3NGYA

Crystal structure of rnase t (e92g mutant)
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
204
structure length
204
Chain Sequence
GLCDRFRGFYPVVIDVETAGFNAKTDALLEIAAITLKMDEQGWLMPDTTLHFHVEPFVGANLQPEALAFNGIDPNDPDRGAVSGYEALHEIFKVVRKGIKASGCNRAIMVAHNANFDHSFMMAAAERASLKRNPFHPFATFDTAALAGLALGQTVLSKACQTAGMDFDSTQAHSALYDTERTAVLFCEIVNRWKRLGGWPLSAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for RNA trimming by RNase T in stable RNA 3'-end maturation
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Ribonuclease T
total genus 60
structure length 204
sequence length 204
chains with identical sequence B, C, D
ec nomenclature ec 3.1.13.-:
pdb deposition date 2010-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00929 RNase_T Exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3ngyA00
3K58A 2XY6A 4RW8A 4CGIA 3E01A 1QQCA 4CEEA 4CF1A 4CJUA 2WOMA 1ZBFA 3DLEA 4E19A 4KTQA 1XC9A 2XY5A 4DSIA 2HNZA 4DTUA 4FYDA 3SUPA 2DFEA 1JLFA 2KZMA 3F73A 5HLFA 1VK0A 2OPPA 3DRRA 3PUFA 3OS2A 3JYTA 4N5SA 1F21A 3KJVA 2IGIA 3CQ8A 1JL1A 4DQRA 4C8OA 1ITGA 4ELVA 3NHGA 2VWKA 3VQ9A 2HHQA 2A1RA 3VQ7A 1D9DA 1BGXT 4OKKA 3B6OA 1QS4A 4EZ6A 2KQ2A 1QHTA 1C0TA 4DLEA 1Q9YA 4FJGA 4W5NA 3D0PA 2DTUA 3DM2A 1C1CA 1WSFA 1T7PA 4K8ZA 3KLFA 3OYHA 4CFAA 4DSLA 4M42A 1RBSA 2Z1HA 2YNFA 3ITHA 5J2QA 4E7HA 4NCGA 3LANA 4O4GA 3HM9A 5HROA 1SL0A 4CGGA 1HYVA 4DTPA 4M3TA 5CZ1A 2WONA 4F2RA 4QCLA 1JLGA 4DTNA 1KTQA 1RBVA 3TAPA 1BQNA 1SL2A 1CXQA 3VQEA 4FJIA 1FK9A 4KHQA 1RCHA 3LZJA 1Y97A 3NGYA 1DTQA 3ZT3A 3LP1A 4CEZA 3S3NA 4N76A 3VQ5A 3LP0A 1LAVA 4Z4CA 4KKOA 1SKSA 4Z4IA 1IKWA 1RTHA 4M3UA 1NJWA 1HYZA 3CFOA 3PO5A 3OYDA 2BE2A 5I3UA 5FRMA 4M3YA 4DFPA 3KLIA 4N41A 2G8FA 1KCFA 4NCBA 1RT4A 1BI4A 4C8KA 1TAUA 1LW2A 4KPYA 4CJVA 3LPUA 3KK1A 3TR8A 1HYSA 1WAFA 1T05A 1L3SA 4ZTJA 3AVGA 2BGGA 2XO7A 1G15A 4DSKA 3C6TA 4KTZA 1NOZA 1NK4A 4B9TA 1BIUA 1WSHA 1KFDA 1YTAA 2FBYA 2Z1GA 4FLYA 2YNHA 4FLTA 4DQSA 1XHZA 2IOCA 4OVLA 4CJFA 3OYFA 1KVCA 4FJ5A 3KK3A 1HQEA 3QLHA 1XWLA 4CGJA 2NUBA 4ELUA 3RWUA 4OLAA 3HYFA 3B6PA 3C94A 2PYLA 1TVRA 4B9VA 3OYEA 1SUQA 5CYQA 1TK5A 1WAJA 1L3UA 1K6YA 1IKYA 3LAKA 3HP6A 1BL3A 2X74A 2BDPA 3M8RA 3QESA 3V1QA 3OYMA 3SPZA 4K8XA 3NFAA 1IG9A 2O4IA 1J54A 3AVIA 4CE9A 4J2AA 4O55A 2JGUA 4AILC 1EXQA 1RDDA 3QNNA 4J2EA 4FJMA 5CYMA 5K14A 4RW7A 3HXMA 4L8RB 2VWJA 1L3TA 1ZBIA 4JS4A 4B8CA 2OZSA 1W9HA 3FFIA 3S9HA 1SKWA 1RT2A 4MQ3A 4FJJA 1C6VA 1U47A 3CM5A 3L3VA 4Z0UA 1Z26A 3LP3A 1NK8A 1D8YA 4ELTA 1TKXA 1VSKA 2IDOA 3QO9A 2P1JA 1TL1A 4IG0A 4E1NA 3V9WA 4F3OA 3QETA 4B9UA 4FW2A 4CGFA 3AVNA 4HCBA 4H4OA 3BGRA 4LSNA 1JXBA 1TL3A 3U3GA 2X6NA 2HHUA 4CGDA 1LV5A 4B9LA 4LH4A 1NK5A 2IAJA 2DFHA 3AA2A 4AHVA 4BDZA 1NK9A 4FK0A 1BIZA 4CEAA 5D3GA 2ZQBA 2G8WA 1DTTA 3K5NA 2B4JA 2G8KA 3IAYA 3VA3A 1JLAA 3QIOA 1NOYA 3VQBA 4FJNA 2P5OA 5EU7A 1HJRA 2ITGA 1CXUA 3IRXA 4DMNA 5HRNA 4DF8A 4W5RA 3L2QA 3I0SA 3NGZA 3MEGA 4I9LA 5J2NA 4FW1A 2PY5A 1Q9XA 4F3TA 1J9AA 1NK0A 3OY9A 2HHWA 4CK3A 2E4LA 2XRIA 3MXIA 1X1PA 3SUNA 3DOLA 1I3AA 1DLOA 3K5LA 3VA0A 1TKTA 4NYNA 1IO2A 5I42A 3NF7A 1KSPA 4NYFA 3HPOA 1RTIA 3P1GA 5HRPA 2RF2A 4CF0A 3L2UA 1ZBLA 4FZYA 4KB1A 1FXXA 4CF2A 3V4IA 2R7YA 4CJWA 1SL1A 3UIQA 3QIPA 3VQQA 4EZ9A 1WSJA 4BWJA 3AVLA 4F4KA 3G10A 3S3MA 1HMVA 1UA0A 3CYMA 4I2QA 2HHTA 2E6MA 3DLBA 1UWBA 2YV0X 4DQPA 1LWFA 1Z25A 4C8NA 4CJ3A 3NH0A 4Z4FA 4B3OA 1C1BA 4W5QA 4CFCA 3MEEA 5HRRA 4DTXA 3T3FA 1KLNA 1S9EA 2HHXA 1BCOA 3NCIA 3OYIA 2RPIA 4WE1A 2IS3A 1W0HA 2HB5A 5FDLA 3RMAA 3HPGA 3SUQA 3IG1A 4CF8A 3MAQA 3DI6A 1KLMA 1QSYA 1JL2A 2G8UA 4F2SA 1HNVA 2KTQA 3O3HA 3ZSXA 2D0AA 3D45A 3LWMA 4KREA 4CJPA 3KKRA 3ZSWA 4M45A 1RILA 3ASMA 3LALA 3O3GA 4CFBA 4CEBA 4Y1CA 4FK2A 3EY1A 3AO5A 3TAEA 4IG3A 1WSEA 3AO4A 1JKHA 1RT1A 3ZSYA 2XHBA 2FBXA 4QOZB 1REVA 1ZBUA 3L2VA 4I7FA 1NKBA 2VG7A 1WLJA 3AVCA 5T7BA 4AHTA 3HO1A 1JLEA 3HP9A 4B9SA 1HRHA 2QXFA 4DFMA 4BE2A 4CESA 2QKBA 4N47A 1Q8IA 2EHGA 1IKVA 5FROA 1YTUA 1BHLA 3AVAA 1WSIA 1S9GA 3MXJA 4IFYA 3ZT2A 4AHCA 4E89A 4CHYA 4OPJA 3TWHA 4FLWA 4JRQA 3AVKA 1B9FA 4B9NA 3HT3A 1NK6A 4FVMA 3CM6A 5SWMA 1ZYQA 4CJSA 4CHZA 1LW0A 4OKJA 4DFKA 4TSXA 3V9SA 3PY8A 4KO0A 1XHXA 4CK2A 4FK4A 3RMCA 2IC3A 4O44A 4BE1A 5JS1A 3EZ5A 3MEDA 1UOCA 1TK8A 1RBRA 3AO1A 1NJYA 1TV6A 2RN2A 4IBNA 3AVMA 4CJTA 2FC0A 3OYAA 4XIUA 1ZBHA 1C0UA 1QTMA 4E7KA 4DQIA 1VSLA 1VSDA 4RW6A 3L3UA 4W5TA 3V9UA 3ALYA 3OJUA 4PWDA 1EKEA 4CJ5A 3OJSA 4O0JA 5DMRA 4CHOA 4PUOA 3S3OA 3TAGA 4DSFA 2KFZA 2A1SA 4E7JA 1GOAA 3G0ZA 1RDCA 4AHSA 3LP2A 3MECA 3U6FA 1HQUA 3LPTA 1U49A 1KFSA 4IKFA 2F8TA 2HHVA 4J2BA 1CZBA 1FKOA 3WNHA 5C25A 1UAXA 1A5WA 3SV4A 1FKPA 3WNEA 3ZSOA 2DY4A 1HNIA 3T19A 3EYZA 4DTSA 3A2FA 3WNGA 3QEVA 3OS0A 4HTUA 1O1WA 2VG5A 4OJRA 3V1RA 3NGIA 3V9ZA 2FBVA 4LD0A 3VQCA 1YT3A 3OYCA 2ATQA 1NJXA 2YKMA 4CJKA 2XY8A 3ZT0A 3OS1A 3V6DA 3L2WA 2QKKA 5HP1A 1CZ9A 2YKNA 4Y1DA 3OYGA 3K57A 4RW4A 4LSLA 5C24A 4BE0A 3RR8A 4NCAA 4FJ8A 3DLKA 3I0RA 2X78A 3TAMA 1VRUA 4B8AB 4CEQA 3RTVA 3QEWA 3V81A 4R5PA 3KLEA 4M3RA 3RMDA 4CCHA 4FJ7A 1IKXA 4KHSA 3DLGA 1QE1A 1I39A 2ZD1A 3QERA 4E7IA 3TABA 3ZCMA 3SJJA 2HVHA 3KKSA 4BWMA 5KRTA 4YNQA 1NJZA 1WSGA 5J2PA 3SQ2A 4CGHA 4DU1A 1S6PA 1ASVA 4CJEA 4E3SA 2ETJA 2PZSA 1WN7A 1BCMA 4ID5A 2YNGA 4LH5A 4PY5A 3HK2A 3KD5E 5CY4A 4HUEA 5HBMA 3AV9A 1VSHA 3PO4A 4FJXA 1VSIA 5KTQA 1X9SA 2OPSA 1JLQA 3ZT4A 1YVUA 3M8SA 2YHBA 4HUFA 4DTMA 3HPHA 4KAZA 4M3WA 3HL8A 1CLQA 3AA3A 4I2PA 4KV8A 1S1TA 1NKEA 4JS5A 3NDKA 1XI1A 3AVJA 3WNFA 1VSMA 1KVAA 1QSLA 1HPZA 3AVBA 3SQ0A 4FJHA 3L8BA 4DSJA 4I9QA 3M8PA 1C1AA 1VSJA 2KW4A 1RT7A 4CK1A 4Q5VA 2G8IA 2HVIA 3DLRA 3NBPA 1IH7A 5E41A 4FM0A 2HMIA 3ZSRA 4M3XA 4AHRA 1A5XA 4CHPA 3SQ1A 4E0DA 5KI6A 4CIGA 4CF9A 1LWEA 3JSMA 1X9WA 4MFBA 1U4BA 2E6LA 4DTOA 4AH9A 3TI0A 1GOCA 4JRPA 2HW3A 1RBTA 4CJLA 4DTJA 1TAQA 1MU2A 1JLCA 1JLBA 3RMBA 4DWIA 2KFNA 2HNDA 3O4NA 1T8EA 2ZE2A 2I5JA 4DS4A 1LWCA 3OYLA 3PX0A 4KHYA 3NE6A 4O5BA 5KGWA 4DTRA 4Z4EA 1L3VA 2GBZA 1JXEA 3H08A 4HVJA 4CHNA 2Y1JA 1B9DA 2VG6A 3KIOA 4E1MA 1RTJA 3T1AA 3NF9A 4KFBA 1U45A 2GV9A 4Z4HA 2YNIA 1QSSA 4W5OA 2HNYA 1S5JA 3AA4A 3AVHA 3QEXA 4KI4A 4H8KA 3VQ6A 3ZSQA 1S6QA 4FM1A 4CEFA 4LY7A 3KK2A 3ISNC 2LSNA 5JS2A 3DOKA 4N56A 1ASUA 3QNOA 3OYBA 4AHUA 2EX3A 5J2MA 1SKRA 2JLEA 3VQPA 3RRGA 2OZMA 1L5UA 1N6QA 4EP4A 3DRPA 3NH2A 1WNSA 5CZ2A 5KGXA 4HUGA 5J1EA 3L2RA 4BDPA 4FZXC 1EETA 5KRSA 3I8DA 4CJRA 1D5AA 4Z4GA 1BI4B 1GOBA 4UQGA 3RRHA 3VQDA 3OYNA 4BDYA 1RT3A 3TAQA 4F8RA 4B08A 1J53A 3SZ2A 2D0BA 4ID1A 3KTQA 4KB0A 4CIEA 3QEPA 2HHSA 1VSEA 4DQQA 3SYZA 1RT5A 1SV5A 3K5OA 4H4MA 3MXMA 3RR7A 4OLBA 4CEOA 1B92A 4FLVA 3SNNA 3K2PA 3VQ4A 1U48A 2RKIA 3PX6A 4KI6A 1NK7A 1RT6A 3AA5X 4CHQA 4B9MA 2FBTA 1U04A 3CFRA 1NKCA 1S1WA 4HCCA 1RTDA 3SQ4A 4FLZA 3HJFA 2YHAA 1D9FA 4O0IA 3C95A 1S1UA 4OPKA 4FJKA 4CEDA 1BQMA 4FCYA 4DFJA 1R0AA 3HSTB 3O3FA 3NF8A 2G8HA 3K5MA 4RG8A 3SPYA 3LZIA 4PA1A 4JLHA 1TGOA 4DG1A 4GMJB 2Y1IA 3CG7A 4DU3A 4KHNA 2QK9A 2O4GA 4KTWA 1RDAA 3C6UA 4CERA 4FJ9A 3AO3A 2KZZA 3DMJA 1TKZA 4GW6A 2D5RA 4ICLA 3SUOA 4DS5A 3DLHA 3OYJA 2OPQA 2Z1IA 1LAWA 4KHUA 3AVFA 4FZZA 3V1OA 3DYAA 4FLUA 3ZSZA 3TANA 1KRPA 1J5OA 1N5YA 4FLXA 3KD1E 4FXDA 4CECA 3ZSVA 4ZTFA 3P83D 3F9KA 1T03A 3KLHA 4M41A 3LAMA 1UA1A 4E7LA 3HVTA 4CFDA 1KVBA 3V9XA 1TK0A 4OGEA 4QAGA 5DK5A 3VQAA 3VN5A 3CFPA 5SZTA 4BACA 2XY7A 4C8LA 1BISA 2OPRA 3ULDA 3QEIA 4GVMA 1A5VA 2P51A 4CIFA 3NAEA 3SCXA 3IS9A 4OGCA 2GUIA 1ASWA 4IDKA 3LWLA 3U3YA 2X6SA 4OKEA 1EP4A 3VQ8A 4FM2A 3PV8A 4J2DA 4M3ZA 3TARA 4Q0BA 3SV3A 2BANA 2D0CA 4EP5A 3SI6A 2DFFA 4DU4A 1C0MA 2Q3SA 3NF6A 1VSFA 1VRTA 3DRSA 5C42A 1X9MA 2P5GA 4KHWA 3OYKA 2W42A 3KLGA 2AJQA 4PQUA 3QINA 3M8QA 4IFVA 2PYJA 2F8SA 4KRFA 1RBUA 2Z1JA 2B5JA 2F96A 4YFUA 4HHTA 4FJLA 4G1QA 4ZHRA 5FRNA 3ZT1A 1EX4A 3THVA 3HVRA 3TAFA 3BDPA 3O4QA 2B6AA 3PX4A 4CJQA 2OYQA 4CJ4A 3OVNA 3K59A 3LDSA 4C8MA 5HRSA 3NH1A 4RW9A 4DSEA 4DF4A 3AO2A 2OA8A 4DLGA 1TKDA 2G8VA 1RNHA 1S1VA 1RDBA 1S1XA 3P5JA
chains in the Genus database with same CATH superfamily
