3IS9A

Crystal structure of the hiv-1 reverse transcriptase (rt) in complex with the alkenyldiarylmethane (adam) non-nucleoside rt inhibitor dimethyl 3,3'-(6-methoxy-6-oxohex-1-ene-1,1-diyl)bis(5-cyano-6-methoxybenzoate).
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
554
structure length
554
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/hydrolase
molecule keywords Reverse transcriptase/ribonuclease H
publication title Crystallographic study of a novel subnanomolar inhibitor provides insight on the binding interactions of alkenyldiarylmethanes with human immunodeficiency virus-1 reverse transcriptase.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
total genus 134
structure length 554
sequence length 554
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3is9A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3is9A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3is9A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3is9A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3is9A05
3SCXA 1ZBLA 3IRXB 4GC7A 4CGIA 4NLWA 5I3UB 2IM1A 2AQ4A 4HUEA 3NGZA 1Y97A 4K8XA 3HO1A 4CEFA 1ASUA 4CJLA 3PW0A 1NKBA 5HP1A 1C0MA 3RBEA 1TK5A 3SI6A 2D3UA 2D0CA 3I0SA 4DU4A 4JRPA 4WE1B 4O3RA 1VRUA 4CF9A 3HK2A 2D3ZA 3NE6A 3PHEA 4ECTA 3TAGA 3CWJA 4K4ZA 4G3IA 3PZPA 5DQGA 5E41A 4JS5A 4I2PA 2ZD1A 2WRMA 5D3GB 4IG0B 4RZRA 3FRZA 3SPYA 3LP2A 2IJFA 4OPKA 5KFLA 2ZQBA 2VG7A 3QIPB 2FVPA 3S9HA 3B6OA 5J2PA 4E1MA 1TKZB 4URQU 4RW8B 5KFWA 4IFVB 4RW6B 1U04A 2XGPA 3QLHA 4JUZA 3L2UA 5L9XA 3EYZA 3TAFA 3V1OA 3UDLA 5J1EA 3KLGA 2DFFA 1SKSA 2OPPB 4NLGA 3B6PA 4KAZA 4ID5A 4BDZA 1HQEA 4NLXA 4CGHA 1NK8A 3VN5A 1C0TB 4KPYA 3G10A 2W7OA 2UUTA 2C2RA 1KVAA 3QERA 3AV9A 4ED7A 4NRTA 1IM4A 2OPSB 4OPJA 1NK4A 4F4XA 3P83D 4OL8A 5KG6A 4TYAA 5DGAA 4KHSA 2AX1A 3NHGA 4W5QA 4WYWA 3FFIA 4EYHB 3SUNA 1EP4A 3ZT3A 1S6QB 4YR0A 3HM9A 4CEOA 3TAMA 2IM3A 5KG0A 3I0SB 1ASVA 1LWFB 1MU2A 4DSEA 3BR9A 3MEDA 3OYBA 3QNOA 2W7PA 4FS1A 4Z4IA 3M8QB 5J2QA 3V1QA 3N6LA 4UQGA 2JC1A 4GW6A 4CHPA 1SV5A 4HKQA 3IAYA 4C8KA 4PQUA 2D41A 4IOBA 4NCGB 3H5XA 3NF7A 4ECYA 4K4VA 3L2RA 2FJVA 2VG7B 2BANB 3V6JA 2FBTA 2AWZA 5J2PB 4CFDA 4CESA 1JLEB 3V6DA 5KG3A 5KG1A 2X78A 2RF2B 3EPIA 3ITHA 1JXEA 3QLHB 3DM2B 3I0RA 1JLBA 4ZTJA 2YNIA 3NGIA 3OSNA 2I5JB 1RAJA 4LH5A 3VQ7A 1VSHA 4J9RA 3OS1A 1HQEB 2IM2A 2AU0A 4KHYA 3LWMA 3UIQA 1X9WA 5CYMA 4HUFA 4CJ5A 1RTHA 4O3NA 1RT1B 1RTDA 3RAXA 3KK3B 2QV6A 3K58A 3UR0A 2XC9A 2QKBA 3LALA 4KBIA 3QYYA 1C1CB 3O3HA 3O4QA 5EWEA 3KHLA 2DPIA 1EETB 4IR1A 1RYRA 4CJFA 1S1WB 2I1RA 3GIMA 1KFDA 5HRPA 3HPGA 2R2SA 3D45A 4Q43A 4KKOB 4BE0A 3TAMB 2CKWA 4O3QA 3GIKA 4RNHA 4K8ZA 3BSNA 5C24A 3OHAA 2HNDA 2WOMA 4NZ0A 1X1PA 3DOLA 3AVGA 1REVB 2AX0A 3VQQA 2XY6A 1T8EA 3SJJA 2Z1IA 5KFNA 5FDLA 1XHZA 4KI6A 2UVWA 1S6PB 4FLUA 3F73A 3MAQA 1KRPA 4WXOA 4CHOA 2WONB 3V6DB 4J2EA 4ZHRA 2YNGB 4GC6A 1DLOA 4GMJB 1SUQB 5KTQA 3I0RB 1JLBB 2GIQA 2Z1JA 3FQKA 1TK8A 4M94A 3ZT1A 3F9KA 4YP3A 3CJ0A 2BGGA 1ASWA 4EO8A 1VSIA 4Y1CA 2B4JA 1RTHB 3KMSA 3U3GA 1RT2A 4B08A 1RA7A 3BGRA 4FJXA 1RBUA 3S3MA 1LW2A 5EUHA 1QAJA 5CZ2A 1IG9A 5DG9A 3CYMA 3QESA 1CSJA 2VA3A 1ZETA 1VSMA 4EBDA 4DTNA 1XI1A 3KD5E 1C2PA 5KFHA 1KVBA 2YKNB 4FYDA 4FLTA 4QWEA 4DS5A 1RT3A 4Z4HA 3V4IA 3NF8A 5C24B 4WYLA 3CFPA 4JV1A 3ZSWA 3G6YA 3HT3A 1QS4A 1UAXA 3VQ4A 3CM5A 4RW9B 3V9UA 3T19A 2GV9A 2AJQA 3LP1A 3KTQA 2B5JB 4W5NA 5DG7A 4RNNA 4F2RA 1QSYA 2ZE2A 3AVCA 3V9WA 1U47A 2J6TA 3NFAA 2BQUA 4ZVGA 4YMEA 1T3NA 3K5OA 1TKXA 2HHWA 2JEIA 4LSNA 1J54A 3KIOA 3MFHA 2YHBA 1XHXA 4U7CA 2HNZA 4CF2A 3L2VA 3OYGA 2P1JA 3QGHA 1NJZA 1EKEA 4LQ3A 4Y1DA 1SKRA 1TL3A 3V81A 1U45A 3OYMA 5KFEA 3L2QA 2F96A 1RT5B 3FSIA 2G8IA 1W9HA 2PY5A 5JUMA 4YNQA 1KTQA 1SL2A 3ZSZA 3RMBA 4FLYA 5JXSA 4CF8A 4FBTA 4ZVFA 4WFXA 3H40A 4EP4A 1EX4A 2IBKA 2XI2A 3BSOA 4RW7A 3H08A 2X6NA 1UWBB 4B9NA 2ILYA 5HROA 1FK9A 1A5VA 2JEGA 3KLFB 3C6TB 5CYQA 5KFUA 3KJVA 4URGA 3AVAA 1T03A 4FBUA 1BI4A 4DQPA 1D5AA 4AHCA 1IO2A 1GOAA 1TP7A 3LP1B 4XPCA 4FXDA 4CF1A 1U48A 2EHGA 1JL1A 4Q8EA 2XHBA 3TAQA 3I5BA 3RBDA 1NHUA 1UA1A 2W42A 4F4YA 1J9AA 1VSDA 5HBMA 2IC3A 5JS1A 5DGBA 3H59A 4E7KA 1RTIB 3IS9A 3TABA 4W5OA 2R8IA 2D7SA 1FKOB 2W9AA 2CJQA 4G1QA 3HVRA 4RNFA 1ZBFA 1K1QA 4TY8B 1SL1A 2VG6B 2HAIA 3DDKA 3G6VA 4B9SA 1RNHA 4J2AA 4KAIA 2IDOA 2ZKUA 2FBYA 3SUPA 4O55A 4KO0A 3QO9B 4CJKA 4NYFA 4DTRA 4FJ8A 2KW4A 3EPGA 2OYQA 2PYJA 1U09A 4RNOA 5C42B 2AGQA 2FJXA 3K2PA 4H54A 3DRPA 5HROB 3Q8RB 3LP0A 4E1NA 2RN2A 4Y34A 3K57A 4O5BA 4CJWA 2KFNA 2FVQA 3MEGA 1HRHA 1S1VB 2YHAA 3DLRA 1T03B 5KFBA 3AVMA 1BI4B 3MECB 5KI6A 3M8PB 4IG3B 4ED3A 3QZ8A 1S1UB 3LZIA 5KFRA 1FKPB 3CIZA 1K1SA 2W9BA 1XWLA 2X6SA 4B3OB 4KFBB 3PX4A 1JKHB 3IS9B 4NLSA 1L3UA 3OYFA 1Q8IA 3CDEA 4CFBA 1DTQB 4CJTA 4DTOA 5EU7A 2YNHB 4ZPAA 3KLHA 4J9PA 4DTPA 1VSLA 1QHTA 1XR7A 3PO5A 5KFCA 1XR5A 3ISNC 4DLEA 3ZSQA 2W8LA 1CZ9A 1BCMA 4Y2AA 1IKXA 1I6JA 3LAKA 1QE1A 4OGEA 1JLCA 4J9MA 3ZSOA 1HQUB 4OVLA 2F8SA 3D5MA 3SQ2A 1S0NA 3VQ5A 1TGOA 2OPRA 3OYNA 4N41A 4RNMA 2Z1GA 4DFJA 1D9DA 1IKVB 2AGOA 3EZ5A 4F4WA 1HNVA 2R8JA 1HMVB 3MR3A 1D1UA 4KHRA 3UQSA 4OGCA 1NK7A 3I5CA 5EDWA 4FJGA 4K4TA 1YVFA 4YFUA 1JLAB 