3NGYA

Crystal structure of rnase t (e92g mutant)
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
204
structure length
204
Chain Sequence
GLCDRFRGFYPVVIDVETAGFNAKTDALLEIAAITLKMDEQGWLMPDTTLHFHVEPFVGANLQPEALAFNGIDPNDPDRGAVSGYEALHEIFKVVRKGIKASGCNRAIMVAHNANFDHSFMMAAAERASLKRNPFHPFATFDTAALAGLALGQTVLSKACQTAGMDFDSTQAHSALYDTERTAVLFCEIVNRWKRLGGWPLSAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease T
publication title Structural basis for RNA trimming by RNase T in stable RNA 3'-end maturation
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 60
structure length 204
sequence length 204
chains with identical sequence B, C, D
ec nomenclature ec 3.1.13.-:
pdb deposition date 2010-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00929 RNase_T Exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3ngyA00
3DLHA 3OYHA 1U4BA 4HCBA 2D0AA 4E89A 3L2UA 1T7PA 2DTUA 2QKBA 1T03A 1RDBA 4AHCA 3TAQA 3G10A 2W42A 5CY4A 3ISNC 4Q0BA 5C24A 1RTHA 1D8YA 3LP3A 4E7HA 4Z0UA 3U3YA 3D0PA 4LH4A 4E19A 2HHQA 3HL8A 3QNNA 2ZQBA 3OYFA 4E1MA 4EZ6A 4CK2A 4ID1A 3SPZA 3CFOA 1HMVA 3OJSA 2Y1IA 4I9LA 1VRUA 2BGGA 4OGCA 4DLGA 1HYVA 3TR8A 2FBVA 3ZSVA 4CFAA 3LALA 3KLHA 3DM2A 5KRSA 2PYLA 4E7KA 5C25A 4DSJA 3SUQA 1RT4A 4DSIA 1TVRA 4AH9A 4CGFA 2G8KA 3L3VA 4QOZB 4NCGA 1Q8IA 2X74A 3VQ9A 3QEWA 3VQ5A 3VQ7A 3AO4A 3V6DA 3VQQA 1FKOA 4FJJA 4KHNA 4KHUA 4PWDA 4FYDA 1JKHA 3ZT4A 3TAMA 4Z4HA 4BDYA 4FK2A 2IS3A 4OKJA 1ZBLA 4FJKA 4BDPA 2RF2A 5FDLA 4CJWA 3DRPA 4DTRA 3V9WA 1JLAA 3BGRA 3OYKA 4DFKA 3OJUA 3V9ZA 4CF0A 4CJPA 4F2SA 4N76A 4M41A 3HXMA 4PA1A 3QO9A 2DFEA 1KVCA 4LY7A 1TAQA 4W5TA 2Z1HA 4FJ5A 1S9GA 3KD1E 3I0RA 4CGJA 3RWUA 4CGIA 1UA0A 4KI4A 1RBVA 1X9WA 3QIOA 4B9UA 1VSDA 4CHZA 4DLEA 5EU7A 1L3SA 1QSYA 3KLFA 3HPHA 2OPPA 2YHAA 3V9UA 4M3UA 1RBSA 3KIOA 1C1BA 4QAGA 4UQGA 3SQ2A 4KB0A 2VWKA 4KREA 1S6QA 3ULDA 4M42A 5K14A 3P83D 3QEXA 1KTQA 4ID5A 4B9TA 2YV0X 1LWEA 3OS2A 4DF4A 2KQ2A 4CJ4A 1TL3A 4FXDA 4E7LA 1BIZA 1D9FA 2HHVA 4YNQA 1DLOA 4EP4A 1IKYA 3NFAA 3SJJA 1WAJA 2P5GA 4FW1A 2HHUA 2IGIA 1EETA 4OLAA 3AVJA 4DF8A 3AO5A 3P1GA 1VSJA 2OA8A 4DSKA 1KRPA 3VQPA 2XY7A 1RNHA 1SL1A 3RTVA 4CJUA 4N47A 1HPZA 1ZBIA 2QXFA 3NGYA 4MQ3A 3UIQA 2LSNA 4B3OA 3K5NA 4FJLA 3OYLA 1YTUA 1ASWA 2DFHA 4BE2A 4Z4FA 4DSFA 1LW2A 4CECA 5E41A 2HNZA 4DS4A 2HNYA 3OYIA 4CFBA 4B9MA 3SYZA 4B9LA 1ITGA 4MFBA 3NCIA 4CJ3A 5HP1A 4JRQA 4CEZA 1LV5A 5HRSA 3QERA 1VSEA 4AHSA 3MEDA 5HRNA 1IKWA 2E6MA 3K5OA 4CHNA 1C6VA 1WSEA 2E6LA 3LPUA 3MEEA 2XY6A 4CJVA 2BANA 3DRRA 4OKKA 3KLEA 5D3GA 4HTUA 3ASMA 3KKRA 5HBMA 3WNFA 3ZT3A 3RR8A 5KRTA 3VQBA 4FK4A 2G8HA 4DTXA 4M3YA 5FROA 1B9DA 3NAEA 4AHUA 3OYJA 3BDPA 1EKEA 1SUQA 1NJWA 3LP1A 1JXBA 3VQ6A 4GW6A 1JLFA 3HPGA 4E3SA 1TKDA 3HP6A 3OYNA 2YNGA 3QESA 3C95A 4E0DA 1FK9A 1QQCA 3CQ8A 4NCAA 1WNSA 1EP4A 1JL1A 4AILC 3TAFA 4KHWA 4LSNA 3O3FA 3AVHA 5J1EA 2VG5A 3OS0A 2JLEA 1FKPA 3K5MA 2HB5A 3ZSRA 3L3UA 4RW6A 3L2WA 1BIUA 2XRIA 1Q9YA 4DU3A 3V1OA 5CYQA 4C8MA 2FBYA 1U49A 1J54A 4HUEA 1QSLA 3NBPA 2X78A 4LD0A 4DFJA 1SKSA 3PO5A 3AO2A 1XI1A 3MXJA 3K5LA 1LWCA 1S1VA 2EX3A 3LAKA 3M8RA 4DFMA 3NE6A 1S5JA 4JS4A 4BWMA 3V9SA 3HP9A 3LZIA 3B6OA 4Z4IA 3MXIA 2YKMA 4KHYA 3SZ2A 1C1AA 1RDDA 3HVTA 1TL1A 3VQ8A 4RW7A 2YNHA 2ATQA 5J2PA 1A5VA 1U47A 3DI6A 1SKWA 2OZMA 1YTAA 3ZSYA 3LPTA 2KW4A 4BE0A 4FJNA 1ZBHA 4M3ZA 1RDCA 3V1QA 4FM1A 1RBUA 2F8SA 1CLQA 4W5QA 3K59A 1JLCA 4DS5A 3OYGA 4E7JA 3TANA 3S3OA 1G15A 1NK9A 1ZYQA 2F8TA 4KFBA 4HUGA 3LP0A 5KTQA 4CK3A 4F3TA 5DK5A 4CIGA 4DG1A 1TK5A 3ZSWA 4FJ7A 4K8ZA 3SNNA 4B08A 3VQAA 3V4IA 3SQ4A 1WSJA 4O55A 3K2PA 4ELUA 1BCOA 4BE1A 1NOZA 3H08A 2O4IA 3QEIA 1YVUA 3HPOA 1RCHA 3AVAA 3AVMA 4CESA 1SKRA 1BISA 4BACA 4IDKA 1IG9A 1XHZA 1NK8A 2XHBA 3SPYA 3D45A 1WSIA 3VA0A 2R7YA 1L5UA 1C0TA 1CXQA 5HRPA 2KTQA 2DY4A 1BHLA 4WE1A 1C1CA 3AA3A 2XY5A 1L3TA 4CJQA 4EP5A 3HK2A 2KZZA 4TSXA 4IKFA 3PUFA 3OVNA 3OYAA 4CFCA 4ZTJA 4FLVA 5SWMA 3SQ0A 3OY9A 2A1SA 1D9DA 3PV8A 1NKBA 2Z1JA 3QIPA 3TABA 3RMDA 1C0UA 3TAPA 3O3HA 3VQDA 1RT2A 3AVLA 4M3RA 4DTSA 1CXUA 2IC3A 1NK0A 1QSSA 3OYEA 1IKXA 3OYBA 4RW4A 1RTJA 4CEAA 1S9EA 1NK7A 1LW0A 4CF1A 1Y97A 4CJLA 4DU1A 1DTQA 3I0SA 4CHPA 3L2QA 3PY8A 3SV4A 4DU4A 5FRNA 4OPJA 4AHVA 1IKVA 1Z26A 1KSPA 3NF6A 4CEQA 1NKCA 4W5RA 3KLIA 5JS1A 3KJVA 4CJKA 3C94A 4CGHA 1X9MA 1GOAA 4B9NA 1REVA 3DOKA 5C42A 3TARA 4N56A 3AVFA 5J2MA 1J5OA 1K6YA 2NUBA 3IG1A 1TKTA 1DTTA 3AO3A 1HJRA 1B9FA 1BL3A 2OYQA 4J2BA 1TKZA 2HHXA 4B8CA 3VA3A 4FVMA 4KHSA 3O4QA 4CF2A 4YFUA 3AA2A 3HYFA 1RT5A 1A5WA 2QK9A 3KLGA 4FJ9A 3VQCA 4CJTA 1EXQA 1W9HA 4N5SA 3L8BA 3F9KA 4FLUA 1T8EA 1SL0A 4CCHA 3T3FA 3M8QA 3IS9A 1RILA 4CGGA 3TWHA 1TK8A 1NOYA 1N5YA 2P51A 4KTQA 2X6NA 3DLGA 3VQ4A 4JRPA 2G8FA 4FZYA 1UAXA 4KPYA 4CJ5A 4DQQA 1UOCA 4H4MA 1BI4A 4C8OA 1XC9A 4FLTA 1U48A 2F96A 3V1RA 2HMIA 2P1JA 1LWFA 1ASVA 2B5JA 3AV9A 4DQIA 2OPSA 3S3NA 5DMRA 3ZSZA 3CG7A 3KTQA 4I7FA 3CM6A 3L2VA 4DSLA 3O3GA 3OYCA 1GOBA 4J2AA 1VSLA 3KK2A 3MECA 4CEDA 4CJEA 1BI4B 1WAFA 4CK1A 1B92A 1S1WA 4F2RA 3SUOA 2HHTA 4CHQA 3WNGA 2YKNA 4O0IA 2WOMA 2GUIA 4FM2A 1IH7A 4OJRA 1RT7A 1XWLA 3A2FA 4DMNA 5KGWA 4AHTA 3DLKA 3SQ1A 1X1PA 4CIEA 4K8XA 5T7BA 1VSKA 3PO4A 3U6FA 4HUFA 4FLXA 3TAGA 3EYZA 4FLWA 4FJ8A 3AVBA 3ZSQA 1SV5A 2IOCA 4HCCA 2KFZA 4M3WA 2HHWA 1Z25A 3G0ZA 4DTUA 2G8WA 2G8UA 4KI6A 1RBTA 2VWJA 2D0BA 3ITHA 3TI0A 4CF9A 5HRRA 3WNHA 3MAQA 3THVA 4CIFA 3QEVA 2Z1IA 4KV8A 3VN5A 1Q9XA 3E01A 1UWBA 1TV6A 1BCMA 5I3UA 1JLBA 1RTIA 1TGOA 4FW2A 1KFDA 4B8AB 3DLEA 4O44A 4JS5A 3DMJA 4IBNA 1F21A 4ELVA 1KLNA 1J9AA 3SUPA 1NK5A 2HW3A 2GV9A 3OS1A 1QHTA 4IFVA 3HT3A 1A5XA 3JYTA 3DRSA 3B6PA 4KO0A 4E1NA 4DTMA 1SL2A 4LSLA 3RRGA 4R5PA 4I9QA 4Z4EA 3IAYA 3IRXA 3DLRA 4PY5A 3LP2A 4PQUA 1GOCA 1LAWA 2RKIA 5CZ2A 3AVIA 3ZCMA 3NGIA 3HSTB 1NJZA 1S1UA 3AO1A 1VRTA 5JS2A 3ZSOA 4CEEA 3S9HA 3ALYA 4KHQA 3NDKA 4ELTA 1RT1A 1HQUA 3F73A 4B9SA 4F8RA 2RN2A 1JLEA 1YT3A 3DLBA 2WONA 4FJIA 3SCXA 2G8IA 1BQNA 1QE1A 5I42A 3NF8A 3KK1A 4CHOA 1QTMA 4DQPA 3MEGA 4W5OA 3JSMA 1EX4A 1D5AA 3AA5X 4CJSA 1I3AA 4FCYA 4Z4GA 5HROA 3CYMA 1WSGA 3EZ5A 4J2DA 1J53A 3AVCA 4C8LA 2A1RA 4J2EA 1NJYA 4G1QA 1L3VA 1NJXA 1KVBA 4RW8A 2IDOA 2ZD1A 4OGEA 4C8KA 3HM9A 4O0JA 3ZT0A 4XIUA 3NHGA 2ETJA 5KGXA 1UA1A 2P5OA 4M3TA 4DQSA 3VQEA 1I39A 4W5NA 4E7IA 4RG8A 2OPRA 4IFYA 2FBTA 1BGXT 4ZTFA 2PY5A 2PZSA 3DOLA 3RRHA 4CEFA 4RW9A 4LH5A 4HVJA 4KB1A 3L2RA 1TKXA 3V9XA 3T19A 4KTZA 4Y1DA 2YNIA 1HRHA 4BWJA 3RMCA 1JLQA 2RPIA 2YNFA 1S1TA 1C0MA 4NYFA 4AHRA 1VSHA 4FM0A 3PX4A 2HNDA 3NF7A 4H4OA 3PX0A 1ZBFA 3LZJA 3SI6A 3M8PA 4DTNA 3ZT2A 3LWLA 4NCBA 2GBZA 1RT3A 2X6SA 5HLFA 4EZ9A 3ZSXA 2Y1JA 5KI6A 2O4GA 1VSIA 1XHXA 1U45A 3OYDA 3KK3A 3NH2A 4O4GA 4FJXA 3T1AA 3OYMA 3C6UA 1KVAA 2G8VA 1RT6A 5CZ1A 3S3MA 3LANA 4CERA 1QS4A 1NK6A 4KTWA 3MXMA 1WN7A 1JXEA 4N41A 2B4JA 1CZBA 1S6PA 2BE2A 3V81A 2QKKA 4FJGA 2HVIA 4CE9A 2FC0A 3AA4A 4DTPA 4OPKA 4Y1CA 4NYNA 1TAUA 1RBRA 3U3GA 2PYJA 1HNVA 1WSFA 4DQRA 3HVRA 1ASUA 4FJHA 3HJFA 4CEOA 4DTJA 4BDZA 3LAMA 4L8RB 1FXXA 4ZHRA 3M8SA 3EY1A 3QNOA 3TAEA 5FRMA 1N6QA 2KFNA 3RR7A 4GVMA 5J2QA 3KD5E 3CM5A 2FBXA 4HHTA 1U04A 2EHGA 4B9VA 1MU2A 1WLJA 1NK4A 4OKEA 3QLHA 3C6TA 3NF9A 3KKSA 3QEPA 3AVGA 3LWMA 3LDSA 4M3XA 3CFPA 4CJFA 2D0CA 2HVHA 2XO7A 4CJRA 4DTOA 2I5JA 2IAJA 2VG7A 3FFIA 3QINA 4DWIA 4FZXC 4CFDA 1JLGA 3SV3A 4F3OA 4F4KA 4CHYA 3NGZA 4KRFA 3ZT1A 3PX6A 4FJMA 5SZTA 3HO1A 2OPQA 1LAVA 4IG0A 1TK0A 2E4LA 1RDAA 3NH0A 1JL2A 4Q5VA 2OZSA 4FK0A 4FZZA 1S1XA 4I2PA 4O5BA 1CZ9A 1HQEA 3O4NA 3NH1A 2KZMA 2ITGA 4CEBA 2Q3SA 4KKOA 4DFPA 2Z1GA 2VG6A 4I2QA 1L3UA 4H8KA 4ICLA 1NKEA 2DFFA 2XY8A 3QETA 4C8NA 2YHBA 1HNIA 3P5JA 4CGDA 4DSEA 1IO2A 2BDPA 4OVLA 2AJQA 2D5RA 1KLMA 3RMAA 1X9SA 1BQMA 4GMJB 1RTDA 3DYAA 3K58A 1KFSA 5CYMA 4QCLA 3I8DA 1HYSA 2JGUA 3AVNA 2HHSA 2ZE2A 1W0HA 1KCFA 3AVKA 4IG3A 4JLHA 4CF8A 1ZBUA 4Z4CA 3K57A 1R0AA 4KAZA 3WNEA 1VSFA 2B6AA 1VK0A 4FLYA 3RMBA 3SUNA 1VSMA 1T05A 4M45A 4OLBA 1HYZA 3CFRA 1O1WA 1WSHA 4PUOA 5J2NA 4FLZA
chains in the Genus database with same CATH superfamily