2QTDA 3D2EA 4RW8A 4CJUA 3VEYA 5AQFA 2WOMA 3EEQA 4I6MA 4KTQA 4X64K 2XY5A 2DFEA 3PUFA 2OPPA 3CJBA 3OS2A 3JYTA 3CQ8A 3D6RA 4DQRA 4C8OA 2NNWA 1VQ6N 4FWLA 3VQ7A 1D9DA 4JI4K 2Q2RA 2CH6A 1C0TA 2RHKA 4FWQA 1WSFA 1T7PA 3OYHA 1RBSA 3H3OB 3MN5A 2CH5A 4NCGA 2NZTA 4M3TA 4NO7A 3FZFA 1RBVA 1BA0A 1CXQA 4BROA 4PL8A 4ILJA 1Y97A 3NGYA 3ZT3A 3LP1A 2HMPA 4N76A 4Z4CA 4KKOA 1NJWA 4H5TA 4M7XA 4WFAL 4DFPA 4M3YA 4H03B 1W2BM 3CCUN 3C7NA 4C8KA 2O8EB 4KPYA 3CJ1A 1WAFA 2ZGYA 1T05A 1QQMA 4DSKA 3C6TA 3I33A 1NK4A 1BIUA 4C23A 4AF1A 4DQSA 4GV9A 3RSEB 2P9IB 2PYLA 3G71N 4DR2K 5CYQA 1TK5A 5AQZA 3IKMA 1L3UA 1K6YA 1KXPA 2ZJQL 3LAKA 2F9WA 3HP6A 2X74A 3M8RA 1HUXA 3V1QA 5AFUA 3G25A 3OYMA 1J54A 2JGUA 3QNNA 4J2EA 4DR7K 1ZBIA 4B8CA 1SKWA 4MDBA 1K8KA 4ELTA 1Z26A 3LP3A 1TKXA 4F3OA 2IVOA 3QETA 2E1YA 1DGKN 4JI8K 1JXBA 5BRHA 4IEIA 4DV4K 3KK7A 2YCHA 3U3GA 3AGKA 4H5WA 5EX5A 4LH4A 2DPNA 1BIZA 2G8WA 4BGBA 2B4JA 2O8BA 2G8KA 3IAYA 4H0TB 5EXWA 4IFEA 2ITGA 5CHIA 1CXUA 4DF8A 4LF7K 4W5RA 3L2QA 3MEGA 1J9AA 3OY9A 1X1PA 3SUNA 3CC2N 1DLOA 3VA0A 1IO2A 3HPOA 2RF2A 4RCHA 4CF0A 1ZBLA 4DR4K 3OTOK 1FXXA 4B3RK 4A2AA 3V4IA 3U9ZA 4QS7A 1KAYA 3G10A 1UA0A 5C0YA 3CJCA 2HHTA 3MN7A 2O8FB 4B3SK 4CJ3A 1C1BA 4W5QA 3T3FA 5HRRA 1BCOA 1ATNA 4WE1A 3THXA 4CF8A 1KLMA 1LOTB 5KQ8A 3PIPL 4JN4A 4GKJK 4JI7K 4IOAL 2D0AA 2VYPA 4DV2K 3ZSWA 3EN9A 4BG8A 3TSUA 1JKHA 3DXKA 4QOZB 5IT9O 3LDNA 1P90A 1ZBUA 4I7FA 4JV5K 2VG7A 1WLJA 4BC2A 1BUPA 5T7BA 3HP9A 4B9SA 2QXFA 4BE2A 4CESA 2NRTA 4N47A 2HF4A 3SAFA 1YTUA 3AVKA 1B9FA 3R3LA 4BRPA 4B9NA 5JICA 1TUUA 1LW0A 1TUYA 3H46O 3F9MA 1XHXA 4CK2A 3RMCA 1TK8A 3AO1A 2RN2A 1N34K 4PKHA 1YJ9N 1ZBHA 3U9DA 1QTMA 4RW6A 4W5TA 4FSVA 3OJUA 1EKEA 4CJ5A 4CZMA 5DMRA 4CHOA 5JVGL 4BRIA 2KFZA 3G0ZA 3LP2A 3MECA 1HQUA 3LPTA 2HHVA 3J7ZO 3VF6A 4JKAA 3Q7CA 1CZBA 3KVGA 5C25A 1UAXA 2QWNA 3WNEA 3ZSOA 4CBUA 3A2FA 3GG4A 3OS0A 3THXB 2A40A 1O1WA 3WXJA 3NGIA 3VQCA 1YT3A 1Q7YO 2Q0UA 2YKMA 1YVNA 5AQUA 4R79A 3ZT0A 3L0QA 3L2WA 2YI1A 1VRUA 4CEQA 3RTVA 4M3RA 4FJ7A 3TABA 3QERA 3SJJA 4E7IA 2HVHA 4YOUA 4AQYK 3CD6N 1VQON 4DR6K 3CJAA 2ETJA 2PZSA 3EL2A 4ID5A 3TPQA 1S22A 1U2VA 4LH5A 3WQUA 5DM7L 3AV9A 1ESVA 3PO4A 3ZYYX 2NLXA 3LL3A 1BDGA 2KKZA 2OPSA 5AQHA 2ZJPL 3ZT4A 4IEEA 1CLQA 3AA3A 3VEVA 5JLFA 4H0XB 1VSMA 1D4XA 1QSLA 1HPZA 4FJHA 1VSJA 1QHAA 3CC4N 3JS6A 1EQYA 4M3XA 3SQ1A 1A5XA 1HKCA 5KI6A 1BO5O 1NLVA 4AH9A 1GOCA 1QZ5A 1MU2A 4DWIA 2HNDA 2ZE2A 2IVNA 1NBWA 1L3VA 4CHNA 4GV3A 4B3MK 4E1MA 1RTJA 3NF9A 1U45A 2GV9A 3ID8A 2YNIA 2QXLA 1S5JA 4XEIA 4A2BA 3VQ6A 3ZSQA 5GIOA 3ISNC 3QNOA 3OYBA 3VQPA 2QI2A 1WNSA 4NLBA 5KGXA 4HUGA 5J1EA 3L2RA 5FPEA 1K73O 4BDPA 3FR0A 2O8EA 1ATSA 5AZJB 3OYNA 4B9QA 1Q86O 3TAQA 3SBTA 4ID1A 2UXBK 2HHSA 4DQQA 4LF5K 1RT5A 1ZC6A 2YX6A 5ELZA 4OLBA 1NGGA 1YHQN 3SNNA 1U48A 1VQ5N 2RKIA 2HBMA 4M7YA 3AA5X 1OVYA 2FBTA 1Q81O 4A62A 4A5AA 1S1UA 3E9PA 5HOOA 3O3FA 3VOVA 4RG8A 4PA1A 4JLHA 3FFKB 4GMJB 2Y1IA 4KHNA 4KTWA 1RDAA 4B1UB 2QWQA 3DMJA 3H3NO 3OYJA 2Z1IA 1LAWA 4EHTA 3AVFA 4JD2A 1KRPA 1J5OA 1N5YA 3KD1E 4FXDA 3C6AA 3JAMO 3P83D 3F9KA 4JKFA 2WC9A 1UA1A 2GEMA 2P9SA 2XY7A 4BACA 1BISA 3ULDA 3P31A 1A5VA 3T69A 4CIFA 2E88A 3PSFA 4IDKA 3LWLA 3U3YA 2X6SA 3THYA 5A2QO 4J2DA 3PV8A 4BQLA 3TARA 3SV3A 2BANA 2D0CA 2DFFA 1VSFA 2ASMA 3D2FB 4JNEA 3OYKA 5LL6Z 3KLGA 1N36K 3M8QA 2F8SA 1U6ZA 4J8FA 2B5JA 2F96A 2P9PA 4HHTA 4G1QA 3THVA 1EX4A 3H6EA 3HVRA 3TAFA 2I7NA 2JWLA 3A5NC 3T7ZA 3SLCA 4G9ZA 4DF4A 1BU6O 4DLGA 1RNHA 1RDBA 3P5JA 1N33K 3CQXA 2XY6A 2FLOA 4CEEA 4YDUA 3VF2A 2KHOA 4DTUA 1BG3A 4YOVA 1JLFA 3BZCA 4X66K 2KZMA 3RSEA 1Y64A 3VTHA 3DRRA 3KJVA 5BRDA 2P9PB 4ELVA 2HHQA 2PFUA 1SZ2A 4BY9C 1QS4A 4EZ6A 3WQTA 1Q9YA 4B1XB 3VTIA 2DTUA 3SBGA 2HSTA 3IMXA 4CBXA 3KLFA 4DSLA 4CFAA 4BC5A 2Z1HA 2YNFA 3ITHA 2P9UB 3LANA 1HYVA 4DTPA 4F2RA 1T44A 4QCLA 2UUBK 1JLGA 4DTNA 3TAPA 1SL2A 4KHQA 1FK9A 1GLCG 1RCHA 4CEZA 4H0VB 1VQ8N 1RFQA 1LAVA 4Z4IA 1IKWA 3SAGA 4CD3A 1HYZA 2F9TA 3MX5A 1HX1A 2BE2A 5I3UA 3KLIA 5M1KA 4IO8A 1BI4A 1T6CA 2GUPA 1LW2A 5KPRA 1HYSA 3MK6A 3O1BA 1FJGK 1E4FT 5CE3A 1MWKA 1WSHA 1KFDA 1XHZA 5AQNA 4CJFA 1YJNN 3OYFA 4IDHA 4FVUA 4FJ5A 3KK3A 2CGLA 1XWLA 4MDAA 4ELUA 1JCEA 3RWUA 3HYFA 4OLAA 1YXQA 3EE8A 3A5MC 3OYEA 3BEXA 5AJ3K 1IKYA 3FGUA 2VCPA 2O4IA 1LCUA 2PBDA 3BP8A 1RDDA 5K14A 4RW7A 4KHPK 3HXMA 4L8RB 2OZSA 3FFIA 4FPBA 4MQ3A 3U4LA 3QFPA 4B3TK 3TU5A 3OA9A 4BR4A 1U47A 1NK8A 3FLCO 4JKEA 1W97L 2IDOA 4E1NA 4B9UA 4CD1A 4CGFA 3AVNA 4HCBA 3O6WA 4H4OA 4B1VA 1RGIA 4DHYA 2VGNA 4CGDA 3AA2A 2DFHA 4BDZA 1NK9A 5D3GA 1M1KO 3P39A 3K5NA 2O8FA 3LDLA 3VA3A 3QIOA 4EAHD 5AQMA 2P5OA 4NXMK 4JHDB 1HJRA 3IRXA 5HRNA 4H5RA 5J2NA 3I0SA 4U7BA 4I9LA 4FW1A 4KBOA 4K41A 2HHWA 2E4LA 1I3AA 4DCHA 4NYNA 2D4WA 3NF7A 5AQKA 1GLBG 1KSPA 4IOCL 1XNQK 5IWAK 4EHUA 4DV6K 1YITN 3VQQA 1WSJA 1HMVA 2YJEA 2EWSA 4I2QA 2E6MA 2YV0X 3R1XA 3NH0A 1KLNA 2W6KA 3NCIA 2RPIA 5FDLA 2D0OA 3HPGA 1QSYA 3DI6A 3M3ZA 3H45C 2ZWHA 3O3HA 3LWMA 3J7YP 3KKRA 3O4WA 1RILA 3ASMA 4KH4A 5BREA 4Z94A 3AO4A 3ZSYA 2O8CB 2FBXA 1MA9B 1REVA 3L2VA 3ZX0A 3AVCA 3J80O 3HO1A 3I55N 1NGIA 2QKBA 5BPNA 2EHGA 3AVAA 4IFYA 3SJHA 4E89A 4CHYA 3E1YA 4JRQA 3Q7BA 3CCJN 1E3MA 1XC3A 4FVMA 3F2KA 5SWMA 1ZYQA 4WYBA 5AQJA 3QBWA 4DV0K 3PY8A 4KO0A 4BC3A 1J6ZA 2IC3A 4O44A 5JS1A 3EZ5A 3CF5L 1UOCA 3AAPA 1TV6A 4BVPA 3AVMA 3BZKA 3IDHA 4E7KA 4DQIA 1VSLA 1VSDA 1ATRA 3L3UA 2O8CA 3W0LA 3ALYA 3OW2M 3VMFB 4FWNA 4PUOA 3S3OA 2QWRA 2IIRA 3CXCM 2OCEA 3E66A 1WB9A 2A1SA 1RDCA 3KWGA 3QB0A 4AHSA 4IKFA 4J2BA 4BRAA 1FKOA 4FOIA 2VGMA 1NMDA 1FKPA 3EYZA 3CETA 2E2QA 2V51B 4DQ8A 4OJRA 2OTJN 2AA4A 3V1RA 3V9ZA 4GVEA 5AQOA 4CZHA 3DXMB 4CJKA 5LJWA 2XY8A 3WXKA 3OS1A 2QKKA 5HP1A 1CZ9A 3OYGA 2F7TA 4BE0A 4FJ8A 3DLKA 4KH6A 3V81A 1NJIO 1RTDA 4BR7A 4LFCK 4KHSA 3DLGA 3EO3A 4WFNL 1QE1A 3AAQA 3KKSA 4BWMA 5KRTA 3UKUA 4DU1A 1ASVA 1DEJA 2QWPA 3G4SN 4JI3K 1WN7A 2YNGA 4PY5A 4LC9B 5CY4A 4HUEA 1JLQA 2VWBA 3SMSA 4KAZA 4DTMA 3HPHA 3HL8A 4LFBK 4I2PA 4KV8A 1C0GA 4JYAK 3FZHA 3MN9A 4ILHA 5KQDA 3SQ0A 3L8BA 4I9QA 4FO0A 2E2OA 4CK1A 1RT7A 1P8ZA 5M1OA 3QFUA 2HMIA 4B1WB 4E1JA 4AHRA 3O8MA 4JKDA 3DXKB 4CF9A 1U4BA 4DTOA 1HKGA 2ASOA 1WBDA 1Z6RA 2QWOA 1RBTA 3RVCA 3RMBA 2KFNA 3O4NA 4DS4A 5C2FA 3PX0A 4KHYA 1O13A 4O5BA 5KGWA 2P9KA 4WF9L 3H08A 4HVJA 2Y1JA 3UKRB 5I9EB 1QSSA 3O08A 2HNYA 4W5OA 1Q18A 3O9SA 3WT0A 3WUHA 4H0YB 4CEFA 5JS2A 2LSNA 3VPZA 4AHUA 2EX3A 5J2MA 3EE9A 5GAGP 5AQLA 2OZMA 3I56N 1EETA 3K9KA 4DB3A 4CJRA 1D5AA 2NRWA 3I8DA 1MWMA 4UQGA 4HTLA 4BRNA 1GLFO 4BDYA 3PIOL 4YOWA 1J53A 2D0BA 1U2VB 3VEOA 4K43A 3GE1A 1VSEA 1SV5A 4H4MA 3MXMA 1GLLO 2O8BB 4PKIA 3PX6A 4IOXA 1RT6A 4B9MA 4DV7K 1NKCA 1NGCA 2NRHA 4CZKA 3SQ4A 4O0IA 3C95A 3O9UA 4FJKA 1R0AA 4X65K 3NF8A 1HNZK 3C6HA 3SPYA 4AM7A 3IFRA 1FW6A 5LMUK 1K8KB 3C7NB 2F4VK 3ZETB 2QK9A 4DUZK 4FJ9A 3C6UA 2D5RA 3SUOA 1RDUA 1QZ6A 5F0XA 1EWQA 4KHUA 3V1OA 4FLUA 4CW7B 3CPWM 1X3NA 4CECA 3ZSVA 3DWLA 3OBYA 3HVTA 4CFDA 3ENOA 1TK0A 3VN5A 3CFPA 5SZTA 4BRMA 2OPRA 3SCXA 5BPLA 4Q0BA 5M1FA 3WXLA 1NOYA 3ATVA 4DR3K 2Q3SA 1VRTA 3DRSA 4KHWA 4PQUA 1NNEA 3D2FA 1RBUA 4YFUA 3L6QA 3VGMA 5FRNA 3BDPA 3ULEA 3O4QA 2B6AA 2QWLA 3PX4A 4B1ZA 3THYB 2OYQA 3K59A 3LDSA 4BREA 3NH1A 4RW9A 4DSEA 3CMEN 3HOTA 1S1VA 3VGKA 1S1XA 5AR0A 1NU0A 4CGIA 2FF3B 1W7AA 3E01A 4CF1A 3MCPA 3DLEA 1ZBFA 1XC9A 1I94K 3QDKA 3F73A 5HLFA 1NWKA 1VK0A 4N5SA 4BR5A 1JL1A 5BR8K 3CIPA 5M1QA 1K8AO 2VWKA 2A1RA 3B6OA 1IBMK 2KQ2A 1QHTA 3R9PA 4Y0WA 4DLEA 4FJGA 4W5NA 2ITMA 3DM2A 1C1CA 3FE1A 4O8UA 1HNWK 4MLEA 5AQIA 1NGHA 1NGAA 3NVKA 3HM9A 1SL0A 4CGGA 2WONA 4FWKA 2BGGA 1KTQA 3ZEUA 3FZKA 2W6LA 3LZJA 1DTQA 4YOYA 2NRZA 3DAWA 4FPAA 4M3UA 2NRXA 3PO5A 3OYDA 5FRMA 2W41A 2G8FA 1KCFA 4BRHA 3A8YA 4NCBA 2O8DB 4RWTA 5JLHA 1TAUA 3VENA 3AGRA 4FOEA 3ENBA 4CJVA 3LPUA 3TR8A 4JEPA 1KQSM 4ZTJA 3CPEA 2XO7A 2E1ZA 1NOZA 4B9TA 5AQQA 2FBYA 2Z1GA 2YNHA 1YAGA 4H5NA 4OVLA 1KVCA 3QLHA 2NUBA 3HI0A 3C94A 3TSQA 3W3DA 1SUQA 4FWPA 1HNXK 1WAJA 1HLUA 3QESA 4X62K 3K0SA 3NFAA 4CE9A 4J2AA 4O55A 4AILC 1EXQA 4FJMA 5CYMA 4WQ5A 2VWJA 4JS4A 1RDWX 1RT2A 1S3XA 4NXNK 1IBLK 4Z0UA 1D8YA 1BOTO 3V9WA 3EKUA 2P1JA 1TL1A 4IG0A 3AY9A 3QICA 2P9IA 1GLJO 3BGRA 2HHUA 3QBXA 2IAJA 4AHVA 3CJ7A 4FK0A 3MWPA 4CEAA 2ZQBA 1DTTA 3TTFA 4FL9A 4L3QA 5ADXA 5EU7A 5GIPA 5B8HA 2BTFA 2Q1NA 3NGZA 4IZ9A 3ENHA 2PY5A 4F3TA 4B1YB 1NK0A 4QS9A 3K9JA 2WFBA 2BUPA 4BRLA 2XRIA 3MXIA 1SQKA 1TKTA 5I42A 4ISEA 5HRPA 5BPMA 4CF2A 2R7YA 1XQSC 3U8XA 3QIPA 4GY2B 3CMAN 3UIQA 4EZ9A 2GWKA 3S3MA 2V7YA 3CYMA 5C10A 5E26A 1WUAA 3DLBA 4WQ4A 4C8NA 1Z25A 4JKCA 2KTQA 4CFCA 3MEEA 5BRFA 2HHXA 2E2NA 2ZGZA 3RMAA 3SUQA 2YHXA 4O8KA 3IG1A 3CCQN 1C0FA 3M5RA 3ZSXA 3D45A 3BF3A 4M45A 5H1SQ 3N4QA 4C1NK 4CEBA 4K25A 4Y1CA 3EY1A 3TAEA 5HL7L 2XHBA 1RT1A 4A61A 1NKBA 2ASPA 4U67L 2P9NB 1HRHA 2P9UA 4DFMA 3O80A 3MMVA 1Q8IA 1IKVA 5FROA 1BHLA 3MXJA 1S9GA 3ULEB 4JD2B 1EO1A 4FLWA 2WBNA 1XUPO 3HT3A 3HM8A 4CJSA 5LMNK 4OKJA 2NRVA 4TSXA 4NLCA 4CJ7A 4BE1A 4KH5A 3MEDA 4FWMA 1WBBA 3AARA 2CGKA 1C0UA 4FWOA 3SMPA 4CZIA 3V9UA 4PWDA 4PHTX 2UUAK 3TAGA 4CVNE 4DSFA 4E7JA 3U6FA 4NCAA 1U49A 4DV5K 1KFSA 3A5LC 1OKJA 3WNHA 4LF4K 2UXDK 4PKGA 3VEWA 3SV4A 3T19A 4DTSA 3WNGA 4BR2A 1GLEG 4HTUA 3BY5A 2VG5A 2OANA 2FBVA 1X9JA 3GDQA 2ATQA 3T1YK 4PL7A 5C24A 3UB5A 3RR8A 3QEWA 4B8AB 4BG9A 5C15A 3RMDA 1OVQA 3BF1A 3HZ6A 3I8BA 1I39A 5LY3A 3ZLJA 5GAHP 4YNQA 1WSGA 4CGHA 1NM1A 2A6AA 1S6PA 1NGBA 2A42A 3WEEA 1BCMA 3HK2A 1JCFA 5HBMA 4FJXA 1VSIA 5KTQA 1X9SA 5GINA 3HRGA 1VQMN 2YHBA 5FPNA 4HUFA 4M3WA 4NB4A 4V19S 4JS5A 3NDKA 3AVJA 1YUWA 1KVAA 3AVBA 4DSJA 2HF3A 4CZLA 2KW4A 3H1VX 4Q5VA 3DLRA 3ZSRA 3O1WA 3NMUA 4E0DA 4CIGA 1LWEA 1X9WA 1YF5L 4YOXA 2HW3A 1ZBSA 1DT9A 1TAQA 1JLCA 3FZLA 2ZM6K 2I5JA 1LWCA 3OYLA 4YOTA 1E4GT 4DTRA 2OTLN 1VQKN 4Z4EA 2GBZA 1B9DA 3P38A 4BRCA 2FXUA 3T1AA 4KFBA 4Z4HA 4BQZA 1QQNA 2UUCK 3HBTA 1S6QA 4LY7A 3KK2A 4N56A 1ASUA 3E9LA 2WUSA 3LM2A 3S41A 2JLEA 3DRPA 5CZ2A 4FZXC 1J5EK 5KRSA 3N4PA 2P9LA 4F8RA 4B08A 4BRGA 1N8RO 3KTQA 3EZWA 4CIEA 3B8AX 3QEPA 4YORA 3VESA 3K5OA 2QEXN 2GELA 3RR7A 4WCEL 4CEOA 1B92A 4H5VA 3K2PA 4KI6A 1NK7A 4CHQA 2GX9A 2YHWA 1U04A 4ISFA 3CFRA 