25A 4B3OB 1IKVB 4W5TA 2E4LA 4FJHA 3GYNA 2OYQA 1VSEA 1KHWA 5SWMA 3GILA 2I5JA 3H5XA 4U7CA 4FK4A 4NRUA 5F8LA 4NLWA 3DYAA 3TAMA 4URGA 3VQDA 4J9OA 4N5SA 2HWIA 3AVCA 3TAQA 2GUIA 2GV9A 1NK7A 2HVHA 4PWDB 2W7PA 3E01A 3MEGB 4CECA 5KRTA 2R8HA 5HRNA 4NYFA 2P1JA 3LZJA 4E19A 4DS5A 5EWGA 2HWHA 3DDKA 2R2UA 1EP4B 1TKXB 2FBVA 3K59A 3CJ3A 4CFCA 1N6QA 4Z4FA 3I0RB 4LY7A 1D9DA 3OSNA 3RMAA 3V6DB 4ELTA 4I9LA 3HP6A 3AO1A 4I9QA 4ED6A 2YNHA 3AVJA 2AGPA 2UVUA 4OLAA 1L3TA 1RT4B 2AX0A 3RBEA 1XR7A 2BDPA 4NCGA 1FXXA 2Y1JA 3NGZA 1L5UA 4O55A 4E1MA 1S1XB 1S1UA 1S49A 1NJWA 2ZE2A 1TKZA 1YVFA 3QNOA 5KFIA 2IBKA 4CGJA 2B6AB 3MECB 3RMCA 4HYKA 4Z4GA 3ZSZA 2OPQA 2Z1JA 3MR3A 5HBMA 3T5HA 4ZPCA 1C0TA 5J1EA 3QEXA 1GX6A 2J6UA 3HKWA 4Z4EA 2G8IA 4F4XA 3O3GA 1LW0A 4YNQA 3TQ1A 4KTZA 3DRRA 2IC3B 3PHEA 2W7OA 5C42A 2YNIB 3LAKA 1NHUA 1YT3A 5F9LA 1RT6A 5KFSA 3EZUA 3QIPA 2VG6B 1K1QA 5KFUA 2XCPA 3UQSA 4Q8FA 4N41A 4CJUA 3JYTA 4TQSA 3L2WA 3AVMA 1KHVA 3V9XA 3DRSA 4FJ5A 1VRUB 4Q43A 4FK0A 4HCCA 4DF8A 3C6UA 1VK0A 2XHBA 3CFOA 3SI6A 3NF8A 4MKAA 4R8UB 5FDLA 1WSHA 1RDDA 1Z26A 4Y1DA 5D3GA 1QSLA 5KT7A 3QO9A 2DY4A 5KFFA 2GIRA 5KT3A 1VSFA 3L3VA 5CY4A 3AVKA 2W9BA 4YP3A 1W9HA 4TSXA 1IKXA 2YKMA 3MF5A 1S4FA 2C28A 1S6QB 4ID5B 4EO6A 2AJQA 5KT4A 3QGHA 5EU7A 3TAFA 5KG3A 2OPPA 3TI0A 1W25A 1I3AA 3DM2A 2HNZB 1NK5A 4B9LA 1HQEA 1FKOA 1EETB 5HLFA 1HJRA 5CZ1A 4BACA 1QE1A 2G8WA 4I7FB 5J2PA 2F8SA 5EDWA 4OJRA 3L2RA 2YKNA 4AHCA 3HPGA 3IGNA 1BCOA 3LP0B 3SV4A 4ID1A 2BANA 3MR2A 1HRHA 3EZ5A 3QEWA 1S48A 3HP9A 4OLBA 4EZ6A 4I2PB 3E51A 3IRXB 2HHUA 4O3OA 3U3GA 3G6YA 2ZD1A 3KLGB 4CCHA 4IG3A 4ED3A 1TL1B 2D7SA 1NHVA 2E9TA 4BDPA 3GIIA 4EBDA 4KE5A 4KB7A 1EKEA 3MR5A 1S1TB 4RUCA 4RW6B 2WHOA 5KG1A 4C8MA 3OYIA 2VG7B 2IM1A 3ZSYA 5FRNA 1IKYB 4WXOA 4IRDA 4K4UA 3RTVA 4O3NA 3HT3A 3PX0A 4WFXA 3ZT4A 4FM2A 1VSLA 4CHYA 1RT2B 3AVGA 4RW4B 2R2SA 4W5RA 2I1RA 4FJIA 1JLBB 3CQ8A 4HTUA 3VN5A 5HP1B 4F8RA 3N6LA 4DU4A 2Z1HA 5DQGA 1RTIA 4E3SA 3SJJA 2OA8A 2DPIA 4Y2AA 5KT6A 4FM0A 3HPHA 3DI6A 5CYQA 3EY1A 3AVLA 2B43A 1ASVA 1MMLA 1BGXT 2R8KA 3L2UA 3L3UA 2UVRA 4URQU 3ITHA 4LD0A 3CJ2A 1JLFA 3RR8A 4CEBA 5KFJA 3OS0A 3ZSWA 2RDJA 3OYKA 3KHRA 3DLRA 4IRCA 3ISND 4LSLA 1ASUA 4CJEA 4RNHA 1S9EB 4K4TA 3LPUA 1C1AA 2KZMA 4G3IA 4F2SA 2IM0A 4QPXA 5KFAA 1S6PB 2OZSA 5KFDA 4CJFA 3IG1B 3M9MB 1WLJA 4KKOB 4MK8A 1R0AB 1JLCA 4RW9B 3V1QA 3OL8A 4KI4A 1DLOA 1S10A 2HMIA 4MFBA 1HQUB 2WOMA 4IFYA 4E0DA 1T03B 4ECWA 1WSFA 4PY5A 5F8IA 5T7BA 1JLEB 4RNOA 2BE2B 4JUZA 2XY6A 2OPRB 4E89A 2WRMA 3SQ0A 3OYGA 4WE1A 3H4BA 4CESA 4FJMA 3TVKA 3SUNA 3QEIA 3PJXA 1EXQA 2D5RA 2XI3A 1EX4A 3HXMA 4NZ0A 1RNHA 1NOZA 3M8QA 1RCHA 4MIBA 2W9CB 3LWMA 1TAQA 1ZETA 4E7IA 4LSNB 3KK2B 3VQCA 4Y3CA 2FBTA 3SNNA 3N6MA 3RR7A 3MEDA 3TAGA 1WSIA 3G86A 1QSSA 4AHRA 1GOBA 4DTPA 3HVAA 2DTUA 3DOKA 3MEEA 2Q3SA 4J9PA 3BQ1A 3FQLA 1VSDA 2WONA 1MU2A 4FZXC 1HYZA 3TAEA 5J2QB 4RNMA 3K5MA 2JGUA 3QIDA 4DTOA 3T5KA 4RW8B 1RT7A 2JEIA 4I2QA 3HVTB 4DQQA 4K4YA 1NK8A 2QE5A 4ZP6A 5KFQA 1T94A 1RTDA 4CHNA 4ELUA 1NK6A 4NLOA 4AHVA 4NLSA 5DQHA 4K4WA 4KHQA 3V6KA 1U4BA 3UDLA 2W42A 5F8HA 4QWDA 4FVMA 1LW2B 3SFGA 3L8BA 2YNFA 3CWJA 5DG7A 1SV5B 1RA7A 2RPIA 4CF2A 3V6JA 4E7LA 4H4OB 4CEAA 4B9UA 1RT1A 4O3SA 3GV5B 3KJVA 2ATQA 2KTQA 1HNVB 4IDKB 4O4GB 2AGOA 2VG5A 2V9WA 1KFDA 3ULDA 3OL9A 4CERA 3KLHA 3H5YA 4KTQA 3DLHA 3V1RA 3MXJA 4U6PA 3QEPA 2ASJA 1VSMA 1TV6B 1RT5A 4ECZA 2B5JA 1HNIA 2JEFA 2IJNA 1RT3A 3RAXA 1LWFB 2FBXA 4H4MB 2IMWP 1CSJA 1S1VA 1RBSA 3V81A 1FK9B 2CKWA 1Y97A 4CFAA 1VSIA 3NDKA 4EZ9A 3NBPB 3AVNA 2XY5A 4LH5A 3PVXA 4ZTFA 3G10A 1VSHA 4PUOA 3HJFA 5KI6A 3OYNA 1UA0A 4CFBA 5JUMA 4NLDA 4FS2A 3H08A 3QEVA 1S0MA 4CJLA 4ZPAA 3NFAA 3H98A 3VQEA 2FLNA 4CJPA 3FFIA 1Q9YA 1JLAB 2V4RA 4CK2A 3OLBA 4LH4A 2HNYA 1VSJA 5KFTA 3D5MA 4GMJB 1ASWA 1RYSA 2XCAA 3G6VA 4URSA 2XC9A 1LWCA 3VQPA 3LALA 1XHXA 2UUTA 2P51A 1JX4A 1ZBIA 2G8HA 2X6SA 4B3OA 4NLRA 1IKVA 2QXFA 4BE2A 3AA2A 4CGIA 4FLYA 3QNNA 1CXQA 3GIKA 3VQ7A 1UAXA 4DG1B 2WB4A 2D0CA 3KHHA 3NL0A 1DTTB 1TQLA 3VQSA 1NK4A 4JS4A 2D0BA 3JSMA 1JL2A 4ZVEA 4DWIA 4IR1A 1J5OB 3AVAA 3HSTB 4Q45A 1T8EA 2YHBA 1VRTA 4CJ4A 1KCFA 4FJJA 3U6FA 3QLHA 4AILC 3NCIA 3TAPA 4KRFA 3NGYA 1SL2A 3I0RA 2DPJA 1UWBB 1IH7A 3V6DA 4O3RA 5F8MA 1A5VA 4DQIA 1RAJA 4LQ3A 4B9VA 4MK7A 4NYNA 2ALZA 3KHLA 3RB6A 1DTQB 2OPSB 3T1AA 2G8VA 4ZVGA 4J9RA 3M9NB 1RDAA 1RT4A 4EP5A 1C1BB 4QWEA 3V4IB 2IM2A 4FCYA 4R5PB 2JEGA 3UPFA 3WNFA 1S1XA 4OPKA 3DMJB 3FQKA 4ECRA 2G8KA 3O3HA 1TKTB 3SFUA 2FJWA 1HARA 4F4KA 4DSIA 3DLBA 3MECA 2IAJB 2I5JB 1YVUA 3BGRB 1NK9A 3D0PA 3KKSA 4ED0A 