2V0NA 5KFKA 4AH9A 2E9RX 3PW7A 4HYKA 4ZVEA 1KFSA 2BE2A 3RRHA 1HPZA 4FLXA 5DLGA 2OPQB 2RDJA 5T7BA 3C6UA 5F8LA 4MK7A 1YT3A 4N47A 2Z1HA 4CFAA 3PX0A 4Z4EA 3IGNA 1BQNB 4J2DA 3K5MA 5F8IA 2VA2A 4Y3CA 4M41A 2KTQA 2FLNA 3OYEA 2VG5A 4B9VA 3M9OB 1HNIA 3RRGA 3KLHB 4WFYA 4F3TA 1NOZA 2IOCA 1WNEA 3HP9A 3O3FA 1ZBIA 1RT7A 4CEDA 2IA6A 2FLPA 4ICLB 3TVKA 2FC0A 3OYKA 1T7PA 4DWIA 3SUOA 3HPOA 2FVCA 1X9SA 2Q3SA 4J9KA 3SQ4A 2IM0A 4DG1B 2OPRB 3RAQA 1LWEA 1B9FA 4FS2A 2QKKA 1S9EA 3DLKA 1G15A 1HNVB 3BJYA 4C8MA 2B6AB 3VQBA 3M9NB 1C1AA 4IH7A 3HVTB 4DEZA 2UVRA 4FZXC 3VA3A 3QEWA 4E7JA 3U6FA 5F9LA 3RTVA 1C1BA 4NYZA 2WCXA 2C2EA 2JEJA 2VWKA 4J2BA 3M8SA 3DRRA 5KFXA 2IAJB 4ELVA 4OKKA 3QEVA 5J2MB 1S0MA 4FW2A 5F9NA 1NK0A 2ASLA 1IKYA 5KFTA 1KSPA 4DFPA 4PY5A 4JS4A 3D0PA 3NH2A 1L5UA 5HP1B 1HYZA 3LPUA 1SL0A 5FRNA 1VRUB 1RT6A 2VG5B 4DFMA 2W9CA 4DS4A 2HB5A 4Q5VA 3HHKA 3OL6A 3U3YA 2WTFA 4I2PB 1S9FA 2ZD1B 3KKRA 4FJ7A 2GIRA 1RT7B 1VK0A 2EX3A 1NJXA 1TAUA 4IFYA 3AVKA 3LP2B 2RKIA 5EWFA 3OVNA 2R8HA 4TQRA 5KT2A 4O3SA 1HYSA 1RT4A 4EZ6A 3H5UA 2JLEA 4PUOA 4ZP6A 1GOBA 3AO4A 3JYTA 3N6MA 2D5RA 3AA4A 3HXMA 2XY8A 4NLOA 3SNNA 4N76A 3DLEA 3C95A 4O0JA 3NH0A 3Q8PB 5J1EB 3KLGB 4KHWA 4ECVA 3JSMA 1BL3A 4ID5B 4ZTFA 3MEEA 3KMQA 5SWMA 4M95A 1YTAA 4Y2CA 1KLMA 1C1BB 1ITGA 3CJ3A 4CEBA 1XC9A 3KK1A 3WNGA 4CHNA 2IGIA 3A2FA 2C2DA 1JLQA 3NCIA 2O5DA 4DLGA 3H5YA 2BRLA 3FFIB 4KB1A 4K4UA 4LSLA 1EP4B 4AILC 2HHSA 1VSFA 3M8RA 4RW4A 5J2NA 3V6KA 4LY7A 2ASJA 1JIHA 3V9XA 1MU2B 3MEDB 2VWJA 2DFHA 4M45A 5J2QB 5KT4A 2BRKA 4Z4CA 1QUVA 1SV5B 1NOYA 1BISA 3PV8A 5K14A 1WSGA 4PQUB 4IFYB 1CXQA 4AHRA 4H4MA 3VQ6A 4CJVA 3BQ2A 3BSCA 3AVLA 2R8KA 4HVJA 1JLFA 3PX6A 2QK9A 3OLBA 1IKWA 5F8HA 5KG4A 3ITHB 4ZPCA 2YNIB 3E01A 2J6UA 3BQ1A 3OYDA 3WNHA 5KFYA 5CYMB 1JLGA 3NGYA 4WXWA 4W5TA 4DL2A 3HP6A 1B9DA 3TWHA 3L3UA 2FBXA 1RTDB 1S1TA 2R2UA 2HHXA 2WHOA 2QE5A 4FJHA 2E6LA 4M3RA 4FJ5A 4B8AB 3QNNA 1JLQB 2YKMA 3SQ1A 3RWUA 2DTUA 4K50A 4LSLB 4E19A 2PYLA 5FRMA 4DQRA 5HLFA 1TV6A 5KFGA 1QSSA 4FZYA 2B43A 4PA1A 5J2NB 2GC8A 5KT3A 4H4OA 4OJRA 4M3TA 4R5PA 2HNDB 1RA6A 4J9LA 2WOMB 1HJRA 2J6SA 2HHTA 4CJ3A 3DLGA 3DOLB 3VQPA 5C25A 3DOKA 3GILA 3Q8QB 4I2QA 4KTZA 4C8OA 4H4MB 5I42A 4HCBA 4DTMA 5FDLB 4TSXA 2ALZA 1EXQA 1TVRA 2BQRA 4DL7A 3G86A 2KQ2A 2LSNA 5KGWA 4CGDA 1JL2A 4ZHRB 2IS3A 3N6NA 2OZSA 1DLOB 2GBZA 3MR5A 3V9SA 4KB0A 3QEXA 3VA0A 1U49A 4PWDA 2IJNA 3KLEA 1LW0A 2BQ3A 4ED1A 4EZ9A 5KFOA 3RMDA 4YQWA 3H98A 1RT2B 2E9TA 3I5AA 1VSKA 3BGRB 4ECUA 4B9MA 5KG2A 2XRIA 2ETJA 2Y1IA 3K5LA 1LW2B 4E7HA 4FM2A 1TK0A 4CJ4A 4AHVA 1UOCA 2BR0A 3NH1A 3LANA 4FCYA 4FVMA 5HLFB 1TV6B 4J9QA 3DRSA 1T05A 1A5XA 3PW4A 3T5LA 4KV8A 1RT3B 4E7LA 4ELTA 3V4IB 3CDUA 5KFDA 4H4OB 3NF6A 1N48A 1ZTTA 1WN7A 1JXLA 1S9GA 2XCAA 3NAHA 1BIUA 1BQMA 5F8NA 5JS2A 2HNYA 3THVA 2HWHA 2ZE2B 1J53A 5I42B 3HPHA 1I3AA 3BDPA 1KLNA 4DMNA 1TVRB 3H4DA 3QIOA 4QW9A 1VRTA 2HHVA 1TKXB 2IMWP 1WNSA 4LSNB 1RDBA 3CVKA 4NLVA 4ED0A 2HNZB 3SUQA 4DFKA 1WSHA 2X74A 1YTUA 4Q0BA 5KT7A 1TL1A 1TL3B 4EBCA 4IRCA 5L1LA 1QAIA 1LWCA 3V81B 1C0UA 4E7IA 5KFQA 3OYJA 2HHUA 1N5YA 4TN2A 1NK6A 4DSLA 4OLAA 3VQ9A 3DMJA 4M3ZA 2ITGA 4X2BA 4W5RA 3HVWA 1RBTA 3AA2A 2FVSA 4FJKA 4RW7B 3RB3A 3V1RA 3SZ2A 2UUWA 2NUBA 1N6QA 1NHVA 4ZP9A 3O4NA 2XY5A 2HVIA 3DRSB 1T05B 2D0AA 4CEQA 1FK9B 3OJSA 4CIEA 1Z25A 3NKYA 5CYQB 3ZT4A 3KJVB 1RDAA 4MK9A 4O44A 4C8LA 4IR9A 3H4BA 1RTJA 1WSEA 3MR6A 5DQIA 4CGJA 4FJMA 3KHRA 2OA8A 4Q44A 2WB4A 4CJPA 3AVIA 4IKAA 5KFJA 2P51A 4IDKA 3ULDA 1BCOA 4CJUA 5HBMB 3TI0A 2IC3B 3PW5A 4DU3A 4KSEB 1N4LA 5FROA 1NK5A 3KOAA 1JX4A 3WNFA 4O3OA 5SZTA 4FK0A 3OLAA 4O4GA 4CJQA 5F8GA 4G1QB 1J5OA 3IRXA 5C5JA 3HSTB 4JRQA 5I3UA 4M3UA 3G0ZA 4DTSA 2G8UA 3SI8A 1W25A 3NAIA 2O4IA 1RYSA 1BIZA 1HARA 4NLDA 4CF0A 3GV7B 3NMAA 3ZSXA 1KHVA 3T1AA 4WE1A 5KFPA 1NJYA 3CJ2A 3ISND 3GIIA 3DMJB 4KO0B 2A1SA 4NCAA 3DLHA 4R0EA 4IKFA 4OKEA 4ECXA 3AO1A 2DY4A 4ZPBA 1UA0A 3MF5A 5D3GA 3S3OA 3MFIA 4IG0A 4DQQA 4CEAA 1A5WA 1CLQA 3AA3A 3T5KA 3DRPB 1ZYQA 3QIPA 3SFUA 1QSLA 3LP0B 5KT5A 2G8WA 1TKZA 4JV0A 3MEGB 4MFBA 4ECZA 3OYLA 5L1IA 3HKWA 1VSEA 3L2WA 4IFVA 3OYCA 1S4FA 4FK4A 5KFAA 1RTJB 4TLRA 4ID1A 4XPEA 1D9FA 4ZVHA 3IGVA 2C22A 2DPJA 2OZMA 4EBEA 2ATQA 4NLQA 1MMLA 2W8KA 4DL4A 5CY4A 3DI6A 4IDKB 4WZMA 1Z26A 2W9BB 1FXXA 3OYHA 1TQLA 3HYFA 2R2TA 4FLVA 3QGIA 3KKSA 3TAEA 2HMIA 4YR3A 4O4GB 4F4KA 1J5OB 4I9QA 4FJLA 4AHTA 1ZTWA 3GIJA 4QWAA 2BDPA 4QW8A 3LAMA 4ZP7A 1S6QA 4MIBA 5KFMA 3CFRA 4HCCA 4LD0A 3QEPA 3SV3A 1IKXB 4L8RB 4EO6A 1LWFA 3IN5A 1LAVA 5KFVA 2ASDA 4IRKA 1S48A 1QE1B 1JLCB 1RCHA 1GX5A 1NNDA 4F4ZA 4KTWA 4N56A 3M8QA 3BSAA 1C6VA 1RDCA 2P5OA 3NBPA 2OH2A 4NCGA 1KVCA 4CECA 5KFZA 4AHUA 1O1WA 2ATLA 5KGXA 2BANA 4M3YA 1RBRA 5F8JA 4DF4A 1JLEA 4ECSA 4MFBB 4DU1A 4IBNA 1L3SA 1DTTA 3ZSVA 2RF2A 5KFFA 2HVHA 4HHTA 3PY8A 4J9SA 1NKEA 3MXIA 2BE2B 3SYZA 3DM2A 1HPZB 4ED6A 2I5JA 3C6UB 3QIDA 4DF8A 4KE5A 3OL8A 4RUAA 2FVRA 3RMAA 1Z4UA 3DI6B 5HRSA 3IG1A 3PR4A 1LV5A 4KI4A 1RDRA 4KREA 1RT1A 3KK3A 3CJ4A 3VQCA 4K4WA 2HMIB 3KHGA 3OHBA 1C1CA 5KT6A 3HL8A 1QTMA 3ASMA 1EETA 2FJWA 1HNIB 4MKBA 3CFOA 4ED2A 4I7FA 5KG7A 3FQLA 1S1WA 3AVJA 1Q9YA 1KCFA 4K4SA 4KKOA 1L3VA 4BWMA 1SH0A 4OLBA 4OKJA 4NLUA 2G8VA 