3IS9A

Crystal structure of the hiv-1 reverse transcriptase (rt) in complex with the alkenyldiarylmethane (adam) non-nucleoside rt inhibitor dimethyl 3,3'-(6-methoxy-6-oxohex-1-ene-1,1-diyl)bis(5-cyano-6-methoxybenzoate).
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
554
structure length
554
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic study of a novel subnanomolar inhibitor provides insight on the binding interactions of alkenyldiarylmethanes with human immunodeficiency virus-1 reverse transcriptase.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Transferase/hydrolase
molecule keywords Reverse transcriptase/ribonuclease H
total genus 134
structure length 554
sequence length 554
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3is9A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3is9A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3is9A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3is9A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3is9A05
3CYMA 4M3RA 4FBTA 1YTUA 4RW9B 3QIPA 5F8IA 2UVWA 5KFMA 4CF2A 3DM2A 4ZVGA 2B6AA 1JKHB 1DLOA 2HNZA 4FVMA 3VQCA 3OLAA 5EUHA 4B8AB 1RBSA 5HP1B 1HARA 2YNHA 2EX3A 4ID1A 3AA2A 2Z1JA 3OYGA 3RR7A 5L1KA 3KHGA 4J2AA 4KHUA 3IS9B 4DEZA 3V4IB 1K1QA 2FJXA 1EP4B 4FJJA 4MFBA 1FKOA 4FJIA 3MEGA 3U3GA 4KHMA 3T5HA 2PY5A 1NK5A 1C0UB 2YKMB 3QO9B 4DSFA 3SUOA 4RNNA 1TL3B 2D0BA 3EZUA 4TYBA 4WFYA 2XY8A 3NF9A 3OJSA 3K5MA 3LP0A 1TL3A 4DTXA 1QE1B 2V4QA 3TARA 3B6OA 3AVGA 3C95A 3OYMA 1JIHA 3DLKA 3DLGB 4KO0B 2G8HA 2BANB 4MFBB 3WNHA 3FDSA 3H5XA 4FZYA 4F2SA 4OKJA 3PZPA 4JS5A 2KZMA 1RBTA 2GC8A 4Z0UA 3NFAA 5KRTA 3BSOA 3O3GA 1JLFA 1D9FA 1XWLA 3M8QB 3FFIA 4DQSA 3MR2A 1RT4B 3CM5A 1VSFA 2LSNA 2V9WA 5K14A 4KB0A 3IRXA 3KHLA 2I5JB 3T19A 2HWHA 4ZP9A 1FKPB 5F9NA 4CE9A 1S9EA 1Z25A 4FBUA 3JYTA 1KFDA 3D45A 4R5PB 1JLGA 1LV5A 4H8KA 3SZ2A 3VQEA 3KMSA 4CEDA 1RTJB 2V0NA 4RUAA 4DG1A 3V9ZA 1RTDA 2E9RX 4LSNA 5J2MA 1DLOB 5T7BA 3FRZA 3NAEA 3RB0A 3OYCA 3H5SA 3TAGA 4TY8A 3L2RA 1NJWA 1S6QB 5DK5A 2RN2A 3RMAA 3Q8RB 1Q9XA 3PY8A 5DG8A 3ZT4A 1YVFA 4AHCA 2G8UA 3QGIA 1S48A 1CLQA 1ZBLA 1T03B 1N6QA 2ZE2A 2W8LA 4Q8FA 4OGEA 5KG4A 2J6TA 1DTTA 4DL3A 1U49A 4O3PA 3CFOA 4CF0A 1TAQA 3H59A 4ELVA 4F2RA 4Q45A 3TVKA 1RA7A 5EWGA 3ZT2A 3RTVA 3MECA 3HK2A 4CEFA 4KREA 1HNVA 3BQ2A 4AH9A 1IKYA 2IOCA 3MF5A 2DFEA 1S1VB 3M9OB 1BCOA 4M95A 4IDKB 5DQHA 4KI4A 3PX6A 4ZPCA 1EETB 4NCAA 2HW3A 2GIRA 4J9PA 4DTUA 1RBUA 4ZVFA 4EBDA 1ZETA 3RR8A 4M3XA 1TKZB 4NLDA 2VA2A 1NOYA 4M3UA 4RW6A 3V4IA 4CFBA 3K5NA 4KTQA 1TQLA 2ETJA 4I9QA 1NKBA 5CYMA 4IFVB 1ZBIA 3ITHA 4DG1B 4B9VA 1S1UA 4Z4CA 1Q9YA 5CYMB 3ISNC 1UOCA 3D5MA 2QXFA 3LP0B 5FDLB 3QGGA 5F8NA 3SYZA 4DF8A 2G8IA 4WFXA 4ZHRA 4PWDA 4M45A 4K50A 2HHXA 4PA1A 4W5TA 3NGIA 4OL8A 2I5JA 4ZHRB 4PWDB 3TAFA 2C2DA 5I3UA 4TYAA 3L2VA 4ELTA 4NLXA 3GQCA 2WOMA 3SPZA 2WTFA 1VRUA 2KZZA 4TQRA 2YNGA 3NF8A 1WSIA 3QIDA 3GV5B 2EHGA 4CCHA 3DRPB 5J2QB 3HKWA 4CFAA 2X74A 3AVAA 2C22A 1Z26A 1RT3A 3RB3A 3QIPB 4FLZA 1T03A 3K2PA 1C1CA 1EETA 2FVQA 4DU4A 3VQSA 2AGOA 3QNOA 3RBEA 4HUGA 4FXDA 1NHVA 2O5DA 1C6VA 1TV6B 4G1QA 4Y3CA 1B92A 3PX0A 3HPHA 1RBVA 1GOBA 4OVLA 1N56A 3HSTB 4CJPA 1I3AA 3TANA 5KFEA 4NLRA 4DTRA 3KOAA 5DLFA 2AX1A 3SV3A 3CWJA 1TGOA 4WYWA 1IO2A 4FJNA 2FC0A 5EU7A 1WNSA 5KFLA 1U04A 5KG7A 1B9FA 5KFJA 3MEDB 1N6QB 4DWIA 4OJRA 3WNGA 4FLWA 2IAJA 2R2UA 3QERA 5SWMA 4CHPA 3VQPA 3DLHA 1IKWA 1TKXB 1ZBFA 3AVKA 5KT3A 4FJGA 1G15A 4RW4B 4FZZA 3V1OA 2HNYB 4EP4A 1LWFB 4CIEA 1TKTA 4ECVA 3M8SA 3OYJA 4DTSA 5KG0A 1U45A 2XHBA 3VQDA 4CFDA 2VG6A 3SUQA 2F8SA 4E3SA 4FS1A 1UAXA 1JLFB 2XWYA 2R8GA 1NK4A 3S9HA 1SUQB 3AVNA 3QZ8A 2XI3A 4YQWA 2Z1GA 4XPEA 1RT6B 4ICLA 2BANA 4M41A 3CFRA 4QWDA 1RTHB 1S9EB 3P83D 1KTQA 4FJ9A 4EYIB 3EPIA 2PYLA 1FKPA 4O4RA 2HHVA 1L3VA 4E19A 3EZ5A 3SQ4A 3BQ0A 1Q8IA 4CECA 5KFKA 2IA6A 3P5JA 2IS3A 4DSKA 1NKCA 1ZBUA 1JLCB 3NCIA 5CZ2A 4YR3A 4IG0B 3HYFA 2HHTA 1QS4A 3MFIA 5KI6A 3I8DA 3DOKB 3THVA 2BGGA 4DFKA 3OS0A 3NE6A 3GIJA 4JV0A 1U48A 4CEZA 3E01B 4R8UB 4HCCA 3DLEB 4IRDA 1NK6A 5DGBA 3RMDA 1T8EA 3LWMA 4F3OA 3QZ7A 1WAJA 2BRLA 1JLCA 4ZP6A 3N6LA 1QE1A 4WZQA 1C0MA 5FRNA 3QEPA 3KHHA 3TAPA 3AVHA 1SKSA 3KK3B 3OJUA 3CO9A 5EWFA 1ITGA 3MXMA 4QW8A 3AO3A 2R8JA 4C8KA 4FZXC 2RKIA 3N6MA 4OKEA 3PVXA 1EP4A 3DYAB 1XR6A 4X2BA 3MEGB 2W9AA 3PW4A 2DY4A 4IFYB 2BQUA 3HP9A 3OSNA 3MFHA 2W7PA 4DQQA 3ISND 1TK8A 3H2LA 4ZTFA 3PR4A 1JLQA 2QKBA 4RZRA 4DFPA 5SZTA 4ECYA 4CJUA 3HPGA 3RMCA 3PW0A 5KFAA 3NGYA 4ZPBA 1TKZA 4J2DA 1IKVA 1JLBB 4EO6A 2JEGA 3MR6A 5HRNA 2XCAA 4OLBA 4JRQA 3TR8A 2FBYA 5C42A 1NK9A 3C6UA 4IDKA 5F8JA 3OYLA 1ZTWA 4Z4FA 4LQ3A 1YT3A 1S6PB 1EX4A 1BCMA 1S6PA 2BE2A 5KRSA 4KAZA 4CJEA 4KFBB 4KPYA 1TVRB 3OL7A 3TI0A 4KE5A 2PZSA 3S3OA 1TKTB 4QPXA 3MEEB 2C2RA 4RNHA 5D3GB 4RW4A 1WLJA 5F9LA 2YHAA 1BL3A 3O3FA 5J2MB 3BREA 3V81B 1KCFA 5KG3A 2XRIA 1RTDB 3KK1A 4K8ZA 4FW1A 1JX4A 3Q8PB 3HJFA 3EY1A 4CJRA 4F8RA 3QLHA 1HYSA 2OPSB 3CJ2A 5KFFA 4KKOB 3Q8SB 5EDWA 3RMBA 3KJVA 4MIAA 5L1IA 5J2QA 2ILZA 3OVNA 5L1JA 5T14A 1KHWA 4DLEA 2ITGA 3K5OA 4E7LA 1XHZA 3NGZA 3HXMA 4EBEA 4QAGA 4Y2AA 4DSLA 1VSEA 4JUZA 3F73A 4K4XA 3H98A 1NKEA 1HPZA 