3OYMA 5J2MB 4B8AB 2A1RA 5I3UA 3DYAB 1ZBFA 4BWMA 1KRPA 5KFXA 1ZBLA 2IOCA 1WAFA 4FLUA 1REVB 5HRPA 2ILZA 3GIJA 3RRHA 4TY8B 3ZCMA 2YNIA 1B9DA 1JLQB 4CIGA 4O0JA 1C1CA 3PO5A 2VG6A 1LWEB 3TABA 1XR6A 2E9ZA 1UA1A 2R8GA 2F8EX 3QIOA 3OL7A 2ZKUA 1VRUA 1SL1A 3S9HA 3O3FA 2ATLA 5KFHA 4M45A 4R8UA 2E6LA 3PO4A 3H59A 2R7YA 4O3PA 4YR0A 5HRRA 3NH2A 4MIAA 3KOAA 4FM1A 3OS2A 3LZIA 4CJWA 4KFBB 1S6QA 2AU0A 3N6NA 4H54A 3BSCA 4O44A 3RB0A 4ECQA 4DL7A 3KIOA 3BQ0A 3QERA 3NF7A 4M3RA 1HPZB 1W0HA 3OYFA 2KFZA 2VA3A 4F50A 3KK1B 2PZSA 4RNFA 4M3ZA 4IBNA 1J53A 1EETA 3NF6A 3C95A 4RG8A 2RDIA 4DSFA 1BCMA 1WNEA 2HB5A 5HROB 5C24A 3K58A 4J9KA 5KG0A 2C2RA 4Q0BA 4CHQA 1BIUA 3LP3A 4KAZA 1U09A 3LP0A 5KFNA 3KLEA 3OVNA 3S3OA 4RZRA 2AGQA 3KK3B 3H5SA 3LP1B 4F4YA 2ITGA 4MH8A 2RKIA 3JYTB 1NNDA 3IRXA 3IS9A 3MAQA 5CYMB 3QZ7A 3CDWA 2ASDA 4IR9A 3AO5A 3KLIA 1TL1A 1HYVA 3RRGA 5F8JA 1WN7A 4WZQA 1D9FA 1XI1A 1RTHB 1GOAA 1D5AA 4FW2A 3QO9B 3KD5E 4M94A 2KQ2A 3H4DA 4K4VA 3AVIA 4ZHRA 2D3ZA 2ASLA 1TL3B 1QSYA 1X9WA 4CEEA 4J2AA 3IAYA 4ZP8A 4KB1A 3PW7A 1RT2A 4JLHA 4CJSA 5K14B 1L3UA 3RAQA 4JRQA 3SPZA 4KHYA 3KNAA 4WFYA 3NH0A 1N5YA 3H2LA 3CG7A 1HQEB 3ZT3A 5KFVA 2G8FA 2IGIA 5HLFB 4KB0A 1S9GB 3WNGA 5J2NB 3VA3A 1LAWA 4CK3A 3TR8A 2QKBA 2HVIA 4JV2A 2YKNB 1N4LA 4CEZA 1BQMB 4ICLB 3TWHA 1U47A 3PR4A 4ECSA 2PYLA 2CJQA 2BANB 3FSIA 3ZSRA 2J6SA 3ZSQA 2AQ4A 2QK9A 1S9EA 1RA6A 3KMSA 1RBVA 3M8PA 4GC7A 1JKHB 3ISNC 3SQ1A 1SKRA 1S6PA 1TVRA 1Q9XA 4AHUA 5DK5A 3IG1A 3SQ2A 4FJGA 3QGGA 3NAIA 2C22A 3KTQA 4FLXA 1BQNA 1JXLA 1RBUA 4M3XA 4RW9A 2HHTA 4CJTA 1KLNA 3LWLA 5C5JA 1XWLA 2F8TA 4O3QA 2IM3A 1T03A 1GOCA 3LPTA 4W5OA 1TGOA 4RW7B 4CF0A 2F96A 3OYJA 1HYSB 2E6MA 4DU1A 4QWAA 3OSPA 3ZSOA 1QS4A 3OYBA 1ZTWA 4MKBA 4ZPDA 4YR3A 5KTQA 4NCBA 2HHWA 3ZSXA 3LP2B 1X1PA 3PW2A 2W9CA 4QWCA 5CYQB 1T7PA 1IM4A 5KFCA 1F21A 3KK2A 4OGCA 3ITHB 4CJQA 4RNNA 4IH6A 3QETA 3FRZA 2ETJA 4LSLB 2RF2B 4BE0A 3TARA 4FJ9A 4WXWA 4KHNA 1KLMA 3KD1E 4DTUA 2HNDB 4CJVA 4CGHA 1ZYQA 5F9NA 4RW8A 2XY8A 4CE9A 4DLEA 3VQAA 3BSNA 1JLCB 3RWUA 2HMIB 4MFBB 1S1WA 3DRPA 4ZVHA 4M3TA 4BDZA 4CJ3A 3WNEA 2R2TA 3RMDA 5KRSA 2WK4A 4GC6A 1KVCA 3M8RA 4CGGA 4E7JA 3Q8SB 3OJUA 2QKKA 3QYYA 3MXMA 2EC0A 4DFKA 3VA0A 4NLGA 1BHLA 4IFVB 3H5UA 5KG5A 3KLVA 1T3NA 4FJXA 2HHXA 1SV5A 3NHGA 4F3TA 1X9MA 3M8QB 5KG6A 4FS1A 2FVQA 1HNVA 3DLKA 4IDKA 4O4GA 3CFPA 2XY7A 3SQ4A 4E1NA 4DTRA 4B9NA 2DFEA 4XPCA 3I0SB 1RBRA 3AA5X 1NJZA 4QCLA 1SH3A 2UUWA 5F8NA 1L3VA 5DG8A 4M95A 3T19A 4DQRA 4HHTA 1JLGB 3MEEB 1C6VA 2EX3A 3HYFA 3EPGA 3GV8B 4FJNA 4CJ5A 1MU2B 4F4WA 3MR6A 4K4ZA 4C8LA 3EYZA 4FJ7A 4KV8B 3PZPA 3BQ2A 4XO0A 3HVRA 4B9MA 1FK9A 3AVBA 3ALYA 5L1IA 4ECVA 1ZBUA 4QW8A 5KGWA 4FLTA 3V1OA 3I5AA 2JC0A 4FJLA 4DSLA 3PW5A 4GVMA 3HO1A 1YTAA 1BI4B 2LSNA 1D0EA 4CF9A 1RDRA 1ITGA 4EEYA 3ICLA 2HAIA 2Y1IA 4OKKA 3BREA 2D0AA 4TN2A 3V6HA 4NLTA 1CZBA 1JXEA 3HVWA 4PQUA 3BR9A 1SL0A 3HPOA 1XR5A 4DF4A 3CM6A 2YNGB 1IKWB 4DU3A 5I42A 3ZT1A 3V9ZA 3ASMA 3OYLA 3SV3A 4QOZB 3SYZA 3DLGA 2KW4A 1NKBA 2XRIA 3DOLB 5KFRA 1I6JA 3KLHB 3KLFA 4ECXA 4F2RA 3LAMA 2IS3A 3OHBA 3DLEA 1N48A 4CHPA 2XGQA 1TK5A 2KFNA 4CIFA 5KG4A 4KO0B 1C0UB 2R2RA 3NAEA 1TK0A 2B5JB 1HNIB 4KHUA 2D3UA 5KFLA 4PA1A 4E7HA 1JXBA 1DTTA 3AO4A 4RUAA 4N56A 4G1QB 2B4JA 1S1VB 5E41A 4CF8A 4XIUA 4Z4IA 3K5LA 1J5OA 2EHGA 3OHAA 4M41A 5JS1A 3OYHA 2VWKA 4Z0UA 4FJ8A 3QESA 4FJKA 4PUOB 2FVRA 1U45A 3BDPA 1Q8IA 4Q5VA 4ED7A 4F4ZA 4B9SA 1RTJB 4DS4A 4PWDA 3CJ5A 3C94A 3MEGA 2YHAA 2JEJA 4QAGA 4Q8EA 4ECYA 2R8IA 4J2EA 3LANA 3NGDA 1DTQA 2OPSA 3GV7B 3P83D 3L2QA 2E9RX 1QHTA 3HM9A 1RILA 5KT2A 1A5XA 3CJ0A 2ZQBA 1EP4A 1TKXA 3T5JA 3RB3A 3V4IA 3H40A 3C6TB 4FBTA 4R5PA 2V0NA 3OYCA 1KSPA 3DMJA 4NLQA 4IG0B 3K5OA 1TKTA 3B6OA 3F9KA 2C2DA 2IAJA 2BRKA 1FKPB 1S97A 3VQ4A 2IDOA 2BQ3A 4C8NA 3VQ9A 3BGRA 5DG9A 5KG2A 5J2MA 3EPIA 2FC0A
chains in the Genus database with same CATH superfamily