5CZ1A 3T5JA 4CGGA 4QWBA 3UPFA 2FBVA 3CDWA 2O4GA 1S0OA 2WK4A 2E6MA 5EWGA 4FJNA 1LWEB 3LZJA 3NBPB 4LQ9A 4CE9A 4CJEA 4DL6A 1S9EB 3DLKB 2ILZA 1REVA 4CJRA 1TKTA 4NYNA 3I8DA 4NLRA 3SV4A 1S6PA 4H8KA 3LWLA 4E3SA 2WONA 4IRDA 1DTTB 2YNGA 3BREA 5T14A 3MXMA 4CFCA 4BE2A 4BDYA 1SUQA 3DRRB 4CCHA 4FW1A 4CK1A 4B9TA 3NDKA 1F21A 2KFZA 3GYNA 2UVUA 2EC0A 3GV5B 2XI3A 4O0IA 1NK9A 3AO2A 1IKYB 4DSFA 3IG1B 4ECRA 3CG7A 1GOCA 4QOZB 2FLLA 4XO0A 4QCLA 3TQ1A 3QINA 3RR7A 4FM1A 4URSA 3RR8A 1S10A 1Q9XA 3HVAA 3MTKA 3NAEA 2HW3A 4QPXA 1RT6B 1N56A 4M3XA 1WSJA 5DMRA 2P5GA 2W9CB 1BGXT 4I7FB 1JXBA 2F8EX 2YKNA 4DTJA 4CEEA 2RKIB 2XGQA 3CM6A 2AGPA 4IQXA 3SPZA 3KK2A 3AVFA 1HYSB 1RT4B 4I9LA 4PUOB 2KZMA 2E9ZA 3JYTB 1RILA 4DSKA 4JLHA 2F8TA 4ZPDA 4RW9A 1T94A 1YVUA 4NRUA 2B5JA 3DLEB 2GUIA 4KHNA 1QQCA 3KNAA 1TKTB 3JSMB 1CZBA 3MEEB 3T5HA 4FM0A 2G8FA 3FDSA 3QGGA 1TAQA 4BACA 4ZMMA 4DSIA 1KLMB 5KRTA 4GVMA 3DYAA 3KK1B 3KLIA 1W0HA 1S97A 4B9LA 5DK5A 4ZP8A 4MKAA 1SKWA 4Q8FA 3NL0A 4FLZA 4LH4A 2G8KA 3ZT2A 2C28A 1B92A 5DLFA 4BWJA 4DL5A 4RG8A 2JC0A 3PW2A 4RW4B 1RT5A 5KG5A 3VQSA 1S49A 4DQSA 4ECWA 4TQSA 3NGDA 3TR8A 1ZBUA 5L1JA 3ZSYA 1LAWA 4DSJA 4FJJA 5K14B 5KFSA 1S5JA 1UWBA 4NLYA 1RBVA 2XWYA 3RB4A 3LPTA 3KK2B 3OL9A 3KLFA 3C6TA 2A1RA 4E89A 4FJ9A 1JLFB 4K4YA 4CJSA 4CIGA 4J9NA 1IKWB 1RDDA 5KRSA 3TAPA 3ZSRA 4F3OA 4CK2A 3E01B 1SH3A 4EP5A 1WSIA 2XO7A 2V4QA 2YV0X 2R7YA 1HYVA 1JLGB 2E4LA 4MK8A 3PR5B 3RB6A 2JGUA 1RTIA 2YNFA 3DYAB 2DFEA 1S1TB 3KLIB 3TARA 1FKOA 4R8UA 3RB0A 4BDPA 4Z0UA 3QETA 3PJXA 3OYAA 4Q45A 3PVXA 2YKMB 4QWCA 4NLTA 3O3GA 4TY8A 2VG6A 4EEYA 4CEZA 1S1XA 3NF9A 1L3TA 1WAFA 3AVHA 4FZZA 4F8RA 3QO9A 4CERA 4MQ3A 4R5PB 5C42A 3DLGB 5C25B 3DOKB 1KHWA 4I2QB 4FLWA 4CHZA 3DLBA 4NLPA 4KTQA 3QEIA 3TANA 3RMCA 1S1VA 3VQAA 3M9MB 3MECA 3P5JA 2RDIA 3M8PA 4IG3A 4CIFA 4N5SA 4XIUA 1WAJA 3BQ0A 1S1UA 4O3PA 4PWDB 5F8MA 3KLEB 1FKPA 1LW0B 1CXUA 3EY1A 3QZ7A 4B8CA 4KB7A 4B3OA 4KFBA 3ZT0A 1JKHA 2YNFB 1GX6A 3OY9A 2V9WA 4MH8A 4R8UB 1DTQA 1K6YA 3G6XA 4M3WA 2YNHA 3H2LA 1VSJA 4Z4FA 3OYIA 3K59A 3C94A 2XCPA 4J9OA 3T3FA 3P1GA 4B9UA 4NCBA 1S1XB 1OS5A 4KV8B 4JV2A 5HRNA 4CK3A 1U4BA 1HQUA 1XR6A 3ICLA 4DTXA 4DQIA 1S9GB 3V9ZA 1ZBHA 4F50A 1X9MA 4BE1A 1IKVA 2R8GA 4WFZA 1BQMB 1HMVA 2HNYB 4QAGA 1R0AA 1WLJA 3KD1E 3CO9A 5DG8A 3K5NA 3MXJA 4CGFA 4O4RA 2HHQA 3GQCA 2R2RA 4Z4GA 1VRTB 1JLAA 3OS2A 4M42A 5KFIA 4TXSA 1D8YA 2XY7A 2HWIA 3ZCMA 3EZUA 4FK2A 3L8BA 1I39A 2OPQA 4FJIA 4U6PA 3HJFA 4KHUA 2G8HA 4Q0BB 1SH2A 4IH5A 2KZZA 1TL1B 3WNEA 3AA5X 1NKCA 3Q8SB 1NJWA 1BQNA 3SQ0A 1LWCB 1C0UB 1D0EA 3GV8B 1N5YB 4CHQA 5HRRA 4ED8A 3ALYA 4RUCA 4F2SA 4E0DA 4HUGA 4QWDA 2Y1JA 4HTUA 4TY9A 4K4XA 4IH6A 1TKDA 2V4RA 4C8NA 3OL7A 3LP3A 1RBSA 4KHQA 1N6QB 4ICLA 2RPIA 3AO5A 4ECQA 3AO3A 4AHSA 2PZSA 3AVNA 3CJ5A 4RW8A 3PJWA 4DTUA 1BHLA 3OJUA 2UVVA 4DG1A 4O44B 3VQDA 4RW6A 3OS0A 3PO4A 3VQEA 4MIAA 3D28A 4DL3A 3OSPA 4YR2A 3KHHA 2B6AA 1IH7A 3H5SA 1R0AB 4EYIB 2OPPA 3E51A 4KRFA 3CQ8A 3L3VA 5DQHA 3S3NA 4ELUA 3KLVA 3HVTA 4RU9A 4CHYA 5L1KA 3V6HA 4KHMA 1C0TA 2JEFA 4WZQA 3AVBA 3LDSA 3PUFA 2IAJA 2D0BA 3MR2A 3VQ8A 4TYBA 5J2MA 2OPSA 2QXFA 1WSFA 3SFGA
chains in the Genus database with same CATH superfamily
1ZBLA 1VQ5S 2L48A 3C66A 3FZFA 4NLWA 3WC0A 2HZCA 3NGZA 2HFUA 4K8XA 4ZJOA 2CH5A 4OZ0A 2D3UA 3I0SA 5IM0A 4DU4A 3ILOA 3TAGA 5ETQA 4G3IA 2CJXB 2ASOA 3J81O 2UV8A 3PZPA 4ILRA 1RB0A 1J6ZA 3T1HJ 4KH4A 2WRMA 2O8FA 2B51A 3ZTPA 2V2VA 3FRZA 4PZVA 4JI7F 4C7QA 3SPYA 4OPKA 5DDRC 5J2PA 4E1MA 3OFEA 4KGKA 4P2XA 4RW8B 1Q0NA 4Z37A 3AAWB 1XMQK 2F40A 1AXQA 2NZCA 3QLHA 4JUZA 2HVZA 3EYZA 3V1OA 4X4PA 2DFFA 2P9NA 4NLGA 3AY0A 2P9EA 5AT1B 1HQEA 2L9WA 1NK8A 3DU6A 5DO2A 1I94K 1PC5A 2XZDB 3G10A 2UUTA 2C2RA 3AV9A 3OTEA 2OPSB 2IFXA 4K43A 3NVMA 5KG6A 5DGAA 4KHSA 1KR4A 1UETA 4EYHB 3E9LA 3B54A 2YH1A 3ZT3A 4YR0A 1UP1A 4ZVQB 2GO8A 1ASVA 4DSEA 3MEDA 4ZJLA 3CXCR 3N6LA 2JC1A 3IAYA 1SV5A 4FPRA 2GHPA 4C8KA 2H48B 1R8BA 4IOBA 3PG9A 4ECYA 1HNZF 2P9LB 1VQ8N 2FJVA 3DGPB 1U1OA 4NMLA 2CQ0A 4M63A 3W62A 2F5GA 1JLEB 4CESA 3V6DA 5LMNJ 3FZMA 2RF2B 2EVZA 3PIPL 1JXEA 4HLBA 5JVHQ 1F5CA 3OSNA 1VSHA 1Z2ZA 2ZBCA 3KDNA 2ZBIA 3O8MA 3LWMA 3UIQA 1X9WA 5CYMA 5EX5A 4YY3K 4UZCA 4W4MA 3AOBA 4OZ2A 1SB6A 3A3PB 1M5KC 3G25A 3K58A 3UR0A 2XC9A 3EM1A 1C1CB 3O3HA 2B7BB 1UAWA 3KHLA 1EETB 4P9SA 1KVKA 1RYRA 4CJFA 3OUYA 4B3SF 1VR6A 3GIMA 1KQGB 4BBYA 2R2SA 4ISFA 5LJ5Y 4KKOB 4LRDA 3DDNA 2DNHA 4BE0A 3TAMB 8ATCB 4O3QA 1NRKA 4RNHA 1FRLA 4X66K 3VALA 3BSNA 2HG4A 2GMLA 5F0UA 2I2YA 5AE1A 1REVB 1RI7A 3H2UB 5AQUA 2XY6A 1T8EA 5KFNA 1V3RA 3D1OA 2EFGA 1S6PB 4FLUA 3MAQA 1IJFB 3RUBL 2EFNA 1YJ9S 3EGWB 1DBDA 3Q2TC 5KTQA 3I0RB 2GIQA 2GELA 3UKUB 3M30A 1TK8A 1BLUA 3CJ0A 3A0IX 2XSJA 1ASWA 1VQ6N 4A8XA 4B3TJ 3VF6A 2GQ2A 4GVBB 1VSIA 3ZTQA 1RTHB 2HIYA 3VVUA 2BOAA 3BGRA 2FC9A 2YI1A 1TL7A 4K59A 4EMDA 3QESA 2VC1A 2HK3A 2OEMA 2XS5A 2P9PB 1XI1A 3BN7A 4GKKJ 3KD5E 4FYDA 5K8NA 2KFYA 4FLTA 4JHDB 3ZZOA 3MM7B 2V6AA 2N3OA 3AXMA 1WACA 5L9NA 3NF8A 5C24B 4WYLA 3CFPA 1Y0HA 4NXNK 4JV1A 3HT3A 2IHR1 4EFAC 2B5JB 1UFKA 1RK8A 4BR5A 2K8GA 3AVCA 4RBUA 4BC5A 3Q23A 2J6TA 2RE1A 1T3NA 2DNQA 2C3UA 2HNZA 1K9MT 3W60A 4CT9A 1K8AO 3CJSA 3OYGA 2P1JA 3QGHA 1EKEA 4LQ3A 1HLWA 