2QE5A 2E6LA 2BQRA 1D1UA 4NCBA 4IRCA 5KFXA 1RDAA 3QETA 2YNFB 2OPQB 2IM0A 4IFYA 3F9KA 3H40A 3M8RA 4CJLA 4J9LA 2RKIB 2P5OA 1LWCA 2YKNB 5KFVA 2OPQA 2G8WA 1Z4UA 3CJ4A 2WB4A 3RB4A 1LAWA 4EBCA 3MAQA 1JXEA 4IH7A 4E7IA 3ZSQA 3MR5A 4N5SA 1LWCB 1HPZB 1S1XB 2DFFA 1RYSA 3DI6A 3U3YA 4DTJA 5HLFB 1S9FA 4CJWA 3CQ8A 4J2BA 1ZBHA 4QWAA 3RBDA 1O1WA 2IGIA 2OZMA 1UA0A 4NCGB 5I42B 3H4BA 4FJMA 4KSEB 4CGDA 1WNEA 4CGFA 1NK0A 2D41A 2BE2B 4J9QA 3L8BA 5FDLA 4MQ3A 1X1PA 4H4MB 3T1AA 2HNDB 4YR0A 5JUMA 2X6SA 3OL6A 4ED8A 4DTOA 3HO1A 5KT7A 1C2PA 2G8FA 3VQ6A 4Q5VA 4KHQA 2PYJA 5KFNA 4IBNA 1HQEA 4O44A 3MXIA 5KFIA 4RW8A 4CJFA 1C1BA 4CGGA 1HRHA 5J2PA 4AILC 3KLGA 3PW5A 3L2WA 3KLHA 4NLTA 1RTJA 4FLTA 5KFWA 2IC3B 1S6QA 1HQUB 2VG7A 3TQ1A 3VQ7A 4ECTA 4K4TA 4JLHA 3V9WA 3HVTA 3JSMB 3T5JA 5KT2A 1KHVA 3HM9A 3CIZA 3ASMA 3H5UA 3NBPB 5DGAA 4CF1A 4YFUA 1BI4B 4Y1CA 3RB6A 3SI8A 1D8YA 1XHXA 1S97A 3WNFA 1B9DA 4IRKA 1U09A 1NNDA 2KW4A 2G8VA 1U47A 3NHGA 3PV8A 3HPOA 3DLEA 3VA0A 2J6SA 4KTWA 1I6JA 1R0AA 3L2UA 5JS1A 2A1RA 3KNAA 3SUNA 3O4QA 4DSJA 3OL8A 5KFZA 4ZPAA 2VWKA 4ECSA 4FLVA 3NH0A 4CEEA 3KLFA 2FBTA 5DG9A 3CDEA 1KVAA 2W42A 2OPRA 1CSJA 3T5KA 5KFRA 4H4MA 4LY7A 1ZYQA 1UWBA 4ZVEA 3BSCA 4G3IA 1RDCA 4O4GA 4GC7A 1X9WA 3D28A 3NL0A 3IN5A 4CJ3A 4O5BA 2AGQA 1JXBA 4LSLB 4NCGA 4J9MA 5C25B 4NLYA 2YHBA 2HWIA 5I42A 2Z1IA 5KFHA 5DQGA 1RDRA 1D0EA 3HP6A 4Z4HA 4BACA 2IM1A 1RT6A 5HBMA 2IMWP 2HHQA 4CERA 3IS9A 3V9UA 1SUQA 3ALYA 3M8QA 4AHSA 2OPRB 3HVAA 1OS5A 3PX4A 1X9SA 3N6NA 3G6VA 4ECQA 3DMJB 3DDKA 3TWHA 3NMAA 4H4OA 1LWFA 1F21A 2HNYA 4CIGA 1RA6A 3G10A 3DRSB 2Q3SA 3HL8A 4EYHB 3V1QA 2DPJA 4DF4A 2ZD1B 1SH2A 4NLGA 1S4FA 3TAMB 3NGDA 1C1AA 4KRFA 1C0TB 2AX0A 3BSNA 5D3GA 3S3MA 1JLEA 4O3SA 4CF8A 5HROA 4RW7A 2WK4A 4I7FA 4RNMA 3CJ0A 4ZTJA 2XGQA 1SV5B 2JEJA 4ED3A 1BIUA 2FBXA 4F3TA 3Q8QB 2ILYA 3SCXA 4MK8A 1A5XA 2Y1IA 4OLAA 3KD1E 1RNHA 5C24A 5C24B 3DOLA 5F8LA 1ZTTA 1RT5B 4AHTA 1S1WA 3AVLA 3RAQA 1KVCA 3DM2B 2WHOA 1IKVB 1JLBA 1S0NA 3CM6A 3SQ2A 1IKYB 1R0AB 4TY8B 3LP1A 4OKKA 5KG5A 1IKXA 1RT5A 4DLGA 4HKQA 4NLQA 3L3VA 2OPPB 1N48A 4E7JA 1WN7A 4K4WA 4FM2A 2D3ZA 4G1QB 1TP7A 3OS2A 4L8RB 3VQ8A 3UPFA 1LW2A 4CF9A 1L3TA 4NRUA 1LWEA 4DTPA 3HT3A 2E9ZA 4IQXA 2BDPA 3PJWA 4UQGA 3ICLA 4WFZA 4O3NA 1TKDA 4QCLA 1HQEB 1VSDA 4DU3A 3EPGA 3HVRA 4FLXA 2YNIA 1QSYA 3FFIB 2CKWA 4I2PB 2XCPA 1JLQB 3K5LA 2IM3A 4HCBA 2HNDA 4PQUB 2FVRA 3E01A 4R8UA 2RPIA 4B9NA 4J2EA 5KFYA 3ZT0A 4LQ9A 4HYKA 4M42A 4JRPA 2EC0A 2DFHA 2YNGB 2X78A 3GIMA 3PO4A 1T94A 3SUPA 5CYQA 5K14B 3B6PA 4XO0A 1KFSA 2I1RA 4TQSA 2W9CA 1BIZA 1RT7B 2VG5A 1RT7A 2VG5B 2W9CB 1Y97A 1XC9A 5CYQB 4U6PA 3QYYA 1GX5A 4B08A 3LZJA 4Z4EA 3VQ5A 2ALZA 4K4ZA 3ZSOA 3SNNA 1X9MA 1RT3B 4Q43A 5F8HA 1MU2A 4M3TA 1MU2B 1EKEA 5JXSA 3CJ5A 2FJVA 1J9AA 2XY5A 1QQCA 5EWEA 1HYSB 3DLRA 4IG0A 3S3NA 4WE1B 2AJQA 3BGRB 1RYRA 1RTIB 2ASDA 4IKAA 3NKYA 3UR0A 2D5RA 3AA5X 2B6AB 2FVPA 2UVVA 1ASUA 4B8CA 1JKHA 2HNZB 4ELUA 1NOZA 4DS5A 3IG1A 4Q0BB 4CJ4A 5KFDA 1WSHA 4CIFA 3QEWA 4BDYA 3GYNA 3AO4A 5KFQA 3NH2A 1CZ9A 1LW0A 1VRTA 1J53A 3KLVA 3LWLA 2XO7A 3ZSYA 5KFTA 2ATQA 1RT1B 1J5OA 2QV6A 4TLRA 2J6UA 3KLEB 4M94A 3VQAA 3MECB 1KLMA 2VG6B 3OYHA 4CGHA 4FLUA 4B9LA 4U7CA 3DLBA 1REVA 3RRHA 3LP1B 1IKXB 2D0AA 4RW6B 1HYZA 4NRTA 2C2EA 1RT4A 1TKXA 3V6JA 3BQ1A 4NLVA 1FXXA 4AHUA 4N47A 1BGXT 5J1EB 1D5AA 1J54A 2IAJB 3L2QA 3NF7A 4XPCA 2QK9A 1KVBA 1TK0A 3OYEA 3V9XA 3ZSRA 3FSIA 3CJ3A 1JLGB 2BQ3A 3ZT1A 1RILA 2RF2A 2B5JB 3NBPA 1SL2A 3PO5A 2RDJA 4WXOA 2RF2B 3LZIA 3RRGA 2WRMA 1QHTA 3IRXB 1VRUB 4CHOA 4E1NA 4FCYA 4H54A 1C0TA 2ASLA 2VG7B 2XY7A 4DQRA 2AQ4A 3AA3A 1GX6A 4IH6A 3LAKA 2ZD1A 2UVUA 2HHUA 4W5NA 4K4YA 1C1CB 4Q44A 4E1MA 4GVMA 4TY9A 3GV8B 1BISA 4FJ8A 4J9OA 2WONA 3GILA 1YVUA 3NF6A 3OHBA 4Y1DA 3K59A 1TK5A 1W0HA 3C6TA 4ID5B 3GIKA 4ECUA 4O0JA 4I7FB 4IH5A 4LSNB 5L1LA 4CGIA 3DLGA 4KO0A 2BR0A 4EZ9A 1DTQB 3DRRB 3ZSXA 3KLEA 3M9NB 3SV4A 3QNNA 3ULDA 4NLOA 3LANA 1SL0A 4K8XA 2WONB 4JV1A 4BWJA 4RNFA 4FJXA 4ED0A 3V1RA 3H08A 3A2FA 3VQ4A 3H4DA 4RNOA 4NYZA 1RCHA 1QUVA 3VQ9A 2XI2A 3VN5A 1HNVB 3NAHA 4M3WA 1W9HA 4HHTA 3CDWA 1S1UB 1XI1A 4IFVA 4MKBA 2W7OA 2NUBA 4FJLA 1VSKA 2HMIB 1BQNB 4F4YA 4YP3A 2E9TA 4FK0A 4E7HA 3HHKA 5HBMB 4QW9A 1SKWA 1S49A 4N76A 4W5OA 4CHZA 2P1JA 1VSHA 4CK2A 3HVWA 3AVBA 1WSEA 1JL2A 3KTQA 1CXUA 5KFSA 4LSLA 4Y2CA 1IM4A 3SFUA 4DTMA 3QIOA 2IDOA 3M8PB 3NDKA 4DSIA 3V6DB 1QSLA 2W9BA 2HHWA 4KB7A 2F8EX 4O3QA 5DMRA 3P1GA 4OGCA 2B5JA 3UQSA 3SQ0A 1N4LA 1IG9A 1WSFA 4LH4A 1NHUA 1S10A 1TL1B 1JLEB 2UUWA 1DTTB 1HNIB 4B3OA 3TAMA 2AGPA 1SH0A 2OZSA 1RAJA 1RT2B 3KLHB 4F4KA 2FBVA 2YNHB 3C94A 3VQBA 4C8OA 3VA3A 2HVHA 3LP2B 3KK2A 3KKSA 2ASJA 2JC1A 3IG1B 4Q0BA 1UA1A 3MR3A 3K57A 4MH8A 4DS4A 4F50A 5CZ1A 1NJXA 4W5RA 2UVRA 1S0OA 3PW7A 1A5VA 4ZP8A 1RTIA 4DMNA 4N56A 4IKFA 4WE1A 5FROA 3HVTB 3JSMA 3QINA 1RT2A 4WYLA 4EP5A 3I0RA 3NH1A 1TAUA 4Z4IA 4E89A 3O3HA 4TN2A 1NJZA 2R7YA 4R0EA 3NAIA 4RW7B 5KT5A 4BDPA 1WAFA 3AVFA 3QESA 4HUEA 3SPYA 4KV8A 2P5GA 3G6XA 1TV6A 2WCXA 3LPTA 1N5YA 3M8PA 1S1XA 2AU0A 1U4BA 4H4OB 3DI6B 4GC6A 3AA4A 1CXQA 4J9SA 4FS2A 3BJYA 5HRPA 3ITHB 4CJKA 3OYKA 3BGRA 4K4VA 2JC0A 1GOCA 4C8NA 2FJWA 2YKNA 5L9XA 2R2TA 1QSSA 2CJQA 1ASWA 1BQNA 3DLKB 