3NGYA

Crystal structure of rnase t (e92g mutant)
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
204
structure length
204
Chain Sequence
GLCDRFRGFYPVVIDVETAGFNAKTDALLEIAAITLKMDEQGWLMPDTTLHFHVEPFVGANLQPEALAFNGIDPNDPDRGAVSGYEALHEIFKVVRKGIKASGCNRAIMVAHNANFDHSFMMAAAERASLKRNPFHPFATFDTAALAGLALGQTVLSKACQTAGMDFDSTQAHSALYDTERTAVLFCEIVNRWKRLGGWPLSAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Ribonuclease T
publication title Structural basis for RNA trimming by RNase T in stable RNA 3'-end maturation
pubmed doi rcsb
source organism Escherichia coli
total genus 60
structure length 204
sequence length 204
chains with identical sequence B, C, D
ec nomenclature ec 3.1.13.-:
pdb deposition date 2010-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00929 RNase_T Exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3ngyA00
4E7KA 4CF8A 2G8IA 3SQ1A 2YNIA 3AVLA 1D8YA 1B9FA 4CF9A 2OZSA 2JLEA 4LY7A 4FW1A 3NHGA 3M8PA 4MFBA 3AVGA 1RBVA 5CZ1A 2ZD1A 4DTJA 4Q0BA 4FJMA 4CHNA 3HM9A 1VSMA 3KD5E 3HSTB 1U4BA 2P5GA 4ICLA 1S5JA 4DSJA 5HP1A 3KLGA 2IC3A 1BI4A 4M41A 4W5OA 4FCYA 3U3YA 3V9SA 2F8TA 4CGHA 3L3VA 3TR8A 4AHSA 4YFUA 2BE2A 3NBPA 1XWLA 4DQQA 1RDDA 2Z1GA 3AVBA 3NF8A 4CF0A 4CGJA 2KZMA 1NOZA 5HBMA 3HT3A 4FJLA 1HRHA 4KHSA 2HNZA 4DSFA 4CJUA 4HUEA 1VSLA 1BIUA 2YV0X 4Z4HA 5KRSA 3ZSVA 1S1XA 1C0UA 4OKJA 4FLTA 4EZ9A 3ASMA 4KV8A 3HJFA 4CF1A 1BCMA 1LW0A 4DWIA 4F2RA 1RTIA 2HVHA 3P5JA 4CEFA 1UA0A 3THVA 5KRTA 2OPQA 1S1UA 5FDLA 1EP4A 2BGGA 1CZ9A 2HHQA 3ZT2A 3S3NA 3G10A 1X9SA 4CGIA 3FFIA 4BWJA 4B9TA 3LANA 1D9DA 3CFOA 1IKXA 3T1AA 1IKVA 1ASVA 1IH7A 3VQCA 3SCXA 1U47A 3QEVA 3RMDA 1HMVA 1TAUA 2I5JA 1XHZA 2VG5A 3D45A 5D3GA 3V1RA 3M8SA 1TL3A 1X1PA 4KRFA 4FLXA 3DYAA 2QKKA 3MXJA 3NGYA 1RTDA 1L3TA 3TWHA 1J9AA 1NKBA 1N6QA 3HVTA 1DLOA 3I0RA 3T19A 3B6PA 2KTQA 1NKCA 4KKOA 3VQAA 4I2QA 4DTXA 3NF6A 3QLHA 2GV9A 4DSKA 4OGCA 4C8MA 1C1BA 3NAEA 3L2WA 1WAJA 1IO2A 2YKNA 4I9QA 1JLEA 4GMJB 4BDPA 1NJZA 2DTUA 1QSSA 1C6VA 1RBRA 4DFPA 3OJUA 1J53A 3CG7A 4R5PA 3NCIA 3V81A 1UA1A 3DLRA 3VQ6A 2YKMA 3SV4A 1ITGA 2RPIA 3VQ9A 2HVIA 3PX6A 2ETJA 1NOYA 1RBUA 3ZT4A 3VQ5A 1SKWA 2KZZA 3IRXA 3VQDA 3DLHA 4O55A 4IG3A 5CYMA 4FVMA 4N76A 4M45A 3VQQA 3RRHA 3CFPA 1JL2A 1KCFA 1RDCA 1VSIA 3JYTA 1Q9XA 3KK1A 1ZBHA 4BDYA 4OLAA 1BGXT 2KW4A 3K5OA 3V6DA 4PUOA 1W9HA 3DMJA 1CXUA 3OVNA 4DTSA 1CXQA 2YHAA 3AO3A 3DM2A 3SV3A 3O3HA 4CK3A 4RW6A 3QEXA 3HXMA 1C0TA 4BE2A 3ZSXA 4Z0UA 3RMBA 4FJIA 1J54A 4CJWA 4FJ5A 2HHVA 4FJXA 1BQMA 2G8VA 4DF8A 1VSEA 3OYBA 5KGXA 2R7YA 1ZBIA 3SQ4A 2HHSA 3JSMA 4KAZA 4C8OA 3T3FA 3O4NA 4CEQA 2IS3A 1JKHA 4CIFA 3OYEA 1EX4A 4FK4A 4Q5VA 3KKSA 1KVBA 2D0BA 4FJ9A 3HO1A 1S6QA 1RT5A 4N47A 1JL1A 1JXEA 4Y1DA 4F4KA 3V1QA 5SZTA 4KHUA 4DFMA 2Q3SA 4NCBA 4HHTA 1RT2A 2YNFA 2Y1JA 4PA1A 3OYKA 2OPSA 4CEOA 1KVAA 3H08A 2XY5A 1LV5A 2IAJA 4BDZA 4BE0A 3WNGA 3IG1A 1TKZA 1R0AA 3SZ2A 3SUPA 1ZYQA 4IKFA 1FKOA 3TAMA 1VRUA 1NJWA 1NK4A 4E0DA 1REVA 3WNHA 4CFAA 2RKIA 2FBXA 2BANA 3DLEA 3P83D 5EU7A 3EYZA 4DQRA 4ZTJA 4C8LA 4CCHA 4E7LA 4HCCA 5C25A 4FJJA 4CEEA 4CJQA 5HRPA 2W42A 1WNSA 4KI4A 2O4IA 1GOBA 1LAVA 2Z1IA 1VSJA 3ITHA 3U6FA 4FW2A 4LH5A 4CJ5A 4K8XA 4AH9A 1W0HA 3NE6A 1QS4A 5HLFA 2Y1IA 4NYFA 3MEGA 5DMRA 3HPGA 3B6OA 4O5BA 1RNHA 4DLGA 4JS5A 4KPYA 3ZT3A 2A1SA 3F9KA 2X78A 2ZE2A 3NDKA 4B9SA 3P1GA 2O4GA 4DSEA 4Z4GA 4CJKA 4CE9A 3AA4A 3K5MA 1RBTA 1KLNA 4H4MA 3HK2A 4QAGA 1FK9A 3QIPA 1QTMA 3SUNA 5FRMA 4JS4A 4FJKA 3ZSOA 4G1QA 4BE1A 1S1WA 2FBTA 3VQBA 2OA8A 3PO5A 3K57A 2HHWA 3OY9A 1UAXA 1WAFA 4KO0A 4DF4A 5HROA 4BWMA 3KD1E 2F96A 3C6TA 3QETA 4CJSA 4CESA 5J2QA 1ASUA 4Z4IA 1S6PA 4H4OA 3KK2A 1UOCA 4HCBA 3TI0A 1JLBA 3AVAA 4CGFA 5HRSA 4OLBA 3AO2A 3KLHA 1VSHA 3QNNA 1KLMA 3LP1A 3OS0A 1RCHA 1KRPA 5JS1A 2OPRA 4GW6A 1G15A 1VK0A 3SNNA 3OYAA 1C1AA 2VG6A 3OYNA 4ID1A 3L2UA 4CJTA 1TL1A 1T03A 1JXBA 3OS1A 1DTTA 4KTWA 4CFCA 3DI6A 1S1VA 2P1JA 1UWBA 4F8RA 2QK9A 1FXXA 4KFBA 3TARA 1NKEA 4DG1A 3IAYA 4CFBA 1KSPA 4DQPA 4CJ4A 5J2NA 1Q8IA 4B9VA 4FJ8A 2AJQA 1VSKA 3AVIA 3RTVA 3OYGA 3LZIA 3ULDA 3MXMA 4J2AA 1JLAA 4FZZA 3KLIA 4FK0A 4DS5A 2HHXA 3O3GA 4E1NA 4IG0A 4PY5A 4XIUA 4DFJA 4KHQA 3L2RA 3V4IA 4NCAA 3KLEA 2KQ2A 4DSIA 3ALYA 2X6NA 1IKYA 3LPUA 5SWMA 4O0IA 3TAQA 1Q9YA 3OYCA 1C0MA 3AVHA 2PZSA 3OYDA 3QO9A 2GBZA 4CJEA 3I8DA 4AILC 5FROA 2E4LA 4M42A 1CLQA 1S9GA 3AVFA 3LDSA 1TK0A 4RW8A 4DTMA 1Z25A 3K2PA 2HMIA 3MAQA 1D5AA 3AV9A 2FBYA 1HPZA 1S9EA 2DFHA 2WONA 1KFDA 2ATQA 2GUIA 3MEEA 4FK2A 3OYHA 4DQSA 1TGOA 4F2SA 3K5LA 5T7BA 1Y97A 3EY1A 2P51A 3DLGA 1LW2A 3DRRA 1BQNA 4DQIA 2D0AA 4M3YA 4O44A 4BACA 4FLYA 2B5JA 3NH2A 4TSXA 1HQEA 2NUBA 5KGWA 5DK5A 4EZ6A 5C42A 1XHXA 3LWLA 4ELTA 3NH0A 3C95A 4Z4FA 1HYSA 2YHBA 4ZHRA 1JLCA 4K8ZA 1RT6A 2PYLA 3QNOA 4LH4A 3S9HA 3V1OA 5HRNA 4OVLA 3AO5A 3K58A 4J2BA 4FJNA 2PYJA 3QEWA 3OS2A 3AA5X 1WSEA 4ELVA 3O4QA 4GVMA 4MQ3A 3AA2A 1RBSA 1XI1A 3NF7A 1NJXA 3OJSA 3S3MA 4DLEA 4CJRA 4M3XA 4PWDA 2KFNA 1IKWA 4OJRA 2F8SA 3PO4A 4CGGA 3BDPA 2X6SA 2VG7A 1TK8A 4EP4A 1NJYA 1A5XA 3OYIA 1VSFA 1S1TA 3L8BA 4DS4A 4I7FA 3QESA 4IFVA 1T05A 1D9FA 2YNGA 1JLFA 4FM0A 1HYZA 3V9WA 2RN2A 1ZBLA 4JLHA 4FXDA 4IBNA 4C8NA 4CECA 4B8AB 1HQUA 3O3FA 1U45A 2HHUA 4FJGA 1SL2A 1O1WA 2HB5A 3K59A 1VSDA 3ZCMA 3K5NA 4HUGA 5CY4A 4B08A 4Y1CA 2IOCA 1RT1A 1LAWA 1RT7A 4DTNA 4LSNA 2G8HA 1T8EA 1I3AA 3V9ZA 1KFSA 1RDBA 3VQ7A 3V9XA 4UQGA 3LPTA 3KKRA 3KLFA 1WSIA 1RT4A 4CJFA 2RF2A 4CIGA 1QSLA 4PQUA 1L3SA 3DOKA 2OZMA 1BCOA 3OYLA 3HYFA 3TABA 3NGIA 3OYMA 3OYJA 1X9WA 1A5VA 4DFKA 5JS2A 3AVCA 1NK6A 4FM1A 4M3UA 2D5RA 3ISNC 4KREA 1SKRA 1NK0A 4CEBA 3SJJA 2B6AA 2FC0A 4ID5A 4B9NA 4I2PA 1N5YA 4M3TA 4FYDA 1U04A 4OKKA 3BGRA 4O0JA 5KTQA 4CK2A 3V9UA 4B3OA 1RTHA 1QQCA 4CJVA 3VN5A 3QIOA 3DRSA 2XY7A 3VQEA 3LP0A 4C8KA 3M8RA 3VA0A 2E6LA 3LP2A 2BDPA 2HNYA 1L3VA 3KIOA 1GOCA 4DTRA 3NH1A 3S3OA 3KK3A 4E3SA 1K6YA 2WOMA 3L3UA 4FLUA 2OYQA 4CJPA 3PX0A 1ZBUA 3HPHA 1DTQA 1LWEA 5C24A 1CZBA 5HRRA 3DLBA 4M3ZA 1GOAA 3ZT0A 2XHBA 3C94A 4CFDA 3DRPA 4E89A 2E6MA 2P5OA 1NK5A 1TK5A 4RW9A 4NCGA 1WSJA 3EZ5A 1SL0A 1A5WA 3E01A 1B9DA 2EHGA 3LALA 4E7HA 3TAPA 2A1RA 4J2DA 2XY8A 3NFAA 4FZXC 4W5NA 3CFRA 4JRQA 1BI4B 1I39A 1NK9A 3PX4A 3AO4A 3HVRA 2DFEA 4CHQA 4DSLA 4AHCA 4KHNA 1F21A 4N56A 1IG9A 1HYVA 2HNDA 4AHUA 3QEPA 4B9UA 4W5TA 1EETA 4FLWA 1TKDA 4KB0A 5I3UA 1EXQA 3WNFA 3QERA 4JRPA 1KTQA 3AO1A 4RW7A 1TV6A 3ZSYA 4DTUA 3HPOA 1SKSA 1J5OA 5E41A 3RRGA 3VA3A 4DU4A 5CYQA 4DTOA 2KFZA 4CEZA 4DMNA 4DU1A 1U48A 2IGIA 4OGEA 1L3UA 1TKTA 4HUFA 3AVJA 4W5QA 4CJLA 2VWJA 4HTUA 3TAFA 3SPYA 3KTQA 2D0CA 3CM6A 4CERA 3NGZA 2X74A 4N41A 3PY8A 4WE1A 4KI6A 3LAKA 3AVMA 1RDAA 4CHYA 4N5SA 3LWMA 4IDKA 4W5RA 1YTAA 2G8UA 3RWUA 5FRNA 5I42A 3PUFA 3AA3A 3PV8A 2ITGA 4CGDA 3SQ0A 4Z4EA 2G8FA 1TKXA 4O4GA 3CM5A 4E7IA 1YVUA 4LSLA 4J2EA 1LWFA 4H8KA 3L2QA 4CHZA 4KHYA 2QXFA 1QE1A 2ZQBA 2Z1HA 1SV5A 4HVJA 5J2MA 3G0ZA 3ZSZA 3ZSQA 1JLQA 1WSHA 3NF9A 4DU3A 1ZBFA 3SYZA 1U49A 2G8WA 1RTJA 1MU2A 1SUQA 3SUQA 1JLGA 3VQ8A 4CHOA 4ELUA 2Z1JA 2QKBA 4E19A 4FZYA 4RW4A 4Z4CA 3AVKA 3SQ2A 4OKEA 1BL3A 4DTPA 3DLKA 4OPJA 4F3TA 3ZSWA 4CF2A 3CQ8A 3LZJA 1SL1A 4FJHA 1Z26A 3D0PA 1QHTA 3A2FA 4IFYA 4AHVA 4AHTA 3MXIA 4AHRA 2DFFA 3HP6A 2EX3A 3TAEA 3OYFA 3VQPA 3ZT1A 1NK7A 3WNEA 4QOZB 2XRIA 1ASWA 4FJ7A 3DOLA 4CEDA 4F3OA 4I9LA 1HNVA 4KTZA 1BIZA 3M8QA 2YNHA 4CJ3A 1HNIA 4CHPA 3TANA 1T7PA 3U3GA 1FKPA 3HL8A 1YT3A 4M3RA 3UIQA 1YTUA 4EP5A 1RT3A 4B8CA 1VRTA 4L8RB 1HJRA 1EKEA 2B4JA 5K14A 3ZSRA 1BISA 3QINA 4OPKA 1L5UA 4KTQA 4YNQA 4ZTFA 3RR8A 2G8KA 2LSNA 5J2PA 4LD0A 1B92A 3SPZA 4FLVA 2XY6A 1X9MA 4FLZA 3HP9A 3C6UA 3MECA 4NYNA 4CEAA 4KHWA 3TAGA 1BHLA 3F73A 1C1CA 4FM2A 4B9MA 4E7JA 3LP3A 1RILA 3AVNA 5CZ2A 4CK1A 5J1EA 3QEIA 2HW3A 3VQ4A 5KI6A 1WSFA 2OPPA 3LAMA 2XO7A 3SUOA 3L2VA 4KB1A 4RG8A 3CYMA 2PY5A 1WN7A 4E1MA 1TAQA 4B9LA 1LWCA 4M3WA 1TVRA 3I0SA 1QSYA 1WLJA 4QCLA 1NK8A 3KJVA 3MEDA 3RMAA 1KVCA 2FBVA 4CIEA 3IS9A 3RR7A 2VWKA 3RMCA 2HHTA 2IDOA 2DY4A 3SI6A 2JGUA 1XC9A 1WSGA
chains in the Genus database with same CATH superfamily