2MMYA 4PWUA 2M88A 5IXUA 4USUA 4DUZJ 3V81A 4LFAJ 3PRVA 4UTGA 5AQLA 3G6ES 3L2QA 3FSIA 2PY5A 3CCUN 3UKRB 3SBTA 4UY8O 2E7VA 5JXSA 4CF8A 2CA9A 4EP4A 2JFKA 1FVQA 1EX4A 1IUJA 4B9NA 2CNOB 4DZ6A 2ZH6A 2ADBA 1A5VA 2JEGA 3C6TB 4URGA 4DCHA 3UO0A 4FBUA 2DGWA 5H9FJ 4DQPA 4CZFA 1IO2A 3HX9A 1HR0J 2KLAA 4FXDA 2ZEJA 2G0IA 3IFEA 4Q8EA 1RSCA 3ZLJA 4NWBA 1UA1A 2VB6A 3KHYA 5HBMA 3N4PA 2IC3A 3MAAB 1XNQF 4BRLA 4E7KA 1RWPB 3IS9A 2P6TA 1N8RT 4W5OA 1H73A 2WVBA 3KWIA 2D7SA 4YOEA 1FW6A 2W9AA 4G1QA 3VEOA 2RJZA 2IVNA 2DEJA 1TTHB 3D9BA 1SL1A 3ENAA 3A5OC 3G6VA 4KH0B 4DV0J 2J0QD 2F4VK 3T1YK 3C2PA 4PKDB 3SUPA 4YDUC 3G4SN 1FDBA 1N0UA 2BM1A 4DV4K 4CJKA 2ZM6K 4NYFA 4OLOA 5DZ6A 4FJ8A 1G4CA 2OYQA 2PYJA 4RNOA 3FRYA 4DR2J 4FKYA 4CLFA 4H54A 4P74A 1TYQB 4WYBA 1RHMB 4U9RA 3MMJA 4LF7F 4O5BA 2I9SA 2NNWA 1HRHA 4RJVA 1S1VB 3D2WA 3DU5A 2YHAA 1RKIA 5KFBA 4DV5F 1BI4B 3ILIA 3EZOA 1FE0A 3M8PB 2OTLN 4IO8A 4JI8F 1N34J 3SDEA 2C3YA 2DO4A 1ZBTA 2CUYA 2W9BA 2XS2A 2DISA 2DR9A 4KFBB 3VEXA 2UP1A 1EKRA 1H72C 2BBEA 2OELA 2CFXA 2HMPA 4BC2A 5GADU 3CDEA 1DTQB 1MWYA 1HUXA 2V8PA 1FO1A 1XR7A 3PO5A 1CC7A 2EXUA 1XR5A 1D9AA 1JQGA 4OIXA 2W7AA 4BY9C 3MWBA 4F04B 2A40A 2W8LA 1CZ9A 4Y2AA 1M90O 4XDDA 4N77A 1I6JA 3ILLA 3DXKA 3LAKA 4OGEA 4IEEA 3ZSOA 1NJIO 4RNMA 1WI8A 4JKHA 5E3CA 4KHRA 3UQSA 3ENQA 3I5CA 4FYVB 2HS3A 4ANEA 1G3OA 4YFUA 2QL5B 1JLAB 2V0NA 4C11A 4P7VA 4LR7A 3PW7A 2N7YA 2O01C 4M5JA 1YHQS 1KFSA 2VONA 2BE2A 3ZEUA 2OPQB 3C6UA 1WTBA 3CUNA 1WHVA 2Z1HA 2E2NA 4C9DA 5FLXY 3HHLB 5AJ3J 4BLGA 2E7WA 4X65J 4JKBA 1AUSL 1FXRA 1BQNB 4PEOA 1JMTA 3FBCA 5F8IA 4M5DB 2MLZA 3OD2A 4Y3CA 3C16A 3IM8A 4HT7A 2FLNA 2GO9A 3C8YA 4JEPA 3KLHB 4WFYA 1MNEA 4C0OC 4EWTA 4CEDA 4O8KA 2NXCA 2CDRB 2CZ9A 1KQSR 3TVKA 2UV8G 4BR2A 2DIUA 4FWPA 3PCOB 4DWIA 2ZBPA 3SUOA 1BU6O 1F0XA 3FVYA 1CJUA 3HPOA 4DV6F 4AM7A 1UVMA 3IAM9 4J9KA 4DG1B 1ZOTA 1LWEA 3MMAB 2JL9A 3CJKB 1RP5A 3BJYA 4BRMA 3BDEA 2R7UA 4J7CA 4BHQA 4YB5A 4ZCLA 4X62F 4HT5A 3A5LC 5LMNK 4IH7A 1VCTA 3QJLA 2Y8YA 3MD3A 2AYMA 3MAHA 4FZXC 4KGVB 1BUXA 4G1PA 3VA3A 1IWGA 3EXYA 2JEJA 2WCXA 3M8YA 3M8SA 3C6HA 1YZ7A 3RAMA 3J7A1 4FOIA 5J2MB 3VEYA 1BDGA 4OZJA 3CT9A 3SQOP 5MAOA 1RHQB 2BJ8A 2EC2A 4PY5A 2YKOA 4JS4A 1H38A 2E66A 3B6BA 4ILJA 4KHPJ 3D0HE 4DV1K 2E44A 1H0HB 4ZPVR 1Q4RA 4X64J 4BC7A 3U1MA 5IM0B 3LPUA 5FRNA 1N32J 4PABA 1RT6A 2UUAJ 1IQZA 4B3RJ 3MMCB 3O5BA 3DHXA 5M1FA 4Q5VA 3HHKA 4CBWA 5D77A 1S9FA 2E1ZA 4DPUA 2OJ3A 2O8FB 3KKRA 2CJAA 1NJXA 3AVKA 4YHHF 1Y11A 2XMWA 3THXA 3CCES 2D5RA 2XY8A 2DHHA 4NLOA 2OP5A 4YS2A 3B4MA 3DLEA 4JI0K 4H0OA 2P9NB 2RMLA 1ZAVA 1KONA 4ZTFA 2ASYA 2FHKA 3KMQA 4CZKA 4Y2CA 1KKHA 1KLMA 1C1BB 1ITGA 3CJ3A 2A6MA 3Q8UA 1TUWA 1X3MA 2JZ5A 3DN9A 3A2FA 1VQON 4JKDA 1JLQA 3JSRA 4Q7AA 3H5YA 3WHIA 1F9EB 3O44A 1Q7YO 2BRLA 4LSLA 2IYGA 4AILC 2HHSA 1UTAA 2L08A 4YEAA 3MWTA 3M8RA 1JCEA 1VSFA 2LQBA 2J76E 2A6AA 5IT0A 5J2NA 4LR8A 4LY7A 3VENA 3CCSN 2NRZA 4DHVA 3V9XA 4CLPA 1B3TA 2PI5A 3MEDB 4M45A 1S4EA 4Z4CA 4RWWA 3GCWP 1SV5B 5K5MA 4JYAJ 5K14A 1WSGA 4C1NI 1HNXJ 3QRQA 4Y2KA 2GAGC 3OBIA 4H4MA 2M2BA 2B4PA 1I5OB 3ZXWA 1EJ7L 2QL7B 1IKWA 5F8HA 4M7YA 3EL2A 2VQFK 4CBXA 1KD1O 1VQ7S 4M8LA 2RRBA 5B0BA 1Q5YA 2J6UA 2CAJA 1EWQA 5CYMB 1JLGA 2DEIA 1OH8A 3MPDA 3HP6A 5B0AA 1B9DA 3L3UA 2KXHA 1M5PC 5RUBA 4FF3A 2Z0GA 2E6LA 4M3RA 1P9YA 1Q79A 4B8AB 3QNNA 4ZVTB 2V69A 3F56A 2CH6A 2F7TA 2DD8S 3OUYB 1S22A 4K50A 5HLFA 4LF8F 1KQKA 2VUGA 3EE9A 4BQLA 3G71N 1BG3A 2XYHB 1X5TA 4Y2MA 2UUCK 4H4OA 4OJRA 4M3TA 5LXYA 2C3OA 1HJRA 1T6DA 4E98A 3S7RA 5C25A 3DOKA 1FX4A 4I2QA 4C8OA 1QVFM 2NXEA 4Z7YA 1VQKS 1NGBA 5J1NA 2BQRA 2H4WB 2KQ2A 1HR0K 4CGDA 1JL2A 2IS3A 4B1UB 2OZSA 2VH7A 5H1SQ 2HS0A 1S7HA 2BVZA 3E8OA 3V9SA 3FNNA 3DDIA 3M30B 5JLHA 1VS3A 1LW0A 2RQCA 2E2QA 2R7XA 4ED5A 2BUNA 3RMDA 3VMFB 2XULA 2E9TA 4IO9L 3BGRB 5KG2A 1T95A 1TL7B 4E7HA 4FM2A 2GQQA 4IO1A 4PL8A 3HLUA 3CCJS 3D2FB 4HL9A 1BO5O 4FCYA 4OI0A 1W97L 3GL1A 1A5XA 2CQ4A 2RHKA 2J8AA 2FYXA 1GH8A 3TW0A 3NF6A 1UVKA 1N48A 4Q2LA 2EWSA 1UZDA 3OVBA 3M2RA 3BF3A 5JS2A 3THVA 4JN4A 2HWHA 2XMUA 4FWMA 2CRLA 1J53A 4CZGA 3HPHA 2F8MA 1ESVA 4DMNA 3GSDA 3IAS9 1N36J 1VRTA 3H7HB 5HQMA 2XMJA 1N34K 1A7GE 2BJ1A 4NLVA 4ED0A 2HNZB 1WSHA 1YTUA 4Q0BA 3ELHA 4HTJA 2M70A 3IKMA 4LF1A 1VQPS 3R7NB 3HSZA 4EBCA 5L1LA 3N5FA 1LWCA 3V81B 1WC1A 1V3SA 1KNZA 3H46O 3IWNC 3A3OB 4TU9A 4X2BA 5LMUK 2QC3A 2AJ1A 3MOZA 3I82A 4J5OA 2XMTA 5BJRA 2D0AA 2MQNA 2VC0A 3L4QA 2G1DA 3TWZA 4DDFA 2N7CA 4H0XB 4LVOP 4C8LA 3K0SA 1RTJA 5HOOA 5M1KA 3TYTA 1NZ8A 1H2VZ 4FJMA 1S3XA 2OA8A 5C10A 3O1LA 2VASA 4IKAA 5KFJA 2P51A 2V67A 1Z05A 4CJUA 5HBMB 2IC3B 3PW5A 3LGHA 1NK5A 3KOAA 3E66A 3W9JA 1MSWD 2QWQA 2NRRA 3E9PA 3WXIA 4G1QB 2Z2YB 2FB0A 3EKSA 3OTOK 3M6WA 2HHHF 2G8UA 1W25A 4JI5K 1RYSA 4DX7A 4NLDA 2HSTA 3ZSXA 4J90A 2WC9A 3CIPA 4P73A 3T1AA 3W63A 2PIIA 3GIIA 4DV2F 4NCAA 3R5DA 1JNRB 3SMSA 4CO4A 4DCJB 4OKEA 2DY4A 4UW2A 1UA0A 5D3GA 3MFIA 4NA2A 4UY85 3M2VA 1CLQA 3CCQN 3FGVA 4C1NK 3SFUA 1K0TA 3R6LB 1GLDG 1MROB 4JV0A 4MFBA 3N79A 4ZLNA 3DGVA 3HOTA 4JI6K 5KFAA 4FK4A 3RBXA 2K1RB 2VJUA 4TLRA 5LSOA 5HN0A 1D9FA 2ATQA 3JAMO 3SDEB 1IWAA 1QLNA 2ZNZA 4DL4A 3DI6A 3QBWA 2W9BB 3HYFA 1LQ9A 1EWRA 1AT1B 4USHA 1VK3A 1J5OB 5GAGI 3QFWA 5D0HA 5IWAF 