4CFCA 2R8HA 4DL7A 4IR9A 4HVJA 4Z4GA 4CJTA 3AO1A 1RTHA 1VSJA 4ZPDA 2R8IA 4M3ZA 1UWBB 2IJFA 3LAMA 4EO8A 3V6KA 4J9NA 5KG6A 4NYNA 4B9UA 1JL1A 3MXJA 3SFGA 4LH5A 3I5CA 4FJHA 5C25A 4ZMMA 2OYQA 4C8MA 3KLIA 1RBRA 3KJVB 3M9MB 1BQMB 3SI6A 2KTQA 2FLNA 1MMLA 2HHSA 1HQUA 2OPSA 4PQUA 3LP2A 3KK2B 2ZKUA 4ED7A 2X6NA 5HP1A 4RUCA 3G86A 2FVSA 4CEAA 3V81A 4O44B 4M3YA 4ZVHA 3C6TB 4ID5A 4FM0A 4YNQA 4O3RA 3T3FA 1VSLA 1S1TA 4PUOA 3IGNA 3TAQA 5KGWA 4XIUA 5KG2A 2VA3A 4AHVA 4ED1A 3K58A 4KHYA 1IH7A 1QAJA 4CGJA 4CK1A 3ZCMA 3OHAA 4KHSA 1S1VA 1RT1A 4NLSA 5JS2A 4B9MA 4CK3A 4HUFA 2KFZA 4O3OA 4CHNA 4W5QA 4B3OB 3AVIA 1S9GB 1BI4A 1QAIA 3AVMA 4KHNA 3BDPA 4CEQA 3EYZA 4C8LA 3LALA 5J2PB 3UDLA 4CJ5A 3CFPA 1S1TB 4PUOB 2XC9A 4DFJA 4KI6A 1KRPA 4NZ0A 1SL1A 5HLFA 3ZT3A 2IC3A 5KT4A 2OH2A 1FK9B 3ZSVA 1REVB 3DOLB 3OS1A 2HMIA 3PW2A 3QEIA 2QKKA 5F8GA 4ED6A 1LAVA 3U6FA 4E0DA 1JLAB 1T05A 1ASVA 5KGXA 3KKRA 4FJKA 2IM2A 4BE0A 3MEDA 3PUFA 3LDSA 3OYDA 5DLGA 1KSPA 4IR1A 1HNIA 4WXWA 3MTKA 3DYAA 4FLYA 3O4NA 2VWJA 1KLNA 4QWBA 2B4JA 4QOZB 4EZ6A 3SQ1A 3G0ZA 4K4SA 4B9TA 1HMVB 4F4XA 3TABA 1JXLA 4DTNA 4URGA 4FM1A 5KFUA 3JYTB 2O4IA 4I9LA 1HMVA 4KB1A 4CHQA 3AO2A 3DRSA 5HRRA 1L5UA 2GIQA 4F4ZA 4NYFA 3CG7A 4CJQA 1A5WA 3CDUA 3OYIA 4HTUA 2AWZA 4KTZA 4KHWA 4DQPA 4CEOA 1GOAA 3E51A 4BDZA 2F96A 3IAYA 2HVIA 1DTQA 5KFGA 3GIIA 3PJXA 3H5YA 2YV0X 4YR2A 5CY4A 1S5JA 5DG7A 1SH3A 4I2QB 4OPKA 4K4UA 2WOMB 3TAEA 2P51A 3MEEA 2F8TA 4RW9A 4MK9A 5KFCA 4ICLB 5E41A 4KFBA 2JEFA 2DPIA 2W8KA 3DOKA 4CJSA 2R2RA 4MKAA 4DSEA 3FQKA 2FLLA 4KHRA 4I2QA 5KG1A 1WSJA 1C0UA 2YKMA 3QO9A 2KFNA 5KFOA 4RU9A 4ECWA 2OPPA 2ZQBA 1VK0A 2RDIA 4J9RA 1W25A 4QWCA 3KLFB 1SKRA 4GW6A 4F4WA 2D7SA 1FK9A 4DL6A 3T5LA 4Q8EA 1NK7A 4KV8B 1BHLA 3QLHB 3PHEA 2YNFA 1T7PA 1IKWB 3RAXA 3QEXA 1T05B 5J2NB 3FQLA 5J2NA 5F8MA 3CVKA 1KLMB 4URSA 3V6HA 4CEBA 2Y1JA 3WNEA 2HAIA 3D0PA 3C6UB 1K6YA 3I0SA 2G8KA 2Z1HA 4N41A 3QGHA 2C28A 1LWEB 5KFBA 3KMQA 3AV9A 1LW2B 4AHRA 3OYAA 4KKOA 1L3UA 1J5OB 3BR9A 1WSGA 1S1WB 4EEYA 4DQIA 4KAIA 4QWEA 4JS4A 5C42B 1L3SA 2E6MA 5KTQA 3KLGB 1I39A 4ECXA 1NK8A 4CHYA 2GV9A 1C1BB 5FRMA 1HJRA 4IG3A 4YMEA 3I5AA 1TL1A 3KD5E 3OLBA 2A1SA 4PY5A 4ECZA 1EXQA 3DMJA 3L3UA 4DL4A 4J9KA 5HROB 2JLEA 5DQIA 3OYBA 4DL5A 1VSIA 2D0CA 3UIQA 2JEIA 4FJ5A 3OL9A 2B43A 3V6DA 4NLUA 3OY9A 2R8KA 1T3NA 4GMJB 1BQMA 3LP3A 4R5PA 4KBIA 2KQ2A 3IGVA 4FJ7A 2OA8A 1K1SA 2GUIA 3AVJA 4FYDA 3OSPA 4MK7A 4ZP7A 2DTUA 4TXSA 1VSMA 3SJJA 2O4GA 3DRPA 3G6YA 3DRRA 4NLPA 4FK2A 4DFMA 4JV2A 2E4LA 2R2SA 3GV7B 4URQU 4I2PA 4NLWA 1FKOB 2FVCA 4E7KA 1N5YB 2ATLA 4RG8A 1S0MA 3I5BA 4OPJA 2FLPA 3BSAA 1CZBA 2XGPA 2UUTA 3KIOA 4TSXA 3KK3A 4B9SA 4BWMA 1RDBA 2V4RA 1HYVA 4MIBA 3I0RB 4ECRA 2JGUA 3QEVA 3PR5B 5C5JA 1XR7A 3OYNA 1TVRA 1NJYA 3AO5A 3AVCA 4O4GB 2IBKA 4FW2A 1JLAA 5HRSA 3VQQA 4Y34A 1XR5A 3KK1B 4RW8B 4BE2A 5J1EA 2IJNA 2YNIB 4O55A 1QTMA 4IG3B 4DL2A 4DU1A 4IOBA 5KT6A 2D3UA 3LPUA 4CJVA 1RDDA 1YTAA 3I0SB 5KFPA 1D9DA 4FK4A 4CESA 4ED2A 2XY6A 2GBZA 4BE1A 2ZE2B 4O0IA 2W9BB 1S9GA 2BRKA 3OYFA 1SV5A 3ZSZA 3KHRA 5I3UB 4WZMA 2HB5A 4LD0A 1LW0B 3KLIB 3ZSWA 1VRTB 3RWUA 3V9SA
chains in the Genus database with same CATH superfamily
1HWKA 1TFWA 1QQNA 1RU2A 5F8IA 4RWWA 2MKHA 2ZITA 4CF2A 2GEMA 2B6AA 2Z2ZA 1NGFA 1FD2A 2KG0A 2YNHA 4PKGA 3BKUA 2Z1JA 4J90A 4PXDA 2XMTA 3KHGA 5L1KA 2NZCA 3CCWA 4J2AA 2ZGZA 4Z2XA 4FDFA 2RMLA 2FJXA 3A1YG 2C2KB 3GOIA 4FJIA 1XK8A 1JXVA 3DKDA 3OR1B 2CDQA 1T9UA 2W7AA 1GLJO 1R6YA 2HS3A 3AA9A 2PY5A 2OD4A 3EZUA 4WFYA 2D0BA 3K5MA 3OTDA 3OJSA 2LKZA 4DTXA 3D6HB 4LF6K 1QE1B 3TARA 3B6OA 3PRDA 1SB6A 4GVBA 4DR7F 1K8KA 2I38A 3OR1A 2A0FB 3B78A 3R5CA 4NYPA 4MJKA 1F3FA 1B7FA 1N5TA 1N34F 4F2SA 1CBKA 4WIQA 4OKJA 2ACYA 3PZPA 5AR0A 5BREA 4ZK7M 3BBBA 2GC8A 4Z0UA 1YKWA 4P2XA 1D9FA 4DV3J 1E4FT 3MR2A 3CCRN 3DAWA 2FYXA 1RT4B 3A8YA 3CM5A 3G4SS 2QYGA 3T19A 2LQ9A 1JNRB 1YJVA 5GMKa 2HS0A 2CQHA 1RJJA 1CZAN 3M05A 5GIPA 2B7BB 1LV5A 1NGHA 3SZ2A 5BPNA 3CJCA 2XHWA 4MO4A 1GNKA 5J2MA 3ILLA 5T7BA 1RISA 4E98A 3QAEA 3H0PA 3H5SA 1YBUA 5H1SQ 4TY8A 2A2CA 1ATNA 1S6QB 5DK5A 2GMLA 3PY8A 1Q9XA 2HYIB 3S7RA 4QJVA 4AHCA 2G8UA 4BBYA 3QJPA 4ZCLA 1LEOA 2ROPA 1DKGD 4K0KJ 3GLJA 4Q8FA 4HWIA 3O4WA 4CF0A 1A0OB 2AYGA 2R7QA 3P3DA 3AXKA 3RTVA 3QB0A 2KB2A 3X1LB 4CEFA 4KREA 1IKYA 3MF5A 3DU6A 3P6YC 3O9SA 4OI3A 1S1VB 5LOQA 1T02A 4IDKB 3IFRA 4KI4A 4ZPCA 1LOUA 2QRRA 1K0TA 1UJ4A 3LF0A 4BRLA 1RBUA 4ZVFA 4EBDA 2PGCA 3RR8A 4M3XA 4FNHA 4FOIA 3D7EO 1TKZB 3GJQB 2VA2A 2RVJA 1NOYA 2Q3PA 2HFNA 3M7VA 3M8YA 3IWNC 4CFBA 1TQLA 5FPEA 1FO1A 1YBTA 4USWA 4ETXA 2UUCJ 3ITHA 4WWSA 1DAXA 1HBOB 4Z4CA 3LDNA 4OHZA 1GK8A 2A10A 3OVBA 2OANA 2QXFA 3PEHA 4P74A 3QGGA 1C4AA 4DL0C 3SYZA 2G8IA 2YKQA 4ZHRA 4PWDA 4JI3F 1G4CA 4QIFA 4K50A 2HHXA 4AQYJ 3OW2R 4OL8A 4ZHRB 4PWDB 2CJXB 2H4YB 3UE5A 3TAFA 5DDPC 1HNWF 3N4QA 3TA1A 1IJFB 1FFGB 4OZLA 4NLXA 3GQCA 3GBTA 3J80Y 3HT0A 4YEAA 2WVBA 4TQRA 2YNGA 3QIDA 1N54B 1JJ2M 4ILGB 3HZ6A 2IY5B 2NLXA 3IBWA 2CJYB 3AVAA 1WF2A 2C22A 4PZVA 3DHWC 3QIPB 3AY9A 1S99A 1RBAA 1HNWK 7FDRA 4JKHA 2YH1A 2HBKA 4FPAA 2AGOA 3T41A 4HUGA 2VGNA 4BCAA 1NHVA 2E1CA 1C6VA 3Q2SC 5FLXO 3W5XA 3PX0A 2EW9A 4ANDA 1C0FA 2LDIA 2AA4A 3MM8B 4KH0B 4CJPA 4NLRA 1RGVA 