5HROA

Structure of hiv-1 reverse transcriptase in complex with a dna aptamer and an alpha-carboxy nucleoside phosphonate inhibitor (alpha-cnp)
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
551
structure length
551
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HIV-1 REVERSE TRANSCRIPTASE P66 SUBUNIT
publication title Conformational States of HIV-1 Reverse Transcriptase for Nucleotide Incorporation vs Pyrophosphorolysis-Binding of Foscarnet.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate bh10)
molecule tags Transferase/transferase inhibitor
total genus 145
structure length 551
sequence length 551
chains with identical sequence C
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2016-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 5hroA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5hroA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5hroA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5hroA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5hroA05
4ELTA 4KV8A 4BE2A 1BCMA 2HHTA 4M41A 3KK2B 2F8EX 4RU9A 4KHWA 3OY9A 3SUQA 3VQ9A 4AH9A 2JEFA 5KG5A 2HVHA 2QKBA 1JXEA 5DG7A 4H4OB 4F4YA 2J6TA 3NMAA 4O44A 5F9LA 1C1CB 2EX3A 4KTZA 3OYAA 2P5GA 3MECB 4QOZB 4DTMA 3T1AA 1J5OB 3ITHB 3O4NA 3U3YA 3DLKB 1RT4A 1BI4A 3HXMA 4DG1A 4F8RA 1VRUB 3L2VA 1RT3B 2OPPA 1U47A 5KT4A 3PX0A 3ZT2A 3N6NA 1CXUA 1T05B 3DRPA 2G8UA 4HTUA 1N5YA 4CE9A 3C6UB 1C0UA 5D3GA 1T03B 1HYSB 1KVAA 4Z4IA 3LZIA 1S1WB 4FS1A 2FJVA 1MMLA 3AO2A 4RNOA 1S9EB 3TAEA 3VQ7A 4DL2A 2FVCA 1S1UB 2BANB 2JC1A 1Y97A 3QGIA 3MR5A 4NYNA 3E01B 3V9XA 4HUEA 1JL1A 2FVPA 4ECQA 2Q3SA 3NF8A 4OVLA 4DWIA 5L1LA 3RRHA 1C1BB 1DTTB 3BJYA 5DLFA 3MR2A 3C6TB 3ZSOA 2OZSA 5KG1A 2BE2B 4TLRA 1S1XB 4LSLA 2V4RA 4K4TA 3TR8A 4G1QA 3ZCMA 4ECUA 4EYIB 4W5OA 3EYZA 3T3FA 4YFUA 2HMIA 5KFRA 2W7OA 3SQ4A 4U7CA 4AHUA 1VSLA 4CF9A 4ZVGA 1RT7A 4FJ7A 5J2MB 4BE0A 1VSKA 3V4IA 2W9CB 3PW7A 4BDPA 3AA3A 4J9QA 1TKZA 3CYMA 3D0PA 4RW4B 1W9HA 1S1TB 2HNZB 4JV0A 4AHCA 1RA7A 3TAQA 1IM4A 1T7PA 4WYLA 3SQ1A 4R8UA 3OVNA 4J2BA 3RTVA 1RNHA 1EP4A 3CDWA 4DTRA 4FK0A 4ECXA 4JRPA 2I5JA 2YNGB 5KFDA 3K5LA 5HRPA 4NZ0A 2Y1JA 2UVVA 4RZRA 1YVUA 2E9RX 3MFIA 3LPUA 4YP3A 4PY5A 3QEVA 1DLOB 1R0AA 1JLGA 3CG7A 3ZT4A 3QEXA 3OHBA 3OYEA 3BQ2A 1WSFA 1J5OA 2JEJA 3ASMA 3OS2A 2PZSA 4CGIA 2R2RA 3NKYA 4O5BA 1GX5A 4FJMA 4F4XA 3HPOA 3L2QA 5J2NA 1KHVA 5C25B 1WSEA 2BQRA 3OL9A 2ATQA 3E51A 4CJWA 1IH7A 3PW0A 3KTQA 3LWLA 3ULDA 2FJWA 4QWBA 1RTIA 4ED1A 1CSJA 1X9SA 4IFVA 3NH2A 3NE6A 4CHPA 4KHYA 2HHSA 1A5WA 2C28A 4NCGA 4DSKA 1LW2B 4Y34A 5HBMA 3ZSYA 4BE1A 5KGXA 1JLQA 1MU2B 1W25A 4OLAA 5HP1A 4NLWA 5DQIA 4F4ZA 3TABA 3A2FA 3C6TA 3OYNA 3KLVA 5EWEA 4OPJA 2FVRA 1NNDA 3SFGA 4H4MA 4ECRA 4CF0A 5KFCA 2AGPA 4IRCA 3TAFA 2VG7B 5HLFB 3ZT0A 1SV5A 3QNOA 4DSIA 3QLHB 3KLGA 4NLPA 2DPJA 2WTFA 4NLRA 2OYQA 3SPZA 2W42A 4NRUA 3NBPB 1LWEB 3OYHA 5KFQA 4N56A 1XHZA 1CZBA 4M95A 4FLTA 4I7FB 2EC0A 4B9MA 4IG3A 4URQU 2QE5A 4LY7A 3NFAA 4NLGA 3PO5A 3OYMA 4KRFA 3MFHA 1NK9A 4N76A 4FCYA 3QO9A 2D3UA 1BIZA 2XO7A 5F8MA 4QWDA 2WB4A 3P1GA 3DOKB 3P5JA 4E7IA 1SUQB 5CZ1A 3AO5A 3PX4A 4O3NA 1DLOA 4RW9A 2AX0A 3VQ6A 4ZPCA 3NH1A 4XPCA 5HRSA 4L8RB 4EYHB 3AVAA 4ZPDA 4JLHA 3KOAA 3WNEA 1NK5A 1BQNA 3EPIA 1Q9YA 1BQMB 4W5TA 3K57A 1BIUA 3L2RA 4Y1DA 5FRMA 1TKTB 1TKXA 2LSNA 4FJKA 4NRTA 2GC8A 4TY8B 3SQ2A 4DQRA 5F8HA 4E7LA 4O3SA 5C24B 5KFBA 4DL5A 5JS2A 4E7HA 2YNIA 3CWJA 2AU0A 2RN2A 2VG5B 2RDJA 4O55A 4EO8A 3OYDA 2Z1IA 2YNHB 4ZVHA 3M8RA 5HRNA 2X6SA 3IS9B 2HHXA 4CHYA 1RDDA 3RMDA 1NKEA 2ETJA 4HKQA 5L9XA 2XY7A 4U6PA 2ITGA 4PWDB 1LW2A 4NYZA 4ZP8A 5KGWA 1YVFA 4G3IA 4O4GB 3KNAA 2G8FA 4E89A 1QAIA 2W8LA 2C2RA 4WFZA 4EP4A 2VWKA 3VQEA 3M9OB 4FBTA 3V81A 4MH8A 4DF8A 2BDPA 3ZSXA 1FK9B 1U09A 4RUAA 2YNFA 3IGNA 1A5VA 4RW7B 4CHOA 5J1EB 3N6MA 4DQSA 4DQQA 4CJEA 4IH5A 4FJGA 1HYZA 4KV8B 4ZP7A 4OKJA 3QLHA 4MK8A 4GVMA 2GIRA 3LP3A 3PR5B 2D5RA 1IG9A 3G6XA 3NF6A 4FJ8A 4ZP6A 2HHQA 1VSJA 4CHZA 1KVBA 4DSJA 2G8KA 4EBEA 2HAIA 1TK8A 4E3SA 4FLXA 1DTQA 3L3UA 1RTDA 4EP5A 5KFFA 4O44B 5KT5A 4ZTFA 2IM2A 4F2RA 3ISND 4J2AA 4CJ4A 1WSJA 3KHGA 1QAJA 4F2SA 3QEIA 1GOBA 2PYLA 1RT4B 2AGOA 3O4QA 1BI4B 4K8ZA 5FRNA 4GC6A 5KFEA 3L2WA 5I42A 3FQLA 4DL7A 4DG1B 4NLXA 4CFAA 1NK6A 3NDKA 2OPPB 4AHRA 1SUQA 4KHNA 4M3WA 3DRPB 1C1AA 5SZTA 1TKDA 1N5YB 3AV9A 4CEEA 4N47A 1NK8A 1C0UB 4MIBA 5D3GB 4LSNA 4YR2A 4Z0UA 3V9SA 4PQUA 3O3HA 2JLEA 5CY4A 3ZSZA 3HPHA 3H40A 5JS1A 1RT2A 3O3FA 4DTXA 4CGGA 1NHVA 1JLAA 1BQMA 1RT5A 4PUOA 2IJFA 1RYRA 3AVBA 1UA0A 3Q8QB 3RBDA 2D0CA 3BSNA 3KMSA 4DF4A 3BQ0A 3CFRA 1JLFA 2R8KA 5C24A 3OYCA 1TL3A 2EHGA 5KFHA 3RAQA 3HYFA 4LSLB 2UVWA 4G1QB 4IDKB 1CXQA 4BDZA 4FLWA 3GQCA 4J2DA 3H2LA 3I8DA 2QXFA 1D8YA 1UWBB 2HMIB 3C95A 1ZTWA 4PWDA 1HQEA 5DG9A 4AHTA 3QERA 1YTUA 2A1SA 1RT7B 2WK4A 3V4IB 2DY4A 5FDLA 3EZUA 4O4GA 4ID1A 2J6SA 2HWHA 2HNYA 3ZT3A 1TKZB 2O4IA 4FZZA 1GOCA 3GIMA 2XC9A 2WOMB 2G8HA 4ZPBA 1D5AA 1FK9A 3KMQA 4CIEA 4DEZA 4I9QA 2RF2A 3SV4A 3PO4A 2D0AA 2XI3A 2XCPA 1RT6A 4EZ6A 3F73A 2GIQA 1EP4B 2I5JB 2R7YA 4Z4CA 3N6LA 1RDBA 2F8TA 3LDSA 3P83D 4DFJA 4IR9A 1T94A 3NAHA 3ISNC 1JLEB 5CYMB 3HVWA 2IBKA 1R0AB 1JLGB 3KLIA 3OS0A 