5HROA

Structure of hiv-1 reverse transcriptase in complex with a dna aptamer and an alpha-carboxy nucleoside phosphonate inhibitor (alpha-cnp)
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
551
structure length
551
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Conformational States of HIV-1 Reverse Transcriptase for Nucleotide Incorporation vs Pyrophosphorolysis-Binding of Foscarnet.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate bh10)
molecule tags Transferase/transferase inhibitor
molecule keywords HIV-1 REVERSE TRANSCRIPTASE P66 SUBUNIT
total genus 145
structure length 551
sequence length 551
chains with identical sequence C
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2016-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 5hroA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5hroA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5hroA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5hroA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5hroA05
3C94A 2VG5A 3GIJA 1NOZA 4CJWA 3ISNC 3PO5A 3P1GA 2G8IA 2ZE2B 5F8JA 3KOAA 3IN5A 4W5RA 4QWAA 1JLFB 4IH5A 2OPSA 1GOCA 2DTUA 1RT1B 4CJFA 4RW8A 4K50A 5DG9A 1G15A 3RMDA 1QSSA 2B43A 4Y1DA 3L2WA 4Y34A 1NJZA 1NKCA 1Q9YA 1RT7A 3O3FA 3FRZA 4DQSA 4ZHRA 4BWJA 4FXDA 5KFRA 5DQIA 1HQEB 2BE2B 2VWKA 3AVJA 1QSYA 3AA3A 4FM0A 1QSLA 5JS1A 2ZKUA 2D0CA 4C8KA 3OYBA 3IAYA 1W25A 3HKWA 4DG1A 3NGZA 4WZQA 1CZBA 3L2VA 3BJYA 4B9TA 1NKBA 3BSNA 2UVVA 3OJUA 2J6UA 4ELTA 1RT3B 3MTKA 3KHGA 4ZPDA 2A1SA 3AVMA 5HLFA 4K4WA 4FLXA 3SZ2A 4KI4A 3K5NA 1SL2A 4TLRA 3SCXA 4M3YA 4WFZA 5KFOA 4WFXA 2P5GA 1IKWB 3I5CA 1JLQA 4DS5A 5KFJA 4IBNA 2VA2A 2PYLA 2V0NA 2ASLA 1BIZA 5CY4A 3L8BA 3DOLB 4FJHA 2G8FA 1WAFA 2Q3SA 3QEPA 3HYFA 4ED1A 3OLBA 5J2MA 5K14A 4ZMMA 1S6PA 3GILA 1WSIA 1VRUA 3BGRB 3OYJA 1T03A 3OHBA 1LWCA 3LP1A 1YTUA 1S6QB 3LZJA 1S1TA 2HHQA 3KLVA 1S97A 3GIKA 1RTHA 1ZETA 2J6TA 1S1VB 2ASJA 4NCGA 1D9FA 1XHZA 1S1UA 3JSMB 3ZSXA 4FJNA 2RN2A 3CM5A 3H5YA 5KFZA 3DRSB 4CIEA 4JRQA 5JS2A 5KTQA 2AX1A 3OS2A 4IKFA 1RT4B 2EC0A 3HVWA 1K6YA 4Z4FA 1JLCB 3C6UB 1A5XA 4KHYA 3HO1A 1TL1B 3QIPB 4CGDA 4Z4HA 3JSMA 4XPEA 1J53A 2AGOA 4O5BA 1C2PA 5DQHA 3QGIA 4IG3A 2EHGA 4BDYA 2ASDA 4DMNA 4PWDB 2V4RA 2BQUA 1TL1A 3QIPA 2W9BA 3CFOA 1S1TB 3QGGA 3K57A 3C6UA 4MK8A 4QOZB 2E9TA 3QEIA 4O4RA 4IFVA 4CF9A 2AX0A 1MMLA 5KG0A 1TKXA 5KT4A 3DI6B 4DWIA 3RMBA 1S1UB 4CFDA 3I5AA 3DRRB 4NLUA 2XY6A 1RBTA 4K8XA 4OKKA 3HP6A 4QW8A 4J2AA 1WSHA 4CHOA 4YFUA 3NGIA 3G6XA 3PV8A 4W5TA 1CLQA 3U6FA 4I2PB 1T03B 2RKIB 3PO4A 3Q8PB 2GUIA 4ZVHA 3SI6A 4K4ZA 3RR7A 4DQPA 4ID5A 2IJNA 5C25B 4UQGA 3NAEA 4DL7A 3SV3A 1MU2A 2ILZA 4ZTJA 1RT5A 4DTXA 1GX5A 4OGCA 1NK9A 1DLOA 3QZ7A 3CO9A 2AWZA 3NAIA 3EPGA 2V4QA 3G6VA 2FLNA 5SWMA 1DTQA 3CWJA 3KJVB 1U4BA 3BREA 3VQ7A 5KFWA 4U7CA 4CFBA 1NK0A 3QEXA 3AVKA 5J1EB 4FS2A 3AVAA 4ED6A 2FC0A 3OL7A 4PY5A 4QWCA 3PW0A 3AO1A 1D1UA 2Z1HA 3S3NA 1TKZA 3U3GA 1BIUA 2HAIA 2BQRA 1EXQA 1XR5A 1Q9XA 3KLEB 3TAFA 1BGXT 4YNQA 2UVUA 5EWGA 4LH4A 2OPSB 2R7YA 4DL5A 1HYSB 4HUGA 3FFIB 1FKPA 4B8CA 4QPXA 4M3RA 3V9UA 4HYKA 2XWYA 3K5LA 5D3GB 3TANA 4E89A 4N56A 2IS3A 2QV6A 4I7FB 4J9SA 4N47A 2D5RA 3RRGA 1K1QA 4J9PA 4KTWA 5HRSA 3EZUA 2XGQA 3ITHA 3F9KA 3NF8A 1F21A 1T8EA 1X9WA 4O44A 3PJXA 1T05B 4J9KA 4JV2A 5KFMA 3MR2A 1HPZB 3D5MA 5FDLA 1XR6A 1RBRA 2O4IA 1NJXA 4CEOA 1RDCA 2KW4A 4I9LA 4HKQA 4J2BA 1BCMA 1QHTA 4DTUA 4FZXC 3IGVA 2W7OA 3TAMA 4Y1CA 4IFYB 1TKTA 1VRTA 2DFFA 3NH2A 4J2DA 3IS9B 1T3NA 5DQGA 1QS4A 3MF5A 1HYZA 3RBDA 3OLAA 3M8PA 1N48A 1EX4A 3G86A 1KSPA 4IKAA 3TAGA 3V6HA 2W42A 2HHUA 2R8GA 4RNFA 3RMAA 4E7IA 1HMVB 2IA6A 2ZD1B 3E01B 2OH2A 4NLGA 5KFGA 2HHWA 3OYDA 3ZSOA 4DU3A 2D0BA 5CZ2A 2V9WA 1JL1A 4CK2A 5F8NA 2GV9A 1U47A 3BQ0A 4CIGA 4F3OA 1KLMB 1Z25A 4R0EA 5I3UA 1WSFA 4NYZA 4CGJA 3A2FA 4MIAA 3V6DB 4FZZA 4ECVA 2R8KA 4CJRA 2OPRA 5L9XA 4YR0A 1N6QB 2OPPB 4H4OB 1U09A 3OYFA 4EP5A 3NBPA 4Z4CA 2D41A 3H59A 4KE5A 2XC9A 3Q8SB 4OKEA 4B9MA 2JEIA 3NH1A 3H08A 3DLEB 3DLKA 4J9LA 1S9FA 5KGWA 4AHTA 4CJ5A 5KRTA 4FJIA 4KO0A 5J2NB 4AHUA 2OPRB 4KHQA 2HW3A 4M95A 4XO0A 5KFUA 3VQQA 1WLJA 4QAGA 2XY7A 1LV5A 2GC8A 2C2EA 4NYNA 1JXLA 3KLEA 2GBZA 1KLMA 2X6SA 3QESA 3TAEA 1K1SA 1REVB 1LWFB 4B3OA 4CIFA 1VSJA 4NCAA 1FK9B 3PW7A 3WNFA 2FVCA 1RILA 4W5OA 3RTVA 4URSA 2VG7A 3CFPA 4CEAA 3T3FA 3DDKA 3PHEA 1S9EA 1TQLA 4ZPAA 2YNGB 1TK8A 3KJVA 1NK8A 3LANA 4TYAA 1UWBB 1DLOB 5KRSA 5C24B 1JKHA 4F4KA 3AVNA 3G6YA 4LSLA 3RBEA 3VQBA 4HHTA 1VRTB 3MR5A 4X2BA 2YKMA 3KTQA 3SUNA 2X6NA 4G1QB 3KKSA 4CJLA 3MECB 1BCOA 1DTTA 4URQU 4KREA 4FW1A 4ED8A 3QZ8A 2FVQA 5L1KA 2JGUA 5HP1B 3DMJA 4EYHB 1RBUA 3MR6A 2WK4A 5KG1A 3DYAA 5L1LA 1YVUA 4FLYA 2RF2B 4NRTA 1TK0A 3OSPA 2JEFA 2G8VA 3I5BA 2J6SA 4B9SA 4IG0A 2OZMA 1U04A 3FDSA 1ASVA 4FLZA 4FCYA 4DTPA 1KLNA 4IFVB 3ALYA 1SUQB 4L8RB 1KFSA 3HHKA 4FK2A 1HYSA 2I1RA 1QE1B 5KG2A 1TVRB 1VSLA 3EZ5A 4KFBA 4ZP7A 3ZT4A 4CJPA 3RB6A 2IM0A 4EZ9A 2YNIB 3DLGB 4F4XA 1S1XA 3VQDA 2XY5A 4F4WA 3PW5A 3ZCMA 4CEEA 1EKEA 3BQ1A 3DRSA 2R2TA 3CDEA 1LW0A 1BQMA 2WONB 4AH9A 1IH7A 3M8RA 5C42B 4R5PA 3G0ZA 2HVIA 4BE0A 1TV6B 1C0UB 4CE9A 3SJJA 4MH8A 4FLUA 3C6TA 3H2LA 2AJQA 4RW4A 3RB4A 