3DLHA 3OYHA 4DV3K 2D0AA 1LOTB 3A0IX 3EL2A 1T7PA 1U6ZA 4AHCA 3EZWA 5CY4A 4Q0BA 5C24A 1D8YA 3D0PA 3HL8A 4U7BA 3OYFA 4OPHA 4CK2A 4ID1A 3SPZA 2D4WA 3ZX2A 3OJSA 3QFPA 2Y1IA 2CGJA 2FBVA 3E1YA 4CFAA 5ADXH 3KLHA 4DSJA 2PYLA 1HUXA 4CD3A 4CGFA 4NCGA 4KHNA 1FKOA 2IIRA 4GKJK 3TAMA 4FK2A 4BG8A 1MWKA 1JLAA 3BGRA 3OYKA 4IZ9A 3FGUA 3HXMA 5FPEA 1KVCA 4IJAA 4W5TA 4FJ5A 1S9GA 4CGIA 1W97L 1L3SA 3HPHA 2OPPA 4IOCL 4UQGA 4KB0A 2VWKA 4BR4A 3G4SN 3J7AP 4M42A 4JHDB 3P83D 3QEXA 1KTQA 5JVHL 3OS2A 5BR8K 3WXKA 4E7LA 1BIZA 2HHVA 2O8EB 4JKEA 1TYQB 2HF3A 3CMEN 4ILJA 4AM6A 2E88A 1EETA 2E2QA 2OA8A 3SAGA 3VQPA 2XY7A 1SL1A 3RTVA 4CJUA 2E20A 3UIQA 2LSNA 1CZAN 1ASWA 2DFHA 4BE2A 3EE8A 1VQNN 4DS4A 3OYIA 1ITGA 3VEOA 5HP1A 1LV5A 2HBJA 1YJ9N 4X62K 5HRNA 3WXLA 3K5OA 1J6ZA 2GEMA 3MEEA 3D2FB 4CJVA 3KLEA 2Q2RA 5D3GA 4HTUA 4WQ4C 3ZT3A 4DR6K 2A41A 3TSUA 4BRLA 4M3YA 1KD1O 3NAEA 4IJNA 4QS9A 4GW6A 4E3SA 3HPGA 2YNGA 1NGFA 4NCAA 1EP4A 1JL1A 5AQYA 4JNEA 3TAFA 3O3FA 3AVHA 5J1EA 3NVKA 3K5MA 3FE1A 1RGIA 5AQXA 5CYQA 4XEIA 4A57A 5B8HA 1C0GA 1GLJO 3ZETA 1S1VA 1VQ8N 4BWMA 2YI1A 3V9SA 3E9PA 3MXIA 1C1AA 1KAXA 2ATQA 5J2PA 1HNXK 3DI6A 1T6CA 1RDCA 1SZ2A 1RBUA 2HHHK 3K59A 1JLCA 3CQYA 3OYGA 4E7JA 2F8TA 1MA9B 5KTQA 1VQKN 4DG1A 4H5NA 3OTOK 4FWOA 4U67L 4B08A 3V4IA 4EFHA 2P9SB 5E26A 4O55A 2QWQA 2QEXN 3CCVN 4PHTX 1SKRA 3CI5A 1BISA 4IDKA 3TU5A 4JI6K 1XHZA 2XHBA 3VA0A 3DAWA 2R7YA 1L5UA 2DY4A 3HOTA 5EY4A 1BHLA 1P90A 4XH5A 3IMXA 1L3TA 3C0BA 3MN7A 3WQTA 3WEEB 1NU0A 3OYAA 4ZTJA 5SWMA 4A61A 2A1SA 1D9DA 3M1FA 1NKBA 2YJFA 2Z1JA 3MK6A 3TABA 1N36K 2O8EA 1QSSA 2VQFK 3OYEA 4IXCA 4CJLA 3I8BA 2HBLA 1YAGA 2Q97A 3L2QA 3SV4A 4B1WB 3UKUB 3VTHA 4AHVA 1KSPA 4B9QA 3UKRA 4WFBL 4BGBA 4B9NA 1REVA 5C42A 3DWLA 3TARA 1J5OA 1K8KB 1TKTA 3E66A 2HHXA 1NJIO 4DV1K 4KH6A 2O8FB 1QQMA 4YFUA 3RVCA 4JI8K 1A5WA 2QK9A 3VQCA 3ZYYX 2D0PA 1W9HA 3G25A 3IS9A 2P9NA 2P51A 3O6WA 5EOYA 3S41A 4PL7A 3VEXA 4FLTA 1U48A 2F96A 4XH4A 2HMIA 1ASVA 1GLBG 2B5JA 3S3NA 2BH1A 5DMRA 3O3GA 4JI5K 1VSLA 3MX2A 3DJCA 4E1JA 4MDAA 5KPZA 1WAFA 1B92A 4F2RA 5AQFA 3WNGA 4CZEA 4FWKA 2GUIA 2I7NA 1IH7A 5KGWA 4AHTA 4CIEA 1VSKA 3VF6A 3U6FA 1FJGK 4FLXA 3EYZA 4FLWA 4EAHD 3AVBA 3A5NC 3P38A 2IOCA 3OA9A 4HCCA 4UY8O 4JD2A 3VGKA 2HHWA 3CQXA 4KI6A 4OX9K 3ITHA 3TPQA 4BG9A 4CF9A 5HRRA 4MO4A 3MAQA 4NO7A 2Z1IA 4IO9L 3VN5A 1Q9XA 2P9SA 2F9TA 1EO1A 1RTIA 1TGOA 3C7NA 4IEIA 5LJWA 4FW2A 2ZJRL 1KFDA 4B8AB 2P9LA 3P31A 2O8DB 4IBNA 1F21A 1J9AA 3G6EN 1G99A 4IFVA 1A5XA 4Z4EA 4LSLA 4R5PA 4I9QA 3IAYA 4PY5A 4C1NI 2RKIA 3NGIA 5CZ2A 1K8AO 1S1UA 3ZSOA 1KQSM 1RT1A 3TTFA 3K9KA 1YT3A 1MDUB 3W3DA 1BQNA 5I42A 3KK1A 4B1YB 3CJBA 3JXUA 5AZIB 3MEGA 2VGMA 4IWVA 3AA5X 4CJSA 5HROA 4RTFD 3BEXA 3B8AX 3EZ5A 1J53A 4J2EA 2HBKA 4G1QA 1L3VA 1KVBA 3PSIA 4RW8A 2ZD1A 1D4XA 4E7IA 4RG8A 1H1VA 5AZJA 4PKHA 4BVPA 1Y64A 2GELA 3BUZB 3O9RA 5TKWA 1K8KA 4JKCA 3L2RA 1TKXA 4KTZA 1HRHA 2GUPA 1VQPN 3R9PA 1WUAA 1VSHA 3NF7A 4ISFA 3PX0A 3M8PA 4NCBA 3LWLA 2GBZA 4BRAA 2ZGZA 4FL9A 4O4GA 3N4PA 5MLCQ 1IG8A 4O8UA 3F9MA 3S3MA 2G8VA 1QS4A 4ILGB 1BOTO 1CZBA 3T7ZA 2QKKA 4FJGA 1ZBSA 3VEVA 3AA4A 4DTPA 4OPKA 2FLOA 2WBNA 1TAUA 3U3GA 1WSFA 4FJHA 2AA4A 4BDZA 4I6MA 3TAEA 3RSEB 4GVMA 5J2QA 3J81O 2QWNA 1K73O 1U04A 1BUPA 4OKEA 3QLHA 1VQ4N 4BQZA 3Q7BA 3QFUA 2HVHA 4CJRA 4DTOA 2I5JA 2IAJA 3SMPA 4DWIA 1Z6RA 4F3OA 1HJOA 4CHYA 3NGZA 4KRFA 4IEEA 3ZT1A 2P9PB 2Q0RA 3M6GA 4H0OA 1LAVA 1JL2A 4FWSA 4CZKA 4O5BA 2KZMA 3NH1A 4CEBA 4DFPA 2GWKA 1L3UA 4C8NA 2YHBA 4IOAL 1NGDA 4CGDA 4DSEA 1IO2A 2AJQA 4OVLA 1KLMA 3DYAA 1KFSA 3THXB 4LF7K 1HYSA 2HHSA 2JGUA 1W0HA 3K57A 3WNEA 1ESVA 1N8RO 4B1UB 4FLYA 3T69A 4WQ5A 3CFRA 5AQUA 1ATNA 1NGHA 1U4BA 4DR1K 1SS6A 4YOVA 4E89A 2DTUA 2FF6A 1RDBA 3CCEN 3G10A 3ZX3A 2W42A 3ISNC 2UXBK 2ZF5O 3LP3A 4FSVA 4E7HA 4LH4A 4E19A 2HHQA 1NMNA 2ZQBA 3CFOA 1VQMN 4DR3K 3TSPA 3ZSVA 4AQYK 5KRSA 4DSIA 1RT4A 3AGRA 2G8KA 2FSKA 4QOZB 1Q8IA 3SBTA 3QEWA 4FJJA 3VQQA 3ZT4A 3A5OC 4OKJA 1JCFA 3HRGA 3D7EO 4DTRA 5M1OA 5AR0A 5M1QA 4CJPA 3V9ZA 3W0LA 1XUPO 4M41A 2PAVA 1TAQA 2Z1HA 4BRKA 3KD1E 3I0RA 4KI4A 4B9UA 4CHZA 4DLEA 3I55N 2V52B 3PLAA 5EVZA 2P9KA 2YHAA 4M3UA 1RBSA 3SQ2A 4DV4K 4KREA 3ULDA 4LC9B 2QTDA 1DLOA 5JVGL 3NFAA 3H3OB 1NG9A 4DSKA 1KRPA 1HPZA 4MQ3A 1YTUA 3VEWA 4Z4FA 4DSFA 4CI6A 4JI7K 4CECA 3AAPA 3G71N 4CFBA 2P9PA 4B9LA 4CEZA 1EWQA 4A2BA 1NGEA 1VSEA 4PKGA 1IKWA 1NMDA 4CHNA 3NMUA 2BUPA 2E6LA 3LPUA 4OKKA 4BR2A 3VF2A 3RR8A 3KKRA 3VQBA 5EX5A 3J7ZO 4FK4A 3CCJN 4HWIA 4EHUA 5FROA 3OYJA 3BDPA 3CC2N 1NJWA 3R6MA 3VQ6A 1JLFA 2O8BA 2RHKA 1VQ9N 3THWA 1YXQA 1T6DA 1QQCA 2NRWA 1WB9A 2VG5A 3KHYA 3NVMA 4DV7K 4K43A 2UUAK 1Q9YA 4C8MA 2FBYA 3QDKA 2OCEA 4HUEA 3NBPA 1XNQK 4LD0A 3PO5A 3MXJA 3K5LA 1WOQA 3M8RA 3B6OA 1NLVA 4Z4IA 2YHYA 2IVNA 2P9UA 4JK9A 1RDDA 3VQ8A 3A5MC 2YNHA 1QZ5A 3ZETB 2QM1A 4DQ8A 3KWGA 3ZSYA 4BE0A 3LPTA 2KW4A 2OTLN 4FM1A 1CLQA 1TUYA 1XNRK 2YHWA 4KFBA 3LP0A 3VTIA 4CIGA 1TK5A 4FJ7A 3F2KA 3SNNA 3OHRA 4CZGA 3SQ4A 4ELUA 3K2PA 2V51B 1BCOA 3C6HA 1N34K 3QEIA 3HPOA 1RCHA 4BRQA 1KAZA 1NK8A 3CCRN 1DT9A 3O8MA 1YF5L 3AARA 3D45A 3SPYA 5HRPA 2XY5A 1HKCA 1GLLO 4CZJA 4C23A 1GLEG 5AQTA 4EP5A 4TSXA 4JN4A 4GNIA 5CHIA 1V4SA 4CFCA 3SQ0A 2E2NA 3O3HA 3AVLA 1IKXA 4RW4A 1NK7A 3ATUA 1Y97A 2VGNA 4DU1A 4HTLA 2ZWHA 4OPJA 4X65K 4CEQA 3O9SA 3Q7CA 4MO5A 1X9MA 4CGHA 1GOAA 4B3RK 2NUBA 1DTTA 3UKRB 1HJRA 1BL3A 4XH1A 4JAXA 1TKZA 2JWKA 3O80A 3CCQN 4KHSA 3AA2A 2NRVA 3KLGA 4YOWA 2I7PA 2NNWA 4N5SA 4CCHA 3L8BA 1SL0A 1XC3A 4JI0K 3MCAB 3TWHA 1NOYA 1N5YA 4WFNL 4KPYA 3VQ4A 3HSCA 1S72N 4CJ5A 4B1ZA 2HSTA 1UOCA 4H4MA 1BI4A 1XC9A 3V1RA 2P9NB 2P1JA 5FPDA 3AV9A 4FWMA 3CCUN 3KTQA 3DXKA 3L2VA 1HPMA 3KK2A 3MECA 2HHTA 4H5TA 4O0IA 4FWNA 2WOMA 1YJWN 4BRPA 1Q81O 1HKGA 3A2FA 1EQYA 4DMNA 3R1XA 4BR5A 4LFCK 1SQKA 3DLKA 1X1PA 3JAMO 1S22A 3IUCA 2ZJPL 1FW6A 1HNWK 3WXIA 3TAGA 4FJ8A 5JMVA 4A5AA 1Z25A 2W41A 5IWAK 2G8UA 4K42A 3KVGA 3TI0A 1YJNN 3THVA 5AQIA 3FZLA 4JD2B 2WFBA 2Q36A 4JI2K 3O4WA 1VQ6N 3LDNA 1KLNA 2PFUA 3OS1A 1BWFO 1QHTA 3HT3A 4DTMA 4KO0A 4H0YB 3C7NB 3MCPA 4JKGB 4PQUA 1C0FA 2P9LB 1GOCA 5EXWA 3VERA 3AVIA 3HSTB 2E2OA 4KHQA 4ELTA 1HQUA 4B1XB 4F8RA 1KXPA 5FLXO 4DUYK 2WONA 4FJIA 2G8IA 2P9IB 4DQPA 5AQRA 3OW2M 3HOSA 4BRDA 1YHQN 1ZC6A 3EKSA 1ZXOA 3L4QA 1NJYA 4F9OA 1NJXA 3HM9A 4O0JA 4DR5K 5KGXA 4KH5A 1UA1A 4DQSA 3VQEA 3CXCM 2PZSA 3DOLA 3RRHA 4KB1A 1YIJN 3CHWA 1JLQA 2CGLA 2RPIA 4JI3K 1C0MA 4FM0A 4K41A 4GKKK 3LZJA 2X6SA 5AZJB 2O8CA 4CBWA 2Y1JA 2O4GA 4LF5K 3OYDA 3SJHA 4FJXA 3OYMA 3L6QA 1KVAA 1BDGA 1RT6A 3BY5A 4CERA 1NK6A 1VQ5N 4KTWA 4N41A 3P4IA 2GX9A 2BE2A 4FPBA 2FC0A 2VWBA 5ELZA 3BZCA 2PYJA 1HNVA 1ASUA 1VAZA 3M8SA 1P8ZA 3QNOA 3IDHA 5AQGA 1X3NA 3RR7A 3CM5A 2FBXA 2KLAA 3T1HK 1WLJA 2Q1NA 4M3XA 3KKSA 3AVGA 3LDSA 3CFPA 4CJFA 5BRFA 4I6MB 2D0CA 2FXUA 3FFIA 3QINA 2QW9A 4FZXC 1JLGA 3SV3A 4BRFA 3PX6A 4CZHA 3HO1A 4IG0A 4CD1A 4H0TB 4FK0A 1NWKA 5JICA 4I2PA 3O4NA 4KKOA 4I2QA 5C0YA 3P5JA 4JKDA 3WXMB 3RMAA 3K58A 4QCLA 3I8DA 3AVNA 3LDLA 4JLHA 2QWMA 1KCFA 4IG3A 4Z4CA 1SKSA 1R0AA 1ZBUA 1VSFA 3RMBA 3SUNA 4JKGA 2FF3B 1IBMK 3D2EA 4PUOA 5J2NA 3F5TA 2ASPA 2QWPA 3HM8A 3SAHA 1ATRA 2QKBA 5BPMA 1OKJA 3TAQA 1RTHA 3LDQA 2P9IA 3VGLA 1HMVA 3GDQA 1VRUA 4OGCA 4DLGA 1OH6A 4BC2A 4BROA 4DHYA 3DM2A 3SUQA 1TVRA 3V6DA 3VQ5A 4PWDA 3AO4A 5C15A 1NGBA 4EIAA 4Z4HA 5FDLA 1JCGA 4V19S 2OTJN 4F2SA 4N76A 4JKFA 3CD6N 4PA1A 3QO9A 4LY7A 4FPAA 4DUZK 3ULEB 3CCSN 4FWRA 4FOIA 3RWUA 1UA0A 1RBVA 3GG4A 1VSDA 3U4LA 5EU7A 3KLFA 4BRHA 1N32K 1C1BA 4QAGA 1V4TA 3M3ZA 3J8AA 3CJAA 5K14A 1IJJA 1KC8O 2YV0X 4DF4A 4FWPA 2KQ2A 4CZFA 4CJ4A 1TL3A 2IVPA 2P9KB 4YNQA 3ID6A 3AY9A 4EP4A 1I94K 3AGKA 1WAJA 2P5GA 4LFBK 1YVNA 2IGIA 4OLAA 1GLFO 3AVJA 3AO5A 4DF8A 4BREA 3E9OA 3CETA 3GL1A 1ZBIA 4B3OA 5IT9O 3OYLA 3K0SA 3CMAN 4DV6K 2NRTA 4MFBA 5BN9A 5E84A 5HRSA 4AHSA 3MEDA 4CBUA 2HF4A 2E6MA 1C6VA 4H0VB 1WSEA 4M7YA 2BANA 2QWRA 1S3XA 3WNFA 2NZTA 5HBMA 2ASOA 5KRTA 2FSNA 4NLCA 4DTXA 1B9DA 2E2PA 2VYPA 3BF1A 5AQOA 1T3VA 3OYNA 3CQ8A 4IOXA 1WNSA 4KHWA 4AILC 4LSNA 1LCUA 4QS8A 3OS0A 1FKPA 3C6AA 3ZSRA 3L3UA 4RW6A 1BIUA 2XRIA 2O8BB 5GIOA 3THWB 4GVEA 3MWPA 5AQWA 2X78A 4DFJA 2H3GX 3CJCA 4KBOA 4PKIA 4CJ7A 1GLDG 3OBYA 2EX3A 4MLEA 3CC4N 4DFMA 3NE6A 5AQSA 4JS4A 3HP9A 3LZIA 4AM7A 4BC5A 2YKMA 2W6KA 3SZ2A 3HVTA 3ID8A 1TL1A 4RW7A 1A5VA 4YDUC 1U47A 1E3MA 1SKWA 2OZMA 4FJNA 3LM9A 3I33A 3QB0A 5DM6L 1G15A 2P9UB 1ZYQA 4F3TA 4CK3A 5DK5A 3ZSWA 4MDBA 4K8ZA 5BRDA 3VQAA 1ATSA 3UE5A 3H08A 2WC9A 3AVAA 2WUSA 5AQJA 4CESA 1QQOA 1IG9A 4J8FA 3ULEA 3SBGA 5BN8A 4K25A 1WSIA 4X64K 2KTQA 1C0TA 4WE1A 5M1NA 3AA3A 3CJ7A 4CJQA 2KZZA 1XMOK 1U2VA 4IKFA 3VOVA 3OVNA 2D0OA 2QA4N 4CVNE 3PV8A 4JV5K 3TAPA 1RT2A 4M3RA 2GTDA 2IC3A 3O1BA 3OYBA 1RTJA 1YUWA 1S9EA 3CPEA 3U9ZA 3WQUA 1LW0A 3KK7A 4CF1A 4K0KK 1DTQA 4CHPA 2OANA 5FRNA 3MDQA 4DU4A 3FZKA 4JK7A 1IKVA 3NF6A 4IO8A 4W5RA 3KLIA 5C12A 3KJVA 4ISEA 3IFRA 3A5LC 3T1YK 3FZFA 3AVFA 5GAGP 1K6YA 3IG1A 1Q86O 2W40A 1B9FA 2OYQA 4J2BA 2HBMA 5GADP 4YY3K 2WTUA 4FVMA 5AQHA 3O4QA 4CF2A 3HYFA 1RT5A 4Z94A 4CJTA 1EXQA 4CZIA 3F9KA 3T3FA 3M8QA 4CGGA 4FO0A 1BO5O 2KKZA 4GY2B 4FZYA 1UAXA 1QVGM 4JKBA 1SAZA 4JI4K 1KAYA 4BRMA 1EWRA 5HL7L 2ZM6K 4DQIA 2OPSA 1HNZK 3ZSZA 1W2BM 3GOIA 4I7FA 4DSLA 4J2AA 1GOBA 4YOXA 2YHXA 4CEDA 4CJEA 1BI4B 5JLHA 2A6AA 1IBKK 2YKNA 1R59O 1HR0K 1WBBA 4FM2A 1RDUA 5GAEP 1J5EK 2Q0UA 3DXKB 5T7BA 2F9WA 4BRNA 3L4IA 1VQON 3KWIA 2UUCK 1N33K 3THYA 2HMPA 4H0PA 2KFZA 3ZLJA 3G0ZA 4DV5K 2D0BA 5ADXA 3WNHA 4H5WA 4X66K 2KHOA 4KV8A 3WXJA 3PIPL 2DPNA 1UWBA 3EKUA 5I3UA 1JLBA 5AQQA 5DM7L 3GBTA 1T44A 4O44A 3U9DA 3DMJA 1E4FT 3ATVA 4ELVA 5BRHA 3SUPA 1NK5A 1OH7A 4BVOA 4JKHA 1SL2A 3B6PA 4GV9A 1GLAG 3DLRA 3LP2A 3O9UA 2JWLA 1LAWA 3ZCMA 3FZMA 1VRTA 3FR0A 1DGKN 4DKWA 3VGMA 5F1XA 3ALYA 3ZX0A 2RN2A 4BRGA 3CCMN 3MN9A 1JLEA 3DLBA 2QWOA 1QE1A 1Q82O 4BY9C 4CHOA 1EX4A 1BG3A 2QXLA 4FCYA 1I3AA 4J2DA 4YOTA 4C8LA 2A1RA 4EHTA 3ZEUA 4LF9K 4DR2K 2IDOA 3ZT0A 4XIUA 3NHGA 2P5OA 4M3TA 4BR9A 2OPRA 2UYTA 1HX1A 4DV0K 4ZTFA 2PY5A 4A2AA 3CJ1A 2NRZA 4CEFA 4LH5A 1NGGA 5CR4A 3H3NO 2YNFA 4AHRA 4NYFA 3PX4A 1ZBFA 