4AHTA 4LFBJ 3GIJA 4QWAA 5GMKa 2R7QA 4EGLA 2M0GB 4OYXA 4QW8A 3VAHA 3JQJA 5DM6L 1NSKL 5CCLA 3SSSA 4RUBA 3DXKB 2IRYA 2ZVSA 1JJ2M 2P9SA 1NNDA 4F4ZA 5U47A 1B7YB 2QEXS 3AODA 4KPCA 2LXIA 2F9JA 2PMHA 3CJCA 4UOGA 1O1WA 2ATLA 4NXMK 2I0XA 5F8JA 2RILA 3BF4A 1ZXOA 3GG1A 2CQPA 1X7VA 1OIAA 4LF5K 3IR5B 3ZSVA 4C11B 2HVHA 5KFFA 4HHTA 3G8TA 5AQIA 3MOJB 3OBWA 1FJGF 3MXIA 2BE2B 3SYZA 2HK2A 3ZEUB 2QRRA 1J27A 1W2IA 4XH5A 1GT8A 3C6UB 5HJYA 4OHYA 5FD1A 1RWUA 4KE5A 1WDTA 1JCFA 3UCGA 3RZAA 2FVRA 4FF2A 5HRSA 1CG2A 4DUYJ 3QQCD 3W2VA 3CJ4A 1SXLA 3C16B 5A6WA 3OHBA 3CPWR 1KP6A 2P9IA 3DXSX 1S5ZA 2IJRA 3G96A 4ZN1A 4ED2A 4I7FA 4I1TA 1X8DA 4OYWA 1S1WA 2VIHA 2GAHC 4DR1K 1KCFA 2C2OB 3QAEA 4OHWA 3L7UA 3EGZA 4OLBA 4OKJA 4NLUA 2G8VA 2BX6A 3T5JA 1CJUB 4QWBA 3UPFA 1KS2A 3CDWA 5EWGA 3L95X 1HNXK 1LWEB 3LZJA 4L74A 2C2KB 3O1WA 2RQMA 4CE9A 4CJEA 4WP9A 2CJKA 3NS6A 3I8DA 4U67L 3GZ7A 4NLRA 1UVJA 3SV4A 3W7BA 2ZJQL 3CSKA 2GTDA 3CEDA 3BH7B 2YNGA 5T14A 1U24A 3MXMA 4BE2A 1SUQA 2XLKA 2E2OA 2B8PA 2CG4A 4JI2K 3AXKA 2UVUA 3VAKA 2EC0A 4PG8A 2XI3A 3J7YI 3IG1B 3DKDA 4RLEA 4ECRA 4EFHA 3Q2SC 1GOCA 2QGFB 2X3DA 2K7JA 3RR7A 2NXUA 4FM1A 1FNOA 3RR8A 4JI4J 3ZTRA 1S10A 4G65A 3HVAA 4DX5A 1IBCB 4QPXA 1RT6B 1WOPA 2P5GA 2NPIA 3J7ZO 1X5OA 2HLUA 1W26A 1YI2S 4BREA 1HWKA 1ZA1B 2F8EX 3Q7BA 1HJOA 1YJ9N 5GAHU 2ZGZA 2EKYA 2AGPA 3BUZB 3THXB 4MIWA 4I9LA 1ZA2B 2E9ZA 2IDEA 3BM7A 3AOCA 2OD4A 1YVUA 2GNKA 3DLEB 2GUIA 1QQCA 2BW7A 3HZGA 1LXJA 3GU0A 4DV3F 2XZTB 3RBZA 4CO1A 4NZ6A 5C2FA 3T5HA 3QGGA 1SC6A 1KLMB 1ZZFA 3DYAA 4NO7A 1X0FA 1IJJA 1W0HA 3TVZA 2IRUA 1IBKK 2R7WA 1SKWA 5DK5A 4MKAA 5CE3A 3ZZPA 2PEBA 3NL0A 3D3CJ 2G8KA 5AE2A 3KG0A 5BRHA 2YXLA 3QWPA 1BA0A 2C28A 5DLFA 1A6LA 3F9MA 2N4DA 4FSVA 1CLFA 4A47A 3PW2A 2BJ9A 5KG5A 1YLXA 1S49A 4OX9F 3VAJA 4WK1A 3KUEA 4BGAA 3NGDA 5E0OA 1LAWA 2WZ1A 5K14B 1S5JA 1UWBA 1CS4A 2YX1A 4NLYA 1RACB 3RB4A 5C7PA 3KK2B 3JTPA 3SAGA 3WEEA 1Q86O 1R31A 4WBFA 1IKWB 2R7SA 2V2QA 4OHZA 5KRSA 1SPBP 4YB6A 3A12A 2NZTA 1GAOA 1N36K 4CK2A 3HI9A 1GLEG 1FDNA 4A8MP 1ZAXA 3G6EN 4EP5A 2XO7A 1XMBA 2V4QA 3H20A 3AT1B 3S6EA 1JLGB 1RDWX 1IBLF 3RB6A 1NXIA 1S77D 2JGUA 4IJNA 2DFEA 2KXNB 3DLLQ 2D9OA 4OJHA 5HO4A 2VYPA 3DFEA 2EBEA 2N3LA 4EU0A 4QWCA 1W7AA 2PI4A 3O3GA 4TY8A 2VG6A 1VQNS 2H54B 3J81Y 3BGOP 1S1XA 1L3TA 5AXKA 4ER8A 4FZZA 3P38A 3QO9A 4CRJA 3SIPB 1P8GA 1VQ4S 1RDUA 1WF2A 3BPSP 3OFGA 3G8SA 2RRNA 2UUBK 5C25B 3DOKB 3EVOA 2APOA 4I2QB 4FLWA 3DLBA 2J0XA 2BOPA 2V5HG 1MN9A 3CB4A 2C42A 3IMXA 2IYIA 4E2FB 2CPZA 2WBMA 3TQEA 3P5JA 2CNKB 1ATNA 4XIUA 3HZEA 4WQ4A 4WFAL 5F8MA 1VQLN 1XTZA 4MYTA 1FKPA 2K3KA 1LW0B 2M4MA 3EY1A 3EX7B 4GKJK 4B8CA 1SS6A 4MLHA 3H42A 1G7CB 2XSFA 2YNFB 1GX6A 5M1NA 2H4YB 2V9WA 4LSZB 2DIVA 2O1PA 2YNHA 3H2LA 1VSJA 3D0GE 1VBYA 3OYIA 4Z4FA 2CVIA 5E3AA 2AYEA 3R7SB 4C3MA 3BGFA 3C0BA 4B9UA 4IOCQ 1HA1A 4O23A 2LKZA 4K2XA 1NB7A 1OSCA 1NGJA 1Y7PA 1N0VC 2V68A 3VGVA 3R3TA 4P7TA 4BE1A 3M2RB 3ZZ0A 2EEYA 3MN9A 1HMVA 4QAGA 4GO7X 3KD1E 2DNYA 3CO9A 5HJXA 2MZSA 2KDOA 2R2RA 1NPKA 3RGIA 1VRTB 2VJVA 2HIQA 4HH1A 3FBFA 2RS8A 3ZCMA 3R9PA 4GV3A 2OMLA 2HLTA 1SI9A 4FOEA 3MPYA 2G8HA 4Q0BB 1O51A 2AKWB 1OMSA 1U1NA 3L7PA 3H90A 4IH5A 2KZZA 3R2CJ 2AZ3A 2WW8A 3SMPA 1QJHA 4P75A 1LWCB 3SQ0A 2DXEA 1WKJA 3VGTA 4E0DA 1S72S 4LFCJ 2Y1JA 2DO0A 2AYBA 2BH1A 2MLYA 2LFVA 1PJ6A 4LF9F 2ZZNA 3PDNA 2XEXA 1GLLO 3PHTA 2PZSA 2VZ9A 4DTUA 4IOCL 3TUZC 3VQDA 3H25A 1N33J 1XQIA 3V4MA 2ZJRQ 1UZHA 3FUYA 1IVZA 4NOHA 4YR2A 4QYZJ 1R0AB 2OPPA 3GJQB 4KRFA 5IT9O 3TA0A 3L3VA 5DQHA 3VGSA 2EI5A 4ZS6A 3UFCX 3S3NA 3KLVA 2ZKTA 4DZDA 2Y0BB 4CHYA 1RAEB 3CCZA 4AD6A 3DCAA 2FZKB 2GVDA 4CQ1A 3CCMN 2VKZG 4WQ5A 2D0BA 4TYBA 3F41A 3ZNUA 2MQ8A 2F7VA 3P96A 3SCXA 4HI1A 4CGIA 5BN8A 5F0WA 3P8BB 2IM1A 1Y97A 2HEKA 1UVLA 4CEFA 1NGCA 1NKBA 5D15A 3IR7B 2NRWA 3RBEA 4ITSA 1TK5A 3O08A 4ID8A 4JRPA 3B78A 1UW4A 3HK2A 1BMQB 2D3ZA 3NE6A 1RAIB 4JI7K 4X4VA 4K4ZA 4C0BA 1JCGA 5DQGA 4IJAA 2CPEA 2WW4A 2ZD1A 3VF2A 5D3GB 2LP4A 3E1YA 4OYOA 3CDBA 3LP2A 3CCRN 5KFLA 4QS8A 3PJ9A 2FVPA 2VOOA 2Q36A 1NMEB 4WFBQ 4IEIA 4WCEQ 2DHGA 2XGPA 1YJTA 2IVPA 3L2UA 1RWMB 1HWLA 1PJ7A 3PYDA 3TAFA 3HMJG 3UDLA 3LA0A 1SKSA 1DKGD 5DM7L 1KOHA 2MKSA 4ID5A 1HBOA 3R5GA 3IR6B 4USTA 2VQEJ 3FEXB 4A5AA 3IM9A 5F0XA 1IM4A 1NK4A 1HFEL 4FYWB 4TYAA 5F1XA 3NHGA 1RBOB 4WYWA 5BR9A 4DL0C 4BRPA 3SUNA 1EP4A 4BRKA 3CCEN 2ZGYA 1LKZA 2G9OA 3VAFA 4DR7F 4MKYA 1AW0A 2O8BA 4L3NA 3BR9A 3OYBA 3MEKA 2P9SB 3DAWA 1HNZK 4KGMA 4UQGA 3V1QA 3VEZA 1IBMJ 4IYQA 2Q97A 4GW6A 4CHPA 4HKQA 2HBLA 3D7EO 2WSCC 4X62J 2V8GA 2NRTA 2VG7B 2A10A 3V6JA 4DR6F 2EPIA 2HRYA 3HCXA 2VODA 4WP8A 1FFWB 1N5TA 3W5YA 4CBUA 4AT1B 5EXWA 3KWGA 2MKKA 7AT1B 3AGKA 4CTAA 4UOCA 4FPIA 3ITHA 1JLBA 5AQTA 1RAJA 5E3PA 2J7KA 2IM2A 2YVSA 3R7BB 2J0WA 4AL7A 3GR1A 4I56A 4OI2A 4O3NA 3W2VB 5GADI 2QV6A 4B3SK 1AZSA 4NLCA 3BO2A 3CMQA 3WXJA 3R2DJ 4KBIA 3QYYA 2P9IB 3O4QA 1K9MO 5EWEA 2E8AA 2OIHA 2P9KB 1UFWA 1S1WB 4LF6F 3IBWA 4YHHJ 5HRPA 4XTTA 4PHTX 1FJ7A 4CD3A 4I68A 1Q1KA 4ILMA 3GIKA 1VQ7N 2M8HA 5ETOA 2DY1A 3OHAA 3QSIA 5ADXH 3GWCA 4NZ0A 4DI6A 4EK2A 4EI2A 1REGX 4K5RA 3R97A 3KG1A 1VJWA 3VQQA 1X5SA 3SJJA 1W2BR 1XHZA 2E5LF 3F73A 1KRPA 1T9XA 4WXOA 3FC9A 4J2EA 4ZHRA 5JJBA 2YNGB 1NWKA 