3J7AP 1TYQA 3MCAB 4JHDA 4FLZA 2Q0RA 1D9FA 4OPKA 4CEDA 4DV1K 4FCYA 4DFJA 4OO1J 3BUZB 3HSTB 3HOSA 4DG1A 5JMVA 4GKKK 4CERA 2O4GA 3GOIA 3J81O 3AO3A 2KZZA 4GW6A 4DS5A 1CZAN 2D1KA 4XH1A 5CR4A 1NGEA 3DYAA 4FLXA 4MO5A 4ZTFA 3O5BA 1T03A 5AZJA 4E7LA 1HPMA 3D2EB 3V9XA 4OGEA 4QAGA 5DK5A 1YI2N 3QEIA 5F1XA 3NAEA 4OGCA 2GUIA 1ASWA 3THWB 2IVPA 1EP4A 3VQ8A 2A41A 4DU4A 1C0MA 1X9MA 2ZF5O 2P5GA 3CQYA 1Z05A 3QINA 2PYJA 1NGDA 3VETA 4LF6K 4KRFA 4FJLA 4ZHRA 5AQVA 3H1QA 1JCGA 4IO9L 5AQRA 4BGAA 4C8MA 2FSJA 2OA8A 2A3ZA 1X3MA 2G8VA 3CC7N 4CZEA 3K58A 4WQ5C 1QQCA 2H3GX 4E19A 2UU9K 4DSIA 2HNZA 5AFUH 4FYDA 4ILGB 3SUPA 4FWSA 2Q36A 1XMQK 3KZBA 3NVMA 3DXMA 1F21A 2IGIA 2A5XA 4IJAA 1ITGA 3NHGA 3VQ9A 5GADP 3CERA 3CCVN 3LM9A 1BGXT 4OKKA 1ILYA 3D0PA 4K8ZA 4JKBA 1KAZA 4M42A 4XH4A 5FPMA 5J2QA 4E7HA 4O4GA 5HROA 2FSNA 3R8EA 5CZ1A 1XMOK 4AM6A 1T3VA 1YIJN 4FJIA 1BQNA 3VQEA 1K9MO 3S3NA 3P4IA 5DM6L 3VQ5A 3LP0A 3OHRA 1SKSA 3PSIA 1RTHA 2V52B 3CFOA 3O9RA 1EWRA 1GLDG 4N41A 3J8AA 3UKUB 1RT4A 5FLXO 3M6GA 3KK1A 3VEXA 4WQ4C 3HSCA 3AVGA 1L3SA 4GV6A 1G15A 5EOYA 4KTZA 4FLTA 4FLYA 1YTAA 1NK5A 5AQXA 2IOCA 1HQEA 5FPDA 4CGJA 4H0PA 3B6PA 2HBJA 1TVRA 4B9VA 2GTDA 3QMLA 4MLHA 4CZJA 4YHHK 1NG9A 4JI1K 2P9KB 1BL3A 2BDPA 2I7PA 3SPZA 4K8XA 1IG9A 3AVIA 4JAXA 2V7ZA 3JXUA 1YJWN 1L3TA 4YDUC 1W9HA 2P9SB 3S9HA 5AQWA 5TKWA 4FJJA 1C6VA 5BR9A 4EFHA 3CM5A 3L3VA 1VSKA 3QO9A 3TTCA 3LDPA 1KC8O 4FW2A 4LSNA 3OBWA 1TL3A 1HKBA 2X6NA 4JK8A 1VQLN 4M63C 2YHYA 1LV5A 4B9LA 4JI0K 4OX9K 1VQ9N 4BR0A 1VQ7N 1HR0K 1JLAA 1XNRK 3VQBA 4FJNA 1V4TA 2E2PA 4DMNA 3C65A 1V4SA 1Q9XA 3PLAA 1G99A 4CK3A 1IG8A 3DOLA 1NMNA 3K5LA 5AQTA 4I6MB 4NYFA 1RTIA 3P1GA 4BR9A 4FZYA 3L2UA 4KB1A 5JVHL 3ID6A 4DKWA 3R6MA 4DUYK 4CJWA 4OPAA 1SL1A 1QVGM 3CHWA 5AQYA 3AVLA 4BWJA 4F4KA 4QS8A 1H1VA 5C12A 4DQPA 1UWBA 4Z4FA 1LWFA 4B3OA 4LF9K 1T6DA 4DTXA 1S9EA 3OYIA 2QA4N 2IS3A 3MN6A 1W0HA 2HB5A 1WOQA 4UY8O 1BWFO 3MAQA 1JL2A 2WTUA 2G8UA 1HNVA 4F2SA 1OH7A 4KREA 4CJPA 4A59A 4DR5K 4F9OA 4WFBL 2E5LK 1SS6A 3LALA 3O3GA 4CFBA 1QVFM 4FK2A 3AO5A 4CZFA 4IG3A 1WSEA 2GWJA 4BRKA 5BN8A 4AHTA 4JK7A 1JLEA 1NGFA 1SAZA 4K0KK 1VQ4N 1WSIA 4AHCA 2BH1A 4OPJA 3ZT2A 3CCSN 4EIAA 3TWHA 2E20A 2ZJRL 3LDOA 4DV3K 1NK6A 3CM6A 4BC4A 4CHZA 3UKRA 4BRDA 1M90O 4DFKA 1KD1O 3V9SA 4FK4A 4XH5A 1RBRA 1NJYA 4IBNA 4CJTA 2FC0A 3OYAA 3DLLL 4XIUA 3SK3A 4DR1K 3FZMA 4JI2K 3UE5A 2UYTA 2VQEK 2O8DA 3OJSA 4O0JA 1ZXOA 2KLAA 3ATUA 3ZX3A 1GOAA 3IUCA 2F8TA 4ISGA 4YY3K 2HHHK 1A5WA 2DY4A 3T1HK 1HNIA 3CCLN 3ZEUB 3QEVA 1HJOA 2HBLA 4O5FA 4LD0A 1IBKK 3OYCA 5AZIA 4LFAK 1NJXA 1KAXA 3SAHA 2JWKA 4JKGB 3V6DA 2YKNA 4Y1DA 3K57A 3D7EO 4RW4A 4LSLA 5AQSA 1TYQB 3I0RA 2X78A 3TAMA 4CCHA 4R5PA 3KLEA 1IKXA 2UXCK 2ZD1A 3ZCMA 3CCRN 4OPHA 5EY4A 1NJZA 5J2PA 3SQ2A 3KWIA 4CJEA 4E3SA 4IJNA 4LF8K 3O9QA 3KD5E 5AQPA 2P9LB 5EVZA 1VSHA 2CGJA 2W40A 1YVUA 3HTVA 3M8SA 3A5OC 3G6EN 4CBWA 2QWMA 1S1TA 1NKEA 1XI1A 3WNFA 3TSPA 4CI6A 3M8PA 1C1AA 2HVIA 2G8IA 1VAZA 5M1NA 4CZGA 3NBPA 1IH7A 5E41A 4FM0A 2P9NA 4CHPA 4BRQA 4C1NI 3JSMA 4MFBA 2E6LA 3GL1A 5F2RA 3TI0A 4JRPA 3WXMB 4CJLA 4DTJA 2YJFA 1JLBA 1R59O 1T8EA 3L4IA 3NE6A 3MWTA 2QW9A 4MO4A 1JXEA 1QQOA 2FSKA 2E8AA 2VG6A 3CI5A 5ADXH 3KIOA 4IWVA 5AQGA 4BVOA 1VQNN 3DJCA 3AVHA 3AA4A 3QEXA 4KI4A 2D0PA 4H8KA 1OH5A 4JKGA 5E84A 4FM1A 3ZETA 3DOKA 4FWRA 3CCEN 1SKRA 3GBTA 3RRGA 3M1FA 1L5UA 5BN9A 4EP4A 3NH2A 1N6QA 4A57A 1S72N 5MLCQ 3EKSA 4Z4GA 4JKHA 3C0BA 1BI4B 1GOBA 3RRHA 3VQDA 2VQFK 1RT3A 3SZ2A 2HBKA 3VEZA 4KB0A 2QM1A 5GAEP 5TKYA 3WEEB 3SYZA 3MX2A 4JI6K 3LDQA 4FLVA 5KPZA 4HWIA 3VQ4A 4IXCA 3L4QA 3O9TA 4GNIA 1S1WA 4HCCA 3WXIA 1JJ2M 3HJFA 2YHAA 3E9OA 1BQMA 4A5BA 2G8HA 3TTDA 4RTFD 3K5MA 3LZIA 3KHYA 1TGOA 1BA1A 1VHXA 2NRRA 3CG7A 4DU3A 3CCMN 4JK9A 5C2DA 1TKZA 4ICLA 3DLHA 2OPQA 5M1PA 4FZZA 3TANA 3ZSZA 2RE2A 2HOEA 1NGJA 1OH8A 3KLHA 4M41A 3LAMA 1Q82O 2PAVA 2Q31A 1KVBA 3MDQA 3VQAA 4C8LA 2FF6A 4GVMA 5LJVA 3CJ9A 2P51A 3VGLA 3A0IX 3IS9A 2AP1A 4OKEA 4M3ZA 4FM2A 5AZIB 4EP5A 3SI6A 3NF6A 5C42A 4BRFA 2W42A 1IV0A 2AJQA 4JI5K 3ZX2A 1GLAG 4IFVA 1DKGD 1VQPN 2Z1JA 3F5TA 3ZT1A 4K42A 1N32K 4H0OA 1OH6A 5KPTA 3THWA 4CJQA 3VERA 4CJ4A 3OVNA 1MDUB 5HRSA 2Q97A 2J4RA 3AO2A 1TKDA 3VF4A 1IJJA
chains in the Genus database with same CATH topology
3K58A 2XY6A 4RW8A 4CGIA 3E01A 1QQCA 4CEEA 4CF1A 4CJUA 2WOMA 1ZBFA 3DLEA 4E19A 4KTQA 1XC9A 2XY5A 4DSIA 2HNZA 4DTUA 4FYDA 3SUPA 2DFEA 1JLFA 2KZMA 3F73A 5HLFA 1VK0A 2OPPA 3DRRA 3PUFA 3OS2A 3JYTA 4N5SA 1F21A 3KJVA 2IGIA 3CQ8A 1JL1A 4DQRA 4C8OA 1ITGA 4ELVA 3NHGA 2VWKA 3VQ9A 2HHQA 2A1RA 3VQ7A 1D9DA 1BGXT 4OKKA 3B6OA 1QS4A 4EZ6A 2KQ2A 1QHTA 1C0TA 4DLEA 1Q9YA 4FJGA 4W5NA 3D0PA 2DTUA 3DM2A 1C1CA 1WSFA 1T7PA 4K8ZA 3KLFA 3OYHA 4CFAA 4DSLA 4M42A 1RBSA 2Z1HA 2YNFA 3ITHA 5J2QA 4E7HA 4NCGA 3LANA 4O4GA 3HM9A 5HROA 1SL0A 4CGGA 1HYVA 4DTPA 4M3TA 5CZ1A 2WONA 4F2RA 4QCLA 1JLGA 4DTNA 1KTQA 1RBVA 3TAPA 1BQNA 1SL2A 1CXQA 3VQEA 4FJIA 1FK9A 4KHQA 1RCHA 3LZJA 1Y97A 3NGYA 1DTQA 3ZT3A 3LP1A 4CEZA 3S3NA 4N76A 3VQ5A 3LP0A 1LAVA 4Z4CA 4KKOA 1SKSA 4Z4IA 1IKWA 1RTHA 4M3UA 1NJWA 1HYZA 3CFOA 3PO5A 3OYDA 2BE2A 5I3UA 5FRMA 4M3YA 4DFPA 3KLIA 4N41A 2G8FA 1KCFA 4NCBA 1RT4A 1BI4A 4C8KA 1TAUA 1LW2A 4KPYA 4CJVA 3LPUA 3KK1A 3TR8A 1HYSA 1WAFA 1T05A 1L3SA 4ZTJA 3AVGA 2BGGA 2XO7A 1G15A 4DSKA 3C6TA 4KTZA 1NOZA 1NK4A 4B9TA 1BIUA 1WSHA 1KFDA 1YTAA 2FBYA 2Z1GA 4FLYA 2YNHA 4FLTA 4DQSA 1XHZA 2IOCA 4OVLA 4CJFA 3OYFA 1KVCA 4FJ5A 3KK3A 1HQEA 3QLHA 1XWLA 4CGJA 2NUBA 4ELUA 3RWUA 4OLAA 3HYFA 3B6PA 3C94A 2PYLA 1TVRA 4B9VA 3OYEA 1SUQA 5CYQA 1TK5A 1WAJA 1L3UA 1K6YA 1IKYA 3LAKA 3HP6A 1BL3A 2X74A 2BDPA 3M8RA 3QESA 3V1QA 3OYMA 3SPZA 4K8XA 3NFAA 1IG9A 2O4IA 1J54A 3AVIA 4CE9A 4J2AA 4O55A 2JGUA 4AILC 1EXQA 1RDDA 3QNNA 4J2EA 4FJMA 5CYMA 5K14A 4RW7A 3HXMA 4L8RB 2VWJA 1L3TA 1ZBIA 4JS4A 4B8CA 2OZSA 1W9HA 3FFIA 3S9HA 1SKWA 1RT2A 4MQ3A 4FJJA 1C6VA 1U47A 3CM5A 3L3VA 4Z0UA 1Z26A 3LP3A 1NK8A 1D8YA 4ELTA 1TKXA 1VSKA 2IDOA 3QO9A 2P1JA 1TL1A 4IG0A 4E1NA 3V9WA 4F3OA 3QETA 4B9UA 4FW2A 4CGFA 3AVNA 4HCBA 4H4OA 3BGRA 4LSNA 1JXBA 1TL3A 3U3GA 2X6NA 2HHUA 4CGDA 1LV5A 4B9LA 4LH4A 1NK5A 2IAJA 2DFHA 3AA2A 4AHVA 4BDZA 1NK9A 4FK0A 1BIZA 4CEAA 5D3GA 2ZQBA 2G8WA 1DTTA 3K5NA 2B4JA 2G8KA 3IAYA 3VA3A 1JLAA 3QIOA 1NOYA 3VQBA 4FJNA 2P5OA 5EU7A 1HJRA 2ITGA 1CXUA 3IRXA 4DMNA 5HRNA 4DF8A 4W5RA 3L2QA 3I0SA 3NGZA 3MEGA 4I9LA 5J2NA 4FW1A 2PY5A 1Q9XA 4F3TA 1J9AA 1NK0A 3OY9A 2HHWA 4CK3A 2E4LA 2XRIA 3MXIA 1X1PA 3SUNA 3DOLA 1I3AA 1DLOA 3K5LA 3VA0A 1TKTA 4NYNA 1IO2A 5I42A 3NF7A 1KSPA 4NYFA 3HPOA 1RTIA 3P1GA 5HRPA 2RF2A 4CF0A 3L2UA 1ZBLA 4FZYA 4KB1A 1FXXA 4CF2A 3V4IA 2R7YA 4CJWA 1SL1A 3UIQA 3QIPA 3VQQA 4EZ9A 1WSJA 4BWJA 3AVLA 4F4KA 3G10A 3S3MA 1HMVA 1UA0A 3CYMA 4I2QA 2HHTA 2E6MA 3DLBA 1UWBA 2YV0X 4DQPA 1LWFA 1Z25A 4C8NA 4CJ3A 3NH0A 4Z4FA 4B3OA 1C1BA 4W5QA 4CFCA 3MEEA 5HRRA 4DTXA 3T3FA 1KLNA 1S9EA 2HHXA 1BCOA 3NCIA 3OYIA 2RPIA 4WE1A 2IS3A 1W0HA 2HB5A 5FDLA 3RMAA 3HPGA 3SUQA 3IG1A 4CF8A 3MAQA 3DI6A 1KLMA 1QSYA 1JL2A 2G8UA 4F2SA 1HNVA 2KTQA 3O3HA 3ZSXA 2D0AA 3D45A 3LWMA 4KREA 4CJPA 3KKRA 3ZSWA 4M45A 1RILA 3ASMA 3LALA 3O3GA 4CFBA 4CEBA 4Y1CA 4FK2A 3EY1A 3AO5A 3TAEA 4IG3A 1WSEA 3AO4A 1JKHA 1RT1A 3ZSYA 2XHBA 2FBXA 4QOZB 1REVA 1ZBUA 3L2VA 4I7FA 1NKBA 2VG7A 1WLJA 3AVCA 5T7BA 4AHTA 3HO1A 1JLEA 3HP9A 4B9SA 1HRHA 2QXFA 4DFMA 4BE2A 4CESA 2QKBA 4N47A 1Q8IA 2EHGA 1IKVA 5FROA 1YTUA 1BHLA 3AVAA 1WSIA 1S9GA 3MXJA 4IFYA 3ZT2A 4AHCA 4E89A 4CHYA 4OPJA 3TWHA 4FLWA 4JRQA 3AVKA 1B9FA 4B9NA 3HT3A 1NK6A 4FVMA 3CM6A 5SWMA 1ZYQA 4CJSA 4CHZA 1LW0A 4OKJA 4DFKA 4TSXA 3V9SA 3PY8A 4KO0A 1XHXA 4CK2A 4FK4A 3RMCA 2IC3A 4O44A 4BE1A 5JS1A 3EZ5A 3MEDA 1UOCA 1TK8A 1RBRA 3AO1A 1NJYA 1TV6A 2RN2A 4IBNA 3AVMA 4CJTA 2FC0A 3OYAA 4XIUA 1ZBHA 1C0UA 1QTMA 4E7KA 4DQIA 1VSLA 1VSDA 4RW6A 3L3UA 4W5TA 3V9UA 3ALYA 3OJUA 4PWDA 1EKEA 4CJ5A 3OJSA 4O0JA 5DMRA 4CHOA 4PUOA 3S3OA 3TAGA 4DSFA 2KFZA 2A1SA 4E7JA 1GOAA 3G0ZA 1RDCA 4AHSA 3LP2A 3MECA 3U6FA 1HQUA 3LPTA 1U49A 1KFSA 4IKFA 2F8TA 2HHVA 4J2BA 1CZBA 1FKOA 3WNHA 5C25A 1UAXA 1A5WA 3SV4A 1FKPA 3WNEA 3ZSOA 2DY4A 1HNIA 3T19A 3EYZA 4DTSA 3A2FA 3WNGA 3QEVA 3OS0A 4HTUA 1O1WA 2VG5A 4OJRA 3V1RA 3NGIA 3V9ZA 2FBVA 4LD0A 3VQCA 1YT3A 3OYCA 2ATQA 1NJXA 2YKMA 4CJKA 2XY8A 3ZT0A 3OS1A 3V6DA 3L2WA 2QKKA 5HP1A 1CZ9A 2YKNA 4Y1DA 3OYGA 3K57A 4RW4A 4LSLA 5C24A 4BE0A 3RR8A 4NCAA 4FJ8A 3DLKA 3I0RA 2X78A 3TAMA 1VRUA 4B8AB 4CEQA 3RTVA 3QEWA 3V81A 4R5PA 3KLEA 4M3RA 3RMDA 4CCHA 4FJ7A 1IKXA 4KHSA 3DLGA 1QE1A 1I39A 2ZD1A 3QERA 4E7IA 3TABA 3ZCMA 3SJJA 2HVHA 3KKSA 4BWMA 5KRTA 4YNQA 1NJZA 1WSGA 5J2PA 3SQ2A 4CGHA 4DU1A 1S6PA 1ASVA 4CJEA 4E3SA 2ETJA 2PZSA 1WN7A 1BCMA 4ID5A 2YNGA 4LH5A 4PY5A 3HK2A 3KD5E 5CY4A 4HUEA 5HBMA 3AV9A 1VSHA 3PO4A 4FJXA 1VSIA 5KTQA 1X9SA 2OPSA 1JLQA 3ZT4A 1YVUA 3M8SA 2YHBA 4HUFA 4DTMA 3HPHA 4KAZA 4M3WA 3HL8A 1CLQA 3AA3A 4I2PA 4KV8A 1S1TA 1NKEA 4JS5A 3NDKA 1XI1A 3AVJA 3WNFA 1VSMA 1KVAA 1QSLA 1HPZA 3AVBA 3SQ0A 4FJHA 3L8BA 4DSJA 4I9QA 3M8PA 1C1AA 1VSJA 2KW4A 1RT7A 4CK1A 4Q5VA 2G8IA 2HVIA 3DLRA 3NBPA 1IH7A 5E41A 4FM0A 