3MX5A 2YNIA 3DXMA 4JI1K 4GVEA 2OZSA 3NHGA 3CD6N 4Q0BA 3HM9A 1N32K 5AQFA 4KH6A 1HKBA 4RCHA 5LMUK 1BI4A 1N34K 3WT0A 3U3YA 4W5OA 2F8TA 1I94K 4U7BA 3FLCO 4AHSA 5HOOA 3NF8A 3P39A 1NOZA 4JKBA 3F5TA 4YORA 4OKJA 4KV8A 5GAGP 3P5JA 4MLEA 3HOTA 2CGLA 1S1UA 1ATRA 2BGGA 4B3RK 2HHQA 3S3NA 3G10A 2P9PB 4BWJA 1IH7A 4JI6K 3QEVA 2AA4A 5JMVA 3O9SA 1XHZA 3A5NC 1TL3A 4KRFA 2FSJA 2QKKA 3MXJA 5AQRA 3NVMA 4JHDB 3HVTA 1DLOA 3T19A 1U6ZA 2IVPA 4DSKA 3EEQA 4OGCA 4IOCL 1OH5A 4I9QA 3HI0A 4BDPA 3ID8A 4DV2K 1C6VA 2ITMA 4WYBA 4NLCA 2V7YA 1ITGA 1NOYA 4K41A 4L3QA 3VETA 3LDNA 3QBXA 3LDLA 5GIPA 3JYTA 3KK1A 3HBTA 4CZKA 4OLAA 3K5OA 2Q97A 2YHAA 3SV3A 2UUCK 4KHQA 1GLCG 3IDHA 1GLFO 1Q7YO 3U9ZA 2G8VA 4DF8A 5JLHA 4B3SK 3U4LA 4EIAA 3TTDA 3OYBA 3EKUA 4CVNE 4KAZA 4MO5A 3T3FA 3O4NA 1JKHA 5LL6Z 1EX4A 4A61A 1X3NA 2D0BA 5FPNA 3VEXA 1S6QA 1YI2N 5AQGA 1JXEA 4Y1DA 4F4KA 4B1WB 3HOSA 2Q3SA 3VGMA 3CERA 1VQKN 1KVAA 3GOIA 2QW9A 1LV5A 4BE0A 1TKZA 3R1XA 1YVNA 2HF3A 3SZ2A 1R0AA 4CFAA 3OTOK 2RKIA 3EYZA 5LY3A 4DQRA 5C10A 2W42A 1NGJA 5HRPA 4DV5K 1NBWA 5DM6L 1GOBA 1LAVA 3ITHA 4CJ5A 4AH9A 4BC5A 5KQDA 2UUAK 1QS4A 4BG9A 3TSUA 4JI5K 5DMRA 1ATNA 3ZT3A 2X78A 2ZE2A 5TKYA 2O4GA 4BR4A 3AA4A 3JXUA 4H4MA 1VAZA 1FK9A 1QQOA 3SUNA 3IFRA 3TSPA 4G1QA 4BE1A 1Y64A 1UAXA 4KO0A 5HROA 4CI6A 4Z4IA 3KK2A 3AVAA 5HRSA 4OLBA 5AQYA 3AO2A 4F9OA 3KLHA 1VSHA 4H5RA 1XMOK 5AJ3K 2JWLA 2OPRA 1XNRK 4JKHA 3L2UA 3O1WA 4CJTA 3OS1A 3L4QA 3W3DA 4F8RA 1UWBA 2QM1A 3TARA 3J7ZO 4DG1A 3IAYA 3M6GA 4CFBA 1KSPA 4DQPA 4CJ4A 1WBBA 4FL9A 2AJQA 3AVIA 3OYGA 3ULDA 3MXMA 4J2AA 1JLAA 4YDUC 5C15A 4DV0K 3EL2A 4YOVA 2KQ2A 4O0IA 3CPEA 1IBLK 3AVHA 2PZSA 3OYDA 4AF1A 4ISFA 2E4LA 5FROA 4M42A 1CLQA 1TK0A 5AQKA 1D5AA 3AV9A 2DFHA 2WONA 4K0KK 2ATQA 3MEEA 4B3TK 3Q7CA 4FK2A 4DQSA 1DKGD 3EY1A 3TTCA 1VQ6N 1HKGA 4IOXA 4CZMA 5FPDA 2PAVA 1HR0K 5BREA 4PHTX 4FLYA 2B5JA 4TSXA 5KGWA 2NUBA 5C42A 1XHXA 4H0XB 1TYQB 3E9PA 4K8ZA 2PYLA 3QNOA 4LH4A 4OVLA 3OS2A 4M3XA 3OJSA 2KFNA 4DLEA 3C6AA 1IKWA 4OJRA 2F8SA 1RDWX 3K0SA 2X6SA 1NJYA 1NGDA 1A5XA 3OBYA 1VSFA 2UXDK 1T05A 3OA9A 4IFVA 1HYZA 2RN2A 3BP8A 4BG8A 1HQUA 4BRDA 1SL2A 1O1WA 3PIPL 1BO5O 5LMNK 4Y1CA 2IOCA 2E8AA 2G8HA 4LSNA 5C0YA 1HLUA 3V9XA 3QB0A 3KKRA 4CJFA 2RF2A 4CBXA 2UUBK 3SK3A 5AQIA 5JLFA 3OYJA 2GWKA 4M3UA 2D5RA 5AQSA 3O6WA 1NK0A 4ID5A 4HWIA 1N5YA 4BRPA 4YOXA 4M63C 3QIOA 3DRSA 2QA4N 2XY7A 3LP0A 3M8RA 2BDPA 3KIOA 1GOCA 4FWLA 4DTRA 4E3SA 4UY8O 4FLUA 2P9UA 1TUYA 1ZBUA 1CZBA 1BDGA 3SAHA 3DXMB 3C94A 1ZBSA 2E6MA 3CCEN 1NK5A 4X62K 1WSJA 1A5WA 1W97L 1BI4B 4FWMA 3E1YA 4N56A 1WUAA 1HYVA 4AHUA 4B9UA 2WC9A 1EETA 5I3UA 4QS9A 2KKZA 3QERA 3WXMB 3ZSYA 5FRMA 4DTUA 5KPRA 1GLDG 2KFZA 5AQWA 1N33K 1FW6A 5CR4A 2I7PA 4OGEA 4XH5A 4HTUA 3SPYA 4LF4K 2D0CA 1M90O 2Q31A 3LAKA 4N5SA 1RDAA 4EAHD 4AM6A 4DV7K 1YXQA 4Z4EA 2E20A 4O4GA 1YVUA 5BPMA 5AQPA 1LWFA 4JAXA 2QXFA 2ZQBA 1HNWK 2NRHA 3ZSZA 1JLQA 1U49A 1SUQA 3VQ8A 2QKBA 1LOTB 3IMXA 4F3TA 3S41A 3ZSWA 4CF2A 4AHTA 3MXIA 4AHRA 4CZFA 2DFFA 3HP6A 2EX3A 3CETA 3OYFA 3VQPA 3ZT1A 1NK7A 5JVHL 4FJ7A 1HNVA 3O08A 4B1VA 3TANA 3HL8A 1YT3A 3CJAA 3ZX3A 4BGBA 1YTUA 5GAEP 4NXMK 4PKHA 2GWJA 4L8RB 3ZSRA 3DXKA 3ATVA 4OPKA 4A57A 1M1KO 2G8KA 3W0LA 4LD0A 3SPZA 1S3XA 3P4IA 2VYPA 1YAGA 3TAGA 1BHLA 3F73A 1C1CA 1S22A 4FM2A 4JYAK 3PLAA 5J1EA 3VQ4A 3VENA 1SQKA 4DB3A 4RG8A 3EE8A 4JK9A 2PY5A 1WN7A 2QXLA 2YI1A 3SBTA 1WLJA 2GUPA 3KJVA 3MEDA 1GLBG 3RMCA 4JNEA 2IDOA 4DQ8A 2HHTA 2DY4A 1YITN 2JGUA 1WSGA 2G8IA 3G4SN 3AVLA 1OVQA 4EHTA 4DTJA 3CHWA 4CHNA 3KD5E 3HSTB 4ICLA 4DSJA 3KLGA 3A5OC 4FCYA 3V9SA 1IJJA 3MMVA 3L3VA 4PL7A 1NGFA 3NBPA 4YFUA 1QQNA 1RDDA 2Z1GA 4A2BA 3EE9A 4WF9L 4C1NI 2HNZA 4DSFA 4YOUA 2YV0X 3O8MA 3UKUA 5KRSA 4B3MK 1C0UA 4CZJA 4LF9K 1G99A 1BCMA 1LW0A 4FWRA 4DWIA 3CC2N 2HBKA 2ZGZA 1UA0A 1NG9A 3THVA 3CJBA 5F2RA 5FDLA 5B8HA 4CGIA 3LANA 5KQ8A 3T1AA 3CJ1A 1ASVA 2HBMA 3SCXA 1HMVA 2VG5A 3D45A 5D3GA 3TSQA 4QS8A 1DEJA 3DYAA 4JKFA 3AGKA 2V51B 3RVCA 1N6QA 3I0RA 2KTQA 3B6PA 3FE1A 1NKCA 4KKOA 3N4QA 2GV9A 4C8MA 3VEOA 1IO2A 3MN7A 3TTFA 1RBRA 2E1ZA 4DFPA 3H46O 3NCIA 3DLRA 5M1KA 3VQ9A 1KC8O 2WUSA 5TKWA 3VQ5A 4JN4A 3VQDA 3DLHA 4CBWA 1SS6A 5CYMA 4N76A 4FWOA 1EO1A 3CFPA 3B8AX 1JL2A 1KCFA 1VSIA 1HKCA 1ZBHA 3EO3A 1BGXT 3V6DA 3ZEUA 2BTFA 3J8AA 1CXQA 3AO3A 4YOWA 3KK7A 3O3HA 3HK2A 3RMBA 1V4TA 3HXMA 1C0TA 3QEXA 4FJ5A 2HHVA 1ATSA 2O8CB 3THXB 2QWMA 2VWBA 4A2AA 5KGXA 4DV1K 4C8OA 4YOTA 4CEQA 3CF5L 1KVBA 3HO1A 5AQOA 1JL1A 4JKEA 3VOVA 4DR1K 3V1QA 5SZTA 4DFMA 3BF1A 1KAZA 2A40A 2NRZA 2YNFA 2Y1JA 1YIJN 3OYKA 2OPSA 3H08A 2IAJA 4IKFA 1VRUA 1BOTO 1REVA 3WNHA 3P83D 3DLEA 3L6QA 5AQQA 5C25A 4CJQA 4KI4A 1VSJA 3UE5A 4LH5A 1DT9A 5HLFA 2HF4A 4FWQA 4O5BA 1RNHA 3VTHA 5EOYA 2A5XA 5BRHA 3CI5A 2E2QA 3P1GA 1Z6RA 3RSEA 4B1ZA 4K25A 4MDBA 2F4VK 2F9TA 2ZGYA 4FJKA 3H1QA 3VQBA 3OY9A 3QETA 3VERA 2UXBK 3SAGA 1ASUA 3VTIA 3ENHA 1UOCA 3TI0A 1JLBA 4CGFA 3HM8A 3LP1A 4JKGA 1KRPA 1NGHA 1VK0A 3OYAA 3OYNA 4B1YB 3M3ZA 3PSIA 2JWKA 4KFBA 3BUZB 3ZLJA 1Q8IA 1HX1A 4B9VA 2VQEK 3RTVA 4U67L 3LZIA 3HRGA 3KLIA 2HHXA 3O3GA 4IG0A 5BN9A 3L2RA 1JJ2M 1RFQA 3KLEA 4GKJK 3LPUA 3QO9A 2GBZA 2FSKA 3I8DA 1C0FA 1S9GA 3AVFA 3LDSA 4RW8A 3BZKA 1Z25A 2HMIA 5AQUA 1VHXA 3SLCA 1EWRA 2W6LA 2KLAA 1TGOA 4F2SA 4BRMA 4MO4A 4NLBA 1LW2A 2QWNA 1BQNA 1NJIO 4DQIA 4KBOA 4WCEL 1BA0A 3VGLA 4O44A 2WFBA 3NH2A 4EZ6A 2E5LK 1Q82O 4Z4FA 4BREA 3AO5A 3K58A 1VQ7N 3ENBA 1E3MA 4GVMA 4MQ3A 3AA2A 1RBSA 4CJRA 4ILGB 3VEYA 3BDPA 4I6MA 4EP4A 1D9FA 4CZEA 1BU6O 1S1TA 3L8BA 3QMLA 2YNGA 3V9WA 3FZHA 5LJWA 4FXDA 4WFBL 1U45A 4FJGA 1QZ6A 4CZLA 4BRHA 5MLCQ 2HB5A 2HOEA 4JI0K 1VSDA 3LDOA 5M1OA 1QQMA 4A59A 4FWKA 1P8ZA 1T8EA 1I3AA 4YOYA 3V9ZA 3HZ6A 3KVGA 4IEIA 3P31A 4CIGA 2ZJRL 3HYFA 3TABA 4CJ7A 4YY3K 5JS2A 4JI8K 2NRVA 5AQNA 4B9NA 2CH6A 4I2PA 4OKKA 4O0JA 3QDKA 4CZHA 3V9UA 4BQZA 1E4FT 1J6ZA 4GV9A 3EKSA 3VA0A 3C7NA 1HJOA 1YUWA 2WOMA 4CJPA 4DR7K 3O9UA 1LWEA 5C24A 4M3ZA 3C0BA 4E89A 4CFDA 4H0OA 1SL0A 5KPTA 2BUPA 2EHGA 4FZXC 4FOIA 4JRQA 2AP1A 4H0YB 4AHCA 4LF6K 1IG9A 3G71N 2NRRA 3D7EO 3Q7BA 4FLWA 1EXQA 4JRPA 1KTQA 4RW7A 1J5OA 4ELTA 3RRGA 4JK8A 5E41A 3UKUB 2HBLA 1X9JA 3ID6A 2QWQA 4DMNA 1L3UA 1TKTA 4W5QA 1YF5L 2NRXA 2FF6A 3CM6A 3MCAB 2X74A 3NGZA 1N36K 4KI6A 3FZFA 3LWMA 4W5RA 1BUPA 3FZLA 4CGDA 3EZWA 3SQ0A 2G8FA 2QWPA 3E9LA 4CZGA 1VQNN 1QE1A 1Q81O 3FZMA 4HVJA 5J2MA 4XH4A 1P90A 1RTJA 1MU2A 1NU0A 4JI2K 4CHOA 5H1SQ 2FXUA 4Z4CA 2O8DA 3SQ2A 4DTPA 1BL3A 3CQ8A 4FJHA 3D0PA 4IFYA 4LFBK 5GINA 4KH4A 3ULEB 2KHOA 3ZYYX 5ADXH 4QOZB 1H1VA 1NGBA 1JCGA 4F3OA 4BR9A 3ZEUB 4KTZA 3M8QA 4K43A 3K9JA 1IG8A 1QZ5A 1VQ8N 3UIQA 1RT3A 2ZWHA 4B8CA 4KH5A 5KPZA 1HJRA 5K14A 4CD1A 5CHIA 1L5UA 4KTQA 4YNQA 1NGIA 5J2PA 3H3OB 3C6HA 4R79A 2J4RA 1W7AA 1GLLO 4KHWA 1RILA 2ASMA 4ISEA 3QEIA 4DKWA 4JKCA 3AAPA 3O80A 1WSFA 3SUOA 1R59O 4JV5K 1LWCA 4MDAA 4M3WA 4DV3K 1KD1O 1XQSC 4QCLA 1NK8A 4AM7A 4JK7A 3IS9A 2CGJA 2NNWA 5AQMA 4YDUA 3SI6A 1VQ5N 3E9OA 3WXJA 1XC9A 4E7KA 3SQ1A 4LFAK 2JLEA 4FW1A 5BRFA 3AVGA 2ZD1A 4FJMA 1KAYA 4C1NK 1U4BA 1VQ4N 5HP1A 4H03B 3FFKB 2IC3A 3GE1A 4M41A 4CGHA 3RSEB 2BE2A 4DQQA 2KZMA 4CGJA 1TUUA 1VQ9N 4BRFA 4FJLA 1HRHA 4Z4HA 3PSFA 4EZ9A 1S1XA 2A42A 2P9NA 2CH5A 3HJFA 4CF1A 4F2RA 2HVHA 3VPZA 3CCJN 4CEFA 4GV6A 1C0GA 4RTFD 5KRTA 2OPQA 2NLXA 2A3ZA 4JKGB 5EVZA 3FFIA 4B9TA 4BRCA 1D9DA 3CFOA 1IKXA 4WQ4C 1IKVA 3RMDA 2E2PA 1TAUA 1LCUA 3NGYA 3ZX0A 4X64K 3N4PA 1J9AA 2ZM6K 3VQAA 3NF6A 3QLHA 1C1BA 2YKNA 1JLEA 1NJZA 3WQTA 3T1HK 3OJUA 3V81A 3CG7A 1UA1A 3VQ6A 2YKMA 4H0PA 2RPIA 4MLHA 3PX6A 1RBUA 3ZT4A 3IRXA 3A5MC 4FVMA 1KAXA 4NXNK 3VQQA 3CMEN 5FPMA 4BDYA 2KW4A 4BVOA 3DMJA 3OVNA 1CXUA 2Q0UA 4DTSA 3DM2A 4CK3A 4RW6A 4BE2A 4Z0UA 3CC7N 2D0OA 4CJWA 4FJXA 1BQMA 4WQ5C 1VSEA 4FWSA 3LM2A 5AQLA 3SQ4A 5GAHP 3WUHA 2VGMA 3VF2A 4I6MB 5AQZA 4K42A 3HTVA 4FK4A 3CCSN 4N47A 5AQHA 4BC3A 3MN9A 1MWMA 5GIOA 4KHUA 4NCBA 1RT2A 4IJNA 4PA1A 1WB9A 3THWA 4M7XA 5AZIA 3BY5A 4JI3K 2NZTA 3WNGA 3IG1A 3ZX2A 5AQTA 4AQYK 1ZYQA 5AFUH 3TAMA 3JAMO 1NJWA 1RDUA 2FBXA 2BANA 5EU7A 5BPNA 2D1KA 4E7LA 4HCCA 4FJJA 4CEEA 1WNSA 2Z1IA 3U6FA 3TPQA 4K8XA 4X65K 4H5TA 4GV3A 3NE6A 5A2QO 2Y1IA 1YJWN 2NRTA 4NYFA 2Q2RA 3HPGA 3D2FA 4DLGA 4KPYA 2A1SA 1HPMA 2ZF5O 4B9SA 3C7NB 4Z4GA 3MWTA 1IBKK 3QIPA 3R3LA 2D4WA 4EFHA 3PO5A 2HHWA 2FBTA 2OA8A 3K57A 2F96A 3C6TA 3T1YK 3E66A 4JKDA 1KQSM 1S6PA 4DV4K 4FWNA 3QBWA 3QNNA 3AGRA 3KHYA 5JS1A 1U2VA 4GW6A 4QS7A 2A41A 5M1FA 4ID1A 1T03A 1JXBA 3UKRA 4CFCA 3DI6A 2P1JA 4BRAA 2QK9A 2YHXA 1NKEA 5ELZA 4FJ8A 1BG3A 4BRKA 5BR8K 2QEXN 4FZZA 4FK0A 3ZETA 2A6AA 4DS5A 4LF5K 4PY5A 2V52B 3V4IA 4NCAA 4DSIA 3ALYA 1IKYA 5SWMA 3TAQA 1Q9YA 2QTDA 3U9DA 3D2EA 4CJEA 4AILC 4DTMA 3K2PA 3I33A 2O8BA 3MWPA 2GUIA 1NLVA 5BRDA 5T7BA 1Y97A 2P51A 2H3GX 2VCPA 1GLAG 3DRRA 3THYA 1DGKN 2D0AA 3F9MA 4M3YA 4OPAA 3G6EN 1HQEA 5DK5A 4PKIA 1FJGK 4BGAA 3LWLA 1HYSA 3NH0A 4H5NA 1RT6A 3S9HA 5DM7L 4FJNA 2E2OA 4J2BA 3QEWA 3AA5X 4ELVA 3O4QA 2OTLN 3NF7A 1NJXA 4PWDA 3I56N 4DUYK 5AFUA 2VG7A 1TK8A 3MK6A 3DLLL 3QESA 1V4SA 1JLFA 4IO9L 1GLJO 4CBUA 4IBNA 4BVPA 4BQLA 3O3FA 2HHUA 5F1XA 1IV0A 3NVKA 4HUGA 3MN5A 4B9QA 1RT1A 1LAWA 1BWFO 1RT7A 5CE3A 3SAFA 1KFSA 1ILYA 3PIOL 4B1XB 3QICA 5BPLA 3KLFA 1RT4A 1QSLA 4PQUA 3OYLA 3NGIA 3OYMA 4GKKK 1X9WA 4FM1A 1XUPO 4CZIA 4FPAA 3ISNC 2YCHA 1SKRA 3MDQA 4CEBA 2IVOA 2FC0A 4M3TA 4FYDA 3VEVA 3BGRA 5AZJA 4IO8A 2FSNA 4CK2A 4B3OA 4CJVA 2D0PA 3VN5A 1XC3A 3VQEA 4C23A 4C8KA 4LF8K 2E6LA 3S3OA 3NH1A 3KK3A 3JS6A 1K6YA 3L3UA 2O8EA 2VGNA 2P9UB 3UB5A 3HPHA 4YHHK 1SZ2A 3DLBA 3CJ9A 4FWPA 5AR0A 2XHBA 2HBJA 2P5OA 3T69A 1T44A 1TK5A 3SMSA 1B9DA 3LALA 2A1RA 5M1NA 4J2DA 2XY8A 3NFAA 3KWIA 1NMDA 4JKAA 1KXPA 3ATUA 3PX4A 4DSLA 4KHNA 1F21A 5F0XA 1TKDA 4KB0A 2W6KA 2IVNA 1NGEA 3WNFA 3CC4N 3AO1A 1TV6A 5EX5A 3VA3A 3IKMA 5HL7L 2P9NB 4CEZA 3VF4A 4DU1A 1U48A 1HUXA 2IGIA 2YX6A 4H0VB 2HHHK 4HUFA 4CJLA 4CERA 4CHYA 4JEPA 4IDKA 2G8UA 5BN8A 3RWUA 5FRNA 5I42A 2P9KA 2O8FA 3PV8A 4WFNL 2EWSA 2QWLA 3F2KA 3CQXA 3J7YP 4E7IA 3IUCA 3L2QA 4CHZA 4KHYA 2Z1HA 3G0ZA 3ZSQA 1WSHA 1ZBFA 2G8WA 1GLEG 4ELUA 2Z1JA 4RW4A 4BC2A 4OKEA 