4DTNA 1XQSC 2UU9K 5HLFA 4EZ9A 4JK8A 5FPNA 4B3SK 5C10A 3KK3A 1JJ2M 1DEJA 3T1AA 1RDWX 3LANA 2O8CB 2B4JA 1S6PA 4BC3A 4CE9A 1X9JA 5AQPA 3CIPA 1RBRA 3BZKA 4DQRA 3HJFA 4DTJA 3LAMA 4L8RB 1FXXA 4ZHRA 3EY1A 4A59A 2KFNA 1N6QA 4H0XB 1YI2N 4KHPK 2V7YA 2EHGA 4B9VA 1MU2A 1NK4A 3C6TA 3QEPA 3MWTA 4CFDA 1HLUA 3VEZA 4B3TK 5SZTA 1TK0A 3O5BA 1RDAA 3IKMA 4NXMK 4FZZA 1S1XA 2QWLA 1CZ9A 1HQEA 3CJ9A 2VG6A 4H8KA 2UXCK 1NKEA 2BDPA 5BREA 1X9SA 4GMJB 1QVFM 5AQNA 3KZBA 1WBDA 2ZE2A 5C2FA 4KAZA 4DV2K 3TTDA 4QS7A 1VSMA 1WSHA 4FWQA 4FVUA 4FLZA 1IV0A 3N4QA 3P39A 4HCBA 3WT0A 3L2UA 2CH5A 1T03A 2BTFA 3CC7N 3R3LA 3EN9A 3D2EB 3U3YA 4Z0UA 2J4RA 5GAHP 3QNNA 2FSJA 5LMUK 1XMQK 4E1MA 4EZ6A 2UUBK 4I9LA 1E4GT 2BGGA 3CERA 3H1QA 1HYVA 3MN6A 3TR8A 3LALA 5TKYA 4DR4K 4E7KA 5C25A 5CE3A 1ILYA 4AH9A 5I9EB 3L3VA 5AQKA 3VQ9A 2X74A 3VETA 3VQ7A 4A5BA 4FYDA 4WCEL 4KHUA 1JKHA 4BDYA 2IS3A 1ZBLA 4FJKA 4BDPA 4AF1A 2RF2A 4CJWA 3DRPA 2Q31A 2E1ZA 3V9WA 4DFKA 3OJUA 4CF0A 1NNEA 4BR0A 2DFEA 4WF9L 4GV6A 4IFEA 5F0XA 4Y0WA 3QMLA 4CGJA 4JHDA 1X9WA 3QIOA 1M1KO 1QSYA 3V9UA 1TYQA 3KIOA 2ZGYA 4ISGA 2NRRA 1S6QA 4LF8K 4ID5A 4B9TA 3QICA 1LWEA 4FXDA 4BC4A 1D9FA 3LDPA 1IKYA 3SJJA 4B3MK 2CH6A 4FW1A 2HHUA 3VEYA 3P1GA 1VSJA 3M5RA 3PSFA 1RNHA 5BPNA 4GV3A 4DB3A 4N47A 2QXFA 3NGYA 3K5NA 4FJLA 4KH4A 3UB5A 1LW2A 5E41A 2HNZA 2YCHA 3D2FA 3HZ6A 2HNYA 2YX6A 4B9MA 3SYZA 4R79A 3NCIA 4CJ3A 4JRQA 3QERA 3E9LA 1QHAA 2XY6A 3DRRA 1NGIA 3ASMA 3J80O 2G8HA 4AHUA 5HOOA 1EKEA 1SUQA 3LP1A 1JXBA 2A40A 4BR7A 1TKDA 3HP6A 4OPAA 4E0DA 3QESA 3C95A 5KPRA 1FK9A 5AQVA 1VQLN 2JLEA 2HB5A 3EE9A 5LL6Z 4B1VA 3L2WA 3VENA 4DU3A 3V1OA 3VF4A 5BR9A 1U49A 1J54A 3K9JA 1QSLA 1M90O 4CW7B 3AO2A 4JEPA 1XI1A 4ILHA 1LWCA 3LAKA 5H1SQ 1OVYA 1S5JA 3MMVA 4KHYA 3HI0A 3VMFB 1YTAA 1ZBHA 1VHXA 4YDUA 1BA1A 4M3ZA 3V1QA 2F8SA 4W5QA 3TANA 4DS5A 3S3OA 4MLHA 1NK9A 5AFUA 4HUGA 1VQ7N 2RE2A 3VESA 1WSJA 4BE1A 1OH5A 5F2RA 1NOZA 3C65A 4L3QA 2O4IA 4DCHA 4IDHA 1YVUA 4H03B 3AVMA 4BACA 3WEEA 3CPWM 1CXQA 2NRHA 5GIPA 3DLLL 1C1CA 5AQZA 3D6RA 3HK2A 2A5XA 3BP8A 3PUFA 4OO1J 3H1VX 4FLVA 5AJ3K 3OY9A 5GINA 4LF4K 4LFAK 3QIPA 3RMDA 1C0UA 3QBXA 3UKUA 3VQDA 2YJEA 3I56N 4DTSA 5AFUH 1CXUA 1U2VB 3ENOA 1NK0A 4CEAA 3O9TA 3I0SA 4DR7K 3PY8A 5M1FA 4BGAA 1Z26A 1RFQA 1NKCA 2ZJQL 5JS1A 1JCEA 2O8FA 4CJKA 3C94A 1NM1A 3DOKA 3SLCA 4N56A 5J2MA 4WYBA 2D1KA 1BU6O 3AO3A 2HOEA 4B8CA 3VA3A 1K9MO 4FJ9A 5A2QO 5JLFA 4FLUA 3WUHA 1T8EA 1RILA 1TK8A 4KTQA 2X6NA 3DLGA 4JRPA 2G8FA 3MX5A 4DQQA 4C8OA 1O13A 3DXMB 4JI1K 1LWFA 3FFKB 3HTVA 1IBLK 5M1PA 3SK3A 3CG7A 1YITN 4NXNK 1W7AA 3CM6A 3OYCA 5M1KA 4CK1A 1HKBA 1S1WA 3SUOA 4CHQA 4G9ZA 2A42A 4JKAA 4WFAL 4OJRA 3CF5L 1RT7A 1XWLA 3SQ1A 1NBWA 3L0QA 4K8XA 3PO4A 2E8AA 3J7YP 3A8YA 4CZLA 4HUFA 3ZSQA 1SV5A 2QI2A 4H5RA 4A62A 4M3WA 4DTUA 2G8WA 2CGKA 1NGJA 1RBTA 2VWJA 4YHHK 2O8DA 4CIFA 3QEVA 3MN5A 3LL3A 3THYB 2UXDK 3E01A 4BQLA 3O08A 1TV6A 1BCMA 3TSQA 3EEQA 3DLEA 4JS5A 1OVQA 1NGAA 2HW3A 2GV9A 2VCPA 3JYTA 3VPZA 4PL8A 3DRSA 4FWLA 4O8KA 4E1NA 3RRGA 4LF6K 5LY3A 2A3ZA 4M7XA 3IRXA 1NJZA 3AO1A 4CEEA 5JS2A 5AZIA 3S9HA 5LMNK 3NDKA 4B9SA 3F73A 1GLCG 3EO3A 1Q18A 1QQNA 3GE1A 3LDOA 4RWTA 3SCXA 2VQEK 4M63C 3NF8A 4BRIA 1QTMA 4W5OA 3JSMA 3SAFA 1D5AA 4Z4GA 1NGCA 3CYMA 3FZHA 1WSGA 2ITMA 3AVCA 3O1WA 2AP1A 4OGEA 4C8KA 5BPLA 2ETJA 4CBXA 1I39A 4W5NA 2V7ZA 4IFYA 2FBTA 1BGXT 5FPMA 4RW9A 4HVJA 2NRXA 2PBDA 3T19A 3V9XA 4Y1DA 2YNIA 4BWJA 3H6EA 3ZEUB 3RMCA 1S1TA 2HNDA 5LJVA 4H4OA 3SI6A 4BRCA 4CZMA 3ZT2A 1RT3A 2F7TA 3ZSXA 4C1NK 5KI6A 1U45A 1VSIA 1XHXA 5KQDA 3R8EA 4YOYA 3NH2A 3TTCA 3H45C 3C6UA 3AAQA 5CZ1A 5KQ8A 1MWMA 2ASMA 4NLBA 1WN7A 1JXEA 3MXMA 3CCLN 3V81A 3O9QA 3RSEA 2HVIA 4YORA 1QZ6A 3DXMA 1X3MA 3U8XA 2EWSA 4Y1CA 4NYNA 3OBWA 3QBWA 4H5VA 2IVOA 3HVRA 4CEOA 4YOUA 2E5LK 5FRMA 1BA0A 3HBTA 3ENHA 3BF3A 3SMSA 5C2DA 3KD5E 4HHTA 2E1YA 3FLCO 3NF9A 2NLXA 3LWMA 2XO7A 5AQLA 2VG7A 4F4KA 3JS6A 2F4VK 1Z05A 4FJMA 2OPQA 3LM2A 2E4LA 3NH0A 4JYAK 4WQ4A 4Q5VA 2OZSA 4O5FA 3THXA 3ENBA 2ITGA 2Q3SA 1TUUA 2Z1GA 4FOEA 4ICLA 2DFFA 2XY8A 3QETA 1HNIA 2D5RA 1BQMA 1RTDA 5CYMA 5AQMA 1Q7YO 3AVKA 4CF8A 5KPTA 4WQ5C 1OH8A 2W6LA 2B6AA 1VK0A 3H46O 1T05A 1DKGD 4RCHA 4M45A 4OLBA 4NB4A 3PIOL 1HYZA 1O1WA 2GWJA
chains in the Genus database with same CATH topology
3DLHA 3OYHA 1U4BA 4HCBA 2D0AA 4E89A 3L2UA 1T7PA 2DTUA 2QKBA 1T03A 1RDBA 4AHCA 3TAQA 3G10A 2W42A 5CY4A 3ISNC 4Q0BA 5C24A 1RTHA 1D8YA 3LP3A 4E7HA 4Z0UA 3U3YA 3D0PA 4LH4A 4E19A 2HHQA 3HL8A 3QNNA 2ZQBA 3OYFA 4E1MA 4EZ6A 4CK2A 4ID1A 3SPZA 3CFOA 1HMVA 3OJSA 2Y1IA 4I9LA 1VRUA 2BGGA 4OGCA 4DLGA 1HYVA 3TR8A 2FBVA 3ZSVA 4CFAA 3LALA 3KLHA 3DM2A 5KRSA 2PYLA 4E7KA 5C25A 4DSJA 3SUQA 1RT4A 4DSIA 1TVRA 4AH9A 4CGFA 2G8KA 3L3VA 4QOZB 4NCGA 1Q8IA 2X74A 3VQ9A 3QEWA 3VQ5A 3VQ7A 3AO4A 3V6DA 3VQQA 1FKOA 4FJJA 4KHNA 4KHUA 4PWDA 4FYDA 1JKHA 3ZT4A 3TAMA 4Z4HA 4BDYA 4FK2A 2IS3A 4OKJA 1ZBLA 4FJKA 4BDPA 2RF2A 5FDLA 4CJWA 3DRPA 4DTRA 3V9WA 1JLAA 3BGRA 3OYKA 4DFKA 3OJUA 3V9ZA 4CF0A 4CJPA 4F2SA 4N76A 4M41A 3HXMA 4PA1A 3QO9A 2DFEA 1KVCA 4LY7A 1TAQA 4W5TA 2Z1HA 4FJ5A 1S9GA 3KD1E 3I0RA 4CGJA 3RWUA 4CGIA 1UA0A 4KI4A 1RBVA 1X9WA 3QIOA 4B9UA 1VSDA 4CHZA 4DLEA 5EU7A 1L3SA 1QSYA 3KLFA 3HPHA 2OPPA 2YHAA 3V9UA 4M3UA 1RBSA 3KIOA 1C1BA 4QAGA 4UQGA 3SQ2A 4KB0A 2VWKA 4KREA 1S6QA 3ULDA 4M42A 5K14A 3P83D 3QEXA 1KTQA 4ID5A 4B9TA 2YV0X 1LWEA 3OS2A 4DF4A 2KQ2A 4CJ4A 1TL3A 4FXDA 4E7LA 1BIZA 1D9FA 2HHVA 4YNQA 1DLOA 4EP4A 1IKYA 3NFAA 3SJJA 1WAJA 2P5GA 4FW1A 2HHUA 2IGIA 1EETA 4OLAA 3AVJA 4DF8A 3AO5A 3P1GA 1VSJA 2OA8A 4DSKA 1KRPA 3VQPA 2XY7A 1RNHA 1SL1A 3RTVA 4CJUA 4N47A 1HPZA 1ZBIA 2QXFA 3NGYA 4MQ3A 3UIQA 2LSNA 4B3OA 3K5NA 4FJLA 3OYLA 1YTUA 1ASWA 2DFHA 4BE2A 4Z4FA 4DSFA 1LW2A 4CECA 5E41A 2HNZA 4DS4A 2HNYA 3OYIA 4CFBA 4B9MA 3SYZA 4B9LA 1ITGA 4MFBA 3NCIA 4CJ3A 5HP1A 4JRQA 4CEZA 1LV5A 5HRSA 3QERA 1VSEA 4AHSA 3MEDA 5HRNA 1IKWA 2E6MA 3K5OA 4CHNA 1C6VA 1WSEA 2E6LA 3LPUA 3MEEA 2XY6A 4CJVA 2BANA 3DRRA 4OKKA 3KLEA 5D3GA 4HTUA 3ASMA 3KKRA 5HBMA 3WNFA 3ZT3A 3RR8A 5KRTA 3VQBA 4FK4A 2G8HA 4DTXA 4M3YA 5FROA 1B9DA 3NAEA 4AHUA 3OYJA 3BDPA 1EKEA 1SUQA 1NJWA 3LP1A 1JXBA 3VQ6A 4GW6A 1JLFA 3HPGA 4E3SA 1TKDA 3HP6A 3OYNA 2YNGA 3QESA 3C95A 4E0DA 1FK9A 1QQCA 3CQ8A 4NCAA 1WNSA 1EP4A 1JL1A 4AILC 3TAFA 4KHWA 4LSNA 3O3FA 3AVHA 5J1EA 2VG5A 3OS0A 2JLEA 1FKPA 3K5MA 2HB5A 3ZSRA 3L3UA 4RW6A 3L2WA 1BIUA 2XRIA 1Q9YA 4DU3A 3V1OA 5CYQA 4C8MA 2FBYA 1U49A 1J54A 4HUEA 1QSLA 3NBPA 2X78A 4LD0A 4DFJA 1SKSA 3PO5A 3AO2A 1XI1A 3MXJA 3K5LA 1LWCA 1S1VA 2EX3A 3LAKA 3M8RA 4DFMA 3NE6A 1S5JA 4JS4A 4BWMA 3V9SA 3HP9A 3LZIA 3B6OA 4Z4IA 3MXIA 2YKMA 4KHYA 3SZ2A 1C1AA 1RDDA 3HVTA 1TL1A 3VQ8A 4RW7A 2YNHA 2ATQA 5J2PA 1A5VA 1U47A 3DI6A 1SKWA 2OZMA 1YTAA 3ZSYA 3LPTA 2KW4A 4BE0A 4FJNA 1ZBHA 4M3ZA 1RDCA 3V1QA 4FM1A 1RBUA 2F8SA 1CLQA 4W5QA 3K59A 1JLCA 4DS5A 3OYGA 4E7JA 3TANA 3S3OA 1G15A 1NK9A 1ZYQA 2F8TA 4KFBA 4HUGA 3LP0A 5KTQA 4CK3A 4F3TA 5DK5A 4CIGA 4DG1A 1TK5A 3ZSWA 4FJ7A 4K8ZA 3SNNA 4B08A 3VQAA 3V4IA 3SQ4A 1WSJA 4O55A 3K2PA 4ELUA 1BCOA 4BE1A 1NOZA 3H08A 2O4IA 3QEIA 1YVUA 3HPOA 1RCHA 3AVAA 3AVMA 4CESA 1SKRA 1BISA 4BACA 4IDKA 1IG9A 1XHZA 1NK8A 2XHBA 3SPYA 3D45A 1WSIA 3VA0A 2R7YA 1L5UA 1C0TA 1CXQA 5HRPA 2KTQA 2DY4A 1BHLA 4WE1A 1C1CA 3AA3A 2XY5A 1L3TA 4CJQA 4EP5A 3HK2A 2KZZA 4TSXA 4IKFA 3PUFA 3OVNA 3OYAA 4CFCA 4ZTJA 4FLVA 5SWMA 3SQ0A 3OY9A 2A1SA 1D9DA 3PV8A 1NKBA 2Z1JA 3QIPA 3TABA 3RMDA 1C0UA 3TAPA 3O3HA 3VQDA 1RT2A 3AVLA 4M3RA 4DTSA 1CXUA 2IC3A 1NK0A 1QSSA 3OYEA 1IKXA 3OYBA 4RW4A 1RTJA 4CEAA 1S9EA 1NK7A 1LW0A 4CF1A 1Y97A 4CJLA 4DU1A 1DTQA 3I0SA 4CHPA 3L2QA 3PY8A 3SV4A 4DU4A 5FRNA 4OPJA 4AHVA 1IKVA 1Z26A 1KSPA 3NF6A 4CEQA 1NKCA 4W5RA 3KLIA 5JS1A 3KJVA 4CJKA 3C94A 4CGHA 1X9MA 1GOAA 4B9NA 1REVA 3DOKA 5C42A 3TARA 4N56A 3AVFA 5J2MA 1J5OA 1K6YA 2NUBA 3IG1A 1TKTA 1DTTA 3AO3A 1HJRA 1B9FA 1BL3A 2OYQA 4J2BA 1TKZA 2HHXA 4B8CA 3VA3A 4FVMA 4KHSA 3O4QA 4CF2A 4YFUA 3AA2A 3HYFA 1RT5A 1A5WA 2QK9A 3KLGA 4FJ9A 3VQCA 4CJTA 1EXQA 1W9HA 4N5SA 3L8BA 3F9KA 4FLUA 1T8EA 1SL0A 4CCHA 3T3FA 3M8QA 3IS9A 1RILA 4CGGA 3TWHA 1TK8A 1NOYA 1N5YA 2P51A 4KTQA 2X6NA 3DLGA 3VQ4A 4JRPA 2G8FA 4FZYA 1UAXA 4KPYA 4CJ5A 4DQQA 1UOCA 4H4MA 1BI4A 4C8OA 1XC9A 4FLTA 1U48A 2F96A 3V1RA 2HMIA 2P1JA 1LWFA 1ASVA 2B5JA 3AV9A 4DQIA 2OPSA 3S3NA 5DMRA 3ZSZA 3CG7A 3KTQA 4I7FA 3CM6A 3L2VA 4DSLA 3O3GA 3OYCA 1GOBA 4J2AA 1VSLA 3KK2A 3MECA 4CEDA 4CJEA 1BI4B 1WAFA 4CK1A 1B92A 1S1WA 4F2RA 3SUOA 2HHTA 4CHQA 3WNGA 2YKNA 4O0IA 2WOMA 2GUIA 4FM2A 1IH7A 4OJRA 1RT7A 1XWLA 3A2FA 4DMNA 5KGWA 4AHTA 3DLKA 3SQ1A 1X1PA 4CIEA 4K8XA 5T7BA 1VSKA 3PO4A 3U6FA 4HUFA 4FLXA 3TAGA 3EYZA 4FLWA 4FJ8A 3AVBA 3ZSQA 1SV5A 2IOCA 4HCCA 2KFZA 4M3WA 2HHWA 1Z25A 3G0ZA 4DTUA 2G8WA 2G8UA 4KI6A 1RBTA 2VWJA 2D0BA 3ITHA 3TI0A 4CF9A 5HRRA 3WNHA 3MAQA 3THVA 4CIFA 3QEVA 2Z1IA 4KV8A 3VN5A 1Q9XA 3E01A 1UWBA 1TV6A 1BCMA 5I3UA 1JLBA 1RTIA 1TGOA 4FW2A 1KFDA 4B8AB 3DLEA 4O44A 4JS5A 3DMJA 4IBNA 1F21A 4ELVA 1KLNA 1J9AA 3SUPA 1NK5A 2HW3A 2GV9A 3OS1A 1QHTA 4IFVA 3HT3A 1A5XA 3JYTA 3DRSA 3B6PA 4KO0A 4E1NA 4DTMA 