3IS9A

Crystal structure of the hiv-1 reverse transcriptase (rt) in complex with the alkenyldiarylmethane (adam) non-nucleoside rt inhibitor dimethyl 3,3'-(6-methoxy-6-oxohex-1-ene-1,1-diyl)bis(5-cyano-6-methoxybenzoate).
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
554
structure length
554
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic study of a novel subnanomolar inhibitor provides insight on the binding interactions of alkenyldiarylmethanes with human immunodeficiency virus-1 reverse transcriptase.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Transferase/hydrolase
molecule keywords Reverse transcriptase/ribonuclease H
total genus 134
structure length 554
sequence length 554
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3is9A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3is9A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3is9A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3is9A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3is9A05
2WK4A 4RNMA 5DG7A 4RNFA 3E01A 3M9NB 2XC9A 2GV9A 3M8QA 3QEXA 4IRCA 3MXIA 3KIOA 5KFEA 3OS1A 3ALYA 4IOBA 1X1PA 3TAMB 1C1CB 4JS5A 2R8HA 3OYEA 3KOAA 3H59A 2G8VA 1BISA 3DLKA 3PJXA 3K5NA 2W9AA 4M45A 3AO4A 4EO8A 2VA2A 3P1GA 1BCMA 4KHUA 1RTHB 1S1WB 1RT5A 2KW4A 2YNHA 3O3FA 4M94A 4M3XA 4EYIB 3DLGA 3SZ2A 1JLAB 1RBRA 2G8IA 2E9RX 5KFBA 4FLWA 5KT6A 1W25A 4J9MA 4UQGA 3KKRA 2WHOA 5SZTA 4DFJA 3ZT4A 2BDPA 2UVRA 3LP0A 3LP2A 2C2RA 3PW5A 4DTNA 1L5UA 1JXEA 4FJLA 4I7FA 2ZE2B 3VQAA 2KTQA 4DQQA 1JLQA 4CIFA 2W9CA 3AA4A 4JLHA 3PW7A 2D0BA 4FLUA 2WTFA 4OPJA 1DTQB 2Z1JA 3ZSYA 1S6QA 2ZD1B 3PW2A 5D3GB 4R0EA 1XR5A 3MFIA 4CEBA 4FXDA 3IS9B 2B5JA 3ZSXA 3G86A 2D3ZA 3QEVA 4I2PA 5J1EA 1VRTA 2QK9A 1JLEA 2D0CA 5DQGA 5KG5A 1IKXB 2BQ3A 3SI8A 1U45A 3V9XA 3GIIA 2HNYB 4MFBB 4FZXC 4B9NA 3OSPA 4H4OA 1C0UA 3CQ8A 1HYSB 3KHGA 2BRKA 3DRRB 3RMDA 4QOZB 3CO9A 2DFHA 3LDSA 3V1QA 4CIGA 3WNHA 3KMQA 3HPHA 3IGVA 4KTZA 3LZIA 5F8MA 4NLYA 3D5MA 1ZTTA 2HNZA 1RT4A 5KG3A 2XGQA 3LPUA 4M3ZA 2Y1JA 3CJ3A 3VQ5A 3KKSA 4O0JA 3PY8A 5L1KA 5DGAA 2ASLA 5KFSA 4TY8B 5F8HA 2BR0A 4WXWA 3OYMA 2J6TA 5HBMB 1N56A 3SJJA 3AVAA 3ISND 4CGFA 3LP2B 4M41A 1SL2A 3QGGA 3OLAA 1T94A 3CDWA 5HRSA 3UIQA 3NH2A 4AHTA 3DOLA 1RTJB 4KBIA 4DL4A 4HUFA 3KHHA 1VSDA 1TK8A 3NGZA 1RT2A 1QSLA 1ZYQA 2IM3A 3D28A 2FBTA 3Q8SB 4KAIA 4FJIA 3TAQA 3P83D 1S1WA 2GIRA 4KO0B 4G3IA 3I5CA 4MKAA 4ZP7A 1IKYA 5DMRA 3VQ9A 4FCYA 1JLEB 3HK2A 1ITGA 4I2QA 4ED3A 1NJXA 4DTPA 2RPIA 4JRPA 1JLFA 3FSIA 2IC3A 3MTKA 3AVBA 2FLLA 3L3UA 5FRMA 2XY8A 4FYDA 4J9SA 4DTSA 5KG2A 1I39A 4E89A 5EWEA 5DK5A 1XWLA 1WNEA 1TK5A 3FFIB 3ITHA 4O4GB 3PHEA 3VQSA 1LWCB 3V4IA 1T03B 1J5OA 3RBDA 2UVUA 4DLGA 3RB3A 4DL6A 2E4LA 3FQLA 1NJZA 4K8ZA 3VA0A 4IRDA 4J2AA 5KRSA 3ZT0A 3KLFB 1HMVB 3L8BA 4AILC 4DEZA 5FROA 1RDDA 2OPRB 4BE1A 2JEJA 2FVCA 4OKEA 3HYFA 4CFCA 4KV8B 5C25B 3AVIA 1VRTB 4OKKA 4CCHA 4RW8A 1C0MA 4DSJA 2ILZA 1IM4A 3SUOA 1O1WA 3CJ2A 2CJQA 3O3GA 2DY4A 1JXBA 1HQUA 4NLTA 1QSSA 3DRPA 4X2BA 3CJ5A 2G8WA 1S1VA 3EPGA 1GX6A 1FKOB 2I5JB 4IFVA 4E7JA 1RT2B 1S97A 4NLWA 4W5TA 1U48A 1J54A 4FJ8A 4LSLA 2BANA 3QNNA 4O3SA 3M8RA 4WZQA 1JLCB 4DG1B 4Q44A 4WFZA 5EWGA 3LZJA 1XHXA 3QEWA 4Z4CA 3OLBA 4W5QA 4BDPA 4Q5VA 4FLXA 2FJXA 2FBVA 1T7PA 1MMLA 1C1BA 1KCFA 3NAIA 3QESA 2HHXA 1EP4B 4ZPDA 3OL7A 2P5GA 3VQQA 1BIZA 1I6JA 4LQ3A 4FM1A 1RT5B 2GC8A 3LPTA 4ZMMA 1KFSA 4KHWA 1WAFA 1SL0A 3PX0A 1C2PA 2YV0X 4KKOA 1MU2B 3F73A 1T8EA 2FLPA 1HNIB 3TR8A 1R0AB 4ICLA 2Z1GA 2VG7A 3KLHB 3HPGA 2PY5A 4OVLA 3H4DA 1CZ9A 1NOZA 1YVUA 4OGCA 3NF8A 3CFPA 1L3TA 3HP6A 2W9CB 2E6LA 1JX4A 3M8PA 5I42B 4PUOA 3ULDA 3KLEB 2IJFA 4IRKA 2JLEA 4TSXA 3QLHB 2QKBA 1NK7A 1YT3A 4WFYA 4F4YA 2HNDA 1TP7A 3CM5A 3LALA 2IC3B 4QWAA 4NYFA 1RT3A 4CJUA 5KFDA 3SYZA 3LANA 3OY9A 4K4SA 1DLOB 3IG1B 2YNFA 2HB5A 4JS4A 4IG0B 3ISNC 4W5RA 3K5MA 4LSLB 1HPZB 2HVHA 3DLEA 4DSFA 1TV6A 3C6UA 1C0UB 4FJNA 2JEFA 4CHNA 3UR0A 1KRPA 4ZP9A 1GOAA 5CY4A 4CF0A 3LP3A 4XIUA 3TAPA 4KI4A 2ALZA 4Q0BA 4CFBA 1SH0A 3K57A 4TYBA 3G0ZA 4H4MA 3RBEA 3KD1E 4CJVA 2D41A 4OLAA 5F8IA 4K4UA 3DI6A 3GV8B 3L2VA 1HNVA 2VG6A 5C42A 3H4BA 4LY7A 2AJQA 1SH2A 4C8MA 1KSPA 4K4ZA 1SKSA 4FW2A 1JLGB 2FVQA 4QW8A 4ZP8A 3HVTB 2QXFA 1Q8IA 2ASDA 2OPPA 1HQEA 3NH1A 3I0SA 1TAUA 5J2PA 2UVVA 4CJKA 5E41A 4RNOA 3CWJA 1LV5A 4QW9A 5JXSA 3BGRA 4BACA 1S0OA 3G6XA 3OYKA 4F50A 2YHBA 1S10A 2D3UA 2XRIA 4DF8A 4B9TA 1G15A 5KFZA 3S3MA 4YMEA 3K58A 3VQ6A 3H40A 2O5DA 2HHVA 2Q3SA 3OYFA 2ETJA 3HVWA 1CSJA 3H2LA 4DS4A 3G10A 2FBXA 2OA8A 1VSLA 3HSTB 3OS2A 1HNIA 3M8SA 4DS5A 4N56A 3OYLA 1R0AA 4Y1CA 3CG7A 5F8NA 1RTIA 3KK2A 1RILA 3KLHA 1J53A 3PW4A 2IM1A 1LWFA 5KRTA 2R8JA 3MXJA 4O4GA 1YTAA 4O44B 3AO3A 4Y34A 5I42A 4DF4A 1FXXA 3C6TB 2AU0A 4HUEA 1EETA 5KFUA 4KI6A 3NH0A 3H5XA 1ZBHA 1NK5A 4ECSA 4FLZA 3T5KA 3S3OA 1WNSA 1IH7A 3Q8RB 3KLIB 4QWCA 4IH5A 2DFEA 4FM0A 3QIPA 1ZBUA 4IH6A 3NFAA 1L3VA 4Z4IA 3RRHA 1K6YA 2OPSB 4CFAA 3SQ4A 2XGPA 2E9ZA 4RZRA 3DM2B 4C8NA 1UAXA 3HVTA 2IM0A 4DMNA 3S9HA 4ECYA 3ASMA 4E7LA 3PR4A 3LP1A 3TAMA 3N6NA 3C6UB 4CJWA 4Z4GA 5DG8A 2RKIA 4DQRA 5KFRA 1JKHB 4ID5B 3GILA 4FBTA 2UUWA 4CEQA 4O4RA 4FLYA 1BCOA 4EO6A 1CXUA 