1OH7A 4OPJA 1QHTA 4IEEA 4AHVA 3J7AP 3LDPA 4XEIA 1K73O 4BY9C 4BRQA 1QVGM 4IDHA 3DOLA 4CEDA 1D4XA 2GX9A 2YNHA 4CJ3A 1HNIA 4CHPA 5AQJA 3U3GA 1FKPA 1O13A 3AY9A 2P9SA 2F7TA 5E26A 1EKEA 1X3MA 3VEZA 3DXKB 3QINA 5AQXA 4FPBA 1YJ9N 3VESA 2QWRA 4FLVA 2XY6A 2P9LA 3C6UA 3MECA 3KZBA 2HMPA 2WBNA 3NMUA 4E7JA 3LP3A 3AVNA 4CK1A 4O5FA 2HW3A 5KI6A 3O9RA 2XO7A 3L2VA 4KB1A 4IWVA 4NO7A 2YJEA 3THWB 5IT9O 5AZIB 4B9LA 5JICA 4LFCK 1QSYA 4X66K 2QI2A 3WEEA 3RMAA 4O8UA 3O5BA 3OHRA 3QFPA 3HSCA 1Z05A 4CF8A 1D8YA 1B9FA 4CF9A 3DWLA 4LY7A 4BRNA 3M8PA 4MFBA 1RBVA 3OBWA 5CZ1A 4JI7K 1OVYA 5C2DA 5M1QA 1VSMA 4V19S 4BR7A 4DR4K 2P5GA 1S5JA 3D2FB 4JD2A 3CCQN 2UU9K 2OTJN 3O4WA 1NGCA 3T7ZA 1S72N 3TR8A 4LF7K 4XH1A 1XWLA 4KHPK 1T3VA 3AVBA 4CF0A 5HBMA 3HT3A 4KHSA 4CJUA 4GY2B 4HUEA 1VSLA 1BIUA 2YHWA 4IJAA 3ZSVA 4FLTA 3ASMA 3BEXA 1RTIA 3SJHA 1EP4A 4BROA 1CZ9A 2IIRA 3ZT2A 1X9SA 1U2VB 3CCRN 3LM9A 2Q36A 3VQCA 4HTLA 1U47A 2I5JA 3UKRB 3SMPA 3V1RA 3M8SA 1X1PA 3R6MA 4FLXA 3VGKA 3M1FA 1RTDA 1L3TA 3CJCA 3TWHA 4DUZK 1NKBA 4DV6K 4BRGA 4DTXA 4I2QA 3ZETB 4BR5A 4WFAL 3L2WA 3NAEA 1WAJA 4GMJB 2DTUA 1QSSA 1J53A 5FPEA 4R5PA 3SV4A 3D2EB 2HVIA 3H3NO 2ETJA 1SKWA 2KZZA 2FF3B 2O8BB 4O55A 4BC4A 4IG3A 5LJVA 4M45A 3RRHA 3CIPA 1QHAA 3K9KA 1RDCA 5EY4A 2CGKA 1Q9XA 2V7ZA 3THYB 4FO0A 1CZAN 4PUOA 1W9HA 3WXIA 1HNZK 1MA9B 3C65A 3MN6A 3ZSXA 4FJIA 2O8CA 2GTDA 1J54A 2P9IA 4Y0WA 3THXA 1XNQK 2E1YA 3CCMN 2R7YA 2HHSA 3P38A 3JSMA 1OH8A 4ILJA 1K8KA 3LL3A 2IS3A 3OYEA 4CIFA 3G25A 3A8YA 4Q5VA 3KKSA 2UXCK 4FJ9A 3KWGA 1RT5A 4IFEA 1E4GT 3MX2A 4PL8A 1VQON 4HHTA 1Q86O 2ASOA 4CEOA 2XY5A 4BDZA 3D6RA 3SUPA 2I7NA 1FKOA 1NK4A 4E0DA 4BR0A 4J8FA 4ZTJA 2FLOA 3MCPA 2WTUA 4C8LA 4CCHA 2GEMA 1NMNA 2O4IA 4FW2A 2OANA 2VQFK 1W0HA 2Q1NA 5AZJB 3GG4A 3MEGA 3B6OA 4JS5A 1JCFA 1Q18A 2OCEA 3F9KA 3NDKA 4DSEA 3QFUA 4CE9A 4CJKA 4H5WA 3K5MA 5JVGL 2O8EB 1RBTA 1KLNA 2W41A 1QTMA 4RWTA 3J80O 3R8EA 4CD3A 1W2BM 4JS4A 3ZSOA 4FOEA 1S1WA 3FGUA 1WAFA 1NWKA 4DF4A 3KD1E 4BWMA 3WXKA 4CJSA 4CESA 5J2QA 4H4OA 4HCBA 3M5RA 1KLMA 1NGAA 1T6DA 3CPWM 3OS0A 1RCHA 2P9PA 3SNNA 1G15A 4GNIA 1C1AA 2VG6A 1TL1A 4BRLA 1DTTA 3O1BA 4KTWA 2PFUA 1K8AO 1S1VA 1ESVA 1JCEA 1FXXA 3L0QA 3DAWA 3GDQA 5AQVA 5J2NA 4H5VA 4DR5K 1VSKA 4JHDA 4G9ZA 5I9EB 1SAZA 5ADXA 4DR2K 4E1NA 1MWKA 4XIUA 4DFJA 4H0TB 2X6NA 3OYCA 1C0MA 4ISGA 3WQUA 2P9KB 4OO1J 2O8FB 3O9TA 3MAQA 5M1PA 2FBYA 1HPZA 1S9EA 1KFDA 4M7YA 2Q0RA 4BRIA 3BF3A 5BR9A 3OYHA 1EQYA 3K5LA 3CCLN 1WOQA 3DLGA 3R9PA 4CW7B 4IZ9A 4BACA 3I55N 1OH6A 1MDUB 2E88A 3C95A 2YHBA 4A5AA 4ZHRA 1JLCA 3CQYA 2E2NA 1ZC6A 3V1OA 5HRNA 1K9MO 2PYJA 1WSEA 2BH1A 1ZBIA 1XI1A 3S3MA 4A62A 3PO4A 4CGGA 3VMFB 3OYIA 4DS4A 4I7FA 3A5LC 2HSTA 4FM0A 1ZBLA 3SBGA 4JLHA 3J81O 3CXCM 1QVFM 4C8NA 4CECA 4B8AB 1OKJA 3FZKA 3K59A 3K5NA 3ZCMA 2NRWA 2P9SB 2UYTA 5CY4A 4DCHA 4B08A 2DPNA 4DTNA 4A5BA 1RDBA 3H1VX 3VQ7A 3FR0A 4NB4A 4UQGA 3LPTA 4E1JA 1WSIA 3ENOA 1J5EK 1L3SA 3DOKA 3WXLA 2OZMA 1BCOA 2P9LB 1A5VA 4DFKA 3AVCA 4DR3K 1NK6A 1HNXK 4KREA 2ZJQL 2B6AA 2RE2A 3SJJA 1NNEA 1VQPN 4WQ4A 1U04A 5KTQA 1RTHA 1QQCA 5C12A 3CCVN 3LP2A 2HNYA 4O8KA 1L3VA 4OX9K 3GBTA 3WEEB 1NGGA 4EHUA 2OYQA 4BR2A 3PX0A 3DJCA 1DTQA 5HRRA 1GOAA 3ZT0A 3DRPA 4RW9A 4NCGA 3EZ5A 3E01A 4ILHA 4E7HA 3TAPA 4W5NA 3CFRA 3O9QA 1I39A 4JD2B 1YHQN 1NK9A 3AO4A 3L4IA 3HVRA 2DFEA 4CHQA 1YJNN 2HNDA 3QEPA 4W5TA 1SKSA 3LDQA 4Z94A 3HPOA 4DU4A 3BZCA 1VQLN 5CYQA 4DTOA 3U8XA 1EWQA 3CCUN 1RGIA 3AVJA 2VWJA 3TAFA 4WQ5A 3KTQA 1VQMN 4N41A 3PY8A 4WE1A 3VF6A 3AVMA 2F9WA 1YTAA 2YJFA 5C2FA 3CJ7A 3PUFA 1NM1A 3AA3A 2ITGA 3CMAN 4DHYA 1TKXA 1ZXOA 5FLXO 3CM5A 1BA1A 4LSLA 4J2EA 4H8KA 4DR6K 3OW2M 1SV5A 4DU3A 3NF9A 3AARA 3SYZA 3SUQA 1JLGA 2YHYA 5GADP 4E19A 4IOAL 4FZYA 1TYQA 3GL1A 3AVKA 2O8DB 1WBDA 3H45C 3DLKA 1IBMK 1N8RO 1SL1A 3LZJA 3TU5A 1Z26A 3A2FA 3AAQA 3ULEA 2RHKA 4JI4K 3TAEA 3WNEA 2XRIA 1ASWA 5E84A 4LC9B 4I9LA 4B1UB 1BIZA 3I8BA 1T7PA 4OPHA 4M3RA 2P9IB 2QWOA 2GELA 4EP5A 1VRTA 4IXCA 2B4JA 3EN9A 1BISA 4ZTFA 1K8KB 3RR8A 2LSNA 4FSVA 3VEWA 1B92A 5EXWA 1XMQK 1X9MA 4FLZA 3HP9A 4NYNA 4CEAA 3H6EA 4B9MA 5CZ2A 2ZJPL 2OPPA 3LAMA 3CYMA 3A0IX 2PBDA 4E1MA 1TAQA 1TVRA 3I0SA 4FVUA 5IWAK 4PKGA 1KVCA 2FBVA 4CIEA 3RR7A 2VWKA 2ASPA 2W40A 1T6CA 4QAGA
chains in the Genus database with same CATH topology
4E7KA 4CF8A 2G8IA 3SQ1A 2YNIA 3AVLA 1D8YA 1B9FA 4CF9A 2OZSA 2JLEA 4LY7A 4FW1A 3NHGA 3M8PA 4MFBA 3AVGA 1RBVA 5CZ1A 2ZD1A 4DTJA 4Q0BA 4FJMA 4CHNA 3HM9A 1VSMA 3KD5E 3HSTB 1U4BA 2P5GA 4ICLA 1S5JA 4DSJA 5HP1A 3KLGA 2IC3A 1BI4A 4M41A 4W5OA 4FCYA 3U3YA 3V9SA 2F8TA 4CGHA 3L3VA 3TR8A 4AHSA 4YFUA 2BE2A 3NBPA 1XWLA 4DQQA 1RDDA 2Z1GA 3AVBA 3NF8A 4CF0A 4CGJA 2KZMA 1NOZA 5HBMA 3HT3A 4FJLA 1HRHA 4KHSA 2HNZA 4DSFA 4CJUA 4HUEA 1VSLA 1BIUA 2YV0X 4Z4HA 5KRSA 3ZSVA 1S1XA 1C0UA 4OKJA 4FLTA 4EZ9A 3ASMA 4KV8A 3HJFA 4CF1A 1BCMA 1LW0A 4DWIA 4F2RA 1RTIA 2HVHA 3P5JA 4CEFA 1UA0A 3THVA 5KRTA 2OPQA 1S1UA 5FDLA 1EP4A 2BGGA 1CZ9A 2HHQA 3ZT2A 3S3NA 3G10A 1X9SA 4CGIA 3FFIA 4BWJA 4B9TA 3LANA 1D9DA 3CFOA 1IKXA 3T1AA 1IKVA 1ASVA 1IH7A 3VQCA 3SCXA 1U47A 3QEVA 3RMDA 1HMVA 1TAUA 2I5JA 1XHZA 2VG5A 3D45A 5D3GA 3V1RA 3M8SA 1TL3A 1X1PA 4KRFA 4FLXA 3DYAA 2QKKA 3MXJA 3NGYA 1RTDA 1L3TA 3TWHA 1J9AA 1NKBA 1N6QA 3HVTA 1DLOA 3I0RA 3T19A 3B6PA 2KTQA 1NKCA 4KKOA 3VQAA 4I2QA 4DTXA 3NF6A 3QLHA 2GV9A 4DSKA 4OGCA 4C8MA 1C1BA 3NAEA 3L2WA 1WAJA 1IO2A 2YKNA 4I9QA 1JLEA 4GMJB 4BDPA 1NJZA 2DTUA 1QSSA 1C6VA 1RBRA 4DFPA 3OJUA 1J53A 3CG7A 4R5PA 3NCIA 3V81A 1UA1A 3DLRA 3VQ6A 2YKMA 3SV4A 1ITGA 2RPIA 3VQ9A 2HVIA 3PX6A 2ETJA 1NOYA 1RBUA 3ZT4A 3VQ5A 1SKWA 2KZZA 3IRXA 3VQDA 3DLHA 4O55A 4IG3A 5CYMA 4FVMA 4N76A 4M45A 3VQQA 3RRHA 3CFPA 1JL2A 1KCFA 1RDCA 1VSIA 3JYTA 1Q9XA 3KK1A 1ZBHA 4BDYA 4OLAA 1BGXT 2KW4A 3K5OA 3V6DA 4PUOA 1W9HA 3DMJA 1CXUA 3OVNA 4DTSA 1CXQA 2YHAA 3AO3A 3DM2A 3SV3A 3O3HA 4CK3A 4RW6A 3QEXA 3HXMA 1C0TA 4BE2A 3ZSXA 4Z0UA 3RMBA 4FJIA 1J54A 4CJWA 4FJ5A 2HHVA 4FJXA 1BQMA 2G8VA 4DF8A 1VSEA 3OYBA 5KGXA 2R7YA 1ZBIA 3SQ4A 2HHSA 3JSMA 4KAZA 4C8OA 3T3FA 3O4NA 4CEQA 2IS3A 1JKHA 4CIFA 3OYEA 1EX4A 4FK4A 4Q5VA 3KKSA 1KVBA 2D0BA 4FJ9A 3HO1A 1S6QA 1RT5A 4N47A 1JL1A 1JXEA 4Y1DA 4F4KA 3V1QA 5SZTA 4KHUA 4DFMA 2Q3SA 4NCBA 4HHTA 1RT2A 2YNFA 2Y1JA 4PA1A 3OYKA 2OPSA 4CEOA 1KVAA 3H08A 2XY5A 1LV5A 2IAJA 4BDZA 4BE0A 3WNGA 3IG1A 1TKZA 1R0AA 3SZ2A 3SUPA 1ZYQA 4IKFA 1FKOA 3TAMA 1VRUA 1NJWA 1NK4A 4E0DA 1REVA 3WNHA 4CFAA 2RKIA 2FBXA 2BANA 3DLEA 3P83D 5EU7A 3EYZA 4DQRA 4ZTJA 4C8LA 4CCHA 4E7LA 4HCCA 5C25A 4FJJA 4CEEA 4CJQA 5HRPA 2W42A 1WNSA 4KI4A 2O4IA 1GOBA 1LAVA 2Z1IA 1VSJA 3ITHA 3U6FA 4FW2A 4LH5A 4CJ5A 4K8XA 4AH9A 1W0HA 3NE6A 1QS4A 5HLFA 2Y1IA 4NYFA 3MEGA 5DMRA 3HPGA 3B6OA 4O5BA 1RNHA 4DLGA 4JS5A 4KPYA 3ZT3A 2A1SA 3F9KA 2X78A 2ZE2A 3NDKA 4B9SA 3P1GA 2O4GA 4DSEA 4Z4GA 4CJKA 4CE9A 3AA4A 3K5MA 1RBTA 1KLNA 4H4MA 3HK2A 4QAGA 1FK9A 3QIPA 1QTMA 3SUNA 5FRMA 4JS4A 4FJKA 3ZSOA 4G1QA 4BE1A 1S1WA 2FBTA 3VQBA 2OA8A 3PO5A 3K57A 2HHWA 3OY9A 1UAXA 1WAFA 4KO0A 4DF4A 5HROA 4BWMA 3KD1E 2F96A 3C6TA 3QETA 4CJSA 4CESA 5J2QA 1ASUA 4Z4IA 1S6PA 4H4OA 3KK2A 1UOCA 4HCBA 3TI0A 1JLBA 3AVAA 4CGFA 5HRSA 4OLBA 3AO2A 3KLHA 1VSHA 3QNNA 1KLMA 3LP1A 3OS0A 1RCHA 1KRPA 5JS1A 2OPRA 4GW6A 1G15A 1VK0A 3SNNA 3OYAA 1C1AA 2VG6A 3OYNA 4ID1A 3L2UA 4CJTA 1TL1A 1T03A 1JXBA 3OS1A 1DTTA 4KTWA 4CFCA 3DI6A 1S1VA 2P1JA 1UWBA 4F8RA 2QK9A 1FXXA 4KFBA 3TARA 1NKEA 4DG1A 3IAYA 4CFBA 1KSPA 4DQPA 4CJ4A 5J2NA 1Q8IA 4B9VA 4FJ8A 2AJQA 1VSKA 3AVIA 3RTVA 3OYGA 3LZIA 3ULDA 3MXMA 4J2AA 1JLAA 4FZZA 3KLIA 4FK0A 4DS5A 2HHXA 3O3GA 4E1NA 4IG0A 4PY5A 4XIUA 4DFJA 4KHQA 3L2RA 3V4IA 4NCAA 3KLEA 2KQ2A 4DSIA 3ALYA 2X6NA 1IKYA 3LPUA 5SWMA 4O0IA 3TAQA 1Q9YA 3OYCA 1C0MA 3AVHA 2PZSA 3OYDA 3QO9A 2GBZA 4CJEA 3I8DA 4AILC 5FROA 2E4LA 4M42A 1CLQA 1S9GA 3AVFA 3LDSA 1TK0A 4RW8A 4DTMA 1Z25A 3K2PA 2HMIA 3MAQA 1D5AA 3AV9A 2FBYA 1HPZA 1S9EA 2DFHA 2WONA 1KFDA 2ATQA 2GUIA 3MEEA 4FK2A 3OYHA 4DQSA 1TGOA 4F2SA 3K5LA 5T7BA 1Y97A 3EY1A 2P51A 3DLGA 1LW2A 3DRRA 1BQNA 4DQIA 2D0AA 4M3YA 4O44A 4BACA 4FLYA 2B5JA 3NH2A 4TSXA 1HQEA 2NUBA 5KGWA 5DK5A 4EZ6A 5C42A 1XHXA 3LWLA 4ELTA 3NH0A 3C95A 4Z4FA 1HYSA 2YHBA 4ZHRA 1JLCA 4K8ZA 1RT6A 2PYLA 3QNOA 4LH4A 3S9HA 3V1OA 5HRNA 4OVLA 3AO5A 3K58A 4J2BA 4FJNA 2PYJA 3QEWA 3OS2A 3AA5X 1WSEA 4ELVA 3O4QA 4GVMA 4MQ3A 3AA2A 1RBSA 1XI1A 3NF7A 1NJXA 3OJSA 3S3MA 4DLEA 4CJRA 4M3XA 4PWDA 2KFNA 1IKWA 4OJRA 2F8SA 3PO4A 4CGGA 3BDPA 2X6SA 2VG7A 1TK8A 4EP4A 1NJYA 1A5XA 3OYIA 1VSFA 1S1TA 3L8BA 4DS4A 4I7FA 3QESA 4IFVA 1T05A 1D9FA 2YNGA 1JLFA 4FM0A 1HYZA 3V9WA 2RN2A 1ZBLA 4JLHA 4FXDA 4IBNA 4C8NA 4CECA 4B8AB 1HQUA 3O3FA 1U45A 2HHUA 4FJGA 1SL2A 1O1WA 2HB5A 3K59A 1VSDA 3ZCMA 3K5NA 4HUGA 5CY4A 4B08A 4Y1CA 2IOCA 1RT1A 1LAWA 1RT7A 4DTNA 4LSNA 2G8HA 1T8EA 1I3AA 3V9ZA 1KFSA 1RDBA 3VQ7A 3V9XA 4UQGA 3LPTA 3KKRA 3KLFA 1WSIA 1RT4A 4CJFA 2RF2A 4CIGA 1QSLA 4PQUA 1L3SA 3DOKA 2OZMA 1BCOA 3OYLA 3HYFA 3TABA 3NGIA 3OYMA 3OYJA 1X9WA 1A5VA 4DFKA 5JS2A 3AVCA 1NK6A 4FM1A 4M3UA 2D5RA 3ISNC 4KREA 1SKRA 1NK0A 4CEBA 3SJJA 2B6AA 2FC0A 4ID5A 4B9NA 4I2PA 1N5YA 4M3TA 4FYDA 