1SL2A 4LSLA 3RRGA 4R5PA 4I9QA 4Z4EA 3IAYA 3IRXA 3DLRA 4PY5A 3LP2A 4PQUA 1GOCA 1LAWA 2RKIA 5CZ2A 3AVIA 3ZCMA 3NGIA 3HSTB 1NJZA 1S1UA 3AO1A 1VRTA 5JS2A 3ZSOA 4CEEA 3S9HA 3ALYA 4KHQA 3NDKA 4ELTA 1RT1A 1HQUA 3F73A 4B9SA 4F8RA 2RN2A 1JLEA 1YT3A 3DLBA 2WONA 4FJIA 3SCXA 2G8IA 1BQNA 1QE1A 5I42A 3NF8A 3KK1A 4CHOA 1QTMA 4DQPA 3MEGA 4W5OA 3JSMA 1EX4A 1D5AA 3AA5X 4CJSA 1I3AA 4FCYA 4Z4GA 5HROA 3CYMA 1WSGA 3EZ5A 4J2DA 1J53A 3AVCA 4C8LA 2A1RA 4J2EA 1NJYA 4G1QA 1L3VA 1NJXA 1KVBA 4RW8A 2IDOA 2ZD1A 4OGEA 4C8KA 3HM9A 4O0JA 3ZT0A 4XIUA 3NHGA 2ETJA 5KGXA 1UA1A 2P5OA 4M3TA 4DQSA 3VQEA 1I39A 4W5NA 4E7IA 4RG8A 2OPRA 4IFYA 2FBTA 1BGXT 4ZTFA 2PY5A 2PZSA 3DOLA 3RRHA 4CEFA 4RW9A 4LH5A 4HVJA 4KB1A 3L2RA 1TKXA 3V9XA 3T19A 4KTZA 4Y1DA 2YNIA 1HRHA 4BWJA 3RMCA 1JLQA 2RPIA 2YNFA 1S1TA 1C0MA 4NYFA 4AHRA 1VSHA 4FM0A 3PX4A 2HNDA 3NF7A 4H4OA 3PX0A 1ZBFA 3LZJA 3SI6A 3M8PA 4DTNA 3ZT2A 3LWLA 4NCBA 2GBZA 1RT3A 2X6SA 5HLFA 4EZ9A 3ZSXA 2Y1JA 5KI6A 2O4GA 1VSIA 1XHXA 1U45A 3OYDA 3KK3A 3NH2A 4O4GA 4FJXA 3T1AA 3OYMA 3C6UA 1KVAA 2G8VA 1RT6A 5CZ1A 3S3MA 3LANA 4CERA 1QS4A 1NK6A 4KTWA 3MXMA 1WN7A 1JXEA 4N41A 2B4JA 1CZBA 1S6PA 2BE2A 3V81A 2QKKA 4FJGA 2HVIA 4CE9A 2FC0A 3AA4A 4DTPA 4OPKA 4Y1CA 4NYNA 1TAUA 1RBRA 3U3GA 2PYJA 1HNVA 1WSFA 4DQRA 3HVRA 1ASUA 4FJHA 3HJFA 4CEOA 4DTJA 4BDZA 3LAMA 4L8RB 1FXXA 4ZHRA 3M8SA 3EY1A 3QNOA 3TAEA 5FRMA 1N6QA 2KFNA 3RR7A 4GVMA 5J2QA 3KD5E 3CM5A 2FBXA 4HHTA 1U04A 2EHGA 4B9VA 1MU2A 1WLJA 1NK4A 4OKEA 3QLHA 3C6TA 3NF9A 3KKSA 3QEPA 3AVGA 3LWMA 3LDSA 4M3XA 3CFPA 4CJFA 2D0CA 2HVHA 2XO7A 4CJRA 4DTOA 2I5JA 2IAJA 2VG7A 3FFIA 3QINA 4DWIA 4FZXC 4CFDA 1JLGA 3SV3A 4F3OA 4F4KA 4CHYA 3NGZA 4KRFA 3ZT1A 3PX6A 4FJMA 5SZTA 3HO1A 2OPQA 1LAVA 4IG0A 1TK0A 2E4LA 1RDAA 3NH0A 1JL2A 4Q5VA 2OZSA 4FK0A 4FZZA 1S1XA 4I2PA 4O5BA 1CZ9A 1HQEA 3O4NA 3NH1A 2KZMA 2ITGA 4CEBA 2Q3SA 4KKOA 4DFPA 2Z1GA 2VG6A 4I2QA 1L3UA 4H8KA 4ICLA 1NKEA 2DFFA 2XY8A 3QETA 4C8NA 2YHBA 1HNIA 3P5JA 4CGDA 4DSEA 1IO2A 2BDPA 4OVLA 2AJQA 2D5RA 1KLMA 3RMAA 1X9SA 1BQMA 4GMJB 1RTDA 3DYAA 3K58A 1KFSA 5CYMA 4QCLA 3I8DA 1HYSA 2JGUA 3AVNA 2HHSA 2ZE2A 1W0HA 1KCFA 3AVKA 4IG3A 4JLHA 4CF8A 1ZBUA 4Z4CA 3K57A 1R0AA 4KAZA 3WNEA 1VSFA 2B6AA 1VK0A 4FLYA 3RMBA 3SUNA 1VSMA 1T05A 4M45A 4OLBA 1HYZA 3CFRA 1O1WA 1WSHA 4PUOA 5J2NA 4FLZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DLH A;  3OYH A;  1U4B A;  4HCB A;  2D0A A;  4E89 A;  3L2U A;  1T7P A;  2DTU A;  2QKB A;  1T03 A;  1RDB A;  4AHC A;  3TAQ A;  3G10 A;  2W42 A;  5CY4 A;  3ISN C;  4Q0B A;  5C24 A;  1RTH A;  1D8Y A;  3LP3 A;  4E7H A;  4Z0U A;  3U3Y A;  3D0P A;  4LH4 A;  4E19 A;  2HHQ A;  3HL8 A;  3QNN A;  2ZQB A;  3OYF A;  4E1M A;  4EZ6 A;  4CK2 A;  4ID1 A;  3SPZ A;  3CFO A;  1HMV A;  3OJS A;  2Y1I A;  4I9L A;  1VRU A;  2BGG A;  4OGC A;  4DLG A;  1HYV A;  3TR8 A;  2FBV A;  3ZSV A;  4CFA A;  3LAL A;  3KLH A;  3DM2 A;  5KRS A;  2PYL A;  4E7K A;  5C25 A;  4DSJ A;  3SUQ A;  1RT4 A;  4DSI A;  1TVR A;  4AH9 A;  4CGF A;  2G8K A;  3L3V A;  4QOZ B;  4NCG A;  1Q8I A;  2X74 A;  3VQ9 A;  3QEW A;  3VQ5 A;  3VQ7 A;  3AO4 A;  3V6D A;  3VQQ A;  1FKO A;  4FJJ A;  4KHN A;  4KHU A;  4PWD A;  4FYD A;  1JKH A;  3ZT4 A;  3TAM A;  4Z4H A;  4BDY A;  4FK2 A;  2IS3 A;  4OKJ A;  1ZBL A;  4FJK A;  4BDP A;  2RF2 A;  5FDL A;  4CJW A;  3DRP A;  4DTR A;  3V9W A;  1JLA A;  3BGR A;  3OYK A;  4DFK A;  3OJU A;  3V9Z A;  4CF0 A;  4CJP A;  4F2S A;  4N76 A;  4M41 A;  3HXM A;  4PA1 A;  3QO9 A;  2DFE A;  1KVC A;  4LY7 A;  1TAQ A;  4W5T A;  2Z1H A;  4FJ5 A;  1S9G A;  3KD1 E;  3I0R A;  4CGJ A;  3RWU A;  4CGI A;  1UA0 A;  4KI4 A;  1RBV A;  1X9W A;  3QIO A;  4B9U A;  1VSD A;  4CHZ A;  4DLE A;  5EU7 A;  1L3S A;  1QSY A;  3KLF A;  3HPH A;  2OPP A;  2YHA A;  3V9U A;  4M3U A;  1RBS A;  3KIO A;  1C1B A;  4QAG A;  4UQG A;  3SQ2 A;  4KB0 A;  2VWK A;  4KRE A;  1S6Q A;  3ULD A;  4M42 A;  5K14 A;  3P83 D;  3QEX A;  1KTQ A;  4ID5 A;  4B9T A;  2YV0 X;  1LWE A;  3OS2 A;  4DF4 A;  2KQ2 A;  4CJ4 A;  1TL3 A;  4FXD A;  4E7L A;  1BIZ A;  1D9F A;  2HHV A;  4YNQ A;  1DLO A;  4EP4 A;  1IKY A;  3NFA A;  3SJJ A;  1WAJ A;  2P5G A;  4FW1 A;  2HHU A;  2IGI A;  1EET A;  4OLA A;  3AVJ A;  4DF8 A;  3AO5 A;  3P1G A;  1VSJ A;  2OA8 A;  4DSK A;  1KRP A;  3VQP A;  2XY7 A;  1RNH A;  1SL1 A;  3RTV A;  4CJU A;  4N47 A;  1HPZ A;  1ZBI A;  2QXF A;  3NGY A;  4MQ3 A;  3UIQ A;  2LSN A;  4B3O A;  3K5N A;  4FJL A;  3OYL A;  1YTU A;  1ASW A;  2DFH A;  4BE2 A;  4Z4F A;  4DSF A;  1LW2 A;  4CEC A;  5E41 A;  2HNZ A;  4DS4 A;  2HNY A;  3OYI A;  4CFB A;  4B9M A;  3SYZ A;  4B9L A;  1ITG A;  4MFB A;  3NCI A;  4CJ3 A;  5HP1 A;  4JRQ A;  4CEZ A;  1LV5 A;  5HRS A;  3QER A;  1VSE A;  4AHS A;  3MED A;  5HRN A;  1IKW A;  2E6M A;  3K5O A;  4CHN A;  1C6V A;  1WSE A;  2E6L A;  3LPU A;  3MEE A;  2XY6 A;  4CJV A;  2BAN A;  3DRR A;  4OKK A;  3KLE A;  5D3G A;  4HTU A;  3ASM A;  3KKR A;  5HBM A;  3WNF A;  3ZT3 A;  3RR8 A;  5KRT A;  3VQB A;  4FK4 A;  2G8H A;  4DTX A;  4M3Y A;  5FRO A;  1B9D A;  3NAE A;  4AHU A;  3OYJ A;  3BDP A;  1EKE A;  1SUQ A;  1NJW A;  3LP1 A;  1JXB A;  3VQ6 A;  4GW6 A;  1JLF A;  3HPG A;  4E3S A;  1TKD A;  3HP6 A;  3OYN A;  2YNG A;  3QES A;  3C95 A;  4E0D A;  1FK9 A;  1QQC A;  3CQ8 A;  4NCA A;  1WNS A;  1EP4 A;  1JL1 A;  4AIL C;  3TAF A;  4KHW A;  4LSN A;  3O3F A;  3AVH A;  5J1E A;  2VG5 A;  3OS0 A;  2JLE A;  1FKP A;  3K5M A;  2HB5 A;  3ZSR A;  3L3U A;  4RW6 A;  3L2W A;  1BIU A;  2XRI A;  1Q9Y A;  4DU3 A;  3V1O A;  5CYQ A;  4C8M A;  2FBY A;  1U49 A;  1J54 A;  4HUE A;  1QSL A;  3NBP A;  2X78 A;  4LD0 A;  4DFJ A;  1SKS A;  3PO5 A;  3AO2 A;  1XI1 A;  3MXJ A;  3K5L A;  1LWC A;  1S1V A;  2EX3 A;  3LAK A;  3M8R A;  4DFM A;  3NE6 A;  1S5J A;  4JS4 A;  4BWM A;  3V9S A;  3HP9 A;  3LZI A;  3B6O A;  4Z4I A;  3MXI A;  2YKM A;  4KHY A;  3SZ2 A;  1C1A A;  1RDD A;  3HVT A;  1TL1 A;  3VQ8 A;  4RW7 A;  2YNH A;  2ATQ A;  5J2P A;  1A5V A;  1U47 A;  3DI6 A;  1SKW A;  2OZM A;  1YTA A;  3ZSY A;  3LPT A;  2KW4 A;  4BE0 A;  4FJN A;  1ZBH A;  4M3Z A;  1RDC A;  3V1Q A;  4FM1 A;  1RBU A;  2F8S A;  1CLQ A;  4W5Q A;  3K59 A;  1JLC A;  4DS5 A;  3OYG A;  4E7J A;  3TAN A;  3S3O A;  1G15 A;  1NK9 A;  1ZYQ A;  2F8T A;  4KFB A;  4HUG A;  3LP0 A;  5KTQ A;  4CK3 A;  4F3T A;  5DK5 A;  4CIG A;  4DG1 A;  1TK5 A;  3ZSW A;  4FJ7 A;  4K8Z A;  3SNN A;  4B08 A;  3VQA A;  3V4I A;  3SQ4 A;  1WSJ A;  4O55 A;  3K2P A;  4ELU A;  1BCO A;  4BE1 A;  1NOZ A;  3H08 A;  2O4I A;  3QEI A;  1YVU A;  3HPO A;  1RCH A;  3AVA A;  3AVM A;  4CES A;  1SKR A;  1BIS A;  4BAC A;  4IDK A;  1IG9 A;  1XHZ A;  1NK8 A;  2XHB A;  3SPY A;  3D45 A;  1WSI A;  3VA0 A;  2R7Y A;  1L5U A;  1C0T A;  1CXQ A;  5HRP A;  2KTQ A;  2DY4 A;  1BHL A;  4WE1 A;  1C1C A;  3AA3 A;  2XY5 A;  1L3T A;  4CJQ A;  4EP5 A;  3HK2 A;  2KZZ A;  4TSX A;  4IKF A;  3PUF A;  3OVN A;  3OYA A;  4CFC A;  4ZTJ A;  4FLV A;  5SWM A;  3SQ0 A;  3OY9 A;  2A1S A;  1D9D A;  3PV8 A;  1NKB A;  2Z1J A;  3QIP A;  3TAB A;  3RMD A;  1C0U A;  3TAP A;  3O3H A;  3VQD A;  1RT2 A;  3AVL A;  4M3R A;  4DTS A;  1CXU A;  2IC3 A;  1NK0 A;  1QSS A;  3OYE A;  1IKX A;  3OYB A;  4RW4 A;  1RTJ A;  4CEA A;  1S9E A;  1NK7 A;  1LW0 A;  4CF1 A;  1Y97 A;  4CJL A;  4DU1 A;  1DTQ A;  3I0S A;  4CHP A;  3L2Q A;  3PY8 A;  3SV4 A;  4DU4 A;  5FRN A;  4OPJ A;  4AHV A;  1IKV A;  1Z26 A;  1KSP A;  3NF6 A;  4CEQ A;  1NKC A;  4W5R A;  3KLI A;  5JS1 A;  3KJV A;  4CJK A;  3C94 A;  4CGH A;  1X9M A;  1GOA A;  4B9N A;  1REV A;  3DOK A;  5C42 A;  3TAR A;  4N56 A;  3AVF A;  5J2M A;  1J5O A;  1K6Y A;  2NUB A;  3IG1 A;  1TKT A;  1DTT A;  3AO3 A;  1HJR A;  1B9F A;  1BL3 A;  2OYQ A;  4J2B A;  1TKZ A;  2HHX A;  4B8C A;  3VA3 A;  4FVM A;  4KHS A;  3O4Q A;  4CF2 A;  4YFU A;  3AA2 A;  3HYF A;  1RT5 A;  1A5W A;  2QK9 A;  3KLG A;  4FJ9 A;  3VQC A;  4CJT A;  1EXQ A;  1W9H A;  4N5S A;  3L8B A;  3F9K A;  4FLU A;  1T8E A;  1SL0 A;  4CCH A;  3T3F A;  3M8Q A;  3IS9 A;  1RIL A;  4CGG A;  3TWH A;  1TK8 A;  1NOY A;  1N5Y A;  2P51 A;  4KTQ A;  2X6N A;  3DLG A;  3VQ4 A;  4JRP A;  2G8F A;  4FZY A;  1UAX A;  4KPY A;  4CJ5 A;  4DQQ A;  1UOC A;  4H4M A;  1BI4 A;  4C8O A;  1XC9 A;  4FLT A;  1U48 A;  2F96 A;  3V1R A;  2HMI A;  2P1J A;  1LWF A;  1ASV A;  2B5J A;  3AV9 A;  4DQI A;  2OPS A;  3S3N A;  5DMR A;  3ZSZ A;  3CG7 A;  3KTQ A;  4I7F A;  3CM6 A;  3L2V A;  4DSL A;  3O3G A;  3OYC A;  1GOB A;  4J2A A;  1VSL A;  3KK2 A;  3MEC A;  4CED A;  4CJE A;  1BI4 B;  1WAF A;  4CK1 A;  1B92 A;  1S1W A;  4F2R A;  3SUO A;  2HHT A;  4CHQ A;  3WNG A;  2YKN A;  4O0I A;  2WOM A;  2GUI A;  4FM2 A;  1IH7 A;  4OJR A;  1RT7 A;  1XWL A;  3A2F A;  4DMN A;  5KGW A;  4AHT A;  3DLK A;  3SQ1 A;  1X1P A;  4CIE A;  4K8X A;  5T7B A;  1VSK A;  3PO4 A;  3U6F A;  4HUF A;  4FLX A;  3TAG A;  3EYZ A;  4FLW A;  4FJ8 A;  3AVB A;  3ZSQ A;  1SV5 A;  2IOC A;  4HCC A;  2KFZ A;  4M3W A;  2HHW A;  1Z25 A;  3G0Z A;  4DTU A;  2G8W A;  2G8U A;  4KI6 A;  1RBT A;  