3KOAA 1LQ9A 3R27A 3GSIA 5AE1A 4OYZA 1GLAG 1ZPVA 4LVOP 2FC0A 4LIWA 5KG7A 2J9CA 3MEDB 4WFAL 2LU2A 5AXMA 3W9JA 4CIOA 2R2UA 2VASA 1KONA 2QEXS 1RHQB 4DR6J 1IKWA 1T0TV 2BVZA 4DQ8A 3BO4A 1RCXB 5KT3A 4FJGA 4RW4B 1YF5L 1OKJA 4CIEA 3M8SA 3VTIA 3FZLA 5KG0A 4CFDA 2VG6A 2F8SA 3R5JB 4E3SA 4X65J 4P52A 1NK4A 1HBUA 4PQAA 5G0RB 1YRTA 4YQWA 2UXDF 3C0BA 1NAQA 4YOVA 2KJVA 2BANA 4LR9A 1RTHB 3CJ9A 1FJGK 1KTQA 2VF3A 1MWQA 3GL1A 2PYLA 1Q1KA 1SJFA 2HHVA 2P9UA 4E19A 3EZ5A 3BH7B 1FFSB 1VC6A 1LCUA 3HI0A 4CECA 3DXMA 3LM9A 1P6TA 3NNAA 1OQ6A 3K9KA 4OV1A 3CJTA 2DNZA 2Z57B 3MFIA 2WZ1A 3HHLC 4IOCL 4DFKA 1XJWB 3F44A 4YOWA 3RMDA 4F3OA 3C6HA 2O8CB 3W1YC 1VQSA 1C0MA 5FRNA 2M8HA 1JWWA 3TAPA 1DQ8A 1Y4ZB 3J81U 3AVHA 3MN5A 3TSQA 4B1ZA 3OJUA 2F9JA 2BXJA 5JMVA 3AO3A 4FZXC 4X2BA 2HBLA 3OFGA 3PW4A 3M32B 3MUVP 3G8SA 3HP9A 1H98A 3OSNA 5F3TA 3IRWP 3K2YA 4Q2MA 2YWKA 1VQ7S 4RZRA 4AE5A 4AXJA 4ECYA 3HPGA 4E1JA 1JB0C 5B09A 4CD3A 4ZPBA 4K43A 1TKZA 2ZH5A 3EXCX 4OLBA 4AL7A 2K7KA 5C42A 1NK9A 3BYRA 5JVGQ 3HSJA 5F8JA 1GLBG 2QSFA 5GADI 1BDGA 1EX4A 3D4JA 2HHPA 2DRDA 4ZVUB 2VPZB 2BJ9A 4WBFA 4AFFA 2QW9A 3CXCM 1KEKA 5F1XA 2O01C 4R0JA 4QPXA 1B64A 3EE8A 1HW8A 5A8KB 2YHAA 3O3FA 3LUYA 5B0GA 5AQJA 1KCFA 2UUAF 4FYVB 3KK1A 4KHPJ 3HJFA 1HHQA 5E0OA 3QLHA 4RTFD 4C1NK 1WC5A 4DV5F 4ZCIA 5EDWA 3RMBA 3OVNA 1G7CB 5L1JA 2YPZA 2QLXA 1S79A 5T14A 4JKBA 1KHWA 4DLEA 3KUGA 3HXMA 2QX0A 4EBEA 4QAGA 4FF3A 3F73A 2C1EB 1EO1A 5IT4A 3KUEA 2MQPA 5EXWA 2QE5A 4Z7CA 2VJVA 1XIQA 2VL1A 3FRYA 2BQRA 2JVRA 2HG4A 4GKKJ 1FDAA 2MXYA 5DDOC 2HWTA 3QJJA 2VU5A 3OTOJ 1ZXOA 2WB4A 1RK8A 2IFXA 3J80U 1JXEA 4E7IA 1Q5YA 1HPZB 1RYSA 5HLFB 3DXMB 3QMLA 4CJWA 1ZBHA 2FZKB 3MCMA 2OZMA 1E3MA 5M2PA 4YDXA 4NCGB 4KSEB 1X3NA 3QSIA 2D41A 2KYZA 1HR0F 3BGLA 4MQ3A 4OHVA 2QLFB 1HIYA 3T1AA 1BY9A 5BR8J 1FWLA 5JUMA 4ED8A 4W98A 4DTOA 4DCOB 3CC7S 5BRFA 4F4AA 1C2PA 4GV9A 4Q5VA 3VQ6A 5IWAF 5F3ZA 4ZS6A 2P9UB 4KHQA 1HQEA 4O44A 5A8WB 5CABA 2D1KA 3MXIA 4CJFA 1C1BA 3D7SB 2DVIA 1TMJA 3RW6A 4DUZK 2GJIA 4DXLA 1JNZB 4NLTA 2ROGA 4FLTA 2IC3B 3ILOA 4K4TA 3HVTA 3T5JA 3Q22A 5KT2A 1Q8LA 5LL6d 2NXUA 4K7QA 3CIZA 2FTRA 5ETLA 2ABYA 3F0NA 3D2EA 1R8HA 2ZWPA 4CF1A 1JK9B 1BI4B 5AE3A 4Y2KA 3SI8A 1X4FA 1D8YA 1N88A 4C9DA 2ZHAA 2ZBRA 1UFLA 1MW7A 3VA0A 1FT8A 4ZPTR 1PAEX 1I6JA 4HT5A 3PIPQ 2Y0SD 4DSJA 4Z37A 3CMEN 4DR7J 3ZZTA 4ECSA 3NH0A 4CEEA 3C66A 3CDEA 1MDUB 1CSJA 2LEPA 4LFAJ 3GG1A 1WUUA 1RDCA 1Q8KA 3O1WA 2ZH4A 1X9WA 1V9OA 5F2RA 3D28A 3MCSA 2AGQA 3R2DJ 5CQGA 3M4XA 4BREA 3LGHA 4ZCMA 4WCEL 4NLYA 5I42A 3DFEA 2QTWA 3T1HF 1D0EA 3HP6A 2HS4A 1X4CA 3MM7A 2IM1A 4G1PA 4LMZA 2NXEA 4CERA 3IS9A 5BR8K 1FE0A 3HVAA 2XEXA 4H5NA 3Q86A 5E2QA 2B7CB 2F40A 3N6NA 4ECQA 2RHQB 3DDKA 1LWFA 1F21A 5K8OA 2IRYA 4CT8A 4D3GA 1RA6A 4FWPA 2R3VA 3HHDA 1FD8A 4EYHB 3V1QA 3O5TB 2DPJA 5A76A 4LF5F 5LY3A 4NLGA 5AZIB 1EKSA 1PYOB 1Q7YT 3MM5A 2CJ9A 4J9VA 2AX0A 2DTJA 4O3SA 4CF8A 2A42A 1V4TA 4RNMA 3K7RA 4CZHA 4QS9A 3UB5A 1FHTA 3T1YF 4FVCA 2FBXA 2ILYA 4LRCA 1X4BA 1M1KO 4OLAA 5C24B 3IC1A 3RVCA 1RT5B 1YG0A 4AHTA 2FIUA 1S1WA 3HOSA 3VERA 1JLBA 3CM6A 1IKYB 4TY8B 5KG5A 3GJSB 2UXCK 1OQ3A 2CPXA 1RT5A 1I5OB 4DLGA 2Q1NA 1RGIA 5FPNA 3UKUB 2E5HA 2D3ZA 3THWB 4G1QB 6FDRA 2V63A 1RBLA 4N8OA 3ISZA 3D54A 4PAAA 3QDKA 5M2RA 4OMFG 2QYCA 2F7VA 4M5NA 5J1NA 1OJ4A 3QSYB 3BPSP 3ICLA 4WFZA 4O3NA 3IMQJ 4BG9A 1Q4RA 2COLA 4WKRA 1NMEB 1VSDA 4DU3A 3EPGA 2DXFA 1YUWA 4KHPF 3J7YP 2YNIA 2D74B 2CKWA 2G2OA 2XCPA 1R43A 5ADXA 4HDGA 3MEKA 4U8VA 4LRDA 3TRGA 3SLCA 2FVRA 3VV2B 2GTDA 4KH4A 1YJUA 2WBMA 3SSQA 2RPIA 4J2EA 5KFYA 4HYKA 4C23A 4FF4A 2A1BA 4BC9A 1DRZA 2DGWA 3EVWA 3M30B 2CDRB 3IDHA 1R31A 4LR7A 1YQHA 3SUPA 5CYQA 3B6PA 1KFSA 2E44A 4TQSA 1RAOA 1PJ5A 2W9CA 2A6MA 1BIZA 2VG5A 1YHQN 1RT7A 4B08A 3VEWA 1U2VA 4WU3A 1GAOA 1K8AO 2O8BA 1OH7A 4KYZA 1MU2B 2Q0UA 1EKEA 5CYJA 1VOMA 1Q82O 4WE1B 2AJQA 1DGKN 3S41A 2PT0A 2HBZB 1RTIB 3P4IA 2ASDA 1KVIA 2WW4A 2Z2YB 1XMOK 2B6AB 1TUGB 2FVPA 1ASUA 1JKHA 4I6MA 5BR8F 1NOZA 3FUYA 2E1YA 1OYDA 3IG1A 4Q0BB 5ETNA 3QEWA 4BDYA 3NH2A 1NGAA 3AJ2A 1CULA 3KLVA 2ZZTA 3GWCA 2BMBA 1FRLA 1RKJA 5KFTA 3CJRA 3HBTA 1N5VA 2B9EA 3VQAA 5EVZA 3MECB 1KLMA 4OX6A 1XN9A 1XBWA 4CGHA 3QBWA 4B9LA 1PSDA 1REVA 2JSXA 4EI2A 1RWVB 3POTA 3LP1B 2D0AA 3DRXA 1S0VA 3GFHA 1FX4A 3TTDA 2C2EA 3SCLE 3V6JA 4YHHK 3BM7A 4AHUA 1KTVA 1BGXT 3EGZA 1JCGA 2P9LB 4IO9Q 4K8RA 1CLFA 4WTOB 2GAGC 5K8PA 1KVBA 3DN9A 1CJUA 3FSIA 4FF2A 4LBIA 2F8MA 3WXIA 3N01A 1RILA 2DH8A 2NYIA 2RDJA 5LMUF 4WXOA 1U1NA 2V2ZA 1M5PC 3IRXB 1VRUB 5GAHU 1FVQA 1WG1A 3W9HA 4CBXA 5A8RB 1GX6A 3AA3A 3AODA 2HMPA 2HFUA 3LA0A 2UVUA 1S22A 3DCAA 3TA0A 2NSBA 4Q44A 1WF1A 1W2BM 1BISA 2B51A 1Q82T 3K59A 1W0HA 3C6TA 2OSRA 3ZZYA 2ITMA 2B9XA 2YQ1A 1U1KA 3BO3A 3UN3A 4CGIA 3JSYA 1DTQB 1B3TA 4IUFA 4IQMA 1U1OA 3M1VA 3ULDA 1RLCL 2XS2A 4BRIA 4ZLPA 4JV1A 4CLLA 4K41A 4ED0A 4M5DB 3V1RA 2LCWA 2VODA 3OVAA 2CPEA 3VQ4A 1MROB 3HF5A 2MZ1A 2FHKA 4NYZA 1RCHA 2FSKA 2BKOA 3VQ9A 2XI2A 2G2YA 5HL7L 4YN3B 3E3XA 2VJUA 3HHLA 1S1UB 4IFVA 4MKBA 4USJC 3TA2A 4XEIA 1BQNB 3FCVA 3OTEA 4YP3A 3O9UA 5HBMB 1HD1A 4Y0WA 2CQCA 2PFFB 2UU9F 3CJSA 4LF5J 1DZ5A 4CK2A 4JI1J 3WZ0A 4NA3A 1U2VB 2I2YA 1NGEA 1CXUA 5KFSA 4PXCA 1IM4A 3QIOA 5HVFA 3W3DA 