1U04A 4OKKA 3BGRA 4O0JA 5KTQA 4CK2A 3V9UA 4B3OA 1RTHA 1QQCA 4CJVA 3VN5A 3QIOA 3DRSA 2XY7A 3VQEA 3LP0A 4C8KA 3M8RA 3VA0A 2E6LA 3LP2A 2BDPA 2HNYA 1L3VA 3KIOA 1GOCA 4DTRA 3NH1A 3S3OA 3KK3A 4E3SA 1K6YA 2WOMA 3L3UA 4FLUA 2OYQA 4CJPA 3PX0A 1ZBUA 3HPHA 1DTQA 1LWEA 5C24A 1CZBA 5HRRA 3DLBA 4M3ZA 1GOAA 3ZT0A 2XHBA 3C94A 4CFDA 3DRPA 4E89A 2E6MA 2P5OA 1NK5A 1TK5A 4RW9A 4NCGA 1WSJA 3EZ5A 1SL0A 1A5WA 3E01A 1B9DA 2EHGA 3LALA 4E7HA 3TAPA 2A1RA 4J2DA 2XY8A 3NFAA 4FZXC 4W5NA 3CFRA 4JRQA 1BI4B 1I39A 1NK9A 3PX4A 3AO4A 3HVRA 2DFEA 4CHQA 4DSLA 4AHCA 4KHNA 1F21A 4N56A 1IG9A 1HYVA 2HNDA 4AHUA 3QEPA 4B9UA 4W5TA 1EETA 4FLWA 1TKDA 4KB0A 5I3UA 1EXQA 3WNFA 3QERA 4JRPA 1KTQA 3AO1A 4RW7A 1TV6A 3ZSYA 4DTUA 3HPOA 1SKSA 1J5OA 5E41A 3RRGA 3VA3A 4DU4A 5CYQA 4DTOA 2KFZA 4CEZA 4DMNA 4DU1A 1U48A 2IGIA 4OGEA 1L3UA 1TKTA 4HUFA 3AVJA 4W5QA 4CJLA 2VWJA 4HTUA 3TAFA 3SPYA 3KTQA 2D0CA 3CM6A 4CERA 3NGZA 2X74A 4N41A 3PY8A 4WE1A 4KI6A 3LAKA 3AVMA 1RDAA 4CHYA 4N5SA 3LWMA 4IDKA 4W5RA 1YTAA 2G8UA 3RWUA 5FRNA 5I42A 3PUFA 3AA3A 3PV8A 2ITGA 4CGDA 3SQ0A 4Z4EA 2G8FA 1TKXA 4O4GA 3CM5A 4E7IA 1YVUA 4LSLA 4J2EA 1LWFA 4H8KA 3L2QA 4CHZA 4KHYA 2QXFA 1QE1A 2ZQBA 2Z1HA 1SV5A 4HVJA 5J2MA 3G0ZA 3ZSZA 3ZSQA 1JLQA 1WSHA 3NF9A 4DU3A 1ZBFA 3SYZA 1U49A 2G8WA 1RTJA 1MU2A 1SUQA 3SUQA 1JLGA 3VQ8A 4CHOA 4ELUA 2Z1JA 2QKBA 4E19A 4FZYA 4RW4A 4Z4CA 3AVKA 3SQ2A 4OKEA 1BL3A 4DTPA 3DLKA 4OPJA 4F3TA 3ZSWA 4CF2A 3CQ8A 3LZJA 1SL1A 4FJHA 1Z26A 3D0PA 1QHTA 3A2FA 4IFYA 4AHVA 4AHTA 3MXIA 4AHRA 2DFFA 3HP6A 2EX3A 3TAEA 3OYFA 3VQPA 3ZT1A 1NK7A 3WNEA 4QOZB 2XRIA 1ASWA 4FJ7A 3DOLA 4CEDA 4F3OA 4I9LA 1HNVA 4KTZA 1BIZA 3M8QA 2YNHA 4CJ3A 1HNIA 4CHPA 3TANA 1T7PA 3U3GA 1FKPA 3HL8A 1YT3A 4M3RA 3UIQA 1YTUA 4EP5A 1RT3A 4B8CA 1VRTA 4L8RB 1HJRA 1EKEA 2B4JA 5K14A 3ZSRA 1BISA 3QINA 4OPKA 1L5UA 4KTQA 4YNQA 4ZTFA 3RR8A 2G8KA 2LSNA 5J2PA 4LD0A 1B92A 3SPZA 4FLVA 2XY6A 1X9MA 4FLZA 3HP9A 3C6UA 3MECA 4NYNA 4CEAA 4KHWA 3TAGA 1BHLA 3F73A 1C1CA 4FM2A 4B9MA 4E7JA 3LP3A 1RILA 3AVNA 5CZ2A 4CK1A 5J1EA 3QEIA 2HW3A 3VQ4A 5KI6A 1WSFA 2OPPA 3LAMA 2XO7A 3SUOA 3L2VA 4KB1A 4RG8A 3CYMA 2PY5A 1WN7A 4E1MA 1TAQA 4B9LA 1LWCA 4M3WA 1TVRA 3I0SA 1QSYA 1WLJA 4QCLA 1NK8A 3KJVA 3MEDA 3RMAA 1KVCA 2FBVA 4CIEA 3IS9A 3RR7A 2VWKA 3RMCA 2HHTA 2IDOA 2DY4A 3SI6A 2JGUA 1XC9A 1WSGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E7K A;  4CF8 A;  2G8I A;  3SQ1 A;  2YNI A;  3AVL A;  1D8Y A;  1B9F A;  4CF9 A;  2OZS A;  2JLE A;  4LY7 A;  4FW1 A;  3NHG A;  3M8P A;  4MFB A;  3AVG A;  1RBV A;  5CZ1 A;  2ZD1 A;  4DTJ A;  4Q0B A;  4FJM A;  4CHN A;  3HM9 A;  1VSM A;  3KD5 E;  3HST B;  1U4B A;  2P5G A;  4ICL A;  1S5J A;  4DSJ A;  5HP1 A;  3KLG A;  2IC3 A;  1BI4 A;  4M41 A;  4W5O A;  4FCY A;  3U3Y A;  3V9S A;  2F8T A;  4CGH A;  3L3V A;  3TR8 A;  4AHS A;  4YFU A;  2BE2 A;  3NBP A;  1XWL A;  4DQQ A;  1RDD A;  2Z1G A;  3AVB A;  3NF8 A;  4CF0 A;  4CGJ A;  2KZM A;  1NOZ A;  5HBM A;  3HT3 A;  4FJL A;  1HRH A;  4KHS A;  2HNZ A;  4DSF A;  4CJU A;  4HUE A;  1VSL A;  1BIU A;  2YV0 X;  4Z4H A;  5KRS A;  3ZSV A;  1S1X A;  1C0U A;  4OKJ A;  4FLT A;  4EZ9 A;  3ASM A;  4KV8 A;  3HJF A;  4CF1 A;  1BCM A;  1LW0 A;  4DWI A;  4F2R A;  1RTI A;  2HVH A;  3P5J A;  4CEF A;  1UA0 A;  3THV A;  5KRT A;  2OPQ A;  1S1U A;  5FDL A;  1EP4 A;  2BGG A;  1CZ9 A;  2HHQ A;  3ZT2 A;  3S3N A;  3G10 A;  1X9S A;  4CGI A;  3FFI A;  4BWJ A;  4B9T A;  3LAN A;  1D9D A;  3CFO A;  1IKX A;  3T1A A;  1IKV A;  1ASV A;  1IH7 A;  3VQC A;  3SCX A;  1U47 A;  3QEV A;  3RMD A;  1HMV A;  1TAU A;  2I5J A;  1XHZ A;  2VG5 A;  3D45 A;  5D3G A;  3V1R A;  3M8S A;  1TL3 A;  1X1P A;  4KRF A;  4FLX A;  3DYA A;  2QKK A;  3MXJ A;  3NGY A;  1RTD A;  1L3T A;  3TWH A;  1J9A A;  1NKB A;  1N6Q A;  3HVT A;  1DLO A;  3I0R A;  3T19 A;  3B6P A;  2KTQ A;  1NKC A;  4KKO A;  3VQA A;  4I2Q A;  4DTX A;  3NF6 A;  3QLH A;  2GV9 A;  4DSK A;  4OGC A;  4C8M A;  1C1B A;  3NAE A;  3L2W A;  1WAJ A;  1IO2 A;  2YKN A;  4I9Q A;  1JLE A;  4GMJ B;  4BDP A;  1NJZ A;  2DTU A;  1QSS A;  1C6V A;  1RBR A;  4DFP A;  3OJU A;  1J53 A;  3CG7 A;  4R5P A;  3NCI A;  3V81 A;  1UA1 A;  3DLR A;  3VQ6 A;  2YKM A;  3SV4 A;  1ITG A;  2RPI A;  3VQ9 A;  2HVI A;  3PX6 A;  2ETJ A;  1NOY A;  1RBU A;  3ZT4 A;  3VQ5 A;  1SKW A;  2KZZ A;  3IRX A;  3VQD A;  3DLH A;  4O55 A;  4IG3 A;  5CYM A;  4FVM A;  4N76 A;  4M45 A;  3VQQ A;  3RRH A;  3CFP A;  1JL2 A;  1KCF A;  1RDC A;  1VSI A;  3JYT A;  1Q9X A;  3KK1 A;  1ZBH A;  4BDY A;  4OLA A;  1BGX T;  2KW4 A;  3K5O A;  3V6D A;  4PUO A;  1W9H A;  3DMJ A;  1CXU A;  3OVN A;  4DTS A;  1CXQ A;  2YHA A;  3AO3 A;  3DM2 A;  3SV3 A;  3O3H A;  4CK3 A;  4RW6 A;  3QEX A;  3HXM A;  1C0T A;  4BE2 A;  3ZSX A;  4Z0U A;  3RMB A;  4FJI A;  1J54 A;  4CJW A;  4FJ5 A;  2HHV A;  4FJX A;  1BQM A;  2G8V A;  4DF8 A;  1VSE A;  3OYB A;  5KGX A;  2R7Y A;  1ZBI A;  3SQ4 A;  2HHS A;  3JSM A;  4KAZ A;  4C8O A;  3T3F A;  3O4N A;  4CEQ A;  2IS3 A;  1JKH A;  4CIF A;  3OYE A;  1EX4 A;  4FK4 A;  4Q5V A;  3KKS A;  1KVB A;  2D0B A;  4FJ9 A;  3HO1 A;  1S6Q A;  1RT5 A;  4N47 A;  1JL1 A;  1JXE A;  4Y1D A;  4F4K A;  3V1Q A;  5SZT A;  4KHU A;  4DFM A;  2Q3S A;  4NCB A;  4HHT A;  1RT2 A;  2YNF A;  2Y1J A;  4PA1 A;  3OYK A;  2OPS A;  4CEO A;  1KVA A;  3H08 A;  2XY5 A;  1LV5 A;  2IAJ A;  4BDZ A;  4BE0 A;  3WNG A;  3IG1 A;  1TKZ A;  1R0A A;  3SZ2 A;  3SUP A;  1ZYQ A;  4IKF A;  1FKO A;  3TAM A;  1VRU A;  1NJW A;  1NK4 A;  4E0D A;  1REV A;  3WNH A;  4CFA A;  2RKI A;  2FBX A;  2BAN A;  3DLE A;  3P83 D;  5EU7 A;  3EYZ A;  4DQR A;  4ZTJ A;  4C8L A;  4CCH A;  4E7L A;  4HCC A;  5C25 A;  4FJJ A;  4CEE A;  4CJQ A;  5HRP A;  2W42 A;  1WNS A;  4KI4 A;  2O4I A;  1GOB A;  1LAV A;  2Z1I A;  1VSJ A;  3ITH A;  3U6F A;  4FW2 A;  4LH5 A;  4CJ5 A;  4K8X A;  4AH9 A;  1W0H A;  3NE6 A;  1QS4 A;  5HLF A;  2Y1I A;  4NYF A;  3MEG A;  5DMR A;  3HPG A;  3B6O A;  4O5B A;  1RNH A;  4DLG A;  4JS5 A;  4KPY A;  3ZT3 A;  2A1S A;  3F9K A;  2X78 A;  2ZE2 A;  3NDK A;  4B9S A;  3P1G A;  2O4G A;  4DSE A;  4Z4G A;  4CJK A;  4CE9 A;  3AA4 A;  3K5M A;  1RBT A;  1KLN A;  4H4M A;  3HK2 A;  4QAG A;  1FK9 A;  3QIP A;  1QTM A;  3SUN A;  5FRM A;  4JS4 A;  4FJK A;  3ZSO A;  4G1Q A;  4BE1 A;  1S1W A;  2FBT A;  3VQB A;  2OA8 A;  3PO5 A;  3K57 A;  2HHW A;  3OY9 A;  1UAX A;  1WAF A;  4KO0 A;  4DF4 A;  5HRO A;  4BWM A;  3KD1 E;  2F96 A;  3C6T A;  3QET A;  4CJS A;  4CES A;  5J2Q A;  1ASU A;  4Z4I A;  1S6P A;  4H4O A;  3KK2 A;  1UOC A;  4HCB A;  3TI0 A;  1JLB A;  3AVA A;  4CGF A;  5HRS A;  4OLB A;  3AO2 A;  3KLH A;  1VSH A;  3QNN A;  1KLM A;  3LP1 A;  3OS0 A;  1RCH A;  1KRP A;  5JS1 A;  2OPR A;  4GW6 A;  1G15 A;  1VK0 A;  3SNN A;  3OYA A;  1C1A A;  2VG6 A;  3OYN A;  4ID1 A;  3L2U A;  4CJT A;  1TL1 A;  1T03 A;  1JXB A;  3OS1 A;  1DTT A;  4KTW A;  4CFC A;  3DI6 A;  1S1V A;  2P1J A;  1UWB A;  4F8R A;  2QK9 A;  1FXX A;  4KFB A;  3TAR A;  1NKE A;  4DG1 A;  3IAY A;  4CFB A;  1KSP A;  4DQP A;  4CJ4 A;  5J2N A;  1Q8I A;  4B9V A;  4FJ8 A;  2AJQ A;  1VSK A;  3AVI A;  3RTV A;  3OYG A;  3LZI A;  3ULD A;  3MXM A;  4J2A A;  1JLA A;  4FZZ A;  3KLI A;  4FK0 A;  4DS5 A;  2HHX A;  3O3G A;  4E1N A;  4IG0 A;  4PY5 A;  4XIU A;  4DFJ A;  4KHQ A;  3L2R A;  3V4I A;  4NCA A;  3KLE A;  2KQ2 A;  4DSI A;  3ALY A;  2X6N A;  1IKY A;  3LPU A;  5SWM A;  4O0I A;  3TAQ A;  1Q9Y A;  3OYC A;  1C0M A;  3AVH A;  2PZS A;  3OYD A;  3QO9 A;  2GBZ A;  4CJE A;  3I8D A;  4AIL C;  5FRO A;  2E4L A;  4M42 A;  1CLQ A;  1S9G A;  3AVF A;  3LDS A;  1TK0 A;  4RW8 A;  4DTM A;  1Z25 A;  3K2P A;  2HMI A;  3MAQ A;  1D5A A;  3AV9 A;  2FBY A;  1HPZ A;  1S9E A;  2DFH A;  2WON A;  1KFD A;  2ATQ A;  2GUI A;  3MEE A;  4FK2 A;  3OYH A;  4DQS A;  1TGO A;  4F2S A;  3K5L A;  5T7B A;  1Y97 A;  3EY1 A;  2P51 A;  3DLG A;  1LW2 A;  3DRR A;  1BQN A;  4DQI A;  2D0A A;  4M3Y A;  4O44 A;  4BAC A;  4FLY A;  2B5J A;  3NH2 A;  4TSX A;  1HQE A;  2NUB A;  5KGW A;  5DK5 A;  4EZ6 A;  5C42 A;  1XHX A;  3LWL A;  4ELT A;  3NH0 A;  3C95 A;  4Z4F A;  1HYS A;  2YHB A;  4ZHR A;  1JLC A;  4K8Z A;  1RT6 A;  2PYL A;  3QNO A;  4LH4 A;  3S9H A;  3V1O A;  5HRN A;  4OVL A;  3AO5 A;  3K58 A;  4J2B A;  4FJN A;  2PYJ A;  3QEW A;  3OS2 A;  3AA5 X;  1WSE A;  4ELV A;  3O4Q A;  4GVM A;  4MQ3 A;  3AA2 A;  1RBS A;  1XI1 A;  3NF7 A;  1NJX A;  3OJS A;  3S3M A;  4DLE A;  4CJR A;  4M3X A;  4PWD A;  2KFN A;  1IKW A;  4OJR A;  2F8S A;  3PO4 A;  4CGG A;  3BDP A;  2X6S A;  2VG7 A;  1TK8 A;  4EP4 A;  1NJY A;  1A5X A;  3OYI A;  1VSF A;  1S1T A;  3L8B A;  4DS4 A;  4I7F A;  3QES A;  4IFV A;  1T05 A;  1D9F A;  2YNG A;  1JLF A;  4FM0 A;  1HYZ A;  3V9W A;  2RN2 A;  1ZBL A;  4JLH A;  4FXD A;  4IBN A;  4C8N A;  4CEC A;  4B8A B;  1HQU A;  3O3F A;  1U45 A;  2HHU A;  4FJG A;  1SL2 A;  1O1W A;  2HB5 A;  3K59 A;  1VSD A;  3ZCM A;  3K5N A;  4HUG A;  5CY4 A;  4B08 A;  4Y1C A;  2IOC A;  1RT1 A;  1LAW A;  1RT7 A;  4DTN A;  4LSN A;  2G8H A;  1T8E A;  