3IS9A

Crystal structure of the hiv-1 reverse transcriptase (rt) in complex with the alkenyldiarylmethane (adam) non-nucleoside rt inhibitor dimethyl 3,3'-(6-methoxy-6-oxohex-1-ene-1,1-diyl)bis(5-cyano-6-methoxybenzoate).
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
554
structure length
554
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
molecule tags Transferase/hydrolase
source organism Human immunodeficiency virus type 1 bh10
publication title Crystallographic study of a novel subnanomolar inhibitor provides insight on the binding interactions of alkenyldiarylmethanes with human immunodeficiency virus-1 reverse transcriptase.
pubmed doi rcsb
total genus 134
structure length 554
sequence length 554
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3is9A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3is9A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3is9A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3is9A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3is9A05
2HNDB 4FJJA 1D1UA 4DSEA 4EP4A 5F9NA 4CF9A 2IJNA 4ELTA 4IFYA 1RDRA 4CGJA 4IRCA 4Y2CA 1SL0A 3MEDA 3V6DA 3DLBA 3C6UA 4CEZA 2OPRA 4E1NA 4IRKA 4CJFA 3BGRA 4KREA 3H98A 1U49A 1S6QB 3QIPB 3NGZA 3DI6B 3ITHB 3NHGA 1SH0A 4YQWA 1DTQB 4KAIA 3BSCA 3KK1A 3AVBA 5KT3A 2W9AA 4WFYA 3MEGB 3LP1B 1TL3A 2W7PA 4CJKA 5E41A 4C8MA 1NK8A 3IN5A 3H08A 1JLGB 4RNMA 3LP1A 4J2AA 4OL8A 1XI1A 2Z1JA 4KPYA 3UR0A 2J6SA 5KG5A 5KT5A 2VG6B 3SV3A 4URGA 3HPGA 1KSPA 3TABA 4ED8A 3OSNA 3DLRA 3AVJA 2I1RA 2W9BB 3ZSQA 2WTFA 1LAVA 1VSJA 3BSNA 2F8SA 2GBZA 4Q5VA 4KV8B 3QLHA 4N47A 2G8WA 3HP6A 4Y1DA 2J6UA 3OS1A 1WNSA 1JKHB 3MXIA 4W5NA 3HSTB 5KFGA 3DRSB 4M94A 4KHYA 1BL3A 3PO4A 3DOLA 4DQPA 3ZSRA 2OA8A 3ZCMA 2XRIA 3DMJA 2IC3A 3MECA 3P83D 4EYIB 3SI6A 4DL6A 3AVFA 2E9ZA 2FBXA 2B4JA 2D0CA 2OZSA 3ZSZA 1RBUA 1C0UA 4R5PA 3JYTA 3I5BA 5KT6A 1S9EA 1A5WA 3NFAA 1QQCA 4NRUA 1N4LA 2PYJA 4J9LA 1UA0A 4OJRA 2D3UA 3PY8A 2FJVA 3F73A 2VG7A 4FLWA 1S6PB 5I42A 3AVMA 2D5RA 2R2SA 1ZTTA 3EZ5A 3GIIA 2OPSA 3ZT2A 3CJ0A 3AVGA 4CJVA 2FLNA 1S9FA 4FYDA 4ZVGA 1RDAA 3CJ2A 1S9EB 5J2NB 1TVRA 5KFUA 3PHEA 2BGGA 5JUMA 3SPZA 4B9TA 1EP4B 1C1CA 3KJVB 2XCPA 3DOLB 3T5JA 4EZ6A 4Q43A 2DFEA 1LW2A 3DLHA 3LP2A 4WZMA 4G1QA 4B9NA 2F8EX 2C2EA 3H5YA 1NJWA 3OYJA 4DF8A 3V6DB 3GIMA 3CFPA 3QNNA 2KTQA 1RT7B 1ASVA 3TAMB 4Y3CA 1G15A 4GC6A 2BR0A 5DK5A 3HT3A 2B5JB 2HNDA 5J1EB 1TKXA 3E51A 1VRTB 2R2UA 4ZPCA 3OSPA 4Z4GA 3SZ2A 3V6JA 1LWFA 4HCBA 4CERA 4QCLA 3VQ7A 4KO0A 4H4MA 2VG5A 4ZMMA 1S0MA 1TL3B 1SUQB 3DLGA 1TAUA 2D7SA 1IO2A 3M8RA 3KK3B 3EYZA 3FRZA 2ILYA 4ID5A 4CHOA 2XY6A 3M8PA 3OYMA 2G8HA 3BGRB 5KG3A 2FVRA 2ALZA 2C2DA 2ETJA 4ICLA 4NCGB 1C0MA 4NRTA 1U47A 2O5DA 2R8KA 1J9AA 3FQKA 1KHVA 4ZPAA 5KFIA 5KFJA 1S1TA 2VG5B 4FM0A 3V6HA 3OYKA 4K4XA 3TANA 4CJUA 3OYDA 4I9QA 4B3OA 4OKJA 3RR7A 1HYVA 2B5JA 4TYAA 4F4ZA 1Z26A 5KFEA 4JUZA 3IS9A 1RDBA 3O4QA 3UQSA 1S97A 4DQSA 1BQNA 2IMWP 3DYAA 3NH0A 5C42B 3V9XA 3TAQA 4JS4A 5F8JA 4Q0BB 1NJXA 3FSIA 4NCBA 2IBKA 3V9UA 1IKXB 1XR6A 4XO0A 1RT6B 4KB7A 2G8VA 3ZSVA 5HLFA 4KKOB 2JEIA 5HLFB 5KTQA 1EETB 5I3UA 5CYMA 1KLMA 3LPUA 4IH7A 3EY1A 2KQ2A 3I5AA 3PW5A 1RT7A 1NOZA 4NLOA 3MXJA 1S1XB 4CCHA 3HVTA 2PZSA 4DLEA 5KFHA 4H4OB 3ZSWA 4BE0A 4R8UA 4FJIA 4WFXA 4OLAA 3T19A 3MECB 2IC3B 1S1UB 5C5JA 5HRRA 1C1CB 3KJVA 1SV5A 4JS5A 4C8OA 3KIOA 4DS4A 3S3MA 1TV6B 2FLPA 2RPIA 3SV4A 1RA6A 1RT5A 2RF2B 3OJUA 2P5OA 3VQCA 4CK1A 5KG1A 3DLEA 1WSJA 1RCHA 4FXDA 3OYIA 1TKTB 3OYEA 5DLFA 3VA3A 4Z0UA 5KFXA 4QW9A 4AHTA 4O4GB 4GW6A 2BRKA 5SZTA 4CJEA 5EWFA 2I5JA 3NCIA 1LWEA 1JLCB 4H4MB 3RBEA 4DL2A 2HHSA 4CIGA 4O3SA 1LWFB 3NGIA 1QTMA 4ED1A 4QAGA 2PYLA 3CYMA 4DTOA 3M8QB 1TL1B 2X78A 4DSKA 1S6QA 5J1EA 4YP3A 1T7PA 2JEJA 1HQUB 4PUOA 4FLTA 4NYNA 2OZMA 3T5LA 2V4QA 4DSIA 5C24B 2R8HA 4RW6B 1U45A 2Z1IA 1UAXA 4DU1A 4ID1A 3I8DA 3LP2B 4EO8A 2YNHA 4Z4CA 1I3AA 2KW4A 3SNNA 4C8LA 4JRPA 1KHWA 1OS5A 5CYQA 5KFWA 3B6OA 4E89A 3T3FA 4FVMA 4K4WA 4MIAA 4O0IA 4ZTFA 4O4RA 3RMAA 5L1KA 4N5SA 3ITHA 3K5LA 3CFRA 4DEZA 3L3VA 2FVQA 4JLHA 4ZP9A 4TN2A 3NF6A 4TY8A 1RILA 2UVWA 4DSLA 4J9OA 2XO7A 3C6UB 5HROB 3H5XA 2JC0A 1TV6A 3H5SA 1IKWB 4KFBB 5KFKA 3ASMA 3AVKA 4AH9A 2UUWA 4FJXA 2E6MA 3PVXA 4IDKA 3OHAA 4TSXA 2ZE2A 2IDOA 4TXSA 2IGIA 2IJFA 1T3NA 4IKFA 4FJGA 4LSLA 2ZE2B 1RTHB 3IGVA 2WONA 4EZ9A 4OVLA 4CHZA 3PJXA 4H4OA 3HVRA 5KFSA 1GX5A 3I0RA 4J9PA 1WN7A 3HVTB 4CIFA 1S1XA 5KT7A 3TAPA 2O4IA 2R7YA 3K5OA 4MQ3A 1BIUA 3MF5A 4ECVA 4RW7A 2R8IA 4XPCA 2XHBA 4M3RA 3AO3A 3DRPA 2IM3A 2W42A 1L3TA 4EEYA 4MH8A 4N56A 4OKEA 3CWJA 1JLCA 4HUGA 1JLGA 5F8IA 4M3ZA 1WNEA 1WSEA 4F3TA 1B9FA 3SQ0A 3AO1A 2DPIA 4QWBA 3DYAB 3H2LA 4J9NA 1VRUA 2UVVA 2HNYA 2V4RA 1HMVA 1ZBHA 1BISA 4F4XA 1RTIA 4NLYA 3SUQA 3ZT1A 3L8BA 1Y97A 2YHBA 1KRPA 2OPPB 1RTDB 1J5OB 2QK9A 5HP1B 1IKVA 1S10A 2Q3SA 3PX6A 1HNVB 1IM4A 4E19A 4ECYA 4IKAA 2UVRA 1NHVA 3ZT3A 3V9SA 3KLHB 4ED3A 1SL1A 5KFFA 4ICLB 2V0NA 3AA4A 4E7KA 4CFDA 3GYNA 3IG1A 5CYMB 4IOBA 3CG7A 2WRMA 1N48A 3KK3A 4DTJA 3DOKA 1NJYA 4IFVA 3Q8RB 2IM2A 5L1IA 3LDSA 3NE6A 4HHTA 2BE2A 4Z4HA 3QEWA 5CZ2A 4KE5A 3CJ5A 3M9NB 4M3TA 3OL7A 3KMQA 1ASWA 5JS2A 3KK2B 4KHSA 1TGOA 