3LALA 3QIOA 3KK1A 1CZ9A 1QSYA 5J2PA 4DLGA 4BWJA 3T5KA 5F9NA 3QETA 4I2PA 2IS3A 1ZETA 1FKPA 2FLNA 3OYIA 4IR1A 4ECWA 4J9OA 5J2NB 2VWJA 3DM2A 4CIGA 3VQSA 4NYFA 4Q44A 3AVMA 4ZP9A 2A1RA 4KPYA 4B8AB 1RTIB 4PA1A 3QESA 3GV8B 4IH6A 1L5UA 4IFVB 3CJ0A 5DGAA 1KLMA 4CEDA 1N4LA 2HWIA 3RB3A 2FLLA 3CM6A 4NCGB 3QIDA 4RW8A 4FM0A 4DL4A 5F8IA 5HBMB 3O3GA 2UVRA 4CJVA 1JLQB 4KO0A 1TAUA 5HP1B 4J9NA 1XR5A 4Z4HA 3CVKA 1VSEA 3SPYA 3UR0A 3KLEA 1NK4A 3NL0A 4IH7A 3NGZA 3QGGA 1TAQA 3NGYA 3IAYA 4NLDA 4HCCA 1O1WA 1K1SA 4IDKA 3OYJA 2R2SA 4H4MB 4ID5B 2RKIB 5KT3A 4KB1A 3G6YA 3CFOA 1UWBA 1SV5B 2X74A 3DLEA 4DS4A 1NJYA 3KLGB 1S0MA 3AO3A 4FM2A 1RBSA 1QE1A 1IKWB 4BACA 3TARA 4ED0A 4CF2A 3M9NB 5KFAA 1Z26A 1BISA 4FJJA 2W8KA 4TSXA 1HNVA 4Q8FA 3KHHA 2BGGA 2WOMA 4CIFA 4IG3B 1SKWA 5DGBA 3BR9A 4QAGA 1HPZB 3KK3A 3QNNA 5EUHA 3MF5A 4CJSA 3OLBA 1D9DA 4C8OA 3G86A 3QZ8A 3QO9B 2OA8A 2BRKA 5KG3A 1QS4A 4CJLA 1XWLA 3TAMB 2FLPA 4B8CA 2OPQA 3NHGA 1JLEA 5CYMA 2R8HA 4RW9B 3FFIA 3BSOA 1FKOB 5KT6A 1S48A 2OPRB 4K50A 4R5PA 2YHAA 4WXWA 1N48A 3GILA 4QPXA 5K14A 3RB0A 1RDAA 1I39A 1BQNB 4LQ3A 3D45A 2W9BA 4AHVA 3NCIA 1D9FA 1LW0B 4FS2A 4UQGA 4RNFA 1VSDA 3JSMA 1S5JA 1YT3A 4DQIA 3AO1A 1RTJA 3L3VA 1TKXB 3DLGB 3AVLA 1ZBLA 5JUMA 3V6DA 1EX4A 1EETA 4ELUA 3DLRA 1XC9A 3CIZA 2XY6A 2YNIB 4DTPA 2IMWP 3FQKA 3BQ1A 2B6AA 1NHUA 3MEGB 4B9SA 3FDSA 4ZVEA 3ZSVA 4Q0BA 3GYNA 3PJXA 3LPTA 5FROA 3VQ8A 4DTJA 3GIJA 3KHLA 2OZMA 4KI6A 4MFBA 2ZQBA 4FJ5A 2JEGA 3SYZA 3SJJA 3ICLA 2RDIA 2D41A 3V81B 2C2DA 4Q45A 2YNFB 1LAWA 4QCLA 3CJ5A 5JXSA 5EWGA 1RBVA 2WONA 3LP1A 4NCAA 2HNDA 4ID5A 1IKYA 2RKIA 1OS5A 4CFDA 4FJXA 3M8QA 5KFWA 3PVXA 2Z1GA 4IBNA 4KHUA 4YR3A 4H54A 2ASLA 4O3QA 2V0NA 4ICLA 2P51A 4EEYA 4J9KA 3V6HA 1IKWA 1U4BA 1C6VA 4ZTJA 3AVKA 4ED7A 5F8LA 2OH2A 1DTQB 2DTUA 1RTDB 4F50A 3WNHA 3ZT1A 4J9PA 4K4VA 2WCXA 4LQ9A 4FK2A 1ZBFA 2P1JA 3TWHA 4B9TA 3OYFA 3OSPA 1HPZA 4LD0A 4FJNA 5CYQB 1KRPA 3OLAA 4B9VA 4GC7A 5KT7A 3GIIA 2IDOA 5I42B 2IC3A 4EBDA 1RBRA 4EO6A 2KZZA 4DLEA 4C8LA 3DLHA 3HO1A 1QSSA 3FSIA 3TAMA 2YKNA 2XRIA 1BGXT 1RDRA 3UQSA 4ECYA 1VRTA 2NUBA 4JS5A 4NLVA 4MKBA 1HYVA 3V9ZA 4LSNB 1FKOA 2OPRA 4M94A 4PQUB 5EDWA 1LWCA 5DQHA 1WN7A 3NGDA 1S49A 3VQAA 1RT2B 3TQ1A 4ECZA 1NOZA 1JLAB 4PUOB 1RT5B 5KFXA 2AGQA 1IKVA 4CEAA 1LW0A 1L3TA 1IKXA 2IM0A 5DK5A 1TVRA 2DPIA 3DLGA 2X6NA 4KB7A 4TYAA 3AVGA 1L3SA 1NJZA 1JLFB 4DU4A 2Z1HA 2FVSA 2AQ4A 3S3MA 2R2TA 2E4LA 1VSMA 1TL3B 3H5YA 1UAXA 1Z4UA 3C94A 1RAJA 4CFBA 2IM3A 2DFEA 3I5BA 4ECVA 3MEGA 1KFSA 2GBZA 2QKKA 1C0MA 3BSCA 3PX6A 5KFGA 4JV1A 3SZ2A 3GV5B 4TN2A 2WHOA 4J9LA 4LH4A 4M45A 1C0TA 2B5JA 3B6OA 3U6FA 3AA2A 4E19A 4Q8EA 1HQEB 3H5UA 1I6JA 2E6LA 1HMVA 3HL8A 2UUWA 3KLHA 4KSEB 4CGFA 2DFFA 4NLOA 3HP6A 5FDLB 3MAQA 1VSIA 1S0NA 2HNYB 4KTWA 2YKMA 4KE5A 1NOYA 4ZPAA 1D0EA 5HROA 3RR7A 1ZYQA 2RF2B 4K8XA 4F4WA 4FLVA 4QWEA 1RT6B 3PY8A 3VQPA 3VQBA 3QZ7A 2OPSA 4CJUA 3OYLA 4K4ZA 1CLQA 1GOAA 1T3NA 4CK2A 3LAMA 2ASDA 3HK2A 5DMRA 4XPEA 4Y1CA 1VSFA 4FLZA 5KG4A 3K59A 3PR4A 4K4SA 4WYWA 3NGIA 1ZBHA 1TK5A 4FVMA 4C8KA 3ZSRA 4MK7A 4CJ5A 3T19A 3KLIB 4I9LA 3KK1B 1XI1A 5J2PB 1X1PA 4CECA 4DTSA 1TL1A 1XR7A 4EBCA 4HUGA 2UUTA 4IFYA 1S1VA 4I2PB 5CYQA 1J9AA 4K4WA 1RTHA 1LV5A 3NF7A 3Q8PB 1FKPB 4DL6A 3EZ5A 1QUVA 3IN5A 3UDLA 1LWFA 3D5MA 3DM2B 2P5OA 4MIAA 1S6PA 3MTKA 1WSHA 3Q8RB 4KREA 3PUFA 2ASJA 3PW4A 1NK7A 5EU7A 4TQRA 3VQ5A 3S3NA 1TQLA 4CJPA 2HW3A 3GV7B 3MXJA 5KI6A 3OJUA 4ECSA 1S97A 1KLMB 4ZVFA 3LWMA 4DS5A 5CZ2A 4CERA 1TV6A 1N6QA 1S6QA 5HRRA 1KSPA 2IJNA 4FW1A 3DLBA 4B9LA 4IG0A 4RNMA 3MEDA 4RW8B 4DMNA 3CJ4A 2ZE2A 1QTMA 1NJXA 4KBIA 4KO0B 2XWYA 1JXBA 2R8IA 3THVA 1B92A 3KLEB 2I1RA 4DTUA 1KHWA 4C8NA 4Z4GA 3RB4A 2FBTA 4HHTA 1REVA 5KFVA 4FLYA 5KRSA 3IRXA 4RW6A 4O3PA 1I3AA 1RBUA 3DLEB 2W7PA 2KFNA 3Q8SB 4OLBA 5I3UB 4YQWA 4FZYA 4KAIA 1QE1B 4DSLA 3H4DA 4CK1A 3K5NA 4CJRA 1U48A 5KG0A 4CJQA 4YR0A 5DLGA 1HNVB 3B6PA 3BSAA 2D3ZA 3G10A 2IGIA 2FVQA 4I2QB 3NAIA 3AA5X 3I0RA 1L3VA 3K58A 2WRMA 2KTQA 2ILZA 3OSNA 3SFUA 3KLFA 5SWMA 3TAGA 3KK3B 3SI8A 2Z1JA 3RMBA 3AO4A 5KFKA 1SL2A 3IG1A 4J9SA 4URSA 3KD1E 4AILC 2XI2A 4M42A 4XIUA 3RMCA 3FRZA 4OPKA 4ECTA 1JKHA 4QWCA 4OGCA 2KQ2A 3VQ4A 1T8EA 3HVRA 2OPQB 1LAVA 3K2PA 1KLNA 1Q8IA 3WNGA 3FFIB 3CQ8A 4B9UA 1KVCA 1JLBA 4R5PB 2ILYA 5KFIA 4RUCA 2IAJA 5K14B 4CEQA 4CF8A 1X9MA 1ASVA 3I5CA 3M8PB 2W9BB 3RWUA 1QQCA 4CGDA 3L8BA 5KG7A 4JS4A 5J2QA 3JSMB 5DQGA 2HVIA 1RTJB 3AA4A 4CK3A 1JL2A 5KFYA 4OKKA 1TK0A 4NLQA 4QW9A 3TAPA 3V6DB 5KFMA 1EETB 3QIPA 4DU3A 1B9DA 3VQQA 4CEZA 1NKCA 4ZMMA 5T7BA 1S4FA 1RT1A 2B6AB 4CEFA 3PJWA 4Y3CA 2O4GA 3G6VA 4Q0BB 4F3TA 3CJ3A 4KB0A 2J6UA 3LAKA 4ZHRA 1WNEA 3I0SB 1WLJA 4WZMA 4CHQA 4MFBB 1SKSA 4B9NA 5KFPA 4KHRA 4BDYA 3DI6A 1S9GB 3OYKA 3JYTB 4DFKA 2JEIA 2AX1A 1ITGA 4KKOA 4DL3A 3VQCA 1SH3A 1HQUA 2VG6A 4K4YA 4FW2A 4CFCA 2B43A 3H98A 3U3GA 4E7JA 1SH0A 4KTQA 1JLCA 2WONB 3LP1B 5C5JA 3S9HA 2HNDB 3SUNA 3AVHA 1IKYB 3KIOA 3OJSA 3M8QB 3MXMA 2IM1A 3HKWA 4E1MA 4IKFA 3EY1A 4ICLB 5E41A 2CKWA 5I3UA 3RB6A 1RILA 3TI0A 4X2BA 4Z4EA 3MEEB 3DRSA 5C42A 3BREA 5L1JA 5KFOA 3OL7A 1Q9XA 2QV6A 3LP0A 4WE1A 5KG6A 4I2QA 1WSIA 3HT3A 2AJQA 3K5OA 3DDKA 1RDCA 3BDPA 3DMJA 1J54A 2IC3B 5KFNA 3KJVB 3G0ZA 4DSEA 2KZMA 