1I3A A;  3V9Z A;  1KFS A;  1RDB A;  3VQ7 A;  3V9X A;  4UQG A;  3LPT A;  3KKR A;  3KLF A;  1WSI A;  1RT4 A;  4CJF A;  2RF2 A;  4CIG A;  1QSL A;  4PQU A;  1L3S A;  3DOK A;  2OZM A;  1BCO A;  3OYL A;  3HYF A;  3TAB A;  3NGI A;  3OYM A;  3OYJ A;  1X9W A;  1A5V A;  4DFK A;  5JS2 A;  3AVC A;  1NK6 A;  4FM1 A;  4M3U A;  2D5R A;  3ISN C;  4KRE A;  1SKR A;  1NK0 A;  4CEB A;  3SJJ A;  2B6A A;  2FC0 A;  4ID5 A;  4B9N A;  4I2P A;  1N5Y A;  4M3T A;  4FYD A;  1U04 A;  4OKK A;  3BGR A;  4O0J A;  5KTQ A;  4CK2 A;  3V9U A;  4B3O A;  1RTH A;  1QQC A;  4CJV A;  3VN5 A;  3QIO A;  3DRS A;  2XY7 A;  3VQE A;  3LP0 A;  4C8K A;  3M8R A;  3VA0 A;  2E6L A;  3LP2 A;  2BDP A;  2HNY A;  1L3V A;  3KIO A;  1GOC A;  4DTR A;  3NH1 A;  3S3O A;  3KK3 A;  4E3S A;  1K6Y A;  2WOM A;  3L3U A;  4FLU A;  2OYQ A;  4CJP A;  3PX0 A;  1ZBU A;  3HPH A;  1DTQ A;  1LWE A;  5C24 A;  1CZB A;  5HRR A;  3DLB A;  4M3Z A;  1GOA A;  3ZT0 A;  2XHB A;  3C94 A;  4CFD A;  3DRP A;  4E89 A;  2E6M A;  2P5O A;  1NK5 A;  1TK5 A;  4RW9 A;  4NCG A;  1WSJ A;  3EZ5 A;  1SL0 A;  1A5W A;  3E01 A;  1B9D A;  2EHG A;  3LAL A;  4E7H A;  3TAP A;  2A1R A;  4J2D A;  2XY8 A;  3NFA A;  4FZX C;  4W5N A;  3CFR A;  4JRQ A;  1BI4 B;  1I39 A;  1NK9 A;  3PX4 A;  3AO4 A;  3HVR A;  2DFE A;  4CHQ A;  4DSL A;  4AHC A;  4KHN A;  1F21 A;  4N56 A;  1IG9 A;  1HYV A;  2HND A;  4AHU A;  3QEP A;  4B9U A;  4W5T A;  1EET A;  4FLW A;  1TKD A;  4KB0 A;  5I3U A;  1EXQ A;  3WNF A;  3QER A;  4JRP A;  1KTQ A;  3AO1 A;  4RW7 A;  1TV6 A;  3ZSY A;  4DTU A;  3HPO A;  1SKS A;  1J5O A;  5E41 A;  3RRG A;  3VA3 A;  4DU4 A;  5CYQ A;  4DTO A;  2KFZ A;  4CEZ A;  4DMN A;  4DU1 A;  1U48 A;  2IGI A;  4OGE A;  1L3U A;  1TKT A;  4HUF A;  3AVJ A;  4W5Q A;  4CJL A;  2VWJ A;  4HTU A;  3TAF A;  3SPY A;  3KTQ A;  2D0C A;  3CM6 A;  4CER A;  3NGZ A;  2X74 A;  4N41 A;  3PY8 A;  4WE1 A;  4KI6 A;  3LAK A;  3AVM A;  1RDA A;  4CHY A;  4N5S A;  3LWM A;  4IDK A;  4W5R A;  1YTA A;  2G8U A;  3RWU A;  5FRN A;  5I42 A;  3PUF A;  3AA3 A;  3PV8 A;  2ITG A;  4CGD A;  3SQ0 A;  4Z4E A;  2G8F A;  1TKX A;  4O4G A;  3CM5 A;  4E7I A;  1YVU A;  4LSL A;  4J2E A;  1LWF A;  4H8K A;  3L2Q A;  4CHZ A;  4KHY A;  2QXF A;  1QE1 A;  2ZQB A;  2Z1H A;  1SV5 A;  4HVJ A;  5J2M A;  3G0Z A;  3ZSZ A;  3ZSQ A;  1JLQ A;  1WSH A;  3NF9 A;  4DU3 A;  1ZBF A;  3SYZ A;  1U49 A;  2G8W A;  1RTJ A;  1MU2 A;  1SUQ A;  3SUQ A;  1JLG A;  3VQ8 A;  4CHO A;  4ELU A;  2Z1J A;  2QKB A;  4E19 A;  4FZY A;  4RW4 A;  4Z4C A;  3AVK A;  3SQ2 A;  4OKE A;  1BL3 A;  4DTP A;  3DLK A;  4OPJ A;  4F3T A;  3ZSW A;  4CF2 A;  3CQ8 A;  3LZJ A;  1SL1 A;  4FJH A;  1Z26 A;  3D0P A;  1QHT A;  3A2F A;  4IFY A;  4AHV A;  4AHT A;  3MXI A;  4AHR A;  2DFF A;  3HP6 A;  2EX3 A;  3TAE A;  3OYF A;  3VQP A;  3ZT1 A;  1NK7 A;  3WNE A;  4QOZ B;  2XRI A;  1ASW A;  4FJ7 A;  3DOL A;  4CED A;  4F3O A;  4I9L A;  1HNV A;  4KTZ A;  1BIZ A;  3M8Q A;  2YNH A;  4CJ3 A;  1HNI A;  4CHP A;  3TAN A;  1T7P A;  3U3G A;  1FKP A;  3HL8 A;  1YT3 A;  4M3R A;  3UIQ A;  1YTU A;  4EP5 A;  1RT3 A;  4B8C A;  1VRT A;  4L8R B;  1HJR A;  1EKE A;  2B4J A;  5K14 A;  3ZSR A;  1BIS A;  3QIN A;  4OPK A;  1L5U A;  4KTQ A;  4YNQ A;  4ZTF A;  3RR8 A;  2G8K A;  2LSN A;  5J2P A;  4LD0 A;  1B92 A;  3SPZ A;  4FLV A;  2XY6 A;  1X9M A;  4FLZ A;  3HP9 A;  3C6U A;  3MEC A;  4NYN A;  4CEA A;  4KHW A;  3TAG A;  1BHL A;  3F73 A;  1C1C A;  4FM2 A;  4B9M A;  4E7J A;  3LP3 A;  1RIL A;  3AVN A;  5CZ2 A;  4CK1 A;  5J1E A;  3QEI A;  2HW3 A;  3VQ4 A;  5KI6 A;  1WSF A;  2OPP A;  3LAM A;  2XO7 A;  3SUO A;  3L2V A;  4KB1 A;  4RG8 A;  3CYM A;  2PY5 A;  1WN7 A;  4E1M A;  1TAQ A;  4B9L A;  1LWC A;  4M3W A;  1TVR A;  3I0S A;  1QSY A;  1WLJ A;  4QCL A;  1NK8 A;  3KJV A;  3MED A;  3RMA A;  1KVC A;  2FBV A;  4CIE A;  3IS9 A;  3RR7 A;  2VWK A;  3RMC A;  2HHT A;  2IDO A;  2DY4 A;  3SI6 A;  2JGU A;  1XC9 A;  1WSG A; 
#chains in the Genus database with same CATH topology
 3MX5 A;  2YNI A;  3DXM A;  4JI1 K;  4GVE A;  2OZS A;  3NHG A;  3CD6 N;  4Q0B A;  3HM9 A;  1N32 K;  5AQF A;  4KH6 A;  1HKB A;  4RCH A;  5LMU K;  1BI4 A;  1N34 K;  3WT0 A;  3U3Y A;  4W5O A;  2F8T A;  1I94 K;  4U7B A;  3FLC O;  4AHS A;  5HOO A;  3NF8 A;  3P39 A;  1NOZ A;  4JKB A;  3F5T A;  4YOR A;  4OKJ A;  4KV8 A;  5GAG P;  3P5J A;  4MLE A;  3HOT A;  2CGL A;  1S1U A;  1ATR A;  2BGG A;  4B3R K;  2HHQ A;  3S3N A;  3G10 A;  2P9P B;  4BWJ A;  1IH7 A;  4JI6 K;  3QEV A;  2AA4 A;  5JMV A;  3O9S A;  1XHZ A;  3A5N C;  1TL3 A;  4KRF A;  2FSJ A;  2QKK A;  3MXJ A;  5AQR A;  3NVM A;  4JHD B;  3HVT A;  1DLO A;  3T19 A;  1U6Z A;  2IVP A;  4DSK A;  3EEQ A;  4OGC A;  4IOC L;  1OH5 A;  4I9Q A;  3HI0 A;  4BDP A;  3ID8 A;  4DV2 K;  1C6V A;  2ITM A;  4WYB A;  4NLC A;  2V7Y A;  1ITG A;  1NOY A;  4K41 A;  4L3Q A;  3VET A;  3LDN A;  3QBX A;  3LDL A;  5GIP A;  3JYT A;  3KK1 A;  3HBT A;  4CZK A;  4OLA A;  3K5O A;  2Q97 A;  2YHA A;  3SV3 A;  2UUC K;  4KHQ A;  1GLC G;  3IDH A;  1GLF O;  1Q7Y O;  3U9Z A;  2G8V A;  4DF8 A;  5JLH A;  4B3S K;  3U4L A;  4EIA A;  3TTD A;  3OYB A;  3EKU A;  4CVN E;  4KAZ A;  4MO5 A;  3T3F A;  3O4N A;  1JKH A;  5LL6 Z;  1EX4 A;  4A61 A;  1X3N A;  2D0B A;  5FPN A;  3VEX A;  1S6Q A;  1YI2 N;  5AQG A;  1JXE A;  4Y1D A;  4F4K A;  4B1W B;  3HOS A;  2Q3S A;  3VGM A;  3CER A;  1VQK N;  1KVA A;  3GOI A;  2QW9 A;  1LV5 A;  4BE0 A;  1TKZ A;  3R1X A;  1YVN A;  2HF3 A;  3SZ2 A;  1R0A A;  4CFA A;  3OTO K;  2RKI A;  3EYZ A;  5LY3 A;  4DQR A;  5C10 A;  2W42 A;  1NGJ A;  5HRP A;  4DV5 K;  1NBW A;  5DM6 L;  1GOB A;  1LAV A;  3ITH A;  4CJ5 A;  4AH9 A;  4BC5 A;  5KQD A;  2UUA K;  1QS4 A;  4BG9 A;  3TSU A;  4JI5 K;  5DMR A;  1ATN A;  3ZT3 A;  2X78 A;  2ZE2 A;  5TKY A;  2O4G A;  4BR4 A;  3AA4 A;  3JXU A;  4H4M A;  1VAZ A;  1FK9 A;  1QQO A;  3SUN A;  3IFR A;  3TSP A;  4G1Q A;  4BE1 A;  1Y64 A;  1UAX A;  4KO0 A;  5HRO A;  4CI6 A;  4Z4I A;  3KK2 A;  3AVA A;  5HRS A;  4OLB A;  5AQY A;  3AO2 A;  4F9O A;  3KLH A;  1VSH A;  4H5R A;  1XMO K;  5AJ3 K;  2JWL A;  2OPR A;  1XNR K;  4JKH A;  3L2U A;  3O1W A;  4CJT A;  3OS1 A;  3L4Q A;  3W3D A;  4F8R A;  1UWB A;  2QM1 A;  3TAR A;  3J7Z O;  4DG1 A;  3IAY A;  3M6G A;  4CFB A;  1KSP A;  4DQP A;  4CJ4 A;  1WBB A;  4FL9 A;  2AJQ A;  3AVI A;  3OYG A;  3ULD A;  3MXM A;  4J2A A;  1JLA A;  4YDU C;  5C15 A;  4DV0 K;  3EL2 A;  4YOV A;  2KQ2 A;  4O0I A;  3CPE A;  1IBL K;  3AVH A;  2PZS A;  3OYD A;  4AF1 A;  4ISF A;  2E4L A;  5FRO A;  4M42 A;  1CLQ A;  1TK0 A;  5AQK A;  1D5A A;  3AV9 A;  2DFH A;  2WON A;  4K0K K;  2ATQ A;  3MEE A;  4B3T K;  3Q7C A;  4FK2 A;  4DQS A;  1DKG D;  3EY1 A;  3TTC A;  1VQ6 N;  1HKG A;  4IOX A;  4CZM A;  5FPD A;  2PAV A;  1HR0 K;  5BRE A;  4PHT X;  4FLY A;  2B5J A;  4TSX A;  5KGW A;  2NUB A;  5C42 A;  1XHX A;  4H0X B;  1TYQ B;  3E9P A;  4K8Z A;  2PYL A;  3QNO A;  4LH4 A;  4OVL A;  3OS2 A;  4M3X A;  3OJS A;  2KFN A;  4DLE A;  3C6A A;  1IKW A;  4OJR A;  2F8S A;  1RDW X;  3K0S A;  2X6S A;  1NJY A;  1NGD A;  1A5X A;  3OBY A;  1VSF A;  2UXD K;  1T05 A;  3OA9 A;  4IFV A;  1HYZ A;  2RN2 A;  3BP8 A;  4BG8 A;  1HQU A;  4BRD A;  1SL2 A;  1O1W A;  3PIP L;  1BO5 O;  5LMN K;  4Y1C A;  2IOC A;  2E8A A;  2G8H A;  4LSN A;  5C0Y A;  1HLU A;  3V9X A;  3QB0 A;  3KKR A;  4CJF A;  2RF2 A;  4CBX A;  2UUB K;  3SK3 A;  5AQI A;  5JLF A;  3OYJ A;  2GWK A;  4M3U A;  2D5R A;  5AQS A;  3O6W A;  1NK0 A;  4ID5 A;  4HWI A;  1N5Y A;  4BRP A;  4YOX A;  4M63 C;  3QIO A;  3DRS A;  2QA4 N;  2XY7 A;  3LP0 A;  3M8R A;  2BDP A;  3KIO A;  1GOC A;  4FWL A;  4DTR A;  4E3S A;  4UY8 O;  4FLU A;  2P9U A;  1TUY A;  1ZBU A;  1CZB A;  1BDG A;  3SAH A;  3DXM B;  3C94 A;  1ZBS A;  2E6M A;  3CCE N;  1NK5 A;  4X62 K;  1WSJ A;  1A5W A;  1W97 L;  1BI4 B;  4FWM A;  3E1Y A;  4N56 A;  1WUA A;  1HYV A;  4AHU A;  4B9U A;  2WC9 A;  1EET A;  5I3U A;  4QS9 A;  2KKZ A;  3QER A;  3WXM B;  3ZSY A;  5FRM A;  4DTU A;  5KPR A;  1GLD G;  2KFZ A;  5AQW A;  1N33 K;  1FW6 A;  5CR4 A;  2I7P A;  4OGE A;  4XH5 A;  4HTU A;  3SPY A;  4LF4 K;  2D0C A;  1M90 O;  2Q31 A;  3LAK A;  4N5S A;  1RDA A;  4EAH D;  4AM6 A;  4DV7 K;  1YXQ A;  4Z4E A;  2E20 A;  4O4G A;  1YVU A;  5BPM A;  5AQP A;  1LWF A;  4JAX A;  2QXF A;  2ZQB A;  1HNW K;  2NRH A;  3ZSZ A;  1JLQ A;  1U49 A;  1SUQ A;  3VQ8 A;  2QKB A;  1LOT B;  3IMX A;  4F3T A;  3S41 A;  3ZSW A;  4CF2 A;  4AHT A;  3MXI A;  4AHR A;  4CZF A;  2DFF A;  3HP6 A;  2EX3 A;  3CET A;  3OYF A;  3VQP A;  3ZT1 A;  1NK7 A;  5JVH L;  4FJ7 A;  1HNV A;  3O08 A;  4B1V A;  3TAN A;  3HL8 A;  1YT3 A;  3CJA A;  3ZX3 A;  4BGB A;  1YTU A;  5GAE P;  4NXM K;  4PKH A;  2GWJ A;  4L8R B;  3ZSR A;  3DXK A;  3ATV A;  4OPK A;  4A57 A;  1M1K O;  2G8K A;  3W0L A;  4LD0 A;  3SPZ A;  1S3X A;  3P4I A;  2VYP A;  1YAG A;  3TAG A;  1BHL A;  3F73 A;  1C1C A;  1S22 A;  4FM2 A;  4JYA K;  3PLA A;  5J1E A;  3VQ4 A;  3VEN A;  1SQK A;  4DB3 A;  4RG8 A;  3EE8 A;  4JK9 