3MAAA 2L9NA 1VHIA 2C2EA 2YVSA 3TUJC 5KAKA 3W5ZA 2PMWA 1FRLA 1FX2A 3CD5A 4O4RA 4ZMMA 2F8MA 1JLQA 2P6SA 1RADB 4H4KC 1LAVA 4LFCJ 4J2BA 4NXNF 4FF3A 4NO7A 3PDNA 3UKRB 1FDDA 3CGIA 4FW1A 1FT8A 4A8WA 3R1LA 3AARA 3QLHB 1B0VA 1S9FA 2HW3A 1K8AT 2HBZB 4CW7B 3R8EA 1CS4A 3TP2A 2UVVA 3ILLA 2IC3A 5AQVA 2FSJA 1YIJN 4J9NA 4FNHA 2CPYA 3UR3C 4NLBA 1MA9B 2P5OA 4EI2A 2FSKA 3CCLN 4KFBA 2C2KB 2G0JA 1IJFB 1HPMA 4BHQA 4EFAC 3K8VA 5JS2A 4DV4F 3CCZA 1QUPA 2OTLN 2QRRA 3TUZC 2DGSA 2W4DA 3A4TA 2EI5A 3NVKA 2V63A 7AT1B 2L41A 3NP5A 3QICA 3DLLL 2POKA 1U49A 5HROA 5DJBA 3MXIA 2A5XA 2HSTA 4N7TA 1FDNA 4DSJA 1Q4RA 1K9MT 3M2RB 5T7LB 2HNZA 3J81O 3LP1A 4ZCIA 4YB7A 5JMNA 3BSOA 1VQ4S 1Q53A 4WKRA 1A0OB 3D28A 2V4QA 2VV5A 2OPQB 1R3NA 2Q36A 5J1EB 4I7FA 1HHTP 4USIA 1VDHA 2FLLA 4DTJA 3D6MB 4J9LA 1M90T 1RTHA 3BB5A 4J9MA 4FK2A 3MM6A 1LW0B 4PL8A 3CMQA 3DRRB 4LRCA 1SBRA 2PFFB 1YJVA 3AO2A 5I4MA 2VONA 1NOYA 5E3RA 4ANEA 4LFBF 1VQ9N 1C2PA 3DRSB 2DRBA 2OEJA 4E7KA 2DNGA 4OHXA 2G0IA 3W66A 4EO8A 4ALZA 3CD6S 1S1TA 1QUVA 1IBKF 4L73A 2VQEJ 1QAXA 2BJ7A 2MKCA 5J2NA 1RWMB 4TU9A 4PHTX 2Y0SD 1JCGA 2YKMB 2ZWHA 1RHRB 3US5A 5CXTA 3TEGA 5AQRA 4OLPA 4PCQA 1B7YB 1W2BM 3KFWX 4WPAA 4CGDA 3NH1A 1YG0A 2OJ3A 2E88A 3H6EA 3CPWM 2HIYA 4YEAA 1D1UA 4PYAA 4P2SA 4BRNA 4QIFA 3IS9B 3UVJA 2ALYB 3PM9A 1F9FA 4YN3B 5DGAA 1K1SA 3KLIB 4WQ5A 4RBUA 2XMWA 3B6PA 2JDJA 2NXEA 3MAHA 1FNMA 3U3YA 2DHHA 4U67L 2DFFA 5FROA 2BM0A 2BQUA 3ZZOA 2FF3B 3CQXA 3P4IA 3I5CA 1N32K 3HZEA 4EUVA 1V3RA 2FLPA 4UY8O 2IJRA 1U2VA 2XQCA 2ZD1B 4WP8A 2PI5A 2X6NA 3I8DA 4E8UA 3CJ8A 3QBCA 1LWXA 5DRKA 5JVHL 5T14A 3CUNA 3LP2A 5L8RC 4WBFA 3JAMY 4CGFA 3M3ZA 4CEFA 2DGOA 4DJBA 2UXBF 1JLEA 1E6YB 3L4BC 3V2UC 1WOOA 2AYBA 1GX5A 2L3MA 3FVYA 1NUEA 2HBMA 4CO1A 4OYMA 5G0RA 4EMDA 2B8PA 1H3DA 2CQDA 2A6MA 2LEAA 3AA3A 1V5IB 3R5JB 1SC6A 2XHWA 4NYZA 2MLZA 3RBZA 3M8PB 3TNVA 3NEKA 4PG4A 1EQYA 4QYZK 4X4VA 1TAUA 2R7XA 2GBZA 4HUFA 1BQNB 1JLFB 3S1TA 4BRPA 1GFWB 3MPVA 1WEYA 3WC0A 3GE9A 1UEUA 3BR8A 4LSZB 4BRLA 2PC6A 2ZF5O 4CJKA 1KTVA 3CDEA 4LF4J 2MTLA 1N36K 3Q8QB 3KHYA 1YITS 5J2QA 4IO8A 2HHQA 5FLXU 2B56A 1OS5A 3W61A 4F0HA 4DUZJ 4IFYB 2AP6A 4CTAB 5IS2A 4YFUA 1ZBHA 2GTDA 2YV0X 4IH5A 3T69A 1C4AA 1U1RA 3PUFA 1NJYA 4K4SA 3GWCA 3DNCA 3O4NA 4V19S 1LW2A 2CZ9A 4KAIA 3W62A 1GNKA 2YXLA 1RHUB 3MCMA 1GLEG 3KUGA 2KHOA 3FZMA 3OW2M 1Y5IB 1KVBA 2HGNA 1VBKA 3PY8A 2XSFA 3O4QA 3M2VA 3OYDA 2DIVA 2XI2A 5ETKA 3X3UA 2G2YA 3MD3A 3R97A 1S1WB 3DRPB 3W7BA 1R89A 4CEOA 3H45C 4DTNA 4KTWA 2WONB 3KXDA 4X4UA 1BHNA 4KHRA 3M9OB 2AEJA 1VQ7S 4H4MA 4W5QA 2Z8QA 4RL1A 2YNGA 4ZP7A 1NAQA 4NCAA 5KT5A 2XMJA 3DXKB 1LOTB 3H20A 1L3SA 3RBDA 1FD2A 2PMHA 3CDUA 1RDCA 3K2PA 3NMAA 3DLKB 4C0BA 2JJ4D 5CYJA 4LBPA 3PFOA 1V9OA 4FWLA 3AAWB 4IOCL 4ZITA 2FJXA 4OPJA 2KU7A 2J9EA 3C15A 5TKYA 3VQQA 1DT9A 1S3XA 1NGBA 4KO0A 1T6CA 1GXTA 5U47A 2KT5A 3KJVB 4DPTA 2ZJPQ 4BRDA 4X65K 4RUHA 2VG5B 4GVBB 4KPYA 4DL0C 4G1QA 2P2CB 1VQKS 4RU9A 3A2FA 4FWNA 4DV1J 5ETRA 3O1LA 2VB6A 4WTYA 3ADAC 2XM3A 1RYRA 2B51A 2ATCB 4LQ9A 3C19A 2MPUA 3D6HB 4NEZA 3VEOA 1RT3B 2WBRA 2BV3A 3MFHA 4ZVTB 3UKUB 4F4AA 3UN2A 2UV8G 4MQ3A 3ZLJA 2CQIA 4OI1A 4Z94A 3PJWA 1O1WA 4CHOA 3PW4A 1KEKA 4WF9L 5B09A 2AEFA 1JWWA 3R5AA 4CF1A 4O0IA 4CFDA 2ASOA 5HRSA 2B7BB 3GJTB 1GH8A 4FSVA 1KC8O 3AXMA 3K0SA 3CJQA 2XEXA 4ECUA 2AW0A 4CJRA 3K57A 4NPOA 4HVJA 1Z2ZA 4NLPA 5F3TA 5M1OA 3FFIB 2H51B 4IOBA 1FKPA 2KZZA 1BC6A 2HRUA 3EWGA 3EO3A 1ZAVA 5BRHA 1RAHB 4FLZA 4FO0A 2HMPA 4DR3F 5K9FA 3A5MC 2X7IA 4ZLJA 4UUXA 1ZPVA 3ENOA 5C25A 4CD1A 5K8PA 4OYZA 1CJVB 3GYNA 5GAEU 3FZLA 3GILA 3VTIA 1UETA 2NRRA 5F8LA 2F3JA 4Q2LA 2XLIA 5GADP 2GJFA 3D1OA 3AVCA 4UOCA 4PWDB 3MEGB 1WC1A 1X0FA 4OPHA 1H73A 4EWTA 4YB5A 2LXIA 4NYFA 3SIPB 3HHLB 3LZJA 4DS5A 5EWGA 1Q86T 3DDKA 2M8DB 1EP4B 1TKXB 2FBVA 2N7CA 3MM7A 2GVDA 1D9DA 3RMAA 3V6DB 1UCNA 5BJRA 4F0MA 2V8HA 1WF0A 1FI4A 4A8XA 2YNHA 3AVJA 2AGPA 1RDWX 3BKUA 3VPZA 1NSAA 3VGKA 2UVUA 2NXNA 2QWOA 3RBEA 3P5TL 3J7Z5 2IFXA 4QOTA 4C1NI 4E1MA 3A3PB 1NJWA 2ZE2A 2YWEA 4LVNP 1NM1A 1SC4B 1V5VA 4CGJA 2KI2A 3LPEA 4Z2XA 3MECB 3RMCA 4P2XA 3ZSZA 3PRVA 2VPYB 2IHR1 1A7GE 1C0TA 3QEXA 1GX6A 4Z4EA 2G8IA 3FKBA 4F4XA 3VENA 3TQ1A 4P2MA 2IC3B 3FE1A 1CZAN 2FLOA 1LEOA 1T02A 1J5EF 5F9LA 4BC9A 4A47A 3EZUA 4Q8FA 1WKJA 2MZTA 2CNKB 4N41A 4CJUA 4LF8K 3JYTA 1U0HA 3AVMA 1KHVA 3V9XA 2QEXN 3CDBA 5A0YB 1VRUB 2V8GA 5LJ3Y 2ZHBA 4HCCA 4DF8A 4P52A 5ADXH 4R8UB 5FDLA 3VVUA 1X9JA 1Z26A 4Y1DA 4IFEA 5KT7A 3W2WA 2DY4A 2F4VK 4MLEA 1VSFA 2OD6A 3QT5A 3TZWA 2UXCK 2JFDA 1WHXA 3BV8A 1RWPB 2IY5B 2C28A 2ZZNA 2IVMA 1ATSA 3WXMB 1S6QB 4UF4A 3NS5A 5KT4A 3FZ2A 2OPPA 2E5GA 1W25A 1I3AA 5BPMA 2HNZB 1PAEX 3QBWA 4P6QA 5AJ3F 3C46A 3HM8A 4PRFA 3B4DA 3W65A 1QE1A 4OYBA 3GONA 4KHPK 4I7FB 3I33A 2RVJA 3NCRA 1M5PC 2KRBA 4NA3A 3HPGA 4AHCA 3IGNA 1FCAA 3MMVA 3HP9A 4EZ6A 3UI3A 3F9MA 1SC3B 2XS2A 4JI6K 3NRBA 3OBWA 3F0NA 5GAHU 4O3OA 4IJAA 1UAWA 4CCHA 4IG3A 4AF1A 4LR8A 2CDQA 3LO3A 1NHVA 1UVNA 1EKEA 3MR5A 1S1TB 3BF3A 4C8MA 4KPCA 3EDRB 3QFUA 2CVEA 3G87A 4ID8A 2V6AA 4MO4A 4FM2A 1Q5VA 2R2SA 4W5RA 4PKHA 3CQ8A 3VN5A 4U7BA 5EOYA 2Z1HA 2MZJA 5DQGA 1RTIA 3CETA 2OA8A 2DPIA 4PPDA 3DI6A 1OY8A 3G8QA 3QMQA 2XLJA 1ASVA 3GIRA 5HO4A 3SMZA 2UVRA 3WC2A 1U2RA 2Q43A 3CJ2A 4JYAK 3OS0A 2HBKA 