2IOCA 1RNHA 1J9AA 4BDYA 5KFXA 5HLFB 5KFKA 4H4MB 2Z1HA 3F9KA 1WLJA 1IKYB 5FRNA 3OL6A 2P5OA 3DMJA 4IDKB 1KLMA 3RAXA 2JC1A 3IRXB 4RW4B 2FJWA 3RMCA 5C42B 4YQWA 4EBCA 5HP1A 1UWBB 3AVHA 4QWBA 3CJ4A 4F8RA 2OZMA 2FVSA 1RT6A 1RYSA 2WRMA 2YKMB 3KK3B 5CZ2A 4EP4A 4KKOB 4K8XA 4ZHRB 3FFIA 5F8GA 3VN5A 2FVPA 1S5JA 3H08A 3NGIA 2VWKA 1S0MA 4JUZA 4LD0A 2W9BA 4CECA 1FKPB 3AVNA 1WSHA 2NUBA 5KG6A 3RMBA 2X74A 1W9HA 4CJSA 3CDUA 1ZETA 1S1XA 3HXMA 1U47A 2IM2A 3VQEA 4XPEA 4KV8A 4CGGA 2W7PA 5EDWA 2Z1IA 5KFAA 3ZT1A 3P5JA 4CERA 3HO1A 1BQMB 4CHOA 3L2WA 2AGPA 2OPQB 4RW6B 3E51A 3LP1B 1KVAA 4DQPA 2KZZA 3BR9A 4URGA 4ECXA 2IAJA 2WOMA 1LWFB 4FJ7A 2HW3A 4ID5A 4O44A 2XY6A 3S3NA 2E9TA 4PQUA 1FKOA 4ZPBA 2RDIA 2BANB 1RYRA 3NL0A 3U6FA 2R2SA 2JEIA 4TY9A 4LSNA 1RDCA 3OYJA 4ECQA 5HLFA 3DLBA 2G8KA 3OS0A 4K4VA 2YNHB 5DQIA 4G1QB 1RAJA 3ZSWA 1N6QA 2EX3A 1KLMB 1BI4A 4FW1A 4CHQA 4E1NA 1RA7A 2ATLA 3O4QA 4MK7A 4NLXA 1S6PA 4CEEA 5HBMA 5J2QA 2QE5A 3SFUA 3JSMA 4DU1A 4RNHA 1WSGA 3KK3A 1EKEA 2BQRA 2WONB 2R7YA 2XO7A 3C94A 4CJFA 2EC0A 4J2BA 1JLQB 4ZVEA 3EPIA 4NCGA 4LQ9A 3QO9A 2IJNA 3PO5A 2R2TA 4KTWA 1RT7A 3VQCA 5KFCA 4IFYA 4J9NA 2EHGA 3HVRA 3NBPB 3V1OA 3RB4A 4EBEA 5DLGA 3IN5A 4KO0A 4DTJA 2A1RA 3CJ0A 3FRZA 5T7BA 4B9VA 3AVFA 4CF2A 5L1JA 4RUAA 3PR5B 4IDKA 1A5WA 1NHUA 1S6QB 5KI6A 2V0NA 5HP1B 2VA3A 5D3GA 3AVJA 3CDEA 3VQPA 3OYCA 2OPQA 1NNDA 3K5OA 5JS2A 1RT3B 3LAMA 2DPJA 2YKMA 3K5LA 3NF7A 2A1SA 3B6PA 5I3UA 5CYMB 2J6SA 4ZPAA 4I2PB 3MFHA 4IH7A 3FDSA 3KD5E 4O3QA 4CEDA 1TKZB 4MQ3A 1BGXT 2W8KA 1Z25A 1NJYA 4GMJB 1D9FA 2W9BB 4J9RA 3MR6A 4O3NA 1N5YA 1GOBA 4AH9A 3KLVA 4M3UA 1HMVA 2QV6A 3KNAA 1DTTB 1RDRA 3I0RA 4ZVFA 2XWYA 4NLPA 3LWMA 3T5HA 3V9UA 4F3TA 4DQIA 4JV1A 1S1XB 4CFDA 4ED2A 5K14B 2HHUA 1QQCA 3BDPA 3PVXA 3SNNA 3HP9A 4FJ5A 2AX0A 5HROB 3PV8A 3VQ7A 1S49A 4FM2A 3MEDA 4FS1A 3KLIA 3DDKA 3TAFA 2HMIA 2HNZB 1ASWA 3VA3A 3BSNA 4J9LA 2P51A 3DLGB 4BWJA 1K1SA 2O4GA 4TN2A 2F8TA 4HHTA 1JL2A 4CIEA 1KVBA 3QO9B 4NLUA 4Z4HA 3CFOA 4FLVA 4KE5A 4KHNA 3OL9A 3ZT2A 3TARA 2R2UA 3AV9A 1S9GA 4L8RB 4LSNB 4PY5A 1IKWA 4NLOA 1X9SA 4RW9A 3DOLB 3ICLA 1RBUA 5FDLA 3VQ8A 1IG9A 4CEOA 4DFMA 5J2PB 5F8JA 1C1BB 3AVKA 1SV5B 3SQ1A 4NLRA 3TABA 5EWFA 2GUIA 3UDLA 4ED0A 5J2QB 2IMWP 1NK6A 3AVMA 5F8LA 4E3SA 2AQ4A 4N5SA 4B9UA 4O3OA 1VSKA 1RTDB 3DRSB 4E7HA 2YKNB 3M9OB 4ECRA 2JGUA 1VK0A 1VSMA 5KFMA 4K4TA 3MXMA 3AVCA 2D7SA 4Y2AA 4I2QB 1LWCA 3V4IB 1T03A 4QWEA 4ED1A 1JL1A 3ZSQA 1ZBLA 4Q8EA 3DYAA 4YR3A 3GV5B 4CF8A 5KT3A 4K4YA 5EUHA 4O0IA 4ELUA 4NLQA 1LWEB 4BE2A 3TANA 1FK9A 4CJ5A 1SH3A 3I0RB 4Q8FA 1YTUA 3U3GA 3B6OA 4IKAA 3MEGB 3TAEA 4FK0A 1SUQA 4JV2A 3KLGB 4HCBA 3QLHA 5HROA 4AHCA 4R5PA 1QS4A 2R2RA 2OZSA 3MEEB 3PUFA 3JYTB 1KFDA 4AHVA 4KREA 5C24A 5I3UB 3PX4A 5DG9A 2OPSA 4CEZA 3QIOA 4RW8B 4FJXA 1S4FA 3OYHA 4IG0A 1KVCA 4OKJA 4KRFA 3QINA 1S1UB 1JLBA 1WN7A 4RW6A 4ECZA 1N5YB 1EXQA 3V81B 2FC0A 3V6DA 4OPKA 3KMSA 1IKVB 1N4LA 5FDLB 2LSNA 1RTJA 1QAJA 5KG1A 1RDAA 3RRGA 4F2SA 3L2QA 4B3OA 4DFPA 1VRUA 4KTQA 4FJMA 4FVMA 1CZBA 3KJVB 4CJQA 4F4XA 5J2NA 4CHPA 3V9ZA 1NK4A 3SFGA 3DRSA 5JUMA 3QEIA 4E7IA 2OH2A 4Q45A 1U49A 1C0TA 1B9FA 3OYDA 4TLRA 4R8UA 4TYAA 3IRXA 3OYGA 4Y3CA 4O3PA 1S6PB 3DYAB 4F4ZA 3OSNA 3LWLA 3DOKB 1QSYA 1L3SA 4DU3A 3CM6A 2VG7B 3GYNA 3SQ0A 3RB0A 3DLRA 3GIJA 3NCIA 3OYAA 4IQXA 3H98A 4IR1A 3AVGA 3HPOA 4IBNA 2YNGA 2RN2A 3QIDA 4B9SA 1QTMA 4AHRA 4RW7B 4N41A 3KLEA 1XC9A 4KHQA 1RT7B 1TVRB 4CHYA 3EYZA 4KHSA 4CESA 5CYQB 1QAIA 1UOCA 2BRLA 4B9LA 2KFZA 1RTDA 1KHVA 5C24B 3T1AA 4ECVA 2XCPA 1SKWA 4ZPCA 3AVLA 1TL1B 3NF9A 3AA2A 3NKYA 1TK0A 3OJSA 3M8QB 1JLBB 1ZBIA 3T19A 3EZ5A 4MFBA 2ASJA 2V9WA 3V6JA 4ED8A 1DLOA 3SPZA 4FK2A 4KHRA 5CYMA 3MECA 3V9WA 4K4XA 5KFHA 5KTQA 5HRNA 3NMAA 2WCXA 1EETB 1TKZA 4WYLA 1QUVA 4NYNA 1BL3A 1JLCA 2XY7A 4R5PB 3PZPA 1C1CA 4FJHA 4CEAA 1RTHA 4ZTJA 3I5BA 4NRTA 3HVAA 4C8LA 4BDZA 4XPCA 4CHZA 1JLAA 1N6QB 2HHWA 3D0PA 1EP4A 3TAGA 1HNVB 1GX5A 4Z0UA 3KK1B 4DSLA 4GVMA 4M3TA 4FJJA 4E0DA 3DM2A 3AA5X 3LP0B 3THVA 1S48A 3QEPA 1D9DA 1S1UA 3MF5A 2IBKA 3CYMA 3DLHA 5KG0A 4I7FB 3NGDA 3V81A 2IGIA 3DI6B 1HQEB 2C28A 4DU4A 4KB1A 3MAQA 3UQSA 1KLNA 4NCGB 5KFJA 4GC7A 3T3FA 4CJLA 3SUNA 3V6KA 5F9NA 2V4RA 1S0NA 4CJ4A 4B8CA 2ZD1A 1S9GB 4DTRA 1LW0B 3AO5A 3TWHA 3IS9A 2YHAA 2GIQA 4AHUA 4PWDB 4CJEA 4DL3A 1S1TB 3BQ1A 4OGEA 1JXLA 3L2UA 2G8FA 1ZBFA 4QAGA 2BE2A 3HL8A 1S9EB 4TXSA 2B5JB 1T3NA 1VSJA 1REVA 1Q9YA 4Z4EA 3VQBA 1QHTA 4TQRA 3WNEA 3SPYA 4WXOA 5DQHA 4DSEA 1NKCA 2FJVA 3Q8PB 4RW7A 5KT5A 4CGHA 2D0AA 1HRHA 4CJTA 1I3AA 4DTMA 4DWIA 1LWEA 4HTUA 4H4OB 2I1RA 4FK4A 4M3YA 2CKWA 4H54A 5KGXA 2PYJA 1W0HA 4ELTA 4HUGA 1SUQB 1B9DA 4J2DA 1RBVA 1LAVA 3SV3A 4IG3A 3H5YA 4URQU 2Y1IA 1D8YA 1F21A 3SUQA 2HHTA 3MEDB 4EEYA 3SQ2A 2VG5A 4J9KA 5SWMA 3RWUA 1HYZA 4XO0A 1C6VA 2WOMB 1ZTWA 3GIKA 3K2PA 3G6VA 3RMAA 1VSFA 5KFFA 2I5JA 4RNNA 1JLGA 3QYYA 2X6SA 1RT1B 5KFWA 5KFLA 3RTVA 4NYZA 4M95A 2C2DA 2IS3A 1SL1A 1UA0A 4RW9B 4ZVGA 4N47A 4KHMA 4YFUA 4FS2A 2JEGA 2YNIB 1WSEA 2X6NA 4EZ6A 4KB0A 3SV4A 4O55A 4OJRA 4KB7A 3ZSVA 4DQSA 1UWBA 2P1JA 3QETA 5KFNA 4U6PA 4TQSA 4ID1A 3QERA 2WONA 3OHAA 1QE1B 3IGNA 1MU2A 3AO1A 2E6MA 3H5SA 1J5OB 4CE9A 4WYWA 4QPXA 4M42A 5KT4A 1JLFB 4ICLB 2PYLA 