A;  2PY5 A;  1WN7 A;  2QXL A;  2YI1 A;  3SBT A;  1WLJ A;  2GUP A;  3KJV A;  3MED A;  1GLB G;  3RMC A;  4JNE A;  2IDO A;  4DQ8 A;  2HHT A;  2DY4 A;  1YIT N;  2JGU A;  1WSG A;  2G8I A;  3G4S N;  3AVL A;  1OVQ A;  4EHT A;  4DTJ A;  3CHW A;  4CHN A;  3KD5 E;  3HST B;  4ICL A;  4DSJ A;  3KLG A;  3A5O C;  4FCY A;  3V9S A;  1IJJ A;  3MMV A;  3L3V A;  4PL7 A;  1NGF A;  3NBP A;  4YFU A;  1QQN A;  1RDD A;  2Z1G A;  4A2B A;  3EE9 A;  4WF9 L;  4C1N I;  2HNZ A;  4DSF A;  4YOU A;  2YV0 X;  3O8M A;  3UKU A;  5KRS A;  4B3M K;  1C0U A;  4CZJ A;  4LF9 K;  1G99 A;  1BCM A;  1LW0 A;  4FWR A;  4DWI A;  3CC2 N;  2HBK A;  2ZGZ A;  1UA0 A;  1NG9 A;  3THV A;  3CJB A;  5F2R A;  5FDL A;  5B8H A;  4CGI A;  3LAN A;  5KQ8 A;  3T1A A;  3CJ1 A;  1ASV A;  2HBM A;  3SCX A;  1HMV A;  2VG5 A;  3D45 A;  5D3G A;  3TSQ A;  4QS8 A;  1DEJ A;  3DYA A;  4JKF A;  3AGK A;  2V51 B;  3RVC A;  1N6Q A;  3I0R A;  2KTQ A;  3B6P A;  3FE1 A;  1NKC A;  4KKO A;  3N4Q A;  2GV9 A;  4C8M A;  3VEO A;  1IO2 A;  3MN7 A;  3TTF A;  1RBR A;  2E1Z A;  4DFP A;  3H46 O;  3NCI A;  3DLR A;  5M1K A;  3VQ9 A;  1KC8 O;  2WUS A;  5TKW A;  3VQ5 A;  4JN4 A;  3VQD A;  3DLH A;  4CBW A;  1SS6 A;  5CYM A;  4N76 A;  4FWO A;  1EO1 A;  3CFP A;  3B8A X;  1JL2 A;  1KCF A;  1VSI A;  1HKC A;  1ZBH A;  3EO3 A;  1BGX T;  3V6D A;  3ZEU A;  2BTF A;  3J8A A;  1CXQ A;  3AO3 A;  4YOW A;  3KK7 A;  3O3H A;  3HK2 A;  3RMB A;  1V4T A;  3HXM A;  1C0T A;  3QEX A;  4FJ5 A;  2HHV A;  1ATS A;  2O8C B;  3THX B;  2QWM A;  2VWB A;  4A2A A;  5KGX A;  4DV1 K;  4C8O A;  4YOT A;  4CEQ A;  3CF5 L;  1KVB A;  3HO1 A;  5AQO A;  1JL1 A;  4JKE A;  3VOV A;  4DR1 K;  3V1Q A;  5SZT A;  4DFM A;  3BF1 A;  1KAZ A;  2A40 A;  2NRZ A;  2YNF A;  2Y1J A;  1YIJ N;  3OYK A;  2OPS A;  3H08 A;  2IAJ A;  4IKF A;  1VRU A;  1BOT O;  1REV A;  3WNH A;  3P83 D;  3DLE A;  3L6Q A;  5AQQ A;  5C25 A;  4CJQ A;  4KI4 A;  1VSJ A;  3UE5 A;  4LH5 A;  1DT9 A;  5HLF A;  2HF4 A;  4FWQ A;  4O5B A;  1RNH A;  3VTH A;  5EOY A;  2A5X A;  5BRH A;  3CI5 A;  2E2Q A;  3P1G A;  1Z6R A;  3RSE A;  4B1Z A;  4K25 A;  4MDB A;  2F4V K;  2F9T A;  2ZGY A;  4FJK A;  3H1Q A;  3VQB A;  3OY9 A;  3QET A;  3VER A;  2UXB K;  3SAG A;  1ASU A;  3VTI A;  3ENH A;  1UOC A;  3TI0 A;  1JLB A;  4CGF A;  3HM8 A;  3LP1 A;  4JKG A;  1KRP A;  1NGH A;  1VK0 A;  3OYA A;  3OYN A;  4B1Y B;  3M3Z A;  3PSI A;  2JWK A;  4KFB A;  3BUZ B;  3ZLJ A;  1Q8I A;  1HX1 A;  4B9V A;  2VQE K;  3RTV A;  4U67 L;  3LZI A;  3HRG A;  3KLI A;  2HHX A;  3O3G A;  4IG0 A;  5BN9 A;  3L2R A;  1JJ2 M;  1RFQ A;  3KLE A;  4GKJ K;  3LPU A;  3QO9 A;  2GBZ A;  2FSK A;  3I8D A;  1C0F A;  1S9G A;  3AVF A;  3LDS A;  4RW8 A;  3BZK A;  1Z25 A;  2HMI A;  5AQU A;  1VHX A;  3SLC A;  1EWR A;  2W6L A;  2KLA A;  1TGO A;  4F2S A;  4BRM A;  4MO4 A;  4NLB A;  1LW2 A;  2QWN A;  1BQN A;  1NJI O;  4DQI A;  4KBO A;  4WCE L;  1BA0 A;  3VGL A;  4O44 A;  2WFB A;  3NH2 A;  4EZ6 A;  2E5L K;  1Q82 O;  4Z4F A;  4BRE A;  3AO5 A;  3K58 A;  1VQ7 N;  3ENB A;  1E3M A;  4GVM A;  4MQ3 A;  3AA2 A;  1RBS A;  4CJR A;  4ILG B;  3VEY A;  3BDP A;  4I6M A;  4EP4 A;  1D9F A;  4CZE A;  1BU6 O;  1S1T A;  3L8B A;  3QML A;  2YNG A;  3V9W A;  3FZH A;  5LJW A;  4FXD A;  4WFB L;  1U45 A;  4FJG A;  1QZ6 A;  4CZL A;  4BRH A;  5MLC Q;  2HB5 A;  2HOE A;  4JI0 K;  1VSD A;  3LDO A;  5M1O A;  1QQM A;  4A59 A;  4FWK A;  1P8Z A;  1T8E A;  1I3A A;  4YOY A;  3V9Z A;  3HZ6 A;  3KVG A;  4IEI A;  3P31 A;  4CIG A;  2ZJR L;  3HYF A;  3TAB A;  4CJ7 A;  4YY3 K;  5JS2 A;  4JI8 K;  2NRV A;  5AQN A;  4B9N A;  2CH6 A;  4I2P A;  4OKK A;  4O0J A;  3QDK A;  4CZH A;  3V9U A;  4BQZ A;  1E4F T;  1J6Z A;  4GV9 A;  3EKS A;  3VA0 A;  3C7N A;  1HJO A;  1YUW A;  2WOM A;  4CJP A;  4DR7 K;  3O9U A;  1LWE A;  5C24 A;  4M3Z A;  3C0B A;  4E89 A;  4CFD A;  4H0O A;  1SL0 A;  5KPT A;  2BUP A;  2EHG A;  4FZX C;  4FOI A;  4JRQ A;  2AP1 A;  4H0Y B;  4AHC A;  4LF6 K;  1IG9 A;  3G71 N;  2NRR A;  3D7E O;  3Q7B A;  4FLW A;  1EXQ A;  4JRP A;  1KTQ A;  4RW7 A;  1J5O A;  4ELT A;  3RRG A;  4JK8 A;  5E41 A;  3UKU B;  2HBL A;  1X9J A;  3ID6 A;  2QWQ A;  4DMN A;  1L3U A;  1TKT A;  4W5Q A;  1YF5 L;  2NRX A;  2FF6 A;  3CM6 A;  3MCA B;  2X74 A;  3NGZ A;  1N36 K;  4KI6 A;  3FZF A;  3LWM A;  4W5R A;  1BUP A;  3FZL A;  4CGD A;  3EZW A;  3SQ0 A;  2G8F A;  2QWP A;  3E9L A;  4CZG A;  1VQN N;  1QE1 A;  1Q81 O;  3FZM A;  4HVJ A;  5J2M A;  4XH4 A;  1P90 A;  1RTJ A;  1MU2 A;  1NU0 A;  4JI2 K;  4CHO A;  5H1S Q;  2FXU A;  4Z4C A;  2O8D A;  3SQ2 A;  4DTP A;  1BL3 A;  3CQ8 A;  4FJH A;  3D0P A;  4IFY A;  4LFB K;  5GIN A;  4KH4 A;  3ULE B;  2KHO A;  3ZYY X;  5ADX H;  4QOZ B;  1H1V A;  1NGB A;  1JCG A;  4F3O A;  4BR9 A;  3ZEU B;  4KTZ A;  3M8Q A;  4K43 A;  3K9J A;  1IG8 A;  1QZ5 A;  1VQ8 N;  3UIQ A;  1RT3 A;  2ZWH A;  4B8C A;  4KH5 A;  5KPZ A;  1HJR A;  5K14 A;  4CD1 A;  5CHI A;  1L5U A;  4KTQ A;  4YNQ A;  1NGI A;  5J2P A;  3H3O B;  3C6H A;  4R79 A;  2J4R A;  1W7A A;  1GLL O;  4KHW A;  1RIL A;  2ASM A;  4ISE A;  3QEI A;  4DKW A;  4JKC A;  3AAP A;  3O80 A;  1WSF A;  3SUO A;  1R59 O;  4JV5 K;  1LWC A;  4MDA A;  4M3W A;  4DV3 K;  1KD1 O;  1XQS C;  4QCL A;  1NK8 A;  4AM7 A;  4JK7 A;  3IS9 A;  2CGJ A;  2NNW A;  5AQM A;  4YDU A;  3SI6 A;  1VQ5 N;  3E9O A;  3WXJ A;  1XC9 A;  4E7K A;  3SQ1 A;  4LFA K;  2JLE A;  4FW1 A;  5BRF A;  3AVG A;  2ZD1 A;  4FJM A;  1KAY A;  4C1N K;  1U4B A;  1VQ4 N;  5HP1 A;  4H03 B;  3FFK B;  2IC3 A;  3GE1 A;  4M41 A;  4CGH A;  3RSE B;  2BE2 A;  4DQQ A;  2KZM A;  4CGJ A;  1TUU A;  1VQ9 N;  4BRF A;  4FJL A;  1HRH A;  4Z4H A;  3PSF A;  4EZ9 A;  1S1X A;  2A42 A;  2P9N A;  2CH5 A;  3HJF A;  4CF1 A;  4F2R A;  2HVH A;  3VPZ A;  3CCJ N;  4CEF A;  4GV6 A;  1C0G A;  4RTF D;  5KRT A;  2OPQ A;  2NLX A;  2A3Z A;  4JKG B;  5EVZ A;  3FFI A;  4B9T A;  4BRC A;  1D9D A;  3CFO A;  1IKX A;  4WQ4 C;  1IKV A;  3RMD A;  2E2P A;  1TAU A;  1LCU A;  3NGY A;  3ZX0 A;  4X64 K;  3N4P A;  1J9A A;  2ZM6 K;  3VQA A;  3NF6 A;  3QLH A;  1C1B A;  2YKN A;  1JLE A;  1NJZ A;  3WQT A;  3T1H K;  3OJU A;  3V81 A;  3CG7 A;  1UA1 A;  3VQ6 A;  2YKM A;  4H0P A;  2RPI A;  4MLH A;  3PX6 A;  1RBU A;  3ZT4 A;  3IRX A;  3A5M C;  4FVM A;  1KAX A;  4NXN K;  3VQQ A;  3CME N;  5FPM A;  4BDY A;  2KW4 A;  4BVO A;  3DMJ A;  3OVN A;  1CXU A;  2Q0U A;  4DTS A;  3DM2 A;  4CK3 A;  4RW6 A;  4BE2 A;  4Z0U A;  3CC7 N;  2D0O A;  4CJW A;  4FJX A;  1BQM A;  4WQ5 C;  1VSE A;  4FWS A;  3LM2 A;  5AQL A;  3SQ4 A;  5GAH P;  3WUH A;  2VGM A;  3VF2 A;  4I6M B;  5AQZ A;  4K42 A;  3HTV A;  4FK4 A;  3CCS N;  4N47 A;  5AQH A;  4BC3 A;  3MN9 A;  1MWM A;  5GIO A;  4KHU A;  4NCB A;  1RT2 A;  4IJN A;  4PA1 A;  1WB9 A;  3THW A;  4M7X A;  5AZI A;  3BY5 A;  4JI3 K;  2NZT A;  3WNG A;  3IG1 A;  3ZX2 A;  5AQT A;  4AQY K;  1ZYQ A;  5AFU H;  3TAM A;  3JAM O;  1NJW A;  1RDU A;  2FBX A;  2BAN A;  5EU7 A;  5BPN A;  2D1K A;  4E7L A;  4HCC A;  4FJJ A;  4CEE A;  1WNS A;  2Z1I A;  3U6F A;  3TPQ A;  4K8X A;  4X65 K;  4H5T A;  4GV3 A;  3NE6 A;  5A2Q O;  2Y1I A;  1YJW N;  2NRT A;  4NYF A;  2Q2R A;  3HPG A;  3D2F A;  4DLG A;  4KPY A;  2A1S A;  1HPM A;  2ZF5 O;  4B9S A;  3C7N B;  4Z4G A;  3MWT A;  1IBK K;  3QIP A;  3R3L A;  2D4W A;  4EFH A;  3PO5 A;  2HHW A;  2FBT A;  2OA8 A;  3K57 A;  2F96 A;  3C6T A;  3T1Y K;  3E66 A;  4JKD A;  1KQS M;  1S6P A;  4DV4 K;  4FWN A;  3QBW A;  3QNN A;  3AGR A;  3KHY A;  5JS1 A;  1U2V A;  4GW6 A;  4QS7 A;  2A41 A;  5M1F A;  4ID1 A;  1T03 A;  1JXB A;  3UKR A;  4CFC A;  3DI6 A;  2P1J A;  4BRA A;  2QK9 A;  2YHX A;  1NKE A;  5ELZ A;  4FJ8 A;  1BG3 A;  4BRK A;  5BR8 K;  2QEX N;  4FZZ A;  4FK0 A;  3ZET A;  2A6A A;  4DS5 A;  4LF5 K;  4PY5 A;  2V52 B;  3V4I A;  4NCA A;  4DSI A;  3ALY A;  1IKY A;  5SWM A;  3TAQ A;  1Q9Y A;  2QTD A;  3U9D A;  3D2E A;  4CJE A;  4AIL C;  4DTM A;  3K2P A;  3I33 A;  2O8B A;  3MWP A;  2GUI A;  1NLV A;  5BRD A;  5T7B A;  1Y97 A;  2P51 A;  2H3G X;  2VCP A;  1GLA G;  3DRR A;  3THY A;  1DGK N;  2D0A A;  3F9M A;  4M3Y A;  4OPA A;  3G6E N;  1HQE A;  5DK5 A;  4PKI A;  1FJG K;  4BGA A;  3LWL A;  1HYS A;  3NH0 A;  4H5N A;  1RT6 A;  3S9H A;  5DM7 L;  4FJN A;  2E2O A;  4J2B A;  3QEW A;  3AA5 X;  4ELV A;  3O4Q A;  2OTL N;  3NF7 A;  1NJX A;  4PWD A;  3I56 N;  4DUY K;  5AFU A;  2VG7 A;  1TK8 A;  3MK6 A;  3DLL L;  3QES A;  1V4S A;  1JLF A;  4IO9 L;  1GLJ O;  4CBU A;  4IBN A;  4BVP A;  4BQL A;  3O3F A;  2HHU A;  5F1X A;  1IV0 A;  3NVK A;  4HUG A;  3MN5 A;  4B9Q A;  1RT1 A;  1LAW A;  1BWF O;  1RT7 A;  5CE3 A;  3SAF A;  1KFS A;  1ILY A;  3PIO L;  4B1X B;  3QIC A;  5BPL A;  3KLF A;  1RT4 A;  1QSL A;  4PQU A;  3OYL A;  3NGI A;  3OYM A;  4GKK K;  1X9W A;  4FM1 A;  1XUP O;  4CZI A;  4FPA A;  3ISN C;  2YCH A;  1SKR A;  3MDQ A;  4CEB A;  2IVO A;  2FC0 A;  4M3T A;  4FYD A;  3VEV A;  3BGR A;  5AZJ A;  4IO8 A;  2FSN A;  4CK2 A;  4B3O A;  4CJV A;  2D0P A;  3VN5 A;  1XC3 A;  3VQE A;  4C23 A;  