2HMIA 3ZSRA 4M3XA 4AHRA 1A5XA 4CHPA 3SQ1A 4E0DA 5KI6A 4CIGA 4CF9A 1LWEA 3JSMA 1X9WA 4MFBA 1U4BA 2E6LA 4DTOA 4AH9A 3TI0A 1GOCA 4JRPA 2HW3A 1RBTA 4CJLA 4DTJA 1TAQA 1MU2A 1JLCA 1JLBA 3RMBA 4DWIA 2KFNA 2HNDA 3O4NA 1T8EA 2ZE2A 2I5JA 4DS4A 1LWCA 3OYLA 3PX0A 4KHYA 3NE6A 4O5BA 5KGWA 4DTRA 4Z4EA 1L3VA 2GBZA 1JXEA 3H08A 4HVJA 4CHNA 2Y1JA 1B9DA 2VG6A 3KIOA 4E1MA 1RTJA 3T1AA 3NF9A 4KFBA 1U45A 2GV9A 4Z4HA 2YNIA 1QSSA 4W5OA 2HNYA 1S5JA 3AA4A 3AVHA 3QEXA 4KI4A 4H8KA 3VQ6A 3ZSQA 1S6QA 4FM1A 4CEFA 4LY7A 3KK2A 3ISNC 2LSNA 5JS2A 3DOKA 4N56A 1ASUA 3QNOA 3OYBA 4AHUA 2EX3A 5J2MA 1SKRA 2JLEA 3VQPA 3RRGA 2OZMA 1L5UA 1N6QA 4EP4A 3DRPA 3NH2A 1WNSA 5CZ2A 5KGXA 4HUGA 5J1EA 3L2RA 4BDPA 4FZXC 1EETA 5KRSA 3I8DA 4CJRA 1D5AA 4Z4GA 1BI4B 1GOBA 4UQGA 3RRHA 3VQDA 3OYNA 4BDYA 1RT3A 3TAQA 4F8RA 4B08A 1J53A 3SZ2A 2D0BA 4ID1A 3KTQA 4KB0A 4CIEA 3QEPA 2HHSA 1VSEA 4DQQA 3SYZA 1RT5A 1SV5A 3K5OA 4H4MA 3MXMA 3RR7A 4OLBA 4CEOA 1B92A 4FLVA 3SNNA 3K2PA 3VQ4A 1U48A 2RKIA 3PX6A 4KI6A 1NK7A 1RT6A 3AA5X 4CHQA 4B9MA 2FBTA 1U04A 3CFRA 1NKCA 1S1WA 4HCCA 1RTDA 3SQ4A 4FLZA 3HJFA 2YHAA 1D9FA 4O0IA 3C95A 1S1UA 4OPKA 4FJKA 4CEDA 1BQMA 4FCYA 4DFJA 1R0AA 3HSTB 3O3FA 3NF8A 2G8HA 3K5MA 4RG8A 3SPYA 3LZIA 4PA1A 4JLHA 1TGOA 4DG1A 4GMJB 2Y1IA 3CG7A 4DU3A 4KHNA 2QK9A 2O4GA 4KTWA 1RDAA 3C6UA 4CERA 4FJ9A 3AO3A 2KZZA 3DMJA 1TKZA 4GW6A 2D5RA 4ICLA 3SUOA 4DS5A 3DLHA 3OYJA 2OPQA 2Z1IA 1LAWA 4KHUA 3AVFA 4FZZA 3V1OA 3DYAA 4FLUA 3ZSZA 3TANA 1KRPA 1J5OA 1N5YA 4FLXA 3KD1E 4FXDA 4CECA 3ZSVA 4ZTFA 3P83D 3F9KA 1T03A 3KLHA 4M41A 3LAMA 1UA1A 4E7LA 3HVTA 4CFDA 1KVBA 3V9XA 1TK0A 4OGEA 4QAGA 5DK5A 3VQAA 3VN5A 3CFPA 5SZTA 4BACA 2XY7A 4C8LA 1BISA 2OPRA 3ULDA 3QEIA 4GVMA 1A5VA 2P51A 4CIFA 3NAEA 3SCXA 3IS9A 4OGCA 2GUIA 1ASWA 4IDKA 3LWLA 3U3YA 2X6SA 4OKEA 1EP4A 3VQ8A 4FM2A 3PV8A 4J2DA 4M3ZA 3TARA 4Q0BA 3SV3A 2BANA 2D0CA 4EP5A 3SI6A 2DFFA 4DU4A 1C0MA 2Q3SA 3NF6A 1VSFA 1VRTA 3DRSA 5C42A 1X9MA 2P5GA 4KHWA 3OYKA 2W42A 3KLGA 2AJQA 4PQUA 3QINA 3M8QA 4IFVA 2PYJA 2F8SA 4KRFA 1RBUA 2Z1JA 2B5JA 2F96A 4YFUA 4HHTA 4FJLA 4G1QA 4ZHRA 5FRNA 3ZT1A 1EX4A 3THVA 3HVRA 3TAFA 3BDPA 3O4QA 2B6AA 3PX4A 4CJQA 2OYQA 4CJ4A 3OVNA 3K59A 3LDSA 4C8MA 5HRSA 3NH1A 4RW9A 4DSEA 4DF4A 3AO2A 2OA8A 4DLGA 1TKDA 2G8VA 1RNHA 1S1VA 1RDBA 1S1XA 3P5JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K58 A;  2XY6 A;  4RW8 A;  4CGI A;  3E01 A;  1QQC A;  4CEE A;  4CF1 A;  4CJU A;  2WOM A;  1ZBF A;  3DLE A;  4E19 A;  4KTQ A;  1XC9 A;  2XY5 A;  4DSI A;  2HNZ A;  4DTU A;  4FYD A;  3SUP A;  2DFE A;  1JLF A;  2KZM A;  3F73 A;  5HLF A;  1VK0 A;  2OPP A;  3DRR A;  3PUF A;  3OS2 A;  3JYT A;  4N5S A;  1F21 A;  3KJV A;  2IGI A;  3CQ8 A;  1JL1 A;  4DQR A;  4C8O A;  1ITG A;  4ELV A;  3NHG A;  2VWK A;  3VQ9 A;  2HHQ A;  2A1R A;  3VQ7 A;  1D9D A;  1BGX T;  4OKK A;  3B6O A;  1QS4 A;  4EZ6 A;  2KQ2 A;  1QHT A;  1C0T A;  4DLE A;  1Q9Y A;  4FJG A;  4W5N A;  3D0P A;  2DTU A;  3DM2 A;  1C1C A;  1WSF A;  1T7P A;  4K8Z A;  3KLF A;  3OYH A;  4CFA A;  4DSL A;  4M42 A;  1RBS A;  2Z1H A;  2YNF A;  3ITH A;  5J2Q A;  4E7H A;  4NCG A;  3LAN A;  4O4G A;  3HM9 A;  5HRO A;  1SL0 A;  4CGG A;  1HYV A;  4DTP A;  4M3T A;  5CZ1 A;  2WON A;  4F2R A;  4QCL A;  1JLG A;  4DTN A;  1KTQ A;  1RBV A;  3TAP A;  1BQN A;  1SL2 A;  1CXQ A;  3VQE A;  4FJI A;  1FK9 A;  4KHQ A;  1RCH A;  3LZJ A;  1Y97 A;  3NGY A;  1DTQ A;  3ZT3 A;  3LP1 A;  4CEZ A;  3S3N A;  4N76 A;  3VQ5 A;  3LP0 A;  1LAV A;  4Z4C A;  4KKO A;  1SKS A;  4Z4I A;  1IKW A;  1RTH A;  4M3U A;  1NJW A;  1HYZ A;  3CFO A;  3PO5 A;  3OYD A;  2BE2 A;  5I3U A;  5FRM A;  4M3Y A;  4DFP A;  3KLI A;  4N41 A;  2G8F A;  1KCF A;  4NCB A;  1RT4 A;  1BI4 A;  4C8K A;  1TAU A;  1LW2 A;  4KPY A;  4CJV A;  3LPU A;  3KK1 A;  3TR8 A;  1HYS A;  1WAF A;  1T05 A;  1L3S A;  4ZTJ A;  3AVG A;  2BGG A;  2XO7 A;  1G15 A;  4DSK A;  3C6T A;  4KTZ A;  1NOZ A;  1NK4 A;  4B9T A;  1BIU A;  1WSH A;  1KFD A;  1YTA A;  2FBY A;  2Z1G A;  4FLY A;  2YNH A;  4FLT A;  4DQS A;  1XHZ A;  2IOC A;  4OVL A;  4CJF A;  3OYF A;  1KVC A;  4FJ5 A;  3KK3 A;  1HQE A;  3QLH A;  1XWL A;  4CGJ A;  2NUB A;  4ELU A;  3RWU A;  4OLA A;  3HYF A;  3B6P A;  3C94 A;  2PYL A;  1TVR A;  4B9V A;  3OYE A;  1SUQ A;  5CYQ A;  1TK5 A;  1WAJ A;  1L3U A;  1K6Y A;  1IKY A;  3LAK A;  3HP6 A;  1BL3 A;  2X74 A;  2BDP A;  3M8R A;  3QES A;  3V1Q A;  3OYM A;  3SPZ A;  4K8X A;  3NFA A;  1IG9 A;  2O4I A;  1J54 A;  3AVI A;  4CE9 A;  4J2A A;  4O55 A;  2JGU A;  4AIL C;  1EXQ A;  1RDD A;  3QNN A;  4J2E A;  4FJM A;  5CYM A;  5K14 A;  4RW7 A;  3HXM A;  4L8R B;  2VWJ A;  1L3T A;  1ZBI A;  4JS4 A;  4B8C A;  2OZS A;  1W9H A;  3FFI A;  3S9H A;  1SKW A;  1RT2 A;  4MQ3 A;  4FJJ A;  1C6V A;  1U47 A;  3CM5 A;  3L3V A;  4Z0U A;  1Z26 A;  3LP3 A;  1NK8 A;  1D8Y A;  4ELT A;  1TKX A;  1VSK A;  2IDO A;  3QO9 A;  2P1J A;  1TL1 A;  4IG0 A;  4E1N A;  3V9W A;  4F3O A;  3QET A;  4B9U A;  4FW2 A;  4CGF A;  3AVN A;  4HCB A;  4H4O A;  3BGR A;  4LSN A;  1JXB A;  1TL3 A;  3U3G A;  2X6N A;  2HHU A;  4CGD A;  1LV5 A;  4B9L A;  4LH4 A;  1NK5 A;  2IAJ A;  2DFH A;  3AA2 A;  4AHV A;  4BDZ A;  1NK9 A;  4FK0 A;  1BIZ A;  4CEA A;  5D3G A;  2ZQB A;  2G8W A;  1DTT A;  3K5N A;  2B4J A;  2G8K A;  3IAY A;  3VA3 A;  1JLA A;  3QIO A;  1NOY A;  3VQB A;  4FJN A;  2P5O A;  5EU7 A;  1HJR A;  2ITG A;  1CXU A;  3IRX A;  4DMN A;  5HRN A;  4DF8 A;  4W5R A;  3L2Q A;  3I0S A;  3NGZ A;  3MEG A;  4I9L A;  5J2N A;  4FW1 A;  2PY5 A;  1Q9X A;  4F3T A;  1J9A A;  1NK0 A;  3OY9 A;  2HHW A;  4CK3 A;  2E4L A;  2XRI A;  3MXI A;  1X1P A;  3SUN A;  3DOL A;  1I3A A;  1DLO A;  3K5L A;  3VA0 A;  1TKT A;  4NYN A;  1IO2 A;  5I42 A;  3NF7 A;  1KSP A;  4NYF A;  3HPO A;  1RTI A;  3P1G A;  5HRP A;  2RF2 A;  4CF0 A;  3L2U A;  1ZBL A;  4FZY A;  4KB1 A;  1FXX A;  4CF2 A;  3V4I A;  2R7Y A;  4CJW A;  1SL1 A;  3UIQ A;  3QIP A;  3VQQ A;  4EZ9 A;  1WSJ A;  4BWJ A;  3AVL A;  4F4K A;  3G10 A;  3S3M A;  1HMV A;  1UA0 A;  3CYM A;  4I2Q A;  2HHT A;  2E6M A;  3DLB A;  1UWB A;  2YV0 X;  4DQP A;  1LWF A;  1Z25 A;  4C8N A;  4CJ3 A;  3NH0 A;  4Z4F A;  4B3O A;  1C1B A;  4W5Q A;  4CFC A;  3MEE A;  5HRR A;  4DTX A;  3T3F A;  1KLN A;  1S9E A;  2HHX A;  1BCO A;  3NCI A;  3OYI A;  2RPI A;  4WE1 A;  2IS3 A;  1W0H A;  2HB5 A;  5FDL A;  3RMA A;  3HPG A;  3SUQ A;  3IG1 A;  4CF8 A;  3MAQ A;  3DI6 A;  1KLM A;  1QSY A;  1JL2 A;  2G8U A;  4F2S A;  1HNV A;  2KTQ A;  3O3H A;  3ZSX A;  2D0A A;  3D45 A;  3LWM A;  4KRE A;  4CJP A;  3KKR A;  3ZSW A;  4M45 A;  1RIL A;  3ASM A;  3LAL A;  3O3G A;  4CFB A;  4CEB A;  4Y1C A;  4FK2 A;  3EY1 A;  3AO5 A;  3TAE A;  4IG3 A;  1WSE A;  3AO4 A;  1JKH A;  1RT1 A;  3ZSY A;  2XHB A;  2FBX A;  4QOZ B;  1REV A;  1ZBU A;  3L2V A;  4I7F A;  1NKB A;  2VG7 A;  1WLJ A;  3AVC A;  5T7B A;  4AHT A;  3HO1 A;  1JLE A;  3HP9 A;  4B9S A;  1HRH A;  2QXF A;  4DFM A;  4BE2 A;  4CES A;  2QKB A;  4N47 A;  1Q8I A;  2EHG A;  1IKV A;  5FRO A;  1YTU A;  1BHL A;  3AVA A;  1WSI A;  1S9G A;  3MXJ A;  4IFY A;  3ZT2 A;  4AHC A;  4E89 A;  4CHY A;  4OPJ A;  3TWH A;  4FLW A;  4JRQ A;  3AVK A;  1B9F A;  4B9N A;  3HT3 A;  1NK6 A;  4FVM A;  3CM6 A;  5SWM A;  1ZYQ A;  4CJS A;  4CHZ A;  1LW0 A;  4OKJ A;  4DFK A;  4TSX A;  3V9S A;  3PY8 A;  4KO0 A;  1XHX A;  4CK2 A;  4FK4 A;  3RMC A;  2IC3 A;  4O44 A;  4BE1 A;  5JS1 A;  3EZ5 A;  3MED A;  1UOC A;  1TK8 A;  1RBR A;  3AO1 A;  1NJY A;  1TV6 A;  2RN2 A;  4IBN A;  3AVM A;  4CJT A;  2FC0 A;  3OYA A;  4XIU A;  1ZBH A;  1C0U A;  1QTM A;  4E7K A;  4DQI A;  1VSL A;  1VSD A;  4RW6 A;  3L3U A;  4W5T A;  3V9U A;  3ALY A;  3OJU A;  4PWD A;  1EKE A;  4CJ5 A;  3OJS A;  4O0J A;  5DMR A;  4CHO A;  4PUO A;  3S3O A;  3TAG A;  4DSF A;  2KFZ A;  2A1S A;  4E7J A;  1GOA A;  3G0Z A;  1RDC A;  4AHS A;  3LP2 A;  3MEC A;  3U6F A;  1HQU A;  3LPT A;  1U49 A;  1KFS A;  4IKF A;  2F8T A;  2HHV A;  4J2B A;  1CZB A;  1FKO A;  3WNH A;  5C25 A;  1UAX A;  1A5W A;  3SV4 A;  1FKP A;  3WNE A;  3ZSO A;  2DY4 A;  1HNI A;  3T19 A;  3EYZ A;  4DTS A;  3A2F A;  3WNG A;  3QEV A;  3OS0 A;  4HTU A;  1O1W A;  2VG5 A;  4OJR A;  3V1R A;  3NGI A;  3V9Z A;  2FBV A;  4LD0 A;  3VQC A;  1YT3 A;  3OYC A;  2ATQ A;  1NJX A;  2YKM A;  4CJK A;  2XY8 A;  3ZT0 A;  3OS1 A;  3V6D A;  3L2W A;  2QKK A;  5HP1 A;  1CZ9 A;  2YKN A;  4Y1D A;  3OYG A;  3K57 A;  4RW4 A;  4LSL A;  5C24 A;  4BE0 A;  3RR8 A;  4NCA A;  4FJ8 A;  3DLK A;  3I0R A;  2X78 A;  3TAM A;  1VRU A;  4B8A B;  4CEQ A;  3RTV A;  3QEW A;  3V81 A;  4R5P A;  3KLE A;  4M3R A;  3RMD A;  4CCH A;  4FJ7 A;  1IKX A;  4KHS A;  3DLG A;  1QE1 A;  1I39 A;  2ZD1 A;  3QER A;  4E7I A;  3TAB A;  3ZCM A;  3SJJ A;  2HVH A;  3KKS A;  4BWM A;  5KRT A;  4YNQ A;  1NJZ A;  1WSG A;  5J2P A;  3SQ2 A;  4CGH A;  4DU1 A;  1S6P A;  1ASV A;  4CJE A;  4E3S A;  2ETJ A;  2PZS A;  1WN7 A;  1BCM A;  4ID5 A;  2YNG A;  4LH5 A;  4PY5 A;  3HK2 A;  3KD5 E;  5CY4 A;  4HUE A;  5HBM A;  3AV9 A;  1VSH A;  3PO4 A;  