2VWJ A;  2D0B A;  3ITH A;  3TI0 A;  4CF9 A;  5HRR A;  3WNH A;  3MAQ A;  3THV A;  4CIF A;  3QEV A;  2Z1I A;  4KV8 A;  3VN5 A;  1Q9X A;  3E01 A;  1UWB A;  1TV6 A;  1BCM A;  5I3U A;  1JLB A;  1RTI A;  1TGO A;  4FW2 A;  1KFD A;  4B8A B;  3DLE A;  4O44 A;  4JS5 A;  3DMJ A;  4IBN A;  1F21 A;  4ELV A;  1KLN A;  1J9A A;  3SUP A;  1NK5 A;  2HW3 A;  2GV9 A;  3OS1 A;  1QHT A;  4IFV A;  3HT3 A;  1A5X A;  3JYT A;  3DRS A;  3B6P A;  4KO0 A;  4E1N A;  4DTM A;  1SL2 A;  4LSL A;  3RRG A;  4R5P A;  4I9Q A;  4Z4E A;  3IAY A;  3IRX A;  3DLR A;  4PY5 A;  3LP2 A;  4PQU A;  1GOC A;  1LAW A;  2RKI A;  5CZ2 A;  3AVI A;  3ZCM A;  3NGI A;  3HST B;  1NJZ A;  1S1U A;  3AO1 A;  1VRT A;  5JS2 A;  3ZSO A;  4CEE A;  3S9H A;  3ALY A;  4KHQ A;  3NDK A;  4ELT A;  1RT1 A;  1HQU A;  3F73 A;  4B9S A;  4F8R A;  2RN2 A;  1JLE A;  1YT3 A;  3DLB A;  2WON A;  4FJI A;  3SCX A;  2G8I A;  1BQN A;  1QE1 A;  5I42 A;  3NF8 A;  3KK1 A;  4CHO A;  1QTM A;  4DQP A;  3MEG A;  4W5O A;  3JSM A;  1EX4 A;  1D5A A;  3AA5 X;  4CJS A;  1I3A A;  4FCY A;  4Z4G A;  5HRO A;  3CYM A;  1WSG A;  3EZ5 A;  4J2D A;  1J53 A;  3AVC A;  4C8L A;  2A1R A;  4J2E A;  1NJY A;  4G1Q A;  1L3V A;  1NJX A;  1KVB A;  4RW8 A;  2IDO A;  2ZD1 A;  4OGE A;  4C8K A;  3HM9 A;  4O0J A;  3ZT0 A;  4XIU A;  3NHG A;  2ETJ A;  5KGX A;  1UA1 A;  2P5O A;  4M3T A;  4DQS A;  3VQE A;  1I39 A;  4W5N A;  4E7I A;  4RG8 A;  2OPR A;  4IFY A;  2FBT A;  1BGX T;  4ZTF A;  2PY5 A;  2PZS A;  3DOL A;  3RRH A;  4CEF A;  4RW9 A;  4LH5 A;  4HVJ A;  4KB1 A;  3L2R A;  1TKX A;  3V9X A;  3T19 A;  4KTZ A;  4Y1D A;  2YNI A;  1HRH A;  4BWJ A;  3RMC A;  1JLQ A;  2RPI A;  2YNF A;  1S1T A;  1C0M A;  4NYF A;  4AHR A;  1VSH A;  4FM0 A;  3PX4 A;  2HND A;  3NF7 A;  4H4O A;  3PX0 A;  1ZBF A;  3LZJ A;  3SI6 A;  3M8P A;  4DTN A;  3ZT2 A;  3LWL A;  4NCB A;  2GBZ A;  1RT3 A;  2X6S A;  5HLF A;  4EZ9 A;  3ZSX A;  2Y1J A;  5KI6 A;  2O4G A;  1VSI A;  1XHX A;  1U45 A;  3OYD A;  3KK3 A;  3NH2 A;  4O4G A;  4FJX A;  3T1A A;  3OYM A;  3C6U A;  1KVA A;  2G8V A;  1RT6 A;  5CZ1 A;  3S3M A;  3LAN A;  4CER A;  1QS4 A;  1NK6 A;  4KTW A;  3MXM A;  1WN7 A;  1JXE A;  4N41 A;  2B4J A;  1CZB A;  1S6P A;  2BE2 A;  3V81 A;  2QKK A;  4FJG A;  2HVI A;  4CE9 A;  2FC0 A;  3AA4 A;  4DTP A;  4OPK A;  4Y1C A;  4NYN A;  1TAU A;  1RBR A;  3U3G A;  2PYJ A;  1HNV A;  1WSF A;  4DQR A;  3HVR A;  1ASU A;  4FJH A;  3HJF A;  4CEO A;  4DTJ A;  4BDZ A;  3LAM A;  4L8R B;  1FXX A;  4ZHR A;  3M8S A;  3EY1 A;  3QNO A;  3TAE A;  5FRM A;  1N6Q A;  2KFN A;  3RR7 A;  4GVM A;  5J2Q A;  3KD5 E;  3CM5 A;  2FBX A;  4HHT A;  1U04 A;  2EHG A;  4B9V A;  1MU2 A;  1WLJ A;  1NK4 A;  4OKE A;  3QLH A;  3C6T A;  3NF9 A;  3KKS A;  3QEP A;  3AVG A;  3LWM A;  3LDS A;  4M3X A;  3CFP A;  4CJF A;  2D0C A;  2HVH A;  2XO7 A;  4CJR A;  4DTO A;  2I5J A;  2IAJ A;  2VG7 A;  3FFI A;  3QIN A;  4DWI A;  4FZX C;  4CFD A;  1JLG A;  3SV3 A;  4F3O A;  4F4K A;  4CHY A;  3NGZ A;  4KRF A;  3ZT1 A;  3PX6 A;  4FJM A;  5SZT A;  3HO1 A;  2OPQ A;  1LAV A;  4IG0 A;  1TK0 A;  2E4L A;  1RDA A;  3NH0 A;  1JL2 A;  4Q5V A;  2OZS A;  4FK0 A;  4FZZ A;  1S1X A;  4I2P A;  4O5B A;  1CZ9 A;  1HQE A;  3O4N A;  3NH1 A;  2KZM A;  2ITG A;  4CEB A;  2Q3S A;  4KKO A;  4DFP A;  2Z1G A;  2VG6 A;  4I2Q A;  1L3U A;  4H8K A;  4ICL A;  1NKE A;  2DFF A;  2XY8 A;  3QET A;  4C8N A;  2YHB A;  1HNI A;  3P5J A;  4CGD A;  4DSE A;  1IO2 A;  2BDP A;  4OVL A;  2AJQ A;  2D5R A;  1KLM A;  3RMA A;  1X9S A;  1BQM A;  4GMJ B;  1RTD A;  3DYA A;  3K58 A;  1KFS A;  5CYM A;  4QCL A;  3I8D A;  1HYS A;  2JGU A;  3AVN A;  2HHS A;  2ZE2 A;  1W0H A;  1KCF A;  3AVK A;  4IG3 A;  4JLH A;  4CF8 A;  1ZBU A;  4Z4C A;  3K57 A;  1R0A A;  4KAZ A;  3WNE A;  1VSF A;  2B6A A;  1VK0 A;  4FLY A;  3RMB A;  3SUN A;  1VSM A;  1T05 A;  4M45 A;  4OLB A;  1HYZ A;  3CFR A;  1O1W A;  1WSH A;  4PUO A;  5J2N A;  4FLZ A; 
#chains in the Genus database with same CATH topology
 3DLH A;  3OYH A;  4DV3 K;  2D0A A;  1LOT B;  3A0I X;  3EL2 A;  1T7P A;  1U6Z A;  4AHC A;  3EZW A;  5CY4 A;  4Q0B A;  5C24 A;  1D8Y A;  3D0P A;  3HL8 A;  4U7B A;  3OYF A;  4OPH A;  4CK2 A;  4ID1 A;  3SPZ A;  2D4W A;  3ZX2 A;  3OJS A;  3QFP A;  2Y1I A;  2CGJ A;  2FBV A;  3E1Y A;  4CFA A;  5ADX H;  3KLH A;  4DSJ A;  2PYL A;  1HUX A;  4CD3 A;  4CGF A;  4NCG A;  4KHN A;  1FKO A;  2IIR A;  4GKJ K;  3TAM A;  4FK2 A;  4BG8 A;  1MWK A;  1JLA A;  3BGR A;  3OYK A;  4IZ9 A;  3FGU A;  3HXM A;  5FPE A;  1KVC A;  4IJA A;  4W5T A;  4FJ5 A;  1S9G A;  4CGI A;  1W97 L;  1L3S A;  3HPH A;  2OPP A;  4IOC L;  4UQG A;  4KB0 A;  2VWK A;  4BR4 A;  3G4S N;  3J7A P;  4M42 A;  4JHD B;  3P83 D;  3QEX A;  1KTQ A;  5JVH L;  3OS2 A;  5BR8 K;  3WXK A;  4E7L A;  1BIZ A;  2HHV A;  2O8E B;  4JKE A;  1TYQ B;  2HF3 A;  3CME N;  4ILJ A;  4AM6 A;  2E88 A;  1EET A;  2E2Q A;  2OA8 A;  3SAG A;  3VQP A;  2XY7 A;  1SL1 A;  3RTV A;  4CJU A;  2E20 A;  3UIQ A;  2LSN A;  1CZA N;  1ASW A;  2DFH A;  4BE2 A;  3EE8 A;  1VQN N;  4DS4 A;  3OYI A;  1ITG A;  3VEO A;  5HP1 A;  1LV5 A;  2HBJ A;  1YJ9 N;  4X62 K;  5HRN A;  3WXL A;  3K5O A;  1J6Z A;  2GEM A;  3MEE A;  3D2F B;  4CJV A;  3KLE A;  2Q2R A;  5D3G A;  4HTU A;  4WQ4 C;  3ZT3 A;  4DR6 K;  2A41 A;  3TSU A;  4BRL A;  4M3Y A;  1KD1 O;  3NAE A;  4IJN A;  4QS9 A;  4GW6 A;  4E3S A;  3HPG A;  2YNG A;  1NGF A;  4NCA A;  1EP4 A;  1JL1 A;  5AQY A;  4JNE A;  3TAF A;  3O3F A;  3AVH A;  5J1E A;  3NVK A;  3K5M A;  3FE1 A;  1RGI A;  5AQX A;  5CYQ A;  4XEI A;  4A57 A;  5B8H A;  1C0G A;  1GLJ O;  3ZET A;  1S1V A;  1VQ8 N;  4BWM A;  2YI1 A;  3V9S A;  3E9P A;  3MXI A;  1C1A A;  1KAX A;  2ATQ A;  5J2P A;  1HNX K;  3DI6 A;  1T6C A;  1RDC A;  1SZ2 A;  1RBU A;  2HHH K;  3K59 A;  1JLC A;  3CQY A;  3OYG A;  4E7J A;  2F8T A;  1MA9 B;  5KTQ A;  1VQK N;  4DG1 A;  4H5N A;  3OTO K;  4FWO A;  4U67 L;  4B08 A;  3V4I A;  4EFH A;  2P9S B;  5E26 A;  4O55 A;  2QWQ A;  2QEX N;  3CCV N;  4PHT X;  1SKR A;  3CI5 A;  1BIS A;  4IDK A;  3TU5 A;  4JI6 K;  1XHZ A;  2XHB A;  3VA0 A;  3DAW A;  2R7Y A;  1L5U A;  2DY4 A;  3HOT A;  5EY4 A;  1BHL A;  1P90 A;  4XH5 A;  3IMX A;  1L3T A;  3C0B A;  3MN7 A;  3WQT A;  3WEE B;  1NU0 A;  3OYA A;  4ZTJ A;  5SWM A;  4A61 A;  2A1S A;  1D9D A;  3M1F A;  1NKB A;  2YJF A;  2Z1J A;  3MK6 A;  3TAB A;  1N36 K;  2O8E A;  1QSS A;  2VQF K;  3OYE A;  4IXC A;  4CJL A;  3I8B A;  2HBL A;  1YAG A;  2Q97 A;  3L2Q A;  3SV4 A;  4B1W B;  3UKU B;  3VTH A;  4AHV A;  1KSP A;  4B9Q A;  3UKR A;  4WFB L;  4BGB A;  4B9N A;  1REV A;  5C42 A;  3DWL A;  3TAR A;  1J5O A;  1K8K B;  1TKT A;  3E66 A;  2HHX A;  1NJI O;  4DV1 K;  4KH6 A;  2O8F B;  1QQM A;  4YFU A;  3RVC A;  4JI8 K;  1A5W A;  2QK9 A;  3VQC A;  3ZYY X;  2D0P A;  1W9H A;  3G25 A;  3IS9 A;  2P9N A;  2P51 A;  3O6W A;  5EOY A;  3S41 A;  4PL7 A;  3VEX A;  4FLT A;  1U48 A;  2F96 A;  4XH4 A;  2HMI A;  1ASV A;  1GLB G;  2B5J A;  3S3N A;  2BH1 A;  5DMR A;  3O3G A;  4JI5 K;  1VSL A;  3MX2 A;  3DJC A;  4E1J A;  4MDA A;  5KPZ A;  1WAF A;  1B92 A;  4F2R A;  5AQF A;  3WNG A;  4CZE A;  4FWK A;  2GUI A;  2I7N A;  1IH7 A;  5KGW A;  4AHT A;  4CIE A;  1VSK A;  3VF6 A;  3U6F A;  1FJG K;  4FLX A;  3EYZ A;  4FLW A;  4EAH D;  3AVB A;  3A5N C;  3P38 A;  2IOC A;  3OA9 A;  4HCC A;  4UY8 O;  4JD2 A;  3VGK A;  2HHW A;  3CQX A;  4KI6 A;  4OX9 K;  3ITH A;  3TPQ A;  4BG9 A;  4CF9 A;  5HRR A;  4MO4 A;  3MAQ A;  4NO7 A;  2Z1I A;  4IO9 L;  3VN5 A;  1Q9X A;  2P9S A;  2F9T A;  1EO1 A;  1RTI A;  1TGO A;  3C7N A;  4IEI A;  5LJW A;  4FW2 A;  2ZJR L;  1KFD A;  4B8A B;  2P9L A;  3P31 A;  2O8D B;  4IBN A;  1F21 A;  1J9A A;  3G6E N;  1G99 A;  4IFV A;  1A5X A;  4Z4E A;  4LSL A;  4R5P A;  4I9Q A;  3IAY A;  4PY5 A;  4C1N I;  2RKI A;  3NGI A;  5CZ2 A;  1K8A O;  1S1U A;  3ZSO A;  1KQS M;  1RT1 A;  3TTF A;  3K9K A;  1YT3 A;  1MDU B;  3W3D A;  1BQN A;  5I42 A;  3KK1 A;  4B1Y B;  3CJB A;  3JXU A;  5AZI B;  3MEG A;  2VGM A;  4IWV A;  3AA5 X;  4CJS A;  5HRO A;  4RTF D;  3BEX A;  3B8A X;  3EZ5 A;  1J53 A;  4J2E A;  2HBK A;  4G1Q A;  1L3V A;  1KVB A;  3PSI A;  4RW8 A;  2ZD1 A;  1D4X A;  4E7I A;  4RG8 A;  1H1V A;  5AZJ A;  4PKH A;  4BVP A;  1Y64 A;  2GEL A;  3BUZ B;  3O9R A;  5TKW A;  1K8K A;  4JKC A;  3L2R A;  1TKX A;  4KTZ A;  1HRH A;  2GUP A;  1VQP N;  3R9P A;  1WUA A;  1VSH A;  3NF7 A;  4ISF A;  3PX0 A;  3M8P A;  4NCB A;  3LWL A;  2GBZ A;  4BRA A;  2ZGZ A;  4FL9 A;  4O4G A;  3N4P A;  5MLC Q;  1IG8 A;  4O8U A;  3F9M A;  3S3M A;  2G8V A;  1QS4 A;  4ILG B;  1BOT O;  1CZB A;  3T7Z A;  2QKK A;  4FJG A;  1ZBS A;  3VEV A;  3AA4 A;  4DTP A;  4OPK A;  2FLO A;  2WBN A;  1TAU A;  3U3G A;  1WSF A;  4FJH A;  2AA4 A;  4BDZ A;  4I6M A;  3TAE A;  3RSE B;  4GVM A;  5J2Q A;  3J81 O;  2QWN A;  1K73 O;  1U04 A;  1BUP A;  4OKE A;  3QLH A;  1VQ4 N;  4BQZ A;  3Q7B A;  3QFU A;  2HVH A;  4CJR A;  4DTO A;  2I5J A;  2IAJ A;  3SMP A;  4DWI A;  1Z6R A;  4F3O A;  1HJO A;  