3IS9A

Crystal structure of the hiv-1 reverse transcriptase (rt) in complex with the alkenyldiarylmethane (adam) non-nucleoside rt inhibitor dimethyl 3,3'-(6-methoxy-6-oxohex-1-ene-1,1-diyl)bis(5-cyano-6-methoxybenzoate).
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
554
structure length
554
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Crystallographic study of a novel subnanomolar inhibitor provides insight on the binding interactions of alkenyldiarylmethanes with human immunodeficiency virus-1 reverse transcriptase.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Transferase/hydrolase
total genus 134
structure length 554
sequence length 554
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3is9A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3is9A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3is9A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3is9A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3is9A05
4ECZA 3LDSA 3I0SB 3PUFA 3ULDA 5DG8A 2JEJA 4KHNA 3KJVB 4KHSA 3IN5A 3DMJB 3H5YA 1S1XA 4DL3A 2YKNB 4ZPBA 3HJFA 3KLEA 4Z4FA 2XGPA 2HHXA 4HUFA 1RT7B 2E6MA 4FYDA 5KG4A 4Q43A 3L2VA 3LP2B 3NGDA 3PZPA 1TAUA 4KB1A 1BI4A 2Y1IA 3AVNA 4Z4CA 4RNFA 1X9WA 4K4SA 1JLGB 2YNIB 5D3GA 3P5JA 5CYQA 3SYZA 1TGOA 4E7HA 1T03A 4NLPA 3IG1B 1GOBA 2YHBA 1TL1A 3LAMA 2GV9A 4DSKA 4NYZA 1JXEA 5CY4A 1RBRA 1U48A 3PW5A 4NLUA 4K4XA 2YKMA 1ZBHA 2D3ZA 2W9CB 1LAWA 4KB0A 1RTHB 3DRRA 3DM2A 2ZQBA 1U45A 4PA1A 1KRPA 2XWYA 3RB6A 2UVRA 1KHWA 1S6QB 4IRDA 4C8MA 4F2RA 3V4IB 3RRHA 1A5WA 5L9XA 3M9NB 3MEDA 3WNGA 3HP9A 3QO9A 1UAXA 3OHBA 3V9WA 1C1BA 2PZSA 1VRTA 4FJJA 3H5SA 2G8KA 3OLBA 1XHZA 5KFSA 1W25A 3QETA 2RN2A 4RNNA 1TK5A 1C0UA 2P51A 3OYCA 2IOCA 2IJNA 1NJYA 4TY8A 2WOMA 4M95A 3MAQA 4IFVA 3NAIA 3HVAA 4CHOA 4DG1B 2AGPA 2RF2A 3M8PB 3PHEA 3KNAA 2YKNA 3T3FA 1LW0B 1C6VA 4PQUB 4Q45A 2ASDA 1WSEA 3IS9B 3F73A 2HHVA 4HCBA 1Z4UA 1YTAA 4Z4EA 4FJ7A 2BRLA 1YT3A 4RW7A 3QGIA 2QKKA 4LQ9A 5DK5A 1TK8A 5FDLB 1HARA 3V1OA 3TAFA 1ZBFA 4ED6A 2XI2A 3H4DA 1WNSA 4PWDB 1Q8IA 4CFCA 5K14B 5KG1A 1BIUA 2YNIA 4GVMA 2GUIA 5EWFA 4K50A 2AX1A 4EBDA 4CGIA 3A2FA 3DRPA 4CJEA 4RW8B 4Y3CA 5KFTA 4Q8FA 4BDYA 3Q8SB 3MF5A 1NK4A 4FK2A 4TN2A 4KTWA 1YVUA 3CYMA 2D0CA 1DTTB 3QIOA 4ZPCA 4FJNA 2PYJA 2E9ZA 1JLBB 3D5MA 3RB3A 2XY8A 4AHRA 3S3MA 1GX5A 3C95A 3KK3A 3V6HA 3K57A 2I1RA 3OYIA 4FJ8A 1NOYA 4IG3A 4NLYA 4F4XA 1QS4A 2VWJA 2XGQA 5KFGA 5EWEA 2Q3SA 3L2WA 1N4LA 5I3UB 4HTUA 4M3ZA 1RCHA 1WSJA 5C42B 4W5NA 1J9AA 3EPIA 3DOLB 3QLHB 5KFKA 2XHBA 2YNGB 4CGGA 1KVBA 5HLFA 5C25B 4KSEB 4DG1A 1S10A 3M8PA 3AA2A 4FLTA 4RW6B 2NUBA 4FZZA 1N5YB 4ZHRB 1BQMA 3AV9A 4I2PA 3I5BA 3GILA 1S0OA 4EYIB 4BWMA 2IDOA 1QSSA 4DMNA 2W9BB 1SKSA 2VG7B 4OVLA 5KG6A 4CJSA 1ZTWA 4M45A 4HYKA 2XO7A 3LAKA 4RZRA 1HNIB 1NJWA 1D8YA 2X6SA 3SUQA 5SWMA 3KHLA 3LP1A 1HQUA 2B43A 4IRCA 3CWJA 5KFLA 4CK3A 1S6PB 1NK5A 1CLQA 1XWLA 4ECRA 2J6SA 3QNNA 4KAZA 4ECTA 3RWUA 1LAVA 3MR3A 3SCXA 5JUMA 4M3YA 4QWDA 4X2BA 3NHGA 5KFUA 4C8KA 1FK9A 3AA4A 1S9FA 3H5UA 3RAXA 1TKXB 2WONA 4K4ZA 3O3HA 5HBMA 4NLDA 1I6JA 3QZ7A 3I8DA 1RYRA 4ED2A 3KOAA 3MEEB 5J2NB 1B92A 3D28A 1EETB 4DFPA 5KRSA 4CIFA 2P5OA 5L1JA 2G8UA 4M41A 3FQLA 1WSHA 3AO4A 4DFMA 4J9SA 3OYEA 1REVB 3V6JA 2OPPB 2BGGA 4B3OB 1S9GB 5KRTA 3H5XA 1RTJB 3VQ8A 3QLHA 4UQGA 4HUEA 1JX4A 5HRNA 4KHQA 4CJTA 3DYAA 2C2DA 3V81B 1C0MA 4FJLA 2QV6A 2D7SA 3NBPB 5C24B 1UOCA 1JXBA 3OYFA 1ZBLA 5J2QA 4FJXA 3AVBA 5KGXA 3EZ5A 3KLFA 1FKOA 3LP3A 1RDCA 2F8EX 1C0TB 3G10A 5F8IA 4F3OA 2IAJB 5KGWA 1NK6A 4M3XA 1JL1A 5KTQA 1HNIA 4URSA 2A1SA 4G1QB 3MR2A 3K2PA 2XCAA 3VQ7A 2AQ4A 4O3OA 1WSFA 4CGJA 3RB0A 2ASLA 4O3QA 4DQRA 5KG7A 1LWFB 4M3TA 2IS3A 4YNQA 4FJHA 1TKZA 4JV1A 2DTUA 5KFCA 3BQ2A 3DRSA 4GC7A 2VA3A 3SFUA 4IH5A 2YV0X 4R5PA 4RNMA 4NCAA 4QPXA 4YFUA 1RT6B 1TKXA 3KKRA 4Y2CA 2R2TA 1UWBB 1VSEA 2PYLA 4OPKA 3MEEA 4LSLA 3NMAA 3ZSWA 3JSMA 1SKRA 3OYDA 4F8RA 4E7LA 4DFJA 2HNZB 4MK7A 1EETA 3VA0A 2B6AB 4FLXA 4JRQA 3FFIB 4URQU 4IG0B 1RTIA 2ALZA 3M9OB 2DPIA 1TP7A 3AVHA 5HROA 1HPZA 2HW3A 2ZD1A 3ZSXA 3OL7A 1S0MA 3KTQA 3DLGB 5F8GA 3CFPA 3VQSA 4K4TA 3B6OA 2QKBA 4I7FB 1SKWA 4J9MA 2FLPA 4IRKA 3T19A 3GIIA 3RRGA 2PY5A 3E01A 3HT3A 2I5JA 4Q44A 3BGRA 1SUQA 1QE1B 3L3VA 4KFBB 2AWZA 2RKIB 4WE1B 3TAMA 1HNVB 4DQIA 2HWHA 2G8IA 2OPSA 2HHSA 3M8RA 1S1UB 4TXSA 4RUAA 4FJ5A 3TAQA 4NCGB 4KBIA 3QEWA 3TAPA 4CIGA 3G86A 3ZCMA 2G8VA 5HP1B 3OYKA 4R8UB 4FXDA 3VQDA 4RU9A 4WXWA 1IKWA 3FSIA 4FLZA 4LSNA 4Q8EA 1RDDA 3HXMA 4CF9A 2OPRA 1QHTA 3VQQA 2IBKA 3K58A 4CECA 4K4WA 4KTZA 3MXIA 1S1XB 3SQ2A 4H8KA 3KLEB 1U04A 3L8BA 1XC9A 1DTQA 4M3UA 3SI6A 4RNOA 1RT6A 4DFKA 1C1CA 4J9LA 1K1SA 1ASUA 3K5LA 1DLOA 1BI4B 4CEOA 4NLQA 4TY9A 2IA6A 2BQUA 2G8WA 3EY1A 3CIZA 4PUOA 2IM0A 5D3GB 5CYQB 4TSXA 1G15A 1T03B 1TL1B 3OJUA 3TANA 3CJ5A 5EUHA 3D45A 1WSIA 2C28A 3V1RA 3DLGA 2HHUA 3NH1A 4DEZA 3GIKA 1CZBA 2RDIA 4TYBA 2YKMB 3MTKA 2RDJA 1ZBIA 3DRRB 3DM2B 1BIZA 4FS2A 2GIRA 5J2MA 5SZTA 1D0EA 1RBUA 3PJWA 4EP5A 5DG9A 4WE1A 4CGDA 1RT2B 1RYSA 3MEDB 3QO9B 4KE5A 4O4GA 4QWBA 3CDEA 1C1BB 4J9OA 4O0JA 1VRTB 4B9MA 2R8KA 4NLXA 3HP6A 4J9KA 2R8HA 4ZVGA 3NF9A 1Q9XA 5C5JA 2KTQA 4MQ3A 