3KHRA 3DLRA 1MMNA 3ISND 1PJ6A 2GHWA 4LSLA 4F3QA 3EDQB 4H5WA 4CJEA 4RNHA 4K4TA 2NRWA 1C1AA 1U2VB 4RKUC 3MM9A 2KT2A 2O01C 2MHNA 8ATCB 3IG1B 1WLJA 3BN7A 4MK8A 3E2EA 2AF6A 1J6ZA 1JLCA 3NGSA 3V1QA 1DLOA 4YHHK 2WOMA 3TTFA 3HHLC 4A8SA 4ECWA 3FUYA 3QPIA 1JLEB 1CJUB 3TX8A 5HL7Q 4MYTA 3Q24A 2L9DA 4CESA 4M5KA 3FZFA 3THXA 1RBAA 2HQCA 2EK6A 3TVKA 4PPZA 4ZVQB 1GLDG 1EXQA 1U1PA 3BGFA 4A46A 4MIBA 1IBMF 2GWJA 3CCES 4DR2K 3MMBA 1E4FT 1R8AA 3SNNA 1URRA 3MEDA 1OVQA 4K42A 1NGIA 2HBYB 2YWHA 4DTPA 2DTUA 3THPA 2HEKA 4J9PA 2R3VA 3OTCA 1ZBSA 1FF2A 3WXIA 5J2QB 3BYRA 4Y28C 1N5TA 4DTOA 3T5KA 1SCJB 3M6GA 3TUIC 2RQKA 4RW8B 5M2RA 2JEIA 4DV5F 4I2QA 3ONQA 5H9EJ 1NSKL 4K4YA 3G25A 3PSIA 3KWMA 4U7UK 4ZP6A 1SIWB 1ZPWX 6AT1B 2C3PA 4DPOA 3KKFA 4NLOA 4TNOA 1PBUA 4JI5K 1BUXA 1NG9A 2HGMA 3M8ZA 2WC9A 4KHQA 1Q16B 5AXMA 4C0HA 5F8HA 4FVMA 1LW2B 3OTDA 4DBQA 5I3QA 3L8BA 3OD2A 3BO4A 2QO3A 5DG7A 3G71S 5HVGA 1SV5B 3THWA 4CF2A 1S72N 1F2GA 2FJDB 1EJ7L 4B9UA 1M5OC 4DR6K 2KTQA 4HTIA 4IDKB 2AGOA 2V9WA 2CFXA 1OPIA 2UUCK 5GMDA 3MR7A 5AQQA 3DLHA 5HQLA 3QEPA 4UY8T 4P2FA 4QIWD 4D3GA 2H5IB 1G6BA 3HKZD 1NLVA 1RT5A 2YKPA 2DR7A 2KM8C 2IJNA 1SB6A 4DB3A 5C0YA 1RBOB 5AQYA 4H4MB 4YY3F 3P5BP 4DUYF 1VC5A 3AY9A 4GV9A 1FK9B 4IO9Q 4UOGA 5AXKA 3W3SA 4N8NA 4CFAA 3NDKA 4EZ9A 2QX0A 4ZTFA 4PUOA 1RCOB 3VV2B 2HIQA 3O9SA 2W2MP 2E7XA 3NFAA 3BP8A 2BA9A 4KH0B 5LMNF 2E1MC 2KRRA 3PLAA 4FPBA 1P27B 5AJ3J 3OLBA 2HNYA 2F63A 3H2VE 3O2IA 4C1NK 4OZNA 4GMJB 1ASWA 2FZGB 1RYSA 2RQ4A 2XCAA 1XQSC 3ZTPA 3VQPA 5IWAK 1F5CA 3CIMA 2AJ4A 1OWXA 4NLRA 1KQSM 2RDDA 5JJBA 1QZ5A 3QNNA 3R9PA 1TZ0A 2BW2A 2EBEA 5D4OA 5JMVA 4WQ5C 1VR6A 1T9XA 3NL0A 1Q95G 5D78A 1K8KA 3MMJA 1RWVB 4JAXA 3L09A 4DR1F 3JSMA 2C3YA 2O8BA 2LP4A 2VH7A 1J5OB 1RWKB 3AAPA 2L9WA 2MYFA 3CF5Q 5B0CA 4JD2B 5A8WA 3NGYA 1SL2A 3HJVA 5DDRC 1IH7A 4O3RA 5H9FK 4LQ3A 1XNQJ 2E20A 2W25A 3TEHB 5JVGL 4WYBA 4NYNA 5E26A 3TPQA 1GLBG 1MN7A 3EM1A 1DTQB 4KIAA 3QNWB 4WFNQ 3ZYYX 3M9NB 1IVZA 1RDAA 4EP5A 4QWEA 4B17A 2CJ9A 4HDHA 4H0OA 1QLNA 2YH1A 4MT1A 4OX7A 1P90A 2DR8A 3FQKA 4KQZA 1TKTB 3SFUA 3HFKA 2RRNA 4DSIA 3DLBA 3AD7C 5DDQC 3FK4A 4TVAB 4ILRA 3L4IA 5J2MB 1SJ3P 1A9NB 1HNWF 5IQQA 3MPYA 3O8WA 2I9SA 1KN6A 1Q78A 5D0RA 1RAIB 3D3CJ 4FLUA 1REVB 3CJKA 4TY8B 2D3OR 3S7RA 1PC5A 1C1CA 2VG6A 2QA1A 3BDEA 1UA1A 2F8EX 3EGVA 4HT7A 4NLCA 1QM9A 1REGX 1N34F 2XMUA 2ATLA 5KFHA 2GVDB 1XJWB 2VPZB 4D3HA 2ZZMA 4AM7A 3UD3P 4DV2F 1WG5A 4MIAA 2F65A 4AFFA 2YQ1A 3LH2S 3OS2A 2RILA 3QT6A 5GAGP 3CD0A 2AYMA 4CJWA 2RQMA 4O8KA 1IBMJ 2XZWA 1HNZF 4Y2MA 4L3KA 4O44A 5RUBA 3KIOA 3NF7A 1YBAA 3E66A 4GKJJ 1AFIA 2GA7A 2KFZA 4RO0A 1P6TA 4CZGA 3KK1B 2PZSA 4IBNA 1U26A 1J53A 1EETA 1HKCA 3FMWA 4OI0A 2CUYA 2X1FA 4Q0BA 5KOXA 1BIUA 3H46O 1HR0F 4RZRA 2VQEK 2JWNA 4F3MA 4F4YA 2ITGA 4MH8A 3JYTB 1U0HB 4BRFA 3PJ9A 4USKA 4OZ0A 3MAQA 4IR9A 2ASDA 4BCAA 3AO5A 3WXLA 1HYVA 3EJMA 2LEPA 5E33A 3RRGA 1Q18A 1D9FA 1TTHB 1SIZA 1OKJA 3D0IE 1D5AA 2Z58B 4O8UA 4ZA1A 4M94A 3GE1A 2EFOA 4ES1A 3J8AA 1X5PA 2H3EB 4ZHRA 1M5KC 2D3ZA 4HI1A 3OFFA 4CEEA 1PYSB 4KB1A 3PW7A 4X64K 3TVYA 3ETOA 5K14B 5LL6d 2VGMA 4JRQA 3SPZA 3K9KA 2LYVA 1O51A 3KNAA 1HBOA 4DR7F 2HFUA 2I0XA 3O08A 2G8FA 1S9GB 1SQFA 2WZ1A 2PEHA 2P9UB 2PMZD 1JJHA 1HWKA 4JV2A 5CAAA 1F1BB 1N4LA 1BQMB 1WTFA 3TWHA 1HX1A 1F60B 1HL6A 4YY3J 3PR4A 1FRHA 2PYLA 1S5ZA 2CQGA 5FPNA 1M5VC 1RISA 2Z2LA 3QT8A 2A2DA 1S9EA 1GXUA 3SQ1A 4C3KA 1TVRA 5DK5A 3NAIA 4K7QA 3W5XA 4FLXA 2NREA 2MSTA 4RW9A 4CJTA 3LWLA 3VF6A 3CCUN 2DB1A 5C5JA 4JI8K 2Q3PA 2F8TA 2E2PA 2H1YA 2ZH6A 3LPTA 3BH7B 3VF2A 1WHYA 4CF0A 2MQPA 4CD3A 1NO8A 1HYSB 2E6MA 3THYA 2WVFA 2UUAJ 3OSPA 3ZSOA 1QS4A 4MKBA 4ZPDA 2NPFA 3N4PA 5KTQA 5D4PA 1R7IA 2QMUB 4NCBA 3KYLA 4NB4A 2NXCA 1X1PA 1Z1ZA 3PXGa 4P74A 1T9WA 2ERRA 2W9CA 2HPUA 4QWCA 3M32A 1KONA 1RU1A 3I6PA 4DR1J 1FE0A 2EG1A 4LT6A 1VBYA 4Y2KA 2ETJA 5IQ6A 4LSLB 3VGMA 2DNOA 3OHRA 2IBOA 1EX8A 4U67Q 3IWNC 1J2VA 2CQ3A 4DV3F 4KHNA 2P9KA 3KD1E 1NZ8A 4DTUA 1JK9B 5M2UA 2DNYA 1R0BG 5F41A 2XY8A 3JSBA 4NXNK 4DLEA 1JLCB 5CCMA 4FPIA 2DNNA 1KOHA 4JNEA 2IVNA 5DM7L 4ZVHA 2HQGA 1FRIA 2GWKA 1YTYA 4BDZA 3W9IA 1NMDA 2R2TA 3MDFA 5GADU 1YITN 2MLYA 5KRSA 2AP1A 3MUMP 4CGGA 3SJHA 2ZNZA 2QKKA 5M2PA 3J7A1 1BHLA 4A8MP 5AQJA 4BR9A 3NHGA 4FYXB 2DXFA 3SQ4A 3WIVA 1GMVA 2IPOB 4DV4K 1H74A 2ADCA 3I0SB 3AA5X 3MMBB 1SH3A 1FJCA 4B3TJ 1NHKL 3CCWA 4ZN3A 3SQGA 3T19A 2M3DA 3SCJE 4F7VA 3N01A 3HYFA 2EX3A 3GV8B 3O4WA 4CJ5A 1ZOTA 4F4WA 1OSDA 4K4ZA 2WUSA 5AQTA 5J1NA 5D6GA 1DQ8A 3M7VA 1I94J 4KV8B 3PZPA 1O13A 4XO0A 1JJCB 1Y9OA 4B9MA 2ZH5A 1SS6A 3VF0B 1KOOA 