4J9MA 3QINA 3MXIA 2YKNB 4TY9A 1VRTB 3T5HA 2VA3A 4K4XA 4M3RA 2ZD1A 4GMJB 1UA1A 2HHWA 4QW8A 3KHRA 2G8IA 4JV2A 2ZKUA 2XCAA 1LWCB 4DFPA 3M8SA 3KK2A 1BHLA 3SUPA 4B3OB 3SI6A 4Z4FA 3SNNA 3M8PA 4Q5VA 1A5XA 1IKVB 2BQUA 4KFBB 1IKXB 3LZJA 4H4OA 1ZBUA 1TVRB 1C1CA 3KKRA 3VN5A 1Z25A 1BCOA 4DSFA 3MECA 1SL0A 3HHKA 3D28A 3AVJA 1D1UA 3HM9A 3ITHA 2R8JA 3DLKA 3H4BA 4O0JA 3SV3A 2RPIA 4Q43A 3KKSA 4FJ9A 1VRUA 5KTQA 3UIQA 1RT3A 4GW6A 4YMEA 3OL8A 1C0TB 3QGHA 2B5JB 3NAEA 1K6YA 3I0SA 1T05A 1U49A 3HVTB 3OS1A 1HMVB 3EPGA 3C6UA 3L2UA 3KLHB 4MK9A 1HJRA 1T03A 1HYSA 5KFSA 4O4RA 1S1WA 2FBXA 1S9GA 2YKMB 2E9TA 1U04A 4KAZA 3JYTA 1UOCA 1XHXA 4Y2CA 3IGVA 2R2UA 1S9EA 4M3UA 2XY8A 4N5SA 5HROB 4K4UA 2GV9A 4JUZA 1S1UA 2BANA 4OKEA 3CO9A 3DYAB 4TXSA 4NCBA 1TP7A 3E01A 2Y1IA 2D0BA 2OPSB 4FK4A 1C1BA 1DTTA 3TVKA 2V4QA 3K5MA 3MEEA 1S10A 3ZSWA 2BE2A 1S1XA 1ZTTA 5T14A 2YV0X 1ASWA 2YHBA 4IQXA 3WNFA 1WSGA 1FXXA 4HVJA 1TL1B 3T5JA 4IFYB 3DRRB 1S1VB 3AVCA 4WFYA 1U45A 1EXQA 1RTHB 4NLYA 5J2MA 3OHAA 4M3TA 2IOCA 2W9CA 4CCHA 4DQPA 4KHMA 4FJHA 1SL1A 1XR6A 4OL8A 4F4KA 3KJVA 1LWFB 2XHBA 2ALZA 3M9MB 2CJQA 1F21A 4RW4A 4WZQA 1S1TA 1S6PB 2HNZA 4H8KA 2BRLA 5KG2A 3LANA 1X9WA 1W0HA 2D7SA 2IA6A 2B4JA 3I5AA 3UPFA 2HHVA 5KRTA 2FJXA 1S9FA 3HSTB 3V1RA 4EZ9A 2E6MA 2YNGA 3V6JA 1TV6B 1N6QB 1S6QB 4B3OA 4IG0B 3MEDB 3HJFA 4DTNA 2ZE2B 4KFBA 4YNQA 3AVNA 4Y2AA 4CJTA 4KHQA 4J2EA 3QEWA 2XGQA 3MR6A 4ELVA 4OGEA 1HNIB 3BGRB 3F9KA 4ED2A 4ED3A 1J53A 5KFUA 4IRDA 3HVAA 4CJ3A 4FXDA 1REVB 4CJKA 1VSHA 1SH2A 4FJLA 1KCFA 3OYGA 4RNHA 4AHSA 2FBVA 3V9WA 2DFHA 2F96A 3IRXB 4RW6B 5C25A 2C2EA 1KTQA 4CHNA 2PYJA 3MR3A 2GUIA 3HVTA 4BWMA 4CEOA 1RCHA 4J9RA 1VK0A 4LH5A 4RG8A 3CM5A 1WNSA 3VQDA 4NLSA 3LP2B 2KW4A 3H5SA 2C22A 4IKAA 3I0RB 3S3OA 3CFPA 3DOLB 1WAJA 4QWAA 2XY5A 1HRHA 4W5RA 4MKAA 3DYAA 3KLFB 4ED8A 3RRGA 2ATLA 3IG1B 1MU2A 1L3UA 4W5NA 4O3OA 1JKHB 5F8GA 3PW2A 4CF1A 4F3OA 4WFXA 1G15A 3SCXA 4OJRA 2XGPA 3CDEA 1HARA 4R0EA 4HCBA 3KD5E 1B9FA 3QEPA 3OYBA 2UVUA 1JLBB 4IOBA 4O3RA 2VG7A 5HLFA 4XO0A 4KI4A 3RAXA 2IAJB 2QK9A 3NF9A 4URGA 1WAFA 3TANA 3DRRA 4M3ZA 4W5QA 4N41A 5J2QB 3NBPA 2G8VA 4FZXC 3HP9A 1LWEA 1RA6A 3QYYA 2F8SA 1RYSA 2PY5A 2JGUA 3RMAA 4TYBA 2R8GA 1ASUA 2O5DA 3PW5A 4I7FA 1NK0A 3QIPB 1TGOA 1C2PA 3PZPA 5KFJA 1NJWA 1RT1B 4KHSA 1JXLA 3OL6A 3SQ0A 5F8JA 1ZBIA 3NH0A 4M3XA 4CESA 1QHTA 4E0DA 1RBTA 5DG8A 3SUOA 2AWZA 1N56A 3DOKA 4E7KA 2E9ZA 3H5XA 4ZHRB 2FC0A 5F8NA 4FJIA 3T5LA 2VA2A 3H59A 1JX4A 1EKEA 4E1NA 2KFZA 1K1QA 3ZSQA 3V6KA 5L1IA 5KFZA 4IRKA 3DI6B 2W9AA 4RNNA 4CEBA 4NLTA 4C8MA 4CGHA 3HPGA 4M3YA 1HNIA 3BGRA 4HYKA 4KKOB 1HQUB 2VG6B 1JLCB 4FYDA 2X78A 4DU1A 1TKTA 4NLUA 1SKRA 2BQ3A 4TY8A 4TQSA 4HUFA 4DFMA 3ALYA 1S0OA 3VA3A 3CDUA 3CJ2A 4ED6A 3GIKA 5L1KA 4MQ3A 3V1QA 1QSLA 2VG5A 4JRQA 3DRSB 2YNHA 5C42B 3V1OA 2JC0A 3IS9A 4DTOA 4CGJA 3LP2A 3PV8A 3LP0B 4WE1B 4FLUA 2HHUA 1JIHA 3V9UA 3VA0A 1YTAA 3DOLA 4FBUA 2G8WA 4B08A 3AVIA 1NKBA 4WXOA 2FBYA 5KFLA 3DMJB 5KFTA 4CJFA 2HB5A 3PHEA 4FM1A 2BR0A 1BL3A 2V9WA 1IO2A 5KT2A 5EWFA 3H08A 1GX6A 3RBEA 4O0IA 3RR8A 3AVFA 2ZD1B 4RW7A 4R8UB 5J1EA 1KFDA
chains in the Genus database with same CATH superfamily
4PG4A 3ENQA 3CJTA 4JI8J 4BE2A 3MUVP 2HZAA 2HHTA 4JKDA 3IP0A 3OY9A 4JI7F 4AH9A 2JEFA 5ADXH 2QKBA 3QRQA 5DG7A 4WU3A 2J6TA 3LGHA 4CDIA 3O9SA 3VAMA 2EX3A 4MDAA 1B0TA 2R3VA 2E1YA 4DTMA 1P1TA 2CG4A 3U3YA 2A6MA 4BRCA 4DG1A 3AODA 4CLWA 3M6VA 5KT4A 3U1LA 3ZT2A 4RWXA 1CXUA 4NA3A 2MQPA 4OV6A 4HTUA 4EFAC 2Q36A 2XMJA 3DLLQ 4LFCK 4AQYF 3LZIA 2DH8A 4AM6A 4LSZB 2M8DB 5FIIA 3AO2A 1S9EB 1EHWA 1R8PA 3VQ7A 3MAHA 1FA0A 2FVCA 3MR7A 2JC1A 2SXLA 2V2ZA 4F25A 4ZPTR 1QVFR 1NB7A 3GDQA 4U8VA 2E2OA 1YBTA 3JQKA 3QGIA 4NYNA 1FF2A 1ZC6A 3OBYA 2DR9A 1Y3JA 2Q3SA 1VHXA 5L1LA 4WFBQ 1C1BB 1DTTB 5AZIA 2BE2B 3IM8A 2V4RA 4BR0A 1FFSB 4G1QA 5AQJA 3ZCMA 1FEEA 2FHJA 2CPYA 4K2JA 1TFWA 4WF9Q 5D4LA 1MNEA 1TMMA 4U7CA 4ILGB 3CJ1A 3O8WA 1X3MA 1X5SA 2E7VA 1JK9B 4MYUA 4FJ7A 5J2MB 4BE0A 1VSKA 2W9CB 3MM9B 4OX9K 2GJ2A 3AA3A 1TKZA 2HGNA 2ZF5O 3D0PA 2C3MA 1W9HA 2GAHC 1S1TB 3KWIA 5CHCB 1RA7A 3PSIA 4P9SA 1IM4A 1RWMB 3D6MB 1AZSB 5THWA 3OVNA 4B3RF 5E5NA 2K1RB 2RT3A 3JSBA 4OZ2A 2PMWA 2YNGB 5LJVA 5HRPA 3M1FA 2M9KA 2C3YA 4GVBB 2UVVA 1V9OA 2E9RX 1VBXA 1CJTA 1DLOB 5IM0A 1R0AA 1JLGA 3P5BP 3T41A 2VONA 1NEEA 2GWJA 5LL6Z 3HZ6A 3BQ2A 3ASMA 1M5OC 2JEJA 4C3MA 2PZSA 4O5BA 1TUGB 4DR1K 3NWRA 4FJMA 3S8SA 3BS9A 2BZ2A 2CYYA 5J2NA 3PEHA 5E7OB 2BQRA 4P74A 2ATQA 2BJ7A 1NDPA 3P4UB 5HJYA 4WWSA 4DR3K 4LRFA 2F8MA 5A6PA 4JI1J 1X9SA 2ZKTA 3NH2A 3NE6A 3OW2M 3CNQP 4C3KA 2EFOA 4Y34A 1EIYB 3BR8A 4HWIA 1FCAA 1O0PA 1W25A 4OLAA 1ESVA 1HJOA 2GJFA 1X5OA 3RJMB 4DV6J 4CZCA 2R7WA 5L39A 2V50A 1SXLA 5EWEA 4Y00A 3RRKA 3D54A 2M4MA 5KFCA 4E8UA 4CZJA 4H5RA 2AGPA 3A8KA 1SV5A 3JXOA 5M1FA 1RHMB 3CD0A 5M1QA 4NLPA 3ZYYX 1ZAWA 3TWZA 3EE8A 4NLRA 4KH4A 4MJKA 2DNKA 1PJ5A 4M95A 2V4JA 4ZIVA 2EC0A 4IG3A 2QYCA 3IA0A 4QU7A 1CZAN 1V5IB 2QWLA 3CCQS 3C16B 3MN9A 2CPXA 1SJ3P 3NFAA 4NLGA 1NK9A 2AW0A 4LF2A 4FCYA 1NCLA 3P1GA 3P5JA 3AAPA 1SUQB 3ID8A 4ZOSA 1B7FA 2E29A 3WQTA 1DLOA 3VQ6A 1WUUA 3O5TB 1J27A 4A2AA 5HRSA 4L8RB 1Q7YT 3QJJA 2DNZA 1RABB 3KWGA 3HD1A 2QSWA 1UKUA 1NK5A 2KKZA 2VBWA 2WZ1A 5AQYA 