1C0UB 2WCXA 4YP3A 4TY8B 2WOMB 2AGOA 4FVMA 1ZYQA 5L1LA 2R7YA 2WB4A 3CVKA 4ZP9A 4CERA 3OL6A 2RF2B 4BE0A 2E4LA 1I3AA 5DQIA 1NJXA 4F4YA 3CJ3A 4ID5A 2EX3A 1KFSA 5KT4A 4QCLA 4O3RA 4FBUA 4RW7B 3UQSA 3AO5A 4CEAA 3RMDA 3S3NA 4N5SA 4ECYA 1QSYA 4ELUA 1RBTA 3O4QA 2FJXA 4JS5A 4KV8A 4CEEA 3H08A 4FJIA 3DLRA 3VQEA 4O55A 5KFBA 1D5AA 4FK0A 2JLEA 3C6UB 3AVCA 1L3VA 4Z4HA 1S0NA 5HRPA 4IKAA 5DMRA 3DRPB 3U6FA 4F3TA 4K4UA 4KI4A 1U09A 4FW2A 1JLCA 3PVXA 4ECSA 4ZTJA 4OKKA 1RTDA 4MKBA 1IKVB 3IRXA 3OYGA 3AVAA 3SUPA 4AHVA 1SL1A 1Q9YA 3EYZA 3NFAA 4MFBB 4ECXA 1RT2A 3KK3B 3SQ1A 4B9UA 3O3GA 3L2RA 2J6TA 4HUGA 1JLFA 4IG3B 4TQSA 1U49A 4W5RA 1JXLA 4QW9A 4FM0A 4GMJB 2BANA 1VSIA 4FJKA 1YTUA 1W9HA 4KO0A 2JEFA 4HVJA 4K8ZA 3C6TA 4JLHA 3GV7B 1D9FA 4CIEA 2ETJA 4W5QA 1RDAA 1RNHA 1VRUA 4ZTFA 3KIOA 5HLFB 1TAQA 1S9EA 4W5TA 1KVAA 3DDKA 1WAFA 4B9LA 1BQMB 4I2PB 4CFDA 4ECUA 2DFFA 2P5GA 1RT5A 1A5XA 1RAJA 4AHUA 4RUCA 3KHRA 1S1TA 4WFYA 5DLGA 2W7OA 4B8CA 3IAYA 3KLIA 1NNDA 4KHUA 4WXOA 3LP1B 1HQUB 3THVA 3PX0A 3C6UA 2OPQA 3PV8A 4IOBA 2O4IA 1VSDA 4DU4A 3MFIA 4NCBA 4E19A 1HYZA 4FLYA 3BQ0A 1LV5A 1T05B 2IM3A 1IKYA 1RT1A 2WK4A 1X9MA 2IMWP 1IKVA 4I9LA 2V4RA 2B5JA 4DLGA 1L3UA 1KSPA 3SQ4A 3JYTB 4WFZA 1FK9B 3VA3A 3AA5X 4MFBA 2WONB 4OLBA 5HBMB 4N76A 3IGVA 3UIQA 1K1QA 1S1VA 4DTMA 3LPTA 1IKXA 4DWIA 1NJZA 2QK9A 2E9RX 3PX4A 2AU0A 4KRFA 4XPCA 1J54A 4NLVA 4FM1A 5KFRA 5T14A 3HPHA 4OL8A 3OVNA 1UA1A 3OS0A 1SL0A 3P1GA 4KPYA 3ZT2A 2OZSA 2FLNA 4AHTA 1KTQA 3OYMA 3P83D 4N41A 2WHOA 2HHWA 3HK2A 3H2LA 1BCMA 4NLWA 3PW4A 3DYAB 4DTNA 1GOCA 3N6MA 3OL9A 3TABA 1VSHA 5J2QB 2KZMA 3AVGA 2ZKUA 2YNHB 3KLFB 1FKOB 1SV5A 4MK8A 5F8MA 4E7IA 2HNDA 1JLAB 2FVPA 4LQ3A 5KG2A 3NH2A 2BQ3A 1NHUA 3NF7A 3RBEA 4IH6A 4ED3A 2D0BA 2ZE2B 5J2PA 2R2SA 4B08A 3NF8A 2Z1GA 1TL3A 3KK1A 5FROA 3TAGA 3K59A 2YNFA 1JL2A 4B9VA 1SL2A 4FZYA 1T05A 4DL6A 2FVSA 2OA8A 3H59A 2EHGA 4MIAA 3S3OA 4IDKA 4NLSA 1TKZB 3F9KA 3AO1A 4M94A 1IH7A 4CGFA 3KLHA 1LWEA 4ZP7A 3NAHA 4QOZB 3DRSB 2W9AA 3G6XA 3JYTA 4R5PB 4F4ZA 3M8QA 2E6LA 3SFGA 3CFOA 4XPEA 3OYLA 4GW6A 1HMVA 4KKOA 4DF4A 4KHYA 4LSLB 3JSMB 4KHRA 5KFDA 5F8JA 3HVRA 4J9RA 4CF8A 4OKEA 1RTIB 1XHXA 1QQCA 4QWCA 4LY7A 4CHQA 3CQ8A 1Y97A 4MK9A 1JIHA 5HROB 1HPZB 2ZD1B 2IM1A 1QTMA 2OZMA 1XI1A 2FVRA 2C2EA 4E1MA 4CESA 3I0RA 1N6QA 2D5RA 4KI6A 2IGIA 4ICLA 5DQGA 3LPUA 3NE6A 3E01B 4ECWA 5JXSA 2YHAA 4CJWA 2I5JB 3BGRB 1I39A 3SPYA 1SUQB 3GV8B 5KFMA 4OLAA 3SQ0A 3TAMB 2YNHA 4NLGA 4QAGA 2OPSB 1JLAA 1HYSA 3VQ5A 4E0DA 5HRSA 2HMIA 2GIQA 1WNEA 1NK8A 3Q8QB 4O3SA 2ZE2A 3VQBA 4EO8A 4BE1A 4CEDA 1CZ9A 4FJGA 3BQ1A 3RAQA 1TV6A 3N6NA 4KHMA 4E7JA 1RDRA 1YVFA 1D9DA 1IKWB 4EBEA 4M3WA 3QESA 1JLQA 4QWAA 1KLMA 3KD5E 4LSNB 1Z26A 4E3SA 4CGHA 2OPRB 3GQCA 1TKTA 3QINA 3OS2A 3HHKA 4EZ9A 4OKJA 4DTJA 4CK2A 5KG3A 5KFZA 3QNOA 1BQNA 1DTQB 3ASMA 3V1QA 1C1CB 4JV0A 1ZBUA 1DLOB 5F9NA 5L1IA 1A5VA 3NGZA 1TQLA 4ID1A 4CFAA 3LALA 3U3GA 2F96A 1S1WA 4PUOB 1KVCA 4EP4A 3MR5A 3ZSYA 3DOKA 3PW7A 5KFIA 3M9MB 2DFEA 3QGHA 4F4KA 2Z1IA 4NLRA 4Z4GA 4DL5A 1T94A 2R8IA 3QERA 3DLKA 3QZ8A 4CFBA 2KZZA 1NKCA 2HNYA 4YR0A 4M42A 2VWKA 4E89A 5J2MB 1KCFA 1RBSA 1LWCA 3AO3A 3AVFA 1L3TA 2JC1A 1NHVA 1KHVA 1NK9A 3LANA 4O4GB 4MIBA 3O3FA 3OHAA 4EBCA 4OJRA 3ZT4A 2R2UA 2BRKA 1BGXT 3FQKA 3KK2A 4CJKA 2BR0A 1S4FA 2W8KA 2Z1JA 4E7KA 3Q8PB 4CJQA 4DU3A 4Z0UA 3DLBA 1RILA 1WN7A 4O5BA 4IH7A 4ZVFA 2X6NA 3KD1E 2UVUA 3QIPA 3N6LA 4B9SA 4TQRA 2Y1JA 3DLHA 4QW8A 4ID5B 2FBTA 2JGUA 3AVMA 3DLEA 4CE9A 3TARA 5HRRA 5KT7A 3PR4A 5J1EB 4DQSA 1FXXA 4N47A 1CSJA 3BSCA 3SV3A 4KV8B 2KQ2A 1VSMA 3AO2A 3CJ2A 4FCYA 2XI3A 4WZQA 1NK7A 5CZ1A 4BWJA 5FRMA 1RA6A 4O0IA 4H4MB 4CF0A 1Z25A 1HQEA 2FJVA 4FK4A 4CJPA 4DL4A 5CYMA 5KFJA 3WNFA 3TAEA 2X78A 1U4BA 3TI0A 5KT3A 2HHQA 1JLCB 5I42A 1EX4A 1ZTTA 5EWGA 1GOAA 1RTDB 3FDSA 1VK0A 2BE2B 2G8HA 3IRXB 4Y1DA 2VG5A 2JEIA 1IG9A 3ALYA 4Y34A 4NLOA 1J53A 4K4YA 3K5NA 3PO5A 5KFXA 4KHWA 4LH4A 4TLRA 3AVLA 2VG6B 4FJMA 1JLFB 1BHLA 4E1NA 2ILYA 2W7PA 2BANB 3MECA 4KAIA 2QE5A 4KO0B 3GV5B 1FKPA 4JRPA 3C6TB 4Z4IA 2UUWA 1QUVA 3V9SA 2FVQA 3I5AA 2ATLA 2E9TA 1XR7A 1VSFA 4I2QA 1B9DA 3MEGA 4FS1A 2HAIA 1VRUB 3L3UA 4DLEA 1S9EB 3L2UA 4WFXA 3G0ZA 3V6DA 3RMCA 3MR6A 4ED1A 4IFYA 1TVRA 3OSNA 3ITHA 4YR3A 5J1EA 1MU2A 4CJ3A 4OGEA 1BISA 2EC0A 3QGGA 1RT5B 4Q0BA 4J2DA 3NDKA 2AJQA 1RDBA 1S1TB 4K8XA 3K5OA 3KLIB 4H4OA 5FRNA 3V9ZA 3NGIA 3T5JA 3KMQA 5F8HA 4AILC 1S49A 4XO0A 4H4MA 1R0AA 2OPQB 4I9QA 4EEYA 1GX6A 3ISNC 1TKDA 3T1AA 1F21A 1C2PA 3OYBA 2Z1HA 2QXFA 4ZVHA 5DG7A 2JEGA 2GBZA 1IKYB 1RT1B 2CJQA 3UR0A 2ATQA 1RBVA 3HVTB 4LH5A 4RG8A 2BE2A 3PW0A 2B5JB 1IM4A 5KFHA 4IQXA 3CFRA 3V9UA 4CJ5A 2HB5A 1T7PA 3ZT1A 4B8AB 4CJRA 1S1VB 4WZMA 1IKXB 2VG6A 2XY5A 3AVJA 4RW9A 2DY4A 3LWLA 2IC3B 1KLNA 1BCOA 3CDWA 1J5OA 1RT4A 4IBNA 5CZ2A 4EZ6A 3BSNA 4DL7A 3KMSA 1NKEA 3OYHA 1CXUA 4J9NA 5KFYA 2W8LA 1WLJA 3AA3A 4ED8A 1N56A 3OY9A 2G8FA 4YQWA 3GYNA 4ECVA 1NKBA 4J2AA 3QEIA 2F8TA 2LSNA 1LW2A 3EZUA 3WNEA 3DI6A 4YR2A 5E41A 1S97A 2W42A 4W5OA 2AX0A 4RW4A 3T5LA 1JKHA 4C8LA 3Q8RB 1EP4A 1SV5B 2HNDB 2JC0A 1ITGA 4H54A 4ZPDA 3I0SA 2XY7A 3KJVA 3DMJA 4QWEA 3K5MA 1X1PA 5J2PB 2C2RA 3V9XA 1QSLA 4FW1A 1RT7A 1TL3B 3KK1B 5KG0A 3LP2A 2YNFB 2GC8A 