1JLBB 2XY8A 3PV8A 4IR9A 1S1UA 3AV9A 4PA1A 4Q8FA 1RT1B 3TAEA 1S1WA 1QE1B 3BQ1A 4DG1B 4BDPA 4QWDA 2EHGA 4ECSA 2AJQA 4CJ5A 3P1GA 1CLQA 3S3NA 4CJ3A 4F8RA 3ZT0A 3BSAA 3IRXB 2ZD1B 3M9MB 4JRQA 5F8LA 2C2RA 2IA6A 2EX3A 1EP4A 4W5RA 1JLEA 3KK2A 4I2PA 3VQDA 3GIJA 3BDPA 1D9FA 2ASJA 2GIQA 4B9MA 2I5JB 4WXOA 1NK9A 1KCFA 2RN2A 3NGDA 4IFVB 3KLIA 3QZ7A 4WFZA 4AHSA 3SFGA 1JLQA 3M8PB 3I0SB 3ISND 3T5HA 2G8UA 4G3IA 2HW3A 5J2QA 1ZYQA 5DG8A 4M3YA 1T03A 2VG7B 5D3GA 2X74A 4ZP7A 2HVHA 3KLHA 3G6XA 4J2EA 3AVCA 2JGUA 4FLUA 1UA1A 2FBYA 2OPQB 1HNVA 5F8NA 4Y34A 4L8RB 4B08A 3CVKA 3GV7B 4AHRA 3QGIA 1NKEA 1GX6A 2P5GA 4RNFA 1TKXB 5KGXA 2R8JA 2C28A 3SCXA 4R8UB 3MR3A 3KHGA 2HNYB 4K4TA 4FJ5A 4FJ7A 3QLHB 4WYLA 5EWEA 1RDDA 1VRUB 3N6NA 4R0EA 2WCXA 1S9GB 3NAEA 1RA7A 4LD0A 4ZHRA 2HWIA 1LW2B 4RUAA 4QWAA 2BQUA 4NLWA 4ECTA 4F3OA 2Y1IA 4I2QB 4YR2A 3Q8QB 3DLGB 4I9LA 4E3SA 1NK0A 1SUQA 3BQ2A 4FJHA 4MFBA 1FKPB 1RDCA 5J2MB 2QKBA 3SI8A 2AU0A 1JIHA 1WAJA 4HTUA 4NLSA 4KKOA 4DU3A 1D0EA 1FKPA 1LAWA 1L3UA 4ECQA 1QUVA 4O3OA 3N6MA 4CGGA 3MR2A 3AVHA 5KG2A 1B9DA 4ZVHA 1X9WA 4B9LA 3U3GA 3V81B 4CGDA 2W8LA 4DL5A 2VA3A 4J2BA 3CM6A 4CEQA 4W5TA 1XR7A 4E7IA 3MEDB 5KFRA 4CF2A 4CGHA 4IQXA 3I0RB 3B6PA 1J54A 4CEEA 1C0UB 5HBMA 3JYTB 1I39A 3VQQA 1RNHA 3AA5X 3KNAA 4CFCA 1D9DA 1SKSA 4O55A 4FM2A 4DL4A 5CZ1A 1VSKA 3SJJA 2UUTA 3MR5A 3OL8A 1U04A 2B6AA 4CJ4A 2G8KA 2XI2A 5KFMA 1ZTWA 3K59A 4KFBA 1JL1A 3G86A 3OYLA 3V4IA 3VQ9A 2YHAA 3PX4A 4FJ9A 4ELVA 4RNNA 5HROA 1RTJA 1LWCB 4H8KA 4HCCA 4FJLA 1L3SA 4KI4A 1JLAA 2W9BA 1HPZA 2UVUA 2QE5A 2KFZA 1QAIA 1C1BA 3IAYA 3QYYA 3OLAA 3D5MA 5KFBA 2DY4A 5KFTA 3OL9A 1S0OA 4NYFA 2J6TA 3SQ4A 4NLQA 2YKMB 2HHQA 1UWBA 2QXFA 5F8GA 4LSNB 4GVMA 3OHBA 1VSDA 2ITGA 5C25A 3DRSA 3KTQA 1S1VB 1CXUA 4BE1A 3T5KA 3NH1A 2JEFA 4EBEA 5FDLB 3MXMA 2JEGA 3TARA 5KG6A 2AX0A 5KFPA 3KKSA 3HM9A 3WNEA 1N5YB 2R2TA 4KHMA 4DU4A 3M8QA 1KVBA 1Q8IA 4FJMA 3OS2A 5K14B 3EZUA 3TQ1A 3NBPB 4Y2AA 3E01B 5KT2A 1JL2A 4FBTA 2FBTA 1B92A 1RT2A 4CGFA 3SUNA 3N6LA 4NLDA 3CM5A 4B8AB 2BQ3A 1KTQA 3GQCA 3KLGB 1VSMA 2R8GA 1K1SA 4OPKA 2WK4A 2RDJA 4ZHRB 4OKKA 4FLVA 4J9QA 3DLEB 5DGAA 2HHUA 3V4IB 2XGQA 5KRSA 4R5PB 4CGIA 3H4DA 2E4LA 1XHZA 4DFJA 4ZPDA 4I7FA 1HNIA 1DTTA 4TQRA 2HHTA 3NF8A 2GIRA 4Y1CA 2WOMA 4W5OA 4LY7A 4J9MA 5KFAA 4Z4IA 5EWGA 3M9OB 1RT4B 1RT1A 3I0SA 3TR8A 3D0PA 1TKZB 4KB0A 5I3UB 4ECRA 3GILA 4F4YA 3CFOA 1HQEB 3OYNA 1F21A 1NKBA 2A1RA 1VSLA 3KLFB 4EP5A 4FK0A 4CK3A 3MAQA 4MFBB 1X1PA 1REVA 1IKXA 4BWMA 3RB0A 3OLBA 5T7BA 3KLVA 4HYKA 3F9KA 3P5JA 3DI6A 2ZD1A 3A2FA 3LPTA 1D5AA 3PW7A 4ZVEA 4DFMA 5KFCA 4BE2A 4F4KA 4B9SA 1BQNB 4FBUA 4CHPA 4O3QA 1X9SA 4O3PA 3IS9B 4O44A 2GV9A 4KI6A 1DTTB 4IFYB 3BR9A 2HB5A 1YT3A 2WONB 2YNFA 2CKWA 4LH4A 2D3ZA 3ULDA 4LH5A 1ASUA 4RNHA 1RBRA 2F8TA 3LZJA 1ZBFA 4C8KA 4YFUA 5KFOA 5DG9A 4DF4A 3MFHA 1S1TB 2BE2B 1KLNA 4MKBA 4ECUA 4MK7A 2P51A 1S48A 4CJTA 4CHQA 1T8EA 2HMIA 3HVAA 2BANA 3JSMA 2ILZA 1RBVA 3G0ZA 3KHLA 1RYRA 5F9LA 1REVB 3FFIA 3RTVA 2B43A 2XCAA 4O0JA 2PY5A 2W7OA 3U6FA 1SKWA 3LAMA 3SYZA 3MFIA 5KT4A 4AHCA 3NBPA 4RU9A 1MU2A 3RAQA 1HARA 1HQEA 4FJ8A 3DRPB 3DM2A 1VRTA 2YNIB 4MK9A 1RTIB 4MKAA 2FLLA 2Z1GA 4TLRA 1FKOB 4DFKA 1YTUA 3M8SA 5J2PB 3KD1E 1X9MA 3CJ4A 3BREA 4FS2A 4J9SA 3KMSA 1XR5A 4FJNA 1IKYA 4KRFA 4QWEA 2KFNA 3EPIA 2IAJA 3L2UA 1GOAA 1SH3A 3UPFA 5KFNA 1S0NA 3LWLA 3QGHA 3RB4A 5DQHA 3NL0A 2BQRA 1HJRA 3QEPA 4K4VA 4URQU 1HPZB 4KHUA 1RT4A 2AGOA 1QSSA 4MIBA 2YNGA 3KLEB 4N41A 5KG7A 5FROA 3CIZA 1YVUA 3RMBA 1S5JA 1L3VA 3QO9B 1HNIB 5FRNA 2G8FA 1ZBLA 1ZBIA 2WHOA 3E01A 3OYCA 4CEFA 4CJLA 5K14A 2IM0A 3D28A 2VWKA 3OL6A 2FJXA 5FRMA 3HPHA 2IAJB 1S49A 4QPXA 4QWCA 2V9WA 3VQAA 1QS4A 1RAJA 4KV8A 1IH7A 3ZSXA 4M42A 3VQSA 3V81A 1FKOA 4Q45A 3HPOA 4FLZA 3V9WA 1TL1A 2HWHA 2D0BA 1UWBB 1NK4A 2YKMA 3CDUA 5KG0A 3K57A 2VG6A 4YR3A 4EYHB 4DMNA 3KHHA 4KHWA 3DDKA 4HVJA 1RT2B 1C6VA 3C6TB 1ZETA 4H54A 4GC7A 1ZBUA 3C6TA 1A5XA 4CJPA 1QSYA 1Q9XA 3CDWA 1DTQA 5JXSA 1D8YA 1CXQA 4KHNA 3H59A 3MEEB 3QESA 3SQ1A 4Q0BA 5EDWA 4DTUA 3OYGA 4DTMA 2X6SA 3IGNA 3QINA 4CJWA 3SPYA 4E7HA 1RTJB 2OPRB 3HL8A 4CE9A 1W9HA 5F8HA 3OJSA 3TAFA 4ECXA 4PWDA 5J2PA 2VWJA 4RZRA 4BWJA 3AVIA 4X2BA 1HQUA 1DLOA 4KTQA 4JV0A 4LSNA 4E7JA 2LSNA 4RW8B 3TWHA 3PW0A 1C1AA 4IH6A 4DSFA 3UIQA 4IDKB 1FK9A 3KD5E 3SUPA 3VA0A 1A5VA 4Z4FA 4EBCA 1IKWA 3NDKA 3RR8A 2XY7A 1KFDA 3FFIB 1CZ9A 4NCGA 2FVCA 4DTSA 2DPJA 3ZSOA 3FQLA 3PUFA 1JLQB 1JXEA 1Q9YA 4DLGA 3V1QA 1VK0A 1W0HA 2A1SA 4CEAA 4DWIA 1EETA 1Z4UA 2GUIA 4N76A 3WNFA 4K50A 4ZVFA 4O3RA 2HNZB 5CY4A 1QSLA 4URSA 3RB3A 1YTAA 2Y1JA 3SQ2A 4LQ3A 3VQEA 2B6AB 1XC9A 2KZZA 1WSIA 3AA3A 4TQSA 1K1QA 2EC0A 3LP0B 1HYZA 4DSJA 5HBMB 4FK2A 1LW0A 4RW6A 4F2SA 5C24A 4DL3A 4FZXC 4Q8EA 1LW0B 4M95A 1KVAA 4IG3B 1T94A 1NK5A 4G1QB 4DG1A 4ZP8A 3SUOA 4DL7A 3DLKA 1JX4A 2Z1HA 2AWZA 4RW9B 4QOZB 4B3OB 1QAJA 4Z4EA 4IG0B 4FW1A 3L2WA 3K58A 3O3FA 5EU7A 2XY5A 2X6NA 4M3XA 3I5CA 3TVKA 2BDPA 4DQQA 1LWEB 1T05B 3NF7A 4YNQA 3BSOA 1VSFA 3H5UA 4DTNA 2AGQA 2OYQA 3LALA 3PW4A 1VSHA 3OYBA 2HVIA 1QHTA 5DQIA 3VQ8A 4ID5B 1U09A 1S9GA 4NLVA 2YKNB 4JV2A 1RT5B 2RF2A 4CF0A 1BQMA 2IOCA 1J5OA 3EPGA 2OPPA 2XC9A 1S4FA 3Q8PB 4CEDA 4KB1A 1VSEA 3NAHA 4NLPA 4RW8A 2E6LA 5KGWA 