3VZIA 1YXQA 4U7UD 1TKTB 4CT9A 4UOFA 1IR2A 1NGAA 2QLBB 4KGXB 3EKUA 2IYIA 5JS2A 2YNIA 3CWJA 4CW7B 2VFSA 1Q8LA 2Z1IA 3BH6B 1RAFB 3SCLE 2WW8A 3A1YG 2X6SA 2Z2MA 2HHXA 8RUCA 4EK2A 1NKEA 1NMEB 4BC5A 5L9XA 2XY7A 3MCPA 3PM9A 4NYZA 4ZCMA 1S7HA 2V8DA 3KUHA 4ZP8A 4BROA 4UW2A 5KGWA 4G3IA 3CC4S 1DQ8A 4OQJA 3MM5B 1KDNA 4O4GB 3KNAA 4E89A 1NNEA 1Q8KA 1IBMJ 2C2RA 4EP4A 4JI8K 2BX6A 3BZQA 1X9JA 3TZWA 1U09A 1TL7A 3IGNA 2EG2A 2E66A 1T95A 3N6MA 1FJGJ 2GW8A 4C48A 4ZP7A 3I96A 4MK8A 2I0XA 4GVMA 3DHXA 1U1LA 3PYDA 2D5RA 4FJ8A 2HHQA 3UD5A 4WIIA 1VSJA 3PACA 4DPTA 4NB4A 1OIAA 3MHYA 1LFWA 1DTQA 2HBYB 4PXBA 5C2CA 5KFFA 4O44B 1IR0A 3FSXA 2DVIA 1NGIA 5B0DA 4CH1A 4J2AA 2EKYA 4BRAA 3IBWA 2AGOA 2PO4A 3ZZYA 2ZGZA 1SQEA 4K8ZA 4GC6A 3L2WA 5I42A 4DL7A 4CFAA 5BYRA 2V2QA 4DU8A 1SUQA 3GTYX 2AYMA 3DRPB 1U6FA 5FJ4A 3AV9A 1R31A 2W2OP 2F3JA 3FK4A 3TSQA 4YR2A 3TUZC 4CBWA 3ENHA 3FGVA 4NO7A 3ZSZA 3HPHA 3WEEA 3O3FA 3W8GA 1JLAA 4PUOA 1RT5A 3OR1B 3NVMA 3NMUA 1UA0A 2W6KA 3AAQA 3RBDA 4NZ7A 2DJWA 4LRBA 2RHQB 3MD3A 2HGMA 2B9EA 3FEYB 2LU1A 1VQMS 4LSLB 3DLLL 2UVWA 3TTDA 1CXQA 4DV7F 3EZOA 2EK6A 4AQYJ 3GQCA 2DNRA 4OX7A 2HMIB 2KHDA 2HPUA 3ILJA 2E7XA 2BBEA 3BZKA 3QERA 1C4CA 4A47A 1RT7B 4OYPA 3H90A 4O4GA 3AY9A 1NMDA 5T7LB 3I55N 3MWPA 1KVKA 3W60A 1FFGB 4M7YA 1VQOS 4WIQA 4WFBL 1T3VA 2G8HA 1UJ4A 3SV4A 1OKJA 2D0AA 3O1LA 3HDSA 5EX0A 2HEKA 2AV5A 4WF9L 3KG0A 4Z4CA 3LDSA 3W64A 5KPTA 4IR9A 3AQOA 1FJ7A 1U1RA 4I64A 3CDBA 1VR6A 5IS2A 2BJ1A 3SQGA 1JLEB 3J81j 2XHWA 4DN9A 3M7VA 1CZ9A 3WXLA 4CO1A 4I69A 4BWJA 1ROFA 1K9MT 4I2PA 1L3KA 1YJWN 4JI4F 2P9KA 2FLNA 3OYIA 4AXJA 4B3RJ 5C15A 1HHTP 3BF1A 4CZIA 2VWJA 3DAWA 5AQHA 1X0PA 4NYFA 5CZXA 4Q44A 4YUDA 2A1RA 2ADCA 3O1WA 1RTIB 1WHVA 4FWPA 1RWKB 1L5UA 7FDRA 1FW6A 5DGAA 1NH7A 2CRLA 4F0MA 3GSIA 1IN0A 2Q3PA 2YKPA 1QZ6A 1EAYC 4DL4A 5HANA 4ZLPA 3QAEA 4LF1A 1TAUA 1Y5NB 2ZNYA 3EX7B 2P9NB 2YX7A 1VSEA 3SPYA 1SIZA 3O3LA 3T69A 3NL0A 5C0YA 1HKAA 2NRXA 1JQGA 1OPIA 1XQIA 4DUYF 1O1WA 2XEXA 2O01C 2G2YA 4H4MB 3QICA 3HZEA 1UEVA 5GINA 5DZ6A 2X74A 1GLAG 4DS4A 2MGZA 3KLGB 2R7UA 1ZM9A 1IKWB 2QLXA 3PKYA 4ED0A 1F3FA 1ZZFA 1PBAA 2R7QA 2W8KA 4GKKJ 2LQJA 4TSXA 2ZUAA 1HNVA 3S41A 4Q8FA 2RD5C 3KHHA 3HSZA 1O6XA 3EGZA 4KYZA 3TSUA 1IUJA 2QIFA 5DGBA 1HPZB 4BR9A 1QVFM 4CJSA 3OLBA 4DR7F 3TEGA 4YOWA 1TUYA 2E5JA 2HRTA 3G86A 1HNWF 1DFDA 3R3TA 3MMBA 4FWOA 1QS4A 4CJLA 1XWLA 5AQZA 2CQ3A 4FF4A 1W2BM 2GIFA 3NHGA 1JLEA 1HBUB 5LJ5Y 4AFFA 1F6TA 2MQ8A 1MG7A 2B9XA 5BJRA 1RUSA 5KT6A 2B0GA 4WXWA 2E5LK 3G8SA 3GILA 4WJBA 4USMA 2WB1D 3RB0A 1Y3KA 1RDAA 1RADB 2X1GA 1BQNB 2BM1A 1EB0A 4C1NK 2HSTA 3D2WA 3NCIA 1NGBA 2FY1A 1VSDA 1FEHA 1YT3A 4DQIA 4C7QA 3L3VA 3RAMA 1M1GA 3U4LA 3HI9A 3SDEA 2NYIA 4ISFA 5DDOC 3S01A 3DLRA 1CG2A 4OYOA 4M5DA 2RNEA 3O08A 3FQKA 3WXKA 2QA4G 3BQ1A 2B6AA 2HURA 1RACB 2EG1A 3GYNA 4Z94A 2ZBCA 1IBMK 3Q86A 3CJCA 3ETOA 1FRHA 4MFBA 3C15A 4K5SA 4L74A 2KM8B 2J4RA 2RUSA 4O8UA 4OYAA 1FJGK 3X3UA 3BPSP 2RDIA 2D41A 2DR8A 3V81B 4C9DA 2JJ4D 2GTDA 2BJDA 2ZZTA 1H72C 3GONA 5CYJA 3VTHA 5HQ8A 1TFYA 3M8QA 4USJC 2ZC4A 4O3QA 2ASLA 2V0NA 2P51A 4EEYA 1IKWA 5I3QA 2YWKA 5AQFA 3SEOA 5D8HB 5BN9A 4LF4K 3OTOF 4NOHA 3AVKA 3JAMU 2QRRA 1WKJA 2DTUA 3PSFA 1RTDB 4MIWA 4F50A 4J9PA 2WCXA 2CNKB 3O2IA 2RE1A 1RSCA 4CI6A 3M32A 3IAM9 1HPZA 4LD0A 4JI7K 4FJNA 1FDDA 1VYAA 2HVEA 3OLAA 3MM8B 2BYCA 3LDOA 3GIIA 4OYXA 1U2CA 3ZX2A 2IC3A 4EBDA 3H2UB 4C0OC 4EO6A 4K41A 4CRJA 3VF2A 3J7Z5 4Y0FA 2YKNA 2XRIA 1RDRA 3A4TA 3UQSA 3D1OA 5HMXA 1VIOA 2NUBA 4OI1A 2ZITA 2J9EA 2RMLA 1HYVA 1YITN 4C0HA 4LSNB 2DGUA 2E20A 1YJ9N 5AQOA 5DQHA 1UVIA 4C97A 2YQ1A 3NGDA 1S49A 1N0VC 4FPIA 2CH5A 3CCRS 1RT2B 1V3ZA 3ENBA 1IKVA 3C6AA 3UKUB 1B4SA 3CCMN 4DR6F 4PWWA 3T9ZA 3AVGA 4BS2A 2FHMA 1JLFB 4DU4A 2PFFB 2AQ4A 3S3MA 3R5DA 1TL3B 1Z4UA 3C94A 1RAJA 2M52A 2IM3A 2DFEA 3I5BA 1KFSA 2QKKA 5SUHA 2QWMA 3BSCA 5KFGA 3GV5B 1U2VA 4ILLA 4TN2A 4P72A 4M45A 4LH4A 3B6OA 4KBOA 3J7YI 2NZ4A 2IRXA 1HQEB 4JV5F 3GFXA 5B0FA 3H5UA 3HL8A 4JHDB 2XM3A 2X51A 3DKDA 3EDRB 1LK5A 3MMCA 3DFEA 1N33F 1NOYA 4JKGB 4FF2A 2AIRB 2HFUA 1ZYQA 2RF2B 3VGVA 1VJWA 1REGX 3OVBA 4DXLA 5IT0A 4QWEA 3PY8A 1ATRA 1MW7A 1KQFB 3VQPA 1SJ1A 4DV7J 1U1NA 4CJUA 1WOSA 5D4NA 3UCUP 1T3NA 1Q7YO 1X4AA 4CK2A 3LAMA 2ASDA 1NGHA 4XPEA 3LOUA 3M5RA 1HNXJ 4PL8A 4CLYA 3RSEB 1TK5A 1I5OB 2HSEB 3ZSRA 4QPTA 3T19A 3THYA 4I9LA 3KK1B 3TVZA 1XI1A 4BQZA 4DTSA 4ZPVR 1CC7A 4CLZA 4IFYA 1J9AA 4J9UE 4LRDA 4WFAQ 3CIPA 3EZ5A 4P52A 1I3OB 3QT5A 2D69A 2L9DA 1S6PA 3CCES 3TOQA 1LCUA 2HHHF 4YOTA 4KREA 3DLJA 3PUFA 3WXMB 3R8YA 4X66F 4CJPA 3KJNB 3OJUA 3GV7B 3MMAA 1U8WA 3KJQB 1Z2ZA 2VFRA 4DS5A 5K8NA 1N6QA 4WQ5A 1JJ2R 4B9LA 1UFLA 4UTGA 1NJXA 4C4WA 1OO0B 3P31A 4JI4J 1FJEB 1JXBA 2GCFA 3THVA 2J7UA 1WWHA 4DTUA 2XS7A 1KHWA 4JI2F 2G0JA 3RB4A 2HS3A 2E44A 3UD4P 2MB0B 5B8HA 4F9OA 4QS8A 3ZTQA 5HOOA 5BPMA 1NRKA 3IWXA 2KFNA 5E3RA 4OLBA 3H2VE 4FZYA 1OVYA 1W7AA 4I0WA 2PI5A 4CJRA 3DGPA 1MROB 1IBKF 2MY8A 3TX8A 4YR0A 3HD2A 2YH1A 3BSAA 2FVQA 4I2QB 3NAIA 3AA5X 4JKGA 1P27B 1XMOF 2RQ4A 2FJBB 3K58A 3THXA 2WRMA 5SWMA 1HKBA 2FHOB 1SL2A 2Z1JA 1V3SA 4OJGA 5KFKA 3AO4A 3RMBA 5IZHA 4DUYJ 4AILC 5U47A 4XIUA 4P2SA 3J80O 2DNMA 1WF1A 2KQ2A 2OPQB 4PEOA 1Q8IA 4HT7A 3CMQA 1CJVA 