1NHVA 3OYNA 2D5RA 3RR7A 4M3WA 2HNYA 3KLFA 2G8HA 3DRRA 4FJKA 2AGQA 4QCLA 4QWDA 2AX1A 1WSIA 5KFQA 1LW2B 3VQ4A 3ZSOA 4NCAA 1XHZA 1TL3B 4CJRA 4IG3B 5C25A 4NLVA 2KFNA 3K59A 2B43A 4O5BA 4FZYA 2JC0A 5DGBA 2X78A 1BQMA 3JYTA 4HYKA 1BQNB 4AHSA 3D45A 4EYHB 2R8GA 1B92A 3T5LA 1NJWA 4YP3A 2C22A 3EZUA 4TY8A 2ILYA 4DL5A 3N6LA 2XI2A 3QGIA 4IFVB 1RBSA 1T05B 1U09A 1TKXB 4HKQA 4WZMA 3V1RA 1HQUB 3BSCA 4KAZA 2XY5A 5KGWA 3DRPB 4CF9A 3RB6A 4CK1A 4J9PA 3KTQA 2FBYA 1HARA 4J9QA 3PX6A 4J2EA 2ZKUA 4IR9A 4G1QA 2KQ2A 4B08A 4Q0BB 4DSKA 1LAWA 2B6AB 1NKEA 3O4NA 5KFYA 1RCHA 3QZ8A 2BQUA 3BQ0A 3JSMB 2HMIB 2IA6A 2AGOA 4MKBA 3BJYA 3GV7B 1NK8A 4MIBA 1CLQA 1K1QA 4HCCA 3QZ7A 3L2RA 4R8UB 4F4WA 1WSJA 3OVNA 3WNGA 4DL2A 2HWHA 3NAHA 4MK9A 4NLGA 3PO4A 2UVWA 4EBDA 1KHWA 3RR8A 4IFYB 3C95A 4M3RA 4FJGA 3I0SB 3NE6A 3BSAA 1ASUA 3M8PB 2F96A 1RBTA 1A5VA 4DTOA 1SV5A 5KG7A 1DTQA 4JRQA 1Y97A 4U7CA 1FKPA 4NLDA 1TVRA 4JV0A 4NZ0A 4RG8A 3NAEA 4CGJA 5L1LA 4CK2A 2OPRA 4NLSA 4EP5A 5KFTA 3OYIA 4E19A 1GOCA 4FLTA 1IO2A 5J1EB 5F9LA 2KZMA 2UUTA 4ED6A 2W42A 4KSEB 2HNDB 1UA1A 1JIHA 1WAJA 1TGOA 1IKXA 1TKXA 4LH4A 1RA6A 4C8KA 2PZSA 4FZZA 3QNOA 4GC6A 4CGIA 2YNFB 4GW6A 3MECB 1S1VB 2RF2A 3DLKB 4MK8A 2XHBA 4KFBA 1HPZA 3MR5A 4F4KA 4NCBA 2B6AA 1WSFA 5KFOA 4DG1A 1Z4UA 3DLEB 3PW0A 4ECUA 3HHKA 1S9FA 3HJFA 5J2MB 3MEEA 4ECTA 3CFRA 1RT4B 1NKBA 1TAQA 3QIPB 3FQKA 2OYQA 5HRRA 4CJPA 1NK9A 2VG6B 1TQLA 4DTUA 3G6YA 2XI3A 3A2FA 3O3HA 1ASVA 1T05A 3H5UA 2DTUA 2VG5B 1Q9XA 4YNQA 2OPPB 3EY1A 2ZE2A 2IDOA 2F8EX 2C2EA 1N48A 4W5NA 4B8AB 3PJWA 2R8IA 4YR2A 3BSOA 2HHQA 2RKIB 3NHGA 3SI6A 5KFGA 2RDJA 3HKWA 4Q43A 4B3OB 3BGRB 1EX4A 4Y1DA 1X9WA 4CK3A 3BQ2A 1A5XA 4YR0A 3NBPA 3WNFA 5KFVA 1IKWB 1D5AA 2ITGA 4BWMA 5J2NB 2R8KA 4PUOB 4OL8A 4ELVA 4RW4A 4O3RA 2DFFA 4E7KA 3TI0A 4I9LA 1U4BA 4EZ9A 2J6UA 2BE2B 1S9EA 4NRUA 2HAIA 2DPIA 3GIMA 5EU7A 3MR3A 1REVB 1CXQA 3SCXA 1FK9B 2YKNA 1QE1A 1HYSA 2ZQBA 3ITHB 4FJ9A 3V6HA 2YNGB 1HYVA 1KTQA 4Z4FA 1BHLA 2RF2B 3MEGA 4DFKA 4KFBB 1RTIB 3KK2B 3KLGA 4ECWA 5KT2A 3AA3A 3CVKA 3AO2A 1TV6B 1L3UA 5J2MA 1DTTA 3QGHA 2B4JA 5KFIA 5CYQA 4DL7A 3ZCMA 3NDKA 2HVIA 4MH8A 2G8UA 3OL8A 3C6TA 5C5JA 1Z26A 4C8OA 1TL3A 5K14A 3IAYA 1TL1A 4WE1A 1TKTB 4DSIA 1XR7A 4BE0A 4WFXA 5JS1A 1XI1A 3NGYA 4CEFA 2AWZA 1YVFA 3RAQA 3U3YA 1D0EA 3KHRA 5L9XA 5L1IA 1JKHA 3I8DA 4PQUB 5KG4A 3E01B 1HJRA 2W8LA 2O4IA 1VRUB 4PA1A 1RT1A 3Q8QB 5KFPA 3V6DB 3I5AA 4Y2CA 1C1AA 4HVJA 3ZT3A 3L3VA 1IKVA 3KJVA 4FBUA 3UPFA 2F8SA 2BGGA 1NK0A 2GBZA 4F3OA 3OJUA 4LH5A 2VWJA 3GQCA 5HRPA 3BREA 3M9MB 3HM9A 3DMJB 5T14A 4RUCA 2YNIA 1BI4B 2QKKA 3KK1A 3MR2A 3OHBA 3VQDA 4CJ3A 1TKDA 4E1MA 4H8KA 3OYBA 4K4WA 4ZTFA 1SKRA 1RT6B 1D1UA 3SUPA 4URSA 1X9MA 1C0TB 4DLEA 1NOYA 1VSEA 1OS5A 4DTXA 3T5JA 4ED7A 3N6MA 2HWIA 3DOKA 2WB4A 4OLBA 4ZP6A 3NF6A 4F2RA 4N76A 3TVKA 4I9QA 1XR6A 3TQ1A 3HT3A 4CGDA 4KPYA 1LW0A 4ZHRA 5KT7A 4J9OA 3KHLA 4B9MA 4PWDA 1VSHA 4W5OA 2HHSA 2FLNA 4KHYA 2XCAA 2V4QA 3LAKA 1LW2A 1S1TA 5DLFA 3ZSZA 4WE1B 1TKTA 4CF1A 3CIZA 4ZVHA 4RU9A 5CZ1A 4IKFA 1RDBA 1BIUA 4K50A 2ATQA 2FVRA 3ZSRA 2W7OA 1VSIA 3V9SA 1U04A 1BQNA 3IG1A 4MIAA 2IAJB
chains in the Genus database with same CATH superfamily
2ZM6J 2WK4A 5DG7A 4RNFA 2IRXA 2GV9A 4JHDA 3MXIA 4OYWA 2NUHA 2W6KA 3R97A 4FWSA 3P4IA 3QJPA 4YOEA 2RUGA 3ZLJA 3H59A 1BISA 2QL9B 3PJXA 1ZC6A 2W9AA 3VAIA 4M45A 4U8YA 1M1HA 4DL0C 2OMOA 2Z57B 3BM7A 1BCMA 2J9DE 4AM6A 1RTHB 1RT5A 1HBOB 3MUVP 3AY9A 2YNHA 2P9NB 2EK1A 4EYIB 3DLGA 2KYXA 5D4NA 1RBRA 2A10A 2KHOA 2E9RX 5KT6A 4ES2A 4Z37A 3FGUA 5SZTA 2UXBF 4ILRA 4OV6A 3LP0A 2V8PA 4DDFA 3NVMA 1YKWA 3VERA 3VQAA 3KHYA 2KTQA 4DQQA 1JLQA 1P1LA 2GMHA 3AA4A 1NAQA 4F67A 1OH8A 3MI7X 3IR5B 3PW7A 2D0BA 4FLUA 1DTQB 3MWBA 5B0EA 4JI5F 4NL5A 3MFIA 4PPDA 2QEXS 2VPYB 4UUXA 4Z7CA 2FJEB 3G86A 2D3ZA 3CCLN 4DX5A 1W2BR 3NMUA 5IS2A 1MA9B 3FKBA 5HL7L 1SC4B 5DQGA 1NGAA 2BQ3A 1HBUB 3SI8A 1U45A 3LDLA 3RGIA 5EY4A 4RWWA 1BG3A 1RAAB 5BYQA 4H4OA 3SIPB 3EGZA 2NPIA 3CJKB 2BRKA 1LOUA 3CO9A 2D3O1 2DFHA 3UCGA 3AT1B 5AQMA 1GLDG 1V5IB 3S41A 3KMQA 1KWMA 1QZ6A 2AJFE 2QWQA 5J1PA 5L38A 4NLYA 5CQGA 4MTPA 3MUTP 1X3MA 1XMOK 2HNZA 3OVAA 2XGQA 3EVWA 2JLFA 3CJ3A 3VQ5A 3IRWP 5ITHA 3PY8A 1M5PC 4TY8B 2BR0A 4BRKA 5JLFA 3KDNA 4WXWA 2RU9A 3OYMA 1N56A 3AVAA 4QPTA 4Y2KA 1Q81T 4JK7A 2UXBJ 5IXUA 4M41A 2J8AA 3OPKA 3OLAA 4C11A 3QFHA 5LJWA 3M7VA 3CDWA 4IUFA 2JWNA 3IR6B 5HRSA 1ZAVA 2DO4A 4KBIA 4DL4A 4HUFA 1F2GA 3KHHA 1JCEA 1RT2A 1QSLA 4MKYA 1RJJA 3D28A 3CD0A 2FBTA 3Q8SB 2YH1A 4KAIA 3D2FB 4G6VB 4W90B 1HPMA 1VOMA 5AJ3J 2A2CA 5JVGL 3W60A 3CCRN 4KH0B 3ZO7A 3M32A 4MKAA 2MB0B 5DMRA 4JI1J 2JH3A 4IYQA 2EFVA 3OD2A 1JLEB 2HEKA 4LBIA 4DR5F 3HK2A 1ITGA 4I2QA 4LF6K 2VFRA 2JVOA 3ELHA 4DTPA 3FSIA 2DGVA 2N7YA 2GNKA 5FRMA 1FHTA 5IM0B 2XY8A 4J9SA 2MLXA 3R5BA 1U0HA 4DTSA 5KG2A 5I4MA 1XWLA 1WNEA 4A8SA 4O4GB 3RBDA 4DV5F 2RNEA 2RSQA 4QR0A 1HX1A 5C2GA 1Y5IB 5EN1A 1NJZA 3FQLA 2DR5A 1NDKA 4J2AA 3ZT0A 4OYMA 1XMQK 4JI3J 5FROA 2XMJA 2QA4N 2W25A 5FLXY 5BXIA 2QJ3A 3L95X 1GLAG 1RSCA 3C19A 1Q1KA 3QWPA 3DLJA 1S6OA 1VRTB 4OJ3A 4OKKA 4YOXA 3IKMA 4AE5A 3SUOA 2VU5A 1O1WA 2OFHX 3CF5Q 1JMTA 3A8KA 2RU3A 2CJQA 4A5AA 2ZBQA 3CCMN 2VQFK 4OHXA 3EEQA 4CZEA 5H9FJ 2PA3A 5IT9Y 