4QW8A 1ZBUA 2YCHA 3P96A 3CO0P 3PFEA 3HO1A 2P9EA 3DN9A 2LSNA 1TUYA 5LSOA 4OKKA 3BREA 4TN2A 1CQNA 2YQ3A 4IXCA 5B7WA 1JXEA 3W63A 3HOTA 4CH0S 3HVWA 1SL0A 1V6HA 5CHCB 1XR5A 4DF4A 1OPZA 2GIFA 1IKWB 3ZT1A 4LFBK 1M0SA 3ASMA 2VF3A 3OYLA 3Q83A 3THWB 2BJ3A 4G65A 4F02A 3FNNA 4AXIA 3N5BA 2UP1A 1WOQA 1NPRA 1KS2A 3VEZA 3CE8A 2EG2A 5AE3A 4GVLA 3MZIA 3DOLB 2WVBA 3PYDA 3KLFA 4F2RA 4JKHA 3OHBA 1IBKK 2J8SA 3R6GB 3FJ2A 2IA0A 2F9WA 2QYGA 1TK5A 4YS2A 1T9TA 2UU9F 4PXBA 4HHHA 5DETA 1C0UB 2OGUA 3QRPA 1JXBA 4AT1B 1Y10A 1NU0A 3T9ZA 5EX0A 5E41A 4UY85 3Q2TC 4XIUA 4CF8A 3CJCA 1HNXF 3HCXA 2ASYA 3EVWA 1SQGA 1EQ0A 4DV7J 5IOLA 3OYHA 1NSPA 3GFXA 1Q7LB 4EFHA 2LLZA 4PUOB 3A12A 2WBNA 4ED7A 2RD5C 1QJHA 5M1PA 3NOCA 2VDIA 2MQNA 4DS4A 3CJ5A 3TZZA 1DQAA 4USJC 4ECYA 2D0OA 3UNYA 4M5HA 2MKKA 3NGDA 4E1JA 1NRKA 2FHMA 4IOCQ 1QHTA 1MMDA 4OYXA 3GFYA 4F26A 1M1HA 5LJ5Y 2V8PA 3CJ0A 4ZK7M 3V4IA 3C6TB 5D0GA 3DMJA 5HMXA 3N5FA 4IG0B 3IM8A 3VQ4A 4C8NA 1U6BA 2UXBK 3VQ9A 3A3OB 2YHXA 3EPIA 1K0TA 3D7EO 1IJJA 1T05B 4BRHA 2DEJA 2DH8A 5LSLA 3FFKB 3GIMA 2P9NA 1HMVB 2O8EA 2Y3YA 3IN5A 3D68A 1ZTTA 5BPNA 3CYMA 1KWMA 2O67A 3JSMB 3M1VA 4JV5J 1UW4A 3RUBL 2NRZA 5L1LA 3LDNA 5EWFA 2B6AA 2EFGA 2ILYA 2GZOA 1WSJA 4CZJA 4A2AA 3FSYA 2L08A 2M4MA 1G99A 2DCUB 4DV6J 3ID6A 1K6YA 1X4EA 3T5LA 3TAMB 2D69A 2YPYA 2LCWA 3SPYA 4IKFA 1WAJA 2A42A 2CQPA 3MTKA 3VAHA 5DLGA 3E01B 1LFWA 2MEWA 1AT1B 2E1RA 2OELA 4CZLA 3UDCA 1J9AA 2AWZA 1PIEA 3TSPA 2I7NA 4IKAA 4K5SA 1GTHA 4BS2A 1VQMN 3I82A 4WWSA 5E5NA 3R7SB 1ZZFA 1N6QB 4USMA 3AO3A 4IEEA 3FC9A 2H65B 1HPZA 3GJRB 3AA4A 1H2TZ 2IJFA 2QJ3A 3D45A 2RRAA 4JI4F 2P9PA 1IBLF 3IMXA 4BRMA 2AJFE 1F0XA 5K5MA 1NGFA 3HL8A 3HTVA 3NGIA 3KKRA 2OP5A 4NCGB 3PYEA 4G1IA 1K47A 2GUPA 3UD4P 3CJKB 1S1UB 2G8UA 1TKZB 3A8JA 3WXJA 2GVZA 3FZKA 1C1CB 3CMES 4K8XA 2GQ2A 3A8YA 4XTTA 5BRDA 1VS3A 3C14A 2XO7A 1IO2A 4BE1A 2E5HA 2EWHA 1HWJA 4FZZA 3CJ4A 4NMLA 4K5RA 2VBXA 2ZHAA 1YKWA 3CIZA 4FLWA 1BD6A 3DGPA 3HX9A 1JIHA 4WK3A 2XB2D 1FJEB 2P9LA 3BSAA 1RT6B 3ET6A 4Z37A 2VQFF 3QIPB 2FZKB 1TL3A 1RJJA 5DMRA 1NWKA 1FEHA 5D77A 3NGUA 2NQPA 1I39A 4AHTA 3KLGA 1UOCA 3C6UB 4O44B 4CHZA 4GVEA 3MEKA 4IQXA 2OLWA 5LMUF 5E7OB 3AOBA 4ZVFA 2BR0A 3OVBA 1UZDA 5D3GB 4Z7CA 3FBBA 3LA0A 1NSQA 3MOJB 4JN4A 2VG7A 4KH1B 2PDAA 3T1HK 4U8YA 1IKXB 2VDHA 2ITMA 2UYTA 4ICLA 4Q0BB 2KB2A 4RW4A 4LFAK 1ICEB 5EUHA 1FDBA 3DM2B 1ZM4A 2DJWA 3SUQA 2UUBK 1FKOB 4H5TA 1GLAG 5A6WA 2LA4A 1KFSA 1VOMA 5CZVA 1XUPO 2ZUGA 3HHKA 5J2PB 3G0ZA 4BGBA 2W7AA 4F36A 4M5LA 2JOQA 1X4FA 3MFIA 1C0MA 4ZVRB 3CO9A 4OYAA 4ZHRB 2FJEB 3KWGA 4GW6A 1F3VA 4ILHA 3TUPA 2DH9A 3Q86A 1SKUB 2DY1A 3PX4A 2QM1A 2AHOB 1NM2A 3J7AN 4KH5A 2DHXA 3GOIA 3Q8RB 4W5NA 1MNEA 2ZC4A 4H0VB 4HACA 5F8GA 2CQCA 2CADA 3NGKA 5B0EA 2WFBA 2FUG9 1N32J 1Q81T 3NCPA 3FBFA 4P9SA 4FXDA 2BRLA 2HHVA 1CEZA 2CQ4A 4FVCA 1RBLA 3K7RA 1HNXJ 1XK8A 4DR5F 4WFZA 1S0OA 3DU6A 5E2QA 1D8ZA 1XHZA 4DR3K 3DXSX 1TVRB 3OR2A 4UQGA 1WG1A 3K5NA 3OXFA 4M5NA 3OY9A 3SI8A 4QW9A 2DNRA 4NI2A 3H8YA 4OV1A 4DPUA 2OH2A 4DCJB 1BL3A 1B0PA 3IFEA 1CZ9A 4OI4A 2PA8D 4A62A 3THYB 3ZFVA 3I5BA 1FJGF 4QYZJ 1X9SA 3QSIA 2XYHB 4IFVA 4ILJA 2BQRA 2GW8A 1G3OA 4DOZA 1TL4A 1WC4A 1NGDA 3VTHA 1NDKA 5CQGA 4Q44A 3QINA 4R25A 4ES3A 3SDEA 2O4IA 1X4HA 1N36J 3E9OA 3VGLA 1QTMA 1TUUA 4OYPA 4WQ4C 1JLGA 2HS4A 2V67A 2R4FA 2FVCA 4F3OA 2CIMA 4H4OA 2FD2A 2V2QA 4B08A 3OFGA 3CCEN 3DOMB 4KY3A 2V8DA 4LR7A 2IMOA 4WZMA 2WVCA 1R8BA 3RJMB 1ATNA 1BI4A 1F2HA 4S0MA 5KFPA 4USVA 4USUA 1HHQA 4FYVB 3ZT2A 3VQ8A 4X4TA 4J9SA 4YMEA 2QT7A 2DHGA 1FFWB 4K59A 1WBBA 1CJTA 1J5EK 5KFZA 1RT7B 3P1GA 4TYBA 2GV1A 2VC0A 4OVLA 4KGMA 3KK7A 4JV0A 3BZCA 4DQSA 3NF9A 5L1KA 1T6DA 2CGKA 3SBGA 4OL8A 4DUTA 1VRQC 3QJLA 2E2QA 1N5QA 3IM9A 3X1LB 2D1CA 3GSIA 2GJ2A 4NYPA 3OLAA 3LM9A 4DEZA 5GAGU 3AXKA 4DFJA 3HT0A 3NXZA 5KFMA 4O0NA 3C65A 4BR4A 1OH5A 7FDRA 5A8RA 3HSJA 2IVPA 4J37A 2LDIA 5C2FA 4HUEA 4JI2K 2HLUA 2WTFA 2Y0BB 3EVMA 4ILLA 1SKWA 2EK1A 1WNSA 4ZCLA 2F8HA 3S3NA 1EZZB 2VQFJ 4FYWB 5B0AA 4DL5A 1VSKA 4B9TA 1FX4A 1H7XA 1QVGR 4HL9A 3D67A 5B08A 4G9ZA 3SZ2A 4X65J 1FEEA 1WG4A 2VBYA 3PIOQ 3V81B 4YDXA 1UJ5A 3CCSS 1RAEB 2O8CA 1UVKA 2YJFA 2YHYA 2ZNYA 2O5DA 4OGEA 3SCXA 3KLFB 3CT9A 4YQWA 4N76A 3FZHA 3GG0A 4DLGA 3HF5A 4DL2A 2C42A 1CVJA 1QDUB 2F9TA 4C8OA 3G96A 4ANDA 1C1BA 3Q8PB 4OZJA 4OX6A 1LV5A 4NMXA 3UCUP 5MLCQ 1HBNA 4AQYF 5LXYA 4B3OB 5AQLA 3MPUB 2E4LA 3L9ZA 3QWUA 2LVWA 1VSEA 1KHWA 2I5JA 1FRJA 4CLFA 3UKRA 4U7CA 4M5IA 1KNZA 5IXUA 2P6TA 3R5CA 1SPBP 1I5OB 1VHFA 1GLCG 1YRTA 3D4JA 4J9OA 2N4CA 3HHDA 3TAQA 1UKUA 2HVHA 2H5JB 2W7PA 4LF6K 