4C8K A;  4LF8 K;  2E6L A;  3S3O A;  3NH1 A;  3KK3 A;  3JS6 A;  1K6Y A;  3L3U A;  2O8E A;  2VGN A;  2P9U B;  3UB5 A;  3HPH A;  4YHH K;  1SZ2 A;  3DLB A;  3CJ9 A;  4FWP A;  5AR0 A;  2XHB A;  2HBJ A;  2P5O A;  3T69 A;  1T44 A;  1TK5 A;  3SMS A;  1B9D A;  3LAL A;  2A1R A;  5M1N A;  4J2D A;  2XY8 A;  3NFA A;  3KWI A;  1NMD A;  4JKA A;  1KXP A;  3ATU A;  3PX4 A;  4DSL A;  4KHN A;  1F21 A;  5F0X A;  1TKD A;  4KB0 A;  2W6K A;  2IVN A;  1NGE A;  3WNF A;  3CC4 N;  3AO1 A;  1TV6 A;  5EX5 A;  3VA3 A;  3IKM A;  5HL7 L;  2P9N B;  4CEZ A;  3VF4 A;  4DU1 A;  1U48 A;  1HUX A;  2IGI A;  2YX6 A;  4H0V B;  2HHH K;  4HUF A;  4CJL A;  4CER A;  4CHY A;  4JEP A;  4IDK A;  2G8U A;  5BN8 A;  3RWU A;  5FRN A;  5I42 A;  2P9K A;  2O8F A;  3PV8 A;  4WFN L;  2EWS A;  2QWL A;  3F2K A;  3CQX A;  3J7Y P;  4E7I A;  3IUC A;  3L2Q A;  4CHZ A;  4KHY A;  2Z1H A;  3G0Z A;  3ZSQ A;  1WSH A;  1ZBF A;  2G8W A;  1GLE G;  4ELU A;  2Z1J A;  4RW4 A;  4BC2 A;  4OKE A;  1OH7 A;  4OPJ A;  1QHT A;  4IEE A;  4AHV A;  3J7A P;  3LDP A;  4XEI A;  1K73 O;  4BY9 C;  4BRQ A;  1QVG M;  4IDH A;  3DOL A;  4CED A;  1D4X A;  2GX9 A;  2YNH A;  4CJ3 A;  1HNI A;  4CHP A;  5AQJ A;  3U3G A;  1FKP A;  1O13 A;  3AY9 A;  2P9S A;  2F7T A;  5E26 A;  1EKE A;  1X3M A;  3VEZ A;  3DXK B;  3QIN A;  5AQX A;  4FPB A;  1YJ9 N;  3VES A;  2QWR A;  4FLV A;  2XY6 A;  2P9L A;  3C6U A;  3MEC A;  3KZB A;  2HMP A;  2WBN A;  3NMU A;  4E7J A;  3LP3 A;  3AVN A;  4CK1 A;  4O5F A;  2HW3 A;  5KI6 A;  3O9R A;  2XO7 A;  3L2V A;  4KB1 A;  4IWV A;  4NO7 A;  2YJE A;  3THW B;  5IT9 O;  5AZI B;  4B9L A;  5JIC A;  4LFC K;  1QSY A;  4X66 K;  2QI2 A;  3WEE A;  3RMA A;  4O8U A;  3O5B A;  3OHR A;  3QFP A;  3HSC A;  1Z05 A;  4CF8 A;  1D8Y A;  1B9F A;  4CF9 A;  3DWL A;  4LY7 A;  4BRN A;  3M8P A;  4MFB A;  1RBV A;  3OBW A;  5CZ1 A;  4JI7 K;  1OVY A;  5C2D A;  5M1Q A;  1VSM A;  4V19 S;  4BR7 A;  4DR4 K;  2P5G A;  1S5J A;  3D2F B;  4JD2 A;  3CCQ N;  2UU9 K;  2OTJ N;  3O4W A;  1NGC A;  3T7Z A;  1S72 N;  3TR8 A;  4LF7 K;  4XH1 A;  1XWL A;  4KHP K;  1T3V A;  3AVB A;  4CF0 A;  5HBM A;  3HT3 A;  4KHS A;  4CJU A;  4GY2 B;  4HUE A;  1VSL A;  1BIU A;  2YHW A;  4IJA A;  3ZSV A;  4FLT A;  3ASM A;  3BEX A;  1RTI A;  3SJH A;  1EP4 A;  4BRO A;  1CZ9 A;  2IIR A;  3ZT2 A;  1X9S A;  1U2V B;  3CCR N;  3LM9 A;  2Q36 A;  3VQC A;  4HTL A;  1U47 A;  2I5J A;  3UKR B;  3SMP A;  3V1R A;  3M8S A;  1X1P A;  3R6M A;  4FLX A;  3VGK A;  3M1F A;  1RTD A;  1L3T A;  3CJC A;  3TWH A;  4DUZ K;  1NKB A;  4DV6 K;  4BRG A;  4DTX A;  4I2Q A;  3ZET B;  4BR5 A;  4WFA L;  3L2W A;  3NAE A;  1WAJ A;  4GMJ B;  2DTU A;  1QSS A;  1J53 A;  5FPE A;  4R5P A;  3SV4 A;  3D2E B;  2HVI A;  3H3N O;  2ETJ A;  1SKW A;  2KZZ A;  2FF3 B;  2O8B B;  4O55 A;  4BC4 A;  4IG3 A;  5LJV A;  4M45 A;  3RRH A;  3CIP A;  1QHA A;  3K9K A;  1RDC A;  5EY4 A;  2CGK A;  1Q9X A;  2V7Z A;  3THY B;  4FO0 A;  1CZA N;  4PUO A;  1W9H A;  3WXI A;  1HNZ K;  1MA9 B;  3C65 A;  3MN6 A;  3ZSX A;  4FJI A;  2O8C A;  2GTD A;  1J54 A;  2P9I A;  4Y0W A;  3THX A;  1XNQ K;  2E1Y A;  3CCM N;  2R7Y A;  2HHS A;  3P38 A;  3JSM A;  1OH8 A;  4ILJ A;  1K8K A;  3LL3 A;  2IS3 A;  3OYE A;  4CIF A;  3G25 A;  3A8Y A;  4Q5V A;  3KKS A;  2UXC K;  4FJ9 A;  3KWG A;  1RT5 A;  4IFE A;  1E4G T;  3MX2 A;  4PL8 A;  1VQO N;  4HHT A;  1Q86 O;  2ASO A;  4CEO A;  2XY5 A;  4BDZ A;  3D6R A;  3SUP A;  2I7N A;  1FKO A;  1NK4 A;  4E0D A;  4BR0 A;  4J8F A;  4ZTJ A;  2FLO A;  3MCP A;  2WTU A;  4C8L A;  4CCH A;  2GEM A;  1NMN A;  2O4I A;  4FW2 A;  2OAN A;  2VQF K;  1W0H A;  2Q1N A;  5AZJ B;  3GG4 A;  3MEG A;  3B6O A;  4JS5 A;  1JCF A;  1Q18 A;  2OCE A;  3F9K A;  3NDK A;  4DSE A;  3QFU A;  4CE9 A;  4CJK A;  4H5W A;  3K5M A;  5JVG L;  2O8E B;  1RBT A;  1KLN A;  2W41 A;  1QTM A;  4RWT A;  3J80 O;  3R8E A;  4CD3 A;  1W2B M;  4JS4 A;  3ZSO A;  4FOE A;  1S1W A;  3FGU A;  1WAF A;  1NWK A;  4DF4 A;  3KD1 E;  4BWM A;  3WXK A;  4CJS A;  4CES A;  5J2Q A;  4H4O A;  4HCB A;  3M5R A;  1KLM A;  1NGA A;  1T6D A;  3CPW M;  3OS0 A;  1RCH A;  2P9P A;  3SNN A;  1G15 A;  4GNI A;  1C1A A;  2VG6 A;  1TL1 A;  4BRL A;  1DTT A;  3O1B A;  4KTW A;  2PFU A;  1K8A O;  1S1V A;  1ESV A;  1JCE A;  1FXX A;  3L0Q A;  3DAW A;  3GDQ A;  5AQV A;  5J2N A;  4H5V A;  4DR5 K;  1VSK A;  4JHD A;  4G9Z A;  5I9E B;  1SAZ A;  5ADX A;  4DR2 K;  4E1N A;  1MWK A;  4XIU A;  4DFJ A;  4H0T B;  2X6N A;  3OYC A;  1C0M A;  4ISG A;  3WQU A;  2P9K B;  4OO1 J;  2O8F B;  3O9T A;  3MAQ A;  5M1P A;  2FBY A;  1HPZ A;  1S9E A;  1KFD A;  4M7Y A;  2Q0R A;  4BRI A;  3BF3 A;  5BR9 A;  3OYH A;  1EQY A;  3K5L A;  3CCL N;  1WOQ A;  3DLG A;  3R9P A;  4CW7 B;  4IZ9 A;  4BAC A;  3I55 N;  1OH6 A;  1MDU B;  2E88 A;  3C95 A;  2YHB A;  4A5A A;  4ZHR A;  1JLC A;  3CQY A;  2E2N A;  1ZC6 A;  3V1O A;  5HRN A;  1K9M O;  2PYJ A;  1WSE A;  2BH1 A;  1ZBI A;  1XI1 A;  3S3M A;  4A62 A;  3PO4 A;  4CGG A;  3VMF B;  3OYI A;  4DS4 A;  4I7F A;  3A5L C;  2HST A;  4FM0 A;  1ZBL A;  3SBG A;  4JLH A;  3J81 O;  3CXC M;  1QVF M;  4C8N A;  4CEC A;  4B8A B;  1OKJ A;  3FZK A;  3K59 A;  3K5N A;  3ZCM A;  2NRW A;  2P9S B;  2UYT A;  5CY4 A;  4DCH A;  4B08 A;  2DPN A;  4DTN A;  4A5B A;  1RDB A;  3H1V X;  3VQ7 A;  3FR0 A;  4NB4 A;  4UQG A;  3LPT A;  4E1J A;  1WSI A;  3ENO A;  1J5E K;  1L3S A;  3DOK A;  3WXL A;  2OZM A;  1BCO A;  2P9L B;  1A5V A;  4DFK A;  3AVC A;  4DR3 K;  1NK6 A;  1HNX K;  4KRE A;  2ZJQ L;  2B6A A;  2RE2 A;  3SJJ A;  1NNE A;  1VQP N;  4WQ4 A;  1U04 A;  5KTQ A;  1RTH A;  1QQC A;  5C12 A;  3CCV N;  3LP2 A;  2HNY A;  4O8K A;  1L3V A;  4OX9 K;  3GBT A;  3WEE B;  1NGG A;  4EHU A;  2OYQ A;  4BR2 A;  3PX0 A;  3DJC A;  1DTQ A;  5HRR A;  1GOA A;  3ZT0 A;  3DRP A;  4RW9 A;  4NCG A;  3EZ5 A;  3E01 A;  4ILH A;  4E7H A;  3TAP A;  4W5N A;  3CFR A;  3O9Q A;  1I39 A;  4JD2 B;  1YHQ N;  1NK9 A;  3AO4 A;  3L4I A;  3HVR A;  2DFE A;  4CHQ A;  1YJN N;  2HND A;  3QEP A;  4W5T A;  1SKS A;  3LDQ A;  4Z94 A;  3HPO A;  4DU4 A;  3BZC A;  1VQL N;  5CYQ A;  4DTO A;  3U8X A;  1EWQ A;  3CCU N;  1RGI A;  3AVJ A;  2VWJ A;  3TAF A;  4WQ5 A;  3KTQ A;  1VQM N;  4N41 A;  3PY8 A;  4WE1 A;  3VF6 A;  3AVM A;  2F9W A;  1YTA A;  2YJF A;  5C2F A;  3CJ7 A;  3PUF A;  1NM1 A;  3AA3 A;  2ITG A;  3CMA N;  4DHY A;  1TKX A;  1ZXO A;  5FLX O;  3CM5 A;  1BA1 A;  4LSL A;  4J2E A;  4H8K A;  4DR6 K;  3OW2 M;  1SV5 A;  4DU3 A;  3NF9 A;  3AAR A;  3SYZ A;  3SUQ A;  1JLG A;  2YHY A;  5GAD P;  4E19 A;  4IOA L;  4FZY A;  1TYQ A;  3GL1 A;  3AVK A;  2O8D B;  1WBD A;  3H45 C;  3DLK A;  1IBM K;  1N8R O;  1SL1 A;  3LZJ A;  3TU5 A;  1Z26 A;  3A2F A;  3AAQ A;  3ULE A;  2RHK A;  4JI4 K;  3TAE A;  3WNE A;  2XRI A;  1ASW A;  5E84 A;  4LC9 B;  4I9L A;  4B1U B;  1BIZ A;  3I8B A;  1T7P A;  4OPH A;  4M3R A;  2P9I B;  2QWO A;  2GEL A;  4EP5 A;  1VRT A;  4IXC A;  2B4J A;  3EN9 A;  1BIS A;  4ZTF A;  1K8K B;  3RR8 A;  2LSN A;  4FSV A;  3VEW A;  1B92 A;  5EXW A;  1XMQ K;  1X9M A;  4FLZ A;  3HP9 A;  4NYN A;  4CEA A;  3H6E A;  4B9M A;  5CZ2 A;  2ZJP L;  2OPP A;  3LAM A;  3CYM A;  3A0I X;  2PBD A;  4E1M A;  1TAQ A;  1TVR A;  3I0S A;  4FVU A;  5IWA K;  4PKG A;  1KVC A;  2FBV A;  4CIE A;  3RR7 A;  2VWK A;  2ASP A;  2W40 A;  1T6C A;  4QAG A; 
#chains in the Genus database with same CATH homology
 4E7K A;  4CF8 A;  2G8I A;  3SQ1 A;  2YNI A;  3AVL A;  1D8Y A;  1B9F A;  4CF9 A;  2OZS A;  2JLE A;  4LY7 A;  4FW1 A;  3NHG A;  3M8P A;  4MFB A;  3AVG A;  1RBV A;  5CZ1 A;  2ZD1 A;  4DTJ A;  4Q0B A;  4FJM A;  4CHN A;  3HM9 A;  1VSM A;  3KD5 E;  3HST B;  1U4B A;  2P5G A;  4ICL A;  1S5J A;  4DSJ A;  5HP1 A;  3KLG A;  2IC3 A;  1BI4 A;  4M41 A;  4W5O A;  4FCY A;  3U3Y A;  3V9S A;  2F8T A;  4CGH A;  3L3V A;  3TR8 A;  4AHS A;  4YFU A;  2BE2 A;  3NBP A;  1XWL A;  4DQQ A;  1RDD A;  2Z1G A;  3AVB A;  3NF8 A;  4CF0 A;  4CGJ A;  2KZM A;  1NOZ A;  5HBM A;  3HT3 A;  4FJL A;  1HRH A;  4KHS A;  2HNZ A;  4DSF A;  4CJU A;  4HUE A;  1VSL A;  1BIU A;  2YV0 X;  4Z4H A;  5KRS A;  3ZSV A;  1S1X A;  1C0U A;  4OKJ A;  4FLT A;  4EZ9 A;  3ASM A;  4KV8 A;  3HJF A;  4CF1 A;  1BCM A;  1LW0 A;  4DWI A;  4F2R A;  1RTI A;  2HVH A;  3P5J A;  4CEF A;  1UA0 A;  3THV A;  5KRT A;  2OPQ A;  1S1U A;  5FDL A;  1EP4 A;  2BGG A;  1CZ9 A;  2HHQ A;  3ZT2 A;  3S3N A;  3G10 A;  1X9S A;  4CGI A;  3FFI A;  4BWJ A;  4B9T A;  3LAN A;  1D9D A;  3CFO A;  1IKX A;  3T1A A;  1IKV A;  1ASV A;  1IH7 A;  3VQC A;  3SCX A;  1U47 A;  3QEV A;  3RMD A;  1HMV A;  1TAU A;  2I5J A;  1XHZ A;  2VG5 A;  3D45 A;  5D3G A;  3V1R A;  3M8S A;  1TL3 A;  1X1P A;  4KRF A;  4FLX A;  3DYA A;  2QKK A;  3MXJ A;  3NGY A;  1RTD A;  1L3T A;  3TWH A;  1J9A A;  1NKB A;  1N6Q A;  3HVT A;  1DLO A;  3I0R A;  3T19 A;  3B6P A;  2KTQ A;  1NKC A;  4KKO A;  3VQA A;  4I2Q A;  4DTX A;  3NF6 A;  3QLH A;  2GV9 A;  4DSK A;  4OGC A;  4C8M A;  1C1B A;  3NAE A;  3L2W A;  1WAJ A;  1IO2 A;  2YKN A;  4I9Q A;  