3BGFA 3MN6A 1EJ7L 4H4KC 3KUHA 2R7QA 3ZNJ1 4OZLA 1S1VA 4FL9A 1RP5A 3AY0A 2DVIA 1RT2B 4NLWA 3J7YP 4W5TA 4M5DB 2HF4A 4FJ8A 2BANA 1Q86O 4O3SA 3WXMB 2XHWA 4Z4CA 1X3NA 4JKEA 2OHDA 2PEHA 1Q0NA 5TKYA 4ZPDA 2UV8A 3VQQA 4FM1A 1YBAA 1U6FA 1RT5B 1EIYB 2GC8A 1KFSA 1WAFA 2B9WA 2YV0X 2WBNA 4KGKA 3G25A 3EUNA 2NS1B 2NXEA 3H45C 3QMLA 1RACB 4RL1A 3UD3P 3TR8A 1GLBG 5AQZA 1PYOB 3JTPA 1O13A 3K5PA 3KLHB 3HPGA 3UNYA 4DMZA 2Z2LA 3H4DA 3WQTA 1K8KB 1NOZA 1L3TA 3NF8A 3SQGA 2W9CB 2E6LA 2VC0A 3D67A 4CRJA 3RU0A 1WELA 4TSXA 3GJTB 4C9DA 2L9WA 4NO7A 1CQMA 4DR3K 3E9OA 2IC3B 4X65J 1YJWN 4CJUA 5KFDA 3LANA 3OY9A 2BJ7A 4K4SA 1DLOB 3OQ2A 1XNQK 3IG1B 4USTA 5IQ6A 2LXIA 4JS4A 4DR4J 3VQTA 4PWUA 2O8DA 1HPZB 3BPDA 3TVYA 4DSFA 5AFUA 2JEFA 4CHNA 2IRUA 2O8BA 4LFAJ 3OR2A 3W65A 5IT4A 4ZP9A 1IR0A 2WVFA 2HK3A 5CY4A 3CMEN 1V5VA 3CERA 3UCUP 3KKFA 2JNJA 2LA4A 2RRAA 2D41A 1ILYA 3DI6A 3GV8B 1WI8A 2OEMA 4QOTA 1SKSA 4YOWA 1JLGB 2XZTB 2G2YA 3OT9A 1Q8IA 2ASDA 2RHQB 3G71S 3G9CA 3TJ8A 2P9UB 4BC2A 3IC1A 3GR1A 2QSWA 2CPYA 3PJ9A 2UVVA 1LOTB 4KH6A 1HBNB 4RNOA 2F4VK 3R1HA 2A3JA 3HHDA 1X5TA 3I31A 1DEJA 4F50A 1S10A 3C6AA 1APSA 1G15A 3KJQB 3QATA 3K58A 4HACB 3F56A 1ZM3A 3S01A 4FZVA 4WFBQ 3H2LA 1Y11A 2QWPA 3OS2A 3M8SA 4DS5A 1HD0A 2CQ4A 1WJ9A 4CJ7A 3KK2A 3KLHA 2KJWA 2WTUA 5IC4B 2F4FA 1LWFA 1WHVA 2FGOA 4O4GA 4DX8H 1Q5YA 4Y34A 5I42A 4DF4A 5JVHQ 4ZVQB 1RWPB 1DURA 3H5XA 1ZBHA 2XMWA 1VQ6S 1NK5A 4ECSA 4FLZA 4A2AA 4X62J 1IH7A 1FDNA 3KLIB 4IH5A 3UE5A 5AT1B 5HJYA 2OMLA 4WQ5A 3RRHA 4CFAA 2V4JB 2YWGA 1SS6A 4GV3A 2V68A 2MJNA 4JNEA 1FX4A 2ZZNA 3MD3A 2RRBA 3C6UB 2UUCJ 4O23A 4RPFA 4CJWA 1TMJA 2HHHK 5KFRA 1JKHB 4FBTA 5EGYA 4JV5F 4WCEL 3R3LA 3PTWA 1N32J 2MHEA 2IOCA 2NXUA 2VPZB 2WW4A 2XYPB 1PIEA 3CJTA 4Z94A 3HHNB 8ATCB 2AT1B 3W9IA 4H4MB 1YAGA 5FRNA 2W2QP 2KM8B 2VC1A 2JC1A 1HQ2A 4YQWA 4HTLA 3BF1A 3UN5A 4F8RA 2OZMA 2FVSA 1MROB 2GHWA 2QGFB 2WRMA 2YKMB 3KK3B 1U0HB 4ZVOB 3MX2A 2CWKA 1X9JA 2LQJA 3D9BA 4ZHRB 3FFIA 1S5JA 3H08A 3BEXA 2VWKA 1YRXA 3AAQA 1NZAA 4JUZA 4OZ2A 4LD0A 4ZVTB 2ZHBA 2WB1D 5KG6A 4USHA 3FFKB 4R0JA 2X74A 1NHKL 2XMUA 1RHQB 2IDLA 2ZH8A 5AZIB 4BROA 2H1YA 5A8KB 1KQFB 5EDWA 1BLUA 3R7BB 2OSRA 1VQ6N 3HO1A 1VQNN 2XEXA 3L2WA 3E51A 5E3RA 2DR7A 4DR7J 5F0WA 4DQPA 1AZSB 4ECXA 2XS7A 1ZA2B 2HMPA 2HBYB 1LWFB 1TTHB 5ADXA 2HW3A 1X5OA 4GO5X 3CCVN 5I9EB 2XY6A 3S3NA 3R9PA 4HHUA 4LFAF 2RDIA 4JKBA 1VLYA 2BANB 1RYRA 3U6FA 2JEIA 5AQLA 2ROEA 3H25A 4WCEQ 2PMZD 1RDCA 1FCAA 4AM7A 4CQ1A 1RAEB 1WEZA 4ATNA 2G8KA 3OS0A 4C6AA 3CI5A 4K25A 4TU7A 1JQGA 1NU4A 4IOCQ 1RA7A 2H51B 4L73A 3SFUA 2E29A 5AQYA 1FNMA 5IFMA 1I3OB 1F5CA 4LFBJ 2F7TA 2AHOB 2CDRB 4B3SK 2JJ4D 2GUPA 3EPIA 4NZ7A 4NCGA 2ZJRL 1NLVA 2CNOB 2W01A 3FGVA 3JXOA 4DBQA 3OR1A 1UVLA 3NBPB 3OA9A 1ZBSA 1PJ7A 5ADXH 4DTJA 5T7BA 4B9VA 2P9SA 2NZTA 3QFPA 1RAGB 4DPYA 5HP1B 3UKRA 3CDEA 2LEPA 4CH7A 3TA0A 3ATUA 3NF7A 3H7HB 2KH9A 3B6PA 2J6SA 4I2PB 3FBFA 3O8WA 1XJWB 3FEXB 1V3RA 1FRIA 2H5JB 2ROPA 2P9IA 4Z7YA 3NGSA 1Z25A 2XMAA 2W8KA 2D9OA 2KDOA 1EQMA 3B54A 4AH9A 1QTNB 3NWRA 4JI8J 1RDRA 5M1KA 4ZVFA 1K9MO 4MYTA 3CXCR 1HA1A 3LWMA 4IO9Q 3V9UA 3OR2B 4DQIA 4CFDA 3EWGA 4BRNA 4I68A 2HHUA 1BE4A 4H0YB 2BTFA 3HP9A 2AX0A 3MMBA 3VQ7A 2DNLA 1UPMB 3KLIA 4CZMA 2WUSA 3WUHA 3VA3A 1UP1A 2RQMA 1I94F 5DM7L 2O4GA 1XTZA 1FFGB 4HHTA 3GYGA 4F3MA 2GS8A 1O8BA 3QO9B 4NLUA 1T9WA 4I6YA 4PEOA 4USWA 3GBTA 4B3TJ 3OL9A 3ZT2A 1JJ2R 4EK2A 4PY5A 4FP9A 1ZS6A 1RBUA 5FDLA 4DFMA 1N34J 5F8JA 1FDAA 4FOIA 3KUEA 3SQ1A 4NLRA 3FBCA 5EWFA 1NMDA 4S0MA 4YDUC 4RBVA 4YORA 4LF5J 1WG1A 1VSKA 3DRSB 4E7HA 2YKNB 3M9OB 4DR5J 1VSMA 1PAEX 3W66A 2HHHF 5AQPA 3WQPA 2ZH7A 1LWCA 3V4IB 4CF8A 4K4YA 4CLWA 5EUHA 1WOSA 4ELUA 4NLQA 3TANA 1FK9A 3HX9A 1SH3A 2ZH2A 4JK8A 2P9CA 3NOCA 3NCPA 4JI5K 1Y4ZB 3TAEA 3ZZZA 5E3QA 3QLHA 4RUBA 3SSQA 1Q8BA 4AHCA 3RUBL 4R5PA 4C0BA 4FF1A 1TFWA 1QS4A 3I56S 3PUFA 3JYTB 1KFDA 2UYTA 4L3QA 4LF9K 3LM2A 4KREA 1AT1B 1NNEA 1X5SA 4ZVSB 5C24A 1GNKA 4X4VA 3BP8A 4RW8B 4FJXA 3OYHA 5C10A 1KVCA 2GCFA 3QINA 2GGPB 2ZGYA 3Q89A 4FWLA 1F9HA 2ZH1A 1PILA 5CA5A 2VWBA 2NRXA 1ZOTA 1W2IA 4K8RA 4DR3J 1W97L 1N4LA 2LKZA 5FDLB 2LSNA 2XULA 2E2PA 2UXDF 3BZQA 3ZEUA 4DFPA 1E6VB 3K17A 2K1RA 1QZ5A 4YB7A 3AXKA 4FVMA 2P9PB 1CZBA 3KVGA 2UUAJ 2DH7A 4F4XA 3T6JA 4CHPA 1NK4A 1J5EK 3SFGA 3DRSA 3IM8A 3BF4A 1U49A 5ETVA 1C0TA 3OYDA 4TLRA 3U8XA 1SIWB 4DUZF 3IRXA 1R0BG 3DYAB 3LWLA 2XB2D 4X84A 1X31C 4DU3A 3CM6A 5BRHA 3MDFA 3SQ0A 3GIJA 3NCIA 4IQXA 3CNQP 4IR1A 3AVGA 2CWXA 4IBNA 1WOQA 1YITS 3QIDA 4AHRA 3VGVA 4B3TF 4KHQA 3WIUA 3N79A 4I6AA 5D4OA 5AE3A 5CABA 1RT7B 2OELA 2Q3PA 3P45B 3HZGA 2H65B 1WACA 2UUBK 2CGKA 3MMCA 5C24B 4A8QA 1GT8A 5L46A 3TZXA 4ECVA 1FE0A 5DM7Q 2VDHA 4FPAA 4OYAA 2GQQA 2MJUA 3CCTA 1AROP 4JHDB 3TEHB 4HL9A 4MFBA 4KC5A 1NRKA 3O9QA 5CYMA 3G87A 5B0GA 3KK7A 4WIQA 4YB1P 3TSQA 2HZCA 1QQOA 1R8HA 5K8OA 3F41A 1V4SA 1FT8A 1YJUA 4U9RA 1RISA 1BL3A 3CCJN 2FHJD 1D9AA 4F0HA 4CEAA 1RTHA 2DR9A 1VQ4N 2I0XA 4NRTA 3R7SB 4LFCJ 3HOTA 2MKCA 4BDZA 4C48A 5LMNK 3QT8A 2DNNA 1EP4A 1GX5A 4Z0UA 2E8AA 4DSLA 2Z0GA 1E4FT 4GVMA 2EPIA 3CTRA 3OFGA 3EDRB 4M3TA 3SCJE 2K8GA 4DR6K 2D0OA 5GAHU 3QEPA 2HGNA 4JOUA 1VC0A 3CYMA 3NNAA 2PO4A 4I7FB 3LM9A 1IWGA 1HQEB 4DU4A 2LFVA 