4CECA 1HI0P 2R8HA 2D9PA 5ETPA 3AA8A 4B3MF 3H0PA 2QWPA 1YRUA 1BOTO 2HWHA 2J9CA 1FDAA 2A2CA 2DGVA 3UCGA 1SZ2A 4Z4FA 3I0RB 4MMOA 4LY7A 3OSNA 1IR0A 2MHEA 3DAWA 2QMWA 4I9LA 5IC4B 3HP6A 3AO1A 4QR2A 2L48A 3MCPA 4BC7A 3SMPA 1Y5NB 1N0UA 3BF1A 4L3NA 1RT4B 1L3TA 1XR7A 1VQNS 2P9NB 2BDPA 2FSNA 3NGZA 1L5UA 1VLOA 3IWLA 3M2RA 4YDUC 5KQ8A 2ZJQQ 2B6AB 3F2KA 4HYKA 2OPQA 3PYGA 5IT9O 3A5NC 5J1EA 2GO8A 4ZCMA 2J6UA 2HHHF 3SLCA 5A2QO 2X1BA 1F6TA 1LW0A 4TKTA 4KTZA 3DRRA 2XS7A 2YNIB 4CH7A 4CO3A 4BRGA 2R7WA 2XCPA 5KFSA 5KFUA 1K1QA 4ZDNA 5B0DA 5AQXA 4J9VA 5E3CA 3DRSA 3K2YA 4Q43A 5JVGQ 3FBEA 2CYYA 2RHKA 4QS9A 4FPRA 3JTPA 4DV5K 3NF8A 4MKAA 2JFKA 5IC6B 2RUSA 5HN0A 2ZEJA 3DXMB 3L3VA 3AVKA 4YP3A 2YKMA 2F1FA 4OYIA 4LF8J 3MF5A 3O9RA 2GX8A 3CSKA 4EO6A 1LCUA 1VI7A 2MMYA 2OO4A 4EIAA 3VOVA 1DRZA 5LJWA 4B9LA 5CA5A 5IT9Y 3C14B 2F4VJ 2V4JA 2G8WA 2UXCJ 1Y5LB 3LQVA 1YK9A 4IYQA 1M1KO 4C2MA 1PJ7A 3JTNA 3LP0B 3TA2A 3LDLA 4ID1A 4X62F 2P9LB 2BANA 2HK2A 5CABA 4OLBA 4RJVA 3CI5A 4HWIA 1BE4A 1QHAA 3B6BA 2ZD1A 3KLGB 3GU0A 4ED3A 4DUYK 2D7SA 4KHPJ 3DHWC 4JI3K 3GIIA 4KE5A 4KB7A 5IWAF 1XEZA 4RUCA 2WHOA 3QATA 2F7TA 2E8AA 1VQ6N 2CPHA 2AZ3A 3OYIA 2VG7B 3ZSYA 5HMYA 1E6YA 3P8BB 2DGTA 4O3NA 4RX6A 3HT3A 4JI6J 1VSLA 4CHYA 3LPYA 5LMNK 4RW4B 4I6YA 1RTZA 1FE4A 2G1DA 2E29A 4Q2MA 3UFCX 4RWWA 4DHVA 1DFDA 1O5JA 3EY1A 1NGAA 1Q82O 3M6WA 2B43A 3RU0A 3VHQA 1BGXT 5ETSA 2R8KA 4DX8H 1JLFA 2C3OA 3K17A 3OYKA 2H5EA 1ASUA 1YAGA 1U0SA 5A6PA 3LPUA 4JKFA 4G3IA 2IM0A 1XMOF 1HKGA 5KFAA 2B9EA 3M05A 1S6PB 4DR1K 1KBRA 1YXQA 5C12A 3O8MA 5K8OA 4XEIA 3IC1A 1Q8KA 1OYDA 4JYAJ 1PGZA 1OO0B 2HMIA 4MFBA 3M6UA 4HVZA 4WIQA 2AKWB 4IFYA 4CTAA 4E0DA 1MLAA 1T03B 2Z2YB 4CM2A 2IDLA 4RNOA 4JUZA 2OFGX 4ZPVR 2WRMA 3IBWA 3SQ0A 3G6EN 3OYGA 4PAAA 5AQUA 3GCXP 4FJMA 1FWKA 2CQ2A 3QEIA 3IWXA 2D5RA 2MGZB 5B0FA 4NZ0A 1RNHA 4YHHJ 3CC2S 1RWUA 3M8QA 2G13A 4GMKA 3NWGA 4RLEA 1ZETA 3OTOF 2YI1A 3KK2B 4LR9A 3CCQS 3O44A 1GK8A 3R1HA 2FBTA 4WKYA 3TAGA 1PC4A 4NI2B 1WSIA 1BA0A 4A8YA 4AHRA 1GOBA 1HNWK 2BOAA 4LF7K 3BQ1A 3EGNA 1VSDA 2WONA 1MU2A 3MCNA 1HYZA 3CMAS 2CJYB 1G2EA 5B8HA 2JGUA 2YKAA 3O9QA 1EKSA 3UO0A 1S0VA 4IUFA 3KDNA 2AIRB 4ED5A 3HLUA 4DZDA 2DGUA 4DR2J 3VVTA 1LNQA 3DXKA 3OQ2A 4DQQA 2HK3A 3CC7S 1T94A 3LDQA 1BA1A 1N34K 2XMTA 4X4PA 5DQHA 1R0CB 5AZJA 4K4WA 4DV2K 5G4DA 1U4BA 5FPEA 1KQKA 3SFGA 1U1MA 1H38A 4AL7A 1RA7A 1PO6A 2QLBB 1AZSA 3V6JA 4E7LA 4H4OB 2KH9A 4CEAA 1HNZK 4O3SA 3GV5B 3KJVA 3TJAA 2VG5A 1IQTA 4PG6A 4JI5J 4LVOP 4KTQA 4R79A 1NJIO 3V1RA 3MXJA 2PE8A 3NWRA 1ZZNA 5EVZA 1ULRA 1VSMA 3TSUA 4C97A 2BUNA 3VF4A 1RT3A 1O8BA 2ROGA 4DR6J 1HR0K 3OA9A 1PBAA 1CJTB 1CSJA 3W1YC 5FLXO 4CBUA 4DR4F 2UUCJ 1E6VB 2W2PP 1RGIA 3U1MA 1VSIA 2NYIA 3R7BB 2E1AA 3AVNA 3J80O 4EU0A 2DKOB 3ULEA 3FCHA 5KI6A 3OYNA 1UA0A 5JUMA 4J7CA 2GFFA 3PRBA 3ENHA 2HFVA 1VIOA 3H08A 4WFNL 3FGVA 1MDUB 5EGYA 3VQEA 5AQFA 3BKFA 3FFIA 1Q9YA 3DFEA 2JH3A 3A3NB 2WAQD 2V4RA 1X4AA 2V2KA 1FFGB 4JKAA 1Z05A 3CJ1A 1JQGA 5A8RB 2CPJA 3LALA 2UUTA 1XHXA 2P51A 1JX4A 4DR7K 2V69A 1U02A 4X62J 3OPKA 4CGIA 2BJDA 4JI8F 3IO1A 3V4MA 3H42A 1BWFO 2CZVC 2WB4A 2D0CA 3DCAA 1VQ8S 4IOAQ 2B4OA 2HQ3A 4YOWA 4E2FB 4K0KF 1NK4A 2D0BA 5IWAJ 2ZVIA 1WKKA 4IR1A 3KUEA 3J7YP 3AVAA 3HHLA 2BKNA 2FC8A 5JLHA 1PSDA 2K7KA 4KBOA 1B64A 1S7HA 5F1XA 3VAJA 4F9OA 2YHBA 3HHNB 3CCJN 1FRMA 3LUYA 4AILC 3QQCD 3NCIA 2X1GA 1TFWA 3OVSA 2HBRB 3V6DA 2BJ1A 5F8MA 1A5VA 4DQIA 5LJVA 2QFIA 3H3OB 4MK7A 3GR1A 2ALZA 1YIJS 1VQYA 1DJ0A 3T9NA 4JI1K 4RR5A 1IR2A 2DNPA 1T9YA 1C1BB 2A40A 3I55N 4M7XA 2JHEA 4GO7X 2I6WA 2HBLA 2RMLA 2ZDPA 1HBNB 3UPFA 3WT0A 2PN6A 2BKOA 4GKKK 1U24A 2G8KA 2WVDA 3MM8A 2RT3A 4ZPWR 5H9FJ 3MECA 4QIEA 2OTLS 2I5JB 1IR1A 3KKSA 2QC3A 2A1RA 5I3UA 3D9BA 1CPZA 1ZBFA 4BWMA 1WORA 2HVEA 2H48B 1NPKA 4MTPA 1WAFA 2EFNA 3T1YF 5HRPA 3E9PA 3GIJA 3RRHA 1B9DA 3I9ZA 4J9UE 3PO5A 1LWEB 3TABA 1XR6A 4DV3K 2E9ZA 4P7VA 3D0GE 2VASA 5A0YA 3D54A 1VRUA 1SL1A 3S9HA 3O3FA 4YOTA 2DH7A 4R8UA 2E6LA 3CCRN 4CM0A 5AQSA 5HRRA 3NH2A 1AW0A 3N79A 3UN5A 4A4JA 2KO1A 4FM1A 5FPMA 4CT8A 3W64A 5GVQA 2QWLA 2YX4A 1VQ9S 1WBDA 3AD8C 4ES2A 1A6LA 1S6QA 2RAQA 1W97L 4H54A 4PZVA 4ECQA 4DL7A 3IP0A 2NZTA 3EICA 3BQ0A 1ESVA 3QERA 4PQAA 4M3RA 2VFRA 4KT0C 2W6LA 3PNIA 2QLWA 3BS9A 3ILIA 2QGFB 2VA3A 2IIRA 2BJ9A 3DLJA 2RDIA 4DSFA 2HB5A 4LF1A 1WNEA 4O5FA 2C2RA 3CQYA 1UVIA 4CHQA 3KG0A 4KAZA 5KFNA 3KLEA 3OVNA 2ZH7A 3KK3B 3H5SA 3CMEN 2Q79A 2RKIA 1H0HB 1IWAA 2OD4A 1K73O 2EEYA 5CYMB 1L3KA 4BY9C 3CDWA 1D9AA 5DZ7A 2MLXA 2MZRA 1WN7A 2FJBB 3U9ZA 1KAYA 1I51B 3TSQA 3AQOA 2N3OA 2O8DB 4H5VA 3H4DA 