4GC6A 4FNHA 3QFPA 1SUQB 4RBVA 1WC5A 2B9WA 3IC1A 2MGZB 1P9QC 1Q53A 2CADA 4KR0B 4CDIA 1DAXA 5A8WA 1RT2A 1RA7A 4LMZA 2EFPA 1RBUA 3GPAA 3CF5L 1QAJA 1IG9A 5DG9A 2CQHA 4CLZA 4C4WA 3W8PA 1VYAA 2AA4A 1VQKN 1C0GA 2KXFA 1V5IB 4DTNA 1NMNA 1C2PA 3CJRA 4R79A 2IMOA 1KVBA 5HMZA 1X4DA 3VTHA 2L3MA 4RWXA 2ATCB 3R1HA 4Z4HA 3GE1A 3V4IA 2W2MP 3BYRA 3ZSWA 3G6YA 2R7TA 2ADCA 1YJNS 4JBCA 1QS4A 1UAXA 1YBTA 2Z4PA 3VQ4A 3V9UA 3T19A 1OPIA 3HF5A 2BZ2A 2AJQA 3KTQA 1NH8A 3W0LA 4F2RA 2ZE2A 1PIEA 2ZUAA 4OI1A 1VGYA 4V19J 3W3DA 4R0JA 2KVIA 4F0MA 2JWKA 2DNKA 3NFAA 2HFOA 2A2DA 1X4CA 3A13A 3K5OA 3UD5A 4AE5A 2Q0RA 3KIOA 3MFHA 3CCJN 2ZC3A 1XHXA 4K0KF 5HK4A 2UXBF 4U7CA 4BRDA 2QX0A 2XMVA 4CF2A 3L2VA 5B09A 5F2RA 5D0EA 4Y1DA 3BP8A 2ZJPQ 2I8EA 2CQIA 2QTDA 5KFEA 4AUKA 2DB1A 4KH1B 2F96A 5AQWA 4YNQA 3BGLA 1KTQA 5DDQC 3J81U 3VERA 4CH0S 4BRNA 3AQPA 1S12A 1NZAA 2G2OA 4M5LA 3CCVS 1TL5A 3HSDA 3H08A 4RW7A 5BR8F 1UWBB 1XMOJ 3NMRA 1CS4B 2ILYA 4DV7F 2RD5C 1SJ3P 5HROA 1FK9A 2CIMA 2FJEB 1NPRA 2DHAA 5CYQA 5KFUA 2VWBA 5F3TA 3KJVA 2G2YA 4QBUA 3WEEB 4DR4J 3GYGA 1VQMS 3H8YA 1VQPN 1GOAA 3LP1B 3MWPA 4CF1A 1XNQK 2EHGA 1KC8T 5D4NA 2QL9B 3V5RA 3AAQA 5JS1A 3H0PA 1KAZA 1HIYA 3RG6A 2AEFA 2OD6A 4B3MF 2VPWB 2CJQA 3CC4S 1RAHB 4RNFA 1ZBFA 3ZTSA 4TY8B 2VG6B 1YJVA 1YGYA 4B9SA 3KJQB 3X1LB 4J2AA 3M1FA 5DDOC 2ZKUA 3BY5A 5L38A 3QO9B 4B1XB 4DTRA 1N5SA 1J5EF 2KW4A 4LF7K 3Q89A 2AGQA 4DV5K 5CQGA 3K2PA 3EXCX 3LP0A 4LF4F 1WC0A 1N5VA 4Y34A 3ZX3A 1KVJA 4CJWA 4JI1J 4WF9Q 4JI8K 4LRCA 1T03B 3AVMA 4QYZK 4QYRA 2ACYA 3OHRA 4QJVA 2B0GA 4JI3F 3D6TB 2VFTA 2NYIA 2DNZA 1K8KB 1FKPB 2DY9A 1SQEA 1K1SA 5BPMA 5K8MA 1XWLA 3DXBA 2QA4S 4DR5J 2QG9B 2W2OP 3BS9A 3A8YA 3MPWA 1VHFA 1NSQA 1HWJA 3OW2R 3R5AA 1RBAA 2YNHB 2NXJA 1OJ4A 4DTPA 1VSLA 4EHUA 3TX0A 3KVGA 4U96A 4DLEA 3ZSQA 2NQPA 3US5A 2K06A 4J9MA 5A2QO 4ZK7M 4I4BA 1HNWF 2M5YA 3MM8A 1S0NA 3VQ5A 4CT8A 2OPRA 3KG4A 2Z1GA 3ULHA 3EZ5A 3E3XA 2R8JA 1HMVB 1VLYA 1D1UA 5CZXA 3AD8C 1NK7A 3NWGA 2GCFA 1GLJO 2ZC4A 2ZBRA 2FSJA 2BE7D 4Y2IA 1H7XA 2ZDOA 3W5XA 4K8RA 1CBKA 1HPZA 5DLGA 5T7BA 3WQPA 3MI7X 2MJNA 3UNGC 1YT3A 4N47A 3QICA 4YDDB 1YF5L 4Z4EA 2J0SD 3P6YC 1RHUB 4J2DA 3HT0A 2JH3A 1N54B 2VA2A 3JB9k 3CHWA 2QN6B 3VF0B 5GAGP 5AXNA 4F3TA 5LL6d 4DV6K 1WTFA 5AQQA 3O3FA 1HD1A 2GV1A 1RT7A 2DNNA 3ZX0A 2P6SA 3FLCO 3D54A 1ITPA 2FC0A 3OYKA 1DJ0A 4WTYA 1T7PA 5DJBA 3AJ1A 1X9SA 3UN3A 2IM0A 4X62K 3CMES 1S9EA 3U1LA 1M1GA 1HNVB 2Q79A 2AMCB 3LPYA 3M9NB 1C1AA 3ENVA 1VIOA 2KYXA 5CCMA 2W4PA 3OR1B 4JB8B 2OLWA 4TKTA 2P9UB 3FFKB 2J9DA 3GFZA 1FTRA 5I3PA 4E7JA 5F9LA 4NYZA 2GVDB 3A5MC 2CGLA 3QEVA 1XNRF 5D6GA 1S0MA 1GLBG 5F9NA 1NK0A 3MCNA 1IKYA 2VU5A 1KSPA 1FHTA 1U6ZA 2BJEA 4WPAA 1E6VA 2PGCA 3FCVA 2AEMA 2YWHA 5HVFA 1RTZA 1HYZA 3BF1A 2VG5B 2W9CA 4YHHK 2NLXA 1HWUA 2GJIA 1PO6A 5MLCV 4DS4A 2RE2A 3OL6A 3U3YA 2WTFA 1SQKA 2ZD1B 4NL5A 3CQYA 1TAUA 3CJTA 2DNGA 2ZH4A 1ZM4A 3LP2B 2RKIA 5EWFA 2R8HA 5KT2A 4EZ6A 3H5UA 2JLEA 3O9TA 3AO4A 3N6MA 3RW7A 3HXMA 4TU8A 1NAQA 3SQGA 2FJAB 1XK8A 2DH9A 3Q8PB 4OJ1A 1YKWA 4DU7A 4X4SA 3JSMA 4ID5B 3ENHA 1HBOB 1HKAA 3HSCA 1OPZA 1I3OB 3HD2A 4M95A 1YTAA 3CCLN 1NO8A 2UXCF 1ZS6A 3MR7A 1XC9A 3PIOQ 3SJHA 2IGIA 3UNYA 1BY9A 5JMVA 3NCIA 5HL7Q 3MUMP 1SBRA 3IMQJ 4DLGA 3N5BA 3WX8A 3R3LA 3MM6A 1QDUB 2KT2A 1EP4B 4ZOSA 1TR0A 4GV6A 2Z30B 1WHXA 3CC2N 4OX8A 2GWKA 2FPHX 2O8BB 5IV4A 1MWMA 3CJQA 2DFHA 3GIRA 5KT4A 2BRKA 4EIAA 1BISA 2W41A 3AH6A 1UW9A 3ENOA 4IFYB 3M6XA 1NLVA 3BH6B 2OCEA 2KN4A 2PDAA 3PKMA 3PX6A 2QK9A 3OLBA 2PFDA 4I69A 4CTAB 4F36A 1ATSA 5KG4A 3ITHB 1KDNA 5E33A 1VLOA 2WVCA 4RO0A 3DHWC 2BMBA 2WVEA 5A6PA 4OJ3A 4ILHA 3NGYA 3WBZA 1YIJS 1K44A 1S1TA 4B02A 4O0NA 4YY3J 2RNEA 1AZSB 2AT1B 4YB7A 5B7WA 4LF8K 2W1BA 1YK9A 2MHEA 2VL1A 3SQ1A 2COLA 2DR6A 2J7UA 2PYLA 5E3RA 4F4AA 2FUG9 2YBVA 1TV6A 2ASPA 4FZYA 3F44A 4PA1A 3GB0A 2HGLA 5KT3A 4A8SA 1QQMA 3TR5A 1BC6A 1Q95G 1SCJB 2V51B 4R5PA 1RA6A 4X66J 1S6OA 4D3GA 4CJ3A 3OXLA 3VQPA 1WG5A 2MZRA 3GILA 3JS9A 4PWWA 4HCBA 1WOOA 2ALZA 1S99A 2LSNA 2OGUA 5KGWA 3D4JA 1FI4A 1R8CA 4ZHRB 1HW8A 2YJEA 1UWAA 1NLKL 2GX9A 1OH5A 4NYPA 4QS9A 4PWDA 3KLEA 4IQMA 2ZOFA 2KHDA 5A8WB 4YQWA 1VQ4N 3H98A 1RT2B 1MN7A 4A8YA 2E1CA 4E1JA 1OYDA 2M7SA 4BGBA 3U27A 1MDUB 3K5LA 4QIFA 5I4MA 4PKIA 4K7QA 1TK0A 4AQYF 4AHVA 2W4DA 2ZUGA 5IT4A 2A5XA 2JVRA 3T9NA 4J9QA 3DRSA 2X1GA 1WELA 3MK6A 3V4IB 2A41A 2WTUA 4IFEA 2D3OR 1S9GA 4CLKA 3L0QA 1QUPA 4NXNJ 5ETRA 2HNYA 1GQEA 2RIJA 2ZE2B 3CPEA 5I42B 3BDPA 1TVRB 3H4DA 4QW9A 3NOCA 3NGKA 4AL6A 2IMWP 4USWA 2KG0A 3HULA 4DFKA 3FCWA 3ULEA 1BQXA 1TL1A 1JJHA 4IRCA 1GFWB 3MM5A 1QAIA 2MQOA 3WIVA 1Y00A 3TZXA 5C15A 3OYJA 1NK6A 2GVZA 2BACA 4LRAA 4YOUA 2F9TA 2DCLA 5EN1A 2R7OA 3W65A 1HLUA 1ZAWA 3AA2A 3EEQA 5LJ3Y 5GAHI 4RW7B 3RB3A 3MX5A 3O4NA 2XY5A 3M6GA 1T05B 1FK9B 4FXWA 3OJSA 4CIEA 1FD8A 5C2CA 2C2NA 1HI8A 3NKYA 3GJSB 5CYQB 1R59O 3KJVB 3IO1A 5GAEI 4O44A 3OFFA 1VK8A 4IR9A 4B1VA 3R6GB 4CGJA 1K8AT 1NGAA 2VD3A 1NG9A 2FHOB 1QD1A 4K42A 2CJYB 4ATNA 4B1WB 1APSA 4DU3A 1S72N 1N4LA 3K89A 1IR2A 3LH2S 2HHHK 4WQ4C 4UY8T 3MGJA 2V34A 4FK0A 1FVSA 4O4GA 3P45B 5FIIA 2QI2A 2RDDA 7FDRA 4UT4A 5C5JA 1O6XA 4DPWA 3HSTB 1X31C 3MDQA 1WDDA 3SI8A 4DV2K 4OLPA 1HARA 4CF0A 2HZVA 3GV7B 1KHVA 