3VQ9A 4BE2A 3AVIA 3BREA 1D1UA 3VQPA 3M8SA 3CM6A 4FZXC 2DFHA 3KLVA 4AHCA 3VQCA 3ICLA 4IDKB 1JLGA 3HVTA 4DF8A 4NLTA 4O44B 3KLHB 1LWEB 3IGNA 3IG1A 3ZSOA 3PX6A 3U3YA 1QAJA 4CCHA 4DTOA 3G6YA 3M8QB 4MKAA 4CEFA 2HWIA 2VA2A 3C94A 4DQQA 1HMVB 3SUNA 2W9CA 4KKOB 1L5UA 1RTHA 1XR6A 3OL8A 4CJVA 1U47A 4KREA 3H4BA 3SV4A 2IC3A 4L8RB 2V9WA 3QEXA 1EXQA 2HVHA 1S6QA 2KFZA 3V4IA 4CEBA 3UPFA 1VSJA 4AH9A 2O5DA 4CHNA 4JV2A 1X9SA 3I0RB 1N6QB 4ICLB 4URGA 3G6VA 5KFOA 1S48A 3TR8A 1HJRA 3RBDA 4M3RA 2FBVA 4DS4A 4FLUA 4Y1CA 3VN5A 2FVCA 3GIJA 3PW2A 4CK1A 3PY8A 1HYSB 3BSAA 3FRZA 3H98A 2HMIB 2ASJA 5JS2A 4ZPAA 4DTUA 2IJFA 3CM5A 4CEZA 5KFPA 3HPOA 1LW0A 4DL2A 3RTVA 4PQUA 1TV6B 4BDPA 3IS9A 2P1JA 3CO9A 3NL0A 1RA7A 4DS5A 3BR9A 4CJFA 1NK0A 5FDLA 1JLQB 1T3NA 1KLMB 2UVWA 4NZ0A 4PWDA 4Q5VA 3LZJA 3SUOA 3BDPA 5K14A 3TWHA 1TKTB 4O44A 3LZIA 4O3NA 5F8LA 1BQNB 4NYFA 4RW8A 4PY5A 4GC6A 3RB4A 3ZSVA 4J9PA 4U6PA 1DTTA 2V0NA 3ZSQA 4WYLA 1S1WB 1JLBA 3MXMA 4J9QA 1N48A 3DOKB 4DTSA 2OYQA 5DLFA 2A1RA 3E51A 2V4QA 1HRHA 2RPIA 4FJ9A 4IR9A 4DTXA 1JLEB 3DLKB 3SNNA 2HNYB 3SI8A 3PR5B 4FLVA 5I3UA 1SH2A 1ASWA 1LWCB 5DQHA 3EPGA 4DU1A 3OSPA 1L3SA 3HPGA 5C42A 3KLGB 3DOLA 2YNGA 2BQRA 4EYHB 5KT5A 5C25A 5KFFA 5KFQA 2DPJA 4IKFA 1BL3A 2XY6A 4RW6A 5L1KA 4J2EA 5F8NA 1N5YA 4HCCA 4ELVA 4ZHRA 4DSLA 3KK2B 3I5CA 3RMAA 5KT2A 1S5JA 1QAIA 4J2BA 3BSOA 4NRUA 2W9BA 3OYJA 4B9NA 4G3IA 4CF2A 4IR1A 3HVWA 1EKEA 2VG7A 2HVIA 4TYAA 1RT3B 4F2SA 4CJ4A 5EDWA 4C8OA 4DSJA 2B4JA 4O3PA 3KHGA 3QIPB 3RR7A 4DQPA 3HSTB 1TK0A 1S6PA 3DLEB 4OGCA 1NOZA 5T7BA 2F8SA 4F4WA 1HYVA 3TVKA 3VQ6A 2C22A 3SPZA 3PO4A 3LP0B 3H40A 3ZT0A 1B9FA 4BACA 3TQ1A 2XCPA 2X74A 4MH8A 4O4RA 4ZP8A 3CJ4A 4JS4A 4KB7A 2XC9A 3QEVA 4EO6A 3HO1A 2IM2A 4WYWA 3D0PA 2J6UA 1K6YA 1HQEB 2FBXA 5CYMB 2ITGA 1ASVA 1O1WA 5J2NA 4YMEA 3VQAA 5I42B 1WAJA 1JLEA 3OS1A 5F9LA 3WNHA 5DGBA 2D0AA 2VG5B 4CHPA 1REVA 4CHYA 4DTRA 1C1AA 2OPPA 3KHHA 3ZSZA 4AHSA 4B3OA 3CG7A 1S9GA 1RTJA 3KLGA 3T5KA 4ED7A 3RR8A 2WTFA 2R8JA 4CEQA 5EU7A 3MECB 3V81A 4NYNA 3NBPA 3QYYA 5C24A 4K4VA 4N56A 3NGYA 2R2RA 1FKPB 1CXQA 5KFVA 5KT6A 2KW4A 3KKSA 4ELTA 3OLAA 1C0TA 3PJXA 2O4GA 3MFHA 2FLLA 3QIDA 3OYAA 2AGQA 2IAJA 1RT3A 3OYNA 4I2QB 3MEGB 3NAEA 4ECQA 4G1QA 4B9TA 3VQ4A 3B6PA 3V6DB 1SH3A 2UUTA 3NF6A 1XR5A 4IFYB 3QEPA 1TVRB 3ISND 3ITHB 5KFEA 1MU2B 4DSIA 3SJJA 3LP0A 3HL8A 3NH0A 1LWFA 4Q0BB 1VSLA 5KI6A 2R8GA 3ZSRA 3RMBA 3MXJA 4R0EA 1T8EA 4H4OB 3ZT3A 4DSEA 5KFNA 5KFWA 3T5HA 3S9HA 3HYFA 1R0AB 4RNHA 3OJSA 4LD0A 1UWBA 2FJWA 3CDUA 1VSKA 2D41A 4XIUA 4KTQA 2HNZA 5DGAA 2B6AA 3FFIA 2CKWA 4BDZA 4IG0A 3V6KA 3SZ2A 4JUZA 4ED0A 2KFNA 3L2QA 5JS1A 4C8NA 4FM2A 4CJLA 2XRIA 3HM9A 4HHTA 3GIMA 2HHTA 1KFDA 2D3UA 4CJUA 4I7FA 1UA0A 2FBYA 4ZMMA 4CF1A 4RW9B 3NCIA 3BJYA 2UVVA 2ILZA 3HKWA 1J5OB 1WSGA 1RT4B 4CHZA 1QE1A 3UDLA 2WRMA 4KFBA 2BDPA 2RKIA 4Y2AA 1IO2A 1HNVA 4U7CA 1W0HA 1ZETA 1S1UA 3AVKA 5KFAA 4F50A 4NCGA 3CJ0A 4HKQA 2FC0A 3O4NA 4DSFA 1LW2B 3DI6B 2OH2A 5HP1A 1SH0A 4R8UA 4DTPA 3NKYA 3LWMA 5KG5A 4ZVEA 4RW4B 1JKHB 1OS5A 1EP4B 4OPJA 1MMLA 4ZP6A 4FLWA 4NRTA 4IFVB 4FBTA
chains in the Genus database with same CATH superfamily
3D3CJ 4CNZA 5THWA 4KHSA 2MPUA 2MZQA 4AUKA 2UXBF 2JL9A 2YWHA 2DR8A 4Z4FA 1DURA 2XGPA 1RT7B 3C46A 5HL7Q 4NB4A 4KJIA 2HFOA 2LFVA 3NOCA 1FESA 5AQFA 3PIPL 3GCXP 4X65F 2AZ1A 1FDBA 3LM2A 1Q79A 4NXNF 1ZOTA 5CYQA 1TGOA 1T03A 4PG8A 4YUDA 3AJDA 1TL1A 2F9DA 4NWBA 1JXEA 3IR5B 4IDHA 5A2QO 1OVQA 4NLUA 1VQ4N 1QHAA 5A8RA 1ZBHA 1Y64A 1HIYA 3FZFA 2ASYA 1LAWA 5M1OA 2DGQA 4KB0A 1IG8A 1H1VA 1VDHA 4PA1A 3I56S 1AA1B 2JH3A 3A8YA 1K8AO 4ISFA 4CO4A 5I3PA 4C8MA 1V9OA 1V3RA 5HOOA 2CVIA 1YI2S 4OZ1A 3QO9A 3ONQA 2Q3PA 1UAXA 3VERA 4K41A 4DV5J 1GFWB 4HACB 3VTHA 1K0TA 2H4YB 4HR2A 2G8KA 3LF0A 2GX8A 1W25A 7FD1A 5H9EJ 5IS2A 1H72C 3ZNUA 1NGFA 1DFDA 3MM8A 1N34K 1NGJA 3HVAA 1B4SA 4DN9A 5AQHA 2AGPA 3NOGA 2F4VJ 4CYUA 4M5MA 4J9UE 3UDVA 2UUAK 4PQUB 2ASDA 2BW2A 1YTAA 4Z4EA 1TK8A 1WKLA 1BWEA 3KJNB 4NMXA 3IXQA 1WNSA 2J7UA 4PWDB 4CFCA 3BGUA 2CXEA 1VBXA 1BIUA 3W63A 2YNIA 4F04B 5L9NA 5JJBA 4JEPA 4CGIA 4ZKAA 1V3ZA 2X1FA 4CDIA 2N82B 1RWNB 2ZWOA 3C15A 3I55S 3Q8SB 3MF5A 4KTWA 2XNRA 1HBMA 4TNOA 2JZ5A 4ZPCA 4QIFA 1JLBB 4M7XA 4JI7K 3RB3A 2XY8A 3ZEUB 2E5LF 1NMDA 2L08A 5C15A 1N32K 1GX5A 4LBIA 3IWXA 3V6HA 4P71A 3OYIA 2EC2A 1WD6A 2BJ7A 2I2YA 3G6ES 1WBBA 4JK8A 1KQSR 2CDRB 5EWEA 3P5BP 1N4LA 5I3UB 2VQEJ 2FYXA 1RCHA 4P74A 3A3PB 4DV0K 4WFBL 1VIOA 4A46A 5T7LA 4DUYJ 4KSEB 2VICA 3DU5A 3P49B 4FLTA 1ITPA 4RW6B 2GVDB 2A6AA 1FHTA 4DV7J 4G6VB 4ZHRB 5AE2A 3AV9A 4I2PA 4DR1J 3J81U 3GILA 2IDOA 4DMNA 2W9BB 2CH6A 3TZXA 3DRYA 5KG6A 1AW0A 2XMJA 4BRQA 4DR6K 2KVIA 3WDOA 4RZRA 2X6SA 2CZ4A 3PXGa 1Q86O 1VOMA 3LP1A 5LXYA 3VZIA 3CWJA 3CF5Q 2F9WA 4ES2A 1H73A 2HFSA 4LFBK 4LF7J 4NL5A 4P2FA 1CLQA 1XWLA 2ZVIA 3QNNA 1LAVA 3HZEA 5EY4A 4M3YA 4QWDA 2J76E 3NHGA 2LEAA 4TVAB 4HI2A 3W8GA 1BOTO 1FK9A 3DXBA 1HNWF 3MM5A 4RKUC 3RAXA 1TKXB 2C2MB 1XMOF 1SJ1A 3N9UC 1B0TA 3HHNB 1RYRA 4ED2A 1WC3A 1EQMA 2F1FA 3D28A 4CNYA 3NWRA 2XULA 3PDNA 2G8UA 4M41A 2IA0A 4UUWA 3VAHA 2DR7A 2B0GA 4J9SA 1O8BA 4OX9J 1O13A 4B3OB 2HQFA 1RAEB 3VQ8A 3QLHA 4UQGA 2QMXA 3MCSA 4X4OA 2RQKA 4HUEA 4KHQA 2UP1A 2ABYA 