3V6DB 3H6EA 2BH1A 3N79A 3W64A 2W9BA 1CEZA 4O3QA 1HHTP 4OGCA 2P8IA 3SQ0A 5BRHA 4OZNA 1T6DA 1WOPA 3MUMP 1SH0A 2KJWA 4BGBA 4U8YA 3N4WA 4DR3F 1RT2B 4JHDA 3G6EN 3FC9A 1NGBA 2FBVA 2UZAA 4P7VA 3LP2B 3KK2A 1VQKS 2DNRA 1FNXH 3EO3A 5CZXA 4H5RA 1VHXA 2DGTA 4F50A 2VQFK 5CZ1A 2L41A 1NJXA 2WC9A 1FE4A 1S0OA 3PW7A 2J9DE 1RTIA 5HOOA 3US5A 4WE1A 3HJVA 4OYXA 3JSMA 5FROA 4PHTX 2ZH2A 3I6PA 4LBHA 3M32A 4E89A 3OTOK 4BRNA 4C6AA 2R7YA 1YIJN 4OI2A 4R0EA 3HRGA 2P9PB 4HI1A 3IMXA 3WEEA 2CPZA 4KV8A 1IUJA 2DPNA 1E6YA 4DV4F 3LPTA 4H4KA 3ZTPA 2B3TB 1N5YA 1U4BA 2DRAA 2MYFA 4ZJLA 1YVNA 3EICA 4C8NA 4X4UA 2XZWA 1QSSA 1H73A 1ASWA 1D3WA 5A2QU 2KN4A 3Q7BA 2ZWHA 3TX0A 4DHVA 4ZPDA 3ID6A 3R5BA 2ZZNA 1GLDG 3J7YU 5IWAJ 3LAMA 4QS8A 2E29A 3V6KA 5KG6A 1APSA 2CJKA 4USIA 3SFGA 4ZMMA 1VLOA 2OYQA 4C8MA 2WAQD 1RAEB 1Y5NB 1YITS 1RBRA 3KJVB 3SI6A 1HNZJ 4HEA9 3KKFA 4PQUA 4H4KC 2YHWA 2ZKUA 2FHJD 2BM1A 3O5BA 3G86A 2FVSA 4C1NI 5B0BA 3V81A 4O44B 5A8WA 4ZVHA 3PEJA 4FM0A 2AIRB 4O3RA 1YJ9N 1E6YB 3TAQA 2CADA 3IUCA 2OAUA 3I55S 3CCLS 4AHVA 4KQZA 3K58A 2OTLN 1NDCA 2D9PA 5D0EA 5A6PA 3ZX2A 1FDNA 2VV5A 3TU5A 1UETA 4HUFA 2KO1A 4DCJB 4B3OB 3MN7A 1S9GB 1BI4A 3AVMA 3O6QA 2GWKA 4C8LA 4M5KA 4BHQA 1NU4A 3D2EB 1HNZK 4ES3A 4XAKA 4DFJA 2XC9A 1UP1A 2HHHJ 1S59A 1MN7A 2ADCA 2FSNA 5HLFA 4XH5A 2IC3A 3I4HX 4DV6J 5KT4A 3ZSVA 4AL6A 4AL5A 2HMIA 1IM6A 3ZETB 2GHWA 4QR0A 4I0WA 3SBTA 2IM2A 3L6QA 1I1GA 4IR1A 4OHYA 2GVZB 4M63A 4LUBA 1SC4B 2WSCC 1VQ6S 2A6AA 3VMFB 4QOZB 4YB1P 3G0ZA 2XB2D 4RJVA 3CJ7A 3JS6A 2O1PA 1Q81T 4NASA 1OPZA 1HMVB 1RWPB 3PCOB 4F4XA 1PGZA 3G71N 3ULHA 2DNNA 5JVGL 4FM1A 3Q0AA 4KB1A 4DUTA 4UZCA 3AO2A 2JJ4D 2A6OA 2GIQA 4NYFA 4CJQA 4CDIA 2AWZA 4KTZA 3ULEA 3MMVA 4N8NA 3EVMA 1LK5A 4CEOA 3KK7A 3BZQA 3E51A 4BDZA 2F96A 3Q24A 1TELA 3PJXA 5FIIA 1MMDA 3TSUA 3K8VA 5CY4A 1S5JA 3GYXB 2P51A 2VCPA 1RACB 2G1HA 5K8NA 1CJTB 4U9RA 4ICLB 5E41A 4M63C 2KXHA 4KFBA 3G96A 4IOCQ 3KG4A 3DOKA 2UU9J 3FK4A 1IR0A 2F1FA 4I2QA 5KG1A 3HHNB 2KFNA 2DHSA 4Y2IA 3MMCB 4J9RA 1CG2A 4QWCA 3KLFB 4GW6A 3CCVN 2CQIA 1Q86O 4CLFA 2D7SA 3SBMA 2CQPA 4NLBA 3T5LA 2V4JB 5D8HB 5AFUA 5CXTA 4KV8B 1TU0B 2Z56B 5L9NA 2YNFA 4TLQA 5E3PA 3NVKA 5IV3A 5F8MA 3U7JA 1KLMB 2HRTA 1X0PA 4MDAA 2Z4PA 1HI0P 2JX2A 4FVUA 4AM6A 2Y0BB 4LF5K 2OMLA 2QL5B 4AT1B 3I0SA 4M1KA 4ZIWA 1UVKA 4J9UE 2AJFE 2C28A 1LWEB 3TW0A 2F5GA 3AV9A 4AHRA 1VQ8N 1S57A 1XMQK 2FC8A 1WSGA 4EEYA 4UOHA 1XTZA 3DNCA 2NCKL 2GMJA 5E7OB 4CHYA 4FKYA 5FRMA 1U0SA 3THXA 4K2XA 2DKOB 3CHWA 2A1SA 1EXQA 3DMJA 3CUNA 5E3CA 3G87A 2Z30B 5DQIA 3OYBA 1FFWB 5DRKA 4PWUA 3JQMA 4FJ5A 3V6DA 3ENHA 2Z0GA 1BQMA 1VQ6N 4R5PA 3PTWA 2KQ2A 3IGVA 4FJ7A 1PJ6A 1JJHA 1ILYA 2GUIA 2J7UA 3AT1B 4ZP7A 1BXNA 2MZQA 2G2ZA 2LXIA 1HWUA 3IBFB 5LXRA 3DRPA 1EQYA 1PILA 4NO7A 2YI1A 1B99A 2KHCA 1WDTA 3KWGA 5DJBA 4DR2K 2ATLA 2ATCB 2FLPA 2NRWA 4C3MA 1NPRA 5L46A 2O8FB 1Q78A 1H0HB 3OXGA 2V4RA 2EC2A 1RDBA 4X66J 2MY8A 1N8RT 3QMQA 1XR7A 1QUPA 3OYNA 1TVRA 1RXOB 3B4DA 4YORA 3CIMA 3NCPA 5HMWA 1SQGA 1NEEA 3U1MA 2MB0B 2GJ2A 4DPTA 4JKCA 4EHTA 2DR9A 4Y34A 3BF3A 4RBTA 3P31A 1YITN 1H74A 4BE2A 4RCHA 4B1XB 2IJNA 2IVOA 1N8RO 3R7BB 4JI4J 4O0NA 4TU8A 3JAMY 4CJVA 1NB2A 5A2QO 2B4UA 2GBZA 2DT9A 3OHRA 2XULA 1WG5A 1DHMA 2A5XA 3ZSZA 4LD0A 3KLIB 3S8SA 2XSJA 3RWUA 1JCFA 3P5TL 2EPIA 1VQ7N 4M3RA 4A48A 3GU0A 4J37A 4FBTA 3QIPA 2FQQB 5C10A 1WACA 3VQCA 4YOYA 3OLAA 4BR2A 4KT0C 5HP1B 1BA0A 1W2IA 2EX3A 1YJTA 1KC8O 3AA2A 4DOZA 1NXIA 4JV5F 4FP9A 4LFCF 2E2NA 3M6WA 1H7WA 1YZ7A 3P38A 1K1QA 2CPDA 1OO0B 3I4PA 1V5VA 2P9GA 3T5HA 4XTTA 2ZC4A 4WK3A 3MWPA 1NK5A 3C15A 2YKMB 1QM9A 4DSFA 3SUOA 2IRUA 2GQQA 3W7BA 1HKGA 1V3ZA 1PYSB 2MQMA 2V4QA 3C95A 2EFPA 3WEEB 2XLJA 3DLKA 3I56N 3DLGB 4KO0B 1F1BB 3PSFA 1VBYA 1TFYA 2BANB 3WNHA 2KXNB 4FZYA 3M2UA 2VBXA 4BC2A 2YPYA 4JS5A 4B1YB 3NFAA 5KRTA 2NXJA 1UWAA 1YSJA 2ROEA 3O3GA 4ZVRB 4ED4A 3HSZA 3M8QB 4DR3J 2UXBJ 1NO8A 2O8EB 1RWUA 2BJ1A 1FESA 5K14A 1KQGB 4BQZA 3CC2S 2HWHA 2UXCJ 2WSEC 3RYLA 3M6XA 4BRKA 1GLEG 2A18A 2XMMA 1Z25A 4ILRA 4FBUA 2HQIA 4RLEA 1JLGA 2BA9A 1VBXA 5BPMA 4CEDA 2ADBA 3MAAA 2VFSA 3U27A 4DX7A 4ZVQB 1RTDA 4R79A 1KKHA 1UZDA 3IP0A 2ZJPQ 3NAEA 3RB0A 4DV0F 3TAGA 1NJWA 2EKNA 3G6ES 1HFEL 2RN2A 3RMAA 3PYDA 1UFWA 3Q8RB 1FXLA 3ZT4A 1S48A 1CLQA 1ZBLA 2G13A 2OD6A 2W8LA 4OGEA 5KG4A 4X64J 1F2GA 1WD6A 4DL3A 1NLKL 4H0PA 4Q45A 5EWGA 1K73O 2BBEA 3L7PA 4ZA1A 3OFFA 5AQNA 3UE2A 1B7YB 3W8GA 1GT8A 3DJCA 4RWXA 4C0HA 3M9OB 1BCOA 1X7VA 3LDLA 3PX6A 1EETB 2NLWA 4NCAA 2GIRA 4J9PA 4DTUA 4QYZJ 4M5DA 2I7PA 3C65A 2UV8A 3CCJS 1U6FA 4M3UA 5C2CA 4RW6A 2F9TA 3K5NA 4UY85 4FWKA 2ASPA 3J81j 3ZTRA 1NKBA 2ZJRQ 5CYMA 2IVFB 4IFVB 3VR1A 1CJKA 2K2PA 1HBOA 4B9VA 1Q9YA 3OUYB 3ISNC 3NXZA 2DD8S 2XS7A 4GKJK 1UW9A 1EAYC 4DF8A 4WFXA 4BY9C 2HQDA 4OZ5A 5JICA 4B02A 4PA1A 4W5TA 3NGIA 3GYGA 4B1VA 4PPDA 3O9RA 4DMZA 5EX5A 2C2DA 1CJVB 5I3UA 3L2VA 4ELTA 2QWOA 2WOMA 4BRPA 4IJNA 4X4SA 4QQBA 4WKYA 4JI0J 1PC4A 4OIXA 3C16B 3NF8A 3BY5A 2OSQA 1FNMA 3FZHA 1S3XA 4H5VA 1SVDA 1Y3JA 2CZ9A 3NNHA 5KPZA 3AB2B 4CFAA 2X74A 2MQNA 1U8SA 4TKTA 2KKZA 1Z26A 1RT3A 3NS6A 3BUZB 1VQMN 1YAGA 1GMWA 3K2PA 3MUTP 5D4NA 1TL7B 2FVQA 2G4BA 4CT9A 3W60A 1S77D 3H45C 4LF7J 3D3CJ 3AAQA 1U0HB 1B92A 1N0UA 3I56S 