2MKJA 1OQ6A 3UQSA 1KLNA 2Q0RA 5KFJA 2CUYA 1GMWA 3UKUA 1R31A 4JI3K 3CJ8A 4OZNA 4CJ4A 4HDGA 5JLHA 1S9GB 4DTRA 4CLTA 2VKZG 3IS9A 1CJUB 3CPWM 1PBAA 1P8GA 4KQZA 2V8VA 4IJAA 1DBDA 2BE2A 1FX2A 3K0JA 2P9KB 3LPEA 4V19J 1N8RO 3HHEA 4DUYK 1LFWA 5D0HA 2VQFJ 1REVA 2W4CA 3SBMA 3BBFA 3W9HA 3HSCA 1NGIA 3VQBA 2J9EA 1HFEL 1QHTA 2IA0A 3SPYA 4K2JA 1PO6A 4WP8A 2UUCF 4OZ3A 1SI9A 3RRKA 3UCZP 4CJTA 1HWKA 3PKMA 1UJ6A 5B8HA 2V8HA 3OTDA 5IZHA 3Q2TC 4GVBB 2E88A 3FVYA 2MQOA 2JDJA 1CEZA 3UB5A 4CM2A 1B9DA 1XNRF 1TELA 5ETQA 4NI2A 2CQIA 3PFOA 3OXGA 4ISFA 4XO0A 3ENVA 2KN4A 4DV5K 2QTWA 1E6YB 1XNQF 1VSFA 5KFFA 2I5JA 3CB4A 4HVZA 2UUAF 1RT1B 5KFWA 2G2OA 1NJIT 4NYZA 3GMGA 4NE9C 2OUGA 4CLKA 3ILOA 2OD4A 1UA0A 4N47A 1NJIO 2FHJA 2KFYA 4C3LA 4FS2A 2M8HA 2R7VA 2YNIB 1Q53A 4JI4J 5GAHP 2DEJA 4KB0A 2XBPA 4DQSA 1UWBA 2XMTA 1MNEA 1U1RA 4ID1A 3VEVA 4QIWD 2QYCA 3M1VA 5DDOC 1MU2A 2L48A 1NSQA 2E6MA 1Y64A 3CD6N 2CAJA 4QPXA 9RUBA 5DZ7A 2MY7A 2L3MA 1HBMB 1MROA 4M3WA 3ZZYA 4DU8A 2V2KA 1SJ1A 2ZWPA 1FW6A 3LDOA 1TU0B 4LF7F 2AGQA 4QCLA 4QWDA 2RQCA 2AX1A 4PKIA 4IOAQ 3JAMU 2F63A 3ZSOA 3J7AN 2IDEA 2V63A 5C25A 4P7VA 2AF6A 2CADA 2B43A 4FZYA 2JC0A 2X78A 3J7YI 4EFHA 3HULA 4HYKA 3C15A 1B92A 2VCPA 2ZEJA 3Q7BA 1QAXA 4DL5A 2A6MA 2JX2A 1RBSA 4M8LA 1U09A 1RHJB 3BKFA 3V1RA 3CJSA 2F65A 4KAZA 1O51A 1LCUA 2M8DB 3OW2M 4CF9A 4F04B 3HFKA 4J9PA 3CD5A 4J2EA 4USIA 2BJ3A 4UOCA 2P9LB 2HVEA 4KGVB 3SXLA 2M2BA 2P9EA 4DSKA 1LAWA 3DXMA 1VQ9S 2XZWA 3U02A 1KAZA 3E9LA 3QZ8A 2BQUA 3BQ0A 2HVDA 3JSMB 4O8KA 4JB8B 4MKBA 3GV7B 3EKSA 3IMXA 3W9JA 1KOHA 2DK2A 2CH6A 4ES1A 4R8UB 4F4WA 2E7XA 1M5HA 3CE8A 3NAHA 3I32A 1UTAA 3UO0A 3ILJA 4EBDA 3UE2A 4CP5A 2VFTA 1GXTA 2B9YA 3NE6A 1ASUA 4B1ZA 3CF5L 4DTOA 5KG7A 4JRQA 5CCMA 3R5DA 3TJAA 1IQTA 3NAEA 2IYIA 1HKCA 3CJQA 3N4QA 4BQZA 4CK2A 3C7NA 1UWAA 3CMAS 2I7NA 4CO5A 2W41A 5KFTA 4U67Q 2VICA 1IO2A 1GOCA 5J1EB 4MLHA 4DX6A 4RO0A 2HNDB 5K8NA 1TKXA 1WORA 4LH4A 4HLBA 2LYVA 1OH6A 4I69A 1B64A 2F1FA 5KOWA 3F5TA 4OJGA 4CM0A 4MK8A 3DXKB 4NCBA 2B6AA 5KFOA 3PW0A 1FFWB 1S9FA 3HJFA 3NRBA 1RUSA 5BR8K 3O2IA 1YGYA 1SC6A 3C16B 4WQ4A 3WX8A 2VASA 1P8ZA 2VG6B 1TQLA 3G82B 2XI3A 3A2FA 4F02A 4NXMK 3O3HA 4QZVB 2GVDA 1Q9XA 1RADB 2MLYA 2YQ0A 4EI2A 2C2EA 1EZZB 1IBLF 2RKIB 1FJEB 2MQ8A 3CJ9A 2P5VA 4P9SA 4B17A 4B3OB 4USKA 4Y1DA 5HQMA 3K2YA 3NBPA 3WNFA 5T7LA 1UW4A 2ITGA 3WQUA 3DCAA 4FKXA 3CQXA 1FF2A 4OX9K 2R8KA 4DX7A 4KHPK 4MYUA 1FNXH 1S22A 4JKGB 3IUCA 2EEYA 4RW4A 2HFUA 1VQKS 4E7KA 3TI0A 2N7CA 4I9LA 2J6UA 1S9EA 2DPIA 2V8DA 5EU7A 2YBVA 4A8FA 2GTDA 2OSQA 1Q16B 3HFVA 1WUUA 3M2UA 1HYSA 3ITHB 5H1SQ 1C4CA 3BN4A 2YNGB 5DRKA 3QICA 1YJ9N 5G0RB 1R59O 1RTIB 3KLGA 4ECWA 3AA3A 2DGOA 5GAGI 1DTTA 2B4JA 4DL7A 5CYQA 4YY3J 1EWQA 4ZCLA 2AZ1A 3J7AP 2DHSA 2ZFHA 3HHLD 1TL3A 5BJRA 1TKTB 2LU1A 3R6MA 5HVGA 3Q22A 4BE0A 3MMBB 2NRTA 2RQ4A 4CEFA 1CJKB 1D0EA 4FKYA 4YHHJ 2FZCB 4JI3F 5L1IA 2B4OA 4JKFA 4PQUB 5D15A 1NGEA 4FVUA 5KG4A 4XTTA 2NZ4A 4PHTX 2O4IA 3A13A 3M5RA 5B0CA 3V6DB 1UETA 4ZS6A 1IKVA 3KJVA 4FBUA 2K7JA 5DZ6A 1NK0A 1Z1ZA 4MT1A 3GQCA 3GCXP 4RUCA 3KG4A 2JFKA 3VF2A 3MR2A 4J37A 3M2RA 4OZ0A 1KQSR 3OBWA 4E1MA 2V34A 1D1UA 1NBEB 3CJAA 3J81O 4DLEA 1B3TA 2QA1A 1F1BB 4LC9B 4LBHA 3QAEA 3K89A 4O8UA 1U2VA 3OFHA 1PKUA 2Y8YA 3V5RA 4ZLPA 4JI1F 2FC9A 3L4BC 3H8YA 4YDDB 4F2RA 1XMBA 4X4PA 1URNA 2XZDB 4HT7A 3D0GE 2H3EB 4CGDA 1LW0A 1OPIA 4ZVUB 4ZHRA 3OHRA 5T7LB 1KQSM 3R7NB 4ZLNA 3GTYX 2CJYB 2HHSA 3HSJA 3QBWA 2XCAA 1LW2A 1S1TA 1KTVA 5DLFA 1G99A 4PKDB 1WC5A 1EHWA 4CF1A 3WX4A 3HCXA 4ZVHA 2CPHA 4JI7K 3MM8A 2DHHA 4MDBA 2MSTA 1C4AA 1KAYA 2V94A 1VSIA 4DB3A 3V9SA 1BQNA 4JI6F 3IG1A 2KVQE 4MIAA 4RNMA 2SXLA 1Q82O 1WEYA 4B3TK 2R7XA 2XC9A 4A57A 3CCSN 3NWGA 5LMUF 3MD1A 4KBOA 3ALYA 1X1PA 4XEIA 1EQ0A 3LTOA 3O80A 2R8HA 3T1YJ 3PNIA 3DLKA 3DGVA 3O08A 4YOUA 3FJ2A 4BVOA 3VAGA 4U96A 1IJJA 3P1GA 2EBGA 2JL9A 3DXMB 2NCKL 4GKKJ 2GA7A 1VC6A 2KW4A 3ENWA 3ENHA 4M94A 2BW2A 4FLWA 3LGHA 1F5AA 3J7YU 2WHOA 4B02A 1P27B 4OHYA 4D3HA 5E3CA 1ZM2A 1RWUA 2OLWA 1JXEA 2RE2A 2AKWB 5CYJA 2CPIA 3ULEA 2PEBA 1QLNA 1T9XA 4DV6F 3CCVS 2WTFA 4OPJA 2E1CA 2Z1JA 1HI8A 2ZD1B 5D3GB 4R0EA 4LF9J 1UVMA 3IS9B 2B5JA 1OMSA 1U2CA 5KAKA 1JJ4A 1RQ0A 3GLJA 3CJBA 4DUTA 3MPDA 5AQSA 2DNZA 4I2PA 3R2CJ 3IO1A 3IMQJ 1JLEA 2NXNA 3E9PA 1JNZB 1SB6A 2CZ9A 5KG5A 3ZZRA 1VQ7S 3I87A 4FZXC 4B9NA 4FYXB 1C0UA 1KBRA 2AYMA 2NSBA 4W92B 3SLCA 4UOHA 3J80O 4QOZB 3KWIA 5A0YB 4L3KA 3HZEA 4QS8A 5DM6Q 4PG6A 4U7UD 4RWXA 5AQTA 5AQJA 3WNHA 2W2MP 3HPHA 3CEDA 5FLXU 3SSRA 3QT7A 5L1KA 2AD9A 2ASLA 5F8HA 4OPHA 2J6TA 5HBMB 3GZ7A 1K73O 3D3CJ 3LP2B 1PBUA 4FWNA 2NRHA 3MWPA 3QGGA 3DN9A 4LVNP 4OYXA 4DV1K 4LF4F 2HVZA 2NSCA 3A0IX 3NH2A 2WVEA 3DU5A 2BYCA 3SJHA 4P6QA 4WFAL 2B3TB 4DV3F 1K8AT 4DR3F 3MCAB 1K8KA 1EB0A 2DYAA 4M7YA 4G3IA 3I5CA 3A5OC 3THPA 2CJBA 3ZZUA 5C7PA 2MGZB 1TUUA 4FCYA 2VDIA 2R7SA 4WIIA 1U1OA 2VBWA 3QRPA 3M05A 3RW6A 3BKUA 2RPIA 4MIWA 3AVBA 2FLLA 5KQ8A 2QX0A 1I39A 4U7UK 5DK5A 3NOGA 1TK5A 3DDIA 3FFIB 5IT9O 1RI7A 1VS3A 1LWCB 3V4IA 1J5OA 2UVUA 3G8SA 3RB3A 1JCFA 1R8BA 2IHR1 2XSJA 4WF9Q 3M2VA 1RK8A 3ILIA 4FVCA 1S77D 4AILC 4LF4J 3ZTSA 5AZIA 1YJ7A 3GFHA 2OPRB 2CQHA 4BE1A 1FWKA 4OV1A 2JEJA 3U7JA 4QYRA 4OJHA 3TVZA 1XN9A 