4FJX A;  1VSI A;  5KTQ A;  1X9S A;  2OPS A;  1JLQ A;  3ZT4 A;  1YVU A;  3M8S A;  2YHB A;  4HUF A;  4DTM A;  3HPH A;  4KAZ A;  4M3W A;  3HL8 A;  1CLQ A;  3AA3 A;  4I2P A;  4KV8 A;  1S1T A;  1NKE A;  4JS5 A;  3NDK A;  1XI1 A;  3AVJ A;  3WNF A;  1VSM A;  1KVA A;  1QSL A;  1HPZ A;  3AVB A;  3SQ0 A;  4FJH A;  3L8B A;  4DSJ A;  4I9Q A;  3M8P A;  1C1A A;  1VSJ A;  2KW4 A;  1RT7 A;  4CK1 A;  4Q5V A;  2G8I A;  2HVI A;  3DLR A;  3NBP A;  1IH7 A;  5E41 A;  4FM0 A;  2HMI A;  3ZSR A;  4M3X A;  4AHR A;  1A5X A;  4CHP A;  3SQ1 A;  4E0D A;  5KI6 A;  4CIG A;  4CF9 A;  1LWE A;  3JSM A;  1X9W A;  4MFB A;  1U4B A;  2E6L A;  4DTO A;  4AH9 A;  3TI0 A;  1GOC A;  4JRP A;  2HW3 A;  1RBT A;  4CJL A;  4DTJ A;  1TAQ A;  1MU2 A;  1JLC A;  1JLB A;  3RMB A;  4DWI A;  2KFN A;  2HND A;  3O4N A;  1T8E A;  2ZE2 A;  2I5J A;  4DS4 A;  1LWC A;  3OYL A;  3PX0 A;  4KHY A;  3NE6 A;  4O5B A;  5KGW A;  4DTR A;  4Z4E A;  1L3V A;  2GBZ A;  1JXE A;  3H08 A;  4HVJ A;  4CHN A;  2Y1J A;  1B9D A;  2VG6 A;  3KIO A;  4E1M A;  1RTJ A;  3T1A A;  3NF9 A;  4KFB A;  1U45 A;  2GV9 A;  4Z4H A;  2YNI A;  1QSS A;  4W5O A;  2HNY A;  1S5J A;  3AA4 A;  3AVH A;  3QEX A;  4KI4 A;  4H8K A;  3VQ6 A;  3ZSQ A;  1S6Q A;  4FM1 A;  4CEF A;  4LY7 A;  3KK2 A;  3ISN C;  2LSN A;  5JS2 A;  3DOK A;  4N56 A;  1ASU A;  3QNO A;  3OYB A;  4AHU A;  2EX3 A;  5J2M A;  1SKR A;  2JLE A;  3VQP A;  3RRG A;  2OZM A;  1L5U A;  1N6Q A;  4EP4 A;  3DRP A;  3NH2 A;  1WNS A;  5CZ2 A;  5KGX A;  4HUG A;  5J1E A;  3L2R A;  4BDP A;  4FZX C;  1EET A;  5KRS A;  3I8D A;  4CJR A;  1D5A A;  4Z4G A;  1BI4 B;  1GOB A;  4UQG A;  3RRH A;  3VQD A;  3OYN A;  4BDY A;  1RT3 A;  3TAQ A;  4F8R A;  4B08 A;  1J53 A;  3SZ2 A;  2D0B A;  4ID1 A;  3KTQ A;  4KB0 A;  4CIE A;  3QEP A;  2HHS A;  1VSE A;  4DQQ A;  3SYZ A;  1RT5 A;  1SV5 A;  3K5O A;  4H4M A;  3MXM A;  3RR7 A;  4OLB A;  4CEO A;  1B92 A;  4FLV A;  3SNN A;  3K2P A;  3VQ4 A;  1U48 A;  2RKI A;  3PX6 A;  4KI6 A;  1NK7 A;  1RT6 A;  3AA5 X;  4CHQ A;  4B9M A;  2FBT A;  1U04 A;  3CFR A;  1NKC A;  1S1W A;  4HCC A;  1RTD A;  3SQ4 A;  4FLZ A;  3HJF A;  2YHA A;  1D9F A;  4O0I A;  3C95 A;  1S1U A;  4OPK A;  4FJK A;  4CED A;  1BQM A;  4FCY A;  4DFJ A;  1R0A A;  3HST B;  3O3F A;  3NF8 A;  2G8H A;  3K5M A;  4RG8 A;  3SPY A;  3LZI A;  4PA1 A;  4JLH A;  1TGO A;  4DG1 A;  4GMJ B;  2Y1I A;  3CG7 A;  4DU3 A;  4KHN A;  2QK9 A;  2O4G A;  4KTW A;  1RDA A;  3C6U A;  4CER A;  4FJ9 A;  3AO3 A;  2KZZ A;  3DMJ A;  1TKZ A;  4GW6 A;  2D5R A;  4ICL A;  3SUO A;  4DS5 A;  3DLH A;  3OYJ A;  2OPQ A;  2Z1I A;  1LAW A;  4KHU A;  3AVF A;  4FZZ A;  3V1O A;  3DYA A;  4FLU A;  3ZSZ A;  3TAN A;  1KRP A;  1J5O A;  1N5Y A;  4FLX A;  3KD1 E;  4FXD A;  4CEC A;  3ZSV A;  4ZTF A;  3P83 D;  3F9K A;  1T03 A;  3KLH A;  4M41 A;  3LAM A;  1UA1 A;  4E7L A;  3HVT A;  4CFD A;  1KVB A;  3V9X A;  1TK0 A;  4OGE A;  4QAG A;  5DK5 A;  3VQA A;  3VN5 A;  3CFP A;  5SZT A;  4BAC A;  2XY7 A;  4C8L A;  1BIS A;  2OPR A;  3ULD A;  3QEI A;  4GVM A;  1A5V A;  2P51 A;  4CIF A;  3NAE A;  3SCX A;  3IS9 A;  4OGC A;  2GUI A;  1ASW A;  4IDK A;  3LWL A;  3U3Y A;  2X6S A;  4OKE A;  1EP4 A;  3VQ8 A;  4FM2 A;  3PV8 A;  4J2D A;  4M3Z A;  3TAR A;  4Q0B A;  3SV3 A;  2BAN A;  2D0C A;  4EP5 A;  3SI6 A;  2DFF A;  4DU4 A;  1C0M A;  2Q3S A;  3NF6 A;  1VSF A;  1VRT A;  3DRS A;  5C42 A;  1X9M A;  2P5G A;  4KHW A;  3OYK A;  2W42 A;  3KLG A;  2AJQ A;  4PQU A;  3QIN A;  3M8Q A;  4IFV A;  2PYJ A;  2F8S A;  4KRF A;  1RBU A;  2Z1J A;  2B5J A;  2F96 A;  4YFU A;  4HHT A;  4FJL A;  4G1Q A;  4ZHR A;  5FRN A;  3ZT1 A;  1EX4 A;  3THV A;  3HVR A;  3TAF A;  3BDP A;  3O4Q A;  2B6A A;  3PX4 A;  4CJQ A;  2OYQ A;  4CJ4 A;  3OVN A;  3K59 A;  3LDS A;  4C8M A;  5HRS A;  3NH1 A;  4RW9 A;  4DSE A;  4DF4 A;  3AO2 A;  2OA8 A;  4DLG A;  1TKD A;  2G8V A;  1RNH A;  1S1V A;  1RDB A;  1S1X A;  3P5J A; 
#chains in the Genus database with same CATH topology
 2QTD A;  3D2E A;  4RW8 A;  4CJU A;  3VEY A;  5AQF A;  2WOM A;  3EEQ A;  4I6M A;  4KTQ A;  4X64 K;  2XY5 A;  2DFE A;  3PUF A;  2OPP A;  3CJB A;  3OS2 A;  3JYT A;  3CQ8 A;  3D6R A;  4DQR A;  4C8O A;  2NNW A;  1VQ6 N;  4FWL A;  3VQ7 A;  1D9D A;  4JI4 K;  2Q2R A;  2CH6 A;  1C0T A;  2RHK A;  4FWQ A;  1WSF A;  1T7P A;  3OYH A;  1RBS A;  3H3O B;  3MN5 A;  2CH5 A;  4NCG A;  2NZT A;  4M3T A;  4NO7 A;  3FZF A;  1RBV A;  1BA0 A;  1CXQ A;  4BRO A;  4PL8 A;  4ILJ A;  1Y97 A;  3NGY A;  3ZT3 A;  3LP1 A;  2HMP A;  4N76 A;  4Z4C A;  4KKO A;  1NJW A;  4H5T A;  4M7X A;  4WFA L;  4DFP A;  4M3Y A;  4H03 B;  1W2B M;  3CCU N;  3C7N A;  4C8K A;  2O8E B;  4KPY A;  3CJ1 A;  1WAF A;  2ZGY A;  1T05 A;  1QQM A;  4DSK A;  3C6T A;  3I33 A;  1NK4 A;  1BIU A;  4C23 A;  4AF1 A;  4DQS A;  4GV9 A;  3RSE B;  2P9I B;  2PYL A;  3G71 N;  4DR2 K;  5CYQ A;  1TK5 A;  5AQZ A;  3IKM A;  1L3U A;  1K6Y A;  1KXP A;  2ZJQ L;  3LAK A;  2F9W A;  3HP6 A;  2X74 A;  3M8R A;  1HUX A;  3V1Q A;  5AFU A;  3G25 A;  3OYM A;  1J54 A;  2JGU A;  3QNN A;  4J2E A;  4DR7 K;  1ZBI A;  4B8C A;  1SKW A;  4MDB A;  1K8K A;  4ELT A;  1Z26 A;  3LP3 A;  1TKX A;  4F3O A;  2IVO A;  3QET A;  2E1Y A;  1DGK N;  4JI8 K;  1JXB A;  5BRH A;  4IEI A;  4DV4 K;  3KK7 A;  2YCH A;  3U3G A;  3AGK A;  4H5W A;  5EX5 A;  4LH4 A;  2DPN A;  1BIZ A;  2G8W A;  4BGB A;  2B4J A;  2O8B A;  2G8K A;  3IAY A;  4H0T B;  5EXW A;  4IFE A;  2ITG A;  5CHI A;  1CXU A;  4DF8 A;  4LF7 K;  4W5R A;  3L2Q A;  3MEG A;  1J9A A;  3OY9 A;  1X1P A;  3SUN A;  3CC2 N;  1DLO A;  3VA0 A;  1IO2 A;  3HPO A;  2RF2 A;  4RCH A;  4CF0 A;  1ZBL A;  4DR4 K;  3OTO K;  1FXX A;  4B3R K;  4A2A A;  3V4I A;  3U9Z A;  4QS7 A;  1KAY A;  3G10 A;  1UA0 A;  5C0Y A;  3CJC A;  2HHT A;  3MN7 A;  2O8F B;  4B3S K;  4CJ3 A;  1C1B A;  4W5Q A;  3T3F A;  5HRR A;  1BCO A;  1ATN A;  4WE1 A;  3THX A;  4CF8 A;  1KLM A;  1LOT B;  5KQ8 A;  3PIP L;  4JN4 A;  4GKJ K;  4JI7 K;  4IOA L;  2D0A A;  2VYP A;  4DV2 K;  3ZSW A;  3EN9 A;  4BG8 A;  3TSU A;  1JKH A;  3DXK A;  4QOZ B;  5IT9 O;  3LDN A;  1P90 A;  1ZBU A;  4I7F A;  4JV5 K;  2VG7 A;  1WLJ A;  4BC2 A;  1BUP A;  5T7B A;  3HP9 A;  4B9S A;  2QXF A;  4BE2 A;  4CES A;  2NRT A;  4N47 A;  2HF4 A;  3SAF A;  1YTU A;  3AVK A;  1B9F A;  3R3L A;  4BRP A;  4B9N A;  5JIC A;  1TUU A;  1LW0 A;  1TUY A;  3H46 O;  3F9M A;  1XHX A;  4CK2 A;  3RMC A;  1TK8 A;  3AO1 A;  2RN2 A;  1N34 K;  4PKH A;  1YJ9 N;  1ZBH A;  3U9D A;  1QTM A;  4RW6 A;  4W5T A;  4FSV A;  3OJU A;  1EKE A;  4CJ5 A;  4CZM A;  5DMR A;  4CHO A;  5JVG L;  4BRI A;  2KFZ A;  3G0Z A;  3LP2 A;  3MEC A;  1HQU A;  3LPT A;  2HHV A;  3J7Z O;  3VF6 A;  4JKA A;  3Q7C A;  1CZB A;  3KVG A;  5C25 A;  1UAX A;  2QWN A;  3WNE A;  3ZSO A;  4CBU A;  3A2F A;  3GG4 A;  3OS0 A;  3THX B;  2A40 A;  1O1W A;  3WXJ A;  3NGI A;  3VQC A;  1YT3 A;  1Q7Y O;  2Q0U A;  2YKM A;  1YVN A;  5AQU A;  4R79 A;  3ZT0 A;  3L0Q A;  3L2W A;  2YI1 A;  1VRU A;  4CEQ A;  3RTV A;  4M3R A;  4FJ7 A;  3TAB A;  3QER A;  3SJJ A;  4E7I A;  2HVH A;  4YOU A;  4AQY K;  3CD6 N;  1VQO N;  4DR6 K;  3CJA A;  2ETJ A;  2PZS A;  3EL2 A;  4ID5 A;  3TPQ A;  1S22 A;  1U2V A;  4LH5 A;  3WQU A;  5DM7 L;  3AV9 A;  1ESV A;  3PO4 A;  3ZYY X;  2NLX A;  3LL3 A;  1BDG A;  2KKZ A;  2OPS A;  5AQH A;  2ZJP L;  3ZT4 A;  4IEE A;  1CLQ A;  3AA3 A;  3VEV A;  5JLF A;  4H0X B;  1VSM A;  1D4X A;  1QSL A;  1HPZ A;  4FJH A;  1VSJ A;  1QHA A;  3CC4 N;  3JS6 A;  1EQY A;  4M3X A;  3SQ1 A;  1A5X A;  1HKC A;  5KI6 A;  1BO5 O;  1NLV A;  4AH9 A;  1GOC A;  1QZ5 A;  1MU2 A;  4DWI A;  2HND A;  2ZE2 A;  2IVN A;  1NBW A;  1L3V A;  4CHN A;  4GV3 A;  4B3M K;  4E1M A;  1RTJ A;  3NF9 A;  1U45 A;  2GV9 A;  3ID8 A;  2YNI A;  2QXL A;  1S5J A;  4XEI A;  4A2B A;  3VQ6 A;  3ZSQ A;  5GIO A;  3ISN C;  3QNO A;  3OYB A;  3VQP A;  2QI2 A;  1WNS A;  4NLB A;  5KGX A;  4HUG A;  5J1E A;  3L2R A;  5FPE A;  1K73 O;  4BDP A;  3FR0 A;  2O8E A;  1ATS A;  5AZJ B;  3OYN A;  4B9Q A;  1Q86 O;  3TAQ A;  3SBT A;  4ID1 A;  2UXB K;  2HHS A;  4DQQ A;  4LF5 K;  1RT5 A;  1ZC6 A;  2YX6 A;  5ELZ A;  4OLB A;  1NGG A;  1YHQ N;  3SNN A;  1U48 A;  1VQ5 N;  2RKI A;  2HBM A;  4M7Y A;  3AA5 X;  1OVY A;  2FBT A;  1Q81 O;  4A62 A;  4A5A A;  1S1U A;  3E9P A;  5HOO A;  3O3F A;  3VOV A;  4RG8 A;  4PA1 A;  4JLH A;  3FFK B;  4GMJ B;  2Y1I A;  4KHN A;  4KTW A;  1RDA A;  4B1U B;  2QWQ A;  3DMJ A;  3H3N O;  3OYJ A;  2Z1I A;  1LAW A;  4EHT A;  3AVF A;  4JD2 A;  1KRP A;  1J5O A;  1N5Y A;  3KD1 E;  4FXD A;  3C6A A;  3JAM O;  3P83 D;  3F9K A;  4JKF A;  2WC9 A;  1UA1 A;  2GEM A;  2P9S A;  2XY7 A;  4BAC A;  1BIS A;  3ULD A;  3P31 A;  1A5V A;  3T69 A;  4CIF A;  2E88 A;  3PSF A;  4IDK A;  3LWL A;  3U3Y A;  2X6S A;  3THY A;  5A2Q O;  4J2D A;  3PV8 A;  4BQL A;  3TAR A;  3SV3 A;  2BAN A;  2D0C A;  2DFF A;  1VSF A;  2ASM A;  3D2F B;  4JNE A;  3OYK A;  5LL6 Z;  3KLG A;  1N36 K;  3M8Q A;  2F8S A;  1U6Z A;  4J8F A;  2B5J A;  2F96 A;  2P9P A;  