3V81B 4FJLA 2A2CA 4B3TK 2RU9A 3CCSS 2HHHF 3K89A 3SBTA 3BGFA 5KGXA 1UPPA 3EZ5A 3KLFA 1FKOA 5KPTA 2CPHA 3G10A 1A9NB 4BC2A 1KR4A 4ZVOB 3VPZA 4NXNJ 5AXMA 1MROA 3LTOA 1JL1A 1HNIA 4ZK7M 3FK4A 2A1SA 1GLFO 3MR2A 3VGSA 4IO8A 3DHWC 3G8SA 2CPIA 2AQ4A 4DPOA 3IKMA 3IWNC 1CJVB 2FY8A 1SB6A 5D15A 3RB0A 2DGOA 1HBOB 3CCJS 4O3QA 1J5EJ 1LWFB 4M3TA 4A8YA 3V4MA 4YY3J 2DT9A 1WJ9A 2DTUA 2R7TA 4YHHK 2KH9A 3DRSA 2CQ0A 5GMDA 4IH5A 3P38A 4PXBA 4JK9A 4OYAA 1NB7A 3KKRA 2CADA 2EFGA 8AT1B 3C8YA 2XZWA 4F8RA 3RJMB 3VA0A 1IR0A 1HBUB 2ZH8A 2E1ZA 4JRQA 2MKSA 2DCUB 2ASOA 2ROGA 3B4DA 4EUVA 2O8DA 3IBFB 2ZD1A 1U0HA 2KDOA 3HZGA 5JICA 1S0MA 3NCPA 3BH6B 3B6OA 4KH6A 2L9DA 4I7FB 2U2FA 4IRKA 4CZCA 3T19A 1VIXA 3QFPA 2PY5A 4BRNA 4USHA 2I5JA 3BGRA 3HULA 2O8EA 3DWLA 1KVIA 3L3VA 4WE1B 3TAMA 1HNVB 5HQ8A 3W9JA 2XMMA 2I8EA 3M8RA 3MUTP 1F60B 4FJ5A 1M1HA 3TAQA 3N5BA 2VH7A 4DX6A 3QEWA 3MAHA 3UKUA 1SS6A 2BX6A 3CC7S 2AV5A 4R8UB 1X4EA 2ZH6A 4FXDA 2KN4A 4RU9A 2R7XA 3CCEN 1YJ9N 1NCLA 4MO5A 2FJBB 1QHTA 2R3VA 5CD4H 3FGUA 5E84A 3K58A 4K4WA 4KTZA 3SQ2A 1JNZB 3CO0P 1NZAA 2FJDB 1U04A 3E9PA 3LDQA 2MZ1A 1SQFA 1YZ6A 4DFKA 2CH5A 4WIIA 3CMAN 2GWJA 1FA0A 5BN9A 3ILOA 1ASUA 3RUBL 4P75A 4OPAA 2FD2A 1BI4B 1NGGA 4TY9A 1SI9A 1Y3JA 2BQUA 2VQFF 4A8XA 3TR5A 1FX2A 5D3GB 1YBTA 1G15A 3VEXA 2B9EA 2YQ3A 3HSJA 2VIHA 5AQJA 3D45A 2P5VA 3V1RA 3DLGA 2HHUA 3MN9A 1VK8A 4BLGA 3NH1A 1CQMA 4I67A 2W4DA 2YKMB 1W97L 3MOZA 3DM2B 1YRXA 4YDDB 3NCQA 1ATRA 2R7SA 2UUCK 1IWGA 4DR7J 1FX4A 3Q86A 3TSPA 2D9OA 3MEDB 2LQ8A 4ZN1A 4QWBA 5AQLA 3G87A 5B8HA 2R8KA 4PWUA 4CH0S 3GIRA 1NPPA 4ZVGA 1VR6A 4QPTA 2MLYA 2UXDF 2WC9A 2MJNA 1FD8A 4MQ3A 3MM7B 1C0UB 3CIPA 1GK8A 4CLYA 3HBTA 3FBFA 5E3PA 2VFVA 4PKDB 3GSDA 3Q7BA 2V50A 4ERDA 1SC3B 4WK3A 1MSWD 3KUHA 4BE0A 2P9NB 1RAHB 1IV0A 2RE1A 1XMOJ 5KT4A 4QCLA 1X4DA 5CYJA 3LH2S 2MQMA 2VPZB 4L74A 1RQ0A 4YDUC 4BVOA 4F0MA 5D78A 1DARA 3O4QA 3ELHA 4OV6A 3VQEA 1X4HA 4O55A 4OYIA 4JYAK 1CULB 3C3LA 4FK0A 1HNXF 3C6UB 1U1RA 1L3VA 3ZTSA 1S0NA 2I9SA 5DMRA 3KHYA 2ZUGA 3M4XA 3U6FA 2JJ4D 3W60A 1P90A 2H5JB 4AQYK 1XNQJ 3PEJA 1QVGR 2CPZA 1NBWA 3VV2B 3PVXA 4ECSA 2EK1A 1RHRB 4ZTJA 2YX7A 2HBKA 1IKVB 3QB0A 3OYGA 4BREA 4KPCA 1W7WA 3AVAA 2WBRA 1XK8A 1YX2A 5DETA 2G2YA 3CD6S 3NFAA 4MFBB 4ECXA 1RT2A 1RWUA 1CVJA 4B9UA 4IG3B 2W41A 4W5RA 1JXLA 4TLQA 3CCLS 1S12A 2HBLA 1YITN 4FJKA 4PCQA 3SCKE 2O01C 4RPFA 4FO0A 3W3SA 4Y2KA 3GV7B 4CIEA 1VQ6N 4ZA1A 3E8OA 2ETJA 1U2CA 4W5QA 2DRAA 1ATSA 1FFSB 3TW0A 4W5TA 1KVAA 1WAFA 3OR2B 4B9LA 2JHEA 4ECUA 1X4CA 1OYDA 4C8YA 2RRNA 1KDNA 3LGHA 4AHUA 2MTLA 2VF3A 5KOWA 1S1TA 3U9DA 3DDIA 4OHXA 4KHUA 4OYXA 2R7VA 2YKPA 3BEGB 4BRHA 2O4IA 3CCQN 1DQ9A 4E19A 2Y8YA 1NHKL 3GB0A 2R7WA 4I9LA 3QT5A 1L3UA 3PLAA 4GVLA 4LF5F 3I33A 3JYTB 2ZHBA 3QFUA 3AA5X 4OLBA 5HBMB 5ETMA 4JI3K 4N76A 2V8GA 1K1QA 1S1VA 4DTMA 5IC6B 1U02A 3LPTA 1IKXA 4DWIA 2J0WA 2JOQA 1M1GA 4H0PA 4WFAL 4JHDA 2HWTA 4XPCA 4QR0A 4FM1A 4WTYA 3OS0A 3PYEA 3B54A 3PEHA 3UW1A 4UT4A 1OY9A 1MN9A 1ELOA 3ZT2A 2OZSA 4K0KJ 3OYMA 4CZFA 2VPWB 5EOYA 4N41A 2MYFA 3ZLJA 1X5SA 3W1YC 1FXLA 4NLWA 3PW4A 3DYAB 2OTJS 4CI0B 3OTOF 2EXUA 4P2MA 1BE4A 3P6YC 2C3OA 5C2DA 4FWQA 3AVGA 2ZKUA 1TMJA 4Y00A 4OV1A 4E7IA 1KQSM 2HNDA 2FVPA 2KJVA 5KG2A 2QLFB 1HBNB 1HHSA 3FZHA 1NHUA 5AQIA 2NSBA 4WP8A 2VQFJ 4JI5J 2D0BA 3FCVA 5J2PA 2C2OB 2R2SA 2P8IA 3LDPA 3NF8A 4EGLA 1TL3A 5FROA 5AR0A 3K59A 1JL2A 2A18A 1OPZA 2HIQA 3BY5A 3GFYA 1T05A 3W2VB 4TU9A 3GSIA 4X4PA 4NXMJ 1UJ5A 1S72N 1JJ2R 1KTVA 3AO1A 5BYSA 1EIYB 2IVMA 2W9AA 4M5JA 4BC7A 2MZSA 2XQCA 4R5PB 4F4ZA 3M8QA 2O8FA 3A5NC 1DT9A 4DF4A 4BC3A 4LSLB 5E3RA 2WTUA 1IBMK 2RQCA 2UXDJ 2BVZA 4CF8A 4OKEA 1XHXA 3UD3P 1OH8A 3CQ8A 4LUBA 1HPZB 3L7UA 1TR0A 2FVRA 1FFGB 4E1MA 1TFWA 1N36K 2DNMA 2D5RA 4H5TA 4KI6A 2IGIA 2M9KA 2UV8A 4YB5A 2MY7A 3NE6A 3E01B 3VAIA 4DV6K 1I39A 3CJ8A 2G13A 2Y9HA 3SPYA 1SUQB 1NLKL 3ENVA 5EVZA 1VAZA 3VF6A 4NLGA 3PRDA 4QAGA 2OPSB 3THPA 2J4RA 3H6EA 3J81Y 4O3SA 3OUYB 4EO8A 1WBDA 1HNXJ 3RAQA 1TV6A 2JWLA 2CQIA 1OIAA 4KHMA 2QEXN 1B7YB 3KJFB 2FIUA 4QIGA 1B99A 3QESA 4ZPTR 2V52B 1KLMA 3NS5A 2XSJA 3CDBA 3M1FA 3HSCA 4WQ4C 3QINA 5LL6Z 4LRFA 5KG3A 1BQNA 1DTQB 4QS8A 4ITSA 4ZLJA 4IO9Q 3WQUA 1PJ6A 2V8DA 1ZBUA 3SDEB 2V2ZA 3UDEA 5F9NA 2NRTA 4KGXB 3HHLD 4ZN3A 4CFAA 3LALA 2E1MC 4AM6A 1S1WA 5CZXA 4PUOB 1KOOA 3FR0A 3LPYA 5HQLA 3PW7A 3NMRA 3M9MB 3QGHA 4NLRA 3SJHA 2FF6A 1T94A 5BXIA 2CJKA 4FYWB 3DLKA 4CFBA 4ILGB 4LFCK 4N8OA 1NKCA 1U8WA 2HNYA 4BR2A 2F4VK 1LWCA 3AO3A 3AVFA 4UUXA 2JC1A 1NHVA 1KHVA 4M5DA 4F9OA 3RRKA 1SC4B 2X1GA 1IBCB 2BRKA 2MQOA 3KK2A 1E6YA 1S4FA 2W8KA 5JVGQ 2Z1JA 3R6GB 2AYMA 4DU8A 4DU3A 4Z0UA 1RILA 4O5BA 1U1OA 3UO0A 3DLHA 4QW8A 3AVMA 3CC4N 4CE9A 2Y0SD 4OI4A 5KT7A 1FXXA 2NXCA 2C2ZB 3CJQA 2BUNA 1XNRJ 2HRTA 4RUHA 4YOVA 2E7VA 4X4QA 2P9KB 2XS7A 1T3VA 2GUPA 4YORA 1IJEB 4FCYA 4DV4F 2CGJA 4BWJA 4OI0A 1P1LA 1RA6A 4DMZA 5EHHA 3R5CA 3E66A 1GMUA 5ADZA 4CJPA 5CYMA 3VAFA 2VL1A 3MEKA 1SXLA 2H9ZA 4CM0A 2ZKTA 3TI0A 1X3NA 4A59A 3MX2A 5I42A 3OHRA 4WFNL 2E1PA 2BE2B 5E26A 3CD5A 4G1PA 3GR0A 4USMA 1QAYA 1VS3A 2QMUB 1J53A 4K4YA 1HW8A 3CW2C 2MKCA 4I6YA 4TLRA 3MAAA 2LU2A 2P9LB 2E7WA 2VFUA 1VQLN 4E1NA 2BANB 5M1QA 3RSEB 3BGOP 1WI6A 2LLZA 2QE5A 