1LXNA 2V2VA 1QSYA 4ISFA 4J2AA 2ZHOA 1S59A 1QZ6A 3LGHA 3TX0A 5AXNA 4JLHA 3QJJA 2D74B 3TR5A 3J81Y 2OMLA 2C3UA 4BR7A 4U96A 2OANA 2RHQB 3VZIA 3H2LA 1UEKA 3CG7A 3W5YA 4X4RA 2V4JB 2K3KA 4CK3A 3TR8A 1CULB 2QKBA 1G1XA 3KG4A 4CEZA 3VWSA 4X64J 2ZH8A 3D7SB 3LGNA 3EL2A 1KVJA 3SSRA 2UU9K 2BANB 2PI4A 3HI0A 1X60A 2CNNB 1RBVA 1YBTA 1EARA 3ZNJ1 1JKHB 1SKRA 4YOEA 3MWTA 2CNOB 3TZXA 3IG1A 3SXLA 1ITPA 1HNXK 3QGGA 4FJGA 3KTQA 3CB4A 1MWZA 4M3XA 3GR0A 3D6RA 4DCHA 5HK4A 1VAZA 2OEMA 3VAMA 3D2EA 2IM3A 4W5OA 4LRAA 1TGOA 4RW7B 1CJUA 3ILJA 1GTEA 5A8KB 4QWAA 1ZTWA 1RHKB 2J7KA 3D0HE 4LC9B 2R7UA 2HHWA 2VICA 3GPAA 2A3ZA 3UNGC 3UCZP 2QL5B 3VZHA 4FPAA 4CNYA 4JI8J 3PW2A 5HATA 1UZHA 4OZLA 4CP5A 1T7PA 3QDKA 5KFCA 4YORA 3JQKA 1VQPN 1F21A 4X66K 3ZTSA 4FWRA 4CJQA 2OFHX 2RIJA 2HYIB 4IH6A 3QETA 5MAOA 3FRZA 3VGTA 2RF2B 4BE0A 1YJ9N 4OHZA 2PO4A 2OMOA 4B3SK 2ZH3A 2LMIA 3FGUA 2HNDB 4RW8A 4CE9A 4LF9F 1RK8A 3BSNA 2VFSA 9ATCB 2XMKA 4C8ZA 3RWUA 2HMIB 4MFBB 4PG5A 4CRJA 1B7FA 1X5TA 4CJ3A 3GYGA 3OVAA 1VCTA 2BEFA 2W6KA 3IAS9 4E7JA 3I56N 3I8BA 3Q8SB 3OJUA 1TL5A 2K2PA 2EC0A 4QZVB 4DFKA 5CH7B 2JWLA 1N5SA 2HHXA 5KG5A 2IYGA 3KLVA 1T3NA 4NXNJ 1VQLN 1SV5A 2LA6A 5L39A 3PACA 1M1KT 3M8QB 4FS1A 4IDKA 5BYSA 2XY7A 4E1NA 1X7VA 2B4PA 1X5OA 3F44A 3T6BA 1T95A 2QYCA 3T1YJ 3ZETB 5E3AA 4JI4K 1IBLK 4DQRA 5IM0B 1LK7A 1XQIA 1C6VA 4YOVA 3R5GA 3EPGA 4CT9A 5LOQA 4FJNA 1X3NA 4FZVA 1MU2B 3VQTA 3V5RA 1IUJA 3EYZA 1N33K 3BO3A 1IN0A 1C4CA 4DDFA 4FJ7A 1WC3A 3BQ2A 4DV4J 3MHYA 3O6QA 3HVRA 4OHYA 3A5OC 1FK9A 3AVBA 3ALYA 3MUTP 2WB1D 3OXLA 4FKXA 4FLTA 3I5AA 2JC0A 2EVZA 4B02A 3D2WA 2HF3A 5ETQA 3HZ6A 1ITGA 1T3OA 1Z2LA 2HAIA 2QA4S 3T1HF 2ZBPA 3MOZA 2D0AA 5AZJB 4PQUA 3UE2A 3CM6A 2E5JA 4LFAF 5M1NA 2VQFK 2UXDF 3LL3A 4JBCA 4DU3A 3V9ZA 1CBKA 3SV3A 1Q82T 3POTB 3TU5A 1AZSB 2GAHC 4DN0A 2UUBF 4MDAA 3DLGA 5LMUK 2KW4A 1RHMB 2P5VA 3WUHA 2DXEA 3DLEA 4ZJOA 1MN9A 4BC2A 3VERA 2KFNA 4M63C 2DISA 2M2BA 5KG4A 4LFBJ 1VK8A 4JI0F 2FGCA 4LRFA 3W3DA 2R2RA 1TK0A 1YHQN 2D3UA 4PA1A 2ROPA 3AO4A 1RFQA 4JI7F 4WCEQ 1TYQA 2WSEC 3NCQA 2YX6A 3K5LA 1XNRK 4I64A 2BYCA 1J5OA 2EHGA 1VC6A 3E8OA 3OHAA 1IBKJ 2W4PA 1C0FA 5JS1A 5LT5A 1JB0C 2VWKA 3ULEB 2KHDA 4FJ8A 4FJKA 3BUZB 3WX8A 2VWBA 1U45A 5LSRA 3BDPA 1Q8IA 1RKJA 4Q5VA 1QAYA 4F4ZA 4JD2A 4DX7A 3RZAA 4TU8A 1RTJB 2XS5A 4B3RF 4YOXA 3Q7CA 2JEJA 4L75A 1YJWS 1P9YA 2ZWOA 5GAEI 1DTQA 2NRHA 1P8ZA 3OR1A 2E9RX 3MM5B 2RU3A 1H98A 5KT2A 3MXHP 1F9EB 2ZQBA 3RB3A 3H40A 5AQPA 2GGPB 1KSPA 3ZZTA 3ZZ0A 4FWPA 2VPWB 4RBTA 2QTWA 1TKTA 1UFKA 3F9KA 5CE3A 5BRFA 3H25A 4KGZB 1FD8A 2BQ3A 3PCOB 2I38A 1AROP 5J2MA 1Q8LA 5AFUA 3U9DA 3HSZA 3AVFA 4AXJA 4CEDA 1OH7A 3NE6A 1BIZA 1KTQA 4KJIA 4UT4A 1REVA 4M8LA 3AB2B 3PR5B 1SUQB 2LFVA 4PKIA 4DR5K 4TY8A 5E84A 1VQOS 1MW7A 1XMQF 4X2BA 3M2UB 1WEZA 3ENQA 1YWXA 2Q1NA 4C9DA 2UXBJ 4ED2A 4FXWA 2R7RA 2QI2A 4FZYA 5EN1A 1XC3A 2HKEA 2Z0GA 4M3YA 4ZN1A 4DTXA 2QL9B 1RWWB 4KI6A 1F5AA 2JC1A 4IDHA 4UOFA 3ID8A 1OSCA 2QEXS 4C11B 1NJIT 1FJGK 3JXUA 1NKEA 4LF2A 3OT9A 4M5GA 4I6AA 4JP8A 2W2NP 1HD0A 3CM5A 2X51A 3MM8B 3ENBA 2AJ1A 3KK1A 4FL9A 4FN5A 3PV8A 4NXMF 1A5WA 5I3UB 2AT1B 2ZM6F 1VQNN 1NJXA 4TQRA 3EKUA 3O3LA 3H1VX 3BJYA 1HI8A 1H2VZ 1P1TA 3L7OA 4DFMA 4DQPA 3M5RA 2GIQA 5HBMB 2CJKA 3MMAB 5BR8F 3NAHA 1D8YA 1EKRA 1VFJA 4LRDA 2BGGA 5C42B 5IFMA 4ZTJA 4MO5A 4AH9A 4I2PA 4DQ8A 5KPRA 2O8FA 2K3IA 2RN2A 2N7YA 3ISZA 4C3LA 4CEQA 1J54A 5K14A 2QW9A 1TL7B 5EWEA 3KZBA 4JI2F 3C2PA 6FDRA 2NUBA 2RJZA 2BACA 4EBEA 3GDQA 1HBMB 4KGVB 2KLAA 1S9GA 2KVQE 1IKYA 5GAHI 2W9BB 2P9UA 4BQZA 2P5GA 1BQMA 4EYIB 4HCBA 1YJRA 5KFOA 3AY0A 4IOXA 4A8OA 3KLEB 3LDSA 5JXSA 3U1NA 3B8AX 2W9AA 4K8RA 5HP1A 3VAKA 4IH7A 2X78A 5H1SQ 2RKIB 2ZH2A 2J0WA 3OFEA 1G15A 4YR2A 4MJKA 2R7OA 2J8AA 3AVHA 1GXLA 1YI2N 1IQZA 3T1HJ 2CGLA 1Y00A 3M6XA 4FF2A 4ED4A 3N4WA 1KR4A 2I8EA 2N3LA 3T3FA 2HURA 4LFAJ 2JLEA 2LQBA 1QAIA 2V94A 5EX3A 2UUBJ 2KXNB 4JV1A 2A6OA 1HYSA 1F3FA 4K8ZA 1LKZA 4L72B 3L6QA 3KMQA 4PYDA 3BO2A 4RWXA 3Q89A 1RBTA 5ADZA 3VEVA 4WFBL 1NDPA 2OEKA 1YX2A 4OHVA 1BDGA 3N4QA 4LFCF 2XNRA 4UQTA 1HFEL 1EWQA 1RCXB 2FBYA 5E3QA 1U6ZA 2O1PA 3RSEA 4IRKA 4YOUA 1SH2A 1U48A 2BE2A 4M3WA 1YJNN 3UIQA 1X8DA 3VQ5A 3P5JA 4KH6A 1NKCA 4LF6F 2GMJA 5KFBA 4AD6A 1RKIA 2A10A 2HWTA 4OZ5A 3EXCX 3U8XA 3K89A 4AQYK 4Z7YA 2DCLA 4LSNA 3THTA 1JCEA 4V1Ak 2XWYA 4CK1A 1DAXA 2XGPA 3QT7A 1B9FA 4NZ7A 3IGVA 2Q2RA 3D2EB 2R7TA 5DGBA 1WC5A 4WTOB 4DMNA 3NOGA 5KG7A 1WB9A 4DR3J 3AOAA 5LM7E 4B3MK 3O5BA 1NB7A 4NLYA 3RGIA 2MKJA 3H1QA 3J7YU 4BROA 1RXOB 2MDAA 1VC0A 3HVTA 1TKDA 4HUGA 3TVZA 1HW8A 4K50A 2ZKTA 