5I4MA 1KVCA 1JLBA 4R5PB 2VOPA 2IAJA 5K14B 4CEQA 1KP6A 4CF8A 2GEMA 3VQTA 3M8PB 5AE2A 3POTB 3M30A 4UOHA 3JSMB 3W8PA 3K8WA 3Q89A 1X4GA 4CNYA 5DQGA 1RTJB 4DV4F 5AJ3F 4DR7J 3AA4A 1JL2A 1TK0A 2IVYA 2P9EA 1HNWJ 4QW9A 5D15A 3TAPA 4HHHA 4FPAA 2G9OA 5CE3A 3CJSA 4DU3A 4CEZA 1NKCA 2BXJA 2L48A 2VV5A 5KPRA 5BYQA 4NI2B 5G4DA 3PJWA 2BW2A 2O4GA 4HTLA 3R7BB 3G6VA 2CIMA 2NSBA 4ZJQA 2MQLA 1J5EF 1WNEA 4V19S 3BB5A 5HQMA 1CQMA 5A76A 1SKSA 4KC5A 4U96A 1PKUA 2OMOA 2CJKA 2VDIA 2YY3A 4BDYA 1S9GB 1V5VA 4F0HA 2KT5A 1N36F 1HL6A 5DZ7A 1G3OA 1DJ0A 2ZH7A 1SH0A 4DB3A 3LP1B 3A3PB 3EMTA 2HNDB 3SUNA 3OJSA 3MXMA 4E1MA 4ICLB 2CKWA 3RB6A 2HZCA 4Z4EA 2MSSA 2HRYA 3BREA 1K9MO 2BKOA 1ELOA 3FZ2A 1YJNS 3B82A 2AEJA 3LO3A 4DR4F 4WE1A 2WAQD 2GWKA 4YS2A 4I2QA 4FKYA 4U67Q 3NNAA 4JB8B 2CWKA 3BKTA 2D1CA 3NRBA 1RTZA 2WFBA 3ENWA 2ROPA 1J54A 4ZPWR 2N4CA 3OXLA 3KK7A 1GXLA 3AOAA 3G0ZA 4DSEA 2KZMA 2E2NA 1NLKL 4LR7A 2EKNA 5ETPA 4C8ZA 5FPMA 4IO9L 3VAFA 3CJKB 1RBLA 2F65A 4I68A 1VRTB 4TY9A 1PGZA 4OLPA 4PKDB 4GMJB 3Q2TC 5HVHA 3VVTA 2XCAA 1LWCB 4DFPA 5K9FA 4YOEA 3KK2A 3SI6A 3SNNA 3M8PA 4Q5VA 1A5XA 4FWKA 3JTPA 4H4OA 4NE9C 1IJJA 3B54A 4AF1A 3KZBA 2DNLA 1R6YA 3KKRA 4DSFA 3CI5A 3MECA 5B0BA 2B51A 3RW6A 4LF8F 1KAYA 5C2DA 2CJBA 2A6OA 3H4BA 2CPIA 5KTQA 3IMQJ 1GQEA 2B5JB 1IBLJ 5DM6Q 2CQ0A 2XZWA 5A8WB 1K6YA 1U49A 1DT9A 4OZ1A 2VICA 4WP9A 1FTCA 4EMDA 1KOHA 3EM1A 4X4NA 1HYSA 2VFVA 4Y2KA 4O4RA 3A8EA 1S1WA 5HN0A 4DV7K 1S9GA 2QW9A 4KAZA 5IWAF 1UOCA 2J8SA 1XHXA 4BG9A 4M3UA 1HIYA 2XY8A 4N5SA 5HROB 3CCSS 4DUTA 2MZJA 1S1UA 3NCRA 3DYAB 2ACMA 5HATA 2DGWA 4ED4A 4TXSA 1X4EA 1Z6RA 4A8QA 1VQKS 4NMLA 3N5BA 4FYWB 3TVKA 2NLWA 3R6MA 2VBYA 1S10A 4LF5J 4B02A 1ZTTA 4JV5J 4ER8A 5T14A 2P9IB 1F5CA 3VAIA 3PDNA 4FWQA 2PIIA 2QTWA 3WNFA 1WSGA 1Y9OA 4ILMA 1N33J 2OO4A 2DHGA 4OJ1A 1OY9A 5KAKA 3AVCA 1RBOB 5H9FJ 4WFYA 2C2NA 1Y5LB 3OHAA 2IOCA 2VJVA 1YLXA 3UKRA 1YDLA 1A6LA 4FJHA 1SL1A 1XR6A 2O8FA 2AHOB 1LWFB 2XMUA 3M9MB 2EFVA 1F21A 2F4VF 3MPVA 2HNZA 1Z1ZA 5KG2A 2EPIA 4CLTA 1W0HA 2EVZA 3LW5C 5A0YB 5JVHQ 1GXUA 4JI4K 4QBUA 4EZ9A 5AZJA 2CPZA 3I8BA 1S6QB 1KWMA 1OWXA 4JYAF 3HJFA 1EQYA 3AVNA 4WFAL 4G65A 4J2EA 3QEWA 3O9RA 5AT1B 2GZOA 3ILOA 4RU2A 1ZS6A 4CLLA 3IUCA 3R5BA 3HVAA 3OFGA 1REVB 1VSHA 4FJLA 3OYGA 4AHSA 2FBVA 3CMES 2DFHA 5DS7A 4DV1J 2HQFA 3IRXB 4X66J 1VMBA 4ERDA 2YXLA 4H0OA 1E3MA 1RWUA 8ATCB 1Y11A 4BWMA 3O9QA 1RCHA 4AT1B 3R5CA 1CJUB 3VAKA 3L09A 5AQKA 3ATUA 4DUYK 4RG8A 3CM5A 1WNSA 3VQDA 2CXEA 3W9IA 4AL6A 3LP2B 3H5SA 1YJRA 2CVIA 4USHA 3CFPA 4BGBA 4AXIA 3TZYA 1HRHA 1WTFA 3DYAA 4JI2J 3TTCA 4I1TA 2ATLA 3A8JA 3JTOA 4B1XB 3NGSA 4QIGA 4JI0F 1N32K 1DBDA 2KYZA 4XTTA 2V8HA 1JKHB 2PE8A 5F8GA 2LU2A 1I94F 3SCXA 1A7GE 3CDEA 1P9YA 4R0EA 4DR7K 4IOBA 2WC9A 2VG7A 2KVIA 1BWEA 5HLFA 4OV1A 3AD8C 2QK9A 2UXBF 2ZWHA 4URGA 3TANA 2XSJA 1YJWS 1PC5A 2B4OA 4OO1J 5G0RA 4NYOA 4CO4A 3DN9A 2KU7A 2V5HG 5IFMA 4N41A 1LXNA 4FZXC 2DGSA 1VQ6S 1LWEA 1SJQA 3HP9A 3M3ZA 4PG8A 3TZXA 2RU9A 3G96A 1GNKA 3R7SB 2WVFA 2O5DA 4UOCA 3CPWR 3PZPA 2LLZA 1RK8A 2CGJA 1H7XA 1RT1B 1OH8A 5A0YA 3R2DJ 3L4BC 1YRTA 1ZBIA 1YJUA 3M4XA 3VESA 3ADAC 2QT7A 1WBDA 4I4BA 1NG9A 3SUOA 3U9DA 3DOKA 4E7KA 3SBTA 5AQSA 2H4YB 4FJIA 3TA1A 4WCEL 3SBGA 1EKEA 2XYGB 4E1NA 4O23A 4A46A 1K1QA 2BM0A 1FJCA 2HFSA 2O8CB 3D6RA 1RWOB 4DV4J 5AJ3J 2UYTA 4P73A 3AH6A 2QEXN 4KKOB 2VG6B 2FZCB 1EX8A 1YIJS 3OFEA 1GTHA 2J7KA 4FYDA 2QYGA 4Z7CA 4H5TA 4DU1A 2JVOA 2BUNA 4ANEA 4DBQA 4ED6A 5L1KA 3V1QA 5JMNA 4TKTA 3ZTPA 3MXHP 1KQSM 1CJUA 4DHVA 1WF0A 3W2WB 4CYUA 2P9LB 3LP2A 1UVJA 4FLUA 4FNIA 1JIHA 4UOGA 1JJHA 3VA0A 2Q43A 1N36J 4WXOA 4WYBA 1X31C 2FC9A 4FM1A 3PHEA 2HFNA 2NREA 5M2PA 1DAXA 2CQDA 3OTOK 2BR0A 1BL3A 1KVJA 4AUKA 1IO2A 2VC0A 1HBNB 2FTRA 1WC3A 1I1GA 4O0IA 2YQ3A 2F7TA 5J1EA 1KFDA 2WTUA 4FL9A 2P8IA 4ELTA 4KV8A 2NYHA 4U67L 4B9QA 4DR4J 2E1PA 4DU7A 3I4PA 4PKHA 4KHWA 2F8EX 1VQLS 3LTOA 1E4FT 3AFGA 2CQHA 3VHQA 1JXEA 1VFJA 2WVCA 4F4YA 1M1KT 2B7CB 3NMAA 3W66A 2OFGX 5K8PA 4K2XA 2Q1LA 3ITHB 2LEBA 1YVNA 1RT4A 2D9PA 1BI4A 2YX1A 3HOSA 1WOOA 4DR6K 1HBMA 1VRUB 1RT3B 4B3SF 2OPPA 1U47A 3PX0A 3D2FB 4NL5A 3N6NA 2LEAA 3P45B 1T05B 4DX8H 1N5YA 4FYXB 4CE9A 1O13A 3BP8A 4DPWA 3C6UB 2BW7A 5CD4H 5D3GA 4ISGA 1KVAA 2FJVA 1B70B 4FF1A 5BRDA 3AHPA 1FVQA 3TAEA 3QQCD 2BANB 1N5SA 4LF8J 3H0PA 4X4VA 1TR0A 4J8FA 4JV5K 2AF6A 1X4FA 1XK8A 2AA4A 3E01B 4TU8A 4ECQA 1F3VA 5DM6L 2W4CA 3RRHA 4PCQA 4U7UK 4X84A 3ZSOA 3CC2N 2DB1A 5H9FK 1HWKA 1N5QA 1S1XB 5ETOA 3W2WA 4ECUA 4EYIB 3T3FA 4JKCA 3CD6N 4B1WB 2Y8WA 3ZO7A 4JOUA 3CCJN 3SQ4A 3F0NA 1VSLA 1RDUA 4CF9A 1Y0HA 2M0GB 3V4IA 4X65F 3PW7A 1K8KA 4NA2A 4BDPA 2Y0SD 4KH0B 3CYMA 4RW4B 3IWNC 3RVCA 3QFUA 4YDUC 5E33A 3P5TL 4AHCA 4H03B 3TAQA 1T7PA 1NDCA 3W63A 2YJFA 3RTVA 4ISEA 1SVDA 2C2KB 1RNHA 1VC5A 1EP4A 2GO9A 4DTRA 4FK0A 2WVDA 1NSAA 3K5LA 3C7NA 1X5TA 4BR5A 4LIRA 2PEHA 1YVUA 2HHHK 1S57A 3LPUA 1VK8A 2P9CA 1VC6A 5ETNA 3QEVA 3LM9A 2MKJA 3CG7A 4ES3A 3HHLD 5AFUA 5KOWA 5EX5A 2QZ8A 3QEXA 1X4DA 1T44A 2JH3A 2ZBPA 3UE5A 1SQGA 2HK3A 1XEZA 4P2FA 5D77A 2F4VJ 3OS2A 3D0HE 1VC0A 3MD1A 1PYTA 3VWSA 1GX5A 4H5WA 2YWHA 1WSEA 3IWLA 4DX5A 1WDDA 1WF2A 4WKYA 1WEXA 4F3QA 4ZLLA 3PW0A 2IY5B 2Z0GA 3ZXWA 2DBBA 4JYAJ 4JI2K 3GIRA 3MPWA 1VQ4N 