4HHT A;  4G1Q A;  3THV A;  1EX4 A;  3H6E A;  3HVR A;  3TAF A;  2I7N A;  2JWL A;  3A5N C;  3T7Z A;  3SLC A;  4G9Z A;  4DF4 A;  1BU6 O;  4DLG A;  1RNH A;  1RDB A;  3P5J A;  1N33 K;  3CQX A;  2XY6 A;  2FLO A;  4CEE A;  4YDU A;  3VF2 A;  2KHO A;  4DTU A;  1BG3 A;  4YOV A;  1JLF A;  3BZC A;  4X66 K;  2KZM A;  3RSE A;  1Y64 A;  3VTH A;  3DRR A;  3KJV A;  5BRD A;  2P9P B;  4ELV A;  2HHQ A;  2PFU A;  1SZ2 A;  4BY9 C;  1QS4 A;  4EZ6 A;  3WQT A;  1Q9Y A;  4B1X B;  3VTI A;  2DTU A;  3SBG A;  2HST A;  3IMX A;  4CBX A;  3KLF A;  4DSL A;  4CFA A;  4BC5 A;  2Z1H A;  2YNF A;  3ITH A;  2P9U B;  3LAN A;  1HYV A;  4DTP A;  4F2R A;  1T44 A;  4QCL A;  2UUB K;  1JLG A;  4DTN A;  3TAP A;  1SL2 A;  4KHQ A;  1FK9 A;  1GLC G;  1RCH A;  4CEZ A;  4H0V B;  1VQ8 N;  1RFQ A;  1LAV A;  4Z4I A;  1IKW A;  3SAG A;  4CD3 A;  1HYZ A;  2F9T A;  3MX5 A;  1HX1 A;  2BE2 A;  5I3U A;  3KLI A;  5M1K A;  4IO8 A;  1BI4 A;  1T6C A;  2GUP A;  1LW2 A;  5KPR A;  1HYS A;  3MK6 A;  3O1B A;  1FJG K;  1E4F T;  5CE3 A;  1MWK A;  1WSH A;  1KFD A;  1XHZ A;  5AQN A;  4CJF A;  1YJN N;  3OYF A;  4IDH A;  4FVU A;  4FJ5 A;  3KK3 A;  2CGL A;  1XWL A;  4MDA A;  4ELU A;  1JCE A;  3RWU A;  3HYF A;  4OLA A;  1YXQ A;  3EE8 A;  3A5M C;  3OYE A;  3BEX A;  5AJ3 K;  1IKY A;  3FGU A;  2VCP A;  2O4I A;  1LCU A;  2PBD A;  3BP8 A;  1RDD A;  5K14 A;  4RW7 A;  4KHP K;  3HXM A;  4L8R B;  2OZS A;  3FFI A;  4FPB A;  4MQ3 A;  3U4L A;  3QFP A;  4B3T K;  3TU5 A;  3OA9 A;  4BR4 A;  1U47 A;  1NK8 A;  3FLC O;  4JKE A;  1W97 L;  2IDO A;  4E1N A;  4B9U A;  4CD1 A;  4CGF A;  3AVN A;  4HCB A;  3O6W A;  4H4O A;  4B1V A;  1RGI A;  4DHY A;  2VGN A;  4CGD A;  3AA2 A;  2DFH A;  4BDZ A;  1NK9 A;  5D3G A;  1M1K O;  3P39 A;  3K5N A;  2O8F A;  3LDL A;  3VA3 A;  3QIO A;  4EAH D;  5AQM A;  2P5O A;  4NXM K;  4JHD B;  1HJR A;  3IRX A;  5HRN A;  4H5R A;  5J2N A;  3I0S A;  4U7B A;  4I9L A;  4FW1 A;  4KBO A;  4K41 A;  2HHW A;  2E4L A;  1I3A A;  4DCH A;  4NYN A;  2D4W A;  3NF7 A;  5AQK A;  1GLB G;  1KSP A;  4IOC L;  1XNQ K;  5IWA K;  4EHU A;  4DV6 K;  1YIT N;  3VQQ A;  1WSJ A;  1HMV A;  2YJE A;  2EWS A;  4I2Q A;  2E6M A;  2YV0 X;  3R1X A;  3NH0 A;  1KLN A;  2W6K A;  3NCI A;  2RPI A;  5FDL A;  2D0O A;  3HPG A;  1QSY A;  3DI6 A;  3M3Z A;  3H45 C;  2ZWH A;  3O3H A;  3LWM A;  3J7Y P;  3KKR A;  3O4W A;  1RIL A;  3ASM A;  4KH4 A;  5BRE A;  4Z94 A;  3AO4 A;  3ZSY A;  2O8C B;  2FBX A;  1MA9 B;  1REV A;  3L2V A;  3ZX0 A;  3AVC A;  3J80 O;  3HO1 A;  3I55 N;  1NGI A;  2QKB A;  5BPN A;  2EHG A;  3AVA A;  4IFY A;  3SJH A;  4E89 A;  4CHY A;  3E1Y A;  4JRQ A;  3Q7B A;  3CCJ N;  1E3M A;  1XC3 A;  4FVM A;  3F2K A;  5SWM A;  1ZYQ A;  4WYB A;  5AQJ A;  3QBW A;  4DV0 K;  3PY8 A;  4KO0 A;  4BC3 A;  1J6Z A;  2IC3 A;  4O44 A;  5JS1 A;  3EZ5 A;  3CF5 L;  1UOC A;  3AAP A;  1TV6 A;  4BVP A;  3AVM A;  3BZK A;  3IDH A;  4E7K A;  4DQI A;  1VSL A;  1VSD A;  1ATR A;  3L3U A;  2O8C A;  3W0L A;  3ALY A;  3OW2 M;  3VMF B;  4FWN A;  4PUO A;  3S3O A;  2QWR A;  2IIR A;  3CXC M;  2OCE A;  3E66 A;  1WB9 A;  2A1S A;  1RDC A;  3KWG A;  3QB0 A;  4AHS A;  4IKF A;  4J2B A;  4BRA A;  1FKO A;  4FOI A;  2VGM A;  1NMD A;  1FKP A;  3EYZ A;  3CET A;  2E2Q A;  2V51 B;  4DQ8 A;  4OJR A;  2OTJ N;  2AA4 A;  3V1R A;  3V9Z A;  4GVE A;  5AQO A;  4CZH A;  3DXM B;  4CJK A;  5LJW A;  2XY8 A;  3WXK A;  3OS1 A;  2QKK A;  5HP1 A;  1CZ9 A;  3OYG A;  2F7T A;  4BE0 A;  4FJ8 A;  3DLK A;  4KH6 A;  3V81 A;  1NJI O;  1RTD A;  4BR7 A;  4LFC K;  4KHS A;  3DLG A;  3EO3 A;  4WFN L;  1QE1 A;  3AAQ A;  3KKS A;  4BWM A;  5KRT A;  3UKU A;  4DU1 A;  1ASV A;  1DEJ A;  2QWP A;  3G4S N;  4JI3 K;  1WN7 A;  2YNG A;  4PY5 A;  4LC9 B;  5CY4 A;  4HUE A;  1JLQ A;  2VWB A;  3SMS A;  4KAZ A;  4DTM A;  3HPH A;  3HL8 A;  4LFB K;  4I2P A;  4KV8 A;  1C0G A;  4JYA K;  3FZH A;  3MN9 A;  4ILH A;  5KQD A;  3SQ0 A;  3L8B A;  4I9Q A;  4FO0 A;  2E2O A;  4CK1 A;  1RT7 A;  1P8Z A;  5M1O A;  3QFU A;  2HMI A;  4B1W B;  4E1J A;  4AHR A;  3O8M A;  4JKD A;  3DXK B;  4CF9 A;  1U4B A;  4DTO A;  1HKG A;  2ASO A;  1WBD A;  1Z6R A;  2QWO A;  1RBT A;  3RVC A;  3RMB A;  2KFN A;  3O4N A;  4DS4 A;  5C2F A;  3PX0 A;  4KHY A;  1O13 A;  4O5B A;  5KGW A;  2P9K A;  4WF9 L;  3H08 A;  4HVJ A;  2Y1J A;  3UKR B;  5I9E B;  1QSS A;  3O08 A;  2HNY A;  4W5O A;  1Q18 A;  3O9S A;  3WT0 A;  3WUH A;  4H0Y B;  4CEF A;  5JS2 A;  2LSN A;  3VPZ A;  4AHU A;  2EX3 A;  5J2M A;  3EE9 A;  5GAG P;  5AQL A;  2OZM A;  3I56 N;  1EET A;  3K9K A;  4DB3 A;  4CJR A;  1D5A A;  2NRW A;  3I8D A;  1MWM A;  4UQG A;  4HTL A;  4BRN A;  1GLF O;  4BDY A;  3PIO L;  4YOW A;  1J53 A;  2D0B A;  1U2V B;  3VEO A;  4K43 A;  3GE1 A;  1VSE A;  1SV5 A;  4H4M A;  3MXM A;  1GLL O;  2O8B B;  4PKI A;  3PX6 A;  4IOX A;  1RT6 A;  4B9M A;  4DV7 K;  1NKC A;  1NGC A;  2NRH A;  4CZK A;  3SQ4 A;  4O0I A;  3C95 A;  3O9U A;  4FJK A;  1R0A A;  4X65 K;  3NF8 A;  1HNZ K;  3C6H A;  3SPY A;  4AM7 A;  3IFR A;  1FW6 A;  5LMU K;  1K8K B;  3C7N B;  2F4V K;  3ZET B;  2QK9 A;  4DUZ K;  4FJ9 A;  3C6U A;  2D5R A;  3SUO A;  1RDU A;  1QZ6 A;  5F0X A;  1EWQ A;  4KHU A;  3V1O A;  4FLU A;  4CW7 B;  3CPW M;  1X3N A;  4CEC A;  3ZSV A;  3DWL A;  3OBY A;  3HVT A;  4CFD A;  3ENO A;  1TK0 A;  3VN5 A;  3CFP A;  5SZT A;  4BRM A;  2OPR A;  3SCX A;  5BPL A;  4Q0B A;  5M1F A;  3WXL A;  1NOY A;  3ATV A;  4DR3 K;  2Q3S A;  1VRT A;  3DRS A;  4KHW A;  4PQU A;  1NNE A;  3D2F A;  1RBU A;  4YFU A;  3L6Q A;  3VGM A;  5FRN A;  3BDP A;  3ULE A;  3O4Q A;  2B6A A;  2QWL A;  3PX4 A;  4B1Z A;  3THY B;  2OYQ A;  3K59 A;  3LDS A;  4BRE A;  3NH1 A;  4RW9 A;  4DSE A;  3CME N;  3HOT A;  1S1V A;  3VGK A;  1S1X A;  5AR0 A;  1NU0 A;  4CGI A;  2FF3 B;  1W7A A;  3E01 A;  4CF1 A;  3MCP A;  3DLE A;  1ZBF A;  1XC9 A;  1I94 K;  3QDK A;  3F73 A;  5HLF A;  1NWK A;  1VK0 A;  4N5S A;  4BR5 A;  1JL1 A;  5BR8 K;  3CIP A;  5M1Q A;  1K8A O;  2VWK A;  2A1R A;  3B6O A;  1IBM K;  2KQ2 A;  1QHT A;  3R9P A;  4Y0W A;  4DLE A;  4FJG A;  4W5N A;  2ITM A;  3DM2 A;  1C1C A;  3FE1 A;  4O8U A;  1HNW K;  4MLE A;  5AQI A;  1NGH A;  1NGA A;  3NVK A;  3HM9 A;  1SL0 A;  4CGG A;  2WON A;  4FWK A;  2BGG A;  1KTQ A;  3ZEU A;  3FZK A;  2W6L A;  3LZJ A;  1DTQ A;  4YOY A;  2NRZ A;  3DAW A;  4FPA A;  4M3U A;  2NRX A;  3PO5 A;  3OYD A;  5FRM A;  2W41 A;  2G8F A;  1KCF A;  4BRH A;  3A8Y A;  4NCB A;  2O8D B;  4RWT A;  5JLH A;  1TAU A;  3VEN A;  3AGR A;  4FOE A;  3ENB A;  4CJV A;  3LPU A;  3TR8 A;  4JEP A;  1KQS M;  4ZTJ A;  3CPE A;  2XO7 A;  2E1Z A;  1NOZ A;  4B9T A;  5AQQ A;  2FBY A;  2Z1G A;  2YNH A;  1YAG A;  4H5N A;  4OVL A;  1KVC A;  3QLH A;  2NUB A;  3HI0 A;  3C94 A;  3TSQ A;  3W3D A;  1SUQ A;  4FWP A;  1HNX K;  1WAJ A;  1HLU A;  3QES A;  4X62 K;  3K0S A;  3NFA A;  4CE9 A;  4J2A A;  4O55 A;  4AIL C;  1EXQ A;  4FJM A;  5CYM A;  4WQ5 A;  2VWJ A;  4JS4 A;  1RDW X;  1RT2 A;  1S3X A;  4NXN K;  1IBL K;  4Z0U A;  1D8Y A;  1BOT O;  3V9W A;  3EKU A;  2P1J A;  1TL1 A;  4IG0 A;  3AY9 A;  3QIC A;  2P9I A;  1GLJ O;  3BGR A;  2HHU A;  3QBX A;  2IAJ A;  4AHV A;  3CJ7 A;  4FK0 A;  3MWP A;  4CEA A;  2ZQB A;  1DTT A;  3TTF A;  4FL9 A;  4L3Q A;  5ADX A;  5EU7 A;  5GIP A;  5B8H A;  2BTF A;  2Q1N A;  3NGZ A;  4IZ9 A;  3ENH A;  2PY5 A;  4F3T A;  4B1Y B;  1NK0 A;  4QS9 A;  3K9J A;  2WFB A;  2BUP A;  4BRL A;  2XRI A;  3MXI A;  1SQK A;  1TKT A;  5I42 A;  4ISE A;  5HRP A;  5BPM A;  4CF2 A;  2R7Y A;  1XQS C;  3U8X A;  3QIP A;  4GY2 B;  3CMA N;  3UIQ A;  4EZ9 A;  2GWK A;  3S3M A;  2V7Y A;  3CYM A;  5C10 A;  5E26 A;  1WUA A;  3DLB A;  4WQ4 A;  4C8N A;  1Z25 A;  4JKC A;  2KTQ A;  4CFC A;  3MEE A;  5BRF A;  2HHX A;  2E2N A;  2ZGZ A;  3RMA A;  3SUQ A;  2YHX A;  4O8K A;  3IG1 A;  3CCQ N;  1C0F A;  3M5R A;  3ZSX A;  3D45 A;  3BF3 A;  4M45 A;  5H1S Q;  3N4Q A;  4C1N K;  4CEB A;  4K25 A;  4Y1C A;  3EY1 A;  3TAE A;  5HL7 L;  2XHB A;  1RT1 A;  4A61 A;  1NKB A;  2ASP A;  4U67 L;  2P9N B;  1HRH A;  2P9U A;  4DFM A;  3O80 A;  3MMV A;  1Q8I A;  1IKV A;  5FRO A;  1BHL A;  3MXJ A;  1S9G A;  3ULE B;  4JD2 B;  1EO1 A;  4FLW A;  2WBN A;  1XUP O;  3HT3 A;  3HM8 A;  4CJS A;  5LMN K;  4OKJ A;  2NRV A;  4TSX A;  4NLC A;  4CJ7 A;  4BE1 A;  4KH5 A;  3MED A;  4FWM A;  1WBB A;  3AAR A;  2CGK A;  1C0U A;  4FWO A;  3SMP A;  4CZI A;  3V9U A;  4PWD A;  4PHT X;  2UUA K;  3TAG A;  4CVN E;  4DSF A;  4E7J A;  3U6F A;  4NCA A;  1U49 A;  4DV5 K;  1KFS A;  3A5L C;  1OKJ A;  3WNH A;  4LF4 K;  2UXD K;  4PKG A;  3VEW A;  3SV4 A;  3T19 A;  4DTS A;  3WNG A;  4BR2 A;  1GLE G;  4HTU A;  3BY5 A;  2VG5 A;  2OAN A;  2FBV A;  1X9J A;  3GDQ A;  2ATQ A;  3T1Y K;  4PL7 A;  5C24 A;  3UB5 A;  3RR8 A;  3QEW A;  4B8A B;  4BG9 A;  5C15 A;  3RMD A;  1OVQ A;  3BF1 A;  3HZ6 A;  3I8B A;  1I39 A;  5LY3 A;  3ZLJ A;  5GAH P;  4YNQ A;  1WSG A;  4CGH A;  1NM1 A;  2A6A A;  1S6P A;  1NGB A;  2A42 A;  3WEE A;  1BCM A;  3HK2 A;  1JCF A;  5HBM A;  4FJX A;  