3Q8RB 3K5OA 1NJWA 1NHVA 3BGRA 3BSOA 3LP0A 2PYJA 3RB0A 3I0SB 3AVHA 1LAVA 5T14A 2HNYB 3TWHA 2AGQA 3ZSZA 1BI4A 5C25A 2DPJA 3K58A 5F8LA 3BQ2A 5KFKA 1IKWA 4NRUA 3TVKA 3VQ9A 3OYLA 4K4XA 4M3ZA 2QKBA 4KAZA 3I0SA 3CVKA 1RDBA 4O3SA 3QINA 2FLLA 1SH3A 2UVRA 4KB7A 4DQQA 4DF4A 2XCAA 4DQIA 4CJ3A 5CZ1A 5KT6A 1BI4B 4TQRA 3IGNA 4DTSA 5DLFA 4KTZA 2B6AB 2HNYA 4DL4A 4WYLA 4O3OA 3AA5X 1LW0B 4XIUA 2NUBA 4TYBA 4PUOB 3AVIA 2B5JB 4KHWA 4Q45A 4NLQA 2HVHA 4BE1A 3CIZA 4RW4B 4RNOA 3G10A 3VQAA 5JXSA 2W9CB 4E1NA 4IG3B 4ZHRB 3KNAA 5KFLA 5C42A 1Z4UA 4Z4IA 4ECQA 1QE1A 2HMIA 3M9MB 1BQMB 3VQPA 2HHXA 4LSNA 3CJ2A 5FROA 1SUQA 3QO9A 1WN7A 2FVRA 3CJ3A 2HHTA 4HCCA 3TABA 5KFSA 5KFYA 2X74A 1R0AA 1N5YA 2YHBA 3KLGB 3KKRA 2BR0A 3LAMA 4FM2A 3HXMA 5KGXA 5EU7A 3OL9A 4IQXA 1TVRA 4G3IA 4XPCA 3CYMA 4J9NA 4B08A 3NE6A 4Q44A 5DMRA 2E9RX 2VG5B 1VRUB 3V1RA 5K14B 1TP7A 4CFAA 1QUVA 4IG0B 2BQ3A 3VQSA 1QAIA 1ZBFA 4LSLB 4NLXA 3M9NB 3SQ4A 1L3UA 2GIQA 4NCBA 1JLGB 4F2RA 4O55A 5HRPA 1J5OB 3NCIA 4TY8A 3O4NA 2EX3A 3PUFA 4GMJB 4M3WA 3MECA 4IDKB 4AHSA 5CYQA 2KFZA 5HRNA 1FKOA 4F4YA 3AV9A 3CFRA 1NHUA 3PR5B 4C8LA 4BE2A 1JKHB 4Q0BB 3WNHA 5KFFA 3FSIA 3QGHA 3AA2A 2G8WA 4FS1A 3OYEA 3S9HA 3I0RA 4CEDA 3SFUA 1S9EB 3UR0A 4LQ3A 4ECZA 4BDZA 3V9WA 4B3OB 1VSFA 5KG6A 4NZ0A 3SQ2A 1U49A 3O4QA 4EO8A 3OVNA 5KG5A 4O0IA 3HPOA 4EBCA 4FK0A 4CEFA 1S0MA 3DLKB 3DLEA 3L3UA 4KHSA 3GIIA 1IKVA 2FVSA 3MFHA 3VQEA 4FM1A 1RDAA 4KHUA 5CYMA 3SUOA 3PW4A 2XY8A 3KK1A 1JL2A 4RW7B 3NF6A 4KO0B 3RAQA 4Z4EA 3M8SA 1EP4A 3H5UA 1HNVA 1QTMA 1VK0A 1SL0A 3V6DA 3MR3A 1NK7A 2Z1JA 3SQ0A 1TAUA 1C1BB 5KFCA 4R8UA 4OGEA 3SFGA 1N4LA 4C8OA 1Q8IA 4FLTA 3TARA 5HROB 1C6VA 3L2RA 3MEEB 3IRXB 4RW9B 2ZD1A 1BISA 3WNEA 3KLHA 1S0NA 1HMVA 1KTQA 1JXEA 1ZTWA 2F96A 1IM4A 4RNNA 4NYFA 2HNZA 2D3ZA 3OYCA 4CCHA 1LW2A 3KK2A 4H4MB 4CJVA 4O4GB 3AVFA 1UA0A 2UUTA 3QYYA 2IOCA 3HT3A 1LW2B 3SYZA 1WSJA 3GIMA 3KLFB 5SZTA 2HNDB 3UPFA 5F8MA 4B9VA 4KB0A 2HWIA 4J9RA 3NHGA 3TAMB 1VSDA 1IKYA 3RRHA 4OJRA 4CEZA 3MEEA 4DS4A 1J5OA 2PZSA 3M8PB 3MXIA 1TGOA 4W5QA 3RMCA 5FDLB 1NOYA 1ZBLA 1A5WA 4R8UB 3H40A 3AVCA 1RAJA 3EY1A 4O3NA 2R2RA 1Y97A 4YQWA 2JLEA 4IFYA 3MXMA 3ITHB 4I9QA 2E4LA 3O3HA 5KG7A 3TR8A 3T19A 4CECA 1ZBIA 2WRMA 3HPGA 3VN5A 2Z1GA 4KKOA 4OKJA 2BRKA 3MXJA 1HNVB 3EYZA 3NAHA 1RBSA 2D7SA 5DGAA 3K5MA 3L2UA 2G8UA 3UIQA 3L2QA 1HPZA 1FKPB 3HSTB 3CDWA 3KLIB 2JC0A 2PY5A 5CYMB 3GV8B 3RAXA 1YT3A 3OS1A 4KRFA 2P1JA 4FJKA 5L1JA 5KFAA 4KHNA 4DSEA 2IAJB 2QKKA 4KB1A 1Z26A 3KHLA 1JLAA 3KLGA 1D8YA 4KI6A 3SNNA 4MK9A 4DTRA 1KFDA 4CF8A 4N41A 4F8RA 1S48A 4WYWA 4OLBA 5HBMA 4NLOA 4CJSA 1J54A 4I2QB 4E7LA 4JS4A 4CJ4A 1NK5A 3OL6A 2YNHB 2P5OA 1SH0A 3MEGA 1NJYA 1JXBA 5KT3A 2W8LA 1CXUA 3V4IA 1DTQB 1HNIB 2KFNA 4NLSA 4ICLB 4JLHA 3V1OA 1RT5B 2GIRA 1MU2B 3LPTA 4IOBA 3NFAA 3LDSA 4HVJA 5F9LA 4E19A 1RTIA 2E9ZA 1X1PA 1IKXA 3OL8A 4ZPCA 5F8IA 4I2PA 3SI8A 2F8TA 5T7BA 1CSJA 3KMQA 4F2SA 4DTNA 3RWUA 3HM9A 2HHVA 4ID5B 3E51A 4QWEA 1RT6A 3DI6A 1TKXB 1I6JA 3BSAA 1ASWA 2R2UA 2ATQA 2YKNB 5KT5A 2RKIA 3JYTB 2FLPA 2D3UA 2Y1JA 4M3UA 1S1WB 3SV4A 2DFHA 1C0UA 1TV6A 1U45A 5EWEA 2IBKA 3ZT0A 4FJJA 4EBEA 2R8IA 4KBIA 2YHAA 3V81B 4E3SA 1JLCA 1R0AB 3AA4A 3HPHA 4ZP6A 4RU9A 4CHZA 3OYKA 2QK9A 1D5AA 2FJWA 1RYSA 3DLGA 4O3RA 2VWJA 3V81A 4DEZA 3VA0A 1T94A 5KT2A 4OPJA 1TL3A 2BGGA 3AVGA 1RNHA 1S4FA 1S1VA 1KHWA 3NH0A 1I3AA 4CGHA 1TL3B 2FJXA 4Q5VA 2HHSA 4C8MA 4FJGA 1S1WA 1NNDA 4FJ7A 1UAXA 3TI0A 4GC6A 4KSEB 4WE1A 1XC9A 3KK3B 4YR3A 3U3YA 2B5JA 4PUOA 5I42A 3FQLA 1SKRA 2Y1IA 4B9LA 3OYNA 3V9ZA 1RT6B 3V9XA 2C2DA 1VSHA 5F8GA 3H4BA 2B6AA 3ISND 1RBVA 1T7PA 1J9AA 2KTQA 2RF2A 2IC3A 4K4VA 3PJWA 4NLVA 1D9DA 3DYAB 1S6QA 4LQ9A 5KFDA 3NF9A 1LWCB 5HP1A 4JV1A 1L3VA 4J2EA 1BHLA 3IG1B 3LPUA 4HUEA 3OSNA 3HVAA 1DTTB 5J2MB 3KMSA 2IM2A 4KTQA 3N6NA 3DOLA 1S0OA 4QWDA 4GC7A 4GW6A 4URGA 4LD0A 2Z1IA 4DU4A 2IM3A 2AGPA 1C0MA 2RPIA 1A5VA 4CEQA 4FVMA 4ICLA 2QE5A 4ZVEA 2VG6A 1IKXB 1UWBA 2FBYA 5FRMA 4FW2A 4TY9A 4FJ5A 1GX6A 1S49A 3T5JA 4QWBA 2YNGA 3K59A 3BDPA 1RTIB 2XRIA 4DFKA 3MEGB 3QNNA 4FZYA 3ICLA 4CEBA 4PA1A 3OJSA 1HQEA 1RA6A 1LAWA 1HYVA 4U6PA 4DSKA 1FK9A 2W9AA 2WTFA 1LWFA 3P5JA 3H5XA 4WZMA 5HBMB 1XR7A 3O3GA 3AVLA 4FJ9A 5KT7A 3ULDA 3HL8A 4DG1B 1C1AA 1GOAA 4CK3A 4EO6A 2DFEA 2YNIA 1RT1A 4TSXA 4DFPA 3AO2A 4JUZA 4JV0A 1JLFA 4KFBB 3P83D 3OYGA 1RDDA 3KHHA 3I8DA 1XI1A 3PZPA 3QEVA 4YR2A 1VSMA 4E7KA 2G8HA 3H4DA 4CESA 3VQ6A 1JLEB 3H98A 4DFJA 1OS5A 4F3TA 3M9OB 4B8AB 4K4YA 4KAIA 3HVTB 1HARA 4HCBA 4F4ZA 3HJFA 4EP4A 2I5JA 3OYHA 4M94A 1KHVA 1SV5A 2IMWP 4J9MA 2FBXA 2IM1A 4OPKA 4OL8A 1IKYB 4CHYA 1NK4A 3UQSA 3AO4A 2JEJA 3T5HA 4DL2A 3LWMA 4K4TA 2YKMB 5I3UB 2OZSA 4M42A 5EUHA 4DSLA 4Q43A 1UA1A 1SKWA 1KVCA 2IDOA 5C24A 3QEWA 1TK5A 2WOMA 3E01A 1KRPA 3ZSVA 3ZT2A 1SH2A 1JLBB 2VG7B 4CJKA 4QW9A 3KLFA 3ZSRA 4H54A 4FYDA 5KFEA 2C22A 4IR9A 5HROA 4BACA 3KK2B 2C28A 2P51A 1NK6A 2FBTA 2UVWA 5KFXA 5HRRA 1RYRA 1C1BA 2KZZA 1TKTB 4ZVGA 4RZRA 3LWLA 4MK7A 3DLRA 4CJUA 2IGIA 4CHNA 3LP2B 4C8NA 3L3VA 1SL1A 1O1WA 4Q8EA 4O3PA 5KG3A 3PX0A 1SV5B 2OPQA 4ED3A 1BQNB 4MIBA 3ZSQA 3M8QB 4DL6A 1L3TA 3MAQA 1JIHA 3PVXA 1T05A 1TKDA 3HVTA 5KFNA 4O44B 5KFQA 4MFBA 2C2RA 4KHMA 4EBDA 4ECXA 3T5LA 4IRCA 4CFCA 