4B8CA 4HKQA 3RBDA 4YR0A 4XPEA 2YNFB 1JKHA 4CHNA 4KSEB 1HMVB 2R2RA 4M45A 5KFVA 1BCMA 4CJRA 4PWDB 4NLGA 4O44B 3BJYA 4DQIA 3PR4A 3CO9A 2HHWA 3LP3A 2E9TA 1L5UA 1XWLA 4WXWA 5J2QB 1S1VA 3D45A 3NMAA 3HO1A 1U4BA 2W9CB 3LAKA 4FLXA 2D41A 1WAFA 3MTKA 1EX4A 1CSJA 4K8XA 1CZBA 2W8KA 4IR1A 1J53A 5HRPA 1NKCA 3KLFA 3FDSA 3VQBA 3PJWA 3H40A 2HNZA 3O3GA 4I2PB 1RT6A 3G6VA 1NOYA 4IG0A 3DOKB 3V1OA 3SFUA 4ED6A 3LWMA 2YV0X 1TKZA 5JS1A 3ZT4A 1N5YA 4FZZA 3PX0A 1RT3B 3TAMA 5KFQA 3L2VA 1BCOA 1BI4A 4DTRA 3VQ5A 2FC0A 1RBTA 2OH2A 1SKRA 2XI3A 4RG8A 4NLTA 3VQPA 3GV8B 4C8NA 4CF1A 3DMJB 5T14A 4DFPA 4CESA 3NAIA 3OY9A 4KTWA 2FVSA 2G8IA 1HRHA 5DG7A 2FJWA 3K5NA 1BQMB 4TY9A 3V9ZA 4EO6A 2OPSB 4TY8B 3L3UA 1C1BB 5SWMA 1C0TA 3ICLA 1SL2A 1O1WA 5I42B 1WSFA 4CECA 2P1JA 2WB4A 1S6PA 3AO5A 2FVPA 4BDYA 3WNHA 4IRDA 4NLXA 5DLGA 3CQ8A 1LWCA 2D0AA 4BDZA 1BIZA 4IH5A 4HUFA 3BQ0A 3HJFA 4TYBA 1IKVB 1WLJA 1BGXT 1RTDA 3QEIA 3MEGA 4KO0B 4PQUA 3KK1B 3ISNC 4J9RA 3RRHA 4F2RA 4CIEA 4CHYA 4F4WA 2E9RX 4K4SA 4CEOA 3QZ8A 5KFYA 3CDEA 3DLKB 3RMDA 3O3HA 2AGPA 3HKWA 5KI6A 1JXBA 3TI0A 4E0DA 4IG3A 3THVA 3PR5B 2GC8A 4PUOB 4CFBA 1NK7A 2VA2A 2AX1A 4OGEA 4K4YA 4ECZA 1TAQA 3QGGA 3LP0A 3NGYA 1RTHA 4LQ9A 3K5MA 5C25B 1TK8A 3RRGA 1LV5A 1MU2B 4RW4A 2ATQA 4PQUB 1WSGA 1JXLA 2OPQA 1RYSA 4KHRA 2DFFA 3AO2A 4OGCA 1TP7A 4M41A 3PO5A 2CJQA 3C94A 4DTPA 4I2QA 1Z25A 3QERA 3G10A 1T03B 1TKTA 3RB6A 3OS0A 3QIPA 4ELUA 4RW7B 1JLAB 2ATLA 4FM1A 3V6KA 2IM1A 3DRRB 4FW2A 4BACA 5F8MA 4XIUA 3KOAA 4U7CA 1KFSA 2DFHA 4CJSA 4WYWA 3LZIA 1FK9B 4KHQA 4ZP6A 3MR6A 3NH2A 5KG4A 4E7LA 1WSHA 4NLUA 3QETA 5L1JA 4M3UA 3AVNA 3IRXA 4DQRA 1DLOB 3RAXA 4DS5A 1C2PA 3QIOA 1EKEA 3LANA 4UQGA 1BI4B 4FJKA 2DTUA 5D3GB 2YNGB 3KLEA 2XWYA 1RT3A 1QE1A 3MEEA 4JV1A 4AHVA 3HK2A 3G6YA 1TQLA 2XGPA 2IS3A 1HYSB 4M3WA 4K8ZA 3DM2B 4J9KA 3KLIB 3VN5A 4F50A 1JLFA 2JLEA 1ITGA 5CYQB 4W5QA 3ZSYA 1KVCA 4ED2A 4B9VA 4ED0A 5J2MA 2C22A 4CJQA 1NNDA 4O4GA 5KFLA 4HUEA 3NF9A 2W9CA 2ZKUA 3JSMB 2BANB 1EXQA 2YNHB 1I6JA 3AVLA 3IG1B 3QEXA 5KRTA 4KBIA 5KFDA 1R0AB 1IKYB 4WZQA 2WOMB 4J2DA 3QIDA 2JC1A 5HRSA 4RUCA 4K4ZA 4IBNA 1GOBA 2RKIA 5EUHA 4KTZA 3Q8SB 4NLRA 2AQ4A 2YNIA 3PW2A 3HVWA 4FCYA 3AVAA 4PY5A 4CFAA 1JLBA 2ASLA 4NZ0A 5L1LA 4CK2A 1U48A 1SH2A 1YVFA 3QO9A 4DTXA 4WE1A 4YMEA 4RNOA 3S9HA 2RDIA 3S3OA 1XHXA 4E1MA 1NHUA 3WNGA 2FBVA 2YKNA 1R0AA 3AO4A 4FK4A 1GOCA 3V1RA 2QV6A 3OVNA 1MMLA 1BHLA 4ZPBA 3T1AA 3KLGA 3AA2A 2HHXA 1T05A 3GV5B 4WE1B 1TK0A 3HHKA 3O4NA 3GIKA 1SV5B 4RW4B 3CJ3A 4FS1A 1TK5A 1JLEB 4RW9A 3VQ6A 2HAIA 3PZPA 4AILC 4CEBA 4OLBA 2F96A 1NJZA 4QW8A 1N56A 3K2PA 2RKIB 1VSIA 2O4GA 4KAZA 4NYZA 3KKRA 5C42A 1N6QA 1IG9A 2NUBA 5FDLA 3OYHA 4ZTJA 2HHVA 3TAGA 1N6QB 5L9XA 1TKDA 3HXMA 1K6YA 4NCAA 4I7FB 1S1WB 1KLMB 3ALYA 2BRLA 4LSLB 5DQGA 1FXXA 3RMCA 1W25A 3NKYA 5KFZA 3HYFA 4B9UA 2QKKA 2KZMA 4ECWA 3RWUA 1TVRB 5J2NA 4K4UA 3KHRA 1UOCA 4O3NA 1JLFB 1NK6A 4FLYA 3QEVA 1RBSA 3DRRA 4FZYA 3C95A 1HYSA 4MK8A 3OYAA 4OPJA 2HMIB 1C0TB 4U6PA 3H4BA 5DMRA 4CF8A 4O5BA 3UDLA 3L2QA 3QNOA 2ZQBA 4EBDA 3U3YA 3OYFA 5HP1A 5DGBA 2ASDA 4AHUA 3VQ4A 4ED7A 4Q44A 5HRNA 3L2RA 4GMJB 3HP9A
chains in the Genus database with same CATH superfamily
3V2UC 1D1UA 2PC6A 4EP4A 2DNHA 5F9NA 4ELTA 4DR4F 1U1KA 3MEDA 3V6DA 1N5SA 1DARA 2MHEA 1RXOB 4IRKA 3POTA 1PG5B 3BGRA 5A2QU 4QIEA 1YQHA 3DI6B 3NGZA 1NGHA 1SH0A 2IRXA 4CIOA 3EVWA 3MM6B 4D3HA 3BSCA 2CQHA 3D0GE 3HD2A 3BO4A 5E41A 2GV1A 2ZH9A 5LMNF 4DUZF 3FZBA 2AJFE 4OZ3A 1XI1A 4KPYA 1PYSB 2Z1JA 1G7CB 3QBXA 1KSPA 3SLCA 4BRDA 3TABA 4RUBA 1CJUA 1O51A 3IO1A 3OSNA 3DLRA 2DHGA 3ZSQA 3G71N 5E2QA 1FNMA 3DGPA 4OI2A 2HZVA 2DR8A 4JI7F 2G8WA 4JI5F 2XG8A 2Y3YA 2J6UA 4KGVB 1T6DA 1UEKA 1BL3A 5AQKA 2AT1B 3D1OA 4I56A 1HKAA 3ZCMA 2XRIA 3DMJA 3DHWC 4JAXA 1RBUA 3JYTA 5KT6A 1B7YB 2CJBA 4JKFA 1FF2A 1QQCA 2PYJA 4A5BA 2NLXA 4A8KA 4B3RJ 1FRKA 2B9WA 4A4JA 4FLWA 3M05A 5I42A 2W2QP 3BB5A 4A8FA 2R2SA 3EZ5A 3ZT2A 3AVGA 4CJVA 2FLNA 1RDAA 1N8RT 4CZIA 2A6OA 3OTOJ 1NGIA 3QB0A 1S9EB 2GHWA 5J2NB 1TVRA 5KFUA 3ZFVA 4DV3F 2VC1A 1MG7A 3GG4A 1LXJA 3M1VA 3UNYA 3KJVB 1VBZA 3VF2A 4GV3A 1D3WA 2DFEA 2B7CB 4GKKF 4B9NA 3GZ7A 2C2EA 2E88A 2XYHB 2VV5A 1XNQK 3CFPA 1K8KA 2CZ9A 1ASVA 2ZM6K 1G15A 4G1IA 5DK5A 3M5RA 3HT3A 2B5JB 3FKBA 4OQJA 2IMOA 1VRTB 2R2UA 4ZPCA 3G8QA 3OSPA 1BWVA 1F2HA 3CC7N 3JAMU 3CDAA 1ELOA 3SJHA 1RWUA 5DZ7A 4CM0A 4NO7A 4H4MA 1FXRA 1UWAA 2FXUA 2VG5A 4ZMMA 2K06A 3DLGA 2OMOA 5T7LA 2D7SA 3M8RA 3KK3B 3EYZA 2ILYA 3RUBL 3EWGA 1Y10A 2YWGA 5ETSA 1K8AT 1EZZB 2ALZA 5AZJB 2YWWA 1YI2S 1DKGD 3N9UC 2QG9B 2MZQA 3ZX3A 1EQMA 3MR7A 3NS7B 2G1DA 3WZ0A 1CPZA 2HYIB 3CJBA 1NGFA 5EHHA 4K4XA 1UVLA 2OCEA 3TANA 3H90A 3OYDA 4I9QA 1YDLA 2AZ1A 3RR7A 2JVRA 1H3DA 4TYAA 2ZJQQ 3UD3P 1JNRB 5DETA 1HHTP 4OYZA 2BJ9A 3IXQA 2MB0B 3UQSA 2JX2A 1S97A 4K43A 5C42B 2VU5A 2EFNA 3CJKA 3N4WA 2WVCA 3O1BA 1WC6A 3BKUA 1XMOJ 4DV1J 1RGVA 2DHXA 3CJAA 3V9UA 1WDDA 4KPCA 3GDQA 4XH1A 1Q4RA 2KJWA 4OHWA 1PYTA 1S22A 4CZJA 2J4RA 5KTQA 2HIQA 2NRVA 2E5IA 3CIMA 4NA3A 1CJVB 3LW5C 2DKOB 5CYMA 3LPUA 3PW5A 1NOZA 4LFBJ 2DNMA 2OMLA 3W62A 3KDOA 5CA5A 3FE1A 4H4OB 2HBRB 4AQYF 4BE0A 3G4SN 1FTCA 3QSYB 3MX2A 3T19A 2IC3B 1X31C 2BV3A 5ETOA 4ZVSB 2JNJA 4JI4J 5C12A 