2FSNA 5KFPA 1NJYA 3KJFB 3CJ2A 3ISND 3DMJB 4RWTA 3DLHA 3T1YJ 4ECXA 4ZPBA 1X0PA 3LGNA 4DV4J 3S3OA 4IG0A 2ZM6J 1U2RA 3T1HF 1A5WA 1ZBSA 3T5KA 1ZYQA 3LP0B 5KT5A 4NA3A 3UN2A 1TKZA 1NPPA 1BD6A 4USVA 3OYLA 1FWPA 5L1IA 3HKWA 3TP2A 3L2WA 1M1HA 2IRXA 3TEHB 2QZ8A 4C48A 2C22A 2OZMA 3UI3A 3H1VX 4KYZA 2W8KA 3AARA 5M2UA 4IDKB 4WZMA 1H74A 3NP5A 9ATCB 3OYHA 2R2TA 2VGMA 4ZLJA 4IOXA 5IWAK 3R9LA 1XUPO 1RAAB 2B9YA 3DXMB 4YR3A 4DXLA 4F4KA 1RQ0A 2CPDA 2GMHA 4I9QA 4FJLA 3TRGA 2BM0A 4A59A 1X4AA 1R0CB 4FNIA 3UR3C 1NBEB 4DKWA 1S6QA 4MIBA 5M2RA 1QVGM 3M8ZA 3QEPA 3SV3A 1HW9A 3CERA 1LWFA 2MZ1A 1S48A 1RCHA 4N56A 3MM8B 3GDQA 4AXIA 4DBQA 1BWFO 2O67A 3DC2A 2AP1A 2OH2A 5AQVA 4NCGA 1KVCA 3MD1A 3PRDA 4AHUA 3ID8A 4M3YA 2X1BA 1ULRA 1RBRA 3PYEA 1FJGK 1ACMB 4DF4A 4ECSA 1LK5A 4DU1A 4GV9A 1MA9B 3JQKA 2GFFA 1SJ4P 1NKEA 1HPZB 3NVKA 2I5JA 4A5BA 5KOXA 3OL8A 3PM9A 4RUAA 3IDHA 2ZOMA 3PR4A 1GXTA 3FKBA 1LV5A 4J9VA 2Q6CA 4USMA 4FWOA 2QM1A 2GGPA 1RT1A 4I6AA 3KK3A 4WQ5C 5AZJA 4K4WA 2HMIB 1XJWB 2AIRB 3KHGA 1KBRA 1SQGA 5KT6A 1FEEA 1NJIT 4Y0WA 2HBJA 4IOAL 3D6HB 1EARA 4CYUA 3HM8A 2WUSA 5KG7A 3FQLA 1TMJA 3VV2B 4G1IA 1SJQA 1Q9YA 2GZOA 1L3VA 3QT8A 1ROFA 2ZH2A 3BEXA 2DBBA 1YUWA 4PG4A 1V4SA 2O4GA 2WBNA 4FJNA 4C97A 3HDSA 3NBPB 5HMWA 1DQ8A 4DL6A 1S9EB 4H0TB 2RHQB 2VDHA 2ILZA 3QNWB 1YRUA 4OZ5A 3LWLA 3W5ZA 1R3NA 3C14A 1U2CA 3O8WA 4IRDA 2FXUA 1DTTB 3HZ6A 4CFCA 1HKGA 1VAZA 1X4FA 2E7XA 4FW1A 4CK1A 1QY7A 2EKNA 2KKHA 1S59A 1NK9A 1IKYB 3VZIA 2VFSA 3M05A 4B3TF 3QINA 2I7PA 5GADP 5AQSA 1HI1A 2I7NA 1Q9XA 4DV1J 3MM9B 4X4OA 2YKPA 4M3XA 2W9CB 1PBUA 3T6BA 3I33A 4AYBD 4OFZA 3G9CA 1JXBA 3CI5A 3D3BJ 1RXOB 1VC0A 1LCUA 3AAPA 3RRKA 1YG0A 2YKNA 4DR6J 4DTJA 2RKIB 4IQXA 4NPOA 4GKKF 2YJFA 1JJCB 3AVFA 4YUDA 2IIHA 2MKCA 2M52A 1H3DA 4DV3K 1YBUA 2R7RA 3M32A 4ZPDA 4RW9A 1PYOB 2XO6A 3ATUA 1NBWA 1IQTA 3SQGB 4NRUA 3I87A 1TKTB 3JSMB 3KWMA 3BKTA 4FM0A 3W2WB 4JI0J 3FDSA 4UQTA 4BACA 1OWXA 4WKYA 2HWTA 2D4WA 5KRTA 3KLIA 1S97A 1UVIA 5FLXO 2YWEA 3EICA 1XN9A 3CULA 4TLQA 2NPFA 3PACA 4LF6J 4LH4A 1ZPVA 5JVHL 3UDEA 4OX9K 4OI6A 1VI7A 1B92A 2IVOA 2YY3A 4DR3F 1T9YA 1TFWA 4BWJA 1GLCG 3W8GA 3I6PA 1X4EA 2JC0A 1YJNN 4DUZF 5ETLA 4BRFA 4LFAF 2WVFA 2J5AA 2QLFB 2CPIA 3VR1A 3UD3P 1Q81T 2RUGA 2RS2A 1LOTB 1FA0A 2V7ZA 4FF1A 4FJJA 2RU3A 5KFSA 5F41A 4ZVRB 2AJ4A 2XWYA 1PYSB 4I0WA 3NMUA 4CW7B 1TUVA 4FJ9A 5DRKA 4K4YA 1CZAN 3RW6A 4CJSA 2J7WA 3AJ2A 4J9NA 1RDDA 4NZ7A 2ROEA 1HHSA 3JAMU 3TAPA 4F3OA 3TJ8A 4A8QA 1IBLK 2VQFJ 3L09A 4W92B 1Q7YT 4LJMA 1P1LA 1FE4A 4ZKAA 1CVJA 4LREA 5AFUA 3N4QA 1S1TB 1SIZA 3TARA 1FKOA 3B82A 3THWB 4R8UA 3TZYA 4BDPA 3GLJA 3QETA 5CH7B 4Q45A 5LJWA 1EQYA 3NNAA 4FWKA 4EEYA 1ZM9A 2DRBA 1VQMN 4DV0F 3TA2A 1WAFA 1U1QA 4F8RA 2VBXA 2FY8A 4MQ3A 4R5PB 4EAHD 1KD1T 3LUYA 2UUCJ 3WXLA 2VFUA 1WI6A 2LVWA 4DR2F 1V4TA 1CC8A 4FWLA 2QO3A 3CC4N 2R42A 1VBZA 2CQGA 4BRGA 1RWKB 5M1QA 3D6FB 4N5SA 2FJBB 1YTYA 1S1UA 1Y64A 4BR7A 1EB0A 1NGHA 5AQOA 4PWDB 3KLEB 2G0CA 2YKAA 3BZKA 3OVSA 2HYIB 3AGRA 1JKHA 5AXLA 4MH8A 2A2CA 5C2GA 3G6XA 4N8NA 2RAQA 1OY8A 3GG4A 1UJ5A 3VAMA 2Z57B 1IN0A 3T3FA 4A2AA 3PRBA 2GS8A 5ADXA 2CPJA 5BYSA 3LGMA 2RUSA 1BA1A 3HBTA 5HRNA 4CK3A 1U4BA 1Q7LB 2DGXA 3VETA 2CPYA 1S9GB 3OR2A 4PR6A 3V9ZA 1X9MA 1IKVA 4WFZA 2HNYB 1R8HA 3ETMA 5IZHA 3G4SS 5HI7A 3FSYA 2QA4N 1WG4A 3K5NA 1R43A 1P90A 5G0RA 5HATA 3BO4A 1WOQA 3QGPA 1NDCA 3HHEA 3OS2A 4M42A 5KFIA 2ROPA 2RU9A 1ZZNA 2QWPA 1MW7A 4NA1A 1U1KA 1I39A 1UEVA 3NRBA 3HJFA 3ULEB 1SH2A 1I51B 2DNPA 5B0CA 2E5GA 1TL1B 3WNEA 3AA5X 2HFVA 4ETZA 5JVGQ 3LDPA 4EHTA 4U95A 6FD1A 5AJ3F 5HMYA 3GV8B 3JS6A 3TJAA 4X65F 2GVZB 4CNZA 1UPMB 4CHQA 4LF9K 3NGSA 3TSPA 2VICA 4OYAA 4RUCA 1H1VA 4HUGA 4QWDA 2ZHAA 1WKLA 5LMUJ 3OL7A 2EWHA 3HSGA 4LF4J 5HSPA 5AE3A 4I64A 3CJAA 3AO5A 4ECQA 1WF1A 3AO3A 2YPZA 5H1SV 3CJ5A 4RW8A 3PJWA 3CETA 2BKNA 4O44B 5BREA 2JJ4D 4MIAA 3D28A 1U1PA 4C3KA 3KHHA 2B6AA 3H5SA 1YWXA 2I38A 1RKJA 1VRQC 5E7OB 4EUVA 3CQ8A 4CD1A 4S0MA 2D74B 3LDSA 1EIYB 3MR2A 3VQ8A 2QXFA 2OPSA 3VAIA 1WSFA 3H3NO 4GC7A 2LQJA 4X4QA 2A6OA 4HUEA 2ZF5O 3OTOJ 3CMEN 5HP1A 4KHPF 1C0MA 4LF2A 4JI5J 3SI6A 2D0CA 1Q18A 4H0PA 4X64F 3PHEA 4JKFA 2X51A 2BUPA 1N32F 2UUAF 4JS5A 4B3RF 4I2PA 1DQAA 3AOAA 2YQ0A 4IG0B 4M5IA 5K20B 1HBNA 3O4WA 2ZQBA 3DGPA 2FF3B 3B6OA 5E84A 1TKZB 4KC5A 1TELA 3ZZUA 4USJC 4OYBA 4RW6B 1FWKA 1U04A 4QZVB 3AY9A 2KH9A 5L9XA 4CM0A 1PG5B 5E3QA 4JI6J 5J1EA 5EOYA 1T0TV 4KAZA 4BDZA 3L7OA 2GHWA 2Q1LA 1PAUB 1C0TB 2JRSA 8AT1B 3W64A 2W7OA 1KVAA 4CO0A 1QVFR 3QRRA 4ED7A 3GONA 3P83D 4OL8A 1UMJA 1RLCL 2QT7A 3SBMA 2HAFA 4OYPA 2WVDA 4DR7K 4GVLA 3FFIA 4DPOA 4WFNQ 1YJWS 1RE1B 2EW9A 1LOUA 1S6QB 3EWGA 3U1NA 4CEOA 4H5WA 3TAMA 4PCQA 5KG0A 3I0SB 1LWFB 1MU2A 2D0PA 2QFIA 3QNOA 2ZH8A 3D1QA 4DR6K 3NY0A 5D4PA 2DR5A 3KKFA 4U7UD 4PQUA 3H5XA 3NF7A 4NCGB 3M8WA 4JYAF 4MDAA 2B4OA 3U9DA 4DMZA 1KWMA 1VOMA 5J2PB 2HGNA 1Y9OA 2C3PA 4NXMJ 3QBCA 3OVAA 2X78A 4FWRA 3I4HX 2HPUA 4LF5J 3QLHB 4WIQA 3W61A 3I0RA 4CH1A 3UKUA 2YNIA 3NGIA 2I5JB 3C7NA 2A0FB 1HQEB 4B1YB 3K8VA 4HUFA 1FNXH 2UXDF 1NM2A 1RTHA 4OZ1A 2GGPB 1RT1B 2AJ0A 3KK3B 3R27A 2V94A 4LF6K 5AZJB 2DT9A 3LALA 2QKBA 1T6CA 2DPIA 2LDYA 4IR1A 4KBOA 4PYDA 4P2FA 2I1RA 3CJ9A 2CPXA 5KPTA 3HPGA 5IQQA 3AD7C 