1BL3A 4CK1A 4I7FA 1EP4B 4FJ8A 5D3GA 5KFBA 4RW7A 2KQ2A 3VQCA 3KK1B 5FRNA 2RDJA 2OPQB 2OA8A 4ZVFA 1FXXA 3OS0A 2ATLA 1IKVB 3PY8A 5J2PB 2F8SA 4IH7A 2W7PA 5DG7A 4RNHA 3V9SA 4DF8A 4RW6A 3K2PA 1C1CB 5J2QA 4LH5A 4CJEA 4KPYA 4ED2A 3NMAA 1S10A 4NLWA 1XHXA 3ZSWA 2WCXA 3F73A 2YNFB 3C95A 4E7JA 2E6LA 3PX6A 5J1EA 1WNEA 4ID1A 4CJQA 3B6OA 3QIDA 1YTAA 5CYQB 4OVLA 4IDKA 2WOMB 5DK5A 1JLGA 2G8KA 3CG7A 2IJFA 2BANB 4DTOA 1IO2A 4Q8FA 3SQ1A 3LZIA 3KD5E 3BR9A 4RUAA 5KFVA 5JUMA 2OYQA 1HQUB 4DLEA 4GVMA 3TAQA 1WSEA 4NLTA 4B9NA 4KHRA 4ELUA 1N56A 3IG1A 1LWEB 4CF0A 3V6KA 4PQUA 4M41A 4DU1A 3DRPB 4ECWA 4ECUA 4J9QA 2AU0A 1TAQA 3QLHB 1ASUA 2IC3B 3CDUA 1VSEA 3OY9A 3GQCA 3QERA 2XCPA 3DRRA 2W8KA 2R8HA 3DOKA 4Z0UA 1N5YB 3D45A 4HTUA 3NDKA 4WFYA 3EPIA 2D0AA 4IR1A 4WE1B 1CZ9A 3V1QA 1B92A 3VQ8A 4YP3A 1S9GB 4MKAA 3FFIA 1C0TB 5C5JA 4ELVA 2HMIB 3LP3A 4PWDA 1QAJA 3THVA 4JRPA 5E41A 2R2SA 3DLHA 1XWLA 3T1AA 3VA3A 1KVAA 4EZ6A 3QO9B 4QCLA 1TKZB 1L5UA 4LSNB 2BRLA 5DGBA 4MQ3A 3KHRA 4NCGB 1RTHB 2W9CA 2X78A 4M3TA 3QETA 3OYMA 4BWMA 1HRHA 3MEDA 3SUQA 3JYTA 1RTDB 1WAJA 4K4SA 2VG6B 2ILYA 4RUCA 1D0EA 1RT2B 2FVPA 4ED7A 4ECSA 4FLWA 4TN2A 4NLDA 2CKWA 1JLQB 2B4JA 4KV8B 3OYIA 1U48A 5DLGA 3NGDA 4DTJA 4HUFA 4K8ZA 5L1IA 4JS5A 1EETB 3LP0B 1B9DA 1EETA 4ECTA 2WB4A 2BDPA 3MEDB 3LALA 1ZBHA 1JX4A 4KV8A 3VQ5A 5HLFB 1RT3A 2CJQA 1QQCA 5EWFA 2ALZA 3QIOA 1RT2A 3CJ5A 5I42B 4CHQA 3PR4A 3LAKA 3KK3A 4K4UA 1IG9A 1HNIA 1RTDA 3AVBA 2XI3A 1S1XB 3OYAA 3BSCA 3HP9A 3C6TB 2W9BB 2YV0X 2BE2A 3CQ8A 2XO7A 4WXWA 3B6PA 2XGPA 1SKSA 4Y3CA 4R5PB 4I2QA 4DSJA 4CF2A 4NLYA 2WONA 1C0TA 2O4GA 4ZTFA 3QNOA 1RT4A 4B9UA 3DLBA 4J9OA 1JLAB 3DOKB 2IAJA 3NL0A 3Q8QB 2VA3A 3QLHA 1S9GA 4DTMA 3D0PA 3PX4A 4AILC 3LP1B 4FJXA 2F8EX 2DY4A 5KG4A 2YKNA 1W0HA 4LY7A 3V6JA 1S6PB 3OHAA 1KCFA 2ITGA 2O5DA 4EYIB 1I39A 4F50A 1HQUA 4TXSA 4G1QA 1W9HA 1RTJA 3S3MA 3GV5B 3DRPA 2BANA 3GV7B 3UDLA 4CERA 4PQUB 2LSNA 3DMJB 1LWEA 4ECYA 3NKYA 4ECRA 2HB5A 1X9MA 4E1MA 3ZT1A 4BDPA 3N6MA 4DFMA 4YMEA 4IRDA 1ZTTA 4CF1A 4CGIA 3CM6A 3ASMA 4AHVA 3TAPA 1REVA 5J2QB 1X9SA 1KVBA 4RW6B 5KFHA 1VSKA 2HNZB 3V4IB 4IH6A 4CGGA 1ZYQA 3WNGA 2R8JA 3GYNA 2YNHA 3KLHB 3PW2A 2YNFA 3DM2B 3ZSYA 4DLGA 3IRXA 1RT7B 1S5JA 3HVRA 3N6LA 3KIOA 2FJVA 4CJTA 1C1CA 4E0DA 4ZPBA 4CGFA 3RR8A 4FBUA 4RW8B 1ITGA 5J2PA 4WXOA 1RA7A 5EDWA 3TQ1A 3SPZA 2ZE2A 3NBPB 2XI2A 3FQKA 4DQRA 3KLIA 4IRKA 1L3SA 2OPPA 2FBVA 2KZMA 5J2NA 4FBTA 5KFPA 1N6QA 3CJ4A 4AHCA 4N76A 1HJRA 3NGYA 1B9FA 3M8QA 1NKEA 4M45A 4RNMA 4Y2CA 1GOBA 4KKOB 3HK2A 3LP2A 4AHRA 4MFBB 2WHOA 2A1RA 4Z4GA 3SUPA 4W5NA 4NLPA 3AO3A 1CXQA 4H4OA 5DG8A 4MKBA 4RG8A 3AO5A 1BQNA 2JC1A 3DM2A 4FK4A 4NLRA 2HWHA 4O0JA 4E7HA 1WSGA 5KI6A 1JLBA 1VSIA 1RDRA 2HNDA 3I0RB 3CJ0A 3H5SA 4OLAA 1YVFA 4O3QA 2XHBA 4Y2AA 4M3XA 5KFTA 2ZQBA 2AQ4A 4O4GA 4H4MA 4CHPA 4Q0BA 1UOCA 2JEGA 5F9NA 4DSFA 1FKOB 3VQ4A 3S3OA 4ED0A 3MFIA 4ZP8A 4DL3A 2DPIA 3RB3A 1WNSA 4FJMA 3SPYA 4RW9A 3ZT3A 1RCHA 2UUWA 4TY8B 2ETJA 3KD1E 2E6MA 2RDIA 4N5SA 1ZBUA 2QXFA 4EEYA 2I5JB 5F8HA 4ZP9A 3IS9A 3NF7A 4DSIA 4TQSA 4H8KA 1RTJB 3T5KA 3D28A 5KFIA 4FJLA 4FLVA 1JLEA
chains in the Genus database with same CATH superfamily
3CMQA 4M1KA 3W63A 5M1PA 5C7PA 2B7CB 1HI1A 1HWJA 8RUCA 2KT2A 1C0GA 2WVDA 4FNHA 5BRFA 1H74A 2G8IA 4DX8H 2M2BA 5B0EA 2GQQA 1GOCA 2VPYB 4RW8A 3BO2A 3O6WA 5FLXY 4K50A 5DG9A 3M1FA 2JFDA 3CW2C 3BKUA 1PC4A 1YJNN 1NJZA 1NKCA 1RT7A 2CQDA 3FRZA 2CDQA 4YHHF 4DQSA 1J5EJ 3I6PA 2VQFF 2BE2B 1QSYA 1IBCB 2Q3PA 5DM7Q 2WW8A 4C8YA 5AXLA 2WFBA 1AFIA 4USHA 1CZBA 1S6UA 4ZCIA 3BJYA 4B9TA 5B0CA 3BSNA 2UVVA 3VESA 3TNVA 1NU0A 2OUGA 2F5GA 4AQYF 1CG2A 4NEYA 1CJTA 4K4WA 3SZ2A 2IVYA 2HGNA 3ILJA 5AQMA 3VAIA 3US5A 1SL2A 5HOOA 3SCXA 4WFZA 3MM6A 2W2MP 1GMWA 2E88A 3FGUA 1IKWB 3I5CA 4HACA 2E1PA 3OVBA 4IBNA 3L7OA 4PR6A 1D9AA 2HS0A 1BIZA 4ENOA 4FXVA 2Q3SA 3NGKA 4FYXB 5J2MA 5TKYA 2ACMA 4CD1A 3FK4A 2YPZA 3BGRB 3OYJA 3OHBA 1LWCA 1S6QB 2R42A 2P9LB 1CJKA 3KLVA 3THYB 1WTFA 4FWPA 2J6TA 1URRA 2ASJA 4NCGA 5A2QY 3TUJC 2CJKA 2HVDA 3QICA 2UXDF 3EZWA 2AX1A 2EC0A 3HVWA 3W62A 1YZ6A 1K6YA 4DUYF 1JLCB 3MAAA 1N33J 4KHYA 1VJQA 3HO1A 3W2VA 4LT6A 1C2PA 5DQHA 3QGIA 2QT7A 3THTA 4P7VA 2VYPA 4WWSA 1IBKK 4PWDB 1EQMA 2BQUA 2XHWA 3CFOA 1NSQA 3C6UA 5T7LB 4QOZB 3MWPA 3JSRA 3QEIA 4O4RA 2AX0A 1XNRF 1U1LA 1MMLA 3W5XA 5K9FA 3KFWX 1S1UB 4CFDA 1G3OA 5IZHA 2H5IB 3DRRB 4NLUA 4K8XA 1RWPB 4OKKA 3CCUS 4BR0A 1N5QA 1ZAWA 3Q22A 2W6KA 2HYIB 1WBBA 3G6XA 1WB9A 4D3HA 1NBEB 2NZ4A 1F60B 2EWSA 2QA2A 4I2PB 3KNGA 2QGFB 3M30B 2RKIB 1ATNA 3PO4A 2GUIA 2EK1A 4F7VA 4ZVHA 3HX9A 3SI6A 4NXNF 1N32F 2K2PA 1NPPA 2MQ8A 3RR7A 4JKBA 2ZNZA 2CPJA 5ETOA 1UJ4A 2IJNA 1V5IB 4M63C 3LO3A 1MU2A 1NZ8A 4FPAA 4LREA 5G4DA 3G96A 1UFLA 2AJ4A 1NK9A 1VQMN 2V4QA 2FLNA 3CWJA 3S7RA 3BN4A 2BTFA 3OTEA 1U4BA 2P9PB 2LP4A 3PM9A 3AD9C 4JYAK 5KFWA 4U7CA 2CQGA 3CC7S 5C2DA 2L9DA 4NWBA 1U02A 3AVAA 3OL7A 3KK7A 4PY5A 3C6HA 3UN3A 3PW0A 1D1UA 2Z1HA 2F63A 4C1NI 1X4DA 1N36J 2HAIA 4P7TA 3TX0A 2BQRA 1EXQA 1XR5A 4OX7A 4FPIA 4YNQA 1S76D 2B51A 4BS2A 4X4PA 2CQBA 3MMCB 2YXLA 3D66A 4X4TA 4A48A 3VEOA 1HYSB 2WAQD 4HUGA 1KWMA 4KC5A 4QPXA 3V9UA 2KG0A 3K5LA 1B99A 5B7WA 3EVMA 1K1QA 3EZUA 2XGQA 4J9KA 4F9OA 1HPZB 3DLJA 3D5MA 1XR6A 