2N3OA 1GOBA 4DX8H 1N56A 2X3DA 3QQCD 1I3AA 2HRUA 2DRBA 2HEKA 4B3MJ 2VGMA 3VAHA 2AX1A 5DLFA 3SV3A 2I7NA 2VKZG 4OV6A 1TGOA 1P9QC 1IN0A 4QYZK 3U1NA 4FJNA 4PG7A 2WUSA 2EG1A 5EU7A 2HFZA 1B9FA 5KFJA 4DV0K 2H1YA 4GKKF 4FLWA 2IAJA 3QERA 3GJTB 5SWMA 2DHAA 4B17A 4CHPA 3DLHA 3AVKA 2C42A 4FZZA 3V1OA 4EP4A 5HANA 4CH7A 4DTSA 2Q6CA 5H9FK 3SUQA 2V7YA 1RWKB 2R8GA 4P10A 1OVYA 2R7UA 1FRHA 3S9HA 3C3LA 3VEOA 1S76D 1V6HA 1RT6B 3I8BA 3ZFVA 4QWDA 1S9EB 2KDOA 4FJ9A 4IYQA 4EYIB 4LFCJ 2G1DA 1K8KB 3EPIA 5AQIA 2O67A 3BV8A 1FKPA 2MKIA 2AEMA 4M5JA 2CPYA 2HBJA 3BQ0A 3LDPA 2IA6A 4J8FA 2W01A 2AV5A 3R1LA 4L76A 5F0WA 3NCIA 5CZ2A 1P9YA 3HYFA 1ZH5A 1QS4A 4EAHD 3DXSX 1VRQC 3FGUA 2BGGA 1SIZA 4JV0A 3D67A 3UD5A 2X7IA 3ZXWA 2KI2A 4HCCA 1T8EA 3LWMA 1CC8A 4ZP6A 4BRDA 4DR3K 4WZQA 2IVPA 3V2UC 3K0JA 1P8GA 3KHHA 3LH2S 1YJ7A 1SKSA 3AGKA 3NNCA 5GIOA 1FRIA 3CO9A 1QVFR 2VUGA 3O1BA 1AW0A 3MXMA 2RKIA 2W4CA 3N6MA 2GA7A 3DYAB 2QA4N 3MEGB 4OZ3A 2DY4A 1ROFA 2C2MB 4P2MA 2LQJA 4OZ2A 3NGRA 2DEIA 5DO2A 3ISND 1TK8A 2FB0A 4UUWA 1JLQA 1FEEA 3AD7C 3R6MA 4C97A 2NRTA 3BGFA 4CJUA 5JLHA 3D0HE 3LOUA 3PW0A 5KFAA 1JLBB 4KC5A 2JEGA 2XCAA 2VYPA 2IDLA 3TR8A 2F4VK 3NP5A 3TJ8A 2GIFA 3OYLA 2LA6A 4Z4FA 3R6LB 2R7RA 1IQZA 4I69A 2ACMA 4KFBB 3D6FB 1YK9A 3L0QA 1ATSA 2PZSA 1ITPA 3W2VA 1S4EA 2CAJA 2AEJA 3OTOF 4RNHA 5A2QY 1UVNA 4RW4A 3THXB 1BL3A 2LFVA 2XRIA 4FW1A 3CJQA 3LM2A 5D77A 4CJRA 2RS2A 3R7NB 4F8RA 4P2FA 1PYTA 4EUVA 1A9NB 4ZVSB 4LF4J 3CJ2A 3Q8SB 5A6WA 3MWBA 4MIAA 1U2RA 3FKBA 4LF6F 2R7VA 3K5OA 2P9IB 4H0YB 3VF2A 4ER8A 3SMSA 2HLTA 3BZCA 3RAMA 4AYBD 1ELOA 3JQJA 3D2WA 4JOUA 5AE2A 1D1UA 1RDAA 2NPFA 2E88A 2YWGA 2YNFB 1NMDA 5A0YA 3F9KA 3IAM9 2XMWA 3M8RA 3H40A 4CJLA 2QG9B 1NJIO 2YKNB 4NXNJ 2F4VF 2P9NA 1N36J 4BLGA 4WYBA 4UF4A 1LAWA 4X66K 1OSCA 4N5SA 3VETA 3C7NB 2MDAA 2BOPA 4RR5A 1S1XB 3DI6A 2DH9A 4B3RF 4DTJA 1S9FA 2E66A 3CQ8A 4QZVB 1RAGB 5CHIA 4J2BA 1UA0A 1BUXA 3TZZA 5I42B 3DC2A 3H4BA 4FJMA 2DB1A 4DR6K 4B3TF 2V94A 5F0XA 4A8QA 2BE2B 5G0RA 3D9BA 1LWXA 3WHIA 1X1PA 1IWAA 4H4MB 1VQ4N 3FBBA 4JI4F 4YR0A 2B56A 3IR7B 5ADXH 4B3MK 2UUBJ 3W5YA 1AUSL 2CQBA 1O51A 2FZCB 1QD1A 1AT1B 1RADB 2R42A 4HACB 4LF7K 5FD1A 4AILC 3UFCX 2Q2RA 3KLGA 3CMAS 2J7WA 4U96A 3IM9A 1H1VA 2OKQA 4DR4J 1HNXK 3SMZA 2V7ZA 1S6QA 1LKZA 4LF9F 2VG7A 1HWIA 3TQ1A 4JLHA 2I6WA 3JSMB 1RHMB 1NSQA 3HM9A 3ASMA 3J80O 1HLWA 3MM8A 2XG8A 3H5UA 4DKWA 3CI5A 2M70A 3MAAB 2KHOA 1AROP 4ATNA 2V69A 3AOCA 4JNEA 2Y8WA 3RB6A 5GAEU 2DGSA 1Y64A 3MDFA 4OYMA 4FWRA 1UEUA 3MMBB 1S97A 3FZBA 3EMTA 2KW4A 2G8VA 4EFHA 1U47A 3NHGA 3PV8A 4A5BA 1XMQJ 3DLEA 3TUJC 2CIMA 5I4MA 4AQYK 4NB4A 2A1RA 3W2WA 3O4QA 5FPDA 4ZPAA 4JI5J 3C7NA 3M2RB 2W42A 1EARA 4EU0A 3DHXA 3KJNB 2OPRA 3EVOA 2PC6A 1EQMA 3T5KA 3AARA 2P9NB 4H4MA 4ZVEA 2D3O1 2DISA 4G3IA 1WC0A 1IBLK 3NL0A 2XZTB 3IN5A 1XQIA 1JXBA 2AJ0A 5C25B 3E9OA 2ZOGA 2HZVA 5KFHA 5AQTA 2QXLA 2RQMA 4Z4HA 1BOTO 4BACA 2MLYA 2EFQA 2FHOB 3K8WA 3NG8A 1JJ4A 3WIUA 3HHEA 2HHQA 1V5IB 4HHUA 4QPTA 4TU7A 1SUQA 2CG8A 5E3QA 3M8QA 4KIAA 4AHSA 4PL7A 1OS5A 3NGTA 2MKYA 5E3RA 3P4UB 4A2BA 1H38A 3QWPA 3CCEN 3TWHA 4CZFA 5E26A 1Q5VA 4CIGA 2N3LA 3DRSB 2YY3A 2QJ3A 4HI2A 1VR6A 4DF4A 5AQQA 4X4OA 5ETPA 3M1VB 3WBZA 1C0TB 5I9EB 3S3MA 2DHXA 2W1BA 2UP1A 1PO6A 5HROA 4RW7A 2WK4A 3WQPA 4GKKK 3OQ2A 2BABA 1WUAA 3CJ0A 3ZZZA 2XGQA 2MQLA 2JEJA 4F3TA 2E1MC 3ATUA 1A5XA 4YOEA 5CE3A 3KD1E 1RNHA 3DOLA 5A8RA 1WOOA 3M8ZA 1GQEA 3GR0A 3AVLA 1KVCA 2WHOA 3P49B 1S0NA 2J0WA 3F5TA 3ETMA 5KQ8A 3B54A 3FMBA 4M5GA 4HKQA 3THTA 3EZWA 3O8WA 2CGJA 1WN7A 1I94J 2B4VA 2CVIA 3H2UB 1TP7A 4YY3J 3OS2A 1SQFA 4NRUA 5BJRA 4DTPA 1VIXA 2E9ZA 3MPUB 4IQXA 3FBCA 4UQGA 1SC3B 3TTCA 5GADU 2HHHK 4QCLA 4Y0FA 1W26A 1HQEB 4J7CA 4BRGA 3GR1A 4N77A 4FLXA 1QSYA 4LF6J 4K5RA 3G8TA 4HCBA 1U1MA 1F9EB 2QLJB 2HNDA 3K0SA 1DT9A 4DV1F 7FD1A 2BW7A 4B9NA 4F0HA 3O8MA 4M42A 4Y65A 1QLNA 4CO2A 5AJ3K 1CVJA 2V9KA 1MG7A 2G0JA 3JSRA 1T94A 5CCLA 1X0FA 2I1RA 3G82B 1RT7B 3G82A 2VG5B 3MZIA 3ZLJA 3QYYA 3LZJA 4Z4EA 5IFMA 1BMQB 3ZSOA 2IMOA 3PRBA 2E8AA 1RT3B 1HWJA 5H1SV 2OMOA 1MU2A 4M3TA 2QI2A 3R1XA 1QQCA 4FYYB 4EGLA 5IWAK 1Q95G 1M0SA 2HOEA 3S3NA 2GVDB 4M7XA 2P9KB 2J7KA 1UJ6A 3CPWR 3NKYA 3UR0A 2D5RA 4CH1A 3OR2A 5MLCQ 3SXLA 3TUZC 2HNZB 4OYPA 3HD2A 2FJBB 3JS9A 4U7UK 2BJ8A 2ZH8A 4CJ4A 1WI8A 4NEYA 4CIFA 4JI4K 3AO4A 5KFQA 4OO1J 1CZ9A 1RAIB 1M1GA 4FWSA 8AT1B 2GVZA 1J53A 1VQ5S 2I8EA 1S72N 3EGVA 2XO7A 3LWLA 3ZSYA 1RT1B 2QV6A 3KNGA 4CO4A 2MQ8A 5C7PA 3OYHA 3VAMA 2HHHF 3TZXA 4U7CA 3TTFA 3AJDA 4X4QA 3RRHA 4RW6B 2AF6A 3VWSA 3OA9A 3PYEA 3JAMO 4FL9A 5J1EB 2VDHA 1RTZA 1J54A 2HGNA 2IAJB 3U1LA 3ZNJ1 3NF7A 4XPCA 4EK2A 3CB4A 2WBRA 2V51B 3J7YI 5HL7Q 3THWA 2J8AA 1IBMJ 4FSVA 1PIEA 4XH1A 1JLGB 1HKAA 2BQ3A 4FWLA 4HL9A 4OI0A 4UW2A 2R7OA 3NBPA 3PO5A 1R3NA 4NA1A 3CC4N 5HI7A 2RF2B 2KM8C 3NVMA 4NE9C 1QHTA 4IOXA 4FCYA 5GAGU 3DXKB 2OI2A 3Q23A 4NX9A 4H54A 1C0TA 2VG7B 4DQRA 1K73T 1VAZA 2AQ4A 3QFWA 4IH6A 5BPLA 4L75A 2HHUA 2Q1LA 4W5NA 4K4YA 1BD6A 2PMWA 4FJ8A 3WUHA 4Y1DA 1TK5A 1WC6A 3GIKA 1OPIA 4O0JA 2B8QA 5GINA 4PEOA 4LSNB 3CTRA 4OZ0A 4B3RJ 3C16A 2PFUA 2XYGB 3OV7A 3TVYA 2GELA 4P9SA 3DRRB 4F04B 3KLEA 9ATCB 3SV4A 3QNNA 2J0QD 5U47A 4K2JA 2VDIA 4NLOA 2WONB 4MLEA 4RNFA 