4KO0B 3VGVA 3GV5B 2PO4A 4JRPA 3C6TB 4Z4IA 1HFEL 1DEJA 1EAYC 4B3MJ 2FVQA 4MT1A 3CCMS 3OD2A 2CQGA 3M05A 2CQ1A 4I2QA 3QBWA 1S6UA 2W4PA 1X4BA 1UEUA 4A62A 4ED1A 4IFYA 2OHDA 1K8AT 2VWBA 3TU5A 1TUGB 4HDGA 1Q82O 5J1EA 1WSRA 1QM9A 1BISA 1DBDA 3QGGA 4P73A 4J2DA 4K8XA 3HSZA 1BA0A 2QA4S 2Z8QA 3G82B 1RJJA 1R0AA 4H4MA 3P5TL 2OPQB 3AAWB 1TKDA 2DJWA 4ZVHA 2PDAA 5DG7A 2JEGA 3LPEA 1F3FA 3D6FB 3MOJB 1KS2A 1M0SA 4RG8A 2B5JB 2UXBK 1EHWA 2CNKB 4KBOA 1Y3KA 2GQQA 4IQXA 1RWKB 2EEYA 2HB5A 3ZT1A 3QFWA 4A47A 1NEEA 4OYWA 4X65K 1E6VB 5BRHA 2IC3B 4B1ZA 1KLNA 1BCOA 1VQMS 2YJEA 1SKUB 1X4AA 1QVGM 4DL7A 1NKEA 4DR2F 1R3NA 2ZBCA 4JB8B 1CXUA 4J9NA 2W8LA 1VQ7S 4CLWA 4X4RA 1N5QA 3GYNA 4ECVA 1NKBA 3LDNA 5KPRA 3PYGA 1LW2A 3CNQP 2GO8A 4IEIA 1CJUB 1BWFO 1JKHA 4C8LA 2V2VA 3Q8RB 3EN9A 3PIOQ 4CLFA 1SV5B 2DNPA 4ANEA 2Q2RA 3DXMA 2FUG9 3M32A 4ZPDA 4YN3B 2XY7A 1YXQA 4GO7X 2OELA 2QG9B 3HD2A 1FF2A 2HZCA 2C2RA 5C2CA 1QSLA 5ETLA 1RT7A 3FZBA 5E7OB 2KHCA 1DY3A 4A8QA 4U67L 1CS4B 4JV5J 3VQ9A 5LMUJ 2MKKA 1DJ0A 3BREA 3M8SA 4FZXC 3LA0A 2E2QA 2B8PA 3ZX2A 2MQQA 4IDKB 3HVTA 4DF8A 3D67A 2HVEA 2BKOA 4CLUA 5CABA 1LWEB 2XTJP 5IT0A 1QAJA 4QS9A 2HWIA 1HMVB 3SUNA 8RUCA 1U6ZA 1L5UA 3NNHA 4P2XA 4CJVA 2E29A 4QYRA 3H4BA 1RWPB 2E88A 3EXCX 5F0UA 2OSRA 3J80U 2HVHA 3U4LA 3C2PA 3BV8A 2DNZA 2DR6A 3AXKA 1Q86T 2B56A 3J7AP 4L72B 3MMVA 4JK7A 3TEGA 3OXFA 4ICLB 2HQ3A 3BP8A 4HACA 3NNAA 3R7BB 3TR8A 1HJRA 1U6FA 3RBDA 4M3RA 4BRFA 4PXDA 3Q2SC 1Q18A 4EAHD 4RWTA 2E5LK 4ZVTB 3PY8A 3HI9A 1HYSB 2FTRA 2P9GA 3HCXA 5JS2A 3VHQA 3H90A 2CNLB 2E1CA 2DPNA 5KFPA 4CEZA 1F0XA 3HPOA 4KC5A 3RTVA 3O08A 1BG3A 4PQUA 3CDAA 4BDPA 1NK0A 2CG8A 3J8AA 2QLXA 3I6PA 4PWDA 4Q5VA 2F9JA 3O9SA 1I3OB 4O44A 2DNGA 3MUMP 4OFZA 3ZC4A 3RG6A 4H5WA 4BRIA 3LZIA 5C0YA 2HFZA 2CJBA 3S1TA 4NYFA 2ADCA 4PY5A 2COLA 2M0GB 2OSQA 1RUSA 2PEHA 3CCTA 3BZQA 4YDUA 4J9PA 1SAZA 2FQQB 1JLBA 4J9QA 3ZEUA 3DOKB 1JJ2M 2ZH5A 1T3OA 4LFAF 3CJBA 3V5RA 5DLFA 2A1RA 3E51A 2V4QA 4FDFA 1F5BA 4EFHA 2WVFA 1W2IA 4M5GA 5DDQC 4BROA 3PJ9A 4USJC 3SI8A 3PR5B 4FLVA 3FJ2A 3CXCR 1T9YA 1VC0A 5I3UA 1SH2A 4ID8A 1ASWA 3GLJA 1HNWK 4HLBA 1L3SA 3ET6B 1VHXA 4CIOA 2QWNA 2YPZA 4RTFD 2GS8A 3HZ6A 1KOHA 2YX4A 5KT5A 1X9JA 1LQ9A 2DPJA 3JQMA 1BL3A 3G8TA 4RW6A 2GVDA 4J2EA 3E9LA 2ZH4A 4ZHRA 2HK2A 3I9V9 1NBEB 4H4KC 2HVZA 1OQ6A 3BSOA 5A8WB 2W9BA 4CF2A 3BYRA 5D0GA 1Q16B 4IR1A 3FZMA 5AZIB 4F2SA 1M5PC 4YOTA 2B4JA 3KHGA 1BUXA 1F3VA 3I31A 3ID6A 1Y5IB 3RR7A 4AL6A 3FSYA 5IM0B 4WYBA 5IT4A 2HHHK 1URRA 2F8SA 1YZ7A 5G0RB 3CMES 2F7VA 2DXEA 2PGCA 2ASMA 3WIVA 2H5IB 1B9FA 3U02A 2QSWA 4BACA 2XCPA 2DHHA 3MWBA 5HANA 3FZKA 4JS4A 3QEVA 4EO6A 2L9NA 4DR2J 3QDKA 1HQEB 5CH7B 2WUSA 2VJVA 4O23A 2A42A 5LJWA 2Q79A 1GLDG 4LF9K 5U47A 1WAJA 3OS1A 1B70B 2WW8A 5DGBA 1Z1ZA 1WHXA 4CLZA 3BF4A 5CAAA 4CHYA 3Q24A 3UR3C 2A6MA 3ID8A 4B3OA 4RWWA 2V67A 4ED7A 3RR8A 2DHXA 2CFXA 4X62J 3V81A 2J7WA 3K7RA 1D9AA 3CJKA 1Q78A 4OYBA 2CVEA 4X64F 3HFKA 2R2RA 1QY7A 1CXQA 2P2CB 3OLAA 2ZH7A 4DX7A 4CBWA 3QIDA 3F41A 4CJ7A 3L4BC 3OYNA 4K2JA 3MEGB 1A7GE 5K8NA 3NAEA 4WWSA 4BRKA 3VQ4A 4DPUA 3NF6A 5FLXU 5B0CA 1KP6A 3ITHB 1CJVA 4RL1A 5KFEA 1SIZA 1YDLA 3T6JA 1HBOA 2HZAA 4DSIA 3LP0A 1LWFA 1FWKA 1YJTA 2ZZTA 1N8RO 3OQ2A 3ZT3A 1HLWA 4KYZA 4G1IA 2FC8A 3D0IE 2MQ8A 1OYEA 2DIUA 2OAUA 1VQ4S 4JI8F 2D41A 2ZM6F 4KTQA 5DGAA 2QYGA 1HBUA 1M5KC 2CKWA 4FF4A 3SZ2A 4ED0A 3FLCO 3VAGA 3W7BA 4FM2A 3MUVP 3GIMA 2HHTA 1KFDA 4CJUA 2HSTA 4I7FA 1UA0A 2FBYA 4CO3A 2ILZA 4LF8F 2CQBA 4UY8O 3UDLA 3IBCB 2XYPB 4UOHA 4Y2AA 4RJVA 3PRVA 1HNVA 4U7CA 1W0HA 2CNOB 2FB0A 4F50A 5D4LA 3TA2A 1BWVA 2DH7A 3FNNA 4HKQA 3D54A 2FC0A 1O6XA 2NZ4A 1ZS6A 3DI6B 2OH2A 3FCHA 1SH0A 4R8UA 4DTPA 3NKYA 1Y11A 1RHQB 1BO5O 1FNMA 2JSXA 2HBZB 1EP4B 5GAHU 4FLWA 1MMLA 3NCRA 4NRTA 3JTPA 4ECZA 3I0SB 3PUFA 1RWVB 5HJXA 1NM2A 3IN5A 3DMJB 4CYUB 3OFEA 5AFUH 3HJFA 1PKUA 4HUFA 2UXDK 4FYDA 4QR2A 4KH1B 5KG4A 2DHSA 4Q43A 3LP2B 1R0CB 1RCXB 3DRXA 1BI4A 2MJUA 4Z4CA 4RNFA 1ICEB 1X9WA 3N4QA 1JWWA 4X4NA 3T1YF 2YNIB 5D3GA 3Q23A 3SYZA 1VQON 3IG1B 2APOA 4DV3K 3LAMA 4WQ4A 4DSKA 3W3DA 1U48A 3PW5A 4CBXA 2PMWA 5GMKa 2PI5A 2DO0A 2YKMA 2D3ZA 1I1GA 3DM2A 3MN6A 1U45A 3IUCA 1KRPA 2MKYA 1FFWB 2XWYA 3A13A 3RRHA 1A5WA 5L9XA 3C16B 3MEDA 2OD6A 4Y2MA 1UFKA 3JQKA 1NLVA 3IWLA 2VGNA 4A8FA 2ZOFA 1ACMB 2UUAF 4FJJA 2GX9A 3H5SA 3KWIA 4DR5F 5KFSA 1XHZA 3QETA 4RNNA 1TK5A 1APSA 3MM7A 1C0UA 2Z30B 2VJUA 3MAQA 1QJHA 2LQ9A 2Q97A 1T6DA 2HLUA 4CHOA 1G2EA 3DAWA 1M5VC 1X8DA 2P9NA 4V19X 1LW0B 1U6BA 2ZOMA 2HHVA 2IVNA 2FJAB 1JB0C 3QGIA 2QKKA 4LQ9A 5DK5A 3DCAA 3VF4A 1I5OB 5FDLB 2NLWA 3L4QA 4ED6A 4C3MA 4MLHA 1LK7A 3N01A 5EWFA 4WF9L 3HDSA 4K50A 2AX1A 4EBDA 1N32F 2AYGA 3BYPA 2AZ3A 3A2FA 3QT8A 4CJEA 2GMLA 4Q8FA 3GTYX 4FNHA 4DUZJ 1HNZJ 3EGNA 1NK4A 4FK2A 3DXSX 5E3QA 2I6WA 3MXHP 1DTTB 3GYXB 4X64J 2PYJA 4U96A 4AHRA 5AXLA 1FJCA 3K57A 1WF1A 4LF4J 1NM1A 4DPYA 4IG3A 1F1BB 3BF1A 1R0BG 2VWJA 2XGQA 1FJGF 2LQ5A 5KFGA 2G1HA 4FNIA 2GQCA 2CAJA 4LF5K 4JI4J 3CC2N 3TWZA 2K3KA 1J9AA 3BB5A 3QWUA 3DOLB 3QLHB 3Q0AA 4K59A 1YK9A 1KVBA 5C25B 2E5HA 3M8PA 3AA2A 4CM2A 1WHVA 1N5YB 1GMWA 3OR2A 3I5BA 4FWNA 3W61A 4OYMA 2AEFA 1QSSA 3B82A 1MWKA 2KM8C 4LREA 2CDQA 3F56A 3C14A 2VG7B 4DU7A 