2DNQA 1RBRA 4XH5A 4CEOA 1RDCA 2KW4A 1HA1A 4Y0WA 5EY4A 2NZCA 4DTUA 4FZXC 3TAMA 3VAJA 4DV3F 4U8VA 1TKTA 1VRTA 1TMMA 3NH2A 1XMOK 1T3NA 2GMJA 1M1KT 1HYZA 1TUUA 3M8PA 2F9WA 4EGLA 3C14B 5A2QU 4DV3K 2VHGA 4EIAA 1ZOTA 4IKAA 3CPWM 4CO5A 2HHUA 3K0JA 4ED4A 3PIPL 4UZCA 4E7IA 2O8DB 3E01B 1HL6A 3VTHA 3D2WA 5CZ2A 3O2IA 2YX1A 3NNAA 1JL1A 5F8NA 2GV9A 2PDAA 3BQ0A 2KB2A 4F3OA 2CQ1A 3UCZP 4IEIA 1K8KA 2X1AA 2XMWA 2P5VA 3DXSX 1WSFA 4NYZA 2BUNA 4CLTA 2HGMA 4OPHA 2E44A 3B4DA 3FNNA 4EHTA 2Z57B 2ZWPA 2UXDK 3CJTA 1OKJA 1W2IA 3CCJN 3GJQB 3BKTA 4H4OB 1U2RA 1U09A 4USMA 3OYFA 4Z4CA 3W3SA 1JB0C 1RU1A 2H51B 4A8SA 1F9FA 3ATUA 4B3RK 3NH1A 2C2KB 3S8SA 1OSDA 4J9LA 4USWA 2ZZTA 3BGFA 5KRTA 1FEEA 4KO0A 3ZEUB 5J2NB 4AL5A 4M95A 4NYOA 4WQ4A 1RAIB 4JYAF 3BF4A 4H0XB 2GC8A 1KAYA 1FHTA 3GONA 3VALA 1SC6A 1KLMA 3Q7BA 3QESA 1HNZK 1HI0P 1URNA 5B0FA 2K3IA 1LWFB 4B3OA 3J81Y 1VSJA 3AB4B 3B8AX 3MCOA 2DCLA 5LMUF 2VG7A 5M2PA 3Q8VA 4O23A 3DDKA 2GQCA 2DGTA 4FWOA 4ZPAA 1NB2A 2YNGB 3KJVA 3NG8A 4NL5A 5JLFA 4ZPWR 1OH5A 5HL7Q 3R6LB 1JKHA 2C3MA 4FL9A 2GA7A 2QEXS 4W4MA 4JI5K 4KHPJ 2V4JB 3CCUN 2DGSA 1KVKA 4Y0FA 4FW1A 2ERRA 2FZKB 5HP1B 3RZAA 2JGUA 4CZKA 5D0EA 3MR6A 4KBOA 3DYAA 1I3OB 3OTOF 3M32B 3A13A 5HMXA 3ID6A 2QWRA 4XK8C 3AJ1A 3OSPA 2PMHA 3I5BA 2J6SA 1LOTB 4LF6J 1ASVA 2BYCA 3BPSP 3J7ZO 1U6ZA 4CTAA 1IUJA 5D4NA 4BR7A 1CJUB 3QBWA 3A5LC 1SKUB 3GP9A 1QE1B 3J7A1 3D0IE 1XUPO 3EZ5A 4OI4A 3ZT4A 1N0UA 4H5RA 1IBKJ 4ZIVA 2H65B 1UP1A 5LMUJ 4KGZB 1S1XA 2XY5A 3TSQA 3PW5A 2HBRB 3TYTA 3VAKA 3DRSA 4CZMA 2R2TA 3CDEA 1LW0A 2W7AA 3CCVN 5IC4B 1TR0A 1VIXA 3DRYA 2VV5A 2IRUA 4CO0A 2HVIA 4BE0A 3MD1A 1Q78A 2QFJA 3U02A 1NH8A 4MH8A 4HDGA 4DV0F 5HJXA 2I8EA 3H2LA 1JJ2R 1Q81O 1BUPA 1PSDA 3BGRA 1BA0A 4BBYA 1MWMA 3POTA 1IJEB 2ASPA 4ILLA 3TWHA 2HK3A 4YB6A 4FVCA 2QM1A 2DPJA 3A1YG 2M3DA 3BQ2A 1IKWA 1V5VA 3SEOA 5ETPA 3VQ9A 4BGBA 3OYLA 2NXJA 3I0SA 4NX9A 4V19X 4BC3A 1BA1A 3M30A 1VQ9N 1UVJA 3I56S 2UVRA 4DQQA 4YEAA 4DQIA 4ZVRB 1QQNA 2AZ3A 2OJ3A 5KT6A 2LXFA 1BI4B 1IQTA 2QLXA 1RLCL 5A8WB 3K9KA 2B6AB 1NMEB 2HNYA 4WYLA 4XIUA 2JX2A 3CJCA 3AVIA 3ENAA 2QA4G 2V8DA 3GFHA 4CIOA 4NLQA 3EMTA 4CQ1A 4H4KA 2X51A 5JXSA 2HFVA 2XMMA 3CETA 5C42A 1Z4UA 4B9QA 2HMIA 4F02A 1IV0A 5D0RA 3TZWA 3QO9A 3CJ3A 2HHTA 2V67A 3LAMA 1SS6A 3HXMA 1W97L 3DKDA 3OL9A 2CXEA 4IQXA 3W7BA 3W2WB 1CJKB 3CYMA 4B08A 1Q1KA 2VG5B 2AEFA 5GAEP 4OMFG 4IG0B 4RR5A 5E3QA 1XMQF 3VQSA 4DV4K 5LJ3Y 2FC8A 1VFJA 4LFAJ 4LRBA 1WI8A 2M70A 1ZAVA 1L3UA 2GIQA 2Z58B 4F2RA 5HRPA 1P90A 4QS8A 3O4NA 1X31C 4AUKA 2I38A 4GMJB 3UKUA 4AHSA 3LW5C 5CYQA 4IXCA 5IT9O 3HULA 1FKOA 5HN0A 3OR1B 4CNYA 3AV9A 3CFRA 5MAOA 1NHUA 3CJ9A 1JKHB 4Q0BB 4W92B 1YZ7A 3PHTA 5KFFA 5B0GA 3CQYA 4ANEA 3AA2A 4CEDA 1S9EB 4LQ3A 4ZOSA 4A46A 1ZBSA 2EFPA 1H2UX 3MUMP 3D1OA 4B3OB 3N4PA 5KG6A 3K8WA 1U49A 1Q86O 3O4QA 2RQCA 1KDNA 3OVNA 5JVGL 4EBCA 3NS6A 1FWPA 1S0MA 3GIIA 4F0HA 3VQEA 4WQ4C 1KQKA 4FM1A 2QZ8A 3SUOA 2QLJB 2FPHX 4A59A 2XY8A 4FF4A 3WX8A 4P73A 3C0BA 1P8ZA 3RAQA 3H5UA 2GQ2A 5KPZA 1VK0A 3TR5A 3LM2A 3IXQA 2KG1A 3CXCM 3MR3A 2DB1A 4NI2A 5KFCA 1RDWX 3CCRS 4C8OA 2DNLA 4NOHA 2C2NA 4CZGA 3B54A 2YX4A 3H20A 3FSYA 4RUBA 2OKQA 1NH7A 4RW9B 3WQPA 4N7TA 1HMVA 3ZLJA 4OHYA 1GT8A 2CJBA 1FJGF 1IWGA 5GAHU 1ZTWA 4Z94A 1RI7A 4DQ8A 1MWQA 3I9ZA 4CLKA 2D3ZA 1LW2A 3MGJA 5E3AA 4O4GB 3DLLQ 3QYYA 4F0KA 3HT3A 1ELOA 1WSJA 1DY3A 1VQ8N 3KLFB 2DO0A 4LF7J 3MCPA 4KB0A 1NM2A 2VC1A 3NGRA 3NHGA 1VSDA 1DBDA 3E2EA 1RTZA 3UKUB 4CLZA 4E1JA 4WQ5C 2ZBQA 4DS4A 4DOZA 1J5OA 3M8PB 1TGOA 5CD4A 5GINA 3LDNA 3O1WA 1K44A 5J1NA 2BE9B 2OO4A 3WX4A 4X84A 2R2RA 4OYZA 2XSFA 4IFYA 4QYRA 2DH9A 3ITHB 4I9QA 4JI7K 2WRMA 3VN5A 2Z1GA 4OKJA 5C2CA 2HFNA 3MXJA 3EYZA 3Q8UA 4D3GA 3L2UA 3BY5A 2G8UA 3UIQA 2O8EB 1HPZA 5CYMB 3NOCA 3OS1A 4KRFA 4M7XA 2YHWA 4LBPA 4KB1A 3QNWB 1V4TA 1GTEA 4OHZA 4BRHA 3ZTRA 4KI6A 3SNNA 2E2PA 2OFHX 2MKSA 5F0UA 2GAGC 4PKHA 5A76A 1WEYA 1KC8O 3DJCA 4OLBA 2O8FB 1Y4ZB 4W90B 1MMNA 4E7LA 2HSEB 3QT7A 2YNHB 5GAEI 1KR4A 3JTOA 2VDIA 8AT1B 2Y0BB 1NJYA 3OPKA 5KT3A 2VQFJ 3AA9A 4PG4A 1NDKA 4MO4A 4MJKA 3C19A 3KDOA 4NLSA 2W4CA 3Q2SC 5SUHA 2E1CA 3NFAA 1J6ZA 1YJTA 3SMSA 4FNIA 5D4LA 5FPDA 4H0TB 2E9ZA 2C2MB 5BN9A 2P9NB 2R7SA 1VHIA 4ZPCA 5F8IA 1U2CA 4J9VA 3W61A 5BJRA 5C2FA 4O5FA 5M1KA 2DXEA 1NPRA 3TO8A 1CSJA 3Q24A 2QA1A 3CCLN 3RWUA 2WSEC 2HHVA 3CIPA 2VIHA 3E51A 4QWEA 2A6OA 2CAJA 3VVTA 3DI6A 1WEXA 2A2CA 2R2UA 3G71S 2Y1JA 4LMZA 4M3UA 3NCRA 4WP9A 2DFHA 2IA0A 4A61A 4GV9A 2KXNB 3VZIA 3IUCA 5EWEA 3ZT0A 4CT9A 4EBEA 4AD6A 2J4RA 3V81B 3AXKA 1W7AA 1K8AO 2QK9A 1XN9A 1KP6A 3DLGA 4O3RA 3VA0A 1H3DA 1T94A 2DGVA 2GHWA 3NH0A 4MDBA 2FJXA 2HHSA 3O9QA 3TZYA 2HZAA 1RAFB 4DV6F 4GC6A 1CQMA 4KSEB 3EJMA 4K59A 5IV4A 4YR3A 1WC0A 3U3YA 5I42A 3FQLA 2NSCA 1RT6B 2ZM6K 1XMOJ 2KTQA 2CRLA 3UO0A 2IC3A 2BJ7A 2FJAB 2FF6A 2YCHA 2DXDA 1MROB 1S6QA 3R5BA 3H3NO 4DUZF 1BHLA 3LPUA 5GMKa 3HVAA 4J8FA 2IM2A 3CEDA 4KTQA 3SLCA 3BF3A 3N6NA 3CCJS 4GW6A 2BA9A 4LD0A 4LF4F 2Z1IA 4DN9A 5E2QA 2F1FA 1B7FA 4FYYB 1F3VA 4TY9A 2BX6A 4FW2A 4QR1A 3T5JA 4QWBA 3THWB 4LFAK 4DFKA 2WSCC 4PA1A 3WC2A 3OJSA 4L3QA 4TLQA 2G13A 1R6VA 1DHMA 3PYFA 3EGWB 3P5JA 2MGZB 4WZMA 5HBMB 1S99A 5AQRA 3ULDA 4DG1B 3ZZZA 1U1MA 4EUVA 1GOAA 3G71N 