4BRHA 3SAFA 2IY5B 5AQPA 3SV4A 4LF7F 1U1NA 3DLEA 1RB0A 3EDQB 3HSDA 1RCHA 1N0VC 1OQ3A 1ZH5A 5BPLA 3OYIA 4BCAA 1PYOB 2ZDPA 1IBLK 4L3KA 2V2VA 5KFXA 4QW9A 4GW6A 3JSRA 1VQPN 2ZITA 3HT0A 2BJ3A 2XZDB 1LWEA 4CH1A 1JLCB 5HOOA 5MAOA 1JQGA 4H4MB 2P9IA 3H7HB 4CIGA 3VGVA 3NGIA 5AQXA 4PKHA 1QTMA 1GMWD 2NPFA 1TL1B 5J1EA 2EFVA 2JEJA 2CQIA 3RAMA 3TYTA 3PLAA 5GAHU 4PUOA 1NZ8A 1FERA 4MO5A 1Q86O 4NYNA 4FPRA 2LQ5A 4ZVPB 2BW2A 3VZHA 1TMJA 4JI4K 3U9DA 1WC3A 1OO0B 3UKRB 2MLYA 3T1HF 1P90A 1UAXA 4DU1A 3I8DA 3LP2B 2YNHA 4Z4CA 4YOTA 2PN6A 2DRBA 2V52B 8RUCA 2OFGX 3SNNA 3R9PA 4CZCA 2ASYA 3BS9A 1DURA 1SJRA 4E89A 4WP3A 3DLJA 1JJCB 4ZTFA 5L1KA 3CFRA 2FVQA 4LF5J 4TN2A 2J5AA 3NF6A 2Q0RA 1RILA 1RU2A 2UVWA 4JI6K 4BR2A 4J9OA 2XO7A 3C6UB 3P5TL 2XS7A 4WBFA 5HROB 1HNWF 3JQKA 1TV6A 3P5BP 3ASMA 4AH9A 5HSPA 2X3GA 3PVXA 4IDKA 3QMLA 1YI2N 2ZE2A 2VPZB 4CLLA 4ZJOA 4C11A 4FJGA 2ZE2B 3IGVA 2MJNA 4OVLA 3MD1A 4QIWD 5AJ3J 1GK8A 1WN7A 5GAHP 1PJ5A 3TAPA 4CIFA 3CT9A 2E1RA 4AXIA 4KC5A 2R7YA 4KGMA 1BIUA 3MMCB 3HHLA 3FC9A 2ZHAA 3M8WA 2R8IA 4M3RA 3T1YK 1BE4A 3AO3A 3VR1A 2XZTB 2DJWA 1I3OB 2VWBA 1L3TA 2W42A 4ANCA 3L3CA 1RWKB 1M5PC 3KK7A 5LM7E 2NXNA 2P6TA 3AOBA 5A76A 3X3UA 2E20A 2GVZB 4CYUB 3H2UB 2RE1A 4NI2B 5HANA 3PFOA 2C3MA 2DPIA 1S72S 3HHLB 4KH4A 4NB4A 1VRUA 1GQEA 4DR1J 3CMAN 2HNYA 2RILA 1HMVA 4LT6A 3I9V9 5CZVA 4NLYA 3PKYA 3AJ1A 2ZM6J 3WXMB 1KD1T 4FNIA 5F2RA 2ATCB 5BYQA 1AXQA 4LRBA 3H6EA 4E19A 1K44A 4ECYA 4LFAK 1YGYA 2UVRA 1NHVA 3FNNA 3ENOA 1WDTA 1FEEA 4ICLB 1VIOA 3AA4A 3GYNA 4ZIVA 2FYXA 3TQEA 4L76A 4FF3A 3SQGA 1N48A 4DTJA 2KYXA 1S57A 1NJYA 4IFVA 3LGNA 3UN3A 1HBOA 4GVLA 3NE6A 2QXLA 3A3PB 3KMQA 3R2CJ 3UW1A 3OVSA 2NRWA 3THWB 4KHSA 2XY8A 4FWLA 3G6EN 2KXFA 2FGOA 1X4BA 2QLJB 4HT7A 2LQJA 2VBXA 1CLQA 1U0HA 2ZD1B 3K8VA 1YF5L 2LQ9A 3RSEB 1Q82O 5HVFA 1VIXA 4LRCA 5CHCB 4CM2A 1VQ5N 5EVZA 3FBCA 4UQTA 2GIQA 4B9MA 2B56A 3IR6B 3E1YA 1DQ8A 1KCFA 2RN2A 4I4BA 3NGDA 5ETVA 3KLIA 4ILLA 1YBTA 4WFZA 3SFGA 1YVNA 3VEZA 1PKUA 2XBPA 4G3IA 2HW3A 5DG8A 3DRXA 1T03A 2VG7B 2HMPA 3NNCA 3KLHA 1U1PA 4OHVA 1S7HA 3CERA 4X4NA 4FLUA 3WX4A 5AXMA 2MZJA 2Q31A 4Y34A 2MGZB 1XNQF 1BDGA 3GV7B 3QGIA 1XBWA 2QEXN 2FY8A 4PKDB 1EWQA 4RNFA 2HEKA 5K20B 2R8JA 3NCQA 2C28A 1NBEB 4GKJJ 3MR3A 3KHGA 3FGUA 1X4CA 4ETXA 4WYLA 3O9UA 5EWEA 1FDDA 2E5LJ 3CJRA 3QBWA 3R8EA 4NLWA 2DRAA 5KOXA 3THPA 4F3OA 2Y1IA 4I2QB 2MQ8A 5T7LB 1OQ6A 4FJHA 3BQ2A 3VEYA 1FKPB 4DV3J 2F9WA 1WAJA 1JIHA 2AU0A 3BZKA 4DU3A 1L3UA 1IR0A 2CH6A 3VESA 5KPTA 2BVZA 2E2NA 4MLHA 1KAYA 1NMEB 3W64A 4J8FA 1X9WA 4B9LA 3U3GA 1HWIA 2DNLA 4B1ZA 3CM6A 4CEQA 2UUBK 1R3NA 5D6GA 4CF2A 3B6PA 1GMWA 5HBMA 1RNHA 2C3OA 3G8SA 1BXNA 4CLWA 4CFCA 5A8KA 4UUWA 5BXIA 3OBIA 1VYAA 1VFJA 2B6AA 1F6TA 2QO3A 1Q86T 2G8KA 3UD5A 1NJIT 1NXIA 5KFMA 1WSVA 4X4VA 4M5LA 4WKYA 3K59A 1UL3A 3G86A 3W8GA 3W9JA 2W4CA 5AE2A 5HROA 3KJQB 4XDDA 2MKSA 4H8KA 4FJLA 1L3SA 3GFYA 4KI4A 3BGLA 5LJ3Y 2UXCK 1SI9A 1UVNA 1X8DA 2KFZA 1QAIA 1VISA 1C1BA 3IAYA 1Y64A 2EPIA 1IQZA 3D5MA 1QZ5A 4J90A 5KFTA 2P9UB 4C2MA 2YKMB 1FDAA 1PC4A 2QXFA 1VSDA 3K5PA 1S1VB 1CXUA 1X4DA 4DHYA 4C1NI 4EUVA 1K8KB 2RT3A 2O1PA 2BJDA 2JEGA 4U9RA 2EFPA 2AX0A 2CQPA 3W2VA 4JKDA 4IOAQ 1NGAA 2AF6A 3ZNJ1 3WNEA 1Q7LB 2OTJN 2AV5A 3M8QA 3AB4B 3M8YA 3MCOA 4FJMA 4KH6A 3OPKA 3TQ1A 3NBPB 4Y2AA 3E01B 5KT2A 3SCKE 2ACYA 2BKNA 2OD6A 4PKGA 4FBTA 3EEQA 4Z37A 3J7AN 2HK2A 2DY9A 2MTLA 4B8AB 2DYAA 3PEHA 4DX8H 4WF9Q 4F36A 4OPKA 2SXLA 1Y3JA 3DDNA 1RHRB 4KJIA 3DLEB 2YX4A 3POTB 4M63A 5DGAA 5C15A 3VAGA 2R3VA 4R5PB 3H4DA 2PE8A 4LJMA 3CC2S 4IO1A 1GLLO 2V4JA 2YX6A 2CPEA 3L9ZA 1Y0HA 1DTTA 4JKBA 1QQNA 1GTHA 1HWLA 1P6TA 3ENAA 4W5OA 2VPYB 4LY7A 5EOYA 3PYDA 3M9OB 1N34F 4KB0A 4ECRA 1HQEB 4K59A 4USHA 1TZ0A 3DXMB 1R89A 4CZKA 3MPVA 4YOUA 4M5IA 3KLFB 3MN7A 2XMTA 1VR6A 4PG4A 5AXKA 2I38A 2RJZA 4HH1A 4MFBB 4UOGA 4F9OA 3TX8A 2WVDA 3MPUB 3RB0A 3OLBA 1XEZA 3F9KA 4HYKA 3DI6A 3LPTA 2JH3A 1D5AA 2XB2D 3DKDA 3R6MA 4ZVEA 2WVEA 4BE2A 1LQ9A 3ILLA 3U7JA 2G0IA 3ENVA 4JI2J 5IQ6A 1X9SA 1CZAN 3TOQA 3H42A 2HB5A 4QIVA 3P45B 5LSRA 2LQBA 3WQTA 1TYQB 2CKWA 1WHVA 2VQFF 1ASUA 3QWPA 4LH5A 4GVBB 1RBRA 4U7UK 4YFUA 3JSYA 2VF3A 1VQ6S 5DG9A 3H1QA 1ATRA 2HVDA 1FVQA 5H9EK 4J5OA 1TR0A 4R79A 4H5VA 2F9DA 1F3VA 2X1FA 4X66K 2HMIA 3TZWA 2O67A 2KT2A 2QTWA 1RE1B 2PGCA 1KNZA 2XCAA 2PY5A 2W7OA 4WIQA 4WF9L 2QFJA 2LECA 1DY3A 4P7TA 3GPAA 1HNXF 1FI4A 3DRPB 3G96A 1S79A 4I0WA 4I6AA 5IFMA 2Z30B 3SK3A 1HR0F 1RWPB 2I7NA 4QJVA 4B17A 2BKOA 3CJ4A 4FS2A 4FF2A 1UAWA 2QYCA 3I9ZA 4V19X 4GKJF 3L2UA 3E9LA 4CO1A 4NI2A 3UPFA 2Q66A 4FXVA 2CGLA 2B4PA 1VBKA 5HO4A 2CFXA 2FSKA 3BKFA 1DHMA 3RB4A 3FBBA 3KFWX 5KPZA 2R7RA 5L46A 3MCAB 4JV5F 4H0PA 3K9KA 4I69A 2YNGA 1RK8A 4JHDA 3ET6B 2FY1A 3NOCA 4YY3K 2ZH4A 3CIZA 1YVUA 1TL7B 3QPIA 5FRNA 2G8FA 3THXA 1ZBLA 2WHOA 3E01A 2BZ2A 4CEFA 1GLAG 1XC3A 4EK2A 4P75A 1OSCA 2IAJB 3L95X 1H2UX 3VQAA 3M6WA 1JWWA 4KV8A 3G9CA 1FRXA 3QFWA 1VHFA 2DITA 4OZ5A 4M42A 5AQWA 2GAGC 4EFHA 2Q1LA 4FLZA 3V9WA 2D0BA 2VGMA 2HBMA 2VBWA 2DNPA 5KG0A 3K57A 4EYHB 2WBNA 1NGJA 4DMNA 1HHQA 3C6TB 3TW0A 2IYIA 4JNEA 3I96A 1KS2A 3BP8A 2CWXA 2XNQA 1Q9XA 4A62A 3DDIA 4X66F 5JXSA 1HHSA 3MM6A 1D8YA 2DR7A 4JI8F 4OLOA 4OJ3A 1AA1B 3QESA 3SQ1A 