5GIPA 2CPDA 2HBQB 3J81O 4ED1A 4BLGA 4IFVA 3R9LA 4KHYA 1A5WA 1T9XA 2C28A 2MDAA 1LW2B 4CP5A 4JP8A 2UZAA 2XG8A 3ZSYA 1CVJA 2YBVA 4P71A 3BY5A 1IBKK 2VFTA 2QG9B 4F4ZA 3GJTB 2QWRA 3M8WA 3J80Y 3A2FA 2XMWA 1IXKA 1XMOK 4F02A 4DR2K 1ZM4A 1KXPA 4OPJA 2FVRA 3O80A 1NNDA 5ETKA 5A2QU 4OYMA 1UJ6A 1GMWA 2FSJA 4CF0A 5ADXA 2F1FA 2V63A 2FF6A 1BD6A 1VQ7S 3QLHB 5GAEI 4M5LA 2DPJA 2KXNB 3MM7A 5ELZA 2OYQA 3SSSA 3NBPB 1FWPA 3OYHA 4LF7F 1XHZA 2QLWA 4FLTA 2CQIA 4EU0A 4I67A 2PFDA 2QE5A 1I94J 1G4CA 2GHWA 2MSTA 3C14B 4N76A 1NSKL 1X4HA 3QO9A 1NO8A 2D3UA 1YHQN 3QFHA 5AJ3K 4QWDA 4ZCLA 5GMKa 4I6YA 3UVJB 1K0VA 2UXBJ 1RAAB 3AO5A 3KUEA 4C11A 4RW9A 4EFHA 3TZZA 4XPCA 4A62A 5H9EJ 2E2PA 4EYHB 5A6WA 4ZPDA 3KOAA 3KDNA 3THWB 3VGTA 3H6EA 3EPIA 1J5EK 1Q9YA 3THPA 4Q7AA 4W5TA 1Z2LA 4OMFG 3OPKA 3BBBA 4FOIA 4Y1DA 3B4DA 3FRYA 5FRMA 1TKXA 2LSNA 3O9UA 3HOTA 4TY8B 1AFJA 2RS2A 5A8KB 3G8QA 4E7HA 1N36K 2AU0A 2VG5B 4EO8A 1HWJA 1NGCA 4BC3A 1SJFA 4CHYA 4M1KA 3UNYA 1VRQC 4GVLA 2XLKA 2LVWA 3RBXA 1PJ7A 4M5GA 4YOXA 5ETMA 1LW2A 4LJMA 3F9MA 1YVFA 2CG8A 3O5BA 3ULHA 1QAIA 3EEQA 2IA0A 3TO8A 4DF8A 2V52B 4NMXA 2HGLA 4RUBA 4B17A 3BZCA 4WTYA 3BN4A 4DQQA 4BRKA 4MLHA 1HYZA 2FDNA 3QLHA 3E9PA 3L0QA 1IG9A 5H1SV 2DXFA 3V4MA 4CHZA 2UV8A 2M5YA 3MM6B 4DSJA 4H0TB 5AQLA 1TK8A 4E3SA 3DXMA 2RRBA 5KT5A 2IM2A 4F2RA 1RHJB 2E5IA 2XSFA 1VLYA 4U9RA 1WSJA 3KHGA 1QAJA 2KHCA 2PYLA 1N8RT 3O4QA 2DRAA 3G4SN 2Q0RA 1NK6A 1CULB 3JSYA 1WUAA 1OH7A 5E26A 4KHNA 4DV3K 1PBUA 3N0VA 2MPUA 4N47A 1GXTA 4LF8K 5M1OA 1C0UB 3ZETB 2Z56B 3O3HA 2CGKA 4DV2F 3LH2S 5JS1A 1NHVA 1YBUA 2HVDA 2QWOA 3KWMA 1N34F 2GUPA 3Q8QB 1B0PA 4E98A 1PO6A 4DF4A 3BEGB 1EO1A 3QAUA 4IQMA 2R8KA 4B3SJ 5IWAK 3G82A 2I38A 3RAQA 5AE1A 3DNCA 4USIA 1G99A 4DR3F 4IDKB 2V7ZA 1RWWB 4XEIA 4FLWA 3HRGA 2ZVIA 3H2LA 4WK3A 1UWBB 4A8FA 2O67A 1ZTWA 1RB0A 2R7VA 3GG1A 1D09B 5DG9A 4AHTA 2QWPA 1YTUA 3AA8A 2A1SA 1RLCL 2DY4A 5FDLA 1LQ9A 4ID1A 2HWHA 2PC6A 2HNYA 3LDNA 4PXDA 3ZT3A 2HYIB 2FQQB 4B3MF 4FZZA 1GOCA 3GIMA 3KMQA 4DEZA 5DDRC 3PO4A 3K0JA 3QJPA 2XI3A 3ENAA 5DDQC 2XCPA 4G1IA 1RT6A 4EZ6A 3TR5A 2GIQA 2OKQA 2I5JB 4BQLA 2OEMA 1FESA 2JFKA 2F8TA 3N28A 3P83D 3UWTA 4J9VA 2F4VK 3DXKA 4Z2XA 3I56S 4QQBA 1FXRA 3ISNC 3OXFA 3T6BA 5CYMB 2IBKA 3D6TB 1YZ6A 4X65J 3KLIA 3SIPB 4ZKAA 2KDOA 4HT5A 3SCKE 3T5KA 5F9NA 3FBCA 3KG4A 4FP9A 3FCHA 4JYAK 1UWAA 4LF9F 4ANDA 2HMPA 3CB4A 1HHSA 4J9OA 1CULA 4CIGA 3AXKA 3Q2SC 2P9SB 2FLOA 3CCLN 3QESA 1WBBA 4CEDA 2JLGA 1KEKA 3CM6A 4NCGB 1VHIA 1Y64A 4GVEA 4FM0A 2HWTA 4ETXA 5F8IA 5HBMB 3O3GA 1JLQB 5LJ3Y 4KO0A 4K5RA 5HP1B 2ZH2A 1UW4A 3CVKA 3KLEA 1NK4A 2Z30B 3QGGA 4NA1A 4HEA9 5B0GA 1CJKB 2K3KA 3CC7S 1TAQA 3EWGA 4YOVA 2GGPA 2I9SA 1K1SA 1NH8A 4IDKA 1MSWD 2R2SA 2F9JA 2HQ3A 1M1KO 5AQPA 4JI0K 2ZOGA 1UWBA 3DLEA 1P90A 4CLPA 3CXCR 1QE1A 5IQ6A 4LFBF 3OV7A 4M5JA 1I94K 5IC4B 3M9NB 2VQEF 4L3QA 4FJJA 3BGLA 3IXQA 3UDEA 2NXUA 1GTEA 2DHSA 1WHYA 3SAFA 3Q7BA 2VCPA 3FZLA 2NUHA 2UXBK 1M5SA 2V34A 3HFKA 4QAGA 5J1NA 1QVGM 3MF5A 4M5IA 1D9DA 4ZA1A 2UXCF 5H9EK 3QZ8A 2OA8A 2BRKA 3PCOB 5HJXA 2GVZB 2RB7A 1WD6A 5KG3A 4KT0C 5FLXU 3TAMB 3G71S 2DEJA 2OAUA 3W2VB 1R59O 5CYMA 2ZDOA 2MKCA 5BPNA 3FFIA 3BSOA 3MAAB 2OPRB 4K50A 4LF7J 3U1NA 1GAOA 3J7YP 1QZ5A 2FD2A 4LQ3A 1NGGA 4G6VB 1UPMB 3TRGA 4X64F 1HD1A 3FNNA 1GLEG 1D9FA 4LRAA 4RNFA 2XS5A 1S5JA 3GYXB 5L38A 3ONQA 4OFZA 3DLGB 4PHTX 5JUMA 1NSQA 2ZWPA 2X7IA 3V6DA 3CD5A 1EETA 4KGMA 1XC9A 3UFCX 1H2TZ 2RVJA 2XY6A 2VBZA 3PTWA 2H9ZA 1WEYA 5HI7A 3ZX0A 4OJ3A 2V94A 4GV6A 4OX8A 3ZSVA 4Q0BA 3PJXA 3DWLA 3LPTA 3FBFA 5FROA 2JWKA 4TLQA 2YHYA 3GIJA 2UP1A 1G7CB 4KI6A 5GADI 3A0IX 3L7PA 5B7WA 4FJ5A 2DHHA 3N01A 1M90T 1IQZA 1C4AA 3OUYB 2FF3B 3SXLA 3GE9A 2NZCA 2YNFB 1LAWA 4QCLA 5JXSA 5EWGA 1RBVA 2HOEA 3B8HA 4OPAA 4HDHA 4J91A 1OS5A 4CFDA 3PVXA 4DZDA 5B09A 3NP5A 1QAYA 4KHUA 3EE3A 1S77D 3MDQA 5LMUF 3K2YA 1CPZA 2KO1A 3A12A 1C6VA 1H6KX 3RBZA 1P8GA 3UCZP 2WBRA 3OVAA 2YI1A 1SBRA 1RBAA 3ZT1A 4WQ4A 3TU5A 5CA5A 4FK2A 3OYFA 1OMSA 1KRPA 4NLBA 5E3PA 3HHEA 3NS7B 3GJRB 5K20B 1Q86T 1RBRA 2FHJD 4V19X 3DLHA 1QSSA 2DNHA 3TAMA 3ZNUA 2O8BA 1TELA 4CLUA 4NLVA 4C23A 3AARA 4FDFA 3RUBL 4UY8T 1RGVA 4I6WA 2QM1A 2OPRA 4M94A 4PQUB 1GMVA 5EOYA 1U26A 3DOMB 2CQGA 4IJAA 1WB9A 2NSCA 4RBUA 4MKVA 1BY9A 2GS8A 1L3TA 1APSA 2G2OA 1NGJA 1SC4B 1FHTA 3GL1A 2AD9A 3DLGA 1NJZA 2BKPA 2UUBK 4PG6A 4QYRA 2W25A 2R2TA 2E4LA 1Z05A 3WQUA 4DKWA 3FFKB 1YJTA 3MCAB 1T02A 5IT9O 1C0MA 4ES1A 4YDDB 4HH1A 3CQXA 4F67A 4I6MA 2WHOA 4J9LA 4A8OA 4OI0A 2LKZA 3U6FA 1X8DA 3L7UA 3UI3A 4Q8EA 3TQEA 3AOCA 2UUWA 3KLHA 4KSEB 3HP6A 3MAQA 2QC3A 3OUYA 2YKMA 2GO8A 1FVSA 3GP9A 3ET6A 4P2XA 3CCUS 4JK9A 1D0EA 2R4FA 4HI2A 4GKJF 3LL3A 3RR7A 1S3XA 2BH1A 2QJ3A 4DR3J 2AYEA 1J2VA 2FJDB 4RUHA 3VQBA 4X65K 3BH7B 3QZ7A 3CMAN 3HK2A 3MMVA 4Y1CA 1HUXA 1VSFA 1YI2S 3PR4A 4K4SA 4OZ3A 3ZZRA 3NGIA 3D6FB 5J1PA 1ZBHA 5AXNA 1R43A 5J2PB 4B3MJ 3W9JA 3M2UA 1TL1A 4EBCA 4HUGA 2V2VA 1S1VA 3IFEA 1GLCG 2MZQA 1RTHA 1LV5A 1T11A 1FKPB 2HS0A 2JOQA 2KL8A 4G1PA 2QSFA 1BO5O 4DL6A 1GLLO 1UVMA 3D5MA 1Q95G 2Q79A 1BXNA 3DM2B 2P5OA 4MIAA 5ETQA 4ZCIA 1Q53A 3MTKA 1JNZB 2RH3A 3M6WA 3PW4A 2DNOA 4TQRA 3VQ5A 1K8AT 2FZGB 2E5LF 1XNQF 2BE9B 1QLNA 2HW3A 1NHKL 1F2GA 2FC8A 3J81Y 2VZ9A 