2ZJPL 2DFEA 1FDBA 5LSRA 2YNIA 4TSXA 4OQJA 4NZ6A 1JLFA 3TOQA 3J81j 1EWQA 5HVHA 4A4JA 1S12A 4HWIA 3KHHA 3I8DA 1XI1A 4FO0A 3AH6A 3QEVA 4ZLPA 3CD6S 3H4DA 1PGZA 2LMIA 4E2FB 4BRCA 2DNPA 1U0HB 3M9OB 4K4YA 1XK8A 1WWHA 1QVGM 1HARA 1VQ9S 2Z30B 4F4ZA 2MZSA 4OHXA 2XULA 1Q5YA 2WVBA 2MPUA 2CDRB 4WF9L 1X4HA 2I0XA 2ZJRQ 1SV5A 1K0VA 3IAS9 4RTFD 3DCAA 4CHYA 2MLZA 4M5MA 4Z7CA 2AJ2A 4MKYA 1U6BA 4KYZA 2OZSA 5EUHA 1CLFA 1UA1A 1SKWA 2N7CA 2F9JA 2IDOA 2DR6A 5DS7A 4CO2A 2UU9K 1YQHA 5KPRA 4DUYK 3E01A 5JMNA 3ZT2A 1FTCA 4KHPF 4NB4A 2VG7B 2RRAA 1YJRA 3W65A 3KLFA 1R6YA 2C22A 1HNZF 4DV4J 4IR9A 5HROA 4F67A 4KH5A 3RRKA 4FF2A 5HRRA 5DZ7A 2ZJPQ 4ZVGA 3MX5A 4C8NA 1GLDG 3DXKB 1O1WA 2B56A 4Q8EA 4MKVA 3GU0A 2FSNA 3FMBA 4ED3A 3VGTA 1BQNB 4H0YB 4DL6A 3QFUA 2MKHA 3MAQA 3PVXA 1AB8A 4Y2KA 2BUPA 4DV1K 3UD3P 4O44B 3W5YA 3CMAS 4ZVUB 1E6VA 2FYXA 3JSBA 4IRCA 4CK1A 4JYAJ 1DEJA 1NSKL 1AW0A 1Q8LA 5KFBA 5BPLA 5FRNA 4IDHA 3T41A 2YHXA 2XLKA 4BCAA 4ZJQA 2ATLA 5LM7E 1IKVB 3MPVA 3PY8A 2R4FA 4IH7A 3MCMA 1NMDA 4DV7K 1OY9A 2Y9HA 3T9ZA 4LH5A 4CJEA 3NMUA 4KPYA 4ED2A 1YDLA 3CNQP 1XHXA 1H2TZ 4P2XA 2EPIA 1Y7PA 3GR0A 4E7JA 2E6LA 4LF5K 1WNEA 4ID1A 4CJQA 3J80U 3QQCD 3QIDA 4JV5F 3P5TL 3HHLC 3LPYA 5GADI 1JLGA 4DR6K 1WOSA 3DDNA 1PILA 2YKAA 2W1BA 4JKHA 1IO2A 4OX9K 4DR4K 3LZIA 4LF5F 3KD5E 3IA0A 4RUAA 5AJ3K 5JUMA 3CD0A 1Q82O 2VD3A 2OYQA 4DLEA 5LJ5Y 1Q4RA 1WSEA 2QTDA 4NLTA 4CLUA 1RAHB 4B9NA 4OI1A 1LWEB 4MO5A 3R1HA 4DU1A 4B3RJ 3DRPB 4DPTA 3C46A 1QLNA 2W8KA 4WPAA 3C3LA 3RW6A 4DV2J 1OPIA 4Z0UA 2WTUA 4FXWA 4FWRA 2DHGA 1Q53A 3AFGA 3NDKA 5DETA 1B92A 2NXCA 2V50A 3FFIA 1PJ7A 3D2FB 3LP3A 1QAJA 3KVGA 5E41A 2BKOA 2KKZA 1XWLA 4DR7F 1UJ6A 1XNQF 2MHNA 1B7YB 3DAWA 5CA5A 4XDDA 3V5RA 4EZ6A 2YWEA 3J8AA 4LSNB 2NLWA 3KHRA 3K89A 4GKKK 2DH7A 1RTHB 2W9CA 4M3TA 3QETA 1JCEA 3OYMA 1VJWA 1WF0A 1HRHA 3MEDA 4C0HA 4BGAA 4ISEA 4HVZA 2ILYA 1N36F 3UNGC 1YAGA 3K8VA 3KDNA 3T6BA 2J9EA 2NRVA 3FGVA 2CKWA 3UWTA 1JLQB 3EVOA 4KV8B 4QU7A 2CH5A 2B9XA 2L48A 3H1VX 2RRNA 2ZKTA 4FWNA 3NP5A 2NRRA 2FHKA 1AROP 4JHDA 4L3KA 4ECTA 2IYIA 3CERA 1BY9A 1NWKA 3LALA 4X64J 5RUBA 5HLFB 5AQPA 4OI6A 2CJQA 2W4DA 3VAFA 2HBZB 1MA9B 3DRXA 3CJ5A 4DPYA 3FBEA 3LAKA 2P9SB 1S1XB 3OYAA 2NCKL 2DR8A 3HP9A 3PRDA 3C6TB 2QWMA 2E7VA 1SJ1A 4C11A 4OZ2A 2XLJA 4LF2A 4DN0A 4JI0F 2XG8A 2XGPA 4A8FA 1GXUA 4Y3CA 3W2VB 4DSJA 4CF2A 2J0QD 5IQ6A 3QAEA 2BH1A 4DR3F 4ZDNA 2NRWA 2D9PA 3DLBA 1NGFA 1SZ2A 1NM1A 2HQCA 2W4PA 2QL5B 2IAJA 3DLLL 1FCAA 5ETRA 3V2UC 2UXCK 2GGPA 4BROA 4FOIA 2QWNA 4FJXA 5K5MA 4YY3F 2DY4A 1BHNA 2CJAA 5KG4A 2HBMA 5I9EB 1KCFA 1V3ZA 1OSCA 2FJBB 2W2OP 3KJNB 4G1QA 2K8GA 1WACA 3DN9A 1O51A 2JWKA 3UDLA 4CERA 2GFFA 3DMJB 4HT5A 3QPIA 3T1HJ 3LA0A 3CPWR 1GFWB 1YXQA 4B1XB 4XEIA 2CPHA 2V4JA 3IFRA 4IRDA 4TKTA 1IR0A 5GAEU 3AT1B 4JI8F 4JKGA 2VQEK 1REVA 1F1BB 1F6TA 2DGOA 2KT5A 1AUSL 1N5SA 3FCWA 1M1HA 3I56N 1Q18A 1X8DA 2DGXA 2DNGA 2ZDOA 3TWZA 2EEYA 5DM6Q 3GYNA 1MG7A 2RQMA 4JD2B 2CUYA 1PJ6A 1VI7A 5GAGI 2QX0A 2QMWA 3IMQJ 4LJMA 1YK9A 3VGUA 1UVKA 1RGIA 1ITGA 4X4NA 4WXOA 3ULEB 1UW4A 4FYVB 4CWBA 2UXCF 1TTHB 3QB0A 3OBWA 3UI3A 4IRKA 1L3SA 1ZA2B 1Y10A 2OTJS 4N76A 1E4FT 3PIPQ 1NKEA 3A3NB 4DUZJ 1YHQN 2H3EB 3TU5A 1C0FA 3RU0A 4W5NA 2AW0A 4RX6A 2WC9A 5DDPC 1T9TA 3PIOL 2AKWB 5EX5A 2LLZA 3DM2A 4DHVA 1ITPA 4O0JA 1YLXA 3SBMA 4CP5A 2HNDA 3H5SA 3HZEA 2GTDA 4O3QA 4HH1A 2ZQBA 4LFCJ 4H4MA 3ZFVA 2UUBJ 1UOCA 4DSFA 2MKCA 2OHDA 1U1PA 3G2XA 2HF3A 2A6MA 4CH0S 4WCEL 4FJMA 1P6TA 4MT1A 3SPYA 4RUHA 3ZTQA 4RW9A 4QZVB 1ZBUA 2QXFA 1CJVA 2B9WA 2J7UA 2OELA 4OZ1A 4B1YB 2HRYA 3IS9A 3CJRA 1HIYA 2VWBA 3R1XA 4DSIA 1MLAA 1WTBA 1RTJB 4H8KA 3NS5A 1W7WA 5EOYA 3WQTA 2A1BA 2VFTA 3T5KA 1WG1A 1V3RA 4FJLA 2F7TA 2FZCB 3C94A 2V6AA 2MJNA 2AV5A 3CMES 1VQKS 4CJWA 4GO5X 3P1GA 4BC2A 3CTRA 2FC9A 1F3FA 1JJHA 2XYHB 3S6EA 2BOPA 2ZE2B 4FKYA 2V5HG 1VQPN 2BJ3A 1U0HA 4QWAA 2J0WA 2EVZA 2E1YA 5M1QA 1VQ4S 2DTUA 1RT1B 2UUAF 2D1CA 3LUYA 4NXMJ 1HR0J 1NPKA 3UVJA 2WBMA 1QSSA 1QTNB 4PG5A 2J9DE 3MOJB 1UJ5A 1TL7A 2G1HA 4RKUC 1HBUB 1Q9YA 2V9KA 4JI7F 3HTVA 4OJ3A 5KFRA 3KJQB 3FEYB 5AXKA 1G99A 3CJ1A 2D0CA 4C8KA 3NVMA 3IAYA 5AQXA 3NGZA 1SC3B 3UB5A 3CD7A 3HD1A 2Q97A 2A10A 4FWQA 3KHGA 5ETNA 3D6HB 1H72C 1RCXB 1WKKA 4TLRA 2JVRA 4M3YA 2ZH2A 3D2EA 2G2OA 3ZTPA 3P49B 4WFXA 3A0IX 2P5GA 2XYPB 2B8QA 2VA2A 2OIHA 3DOLB 4FJHA 3HYFA 4NPOA 3OLBA 2W01A 5K14A 3H7HB 3VAHA 2LU2A 1VHXA 4IFEA 1M5PC 1T03A 2LXIA 4CZCA 4FDFA 3CJKA 3LP1A 1YJ7A 1KVIA 1S1TA 2RS8A 2V2KA 1YG0A 1RTHA 2V7ZA 4GV6A 1XHZA 3ZSXA 4FJNA 1VDHA 2RN2A 1X4CA 3PRBA 5IV3A 3BUZB 3H5YA 5KFZA 3DRSB 4CIEA 4JRQA 1UPMB 4IOXA 3Q23A 1SQGA 3NWRA 4Z4FA 1WDDA 3C6UB 2RU9A 3VHQA 2HLUA 3D6MB 3LDLA 4ETXA 5IM0B 4XPEA 4X66J 2AGOA 2HMPA 2EHGA 3G82A 3EN9A 2V4RA 2AP1A 2W9BA 3D7EO 3CJKB 3A8EA 1DAXA 1X0PA 4CTAB 3QRQA 2F40A 5KG0A 1CC8A 2HIYA 1T95A 4OYBA 3UCUP 4I6YA 2XY6A 1X4GA 1WSHA 4CHOA 5IWAK 4YFUA 2E5HA 4OIXA 2IDLA 4H5VA 3CCSN 1KQGB 2DPNA 3AA8A 3U6FA 3O1LA 5LSLA 1VCTA 5IS2A 1FJEB 4ZPTR 3ILIA 2VUGA 4GY2B 3DHXA 2OEMA 1FDDA 5CH7B 3PEHA 5C25B 2AP6A 3DGVA 2YVSA 3D2EB 1DLOA 4LF9F 1LOUA 2CZ4A 3G6VA 3HSJA 1HWIA 5SWMA 4WP8A 4BRLA 3KJVB 5A0YB 2Y0SD 1NK0A 3QEXA 3CC2S 1CJTB 5J1EB 4FS2A 3GMGA 3BS9A 4ED6A 3FEXB 3R5AA 3AGRA 