4CHY A;  3NGZ A;  4KRF A;  4IEE A;  3ZT1 A;  2P9P B;  2Q0R A;  3M6G A;  4H0O A;  1LAV A;  1JL2 A;  4FWS A;  4CZK A;  4O5B A;  2KZM A;  3NH1 A;  4CEB A;  4DFP A;  2GWK A;  1L3U A;  4C8N A;  2YHB A;  4IOA L;  1NGD A;  4CGD A;  4DSE A;  1IO2 A;  2AJQ A;  4OVL A;  1KLM A;  3DYA A;  1KFS A;  3THX B;  4LF7 K;  1HYS A;  2HHS A;  2JGU A;  1W0H A;  3K57 A;  3WNE A;  1ESV A;  1N8R O;  4B1U B;  4FLY A;  3T69 A;  4WQ5 A;  3CFR A;  5AQU A;  1ATN A;  1NGH A;  1U4B A;  4DR1 K;  1SS6 A;  4YOV A;  4E89 A;  2DTU A;  2FF6 A;  1RDB A;  3CCE N;  3G10 A;  3ZX3 A;  2W42 A;  3ISN C;  2UXB K;  2ZF5 O;  3LP3 A;  4FSV A;  4E7H A;  4LH4 A;  4E19 A;  2HHQ A;  1NMN A;  2ZQB A;  3CFO A;  1VQM N;  4DR3 K;  3TSP A;  3ZSV A;  4AQY K;  5KRS A;  4DSI A;  1RT4 A;  3AGR A;  2G8K A;  2FSK A;  4QOZ B;  1Q8I A;  3SBT A;  3QEW A;  4FJJ A;  3VQQ A;  3ZT4 A;  3A5O C;  4OKJ A;  1JCF A;  3HRG A;  3D7E O;  4DTR A;  5M1O A;  5AR0 A;  5M1Q A;  4CJP A;  3V9Z A;  3W0L A;  1XUP O;  4M41 A;  2PAV A;  1TAQ A;  2Z1H A;  4BRK A;  3KD1 E;  3I0R A;  4KI4 A;  4B9U A;  4CHZ A;  4DLE A;  3I55 N;  2V52 B;  3PLA A;  5EVZ A;  2P9K A;  2YHA A;  4M3U A;  1RBS A;  3SQ2 A;  4DV4 K;  4KRE A;  3ULD A;  4LC9 B;  2QTD A;  1DLO A;  5JVG L;  3NFA A;  3H3O B;  1NG9 A;  4DSK A;  1KRP A;  1HPZ A;  4MQ3 A;  1YTU A;  3VEW A;  4Z4F A;  4DSF A;  4CI6 A;  4JI7 K;  4CEC A;  3AAP A;  3G71 N;  4CFB A;  2P9P A;  4B9L A;  4CEZ A;  1EWQ A;  4A2B A;  1NGE A;  1VSE A;  4PKG A;  1IKW A;  1NMD A;  4CHN A;  3NMU A;  2BUP A;  2E6L A;  3LPU A;  4OKK A;  4BR2 A;  3VF2 A;  3RR8 A;  3KKR A;  3VQB A;  5EX5 A;  3J7Z O;  4FK4 A;  3CCJ N;  4HWI A;  4EHU A;  5FRO A;  3OYJ A;  3BDP A;  3CC2 N;  1NJW A;  3R6M A;  3VQ6 A;  1JLF A;  2O8B A;  2RHK A;  1VQ9 N;  3THW A;  1YXQ A;  1T6D A;  1QQC A;  2NRW A;  1WB9 A;  2VG5 A;  3KHY A;  3NVM A;  4DV7 K;  4K43 A;  2UUA K;  1Q9Y A;  4C8M A;  2FBY A;  3QDK A;  2OCE A;  4HUE A;  3NBP A;  1XNQ K;  4LD0 A;  3PO5 A;  3MXJ A;  3K5L A;  1WOQ A;  3M8R A;  3B6O A;  1NLV A;  4Z4I A;  2YHY A;  2IVN A;  2P9U A;  4JK9 A;  1RDD A;  3VQ8 A;  3A5M C;  2YNH A;  1QZ5 A;  3ZET B;  2QM1 A;  4DQ8 A;  3KWG A;  3ZSY A;  4BE0 A;  3LPT A;  2KW4 A;  2OTL N;  4FM1 A;  1CLQ A;  1TUY A;  1XNR K;  2YHW A;  4KFB A;  3LP0 A;  3VTI A;  4CIG A;  1TK5 A;  4FJ7 A;  3F2K A;  3SNN A;  3OHR A;  4CZG A;  3SQ4 A;  4ELU A;  3K2P A;  2V51 B;  1BCO A;  3C6H A;  1N34 K;  3QEI A;  3HPO A;  1RCH A;  4BRQ A;  1KAZ A;  1NK8 A;  3CCR N;  1DT9 A;  3O8M A;  1YF5 L;  3AAR A;  3D45 A;  3SPY A;  5HRP A;  2XY5 A;  1HKC A;  1GLL O;  4CZJ A;  4C23 A;  1GLE G;  5AQT A;  4EP5 A;  4TSX A;  4JN4 A;  4GNI A;  5CHI A;  1V4S A;  4CFC A;  3SQ0 A;  2E2N A;  3O3H A;  3AVL A;  1IKX A;  4RW4 A;  1NK7 A;  3ATU A;  1Y97 A;  2VGN A;  4DU1 A;  4HTL A;  2ZWH A;  4OPJ A;  4X65 K;  4CEQ A;  3O9S A;  3Q7C A;  4MO5 A;  1X9M A;  4CGH A;  1GOA A;  4B3R K;  2NUB A;  1DTT A;  3UKR B;  1HJR A;  1BL3 A;  4XH1 A;  4JAX A;  1TKZ A;  2JWK A;  3O80 A;  3CCQ N;  4KHS A;  3AA2 A;  2NRV A;  3KLG A;  4YOW A;  2I7P A;  2NNW A;  4N5S A;  4CCH A;  3L8B A;  1SL0 A;  1XC3 A;  4JI0 K;  3MCA B;  3TWH A;  1NOY A;  1N5Y A;  4WFN L;  4KPY A;  3VQ4 A;  3HSC A;  1S72 N;  4CJ5 A;  4B1Z A;  2HST A;  1UOC A;  4H4M A;  1BI4 A;  1XC9 A;  3V1R A;  2P9N B;  2P1J A;  5FPD A;  3AV9 A;  4FWM A;  3CCU N;  3KTQ A;  3DXK A;  3L2V A;  1HPM A;  3KK2 A;  3MEC A;  2HHT A;  4H5T A;  4O0I A;  4FWN A;  2WOM A;  1YJW N;  4BRP A;  1Q81 O;  1HKG A;  3A2F A;  1EQY A;  4DMN A;  3R1X A;  4BR5 A;  4LFC K;  1SQK A;  3DLK A;  1X1P A;  3JAM O;  1S22 A;  3IUC A;  2ZJP L;  1FW6 A;  1HNW K;  3WXI A;  3TAG A;  4FJ8 A;  5JMV A;  4A5A A;  1Z25 A;  2W41 A;  5IWA K;  2G8U A;  4K42 A;  3KVG A;  3TI0 A;  1YJN N;  3THV A;  5AQI A;  3FZL A;  4JD2 B;  2WFB A;  2Q36 A;  4JI2 K;  3O4W A;  1VQ6 N;  3LDN A;  1KLN A;  2PFU A;  3OS1 A;  1BWF O;  1QHT A;  3HT3 A;  4DTM A;  4KO0 A;  4H0Y B;  3C7N B;  3MCP A;  4JKG B;  4PQU A;  1C0F A;  2P9L B;  1GOC A;  5EXW A;  3VER A;  3AVI A;  3HST B;  2E2O A;  4KHQ A;  4ELT A;  1HQU A;  4B1X B;  4F8R A;  1KXP A;  5FLX O;  4DUY K;  2WON A;  4FJI A;  2G8I A;  2P9I B;  4DQP A;  5AQR A;  3OW2 M;  3HOS A;  4BRD A;  1YHQ N;  1ZC6 A;  3EKS A;  1ZXO A;  3L4Q A;  1NJY A;  4F9O A;  1NJX A;  3HM9 A;  4O0J A;  4DR5 K;  5KGX A;  4KH5 A;  1UA1 A;  4DQS A;  3VQE A;  3CXC M;  2PZS A;  3DOL A;  3RRH A;  4KB1 A;  1YIJ N;  3CHW A;  1JLQ A;  2CGL A;  2RPI A;  4JI3 K;  1C0M A;  4FM0 A;  4K41 A;  4GKK K;  3LZJ A;  2X6S A;  5AZJ B;  2O8C A;  4CBW A;  2Y1J A;  2O4G A;  4LF5 K;  3OYD A;  3SJH A;  4FJX A;  3OYM A;  3L6Q A;  1KVA A;  1BDG A;  1RT6 A;  3BY5 A;  4CER A;  1NK6 A;  1VQ5 N;  4KTW A;  4N41 A;  3P4I A;  2GX9 A;  2BE2 A;  4FPB A;  2FC0 A;  2VWB A;  5ELZ A;  3BZC A;  2PYJ A;  1HNV A;  1ASU A;  1VAZ A;  3M8S A;  1P8Z A;  3QNO A;  3IDH A;  5AQG A;  1X3N A;  3RR7 A;  3CM5 A;  2FBX A;  2KLA A;  3T1H K;  1WLJ A;  2Q1N A;  4M3X A;  3KKS A;  3AVG A;  3LDS A;  3CFP A;  4CJF A;  5BRF A;  4I6M B;  2D0C A;  2FXU A;  3FFI A;  3QIN A;  2QW9 A;  4FZX C;  1JLG A;  3SV3 A;  4BRF A;  3PX6 A;  4CZH A;  3HO1 A;  4IG0 A;  4CD1 A;  4H0T B;  4FK0 A;  1NWK A;  5JIC A;  4I2P A;  3O4N A;  4KKO A;  4I2Q A;  5C0Y A;  3P5J A;  4JKD A;  3WXM B;  3RMA A;  3K58 A;  4QCL A;  3I8D A;  3AVN A;  3LDL A;  4JLH A;  2QWM A;  1KCF A;  4IG3 A;  4Z4C A;  1SKS A;  1R0A A;  1ZBU A;  1VSF A;  3RMB A;  3SUN A;  4JKG A;  2FF3 B;  1IBM K;  3D2E A;  4PUO A;  5J2N A;  3F5T A;  2ASP A;  2QWP A;  3HM8 A;  3SAH A;  1ATR A;  2QKB A;  5BPM A;  1OKJ A;  3TAQ A;  1RTH A;  3LDQ A;  2P9I A;  3VGL A;  1HMV A;  3GDQ A;  1VRU A;  4OGC A;  4DLG A;  1OH6 A;  4BC2 A;  4BRO A;  4DHY A;  3DM2 A;  3SUQ A;  1TVR A;  3V6D A;  3VQ5 A;  4PWD A;  3AO4 A;  5C15 A;  1NGB A;  4EIA A;  4Z4H A;  5FDL A;  1JCG A;  4V19 S;  2OTJ N;  4F2S A;  4N76 A;  4JKF A;  3CD6 N;  4PA1 A;  3QO9 A;  4LY7 A;  4FPA A;  4DUZ K;  3ULE B;  3CCS N;  4FWR A;  4FOI A;  3RWU A;  1UA0 A;  1RBV A;  3GG4 A;  1VSD A;  3U4L A;  5EU7 A;  3KLF A;  4BRH A;  1N32 K;  1C1B A;  4QAG A;  1V4T A;  3M3Z A;  3J8A A;  3CJA A;  5K14 A;  1IJJ A;  1KC8 O;  2YV0 X;  4DF4 A;  4FWP A;  2KQ2 A;  4CZF A;  4CJ4 A;  1TL3 A;  2IVP A;  2P9K B;  4YNQ A;  3ID6 A;  3AY9 A;  4EP4 A;  1I94 K;  3AGK A;  1WAJ A;  2P5G A;  4LFB K;  1YVN A;  2IGI A;  4OLA A;  1GLF O;  3AVJ A;  3AO5 A;  4DF8 A;  4BRE A;  3E9O A;  3CET A;  3GL1 A;  1ZBI A;  4B3O A;  5IT9 O;  3OYL A;  3K0S A;  3CMA N;  4DV6 K;  2NRT A;  4MFB A;  5BN9 A;  5E84 A;  5HRS A;  4AHS A;  3MED A;  4CBU A;  2HF4 A;  2E6M A;  1C6V A;  4H0V B;  1WSE A;  4M7Y A;  2BAN A;  2QWR A;  1S3X A;  3WNF A;  2NZT A;  5HBM A;  2ASO A;  5KRT A;  2FSN A;  4NLC A;  4DTX A;  1B9D A;  2E2P A;  2VYP A;  3BF1 A;  5AQO A;  1T3V A;  3OYN A;  3CQ8 A;  4IOX A;  1WNS A;  4KHW A;  4AIL C;  4LSN A;  1LCU A;  4QS8 A;  3OS0 A;  1FKP A;  3C6A A;  3ZSR A;  3L3U A;  4RW6 A;  1BIU A;  2XRI A;  2O8B B;  5GIO A;  3THW B;  4GVE A;  3MWP A;  5AQW A;  2X78 A;  4DFJ A;  2H3G X;  3CJC A;  4KBO A;  4PKI A;  4CJ7 A;  1GLD G;  3OBY A;  2EX3 A;  4MLE A;  3CC4 N;  4DFM A;  3NE6 A;  5AQS A;  4JS4 A;  3HP9 A;  3LZI A;  4AM7 A;  4BC5 A;  2YKM A;  2W6K A;  3SZ2 A;  3HVT A;  3ID8 A;  1TL1 A;  4RW7 A;  1A5V A;  4YDU C;  1U47 A;  1E3M A;  1SKW A;  2OZM A;  4FJN A;  3LM9 A;  3I33 A;  3QB0 A;  5DM6 L;  1G15 A;  2P9U B;  1ZYQ A;  4F3T A;  4CK3 A;  5DK5 A;  3ZSW A;  4MDB A;  4K8Z A;  5BRD A;  3VQA A;  1ATS A;  3UE5 A;  3H08 A;  2WC9 A;  3AVA A;  2WUS A;  5AQJ A;  4CES A;  1QQO A;  1IG9 A;  4J8F A;  3ULE A;  3SBG A;  5BN8 A;  4K25 A;  1WSI A;  4X64 K;  2KTQ A;  1C0T A;  4WE1 A;  5M1N A;  3AA3 A;  3CJ7 A;  4CJQ A;  2KZZ A;  1XMO K;  1U2V A;  4IKF A;  3VOV A;  3OVN A;  2D0O A;  2QA4 N;  4CVN E;  3PV8 A;  4JV5 K;  3TAP A;  1RT2 A;  4M3R A;  2GTD A;  2IC3 A;  3O1B A;  3OYB A;  1RTJ A;  1YUW A;  1S9E A;  3CPE A;  3U9Z A;  3WQU A;  1LW0 A;  3KK7 A;  4CF1 A;  4K0K K;  1DTQ A;  4CHP A;  2OAN A;  5FRN A;  3MDQ A;  4DU4 A;  3FZK A;  4JK7 A;  1IKV A;  3NF6 A;  4IO8 A;  4W5R A;  3KLI A;  5C12 A;  3KJV A;  4ISE A;  3IFR A;  3A5L C;  3T1Y K;  3FZF A;  3AVF A;  5GAG P;  1K6Y A;  3IG1 A;  1Q86 O;  2W40 A;  1B9F A;  2OYQ A;  4J2B A;  2HBM A;  5GAD P;  4YY3 K;  2WTU A;  4FVM A;  5AQH A;  3O4Q A;  4CF2 A;  3HYF A;  1RT5 A;  4Z94 A;  4CJT A;  1EXQ A;  4CZI A;  3F9K A;  3T3F A;  3M8Q A;  4CGG A;  4FO0 A;  1BO5 O;  2KKZ A;  4GY2 B;  4FZY A;  1UAX A;  1QVG M;  4JKB A;  1SAZ A;  4JI4 K;  1KAY A;  4BRM A;  1EWR A;  5HL7 L;  2ZM6 K;  4DQI A;  2OPS A;  1HNZ K;  3ZSZ A;  1W2B M;  3GOI A;  4I7F A;  4DSL A;  4J2A A;  1GOB A;  4YOX A;  2YHX A;  4CED A;  4CJE A;  1BI4 B;  5JLH A;  2A6A A;  1IBK K;  2YKN A;  1R59 O;  1HR0 K;  1WBB A;  4FM2 A;  1RDU A;  5GAE P;  1J5E K;  2Q0U A;  3DXK B;  5T7B A;  2F9W A;  4BRN A;  3L4I A;  1VQO N;  3KWI A;  2UUC K;  1N33 K;  3THY