2CKWA 4JHDA 3MM7A 3PFOA 3MHYA 4WIIA 4DR1J 2AHOB 1XQSC 5C24A 3RJMB 3CQXA 4P71A 2ZBQA 2O8DA 1X9JA 5H9EK 2E5LK 4M5HA 3BBFA 3CCSS 3VPZA 2DNLA 4A8FA 3I9ZA 2V63A 1VMBA 2AX0A 1DQ9A 5I9EB 4A4JA 2N82B 2Z1IA 1YSJA 2CYYA 4KI6A 2B4VA 1T02A 5ADZA 4CHOA 4J91A 2UXCJ 3C14B 3V6DB 1FRHA 2PEHA 2FLOA 4IDHA 4ILGB 1DLOA 4GY2B 3RSEA 3FMWA 2CQ2A 3SSQA 4UUWA 3ZT1A 3F9KA 3B8AX 3A8EA 2GWJA 2OFHX 2MKHA 2CQDA 3ONQA 4JI2J 4EO8A 1FXLA 2R9LA 3KMSA 3U3GA 1VISA 3C46A 1RGVA 2D3O1 1ICEB 4U7UK 4FJXA 1URRA 3S3MA 5CZVA 2Y3YA 1OSDA 3CYMA 4OV6A 3O80A 1CSJA 1ZETA 1VSMA 5A2QY 3EO3A 2YX7A 4NASA 4EBDA 1KEKA 5LOQA 5KFHA 2YKNB 2HKEA 1IR1A 4QWEA 3Q8VA 2QLBB 4F0HA 2KT5A 1GTHA 3CMAN 4H5TA 3EZWA 2J9EA 3FGUA 2VCPA 3A8JA 4RW9B 4HDGA 3THYA 3G71S 5ETMA 5IT9U 4W5NA 5DG7A 4BCAA 5J1PA 4CNYA 4RNNA 3I55N 4K25A 3CJBA 2BKPA 5E26A 3V9WA 4K0KK 1U47A 2UXBK 1S7IA 5E2QA 4YMEA 5B0EA 5ETPA 4Z2XA 2JEIA 4LSNA 1WG1A 2YHBA 4HI2A 1U2VA 2ASMA 4PRFA 1LFPA 3NS7B 4BVOA 3J7ZT 2HZAA 3CW2C 2Q0UA 1S6UA 2DKOB 1NU0A 2XSJB 1TL4A 1T3OA 1IBKJ 5GAGU 4TNOA 2H9ZA 3A4TA 1U45A 4RU2A 3OYMA 5LL6Z 3P5TL 4DUTA 2DHSA 5BR8K 4V1Ak 1SL2A 3CO0P 3ZSZA 5D0GA 4FPBA 1RLDA 4FLYA 3J80Y 4ALZA 4DV7K 4FBTA 3H40A 4MMOA 1FRIA 2IBKA 2G0JA 3I96A 3HI0A 5FPMA 2XI2A 3BSOA 3GCXP 3SEOA 2X6NA 2FHMA 2L9NA 4P10A 1RAOA 2BABA 3MN5A 1S79A 4CLSA 2AV5A 5KQDA 2HBZB 3AFGA 1BI4A 1B0VA 1D5AA 3WQUA 2XG8A 1U48A 1BUPA 5B0GA 1JJ2R 5K8OA 3I5BA 3QDKA 4BQZA 2KRBA 2YPYA 2W42A 4B3MK 5AQNA 5DGBA 3H59A 1XEZA 2IA0A 3R5BA 1E6YA 2MZTA 1FKOB 4OV1A 2F1FA 4JK7A 2GIFA 1K1QA 2HS4A 2V8VA 2DGOA 2HAIA 2CZVC 3MCMA 4H0YB 1UJ6A 3TSUA 1J5EK 1M5HA 1IM6A 4KAIA 2IDOA 3MTJA 3QT5A 1YJRA 2CNLB 4KO0A 3CGIA 1Q86T 3VEWA 4BR9A 4LF4K 1U09A 5GAHP 1FNMA 4YB1P 3NCRA 4X4RA 2FJXA 4M5KA 5ITHA 4BR0A 1RISA 2UUBJ 3Q8RB 4E1NA 2RN2A 4JI3K 4HHHA 3MPUB 1YITS 3MN6A 1QAXA 5GAEP 2NRHA 2GJFA 2Z8QA 3DLRA 3SCJE 1HHTP 5IC4B 3Q8YA 4ED3A 3QZ8A 3OTBA 1S1UB 4JK9A 3UCUP 5KFRA 4QIEA 4AF1A 2XNQA 4ENOA 3HHLA 3GR0A 3J7YU 4KRWA 4BVPA 1BOTO 4GKJJ 1PGZA 1Q16B 1JKHB 3IS9B 4FO0A 2QMXA 5EU7A 4ZPAA 1CJTA 3KLHA 4J9PA 2PA8D 2V8HA 1QHTA 2JHEA 3L9ZA 1HNWK 3VOVA 4LFBF 3ISNC 3KK7A 3THTA 1UJ4A 3H6EA 1IKXA 5C2DA 5CABA 1HHQA 1SJ1A 1QE1A 1JLCA 1SZ2A 3SQ2A 1Y10A 4N41A 1MWZA 3OR2B 4GO5X 1WHYA 3CJKA 3Q0AA 1IKVB 1ILYA 1F2GA 2H65B 3ADAC 4OGCA 2D1KA 4ETXA 5G0RB 1J2VA 3CCWA 2P9CA 1NSAA 1R0BG 1FERA 3EVWA 2H3EB 2IDLA 5AQHA 4L6V3 3CCQS 1VQ5N 4AH9A 4HYKA 4ZVEA 1FRKA 3W9IA 3IWLA 4FLXA 4OZNA 3ZFVA 4MK7A 1SC3B 2QA1A 4CFAA 3PX0A 2P2CB 1PILA 3DWLA 4GNIA 3IGNA 4PQAA 4R25A 3K5MA 1M1KO 1F3FA 3HHLD 1WJ9A 1JWWA 4DUYF 2ALYB 3SK3A 3UVJA 1RZMA 5A8RA 3H2VE 3L3CA 3HHDA 3MMCA 4ZLLA 2IOCA 1WNEA 3HP9A 3VESA 5HQLA 4PYAA 2HRUA 2FLPA 5LY3A 1EX8A 2ROGA 3NG8A 3PIPQ 1M5OC 2R3VA 2ZFHA 2Q3SA 4Y28C 1VQYA 3RAQA 3NGUA 1RWOB 3EGVA 4F0KA 4ZCIA 2B6AB 4HACA 2HBQB 3VQBA 1DEJA 1DGKN 1IG8A 1S57A 1QAYA 2QWNA 4F02A 4DEZA 3J8AA 1XNRK 2UVRA 1FFGB 3P39A 2YTCA 1WSRA 1OVQA 3PSFA 1C1BA 2C2EA 2VWKA 3DRYA 5KFXA 3VVTA 2BA9A 3GFHA 2CPFA 1Y3JA 2ASLA 1UCNA 3WDOA 3MDFA 2Q66A 2FDNA 3D0PA 1GEHA 2FJDB 1L5UA 3NH2A 3SLCA 5HP1B 3IBFB 4CO5A 4ZIVA 2FZGB 3MN7A 4JI4F 2EG1A 2DJWA 4DFMA 4M5NA 4X84A 2X7IA 2KB2A 2ZH5A 2HB5A 2QTWA 4C2MA 4I2PB 4KH5A 4JI7J 3KNGA 2VFRA 2EX3A 2GUPA 1HBNB 4ILLA 2DXDA 1HYSA 3ZTOA 4RKUC 1GOBA 3VGKA 3JYTA 3AA4A 2BKOA 2NSBA 3M6VA 2ZVIA 3PEJA 3NH0A 5J1EB 1Q82T 4KHWA 2UXCK 4DCPB 1BL3A 2HHPA 1M0SA 2YHWA 2LCWA 2OAUA 4CEBA 3KK1A 1JB0C 2XHWA 3NCQA 1NSPA 3WNGA 4CHNA 2CGKA 2EBGA 2C2DA 3Q7CA 2O5DA 3E9OA 5E5NA 3FFIB 4KB1A 3C6AA 5LSLA 3VQTA 4OZ3A 1B7FA 2Q3PA 4RW4A 2H3GX 1M5VC 1JIHA 3G87A 1MU2B 5IQ6A 2JVOA 2ZOGA 5G4DA 5FPNA 2VWJA 2P5VA 5IV3A 2HBMA 1LWXA 1HNZJ 1NOYA 4FP9A 4ZCMA 4PQUB 1V6HA 4QOTA 1CXQA 4AHRA 3VQ6A 2LA4A 4CJVA 3BQ2A 3AVLA 2R8KA 4HVJA 2E20A 1PJ5A 3PFEA 3GYXB 1WBBA 2MPUA 2QA4G 4ZPCA 2YHXA 4CI6A 2J4RA 2YNIB 3PSIA 4GRSA 2CQCA 3FCHA 3C7NB 4B9QA 1F6TA 3WNHA 5KFYA 2E1RA 1RHRB 4DL2A 3TWHA 2BEFA 1FRMA 2FQQB 2HHXA 1JXVA 4FJHA 1XBWA 2LEPA 1JLQB 4B3SJ 1QHAA 5D4OA 3D2FA 5DZ7A 1AB8A 2IVFB 4LSLB 4E19A 4DQRA 4IZ9A 5KFGA 4V19X 1P6TA 5KPRA 5A2QU 2R4FA 5J2NB 1T44A 2V2KA 2O8DB 1SAZA 1V5VA 2DH7A 1NU4A 5GIOA 2C1EB 3VWSA 5CHIA 3R5CA 2OHDA 3ZO7A 4KTZA 4H4MB 4CH7A 4DTMA 4TSXA 5A8KA 1FESA 1EXQA 4DL7A 5M1PA 2ZWOA 3BB5A 3N6NA 5IC6B 1DLOB 3RSEB 1SIWB 2X3GA 3OTDA 3MR5A 1ZPWX 1NMDA 3TU5A 4KB0A 3QEXA 2NS1B 3VA0A 3L4IA 1EHWA 1YRTA 4DR3J 2BQ3A 3H45C 3BPDA 4EZ9A 4PG5A 4PKHA 2XMAA 3I56S 4AQYK 3CXCM 3I5AA 1VSKA 4P6QA 4B9MA 2ETJA 3N9UC 2WSEC 5LM7E 4J8FA 2DGVA 4CJ4A 4QQBA 3LTOA 1UOCA 2YX4A 4HDHA 2FSKA 4B17A 1I1GA 3LANA 3J80U 4FVMA 5HLFB 2IVMA 4KV8A 4PXEA 1XIQA 1U0HA 4A46A 3CDUA 5KFDA 4H4OB 2ZH9A 1ZTTA 4OX7A 2KM8B 5AQYA 3A5NC 1RUSA 3FZKA 3NAHA 1BIUA 3THYB 3P4UB 5F8NA 4A57A 2CWXA 3ZZRA 3H3OB 5ETKA 4BRIA 4ZITA 2LQ9A 1I3AA 3DNCA 4RCHA 2OEKA 1KLNA 4LC9B 2HHVA 4Z94A 1QZ5A 1JJ4A 2IVYA 3CJ8A 1WNSA 2QMUB 4LSNB 1RDBA 3CVKA 4IUFA 1U2VB 2Q43A 4ZPWR 3HHNB 5EY4A 2X74A 2V52B 1WEXA 5KT7A 1O13A 1KVIA 1K0VA 1RCOB 4P2MA 1N5YA 1VQLS 4TN2A 2PC6A 2CPHA 4OLAA 3VQ9A 4M3ZA 3FZ2A 4W5RA 2O3DA 3HVWA 3DLLL 1RBTA 2XYPB 2FVSA 4LFCF 2O8EA 5C0YA 4JV5F 3V1RA 3C3LA 4ZVOB 2UUWA 2NUBA 3O9SA 1NHVA 2HVIA <