1KLMB 3LWMA 3VPZA 5CZ2A 1TV6A 4FW1A 4IG0A 3K17A 5FPNA 3MEDA 4RW8B 4DMNA 4L76A 3CJ4A 2ZE2A 1VQNN 3LUYA 3NNCA 4KBIA 4CTAB 2CQ2A 2GQ2A 3CULA 1Q81T 2R8IA 2WW4A 3CC2S 1XNRF 4Z4GA 2H4WB 2LDYA 2FBTA 3H45C 4Q2MA 2YKOA 5KFVA 4USTA 4NASA 1AFIA 4JAXA 3BBFA 4OHZA 5MAOA 3R5JB 2W7PA 3BPDA 5I3UB 4YQWA 1FE4A 3ILLA 4WKRA 3MEKA 2F5GA 2FY8A 2MXYA 1N8RO 4CJQA 5DLGA 3B6PA 1WHXA 1L3VA 1S4EA 3GB0A 1X4CA 2M8HA 4FSVA 2ILZA 1ZAVA 2VL1A 3SFUA 3KLFA 5GAGI 3KK3B 3SI8A 2B4UA 3M2VA 3ATVA 1ZH5A 3AGKA 4DV0F 3RMCA 4OPKA 4LF7K 4QWCA 1T9WA 3HVRA 1LAVA 2CPHA 4LFBJ 3WNGA 4ETZA 3BBCA 2QA1A 2R7XA 3VTIA 3L7OA 4RUCA 2FSKA 2DNYA 5BXIA 3P39A 2W9BB 3RWUA 4CGDA 3OR2B 2W01A 2ZJPQ 2QFJA 3D9BA 3G6EN 4JKAA 4OKKA 2UXCJ 1PYSB 2GAGC 4JD2A 1KQKA 3O8MA 5CCMA 5D4OA 1S4FA 4IOCQ 3M1VB 4Y3CA 2HQGA 4F4AA 2RQCA 1FRXA 4F3TA 2Q97A 4IEEA 3LAKA 3I0SB 1WLJA 4CHQA 3FBBA 5AQWA 2J0WA 2XMVA 2IBOA 3KJFB 2IVFB 4DPXA 2C3PA 3ZTOA 4KHRA 4CTAA 4JEPA 2AJFE 3GFZA 2EXUA 1ITGA 4PAAA 4CFCA 3H98A 4KTQA 2WONB 3S9HA 3QT7A 3AVHA 1IKYB 1WHWA 2GELA 2GMLA 1T6DA 5E41A 5I3UA 1TL4A 3TI0A 4J7CA 2RRNA 1RILA 2EBEA 2IRUA 3OHRA 3OTEA 5C42A 3M8ZA 2ZH9A 3FZMA 3OL7A 4MAKA 5F1XA 1LOUA 2QV6A 3LP0A 1LEOA 2NR0A 1NJIT 3MUTP 5L8RC 3VGUA 5LY3A 2EC2A 1RDCA 2I2YA 4X4RA 3DMJA 1YHQS 1NU4A 3KJVB 2HF3A 2Y8YA 4A61A 4J9MA 5EGYA 3QINA 3G8TA 4J37A 5LMUJ 4K4XA 4FYVB 4M3RA 1UTAA 2WSEC 2GVDB 1FDNA 4JV2A 4M8LA 3PEJA 2O3DA 3O44A 2ZGYA 3SUPA 5AQQA 4B3OB 4Z4FA 3FBEA 4FNHA 5E3CA 3OR2A 4KFBB 1IKXB 4JBCA 1X60A 2NRTA 3QBCA 1TVRB 1NM2A 4U8YA 5RUBA 1Z25A 2Y1LB 1BCOA 5M1PA 4RCHA 4DV2K 3CJBA 1KD1T 4KHPF 3TUJC 1N34K 4FJ9A 3PYGA 4CD1A 3UIQA 3TJ9A 1IQTA 4GW6A 3LDPA 1TYQB 1C0TB 3TTFA 3I0SA 3HVTB 3VEVA 1OY8A 3OS1A 1HMVB 3EPGA 1RQ0A 5KFSA 4WQ5C 5JMVA 2DO4A 4UUWA 2BE7D 2E9TA 2MHEA 5DM7Q 2R2UA 1S9EA 1XBWA 3CQYA 2WSCC 3HCXA 1W7WA 3K0SA 1FDAA 3VGMA 1Q79A 3NGTA 4FWLA 4BCAA 4NCBA 1RCXB 2D0BA 2OPSB 4B3MK 1C1BA 1DTTA 4USUA 5EVZA 3QT6A 2BE2A 2YHBA 4PZVA 4H4KA 1S76D 4YY3F 1ZZNA 3MN6A 3T5JA 2E2QA 3A5LC 1R27B 1H98A 3JS6A 4GKJJ 2VIHA 2EFNA 3PG9A 4M3TA 5J2MA 2W9CA 2ALYB 3MM9A 3HHNB 3KJVA 2XHBA 4EUVA 1VIXA 1HLWA 1S1TA 3SK3A 1OJ4A 1AZSA 4LF9K 1VQ5S 4K0KF 2B56A 2K1RA 2ADBA 1S9FA 3CE8A 2YNGA 4B3OA 5B08A 4GVBA 4DJBA 1R0BG 3MPYA 1HI0P 1HD0A 4KFBA 2LQ8A 1CBKA 4Y2AA 1WSRA 1R8CA 3W3SA 2MKHA 3PFOA 3BO2A 3BYRA 3T1HF 1XIQA 3AD7C 3TPQA 1YZ7A 2CNOB 4ED2A 4ED3A 1J53A 4JI6F 1FWLA 4ZK7M 4FXDA 3VERA 1WC0A 4M63A 1RKJA 1KCFA 4RNHA 2WVEA 1VQPS 1ACMB 3AJ1A 2F96A 4RW6B 2HLTA 2C2EA 1KTQA 4CHNA 2E5LJ 1BWFO 1TYQA 2BTFA 2PYJA 3MR3A 2JRSA 3GBTA 2VGNA 3HVTA 3HSCA 2DNNA 4LH5A 3BGOP 2N82B 4NLSA 3J7ZT 2FIUA 4IKAA 1Q86O 3I0RB 1FXLA 2XY5A 2CH6A 2YKAA 1NWKA 2PMZD 1XNRJ 2JL9A 3RRGA 4LFBK 3FZFA 3B8AX 3IG1B 3H7HB 9RUBA 2K7KA 3W9HA 1L3UA 2VQEK 3GSDA 1R89A 4OYWA 4UY8O 3P8BB 2V8PA 1VJQA 1G15A 4ZVSB 4OJRA 2XGPA 4J5OA 3TEHB 3VEZA 2J5AA 2DCUB 3ULEB 1FX2A 2CVEA 2Z2YB 5LM7E 2UXCK 3RW7A 3QFWA 4XO0A 5D78A 4KI4A 3VF6A 2QFIA 5CAAA 3NF9A 1WAFA 3DJCA 3J7A1 4W5QA 3N4WA 5J2QB 1KONA 4DOZA 2AZ1A 2ZJQQ 3QYYA 3W65A 4H5NA 4DL0C 3GFHA 5BRFA 2PY5A 4TYBA 4OJHA 1ASUA 1K73T 1RAGB 3QIPB 2ZZNA 2CNLB 2IVMA 1C2PA 1TGOA 3C16A 3GFYA 4X64K 4KHSA 3CCQN 4LF4J 3D68A 1BE4A 1DARA 3O9TA 3SQ0A 2HBRB 5F8JA 3NH0A 1U0HB 4FZVA 3DDNA 5DG8A 2AWZA 1FRJA 4A57A 4ZHRB 4UT4A 5F8NA 3T5LA 2VA2A 5JLFA 1JX4A 4JI7J 4C3LA 4F04B 3MMJA 2MKYA 2ZJPL 5GAHI 3DI6B 3IO1A 2W9AA 2QA4S 5H1SQ 4N8OA 2NLXA 4M3YA 2QL7B 3IM9A 1HQUB 2K06A 4IOCL 4I6AA 4M5MA 1JLCB 4A48A 2DR7A 4HTIA 2H65B 3MURP 1EARA 5M1KA 5AXMA 2X78A 1TKTA 3C19A 3VZHA 2VGMA 5AQRA 1WG1A 2PEBA 3ZZOA 1S0OA 3VA3A 4MQ3A 1DURA 4YOYA 1QSLA 4FO0A 4NEZA 3BM7A 3DRSB 1QQNA 5GMDA 3V1OA 1EKRA 3O6QA 5CH7B 1VDHA 2HHUA 3V9UA 2F9DA 1WOQA 2G8WA 5TKYA 5LMUK 3R2CJ 1JCGA 2HB5A 3MM5A 4OHXA 1SS6A 3F2KA 2V9WA 2E1AA 1K8AO 4RLEA 5CABA 2LCWA 2A41A 3W5XA 3TUIC 3RBEA 1S12A 3K9KA 2GFFA 3RR8A 4OX6A 2ZD1B 2OSQA 4ILRA 2F40A 4H0YB 3HX9A 4CZLA 5EX3A 4PL7A 1FRIA 3H3OB 3AB4B 2Z57B 4MDBA 2UUCF 2MLZA 1BCMA 3ZTRA 1Q81O 4RU9A 2KYXA 2JDJA 3SUQA 2HVHA 2XNQA 5GVQA 3VQ9A 2VJUA 2A18A 4KQZA 3M6XA 1FI4A 5B0AA 2PDAA 2X3GA 4BHQA 1NXIA 4O44A 5F9LA 1C1CB 4GMKA 4KTZA 3OYAA 2P5GA 1GLBG 2I6WA 3E3XA 2CZ4A 1UVLA 1CLFA 1Q78A 3DLKB 4PYDA 3C46A 2W2MP 1U0HA 5IT9Y 4XDCA 2OANA 2ZH8A 1IJEB 3DRPA 3RU0A 4JI5F 2K2PA 2FB0A 3E1YA 4BG8A 1T03B 3I4HX 1WKKA 5M2UA 4FS1A 1YJVA 2W1BA 1MWZA 3WHIA 5GAEP 4RNOA 2AYBA 2R7RA 4UQTA 3OR1A 1Y97A 3GJSB 3MPDA 2HLUA 2XMMA 2OUGA 2HRUA 3V9XA 2X1AA 3WXIA 3NF8A 3FJ2A 1BQXA 4IOXA 3BJYA 5DLFA 3C6TB 1Y5IB 1R0CB 5KG1A 4GKJK 4TLRA 4LSLA 3TR8A 3VALA 4BR4A 4PXCA 2AEMA 4YFUA 1M5PC 5DM7L 2VC1A 3FCVA 2HMIA 2W7OA 2OTLS 4RX6A 3CJ8A 4AHUA 3WZ0A 1TMJA 3W1YC 2YQ0A 1NMNA 1H1VA 1P1LA 4ZVGA 1RT7A 2POKA 1OQ3A 1N32F 2OIHA 2QWQA 5T7LA 4J9QA 1AROP 3D2EB 2BJ3A 3ZFVA 3G9CA 4A4JA 2O8DB 4ZDNA 4JV0A 1JXVA 1FNOA 1VQON 1RKIA 1O5JA 2YX4A 3SQ1A 5LSLA 4J2BA 2E5HA 2ITMA 3UCGA 3OW2R 4JRPA 4NZ0A 3NG8A 3SAHA 4YY3J 1T6CA 2HIQA 5CQGA 3UW1A 4ZJOA 4BRHA 2EK1A 1MA9B 4G9ZA 4K59A 3PIOL 4A8YA 1RU1A 3ZT4A 3EE9A 3EGNA 1XNQK 3OHBA 2C2OB 3OYEA 3PFEA 4CGIA 1FDBA 4BBYA 2PI4A 3VF4A 3U02A 3EDQB 4F4XA 1M5HA 3TSPA 1KHVA 3L2QA 5C25B 4K0KJ 4HVZA 1RLDA 1MWYA 3OL9A 