A;  2HMP A;  4H0P A;  2KFZ A;  3ZLJ A;  3G0Z A;  4DV5 K;  2D0B A;  5ADX A;  3WNH A;  4H5W A;  4X66 K;  2KHO A;  4KV8 A;  3WXJ A;  3PIP L;  2DPN A;  1UWB A;  3EKU A;  5I3U A;  1JLB A;  5AQQ A;  5DM7 L;  3GBT A;  1T44 A;  4O44 A;  3U9D A;  3DMJ A;  1E4F T;  3ATV A;  4ELV A;  5BRH A;  3SUP A;  1NK5 A;  1OH7 A;  4BVO A;  4JKH A;  1SL2 A;  3B6P A;  4GV9 A;  1GLA G;  3DLR A;  3LP2 A;  3O9U A;  2JWL A;  1LAW A;  3ZCM A;  3FZM A;  1VRT A;  3FR0 A;  1DGK N;  4DKW A;  3VGM A;  5F1X A;  3ALY A;  3ZX0 A;  2RN2 A;  4BRG A;  3CCM N;  3MN9 A;  1JLE A;  3DLB A;  2QWO A;  1QE1 A;  1Q82 O;  4BY9 C;  4CHO A;  1EX4 A;  1BG3 A;  2QXL A;  4FCY A;  1I3A A;  4J2D A;  4YOT A;  4C8L A;  2A1R A;  4EHT A;  3ZEU A;  4LF9 K;  4DR2 K;  2IDO A;  3ZT0 A;  4XIU A;  3NHG A;  2P5O A;  4M3T A;  4BR9 A;  2OPR A;  2UYT A;  1HX1 A;  4DV0 K;  4ZTF A;  2PY5 A;  4A2A A;  3CJ1 A;  2NRZ A;  4CEF A;  4LH5 A;  1NGG A;  5CR4 A;  3H3N O;  2YNF A;  4AHR A;  4NYF A;  3PX4 A;  1ZBF A;  4DTN A;  1XQS C;  2UU9 K;  5HLF A;  4EZ9 A;  4JK8 A;  5FPN A;  4B3S K;  5C10 A;  3KK3 A;  1JJ2 M;  1DEJ A;  3T1A A;  1RDW X;  3LAN A;  2O8C B;  2B4J A;  1S6P A;  4BC3 A;  4CE9 A;  1X9J A;  5AQP A;  3CIP A;  1RBR A;  3BZK A;  4DQR A;  3HJF A;  4DTJ A;  3LAM A;  4L8R B;  1FXX A;  4ZHR A;  3EY1 A;  4A59 A;  2KFN A;  1N6Q A;  4H0X B;  1YI2 N;  4KHP K;  2V7Y A;  2EHG A;  4B9V A;  1MU2 A;  1NK4 A;  3C6T A;  3QEP A;  3MWT A;  4CFD A;  1HLU A;  3VEZ A;  4B3T K;  5SZT A;  1TK0 A;  3O5B A;  1RDA A;  3IKM A;  4NXM K;  4FZZ A;  1S1X A;  2QWL A;  1CZ9 A;  1HQE A;  3CJ9 A;  2VG6 A;  4H8K A;  2UXC K;  1NKE A;  2BDP A;  5BRE A;  1X9S A;  4GMJ B;  1QVF M;  5AQN A;  3KZB A;  1WBD A;  2ZE2 A;  5C2F A;  4KAZ A;  4DV2 K;  3TTD A;  4QS7 A;  1VSM A;  1WSH A;  4FWQ A;  4FVU A;  4FLZ A;  1IV0 A;  3N4Q A;  3P39 A;  4HCB A;  3WT0 A;  3L2U A;  2CH5 A;  1T03 A;  2BTF A;  3CC7 N;  3R3L A;  3EN9 A;  3D2E B;  3U3Y A;  4Z0U A;  2J4R A;  5GAH P;  3QNN A;  2FSJ A;  5LMU K;  1XMQ K;  4E1M A;  4EZ6 A;  2UUB K;  4I9L A;  1E4G T;  2BGG A;  3CER A;  3H1Q A;  1HYV A;  3MN6 A;  3TR8 A;  3LAL A;  5TKY A;  4DR4 K;  4E7K A;  5C25 A;  5CE3 A;  1ILY A;  4AH9 A;  5I9E B;  3L3V A;  5AQK A;  3VQ9 A;  2X74 A;  3VET A;  3VQ7 A;  4A5B A;  4FYD A;  4WCE L;  4KHU A;  1JKH A;  4BDY A;  2IS3 A;  1ZBL A;  4FJK A;  4BDP A;  4AF1 A;  2RF2 A;  4CJW A;  3DRP A;  2Q31 A;  2E1Z A;  3V9W A;  4DFK A;  3OJU A;  4CF0 A;  1NNE A;  4BR0 A;  2DFE A;  4WF9 L;  4GV6 A;  4IFE A;  5F0X A;  4Y0W A;  3QML A;  4CGJ A;  4JHD A;  1X9W A;  3QIO A;  1M1K O;  1QSY A;  3V9U A;  1TYQ A;  3KIO A;  2ZGY A;  4ISG A;  2NRR A;  1S6Q A;  4LF8 K;  4ID5 A;  4B9T A;  3QIC A;  1LWE A;  4FXD A;  4BC4 A;  1D9F A;  3LDP A;  1IKY A;  3SJJ A;  4B3M K;  2CH6 A;  4FW1 A;  2HHU A;  3VEY A;  3P1G A;  1VSJ A;  3M5R A;  3PSF A;  1RNH A;  5BPN A;  4GV3 A;  4DB3 A;  4N47 A;  2QXF A;  3NGY A;  3K5N A;  4FJL A;  4KH4 A;  3UB5 A;  1LW2 A;  5E41 A;  2HNZ A;  2YCH A;  3D2F A;  3HZ6 A;  2HNY A;  2YX6 A;  4B9M A;  3SYZ A;  4R79 A;  3NCI A;  4CJ3 A;  4JRQ A;  3QER A;  3E9L A;  1QHA A;  2XY6 A;  3DRR A;  1NGI A;  3ASM A;  3J80 O;  2G8H A;  4AHU A;  5HOO A;  1EKE A;  1SUQ A;  3LP1 A;  1JXB A;  2A40 A;  4BR7 A;  1TKD A;  3HP6 A;  4OPA A;  4E0D A;  3QES A;  3C95 A;  5KPR A;  1FK9 A;  5AQV A;  1VQL N;  2JLE A;  2HB5 A;  3EE9 A;  5LL6 Z;  4B1V A;  3L2W A;  3VEN A;  4DU3 A;  3V1O A;  3VF4 A;  5BR9 A;  1U49 A;  1J54 A;  3K9J A;  1QSL A;  1M90 O;  4CW7 B;  3AO2 A;  4JEP A;  1XI1 A;  4ILH A;  1LWC A;  3LAK A;  5H1S Q;  1OVY A;  1S5J A;  3MMV A;  4KHY A;  3HI0 A;  3VMF B;  1YTA A;  1ZBH A;  1VHX A;  4YDU A;  1BA1 A;  4M3Z A;  3V1Q A;  2F8S A;  4W5Q A;  3TAN A;  4DS5 A;  3S3O A;  4MLH A;  1NK9 A;  5AFU A;  4HUG A;  1VQ7 N;  2RE2 A;  3VES A;  1WSJ A;  4BE1 A;  1OH5 A;  5F2R A;  1NOZ A;  3C65 A;  4L3Q A;  2O4I A;  4DCH A;  4IDH A;  1YVU A;  4H03 B;  3AVM A;  4BAC A;  3WEE A;  3CPW M;  1CXQ A;  2NRH A;  5GIP A;  3DLL L;  1C1C A;  5AQZ A;  3D6R A;  3HK2 A;  2A5X A;  3BP8 A;  3PUF A;  4OO1 J;  3H1V X;  4FLV A;  5AJ3 K;  3OY9 A;  5GIN A;  4LF4 K;  4LFA K;  3QIP A;  3RMD A;  1C0U A;  3QBX A;  3UKU A;  3VQD A;  2YJE A;  3I56 N;  4DTS A;  5AFU H;  1CXU A;  1U2V B;  3ENO A;  1NK0 A;  4CEA A;  3O9T A;  3I0S A;  4DR7 K;  3PY8 A;  5M1F A;  4BGA A;  1Z26 A;  1RFQ A;  1NKC A;  2ZJQ L;  5JS1 A;  1JCE A;  2O8F A;  4CJK A;  3C94 A;  1NM1 A;  3DOK A;  3SLC A;  4N56 A;  5J2M A;  4WYB A;  2D1K A;  1BU6 O;  3AO3 A;  2HOE A;  4B8C A;  3VA3 A;  1K9M O;  4FJ9 A;  5A2Q O;  5JLF A;  4FLU A;  3WUH A;  1T8E A;  1RIL A;  1TK8 A;  4KTQ A;  2X6N A;  3DLG A;  4JRP A;  2G8F A;  3MX5 A;  4DQQ A;  4C8O A;  1O13 A;  3DXM B;  4JI1 K;  1LWF A;  3FFK B;  3HTV A;  1IBL K;  5M1P A;  3SK3 A;  3CG7 A;  1YIT N;  4NXN K;  1W7A A;  3CM6 A;  3OYC A;  5M1K A;  4CK1 A;  1HKB A;  1S1W A;  3SUO A;  4CHQ A;  4G9Z A;  2A42 A;  4JKA A;  4WFA L;  4OJR A;  3CF5 L;  1RT7 A;  1XWL A;  3SQ1 A;  1NBW A;  3L0Q A;  4K8X A;  3PO4 A;  2E8A A;  3J7Y P;  3A8Y A;  4CZL A;  4HUF A;  3ZSQ A;  1SV5 A;  2QI2 A;  4H5R A;  4A62 A;  4M3W A;  4DTU A;  2G8W A;  2CGK A;  1NGJ A;  1RBT A;  2VWJ A;  4YHH K;  2O8D A;  4CIF A;  3QEV A;  3MN5 A;  3LL3 A;  3THY B;  2UXD K;  3E01 A;  4BQL A;  3O08 A;  1TV6 A;  1BCM A;  3TSQ A;  3EEQ A;  3DLE A;  4JS5 A;  1OVQ A;  1NGA A;  2HW3 A;  2GV9 A;  2VCP A;  3JYT A;  3VPZ A;  4PL8 A;  3DRS A;  4FWL A;  4O8K A;  4E1N A;  3RRG A;  4LF6 K;  5LY3 A;  2A3Z A;  4M7X A;  3IRX A;  1NJZ A;  3AO1 A;  4CEE A;  5JS2 A;  5AZI A;  3S9H A;  5LMN K;  3NDK A;  4B9S A;  3F73 A;  1GLC G;  3EO3 A;  1Q18 A;  1QQN A;  3GE1 A;  3LDO A;  4RWT A;  3SCX A;  2VQE K;  4M63 C;  3NF8 A;  4BRI A;  1QTM A;  4W5O A;  3JSM A;  3SAF A;  1D5A A;  4Z4G A;  1NGC A;  3CYM A;  3FZH A;  1WSG A;  2ITM A;  3AVC A;  3O1W A;  2AP1 A;  4OGE A;  4C8K A;  5BPL A;  2ETJ A;  4CBX A;  1I39 A;  4W5N A;  2V7Z A;  4IFY A;  2FBT A;  1BGX T;  5FPM A;  4RW9 A;  4HVJ A;  2NRX A;  2PBD A;  3T19 A;  3V9X A;  4Y1D A;  2YNI A;  4BWJ A;  3H6E A;  3ZEU B;  3RMC A;  1S1T A;  2HND A;  5LJV A;  4H4O A;  3SI6 A;  4BRC A;  4CZM A;  3ZT2 A;  1RT3 A;  2F7T A;  3ZSX A;  4C1N K;  5KI6 A;  1U45 A;  1VSI A;  1XHX A;  5KQD A;  3R8E A;  4YOY A;  3NH2 A;  3TTC A;  3H45 C;  3C6U A;  3AAQ A;  5CZ1 A;  5KQ8 A;  1MWM A;  2ASM A;  4NLB A;  1WN7 A;  1JXE A;  3MXM A;  3CCL N;  3V81 A;  3O9Q A;  3RSE A;  2HVI A;  4YOR A;  1QZ6 A;  3DXM A;  1X3M A;  3U8X A;  2EWS A;  4Y1C A;  4NYN A;  3OBW A;  3QBW A;  4H5V A;  2IVO A;  3HVR A;  4CEO A;  4YOU A;  2E5L K;  5FRM A;  1BA0 A;  3HBT A;  3ENH A;  3BF3 A;  3SMS A;  5C2D A;  3KD5 E;  4HHT A;  2E1Y A;  3FLC O;  3NF9 A;  2NLX A;  3LWM A;  2XO7 A;  5AQL A;  2VG7 A;  4F4K A;  3JS6 A;  2F4V K;  1Z05 A;  4FJM A;  2OPQ A;  3LM2 A;  2E4L A;  3NH0 A;  4JYA K;  4WQ4 A;  4Q5V A;  2OZS A;  4O5F A;  3THX A;  3ENB A;  2ITG A;  2Q3S A;  1TUU A;  2Z1G A;  4FOE A;  4ICL A;  2DFF A;  2XY8 A;  3QET A;  1HNI A;  2D5R A;  1BQM A;  1RTD A;  5CYM A;  5AQM A;  1Q7Y O;  3AVK A;  4CF8 A;  5KPT A;  4WQ5 C;  1OH8 A;  2W6L A;  2B6A A;  1VK0 A;  3H46 O;  1T05 A;  1DKG D;  4RCH A;  4M45 A;  4OLB A;  4NB4 A;  3PIO L;  1HYZ A;  1O1W A;  2GWJ A; 
#chains in the Genus database with same CATH homology
 3DLH A;  3OYH A;  1U4B A;  4HCB A;  2D0A A;  4E89 A;  3L2U A;  1T7P A;  2DTU A;  2QKB A;  1T03 A;  1RDB A;  4AHC A;  3TAQ A;  3G10 A;  2W42 A;  5CY4 A;  3ISN C;  4Q0B A;  5C24 A;  1RTH A;  1D8Y A;  3LP3 A;  4E7H A;  4Z0U A;  3U3Y A;  3D0P A;  4LH4 A;  4E19 A;  2HHQ A;  3HL8 A;  3QNN A;  2ZQB A;  3OYF A;  4E1M A;  4EZ6 A;  4CK2 A;  4ID1 A;  3SPZ A;  3CFO A;  1HMV A;  3OJS A;  2Y1I A;  4I9L A;  1VRU A;  2BGG A;  4OGC A;  4DLG A;  1HYV A;  3TR8 A;  2FBV A;  3ZSV A;  4CFA A;  3LAL A;  3KLH A;  3DM2 A;  5KRS A;  2PYL A;  4E7K A;  5C25 A;  4DSJ A;  3SUQ A;  1RT4 A;  4DSI A;  1TVR A;  4AH9 A;  4CGF A;  2G8K A;  3L3V A;  4QOZ B;  4NCG A;  1Q8I A;  2X74 A;  3VQ9 A;  3QEW A;  3VQ5 A;  3VQ7 A;  3AO4 A;  3V6D A;  3VQQ A;  1FKO A;  4FJJ A;  4KHN A;  4KHU A;  4PWD A;  4FYD A;  1JKH A;  3ZT4 A;  3TAM A;  4Z4H A;  4BDY A;  4FK2 A;  2IS3 A;  4OKJ A;  1ZBL A;  4FJK A;  4BDP A;  2RF2 A;  5FDL A;  4CJW A;  3DRP A;  4DTR A;  3V9W A;  1JLA A;  3BGR A;  3OYK A;  4DFK A;  3OJU A;  3V9Z A;  4CF0 A;  4CJP A;  4F2S A;  4N76 A;  4M41 A;  3HXM A;  4PA1 A;  3QO9 A;  2DFE A;  1KVC A;  4LY7 A;  1TAQ A;  4W5T A;  2Z1H A;  4FJ5 A;  1S9G A;  3KD1 E;  3I0R A;  4CGJ A;  3RWU A;  4CGI A;  1UA0 A;  4KI4 A;  1RBV A;  1X9W A;  3QIO A;  4B9U A;  1VSD A;  4CHZ A;  4DLE A;  5EU7 A;  1L3S A;  1QSY A;  3KLF A;  3HPH A;  2OPP A;  2YHA A;  3V9U A;  4M3U A;  1RBS A;  3KIO A;  1C1B A;  4QAG A;  4UQG A;  3SQ2 A;  4KB0 A;  2VWK A;  4KRE A;  1S6Q A;  3ULD A;  4M42 A;  5K14 A;  3P83 D;  3QEX A;  1KTQ A;  4ID5 A;  4B9T A;  2YV0 X;  1LWE A;  3OS2 A;  4DF4 A;  2KQ2 