5IT0A 3PIOQ 3ZYYX 4DSJA 4M1KA 1WC6A 2XG8A 1S79A 4DZDA 1NM1A 4FYVB 5IT9U 3HKZD 4A8WA 3BGUA 2P9GA 5EX3A 3THTA 2DXDA 1XNRJ 3DRPA 5HMXA 2B9XA 1FKOB 4OYZA 3ET6B 3G96A 4IXCA 5EHHA 3MX5A 3OLBA 1SXLA 4DJBA 4DV2K 3Q86A 2FBVA 3K8WA 4J90A 2MGZA 2VFVA 2XSFA 1C1BA 5HAOA 1KC8O 3QESA 4U7BA 2N4CA 2EFQA 3PRBA 2P5GA 2ACMA 2PT0A 2VD3A 4ZMMA 3POTA 6FD1A 4MMOA 2VKRA 4KHWA 5CE3A 1C2PA 5FD1A 4KKOA 1MU2B 1UJ5A 2I8EA 3UKUB 1R0AB 3ILLA 2J0SD 3T1HJ 4ICLA 2Z1GA 4RJVA 2ZHAA 1KAXA 3RZAA 4OVLA 1YVUA 3CFPA 3HP6A 3VAKA 1N8RT 2XLKA 5I42B 2EG2A 2BMBA 3KLEB 3MMCB 3ULDA 1NGFA 2A41A 4IRKA 5L8RC 5LY3A 3ZFVA 2QKBA 2DCUB 4WFYA 4F4YA 2YTCA 2HNDA 5HSPA 2IVPA 3EZWA 1M1GA 3BGOP 3LALA 4QWAA 5AE2A 5AQUA 3SYZA 2AP1A 1V6HA 2KM8C 2QW9A 5ELZA 4Z2XA 4W5RA 4JI7J 2QMWA 3ET6A 4KHPJ 2XS2A 4WPAA 5MAOA 1NG9A 1TV6A 4FJNA 1KRPA 4HI1A 1OH7A 2IVNA 1S7HA 1Q79A 1TYQB 4CF0A 2PI5A 4MJKA 1MG7A 1ZAXA 3ZEUB 1KEKA 1JJHA 4KI4A 5K8PA 1OY8A 2ALZA 4B1XB 5HQ8A 2P9PA 1SH0A 3K57A 4JI6J 3G0ZA 3HF5A 5F0XA 1KVJA 4H4MA 3RBEA 1RAHB 2DHXA 4CZLA 3MZIA 3MM9A 4UQTA 3RW7A 2KB2A 4I67A 5C42A 1R43A 2AJQA 4C8MA 1M5KC 3CIMA 4FW2A 4TNOA 4N8NA 3L4IA 4ZP8A 2QXFA 2B8QA 4M63A 2HBMA 1GLEG 3JTNA 3FC9A 1RTZA 3NH1A 3I0SA 5K8MA 5GMEA 5J2PA 1LV5A 1VCTA 5D6GA 3WC0A 2D4WA 3OXFA 3G6XA 2OTLN 2PMHA 4AXIA 2O8EA 2GHVC 3H40A 2RVJA 4KJIA 3G10A 2NRRA 4JD2B 3MAAB 3PM9A 1HNIA 1DHMA 3A8JA 5CHCB 3OYLA 4OMFG 4USVA 4DV1F 3CG7A 1V3ZA 1RILA 1F0XA 4F4AA 3I6PA 6AT1B 5ETRA 5KRTA 3MXJA 1TL4A 5JMNA 3OUYB 3N28A 4HUEA 1EETA 5KFUA 3HHLC 4H5RA 1HI1A 2AV5A 3SAFA 3T5KA 3S3OA 1WNSA 5LXRA 4MAKA 2DFEA 3U1LA 3QIPA 4L3NA 1L3VA 2UUCK 4BBYA 1WOOA 1VQ4S 4LT6A 4L74A 4C8NA 3DM2B 4RZRA 3NXZA 3MN9A 2A2DA 3S9HA 3ASMA 4PWWA 3PR4A 2MSSA 3N6NA 4F0MA 3G2XA 5DG8A 2RKIA 4GV6A 4XK8C 3GILA 2UUWA 4CD3A 4CEQA 4O4RA 4EO6A 4OI1A 2W24A 3PHTA 2ZH6A 1WOPA 4USMA 3D1OA 1Z2ZA 3HHLA 3L7UA 1J9AA 5DM6L 2CQCA 4BDYA 4X4TA 1FO1A 4JAXA 5HLFB 2FY1A 5KFKA 3F9KA 3OL6A 5IWAK 3DMJA 1KLMA 1EQYA 3PRDA 3IRXB 2UU9F 4M5IA 3QMQA 2MTLA 5JVHL 3HD2A 2P9KA 4LIRA 3H2UB 4F25A 3IWNC 2LQ9A 4UY85 4H4KA 3VN5A 5FJ4A 1G1XA 4BG8A 1S0MA 1U1QA 1R0CB 1WSHA 4ISGA 4JKCA 5LJVA 4J9VA 2CDQA 4WKYA 2LQ5A 1UKUA 1PC5A 2VF3A 4CJSA 2VPXB 3ONQA 1QVGR 3HXMA 2IM2A 3VQEA 2FSKA 1N52B 4XPEA 4BR4A 1I94J 4KV8A 2W7PA 4KGXB 4LF4K 3WZ0A 1QM9A 3OBIA 2GJ2A 5KFAA 1BQMB 4JKDA 1HKBA 5LMUK 4RW6B 5AR0A 2UZAA 3R3TA 5A8WA 2WVCA 3BR9A 4DCJB 2E5LF 1N33K 2IAJA 2WOMA 3EXCX 5D4PA 1IVZA 4DR1K 1V4TA 2KG1A 4PQUA 3DXKA 1FKOA 2V69A 5C12A 1OVYA 1U0SA 2K1RB 1FWLA 1DQAA 2M52A 1Q8KA 4DPOA 3DLBA 1Q4RA 3CPEA 1NPKA 2YNHB 2DGUA 1BUPA 4G1QB 3C3LA 2QLJB 4NMXA 2EX3A 1KLMB 2MQPA 1BD6A 2ZH3A 1YIJS 4RU2A 4FW1A 2V50A 3CIPA 4RTFD 1B0TA 2VFSA 3CCQN 2RHKA 3MMVA 3GCWP 5A2QO 1S5ZA 1WSGA 3LGNA 4LR7A 2WONB 4XH5A 3MM9B 4BC5A 2R7YA 2XO7A 2EC0A 2YHXA 4ZVEA 2V9KA 3FZ2A 4LQ9A 3E8OA 3J8AA 4OHVA 3PO5A 4MKVA 3JAMY 4CD1A 2FSJA 1S0VA 1RT7A 2ZNZA 2YKAA 1SQKA 1NEEA 3HZ6A 3EVMA 3HVRA 5LXYA 3N9UC 3RB4A 4V19S 2CG8A 4EBEA 4PABA 5DLGA 3DOMB 4CZHA 4B3MF 4FWMA 3FRZA 2QM1A 3AVFA 3HLUA 1X5PA 5L1JA 4IDKA 1A5WA 1A6LA 2V0NA 2AJ1A 2DH9A 3AVJA 3MHYA 3OYCA 1NNDA 5JS2A 3LAMA 2DPJA 2YKMA 3WEEA 3EO3A 5I3UA 2HK2A 1YRTA 3MFHA 1X4DA 2OI2A 3FDSA 4OLOA 4O3QA 4ZLJA 4CEDA 1TKZB 1PG5B 4OI4A 2W9BB 4BVPA 4O3NA 1IJEB 1RBAA 1M1KO 2QV6A 3QGPA 1DTTB 2XWYA 2BKNA 5F3ZA 3T5HA 1HW8A 2JRSA 4DPUA 4ZKAA 1S1XB 3A5LC 5K14B 2KRRA 3BDPA 2BE9B 2RILA 5GAGP 3S6EA 3P38A 4DR2K 2LDIA 4ZN3A 2CJAA 4FS1A 3RVCA 3T9NA 3BSNA 2QRRA 5FPMA 2P51A 1K1SA 1RE1B 2F8TA 3AAWB 4X64K 5D0GA 4JI6K 5AZJA 4KE5A 2RS8A 4Y65A 2UUBJ 2CQPA 4CNYA 4DPWA 2R2UA 3JAMO 5BREA 4C7QA 1TZ0A 4RW9A 3OW2R 3C66A 5H9EJ 2E5GA 1IG9A 4I64A 3AVKA 1SV5B 2DGTA 2DNHA 1F9FA 2CPZA 1VIOA 4NEYA 4EGLA 4TU8A 5LM7E 5J2QB 3AVMA 2HLUA 5F8LA 4E3SA 2AQ4A 1AA1B 3DWLA 3MXMA 2D7SA 1YF5L 4FWQA 1JL1A 2HQCA 4QWEA 4Q8EA 3GV5B 2JSXA 5KT3A 9ATCB 4RR5A 2HF3A 1EO1A 2QL5B 4PCQA 5BPNA 3I0RB 4Q8FA 3B6OA 1QQMA 2CJXB 1HKAA 2EFPA 3KLGB 1ZZNA 2WSCC 4EAHD 3MCOA 4DHVA 4DXLA 5HATA 4A8XA 3B6BA 3LDPA 1N5TA 3J80U 2L41A 5I3UB 2V5HG 4FPIA 3PX4A 3B8AX 1X4GA 4M5MA 1S4FA 3IBWA 2UP1A 2J8SA 3NNHA 1HHSA 1S1UB 3NCRA 1VGYA 4J7CA 2N3OA 3V6DA 4OPKA 4I56A 1Y3KA 2OCEA 4UOFA 4PR6A 3QFWA 3A8EA 2MKHA 2Y3YA 1RTJA 1QUPA 3TO8A 4K0KK 2HS4A 2ZJPL 5KG1A 4OI0A 4AFFA 4F2SA 4M5DA 3L2QA 1FNOA 4FJMA 2BABA 1KD1O 3UVJB 2EK6A 3B78A 3KJVB 3Q8UA 1N5VA 4ITSA 4DV2F 2NRVA 5JUMA 5E3AA 3UNGC 2VQFF 3AOAA 4JKGA 3LDNA 4WYBA 2QA2A 1S6PB 3MPVA 1F2HA 4K0KF 2VG7B 3MMAA 1C0FA 2F4VJ 5C15A 1SQFA 2G0CA 2H5IB 2D74B 3HPOA 4OZ5A 2Q36A 4N41A 4KHPF 1OVQA 3KLEA 4H5WA 1XC9A 3MR7A 2YPYA 1VJQA 2PD1A 3EYZA 3DAWA 4KHSA 1U2RA 4XH4A 3MEKA 5CYQB 3FCVA 1KQGB 2BRLA 4N8OA 2E1YA 4LFAK 1RTDA 3D3BJ 4M5GA 3T1AA 4OX9J 4EHUA 1IBLK 2C1EB 2LQ8A 2QMXA 3NKYA 3VGSA 5TKWA 1FKAF 3OJSA 3M8QB 3CD7A 1JLBB 1ZBIA 2EVZA 3T19A 1IUJA 4DV4K 3V6JA 3ADAC 1SJRA 3C65A 3EN9A 4Y2MA 3G8QA 5B7WA 1FI4A 2CXEA 4OLPA 1UL3A 1VQ9N 4DN0A 2B4UA 5E7OB 3LF0A 1RLDA 4WYLA 4ILGB 1JLCA 2XY7A 4R5PB 4FJHA 2RD5C 4ZTJA 1UEVA 3I5BA 3NLCA 3WXLA 4UY8T 3HVAA 4XPCA 2JWLA 1JLAA 2HHWA 3D6HB 2J9CA 2YX6A 3KK1B 2R9LA 4FJJA 3AA5X 4I6MB 1GLFO 3LP0B 3LPYA 3MF5A 1N36F 2IBKA 3DLHA 4C1NK 4IO8A 