4Q0BA 5EDWA 1CS4B 1XERA 4FPBA 2W4DA 2OPRB 3HL8A 1UKUA 2Z2LA 1Q82T 4ECXA 3LOUA 4PWDA 5LT5A 4RZRA 4JI0J 4FWNA 3AVIA 2YTCA 1M1HA 1JCEA 5ETTA 4JV0A 3HSJA 4LSNA 2UUCJ 5AQUA 4M5HA 4AT1B 3BGFA 1C1AA 4NXMK 3UIQA 1Q79A 2P9UA 1A5VA 3LM2A 3OQ2A 1IKWA 3NDKA 4QR2A 4B3TJ 4OV1A 1O0PA 4PR6A 1EQYA 1G1XA 4BS2A 5AR0A 4QS7A 5ETKA 4BROA 3P8BB 3CD0A 4DLGA 3V1QA 4P2FA 4DWIA 2GHPA 4CQ1A 1FD8A 1EETA 4IQMA 4N76A 3WNFA 3QAEA 4K50A 1VOMA 4ZCMA 4URSA 2DGTA 3O5TB 2B6AB 3CW2C 4JV5K 1XC9A 9ATCB 2RU3A 5GAEP 5B0GA 1WSIA 3ZX0A 1EHWA 2RE2A 2XMVA 4NXNK 4DSJA 5KQDA 3AD7C 1VLYA 1FJEB 3BF4A 1XMBA 4F2SA 1U6BA 4DR4K 4ZLPA 4QYRA 3MM7A 4M95A 3FBFA 3GTYX 2QA4G 2PMZD 3SUOA 3R7NB 1RP5A 2FSJA 2QWOA 4IEIA 2Z1HA 1PGZA 4B3OB 3GB0A 1YJNN 4Z4EA 4IG0B 3O3FA 1IWGA 4F3QA 2XY5A 4M3XA 1GTEA 3L7PA 1VDHA 1LWEB 4DCHA 3MN9A 4YNQA 1QQMA 1VSFA 5D78A 3H5UA 3VTHA 4DTNA 3UVJA 5MLCV 1LK5A 4ZPTR 4B02A 5GMKa 2RRNA 3PM9A 3VF0B 3PW4A 4JD2B 1QHTA 1U09A 2YKNB 3D7EO 1ZPVA 1UW4A 2RRAA 3PIPL 4DR7F 2KKZA 2JLGA 4CF0A 1RHJB 3K0SA 1BQMA 2IOCA 2BUNA 2O01C 1J5OA 3EPGA 1WI8A 2WB1D 2OPPA 1S4FA 2YY3A 2COLA 4KB1A 1VSEA 3JTOA 2HZCA 3RSEA 1FJGJ 4HKQA 3RBDA 5HVGA 2YNFB 2MGZA 3HTVA 1ACMB 4DQIA 2CDQA 1BOTO 2O8BA 2LQ8A 3D67A 3NMAA 3KG4A 4Q7AA 5A6PA 5JVHQ 1XNRK 2D41A 3MPWA 1CZBA 4LRFA 2UU9K 2W8KA 4LVOP 3KLFA 2L9WA 1OVQA 2UXDJ 3EZWA 2A6AA 3G6VA 1NB7A 3FSYA 2FJDB 3HRGA 4CD1A 3SFUA 1XMQK 3VEXA 3WDOA 3VF4A 1VJQA 2W6LA 3L2VA 1NGCA 1S77D 4DTRA 2FC0A 1EWRA 3BKTA 1MWZA 4FWRA 4FNHA 4ES1A 3TA1A 3GYXB 5T14A 4PXCA 3SSSA 4NZ7A 2UUAK 4CESA 3MZIA 3OY9A 4KTWA 2FVSA 5ADXA 3MURP 4ITSA 5FD1A 1HBMA 3K5NA 2PEBA 3N79A 2NSCA 5JJBA 2HURA 3QT5A 1T9VA 1SZ2A 2OPSB 1HNWK 3CJ7A 3TA0A 1OH6A 2V7ZA 5M1FA 2P1JA 2FLOA 1ZM2A 1YTYA 1RQ0A 4BDYA 4IRDA 5DLGA 3CQ8A 4JP8A 1VQ6N 4DV7J 4BDZA 2WBMA 3J81j 1BIZA 4IH5A 3BQ0A 3HJFA 4TYBA 1WLJA 2LP4A 2NYIA 3ZXWA 4KO0B 2ZNZA 2HVEA 3KK1B 4M7YA 1OPIA 2WSEC 4F2RA 3CCJS 4CIEA 1BQXA 4F4WA 2E9RX 2VODA 4K4SA 4CEOA 2DH9A 4DR4J 3CDEA 4A8YA 1LOUA 3DLKB 5M2UA 2ZBCA 3RMDA 3HFKA 1U0SA 3OFHA 1JXBA 5HN0A 2W2PP 3C15B 4C7QA 3EDRB 2AX1A 3UO0A 2RS8A 4K4YA 3EXCX 4LQ9A 2KHCA 1LV5A 1MU2B 3NGKA 5F0UA 3TTDA 5TKYA 5LL6d 1R8BA 2OPQA 1RYSA 3BM7A 4ZKAA 3VWSA 4DTPA 3QERA 4I2QA 2W24A 5B0EA 4DR7K 4YOEA 1JLAB 5AJ3K 3OR1A 2QX0A 2QYGA 1OPZA 2IM1A 4FW2A 5HK4A 1SIWB 2Y9HA 5F8MA 4XIUA 1RU1A 3BGOP 4U7CA 2G0JA 2DFHA 2FSNA 4WYWA 3LZIA 1RHKB 3HDSA 1FK9B 1HA1A 3U9ZA 4ZP6A 3JXOA 5KG4A 1UTAA 2OFHX 4F3MA 2DEJA 5KOWA 5L1JA 3AVNA 1VQ9N 4CZMA 1BMQB 2RAQA 3SCJE 2A5XA 4UQGA 2VGNA 2R7XA 2XYPB 3HM8A 2EWSA 5D3GB 4YY3J 2YNGB 2PMWA 3A12A 2W2MP 3ENWA 1QE1A 4RWWA 4JV1A 4C97A 2BH1A 2XGPA 2IS3A 4K8ZA 4J9KA 3OVBA 4OYIA 1MWQA 2NPIA 5BR8F 4BR5A 5B0DA 2CADA 4F50A 5LMUF 3MMVA 3CCSN 4DR3K 1IN0A 1HNXJ 2IHR1 2Y8YA 1I94F 3R2DJ 4W4MA 4DR3J 5AQOA 2YNHB 2YQ0A 1QVFM 1FWKA 4LFCJ 1VQSA 1U0HB 4X4QA 5KFDA 1E6VA 2FF3B 2LA4A 2WOMB 5F0XA 3QIDA 2ZM6F 2VCPA 1U1MA 4CP5A 4IBNA 2UUAF 3SEOA 3HBTA 2RKIA 3IBWA 1N52B 2AEMA 3ZZYA 1CJKB 4NLRA 2YVSA 3VEWA 3PW2A 5CCMA 2E1CA 4CFAA 1JLBA 3QRRA 1KOOA 2ZZTA 3DFEA 1IBLJ 1W26A 4RNOA 3S3OA 1SJQA 2GHVC 2OKQA 1WTBA 1QVFR 1NHUA 2ZOFA 4QU7A 2FBVA 1GOCA 3AAPA 3OVNA 2EFQA 1CJVA 2HLTA 2LVWA 4GY2B 4O5FA 3KLGA 2OSQA 5H9FJ 1AROP 3UVJB 4GO5X 3AA2A 3NVMA 3VERA 3LUYA 4U8VA 1T05A 4FOIA 4WE1B 1J5EF 3HHKA 1FRLA 3D3BJ 1SV5B 4KR0B 5B0CA 5AQQA 3JB9k 4JKGB 5D77A 1RADB 2F96A 2Y0BB 4CDIA 1N56A 4ZCLA 4KAZA 3D54A 2RHQB 5FLXY 5C42A 2DIUA 2E5LF 4DV5F 4OX9J 1XMOF 4G6VB 4LSLB 1FXXA 3HYFA 4OJHA 3IC1A 4LF6J 4UW2A 2MKJA 3RWUA 4WCEQ 5I9EB 2W01A 4K7QA 1Q0NA 2WFBA 4O3NA 1NK6A 1OY9A 1RBSA 3KUGA 1B0PA 3MOZA 5F0WA 2B9YA 3ONQA 4LRDA 4UF4A 4ATNA 4DV7K 1C0TB 2K3IA 1RWNB 4LF5K 4WU3A 2ZQBA 4USJC 3OYFA 2C2MB 5A2QO 1NAQA 5DGBA 2ASDA 1Q5YA 5L39A 2QLBB 3US5A 2X7IA 3I56S 2BBEA 3CMES 4GMJB 3IM9A 1U2CA 3FFKB 3NLCA 1JJHA 2PSZA 4OZ2A 3U1LA 3R3TA 4C6AA 2YHXA 2OPRA 4CJFA 1CC8A 3ZEUB 3AGKA 1U49A 1S6QB 3NHGA 5IT0A 3Q24A 1DTQB 2UV8G 3O80A 4A8SA 3AVBA 5KT3A 3ZZOA 3KJFB 2W7PA 3LP1B 1TL3A 4C8MA 6FD1A 3QT7A 3WIVA 3LP1A 5AJ3F 4J2AA 3AJDA 3VAJA 1N32F 2J6SA 3NGUA 5D8HB 4URGA 1IJEB 2XQCA 3UE5A 2JOQA 3F44A 2DR9A 2I1RA 4CTAA 2KN4A 1FJ7A 2LA6A 4DV4F 2YH1A 1VAZA 4KV8B 2ZJQL 3QLHA 3A8EA 4Y1DA 2J76E 1JKHB 4UOFA 3O9QA 4CO5A 4W5NA 5KFGA 3O6WA 5LL6Z 2A6MA 2XMKA 4MKVA 4M94A 1APSA 4KHYA 3UB5A 3NMUA 1GLFO 2LXUA 2ZOMA 2H3EB 4UZCA 3ZSRA 2OA8A 1GLCG 3ZLJA 2CJ9A 3P83D 2E9ZA 2FBXA 2OZSA 2Z56B 4DCJB 2HVZA 3I5BA 4S0MA 1S9EA 4PWUA 3NFAA 4OHYA 2CG4A 3CCES 4J9LA 3DGVA 4OJRA 3T69A 2DNGA 4JHDB 2G1HA 1WG4A 4PXEA 2D5RA 1W2IA 2OPSA 2GFFA 5A6WA 4FYDA 1S9FA 4ZVGA 4OZ0A 3CJ2A 3VOVA 1UP1A 4CZGA 4DDFA 5BPMA 4IYQA 4CH7A 4X62K 5HL7Q 3PTWA 3H3NO 1E6YB 1U6FA 3T9ZA 4FKYA 5JUMA 4B9TA 1S6OA 4DCPB 2XCPA 3DOLB 2H1YA 3J81Y 1G99A 2V2KA 1UVMA 3LP2A 1T9UA 4G1QA 2GAHC 2YWKA 1OJ4A 3OYJA 4DF8A 2JWNA 2Z0GA 2KTQA 2EC2A 2WSCC 3TSQA 4OJGA 2ZF5O 3QNWB 2Q3PA 5J1EB 3VAIA 2NZ4A 2G0CA 2R42A 2CXEA 3SZ2A 1SXLA 3VQ7A 1K8AO 4OYWA 4NLCA 1VQYA 4P10A 2HFZA 2J7KA 1YXQA 1TAUA 1WHXA 4QQBA 4DR6J 2XY6A 3EE9A 2J9DE 3RBZA 3BGRB 2C2DA 4I6MB 4NCGB 7FD1A 4NRTA 2UYTA 2O5DA 3FQKA 4B3MJ 1KHVA 5KFIA 2ADBA 2XEXA 4CLKA 4FM0A 3OYKA 1AUSL 4CJUA 2G13A 4B3OA 