1JLE A;  4GMJ B;  4BDP A;  1NJZ A;  2DTU A;  1QSS A;  1C6V A;  1RBR A;  4DFP A;  3OJU A;  1J53 A;  3CG7 A;  4R5P A;  3NCI A;  3V81 A;  1UA1 A;  3DLR A;  3VQ6 A;  2YKM A;  3SV4 A;  1ITG A;  2RPI A;  3VQ9 A;  2HVI A;  3PX6 A;  2ETJ A;  1NOY A;  1RBU A;  3ZT4 A;  3VQ5 A;  1SKW A;  2KZZ A;  3IRX A;  3VQD A;  3DLH A;  4O55 A;  4IG3 A;  5CYM A;  4FVM A;  4N76 A;  4M45 A;  3VQQ A;  3RRH A;  3CFP A;  1JL2 A;  1KCF A;  1RDC A;  1VSI A;  3JYT A;  1Q9X A;  3KK1 A;  1ZBH A;  4BDY A;  4OLA A;  1BGX T;  2KW4 A;  3K5O A;  3V6D A;  4PUO A;  1W9H A;  3DMJ A;  1CXU A;  3OVN A;  4DTS A;  1CXQ A;  2YHA A;  3AO3 A;  3DM2 A;  3SV3 A;  3O3H A;  4CK3 A;  4RW6 A;  3QEX A;  3HXM A;  1C0T A;  4BE2 A;  3ZSX A;  4Z0U A;  3RMB A;  4FJI A;  1J54 A;  4CJW A;  4FJ5 A;  2HHV A;  4FJX A;  1BQM A;  2G8V A;  4DF8 A;  1VSE A;  3OYB A;  5KGX A;  2R7Y A;  1ZBI A;  3SQ4 A;  2HHS A;  3JSM A;  4KAZ A;  4C8O A;  3T3F A;  3O4N A;  4CEQ A;  2IS3 A;  1JKH A;  4CIF A;  3OYE A;  1EX4 A;  4FK4 A;  4Q5V A;  3KKS A;  1KVB A;  2D0B A;  4FJ9 A;  3HO1 A;  1S6Q A;  1RT5 A;  4N47 A;  1JL1 A;  1JXE A;  4Y1D A;  4F4K A;  3V1Q A;  5SZT A;  4KHU A;  4DFM A;  2Q3S A;  4NCB A;  4HHT A;  1RT2 A;  2YNF A;  2Y1J A;  4PA1 A;  3OYK A;  2OPS A;  4CEO A;  1KVA A;  3H08 A;  2XY5 A;  1LV5 A;  2IAJ A;  4BDZ A;  4BE0 A;  3WNG A;  3IG1 A;  1TKZ A;  1R0A A;  3SZ2 A;  3SUP A;  1ZYQ A;  4IKF A;  1FKO A;  3TAM A;  1VRU A;  1NJW A;  1NK4 A;  4E0D A;  1REV A;  3WNH A;  4CFA A;  2RKI A;  2FBX A;  2BAN A;  3DLE A;  3P83 D;  5EU7 A;  3EYZ A;  4DQR A;  4ZTJ A;  4C8L A;  4CCH A;  4E7L A;  4HCC A;  5C25 A;  4FJJ A;  4CEE A;  4CJQ A;  5HRP A;  2W42 A;  1WNS A;  4KI4 A;  2O4I A;  1GOB A;  1LAV A;  2Z1I A;  1VSJ A;  3ITH A;  3U6F A;  4FW2 A;  4LH5 A;  4CJ5 A;  4K8X A;  4AH9 A;  1W0H A;  3NE6 A;  1QS4 A;  5HLF A;  2Y1I A;  4NYF A;  3MEG A;  5DMR A;  3HPG A;  3B6O A;  4O5B A;  1RNH A;  4DLG A;  4JS5 A;  4KPY A;  3ZT3 A;  2A1S A;  3F9K A;  2X78 A;  2ZE2 A;  3NDK A;  4B9S A;  3P1G A;  2O4G A;  4DSE A;  4Z4G A;  4CJK A;  4CE9 A;  3AA4 A;  3K5M A;  1RBT A;  1KLN A;  4H4M A;  3HK2 A;  4QAG A;  1FK9 A;  3QIP A;  1QTM A;  3SUN A;  5FRM A;  4JS4 A;  4FJK A;  3ZSO A;  4G1Q A;  4BE1 A;  1S1W A;  2FBT A;  3VQB A;  2OA8 A;  3PO5 A;  3K57 A;  2HHW A;  3OY9 A;  1UAX A;  1WAF A;  4KO0 A;  4DF4 A;  5HRO A;  4BWM A;  3KD1 E;  2F96 A;  3C6T A;  3QET A;  4CJS A;  4CES A;  5J2Q A;  1ASU A;  4Z4I A;  1S6P A;  4H4O A;  3KK2 A;  1UOC A;  4HCB A;  3TI0 A;  1JLB A;  3AVA A;  4CGF A;  5HRS A;  4OLB A;  3AO2 A;  3KLH A;  1VSH A;  3QNN A;  1KLM A;  3LP1 A;  3OS0 A;  1RCH A;  1KRP A;  5JS1 A;  2OPR A;  4GW6 A;  1G15 A;  1VK0 A;  3SNN A;  3OYA A;  1C1A A;  2VG6 A;  3OYN A;  4ID1 A;  3L2U A;  4CJT A;  1TL1 A;  1T03 A;  1JXB A;  3OS1 A;  1DTT A;  4KTW A;  4CFC A;  3DI6 A;  1S1V A;  2P1J A;  1UWB A;  4F8R A;  2QK9 A;  1FXX A;  4KFB A;  3TAR A;  1NKE A;  4DG1 A;  3IAY A;  4CFB A;  1KSP A;  4DQP A;  4CJ4 A;  5J2N A;  1Q8I A;  4B9V A;  4FJ8 A;  2AJQ A;  1VSK A;  3AVI A;  3RTV A;  3OYG A;  3LZI A;  3ULD A;  3MXM A;  4J2A A;  1JLA A;  4FZZ A;  3KLI A;  4FK0 A;  4DS5 A;  2HHX A;  3O3G A;  4E1N A;  4IG0 A;  4PY5 A;  4XIU A;  4DFJ A;  4KHQ A;  3L2R A;  3V4I A;  4NCA A;  3KLE A;  2KQ2 A;  4DSI A;  3ALY A;  2X6N A;  1IKY A;  3LPU A;  5SWM A;  4O0I A;  3TAQ A;  1Q9Y A;  3OYC A;  1C0M A;  3AVH A;  2PZS A;  3OYD A;  3QO9 A;  2GBZ A;  4CJE A;  3I8D A;  4AIL C;  5FRO A;  2E4L A;  4M42 A;  1CLQ A;  1S9G A;  3AVF A;  3LDS A;  1TK0 A;  4RW8 A;  4DTM A;  1Z25 A;  3K2P A;  2HMI A;  3MAQ A;  1D5A A;  3AV9 A;  2FBY A;  1HPZ A;  1S9E A;  2DFH A;  2WON A;  1KFD A;  2ATQ A;  2GUI A;  3MEE A;  4FK2 A;  3OYH A;  4DQS A;  1TGO A;  4F2S A;  3K5L A;  5T7B A;  1Y97 A;  3EY1 A;  2P51 A;  3DLG A;  1LW2 A;  3DRR A;  1BQN A;  4DQI A;  2D0A A;  4M3Y A;  4O44 A;  4BAC A;  4FLY A;  2B5J A;  3NH2 A;  4TSX A;  1HQE A;  2NUB A;  5KGW A;  5DK5 A;  4EZ6 A;  5C42 A;  1XHX A;  3LWL A;  4ELT A;  3NH0 A;  3C95 A;  4Z4F A;  1HYS A;  2YHB A;  4ZHR A;  1JLC A;  4K8Z A;  1RT6 A;  2PYL A;  3QNO A;  4LH4 A;  3S9H A;  3V1O A;  5HRN A;  4OVL A;  3AO5 A;  3K58 A;  4J2B A;  4FJN A;  2PYJ A;  3QEW A;  3OS2 A;  3AA5 X;  1WSE A;  4ELV A;  3O4Q A;  4GVM A;  4MQ3 A;  3AA2 A;  1RBS A;  1XI1 A;  3NF7 A;  1NJX A;  3OJS A;  3S3M A;  4DLE A;  4CJR A;  4M3X A;  4PWD A;  2KFN A;  1IKW A;  4OJR A;  2F8S A;  3PO4 A;  4CGG A;  3BDP A;  2X6S A;  2VG7 A;  1TK8 A;  4EP4 A;  1NJY A;  1A5X A;  3OYI A;  1VSF A;  1S1T A;  3L8B A;  4DS4 A;  4I7F A;  3QES A;  4IFV A;  1T05 A;  1D9F A;  2YNG A;  1JLF A;  4FM0 A;  1HYZ A;  3V9W A;  2RN2 A;  1ZBL A;  4JLH A;  4FXD A;  4IBN A;  4C8N A;  4CEC A;  4B8A B;  1HQU A;  3O3F A;  1U45 A;  2HHU A;  4FJG A;  1SL2 A;  1O1W A;  2HB5 A;  3K59 A;  1VSD A;  3ZCM A;  3K5N A;  4HUG A;  5CY4 A;  4B08 A;  4Y1C A;  2IOC A;  1RT1 A;  1LAW A;  1RT7 A;  4DTN A;  4LSN A;  2G8H A;  1T8E A;  1I3A A;  3V9Z A;  1KFS A;  1RDB A;  3VQ7 A;  3V9X A;  4UQG A;  3LPT A;  3KKR A;  3KLF A;  1WSI A;  1RT4 A;  4CJF A;  2RF2 A;  4CIG A;  1QSL A;  4PQU A;  1L3S A;  3DOK A;  2OZM A;  1BCO A;  3OYL A;  3HYF A;  3TAB A;  3NGI A;  3OYM A;  3OYJ A;  1X9W A;  1A5V A;  4DFK A;  5JS2 A;  3AVC A;  1NK6 A;  4FM1 A;  4M3U A;  2D5R A;  3ISN C;  4KRE A;  1SKR A;  1NK0 A;  4CEB A;  3SJJ A;  2B6A A;  2FC0 A;  4ID5 A;  4B9N A;  4I2P A;  1N5Y A;  4M3T A;  4FYD A;  1U04 A;  4OKK A;  3BGR A;  4O0J A;  5KTQ A;  4CK2 A;  3V9U A;  4B3O A;  1RTH A;  1QQC A;  4CJV A;  3VN5 A;  3QIO A;  3DRS A;  2XY7 A;  3VQE A;  3LP0 A;  4C8K A;  3M8R A;  3VA0 A;  2E6L A;  3LP2 A;  2BDP A;  2HNY A;  1L3V A;  3KIO A;  1GOC A;  4DTR A;  3NH1 A;  3S3O A;  3KK3 A;  4E3S A;  1K6Y A;  2WOM A;  3L3U A;  4FLU A;  2OYQ A;  4CJP A;  3PX0 A;  1ZBU A;  3HPH A;  1DTQ A;  1LWE A;  5C24 A;  1CZB A;  5HRR A;  3DLB A;  4M3Z A;  1GOA A;  3ZT0 A;  2XHB A;  3C94 A;  4CFD A;  3DRP A;  4E89 A;  2E6M A;  2P5O A;  1NK5 A;  1TK5 A;  4RW9 A;  4NCG A;  1WSJ A;  3EZ5 A;  1SL0 A;  1A5W A;  3E01 A;  1B9D A;  2EHG A;  3LAL A;  4E7H A;  3TAP A;  2A1R A;  4J2D A;  2XY8 A;  3NFA A;  4FZX C;  4W5N A;  3CFR A;  4JRQ A;  1BI4 B;  1I39 A;  1NK9 A;  3PX4 A;  3AO4 A;  3HVR A;  2DFE A;  4CHQ A;  4DSL A;  4AHC A;  4KHN A;  1F21 A;  4N56 A;  1IG9 A;  1HYV A;  2HND A;  4AHU A;  3QEP A;  4B9U A;  4W5T A;  1EET A;  4FLW A;  1TKD A;  4KB0 A;  5I3U A;  1EXQ A;  3WNF A;  3QER A;  4JRP A;  1KTQ A;  3AO1 A;  4RW7 A;  1TV6 A;  3ZSY A;  4DTU A;  3HPO A;  1SKS A;  1J5O A;  5E41 A;  3RRG A;  3VA3 A;  4DU4 A;  5CYQ A;  4DTO A;  2KFZ A;  4CEZ A;  4DMN A;  4DU1 A;  1U48 A;  2IGI A;  4OGE A;  1L3U A;  1TKT A;  4HUF A;  3AVJ A;  4W5Q A;  4CJL A;  2VWJ A;  4HTU A;  3TAF A;  3SPY A;  3KTQ A;  2D0C A;  3CM6 A;  4CER A;  3NGZ A;  2X74 A;  4N41 A;  3PY8 A;  4WE1 A;  4KI6 A;  3LAK A;  3AVM A;  1RDA A;  4CHY A;  4N5S A;  3LWM A;  4IDK A;  4W5R A;  1YTA A;  2G8U A;  3RWU A;  5FRN A;  5I42 A;  3PUF A;  3AA3 A;  3PV8 A;  2ITG A;  4CGD A;  3SQ0 A;  4Z4E A;  2G8F A;  1TKX A;  4O4G A;  3CM5 A;  4E7I A;  1YVU A;  4LSL A;  4J2E A;  1LWF A;  4H8K A;  3L2Q A;  4CHZ A;  4KHY A;  2QXF A;  1QE1 A;  2ZQB A;  2Z1H A;  1SV5 A;  4HVJ A;  5J2M A;  3G0Z A;  3ZSZ A;  3ZSQ A;  1JLQ A;  1WSH A;  3NF9 A;  4DU3 A;  1ZBF A;  3SYZ A;  1U49 A;  2G8W A;  1RTJ A;  1MU2 A;  1SUQ A;  3SUQ A;  1JLG A;  3VQ8 A;  4CHO A;  4ELU A;  2Z1J A;  2QKB A;  4E19 A;  4FZY A;  4RW4 A;  4Z4C A;  3AVK A;  3SQ2 A;  4OKE A;  1BL3 A;  4DTP A;  3DLK A;  4OPJ A;  4F3T A;  3ZSW A;  4CF2 A;  3CQ8 A;  3LZJ A;  1SL1 A;  4FJH A;  1Z26 A;  3D0P A;  1QHT A;  3A2F A;  4IFY A;  4AHV A;  4AHT A;  3MXI A;  4AHR A;  2DFF A;  3HP6 A;  2EX3 A;  3TAE A;  3OYF A;  3VQP A;  3ZT1 A;  1NK7 A;  3WNE A;  4QOZ B;  2XRI A;  1ASW A;  4FJ7 A;  3DOL A;  4CED A;  4F3O A;  4I9L A;  1HNV A;  4KTZ A;  1BIZ A;  3M8Q A;  2YNH A;  4CJ3 A;  1HNI A;  4CHP A;  3TAN A;  1T7P A;  3U3G A;  1FKP A;  3HL8 A;  1YT3 A;  4M3R A;  3UIQ A;  1YTU A;  4EP5 A;  1RT3 A;  4B8C A;  1VRT A;  4L8R B;  1HJR A;  1EKE A;  2B4J A;  5K14 A;  3ZSR A;  1BIS A;  3QIN A;  4OPK A;  1L5U A;  4KTQ A;  4YNQ A;  4ZTF A;  3RR8 A;  2G8K A;  2LSN A;  5J2P A;  4LD0 A;  1B92 A;  3SPZ A;  4FLV A;  2XY6 A;  1X9M A;  4FLZ A;  3HP9 A;  3C6U A;  3MEC A;  4NYN A;  4CEA A;  4KHW A;  3TAG A;  1BHL A;  3F73 A;  1C1C A;  4FM2 A;  4B9M A;  4E7J A;  3LP3 A;  1RIL A;  3AVN A;  5CZ2 A;  4CK1 A;  5J1E A;  3QEI A;  2HW3 A;  3VQ4 A;  5KI6 A;  1WSF A;  2OPP A;  3LAM A;  2XO7 A;  3SUO A;  3L2V A;  4KB1 A;  4RG8 A;  3CYM A;  2PY5 A;  1WN7 A;  4E1M A;  1TAQ A;  4B9L A;  1LWC A;  4M3W A;  1TVR A;  3I0S A;  1QSY A;  1WLJ A;  4QCL A;  1NK8 A;  3KJV A;  3MED A;  3RMA A;  1KVC A;  2FBV A;  4CIE A;  3IS9 A;  3RR7 A;  2VWK A;  3RMC A;  2HHT A;  2IDO A;  2DY4 A;  3SI6 A;  2JGU A;  1XC9 A;  1WSG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...