2IGIA 4DV6J 3VEZA 2C28A 4KB1A 3CW2C 3JSRA 3TRGA 3MAQA 2V2VA 4GC7A 4CJLA 2HBRB 2DNQA 3O6QA 3SUNA 4FNIA 1VQ8N 4DOZA 2B51A 3TUIC 2GQ2A 1LW0B 4K59A 2C2OB 5E33A 1H98A 2GWKA 5MLCQ 2RIJA 4PWDB 4CJEA 2GV1A 5B0BA 4W4MA 2MQLA 4B1WB 1FRXA 3RBZA 2OKQA 5E26A 1EARA 3HL8A 2IMOA 2CJKA 1VSJA 3MM6A 2XYHB 1Q9YA 2A18A 1SCJB 1F60B 4TQRA 3LA0A 4PXBA 3WNEA 4RCHA 3GIRA 2FJVA 3Q8PB 1Y10A 5A0YA 2ZM6K 3CCUN 4RW7A 1SIZA 1HRHA 5LJ5Y 1Y00A 4DWIA 1I3AA 5IWAJ 5ETKA 4HTUA 4FPBA 2ZC3A 1NGHA 4FK4A 2HGMA 2G1DA 1W0HA 4HUGA 1HHQA 4AUKA 2XMKA 1MSWD 1RWOB 1RBVA 3SV3A 2FDNA 2Y1IA 3H20A 3MCNA 1H7XA 3RWUA 2DNPA 3UD4P 1GLLO 1ZTWA 3FEYB 1ESVA 2HFSA 3GIKA 3CCLS 4DR2J 2H3GX 4RNNA 4PXDA 3TTCA 2Y0SD 5CD4A 3RTVA 2GX9A 2ZVSA 2ZDPA 2BEFA 2J9DA 2IS3A 2C2DA 5ETPA 1SL1A 1T95A 4ZVGA 3T1YK 4B1VA 3AD9C 2KHDA 1S4EA 3H46O 2JEGA 1WSEA 5HVFA 4EZ6A 3CCZA 1RWMB 4O55A 4DR6J 3ZSVA 2P1JA 1VQ8S 3QETA 2X1FA 3QRRA 4RWTA 3AJ1A 3C7NB 3QERA 3OHAA 1CPZA 1QE1B 2QLWA 3IGNA 7FD1A 1UPPA 3AO1A 3C6HA 1J5OB 2HPUA 4WYWA 1JB0C 3OXLA 1NMNA 1JLFB 2PYLA 1NHVA 3OYNA 1D8ZA 1BC6A 1NH8A 1IBMK 4DV0K 1N33F 2E5LK 2ZGZA 4FJKA 3JXUA 2QMUB 4WU2A 3QRQA 2MZTA 5KFQA 4NCAA 1L3KA 1TL3B 4IG3B 2KFNA 3W7BA 3I55S 3K59A 3C2PA 5IOLA 2EKYA 1T9VA 1RHRB 3D2WA 2D69A 1BQMA 3HM8A 1LK7A 4AHSA 3MDQA 3D45A 2ACYA 2R8GA 1NJWA 2I2YA 4YP3A 1NSKL 1LNQA 3G82A 1W2BM 2ILYA 2CNKB 3JQKA 1WF1A 1T05B 1VQ5N 2YJEA 3J81Y 1HQUB 2UXCJ 2XY5A 5KGWA 1HNWK 1CJVA 4BGAA 3G6EN 4WF9L 5RUBA 3BH7B 5F3TA 1HNXJ 4RBTA 1Q81O 1WC4A 2FBYA 3PX6A 5A8RB 3GSDA 2UUBF 3BPSP 1J6ZA 3PIPL 2CA9A 1KOOA 4CZCA 4Q0BB 2Z58B 3L09A 5KFYA 3O4NA 3OVSA 1HR0F 3FE1A 2QLBB 2IA6A 2AGOA 1Q7LB 4MIBA 1K1QA 1RB0A 3QZ7A 2RB7A 2HWHA 1JWWA 1IJFB 2CRLA 1YLXA 2G0JA 1Z6RA 4ZJLA 4PQAA 3PO4A 3NMRA 2UVWA 6FDRA 2OTJN 1KHWA 2MPUA 4CTAA 4AQYF 1NSPA 3MOZA 2GO9A 5EOYA 3CC7S 3M4XA 4OQJA 4FJGA 3I0SB 3BSAA 5M1QA 3M8PB 2F96A 2YWEA 1NLKL 1O6XA 3THYA 1T9YA 3L7OA 2R7WA 1DTQA 1J5EF 2AP6A 4U7CA 2ABYA 4NLDA 3ZTPA 2BA9A 4NZ0A 5HL7Q 1VQOS 3M1FA 3W2WA 4CZFA 3H3OB 2OPRA 1RBLA 3TUPA 2AMCB 4EP5A 3LUYA 4C8YA 1FVSA 2KZMA 1WAJA 1WSVA 1IKXA 1FFSB 4ANEA 2XQCA 3H2VE 1CJTB 2MMYA 1A9NB 2CIMA 3CO0P 4GC6A 2VONA 3I33A 4GW6A 2ZKTA 3QBCA 2Q79A 4HEA9 3L7PA 3N4WA 2HQIA 3OTCA 1WUAA 4KFBA 2PSZA 3JSBA 4LF9F 2KG0A 3O8MA 4C97A 4LBPA 1WSFA 4DG1A 4JI0K 3I4HX 3KUGA 4PG4A 1A0OB 1SBRA 4H0VB 5A6PA 3MEEA 2FD2A 1NKBA 1IWAA 4LIWA 2DEIA 1KVKA 1TAQA 1OKJA 2NXJA 3SMZA 4MO5A 3G71N 2CPXA 1NK9A 3FR0A 2FTRA 2AJ4A 3HRGA 3A3OB 3WDOA 1RGVA 1Y5NB 3JS6A 1GFWB 5I3QA 3PKYA 1T05A 4Q2MA 3K0SA 2DTUA 2IJRA 1CJKA 4YNQA 1NGGA 3W5XA 3EY1A 2IDOA 4W5NA 4DV7J 3PJWA 3BSOA 4PXCA 3SI6A 3MN7A 4PG5A 1R8CA 4Q43A 1VAZA 3OBYA 1E6VA 2E7VA 2VIHA 3BGRB 5C2CA 2R4FA 3BQ2A 1A5XA 4YR0A 2Y0BB 2RMLA 3J80Y 4NXNK 3FZLA 4BWMA 2O67A 2HYIB 4PUOB 4BGBA 4CI6A 3A5NC 3AJDA 3VF4A 2M70A 3D54A 2BVZA 3BYRA 3SSSA 3ZETB 2KXFA 4YEAA 1N32K 2HQGA 1REVB 3IWXA 4WTOB 1W7WA 1R3NA 2NNWA 4K5SA 3NS6A 3TX0A 4FJ9A 2NLWA 1U1KA 3KXDA 2IYGA 1HYVA 1RU2A 4C23A 1VBXA 3H3NO 4E1JA 4DFKA 3I9V9 3NNCA 2XSJB 2FXUA 1XMOF 3FEZA 1LK5A 3L3CA 2Z2ZA 3CVKA 2H4WB 3AO2A 1TV6B 1U8WA 3CJ1A 5BRDA 2X3GA 4FPRA 2Z56B 1HNWJ 2HVIA 3NDKA 4MH8A 1IR2A 1HNXK 4DV3K 5C5JA 1Z26A 1XK8A 4ED4A 4OJ1A 3UFCX 2Z2MA 1TL1A 4WFXA 3NGYA 2BJ9A 3Q7CA 4DV4F 3RAQA 3U3YA 4NLCA 4KRWA 2NREA 1BWEA 4CLFA 3KHRA 3L9ZA 4H5VA 1ATSA 1JKHA 4G65A 3J81U 3DNCA 3E01B 1HJRA 3EMTA 2W8LA 4BR9A 1E4GT 3Q8QB 1PYTA 3HDSA 5KFPA 3ZT3A 3L3VA 2Q2RA 2F8SA 4IEIA 2GBZA 2NYIA 3ULEB 4FSVA 3TJ9A 4P71A 2DJWA 5T14A 2YNIA 1MMNA 1U8SA 4CJ3A 1TKDA 2RQKA 2DY1A 1DARA 3OYBA 1YHQS 2F9TA 1RT6B 3R6GB 3EZOA 4LRCA 2HURA 4URSA 1X9MA 1C0TB 2M5YA 4V19X 1NOYA 1S99A 2K06A 3C14A 1OS5A 1RCOB 4DTXA 3T5JA 3N6MA 1DT9A 2JZ5A 2HWIA 3D6TB 3GG1A 3CETA 3NF6A 1DGKN 2QA4S 2J7KA 4YY3F 3FZFA 4UZBA 4JKHA 2EWHA 4PYDA 4PPZA 2CPEA 4I9QA 3HSZA 3TQ1A 2JVRA 2QLFB 3SQGB 3C46A 2MDAA 4B9MA 4PWDA 4WFAQ 1X4EA 2V4QA 4IO1A 1TKTA 4DV1J 3E2EA 3CCMS 3CIZA 7AT1B 5CZ1A 4CIOA 1RDBA 3UI3A 4K50A 3ZSRA 2DCLA 2RDDA 2IAJB 3IAS9 3TX8A 3CC2N 5G0RA 2M88A 1HW9A 3QEXA 4C98A 4IRCA 1HBUA 2LDYA 5KFEA 2P6TA 4C11B 3OS1A 4IOBA 3MPUB 1VBKA 3B8HA 1YK9A 4P10A 3OYEA 5EX5A 1RHMB 1WHWA 2MKSA 3IM9A 1X4FA 5AQWA 1RABB 4C3KA 2OEKA 3H42A 4WU3A 4KHUA 3O1BA 4YDUA 1RCXB 3O3FA 4M3XA 3BGLA 2HSEB 1JLAB 2G8IA 3GJQB 4WTYA 5KFBA 1F9EB 1W25A 2HLTA 4J9MA 3BEGB 2BDPA 3LP2A 1PCAA 4PYAA 2FPHX 4FJLA 4I7FA 1NCLA 1D4XA 1BOTO 2BJ1A 2ZNYA 5E84A 3IAM9 4JLHA 4FYYB 4DN9A 3M6XA 2Y8WA 2KU7A 1Q18A 4GRSA 4H5TA 5AXKA 3PW2A 3D2FA 3EKUA 3ZSXA 2OFGX 2BOAA 3BV8A 1Y9OA 4K7QA 5D78A 4JV5K 2DNYA 3QEVA 4JI1K 5J1EA 4BR0A 3MAAA 3J7ZT 2D0CA 2DIUA 1VHXA 2DD8S 3JS9A 1IKXB 3GIIA 2HNYB 3GE9A 1KQKA 3OSPA 2G13A 2M4MA 2YX4A 3JQJA 3CQ8A 3KHGA 3DRRB 1HKGA 1NDPA 1SC1B 3LDSA 2HBQB 2YH0A 4CIGA 3W1YC 1LEOA 4KTZA 3LZIA 5F8MA 4X4SA 3D5MA 1ZTTA 1RT4A 5KG3A 1YI2N 1OIAA 2Y1JA 3FCWA 4O0JA 1ROFA 5BYSA 5DGAA 5KFSA 3O5TB 2FHOB 2M7SA 4CGFA 2COLA 1M5OC 3POTB 1SL2A 4X65F 2FHKA 2EI5A 2CQ0A 1BA0A 5M1FA 3UIQA 2DGSA 2DGWA 1N33J 4AHTA 1RTJB 3QFUA 3A8IA 4B3RF 4XDCA 2PMWA 2QA4G 3NGZA 2IM3A 1XNQJ 1H7WA 3P5TL 4C3MA 4FDFA 3RAMA 1FE4A 3S8SA 3TAQA 2APOA 4I0WA 4DV7K 3P49B 3VTHA 3VEYA 1S1WA 1YG0A 4KO0B 