3K0JA 2Y1LB 3S6EA 5FLXO 3MWPA 4ILJA 1MWKA 2ZH3A 4JUZA 4AYBD 1N34J 1V5VA 1RDBA 4DQSA 3VGSA 3TAQA 3NH0A 3V9XA 4JS4A 3PCOB 3HHLD 3C0BA 3CF5L 1NJXA 5C0YA 3IFEA 4H5RA 1N5TA 5AQVA 4ALZA 5DM6Q 2VBZA 4FVUA 4XO0A 2G8VA 3MAAA 5AQJA 1YX2A 5AZIB 4RBTA 2NRRA 3Q8YA 5BJRA 3MEKA 1EETB 4LR7A 1KLMA 4H5WA 1NEEA 3EY1A 1N8RO 2KQ2A 1OY8A 3I5AA 2QSFA 2A3ZA 3BR8A 3W5ZA 3MXJA 1S1XB 1R43A 3HVTA 2PZSA 1HR0K 3ZSWA 2DIVA 4R8UA 1VCTA 4WFXA 4OLAA 3MECB 1S1UB 2DGWA 1F5CA 2AYMA 5C5JA 3R5JB 4JS5A 2VIHA 3TZYA 2HOEA 4IJNA 1VQLN 2BJ7A 4BRCA 2RPIA 1Q8KA 1Y4ZB 2LEAA 4BC9A 4WTOB 3C8YA 2OGUA 2QSWA 1WG1A 4GNIA 1XK8A 4J9UE 5A0YB 1B99A 4UTGA 3VA3A 4Z0UA 2CGKA 2DNZA 3GFHA 2E5JA 4TNOA 2I5JA 3QFPA 5ETMA 4LF4J 1YG0A 4DL2A 1P8GA 4LFAJ 1RWVB 1FW6A 3KG1A 4ED1A 4QAGA 2PYLA 3CYMA 3GG1A 4DTOA 4OI6A 4DSKA 4YP3A 1T7PA 4OX8A 1AFJA 1HQUB 2K1RA 4U67L 4B3SJ 2V4QA 1RDWX 3DGPB 2BKPA 3FZKA 4RW6B 3IBCB 4DR1K 2RU9A 1ZZNA 1NU4A 3DNCA 2PEHA 4ID1A 3TEGA 1MA9B 1HI1A 2D9OA 1WKKA 1NGGA 1YUWA 4C8LA 5DDQC 1EKRA 1FO1A 2QWRA 1OS5A 3PYGA 1U26A 5CYQA 3QJJA 5KFWA 2MYFA 1HPMA 4FVMA 5GAEU 4DR3F 2HBZB 4K4WA 4O0IA 4X4PA 4N5SA 1XJWB 4DEZA 3Q7CA 3X1LB 4JLHA 2K7KA 5JVGQ 2MQLA 4DR5J 3FVYA 3KDNA 3CXCM 4C1NK 4MLEA 2VQEF 2JC0A 4OZJA 3H5SA 3JTNA 3TP2A 1BO5O 3VHQA 4BC4A 2IFXA 2E6MA 3OHAA 4TSXA 4OMFG 4TXSA 3H0PA 4IKFA 1BC6A 2M5YA 4LSLA 2GA7A 3CUNA 1RTHB 2RVJA 2WONA 1RHMB 3CQXA 1T9YA 3UN2A 2P6SA 3ZZ0A 2KU7A 3HVTB 1A0OB 1S1XA 2W4PA 2BOPA 1QVGM 3QICA 3K5OA 4MQ3A 1MLAA 1RKIA 4RW7A 1KQSM 2XHBA 2A1BA 1WEXA 3ISZA 3DRPA 1H72C 2IM3A 2LU1A 4EEYA 5EXWA 4MH8A 3B82A 3CWJA 2QMWA 4HUGA 4C0BA 1YIJS 1WNEA 3SMPA 2E7WA 1TL4A 4ZCIA 2MLXA 5E3PA 4JB8B 3WHIA 2JWKA 1WF0A 1CBKA 5EGYA 1KVKA 3JAMY 2V68A 4J9NA 1KQSR 3IWNC 2GVDB 3H3OB 3SAGA 3ZTOA 5IV4A 3SBGA 1B4SA 3C2PA 4ZJQA 4F4XA 3SUQA 2BYCA 4DV0K 1QAYA 1J5OB 2DNKA 4C8ZA 4JI1K 1S10A 2Q3SA 3UDCA 2FHOB 3PX6A 2R7TA 1HNVB 1IM4A 4H0YB 2UXBK 2CNOB 2H48B 3RG6A 2C2OB 3KLHB 1KKHA 5IM0A 1SL1A 5KFFA 2ZJRL 4E7KA 4LIWA 4K5RA 1U02A 2IA0A 4USVA 1HNZJ 4FOEA 4YB1P 3CCUS 1HI0P 2Q1NA 3VTIA 1N32J 3FR0A 3Q8RB 1MDUB 2NQPA 4JK8A 1X5TA 4DR6F 2KH9A 4Z4HA 3QEWA 4BRLA 3CJ5A 5LOQA 4M3TA 1CULB 4DCOB 5F41A 3OL7A 3KK2B 2X3DA 1JLBB 3PV8A 4Q8FA 1K0VA 4AUKA 1S1WA 3BQ1A 2FHMA 2RB7A 1KEKA 2M9KA 3J8AA 1QQOA 2O8BB 1SC1B 3HFZB 3P1GA 4FF1A 7FDRA 3S3NA 4CJ3A 4F8RA 4HI2A 2V51B 5F8LA 2C2RA 2A40A 4MDAA 1HWJA 3C46A 4BVOA 3KK2A 4I2PA 2VFTA 3VQDA 3CJ8A 3OBWA 3ETOA 4WXOA 1NDCA 1PAEX 3CCUN 4PAAA 4IFVB 4BC2A 4CLTA 2NZCA 1JLQA 2GJIA 3ISND 5AQYA 2G8UA 3PEJA 3CNQP 2Q6CA 4UY8T 5D3GA 1S4EA 2OTLN 2HVHA 2NZTA 9RUBA 3CC4S 2JGUA 2FBYA 1Q18A 2OPQB 2XHCA 4B08A 4OIXA 2GMLA 4HHUA 3TRGA 2NUUG 3LDQA 3QFUA 5JVGL 1F9EB 2XNRA 1UVIA 1PIEA 3SCXA 2PI4A 2HNYB 4K4TA 1U1QA 1VGYA 3QLHB 1FRMA 3NMRA 4GVEA 2WCXA 5GADP 1RUSA 1RA7A 5LJVA 1VQNN 1RAOA 4LD0A 4ZHRA 2BQUA 2YBVA 4ECTA 1R31A 2HS0A 2VOPA 3SXLA 1RTZA 3DLGB 4E3SA 1RDCA 1X5OA 5B0BA 3OVAA 4HTUA 4NLSA 4KKOA 3HLUA 1XNRF 1LAWA 1H0HB 1XIQA 4ETZA 1I5OB 4GV6A 4LF1A 2BJ1A 5KG2A 5BYSA 4ZVHA 1DRZA 4ISFA 2W8LA 3QMQA 5GAGP 3CEDA 3FCWA 2J7WA 1T3VA 1UFLA 1WKLA 3JYTB 2BJ8A 3VQQA 2O8FA 2XO6A 5G4DA 1YITS 1D9DA 1SKSA 4NA1A 1HBUB 4DPUA 3GG0A 1VSKA 4WQ5A 3ZTPA 4B1UB 1IBKK 2XULA 5H1SQ 2XI2A 3MDQA 3EKUA 3UE2A 1ZTWA 3A5LC 3OYLA 3V4IA 3PX4A 8AT1B 4BR7A 2AHOB 1VQ4S 5E5NA 1RI7A 1RTJA 1LWCB 4DX5A 2F7VA 3F56A 5KAKA 3U4LA 1TMMA 2FJAB 2XHWA 1JB0C 1SQGA 4JI6F 3LDOA 2O8EB 1AUDA 4NPOA 2C3YA 1V6HA 3OLAA 2HHHK 3NWRA 1MSWD 3IWXA 3M6GA 4HTLA 1LFPA 2P9SA 2HWTA 4YHHF 3OL9A 1N36J 1TUVA 2R9LA 2J6TA 3K8WA 5F8GA 3OHBA 3T5KA 1TL5A 2J8AA 3T1HK 3L09A 4GKJK 2FD2A 2ERRA 2KO1A 4OYPA 1KQFB 5KG6A 1NGEA 5KFPA 1HD0A 4KH5A 4MJKA 2OSRA 2NSBA 2IVYA 4HI1A 2ASOA 3KKSA 2XMUA 3E8OA 2R2TA 4KHMA 3GSIA 4DI6A 3EZUA 2BA9A 1S12A 4JN4A 3OTCA 2UUBF 2GO8A 4I6WA 4NLDA 3CM5A 1KTQA 3GQCA 1WOSA 2PBDA 3RYLA 1K1SA 2WK4A 4YHHJ 4K5SA 2QL5B 4HTIA 4RBVA 3UFCX 4OKKA 2MQMA 4J9QA 1X0PA 3BO2A 3ATUA 3TTFA 2GQCA 2EG1A 3I87A 2HHUA 1SVDA 2DR5A 2XGQA 4IJAA 3R1HA 4UZBA 3C16B 2E4LA 5BN8A 1EAYC 4ZPDA 3R1XA 3G6ES 4L74A 1CJTB 3J80U 4H5NA 1X4HA 2KXHA 2QA2A 3DHXA 3VEVA 5DM6L 2HBQB 1O6XA 4HEA9 4Y1CA 3TO8A 3NG8A 4M5DA 4ES2A 2VL1A 1FXDA 1VBXA 4Z4IA 1E3MA 2OTJS 3I0SA 2HHHJ 1NJIO 1TKZB 3GILA 3CFOA 1WC1A 3OR2B 2NRHA 1NKBA 2V8GA 4C4WA 1VSLA 4RPFA 5FJ4A 2QLFB 4OX9F 3EM1A 3MAQA 2VOOA 4J37A 3ULEA 1MMNA 1IKXA 2W2OP 4BWMA 4C98A 2Q43A 5T7BA 4H03B 2ZD1A 3PW7A 2MKYA 1A9NB 4DFMA 4F4KA 1KXPA 5IXUA 2FHJD 2DCUB 3CMAS 4Y28C 4ER8A 4O44A 4YOVA 4IFYB 2PDAA 2W1BA 1YT3A 1F5BA 1S72N 4ZITA 1ZS6A 3ULDA 2OLWA 3LZJA 1ZBFA 4C8KA 4B1VA 2HKEA 4E2FB 5KFOA 2BW7A 2UUCF 1KLNA 4MKBA 2A10A 1NGBA 4MK7A 3HZGA 3I6PA 1S48A 3KXDA 1PAUB 3WEEA 1M90O 4X4RA 2B4UA 3JSMA 4PYAA 3CQYA 5F9LA 3PYEA 2I8EA 2NRZA 3CJSA 1RLDA 5DDRC 4F0MA 3RTVA 2CPHA 3M1FA 3LPYA 3SYZA 3MFIA 2A42A 2LDIA 3R7SB 4AL6A 3NBPA 3RAQA 2IDEA 2RDDA 3CSKA 3HOTA 1HQEA 4X65J 1VRTA 3MCSA 4MK9A 5E26A 1Q1KA 4TLRA 1GAOA 4DV2F 2Y8WA 1YTUA 1IKYA 4M5JA 4KRFA 4P6QA 1M90T 4LBPA 4QWEA 2IAJA 5HMZA 2N7CA 2CNNB 3CCMS 5KFNA 4JEPA 2Q97A 1X7VA 3EGWB 1E6YA 4M5NA 5CZXA 3LWLA 3SBTA 1V3RA 2J9DA 2O8DB 1M1KT 5DQHA 3NL0A 2F4FA 4DR5K 3MMJA 1AT1B 3GMGA 1HJRA 2MQOA 