A;  4CJ4 A;  1TL3 A;  4FXD A;  4E7L A;  1BIZ A;  1D9F A;  2HHV A;  4YNQ A;  1DLO A;  4EP4 A;  1IKY A;  3NFA A;  3SJJ A;  1WAJ A;  2P5G A;  4FW1 A;  2HHU A;  2IGI A;  1EET A;  4OLA A;  3AVJ A;  4DF8 A;  3AO5 A;  3P1G A;  1VSJ A;  2OA8 A;  4DSK A;  1KRP A;  3VQP A;  2XY7 A;  1RNH A;  1SL1 A;  3RTV A;  4CJU A;  4N47 A;  1HPZ A;  1ZBI A;  2QXF A;  3NGY A;  4MQ3 A;  3UIQ A;  2LSN A;  4B3O A;  3K5N A;  4FJL A;  3OYL A;  1YTU A;  1ASW A;  2DFH A;  4BE2 A;  4Z4F A;  4DSF A;  1LW2 A;  4CEC A;  5E41 A;  2HNZ A;  4DS4 A;  2HNY A;  3OYI A;  4CFB A;  4B9M A;  3SYZ A;  4B9L A;  1ITG A;  4MFB A;  3NCI A;  4CJ3 A;  5HP1 A;  4JRQ A;  4CEZ A;  1LV5 A;  5HRS A;  3QER A;  1VSE A;  4AHS A;  3MED A;  5HRN A;  1IKW A;  2E6M A;  3K5O A;  4CHN A;  1C6V A;  1WSE A;  2E6L A;  3LPU A;  3MEE A;  2XY6 A;  4CJV A;  2BAN A;  3DRR A;  4OKK A;  3KLE A;  5D3G A;  4HTU A;  3ASM A;  3KKR A;  5HBM A;  3WNF A;  3ZT3 A;  3RR8 A;  5KRT A;  3VQB A;  4FK4 A;  2G8H A;  4DTX A;  4M3Y A;  5FRO A;  1B9D A;  3NAE A;  4AHU A;  3OYJ A;  3BDP A;  1EKE A;  1SUQ A;  1NJW A;  3LP1 A;  1JXB A;  3VQ6 A;  4GW6 A;  1JLF A;  3HPG A;  4E3S A;  1TKD A;  3HP6 A;  3OYN A;  2YNG A;  3QES A;  3C95 A;  4E0D A;  1FK9 A;  1QQC A;  3CQ8 A;  4NCA A;  1WNS A;  1EP4 A;  1JL1 A;  4AIL C;  3TAF A;  4KHW A;  4LSN A;  3O3F A;  3AVH A;  5J1E A;  2VG5 A;  3OS0 A;  2JLE A;  1FKP A;  3K5M A;  2HB5 A;  3ZSR A;  3L3U A;  4RW6 A;  3L2W A;  1BIU A;  2XRI A;  1Q9Y A;  4DU3 A;  3V1O A;  5CYQ A;  4C8M A;  2FBY A;  1U49 A;  1J54 A;  4HUE A;  1QSL A;  3NBP A;  2X78 A;  4LD0 A;  4DFJ A;  1SKS A;  3PO5 A;  3AO2 A;  1XI1 A;  3MXJ A;  3K5L A;  1LWC A;  1S1V A;  2EX3 A;  3LAK A;  3M8R A;  4DFM A;  3NE6 A;  1S5J A;  4JS4 A;  4BWM A;  3V9S A;  3HP9 A;  3LZI A;  3B6O A;  4Z4I A;  3MXI A;  2YKM A;  4KHY A;  3SZ2 A;  1C1A A;  1RDD A;  3HVT A;  1TL1 A;  3VQ8 A;  4RW7 A;  2YNH A;  2ATQ A;  5J2P A;  1A5V A;  1U47 A;  3DI6 A;  1SKW A;  2OZM A;  1YTA A;  3ZSY A;  3LPT A;  2KW4 A;  4BE0 A;  4FJN A;  1ZBH A;  4M3Z A;  1RDC A;  3V1Q A;  4FM1 A;  1RBU A;  2F8S A;  1CLQ A;  4W5Q A;  3K59 A;  1JLC A;  4DS5 A;  3OYG A;  4E7J A;  3TAN A;  3S3O A;  1G15 A;  1NK9 A;  1ZYQ A;  2F8T A;  4KFB A;  4HUG A;  3LP0 A;  5KTQ A;  4CK3 A;  4F3T A;  5DK5 A;  4CIG A;  4DG1 A;  1TK5 A;  3ZSW A;  4FJ7 A;  4K8Z A;  3SNN A;  4B08 A;  3VQA A;  3V4I A;  3SQ4 A;  1WSJ A;  4O55 A;  3K2P A;  4ELU A;  1BCO A;  4BE1 A;  1NOZ A;  3H08 A;  2O4I A;  3QEI A;  1YVU A;  3HPO A;  1RCH A;  3AVA A;  3AVM A;  4CES A;  1SKR A;  1BIS A;  4BAC A;  4IDK A;  1IG9 A;  1XHZ A;  1NK8 A;  2XHB A;  3SPY A;  3D45 A;  1WSI A;  3VA0 A;  2R7Y A;  1L5U A;  1C0T A;  1CXQ A;  5HRP A;  2KTQ A;  2DY4 A;  1BHL A;  4WE1 A;  1C1C A;  3AA3 A;  2XY5 A;  1L3T A;  4CJQ A;  4EP5 A;  3HK2 A;  2KZZ A;  4TSX A;  4IKF A;  3PUF A;  3OVN A;  3OYA A;  4CFC A;  4ZTJ A;  4FLV A;  5SWM A;  3SQ0 A;  3OY9 A;  2A1S A;  1D9D A;  3PV8 A;  1NKB A;  2Z1J A;  3QIP A;  3TAB A;  3RMD A;  1C0U A;  3TAP A;  3O3H A;  3VQD A;  1RT2 A;  3AVL A;  4M3R A;  4DTS A;  1CXU A;  2IC3 A;  1NK0 A;  1QSS A;  3OYE A;  1IKX A;  3OYB A;  4RW4 A;  1RTJ A;  4CEA A;  1S9E A;  1NK7 A;  1LW0 A;  4CF1 A;  1Y97 A;  4CJL A;  4DU1 A;  1DTQ A;  3I0S A;  4CHP A;  3L2Q A;  3PY8 A;  3SV4 A;  4DU4 A;  5FRN A;  4OPJ A;  4AHV A;  1IKV A;  1Z26 A;  1KSP A;  3NF6 A;  4CEQ A;  1NKC A;  4W5R A;  3KLI A;  5JS1 A;  3KJV A;  4CJK A;  3C94 A;  4CGH A;  1X9M A;  1GOA A;  4B9N A;  1REV A;  3DOK A;  5C42 A;  3TAR A;  4N56 A;  3AVF A;  5J2M A;  1J5O A;  1K6Y A;  2NUB A;  3IG1 A;  1TKT A;  1DTT A;  3AO3 A;  1HJR A;  1B9F A;  1BL3 A;  2OYQ A;  4J2B A;  1TKZ A;  2HHX A;  4B8C A;  3VA3 A;  4FVM A;  4KHS A;  3O4Q A;  4CF2 A;  4YFU A;  3AA2 A;  3HYF A;  1RT5 A;  1A5W A;  2QK9 A;  3KLG A;  4FJ9 A;  3VQC A;  4CJT A;  1EXQ A;  1W9H A;  4N5S A;  3L8B A;  3F9K A;  4FLU A;  1T8E A;  1SL0 A;  4CCH A;  3T3F A;  3M8Q A;  3IS9 A;  1RIL A;  4CGG A;  3TWH A;  1TK8 A;  1NOY A;  1N5Y A;  2P51 A;  4KTQ A;  2X6N A;  3DLG A;  3VQ4 A;  4JRP A;  2G8F A;  4FZY A;  1UAX A;  4KPY A;  4CJ5 A;  4DQQ A;  1UOC A;  4H4M A;  1BI4 A;  4C8O A;  1XC9 A;  4FLT A;  1U48 A;  2F96 A;  3V1R A;  2HMI A;  2P1J A;  1LWF A;  1ASV A;  2B5J A;  3AV9 A;  4DQI A;  2OPS A;  3S3N A;  5DMR A;  3ZSZ A;  3CG7 A;  3KTQ A;  4I7F A;  3CM6 A;  3L2V A;  4DSL A;  3O3G A;  3OYC A;  1GOB A;  4J2A A;  1VSL A;  3KK2 A;  3MEC A;  4CED A;  4CJE A;  1BI4 B;  1WAF A;  4CK1 A;  1B92 A;  1S1W A;  4F2R A;  3SUO A;  2HHT A;  4CHQ A;  3WNG A;  2YKN A;  4O0I A;  2WOM A;  2GUI A;  4FM2 A;  1IH7 A;  4OJR A;  1RT7 A;  1XWL A;  3A2F A;  4DMN A;  5KGW A;  4AHT A;  3DLK A;  3SQ1 A;  1X1P A;  4CIE A;  4K8X A;  5T7B A;  1VSK A;  3PO4 A;  3U6F A;  4HUF A;  4FLX A;  3TAG A;  3EYZ A;  4FLW A;  4FJ8 A;  3AVB A;  3ZSQ A;  1SV5 A;  2IOC A;  4HCC A;  2KFZ A;  4M3W A;  2HHW A;  1Z25 A;  3G0Z A;  4DTU A;  2G8W A;  2G8U A;  4KI6 A;  1RBT A;  2VWJ A;  2D0B A;  3ITH A;  3TI0 A;  4CF9 A;  5HRR A;  3WNH A;  3MAQ A;  3THV A;  4CIF A;  3QEV A;  2Z1I A;  4KV8 A;  3VN5 A;  1Q9X A;  3E01 A;  1UWB A;  1TV6 A;  1BCM A;  5I3U A;  1JLB A;  1RTI A;  1TGO A;  4FW2 A;  1KFD A;  4B8A B;  3DLE A;  4O44 A;  4JS5 A;  3DMJ A;  4IBN A;  1F21 A;  4ELV A;  1KLN A;  1J9A A;  3SUP A;  1NK5 A;  2HW3 A;  2GV9 A;  3OS1 A;  1QHT A;  4IFV A;  3HT3 A;  1A5X A;  3JYT A;  3DRS A;  3B6P A;  4KO0 A;  4E1N A;  4DTM A;  1SL2 A;  4LSL A;  3RRG A;  4R5P A;  4I9Q A;  4Z4E A;  3IAY A;  3IRX A;  3DLR A;  4PY5 A;  3LP2 A;  4PQU A;  1GOC A;  1LAW A;  2RKI A;  5CZ2 A;  3AVI A;  3ZCM A;  3NGI A;  3HST B;  1NJZ A;  1S1U A;  3AO1 A;  1VRT A;  5JS2 A;  3ZSO A;  4CEE A;  3S9H A;  3ALY A;  4KHQ A;  3NDK A;  4ELT A;  1RT1 A;  1HQU A;  3F73 A;  4B9S A;  4F8R A;  2RN2 A;  1JLE A;  1YT3 A;  3DLB A;  2WON A;  4FJI A;  3SCX A;  2G8I A;  1BQN A;  1QE1 A;  5I42 A;  3NF8 A;  3KK1 A;  4CHO A;  1QTM A;  4DQP A;  3MEG A;  4W5O A;  3JSM A;  1EX4 A;  1D5A A;  3AA5 X;  4CJS A;  1I3A A;  4FCY A;  4Z4G A;  5HRO A;  3CYM A;  1WSG A;  3EZ5 A;  4J2D A;  1J53 A;  3AVC A;  4C8L A;  2A1R A;  4J2E A;  1NJY A;  4G1Q A;  1L3V A;  1NJX A;  1KVB A;  4RW8 A;  2IDO A;  2ZD1 A;  4OGE A;  4C8K A;  3HM9 A;  4O0J A;  3ZT0 A;  4XIU A;  3NHG A;  2ETJ A;  5KGX A;  1UA1 A;  2P5O A;  4M3T A;  4DQS A;  3VQE A;  1I39 A;  4W5N A;  4E7I A;  4RG8 A;  2OPR A;  4IFY A;  2FBT A;  1BGX T;  4ZTF A;  2PY5 A;  2PZS A;  3DOL A;  3RRH A;  4CEF A;  4RW9 A;  4LH5 A;  4HVJ A;  4KB1 A;  3L2R A;  1TKX A;  3V9X A;  3T19 A;  4KTZ A;  4Y1D A;  2YNI A;  1HRH A;  4BWJ A;  3RMC A;  1JLQ A;  2RPI A;  2YNF A;  1S1T A;  1C0M A;  4NYF A;  4AHR A;  1VSH A;  4FM0 A;  3PX4 A;  2HND A;  3NF7 A;  4H4O A;  3PX0 A;  1ZBF A;  3LZJ A;  3SI6 A;  3M8P A;  4DTN A;  3ZT2 A;  3LWL A;  4NCB A;  2GBZ A;  1RT3 A;  2X6S A;  5HLF A;  4EZ9 A;  3ZSX A;  2Y1J A;  5KI6 A;  2O4G A;  1VSI A;  1XHX A;  1U45 A;  3OYD A;  3KK3 A;  3NH2 A;  4O4G A;  4FJX A;  3T1A A;  3OYM A;  3C6U A;  1KVA A;  2G8V A;  1RT6 A;  5CZ1 A;  3S3M A;  3LAN A;  4CER A;  1QS4 A;  1NK6 A;  4KTW A;  3MXM A;  1WN7 A;  1JXE A;  4N41 A;  2B4J A;  1CZB A;  1S6P A;  2BE2 A;  3V81 A;  2QKK A;  4FJG A;  2HVI A;  4CE9 A;  2FC0 A;  3AA4 A;  4DTP A;  4OPK A;  4Y1C A;  4NYN A;  1TAU A;  1RBR A;  3U3G A;  2PYJ A;  1HNV A;  1WSF A;  4DQR A;  3HVR A;  1ASU A;  4FJH A;  3HJF A;  4CEO A;  4DTJ A;  4BDZ A;  3LAM A;  4L8R B;  1FXX A;  4ZHR A;  3M8S A;  3EY1 A;  3QNO A;  3TAE A;  5FRM A;  1N6Q A;  2KFN A;  3RR7 A;  4GVM A;  5J2Q A;  3KD5 E;  3CM5 A;  2FBX A;  4HHT A;  1U04 A;  2EHG A;  4B9V A;  1MU2 A;  1WLJ A;  1NK4 A;  4OKE A;  3QLH A;  3C6T A;  3NF9 A;  3KKS A;  3QEP A;  3AVG A;  3LWM A;  3LDS A;  4M3X A;  3CFP A;  4CJF A;  2D0C A;  2HVH A;  2XO7 A;  4CJR A;  4DTO A;  2I5J A;  2IAJ A;  2VG7 A;  3FFI A;  3QIN A;  4DWI A;  4FZX C;  4CFD A;  1JLG A;  3SV3 A;  4F3O A;  4F4K A;  4CHY A;  3NGZ A;  4KRF A;  3ZT1 A;  3PX6 A;  4FJM A;  5SZT A;  3HO1 A;  2OPQ A;  1LAV A;  4IG0 A;  1TK0 A;  2E4L A;  1RDA A;  3NH0 A;  1JL2 A;  4Q5V A;  2OZS A;  4FK0 A;  4FZZ A;  1S1X A;  4I2P A;  4O5B A;  1CZ9 A;  1HQE A;  3O4N A;  3NH1 A;  2KZM A;  2ITG A;  4CEB A;  2Q3S A;  4KKO A;  4DFP A;  2Z1G A;  2VG6 A;  4I2Q A;  1L3U A;  4H8K A;  4ICL A;  1NKE A;  2DFF A;  2XY8 A;  3QET A;  4C8N A;  2YHB A;  1HNI A;  3P5J A;  4CGD A;  4DSE A;  1IO2 A;  2BDP A;  4OVL A;  2AJQ A;  2D5R A;  1KLM A;  3RMA A;  1X9S A;  1BQM A;  4GMJ B;  1RTD A;  3DYA A;  3K58 A;  1KFS A;  5CYM A;  4QCL A;  3I8D A;  1HYS A;  2JGU A;  3AVN A;  2HHS A;  2ZE2 A;  1W0H A;  1KCF A;  3AVK A;  4IG3 A;  4JLH A;  4CF8 A;  1ZBU A;  4Z4C A;  3K57 A;  1R0A A;  4KAZ A;  3WNE A;  1VSF A;  2B6A A;  1VK0 A;  4FLY A;  3RMB A;  3SUN A;  1VSM A;  1T05 A;  4M45 A;  4OLB A;  1HYZ A;  3CFR A;  1O1W A;  1WSH A;  4PUO A;  5J2N A;  4FLZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...