3C65A 3AO1A 2MKJA 1F5CA 3UN2A 1SB6A 3LTOA 3RBZA 1VQMS 3MM7A 3KLEB 2R7QA 3TAFA 5EWGA 4LH4A 2VZ9A 2OPSB 4DV0J 1T9VA 2R7YA 4J91A 2RD5C 1L3KA 2FIUA 3U27A 2GUPA 3VOVA 3FFIB 1FKPA 4HI1A 4ES2A 3MMAA 5E3CA 2MQQA 5D3GB 3TANA 2IS3A 4AM7A 2ZBPA 1G2EA 4LF4J 4J9SA 4N47A 2D5RA 3RRGA 3M2UB 3ITHA 3F9KA 2YX6A 1WD6A 1S7HA 1T05B 2GIFA 3W8PA 4U7UD 3KUGA 2KM8C 1EKSA 2O4IA 1NJXA 1RHQB 4HKQA 3C6AA 1R8BA 3IGVA 2W7OA 2HHHK 1VBXA 2QLBB 1U8WA 2AJ0A 3IM9A 1RGVA 3AOAA 3T1YJ 2HVZA 2NSBA 2YPYA 3IWLA 3IS9B 2BW2A 1XERA 3MF5A 2GJ2A 1S7IA 2Q1NA 3VAGA 3R5JB 2VC0A 3R8EA 3G86A 1KSPA 4JI1J 1O5JA 2R8GA 3HFKA 4RNFA 3D0GE 5B09A 2IA6A 1ZPWX 4NLGA 3R7NB 3OYDA 1ZPVA 4CO1A 2V9WA 3ZX0A 2NREA 4K8RA 1U47A 5JJBA 5IT4A 4CIGA 1KLMB 1Z25A 3BZCA 5I3UA 3CPEA 4N8NA 2YWKA 4IOAL 3I55N 1M90T 4CGJA 4MIAA 4OI2A 2EC2A 1P1TA 1YKWA 4CJRA 2PAVA 2QI2A 3O44A 3MM5A 1SVDA 1ZM9A 2OPPB 2EFQA 4B1UB 2JDJA 1RDUA 4OO1J 1FRJA 4TVAB 3NBPA 4NA2A 3H59A 4B9MA 1U25A 2LDYA 4BVPA 1EQYA 2XEXA 1S9FA 2J7KA 5KGWA 1WEZA 1VRQC 4CJ5A 3BGUA 2IIHA 4JI4K 1Q82T 3OFFA 3T7ZA 3M8ZA 4AHUA 1IBMK 1XBWA 4H0OA 1HBNA 3VQQA 1WSVA 2KL8A 1PYTA 4QAGA 1LV5A 2R7OA 4CLLA 4NYNA 1DZ5A 3CUNA 4FP9A 3ZZRA 4BHQA 2ADCA 4KJIA 1Q0NA 1EARA 1AYEA 3GR1A 3P38A 2XMKA 4NCAA 4CIFA 1FK9B 3HMJG 4OPAA 3WNFA 1RILA 4X65F 3UNYA 4W5OA 2DEJA 2RJZA 3CFPA 4CEAA 3PHEA 1AZSA 1WHYA 2Q36A 2H5JB 5E5NA 1NK8A 4TYAA 1Q7LB 5BRDA 1DLOB 4RBTA 2V2ZA 1Q86T 5C24B 4F4KA 2G0IA 4OYPA 3ET6B 3AVNA 2PMZD 4LSLA 3T9NA 4HHTA 4X2BA 3SUNA 2X6NA 2QA4S 1TUGB 2QIFA 1RWOB 4URQU 1X60A 2QWLA 4KREA 2VBYA 4ED8A 2HZCA 1NAQA 2ZBIA 3QZ8A 2FVQA 5L1KA 4EYHB 1RBUA 3VEYA 5M1FA 2XO6A 5L1LA 4JP8A 4CYUA 3TEGA 4WKYA 2RF2B 2JEFA 1LQ9A 3CMAN 2CIMA 4IG0A 2OZMA 4ZPVR 2XTJP 4FCYA 4DTPA 3MOZA 2W2QP 4JI6K 1SUQB 2XS7A 1KFSA 4FK2A 1HYSA 4YS2A 3TA2A 2GGPB 4ZP7A 2PN6A 3RB6A 3H3OB 1VQSA 5BR8K 4H5WA 3DLGB 4F4XA 2PI5A 1KONA 3ZCMA 5AQHA 1T3VA 3NY0A 2F4VK 2JWLA 1HWLA 4ATNA 2QEXN 4OZNA 4RCHA 4J9UE 1C0UB 2MQPA 1AA1B 4H0PA 1M5OC 4FLUA 3S41A 2Z0GA 1GLLO 3O80A 1F5BA 1YITN 4JI3F 3QGPA 3RB4A 3Q8RB 1NHVA 2ZH7A 2CPDA 3TSUA 2Q2RA 2GHPA 2AYEA 3I0SB 3AVHA 5T14A 2UXBF 5GADU 3O8WA 2H5EA 2HNYB 5C25A 1UL3A 3K58A 5KFKA 3FBCA 3W3DA 3OTCA 5AZIB 2DRDA 1RISA 1X5SA 4XTTA 4K4XA 1F0XA 2QKBA 1FFWB 3EWGA 2FLOA 2POKA 3THPA 4O3SA 4B3MK 4USVA 2FLLA 1SH3A 4KB7A 4DF4A 2FTRA 4CJ3A 4KH1B 2D3O1 3J81O 4BR4A 4G6VB 2YTCA 1RXOB 2GEMA 4DL4A 4M5GA 4O3OA 2VASA 3POTB 3RUBL 3AA5X 4AE5A 1CZAN 4PUOB 4Q45A 5LMNF 1I5OB 1OO0B 4BE1A 3ZTSA 2CJXB 1SXLA 3G10A 4WTOB 4TU8A 3VQAA 5BYSA 4IYQA 3IM8A 4E1NA 4ZHRB 2PGCA 1WF1A 3KNAA 2W2NP 2A40A 3TTDA 2FD2A 5LXYA 3H90A 5C10A 3M9MB 3D2FA 3CJSA 4L75A 1ROFA 3HI0A 1KTVA 1SUQA 4PYAA 2FVRA 1R7IA 4V19S 1LKZA 3AJ2A 3ZXWA 4DU7A 3WT0A 3TABA 3CC2N 5KFSA 2X74A 4F04B 1N5YA 3KLGB 2BR0A 4HI2A 5AZJB 5IWAJ 4FM2A 2HQFA 3CULA 2ROGA 2LA4A 5EU7A 1HWKA 3P4UB 4OHWA 3THYA 4XPCA 3P45B 4Z2XA 4J9NA 1RJJA 4Q44A 2IMOA 3BGLA 1VQ7N 4JI2J 2C3UA 3O9RA 1R8AA 3CCWA 2GMHA 2QLWA 1DJ0A 2LQ5A 4IEEA 3VEXA 3D1HA 4MTPA 4M5KA 3VVUA 2CH6A 1QAIA 1BWVA 2PT0A 1ZBFA 4PPZA 3ET6A 3D0HE 2FZGB 2JLFA 3M9NB 4P2MA 2M88A 4DXLA 5TKWA 2ZVIA 2AJFE 3T6JA 1WC3A 5FIIA 4HTJA 4IDKB 3MM9B 1LFWA 4I67A 2XS5A 2KFZA 5HRNA 4F4YA 2JH3A 3PR5B 4BE2A 1MWZA 4HH0A 1F9HA 1T3OA 3D54A 4O8KA 3ENWA 2E7WA 4OX8A 1QVFR 3QGHA 4YDUA 1WUAA 3MD3A 4ECZA 4H5TA 3E66A 3V9WA 1XMQK 5A8RB 1VSFA 3PDNA 2Q79A 4EO8A 2AA4A 4DMZA 3UVJB 5HO4A 2R7WA 4CEFA 4P74A 3N0VA 3N4QA 5ETSA 1IKVA 4X4RA 3EL2A 1E6VB 4ILMA 1NGIA 1TU0B 2HKEA 5H9EJ 4JI7J 1SQEA 3R3TA 3M8YA 2IHR1 4RW7B 1PYOB 5I3QA 4Z4EA 2NPIA 4LC9B 3LGNA 1HNVA 3P3DA 1SL0A 3R3LA 4PXCA 2UUAJ 5FLXU 2CGLA 3SQ0A 1TAUA 1C1BB 2RHQB 1S79A 3KG4A 4C0BA 5MLCQ 1N4LA 4FLTA 2CQ4A 3TARA 2EFGA 5HROB 2MSTA 3HKZD 1U0SA 3MEEB 3AODA 5DDQC 3H2UB 4QPTA 5CCMA 5I4MA 2ZD1A 1OY6A 1WUUA 2FXUA 1KTQA 4TU9A 1Z05A 1XTZA 2ZUAA 2HNZA 4C6AA 2FSKA 3I31A 1RBLA 4DCHA 4CW7B 2UUTA 2P9UA 3GIMA 2J8SA 1RFQA 2KXHA 4QU6A 5F8MA 4B9VA 4AQYK 4LF1A 4GKJK 3ZC4A 3SDEB 2LECA 4YOXA 1IKYA 5KAKA 3VENA 4OJRA 2PZSA 3MXIA 4W5QA 2DNRA 1J27A 3IWNC 4LF6F 1ZBLA 5GAGP 4K0KK 1Z2LA 2VQFK 1ZZNA 1RAJA 3EY1A 4YQWA 2JLEA 2R7TA 4NI2B 3MXMA 1RHJB 2ZH4A 3GLJA 1ZA1B 2BRKA 3BKFA 1LXNA 1HNVB 3IRWP 2OP5A 4WFAQ 2FQQB 1X4EA 3L2QA 1X4AA 2YBVA 3HSTB 2VONA 2PY5A 1I51B 4ZA1A 3GV8B 3RAXA 1YT3A 4UOCA 4FJKA 3VEVA 5L1JA 4KHNA 2GV1A 4MAKA 3SAGA 3R2CJ 4M5NA 3SQGB 4ISGA 4JKEA 2W41A 1KFDA 1FD8A 3QWPA 3LGMA 3M7VA 4BR2A 3CJ8A 4F8RA 3MMAB 1S48A 4WYWA 1HD1A 2XSJA 2Q0UA 5C2GA 4JI1K 2P9IB 4CJSA 2RMLA 4I2QB 4JS4A 4CBWA 3OL6A 1YRXA 4L73A 1UEVA 3SAHA 3QDKA 3MEGA 3QFHA 4AYBD 1CXUA 4MDAA 1DTQB 1V9OA 4DV5F 2KRBA 1HNIB 2KFNA 4HL9A 3U4LA 2ZDPA 2B4UA 1NU4A 3TZXA 4ICLB 2VOOA 2E20A 1RWWB 3NNHA 3M5RA 1GTHA 3LDSA 1HNXF 3OR1A 1HW9A 3EO3A 1B0PA 2WUSA 4HVJA 1H73A 2RE2A 3G8SA 3R1LA 2M8DB 2Q43A 2F8TA 5T7BA 4JI8J 3KMQA 1M5VC 4F2SA 2OTLS 4ID5B 1RT6A 1K0TA 3BSAA 1VBYA 2RKIA 5T7LA 1S1WB 3W2WA 3VETA 4DR7J 2KM8B 3MMVA 1C0UA 2PC6A 2V7YA 1U45A 4FJJA 1IN0A 4KBIA 2HQDA 2HLTA 2IPOB 2NLXA 2B9YA 3AA4A 3SQOP 2GJIA 4ZP6A 4CHZA 3ZO7A 2E5LF 3OYKA 2FJWA 1D5AA 3QRPA 4O8UA 4YY3J 4DEZA 5KT2A 1NO8A 2NRXA 1S1VA 1X7VA 1JWWA 1I3AA 3ZETA 4B3TF 3R7BB 1TL3B 4B3RF 1VC0A 