1ZAWA 1MLAA 2LVWA 3VQ9A 4M5KA 2HGLA 4JRPA 5E0OA 2IC3A 3MTKA 2M3DA 4DV4J 1XC3A 1OSCA 3NCQA 4FYDA 5GAEU 1PC4A 4E89A 1IBKF 3P39A 4P2XA 5DDPC 3BY5A 3MK6A 3VQSA 3PHEA 1T03B 5KOXA 4DLGA 4QU7A 1BA1A 5GVQA 4DL6A 3ETOA 3BO3A 2H48B 4IRDA 2VODA 1YUWA 1HMVB 5D0EA 1NGDA 2PC6A 4DEZA 2AZ3A 4A8MP 2J7UA 3BBCA 4GVBA 2Q66A 3O1WA 2HG4A 1RDDA 1GK8A 3IDHA 1BO5O 2FVCA 4OKEA 1GXLA 4CFCA 5C25B 3A4TA 1HNZF 1C0MA 2ILZA 1GTHA 3CJ2A 1Q82T 3X1LB 3O3GA 4DV3J 4G1IA 3OTOJ 1HQUA 3MUMP 2HHPA 2F9DA 3PYGA 3CJ5A 2Q6BA 4NXMF 4KGMA 2G8WA 1GX6A 4E7JA 4IFVA 4X66F 1J54A 3QNNA 1YJVA 4WZQA 1JLCB 2CPDA 4WFZA 3LZJA 1XHXA 3TR5A 1YJ9S 4Q5VA 4RBUA 1T7PA 1MMLA 2F9WA 1FDDA 2HHXA 2GW8A 5HJXA 3ULHA 3NY0A 2WSEC 1VQLN 1CULB 1FXRA 3OL7A 3HI0A 1BIZA 4LQ3A 2GVDB 5M1PA 1WKJA 2HWTA 1SL0A 2FC8A 1FRHA 3M1VB 3US5A 3ZXWA 2X1BA 3AXMA 2UU9K 3VESA 1T8EA 2FLPA 4X64J 4KH4A 2DHAA 5D8HB 3PRVA 2VG7A 2PY5A 3IBFB 1T9UA 4LFBF 2V7YA 5KPTA 1CZ9A 3VGMA 4JEPA 4WKRA 3AODA 4OGCA 1FA0A 1FWPA 3EE8A 3NGRA 1JX4A 1H72C 2RS2A 2AYBA 3O9UA 4OI6A 1X4BA 2JLEA 4OYBA 2HRUA 1GMVA 1YT3A 3CM5A 4NOHA 4NYFA 2FB0A 3D6RA 1RT3A 3RSEB 3FLCO 2L9DA 1CZAN 1LXJA 2GELA 2HFVA 2HB5A 4TKTA 7FDRA 1FERA 1R8PA 4IG0B 3ISNC 3K5MA 4KR0B 4NEZA 4LSLB 2Z8QA 3W2VA 3ATVA 3AQOA 2HVHA 3C6UA 1C0UB 4LF6J 3O9SA 5E2QA 1SAZA 2PFUA 2W4DA 3P96A 4ILLA 2LLZA 1GOAA 2A5XA 4WFBL 3VVTA 5FLXO 4YHHK 2YY3A 1FD8A 3S7RA 4Q0BA 2MQQA 3O6WA 4CFBA 4TYBA 2G2ZA 2EFOA 4OX9F 3L2VA 2W6LA 2Q31A 2Z2YB 3H4BA 4LY7A 2ZJQL 1SH2A 4K4ZA 3W64A 4OYOA 2FVQA 1VQLS 1NZ8A 3HVTB 4ALZA 4R79A 4A48A 4AT1B 4UOGA 2OPPA 1HQEA 1B70B 1I94K 3THWB 2UXCF 2ZUGA 3QQCD 4ILJA 4B1YB 1TAUA 4HH0A 3TUZC 4CJKA 5E41A 3CWJA 5JXSA 3BGRA 1S0OA 4LF7K 3DHWC 2X1AA 4DF8A 2XRIA 4B9TA 1FXLA 1HUXA 4YMEA 3VQ6A 2F9JA 2HHVA 5GAHI 1N32F 2Q3SA 1VQPS 3OYFA 3HVWA 1CSJA 3R1XA 2GO8A 4LRDA 4M5JA 4P2SA 2CNLB 2VBZA 2XLJA 1AW0A 2OA8A 1VSLA 2C2MB 1H3DA 1R0AA 2B7CB 2VOOA 2HZVA 5F8NA 4NA2A 1RTIA 3CGIA 1J53A 3DXBA 2P2CB 3VCDA 4YS2A 3CSKA 3I82A 2R8JA 3G4SS 4O44B 1IQZA 3AD8C 2AU0A 5BPLA 4PXEA 2YWKA 4X4UA 2QL7B 1J5EJ 1OQ3A 2P8IA 2DB1A 3Q8RB 4QWCA 4FM0A 4CVNE 3SK3A 4IH6A 2KT5A 4Z4IA 1K6YA 2OPSB 3W63A 5CHIA 3A1YG 1MWQA 3SQ4A 2XGPA 2NXCA 3HFZB 1IBLJ 2E9ZA 3M3ZA 3I4PA 4JP8A 1GLJO 3HVTA 2IM0A 4DU7A 2B4PA 5I3PA 3EL2A 4OYIA 4DUZJ 4I1TA 4Z4GA 1T9TA 4ID5B 1EKRA 1TUGB 2QWNA 4YHHF 4FLYA 4AL7A 1BCOA 2PGCA 3PIPQ 2EXUA 1RNHA 1YJNS 3GDQA 5KFXA 2J5AA 4V1Ak 5THWA 2HOEA 4O0NA 4FN5A 1HWIA 1H38A 4ZVRB 2YX7A 5D4LA 2CJ9A 2P5OA 1BWFO 3T41A 5L39A 4RW4B 2ZVIA 5HP1A 1F3VA 3BBBA 3DGPA 3WC2A 4QWBA 2IVFB 3P31A 4JK9A 1P9YA 4B3SJ 4PG8A 3NGIA 2VGMA 4U67L 3WIVA 1FRLA 1AXQA 4CECA 1WI6A 3AVNA 3VF0B 1VQNS 4WP3A 4LREA 3CT9A 4X62K 5JICA 3CDAA 2DRDA 3CDUA 1ZETA 1IBKJ 2A3ZA 1E3MA 2D9PA 1H2UX 4I6WA 1NGJA 4CGGA 2VBYA 4DR1J 4LF2A 3AARA 1WF2A 3P5JA 4QBUA 4CHOA 3OTEA 2AGPA 1VHFA 5M2PA 3LP1B 1KVAA 2NR0A 2LQBA 1Z05A 4CO4A 3CCWA 2HBLA 3MM5B 4FJ7A 4BC7A 4ID5A 4CO0A 2E9TA 1NO8A 5GAEI 3MWTA 4LF5F 4ZPBA 1FEEA 3NL0A 1HWUA 2R2SA 3DDNA 4TY9A 4LSNA 5HLFA 3N5FA 1XMQJ 1LKZA 2W2PP 2ZZTA 1RAJA 2PFFB 2QIFA 1BI4A 4CHQA 2VH7A 2ATLA 3O4QA 3VGKA 3GFZA 4CEEA 5HBMA 5J2QA 2QE5A 3M30A 4UY8O 4DU1A 4RNHA 2DH8A 3KK3A 1EKEA 2BQRA 4ZOSA 1HWJA 3AB2B 1UFLA 4P72A 5HMYA 1JLQB 1QD1A 5GAGU 1NB7A 4DCPB 3QO9A 4JI2F 2VJUA 3VQCA 1VQ5S 4J9NA 1ICEB 1OYDA 2ZBCA 2EHGA 3V1OA 3U27A 3P3DA 5AQNA 3IN5A 4KO0A 4CO2A 2A1RA 3L4QA 4NASA 4CBWA 4U95A 3THYB 1BUXA 4CF2A 2YHYA 1HHTP 3O9RA 4RUAA 3MM7A 1NHUA 4RKUC 1S6QB 5KI6A 2VQEK 4NX9A 3Q83A 3VQPA 4CLPA 4ANDA 4AL5A 3MM6B 4R25A 2OPQA 1FJGJ 4ZCKA 3K5LA 3I55N 5CYMB 2PBDA 1TMMA 4CYUA 2MKIA 4IH7A 4H5NA 3QPIA 3KD5E 2DNRA 4MQ3A 2LCWA 1BGXT 1NJYA 2VB6A 3MR6A 4EU0A 2ZOFA 4JN4A 1UJ4A 3T1YF 1GOBA 3UD5A 1HMVA 3KNAA 4NA3A 1V9OA 2GVZA 2C3OA 2RE1A 4ED2A 2H9ZA 1QQCA 2UXDK 5CAAA 3PVXA 1RWNB 5M2UA 3SNNA 4MDAA 2F4VF 2PIIA 2XTJP 3SBGA 1S49A 5LSOA 4FM2A 3BF3A 3MEDA 1H6KX 3DDKA 3TAFA 2HMIA 2HNZB 1HL6A 1ASWA 4J9LA 4X65K 4OX7A 4BWJA 3CJCA 1Q95G 2BOPA 1FRKA 3M6VA 4DPTA 3N0VA 2V4JA 2P6SA 1JL2A 1MMDA 3PG9A 1N36J 4CIEA 1KVBA 5KPZA 2K2PA 2EKNA 3MURP 4OZ1A 4KHNA 3TZZA 2G4BA 1XEZA 3TARA 3AV9A 1S9GA 3F2KA 2QEXN 3C0BA 1IKWA 1AUDA 1M90T 1X9SA 3VQ8A 1WKLA 4CEOA 3Q8VA 1C1BB 3ETMA 1HBNA 3FNNA 2OTJS 2YKQA 3MM7B 1TUWA 3TABA 4RUHA 4ED0A 2XWXA 2MQMA 4X4QA 4CO3A 4N5SA 4B9UA 3IFRA 1RTDB 4ZVPB 1U26A 4ECRA 1XUPO 4IO9L 2JGUA 3T7ZA 4LRAA 4F9OA 1Y0HA 2AYGA 3AVCA 4I2QB 2BM0A 4LF7J 1ZBLA 5ADZA 2MEWA 3DYAA 3W0LA 4LVOP 2WAQD 3GPAA 4H03B 4BE2A 2G0IA 4CJ5A 1TUVA 2J0WA 1YTUA 3U3GA 4UT4A 2QWMA 3MEGB 4FK0A 4BS2A 1SUQA 2I38A 4EWTA 4JV2A 5B0DA 3UN2A 5HROA 3MOJB 4GO7X 3P4UB 1ZZFA 3MEEB 4AHVA 1DKGD 4ENOA 1T3VA 1RKIA 4EUVA 2OPSA 4CEZA 2EBEA 4IOXA 3QIOA 1RAIB 4KRFA 3IFEA 2E1PA 2NUUG 5AE1A 1WN7A 2YQ1A 4MO4A 4RW6A 1EXQA 1EWRA 1D09B 3V81B 4PKGA 4YN3B 2FC0A 3AAPA 1IKVB 2CG4A 2R7UA 5IV4A 2AJ2A 3R5CA 1U24A 1QAJA 4CZKA 2BX6A 1RDAA 3MAHA 4B3OA 3CMAN 4BY9C 4KTQA 3ZTRA 3ENAA 1YJWS 5EX0A 4DUZK 2PN6A 1RGIA 3SDEB 5J2NA 4E7IA 1YITN 4JKAA 2OH2A 3U1NA 1B9FA 4BQLA 1M0SA 1WDTA 4TYAA 5E3PA 1Q7YT 2KKHA 4F4ZA 3OSNA 3DOKB 1R8AA 1QSYA 1L3SA 3GWCA 4LR9A 1Q7YO 5IM0A 3DLRA 3OYAA 3W5ZA 3H98A 3A8YA 3R2DJ 3EGVA 1YXQA 2RN2A