2OEKA 4FJXA 3CERA 1J5EF 1GXUA 3A2FA 4DB3A 4RNOA 5IOLA 4F0MA 4YB7A 5AXKA 4X4TA 2BZ2A 4UTGA 4M3WA 1WC1A 1W9HA 4CI6A 4HHTA 1XI1A 3S1TA 1MN9A 4MLHA 2F9DA 2HMIB 2GO9A 1BG3A 2Q31A 5GAEI 3HHKA 4FOEA 1SKWA 2CJAA 3BEXA 4N76A 2CFXA 2EWHA 3HVWA 3LGMA 2MY7A 4IO9L 5AJ3F 2D0PA 4DR2F 4DSIA 3NDKA 1RQ0A 1MWKA 4B1WB 4KB7A 1IVZA 2CG4A 2W6LA 2B5JA 3MAHA 3UQSA 2BUPA 1N4LA 2ZBQA 4LH4A 2RQ4A 1QVFM 1UVIA 1S10A 1TL1B 1L3KA 4DUYF 1HNIB 4B3OA 2DGQA 3MM5B 1ZS6A 4X4VA 1NGDA 1RAJA 2D69A 2ASOA 2RILA 2RU3A 3THYA 3MPDA 3MMJA 3PM9A 3HZEA 2X51A 2DY9A 1P90A 2UU9K 1NG9A 3VA3A 2MJNA 4G1IA 3OBWA 3K57A 4DS4A 2F9WA 1WHXA 5CA5A 3BKTA 2CGLA 2WFBA 4HHHA 1A5VA 2Z8QA 2YKAA 4DMNA 3JAMU 1Q79A 4N56A 4I6WA 1Q16B 2GV1A 3HVTB 3AHPA 1FERA 1NM1A 4WYLA 3T7ZA 4EP5A 2NXCA 2DR7A 3I0RA 3NH1A 5HATA 2JNJA 3A13A 3MPYA 2AYEA 4ALZA 1NJZA 1JMTA 4YHHJ 5HAOA 1VK8A 3SEOA 3NAIA 1Z2LA 2K7JA 3PKMA 1DURA 3EGNA 1MWYA 2P5GA 1TV6A 2WCXA 4V19X 3EL2A 1S1XA 4QU7A 5HJXA 2B9YA 3DI6B 3AA4A 4ZOSA 2DNYA 2EBEA 4X4PA 4QS7A 3GFXA 5HRPA 3UDCA 3ITHB 1F0XA 4CJKA 3BGRA 4NXMF 4P2SA 4M5IA 4EMDA 4YOXA 3DLLL 4KH6A 3KDOA 2XZDB 2YKNA 2CZVC 4DV7K 1FCAA 3FEXB 2R2TA 3OVSA 1K9MT 3DLKB 2R8HA 1NGIA 3L95X 2L9DA 3TZYA 4A2AA 1RKIA 4ZIVA 2UXDJ 3WX8A 4EFAC 4YDDB 5HSPA 3LTOA 4M3ZA 1UWBB 1UTAA 3SAFA 2W2PP 1VLYA 4NYNA 2IJRA 1Z6RA 2MQQA 3KVGA 3A4TA 1BO5O 5T7LA 3KLIA 4UOCA 4CTAB 1VHFA 4XK8C 2KTQA 2AYBA 4KGXB 2SXLA 1NDKA 2HHSA 1HQUA 5DDQC 1WHVA 3S01A 1ICEB 4DBQA 1JJ2R 3K89A 5LSOA 2VHGA 3LP2A 3KK2B 2X6NA 5HP1A 2BOAA 4LVNP 3WIVA 5A8KA 3IGNA 1HJOA 2QIFA 2E2QA 2GAHC 3KJFB 2J5AA 3ZTQA 1BA1A 1IH7A 4KHYA 1QAJA 1NU0A 1J27A 5B0CA 1OY9A 3OHAA 3NGUA 3D68A 1ZM2A 1S1VA 1AFJA 3ZEUA 1T9VA 1WC4A 1VC0A 4O3OA 4ISEA 5DS7A 3BDPA 2YXLA 3LALA 5J2PB 2KFYA 1MWMA 3CFPA 2P5VA 3A8JA 4ILJA 1S1TB 5AQPA 2FGOA 4OPAA 2V4JA 1T95A 1FK9B 1REVB 3OS1A 4NPOA 1LAVA 5EX3A 1T05A 3KKRA 1QHAA 3IWXA 4QIEA 1YZ6A 2PFDA 4BE0A 3PUFA 3JXOA 3QAUA 4MYTA 3LDSA 4M5HA 2MGZA 2VFRA 3GIRA 1SZ2A 3MTKA 4CTAA 2B4JA 3CJBA 1M5SA 1WJ9A 1WB9A 2JOQA 4OX9J 2Y9HA 3HHLB 2IPOB 3FR0A 3PSIA 5ETQA 2HKEA 3TABA 4E2FB 1XNRF 3MMAA 3ADAC 3TJ9A 1RDWX 2OHDA 2RRBA 3GPAA 3JYTB 2O4IA 2OIHA 4CHQA 5HRRA 2Y1LB 1L5UA 3Q83A 4A8XA 4L3QA 1VQKN 3R9PA 3MCOA 1HUXA 4IEEA 4L72B 2AYMA 4KHWA 2RNEA 3CJKB 4CI0B 1GOAA 2RB7A 1SQEA 4TNOA 3LQVA 1DTQA 4W92B 3AQPA 5KFGA 3GIIA 3OFEA 4CRJA 3WQTA 4YR2A 2CXEA 4XH4A 1SH3A 4DV5J 4OPKA 2HK3A 2WOMB 4DX6A 3ENQA 3TAEA 2FF3B 3OW2M 1J5EJ 3Q89A 3PIPL 4USUA 2F8TA 4RW9A 2XMJA 2VQFJ 2MLXA 2CQ0A 1WHYA 4CM0A 2M9KA 3GMGA 1OH6A 1UJ5A 3DU5A 3ENWA 4CJSA 2W2MP 2VC0A 2FLLA 3FQKA 4LR8A 4KHRA 4PXBA 2MGZB 1C0UA 1GMVA 4JK9A 3CC4S 4RU9A 2DHGA 4QR1A 3M2RA 2DXDA 4F4WA 1RI7A 4CO5A 2BJEA 2M52A 2QLBB 1FK9A 5F0UA 4Q8EA 1BC6A 2IRXA 4HT7A 4HH0A 3QLHB 3TUPA 1IKWB 1IBMF 1KOOA 2CJBA 1T05B 3FQLA 3CVKA 1OMSA 4MKYA 4URSA 4LF2A 4CEBA 2Y1JA 3Q8UA 3WNEA 4W4MA 3L7UA 1JJCB 2HK2A 1KQFB 2DBBA 1EWQA 2FGCA 3QGHA 5AQMA 1HW9A 1NH8A 2BE9B 3HM8A 3SAGA 3OYAA 3QATA 4JN4A 1J5OB 4B1UB 1SC1B 1N52B 1URNA 1OH8A 2BJDA 5C42B 1BWVA 5IT9O 5KTQA 2HF3A 3KLGB 2JWKA 4WFAQ 4JI1F 3KG0A 3A12A 4WFBQ 2PA3A 8RUCA 1HJRA 2NUHA 4IG3A 3I87A 2E2OA 1RHUB 1NSAA 5KQDA 2GUPA 3I5AA 3NOGA 2HLUA 3S6EA 4O5FA 5HVGA 5GMDA 2ZBIA 3BBCA 3CC2N 3NLCA 5HROB 2JLEA 5DM7L 4NI2B 4DU8A 4FWOA 1I51B 2EI5A 2B43A 3OL9A 3A3OB 3OY9A 2R8KA 4GMJB 4DJBA 2Q66A 4A4JA 3H1QA 3W65A 4NXMJ 3FMWA 1F5CA 1RABB 4Q7AA 1K1SA 1CJTA 4KJIA 3AVJA 1VQLS 4FYDA 1S12A 1T44A 1RWOB 3TOQA 3OSPA 1UVMA 2BACA 1DARA 3SJHA 2C2ZB 2YX7A 4C48A 4CZIA 4TXSA 2O4GA 1E4GT 5B0AA 4C8ZA 2JHEA 2E4LA 2GQ2A 5C0YA 2R2SA 2RE1A 3E8OA 5FPMA 4LT6A 1G99A 4JYAK 4NLWA 1FKOB 1N5YB 3LPEA 3U9DA 2HAFA 2ZC3A 3IXQA 4RU2A 4ILMA 2EFOA 1CZBA 3ZZOA 2WVFA 5RUBA 4JI3J 3KK3A 3ZETA 1WSRA 2HBRB 1ACMB 1Y0HA 1WSVA 1HYVA 3I0RB 3CCMN 1N34K 4QU6A 2XBPA 1N36K 4TU9A 2RHSB 1CJKB 2YX6A 4BRAA 3HZGA 2W6KA 1GMWD 1NJYA 3AO5A 1QJHA 4QOTA 4PKDB 2NZTA 1X5SA 4O4GB 3AXMA 3MN6A 4N7TA 1PBAA 1HI1A 4A57A 2DNMA 3BN4A 5HRSA 3VQQA 1XNQJ 1XR5A 2WVEA 4RW8B 5J1EA 1VQLN 5G4DA 2YNIB 1E6VA 3PHTA 5BXIA 3N0VA 3ET6B 4ZJQA 3NGKA 4IOBA 2FF6A 4C0BA 3LPUA 1YTAA 5KFPA 1OY6A 1SIWB 1X4AA 1N32J 2XMKA 1IR2A 1XMOJ 3FSXA 5ETMA 1RDUA 4O0IA 2O8DA 1S9GA 4KHPK 3GB0A 3HDSA 2O8DB 1Z1ZA 3CO0P 4WZMA 4CZLA 2HB5A 3ZTOA 1LW0B 4JD2A 3EKSA 1NPPA 4OI4A 4CQ1A 2QA4G 4FXWA 3V9SA 2HPUA 3VF6A 1YTUA 2GHPA 5B7WA 3D66A 3CC7N 3GFZA 3ET6A 4X84A 5KFMA 2HNZA 4FVMA 5EUHA 4USHA 4B8AB 3OR2B 2QWPA 1HARA 3GP9A 4ID1A 4HTLA 3MPWA 3OYGA 4RWTA 4XDCA 3CCZA 3IS9B 4DEZA 2KM8B 1EP4B 4MFBA 3MEGA 5A0YB 3U3GA 5AT1B 1DBDA 1H3DA 4UQTA 3O08A 3SSSA 4Y28C 3QO9B 1XNRK 4RNNA 4A62A 1EQ0A 2BV3A 2CH5A 3LP0A 2HZCA 3MK6A 2H4WB 4MFBB 4GMKA 4BRMA 5E84A 1RSCA 3D6TB 2AEFA 3JXUA 1RBTA 3A5LC 2BE7D 1RCOB 4A8OA 4C0OC 3FFIA 4DZ6A 2BM0A 1G1XA 5H9EJ 1ZAXA 3ID8A 2LSNA 3KHLA 3GJRB 3T6BA 4PPZA 4CE9A 2WW8A 1FW6A 4PABA 4DDFA 3WXMB 3D45A 4R5PB 1H7XA 1NJIT 4RUHA 4LC9B 4QBUA 1X60A 1F5AA 3C6AA 4WIIA 2V0NA 2W2OP 4RUAA 4KGMA 1SBRA 4WF9Q 4IO1A 3V9ZA 4MIWA 4LSNA 1WDDA 1IBKF 3FRZA 2OFGX 4K25A 2HSEB 3OYCA 4OQJA 2QL7B 4CZKA 3U9ZA 1RE1B 1QDUB 1T6CA 2ZH3A 1YVFA 4X62J 1Q0NA 5AQHA 4RO0A 5M1PA 1T03B 1N6QA 2AMCB 4FN5A 4CNZA 1U49A 4O3PA 