3P5BP 3DU5A 1QZ6A 3B78A 3MAAB 3NGSA 2ZF5O 4FJ7A 1OQ3A 1UAXA 2P9SA 4WE1A 1JQGA 4DR5F 1XC9A 3KK3B 3FZLA 4H5NA 4DR3J 3OYNA 2OMLA 1VSHA 2B6AA 1RBVA 3DFEA 3VGLA 4HTIA 2RF2A 4K4VA 3PJWA 4B3MJ 1GLCG 3W5ZA 3DYAB 2DR7A 4AF1A 1OWXA 3OSNA 3ISZA 2P9KB 4DZ6A 2ZVSA 2UP1A 2V2QA 3OXGA 5F3TA 1RABB 4QWDA 4PL8A 4URGA 2YI1A 2P2CB 1M5SA 4DU4A 3NMRA 4JI2K 3R6MA 1PBUA 4X64F 3EEQA 2ASMA 4CEQA 1KS2A 3OT9A 2QE5A 1WC1A 2CVEA 1IKXB 2FBYA 5FRMA 3GG4A 1SJFA 1J2VA 3A8IA 4CBUA 1RTIB 3LPEA 2XRIA 3MEGB 3QNNA 4FZYA 3ICLA 3L3CA 1LAWA 1HYVA 4DSKA 1FK9A 2W9AA 2WTFA 2CVIA 4BRGA 3C15B 3H5XA 1XR7A 3O3GA 3RBXA 4FJ9A 1WC4A 5FLXO 1YBTA 3HRGA 3EKSA 2QO3A 4EO6A 4DV7F 1RT1A 4BY9C 2RT3A 5AXNA 1S4EA 4JUZA 2EXUA 3CSKA 1HLWA 1HHSA 1VQ8S 4KFBB 2ZH8A 2KJWA 4OYIA 1XEZA 4IUFA 3CJBA 3PZPA 1W2BR 1E4GT 4DL0C 2AEJA 1VSMA 2G8HA 5GMDA 4GKJF 3VQ6A 2KFYA 4IOAQ 4DFJA 4U7BA 2JNJA 2VGNA 1U8SA 4B8AB 5AQQA 2QA4N 3VF0B 3HD2A 3MK6A 3I87A 4EP4A 2V8VA 1SCJB 2I5JA 2Y3YA 2IM1A 4OPKA 4OL8A 1IKYB 5F3ZA 2U1AA 4FWLA 2F9TA 1H7WA 3V4MA 3AO4A 2KHDA 2HQ3A 3T5HA 1XNRJ 1K8KB 4OI0A 3MHYA 3L95X 5C24A 1TK5A 5LMNK 2Z2MA 5D77A 4K7QA 3FBFA 4YOUA 1TFYA 3U9DA 1GK8A 4P2SA 4HTLA 1QVGR 2BEFA 3CMEN 4UQTA 4BACA 4CI0B 2DGWA 2C28A 4ZLNA 1IBLK 1Y9OA 3J7AN 1H6KX 2G2YA 2BJ9A 5DO2A 1SL1A 2D0PA 4O3PA 1RWKB 5KG3A 4Y2IA 1UPPA 3TUPA 4MIBA 3M8QB 3NEKA 2NXUA 1XNRK 1UMJA 1JIHA 2O1PA 3DWLA 4B17A 1TKDA 1YRUA 4B02A 2M5YA 1S6OA 2C2RA 4KHMA 5KPTA 4EBDA 1PCAA 1PG5B 3MMJA 3FZMA 3MURP 4BRQA 4CT8A 1Q8BA 4KY3A 3VQCA 5IQQA 2OA8A 4ZVFA 1IR1A 4K0KJ 5AQUA 1MW7A 2AJ1A 3MPUB 1B3TA 4RNHA 4DF8A 4ISFA 4FKXA 4RW6A 3K2PA 3PTWA 1U26A 4QYZJ 4NLWA 4JI6F 2WCXA 3C95A 4HEA9 2O8DA 3FLCO 4LVOP 1WHWA 1Y5LB 1YTAA 1O8BA 2XMUA 3UW1A 3C66A 3Q0AA 4R25A 4OZ5A 4RU2A 3HM8A 3C14A 5DK5A 2P6SA 3FZHA 3CG7A 2M52A 4Q8FA 3SQ1A 2FY1A 1PBAA 5DDOC 4BR5A 2AIRB 3AY9A 3TAQA 4WFNQ 1RBOB 1NGCA 3HOSA 2KRRA 4KHRA 4ELUA 2D74B 4CF0A 1WC6A 4PQUA 3OR2B 3QAUA 3T69A 3ZNJ1 4ECUA 2XS2A 4PYDA 4J9QA 2AU0A 1VQ5S 1TAQA 4DU8A 3PKYA 5AJ3J 1VSEA 3GQCA 5LL6d 4C7QA 2X1FA 3DHWC 3KWIA 1VBKA 3D45A 4HTUA 3I4HX 2D0AA 4IR1A 2BACA 1CZ9A 3V1QA 3VQ8A 2V51B 4YP3A 4MKAA 1HBOB 3D6FB 5C5JA 1C0TB 1NJIT 1GMVA 3T1AA 3VA3A 3IMXA 4I6WA 4Y65A 5BRHA 1I94F 2V63A 2O8BB 4QCLA 5AR0A 3GIRA 1MMDA 2BRLA 2RUGA 5A6PA 4NCGB 3M05A 4DPOA 1FERA 1NBWA 2OMOA 2UXBK 5H9FJ 2X78A 1VLOA 4ITSA 3SUQA 1P9YA 2OD4A 1RTDB 1SQFA 1YITS 2VG6B 3MDQA 1VK8A 2FVPA 1N34K 4FLWA 4TN2A 1LNQA 3M6GA 4AQYJ 2B4JA 3A5OC 5DLGA 3NGDA 5L1IA 1YBUA 4JS5A 1AXQA 3E8OA 1EETA 2UXCJ 4NLCA 3AJDA 3HF5A 4EI2A 2MLYA 4EAHD 4CNZA 2C1EB 5I42B 3CCZA 3KK3A 4K4UA 1HNIA 2WVFA 1C4CA 3LQVA 3PNIA 2VBWA 2DNKA 2YV0X 2BE2A 4GVBB 1SKSA 4I2QA 2ZZMA 4YOVA 4NLYA 2WONA 2O4GA 2FJDB 1FXDA 2Z2ZA 2AYBA 2NZTA 4FYWB 1SJ3P 1CJUA 1VQYA 2VF3A 4I6MB 1MWYA 4NMXA 2UUCF 3EKUA 3DOKB 2NXEA 3OBYA 2O01C 4DR1J 1IVZA 2P8IA 4N77A 1HNWK 5GAGU 1VQLN 4YOEA 3QLHA 4QQBA 4DKWA 1S9GA 2CZ9A 3D0PA 1GXLA 3LP1B 1KOHA 4AILC 1VQ6N 3TPQA 2MDAA 3R5DA 3OHAA 4UUXA 3MZIA 2O5DA 1VQ6S 4Y2MA 5EX0A 1I39A 3H46O 1NG9A 2W24A 1YJUA 5FJ4A 4JAXA 1RTJA 3S3MA 1N34F 4HHHA 3GV5B 4LFBF 5KQ8A 1O6XA 6FDRA 3GV7B 4ZIWA 2LSNA 1H7XA 5AQKA 5AE3A 1GXTA 1OIAA 4ECRA 2HB5A 2DNOA 4E1MA 4DFMA 4CGIA 1ZTTA 2LU1A 3ASMA 4JI4F 4AHVA 3J81U 3G25A 4NA1A 1X9SA 5KFHA 2DKOB 4R0JA 2BJDA 4IH6A 2UUCK 3EDQB 1BDGA 1NSPA 3FE1A 4X64K 5CXTA 2KKHA 3DM2B 3IRXA 1Y64A 1RUSA 3JS6A 2OI2A 3BBCA 1FT8A 3N6LA 3KIOA 5HSPA 2FJVA 2I6WA 3J7YP 3WQUA 2CGJA 3UE2A 1FTRA 4FBUA 3ZZOA 2IRYA 2JRSA 2DNNA 2M9KA 3OUYB 2XNQA 4DQRA 3KLIA 4WIIA 3OTDA 2OPPA 2KZMA 2W25A 1N6QA 2COLA 4EHUA 1B9FA 3M8QA 2XQCA 4RNMA 4AL7A 1GOBA 1EHWA 2E2OA 5G0RB 3LP2A 2CFXA 2NRTA 2GX9A 1U6FA 4C8ZA 2WHOA 2XMAA 3AO3A 2I2YA 4MKBA 2OTLN 2EG1A 1SC1B 3FRYA 1BQNA 2K1RB 2ZM6F 2GAHC 3BR8A 2EFNA 4NLRA 1YIJN 4E7HA 5JICA 4JN4A 2QC3A 4A47A 1B0TA 2O8CA 1WHXA 3CJ0A 1RHKB 4QIGA 3Q2TC 2XHBA 4F26A 2P9UB 4Y2AA 4M3XA 1N5VA 3BZQA 4CHPA 4Q0BA 4LBHA 1NSAA 1N0VC 1FKOB 3TJ8A 3Q89A 3S3OA 4ED0A 4ZP8A 4DL3A 4XH1A 3RB3A 3HHLB 3E9PA 2L3MA 3MUTP 2RQ4A 1FW6A 2UUWA 2AHOB 2PO4A 3SMPA 2LFVA 3GJSB 5F8HA 4DV2F 3HI9A 3DNCA 4UT4A 2MB0B 2LCWA 4PKGA 3HSZA 3F44A 5AQWA 1FXLA 3SCLE 2F65A 1X4FA 5M2RA 5HI7A 3GIJA 1NMNA 1Q7YO 3F9MA 2ZC4A 2CPEA 3IN5A 1JLFB 4PZVA 3BGOP 3RG6A 4CJFA 1R59O 2HGLA 3RMDA 2BW7A 2B43A 4MIWA 3L2WA 3FZ2A 2FB0A 4DR5K 4Y34A 2ZH5A 2KXFA 3O3FA 2W2PP 2YWFA 4FXDA 5DQIA 1HQEB 1R3NA 4EMDA 4B3TK 3AVJA 4BRAA 1S3XA 2D4WA 4YDUC 2ZKUA 2IYGA 3L0QA 3DGPB 1W25A 3HKWA 4DG1A 5IC6B 1R8CA 2O67A 1S0VA 2DISA 2A1SA 2MKIA 3WZ0A 3KG0A 4FLXA 4G65A 2VKRA 1U1KA 5AFUH 2HFZA 3AOCA 3VF2A 4KI4A 3K5NA 1WC5A 1DT9A 2HOEA 3SSSA 4OFZA 2AF6A 2HRTA 1T44A 3R5CA 2BM0A 5DRKA 1JLQA 4DS5A 3N5BA 5KFJA 3GJTB 2ASLA 4RBUA 1TMJA 1UW9A 5CY4A 4OYOA 1WAFA 3GE9A 4LVNP 5ADXA 3EICA 5CR4A 4ED1A 1S6PA 3GILA 1WSIA 3GOIA 1VRUA 2DH8A 4BLGA 4UZBA 1FD2A 3MCAB 3LZJA 2BJEA 4X4SA 2HHQA 1S97A 2E2QA 1OYDA 1S1VB 3TTCA 1D9FA 3MN7A 3H6EA 3JSMB 5AQOA 3SCKE 3CM5A 4CLWA 3OS2A 1FKAF 1RACB 1A5XA 2CPFA 4YB1P 1TL1B 3QIPB 3JSMA 4LRCA 2ZUGA 3IR5B 1J53A 2WB1D 4IG3A 4DMNA 4U9RA 1UWAA 2O66A 3QGGA 3K57A 2VBZA 1HWUA 2ZM6J 1FJGK 4CO3A 2ZH6A 1TKXA 3DI6B 4DWIA 3GCWP 3RMBA 3M6WA 1M1GA 1FJCA 1BLUA 