4XPEA 1JMTA 4LRBA 3SUPA 2VU5A 1UP1A 4W90B 1PYTA 4ELVA 4XH1A 3PW0A 1RE1B 2XNQA 3I0SA 5CD4A 2HRYA 4WE1B 3N9UC 4Y34A 1K73T 3F73A 4QR0A 4C8KA 2HOEA 1D4XA 3OYEA 4MK9A 4TXSA 5GMEA 3OYAA 2GNKA 5I3PA 1S72S 1N54B 1V3SA 2MY8A 3WIUA 1D09B 1N56A 1GMUA 2MJNA 4KBIA 3QSYB 4MIWA 2DVIA 1MWQA 5BN8A 4DV0K 4KV8A 4F0KA 2BJ8A 2RRBA 2FQQB 2VCPA 4ZP9A 2HBJA 5HANA 4OKEA 4DFPA 2PGCA 4NLXA 5F0WA 3SCIE 4CZKA 1UVLA 1UMJA 4DXLA 3DOKB 2HHHK 3PIOL 4ZJQA 1NXIA 2ASMA 3G4SN 2NRVA 5CZXA 2X3DA 2KHCA 3ZC4A 1LWFA 1ZAWA 1UEVA 1Z6RA 4RPFA 2JVRA 1E3MA 1WKLA 3BN4A 3WZ0A 1IKWA 4CO4A 2D0PA 2FYXA 2OZMA 2JX2A 2RH3A 3ZSVA 1PG5B 3CC7N 1FXLA 3HDSA 3GQCA 1O6XA 4TY9A 1BWEA 1RTDB 3PX6A 3RMBA 4DL3A 2FVSA 3DOLA 5GMKa 3OS1A 2GEMA 1N88A 4KHSA 3AJ1A 3QGIA 1J5EJ 5DM6Q 3E1YA 1JLAA 3M8SA 2YNFB 3VESA 2RS8A 1C0UA 1P8GA 4FYYB 3THVA 3WNHA 3UD5A 2XMVA 4H5RA 1RT1B 2DNKA 1NMEB 4C98A 4M5MA 2NLWA 3OBIA 3CFRA 3GFZA 4HHJA 4JI3F 3CCVN 1ROFA 3WQTA 2H3GX 4JS5A 1R27B 2D41A 2XG8A 5DO2A 1U1KA 2BKPA 4USTA 1NDLA 1QQNA 4M5JA 3G6XA 4DG1A 3W2VA 2P9CA 4DSEA 4EP4A 4OX8A 4BBYA 4C6AA 4X62K 4PQUB 4LIWA 3D1HA 1V3ZA 4ZLNA 2NUHA 4JI2J 2VA2A 4YDDB 5KFGA 3AJ2A 3D3BJ 4FNIA 1X3MA 3DLGB 5IT9U 2E2OA 1EQMA 4DL4A 5L9XA 3C6TA 3SSQA 2IA6A 1ZC6A 3SAGA 1B0TA 5L1JA 4IG0A 3H90A 3RB4A 4NX9A 2IRYA 2FJAB 3DLEB 4N47A 3CNQP 5KFWA 2W40A 4IQMA 4WYWA 2HHSA 3EKSA 3SUOA 1R6YA 3HSGA 1WSEA 4ED1A 2D1KA 1QVGM 1T05A 3JS9A 1Z25A 4LF4F 2ZJQL 3EGWB 2HSEB 4Z4HA 3UDEA 2QWQA 1HMVA 4Y1CA 4KHWA 2AYGA 4ILGB 1LWCB 1YBUA 1TYQB 3UR0A 3Q2SC 4H8KA 1X31C 4L76A 2KDOA 5D4NA 2ZFHA 1IKVB 4W5TA 2FHJA 3KNGA 1NEEA 1XBWA 2OYQA 5C10A 1DQ9A 3L4QA 2XYGB 4FK4A 4NRUA 3CC4N 3DYAA 3TAMA 2ZDOA 4URGA 4P71A 2CPDA 2A0FB 4N5SA 2Q1LA 2CDRB 4I68A 2GUIA 2GV9A 1HI1A 3UWTA 4LF5K 3E01A 2JNJA 3A8IA 5KRTA 1GMWA 2LECA 2RSQA 3CERA 1NCLA 2P1JA 1DHMA 3OR1B 1XMOK 3CJBA 1WI8A 4DPWA 4JOUA 3TTDA 4DX5A 1ZS6A 4QIGA 1N6QA 2ZH9A 2Q6BA 1I3OB 2AEMA 4LF6J 4ED6A 4WQ4A 2VKRA 2MQMA 2KJVA 4OLAA 4LF7F 1IG8A 3EE9A 1YSJA 1Q0NA 1Q8BA 3ENWA 2Q6CA 1Y3KA 4NCGA 1FXXA 1S1XB 1S1UA 1S49A 1TKZA 1YVFA 2FDNA 3I4HX 5KFIA 3BKTA 2E5LK 1U8SA 4LMZA 3HFZB 2JRSA 3MR3A 3OTOK 4HDGA 3O9TA 1UVMA 3DDIA 2HS3A 3HKWA 3O5TB 5AXLA 3O3GA 3HSCA 1X4GA 4NASA 2OIHA 3PHEA 3NMUA 1B4SA 2W7OA 2MKYA 3LAKA 3HULA 3TZYA 1YT3A 2MZSA 1RT6A 3QIPA 4CI0B 2E66A 3L2WA 5B0BA 4FJ5A 1MG7A 4FK0A 4DX6A 3C6UA 2XHBA 4CQ1A 2KXFA 3SI6A 4UOHA 5AR0A 2N4DA 3WDOA 4DV1F 2VPXB 5D3GA 1QSLA 2V52B 2LEBA 3QO9A 5KFFA 5HVHA 3TO8A 1KXPA 2BABA 5CY4A 1IKXA 4JHDA 4N8OA 4HH0A 1S4FA 4H03B 2AJQA 3A8KA 2NNWA 2JWKA 3FMBA 3QGHA 5EU7A 3TAFA 4CLUA 1IWGA 3TI0A 4DV5J 3K0JA 3ZX3A 3DM2A 1VQ4N 5AQHA 2P9IB 1FKOA 4BVOA 1KC8T 2DR5A 3JAMO 3ZTQA 2XSJB 4UTGA 4P72A 2H54B 5J2PA 3F56A 3E9LA 4QU6A 3MR2A 1HRHA 2G2ZA 4K41A 5KPTA 3QEWA 3TYTA 4I2PB 1BQXA 3HFVA 3RG6A 3S41A 4Q7AA 4OO1J 3E51A 2O8FB 3IRXB 2DD8S 3U3GA 2EKYA 3KWIA 3G6YA 5T41A 2FF6A 3AGKA 4I6MA 1TL1B 3JQMA 4DR4K 2E9TA 2DHSA 2RU9A 4BDPA 3LGMA 3D2FB 4CLYA 3CD6N 4CIOA 4EBDA 3W8GA 2ACYA 2OTJS 2WW8A 3A13A 3CCUS 1PJ5A 2IM1A 3KUHA 1HLWA 1IKYB 4WXOA 5KQDA 3PX0A 2IRXA 4WFXA 3ZT4A 2P9SB 1RT2B 3ATUA 2G2OA 4BRIA 1APSA 4DUYJ 3VGSA 4WP3A 3W9HA 4HTUA 4JI3J 5HP1B 4DU4A 2NZCA 4E3SA 2CA9A 4Y2AA 5KT6A 1K44A 4FM0A 3HPHA 5CYQA 3ENVA 5AE2A 3KJQB 1YJUA 5AQNA 3L2UA 2DO0A 3L3UA 5ETVA 4URQU 1FRKA 5LMNJ 5KFJA 3ZSWA 2RDJA 3IDHA 4OJ3A 2IVOA 1PILA 1IJEB 2QLFB 3B82A 2EKNA 4JI1F 4K0KK 3EN9A 3VEYA 1S7IA 2OZSA 4NZ6A 4CJFA 4A8FA 1HWLA 5BN9A 2I2YA 4CDIA 4ZS6A 4PL7A 1EB0A 1QY7A 3HSDA 4GKKF 1HW9A 3OL8A 2V5HG 4ER8A 2EBGA 3G9CA 2NS1B 4KI4A 1S10A 3U27A 1P9QC 1H2UX 2CPFA 2BE7D 2FTRA 3RSEB 4PY5A 3D6FB 2B9XA 8AT1B 5F8IA 5T7BA 4U9RA 2BE2B 4E89A 2HZAA 4CBWA 3QGPA 2COLA 4YDUA 3EXYA 2Z30B 3VAGA 3MPWA 2C2MB 3CD7A 3PJXA 1N52B 2KVIA 2IRUA 3IA0A 1EX4A 3HXMA 4HEA9 3EX7B 4X4NA 3J80U 1NOZA 1RCHA 3A5LC 2F4FA 1TAQA 5GADI 3A8EA 4F25A 2FHKA 2QWMA 1JJ4A 4LSNB 3DOMA 4ANCA 4DI6A 2LU1A 3PIPQ 3FSXA 4Y3CA 4IO1A 5E0OA 4JK8A 3N6MA 3G8TA 2D3O1 3GTYX 2DY9A 1Y7PA 3HVAA 3AA9A 2Q3SA 4XDCA 4AUKA 1FRXA 1KQGB 2J4RA 1BG3A 5C2DA 4FZXC 1HHSA 3TAEA 3T1YK 3EE8A 3GJQB 4YB6A 4KGKA 1RT7A 3QBXA 1HBUB 5AZIA 3HVTB 2OCEA 1CLFA 4FVUA 3RW6A 1RACB 1XTZA 1NK8A 2BW7A 1NGHA 2QE5A 1OVYA 5KFQA 1RU2A 1HNWJ 4CHNA 4ELUA 4LF7J 1NK6A 4LBIA 5SUHA 2QXLA 3MN9A 3GFHA 2XWXA 2ZUAA 4MKYA 3OUYB 3V6KA 2YX7A 4QWDA 2CAJA 1VHXA 4CYUB 3CWJA 3P31A 2GHPA 3EZOA 5F0XA 4DCOB 2RPIA 2H4YB 1FTRA 2HQIA 3PG9A 3I31A 1V4TA 4JKDA 2ATQA 1HNVB 4O4GB 4OLOA 3PKYA 1N34J 3OL9A 4YB1P 4CERA 4DHYA 3GG4A 2MZQA 4P75A 2CNLB 3ZZUA 1IM6A 1WHVA 3UW1A