1VSI A;  5KTQ A;  1X9S A;  5GIN A;  3HRG A;  1VQM N;  2YHB A;  5FPN A;  4HUF A;  4M3W A;  4NB4 A;  4V19 S;  4JS5 A;  3NDK A;  3AVJ A;  1YUW A;  1KVA A;  3AVB A;  4DSJ A;  2HF3 A;  4CZL A;  2KW4 A;  3H1V X;  4Q5V A;  3DLR A;  3ZSR A;  3O1W A;  3NMU A;  4E0D A;  4CIG A;  1LWE A;  1X9W A;  1YF5 L;  4YOX A;  2HW3 A;  1ZBS A;  1DT9 A;  1TAQ A;  1JLC A;  3FZL A;  2ZM6 K;  2I5J A;  1LWC A;  3OYL A;  4YOT A;  1E4G T;  4DTR A;  2OTL N;  1VQK N;  4Z4E A;  2GBZ A;  1B9D A;  3P38 A;  4BRC A;  2FXU A;  3T1A A;  4KFB A;  4Z4H A;  4BQZ A;  1QQN A;  2UUC K;  3HBT A;  1S6Q A;  4LY7 A;  3KK2 A;  4N56 A;  1ASU A;  3E9L A;  2WUS A;  3LM2 A;  3S41 A;  2JLE A;  3DRP A;  5CZ2 A;  4FZX C;  1J5E K;  5KRS A;  3N4P A;  2P9L A;  4F8R A;  4B08 A;  4BRG A;  1N8R O;  3KTQ A;  3EZW A;  4CIE A;  3B8A X;  3QEP A;  4YOR A;  3VES A;  3K5O A;  2QEX N;  2GEL A;  3RR7 A;  4WCE L;  4CEO A;  1B92 A;  4H5V A;  3K2P A;  4KI6 A;  1NK7 A;  4CHQ A;  2GX9 A;  2YHW A;  1U04 A;  4ISF A;  3CFR A;  3J7A P;  1TYQ A;  3MCA B;  4JHD A;  4FLZ A;  2Q0R A;  1D9F A;  4OPK A;  4CED A;  4DV1 K;  4FCY A;  4DFJ A;  4OO1 J;  3BUZ B;  3HST B;  3HOS A;  4DG1 A;  5JMV A;  4GKK K;  4CER A;  2O4G A;  3GOI A;  3J81 O;  3AO3 A;  2KZZ A;  4GW6 A;  4DS5 A;  1CZA N;  2D1K A;  4XH1 A;  5CR4 A;  1NGE A;  3DYA A;  4FLX A;  4MO5 A;  4ZTF A;  3O5B A;  1T03 A;  5AZJ A;  4E7L A;  1HPM A;  3D2E B;  3V9X A;  4OGE A;  4QAG A;  5DK5 A;  1YI2 N;  3QEI A;  5F1X A;  3NAE A;  4OGC A;  2GUI A;  1ASW A;  3THW B;  2IVP A;  1EP4 A;  3VQ8 A;  2A41 A;  4DU4 A;  1C0M A;  1X9M A;  2ZF5 O;  2P5G A;  3CQY A;  1Z05 A;  3QIN A;  2PYJ A;  1NGD A;  3VET A;  4LF6 K;  4KRF A;  4FJL A;  4ZHR A;  5AQV A;  3H1Q A;  1JCG A;  4IO9 L;  5AQR A;  4BGA A;  4C8M A;  2FSJ A;  2OA8 A;  2A3Z A;  1X3M A;  2G8V A;  3CC7 N;  4CZE A;  3K58 A;  4WQ5 C;  1QQC A;  2H3G X;  4E19 A;  2UU9 K;  4DSI A;  2HNZ A;  5AFU H;  4FYD A;  4ILG B;  3SUP A;  4FWS A;  2Q36 A;  1XMQ K;  3KZB A;  3NVM A;  3DXM A;  1F21 A;  2IGI A;  2A5X A;  4IJA A;  1ITG A;  3NHG A;  3VQ9 A;  5GAD P;  3CER A;  3CCV N;  3LM9 A;  1BGX T;  4OKK A;  1ILY A;  3D0P A;  4K8Z A;  4JKB A;  1KAZ A;  4M42 A;  4XH4 A;  5FPM A;  5J2Q A;  4E7H A;  4O4G A;  5HRO A;  2FSN A;  3R8E A;  5CZ1 A;  1XMO K;  4AM6 A;  1T3V A;  1YIJ N;  4FJI A;  1BQN A;  3VQE A;  1K9M O;  3S3N A;  3P4I A;  5DM6 L;  3VQ5 A;  3LP0 A;  3OHR A;  1SKS A;  3PSI A;  1RTH A;  2V52 B;  3CFO A;  3O9R A;  1EWR A;  1GLD G;  4N41 A;  3J8A A;  3UKU B;  1RT4 A;  5FLX O;  3M6G A;  3KK1 A;  3VEX A;  4WQ4 C;  3HSC A;  3AVG A;  1L3S A;  4GV6 A;  1G15 A;  5EOY A;  4KTZ A;  4FLT A;  4FLY A;  1YTA A;  1NK5 A;  5AQX A;  2IOC A;  1HQE A;  5FPD A;  4CGJ A;  4H0P A;  3B6P A;  2HBJ A;  1TVR A;  4B9V A;  2GTD A;  3QML A;  4MLH A;  4CZJ A;  4YHH K;  1NG9 A;  4JI1 K;  2P9K B;  1BL3 A;  2BDP A;  2I7P A;  3SPZ A;  4K8X A;  1IG9 A;  3AVI A;  4JAX A;  2V7Z A;  3JXU A;  1YJW N;  1L3T A;  4YDU C;  1W9H A;  2P9S B;  3S9H A;  5AQW A;  5TKW A;  4FJJ A;  1C6V A;  5BR9 A;  4EFH A;  3CM5 A;  3L3V A;  1VSK A;  3QO9 A;  3TTC A;  3LDP A;  1KC8 O;  4FW2 A;  4LSN A;  3OBW A;  1TL3 A;  1HKB A;  2X6N A;  4JK8 A;  1VQL N;  4M63 C;  2YHY A;  1LV5 A;  4B9L A;  4JI0 K;  4OX9 K;  1VQ9 N;  4BR0 A;  1VQ7 N;  1HR0 K;  1JLA A;  1XNR K;  3VQB A;  4FJN A;  1V4T A;  2E2P A;  4DMN A;  3C65 A;  1V4S A;  1Q9X A;  3PLA A;  1G99 A;  4CK3 A;  1IG8 A;  3DOL A;  1NMN A;  3K5L A;  5AQT A;  4I6M B;  4NYF A;  1RTI A;  3P1G A;  4BR9 A;  4FZY A;  3L2U A;  4KB1 A;  5JVH L;  3ID6 A;  4DKW A;  3R6M A;  4DUY K;  4CJW A;  4OPA A;  1SL1 A;  1QVG M;  3CHW A;  5AQY A;  3AVL A;  4BWJ A;  4F4K A;  4QS8 A;  1H1V A;  5C12 A;  4DQP A;  1UWB A;  4Z4F A;  1LWF A;  4B3O A;  4LF9 K;  1T6D A;  4DTX A;  1S9E A;  3OYI A;  2QA4 N;  2IS3 A;  3MN6 A;  1W0H A;  2HB5 A;  1WOQ A;  4UY8 O;  1BWF O;  3MAQ A;  1JL2 A;  2WTU A;  2G8U A;  1HNV A;  4F2S A;  1OH7 A;  4KRE A;  4CJP A;  4A59 A;  4DR5 K;  4F9O A;  4WFB L;  2E5L K;  1SS6 A;  3LAL A;  3O3G A;  4CFB A;  1QVF M;  4FK2 A;  3AO5 A;  4CZF A;  4IG3 A;  1WSE A;  2GWJ A;  4BRK A;  5BN8 A;  4AHT A;  4JK7 A;  1JLE A;  1NGF A;  1SAZ A;  4K0K K;  1VQ4 N;  1WSI A;  4AHC A;  2BH1 A;  4OPJ A;  3ZT2 A;  3CCS N;  4EIA A;  3TWH A;  2E20 A;  2ZJR L;  3LDO A;  4DV3 K;  1NK6 A;  3CM6 A;  4BC4 A;  4CHZ A;  3UKR A;  4BRD A;  1M90 O;  4DFK A;  1KD1 O;  3V9S A;  4FK4 A;  4XH5 A;  1RBR A;  1NJY A;  4IBN A;  4CJT A;  2FC0 A;  3OYA A;  3DLL L;  4XIU A;  3SK3 A;  4DR1 K;  3FZM A;  4JI2 K;  3UE5 A;  2UYT A;  2VQE K;  2O8D A;  3OJS A;  4O0J A;  1ZXO A;  2KLA A;  3ATU A;  3ZX3 A;  1GOA A;  3IUC A;  2F8T A;  4ISG A;  4YY3 K;  2HHH K;  1A5W A;  2DY4 A;  3T1H K;  1HNI A;  3CCL N;  3ZEU B;  3QEV A;  1HJO A;  2HBL A;  4O5F A;  4LD0 A;  1IBK K;  3OYC A;  5AZI A;  4LFA K;  1NJX A;  1KAX A;  3SAH A;  2JWK A;  4JKG B;  3V6D A;  2YKN A;  4Y1D A;  3K57 A;  3D7E O;  4RW4 A;  4LSL A;  5AQS A;  1TYQ B;  3I0R A;  2X78 A;  3TAM A;  4CCH A;  4R5P A;  3KLE A;  1IKX A;  2UXC K;  2ZD1 A;  3ZCM A;  3CCR N;  4OPH A;  5EY4 A;  1NJZ A;  5J2P A;  3SQ2 A;  3KWI A;  4CJE A;  4E3S A;  4IJN A;  4LF8 K;  3O9Q A;  3KD5 E;  5AQP A;  2P9L B;  5EVZ A;  1VSH A;  2CGJ A;  2W40 A;  1YVU A;  3HTV A;  3M8S A;  3A5O C;  3G6E N;  4CBW A;  2QWM A;  1S1T A;  1NKE A;  1XI1 A;  3WNF A;  3TSP A;  4CI6 A;  3M8P A;  1C1A A;  2HVI A;  2G8I A;  1VAZ A;  5M1N A;  4CZG A;  3NBP A;  1IH7 A;  5E41 A;  4FM0 A;  2P9N A;  4CHP A;  4BRQ A;  4C1N I;  3JSM A;  4MFB A;  2E6L A;  3GL1 A;  5F2R A;  3TI0 A;  4JRP A;  3WXM B;  4CJL A;  4DTJ A;  2YJF A;  1JLB A;  1R59 O;  1T8E A;  3L4I A;  3NE6 A;  3MWT A;  2QW9 A;  4MO4 A;  1JXE A;  1QQO A;  2FSK A;  2E8A A;  2VG6 A;  3CI5 A;  5ADX H;  3KIO A;  4IWV A;  5AQG A;  4BVO A;  1VQN N;  3DJC A;  3AVH A;  3AA4 A;  3QEX A;  4KI4 A;  2D0P A;  4H8K A;  1OH5 A;  4JKG A;  5E84 A;  4FM1 A;  3ZET A;  3DOK A;  4FWR A;  3CCE N;  1SKR A;  3GBT A;  3RRG A;  3M1F A;  1L5U A;  5BN9 A;  4EP4 A;  3NH2 A;  1N6Q A;  4A57 A;  1S72 N;  5MLC Q;  3EKS A;  4Z4G A;  4JKH A;  3C0B A;  1BI4 B;  1GOB A;  3RRH A;  3VQD A;  2VQF K;  1RT3 A;  3SZ2 A;  2HBK A;  3VEZ A;  4KB0 A;  2QM1 A;  5GAE P;  5TKY A;  3WEE B;  3SYZ A;  3MX2 A;  4JI6 K;  3LDQ A;  4FLV A;  5KPZ A;  4HWI A;  3VQ4 A;  4IXC A;  3L4Q A;  3O9T A;  4GNI A;  1S1W A;  4HCC A;  3WXI A;  1JJ2 M;  3HJF A;  2YHA A;  3E9O A;  1BQM A;  4A5B A;  2G8H A;  3TTD A;  4RTF D;  3K5M A;  3LZI A;  3KHY A;  1TGO A;  1BA1 A;  1VHX A;  2NRR A;  3CG7 A;  4DU3 A;  3CCM N;  4JK9 A;  5C2D A;  1TKZ A;  4ICL A;  3DLH A;  2OPQ A;  5M1P A;  4FZZ A;  3TAN A;  3ZSZ A;  2RE2 A;  2HOE A;  1NGJ A;  1OH8 A;  3KLH A;  4M41 A;  3LAM A;  1Q82 O;  2PAV A;  2Q31 A;  1KVB A;  3MDQ A;  3VQA A;  4C8L A;  2FF6 A;  4GVM A;  5LJV A;  3CJ9 A;  2P51 A;  3VGL A;  3A0I X;  3IS9 A;  2AP1 A;  4OKE A;  4M3Z A;  4FM2 A;  5AZI B;  4EP5 A;  3SI6 A;  3NF6 A;  5C42 A;  4BRF A;  2W42 A;  1IV0 A;  2AJQ A;  4JI5 K;  3ZX2 A;  1GLA G;  4IFV A;  1DKG D;  1VQP N;  2Z1J A;  3F5T A;  3ZT1 A;  4K42 A;  1N32 K;  4H0O A;  1OH6 A;  5KPT A;  3THW A;  4CJQ A;  3VER A;  4CJ4 A;  3OVN A;  1MDU B;  5HRS A;  2Q97 A;  2J4R A;  3AO2 A;  1TKD A;  3VF4 A;  1IJJ A; 
#chains in the Genus database with same CATH homology
 3K58 A;  2XY6 A;  4RW8 A;  4CGI A;  3E01 A;  1QQC A;  4CEE A;  4CF1 A;  4CJU A;  2WOM A;  1ZBF A;  3DLE A;  4E19 A;  4KTQ A;  1XC9 A;  2XY5 A;  4DSI A;  2HNZ A;  4DTU A;  4FYD A;  3SUP A;  2DFE A;  1JLF A;  2KZM A;  3F73 A;  5HLF A;  1VK0 A;  2OPP A;  3DRR A;  3PUF A;  3OS2 A;  3JYT A;  4N5S A;  1F21 A;  3KJV A;  2IGI A;  3CQ8 A;  1JL1 A;  4DQR A;  4C8O A;  1ITG A;  4ELV A;  3NHG A;  2VWK A;  3VQ9 A;  2HHQ A;  2A1R A;  3VQ7 A;  1D9D A;  1BGX T;  4OKK A;  3B6O A;  1QS4 A;  4EZ6 A;  2KQ2 A;  1QHT A;  1C0T A;  4DLE A;  1Q9Y A;  4FJG A;  4W5N A;  3D0P A;  2DTU A;  3DM2 A;  1C1C A;  1WSF A;  1T7P A;  4K8Z A;  3KLF A;  3OYH A;  4CFA A;  4DSL A;  4M42 A;  1RBS A;  2Z1H A;  2YNF A;  3ITH A;  5J2Q A;  4E7H A;  4NCG A;  3LAN A;  4O4G A;  3HM9 A;  5HRO A;  1SL0 A;  4CGG A;  1HYV A;  4DTP A;  4M3T A;  5CZ1 A;  2WON A;  4F2R A;  4QCL A;  1JLG A;  4DTN A;  1KTQ A;  1RBV A;  3TAP A;  1BQN A;  1SL2 A;  1CXQ A;  3VQE A;  4FJI A;  1FK9 A;  4KHQ A;  1RCH A;  3LZJ A;  1Y97 A;  3NGY A;  1DTQ A;  3ZT3 A;  3LP1 A;  4CEZ A;  3S3N A;  4N76 A;  3VQ5 A;  3LP0 A;  1LAV A;  4Z4C A;  4KKO A;  1SKS A;  4Z4I A;  1IKW A;  1RTH A;  4M3U A;  1NJW A;  1HYZ A;  3CFO A;  3PO5 A;  3OYD A;  2BE2 A;  5I3U A;  5FRM A;  4M3Y A;  4DFP A;  3KLI A;  4N41 A;  2G8F A;  1KCF A;  4NCB A;  1RT4 A;  1BI4 A;  4C8K A;  1TAU A;  1LW2 A;  4KPY A;  4CJV A;  3LPU A;  3KK1 A;  3TR8 A;  1HYS A;  1WAF A;  1T05 A;  1L3S A;  4ZTJ A;  3AVG A;  2BGG A;  2XO7 A;  1G15 A;  4DSK A;  3C6T A;  4KTZ A;  1NOZ A;  1NK4 A;  4B9T A;  1BIU A;  1WSH A;  1KFD A;  1YTA A;  2FBY A;  2Z1G