2IVFB 4QW8A 3R97A 3NVKA 4Z7YA 1T03B 3K5PA 1U2VB 4DZDA 2VFSA 4DQPA 2W40A 2HFOA 4UQGA 3EE9A 4DL7A 4JI5F 3SV3A 2ILZA 5D4OA 4USTA 3HZGA 3G8QA 1GX5A 4PXBA 4OGCA 2CADA 1KBRA 2HSTA 2MQLA 3CO9A 3QZ7A 2AWZA 3EPGA 4XDCA 1DTQA 3KKFA 3R2DJ 2N4DA 4WK3A 1SIWB 3KUHA 2K7KA 2FC0A 1H2VZ 3M2RB 3G87A 3WC0A 3G6EN 1UTAA 2ZOFA 2UVUA 1XQSC 4E98A 4DL5A 4JI4J 1AT1B 2B7BB 2M8HA 3U1MA 5E7OB 1HBNB 4GO7X 3MXHP 5U47A 2WZ1A 2XSJB 1RBAA 4LIRA 4B8CA 2F8HA 3OW2M 4M3RA 4HYKA 2XWYA 3NCPA 3QBXA 4E89A 2QV6A 3BO3A 4RWWA 1ILYA 3O9TA 5HRSA 1KVJA 5IFMA 1F21A 1T8EA 1X9WA 1Q16B 4PKIA 3PJXA 5KFMA 5J1PA 5FDLA 3A3OB 4GVEA 4I9LA 4QOTA 1UFKA 4UOHA 4F3QA 1QHTA 1GLFO 4B1WB 1YJVA 3SDEA 2E5JA 1XIQA 4Y1CA 4WJBA 4IFYB 3TVZA 3M6VA 2DFFA 4J2DA 4DR6J 5D6GA 2AMCB 5DQGA 2UUCJ 1UVLA 2A42A 5B0DA 3OLAA 4UTGA 3CQXA 4EU0A 4I0WA 3SXLA 3T1YF 4QYZK 3TAGA 3V6HA 3RMAA 1VQNS 1HMVB 3ELHA 4YB7A 2ZD1B 2OH2A 1FO1A 1H0HB 1HBMB 4GVLA 5KFGA 4DU3A 2OGUA 4PHTX 3M1VB 2C42A 4RWXA 2MLXA 3EX7B 1A6LA 2EW9A 4WFBQ 1NLVA 2LEBA 2O3DA 2ABYA 3V6DB 2ACYA 4FZZA 4ECVA 2R8KA 5L9XA 4ZVOB 3R9PA 2CPXA 1N6QB 2GWKA 3O3LA 5DM6L 2CQPA 4EP5A 2D41A 4DX7A 3R5GA 2HURA 4I56A 4KE5A 4DV1J 1X0FA 3HCXA 2JEIA 3ENHA 4K0KF 1A7GE 3DLEB 4USKA 3DLKA 3UD4P 4X4OA 3MEKA 4AHTA 4QBUA 1F5AA 2F4VF 5D8HB 2OPRB 2R7UA 4KHQA 2GHVC 3B4MA 1IJJA 4XO0A 2J8AA 3I82A 5CCLA 4A8XA 5HVFA 5HL7L 3Q7CA 1JXLA 5AQSA 3KLEA 3BO4A 4B1VA 5H9EK 2MY7A 1TYQA 2W6LA 2IFXA 1REVB 1RWUA 3TX8A 2YJEA 2A3ZA 1P27B 4URSA 1SJ4P 4YUDA 3ETMA 5M2UA 1XNQJ 3ZZPA 3THWA 1VMBA 2EG2A 1TK8A 3LANA 1UWBB 3VR1A 3OFEA 1FNMA 4L3NA 3QFWA 2DHXA 3OXFA 4OZLA 1UEUA 2MQOA 1VYAA 4Q2MA 2AZ1A 3RBEA 3VQBA 1VRTB 1PJ5A 4LRFA 2YKMA 4P75A 2GZOA 2R7RA 2Z8QA 2ZNYA 2BVZA 4ERDA 3IAM9 1DTTA 4X62J 2P6TA 1VC6A 3HT0A 3FMWA 4OX9F 1RHUB 5LXRA 2C2OB 3TVYA 1BD6A 1P9QC 4MLEA 1GMUA 1YVUA 3VZHA 3M6XA 1TK0A 1SIZA 3HFVA 4B9SA 1NGGA 1GMWD 5BYRA 1S57A 4CO4A 1APSA 1U04A 4ILJA 2NRZA 2FHMA 5K8OA 2FGOA 4I1TA 4IFVB 4DCOB 3SIPB 4DPXA 1G4CA 2I1RA 2GVZA 5KG2A 3G82B 1TVRB 2DTJA 2VOPA 1NEEA 4KFBA 4ZCMA 2GNKA 2J76E 4CJPA 4EZ9A 2YNIB 4DV2K 5K20B 3CCMS 2MQNA 4PKDB 4CEEA 3BQ1A 3PYEA 2E2NA 4AH9A 1QM9A 5C42B 3UFCX 2PBDA 2XM3A 3G0ZA 4JKFA 5BR8F 4ZVPB 1UVIA 1X5PA 4CE9A 3SJJA 3A8JA 4PRFA 2AJQA 1IBLJ 4RW4A 1NJWA 3K5OA 2VJUA 4K2XA 2OEKA 1YTYA 3BSOA 2JJ4D 4NE9C 3BPDA 1LAVA 1BU6O 4ZN1A 1P8GA 4GKKF 5JVHL 3ZSZA 5F8LA 1ZM2A 3G4SN 1JK9B 4IO8A 3TVKA 1EKRA 4KAZA 2RDDA 3CVKA 3J80O 3DU6A 1QY7A 1CEZA 4L6V3 1OPZA 4A2BA 2KYZA 2ASOA 3NRBA 2XCAA 4NLBA 2YH1A 4BREA 3WXKA 2K06A 4DTSA 5DLFA 4KHPK 3RAMA 2ASYA 2C3YA 1LW0B 3AAPA 4NXNJ 1N32J 3W64A 2B5JB 1QD1A 1HR0F 3CIZA 4RW4B 4FPRA 1KC8T 4RNOA 5ETLA 3GJRB 4KGKA 2YHYA 5E3RA 3GG1A 2E5GA 3W1YC 4LSNA 5IT0A 4ANDA 5FROA 1WOPA 3H8YA 4DR5J 2NUUG 3BV8A 4DR1K 4PEOA 1CC7A 1R0AA 2YH0A 2YHBA 3KKRA 2BKPA 4EFAC 1D3WA 2DD8S 3NE6A 1GQEA 4DUYJ 2ZWHA 3ZZTA 1VRUB 3R27A 4X4QA 1QQMA 2RRBA 1TP7A 1FXRA 1WG5A 4CFAA 2D9OA 3GFZA 2BQ3A 3HLUA 1JNZB 2OD6A 4FSVA 2XHCA 4LSLB 3M32A 2UUBF 4CJ7A 3SQ4A 4NCBA 3RSEA 1CJVB 4O55A 3CCEN 4C0OC 3CD5A 3F2KA 3NCIA 4N8OA 1O13A 5M1OA 4DR1F 4M3WA 1PYSB 3MECA 3R7SB 2P9EA 4WF9Q 4LIWA 4IO9Q 3PFOA 3WNHA 3IC1A 4ANCA 3UDEA 3UKRB 4DPWA 4OYXA 3ZZYA 4FS1A 3CGIA 2N82B 2O8CB 2DO4A 3EDRB 1G6BA 5H1SV 4BDZA 2D1KA 4NZ0A 3SQ2A 3NNCA 1WOQA 2MY8A 1YJWS 2RHKA 5D15A 2N4CA 4O0IA 4ES1A 4C3MA 3HPOA 1YX2A 3L3UA 4KHSA 5FPEA 1FE0A 2FVSA 3MFHA 4AXJA 1DURA 3QSIA 3VF6A 4KHUA 5CYMA 1BOTO 3PW4A 3KK1A 1JL2A 3NF6A 1EZZB 3TA0A 3AGKA 3M8SA 1EP4A 3C16B 3QT8A 1QTMA 1QVFM 3V6DA 1R43A 2XLIA 2CWKA 3J7YU 1S77D 2ZGYA 1FWKA 1NK7A 1J5EK 4B3MF 2G0CA 1V3SA 4IOCL 2HPUA 2YWHA 4R8UA 1RAEB 4OGEA 1Y3JA 5F0WA 3OVAA 2KN4A 3M1VA 4ZCLA 4KT0C 4O0NA 5GADP 2RB7A 3DXMB 3KLHA 1S0NA 1PAUB 3SJHA 4NMLA 4YOWA 1JXEA 3C2PA 2ITMA 2F96A 1IM4A 4RNNA 1BE4A 4NYFA 1TUVA 4JI3K 3G9CA 3KK2A 2MZ1A 1IBKF 2IOCA 3GB0A 1VQOS 4FPBA 2AT1B 1LW2B 3SYZA 3ZX3A 1YJNS 2HNDB 3NOGA 2DIUA 4MMOA 4C4WA 1H1VA 4U67L 4CEZA 4NEZA 3MEEA 1HQ2A 2VQEJ 5BYQA 3U7JA 1G1XA 1OQ6A 3RSEB 3RMCA 5FDLB 2VDHA 1NOYA 3AB2B 1A5WA 3GDQA 4WYBA 4R8UB 2DXFA 3AVCA 3EGNA 1MN9A 4O3NA 1Y97A 2XBPA 4L72B 3VGMA 2R3VA 2E4LA 1FRMA 4JNEA 5KG7A 4CECA 3HPGA 4OLPA 3KWMA 1YWXA 3A5MC 3GL1A 5A6WA 3NAHA 1RBSA 2D7SA 3K5MA 2IVNA 2ZZNA 2Y1RI 1FKPB 1OJ4A 3CDWA 3SBGA 3KLIB 2CYYA 4U7UK 2EBEA 5KFAA 1BQXA 2IAJB 2Q66A 1JLAA 3KLGA 1D8YA 1NDPA 2OANA 2ZHOA 3MM8A 3M6UA 4NLOA 5MLCV 2DNYA 1J54A 2L9NA 1NK5A 4PABA 5ITHA 1UETA 5D78A 2YKOA 5A0YA 5IXUA 3TUZC 2PSZA 2E29A 1ACMB 1D8ZA 4LR7A 3CDBA 3V1OA 1RT5B 2GIRA 3WDOA 1MU2B 2ATCB 3LPTA 4YHHK 1QAXA 3R9LA 1CS4A 5F9LA 4E19A 1RTIA 3VF4A 4BG9A 3FVYA 4CM0A 3OBIA 4F0MA 1R0BG 3OL8A 2DNZA 4OJGA 1ZZFA 1YVNA 3CCES 4DTNA 1T9YA 3FFKB 3HM9A 4HHJA 2J5AA 3GSIA 1I94K 3R8YA 1U2VA 2AD9A 4V19J 1I6JA 1R8HA 2ATQA 1QJHA 5KT5A 3JYTB 3LM9A 1CULB 5AQZA 3SV4A 4NYPA 4C3LA 3AAQA 5E26A 1EX8A 5LJVA 2MZQA 3OHRA 1QZ5A 2R8IA 2HAFA 4DV4F 1T6DA 1Z6RA 4CLYA 3HPHA 4JKDA 3V81A 1CQNA 2XZDB 4DR2F 2BGGA 4CZIA 3QT6A 1KHWA 4U95A 2PFUA 4CGHA 4Q5VA 2E66A 4FJGA 4LF9K 4I6AA 1S1WA 5GAHI 1NNDA 3A4TA 4LF7K 2BXJA 5A8KA 1CULA 2DYAA 2JWNA 1S5ZA 3GWCA 4HT7A 1R8PA 4PUOA 1SKRA 1F9EB 4B9LA 2C2DA 2CG4A 2YQ3A 5F8GA 3H4BA 3ISND 1T7PA</