1ZTWA 2BV3A 3LAKA 1HNIB 3N5FA 1NJWA 1D8YA 2G0JA 5ETSA 4LR8A 3KHLA 2B43A 4IRCA 5IQQA 4CK3A 1S6PB 2QWPA 4FSVA 3OTOK 5GAHP 5DM7Q 2J6SA 2QWQA 1UJ6A 1P9YA 3AHPA 3WXKA 5JUMA 4H0TB 4LF8J 4X2BA 2P9IB 2AEMA 1VLOA 2VBWA 4M1KA 3C0BA 3UWTA 3TTDA 2DXFA 5HBMA 2M7SA 2QZ8A 4JOUA 4NLDA 2FZCB 1H6KX 1YJRA 5GAHI 3J80Y 4KGZB 4DDFA 5GADP 1B92A 2VB6A 4HWIA 1KQGB 5KRSA 4EMDA 1V4TA 4CIFA 2P5OA 5A6PA 3AO4A 1YJVA 2HBYB 3K9KA 2H65B 1VC6A 1S9GB 3H5XA 1RTJB 4BBYA 3AJ2A 1KAZA 1YBUA 5GADI 3DYAA 1FVSA 2OLWA 2OO4A 3MMBB 1JXBA 4J37A 4FJXA 3AVBA 5K5MA 1HI0P 3DLLL 1RDCA 2AA4A 3CCES 3W0LA 1YJ9S 1HBNA 4ETXA 3CXCM 4F3OA 5KGWA 2FF3B 5E2QA 2ZGYA 3T1YJ 5KTQA 2N3OA 3R6MA 4URSA 4G1QB 4X4VA 1HI1A 3H1VX 2XCAA 5D4PA 3ENWA 3DU6A 1WSFA 1YJUA 3CD0A 2QN6B 3LDOA 1A0OB 3JSBA 3W2VA 1FNOA 3CMAS 5J1NA 1IWAA 2ZZNA 1RBAA 4YNQA 2N7CA 1YSJA 3WC0A 3NLCA 3BQ2A 4XH4A 2VA3A 3SFUA 3EWGA 1X5TA 4MIWA 1CZAN 4R5PA 4YFUA 3F5TA 5GMEA 1N34J 4Y2CA 1SBRA 2GV1A 1UWBB 3H42A 5AZJA 1ROFA 1VSEA 2PYLA 3ZSWA 4LSLA 3OYDA 3T7ZA 4E7LA 4DFJA 2UUAJ 2HNZB 4MK7A 1MMDA 4KH5A 3GJRB 4FLXA 1VBKA 3AVHA 3CGIA 1HPZA 2HW3A 3ZSXA 1OQ3A 3OL7A 3DLGB 5F8GA 4K4TA 1J27A 4NLBA 3CULA 1SKWA 3GIIA 1X31C 4DPWA 4PQAA 3E01A 2XYHB 3MM9B 4AM7A 2J9DA 3JTNA 1SUQA 2AWZA 2R42A 2OPSA 2KHDA 1Q8BA 1S1UB 4TXSA 4A8SA 2RU3A 2YHYA 4JI7J 4LIRA 3OUYA 1XMQF 2FSNA 5ETTA 1N32J 5HP1B 3OYKA 3ATUA 3VQDA 2DK2A 3MPYA 3H2VE 4WXWA 3EE8A 2KYXA 4ZCMA 1QVFR 3PM9A 5HSPA 4CF9A 2HGNA 1RWXB 4PXCA 2AMCB 4CLSA 4H8KA 3KLEB 4DV0J 1DTQA 4PKIA 2CWKA 4C8ZA 5AQMA 2F9TA 2MY8A 1K1SA 3SDEA 4CEOA 3K2YA 4NLQA 5HQMA 3EY1A 2CJXB 4PUOA 4TSXA 3US5A 4UZCA 3CJ5A 3MR7A 5H9FK 1WSIA 2HSEB 3PYDA 4NI2B 2MQPA 4DR6J 1Q82T 4DEZA 3GIKA 1CZBA 2HURA 2RDIA 2BM1A 4OX6A 3KWGA 1ZBIA 4JNEA 2WB1D 2GFFA 2OP5A 1YITS 3ENAA 2GIRA 3SBMA 4LFBJ 4DV4K 4A8MP 1KVKA 3KG1A 1D0EA 1RBUA 3PJWA 3JQJA 5AQOA 4EP5A 5DG9A 4QS7A 1VHFA 1RT2B 1R8BA 1VCTA 4KE5A 2UXCF 1VQ6S 3CDEA 1C1BB 4O0JA 2CPJA 2FY1A 3KZBA 1YJWN 3I32A 3HP6A 2R8HA 3NF9A 2BJ1A 2KTQA 1AROP 2RUGA 3BBBA 2DNHA 4TY8B 2WOMB 1WEYA 2AGOA 2Y1RI 3AB4B 4FVMA 2CQ2A 3VF2A 1ZYQA 5L1LA 2NYHA 4M5IA 3CVKA 5ELZA 5FLXY 2H5EA 4JYAF 4CERA 3OL6A 2RF2B 3HRGA 2CQPA 2XZDB 4DJBA 5B0AA 1QD1A 4O3RA 5IT9O 4AQYF 1XTZA 3CCQS 4RW7B 1LFWA 3RMDA 3S3NA 4N5SA 1YJ7A 1KKHA 4ECYA 3LOUA 4B3TJ 2P9KA 4ES3A 4CEEA 2NPFA 3H08A 2MEWA 2YH1A 4MTPA 1SC1B 3VEWA 1RACB 4DBQA 3CCRN 2ROPA 3FZLA 4WQ5A 3G25A 2A10A 1NZ8A 5HRPA 3D6MB 4B1VA 1UVKA 3MWPA 3TJAA 4K4UA 3VAJA 3BS9A 4FW2A 4I69A 3KXDA 2KHOA 3CETA 2C3MA 2LYVA 2H3EB 1M90O 4AHVA 5BPMA 1RI7A 3O8MA 5ETRA 3KK3B 3QQCD 2KT3A 2V6AA 4RR5A 3L2RA 2P9LA 1Q5VA 2W6LA 4FM0A 4QW9A 2JWKA 4GMJB 2BANA 3RSEA 5HJYA 4JI2F 4KO0A 4CD3A 2WAQD 3C6TA 3CJ1A 4FPIA 4MJKA 4JLHA 2B9YA 2GNKA 4X4UA 2IRXA 3S8SA 2ZWPA 5LL6d 2OTLN 3U1NA 1RNHA 5KAKA 4KGMA 2MHNA 2DGUA 3MURP 1IM6A 4ILMA 2GGPA 1XC3A 3M6UA 2DNOA 1Q8KA 1PIEA 2ZJRQ 4CFDA 2E1YA 3GDQA 2AJ4A 1RHJB 3ZFVA 4KQZA 4DR2K 4ILLA 1A5XA 1RAJA 4L76A 1GAOA 3EDQB 3H3NO 1S72S 2W7OA 1VFJA 1NNDA 4Q2LA 3CERA 4WXOA 1OPIA 3G82A 3THVA 2YWFA 3H7HB 4JI3F 2OPQA 1K44A 3GFZA 1TL7B 4IOBA 4NCBA 1FWLA 2PFUA 4DU4A 1M1KO 1HYZA 1LKZA 1LV5A 5ETPA 1T05B 3EKUA 2QLBB 1TYQB 3VENA 2WK4A 1X9MA 1VHIA 1IBLF 2V4RA 2B5JA 4DLGA 1HKGA 3PRBA 4DV1K 2YKAA 4WFZA 2PD1A 3OTEA 4GNIA 5M1KA 2WONB 2O8FB 3UIQA 3HD1A 1Z05A 5EGYA 2E9RX 4MAKA 1EKRA 3PX4A 1E6VA 4KRFA 4J91A 3ILIA 1AXQA 5FD1A 4U7UD 1KXPA 4NYOA 4CRJA 3O9UA 1NMNA 4WU2A 4PYDA 3HMJG 1SL0A 4KPYA 3KK7A 5EX5A 5E3AA 2H54B 1X4FA 3GYGA 1ZM9A 3H2LA 1BCMA 1GOCA 2W2PP 5JMVA 1CJUA 3TABA 1YRTA 1VSHA 2K2PA 2HHPA 4MKYA 4QU7A 2QEXS 5BR8F 1SV5A 5F8MA 4LQ3A 2BQ3A 3G71N 4PXEA 3RBEA 4DCJB 1TFYA 3H0PA 2YX1A 2ZJPL 2UUCJ 5HVHA 5FIIA 4X66F 1B7FA 2Z1GA 5TKWA 2GJIA 3O8WA 2ZVSA 3MCOA 3TAGA 2JWNA 3CCUN 2NRXA 3LUYA 4B9VA 3ISZA 2M70A 3F2KA 4FZYA 2FVSA 1FDDA 1G6BA 1WEXA 4IDKA 4NLSA 1TKZB 2PMZD 1GLAG 3F9KA 2Q6BA 1LWEA 3NAHA 3VEOA 1UL3A 3VMFB 4FVCA 2BKNA 1N36F 2E6LA 3OYLA 5GAEU 1HMVA 2O8BB 1S57A 5A0YB 4M5LA 4KHYA 3JSMB 3C6HA 4DV6F 1SC6A 1C4AA 3HVRA 4J9RA 1S6OA 1SVDA 3A8IA 3SXLA 1RTIB 4P10A 1QQCA 1YGYA 3S41A 2WSEC 1Y97A 5HROB 2ZH1A 3WC2A 2OZMA 1QTMA 1P1TA 5CHIA 1XI1A 3MMCB 2C2EA 2YY3A 2DKOB 2EFVA 1RSCA 4NE9C 2ZJQQ 4ICLA 2A1BA 5DQGA 4JYAJ 3WXMB 4AYBD 2X3DA 1JCEA 3R8YA 2YHAA 4CJWA 2H51B 3CJ9A 3TTFA 4AQYJ 4OLAA 2CJ9A 2WFBA 2RD5C 2DEJA 1WG1A 4LFAK 1EQ0A 1JLAA 1HYSA 3SCJE 3VQ5A 5HRSA 1LXJA 2O3DA 5FLXO 3Q8QB 4PRFA 1ZBSA 2N3LA 3UD4P 1FERA 2ZITA 1CZ9A 4J90A 3OVAA 1RK8A 3WUHA 1XJWB 2KI2A 2ZH3A 3CC4S 1IKWB 4M3WA 1BDGA 2Q66A 1K73O 2NR0A 3KD5E 4LSNB 4E3SA 2OPRB 3IRWP 2EFPA 5IC4B 2W1BA 3OS2A 3HHKA 2GVZB 4ATNA 5IXUA 3NGKA 3VGTA 4CK2A 5ETOA 1XUPO 3QNOA 4RX6A 1HWJA 4F02A 1FWPA 2BUPA 1BLUA 1CJTB 3CPEA 1V5IB 5L1IA 1E4GT 2QXLA 2XMAA 5K8PA 2LXIA 4EP4A 3ZSYA 3DOKA 1OO0B 2D74B 2DD8S 2P9PB 4JN4A 2QM1A 1ZM2A 4ILRA 2Z1IA 4P7TA 1V6HA 4OI6A 1VBYA 4Z4GA 4DCPB 3JB9k 3DN9A 4GKJF 1GH8A 1FRIA 3TTCA 2R8IA 3PYFA 2A0FB 3QERA 1T95A 5LXRA 1OVYA 2UUBF 2HF4A 3PHTA 3QZ8A 4C2MA 1VQLS 1YHQN 2VWKA 1WG5A 1N8RT 2K7JA 5J2MB 1KCFA 1RBSA 1VQ9N 3CQXA 4CVNE 4HI1A 3ET6A 2VHGA 5CXTA 3MAAB 2YHWA 2NLXA 3OHAA 3RBZA 3ZT4A 4C11B 2NQPA 3FQKA 4JI3J 3D4JA 3ZZOA 