4JI7J 3CFOA 1TAQA 3OBYA 1GMUA 2JFKA 1RA7A 4USMA 3C14B 3ZT2A 5M2UA 1G2EA 4PG4A 3BQ2A 4AH9A 1Y7PA 3TPQA 2QWLA 4JI0F 2DFEA 3NWRA 5CHCB 4LRFA 1RZMA 1REGX 3J7A1 4FWNA 5DQHA 4DV0J 4FNIA 1GLLO 4CYUA 2W4PA 2VC1A 1ZETA 1YJNN 2RAQA 2W2QP 2ZDOA 3L4BC 4NLDA 2CUYA 3V4IA 4JI2J 2DY1A 4KTQA 1MSWD 2BJ3A 2RJZA 3G8QA 2BYCA 3NRBA 1HKCA 2CGKA 2YQ3A 1S1UA 4FYWB 4FKXA 3QBCA 1UOCA 3MDQA 3ZZ0A 2RHKA 1CQNA 3AGRA 2CQGA 1NNEA 4QIVA 3VGVA 1FXRA 3I31A 1HNWJ 3CPEA 4M45A 2IYGA 1UKUA 4IOAL 3F56A 3P8BB 1NRKA 3IBCB 3SDEA 2IIHA 5E5NA 4I6MB 2AZ3A 2A3JA 3A8IA 3VAGA 3SPZA 3CQYA 4NLCA 4IDHA 3PXGa 3SQGB 2WTFA 1VRUA 1YJRA 3CD6N 4AUKA 2W2NP 3GV5B 4CCHA 3DRPB 2RQCA 2DNOA 3MM9B 3WXKA 1CC7A 2ZDPA 4FPIA 4KGKA 1HHSA 1T03A 4MMOA 2R7SA 4LF4F 1FRKA 4DU4A 1X3MA 2RH3A 3R3TA 3VQSA 1ZM9A 4CNYA 3CCES 3QNOA 3FBFA 3HD1A 1KS2A 2O5DA 2Q43A 4ZVPB 4G1QA 1NWKA 1KAYA 3NS7B 4Y3CA 1T3VA 3HPHA 1XNQF 3ZZRA 4OVLA 3HSTB 3KZBA 1YJWS 3PIOQ 3KUHA 3TANA 2E1AA 2FSJA 5KFEA 4DTRA 2YX1A 4WYWA 3CPWM 2VFTA 1IO2A 2FLOA 1QVGR 3KWIA 1IBKK 2ZH7A 1MA9B 2PO4A 3MOZA 1N6QB 4OJRA 3WNGA 3M1FA 5KAKA 3UCZP 3R7SB 2QFJA 3H90A 2UUAK 2HNYB 2EWSA 3A8KA 2VD3A 5ETSA 1U45A 2XHBA 4LF7F 4MTPA 4FS1A 2GS8A 2VH7A 1R27B 1JLFB 2XWYA 4JKAA 2BTFA 1SUQB 3MN9A 2FDNA 5IQ6A 3QZ8A 2XI3A 2P9CA 1CULB 1ZAVA 1ZZFA 5GMEA 4M41A 3CFRA 2FUG9 1O6XA 3SDEB 2KXFA 1QAXA 1L3VA 2OTJS 3SQ4A 3WC2A 1KAXA 3VGMA 3R5DA 4DSKA 1NKCA 1ZBUA 2A41A 2LYVA 4DZDA 4YR3A 3FBEA 4JI6K 2HHTA 2V8PA 3H8YA 3AOBA 3J7ZT 3I8DA 4OX9K 3DOKB 2DHHA 1G6BA 4HHJA 3OS0A 3NE6A 3GIJA 4DUZF 3W63A 4DR4F 2JWNA 3E01B 3DLEB 5EOYA 3QZ7A 1WAJA 3HFZB 2UXBK 5HN0A 4ZJOA 2H3EB 2B9WA 3QEPA 1YI2N 3H7HB 4HH1A 2IIRA 1ZC6A 5ELZA 2O8CA 4B3SK 1ITGA 4I56A 4L74A 2R8JA 1U1QA 1Q7YO 4OKEA 4CZJA 1XR6A 1BWFO 2BQUA 2V8HA 3MFHA 3SBGA 2W7PA 4DQQA 1HBUB 3CQXA 3H2LA 3I32A 1WKJA 1M5OC 4ZTFA 3PR4A 3MXHP 5CR4A 5SZTA 4BRQA 3NGSA 3J81O 4GO7X 1ATRA 5CD4H 2DNGA 3NGYA 2EEYA 2A40A 2P9EA 2BKPA 3MR6A 5HRNA 5HMXA 4MYUA 4JRQA 2V50A 4W90B 2FBYA 2PAVA 5IC4B 1VMBA 2ZH6A 3MD3A 1YT3A 5D6GA 2YJFA 2ZVSA 1S6PA 5D0HA 1BCMA 4OJ1A 2BE2A 5KRSA 2APOA 1WOQA 2RIJA 4CJEA 2E5GA 2KRBA 3TI0A 4KE5A 3S3OA 1TUWA 3MEEB 1S5ZA 3UW1A 2UXBF 4X4RA 3BREA 1KBRA 3V81B 2DGVA 5KG3A 3PIOL 3ENVA 1RTDB 4K8ZA 3EY1A 4KR0B 4I6YA 2MPUA 1WWHA 1A6LA 1HYSA 2PDAA 3J81Y 5KFFA 1EHWA 2R7XA 3KJVA 5L1IA 5J2QA 2ILZA 4NA2A 4E7LA 1HPMA 3NGZA 4Y2AA 5M1NA 4DSLA 1U1RA 1QTNB 4JI2F 2E5JA 1FJEB 1HI8A 4K4XA 1NM2A 3H98A 1NKEA 2ZJQL 1HPZA 2B4PA 4BRHA 4PWWA 5L8RC 3EX7B 4LF8K 4NCBA 4IRCA 5KFXA 3QETA 2IM0A 3L09A 4IFYA 2CH6A 1LWCA 5KFVA 1T9TA 1Z4UA 4DN9A 4L73A 3CJ4A 5HQLA 2VBYA 2A3ZA 4MAKA 3MAQA 1KQSM 3ZSQA 3ZTSA 3MR5A 4WFNL 2QO3A 4B9QA 1LWCB 5KOXA 1RFQA 4X65K 3BGOP 4DV2J 3RBDA 3MM7B 1FEHA 4YY3F 1VQNS 4FF1A 1YJWN 4CGDA 4CGFA 1UVJA 2IBOA 4J9QA 2V8VA 1LXNA 3VF0B 4NI2A 3FVYA 2X6SA 3OL6A 3CETA 1AA1B 2FHJA 4LJMA 4JI5F 2E5LK 1FKAF 4WP9A 1GEHA 1NSPA 4H0OA 2PYJA 5KFNA 3NMUA 5AZJA 2RS8A 1KNZA 4RW8A 1LOTB 4B3TK 3MCNA 2XSJB 1URRA 3PW5A 3HSCA 3L2WA 4QIGA 3KLHA 1RTJA 3AOAA 2V2QA 4ILLA 2M2BA 3SCIE 1CPZA 4OYBA 3D0GE 4DI6A 3O9TA 3NBPB 5DGAA 4IFEA 1RWMB 1NLVA 4NOHA 3WNFA 1NNDA 2K1RB 1K47A 2J6SA 5GVQA 2NR0A 1R0AA 1R6VA 2V6AA 1B4SA 3KNAA 1Z2ZA 5M1FA 3OL8A 5KFZA 2VWKA 3L7OA 2R7TA 1AB8A 5DG9A 1RP5A 3HLUA 2VONA 1KVAA 2HSTA 1P8ZA 5KFRA 1ZYQA 3BSCA 4O4GA 1UAWA 2MKKA 3AAWB 4OX7A 4CJ3A 2AD9A 2XS5A 4J9MA 2E7WA 2YHBA 2HWIA 2Z1IA 2Q79A 5DQGA 1RDRA 2JVOA 1M90T 1VQ9N 1RT6A 3KXDA 4ZN3A 4OJGA 4ED5A 5HBMA 2IMWP 1KD1T 2QN6B 3C8YA 5LMNJ 1RWNB 4IWVA 4JI8F 3EKUA 5LMUK 1IXKA 3PX4A 4DR5K 4GO5X 1X9SA 1DJ0A 3G6VA 4B3SF 3DMJB 4WCEQ 3NMAA 4H4OA 2NREA 1IBCB 2VBZA 2HNYA 3UVJB 3QJLA 3TEGA 2YKOA 3A3NB 4WK1A 4OHXA 2K1RA 2LEAA 5GAGI 2MJUA 2YJEA 2ZD1B 1SH2A 5SUHA 4KRFA 3BSNA 5D3GA 1N33J 5C2GA 2V2VA 1C4CA 1BLUA 3UD3P 4JK8A 4L3NA 2DGUA 2HBQB 4C3LA 4I7FA 3M30A 2J76E 2D0OA 4JI7F 1EB0A 1CJUB 3T9ZA 4DPUA 1GTHA 1BIUA 3OXLA 2NRZA 4P71A 8ATCB 3SCXA 1OYEA 4CD1A 3HFKA 3CW2C 4A8KA 3WX4A 4BR7A 2DNKA 3T1YJ 3LDOA 1IKVB 1O0PA 4A46A 4FZVA 4OKKA 2GMHA 3ENBA 4H0XB 4U67Q 2MKCA 5AQLA 4NLQA 2OTLS 1X9JA 3L3VA 3PYFA 1YBAA 5HQMA 1N48A 3IKMA 2J9DA 4E7JA 2P9SB 4JB8B 3CCJN 5J1PA 4K4WA 2NYHA 4L8RB 1QAYA 3T69A 4I64A 3NWGA 1AZSA 1LWEA 4F36A 1ZOTA 3UN5A 3HMJG 2BDPA 2G0IA 2MZSA 3RSEB 1NGJA 1KAZA 3NY0A 1KOHA 2CPHA 2VB6A 3HVRA 2VQEF 3FFIB 3VVTA 4I2PB 1JLQB 3K5LA 5LJWA 1HBNA 1YLXA 2M88A 4R8UA 1SJRA 3VHQA 3NCQA 2FJDB 3IA0A 4JRPA 2ZUGA 4PR6A 2QWMA 2O8BB 2EC0A 2X78A 3GIMA 4RUBA 3FZMA 1NUEA 4HR2A 2MHNA 2QC3A 5GAHI 1CQMA 5ETKA 3DOMB 2W9CB 1Y97A 4S0MA 7AT1B 5CYQB 4U6PA 2QWNA 2NPIA 3BP8A 3G9CA 3VQ5A 2ALZA 2K3KA 1X9MA 2JL9A 5F8HA 4J5OA 2F65A 3CJ5A 2XY5A 2B0GA 1U1PA 4JV5J 3DLRA 4IG0A 4ZKAA 5LSLA 3MD1A 3VALA 3BGRB 1RYRA 2CNNB 3MMBA 1P1TA 2UVVA 2MZJA 4B8CA 1HR0K 1ZBTA 3BZKA 4BGAA 5BYRA 1GFWB 1TYQA 3UN2A 2KT3A 3EEQA 3T1YK 3B4MA 3NS5A 4V19S 4OJ3A 1KP6A 2ATQA 1VQ8S 3ZEUB 4M94A 3EDRB 3JTPA 4F02A 4FLUA 2GW8A 1WTFA 4CLSA 3DLBA 3D6MB 2F8HA 3D1QA 2RRNA 5ETOA 2AP6A 3HKZD 3BQ1A 4NLVA 2JWLA 4WQ5C 1FXXA 4PXEA 3O2IA 4ANCA 3CCUS 1D5AA 4WTYA 2DYAA 5L39A 3L2QA 4JEPA 2QK9A 2E7VA 2F3JA 1TK0A 3V9XA 3ZSRA 1YGYA 3VEYA 3CJ3A 3GTYX 3C46A 2Q36A 3LPYA 1X5PA