A;  4FLY A;  2YNH A;  4FLT A;  4DQS A;  1XHZ A;  2IOC A;  4OVL A;  4CJF A;  3OYF A;  1KVC A;  4FJ5 A;  3KK3 A;  1HQE A;  3QLH A;  1XWL A;  4CGJ A;  2NUB A;  4ELU A;  3RWU A;  4OLA A;  3HYF A;  3B6P A;  3C94 A;  2PYL A;  1TVR A;  4B9V A;  3OYE A;  1SUQ A;  5CYQ A;  1TK5 A;  1WAJ A;  1L3U A;  1K6Y A;  1IKY A;  3LAK A;  3HP6 A;  1BL3 A;  2X74 A;  2BDP A;  3M8R A;  3QES A;  3V1Q A;  3OYM A;  3SPZ A;  4K8X A;  3NFA A;  1IG9 A;  2O4I A;  1J54 A;  3AVI A;  4CE9 A;  4J2A A;  4O55 A;  2JGU A;  4AIL C;  1EXQ A;  1RDD A;  3QNN A;  4J2E A;  4FJM A;  5CYM A;  5K14 A;  4RW7 A;  3HXM A;  4L8R B;  2VWJ A;  1L3T A;  1ZBI A;  4JS4 A;  4B8C A;  2OZS A;  1W9H A;  3FFI A;  3S9H A;  1SKW A;  1RT2 A;  4MQ3 A;  4FJJ A;  1C6V A;  1U47 A;  3CM5 A;  3L3V A;  4Z0U A;  1Z26 A;  3LP3 A;  1NK8 A;  1D8Y A;  4ELT A;  1TKX A;  1VSK A;  2IDO A;  3QO9 A;  2P1J A;  1TL1 A;  4IG0 A;  4E1N A;  3V9W A;  4F3O A;  3QET A;  4B9U A;  4FW2 A;  4CGF A;  3AVN A;  4HCB A;  4H4O A;  3BGR A;  4LSN A;  1JXB A;  1TL3 A;  3U3G A;  2X6N A;  2HHU A;  4CGD A;  1LV5 A;  4B9L A;  4LH4 A;  1NK5 A;  2IAJ A;  2DFH A;  3AA2 A;  4AHV A;  4BDZ A;  1NK9 A;  4FK0 A;  1BIZ A;  4CEA A;  5D3G A;  2ZQB A;  2G8W A;  1DTT A;  3K5N A;  2B4J A;  2G8K A;  3IAY A;  3VA3 A;  1JLA A;  3QIO A;  1NOY A;  3VQB A;  4FJN A;  2P5O A;  5EU7 A;  1HJR A;  2ITG A;  1CXU A;  3IRX A;  4DMN A;  5HRN A;  4DF8 A;  4W5R A;  3L2Q A;  3I0S A;  3NGZ A;  3MEG A;  4I9L A;  5J2N A;  4FW1 A;  2PY5 A;  1Q9X A;  4F3T A;  1J9A A;  1NK0 A;  3OY9 A;  2HHW A;  4CK3 A;  2E4L A;  2XRI A;  3MXI A;  1X1P A;  3SUN A;  3DOL A;  1I3A A;  1DLO A;  3K5L A;  3VA0 A;  1TKT A;  4NYN A;  1IO2 A;  5I42 A;  3NF7 A;  1KSP A;  4NYF A;  3HPO A;  1RTI A;  3P1G A;  5HRP A;  2RF2 A;  4CF0 A;  3L2U A;  1ZBL A;  4FZY A;  4KB1 A;  1FXX A;  4CF2 A;  3V4I A;  2R7Y A;  4CJW A;  1SL1 A;  3UIQ A;  3QIP A;  3VQQ A;  4EZ9 A;  1WSJ A;  4BWJ A;  3AVL A;  4F4K A;  3G10 A;  3S3M A;  1HMV A;  1UA0 A;  3CYM A;  4I2Q A;  2HHT A;  2E6M A;  3DLB A;  1UWB A;  2YV0 X;  4DQP A;  1LWF A;  1Z25 A;  4C8N A;  4CJ3 A;  3NH0 A;  4Z4F A;  4B3O A;  1C1B A;  4W5Q A;  4CFC A;  3MEE A;  5HRR A;  4DTX A;  3T3F A;  1KLN A;  1S9E A;  2HHX A;  1BCO A;  3NCI A;  3OYI A;  2RPI A;  4WE1 A;  2IS3 A;  1W0H A;  2HB5 A;  5FDL A;  3RMA A;  3HPG A;  3SUQ A;  3IG1 A;  4CF8 A;  3MAQ A;  3DI6 A;  1KLM A;  1QSY A;  1JL2 A;  2G8U A;  4F2S A;  1HNV A;  2KTQ A;  3O3H A;  3ZSX A;  2D0A A;  3D45 A;  3LWM A;  4KRE A;  4CJP A;  3KKR A;  3ZSW A;  4M45 A;  1RIL A;  3ASM A;  3LAL A;  3O3G A;  4CFB A;  4CEB A;  4Y1C A;  4FK2 A;  3EY1 A;  3AO5 A;  3TAE A;  4IG3 A;  1WSE A;  3AO4 A;  1JKH A;  1RT1 A;  3ZSY A;  2XHB A;  2FBX A;  4QOZ B;  1REV A;  1ZBU A;  3L2V A;  4I7F A;  1NKB A;  2VG7 A;  1WLJ A;  3AVC A;  5T7B A;  4AHT A;  3HO1 A;  1JLE A;  3HP9 A;  4B9S A;  1HRH A;  2QXF A;  4DFM A;  4BE2 A;  4CES A;  2QKB A;  4N47 A;  1Q8I A;  2EHG A;  1IKV A;  5FRO A;  1YTU A;  1BHL A;  3AVA A;  1WSI A;  1S9G A;  3MXJ A;  4IFY A;  3ZT2 A;  4AHC A;  4E89 A;  4CHY A;  4OPJ A;  3TWH A;  4FLW A;  4JRQ A;  3AVK A;  1B9F A;  4B9N A;  3HT3 A;  1NK6 A;  4FVM A;  3CM6 A;  5SWM A;  1ZYQ A;  4CJS A;  4CHZ A;  1LW0 A;  4OKJ A;  4DFK A;  4TSX A;  3V9S A;  3PY8 A;  4KO0 A;  1XHX A;  4CK2 A;  4FK4 A;  3RMC A;  2IC3 A;  4O44 A;  4BE1 A;  5JS1 A;  3EZ5 A;  3MED A;  1UOC A;  1TK8 A;  1RBR A;  3AO1 A;  1NJY A;  1TV6 A;  2RN2 A;  4IBN A;  3AVM A;  4CJT A;  2FC0 A;  3OYA A;  4XIU A;  1ZBH A;  1C0U A;  1QTM A;  4E7K A;  4DQI A;  1VSL A;  1VSD A;  4RW6 A;  3L3U A;  4W5T A;  3V9U A;  3ALY A;  3OJU A;  4PWD A;  1EKE A;  4CJ5 A;  3OJS A;  4O0J A;  5DMR A;  4CHO A;  4PUO A;  3S3O A;  3TAG A;  4DSF A;  2KFZ A;  2A1S A;  4E7J A;  1GOA A;  3G0Z A;  1RDC A;  4AHS A;  3LP2 A;  3MEC A;  3U6F A;  1HQU A;  3LPT A;  1U49 A;  1KFS A;  4IKF A;  2F8T A;  2HHV A;  4J2B A;  1CZB A;  1FKO A;  3WNH A;  5C25 A;  1UAX A;  1A5W A;  3SV4 A;  1FKP A;  3WNE A;  3ZSO A;  2DY4 A;  1HNI A;  3T19 A;  3EYZ A;  4DTS A;  3A2F A;  3WNG A;  3QEV A;  3OS0 A;  4HTU A;  1O1W A;  2VG5 A;  4OJR A;  3V1R A;  3NGI A;  3V9Z A;  2FBV A;  4LD0 A;  3VQC A;  1YT3 A;  3OYC A;  2ATQ A;  1NJX A;  2YKM A;  4CJK A;  2XY8 A;  3ZT0 A;  3OS1 A;  3V6D A;  3L2W A;  2QKK A;  5HP1 A;  1CZ9 A;  2YKN A;  4Y1D A;  3OYG A;  3K57 A;  4RW4 A;  4LSL A;  5C24 A;  4BE0 A;  3RR8 A;  4NCA A;  4FJ8 A;  3DLK A;  3I0R A;  2X78 A;  3TAM A;  1VRU A;  4B8A B;  4CEQ A;  3RTV A;  3QEW A;  3V81 A;  4R5P A;  3KLE A;  4M3R A;  3RMD A;  4CCH A;  4FJ7 A;  1IKX A;  4KHS A;  3DLG A;  1QE1 A;  1I39 A;  2ZD1 A;  3QER A;  4E7I A;  3TAB A;  3ZCM A;  3SJJ A;  2HVH A;  3KKS A;  4BWM A;  5KRT A;  4YNQ A;  1NJZ A;  1WSG A;  5J2P A;  3SQ2 A;  4CGH A;  4DU1 A;  1S6P A;  1ASV A;  4CJE A;  4E3S A;  2ETJ A;  2PZS A;  1WN7 A;  1BCM A;  4ID5 A;  2YNG A;  4LH5 A;  4PY5 A;  3HK2 A;  3KD5 E;  5CY4 A;  4HUE A;  5HBM A;  3AV9 A;  1VSH A;  3PO4 A;  4FJX A;  1VSI A;  5KTQ A;  1X9S A;  2OPS A;  1JLQ A;  3ZT4 A;  1YVU A;  3M8S A;  2YHB A;  4HUF A;  4DTM A;  3HPH A;  4KAZ A;  4M3W A;  3HL8 A;  1CLQ A;  3AA3 A;  4I2P A;  4KV8 A;  1S1T A;  1NKE A;  4JS5 A;  3NDK A;  1XI1 A;  3AVJ A;  3WNF A;  1VSM A;  1KVA A;  1QSL A;  1HPZ A;  3AVB A;  3SQ0 A;  4FJH A;  3L8B A;  4DSJ A;  4I9Q A;  3M8P A;  1C1A A;  1VSJ A;  2KW4 A;  1RT7 A;  4CK1 A;  4Q5V A;  2G8I A;  2HVI A;  3DLR A;  3NBP A;  1IH7 A;  5E41 A;  4FM0 A;  2HMI A;  3ZSR A;  4M3X A;  4AHR A;  1A5X A;  4CHP A;  3SQ1 A;  4E0D A;  5KI6 A;  4CIG A;  4CF9 A;  1LWE A;  3JSM A;  1X9W A;  4MFB A;  1U4B A;  2E6L A;  4DTO A;  4AH9 A;  3TI0 A;  1GOC A;  4JRP A;  2HW3 A;  1RBT A;  4CJL A;  4DTJ A;  1TAQ A;  1MU2 A;  1JLC A;  1JLB A;  3RMB A;  4DWI A;  2KFN A;  2HND A;  3O4N A;  1T8E A;  2ZE2 A;  2I5J A;  4DS4 A;  1LWC A;  3OYL A;  3PX0 A;  4KHY A;  3NE6 A;  4O5B A;  5KGW A;  4DTR A;  4Z4E A;  1L3V A;  2GBZ A;  1JXE A;  3H08 A;  4HVJ A;  4CHN A;  2Y1J A;  1B9D A;  2VG6 A;  3KIO A;  4E1M A;  1RTJ A;  3T1A A;  3NF9 A;  4KFB A;  1U45 A;  2GV9 A;  4Z4H A;  2YNI A;  1QSS A;  4W5O A;  2HNY A;  1S5J A;  3AA4 A;  3AVH A;  3QEX A;  4KI4 A;  4H8K A;  3VQ6 A;  3ZSQ A;  1S6Q A;  4FM1 A;  4CEF A;  4LY7 A;  3KK2 A;  3ISN C;  2LSN A;  5JS2 A;  3DOK A;  4N56 A;  1ASU A;  3QNO A;  3OYB A;  4AHU A;  2EX3 A;  5J2M A;  1SKR A;  2JLE A;  3VQP A;  3RRG A;  2OZM A;  1L5U A;  1N6Q A;  4EP4 A;  3DRP A;  3NH2 A;  1WNS A;  5CZ2 A;  5KGX A;  4HUG A;  5J1E A;  3L2R A;  4BDP A;  4FZX C;  1EET A;  5KRS A;  3I8D A;  4CJR A;  1D5A A;  4Z4G A;  1BI4 B;  1GOB A;  4UQG A;  3RRH A;  3VQD A;  3OYN A;  4BDY A;  1RT3 A;  3TAQ A;  4F8R A;  4B08 A;  1J53 A;  3SZ2 A;  2D0B A;  4ID1 A;  3KTQ A;  4KB0 A;  4CIE A;  3QEP A;  2HHS A;  1VSE A;  4DQQ A;  3SYZ A;  1RT5 A;  1SV5 A;  3K5O A;  4H4M A;  3MXM A;  3RR7 A;  4OLB A;  4CEO A;  1B92 A;  4FLV A;  3SNN A;  3K2P A;  3VQ4 A;  1U48 A;  2RKI A;  3PX6 A;  4KI6 A;  1NK7 A;  1RT6 A;  3AA5 X;  4CHQ A;  4B9M A;  2FBT A;  1U04 A;  3CFR A;  1NKC A;  1S1W A;  4HCC A;  1RTD A;  3SQ4 A;  4FLZ A;  3HJF A;  2YHA A;  1D9F A;  4O0I A;  3C95 A;  1S1U A;  4OPK A;  4FJK A;  4CED A;  1BQM A;  4FCY A;  4DFJ A;  1R0A A;  3HST B;  3O3F A;  3NF8 A;  2G8H A;  3K5M A;  4RG8 A;  3SPY A;  3LZI A;  4PA1 A;  4JLH A;  1TGO A;  4DG1 A;  4GMJ B;  2Y1I A;  3CG7 A;  4DU3 A;  4KHN A;  2QK9 A;  2O4G A;  4KTW A;  1RDA A;  3C6U A;  4CER A;  4FJ9 A;  3AO3 A;  2KZZ A;  3DMJ A;  1TKZ A;  4GW6 A;  2D5R A;  4ICL A;  3SUO A;  4DS5 A;  3DLH A;  3OYJ A;  2OPQ A;  2Z1I A;  1LAW A;  4KHU A;  3AVF A;  4FZZ A;  3V1O A;  3DYA A;  4FLU A;  3ZSZ A;  3TAN A;  1KRP A;  1J5O A;  1N5Y A;  4FLX A;  3KD1 E;  4FXD A;  4CEC A;  3ZSV A;  4ZTF A;  3P83 D;  3F9K A;  1T03 A;  3KLH A;  4M41 A;  3LAM A;  1UA1 A;  4E7L A;  3HVT A;  4CFD A;  1KVB A;  3V9X A;  1TK0 A;  4OGE A;  4QAG A;  5DK5 A;  3VQA A;  3VN5 A;  3CFP A;  5SZT A;  4BAC A;  2XY7 A;  4C8L A;  1BIS A;  2OPR A;  3ULD A;  3QEI A;  4GVM A;  1A5V A;  2P51 A;  4CIF A;  3NAE A;  3SCX A;  3IS9 A;  4OGC A;  2GUI A;  1ASW A;  4IDK A;  3LWL A;  3U3Y A;  2X6S A;  4OKE A;  1EP4 A;  3VQ8 A;  4FM2 A;  3PV8 A;  4J2D A;  4M3Z A;  3TAR A;  4Q0B A;  3SV3 A;  2BAN A;  2D0C A;  4EP5 A;  3SI6 A;  2DFF A;  4DU4 A;  1C0M A;  2Q3S A;  3NF6 A;  1VSF A;  1VRT A;  3DRS A;  5C42 A;  1X9M A;  2P5G A;  4KHW A;  3OYK A;  2W42 A;  3KLG A;  2AJQ A;  4PQU A;  3QIN A;  3M8Q A;  4IFV A;  2PYJ A;  2F8S A;  4KRF A;  1RBU A;  2Z1J A;  2B5J A;  2F96 A;  4YFU A;  4HHT A;  4FJL A;  4G1Q A;  4ZHR A;  5FRN A;  3ZT1 A;  1EX4 A;  3THV A;  3HVR A;  3TAF A;  3BDP A;  3O4Q A;  2B6A A;  3PX4 A;  4CJQ A;  2OYQ A;  4CJ4 A;  3OVN A;  3K59 A;  3LDS A;  4C8M A;  5HRS A;  3NH1 A;  4RW9 A;  4DSE A;  4DF4 A;  3AO2 A;  2OA8 A;  4DLG A;  1TKD A;  2G8V A;  1RNH A;  1S1V A;  1RDB A;  1S1X A;  3P5J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...