4E7KA 3IC1A 5A8WA 3TP2A 2BOPA 3Q8PB 1B0PA 4CJQA 2ITMA 3HJVA 3UCUP 4HHUA 4QYZK 3CCWA 4KHPF 5BR9A 1IBLJ 3DLBA 2BJDA 4ZVFA 1DZ5A 4P2SA 2Y1JA 1KD1O 3SAFA 3R5AA 2KO1A 5IM0A 4K43A 3LW5C 3A5OC 2ROEA 2LQJA 3TARA 1IBKF 4I56A 5G0RA 3PR4A 5J1EB 4DQSA 4LJMA 2CG4A 4OIXA 2DNYA 1CSJA 4A48A 4BR5A 3QMQA 4LRAA 3SV3A 2KQ2A 2LDIA 3AO2A 3EDRB 1QVFM 3MN7A 3J7Z5 1NK7A 5CZ1A 4BQLA 4MDBA 5F2RA 3D6TB 4O0IA 5D6GA 1FRMA 4H4MB 3TX0A 5K8OA 1HQEA 4DL4A 3FSXA 3Q89A 3WNFA 2RMLA 2ZH9A 5A6WA 3TAEA 2BYCA 5KT3A 2HHQA 3CE8A 4OZLA 5EWGA 1RTDB 1IXKA 3HHLC 1HPMA 1VK0A 3BPSP 5DJBA 1RHMB 2I0XA 3ALYA 4Y34A 3K5NA 5KFXA 4KHWA 1VQNN 3B8HA 3ETOA 3AY0A 2JX2A 1JLFB 4FWMA 4JI8K 2ZM6K 2ILYA 2FPHX 3Q83A 2E44A 1DAXA 1T9VA 2YQ0A 1NUEA 1E3MA 3FZ2A 5D0RA 3HOSA 2UUWA 6FDRA 1IBMJ 1CC8A 5BN8A 4DLEA 3MEGA 3L3UA 5AQRA 4WFXA 5LJVA 2KJWA 2A5XA 3G0ZA 3RMCA 3T41A 3MR6A 1N36J 1F9HA 2K1RB 3ZXWA 3ITHA 2NXJA 3M3ZA 3G4SN 3DXMB 4Y65A 1N33K 1RT5B 4DV6J 3NDKA 2AJQA 2R9LA 2DR5A 2BKPA 3WIUA 4LC9B 2LVWA 4JKAA 3NWGA 1N88A 2WW4A 5K8MA 3KMQA 3QSYB 3K8VA 1S49A 4OPHA 1GX6A 3T1AA 1F21A 3OYBA 4WBFA 3LL3A 1IKYB 4IFEA 3UB5A 1RT1B 5GIPA 4JKDA 2KYZA 1QLNA 3HVTB 4LH5A 4DR4K 1UVMA 1F2GA 4IOCQ 4GY2B 3CFRA 4CJ5A 2DNNA 4CJRA 3U27A 4WZMA 2RRAA 4ZJOA 2VG6A 3AVJA 4OI2A 5IQ6A 2W2NP 4FXWA 3LWLA 3CDWA 3D0HE 3T1YK 5CZ2A 3AA9A 2D0PA 2OFGX 4GVBA 3OYHA 1S22A 1YIJN 2C3PA 3AXMA 4QR1A 2AYBA 2PFDA 5C7PA 5AQYA 5ITHA 4J2AA 3EICA 1Q5YA 3WZ0A 2FSKA 2LSNA 3EZUA 3DI6A 4YR2A 5E41A 2W42A 4OX8A 4AT1B 2AX0A 5B0FA 4M7YA 1G4CA 1EP4A 4CZJA 4QIEA 2JC0A 1ITGA 4LFCJ 3ULHA 3I0SA 1CBKA 4J9VA 3DMJA 4QWEA 3K5MA 1O0PA 1X1PA 2GZOA 1OSCA 4JI6K 4ZPWR 2KT5A 4DR5K 2QTWA 3SSRA 3WHIA 3LP2A 2YNFB 3M8YA 2A40A 3BZKA 1D1UA 2EWHA 3CM6A 2UUBJ 3KLVA 3VQCA 5LSOA 3ICLA 3BM7A 4CQ1A 3AJ1A 5F41A 3Q8UA 4O44B 3KLHB 2HKEA 3K5PA 3IGNA 3IG1A 3ZSOA 2FXUA 2ZC3A 4DTOA 1GXLA 4CEFA 3L9ZA 4J8FA 5E33A 3JTOA 3L3CA 1NGBA 2QWMA 4BR9A 2FHJA 2NCKL 3ZZRA 1U47A 4BR0A 4CWBA 3OXGA 2V9WA 1MWZA 2MMYA 2KFZA 3PTWA 3C16A 1FCAA 2G2OA 1XBWA 2DITA 2WVEA 3I0RB 1N6QB 1S48A 1NSPA 3O5BA 2BE7D 5M1FA 4FLUA 4GKKK 4GV6A 4GMKA 3VN5A 2FVCA 3PW2A 2NXEA 1HA1A 3M30B 2OIHA 2L48A 3CSKA 2GA7A 3H98A 4BC5A 3TJ8A 4DPTA 4DTUA 2CPFA 1WUAA 3LGMA 3L7OA 1LW0A 4H0YB 1FJGK 1RAGB 3UN5A 3T1HF 2KKHA 2CA9A 2HRYA 4CJFA 4CLPA 5FDLA 1JLQB 2NRZA 1ZM3A 2UVWA 1Q1KA 2PBDA 3NS6A 3LZJA 1FE0A 3SUOA 5F8LA 1FKAF 3UDCA 4BRMA 3HF5A 1WELA 2W6KA 1MWMA 5IV3A 2GCFA 3CTRA 4H0VB 1NGAA 1DTTA 3D2EB 4ANDA 2BW7A 2P9SB 3QAUA 3MXMA 3NG8A 1N48A 3SMPA 3DC2A 4AD6A 2OYQA 4IOAQ 1HRHA 5CCLA 2M4MA 2ASPA 4IR9A 5L39A 3ATVA 4DTXA 5B7WA 2BZ2A 1RAIB 2JLGA 1X0PA 2UU9F 3ZO7A 2PT0A 4DU1A 3CPWR 3OSPA 3CJSA 1PO6A 1VQSA 4LF2A 4R25A 6FD1A 3DOLA 4EYHB 2UXBJ 5C25A 3QATA 4IKFA 3FKBA 3UN2A 3VEVA 2E2PA 1N5YA 3CJKB 4ELVA 4DPXA 4DSLA 4LVOP 1I94F 5D8HB 4EHUA 1RAOA 4MO4A 3EGWB 2Q0UA 5BYRA 4G3IA 4BC4A 2PA8D 4X65J 1UP1A 3FBCA 5AQKA 2VG7A 5LJ5Y 4YB1P 2X51A 2W7AA 5EDWA 5LSLA 3NNCA 1GXUA 4IEEA 2WSCC 3R5BA 3D68A 1S6PA 3AOAA 3DLEB 5BYQA 2BJ3A 1NOZA 4F4WA 3VQ6A 1T0TV 2C2KB 3PO4A 1R8HA 3L09A 3LP0B 3SQOP 3H40A 3ZT0A 4LF9F 3TZWA 5HL7L 1VRQC 1V3SA 2P9IA 4MH8A 3AGKA 2DGXA 3THXB 4KB7A 2XC9A 1GLEG 3D0PA 3A5MC 4MKVA 2FBXA 1WHWA 3B6BA 2ITGA 2B7CB 4MYUA 4TU7A 2E5GA 4YMEA 2ZHAA 1GMWD 3VQAA 2L3MA 2YWWA 4XDDA 1T9WA 1WOQA 2QL7B 2YX6A 2VU5A 1MW7A 1HW9A 3GJQB 1BY9A 4CHPA 5HMWA 1C1AA 4AHSA 1S9GA 1RTJA 3KLGA 2GIFA 3SEOA 4IZ9A 4C23A 4B1XB 3WXJA 4AL7A 4I1TA 3MECB 4NYNA 3OA9A 5B0EA 3QYYA 2ZBQA 3MMBA 4M5KA 4N56A 4W4MA 5T41A 2PFFB 1AB8A 2KW4A 3ILLA 4LR7A 1KC8T 2O4GA 1FD2A 2VONA 1UEKA 4F7VA 2XNQA 1LOTB 4G1QA 1FI4A 1T9TA 3V6DB 1SH3A 2J9CA 2UUTA 1TVRB 5E0OA 1RAFB 2DY1A 3HL8A 3D0GE 4Q0BB 2V7YA 3IR7B 2R8GA 1YUWA 3RMBA 2J9DE 3VVTA 2VPYB 4F26A 1XMQK 2W24A 2E5LJ 3U7JA 2DY9A 5KFNA 5AJ3F 3D2WA 1VQOS 3EVOA 4O8KA 2CJYB 1JCFA 1N5SA 3GE1A 1X4GA 4OZ2A 1UWBA 1NGDA 3GL1A 1HKAA 3QNWB 3O1LA 1OY8A 2HNZA 2E66A 1RZMA 2HQIA 1U7LA 2EFNA 1MMNA 4ZOSA 2QFJA 2CZ9A 2XRIA 1WC0A 1S7IA 3JS6A 1HHTP 2CQHA 1VQ5N 5HMXA 2KU7A 3AGRA 3NCIA 3MM9A 2UVVA 1MDUB 1LK5A 2WRMA 3WT0A 5L8RC 3SCIE 2G0IA 3ZZYA 1JQGA 1ZETA 4JKCA 2HS0A 1S1UA 3NVMA 4YDXA 4A61A 4BGBA 1H74A 4ZVRB 2AT1B 2AJFE 3CIMA 4F3MA 5HP1A 1UMJA 4FPRA 4NPOA 3J7ZO 2O8CA 3LWMA 5KG5A 4ZVEA 4RW4B 4DQ8A 3M8WA 1M90T 3NRBA 1OS5A 2G4BA 4OPJA 4ZP6A 1DGKN 2EFQA 2UXCK 4DZ6A 5AQZA 3H5YA 3VF0B 4DL3A 4DV3F 3MPVA 1HNWJ 3KLEA 2Z2ZA 4PZVA 2HHXA 4FWLA 2E6MA 3L2VA 1NDPA 2K7KA 5JLHA 4KB1A 2UV8G 2YWEA 2JVRA 2Y1IA 1GTHA 3AVNA 3O5TB 2OANA 2HQDA 4WKYA 3CF5L 2QA1A 4KIAA 4ER8A 2LU1A 2UU9J 4E7HA 2J9EA 4NLPA 2YHBA 4GV3A 2W25A 5JVHQ 2GV9A 3VGKA 4NYZA 3Q22A 2WVCA 5CY4A 3GZ7A 4NI2A 2B4PA 4K4XA 2W9CB 1RTHB 2B7BB 5DZ6A 3FC9A 2HHHJ 1I94J 2ZBIA 1HWUA 3RB6A 1KWMA 3SAHA 4IRDA 4Q7AA 3R8EA 2KXFA 4I4BA 4OZJA 1MWYA 3WNGA 3CC2S 2HGLA 1M1KT 3UCGA 1VQPN 3V9WA 1C1BA 2PZSA 2YQ1A 3QMLA 3GPAA 3AT1B 3FEYB 1LOUA 2P51A 1FXRA 1NJYA 4TY8A 2WOMA 4M95A 4LF9J 4IFVA 4IWVA 4TKTA 1VK3A 2IYIA 3O9TA 5DM6Q 2RF2A 3M8PB 2V4JB 3GBTA 4DV2K 3KNAA 2YKNA 3T3FA 4JI2K 2YH0A 3J81j 4Q45A 1WSEA 3IS9B 4D3HA 4HCBA 4GO5X 1Y4ZB 3OT9A 1YT3A 1OMSA 1UW4A 4ETZA 4RW7A 1EQYA 3TJ9A 3C14B 2BTFA 1HARA 5D4OA 2EBEA 3TAFA 