1HL6A 1WEYA 1A6LA 3QEPA 2CQDA 2AMCB 4BR4A 2QEXS 4FVCA 3ZZZA 2AGOA 3OFFA 5C10A 4Z7CA 4M8LA 3EN9A 5KG7A 5FROA 4NXMF 4A61A 1S5JA 4FYVB 1HNIB 3NGSA 3TSPA 3VCDA 2BE9B 2R7WA 3OYCA 3CCSS 3D28A 3UCUP 3OL6A 2PFFB 3DXSX 5FRMA 1VQ7N 1S49A 2V9WA 1GXUA 5J1PA 2V34A 4QOTA 5LSOA 4PPZA 2M0GB 4Q45A 4PL7A 1OVYA 1TL1A 3J7A1 2YKMA 2VQEK 3KHHA 4HVJA 1RT2B 3QQCD 1ZBUA 2CQBA 4FYWB 1A5XA 4HH0A 2RS2A 1ICEB 5CAAA 4OI0A 4CJPA 1QSYA 1DTQA 1WD6A 3C19A 1K0TA 4DV0J 2YKOA 3H59A 1LK7A 3G82B 3OYGA 3H25A 2X6SA 3IGNA 3QINA 4E7HA 2CPDA 3F2KA 1EO1A 4X4UA 3TAFA 3E9PA 2DHSA 1R8CA 4HR2A 5J2PA 3AAQA 2VWJA 2MMYA 4KHPJ 2VFSA 4RR5A 2YHYA 3JS6A 4KTQA 2GCFA 4DPTA 1SJ4P 2LSNA 1BA0A 4CLFA 3MPDA 1UZDA 2DGOA 1TYQA 3SUPA 3MWBA 3QSIA 3RU0A 4LF5F 2DY1A 1HW9A 4MIWA 4Z4FA 2BEFA 5JVHL 4ISEA 2A2CA 4IOCL 2XY7A 1V4TA 4NCGA 3D1HA 4KHPK 2FVCA 3VAFA 2M7SA 4DTSA 3Q8UA 3FQLA 3PUFA 1JLQB 1JXEA 1IXKA 1W0HA 3LO3A 2ZZMA 1Z4UA 2GUIA 3GFXA 4P2XA 3HX9A 4ZVFA 2HNZB 3RB3A 2CWKA 2DGSA 3D2FB 3MMAA 3BN7A 2KZZA 3LP0B 1HYZA 4FK2A 4PWWA 1NSAA 5C24A 4DL3A 1YJ7A 4RWXA 4FZXC 1BD6A 4IG3B 1NK5A 4G1QB 3WC0A 1JX4A 2AWZA 3CIPA 3H45C 2ZJRQ 3HKZD 3ZETA 4DV3K 4QOZB 2OIHA 1PJ6A 3L2WA 1N33K 3TVKA 1KR4A 2DO0A 2AYEA 3NF7A 1HBOB 3I8BA 2JLFA 4GKKK 4UUXA 3TR5A 4I6MA 1VI7A 3OYBA 1VSHA 3KJNB 4ANDA 1S9GA 4LFCF 2FZGB 1RT5B 1VQNS 4ILMA 3R5CA 4HWIA 3VALA 3SMSA 4USUA 3OD2A 1WBDA 2GS8A 1F2GA 1LEOA 2DNNA 3Q8PB 1HKGA 4RWTA 3BV8A 4YB5A 1YJ9S 2E6LA 1VLOA 5LSLA 5KGWA 1RAAB 2LKZA 2WW4A 4XPEA 4CHNA 2R2RA 1BCMA 1NO8A 2VASA 3CB4A 4PXBA 1Q7YO 3PR4A 3L0QA 3CO9A 2R7UA 3SSQA 3MM5B 4GO7X 2E2QA 5IS2A 2MY7A 1L5UA 2UU9F 4MKYA 5F3ZA 4WXWA 2ZH1A 3B4DA 1S1VA 2PAVA 3CXCR 3NY0A 2YJFA 3HO1A 2CUYA 1WWHA 1T3OA 4YY3F 3G8TA 1J5EK 4IZ9A 2FHKA 1I94K 2GNKA 5HRPA 1J53A 1NKCA 2DT9A 3O3GA 2EVZA 4CBWA 1NOYA 4HDHA 3SSRA 1G4CA 1UFKA 4PABA 1D4XA 3EO3A 2YKAA 4ED6A 4NE9C 4NMLA 3ZT4A 4ILRA 3WXKA 5HMYA 4FZZA 3PX0A 4M7XA 4NA2A 2MQNA 1RT3B 3TAMA 1YIJN 1SQFA 2CQ1A 2ABYA 2O3DA 5LJ5Y 2Z2ZA 1SKRA 2ASPA 2ZEJA 4RG8A 5EY4A 2HBKA 3VQPA 4C8NA 3DMJB 3O8WA 4N8OA 2LEBA 2F63A 2F4VK 1H2VZ 2G8IA 2YQ1A 5DG7A 4LF8F 2WTUA 3Q22A 2E29A 4FO0A 1UPMB 2KG1A 2O8CB 1WORA 1C1BB 5SWMA 1C0TA 2B8PA 5L9NA 3U02A 5I42B 1S6PA 4H0OA 2AW0A 4KIAA 3H8YA 3A5MC 1F1BB 4DV6J 5E3RA 4ENOA 1EQ0A 2AP6A 1IKVB 3AODA 1BGXT 2E7XA 3QAUA 4RU2A 5A8KB 5IZHA 4ERDA 2F8MA 5DDPC 3QZ8A 5KFYA 3HD1A 3O3HA 2EFOA 3TI0A 2ZH2A 3FSXA 3PR5B 4G65A 4PUOB 2RSQA 3DC2A 2K1RB 1NK7A 4X65K 1MN9A 2GZOA 3NGYA 1TK8A 2ZH5A 3RRGA 5FIIA 1DFDA 5DM7L 3FZHA 2ATQA 1U25A 2E5HA 3CJQA 4Y0FA 1JXLA 4WK1A 2W40A 2E2PA 3AO2A 4OGCA 4EAHD 2H54B 3PO5A 2CJQA 3EJMA 1T03B 3ELHA 3OS0A 2VZ9A 3AY9A 2Z4PA 3D2EA 2N4DA 1FT8A 3V6KA 1QTNB 2HBYB 2KKHA 4CJSA 2E1AA 2HQDA 2FZKB 4KHQA 4M5GA 1JK9B 1SC3B 1MW7A 4L3NA 2AEJA 1GLJO 4XH5A 2B4VA 3TUZC 4M3UA 3QIOA 1U1OA 3LANA 2CIMA 2FQQB 3KLEA 4Y2MA 2XWYA 2IVNA 3MEEA 1T6CA 2V5HG 4M3WA 1T11A 3DM2B 3KLIB 3VN5A 2FIUA 1F9FA 3M6UA 3G2XA 2X1BA 1JLFA 3N5BA 2EK1A 2G2YA 1ITGA 1T9XA 5H9FK 4W5QA 3MAAB 4ED0A 2C22A 4W92B 1Y5IB 4CJQA 4LSZB 4A8MP 3WC2A 3S41A 4DR2K 2KDOA 2ZVIA 2BANB 4BR0A 1EXQA 1I6JA 3QEXA 3CJKB 3A4TA 4DV2J 2VQFK 1X4FA 4AM6A 4WZQA 4J2DA 2JC1A 2VDHA 4RUCA 3AFGA 1HFEL 1GOBA 4X64K 2I2YA 2AQ4A 3BH6B 3I32A 3OUYB 2W6KA 1EB0A 4NZ0A 5L1LA 2F9TA 4OI3A 1YJ9N 3QO9A 4DTXA 4YMEA 3J7ZT 2F5GA 4E1MA 2ZVSA 3M2RB 2YKNA 1R0AA 1IM6A 3AO4A 3UWTA 3D6HB 2RH3A 1R0CB 3CULA 2ROEA 3T1AA 2IDLA 3RGIA 2UXCJ 1VK3A 4HDGA 2FDNA 3GV5B 1ITPA 1TK0A 1YJNS 1B0TA 3ENQA 2CQCA 3CJ3A 4FDFA 1VQLS 1JLEB 2HAIA 4LREA 2UXDF 3PZPA 4CEBA 3W3SA 2VFUA 4OLBA 1HKBA 2O4GA 2E1MC 4CNYA 2EXUA 4JYAF 3C15A 3KKRA 1N6QA 1IG9A 3EGZA 3OYHA 2HG4A 1MWYA 5L9XA 2VB6A 1O8BA 2OELA 4A48A 2CZVC 1X4EA 1K6YA 1ZM9A 4NCAA 3W3DA 5G0RA 3BH7B 2HLUA 3NKYA 4QIGA 5KFZA 3HF5A 1FFSB 2KZMA 4ECWA 4DV1K 5J2NA 1X60A 2UUAJ 4M5MA 5SUHA 2E44A 3KHRA 1TELA 1UOCA 1G6BA 4FLYA 3T7ZA 3M4XA 4I1TA 2JRSA 3C95A 4FZYA 5B09A 1HYSA 1X0FA 1OYDA 3OYAA 4LF6K 2MZSA 1QVGR 4ZLNA 3H4BA 2E66A 4JI1F 2XSJA 2IRYA 3L2QA 1IBKJ 3U3YA 3IFRA 3PYFA 5HP1A 3AH6A 1O5JA 1UVJA 2E5LK 4QS9A 1U24A 5E3QA 3VQ4A 3NS6A 4Q44A 4P2MA 3FLCO 3R7BB 3L2RA 2F9JA 4L3QA 4CF9A 1RDRA 4CGJA 1SL0A 1WF1A 3DLBA 3C6UA 3ADAC 1SC4B 4E1NA 1PBUA 2MQQA 1AFIA 5B8HA 2HFSA 1NSPA 4YQWA 1GEHA 3KK1A 2YPYA 1NK8A 3H08A 2K8GA 2KM8B 3KKFA 1JLGB 3LF0A 4RNMA 3H2VE 4A59A 4A2AA 2XLIA 3UR0A 1H1VA 4HACB 5KG5A 1N5VA 5KT5A 2VG6B 3HPGA 3ZYYX 2GMJA 3CD5A 4ED8A 1KC8O 3AVJA 2W9BB 3J7YP 2WTFA 4V1Ak 5D4PA 1LAVA 3BSNA 3MN6A 1PO6A 4Q5VA 1GNKA 3M7VA 4N47A 1BUPA 3HP6A 5T41A 1WNSA 3MXIA 3HSTB 2UXBJ 4IOCQ 1VQKS 5BR9A 4DUYK 3G87A 3HULA 2FJEB 5MLCQ 3PO4A 5CH7B 4DV2K 4DV7F 3MECA 3TJAA 4DL6A 3AVFA 2B4JA 1U1RA 2D0CA 3ZSZA 1GLDG 4CD3A 2CNKB 1VQON 1A5WA 1N4LA 2RHSB 2PD1A 3NWGA 1UA0A 2D3UA 3PY8A 3SAHA 4HLBA 3F73A 3SDEB 2VG7A 2CVEA 2DRDA 1NDLA 1ZZFA 1FJCA 1WUAA 1RAEB 2G2OA 1ZTTA 2RNEA 3GIIA 3CJ0A 2PIIA 4RJVA 4DR5F 2ACMA 2CJAA 2P9GA 3EE8A 4DV5K 3CCEN 5CABA 1UZHA 3SPZA 4JYAK 5C2GA 3A8KA 4EZ6A 2OJ3A 4OYAA 4PEOA 4KY3A 4WZMA 1U2RA 2F8EX 1NJWA 2XLKA 3ILJA 4YDUA 3V6DB 2D3O1 3CO0P 1HWUA 4ED4A 3GIMA 4B1WB 2QC3A 3QNNA 1WACA 2Z2YB 3V4MA 3Q7BA 2UZAA 4Y3CA 4GC6A 2HNDA 5GIPA 1VRQC 1HJOA 