2M3DA 5BR9A 2NRZA 1NJIO 3KYLA 1XNRK 3ULDA 2A0FB 1RTIA 1B7YB 4QS7A 1CSJA 1HFEL 3T1HJ 1BA0A 2HHSA 1TTHB 4QIVA 4H0XB 3VETA 4Z7YA 3V2UC 4C1NI 1UFKA 4BE1A 4CO2A 2L3MA 5KGXA 1MU2B 4YB1P 4LF6F 2P9NA 5DQIA 3TABA 3C6TA 1UMJA 2UV8G 3KLVA 1E6VB 2XHCA 1UL3A 4H4MA 3TP2A 3D67A 4R0JA 5HQLA 3ZT0A 3QNOA 4DSIA 2AYGA 3KLGA 4DV0K 4IO9Q 3KHYA 4BC7A 2WTFA 2RQMA 1NB2A 4NRUA 2B8QA 1VI7A 2UUAF 1KD1O 3B4MA 5KFQA 4N56A 1CZBA 4CZFA 4I7FB 2FGOA 4B9MA 2BOPA 4URQU 1QAXA 4DDFA 5F0UA 4LY7A 3BO3A 1NDKA 3C65A 3OYMA 3LDQA 3GU0A 3MFHA 2JNJA 4GV9A 3Q7CA 4DCOB 1HWUA 2LMIA 1Q18A 1BIZA 2XO7A 2ZBQA 5CD4A 4E7IA 2H5EA 5CZ1A 3EKSA 1VQNS 3PX4A 1HBUA 4O3NA 3Q83A 1OQ6A 2HFZA 4LC9B 2Q2RA 3ZZUA 2ZJQL 2ZH6A 3DDIA 2MQNA 3EZWA 1IV0A 4JLHA 4HDGA 1BQNA 2A40A 3MOJB 5LXYA 2B7BB 3L2RA 2A42A 3CIMA 5L46A 2VF3A 4NRTA 3UNGC 2I7NA 2PA3A 5F8HA 2X3DA 4KPCA 4DQRA 5C24B 3EO3A 5KFBA 3A5MC 1F2HA 2FJEB 2RN2A 5E3QA 2RDJA 2MTLA 2YNHB 3M8RA 5HRNA 3L95X 4GY2B 3IS9B 4W4MA 2VD3A 2ETJA 4HKQA 2XMAA 4IDHA 1SQFA 4DCPB 4U6PA 4PWDB 4K7QA 4IXCA 3JB9k 1TU0B 2L41A 4LT6A 5HK4A 2E8AA 1YSJA 5E0OA 4WFZA 1CEZA 5KQ8A 2VWKA 3VQEA 3M9OB 4FBTA 3V81A 3J7AP 3ZSXA 1FK9B 4RUAA 2ZNZA 3WX4A 5K8OA 1WORA 1A5VA 1F9HA 4RW7B 3SMZA 2HVZA 4CJEA 2JX2A 4IH5A 4FJGA 3QSIA 3D0IE 2GIRA 3G6XA 2V8VA 3PKMA 1PG5B 2RDDA 1GT8A 3N5FA 1KVBA 2G8KA 4EBEA 1HWLA 1RHRB 2R7SA 3IR6B 2E88A 4FLXA 1RTDA 3SCJE 4ZTFA 4LFAK 3QBXA 3ISND 2M7SA 3SSQA 1YKWA 2G0IA 1NM1A 4CJ4A 1S72N 4BRLA 4F2SA 1GOBA 3MM8A 2UXDF 2R7OA 3DGVA 1Q82T 5FRNA 3MUMP 5IXUA 4DG1B 2LFVA 2QL9B 4NLXA 4IUFA 3D3BJ 3SMPA 3J7ZO 1IWAA 3D6HB 4M3WA 4QR1A 4TNOA 5LSOA 1HKGA 3MDFA 4BRPA 1YF5L 4MIBA 4OPHA 3FE1A 3EVMA 4LSNA 4KHPK 4Z0UA 4PG7A 1W2IA 3VCDA 3MK6A 1CQNA 1HPMA 3H40A 1RT2A 1RI7A 5AQUA 4X62F 4CGGA 1KAXA 1RYRA 5AFUH 3CCRN 3FZHA 3UKUA 3CJQA 5JLHA 4QIWD 3BSNA 1RWVB 2WUSA 1WC1A 1JLFA 3BKFA 5C24A 3QPIA 5A8RB 4KGVB 1TL3A 3JTNA 3DU5A 4CM2A 1C0FA 2XZTB 2MZTA 2HQDA 3W3DA 5AZIB 4JI5J 2AZ3A 4G1QB 1VLOA 4B1YB 4J2DA 3I8DA 1RXOB 2ASYA 2QXFA 3C95A 4BRNA 4PWDA 3IR5B 1K73O 1QUPA 2LXUA 1HQEA 1NGDA 3J7YU 4QR2A 1VAZA 2OELA 1K47A 2ZHBA 3EZUA 5B0CA 2DR5A 4JHDA 2J6SA 4RKUC 1TKZB 2O4IA 2EW9A 3P96A 4ZPBA 2HBMA 4YY3K 1FK9A 4DR2F 1VHFA 3GYGA 4CIEA 4I9QA 2RF2A 1F60B 3W62A 2CDRB 4L3KA 3F73A 1RFQA 2NS1B 3N6LA 1T0TV 1ZM3A 4DFJA 5F41A 1T94A 3NAHA 3C6HA 5KPZA 4WK1A 2NRRA 1ZBTA 3RSEA 1CJTB 3HVWA 1YUWA 4PRFA 5IM0B 1R0AB 1JLGB 1N32J 3C66A 3KK1A 4K0KK 4NXNF 4DLGA 2QWNA 5GADP 1YG0A 3I32A 3IRWP 4WCEQ 1BWVA 2IS3A 1ZETA 1DZ5A 2MLYA 2IMOA 5J2NB 4WP3A 1EQ0A 3T1HK 4JI3K 4MTPA 4RPFA 3UN5A 2W6LA 4JI6K 1BUPA 4KPYA 3CCEN 3A3OB 2LQ5A 2KFYA 4OZ5A 8AT1B 3CJ0A 2G4BA 3OBWA 1ILYA 4IJNA 3RB3A 3GWCA 2FLLA 1N5VA 5M1NA 1OSDA 5D0HA 2DY9A 5F0XA 2H5JB 2KG1A 4CJVA 2E7WA 2NCKL 1M5VC 2F9TA 4J9NA 1U8SA 2BACA 5AR0A 3UR0A 5A8RA 3NGZA 1W2BR 2VODA 3TA0A 4NLDA 4HCCA 3O4WA 4YB6A 4X4TA 3EN9A 1ZPVA 5KT3A 3P6YC 4KY3A 3G6YA 1IJFB 1SV5B 1NJYA 2RUGA 2YX6A 3FCWA 1S0MA 2IJRA 3AO3A 4LUBA 1RBSA 3FGUA 1UEUA 2CZVC 1FRLA 1Q4RA 4BACA 3K8VA 4CF2A 1MROA 5KFAA 1Z26A 3JSRA 2V4JB 4LF6J 2BGGA 2QO3A 3QGPA 4IG3B 1SKWA 4CIFA 3PLAA 4A8MP 2YWGA 3BV8A 3PXGa 3EVOA 1D8ZA 1A9NB 4EI2A 2HFVA 3HSGA 5EXWA 1TUWA 4A5BA 2EWHA 3US5A 1F5BA 3LF0A 2OPQA 3OTDA 2YPYA 2DCLA 4ZVRB 4RTFD 2H51B 4UF4A 4JKHA 1FKOB 3OTOJ 1HI1A 4R5PA 2UUAJ 2YHAA 3S1TA 4DZ6A 4X4PA 1OH5A 4QPXA 5K14A 1I39A 2AKWB 2NUUG 1FO1A 3D45A 2DXDA 4AHVA 5AQNA 3POTA 2CDQA 2MEWA 4UQGA 4FS2A 3JSMA 3AO1A 1RTJA 2RIJA 3AVLA 1WKLA 2KJWA 2OD6A 3WUHA 4DV3F 4M7XA 4ELUA 3CIZA 2YNIB 4ZN1A 4PQAA 4DTPA 2IMWP 3TJAA 4OI2A 2ERRA 2LXIA 4NI2A 2Z2LA 1NHUA 3MEGB 3FDSA 3TYTA 1NPPA 4DCJB 1HA1A 2KRRA 2ZQBA 1VBYA 4EHTA 4X4UA 3RGIA 3JAMO 1MN7A 2N4DA 4GKKF 2QMXA 4EAHD 2JEGA 3M8YA 4X4OA 4DR6J 3SYZA 3SJJA 3BGFA 4NZ6A 4UY85 1SC6A 1FT8A 2XB2D 3CCWA 1NPKA 1TL7B 3L9ZA 3IMXA 3LP1A 2G13A 1U7LA 4NCAA 2QLFB 2HNDA 2Y0BB 2FGCA 5EN1A 4FJXA 2Z1GA 2DIUA 1PIEA 4YR3A 4H54A 3GR1A 4ICLA 3V5RA 3OD2A 4J9KA 1YJ7A 3BF4A 5DRKA 1U4BA 1SB6A 1XN9A 2XS2A 5DDPC 2OH2A 1DTQB 1LOTB 2J9DA 3DCAA 2O8EB 2W24A 3W5YA 3P38A 1YJNN 2UUCK 3TWHA 5C12A 2KI2A 2QMUB 4S0MA 3HSDA 3OSPA 3C3LA 5TKWA 5HMWA 1PYOB 4ENOA 5I42B 2PD1A 4AE5A 2MZ1A 5LXRA 2DPNA 2A2CA 3HHLC 3HO1A 2YHXA 2ATCB 3FSIA 3OQ2A 2J0XA 2ZC3A 3CJKA 3U8XA 4ECYA 1VRTA 2HFOA 3H1VX 1XC3A 1R7IA 1FKOA 2DGXA 2PN6A 1N5TA 5HL7Q 5EDWA 1LWCA 1OY6A 5FPEA 1VQ8N 3VQAA 3WEEB 3NLCA 1JLAB 4PUOB 1RT5B 2RU3A 4JI5K 1R8AA 5DK5A 2UXDJ 2X6NA 3FEXB 4TYAA 2Z1HA 2PAVA 1VSMA 5GAGP 2GHVC 3H5YA 4A59A 1UAXA 2J9DE 2ZH1A 4OHYA 2HHHJ 4DR5F 1R6VA 3MEGA 1HLUA 1SQKA 2AJ0A 1S6UA 4OI4A 3HSJA 4WP8A 3EGWB 2YWFA 2XO6A 2B5JA 3D1QA 1A0OB 4HI1A 3TA2A 4YEAA 5A8WA 5HMZA 3SSRA 3AA2A 4E19A 1I6JA 4X62J 2MJNA 3A13A 3I55S 1JCFA 4FKXA 1VSIA 3AXMA 3H25A 2Q1NA 1QDUB 4KE5A 1PCAA 5K5MA 4OZLA 5E2QA 1QQOA 5HROA 2F63A 3CCSN 4FWMA 4F4WA 1DY3A 2QA2A 3VENA 4TVAB 1HX1A 2HQCA 3HI0A 1UVNA 2DTJA 3HBTA 3OYLA 4K4ZA 1CLQA 1GOAA 4D3HA 1VQKN 2GNKA 2YTCA 5DMRA 3EUNA 3ENOA 1ZM2A 4FLZA 5KG4A 3K59A 3SQGB 3TW0A 2CPEA 4FVMA 2P9IA 4MK7A 3NGKA 3JS9A 2MZRA 4CJ5A 1IBKJ 2RS8A 2O8EA 4CECA 2MLXA 1LWXA 2UUTA 1XMOJ 4I2PB 4DR2J 3NF7A 2A3JA 3Q8PB 2P9KB 1FRKA 2JSXA 2EEYA 2C1EB 1U6BA 2IYGA 3UDLA 1LWFA