2GWKA 3H4DA 1Q8IA 3VQTA 5KG1A 3GE9A 4GVMA 1M5HA 2CQ4A 4RW8B 5KFTA 2D4WA 3OR1B 1H7XA 2YKQA 3ADAC 5DRKA 2ALYB 3NEKA 1PGZA 4IO1A 3HSDA 4B3RK 3EE9A 1T02A 2D0CA 3QIOA 4FJNA 1K8KB 2E9ZA 4UW2A 2PSZA 3S3MA 2N4CA 2QYCA 3FRYA 3C95A 4DX5A 3MPWA 3KK3A 4BRGA 4C0BA 3ZTQA 2HEKA 3MWTA 2I1RA 3GG4A 1WDDA 1U1PA 4BRCA 1NOYA 1XERA 1TU0B 4F4XA 1QS4A 1XQSC 1IBLK 2XO6A 3K0JA 2J5AA 3A8EA 3HFVA 5D4NA 1K9MT 4M3ZA 1WHYA 2DIVA 1PILA 3SMSA 5C42B 3EE3A 2W2QP 2XBPA 4CGGA 4HTLA 4MLEA 2XMTA 3AY9A 4DG1A 3PACA 1S10A 4BS2A 1HWLA 2NUBA 4FZZA 3TUIC 2Q36A 3J7YU 2KFYA 4OLPA 4EYIB 4BWMA 2CGKA 5A8KB 5AQQA 3VGMA 2Z57B 2DNKA 4ED5A 4W92B 4M45A 4HYKA 1B0VA 2XO7A 1HKBA 3PIPQ 3SUQA 5SWMA 4DR3F 2VFRA 4CH1A 2AF6A 4OYPA 1TL7A 3RZAA 4UF4A 3MM6B 3O9QA 5BR8K 4ECRA 4I68A 4KAZA 4ECTA 1TYQA 4HHHA 3MR3A 3FCWA 1HQ2A 1LCUA 5CZVA 1QQNA 4HH0A 3G9CA 4EK2A 2IPOB 1ZAWA 4X66K 5KFUA 1S9FA 1HHQA 2WONA 4K4ZA 3O3HA 2M8HA 3IBWA 5AZJB 1I6JA 2XYGB 3I8DA 1VI7A 3MHYA 5J2NB 1K73T 3RBXA 4WP9A 4FKXA 1T9UA 2PN6A 4JKBA 5L1JA 2IVFB 3FQLA 2R7QA 1T6CA 5M1NA 1WB9A 2DGWA 3I8BA 3OYEA 3L0QA 4USIA 3V6JA 1VQ8N 3OTBA 2OPPB 2BMBA 2A3JA 5LSRA 1XMBA 5HRNA 1NDCA 4DV3J 4CJTA 2E7XA 3FBBA 4ZPVR 2C2DA 5B0DA 1C0MA 2D7SA 2NYIA 3M6VA 1YAGA 5C24B 1KQKA 4P9SA 3SK3A 4BHQA 2QGFB 3LP3A 2F8EX 5DS7A 1C0TB 2NPIA 5F8IA 4K8RA 2ZUAA 4F0KA 4M3XA 3I87A 5LY3A 4K2XA 4USKA 3W62A 4DV5F 3CPWM 1RHKB 1C4CA 3PKMA 3K2PA 4O3OA 4I6MB 4PAAA 1LFPA 4X4SA 3AQOA 1Q7LB 1SJRA 1S4EA 4DQRA 3BF3A 2IBOA 2Z2LA 4N77A 3JAMU 1TKZA 4H5RA 2DB1A 2LA6A 3ZTPA 4U8VA 4C1NI 4C48A 1FRJA 4OHZA 4NCAA 4RNMA 2V51B 1HJOA 2QSFA 1SQEA 4HT5A 2O8BA 5A0YA 3MEEA 3NMAA 3JSMA 1EETA 1AZSB 3ZX3A 3TZYA 3BR8A 3P3DA 3FFIB 4IG0B 1RTIA 2ALZA 5LMNK 3ZETB 1KD1T 3J7AN 3SMZA 3ENOA 5HROA 3M6GA 3MD1A 3EEQA 3MMCA 3QJJA 4L3QA 3KTQA 1NAQA 5JMNA 3VQSA 3OVBA 2RH3A 2X7IA 1S0VA 1P8ZA 2DGSA 2F4FA 4F0HA 3HT3A 1YJWS 4Q44A 4WFBQ 1JXVA 1QE1B 3R27A 3S6EA 2Z0GA 4KFBB 3HFZB 2RKIB 3M2VB 2VODA 4DQIA 2G8IA 2HHSA 5CQGA 1BUPA 3IAM9 3R1HA 4BC9A 1TMMA 1EX8A 4GKJK 3R97A 4CIGA 2UUBK 4B1UB 4K5SA 3TRGA 1IKWA 2YJFA 3FSIA 2VQEF 4BRLA 3D2FB 4LSNA 1RDDA 3HXMA 2OPRA 3VQQA 1Q81O 2IBKA 1NGEA 4CECA 2RT3A 4LF5J 1S1XB 2GVZA 1K0VA 4UY85 3J7YP 1XC9A 3FEXB 5IV4A 4KRWA 3CCRS 1RT6A 2AYEA 3MN5A 4J9LA 1CJTA 3K5LA 4ES1A 1NU4A 4WCEQ 1UFWA 2IA6A 4KHPK 4JD2B 3VGLA 3CIZA 3BPDA 3GJTB 3C6AA 2P9PA 2GHVC 3J7YI 2C28A 3MX5A 1IBKK 2DVIA 4LF7F 4TYBA 3MTKA 2ATCB 3DRRB 2GO9A 2VV5A 3KKFA 3D3BJ 1S59A 2AJ2A 1BIZA 2FSJA 3N4WA 3OTOJ 4FS2A 4DB3A 4CBUA 5J2MA 4V19S 5SZTA 2LECA 3BUZB 2MZTA 5F3TA 4CGDA 1RYSA 3BBCA 3BBFA 3EMTA 2QRRA 4FYYB 4DCHA 4J9OA 1VRTB 2OTLS 4B9MA 3BN7A 1EZZB 3T9NA 4C11A 4J9KA 4I6AA 3THTA 5C5JA 2AP6A 1JMTA 1EO1A 2WCXA 4YP3A 2NRWA 2CPDA 5G4DA 3K9JA 4OJ3A 2VPXB 4OX9F 2KVQE 2C3UA 1Q95G 2DO4A 2E4LA 1I3AA 5DQIA 3MZIA 4F4YA 3CJ3A 2GGPB 3JXUA 2JFKA 4OZNA 1KFSA 2GAHC 1GMVA 2N4DA 4FBUA 1NNEA 4EIAA 3UQSA 3MMJA 2KXHA 2ACMA 3W65A 1RBTA 2FJXA 2GELA 4PG7A 3H46O 2JFDA 4JS5A 2Q1NA 4AFFA 3DLRA 1C0GA 4DXLA 5KFBA 1D5AA 1Z6RA 5GINA 2EKYA 2ZBRA 3A8KA 2M52A 4IKAA 3DRPB 4CZHA 4F3TA 5AQGA 4KI4A 3MK6A 1XN9A 1WTFA 2NUUG 1HKCA 3HLUA 2E5JA 1RTDA 1TELA 1J5EF 2IYGA 4F36A 4MKBA 3IR6B 4YY3F 4ZVQB 2GEMA 4YOUA 3ZTRA 1SL1A 3EYZA 4KGKA 3DKDA 3SQ1A 3O3GA 1JLFA 7AT1B 3FUYA 4CO0A 1PSDA 1Z2ZA 2JEFA 4K8ZA 2EK6A 4AXIA 5DDRC 3AOBA 1D9FA 3ENBA 2Y0BB 2MSTA 4LRDA 1RDAA 1N0UA 3G71S 3KIOA 2F8MA 5HLFB 2KLAA 2HK3A 1GQEA 2F65A 3MCMA 4ZVUB 1BQMB 3VESA 4BRPA 2K1RA 2OMOA 4RBUA 2DFFA 3CCUS 3S7RA 1YLXA 1QQMA 2HOEA 1ZC6A 1RT5A 2B3TB 2QJ3A 3V2UC 3RAMA 3KHRA 4Y0WA 2HAFA 4I6WA 4DV1F 3OTDA 3GONA 2IFXA 1HQUB 1Y5LB 1VQKN 1VSDA 4CTAA 2B9WA 1IKYA 1ULRA 3IFEA 4U7BA 1RT1A 2DISA 5IT9U 4IO9L 2IMWP 4V1Ak 1OJ4A 5HO4A 3SQGB 1KSPA 5ETQA 5M1PA 4NX9A 1RDUA 1RAAB 5M2UA 2YWGA 3IGVA 3M6WA 2VOOA 5AXKA 1U2RA 1KBRA 3EGZA 2XLKA 4CLKA 5AT1B 4K42A 2NRHA 1X0FA 2MQLA 4MYTA 5GIOA 3HPHA 4OL8A 3OVNA 1UA1A 3QRRA 3O9RA 3RYLA 4DX8H 2VZ9A 4AHTA 4QBUA 1R8AA 4ZJLA 4CT8A 3J7A1 1NMEB 4LF6K 2LDYA 3N4PA 3P83D 4PABA 4YOWA 3LO3A 4DTNA 2ZDOA 5H9FJ 3Q7CA 1BQXA 3OXLA 4Z2XA 4BG8A 1WKJA 3HKZD 1RKJA 5J2QB 3UE5A 2KZMA 4PYAA 6AT1B 2ZNZA 4MK8A 4DR7F 1JLAB 3NH2A 4XDCA 5CA5A 2IY5B 3NF7A 5D77A 4ED3A 1RXOB 5AQPA 3SSSA 3AARA 4DV4J 5JVGL 4QIVA 4B08A 3BO4A 4OZ3A 4PWWA 1CC7A 4BRDA 4ZLPA 2YNFA 5FJ4A 5CR4A 4DL6A 1BU6O 2DBBA 2EHGA 5IFMA 4MIAA 2V69A 3TUZC 3KLHA 3K0SA 4ZP7A 3P8BB 3G6XA 4WCEL 4P6QA 5HN0A 2YI1A 4NA1A 3SFGA 2JDJA 1ZBTA 2FHMA 3T1HK 3AFGA 1HR0K 1WOPA 4RLEA 4E2FB 5F8JA 1ESVA 1YJNN 4QWCA 1YHQS 4LY7A 4CHQA 4MK9A 1NG9A 1JIHA 2IM1A 3Q8YA 1VQ9S 5H1SQ 1CQNA 3ULEB 4CESA 3I0RA 1N6QA 3THYB 1FT8A 4B17A 1XNQF 3LPUA 3W2WB 2F63A 2R7UA 4ECWA 1N5VA 1UJ4A 3GV8B 2O66A 3P31A 3OFFA 5KFMA 2HLTA 3SQ0A 4NLCA 2YNHA 3M30A 4H5NA 4E0DA 3CJTA 4BR4A 1R27B 4RBTA 5LOQA 3VZHA 1U24A 4NYPA 2ZE2A 4BE1A 4CEDA 1RBLA 5A76A 5EX3A 4FJGA 3N6NA 4E7JA 1RB0A 4LBHA 4KGVB 5F0WA 1YVFA 2UU9K 1D9DA 2FHJD 4EBEA 4C98A 3QT6A 1JLQA 4L3KA 2XHCA 3UNGC 4QWAA 1Z26A 2EW9A 3LQVA 1UCNA 4P52A 2KRBA 3H3OB 3GQCA 2P9CA 2XWXA 3R1LA 4OKJA 1Q8LA 1H0HB 2KL8A 1I94K 3AQPA 2MLXA 3CJ7A 5E3CA 1C1CB 2UYTA 3BO3A 1F9EB 4JV0A 1DLOB 1RISA 4N7TA 1TQLA 2KM8B 2QA2A 4ID1A