5AQLA 1SB6A 2FTRA 3V6JA 1LWFA 4QCLA 4CERA 5M1KA 5THWA 3IM8A 1EX8A 4WYBA 4NMXA 3MGJA 2HFOA 3LM9A 3HHLC 3CCWA 1GT8A 4USIA 3IKMA 1VQ9S 3LA0A 3RW7A 3O9SA 4U96A 4CHOA 5BREA 4KGKA 1FRIA 3LPEA 2M88A 2FVRA 4ICLA 2HRTA 1C0MA 1RAIB 1U47A 3OFEA 2NXJA 1KAXA 2MSSA 3A8IA 5KFJA 1S1TA 2VG5B 4FSVA 4CNZA 3DLLL 4EU0A 4U67Q 1RBAA 4B3TF 4B3TK 1K9MT 4ANEA 3A0IX 2PA3A 3A3OB 4V19J 1HYVA 5LMUJ 5RUBA 3TWZA 2B5JA 1U2VB 3MMBB 4F4ZA 4J7CA 2JVOA 5KFEA 2MSTA 1FRJA 3IS9A 3BYRA 3D0IE 2J0WA 4BBYA 3C66A 2B3TB 5ELZA 4LF8J 3DN9A 2F7TA 1BQNA 2VPWB 5IOLA 2IMWP 4Q0BB 5IT9U 4RUHA 2MKKA 5D4LA 3PNIA 3D1QA 5DRKA 3FSIA 4NCBA 1VQ8S 3L4IA 3R97A 3ZZPA 1RT6B 4UY8O 2G9OA 5E84A 3ZSVA 4JKHA 2KJVA 3NS5A 5HLFB 2QWPA 1YWXA 2WZ1A 3WBZA 3MPYA 2FB0A 4LF4K 3O1WA 1F0XA 5BRFA 1RT7A 2KRBA 4NLOA 2D9PA 1FX4A 5HL7L 3PRDA 3GLJA 5KFHA 4YOYA 4PHTX 4FJIA 3FCHA 2HPUA 3LL3A 1RSCA 5HRRA 2OUGA 1WC0A 3KJVA 2A3JA 2BM1A 3KIOA 2AKWB 2GQQA 1TV6B 2FLPA 1UPPA 1N88A 1RA6A 3MCNA 2RF2B 1NBWA 3OJUA 3VQCA 4CK1A 5KG1A 1WSJA 1IQTA 1PJ7A 2OANA 2GVZA 5DLFA 2ADCA 1S3XA 2IVFB 2HQGA 4O4GB 4AHTA 2BRKA 5EWFA 1HNZF 3NCIA 5C7PA 3RBEA 4C0OC 3WXIA 1XUPO 4IWVA 3BEGB 3G4SS 3W5YA 3M8QB 2YWFA 3O6QA 2Z57B 1S6QA 2U2FA 4BRPA 4A57A 1AZSA 3MMCA 2V8PA 2CYYA 2OZMA 5K8NA 2Z58B 3DU5A 4DSIA 5C24B 4DV4J 2R8HA 3THYB 4CLSA 2Z1IA 1I3AA 5IWAK 5AQRA 5DO2A 2Z2MA 3EX7B 5E7OB 3TEHB 2H5EA 1KHWA 1XNRJ 3CE8A 4JI7K 2VPXB 3O2IA 3B6OA 3T3FA 1S5ZA 4MIAA 3IP0A 1WHWA 4O4RA 2BOAA 2ZJPQ 3RMAA 4Y2KA 5D0EA 3ITHA 3K5LA 5LJWA 4ZP9A 2FZCB 3DRYA 2CPJA 1FFGB 3E2EA 4DSLA 3R5GA 1S59A 1LWXA 1UJ5A 4ILGB 5KQ8A 2RQMA 4DZ6A 2UUWA 4FJXA 3MXHP 4CLPA 2IDOA 4ID8A 2IJFA 3TSUA 5HJYA 3SIPB 4EZ9A 1FWLA 5KFSA 1GX5A 3I0RA 4J9PA 1PCAA 3DOMB 5HI7A 2O4IA 2CPFA 4OYMA 1ZC6A 2E8AA 3LQVA 2D74B 4XPCA 3KUEA 4B3SF 3UDEA 2EBEA 1JLCA 3IBFB 4DN9A 5F8IA 2XZWA 3CF5Q 4M3ZA 3C6AA 3FZFA 3GONA 1WSEA 3P49B 2I6WA 3Q89A 3AO1A 3MAHA 3VETA 2VC0A 3Q2SC 1VMBA 3P31A 4USKA 4CBUA 3H2LA 4OZNA 4WP9A 2UVVA 3DOMA 2GWJA 2V4RA 1ZBHA 1YJTA 3CDBA 1XNQJ 1CJTA 4H4KC 1RTIA 3OW2M 1TUYA 2P9PB 2KI2A 4GVBA 3O9RA 3ZT1A 3L8BA 3KYLA 4FL9A 1Y97A 2YHBA 1MROA 1KRPA 4JI2K 2OPPB 1RTDB 4YOXA 2QK9A 3KG0A 3VVTA 4IKAA 3ZT3A 4HHJA 3V9SA 2YH0A 4DR6K 4D3GA 4ED3A 3C7NA 2V0NA 5AZJA 3G25A 3C6HA 4CFDA 4BG8A 5CYMB 3CG7A 1NH7A 5EX0A 2UP1A 2V6AA 1NB2A 1OY6A 2NS1B 4BC5A 3DOKA 3PDNA 2IM2A 3EGNA 3N4PA 4HHTA 5CZ2A 4KE5A 2D1CA 7AT1B 1XQSC 3EICA 1ASWA 4J9VA 1WUUA 5JS2A 1CVJA 3GJQB 1P27B 4OJ1A 2V8DA 4R0JA 4K2XA 2ZH6A 4JI0K 1ZAVA 5DJBA 4YN3B 3CCTA 3ENBA 4B3RF 4PG7A 1RT1B 3TAEA 1KTVA 1QE1B 3K7RA 3IAM9 3J7YU 1EARA 3W2WA 4QWDA 2EHGA 1HUXA 4ECSA 2AJQA 4CJ5A 3EUNA 3BSAA 1F3FA 4JRQA 3M9MB 3BO3A 2IA6A 4WFBL 3S01A 2V4JB 3IRWP 4JI8K 4A8QA 2A18A 2YX7A 1Y5NB 3GIJA 3BDPA 1D9FA 3W61A 2I5JB 2H65B 3D6MB 3ZNUA 5FPNA 3QZ7A 3SQGB 2KL8A 3GR0A 3OTOF 3M8PB 1V4SA 3TA2A 1KONA 5J2QA 4M3YA 3JQJA 1YAGA 2X74A 3MM5A 2ZWOA 1UA1A 4DR1F 2UXBF 1Y00A 2UV8A 4L8RB 3CVKA 1DJ0A 4LF8K 3FMWA 2PI5A 3BPDA 4QR1A 3NOGA 1NKEA 3M3ZA 2P5GA 4RO0A 1S99A 3CCQN 3PIPQ 2ZUAA 3D7SB 5KGXA 1RLCL 1CQMA 4WU2A 4FJ5A 4FJ7A 1RDDA 4MT1A 1VRUB 2B0GA 1Q8LA 4IFEA 4WCEL 4YB7A 3N6NA 4R0EA 1S9GB 5D0RA 1LW2B 4QWAA 3JQMA 2FJBB 5HVHA 1YJRA 1SUQA 2ZFHA 3S8SA 5J2MB 3SI8A 5AZIA 2YXLA 1Q81T 1D0EA 1FKPA 2KT5A 4LRAA 4ECQA 2BE7D 1LXNA 2Q6BA 2NLWA 4NEZA 1B9DA 3CD6N 4X65F 2CNLB 4E8UA 3EGVA 5CCLA 4CGDA 2BABA 2VA3A 4J2BA 1BHNA 4W5TA 2CGJA 5KFRA 1YJUA 2NYHA 4CGHA 1IR1A 1IG8A 4P73A 1J54A 2QZ8A 4DQ8A 1C0UB 3BBBA 1I39A 1FX2A 4RL1A 2P9NB 2HRYA 4FM2A 1Q16B 3WIUA 4F4AA 4DL4A 5GAEI 5CZ1A 2UUTA 3MR5A 2FHJA 4CJ4A 2N3LA 6FDRA 4KFBA 1JL1A 2YHAA 4ELVA 1P1TA 2IBOA 1Y11A 4USMA 4QR0A 2I7PA 1M5OC 5ITHA 2UVUA 2RMLA 1M5HA 2HFNA 5KFBA 2JFDA 4CH0S 4FWMA 2DXFA 4DR2J 1W7AA 2MZRA 1S0OA 2VONA 1VC6A 3SQ4A 4NLQA 2HHQA 1UWBA 1RWWB 3AXMA 5CYJA 2AIRB 5C25A 3DRSA 2P9NA 4BE1A 3EVMA 3UKRA 4OHXA 3NH1A 2JEFA 2OTLS 4EBEA 2MZTA 1FDNA 2JSXA 5FDLB 3MXMA 4C3MA 2GTDA 2JDJA 3M2VA 2B4OA 4DL0C 3HM9A 1N5YB 1YHQN 3GWCA 4DU4A 1Q8IA 3OS2A 5K14B 3K17A 4DU7A 3J7AP 4LF7J 2FBTA 2AJ4A 4BY9C 5K8MA 3SUNA 3OT9A 2BQ3A 1FESA 4PCQA 3KLGB 4YEAA 3FUYA 2OEKA 5ADXH 2R8GA 4H0VB 4QIFA 4MDBA 3CJTA 2BTFA 1OYEA 3PSIA 2RDJA 4LFBF 3W5XA 3BBFA 4LF7K 3V4IB 2H4WB 4JYAJ 2E2OA 4JI3F 5KRSA 3CGIA 4CGIA 4LF9K 2QL9B 1XHZA 3I82A 3FRYA 4ZPVR 4KYZA 2YWHA 3MN5A 2CJKA 3T1HJ 1HNIA 1RWXB 1YK9A 1N36F 3HMJG 2XS5A 4WFAQ 2GIRA 2WOMA 4X62F 2P9KB 4EFAC 4YHHK 4WIIA 1GLEG 4H4KA 1RT4B 4BRNA 1NGDA 3TR8A 2OD4A 3D0PA 3ILOA 4A8XA 4DKWA 5I3UB 4F4YA 1J6ZA 3RJMB 4M5KA 3OYNA 2V8VA 3HI9A 4P52A 1YJWS 2X1AA 2DPNA 3VEOA 1Y3KA 2O8DA 1E4FT 3AQPA 3R5AA 4DUYJ 3GSDA 1X1PA 3IA0A 2IYGA 2ZH8A 1REVA 1C4CA 3KLVA 3P5JA 2MHNA 3GJSB 5A8RA 1KN6A 2OHDA 4QS8A 2MKHA 2LCWA 5E0OA 4WFNQ 1BQNB 2NRTA 4CHPA 2GV9A 1DTTB 3D3CJ 1N0UA 2WONB 4LVNP 3T1YF 3AA8A 1T02A 2HGMA 5ADZA 4RNHA 3A8YA 2EKYA 3M2UA 2F8TA 2I0XA 1HLWA 1ZAXA 2VJUA 4CW7B 3IMXA 4C8YA 1FE4A 3IDHA 1CC7A 2BE2B 3QT6A 3MHYA 2QWQA 1KWMA 4JI5K 4U7BA 1VQMN 2ZBPA 4KRWA 4JK9A 1T8EA 4CJTA 1ESVA 3HVAA 3WEEB 4ZJLA 4CYUA 1RBVA 4Y00A 1HI8A 2FC8A 1V3ZA 4NLBA 1RJJA 1HNWJ 3U6FA 2F65A 3ID6A 3LAMA 2VH7A 4RU9A 1MU2A 2FGCA 2ZBRA 2X51A 2YWEA 2YNIB 4JI8J 1RTIB 4MKAA